1C76A

Staphylokinase (sak) monomer
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
121
structure length
121
Chain Sequence
SYFEPTGPYLMVNVTGVDGKGNELLSPHYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOKINASE
publication title Crystal Structure of Staphylokinase Dimer Offers New Clue to Reduction of Immunogenicity
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 23
structure length 121
sequence length 121
ec nomenclature ec 3.4.24.29: Aureolysin.
pdb deposition date 2000-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02821 Staphylokinase Staphylokinase/Streptokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.130 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1c76A00
2SAKA 1BUIC 1SSNA 1C77A 1C79A 1C78A 1C76A
chains in the Genus database with same CATH superfamily
2WNMA 2LVQA 1VCBA 1GOZA 2ZCBA 1NENB 4CO7A 1S1QB 2FUHB 1P3QU 3B1LX 4KX6B 4BFRA 3U7DA 2LEKA 4KDLB 3V05A 4KDIC 2PVOD 5JHBA 1F9JA 1QOBA 4NJ7A 3H7SA 3H9DA 3V6CB 4W9EA 2ACZB 2QMTA 5MPOA 1A70A 3MHZA 1XLNA 3C8YA 4C80A 2RD0A 3X0WA 3KYCD 3NVZA 1WX8A 3R2TA 1FRDA 2JVCA 3Q69A 5CX3A 2DZJA 4M0WA 2PIAA 3AXCA 4RM8A 2LVPA 3IAS1 3ENEA 1GPXA 4XZ4A 4II2B 3TMPB 5HFYA 2PVGC 4WJQA 1FFVA 5BYQA 1H8CA 4I6NB 1C9FA 2BS2B 2IO0B 4DBGA 3P2BA 1UH6A 3FC4A 5AEKB 3PPAA 2KWVB 1V49A 2GLSA 1ZPSA 4AJWA 3KQ4A 2I1KA 3VTWA 1GB4A 2WU5B 2I2YA 1IYFA 1TS2A 4JWSC 1X1MA 2L3ZA 2KFKB 3ZGZA 1NYQA 1L6UA 4EZLA 2BS3B 2ZNVB 1V97A 2B76B 1WYGA 2O2VA 2FNJB 4LDTB 1CK1A 2W55A 4A8XC 2BT6A 1TKGA 4WWOA 2N1WA 4B0MA 3ZDTA 3VR8B 2INNE 2INPE 3DDCB 2M0XA 3ETRA 2GBMA 2JUOA 1L2NA 2BWES 4Q2JA 4M00A 1LQBA 3NRZA 1NBFC 1ET9A 3VFKA 2KN4A 2L1AA 2KQSA 2KTRA 1WR1A 3WA0A 1I4GA 2MP2A 3LJ3A 4E3CA 3NVYA 3VAWA 2BKFA 1ZE3D 4DXAB 2GI9A 1C4AA 5JH5C 3VUWA 4KIKA 4G50A 1ROEA 3APDA 4HJGE 4C7YA 4GLSC 4FULA 4WJPA 2KLCA 3ZNGC 3BYYB 1XCTL 1LXDA 2RR9A 4FJZA 2K0PA 4TSSA 3W1SA 3TJPA 2JWZA 3N32A 4NPNA 1I4XA 2Z59B 3A33B 1VDVA 3AEDB 1V1OA 4XDCA 5KHQA 2ZPNA 1H4RA 3AECB 1WGRA 1UGMA 3C19A 4M8NA 3O13A 5DPSA 1L0XB 3AE4B 2L05A 2VZKB 2OJRA 4JX1C 2LUEA 2J0MA 4KZCA 2V3NA 2INDC 1YN4A 1GG3A 3VH3B 2GMIC 4KIKB 3WALA 1WSPA 3SU8X 2Z8LA 1UWXA 2AEHA 3A9KA 2XK5A 3QHTA 1YJJA 1OEYA 2KANA 3GZNB 4YSZB 2H89B 4MH8A 1Y56A 1KRHA 3TSSA 2W9NA 4XDDA 2N7DA 3SFDB 1BXTA 4DHZE 2HDEA 1WRDB 4MSMB 3QCAA 2MBQA 4BBNC 1Y8RC 2LGDA 1YQ3B 3NVVA 3HM6X 4XWWA 1JWMD 2REXA 5D3IB 1RRBA 3I57A 4BOSC 3UGBB 2KHWB 3HK0A 3NZ3A 3N9YC 4FJVB 2LGXA 2N9KA 2G9HD 1FNUA 3U52E 2IDYA 2IZVB 2NVUI 3ZRCA 1M94A 3ZVVA 3OLMD 1D5XC 1YJ1A 2KD0A 1YQBA 2M19A 4PT5A 2K22A 1UWMA 3RNAC 4BKSA 1J8CA 3DVNU 2RDBC 2JZZA 5J17A 2GBRA 2KJRA 2FBWB 3ML9A 3ZJTA 1K51A 4GN1A 4IM3A 2D10A 3N30A 3AE1B 3FKYA 3Q14C 2WXNA 4JIOU 2KOXA 2JRHA 1FMAD 5CHWA 1D3ZA 1N61A 5D3DA 4KGSA 2R2QA 1KLUD 4C56C 5E6NA 2M4NA 4W9KA 3MC8A 1VR9A 4P16A 4YTNB 2IGDA 2RDGA 4IKGA 2YEPB 3NG0A 4IUMB 3P1MA 3MJWA 4HK2A 1T0RC 2WXGA 4RNAA 4RCOA 4ZOHC 1EWYC 1OFFA 1ZXIA 1XEEA 5AUIA 3IT4B 2D07B 1R4NI 1WGDA 5HKHA 1WXSA 4USAA 2KACA 3P4PB 2L00B 2ZJDA 5G55A 1A5RA 3U30A 2ZPYA 3IFWB 2FIFA 4IWOA 2MJDA 2GBNA 2J0KA 2KFJA 3QA8A 3L0WB 3JSVA 1FNWA 1E9MA 5JZEB 4JPSA 2WS3B 4I6LB 1TS3A 4YTPB 3UIOB 2QSDA 4C7ZA 1PUTA 3R8BA 3PRZA 2K39A 4XYCA 4EEWA 2YVCA 2OEDA 2YEPF 4NNJB 2JX5A 1VJKA 2WDVB 4HXDA 1WJ4A 3L13A 2M17A 4YXDB 1D5MC 2WDRB 1N6ZA 2LUMA 3DVGX 4A6QA 1WMHB 3ALBA 4BKTA 4RGOS 3DBLB 1UD7A 3I5JC 1KF6B 3IXSA 4ZRQA 3RZFA 4FN2A 1EF5A 3LB8C 3PT2B 4LJPB 2DNFA 1MG4A 2KX3A 2NCNA 4L23A 5EE1A 3TEYA 1VZ7A 2V4IB 2O6VA 1SXTA 3AE3B 1WM3A 3BVZA 1E0ZA 1L0VB 4WWPA 3A1QA 4FHKA 2PJHA 3UI3A 2Q5WD 2PTLA 1NVID 3VTUA 5BO4B 5G5GA 1IBXA 3NHEB 3VUXA 2D3GA 4J6IA 2MQJA 2PE6B 4DHZB 3PTFC 5AZGA 2N4FA 3AE9B 4LLGM 2IJ0A 4KGRA 4GOCA 1KTKA 1Q5WB 3MFGA 3PHWB 2JXXA 1RYJA 1JW9D 3Q3JA 4HPMB 1ZDVA 3RFZB 1UBQA 2EMSA 3DHIC 2O6VB 3DBHI 2CS4A 2NTTA 5JXVA 3AE5B 2N1VA 1RFAA 2D3BA 3W2DA 3TBLD 2DBYA 1WRIA 4ZDVA 1PFDA 2WXMA 2L52A 2N9XA 2G4DB 1F0ZA 3AE8B 1JROA 1FIQA 2WDTB 2G4SA 3I9V1 4PS3A 4AOFA 3T3OA 2VRRB 4K81A 4WAAA 2WDQB 1EU4A 2KC1A 1ZXHA 2MEKA 3ABVB 3RPFC 2KVZA 2M1MA 3BYTB 2UU7A 4KV2A 3WIMA 2LHEA 2CJOA 2INCC 3DOWA 4JL9A 1VZ8A 1JQ4A 2R61A 2WXPA 3V61A 3DWMA 1HZ5A 2KK8A 1D6EC 3AM9A 5EE9A 4DWFA 4R3DA 1PQSA 2ASQA 5TSSA 4MEMA 4II3B 2AQ2B 1TT5B 2AWTA 5E6OA 2AQ1B 4MJSB 2R2OA 4P1BC 1F1HA 4WJNA 4WQMA 1J7AA 2DZMA 1YJIA 4RF1A 1XT9B 4JE3B 4WH4A 4FADA 5J18A 2KFKA 1MPEA 2JYTA 3L4PA 1YIWA 3P63A 4LNOA 2CHZA 3ZO5B 1PDXA 2QIEB 1IGCA 2HE7A 5BYRA 3EFUA 4CHKA 4LNNA 5IAAC 4LCDE 2MBBB 4NQKE 3PRMB 2NMQA 4MH0E 2CHWA 4DDID 4G11A 3EFCA 3W5UB 3VH4B 1V2YA 2EKEC 2WXQA 4N59A 2X38A 4NJ6A 4EZKA 2LJIA 3RNEC 3N3KB 3H8HA 3R2IA 2KDMA 4ZRKA 2V9HA 4IM0A 2SAKA 4OZBA 5DPTA 1ZDXA 1OEYJ 3CSTA 2MJEA 5L83A 4I6PA 2C5LC 3Q3FA 2HJ8A 3AEBB 3ZLZA 5H92C 3RYTA 2KZRA 2QDFA 1VZ6A 1FXIA 1J19A 1GC6A 2J53A 4TKNA 4A3OA 2MRPA 2J42A 1E10A 5I4DA 2DYMA 4XGAB 2N9EB 2MBEA 3SEBA 2C60A 1WY8A 3K9PB 2AQ3B 2DX5B 2WXJA 2K6QA 4FXCA 4KSKC 3RI7C 4ZHPA 1SIJA 1FNVA 3NVWA 1XCQL 1DOYA 2IY0B 3RNBC 3GB1A 5BMIA 2KDIA 1UBIA 1JWSD 4ZYSA 3VUYA 2GBKA 3ONSA 4ZHOA 2MBHA 3ZIMA 3NZSA 3W5VB 1SGHA 3PLUA 1I7HA 2ONQA 2BWFA 2QJLA 3AEAB 3L08A 3BK2A 1ZW7A 2BKRB 2MA9B 2FE8A 1E7PB 2JSVX 2BF8B 4W9CA 4HROA 1KOTA 4BOZB 3V3XA 2BQQA 1Q10A 1HTQA 2MWSB 3HM3A 2GB1A 2W3SA 3DVNV 4A20A 1E6EB 1IGDA 1N62A 1PGBA 3BWUD 2KKCA 4ICUA 4WURA 4FBJB 1E90A 2C7MB 2M56B 2D3CA 4BZAA 2KWCA 1C76A 4YSXB 3ZTCA 1CJEA 1OQYA 4FLHA 4GDLB 3CWIA 4JQWC 3R66C 3L54A 4CYEA 2KTFA 1XLQA 5AZHA 4KSLC 2PLPA 2LGSA 3TIXA 4PYZA 2WX0A 3PRPB 3BVGA 3JW0X 2NTSA 3PZ8A 4URKA 3WAPA 4ANVA 2LHDA 1V1PB 2XBBC 2LRUA 1NEKB 1ISNA 2PW9A 2BYFA 2HD5B 2YLMA 3WAMA 2K8BA 2Y5BB 4L1BA 1SF0A 1U4AA 4HJKA 4EE2A 1YX5B 2KYWA 4P1CC 3H7PB 3PZDA 2N7JA 2D3AA 4M8MA 1WGGA 5BMGA 3AH7A 2WLBA 4D2KA 3UQAA 2ZW1A 2KT7A 3PO0A 4TV3A 2G3QB 1XF5L 1QOAA 2LRWA 3DQVA 1BMLC 3AE6B 1E8XA 1R4MB 2FIDA 4XX5A 3Q6BA 3Q8AA 3IVFA 4G3XB 3DWGC 2NPTB 2IGHA 4W9LA 3J9CA 4RM9A 3IHPC 2QCZA 2OJWA 1KH0A 4LTUA 2VH1A 5BMHA 3M3JA 4IW0A 4GGQA 4ARIA 3SR6A 1FXTB 4A55A 1QZEA 1RM6C 1C79A 2K25A 4A3PA 2FCSA 3B08A 3H1UA 3FILB 5HHDG 2V3SA 1B9RA 2MX2A 2PE9A 4HKZE 2G1EA 3AEEB 3EECA 1KM7A 1WF9A 1WZ3A 1T0SC 2MLBA 2JY6A 4OW0A 1MVKA 3V60A 2NS5A 3NJTA 2IBIB 4MM3B 4HLEA 3DBRB 1WM2A 1FEHA 2WXFA 1P0RA 1T0YA 3ZJUA 1TYGB 4XC2A 1ZP0B 3Q8CA 3RNCC 1F2RI 1TY0A 1TJEA 2IO3B 3NY5A 3KUCB 3AU4A 1KLVA 1TKEA 3R7RA 2C7NB 3GS2A 3ZNID 3IG3A 1SEBD 2W3RA 1SE9A 3NZUA 4J3OD 3ECIA 2WXRA 4HVBA 3KH0A 2BYEA 1JALA 2DYOA 3B2GA 4AQ7A 4NY0A 5IP4D 5CTRC 1JWAD 4P6VF 4JLCA 1E7VA 2ICIA 5IN7A 1WJUA 2LVOA 4JWUC 1WMHA 3VVWB 2ZVNA 4ZRPA 3PS6A 2KJHB 2BB5A 2JQRB 3GZNI 4RH6A 3VR9B 4C00A 1V86A 5DPWA 2JXTA 2UYZB 1B1ZA 1V6EA 4B0EA 2K1FA 4IDIA 4DHJD 1STEA 1D4BA 4N6EB 4WWMA 2E6XA 3HUIA 5HI1A 1RLFA 3AB5A 1AN8A 1QT9A 5FKAC 3CSFA 2FAZA 2NBVB 4WJOA 3QC8B 3TUOA 3Q3MC 3KW5B 4N58A 1FFUA 3Q2AC 1S3SG 4DQOC 5LNK1 5JHAA 1SE4A 3ZJVA 3PSEB 2N0SB 5EDSA 1FCCC 2WGSA 4N9F4 4HCNB 1K53A 1WJNA 1L4DB 3EC8A 1GB1A 1JRPA 1Z2MA 1EU3A 4GDKB 1K8RB 2WQYB 1OQQA 4OZCA 4JGHB 1SBBB 3Q8EA 3KLSX 1SIFA 1KJTA 2BS4B 4BKSD 3HIZA 2IPKD 4RGTA 3RNGC 3QAQA 3QIJA 5EE0A 1HEZE 3AV8A 3DHHC 5GMVA 4M02A 2SEBD 4ITKA 1SE2A 2HTHA 1MJDA 2PKOA 4W9JA 1P9DU 1N60A 1JRUA 1TZOA 3I63C 3SFEB 2LXCA 2WHIA 1LM8B 1OGWA 2FUG1 4OVZA 1P98A 4IWPA 4F1SA 1GAQB 3GE8C 4RFBA 1WE6A 2G45B 4IWQA 2C7HA 1TGZB 1J7CA 2XN9C 2WP9B 3BY4B 2KC2A 3FAHA 4OVVA 3VHTC 3U4EG 2M8SA 1YNTE 2K9XA 3E9SA 3KVFB 2JF5A 2L0FA 2E3TA 2MCNB 2BTEA 2WXIA 1MHHE 2IO1B 2L76A 2XNAC 4YWGG 4LNFA 5LLIA 2WX1A 1J7BA 3BVMA 2K5PA 2CR5A 3KWLA 1YQ4B 1RAXA 2LWPA 3AN1A 1E8WA 1T0QC 2BW2A 2MJ3A 5CHFA 4IG7B 1WXQA 2N9PC 4MGZE 2L32A 2GBJA 4HDOA 2WXHA 3URYA 1F2RC 2LJ5A 2AYOB 1SE3A 1WI0A 2DHZA 4K7SA 5H8YE 4TUUA 5IOIA 3P4RB 3NS1A 1V8CA 3N1ZC 4MJSA 3TEWA 3APCA 3TEZA 1EM7A 1JMLA 4HRSA 5IKCM 2JPHA 5D94A 1FO4A 4MGKE 4OZAA 3IAM1 5KHOA 4C4VB 1QF6A 3DBLI 3KYDD 2HTME 4CQNA 2KNBA 2DYBA 3V6EB 2V4LA 4ASWC 2CHXA 1JWUD 4ZRIA 3CIRB 1FM0D 4MGYE 2J52A 4LNKA 3TL5A 2MSED 4BBNF 3B9JA 3P42A 4FHJA 5AZFA 1AW7A 1DOXA 2O6VD 3PREA 1IUEA 3W1SC 4L2YA 5L95C 1N5XA 4YTMB 1R7SA 2JRIB 1FXAA 2AX5A 3N1YC 2KDEB 2QHOA 5LXHA 3IBEA 4KKIA 1V5OA 1ET6A 4LJOB 3VDZA 2WWZA 1GJZA 2MW5A 3RNFC 4FJYA 3SD5A 2LXAA 2KVRA 3MHSD 4W9IA 3RCZA 2PEAA 4NZLB 4TQ1A 3Q8FA 3JVZX 2L8JA 5LXIB 4AS1A 1N63A 1L6VA 2JWUA 4PS7A 4DK5A 1P1AA 1TTNA 2GOWA 1GC7A 3AEGB 4YL8A 3KUDB 4DXGA 5T8IA 2KO3A 1WE7A 2W54A 4K1RB 3BIID 2ZW0A 2DZKA 2V3PA 2N7EA 1HZ6A 1J0GA 2KWUB 1L4ZB 4O1NA 1C4PA 4ICVA 1Z5SB 4P7IA 3OG5A 3GP7A 1WZ0A 1WFYA 2MHJA 4GU2A 2OOBB 4F7ZA 1WX9A 2RSUA 3M62B 4KVGB 1GNUA 5TR5A 4WWNA 4QAYA 4M01A 1MHXA 2KX0A 3VTVA 2B3AA 1WGYA 1DGJA 2I1JA 2WXLA 5J2RA 4GSWA 2DLBA 2KMCA 1AYFA 1I35A 3BZDB 3MTNB 4BKGA 1WXVA 4AUQC 5C2TB 2JYEA 1FCLA 3N1XC 2RGFA 1CQVA 3O65B 4EUTA 2BB6A 3ZUNA 4EZJA 3BK1A 2KXJA 2FCMA 3HRDD 1GUAB 1V81A 1ZGUB 3H6NA 2JZPA 1YD8U 1TS4A 4YT0B 4UDUC 3EA6A 4AP4C 5CHVC 3PGEA 1OTRB 3X23A 4M0WB 2I38A 3QQ8B 4GDLA 5C3JB 2RMMA 2XEWA 2MBOA 4GIVA 3A4RA 1CZPA 2KMAA 4ARCA 2Y3AA 1ZUD2 4XE0A 4HPPA 5HG2A 3R7QA 2L83A 2X8XX 3W1YA 4BVUC 3DCGA 3ZXVA 3DPDA 1Q0WB 1XLOA 1G6JA 1WYWB 1YN3A 3AMZA 3SDLC 3W9CB 3U7ZA 1WXMA 3VRAB 5FR3A 1YX6B 1V1PA 2NR2A 1LO5D 3D32A 1QQRA 2D2QA 1VLBA 3AE7B 2ON8A 1FD6A 1UUPA 4ANUA 3WAOA 1C1YB 2FCNA 1NI2A 4S0RA 2KLGA 3OJ4B 3VRBB 2CJNA 3GE3C 2KMMA 3K9OB 3WCQA 3H7PA 3ZRFA 3ZNZB 1I4HA 2LD9A 3OAWA 2RPQA 5E6JA 1BT0A 4LDTD 1UZXB 3BINA 1MFWA 1V5TA 1FRRA 4HWIB 4H2AA 3WANA 2O2VB 3UQBA 2L7RA 4HPLB 4EOYA 4DXFA 1NYRA 3PVLA 1K50A 3AI5A 1UGJA 1HQRD 5D6JB 2IY1B 2LZ6A 1SSNA 2NPTA 3T9LA 3EHVA 1AARA 3B0AA 3EUB2 4OHJA 3TEXA 3KUZA 4W9FA 1F52A 2N9LA 1ZOYB 2PMVA 1TKYA 1QLBB 2Z0DB 3NOBA 2JZ3B 3MC0B 4NAWA 1N5WA 1I4PA 2KTRB 1JCKB 2MP2B 3FILA 4AWJA 3OJ3A 2MH7A 1LFDA 2LGYA 3NS8A 4MACA 2WXKA 3MP9A 4MGIE 3B2FA 3MC9A 1KFYB 4W9HA 1YOVB 1SJED 3RZWC 3HHMA 4MM3A 1EO6A 2IYDB 3NUHB 1ACCA 1F77A 2WXOA 4K3BA 4AJYB 1TIFA 4K7WA 4HCPB 4RF0A 4MELA 3JYUA 2WYQA 1T6BX 1WX7A 5D2MB 1PYWD 1R4NB 4RGNA 4PYUA 4B95A 2IGGA 1AWDA 1IPGA 3I3TB 5FK9C 1SB3C 3P4QB 3Q3NC 1WGKA 4HKQA 3M63B 2CKHB 3LDZE 2OHFA 3ZXRA 1EWCA 3ZTDA 3U2SC 5E6PA 2KDFB 3AEFB 2LASA 4NAWB 2VZKD 1C3TA 4FA6A 2DENB 1LGRA 1VRAB 4IC7B 1HTOA 4XWTA 3V62A 3RT3B 4S17A 2KQ4X 1NDDA 2QEJC 3AE2B 4MSQB 2D5GA 1HXYD 1C4CA 1V80A 1FPYA 3DBSA 1P7EA 2QC8A 4A9AA 2M0AA 3APFA 2NBUA 3A9KB 2LFIA 3HVZA 2XK5B 3DVGY 1YMHE 2KAJA 4YSYB 3C0RB 2J4XA 3HVDA 1EUVB 2LGIA 4DHJB 1L0YB 1K52A 3RN9C 1TY2A 4EKUA 3ZKJC 2ZEQA 1XXGA 1QILA 4KGTA 1P7FA 2DAJA 1XD3B 3M95A 2ZCCA 3T8MA 1V9JA 3QX1A 2Z0EB 4W9GA 3UINB 1E8YA 2J7QB 2Y5PA 2RPVA 2CU3A 3A9JA 4DDGD 2D11A 4GDKA 3MJ5A 3P4SB 2AL3A 2AL6A 3L17A 4A90A 3UIPB 3ML8A 3LYYA 4W9DA 3OWEB 2K8HA 4MDKE 1XLPA 1DYQA 1RFKA 1MG8A 3ZQ4A 1WH3A 3DHGC 4ZRJA 1T3QA 1I42A 1WXAA 4RMAA 3Q3OC 3QARA 5AUKA 1R4MI 2LMCA 3PHXB 2JT4B 4WQOB 4GB9A 1XO3A 2BYTA 3R3MA 4NQLB 1NI3A 3DBHB 4X57B 5DCNA 1ENFA 2WU2B 4WIPA 1QOGA 1C77A 3U8ZA 3T3NA 1ESFA 4B9KA 3EGRA 2EKIA 2K3UA 3SHQA 4K3CA 3ZYYX 1C78A 5IA7A 3A9JB 4HEA1 2ZZPB 1I4QA 1PGAA 1PGXA 1TS5A 3AU5A 3RMKC 3VQIA 2IO2B 2KN5A 2FCQA 1ZKHA 2KDBA 2DZIA 2PPHA 4LNIA 4US8A 1RWSA 4ZYNA 2H88B 3DBRI 4K7UA 4IM2A 4US9A 3KWVA 4TQ0A 2Y5CA 4WAFA 1XQQA 2HJ1A 2ZNVC 3RULA 4MT5A 1EF1A 3ZW3A 5GXGB 1KLGD 3UF8A 2DWQA 1CMXB 1WWTA 1T5XD 2GRIA 3PLVA 4NAMA 2BYVE 5C23A 1DOIA 4ACFA 4E71A 2EMTA 3Q8BA 1JWBD 1E8ZA 1HE8A 3CMMB 2BVCA 3JSVB 1WR6E 2UWQA 3VXWA 3L10B 2NBWB 4BAXA 4IOIE 3N20C 2W82A 2A5UA 2RDHA 5G2NA 4HDQA 5BYSA 2BPSA 2VH2A 4C4VA 1BUIC 3S2AA 2ZVOA 4EFOA 1WJ6A 2BGFA 4GXBA 3TCAA 2A4ZA 1Q1OA 1E5WA 3LXFA 1IP9A 4RGMA 1SJHD 1UF0A 5FR6A 2CU1A 1UNSA 2KQ7A 1E7UA 4OVUA 3E56A 2QILA 3QK0A 3AULA 5C1ZA 1WGHA 4PS8A 3PV1A 5G5HA 1TZ1A 3CF6E 4F8CB 3IT6B 4KKJA 1L5PA 1QOFA 1TBEA 2L0TA 3A4SC 3QWZB 1QKZA 4G0NB 1UELA 3A1QB 1M4VA 4TMAB 4LK0M 5DPRA 2DAFA 3RD2A 4ANXA 4NJCA 2TSSA 1OQRA 4ANWA 1HA5A 2JU6X 1D5ZC 1IBXB 2EELA 4E74A 2V1YA 1L7YA 2K8CA 3GOEA 3ZNHB 2V0GA 5EE3A 1YN5A 4PK1A 2BBCA 4KZ0A 4REZA 1VD2A 2KJ6A 1MI0A 5D7GA 4B6WA 1I4RA 1WIAA 3L16A 3QJZA 3ZDMC 5IO9A 2K6DB 2KWDA 2J0JA 2LI5A 3PZ7A 3RUIB 4GMVA 2C9WB
chains in the Genus database with same CATH topology
1KF6B 3IXSA 2WNMA 1YN3A 3AMZA 3W9CB 3U7ZA 3FILB 3LB8C 3VRAB 5FR3A 1GOZA 5HHDG 1V1PA 1NENB 1LO5D 1QQRA 1B9RA 1VLBA 4HKZE 4L23A 5EE1A 2G1EA 3AEEB 4KX6B 3TEYA 3AE7B 2ON8A 1VZ7A 2V4IB 1FD6A 1UUPA 1SXTA 3AE3B 3BVZA 1MVKA 4OW0A 1E0ZA 2LEKA 4MM3B 1L0VB 3V05A 1FEHA 2PVOD 1QOBA 2WXFA 3ZJUA 1TYGB 1ZP0B 3VRBB 2CJNA 3Q8CA 2KMMA 1F2RI 2ACZB 2QMTA 1TY0A 3UI3A 3WCQA 1TJEA 2Q5WD 5MPOA 1A70A 2PTLA 1NVID 3MHZA 1I4HA 1XLNA 3C8YA 1TKEA 4C80A 5E6JA 3GS2A 1FRRA 3NVZA 5G5GA 3R2TA 4H2AA 1IBXA 1SEBD 1FRDA 2W3RA 4J3OD 2WXRA 4DXFA 3Q69A 1NYRA 3AE9B 4M0WA 4LLGM 1JALA 1K50A 2DYOA 2IJ0A 2PIAA 3B2GA 4KGRA 4AQ7A 1KTKA 1UGJA 1HQRD 3MFGA 1JWAD 3IAS1 1SSNA 4P6VF 1GPXA 2ICIA 1RYJA 1JW9D 3EUB2 4OHJA 3TEXA 1ZDVA 3RFZB 2N9LA 1ZOYB 2PMVA 2PVGC 1TKYA 1QLBB 5HFYA 1FFVA 5BYQA 4JWUC 4ZRPA 3MC0B 1C9FA 1N5WA 2BB5A 1I4PA 2BS2B 2JQRB 1JCKB 4RH6A 2NTTA 3VR9B 5JXVA 3AE5B 2JXTA 3FILA 1B1ZA 3FC4A 2MH7A 3W2DA 4B0EA 4IDIA 1ZPSA 2DBYA 4MACA 2WXKA 3KQ4A 3MP9A 1STEA 1D4BA 3B2FA 4N6EB 4WWMA 1WRIA 1KFYB 1PFDA 2E6XA 2WXMA 3HUIA 2L52A 1SJED 5HI1A 1GB4A 2WU5B 2I2YA 3AB5A 1F0ZA 3AE8B 1AN8A 1JROA 1ACCA 1F77A 1QT9A 1TS2A 2WXOA 3NUHB 4JWSC 5FKAC 1FIQA 3TUOA 4RF0A 3ZGZA 1T6BX 4N58A 1PYWD 1FFUA 3I9V1 1NYQA 4RGNA 4DQOC 5LNK1 1L6UA 2BS3B 1SE4A 2IGGA 3ZJVA 1AWDA 2N0SB 5FK9C 1SB3C 1FCCC 1V97A 3P4QB 2B76B 1WYGA 3T3OA 1WGKA 1CK1A 1K53A 4HKQA 2W55A 1L4DB 4A8XC 1GB1A 2BT6A 2OHFA 1TKGA 1EWCA 4B0MA 1JRPA 2WDQB 1EU4A 1EU3A 3U2SC 3VR8B 2INNE 1ZXHA 2INPE 4GDKB 3AEFB 2MEKA 2WQYB 4NAWB 2VZKD 1OQQA 3ABVB 3ETRA 4OZCA 3RPFC 3BYTB 1SBBB 1VRAB 3KLSX 3Q8EA 4Q2JA 2BS4B 2LHEA 4XWTA 2CJOA 2IPKD 4RGTA 3NRZA 1VZ8A 1ET9A 2KQ4X 2QEJC 3AE2B 1JQ4A 2R61A 2KN4A 2WXPA 3DWMA 5EE0A 1HZ5A 1D6EC 2D5GA 3AM9A 1HEZE 2L1AA 3AV8A 5EE9A 1HXYD 4R3DA 5TSSA 1C4CA 2SEBD 1I4GA 4ITKA 1SE2A 2AQ2B 1P7EA 2PKOA 2AQ1B 4A9AA 2M0AA 3NVYA 1N60A 1TZOA 3SFEB 3HVZA 2LFIA 4WQMA 1YMHE 2KAJA 1ZE3D 4YSYB 2J4XA 2FUG1 1J7AA 2GI9A 3HVDA 4OVZA 1C4AA 2LGIA 1GAQB 1L0YB 1YJIA 4RFBA 4RF1A 4WH4A 1K52A 4JE3B 1ROEA 4HJGE 4C7YA 4GLSC 1J7CA 1TY2A 2XN9C 2WP9B 1MPEA 2JYTA 3L4PA 3P63A 1XXGA 1QILA 4KGTA 1PDXA 1P7FA 3FAHA 2QIEB 3BYYB 1XCTL 3U4EG 1IGCA 1YNTE 2K9XA 2K0PA 4TSSA 5BYRA 3W1SA 3E9SA 1I4XA 2E3TA 2BTEA 2WXIA 1MHHE 2Y5PA 1VDVA 2NMQA 2XNAC 2RPVA 2CU3A 3AEDB 1V1OA 4XDCA 4YWGG 3AECB 3W5UB 2WXQA 4N59A 1J7BA 2X38A 3MJ5A 2LJIA 3BVMA 2K5PA 3P4SB 3H8HA 3O13A 3R2IA 1L0XB 2KDMA 3KWLA 1YQ4B 3AE4B 4A90A 2SAKA 2VZKB 3LYYA 3OWEB 3AN1A 4JX1C 4OZBA 1ZDXA 1XLPA 1DYQA 2BW2A 2MJ3A 2V3NA 1RFKA 2MJEA 1WXQA 1YN4A 2L32A 3ZQ4A 3AEBB 2WXHA 5H92C 1F2RC 3URYA 1T3QA 1SE3A 5H8YE 1WSPA 3P4RB 3NS1A 2Z8LA 1V8CA 5AUKA 3TEWA 1VZ6A 2LMCA 1FXIA 1UWXA 1XO3A 2BYTA 3TEZA 1YJJA 1NI3A 2J53A 1EM7A 1ENFA 1JMLA 2J42A 4HRSA 2WU2B 1E10A 4YSZB 2H89B 5I4DA 2DYMA 4MH8A 4WIPA 1QOGA 1Y56A 1KRHA 1FO4A 4OZAA 3TSSA 1C77A 3IAM1 4XDDA 3SEBA 3T3NA 3SFDB 1ESFA 1BXTA 1QF6A 3EGRA 2HDEA 2EKIA 2K3UA 2AQ3B 3ZYYX 2HTME 2WXJA 1C78A 4HEA1 4FXCA 4CQNA 1YQ3B 3NVVA 4ZHPA 1I4QA 1SIJA 1FNVA 1PGAA 1PGXA 4XWWA 1TS5A 1JWUD 3NVWA 1XCQL 1JWMD 3CIRB 1DOYA 3VQIA 1FM0D 5D3IB 3I57A 3GB1A 2J52A 3NZ3A 4US8A 5BMIA 3N9YC 1RWSA 1JWSD 4ZYSA 3B9JA 3P42A 2H88B 4US9A 3KWVA 4TQ0A 2Y5CA 1AW7A 2N9KA 4WAFA 1DOXA 2G9HD 1FNUA 3U52E 4ZHOA 2IDYA 1IUEA 4L2YA 4MT5A 1N5XA 5GXGB 3W5VB 1D5XC 1R7SA 1KLGD 4YTMB 1I7HA 1FXAA 2M19A 2ONQA 4PT5A 2K22A 2DWQA 2AX5A 1WWTA 1T5XD 2QJLA 2GRIA 3AEAB 1UWMA 4NAMA 3BK2A 4KKIA 1DOIA 2FE8A 1ET6A 1E7PB 2JSVX 4HROA 3V3XA 3Q8BA 2FBWB 1JWBD 1Q10A 3ZJTA 1K51A 2GB1A 2W3SA 1E6EB 4NZLB 4TQ1A 1IGDA 3Q8FA 1N62A 1PGBA 3AE1B 3BWUD 4WURA 4IOIE 2WXNA 2W82A 4AS1A 1N63A 1L6VA 2M56B 2RDHA 2JWUA 1C76A 1FMAD 4YSXB 1CJEA 3AEGB 5BYSA 1BUIC 4GDLB 4DXGA 3CWIA 1N61A 5T8IA 2W54A 3BIID 5D3DA 2ZW0A 4KGSA 1KLUD 1XLQA 2V3PA 1HZ6A 4C56C 2PLPA 1L4ZB 4O1NA 3LXFA 1C4PA 1VR9A 4RGMA 3BVGA 3GP7A 1SJHD 4P16A 4YTNB 2NTSA 2IGDA 1UNSA 2RDGA 3E56A 2QILA 3PZ8A 4IKGA 2YEPB 2LHDA 3P1MA 1MHXA 1V1PB 2WXGA 4RNAA 1DGJA 1NEKB 4RCOA 2PW9A 4ZOHC 5G5HA 2WXLA 1EWYC 1OFFA 1ZXIA 1XEEA 5AUIA 2DLBA 3IT6B 3IT4B 4KKJA 4L1BA 1L5PA 1QOFA 1SF0A 1QKZA 1AYFA 3BZDB 4EE2A 4USAA 2KACA 3P4PB 5C2TB 1M4VA 2JYEA 1FCLA 1CQVA 2N7JA 4TMAB 2BB6A 4LK0M 3BK1A 2MJDA 5BMGA 3AH7A 2WLBA 4D2KA 4NJCA 2TSSA 1OQRA 2ZW1A 3PO0A 3HRDD 1FNWA 1HA5A 1E9MA 1XF5L 2JU6X 4JPSA 1D5ZC 1IBXB 1QOAA 2JZPA 2EELA 2WS3B 1TS4A 1TS3A 4YT0B 4YTPB 4UDUC 2QSDA 3EA6A 4C7ZA 1PUTA 1BMLC 3R8BA 3AE6B 2V0GA 5EE3A 1YN5A 2BBCA 2I38A 4REZA 2OEDA 2YEPF 5C3JB 2JX5A 2RMMA 1VJKA 1MI0A 2WDVB 3Q8AA 5D7GA 3DWGC 1CZPA 2IGHA 3J9CA 4ARCA 1I4RA 1KH0A 4LTUA 5BMHA 2Y3AA 4YXDB 1ZUD2 1D5MC 2WDRB 2KWDA 4XE0A 2LUMA 5HG2A 2L83A 4A6QA 4ARIA 3SR6A 3PZ7A 4RGOS 4A55A 1RM6C 1C79A 1XLOA 4ZRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2SAK A;  1BUI C;  1SSN A;  1C77 A;  1C79 A;  1C78 A;  1C76 A; 
#chains in the Genus database with same CATH topology
 2WNM A;  2LVQ A;  1VCB A;  1GOZ A;  2ZCB A;  1NEN B;  4CO7 A;  1S1Q B;  2FUH B;  1P3Q U;  3B1L X;  4KX6 B;  4BFR A;  3U7D A;  2LEK A;  4KDL B;  3V05 A;  4KDI C;  2PVO D;  5JHB A;  1F9J A;  1QOB A;  4NJ7 A;  3H7S A;  3H9D A;  3V6C B;  4W9E A;  2ACZ B;  2QMT A;  5MPO A;  1A70 A;  3MHZ A;  1XLN A;  3C8Y A;  4C80 A;  2RD0 A;  3X0W A;  3KYC D;  3NVZ A;  1WX8 A;  3R2T A;  1FRD A;  2JVC A;  3Q69 A;  5CX3 A;  2DZJ A;  4M0W A;  2PIA A;  3AXC A;  4RM8 A;  2LVP A;  3IAS 1;  3ENE A;  1GPX A;  4XZ4 A;  4II2 B;  3TMP B;  5HFY A;  2PVG C;  4WJQ A;  1FFV A;  5BYQ A;  1H8C A;  4I6N B;  1C9F A;  2BS2 B;  2IO0 B;  4DBG A;  3P2B A;  1UH6 A;  3FC4 A;  5AEK B;  3PPA A;  2KWV B;  1V49 A;  2GLS A;  1ZPS A;  4AJW A;  3KQ4 A;  2I1K A;  3VTW A;  1GB4 A;  2WU5 B;  2I2Y A;  1IYF A;  1TS2 A;  4JWS C;  1X1M A;  2L3Z A;  2KFK B;  3ZGZ A;  1NYQ A;  1L6U A;  4EZL A;  2BS3 B;  2ZNV B;  1V97 A;  2B76 B;  1WYG A;  2O2V A;  2FNJ B;  4LDT B;  1CK1 A;  2W55 A;  4A8X C;  2BT6 A;  1TKG A;  4WWO A;  2N1W A;  4B0M A;  3ZDT A;  3VR8 B;  2INN E;  2INP E;  3DDC B;  2M0X A;  3ETR A;  2GBM A;  2JUO A;  1L2N A;  2BWE S;  4Q2J A;  4M00 A;  1LQB A;  3NRZ A;  1NBF C;  1ET9 A;  3VFK A;  2KN4 A;  2L1A A;  2KQS A;  2KTR A;  1WR1 A;  3WA0 A;  1I4G A;  2MP2 A;  3LJ3 A;  4E3C A;  3NVY A;  3VAW A;  2BKF A;  1ZE3 D;  4DXA B;  2GI9 A;  1C4A A;  5JH5 C;  3VUW A;  4KIK A;  4G50 A;  1ROE A;  3APD A;  4HJG E;  4C7Y A;  4GLS C;  4FUL A;  4WJP A;  2KLC A;  3ZNG C;  3BYY B;  1XCT L;  1LXD A;  2RR9 A;  4FJZ A;  2K0P A;  4TSS A;  3W1S A;  3TJP A;  2JWZ A;  3N32 A;  4NPN A;  1I4X A;  2Z59 B;  3A33 B;  1VDV A;  3AED B;  1V1O A;  4XDC A;  5KHQ A;  2ZPN A;  1H4R A;  3AEC B;  1WGR A;  1UGM A;  3C19 A;  4M8N A;  3O13 A;  5DPS A;  1L0X B;  3AE4 B;  2L05 A;  2VZK B;  2OJR A;  4JX1 C;  2LUE A;  2J0M A;  4KZC A;  2V3N A;  2IND C;  1YN4 A;  1GG3 A;  3VH3 B;  2GMI C;  4KIK B;  3WAL A;  1WSP A;  3SU8 X;  2Z8L A;  1UWX A;  2AEH A;  3A9K A;  2XK5 A;  3QHT A;  1YJJ A;  1OEY A;  2KAN A;  3GZN B;  4YSZ B;  2H89 B;  4MH8 A;  1Y56 A;  1KRH A;  3TSS A;  2W9N A;  4XDD A;  2N7D A;  3SFD B;  1BXT A;  4DHZ E;  2HDE A;  1WRD B;  4MSM B;  3QCA A;  2MBQ A;  4BBN C;  1Y8R C;  2LGD A;  1YQ3 B;  3NVV A;  3HM6 X;  4XWW A;  1JWM D;  2REX A;  5D3I B;  1RRB A;  3I57 A;  4BOS C;  3UGB B;  2KHW B;  3HK0 A;  3NZ3 A;  3N9Y C;  4FJV B;  2LGX A;  2N9K A;  2G9H D;  1FNU A;  3U52 E;  2IDY A;  2IZV B;  2NVU I;  3ZRC A;  1M94 A;  3ZVV A;  3OLM D;  1D5X C;  1YJ1 A;  2KD0 A;  1YQB A;  2M19 A;  4PT5 A;  2K22 A;  1UWM A;  3RNA C;  4BKS A;  1J8C A;  3DVN U;  2RDB C;  2JZZ A;  5J17 A;  2GBR A;  2KJR A;  2FBW B;  3ML9 A;  3ZJT A;  1K51 A;  4GN1 A;  4IM3 A;  2D10 A;  3N30 A;  3AE1 B;  3FKY A;  3Q14 C;  2WXN A;  4JIO U;  2KOX A;  2JRH A;  1FMA D;  5CHW A;  1D3Z A;  1N61 A;  5D3D A;  4KGS A;  2R2Q A;  1KLU D;  4C56 C;  5E6N A;  2M4N A;  4W9K A;  3MC8 A;  1VR9 A;  4P16 A;  4YTN B;  2IGD A;  2RDG A;  4IKG A;  2YEP B;  3NG0 A;  4IUM B;  3P1M A;  3MJW A;  4HK2 A;  1T0R C;  2WXG A;  4RNA A;  4RCO A;  4ZOH C;  1EWY C;  1OFF A;  1ZXI A;  1XEE A;  5AUI A;  3IT4 B;  2D07 B;  1R4N I;  1WGD A;  5HKH A;  1WXS A;  4USA A;  2KAC A;  3P4P B;  2L00 B;  2ZJD A;  5G55 A;  1A5R A;  3U30 A;  2ZPY A;  3IFW B;  2FIF A;  4IWO A;  2MJD A;  2GBN A;  2J0K A;  2KFJ A;  3QA8 A;  3L0W B;  3JSV A;  1FNW A;  1E9M A;  5JZE B;  4JPS A;  2WS3 B;  4I6L B;  1TS3 A;  4YTP B;  3UIO B;  2QSD A;  4C7Z A;  1PUT A;  3R8B A;  3PRZ A;  2K39 A;  4XYC A;  4EEW A;  2YVC A;  2OED A;  2YEP F;  4NNJ B;  2JX5 A;  1VJK A;  2WDV B;  4HXD A;  1WJ4 A;  3L13 A;  2M17 A;  4YXD B;  1D5M C;  2WDR B;  1N6Z A;  2LUM A;  3DVG X;  4A6Q A;  1WMH B;  3ALB A;  4BKT A;  4RGO S;  3DBL B;  1UD7 A;  3I5J C;  1KF6 B;  3IXS A;  4ZRQ A;  3RZF A;  4FN2 A;  1EF5 A;  3LB8 C;  3PT2 B;  4LJP B;  2DNF A;  1MG4 A;  2KX3 A;  2NCN A;  4L23 A;  5EE1 A;  3TEY A;  1VZ7 A;  2V4I B;  2O6V A;  1SXT A;  3AE3 B;  1WM3 A;  3BVZ A;  1E0Z A;  1L0V B;  4WWP A;  3A1Q A;  4FHK A;  2PJH A;  3UI3 A;  2Q5W D;  2PTL A;  1NVI D;  3VTU A;  5BO4 B;  5G5G A;  1IBX A;  3NHE B;  3VUX A;  2D3G A;  4J6I A;  2MQJ A;  2PE6 B;  4DHZ B;  3PTF C;  5AZG A;  2N4F A;  3AE9 B;  4LLG M;  2IJ0 A;  4KGR A;  4GOC A;  1KTK A;  1Q5W B;  3MFG A;  3PHW B;  2JXX A;  1RYJ A;  1JW9 D;  3Q3J A;  4HPM B;  1ZDV A;  3RFZ B;  1UBQ A;  2EMS A;  3DHI C;  2O6V B;  3DBH I;  2CS4 A;  2NTT A;  5JXV A;  3AE5 B;  2N1V A;  1RFA A;  2D3B A;  3W2D A;  3TBL D;  2DBY A;  1WRI A;  4ZDV A;  1PFD A;  2WXM A;  2L52 A;  2N9X A;  2G4D B;  1F0Z A;  3AE8 B;  1JRO A;  1FIQ A;  2WDT B;  2G4S A;  3I9V 1;  4PS3 A;  4AOF A;  3T3O A;  2VRR B;  4K81 A;  4WAA A;  2WDQ B;  1EU4 A;  2KC1 A;  1ZXH A;  2MEK A;  3ABV B;  3RPF C;  2KVZ A;  2M1M A;  3BYT B;  2UU7 A;  4KV2 A;  3WIM A;  2LHE A;  2CJO A;  2INC C;  3DOW A;  4JL9 A;  1VZ8 A;  1JQ4 A;  2R61 A;  2WXP A;  3V61 A;  3DWM A;  1HZ5 A;  2KK8 A;  1D6E C;  3AM9 A;  5EE9 A;  4DWF A;  4R3D A;  1PQS A;  2ASQ A;  5TSS A;  4MEM A;  4II3 B;  2AQ2 B;  1TT5 B;  2AWT A;  5E6O A;  2AQ1 B;  4MJS B;  2R2O A;  4P1B C;  1F1H A;  4WJN A;  4WQM A;  1J7A A;  2DZM A;  1YJI A;  4RF1 A;  1XT9 B;  4JE3 B;  4WH4 A;  4FAD A;  5J18 A;  2KFK A;  1MPE A;  2JYT A;  3L4P A;  1YIW A;  3P63 A;  4LNO A;  2CHZ A;  3ZO5 B;  1PDX A;  2QIE B;  1IGC A;  2HE7 A;  5BYR A;  3EFU A;  4CHK A;  4LNN A;  5IAA C;  4LCD E;  2MBB B;  4NQK E;  3PRM B;  2NMQ A;  4MH0 E;  2CHW A;  4DDI D;  4G11 A;  3EFC A;  3W5U B;  3VH4 B;  1V2Y A;  2EKE C;  2WXQ A;  4N59 A;  2X38 A;  4NJ6 A;  4EZK A;  2LJI A;  3RNE C;  3N3K B;  3H8H A;  3R2I A;  2KDM A;  4ZRK A;  2V9H A;  4IM0 A;  2SAK A;  4OZB A;  5DPT A;  1ZDX A;  1OEY J;  3CST A;  2MJE A;  5L83 A;  4I6P A;  2C5L C;  3Q3F A;  2HJ8 A;  3AEB B;  3ZLZ A;  5H92 C;  3RYT A;  2KZR A;  2QDF A;  1VZ6 A;  1FXI A;  1J19 A;  1GC6 A;  2J53 A;  4TKN A;  4A3O A;  2MRP A;  2J42 A;  1E10 A;  5I4D A;  2DYM A;  4XGA B;  2N9E B;  2MBE A;  3SEB A;  2C60 A;  1WY8 A;  3K9P B;  2AQ3 B;  2DX5 B;  2WXJ A;  2K6Q A;  4FXC A;  4KSK C;  3RI7 C;  4ZHP A;  1SIJ A;  1FNV A;  3NVW A;  1XCQ L;  1DOY A;  2IY0 B;  3RNB C;  3GB1 A;  5BMI A;  2KDI A;  1UBI A;  1JWS D;  4ZYS A;  3VUY A;  2GBK A;  3ONS A;  4ZHO A;  2MBH A;  3ZIM A;  3NZS A;  3W5V B;  1SGH A;  3PLU A;  1I7H A;  2ONQ A;  2BWF A;  2QJL A;  3AEA B;  3L08 A;  3BK2 A;  1ZW7 A;  2BKR B;  2MA9 B;  2FE8 A;  1E7P B;  2JSV X;  2BF8 B;  4W9C A;  4HRO A;  1KOT A;  4BOZ B;  3V3X A;  2BQQ A;  1Q10 A;  1HTQ A;  2MWS B;  3HM3 A;  2GB1 A;  2W3S A;  3DVN V;  4A20 A;  1E6E B;  1IGD A;  1N62 A;  1PGB A;  3BWU D;  2KKC A;  4ICU A;  4WUR A;  4FBJ B;  1E90 A;  2C7M B;  2M56 B;  2D3C A;  4BZA A;  2KWC A;  1C76 A;  4YSX B;  3ZTC A;  1CJE A;  1OQY A;  4FLH A;  4GDL B;  3CWI A;  4JQW C;  3R66 C;  3L54 A;  4CYE A;  2KTF A;  1XLQ A;  5AZH A;  4KSL C;  2PLP A;  2LGS A;  3TIX A;  4PYZ A;  2WX0 A;  3PRP B;  3BVG A;  3JW0 X;  2NTS A;  3PZ8 A;  4URK A;  3WAP A;  4ANV A;  2LHD A;  1V1P B;  2XBB C;  2LRU A;  1NEK B;  1ISN A;  2PW9 A;  2BYF A;  2HD5 B;  2YLM A;  3WAM A;  2K8B A;  2Y5B B;  4L1B A;  1SF0 A;  1U4A A;  4HJK A;  4EE2 A;  1YX5 B;  2KYW A;  4P1C C;  3H7P B;  3PZD A;  2N7J A;  2D3A A;  4M8M A;  1WGG A;  5BMG A;  3AH7 A;  2WLB A;  4D2K A;  3UQA A;  2ZW1 A;  2KT7 A;  3PO0 A;  4TV3 A;  2G3Q B;  1XF5 L;  1QOA A;  2LRW A;  3DQV A;  1BML C;  3AE6 B;  1E8X A;  1R4M B;  2FID A;  4XX5 A;  3Q6B A;  3Q8A A;  3IVF A;  4G3X B;  3DWG C;  2NPT B;  2IGH A;  4W9L A;  3J9C A;  4RM9 A;  3IHP C;  2QCZ A;  2OJW A;  1KH0 A;  4LTU A;  2VH1 A;  5BMH A;  3M3J A;  4IW0 A;  4GGQ A;  4ARI A;  3SR6 A;  1FXT B;  4A55 A;  1QZE A;  1RM6 C;  1C79 A;  2K25 A;  4A3P A;  2FCS A;  3B08 A;  3H1U A;  3FIL B;  5HHD G;  2V3S A;  1B9R A;  2MX2 A;  2PE9 A;  4HKZ E;  2G1E A;  3AEE B;  3EEC A;  1KM7 A;  1WF9 A;  1WZ3 A;  1T0S C;  2MLB A;  2JY6 A;  4OW0 A;  1MVK A;  3V60 A;  2NS5 A;  3NJT A;  2IBI B;  4MM3 B;  4HLE A;  3DBR B;  1WM2 A;  1FEH A;  2WXF A;  1P0R A;  1T0Y A;  3ZJU A;  1TYG B;  4XC2 A;  1ZP0 B;  3Q8C A;  3RNC C;  1F2R I;  1TY0 A;  1TJE A;  2IO3 B;  3NY5 A;  3KUC B;  3AU4 A;  1KLV A;  1TKE A;  3R7R A;  2C7N B;  3GS2 A;  3ZNI D;  3IG3 A;  1SEB D;  2W3R A;  1SE9 A;  3NZU A;  4J3O D;  3ECI A;  2WXR A;  4HVB A;  3KH0 A;  2BYE A;  1JAL A;  2DYO A;  3B2G A;  4AQ7 A;  4NY0 A;  5IP4 D;  5CTR C;  1JWA D;  4P6V F;  4JLC A;  1E7V A;  2ICI A;  5IN7 A;  1WJU A;  2LVO A;  4JWU C;  1WMH A;  3VVW B;  2ZVN A;  4ZRP A;  3PS6 A;  2KJH B;  2BB5 A;  2JQR B;  3GZN I;  4RH6 A;  3VR9 B;  4C00 A;  1V86 A;  5DPW A;  2JXT A;  2UYZ B;  1B1Z A;  1V6E A;  4B0E A;  2K1F A;  4IDI A;  4DHJ D;  1STE A;  1D4B A;  4N6E B;  4WWM A;  2E6X A;  3HUI A;  5HI1 A;  1RLF A;  3AB5 A;  1AN8 A;  1QT9 A;  5FKA C;  3CSF A;  2FAZ A;  2NBV B;  4WJO A;  3QC8 B;  3TUO A;  3Q3M C;  3KW5 B;  4N58 A;  1FFU A;  3Q2A C;  1S3S G;  4DQO C;  5LNK 1;  5JHA A;  1SE4 A;  3ZJV A;  3PSE B;  2N0S B;  5EDS A;  1FCC C;  2WGS A;  4N9F 4;  4HCN B;  1K53 A;  1WJN A;  1L4D B;  3EC8 A;  1GB1 A;  1JRP A;  1Z2M A;  1EU3 A;  4GDK B;  1K8R B;  2WQY B;  1OQQ A;  4OZC A;  4JGH B;  1SBB B;  3Q8E A;  3KLS X;  1SIF A;  1KJT A;  2BS4 B;  4BKS D;  3HIZ A;  2IPK D;  4RGT A;  3RNG C;  3QAQ A;  3QIJ A;  5EE0 A;  1HEZ E;  3AV8 A;  3DHH C;  5GMV A;  4M02 A;  2SEB D;  4ITK A;  1SE2 A;  2HTH A;  1MJD A;  2PKO A;  4W9J A;  1P9D U;  1N60 A;  1JRU A;  1TZO A;  3I63 C;  3SFE B;  2LXC A;  2WHI A;  1LM8 B;  1OGW A;  2FUG 1;  4OVZ A;  1P98 A;  4IWP A;  4F1S A;  1GAQ B;  3GE8 C;  4RFB A;  1WE6 A;  2G45 B;  4IWQ A;  2C7H A;  1TGZ B;  1J7C A;  2XN9 C;  2WP9 B;  3BY4 B;  2KC2 A;  3FAH A;  4OVV A;  3VHT C;  3U4E G;  2M8S A;  1YNT E;  2K9X A;  3E9S A;  3KVF B;  2JF5 A;  2L0F A;  2E3T A;  2MCN B;  2BTE A;  2WXI A;  1MHH E;  2IO1 B;  2L76 A;  2XNA C;  4YWG G;  4LNF A;  5LLI A;  2WX1 A;  1J7B A;  3BVM A;  2K5P A;  2CR5 A;  3KWL A;  1YQ4 B;  1RAX A;  2LWP A;  3AN1 A;  1E8W A;  1T0Q C;  2BW2 A;  2MJ3 A;  5CHF A;  4IG7 B;  1WXQ A;  2N9P C;  4MGZ E;  2L32 A;  2GBJ A;  4HDO A;  2WXH A;  3URY A;  1F2R C;  2LJ5 A;  2AYO B;  1SE3 A;  1WI0 A;  2DHZ A;  4K7S A;  5H8Y E;  4TUU A;  5IOI A;  3P4R B;  3NS1 A;  1V8C A;  3N1Z C;  4MJS A;  3TEW A;  3APC A;  3TEZ A;  1EM7 A;  1JML A;  4HRS A;  5IKC M;  2JPH A;  5D94 A;  1FO4 A;  4MGK E;  4OZA A;  3IAM 1;  5KHO A;  4C4V B;  1QF6 A;  3DBL I;  3KYD D;  2HTM E;  4CQN A;  2KNB A;  2DYB A;  3V6E B;  2V4L A;  4ASW C;  2CHX A;  1JWU D;  4ZRI A;  3CIR B;  1FM0 D;  4MGY E;  2J52 A;  4LNK A;  3TL5 A;  2MSE D;  4BBN F;  3B9J A;  3P42 A;  4FHJ A;  5AZF A;  1AW7 A;  1DOX A;  2O6V D;  3PRE A;  1IUE A;  3W1S C;  4L2Y A;  5L95 C;  1N5X A;  4YTM B;  1R7S A;  2JRI B;  1FXA A;  2AX5 A;  3N1Y C;  2KDE B;  2QHO A;  5LXH A;  3IBE A;  4KKI A;  1V5O A;  1ET6 A;  4LJO B;  3VDZ A;  2WWZ A;  1GJZ A;  2MW5 A;  3RNF C;  4FJY A;  3SD5 A;  2LXA A;  2KVR A;  3MHS D;  4W9I A;  3RCZ A;  2PEA A;  4NZL B;  4TQ1 A;  3Q8F A;  3JVZ X;  2L8J A;  5LXI B;  4AS1 A;  1N63 A;  1L6V A;  2JWU A;  4PS7 A;  4DK5 A;  1P1A A;  1TTN A;  2GOW A;  1GC7 A;  3AEG B;  4YL8 A;  3KUD B;  4DXG A;  5T8I A;  2KO3 A;  1WE7 A;  2W54 A;  4K1R B;  3BII D;  2ZW0 A;  2DZK A;  2V3P A;  2N7E A;  1HZ6 A;  1J0G A;  2KWU B;  1L4Z B;  4O1N A;  1C4P A;  4ICV A;  1Z5S B;  4P7I A;  3OG5 A;  3GP7 A;  1WZ0 A;  1WFY A;  2MHJ A;  4GU2 A;  2OOB B;  4F7Z A;  1WX9 A;  2RSU A;  3M62 B;  4KVG B;  1GNU A;  5TR5 A;  4WWN A;  4QAY A;  4M01 A;  1MHX A;  2KX0 A;  3VTV A;  2B3A A;  1WGY A;  1DGJ A;  2I1J A;  2WXL A;  5J2R A;  4GSW A;  2DLB A;  2KMC A;  1AYF A;  1I35 A;  3BZD B;  3MTN B;  4BKG A;  1WXV A;  4AUQ C;  5C2T B;  2JYE A;  1FCL A;  3N1X C;  2RGF A;  1CQV A;  3O65 B;  4EUT A;  2BB6 A;  3ZUN A;  4EZJ A;  3BK1 A;  2KXJ A;  2FCM A;  3HRD D;  1GUA B;  1V81 A;  1ZGU B;  3H6N A;  2JZP A;  1YD8 U;  1TS4 A;  4YT0 B;  4UDU C;  3EA6 A;  4AP4 C;  5CHV C;  3PGE A;  1OTR B;  3X23 A;  4M0W B;  2I38 A;  3QQ8 B;  4GDL A;  5C3J B;  2RMM A;  2XEW A;  2MBO A;  4GIV A;  3A4R A;  1CZP A;  2KMA A;  4ARC A;  2Y3A A;  1ZUD 2;  4XE0 A;  4HPP A;  5HG2 A;  3R7Q A;  2L83 A;  2X8X X;  3W1Y A;  4BVU C;  3DCG A;  3ZXV A;  3DPD A;  1Q0W B;  1XLO A;  1G6J A;  1WYW B;  1YN3 A;  3AMZ A;  3SDL C;  3W9C B;  3U7Z A;  1WXM A;  3VRA B;  5FR3 A;  1YX6 B;  1V1P A;  2NR2 A;  1LO5 D;  3D32 A;  1QQR A;  2D2Q A;  1VLB A;  3AE7 B;  2ON8 A;  1FD6 A;  1UUP A;  4ANU A;  3WAO A;  1C1Y B;  2FCN A;  1NI2 A;  4S0R A;  2KLG A;  3OJ4 B;  3VRB B;  2CJN A;  3GE3 C;  2KMM A;  3K9O B;  3WCQ A;  3H7P A;  3ZRF A;  3ZNZ B;  1I4H A;  2LD9 A;  3OAW A;  2RPQ A;  5E6J A;  1BT0 A;  4LDT D;  1UZX B;  3BIN A;  1MFW A;  1V5T A;  1FRR A;  4HWI B;  4H2A A;  3WAN A;  2O2V B;  3UQB A;  2L7R A;  4HPL B;  4EOY A;  4DXF A;  1NYR A;  3PVL A;  1K50 A;  3AI5 A;  1UGJ A;  1HQR D;  5D6J B;  2IY1 B;  2LZ6 A;  1SSN A;  2NPT A;  3T9L A;  3EHV A;  1AAR A;  3B0A A;  3EUB 2;  4OHJ A;  3TEX A;  3KUZ A;  4W9F A;  1F52 A;  2N9L A;  1ZOY B;  2PMV A;  1TKY A;  1QLB B;  2Z0D B;  3NOB A;  2JZ3 B;  3MC0 B;  4NAW A;  1N5W A;  1I4P A;  2KTR B;  1JCK B;  2MP2 B;  3FIL A;  4AWJ A;  3OJ3 A;  2MH7 A;  1LFD A;  2LGY A;  3NS8 A;  4MAC A;  2WXK A;  3MP9 A;  4MGI E;  3B2F A;  3MC9 A;  1KFY B;  4W9H A;  1YOV B;  1SJE D;  3RZW C;  3HHM A;  4MM3 A;  1EO6 A;  2IYD B;  3NUH B;  1ACC A;  1F77 A;  2WXO A;  4K3B A;  4AJY B;  1TIF A;  4K7W A;  4HCP B;  4RF0 A;  4MEL A;  3JYU A;  2WYQ A;  1T6B X;  1WX7 A;  5D2M B;  1PYW D;  1R4N B;  4RGN A;  4PYU A;  4B95 A;  2IGG A;  1AWD A;  1IPG A;  3I3T B;  5FK9 C;  1SB3 C;  3P4Q B;  3Q3N C;  1WGK A;  4HKQ A;  3M63 B;  2CKH B;  3LDZ E;  2OHF A;  3ZXR A;  1EWC A;  3ZTD A;  3U2S C;  5E6P A;  2KDF B;  3AEF B;  2LAS A;  4NAW B;  2VZK D;  1C3T A;  4FA6 A;  2DEN B;  1LGR A;  1VRA B;  4IC7 B;  1HTO A;  4XWT A;  3V62 A;  3RT3 B;  4S17 A;  2KQ4 X;  1NDD A;  2QEJ C;  3AE2 B;  4MSQ B;  2D5G A;  1HXY D;  1C4C A;  1V80 A;  1FPY A;  3DBS A;  1P7E A;  2QC8 A;  4A9A A;  2M0A A;  3APF A;  2NBU A;  3A9K B;  2LFI A;  3HVZ A;  2XK5 B;  3DVG Y;  1YMH E;  2KAJ A;  4YSY B;  3C0R B;  2J4X A;  3HVD A;  1EUV B;  2LGI A;  4DHJ B;  1L0Y B;  1K52 A;  3RN9 C;  1TY2 A;  4EKU A;  3ZKJ C;  2ZEQ A;  1XXG A;  1QIL A;  4KGT A;  1P7F A;  2DAJ A;  1XD3 B;  3M95 A;  2ZCC A;  3T8M A;  1V9J A;  3QX1 A;  2Z0E B;  4W9G A;  3UIN B;  1E8Y A;  2J7Q B;  2Y5P A;  2RPV A;  2CU3 A;  3A9J A;  4DDG D;  2D11 A;  4GDK A;  3MJ5 A;  3P4S B;  2AL3 A;  2AL6 A;  3L17 A;  4A90 A;  3UIP B;  3ML8 A;  3LYY A;  4W9D A;  3OWE B;  2K8H A;  4MDK E;  1XLP A;  1DYQ A;  1RFK A;  1MG8 A;  3ZQ4 A;  1WH3 A;  3DHG C;  4ZRJ A;  1T3Q A;  1I42 A;  1WXA A;  4RMA A;  3Q3O C;  3QAR A;  5AUK A;  1R4M I;  2LMC A;  3PHX B;  2JT4 B;  4WQO B;  4GB9 A;  1XO3 A;  2BYT A;  3R3M A;  4NQL B;  1NI3 A;  3DBH B;  4X57 B;  5DCN A;  1ENF A;  2WU2 B;  4WIP A;  1QOG A;  1C77 A;  3U8Z A;  3T3N A;  1ESF A;  4B9K A;  3EGR A;  2EKI A;  2K3U A;  3SHQ A;  4K3C A;  3ZYY X;  1C78 A;  5IA7 A;  3A9J B;  4HEA 1;  2ZZP B;  1I4Q A;  1PGA A;  1PGX A;  1TS5 A;  3AU5 A;  3RMK C;  3VQI A;  2IO2 B;  2KN5 A;  2FCQ A;  1ZKH A;  2KDB A;  2DZI A;  2PPH A;  4LNI A;  4US8 A;  1RWS A;  4ZYN A;  2H88 B;  3DBR I;  4K7U A;  4IM2 A;  4US9 A;  3KWV A;  4TQ0 A;  2Y5C A;  4WAF A;  1XQQ A;  2HJ1 A;  2ZNV C;  3RUL A;  4MT5 A;  1EF1 A;  3ZW3 A;  5GXG B;  1KLG D;  3UF8 A;  2DWQ A;  1CMX B;  1WWT A;  1T5X D;  2GRI A;  3PLV A;  4NAM A;  2BYV E;  5C23 A;  1DOI A;  4ACF A;  4E71 A;  2EMT A;  3Q8B A;  1JWB D;  1E8Z A;  1HE8 A;  3CMM B;  2BVC A;  3JSV B;  1WR6 E;  2UWQ A;  3VXW A;  3L10 B;  2NBW B;  4BAX A;  4IOI E;  3N20 C;  2W82 A;  2A5U A;  2RDH A;  5G2N A;  4HDQ A;  5BYS A;  2BPS A;  2VH2 A;  4C4V A;  1BUI C;  3S2A A;  2ZVO A;  4EFO A;  1WJ6 A;  2BGF A;  4GXB A;  3TCA A;  2A4Z A;  1Q1O A;  1E5W A;  3LXF A;  1IP9 A;  4RGM A;  1SJH D;  1UF0 A;  5FR6 A;  2CU1 A;  1UNS A;  2KQ7 A;  1E7U A;  4OVU A;  3E56 A;  2QIL A;  3QK0 A;  3AUL A;  5C1Z A;  1WGH A;  4PS8 A;  3PV1 A;  5G5H A;  1TZ1 A;  3CF6 E;  4F8C B;  3IT6 B;  4KKJ A;  1L5P A;  1QOF A;  1TBE A;  2L0T A;  3A4S C;  3QWZ B;  1QKZ A;  4G0N B;  1UEL A;  3A1Q B;  1M4V A;  4TMA B;  4LK0 M;  5DPR A;  2DAF A;  3RD2 A;  4ANX A;  4NJC A;  2TSS A;  1OQR A;  4ANW A;  1HA5 A;  2JU6 X;  1D5Z C;  1IBX B;  2EEL A;  4E74 A;  2V1Y A;  1L7Y A;  2K8C A;  3GOE A;  3ZNH B;  2V0G A;  5EE3 A;  1YN5 A;  4PK1 A;  2BBC A;  4KZ0 A;  4REZ A;  1VD2 A;  2KJ6 A;  1MI0 A;  5D7G A;  4B6W A;  1I4R A;  1WIA A;  3L16 A;  3QJZ A;  3ZDM C;  5IO9 A;  2K6D B;  2KWD A;  2J0J A;  2LI5 A;  3PZ7 A;  3RUI B;  4GMV A;  2C9W B; 
#chains in the Genus database with same CATH homology
 1KF6 B;  3IXS A;  2WNM A;  1YN3 A;  3AMZ A;  3W9C B;  3U7Z A;  3FIL B;  3LB8 C;  3VRA B;  5FR3 A;  1GOZ A;  5HHD G;  1V1P A;  1NEN B;  1LO5 D;  1QQR A;  1B9R A;  1VLB A;  4HKZ E;  4L23 A;  5EE1 A;  2G1E A;  3AEE B;  4KX6 B;  3TEY A;  3AE7 B;  2ON8 A;  1VZ7 A;  2V4I B;  1FD6 A;  1UUP A;  1SXT A;  3AE3 B;  3BVZ A;  1MVK A;  4OW0 A;  1E0Z A;  2LEK A;  4MM3 B;  1L0V B;  3V05 A;  1FEH A;  2PVO D;  1QOB A;  2WXF A;  3ZJU A;  1TYG B;  1ZP0 B;  3VRB B;  2CJN A;  3Q8C A;  2KMM A;  1F2R I;  2ACZ B;  2QMT A;  1TY0 A;  3UI3 A;  3WCQ A;  1TJE A;  2Q5W D;  5MPO A;  1A70 A;  2PTL A;  1NVI D;  3MHZ A;  1I4H A;  1XLN A;  3C8Y A;  1TKE A;  4C80 A;  5E6J A;  3GS2 A;  1FRR A;  3NVZ A;  5G5G A;  3R2T A;  4H2A A;  1IBX A;  1SEB D;  1FRD A;  2W3R A;  4J3O D;  2WXR A;  4DXF A;  3Q69 A;  1NYR A;  3AE9 B;  4M0W A;  4LLG M;  1JAL A;  1K50 A;  2DYO A;  2IJ0 A;  2PIA A;  3B2G A;  4KGR A;  4AQ7 A;  1KTK A;  1UGJ A;  1HQR D;  3MFG A;  1JWA D;  3IAS 1;  1SSN A;  4P6V F;  1GPX A;  2ICI A;  1RYJ A;  1JW9 D;  3EUB 2;  4OHJ A;  3TEX A;  1ZDV A;  3RFZ B;  2N9L A;  1ZOY B;  2PMV A;  2PVG C;  1TKY A;  1QLB B;  5HFY A;  1FFV A;  5BYQ A;  4JWU C;  4ZRP A;  3MC0 B;  1C9F A;  1N5W A;  2BB5 A;  1I4P A;  2BS2 B;  2JQR B;  1JCK B;  4RH6 A;  2NTT A;  3VR9 B;  5JXV A;  3AE5 B;  2JXT A;  3FIL A;  1B1Z A;  3FC4 A;  2MH7 A;  3W2D A;  4B0E A;  4IDI A;  1ZPS A;  2DBY A;  4MAC A;  2WXK A;  3KQ4 A;  3MP9 A;  1STE A;  1D4B A;  3B2F A;  4N6E B;  4WWM A;  1WRI A;  1KFY B;  1PFD A;  2E6X A;  2WXM A;  3HUI A;  2L52 A;  1SJE D;  5HI1 A;  1GB4 A;  2WU5 B;  2I2Y A;  3AB5 A;  1F0Z A;  3AE8 B;  1AN8 A;  1JRO A;  1ACC A;  1F77 A;  1QT9 A;  1TS2 A;  2WXO A;  3NUH B;  4JWS C;  5FKA C;  1FIQ A;  3TUO A;  4RF0 A;  3ZGZ A;  1T6B X;  4N58 A;  1PYW D;  1FFU A;  3I9V 1;  1NYQ A;  4RGN A;  4DQO C;  5LNK 1;  1L6U A;  2BS3 B;  1SE4 A;  2IGG A;  3ZJV A;  1AWD A;  2N0S B;  5FK9 C;  1SB3 C;  1FCC C;  1V97 A;  3P4Q B;  2B76 B;  1WYG A;  3T3O A;  1WGK A;  1CK1 A;  1K53 A;  4HKQ A;  2W55 A;  1L4D B;  4A8X C;  1GB1 A;  2BT6 A;  2OHF A;  1TKG A;  1EWC A;  4B0M A;  1JRP A;  2WDQ B;  1EU4 A;  1EU3 A;  3U2S C;  3VR8 B;  2INN E;  1ZXH A;  2INP E;  4GDK B;  3AEF B;  2MEK A;  2WQY B;  4NAW B;  2VZK D;  1OQQ A;  3ABV B;  3ETR A;  4OZC A;  3RPF C;  3BYT B;  1SBB B;  1VRA B;  3KLS X;  3Q8E A;  4Q2J A;  2BS4 B;  2LHE A;  4XWT A;  2CJO A;  2IPK D;  4RGT A;  3NRZ A;  1VZ8 A;  1ET9 A;  2KQ4 X;  2QEJ C;  3AE2 B;  1JQ4 A;  2R61 A;  2KN4 A;  2WXP A;  3DWM A;  5EE0 A;  1HZ5 A;  1D6E C;  2D5G A;  3AM9 A;  1HEZ E;  2L1A A;  3AV8 A;  5EE9 A;  1HXY D;  4R3D A;  5TSS A;  1C4C A;  2SEB D;  1I4G A;  4ITK A;  1SE2 A;  2AQ2 B;  1P7E A;  2PKO A;  2AQ1 B;  4A9A A;  2M0A A;  3NVY A;  1N60 A;  1TZO A;  3SFE B;  3HVZ A;  2LFI A;  4WQM A;  1YMH E;  2KAJ A;  1ZE3 D;  4YSY B;  2J4X A;  2FUG 1;  1J7A A;  2GI9 A;  3HVD A;  4OVZ A;  1C4A A;  2LGI A;  1GAQ B;  1L0Y B;  1YJI A;  4RFB A;  4RF1 A;  4WH4 A;  1K52 A;  4JE3 B;  1ROE A;  4HJG E;  4C7Y A;  4GLS C;  1J7C A;  1TY2 A;  2XN9 C;  2WP9 B;  1MPE A;  2JYT A;  3L4P A;  3P63 A;  1XXG A;  1QIL A;  4KGT A;  1PDX A;  1P7F A;  3FAH A;  2QIE B;  3BYY B;  1XCT L;  3U4E G;  1IGC A;  1YNT E;  2K9X A;  2K0P A;  4TSS A;  5BYR A;  3W1S A;  3E9S A;  1I4X A;  2E3T A;  2BTE A;  2WXI A;  1MHH E;  2Y5P A;  1VDV A;  2NMQ A;  2XNA C;  2RPV A;  2CU3 A;  3AED B;  1V1O A;  4XDC A;  4YWG G;  3AEC B;  3W5U B;  2WXQ A;  4N59 A;  1J7B A;  2X38 A;  3MJ5 A;  2LJI A;  3BVM A;  2K5P A;  3P4S B;  3H8H A;  3O13 A;  3R2I A;  1L0X B;  2KDM A;  3KWL A;  1YQ4 B;  3AE4 B;  4A90 A;  2SAK A;  2VZK B;  3LYY A;  3OWE B;  3AN1 A;  4JX1 C;  4OZB A;  1ZDX A;  1XLP A;  1DYQ A;  2BW2 A;  2MJ3 A;  2V3N A;  1RFK A;  2MJE A;  1WXQ A;  1YN4 A;  2L32 A;  3ZQ4 A;  3AEB B;  2WXH A;  5H92 C;  1F2R C;  3URY A;  1T3Q A;  1SE3 A;  5H8Y E;  1WSP A;  3P4R B;  3NS1 A;  2Z8L A;  1V8C A;  5AUK A;  3TEW A;  1VZ6 A;  2LMC A;  1FXI A;  1UWX A;  1XO3 A;  2BYT A;  3TEZ A;  1YJJ A;  1NI3 A;  2J53 A;  1EM7 A;  1ENF A;  1JML A;  2J42 A;  4HRS A;  2WU2 B;  1E10 A;  4YSZ B;  2H89 B;  5I4D A;  2DYM A;  4MH8 A;  4WIP A;  1QOG A;  1Y56 A;  1KRH A;  1FO4 A;  4OZA A;  3TSS A;  1C77 A;  3IAM 1;  4XDD A;  3SEB A;  3T3N A;  3SFD B;  1ESF A;  1BXT A;  1QF6 A;  3EGR A;  2HDE A;  2EKI A;  2K3U A;  2AQ3 B;  3ZYY X;  2HTM E;  2WXJ A;  1C78 A;  4HEA 1;  4FXC A;  4CQN A;  1YQ3 B;  3NVV A;  4ZHP A;  1I4Q A;  1SIJ A;  1FNV A;  1PGA A;  1PGX A;  4XWW A;  1TS5 A;  1JWU D;  3NVW A;  1XCQ L;  1JWM D;  3CIR B;  1DOY A;  3VQI A;  1FM0 D;  5D3I B;  3I57 A;  3GB1 A;  2J52 A;  3NZ3 A;  4US8 A;  5BMI A;  3N9Y C;  1RWS A;  1JWS D;  4ZYS A;  3B9J A;  3P42 A;  2H88 B;  4US9 A;  3KWV A;  4TQ0 A;  2Y5C A;  1AW7 A;  2N9K A;  4WAF A;  1DOX A;  2G9H D;  1FNU A;  3U52 E;  4ZHO A;  2IDY A;  1IUE A;  4L2Y A;  4MT5 A;  1N5X A;  5GXG B;  3W5V B;  1D5X C;  1R7S A;  1KLG D;  4YTM B;  1I7H A;  1FXA A;  2M19 A;  2ONQ A;  4PT5 A;  2K22 A;  2DWQ A;  2AX5 A;  1WWT A;  1T5X D;  2QJL A;  2GRI A;  3AEA B;  1UWM A;  4NAM A;  3BK2 A;  4KKI A;  1DOI A;  2FE8 A;  1ET6 A;  1E7P B;  2JSV X;  4HRO A;  3V3X A;  3Q8B A;  2FBW B;  1JWB D;  1Q10 A;  3ZJT A;  1K51 A;  2GB1 A;  2W3S A;  1E6E B;  4NZL B;  4TQ1 A;  1IGD A;  3Q8F A;  1N62 A;  1PGB A;  3AE1 B;  3BWU D;  4WUR A;  4IOI E;  2WXN A;  2W82 A;  4AS1 A;  1N63 A;  1L6V A;  2M56 B;  2RDH A;  2JWU A;  1C76 A;  1FMA D;  4YSX B;  1CJE A;  3AEG B;  5BYS A;  1BUI C;  4GDL B;  4DXG A;  3CWI A;  1N61 A;  5T8I A;  2W54 A;  3BII D;  5D3D A;  2ZW0 A;  4KGS A;  1KLU D;  1XLQ A;  2V3P A;  1HZ6 A;  4C56 C;  2PLP A;  1L4Z B;  4O1N A;  3LXF A;  1C4P A;  1VR9 A;  4RGM A;  3BVG A;  3GP7 A;  1SJH D;  4P16 A;  4YTN B;  2NTS A;  2IGD A;  1UNS A;  2RDG A;  3E56 A;  2QIL A;  3PZ8 A;  4IKG A;  2YEP B;  2LHD A;  3P1M A;  1MHX A;  1V1P B;  2WXG A;  4RNA A;  1DGJ A;  1NEK B;  4RCO A;  2PW9 A;  4ZOH C;  5G5H A;  2WXL A;  1EWY C;  1OFF A;  1ZXI A;  1XEE A;  5AUI A;  2DLB A;  3IT6 B;  3IT4 B;  4KKJ A;  4L1B A;  1L5P A;  1QOF A;  1SF0 A;  1QKZ A;  1AYF A;  3BZD B;  4EE2 A;  4USA A;  2KAC A;  3P4P B;  5C2T B;  1M4V A;  2JYE A;  1FCL A;  1CQV A;  2N7J A;  4TMA B;  2BB6 A;  4LK0 M;  3BK1 A;  2MJD A;  5BMG A;  3AH7 A;  2WLB A;  4D2K A;  4NJC A;  2TSS A;  1OQR A;  2ZW1 A;  3PO0 A;  3HRD D;  1FNW A;  1HA5 A;  1E9M A;  1XF5 L;  2JU6 X;  4JPS A;  1D5Z C;  1IBX B;  1QOA A;  2JZP A;  2EEL A;  2WS3 B;  1TS4 A;  1TS3 A;  4YT0 B;  4YTP B;  4UDU C;  2QSD A;  3EA6 A;  4C7Z A;  1PUT A;  1BML C;  3R8B A;  3AE6 B;  2V0G A;  5EE3 A;  1YN5 A;  2BBC A;  2I38 A;  4REZ A;  2OED A;  2YEP F;  5C3J B;  2JX5 A;  2RMM A;  1VJK A;  1MI0 A;  2WDV B;  3Q8A A;  5D7G A;  3DWG C;  1CZP A;  2IGH A;  3J9C A;  4ARC A;  1I4R A;  1KH0 A;  4LTU A;  5BMH A;  2Y3A A;  4YXD B;  1ZUD 2;  1D5M C;  2WDR B;  2KWD A;  4XE0 A;  2LUM A;  5HG2 A;  2L83 A;  4A6Q A;  4ARI A;  3SR6 A;  3PZ7 A;  4RGO S;  4A55 A;  1RM6 C;  1C79 A;  1XLO A;  4ZRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...