1C76A

Staphylokinase (sak) monomer
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
121
structure length
121
Chain Sequence
SYFEPTGPYLMVNVTGVDGKGNELLSPHYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords STAPHYLOKINASE
publication title Crystal Structure of Staphylokinase Dimer Offers New Clue to Reduction of Immunogenicity
rcsb
source organism Staphylococcus aureus
total genus 23
structure length 121
sequence length 121
ec nomenclature ec 3.4.24.29: Aureolysin.
pdb deposition date 2000-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02821 Staphylokinase Staphylokinase/Streptokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.130 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1c76A00
1SSNA 1C78A 1C76A 2SAKA 1C77A 1BUIC 1C79A
chains in the Genus database with same CATH superfamily
4BVUC 2XEWA 2Y5PA 5LXHA 1VR9A 1QOBA 3ETRA 4RF0A 1FPYA 4NJ7A 2WXQA 4W9IA 2REXA 2LEKA 2CKHB 1H8CA 2WGSA 3RNCC 2RR9A 1XT9B 4GLSC 1EU3A 3MP9A 4GSWA 2Y3AA 1UWXA 4C7ZA 1PGBA 2WDTB 4P6VF 1ZPSA 2JUOA 5CTRC 3IHPC 2XK5B 1F77A 3GE3C 3I3TB 3ZDTA 2C9WB 2D5GA 1T0YA 2LGIA 2MP2A 3HM6X 4RM8A 1EWYC 4DBGA 3CF6E 1KLUD 3DVNU 3M3JA 2K9XA 4H2AA 1PQSA 2DLBA 2NBWB 4MACA 3DDCB 4YXDB 1D5ZC 2L76A 1RLFA 4C4VB 1YN5A 1EO6A 1L0YB 1SJHD 3AULA 5CX3A 2G4SA 4KZ0A 1A5RA 5D3DA 3KQ4A 2KYWA 3DPDA 1QOFA 2KC2A 3EFCA 5C23A 2ASQA 3BWUD 4GIVA 3ZVVA 4UDUC 2IO1B 1VLBA 4WWMA 5AZHA 1TT5B 4NAMA 1WIAA 4WJQA 2OHFA 3PREA 4K3CA 2KWCA 3V6EB 1FRRA 1RRBA 2KQ7A 1UUPA 4P1CC 1HXYD 3DWGC 1K51A 1XCTL 2JYTA 2CJOA 3U30A 4HKQA 4ASWC 4ZOHC 1ISNA 1Q5WB 3Q14C 4ZRJA 4HJGE 2BS4B 2BS3B 2ZVNA 1F1HA 2K5PA 3H1UA 4FA6A 3IAM1 4ZRQA 1FXIA 4TKNA 3BVZA 1EU4A 2GOWA 4WWPA 3AU5A 4ARCA 2KDMA 1J19A 1Q0WB 2BKRB 2JT4B 2QHOA 3R7RA 1WRIA 2D3AA 3RCZA 1M94A 3D32A 1AARA 4F7ZA 3L0WB 2R2OA 1FO4A 2MBBB 3APDA 1IUEA 3QWZB 1VDVA 1Z5SB 2RD0A 1JWUD 5DPWA 4K3BA 2AQ1B 2XBBC 2KFKA 3AEGB 3O65B 2NBUA 1RM6C 1D3ZA 1TYGB 4EFOA 1KRHA 3ZUNA 2AEHA 2NTTA 2XN9C 3APFA 1P1AA 3P2BA 3WIMA 3NVWA 2ZCCA 2YEPB 2PJHA 1ZXHA 2RMMA 2E3TA 2KC1A 4M02A 3QIJA 4B9KA 3MJWA 2KFJA 1E7PB 1JCKB 1QLBB 2WXLA 3RT3B 1FM0D 5LXIB 1XLQA 1TKGA 1WJNA 4JWUC 1FNWA 3Q3MC 2WU5B 4XDDA 1C9FA 3L10B 2N9LA 4IWOA 2BYFA 5EE3A 4FULA 3NVZA 3T3OA 1V81A 4HPMB 2J0MA 3AH7A 4G3XB 3SFDB 1L0VB 4J3OD 2IY0B 2WQYB 2O2VA 2KWVB 4WAFA 1ZW7A 4NY0A 3MHSD 3A4SC 3RD2A 1LGRA 5D3IB 1ET6A 3AE7B 3U7DA 3N30A 3AE3B 5CHVC 2ZPYA 2YEPF 4HLEA 4KV2A 2N7EA 4C56C 3R2TA 4LLGM 2W82A 5FR3A 1JWSD 3X0WA 2N4FA 3N32A 2WXOA 1OEYA 1I42A 3ZTDA 4WQOB 5TSSA 2KLGA 4KZCA 4W9CA 2DNFA 2WXGA 4BBNC 2CJNA 3A33B 3RZFA 3H7PB 4HWIB 2GBJA 1YQ3B 1EWCA 3VXWA 1VCBA 4EUTA 1M4VA 4FXCA 5JHAA 4ANWA 5HFYA 1CZPA 3PZDA 1SXTA 4OVVA 5EDSA 3BK2A 1PUTA 5BYRA 1MG4A 3DOWA 1P3QU 4MSQB 1L7YA 4USAA 3H7SA 1XQQA 2WDRB 3I63C 2MBOA 2MX2A 3QX1A 1MVKA 4MM3A 3UQAA 5T8IA 2JX5A 3MC9A 2N7DA 4ACFA 2HTME 3SR6A 4MDKE 2KN5A 2D2QA 1MJDA 3JVZX 3ZRCA 4IG7B 3ZLZA 1F2RC 3AI5A 1UBIA 4WH4A 3J9CA 1TKEA 1WR6E 3VTVA 2KN4A 3P4SB 1IYFA 3Q3JA 4MJSB 2GBKA 2M56B 1QF6A 3ABVB 4OVZA 3MJ5A 5C2TB 4XX5A 4ZHPA 1E8YA 1V5OA 4II2B 1TJEA 1WY8A 2IDYA 1UELA 2WXPA 3A9JA 1TS4A 4YTPB 3RUIB 1E5WA 4M0WB 3EGRA 2KJRA 1NI2A 1STEA 3VUWA 1WI0A 5BMGA 4ANVA 5G2NA 1IBXA 1E7VA 2BBCA 1GB4A 3QJZA 1TTNA 3VH4B 4YSXB 1P98A 2ZJDA 3PGEA 3TBLD 1WM3A 4HPPA 4GDKA 2K1FA 4O1NA 3RNEC 4EZLA 5GMVA 2MH7A 1YJIA 4I6PA 3U2SC 3URYA 1FNVA 2KXJA 4L23A 1I4GA 1YIWA 3L08A 4OZAA 2QSDA 3ZYYX 2QILA 4WJOA 2IO2B 2QJLA 3A4RA 3QARA 3A1QA 3JSVB 4W9HA 2UU7A 1P7EA 1JRUA 2JVCA 5G55A 2IY1B 2V4IB 4TUUA 1C77A 4NQLB 4HVBA 1UBQA 4QAYA 2GI9A 2BYEA 2W54A 2HTHA 4EEWA 4RGOS 4YSZB 2K22A 2BGFA 1EUVB 2KKCA 3V3XA 1YX5B 1ZOYB 2I38A 2C7NB 3ZRFA 2IGGA 3JW0X 4TV3A 2OJRA 1ZP0B 1K52A 1NDDA 4WQMA 1F52A 1T0RC 4E74A 1PYWD 1WE6A 2JXTA 1D6EC 3AECB 3TCAA 3DBRB 3RNFC 3KH0A 1S3SG 2QMTA 1E9MA 3QAQA 3O13A 4LNFA 2V3NA 5D6JB 4BFRA 5DPSA 2ZNVB 3AEEB 4EZJA 2H89B 3MTNB 2Q5WD 2K25A 3A9KB 3AMZA 4D2KA 4EOYA 4BKSA 2LXAA 4FJYA 3ZW3A 1R4NB 3DHIC 5J2RA 3Q3OC 3NHEB 1WFYA 3AE1B 4HKZE 3SHQA 3DVGY 3E9SA 1MG8A 3DVGX 2JSVX 4US9A 2X8XX 3EUB2 2CU3A 5KHOA 2LWPA 2LJIA 4RFBA 3ZXVA 4K7SA 4IM3A 4JE3B 3UINB 3M62B 4DDID 5H8YE 3OJ3A 3Q2AC 1YJJA 3LXFA 3B08A 4GGQA 1YNTE 5TR5A 2WXKA 1NVID 2WP9B 2WYQA 3Q8CA 1SEBD 1DOYA 2D3BA 4TMAB 3TIXA 1KH0A 5L83A 3NS8A 2WHIA 4A90A 2KZRA 3N1ZC 5HI1A 4YT0B 3KWLA 2IPKD 1KJTA 3PPAA 2K8HA 1XCQL 1KFYB 1K50A 5H92C 1L2NA 1C1YB 2W9NA 3DBLB 2ZEQA 5KHQA 1GNUA 3EHVA 1WGHA 3B2FA 3N3KB 2JU6X 4W9GA 3MC0B 3OAWA 5MPOA 2FCQA 4R3DA 4LJOB 5IN7A 3AXCA 1SJED 2KD0A 1BXTA 3BVGA 1D4BA 1OQQA 1FFVA 5FKAC 3RMKC 1P9DU 4YSYB 3ZIMA 1R4MI 2WS3B 3AE4B 1V49A 4US8A 1SBBB 4KDLB 4P7IA 2GB1A 4URKA 1F9JA 2LXCA 4ANXA 3HVZA 3PHXB 3BYTB 3DVNV 3VDZA 2M1MA 2LVOA 4K7WA 3I57A 2IBIB 4KSKC 1OFFA 3IFWB 1N62A 1SF0A 3KUCB 4I6LB 2DAFA 4HPLB 5G5GA 2LASA 2GRIA 2MQJA 3P42A 2NPTB 2IGHA 1N6ZA 4YTNB 1HA5A 1C4AA 3UIOB 4F1SA 4JX1C 1UF0A 3W5UB 2JWZA 2MJDA 5HHDG 4REZA 2HDEA 1TBEA 1ZDVA 3HIZA 3UI3A 1ZKHA 5J18A 1HZ5A 1RFKA 2N9KA 3ZNID 3VVWB 2D3CA 3T9LA 4K81A 3NOBA 2Z0EB 3LJ3A 1ZUD2 3SEBA 4C7YA 5JZEB 1E8ZA 3VFKA 3IT6B 2KNBA 4I6NB 2WXRA 2EELA 4B95A 3W1SA 2C7HA 3WALA 2N9XA 2EKEC 2CU1A 4WJPA 3QK0A 2CR5A 3Q8BA 4JL9A 4ZDVA 3KYDD 2FAZA 3DCGA 4ANUA 2K0PA 2KK8A 2KTFA 2KX3A 1YOVB 3NS1A 1NYQA 2KDBA 3ZQ4A 3AE9B 2Z59B 2KAJA 1UGJA 3UGBB 4HXDA 2CS4A 3ONSA 2PLPA 1TY0A 1UGMA 2J0JA 3GP7A 3CWIA 2JF5A 3GZNB 3AV8A 1SE9A 2QCZA 5G5HA 4DXFA 2PMVA 4FJZA 1V1PA 1PGAA 4WAAA 2N9PC 3WAOA 2BKFA 4G50A 4DQOC 1Z2MA 4KIKB 1LXDA 1QILA 3IBEA 1P7FA 2FCMA 2UYZB 2AX5A 5BYSA 2PPHA 5CHFA 2ZW1A 3FILB 5J17A 2BVCA 2IJ0A 4RGNA 2C60A 1WMHA 1RWSA 1YQ4B 4ICUA 3TEZA 2YVCA 3KUDB 3GS2A 3OG5A 2D11A 2B3AA 2DHZA 2MWSB 3PVLA 2LD9A 3AE8B 2O6VA 3QC8B 2RSUA 4JGHB 2INCC 1N60A 2L3ZA 3VH3B 5IAAC 3PLUA 1NBFC 5CHWA 1J8CA 1ET9A 3CMMB 4RM9A 5E6NA 2MBQA 2K3UA 1KTKA 1IGCA 2BTEA 3RYTA 2KQ4X 4FN2A 1TZ1A 5D7GA 2DZMA 1KOTA 1WGGA 3B0AA 2W3RA 3VTUA 2IO0B 2JZPA 2OJWA 3Q3NC 3AN1A 3ML9A 2X38A 2KQSA 1NYRA 2K6QA 3ZNGC 3TSSA 1XEEA 2OEDA 5C1ZA 4J6IA 1L6VA 3L16A 1FNUA 3IVFA 2FCSA 1HE8A 2QC8A 2Y5CA 3W1YA 2J4XA 2NMQA 1MPEA 2M4NA 2ZCBA 3EA6A 3KWVA 2QIEB 1WF9A 2PE6B 1FIQA 2RDGA 1QKZA 4IUMB 5LLIA 1L4ZB 4KVGB 3WANA 5JXVA 2LVQA 2ONQA 3P1MA 4FLHA 4XDCA 2LGXA 1OEYJ 4GDLA 3DBHB 1Y8RC 3GE8C 5C3JB 2C7MB 2SAKA 4ZHOA 1BT0A 3W1SC 3EECA 4NJCA 5DCNA 3BY4B 2N7JA 4GOCA 3CSFA 2C5LC 4KX6B 2LJ5A 4RGMA 1FMAD 3RN9C 2M17A 4AOFA 3HHMA 1J7AA 1V97A 1ZXIA 3S2AA 2NBVB 3AE5B 3I5JC 1YX6B 1FRDA 4W9DA 2JPHA 3RNAC 1UZXB 3L54A 3X23A 3I9V1 1YQBA 3PRZA 1ZE3D 4OZCA 3VUYA 4BKTA 3LDZE 1T0QC 3Q8EA 2VH1A 4MGZE 4PYZA 1BUIC 1T5XD 4AS1A 2L0FA 4LCDE 4ZRKA 1RFAA 4RMAA 4II3B 2WXNA 5BYQA 2ZVOA 4B6WA 1ZDXA 5LNK1 2GBMA 3DWMA 1F0ZA 2K8CA 2XK5A 4JQWC 4ZRIA 3ZNHB 1XLPA 3ZJVA 4ZRPA 3HK0A 1WGKA 1KLGD 2KHWB 2MP2B 5BMIA 3L17A 1N61A 4DHJB 1WXAA 1WXMA 2BB6A 2LMCA 1C76A 1LQBA 3PRMB 1I7HA 5EE0A 2G3QB 1GUAB 4IM2A 2LFIA 4C4VA 2NVUI 3NRZA 4JLCA 1L0XB 4A55A 1RYJA 2KDIA 1U4AA 2KMAA 2AL6A 1E8WA 3ZJTA 2VZKB 1HEZE 4E3CA 1TS5A 3T8MA 1MHHE 1GC7A 4DHJD 4IC7B 4AP4C 2J52A 3IT4B 4OVUA 3M95A 5D2MB 1Q10A 3WAMA 2CHWA 4KSLC 2J7QB 3U52E 3VRAB 4WWOA 1XO3A 2KTRA 3GB1A 2EMSA 4EKUA 1MI0A 3CIRB 1L5PA 2JQRB 1NEKB 1P0RA 3IXSA 2INNE 2ICIA 1C79A 2KMCA 2KVRA 2VZKD 1N63A 4F8CB 3KVFB 2BYVE 2WWZA 1HTOA 3RZWC 3NVVA 4CO7A 3U8ZA 5AUIA 2L52A 3N9YC 3AEFB 1ROEA 4KGSA 4OW0A 4M8NA 3V6CB 4XE0A 2PVOD 3QHTA 1PGXA 1YD8U 4A8XC 3LB8C 4JPSA 2L0TA 4N6EB 2HD5B 3MC8A 4GN1A 2RDBC 2FUG1 2JZZA 2J53A 5DPRA 3VAWA 1CMXB 2M0AA 1GOZA 4RCOA 2N0SB 2I2YA 1JQ4A 1WM2A 1JROA 2A5UA 1XF5L 2MSED 4IWPA 4BOZB 5AUKA 3KW5B 3R66C 3PT2B 2LGSA 4YL8A 3QA8A 4C80A 4B0EA 4WJNA 1UH6A 1VRAB 2RPVA 4EZKA 4A6QA 2FBWB 3N20C 4BBNF 2L32A 1WMHB 2PEAA 3TL5A 2PIAA 2KFKB 3OLMD 2LI5A 4M00A 4XYCA 2DENB 4IOIE 1SSNA 1T6BX 3ML8A 2ZZPB 2L7RA 2MCNB 2V3PA 3DBRI 3PHWB 3UF8A 3QCAA 4PT5A 4XC2A 4TQ0A 4GMVA 5IOIA 1SB3C 1SE4A 3UQBA 3NG0A 3HUIA 2RDHA 2IYDB 2BPSA 1I4RA 3VTWA 2WXIA 4RF1A 2DWQA 2MEKA 1WX7A 1WZ3A 2GBRA 1GG3A 3ECIA 3L4PA 1UD7A 5FK9C 1R4NI 3P63A 3RFZB 3VRBB 4FHKA 1WR1A 3B9JA 1T0SC 1GAQB 3HVDA 2G9HD 2AQ2B 1AWDA 2TSSA 1C78A 1WGDA 3B1LX 1NENB 2O2VB 1GPXA 2BQQA 3K9PB 1VZ6A 1C4CA 3FKYA 3VR9B 3ZNZB 4LNOA 4NQKE 1V2YA 2HE7A 2BB5A 2LRUA 1J7CA 1YN3A 1RAXA 4IKGA 4W9EA 2WXMA 1DGJA 1H4RA 4C00A 3V61A 2KDEB 1HTQA 4DXAB 2JYEA 1WGYA 4M01A 2DAJA 3Q8FA 4JWSC 1X1MA 3DBLI 3CSTA 2JXXA 4NAWA 5JHBA 1I35A 2JRHA 3NZ3A 3AE2B 2W3SA 3ZXRA 3TEXA 4HK2A 1E6EB 4ZYSA 1EF1A 1WXVA 2VH2A 2BYTA 5BO4B 3BINA 2MA9B 4FBJB 2WX1A 1VD2A 4NNJB 2WXFA 3C8YA 4ARIA 4OHJA 2B76B 3OJ4B 1G6JA 1IGDA 2LUMA 2RGFA 2WNMA 3W2DA 3C0RB 3Q6BA 3GOEA 4IM0A 5DPTA 2WDQB 2ZW0A 2N1VA 2I1JA 3H9DA 4MM3B 5IA7A 4XZ4A 3BYYB 3HRDD 3N1YC 2WDVB 4LK0M 3V62A 2MBEA 2KX0A 2KOXA 2OOBB 5L95C 4WIPA 5IO9A 2PKOA 4ITKA 3W9CB 1QZEA 2MJEA 4MJSA 1CK1A 2D3GA 1PDXA 2Y5BB 1GJZA 3PO0A 1ZGUB 2PW9A 3ZJUA 1ENFA 1K8RB 4M8MA 1D5XC 1HQRD 3A9JB 1V9JA 2KT7A 3PSEB 4HCPB 1GB1A 4M0WA 2INDC 2V3SA 3WA0A 1FD6A 1D5MC 1I4PA 4EE2A 4RNAA 4NJ6A 3P4RB 3EFUA 2AL3A 2KTRB 4FHJA 1IBXB 1WYWB 1E0ZA 4JIOU 3MHZA 2K8BA 2MW5A 2KLCA 3AEDB 1E10A 4PS3A 1SE2A 4GDKB 3RNGC 2FUHB 1XD3B 1E7UA 1MFWA 4MGIE 4B0MA 3H8HA 2EKIA 4MH8A 1EF5A 1JMLA 4P16A 4BOSC 4MH0E 3QQ8B 4OZBA 3U7ZA 1VJKA 4A3OA 2KANA 4KKIA 1WZ0A 1AN8A 2K39A 2MLBA 3HM3A 4LNKA 3JSVA 2VRRB 2IZVB 3AEAB 3A1QB 1DOIA 2DX5B 2NR2A 1C4PA 1R7SA 2Z8LA 1JRPA 1TS2A 3DQVA 3H6NA 4N58A 3V05A 2M19A 3GZNI 4L2YA 2CHXA 1CQVA 2G4DB 2KACA 3BVMA 4MSMB 1XLOA 3DBSA 4HJKA 4XWWA 2L05A 1FCCC 4HRSA 4PS8A 1WXSA 1A70A 4LNNA 3TEWA 1S1QB 2FCNA 3OWEB 4KGRA 3JYUA 1AW7A 3W5VB 4K1RB 4GXBA 2PVGC 4W9JA 2BS2B 3U4EG 2FNJB 4MEMA 2G1EA 1TS3A 3ZO5B 4DK5A 4WWNA 2W55A 4W9LA 3ZTCA 3Q3FA 1WX9A 1ACCA 2N1WA 3BIID 1TGZB 4KKJA 2FIDA 2WLBA 1TZOA 3A9KA 4PYUA 4A9AA 2HJ1A 4G0NB 5HKHA 1FXAA 2IO3B 3ALBA 2LVPA 4IW0A 1WE7A 1JWAD 1UNSA 2D10A 5I4DA 2V4LA 1FCLA 4MGKE 3WCQA 2L8JA 4GB9A 3BZDB 2DZJA 2ZPNA 1OQRA 2PE9A 3ZGZA 2QDFA 3IG3A 1KF6B 4BKSD 3WAPA 2RPQA 1GC6A 4CYEA 2LGYA 4XWTA 1KM7A 1DYQA 2GLSA 2L00B 3NJTA 4DWFA 4AWJA 5E6JA 4MT5A 3VUXA 5FR6A 2D07B 1I4QA 2WXJA 2LRWA 3DBHI 2NTSA 1JW9D 2KWDA 4CHKA 4AQ7A 2V1YA 5BMHA 2CHZA 1LM8B 3APCA 1SE3A 2EMTA 2XNAC 3LYYA 3SDLC 1V5TA 2FE8A 4RGTA 1TIFA 3AE6B 4Q2JA 1OGWA 4NAWB 1V8CA 5JH5C 3PTFC 1T3QA 4DXGA 2QEJC 2LHEA 2ON8A 2MRPA 4ZYNA 4HDOA 1WJUA 3KLSX 2JY6A 1XXGA 3V60A 1J7BA 1WXQA 2FIFA 1UWMA 1EM7A 5D94A 2DYBA 1IP9A 2KWUB 1TY2A 4S0RA 5AEKB 4P1BC 4ICVA 1KLVA 4L1BA 2J42A 3PV1A 4E71A 1B1ZA 3RPFC 1QOGA 4YWGG 4WURA 5GXGB 2LZ6A 2NS5A 2R61A 1HZ6A 2NPTA 3FAHA 2KJ6A 1V1OA 2J0KA 1WX8A 4AJYB 3NVYA 2V9HA 5E6PA 3TMPB 2BWFA 3SFEB 3SU8X 2GMIC 3FC4A 2N9EB 2MHJA 4YTMB 1XLNA 1FEHA 1FXTB 4N59A 1WJ4A 1SIFA 4LTUA 1WRDB 4AJWA 2JZ3B 5E6OA 3R7QA 4X57B 4DHZB 1BMLC 2ZNVC 1YN4A 2KDFB 2V0GA 4KDIC 3AB5A 2LGDA 3ENEA 2DYMA 3KYCD 4A3PA 1IPGA 1JWBD 3KUZA 5IP4D 3E56A 2DYOA 4BKGA 2SEBD 1C3TA 1V86A 2Z0DB 2M0XA 4BZAA 3UIPB 4DDGD 1NI3A 2M8SA 3R8BA 4RH6A 4S17A 3TUOA 3PZ7A 3P4QB 4N9F4 1DOXA 2BW2A 1V6EA 3L13A 3ZKJC 1LFDA 3NY5A 2L1AA 2AQ3B 4HROA 1I4HA 3VHTC 1CJEA 1E8XA 3N1XC 2BF8B 3K9OB 1N5XA 3P4PB 5EE9A 3EC8A 1Y56A 1QT9A 2G45B 1J0GA 2A4ZA 2BT6A 4LNIA 1ESFA 4W9FA 4KGTA 5IKCM 1V1PB 4KIKA 1K53A 4G11A 5AZGA 3Q69A 3Q8AA 2YLMA 4MGYE 3BK1A 1E90A 3R2IA 1WSPA 4LDTB 3FILA 4HEA1 1AYFA 5AZFA 2DBYA 1VZ7A 3NZSA 2KVZA 4TSSA 4XGAB 3RI7C 4NZLB 1VZ8A 1WH3A 2DZKA 3PZ8A 2JWUA 3AM9A 1F2RI 1OQYA 2E6XA 4FJVB 4BAXA 2UWQA 1MHXA 2O6VB 4LDTD 3AU4A 1QOAA 1LO5D 4W9KA 3T3NA 3M63B 3ZDMC 4GU2A 3IAS1 4AUQC 1WGRA 3PRPB 3TEYA 4MELA 1JWMD 4NPNA 1N5WA 2LHDA 1TKYA 4PK1A 1SGHA 1QQRA 2H88B 2BWES 2JRIB 2O6VD 2K6DB 3C19A 1Q1OA 2AWTA 3PS6A 3MFGA 4CQNA 1B9RA 2GBNA 4FADA 2WXHA 3AEBB 4IDIA 1SIJA 4HDQA 3PLVA 2R2QA 3SD5A 2HJ8A 1I4XA 1FFUA 4K7UA 2MJ3A 2LUEA 3RNBC 3DHGC 1YJ1A 3B2GA 2PTLA 2ACZB 3DHHC 2MBHA 2DZIA 2KJHB 4HCNB 2NCNA 2KO3A 2WX0A 4TQ1A 4DHZE 1WJ6A 1WYGA 3R3MA 3VR8B 1V80A 4GDLB 1L6UA 5HG2A 3TJPA 3NUHB 1L4DB 3NZUA 2L83A 1JALA 4IWQA 3VQIA 4A20A 5EE1A 2KMMA 3H7PA 1PFDA 2INPE 2I1KA 3RULA 4PS7A 4LJPB 1YMHE 1WWTA 2WU2B 1R4MB 2AYOB 1OTRB 2IGDA
chains in the Genus database with same CATH topology
1ZE3D 2Y5PA 2KACA 3BVMA 2GI9A 4OZCA 2W54A 1XLOA 4RGOS 4YSZB 1VR9A 1QOBA 3ETRA 4RF0A 2K22A 2WXQA 4XWWA 1FCCC 3Q8EA 4HRSA 1BUIC 1T5XD 2LEKA 3V3XA 4AS1A 1ZOYB 2I38A 1A70A 3TEWA 2IGGA 3OWEB 4KGRA 4GLSC 1EU3A 3MP9A 1ZP0B 1K52A 2Y3AA 1UWXA 2WXNA 1AW7A 4WQMA 3W5VB 4C7ZA 5BYQA 1PGBA 1ZDXA 2PVGC 5LNK1 2BS2B 3U4EG 1PYWD 4P6VF 1ZPSA 2JXTA 3DWMA 1F0ZA 2G1EA 1D6EC 1TS3A 1F77A 3AECB 1XLPA 3ZJVA 4ZRPA 2D5GA 2QMTA 1WGKA 1E9MA 2LGIA 1KLGD 1EWYC 2W55A 3O13A 2V3NA 1KLUD 5BMIA 2K9XA 1N61A 4H2AA 1ACCA 2DLBA 3BIID 2BB6A 3AEEB 4KKJA 2H89B 2LMCA 4MACA 2WLBA 1C76A 2Q5WD 1TZOA 1I7HA 4YXDB 3AMZA 4A9AA 1D5ZC 5EE0A 4D2KA 2LFIA 1YN5A 1FXAA 3NRZA 1L0XB 4A55A 1L0YB 1RYJA 1SJHD 3AE1B 4HKZE 3E9SA 3ZJTA 2VZKB 1HEZE 5D3DA 2JSVX 3KQ4A 1TS5A 4US9A 3EUB2 2CU3A 1JWAD 1MHHE 1QOFA 1UNSA 2LJIA 2J52A 3IT4B 5I4DA 4RFBA 1FCLA 3BWUD 3WCQA 1Q10A 3BZDB 4UDUC 1OQRA 4JE3B 3U52E 3VRAB 3ZGZA 1VLBA 1XO3A 4WWMA 3GB1A 5H8YE 1KF6B 1MI0A 4NAMA 3CIRB 1YJJA 2OHFA 3LXFA 1L5PA 2JQRB 1NEKB 3IXSA 4XWTA 2INNE 1YNTE 2ICIA 2WXKA 1NVID 1DYQA 2WP9B 3Q8CA 1C79A 2VZKD 1N63A 1SEBD 1DOYA 4TMAB 1FRRA 1KH0A 4A90A 1UUPA 3NVVA 5E6JA 5HI1A 4YT0B 4MT5A 1HXYD 3DWGC 3KWLA 2IPKD 1K51A 1XCTL 2JYTA 5AUIA 1XCQL 1KFYB 1I4QA 2CJOA 2WXJA 2L52A 4HKQA 3N9YC 1K50A 3AEFB 2NTSA 4ZOHC 5H92C 1JW9D 2KWDA 1ROEA 4KGSA 4AQ7A 4OW0A 5BMHA 4XE0A 3B2FA 4HJGE 2PVOD 2JU6X 2BS4B 2BS3B 1PGXA 3MC0B 1SE3A 5MPOA 4R3DA 2XNAC 3LYYA 2K5PA 3LB8C 4A8XC 4JPSA 3IAM1 2FE8A 4ZRQA 1FXIA 4RGTA 4N6EB 1SJED 3AE6B 4Q2JA 3BVZA 1EU4A 4NAWB 1BXTA 1V8CA 3BVGA 1D4BA 1T3QA 1OQQA 4DXGA 1FFVA 2FUG1 2J53A 2QEJC 2LHEA 5FKAC 2ON8A 2KDMA 4ARCA 4YSYB 2M0AA 2WS3B 3KLSX 3AE4B 1GOZA 4RCOA 2N0SB 2I2YA 4US8A 1WRIA 1JQ4A 1SBBB 1JROA 2GB1A 1XXGA 1XF5L 1J7BA 3HVZA 5AUKA 1WXQA 4C80A 4B0EA 1FO4A 3BYTB 1UWMA 1IUEA 1VRAB 1EM7A 1VDVA 2RPVA 1JWUD 4A6QA 2FBWB 1TY2A 3I57A 2L32A 1OFFA 2AQ1B 1N62A 3AEGB 4L1BA 2PIAA 2J42A 1RM6C 1SF0A 1TYGB 1KRHA 1B1ZA 5G5GA 3RPFC 1QOGA 4YWGG 4IOIE 2NTTA 4WURA 5GXGB 2XN9C 2GRIA 2R61A 1HZ6A 1SSNA 1T6BX 3P42A 2IGHA 3FAHA 3NVWA 1V1OA 2YEPB 2V3PA 4YTNB 1HA5A 1ZXHA 2RMMA 2E3TA 3NVYA 4PT5A 1C4AA 4TQ0A 4JX1C 1SB3C 3W5UB 1SE4A 2MJDA 3SFEB 5HHDG 4REZA 2HDEA 2RDHA 3HUIA 1ZDVA 1I4RA 3FC4A 2WXIA 1E7PB 3UI3A 4RF1A 2DWQA 1JCKB 1QLBB 4YTMB 1HZ5A 1RFKA 2MEKA 1XLNA 2N9KA 1FM0D 1FEHA 2WXLA 1XLQA 1TKGA 4N59A 4JWUC 1FNWA 3L4PA 4LTUA 2WU5B 5FK9C 4XDDA 1C9FA 3P63A 3RFZB 3VRBB 1ZUD2 2N9LA 3SEBA 1BMLC 3B9JA 4C7YA 1YN4A 2V0GA 5EE3A 3AB5A 3NVZA 1GAQB 3T3OA 2DYMA 3AH7A 3HVDA 1JWBD 2AQ2B 2G9HD 3IT6B 3SFDB 1L0VB 4J3OD 1AWDA 2TSSA 1C78A 2WQYB 2WXRA 2EELA 3E56A 4WAFA 3W1SA 1NENB 1GPXA 2DYOA 2SEBD 1VZ6A 1C4CA 3VR9B 5D3IB 1ET6A 3AE7B 1NI3A 3R8BA 4RH6A 3Q8BA 3TUOA 3AE3B 3PZ7A 2BB5A 2YEPF 3P4QB 1J7CA 1DOXA 1YN3A 2BW2A 4C56C 4IKGA 3R2TA 4LLGM 2W82A 2K0PA 2WXMA 5FR3A 1DGJA 1JWSD 2L1AA 2AQ3B 4HROA 1I4HA 1CJEA 2WXOA 2JYEA 1NYQA 3NS1A 1N5XA 3ZQ4A 3P4PB 3Q8FA 4JWSC 5EE9A 3AE9B 5TSSA 1Y56A 2KAJA 1UGJA 1QT9A 3NZ3A 2WXGA 2CJNA 3AE2B 2BT6A 2W3SA 2PLPA 1YQ3B 1TY0A 3TEXA 1EWCA 3GP7A 1E6EB 3CWIA 1ESFA 4ZYSA 1M4VA 3AV8A 4FXCA 5G5HA 4DXFA 2PMVA 4KGTA 1V1PA 1PGAA 5HFYA 1CZPA 1V1PB 1SXTA 1K53A 2BYTA 4DQOC 3Q69A 3Q8AA 1QILA 3BK1A 1P7FA 3R2IA 3BK2A 1WSPA 1PUTA 2AX5A 5BYSA 5BYRA 3FILA 2WXFA 3C8YA 2ZW1A 4HEA1 4ARIA 3FILB 1AYFA 4USAA 4OHJA 2B76B 2DBYA 1IGDA 2IJ0A 2LUMA 2WNMA 4RGNA 1VZ7A 2WDRB 3W2DA 4TSSA 1RWSA 4NZLB 2WDQB 1VZ8A 1YQ4B 2ZW0A 1MVKA 3TEZA 3PZ8A 4MM3B 5T8IA 2JX5A 2JWUA 3GS2A 3AM9A 1F2RI 2E6XA 3BYYB 3AE8B 3HRDD 1MHXA 2WDVB 4LK0M 1QOAA 2HTME 1N60A 1LO5D 3SR6A 3T3NA 1ET9A 4WIPA 2K3UA 1F2RC 3IAS1 1KTKA 2PKOA 1IGCA 3TEYA 4ITKA 2BTEA 4WH4A 3J9CA 1TKEA 2KQ4X 3W9CB 2KN4A 3P4SB 5D7GA 2MJEA 1JWMD 1N5WA 2M56B 2LHDA 2W3RA 1CK1A 1TKYA 1QF6A 1PDXA 1QQRA 2H88B 2JZPA 3ABVB 4OVZA 3MJ5A 3AN1A 5C2TB 2X38A 1NYRA 3PO0A 4ZHPA 3MFGA 3TSSA 4CQNA 1XEEA 1B9RA 2OEDA 2PW9A 2WXHA 1TJEA 1ENFA 3ZJUA 1L6VA 3AEBB 2IDYA 1D5XC 4IDIA 2WXPA 1SIJA 1HQRD 1TS4A 1FNUA 4YTPB 2Y5CA 1GB1A 1I4XA 4M0WA 2J4XA 2NMQA 1FD6A 1FFUA 1D5MC 1MPEA 3EA6A 3KWVA 2QIEB 2MJ3A 1I4PA 3EGRA 4EE2A 1STEA 1FIQA 2RDGA 4RNAA 1QKZA 3B2GA 2PTLA 5BMGA 2ACZB 3P4RB 1L4ZB 1IBXA 1GB4A 2BBCA 1IBXB 5JXVA 1E0ZA 4TQ1A 3MHZA 1WYGA 4YSXB 2ONQA 3P1MA 4XDCA 3AEDB 3VR8B 1E10A 4GDLB 5C3JB 1L6UA 4O1NA 5HG2A 1SE2A 2SAKA 4GDKB 4ZHOA 3NUHB 4B0MA 4NJCA 2MH7A 1L4DB 2EKIA 3H8HA 1YJIA 3U2SC 2N7JA 3URYA 2L83A 1JALA 1FNVA 1JMLA 4KX6B 4MH8A 4P16A 4L23A 4RGMA 1FMAD 5EE1A 3VQIA 2KMMA 4OZBA 1I4GA 1J7AA 1PFDA 1V97A 2INPE 3U7ZA 1ZXIA 1VJKA 4OZAA 2QSDA 4KKIA 3ZYYX 2QILA 1AN8A 2QJLA 3AE5B 3AEAB 1YMHE 1FRDA 1DOIA 1P7EA 1WWTA 2WU2B 1C4PA 1R7SA 2Z8LA 2V4IB 1JRPA 1TS2A 3I9V1 4N58A 3V05A 2M19A 1C77A 4L2YA 2IGDA 1CQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SSN A;  1C78 A;  1C76 A;  2SAK A;  1C77 A;  1BUI C;  1C79 A; 
#chains in the Genus database with same CATH topology
 4BVU C;  2XEW A;  2Y5P A;  5LXH A;  1VR9 A;  1QOB A;  3ETR A;  4RF0 A;  1FPY A;  4NJ7 A;  2WXQ A;  4W9I A;  2REX A;  2LEK A;  2CKH B;  1H8C A;  2WGS A;  3RNC C;  2RR9 A;  1XT9 B;  4GLS C;  1EU3 A;  3MP9 A;  4GSW A;  2Y3A A;  1UWX A;  4C7Z A;  1PGB A;  2WDT B;  4P6V F;  1ZPS A;  2JUO A;  5CTR C;  3IHP C;  2XK5 B;  1F77 A;  3GE3 C;  3I3T B;  3ZDT A;  2C9W B;  2D5G A;  1T0Y A;  2LGI A;  2MP2 A;  3HM6 X;  4RM8 A;  1EWY C;  4DBG A;  3CF6 E;  1KLU D;  3DVN U;  3M3J A;  2K9X A;  4H2A A;  1PQS A;  2DLB A;  2NBW B;  4MAC A;  3DDC B;  4YXD B;  1D5Z C;  2L76 A;  1RLF A;  4C4V B;  1YN5 A;  1EO6 A;  1L0Y B;  1SJH D;  3AUL A;  5CX3 A;  2G4S A;  4KZ0 A;  1A5R A;  5D3D A;  3KQ4 A;  2KYW A;  3DPD A;  1QOF A;  2KC2 A;  3EFC A;  5C23 A;  2ASQ A;  3BWU D;  4GIV A;  3ZVV A;  4UDU C;  2IO1 B;  1VLB A;  4WWM A;  5AZH A;  1TT5 B;  4NAM A;  1WIA A;  4WJQ A;  2OHF A;  3PRE A;  4K3C A;  2KWC A;  3V6E B;  1FRR A;  1RRB A;  2KQ7 A;  1UUP A;  4P1C C;  1HXY D;  3DWG C;  1K51 A;  1XCT L;  2JYT A;  2CJO A;  3U30 A;  4HKQ A;  4ASW C;  4ZOH C;  1ISN A;  1Q5W B;  3Q14 C;  4ZRJ A;  4HJG E;  2BS4 B;  2BS3 B;  2ZVN A;  1F1H A;  2K5P A;  3H1U A;  4FA6 A;  3IAM 1;  4ZRQ A;  1FXI A;  4TKN A;  3BVZ A;  1EU4 A;  2GOW A;  4WWP A;  3AU5 A;  4ARC A;  2KDM A;  1J19 A;  1Q0W B;  2BKR B;  2JT4 B;  2QHO A;  3R7R A;  1WRI A;  2D3A A;  3RCZ A;  1M94 A;  3D32 A;  1AAR A;  4F7Z A;  3L0W B;  2R2O A;  1FO4 A;  2MBB B;  3APD A;  1IUE A;  3QWZ B;  1VDV A;  1Z5S B;  2RD0 A;  1JWU D;  5DPW A;  4K3B A;  2AQ1 B;  2XBB C;  2KFK A;  3AEG B;  3O65 B;  2NBU A;  1RM6 C;  1D3Z A;  1TYG B;  4EFO A;  1KRH A;  3ZUN A;  2AEH A;  2NTT A;  2XN9 C;  3APF A;  1P1A A;  3P2B A;  3WIM A;  3NVW A;  2ZCC A;  2YEP B;  2PJH A;  1ZXH A;  2RMM A;  2E3T A;  2KC1 A;  4M02 A;  3QIJ A;  4B9K A;  3MJW A;  2KFJ A;  1E7P B;  1JCK B;  1QLB B;  2WXL A;  3RT3 B;  1FM0 D;  5LXI B;  1XLQ A;  1TKG A;  1WJN A;  4JWU C;  1FNW A;  3Q3M C;  2WU5 B;  4XDD A;  1C9F A;  3L10 B;  2N9L A;  4IWO A;  2BYF A;  5EE3 A;  4FUL A;  3NVZ A;  3T3O A;  1V81 A;  4HPM B;  2J0M A;  3AH7 A;  4G3X B;  3SFD B;  1L0V B;  4J3O D;  2IY0 B;  2WQY B;  2O2V A;  2KWV B;  4WAF A;  1ZW7 A;  4NY0 A;  3MHS D;  3A4S C;  3RD2 A;  1LGR A;  5D3I B;  1ET6 A;  3AE7 B;  3U7D A;  3N30 A;  3AE3 B;  5CHV C;  2ZPY A;  2YEP F;  4HLE A;  4KV2 A;  2N7E A;  4C56 C;  3R2T A;  4LLG M;  2W82 A;  5FR3 A;  1JWS D;  3X0W A;  2N4F A;  3N32 A;  2WXO A;  1OEY A;  1I42 A;  3ZTD A;  4WQO B;  5TSS A;  2KLG A;  4KZC A;  4W9C A;  2DNF A;  2WXG A;  4BBN C;  2CJN A;  3A33 B;  3RZF A;  3H7P B;  4HWI B;  2GBJ A;  1YQ3 B;  1EWC A;  3VXW A;  1VCB A;  4EUT A;  1M4V A;  4FXC A;  5JHA A;  4ANW A;  5HFY A;  1CZP A;  3PZD A;  1SXT A;  4OVV A;  5EDS A;  3BK2 A;  1PUT A;  5BYR A;  1MG4 A;  3DOW A;  1P3Q U;  4MSQ B;  1L7Y A;  4USA A;  3H7S A;  1XQQ A;  2WDR B;  3I63 C;  2MBO A;  2MX2 A;  3QX1 A;  1MVK A;  4MM3 A;  3UQA A;  5T8I A;  2JX5 A;  3MC9 A;  2N7D A;  4ACF A;  2HTM E;  3SR6 A;  4MDK E;  2KN5 A;  2D2Q A;  1MJD A;  3JVZ X;  3ZRC A;  4IG7 B;  3ZLZ A;  1F2R C;  3AI5 A;  1UBI A;  4WH4 A;  3J9C A;  1TKE A;  1WR6 E;  3VTV A;  2KN4 A;  3P4S B;  1IYF A;  3Q3J A;  4MJS B;  2GBK A;  2M56 B;  1QF6 A;  3ABV B;  4OVZ A;  3MJ5 A;  5C2T B;  4XX5 A;  4ZHP A;  1E8Y A;  1V5O A;  4II2 B;  1TJE A;  1WY8 A;  2IDY A;  1UEL A;  2WXP A;  3A9J A;  1TS4 A;  4YTP B;  3RUI B;  1E5W A;  4M0W B;  3EGR A;  2KJR A;  1NI2 A;  1STE A;  3VUW A;  1WI0 A;  5BMG A;  4ANV A;  5G2N A;  1IBX A;  1E7V A;  2BBC A;  1GB4 A;  3QJZ A;  1TTN A;  3VH4 B;  4YSX B;  1P98 A;  2ZJD A;  3PGE A;  3TBL D;  1WM3 A;  4HPP A;  4GDK A;  2K1F A;  4O1N A;  3RNE C;  4EZL A;  5GMV A;  2MH7 A;  1YJI A;  4I6P A;  3U2S C;  3URY A;  1FNV A;  2KXJ A;  4L23 A;  1I4G A;  1YIW A;  3L08 A;  4OZA A;  2QSD A;  3ZYY X;  2QIL A;  4WJO A;  2IO2 B;  2QJL A;  3A4R A;  3QAR A;  3A1Q A;  3JSV B;  4W9H A;  2UU7 A;  1P7E A;  1JRU A;  2JVC A;  5G55 A;  2IY1 B;  2V4I B;  4TUU A;  1C77 A;  4NQL B;  4HVB A;  1UBQ A;  4QAY A;  2GI9 A;  2BYE A;  2W54 A;  2HTH A;  4EEW A;  4RGO S;  4YSZ B;  2K22 A;  2BGF A;  1EUV B;  2KKC A;  3V3X A;  1YX5 B;  1ZOY B;  2I38 A;  2C7N B;  3ZRF A;  2IGG A;  3JW0 X;  4TV3 A;  2OJR A;  1ZP0 B;  1K52 A;  1NDD A;  4WQM A;  1F52 A;  1T0R C;  4E74 A;  1PYW D;  1WE6 A;  2JXT A;  1D6E C;  3AEC B;  3TCA A;  3DBR B;  3RNF C;  3KH0 A;  1S3S G;  2QMT A;  1E9M A;  3QAQ A;  3O13 A;  4LNF A;  2V3N A;  5D6J B;  4BFR A;  5DPS A;  2ZNV B;  3AEE B;  4EZJ A;  2H89 B;  3MTN B;  2Q5W D;  2K25 A;  3A9K B;  3AMZ A;  4D2K A;  4EOY A;  4BKS A;  2LXA A;  4FJY A;  3ZW3 A;  1R4N B;  3DHI C;  5J2R A;  3Q3O C;  3NHE B;  1WFY A;  3AE1 B;  4HKZ E;  3SHQ A;  3DVG Y;  3E9S A;  1MG8 A;  3DVG X;  2JSV X;  4US9 A;  2X8X X;  3EUB 2;  2CU3 A;  5KHO A;  2LWP A;  2LJI A;  4RFB A;  3ZXV A;  4K7S A;  4IM3 A;  4JE3 B;  3UIN B;  3M62 B;  4DDI D;  5H8Y E;  3OJ3 A;  3Q2A C;  1YJJ A;  3LXF A;  3B08 A;  4GGQ A;  1YNT E;  5TR5 A;  2WXK A;  1NVI D;  2WP9 B;  2WYQ A;  3Q8C A;  1SEB D;  1DOY A;  2D3B A;  4TMA B;  3TIX A;  1KH0 A;  5L83 A;  3NS8 A;  2WHI A;  4A90 A;  2KZR A;  3N1Z C;  5HI1 A;  4YT0 B;  3KWL A;  2IPK D;  1KJT A;  3PPA A;  2K8H A;  1XCQ L;  1KFY B;  1K50 A;  5H92 C;  1L2N A;  1C1Y B;  2W9N A;  3DBL B;  2ZEQ A;  5KHQ A;  1GNU A;  3EHV A;  1WGH A;  3B2F A;  3N3K B;  2JU6 X;  4W9G A;  3MC0 B;  3OAW A;  5MPO A;  2FCQ A;  4R3D A;  4LJO B;  5IN7 A;  3AXC A;  1SJE D;  2KD0 A;  1BXT A;  3BVG A;  1D4B A;  1OQQ A;  1FFV A;  5FKA C;  3RMK C;  1P9D U;  4YSY B;  3ZIM A;  1R4M I;  2WS3 B;  3AE4 B;  1V49 A;  4US8 A;  1SBB B;  4KDL B;  4P7I A;  2GB1 A;  4URK A;  1F9J A;  2LXC A;  4ANX A;  3HVZ A;  3PHX B;  3BYT B;  3DVN V;  3VDZ A;  2M1M A;  2LVO A;  4K7W A;  3I57 A;  2IBI B;  4KSK C;  1OFF A;  3IFW B;  1N62 A;  1SF0 A;  3KUC B;  4I6L B;  2DAF A;  4HPL B;  5G5G A;  2LAS A;  2GRI A;  2MQJ A;  3P42 A;  2NPT B;  2IGH A;  1N6Z A;  4YTN B;  1HA5 A;  1C4A A;  3UIO B;  4F1S A;  4JX1 C;  1UF0 A;  3W5U B;  2JWZ A;  2MJD A;  5HHD G;  4REZ A;  2HDE A;  1TBE A;  1ZDV A;  3HIZ A;  3UI3 A;  1ZKH A;  5J18 A;  1HZ5 A;  1RFK A;  2N9K A;  3ZNI D;  3VVW B;  2D3C A;  3T9L A;  4K81 A;  3NOB A;  2Z0E B;  3LJ3 A;  1ZUD 2;  3SEB A;  4C7Y A;  5JZE B;  1E8Z A;  3VFK A;  3IT6 B;  2KNB A;  4I6N B;  2WXR A;  2EEL A;  4B95 A;  3W1S A;  2C7H A;  3WAL A;  2N9X A;  2EKE C;  2CU1 A;  4WJP A;  3QK0 A;  2CR5 A;  3Q8B A;  4JL9 A;  4ZDV A;  3KYD D;  2FAZ A;  3DCG A;  4ANU A;  2K0P A;  2KK8 A;  2KTF A;  2KX3 A;  1YOV B;  3NS1 A;  1NYQ A;  2KDB A;  3ZQ4 A;  3AE9 B;  2Z59 B;  2KAJ A;  1UGJ A;  3UGB B;  4HXD A;  2CS4 A;  3ONS A;  2PLP A;  1TY0 A;  1UGM A;  2J0J A;  3GP7 A;  3CWI A;  2JF5 A;  3GZN B;  3AV8 A;  1SE9 A;  2QCZ A;  5G5H A;  4DXF A;  2PMV A;  4FJZ A;  1V1P A;  1PGA A;  4WAA A;  2N9P C;  3WAO A;  2BKF A;  4G50 A;  4DQO C;  1Z2M A;  4KIK B;  1LXD A;  1QIL A;  3IBE A;  1P7F A;  2FCM A;  2UYZ B;  2AX5 A;  5BYS A;  2PPH A;  5CHF A;  2ZW1 A;  3FIL B;  5J17 A;  2BVC A;  2IJ0 A;  4RGN A;  2C60 A;  1WMH A;  1RWS A;  1YQ4 B;  4ICU A;  3TEZ A;  2YVC A;  3KUD B;  3GS2 A;  3OG5 A;  2D11 A;  2B3A A;  2DHZ A;  2MWS B;  3PVL A;  2LD9 A;  3AE8 B;  2O6V A;  3QC8 B;  2RSU A;  4JGH B;  2INC C;  1N60 A;  2L3Z A;  3VH3 B;  5IAA C;  3PLU A;  1NBF C;  5CHW A;  1J8C A;  1ET9 A;  3CMM B;  4RM9 A;  5E6N A;  2MBQ A;  2K3U A;  1KTK A;  1IGC A;  2BTE A;  3RYT A;  2KQ4 X;  4FN2 A;  1TZ1 A;  5D7G A;  2DZM A;  1KOT A;  1WGG A;  3B0A A;  2W3R A;  3VTU A;  2IO0 B;  2JZP A;  2OJW A;  3Q3N C;  3AN1 A;  3ML9 A;  2X38 A;  2KQS A;  1NYR A;  2K6Q A;  3ZNG C;  3TSS A;  1XEE A;  2OED A;  5C1Z A;  4J6I A;  1L6V A;  3L16 A;  1FNU A;  3IVF A;  2FCS A;  1HE8 A;  2QC8 A;  2Y5C A;  3W1Y A;  2J4X A;  2NMQ A;  1MPE A;  2M4N A;  2ZCB A;  3EA6 A;  3KWV A;  2QIE B;  1WF9 A;  2PE6 B;  1FIQ A;  2RDG A;  1QKZ A;  4IUM B;  5LLI A;  1L4Z B;  4KVG B;  3WAN A;  5JXV A;  2LVQ A;  2ONQ A;  3P1M A;  4FLH A;  4XDC A;  2LGX A;  1OEY J;  4GDL A;  3DBH B;  1Y8R C;  3GE8 C;  5C3J B;  2C7M B;  2SAK A;  4ZHO A;  1BT0 A;  3W1S C;  3EEC A;  4NJC A;  5DCN A;  3BY4 B;  2N7J A;  4GOC A;  3CSF A;  2C5L C;  4KX6 B;  2LJ5 A;  4RGM A;  1FMA D;  3RN9 C;  2M17 A;  4AOF A;  3HHM A;  1J7A A;  1V97 A;  1ZXI A;  3S2A A;  2NBV B;  3AE5 B;  3I5J C;  1YX6 B;  1FRD A;  4W9D A;  2JPH A;  3RNA C;  1UZX B;  3L54 A;  3X23 A;  3I9V 1;  1YQB A;  3PRZ A;  1ZE3 D;  4OZC A;  3VUY A;  4BKT A;  3LDZ E;  1T0Q C;  3Q8E A;  2VH1 A;  4MGZ E;  4PYZ A;  1BUI C;  1T5X D;  4AS1 A;  2L0F A;  4LCD E;  4ZRK A;  1RFA A;  4RMA A;  4II3 B;  2WXN A;  5BYQ A;  2ZVO A;  4B6W A;  1ZDX A;  5LNK 1;  2GBM A;  3DWM A;  1F0Z A;  2K8C A;  2XK5 A;  4JQW C;  4ZRI A;  3ZNH B;  1XLP A;  3ZJV A;  4ZRP A;  3HK0 A;  1WGK A;  1KLG D;  2KHW B;  2MP2 B;  5BMI A;  3L17 A;  1N61 A;  4DHJ B;  1WXA A;  1WXM A;  2BB6 A;  2LMC A;  1C76 A;  1LQB A;  3PRM B;  1I7H A;  5EE0 A;  2G3Q B;  1GUA B;  4IM2 A;  2LFI A;  4C4V A;  2NVU I;  3NRZ A;  4JLC A;  1L0X B;  4A55 A;  1RYJ A;  2KDI A;  1U4A A;  2KMA A;  2AL6 A;  1E8W A;  3ZJT A;  2VZK B;  1HEZ E;  4E3C A;  1TS5 A;  3T8M A;  1MHH E;  1GC7 A;  4DHJ D;  4IC7 B;  4AP4 C;  2J52 A;  3IT4 B;  4OVU A;  3M95 A;  5D2M B;  1Q10 A;  3WAM A;  2CHW A;  4KSL C;  2J7Q B;  3U52 E;  3VRA B;  4WWO A;  1XO3 A;  2KTR A;  3GB1 A;  2EMS A;  4EKU A;  1MI0 A;  3CIR B;  1L5P A;  2JQR B;  1NEK B;  1P0R A;  3IXS A;  2INN E;  2ICI A;  1C79 A;  2KMC A;  2KVR A;  2VZK D;  1N63 A;  4F8C B;  3KVF B;  2BYV E;  2WWZ A;  1HTO A;  3RZW C;  3NVV A;  4CO7 A;  3U8Z A;  5AUI A;  2L52 A;  3N9Y C;  3AEF B;  1ROE A;  4KGS A;  4OW0 A;  4M8N A;  3V6C B;  4XE0 A;  2PVO D;  3QHT A;  1PGX A;  1YD8 U;  4A8X C;  3LB8 C;  4JPS A;  2L0T A;  4N6E B;  2HD5 B;  3MC8 A;  4GN1 A;  2RDB C;  2FUG 1;  2JZZ A;  2J53 A;  5DPR A;  3VAW A;  1CMX B;  2M0A A;  1GOZ A;  4RCO A;  2N0S B;  2I2Y A;  1JQ4 A;  1WM2 A;  1JRO A;  2A5U A;  1XF5 L;  2MSE D;  4IWP A;  4BOZ B;  5AUK A;  3KW5 B;  3R66 C;  3PT2 B;  2LGS A;  4YL8 A;  3QA8 A;  4C80 A;  4B0E A;  4WJN A;  1UH6 A;  1VRA B;  2RPV A;  4EZK A;  4A6Q A;  2FBW B;  3N20 C;  4BBN F;  2L32 A;  1WMH B;  2PEA A;  3TL5 A;  2PIA A;  2KFK B;  3OLM D;  2LI5 A;  4M00 A;  4XYC A;  2DEN B;  4IOI E;  1SSN A;  1T6B X;  3ML8 A;  2ZZP B;  2L7R A;  2MCN B;  2V3P A;  3DBR I;  3PHW B;  3UF8 A;  3QCA A;  4PT5 A;  4XC2 A;  4TQ0 A;  4GMV A;  5IOI A;  1SB3 C;  1SE4 A;  3UQB A;  3NG0 A;  3HUI A;  2RDH A;  2IYD B;  2BPS A;  1I4R A;  3VTW A;  2WXI A;  4RF1 A;  2DWQ A;  2MEK A;  1WX7 A;  1WZ3 A;  2GBR A;  1GG3 A;  3ECI A;  3L4P A;  1UD7 A;  5FK9 C;  1R4N I;  3P63 A;  3RFZ B;  3VRB B;  4FHK A;  1WR1 A;  3B9J A;  1T0S C;  1GAQ B;  3HVD A;  2G9H D;  2AQ2 B;  1AWD A;  2TSS A;  1C78 A;  1WGD A;  3B1L X;  1NEN B;  2O2V B;  1GPX A;  2BQQ A;  3K9P B;  1VZ6 A;  1C4C A;  3FKY A;  3VR9 B;  3ZNZ B;  4LNO A;  4NQK E;  1V2Y A;  2HE7 A;  2BB5 A;  2LRU A;  1J7C A;  1YN3 A;  1RAX A;  4IKG A;  4W9E A;  2WXM A;  1DGJ A;  1H4R A;  4C00 A;  3V61 A;  2KDE B;  1HTQ A;  4DXA B;  2JYE A;  1WGY A;  4M01 A;  2DAJ A;  3Q8F A;  4JWS C;  1X1M A;  3DBL I;  3CST A;  2JXX A;  4NAW A;  5JHB A;  1I35 A;  2JRH A;  3NZ3 A;  3AE2 B;  2W3S A;  3ZXR A;  3TEX A;  4HK2 A;  1E6E B;  4ZYS A;  1EF1 A;  1WXV A;  2VH2 A;  2BYT A;  5BO4 B;  3BIN A;  2MA9 B;  4FBJ B;  2WX1 A;  1VD2 A;  4NNJ B;  2WXF A;  3C8Y A;  4ARI A;  4OHJ A;  2B76 B;  3OJ4 B;  1G6J A;  1IGD A;  2LUM A;  2RGF A;  2WNM A;  3W2D A;  3C0R B;  3Q6B A;  3GOE A;  4IM0 A;  5DPT A;  2WDQ B;  2ZW0 A;  2N1V A;  2I1J A;  3H9D A;  4MM3 B;  5IA7 A;  4XZ4 A;  3BYY B;  3HRD D;  3N1Y C;  2WDV B;  4LK0 M;  3V62 A;  2MBE A;  2KX0 A;  2KOX A;  2OOB B;  5L95 C;  4WIP A;  5IO9 A;  2PKO A;  4ITK A;  3W9C B;  1QZE A;  2MJE A;  4MJS A;  1CK1 A;  2D3G A;  1PDX A;  2Y5B B;  1GJZ A;  3PO0 A;  1ZGU B;  2PW9 A;  3ZJU A;  1ENF A;  1K8R B;  4M8M A;  1D5X C;  1HQR D;  3A9J B;  1V9J A;  2KT7 A;  3PSE B;  4HCP B;  1GB1 A;  4M0W A;  2IND C;  2V3S A;  3WA0 A;  1FD6 A;  1D5M C;  1I4P A;  4EE2 A;  4RNA A;  4NJ6 A;  3P4R B;  3EFU A;  2AL3 A;  2KTR B;  4FHJ A;  1IBX B;  1WYW B;  1E0Z A;  4JIO U;  3MHZ A;  2K8B A;  2MW5 A;  2KLC A;  3AED B;  1E10 A;  4PS3 A;  1SE2 A;  4GDK B;  3RNG C;  2FUH B;  1XD3 B;  1E7U A;  1MFW A;  4MGI E;  4B0M A;  3H8H A;  2EKI A;  4MH8 A;  1EF5 A;  1JML A;  4P16 A;  4BOS C;  4MH0 E;  3QQ8 B;  4OZB A;  3U7Z A;  1VJK A;  4A3O A;  2KAN A;  4KKI A;  1WZ0 A;  1AN8 A;  2K39 A;  2MLB A;  3HM3 A;  4LNK A;  3JSV A;  2VRR B;  2IZV B;  3AEA B;  3A1Q B;  1DOI A;  2DX5 B;  2NR2 A;  1C4P A;  1R7S A;  2Z8L A;  1JRP A;  1TS2 A;  3DQV A;  3H6N A;  4N58 A;  3V05 A;  2M19 A;  3GZN I;  4L2Y A;  2CHX A;  1CQV A;  2G4D B;  2KAC A;  3BVM A;  4MSM B;  1XLO A;  3DBS A;  4HJK A;  4XWW A;  2L05 A;  1FCC C;  4HRS A;  4PS8 A;  1WXS A;  1A70 A;  4LNN A;  3TEW A;  1S1Q B;  2FCN A;  3OWE B;  4KGR A;  3JYU A;  1AW7 A;  3W5V B;  4K1R B;  4GXB A;  2PVG C;  4W9J A;  2BS2 B;  3U4E G;  2FNJ B;  4MEM A;  2G1E A;  1TS3 A;  3ZO5 B;  4DK5 A;  4WWN A;  2W55 A;  4W9L A;  3ZTC A;  3Q3F A;  1WX9 A;  1ACC A;  2N1W A;  3BII D;  1TGZ B;  4KKJ A;  2FID A;  2WLB A;  1TZO A;  3A9K A;  4PYU A;  4A9A A;  2HJ1 A;  4G0N B;  5HKH A;  1FXA A;  2IO3 B;  3ALB A;  2LVP A;  4IW0 A;  1WE7 A;  1JWA D;  1UNS A;  2D10 A;  5I4D A;  2V4L A;  1FCL A;  4MGK E;  3WCQ A;  2L8J A;  4GB9 A;  3BZD B;  2DZJ A;  2ZPN A;  1OQR A;  2PE9 A;  3ZGZ A;  2QDF A;  3IG3 A;  1KF6 B;  4BKS D;  3WAP A;  2RPQ A;  1GC6 A;  4CYE A;  2LGY A;  4XWT A;  1KM7 A;  1DYQ A;  2GLS A;  2L00 B;  3NJT A;  4DWF A;  4AWJ A;  5E6J A;  4MT5 A;  3VUX A;  5FR6 A;  2D07 B;  1I4Q A;  2WXJ A;  2LRW A;  3DBH I;  2NTS A;  1JW9 D;  2KWD A;  4CHK A;  4AQ7 A;  2V1Y A;  5BMH A;  2CHZ A;  1LM8 B;  3APC A;  1SE3 A;  2EMT A;  2XNA C;  3LYY A;  3SDL C;  1V5T A;  2FE8 A;  4RGT A;  1TIF A;  3AE6 B;  4Q2J A;  1OGW A;  4NAW B;  1V8C A;  5JH5 C;  3PTF C;  1T3Q A;  4DXG A;  2QEJ C;  2LHE A;  2ON8 A;  2MRP A;  4ZYN A;  4HDO A;  1WJU A;  3KLS X;  2JY6 A;  1XXG A;  3V60 A;  1J7B A;  1WXQ A;  2FIF A;  1UWM A;  1EM7 A;  5D94 A;  2DYB A;  1IP9 A;  2KWU B;  1TY2 A;  4S0R A;  5AEK B;  4P1B C;  4ICV A;  1KLV A;  4L1B A;  2J42 A;  3PV1 A;  4E71 A;  1B1Z A;  3RPF C;  1QOG A;  4YWG G;  4WUR A;  5GXG B;  2LZ6 A;  2NS5 A;  2R61 A;  1HZ6 A;  2NPT A;  3FAH A;  2KJ6 A;  1V1O A;  2J0K A;  1WX8 A;  4AJY B;  3NVY A;  2V9H A;  5E6P A;  3TMP B;  2BWF A;  3SFE B;  3SU8 X;  2GMI C;  3FC4 A;  2N9E B;  2MHJ A;  4YTM B;  1XLN A;  1FEH A;  1FXT B;  4N59 A;  1WJ4 A;  1SIF A;  4LTU A;  1WRD B;  4AJW A;  2JZ3 B;  5E6O A;  3R7Q A;  4X57 B;  4DHZ B;  1BML C;  2ZNV C;  1YN4 A;  2KDF B;  2V0G A;  4KDI C;  3AB5 A;  2LGD A;  3ENE A;  2DYM A;  3KYC D;  4A3P A;  1IPG A;  1JWB D;  3KUZ A;  5IP4 D;  3E56 A;  2DYO A;  4BKG A;  2SEB D;  1C3T A;  1V86 A;  2Z0D B;  2M0X A;  4BZA A;  3UIP B;  4DDG D;  1NI3 A;  2M8S A;  3R8B A;  4RH6 A;  4S17 A;  3TUO A;  3PZ7 A;  3P4Q B;  4N9F 4;  1DOX A;  2BW2 A;  1V6E A;  3L13 A;  3ZKJ C;  1LFD A;  3NY5 A;  2L1A A;  2AQ3 B;  4HRO A;  1I4H A;  3VHT C;  1CJE A;  1E8X A;  3N1X C;  2BF8 B;  3K9O B;  1N5X A;  3P4P B;  5EE9 A;  3EC8 A;  1Y56 A;  1QT9 A;  2G45 B;  1J0G A;  2A4Z A;  2BT6 A;  4LNI A;  1ESF A;  4W9F A;  4KGT A;  5IKC M;  1V1P B;  4KIK A;  1K53 A;  4G11 A;  5AZG A;  3Q69 A;  3Q8A A;  2YLM A;  4MGY E;  3BK1 A;  1E90 A;  3R2I A;  1WSP A;  4LDT B;  3FIL A;  4HEA 1;  1AYF A;  5AZF A;  2DBY A;  1VZ7 A;  3NZS A;  2KVZ A;  4TSS A;  4XGA B;  3RI7 C;  4NZL B;  1VZ8 A;  1WH3 A;  2DZK A;  3PZ8 A;  2JWU A;  3AM9 A;  1F2R I;  1OQY A;  2E6X A;  4FJV B;  4BAX A;  2UWQ A;  1MHX A;  2O6V B;  4LDT D;  3AU4 A;  1QOA A;  1LO5 D;  4W9K A;  3T3N A;  3M63 B;  3ZDM C;  4GU2 A;  3IAS 1;  4AUQ C;  1WGR A;  3PRP B;  3TEY A;  4MEL A;  1JWM D;  4NPN A;  1N5W A;  2LHD A;  1TKY A;  4PK1 A;  1SGH A;  1QQR A;  2H88 B;  2BWE S;  2JRI B;  2O6V D;  2K6D B;  3C19 A;  1Q1O A;  2AWT A;  3PS6 A;  3MFG A;  4CQN A;  1B9R A;  2GBN A;  4FAD A;  2WXH A;  3AEB B;  4IDI A;  1SIJ A;  4HDQ A;  3PLV A;  2R2Q A;  3SD5 A;  2HJ8 A;  1I4X A;  1FFU A;  4K7U A;  2MJ3 A;  2LUE A;  3RNB C;  3DHG C;  1YJ1 A;  3B2G A;  2PTL A;  2ACZ B;  3DHH C;  2MBH A;  2DZI A;  2KJH B;  4HCN B;  2NCN A;  2KO3 A;  2WX0 A;  4TQ1 A;  4DHZ E;  1WJ6 A;  1WYG A;  3R3M A;  3VR8 B;  1V80 A;  4GDL B;  1L6U A;  5HG2 A;  3TJP A;  3NUH B;  1L4D B;  3NZU A;  2L83 A;  1JAL A;  4IWQ A;  3VQI A;  4A20 A;  5EE1 A;  2KMM A;  3H7P A;  1PFD A;  2INP E;  2I1K A;  3RUL A;  4PS7 A;  4LJP B;  1YMH E;  1WWT A;  2WU2 B;  1R4M B;  2AYO B;  1OTR B;  2IGD A; 
#chains in the Genus database with same CATH homology
 1ZE3 D;  2Y5P A;  2KAC A;  3BVM A;  2GI9 A;  4OZC A;  2W54 A;  1XLO A;  4RGO S;  4YSZ B;  1VR9 A;  1QOB A;  3ETR A;  4RF0 A;  2K22 A;  2WXQ A;  4XWW A;  1FCC C;  3Q8E A;  4HRS A;  1BUI C;  1T5X D;  2LEK A;  3V3X A;  4AS1 A;  1ZOY B;  2I38 A;  1A70 A;  3TEW A;  2IGG A;  3OWE B;  4KGR A;  4GLS C;  1EU3 A;  3MP9 A;  1ZP0 B;  1K52 A;  2Y3A A;  1UWX A;  2WXN A;  1AW7 A;  4WQM A;  3W5V B;  4C7Z A;  5BYQ A;  1PGB A;  1ZDX A;  2PVG C;  5LNK 1;  2BS2 B;  3U4E G;  1PYW D;  4P6V F;  1ZPS A;  2JXT A;  3DWM A;  1F0Z A;  2G1E A;  1D6E C;  1TS3 A;  1F77 A;  3AEC B;  1XLP A;  3ZJV A;  4ZRP A;  2D5G A;  2QMT A;  1WGK A;  1E9M A;  2LGI A;  1KLG D;  1EWY C;  2W55 A;  3O13 A;  2V3N A;  1KLU D;  5BMI A;  2K9X A;  1N61 A;  4H2A A;  1ACC A;  2DLB A;  3BII D;  2BB6 A;  3AEE B;  4KKJ A;  2H89 B;  2LMC A;  4MAC A;  2WLB A;  1C76 A;  2Q5W D;  1TZO A;  1I7H A;  4YXD B;  3AMZ A;  4A9A A;  1D5Z C;  5EE0 A;  4D2K A;  2LFI A;  1YN5 A;  1FXA A;  3NRZ A;  1L0X B;  4A55 A;  1L0Y B;  1RYJ A;  1SJH D;  3AE1 B;  4HKZ E;  3E9S A;  3ZJT A;  2VZK B;  1HEZ E;  5D3D A;  2JSV X;  3KQ4 A;  1TS5 A;  4US9 A;  3EUB 2;  2CU3 A;  1JWA D;  1MHH E;  1QOF A;  1UNS A;  2LJI A;  2J52 A;  3IT4 B;  5I4D A;  4RFB A;  1FCL A;  3BWU D;  3WCQ A;  1Q10 A;  3BZD B;  4UDU C;  1OQR A;  4JE3 B;  3U52 E;  3VRA B;  3ZGZ A;  1VLB A;  1XO3 A;  4WWM A;  3GB1 A;  5H8Y E;  1KF6 B;  1MI0 A;  4NAM A;  3CIR B;  1YJJ A;  2OHF A;  3LXF A;  1L5P A;  2JQR B;  1NEK B;  3IXS A;  4XWT A;  2INN E;  1YNT E;  2ICI A;  2WXK A;  1NVI D;  1DYQ A;  2WP9 B;  3Q8C A;  1C79 A;  2VZK D;  1N63 A;  1SEB D;  1DOY A;  4TMA B;  1FRR A;  1KH0 A;  4A90 A;  1UUP A;  3NVV A;  5E6J A;  5HI1 A;  4YT0 B;  4MT5 A;  1HXY D;  3DWG C;  3KWL A;  2IPK D;  1K51 A;  1XCT L;  2JYT A;  5AUI A;  1XCQ L;  1KFY B;  1I4Q A;  2CJO A;  2WXJ A;  2L52 A;  4HKQ A;  3N9Y C;  1K50 A;  3AEF B;  2NTS A;  4ZOH C;  5H92 C;  1JW9 D;  2KWD A;  1ROE A;  4KGS A;  4AQ7 A;  4OW0 A;  5BMH A;  4XE0 A;  3B2F A;  4HJG E;  2PVO D;  2JU6 X;  2BS4 B;  2BS3 B;  1PGX A;  3MC0 B;  1SE3 A;  5MPO A;  4R3D A;  2XNA C;  3LYY A;  2K5P A;  3LB8 C;  4A8X C;  4JPS A;  3IAM 1;  2FE8 A;  4ZRQ A;  1FXI A;  4RGT A;  4N6E B;  1SJE D;  3AE6 B;  4Q2J A;  3BVZ A;  1EU4 A;  4NAW B;  1BXT A;  1V8C A;  3BVG A;  1D4B A;  1T3Q A;  1OQQ A;  4DXG A;  1FFV A;  2FUG 1;  2J53 A;  2QEJ C;  2LHE A;  5FKA C;  2ON8 A;  2KDM A;  4ARC A;  4YSY B;  2M0A A;  2WS3 B;  3KLS X;  3AE4 B;  1GOZ A;  4RCO A;  2N0S B;  2I2Y A;  4US8 A;  1WRI A;  1JQ4 A;  1SBB B;  1JRO A;  2GB1 A;  1XXG A;  1XF5 L;  1J7B A;  3HVZ A;  5AUK A;  1WXQ A;  4C80 A;  4B0E A;  1FO4 A;  3BYT B;  1UWM A;  1IUE A;  1VRA B;  1EM7 A;  1VDV A;  2RPV A;  1JWU D;  4A6Q A;  2FBW B;  1TY2 A;  3I57 A;  2L32 A;  1OFF A;  2AQ1 B;  1N62 A;  3AEG B;  4L1B A;  2PIA A;  2J42 A;  1RM6 C;  1SF0 A;  1TYG B;  1KRH A;  1B1Z A;  5G5G A;  3RPF C;  1QOG A;  4YWG G;  4IOI E;  2NTT A;  4WUR A;  5GXG B;  2XN9 C;  2GRI A;  2R61 A;  1HZ6 A;  1SSN A;  1T6B X;  3P42 A;  2IGH A;  3FAH A;  3NVW A;  1V1O A;  2YEP B;  2V3P A;  4YTN B;  1HA5 A;  1ZXH A;  2RMM A;  2E3T A;  3NVY A;  4PT5 A;  1C4A A;  4TQ0 A;  4JX1 C;  1SB3 C;  3W5U B;  1SE4 A;  2MJD A;  3SFE B;  5HHD G;  4REZ A;  2HDE A;  2RDH A;  3HUI A;  1ZDV A;  1I4R A;  3FC4 A;  2WXI A;  1E7P B;  3UI3 A;  4RF1 A;  2DWQ A;  1JCK B;  1QLB B;  4YTM B;  1HZ5 A;  1RFK A;  2MEK A;  1XLN A;  2N9K A;  1FM0 D;  1FEH A;  2WXL A;  1XLQ A;  1TKG A;  4N59 A;  4JWU C;  1FNW A;  3L4P A;  4LTU A;  2WU5 B;  5FK9 C;  4XDD A;  1C9F A;  3P63 A;  3RFZ B;  3VRB B;  1ZUD 2;  2N9L A;  3SEB A;  1BML C;  3B9J A;  4C7Y A;  1YN4 A;  2V0G A;  5EE3 A;  3AB5 A;  3NVZ A;  1GAQ B;  3T3O A;  2DYM A;  3AH7 A;  3HVD A;  1JWB D;  2AQ2 B;  2G9H D;  3IT6 B;  3SFD B;  1L0V B;  4J3O D;  1AWD A;  2TSS A;  1C78 A;  2WQY B;  2WXR A;  2EEL A;  3E56 A;  4WAF A;  3W1S A;  1NEN B;  1GPX A;  2DYO A;  2SEB D;  1VZ6 A;  1C4C A;  3VR9 B;  5D3I B;  1ET6 A;  3AE7 B;  1NI3 A;  3R8B A;  4RH6 A;  3Q8B A;  3TUO A;  3AE3 B;  3PZ7 A;  2BB5 A;  2YEP F;  3P4Q B;  1J7C A;  1DOX A;  1YN3 A;  2BW2 A;  4C56 C;  4IKG A;  3R2T A;  4LLG M;  2W82 A;  2K0P A;  2WXM A;  5FR3 A;  1DGJ A;  1JWS D;  2L1A A;  2AQ3 B;  4HRO A;  1I4H A;  1CJE A;  2WXO A;  2JYE A;  1NYQ A;  3NS1 A;  1N5X A;  3ZQ4 A;  3P4P B;  3Q8F A;  4JWS C;  5EE9 A;  3AE9 B;  5TSS A;  1Y56 A;  2KAJ A;  1UGJ A;  1QT9 A;  3NZ3 A;  2WXG A;  2CJN A;  3AE2 B;  2BT6 A;  2W3S A;  2PLP A;  1YQ3 B;  1TY0 A;  3TEX A;  1EWC A;  3GP7 A;  1E6E B;  3CWI A;  1ESF A;  4ZYS A;  1M4V A;  3AV8 A;  4FXC A;  5G5H A;  4DXF A;  2PMV A;  4KGT A;  1V1P A;  1PGA A;  5HFY A;  1CZP A;  1V1P B;  1SXT A;  1K53 A;  2BYT A;  4DQO C;  3Q69 A;  3Q8A A;  1QIL A;  3BK1 A;  1P7F A;  3R2I A;  3BK2 A;  1WSP A;  1PUT A;  2AX5 A;  5BYS A;  5BYR A;  3FIL A;  2WXF A;  3C8Y A;  2ZW1 A;  4HEA 1;  4ARI A;  3FIL B;  1AYF A;  4USA A;  4OHJ A;  2B76 B;  2DBY A;  1IGD A;  2IJ0 A;  2LUM A;  2WNM A;  4RGN A;  1VZ7 A;  2WDR B;  3W2D A;  4TSS A;  1RWS A;  4NZL B;  2WDQ B;  1VZ8 A;  1YQ4 B;  2ZW0 A;  1MVK A;  3TEZ A;  3PZ8 A;  4MM3 B;  5T8I A;  2JX5 A;  2JWU A;  3GS2 A;  3AM9 A;  1F2R I;  2E6X A;  3BYY B;  3AE8 B;  3HRD D;  1MHX A;  2WDV B;  4LK0 M;  1QOA A;  2HTM E;  1N60 A;  1LO5 D;  3SR6 A;  3T3N A;  1ET9 A;  4WIP A;  2K3U A;  1F2R C;  3IAS 1;  1KTK A;  2PKO A;  1IGC A;  3TEY A;  4ITK A;  2BTE A;  4WH4 A;  3J9C A;  1TKE A;  2KQ4 X;  3W9C B;  2KN4 A;  3P4S B;  5D7G A;  2MJE A;  1JWM D;  1N5W A;  2M56 B;  2LHD A;  2W3R A;  1CK1 A;  1TKY A;  1QF6 A;  1PDX A;  1QQR A;  2H88 B;  2JZP A;  3ABV B;  4OVZ A;  3MJ5 A;  3AN1 A;  5C2T B;  2X38 A;  1NYR A;  3PO0 A;  4ZHP A;  3MFG A;  3TSS A;  4CQN A;  1XEE A;  1B9R A;  2OED A;  2PW9 A;  2WXH A;  1TJE A;  1ENF A;  3ZJU A;  1L6V A;  3AEB B;  2IDY A;  1D5X C;  4IDI A;  2WXP A;  1SIJ A;  1HQR D;  1TS4 A;  1FNU A;  4YTP B;  2Y5C A;  1GB1 A;  1I4X A;  4M0W A;  2J4X A;  2NMQ A;  1FD6 A;  1FFU A;  1D5M C;  1MPE A;  3EA6 A;  3KWV A;  2QIE B;  2MJ3 A;  1I4P A;  3EGR A;  4EE2 A;  1STE A;  1FIQ A;  2RDG A;  4RNA A;  1QKZ A;  3B2G A;  2PTL A;  5BMG A;  2ACZ B;  3P4R B;  1L4Z B;  1IBX A;  1GB4 A;  2BBC A;  1IBX B;  5JXV A;  1E0Z A;  4TQ1 A;  3MHZ A;  1WYG A;  4YSX B;  2ONQ A;  3P1M A;  4XDC A;  3AED B;  3VR8 B;  1E10 A;  4GDL B;  5C3J B;  1L6U A;  4O1N A;  5HG2 A;  1SE2 A;  2SAK A;  4GDK B;  4ZHO A;  3NUH B;  4B0M A;  4NJC A;  2MH7 A;  1L4D B;  2EKI A;  3H8H A;  1YJI A;  3U2S C;  2N7J A;  3URY A;  2L83 A;  1JAL A;  1FNV A;  1JML A;  4KX6 B;  4MH8 A;  4P16 A;  4L23 A;  4RGM A;  1FMA D;  5EE1 A;  3VQI A;  2KMM A;  4OZB A;  1I4G A;  1J7A A;  1PFD A;  1V97 A;  2INP E;  3U7Z A;  1ZXI A;  1VJK A;  4OZA A;  2QSD A;  4KKI A;  3ZYY X;  2QIL A;  1AN8 A;  2QJL A;  3AE5 B;  3AEA B;  1YMH E;  1FRD A;  1DOI A;  1P7E A;  1WWT A;  2WU2 B;  1C4P A;  1R7S A;  2Z8L A;  2V4I B;  1JRP A;  1TS2 A;  3I9V 1;  4N58 A;  3V05 A;  2M19 A;  1C77 A;  4L2Y A;  2IGD A;  1CQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...