1C76A

Staphylokinase (sak) monomer
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
121
structure length
121
Chain Sequence
b'SYFEPTGPYLMVNVTGVDGKGNELLSPHYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOKINASE
publication title Crystal Structure of Staphylokinase Dimer Offers New Clue to Reduction of Immunogenicity
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 23
structure length 121
sequence length 121
ec nomenclature ec 3.4.24.29: Aureolysin.
pdb deposition date 2000-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02821 Staphylokinase Staphylokinase/Streptokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.130 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1c76A00
1SSNA 1C79A 1C76A 2SAKA 1BUIC 1C77A 1C78A
chains in the Genus database with same CATH superfamily
2N1WA 1IBXA 1D5XC 2Y5CA 4WIPA 2WU2B 4M01A 4IKGA 3NG0A 3H9DA 1FNVA 2PVGC 5JZEB 4M8MA 4W9JA 4W9DA 3RNCC 1V2YA 4CHKA 3JW0X 1QQRA 4L1BA 4WJNA 3Q3JA 1Z2MA 4P1BC 1T0RC 2KQ7A 5IO9A 1V49A 1ZE3D 4K7WA 4HJKA 4HVBA 1NI2A 2NVUI 1OTRB 2JZZA 3U30A 4AQ7A 2KYWA 4GU2A 1WF9A 2ZPYA 3W5VB 2KN4A 4FJVB 2IYDB 3RNGC 3HUIA 3PZDA 3B2GA 1N6ZA 3NS8A 3QK0A 2MJ3A 1FNWA 2PLPA 3GZNI 1WY8A 3L17A 3B9JA 3BWUD 4IWQA 1XLPA 1WR6E 3AE9B 2JY6A 3VAWA 4ZRJA 2BBCA 1TGZB 3NOBA 1AW7A 2CJOA 3NY5A 4GDKA 2GBNA 4ZRIA 2CHZA 1E8XA 2I1KA 3UI3A 3V6EB 2L1AA 1C9FA 2KDBA 1J19A 2K6QA 2C60A 3PREA 1DOXA 2Z0EB 4D2KA 4C56C 4YTNB 4TQ1A 1VD2A 3OWEB 1F9JA 5IN7A 4ZRKA 2C7HA 2D3BA 2M8SA 3AEAB 2AYOB 3T9LA 4A90A 5E6JA 3BYTB 4BKSA 1WX8A 2K8BA 1HTOA 4ZRPA 3ENEA 2L7RA 3A1QA 1WYWB 1HEZE 3RZFA 2Y5BB 1ZUD2 2TSSA 2XNAC 3A9KB 5LXIB 3A9JA 2X8XX 4EKUA 3IT6B 2KWDA 1CQVA 2WNMA 4AS1A 3OLMD 1ACCA 4E71A 1JMLA 4GB9A 4B95A 1L0XB 4IC7B 2KMAA 3DVGX 4KZCA 4PYUA 3DBLI 5EE1A 1FIQA 2PIAA 5GMVA 4ANVA 3T3OA 2LHEA 1VDVA 3URYA 3AE1B 4DQOC 1YMHE 2B3AA 2CU1A 1T0QC 1DYQA 5DPRA 1EUVB 3TEZA 3UQAA 2RGFA 3ML9A 4HRSA 3ZRCA 1WGGA 2D3CA 4MACA 3PRZA 2LRUA 4LDTD 2YLMA 1N63A 2FBWB 4RFBA 1QT9A 3DBSA 3R66C 4XE0A 1FXIA 2MSED 4ICVA 2YVCA 2K25A 3GP7A 5AZFA 5AZHA 2KMCA 3V6CB 3Q8AA 3PO0A 5HG2A 4A20A 3N1YC 2BW2A 2LGXA 3AU5A 3OJ3A 3NVYA 1LFDA 2ZCCA 2PE9A 3AE2B 4BZAA 1IP9A 3C19A 4DDID 1MJDA 2WXQA 2OHFA 3H6NA 1V97A 2JUOA 1WGKA 2A4ZA 4GDLB 2D3GA 2L05A 2RDHA 2K3UA 1K53A 1YX5B 1N5WA 1F2RI 1TKEA 2L3ZA 4JWSC 1WWTA 3J9CA 2NCNA 1D4BA 1F1HA 2JXXA 2OJWA 2QSDA 3H1UA 2WWZA 2PE6B 4M8NA 1I35A 3A4SC 3ZW3A 4W9LA 2KJ6A 5DPSA 1L5PA 1WJUA 3NUHB 4YL8A 2N9PC 2R2OA 3AV8A 3B1LX 4YSXB 1QOGA 1E6EB 1SB3C 3N1ZC 4G11A 2WHIA 2BQQA 1IGDA 4ZYSA 3GB1A 3PVLA 3KYDD 2MP2A 3RNEC 2ZPNA 2BYFA 2VRRB 3ABVB 3WA0A 2JPHA 4RGTA 3AE3B 3PV1A 4P6VF 1DOIA 2INNE 4QAYA 4RGNA 4HROA 1Q1OA 2LUMA 1SE3A 3APFA 2ICIA 4W9GA 4XWTA 1VZ6A 1D3ZA 2Z0DB 4KSLC 2CHWA 2QEJC 4LLGM 3H7PB 4A8XC 2WXGA 1Q5WB 5C2TB 3B0AA 4II3B 4YT0B 1D6EC 1YN3A 2CKHB 3QQ8B 2XEWA 3ONSA 2IGHA 2RDBC 1ISNA 1TZ1A 2N7EA 4A3PA 3V62A 3EUB2 3FC4A 2MCNB 4PS8A 4ITKA 3KWVA 4ZRQA 4JX1C 3EFUA 1WI0A 3QA8A 1QF6A 3NHEB 3HIZA 4GIVA 3R7QA 1HTQA 4ANWA 1GNUA 1OGWA 1EO6A 4M02A 1IUEA 4DHZB 1SGHA 1WX9A 2V4LA 1ZDXA 3VTWA 1MFWA 1JWBD 3EFCA 1ZGUB 3SEBA 1Y8RC 4DBGA 2PPHA 1TZOA 4KGTA 4YWGG 5CTRC 4IM3A 1GC6A 2N7JA 1IPGA 2NPTA 1JWAD 2GBMA 1V86A 4F1SA 4C80A 3L16A 2Q5WD 3ZNHB 3N30A 2H89B 4RGOS 4UDUC 1GAQB 1J8CA 2KDMA 1WM3A 3TIXA 4IOIE 4A6QA 3MC9A 2YEPB 1C3TA 3VXWA 2JU6X 4HLEA 1VZ7A 4JE3B 2REXA 4BKGA 2V3SA 3C0RB 3QHTA 4PT5A 4HEA1 3N9YC 1GOZA 2O6VA 2WDRB 1VCBA 2DYMA 2L0FA 4GLSC 5C23A 2G9HD 2KHWB 2JYTA 1YQBA 1WXSA 4NAMA 2D3AA 3VUXA 2G1EA 2MLBA 3RI7C 2KXJA 1WJNA 1V5TA 4TKNA 3U7ZA 4B0MA 5D7GA 4BKSD 5JHAA 4KIKA 5E6NA 1WMHB 4OW0A 3MHZA 1XQQA 3AE6B 5CX3A 1T6BX 4XX5A 2M4NA 2FNJB 4EFOA 1OQQA 1V1PB 2MA9B 4WJOA 2DYOA 3QAQA 3RUIB 1QKZA 2W82A 2WXOA 2J52A 3TMPB 4KGSA 2ZW1A 1HQRD 2NTSA 4WWNA 5IOIA 1WSPA 2ZJDA 2ZW0A 2Y3AA 3ZDMC 1WZ0A 5D2MB 1TY0A 2DHZA 2G3QB 3VDZA 5L95C 1ZW7A 1FNUA 3M63B 2SEBD 3Q8BA 5HKHA 2KWCA 3ZXVA 2J0JA 3AE8B 3PRPB 3B08A 3X0WA 3AE7B 2DAJA 3CF6E 1N60A 2J7QB 2ZNVB 1WRIA 3N32A 3N20C 1TYGB 3W1SA 5JXVA 1VR9A 4YTMB 1I42A 4HCPB 4ARIA 4EZLA 4L23A 4WAFA 1M94A 4GGQA 4EUTA 2NTTA 2GRIA 5FKAC 3PSEB 4YSZB 1EU3A 4EE2A 2LD9A 5C3JB 3ZDTA 2O2VA 1XLQA 5IAAC 2L76A 4C4VB 2M0XA 3RCZA 4HPMB 3P4QB 1L4ZB 3TEYA 3ZNGC 2XN9C 4KKIA 2K22A 4IDIA 5FK9C 5E6PA 1PDXA 1E9MA 5HFYA 4XDDA 3Q3FA 3Q2AC 4WJQA 3QC8B 3UIPB 4MEMA 2KC2A 4MT5A 5EE3A 2MBOA 3LJ3A 4L2YA 1MG8A 3PPAA 3PZ8A 2Z59B 4W9CA 5CHWA 3E56A 2XK5A 3R7RA 5EE0A 1QZEA 1V80A 2KWVB 2BYEA 1UBIA 2EMSA 3FILA 4NAWA 3P1MA 3RZWC 5EDSA 1PYWD 3AEDB 2JT4B 3W1SC 1YX6B 1HA5A 1WE6A 1RFAA 3I63C 5CHFA 3LYYA 3ZJUA 2INDC 3EECA 2KDFB 2KAJA 3N1XC 4URKA 2L8JA 5IP4D 1GPXA 4RNAA 3VUYA 5BYQA 2KTFA 1Y56A 3PHXB 4KSKC 5L83A 2ZVOA 4GOCA 1SSNA 2IO2B 2HJ1A 4FN2A 1IYFA 2KFKA 3AE5B 1AN8A 1MVKA 4RM8A 3M3JA 1LM8B 4WURA 1S3SG 1LQBA 4NJ6A 4GN1A 4RH6A 2KTRA 1T0YA 2DWQA 4HDQA 1WYGA 4N58A 2I2YA 1T3QA 4GXBA 4FA6A 2GBKA 2K8CA 1KRHA 1QOBA 4BOZB 4HXDA 4OZAA 4RM9A 1J0GA 4MJSA 3SD5A 4MGKE 1JRPA 3A9JB 4MGZE 3VTVA 2J0KA 4JWUC 2LGSA 2WXJA 3AI5A 2KDEB 1XXGA 2N9XA 1XLOA 3DVGY 1FRRA 3JSVA 1SJED 2K6DB 4IUMB 5C1ZA 1P7FA 2KFJA 2LVQA 4R3DA 2K39A 3ZRFA 3T8MA 1T0SC 4MM3B 1RLFA 2KC1A 2IBIB 2HTME 1KLUD 4GSWA 1NVID 1Q0WB 1ZPSA 3BVGA 3EGRA 4GMVA 2BVCA 1DGJA 3ZNZB 4LNFA 4ZYNA 2INPE 2YEPF 2JZ3B 1I4XA 2ZZPB 1TT5B 2RPQA 2CR5A 3VR8B 4BOSC 1NBFC 4RCOA 3PLVA 1UBQA 3K9OB 3VVWB 1ROEA 5D3DA 1L0VB 5G2NA 2DAFA 2Z8LA 3IBEA 2PEAA 4NJCA 2ASQA 3W1YA 1ESFA 5IA7A 1FXTB 1XO3A 2QILA 4W9EA 3O65B 4B0EA 3ZGZA 4C7ZA 4NZLB 1F2RC 2KJRA 3Q6BA 2KD0A 2DZIA 1F77A 5KHOA 3UF8A 1V8CA 2WXNA 1SBBB 4JQWC 1YQ3B 2KVZA 2BS4B 2RPVA 2LI5A 5D6JB 3DBRB 3AEFB 1XD3B 1AYFA 1E5WA 2LEKA 1RYJA 1HXYD 4ANUA 2BGFA 3TEWA 3IAM1 2D07B 2MHJA 5BYSA 3HK0A 4KZ0A 2JQRB 2C9WB 4DHZE 2D5GA 3PRMB 2LUEA 2IY0B 1F0ZA 2N9EB 4AJYB 5AEKB 1XEEA 4AWJA 2D10A 1OFFA 2W3RA 5BMHA 3A9KA 3NRZA 3KWLA 4J6IA 1QILA 4M0WB 1V9JA 1V6EA 4O1NA 2D2QA 3P4SB 2L0TA 2JXTA 3TJPA 3HHMA 3HVZA 1PQSA 2MW5A 3PS6A 1STEA 4US9A 4FJZA 1R4NB 4ACFA 1I4GA 2M1MA 3UQBA 2HJ8A 1C79A 3Q8CA 4USAA 2BT6A 2KMMA 2MX2A 2IDYA 2LRWA 2ON8A 3EA6A 2OOBB 3L13A 2VZKD 2UYZB 4I6PA 3Q69A 2IGDA 2N9LA 4IM2A 1WJ4A 1E8WA 1I4RA 1SE4A 3DPDA 2QC8A 2IPKD 3I57A 5DPTA 4BKTA 1R7SA 4MGIE 2BB5A 4N6EB 1KM7A 2KJHB 1CK1A 1TBEA 3ZVVA 1UGJA 2DX5B 5JH5C 5HHDG 3ZUNA 4IWPA 1RRBA 1RAXA 4FHJA 1FD6A 2BWFA 3CIRB 2K9XA 3ZNID 2FCQA 3KUCB 1I4HA 3DVNU 3IVFA 5T8IA 4S17A 3R3MA 3UINB 1SIFA 1E10A 1NYRA 1MI0A 4ZOHC 1E90A 2V3NA 2VH1A 4WWOA 1N62A 2KLCA 1BXTA 4Q2JA 2JRHA 1OEYA 3ETRA 4LK0M 4TV3A 1K50A 2QHOA 4LNIA 1J7CA 3S2AA 1XF5L 3QARA 2LVPA 4LNKA 2WS3B 4GDLA 3NVZA 1J7AA 1SIJA 1YIWA 2BTEA 4A9AA 2OJRA 2XBBC 1KFYB 1WX7A 1SF0A 1C4AA 2J4XA 2R2QA 1A70A 4G0NB 3RD2A 3MJWA 3LXFA 2KO3A 4WWPA 3FAHA 2LXCA 3D32A 2K8HA 4BFRA 2AEHA 4ZHPA 3C8YA 4IM0A 4PS3A 2KVRA 2ZCBA 4LCDE 1ET9A 3PGEA 2JWZA 2V4IB 3NZSA 1QLBB 2GLSA 3RMKC 1WH3A 3R2IA 2BKRB 3A4RA 2FCSA 1PGXA 1L7YA 3BIID 3HM3A 1EWYC 4LDTB 4HDOA 2BS3B 2R61A 3A33B 1KF6B 4FHKA 3IFWB 1V5OA 2W55A 2WP9B 5G5HA 1L4DB 2LJIA 3I5JC 4JGHB 3WAOA 1UD7A 1FXAA 3I9V1 1WE7A 3X23A 2A5UA 2FUG1 1SE2A 1I7HA 1ZKHA 3KUDB 1ENFA 4IWOA 1LGRA 1WXMA 1RM6C 1UNSA 2DZMA 1E7PB 3Q14C 2WXFA 3W5UB 5D3IB 4BBNC 3BYYB 3AEGB 3L54A 3DHGC 4NQLB 5LNK1 2E6XA 1TIFA 2UWQA 4FBJB 4FADA 2GI9A 1MG4A 2VZKB 4TUUA 3RN9C 3SFEB 1NYQA 3WIMA 4EOYA 1L6UA 3L08A 4EEWA 2CJNA 4OVZA 2WXMA 2N7DA 2WYQA 2L00B 1WJ6A 2D11A 3AM9A 2BS2B 3QX1A 4HPLB 2BB6A 2FUHB 3ZLZA 3GS2A 4P1CC 3P42A 1Z5SB 1YJJA 3HRDD 5G5GA 3U2SC 1EF5A 2ACZB 1YNTE 1ZP0B 1EWCA 1P0RA 1YJ1A 3VTUA 3WCQA 4IW0A 1JW9D 2LZ6A 4X57B 3JVZX 4OZCA 2LVOA 1C4CA 4K81A 3M95A 4TSSA 1R4MB 3LDZE 4FXCA 4H2AA 2J42A 1KH0A 5IKCM 4K7SA 2NS5A 2IY1B 1R4NI 1P3QU 4US8A 4TMAB 2ZVNA 3DBHB 2G4DB 4DWFA 1P1AA 2E3TA 4E3CA 1FMAD 2KX3A 1JCKB 1QOAA 3V3XA 1HE8A 1IBXB 1TS3A 2BKFA 1ZXHA 4B9KA 2QDFA 2HTHA 3Q3NC 1FFUA 5H8YE 3PTFC 2IO0B 4DXAB 3H7SA 3MC0B 5CHVC 1B1ZA 2LXAA 2CU3A 4XC2A 1C76A 3R8BA 3I3TB 3O13A 1V1PA 4JLCA 2LASA 3VHTC 3HVDA 1UF0A 4II2B 2IZVB 3V05A 2LFIA 2UU7A 3RYTA 3AXCA 2V0GA 2KTRB 3DVNV 4WJPA 3M62B 4PK1A 3PLUA 3W9CB 4TQ0A 3AEEB 4OZBA 2MJDA 1L2NA 3BK1A 2RD0A 3KUZA 2I38A 2KKCA 4IG7B 1FM0D 3MJ5A 1L6VA 3BZDB 2WXLA 2RMMA 3JYUA 5HI1A 1X1MA 4K3BA 2MWSB 4MH8A 3CMMB 4P7IA 2WXIA 3GE8C 1RWSA 1UELA 4GDKB 3OG5A 4ANXA 4HWIB 4N59A 3AECB 4BAXA 3TEXA 3ZYYX 2L52A 2WLBA 2C5LC 1B9RA 1XT9B 4KVGB 2BWES 3FKYA 4C4VA 3ALBA 3VR9B 3ZJTA 2G45B 3DDCB 1GB4A 3IXSA 3KH0A 4W9IA 2SAKA 1FRDA 5G55A 1YOVB 4W9KA 4XGAB 2PMVA 4AUQC 4PYZA 2C7NB 1V81A 1TKGA 2QIEB 1HZ5A 1FPYA 1WGRA 1WGYA 5MPOA 1FFVA 2H88B 4LNOA 2DLBA 2KOXA 2FCMA 2NBVB 2M0AA 3A1QB 3AH7A 4CO7A 4KGRA 3PZ7A 2ZNVC 1WR1A 5TSSA 3QWZB 1ZDVA 3VRAB 1MPEA 3RPFC 2AQ1B 2WXPA 5E6OA 3AEBB 3BY4B 1E7UA 3P63A 1KLGD 1WRDB 2J0MA 3WAMA 2MBHA 4BVUC 4KDLB 3LB8C 3Q8FA 5BMGA 1YN4A 1F52A 4AP4C 3ZXRA 3SDLC 5I4DA 3K9PB 1NDDA 3QJZA 2KQSA 1C4PA 2FCNA 1GG3A 4OVVA 1UUPA 3DHIC 2HDEA 2JWUA 4AJWA 2PJHA 4NPNA 2N9KA 1MHHE 1KLVA 3UIOB 3SHQA 2JF5A 3RNAC 5BYRA 1UZXB 3NZ3A 2W54A 1JRUA 2IJ0A 5AZGA 3T3NA 3OJ4B 1LO5D 1FCCC 1DOYA 1TS5A 3NVVA 2CHXA 4KKJA 4XDCA 4N9F4 4DK5A 1QOFA 2GBRA 4LJOB 4XZ4A 2N4FA 3UGBB 4DXGA 2AX5A 5KHQA 3DWMA 1JWUD 4G3XB 4A55A 5DCNA 1H4RA 2L32A 5AUKA 2M17A 1R4MI 1CZPA 2X38A 3E9SA 3VH3B 2GOWA 2O6VD 4MM3A 2I1JA 3IG3A 2NBWB 3DBHI 1C78A 2DENB 3L0WB 1SXTA 2BYVE 1CMXB 2INCC 4K3CA 4KDIC 4E74A 4NQKE 3PHWB 3NVWA 4K1RB 1VLBA 3BK2A 4FLHA 1TS4A 2HE7A 3L4PA 3QIJA 3AMZA 1S1QB 2JSVX 1GUAB 3AE4B 3AU4A 4AOFA 4MH0E 2J53A 1TY2A 1KJTA 2Y5PA 2W9NA 3Q3OC 2K1FA 1KTKA 1C77A 2FE8A 1CJEA 3GOEA 3KW5B 2NR2A 1YN5A 1V1OA 4DXFA 2QCZA 2JYEA 2N0SB 5AUIA 4MGYE 3TBLD 3ZQ4A 2DZKA 4C7YA 4WAAA 2KZRA 3KLSX 3NJTA 5TR5A 2MP2B 2KQ4X 4WWMA 4PS7A 3TSSA 3AULA 3B2FA 4WQOB 2JRIB 2MRPA 3CWIA 4S0RA 1T5XD 2EKEC 3ML8A 3RNBC 3RULA 3N3KB 4DHJD 5BO4B 4OHJA 2PVOD 4MSMB 5FR6A 2BYTA 1NI3A 2WGSA 5JHBA 3ZIMA 3AN1A 2JX5A 1G6JA 4G50A 4YXDB 1L0YB 1Q10A 1P7EA 3CSFA 3P4RB 3CSTA 1WGHA 4F8CB 4EZJA 3SR6A 2KANA 3RNFC 5J18A 4JPSA 1P98A 2B76B 2WX0A 5J17A 1XCTL 3L10B 1EU4A 4HKZE 2WX1A 4LNNA 2FIDA 1TTNA 4XYCA 5GXGB 1UWXA 2ONQA 3SFDB 1IGCA 2KX0A 1I4PA 4YTPB 2LJ5A 4M0WA 1OQYA 3RFZB 1RFKA 3NZUA 2MBQA 4NY0A 3OAWA 2LGDA 1BUIC 2IO1B 3U4EG 1I4QA 3Q3MC 2NBUA 3ZTDA 4CYEA 1OEYJ 3DOWA 2NMQA 4NNJB 1LXDA 1E8ZA 2M56B 4RF0A 3APDA 4EZKA 2PKOA 2NPTB 2C7MB 2L83A 1SEBD 4M00A 4HK2A 2JZPA 4MELA 3WALA 4J3OD 2LGIA 3U7DA 2MEKA 1PGBA 2QJLA 5J2RA 4LTUA 3TUOA 2KN5A 2MJEA 3DQVA 3U8ZA 4F7ZA 1NENB 2KDIA 1D5MC 4K7UA 3TCAA 2PTLA 1JWMD 2O6VB 4YSYB 3P4PB 3ZJVA 2GBJA 3DWGC 1UGMA 3MP9A 1WXAA 1H8CA 1WXQA 2MQJA 2EELA 1E0ZA 1D5ZC 4KIKB 1GJZA 1BT0A 4MDKE 1PUTA 5EE9A 2AQ3B 2WU5B 2KLGA 1FO4A 4ARCA 3APCA 1SJHD 4W9FA 2KWUB 2V1YA 3BVMA 3GZNB 1TKYA 4CQNA 3VRBB 1JWSD 4A3OA 3MTNB 2DYBA 5LLIA 2EMTA 3BINA 1GC7A 1YD8U 1VZ8A 4ZHOA 5FR3A 2RR9A 2KNBA 5BMIA 1VRAB 1FEHA 1WGDA 1A5RA 3H7PA 1YQ4B 4NJ7A 3IT4B 4B6WA 4HJGE 2K5PA 4REZA 2WXHA 3V60A 1EM7A 2KACA 3NS1A 1JALA 1N5XA 3EHVA 4WQMA 3TL5A 4KV2A 2DBYA 3WANA 4DHJB 5DPWA 1K8RB 1ET6A 2WDVB 4XWWA 3DBRI 2LMCA 2MH7A 3P2BA 2DNFA 2AL6A 1TS2A 1FCLA 3VUWA 2AQ2B 5D94A 3GE3C 4C00A 2WDTB 2O2VB 4P16A 2PW9A 2GB1A 3PT2B 2MBBB 3ZKJC 3IHPC 4DDGD 2QMTA 3AB5A 3ZTCA 3DHHC 1AARA 1GB1A 1JQ4A 2WXKA 3VFKA 1AWDA 2G4SA 1M4VA 3VH4B 2V3PA 1BMLC 1WZ3A 1K52A 2LGYA 3RT3B 1K51A 2EKIA 1UH6A 2XK5B 2V9HA 2GMIC 3SU8X 3MHSD 1WM2A 3HM6X 1HZ6A 2LHDA 4I6LB 3R2TA 3FILB 4NAWB 2HD5B 3V61A 3KVFB 3DBLB 2ZEQA 3DCGA 4KX6B 2AL3A 2IO3B 3KYCD 1YJIA 1SE9A 1JROA 1P9DU 2IGGA 5LXHA 2LWPA 1E7VA 1J7BA 1TJEA 2FAZA 3IAS1 4HKQA 3VQIA 4WH4A 4OVUA 3H8HA 2WXRA 3MC8A 2M19A 1WMHA 1WIAA 1XLNA 2N1VA 2KFKB 2KT7A 3KQ4A 1OQRA 2BPSA 2AWTA 2RDGA 2RSUA 2WQYB 2OEDA 5H92C 1MHXA 3ECIA 2FIFA 4HCNB 3MFGA 1KOTA 2BF8B 2DZJA 4JL9A 4FJYA 4RMAA 4I6NB 1NEKB 2W3SA 2WDQB 1UWMA 1WFYA 1EF1A 4W9HA 2VH2A 1XCQL 4ZDVA 4LJPB 2JVCA 3Q8EA 3W2DA 1N61A 1PFDA 3EC8A 2CS4A 3BVZA 1C1YB 4BBNF 3ZO5B 4JIOU 1U4AA 4ICUA 4MJSB 1E8YA 4ASWC 3WAPA 3U52E 2KK8A 3QCAA 1PGAA 1WXVA 4FULA 1VJKA 4RF1A 2K0PA 4HPPA 3JSVB 1ZXIA 4RGMA 1ZOYB 4MSQB 2MBEA
chains in the Genus database with same CATH topology
3CIRB 2K9XA 3U7ZA 4B0MA 5D7GA 1IBXA 4A55A 1D5XC 2Y5CA 1I4HA 5T8IA 2L32A 5AUKA 4OW0A 4WIPA 3MHZA 1E10A 1CZPA 2WU2B 2X38A 3AE6B 1NYRA 1MI0A 1T6BX 3E9SA 2V3NA 4IKGA 4ZOHC 1OQQA 1V1PB 1FNVA 2PVGC 1N62A 2DYOA 1BXTA 4Q2JA 4L1BA 1QQRA 3ETRA 4LK0M 1QKZA 2W82A 2WXOA 2J52A 1K50A 4KGSA 1C78A 2ZW1A 1HQRD 1ZE3D 2NTSA 1WSPA 1SXTA 2ZW0A 2Y3AA 1J7CA 1XF5L 4AQ7A 1TY0A 3NVWA 1VLBA 1FNUA 3BK2A 3W5VB 1TS4A 2WS3B 3NVZA 1J7AA 1SIJA 2SEBD 2BTEA 3L4PA 4A9AA 2KN4A 3Q8BA 3HUIA 3AE8B 3B2GA 3AMZA 1KFYB 2MJ3A 1FNWA 2PLPA 2JSVX 3AE7B 3AE4B 1SF0A 1C4AA 2J4XA 1A70A 1N60A 1WRIA 3B9JA 3LXFA 3BWUD 3FAHA 1XLPA 2J53A 1TYGB 3W1SA 4ZHPA 1TY2A 3C8YA 3AE9B 2Y5PA 5JXVA 1VR9A 1ET9A 4YTMB 2BBCA 4ARIA 2V4IB 4L23A 4WAFA 1KTKA 1C77A 1AW7A 2FE8A 1CJEA 1QLBB 1YN5A 1V1OA 2CJOA 2NTTA 4DXFA 2GRIA 5FKAC 4YSZB 1EU3A 2JYEA 2N0SB 3R2IA 5AUIA 3ZQ4A 4EE2A 4C7YA 5C3JB 1XLQA 1PGXA 3KLSX 3UI3A 3BIID 1C9FA 1EWYC 2L1AA 2BS3B 2R61A 2KQ4X 3P4QB 4WWMA 1L4ZB 1KF6B 3TSSA 3TEYA 3B2FA 2XN9C 3CWIA 4KKIA 1T5XD 1DOXA 2K22A 4IDIA 5FK9C 2W55A 2WP9B 4D2KA 1PDXA 5G5HA 4OHJA 4C56C 1E9MA 4YTNB 2PVOD 4TQ1A 5HFYA 1L4DB 4XDDA 2BYTA 2LJIA 3OWEB 1NI3A 3AN1A 4MT5A 1FXAA 5EE3A 4L2YA 3I9V1 2JX5A 3PZ8A 3AEAB 3E56A 5EE0A 4A90A 2FUG1 5E6JA 3BYTB 4YXDB 1L0YB 1Q10A 1I7HA 1SE2A 1P7EA 3P4RB 1ENFA 3FILA 3P1MA 4ZRPA 3SR6A 1PYWD 3AEDB 1RM6C 1UNSA 1HA5A 1HEZE 1E7PB 4JPSA 2WXFA 3W5UB 5D3IB 1ZUD2 2TSSA 3LYYA 3ZJUA 2XNAC 2B76B 3BYYB 3AEGB 1XCTL 3IT6B 2KWDA 5LNK1 2E6XA 1EU4A 4HKZE 1CQVA 2KAJA 2WNMA 4AS1A 1ACCA 5GXGB 1GPXA 4RNAA 1UWXA 2ONQA 3SFDB 2GI9A 1IGCA 2VZKB 1I4PA 4YTPB 1JMLA 4M0WA 3SFEB 3RFZB 5BYQA 1RFKA 1NYQA 1Y56A 1L0XB 1L6UA 5EE1A 2CJNA 1BUIC 4OVZA 2WXMA 1FIQA 2PIAA 3U4EG 1SSNA 1I4QA 3AM9A 3AE5B 1AN8A 1MVKA 2BS2B 2NMQA 3T3OA 2LHEA 2M56B 4RF0A 2BB6A 2PKOA 3GS2A 2L83A 1VDVA 4WURA 1SEBD 4RH6A 3AE1B 3P42A 3URYA 2JZPA 1YJJA 3HRDD 4DQOC 1YMHE 5G5GA 3U2SC 2ACZB 1YNTE 2DWQA 1ZP0B 1DYQA 1EWCA 1WYGA 4J3OD 2LGIA 4N58A 3WCQA 2MEKA 1JW9D 1PGBA 2QJLA 3TEZA 2I2YA 4LTUA 1T3QA 4OZCA 3TUOA 2MJEA 1C4CA 4HRSA 1NENB 4TSSA 1KRHA 4FXCA 4MACA 4H2AA 1D5MC 2J42A 1KH0A 2PTLA 1QOBA 1JWMD 4YSYB 4US8A 4OZAA 3P4PB 4TMAB 1N63A 2FBWB 3ZJVA 4RFBA 1QT9A 3DWGC 4XE0A 2E3TA 1FMAD 1JRPA 1JCKB 4JWUC 2WXJA 3MP9A 1FXIA 1QOAA 1XXGA 1WXQA 3V3XA 2EELA 1E0ZA 1IBXB 3GP7A 1D5ZC 1XLOA 1TS3A 1FRRA 1SJED 1ZXHA 1P7FA 1FFUA 1PUTA 5EE9A 5H8YE 2AQ3B 2WU5B 4R3DA 1FO4A 4ARCA 3MC0B 1SJHD 1B1ZA 3Q8AA 3PO0A 2CU3A 4MM3B 3BVMA 5HG2A 2BW2A 1TKYA 2HTME 1KLUD 4CQNA 1C76A 1JWSD 1NVID 1ZPSA 3BVGA 3R8BA 3VRBB 3EGRA 3NVYA 3AE2B 3O13A 1V1PA 2WXQA 1DGJA 3HVDA 2OHFA 2INPE 3V05A 2LFIA 1V97A 2YEPF 2V0GA 1VZ8A 1I4XA 1WGKA 4ZHOA 5FR3A 3W9CB 4TQ0A 4GDLB 3AEEB 4OZBA 5BMIA 1VRAB 1FEHA 2RDHA 3VR8B 2K3UA 1YQ4B 1K53A 2MJDA 1N5WA 1F2RI 3BK1A 1TKEA 2I38A 3IT4B 4JWSC 4HJGE 1WWTA 2K5PA 4REZA 1FM0D 3J9CA 4RCOA 1D4BA 3MJ5A 2WXHA 1L6VA 2QSDA 3BZDB 1EM7A 2WXLA 2KACA 2RMMA 3NS1A 1JALA 1N5XA 1ROEA 4WQMA 5D3DA 1L0VB 5HI1A 2Z8LA 2DBYA 4NJCA 1ET6A 2WDVB 4MH8A 4XWWA 2WXIA 1L5PA 2LMCA 1ESFA 2MH7A 1RWSA 1TS2A 4GDKB 1FCLA 2AQ2B 1XO3A 3AECB 2QILA 3NUHB 4N59A 3TEXA 3ZYYX 2L52A 4B0EA 3ZGZA 4P16A 2PW9A 2WLBA 3AV8A 1F2RC 1QOGA 2GB1A 4NZLB 4C7ZA 1E6EB 1SB3C 4YSXB 1B9RA 1F77A 1V8CA 1IGDA 2WXNA 4ZYSA 2QMTA 3GB1A 1SBBB 3AB5A 1GB1A 1JQ4A 2WXKA 1YQ3B 3VR9B 3ZJTA 1AWDA 1M4VA 3ABVB 2BS4B 4RGTA 1GB4A 2RPVA 3AE3B 2V3PA 3IXSA 1BMLC 4P6VF 1DOIA 2INNE 4RGNA 4HROA 2SAKA 2LUMA 1K52A 1SE3A 1FRDA 2ICIA 2PMVA 1K51A 2EKIA 4XWTA 1VZ6A 3AEFB 1TKGA 2QIEB 1HZ6A 2LHDA 1HZ5A 1AYFA 3R2TA 2QEJC 4LLGM 2LEKA 5MPOA 1FFVA 1RYJA 1HXYD 3FILB 4NAWB 2H88B 4A8XC 2WXGA 2DLBA 5C2TB 2M0AA 3AH7A 4YT0B 3TEWA 3IAM1 5BYSA 1D6EC 4KGRA 3PZ7A 1YN3A 4KX6B 5TSSA 2IGHA 2JQRB 1ZDVA 1YJIA 2D5GA 1JROA 3VRAB 1F0ZA 2IGGA 1MPEA 3EUB2 3FC4A 3RPFC 2AQ1B 2WXPA 1J7BA 1TJEA 1XEEA 4ITKA 3KWVA 2W3RA 1OFFA 3AEBB 5BMHA 4ZRQA 3NRZA 3KWLA 4JX1C 3IAS1 1QILA 3P63A 1KLGD 4HKQA 3VQIA 1QF6A 4WH4A 3H8HA 2WXRA 4O1NA 3P4SB 1IUEA 2M19A 2JXTA 3LB8C 3Q8FA 5BMGA 1YN4A 1XLNA 3KQ4A 3HVZA 1OQRA 1ZDXA 5I4DA 1JWBD 1STEA 2RDGA 4US9A 2WQYB 2OEDA 1C4PA 3SEBA 5H92C 1MHXA 3MFGA 1I4GA 1UUPA 1TZOA 4KGTA 2HDEA 2JWUA 4YWGG 1C79A 3Q8CA 2N7JA 1NEKB 2W3SA 2BT6A 2KMMA 4USAA 2IDYA 1JWAD 2N9KA 2WDQB 1MHHE 2ON8A 1UWMA 3EA6A 4C80A 2Q5WD 1XCQL 2VZKD 2H89B 4RGOS 3Q69A 1GAQB 4UDUC 5BYRA 2KDMA 2IGDA 2N9LA 3Q8EA 4IOIE 3NZ3A 3W2DA 4A6QA 2W54A 2YEPB 2IJ0A 2JU6X 1VZ7A 1N61A 4JE3B 3T3NA 1LO5D 1I4RA 1PFDA 1SE4A 3BVZA 1FCCC 4PT5A 4HEA1 3N9YC 1DOYA 1GOZA 2IPKD 1TS5A 3NVVA 3I57A 1R7SA 2BB5A 4N6EB 4KKJA 4XDCA 2WDRB 1CK1A 3U52E 1QOFA 1PGAA 2DYMA 4GLSC 1UGJA 2G9HD 2JYTA 1VJKA 4RF1A 5HHDG 4NAMA 2K0PA 4DXGA 2AX5A 2G1EA 1ZXIA 1FD6A 4RGMA 1ZOYB 3DWMA 1JWUD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SSN A;  1C79 A;  1C76 A;  2SAK A;  1BUI C;  1C77 A;  1C78 A; 
#chains in the Genus database with same CATH topology
 2N1W A;  1IBX A;  1D5X C;  2Y5C A;  4WIP A;  2WU2 B;  4M01 A;  4IKG A;  3NG0 A;  3H9D A;  1FNV A;  2PVG C;  5JZE B;  4M8M A;  4W9J A;  4W9D A;  3RNC C;  1V2Y A;  4CHK A;  3JW0 X;  1QQR A;  4L1B A;  4WJN A;  3Q3J A;  1Z2M A;  4P1B C;  1T0R C;  2KQ7 A;  5IO9 A;  1V49 A;  1ZE3 D;  4K7W A;  4HJK A;  4HVB A;  1NI2 A;  2NVU I;  1OTR B;  2JZZ A;  3U30 A;  4AQ7 A;  2KYW A;  4GU2 A;  1WF9 A;  2ZPY A;  3W5V B;  2KN4 A;  4FJV B;  2IYD B;  3RNG C;  3HUI A;  3PZD A;  3B2G A;  1N6Z A;  3NS8 A;  3QK0 A;  2MJ3 A;  1FNW A;  2PLP A;  3GZN I;  1WY8 A;  3L17 A;  3B9J A;  3BWU D;  4IWQ A;  1XLP A;  1WR6 E;  3AE9 B;  2JY6 A;  3VAW A;  4ZRJ A;  2BBC A;  1TGZ B;  3NOB A;  1AW7 A;  2CJO A;  3NY5 A;  4GDK A;  2GBN A;  4ZRI A;  2CHZ A;  1E8X A;  2I1K A;  3UI3 A;  3V6E B;  2L1A A;  1C9F A;  2KDB A;  1J19 A;  2K6Q A;  2C60 A;  3PRE A;  1DOX A;  2Z0E B;  4D2K A;  4C56 C;  4YTN B;  4TQ1 A;  1VD2 A;  3OWE B;  1F9J A;  5IN7 A;  4ZRK A;  2C7H A;  2D3B A;  2M8S A;  3AEA B;  2AYO B;  3T9L A;  4A90 A;  5E6J A;  3BYT B;  4BKS A;  1WX8 A;  2K8B A;  1HTO A;  4ZRP A;  3ENE A;  2L7R A;  3A1Q A;  1WYW B;  1HEZ E;  3RZF A;  2Y5B B;  1ZUD 2;  2TSS A;  2XNA C;  3A9K B;  5LXI B;  3A9J A;  2X8X X;  4EKU A;  3IT6 B;  2KWD A;  1CQV A;  2WNM A;  4AS1 A;  3OLM D;  1ACC A;  4E71 A;  1JML A;  4GB9 A;  4B95 A;  1L0X B;  4IC7 B;  2KMA A;  3DVG X;  4KZC A;  4PYU A;  3DBL I;  5EE1 A;  1FIQ A;  2PIA A;  5GMV A;  4ANV A;  3T3O A;  2LHE A;  1VDV A;  3URY A;  3AE1 B;  4DQO C;  1YMH E;  2B3A A;  2CU1 A;  1T0Q C;  1DYQ A;  5DPR A;  1EUV B;  3TEZ A;  3UQA A;  2RGF A;  3ML9 A;  4HRS A;  3ZRC A;  1WGG A;  2D3C A;  4MAC A;  3PRZ A;  2LRU A;  4LDT D;  2YLM A;  1N63 A;  2FBW B;  4RFB A;  1QT9 A;  3DBS A;  3R66 C;  4XE0 A;  1FXI A;  2MSE D;  4ICV A;  2YVC A;  2K25 A;  3GP7 A;  5AZF A;  5AZH A;  2KMC A;  3V6C B;  3Q8A A;  3PO0 A;  5HG2 A;  4A20 A;  3N1Y C;  2BW2 A;  2LGX A;  3AU5 A;  3OJ3 A;  3NVY A;  1LFD A;  2ZCC A;  2PE9 A;  3AE2 B;  4BZA A;  1IP9 A;  3C19 A;  4DDI D;  1MJD A;  2WXQ A;  2OHF A;  3H6N A;  1V97 A;  2JUO A;  1WGK A;  2A4Z A;  4GDL B;  2D3G A;  2L05 A;  2RDH A;  2K3U A;  1K53 A;  1YX5 B;  1N5W A;  1F2R I;  1TKE A;  2L3Z A;  4JWS C;  1WWT A;  3J9C A;  2NCN A;  1D4B A;  1F1H A;  2JXX A;  2OJW A;  2QSD A;  3H1U A;  2WWZ A;  2PE6 B;  4M8N A;  1I35 A;  3A4S C;  3ZW3 A;  4W9L A;  2KJ6 A;  5DPS A;  1L5P A;  1WJU A;  3NUH B;  4YL8 A;  2N9P C;  2R2O A;  3AV8 A;  3B1L X;  4YSX B;  1QOG A;  1E6E B;  1SB3 C;  3N1Z C;  4G11 A;  2WHI A;  2BQQ A;  1IGD A;  4ZYS A;  3GB1 A;  3PVL A;  3KYD D;  2MP2 A;  3RNE C;  2ZPN A;  2BYF A;  2VRR B;  3ABV B;  3WA0 A;  2JPH A;  4RGT A;  3AE3 B;  3PV1 A;  4P6V F;  1DOI A;  2INN E;  4QAY A;  4RGN A;  4HRO A;  1Q1O A;  2LUM A;  1SE3 A;  3APF A;  2ICI A;  4W9G A;  4XWT A;  1VZ6 A;  1D3Z A;  2Z0D B;  4KSL C;  2CHW A;  2QEJ C;  4LLG M;  3H7P B;  4A8X C;  2WXG A;  1Q5W B;  5C2T B;  3B0A A;  4II3 B;  4YT0 B;  1D6E C;  1YN3 A;  2CKH B;  3QQ8 B;  2XEW A;  3ONS A;  2IGH A;  2RDB C;  1ISN A;  1TZ1 A;  2N7E A;  4A3P A;  3V62 A;  3EUB 2;  3FC4 A;  2MCN B;  4PS8 A;  4ITK A;  3KWV A;  4ZRQ A;  4JX1 C;  3EFU A;  1WI0 A;  3QA8 A;  1QF6 A;  3NHE B;  3HIZ A;  4GIV A;  3R7Q A;  1HTQ A;  4ANW A;  1GNU A;  1OGW A;  1EO6 A;  4M02 A;  1IUE A;  4DHZ B;  1SGH A;  1WX9 A;  2V4L A;  1ZDX A;  3VTW A;  1MFW A;  1JWB D;  3EFC A;  1ZGU B;  3SEB A;  1Y8R C;  4DBG A;  2PPH A;  1TZO A;  4KGT A;  4YWG G;  5CTR C;  4IM3 A;  1GC6 A;  2N7J A;  1IPG A;  2NPT A;  1JWA D;  2GBM A;  1V86 A;  4F1S A;  4C80 A;  3L16 A;  2Q5W D;  3ZNH B;  3N30 A;  2H89 B;  4RGO S;  4UDU C;  1GAQ B;  1J8C A;  2KDM A;  1WM3 A;  3TIX A;  4IOI E;  4A6Q A;  3MC9 A;  2YEP B;  1C3T A;  3VXW A;  2JU6 X;  4HLE A;  1VZ7 A;  4JE3 B;  2REX A;  4BKG A;  2V3S A;  3C0R B;  3QHT A;  4PT5 A;  4HEA 1;  3N9Y C;  1GOZ A;  2O6V A;  2WDR B;  1VCB A;  2DYM A;  2L0F A;  4GLS C;  5C23 A;  2G9H D;  2KHW B;  2JYT A;  1YQB A;  1WXS A;  4NAM A;  2D3A A;  3VUX A;  2G1E A;  2MLB A;  3RI7 C;  2KXJ A;  1WJN A;  1V5T A;  4TKN A;  3U7Z A;  4B0M A;  5D7G A;  4BKS D;  5JHA A;  4KIK A;  5E6N A;  1WMH B;  4OW0 A;  3MHZ A;  1XQQ A;  3AE6 B;  5CX3 A;  1T6B X;  4XX5 A;  2M4N A;  2FNJ B;  4EFO A;  1OQQ A;  1V1P B;  2MA9 B;  4WJO A;  2DYO A;  3QAQ A;  3RUI B;  1QKZ A;  2W82 A;  2WXO A;  2J52 A;  3TMP B;  4KGS A;  2ZW1 A;  1HQR D;  2NTS A;  4WWN A;  5IOI A;  1WSP A;  2ZJD A;  2ZW0 A;  2Y3A A;  3ZDM C;  1WZ0 A;  5D2M B;  1TY0 A;  2DHZ A;  2G3Q B;  3VDZ A;  5L95 C;  1ZW7 A;  1FNU A;  3M63 B;  2SEB D;  3Q8B A;  5HKH A;  2KWC A;  3ZXV A;  2J0J A;  3AE8 B;  3PRP B;  3B08 A;  3X0W A;  3AE7 B;  2DAJ A;  3CF6 E;  1N60 A;  2J7Q B;  2ZNV B;  1WRI A;  3N32 A;  3N20 C;  1TYG B;  3W1S A;  5JXV A;  1VR9 A;  4YTM B;  1I42 A;  4HCP B;  4ARI A;  4EZL A;  4L23 A;  4WAF A;  1M94 A;  4GGQ A;  4EUT A;  2NTT A;  2GRI A;  5FKA C;  3PSE B;  4YSZ B;  1EU3 A;  4EE2 A;  2LD9 A;  5C3J B;  3ZDT A;  2O2V A;  1XLQ A;  5IAA C;  2L76 A;  4C4V B;  2M0X A;  3RCZ A;  4HPM B;  3P4Q B;  1L4Z B;  3TEY A;  3ZNG C;  2XN9 C;  4KKI A;  2K22 A;  4IDI A;  5FK9 C;  5E6P A;  1PDX A;  1E9M A;  5HFY A;  4XDD A;  3Q3F A;  3Q2A C;  4WJQ A;  3QC8 B;  3UIP B;  4MEM A;  2KC2 A;  4MT5 A;  5EE3 A;  2MBO A;  3LJ3 A;  4L2Y A;  1MG8 A;  3PPA A;  3PZ8 A;  2Z59 B;  4W9C A;  5CHW A;  3E56 A;  2XK5 A;  3R7R A;  5EE0 A;  1QZE A;  1V80 A;  2KWV B;  2BYE A;  1UBI A;  2EMS A;  3FIL A;  4NAW A;  3P1M A;  3RZW C;  5EDS A;  1PYW D;  3AED B;  2JT4 B;  3W1S C;  1YX6 B;  1HA5 A;  1WE6 A;  1RFA A;  3I63 C;  5CHF A;  3LYY A;  3ZJU A;  2IND C;  3EEC A;  2KDF B;  2KAJ A;  3N1X C;  4URK A;  2L8J A;  5IP4 D;  1GPX A;  4RNA A;  3VUY A;  5BYQ A;  2KTF A;  1Y56 A;  3PHX B;  4KSK C;  5L83 A;  2ZVO A;  4GOC A;  1SSN A;  2IO2 B;  2HJ1 A;  4FN2 A;  1IYF A;  2KFK A;  3AE5 B;  1AN8 A;  1MVK A;  4RM8 A;  3M3J A;  1LM8 B;  4WUR A;  1S3S G;  1LQB A;  4NJ6 A;  4GN1 A;  4RH6 A;  2KTR A;  1T0Y A;  2DWQ A;  4HDQ A;  1WYG A;  4N58 A;  2I2Y A;  1T3Q A;  4GXB A;  4FA6 A;  2GBK A;  2K8C A;  1KRH A;  1QOB A;  4BOZ B;  4HXD A;  4OZA A;  4RM9 A;  1J0G A;  4MJS A;  3SD5 A;  4MGK E;  1JRP A;  3A9J B;  4MGZ E;  3VTV A;  2J0K A;  4JWU C;  2LGS A;  2WXJ A;  3AI5 A;  2KDE B;  1XXG A;  2N9X A;  1XLO A;  3DVG Y;  1FRR A;  3JSV A;  1SJE D;  2K6D B;  4IUM B;  5C1Z A;  1P7F A;  2KFJ A;  2LVQ A;  4R3D A;  2K39 A;  3ZRF A;  3T8M A;  1T0S C;  4MM3 B;  1RLF A;  2KC1 A;  2IBI B;  2HTM E;  1KLU D;  4GSW A;  1NVI D;  1Q0W B;  1ZPS A;  3BVG A;  3EGR A;  4GMV A;  2BVC A;  1DGJ A;  3ZNZ B;  4LNF A;  4ZYN A;  2INP E;  2YEP F;  2JZ3 B;  1I4X A;  2ZZP B;  1TT5 B;  2RPQ A;  2CR5 A;  3VR8 B;  4BOS C;  1NBF C;  4RCO A;  3PLV A;  1UBQ A;  3K9O B;  3VVW B;  1ROE A;  5D3D A;  1L0V B;  5G2N A;  2DAF A;  2Z8L A;  3IBE A;  2PEA A;  4NJC A;  2ASQ A;  3W1Y A;  1ESF A;  5IA7 A;  1FXT B;  1XO3 A;  2QIL A;  4W9E A;  3O65 B;  4B0E A;  3ZGZ A;  4C7Z A;  4NZL B;  1F2R C;  2KJR A;  3Q6B A;  2KD0 A;  2DZI A;  1F77 A;  5KHO A;  3UF8 A;  1V8C A;  2WXN A;  1SBB B;  4JQW C;  1YQ3 B;  2KVZ A;  2BS4 B;  2RPV A;  2LI5 A;  5D6J B;  3DBR B;  3AEF B;  1XD3 B;  1AYF A;  1E5W A;  2LEK A;  1RYJ A;  1HXY D;  4ANU A;  2BGF A;  3TEW A;  3IAM 1;  2D07 B;  2MHJ A;  5BYS A;  3HK0 A;  4KZ0 A;  2JQR B;  2C9W B;  4DHZ E;  2D5G A;  3PRM B;  2LUE A;  2IY0 B;  1F0Z A;  2N9E B;  4AJY B;  5AEK B;  1XEE A;  4AWJ A;  2D10 A;  1OFF A;  2W3R A;  5BMH A;  3A9K A;  3NRZ A;  3KWL A;  4J6I A;  1QIL A;  4M0W B;  1V9J A;  1V6E A;  4O1N A;  2D2Q A;  3P4S B;  2L0T A;  2JXT A;  3TJP A;  3HHM A;  3HVZ A;  1PQS A;  2MW5 A;  3PS6 A;  1STE A;  4US9 A;  4FJZ A;  1R4N B;  4ACF A;  1I4G A;  2M1M A;  3UQB A;  2HJ8 A;  1C79 A;  3Q8C A;  4USA A;  2BT6 A;  2KMM A;  2MX2 A;  2IDY A;  2LRW A;  2ON8 A;  3EA6 A;  2OOB B;  3L13 A;  2VZK D;  2UYZ B;  4I6P A;  3Q69 A;  2IGD A;  2N9L A;  4IM2 A;  1WJ4 A;  1E8W A;  1I4R A;  1SE4 A;  3DPD A;  2QC8 A;  2IPK D;  3I57 A;  5DPT A;  4BKT A;  1R7S A;  4MGI E;  2BB5 A;  4N6E B;  1KM7 A;  2KJH B;  1CK1 A;  1TBE A;  3ZVV A;  1UGJ A;  2DX5 B;  5JH5 C;  5HHD G;  3ZUN A;  4IWP A;  1RRB A;  1RAX A;  4FHJ A;  1FD6 A;  2BWF A;  3CIR B;  2K9X A;  3ZNI D;  2FCQ A;  3KUC B;  1I4H A;  3DVN U;  3IVF A;  5T8I A;  4S17 A;  3R3M A;  3UIN B;  1SIF A;  1E10 A;  1NYR A;  1MI0 A;  4ZOH C;  1E90 A;  2V3N A;  2VH1 A;  4WWO A;  1N62 A;  2KLC A;  1BXT A;  4Q2J A;  2JRH A;  1OEY A;  3ETR A;  4LK0 M;  4TV3 A;  1K50 A;  2QHO A;  4LNI A;  1J7C A;  3S2A A;  1XF5 L;  3QAR A;  2LVP A;  4LNK A;  2WS3 B;  4GDL A;  3NVZ A;  1J7A A;  1SIJ A;  1YIW A;  2BTE A;  4A9A A;  2OJR A;  2XBB C;  1KFY B;  1WX7 A;  1SF0 A;  1C4A A;  2J4X A;  2R2Q A;  1A70 A;  4G0N B;  3RD2 A;  3MJW A;  3LXF A;  2KO3 A;  4WWP A;  3FAH A;  2LXC A;  3D32 A;  2K8H A;  4BFR A;  2AEH A;  4ZHP A;  3C8Y A;  4IM0 A;  4PS3 A;  2KVR A;  2ZCB A;  4LCD E;  1ET9 A;  3PGE A;  2JWZ A;  2V4I B;  3NZS A;  1QLB B;  2GLS A;  3RMK C;  1WH3 A;  3R2I A;  2BKR B;  3A4R A;  2FCS A;  1PGX A;  1L7Y A;  3BII D;  3HM3 A;  1EWY C;  4LDT B;  4HDO A;  2BS3 B;  2R61 A;  3A33 B;  1KF6 B;  4FHK A;  3IFW B;  1V5O A;  2W55 A;  2WP9 B;  5G5H A;  1L4D B;  2LJI A;  3I5J C;  4JGH B;  3WAO A;  1UD7 A;  1FXA A;  3I9V 1;  1WE7 A;  3X23 A;  2A5U A;  2FUG 1;  1SE2 A;  1I7H A;  1ZKH A;  3KUD B;  1ENF A;  4IWO A;  1LGR A;  1WXM A;  1RM6 C;  1UNS A;  2DZM A;  1E7P B;  3Q14 C;  2WXF A;  3W5U B;  5D3I B;  4BBN C;  3BYY B;  3AEG B;  3L54 A;  3DHG C;  4NQL B;  5LNK 1;  2E6X A;  1TIF A;  2UWQ A;  4FBJ B;  4FAD A;  2GI9 A;  1MG4 A;  2VZK B;  4TUU A;  3RN9 C;  3SFE B;  1NYQ A;  3WIM A;  4EOY A;  1L6U A;  3L08 A;  4EEW A;  2CJN A;  4OVZ A;  2WXM A;  2N7D A;  2WYQ A;  2L00 B;  1WJ6 A;  2D11 A;  3AM9 A;  2BS2 B;  3QX1 A;  4HPL B;  2BB6 A;  2FUH B;  3ZLZ A;  3GS2 A;  4P1C C;  3P42 A;  1Z5S B;  1YJJ A;  3HRD D;  5G5G A;  3U2S C;  1EF5 A;  2ACZ B;  1YNT E;  1ZP0 B;  1EWC A;  1P0R A;  1YJ1 A;  3VTU A;  3WCQ A;  4IW0 A;  1JW9 D;  2LZ6 A;  4X57 B;  3JVZ X;  4OZC A;  2LVO A;  1C4C A;  4K81 A;  3M95 A;  4TSS A;  1R4M B;  3LDZ E;  4FXC A;  4H2A A;  2J42 A;  1KH0 A;  5IKC M;  4K7S A;  2NS5 A;  2IY1 B;  1R4N I;  1P3Q U;  4US8 A;  4TMA B;  2ZVN A;  3DBH B;  2G4D B;  4DWF A;  1P1A A;  2E3T A;  4E3C A;  1FMA D;  2KX3 A;  1JCK B;  1QOA A;  3V3X A;  1HE8 A;  1IBX B;  1TS3 A;  2BKF A;  1ZXH A;  4B9K A;  2QDF A;  2HTH A;  3Q3N C;  1FFU A;  5H8Y E;  3PTF C;  2IO0 B;  4DXA B;  3H7S A;  3MC0 B;  5CHV C;  1B1Z A;  2LXA A;  2CU3 A;  4XC2 A;  1C76 A;  3R8B A;  3I3T B;  3O13 A;  1V1P A;  4JLC A;  2LAS A;  3VHT C;  3HVD A;  1UF0 A;  4II2 B;  2IZV B;  3V05 A;  2LFI A;  2UU7 A;  3RYT A;  3AXC A;  2V0G A;  2KTR B;  3DVN V;  4WJP A;  3M62 B;  4PK1 A;  3PLU A;  3W9C B;  4TQ0 A;  3AEE B;  4OZB A;  2MJD A;  1L2N A;  3BK1 A;  2RD0 A;  3KUZ A;  2I38 A;  2KKC A;  4IG7 B;  1FM0 D;  3MJ5 A;  1L6V A;  3BZD B;  2WXL A;  2RMM A;  3JYU A;  5HI1 A;  1X1M A;  4K3B A;  2MWS B;  4MH8 A;  3CMM B;  4P7I A;  2WXI A;  3GE8 C;  1RWS A;  1UEL A;  4GDK B;  3OG5 A;  4ANX A;  4HWI B;  4N59 A;  3AEC B;  4BAX A;  3TEX A;  3ZYY X;  2L52 A;  2WLB A;  2C5L C;  1B9R A;  1XT9 B;  4KVG B;  2BWE S;  3FKY A;  4C4V A;  3ALB A;  3VR9 B;  3ZJT A;  2G45 B;  3DDC B;  1GB4 A;  3IXS A;  3KH0 A;  4W9I A;  2SAK A;  1FRD A;  5G55 A;  1YOV B;  4W9K A;  4XGA B;  2PMV A;  4AUQ C;  4PYZ A;  2C7N B;  1V81 A;  1TKG A;  2QIE B;  1HZ5 A;  1FPY A;  1WGR A;  1WGY A;  5MPO A;  1FFV A;  2H88 B;  4LNO A;  2DLB A;  2KOX A;  2FCM A;  2NBV B;  2M0A A;  3A1Q B;  3AH7 A;  4CO7 A;  4KGR A;  3PZ7 A;  2ZNV C;  1WR1 A;  5TSS A;  3QWZ B;  1ZDV A;  3VRA B;  1MPE A;  3RPF C;  2AQ1 B;  2WXP A;  5E6O A;  3AEB B;  3BY4 B;  1E7U A;  3P63 A;  1KLG D;  1WRD B;  2J0M A;  3WAM A;  2MBH A;  4BVU C;  4KDL B;  3LB8 C;  3Q8F A;  5BMG A;  1YN4 A;  1F52 A;  4AP4 C;  3ZXR A;  3SDL C;  5I4D A;  3K9P B;  1NDD A;  3QJZ A;  2KQS A;  1C4P A;  2FCN A;  1GG3 A;  4OVV A;  1UUP A;  3DHI C;  2HDE A;  2JWU A;  4AJW A;  2PJH A;  4NPN A;  2N9K A;  1MHH E;  1KLV A;  3UIO B;  3SHQ A;  2JF5 A;  3RNA C;  5BYR A;  1UZX B;  3NZ3 A;  2W54 A;  1JRU A;  2IJ0 A;  5AZG A;  3T3N A;  3OJ4 B;  1LO5 D;  1FCC C;  1DOY A;  1TS5 A;  3NVV A;  2CHX A;  4KKJ A;  4XDC A;  4N9F 4;  4DK5 A;  1QOF A;  2GBR A;  4LJO B;  4XZ4 A;  2N4F A;  3UGB B;  4DXG A;  2AX5 A;  5KHQ A;  3DWM A;  1JWU D;  4G3X B;  4A55 A;  5DCN A;  1H4R A;  2L32 A;  5AUK A;  2M17 A;  1R4M I;  1CZP A;  2X38 A;  3E9S A;  3VH3 B;  2GOW A;  2O6V D;  4MM3 A;  2I1J A;  3IG3 A;  2NBW B;  3DBH I;  1C78 A;  2DEN B;  3L0W B;  1SXT A;  2BYV E;  1CMX B;  2INC C;  4K3C A;  4KDI C;  4E74 A;  4NQK E;  3PHW B;  3NVW A;  4K1R B;  1VLB A;  3BK2 A;  4FLH A;  1TS4 A;  2HE7 A;  3L4P A;  3QIJ A;  3AMZ A;  1S1Q B;  2JSV X;  1GUA B;  3AE4 B;  3AU4 A;  4AOF A;  4MH0 E;  2J53 A;  1TY2 A;  1KJT A;  2Y5P A;  2W9N A;  3Q3O C;  2K1F A;  1KTK A;  1C77 A;  2FE8 A;  1CJE A;  3GOE A;  3KW5 B;  2NR2 A;  1YN5 A;  1V1O A;  4DXF A;  2QCZ A;  2JYE A;  2N0S B;  5AUI A;  4MGY E;  3TBL D;  3ZQ4 A;  2DZK A;  4C7Y A;  4WAA A;  2KZR A;  3KLS X;  3NJT A;  5TR5 A;  2MP2 B;  2KQ4 X;  4WWM A;  4PS7 A;  3TSS A;  3AUL A;  3B2F A;  4WQO B;  2JRI B;  2MRP A;  3CWI A;  4S0R A;  1T5X D;  2EKE C;  3ML8 A;  3RNB C;  3RUL A;  3N3K B;  4DHJ D;  5BO4 B;  4OHJ A;  2PVO D;  4MSM B;  5FR6 A;  2BYT A;  1NI3 A;  2WGS A;  5JHB A;  3ZIM A;  3AN1 A;  2JX5 A;  1G6J A;  4G50 A;  4YXD B;  1L0Y B;  1Q10 A;  1P7E A;  3CSF A;  3P4R B;  3CST A;  1WGH A;  4F8C B;  4EZJ A;  3SR6 A;  2KAN A;  3RNF C;  5J18 A;  4JPS A;  1P98 A;  2B76 B;  2WX0 A;  5J17 A;  1XCT L;  3L10 B;  1EU4 A;  4HKZ E;  2WX1 A;  4LNN A;  2FID A;  1TTN A;  4XYC A;  5GXG B;  1UWX A;  2ONQ A;  3SFD B;  1IGC A;  2KX0 A;  1I4P A;  4YTP B;  2LJ5 A;  4M0W A;  1OQY A;  3RFZ B;  1RFK A;  3NZU A;  2MBQ A;  4NY0 A;  3OAW A;  2LGD A;  1BUI C;  2IO1 B;  3U4E G;  1I4Q A;  3Q3M C;  2NBU A;  3ZTD A;  4CYE A;  1OEY J;  3DOW A;  2NMQ A;  4NNJ B;  1LXD A;  1E8Z A;  2M56 B;  4RF0 A;  3APD A;  4EZK A;  2PKO A;  2NPT B;  2C7M B;  2L83 A;  1SEB D;  4M00 A;  4HK2 A;  2JZP A;  4MEL A;  3WAL A;  4J3O D;  2LGI A;  3U7D A;  2MEK A;  1PGB A;  2QJL A;  5J2R A;  4LTU A;  3TUO A;  2KN5 A;  2MJE A;  3DQV A;  3U8Z A;  4F7Z A;  1NEN B;  2KDI A;  1D5M C;  4K7U A;  3TCA A;  2PTL A;  1JWM D;  2O6V B;  4YSY B;  3P4P B;  3ZJV A;  2GBJ A;  3DWG C;  1UGM A;  3MP9 A;  1WXA A;  1H8C A;  1WXQ A;  2MQJ A;  2EEL A;  1E0Z A;  1D5Z C;  4KIK B;  1GJZ A;  1BT0 A;  4MDK E;  1PUT A;  5EE9 A;  2AQ3 B;  2WU5 B;  2KLG A;  1FO4 A;  4ARC A;  3APC A;  1SJH D;  4W9F A;  2KWU B;  2V1Y A;  3BVM A;  3GZN B;  1TKY A;  4CQN A;  3VRB B;  1JWS D;  4A3O A;  3MTN B;  2DYB A;  5LLI A;  2EMT A;  3BIN A;  1GC7 A;  1YD8 U;  1VZ8 A;  4ZHO A;  5FR3 A;  2RR9 A;  2KNB A;  5BMI A;  1VRA B;  1FEH A;  1WGD A;  1A5R A;  3H7P A;  1YQ4 B;  4NJ7 A;  3IT4 B;  4B6W A;  4HJG E;  2K5P A;  4REZ A;  2WXH A;  3V60 A;  1EM7 A;  2KAC A;  3NS1 A;  1JAL A;  1N5X A;  3EHV A;  4WQM A;  3TL5 A;  4KV2 A;  2DBY A;  3WAN A;  4DHJ B;  5DPW A;  1K8R B;  1ET6 A;  2WDV B;  4XWW A;  3DBR I;  2LMC A;  2MH7 A;  3P2B A;  2DNF A;  2AL6 A;  1TS2 A;  1FCL A;  3VUW A;  2AQ2 B;  5D94 A;  3GE3 C;  4C00 A;  2WDT B;  2O2V B;  4P16 A;  2PW9 A;  2GB1 A;  3PT2 B;  2MBB B;  3ZKJ C;  3IHP C;  4DDG D;  2QMT A;  3AB5 A;  3ZTC A;  3DHH C;  1AAR A;  1GB1 A;  1JQ4 A;  2WXK A;  3VFK A;  1AWD A;  2G4S A;  1M4V A;  3VH4 B;  2V3P A;  1BML C;  1WZ3 A;  1K52 A;  2LGY A;  3RT3 B;  1K51 A;  2EKI A;  1UH6 A;  2XK5 B;  2V9H A;  2GMI C;  3SU8 X;  3MHS D;  1WM2 A;  3HM6 X;  1HZ6 A;  2LHD A;  4I6L B;  3R2T A;  3FIL B;  4NAW B;  2HD5 B;  3V61 A;  3KVF B;  3DBL B;  2ZEQ A;  3DCG A;  4KX6 B;  2AL3 A;  2IO3 B;  3KYC D;  1YJI A;  1SE9 A;  1JRO A;  1P9D U;  2IGG A;  5LXH A;  2LWP A;  1E7V A;  1J7B A;  1TJE A;  2FAZ A;  3IAS 1;  4HKQ A;  3VQI A;  4WH4 A;  4OVU A;  3H8H A;  2WXR A;  3MC8 A;  2M19 A;  1WMH A;  1WIA A;  1XLN A;  2N1V A;  2KFK B;  2KT7 A;  3KQ4 A;  1OQR A;  2BPS A;  2AWT A;  2RDG A;  2RSU A;  2WQY B;  2OED A;  5H92 C;  1MHX A;  3ECI A;  2FIF A;  4HCN B;  3MFG A;  1KOT A;  2BF8 B;  2DZJ A;  4JL9 A;  4FJY A;  4RMA A;  4I6N B;  1NEK B;  2W3S A;  2WDQ B;  1UWM A;  1WFY A;  1EF1 A;  4W9H A;  2VH2 A;  1XCQ L;  4ZDV A;  4LJP B;  2JVC A;  3Q8E A;  3W2D A;  1N61 A;  1PFD A;  3EC8 A;  2CS4 A;  3BVZ A;  1C1Y B;  4BBN F;  3ZO5 B;  4JIO U;  1U4A A;  4ICU A;  4MJS B;  1E8Y A;  4ASW C;  3WAP A;  3U52 E;  2KK8 A;  3QCA A;  1PGA A;  1WXV A;  4FUL A;  1VJK A;  4RF1 A;  2K0P A;  4HPP A;  3JSV B;  1ZXI A;  4RGM A;  1ZOY B;  4MSQ B;  2MBE A; 
#chains in the Genus database with same CATH homology
 3CIR B;  2K9X A;  3U7Z A;  4B0M A;  5D7G A;  1IBX A;  4A55 A;  1D5X C;  2Y5C A;  1I4H A;  5T8I A;  2L32 A;  5AUK A;  4OW0 A;  4WIP A;  3MHZ A;  1E10 A;  1CZP A;  2WU2 B;  2X38 A;  3AE6 B;  1NYR A;  1MI0 A;  1T6B X;  3E9S A;  2V3N A;  4IKG A;  4ZOH C;  1OQQ A;  1V1P B;  1FNV A;  2PVG C;  1N62 A;  2DYO A;  1BXT A;  4Q2J A;  4L1B A;  1QQR A;  3ETR A;  4LK0 M;  1QKZ A;  2W82 A;  2WXO A;  2J52 A;  1K50 A;  4KGS A;  1C78 A;  2ZW1 A;  1HQR D;  1ZE3 D;  2NTS A;  1WSP A;  1SXT A;  2ZW0 A;  2Y3A A;  1J7C A;  1XF5 L;  4AQ7 A;  1TY0 A;  3NVW A;  1VLB A;  1FNU A;  3BK2 A;  3W5V B;  1TS4 A;  2WS3 B;  3NVZ A;  1J7A A;  1SIJ A;  2SEB D;  2BTE A;  3L4P A;  4A9A A;  2KN4 A;  3Q8B A;  3HUI A;  3AE8 B;  3B2G A;  3AMZ A;  1KFY B;  2MJ3 A;  1FNW A;  2PLP A;  2JSV X;  3AE7 B;  3AE4 B;  1SF0 A;  1C4A A;  2J4X A;  1A70 A;  1N60 A;  1WRI A;  3B9J A;  3LXF A;  3BWU D;  3FAH A;  1XLP A;  2J53 A;  1TYG B;  3W1S A;  4ZHP A;  1TY2 A;  3C8Y A;  3AE9 B;  2Y5P A;  5JXV A;  1VR9 A;  1ET9 A;  4YTM B;  2BBC A;  4ARI A;  2V4I B;  4L23 A;  4WAF A;  1KTK A;  1C77 A;  1AW7 A;  2FE8 A;  1CJE A;  1QLB B;  1YN5 A;  1V1O A;  2CJO A;  2NTT A;  4DXF A;  2GRI A;  5FKA C;  4YSZ B;  1EU3 A;  2JYE A;  2N0S B;  3R2I A;  5AUI A;  3ZQ4 A;  4EE2 A;  4C7Y A;  5C3J B;  1XLQ A;  1PGX A;  3KLS X;  3UI3 A;  3BII D;  1C9F A;  1EWY C;  2L1A A;  2BS3 B;  2R61 A;  2KQ4 X;  3P4Q B;  4WWM A;  1L4Z B;  1KF6 B;  3TSS A;  3TEY A;  3B2F A;  2XN9 C;  3CWI A;  4KKI A;  1T5X D;  1DOX A;  2K22 A;  4IDI A;  5FK9 C;  2W55 A;  2WP9 B;  4D2K A;  1PDX A;  5G5H A;  4OHJ A;  4C56 C;  1E9M A;  4YTN B;  2PVO D;  4TQ1 A;  5HFY A;  1L4D B;  4XDD A;  2BYT A;  2LJI A;  3OWE B;  1NI3 A;  3AN1 A;  4MT5 A;  1FXA A;  5EE3 A;  4L2Y A;  3I9V 1;  2JX5 A;  3PZ8 A;  3AEA B;  3E56 A;  5EE0 A;  4A90 A;  2FUG 1;  5E6J A;  3BYT B;  4YXD B;  1L0Y B;  1Q10 A;  1I7H A;  1SE2 A;  1P7E A;  3P4R B;  1ENF A;  3FIL A;  3P1M A;  4ZRP A;  3SR6 A;  1PYW D;  3AED B;  1RM6 C;  1UNS A;  1HA5 A;  1HEZ E;  1E7P B;  4JPS A;  2WXF A;  3W5U B;  5D3I B;  1ZUD 2;  2TSS A;  3LYY A;  3ZJU A;  2XNA C;  2B76 B;  3BYY B;  3AEG B;  1XCT L;  3IT6 B;  2KWD A;  5LNK 1;  2E6X A;  1EU4 A;  4HKZ E;  1CQV A;  2KAJ A;  2WNM A;  4AS1 A;  1ACC A;  5GXG B;  1GPX A;  4RNA A;  1UWX A;  2ONQ A;  3SFD B;  2GI9 A;  1IGC A;  2VZK B;  1I4P A;  4YTP B;  1JML A;  4M0W A;  3SFE B;  3RFZ B;  5BYQ A;  1RFK A;  1NYQ A;  1Y56 A;  1L0X B;  1L6U A;  5EE1 A;  2CJN A;  1BUI C;  4OVZ A;  2WXM A;  1FIQ A;  2PIA A;  3U4E G;  1SSN A;  1I4Q A;  3AM9 A;  3AE5 B;  1AN8 A;  1MVK A;  2BS2 B;  2NMQ A;  3T3O A;  2LHE A;  2M56 B;  4RF0 A;  2BB6 A;  2PKO A;  3GS2 A;  2L83 A;  1VDV A;  4WUR A;  1SEB D;  4RH6 A;  3AE1 B;  3P42 A;  3URY A;  2JZP A;  1YJJ A;  3HRD D;  4DQO C;  1YMH E;  5G5G A;  3U2S C;  2ACZ B;  1YNT E;  2DWQ A;  1ZP0 B;  1DYQ A;  1EWC A;  1WYG A;  4J3O D;  2LGI A;  4N58 A;  3WCQ A;  2MEK A;  1JW9 D;  1PGB A;  2QJL A;  3TEZ A;  2I2Y A;  4LTU A;  1T3Q A;  4OZC A;  3TUO A;  2MJE A;  1C4C A;  4HRS A;  1NEN B;  4TSS A;  1KRH A;  4FXC A;  4MAC A;  4H2A A;  1D5M C;  2J42 A;  1KH0 A;  2PTL A;  1QOB A;  1JWM D;  4YSY B;  4US8 A;  4OZA A;  3P4P B;  4TMA B;  1N63 A;  2FBW B;  3ZJV A;  4RFB A;  1QT9 A;  3DWG C;  4XE0 A;  2E3T A;  1FMA D;  1JRP A;  1JCK B;  4JWU C;  2WXJ A;  3MP9 A;  1FXI A;  1QOA A;  1XXG A;  1WXQ A;  3V3X A;  2EEL A;  1E0Z A;  1IBX B;  3GP7 A;  1D5Z C;  1XLO A;  1TS3 A;  1FRR A;  1SJE D;  1ZXH A;  1P7F A;  1FFU A;  1PUT A;  5EE9 A;  5H8Y E;  2AQ3 B;  2WU5 B;  4R3D A;  1FO4 A;  4ARC A;  3MC0 B;  1SJH D;  1B1Z A;  3Q8A A;  3PO0 A;  2CU3 A;  4MM3 B;  3BVM A;  5HG2 A;  2BW2 A;  1TKY A;  2HTM E;  1KLU D;  4CQN A;  1C76 A;  1JWS D;  1NVI D;  1ZPS A;  3BVG A;  3R8B A;  3VRB B;  3EGR A;  3NVY A;  3AE2 B;  3O13 A;  1V1P A;  2WXQ A;  1DGJ A;  3HVD A;  2OHF A;  2INP E;  3V05 A;  2LFI A;  1V97 A;  2YEP F;  2V0G A;  1VZ8 A;  1I4X A;  1WGK A;  4ZHO A;  5FR3 A;  3W9C B;  4TQ0 A;  4GDL B;  3AEE B;  4OZB A;  5BMI A;  1VRA B;  1FEH A;  2RDH A;  3VR8 B;  2K3U A;  1YQ4 B;  1K53 A;  2MJD A;  1N5W A;  1F2R I;  3BK1 A;  1TKE A;  2I38 A;  3IT4 B;  4JWS C;  4HJG E;  1WWT A;  2K5P A;  4REZ A;  1FM0 D;  3J9C A;  4RCO A;  1D4B A;  3MJ5 A;  2WXH A;  1L6V A;  2QSD A;  3BZD B;  1EM7 A;  2WXL A;  2KAC A;  2RMM A;  3NS1 A;  1JAL A;  1N5X A;  1ROE A;  4WQM A;  5D3D A;  1L0V B;  5HI1 A;  2Z8L A;  2DBY A;  4NJC A;  1ET6 A;  2WDV B;  4MH8 A;  4XWW A;  2WXI A;  1L5P A;  2LMC A;  1ESF A;  2MH7 A;  1RWS A;  1TS2 A;  4GDK B;  1FCL A;  2AQ2 B;  1XO3 A;  3AEC B;  2QIL A;  3NUH B;  4N59 A;  3TEX A;  3ZYY X;  2L52 A;  4B0E A;  3ZGZ A;  4P16 A;  2PW9 A;  2WLB A;  3AV8 A;  1F2R C;  1QOG A;  2GB1 A;  4NZL B;  4C7Z A;  1E6E B;  1SB3 C;  4YSX B;  1B9R A;  1F77 A;  1V8C A;  1IGD A;  2WXN A;  4ZYS A;  2QMT A;  3GB1 A;  1SBB B;  3AB5 A;  1GB1 A;  1JQ4 A;  2WXK A;  1YQ3 B;  3VR9 B;  3ZJT A;  1AWD A;  1M4V A;  3ABV B;  2BS4 B;  4RGT A;  1GB4 A;  2RPV A;  3AE3 B;  2V3P A;  3IXS A;  1BML C;  4P6V F;  1DOI A;  2INN E;  4RGN A;  4HRO A;  2SAK A;  2LUM A;  1K52 A;  1SE3 A;  1FRD A;  2ICI A;  2PMV A;  1K51 A;  2EKI A;  4XWT A;  1VZ6 A;  3AEF B;  1TKG A;  2QIE B;  1HZ6 A;  2LHD A;  1HZ5 A;  1AYF A;  3R2T A;  2QEJ C;  4LLG M;  2LEK A;  5MPO A;  1FFV A;  1RYJ A;  1HXY D;  3FIL B;  4NAW B;  2H88 B;  4A8X C;  2WXG A;  2DLB A;  5C2T B;  2M0A A;  3AH7 A;  4YT0 B;  3TEW A;  3IAM 1;  5BYS A;  1D6E C;  4KGR A;  3PZ7 A;  1YN3 A;  4KX6 B;  5TSS A;  2IGH A;  2JQR B;  1ZDV A;  1YJI A;  2D5G A;  1JRO A;  3VRA B;  1F0Z A;  2IGG A;  1MPE A;  3EUB 2;  3FC4 A;  3RPF C;  2AQ1 B;  2WXP A;  1J7B A;  1TJE A;  1XEE A;  4ITK A;  3KWV A;  2W3R A;  1OFF A;  3AEB B;  5BMH A;  4ZRQ A;  3NRZ A;  3KWL A;  4JX1 C;  3IAS 1;  1QIL A;  3P63 A;  1KLG D;  4HKQ A;  3VQI A;  1QF6 A;  4WH4 A;  3H8H A;  2WXR A;  4O1N A;  3P4S B;  1IUE A;  2M19 A;  2JXT A;  3LB8 C;  3Q8F A;  5BMG A;  1YN4 A;  1XLN A;  3KQ4 A;  3HVZ A;  1OQR A;  1ZDX A;  5I4D A;  1JWB D;  1STE A;  2RDG A;  4US9 A;  2WQY B;  2OED A;  1C4P A;  3SEB A;  5H92 C;  1MHX A;  3MFG A;  1I4G A;  1UUP A;  1TZO A;  4KGT A;  2HDE A;  2JWU A;  4YWG G;  1C79 A;  3Q8C A;  2N7J A;  1NEK B;  2W3S A;  2BT6 A;  2KMM A;  4USA A;  2IDY A;  1JWA D;  2N9K A;  2WDQ B;  1MHH E;  2ON8 A;  1UWM A;  3EA6 A;  4C80 A;  2Q5W D;  1XCQ L;  2VZK D;  2H89 B;  4RGO S;  3Q69 A;  1GAQ B;  4UDU C;  5BYR A;  2KDM A;  2IGD A;  2N9L A;  3Q8E A;  4IOI E;  3NZ3 A;  3W2D A;  4A6Q A;  2W54 A;  2YEP B;  2IJ0 A;  2JU6 X;  1VZ7 A;  1N61 A;  4JE3 B;  3T3N A;  1LO5 D;  1I4R A;  1PFD A;  1SE4 A;  3BVZ A;  1FCC C;  4PT5 A;  4HEA 1;  3N9Y C;  1DOY A;  1GOZ A;  2IPK D;  1TS5 A;  3NVV A;  3I57 A;  1R7S A;  2BB5 A;  4N6E B;  4KKJ A;  4XDC A;  2WDR B;  1CK1 A;  3U52 E;  1QOF A;  1PGA A;  2DYM A;  4GLS C;  1UGJ A;  2G9H D;  2JYT A;  1VJK A;  4RF1 A;  5HHD G;  4NAM A;  2K0P A;  4DXG A;  2AX5 A;  2G1E A;  1ZXI A;  1FD6 A;  4RGM A;  1ZOY B;  3DWM A;  1JWU D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...