1C76A

Staphylokinase (sak) monomer
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
121
structure length
121
Chain Sequence
SYFEPTGPYLMVNVTGVDGKGNELLSPHYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Staphylokinase Dimer Offers New Clue to Reduction of Immunogenicity
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords STAPHYLOKINASE
total genus 23
structure length 121
sequence length 121
ec nomenclature ec 3.4.24.29: Aureolysin.
pdb deposition date 2000-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02821 Staphylokinase Staphylokinase/Streptokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.130 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1c76A00
2SAKA 1C79A 1SSNA 1C77A 1BUIC 1C76A 1C78A
chains in the Genus database with same CATH superfamily
4F8CB 4CYEA 1GJZA 2M0AA 4C7YA 4I6PA 2VH2A 1OFFA 1XF5L 4ZOHC 1GNUA 2KQSA 1TZ1A 2O6VB 4NNJB 3AEEB 1M4VA 3V60A 2GOWA 2O6VA 4ANWA 1JWUD 3AE2B 5AUIA 3M95A 3CMMB 4DHZE 3NZSA 1TYGB 2V3PA 1NVID 4W9HA 2K1FA 4JWSC 1XLNA 2ZW1A 2KTRA 4JL9A 3RPFC 4P1BC 4I6NB 4ANVA 1GC7A 5JZEB 5EDSA 3BVMA 2BB5A 1H8CA 1B9RA 1A70A 4AOFA 4X57B 3HM6X 1V1PA 3TEZA 2WWZA 1P98A 2BT6A 3QC8B 4WWPA 4M8MA 1WGRA 4OHJA 4I6LB 3T8MA 4P6VF 3SHQA 2KAJA 3BK2A 1YQBA 2BWES 3N1ZC 4R3DA 4C7ZA 2MBBB 2N9LA 1CJEA 2KOXA 2W9NA 2EMTA 4MH0E 2FIDA 5EE0A 4DXAB 2RPQA 2X8XX 1ENFA 3LXFA 1Q0WB 2ZW0A 3ZLZA 4RFBA 2SEBD 1AWDA 2DZJA 3I57A 3BVGA 4KKIA 2XEWA 3OLMD 2L8JA 3H7PB 4RGNA 1MI0A 3NJTA 2BWFA 2KYWA 2M56B 3Q3MC 4FBJB 4PS7A 2DAJA 3FC4A 2AX5A 4ARIA 1L6VA 2DNFA 1FO4A 1E5WA 2M8SA 1IYFA 1WXMA 4OVZA 4JGHB 2AEHA 3ABVB 2C5LC 4N9F4 2H89B 1FRRA 3NZUA 1RM6C 2C7HA 1MG8A 3JVZX 4IKGA 4WAAA 1WI0A 2JPHA 2HDEA 2M4NA 1C4AA 1HTOA 3ALBA 1ZW7A 1ISNA 2L0FA 2KDFB 4A6QA 4BOSC 2WX0A 4CQNA 1ZE3D 3U7ZA 2WYQA 4GIVA 1JRPA 2ACZB 2FUG1 3A1QB 1VZ7A 4US8A 1GOZA 4K7UA 2INPE 3QIJA 1KTKA 1JRUA 3E9SA 3A4SC 2LFIA 4BKSD 1N61A 4ACFA 2N9KA 4YSXB 1WFYA 1P7FA 3AE9B 1SJED 2WLBA 5EE9A 2MCNB 2K6QA 2KVRA 4LNFA 3DBRB 2LGYA 4BAXA 2Z8LA 5FR3A 2LWPA 1WWTA 4J3OD 2FNJB 4FHKA 3S2AA 2GBKA 4M02A 3NVYA 4IWOA 1FXTB 4EOYA 1FCCC 3AN1A 1D6EC 5I4DA 2KWUB 2MBHA 3RYTA 3RNCC 1QOGA 3ZIMA 2IZVB 4W9GA 1RFAA 4JLCA 3TMPB 4W9LA 3TCAA 5CHFA 3VVWB 4H2AA 1J19A 3IFWB 1WJNA 2G4SA 4RMAA 4B95A 1L0VB 2C9WB 2DZKA 3BIID 4JPSA 2HJ8A 1UF0A 2AL6A 3DBHB 4BKGA 1SIJA 4FJYA 1YJJA 3EGRA 1R7SA 5IP4D 4FADA 1C1YB 3PRZA 3W9CB 4CO7A 3MHZA 3URYA 4LTUA 1C3TA 2XK5B 3AECB 3N1YC 4AP4C 1GPXA 2BKFA 2E6XA 1EM7A 3K9PB 3ZDMC 3UGBB 4BKSA 4DDID 1ZDXA 2DZIA 1V2YA 4AS1A 3V61A 2Y5BB 1KOTA 5J17A 3BYTB 1F9JA 4PS3A 2IY1B 3SU8X 5AZGA 2DYMA 2KJRA 2FCMA 1WYGA 4S0RA 2JZZA 1ESFA 2N1VA 1B1ZA 1E0ZA 3O13A 1SGHA 1C4CA 3HUIA 2PJHA 2FBWB 3Q8AA 2LMCA 1C9FA 3LB8C 2WX1A 3IAM1 2KWCA 2WXGA 4ITKA 4JIOU 1I7HA 2JU6X 2ZNVB 3PZDA 2K22A 4W9DA 2IDYA 1LO5D 1UGMA 3N3KB 5DPWA 3AB5A 3W5UB 3PT2B 2YEPB 2CU3A 4BVUC 2KVZA 2GRIA 3AXCA 1E90A 1F0ZA 4Q2JA 2Q5WD 2NPTB 4MGKE 2KZRA 1XQQA 2QC8A 2K9XA 2KWVB 2L0TA 2MX2A 4E71A 3AU4A 3HVZA 3UQBA 3ECIA 2IY0B 2R2OA 4ZRQA 4W9JA 2REXA 4OVVA 5L83A 1V5OA 1PFDA 2L1AA 2N0SB 2ZCCA 4M8NA 4MJSA 1ZUD2 1LFDA 2LGIA 4LNOA 4ANUA 1E8ZA 1V9JA 2JSVX 3BZDB 2N7JA 3H8HA 3RI7C 3V3XA 2K8CA 4XC2A 1S1QB 1WXAA 1E7VA 2PW9A 1QKZA 1P1AA 4WH4A 1RRBA 2WDQB 5KHQA 3L54A 1YMHE 3HVDA 3HM3A 3NS8A 4FHJA 3SFEB 4LNNA 1TKGA 2UWQA 3SFDB 2JXTA 1TS5A 1FEHA 5HKHA 3WAMA 2ZPNA 2K8BA 3AE4B 2WDRB 1SE9A 2WXMA 2NTSA 1EU3A 4O1NA 2LRWA 3PHWB 4YTPB 1TTNA 4N6EB 1AARA 1TGZB 3DVGX 4LJPB 2KDIA 4NQKE 2WDTB 3C19A 3PZ7A 1VJKA 1MG4A 2M0XA 2KDBA 3DVNV 4GB9A 3Q6BA 1MHHE 1AW7A 1V5TA 1QQRA 1FNVA 2IGHA 1MHXA 4WWMA 1HA5A 3Q8CA 3V6EB 4P1CC 3PTFC 4YT0B 3RD2A 3WANA 4FULA 1AN8A 3H9DA 2DENB 1UBIA 3OJ3A 2KJ6A 2G1EA 1DGJA 4YSYB 2GB1A 3IBEA 2LVPA 1V6EA 4FN2A 4L1BA 2SAKA 4IM2A 3CWIA 4ARCA 1NDDA 5E6JA 4ICVA 1TIFA 2W3RA 3WCQA 4JE3B 1Q10A 1I4GA 3Q2AC 4KV2A 4TSSA 1ET6A 4AUQC 3N32A 1WXVA 1YX6B 1K8RB 5HG2A 4K7WA 2KMMA 2IO0B 2LGDA 4ZDVA 1GG3A 2GBMA 2LUEA 4IW0A 4F1SA 4W9KA 1ZKHA 4KDLB 2BB6A 3WAOA 1I35A 2INDC 3U8ZA 1N5WA 5CHVC 1FIQA 3TBLD 1UUPA 2BBCA 1SBBB 1UGJA 3WA0A 2CHXA 2X38A 4C00A 2RD0A 4BBNC 2K25A 2ZVNA 2LHDA 5H92C 2L32A 4GDLB 2W54A 2N7EA 1RWSA 2R61A 2BYVE 3DHIC 2ZNVC 2CHZA 5DPRA 1WJ4A 1K53A 2KXJA 4OZCA 3Q3OC 3Q8EA 1F1HA 1I42A 3Q8BA 4YTNB 1UWXA 2D3CA 2D10A 2LVQA 5IA7A 3NZ3A 3VAWA 4A3PA 3UIPB 3AE7B 4DWFA 5LNK1 3ZDTA 2DLBA 4B0EA 1D3ZA 2ON8A 1OQYA 1WSPA 5LLIA 2KNBA 1T0YA 3R3MA 3NG0A 3A33B 3SEBA 1WZ0A 3IXSA 2RSUA 4IC7B 1P0RA 1E8XA 2KMAA 3KUDB 4ANXA 4W9EA 4KIKB 1KM7A 1YN5A 2YEPF 3OWEB 3VHTC 3Q69A 3C0RB 2NBWB 4ZRKA 2INCC 3D32A 1KRHA 4KZ0A 2KHWB 1ZOYB 2PE6B 3Q3NC 4NAWA 3AE3B 1UBQA 3FILB 3ZYYX 3PHXB 2UU7A 4DHZB 2MW5A 3VXWA 3X0WA 2DYBA 2KK8A 2VZKB 4LJOB 3EECA 1Q1OA 4FXCA 1I4PA 4WJPA 2NPTA 2QJLA 2KLGA 3AE6B 4L23A 2QSDA 1XT9B 3JW0X 2KLCA 4C56C 4ASWC 1KLUD 4HDQA 3W2DA 4YTMB 1R4MI 3DHGC 4GDKB 4HPPA 4DDGD 3A4RA 1TT5B 1E7UA 2KKCA 1SEBD 1XLPA 1K52A 1QOBA 3IHPC 1NYQA 3DHHC 4HCNB 2LGSA 1D5MC 5TSSA 4YXDB 4WAFA 2L52A 5GXGB 2CJOA 2IYDB 2J4XA 5CHWA 2JRIB 1NBFC 2LXCA 1U4AA 3RFZB 4US9A 1EF1A 1GUAB 5E6OA 3KYCD 1L0YB 3VUYA 1I4XA 1SF0A 2PEAA 4MJSB 2O2VA 3H7SA 3SDLC 2WNMA 3ZQ4A 2VRRB 3VQIA 3PO0A 4HWIB 3BYYB 2W82A 2D5GA 1SB3C 3AE1B 3AU5A 4A90A 2KWDA 2IGDA 1ET9A 4LK0M 1UD7A 4XDCA 1L4DB 3FILA 1UELA 5G5GA 3TIXA 4B9KA 5D6JB 2Y5PA 4RGOS 2LVOA 1XO3A 5G2NA 3W1SC 1BUIC 4IM3A 3I63C 2V3SA 3QAQA 4XE0A 2BVCA 4G3XB 3MJWA 4TQ0A 3ML9A 4RGMA 2EKEC 4GLSC 3V05A 4MELA 3R2TA 1I4HA 2MA9B 3MC8A 4FJZA 2Z59B 2HTHA 1D5ZC 2CHWA 1UNSA 3RMKC 1F2RI 3AE5B 2KMCA 2KX0A 2QIEB 2Y5CA 2ICIA 3I5JC 4XDDA 3RT3B 3R7QA 1EWYC 1VCBA 2MJ3A 3TEXA 1FNUA 4J6IA 1UZXB 2NS5A 3U4EG 2O6VD 3GS2A 3ZUNA 1WM2A 3IVFA 4XZ4A 2J0KA 4YSZB 2MJEA 2EELA 3BVZA 2WXLA 5BYRA 4WQOB 3ZJUA 4NZLB 2JVCA 4HDOA 2BYTA 1VZ6A 1XXGA 2CS4A 1WX9A 4OZAA 2N4FA 3KLSX 4EE2A 1L0XB 4LDTD 3T3NA 1XD3B 1JROA 2BPSA 4EZKA 3L17A 3A1QA 1J0GA 3UIOB 4B6WA 1WRIA 3P63A 1RLFA 1WGYA 2V0GA 3WIMA 3ZTCA 4KKJA 5CTRC 2KQ4X 2L3ZA 4GMVA 3KQ4A 1UH6A 2DHZA 5D94A 4W9FA 4RF1A 4XX5A 5MPOA 3PGEA 4ZRJA 1TKEA 3H1UA 1HXYD 4E3CA 2J7QB 1ZXIA 2JT4B 2V3NA 1M94A 3MHSD 4W9CA 4LCDE 2FCNA 2D11A 3ZKJC 5C1ZA 4GXBA 3IAS1 4K7SA 1GB4A 3WALA 1IP9A 1PGXA 4M01A 1PGAA 3GE8C 3NVVA 5AUKA 1VRAB 4LNKA 3TUOA 4KDIC 2ZZPB 2FIFA 2HJ1A 3TL5A 1NENB 2W55A 3AEFB 1R4MB 4GOCA 2MH7A 3EA6A 5T8IA 1IGCA 2BTEA 4OVUA 2WXJA 1OEYJ 1X1MA 1V80A 2BKRB 2KANA 3RCZA 2L05A 1EO6A 1T6BX 3HIZA 3W1SA 2QHOA 4WURA 4TUUA 1T0RC 4DHJB 1RAXA 1VLBA 4A20A 4EFOA 1FPYA 2WXIA 2KC2A 1FM0D 1L6UA 2BW2A 2G9HD 1VDVA 4KSLC 1LGRA 1YIWA 3B9JA 3NHEB 1I4RA 1KJTA 4G50A 1TY2A 2IBIB 2ZJDA 1VZ8A 1HEZE 3AEDB 2Y3AA 3RNBC 2JUOA 3QARA 2N9EB 1PYWD 1Z2MA 1Q5WB 3MC9A 2LUMA 4DHJD 2KDMA 2GBNA 2ZEQA 5BMHA 3M63B 2MLBA 2LD9A 3ZO5B 2KACA 2I2YA 4NJ7A 1EUVB 3J9CA 2LJ5A 2IO3B 3MTNB 2H88B 4ZRPA 1LQBA 5FK9C 4MGIE 4HKQA 2JRHA 1BMLC 2JXXA 4EZLA 2VZKD 4K81A 4GN1A 4KVGB 2QCZA 1SE2A 1LXDA 2GI9A 4NQLB 5TR5A 3B08A 2NR2A 5L95C 2HD5B 1XLOA 4RGTA 4KGSA 3RNEC 2BS2B 1WRDB 2CU1A 4OZBA 3DPDA 4BBNF 3QK0A 2NTTA 1FD6A 4N59A 2M17A 4F7ZA 4QAYA 2AWTA 1V1PB 4JX1C 4USAA 2D3GA 3N30A 4II3B 1TY0A 1PQSA 2G4DB 4WQMA 4K3CA 1WY8A 4REZA 1ZGUB 4XGAB 3JSVB 1WJUA 2D3AA 2J0JA 3SD5A 2L76A 2NMQA 3NVZA 2E3TA 3VFKA 1WXQA 3L16A 2IPKD 2C7MB 2WQYB 2BYFA 3QA8A 1T0QC 1XCTL 2G45B 2MBOA 2M19A 5FR6A 3APCA 4URKA 4HPLB 3N9YC 4M0WB 3KWVA 2MBEA 2K0PA 3A9JB 4A9AA 2QDFA 3UI3A 1TKYA 1JMLA 2INNE 2LI5A 2BF8B 4C4VB 3RNFC 1OQQA 3AV8A 4RH6A 2KN4A 1IGDA 3ZNID 4A55A 3TJPA 1P7EA 5LXHA 4NY0A 3ZVVA 2DX5B 1HTQA 3R2IA 2AQ1B 4PK1A 5HI1A 1DOIA 1SIFA 4K3BA 5IKCM 3DWMA 3HK0A 2KFJA 3KVFB 1E8WA 2MP2B 2WDVB 2PE9A 3ZTDA 1A5RA 4C4VA 1WYWB 4BFRA 3HHMA 4GDKA 2LEKA 3ZGZA 3DVNU 3Q8FA 3VRBB 3ZNGC 2MJDA 1HQRD 4MT5A 1HZ6A 1QOFA 1ZP0B 2MHJA 2HTME 2NVUI 4B0MA 4AQ7A 2LASA 2W3SA 4LDTB 1T0SC 2PPHA 5C2TB 1WXSA 3PRPB 2LZ6A 1OEYA 4LNIA 2LXAA 4RF0A 1OGWA 3P1MA 5G55A 1C78A 5BYSA 3VTVA 2MBQA 3DCGA 4E74A 3P4QB 1I4QA 4MM3B 5JH5C 3GZNB 2RDBC 1IPGA 2BQQA 1C76A 1Y8RC 2UYZB 1WR6E 2DAFA 3KW5B 3RNGC 1ZDVA 4AJYB 1WGKA 5IN7A 5BMGA 3TEYA 3CSTA 3GP7A 4KGTA 2AQ2B 2K6DB 1V49A 2RGFA 4FJVB 2K39A 5JHAA 4DXFA 3ENEA 3VUXA 2RDGA 5JHBA 3R7RA 3ETRA 1JW9D 3AEAB 1J8CA 3ONSA 1GAQB 2KQ7A 5J18A 2VH1A 4WJOA 3TSSA 3X23A 1IBXB 1WZ3A 4TQ1A 3PVLA 2KN5A 2WXPA 4HXDA 2GMIC 1WGGA 4MACA 3NOBA 3NY5A 2JQRB 5AZFA 2NCNA 2XK5A 3DBSA 1SJHD 4MDKE 1SSNA 1WE6A 3P42A 3GZNI 2PVOD 1E10A 3ZXVA 4MEMA 1JWMD 2BYEA 5AEKB 3P2BA 2AQ3B 2WU2B 2MQJA 2NBUA 2N9PC 2KFKA 4KGRA 1WJ6A 2PMVA 4PYUA 1JWAD 2WXOA 1WX7A 4NPNA 3PZ8A 4WIPA 3UF8A 3ZNZB 3U7DA 3LYYA 4DK5A 4HRSA 2FAZA 1CK1A 1YQ4B 3W1YA 4MSMB 2WXHA 2KDEB 2G3QB 1FRDA 1V8CA 3AULA 4TV3A 1SXTA 2XNAC 3B1LX 3VH3B 1T5XD 1J7CA 1WE7A 1WGDA 4HEA1 5DPTA 3T9LA 3QX1A 3PLUA 4NJ6A 3VTUA 4OW0A 2D07B 4LLGM 4IUMB 4P7IA 4K1RB 4IG7B 1TJEA 3M62B 2WXRA 1V86A 2GBJA 3GB1A 1DYQA 1JWSD 5IOIA 3PSEB 2KFKB 2J53A 3P4SB 1AYFA 1FMAD 1N63A 4GU2A 1OTRB 3H7PA 2I1JA 4S17A 5KHOA 1K51A 2FCQA 1WM3A 3EFUA 3PRMB 1P3QU 2WU5B 1N62A 4HKZE 1L2NA 3QHTA 3BINA 5LXIB 5D3DA 2CKHB 2GBRA 1R4NI 3ZRFA 2WGSA 4NJCA 3RZFA 2D2QA 4MGZE 2D3BA 2AL3A 4GGQA 1QT9A 2OEDA 3ZJVA 1T3QA 1XEEA 3GE3C 1STEA 4KSKC 2JF5A 3TEWA 3FAHA 3ZXRA 1KH0A 3AEBB 3P4RB 3OJ4B 3RNAC 2DZMA 1FFVA 2OJWA 1JWBD 4EUTA 1J7BA 3ZRCA 4ZYNA 2PVGC 4G11A 3N1XC 2BGFA 3PS6A 1V1OA 2IO1B 3APDA 5DPSA 1JQ4A 1NYRA 5FKAC 2DBYA 3BY4B 3LDZE 2TSSA 2JZPA 3RULA 4BOZB 5BYQA 2MRPA 3VUWA 2OJRA 4HJKA 2GLSA 3B0AA 1RYJA 3EUB2 4JQWC 2RMMA 3L10B 5BMIA 4UDUC 1N5XA 1SE3A 1D4BA 4GSWA 4D2KA 2XN9C 2LRUA 2KTFA 2WHIA 1QOAA 4NAMA 4HCPB 2Z0DB 3UINB 3VH4B 2K3UA 2DYOA 2I38A 2IO2B 1MFWA 3Q3JA 3JSVA 4FLHA 4N58A 5E6PA 5DCNA 3GOEA 4BKTA 2LGXA 1WX8A 5D2MB 3IG3A 1E8YA 5JXVA 1MJDA 1CMXB 1E9MA 2FUHB 4G0NB 1F2RC 1LM8B 1WMHA 2PLPA 2WXQA 3DOWA 1F52A 1G6JA 3R8BA 2ZVOA 4ZRIA 1YX5B 1C4PA 2KO3A 1MVKA 2V4IB 3MP9A 3RN9C 3BK1A 1YQ3B 1K50A 3EHVA 2WXFA 2WXKA 3NUHB 3K9OB 5D7GA 2Z0EB 3MFGA 5H8YE 4ZHPA 2L83A 1EF5A 1NI3A 3Q14C 3QCAA 2KC1A 3NVWA 1F77A 1RFKA 2KTRB 3DDCB 3T3OA 3DVGY 1SE4A 4MH8A 2IGGA 1CZPA 4MSQB 5D3IB 1TZOA 2A5UA 4M0WA 4AJWA 3A9JA 1HE8A 2JWZA 3PLVA 4RCOA 1YNTE 4ZHOA 2RPVA 1ACCA 3DWGC 3CIRB 1KF6B 1TBEA 3QQ8B 1DOYA 1S3SG 3PREA 4KX6B 5EE1A 1KLGD 4NAWB 2J42A 2BS3B 3V6CB 4P16A 4TKNA 3WAPA 2KX3A 2EKIA 2YLMA 2J0MA 2EMSA 3VR8B 1ZXHA 1YD8U 5G5HA 4XWWA 4EEWA 3AEGB 2JYEA 1ZPSA 3B2GA 3H6NA 3DBRI 3LJ3A 1FNWA 3FKYA 4KIKA 4TMAB 4XWTA 2ZPYA 3EC8A 4HPMB 2LHEA 1E6EB 1QLBB 3IT4B 2N7DA 1YN3A 4KZCA 1NEKB 4BZAA 1NI2A 1MPEA 2WS3B 2RR9A 3AMZA 2B3AA 3CSFA 3JYUA 4IDIA 1D5XC 5E6NA 2V9HA 1QILA 2JX5A 3I9V1 4JWUC 4IWPA 2I1KA 3UQAA 4CHKA 1WF9A 3KUZA 3DBHI 4C80A 2KD0A 2L00B 3OAWA 3KWLA 2R2QA 5IO9A 4YL8A 1TS2A 2MSED 1IUEA 4W9IA 2FE8A 1JALA 4ZYSA 1WR1A 1YN4A 1H4RA 4HVBA 3E56A 3M3JA 3MJ5A 3W5VB 1WH3A 4HJGE 5AZHA 4DQOC 3DBLB 2V4LA 1TS4A 3ZW3A 2N9XA 2MEKA 2B76B 1BT0A 1QF6A 1DOXA 2JYTA 4L2YA 1HZ5A 3QWZB 2PTLA 1V81A 1EWCA 2OHFA 4MGYE 4PT5A 2FCSA 5C23A 3RUIB 3CF6E 2XBBC 2PKOA 1GB1A 1PDXA 1E7PB 1N60A 3KH0A 3N20C 4MM3A 1C77A 2JY6A 1PGBA 3ML8A 4GDLA 1V97A 5C3JB 1P9DU 3U2SC 1ROEA 4DBGA 4IM0A 4M00A 2N1WA 2M1MA 1Z5SB 2RDHA 2QMTA 1FXIA 3NRZA 3PV1A 3AI5A 3ZJTA 4XYCA 2PIAA 1YOVB 1IBXA 3Q3FA 2ONQA 2J52A 4RM8A 3B2FA 1JCKB 4PYZA 2A4ZA 4IOIE 1FFUA 3L08A 2NBVB 3IT6B 3EFCA 4A8XC 3P4PB 2MWSB 5IAAC 2O2VB 4ICUA 1XCQL 3AM9A 3L13A 4IWQA 4HROA 3V62A 1PUTA 2AYOB 3DQVA 3SR6A 1KLVA 2HE7A 3U30A 1WIAA 2KJHB 4EZJA 4HLEA 2IJ0A 2K8HA 4FA6A 3L4PA 2CR5A 1YJ1A 5HFYA 3U52E 1C79A 2K5PA 2C7NB 3BWUD 2JWUA 3OG5A 4AWJA 1EU4A 4HK2A 4II2B 3VTWA 5GMVA 3RZWC 3KUCB 1OQRA 3PPAA 2QEJC 1TS3A 3AH7A 4RNAA 1XLQA 1CQVA 1J7AA 2OOBB 3O65B 4PS8A 2KT7A 3VRAB 1FCLA 2WP9B 1N6ZA 1KFYB 2LJIA 2ASQA 1L4ZB 3NS1A 2C60A 3C8YA 1Y56A 4EKUA 2QILA 2WXNA 2ZCBA 3DBLI 4YWGG 3L0WB 1QZEA 3KYDD 2DWQA 3VR9B 1BXTA 3ZNHB 1WMHB 2MP2A 3APFA 2V1YA 5J2RA 3A9KB 3MC0B 1WGHA 3AE8B 4RM9A 3QJZA 3R66C 2YVCA 3A9KA 1UWMA 3HRDD 2JZ3B 5EE3A 1VD2A 1FXAA 4WJNA 3I3TB 4A3OA 4WWOA 3VDZA 1L7YA 2L7RA 5CX3A 1YJIA 1R4NB 1VR9A 5BO4B 1GC6A 2BS4B 4DXGA 4WJQA 2CJNA 5HHDG 1L5PA 4WWNA
chains in the Genus database with same CATH topology
1FFVA 1T6BX 4YT0B 2M0AA 4C7YA 3W1SA 1OFFA 1XF5L 4WURA 4ZOHC 1JWBD 1J7BA 1AN8A 3AEEB 2PVGC 1M4VA 1VLBA 1JWUD 1V1OA 3AE2B 5AUIA 1JQ4A 1NYRA 5FKAC 2G1EA 2WXIA 2DBYA 1DGJA 1FM0D 1L6UA 1TYGB 2JZPA 2GB1A 2TSSA 2V3PA 4YSYB 5BYQA 2BW2A 2G9HD 1NVID 4L1BA 2SAKA 1VDVA 4JWSC 1RYJA 1XLNA 2ZW1A 3CWIA 3EUB2 3B9JA 4ARCA 2RMMA 5BMIA 5E6JA 1I4RA 2W3RA 3WCQA 1TY2A 4JE3B 3RPFC 1Q10A 1I4GA 1N5XA 1VZ8A 1SE3A 4UDUC 1D4BA 1HEZE 4TSSA 3AEDB 4D2KA 1ET6A 2Y3AA 2XN9C 3BVMA 2BB5A 1B9RA 5HG2A 1QOAA 1A70A 4NAMA 2KMMA 1V1PA 1PYWD 3TEZA 2K3UA 2DYOA 2LUMA 2BT6A 2KDMA 5BMHA 2I38A 2BB6A 4OHJA 1N5WA 4N58A 4P6VF 2KAJA 3BK2A 1FIQA 1UUPA 2KACA 2BBCA 2I2YA 3J9CA 1SBBB 4R3DA 1UGJA 4C7ZA 2H88B 2N9LA 4ZRPA 5FK9C 4HKQA 2X38A 1CJEA 5JXVA 1BMLC 1E9MA 2VZKD 2LHDA 1F2RC 5H92C 5EE0A 2L32A 2PLPA 2WXQA 1SE2A 4GDLB 2GI9A 2W54A 1RWSA 3R8BA 1XLOA 1ENFA 2R61A 4RGTA 3LXFA 4KGSA 2BS2B 1C4PA 1MVKA 2V4IB 3MP9A 4OZBA 2ZW0A 1YQ3B 1K50A 3BK1A 2WXFA 2WXKA 3NUHB 1K53A 5D7GA 4RFBA 2SEBD 1AWDA 3MFGA 4OZCA 2NTTA 5H8YE 1FD6A 4ZHPA 2L83A 3Q8EA 1NI3A 3I57A 3BVGA 4N59A 3Q8BA 4KKIA 4YTNB 1UWXA 3NVWA 4RGNA 1MI0A 1F77A 1RFKA 3NZ3A 3T3OA 1V1PB 4JX1C 1SE4A 4MH8A 2M56B 4USAA 2IGGA 1CZPA 5D3IB 1TZOA 3AE7B 5LNK1 4M0WA 1TY0A 2DLBA 4B0EA 2ON8A 3FC4A 1WSPA 4RCOA 4WQMA 2AX5A 4ARIA 1L6VA 1YNTE 4REZA 1FO4A 4ZHOA 2RPVA 3SEBA 1ACCA 3DWGC 3CIRB 3IXSA 1KF6B 1DOYA 2NMQA 3NVZA 2E3TA 4OVZA 3ABVB 1WXQA 4KX6B 5EE1A 2IPKD 1KLGD 2H89B 2WQYB 4NAWB 1FRRA 1RM6C 2J42A 2BS3B 1YN5A 2YEPF 3OWEB 4P16A 2EKIA 3Q69A 1XCTL 3VR8B 1ZXHA 2M19A 4IKGA 1KRHA 5G5HA 4XWWA 1ZOYB 2HDEA 2JYEA 1C4AA 1ZPSA 3AEGB 3B2GA 3KWVA 2K0PA 3N9YC 1FNWA 4A9AA 3AE3B 3UI3A 1TKYA 1JMLA 2INNE 4TMAB 4A6QA 3FILB 3ZYYX 4XWTA 2LHEA 1E6EB 4CQNA 1OQQA 1ZE3D 1QLBB 2VZKB 3IT4B 3AV8A 1YN3A 3U7ZA 1NEKB 4RH6A 2KN4A 4FXCA 1I4PA 1JRPA 1IGDA 1MPEA 4A55A 2WS3B 2ACZB 2FUG1 1VZ7A 4US8A 1GOZA 1P7EA 3AMZA 2INPE 1KTKA 2QJLA 3E9SA 3R2IA 2AQ1B 3AE6B 4L23A 2LFIA 5HI1A 1DOIA 2QSDA 4IDIA 1N61A 1D5XC 3DWMA 2N9KA 4YSXB 1P7FA 3AE9B 1SJED 2WLBA 5EE9A 2WDVB 4C56C 1QILA 2JX5A 3I9V1 4JWUC 2LEKA 1KLUD 2Z8LA 5FR3A 3W2DA 4YTMB 4GDKB 1WWTA 4J3OD 3ZGZA 4C80A 1SEBD 1XLPA 3KWLA 3Q8FA 3NVYA 3VRBB 1K52A 2MJDA 1HQRD 1QOBA 1TS2A 4MT5A 1HZ6A 1NYQA 1IUEA 2FE8A 1QOFA 1ZP0B 2HTME 1FCCC 1D5MC 5TSSA 3AN1A 4YXDB 4B0MA 4AQ7A 4WAFA 1D6EC 2L52A 1JALA 2W3SA 5GXGB 4ZYSA 2CJOA 5I4DA 1QOGA 2J4XA 1YN4A 5C2TB 3RFZB 3E56A 4US9A 3MJ5A 3W5VB 1L0YB 1I4XA 4HJGE 4DQOC 1SF0A 1TS4A 4RF0A 2MEKA 3P1MA 4H2AA 2B76B 1QF6A 1DOXA 2JYTA 1C78A 5BYSA 4L2YA 1L0VB 2WNMA 3BIID 3P4QB 1HZ5A 4JPSA 3ZQ4A 1I4QA 4MM3B 2PTLA 3VQIA 3PO0A 3BYYB 1SIJA 1EWCA 1YJJA 2OHFA 2W82A 2D5GA 3EGRA 1SB3C 1R7SA 3AE1B 4A90A 4PT5A 2KWDA 2IGDA 3W9CB 1C76A 1ET9A 3MHZA 3URYA 4LK0M 4LTUA 2PKOA 4XDCA 1L4DB 1GB1A 1PDXA 1ZDVA 3AECB 1WGKA 1E7PB 1N60A 3FILA 5BMGA 3TEYA 3GP7A 5G5GA 4KGTA 1GPXA 2AQ2B 1C77A 2E6XA 1EM7A 1PGBA 2Y5PA 4RGOS 1ZDXA 1V97A 5C3JB 4AS1A 1XO3A 4DXFA 3U2SC 1BUIC 1ROEA 3BYTB 2RDGA 3ETRA 1JW9D 3AEAB 1GAQB 4XE0A 2DYMA 4TQ0A 2RDHA 2QMTA 1FXIA 3NRZA 4RGMA 1WYGA 4GLSC 1ESFA 3TSSA 3V05A 1IBXB 3ZJTA 1B1ZA 2PIAA 3R2TA 4TQ1A 1E0ZA 1I4HA 2WXPA 1IBXA 3O13A 2ONQA 2J52A 3B2FA 1C4CA 3HUIA 1D5ZC 4MACA 1UNSA 2FBWB 2JQRB 1JCKB 2LMCA 3Q8AA 1C9FA 3LB8C 4IOIE 1F2RI 3AE5B 1FFUA 2QIEB 3IAM1 2WXGA 2Y5CA 3IT6B 1SJHD 2ICIA 4A8XC 4ITKA 3P4PB 4XDDA 1SSNA 3P42A 1I7HA 2PVOD 1EWYC 1E10A 2MJ3A 2JU6X 2K22A 1XCQL 3AM9A 3TEXA 1FNUA 1JWMD 2IDYA 4HROA 1LO5D 1PUTA 3U4EG 2AQ3B 3AB5A 3W5UB 3SR6A 2WU2B 2YEPB 2CU3A 4KGRA 2GRIA 2PMVA 1JWAD 2IJ0A 3GS2A 1F0ZA 4Q2JA 2Q5WD 3L4PA 2WXOA 3PZ8A 4WIPA 4YSZB 2MJEA 2EELA 2K9XA 3BVZA 2WXLA 3LYYA 4HRSA 5BYRA 1C79A 2K5PA 4NZLB 3U52E 5HFYA 3ZJUA 1CK1A 1YQ4B 3HVZA 2BYTA 1VZ6A 1XXGA 3BWUD 2JWUA 4OZAA 1EU4A 2WXHA 1FRDA 1V8CA 3KLSX 4ZRQA 4EE2A 1L0XB 1SXTA 2XNAC 3T3NA 1T5XD 1J7CA 1PFDA 4HEA1 2L1AA 2N0SB 1JROA 4OW0A 1ZUD2 1WRIA 2LGIA 3P63A 1OQRA 4LLGM 2V0GA 2QEJC 1TS3A 3AH7A 1TJEA 4RNAA 2WXRA 4KKJA 2KQ4X 3GB1A 2JSVX 3BZDB 2N7JA 3H8HA 1XLQA 1DYQA 1JWSD 1CQVA 1J7AA 3V3XA 3KQ4A 3VRAB 2J53A 1FCLA 2WP9B 3P4SB 1AYFA 1FMAD 1KFYB 1N63A 4RF1A 2LJIA 5MPOA 1L4ZB 1TKEA 3NS1A 2PW9A 1HXYD 1K51A 1QKZA 1Y56A 3C8YA 4WH4A 2QILA 2WDQB 2WXNA 2V3NA 1ZXIA 1YMHE 2WU5B 4YWGG 1N62A 3HVDA 4HKZE 3SFEB 1TKGA 3SFDB 2JXTA 2DWQA 1TS5A 1FEHA 3VR9B 1BXTA 3AE4B 3IAS1 2WDRB 1GB4A 5D3DA 2WXMA 2NTSA 1PGXA 3MC0B 3AE8B 1EU3A 1PGAA 4O1NA 3NVVA 5AUKA 4YTPB 4NJCA 1UWMA 4N6EB 1VRAB 3HRDD 3TUOA 5EE3A 1FXAA 1QT9A 2OEDA 1NENB 3ZJVA 1T3QA 3PZ7A 1XEEA 2W55A 3AEFB 1VJKA 1STEA 2MH7A 3EA6A 5T8IA 1YJIA 1IGCA 1MHHE 1AW7A 3TEWA 3FAHA 2BTEA 1VR9A 1QQRA 1KH0A 1FNVA 2BS4B 3AEBB 3P4RB 2IGHA 4DXGA 2WXJA 1MHXA 2CJNA 4WWMA 5HHDG 1HA5A 1L5PA 3Q8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2SAK A;  1C79 A;  1SSN A;  1C77 A;  1BUI C;  1C76 A;  1C78 A; 
#chains in the Genus database with same CATH topology
 4F8C B;  4CYE A;  1GJZ A;  2M0A A;  4C7Y A;  4I6P A;  2VH2 A;  1OFF A;  1XF5 L;  4ZOH C;  1GNU A;  2KQS A;  1TZ1 A;  2O6V B;  4NNJ B;  3AEE B;  1M4V A;  3V60 A;  2GOW A;  2O6V A;  4ANW A;  1JWU D;  3AE2 B;  5AUI A;  3M95 A;  3CMM B;  4DHZ E;  3NZS A;  1TYG B;  2V3P A;  1NVI D;  4W9H A;  2K1F A;  4JWS C;  1XLN A;  2ZW1 A;  2KTR A;  4JL9 A;  3RPF C;  4P1B C;  4I6N B;  4ANV A;  1GC7 A;  5JZE B;  5EDS A;  3BVM A;  2BB5 A;  1H8C A;  1B9R A;  1A70 A;  4AOF A;  4X57 B;  3HM6 X;  1V1P A;  3TEZ A;  2WWZ A;  1P98 A;  2BT6 A;  3QC8 B;  4WWP A;  4M8M A;  1WGR A;  4OHJ A;  4I6L B;  3T8M A;  4P6V F;  3SHQ A;  2KAJ A;  3BK2 A;  1YQB A;  2BWE S;  3N1Z C;  4R3D A;  4C7Z A;  2MBB B;  2N9L A;  1CJE A;  2KOX A;  2W9N A;  2EMT A;  4MH0 E;  2FID A;  5EE0 A;  4DXA B;  2RPQ A;  2X8X X;  1ENF A;  3LXF A;  1Q0W B;  2ZW0 A;  3ZLZ A;  4RFB A;  2SEB D;  1AWD A;  2DZJ A;  3I57 A;  3BVG A;  4KKI A;  2XEW A;  3OLM D;  2L8J A;  3H7P B;  4RGN A;  1MI0 A;  3NJT A;  2BWF A;  2KYW A;  2M56 B;  3Q3M C;  4FBJ B;  4PS7 A;  2DAJ A;  3FC4 A;  2AX5 A;  4ARI A;  1L6V A;  2DNF A;  1FO4 A;  1E5W A;  2M8S A;  1IYF A;  1WXM A;  4OVZ A;  4JGH B;  2AEH A;  3ABV B;  2C5L C;  4N9F 4;  2H89 B;  1FRR A;  3NZU A;  1RM6 C;  2C7H A;  1MG8 A;  3JVZ X;  4IKG A;  4WAA A;  1WI0 A;  2JPH A;  2HDE A;  2M4N A;  1C4A A;  1HTO A;  3ALB A;  1ZW7 A;  1ISN A;  2L0F A;  2KDF B;  4A6Q A;  4BOS C;  2WX0 A;  4CQN A;  1ZE3 D;  3U7Z A;  2WYQ A;  4GIV A;  1JRP A;  2ACZ B;  2FUG 1;  3A1Q B;  1VZ7 A;  4US8 A;  1GOZ A;  4K7U A;  2INP E;  3QIJ A;  1KTK A;  1JRU A;  3E9S A;  3A4S C;  2LFI A;  4BKS D;  1N61 A;  4ACF A;  2N9K A;  4YSX B;  1WFY A;  1P7F A;  3AE9 B;  1SJE D;  2WLB A;  5EE9 A;  2MCN B;  2K6Q A;  2KVR A;  4LNF A;  3DBR B;  2LGY A;  4BAX A;  2Z8L A;  5FR3 A;  2LWP A;  1WWT A;  4J3O D;  2FNJ B;  4FHK A;  3S2A A;  2GBK A;  4M02 A;  3NVY A;  4IWO A;  1FXT B;  4EOY A;  1FCC C;  3AN1 A;  1D6E C;  5I4D A;  2KWU B;  2MBH A;  3RYT A;  3RNC C;  1QOG A;  3ZIM A;  2IZV B;  4W9G A;  1RFA A;  4JLC A;  3TMP B;  4W9L A;  3TCA A;  5CHF A;  3VVW B;  4H2A A;  1J19 A;  3IFW B;  1WJN A;  2G4S A;  4RMA A;  4B95 A;  1L0V B;  2C9W B;  2DZK A;  3BII D;  4JPS A;  2HJ8 A;  1UF0 A;  2AL6 A;  3DBH B;  4BKG A;  1SIJ A;  4FJY A;  1YJJ A;  3EGR A;  1R7S A;  5IP4 D;  4FAD A;  1C1Y B;  3PRZ A;  3W9C B;  4CO7 A;  3MHZ A;  3URY A;  4LTU A;  1C3T A;  2XK5 B;  3AEC B;  3N1Y C;  4AP4 C;  1GPX A;  2BKF A;  2E6X A;  1EM7 A;  3K9P B;  3ZDM C;  3UGB B;  4BKS A;  4DDI D;  1ZDX A;  2DZI A;  1V2Y A;  4AS1 A;  3V61 A;  2Y5B B;  1KOT A;  5J17 A;  3BYT B;  1F9J A;  4PS3 A;  2IY1 B;  3SU8 X;  5AZG A;  2DYM A;  2KJR A;  2FCM A;  1WYG A;  4S0R A;  2JZZ A;  1ESF A;  2N1V A;  1B1Z A;  1E0Z A;  3O13 A;  1SGH A;  1C4C A;  3HUI A;  2PJH A;  2FBW B;  3Q8A A;  2LMC A;  1C9F A;  3LB8 C;  2WX1 A;  3IAM 1;  2KWC A;  2WXG A;  4ITK A;  4JIO U;  1I7H A;  2JU6 X;  2ZNV B;  3PZD A;  2K22 A;  4W9D A;  2IDY A;  1LO5 D;  1UGM A;  3N3K B;  5DPW A;  3AB5 A;  3W5U B;  3PT2 B;  2YEP B;  2CU3 A;  4BVU C;  2KVZ A;  2GRI A;  3AXC A;  1E90 A;  1F0Z A;  4Q2J A;  2Q5W D;  2NPT B;  4MGK E;  2KZR A;  1XQQ A;  2QC8 A;  2K9X A;  2KWV B;  2L0T A;  2MX2 A;  4E71 A;  3AU4 A;  3HVZ A;  3UQB A;  3ECI A;  2IY0 B;  2R2O A;  4ZRQ A;  4W9J A;  2REX A;  4OVV A;  5L83 A;  1V5O A;  1PFD A;  2L1A A;  2N0S B;  2ZCC A;  4M8N A;  4MJS A;  1ZUD 2;  1LFD A;  2LGI A;  4LNO A;  4ANU A;  1E8Z A;  1V9J A;  2JSV X;  3BZD B;  2N7J A;  3H8H A;  3RI7 C;  3V3X A;  2K8C A;  4XC2 A;  1S1Q B;  1WXA A;  1E7V A;  2PW9 A;  1QKZ A;  1P1A A;  4WH4 A;  1RRB A;  2WDQ B;  5KHQ A;  3L54 A;  1YMH E;  3HVD A;  3HM3 A;  3NS8 A;  4FHJ A;  3SFE B;  4LNN A;  1TKG A;  2UWQ A;  3SFD B;  2JXT A;  1TS5 A;  1FEH A;  5HKH A;  3WAM A;  2ZPN A;  2K8B A;  3AE4 B;  2WDR B;  1SE9 A;  2WXM A;  2NTS A;  1EU3 A;  4O1N A;  2LRW A;  3PHW B;  4YTP B;  1TTN A;  4N6E B;  1AAR A;  1TGZ B;  3DVG X;  4LJP B;  2KDI A;  4NQK E;  2WDT B;  3C19 A;  3PZ7 A;  1VJK A;  1MG4 A;  2M0X A;  2KDB A;  3DVN V;  4GB9 A;  3Q6B A;  1MHH E;  1AW7 A;  1V5T A;  1QQR A;  1FNV A;  2IGH A;  1MHX A;  4WWM A;  1HA5 A;  3Q8C A;  3V6E B;  4P1C C;  3PTF C;  4YT0 B;  3RD2 A;  3WAN A;  4FUL A;  1AN8 A;  3H9D A;  2DEN B;  1UBI A;  3OJ3 A;  2KJ6 A;  2G1E A;  1DGJ A;  4YSY B;  2GB1 A;  3IBE A;  2LVP A;  1V6E A;  4FN2 A;  4L1B A;  2SAK A;  4IM2 A;  3CWI A;  4ARC A;  1NDD A;  5E6J A;  4ICV A;  1TIF A;  2W3R A;  3WCQ A;  4JE3 B;  1Q10 A;  1I4G A;  3Q2A C;  4KV2 A;  4TSS A;  1ET6 A;  4AUQ C;  3N32 A;  1WXV A;  1YX6 B;  1K8R B;  5HG2 A;  4K7W A;  2KMM A;  2IO0 B;  2LGD A;  4ZDV A;  1GG3 A;  2GBM A;  2LUE A;  4IW0 A;  4F1S A;  4W9K A;  1ZKH A;  4KDL B;  2BB6 A;  3WAO A;  1I35 A;  2IND C;  3U8Z A;  1N5W A;  5CHV C;  1FIQ A;  3TBL D;  1UUP A;  2BBC A;  1SBB B;  1UGJ A;  3WA0 A;  2CHX A;  2X38 A;  4C00 A;  2RD0 A;  4BBN C;  2K25 A;  2ZVN A;  2LHD A;  5H92 C;  2L32 A;  4GDL B;  2W54 A;  2N7E A;  1RWS A;  2R61 A;  2BYV E;  3DHI C;  2ZNV C;  2CHZ A;  5DPR A;  1WJ4 A;  1K53 A;  2KXJ A;  4OZC A;  3Q3O C;  3Q8E A;  1F1H A;  1I42 A;  3Q8B A;  4YTN B;  1UWX A;  2D3C A;  2D10 A;  2LVQ A;  5IA7 A;  3NZ3 A;  3VAW A;  4A3P A;  3UIP B;  3AE7 B;  4DWF A;  5LNK 1;  3ZDT A;  2DLB A;  4B0E A;  1D3Z A;  2ON8 A;  1OQY A;  1WSP A;  5LLI A;  2KNB A;  1T0Y A;  3R3M A;  3NG0 A;  3A33 B;  3SEB A;  1WZ0 A;  3IXS A;  2RSU A;  4IC7 B;  1P0R A;  1E8X A;  2KMA A;  3KUD B;  4ANX A;  4W9E A;  4KIK B;  1KM7 A;  1YN5 A;  2YEP F;  3OWE B;  3VHT C;  3Q69 A;  3C0R B;  2NBW B;  4ZRK A;  2INC C;  3D32 A;  1KRH A;  4KZ0 A;  2KHW B;  1ZOY B;  2PE6 B;  3Q3N C;  4NAW A;  3AE3 B;  1UBQ A;  3FIL B;  3ZYY X;  3PHX B;  2UU7 A;  4DHZ B;  2MW5 A;  3VXW A;  3X0W A;  2DYB A;  2KK8 A;  2VZK B;  4LJO B;  3EEC A;  1Q1O A;  4FXC A;  1I4P A;  4WJP A;  2NPT A;  2QJL A;  2KLG A;  3AE6 B;  4L23 A;  2QSD A;  1XT9 B;  3JW0 X;  2KLC A;  4C56 C;  4ASW C;  1KLU D;  4HDQ A;  3W2D A;  4YTM B;  1R4M I;  3DHG C;  4GDK B;  4HPP A;  4DDG D;  3A4R A;  1TT5 B;  1E7U A;  2KKC A;  1SEB D;  1XLP A;  1K52 A;  1QOB A;  3IHP C;  1NYQ A;  3DHH C;  4HCN B;  2LGS A;  1D5M C;  5TSS A;  4YXD B;  4WAF A;  2L52 A;  5GXG B;  2CJO A;  2IYD B;  2J4X A;  5CHW A;  2JRI B;  1NBF C;  2LXC A;  1U4A A;  3RFZ B;  4US9 A;  1EF1 A;  1GUA B;  5E6O A;  3KYC D;  1L0Y B;  3VUY A;  1I4X A;  1SF0 A;  2PEA A;  4MJS B;  2O2V A;  3H7S A;  3SDL C;  2WNM A;  3ZQ4 A;  2VRR B;  3VQI A;  3PO0 A;  4HWI B;  3BYY B;  2W82 A;  2D5G A;  1SB3 C;  3AE1 B;  3AU5 A;  4A90 A;  2KWD A;  2IGD A;  1ET9 A;  4LK0 M;  1UD7 A;  4XDC A;  1L4D B;  3FIL A;  1UEL A;  5G5G A;  3TIX A;  4B9K A;  5D6J B;  2Y5P A;  4RGO S;  2LVO A;  1XO3 A;  5G2N A;  3W1S C;  1BUI C;  4IM3 A;  3I63 C;  2V3S A;  3QAQ A;  4XE0 A;  2BVC A;  4G3X B;  3MJW A;  4TQ0 A;  3ML9 A;  4RGM A;  2EKE C;  4GLS C;  3V05 A;  4MEL A;  3R2T A;  1I4H A;  2MA9 B;  3MC8 A;  4FJZ A;  2Z59 B;  2HTH A;  1D5Z C;  2CHW A;  1UNS A;  3RMK C;  1F2R I;  3AE5 B;  2KMC A;  2KX0 A;  2QIE B;  2Y5C A;  2ICI A;  3I5J C;  4XDD A;  3RT3 B;  3R7Q A;  1EWY C;  1VCB A;  2MJ3 A;  3TEX A;  1FNU A;  4J6I A;  1UZX B;  2NS5 A;  3U4E G;  2O6V D;  3GS2 A;  3ZUN A;  1WM2 A;  3IVF A;  4XZ4 A;  2J0K A;  4YSZ B;  2MJE A;  2EEL A;  3BVZ A;  2WXL A;  5BYR A;  4WQO B;  3ZJU A;  4NZL B;  2JVC A;  4HDO A;  2BYT A;  1VZ6 A;  1XXG A;  2CS4 A;  1WX9 A;  4OZA A;  2N4F A;  3KLS X;  4EE2 A;  1L0X B;  4LDT D;  3T3N A;  1XD3 B;  1JRO A;  2BPS A;  4EZK A;  3L17 A;  3A1Q A;  1J0G A;  3UIO B;  4B6W A;  1WRI A;  3P63 A;  1RLF A;  1WGY A;  2V0G A;  3WIM A;  3ZTC A;  4KKJ A;  5CTR C;  2KQ4 X;  2L3Z A;  4GMV A;  3KQ4 A;  1UH6 A;  2DHZ A;  5D94 A;  4W9F A;  4RF1 A;  4XX5 A;  5MPO A;  3PGE A;  4ZRJ A;  1TKE A;  3H1U A;  1HXY D;  4E3C A;  2J7Q B;  1ZXI A;  2JT4 B;  2V3N A;  1M94 A;  3MHS D;  4W9C A;  4LCD E;  2FCN A;  2D11 A;  3ZKJ C;  5C1Z A;  4GXB A;  3IAS 1;  4K7S A;  1GB4 A;  3WAL A;  1IP9 A;  1PGX A;  4M01 A;  1PGA A;  3GE8 C;  3NVV A;  5AUK A;  1VRA B;  4LNK A;  3TUO A;  4KDI C;  2ZZP B;  2FIF A;  2HJ1 A;  3TL5 A;  1NEN B;  2W55 A;  3AEF B;  1R4M B;  4GOC A;  2MH7 A;  3EA6 A;  5T8I A;  1IGC A;  2BTE A;  4OVU A;  2WXJ A;  1OEY J;  1X1M A;  1V80 A;  2BKR B;  2KAN A;  3RCZ A;  2L05 A;  1EO6 A;  1T6B X;  3HIZ A;  3W1S A;  2QHO A;  4WUR A;  4TUU A;  1T0R C;  4DHJ B;  1RAX A;  1VLB A;  4A20 A;  4EFO A;  1FPY A;  2WXI A;  2KC2 A;  1FM0 D;  1L6U A;  2BW2 A;  2G9H D;  1VDV A;  4KSL C;  1LGR A;  1YIW A;  3B9J A;  3NHE B;  1I4R A;  1KJT A;  4G50 A;  1TY2 A;  2IBI B;  2ZJD A;  1VZ8 A;  1HEZ E;  3AED B;  2Y3A A;  3RNB C;  2JUO A;  3QAR A;  2N9E B;  1PYW D;  1Z2M A;  1Q5W B;  3MC9 A;  2LUM A;  4DHJ D;  2KDM A;  2GBN A;  2ZEQ A;  5BMH A;  3M63 B;  2MLB A;  2LD9 A;  3ZO5 B;  2KAC A;  2I2Y A;  4NJ7 A;  1EUV B;  3J9C A;  2LJ5 A;  2IO3 B;  3MTN B;  2H88 B;  4ZRP A;  1LQB A;  5FK9 C;  4MGI E;  4HKQ A;  2JRH A;  1BML C;  2JXX A;  4EZL A;  2VZK D;  4K81 A;  4GN1 A;  4KVG B;  2QCZ A;  1SE2 A;  1LXD A;  2GI9 A;  4NQL B;  5TR5 A;  3B08 A;  2NR2 A;  5L95 C;  2HD5 B;  1XLO A;  4RGT A;  4KGS A;  3RNE C;  2BS2 B;  1WRD B;  2CU1 A;  4OZB A;  3DPD A;  4BBN F;  3QK0 A;  2NTT A;  1FD6 A;  4N59 A;  2M17 A;  4F7Z A;  4QAY A;  2AWT A;  1V1P B;  4JX1 C;  4USA A;  2D3G A;  3N30 A;  4II3 B;  1TY0 A;  1PQS A;  2G4D B;  4WQM A;  4K3C A;  1WY8 A;  4REZ A;  1ZGU B;  4XGA B;  3JSV B;  1WJU A;  2D3A A;  2J0J A;  3SD5 A;  2L76 A;  2NMQ A;  3NVZ A;  2E3T A;  3VFK A;  1WXQ A;  3L16 A;  2IPK D;  2C7M B;  2WQY B;  2BYF A;  3QA8 A;  1T0Q C;  1XCT L;  2G45 B;  2MBO A;  2M19 A;  5FR6 A;  3APC A;  4URK A;  4HPL B;  3N9Y C;  4M0W B;  3KWV A;  2MBE A;  2K0P A;  3A9J B;  4A9A A;  2QDF A;  3UI3 A;  1TKY A;  1JML A;  2INN E;  2LI5 A;  2BF8 B;  4C4V B;  3RNF C;  1OQQ A;  3AV8 A;  4RH6 A;  2KN4 A;  1IGD A;  3ZNI D;  4A55 A;  3TJP A;  1P7E A;  5LXH A;  4NY0 A;  3ZVV A;  2DX5 B;  1HTQ A;  3R2I A;  2AQ1 B;  4PK1 A;  5HI1 A;  1DOI A;  1SIF A;  4K3B A;  5IKC M;  3DWM A;  3HK0 A;  2KFJ A;  3KVF B;  1E8W A;  2MP2 B;  2WDV B;  2PE9 A;  3ZTD A;  1A5R A;  4C4V A;  1WYW B;  4BFR A;  3HHM A;  4GDK A;  2LEK A;  3ZGZ A;  3DVN U;  3Q8F A;  3VRB B;  3ZNG C;  2MJD A;  1HQR D;  4MT5 A;  1HZ6 A;  1QOF A;  1ZP0 B;  2MHJ A;  2HTM E;  2NVU I;  4B0M A;  4AQ7 A;  2LAS A;  2W3S A;  4LDT B;  1T0S C;  2PPH A;  5C2T B;  1WXS A;  3PRP B;  2LZ6 A;  1OEY A;  4LNI A;  2LXA A;  4RF0 A;  1OGW A;  3P1M A;  5G55 A;  1C78 A;  5BYS A;  3VTV A;  2MBQ A;  3DCG A;  4E74 A;  3P4Q B;  1I4Q A;  4MM3 B;  5JH5 C;  3GZN B;  2RDB C;  1IPG A;  2BQQ A;  1C76 A;  1Y8R C;  2UYZ B;  1WR6 E;  2DAF A;  3KW5 B;  3RNG C;  1ZDV A;  4AJY B;  1WGK A;  5IN7 A;  5BMG A;  3TEY A;  3CST A;  3GP7 A;  4KGT A;  2AQ2 B;  2K6D B;  1V49 A;  2RGF A;  4FJV B;  2K39 A;  5JHA A;  4DXF A;  3ENE A;  3VUX A;  2RDG A;  5JHB A;  3R7R A;  3ETR A;  1JW9 D;  3AEA B;  1J8C A;  3ONS A;  1GAQ B;  2KQ7 A;  5J18 A;  2VH1 A;  4WJO A;  3TSS A;  3X23 A;  1IBX B;  1WZ3 A;  4TQ1 A;  3PVL A;  2KN5 A;  2WXP A;  4HXD A;  2GMI C;  1WGG A;  4MAC A;  3NOB A;  3NY5 A;  2JQR B;  5AZF A;  2NCN A;  2XK5 A;  3DBS A;  1SJH D;  4MDK E;  1SSN A;  1WE6 A;  3P42 A;  3GZN I;  2PVO D;  1E10 A;  3ZXV A;  4MEM A;  1JWM D;  2BYE A;  5AEK B;  3P2B A;  2AQ3 B;  2WU2 B;  2MQJ A;  2NBU A;  2N9P C;  2KFK A;  4KGR A;  1WJ6 A;  2PMV A;  4PYU A;  1JWA D;  2WXO A;  1WX7 A;  4NPN A;  3PZ8 A;  4WIP A;  3UF8 A;  3ZNZ B;  3U7D A;  3LYY A;  4DK5 A;  4HRS A;  2FAZ A;  1CK1 A;  1YQ4 B;  3W1Y A;  4MSM B;  2WXH A;  2KDE B;  2G3Q B;  1FRD A;  1V8C A;  3AUL A;  4TV3 A;  1SXT A;  2XNA C;  3B1L X;  3VH3 B;  1T5X D;  1J7C A;  1WE7 A;  1WGD A;  4HEA 1;  5DPT A;  3T9L A;  3QX1 A;  3PLU A;  4NJ6 A;  3VTU A;  4OW0 A;  2D07 B;  4LLG M;  4IUM B;  4P7I A;  4K1R B;  4IG7 B;  1TJE A;  3M62 B;  2WXR A;  1V86 A;  2GBJ A;  3GB1 A;  1DYQ A;  1JWS D;  5IOI A;  3PSE B;  2KFK B;  2J53 A;  3P4S B;  1AYF A;  1FMA D;  1N63 A;  4GU2 A;  1OTR B;  3H7P A;  2I1J A;  4S17 A;  5KHO A;  1K51 A;  2FCQ A;  1WM3 A;  3EFU A;  3PRM B;  1P3Q U;  2WU5 B;  1N62 A;  4HKZ E;  1L2N A;  3QHT A;  3BIN A;  5LXI B;  5D3D A;  2CKH B;  2GBR A;  1R4N I;  3ZRF A;  2WGS A;  4NJC A;  3RZF A;  2D2Q A;  4MGZ E;  2D3B A;  2AL3 A;  4GGQ A;  1QT9 A;  2OED A;  3ZJV A;  1T3Q A;  1XEE A;  3GE3 C;  1STE A;  4KSK C;  2JF5 A;  3TEW A;  3FAH A;  3ZXR A;  1KH0 A;  3AEB B;  3P4R B;  3OJ4 B;  3RNA C;  2DZM A;  1FFV A;  2OJW A;  1JWB D;  4EUT A;  1J7B A;  3ZRC A;  4ZYN A;  2PVG C;  4G11 A;  3N1X C;  2BGF A;  3PS6 A;  1V1O A;  2IO1 B;  3APD A;  5DPS A;  1JQ4 A;  1NYR A;  5FKA C;  2DBY A;  3BY4 B;  3LDZ E;  2TSS A;  2JZP A;  3RUL A;  4BOZ B;  5BYQ A;  2MRP A;  3VUW A;  2OJR A;  4HJK A;  2GLS A;  3B0A A;  1RYJ A;  3EUB 2;  4JQW C;  2RMM A;  3L10 B;  5BMI A;  4UDU C;  1N5X A;  1SE3 A;  1D4B A;  4GSW A;  4D2K A;  2XN9 C;  2LRU A;  2KTF A;  2WHI A;  1QOA A;  4NAM A;  4HCP B;  2Z0D B;  3UIN B;  3VH4 B;  2K3U A;  2DYO A;  2I38 A;  2IO2 B;  1MFW A;  3Q3J A;  3JSV A;  4FLH A;  4N58 A;  5E6P A;  5DCN A;  3GOE A;  4BKT A;  2LGX A;  1WX8 A;  5D2M B;  3IG3 A;  1E8Y A;  5JXV A;  1MJD A;  1CMX B;  1E9M A;  2FUH B;  4G0N B;  1F2R C;  1LM8 B;  1WMH A;  2PLP A;  2WXQ A;  3DOW A;  1F52 A;  1G6J A;  3R8B A;  2ZVO A;  4ZRI A;  1YX5 B;  1C4P A;  2KO3 A;  1MVK A;  2V4I B;  3MP9 A;  3RN9 C;  3BK1 A;  1YQ3 B;  1K50 A;  3EHV A;  2WXF A;  2WXK A;  3NUH B;  3K9O B;  5D7G A;  2Z0E B;  3MFG A;  5H8Y E;  4ZHP A;  2L83 A;  1EF5 A;  1NI3 A;  3Q14 C;  3QCA A;  2KC1 A;  3NVW A;  1F77 A;  1RFK A;  2KTR B;  3DDC B;  3T3O A;  3DVG Y;  1SE4 A;  4MH8 A;  2IGG A;  1CZP A;  4MSQ B;  5D3I B;  1TZO A;  2A5U A;  4M0W A;  4AJW A;  3A9J A;  1HE8 A;  2JWZ A;  3PLV A;  4RCO A;  1YNT E;  4ZHO A;  2RPV A;  1ACC A;  3DWG C;  3CIR B;  1KF6 B;  1TBE A;  3QQ8 B;  1DOY A;  1S3S G;  3PRE A;  4KX6 B;  5EE1 A;  1KLG D;  4NAW B;  2J42 A;  2BS3 B;  3V6C B;  4P16 A;  4TKN A;  3WAP A;  2KX3 A;  2EKI A;  2YLM A;  2J0M A;  2EMS A;  3VR8 B;  1ZXH A;  1YD8 U;  5G5H A;  4XWW A;  4EEW A;  3AEG B;  2JYE A;  1ZPS A;  3B2G A;  3H6N A;  3DBR I;  3LJ3 A;  1FNW A;  3FKY A;  4KIK A;  4TMA B;  4XWT A;  2ZPY A;  3EC8 A;  4HPM B;  2LHE A;  1E6E B;  1QLB B;  3IT4 B;  2N7D A;  1YN3 A;  4KZC A;  1NEK B;  4BZA A;  1NI2 A;  1MPE A;  2WS3 B;  2RR9 A;  3AMZ A;  2B3A A;  3CSF A;  3JYU A;  4IDI A;  1D5X C;  5E6N A;  2V9H A;  1QIL A;  2JX5 A;  3I9V 1;  4JWU C;  4IWP A;  2I1K A;  3UQA A;  4CHK A;  1WF9 A;  3KUZ A;  3DBH I;  4C80 A;  2KD0 A;  2L00 B;  3OAW A;  3KWL A;  2R2Q A;  5IO9 A;  4YL8 A;  1TS2 A;  2MSE D;  1IUE A;  4W9I A;  2FE8 A;  1JAL A;  4ZYS A;  1WR1 A;  1YN4 A;  1H4R A;  4HVB A;  3E56 A;  3M3J A;  3MJ5 A;  3W5V B;  1WH3 A;  4HJG E;  5AZH A;  4DQO C;  3DBL B;  2V4L A;  1TS4 A;  3ZW3 A;  2N9X A;  2MEK A;  2B76 B;  1BT0 A;  1QF6 A;  1DOX A;  2JYT A;  4L2Y A;  1HZ5 A;  3QWZ B;  2PTL A;  1V81 A;  1EWC A;  2OHF A;  4MGY E;  4PT5 A;  2FCS A;  5C23 A;  3RUI B;  3CF6 E;  2XBB C;  2PKO A;  1GB1 A;  1PDX A;  1E7P B;  1N60 A;  3KH0 A;  3N20 C;  4MM3 A;  1C77 A;  2JY6 A;  1PGB A;  3ML8 A;  4GDL A;  1V97 A;  5C3J B;  1P9D U;  3U2S C;  1ROE A;  4DBG A;  4IM0 A;  4M00 A;  2N1W A;  2M1M A;  1Z5S B;  2RDH A;  2QMT A;  1FXI A;  3NRZ A;  3PV1 A;  3AI5 A;  3ZJT A;  4XYC A;  2PIA A;  1YOV B;  1IBX A;  3Q3F A;  2ONQ A;  2J52 A;  4RM8 A;  3B2F A;  1JCK B;  4PYZ A;  2A4Z A;  4IOI E;  1FFU A;  3L08 A;  2NBV B;  3IT6 B;  3EFC A;  4A8X C;  3P4P B;  2MWS B;  5IAA C;  2O2V B;  4ICU A;  1XCQ L;  3AM9 A;  3L13 A;  4IWQ A;  4HRO A;  3V62 A;  1PUT A;  2AYO B;  3DQV A;  3SR6 A;  1KLV A;  2HE7 A;  3U30 A;  1WIA A;  2KJH B;  4EZJ A;  4HLE A;  2IJ0 A;  2K8H A;  4FA6 A;  3L4P A;  2CR5 A;  1YJ1 A;  5HFY A;  3U52 E;  1C79 A;  2K5P A;  2C7N B;  3BWU D;  2JWU A;  3OG5 A;  4AWJ A;  1EU4 A;  4HK2 A;  4II2 B;  3VTW A;  5GMV A;  3RZW C;  3KUC B;  1OQR A;  3PPA A;  2QEJ C;  1TS3 A;  3AH7 A;  4RNA A;  1XLQ A;  1CQV A;  1J7A A;  2OOB B;  3O65 B;  4PS8 A;  2KT7 A;  3VRA B;  1FCL A;  2WP9 B;  1N6Z A;  1KFY B;  2LJI A;  2ASQ A;  1L4Z B;  3NS1 A;  2C60 A;  3C8Y A;  1Y56 A;  4EKU A;  2QIL A;  2WXN A;  2ZCB A;  3DBL I;  4YWG G;  3L0W B;  1QZE A;  3KYD D;  2DWQ A;  3VR9 B;  1BXT A;  3ZNH B;  1WMH B;  2MP2 A;  3APF A;  2V1Y A;  5J2R A;  3A9K B;  3MC0 B;  1WGH A;  3AE8 B;  4RM9 A;  3QJZ A;  3R66 C;  2YVC A;  3A9K A;  1UWM A;  3HRD D;  2JZ3 B;  5EE3 A;  1VD2 A;  1FXA A;  4WJN A;  3I3T B;  4A3O A;  4WWO A;  3VDZ A;  1L7Y A;  2L7R A;  5CX3 A;  1YJI A;  1R4N B;  1VR9 A;  5BO4 B;  1GC6 A;  2BS4 B;  4DXG A;  4WJQ A;  2CJN A;  5HHD G;  1L5P A;  4WWN A; 
#chains in the Genus database with same CATH homology
 1FFV A;  1T6B X;  4YT0 B;  2M0A A;  4C7Y A;  3W1S A;  1OFF A;  1XF5 L;  4WUR A;  4ZOH C;  1JWB D;  1J7B A;  1AN8 A;  3AEE B;  2PVG C;  1M4V A;  1VLB A;  1JWU D;  1V1O A;  3AE2 B;  5AUI A;  1JQ4 A;  1NYR A;  5FKA C;  2G1E A;  2WXI A;  2DBY A;  1DGJ A;  1FM0 D;  1L6U A;  1TYG B;  2JZP A;  2GB1 A;  2TSS A;  2V3P A;  4YSY B;  5BYQ A;  2BW2 A;  2G9H D;  1NVI D;  4L1B A;  2SAK A;  1VDV A;  4JWS C;  1RYJ A;  1XLN A;  2ZW1 A;  3CWI A;  3EUB 2;  3B9J A;  4ARC A;  2RMM A;  5BMI A;  5E6J A;  1I4R A;  2W3R A;  3WCQ A;  1TY2 A;  4JE3 B;  3RPF C;  1Q10 A;  1I4G A;  1N5X A;  1VZ8 A;  1SE3 A;  4UDU C;  1D4B A;  1HEZ E;  4TSS A;  3AED B;  4D2K A;  1ET6 A;  2Y3A A;  2XN9 C;  3BVM A;  2BB5 A;  1B9R A;  5HG2 A;  1QOA A;  1A70 A;  4NAM A;  2KMM A;  1V1P A;  1PYW D;  3TEZ A;  2K3U A;  2DYO A;  2LUM A;  2BT6 A;  2KDM A;  5BMH A;  2I38 A;  2BB6 A;  4OHJ A;  1N5W A;  4N58 A;  4P6V F;  2KAJ A;  3BK2 A;  1FIQ A;  1UUP A;  2KAC A;  2BBC A;  2I2Y A;  3J9C A;  1SBB B;  4R3D A;  1UGJ A;  4C7Z A;  2H88 B;  2N9L A;  4ZRP A;  5FK9 C;  4HKQ A;  2X38 A;  1CJE A;  5JXV A;  1BML C;  1E9M A;  2VZK D;  2LHD A;  1F2R C;  5H92 C;  5EE0 A;  2L32 A;  2PLP A;  2WXQ A;  1SE2 A;  4GDL B;  2GI9 A;  2W54 A;  1RWS A;  3R8B A;  1XLO A;  1ENF A;  2R61 A;  4RGT A;  3LXF A;  4KGS A;  2BS2 B;  1C4P A;  1MVK A;  2V4I B;  3MP9 A;  4OZB A;  2ZW0 A;  1YQ3 B;  1K50 A;  3BK1 A;  2WXF A;  2WXK A;  3NUH B;  1K53 A;  5D7G A;  4RFB A;  2SEB D;  1AWD A;  3MFG A;  4OZC A;  2NTT A;  5H8Y E;  1FD6 A;  4ZHP A;  2L83 A;  3Q8E A;  1NI3 A;  3I57 A;  3BVG A;  4N59 A;  3Q8B A;  4KKI A;  4YTN B;  1UWX A;  3NVW A;  4RGN A;  1MI0 A;  1F77 A;  1RFK A;  3NZ3 A;  3T3O A;  1V1P B;  4JX1 C;  1SE4 A;  4MH8 A;  2M56 B;  4USA A;  2IGG A;  1CZP A;  5D3I B;  1TZO A;  3AE7 B;  5LNK 1;  4M0W A;  1TY0 A;  2DLB A;  4B0E A;  2ON8 A;  3FC4 A;  1WSP A;  4RCO A;  4WQM A;  2AX5 A;  4ARI A;  1L6V A;  1YNT E;  4REZ A;  1FO4 A;  4ZHO A;  2RPV A;  3SEB A;  1ACC A;  3DWG C;  3CIR B;  3IXS A;  1KF6 B;  1DOY A;  2NMQ A;  3NVZ A;  2E3T A;  4OVZ A;  3ABV B;  1WXQ A;  4KX6 B;  5EE1 A;  2IPK D;  1KLG D;  2H89 B;  2WQY B;  4NAW B;  1FRR A;  1RM6 C;  2J42 A;  2BS3 B;  1YN5 A;  2YEP F;  3OWE B;  4P16 A;  2EKI A;  3Q69 A;  1XCT L;  3VR8 B;  1ZXH A;  2M19 A;  4IKG A;  1KRH A;  5G5H A;  4XWW A;  1ZOY B;  2HDE A;  2JYE A;  1C4A A;  1ZPS A;  3AEG B;  3B2G A;  3KWV A;  2K0P A;  3N9Y C;  1FNW A;  4A9A A;  3AE3 B;  3UI3 A;  1TKY A;  1JML A;  2INN E;  4TMA B;  4A6Q A;  3FIL B;  3ZYY X;  4XWT A;  2LHE A;  1E6E B;  4CQN A;  1OQQ A;  1ZE3 D;  1QLB B;  2VZK B;  3IT4 B;  3AV8 A;  1YN3 A;  3U7Z A;  1NEK B;  4RH6 A;  2KN4 A;  4FXC A;  1I4P A;  1JRP A;  1IGD A;  1MPE A;  4A55 A;  2WS3 B;  2ACZ B;  2FUG 1;  1VZ7 A;  4US8 A;  1GOZ A;  1P7E A;  3AMZ A;  2INP E;  1KTK A;  2QJL A;  3E9S A;  3R2I A;  2AQ1 B;  3AE6 B;  4L23 A;  2LFI A;  5HI1 A;  1DOI A;  2QSD A;  4IDI A;  1N61 A;  1D5X C;  3DWM A;  2N9K A;  4YSX B;  1P7F A;  3AE9 B;  1SJE D;  2WLB A;  5EE9 A;  2WDV B;  4C56 C;  1QIL A;  2JX5 A;  3I9V 1;  4JWU C;  2LEK A;  1KLU D;  2Z8L A;  5FR3 A;  3W2D A;  4YTM B;  4GDK B;  1WWT A;  4J3O D;  3ZGZ A;  4C80 A;  1SEB D;  1XLP A;  3KWL A;  3Q8F A;  3NVY A;  3VRB B;  1K52 A;  2MJD A;  1HQR D;  1QOB A;  1TS2 A;  4MT5 A;  1HZ6 A;  1NYQ A;  1IUE A;  2FE8 A;  1QOF A;  1ZP0 B;  2HTM E;  1FCC C;  1D5M C;  5TSS A;  3AN1 A;  4YXD B;  4B0M A;  4AQ7 A;  4WAF A;  1D6E C;  2L52 A;  1JAL A;  2W3S A;  5GXG B;  4ZYS A;  2CJO A;  5I4D A;  1QOG A;  2J4X A;  1YN4 A;  5C2T B;  3RFZ B;  3E56 A;  4US9 A;  3MJ5 A;  3W5V B;  1L0Y B;  1I4X A;  4HJG E;  4DQO C;  1SF0 A;  1TS4 A;  4RF0 A;  2MEK A;  3P1M A;  4H2A A;  2B76 B;  1QF6 A;  1DOX A;  2JYT A;  1C78 A;  5BYS A;  4L2Y A;  1L0V B;  2WNM A;  3BII D;  3P4Q B;  1HZ5 A;  4JPS A;  3ZQ4 A;  1I4Q A;  4MM3 B;  2PTL A;  3VQI A;  3PO0 A;  3BYY B;  1SIJ A;  1EWC A;  1YJJ A;  2OHF A;  2W82 A;  2D5G A;  3EGR A;  1SB3 C;  1R7S A;  3AE1 B;  4A90 A;  4PT5 A;  2KWD A;  2IGD A;  3W9C B;  1C76 A;  1ET9 A;  3MHZ A;  3URY A;  4LK0 M;  4LTU A;  2PKO A;  4XDC A;  1L4D B;  1GB1 A;  1PDX A;  1ZDV A;  3AEC B;  1WGK A;  1E7P B;  1N60 A;  3FIL A;  5BMG A;  3TEY A;  3GP7 A;  5G5G A;  4KGT A;  1GPX A;  2AQ2 B;  1C77 A;  2E6X A;  1EM7 A;  1PGB A;  2Y5P A;  4RGO S;  1ZDX A;  1V97 A;  5C3J B;  4AS1 A;  1XO3 A;  4DXF A;  3U2S C;  1BUI C;  1ROE A;  3BYT B;  2RDG A;  3ETR A;  1JW9 D;  3AEA B;  1GAQ B;  4XE0 A;  2DYM A;  4TQ0 A;  2RDH A;  2QMT A;  1FXI A;  3NRZ A;  4RGM A;  1WYG A;  4GLS C;  1ESF A;  3TSS A;  3V05 A;  1IBX B;  3ZJT A;  1B1Z A;  2PIA A;  3R2T A;  4TQ1 A;  1E0Z A;  1I4H A;  2WXP A;  1IBX A;  3O13 A;  2ONQ A;  2J52 A;  3B2F A;  1C4C A;  3HUI A;  1D5Z C;  4MAC A;  1UNS A;  2FBW B;  2JQR B;  1JCK B;  2LMC A;  3Q8A A;  1C9F A;  3LB8 C;  4IOI E;  1F2R I;  3AE5 B;  1FFU A;  2QIE B;  3IAM 1;  2WXG A;  2Y5C A;  3IT6 B;  1SJH D;  2ICI A;  4A8X C;  4ITK A;  3P4P B;  4XDD A;  1SSN A;  3P42 A;  1I7H A;  2PVO D;  1EWY C;  1E10 A;  2MJ3 A;  2JU6 X;  2K22 A;  1XCQ L;  3AM9 A;  3TEX A;  1FNU A;  1JWM D;  2IDY A;  4HRO A;  1LO5 D;  1PUT A;  3U4E G;  2AQ3 B;  3AB5 A;  3W5U B;  3SR6 A;  2WU2 B;  2YEP B;  2CU3 A;  4KGR A;  2GRI A;  2PMV A;  1JWA D;  2IJ0 A;  3GS2 A;  1F0Z A;  4Q2J A;  2Q5W D;  3L4P A;  2WXO A;  3PZ8 A;  4WIP A;  4YSZ B;  2MJE A;  2EEL A;  2K9X A;  3BVZ A;  2WXL A;  3LYY A;  4HRS A;  5BYR A;  1C79 A;  2K5P A;  4NZL B;  3U52 E;  5HFY A;  3ZJU A;  1CK1 A;  1YQ4 B;  3HVZ A;  2BYT A;  1VZ6 A;  1XXG A;  3BWU D;  2JWU A;  4OZA A;  1EU4 A;  2WXH A;  1FRD A;  1V8C A;  3KLS X;  4ZRQ A;  4EE2 A;  1L0X B;  1SXT A;  2XNA C;  3T3N A;  1T5X D;  1J7C A;  1PFD A;  4HEA 1;  2L1A A;  2N0S B;  1JRO A;  4OW0 A;  1ZUD 2;  1WRI A;  2LGI A;  3P63 A;  1OQR A;  4LLG M;  2V0G A;  2QEJ C;  1TS3 A;  3AH7 A;  1TJE A;  4RNA A;  2WXR A;  4KKJ A;  2KQ4 X;  3GB1 A;  2JSV X;  3BZD B;  2N7J A;  3H8H A;  1XLQ A;  1DYQ A;  1JWS D;  1CQV A;  1J7A A;  3V3X A;  3KQ4 A;  3VRA B;  2J53 A;  1FCL A;  2WP9 B;  3P4S B;  1AYF A;  1FMA D;  1KFY B;  1N63 A;  4RF1 A;  2LJI A;  5MPO A;  1L4Z B;  1TKE A;  3NS1 A;  2PW9 A;  1HXY D;  1K51 A;  1QKZ A;  1Y56 A;  3C8Y A;  4WH4 A;  2QIL A;  2WDQ B;  2WXN A;  2V3N A;  1ZXI A;  1YMH E;  2WU5 B;  4YWG G;  1N62 A;  3HVD A;  4HKZ E;  3SFE B;  1TKG A;  3SFD B;  2JXT A;  2DWQ A;  1TS5 A;  1FEH A;  3VR9 B;  1BXT A;  3AE4 B;  3IAS 1;  2WDR B;  1GB4 A;  5D3D A;  2WXM A;  2NTS A;  1PGX A;  3MC0 B;  3AE8 B;  1EU3 A;  1PGA A;  4O1N A;  3NVV A;  5AUK A;  4YTP B;  4NJC A;  1UWM A;  4N6E B;  1VRA B;  3HRD D;  3TUO A;  5EE3 A;  1FXA A;  1QT9 A;  2OED A;  1NEN B;  3ZJV A;  1T3Q A;  3PZ7 A;  1XEE A;  2W55 A;  3AEF B;  1VJK A;  1STE A;  2MH7 A;  3EA6 A;  5T8I A;  1YJI A;  1IGC A;  1MHH E;  1AW7 A;  3TEW A;  3FAH A;  2BTE A;  1VR9 A;  1QQR A;  1KH0 A;  1FNV A;  2BS4 B;  3AEB B;  3P4R B;  2IGH A;  4DXG A;  2WXJ A;  1MHX A;  2CJN A;  4WWM A;  5HHD G;  1HA5 A;  1L5P A;  3Q8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...