1SSNA

Staphylokinase, sakstar variant, nmr, 20 structures
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
136
structure length
136
Chain Sequence
SSSFDKGKYKKGDDASYFEPTGPYLMVNVTGVDSKGNELLSPHYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nuclear magnetic resonance solution structure of the plasminogen-activator protein staphylokinase.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords STAPHYLOKINASE
total genus 16
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 1998-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02821 Staphylokinase Staphylokinase/Streptokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.130 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ssnA00
1SSNA 1C77A 2SAKA 1C78A 1BUIC 1C79A 1C76A
chains in the Genus database with same CATH superfamily
3TL5A 4REZA 1XCQL 2IO0B 2BW2A 5CTRC 4HKZE 1KFYB 3Q6BA 4EFOA 4P1CC 1WZ0A 3BWUD 3N1XC 2SEBD 4EOYA 1UWXA 2KWDA 1YN4A 2ZVOA 2O2VB 2KC1A 1WM2A 1JALA 3B1LX 3ZQ4A 3R3MA 1L5PA 4PS3A 4I6PA 2LD9A 4DHJD 4FULA 4B9KA 4W9KA 3HM6X 3GP7A 1ZW7A 1LQBA 2V9HA 2KX0A 2YVCA 2WP9B 5H8YE 4WJOA 1RWSA 1ZOYB 2MBHA 2CJOA 4WAFA 5LXHA 2NS5A 1V97A 3ZDMC 4P1BC 5IKCM 3NUHB 3RD2A 1KM7A 1WRIA 4KX6B 2LVOA 3QHTA 4C7ZA 1P0RA 3CSTA 5D6JB 1XLPA 3JW0X 1JW9D 4DHZB 1OTRB 4EEWA 2BYFA 3JSVB 3HUIA 2KJRA 4G3XB 4PYZA 1V2YA 4TQ0A 1F52A 4F8CB 3B2GA 4EKUA 3RNFC 3MFGA 3IVFA 2WXPA 3VXWA 5JZEB 2ZEQA 3QC8B 1WM3A 1CQVA 2KO3A 1T6BX 1YN5A 2IO3B 4MGIE 4TV3A 5BMIA 1D5ZC 1FNVA 1MPEA 2HTHA 2L0FA 3KWLA 1XT9B 1FXAA 3BZDB 1QOAA 1VRAB 3OJ4B 2KX3A 3QWZB 4LNOA 4RNAA 3J9CA 4KIKB 2XBBC 2BVCA 3BVZA 2IY1B 2VRRB 3P63A 4G50A 2M19A 3EGRA 1SE2A 1SJED 1M4VA 4YT0B 1S3SG 5AZFA 1QQRA 3R7RA 4M8NA 1L0YB 5G2NA 2LWPA 4XE0A 2N1WA 2VZKB 3WAPA 1VJKA 2DAFA 4LLGM 4ZHOA 1KLVA 1AYFA 2D2QA 3AI5A 5CX3A 2MCNB 1XF5L 2LUEA 1TS4A 3DVNU 1TJEA 1EWYC 2OEDA 1FMAD 2J4XA 4IWQA 4ARIA 2HJ8A 1V8CA 3W1SC 1JMLA 1WYGA 3U52E 4IWPA 4NQLB 1P9DU 4UDUC 2EMSA 4YL8A 1WGDA 2KN5A 2IJ0A 3QQ8B 2N9KA 4Q2JA 1UZXB 3AB5A 4GDLB 1JROA 2GRIA 4CHKA 2JZZA 1N61A 2MSED 1LFDA 3ML8A 4A3PA 4AOFA 1T0RC 3P1MA 3AU4A 1FXIA 1NYRA 4TUUA 1JWSD 1GNUA 2L52A 1WJUA 2LVPA 2CHXA 2WXQA 1BXTA 3VUXA 1YJ1A 1TT5B 3LYYA 4W9CA 1SIJA 3RZFA 1BT0A 4ANUA 3UIPB 4TQ1A 2LJ5A 3HM3A 2M56B 4F1SA 2JT4B 1TIFA 5L83A 2K8HA 3DBLI 1M94A 1DOXA 4LTUA 1YX5B 1I4QA 3NS8A 2WXRA 4W9DA 5J2RA 4A55A 1MJDA 2K9XA 3DHIC 4JX1C 2KANA 2OHFA 3WAOA 1WZ3A 4I6NB 2Z8LA 4WH4A 4N59A 4NZLB 4B95A 3LJ3A 5HHDG 4A20A 1IUEA 4JPSA 4DXAB 4GDLA 4US9A 1GB4A 2YLMA 1L4DB 1PGXA 2TSSA 4LNKA 1AWDA 2IDYA 4DHJB 3VHTC 2ONQA 2R2QA 1E7VA 1E8ZA 2K8CA 4BFRA 5D2MB 1HXYD 3M3JA 2PLPA 5IN7A 1HTQA 4II3B 2MBEA 2C7NB 3MP9A 2KQ7A 4ZYSA 2RMMA 3SFEB 2PE9A 4J3OD 1L2NA 2L3ZA 1AN8A 1NI3A 5EE9A 1XLOA 3VR8B 2M1MA 2IGHA 3EECA 3NVZA 3NZSA 2PKOA 3RNBC 2G4SA 1QOBA 2KQSA 1GC7A 2RSUA 3PPAA 2J42A 3KLSX 2PTLA 5D94A 4NJCA 2D3CA 3R7QA 1SXTA 2L7RA 3RZWC 5EDSA 2LJIA 1KOTA 5LXIB 2ZW0A 3DPDA 1F2RC 3PGEA 1UNSA 3C0RB 4W9HA 3CF6E 3PHXB 1ENFA 2O2VA 3PT2B 1U4AA 3MTNB 2KNBA 2C9WB 2JVCA 4MSMB 1TY2A 4YTMB 3H7PA 4OHJA 1H8CA 1VZ7A 2ZPNA 4EUTA 2NVUI 2LHEA 2RDBC 1XCTL 1A70A 4H2AA 1C78A 2DZIA 2Y3AA 1SSNA 3HVZA 1KJTA 5AUKA 1WYWB 2RR9A 5FK9C 2KDEB 1ZXHA 4GN1A 3NVWA 1P7FA 4BBNC 4XWTA 1CK1A 1WE6A 4GXBA 1SIFA 1SB3C 1IBXB 4RGMA 3ZNGC 3TIXA 1YJIA 4WURA 3APDA 1I4PA 4RM8A 2K6QA 2CHWA 1FXTB 3AE6B 4GIVA 2R2OA 2JPHA 4GB9A 3OLMD 4A90A 1G6JA 2NPTB 1XQQA 1E8XA 4WJPA 3S2AA 2JU6X 3KVFB 3RNEC 4ACFA 3V61A 1D3ZA 4KGRA 4AJYB 4MM3A 3P42A 2DZKA 4XWWA 2K0PA 2RPVA 2EKIA 1TKEA 3MC8A 1ESFA 3KYCD 4FJVB 4LCDE 4M8MA 4GMVA 3EA6A 4MJSB 2NCNA 4W9LA 1ZKHA 3QCAA 3RULA 3FILB 2O6VD 3GE3C 4AUQC 2DLBA 4IWOA 3W5VB 2PW9A 1L4ZB 4HPMB 5J18A 2J0JA 1L0XB 3FAHA 2JRIB 3HHMA 3BIID 2KTRB 3I5JC 2V0GA 3JSVA 2KDMA 3APFA 1B9RA 3Q3OC 2RDGA 1FNWA 2LVQA 4ANWA 4B0MA 1NYQA 1HEZE 4XZ4A 1XEEA 3VVWB 5G5GA 1ZXIA 1V49A 4IM0A 2JYTA 5BMHA 3PRPB 1ROEA 3SHQA 3Q8EA 2VH2A 1QZEA 1MHHE 1TGZB 1MHXA 2MEKA 4PK1A 3B9JA 3EUB2 3PV1A 4NPNA 1QLBB 2HE7A 1T5XD 3ZKJC 4LDTD 5JHAA 2MP2B 3A9KA 5EE3A 1OFFA 2FCQA 2LHDA 2KTRA 1TS5A 4M02A 4FLHA 2BB6A 2NBVB 2WYQA 3AE1B 1WMHB 3VDZA 2QMTA 3SDLC 4MJSA 3LXFA 2FCSA 3WAMA 3H9DA 2KWCA 4LJPB 1WR1A 1EU4A 2H89B 5TSSA 1T0YA 3R2TA 3TCAA 3L08A 1PUTA 2DHZA 4BKGA 5JHBA 2WXIA 3IAM1 1WGYA 3V3XA 2L0TA 1MG4A 3K9OB 5HI1A 4AQ7A 2UYZB 1YNTE 4ICVA 2KQ4X 2EELA 3QAQA 2PJHA 1PGBA 2A5UA 2FE8A 1QKZA 4JWUC 1C3TA 2W54A 3DVNV 2IBIB 1ACCA 5CHFA 1UWMA 3MJ5A 4HK2A 3ZGZA 3DBRB 2ASQA 1EM7A 3PRZA 5KHOA 3DCGA 3ZNHB 5EE1A 1I4RA 1VD2A 3V6EB 1XD3B 3ZXVA 3PSEB 4WJQA 5IA7A 4K3CA 2LGDA 3DDCB 1FFUA 1R4MB 4HWIB 3KW5B 4NAMA 1V6EA 1RFKA 4BOZB 1WR6E 2B76B 1BMLC 4CQNA 3N32A 2ZZPB 2QSDA 1OQYA 2MH7A 4M00A 3D32A 2BS2B 3NY5A 2A4ZA 1C77A 1GOZA 2KLCA 3GE8C 1T0SC 1HE8A 2D5GA 2I1JA 2J53A 1E7UA 1TZOA 1R4NB 1QILA 2BYTA 4WWPA 1P7EA 3KWVA 1TTNA 1HA5A 2GBNA 1K53A 1I42A 1SGHA 1QOFA 4O1NA 2D10A 1V1PB 3NS1A 4DQOC 1EF1A 3ZIMA 2JY6A 1D4BA 2R61A 2MA9B 1PDXA 2BYEA 1PQSA 4P16A 4ZRKA 3OG5A 4BVUC 2JXTA 4EZLA 1N6ZA 1IPGA 1FO4A 2V3SA 1P1AA 2O6VA 4PS8A 3UI3A 2BT6A 1V81A 1UGJA 1R7SA 4DXGA 3NZUA 2PE6B 4IC7B 2FBWB 2DYBA 1RAXA 3SFDB 2CU1A 1DGJA 2JZ3B 3M62B 2LMCA 2JWUA 1JRPA 3P4RB 3WANA 1VZ8A 3UQAA 3VQIA 4XYCA 3AEFB 4ARCA 3QJZA 4A8XC 4TMAB 3ZNID 1YMHE 3VRBB 4HPPA 4KZ0A 1K50A 1D5XC 1FD6A 2K25A 1VCBA 2BKFA 3V05A 2G3QB 2MJ3A 3GOEA 2UU7A 1J19A 1HZ6A 3ZLZA 2JX5A 3ZTCA 3NRZA 2BS4B 1YQ3B 4W9EA 1PGAA 4HRSA 4WIPA 4FADA 1SJHD 1EO6A 3RMKC 2INNE 3DWGC 4W9IA 2WDQB 3QARA 4BBNF 3V6CB 3A33B 4MSQB 3BVGA 1V1OA 2WGSA 4E3CA 1F1HA 3RNAC 3AV8A 2OJRA 3VRAB 2FAZA 3WALA 4IDIA 3N30A 2FIDA 3PZDA 3AE3B 4HVBA 3RI7C 2V4IB 2KD0A 3W5UB 1RFAA 2M0XA 2MRPA 4BKSD 2XEWA 3N1YC 3RYTA 2KHWB 4HJGE 4ZRPA 2AYOB 3P2BA 2IY0B 2JUOA 2WXMA 1TS2A 1RM6C 4HXDA 4DDID 1B1ZA 3VUYA 5E6OA 3MHZA 3GZNB 4HDQA 1ZDVA 1WJ6A 2D3AA 1I7HA 5L95C 1WJ4A 5AZGA 1OEYA 3FILA 1WF9A 3ZRFA 4JQWC 3AXCA 3A4SC 2DWQA 4HEA1 3BYYB 1EF5A 1PYWD 3OJ3A 1S1QB 1NEKB 3L0WB 3I9V1 4P6VF 4EZJA 1IBXA 2E3TA 4E71A 4IM2A 3U8ZA 3EFCA 1WGKA 4HLEA 3CWIA 3R8BA 2WXKA 2ZVNA 1J8CA 2J52A 3EHVA 2JF5A 2BTEA 2D11A 4IUMB 4RF1A 1GPXA 1Y56A 4YSXB 1GC6A 2N1VA 1WGRA 1KLGD 3PLVA 2WX1A 4FHJA 3AE9B 3BINA 3NVYA 1CJEA 4KZCA 4ZOHC 2RD0A 1WXVA 3IG3A 4X57B 2MWSB 1K52A 3GS2A 1TY0A 2PVOD 4MT5A 4A3OA 3IFWB 2IZVB 4R3DA 2MJDA 2AQ3B 1I4XA 4EZKA 3DBHI 1WFYA 1JWBD 1Q0WB 2AQ2B 1WIAA 4S17A 3WCQA 4ANXA 3QK0A 2REXA 3DOWA 3TUOA 2IGDA 2JSVX 3L54A 2JZPA 3DHHC 3ZVVA 3M95A 3RPFC 4FJZA 3HVDA 5DPRA 5BYSA 3RNGC 4P7IA 1WI0A 4JWSC 1QOGA 4BKTA 2ZNVC 1KLUD 4IOIE 2Z0DB 2YEPB 4AJWA 1Q1OA 4FN2A 2J7QB 3KQ4A 5DPTA 2H88B 3RUIB 2HTME 5JH5C 1NDDA 3T3NA 2KFJA 4W9FA 3B08A 4NNJB 3MC9A 4PS7A 4NJ6A 2KAJA 1OQQA 4WWOA 4II2B 2CS4A 1N62A 4S0RA 2IPKD 4C7YA 1XLNA 2NBWB 4XDDA 3PTFC 1A5RA 5E6NA 3PS6A 4USAA 4QAYA 2NPTA 3P4PB 3AECB 2LUMA 3DQVA 1Y8RC 2BKRB 4KDIC 4FA6A 3L16A 5DCNA 1IGCA 2KFKB 2DX5B 2IO2B 2WS3B 3JYUA 4W9GA 2ZJDA 3VTVA 1K8RB 3R66C 3NZ3A 1F9JA 1WX9A 1C4AA 2BWES 3Q8CA 3E9SA 2MJEA 2WX0A 3TEZA 3TSSA 5G5HA 1WXAA 2LEKA 2CHZA 5GXGB 3ZYYX 1SE9A 1VR9A 2N9LA 2V1YA 2Z0EB 1I4GA 3ZXRA 3AULA 3ZW3A 4JE3B 4W9JA 3P4QB 4ZDVA 3E56A 2KTFA 1V1PA 3IT6B 1TZ1A 3BY4B 4GGQA 2QIEB 1JWMD 2RDHA 3VUWA 3L10B 2INDC 3RN9C 1ZUD2 3K9PB 1IYFA 4WQOB 3U4EG 4OVZA 1J7BA 2NBUA 5JXVA 3NG0A 3ECIA 2W82A 4DK5A 2J0MA 4G11A 3VFKA 3O13A 3ZJUA 2XNAC 2AL3A 1JWUD 1YN3A 2VZKD 1V5TA 3H6NA 4RM9A 4DWFA 3TEWA 4NAWB 1N63A 4C56C 1E8WA 4HKQA 2Y5CA 4LDTB 2KJ6A 2DZMA 4YWGG 3H7PB 3AMZA 3IT4B 3AE2B 2HJ1A 2GLSA 5HKHA 4NY0A 4KKJA 3KUDB 2WDTB 1ZE3D 3A1QA 4N9F4 1WX8A 2D3BA 2N9XA 3H8HA 2XK5B 1ZGUB 1GG3A 2MP2A 3A9KB 2X38A 3NJTA 2J0KA 1ZP0B 3M63B 2ZCCA 2LGIA 2CR5A 1E90A 1ZPSA 1H4RA 1JWAD 3DWMA 4F7ZA 2CKHB 5HFYA 3UQBA 3VH4B 1IP9A 4GOCA 3AM9A 3N20C 4AP4C 2GB1A 1E6EB 1DOIA 3NHEB 2Q5WD 4J6IA 4B6WA 2QC8A 3QA8A 3HK0A 2N7JA 4MACA 4OZAA 4MDKE 5E6PA 3BK1A 2N7DA 3ZNZB 4JGHB 1C79A 2I38A 4GLSC 2AL6A 4K1RB 3A9JB 1ZDXA 3SEBA 3AN1A 3O65B 2G9HD 3DBHB 4HCPB 2N7EA 2NMQA 2QILA 2FUHB 1AW7A 2WWZA 2FIFA 1J7CA 4L23A 3V62A 1JQ4A 1Q10A 4ITKA 3QIJA 1WXQA 3C8YA 3GB1A 3PZ8A 3HRDD 1Z2MA 2NTTA 4KVGB 2LRWA 2LGXA 2MBBB 3AU5A 1N60A 4OZCA 2JRHA 1UD7A 5IO9A 3BYTB 1EU3A 1YJJA 1EUVB 3ALBA 3PZ7A 2WDRB 2W55A 1CZPA 2IO1B 3AE8B 1HQRD 3ABVB 1HZ5A 4K3BA 5MPOA 1SEBD 5C1ZA 2DZJA 1DOYA 3V60A 2JQRB 5AZHA 4GU2A 4K81A 4ZRQA 1WMHA 3B0AA 1KH0A 1FCLA 3U7ZA 2WLBA 2KOXA 2GI9A 4LJOB 1T3QA 2G1EA 1XLQA 2EKEC 4BAXA 3UF8A 1FIQA 3AEDB 2LXCA 4KV2A 2QCZA 2MW5A 4C4VB 2LASA 3AE5B 1V9JA 2AEHA 2MBOA 5D3DA 5EE0A 1TKGA 3KUZA 1WJNA 2MQJA 5BYQA 2LRUA 3DBRI 1TBEA 1NBFC 3DVGY 1F77A 2BS3B 4WWNA 1OEYJ 1WH3A 1GJZA 3ZRCA 1T0QC 2VH1A 1E7PB 1NVID 3TMPB 1E5WA 3ZUNA 3Q3MC 2WQYB 2KVRA 2Z59B 1R4MI 2KT7A 1F0ZA 1FRDA 4OZBA 3RNCC 3ZJVA 5H92C 2W3RA 5GMVA 1LM8B 4LNNA 2L76A 2LFIA 4RF0A 3DBLB 1SF0A 3W9CB 4ASWC 2WNMA 1D5MC 2L8JA 3P4SB 4HDOA 2BQQA 3WIMA 4WQMA 2KDIA 4IKGA 1FPYA 4MM3B 3AEGB 3I57A 2K6DB 3VTWA 4MH0E 1XXGA 1JCKB 4XX5A 3PHWB 4MH8A 4NAWA 2MHJA 2DAJA 2KDFB 3FC4A 1RLFA 1I35A 1L0VB 3IHPC 4L2YA 4YXDB 4MGYE 1LO5D 5DPWA 3I63C 1ET9A 1WY8A 3KUCB 3Q2AC 1Q5WB 4ZYNA 2ZPYA 3GZNI 4IM3A 5CHWA 2WXOA 3T9LA 5DPSA 3RCZA 3OAWA 4NJ7A 2WXFA 4G0NB 4C80A 2WHIA 4TKNA 3VAWA 4KSKC 3N3KB 1OGWA 2FCNA 3A4RA 4JIOU 4ZHPA 2ACZB 3CIRB 4KIKA 3URYA 3DBSA 3AEEB 3NOBA 3L13A 2V4LA 3IBEA 4L1BA 1NENB 1IGDA 2LZ6A 2BGFA 3RT3B 3PVLA 5FR6A 1L7YA 3LB8C 3Q3JA 1ISNA 1GUAB 1E10A 4CYEA 1MFWA 1Z5SB 1UELA 2V3NA 3ONSA 2KFKA 2L83A 3UINB 4RH6A 2CU3A 4CO7A 2PPHA 3VTUA 3MC0B 2DBYA 1C4PA 5E6JA 2KMCA 2NR2A 1KTKA 4AWJA 3SU8X 4MGKE 1C4CA 1YIWA 2G45B 1FNUA 2L05A 1P98A 4DBGA 2M4NA 4M0WB 2KC2A 3X23A 3SR6A 4FJYA 2GBKA 2K5PA 2KXJA 1AARA 3Q14C 2QDFA 3Q8BA 3AE4B 3Q8AA 3ETRA 5BMGA 2LI5A 2WU2B 4ZRIA 1V5OA 2OJWA 3T8MA 3ENEA 1WE7A 2QJLA 1FM0D 2MBQA 2MX2A 1RRBA 2WXHA 1C9FA 5C3JB 3APCA 4HCNB 1P3QU 5IP4D 5I4DA 1CMXB 3ZJTA 4GSWA 2FCMA 1XO3A 1YQBA 1WXSA 4K7SA 1STEA 3TBLD 1MVKA 5AEKB 2L00B 1UF0A 4TSSA 1I4HA 4OW0A 4RGTA 3VH3B 3ZDTA 1SE3A 3U30A 1V86A 3N1ZC 3Q69A 2KMAA 1YD8U 3T3OA 2KKCA 2DENB 3U7DA 5BO4B 2SAKA 3HIZA 5FKAC 3VR9B 2WXLA 2KMMA 1OQRA 3ZO5B 3CSFA 4N6EB 2INCC 1KF6B 1KRHA 2KZRA 3BVMA 4LNFA 2DYOA 2XN9C 2UWQA 2DNFA 3PREA 4KGSA 4EE2A 3KH0A 1UBIA 2IGGA 2WXNA 4ZRJA 1WXMA 3Q8FA 3PLUA 2I2YA 2KJHB 2RPQA 2K8BA 2C7MB 3L17A 2MLBA 4A9AA 4JLCA 4FHKA 4XGAB 4WJNA 3DHGC 1GAQB 4KDLB 3Q3NC 3FKYA 4BOSC 2PEAA 1FFVA 2HDEA 1EWCA 2WXJA 1LXDA 2DYMA 4RGNA 1WRDB 3U2SC 3AEBB 4OVUA 3R2IA 4HJKA 4WWMA 5IOIA 5FR3A 2ICIA 2I1KA 1V80A 1QT9A 2BBCA 2RGFA 3A1QB 1DYQA 4A6QA 3OWEB 2E6XA 2W9NA 2XK5A 4WAAA 4KSLC 1TKYA 1VLBA 2WXGA 3A9JA 2BB5A 1SE4A 1C1YB 4LNIA 1J0GA 1YQ4B 4YTPB 1QF6A 5LLIA 1UUPA 1VZ6A 5BYRA 2C7HA 1FEHA 1FCCC 4B0EA 4US8A 5AUIA 2GBJA 2L32A 3ML9A 1E0ZA 2GMIC 4N58A 3IAS1 1HTOA 1YOVB 4XDCA 2AWTA 4ANVA 4GDKA 2WDVB 3DVGX 2KACA 3Q3FA 2M0AA 3TEXA 4PT5A 1NI2A 2FNJB 3UIOB 5TR5A 4IW0A 2AX5A 2EMTA 3B2FA 4PYUA 3CMMB 3BK2A 2GBRA 3PRMB 2KYWA 4MEMA 1L6UA 4HPLB 1FRRA 4BZAA 1L6VA 2ON8A 3W1YA 3EC8A 4M0WA 5KHQA 2JXXA 1E9MA 2LGSA 4GDKB 1MI0A 1GB1A 4YSZB 1UBQA 2ZW1A 4YSYB 5C23A 1MG8A 4M01A 5D7GA 2KN4A 3X0WA 3LDZE 4AS1A 2K1FA 2PIAA 4K7WA 1JRUA 2ZCBA 2L1AA 2OOBB 2B3AA 2Y5PA 4IG7B 3JVZX 4RFBA 2KLGA 1SBBB 1R4NI 2JYEA 2D07B 2KVZA 3H7SA 2BWFA 2X8XX 1N5XA 1UH6A 1N5WA 2Y5BB 1WGHA 1J7AA 2FUG1 2K22A 5HG2A 4DHZE 2N0SB 3H1UA 4XC2A 2O6VB 3L4PA 3MHSD 1TS3A 4KGTA 1TYGB 1YX6B 3EFUA 2N9EB 2N4FA 3TEYA 4ICUA 3AE7B 1K51A 2D3GA 3ZTDA 3TJPA 2KWUB 3WA0A 3AEAB 3SD5A 2PMVA 2C60A 1WSPA 2KDBA 4D2KA 3KYDD 1UGMA 2M8SA 1E8YA 2LGYA 5G55A 5C2TB 1WGGA 2AQ1B 2LXAA 3IXSA 2INPE 4KKIA 2QEJC 3MJWA 4MELA 2NTSA 2V3PA 3AH7A 2HD5B 3QX1A 3PO0A 4HROA 5D3IB 1X1MA 3RFZB 2N9PC 2BYVE 2IYDB 2KK8A 2PVGC 4OVVA 4JL9A 2W3SA 2JWZA 1WWTA 2QHOA 4BKSA 5J17A 3W2DA 2M17A 4C4VA 2C5LC 1BUIC 2GOWA 1C76A 4FBJB 1PFDA 4YTNB 4E74A 2BPSA 1VDVA 4K7UA 3UGBB 4DXFA 4DDGD 4URKA 4LK0M 4RMAA 4FXCA 4RGOS 3NVVA 4RCOA 4NQKE 2GBMA 3C19A 5T8IA 5IAAC 1WX7A 2WU5B 4MGZE 1F2RI 2BF8B 2K39A 1LGRA 2ZNVB 1D6EC 4I6LB 2G4DB 5CHVC 2YEPF 1ET6A 1RYJA 3I3TB 5LNK1 2K3UA 4C00A 3N9YC 2CJNA 3W1SA 2KWVB
chains in the Genus database with same CATH topology
1KLUD 4REZA 4IOIE 4L1BA 1NENB 1XCQL 2KDMA 1IGDA 2BW2A 2YEPB 1B9RA 4HKZE 2RDGA 1FNWA 1KFYB 3KQ4A 3LB8C 2H88B 1NYQA 1HEZE 4B0MA 1E10A 3BWUD 1XEEA 2SEBD 5G5GA 2HTME 1ZXIA 2JYTA 5BMHA 1UWXA 2KWDA 2V3NA 1ROEA 3Q8EA 3T3NA 1YN4A 1MHHE 1JALA 2L83A 1MHXA 2MEKA 3ZQ4A 3B9JA 2KAJA 1L5PA 2CU3A 3EUB2 4RH6A 1QLBB 1T5XD 1OQQA 3MC0B 5EE3A 1OFFA 1N62A 2LHDA 2IPKD 4C7YA 3GP7A 1XLNA 2DBYA 1C4PA 5E6JA 4XDDA 1TS5A 4USAA 3P4PB 3AECB 2BB6A 2LUMA 3AE1B 1KTKA 2QMTA 1C4CA 1IGCA 2WP9B 5H8YE 2WS3B 1FNUA 1RWSA 1ZOYB 2CJOA 4WAFA 3LXFA 3NZ3A 1V97A 3SR6A 2K5PA 1EU4A 3NUHB 1C4AA 1WRIA 2H89B 3AE4B 3Q8CA 3E9SA 3Q8BA 4KX6B 5TSSA 3Q8AA 3R2TA 2MJEA 4C7ZA 3ETRA 5BMGA 1XLPA 1PUTA 3TEZA 1JW9D 2WU2B 3TSSA 5G5HA 2WXIA 2LEKA 3IAM1 3V3XA 3HUIA 5HI1A 5GXGB 3ZYYX 4TQ0A 2QJLA 4AQ7A 1FM0D 1VR9A 2N9LA 3B2GA 1YNTE 2WXHA 1I4GA 1C9FA 5C3JB 2KQ4X 3MFGA 2EELA 4JE3B 1PGBA 3P4QB 2WXPA 2FE8A 1QKZA 4JWUC 5I4DA 3E56A 2W54A 1V1PA 3IT6B 3ZJTA 1ACCA 1XO3A 1UWMA 3MJ5A 3ZGZA 1CQVA 2QIEB 1JWMD 2RDHA 1STEA 1EM7A 1T6BX 1ZUD2 1MVKA 1YN5A 5BMIA 1D5ZC 3U4EG 1I4HA 4OW0A 4OVZA 4RGTA 1J7BA 1FNVA 1I4RA 1SE3A 4TSSA 1MPEA 5EE1A 5JXVA 3KWLA 1FXAA 3BZDB 3Q69A 1QOAA 1VRAB 3T3OA 2W82A 4RNAA 3J9CA 2SAKA 3BVZA 1FFUA 3O13A 5FKAC 3VR9B 3ZJUA 2XNAC 3P63A 4NAMA 2M19A 2WXLA 1RFKA 2KMMA 1JWUD 1YN3A 1OQRA 3EGRA 2VZKD 1SE2A 1SJED 4N6EB 2B76B 1KF6B 1KRHA 1BMLC 1M4VA 4NAWB 3TEWA 1N63A 4CQNA 3BVMA 4C56C 2DYOA 2XN9C 4YT0B 4KGSA 4HKQA 1QQRA 4EE2A 2Y5CA 2IGGA 2WXNA 2QSDA 2MH7A 1L0YB 2BS2B 4YWGG 3Q8FA 1C77A 3AMZA 2I2YA 4XE0A 3IT4B 3AE2B 1GOZA 2VZKB 4A9AA 2D5GA 1VJKA 2J53A 4KKJA 1TZOA 4LLGM 4ZHOA 1QILA 1AYFA 2BYTA 1ZE3D 1GAQB 1FFVA 1P7EA 2HDEA 3KWVA 1EWCA 2WXJA 1XF5L 3H8HA 2DYMA 4RGNA 1TS4A 1HA5A 1TJEA 1EWYC 1K53A 2OEDA 1FMAD 2J4XA 1QOFA 3U2SC 2X38A 4ARIA 4O1NA 1V8CA 1ZP0B 1V1PB 3NS1A 3AEBB 4DQOC 1JMLA 1WYGA 3U52E 2LGIA 4UDUC 1D4BA 3R2IA 2R61A 2IJ0A 4WWMA 1PDXA 1ZPSA 2N9KA 1JWAD 5FR3A 4Q2JA 3AB5A 2ICIA 3DWMA 4GDLB 4P16A 1JROA 1QT9A 2BBCA 5HFYA 2GRIA 1DYQA 4A6QA 2JXTA 1FO4A 3OWEB 1N61A 2E6XA 3P1MA 1TKYA 3UI3A 3AM9A 1FXIA 1VLBA 2WXGA 2BT6A 2BB5A 1NYRA 1SE4A 1UGJA 2GB1A 1R7SA 1JWSD 4DXGA 1E6EB 1DOIA 2L52A 2FBWB 1YQ4B 4YTPB 2Q5WD 1QF6A 1UUPA 3SFDB 1VZ6A 2WXQA 1BXTA 5BYRA 2N7JA 4MACA 1FEHA 4OZAA 1FCCC 4B0EA 4US8A 1DGJA 3LYYA 5AUIA 2L32A 2LMCA 3BK1A 1E0ZA 1SIJA 2JWUA 1C79A 1JRPA 2I38A 3P4RB 4GLSC 4N58A 4TQ1A 1VZ8A 3IAS1 2M56B 3VQIA 1ZDXA 3SEBA 3AN1A 3AEFB 4XDCA 4A8XC 2G9HD 4ARCA 4TMAB 2NMQA 1DOXA 2QILA 1YMHE 4LTUA 2WDVB 1AW7A 3VRBB 1J7CA 2KACA 4L23A 2M0AA 1I4QA 3TEXA 1JQ4A 4PT5A 1K50A 2WXRA 1D5XC 1Q10A 1FD6A 4ITKA 2AX5A 4A55A 3B2FA 2K9XA 3V05A 1WXQA 2MJ3A 3BK2A 4JX1C 3C8YA 3GB1A 3PZ8A 2OHFA 3HRDD 1HZ6A 2NTTA 1L6UA 2JX5A 1FRRA 2Z8LA 4WH4A 4N59A 1L6VA 2ON8A 3NRZA 4NZLB 1N60A 4M0WA 4OZCA 2BS4B 1YQ3B 5HHDG 1PGAA 1IUEA 3BYTB 4HRSA 1E9MA 4WIPA 4GDKB 1MI0A 1GB1A 4JPSA 1EU3A 1SJHD 4US9A 2INNE 3DWGC 4YSZB 2WDQB 1YJJA 1GB4A 3PZ7A 3BVGA 1L4DB 2WDRB 2ZW1A 2W55A 1CZPA 1PGXA 1V1OA 2TSSA 4YSYB 1AWDA 3AE8B 2IDYA 3AV8A 1HQRD 3ABVB 5D7GA 1HZ5A 2KN4A 3VRAB 5MPOA 1SEBD 2ONQA 4AS1A 1DOYA 4IDIA 1HXYD 2PIAA 2PLPA 2JQRB 3AE3B 3MP9A 4ZYSA 2V4IB 2L1AA 2RMMA 2Y5PA 3SFEB 4J3OD 4RFBA 4ZRQA 3W5UB 1SBBB 1AN8A 1NI3A 2JYEA 1KH0A 5EE9A 1XLOA 3VR8B 1FCLA 3U7ZA 2IGHA 2WLBA 3NVZA 2GI9A 1N5XA 1N5WA 1T3QA 2G1EA 2PKOA 4HJGE 1XLQA 4ZRPA 1J7AA 1QOBA 2FUG1 2K22A 2WXMA 1TS2A 1RM6C 5HG2A 2J42A 3KLSX 1B1ZA 1FIQA 2N0SB 2PTLA 3AEDB 4NJCA 3MHZA 1SXTA 3AE5B 3L4PA 1ZDVA 5D3DA 5EE0A 1I7HA 1TKGA 1TS3A 2LJIA 4KGTA 1TYGB 2ZW0A 5BYQA 1F2RC 3TEYA 1UNSA 3FILA 3AE7B 1K51A 1F77A 2BS3B 1ENFA 4HEA1 2DWQA 3BYYB 3AEAB 1E7PB 1NVID 1PYWD 1TY2A 2PMVA 4YTMB 1NEKB 4OHJA 2WQYB 1WSPA 3I9V1 4P6VF 1VZ7A 1IBXA 2LHEA 2E3TA 1XCTL 1A70A 4H2AA 1C78A 4D2KA 1F0ZA 1WGKA 2Y3AA 3CWIA 3R8BA 1SSNA 1FRDA 3HVZA 4OZBA 3ZJVA 2WXKA 5AUKA 5H92C 2W3RA 5C2TB 2AQ1B 5FK9C 2LFIA 4RF0A 2J52A 1ZXHA 2BTEA 1SF0A 4RF1A 3IXSA 1GPXA 3NVWA 1P7FA 2INPE 4KKIA 2QEJC 4XWTA 1Y56A 3W9CB 4YSXB 2WNMA 1CK1A 2NTSA 1SB3C 1D5MC 2V3PA 4RGMA 1IBXB 3P4SB 3AH7A 1KLGD 4WQMA 1YJIA 3PO0A 4HROA 4IKGA 4WURA 3AE9B 4MM3B 5D3IB 3AEGB 3I57A 1I4PA 3NVYA 3RFZB 3AE6B 1CJEA 1XXGA 4ZOHC 1JCKB 2PVGC 4MH8A 4A90A 2W3SA 3FC4A 1K52A 1WWTA 3GS2A 1L0VB 1TY0A 2JU6X 4L2YA 2PVOD 4YXDB 4MT5A 3W2DA 1LO5D 4R3DA 1BUIC 2MJDA 1C76A 2AQ3B 1I4XA 1PFDA 4YTNB 4KGRA 1ET9A 1VDVA 1JWBD 4DXFA 3P42A 4XWWA 4LK0M 4FXCA 4RGOS 2K0PA 2RPVA 2AQ2B 2EKIA 2WXOA 3NVVA 4RCOA 3WCQA 1TKEA 1ESFA 5T8IA 2WXFA 4C80A 2WU5B 3TUOA 1F2RI 2IGDA 2JSVX 3EA6A 2JZPA 1D6EC 3RPFC 2YEPF 3FILB 4ZHPA 1ET6A 1RYJA 3HVDA 2DLBA 3W5VB 2PW9A 1L4ZB 5LNK1 5BYSA 2K3UA 2ACZB 3CIRB 3URYA 1L0XB 3FAHA 3N9YC 4JWSC 2CJNA 3BIID 3AEEB 1QOGA 2V0GA 3W1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SSN A;  1C77 A;  2SAK A;  1C78 A;  1BUI C;  1C79 A;  1C76 A; 
#chains in the Genus database with same CATH topology
 3TL5 A;  4REZ A;  1XCQ L;  2IO0 B;  2BW2 A;  5CTR C;  4HKZ E;  1KFY B;  3Q6B A;  4EFO A;  4P1C C;  1WZ0 A;  3BWU D;  3N1X C;  2SEB D;  4EOY A;  1UWX A;  2KWD A;  1YN4 A;  2ZVO A;  2O2V B;  2KC1 A;  1WM2 A;  1JAL A;  3B1L X;  3ZQ4 A;  3R3M A;  1L5P A;  4PS3 A;  4I6P A;  2LD9 A;  4DHJ D;  4FUL A;  4B9K A;  4W9K A;  3HM6 X;  3GP7 A;  1ZW7 A;  1LQB A;  2V9H A;  2KX0 A;  2YVC A;  2WP9 B;  5H8Y E;  4WJO A;  1RWS A;  1ZOY B;  2MBH A;  2CJO A;  4WAF A;  5LXH A;  2NS5 A;  1V97 A;  3ZDM C;  4P1B C;  5IKC M;  3NUH B;  3RD2 A;  1KM7 A;  1WRI A;  4KX6 B;  2LVO A;  3QHT A;  4C7Z A;  1P0R A;  3CST A;  5D6J B;  1XLP A;  3JW0 X;  1JW9 D;  4DHZ B;  1OTR B;  4EEW A;  2BYF A;  3JSV B;  3HUI A;  2KJR A;  4G3X B;  4PYZ A;  1V2Y A;  4TQ0 A;  1F52 A;  4F8C B;  3B2G A;  4EKU A;  3RNF C;  3MFG A;  3IVF A;  2WXP A;  3VXW A;  5JZE B;  2ZEQ A;  3QC8 B;  1WM3 A;  1CQV A;  2KO3 A;  1T6B X;  1YN5 A;  2IO3 B;  4MGI E;  4TV3 A;  5BMI A;  1D5Z C;  1FNV A;  1MPE A;  2HTH A;  2L0F A;  3KWL A;  1XT9 B;  1FXA A;  3BZD B;  1QOA A;  1VRA B;  3OJ4 B;  2KX3 A;  3QWZ B;  4LNO A;  4RNA A;  3J9C A;  4KIK B;  2XBB C;  2BVC A;  3BVZ A;  2IY1 B;  2VRR B;  3P63 A;  4G50 A;  2M19 A;  3EGR A;  1SE2 A;  1SJE D;  1M4V A;  4YT0 B;  1S3S G;  5AZF A;  1QQR A;  3R7R A;  4M8N A;  1L0Y B;  5G2N A;  2LWP A;  4XE0 A;  2N1W A;  2VZK B;  3WAP A;  1VJK A;  2DAF A;  4LLG M;  4ZHO A;  1KLV A;  1AYF A;  2D2Q A;  3AI5 A;  5CX3 A;  2MCN B;  1XF5 L;  2LUE A;  1TS4 A;  3DVN U;  1TJE A;  1EWY C;  2OED A;  1FMA D;  2J4X A;  4IWQ A;  4ARI A;  2HJ8 A;  1V8C A;  3W1S C;  1JML A;  1WYG A;  3U52 E;  4IWP A;  4NQL B;  1P9D U;  4UDU C;  2EMS A;  4YL8 A;  1WGD A;  2KN5 A;  2IJ0 A;  3QQ8 B;  2N9K A;  4Q2J A;  1UZX B;  3AB5 A;  4GDL B;  1JRO A;  2GRI A;  4CHK A;  2JZZ A;  1N61 A;  2MSE D;  1LFD A;  3ML8 A;  4A3P A;  4AOF A;  1T0R C;  3P1M A;  3AU4 A;  1FXI A;  1NYR A;  4TUU A;  1JWS D;  1GNU A;  2L52 A;  1WJU A;  2LVP A;  2CHX A;  2WXQ A;  1BXT A;  3VUX A;  1YJ1 A;  1TT5 B;  3LYY A;  4W9C A;  1SIJ A;  3RZF A;  1BT0 A;  4ANU A;  3UIP B;  4TQ1 A;  2LJ5 A;  3HM3 A;  2M56 B;  4F1S A;  2JT4 B;  1TIF A;  5L83 A;  2K8H A;  3DBL I;  1M94 A;  1DOX A;  4LTU A;  1YX5 B;  1I4Q A;  3NS8 A;  2WXR A;  4W9D A;  5J2R A;  4A55 A;  1MJD A;  2K9X A;  3DHI C;  4JX1 C;  2KAN A;  2OHF A;  3WAO A;  1WZ3 A;  4I6N B;  2Z8L A;  4WH4 A;  4N59 A;  4NZL B;  4B95 A;  3LJ3 A;  5HHD G;  4A20 A;  1IUE A;  4JPS A;  4DXA B;  4GDL A;  4US9 A;  1GB4 A;  2YLM A;  1L4D B;  1PGX A;  2TSS A;  4LNK A;  1AWD A;  2IDY A;  4DHJ B;  3VHT C;  2ONQ A;  2R2Q A;  1E7V A;  1E8Z A;  2K8C A;  4BFR A;  5D2M B;  1HXY D;  3M3J A;  2PLP A;  5IN7 A;  1HTQ A;  4II3 B;  2MBE A;  2C7N B;  3MP9 A;  2KQ7 A;  4ZYS A;  2RMM A;  3SFE B;  2PE9 A;  4J3O D;  1L2N A;  2L3Z A;  1AN8 A;  1NI3 A;  5EE9 A;  1XLO A;  3VR8 B;  2M1M A;  2IGH A;  3EEC A;  3NVZ A;  3NZS A;  2PKO A;  3RNB C;  2G4S A;  1QOB A;  2KQS A;  1GC7 A;  2RSU A;  3PPA A;  2J42 A;  3KLS X;  2PTL A;  5D94 A;  4NJC A;  2D3C A;  3R7Q A;  1SXT A;  2L7R A;  3RZW C;  5EDS A;  2LJI A;  1KOT A;  5LXI B;  2ZW0 A;  3DPD A;  1F2R C;  3PGE A;  1UNS A;  3C0R B;  4W9H A;  3CF6 E;  3PHX B;  1ENF A;  2O2V A;  3PT2 B;  1U4A A;  3MTN B;  2KNB A;  2C9W B;  2JVC A;  4MSM B;  1TY2 A;  4YTM B;  3H7P A;  4OHJ A;  1H8C A;  1VZ7 A;  2ZPN A;  4EUT A;  2NVU I;  2LHE A;  2RDB C;  1XCT L;  1A70 A;  4H2A A;  1C78 A;  2DZI A;  2Y3A A;  1SSN A;  3HVZ A;  1KJT A;  5AUK A;  1WYW B;  2RR9 A;  5FK9 C;  2KDE B;  1ZXH A;  4GN1 A;  3NVW A;  1P7F A;  4BBN C;  4XWT A;  1CK1 A;  1WE6 A;  4GXB A;  1SIF A;  1SB3 C;  1IBX B;  4RGM A;  3ZNG C;  3TIX A;  1YJI A;  4WUR A;  3APD A;  1I4P A;  4RM8 A;  2K6Q A;  2CHW A;  1FXT B;  3AE6 B;  4GIV A;  2R2O A;  2JPH A;  4GB9 A;  3OLM D;  4A90 A;  1G6J A;  2NPT B;  1XQQ A;  1E8X A;  4WJP A;  3S2A A;  2JU6 X;  3KVF B;  3RNE C;  4ACF A;  3V61 A;  1D3Z A;  4KGR A;  4AJY B;  4MM3 A;  3P42 A;  2DZK A;  4XWW A;  2K0P A;  2RPV A;  2EKI A;  1TKE A;  3MC8 A;  1ESF A;  3KYC D;  4FJV B;  4LCD E;  4M8M A;  4GMV A;  3EA6 A;  4MJS B;  2NCN A;  4W9L A;  1ZKH A;  3QCA A;  3RUL A;  3FIL B;  2O6V D;  3GE3 C;  4AUQ C;  2DLB A;  4IWO A;  3W5V B;  2PW9 A;  1L4Z B;  4HPM B;  5J18 A;  2J0J A;  1L0X B;  3FAH A;  2JRI B;  3HHM A;  3BII D;  2KTR B;  3I5J C;  2V0G A;  3JSV A;  2KDM A;  3APF A;  1B9R A;  3Q3O C;  2RDG A;  1FNW A;  2LVQ A;  4ANW A;  4B0M A;  1NYQ A;  1HEZ E;  4XZ4 A;  1XEE A;  3VVW B;  5G5G A;  1ZXI A;  1V49 A;  4IM0 A;  2JYT A;  5BMH A;  3PRP B;  1ROE A;  3SHQ A;  3Q8E A;  2VH2 A;  1QZE A;  1MHH E;  1TGZ B;  1MHX A;  2MEK A;  4PK1 A;  3B9J A;  3EUB 2;  3PV1 A;  4NPN A;  1QLB B;  2HE7 A;  1T5X D;  3ZKJ C;  4LDT D;  5JHA A;  2MP2 B;  3A9K A;  5EE3 A;  1OFF A;  2FCQ A;  2LHD A;  2KTR A;  1TS5 A;  4M02 A;  4FLH A;  2BB6 A;  2NBV B;  2WYQ A;  3AE1 B;  1WMH B;  3VDZ A;  2QMT A;  3SDL C;  4MJS A;  3LXF A;  2FCS A;  3WAM A;  3H9D A;  2KWC A;  4LJP B;  1WR1 A;  1EU4 A;  2H89 B;  5TSS A;  1T0Y A;  3R2T A;  3TCA A;  3L08 A;  1PUT A;  2DHZ A;  4BKG A;  5JHB A;  2WXI A;  3IAM 1;  1WGY A;  3V3X A;  2L0T A;  1MG4 A;  3K9O B;  5HI1 A;  4AQ7 A;  2UYZ B;  1YNT E;  4ICV A;  2KQ4 X;  2EEL A;  3QAQ A;  2PJH A;  1PGB A;  2A5U A;  2FE8 A;  1QKZ A;  4JWU C;  1C3T A;  2W54 A;  3DVN V;  2IBI B;  1ACC A;  5CHF A;  1UWM A;  3MJ5 A;  4HK2 A;  3ZGZ A;  3DBR B;  2ASQ A;  1EM7 A;  3PRZ A;  5KHO A;  3DCG A;  3ZNH B;  5EE1 A;  1I4R A;  1VD2 A;  3V6E B;  1XD3 B;  3ZXV A;  3PSE B;  4WJQ A;  5IA7 A;  4K3C A;  2LGD A;  3DDC B;  1FFU A;  1R4M B;  4HWI B;  3KW5 B;  4NAM A;  1V6E A;  1RFK A;  4BOZ B;  1WR6 E;  2B76 B;  1BML C;  4CQN A;  3N32 A;  2ZZP B;  2QSD A;  1OQY A;  2MH7 A;  4M00 A;  3D32 A;  2BS2 B;  3NY5 A;  2A4Z A;  1C77 A;  1GOZ A;  2KLC A;  3GE8 C;  1T0S C;  1HE8 A;  2D5G A;  2I1J A;  2J53 A;  1E7U A;  1TZO A;  1R4N B;  1QIL A;  2BYT A;  4WWP A;  1P7E A;  3KWV A;  1TTN A;  1HA5 A;  2GBN A;  1K53 A;  1I42 A;  1SGH A;  1QOF A;  4O1N A;  2D10 A;  1V1P B;  3NS1 A;  4DQO C;  1EF1 A;  3ZIM A;  2JY6 A;  1D4B A;  2R61 A;  2MA9 B;  1PDX A;  2BYE A;  1PQS A;  4P16 A;  4ZRK A;  3OG5 A;  4BVU C;  2JXT A;  4EZL A;  1N6Z A;  1IPG A;  1FO4 A;  2V3S A;  1P1A A;  2O6V A;  4PS8 A;  3UI3 A;  2BT6 A;  1V81 A;  1UGJ A;  1R7S A;  4DXG A;  3NZU A;  2PE6 B;  4IC7 B;  2FBW B;  2DYB A;  1RAX A;  3SFD B;  2CU1 A;  1DGJ A;  2JZ3 B;  3M62 B;  2LMC A;  2JWU A;  1JRP A;  3P4R B;  3WAN A;  1VZ8 A;  3UQA A;  3VQI A;  4XYC A;  3AEF B;  4ARC A;  3QJZ A;  4A8X C;  4TMA B;  3ZNI D;  1YMH E;  3VRB B;  4HPP A;  4KZ0 A;  1K50 A;  1D5X C;  1FD6 A;  2K25 A;  1VCB A;  2BKF A;  3V05 A;  2G3Q B;  2MJ3 A;  3GOE A;  2UU7 A;  1J19 A;  1HZ6 A;  3ZLZ A;  2JX5 A;  3ZTC A;  3NRZ A;  2BS4 B;  1YQ3 B;  4W9E A;  1PGA A;  4HRS A;  4WIP A;  4FAD A;  1SJH D;  1EO6 A;  3RMK C;  2INN E;  3DWG C;  4W9I A;  2WDQ B;  3QAR A;  4BBN F;  3V6C B;  3A33 B;  4MSQ B;  3BVG A;  1V1O A;  2WGS A;  4E3C A;  1F1H A;  3RNA C;  3AV8 A;  2OJR A;  3VRA B;  2FAZ A;  3WAL A;  4IDI A;  3N30 A;  2FID A;  3PZD A;  3AE3 B;  4HVB A;  3RI7 C;  2V4I B;  2KD0 A;  3W5U B;  1RFA A;  2M0X A;  2MRP A;  4BKS D;  2XEW A;  3N1Y C;  3RYT A;  2KHW B;  4HJG E;  4ZRP A;  2AYO B;  3P2B A;  2IY0 B;  2JUO A;  2WXM A;  1TS2 A;  1RM6 C;  4HXD A;  4DDI D;  1B1Z A;  3VUY A;  5E6O A;  3MHZ A;  3GZN B;  4HDQ A;  1ZDV A;  1WJ6 A;  2D3A A;  1I7H A;  5L95 C;  1WJ4 A;  5AZG A;  1OEY A;  3FIL A;  1WF9 A;  3ZRF A;  4JQW C;  3AXC A;  3A4S C;  2DWQ A;  4HEA 1;  3BYY B;  1EF5 A;  1PYW D;  3OJ3 A;  1S1Q B;  1NEK B;  3L0W B;  3I9V 1;  4P6V F;  4EZJ A;  1IBX A;  2E3T A;  4E71 A;  4IM2 A;  3U8Z A;  3EFC A;  1WGK A;  4HLE A;  3CWI A;  3R8B A;  2WXK A;  2ZVN A;  1J8C A;  2J52 A;  3EHV A;  2JF5 A;  2BTE A;  2D11 A;  4IUM B;  4RF1 A;  1GPX A;  1Y56 A;  4YSX B;  1GC6 A;  2N1V A;  1WGR A;  1KLG D;  3PLV A;  2WX1 A;  4FHJ A;  3AE9 B;  3BIN A;  3NVY A;  1CJE A;  4KZC A;  4ZOH C;  2RD0 A;  1WXV A;  3IG3 A;  4X57 B;  2MWS B;  1K52 A;  3GS2 A;  1TY0 A;  2PVO D;  4MT5 A;  4A3O A;  3IFW B;  2IZV B;  4R3D A;  2MJD A;  2AQ3 B;  1I4X A;  4EZK A;  3DBH I;  1WFY A;  1JWB D;  1Q0W B;  2AQ2 B;  1WIA A;  4S17 A;  3WCQ A;  4ANX A;  3QK0 A;  2REX A;  3DOW A;  3TUO A;  2IGD A;  2JSV X;  3L54 A;  2JZP A;  3DHH C;  3ZVV A;  3M95 A;  3RPF C;  4FJZ A;  3HVD A;  5DPR A;  5BYS A;  3RNG C;  4P7I A;  1WI0 A;  4JWS C;  1QOG A;  4BKT A;  2ZNV C;  1KLU D;  4IOI E;  2Z0D B;  2YEP B;  4AJW A;  1Q1O A;  4FN2 A;  2J7Q B;  3KQ4 A;  5DPT A;  2H88 B;  3RUI B;  2HTM E;  5JH5 C;  1NDD A;  3T3N A;  2KFJ A;  4W9F A;  3B08 A;  4NNJ B;  3MC9 A;  4PS7 A;  4NJ6 A;  2KAJ A;  1OQQ A;  4WWO A;  4II2 B;  2CS4 A;  1N62 A;  4S0R A;  2IPK D;  4C7Y A;  1XLN A;  2NBW B;  4XDD A;  3PTF C;  1A5R A;  5E6N A;  3PS6 A;  4USA A;  4QAY A;  2NPT A;  3P4P B;  3AEC B;  2LUM A;  3DQV A;  1Y8R C;  2BKR B;  4KDI C;  4FA6 A;  3L16 A;  5DCN A;  1IGC A;  2KFK B;  2DX5 B;  2IO2 B;  2WS3 B;  3JYU A;  4W9G A;  2ZJD A;  3VTV A;  1K8R B;  3R66 C;  3NZ3 A;  1F9J A;  1WX9 A;  1C4A A;  2BWE S;  3Q8C A;  3E9S A;  2MJE A;  2WX0 A;  3TEZ A;  3TSS A;  5G5H A;  1WXA A;  2LEK A;  2CHZ A;  5GXG B;  3ZYY X;  1SE9 A;  1VR9 A;  2N9L A;  2V1Y A;  2Z0E B;  1I4G A;  3ZXR A;  3AUL A;  3ZW3 A;  4JE3 B;  4W9J A;  3P4Q B;  4ZDV A;  3E56 A;  2KTF A;  1V1P A;  3IT6 B;  1TZ1 A;  3BY4 B;  4GGQ A;  2QIE B;  1JWM D;  2RDH A;  3VUW A;  3L10 B;  2IND C;  3RN9 C;  1ZUD 2;  3K9P B;  1IYF A;  4WQO B;  3U4E G;  4OVZ A;  1J7B A;  2NBU A;  5JXV A;  3NG0 A;  3ECI A;  2W82 A;  4DK5 A;  2J0M A;  4G11 A;  3VFK A;  3O13 A;  3ZJU A;  2XNA C;  2AL3 A;  1JWU D;  1YN3 A;  2VZK D;  1V5T A;  3H6N A;  4RM9 A;  4DWF A;  3TEW A;  4NAW B;  1N63 A;  4C56 C;  1E8W A;  4HKQ A;  2Y5C A;  4LDT B;  2KJ6 A;  2DZM A;  4YWG G;  3H7P B;  3AMZ A;  3IT4 B;  3AE2 B;  2HJ1 A;  2GLS A;  5HKH A;  4NY0 A;  4KKJ A;  3KUD B;  2WDT B;  1ZE3 D;  3A1Q A;  4N9F 4;  1WX8 A;  2D3B A;  2N9X A;  3H8H A;  2XK5 B;  1ZGU B;  1GG3 A;  2MP2 A;  3A9K B;  2X38 A;  3NJT A;  2J0K A;  1ZP0 B;  3M63 B;  2ZCC A;  2LGI A;  2CR5 A;  1E90 A;  1ZPS A;  1H4R A;  1JWA D;  3DWM A;  4F7Z A;  2CKH B;  5HFY A;  3UQB A;  3VH4 B;  1IP9 A;  4GOC A;  3AM9 A;  3N20 C;  4AP4 C;  2GB1 A;  1E6E B;  1DOI A;  3NHE B;  2Q5W D;  4J6I A;  4B6W A;  2QC8 A;  3QA8 A;  3HK0 A;  2N7J A;  4MAC A;  4OZA A;  4MDK E;  5E6P A;  3BK1 A;  2N7D A;  3ZNZ B;  4JGH B;  1C79 A;  2I38 A;  4GLS C;  2AL6 A;  4K1R B;  3A9J B;  1ZDX A;  3SEB A;  3AN1 A;  3O65 B;  2G9H D;  3DBH B;  4HCP B;  2N7E A;  2NMQ A;  2QIL A;  2FUH B;  1AW7 A;  2WWZ A;  2FIF A;  1J7C A;  4L23 A;  3V62 A;  1JQ4 A;  1Q10 A;  4ITK A;  3QIJ A;  1WXQ A;  3C8Y A;  3GB1 A;  3PZ8 A;  3HRD D;  1Z2M A;  2NTT A;  4KVG B;  2LRW A;  2LGX A;  2MBB B;  3AU5 A;  1N60 A;  4OZC A;  2JRH A;  1UD7 A;  5IO9 A;  3BYT B;  1EU3 A;  1YJJ A;  1EUV B;  3ALB A;  3PZ7 A;  2WDR B;  2W55 A;  1CZP A;  2IO1 B;  3AE8 B;  1HQR D;  3ABV B;  1HZ5 A;  4K3B A;  5MPO A;  1SEB D;  5C1Z A;  2DZJ A;  1DOY A;  3V60 A;  2JQR B;  5AZH A;  4GU2 A;  4K81 A;  4ZRQ A;  1WMH A;  3B0A A;  1KH0 A;  1FCL A;  3U7Z A;  2WLB A;  2KOX A;  2GI9 A;  4LJO B;  1T3Q A;  2G1E A;  1XLQ A;  2EKE C;  4BAX A;  3UF8 A;  1FIQ A;  3AED B;  2LXC A;  4KV2 A;  2QCZ A;  2MW5 A;  4C4V B;  2LAS A;  3AE5 B;  1V9J A;  2AEH A;  2MBO A;  5D3D A;  5EE0 A;  1TKG A;  3KUZ A;  1WJN A;  2MQJ A;  5BYQ A;  2LRU A;  3DBR I;  1TBE A;  1NBF C;  3DVG Y;  1F77 A;  2BS3 B;  4WWN A;  1OEY J;  1WH3 A;  1GJZ A;  3ZRC A;  1T0Q C;  2VH1 A;  1E7P B;  1NVI D;  3TMP B;  1E5W A;  3ZUN A;  3Q3M C;  2WQY B;  2KVR A;  2Z59 B;  1R4M I;  2KT7 A;  1F0Z A;  1FRD A;  4OZB A;  3RNC C;  3ZJV A;  5H92 C;  2W3R A;  5GMV A;  1LM8 B;  4LNN A;  2L76 A;  2LFI A;  4RF0 A;  3DBL B;  1SF0 A;  3W9C B;  4ASW C;  2WNM A;  1D5M C;  2L8J A;  3P4S B;  4HDO A;  2BQQ A;  3WIM A;  4WQM A;  2KDI A;  4IKG A;  1FPY A;  4MM3 B;  3AEG B;  3I57 A;  2K6D B;  3VTW A;  4MH0 E;  1XXG A;  1JCK B;  4XX5 A;  3PHW B;  4MH8 A;  4NAW A;  2MHJ A;  2DAJ A;  2KDF B;  3FC4 A;  1RLF A;  1I35 A;  1L0V B;  3IHP C;  4L2Y A;  4YXD B;  4MGY E;  1LO5 D;  5DPW A;  3I63 C;  1ET9 A;  1WY8 A;  3KUC B;  3Q2A C;  1Q5W B;  4ZYN A;  2ZPY A;  3GZN I;  4IM3 A;  5CHW A;  2WXO A;  3T9L A;  5DPS A;  3RCZ A;  3OAW A;  4NJ7 A;  2WXF A;  4G0N B;  4C80 A;  2WHI A;  4TKN A;  3VAW A;  4KSK C;  3N3K B;  1OGW A;  2FCN A;  3A4R A;  4JIO U;  4ZHP A;  2ACZ B;  3CIR B;  4KIK A;  3URY A;  3DBS A;  3AEE B;  3NOB A;  3L13 A;  2V4L A;  3IBE A;  4L1B A;  1NEN B;  1IGD A;  2LZ6 A;  2BGF A;  3RT3 B;  3PVL A;  5FR6 A;  1L7Y A;  3LB8 C;  3Q3J A;  1ISN A;  1GUA B;  1E10 A;  4CYE A;  1MFW A;  1Z5S B;  1UEL A;  2V3N A;  3ONS A;  2KFK A;  2L83 A;  3UIN B;  4RH6 A;  2CU3 A;  4CO7 A;  2PPH A;  3VTU A;  3MC0 B;  2DBY A;  1C4P A;  5E6J A;  2KMC A;  2NR2 A;  1KTK A;  4AWJ A;  3SU8 X;  4MGK E;  1C4C A;  1YIW A;  2G45 B;  1FNU A;  2L05 A;  1P98 A;  4DBG A;  2M4N A;  4M0W B;  2KC2 A;  3X23 A;  3SR6 A;  4FJY A;  2GBK A;  2K5P A;  2KXJ A;  1AAR A;  3Q14 C;  2QDF A;  3Q8B A;  3AE4 B;  3Q8A A;  3ETR A;  5BMG A;  2LI5 A;  2WU2 B;  4ZRI A;  1V5O A;  2OJW A;  3T8M A;  3ENE A;  1WE7 A;  2QJL A;  1FM0 D;  2MBQ A;  2MX2 A;  1RRB A;  2WXH A;  1C9F A;  5C3J B;  3APC A;  4HCN B;  1P3Q U;  5IP4 D;  5I4D A;  1CMX B;  3ZJT A;  4GSW A;  2FCM A;  1XO3 A;  1YQB A;  1WXS A;  4K7S A;  1STE A;  3TBL D;  1MVK A;  5AEK B;  2L00 B;  1UF0 A;  4TSS A;  1I4H A;  4OW0 A;  4RGT A;  3VH3 B;  3ZDT A;  1SE3 A;  3U30 A;  1V86 A;  3N1Z C;  3Q69 A;  2KMA A;  1YD8 U;  3T3O A;  2KKC A;  2DEN B;  3U7D A;  5BO4 B;  2SAK A;  3HIZ A;  5FKA C;  3VR9 B;  2WXL A;  2KMM A;  1OQR A;  3ZO5 B;  3CSF A;  4N6E B;  2INC C;  1KF6 B;  1KRH A;  2KZR A;  3BVM A;  4LNF A;  2DYO A;  2XN9 C;  2UWQ A;  2DNF A;  3PRE A;  4KGS A;  4EE2 A;  3KH0 A;  1UBI A;  2IGG A;  2WXN A;  4ZRJ A;  1WXM A;  3Q8F A;  3PLU A;  2I2Y A;  2KJH B;  2RPQ A;  2K8B A;  2C7M B;  3L17 A;  2MLB A;  4A9A A;  4JLC A;  4FHK A;  4XGA B;  4WJN A;  3DHG C;  1GAQ B;  4KDL B;  3Q3N C;  3FKY A;  4BOS C;  2PEA A;  1FFV A;  2HDE A;  1EWC A;  2WXJ A;  1LXD A;  2DYM A;  4RGN A;  1WRD B;  3U2S C;  3AEB B;  4OVU A;  3R2I A;  4HJK A;  4WWM A;  5IOI A;  5FR3 A;  2ICI A;  2I1K A;  1V80 A;  1QT9 A;  2BBC A;  2RGF A;  3A1Q B;  1DYQ A;  4A6Q A;  3OWE B;  2E6X A;  2W9N A;  2XK5 A;  4WAA A;  4KSL C;  1TKY A;  1VLB A;  2WXG A;  3A9J A;  2BB5 A;  1SE4 A;  1C1Y B;  4LNI A;  1J0G A;  1YQ4 B;  4YTP B;  1QF6 A;  5LLI A;  1UUP A;  1VZ6 A;  5BYR A;  2C7H A;  1FEH A;  1FCC C;  4B0E A;  4US8 A;  5AUI A;  2GBJ A;  2L32 A;  3ML9 A;  1E0Z A;  2GMI C;  4N58 A;  3IAS 1;  1HTO A;  1YOV B;  4XDC A;  2AWT A;  4ANV A;  4GDK A;  2WDV B;  3DVG X;  2KAC A;  3Q3F A;  2M0A A;  3TEX A;  4PT5 A;  1NI2 A;  2FNJ B;  3UIO B;  5TR5 A;  4IW0 A;  2AX5 A;  2EMT A;  3B2F A;  4PYU A;  3CMM B;  3BK2 A;  2GBR A;  3PRM B;  2KYW A;  4MEM A;  1L6U A;  4HPL B;  1FRR A;  4BZA A;  1L6V A;  2ON8 A;  3W1Y A;  3EC8 A;  4M0W A;  5KHQ A;  2JXX A;  1E9M A;  2LGS A;  4GDK B;  1MI0 A;  1GB1 A;  4YSZ B;  1UBQ A;  2ZW1 A;  4YSY B;  5C23 A;  1MG8 A;  4M01 A;  5D7G A;  2KN4 A;  3X0W A;  3LDZ E;  4AS1 A;  2K1F A;  2PIA A;  4K7W A;  1JRU A;  2ZCB A;  2L1A A;  2OOB B;  2B3A A;  2Y5P A;  4IG7 B;  3JVZ X;  4RFB A;  2KLG A;  1SBB B;  1R4N I;  2JYE A;  2D07 B;  2KVZ A;  3H7S A;  2BWF A;  2X8X X;  1N5X A;  1UH6 A;  1N5W A;  2Y5B B;  1WGH A;  1J7A A;  2FUG 1;  2K22 A;  5HG2 A;  4DHZ E;  2N0S B;  3H1U A;  4XC2 A;  2O6V B;  3L4P A;  3MHS D;  1TS3 A;  4KGT A;  1TYG B;  1YX6 B;  3EFU A;  2N9E B;  2N4F A;  3TEY A;  4ICU A;  3AE7 B;  1K51 A;  2D3G A;  3ZTD A;  3TJP A;  2KWU B;  3WA0 A;  3AEA B;  3SD5 A;  2PMV A;  2C60 A;  1WSP A;  2KDB A;  4D2K A;  3KYD D;  1UGM A;  2M8S A;  1E8Y A;  2LGY A;  5G55 A;  5C2T B;  1WGG A;  2AQ1 B;  2LXA A;  3IXS A;  2INP E;  4KKI A;  2QEJ C;  3MJW A;  4MEL A;  2NTS A;  2V3P A;  3AH7 A;  2HD5 B;  3QX1 A;  3PO0 A;  4HRO A;  5D3I B;  1X1M A;  3RFZ B;  2N9P C;  2BYV E;  2IYD B;  2KK8 A;  2PVG C;  4OVV A;  4JL9 A;  2W3S A;  2JWZ A;  1WWT A;  2QHO A;  4BKS A;  5J17 A;  3W2D A;  2M17 A;  4C4V A;  2C5L C;  1BUI C;  2GOW A;  1C76 A;  4FBJ B;  1PFD A;  4YTN B;  4E74 A;  2BPS A;  1VDV A;  4K7U A;  3UGB B;  4DXF A;  4DDG D;  4URK A;  4LK0 M;  4RMA A;  4FXC A;  4RGO S;  3NVV A;  4RCO A;  4NQK E;  2GBM A;  3C19 A;  5T8I A;  5IAA C;  1WX7 A;  2WU5 B;  4MGZ E;  1F2R I;  2BF8 B;  2K39 A;  1LGR A;  2ZNV B;  1D6E C;  4I6L B;  2G4D B;  5CHV C;  2YEP F;  1ET6 A;  1RYJ A;  3I3T B;  5LNK 1;  2K3U A;  4C00 A;  3N9Y C;  2CJN A;  3W1S A;  2KWV B; 
#chains in the Genus database with same CATH homology
 1KLU D;  4REZ A;  4IOI E;  4L1B A;  1NEN B;  1XCQ L;  2KDM A;  1IGD A;  2BW2 A;  2YEP B;  1B9R A;  4HKZ E;  2RDG A;  1FNW A;  1KFY B;  3KQ4 A;  3LB8 C;  2H88 B;  1NYQ A;  1HEZ E;  4B0M A;  1E10 A;  3BWU D;  1XEE A;  2SEB D;  5G5G A;  2HTM E;  1ZXI A;  2JYT A;  5BMH A;  1UWX A;  2KWD A;  2V3N A;  1ROE A;  3Q8E A;  3T3N A;  1YN4 A;  1MHH E;  1JAL A;  2L83 A;  1MHX A;  2MEK A;  3ZQ4 A;  3B9J A;  2KAJ A;  1L5P A;  2CU3 A;  3EUB 2;  4RH6 A;  1QLB B;  1T5X D;  1OQQ A;  3MC0 B;  5EE3 A;  1OFF A;  1N62 A;  2LHD A;  2IPK D;  4C7Y A;  3GP7 A;  1XLN A;  2DBY A;  1C4P A;  5E6J A;  4XDD A;  1TS5 A;  4USA A;  3P4P B;  3AEC B;  2BB6 A;  2LUM A;  3AE1 B;  1KTK A;  2QMT A;  1C4C A;  1IGC A;  2WP9 B;  5H8Y E;  2WS3 B;  1FNU A;  1RWS A;  1ZOY B;  2CJO A;  4WAF A;  3LXF A;  3NZ3 A;  1V97 A;  3SR6 A;  2K5P A;  1EU4 A;  3NUH B;  1C4A A;  1WRI A;  2H89 B;  3AE4 B;  3Q8C A;  3E9S A;  3Q8B A;  4KX6 B;  5TSS A;  3Q8A A;  3R2T A;  2MJE A;  4C7Z A;  3ETR A;  5BMG A;  1XLP A;  1PUT A;  3TEZ A;  1JW9 D;  2WU2 B;  3TSS A;  5G5H A;  2WXI A;  2LEK A;  3IAM 1;  3V3X A;  3HUI A;  5HI1 A;  5GXG B;  3ZYY X;  4TQ0 A;  2QJL A;  4AQ7 A;  1FM0 D;  1VR9 A;  2N9L A;  3B2G A;  1YNT E;  2WXH A;  1I4G A;  1C9F A;  5C3J B;  2KQ4 X;  3MFG A;  2EEL A;  4JE3 B;  1PGB A;  3P4Q B;  2WXP A;  2FE8 A;  1QKZ A;  4JWU C;  5I4D A;  3E56 A;  2W54 A;  1V1P A;  3IT6 B;  3ZJT A;  1ACC A;  1XO3 A;  1UWM A;  3MJ5 A;  3ZGZ A;  1CQV A;  2QIE B;  1JWM D;  2RDH A;  1STE A;  1EM7 A;  1T6B X;  1ZUD 2;  1MVK A;  1YN5 A;  5BMI A;  1D5Z C;  3U4E G;  1I4H A;  4OW0 A;  4OVZ A;  4RGT A;  1J7B A;  1FNV A;  1I4R A;  1SE3 A;  4TSS A;  1MPE A;  5EE1 A;  5JXV A;  3KWL A;  1FXA A;  3BZD B;  3Q69 A;  1QOA A;  1VRA B;  3T3O A;  2W82 A;  4RNA A;  3J9C A;  2SAK A;  3BVZ A;  1FFU A;  3O13 A;  5FKA C;  3VR9 B;  3ZJU A;  2XNA C;  3P63 A;  4NAM A;  2M19 A;  2WXL A;  1RFK A;  2KMM A;  1JWU D;  1YN3 A;  1OQR A;  3EGR A;  2VZK D;  1SE2 A;  1SJE D;  4N6E B;  2B76 B;  1KF6 B;  1KRH A;  1BML C;  1M4V A;  4NAW B;  3TEW A;  1N63 A;  4CQN A;  3BVM A;  4C56 C;  2DYO A;  2XN9 C;  4YT0 B;  4KGS A;  4HKQ A;  1QQR A;  4EE2 A;  2Y5C A;  2IGG A;  2WXN A;  2QSD A;  2MH7 A;  1L0Y B;  2BS2 B;  4YWG G;  3Q8F A;  1C77 A;  3AMZ A;  2I2Y A;  4XE0 A;  3IT4 B;  3AE2 B;  1GOZ A;  2VZK B;  4A9A A;  2D5G A;  1VJK A;  2J53 A;  4KKJ A;  1TZO A;  4LLG M;  4ZHO A;  1QIL A;  1AYF A;  2BYT A;  1ZE3 D;  1GAQ B;  1FFV A;  1P7E A;  2HDE A;  3KWV A;  1EWC A;  2WXJ A;  1XF5 L;  3H8H A;  2DYM A;  4RGN A;  1TS4 A;  1HA5 A;  1TJE A;  1EWY C;  1K53 A;  2OED A;  1FMA D;  2J4X A;  1QOF A;  3U2S C;  2X38 A;  4ARI A;  4O1N A;  1V8C A;  1ZP0 B;  1V1P B;  3NS1 A;  3AEB B;  4DQO C;  1JML A;  1WYG A;  3U52 E;  2LGI A;  4UDU C;  1D4B A;  3R2I A;  2R61 A;  2IJ0 A;  4WWM A;  1PDX A;  1ZPS A;  2N9K A;  1JWA D;  5FR3 A;  4Q2J A;  3AB5 A;  2ICI A;  3DWM A;  4GDL B;  4P16 A;  1JRO A;  1QT9 A;  2BBC A;  5HFY A;  2GRI A;  1DYQ A;  4A6Q A;  2JXT A;  1FO4 A;  3OWE B;  1N61 A;  2E6X A;  3P1M A;  1TKY A;  3UI3 A;  3AM9 A;  1FXI A;  1VLB A;  2WXG A;  2BT6 A;  2BB5 A;  1NYR A;  1SE4 A;  1UGJ A;  2GB1 A;  1R7S A;  1JWS D;  4DXG A;  1E6E B;  1DOI A;  2L52 A;  2FBW B;  1YQ4 B;  4YTP B;  2Q5W D;  1QF6 A;  1UUP A;  3SFD B;  1VZ6 A;  2WXQ A;  1BXT A;  5BYR A;  2N7J A;  4MAC A;  1FEH A;  4OZA A;  1FCC C;  4B0E A;  4US8 A;  1DGJ A;  3LYY A;  5AUI A;  2L32 A;  2LMC A;  3BK1 A;  1E0Z A;  1SIJ A;  2JWU A;  1C79 A;  1JRP A;  2I38 A;  3P4R B;  4GLS C;  4N58 A;  4TQ1 A;  1VZ8 A;  3IAS 1;  2M56 B;  3VQI A;  1ZDX A;  3SEB A;  3AN1 A;  3AEF B;  4XDC A;  4A8X C;  2G9H D;  4ARC A;  4TMA B;  2NMQ A;  1DOX A;  2QIL A;  1YMH E;  4LTU A;  2WDV B;  1AW7 A;  3VRB B;  1J7C A;  2KAC A;  4L23 A;  2M0A A;  1I4Q A;  3TEX A;  1JQ4 A;  4PT5 A;  1K50 A;  2WXR A;  1D5X C;  1Q10 A;  1FD6 A;  4ITK A;  2AX5 A;  4A55 A;  3B2F A;  2K9X A;  3V05 A;  1WXQ A;  2MJ3 A;  3BK2 A;  4JX1 C;  3C8Y A;  3GB1 A;  3PZ8 A;  2OHF A;  3HRD D;  1HZ6 A;  2NTT A;  1L6U A;  2JX5 A;  1FRR A;  2Z8L A;  4WH4 A;  4N59 A;  1L6V A;  2ON8 A;  3NRZ A;  4NZL B;  1N60 A;  4M0W A;  4OZC A;  2BS4 B;  1YQ3 B;  5HHD G;  1PGA A;  1IUE A;  3BYT B;  4HRS A;  1E9M A;  4WIP A;  4GDK B;  1MI0 A;  1GB1 A;  4JPS A;  1EU3 A;  1SJH D;  4US9 A;  2INN E;  3DWG C;  4YSZ B;  2WDQ B;  1YJJ A;  1GB4 A;  3PZ7 A;  3BVG A;  1L4D B;  2WDR B;  2ZW1 A;  2W55 A;  1CZP A;  1PGX A;  1V1O A;  2TSS A;  4YSY B;  1AWD A;  3AE8 B;  2IDY A;  3AV8 A;  1HQR D;  3ABV B;  5D7G A;  1HZ5 A;  2KN4 A;  3VRA B;  5MPO A;  1SEB D;  2ONQ A;  4AS1 A;  1DOY A;  4IDI A;  1HXY D;  2PIA A;  2PLP A;  2JQR B;  3AE3 B;  3MP9 A;  4ZYS A;  2V4I B;  2L1A A;  2RMM A;  2Y5P A;  3SFE B;  4J3O D;  4RFB A;  4ZRQ A;  3W5U B;  1SBB B;  1AN8 A;  1NI3 A;  2JYE A;  1KH0 A;  5EE9 A;  1XLO A;  3VR8 B;  1FCL A;  3U7Z A;  2IGH A;  2WLB A;  3NVZ A;  2GI9 A;  1N5X A;  1N5W A;  1T3Q A;  2G1E A;  2PKO A;  4HJG E;  1XLQ A;  4ZRP A;  1J7A A;  1QOB A;  2FUG 1;  2K22 A;  2WXM A;  1TS2 A;  1RM6 C;  5HG2 A;  2J42 A;  3KLS X;  1B1Z A;  1FIQ A;  2N0S B;  2PTL A;  3AED B;  4NJC A;  3MHZ A;  1SXT A;  3AE5 B;  3L4P A;  1ZDV A;  5D3D A;  5EE0 A;  1I7H A;  1TKG A;  1TS3 A;  2LJI A;  4KGT A;  1TYG B;  2ZW0 A;  5BYQ A;  1F2R C;  3TEY A;  1UNS A;  3FIL A;  3AE7 B;  1K51 A;  1F77 A;  2BS3 B;  1ENF A;  4HEA 1;  2DWQ A;  3BYY B;  3AEA B;  1E7P B;  1NVI D;  1PYW D;  1TY2 A;  2PMV A;  4YTM B;  1NEK B;  4OHJ A;  2WQY B;  1WSP A;  3I9V 1;  4P6V F;  1VZ7 A;  1IBX A;  2LHE A;  2E3T A;  1XCT L;  1A70 A;  4H2A A;  1C78 A;  4D2K A;  1F0Z A;  1WGK A;  2Y3A A;  3CWI A;  3R8B A;  1SSN A;  1FRD A;  3HVZ A;  4OZB A;  3ZJV A;  2WXK A;  5AUK A;  5H92 C;  2W3R A;  5C2T B;  2AQ1 B;  5FK9 C;  2LFI A;  4RF0 A;  2J52 A;  1ZXH A;  2BTE A;  1SF0 A;  4RF1 A;  3IXS A;  1GPX A;  3NVW A;  1P7F A;  2INP E;  4KKI A;  2QEJ C;  4XWT A;  1Y56 A;  3W9C B;  4YSX B;  2WNM A;  1CK1 A;  2NTS A;  1SB3 C;  1D5M C;  2V3P A;  4RGM A;  1IBX B;  3P4S B;  3AH7 A;  1KLG D;  4WQM A;  1YJI A;  3PO0 A;  4HRO A;  4IKG A;  4WUR A;  3AE9 B;  4MM3 B;  5D3I B;  3AEG B;  3I57 A;  1I4P A;  3NVY A;  3RFZ B;  3AE6 B;  1CJE A;  1XXG A;  4ZOH C;  1JCK B;  2PVG C;  4MH8 A;  4A90 A;  2W3S A;  3FC4 A;  1K52 A;  1WWT A;  3GS2 A;  1L0V B;  1TY0 A;  2JU6 X;  4L2Y A;  2PVO D;  4YXD B;  4MT5 A;  3W2D A;  1LO5 D;  4R3D A;  1BUI C;  2MJD A;  1C76 A;  2AQ3 B;  1I4X A;  1PFD A;  4YTN B;  4KGR A;  1ET9 A;  1VDV A;  1JWB D;  4DXF A;  3P42 A;  4XWW A;  4LK0 M;  4FXC A;  4RGO S;  2K0P A;  2RPV A;  2AQ2 B;  2EKI A;  2WXO A;  3NVV A;  4RCO A;  3WCQ A;  1TKE A;  1ESF A;  5T8I A;  2WXF A;  4C80 A;  2WU5 B;  3TUO A;  1F2R I;  2IGD A;  2JSV X;  3EA6 A;  2JZP A;  1D6E C;  3RPF C;  2YEP F;  3FIL B;  4ZHP A;  1ET6 A;  1RYJ A;  3HVD A;  2DLB A;  3W5V B;  2PW9 A;  1L4Z B;  5LNK 1;  5BYS A;  2K3U A;  2ACZ B;  3CIR B;  3URY A;  1L0X B;  3FAH A;  3N9Y C;  4JWS C;  2CJN A;  3BII D;  3AEE B;  1QOG A;  2V0G A;  3W1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...