1SSNA

Staphylokinase, sakstar variant, nmr, 20 structures
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
136
structure length
136
Chain Sequence
SSSFDKGKYKKGDDASYFEPTGPYLMVNVTGVDSKGNELLSPHYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOKINASE
publication title Nuclear magnetic resonance solution structure of the plasminogen-activator protein staphylokinase.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 16
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 1998-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02821 Staphylokinase Staphylokinase/Streptokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.130 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ssnA00
1SSNA 1BUIC 1C76A 1C79A 1C77A 1C78A 2SAKA
chains in the Genus database with same CATH superfamily
4GXBA 2XN9C 3NZ3A 4XDCA 2KNBA 3EGRA 3B1LX 4HWIB 2H88B 3OLMD 3TUOA 1WFYA 1I4HA 2ZEQA 3AI5A 3Q8AA 4B0MA 4FLHA 4GMVA 5J17A 4HDOA 1WWTA 4ZHOA 5LXHA 2MWSB 4ZOHC 3KYDD 1WX9A 2NCNA 2WXQA 1TTNA 1PFDA 2FCSA 2N9LA 3VUWA 1VZ7A 2KFKB 3IT6B 1WYWB 1YJIA 1Y56A 4TMAB 1HE8A 4L2YA 4XDDA 2PMVA 2KMMA 1BXTA 2WYQA 4W9KA 3ZNID 2CR5A 2BS4B 1GC7A 1EF1A 5FK9C 1JW9D 4AS1A 1FNVA 1YD8U 3GS2A 3FC4A 3WANA 1WX8A 1XD3B 2D11A 2RDHA 3UQBA 4ZRPA 2KZRA 1ZXIA 2D07B 2CKHB 1IP9A 2Q5WD 1UZXB 4JWSC 3AE4B 2V4LA 4G50A 3QC8B 3N3KB 4I6NB 3N1YC 2A5UA 2ASQA 4GSWA 2KYWA 1N5WA 2KJRA 4MGZE 1G6JA 3Q8FA 5HG2A 1ISNA 1KLUD 1K53A 2GBKA 5AUKA 3DBSA 4KGSA 4HK2A 4FJYA 3DHIC 2I38A 2NVUI 5D2MB 2MA9B 4C7ZA 4DHZB 3KVFB 1C4PA 1JWMD 5EE1A 1RM6C 2JYTA 3JSVB 4WIPA 2WDRB 2RR9A 4ZHPA 2KDIA 3NZUA 3TEYA 1YN3A 2KK8A 2KN5A 1Q1OA 3PHWB 2MP2A 1LM8B 1WGHA 3MJ5A 2N0SB 1YQ3B 1UNSA 3RT3B 3VHTC 3DVGX 4F7ZA 3MP9A 1DOYA 4E3CA 4J6IA 4YT0B 2PPHA 3BYYB 1LO5D 1QT9A 5D3IB 4DHJD 1E8YA 4K81A 1U4AA 3U7DA 2Y5BB 3RD2A 3R3MA 1D5XC 5EDSA 2M19A 1NI3A 2KC1A 3ZJVA 2MBOA 2O6VA 2L0TA 1H8CA 2EMTA 4EZKA 3DBLI 1D5ZC 2A4ZA 2O2VB 1C4AA 3T8MA 4MH0E 1J19A 2BPSA 1TYGB 4W9HA 3RNCC 2FUHB 4HRSA 4LLGM 2D5GA 1CZPA 4XZ4A 5L95C 4LJOB 3ZVVA 5E6PA 3APFA 1ZDVA 5CHWA 3SU8X 2LHDA 1YJ1A 1TS3A 1YIWA 2V1YA 3L08A 2WXLA 2KOXA 4W9IA 3JW0X 2FBWB 3P2BA 2UWQA 1D4BA 4W9DA 5EE3A 5HFYA 1EU4A 4F1SA 1NBFC 1D6EC 4BAXA 3ML9A 3T9LA 1L6VA 3N1XC 4BFRA 3ZUNA 2IY0B 2J0MA 4KVGB 3HUIA 3M63B 3P4QB 3NZSA 3N30A 2KJ6A 3H7SA 1E8WA 3AEDB 1GNUA 2IGGA 4YTNB 3VAWA 2XEWA 4WJQA 4LCDE 3GZNI 1XT9B 2JWZA 2ZW0A 2IO1B 4YWGG 1TZ1A 3H6NA 1L0XB 2J0JA 1N63A 4ICVA 5HI1A 1E0ZA 2WNMA 1N62A 3P63A 3D32A 2BKRB 2BB6A 1C4CA 2JZPA 2RPVA 1KRHA 1OQYA 3Q3MC 3PLVA 5J18A 3QAQA 4IUMB 1C79A 3O13A 4YTMB 2QCZA 1V97A 4P16A 2WU2B 1LQBA 2W3SA 1KTKA 2GBMA 4HJGE 1OTRB 3L10B 4G0NB 3BYTB 5LNK1 2G9HD 3KW5B 3SFEB 5LXIB 1QOAA 1SJED 4B9KA 3DVGY 1VZ6A 3KUCB 3L17A 3ZLZA 5HKHA 4ASWC 4YL8A 3WALA 2CU3A 1TGZB 5JHBA 3W1SC 2KDMA 3Q8CA 4TSSA 4JLCA 3SEBA 3DQVA 2MSED 1FPYA 1VLBA 2WQYB 2QC8A 2INCC 4HJKA 1BT0A 1PDXA 4TQ0A 4GOCA 3TEWA 1P1AA 5CHFA 2N4FA 4M02A 2KWCA 2JVCA 1F77A 1T0RC 2MLBA 2KANA 1PGAA 3ZQ4A 3Q69A 1DYQA 4KKIA 3AEGB 4EEWA 2DZMA 1SXTA 2D3AA 3AE3B 1FFVA 1WIAA 1E8XA 2K8HA 2PIAA 1WY8A 1WJ6A 3PGEA 2YVCA 4XYCA 4M0WA 2GBNA 4MJSA 2WS3B 3RMKC 2WXKA 2RGFA 1WXSA 2PE6B 4NQKE 2IGDA 3SHQA 1XCQL 2QHOA 1JWSD 1WXAA 3AE7B 2MJEA 5H92C 2KWDA 3AE6B 2YEPB 3VR9B 1UH6A 3WAOA 2FNJB 2L83A 1DOIA 3HRDD 1F1HA 3UGBB 5FKAC 2MJ3A 4K7SA 3ZIMA 2HD5B 2DAJA 4KZ0A 1LGRA 5TR5A 3R7QA 1HTQA 3VTUA 3RNBC 4KSLC 2KHWB 2ZJDA 1TKGA 4OVUA 3FKYA 1P7EA 1SIFA 1TBEA 1K8RB 2CJNA 3ML8A 4R3DA 4WURA 3W5UB 2HTME 1QF6A 1MG8A 3ZJUA 3IHPC 4LK0M 2BF8B 2L00B 3AM9A 2MP2B 1WZ3A 3N20C 4FJVB 4K3CA 4QAYA 1EUVB 4JWUC 3CF6E 2MBBB 4WWPA 2L76A 1T6BX 1CMXB 2QILA 3ECIA 1IGCA 2WDVB 4XGAB 4PT5A 4PS7A 2BW2A 1C9FA 2K22A 4HEA1 1AN8A 1TJEA 4DXAB 3AMZA 4JGHB 3GOEA 1SJHD 2DLBA 1JRUA 2DBYA 2O6VB 4RFBA 2ACZB 5G5GA 4KX6B 4GDKB 5DPRA 3MFGA 3Q14C 3SFDB 3GE3C 1IGDA 3PVLA 4YTPB 4C80A 5JH5C 3AECB 1I42A 1HZ6A 3Q2AC 2MBHA 3CMMB 3BY4B 3VTVA 2CHWA 2EELA 3B2FA 2I2YA 1IBXA 5DCNA 1QLBB 4ZRJA 1JWUD 1Q10A 1EWCA 2QEJC 2IJ0A 2Z59B 2D10A 1YX5B 2GLSA 2IO2B 2JXXA 4M8NA 5CHVC 3LB8C 2BT6A 1N60A 3LYYA 1F2RI 1I4QA 2M8SA 1C77A 1TT5B 3HVZA 4J3OD 1VZ8A 4A3OA 4KDLB 5E6NA 4ANUA 3AH7A 2R2OA 3KQ4A 2M17A 2OEDA 1S3SG 3W9CB 2ZPYA 5G5HA 5BMIA 2OOBB 1RWSA 2JT4B 4NY0A 3UI3A 2C7HA 5KHQA 3ZKJC 3HK0A 2ZCCA 5L83A 3IAM1 4G3XB 3MC8A 3PZ8A 1OQQA 2IGHA 2WXIA 3TEZA 4NPNA 4IM3A 1V8CA 4OVZA 4MGIE 1JWAD 2E3TA 1TKEA 2KAJA 1RAXA 2DZJA 1KH0A 1WE6A 2MCNB 1J7BA 2SEBD 4JE3B 4II3B 1WGYA 1YN4A 3BIID 4TQ1A 4A8XC 1B9RA 1FNUA 3KUZA 2RDGA 3AULA 2FCMA 4A3PA 4WAAA 4RH6A 1HA5A 1NENB 3E9SA 2INPE 2FIDA 4DQOC 1WM3A 4P1BC 4N59A 3A9KA 1T0YA 3ZNZB 1J7AA 1A70A 4N6EB 2PW9A 4M00A 3V60A 5AEKB 2REXA 1WXVA 1WGGA 4IWPA 3RUIB 1L6UA 2M1MA 3M62B 4ZYSA 2B3AA 2DZIA 4W9LA 2LXAA 3UIPB 3P4SB 4AQ7A 1YX6B 4W9CA 3RNGC 2EKIA 4WJPA 4MACA 2KVZA 3DWMA 4RGMA 2QJLA 3MJWA 1OEYA 3SR6A 3QWZB 4FXCA 2G4DB 1V1PA 4S0RA 2JF5A 5AZGA 3DBHI 2VZKB 1C78A 4A6QA 3IVFA 3BINA 2PEAA 4EUTA 1ZOYB 3HVDA 3EECA 3UF8A 3NOBA 4AOFA 1FIQA 5EE9A 2IDYA 4WAFA 3MTNB 1XLOA 3BK2A 3Q3NC 4EE2A 4GU2A 4YSYB 3TJPA 3KH0A 2KDEB 5D94A 3VR8B 1GUAB 3A9JA 2FUG1 1VJKA 2LZ6A 3X0WA 3AEEB 4EOYA 1FNWA 1M94A 1N5XA 1SE4A 3OG5A 2BB5A 3QJZA 4AWJA 1A5RA 4JQWC 3MHZA 3EA6A 4WQMA 2ON8A 1R4MI 1ZXHA 3U2SC 3SDLC 2WXOA 3DDCB 2WWZA 1XLQA 4M0WB 1N6ZA 2GB1A 2FCNA 1OFFA 4MJSB 1J0GA 2Y3AA 5HHDG 3KWVA 3V6CB 1ZUD2 3W1YA 1DGJA 2LRWA 2NMQA 4NNJB 4CYEA 1Y8RC 3A4RA 2R2QA 4Q2JA 1V5TA 1L0VB 3QCAA 5G55A 4GDKA 4OVVA 3NY5A 4E71A 3AE1B 1TS5A 3IFWB 1UD7A 2KWVB 3VH4B 3CWIA 3ZXVA 4RM9A 2DZKA 1GC6A 2JXTA 2DX5B 4MT5A 1YOVB 2E6XA 4FJZA 3EC8A 1XLPA 4HCPB 4WWNA 3WCQA 3IBEA 2FAZA 3PHXB 3PLUA 1M4VA 1MVKA 2HDEA 2AL6A 5IA7A 1QOBA 1WR6E 2N1VA 4XWWA 1NVID 1MFWA 4ZDVA 4MM3B 3N9YC 5E6OA 1RYJA 1B1ZA 2DYBA 5IOIA 3NVYA 3B08A 5JHAA 2D2QA 4TV3A 2IPKD 2NS5A 3RZWC 4RNAA 2KTRB 2J4XA 4BKTA 4NJ6A 2LGXA 2KFJA 3WIMA 1ZDXA 5C2TB 2DHZA 2G3QB 3OJ3A 2JYEA 4FHJA 2I1KA 4DK5A 3IT4B 1Q0WB 3U52E 4WH4A 5IKCM 1JRPA 2J52A 5IO9A 3APDA 1JMLA 3DOWA 1PUTA 2KWUB 2JZZA 3I57A 3PPAA 4OZBA 3QARA 3VVWB 5TSSA 2NBVB 3P4PB 5BYSA 5GXGB 4LNNA 3BWUD 1E7PB 1SF0A 2WXMA 2V3SA 4DWFA 1UELA 1GJZA 3ZO5B 2WXNA 1IBXB 3RPFC 1WJUA 4HPLB 3DHGC 2RSUA 1T5XD 3PZ7A 2LXCA 1ACCA 2WX0A 3TCAA 1ENFA 3AXCA 5IN7A 2WHIA 3QIJA 3DWGC 3LDZE 1AW7A 2IO3B 4PK1A 1I35A 1WX7A 4DDGD 2KKCA 1GG3A 1E7VA 2L32A 1WM2A 1NYRA 1ET9A 2INDC 2L3ZA 2LRUA 2V3PA 1F2RC 1V5OA 5IAAC 3H7PA 1C76A 4LJPB 2JX5A 3ZRFA 4ANWA 1R4NI 1E8ZA 2KQ7A 4W9FA 3NUHB 1STEA 4AJYB 3DBLB 2W82A 4RGTA 3ZNGC 4BOZB 2GBRA 1MI0A 1E90A 2ZNVB 3NS8A 1ROEA 4W9JA 5D6JB 3ZW3A 2IBIB 3DBRI 2GRIA 2LEKA 2CHXA 4ICUA 2CHZA 4USAA 1MHHE 2KX0A 2PKOA 5C23A 2K3UA 3Q3OC 2K0PA 1FRRA 2Y5CA 3I5JC 1P0RA 4S17A 1FD6A 3AU4A 3R2TA 3KUDB 1ZKHA 2WXGA 3TBLD 4IM0A 1SE3A 1I4GA 2DAFA 4JPSA 3OJ4B 2ZVNA 2BS2B 2M0XA 1V9JA 2JZ3B 3A9KB 4IC7B 4MGYE 3U30A 2KQ4X 3RNFC 4IDIA 1RRBA 2CS4A 2BYEA 3B0AA 1V49A 4ACFA 2K39A 4KSKC 2LVPA 2WU5B 2N7DA 2B76B 4DHZE 3K9PB 1D5MC 3ZJTA 1V86A 4PYZA 1WI0A 1WMHA 2O6VD 2ONQA 3GE8C 1JROA 3ENEA 2MBQA 3B9JA 1SE9A 3HM3A 1QKZA 2QDFA 2RD0A 4OHJA 2HJ1A 1WXQA 1IPGA 2NBUA 3M3JA 5DPWA 4AJWA 2V9HA 1WRDB 1I4PA 3GZNB 4RM8A 2K6QA 3RNAC 1BUIC 1QOFA 3Q8BA 1V1PB 2LUMA 1WGRA 1CK1A 3WAPA 2DNFA 2BKFA 1FMAD 4KV2A 2BYTA 5CTRC 5AUIA 3PT2B 4C4VA 2Z0DB 1XEEA 4RF0A 3LXFA 4XX5A 4AP4C 4W9GA 2M4NA 2OHFA 2OJWA 2N7EA 4LNFA 2RDBC 2Z0EB 3A9JB 2KXJA 3UQAA 2ZPNA 5H8YE 2W3RA 2D3CA 2AQ3B 5G2NA 4MM3A 4BBNC 5BO4B 4N58A 3ZTCA 4A20A 3AU5A 1FXAA 4NZLB 1WR1A 2KX3A 1JCKB 1L0YB 2KTRA 3QHTA 4HPMB 1FEHA 4RGNA 2PE9A 1E6EB 3GP7A 2G45B 1NEKB 4K7UA 2AX5A 2C9WB 2XK5B 1ZW7A 1L2NA 4PS3A 1L5PA 1NI2A 4CHKA 4MSQB 1E9MA 4I6LB 2KT7A 1YJJA 1K50A 2AQ1B 1TY0A 2JWUA 1MHXA 1ET6A 1FXIA 3CSTA 2LMCA 5AZFA 5AZHA 3VFKA 4MSMB 3FILA 2BYVE 2G1EA 1JWBD 1YN5A 4EZLA 4FADA 1F52A 4NAMA 3HM6X 2WXRA 1EWYC 2KJHB 4K1RB 2LVQA 5EE0A 2ZNVC 2PLPA 1PGBA 2NTSA 2DENB 3NS1A 3SD5A 2W9NA 1MG4A 1T0QC 3ABVB 4M01A 2LHEA 1V1OA 2KMCA 1WXMA 4LTUA 4WJNA 1QOGA 2NPTB 4HPPA 3I3TB 3JVZX 3Q8EA 1FFUA 4KKJA 3V6EB 2R61A 1WF9A 4BKGA 2ZZPB 4P6VF 3ZDMC 3RI7C 3AE5B 1EF5A 4REZA 4NAWB 3R66C 2QIEB 3VDZA 1FXTB 2LD9A 3HIZA 3EUB2 4OZCA 4MELA 2VZKD 1L4ZB 1BMLC 5J2RA 1WH3A 2VH1A 3QK0A 3TMPB 2G4SA 1GB4A 1X1MA 3PO0A 1OGWA 3AE2B 4II2B 3AEBB 2HE7A 4KGRA 1KJTA 2MH7A 2L7RA 4GGQA 3W5VB 2X8XX 4IG7B 4WQOB 2DWQA 1OEYJ 2PVOD 3WA0A 4ANXA 4AUQC 5FR3A 1VRAB 3QX1A 2KVRA 2MBEA 1WZ0A 2RMMA 1RFKA 2N7JA 3ZRCA 4P1CC 2BBCA 4LDTB 2KO3A 2JRHA 2N9XA 4NJCA 2HJ8A 3Q3JA 5JZEB 2N1WA 2N9PC 1J8CA 4YSXB 1HXYD 4W9EA 1UBQA 5BMHA 2NTTA 2YEPF 1AYFA 1UGMA 3A1QA 3ETRA 5BMGA 4NJ7A 3V62A 4JX1C 4BOSC 3MHSD 3VXWA 3V05A 4K7WA 3DVNV 3JYUA 4KIKA 2M0AA 3H7PB 4GIVA 3U4EG 2JSVX 2C60A 2KACA 2LGIA 2RPQA 4G11A 3S2AA 1YQ4B 3TL5A 1IUEA 4GN1A 1ZGUB 4XWTA 1QZEA 4HVBA 3NHEB 1C3TA 2K9XA 2HTHA 3CIRB 1T0SC 2IYDB 1ZP0B 2LGYA 2KLCA 3RN9C 1FRDA 2H89B 2VH2A 3L13A 5D3DA 1GAQB 1K51A 2N9EB 2GMIC 3PRPB 1TZOA 3RNEC 1GOZA 1QQRA 2J42A 5LLIA 3BK1A 1TIFA 4C7YA 1SBBB 2L1AA 4HDQA 2MEKA 4TUUA 2KDFB 3P42A 2QMTA 2TSSA 4IWQA 3V61A 4IWOA 1RLFA 2WDQB 5BYRA 4L1BA 4B0EA 2WP9B 2JPHA 4YXDB 2K25A 5CX3A 4L23A 3EFCA 4RCOA 2GOWA 2XBBC 2AQ2B 4N9F4 1ESFA 2IO0B 3EFUA 1WMHB 3C19A 3QQ8B 1SGHA 1KOTA 2MX2A 4ZRKA 2FIFA 2K5PA 1DOXA 1JALA 2L52A 2XK5A 4DXGA 5DPTA 3T3OA 2V4IB 3PREA 4GLSC 3R8BA 1UBIA 2IY1B 4ZRIA 1SE2A 4BKSA 4FN2A 3AB5A 2Z8LA 3BVGA 1FM0D 3P4RB 4X57B 1V2YA 3VTWA 3AE9B 2BVCA 4ZYNA 4UDUC 3RZFA 2SAKA 4NQLB 1Z5SB 4C4VB 1TKYA 2LUEA 1UWMA 3TSSA 3Q3FA 2DYOA 4HCNB 4ITKA 1K52A 2KLGA 1V80A 3LJ3A 1L4DB 2L05A 3N32A 3IXSA 3R7RA 4HKZE 3C0RB 2N9KA 3PRMB 3CSFA 4E74A 2K8CA 4JIOU 2LWPA 5KHOA 4XC2A 2CU1A 2JY6A 3L0WB 2J53A 2NPTA 2VRRB 3QA8A 4B6WA 4TKNA 1GPXA 2KDBA 1I4RA 3PZDA 3NRZA 3AEAB 4IM2A 4EFOA 3MC0B 4NAWA 2K1FA 1J7CA 3E56A 2K6DB 1V81A 2MRPA 3X23A 2WX1A 3DPDA 1UF0A 1NDDA 1SB3C 4KGTA 4C00A 3DBHB 1XF5L 3NVWA 3MC9A 3VRAB 1Z2MA 4URKA 2D3BA 1F0ZA 1LFDA 2C5LC 2INNE 3DVNU 2JQRB 2KQSA 3Q6BA 2KTFA 1VR9A 4DDID 3N1ZC 3FILB 2BWES 3A4SC 2WLBA 1P98A 3RULA 3H1UA 4H2AA 2WXPA 3H9DA 4DHJB 1KFYB 2LFIA 4GDLB 4XE0A 5MPOA 4US8A 1R4MB 3H8HA 1YQBA 2BQQA 4HKQA 2OJRA 4FBJB 4MGKE 2M56B 4EZJA 3ZNHB 3BZDB 4DXFA 1HTOA 3J9CA 1CJEA 3I9V1 1RFAA 3NG0A 2LVOA 4WJOA 2BYFA 1IYFA 3TIXA 3ZDTA 1WSPA 2ZCBA 3AE8B 2KFKA 3VH3B 1C1YB 4HXDA 1P3QU 4MDKE 3EHVA 4RF1A 2YLMA 3RCZA 2FCQA 2AEHA 5IP4D 2KMAA 2WGSA 3PV1A 4O1NA 2WXFA 1VDVA 3R2IA 4I6PA 3URYA 3IG3A 3ZGZA 2ICIA 1YNTE 1H4RA 1R7SA 3UINB 3VUXA 2FE8A 1EO6A 1KLGD 1VCBA 2KC2A 3FAHA 2L0FA 1SEBD 3ZYYX 2ZVOA 1JQ4A 3NVZA 1V6EA 3AEFB 1L7YA 4FULA 4ZRQA 2WXHA 3M95A 1KLVA 4KDIC 3OWEB 5I4DA 2BS3B 2ZW1A 1KM7A 2BTEA 3L54A 3BVZA 2LI5A 2BWFA 4A55A 1HZ5A 4US9A 3PTFC 2NBWB 1N61A 2MJDA 4OW0A 1EU3A 3HHMA 4WWOA 3BVMA 1UUPA 1XXGA 3IAS1 3RYTA 3NVVA 1CQVA 4EKUA 2IZVB 1GB1A 2X38A 2LASA 4M8MA 3JSVA 2LGSA 3A1QB 4LNIA 2J7QB 1WYGA 1SIJA 1E5WA 1ZPSA 3B2GA 1TS2A 3P1MA 4MEMA 5C3JB 4BKSD 3A33B 4IOIE 2L8JA 2LJIA 3C8YA 4KIKB 2DYMA 3KYCD 5E6JA 2BGFA 3W1SA 4KZCA 4CQNA 1I4XA 3W2DA 4BZAA 3DHHC 1QILA 2V0GA 2MW5A 4PS8A 1PYWD 3V3XA 1OQRA 1VD2A 4A9AA 1S1QB 1UWXA 3RFZB 1SSNA 1MPEA 5C1ZA 4HLEA 4ANVA 4A90A 3PSEB 1FCLA 2O2VA 3VQIA 5BYQA 1XLNA 2KD0A 5DPSA 3WAMA 2JUOA 2WXJA 1Q5WB 4RGOS 4F8CB 1YMHE 2QSDA 1P7FA 1NYQA 4B95A 2Y5PA 2K8BA 1HEZE 5FR6A 1R4NB 2D3GA 4HROA 2C7NB 2MHJA 2W55A 3KLSX 2UYZB 2PTLA 2NR2A 4OZAA 4PYUA 3ZTDA 4JL9A 4BBNF 3NJTA 2W54A 2WDTB 1E7UA 4ARIA 1TY2A 3ALBA 2CJOA 2XNAC 4LNKA 4GB9A 4C56C 3DBRB 4D2KA 1ZE3D 1LXDA 1AWDA 2MQJA 1MJDA 3APCA 3AV8A 1FO4A 3TEXA 4LDTD 1WJNA 4MH8A 2LGDA 3U7ZA 1PQSA 2GI9A 3OAWA 5T8IA 3UIOB 4CO7A 2EKEC 3O65B 3AN1A 2JU6X 4GDLA 4RMAA 1HQRD 3GB1A 2AWTA 4DBGA 1FCCC 1AARA 3DCGA 1XO3A 2PVGC 4IW0A 5GMVA 3PRZA 1TS4A 3U8ZA 2KN4A 4LNOA 3ONSA 1WRIA 1KF6B 2I1JA 2LJ5A 3PS6A 4P7IA 3VUYA 1PGXA 4YSZB 3VRBB 4K3BA 1E10A 2AL3A 4WWMA 2GBJA 1EM7A 2V3NA 2C7MB 2J0KA 2JRIB 4BVUC 1I7HA 1XCTL 1XQQA 1F9JA 3I63C 3ZXRA 1D3ZA 2EMSA 2UU7A 1P9DU 1WE7A 4FA6A 1WJ4A 3KWLA 4IKGA 1WGDA 3K9OB 5JXVA 4FHKA 3L16A 1UGJA 5D7GA 3L4PA 2AYOB 2PJHA 1T3QA 1WGKA 3T3NA 4ARCA
chains in the Genus database with same CATH topology
1ESFA 1ACCA 1ENFA 2XN9C 3NZ3A 3DWGC 2K5PA 4XDCA 1JALA 2L52A 1DOXA 4DXGA 3EGRA 1AW7A 3T3OA 2V4IB 4GLSC 2H88B 3TUOA 3R8BA 1I4HA 3Q8AA 1SE2A 1TKGA 4B0MA 3AB5A 2Z8LA 1P7EA 3BVGA 1FM0D 2L32A 1WWTA 2CJNA 1NYRA 4R3DA 4WURA 1ET9A 3W5UB 3P4RB 2HTME 2V3PA 1F2RC 4ZHOA 1C76A 3AE9B 1QF6A 2JX5A 4UDUC 2SAKA 3ZJUA 4ZOHC 4LK0M 1TKYA 3AM9A 3NUHB 1STEA 1UWMA 2W82A 2WXQA 3TSSA 4RGTA 1PFDA 2DYOA 2N9LA 4JWUC 1MI0A 4ITKA 1K52A 1VZ7A 1WGKA 1T6BX 3IT6B 1L4DB 1YJIA 3IXSA 1ROEA 1Y56A 4HKZE 4TMAB 2N9KA 4L2YA 2QILA 4XDDA 2PMVA 1IGCA 2GRIA 2KMMA 1BXTA 2LEKA 2WDVB 2J53A 4USAA 1MHHE 4PT5A 2BW2A 2BS4B 2PKOA 1C9FA 2K22A 4HEA1 1GPXA 1AN8A 1TJEA 5FK9C 2K3UA 1JW9D 4AS1A 1FNVA 3AMZA 3GS2A 2K0PA 1SJHD 1I4RA 3FC4A 2RDHA 1FRRA 2DLBA 2Y5CA 3NRZA 3AEAB 2DBYA 1FD6A 4RFBA 4ZRPA 1ZXIA 2ACZB 3MC0B 3R2TA 5G5GA 4KX6B 2WXGA 4GDKB 1J7CA 3E56A 3MFGA 1SE3A 2Q5WD 1I4GA 3SFDB 4JWSC 1IGDA 3AE4B 4JPSA 4YTPB 2BS2B 4C80A 3AECB 1HZ6A 1SB3C 2KQ4X 4KGTA 1N5WA 4IDIA 2EELA 3B2FA 2I2YA 1IBXA 2WU5B 1QLBB 1XF5L 2B76B 3Q8FA 1JWUD 1Q10A 3NVWA 5HG2A 3VRAB 1EWCA 2QEJC 2IJ0A 1D5MC 3ZJTA 1KLUD 1F0ZA 1K53A 2ONQA 1JROA 5AUKA 2INNE 3LB8C 3B9JA 2JQRB 4KGSA 1QKZA 2BT6A 4OHJA 1N60A 3LYYA 1F2RI 1I4QA 2I38A 1VR9A 1C77A 1WXQA 3FILB 3HVZA 2WLBA 4J3OD 1VZ8A 4C7ZA 1C4PA 1I4PA 1JWMD 5EE1A 1RM6C 3AH7A 3KQ4A 2JYTA 2OEDA 4H2AA 1BUIC 2WXPA 1QOFA 3Q8BA 1KFYB 1V1PB 2LFIA 3W9CB 2LUMA 4GDLB 5G5HA 5BMIA 4XE0A 5MPOA 1RWSA 4US8A 1CK1A 4WIPA 2WDRB 3H8HA 3UI3A 4ZHPA 4HKQA 1FMAD 2BYTA 5AUIA 3IAM1 3TEYA 2M56B 1YN3A 1XEEA 3BZDB 3PZ8A 4RF0A 1OQQA 4DXFA 2IGHA 3LXFA 3J9CA 1CJEA 3I9V1 2WXIA 3TEZA 2OHFA 3MJ5A 1WSPA 1V8CA 3AE8B 4OVZA 2N0SB 1JWAD 2E3TA 1YQ3B 1UNSA 1TKEA 2KAJA 5H8YE 2W3RA 3MP9A 1DOYA 1KH0A 4RF1A 4YT0B 3BYYB 2AQ3B 1LO5D 1J7BA 1QT9A 5D3IB 2SEBD 4JE3B 4N58A 4O1NA 2WXFA 1VDVA 1YN4A 3R2IA 1FXAA 4NZLB 3BIID 1D5XC 3URYA 3ZGZA 1JCKB 2ICIA 4TQ1A 4A8XC 1L0YB 1YNTE 2M19A 1NI3A 1FEHA 1R7SA 4RGNA 3ZJVA 1E6EB 1B9RA 1FNUA 2FE8A 1KLGD 2RDGA 1D5ZC 4RH6A 1HA5A 1C4AA 1NENB 2INPE 3E9SA 3GP7A 3FAHA 4DQOC 1SEBD 3ZYYX 1JQ4A 4N59A 3NVZA 1NEKB 3AEFB 2AX5A 1J7AA 1TYGB 1A70A 4N6EB 2PW9A 4ZRQA 2WXHA 3OWEB 5I4DA 2BS3B 2ZW1A 2BTEA 1L5PA 4HRSA 1L6UA 4LLGM 3BVZA 4A55A 2D5GA 1CZPA 1E9MA 1HZ5A 4US9A 4ZYSA 1YJJA 1K50A 1ZDVA 1N61A 2MJDA 3P4SB 4OW0A 4AQ7A 1EU3A 1TY0A 2AQ1B 1MHXA 2JWUA 2LHDA 2EKIA 1TS3A 1ET6A 1FXIA 3BVMA 1UUPA 1XXGA 2LMCA 4MACA 3IAS1 3FILA 3NVVA 2WXLA 1CQVA 3DWMA 4RGMA 2QJLA 2G1EA 1JWBD 1YN5A 3SR6A 4FXCA 1GB1A 2X38A 2FBWB 4NAMA 2WXRA 1V1PA 1D4BA 1EWYC 1WYGA 1SIJA 5EE0A 2VZKB 1C78A 1ZPSA 2PLPA 3B2GA 4A6QA 1PGBA 1TS2A 2NTSA 3P1MA 5C3JB 5EE3A 5HFYA 1EU4A 3NS1A 4IOIE 1ZOYB 1D6EC 3HVDA 2LJIA 3ABVB 2LHEA 3C8YA 1L6VA 1V1OA 4LTUA 1FIQA 1QOGA 2DYMA 5EE9A 2IDYA 4WAFA 1XLOA 3BK2A 4EE2A 3HUIA 5E6JA 4YSYB 3Q8EA 1FFUA 4KKJA 3P4QB 2R61A 3VR8B 3W1SA 4CQNA 3AEDB 2FUG1 4P6VF 1I4XA 2IGGA 1VJKA 4YTNB 3AE5B 3W2DA 4REZA 1QILA 4NAWB 2V0GA 3AEEB 2QIEB 1PYWD 3V3XA 1FNWA 1N5XA 3EUB2 1SE4A 1OQRA 4A9AA 2BB5A 4OZCA 1UWXA 2VZKD 2ZW0A 1L4ZB 1BMLC 1SSNA 4YWGG 3MHZA 3RFZB 3EA6A 4WQMA 2ON8A 1MPEA 1GB4A 1ZXHA 1L0XB 3U2SC 4A90A 3PO0A 1N63A 2WXOA 1FCLA 1XLQA 3AE2B 5HI1A 1E0ZA 2WNMA 3AEBB 1N62A 2GB1A 3P63A 4KGRA 3VQIA 2BB6A 1OFFA 5BYQA 1C4CA 1XLNA 2JZPA 2RPVA 2Y3AA 5HHDG 1KRHA 3KWVA 2MH7A 1ZUD2 3W5VB 1DGJA 2NMQA 2WXJA 2DWQA 2PVOD 1C79A 5FR3A 1VRAB 4Q2JA 3O13A 4RGOS 4YTMB 1YMHE 2QSDA 2RMMA 1P7FA 1RFKA 1L0VB 1NYQA 1V97A 2Y5PA 4P16A 2N7JA 2WU2B 1HEZE 1KTKA 2BBCA 2W3SA 3AE1B 4HJGE 4HROA 1TS5A 3KLSX 2W55A 4NJCA 2PTLA 4OZAA 3BYTB 5LNK1 3CWIA 4YSXB 2G9HD 1HXYD 2JXTA 4MT5A 2W54A 3SFEB 2E6XA 1QOAA 4ARIA 1SJED 1TY2A 5BMHA 2NTTA 2YEPF 1XLPA 1AYFA 2CJOA 1VZ6A 3WCQA 2XNAC 3ETRA 5BMGA 4C56C 4D2KA 2CU3A 1M4VA 1MVKA 2HDEA 1ZE3D 1QOBA 4JX1C 2KDMA 3Q8CA 4TSSA 1AWDA 3V05A 3SEBA 4XWWA 1NVID 3AV8A 1FO4A 2M0AA 4MM3B 3TEXA 1VLBA 2WQYB 3N9YC 4MH8A 1RYJA 3U7ZA 1B1ZA 3U4EG 2JSVX 2GI9A 3NVYA 2KACA 2LGIA 5T8IA 1PDXA 4TQ0A 2IPKD 4RNAA 2J4XA 1YQ4B 1IUEA 3TEWA 4XWTA 3AN1A 2JU6X 1F77A 1HQRD 3GB1A 2K9XA 1FCCC 1ZDXA 1PGAA 3CIRB 5C2TB 3Q69A 1XO3A 2PVGC 3ZQ4A 1ZP0B 1DYQA 4KKIA 2JYEA 3AEGB 1FRDA 1TS4A 2H89B 2KN4A 1SXTA 3IT4B 1WRIA 3AE3B 1KF6B 1FFVA 3U52E 5D3DA 4WH4A 2PIAA 1PGXA 1GAQB 4YSZB 3VRBB 1K51A 1JRPA 1E10A 1TZOA 4M0WA 1GOZA 4WWMA 1QQRA 2J42A 2J52A 2WS3B 3BK1A 1EM7A 2WXKA 1JMLA 2V3NA 4C7YA 2IGDA 1PUTA 1I7HA 1SBBB 1XCTL 1XCQL 2L1AA 1JWSD 3I57A 2MEKA 3AE7B 2MJEA 4OZBA 2KWDA 5H92C 3AE6B 5TSSA 2YEPB 3P42A 3P4PB 2QMTA 5GXGB 3VR9B 5BYSA 2TSSA 3BWUD 1E7PB 1SF0A 2WXMA 2WDQB 5BYRA 2L83A 1DOIA 3HRDD 4L1BA 4B0EA 3KWLA 4IKGA 2WP9B 2WXNA 1IBXB 5FKAC 3RPFC 2MJ3A 4YXDB 5JXVA 1UGJA 4L23A 5D7GA 1T5XD 4RCOA 3PZ7A 3L4PA 1T3QA 2AQ2B 3T3NA 4ARCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SSN A;  1BUI C;  1C76 A;  1C79 A;  1C77 A;  1C78 A;  2SAK A; 
#chains in the Genus database with same CATH topology
 4GXB A;  2XN9 C;  3NZ3 A;  4XDC A;  2KNB A;  3EGR A;  3B1L X;  4HWI B;  2H88 B;  3OLM D;  3TUO A;  1WFY A;  1I4H A;  2ZEQ A;  3AI5 A;  3Q8A A;  4B0M A;  4FLH A;  4GMV A;  5J17 A;  4HDO A;  1WWT A;  4ZHO A;  5LXH A;  2MWS B;  4ZOH C;  3KYD D;  1WX9 A;  2NCN A;  2WXQ A;  1TTN A;  1PFD A;  2FCS A;  2N9L A;  3VUW A;  1VZ7 A;  2KFK B;  3IT6 B;  1WYW B;  1YJI A;  1Y56 A;  4TMA B;  1HE8 A;  4L2Y A;  4XDD A;  2PMV A;  2KMM A;  1BXT A;  2WYQ A;  4W9K A;  3ZNI D;  2CR5 A;  2BS4 B;  1GC7 A;  1EF1 A;  5FK9 C;  1JW9 D;  4AS1 A;  1FNV A;  1YD8 U;  3GS2 A;  3FC4 A;  3WAN A;  1WX8 A;  1XD3 B;  2D11 A;  2RDH A;  3UQB A;  4ZRP A;  2KZR A;  1ZXI A;  2D07 B;  2CKH B;  1IP9 A;  2Q5W D;  1UZX B;  4JWS C;  3AE4 B;  2V4L A;  4G50 A;  3QC8 B;  3N3K B;  4I6N B;  3N1Y C;  2A5U A;  2ASQ A;  4GSW A;  2KYW A;  1N5W A;  2KJR A;  4MGZ E;  1G6J A;  3Q8F A;  5HG2 A;  1ISN A;  1KLU D;  1K53 A;  2GBK A;  5AUK A;  3DBS A;  4KGS A;  4HK2 A;  4FJY A;  3DHI C;  2I38 A;  2NVU I;  5D2M B;  2MA9 B;  4C7Z A;  4DHZ B;  3KVF B;  1C4P A;  1JWM D;  5EE1 A;  1RM6 C;  2JYT A;  3JSV B;  4WIP A;  2WDR B;  2RR9 A;  4ZHP A;  2KDI A;  3NZU A;  3TEY A;  1YN3 A;  2KK8 A;  2KN5 A;  1Q1O A;  3PHW B;  2MP2 A;  1LM8 B;  1WGH A;  3MJ5 A;  2N0S B;  1YQ3 B;  1UNS A;  3RT3 B;  3VHT C;  3DVG X;  4F7Z A;  3MP9 A;  1DOY A;  4E3C A;  4J6I A;  4YT0 B;  2PPH A;  3BYY B;  1LO5 D;  1QT9 A;  5D3I B;  4DHJ D;  1E8Y A;  4K81 A;  1U4A A;  3U7D A;  2Y5B B;  3RD2 A;  3R3M A;  1D5X C;  5EDS A;  2M19 A;  1NI3 A;  2KC1 A;  3ZJV A;  2MBO A;  2O6V A;  2L0T A;  1H8C A;  2EMT A;  4EZK A;  3DBL I;  1D5Z C;  2A4Z A;  2O2V B;  1C4A A;  3T8M A;  4MH0 E;  1J19 A;  2BPS A;  1TYG B;  4W9H A;  3RNC C;  2FUH B;  4HRS A;  4LLG M;  2D5G A;  1CZP A;  4XZ4 A;  5L95 C;  4LJO B;  3ZVV A;  5E6P A;  3APF A;  1ZDV A;  5CHW A;  3SU8 X;  2LHD A;  1YJ1 A;  1TS3 A;  1YIW A;  2V1Y A;  3L08 A;  2WXL A;  2KOX A;  4W9I A;  3JW0 X;  2FBW B;  3P2B A;  2UWQ A;  1D4B A;  4W9D A;  5EE3 A;  5HFY A;  1EU4 A;  4F1S A;  1NBF C;  1D6E C;  4BAX A;  3ML9 A;  3T9L A;  1L6V A;  3N1X C;  4BFR A;  3ZUN A;  2IY0 B;  2J0M A;  4KVG B;  3HUI A;  3M63 B;  3P4Q B;  3NZS A;  3N30 A;  2KJ6 A;  3H7S A;  1E8W A;  3AED B;  1GNU A;  2IGG A;  4YTN B;  3VAW A;  2XEW A;  4WJQ A;  4LCD E;  3GZN I;  1XT9 B;  2JWZ A;  2ZW0 A;  2IO1 B;  4YWG G;  1TZ1 A;  3H6N A;  1L0X B;  2J0J A;  1N63 A;  4ICV A;  5HI1 A;  1E0Z A;  2WNM A;  1N62 A;  3P63 A;  3D32 A;  2BKR B;  2BB6 A;  1C4C A;  2JZP A;  2RPV A;  1KRH A;  1OQY A;  3Q3M C;  3PLV A;  5J18 A;  3QAQ A;  4IUM B;  1C79 A;  3O13 A;  4YTM B;  2QCZ A;  1V97 A;  4P16 A;  2WU2 B;  1LQB A;  2W3S A;  1KTK A;  2GBM A;  4HJG E;  1OTR B;  3L10 B;  4G0N B;  3BYT B;  5LNK 1;  2G9H D;  3KW5 B;  3SFE B;  5LXI B;  1QOA A;  1SJE D;  4B9K A;  3DVG Y;  1VZ6 A;  3KUC B;  3L17 A;  3ZLZ A;  5HKH A;  4ASW C;  4YL8 A;  3WAL A;  2CU3 A;  1TGZ B;  5JHB A;  3W1S C;  2KDM A;  3Q8C A;  4TSS A;  4JLC A;  3SEB A;  3DQV A;  2MSE D;  1FPY A;  1VLB A;  2WQY B;  2QC8 A;  2INC C;  4HJK A;  1BT0 A;  1PDX A;  4TQ0 A;  4GOC A;  3TEW A;  1P1A A;  5CHF A;  2N4F A;  4M02 A;  2KWC A;  2JVC A;  1F77 A;  1T0R C;  2MLB A;  2KAN A;  1PGA A;  3ZQ4 A;  3Q69 A;  1DYQ A;  4KKI A;  3AEG B;  4EEW A;  2DZM A;  1SXT A;  2D3A A;  3AE3 B;  1FFV A;  1WIA A;  1E8X A;  2K8H A;  2PIA A;  1WY8 A;  1WJ6 A;  3PGE A;  2YVC A;  4XYC A;  4M0W A;  2GBN A;  4MJS A;  2WS3 B;  3RMK C;  2WXK A;  2RGF A;  1WXS A;  2PE6 B;  4NQK E;  2IGD A;  3SHQ A;  1XCQ L;  2QHO A;  1JWS D;  1WXA A;  3AE7 B;  2MJE A;  5H92 C;  2KWD A;  3AE6 B;  2YEP B;  3VR9 B;  1UH6 A;  3WAO A;  2FNJ B;  2L83 A;  1DOI A;  3HRD D;  1F1H A;  3UGB B;  5FKA C;  2MJ3 A;  4K7S A;  3ZIM A;  2HD5 B;  2DAJ A;  4KZ0 A;  1LGR A;  5TR5 A;  3R7Q A;  1HTQ A;  3VTU A;  3RNB C;  4KSL C;  2KHW B;  2ZJD A;  1TKG A;  4OVU A;  3FKY A;  1P7E A;  1SIF A;  1TBE A;  1K8R B;  2CJN A;  3ML8 A;  4R3D A;  4WUR A;  3W5U B;  2HTM E;  1QF6 A;  1MG8 A;  3ZJU A;  3IHP C;  4LK0 M;  2BF8 B;  2L00 B;  3AM9 A;  2MP2 B;  1WZ3 A;  3N20 C;  4FJV B;  4K3C A;  4QAY A;  1EUV B;  4JWU C;  3CF6 E;  2MBB B;  4WWP A;  2L76 A;  1T6B X;  1CMX B;  2QIL A;  3ECI A;  1IGC A;  2WDV B;  4XGA B;  4PT5 A;  4PS7 A;  2BW2 A;  1C9F A;  2K22 A;  4HEA 1;  1AN8 A;  1TJE A;  4DXA B;  3AMZ A;  4JGH B;  3GOE A;  1SJH D;  2DLB A;  1JRU A;  2DBY A;  2O6V B;  4RFB A;  2ACZ B;  5G5G A;  4KX6 B;  4GDK B;  5DPR A;  3MFG A;  3Q14 C;  3SFD B;  3GE3 C;  1IGD A;  3PVL A;  4YTP B;  4C80 A;  5JH5 C;  3AEC B;  1I42 A;  1HZ6 A;  3Q2A C;  2MBH A;  3CMM B;  3BY4 B;  3VTV A;  2CHW A;  2EEL A;  3B2F A;  2I2Y A;  1IBX A;  5DCN A;  1QLB B;  4ZRJ A;  1JWU D;  1Q10 A;  1EWC A;  2QEJ C;  2IJ0 A;  2Z59 B;  2D10 A;  1YX5 B;  2GLS A;  2IO2 B;  2JXX A;  4M8N A;  5CHV C;  3LB8 C;  2BT6 A;  1N60 A;  3LYY A;  1F2R I;  1I4Q A;  2M8S A;  1C77 A;  1TT5 B;  3HVZ A;  4J3O D;  1VZ8 A;  4A3O A;  4KDL B;  5E6N A;  4ANU A;  3AH7 A;  2R2O A;  3KQ4 A;  2M17 A;  2OED A;  1S3S G;  3W9C B;  2ZPY A;  5G5H A;  5BMI A;  2OOB B;  1RWS A;  2JT4 B;  4NY0 A;  3UI3 A;  2C7H A;  5KHQ A;  3ZKJ C;  3HK0 A;  2ZCC A;  5L83 A;  3IAM 1;  4G3X B;  3MC8 A;  3PZ8 A;  1OQQ A;  2IGH A;  2WXI A;  3TEZ A;  4NPN A;  4IM3 A;  1V8C A;  4OVZ A;  4MGI E;  1JWA D;  2E3T A;  1TKE A;  2KAJ A;  1RAX A;  2DZJ A;  1KH0 A;  1WE6 A;  2MCN B;  1J7B A;  2SEB D;  4JE3 B;  4II3 B;  1WGY A;  1YN4 A;  3BII D;  4TQ1 A;  4A8X C;  1B9R A;  1FNU A;  3KUZ A;  2RDG A;  3AUL A;  2FCM A;  4A3P A;  4WAA A;  4RH6 A;  1HA5 A;  1NEN B;  3E9S A;  2INP E;  2FID A;  4DQO C;  1WM3 A;  4P1B C;  4N59 A;  3A9K A;  1T0Y A;  3ZNZ B;  1J7A A;  1A70 A;  4N6E B;  2PW9 A;  4M00 A;  3V60 A;  5AEK B;  2REX A;  1WXV A;  1WGG A;  4IWP A;  3RUI B;  1L6U A;  2M1M A;  3M62 B;  4ZYS A;  2B3A A;  2DZI A;  4W9L A;  2LXA A;  3UIP B;  3P4S B;  4AQ7 A;  1YX6 B;  4W9C A;  3RNG C;  2EKI A;  4WJP A;  4MAC A;  2KVZ A;  3DWM A;  4RGM A;  2QJL A;  3MJW A;  1OEY A;  3SR6 A;  3QWZ B;  4FXC A;  2G4D B;  1V1P A;  4S0R A;  2JF5 A;  5AZG A;  3DBH I;  2VZK B;  1C78 A;  4A6Q A;  3IVF A;  3BIN A;  2PEA A;  4EUT A;  1ZOY B;  3HVD A;  3EEC A;  3UF8 A;  3NOB A;  4AOF A;  1FIQ A;  5EE9 A;  2IDY A;  4WAF A;  3MTN B;  1XLO A;  3BK2 A;  3Q3N C;  4EE2 A;  4GU2 A;  4YSY B;  3TJP A;  3KH0 A;  2KDE B;  5D94 A;  3VR8 B;  1GUA B;  3A9J A;  2FUG 1;  1VJK A;  2LZ6 A;  3X0W A;  3AEE B;  4EOY A;  1FNW A;  1M94 A;  1N5X A;  1SE4 A;  3OG5 A;  2BB5 A;  3QJZ A;  4AWJ A;  1A5R A;  4JQW C;  3MHZ A;  3EA6 A;  4WQM A;  2ON8 A;  1R4M I;  1ZXH A;  3U2S C;  3SDL C;  2WXO A;  3DDC B;  2WWZ A;  1XLQ A;  4M0W B;  1N6Z A;  2GB1 A;  2FCN A;  1OFF A;  4MJS B;  1J0G A;  2Y3A A;  5HHD G;  3KWV A;  3V6C B;  1ZUD 2;  3W1Y A;  1DGJ A;  2LRW A;  2NMQ A;  4NNJ B;  4CYE A;  1Y8R C;  3A4R A;  2R2Q A;  4Q2J A;  1V5T A;  1L0V B;  3QCA A;  5G55 A;  4GDK A;  4OVV A;  3NY5 A;  4E71 A;  3AE1 B;  1TS5 A;  3IFW B;  1UD7 A;  2KWV B;  3VH4 B;  3CWI A;  3ZXV A;  4RM9 A;  2DZK A;  1GC6 A;  2JXT A;  2DX5 B;  4MT5 A;  1YOV B;  2E6X A;  4FJZ A;  3EC8 A;  1XLP A;  4HCP B;  4WWN A;  3WCQ A;  3IBE A;  2FAZ A;  3PHX B;  3PLU A;  1M4V A;  1MVK A;  2HDE A;  2AL6 A;  5IA7 A;  1QOB A;  1WR6 E;  2N1V A;  4XWW A;  1NVI D;  1MFW A;  4ZDV A;  4MM3 B;  3N9Y C;  5E6O A;  1RYJ A;  1B1Z A;  2DYB A;  5IOI A;  3NVY A;  3B08 A;  5JHA A;  2D2Q A;  4TV3 A;  2IPK D;  2NS5 A;  3RZW C;  4RNA A;  2KTR B;  2J4X A;  4BKT A;  4NJ6 A;  2LGX A;  2KFJ A;  3WIM A;  1ZDX A;  5C2T B;  2DHZ A;  2G3Q B;  3OJ3 A;  2JYE A;  4FHJ A;  2I1K A;  4DK5 A;  3IT4 B;  1Q0W B;  3U52 E;  4WH4 A;  5IKC M;  1JRP A;  2J52 A;  5IO9 A;  3APD A;  1JML A;  3DOW A;  1PUT A;  2KWU B;  2JZZ A;  3I57 A;  3PPA A;  4OZB A;  3QAR A;  3VVW B;  5TSS A;  2NBV B;  3P4P B;  5BYS A;  5GXG B;  4LNN A;  3BWU D;  1E7P B;  1SF0 A;  2WXM A;  2V3S A;  4DWF A;  1UEL A;  1GJZ A;  3ZO5 B;  2WXN A;  1IBX B;  3RPF C;  1WJU A;  4HPL B;  3DHG C;  2RSU A;  1T5X D;  3PZ7 A;  2LXC A;  1ACC A;  2WX0 A;  3TCA A;  1ENF A;  3AXC A;  5IN7 A;  2WHI A;  3QIJ A;  3DWG C;  3LDZ E;  1AW7 A;  2IO3 B;  4PK1 A;  1I35 A;  1WX7 A;  4DDG D;  2KKC A;  1GG3 A;  1E7V A;  2L32 A;  1WM2 A;  1NYR A;  1ET9 A;  2IND C;  2L3Z A;  2LRU A;  2V3P A;  1F2R C;  1V5O A;  5IAA C;  3H7P A;  1C76 A;  4LJP B;  2JX5 A;  3ZRF A;  4ANW A;  1R4N I;  1E8Z A;  2KQ7 A;  4W9F A;  3NUH B;  1STE A;  4AJY B;  3DBL B;  2W82 A;  4RGT A;  3ZNG C;  4BOZ B;  2GBR A;  1MI0 A;  1E90 A;  2ZNV B;  3NS8 A;  1ROE A;  4W9J A;  5D6J B;  3ZW3 A;  2IBI B;  3DBR I;  2GRI A;  2LEK A;  2CHX A;  4ICU A;  2CHZ A;  4USA A;  1MHH E;  2KX0 A;  2PKO A;  5C23 A;  2K3U A;  3Q3O C;  2K0P A;  1FRR A;  2Y5C A;  3I5J C;  1P0R A;  4S17 A;  1FD6 A;  3AU4 A;  3R2T A;  3KUD B;  1ZKH A;  2WXG A;  3TBL D;  4IM0 A;  1SE3 A;  1I4G A;  2DAF A;  4JPS A;  3OJ4 B;  2ZVN A;  2BS2 B;  2M0X A;  1V9J A;  2JZ3 B;  3A9K B;  4IC7 B;  4MGY E;  3U30 A;  2KQ4 X;  3RNF C;  4IDI A;  1RRB A;  2CS4 A;  2BYE A;  3B0A A;  1V49 A;  4ACF A;  2K39 A;  4KSK C;  2LVP A;  2WU5 B;  2N7D A;  2B76 B;  4DHZ E;  3K9P B;  1D5M C;  3ZJT A;  1V86 A;  4PYZ A;  1WI0 A;  1WMH A;  2O6V D;  2ONQ A;  3GE8 C;  1JRO A;  3ENE A;  2MBQ A;  3B9J A;  1SE9 A;  3HM3 A;  1QKZ A;  2QDF A;  2RD0 A;  4OHJ A;  2HJ1 A;  1WXQ A;  1IPG A;  2NBU A;  3M3J A;  5DPW A;  4AJW A;  2V9H A;  1WRD B;  1I4P A;  3GZN B;  4RM8 A;  2K6Q A;  3RNA C;  1BUI C;  1QOF A;  3Q8B A;  1V1P B;  2LUM A;  1WGR A;  1CK1 A;  3WAP A;  2DNF A;  2BKF A;  1FMA D;  4KV2 A;  2BYT A;  5CTR C;  5AUI A;  3PT2 B;  4C4V A;  2Z0D B;  1XEE A;  4RF0 A;  3LXF A;  4XX5 A;  4AP4 C;  4W9G A;  2M4N A;  2OHF A;  2OJW A;  2N7E A;  4LNF A;  2RDB C;  2Z0E B;  3A9J B;  2KXJ A;  3UQA A;  2ZPN A;  5H8Y E;  2W3R A;  2D3C A;  2AQ3 B;  5G2N A;  4MM3 A;  4BBN C;  5BO4 B;  4N58 A;  3ZTC A;  4A20 A;  3AU5 A;  1FXA A;  4NZL B;  1WR1 A;  2KX3 A;  1JCK B;  1L0Y B;  2KTR A;  3QHT A;  4HPM B;  1FEH A;  4RGN A;  2PE9 A;  1E6E B;  3GP7 A;  2G45 B;  1NEK B;  4K7U A;  2AX5 A;  2C9W B;  2XK5 B;  1ZW7 A;  1L2N A;  4PS3 A;  1L5P A;  1NI2 A;  4CHK A;  4MSQ B;  1E9M A;  4I6L B;  2KT7 A;  1YJJ A;  1K50 A;  2AQ1 B;  1TY0 A;  2JWU A;  1MHX A;  1ET6 A;  1FXI A;  3CST A;  2LMC A;  5AZF A;  5AZH A;  3VFK A;  4MSM B;  3FIL A;  2BYV E;  2G1E A;  1JWB D;  1YN5 A;  4EZL A;  4FAD A;  1F52 A;  4NAM A;  3HM6 X;  2WXR A;  1EWY C;  2KJH B;  4K1R B;  2LVQ A;  5EE0 A;  2ZNV C;  2PLP A;  1PGB A;  2NTS A;  2DEN B;  3NS1 A;  3SD5 A;  2W9N A;  1MG4 A;  1T0Q C;  3ABV B;  4M01 A;  2LHE A;  1V1O A;  2KMC A;  1WXM A;  4LTU A;  4WJN A;  1QOG A;  2NPT B;  4HPP A;  3I3T B;  3JVZ X;  3Q8E A;  1FFU A;  4KKJ A;  3V6E B;  2R61 A;  1WF9 A;  4BKG A;  2ZZP B;  4P6V F;  3ZDM C;  3RI7 C;  3AE5 B;  1EF5 A;  4REZ A;  4NAW B;  3R66 C;  2QIE B;  3VDZ A;  1FXT B;  2LD9 A;  3HIZ A;  3EUB 2;  4OZC A;  4MEL A;  2VZK D;  1L4Z B;  1BML C;  5J2R A;  1WH3 A;  2VH1 A;  3QK0 A;  3TMP B;  2G4S A;  1GB4 A;  1X1M A;  3PO0 A;  1OGW A;  3AE2 B;  4II2 B;  3AEB B;  2HE7 A;  4KGR A;  1KJT A;  2MH7 A;  2L7R A;  4GGQ A;  3W5V B;  2X8X X;  4IG7 B;  4WQO B;  2DWQ A;  1OEY J;  2PVO D;  3WA0 A;  4ANX A;  4AUQ C;  5FR3 A;  1VRA B;  3QX1 A;  2KVR A;  2MBE A;  1WZ0 A;  2RMM A;  1RFK A;  2N7J A;  3ZRC A;  4P1C C;  2BBC A;  4LDT B;  2KO3 A;  2JRH A;  2N9X A;  4NJC A;  2HJ8 A;  3Q3J A;  5JZE B;  2N1W A;  2N9P C;  1J8C A;  4YSX B;  1HXY D;  4W9E A;  1UBQ A;  5BMH A;  2NTT A;  2YEP F;  1AYF A;  1UGM A;  3A1Q A;  3ETR A;  5BMG A;  4NJ7 A;  3V62 A;  4JX1 C;  4BOS C;  3MHS D;  3VXW A;  3V05 A;  4K7W A;  3DVN V;  3JYU A;  4KIK A;  2M0A A;  3H7P B;  4GIV A;  3U4E G;  2JSV X;  2C60 A;  2KAC A;  2LGI A;  2RPQ A;  4G11 A;  3S2A A;  1YQ4 B;  3TL5 A;  1IUE A;  4GN1 A;  1ZGU B;  4XWT A;  1QZE A;  4HVB A;  3NHE B;  1C3T A;  2K9X A;  2HTH A;  3CIR B;  1T0S C;  2IYD B;  1ZP0 B;  2LGY A;  2KLC A;  3RN9 C;  1FRD A;  2H89 B;  2VH2 A;  3L13 A;  5D3D A;  1GAQ B;  1K51 A;  2N9E B;  2GMI C;  3PRP B;  1TZO A;  3RNE C;  1GOZ A;  1QQR A;  2J42 A;  5LLI A;  3BK1 A;  1TIF A;  4C7Y A;  1SBB B;  2L1A A;  4HDQ A;  2MEK A;  4TUU A;  2KDF B;  3P42 A;  2QMT A;  2TSS A;  4IWQ A;  3V61 A;  4IWO A;  1RLF A;  2WDQ B;  5BYR A;  4L1B A;  4B0E A;  2WP9 B;  2JPH A;  4YXD B;  2K25 A;  5CX3 A;  4L23 A;  3EFC A;  4RCO A;  2GOW A;  2XBB C;  2AQ2 B;  4N9F 4;  1ESF A;  2IO0 B;  3EFU A;  1WMH B;  3C19 A;  3QQ8 B;  1SGH A;  1KOT A;  2MX2 A;  4ZRK A;  2FIF A;  2K5P A;  1DOX A;  1JAL A;  2L52 A;  2XK5 A;  4DXG A;  5DPT A;  3T3O A;  2V4I B;  3PRE A;  4GLS C;  3R8B A;  1UBI A;  2IY1 B;  4ZRI A;  1SE2 A;  4BKS A;  4FN2 A;  3AB5 A;  2Z8L A;  3BVG A;  1FM0 D;  3P4R B;  4X57 B;  1V2Y A;  3VTW A;  3AE9 B;  2BVC A;  4ZYN A;  4UDU C;  3RZF A;  2SAK A;  4NQL B;  1Z5S B;  4C4V B;  1TKY A;  2LUE A;  1UWM A;  3TSS A;  3Q3F A;  2DYO A;  4HCN B;  4ITK A;  1K52 A;  2KLG A;  1V80 A;  3LJ3 A;  1L4D B;  2L05 A;  3N32 A;  3IXS A;  3R7R A;  4HKZ E;  3C0R B;  2N9K A;  3PRM B;  3CSF A;  4E74 A;  2K8C A;  4JIO U;  2LWP A;  5KHO A;  4XC2 A;  2CU1 A;  2JY6 A;  3L0W B;  2J53 A;  2NPT A;  2VRR B;  3QA8 A;  4B6W A;  4TKN A;  1GPX A;  2KDB A;  1I4R A;  3PZD A;  3NRZ A;  3AEA B;  4IM2 A;  4EFO A;  3MC0 B;  4NAW A;  2K1F A;  1J7C A;  3E56 A;  2K6D B;  1V81 A;  2MRP A;  3X23 A;  2WX1 A;  3DPD A;  1UF0 A;  1NDD A;  1SB3 C;  4KGT A;  4C00 A;  3DBH B;  1XF5 L;  3NVW A;  3MC9 A;  3VRA B;  1Z2M A;  4URK A;  2D3B A;  1F0Z A;  1LFD A;  2C5L C;  2INN E;  3DVN U;  2JQR B;  2KQS A;  3Q6B A;  2KTF A;  1VR9 A;  4DDI D;  3N1Z C;  3FIL B;  2BWE S;  3A4S C;  2WLB A;  1P98 A;  3RUL A;  3H1U A;  4H2A A;  2WXP A;  3H9D A;  4DHJ B;  1KFY B;  2LFI A;  4GDL B;  4XE0 A;  5MPO A;  4US8 A;  1R4M B;  3H8H A;  1YQB A;  2BQQ A;  4HKQ A;  2OJR A;  4FBJ B;  4MGK E;  2M56 B;  4EZJ A;  3ZNH B;  3BZD B;  4DXF A;  1HTO A;  3J9C A;  1CJE A;  3I9V 1;  1RFA A;  3NG0 A;  2LVO A;  4WJO A;  2BYF A;  1IYF A;  3TIX A;  3ZDT A;  1WSP A;  2ZCB A;  3AE8 B;  2KFK A;  3VH3 B;  1C1Y B;  4HXD A;  1P3Q U;  4MDK E;  3EHV A;  4RF1 A;  2YLM A;  3RCZ A;  2FCQ A;  2AEH A;  5IP4 D;  2KMA A;  2WGS A;  3PV1 A;  4O1N A;  2WXF A;  1VDV A;  3R2I A;  4I6P A;  3URY A;  3IG3 A;  3ZGZ A;  2ICI A;  1YNT E;  1H4R A;  1R7S A;  3UIN B;  3VUX A;  2FE8 A;  1EO6 A;  1KLG D;  1VCB A;  2KC2 A;  3FAH A;  2L0F A;  1SEB D;  3ZYY X;  2ZVO A;  1JQ4 A;  3NVZ A;  1V6E A;  3AEF B;  1L7Y A;  4FUL A;  4ZRQ A;  2WXH A;  3M95 A;  1KLV A;  4KDI C;  3OWE B;  5I4D A;  2BS3 B;  2ZW1 A;  1KM7 A;  2BTE A;  3L54 A;  3BVZ A;  2LI5 A;  2BWF A;  4A55 A;  1HZ5 A;  4US9 A;  3PTF C;  2NBW B;  1N61 A;  2MJD A;  4OW0 A;  1EU3 A;  3HHM A;  4WWO A;  3BVM A;  1UUP A;  1XXG A;  3IAS 1;  3RYT A;  3NVV A;  1CQV A;  4EKU A;  2IZV B;  1GB1 A;  2X38 A;  2LAS A;  4M8M A;  3JSV A;  2LGS A;  3A1Q B;  4LNI A;  2J7Q B;  1WYG A;  1SIJ A;  1E5W A;  1ZPS A;  3B2G A;  1TS2 A;  3P1M A;  4MEM A;  5C3J B;  4BKS D;  3A33 B;  4IOI E;  2L8J A;  2LJI A;  3C8Y A;  4KIK B;  2DYM A;  3KYC D;  5E6J A;  2BGF A;  3W1S A;  4KZC A;  4CQN A;  1I4X A;  3W2D A;  4BZA A;  3DHH C;  1QIL A;  2V0G A;  2MW5 A;  4PS8 A;  1PYW D;  3V3X A;  1OQR A;  1VD2 A;  4A9A A;  1S1Q B;  1UWX A;  3RFZ B;  1SSN A;  1MPE A;  5C1Z A;  4HLE A;  4ANV A;  4A90 A;  3PSE B;  1FCL A;  2O2V A;  3VQI A;  5BYQ A;  1XLN A;  2KD0 A;  5DPS A;  3WAM A;  2JUO A;  2WXJ A;  1Q5W B;  4RGO S;  4F8C B;  1YMH E;  2QSD A;  1P7F A;  1NYQ A;  4B95 A;  2Y5P A;  2K8B A;  1HEZ E;  5FR6 A;  1R4N B;  2D3G A;  4HRO A;  2C7N B;  2MHJ A;  2W55 A;  3KLS X;  2UYZ B;  2PTL A;  2NR2 A;  4OZA A;  4PYU A;  3ZTD A;  4JL9 A;  4BBN F;  3NJT A;  2W54 A;  2WDT B;  1E7U A;  4ARI A;  1TY2 A;  3ALB A;  2CJO A;  2XNA C;  4LNK A;  4GB9 A;  4C56 C;  3DBR B;  4D2K A;  1ZE3 D;  1LXD A;  1AWD A;  2MQJ A;  1MJD A;  3APC A;  3AV8 A;  1FO4 A;  3TEX A;  4LDT D;  1WJN A;  4MH8 A;  2LGD A;  3U7Z A;  1PQS A;  2GI9 A;  3OAW A;  5T8I A;  3UIO B;  4CO7 A;  2EKE C;  3O65 B;  3AN1 A;  2JU6 X;  4GDL A;  4RMA A;  1HQR D;  3GB1 A;  2AWT A;  4DBG A;  1FCC C;  1AAR A;  3DCG A;  1XO3 A;  2PVG C;  4IW0 A;  5GMV A;  3PRZ A;  1TS4 A;  3U8Z A;  2KN4 A;  4LNO A;  3ONS A;  1WRI A;  1KF6 B;  2I1J A;  2LJ5 A;  3PS6 A;  4P7I A;  3VUY A;  1PGX A;  4YSZ B;  3VRB B;  4K3B A;  1E10 A;  2AL3 A;  4WWM A;  2GBJ A;  1EM7 A;  2V3N A;  2C7M B;  2J0K A;  2JRI B;  4BVU C;  1I7H A;  1XCT L;  1XQQ A;  1F9J A;  3I63 C;  3ZXR A;  1D3Z A;  2EMS A;  2UU7 A;  1P9D U;  1WE7 A;  4FA6 A;  1WJ4 A;  3KWL A;  4IKG A;  1WGD A;  3K9O B;  5JXV A;  4FHK A;  3L16 A;  1UGJ A;  5D7G A;  3L4P A;  2AYO B;  2PJH A;  1T3Q A;  1WGK A;  3T3N A;  4ARC A; 
#chains in the Genus database with same CATH homology
 1ESF A;  1ACC A;  1ENF A;  2XN9 C;  3NZ3 A;  3DWG C;  2K5P A;  4XDC A;  1JAL A;  2L52 A;  1DOX A;  4DXG A;  3EGR A;  1AW7 A;  3T3O A;  2V4I B;  4GLS C;  2H88 B;  3TUO A;  3R8B A;  1I4H A;  3Q8A A;  1SE2 A;  1TKG A;  4B0M A;  3AB5 A;  2Z8L A;  1P7E A;  3BVG A;  1FM0 D;  2L32 A;  1WWT A;  2CJN A;  1NYR A;  4R3D A;  4WUR A;  1ET9 A;  3W5U B;  3P4R B;  2HTM E;  2V3P A;  1F2R C;  4ZHO A;  1C76 A;  3AE9 B;  1QF6 A;  2JX5 A;  4UDU C;  2SAK A;  3ZJU A;  4ZOH C;  4LK0 M;  1TKY A;  3AM9 A;  3NUH B;  1STE A;  1UWM A;  2W82 A;  2WXQ A;  3TSS A;  4RGT A;  1PFD A;  2DYO A;  2N9L A;  4JWU C;  1MI0 A;  4ITK A;  1K52 A;  1VZ7 A;  1WGK A;  1T6B X;  3IT6 B;  1L4D B;  1YJI A;  3IXS A;  1ROE A;  1Y56 A;  4HKZ E;  4TMA B;  2N9K A;  4L2Y A;  2QIL A;  4XDD A;  2PMV A;  1IGC A;  2GRI A;  2KMM A;  1BXT A;  2LEK A;  2WDV B;  2J53 A;  4USA A;  1MHH E;  4PT5 A;  2BW2 A;  2BS4 B;  2PKO A;  1C9F A;  2K22 A;  4HEA 1;  1GPX A;  1AN8 A;  1TJE A;  5FK9 C;  2K3U A;  1JW9 D;  4AS1 A;  1FNV A;  3AMZ A;  3GS2 A;  2K0P A;  1SJH D;  1I4R A;  3FC4 A;  2RDH A;  1FRR A;  2DLB A;  2Y5C A;  3NRZ A;  3AEA B;  2DBY A;  1FD6 A;  4RFB A;  4ZRP A;  1ZXI A;  2ACZ B;  3MC0 B;  3R2T A;  5G5G A;  4KX6 B;  2WXG A;  4GDK B;  1J7C A;  3E56 A;  3MFG A;  1SE3 A;  2Q5W D;  1I4G A;  3SFD B;  4JWS C;  1IGD A;  3AE4 B;  4JPS A;  4YTP B;  2BS2 B;  4C80 A;  3AEC B;  1HZ6 A;  1SB3 C;  2KQ4 X;  4KGT A;  1N5W A;  4IDI A;  2EEL A;  3B2F A;  2I2Y A;  1IBX A;  2WU5 B;  1QLB B;  1XF5 L;  2B76 B;  3Q8F A;  1JWU D;  1Q10 A;  3NVW A;  5HG2 A;  3VRA B;  1EWC A;  2QEJ C;  2IJ0 A;  1D5M C;  3ZJT A;  1KLU D;  1F0Z A;  1K53 A;  2ONQ A;  1JRO A;  5AUK A;  2INN E;  3LB8 C;  3B9J A;  2JQR B;  4KGS A;  1QKZ A;  2BT6 A;  4OHJ A;  1N60 A;  3LYY A;  1F2R I;  1I4Q A;  2I38 A;  1VR9 A;  1C77 A;  1WXQ A;  3FIL B;  3HVZ A;  2WLB A;  4J3O D;  1VZ8 A;  4C7Z A;  1C4P A;  1I4P A;  1JWM D;  5EE1 A;  1RM6 C;  3AH7 A;  3KQ4 A;  2JYT A;  2OED A;  4H2A A;  1BUI C;  2WXP A;  1QOF A;  3Q8B A;  1KFY B;  1V1P B;  2LFI A;  3W9C B;  2LUM A;  4GDL B;  5G5H A;  5BMI A;  4XE0 A;  5MPO A;  1RWS A;  4US8 A;  1CK1 A;  4WIP A;  2WDR B;  3H8H A;  3UI3 A;  4ZHP A;  4HKQ A;  1FMA D;  2BYT A;  5AUI A;  3IAM 1;  3TEY A;  2M56 B;  1YN3 A;  1XEE A;  3BZD B;  3PZ8 A;  4RF0 A;  1OQQ A;  4DXF A;  2IGH A;  3LXF A;  3J9C A;  1CJE A;  3I9V 1;  2WXI A;  3TEZ A;  2OHF A;  3MJ5 A;  1WSP A;  1V8C A;  3AE8 B;  4OVZ A;  2N0S B;  1JWA D;  2E3T A;  1YQ3 B;  1UNS A;  1TKE A;  2KAJ A;  5H8Y E;  2W3R A;  3MP9 A;  1DOY A;  1KH0 A;  4RF1 A;  4YT0 B;  3BYY B;  2AQ3 B;  1LO5 D;  1J7B A;  1QT9 A;  5D3I B;  2SEB D;  4JE3 B;  4N58 A;  4O1N A;  2WXF A;  1VDV A;  1YN4 A;  3R2I A;  1FXA A;  4NZL B;  3BII D;  1D5X C;  3URY A;  3ZGZ A;  1JCK B;  2ICI A;  4TQ1 A;  4A8X C;  1L0Y B;  1YNT E;  2M19 A;  1NI3 A;  1FEH A;  1R7S A;  4RGN A;  3ZJV A;  1E6E B;  1B9R A;  1FNU A;  2FE8 A;  1KLG D;  2RDG A;  1D5Z C;  4RH6 A;  1HA5 A;  1C4A A;  1NEN B;  2INP E;  3E9S A;  3GP7 A;  3FAH A;  4DQO C;  1SEB D;  3ZYY X;  1JQ4 A;  4N59 A;  3NVZ A;  1NEK B;  3AEF B;  2AX5 A;  1J7A A;  1TYG B;  1A70 A;  4N6E B;  2PW9 A;  4ZRQ A;  2WXH A;  3OWE B;  5I4D A;  2BS3 B;  2ZW1 A;  2BTE A;  1L5P A;  4HRS A;  1L6U A;  4LLG M;  3BVZ A;  4A55 A;  2D5G A;  1CZP A;  1E9M A;  1HZ5 A;  4US9 A;  4ZYS A;  1YJJ A;  1K50 A;  1ZDV A;  1N61 A;  2MJD A;  3P4S B;  4OW0 A;  4AQ7 A;  1EU3 A;  1TY0 A;  2AQ1 B;  1MHX A;  2JWU A;  2LHD A;  2EKI A;  1TS3 A;  1ET6 A;  1FXI A;  3BVM A;  1UUP A;  1XXG A;  2LMC A;  4MAC A;  3IAS 1;  3FIL A;  3NVV A;  2WXL A;  1CQV A;  3DWM A;  4RGM A;  2QJL A;  2G1E A;  1JWB D;  1YN5 A;  3SR6 A;  4FXC A;  1GB1 A;  2X38 A;  2FBW B;  4NAM A;  2WXR A;  1V1P A;  1D4B A;  1EWY C;  1WYG A;  1SIJ A;  5EE0 A;  2VZK B;  1C78 A;  1ZPS A;  2PLP A;  3B2G A;  4A6Q A;  1PGB A;  1TS2 A;  2NTS A;  3P1M A;  5C3J B;  5EE3 A;  5HFY A;  1EU4 A;  3NS1 A;  4IOI E;  1ZOY B;  1D6E C;  3HVD A;  2LJI A;  3ABV B;  2LHE A;  3C8Y A;  1L6V A;  1V1O A;  4LTU A;  1FIQ A;  1QOG A;  2DYM A;  5EE9 A;  2IDY A;  4WAF A;  1XLO A;  3BK2 A;  4EE2 A;  3HUI A;  5E6J A;  4YSY B;  3Q8E A;  1FFU A;  4KKJ A;  3P4Q B;  2R61 A;  3VR8 B;  3W1S A;  4CQN A;  3AED B;  2FUG 1;  4P6V F;  1I4X A;  2IGG A;  1VJK A;  4YTN B;  3AE5 B;  3W2D A;  4REZ A;  1QIL A;  4NAW B;  2V0G A;  3AEE B;  2QIE B;  1PYW D;  3V3X A;  1FNW A;  1N5X A;  3EUB 2;  1SE4 A;  1OQR A;  4A9A A;  2BB5 A;  4OZC A;  1UWX A;  2VZK D;  2ZW0 A;  1L4Z B;  1BML C;  1SSN A;  4YWG G;  3MHZ A;  3RFZ B;  3EA6 A;  4WQM A;  2ON8 A;  1MPE A;  1GB4 A;  1ZXH A;  1L0X B;  3U2S C;  4A90 A;  3PO0 A;  1N63 A;  2WXO A;  1FCL A;  1XLQ A;  3AE2 B;  5HI1 A;  1E0Z A;  2WNM A;  3AEB B;  1N62 A;  2GB1 A;  3P63 A;  4KGR A;  3VQI A;  2BB6 A;  1OFF A;  5BYQ A;  1C4C A;  1XLN A;  2JZP A;  2RPV A;  2Y3A A;  5HHD G;  1KRH A;  3KWV A;  2MH7 A;  1ZUD 2;  3W5V B;  1DGJ A;  2NMQ A;  2WXJ A;  2DWQ A;  2PVO D;  1C79 A;  5FR3 A;  1VRA B;  4Q2J A;  3O13 A;  4RGO S;  4YTM B;  1YMH E;  2QSD A;  2RMM A;  1P7F A;  1RFK A;  1L0V B;  1NYQ A;  1V97 A;  2Y5P A;  4P16 A;  2N7J A;  2WU2 B;  1HEZ E;  1KTK A;  2BBC A;  2W3S A;  3AE1 B;  4HJG E;  4HRO A;  1TS5 A;  3KLS X;  2W55 A;  4NJC A;  2PTL A;  4OZA A;  3BYT B;  5LNK 1;  3CWI A;  4YSX B;  2G9H D;  1HXY D;  2JXT A;  4MT5 A;  2W54 A;  3SFE B;  2E6X A;  1QOA A;  4ARI A;  1SJE D;  1TY2 A;  5BMH A;  2NTT A;  2YEP F;  1XLP A;  1AYF A;  2CJO A;  1VZ6 A;  3WCQ A;  2XNA C;  3ETR A;  5BMG A;  4C56 C;  4D2K A;  2CU3 A;  1M4V A;  1MVK A;  2HDE A;  1ZE3 D;  1QOB A;  4JX1 C;  2KDM A;  3Q8C A;  4TSS A;  1AWD A;  3V05 A;  3SEB A;  4XWW A;  1NVI D;  3AV8 A;  1FO4 A;  2M0A A;  4MM3 B;  3TEX A;  1VLB A;  2WQY B;  3N9Y C;  4MH8 A;  1RYJ A;  3U7Z A;  1B1Z A;  3U4E G;  2JSV X;  2GI9 A;  3NVY A;  2KAC A;  2LGI A;  5T8I A;  1PDX A;  4TQ0 A;  2IPK D;  4RNA A;  2J4X A;  1YQ4 B;  1IUE A;  3TEW A;  4XWT A;  3AN1 A;  2JU6 X;  1F77 A;  1HQR D;  3GB1 A;  2K9X A;  1FCC C;  1ZDX A;  1PGA A;  3CIR B;  5C2T B;  3Q69 A;  1XO3 A;  2PVG C;  3ZQ4 A;  1ZP0 B;  1DYQ A;  4KKI A;  2JYE A;  3AEG B;  1FRD A;  1TS4 A;  2H89 B;  2KN4 A;  1SXT A;  3IT4 B;  1WRI A;  3AE3 B;  1KF6 B;  1FFV A;  3U52 E;  5D3D A;  4WH4 A;  2PIA A;  1PGX A;  1GAQ B;  4YSZ B;  3VRB B;  1K51 A;  1JRP A;  1E10 A;  1TZO A;  4M0W A;  1GOZ A;  4WWM A;  1QQR A;  2J42 A;  2J52 A;  2WS3 B;  3BK1 A;  1EM7 A;  2WXK A;  1JML A;  2V3N A;  4C7Y A;  2IGD A;  1PUT A;  1I7H A;  1SBB B;  1XCT L;  1XCQ L;  2L1A A;  1JWS D;  3I57 A;  2MEK A;  3AE7 B;  2MJE A;  4OZB A;  2KWD A;  5H92 C;  3AE6 B;  5TSS A;  2YEP B;  3P42 A;  3P4P B;  2QMT A;  5GXG B;  3VR9 B;  5BYS A;  2TSS A;  3BWU D;  1E7P B;  1SF0 A;  2WXM A;  2WDQ B;  5BYR A;  2L83 A;  1DOI A;  3HRD D;  4L1B A;  4B0E A;  3KWL A;  4IKG A;  2WP9 B;  2WXN A;  1IBX B;  5FKA C;  3RPF C;  2MJ3 A;  4YXD B;  5JXV A;  1UGJ A;  4L23 A;  5D7G A;  1T5X D;  4RCO A;  3PZ7 A;  3L4P A;  1T3Q A;  2AQ2 B;  3T3N A;  4ARC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...