1SSNA

Staphylokinase, sakstar variant, nmr, 20 structures
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
136
structure length
136
Chain Sequence
SSSFDKGKYKKGDDASYFEPTGPYLMVNVTGVDSKGNELLSPHYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOKINASE
publication title Nuclear magnetic resonance solution structure of the plasminogen-activator protein staphylokinase.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 16
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 1998-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02821 Staphylokinase Staphylokinase/Streptokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.130 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ssnA00
1C76A 1C77A 2SAKA 1BUIC 1C78A 1SSNA 1C79A
chains in the Genus database with same CATH superfamily
1KM7A 4NAWA 1KH0A 2IJ0A 4N9F4 1V9JA 1G6JA 3APCA 3ZYYX 5G2NA 1E10A 2D3GA 4IOIE 1WM2A 5FR6A 5EE9A 3NY5A 4G0NB 2KWUB 3AECB 4KSLC 1N60A 2QEJC 1RAXA 1V2YA 1C77A 3VHTC 1KLVA 1PGXA 1I4QA 2M1MA 2AQ1B 2OHFA 2BQQA 2Y5BB 2QMTA 1I42A 3ENEA 1T0YA 2J42A 3JYUA 4GGQA 4XDDA 2K9XA 3ZRFA 3MHSD 2TSSA 3APFA 3NHEB 1TYGB 1Q10A 2IGGA 2KVRA 4B9KA 2C7HA 2L7RA 4B0EA 3CIRB 1UGMA 3RULA 2X8XX 1FIQA 1TKYA 4ZHPA 2FCMA 2ONQA 3W9CB 2Q5WD 2G45B 2K5PA 4KV2A 1GAQB 1QQRA 4WJQA 2BF8B 2SEBD 3QARA 1JROA 3AI5A 3N30A 4LJOB 4YT0B 3UIOB 1UZXB 1WGGA 1R7SA 2BGFA 2QDFA 3P63A 1YN4A 2AQ2B 4KDLB 4IWQA 3WCQA 1UH6A 3KW5B 3AEEB 1VCBA 1YJJA 3X23A 2J0KA 1WXAA 2NBVB 1L4ZB 3M63B 3PLVA 2I2YA 2V3SA 4RFBA 5H92C 2LI5A 1I4XA 1C4PA 4WWOA 2J53A 1CMXB 1HXYD 3WA0A 2L05A 2AX5A 1V86A 1XQQA 2MRPA 2XNAC 4W9HA 2N7EA 2HJ8A 2KJRA 4ZRIA 4LTUA 4PT5A 1SXTA 3AE3B 1EU4A 1SE2A 4ICUA 4KKIA 3B2GA 3WIMA 1L7YA 3WAOA 2DENB 3K9PB 4CQNA 1JRUA 5D3DA 2Y5PA 3TEZA 1KLUD 3A9JA 1R4MI 1E8YA 1SE4A 3A4SC 3RNFC 4PS7A 4WH4A 3KWVA 3AE2B 5HG2A 1S1QB 4L2YA 2LHEA 1L5PA 3H9DA 4HWIB 2BW2A 3KQ4A 3PHWB 2CHWA 1QKZA 3AE6B 1UNSA 4ZDVA 2LJIA 3ZNZB 1YJIA 4IM3A 1QZEA 4EKUA 2WXRA 3ZXVA 4K3CA 3RD2A 3AEAB 3CSFA 4A6QA 3OJ3A 1XLPA 4K81A 1T5XD 5AZGA 2FIDA 3P4PB 1N63A 4GSWA 2RR9A 4W9GA 2N9XA 4GDLA 1AN8A 2DZJA 3BVZA 4IWOA 1WE6A 2MA9B 1TY2A 3W1SA 2JQRB 4RNAA 1C78A 3NZSA 1WMHB 2KKCA 3UGBB 1EF1A 2N7DA 2IZVB 2O2VB 1CK1A 3ZDMC 3W2DA 3BY4B 1LM8B 3DBRB 1TGZB 2I1JA 4C4VA 5C1ZA 1WMHA 1VRAB 4TMAB 3O13A 5D2MB 2O2VA 2J4XA 3AE4B 2WXMA 2LXAA 2D3CA 4MACA 5EE1A 4HKQA 2W3RA 2KZRA 3KVFB 1XF5L 3CMMB 4LDTB 2IYDB 1PUTA 3SR6A 2A5UA 1C4CA 4RGMA 4ZRKA 4ZYNA 4GXBA 1FRDA 1HZ5A 4M02A 5J17A 2W82A 3R66C 3HHMA 4C7ZA 3P4RB 5JHBA 4C7YA 2IPKD 2MBOA 1QF6A 3DDCB 4TKNA 1IYFA 4PS3A 2INCC 2G9HD 5IAAC 4KZ0A 4K1RB 2LGYA 2JXTA 1J7AA 4HPMB 4FJVB 4A55A 2BYEA 5BO4B 4G50A 1E7VA 2CKHB 2DAFA 2MBBB 2FIFA 4OZBA 5I4DA 2ZEQA 1QOAA 1WY8A 1YQ4B 3PZ8A 4BKTA 1MHHE 4IM0A 2FUG1 2K39A 3WANA 4EZLA 2MLBA 2Z8LA 4IUMB 2CS4A 1P98A 4US8A 4MGIE 3LDZE 5JZEB 2MEKA 4F8CB 1SF0A 2BYFA 3MJ5A 1T0QC 1D5ZC 4IWPA 4LNIA 4YSZB 4ZRQA 2M56B 2CJNA 3SHQA 4HJGE 2RDHA 4M8NA 3C0RB 3T3NA 3VFKA 1KLGD 3SD5A 2LGIA 3QK0A 2CR5A 1FXIA 3HIZA 2MHJA 3Q8FA 3GZNB 3OLMD 1YQ3B 4O1NA 2EKEC 3L17A 5BMGA 3HVZA 4QAYA 4TSSA 3RFZB 2BKRB 2QHOA 1RLFA 2AQ3B 2KTRB 1ZGUB 1WM3A 5AZFA 2IY1B 1VD2A 4FXCA 1AW7A 5D7GA 3N20C 1EM7A 1L0XB 1FCCC 2G4SA 4ITKA 3AV8A 2RPQA 1KFYB 2NTTA 2KTRA 2Z0DB 1ENFA 4BOZB 3EGRA 3AEBB 1XLNA 3RZWC 3RZFA 2JX5A 4N6EB 2M19A 1DYQA 3DBLB 3L13A 2BS2B 3P4SB 3L54A 1I4GA 2LFIA 4XYCA 3DBSA 4KIKB 2J7QB 3HRDD 3QHTA 1Q1OA 1E8XA 2UWQA 4DXAB 4OVZA 3ZJTA 5FKAC 3QX1A 2KX0A 3ZRCA 1WRIA 4HCPB 3Q8AA 4W9FA 3V60A 1YMHE 4A90A 3CSTA 4S17A 5LXHA 2K8BA 1MPEA 1FD6A 3TIXA 4GOCA 1WJNA 1K50A 2OOBB 1RRBA 4FBJB 2PLPA 2D5GA 2WDRB 1LGRA 1JALA 1LXDA 5TSSA 4FN2A 3ZTCA 1FO4A 2HTHA 3H7SA 3IXSA 4II2B 2JZZA 2SAKA 1C79A 1GJZA 2MP2B 1I4HA 5G5GA 3ZLZA 3W5VB 1WFYA 4B6WA 5L83A 1JQ4A 2KMCA 2NVUI 1IP9A 3B9JA 4ANUA 4HDOA 4XZ4A 4J3OD 1V97A 3BK2A 3U7DA 1V49A 5GMVA 4EE2A 1L2NA 3FKYA 3L16A 3EFCA 2LGDA 4RMAA 2NBWB 3ZIMA 3ZTDA 3VH4B 2HTME 5EE0A 2JPHA 2LEKA 3HK0A 3KLSX 3I57A 1WXSA 2WXHA 2WQYB 5HHDG 2LASA 4IC7B 3WAMA 2REXA 3TSSA 2FNJB 1ET9A 2JRIB 2D3BA 2V3NA 2L52A 1IBXB 4W9KA 3Q14C 2L32A 2FAZA 1FFVA 2RDGA 3ECIA 3M3JA 1WGHA 2V4IB 3EFUA 3QAQA 1J8CA 3URYA 2PE9A 1FCLA 4XWWA 2D2QA 4PYUA 4DDID 1IBXA 2KWDA 2NMQA 3R2IA 1GC6A 1N5XA 2BB5A 1R4MB 4DQOC 2V4LA 3P4QB 2LGSA 4B95A 1E8WA 1K52A 4AOFA 4P1BC 2HD5B 5DPRA 2C7MB 1F9JA 2J0JA 5H8YE 4USAA 3VXWA 4OZAA 1AWDA 2IBIB 3AU5A 4RGNA 1ISNA 1BMLC 3V6CB 2DHZA 3P42A 2HE7A 4TV3A 3BZDB 3H1UA 3ZNGC 3ZXRA 4WIPA 5HKHA 3MC9A 4X57B 4XWTA 1A70A 4JLCA 5E6PA 1JMLA 2Y3AA 3E9SA 4BAXA 2G3QB 1WRDB 2AYOB 3B2FA 5HI1A 2IO3B 4RGTA 1RWSA 4A8XC 2YEPF 4FLHA 2VZKB 1LFDA 3CWIA 3TUOA 1TY0A 3VR9B 3PREA 2WXQA 2KLGA 1TBEA 1V81A 1L0VB 4ASWC 1VR9A 4MJSB 2NPTB 5E6OA 3VTWA 2C60A 4IKGA 1V1PA 4IW0A 2LVOA 2FCQA 3WALA 3ZDTA 2KACA 4URKA 4MJSA 2NPTA 3BK1A 1F2RI 1EF5A 4DXGA 1JWUD 1B1ZA 4FHJA 1MVKA 2B3AA 3FILA 2KDEB 3A9KA 2AEHA 3EHVA 3TEXA 1TZ1A 2JZ3B 3PRMB 2L8JA 2JY6A 1E6EB 5G55A 2KQ7A 2VH2A 3Q8EA 1D4BA 1CJEA 4HK2A 3GP7A 1Q0WB 3A1QB 4I6PA 4RF0A 1NENB 4CO7A 1OQRA 4HXDA 3VH3B 3SFEB 2MSED 1TT5B 3APDA 3VR8B 4KGTA 3MTNB 1TTNA 4MDKE 2JYTA 4REZA 1TS4A 2KJ6A 3M95A 2PE6B 3A1QA 3T9LA 4MH8A 1C9FA 2JXXA 3I3TB 4WQOB 1M4VA 2LUEA 2DBYA 4RGOS 4WURA 1FMAD 1NYQA 4NY0A 1WJ4A 2RD0A 4C56C 1YNTE 4LK0M 2N9LA 3ZUNA 4TQ1A 2ON8A 3HM6X 2DAJA 4IG7B 4ANVA 3VTUA 3A9JB 3QA8A 1UELA 1HTOA 4OW0A 3BIID 1ZOYB 3DCGA 3NJTA 2IO1B 2L0FA 4AWJA 4MSMB 3R7QA 2BS3B 3BYYB 4MT5A 4NJCA 2FCSA 4RF1A 2DZIA 2D3AA 1P0RA 4W9CA 3ETRA 3BWUD 2QCZA 1D6EC 1X1MA 3ZW3A 2GB1A 1SJED 4XX5A 2V1YA 3D32A 2R61A 4C80A 2KD0A 2FUHB 2IY0B 4JX1C 2ZVOA 1QT9A 3RNEC 2C5LC 3TL5A 4EFOA 3Q3JA 3HVDA 5D3IB 3T8MA 1UGJA 3N32A 4GDLB 2AWTA 3DBHI 2OJWA 5D94A 4DHJD 3LYYA 3U8ZA 3IT6B 1GNUA 4ARCA 5IOIA 1EUVB 3TEYA 2RGFA 4YTPB 2WDTB 3NVVA 2BWFA 2FE8A 4JIOU 2PVOD 1V1OA 2WXFA 1OTRB 5T8IA 3SDLC 3IAS1 1XCQL 4C4VB 4LNKA 1PYWD 4US9A 5C3JB 2D10A 4FHKA 3IT4B 1WR6E 4HEA1 2ZNVB 3W1SC 2R2QA 2N9KA 5GXGB 3RN9C 5FK9C 1IUEA 2D07B 1P7FA 2JT4B 2WLBA 1V80A 3PRPB 1SIJA 2MBEA 3AU4A 3U7ZA 2N1WA 4YTNB 5MPOA 3RCZA 1WX8A 1FXAA 4LJPB 1WZ0A 5IN7A 3JSVA 1SE9A 5IKCM 2KXJA 2MJEA 2K8CA 2DZKA 4MSQB 3NVZA 4XDCA 5D6JB 2GOWA 1WH3A 3JVZX 4B0MA 2BKFA 1Y56A 4WJNA 3U2SC 2V0GA 2K6DB 3L10B 2K1FA 3R3MA 1WYGA 2LVQA 4N59A 1XLQA 2NTSA 2KO3A 4DHJB 1UWMA 1HQRD 2GBJA 4IDIA 3OJ4B 4NAMA 4W9JA 3E56A 2IGDA 1VZ6A 4GMVA 3GE8C 1YOVB 1GB4A 1IPGA 2MX2A 4GN1A 2M4NA 1L0YB 4KZCA 2CJOA 1ESFA 3MP9A 4W9EA 3DOWA 1HE8A 2QIEB 3PLUA 1FFUA 4HRSA 3V6EB 2PEAA 2LD9A 1C1YB 4KGSA 3MJWA 1N5WA 1XT9B 4FULA 5CHWA 2PPHA 2MJDA 1YJ1A 1S3SG 4TUUA 3AEGB 4LLGM 1OQYA 5HFYA 3NZ3A 1D5MC 4HROA 5AUKA 2JVCA 3PSEB 4M8MA 1UBIA 1IGDA 3RNAC 3Q69A 1MFWA 1ZE3D 4G3XB 1JWSD 1GOZA 2FBWB 2WS3B 3DQVA 2GBKA 4ZRJA 2BYTA 3AE5B 5BMIA 3B0AA 4HLEA 2KFKB 3P1MA 1EU3A 1D3ZA 2ZW1A 1N62A 3N1ZC 4HVBA 1C3TA 4MH0E 2X38A 1OQQA 2KFKA 3VAWA 4R3DA 1WWTA 4G11A 4YL8A 2WX1A 3KUDB 1VZ7A 3VUWA 4KGRA 3PV1A 3IHPC 3QCAA 5KHOA 1KJTA 5J18A 3PRZA 2L76A 3KYCD 1JW9D 3HUIA 3GOEA 2GMIC 3RI7C 2KMMA 3WAPA 2QJLA 2K3UA 1N61A 1WE7A 4XE0A 3DHHC 3Q6BA 3UINB 2JSVX 1DGJA 2KYWA 4KVGB 1DOYA 1WGYA 2ZVNA 1YN3A 4NJ6A 2IO2B 1TZOA 1WI0A 3ZQ4A 2OEDA 3DPDA 4YSXB 5DPTA 2BPSA 1MG4A 3EA6A 2M17A 3B08A 4KKJA 5BYRA 4WJOA 1J0GA 4K7WA 2MW5A 3L4PA 4WWPA 2BYVE 1FEHA 3ML9A 1T0SC 1RYJA 3U52E 1E9MA 4FJYA 4KX6B 1WJ6A 1V8CA 3L08A 2GI9A 1SJHD 2WXJA 3SU8X 2KVZA 2WXGA 4Q2JA 4RCOA 1P7EA 4FA6A 2DX5B 4LNFA 2KQSA 2PVGC 1TKEA 1U4AA 1ZXIA 2I1KA 5LXIB 1QLBB 3N1XC 3ZNID 1E7UA 1TS2A 2R2OA 5FR3A 1Y8RC 2KDIA 2KN5A 1WZ3A 1VDVA 3CF6E 3NVWA 1RFAA 1OGWA 2KMAA 3I9V1 1WR1A 1XLOA 2K25A 2LWPA 2J52A 1YIWA 4HPPA 1YQBA 3N1YC 2L0TA 2L83A 2LRUA 2KC1A 2DZMA 3AM9A 3MC8A 2DYBA 2M0XA 2C7NB 3SEBA 1SBBB 2HJ1A 1E0ZA 2AL3A 3QJZA 1KOTA 3U30A 1JWAD 3KUCB 2BT6A 3ZKJC 1EO6A 3QIJA 1GG3A 5EDSA 2LZ6A 4ANWA 2MCNB 2A4ZA 2N1VA 2WXNA 2RDBC 3PTFC 2LUMA 2WXPA 3ZJUA 2PKOA 1WIAA 2JF5A 3RUIB 4FJZA 1UUPA 5JHAA 4MGZE 2KK8A 3Q3MC 3C19A 1F77A 4NZLB 3OWEB 2XK5B 1HA5A 2L00B 2MJ3A 5KHQA 5LLIA 5J2RA 2KDMA 1K51A 3ZGZA 3NS1A 2ZZPB 1T6BX 4N58A 2XK5A 3KH0A 1E7PB 3IBEA 1E90A 1NVID 1MG8A 4HDQA 3PT2B 4MGYE 1PDXA 2N7JA 3VRAB 5CHFA 1E5WA 1V1PB 3DVGY 4L23A 5DPWA 5IO9A 3QC8B 4TQ0A 4P1CC 1WGKA 2KTFA 4P16A 4IM2A 1NI3A 2EKIA 2DWQA 3J9CA 1V5TA 3DBLI 4UDUC 3DWGC 3FILB 1I7HA 5C23A 3A9KB 2PJHA 4LCDE 3V3XA 1NDDA 1XO3A 2DNFA 1QOGA 3SFDB 1L6UA 2EMSA 2L1AA 2N4FA 5DCNA 4BKSD 2MWSB 5E6JA 1A5RA 1F0ZA 3ALBA 5E6NA 2K0PA 3ZVVA 1V5OA 1XEEA 1ZP0B 2PMVA 3DHIC 2NCNA 1EWYC 4WWNA 1AARA 1OEYJ 4PS8A 3V61A 1FNVA 3AE9B 2W3SA 3Q3FA 1WXVA 3IG3A 3GS2A 4A3OA 1OEYA 4EZKA 2N0SB 2ZPNA 2KX3A 4E71A 2PTLA 1IGCA 2RPVA 5TR5A 1TJEA 2WU5B 3PS6A 3RMKC 1GC7A 1WSPA 2KQ4X 3Q3OC 3DVGX 3PVLA 4K7UA 1WX9A 4AP4C 3A33B 3TBLD 1C4AA 3ZO5B 5BYQA 2KN4A 1WJUA 1UWXA 4BFRA 1ZDXA 2WU2B 2GBMA 2IO0B 5CHVC 1GPXA 2N9EB 3UQAA 4M0WB 2K22A 2L3ZA 2JWZA 1JCKB 4CHKA 3UQBA 4W9IA 2DLBA 1QILA 1PGBA 1R4NI 2EELA 2XN9C 2BS4B 2YLMA 4M0WA 3Q8BA 5AEKB 2KDBA 1WXQA 1I4PA 1NEKB 4HKZE 3LJ3A 2JZPA 1TS3A 3UIPB 4MELA 3TJPA 2IGHA 2BBCA 4ZOHC 3VUXA 1ZDVA 3MFGA 3FAHA 1P1AA 3B1LX 4YTMB 2EMTA 1RFKA 1AYFA 3P2BA 3NOBA 2V3PA 2E6XA 3AMZA 1QOBA 3AE7B 1J7BA 1KTKA 3AH7A 2KT7A 1UD7A 1N6ZA 2H89B 1LO5D 4XC2A 4BKSA 1FNWA 1K8RB 1FXTB 1H4RA 2GBNA 3S2AA 2H88B 3IVFA 2ASQA 4C00A 4W9DA 4LDTD 4KDIC 4HCNB 1ZUD2 2KAJA 4K3BA 2GRIA 1H8CA 4AJYB 3AE8B 1SE3A 2Y5CA 4DHZE 1OFFA 2KANA 2B76B 2FCNA 2CU3A 4WQMA 2JWUA 2WXLA 3NRZA 1SB3C 1DOXA 2LJ5A 1TS5A 5CTRC 4ANXA 3BYTB 3KWLA 1EWCA 4HJKA 1NI2A 2WX0A 3FC4A 5LNK1 4P6VF 2Z0EB 1YX5B 3JSVB 2KHWB 2C9WB 2ZJDA 2VH1A 1JRPA 2KC2A 2W9NA 2WXOA 2WYQA 1NYRA 1HZ6A 2CU1A 3TMPB 4NQLB 3X0WA 2KNBA 1SEBD 4BOSC 2CHXA 4ZRPA 2ZNVC 5AZHA 1VLBA 2ZW0A 1ZPSA 2G4DB 2WXIA 3AE1B 3DWMA 3AN1A 2BTEA 5AUIA 4GLSC 2JYEA 1Z5SB 1ET6A 2WWZA 4A3PA 2JRHA 3VRBB 1RM6C 3UF8A 4MEMA 2QILA 3EECA 1TIFA 4EEWA 3PGEA 2V9HA 2LHDA 3EUB2 4KSKC 1ZKHA 3AEFB 3MC0B 1LQBA 2KWVB 2LMCA 1UBQA 3U4EG 5C2TB 4YWGG 3ZJVA 2QSDA 4I6LB 5CX3A 1GB1A 2IDYA 4F1SA 4M01A 1TKGA 4GIVA 2GBRA 2G1EA 2HDEA 2WGSA 3W1YA 2N9PC 4DK5A 2W54A 3L0WB 3BVGA 2E3TA 2INNE 4L1BA 3VQIA 2MQJA 4DXFA 2LRWA 1SIFA 1GUAB 2JUOA 4II3B 4NNJB 1MI0A 4A20A 2K6QA 2VRRB 3LB8C 4J6IA 1WF9A 2KOXA 1MHXA 4I6NB 3C8YA 1T0RC 1SGHA 1BXTA 3EC8A 1P9DU 3Q8CA 4LNOA 1T3QA 3Q3NC 2XEWA 3RNCC 2QC8A 4JGHB 4NPNA 3AEDB 4BZAA 5IP4D 1F52A 5EE3A 4YSYB 1ROEA 1XD3B 4RM9A 3R7RA 2KLCA 3M62B 1ACCA 1STEA 2KDFB 3TCAA 2UU7A 4RH6A 1WXMA 4HPLB 2M8SA 5L95C 3AB5A 4PK1A 3OAWA 3MHZA 1VZ8A 4EUTA 3RNBC 3PZ7A 3H8HA 2BVCA 3DVNV 2OJRA 1SSNA 3H6NA 1M94A 4WWMA 1VJKA 1UF0A 4ICVA 3NG0A 4WAAA 5G5HA 3V05A 2PIAA 1L6VA 3RNGC 1YN5A 1FPYA 1Q5WB 2DYMA 2YVCA 5BYSA 3R2TA 3GB1A 2WDVB 4BVUC 4XGAB 4EZJA 2ZCCA 4F7ZA 5IA7A 1B9RA 3OG5A 4LNNA 1HTQA 1FNUA 1FM0D 3BINA 2YEPB 4E74A 1I35A 2M0AA 1CQVA 2O6VD 2PW9A 3O65B 4ACFA 1KRHA 2K8HA 2WXKA 1ZW7A 3RYTA 4P7IA 4BBNC 1J19A 3N9YC 3IFWB 4BKGA 4GU2A 1DOIA 3LXFA 4JWSC 4KIKA 3VUYA 1BT0A 3PPAA 2NBUA 3NS8A 4ARIA 4OVUA 2Z59B 3QWZB 1Z2MA 1WX7A 4OZCA 1NBFC 3PZDA 1CZPA 2GLSA 3AULA 5JH5C 4WJPA 1F2RC 4S0RA 4NJ7A 2INPE 3A4RA 3VTVA 2LGXA 4K7SA 3AXCA 4ZYSA 3I63C 2LVPA 3DVNU 2J0MA 3DBRI 2CHZA 3BVMA 3Q2AC 3ZNHB 1ZXHA 3V62A 4A9AA 3IAM1 4NQKE 2WNMA 2XBBC 2ZPYA 3PO0A 4E3CA 2MP2A 3ML8A 3KYDD 4GDKB 1K53A 3QQ8B 4JWUC 4AQ7A 2WHIA 4MM3B 3W5UB 4WAFA 2KWCA 4PYZA 1L4DB 3NZUA 1F1HA 3VVWB 1R4NB 3ABVB 2JU6X 4AUQC 1JWBD 1P3QU 3DHGC 4GDKA 2RMMA 2ICIA 3NVYA 3GE3C 1KF6B 3H7PB 1E8ZA 4MGKE 3KUZA 4JL9A 4MM3A 1C76A 2BWES 2O6VB 2WDQB 2MBQA 2MBHA 3PHXB 2ACZB 1J7CA 3TEWA 2LXCA 2RSUA 4W9LA 1BUIC 4GB9A 4JPSA 1FRRA 3ONSA 2VZKD 2D11A 5DPSA 3I5JC 5BMHA 4DDGD 3H7PA 3NUHB 2O6VA 3K9OB 2ZCBA 3RPFC 2UYZB 1QOFA 3R8BA 4AJWA 4DWFA 1PGAA 4CYEA 4H2AA 4ZHOA 3HM3A 2DYOA 3DBHB 2INDC 4RM8A 4JE3B 4AS1A 1WYWB 2AL6A 1XXGA 2NR2A 4FADA 4JQWC 3GZNI 4DHZB 1PQSA 4EOYA 1WGRA 2BB6A 1HEZE 1YD8U 4OVVA 4YXDB 1YX6B 1D5XC 1I4RA 1WGDA 1PFDA 2KJHB 2I38A 4DBGA 4OHJA 1JWMD 4NAWB 1V6EA 4M00A 2W55A 1MJDA 2NS5A 1XCTL 3VDZA 4D2KA 3UI3A 3T3OA 3RT3B 2KFJA 4BBNF 2MH7A 3N3KB 3JW0X 5JXVA 2WP9B
chains in the Genus database with same CATH topology
1ESFA 3B9JA 3MP9A 1KH0A 2IJ0A 4J3OD 1V97A 2H88B 2QIEB 3BK2A 1FFUA 3ZYYX 4HRSA 1E10A 4IOIE 4EE2A 1ZUD2 2KAJA 4KGSA 1N5WA 2GRIA 5EE9A 3AECB 1N60A 2MJDA 3AE8B 2QEJC 1SE3A 2Y5CA 2HTME 3AEGB 1OFFA 5EE0A 4LLGM 1C77A 2B76B 2CU3A 4WQMA 2LEKA 3KLSX 1PGXA 3I57A 1I4QA 3NZ3A 1D5MC 2AQ1B 4HROA 5HFYA 2JWUA 2WXLA 5AUKA 3NRZA 2WXHA 2WQYB 1IGDA 1SB3C 2OHFA 5HHDG 1FNWA 1DOXA 3Q69A 2QMTA 1ZE3D 1JWSD 1GOZA 1TS5A 2FBWB 2J42A 2WS3B 4XDDA 3BYTB 3TSSA 3KWLA 1ET9A 2K9XA 1EWCA 2BYTA 2V3NA 3AE5B 5BMIA 2L52A 1IBXB 2L32A 3P1MA 2TSSA 1EU3A 3FC4A 1TYGB 5LNK1 4P6VF 1Q10A 2IGGA 1FFVA 2RDGA 2ZW1A 1N62A 4B0EA 3CIRB 2V4IB 1JRPA 1FIQA 1TKYA 4ZHPA 2X38A 3URYA 2ONQA 2WXOA 1FCLA 4XWWA 1NYRA 3W9CB 1HZ6A 2Q5WD 2K5PA 1IBXA 1GAQB 1OQQA 2KWDA 1QQRA 2NMQA 2SEBD 3R2IA 1SEBD 1JROA 1N5XA 4R3DA 2BB5A 1WWTA 4ZRPA 4YT0B 4DQOC 1VLBA 2ZW0A 1R7SA 1ZPSA 1VZ7A 4KGRA 2WXIA 3AE1B 1YN4A 3P63A 3P4QB 3DWMA 3AN1A 2AQ2B 3WCQA 2BTEA 1K52A 3AEEB 4GLSC 5AUIA 2JYEA 1YJJA 1ET6A 5H8YE 3VRBB 1RM6C 4USAA 4OZAA 2QILA 1L4ZB 1JW9D 2I2YA 3HUIA 1AWDA 2LHDA 3EUB2 4RFBA 5H92C 4RGNA 3AEFB 1I4XA 2KMMA 3MC0B 1C4PA 2QJLA 2LMCA 1BMLC 2K3UA 3U4EG 2J53A 3P42A 1N61A 1HXYD 4XE0A 2JSVX 2AX5A 5C2TB 3BZDB 1DGJA 2XNAC 4YWGG 3ZJVA 1DOYA 2QSDA 1YN3A 4LTUA 1GB1A 4WIPA 1TZOA 2IDYA 4PT5A 1TKGA 1SXTA 3AE3B 1EU4A 1SE2A 3ZQ4A 4KKIA 3B2GA 2OEDA 4YSXB 2G1EA 2HDEA 4XWTA 1A70A 1JMLA 2Y3AA 3E9SA 4CQNA 3EA6A 4KKJA 5BYRA 2W54A 3L4PA 3BVGA 2E3TA 2INNE 4L1BA 3B2FA 5D3DA 2Y5PA 3VQIA 5HI1A 4RGTA 1RWSA 1FEHA 3TEZA 1KLUD 4A8XC 1RYJA 2YEPF 3U52E 1E9MA 2VZKB 3CWIA 3TUOA 4DXFA 4KX6B 1TY0A 1SE4A 1V8CA 3VR9B 4WH4A 2WXQA 3KWVA 3AE2B 2GI9A 5HG2A 4L2YA 1L0VB 1SJHD 1L5PA 2LHEA 1VR9A 2WXJA 2BW2A 3KQ4A 1MI0A 2WXGA 4Q2JA 4RCOA 1QKZA 1P7EA 3LB8C 3AE6B 4IKGA 1UNSA 2LJIA 1V1PA 1MHXA 1YJIA 2PVGC 3C8YA 1TKEA 1BXTA 1ZXIA 2WXRA 3Q8CA 1QLBB 1TS2A 1T3QA 5FR3A 3AEAB 2KACA 3BK1A 3AEDB 4A6QA 1F2RI 5EE3A 1XLPA 4DXGA 1JWUD 1VDVA 1B1ZA 3NVWA 1T5XD 4YSYB 1MVKA 1ROEA 3P4PB 3I9V1 1ACCA 3FILA 1N63A 1XLOA 1STEA 1AN8A 4RH6A 2J52A 3TEXA 3BVZA 1TY2A 3AB5A 3W1SA 2JQRB 4RNAA 1C78A 1E6EB 3MHZA 1VZ8A 2L83A 3PZ7A 3H8HA 3AM9A 1SSNA 3Q8EA 3SEBA 1SBBB 4WWMA 1VJKA 1D4BA 1CK1A 1E0ZA 1CJEA 3W2DA 3GP7A 1JWAD 4RF0A 1NENB 5G5HA 3V05A 2PIAA 2BT6A 1L6VA 1OQRA 1YN5A 3SFEB 1VRAB 2DYMA 3VR8B 2WXNA 4KGTA 4TMAB 5BYSA 3R2TA 3GB1A 3O13A 2WDVB 2LUMA 2JYTA 2WXPA 4REZA 1TS4A 3ZJUA 2PKOA 2J4XA 3AE4B 2WXMA 1B9RA 4MACA 5EE1A 4HKQA 2W3RA 4MH8A 1UUPA 1FNUA 1FM0D 1C9FA 1XF5L 2YEPB 1PUTA 3SR6A 1C4CA 1F77A 4RGMA 1M4VA 2M0AA 1FRDA 1HZ5A 1CQVA 4NZLB 2PW9A 3OWEB 2DBYA 4RGOS 2W82A 1FMAD 1HA5A 1KRHA 1NYQA 2WXKA 4WURA 4C7ZA 2MJ3A 4C56C 1YNTE 3P4RB 4LK0M 4C7YA 2IPKD 2N9LA 1QF6A 4TQ1A 3N9YC 2KDMA 2ON8A 1K51A 3ZGZA 2G9HD 1DOIA 3LXFA 4JWSC 3NS1A 2JXTA 1J7AA 3BIID 4OW0A 1ZOYB 4ARIA 4A55A 1T6BX 4N58A 4OZCA 2BS3B 1E7PB 1CZPA 3BYYB 1NVID 4MT5A 4OZBA 5I4DA 1F2RC 1QOAA 1PDXA 2N7JA 4NJCA 4RF1A 1YQ4B 3VRAB 3PZ8A 2INPE 1MHHE 1V1PB 2FUG1 4ZYSA 3ETRA 4L23A 3BWUD 2Z8LA 4TQ0A 1WGKA 1D6EC 4US8A 4P16A 2MEKA 2GB1A 1NI3A 1SF0A 1SJED 2DWQA 2EKIA 3J9CA 2R61A 4C80A 3MJ5A 1D5ZC 3BVMA 1ZXHA 4A9AA 4JX1C 3IAM1 2WNMA 4YSZB 1QT9A 4ZRQA 2M56B 2CJNA 4UDUC 3DWGC 4HJGE 3FILB 3HVDA 5D3IB 1UGJA 2RDHA 1I7HA 3PO0A 3T3NA 4GDLB 3V3XA 1KLGD 1XO3A 1QOGA 2LGIA 4GDKB 3LYYA 1K53A 3SFDB 1FXIA 3IT6B 4JWUC 1L6UA 4ARCA 4AQ7A 3Q8FA 4MM3B 3TEYA 3W5UB 2L1AA 1YQ3B 4WAFA 5E6JA 1F0ZA 1L4DB 4O1NA 4YTPB 2K0PA 3NVVA 3ABVB 2FE8A 2JU6X 1XEEA 5BMGA 3HVZA 2PVOD 1JWBD 4TSSA 3RFZB 1ZP0B 1V1OA 2PMVA 2WXFA 1EWYC 2RMMA 5T8IA 2AQ3B 2ICIA 3NVYA 1KF6B 3IAS1 1XCQL 1FNVA 1PYWD 1C76A 3AE9B 2W3SA 4US9A 5C3JB 3GS2A 4FXCA 1AW7A 5D7GA 2WDQB 3IT4B 4HEA1 2N0SB 2ACZB 1J7CA 1EM7A 2N9KA 3TEWA 5GXGB 5FK9C 1L0XB 2PTLA 1IGCA 1BUIC 1FCCC 4JPSA 1IUEA 2RPVA 1FRRA 2VZKD 1TJEA 4ITKA 3AV8A 1P7FA 1KFYB 2WU5B 5BMHA 2NTTA 2WLBA 1ENFA 3NUHB 1WSPA 2KQ4X 1SIJA 3EGRA 3AEBB 1XLNA 3U7ZA 3RPFC 2JX5A 4YTNB 1QOFA 2M19A 4N6EB 3R8BA 1DYQA 5MPOA 1PGAA 1C4AA 1FXAA 5BYQA 2KN4A 1UWXA 2BS2B 3P4SB 1I4GA 4H2AA 4ZHOA 1ZDXA 2LFIA 2WU2B 2MJEA 2DYOA 3HRDD 1GPXA 4JE3B 3NVZA 4AS1A 4XDCA 4OVZA 2K22A 3ZJTA 5FKAC 4B0MA 1XXGA 1JCKB 1Y56A 1WRIA 3U2SC 2V0GA 3Q8AA 2DLBA 1YMHE 4A90A 1QILA 1PGBA 2EELA 2BB6A 1HEZE 1WYGA 2XN9C 4N59A 1MPEA 1FD6A 1XLQA 2BS4B 2NTSA 4M0WA 4YXDB 3Q8BA 1WXQA 1D5XC 1I4PA 1NEKB 1UWMA 1HQRD 4HKZE 1K50A 1I4RA 2JZPA 2PLPA 1PFDA 2D5GA 1TS3A 2I38A 4IDIA 2WDRB 2IGHA 2BBCA 4ZOHC 1JALA 1ZDVA 3MFGA 4OHJA 3FAHA 5TSSA 4NAMA 1JWMD 4NAWB 3E56A 4YTMB 1FO4A 1RFKA 1AYFA 2IGDA 2W55A 1VZ6A 2V3PA 3IXSA 1XCTL 2E6XA 4D2KA 3AMZA 3UI3A 1QOBA 2SAKA 3AE7B 3T3OA 1C79A 1J7BA 1KTKA 1GB4A 1I4HA 3AH7A 5G5GA 2MH7A 3W5VB 1L0YB 2H89B 5JXVA 1JQ4A 2WP9B 1LO5D 2CJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C76 A;  1C77 A;  2SAK A;  1BUI C;  1C78 A;  1SSN A;  1C79 A; 
#chains in the Genus database with same CATH topology
 1KM7 A;  4NAW A;  1KH0 A;  2IJ0 A;  4N9F 4;  1V9J A;  1G6J A;  3APC A;  3ZYY X;  5G2N A;  1E10 A;  2D3G A;  4IOI E;  1WM2 A;  5FR6 A;  5EE9 A;  3NY5 A;  4G0N B;  2KWU B;  3AEC B;  4KSL C;  1N60 A;  2QEJ C;  1RAX A;  1V2Y A;  1C77 A;  3VHT C;  1KLV A;  1PGX A;  1I4Q A;  2M1M A;  2AQ1 B;  2OHF A;  2BQQ A;  2Y5B B;  2QMT A;  1I42 A;  3ENE A;  1T0Y A;  2J42 A;  3JYU A;  4GGQ A;  4XDD A;  2K9X A;  3ZRF A;  3MHS D;  2TSS A;  3APF A;  3NHE B;  1TYG B;  1Q10 A;  2IGG A;  2KVR A;  4B9K A;  2C7H A;  2L7R A;  4B0E A;  3CIR B;  1UGM A;  3RUL A;  2X8X X;  1FIQ A;  1TKY A;  4ZHP A;  2FCM A;  2ONQ A;  3W9C B;  2Q5W D;  2G45 B;  2K5P A;  4KV2 A;  1GAQ B;  1QQR A;  4WJQ A;  2BF8 B;  2SEB D;  3QAR A;  1JRO A;  3AI5 A;  3N30 A;  4LJO B;  4YT0 B;  3UIO B;  1UZX B;  1WGG A;  1R7S A;  2BGF A;  2QDF A;  3P63 A;  1YN4 A;  2AQ2 B;  4KDL B;  4IWQ A;  3WCQ A;  1UH6 A;  3KW5 B;  3AEE B;  1VCB A;  1YJJ A;  3X23 A;  2J0K A;  1WXA A;  2NBV B;  1L4Z B;  3M63 B;  3PLV A;  2I2Y A;  2V3S A;  4RFB A;  5H92 C;  2LI5 A;  1I4X A;  1C4P A;  4WWO A;  2J53 A;  1CMX B;  1HXY D;  3WA0 A;  2L05 A;  2AX5 A;  1V86 A;  1XQQ A;  2MRP A;  2XNA C;  4W9H A;  2N7E A;  2HJ8 A;  2KJR A;  4ZRI A;  4LTU A;  4PT5 A;  1SXT A;  3AE3 B;  1EU4 A;  1SE2 A;  4ICU A;  4KKI A;  3B2G A;  3WIM A;  1L7Y A;  3WAO A;  2DEN B;  3K9P B;  4CQN A;  1JRU A;  5D3D A;  2Y5P A;  3TEZ A;  1KLU D;  3A9J A;  1R4M I;  1E8Y A;  1SE4 A;  3A4S C;  3RNF C;  4PS7 A;  4WH4 A;  3KWV A;  3AE2 B;  5HG2 A;  1S1Q B;  4L2Y A;  2LHE A;  1L5P A;  3H9D A;  4HWI B;  2BW2 A;  3KQ4 A;  3PHW B;  2CHW A;  1QKZ A;  3AE6 B;  1UNS A;  4ZDV A;  2LJI A;  3ZNZ B;  1YJI A;  4IM3 A;  1QZE A;  4EKU A;  2WXR A;  3ZXV A;  4K3C A;  3RD2 A;  3AEA B;  3CSF A;  4A6Q A;  3OJ3 A;  1XLP A;  4K81 A;  1T5X D;  5AZG A;  2FID A;  3P4P B;  1N63 A;  4GSW A;  2RR9 A;  4W9G A;  2N9X A;  4GDL A;  1AN8 A;  2DZJ A;  3BVZ A;  4IWO A;  1WE6 A;  2MA9 B;  1TY2 A;  3W1S A;  2JQR B;  4RNA A;  1C78 A;  3NZS A;  1WMH B;  2KKC A;  3UGB B;  1EF1 A;  2N7D A;  2IZV B;  2O2V B;  1CK1 A;  3ZDM C;  3W2D A;  3BY4 B;  1LM8 B;  3DBR B;  1TGZ B;  2I1J A;  4C4V A;  5C1Z A;  1WMH A;  1VRA B;  4TMA B;  3O13 A;  5D2M B;  2O2V A;  2J4X A;  3AE4 B;  2WXM A;  2LXA A;  2D3C A;  4MAC A;  5EE1 A;  4HKQ A;  2W3R A;  2KZR A;  3KVF B;  1XF5 L;  3CMM B;  4LDT B;  2IYD B;  1PUT A;  3SR6 A;  2A5U A;  1C4C A;  4RGM A;  4ZRK A;  4ZYN A;  4GXB A;  1FRD A;  1HZ5 A;  4M02 A;  5J17 A;  2W82 A;  3R66 C;  3HHM A;  4C7Z A;  3P4R B;  5JHB A;  4C7Y A;  2IPK D;  2MBO A;  1QF6 A;  3DDC B;  4TKN A;  1IYF A;  4PS3 A;  2INC C;  2G9H D;  5IAA C;  4KZ0 A;  4K1R B;  2LGY A;  2JXT A;  1J7A A;  4HPM B;  4FJV B;  4A55 A;  2BYE A;  5BO4 B;  4G50 A;  1E7V A;  2CKH B;  2DAF A;  2MBB B;  2FIF A;  4OZB A;  5I4D A;  2ZEQ A;  1QOA A;  1WY8 A;  1YQ4 B;  3PZ8 A;  4BKT A;  1MHH E;  4IM0 A;  2FUG 1;  2K39 A;  3WAN A;  4EZL A;  2MLB A;  2Z8L A;  4IUM B;  2CS4 A;  1P98 A;  4US8 A;  4MGI E;  3LDZ E;  5JZE B;  2MEK A;  4F8C B;  1SF0 A;  2BYF A;  3MJ5 A;  1T0Q C;  1D5Z C;  4IWP A;  4LNI A;  4YSZ B;  4ZRQ A;  2M56 B;  2CJN A;  3SHQ A;  4HJG E;  2RDH A;  4M8N A;  3C0R B;  3T3N A;  3VFK A;  1KLG D;  3SD5 A;  2LGI A;  3QK0 A;  2CR5 A;  1FXI A;  3HIZ A;  2MHJ A;  3Q8F A;  3GZN B;  3OLM D;  1YQ3 B;  4O1N A;  2EKE C;  3L17 A;  5BMG A;  3HVZ A;  4QAY A;  4TSS A;  3RFZ B;  2BKR B;  2QHO A;  1RLF A;  2AQ3 B;  2KTR B;  1ZGU B;  1WM3 A;  5AZF A;  2IY1 B;  1VD2 A;  4FXC A;  1AW7 A;  5D7G A;  3N20 C;  1EM7 A;  1L0X B;  1FCC C;  2G4S A;  4ITK A;  3AV8 A;  2RPQ A;  1KFY B;  2NTT A;  2KTR A;  2Z0D B;  1ENF A;  4BOZ B;  3EGR A;  3AEB B;  1XLN A;  3RZW C;  3RZF A;  2JX5 A;  4N6E B;  2M19 A;  1DYQ A;  3DBL B;  3L13 A;  2BS2 B;  3P4S B;  3L54 A;  1I4G A;  2LFI A;  4XYC A;  3DBS A;  4KIK B;  2J7Q B;  3HRD D;  3QHT A;  1Q1O A;  1E8X A;  2UWQ A;  4DXA B;  4OVZ A;  3ZJT A;  5FKA C;  3QX1 A;  2KX0 A;  3ZRC A;  1WRI A;  4HCP B;  3Q8A A;  4W9F A;  3V60 A;  1YMH E;  4A90 A;  3CST A;  4S17 A;  5LXH A;  2K8B A;  1MPE A;  1FD6 A;  3TIX A;  4GOC A;  1WJN A;  1K50 A;  2OOB B;  1RRB A;  4FBJ B;  2PLP A;  2D5G A;  2WDR B;  1LGR A;  1JAL A;  1LXD A;  5TSS A;  4FN2 A;  3ZTC A;  1FO4 A;  2HTH A;  3H7S A;  3IXS A;  4II2 B;  2JZZ A;  2SAK A;  1C79 A;  1GJZ A;  2MP2 B;  1I4H A;  5G5G A;  3ZLZ A;  3W5V B;  1WFY A;  4B6W A;  5L83 A;  1JQ4 A;  2KMC A;  2NVU I;  1IP9 A;  3B9J A;  4ANU A;  4HDO A;  4XZ4 A;  4J3O D;  1V97 A;  3BK2 A;  3U7D A;  1V49 A;  5GMV A;  4EE2 A;  1L2N A;  3FKY A;  3L16 A;  3EFC A;  2LGD A;  4RMA A;  2NBW B;  3ZIM A;  3ZTD A;  3VH4 B;  2HTM E;  5EE0 A;  2JPH A;  2LEK A;  3HK0 A;  3KLS X;  3I57 A;  1WXS A;  2WXH A;  2WQY B;  5HHD G;  2LAS A;  4IC7 B;  3WAM A;  2REX A;  3TSS A;  2FNJ B;  1ET9 A;  2JRI B;  2D3B A;  2V3N A;  2L52 A;  1IBX B;  4W9K A;  3Q14 C;  2L32 A;  2FAZ A;  1FFV A;  2RDG A;  3ECI A;  3M3J A;  1WGH A;  2V4I B;  3EFU A;  3QAQ A;  1J8C A;  3URY A;  2PE9 A;  1FCL A;  4XWW A;  2D2Q A;  4PYU A;  4DDI D;  1IBX A;  2KWD A;  2NMQ A;  3R2I A;  1GC6 A;  1N5X A;  2BB5 A;  1R4M B;  4DQO C;  2V4L A;  3P4Q B;  2LGS A;  4B95 A;  1E8W A;  1K52 A;  4AOF A;  4P1B C;  2HD5 B;  5DPR A;  2C7M B;  1F9J A;  2J0J A;  5H8Y E;  4USA A;  3VXW A;  4OZA A;  1AWD A;  2IBI B;  3AU5 A;  4RGN A;  1ISN A;  1BML C;  3V6C B;  2DHZ A;  3P42 A;  2HE7 A;  4TV3 A;  3BZD B;  3H1U A;  3ZNG C;  3ZXR A;  4WIP A;  5HKH A;  3MC9 A;  4X57 B;  4XWT A;  1A70 A;  4JLC A;  5E6P A;  1JML A;  2Y3A A;  3E9S A;  4BAX A;  2G3Q B;  1WRD B;  2AYO B;  3B2F A;  5HI1 A;  2IO3 B;  4RGT A;  1RWS A;  4A8X C;  2YEP F;  4FLH A;  2VZK B;  1LFD A;  3CWI A;  3TUO A;  1TY0 A;  3VR9 B;  3PRE A;  2WXQ A;  2KLG A;  1TBE A;  1V81 A;  1L0V B;  4ASW C;  1VR9 A;  4MJS B;  2NPT B;  5E6O A;  3VTW A;  2C60 A;  4IKG A;  1V1P A;  4IW0 A;  2LVO A;  2FCQ A;  3WAL A;  3ZDT A;  2KAC A;  4URK A;  4MJS A;  2NPT A;  3BK1 A;  1F2R I;  1EF5 A;  4DXG A;  1JWU D;  1B1Z A;  4FHJ A;  1MVK A;  2B3A A;  3FIL A;  2KDE B;  3A9K A;  2AEH A;  3EHV A;  3TEX A;  1TZ1 A;  2JZ3 B;  3PRM B;  2L8J A;  2JY6 A;  1E6E B;  5G55 A;  2KQ7 A;  2VH2 A;  3Q8E A;  1D4B A;  1CJE A;  4HK2 A;  3GP7 A;  1Q0W B;  3A1Q B;  4I6P A;  4RF0 A;  1NEN B;  4CO7 A;  1OQR A;  4HXD A;  3VH3 B;  3SFE B;  2MSE D;  1TT5 B;  3APD A;  3VR8 B;  4KGT A;  3MTN B;  1TTN A;  4MDK E;  2JYT A;  4REZ A;  1TS4 A;  2KJ6 A;  3M95 A;  2PE6 B;  3A1Q A;  3T9L A;  4MH8 A;  1C9F A;  2JXX A;  3I3T B;  4WQO B;  1M4V A;  2LUE A;  2DBY A;  4RGO S;  4WUR A;  1FMA D;  1NYQ A;  4NY0 A;  1WJ4 A;  2RD0 A;  4C56 C;  1YNT E;  4LK0 M;  2N9L A;  3ZUN A;  4TQ1 A;  2ON8 A;  3HM6 X;  2DAJ A;  4IG7 B;  4ANV A;  3VTU A;  3A9J B;  3QA8 A;  1UEL A;  1HTO A;  4OW0 A;  3BII D;  1ZOY B;  3DCG A;  3NJT A;  2IO1 B;  2L0F A;  4AWJ A;  4MSM B;  3R7Q A;  2BS3 B;  3BYY B;  4MT5 A;  4NJC A;  2FCS A;  4RF1 A;  2DZI A;  2D3A A;  1P0R A;  4W9C A;  3ETR A;  3BWU D;  2QCZ A;  1D6E C;  1X1M A;  3ZW3 A;  2GB1 A;  1SJE D;  4XX5 A;  2V1Y A;  3D32 A;  2R61 A;  4C80 A;  2KD0 A;  2FUH B;  2IY0 B;  4JX1 C;  2ZVO A;  1QT9 A;  3RNE C;  2C5L C;  3TL5 A;  4EFO A;  3Q3J A;  3HVD A;  5D3I B;  3T8M A;  1UGJ A;  3N32 A;  4GDL B;  2AWT A;  3DBH I;  2OJW A;  5D94 A;  4DHJ D;  3LYY A;  3U8Z A;  3IT6 B;  1GNU A;  4ARC A;  5IOI A;  1EUV B;  3TEY A;  2RGF A;  4YTP B;  2WDT B;  3NVV A;  2BWF A;  2FE8 A;  4JIO U;  2PVO D;  1V1O A;  2WXF A;  1OTR B;  5T8I A;  3SDL C;  3IAS 1;  1XCQ L;  4C4V B;  4LNK A;  1PYW D;  4US9 A;  5C3J B;  2D10 A;  4FHK A;  3IT4 B;  1WR6 E;  4HEA 1;  2ZNV B;  3W1S C;  2R2Q A;  2N9K A;  5GXG B;  3RN9 C;  5FK9 C;  1IUE A;  2D07 B;  1P7F A;  2JT4 B;  2WLB A;  1V80 A;  3PRP B;  1SIJ A;  2MBE A;  3AU4 A;  3U7Z A;  2N1W A;  4YTN B;  5MPO A;  3RCZ A;  1WX8 A;  1FXA A;  4LJP B;  1WZ0 A;  5IN7 A;  3JSV A;  1SE9 A;  5IKC M;  2KXJ A;  2MJE A;  2K8C A;  2DZK A;  4MSQ B;  3NVZ A;  4XDC A;  5D6J B;  2GOW A;  1WH3 A;  3JVZ X;  4B0M A;  2BKF A;  1Y56 A;  4WJN A;  3U2S C;  2V0G A;  2K6D B;  3L10 B;  2K1F A;  3R3M A;  1WYG A;  2LVQ A;  4N59 A;  1XLQ A;  2NTS A;  2KO3 A;  4DHJ B;  1UWM A;  1HQR D;  2GBJ A;  4IDI A;  3OJ4 B;  4NAM A;  4W9J A;  3E56 A;  2IGD A;  1VZ6 A;  4GMV A;  3GE8 C;  1YOV B;  1GB4 A;  1IPG A;  2MX2 A;  4GN1 A;  2M4N A;  1L0Y B;  4KZC A;  2CJO A;  1ESF A;  3MP9 A;  4W9E A;  3DOW A;  1HE8 A;  2QIE B;  3PLU A;  1FFU A;  4HRS A;  3V6E B;  2PEA A;  2LD9 A;  1C1Y B;  4KGS A;  3MJW A;  1N5W A;  1XT9 B;  4FUL A;  5CHW A;  2PPH A;  2MJD A;  1YJ1 A;  1S3S G;  4TUU A;  3AEG B;  4LLG M;  1OQY A;  5HFY A;  3NZ3 A;  1D5M C;  4HRO A;  5AUK A;  2JVC A;  3PSE B;  4M8M A;  1UBI A;  1IGD A;  3RNA C;  3Q69 A;  1MFW A;  1ZE3 D;  4G3X B;  1JWS D;  1GOZ A;  2FBW B;  2WS3 B;  3DQV A;  2GBK A;  4ZRJ A;  2BYT A;  3AE5 B;  5BMI A;  3B0A A;  4HLE A;  2KFK B;  3P1M A;  1EU3 A;  1D3Z A;  2ZW1 A;  1N62 A;  3N1Z C;  4HVB A;  1C3T A;  4MH0 E;  2X38 A;  1OQQ A;  2KFK A;  3VAW A;  4R3D A;  1WWT A;  4G11 A;  4YL8 A;  2WX1 A;  3KUD B;  1VZ7 A;  3VUW A;  4KGR A;  3PV1 A;  3IHP C;  3QCA A;  5KHO A;  1KJT A;  5J18 A;  3PRZ A;  2L76 A;  3KYC D;  1JW9 D;  3HUI A;  3GOE A;  2GMI C;  3RI7 C;  2KMM A;  3WAP A;  2QJL A;  2K3U A;  1N61 A;  1WE7 A;  4XE0 A;  3DHH C;  3Q6B A;  3UIN B;  2JSV X;  1DGJ A;  2KYW A;  4KVG B;  1DOY A;  1WGY A;  2ZVN A;  1YN3 A;  4NJ6 A;  2IO2 B;  1TZO A;  1WI0 A;  3ZQ4 A;  2OED A;  3DPD A;  4YSX B;  5DPT A;  2BPS A;  1MG4 A;  3EA6 A;  2M17 A;  3B08 A;  4KKJ A;  5BYR A;  4WJO A;  1J0G A;  4K7W A;  2MW5 A;  3L4P A;  4WWP A;  2BYV E;  1FEH A;  3ML9 A;  1T0S C;  1RYJ A;  3U52 E;  1E9M A;  4FJY A;  4KX6 B;  1WJ6 A;  1V8C A;  3L08 A;  2GI9 A;  1SJH D;  2WXJ A;  3SU8 X;  2KVZ A;  2WXG A;  4Q2J A;  4RCO A;  1P7E A;  4FA6 A;  2DX5 B;  4LNF A;  2KQS A;  2PVG C;  1TKE A;  1U4A A;  1ZXI A;  2I1K A;  5LXI B;  1QLB B;  3N1X C;  3ZNI D;  1E7U A;  1TS2 A;  2R2O A;  5FR3 A;  1Y8R C;  2KDI A;  2KN5 A;  1WZ3 A;  1VDV A;  3CF6 E;  3NVW A;  1RFA A;  1OGW A;  2KMA A;  3I9V 1;  1WR1 A;  1XLO A;  2K25 A;  2LWP A;  2J52 A;  1YIW A;  4HPP A;  1YQB A;  3N1Y C;  2L0T A;  2L83 A;  2LRU A;  2KC1 A;  2DZM A;  3AM9 A;  3MC8 A;  2DYB A;  2M0X A;  2C7N B;  3SEB A;  1SBB B;  2HJ1 A;  1E0Z A;  2AL3 A;  3QJZ A;  1KOT A;  3U30 A;  1JWA D;  3KUC B;  2BT6 A;  3ZKJ C;  1EO6 A;  3QIJ A;  1GG3 A;  5EDS A;  2LZ6 A;  4ANW A;  2MCN B;  2A4Z A;  2N1V A;  2WXN A;  2RDB C;  3PTF C;  2LUM A;  2WXP A;  3ZJU A;  2PKO A;  1WIA A;  2JF5 A;  3RUI B;  4FJZ A;  1UUP A;  5JHA A;  4MGZ E;  2KK8 A;  3Q3M C;  3C19 A;  1F77 A;  4NZL B;  3OWE B;  2XK5 B;  1HA5 A;  2L00 B;  2MJ3 A;  5KHQ A;  5LLI A;  5J2R A;  2KDM A;  1K51 A;  3ZGZ A;  3NS1 A;  2ZZP B;  1T6B X;  4N58 A;  2XK5 A;  3KH0 A;  1E7P B;  3IBE A;  1E90 A;  1NVI D;  1MG8 A;  4HDQ A;  3PT2 B;  4MGY E;  1PDX A;  2N7J A;  3VRA B;  5CHF A;  1E5W A;  1V1P B;  3DVG Y;  4L23 A;  5DPW A;  5IO9 A;  3QC8 B;  4TQ0 A;  4P1C C;  1WGK A;  2KTF A;  4P16 A;  4IM2 A;  1NI3 A;  2EKI A;  2DWQ A;  3J9C A;  1V5T A;  3DBL I;  4UDU C;  3DWG C;  3FIL B;  1I7H A;  5C23 A;  3A9K B;  2PJH A;  4LCD E;  3V3X A;  1NDD A;  1XO3 A;  2DNF A;  1QOG A;  3SFD B;  1L6U A;  2EMS A;  2L1A A;  2N4F A;  5DCN A;  4BKS D;  2MWS B;  5E6J A;  1A5R A;  1F0Z A;  3ALB A;  5E6N A;  2K0P A;  3ZVV A;  1V5O A;  1XEE A;  1ZP0 B;  2PMV A;  3DHI C;  2NCN A;  1EWY C;  4WWN A;  1AAR A;  1OEY J;  4PS8 A;  3V61 A;  1FNV A;  3AE9 B;  2W3S A;  3Q3F A;  1WXV A;  3IG3 A;  3GS2 A;  4A3O A;  1OEY A;  4EZK A;  2N0S B;  2ZPN A;  2KX3 A;  4E71 A;  2PTL A;  1IGC A;  2RPV A;  5TR5 A;  1TJE A;  2WU5 B;  3PS6 A;  3RMK C;  1GC7 A;  1WSP A;  2KQ4 X;  3Q3O C;  3DVG X;  3PVL A;  4K7U A;  1WX9 A;  4AP4 C;  3A33 B;  3TBL D;  1C4A A;  3ZO5 B;  5BYQ A;  2KN4 A;  1WJU A;  1UWX A;  4BFR A;  1ZDX A;  2WU2 B;  2GBM A;  2IO0 B;  5CHV C;  1GPX A;  2N9E B;  3UQA A;  4M0W B;  2K22 A;  2L3Z A;  2JWZ A;  1JCK B;  4CHK A;  3UQB A;  4W9I A;  2DLB A;  1QIL A;  1PGB A;  1R4N I;  2EEL A;  2XN9 C;  2BS4 B;  2YLM A;  4M0W A;  3Q8B A;  5AEK B;  2KDB A;  1WXQ A;  1I4P A;  1NEK B;  4HKZ E;  3LJ3 A;  2JZP A;  1TS3 A;  3UIP B;  4MEL A;  3TJP A;  2IGH A;  2BBC A;  4ZOH C;  3VUX A;  1ZDV A;  3MFG A;  3FAH A;  1P1A A;  3B1L X;  4YTM B;  2EMT A;  1RFK A;  1AYF A;  3P2B A;  3NOB A;  2V3P A;  2E6X A;  3AMZ A;  1QOB A;  3AE7 B;  1J7B A;  1KTK A;  3AH7 A;  2KT7 A;  1UD7 A;  1N6Z A;  2H89 B;  1LO5 D;  4XC2 A;  4BKS A;  1FNW A;  1K8R B;  1FXT B;  1H4R A;  2GBN A;  3S2A A;  2H88 B;  3IVF A;  2ASQ A;  4C00 A;  4W9D A;  4LDT D;  4KDI C;  4HCN B;  1ZUD 2;  2KAJ A;  4K3B A;  2GRI A;  1H8C A;  4AJY B;  3AE8 B;  1SE3 A;  2Y5C A;  4DHZ E;  1OFF A;  2KAN A;  2B76 B;  2FCN A;  2CU3 A;  4WQM A;  2JWU A;  2WXL A;  3NRZ A;  1SB3 C;  1DOX A;  2LJ5 A;  1TS5 A;  5CTR C;  4ANX A;  3BYT B;  3KWL A;  1EWC A;  4HJK A;  1NI2 A;  2WX0 A;  3FC4 A;  5LNK 1;  4P6V F;  2Z0E B;  1YX5 B;  3JSV B;  2KHW B;  2C9W B;  2ZJD A;  2VH1 A;  1JRP A;  2KC2 A;  2W9N A;  2WXO A;  2WYQ A;  1NYR A;  1HZ6 A;  2CU1 A;  3TMP B;  4NQL B;  3X0W A;  2KNB A;  1SEB D;  4BOS C;  2CHX A;  4ZRP A;  2ZNV C;  5AZH A;  1VLB A;  2ZW0 A;  1ZPS A;  2G4D B;  2WXI A;  3AE1 B;  3DWM A;  3AN1 A;  2BTE A;  5AUI A;  4GLS C;  2JYE A;  1Z5S B;  1ET6 A;  2WWZ A;  4A3P A;  2JRH A;  3VRB B;  1RM6 C;  3UF8 A;  4MEM A;  2QIL A;  3EEC A;  1TIF A;  4EEW A;  3PGE A;  2V9H A;  2LHD A;  3EUB 2;  4KSK C;  1ZKH A;  3AEF B;  3MC0 B;  1LQB A;  2KWV B;  2LMC A;  1UBQ A;  3U4E G;  5C2T B;  4YWG G;  3ZJV A;  2QSD A;  4I6L B;  5CX3 A;  1GB1 A;  2IDY A;  4F1S A;  4M01 A;  1TKG A;  4GIV A;  2GBR A;  2G1E A;  2HDE A;  2WGS A;  3W1Y A;  2N9P C;  4DK5 A;  2W54 A;  3L0W B;  3BVG A;  2E3T A;  2INN E;  4L1B A;  3VQI A;  2MQJ A;  4DXF A;  2LRW A;  1SIF A;  1GUA B;  2JUO A;  4II3 B;  4NNJ B;  1MI0 A;  4A20 A;  2K6Q A;  2VRR B;  3LB8 C;  4J6I A;  1WF9 A;  2KOX A;  1MHX A;  4I6N B;  3C8Y A;  1T0R C;  1SGH A;  1BXT A;  3EC8 A;  1P9D U;  3Q8C A;  4LNO A;  1T3Q A;  3Q3N C;  2XEW A;  3RNC C;  2QC8 A;  4JGH B;  4NPN A;  3AED B;  4BZA A;  5IP4 D;  1F52 A;  5EE3 A;  4YSY B;  1ROE A;  1XD3 B;  4RM9 A;  3R7R A;  2KLC A;  3M62 B;  1ACC A;  1STE A;  2KDF B;  3TCA A;  2UU7 A;  4RH6 A;  1WXM A;  4HPL B;  2M8S A;  5L95 C;  3AB5 A;  4PK1 A;  3OAW A;  3MHZ A;  1VZ8 A;  4EUT A;  3RNB C;  3PZ7 A;  3H8H A;  2BVC A;  3DVN V;  2OJR A;  1SSN A;  3H6N A;  1M94 A;  4WWM A;  1VJK A;  1UF0 A;  4ICV A;  3NG0 A;  4WAA A;  5G5H A;  3V05 A;  2PIA A;  1L6V A;  3RNG C;  1YN5 A;  1FPY A;  1Q5W B;  2DYM A;  2YVC A;  5BYS A;  3R2T A;  3GB1 A;  2WDV B;  4BVU C;  4XGA B;  4EZJ A;  2ZCC A;  4F7Z A;  5IA7 A;  1B9R A;  3OG5 A;  4LNN A;  1HTQ A;  1FNU A;  1FM0 D;  3BIN A;  2YEP B;  4E74 A;  1I35 A;  2M0A A;  1CQV A;  2O6V D;  2PW9 A;  3O65 B;  4ACF A;  1KRH A;  2K8H A;  2WXK A;  1ZW7 A;  3RYT A;  4P7I A;  4BBN C;  1J19 A;  3N9Y C;  3IFW B;  4BKG A;  4GU2 A;  1DOI A;  3LXF A;  4JWS C;  4KIK A;  3VUY A;  1BT0 A;  3PPA A;  2NBU A;  3NS8 A;  4ARI A;  4OVU A;  2Z59 B;  3QWZ B;  1Z2M A;  1WX7 A;  4OZC A;  1NBF C;  3PZD A;  1CZP A;  2GLS A;  3AUL A;  5JH5 C;  4WJP A;  1F2R C;  4S0R A;  4NJ7 A;  2INP E;  3A4R A;  3VTV A;  2LGX A;  4K7S A;  3AXC A;  4ZYS A;  3I63 C;  2LVP A;  3DVN U;  2J0M A;  3DBR I;  2CHZ A;  3BVM A;  3Q2A C;  3ZNH B;  1ZXH A;  3V62 A;  4A9A A;  3IAM 1;  4NQK E;  2WNM A;  2XBB C;  2ZPY A;  3PO0 A;  4E3C A;  2MP2 A;  3ML8 A;  3KYD D;  4GDK B;  1K53 A;  3QQ8 B;  4JWU C;  4AQ7 A;  2WHI A;  4MM3 B;  3W5U B;  4WAF A;  2KWC A;  4PYZ A;  1L4D B;  3NZU A;  1F1H A;  3VVW B;  1R4N B;  3ABV B;  2JU6 X;  4AUQ C;  1JWB D;  1P3Q U;  3DHG C;  4GDK A;  2RMM A;  2ICI A;  3NVY A;  3GE3 C;  1KF6 B;  3H7P B;  1E8Z A;  4MGK E;  3KUZ A;  4JL9 A;  4MM3 A;  1C76 A;  2BWE S;  2O6V B;  2WDQ B;  2MBQ A;  2MBH A;  3PHX B;  2ACZ B;  1J7C A;  3TEW A;  2LXC A;  2RSU A;  4W9L A;  1BUI C;  4GB9 A;  4JPS A;  1FRR A;  3ONS A;  2VZK D;  2D11 A;  5DPS A;  3I5J C;  5BMH A;  4DDG D;  3H7P A;  3NUH B;  2O6V A;  3K9O B;  2ZCB A;  3RPF C;  2UYZ B;  1QOF A;  3R8B A;  4AJW A;  4DWF A;  1PGA A;  4CYE A;  4H2A A;  4ZHO A;  3HM3 A;  2DYO A;  3DBH B;  2IND C;  4RM8 A;  4JE3 B;  4AS1 A;  1WYW B;  2AL6 A;  1XXG A;  2NR2 A;  4FAD A;  4JQW C;  3GZN I;  4DHZ B;  1PQS A;  4EOY A;  1WGR A;  2BB6 A;  1HEZ E;  1YD8 U;  4OVV A;  4YXD B;  1YX6 B;  1D5X C;  1I4R A;  1WGD A;  1PFD A;  2KJH B;  2I38 A;  4DBG A;  4OHJ A;  1JWM D;  4NAW B;  1V6E A;  4M00 A;  2W55 A;  1MJD A;  2NS5 A;  1XCT L;  3VDZ A;  4D2K A;  3UI3 A;  3T3O A;  3RT3 B;  2KFJ A;  4BBN F;  2MH7 A;  3N3K B;  3JW0 X;  5JXV A;  2WP9 B; 
#chains in the Genus database with same CATH homology
 1ESF A;  3B9J A;  3MP9 A;  1KH0 A;  2IJ0 A;  4J3O D;  1V97 A;  2H88 B;  2QIE B;  3BK2 A;  1FFU A;  3ZYY X;  4HRS A;  1E10 A;  4IOI E;  4EE2 A;  1ZUD 2;  2KAJ A;  4KGS A;  1N5W A;  2GRI A;  5EE9 A;  3AEC B;  1N60 A;  2MJD A;  3AE8 B;  2QEJ C;  1SE3 A;  2Y5C A;  2HTM E;  3AEG B;  1OFF A;  5EE0 A;  4LLG M;  1C77 A;  2B76 B;  2CU3 A;  4WQM A;  2LEK A;  3KLS X;  1PGX A;  3I57 A;  1I4Q A;  3NZ3 A;  1D5M C;  2AQ1 B;  4HRO A;  5HFY A;  2JWU A;  2WXL A;  5AUK A;  3NRZ A;  2WXH A;  2WQY B;  1IGD A;  1SB3 C;  2OHF A;  5HHD G;  1FNW A;  1DOX A;  3Q69 A;  2QMT A;  1ZE3 D;  1JWS D;  1GOZ A;  1TS5 A;  2FBW B;  2J42 A;  2WS3 B;  4XDD A;  3BYT B;  3TSS A;  3KWL A;  1ET9 A;  2K9X A;  1EWC A;  2BYT A;  2V3N A;  3AE5 B;  5BMI A;  2L52 A;  1IBX B;  2L32 A;  3P1M A;  2TSS A;  1EU3 A;  3FC4 A;  1TYG B;  5LNK 1;  4P6V F;  1Q10 A;  2IGG A;  1FFV A;  2RDG A;  2ZW1 A;  1N62 A;  4B0E A;  3CIR B;  2V4I B;  1JRP A;  1FIQ A;  1TKY A;  4ZHP A;  2X38 A;  3URY A;  2ONQ A;  2WXO A;  1FCL A;  4XWW A;  1NYR A;  3W9C B;  1HZ6 A;  2Q5W D;  2K5P A;  1IBX A;  1GAQ B;  1OQQ A;  2KWD A;  1QQR A;  2NMQ A;  2SEB D;  3R2I A;  1SEB D;  1JRO A;  1N5X A;  4R3D A;  2BB5 A;  1WWT A;  4ZRP A;  4YT0 B;  4DQO C;  1VLB A;  2ZW0 A;  1R7S A;  1ZPS A;  1VZ7 A;  4KGR A;  2WXI A;  3AE1 B;  1YN4 A;  3P63 A;  3P4Q B;  3DWM A;  3AN1 A;  2AQ2 B;  3WCQ A;  2BTE A;  1K52 A;  3AEE B;  4GLS C;  5AUI A;  2JYE A;  1YJJ A;  1ET6 A;  5H8Y E;  3VRB B;  1RM6 C;  4USA A;  4OZA A;  2QIL A;  1L4Z B;  1JW9 D;  2I2Y A;  3HUI A;  1AWD A;  2LHD A;  3EUB 2;  4RFB A;  5H92 C;  4RGN A;  3AEF B;  1I4X A;  2KMM A;  3MC0 B;  1C4P A;  2QJL A;  2LMC A;  1BML C;  2K3U A;  3U4E G;  2J53 A;  3P42 A;  1N61 A;  1HXY D;  4XE0 A;  2JSV X;  2AX5 A;  5C2T B;  3BZD B;  1DGJ A;  2XNA C;  4YWG G;  3ZJV A;  1DOY A;  2QSD A;  1YN3 A;  4LTU A;  1GB1 A;  4WIP A;  1TZO A;  2IDY A;  4PT5 A;  1TKG A;  1SXT A;  3AE3 B;  1EU4 A;  1SE2 A;  3ZQ4 A;  4KKI A;  3B2G A;  2OED A;  4YSX B;  2G1E A;  2HDE A;  4XWT A;  1A70 A;  1JML A;  2Y3A A;  3E9S A;  4CQN A;  3EA6 A;  4KKJ A;  5BYR A;  2W54 A;  3L4P A;  3BVG A;  2E3T A;  2INN E;  4L1B A;  3B2F A;  5D3D A;  2Y5P A;  3VQI A;  5HI1 A;  4RGT A;  1RWS A;  1FEH A;  3TEZ A;  1KLU D;  4A8X C;  1RYJ A;  2YEP F;  3U52 E;  1E9M A;  2VZK B;  3CWI A;  3TUO A;  4DXF A;  4KX6 B;  1TY0 A;  1SE4 A;  1V8C A;  3VR9 B;  4WH4 A;  2WXQ A;  3KWV A;  3AE2 B;  2GI9 A;  5HG2 A;  4L2Y A;  1L0V B;  1SJH D;  1L5P A;  2LHE A;  1VR9 A;  2WXJ A;  2BW2 A;  3KQ4 A;  1MI0 A;  2WXG A;  4Q2J A;  4RCO A;  1QKZ A;  1P7E A;  3LB8 C;  3AE6 B;  4IKG A;  1UNS A;  2LJI A;  1V1P A;  1MHX A;  1YJI A;  2PVG C;  3C8Y A;  1TKE A;  1BXT A;  1ZXI A;  2WXR A;  3Q8C A;  1QLB B;  1TS2 A;  1T3Q A;  5FR3 A;  3AEA B;  2KAC A;  3BK1 A;  3AED B;  4A6Q A;  1F2R I;  5EE3 A;  1XLP A;  4DXG A;  1JWU D;  1VDV A;  1B1Z A;  3NVW A;  1T5X D;  4YSY B;  1MVK A;  1ROE A;  3P4P B;  3I9V 1;  1ACC A;  3FIL A;  1N63 A;  1XLO A;  1STE A;  1AN8 A;  4RH6 A;  2J52 A;  3TEX A;  3BVZ A;  1TY2 A;  3AB5 A;  3W1S A;  2JQR B;  4RNA A;  1C78 A;  1E6E B;  3MHZ A;  1VZ8 A;  2L83 A;  3PZ7 A;  3H8H A;  3AM9 A;  1SSN A;  3Q8E A;  3SEB A;  1SBB B;  4WWM A;  1VJK A;  1D4B A;  1CK1 A;  1E0Z A;  1CJE A;  3W2D A;  3GP7 A;  1JWA D;  4RF0 A;  1NEN B;  5G5H A;  3V05 A;  2PIA A;  2BT6 A;  1L6V A;  1OQR A;  1YN5 A;  3SFE B;  1VRA B;  2DYM A;  3VR8 B;  2WXN A;  4KGT A;  4TMA B;  5BYS A;  3R2T A;  3GB1 A;  3O13 A;  2WDV B;  2LUM A;  2JYT A;  2WXP A;  4REZ A;  1TS4 A;  3ZJU A;  2PKO A;  2J4X A;  3AE4 B;  2WXM A;  1B9R A;  4MAC A;  5EE1 A;  4HKQ A;  2W3R A;  4MH8 A;  1UUP A;  1FNU A;  1FM0 D;  1C9F A;  1XF5 L;  2YEP B;  1PUT A;  3SR6 A;  1C4C A;  1F77 A;  4RGM A;  1M4V A;  2M0A A;  1FRD A;  1HZ5 A;  1CQV A;  4NZL B;  2PW9 A;  3OWE B;  2DBY A;  4RGO S;  2W82 A;  1FMA D;  1HA5 A;  1KRH A;  1NYQ A;  2WXK A;  4WUR A;  4C7Z A;  2MJ3 A;  4C56 C;  1YNT E;  3P4R B;  4LK0 M;  4C7Y A;  2IPK D;  2N9L A;  1QF6 A;  4TQ1 A;  3N9Y C;  2KDM A;  2ON8 A;  1K51 A;  3ZGZ A;  2G9H D;  1DOI A;  3LXF A;  4JWS C;  3NS1 A;  2JXT A;  1J7A A;  3BII D;  4OW0 A;  1ZOY B;  4ARI A;  4A55 A;  1T6B X;  4N58 A;  4OZC A;  2BS3 B;  1E7P B;  1CZP A;  3BYY B;  1NVI D;  4MT5 A;  4OZB A;  5I4D A;  1F2R C;  1QOA A;  1PDX A;  2N7J A;  4NJC A;  4RF1 A;  1YQ4 B;  3VRA B;  3PZ8 A;  2INP E;  1MHH E;  1V1P B;  2FUG 1;  4ZYS A;  3ETR A;  4L23 A;  3BWU D;  2Z8L A;  4TQ0 A;  1WGK A;  1D6E C;  4US8 A;  4P16 A;  2MEK A;  2GB1 A;  1NI3 A;  1SF0 A;  1SJE D;  2DWQ A;  2EKI A;  3J9C A;  2R61 A;  4C80 A;  3MJ5 A;  1D5Z C;  3BVM A;  1ZXH A;  4A9A A;  4JX1 C;  3IAM 1;  2WNM A;  4YSZ B;  1QT9 A;  4ZRQ A;  2M56 B;  2CJN A;  4UDU C;  3DWG C;  4HJG E;  3FIL B;  3HVD A;  5D3I B;  1UGJ A;  2RDH A;  1I7H A;  3PO0 A;  3T3N A;  4GDL B;  3V3X A;  1KLG D;  1XO3 A;  1QOG A;  2LGI A;  4GDK B;  3LYY A;  1K53 A;  3SFD B;  1FXI A;  3IT6 B;  4JWU C;  1L6U A;  4ARC A;  4AQ7 A;  3Q8F A;  4MM3 B;  3TEY A;  3W5U B;  2L1A A;  1YQ3 B;  4WAF A;  5E6J A;  1F0Z A;  1L4D B;  4O1N A;  4YTP B;  2K0P A;  3NVV A;  3ABV B;  2FE8 A;  2JU6 X;  1XEE A;  5BMG A;  3HVZ A;  2PVO D;  1JWB D;  4TSS A;  3RFZ B;  1ZP0 B;  1V1O A;  2PMV A;  2WXF A;  1EWY C;  2RMM A;  5T8I A;  2AQ3 B;  2ICI A;  3NVY A;  1KF6 B;  3IAS 1;  1XCQ L;  1FNV A;  1PYW D;  1C76 A;  3AE9 B;  2W3S A;  4US9 A;  5C3J B;  3GS2 A;  4FXC A;  1AW7 A;  5D7G A;  2WDQ B;  3IT4 B;  4HEA 1;  2N0S B;  2ACZ B;  1J7C A;  1EM7 A;  2N9K A;  3TEW A;  5GXG B;  5FK9 C;  1L0X B;  2PTL A;  1IGC A;  1BUI C;  1FCC C;  4JPS A;  1IUE A;  2RPV A;  1FRR A;  2VZK D;  1TJE A;  4ITK A;  3AV8 A;  1P7F A;  1KFY B;  2WU5 B;  5BMH A;  2NTT A;  2WLB A;  1ENF A;  3NUH B;  1WSP A;  2KQ4 X;  1SIJ A;  3EGR A;  3AEB B;  1XLN A;  3U7Z A;  3RPF C;  2JX5 A;  4YTN B;  1QOF A;  2M19 A;  4N6E B;  3R8B A;  1DYQ A;  5MPO A;  1PGA A;  1C4A A;  1FXA A;  5BYQ A;  2KN4 A;  1UWX A;  2BS2 B;  3P4S B;  1I4G A;  4H2A A;  4ZHO A;  1ZDX A;  2LFI A;  2WU2 B;  2MJE A;  2DYO A;  3HRD D;  1GPX A;  4JE3 B;  3NVZ A;  4AS1 A;  4XDC A;  4OVZ A;  2K22 A;  3ZJT A;  5FKA C;  4B0M A;  1XXG A;  1JCK B;  1Y56 A;  1WRI A;  3U2S C;  2V0G A;  3Q8A A;  2DLB A;  1YMH E;  4A90 A;  1QIL A;  1PGB A;  2EEL A;  2BB6 A;  1HEZ E;  1WYG A;  2XN9 C;  4N59 A;  1MPE A;  1FD6 A;  1XLQ A;  2BS4 B;  2NTS A;  4M0W A;  4YXD B;  3Q8B A;  1WXQ A;  1D5X C;  1I4P A;  1NEK B;  1UWM A;  1HQR D;  4HKZ E;  1K50 A;  1I4R A;  2JZP A;  2PLP A;  1PFD A;  2D5G A;  1TS3 A;  2I38 A;  4IDI A;  2WDR B;  2IGH A;  2BBC A;  4ZOH C;  1JAL A;  1ZDV A;  3MFG A;  4OHJ A;  3FAH A;  5TSS A;  4NAM A;  1JWM D;  4NAW B;  3E56 A;  4YTM B;  1FO4 A;  1RFK A;  1AYF A;  2IGD A;  2W55 A;  1VZ6 A;  2V3P A;  3IXS A;  1XCT L;  2E6X A;  4D2K A;  3AMZ A;  3UI3 A;  1QOB A;  2SAK A;  3AE7 B;  3T3O A;  1C79 A;  1J7B A;  1KTK A;  1GB4 A;  1I4H A;  3AH7 A;  5G5G A;  2MH7 A;  3W5V B;  1L0Y B;  2H89 B;  5JXV A;  1JQ4 A;  2WP9 B;  1LO5 D;  2CJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...