1SSNA

Staphylokinase, sakstar variant, nmr, 20 structures
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
136
structure length
136
Chain Sequence
b'SSSFDKGKYKKGDDASYFEPTGPYLMVNVTGVDSKGNELLSPHYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOKINASE
publication title Nuclear magnetic resonance solution structure of the plasminogen-activator protein staphylokinase.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 16
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 1998-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02821 Staphylokinase Staphylokinase/Streptokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.130 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ssnA00
2SAKA 1SSNA 1C78A 1C79A 1BUIC 1C76A 1C77A
chains in the Genus database with same CATH superfamily
3TBLD 3TMPB 4W9GA 3U52E 1XLOA 3DVNU 1RYJA 2JWUA 3P42A 3N32A 2LRUA 3JYUA 2PVGC 3A9KA 4US8A 4US9A 2AWTA 3EA6A 2M19A 2MW5A 1XCTL 5H92C 5CHFA 4WAFA 5L83A 1DYQA 2INPE 3L10B 1GC6A 2O6VD 2K6DB 5KHOA 3NVVA 2RR9A 5EE3A 2K22A 3NZ3A 2KDMA 4BFRA 5BMIA 2YEPB 4BOZB 2EELA 2QCZA 1PQSA 4O1NA 1ZUD2 1IYFA 2EMSA 2D3CA 4USAA 2V4IB 2MSED 3L0WB 2DBYA 1L0YB 2N1WA 5G5GA 4YSZB 1Q1OA 3H7PB 2LHEA 2KDEB 1J7AA 2JT4B 4S0RA 2WX0A 2JY6A 2X8XX 1V80A 2RPVA 2WYQA 3MC9A 2KKCA 1HEZE 1J0GA 1E8XA 1ET9A 1WR1A 1WZ3A 1HTQA 1RM6C 1STEA 4W9EA 1KOTA 1V6EA 3LB8C 3T9LA 4URKA 4LJOB 2JYTA 2ZVOA 2HE7A 4WWMA 4LNKA 5TSSA 3SR6A 4Q2JA 2MH7A 2BPSA 1F2RI 3I57A 1GAQB 2KJRA 3M62B 4IWPA 2M8SA 3MTNB 4KZCA 1GC7A 3R2IA 2HJ1A 4WWNA 2DLBA 2PE6B 5J2RA 4ASWC 3DBLB 4CO7A 2EKIA 4ZRJA 1GB1A 3EFUA 1K53A 2XNAC 1V1PB 4K81A 2NCNA 2J4XA 5AEKB 2BKRB 1Y56A 1OGWA 3RYTA 2DYOA 3L08A 4NJCA 3RT3B 1YJIA 3BK2A 4DQOC 2DZKA 4P1CC 4ZHPA 1NEKB 2KO3A 3KH0A 4KDLB 4C4VA 2KMAA 3PREA 3B1LX 2LUMA 3A1QA 3RD2A 2D07B 2L8JA 2W54A 4B9KA 4ZRIA 4RF0A 3RMKC 1WMHA 4E74A 4ACFA 1SSNA 5BYRA 2KVRA 3WIMA 2BYFA 4DHZE 2GOWA 2IY0B 4DHZB 4J6IA 1C79A 4X57B 2KNBA 5HI1A 3ZYYX 1DOXA 2J42A 1TGZB 1ZDVA 2C7MB 2N7DA 4OVZA 1JWAD 3ZXVA 3LYYA 2D3AA 2OEDA 2KXJA 2BBCA 5JH5C 3DVNV 2CU1A 3W5VB 3PHXB 3N1XC 2MP2B 1WYWB 3N3KB 1KM7A 4EUTA 2JZZA 3V3XA 3R7RA 4UDUC 1JMLA 1FNWA 1I4GA 1N62A 4CYEA 2GRIA 2Z0EB 2A4ZA 2BF8B 1T0SC 2WXOA 2GMIC 1E0ZA 2D10A 2Z8LA 4WWOA 2NS5A 4IG7B 3VTUA 1ROEA 1YN5A 2IO2B 2NMQA 2IZVB 4W9IA 2LVPA 4NQLB 1MFWA 1C4AA 3B0AA 2WXJA 1V2YA 1HXYD 2EMTA 2ZW0A 1WFYA 2UYZB 2MBHA 1N63A 3W5UB 3W9CB 2K8HA 4RM9A 1FEHA 4DBGA 1KFYB 5GMVA 2FCQA 2LI5A 3RFZB 3SFDB 1ZXIA 1WYGA 5DPWA 4FBJB 1GUAB 4WQOB 4ANWA 3VQIA 2L7RA 4BVUC 4KKIA 2FUG1 1P1AA 2L00B 2JUOA 2ZNVB 1VZ7A 2WU5B 1E6EB 2BB5A 1N6ZA 2W55A 2QHOA 2NTSA 3ZNZB 1RAXA 3ZNID 4NZLB 3ZJVA 3U7ZA 4XZ4A 2VH1A 3PVLA 4DXGA 2GBNA 1QLBB 4A8XC 4EZKA 4JE3B 2Y5PA 1WX9A 4M01A 4NJ7A 2NR2A 3RUIB 3UIOB 2KACA 5DPTA 2I1JA 1GJZA 1WRDB 3Q3FA 1EWCA 5JHBA 1I42A 2J0MA 1L0XB 1J19A 2CJOA 5G5HA 3W1SC 2LGIA 4YTPB 1JROA 1FCCC 2J0JA 1DGJA 2N7EA 2A5UA 3OWEB 4G0NB 5FK9C 3BVGA 5IA7A 3ZLZA 3P4QB 1JRPA 1JQ4A 3P2BA 4H2AA 3WAMA 3IT6B 1WWTA 1V97A 4FJYA 4J3OD 4NY0A 3CF6E 3NS8A 4L1BA 2LUEA 1V5OA 2JRHA 4GXBA 2M0AA 3A4RA 1TS5A 1N5WA 2PE9A 3H6NA 2K0PA 5AZHA 5MPOA 1ZW7A 4NAWB 2N7JA 2PEAA 1F77A 3H7SA 4LLGM 4EZLA 1OTRB 4TQ0A 4ZYSA 1SIJA 1WSPA 4FXCA 3GS2A 1UH6A 1V86A 2QC8A 4K7UA 4M02A 2C60A 4GMVA 3W1SA 2KANA 3VTWA 3I9V1 2AEHA 1NYRA 2KC1A 2KFKB 4KIKA 4BKTA 3BINA 3RI7C 2ZVNA 1FM0D 4DK5A 2IJ0A 1C77A 1L4DB 4MM3B 2GB1A 2LD9A 1R4NB 4K1RB 4ZYNA 4YSXB 1WXAA 4FJVB 2WP9B 2N1VA 1NVID 2KK8A 4XYCA 1P9DU 2R2OA 1WX8A 2QILA 2DYBA 1GPXA 3PZ7A 2MBEA 3EGRA 3M95A 4W9DA 1I4HA 2FCSA 1IP9A 1R4MB 1EU3A 3BK1A 2K8BA 3MHZA 2N9PC 2HJ8A 2LGYA 3UF8A 2L76A 4JIOU 1HZ6A 2LZ6A 3DCGA 1AWDA 2ZPNA 4YXDB 3K9PB 2Q5WD 4C80A 3Q14C 3SEBA 4IWOA 1UNSA 2G4DB 3P1MA 1N61A 3I5JC 4KV2A 4B6WA 2CJNA 4XDDA 3QA8A 2KZRA 2FAZA 2CS4A 3BY4B 1F0ZA 3BYYB 3UQAA 2PTLA 5LNK1 3DWGC 3WCQA 4KSLC 1D6EC 3AU5A 2JWZA 4PT5A 1FFVA 1YX6B 3N20C 1A70A 4N58A 1KLUD 1PUTA 3OAWA 4AP4C 4RM8A 2B76B 1NBFC 1KTKA 1QKZA 1WX7A 5AUIA 4W9LA 2G1EA 2G3QB 2M17A 4BKGA 3QHTA 2INNE 4N6EB 1TY2A 1MHXA 2L3ZA 1UUPA 2QIEB 2FCMA 4I6PA 4BKSD 2KQSA 2UU7A 2YLMA 2CR5A 2L52A 2M1MA 4BAXA 1TY0A 4GN1A 4WURA 4NAMA 1TIFA 2FIFA 5IP4D 4HJKA 4TUUA 3LDZE 4MJSB 3GZNB 1XQQA 5H8YE 2NBVB 1FXAA 2BKFA 4LNNA 1YD8U 1I4XA 1XT9B 4JL9A 1IPGA 4C4VB 1TKYA 2OJRA 1LQBA 4A55A 3GZNI 1L2NA 3IBEA 3L4PA 2MRPA 3CSFA 3JSVB 3DHGC 4K7SA 5D3DA 3RNAC 2G4SA 5I4DA 3PTFC 4RF1A 5D6JB 2C9WB 2ACZB 2AQ3B 3ML8A 3QWZB 3KWLA 4ICVA 3FILB 2FCNA 4AUQC 1SGHA 3HK0A 2L05A 2PKOA 1FRRA 5AUKA 1E8YA 5BYQA 3L17A 3H9DA 1SJED 2N9EB 1EWYC 2IO3B 2IDYA 4HEA1 2MWSB 2QJLA 1KLGD 1EO6A 5DPSA 2M0XA 4XE0A 3QARA 2BTEA 1EM7A 3PRPB 1YJ1A 3X0WA 2NTTA 4HCNB 3KYDD 3VDZA 3DQVA 3AEAB 5TR5A 1C76A 4HVBA 3AE1B 3JW0X 1WXQA 2ZPYA 4M0WB 3O65B 3TSSA 3RNCC 3BIID 3P63A 4C56C 4KX6B 1SJHD 3TCAA 1FXTB 3KUCB 2N0SB 4OZAA 2MBOA 3V05A 1S3SG 3SFEB 2D3GA 3AEFB 3AECB 4FULA 4LNOA 3C0RB 4WJPA 5D94A 2WDVB 3RZFA 4I6LB 1PDXA 1LGRA 3AE5B 4MSQB 4NQKE 1QZEA 2IGDA 2JSVX 2MJEA 3DDCB 2KX0A 3KYCD 1WXSA 1PGAA 1ZGUB 2KJ6A 2PW9A 3HM3A 4WIPA 4RH6A 3DPDA 3ZDMC 1VR9A 2WXPA 1KH0A 3ZVVA 2KYWA 4IWQA 2J53A 3PV1A 3AMZA 1T0YA 3C19A 1E7UA 1IGCA 2RGFA 3DWMA 3HUIA 1Q0WB 3K9OB 3DVGX 2LASA 1WGRA 2LXAA 2KWVB 2WXIA 3BYTB 3P4RB 4B0EA 3KWVA 3Q3MC 2V3NA 1GG3A 1NI2A 1T0RC 2JPHA 1TT5B 3I63C 2M4NA 3MHSD 2UWQA 5LLIA 2ZJDA 3NS1A 4YTMB 2K6QA 3PZ8A 3AEEB 1CZPA 1VLBA 2HDEA 4JWSC 4EOYA 1JRUA 1CMXB 4GDKB 2D11A 3W1YA 3RCZA 3MC0B 2NPTB 4R3DA 2HTME 4HCPB 3ZNGC 3Q8AA 2WS3B 2LGXA 4HDQA 4KZ0A 4L23A 3D32A 3Q3OC 4W9HA 1WGKA 2DENB 4ZRPA 1UBQA 4EE2A 3TJPA 1TBEA 1M94A 4W9JA 2SAKA 1E7PB 1T0QC 4M00A 4ANXA 5L95C 4RGOS 1WF9A 1ZE3D 3EECA 3WAPA 3ZRFA 4AS1A 2G9HD 4M8NA 1ZOYB 5JXVA 2Y5BB 2J7QB 2J52A 4TV3A 5C2TB 4XGAB 1WR6E 3ZTDA 4W9CA 4TKNA 1JWUD 3ECIA 4AJYB 1D4BA 4A20A 2WHIA 2VZKD 1GB4A 3VR9B 1AYFA 3U8ZA 1UGJA 2CU3A 3NZUA 3TEYA 2ZCBA 4CHKA 3RNBC 4HKQA 1BXTA 1TS4A 4FHKA 1C4PA 2O6VB 5G55A 2XK5A 1TZOA 4GU2A 1CK1A 3HRDD 4II3B 2WXLA 1UF0A 1U4AA 1JALA 1VD2A 2V4LA 5T8IA 4OHJA 1MVKA 1LO5D 5CHWA 3ZXRA 4GDLB 4AOFA 2BT6A 1IUEA 1WI0A 1QF6A 2WXKA 1AN8A 3MC8A 2VH2A 2ASQA 1SE2A 1RRBA 2IGGA 1E5WA 1FFUA 1E8WA 3U4EG 3PSEB 1NYQA 2DYMA 2YVCA 3KQ4A 2AYOB 3GE8C 2KT7A 4AQ7A 3B9JA 4AJWA 2AQ1B 4REZA 4FA6A 2GBRA 1SE3A 2KAJA 1L6UA 3A33B 1IBXB 1EUVB 2HD5B 4G3XB 1L5PA 4HPLB 1WJNA 1YQ4B 1OEYA 2WDTB 3QC8B 4YSYB 3VTVA 2LFIA 3C8YA 3BZDB 1C1YB 4MT5A 2MX2A 1WRIA 3ML9A 3AB5A 1UWXA 3KVFB 5EE1A 4K3BA 5IO9A 2LHDA 2AL6A 2KTRB 4GB9A 1F52A 1WGDA 2WQYB 2FE8A 1XEEA 1V8CA 1ZDXA 2WLBA 3H7PA 4F8CB 4EZJA 2AQ2B 3NVYA 4DDID 1MHHE 3IG3A 1WH3A 2LWPA 1LXDA 4XWWA 1FIQA 2XN9C 3AE9B 5DPRA 1F1HA 3VUWA 3NVWA 2CHWA 3DBHI 1K50A 2AL3A 4IUMB 1E7VA 4W9KA 4EFOA 1BMLC 3L54A 1T3QA 1N5XA 1BUIC 3UGBB 2Z0DB 2BGFA 2Y5CA 4YL8A 1UD7A 4YWGG 4IM3A 1ZPSA 2TSSA 1HTOA 3P4SB 2FNJB 1C78A 2VZKB 3GOEA 2V1YA 2MBQA 4YT0B 2DWQA 2QSDA 4RCOA 2RDBC 2WXRA 1YQ3B 3T3NA 3APDA 3A9JB 3V6EB 2G45B 4AWJA 4WAAA 2D5GA 3M63B 2BQQA 5EE0A 3AE8B 2KLCA 3EFCA 4C7YA 5GXGB 3DOWA 1HZ5A 2BYVE 2WWZA 4DXFA 4DHJD 2W3RA 5JHAA 4GGQA 4IW0A 2Y3AA 3T3OA 1FD6A 4HRSA 1R7SA 2KDBA 4JWUC 2IGHA 2I38A 3PZDA 1VCBA 3DHHC 3IAS1 2O2VB 4F7ZA 1YJJA 2DX5B 2KDIA 3AU4A 4IKGA 1QILA 4OZCA 2KWUB 3A9KB 4LCDE 3DVGY 3A4SC 4M8MA 4C7ZA 1MG4A 3AEGB 4E71A 1TJEA 3MFGA 3IAM1 1FNVA 1BT0A 3P4PB 1RLFA 1H8CA 4JLCA 3ZKJC 2KWCA 2JF5A 2ICIA 3CSTA 4LJPB 2MP2A 3PRMB 2V9HA 1ZXHA 2KTFA 5IAAC 1FO4A 1K52A 1WIAA 2CHXA 4RGNA 2L0FA 4TSSA 3Q2AC 3PS6A 5DCNA 3EUB2 4ANUA 3V61A 3MJ5A 4FLHA 4EKUA 3X23A 3CWIA 1AW7A 3FKYA 4GSWA 4JPSA 4XWTA 2BWFA 4WJQA 1V5TA 1UELA 4LDTD 1SB3C 4DDGD 3W2DA 1PGBA 2XBBC 3HHMA 3AV8A 2CKHB 3Q69A 4HPPA 1DOYA 1MI0A 1B9RA 3AEDB 5CTRC 2MJ3A 4FHJA 1E8ZA 2KQ4X 1OQRA 3N30A 1FNUA 3HIZA 4LK0M 4MACA 3N1ZC 2C7HA 3RPFC 1NENB 4ZRQA 3RNGC 2PPHA 4HDOA 1I7HA 3IVFA 4DHJB 3AE4B 4MH0E 3ZJTA 4HPMB 4OW0A 2MEKA 5G2NA 2MBBB 2N4FA 1EF5A 2WDRB 1ENFA 3QCAA 1IGDA 1HQRD 4TQ1A 3RNEC 3Q3NC 3ZW3A 4C00A 4HKZE 1KJTA 2L32A 3Q6BA 5EE9A 4NPNA 1OFFA 1WGHA 3AH7A 4G11A 3B08A 3V6CB 4PYZA 3A1QB 4P16A 2DAJA 2K8CA 1XO3A 1DOIA 4JGHB 1C3TA 1WMHB 3TUOA 3N9YC 3PT2B 4MGIE 4KGTA 4XX5A 5E6PA 2BYTA 5LXHA 2C7NB 4YTNB 1VDVA 4FJZA 4MEMA 2EKEC 1WJ4A 2GBMA 4OVUA 3APFA 1LFDA 3OJ3A 4JX1C 4RGMA 1WXMA 3WAOA 1MG8A 1XLNA 3SU8X 3AI5A 2DZIA 1VZ6A 4NAWA 3CIRB 1V1OA 3TEXA 1Z5SB 2ZCCA 5IKCM 2OHFA 2FBWB 5CHVC 3PHWB 4MGYE 3ZRCA 5KHQA 5HHDG 2RSUA 2RDGA 3VRBB 2AX5A 5IOIA 1I35A 2KOXA 3FC4A 3BVZA 4P6VF 4E3CA 1CQVA 2WXFA 2KFKA 3NG0A 1TYGB 4HXDA 3R8BA 3SD5A 2KDFB 1NI3A 4IM0A 1ESFA 2REXA 3RULA 2Z59B 2KVZA 2L1AA 2K5PA 4MM3A 4LDTB 1TKGA 3OLMD 3BWUD 3RZWC 1P3QU 5HG2A 4GOCA 1ET6A 4ZDVA 3ZTCA 1J7BA 3AE7B 2GI9A 1ACCA 1UZXB 4BZAA 1JWSD 2KN4A 4KVGB 5BO4B 2K9XA 3DBRB 4A90A 1OQYA 1JW9D 3VVWB 1QOBA 3ETRA 1M4VA 4IC7B 1WE6A 1MPEA 2OOBB 3R7QA 1B1ZA 3OJ4B 4NNJB 4B95A 3M3JA 2WXHA 2K3UA 4MH8A 1WXVA 3DBRI 4BBNC 1TS3A 5HKHA 1RFAA 2N9KA 3I3TB 4LTUA 2V0GA 2VRRB 2INDC 3VUYA 3DBSA 3VXWA 4WQMA 3AE3B 2CHZA 2D3BA 3PO0A 4MSMB 3OG5A 4IDIA 2L0TA 4FADA 2JQRB 5IN7A 1SF0A 5BYSA 3VUXA 3QAQA 2WDQB 3H8HA 2X38A 3TL5A 3J9CA 4ZHOA 3PPAA 2NVUI 4B0MA 2DNFA 1I4RA 1CJEA 2MA9B 1WM2A 3PLUA 4MGKE 1P98A 1XLQA 2MCNB 4WJOA 1TZ1A 2IBIB 4IOIE 5CX3A 1L6VA 1UWMA 3GB1A 2BWES 1OQQA 5D3IB 3AE2B 4MJSA 3PGEA 5J17A 3AE6B 1QOGA 2KFJA 2BB6A 1KF6B 4I6NB 1V49A 3Q8FA 3DBLI 1PYWD 3NZSA 1G6JA 1HA5A 4PK1A 2PJHA 1WZ0A 2IY1B 4KDIC 5EDSA 3HM6X 1SXTA 1FPYA 4HROA 4ZRKA 3JSVA 1FXIA 5AZGA 2QMTA 1C9FA 1Y8RC 2W82A 2JZPA 1ZP0B 4XC2A 3BVMA 3KUDB 1J8CA 2RPQA 3FILA 2PVOD 2MHJA 1N60A 2FUHB 1XCQL 1FRDA 3VH4B 2XEWA 4KIKB 1XD3B 3VRAB 4G50A 4MDKE 1KRHA 3KUZA 2ON8A 2KLGA 2JZ3B 4NJ6A 3VHTC 4BOSC 4F1SA 2BYEA 2WXNA 1RWSA 5E6NA 5C1ZA 2E3TA 3AM9A 2KD0A 2LVOA 1WY8A 4KGRA 1YMHE 3T8MA 4M0WA 1QQRA 1C4CA 1L0VB 4N59A 1JWMD 4KKJA 3TEWA 3AN1A 2V3PA 2WXQA 1F2RC 1P7EA 3ENEA 5HFYA 1E90A 5BMGA 3CMMB 3IHPC 1S1QB 1ISNA 2LRWA 3ZIMA 2LGSA 2KQ7A 4PYUA 5E6OA 2K25A 5LXIB 1T5XD 4W9FA 4K7WA 1UBIA 3NRZA 1EF1A 4OVVA 1ZKHA 3HVZA 3GE3C 3QK0A 4N9F4 1FMAD 4BBNF 3UQBA 3IXSA 2WXMA 4CQNA 4MELA 3URYA 3NJTA 1QT9A 2K1FA 2BW2A 2JVCA 1SEBD 1QOAA 2WX1A 1K8RB 3DBHB 2IYDB 5BMHA 3U30A 1QOFA 4BKSA 2D2QA 1WJ6A 2BS2B 2N9LA 3NVZA 2JXTA 1GNUA 3NHEB 1I4PA 3ABVB 2I1KA 3GP7A 1YN4A 2LEKA 2ONQA 2R2QA 3LJ3A 1E9MA 4KGSA 2ZW1A 1I4QA 4RMAA 4ICUA 4PS3A 1AARA 4GDKA 5C3JB 2R61A 2QEJC 2NPTA 3Q3JA 1VZ8A 4QAYA 1SE4A 3N1YC 4WH4A 1JWBD 1V1PA 4P1BC 2IO1B 4MGZE 2JRIB 1L4ZB 1EU4A 2MLBA 3NY5A 1TTNA 3B2FA 3UINB 3VH3B 1T6BX 4PS8A 1D5XC 2KJHB 3AXCA 1PGXA 3L13A 1A5RA 2DZJA 3UIPB 4A3PA 2B3AA 4HK2A 2YEPF 2PMVA 2N9XA 2BVCA 5FR6A 3WA0A 4A3OA 4P7IA 4OZBA 1YQBA 1X1MA 1XLPA 4ARCA 2W3SA 3R2TA 3ZDTA 3ZGZA 2RMMA 3B2GA 1JCKB 1P0RA 4GLSC 2GBKA 3VAWA 3V60A 4L2YA 1WJUA 2KHWB 2DAFA 1OEYJ 2V3SA 2O6VA 3ZJUA 1D5ZC 2LXCA 3RNFC 5J18A 5E6JA 2DHZA 2NBUA 2LJ5A 3NUHB 2H88B 1YN3A 4LNFA 2GLSA 2LMCA 2OJWA 5AZFA 2HTHA 3U2SC 2C5LC 3S2AA 3DHIC 3NOBA 2WGSA 4GDLA 5C23A 2JX5A 4II2B 4RFBA 3R66C 1L7YA 3APCA 2ZNVC 3WANA 3VR8B 2J0KA 4TMAB 2NBWB 2MJDA 2KX3A 2K39A 3KW5B 3VFKA 3Q8BA 3U7DA 1D5MC 4K3CA 2E6XA 1YIWA 1R4NI 3ZNHB 3ONSA 1HE8A 1Z2MA 4PS7A 2JU6X 3LXFA 1H4RA 1IBXA 1TKEA 1P7FA 3ZO5B 4HLEA 2RD0A 3WALA 2W9NA 2IPKD 1YOVB 1SIFA 3ALBA 4EEWA 4D2KA 2KMMA 1KLVA 3TEZA 4FN2A 3AEBB 4ITKA 2PLPA 3SDLC 4DWFA 1R4MI 2KTRA 2KN5A 3UI3A 3ZQ4A 4ARIA 3AULA 4RNAA 2KMCA 1YNTE 2SEBD 3E56A 3H1UA 1D3ZA 4KSKC 3TIXA 2INCC 2ZEQA 3L16A 5JZEB 3IFWB 3Q8CA 2BS4B 2LJIA 4XDCA 2DZMA 4HWIB 2M56B 1NDDA 3QX1A 3EC8A 2LGDA 3FAHA 4IM2A 1F9JA 4HJGE 2KWDA 3ZUNA 1V9JA 3PLVA 1WM3A 2JYEA 4WJNA 2BS3B 3KLSX 5FKAC 1Q10A 2ZZPB 3SHQA 1Q5WB 3QIJA 4ANVA 3E9SA 2GBJA 4JQWC 1J7CA 2MQJA 3V62A 3MP9A 4A9AA 4DXAB 1WE7A 3HVDA 2WXGA 1K51A 1RFKA 3A9JA 2L83A 4ZOHC 2KC2A 1XF5L 1LM8B 2LVQA 3Q8EA 1SE9A 4LNIA 4A6QA 4GIVA 3RN9C 1PFDA 3IT4B 3EHVA 1SBBB 1GOZA 3O13A 2RDHA 1XXGA 4WWPA 3QJZA 5D7GA 1TS2A 2JXXA 5D2MB 3MJWA 1MJDA 1WGYA 2IO0B 2XK5B 1VRAB 3PRZA 2I2YA 2WU2B 4RGTA 5FR3A 1VJKA 1FCLA 3JVZX 2FIDA 1YX5B 2O2VA 1V81A 2PIAA 3QQ8B 4S17A 1E10A 3R3MA 2WNMA 1WGGA 2H89B 1UGMA 2QDFA
chains in the Genus database with same CATH topology
3MHZA 1T3QA 1N5XA 1HA5A 1BUIC 3U52E 1XLOA 1RYJA 2JWUA 3P42A 2Y5CA 1SXTA 1HZ6A 4YWGG 1ZPSA 2TSSA 1AWDA 4HROA 2PVGC 3P4SB 4YXDB 4US8A 1C78A 1FXIA 2VZKB 2QMTA 2Q5WD 4C80A 1C9FA 3SEBA 4US9A 1UNSA 2W82A 3EA6A 2M19A 1N61A 3P1MA 4YT0B 2JZPA 2DWQA 1ZP0B 2CJNA 2QSDA 3BVMA 4RCOA 4XDDA 1XCTL 3FILA 5H92C 2PVOD 1N60A 2WXRA 4WAFA 1F0ZA 1DYQA 1YQ3B 3BYYB 2INPE 2PTLA 3T3NA 5LNK1 3DWGC 1XCQL 3WCQA 1FRDA 1D6EC 2D5GA 5EE0A 3AE8B 4PT5A 3NVVA 5EE3A 1FFVA 2K22A 1A70A 3NZ3A 2KDMA 1KLUD 4N58A 3VRAB 1PUTA 5BMIA 1KRHA 2YEPB 4C7YA 2B76B 2EELA 5GXGB 1HZ5A 2ON8A 1KTKA 1QKZA 5AUIA 4O1NA 1ZUD2 4DXFA 2G1EA 4USAA 2WXNA 1RWSA 2W3RA 2INNE 2V4IB 4N6EB 1TY2A 2E3TA 2DBYA 1MHXA 3AM9A 1UUPA 1L0YB 2QIEB 5G5GA 4KGRA 4YSZB 1YMHE 2Y3AA 4M0WA 1QQRA 1C4CA 2L52A 1L0VB 3T3OA 2LHEA 1FD6A 4N59A 4HRSA 1JWMD 1J7AA 1TY0A 4KKJA 3TEWA 3AN1A 1R7SA 2V3PA 4JWUC 4NAMA 4WURA 2IGHA 2I38A 2WXQA 1F2RC 1P7EA 5HFYA 2RPVA 5BMGA 3IAS1 1YJJA 1HEZE 5H8YE 4IKGA 1ET9A 1QILA 1FXAA 4OZCA 1RM6C 1T5XD 1STEA 1I4XA 1TKYA 3NRZA 4A55A 3HVZA 3LB8C 1FMAD 2JYTA 3L4PA 4WWMA 5TSSA 3SR6A 4Q2JA 2MH7A 5D3DA 1F2RI 3IXSA 3I57A 2WXMA 5I4DA 4RF1A 4CQNA 1GAQB 3URYA 4C7ZA 3AEGB 3R2IA 1TJEA 1QT9A 2ACZB 2AQ3B 2DLBA 3MFGA 2BW2A 3IAM1 3KWLA 1SEBD 3FILB 1FNVA 1QOAA 5BMHA 3P4PB 2PKOA 1FRRA 2ICIA 5AUKA 5BYQA 2EKIA 1QOFA 1SJED 1GB1A 1K53A 1EWYC 2BS2B 1V1PB 1ZXHA 2N9LA 2XNAC 2J4XA 3NVZA 1FO4A 1Y56A 2IDYA 4HEA1 2DYOA 1K52A 2JXTA 2QJLA 4NJCA 4RGNA 1I4PA 1KLGD 1YJIA 3BK2A 4TSSA 4DQOC 4ZHPA 4XE0A 1NEKB 3ABVB 1EM7A 2BTEA 3GP7A 3EUB2 1YN4A 2NTTA 2LEKA 2ONQA 3MJ5A 2LUMA 3AEAB 1C76A 3AE1B 1E9MA 4KGSA 3CWIA 1AW7A 2W54A 2ZW1A 1WXQA 4RF0A 4JPSA 1I4QA 4XWTA 3TSSA 3BIID 3P63A 4C56C 4KX6B 1SJHD 1SSNA 5BYRA 2N0SB 4OZAA 1SB3C 3V05A 3SFEB 3AEFB 3AECB 5C3JB 2R61A 2QEJC 3W2DA 1PGBA 1VZ8A 1SE4A 2WDVB 1C79A 3AV8A 1JWBD 4WH4A 1V1PA 5HI1A 3ZYYX 3Q69A 1DOYA 1DOXA 1MI0A 1B9RA 1PDXA 2J42A 3AE5B 3AEDB 1L4ZB 1ZDVA 1EU4A 2MJ3A 2IGDA 3B2FA 2JSVX 1T6BX 2KQ4X 1OQRA 2MJEA 4OVZA 1FNUA 1JWAD 1D5XC 1PGAA 1PGXA 3LYYA 4LK0M 4MACA 2PW9A 2OEDA 4WIPA 4RH6A 3RPFC 2BBCA 1VR9A 1NENB 4ZRQA 2YEPF 2PMVA 1I7HA 2WXPA 3W5VB 1KH0A 3AE4B 3ZJTA 2J53A 4OW0A 2MEKA 3AMZA 4OZBA 2WDRB 1ENFA 1XLPA 1IGCA 1IGDA 1HQRD 4ARCA 3DWMA 2W3SA 3R2TA 4TQ1A 3HUIA 3V3XA 3ZGZA 2RMMA 4UDUC 3B2GA 1JMLA 4HKZE 1JCKB 1FNWA 4GLSC 1I4GA 1N62A 2L32A 4L2YA 2GRIA 2WXOA 1E0ZA 5EE9A 2Z8LA 1OFFA 2WXIA 3AH7A 3BYTB 3P4RB 1ROEA 1YN5A 4B0EA 3KWVA 2V3NA 2NMQA 4P16A 3ZJUA 1D5ZC 5E6JA 1XO3A 1C4AA 1DOIA 3NS1A 2WXJA 3NUHB 4YTMB 3TUOA 2H88B 3PZ8A 3N9YC 3AEEB 1CZPA 1VLBA 1YN3A 2HDEA 4KGTA 1HXYD 4JWSC 2ZW0A 2LMCA 2BYTA 1N63A 3W5UB 3U2SC 4YTNB 3W9CB 4GDKB 1FEHA 2JX5A 1KFYB 4RFBA 3MC0B 1VDVA 4R3DA 2HTME 3RFZB 3SFDB 1ZXIA 1WYGA 3Q8AA 3VR8B 2WS3B 4TMAB 2MJDA 4L23A 4JX1C 4RGMA 3VQIA 3Q8BA 4KKIA 2FUG1 1XLNA 1WGKA 4ZRPA 1D5MC 1VZ6A 2E6XA 3CIRB 1V1OA 1VZ7A 3TEXA 4EE2A 2WU5B 1E6EB 2BB5A 2FBWB 2OHFA 2W55A 2NTSA 2SAKA 1E7PB 4NZLB 5HHDG 3ZJVA 2RDGA 3VRBB 2AX5A 4RGOS 3FC4A 1ZE3D 2JU6X 3BVZA 3U7ZA 3LXFA 4AS1A 1IBXA 2G9HD 4DXGA 1ZOYB 5JXVA 4P6VF 1TKEA 1CQVA 1P7FA 2J52A 2WXFA 5C2TB 1QLBB 1TYGB 4A8XC 3R8BA 2IPKD 1JWUD 1NI3A 4JE3B 1D4BA 4D2KA 2KMMA 2Y5PA 3TEZA 1ESFA 3AEBB 2VZKD 2KACA 1GB4A 3VR9B 1AYFA 2L1AA 2PLPA 4ITKA 2K5PA 1EWCA 1UGJA 2CU3A 1TKGA 3TEYA 1L0XB 2CJOA 5G5HA 3ZQ4A 3UI3A 4HKQA 1BXTA 2LGIA 4YTPB 1JROA 4ARIA 1TS4A 3BWUD 4RNAA 1C4PA 5HG2A 1FCCC 1YNTE 2SEBD 1DGJA 1TZOA 1ET6A 3OWEB 1CK1A 3HRDD 3E56A 5FK9C 3BVGA 1J7BA 3P4QB 2WXLA 3AE7B 2GI9A 1JRPA 1JQ4A 1JALA 4H2AA 1ACCA 3IT6B 1JWSD 2KN4A 3Q8CA 2BS4B 1WWTA 5T8IA 4OHJA 2LJIA 4XDCA 1MVKA 1V97A 1LO5D 2M56B 4J3OD 2K9XA 4GDLB 4A90A 1JW9D 3FAHA 4L1BA 1QOBA 2BT6A 2KWDA 4HJGE 1IUEA 3ETRA 1M4VA 2M0AA 1QF6A 2WXKA 1AN8A 1TS5A 1MPEA 2JYEA 1N5WA 1B1ZA 1SE2A 2K0PA 2IGGA 5MPOA 2WXHA 2K3UA 1FFUA 2BS3B 3KLSX 4MH8A 3U4EG 5FKAC 4NAWB 1Q10A 2N7JA 1F77A 1TS3A 1NYQA 2N9KA 4LLGM 2DYMA 4LTUA 4TQ0A 3KQ4A 2V0GA 3E9SA 4ZYSA 1J7CA 1SIJA 1WSPA 3B9JA 4AQ7A 2AQ1B 4FXCA 4REZA 3GS2A 4WQMA 3MP9A 3AE3B 4A9AA 1SE3A 2KAJA 1L6UA 3PO0A 3HVDA 1IBXB 2WXGA 3W1SA 1K51A 1RFKA 3I9V1 1NYRA 1L5PA 2L83A 4IDIA 4ZOHC 1YQ4B 2JQRB 4YSYB 1XF5L 1SF0A 2LFIA 3C8YA 5BYSA 1FM0D 3BZDB 3Q8EA 2WDQB 4MT5A 4A6QA 2IJ0A 1PFDA 3IT4B 3H8HA 2X38A 1WRIA 1C77A 1L4DB 1SBBB 1GOZA 3AB5A 1UWXA 3J9CA 3O13A 2RDHA 4ZHOA 1XXGA 4MM3B 5EE1A 2GB1A 2LHDA 4B0MA 5D7GA 1I4RA 1CJEA 1TS2A 2WQYB 4YSXB 2FE8A 1XEEA 1XLQA 1V8CA 1ZDXA 1VRAB 2WP9B 4IOIE 2WLBA 2I2YA 1L6VA 1UWMA 2AQ2B 2WU2B 3NVYA 1MHHE 3GB1A 4RGTA 1NVID 5FR3A 1VJKA 1OQQA 1FCLA 5D3IB 3AE2B 4XWWA 1FIQA 2QILA 2XN9C 3AE6B 1QOGA 3AE9B 1GPXA 3PZ7A 3EGRA 2PIAA 3NVWA 1I4HA 1E10A 1K50A 2BB6A 2WNMA 1KF6B 1EU3A 3Q8FA 2H89B 1PYWD 3BK1A 1BMLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2SAK A;  1SSN A;  1C78 A;  1C79 A;  1BUI C;  1C76 A;  1C77 A; 
#chains in the Genus database with same CATH topology
 3TBL D;  3TMP B;  4W9G A;  3U52 E;  1XLO A;  3DVN U;  1RYJ A;  2JWU A;  3P42 A;  3N32 A;  2LRU A;  3JYU A;  2PVG C;  3A9K A;  4US8 A;  4US9 A;  2AWT A;  3EA6 A;  2M19 A;  2MW5 A;  1XCT L;  5H92 C;  5CHF A;  4WAF A;  5L83 A;  1DYQ A;  2INP E;  3L10 B;  1GC6 A;  2O6V D;  2K6D B;  5KHO A;  3NVV A;  2RR9 A;  5EE3 A;  2K22 A;  3NZ3 A;  2KDM A;  4BFR A;  5BMI A;  2YEP B;  4BOZ B;  2EEL A;  2QCZ A;  1PQS A;  4O1N A;  1ZUD 2;  1IYF A;  2EMS A;  2D3C A;  4USA A;  2V4I B;  2MSE D;  3L0W B;  2DBY A;  1L0Y B;  2N1W A;  5G5G A;  4YSZ B;  1Q1O A;  3H7P B;  2LHE A;  2KDE B;  1J7A A;  2JT4 B;  4S0R A;  2WX0 A;  2JY6 A;  2X8X X;  1V80 A;  2RPV A;  2WYQ A;  3MC9 A;  2KKC A;  1HEZ E;  1J0G A;  1E8X A;  1ET9 A;  1WR1 A;  1WZ3 A;  1HTQ A;  1RM6 C;  1STE A;  4W9E A;  1KOT A;  1V6E A;  3LB8 C;  3T9L A;  4URK A;  4LJO B;  2JYT A;  2ZVO A;  2HE7 A;  4WWM A;  4LNK A;  5TSS A;  3SR6 A;  4Q2J A;  2MH7 A;  2BPS A;  1F2R I;  3I57 A;  1GAQ B;  2KJR A;  3M62 B;  4IWP A;  2M8S A;  3MTN B;  4KZC A;  1GC7 A;  3R2I A;  2HJ1 A;  4WWN A;  2DLB A;  2PE6 B;  5J2R A;  4ASW C;  3DBL B;  4CO7 A;  2EKI A;  4ZRJ A;  1GB1 A;  3EFU A;  1K53 A;  2XNA C;  1V1P B;  4K81 A;  2NCN A;  2J4X A;  5AEK B;  2BKR B;  1Y56 A;  1OGW A;  3RYT A;  2DYO A;  3L08 A;  4NJC A;  3RT3 B;  1YJI A;  3BK2 A;  4DQO C;  2DZK A;  4P1C C;  4ZHP A;  1NEK B;  2KO3 A;  3KH0 A;  4KDL B;  4C4V A;  2KMA A;  3PRE A;  3B1L X;  2LUM A;  3A1Q A;  3RD2 A;  2D07 B;  2L8J A;  2W54 A;  4B9K A;  4ZRI A;  4RF0 A;  3RMK C;  1WMH A;  4E74 A;  4ACF A;  1SSN A;  5BYR A;  2KVR A;  3WIM A;  2BYF A;  4DHZ E;  2GOW A;  2IY0 B;  4DHZ B;  4J6I A;  1C79 A;  4X57 B;  2KNB A;  5HI1 A;  3ZYY X;  1DOX A;  2J42 A;  1TGZ B;  1ZDV A;  2C7M B;  2N7D A;  4OVZ A;  1JWA D;  3ZXV A;  3LYY A;  2D3A A;  2OED A;  2KXJ A;  2BBC A;  5JH5 C;  3DVN V;  2CU1 A;  3W5V B;  3PHX B;  3N1X C;  2MP2 B;  1WYW B;  3N3K B;  1KM7 A;  4EUT A;  2JZZ A;  3V3X A;  3R7R A;  4UDU C;  1JML A;  1FNW A;  1I4G A;  1N62 A;  4CYE A;  2GRI A;  2Z0E B;  2A4Z A;  2BF8 B;  1T0S C;  2WXO A;  2GMI C;  1E0Z A;  2D10 A;  2Z8L A;  4WWO A;  2NS5 A;  4IG7 B;  3VTU A;  1ROE A;  1YN5 A;  2IO2 B;  2NMQ A;  2IZV B;  4W9I A;  2LVP A;  4NQL B;  1MFW A;  1C4A A;  3B0A A;  2WXJ A;  1V2Y A;  1HXY D;  2EMT A;  2ZW0 A;  1WFY A;  2UYZ B;  2MBH A;  1N63 A;  3W5U B;  3W9C B;  2K8H A;  4RM9 A;  1FEH A;  4DBG A;  1KFY B;  5GMV A;  2FCQ A;  2LI5 A;  3RFZ B;  3SFD B;  1ZXI A;  1WYG A;  5DPW A;  4FBJ B;  1GUA B;  4WQO B;  4ANW A;  3VQI A;  2L7R A;  4BVU C;  4KKI A;  2FUG 1;  1P1A A;  2L00 B;  2JUO A;  2ZNV B;  1VZ7 A;  2WU5 B;  1E6E B;  2BB5 A;  1N6Z A;  2W55 A;  2QHO A;  2NTS A;  3ZNZ B;  1RAX A;  3ZNI D;  4NZL B;  3ZJV A;  3U7Z A;  4XZ4 A;  2VH1 A;  3PVL A;  4DXG A;  2GBN A;  1QLB B;  4A8X C;  4EZK A;  4JE3 B;  2Y5P A;  1WX9 A;  4M01 A;  4NJ7 A;  2NR2 A;  3RUI B;  3UIO B;  2KAC A;  5DPT A;  2I1J A;  1GJZ A;  1WRD B;  3Q3F A;  1EWC A;  5JHB A;  1I42 A;  2J0M A;  1L0X B;  1J19 A;  2CJO A;  5G5H A;  3W1S C;  2LGI A;  4YTP B;  1JRO A;  1FCC C;  2J0J A;  1DGJ A;  2N7E A;  2A5U A;  3OWE B;  4G0N B;  5FK9 C;  3BVG A;  5IA7 A;  3ZLZ A;  3P4Q B;  1JRP A;  1JQ4 A;  3P2B A;  4H2A A;  3WAM A;  3IT6 B;  1WWT A;  1V97 A;  4FJY A;  4J3O D;  4NY0 A;  3CF6 E;  3NS8 A;  4L1B A;  2LUE A;  1V5O A;  2JRH A;  4GXB A;  2M0A A;  3A4R A;  1TS5 A;  1N5W A;  2PE9 A;  3H6N A;  2K0P A;  5AZH A;  5MPO A;  1ZW7 A;  4NAW B;  2N7J A;  2PEA A;  1F77 A;  3H7S A;  4LLG M;  4EZL A;  1OTR B;  4TQ0 A;  4ZYS A;  1SIJ A;  1WSP A;  4FXC A;  3GS2 A;  1UH6 A;  1V86 A;  2QC8 A;  4K7U A;  4M02 A;  2C60 A;  4GMV A;  3W1S A;  2KAN A;  3VTW A;  3I9V 1;  2AEH A;  1NYR A;  2KC1 A;  2KFK B;  4KIK A;  4BKT A;  3BIN A;  3RI7 C;  2ZVN A;  1FM0 D;  4DK5 A;  2IJ0 A;  1C77 A;  1L4D B;  4MM3 B;  2GB1 A;  2LD9 A;  1R4N B;  4K1R B;  4ZYN A;  4YSX B;  1WXA A;  4FJV B;  2WP9 B;  2N1V A;  1NVI D;  2KK8 A;  4XYC A;  1P9D U;  2R2O A;  1WX8 A;  2QIL A;  2DYB A;  1GPX A;  3PZ7 A;  2MBE A;  3EGR A;  3M95 A;  4W9D A;  1I4H A;  2FCS A;  1IP9 A;  1R4M B;  1EU3 A;  3BK1 A;  2K8B A;  3MHZ A;  2N9P C;  2HJ8 A;  2LGY A;  3UF8 A;  2L76 A;  4JIO U;  1HZ6 A;  2LZ6 A;  3DCG A;  1AWD A;  2ZPN A;  4YXD B;  3K9P B;  2Q5W D;  4C80 A;  3Q14 C;  3SEB A;  4IWO A;  1UNS A;  2G4D B;  3P1M A;  1N61 A;  3I5J C;  4KV2 A;  4B6W A;  2CJN A;  4XDD A;  3QA8 A;  2KZR A;  2FAZ A;  2CS4 A;  3BY4 B;  1F0Z A;  3BYY B;  3UQA A;  2PTL A;  5LNK 1;  3DWG C;  3WCQ A;  4KSL C;  1D6E C;  3AU5 A;  2JWZ A;  4PT5 A;  1FFV A;  1YX6 B;  3N20 C;  1A70 A;  4N58 A;  1KLU D;  1PUT A;  3OAW A;  4AP4 C;  4RM8 A;  2B76 B;  1NBF C;  1KTK A;  1QKZ A;  1WX7 A;  5AUI A;  4W9L A;  2G1E A;  2G3Q B;  2M17 A;  4BKG A;  3QHT A;  2INN E;  4N6E B;  1TY2 A;  1MHX A;  2L3Z A;  1UUP A;  2QIE B;  2FCM A;  4I6P A;  4BKS D;  2KQS A;  2UU7 A;  2YLM A;  2CR5 A;  2L52 A;  2M1M A;  4BAX A;  1TY0 A;  4GN1 A;  4WUR A;  4NAM A;  1TIF A;  2FIF A;  5IP4 D;  4HJK A;  4TUU A;  3LDZ E;  4MJS B;  3GZN B;  1XQQ A;  5H8Y E;  2NBV B;  1FXA A;  2BKF A;  4LNN A;  1YD8 U;  1I4X A;  1XT9 B;  4JL9 A;  1IPG A;  4C4V B;  1TKY A;  2OJR A;  1LQB A;  4A55 A;  3GZN I;  1L2N A;  3IBE A;  3L4P A;  2MRP A;  3CSF A;  3JSV B;  3DHG C;  4K7S A;  5D3D A;  3RNA C;  2G4S A;  5I4D A;  3PTF C;  4RF1 A;  5D6J B;  2C9W B;  2ACZ B;  2AQ3 B;  3ML8 A;  3QWZ B;  3KWL A;  4ICV A;  3FIL B;  2FCN A;  4AUQ C;  1SGH A;  3HK0 A;  2L05 A;  2PKO A;  1FRR A;  5AUK A;  1E8Y A;  5BYQ A;  3L17 A;  3H9D A;  1SJE D;  2N9E B;  1EWY C;  2IO3 B;  2IDY A;  4HEA 1;  2MWS B;  2QJL A;  1KLG D;  1EO6 A;  5DPS A;  2M0X A;  4XE0 A;  3QAR A;  2BTE A;  1EM7 A;  3PRP B;  1YJ1 A;  3X0W A;  2NTT A;  4HCN B;  3KYD D;  3VDZ A;  3DQV A;  3AEA B;  5TR5 A;  1C76 A;  4HVB A;  3AE1 B;  3JW0 X;  1WXQ A;  2ZPY A;  4M0W B;  3O65 B;  3TSS A;  3RNC C;  3BII D;  3P63 A;  4C56 C;  4KX6 B;  1SJH D;  3TCA A;  1FXT B;  3KUC B;  2N0S B;  4OZA A;  2MBO A;  3V05 A;  1S3S G;  3SFE B;  2D3G A;  3AEF B;  3AEC B;  4FUL A;  4LNO A;  3C0R B;  4WJP A;  5D94 A;  2WDV B;  3RZF A;  4I6L B;  1PDX A;  1LGR A;  3AE5 B;  4MSQ B;  4NQK E;  1QZE A;  2IGD A;  2JSV X;  2MJE A;  3DDC B;  2KX0 A;  3KYC D;  1WXS A;  1PGA A;  1ZGU B;  2KJ6 A;  2PW9 A;  3HM3 A;  4WIP A;  4RH6 A;  3DPD A;  3ZDM C;  1VR9 A;  2WXP A;  1KH0 A;  3ZVV A;  2KYW A;  4IWQ A;  2J53 A;  3PV1 A;  3AMZ A;  1T0Y A;  3C19 A;  1E7U A;  1IGC A;  2RGF A;  3DWM A;  3HUI A;  1Q0W B;  3K9O B;  3DVG X;  2LAS A;  1WGR A;  2LXA A;  2KWV B;  2WXI A;  3BYT B;  3P4R B;  4B0E A;  3KWV A;  3Q3M C;  2V3N A;  1GG3 A;  1NI2 A;  1T0R C;  2JPH A;  1TT5 B;  3I63 C;  2M4N A;  3MHS D;  2UWQ A;  5LLI A;  2ZJD A;  3NS1 A;  4YTM B;  2K6Q A;  3PZ8 A;  3AEE B;  1CZP A;  1VLB A;  2HDE A;  4JWS C;  4EOY A;  1JRU A;  1CMX B;  4GDK B;  2D11 A;  3W1Y A;  3RCZ A;  3MC0 B;  2NPT B;  4R3D A;  2HTM E;  4HCP B;  3ZNG C;  3Q8A A;  2WS3 B;  2LGX A;  4HDQ A;  4KZ0 A;  4L23 A;  3D32 A;  3Q3O C;  4W9H A;  1WGK A;  2DEN B;  4ZRP A;  1UBQ A;  4EE2 A;  3TJP A;  1TBE A;  1M94 A;  4W9J A;  2SAK A;  1E7P B;  1T0Q C;  4M00 A;  4ANX A;  5L95 C;  4RGO S;  1WF9 A;  1ZE3 D;  3EEC A;  3WAP A;  3ZRF A;  4AS1 A;  2G9H D;  4M8N A;  1ZOY B;  5JXV A;  2Y5B B;  2J7Q B;  2J52 A;  4TV3 A;  5C2T B;  4XGA B;  1WR6 E;  3ZTD A;  4W9C A;  4TKN A;  1JWU D;  3ECI A;  4AJY B;  1D4B A;  4A20 A;  2WHI A;  2VZK D;  1GB4 A;  3VR9 B;  1AYF A;  3U8Z A;  1UGJ A;  2CU3 A;  3NZU A;  3TEY A;  2ZCB A;  4CHK A;  3RNB C;  4HKQ A;  1BXT A;  1TS4 A;  4FHK A;  1C4P A;  2O6V B;  5G55 A;  2XK5 A;  1TZO A;  4GU2 A;  1CK1 A;  3HRD D;  4II3 B;  2WXL A;  1UF0 A;  1U4A A;  1JAL A;  1VD2 A;  2V4L A;  5T8I A;  4OHJ A;  1MVK A;  1LO5 D;  5CHW A;  3ZXR A;  4GDL B;  4AOF A;  2BT6 A;  1IUE A;  1WI0 A;  1QF6 A;  2WXK A;  1AN8 A;  3MC8 A;  2VH2 A;  2ASQ A;  1SE2 A;  1RRB A;  2IGG A;  1E5W A;  1FFU A;  1E8W A;  3U4E G;  3PSE B;  1NYQ A;  2DYM A;  2YVC A;  3KQ4 A;  2AYO B;  3GE8 C;  2KT7 A;  4AQ7 A;  3B9J A;  4AJW A;  2AQ1 B;  4REZ A;  4FA6 A;  2GBR A;  1SE3 A;  2KAJ A;  1L6U A;  3A33 B;  1IBX B;  1EUV B;  2HD5 B;  4G3X B;  1L5P A;  4HPL B;  1WJN A;  1YQ4 B;  1OEY A;  2WDT B;  3QC8 B;  4YSY B;  3VTV A;  2LFI A;  3C8Y A;  3BZD B;  1C1Y B;  4MT5 A;  2MX2 A;  1WRI A;  3ML9 A;  3AB5 A;  1UWX A;  3KVF B;  5EE1 A;  4K3B A;  5IO9 A;  2LHD A;  2AL6 A;  2KTR B;  4GB9 A;  1F52 A;  1WGD A;  2WQY B;  2FE8 A;  1XEE A;  1V8C A;  1ZDX A;  2WLB A;  3H7P A;  4F8C B;  4EZJ A;  2AQ2 B;  3NVY A;  4DDI D;  1MHH E;  3IG3 A;  1WH3 A;  2LWP A;  1LXD A;  4XWW A;  1FIQ A;  2XN9 C;  3AE9 B;  5DPR A;  1F1H A;  3VUW A;  3NVW A;  2CHW A;  3DBH I;  1K50 A;  2AL3 A;  4IUM B;  1E7V A;  4W9K A;  4EFO A;  1BML C;  3L54 A;  1T3Q A;  1N5X A;  1BUI C;  3UGB B;  2Z0D B;  2BGF A;  2Y5C A;  4YL8 A;  1UD7 A;  4YWG G;  4IM3 A;  1ZPS A;  2TSS A;  1HTO A;  3P4S B;  2FNJ B;  1C78 A;  2VZK B;  3GOE A;  2V1Y A;  2MBQ A;  4YT0 B;  2DWQ A;  2QSD A;  4RCO A;  2RDB C;  2WXR A;  1YQ3 B;  3T3N A;  3APD A;  3A9J B;  3V6E B;  2G45 B;  4AWJ A;  4WAA A;  2D5G A;  3M63 B;  2BQQ A;  5EE0 A;  3AE8 B;  2KLC A;  3EFC A;  4C7Y A;  5GXG B;  3DOW A;  1HZ5 A;  2BYV E;  2WWZ A;  4DXF A;  4DHJ D;  2W3R A;  5JHA A;  4GGQ A;  4IW0 A;  2Y3A A;  3T3O A;  1FD6 A;  4HRS A;  1R7S A;  2KDB A;  4JWU C;  2IGH A;  2I38 A;  3PZD A;  1VCB A;  3DHH C;  3IAS 1;  2O2V B;  4F7Z A;  1YJJ A;  2DX5 B;  2KDI A;  3AU4 A;  4IKG A;  1QIL A;  4OZC A;  2KWU B;  3A9K B;  4LCD E;  3DVG Y;  3A4S C;  4M8M A;  4C7Z A;  1MG4 A;  3AEG B;  4E71 A;  1TJE A;  3MFG A;  3IAM 1;  1FNV A;  1BT0 A;  3P4P B;  1RLF A;  1H8C A;  4JLC A;  3ZKJ C;  2KWC A;  2JF5 A;  2ICI A;  3CST A;  4LJP B;  2MP2 A;  3PRM B;  2V9H A;  1ZXH A;  2KTF A;  5IAA C;  1FO4 A;  1K52 A;  1WIA A;  2CHX A;  4RGN A;  2L0F A;  4TSS A;  3Q2A C;  3PS6 A;  5DCN A;  3EUB 2;  4ANU A;  3V61 A;  3MJ5 A;  4FLH A;  4EKU A;  3X23 A;  3CWI A;  1AW7 A;  3FKY A;  4GSW A;  4JPS A;  4XWT A;  2BWF A;  4WJQ A;  1V5T A;  1UEL A;  4LDT D;  1SB3 C;  4DDG D;  3W2D A;  1PGB A;  2XBB C;  3HHM A;  3AV8 A;  2CKH B;  3Q69 A;  4HPP A;  1DOY A;  1MI0 A;  1B9R A;  3AED B;  5CTR C;  2MJ3 A;  4FHJ A;  1E8Z A;  2KQ4 X;  1OQR A;  3N30 A;  1FNU A;  3HIZ A;  4LK0 M;  4MAC A;  3N1Z C;  2C7H A;  3RPF C;  1NEN B;  4ZRQ A;  3RNG C;  2PPH A;  4HDO A;  1I7H A;  3IVF A;  4DHJ B;  3AE4 B;  4MH0 E;  3ZJT A;  4HPM B;  4OW0 A;  2MEK A;  5G2N A;  2MBB B;  2N4F A;  1EF5 A;  2WDR B;  1ENF A;  3QCA A;  1IGD A;  1HQR D;  4TQ1 A;  3RNE C;  3Q3N C;  3ZW3 A;  4C00 A;  4HKZ E;  1KJT A;  2L32 A;  3Q6B A;  5EE9 A;  4NPN A;  1OFF A;  1WGH A;  3AH7 A;  4G11 A;  3B08 A;  3V6C B;  4PYZ A;  3A1Q B;  4P16 A;  2DAJ A;  2K8C A;  1XO3 A;  1DOI A;  4JGH B;  1C3T A;  1WMH B;  3TUO A;  3N9Y C;  3PT2 B;  4MGI E;  4KGT A;  4XX5 A;  5E6P A;  2BYT A;  5LXH A;  2C7N B;  4YTN B;  1VDV A;  4FJZ A;  4MEM A;  2EKE C;  1WJ4 A;  2GBM A;  4OVU A;  3APF A;  1LFD A;  3OJ3 A;  4JX1 C;  4RGM A;  1WXM A;  3WAO A;  1MG8 A;  1XLN A;  3SU8 X;  3AI5 A;  2DZI A;  1VZ6 A;  4NAW A;  3CIR B;  1V1O A;  3TEX A;  1Z5S B;  2ZCC A;  5IKC M;  2OHF A;  2FBW B;  5CHV C;  3PHW B;  4MGY E;  3ZRC A;  5KHQ A;  5HHD G;  2RSU A;  2RDG A;  3VRB B;  2AX5 A;  5IOI A;  1I35 A;  2KOX A;  3FC4 A;  3BVZ A;  4P6V F;  4E3C A;  1CQV A;  2WXF A;  2KFK A;  3NG0 A;  1TYG B;  4HXD A;  3R8B A;  3SD5 A;  2KDF B;  1NI3 A;  4IM0 A;  1ESF A;  2REX A;  3RUL A;  2Z59 B;  2KVZ A;  2L1A A;  2K5P A;  4MM3 A;  4LDT B;  1TKG A;  3OLM D;  3BWU D;  3RZW C;  1P3Q U;  5HG2 A;  4GOC A;  1ET6 A;  4ZDV A;  3ZTC A;  1J7B A;  3AE7 B;  2GI9 A;  1ACC A;  1UZX B;  4BZA A;  1JWS D;  2KN4 A;  4KVG B;  5BO4 B;  2K9X A;  3DBR B;  4A90 A;  1OQY A;  1JW9 D;  3VVW B;  1QOB A;  3ETR A;  1M4V A;  4IC7 B;  1WE6 A;  1MPE A;  2OOB B;  3R7Q A;  1B1Z A;  3OJ4 B;  4NNJ B;  4B95 A;  3M3J A;  2WXH A;  2K3U A;  4MH8 A;  1WXV A;  3DBR I;  4BBN C;  1TS3 A;  5HKH A;  1RFA A;  2N9K A;  3I3T B;  4LTU A;  2V0G A;  2VRR B;  2IND C;  3VUY A;  3DBS A;  3VXW A;  4WQM A;  3AE3 B;  2CHZ A;  2D3B A;  3PO0 A;  4MSM B;  3OG5 A;  4IDI A;  2L0T A;  4FAD A;  2JQR B;  5IN7 A;  1SF0 A;  5BYS A;  3VUX A;  3QAQ A;  2WDQ B;  3H8H A;  2X38 A;  3TL5 A;  3J9C A;  4ZHO A;  3PPA A;  2NVU I;  4B0M A;  2DNF A;  1I4R A;  1CJE A;  2MA9 B;  1WM2 A;  3PLU A;  4MGK E;  1P98 A;  1XLQ A;  2MCN B;  4WJO A;  1TZ1 A;  2IBI B;  4IOI E;  5CX3 A;  1L6V A;  1UWM A;  3GB1 A;  2BWE S;  1OQQ A;  5D3I B;  3AE2 B;  4MJS A;  3PGE A;  5J17 A;  3AE6 B;  1QOG A;  2KFJ A;  2BB6 A;  1KF6 B;  4I6N B;  1V49 A;  3Q8F A;  3DBL I;  1PYW D;  3NZS A;  1G6J A;  1HA5 A;  4PK1 A;  2PJH A;  1WZ0 A;  2IY1 B;  4KDI C;  5EDS A;  3HM6 X;  1SXT A;  1FPY A;  4HRO A;  4ZRK A;  3JSV A;  1FXI A;  5AZG A;  2QMT A;  1C9F A;  1Y8R C;  2W82 A;  2JZP A;  1ZP0 B;  4XC2 A;  3BVM A;  3KUD B;  1J8C A;  2RPQ A;  3FIL A;  2PVO D;  2MHJ A;  1N60 A;  2FUH B;  1XCQ L;  1FRD A;  3VH4 B;  2XEW A;  4KIK B;  1XD3 B;  3VRA B;  4G50 A;  4MDK E;  1KRH A;  3KUZ A;  2ON8 A;  2KLG A;  2JZ3 B;  4NJ6 A;  3VHT C;  4BOS C;  4F1S A;  2BYE A;  2WXN A;  1RWS A;  5E6N A;  5C1Z A;  2E3T A;  3AM9 A;  2KD0 A;  2LVO A;  1WY8 A;  4KGR A;  1YMH E;  3T8M A;  4M0W A;  1QQR A;  1C4C A;  1L0V B;  4N59 A;  1JWM D;  4KKJ A;  3TEW A;  3AN1 A;  2V3P A;  2WXQ A;  1F2R C;  1P7E A;  3ENE A;  5HFY A;  1E90 A;  5BMG A;  3CMM B;  3IHP C;  1S1Q B;  1ISN A;  2LRW A;  3ZIM A;  2LGS A;  2KQ7 A;  4PYU A;  5E6O A;  2K25 A;  5LXI B;  1T5X D;  4W9F A;  4K7W A;  1UBI A;  3NRZ A;  1EF1 A;  4OVV A;  1ZKH A;  3HVZ A;  3GE3 C;  3QK0 A;  4N9F 4;  1FMA D;  4BBN F;  3UQB A;  3IXS A;  2WXM A;  4CQN A;  4MEL A;  3URY A;  3NJT A;  1QT9 A;  2K1F A;  2BW2 A;  2JVC A;  1SEB D;  1QOA A;  2WX1 A;  1K8R B;  3DBH B;  2IYD B;  5BMH A;  3U30 A;  1QOF A;  4BKS A;  2D2Q A;  1WJ6 A;  2BS2 B;  2N9L A;  3NVZ A;  2JXT A;  1GNU A;  3NHE B;  1I4P A;  3ABV B;  2I1K A;  3GP7 A;  1YN4 A;  2LEK A;  2ONQ A;  2R2Q A;  3LJ3 A;  1E9M A;  4KGS A;  2ZW1 A;  1I4Q A;  4RMA A;  4ICU A;  4PS3 A;  1AAR A;  4GDK A;  5C3J B;  2R61 A;  2QEJ C;  2NPT A;  3Q3J A;  1VZ8 A;  4QAY A;  1SE4 A;  3N1Y C;  4WH4 A;  1JWB D;  1V1P A;  4P1B C;  2IO1 B;  4MGZ E;  2JRI B;  1L4Z B;  1EU4 A;  2MLB A;  3NY5 A;  1TTN A;  3B2F A;  3UIN B;  3VH3 B;  1T6B X;  4PS8 A;  1D5X C;  2KJH B;  3AXC A;  1PGX A;  3L13 A;  1A5R A;  2DZJ A;  3UIP B;  4A3P A;  2B3A A;  4HK2 A;  2YEP F;  2PMV A;  2N9X A;  2BVC A;  5FR6 A;  3WA0 A;  4A3O A;  4P7I A;  4OZB A;  1YQB A;  1X1M A;  1XLP A;  4ARC A;  2W3S A;  3R2T A;  3ZDT A;  3ZGZ A;  2RMM A;  3B2G A;  1JCK B;  1P0R A;  4GLS C;  2GBK A;  3VAW A;  3V60 A;  4L2Y A;  1WJU A;  2KHW B;  2DAF A;  1OEY J;  2V3S A;  2O6V A;  3ZJU A;  1D5Z C;  2LXC A;  3RNF C;  5J18 A;  5E6J A;  2DHZ A;  2NBU A;  2LJ5 A;  3NUH B;  2H88 B;  1YN3 A;  4LNF A;  2GLS A;  2LMC A;  2OJW A;  5AZF A;  2HTH A;  3U2S C;  2C5L C;  3S2A A;  3DHI C;  3NOB A;  2WGS A;  4GDL A;  5C23 A;  2JX5 A;  4II2 B;  4RFB A;  3R66 C;  1L7Y A;  3APC A;  2ZNV C;  3WAN A;  3VR8 B;  2J0K A;  4TMA B;  2NBW B;  2MJD A;  2KX3 A;  2K39 A;  3KW5 B;  3VFK A;  3Q8B A;  3U7D A;  1D5M C;  4K3C A;  2E6X A;  1YIW A;  1R4N I;  3ZNH B;  3ONS A;  1HE8 A;  1Z2M A;  4PS7 A;  2JU6 X;  3LXF A;  1H4R A;  1IBX A;  1TKE A;  1P7F A;  3ZO5 B;  4HLE A;  2RD0 A;  3WAL A;  2W9N A;  2IPK D;  1YOV B;  1SIF A;  3ALB A;  4EEW A;  4D2K A;  2KMM A;  1KLV A;  3TEZ A;  4FN2 A;  3AEB B;  4ITK A;  2PLP A;  3SDL C;  4DWF A;  1R4M I;  2KTR A;  2KN5 A;  3UI3 A;  3ZQ4 A;  4ARI A;  3AUL A;  4RNA A;  2KMC A;  1YNT E;  2SEB D;  3E56 A;  3H1U A;  1D3Z A;  4KSK C;  3TIX A;  2INC C;  2ZEQ A;  3L16 A;  5JZE B;  3IFW B;  3Q8C A;  2BS4 B;  2LJI A;  4XDC A;  2DZM A;  4HWI B;  2M56 B;  1NDD A;  3QX1 A;  3EC8 A;  2LGD A;  3FAH A;  4IM2 A;  1F9J A;  4HJG E;  2KWD A;  3ZUN A;  1V9J A;  3PLV A;  1WM3 A;  2JYE A;  4WJN A;  2BS3 B;  3KLS X;  5FKA C;  1Q10 A;  2ZZP B;  3SHQ A;  1Q5W B;  3QIJ A;  4ANV A;  3E9S A;  2GBJ A;  4JQW C;  1J7C A;  2MQJ A;  3V62 A;  3MP9 A;  4A9A A;  4DXA B;  1WE7 A;  3HVD A;  2WXG A;  1K51 A;  1RFK A;  3A9J A;  2L83 A;  4ZOH C;  2KC2 A;  1XF5 L;  1LM8 B;  2LVQ A;  3Q8E A;  1SE9 A;  4LNI A;  4A6Q A;  4GIV A;  3RN9 C;  1PFD A;  3IT4 B;  3EHV A;  1SBB B;  1GOZ A;  3O13 A;  2RDH A;  1XXG A;  4WWP A;  3QJZ A;  5D7G A;  1TS2 A;  2JXX A;  5D2M B;  3MJW A;  1MJD A;  1WGY A;  2IO0 B;  2XK5 B;  1VRA B;  3PRZ A;  2I2Y A;  2WU2 B;  4RGT A;  5FR3 A;  1VJK A;  1FCL A;  3JVZ X;  2FID A;  1YX5 B;  2O2V A;  1V81 A;  2PIA A;  3QQ8 B;  4S17 A;  1E10 A;  3R3M A;  2WNM A;  1WGG A;  2H89 B;  1UGM A;  2QDF A; 
#chains in the Genus database with same CATH homology
 3MHZ A;  1T3Q A;  1N5X A;  1HA5 A;  1BUI C;  3U52 E;  1XLO A;  1RYJ A;  2JWU A;  3P42 A;  2Y5C A;  1SXT A;  1HZ6 A;  4YWG G;  1ZPS A;  2TSS A;  1AWD A;  4HRO A;  2PVG C;  3P4S B;  4YXD B;  4US8 A;  1C78 A;  1FXI A;  2VZK B;  2QMT A;  2Q5W D;  4C80 A;  1C9F A;  3SEB A;  4US9 A;  1UNS A;  2W82 A;  3EA6 A;  2M19 A;  1N61 A;  3P1M A;  4YT0 B;  2JZP A;  2DWQ A;  1ZP0 B;  2CJN A;  2QSD A;  3BVM A;  4RCO A;  4XDD A;  1XCT L;  3FIL A;  5H92 C;  2PVO D;  1N60 A;  2WXR A;  4WAF A;  1F0Z A;  1DYQ A;  1YQ3 B;  3BYY B;  2INP E;  2PTL A;  3T3N A;  5LNK 1;  3DWG C;  1XCQ L;  3WCQ A;  1FRD A;  1D6E C;  2D5G A;  5EE0 A;  3AE8 B;  4PT5 A;  3NVV A;  5EE3 A;  1FFV A;  2K22 A;  1A70 A;  3NZ3 A;  2KDM A;  1KLU D;  4N58 A;  3VRA B;  1PUT A;  5BMI A;  1KRH A;  2YEP B;  4C7Y A;  2B76 B;  2EEL A;  5GXG B;  1HZ5 A;  2ON8 A;  1KTK A;  1QKZ A;  5AUI A;  4O1N A;  1ZUD 2;  4DXF A;  2G1E A;  4USA A;  2WXN A;  1RWS A;  2W3R A;  2INN E;  2V4I B;  4N6E B;  1TY2 A;  2E3T A;  2DBY A;  1MHX A;  3AM9 A;  1UUP A;  1L0Y B;  2QIE B;  5G5G A;  4KGR A;  4YSZ B;  1YMH E;  2Y3A A;  4M0W A;  1QQR A;  1C4C A;  2L52 A;  1L0V B;  3T3O A;  2LHE A;  1FD6 A;  4N59 A;  4HRS A;  1JWM D;  1J7A A;  1TY0 A;  4KKJ A;  3TEW A;  3AN1 A;  1R7S A;  2V3P A;  4JWU C;  4NAM A;  4WUR A;  2IGH A;  2I38 A;  2WXQ A;  1F2R C;  1P7E A;  5HFY A;  2RPV A;  5BMG A;  3IAS 1;  1YJJ A;  1HEZ E;  5H8Y E;  4IKG A;  1ET9 A;  1QIL A;  1FXA A;  4OZC A;  1RM6 C;  1T5X D;  1STE A;  1I4X A;  1TKY A;  3NRZ A;  4A55 A;  3HVZ A;  3LB8 C;  1FMA D;  2JYT A;  3L4P A;  4WWM A;  5TSS A;  3SR6 A;  4Q2J A;  2MH7 A;  5D3D A;  1F2R I;  3IXS A;  3I57 A;  2WXM A;  5I4D A;  4RF1 A;  4CQN A;  1GAQ B;  3URY A;  4C7Z A;  3AEG B;  3R2I A;  1TJE A;  1QT9 A;  2ACZ B;  2AQ3 B;  2DLB A;  3MFG A;  2BW2 A;  3IAM 1;  3KWL A;  1SEB D;  3FIL B;  1FNV A;  1QOA A;  5BMH A;  3P4P B;  2PKO A;  1FRR A;  2ICI A;  5AUK A;  5BYQ A;  2EKI A;  1QOF A;  1SJE D;  1GB1 A;  1K53 A;  1EWY C;  2BS2 B;  1V1P B;  1ZXH A;  2N9L A;  2XNA C;  2J4X A;  3NVZ A;  1FO4 A;  1Y56 A;  2IDY A;  4HEA 1;  2DYO A;  1K52 A;  2JXT A;  2QJL A;  4NJC A;  4RGN A;  1I4P A;  1KLG D;  1YJI A;  3BK2 A;  4TSS A;  4DQO C;  4ZHP A;  4XE0 A;  1NEK B;  3ABV B;  1EM7 A;  2BTE A;  3GP7 A;  3EUB 2;  1YN4 A;  2NTT A;  2LEK A;  2ONQ A;  3MJ5 A;  2LUM A;  3AEA B;  1C76 A;  3AE1 B;  1E9M A;  4KGS A;  3CWI A;  1AW7 A;  2W54 A;  2ZW1 A;  1WXQ A;  4RF0 A;  4JPS A;  1I4Q A;  4XWT A;  3TSS A;  3BII D;  3P63 A;  4C56 C;  4KX6 B;  1SJH D;  1SSN A;  5BYR A;  2N0S B;  4OZA A;  1SB3 C;  3V05 A;  3SFE B;  3AEF B;  3AEC B;  5C3J B;  2R61 A;  2QEJ C;  3W2D A;  1PGB A;  1VZ8 A;  1SE4 A;  2WDV B;  1C79 A;  3AV8 A;  1JWB D;  4WH4 A;  1V1P A;  5HI1 A;  3ZYY X;  3Q69 A;  1DOY A;  1DOX A;  1MI0 A;  1B9R A;  1PDX A;  2J42 A;  3AE5 B;  3AED B;  1L4Z B;  1ZDV A;  1EU4 A;  2MJ3 A;  2IGD A;  3B2F A;  2JSV X;  1T6B X;  2KQ4 X;  1OQR A;  2MJE A;  4OVZ A;  1FNU A;  1JWA D;  1D5X C;  1PGA A;  1PGX A;  3LYY A;  4LK0 M;  4MAC A;  2PW9 A;  2OED A;  4WIP A;  4RH6 A;  3RPF C;  2BBC A;  1VR9 A;  1NEN B;  4ZRQ A;  2YEP F;  2PMV A;  1I7H A;  2WXP A;  3W5V B;  1KH0 A;  3AE4 B;  3ZJT A;  2J53 A;  4OW0 A;  2MEK A;  3AMZ A;  4OZB A;  2WDR B;  1ENF A;  1XLP A;  1IGC A;  1IGD A;  1HQR D;  4ARC A;  3DWM A;  2W3S A;  3R2T A;  4TQ1 A;  3HUI A;  3V3X A;  3ZGZ A;  2RMM A;  4UDU C;  3B2G A;  1JML A;  4HKZ E;  1JCK B;  1FNW A;  4GLS C;  1I4G A;  1N62 A;  2L32 A;  4L2Y A;  2GRI A;  2WXO A;  1E0Z A;  5EE9 A;  2Z8L A;  1OFF A;  2WXI A;  3AH7 A;  3BYT B;  3P4R B;  1ROE A;  1YN5 A;  4B0E A;  3KWV A;  2V3N A;  2NMQ A;  4P16 A;  3ZJU A;  1D5Z C;  5E6J A;  1XO3 A;  1C4A A;  1DOI A;  3NS1 A;  2WXJ A;  3NUH B;  4YTM B;  3TUO A;  2H88 B;  3PZ8 A;  3N9Y C;  3AEE B;  1CZP A;  1VLB A;  1YN3 A;  2HDE A;  4KGT A;  1HXY D;  4JWS C;  2ZW0 A;  2LMC A;  2BYT A;  1N63 A;  3W5U B;  3U2S C;  4YTN B;  3W9C B;  4GDK B;  1FEH A;  2JX5 A;  1KFY B;  4RFB A;  3MC0 B;  1VDV A;  4R3D A;  2HTM E;  3RFZ B;  3SFD B;  1ZXI A;  1WYG A;  3Q8A A;  3VR8 B;  2WS3 B;  4TMA B;  2MJD A;  4L23 A;  4JX1 C;  4RGM A;  3VQI A;  3Q8B A;  4KKI A;  2FUG 1;  1XLN A;  1WGK A;  4ZRP A;  1D5M C;  1VZ6 A;  2E6X A;  3CIR B;  1V1O A;  1VZ7 A;  3TEX A;  4EE2 A;  2WU5 B;  1E6E B;  2BB5 A;  2FBW B;  2OHF A;  2W55 A;  2NTS A;  2SAK A;  1E7P B;  4NZL B;  5HHD G;  3ZJV A;  2RDG A;  3VRB B;  2AX5 A;  4RGO S;  3FC4 A;  1ZE3 D;  2JU6 X;  3BVZ A;  3U7Z A;  3LXF A;  4AS1 A;  1IBX A;  2G9H D;  4DXG A;  1ZOY B;  5JXV A;  4P6V F;  1TKE A;  1CQV A;  1P7F A;  2J52 A;  2WXF A;  5C2T B;  1QLB B;  1TYG B;  4A8X C;  3R8B A;  2IPK D;  1JWU D;  1NI3 A;  4JE3 B;  1D4B A;  4D2K A;  2KMM A;  2Y5P A;  3TEZ A;  1ESF A;  3AEB B;  2VZK D;  2KAC A;  1GB4 A;  3VR9 B;  1AYF A;  2L1A A;  2PLP A;  4ITK A;  2K5P A;  1EWC A;  1UGJ A;  2CU3 A;  1TKG A;  3TEY A;  1L0X B;  2CJO A;  5G5H A;  3ZQ4 A;  3UI3 A;  4HKQ A;  1BXT A;  2LGI A;  4YTP B;  1JRO A;  4ARI A;  1TS4 A;  3BWU D;  4RNA A;  1C4P A;  5HG2 A;  1FCC C;  1YNT E;  2SEB D;  1DGJ A;  1TZO A;  1ET6 A;  3OWE B;  1CK1 A;  3HRD D;  3E56 A;  5FK9 C;  3BVG A;  1J7B A;  3P4Q B;  2WXL A;  3AE7 B;  2GI9 A;  1JRP A;  1JQ4 A;  1JAL A;  4H2A A;  1ACC A;  3IT6 B;  1JWS D;  2KN4 A;  3Q8C A;  2BS4 B;  1WWT A;  5T8I A;  4OHJ A;  2LJI A;  4XDC A;  1MVK A;  1V97 A;  1LO5 D;  2M56 B;  4J3O D;  2K9X A;  4GDL B;  4A90 A;  1JW9 D;  3FAH A;  4L1B A;  1QOB A;  2BT6 A;  2KWD A;  4HJG E;  1IUE A;  3ETR A;  1M4V A;  2M0A A;  1QF6 A;  2WXK A;  1AN8 A;  1TS5 A;  1MPE A;  2JYE A;  1N5W A;  1B1Z A;  1SE2 A;  2K0P A;  2IGG A;  5MPO A;  2WXH A;  2K3U A;  1FFU A;  2BS3 B;  3KLS X;  4MH8 A;  3U4E G;  5FKA C;  4NAW B;  1Q10 A;  2N7J A;  1F77 A;  1TS3 A;  1NYQ A;  2N9K A;  4LLG M;  2DYM A;  4LTU A;  4TQ0 A;  3KQ4 A;  2V0G A;  3E9S A;  4ZYS A;  1J7C A;  1SIJ A;  1WSP A;  3B9J A;  4AQ7 A;  2AQ1 B;  4FXC A;  4REZ A;  3GS2 A;  4WQM A;  3MP9 A;  3AE3 B;  4A9A A;  1SE3 A;  2KAJ A;  1L6U A;  3PO0 A;  3HVD A;  1IBX B;  2WXG A;  3W1S A;  1K51 A;  1RFK A;  3I9V 1;  1NYR A;  1L5P A;  2L83 A;  4IDI A;  4ZOH C;  1YQ4 B;  2JQR B;  4YSY B;  1XF5 L;  1SF0 A;  2LFI A;  3C8Y A;  5BYS A;  1FM0 D;  3BZD B;  3Q8E A;  2WDQ B;  4MT5 A;  4A6Q A;  2IJ0 A;  1PFD A;  3IT4 B;  3H8H A;  2X38 A;  1WRI A;  1C77 A;  1L4D B;  1SBB B;  1GOZ A;  3AB5 A;  1UWX A;  3J9C A;  3O13 A;  2RDH A;  4ZHO A;  1XXG A;  4MM3 B;  5EE1 A;  2GB1 A;  2LHD A;  4B0M A;  5D7G A;  1I4R A;  1CJE A;  1TS2 A;  2WQY B;  4YSX B;  2FE8 A;  1XEE A;  1XLQ A;  1V8C A;  1ZDX A;  1VRA B;  2WP9 B;  4IOI E;  2WLB A;  2I2Y A;  1L6V A;  1UWM A;  2AQ2 B;  2WU2 B;  3NVY A;  1MHH E;  3GB1 A;  4RGT A;  1NVI D;  5FR3 A;  1VJK A;  1OQQ A;  1FCL A;  5D3I B;  3AE2 B;  4XWW A;  1FIQ A;  2QIL A;  2XN9 C;  3AE6 B;  1QOG A;  3AE9 B;  1GPX A;  3PZ7 A;  3EGR A;  2PIA A;  3NVW A;  1I4H A;  1E10 A;  1K50 A;  2BB6 A;  2WNM A;  1KF6 B;  1EU3 A;  3Q8F A;  2H89 B;  1PYW D;  3BK1 A;  1BML C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...