1SSNA

Staphylokinase, sakstar variant, nmr, 20 structures
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
136
structure length
136
Chain Sequence
SSSFDKGKYKKGDDASYFEPTGPYLMVNVTGVDSKGNELLSPHYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords STAPHYLOKINASE
publication title Nuclear magnetic resonance solution structure of the plasminogen-activator protein staphylokinase.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 16
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 1998-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02821 Staphylokinase Staphylokinase/Streptokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.130 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ssnA00
1C77A 1C78A 1C76A 2SAKA 1SSNA 1BUIC 1C79A
chains in the Genus database with same CATH superfamily
1F1HA 1UUPA 5FK9C 4HVBA 3A33B 4IWPA 1SIFA 2PVOD 3JYUA 1FFUA 1WYWB 2JU6X 2KC1A 1WX9A 3ZDMC 3VR8B 3A9KB 4MH0E 3BYYB 2J0MA 3RNFC 3TMPB 1L0YB 4FA6A 2MJDA 2DNFA 3RYTA 4TSSA 1NVID 2MP2A 4W9FA 4MGIE 3NJTA 2JXXA 3DBRI 1FNWA 2FAZA 2FE8A 3RNAC 4W9EA 4N59A 2OOBB 4NAMA 2DWQA 1STEA 2IZVB 2N7EA 2V3SA 4IKGA 2NPTB 2LI5A 3DCGA 3LJ3A 1IBXA 2XN9C 4I6PA 2N9KA 1IUEA 3GZNI 1T5XD 3BZDB 3CMMB 4HJGE 3PLUA 5G55A 2KWCA 2QILA 4DDGD 3A4SC 1FM0D 2REXA 3S2AA 1XXGA 3EUB2 2D3CA 4G3XB 3SU8X 1V5TA 4RGOS 2CU3A 3MTNB 3PGEA 2ZCCA 2L83A 3ZJUA 3KWVA 1ZUD2 1I35A 5CX3A 3VTUA 2J0JA 2MCNB 4NPNA 2WWZA 5EE1A 5AZGA 1VZ8A 2K39A 2AL3A 4N6EB 4LJPB 1DOYA 4LJOB 5IN7A 2BPSA 1HZ6A 4G11A 3TEZA 3RN9C 2MQJA 5LLIA 1FCLA 1Q1OA 2D3GA 3E56A 2LFIA 3P2BA 4BKSD 3CF6E 2ZVOA 3TSSA 5AUIA 2LJIA 3IAM1 5D6JB 3R66C 3B9JA 2X8XX 1WGHA 2G3QB 2ZEQA 1IGDA 3I57A 1GG3A 1V86A 2FUHB 4LNFA 1FNVA 3W1SA 5HKHA 3DBHI 4F8CB 2LEKA 1K50A 4I6LB 1P1AA 4FJYA 2INCC 1J7AA 3FC4A 3QQ8B 4YSZB 5G5GA 3ZGZA 2XNAC 2AYOB 2I2YA 2Z8LA 1F2RI 4RM9A 2WHIA 2K22A 1KM7A 2KMCA 2I38A 4YSYB 4YL8A 1DYQA 2WDTB 4ZYNA 2LGSA 1PFDA 1PGXA 1TYGB 3AU4A 2B3AA 3AEEB 2YVCA 1E10A 4P16A 2L1AA 4O1NA 3WIMA 5H92C 3TL5A 2KANA 4TMAB 4OHJA 3Q2AC 1AN8A 3AU5A 4JPSA 2Y5PA 2DZKA 3DQVA 1GUAB 2G9HD 1F0ZA 2LVQA 1KF6B 2NBUA 3BWUD 3Q14C 3FILB 2LVOA 3J9CA 4FBJB 1AARA 1GJZA 3ENEA 2MA9B 1JQ4A 3W1SC 1QOBA 3ZRFA 1EWCA 4ASWC 2WXLA 1UH6A 3MHSD 4RCOA 4EKUA 1TS4A 1UGMA 4YT0B 4QAYA 2WP9B 5BYSA 4S17A 3DVGX 4DHZE 4DWFA 3AEDB 2L7RA 4CHKA 5AZFA 2INDC 1UWXA 2G4SA 2D3BA 2JX5A 4KGRA 4HKQA 4M02A 4W9LA 1E5WA 1WMHB 5E6JA 4EOYA 2LUEA 1V1PA 2E6XA 1CMXB 1MG4A 1L4DB 3QA8A 3UQBA 5D3DA 4MT5A 1OGWA 4LNNA 2LASA 2I1JA 2DX5B 3Q6BA 1GNUA 3K9OB 3L13A 1QOGA 1V49A 4JIOU 5EDSA 3B0AA 3SDLC 1P98A 2MSED 3RZFA 2Q5WD 1WGRA 2HTHA 4FULA 3N20C 1SJED 2MH7A 1KRHA 4GSWA 2BYVE 1J7BA 2RR9A 4PS7A 3H1UA 4RGMA 2V4IB 2WX1A 3UI3A 1J7CA 4WJQA 2NBWB 3P4RB 4YSXB 3ALBA 1VR9A 3NVZA 2AX5A 1G6JA 2NTSA 4JWSC 3PREA 2C7NB 1JMLA 3WAOA 3EA6A 4B6WA 2N1VA 3QCAA 3IT4B 1OTRB 1OEYJ 2LJ5A 4YTNB 4ZDVA 3OJ4B 1ZDVA 3H6NA 3ZYYX 1OFFA 4KZCA 2J4XA 1J19A 1UBIA 1WX8A 1JWBD 2CU1A 1E8YA 2JSVX 2AEHA 4BKTA 1QLBB 2Y3AA 5D3IB 4MELA 1WJ4A 3U7ZA 4IG7B 4MACA 1E8WA 1E7PB 4NY0A 2WXJA 2DAJA 1PQSA 3W5VB 1VJKA 3ONSA 4K81A 2KT7A 2MBEA 3IHPC 4B0EA 1ET6A 4WURA 2IGGA 3EFCA 2L0FA 4PT5A 1WXSA 4C7YA 3H7PA 3MJWA 3V05A 1I4RA 5I4DA 4W9IA 2J52A 1NENB 5J18A 1V1OA 4ZHPA 3Q3MC 3VHTC 4I6NB 3N32A 1TGZB 1EM7A 3AEBB 3OWEB 3DOWA 4KGSA 1C1YB 2PIAA 1MJDA 3PHXB 1PGAA 2BB5A 3PS6A 2K25A 1CK1A 5LNK1 2KNBA 1KLGD 3ZJTA 1LXDA 1HXYD 1ZPSA 3ZLZA 3DBRB 2M17A 1QKZA 3HM6X 4WWMA 2BQQA 2MEKA 3JW0X 4HLEA 1VDVA 3H8HA 2NMQA 3A9JA 2O6VD 3GZNB 2VH1A 3DBSA 4ZRPA 1XD3B 2HJ8A 1FXIA 3ZTDA 5CTRC 4KKJA 2WNMA 2WXFA 5TR5A 2LVPA 2N7JA 2LWPA 2EELA 3UIOB 3AECB 1SE3A 1C78A 1YNTE 3T8MA 3SEBA 1L4ZB 4RFBA 5DPSA 2LGYA 1CZPA 1DGJA 3M62B 5BMIA 1N62A 1N5WA 4BBNC 2C7HA 1JWUD 2C7MB 2WXNA 3AH7A 4HPLB 4N58A 1C76A 4KV2A 1GPXA 4AP4C 1R7SA 1NDDA 2QDFA 1HE8A 2IGDA 4M0WA 2KTRA 3R3MA 2BYEA 3AE6B 2LHEA 2GBJA 3T3OA 1S3SG 4WQOB 3Q8CA 2IO1B 3HK0A 2C60A 2KOXA 3FKYA 2DBYA 1WSPA 2K8BA 1N6ZA 1FRDA 1OQYA 4GDKB 4ICVA 2CHXA 5TSSA 4ARIA 4NJ6A 1NYQA 2N7DA 2XEWA 1JCKB 1L6VA 2JRHA 2KQ4X 3BY4B 4C4VA 1MFWA 1PUTA 1C79A 2KMAA 5G2NA 1WY8A 2A5UA 2EKIA 3DBHB 3A1QB 1YQ4B 3LB8C 1E90A 4FHKA 3D32A 4RGNA 4DK5A 3N30A 1HZ5A 1A70A 4FADA 4JQWC 1I4GA 1SGHA 1XLPA 4CYEA 4ZRQA 4MM3A 1N63A 3Q3FA 2ZCBA 2RSUA 1JWAD 4KDLB 2MJEA 5CHWA 2KVRA 3PT2B 4W9DA 4WWPA 2FIDA 1ZGUB 1ZOYB 4NAWB 1WI0A 2N0SB 2CKHB 1ZXHA 2HD5B 2LXAA 3Q3OC 4ACFA 1YJIA 2Z59B 4DHJB 1RFAA 1OQQA 4J6IA 2KQSA 2HJ1A 1WJUA 2KO3A 2CJOA 3LYYA 1K53A 1RYJA 3GP7A 1NEKB 2D5GA 3PVLA 3L17A 2WS3B 4W9CA 3ZXRA 1HEZE 1WIAA 1WJNA 1L2NA 1XCTL 2KZRA 1I7HA 1XCQL 1NI2A 1YX5B 2RD0A 3OJ3A 1NYRA 4MJSB 3U2SC 3WALA 3RNGC 4ANUA 4EEWA 5DPWA 2I1KA 2RDHA 3VUWA 3W5UB 2YLMA 2M1MA 1R4MI 5LXIB 1ESFA 1UZXB 1WH3A 3TIXA 2KXJA 2LXCA 2WXOA 3JSVA 4A55A 3ZIMA 4F7ZA 3VUYA 4GDLB 3AE1B 5GMVA 2GMIC 5D7GA 4USAA 3RNBC 4IM0A 5EE0A 1E8ZA 2CHZA 3Q8EA 2MW5A 2O2VA 1ACCA 4TUUA 1HTOA 3C0RB 3UGBB 1KFYB 1JW9D 3VAWA 1P7FA 1K52A 2PEAA 4MH8A 3W9CB 3MC8A 1WE6A 2V4LA 1XEEA 1MPEA 2JZZA 2KDMA 5D2MB 2KWDA 4DQOC 4D2KA 3GB1A 4GB9A 4RF1A 4B0MA 2N4FA 3BIID 4L2YA 1IPGA 3ZNZB 2DYMA 4E74A 1IP9A 1QILA 1DOIA 1EWYC 1P0RA 2PJHA 2WXHA 1TY2A 1EO6A 4FXCA 2JY6A 3PZ8A 4IWQA 2ONQA 3RMKC 1I4QA 2MHJA 2IGHA 3QAQA 3KYCD 2K8CA 1YD8U 2GBMA 3URYA 1C3TA 2ZNVB 1PGBA 3P42A 1EU4A 5HG2A 2ICIA 3NY5A 1S1QB 2D07B 3IG3A 5IA7A 4ZRIA 4WIPA 4WWNA 2DZMA 2INNE 2O6VB 3OLMD 2CS4A 3P63A 2GRIA 4REZA 1QF6A 1LO5D 1MHXA 5IP4D 4X57B 4NJCA 2DZJA 4HWIB 4A9AA 1ISNA 3NS1A 3P4SB 1ET9A 4A6QA 4J3OD 2BVCA 1FD6A 1NI3A 4US8A 4YXDB 2J0KA 3GS2A 3W2DA 3I3TB 3RZWC 1FNUA 1TKYA 3UIPB 5AZHA 5JZEB 2XK5B 3E9SA 3ZUNA 4US9A 4WQMA 2BTEA 2ZVNA 2KVZA 3X0WA 3ETRA 1EF5A 2K3UA 1VD2A 4IWOA 4P1CC 1LGRA 2KFKB 1E9MA 3VDZA 4MSQB 2LMCA 2DYOA 3BVGA 3GOEA 4LNIA 3EC8A 3A9KA 2BT6A 3DWGC 4EZLA 5JH5C 2WXQA 3H9DA 3IAS1 1PDXA 4PS8A 4XE0A 4HK2A 1ENFA 4IC7B 4TQ0A 4ARCA 2RGFA 2IJ0A 4XX5A 1V6EA 2V0GA 1P9DU 3MC0B 4HCNB 3B2FA 1D6EC 4M8MA 3PSEB 1RWSA 1WJ6A 2BGFA 2CJNA 3Q8BA 1V80A 2NPTA 1FPYA 2M19A 1QOAA 2K9XA 4LCDE 4K7WA 3LXFA 2W82A 1I42A 3T9LA 3O65B 3ZW3A 5HHDG 3P4QB 1JWMD 2JXTA 4RH6A 1ZDXA 2BKRB 3QC8B 2WYQA 4WJNA 3DHGC 2ZPYA 1KTKA 1MVKA 1N5XA 3R7RA 1FO4A 5DCNA 2W54A 1XF5L 4MDKE 5JHBA 2IDYA 3B1LX 4HROA 1C4AA 3WANA 3AE9B 2ZJDA 2BKFA 2JYEA 1T0YA 1X1MA 2V1YA 3SFEB 5C3JB 5E6PA 3PLVA 2MJ3A 1EU3A 1WXAA 4K7SA 1WGDA 3ZNHB 4DHJD 4ANWA 4GN1A 1UGJA 5E6OA 1YJ1A 2J42A 4YWGG 3APCA 4LNOA 3HVZA 1GC6A 2JWZA 4OZCA 2KJ6A 1YQ3B 4H2AA 3DBLI 4ZRJA 2N9XA 4ANVA 3I63C 3R8BA 2KLGA 1GC7A 3AE8B 3B08A 5JXVA 3T3NA 3NVVA 1XT9B 1LM8B 4GLSC 2ZW0A 3KLSX 4HEA1 2WDRB 2ZW1A 3R2IA 2M56B 2K6DB 4ITKA 2AL6A 4OZBA 4A3OA 1WYGA 1ZW7A 1RLFA 4RF0A 2KMMA 4ICUA 5MPOA 3V61A 3M63B 1KLVA 2PPHA 2JRIB 3P1MA 2L00B 2DAFA 2BW2A 3KWLA 2Z0EB 2L0TA 4BVUC 2VZKB 3BYTB 4P7IA 1P7EA 3M95A 2HTME 4KIKB 2KC2A 2UYZB 2QHOA 3QK0A 1XQQA 3PO0A 2PLPA 2FBWB 2MBBB 4WWOA 3KUDB 2ASQA 2K5PA 2W3RA 3ZXVA 2FCNA 3AE7B 3RT3B 5CHFA 3RPFC 3ZQ4A 3MJ5A 4HXDA 1TJEA 2QEJC 3IXSA 4XWTA 2R61A 1WWTA 2MBQA 3FILA 4NQKE 1L0VB 2IO0B 5DPTA 4B9KA 1E6EB 4IM3A 1T0RC 2J53A 4HJKA 4XDDA 1WXVA 2QJLA 4TQ1A 5FR6A 1T6BX 4UDUC 2AQ2B 4A3PA 2NR2A 3RD2A 4E71A 2KX0A 3HIZA 5FR3A 2QCZA 4IW0A 1R4MB 1E0ZA 1IGCA 2NCNA 3NUHB 3MP9A 2K1FA 2PVGC 1KJTA 4RNAA 2Y5BB 2PW9A 3ZVVA 3VRAB 1D5XC 1WMHA 1A5RA 3R2TA 2G4DB 3VTWA 1JROA 3MFGA 3Q3JA 3EGRA 2BF8B 4NJ7A 2KDIA 1BMLC 2KK8A 2LGXA 1TS3A 4HDQA 3ZKJC 2WXIA 1KOTA 1BXTA 2QSDA 2NTTA 2PKOA 5CHVC 2G45B 1YQBA 4WJPA 1FFVA 1FRRA 4WJOA 4AOFA 4L1BA 2QIEB 3TEYA 3NZSA 4HDOA 3GE8C 1WF9A 2JZ3B 2JUOA 1FCCC 3AI5A 2MP2B 1Q10A 5IOIA 3A4RA 1U4AA 3KQ4A 4ZHOA 3DHIC 3I5JC 2MBHA 4K3CA 3IFWB 1T0QC 4NQLB 1QOFA 4RMAA 4DDID 1IBXB 1C77A 4GMVA 3GE3C 2IO2B 1MG8A 3VH4B 2LRWA 5BYRA 3RI7C 2QMTA 1I4PA 4BKGA 3U30A 2KWUB 2GBRA 1MI0A 4AQ7A 1PYWD 2BYFA 1M4VA 3DVNU 4W9KA 1DOXA 4FHJA 3AV8A 2UU7A 4FJZA 3TEXA 5AUKA 1WRDB 4JE3B 5C1ZA 2CHWA 2NBVB 3ZJVA 3PRZA 2KD0A 1HTQA 1GB4A 2K6QA 4XC2A 2WLBA 4GU2A 1GB1A 1VZ7A 2N9LA 3PTFC 1L7YA 4S0RA 4P6VF 2J7QB 3IT6B 3WAMA 2Z0DB 1BUIC 3AEAB 2DENB 4XDCA 3VUXA 2LGIA 1FXAA 2PE6B 3V62A 4W9JA 1D5ZC 2RPQA 2L52A 1GOZA 4FN2A 2B76B 3B2GA 1SSNA 3VQIA 4HCPB 4E3CA 1ZE3D 3WA0A 1TY0A 3BVZA 4BKSA 1SBBB 3L0WB 4HRSA 3VVWB 3ZO5B 1MHHE 4OVVA 2KDEB 2W55A 3PPAA 5E6NA 2WXRA 1IYFA 1R4NI 3K9PB 4ZYSA 4LK0M 1WE7A 3BVMA 1Q5WB 2D10A 3KVFB 2LHDA 1F9JA 2OJRA 3TBLD 2INPE 4MSMB 1JRUA 1YN5A 1CQVA 2WXPA 2NS5A 1V97A 1SF0A 2JQRB 4A8XC 4L23A 4OVUA 5T8IA 4TV3A 1I4HA 2ON8A 4IOIE 1WGYA 3TCAA 5C23A 2L05A 2BS4B 2ZZPB 3X23A 3EFUA 3W1YA 3MHZA 3UINB 3BK2A 1Y56A 1RAXA 4IUMB 5J2RA 4AJYB 2N9EB 4IM2A 3TUOA 5H8YE 3R7QA 2TSSA 3HUIA 2FUG1 3ABVB 2D3AA 2V3PA 1KLUD 4A20A 2GOWA 4EZKA 5D94A 1E7UA 4XZ4A 2VZKD 2M0AA 3AE3B 2WU5B 4II2B 1M94A 2MX2A 4NNJB 3Q3NC 4DHZB 2BB6A 3APFA 3PV1A 4BFRA 4DXAB 2KX3A 4W9HA 1D3ZA 4GDKA 4Q2JA 1TTNA 2GLSA 3AN1A 1FIQA 4JWUC 3RCZA 5BYQA 4CQNA 3WAPA 1YJJA 4LDTB 4PYUA 4WAAA 3DBLB 1ZKHA 3KH0A 3Q69A 3Q8AA 1WM2A 5AEKB 3A1QA 4M01A 5BMHA 3SHQA 2LRUA 2AQ1B 1UBQA 4C00A 3L16A 4BOSC 2C5LC 2JVCA 3N1YC 5FKAC 2WXKA 4LTUA 5IO9A 1SEBD 3NVWA 2LGDA 1TBEA 1SE2A 3RUIB 1V1PB 3VTVA 3N1XC 2WU2B 3AEFB 3DHHC 2N9PC 4IDIA 5KHQA 3AULA 2GI9A 2WDVB 4NAWA 2IYDB 1WXQA 3V3XA 4DXGA 3EHVA 3TJPA 1L6UA 3FAHA 1YX6B 2FIFA 3AE4B 3ZNGC 1TIFA 1HQRD 3AM9A 2R2QA 2EMTA 1Z5SB 3N1ZC 3CSFA 3P4PB 3ZNID 2L32A 4XYCA 1TZOA 1LFDA 3BK1A 1JWSD 3NZUA 2BS2B 1EF1A 1D4BA 4FJVB 1V81A 3ZTCA 3APDA 3AE5B 3OG5A 4MJSA 2WQYB 3AMZA 4EZJA 3L54A 1WXMA 4BOZB 1L5PA 4LLGM 2WGSA 3U52E 1AW7A 4OZAA 3DVNV 1EUVB 3JVZX 2A4ZA 2SEBD 1F2RC 2LUMA 2QC8A 3I9V1 2JZPA 2SAKA 2KACA 1H8CA 1K51A 1FMAD 5BMGA 3N9YC 3EECA 2FCSA 3KUCB 2V9HA 3PRPB 1SJHD 1WGGA 3NG0A 2IBIB 2OHFA 1NBFC 4GDLA 1C4PA 3HVDA 1Z2MA 3OAWA 1SXTA 4GGQA 1B9RA 1WM3A 4JX1C 2FCQA 4EUTA 3H7PB 4MGZE 3L4PA 4ANXA 2XBBC 2D11A 3RULA 2GB1A 2KDFB 1SB3C 2KAJA 2KN5A 4KZ0A 1E8XA 1Y8RC 3KYDD 4BAXA 4EE2A 3PHWB 5JHAA 2MRPA 1HA5A 3AXCA 2KKCA 1ZXIA 2X38A 1VCBA 2KJHB 1LQBA 1K8RB 1CJEA 3SR6A 2ZPNA 1FXTB 3O13A 2YEPB 1XO3A 2KYWA 2JT4B 1V9JA 3U7DA 4TKNA 4DBGA 2IPKD 2PE9A 4YTMB 2BS3B 3A9JB 4ZOHC 2KDBA 1P3QU 4HPPA 3C8YA 4XWWA 4JLCA 2O6VA 3NRZA 3VFKA 1XLNA 4AJWA 1WRIA 4LNKA 4W9GA 3NOBA 3HRDD 2JF5A 3NZ3A 3QIJA 1T3QA 4HPMB 2KQ7A 1YN4A 2E3TA 1SE9A 4GOCA 2AQ3B 3CWIA 3QARA 4XGAB 2IY0B 3VH3B 1WX7A 2K0PA 2OEDA 2NVUI 2BBCA 3HM3A 5DPRA 3UQAA 5EE3A 2MLBA 2XK5A 2EMSA 2GBNA 3V6EB 2HDEA 3C19A 1YMHE 2RMMA 4M0WB 2KTRB 3ZRCA 5HI1A 5G5HA 4F1SA 3TEWA 2KFKA 2V3NA 1ROEA 3IVFA 1AWDA 1D5MC 2L76A 5L95C 4MGKE 2WXMA 3V60A 1C9FA 1UNSA 3KUZA 3BINA 5IKCM 4C80A 5EE9A 1QQRA 2JWUA 3MC9A 2GBKA 1F52A 4C4VB 1RRBA 2LD9A 4G0NB 1QT9A 5J17A 2ZNVC 4WH4A 3VR9B 1R4NB 5LXHA 1QZEA 4KVGB 4M8NA 2KWVB 2Y5CA 3AE2B 2C9WB 2WXGA 4LDTD 2IO3B 1C4CA 3M3JA 3NHEB 4KSKC 4MM3B 4OW0A 2ACZB 1V5OA 4G50A 4PS3A 2JYTA 2BWFA 2KFJA 1T0SC 2MBOA 1I4XA 1OQRA 2AWTA 4KDIC 2L3ZA 2PMVA 1J0GA 2FNJB 5GXGB 2N1WA 3RNCC 3ML9A 4URKA 4GXBA 3UF8A 4HKZE 2DLBA 1V2YA 1TT5B 4MEMA 3SD5A 1L0XB 2KTFA 4DXFA 2VRRB 1WR6E 2LZ6A 3LDZE 1VZ6A 3IBEA 3PRMB 1VLBA 1BT0A 2KLCA 4KX6B 2EKEC 1TKGA 2UWQA 2RPVA 1WZ3A 4OVZA 1OEYA 4C56C 1H4RA 3L10B 4NZLB 4AS1A 3N3KB 4WAFA 3DVGY 2JPHA 1XLOA 3DDCB 3RFZB 3U8ZA 1TZ1A 2MWSB 2IY1B 2H88B 4C7ZA 2BYTA 1UD7A 1YOVB 3ECIA 1F77A 4PYZA 3NVYA 4R3DA 2DZIA 2KN4A 1SE4A 2M8SA 3HHMA 3JSVB 2H89B 5C2TB 1UWMA 3PZ7A 4JL9A 1JALA 2M0XA 3VRBB 4N9F4 4GIVA 2L8JA 2RDBC 4M00A 3ML8A 1RFKA 4K1RB 3CIRB 2W9NA 3H7SA 1UELA 2R2OA 5IAAC 1XLQA 5L83A 1J8CA 3V6CB 4EFOA 3L08A 4ZRKA 4JGHB 1TKEA 2WX0A 2KHWB 1N61A 1TS5A 2FCMA 2O2VB 3DWMA 1Q0WB 1UF0A 1N60A 3AB5A 4B95A 2D2QA 4KKIA 3NS8A 1E7VA 4KIKA 2CR5A 2K8HA 3PZDA 2PTLA 2DHZA 2W3SA 1YN3A 1WZ0A 4RM8A 5KHOA 4PK1A 2RDGA 3AEGB 3ZDTA 4K7UA 2BWES 4K3BA 3QWZB 1JRPA 1WGKA 4KGTA 4YTPB 4II3B 2HE7A 3SFDB 1WR1A 1ZP0B 2KJRA 3RNEC 1FEHA 4AWJA 1VRAB 2OJWA 1KH0A 3CSTA 4BBNF 3QX1A 2G1EA 4MGYE 4A90A 3Q8FA 4RGTA 2DYBA 3QHTA 1GAQB 4CO7A 4AUQC 1YIWA 1B1ZA 4BZAA 4P1BC 2VH2A 4KSLC 2M4NA 3U4EG 1V8CA 3KW5B 1TS2A 3QJZA 2YEPF 1AYFA 5BO4B 1SIJA 2WDQB 1WFYA 3WCQA 1RM6C 3VXWA 4FLHA 5HFYA 3DPDA
chains in the Genus database with same CATH topology
2EELA 1UUPA 5FK9C 5JXVA 3T3NA 3NVVA 3AECB 3BK1A 1SE3A 1JWSD 1D4BA 2BS2B 1C78A 1YNTE 2ZW0A 4GLSC 3KLSX 2PVOD 4HEA1 2WDRB 1L4ZB 4RFBA 1FFUA 3SEBA 2JU6X 2ZW1A 3R2IA 1CZPA 2M56B 3AE5B 3VR8B 1DGJA 4ITKA 5BMIA 3BYYB 1N62A 1N5WA 2WQYB 3AMZA 1L0YB 4OZBA 1JWUD 2MJDA 1WYGA 2WXNA 3AH7A 1L5PA 4LLGM 1C76A 4N58A 4RF0A 2KMMA 3U52E 1AW7A 4OZAA 4TSSA 5MPOA 1GPXA 1NVID 1R7SA 2IGDA 4M0WA 3AE6B 3P1MA 1FNWA 2BW2A 2SEBD 1F2RC 2LUMA 3KWLA 2FE8A 2LHEA 3I9V1 3T3OA 2JZPA 2SAKA 4N59A 4NAMA 2KACA 1K51A 2DWQA 1FMAD 1STEA 2VZKB 3Q8CA 5BMGA 3N9YC 3BYTB 4IKGA 1P7EA 1IBXA 2HTME 2XN9C 2DBYA 1SJHD 2N9KA 1WSPA 1IUEA 2OHFA 1FRDA 1T5XD 3BZDB 4GDKB 5TSSA 4HJGE 4ARIA 1NYQA 3PO0A 1C4PA 2PLPA 3HVDA 2FBWB 2QILA 1JCKB 1L6VA 1SXTA 1FM0D 2KQ4X 2K5PA 2W3RA 1B9RA 1XXGA 3EUB2 3AE7B 3RPFC 1PUTA 3ZQ4A 1C79A 4JX1C 3MJ5A 2EKIA 1TJEA 4RGOS 2CU3A 2QEJC 3IXSA 2R61A 3L4PA 4XWTA 1WWTA 1YQ4B 3LB8C 3FILA 2GB1A 4RGNA 1L0VB 1SB3C 2KAJA 1HZ5A 1A70A 2L83A 3ZJUA 3KWVA 1E6EB 1I4GA 1ZUD2 2J53A 1XLPA 4XDDA 2QJLA 4ZRQA 4TQ1A 4EE2A 1T6BX 4UDUC 1N63A 1HA5A 2AQ2B 5EE1A 1ZXIA 2X38A 1VZ8A 1JWAD 1CJEA 3SR6A 2MJEA 3O13A 2YEPB 1XO3A 4N6EB 1DOYA 5FR3A 1ZOYB 4NAWB 1IGCA 1HZ6A 1E0ZA 3TEZA 1FCLA 2N0SB 3NUHB 3E56A 2LFIA 1ZXHA 3MP9A 1YJIA 2PVGC 4RNAA 2IPKD 3TSSA 5AUIA 2LJIA 3IAM1 2PW9A 3B9JA 4YTMB 2BS3B 1OQQA 3VRAB 1D5XC 1IGDA 3I57A 4ZOHC 3R2TA 1JROA 3MFGA 3C8YA 3EGRA 4XWWA 2CJOA 3LYYA 1K53A 1RYJA 3GP7A 1FNVA 1NEKB 3NRZA 2D5GA 3W1SA 2WS3B 1XLNA 1WRIA 1HEZE 2LEKA 1K50A 1BMLC 1TS3A 1J7AA 3FC4A 3HRDD 4YSZB 1XCTL 5G5GA 3NZ3A 3ZGZA 1T3QA 2WXIA 1YN4A 2E3TA 2XNAC 1I7HA 2AQ3B 1XCQL 2I2YA 1BXTA 2QSDA 2NTTA 2PKOA 3CWIA 2Z8LA 1F2RI 1NYRA 2K22A 3U2SC 2K0PA 1FFVA 1FRRA 2I38A 4L1BA 2QIEB 2OEDA 3TEYA 2BBCA 4YSYB 2RDHA 5EE3A 3W5UB 2HDEA 1FCCC 1Q10A 1YMHE 2RMMA 1DYQA 3KQ4A 5HI1A 4ZHOA 1ESFA 5G5HA 1PFDA 1PGXA 1TYGB 2WXOA 4A55A 3TEWA 3AEEB 2V3NA 1ROEA 1QOFA 1E10A 4P16A 1AWDA 1D5MC 1C77A 1IBXB 2L1AA 4O1NA 2WXMA 5BYRA 4GDLB 3AE1B 1C9FA 1UNSA 5H92C 4TMAB 2QMTA 1I4PA 4C80A 4OHJA 5EE9A 1AN8A 1QQRA 2JWUA 4JPSA 5D7GA 2Y5PA 4USAA 1MI0A 2G9HD 4AQ7A 1F0ZA 1PYWD 5EE0A 1KF6B 1M4VA 3Q8EA 1QT9A 3BWUD 1DOXA 4WH4A 3VR9B 3FILB 3AV8A 3J9CA 1ACCA 3TEXA 5AUKA 1KFYB 4JE3B 1JW9D 3ZJVA 1P7FA 1K52A 2Y5CA 3AE2B 1GB4A 4MH8A 3W9CB 1JQ4A 2WLBA 2WXGA 1QOBA 1C4CA 1GB1A 1XEEA 1MPEA 1VZ7A 4MM3B 2N9LA 1EWCA 2KDMA 4OW0A 2WXLA 2ACZB 2KWDA 4RCOA 4DQOC 4D2KA 2JYTA 3GB1A 4RF1A 4B0MA 3BIID 4L2YA 1TS4A 4P6VF 4YT0B 2WP9B 5BYSA 2DYMA 1I4XA 3IT6B 1OQRA 1QILA 1BUIC 2PMVA 1DOIA 3AEAB 1EWYC 3AEDB 4XDCA 2WXHA 1TY2A 5GXGB 4FXCA 2LGIA 1FXAA 3PZ8A 2ONQA 1I4QA 4HKZE 2IGHA 1UWXA 2DLBA 1D5ZC 3URYA 2L52A 2JX5A 1GOZA 4KGRA 2B76B 3B2GA 4HKQA 1L0XB 1PGBA 3P42A 4DXFA 1SSNA 3VQIA 1EU4A 5HG2A 2ICIA 5E6JA 1ZE3D 1TY0A 1VZ6A 3BVZA 1V1PA 1SBBB 4HRSA 4WIPA 2E6XA 1VLBA 2INNE 1L4DB 1MHHE 5D3DA 4MT5A 4KX6B 2W55A 3P63A 1TKGA 2GRIA 2WXRA 4REZA 4ZYSA 1LO5D 1QF6A 1MHXA 2RPVA 4LK0M 4NJCA 4OVZA 3BVMA 4A9AA 1QOGA 2LHDA 4C56C 4NZLB 3NS1A 4AS1A 3P4SB 1ET9A 4WAFA 4A6QA 4J3OD 1XLOA 2INPE 1YN5A 3RFZB 1FD6A 1CQVA 2WXPA 1NI3A 4US8A 4C7ZA 2H88B 4YXDB 3GS2A 2Q5WD 2BYTA 3W2DA 1V97A 1SF0A 1FNUA 2JQRB 1TKYA 4A8XC 1SJED 2MH7A 1KRHA 3E9SA 4US9A 1F77A 1J7BA 4RGMA 2V4IB 3UI3A 1J7CA 3NVYA 4R3DA 4WQMA 3P4RB 4L23A 2BTEA 2KN4A 1SE4A 5T8IA 3ETRA 2K3UA 1I4HA 2ON8A 4YSXB 2H89B 1VR9A 3NVZA 2AX5A 4IOIE 1UWMA 3PZ7A 1E9MA 1JALA 5C2TB 2NTSA 2BS4B 2LMCA 2DYOA 3BVGA 3VRBB 4JWSC 3MHZA 2BT6A 3BK2A 1Y56A 3DWGC 1JMLA 1RFKA 2WXQA 3EA6A 3CIRB 3TUOA 5H8YE 3IAS1 1PDXA 2TSSA 3HUIA 3IT4B 2FUG1 3ABVB 4XE0A 1XLQA 1ENFA 4YTNB 4TQ0A 4ARCA 1ZDVA 2V3PA 1KLUD 2IJ0A 2V0GA 3MC0B 3B2FA 2VZKD 1D6EC 3ZYYX 1OFFA 2M0AA 3AE3B 1RWSA 1TKEA 2WU5B 1N61A 1TS5A 2J4XA 2CJNA 3DWMA 1JWBD 1N60A 3Q8BA 2JSVX 3AB5A 4KKIA 1QLBB 2Y3AA 5D3IB 2BB6A 2M19A 1QOAA 3U7ZA 2K9XA 4MACA 4Q2JA 1E7PB 2PTLA 2WXJA 3LXFA 2W3SA 2W82A 3W5VB 3AN1A 1FIQA 4JWUC 1VJKA 1YN3A 5BYQA 4CQNA 1YJJA 2RDGA 4B0EA 3AEGB 1ET6A 4WURA 5HHDG 2IGGA 4PT5A 3Q69A 3P4QB 3Q8AA 1JRPA 4C7YA 1JWMD 2JXTA 4RH6A 3V05A 1I4RA 1WGKA 4KGTA 1ZDXA 4YTPB 5BMHA 5I4DA 3SFDB 2J52A 1ZP0B 2AQ1B 1NENB 1V1OA 1FEHA 1KTKA 1MVKA 1N5XA 1VRAB 4ZHPA 1FO4A 5FKAC 1KH0A 2WXKA 2W54A 4LTUA 1XF5L 1EM7A 1SEBD 3AEBB 3NVWA 3OWEB 4KGSA 2IDYA 2PIAA 2G1EA 1SE2A 4HROA 1PGAA 1C4AA 1V1PB 4A90A 2BB5A 3Q8FA 4RGTA 3AE9B 1CK1A 1GAQB 5LNK1 2WU2B 3AEFB 2JYEA 1KLGD 3ZJTA 3SFEB 1B1ZA 1ZPSA 1HXYD 4IDIA 5C3JB 2GI9A 2WDVB 1QKZA 2MJ3A 1WXQA 1EU3A 3V3XA 4DXGA 4WWMA 3U4EG 1V8CA 1L6UA 1TS2A 1UGJA 2MEKA 3FAHA 1VDVA 2J42A 3AE4B 3H8HA 4YWGG 2NMQA 2YEPF 1AYFA 1HQRD 3HVZA 1SIJA 3AM9A 4OZCA 1YQ3B 2WDQB 4H2AA 4ZRPA 3WCQA 1RM6C 1FXIA 3P4PB 3R8BA 4KKJA 5HFYA 2WNMA 2L32A 2WXFA 3AE8B 2N7JA 1TZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C77 A;  1C78 A;  1C76 A;  2SAK A;  1SSN A;  1BUI C;  1C79 A; 
#chains in the Genus database with same CATH topology
 1F1H A;  1UUP A;  5FK9 C;  4HVB A;  3A33 B;  4IWP A;  1SIF A;  2PVO D;  3JYU A;  1FFU A;  1WYW B;  2JU6 X;  2KC1 A;  1WX9 A;  3ZDM C;  3VR8 B;  3A9K B;  4MH0 E;  3BYY B;  2J0M A;  3RNF C;  3TMP B;  1L0Y B;  4FA6 A;  2MJD A;  2DNF A;  3RYT A;  4TSS A;  1NVI D;  2MP2 A;  4W9F A;  4MGI E;  3NJT A;  2JXX A;  3DBR I;  1FNW A;  2FAZ A;  2FE8 A;  3RNA C;  4W9E A;  4N59 A;  2OOB B;  4NAM A;  2DWQ A;  1STE A;  2IZV B;  2N7E A;  2V3S A;  4IKG A;  2NPT B;  2LI5 A;  3DCG A;  3LJ3 A;  1IBX A;  2XN9 C;  4I6P A;  2N9K A;  1IUE A;  3GZN I;  1T5X D;  3BZD B;  3CMM B;  4HJG E;  3PLU A;  5G55 A;  2KWC A;  2QIL A;  4DDG D;  3A4S C;  1FM0 D;  2REX A;  3S2A A;  1XXG A;  3EUB 2;  2D3C A;  4G3X B;  3SU8 X;  1V5T A;  4RGO S;  2CU3 A;  3MTN B;  3PGE A;  2ZCC A;  2L83 A;  3ZJU A;  3KWV A;  1ZUD 2;  1I35 A;  5CX3 A;  3VTU A;  2J0J A;  2MCN B;  4NPN A;  2WWZ A;  5EE1 A;  5AZG A;  1VZ8 A;  2K39 A;  2AL3 A;  4N6E B;  4LJP B;  1DOY A;  4LJO B;  5IN7 A;  2BPS A;  1HZ6 A;  4G11 A;  3TEZ A;  3RN9 C;  2MQJ A;  5LLI A;  1FCL A;  1Q1O A;  2D3G A;  3E56 A;  2LFI A;  3P2B A;  4BKS D;  3CF6 E;  2ZVO A;  3TSS A;  5AUI A;  2LJI A;  3IAM 1;  5D6J B;  3R66 C;  3B9J A;  2X8X X;  1WGH A;  2G3Q B;  2ZEQ A;  1IGD A;  3I57 A;  1GG3 A;  1V86 A;  2FUH B;  4LNF A;  1FNV A;  3W1S A;  5HKH A;  3DBH I;  4F8C B;  2LEK A;  1K50 A;  4I6L B;  1P1A A;  4FJY A;  2INC C;  1J7A A;  3FC4 A;  3QQ8 B;  4YSZ B;  5G5G A;  3ZGZ A;  2XNA C;  2AYO B;  2I2Y A;  2Z8L A;  1F2R I;  4RM9 A;  2WHI A;  2K22 A;  1KM7 A;  2KMC A;  2I38 A;  4YSY B;  4YL8 A;  1DYQ A;  2WDT B;  4ZYN A;  2LGS A;  1PFD A;  1PGX A;  1TYG B;  3AU4 A;  2B3A A;  3AEE B;  2YVC A;  1E10 A;  4P16 A;  2L1A A;  4O1N A;  3WIM A;  5H92 C;  3TL5 A;  2KAN A;  4TMA B;  4OHJ A;  3Q2A C;  1AN8 A;  3AU5 A;  4JPS A;  2Y5P A;  2DZK A;  3DQV A;  1GUA B;  2G9H D;  1F0Z A;  2LVQ A;  1KF6 B;  2NBU A;  3BWU D;  3Q14 C;  3FIL B;  2LVO A;  3J9C A;  4FBJ B;  1AAR A;  1GJZ A;  3ENE A;  2MA9 B;  1JQ4 A;  3W1S C;  1QOB A;  3ZRF A;  1EWC A;  4ASW C;  2WXL A;  1UH6 A;  3MHS D;  4RCO A;  4EKU A;  1TS4 A;  1UGM A;  4YT0 B;  4QAY A;  2WP9 B;  5BYS A;  4S17 A;  3DVG X;  4DHZ E;  4DWF A;  3AED B;  2L7R A;  4CHK A;  5AZF A;  2IND C;  1UWX A;  2G4S A;  2D3B A;  2JX5 A;  4KGR A;  4HKQ A;  4M02 A;  4W9L A;  1E5W A;  1WMH B;  5E6J A;  4EOY A;  2LUE A;  1V1P A;  2E6X A;  1CMX B;  1MG4 A;  1L4D B;  3QA8 A;  3UQB A;  5D3D A;  4MT5 A;  1OGW A;  4LNN A;  2LAS A;  2I1J A;  2DX5 B;  3Q6B A;  1GNU A;  3K9O B;  3L13 A;  1QOG A;  1V49 A;  4JIO U;  5EDS A;  3B0A A;  3SDL C;  1P98 A;  2MSE D;  3RZF A;  2Q5W D;  1WGR A;  2HTH A;  4FUL A;  3N20 C;  1SJE D;  2MH7 A;  1KRH A;  4GSW A;  2BYV E;  1J7B A;  2RR9 A;  4PS7 A;  3H1U A;  4RGM A;  2V4I B;  2WX1 A;  3UI3 A;  1J7C A;  4WJQ A;  2NBW B;  3P4R B;  4YSX B;  3ALB A;  1VR9 A;  3NVZ A;  2AX5 A;  1G6J A;  2NTS A;  4JWS C;  3PRE A;  2C7N B;  1JML A;  3WAO A;  3EA6 A;  4B6W A;  2N1V A;  3QCA A;  3IT4 B;  1OTR B;  1OEY J;  2LJ5 A;  4YTN B;  4ZDV A;  3OJ4 B;  1ZDV A;  3H6N A;  3ZYY X;  1OFF A;  4KZC A;  2J4X A;  1J19 A;  1UBI A;  1WX8 A;  1JWB D;  2CU1 A;  1E8Y A;  2JSV X;  2AEH A;  4BKT A;  1QLB B;  2Y3A A;  5D3I B;  4MEL A;  1WJ4 A;  3U7Z A;  4IG7 B;  4MAC A;  1E8W A;  1E7P B;  4NY0 A;  2WXJ A;  2DAJ A;  1PQS A;  3W5V B;  1VJK A;  3ONS A;  4K81 A;  2KT7 A;  2MBE A;  3IHP C;  4B0E A;  1ET6 A;  4WUR A;  2IGG A;  3EFC A;  2L0F A;  4PT5 A;  1WXS A;  4C7Y A;  3H7P A;  3MJW A;  3V05 A;  1I4R A;  5I4D A;  4W9I A;  2J52 A;  1NEN B;  5J18 A;  1V1O A;  4ZHP A;  3Q3M C;  3VHT C;  4I6N B;  3N32 A;  1TGZ B;  1EM7 A;  3AEB B;  3OWE B;  3DOW A;  4KGS A;  1C1Y B;  2PIA A;  1MJD A;  3PHX B;  1PGA A;  2BB5 A;  3PS6 A;  2K25 A;  1CK1 A;  5LNK 1;  2KNB A;  1KLG D;  3ZJT A;  1LXD A;  1HXY D;  1ZPS A;  3ZLZ A;  3DBR B;  2M17 A;  1QKZ A;  3HM6 X;  4WWM A;  2BQQ A;  2MEK A;  3JW0 X;  4HLE A;  1VDV A;  3H8H A;  2NMQ A;  3A9J A;  2O6V D;  3GZN B;  2VH1 A;  3DBS A;  4ZRP A;  1XD3 B;  2HJ8 A;  1FXI A;  3ZTD A;  5CTR C;  4KKJ A;  2WNM A;  2WXF A;  5TR5 A;  2LVP A;  2N7J A;  2LWP A;  2EEL A;  3UIO B;  3AEC B;  1SE3 A;  1C78 A;  1YNT E;  3T8M A;  3SEB A;  1L4Z B;  4RFB A;  5DPS A;  2LGY A;  1CZP A;  1DGJ A;  3M62 B;  5BMI A;  1N62 A;  1N5W A;  4BBN C;  2C7H A;  1JWU D;  2C7M B;  2WXN A;  3AH7 A;  4HPL B;  4N58 A;  1C76 A;  4KV2 A;  1GPX A;  4AP4 C;  1R7S A;  1NDD A;  2QDF A;  1HE8 A;  2IGD A;  4M0W A;  2KTR A;  3R3M A;  2BYE A;  3AE6 B;  2LHE A;  2GBJ A;  3T3O A;  1S3S G;  4WQO B;  3Q8C A;  2IO1 B;  3HK0 A;  2C60 A;  2KOX A;  3FKY A;  2DBY A;  1WSP A;  2K8B A;  1N6Z A;  1FRD A;  1OQY A;  4GDK B;  4ICV A;  2CHX A;  5TSS A;  4ARI A;  4NJ6 A;  1NYQ A;  2N7D A;  2XEW A;  1JCK B;  1L6V A;  2JRH A;  2KQ4 X;  3BY4 B;  4C4V A;  1MFW A;  1PUT A;  1C79 A;  2KMA A;  5G2N A;  1WY8 A;  2A5U A;  2EKI A;  3DBH B;  3A1Q B;  1YQ4 B;  3LB8 C;  1E90 A;  4FHK A;  3D32 A;  4RGN A;  4DK5 A;  3N30 A;  1HZ5 A;  1A70 A;  4FAD A;  4JQW C;  1I4G A;  1SGH A;  1XLP A;  4CYE A;  4ZRQ A;  4MM3 A;  1N63 A;  3Q3F A;  2ZCB A;  2RSU A;  1JWA D;  4KDL B;  2MJE A;  5CHW A;  2KVR A;  3PT2 B;  4W9D A;  4WWP A;  2FID A;  1ZGU B;  1ZOY B;  4NAW B;  1WI0 A;  2N0S B;  2CKH B;  1ZXH A;  2HD5 B;  2LXA A;  3Q3O C;  4ACF A;  1YJI A;  2Z59 B;  4DHJ B;  1RFA A;  1OQQ A;  4J6I A;  2KQS A;  2HJ1 A;  1WJU A;  2KO3 A;  2CJO A;  3LYY A;  1K53 A;  1RYJ A;  3GP7 A;  1NEK B;  2D5G A;  3PVL A;  3L17 A;  2WS3 B;  4W9C A;  3ZXR A;  1HEZ E;  1WIA A;  1WJN A;  1L2N A;  1XCT L;  2KZR A;  1I7H A;  1XCQ L;  1NI2 A;  1YX5 B;  2RD0 A;  3OJ3 A;  1NYR A;  4MJS B;  3U2S C;  3WAL A;  3RNG C;  4ANU A;  4EEW A;  5DPW A;  2I1K A;  2RDH A;  3VUW A;  3W5U B;  2YLM A;  2M1M A;  1R4M I;  5LXI B;  1ESF A;  1UZX B;  1WH3 A;  3TIX A;  2KXJ A;  2LXC A;  2WXO A;  3JSV A;  4A55 A;  3ZIM A;  4F7Z A;  3VUY A;  4GDL B;  3AE1 B;  5GMV A;  2GMI C;  5D7G A;  4USA A;  3RNB C;  4IM0 A;  5EE0 A;  1E8Z A;  2CHZ A;  3Q8E A;  2MW5 A;  2O2V A;  1ACC A;  4TUU A;  1HTO A;  3C0R B;  3UGB B;  1KFY B;  1JW9 D;  3VAW A;  1P7F A;  1K52 A;  2PEA A;  4MH8 A;  3W9C B;  3MC8 A;  1WE6 A;  2V4L A;  1XEE A;  1MPE A;  2JZZ A;  2KDM A;  5D2M B;  2KWD A;  4DQO C;  4D2K A;  3GB1 A;  4GB9 A;  4RF1 A;  4B0M A;  2N4F A;  3BII D;  4L2Y A;  1IPG A;  3ZNZ B;  2DYM A;  4E74 A;  1IP9 A;  1QIL A;  1DOI A;  1EWY C;  1P0R A;  2PJH A;  2WXH A;  1TY2 A;  1EO6 A;  4FXC A;  2JY6 A;  3PZ8 A;  4IWQ A;  2ONQ A;  3RMK C;  1I4Q A;  2MHJ A;  2IGH A;  3QAQ A;  3KYC D;  2K8C A;  1YD8 U;  2GBM A;  3URY A;  1C3T A;  2ZNV B;  1PGB A;  3P42 A;  1EU4 A;  5HG2 A;  2ICI A;  3NY5 A;  1S1Q B;  2D07 B;  3IG3 A;  5IA7 A;  4ZRI A;  4WIP A;  4WWN A;  2DZM A;  2INN E;  2O6V B;  3OLM D;  2CS4 A;  3P63 A;  2GRI A;  4REZ A;  1QF6 A;  1LO5 D;  1MHX A;  5IP4 D;  4X57 B;  4NJC A;  2DZJ A;  4HWI B;  4A9A A;  1ISN A;  3NS1 A;  3P4S B;  1ET9 A;  4A6Q A;  4J3O D;  2BVC A;  1FD6 A;  1NI3 A;  4US8 A;  4YXD B;  2J0K A;  3GS2 A;  3W2D A;  3I3T B;  3RZW C;  1FNU A;  1TKY A;  3UIP B;  5AZH A;  5JZE B;  2XK5 B;  3E9S A;  3ZUN A;  4US9 A;  4WQM A;  2BTE A;  2ZVN A;  2KVZ A;  3X0W A;  3ETR A;  1EF5 A;  2K3U A;  1VD2 A;  4IWO A;  4P1C C;  1LGR A;  2KFK B;  1E9M A;  3VDZ A;  4MSQ B;  2LMC A;  2DYO A;  3BVG A;  3GOE A;  4LNI A;  3EC8 A;  3A9K A;  2BT6 A;  3DWG C;  4EZL A;  5JH5 C;  2WXQ A;  3H9D A;  3IAS 1;  1PDX A;  4PS8 A;  4XE0 A;  4HK2 A;  1ENF A;  4IC7 B;  4TQ0 A;  4ARC A;  2RGF A;  2IJ0 A;  4XX5 A;  1V6E A;  2V0G A;  1P9D U;  3MC0 B;  4HCN B;  3B2F A;  1D6E C;  4M8M A;  3PSE B;  1RWS A;  1WJ6 A;  2BGF A;  2CJN A;  3Q8B A;  1V80 A;  2NPT A;  1FPY A;  2M19 A;  1QOA A;  2K9X A;  4LCD E;  4K7W A;  3LXF A;  2W82 A;  1I42 A;  3T9L A;  3O65 B;  3ZW3 A;  5HHD G;  3P4Q B;  1JWM D;  2JXT A;  4RH6 A;  1ZDX A;  2BKR B;  3QC8 B;  2WYQ A;  4WJN A;  3DHG C;  2ZPY A;  1KTK A;  1MVK A;  1N5X A;  3R7R A;  1FO4 A;  5DCN A;  2W54 A;  1XF5 L;  4MDK E;  5JHB A;  2IDY A;  3B1L X;  4HRO A;  1C4A A;  3WAN A;  3AE9 B;  2ZJD A;  2BKF A;  2JYE A;  1T0Y A;  1X1M A;  2V1Y A;  3SFE B;  5C3J B;  5E6P A;  3PLV A;  2MJ3 A;  1EU3 A;  1WXA A;  4K7S A;  1WGD A;  3ZNH B;  4DHJ D;  4ANW A;  4GN1 A;  1UGJ A;  5E6O A;  1YJ1 A;  2J42 A;  4YWG G;  3APC A;  4LNO A;  3HVZ A;  1GC6 A;  2JWZ A;  4OZC A;  2KJ6 A;  1YQ3 B;  4H2A A;  3DBL I;  4ZRJ A;  2N9X A;  4ANV A;  3I63 C;  3R8B A;  2KLG A;  1GC7 A;  3AE8 B;  3B08 A;  5JXV A;  3T3N A;  3NVV A;  1XT9 B;  1LM8 B;  4GLS C;  2ZW0 A;  3KLS X;  4HEA 1;  2WDR B;  2ZW1 A;  3R2I A;  2M56 B;  2K6D B;  4ITK A;  2AL6 A;  4OZB A;  4A3O A;  1WYG A;  1ZW7 A;  1RLF A;  4RF0 A;  2KMM A;  4ICU A;  5MPO A;  3V61 A;  3M63 B;  1KLV A;  2PPH A;  2JRI B;  3P1M A;  2L00 B;  2DAF A;  2BW2 A;  3KWL A;  2Z0E B;  2L0T A;  4BVU C;  2VZK B;  3BYT B;  4P7I A;  1P7E A;  3M95 A;  2HTM E;  4KIK B;  2KC2 A;  2UYZ B;  2QHO A;  3QK0 A;  1XQQ A;  3PO0 A;  2PLP A;  2FBW B;  2MBB B;  4WWO A;  3KUD B;  2ASQ A;  2K5P A;  2W3R A;  3ZXV A;  2FCN A;  3AE7 B;  3RT3 B;  5CHF A;  3RPF C;  3ZQ4 A;  3MJ5 A;  4HXD A;  1TJE A;  2QEJ C;  3IXS A;  4XWT A;  2R61 A;  1WWT A;  2MBQ A;  3FIL A;  4NQK E;  1L0V B;  2IO0 B;  5DPT A;  4B9K A;  1E6E B;  4IM3 A;  1T0R C;  2J53 A;  4HJK A;  4XDD A;  1WXV A;  2QJL A;  4TQ1 A;  5FR6 A;  1T6B X;  4UDU C;  2AQ2 B;  4A3P A;  2NR2 A;  3RD2 A;  4E71 A;  2KX0 A;  3HIZ A;  5FR3 A;  2QCZ A;  4IW0 A;  1R4M B;  1E0Z A;  1IGC A;  2NCN A;  3NUH B;  3MP9 A;  2K1F A;  2PVG C;  1KJT A;  4RNA A;  2Y5B B;  2PW9 A;  3ZVV A;  3VRA B;  1D5X C;  1WMH A;  1A5R A;  3R2T A;  2G4D B;  3VTW A;  1JRO A;  3MFG A;  3Q3J A;  3EGR A;  2BF8 B;  4NJ7 A;  2KDI A;  1BML C;  2KK8 A;  2LGX A;  1TS3 A;  4HDQ A;  3ZKJ C;  2WXI A;  1KOT A;  1BXT A;  2QSD A;  2NTT A;  2PKO A;  5CHV C;  2G45 B;  1YQB A;  4WJP A;  1FFV A;  1FRR A;  4WJO A;  4AOF A;  4L1B A;  2QIE B;  3TEY A;  3NZS A;  4HDO A;  3GE8 C;  1WF9 A;  2JZ3 B;  2JUO A;  1FCC C;  3AI5 A;  2MP2 B;  1Q10 A;  5IOI A;  3A4R A;  1U4A A;  3KQ4 A;  4ZHO A;  3DHI C;  3I5J C;  2MBH A;  4K3C A;  3IFW B;  1T0Q C;  4NQL B;  1QOF A;  4RMA A;  4DDI D;  1IBX B;  1C77 A;  4GMV A;  3GE3 C;  2IO2 B;  1MG8 A;  3VH4 B;  2LRW A;  5BYR A;  3RI7 C;  2QMT A;  1I4P A;  4BKG A;  3U30 A;  2KWU B;  2GBR A;  1MI0 A;  4AQ7 A;  1PYW D;  2BYF A;  1M4V A;  3DVN U;  4W9K A;  1DOX A;  4FHJ A;  3AV8 A;  2UU7 A;  4FJZ A;  3TEX A;  5AUK A;  1WRD B;  4JE3 B;  5C1Z A;  2CHW A;  2NBV B;  3ZJV A;  3PRZ A;  2KD0 A;  1HTQ A;  1GB4 A;  2K6Q A;  4XC2 A;  2WLB A;  4GU2 A;  1GB1 A;  1VZ7 A;  2N9L A;  3PTF C;  1L7Y A;  4S0R A;  4P6V F;  2J7Q B;  3IT6 B;  3WAM A;  2Z0D B;  1BUI C;  3AEA B;  2DEN B;  4XDC A;  3VUX A;  2LGI A;  1FXA A;  2PE6 B;  3V62 A;  4W9J A;  1D5Z C;  2RPQ A;  2L52 A;  1GOZ A;  4FN2 A;  2B76 B;  3B2G A;  1SSN A;  3VQI A;  4HCP B;  4E3C A;  1ZE3 D;  3WA0 A;  1TY0 A;  3BVZ A;  4BKS A;  1SBB B;  3L0W B;  4HRS A;  3VVW B;  3ZO5 B;  1MHH E;  4OVV A;  2KDE B;  2W55 A;  3PPA A;  5E6N A;  2WXR A;  1IYF A;  1R4N I;  3K9P B;  4ZYS A;  4LK0 M;  1WE7 A;  3BVM A;  1Q5W B;  2D10 A;  3KVF B;  2LHD A;  1F9J A;  2OJR A;  3TBL D;  2INP E;  4MSM B;  1JRU A;  1YN5 A;  1CQV A;  2WXP A;  2NS5 A;  1V97 A;  1SF0 A;  2JQR B;  4A8X C;  4L23 A;  4OVU A;  5T8I A;  4TV3 A;  1I4H A;  2ON8 A;  4IOI E;  1WGY A;  3TCA A;  5C23 A;  2L05 A;  2BS4 B;  2ZZP B;  3X23 A;  3EFU A;  3W1Y A;  3MHZ A;  3UIN B;  3BK2 A;  1Y56 A;  1RAX A;  4IUM B;  5J2R A;  4AJY B;  2N9E B;  4IM2 A;  3TUO A;  5H8Y E;  3R7Q A;  2TSS A;  3HUI A;  2FUG 1;  3ABV B;  2D3A A;  2V3P A;  1KLU D;  4A20 A;  2GOW A;  4EZK A;  5D94 A;  1E7U A;  4XZ4 A;  2VZK D;  2M0A A;  3AE3 B;  2WU5 B;  4II2 B;  1M94 A;  2MX2 A;  4NNJ B;  3Q3N C;  4DHZ B;  2BB6 A;  3APF A;  3PV1 A;  4BFR A;  4DXA B;  2KX3 A;  4W9H A;  1D3Z A;  4GDK A;  4Q2J A;  1TTN A;  2GLS A;  3AN1 A;  1FIQ A;  4JWU C;  3RCZ A;  5BYQ A;  4CQN A;  3WAP A;  1YJJ A;  4LDT B;  4PYU A;  4WAA A;  3DBL B;  1ZKH A;  3KH0 A;  3Q69 A;  3Q8A A;  1WM2 A;  5AEK B;  3A1Q A;  4M01 A;  5BMH A;  3SHQ A;  2LRU A;  2AQ1 B;  1UBQ A;  4C00 A;  3L16 A;  4BOS C;  2C5L C;  2JVC A;  3N1Y C;  5FKA C;  2WXK A;  4LTU A;  5IO9 A;  1SEB D;  3NVW A;  2LGD A;  1TBE A;  1SE2 A;  3RUI B;  1V1P B;  3VTV A;  3N1X C;  2WU2 B;  3AEF B;  3DHH C;  2N9P C;  4IDI A;  5KHQ A;  3AUL A;  2GI9 A;  2WDV B;  4NAW A;  2IYD B;  1WXQ A;  3V3X A;  4DXG A;  3EHV A;  3TJP A;  1L6U A;  3FAH A;  1YX6 B;  2FIF A;  3AE4 B;  3ZNG C;  1TIF A;  1HQR D;  3AM9 A;  2R2Q A;  2EMT A;  1Z5S B;  3N1Z C;  3CSF A;  3P4P B;  3ZNI D;  2L32 A;  4XYC A;  1TZO A;  1LFD A;  3BK1 A;  1JWS D;  3NZU A;  2BS2 B;  1EF1 A;  1D4B A;  4FJV B;  1V81 A;  3ZTC A;  3APD A;  3AE5 B;  3OG5 A;  4MJS A;  2WQY B;  3AMZ A;  4EZJ A;  3L54 A;  1WXM A;  4BOZ B;  1L5P A;  4LLG M;  2WGS A;  3U52 E;  1AW7 A;  4OZA A;  3DVN V;  1EUV B;  3JVZ X;  2A4Z A;  2SEB D;  1F2R C;  2LUM A;  2QC8 A;  3I9V 1;  2JZP A;  2SAK A;  2KAC A;  1H8C A;  1K51 A;  1FMA D;  5BMG A;  3N9Y C;  3EEC A;  2FCS A;  3KUC B;  2V9H A;  3PRP B;  1SJH D;  1WGG A;  3NG0 A;  2IBI B;  2OHF A;  1NBF C;  4GDL A;  1C4P A;  3HVD A;  1Z2M A;  3OAW A;  1SXT A;  4GGQ A;  1B9R A;  1WM3 A;  4JX1 C;  2FCQ A;  4EUT A;  3H7P B;  4MGZ E;  3L4P A;  4ANX A;  2XBB C;  2D11 A;  3RUL A;  2GB1 A;  2KDF B;  1SB3 C;  2KAJ A;  2KN5 A;  4KZ0 A;  1E8X A;  1Y8R C;  3KYD D;  4BAX A;  4EE2 A;  3PHW B;  5JHA A;  2MRP A;  1HA5 A;  3AXC A;  2KKC A;  1ZXI A;  2X38 A;  1VCB A;  2KJH B;  1LQB A;  1K8R B;  1CJE A;  3SR6 A;  2ZPN A;  1FXT B;  3O13 A;  2YEP B;  1XO3 A;  2KYW A;  2JT4 B;  1V9J A;  3U7D A;  4TKN A;  4DBG A;  2IPK D;  2PE9 A;  4YTM B;  2BS3 B;  3A9J B;  4ZOH C;  2KDB A;  1P3Q U;  4HPP A;  3C8Y A;  4XWW A;  4JLC A;  2O6V A;  3NRZ A;  3VFK A;  1XLN A;  4AJW A;  1WRI A;  4LNK A;  4W9G A;  3NOB A;  3HRD D;  2JF5 A;  3NZ3 A;  3QIJ A;  1T3Q A;  4HPM B;  2KQ7 A;  1YN4 A;  2E3T A;  1SE9 A;  4GOC A;  2AQ3 B;  3CWI A;  3QAR A;  4XGA B;  2IY0 B;  3VH3 B;  1WX7 A;  2K0P A;  2OED A;  2NVU I;  2BBC A;  3HM3 A;  5DPR A;  3UQA A;  5EE3 A;  2MLB A;  2XK5 A;  2EMS A;  2GBN A;  3V6E B;  2HDE A;  3C19 A;  1YMH E;  2RMM A;  4M0W B;  2KTR B;  3ZRC A;  5HI1 A;  5G5H A;  4F1S A;  3TEW A;  2KFK A;  2V3N A;  1ROE A;  3IVF A;  1AWD A;  1D5M C;  2L76 A;  5L95 C;  4MGK E;  2WXM A;  3V60 A;  1C9F A;  1UNS A;  3KUZ A;  3BIN A;  5IKC M;  4C80 A;  5EE9 A;  1QQR A;  2JWU A;  3MC9 A;  2GBK A;  1F52 A;  4C4V B;  1RRB A;  2LD9 A;  4G0N B;  1QT9 A;  5J17 A;  2ZNV C;  4WH4 A;  3VR9 B;  1R4N B;  5LXH A;  1QZE A;  4KVG B;  4M8N A;  2KWV B;  2Y5C A;  3AE2 B;  2C9W B;  2WXG A;  4LDT D;  2IO3 B;  1C4C A;  3M3J A;  3NHE B;  4KSK C;  4MM3 B;  4OW0 A;  2ACZ B;  1V5O A;  4G50 A;  4PS3 A;  2JYT A;  2BWF A;  2KFJ A;  1T0S C;  2MBO A;  1I4X A;  1OQR A;  2AWT A;  4KDI C;  2L3Z A;  2PMV A;  1J0G A;  2FNJ B;  5GXG B;  2N1W A;  3RNC C;  3ML9 A;  4URK A;  4GXB A;  3UF8 A;  4HKZ E;  2DLB A;  1V2Y A;  1TT5 B;  4MEM A;  3SD5 A;  1L0X B;  2KTF A;  4DXF A;  2VRR B;  1WR6 E;  2LZ6 A;  3LDZ E;  1VZ6 A;  3IBE A;  3PRM B;  1VLB A;  1BT0 A;  2KLC A;  4KX6 B;  2EKE C;  1TKG A;  2UWQ A;  2RPV A;  1WZ3 A;  4OVZ A;  1OEY A;  4C56 C;  1H4R A;  3L10 B;  4NZL B;  4AS1 A;  3N3K B;  4WAF A;  3DVG Y;  2JPH A;  1XLO A;  3DDC B;  3RFZ B;  3U8Z A;  1TZ1 A;  2MWS B;  2IY1 B;  2H88 B;  4C7Z A;  2BYT A;  1UD7 A;  1YOV B;  3ECI A;  1F77 A;  4PYZ A;  3NVY A;  4R3D A;  2DZI A;  2KN4 A;  1SE4 A;  2M8S A;  3HHM A;  3JSV B;  2H89 B;  5C2T B;  1UWM A;  3PZ7 A;  4JL9 A;  1JAL A;  2M0X A;  3VRB B;  4N9F 4;  4GIV A;  2L8J A;  2RDB C;  4M00 A;  3ML8 A;  1RFK A;  4K1R B;  3CIR B;  2W9N A;  3H7S A;  1UEL A;  2R2O A;  5IAA C;  1XLQ A;  5L83 A;  1J8C A;  3V6C B;  4EFO A;  3L08 A;  4ZRK A;  4JGH B;  1TKE A;  2WX0 A;  2KHW B;  1N61 A;  1TS5 A;  2FCM A;  2O2V B;  3DWM A;  1Q0W B;  1UF0 A;  1N60 A;  3AB5 A;  4B95 A;  2D2Q A;  4KKI A;  3NS8 A;  1E7V A;  4KIK A;  2CR5 A;  2K8H A;  3PZD A;  2PTL A;  2DHZ A;  2W3S A;  1YN3 A;  1WZ0 A;  4RM8 A;  5KHO A;  4PK1 A;  2RDG A;  3AEG B;  3ZDT A;  4K7U A;  2BWE S;  4K3B A;  3QWZ B;  1JRP A;  1WGK A;  4KGT A;  4YTP B;  4II3 B;  2HE7 A;  3SFD B;  1WR1 A;  1ZP0 B;  2KJR A;  3RNE C;  1FEH A;  4AWJ A;  1VRA B;  2OJW A;  1KH0 A;  3CST A;  4BBN F;  3QX1 A;  2G1E A;  4MGY E;  4A90 A;  3Q8F A;  4RGT A;  2DYB A;  3QHT A;  1GAQ B;  4CO7 A;  4AUQ C;  1YIW A;  1B1Z A;  4BZA A;  4P1B C;  2VH2 A;  4KSL C;  2M4N A;  3U4E G;  1V8C A;  3KW5 B;  1TS2 A;  3QJZ A;  2YEP F;  1AYF A;  5BO4 B;  1SIJ A;  2WDQ B;  1WFY A;  3WCQ A;  1RM6 C;  3VXW A;  4FLH A;  5HFY A;  3DPD A; 
#chains in the Genus database with same CATH homology
 2EEL A;  1UUP A;  5FK9 C;  5JXV A;  3T3N A;  3NVV A;  3AEC B;  3BK1 A;  1SE3 A;  1JWS D;  1D4B A;  2BS2 B;  1C78 A;  1YNT E;  2ZW0 A;  4GLS C;  3KLS X;  2PVO D;  4HEA 1;  2WDR B;  1L4Z B;  4RFB A;  1FFU A;  3SEB A;  2JU6 X;  2ZW1 A;  3R2I A;  1CZP A;  2M56 B;  3AE5 B;  3VR8 B;  1DGJ A;  4ITK A;  5BMI A;  3BYY B;  1N62 A;  1N5W A;  2WQY B;  3AMZ A;  1L0Y B;  4OZB A;  1JWU D;  2MJD A;  1WYG A;  2WXN A;  3AH7 A;  1L5P A;  4LLG M;  1C76 A;  4N58 A;  4RF0 A;  2KMM A;  3U52 E;  1AW7 A;  4OZA A;  4TSS A;  5MPO A;  1GPX A;  1NVI D;  1R7S A;  2IGD A;  4M0W A;  3AE6 B;  3P1M A;  1FNW A;  2BW2 A;  2SEB D;  1F2R C;  2LUM A;  3KWL A;  2FE8 A;  2LHE A;  3I9V 1;  3T3O A;  2JZP A;  2SAK A;  4N59 A;  4NAM A;  2KAC A;  1K51 A;  2DWQ A;  1FMA D;  1STE A;  2VZK B;  3Q8C A;  5BMG A;  3N9Y C;  3BYT B;  4IKG A;  1P7E A;  1IBX A;  2HTM E;  2XN9 C;  2DBY A;  1SJH D;  2N9K A;  1WSP A;  1IUE A;  2OHF A;  1FRD A;  1T5X D;  3BZD B;  4GDK B;  5TSS A;  4HJG E;  4ARI A;  1NYQ A;  3PO0 A;  1C4P A;  2PLP A;  3HVD A;  2FBW B;  2QIL A;  1JCK B;  1L6V A;  1SXT A;  1FM0 D;  2KQ4 X;  2K5P A;  2W3R A;  1B9R A;  1XXG A;  3EUB 2;  3AE7 B;  3RPF C;  1PUT A;  3ZQ4 A;  1C79 A;  4JX1 C;  3MJ5 A;  2EKI A;  1TJE A;  4RGO S;  2CU3 A;  2QEJ C;  3IXS A;  2R61 A;  3L4P A;  4XWT A;  1WWT A;  1YQ4 B;  3LB8 C;  3FIL A;  2GB1 A;  4RGN A;  1L0V B;  1SB3 C;  2KAJ A;  1HZ5 A;  1A70 A;  2L83 A;  3ZJU A;  3KWV A;  1E6E B;  1I4G A;  1ZUD 2;  2J53 A;  1XLP A;  4XDD A;  2QJL A;  4ZRQ A;  4TQ1 A;  4EE2 A;  1T6B X;  4UDU C;  1N63 A;  1HA5 A;  2AQ2 B;  5EE1 A;  1ZXI A;  2X38 A;  1VZ8 A;  1JWA D;  1CJE A;  3SR6 A;  2MJE A;  3O13 A;  2YEP B;  1XO3 A;  4N6E B;  1DOY A;  5FR3 A;  1ZOY B;  4NAW B;  1IGC A;  1HZ6 A;  1E0Z A;  3TEZ A;  1FCL A;  2N0S B;  3NUH B;  3E56 A;  2LFI A;  1ZXH A;  3MP9 A;  1YJI A;  2PVG C;  4RNA A;  2IPK D;  3TSS A;  5AUI A;  2LJI A;  3IAM 1;  2PW9 A;  3B9J A;  4YTM B;  2BS3 B;  1OQQ A;  3VRA B;  1D5X C;  1IGD A;  3I57 A;  4ZOH C;  3R2T A;  1JRO A;  3MFG A;  3C8Y A;  3EGR A;  4XWW A;  2CJO A;  3LYY A;  1K53 A;  1RYJ A;  3GP7 A;  1FNV A;  1NEK B;  3NRZ A;  2D5G A;  3W1S A;  2WS3 B;  1XLN A;  1WRI A;  1HEZ E;  2LEK A;  1K50 A;  1BML C;  1TS3 A;  1J7A A;  3FC4 A;  3HRD D;  4YSZ B;  1XCT L;  5G5G A;  3NZ3 A;  3ZGZ A;  1T3Q A;  2WXI A;  1YN4 A;  2E3T A;  2XNA C;  1I7H A;  2AQ3 B;  1XCQ L;  2I2Y A;  1BXT A;  2QSD A;  2NTT A;  2PKO A;  3CWI A;  2Z8L A;  1F2R I;  1NYR A;  2K22 A;  3U2S C;  2K0P A;  1FFV A;  1FRR A;  2I38 A;  4L1B A;  2QIE B;  2OED A;  3TEY A;  2BBC A;  4YSY B;  2RDH A;  5EE3 A;  3W5U B;  2HDE A;  1FCC C;  1Q10 A;  1YMH E;  2RMM A;  1DYQ A;  3KQ4 A;  5HI1 A;  4ZHO A;  1ESF A;  5G5H A;  1PFD A;  1PGX A;  1TYG B;  2WXO A;  4A55 A;  3TEW A;  3AEE B;  2V3N A;  1ROE A;  1QOF A;  1E10 A;  4P16 A;  1AWD A;  1D5M C;  1C77 A;  1IBX B;  2L1A A;  4O1N A;  2WXM A;  5BYR A;  4GDL B;  3AE1 B;  1C9F A;  1UNS A;  5H92 C;  4TMA B;  2QMT A;  1I4P A;  4C80 A;  4OHJ A;  5EE9 A;  1AN8 A;  1QQR A;  2JWU A;  4JPS A;  5D7G A;  2Y5P A;  4USA A;  1MI0 A;  2G9H D;  4AQ7 A;  1F0Z A;  1PYW D;  5EE0 A;  1KF6 B;  1M4V A;  3Q8E A;  1QT9 A;  3BWU D;  1DOX A;  4WH4 A;  3VR9 B;  3FIL B;  3AV8 A;  3J9C A;  1ACC A;  3TEX A;  5AUK A;  1KFY B;  4JE3 B;  1JW9 D;  3ZJV A;  1P7F A;  1K52 A;  2Y5C A;  3AE2 B;  1GB4 A;  4MH8 A;  3W9C B;  1JQ4 A;  2WLB A;  2WXG A;  1QOB A;  1C4C A;  1GB1 A;  1XEE A;  1MPE A;  1VZ7 A;  4MM3 B;  2N9L A;  1EWC A;  2KDM A;  4OW0 A;  2WXL A;  2ACZ B;  2KWD A;  4RCO A;  4DQO C;  4D2K A;  2JYT A;  3GB1 A;  4RF1 A;  4B0M A;  3BII D;  4L2Y A;  1TS4 A;  4P6V F;  4YT0 B;  2WP9 B;  5BYS A;  2DYM A;  1I4X A;  3IT6 B;  1OQR A;  1QIL A;  1BUI C;  2PMV A;  1DOI A;  3AEA B;  1EWY C;  3AED B;  4XDC A;  2WXH A;  1TY2 A;  5GXG B;  4FXC A;  2LGI A;  1FXA A;  3PZ8 A;  2ONQ A;  1I4Q A;  4HKZ E;  2IGH A;  1UWX A;  2DLB A;  1D5Z C;  3URY A;  2L52 A;  2JX5 A;  1GOZ A;  4KGR A;  2B76 B;  3B2G A;  4HKQ A;  1L0X B;  1PGB A;  3P42 A;  4DXF A;  1SSN A;  3VQI A;  1EU4 A;  5HG2 A;  2ICI A;  5E6J A;  1ZE3 D;  1TY0 A;  1VZ6 A;  3BVZ A;  1V1P A;  1SBB B;  4HRS A;  4WIP A;  2E6X A;  1VLB A;  2INN E;  1L4D B;  1MHH E;  5D3D A;  4MT5 A;  4KX6 B;  2W55 A;  3P63 A;  1TKG A;  2GRI A;  2WXR A;  4REZ A;  4ZYS A;  1LO5 D;  1QF6 A;  1MHX A;  2RPV A;  4LK0 M;  4NJC A;  4OVZ A;  3BVM A;  4A9A A;  1QOG A;  2LHD A;  4C56 C;  4NZL B;  3NS1 A;  4AS1 A;  3P4S B;  1ET9 A;  4WAF A;  4A6Q A;  4J3O D;  1XLO A;  2INP E;  1YN5 A;  3RFZ B;  1FD6 A;  1CQV A;  2WXP A;  1NI3 A;  4US8 A;  4C7Z A;  2H88 B;  4YXD B;  3GS2 A;  2Q5W D;  2BYT A;  3W2D A;  1V97 A;  1SF0 A;  1FNU A;  2JQR B;  1TKY A;  4A8X C;  1SJE D;  2MH7 A;  1KRH A;  3E9S A;  4US9 A;  1F77 A;  1J7B A;  4RGM A;  2V4I B;  3UI3 A;  1J7C A;  3NVY A;  4R3D A;  4WQM A;  3P4R B;  4L23 A;  2BTE A;  2KN4 A;  1SE4 A;  5T8I A;  3ETR A;  2K3U A;  1I4H A;  2ON8 A;  4YSX B;  2H89 B;  1VR9 A;  3NVZ A;  2AX5 A;  4IOI E;  1UWM A;  3PZ7 A;  1E9M A;  1JAL A;  5C2T B;  2NTS A;  2BS4 B;  2LMC A;  2DYO A;  3BVG A;  3VRB B;  4JWS C;  3MHZ A;  2BT6 A;  3BK2 A;  1Y56 A;  3DWG C;  1JML A;  1RFK A;  2WXQ A;  3EA6 A;  3CIR B;  3TUO A;  5H8Y E;  3IAS 1;  1PDX A;  2TSS A;  3HUI A;  3IT4 B;  2FUG 1;  3ABV B;  4XE0 A;  1XLQ A;  1ENF A;  4YTN B;  4TQ0 A;  4ARC A;  1ZDV A;  2V3P A;  1KLU D;  2IJ0 A;  2V0G A;  3MC0 B;  3B2F A;  2VZK D;  1D6E C;  3ZYY X;  1OFF A;  2M0A A;  3AE3 B;  1RWS A;  1TKE A;  2WU5 B;  1N61 A;  1TS5 A;  2J4X A;  2CJN A;  3DWM A;  1JWB D;  1N60 A;  3Q8B A;  2JSV X;  3AB5 A;  4KKI A;  1QLB B;  2Y3A A;  5D3I B;  2BB6 A;  2M19 A;  1QOA A;  3U7Z A;  2K9X A;  4MAC A;  4Q2J A;  1E7P B;  2PTL A;  2WXJ A;  3LXF A;  2W3S A;  2W82 A;  3W5V B;  3AN1 A;  1FIQ A;  4JWU C;  1VJK A;  1YN3 A;  5BYQ A;  4CQN A;  1YJJ A;  2RDG A;  4B0E A;  3AEG B;  1ET6 A;  4WUR A;  5HHD G;  2IGG A;  4PT5 A;  3Q69 A;  3P4Q B;  3Q8A A;  1JRP A;  4C7Y A;  1JWM D;  2JXT A;  4RH6 A;  3V05 A;  1I4R A;  1WGK A;  4KGT A;  1ZDX A;  4YTP B;  5BMH A;  5I4D A;  3SFD B;  2J52 A;  1ZP0 B;  2AQ1 B;  1NEN B;  1V1O A;  1FEH A;  1KTK A;  1MVK A;  1N5X A;  1VRA B;  4ZHP A;  1FO4 A;  5FKA C;  1KH0 A;  2WXK A;  2W54 A;  4LTU A;  1XF5 L;  1EM7 A;  1SEB D;  3AEB B;  3NVW A;  3OWE B;  4KGS A;  2IDY A;  2PIA A;  2G1E A;  1SE2 A;  4HRO A;  1PGA A;  1C4A A;  1V1P B;  4A90 A;  2BB5 A;  3Q8F A;  4RGT A;  3AE9 B;  1CK1 A;  1GAQ B;  5LNK 1;  2WU2 B;  3AEF B;  2JYE A;  1KLG D;  3ZJT A;  3SFE B;  1B1Z A;  1ZPS A;  1HXY D;  4IDI A;  5C3J B;  2GI9 A;  2WDV B;  1QKZ A;  2MJ3 A;  1WXQ A;  1EU3 A;  3V3X A;  4DXG A;  4WWM A;  3U4E G;  1V8C A;  1L6U A;  1TS2 A;  1UGJ A;  2MEK A;  3FAH A;  1VDV A;  2J42 A;  3AE4 B;  3H8H A;  4YWG G;  2NMQ A;  2YEP F;  1AYF A;  1HQR D;  3HVZ A;  1SIJ A;  3AM9 A;  4OZC A;  1YQ3 B;  2WDQ B;  4H2A A;  4ZRP A;  3WCQ A;  1RM6 C;  1FXI A;  3P4P B;  3R8B A;  4KKJ A;  5HFY A;  2WNM A;  2L32 A;  2WXF A;  3AE8 B;  2N7J A;  1TZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...