3RPFC

Protein-protein complex of subunit 1 and 2 of molybdopterin-converting factor from helicobacter pylori 26695
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
74
structure length
74
Chain Sequence
MMVEVRFFGPIKEENFFIKANDLKELRAILQEKEGLKEWLGVCAIALNDHLIDNLNTPLKDGDVISLLPPVCGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Molybdopterin synthase catalytic subunit
publication title Protein-protein complex of subunit 1 and 2 of Molybdopterin-converting factor from Helicobacter pylori 26695
rcsb
source organism Helicobacter pylori
total genus 11
structure length 74
sequence length 74
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3rpfC00
2CU3A 1XLQA 4ZHPA 1J7AA 3AE5B 2PIAA 2H88B 3W9CB 1AYFA 1QLBB 2EKIA 3HUIA 1QOBA 5C2TB 1F0ZA 1E7PB 3AEBB 2WU2B 3WCQA 1L6UA 5H8YE 1J7CA 3NS1A 1N5XA 1DGJA 3SFEB 1QF6A 4ZHOA 5EE9A 2L83A 1TKGA 1TKEA 3L4PA 2CJOA 4YSXB 1TJEA 2K5PA 1E0ZA 1ZOYB 1YJJA 3AE2B 3VRAB 4C80A 1T3QA 1KFYB 1JROA 3P63A 4N59A 4FXCA 3VR9B 3AEFB 1RM6C 2ACZB 3P4RB 3AEGB 2W3SA 3NRZA 4ITKA 1DOXA 3P4SB 1QOGA 1N60A 1SF0A 1YQ3B 1JQ4A 3FAHA 1JWAD 1XLNA 3B2GA 2WDQB 3SR6A 1IUEA 3ZYYX 1RYJA 1XLPA 1N61A 1N63A 3AEAB 2B76B 3VR8B 3ABVB 1RFKA 2WLBA 3AECB 1JRPA 3EUB2 1UWMA 1N62A 1FMAD 2LEKA 3AH7A 1OQRA 2WDRB 4N6EB 1WRIA 1KF6B 3CWIA 4LTUA 4YTMB 4US8A 2BT6A 1OFFA 1XO3A 3B9JA 2WQYB 3NVVA 2WS3B 1TYGB 2PKOA 5AUKA 2AX5A 2M19A 3AMZA 2QIEB 4JWSC 4IDIA 1CJEA 1QOAA 3LB8C 4USAA 1FO4A 3KWLA 3AM9A 1NI3A 3AE3B 4YXDB 1WWTA 1ROEA 1VLBA 1WXQA 1RWSA 2PVOD 5H92C 4HRSA 2W54A 2OHFA 1FFUA 1ZP0B 2Q5WD 3NVZA 1L0VB 3CIRB 4HROA 4P6VF 2BS2B 1SIJA 1I7HA 1SB3C 1XLOA 3AE9B 2W3RA 1NEKB 4YSYB 2BS3B 2H89B 3AE6B 3AEEB 2BS4B 1GPXA 3AE4B 3P1MA 1QT9A 3VRBB 1NYQA 1E9MA 1V97A 3P4PB 3B2FA 1FFVA 5MPOA 2K9XA 1AWDA 1ZUD2 5EE0A 3P4QB 2HTME 1OQQA 2K22A 4JX1C 2WP9B 1JALA 2MJ3A 1JW9D 1DOYA 1CZPA 1L6VA 1FRDA 3DWGC 2E3TA 1DOIA 2DBYA 1ZXIA 3ETRA 2KAJA 3RPFC 1R7SA 2L52A 4US9A 1VJKA 5AUIA 1NENB 3PO0A 4WWMA 3NVWA 3AN1A 1L5PA 2MJEA 1PFDA 2KMMA 2M56B 3AEDB 1PDXA 3LXFA 4A9AA 2DWQA 4WQMA 5C3JB 3DWMA 1FM0D 2G1EA 1PUTA 2QJLA 1FRRA 3BIID 4KX6B 5EE1A 5GXGB 1YQ4B 3AB5A 1N5WA 2FBWB 4YSZB 3W5UB 4JWUC 1NYRA 1WYGA 4C7ZA 4YTNB 1E10A 3AE1B 2WDVB 5G5GA 1B9RA 2JX5A 1YJIA 5G5HA 4ZOHC 3NVYA 1JWBD 3HVZA 1FXAA 2PVGC 4N58A 5EE3A 3W5VB 1E6EB 1GAQB 1A70A 1KRHA 1TKYA 2JQRB 2N0SB 1QOFA 3AE8B 3SFDB 2MH7A 2W55A 2MJDA 1EWYC 1VDVA 3AE7B 3AV8A 4C7YA 2WU5B 4YTPB 2Y5CA 1FIQA 1WGKA 2CJNA 1J7BA 1FXIA 1NVID 1V8CA 4YT0B 3FC4A 3HRDD
chains in the Genus database with same CATH superfamily
1GB1A 2CHWA 3MC0B 2KO3A 3KH0A 1GB4A 3FKYA 3ZDTA 4DHZE 2L32A 3H9DA 1WX9A 4LNIA 4FXCA 1RM6C 3IT6B 1ZDVA 3NG0A 1UGJA 2LXCA 4HPMB 4M8NA 1IUEA 4TSSA 2MBHA 2J4XA 3AEAB 4K7WA 2PTLA 1I4QA 3NOBA 4MJSA 2GBJA 4L1BA 4YTMB 4CQNA 4NAMA 2RPVA 1CJEA 3MP9A 3C8YA 4HVBA 1WXQA 2KFKA 1C1YB 2W9NA 3PZ7A 4MELA 4PK1A 4FJZA 2LJ5A 1NEKB 2H89B 2X38A 3A1QA 3L13A 1YX6B 2XBBC 2K9XA 3DPDA 2CS4A 2ZJDA 2BYTA 4OVVA 3RZFA 2JRIB 1DOYA 1RLFA 2MHJA 1UF0A 1WXMA 1NENB 1FXTB 4W9LA 1GOZA 2ZPNA 3IAS1 2QJLA 4E74A 4KKJA 1WZ0A 4GIVA 4C4VA 4RF0A 3RZWC 3V6CB 3M63B 3QAQA 2OEDA 4LLGM 2INDC 1ZW7A 2HD5B 2JPHA 2MP2A 3UI3A 3W1SA 3BK2A 2MH7A 2K39A 3Q69A 1FXIA 2WXMA 2GMIC 5TR5A 2PIAA 4IM3A 4MGKE 3W9CB 1UWXA 3MHSD 2ZEQA 3W1SC 3UIOB 2LVQA 1ZOYB 2PPHA 1T3QA 3DQVA 1PQSA 2DYOA 2ACZB 4OZCA 4BKSD 3FAHA 1SE3A 1E8YA 1N61A 3EHVA 3VR8B 3FILB 3Q8BA 2EMSA 1WRDB 3RT3B 1KF6B 4LJOB 4J6IA 3Q3MC 4L2YA 5CHWA 1T0QC 2WQYB 3AULA 1J19A 1VZ7A 5C1ZA 1C9FA 5J18A 4MGZE 2KD0A 2ZW1A 3AI5A 4ZYSA 4YWGG 2D11A 2LXAA 1TBEA 3AE6B 2BVCA 2KTRA 1BXTA 2IJ0A 1NYQA 4W9IA 2PE9A 2JXTA 4I6PA 3PLUA 2GRIA 2HTME 3L16A 2RMMA 2JY6A 4Q2JA 1V80A 1CMXB 2M0AA 4ICUA 4WQMA 1FM0D 1EU4A 1NDDA 4WWOA 3ZVVA 1RAXA 3V62A 3JSVB 4HDQA 4W9HA 1F77A 1J0GA 2LJIA 3CSFA 4W9EA 1WY8A 2L05A 3ZIMA 2MJDA 3AE7B 1XQQA 1F2RI 3A4RA 1Q1OA 3ZXRA 4XYCA 1K53A 2AQ3B 4JE3B 2DZMA 4RCOA 4IUMB 4FHKA 2XEWA 2MEKA 3VDZA 4RNAA 3Q8AA 2LHEA 3QHTA 4ZHOA 3GOEA 1TJEA 2K3UA 1XCTL 2DNFA 3C19A 1T0YA 3QA8A 1N60A 1JQ4A 1PGXA 1D5ZC 2KT7A 3J9CA 2K8HA 2MX2A 1EF1A 1JRPA 2PEAA 2UYZB 5CHFA 2XN9C 4N6EB 2MRPA 4K3BA 3RNEC 1TZOA 5AUKA 3Q8CA 1WJNA 2GLSA 2LASA 1FO4A 4TV3A 1I4XA 4MM3B 2L1AA 2ONQA 5H92C 4GDLB 4XWTA 1L4DB 2LD9A 3VXWA 2GBNA 5FR3A 2PLPA 4KV2A 1E9MA 4MT5A 4MDKE 2KJ6A 2D2QA 2FIFA 1JW9D 2J42A 1BT0A 2OJWA 1P3QU 5FKAC 3BYYB 2L3ZA 3V05A 2KC2A 2RSUA 5DPSA 1D6EC 2O6VD 2BW2A 3A9JB 2IGGA 4IG7B 1WYGA 2R2OA 3N9YC 1C76A 3HM6X 5AZFA 5CX3A 4HJGE 1VZ6A 4ZRJA 3AE8B 4GMVA 4II2B 4NAWB 1V5TA 2C7NB 4OW0A 4ARCA 4FJYA 2N4FA 4WJQA 1FPYA 4P1CC 1E7PB 4AWJA 3PHWB 1TKEA 1HE8A 4WJNA 3L08A 1KLVA 2K0PA 2FCMA 1X1MA 5IP4D 3N1YC 1JWMD 1QOGA 3GE8C 3B2GA 3VH4B 2KVRA 1WM3A 5HI1A 4MJSB 2KANA 3OJ3A 3M3JA 3QWZB 3EUB2 1Z2MA 2K8BA 2ZVOA 4DXFA 4A3OA 2K6DB 4FJVB 1PGBA 3ZUNA 1AN8A 2YVCA 3BK1A 1Q10A 1VRAB 2KFKB 2KKCA 1WWTA 3CF6E 3QCAA 2MWSB 4NQKE 2W54A 1ZP0B 1SE2A 3VTUA 2D07B 3A1QB 4ZRKA 3AE9B 3BVGA 2BYEA 1FFVA 3EC8A 4M0WB 3BINA 4UDUC 2OOBB 2WP9B 3RNAC 4OZBA 3ECIA 4EKUA 4WWMA 1PFDA 4HXDA 1YNTE 1E8WA 3K9PB 2KLCA 4W9KA 3VUXA 3L0WB 3TMPB 4C4VB 5GXGB 3AU5A 3TEXA 2JZZA 3AXCA 3DHGC 2LI5A 4YTNB 2NCNA 3ZJVA 2MP2B 2G9HD 1FXAA 1DYQA 1FNVA 1LFDA 2Z8LA 1XEEA 1STEA 1E5WA 1V8CA 4YT0B 1MG4A 2GB1A 3W1YA 4A3PA 3KUZA 4BKSA 5L95C 3HUIA 2QCZA 1FNWA 1XXGA 3SFEB 1ENFA 2MBOA 2CHZA 3AE2B 1WZ3A 2KX0A 2AEHA 3R2TA 2IO1B 3DBSA 2BKFA 2KTFA 3PV1A 3VTVA 4HCNB 4DHZB 5EDSA 2DZJA 3NVVA 2FUHB 4M02A 3EGRA 3HK0A 3VHTC 4F7ZA 2V0GA 1LM8B 2LZ6A 2M8SA 3PLVA 4XZ4A 2IO3B 1TS5A 2BWFA 2KTRB 3NZ3A 3KYDD 3NZUA 3QARA 1P9DU 1M94A 4RGTA 1I4RA 4AQ7A 2XK5A 3B2FA 3R3MA 1E7VA 4B6WA 1ZUD2 1KLGD 2INCC 1OQQA 2ZVNA 1TS3A 3VFKA 3DWGC 3P2BA 3RPFC 3EFUA 2LGYA 1C4CA 2L52A 2BF8B 1TY2A 1L2NA 2HE7A 1MI0A 5HHDG 1ZE3D 4AUQC 2KQ4X 3ZKJC 5C3JB 1C3TA 3Q3NC 1YOVB 3BIID 5EE1A 4A8XC 4FA6A 2JRHA 1MHXA 3ZRCA 5G5GA 1WGDA 2PMVA 4KIKA 4N58A 3W5VB 3JW0X 3ZO5B 3N32A 3SFDB 3DVGY 1PGAA 3WAMA 1SE4A 1G6JA 5AEKB 2Y5CA 4BOZB 1V49A 1XT9B 4K7SA 1T0SC 2BPSA 3AE5B 2XNAC 2QEJC 1EM7A 1WFYA 1E0ZA 3PTFC 1GJZA 3VUWA 1YX5B 2KJRA 4XWWA 1VD2A 3UGBB 3VR9B 4IM0A 2JSVX 2DX5B 1WH3A 2R61A 5BYRA 3N3KB 4P16A 1K50A 3UF8A 2N1VA 2RDHA 4DQOC 1WJ6A 2N9XA 4M01A 4GGQA 4J3OD 4LTUA 4US8A 2BT6A 2M1MA 1KOTA 4D2KA 3WA0A 4HCPB 3KWLA 5JXVA 4A90A 3IT4B 2KN5A 3TL5A 3CIRB 2VZKD 2BB6A 2N9KA 3CMMB 2ON8A 1R4NB 2TSSA 3PRPB 2BS4B 3P1MA 1QT9A 3VRBB 4C00A 4A55A 1L7YA 1CQVA 2NS5A 2NVUI 1K52A 1IBXA 3O13A 3ETRA 5CTRC 3ZQ4A 1TT5B 2INNE 4FLHA 4HKZE 3VUYA 4HK2A 2AL6A 4A20A 3QQ8B 4LK0M 2IPKD 4DXGA 5EE3A 4BKTA 1E6EB 4M0WA 2RGFA 3DVNU 1E90A 4LDTD 3BZDB 1S1QB 2CJNA 1ZXHA 3U7DA 2JU6X 2CU3A 4XE0A 4HKQA 3R2IA 4TMAB 1QOBA 5H8YE 1J7CA 4RGOS 3Q14C 1WXVA 4RGNA 2L83A 4DHJD 3WALA 4ARIA 2A5UA 2NPTA 1JROA 2WDTB 2Y5PA 2ICIA 1L4ZB 3AEFB 2W3SA 3U52E 3O65B 2YLMA 4GN1A 4W9CA 1YQ3B 2KMAA 2DENB 2BBCA 2WDQB 1HXYD 5D3DA 1TGZB 4KGTA 3GP7A 1JCKB 1HZ6A 2NBUA 3DHHC 2KDEB 1T0RC 1N62A 2M0XA 2IGDA 2WXQA 3HM3A 2OJRA 3R8BA 1I35A 2PKOA 4IKGA 5LNK1 1UH6A 1YQBA 3RYTA 2LGSA 1V1OA 4NNJB 4GDKA 5IAAC 2B3AA 2BS3B 2LGDA 2WXRA 3SD5A 3P4PB 2C7HA 5D2MB 2CU1A 1UUPA 2ASQA 5EE0A 1ISNA 3IHPC 3SHQA 2FCNA 4OVZA 1Q0WB 4IM2A 3KWVA 3TIXA 4KKIA 2KMMA 1PDXA 3LXFA 4NQLB 4A9AA 5JHBA 3V3XA 2AWTA 5TSSA 2WXOA 1WR6E 2EELA 1J8CA 3JYUA 3DBRB 1EUVB 3L17A 2AQ1B 1WMHA 4JL9A 3OLMD 2BQQA 2IBIB 4MGYE 5LXIB 4WJOA 4AOFA 3DBLB 3HRDD 3B0AA 4HWIB 2H88B 1QLBB 2N7EA 1BUIC 1R4NI 3WCQA 1D4BA 5IKCM 5LXHA 3NUHB 4XX5A 4RF1A 3CSTA 1MHHE 2KHWB 1MPEA 2V3SA 4QAYA 4KZ0A 4ZYNA 2WLBA 4NJ6A 2PW9A 1C4AA 1OTRB 3U7ZA 2FAZA 1EU3A 1I4GA 2RD0A 4G11A 2HTHA 2GBRA 2JZ3B 4JWSC 4IDIA 3LB8C 2O2VA 3OG5A 3RNBC 1V1PA 3BY4B 1KM7A 2KN4A 3NS8A 4BVUC 2JF5A 1FFUA 2YEPF 2IDYA 1FD6A 1MFWA 3LJ3A 2XK5B 4P7IA 4DDID 1SE9A 3KUCB 4MH0E 4EZLA 2J52A 3WIMA 2LRWA 2KMCA 4M8MA 1VZ8A 4TQ1A 2UWQA 2QILA 4F8CB 1UELA 2J0MA 1BMLC 4S0RA 2DBYA 3V61A 1ZXIA 2Z59B 2WWZA 2E6XA 3JVZX 2KACA 1YD8U 2DAFA 3DWMA 5IN7A 1YN4A 2G1EA 2WXNA 3H6NA 1YQ4B 4HPPA 3GB1A 3KUDB 3WAPA 4KIKB 2MSED 4S17A 1N6ZA 2MA9B 3QJZA 4DWFA 1IGCA 2HJ8A 3NVYA 2KC1A 4ANVA 1QOFA 3PRZA 2W55A 1YMHE 3T3OA 4GU2A 3HHMA 5L83A 1SJED 2GBMA 4JGHB 4MGIE 4HEA1 1I4HA 1TS2A 4HLEA 1QF6A 1HQRD 4PS3A 4CHKA 3APFA 1WXAA 1D5MC 1P7EA 2KWDA 4F1SA 1PYWD 1MVKA 3ZNGC 2CKHB 2N9EB 1JWAD 1EF5A 2MBEA 3UQAA 3ZYYX 1F9JA 2Y5BB 3T9LA 1XF5L 1I42A 4B9KA 4XDCA 1NI2A 1WRIA 1QKZA 2J7QB 3N20C 4PYUA 4TUUA 1EWCA 4KGSA 1VLBA 3DBLI 2OHFA 1MG8A 5DPRA 4BAXA 4P6VF 2KVZA 3L54A 4I6LB 1SB3C 4LCDE 4YSYB 2ZNVC 3VH3B 3NZSA 2DZKA 2ZPYA 1FCCC 2O6VB 5D7GA 3GE3C 4KSKC 3IXSA 1IBXB 3C0RB 2IY1B 1CK1A 4M00A 4BOSC 4G0NB 3IFWB 2LWPA 3Q6BA 4LJPB 1ZPSA 2N7DA 1DOIA 2JVCA 2JWZA 3RNFC 1R7SA 3VQIA 4US9A 3N30A 4I6NB 3ZW3A 2NBWB 2MBQA 2L0FA 1IYFA 2KQ7A 4YSZB 2GBKA 2BYFA 3GZNB 4C7ZA 4BKGA 5G5HA 1LXDA 3A9KA 3HVZA 2WU5B 4ZRIA 3MFGA 5AZGA 3PREA 3GS2A 1VCBA 3W2DA 3PVLA 2KX3A 2K25A 3RI7C 5FK9C 3SU8X 2DAJA 4L23A 1VR9A 4EFOA 1L6UA 4JLCA 2D3CA 2NPTB 4P1BC 3RFZB 2K5PA 4NZLB 1XD3B 1YJJA 4C80A 3DBHB 2QDFA 3N1ZC 5D94A 4BZAA 4W9FA 3P4SB 5HG2A 3ZRFA 1SF0A 4A6QA 3KYCD 2QC8A 1RYJA 4EZKA 4JIOU 2K1FA 2BKRB 4LNKA 4EUTA 2V4LA 4WWNA 2WXJA 1UZXB 3DVNV 3ONSA 1KJTA 2C60A 2D3GA 2FUG1 4GOCA 1LGRA 3EA6A 4BFRA 2WXPA 1SSNA 3AE3B 2BYVE 4GDKB 4B95A 2WXFA 1SIFA 3ALBA 3DCGA 2G4SA 4C56C 1M4VA 3APDA 3AE4B 3QC8B 3QIJA 3PGEA 1AWDA 1GC7A 2RR9A 1JALA 3ZNID 3DVGX 1FRDA 3UQBA 2JZPA 5AUIA 3U8ZA 1WSPA 4WAAA 2L0TA 2L76A 2WXHA 2DHZA 1GG3A 4PS8A 2X8XX 3ZDMC 3W5UB 4ICVA 1K51A 2V4IB 3TCAA 1JWSD 1WMHB 2V3PA 2PVGC 2KFJA 4HPLB 1KRHA 4PS7A 1JWUD 4ANUA 3EECA 1HTQA 5C23A 3FC4A 3OJ4B 1Y56A 1F0ZA 3P42A 1JMLA 2KWVB 3AEBB 2I38A 5IA7A 4O1NA 1GC6A 4G3XB 2ZCCA 5I4DA 4CYEA 1R4MB 2LMCA 3P63A 4N59A 3Q3FA 2J0KA 2N9LA 1WR1A 4MSQB 3NRZA 2HJ1A 1WGGA 1F1HA 1XLPA 2G4DB 2RDGA 3LYYA 2MCNB 1FCLA 3AECB 4RGMA 5E6NA 1ZGUB 4OZAA 1FMAD 3GZNI 5KHOA 2N7JA 2ZW0A 3KVFB 3B9JA 2O2VB 4H2AA 1V1PB 3AMZA 3RULA 3X0WA 1NI3A 1TS4A 1RWSA 1ET9A 2JYTA 1S3SG 4HROA 2M17A 1I7HA 1WX8A 5BMHA 2W3RA 2WXLA 2R2QA 3TBLD 1V97A 3HIZA 1F52A 1L0XB 1UBIA 3DBHI 4GLSC 3ZJUA 2EKEC 1B1ZA 2L8JA 4X57B 1WF9A 1HA5A 2CHXA 4K7UA 4ACFA 5KHQA 4B0MA 2M56B 2Z0DB 3I57A 4TQ0A 2WX0A 2DWQA 1H4RA 2C9WB 2FCSA 4PT5A 1A5RA 3IG3A 2VH2A 2PJHA 5G55A 2JX5A 4OVUA 2DYBA 3IAM1 2O6VA 4R3DA 1AW7A 1TKYA 2N0SB 3WAOA 4WQOB 2GI9A 2NTSA 3AV8A 3B1LX 1FIQA 4RMAA 2MQJA 4HJKA 2KJHB 1XLQA 1J7AA 5BMGA 2UU7A 4FHJA 3NS1A 1DGJA 4LNOA 3E56A 3ML9A 3Q3JA 3TEWA 2WXGA 3PPAA 4EZJA 3H1UA 3H7PA 3PSEB 4FBJB 5J2RA 2WXIA 5FR6A 1XLNA 4RH6A 1GUAB 2IY0B 1RFAA 2I1KA 5IOIA 3IVFA 2QMTA 4DXAB 2VZKB 1XCQL 3M95A 1UWMA 5D6JB 3LDZE 5JZEB 2ZNVB 3VVWB 1OFFA 2EMTA 4IWPA 3MHZA 1D5XC 1EO6A 4RM9A 3AM9A 2N9PC 5CHVC 4ZRPA 3R7QA 5GMVA 3PZDA 2ZZPB 3ENEA 5JH5C 2LVOA 2G45B 3NVZA 3K9OB 2BS2B 5IO9A 1QILA 1XLOA 3AEEB 1E7UA 1R4MI 1D3ZA 3X23A 2K22A 1C77A 1L6VA 1WE7A 2E3TA 3N1XC 1IP9A 3PO0A 3V60A 3S2AA 4LDTB 2KQSA 1UNSA 2WHIA 2BGFA 1UBQA 2AL3A 2FNJB 3AU4A 3A4SC 3D32A 1HEZE 3Q2AC 2VRRB 3ZGZA 5DPTA 3A9KB 2L7RA 4AJWA 1V81A 5LLIA 3TEZA 4DHJB 4ASWC 3NY5A 1A70A 1V6EA 4WIPA 3RMKC 1ESFA 2GOWA 1WIAA 1WGKA 5D3IB 4KGRA 4GXBA 3Q3OC 2LUMA 1AYFA 2EKIA 5C2TB 4LNNA 4MSMB 2C7MB 2D10A 1WM2A 4IOIE 1C79A 4XGAB 2W82A 2LUEA 2JT4B 2JYEA 3P4RB 3AEGB 2LGIA 4IWOA 1Y8RC 1IPGA 4W9JA 2VH1A 3NJTA 1RFKA 3TJPA 3PRMB 1P98A 4BBNF 2LRUA 3I9V1 3SDLC 1SBBB 2M19A 2NMQA 5J17A 4JPSA 2KWCA 4USAA 3Q8FA 3KLSX 2ZCBA 1SGHA 1WE6A 2Q5WD 3TUOA 4OHJA 1AARA 2D5GA 2KDBA 4WURA 1GPXA 1UGMA 2WYQA 4NJ7A 2KNBA 1TY0A 3MC8A 1YIWA 4JX1C 1E8ZA 1WXSA 2KXJA 3RNGC 2YEPB 2KAJA 3U4EG 3NVWA 4DK5A 1L5PA 1WJ4A 4KDIC 1WGHA 4URKA 1HTOA 1V9JA 4KZCA 4KX6B 3AB5A 4FULA 3BWUD 1L0YB 4HDOA 5G2NA 1KTKA 2J53A 2KDIA 3A33B 1B9RA 4JQWC 1YJIA 3KW5B 3L10B 4ZOHC 2A4ZA 1WYWB 2WXKA 2IGHA 1GAQB 4MH8A 3ZNHB 2JQRB 1YJ1A 1EWYC 4YL8A 4KVGB 4AJYB 1NVID 5JHAA 5HKHA 1WI0A 2I2YA 2WU2B 2V3NA 2D3BA 4G50A 2V1YA 2V9HA 3PT2B 4TKNA 4ZRQA 3L4PA 1TKGA 5EE9A 4YSXB 3ZTDA 1TIFA 1YN5A 2INPE 2LGXA 1T6BX 5HFYA 2I1JA 3SR6A 1V86A 5BYSA 2B76B 4B0EA 4KDLB 3CWIA 5BYQA 1I4PA 1XO3A 4AS1A 2AX5A 1RRBA 3EFCA 1ROEA 2PVOD 3HVDA 1P0RA 1L0VB 3MC9A 5T8IA 2MLBA 1SIJA 1ET6A 2RPQA 4MACA 3MJ5A 5E6OA 5MPOA 3T3NA 1C4PA 3H7SA 3P4QB 3DBRI 3RN9C 2JWUA 3OAWA 3T8MA 1F2RC 2QHOA 4NPNA 3R66C 1KLUD 1FEHA 4ANXA 3AEDB 2BTEA 4IC7B 4W9DA 2NBVB 3PHXB 1N5WA 1TTNA 1V5OA 2LVPA 1WX7A 2FBWB 2KLGA 2WX1A 3MTNB 1E10A 3AE1B 3U2SC 3QK0A 5E6PA 2C5LC 1WJUA 2DYMA 3VAWA 4DDGD 3RD2A 4C7YA 2IYDB 4K3CA 2KYWA 3PZ8A 5E6JA 3IBEA 1QQRA 4YTPB 3ZXVA 1V2YA 2IO0B 3M62B 2PE6B 3ML8A 4MEMA 3MJWA 1E8XA 1TZ1A 3U30A 5BMIA 2CJOA 3H7PB 3BVMA 3VRAB 1KFYB 2K8CA 2SAKA 1ZKHA 2D3AA 1DOXA 2CR5A 4KSLC 3NHEB 3WANA 1NBFC 1N63A 3H8HA 1Q5WB 4RM8A 3ABVB 3UINB 3AH7A 3UIPB 1OQRA 2WDRB 3FILA 1QZEA 2WGSA 4NJCA 4EOYA 2KOXA 3TEYA 3ZNZB 1U4AA 4XC2A 4NY0A 4ANWA 4CO7A 4ZDVA 2QIEB 3SEBA 1KH0A 2BB5A 4W9GA 2G3QB 4AP4C 2DLBA 4E71A 4HRSA 4EE2A 2L00B 4IWQA 3BVZA 2HDEA 4GB9A 1WGYA 3R7RA 4RFBA 3KQ4A 2REXA 1YN3A 3DOWA 1FNUA 1OEYJ 2J0JA 2MJ3A 4GSWA 3RCZA 3VTWA 1VJKA 4BBNC 2MJEA 1LQBA 2DZIA 2Y3AA 1LO5D 5DCNA 2KDMA 3B08A 5DPWA 2RDBC 1NYRA 4EEWA 3OWEB 3JSVA 2WDVB 3I63C 3E9SA 1JWBD 1SEBD 1ACCA 2M4NA 3RNCC 1IGDA 1JRUA 4WWPA 3V6EB 1OQYA 4WJPA 3Q8EA 4ZHPA 4DBGA 2KWUB 3ZJTA 2LHDA 2KK8A 1N5XA 2KDFB 4IW0A 2WNMA 2JUOA 4FADA 3BYTB 4ITKA 4LNFA 1T5XD 2JXXA 4XDDA 1MJDA 3I3TB 1C78A 1Z5SB 2LEKA 3I5JC 4WAFA 2QSDA 5AZHA 2N1WA 1HZ5A 2WS3B 1TYGB 3ZTCA 1QOAA 3DDCB 4YXDB 2Z0EB 4REZA 1P7FA 2K6QA 4MM3A 4GDLA 4K81A 2KZRA 2AYOB 4K1RB 1P1AA 2AQ2B 2FCQA 4II3B 1OEYA 3RUIB 2FE8A 1SXTA 4E3CA 1CZPA 4WH4A 5BO4B 1SJHD 3AN1A 3ZLZA 2BWES 1H8CA 2NTTA 2IO2B 3PS6A 1PUTA 1FRRA 2LFIA 4PYZA 2MW5A 1GNUA 4JWUC 2FIDA 3A9JA 3APCA 2MBBB 2IZVB 2SEBD 4FN2A 3URYA 1ZDXA 3DHIC 1VDVA 1UD7A 1OGWA 4NAWA 1WGRA 3TSSA 1K8RB 4N9F4 1J7BA 2NR2A 3QX1A
chains in the Genus database with same CATH topology
1GB1A 2LUMA 1AYFA 2EKIA 3HUIA 4HEA1 1I4HA 3MC0B 5C2TB 1TS2A 1FNWA 1QF6A 1HQRD 1XXGA 3SFEB 1GB4A 1ENFA 2L32A 4IOIE 1C79A 3AE2B 2W82A 1D5MC 1P7EA 2KWDA 4FXCA 1RM6C 2JYEA 3R2TA 3P4RB 3AEGB 2LGIA 3IT6B 1ZDVA 1PYWD 1MVKA 1UGJA 1JWAD 1IUEA 3ZYYX 4TSSA 1XF5L 2J4XA 3AEAB 2PTLA 1I4QA 1RFKA 4XDCA 1WRIA 4L1BA 1QKZA 4YTMB 3I9V1 4CQNA 3NVVA 1SBBB 4NAMA 2M19A 2NMQA 3EGRA 2RPVA 4JPSA 1CJEA 4USAA 3MP9A 3Q8FA 2V0GA 3C8YA 1EWCA 4KGSA 3KLSX 1VLBA 1WXQA 2OHFA 2Q5WD 3TUOA 3PZ7A 4OHJA 1TS5A 4P6VF 2D5GA 3NZ3A 1SB3C 4WURA 1NEKB 4YSYB 2H89B 2X38A 4RGTA 1GPXA 1FCCC 1I4RA 5D7GA 4AQ7A 3B2FA 3IXSA 1IBXB 2K9XA 1CK1A 1ZUD2 1KLGD 1TY0A 1OQQA 2BYTA 4JX1C 1TS3A 1DOYA 1ZPSA 3DWGC 1DOIA 2YEPB 3RPFC 2KAJA 1R7SA 3U4EG 1C4CA 2L52A 3VQIA 4US9A 1TY2A 1NENB 3NVWA 1L5PA 1MI0A 5HHDG 1ZE3D 1GOZA 2KQ4X 3IAS1 5C3JB 2QJLA 3BIID 4KX6B 4KKJA 5EE1A 4A8XC 3AB5A 3BWUD 1L0YB 4YSZB 1KTKA 4C7ZA 1MHXA 4RF0A 2J53A 2OEDA 4LLGM 2PMVA 5G5GA 1B9RA 1YJIA 5G5HA 4ZOHC 3HVZA 4N58A 3W5VB 2WXKA 2IGHA 1GAQB 4MH8A 3SFDB 2JQRB 3UI3A 1PGAA 3W1SA 3BK2A 2MH7A 1EWYC 1SE4A 2WU5B 3MFGA 2Y5CA 3Q69A 3GS2A 1FXIA 1NVID 3W2DA 2WXMA 3AE5B 2PIAA 5FK9C 3W9CB 2I2YA 2XNAC 1UWXA 2QEJC 4L23A 1VR9A 2WU2B 1L6UA 2V3NA 4ZRQA 5EE9A 3L4PA 1TKGA 1EM7A 3RFZB 4YSXB 2K5PA 1E0ZA 4NZLB 1ZOYB 1YJJA 4C80A 1T3QA 2DYOA 4XWWA 3VR9B 2ACZB 4OZCA 1YN5A 2JSVX 3P4SB 5HG2A 1SF0A 2INPE 3FAHA 4A6QA 1T6BX 1SE3A 2R61A 5HFYA 3SR6A 1RYJA 1N61A 5BYRA 5BYSA 4P16A 1K50A 2B76B 3VR8B 3FILB 2RDHA 4B0EA 3Q8BA 4DQOC 1KF6B 3CWIA 4J3OD 4LTUA 4L2YA 2BT6A 5BYQA 4US8A 1I4PA 1XO3A 2WXJA 2WQYB 4AS1A 4D2KA 2AX5A 1VZ7A 1C9FA 2FUG1 3EA6A 2ZW1A 3KWLA 4ZYSA 2WXPA 1SSNA 3AE3B 4YWGG 5JXVA 1ROEA 2PVOD 4GDKB 2WXFA 3HVDA 4A90A 3IT4B 1L0VB 3CIRB 2VZKD 5T8IA 4C56C 1SIJA 1ET6A 1M4VA 2BB6A 2N9KA 2ON8A 2TSSA 3AE6B 2BS4B 1BXTA 2IJ0A 1QT9A 3AE4B 3P1MA 3VRBB 1NYQA 4MACA 4A55A 3MJ5A 1CQVA 2JXTA 5MPOA 3T3NA 1C4PA 1AWDA 3P4QB 2GRIA 2HTME 1IBXA 1K52A 1JALA 3O13A 2JWUA 2RMMA 1FRDA 1F2RC 3ETRA 4Q2JA 2JZPA 5AUIA 1KLUD 1FEHA 1WSPA 3ZQ4A 2M0AA 3AEDB 2BTEA 2WXHA 2INNE 4WQMA 4HKZE 1FM0D 1EU4A 1N5WA 2FBWB 3W5UB 1F77A 4LK0M 1K51A 2IPKD 2V4IB 1E10A 3AE1B 1JWSD 4DXGA 3U2SC 2LJIA 2V3PA 2PVGC 5EE3A 1E6EB 2DYMA 1KRHA 4M0WA 4C7YA 2MJDA 3AE7B 3PZ8A 5E6JA 1QQRA 4YTPB 3BZDB 1F2RI 1JWUD 2CJNA 1ZXHA 3FC4A 2JU6X 1Y56A 2CU3A 4XE0A 1K53A 4HKQA 2AQ3B 3R2IA 4JE3B 4RCOA 4TMAB 1QOBA 3P42A 1JMLA 1F0ZA 3AEBB 2I38A 5H8YE 1J7CA 4RGOS 2MEKA 4RNAA 3Q8AA 2LHEA 4O1NA 4RGNA 4ZHOA 2L83A 5BMIA 2CJOA 5I4DA 1TJEA 4ARIA 2K3UA 1XCTL 3BVMA 3VRAB 2LMCA 1KFYB 1JROA 3P63A 4N59A 2Y5PA 2SAKA 2ICIA 2N9LA 1L4ZB 3AEFB 1DOXA 2W3SA 3NRZA 3U52E 1N60A 1YQ3B 1JQ4A 1PGXA 1D5ZC 2BBCA 2WDQB 1HXYD 1XLPA 5D3DA 1N63A 3H8HA 2RDGA 3LYYA 3J9CA 4KGTA 1FCLA 3ABVB 3AECB 1JCKB 3GP7A 1HZ6A 1JRPA 4RGMA 4OZAA 1N62A 1FMAD 3AH7A 1OQRA 2WDRB 3FILA 4NJCA 2XN9C 4N6EB 3TEYA 2N7JA 2IGDA 2WXQA 2ZW0A 3B9JA 1TZOA 3R8BA 5AUKA 2PKOA 3Q8CA 4H2AA 4IKGA 1V1PB 2QIEB 3AMZA 5LNK1 3SEBA 1KH0A 2BB5A 1FO4A 1NI3A 1I4XA 2DLBA 1TS4A 4MM3B 2L1AA 2ONQA 1RWSA 5H92C 4GDLB 4XWTA 1V1OA 4HRSA 1ET9A 2JYTA 4EE2A 1L4DB 4HROA 3BVZA 2HDEA 1I7HA 5BMHA 2W3RA 2WXLA 2BS3B 2WXRA 5FR3A 2PLPA 1E9MA 1V97A 3P4PB 4MT5A 1UUPA 1L0XB 4RFBA 5EE0A 3KQ4A 1YN3A 4GLSC 3ZJUA 1FNUA 2MJ3A 1JW9D 1B1ZA 2J42A 1HA5A 4OVZA 1VJKA 3KWVA 5FKAC 3BYYB 4KKIA 2MJEA 4B0MA 2KMMA 2M56B 3I57A 4TQ0A 1PDXA 3V05A 3LXFA 4A9AA 2DWQA 2Y3AA 1LO5D 3V3XA 1D6EC 2KDMA 2BW2A 2WXOA 5TSSA 2IGGA 4PT5A 2EELA 1NYRA 1WYGA 3OWEB 2WDVB 3N9YC 1C76A 2JX5A 3E9SA 3IAM1 1JWBD 4HJGE 4R3DA 2AQ1B 1SEBD 1VZ6A 1ACCA 1AW7A 1TKYA 2N0SB 3AE8B 1IGDA 4NAWB 2GI9A 2NTSA 3AV8A 1FIQA 4OW0A 4ARCA 3HRDD 3Q8EA 1XLQA 4ZHPA 1J7AA 3ZJTA 5BMGA 2H88B 2LHDA 1QLBB 1BUIC 1E7PB 3WCQA 1D4BA 3NS1A 1N5XA 1DGJA 3E56A 2WNMA 1TKEA 3TEWA 2WXGA 2K0PA 3NUHB 3BYTB 4ITKA 4RF1A 1JWMD 1QOGA 1T5XD 2WXIA 1XLNA 3B2GA 4RH6A 4XDDA 1MHHE 5HI1A 1MPEA 2QMTA 2VZKB 2WLBA 1XCQL 1C78A 3EUB2 1UWMA 2LEKA 2PW9A 1C4AA 4DXFA 4WAFA 2QSDA 3U7ZA 1OFFA 1EU3A 1I4GA 1PGBA 1HZ5A 2WS3B 1AN8A 1TYGB 3BK1A 1Q10A 4JWSC 4IDIA 3MHZA 1D5XC 1QOAA 3LB8C 1VRAB 3AM9A 4YXDB 4ZRPA 4REZA 1P7FA 1V1PA 1WWTA 2KN4A 2W54A 1FFUA 1ZP0B 2YEPF 1SE2A 3NVZA 2BS2B 2IDYA 1QILA 1FD6A 1XLOA 3AE9B 3BVGA 3AEEB 2AQ2B 2J52A 1FFVA 4UDUC 2FE8A 1SXTA 1VZ8A 2K22A 4TQ1A 2WP9B 1C77A 1CZPA 2QILA 4OZBA 1L6VA 4WH4A 1BMLC 2E3TA 2DBYA 1ZXIA 2E6XA 1SJHD 3PO0A 4WWMA 3AN1A 1PFDA 1YNTE 2NTTA 2KACA 3DWMA 1UNSA 1YN4A 1PUTA 2G1EA 1FRRA 2LFIA 2WXNA 5GXGB 3TEXA 1YQ4B 1HEZE 3GB1A 4JWUC 3ZGZA 4YTNB 3TEZA 3ZJVA 1IGCA 3NVYA 2G9HD 1FXAA 2SEBD 1DYQA 1FNVA 3URYA 1A70A 1QOFA 1ZDXA 2W55A 2Z8LA 1VDVA 4WIPA 1XEEA 1YMHE 3T3OA 3TSSA 1ESFA 1STEA 1WGKA 5D3IB 1J7BA 1V8CA 4YT0B 2GB1A 4KGRA 1SJED
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CU3 A;  1XLQ A;  4ZHP A;  1J7A A;  3AE5 B;  2PIA A;  2H88 B;  3W9C B;  1AYF A;  1QLB B;  2EKI A;  3HUI A;  1QOB A;  5C2T B;  1F0Z A;  1E7P B;  3AEB B;  2WU2 B;  3WCQ A;  1L6U A;  5H8Y E;  1J7C A;  3NS1 A;  1N5X A;  1DGJ A;  3SFE B;  1QF6 A;  4ZHO A;  5EE9 A;  2L83 A;  1TKG A;  1TKE A;  3L4P A;  2CJO A;  4YSX B;  1TJE A;  2K5P A;  1E0Z A;  1ZOY B;  1YJJ A;  3AE2 B;  3VRA B;  4C80 A;  1T3Q A;  1KFY B;  1JRO A;  3P63 A;  4N59 A;  4FXC A;  3VR9 B;  3AEF B;  1RM6 C;  2ACZ B;  3P4R B;  3AEG B;  2W3S A;  3NRZ A;  4ITK A;  1DOX A;  3P4S B;  1QOG A;  1N60 A;  1SF0 A;  1YQ3 B;  1JQ4 A;  3FAH A;  1JWA D;  1XLN A;  3B2G A;  2WDQ B;  3SR6 A;  1IUE A;  3ZYY X;  1RYJ A;  1XLP A;  1N61 A;  1N63 A;  3AEA B;  2B76 B;  3VR8 B;  3ABV B;  1RFK A;  2WLB A;  3AEC B;  1JRP A;  3EUB 2;  1UWM A;  1N62 A;  1FMA D;  2LEK A;  3AH7 A;  1OQR A;  2WDR B;  4N6E B;  1WRI A;  1KF6 B;  3CWI A;  4LTU A;  4YTM B;  4US8 A;  2BT6 A;  1OFF A;  1XO3 A;  3B9J A;  2WQY B;  3NVV A;  2WS3 B;  1TYG B;  2PKO A;  5AUK A;  2AX5 A;  2M19 A;  3AMZ A;  2QIE B;  4JWS C;  4IDI A;  1CJE A;  1QOA A;  3LB8 C;  4USA A;  1FO4 A;  3KWL A;  3AM9 A;  1NI3 A;  3AE3 B;  4YXD B;  1WWT A;  1ROE A;  1VLB A;  1WXQ A;  1RWS A;  2PVO D;  5H92 C;  4HRS A;  2W54 A;  2OHF A;  1FFU A;  1ZP0 B;  2Q5W D;  3NVZ A;  1L0V B;  3CIR B;  4HRO A;  4P6V F;  2BS2 B;  1SIJ A;  1I7H A;  1SB3 C;  1XLO A;  3AE9 B;  2W3R A;  1NEK B;  4YSY B;  2BS3 B;  2H89 B;  3AE6 B;  3AEE B;  2BS4 B;  1GPX A;  3AE4 B;  3P1M A;  1QT9 A;  3VRB B;  1NYQ A;  1E9M A;  1V97 A;  3P4P B;  3B2F A;  1FFV A;  5MPO A;  2K9X A;  1AWD A;  1ZUD 2;  5EE0 A;  3P4Q B;  2HTM E;  1OQQ A;  2K22 A;  4JX1 C;  2WP9 B;  1JAL A;  2MJ3 A;  1JW9 D;  1DOY A;  1CZP A;  1L6V A;  1FRD A;  3DWG C;  2E3T A;  1DOI A;  2DBY A;  1ZXI A;  3ETR A;  2KAJ A;  3RPF C;  1R7S A;  2L52 A;  4US9 A;  1VJK A;  5AUI A;  1NEN B;  3PO0 A;  4WWM A;  3NVW A;  3AN1 A;  1L5P A;  2MJE A;  1PFD A;  2KMM A;  2M56 B;  3AED B;  1PDX A;  3LXF A;  4A9A A;  2DWQ A;  4WQM A;  5C3J B;  3DWM A;  1FM0 D;  2G1E A;  1PUT A;  2QJL A;  1FRR A;  3BII D;  4KX6 B;  5EE1 A;  5GXG B;  1YQ4 B;  3AB5 A;  1N5W A;  2FBW B;  4YSZ B;  3W5U B;  4JWU C;  1NYR A;  1WYG A;  4C7Z A;  4YTN B;  1E10 A;  3AE1 B;  2WDV B;  5G5G A;  1B9R A;  2JX5 A;  1YJI A;  5G5H A;  4ZOH C;  3NVY A;  1JWB D;  3HVZ A;  1FXA A;  2PVG C;  4N58 A;  5EE3 A;  3W5V B;  1E6E B;  1GAQ B;  1A70 A;  1KRH A;  1TKY A;  2JQR B;  2N0S B;  1QOF A;  3AE8 B;  3SFD B;  2MH7 A;  2W55 A;  2MJD A;  1EWY C;  1VDV A;  3AE7 B;  3AV8 A;  4C7Y A;  2WU5 B;  4YTP B;  2Y5C A;  1FIQ A;  1WGK A;  2CJN A;  1J7B A;  1FXI A;  1NVI D;  1V8C A;  4YT0 B;  3FC4 A;  3HRD D; 
#chains in the Genus database with same CATH topology
 1GB1 A;  2CHW A;  3MC0 B;  2KO3 A;  3KH0 A;  1GB4 A;  3FKY A;  3ZDT A;  4DHZ E;  2L32 A;  3H9D A;  1WX9 A;  4LNI A;  4FXC A;  1RM6 C;  3IT6 B;  1ZDV A;  3NG0 A;  1UGJ A;  2LXC A;  4HPM B;  4M8N A;  1IUE A;  4TSS A;  2MBH A;  2J4X A;  3AEA B;  4K7W A;  2PTL A;  1I4Q A;  3NOB A;  4MJS A;  2GBJ A;  4L1B A;  4YTM B;  4CQN A;  4NAM A;  2RPV A;  1CJE A;  3MP9 A;  3C8Y A;  4HVB A;  1WXQ A;  2KFK A;  1C1Y B;  2W9N A;  3PZ7 A;  4MEL A;  4PK1 A;  4FJZ A;  2LJ5 A;  1NEK B;  2H89 B;  2X38 A;  3A1Q A;  3L13 A;  1YX6 B;  2XBB C;  2K9X A;  3DPD A;  2CS4 A;  2ZJD A;  2BYT A;  4OVV A;  3RZF A;  2JRI B;  1DOY A;  1RLF A;  2MHJ A;  1UF0 A;  1WXM A;  1NEN B;  1FXT B;  4W9L A;  1GOZ A;  2ZPN A;  3IAS 1;  2QJL A;  4E74 A;  4KKJ A;  1WZ0 A;  4GIV A;  4C4V A;  4RF0 A;  3RZW C;  3V6C B;  3M63 B;  3QAQ A;  2OED A;  4LLG M;  2IND C;  1ZW7 A;  2HD5 B;  2JPH A;  2MP2 A;  3UI3 A;  3W1S A;  3BK2 A;  2MH7 A;  2K39 A;  3Q69 A;  1FXI A;  2WXM A;  2GMI C;  5TR5 A;  2PIA A;  4IM3 A;  4MGK E;  3W9C B;  1UWX A;  3MHS D;  2ZEQ A;  3W1S C;  3UIO B;  2LVQ A;  1ZOY B;  2PPH A;  1T3Q A;  3DQV A;  1PQS A;  2DYO A;  2ACZ B;  4OZC A;  4BKS D;  3FAH A;  1SE3 A;  1E8Y A;  1N61 A;  3EHV A;  3VR8 B;  3FIL B;  3Q8B A;  2EMS A;  1WRD B;  3RT3 B;  1KF6 B;  4LJO B;  4J6I A;  3Q3M C;  4L2Y A;  5CHW A;  1T0Q C;  2WQY B;  3AUL A;  1J19 A;  1VZ7 A;  5C1Z A;  1C9F A;  5J18 A;  4MGZ E;  2KD0 A;  2ZW1 A;  3AI5 A;  4ZYS A;  4YWG G;  2D11 A;  2LXA A;  1TBE A;  3AE6 B;  2BVC A;  2KTR A;  1BXT A;  2IJ0 A;  1NYQ A;  4W9I A;  2PE9 A;  2JXT A;  4I6P A;  3PLU A;  2GRI A;  2HTM E;  3L16 A;  2RMM A;  2JY6 A;  4Q2J A;  1V80 A;  1CMX B;  2M0A A;  4ICU A;  4WQM A;  1FM0 D;  1EU4 A;  1NDD A;  4WWO A;  3ZVV A;  1RAX A;  3V62 A;  3JSV B;  4HDQ A;  4W9H A;  1F77 A;  1J0G A;  2LJI A;  3CSF A;  4W9E A;  1WY8 A;  2L05 A;  3ZIM A;  2MJD A;  3AE7 B;  1XQQ A;  1F2R I;  3A4R A;  1Q1O A;  3ZXR A;  4XYC A;  1K53 A;  2AQ3 B;  4JE3 B;  2DZM A;  4RCO A;  4IUM B;  4FHK A;  2XEW A;  2MEK A;  3VDZ A;  4RNA A;  3Q8A A;  2LHE A;  3QHT A;  4ZHO A;  3GOE A;  1TJE A;  2K3U A;  1XCT L;  2DNF A;  3C19 A;  1T0Y A;  3QA8 A;  1N60 A;  1JQ4 A;  1PGX A;  1D5Z C;  2KT7 A;  3J9C A;  2K8H A;  2MX2 A;  1EF1 A;  1JRP A;  2PEA A;  2UYZ B;  5CHF A;  2XN9 C;  4N6E B;  2MRP A;  4K3B A;  3RNE C;  1TZO A;  5AUK A;  3Q8C A;  1WJN A;  2GLS A;  2LAS A;  1FO4 A;  4TV3 A;  1I4X A;  4MM3 B;  2L1A A;  2ONQ A;  5H92 C;  4GDL B;  4XWT A;  1L4D B;  2LD9 A;  3VXW A;  2GBN A;  5FR3 A;  2PLP A;  4KV2 A;  1E9M A;  4MT5 A;  4MDK E;  2KJ6 A;  2D2Q A;  2FIF A;  1JW9 D;  2J42 A;  1BT0 A;  2OJW A;  1P3Q U;  5FKA C;  3BYY B;  2L3Z A;  3V05 A;  2KC2 A;  2RSU A;  5DPS A;  1D6E C;  2O6V D;  2BW2 A;  3A9J B;  2IGG A;  4IG7 B;  1WYG A;  2R2O A;  3N9Y C;  1C76 A;  3HM6 X;  5AZF A;  5CX3 A;  4HJG E;  1VZ6 A;  4ZRJ A;  3AE8 B;  4GMV A;  4II2 B;  4NAW B;  1V5T A;  2C7N B;  4OW0 A;  4ARC A;  4FJY A;  2N4F A;  4WJQ A;  1FPY A;  4P1C C;  1E7P B;  4AWJ A;  3PHW B;  1TKE A;  1HE8 A;  4WJN A;  3L08 A;  1KLV A;  2K0P A;  2FCM A;  1X1M A;  5IP4 D;  3N1Y C;  1JWM D;  1QOG A;  3GE8 C;  3B2G A;  3VH4 B;  2KVR A;  1WM3 A;  5HI1 A;  4MJS B;  2KAN A;  3OJ3 A;  3M3J A;  3QWZ B;  3EUB 2;  1Z2M A;  2K8B A;  2ZVO A;  4DXF A;  4A3O A;  2K6D B;  4FJV B;  1PGB A;  3ZUN A;  1AN8 A;  2YVC A;  3BK1 A;  1Q10 A;  1VRA B;  2KFK B;  2KKC A;  1WWT A;  3CF6 E;  3QCA A;  2MWS B;  4NQK E;  2W54 A;  1ZP0 B;  1SE2 A;  3VTU A;  2D07 B;  3A1Q B;  4ZRK A;  3AE9 B;  3BVG A;  2BYE A;  1FFV A;  3EC8 A;  4M0W B;  3BIN A;  4UDU C;  2OOB B;  2WP9 B;  3RNA C;  4OZB A;  3ECI A;  4EKU A;  4WWM A;  1PFD A;  4HXD A;  1YNT E;  1E8W A;  3K9P B;  2KLC A;  4W9K A;  3VUX A;  3L0W B;  3TMP B;  4C4V B;  5GXG B;  3AU5 A;  3TEX A;  2JZZ A;  3AXC A;  3DHG C;  2LI5 A;  4YTN B;  2NCN A;  3ZJV A;  2MP2 B;  2G9H D;  1FXA A;  1DYQ A;  1FNV A;  1LFD A;  2Z8L A;  1XEE A;  1STE A;  1E5W A;  1V8C A;  4YT0 B;  1MG4 A;  2GB1 A;  3W1Y A;  4A3P A;  3KUZ A;  4BKS A;  5L95 C;  3HUI A;  2QCZ A;  1FNW A;  1XXG A;  3SFE B;  1ENF A;  2MBO A;  2CHZ A;  3AE2 B;  1WZ3 A;  2KX0 A;  2AEH A;  3R2T A;  2IO1 B;  3DBS A;  2BKF A;  2KTF A;  3PV1 A;  3VTV A;  4HCN B;  4DHZ B;  5EDS A;  2DZJ A;  3NVV A;  2FUH B;  4M02 A;  3EGR A;  3HK0 A;  3VHT C;  4F7Z A;  2V0G A;  1LM8 B;  2LZ6 A;  2M8S A;  3PLV A;  4XZ4 A;  2IO3 B;  1TS5 A;  2BWF A;  2KTR B;  3NZ3 A;  3KYD D;  3NZU A;  3QAR A;  1P9D U;  1M94 A;  4RGT A;  1I4R A;  4AQ7 A;  2XK5 A;  3B2F A;  3R3M A;  1E7V A;  4B6W A;  1ZUD 2;  1KLG D;  2INC C;  1OQQ A;  2ZVN A;  1TS3 A;  3VFK A;  3DWG C;  3P2B A;  3RPF C;  3EFU A;  2LGY A;  1C4C A;  2L52 A;  2BF8 B;  1TY2 A;  1L2N A;  2HE7 A;  1MI0 A;  5HHD G;  1ZE3 D;  4AUQ C;  2KQ4 X;  3ZKJ C;  5C3J B;  1C3T A;  3Q3N C;  1YOV B;  3BII D;  5EE1 A;  4A8X C;  4FA6 A;  2JRH A;  1MHX A;  3ZRC A;  5G5G A;  1WGD A;  2PMV A;  4KIK A;  4N58 A;  3W5V B;  3JW0 X;  3ZO5 B;  3N32 A;  3SFD B;  3DVG Y;  1PGA A;  3WAM A;  1SE4 A;  1G6J A;  5AEK B;  2Y5C A;  4BOZ B;  1V49 A;  1XT9 B;  4K7S A;  1T0S C;  2BPS A;  3AE5 B;  2XNA C;  2QEJ C;  1EM7 A;  1WFY A;  1E0Z A;  3PTF C;  1GJZ A;  3VUW A;  1YX5 B;  2KJR A;  4XWW A;  1VD2 A;  3UGB B;  3VR9 B;  4IM0 A;  2JSV X;  2DX5 B;  1WH3 A;  2R61 A;  5BYR A;  3N3K B;  4P16 A;  1K50 A;  3UF8 A;  2N1V A;  2RDH A;  4DQO C;  1WJ6 A;  2N9X A;  4M01 A;  4GGQ A;  4J3O D;  4LTU A;  4US8 A;  2BT6 A;  2M1M A;  1KOT A;  4D2K A;  3WA0 A;  4HCP B;  3KWL A;  5JXV A;  4A90 A;  3IT4 B;  2KN5 A;  3TL5 A;  3CIR B;  2VZK D;  2BB6 A;  2N9K A;  3CMM B;  2ON8 A;  1R4N B;  2TSS A;  3PRP B;  2BS4 B;  3P1M A;  1QT9 A;  3VRB B;  4C00 A;  4A55 A;  1L7Y A;  1CQV A;  2NS5 A;  2NVU I;  1K52 A;  1IBX A;  3O13 A;  3ETR A;  5CTR C;  3ZQ4 A;  1TT5 B;  2INN E;  4FLH A;  4HKZ E;  3VUY A;  4HK2 A;  2AL6 A;  4A20 A;  3QQ8 B;  4LK0 M;  2IPK D;  4DXG A;  5EE3 A;  4BKT A;  1E6E B;  4M0W A;  2RGF A;  3DVN U;  1E90 A;  4LDT D;  3BZD B;  1S1Q B;  2CJN A;  1ZXH A;  3U7D A;  2JU6 X;  2CU3 A;  4XE0 A;  4HKQ A;  3R2I A;  4TMA B;  1QOB A;  5H8Y E;  1J7C A;  4RGO S;  3Q14 C;  1WXV A;  4RGN A;  2L83 A;  4DHJ D;  3WAL A;  4ARI A;  2A5U A;  2NPT A;  1JRO A;  2WDT B;  2Y5P A;  2ICI A;  1L4Z B;  3AEF B;  2W3S A;  3U52 E;  3O65 B;  2YLM A;  4GN1 A;  4W9C A;  1YQ3 B;  2KMA A;  2DEN B;  2BBC A;  2WDQ B;  1HXY D;  5D3D A;  1TGZ B;  4KGT A;  3GP7 A;  1JCK B;  1HZ6 A;  2NBU A;  3DHH C;  2KDE B;  1T0R C;  1N62 A;  2M0X A;  2IGD A;  2WXQ A;  3HM3 A;  2OJR A;  3R8B A;  1I35 A;  2PKO A;  4IKG A;  5LNK 1;  1UH6 A;  1YQB A;  3RYT A;  2LGS A;  1V1O A;  4NNJ B;  4GDK A;  5IAA C;  2B3A A;  2BS3 B;  2LGD A;  2WXR A;  3SD5 A;  3P4P B;  2C7H A;  5D2M B;  2CU1 A;  1UUP A;  2ASQ A;  5EE0 A;  1ISN A;  3IHP C;  3SHQ A;  2FCN A;  4OVZ A;  1Q0W B;  4IM2 A;  3KWV A;  3TIX A;  4KKI A;  2KMM A;  1PDX A;  3LXF A;  4NQL B;  4A9A A;  5JHB A;  3V3X A;  2AWT A;  5TSS A;  2WXO A;  1WR6 E;  2EEL A;  1J8C A;  3JYU A;  3DBR B;  1EUV B;  3L17 A;  2AQ1 B;  1WMH A;  4JL9 A;  3OLM D;  2BQQ A;  2IBI B;  4MGY E;  5LXI B;  4WJO A;  4AOF A;  3DBL B;  3HRD D;  3B0A A;  4HWI B;  2H88 B;  1QLB B;  2N7E A;  1BUI C;  1R4N I;  3WCQ A;  1D4B A;  5IKC M;  5LXH A;  3NUH B;  4XX5 A;  4RF1 A;  3CST A;  1MHH E;  2KHW B;  1MPE A;  2V3S A;  4QAY A;  4KZ0 A;  4ZYN A;  2WLB A;  4NJ6 A;  2PW9 A;  1C4A A;  1OTR B;  3U7Z A;  2FAZ A;  1EU3 A;  1I4G A;  2RD0 A;  4G11 A;  2HTH A;  2GBR A;  2JZ3 B;  4JWS C;  4IDI A;  3LB8 C;  2O2V A;  3OG5 A;  3RNB C;  1V1P A;  3BY4 B;  1KM7 A;  2KN4 A;  3NS8 A;  4BVU C;  2JF5 A;  1FFU A;  2YEP F;  2IDY A;  1FD6 A;  1MFW A;  3LJ3 A;  2XK5 B;  4P7I A;  4DDI D;  1SE9 A;  3KUC B;  4MH0 E;  4EZL A;  2J52 A;  3WIM A;  2LRW A;  2KMC A;  4M8M A;  1VZ8 A;  4TQ1 A;  2UWQ A;  2QIL A;  4F8C B;  1UEL A;  2J0M A;  1BML C;  4S0R A;  2DBY A;  3V61 A;  1ZXI A;  2Z59 B;  2WWZ A;  2E6X A;  3JVZ X;  2KAC A;  1YD8 U;  2DAF A;  3DWM A;  5IN7 A;  1YN4 A;  2G1E A;  2WXN A;  3H6N A;  1YQ4 B;  4HPP A;  3GB1 A;  3KUD B;  3WAP A;  4KIK B;  2MSE D;  4S17 A;  1N6Z A;  2MA9 B;  3QJZ A;  4DWF A;  1IGC A;  2HJ8 A;  3NVY A;  2KC1 A;  4ANV A;  1QOF A;  3PRZ A;  2W55 A;  1YMH E;  3T3O A;  4GU2 A;  3HHM A;  5L83 A;  1SJE D;  2GBM A;  4JGH B;  4MGI E;  4HEA 1;  1I4H A;  1TS2 A;  4HLE A;  1QF6 A;  1HQR D;  4PS3 A;  4CHK A;  3APF A;  1WXA A;  1D5M C;  1P7E A;  2KWD A;  4F1S A;  1PYW D;  1MVK A;  3ZNG C;  2CKH B;  2N9E B;  1JWA D;  1EF5 A;  2MBE A;  3UQA A;  3ZYY X;  1F9J A;  2Y5B B;  3T9L A;  1XF5 L;  1I42 A;  4B9K A;  4XDC A;  1NI2 A;  1WRI A;  1QKZ A;  2J7Q B;  3N20 C;  4PYU A;  4TUU A;  1EWC A;  4KGS A;  1VLB A;  3DBL I;  2OHF A;  1MG8 A;  5DPR A;  4BAX A;  4P6V F;  2KVZ A;  3L54 A;  4I6L B;  1SB3 C;  4LCD E;  4YSY B;  2ZNV C;  3VH3 B;  3NZS A;  2DZK A;  2ZPY A;  1FCC C;  2O6V B;  5D7G A;  3GE3 C;  4KSK C;  3IXS A;  1IBX B;  3C0R B;  2IY1 B;  1CK1 A;  4M00 A;  4BOS C;  4G0N B;  3IFW B;  2LWP A;  3Q6B A;  4LJP B;  1ZPS A;  2N7D A;  1DOI A;  2JVC A;  2JWZ A;  3RNF C;  1R7S A;  3VQI A;  4US9 A;  3N30 A;  4I6N B;  3ZW3 A;  2NBW B;  2MBQ A;  2L0F A;  1IYF A;  2KQ7 A;  4YSZ B;  2GBK A;  2BYF A;  3GZN B;  4C7Z A;  4BKG A;  5G5H A;  1LXD A;  3A9K A;  3HVZ A;  2WU5 B;  4ZRI A;  3MFG A;  5AZG A;  3PRE A;  3GS2 A;  1VCB A;  3W2D A;  3PVL A;  2KX3 A;  2K25 A;  3RI7 C;  5FK9 C;  3SU8 X;  2DAJ A;  4L23 A;  1VR9 A;  4EFO A;  1L6U A;  4JLC A;  2D3C A;  2NPT B;  4P1B C;  3RFZ B;  2K5P A;  4NZL B;  1XD3 B;  1YJJ A;  4C80 A;  3DBH B;  2QDF A;  3N1Z C;  5D94 A;  4BZA A;  4W9F A;  3P4S B;  5HG2 A;  3ZRF A;  1SF0 A;  4A6Q A;  3KYC D;  2QC8 A;  1RYJ A;  4EZK A;  4JIO U;  2K1F A;  2BKR B;  4LNK A;  4EUT A;  2V4L A;  4WWN A;  2WXJ A;  1UZX B;  3DVN V;  3ONS A;  1KJT A;  2C60 A;  2D3G A;  2FUG 1;  4GOC A;  1LGR A;  3EA6 A;  4BFR A;  2WXP A;  1SSN A;  3AE3 B;  2BYV E;  4GDK B;  4B95 A;  2WXF A;  1SIF A;  3ALB A;  3DCG A;  2G4S A;  4C56 C;  1M4V A;  3APD A;  3AE4 B;  3QC8 B;  3QIJ A;  3PGE A;  1AWD A;  1GC7 A;  2RR9 A;  1JAL A;  3ZNI D;  3DVG X;  1FRD A;  3UQB A;  2JZP A;  5AUI A;  3U8Z A;  1WSP A;  4WAA A;  2L0T A;  2L76 A;  2WXH A;  2DHZ A;  1GG3 A;  4PS8 A;  2X8X X;  3ZDM C;  3W5U B;  4ICV A;  1K51 A;  2V4I B;  3TCA A;  1JWS D;  1WMH B;  2V3P A;  2PVG C;  2KFJ A;  4HPL B;  1KRH A;  4PS7 A;  1JWU D;  4ANU A;  3EEC A;  1HTQ A;  5C23 A;  3FC4 A;  3OJ4 B;  1Y56 A;  1F0Z A;  3P42 A;  1JML A;  2KWV B;  3AEB B;  2I38 A;  5IA7 A;  4O1N A;  1GC6 A;  4G3X B;  2ZCC A;  5I4D A;  4CYE A;  1R4M B;  2LMC A;  3P63 A;  4N59 A;  3Q3F A;  2J0K A;  2N9L A;  1WR1 A;  4MSQ B;  3NRZ A;  2HJ1 A;  1WGG A;  1F1H A;  1XLP A;  2G4D B;  2RDG A;  3LYY A;  2MCN B;  1FCL A;  3AEC B;  4RGM A;  5E6N A;  1ZGU B;  4OZA A;  1FMA D;  3GZN I;  5KHO A;  2N7J A;  2ZW0 A;  3KVF B;  3B9J A;  2O2V B;  4H2A A;  1V1P B;  3AMZ A;  3RUL A;  3X0W A;  1NI3 A;  1TS4 A;  1RWS A;  1ET9 A;  2JYT A;  1S3S G;  4HRO A;  2M17 A;  1I7H A;  1WX8 A;  5BMH A;  2W3R A;  2WXL A;  2R2Q A;  3TBL D;  1V97 A;  3HIZ A;  1F52 A;  1L0X B;  1UBI A;  3DBH I;  4GLS C;  3ZJU A;  2EKE C;  1B1Z A;  2L8J A;  4X57 B;  1WF9 A;  1HA5 A;  2CHX A;  4K7U A;  4ACF A;  5KHQ A;  4B0M A;  2M56 B;  2Z0D B;  3I57 A;  4TQ0 A;  2WX0 A;  2DWQ A;  1H4R A;  2C9W B;  2FCS A;  4PT5 A;  1A5R A;  3IG3 A;  2VH2 A;  2PJH A;  5G55 A;  2JX5 A;  4OVU A;  2DYB A;  3IAM 1;  2O6V A;  4R3D A;  1AW7 A;  1TKY A;  2N0S B;  3WAO A;  4WQO B;  2GI9 A;  2NTS A;  3AV8 A;  3B1L X;  1FIQ A;  4RMA A;  2MQJ A;  4HJK A;  2KJH B;  1XLQ A;  1J7A A;  5BMG A;  2UU7 A;  4FHJ A;  3NS1 A;  1DGJ A;  4LNO A;  3E56 A;  3ML9 A;  3Q3J A;  3TEW A;  2WXG A;  3PPA A;  4EZJ A;  3H1U A;  3H7P A;  3PSE B;  4FBJ B;  5J2R A;  2WXI A;  5FR6 A;  1XLN A;  4RH6 A;  1GUA B;  2IY0 B;  1RFA A;  2I1K A;  5IOI A;  3IVF A;  2QMT A;  4DXA B;  2VZK B;  1XCQ L;  3M95 A;  1UWM A;  5D6J B;  3LDZ E;  5JZE B;  2ZNV B;  3VVW B;  1OFF A;  2EMT A;  4IWP A;  3MHZ A;  1D5X C;  1EO6 A;  4RM9 A;  3AM9 A;  2N9P C;  5CHV C;  4ZRP A;  3R7Q A;  5GMV A;  3PZD A;  2ZZP B;  3ENE A;  5JH5 C;  2LVO A;  2G45 B;  3NVZ A;  3K9O B;  2BS2 B;  5IO9 A;  1QIL A;  1XLO A;  3AEE B;  1E7U A;  1R4M I;  1D3Z A;  3X23 A;  2K22 A;  1C77 A;  1L6V A;  1WE7 A;  2E3T A;  3N1X C;  1IP9 A;  3PO0 A;  3V60 A;  3S2A A;  4LDT B;  2KQS A;  1UNS A;  2WHI A;  2BGF A;  1UBQ A;  2AL3 A;  2FNJ B;  3AU4 A;  3A4S C;  3D32 A;  1HEZ E;  3Q2A C;  2VRR B;  3ZGZ A;  5DPT A;  3A9K B;  2L7R A;  4AJW A;  1V81 A;  5LLI A;  3TEZ A;  4DHJ B;  4ASW C;  3NY5 A;  1A70 A;  1V6E A;  4WIP A;  3RMK C;  1ESF A;  2GOW A;  1WIA A;  1WGK A;  5D3I B;  4KGR A;  4GXB A;  3Q3O C;  2LUM A;  1AYF A;  2EKI A;  5C2T B;  4LNN A;  4MSM B;  2C7M B;  2D10 A;  1WM2 A;  4IOI E;  1C79 A;  4XGA B;  2W82 A;  2LUE A;  2JT4 B;  2JYE A;  3P4R B;  3AEG B;  2LGI A;  4IWO A;  1Y8R C;  1IPG A;  4W9J A;  2VH1 A;  3NJT A;  1RFK A;  3TJP A;  3PRM B;  1P98 A;  4BBN F;  2LRU A;  3I9V 1;  3SDL C;  1SBB B;  2M19 A;  2NMQ A;  5J17 A;  4JPS A;  2KWC A;  4USA A;  3Q8F A;  3KLS X;  2ZCB A;  1SGH A;  1WE6 A;  2Q5W D;  3TUO A;  4OHJ A;  1AAR A;  2D5G A;  2KDB A;  4WUR A;  1GPX A;  1UGM A;  2WYQ A;  4NJ7 A;  2KNB A;  1TY0 A;  3MC8 A;  1YIW A;  4JX1 C;  1E8Z A;  1WXS A;  2KXJ A;  3RNG C;  2YEP B;  2KAJ A;  3U4E G;  3NVW A;  4DK5 A;  1L5P A;  1WJ4 A;  4KDI C;  1WGH A;  4URK A;  1HTO A;  1V9J A;  4KZC A;  4KX6 B;  3AB5 A;  4FUL A;  3BWU D;  1L0Y B;  4HDO A;  5G2N A;  1KTK A;  2J53 A;  2KDI A;  3A33 B;  1B9R A;  4JQW C;  1YJI A;  3KW5 B;  3L10 B;  4ZOH C;  2A4Z A;  1WYW B;  2WXK A;  2IGH A;  1GAQ B;  4MH8 A;  3ZNH B;  2JQR B;  1YJ1 A;  1EWY C;  4YL8 A;  4KVG B;  4AJY B;  1NVI D;  5JHA A;  5HKH A;  1WI0 A;  2I2Y A;  2WU2 B;  2V3N A;  2D3B A;  4G50 A;  2V1Y A;  2V9H A;  3PT2 B;  4TKN A;  4ZRQ A;  3L4P A;  1TKG A;  5EE9 A;  4YSX B;  3ZTD A;  1TIF A;  1YN5 A;  2INP E;  2LGX A;  1T6B X;  5HFY A;  2I1J A;  3SR6 A;  1V86 A;  5BYS A;  2B76 B;  4B0E A;  4KDL B;  3CWI A;  5BYQ A;  1I4P A;  1XO3 A;  4AS1 A;  2AX5 A;  1RRB A;  3EFC A;  1ROE A;  2PVO D;  3HVD A;  1P0R A;  1L0V B;  3MC9 A;  5T8I A;  2MLB A;  1SIJ A;  1ET6 A;  2RPQ A;  4MAC A;  3MJ5 A;  5E6O A;  5MPO A;  3T3N A;  1C4P A;  3H7S A;  3P4Q B;  3DBR I;  3RN9 C;  2JWU A;  3OAW A;  3T8M A;  1F2R C;  2QHO A;  4NPN A;  3R66 C;  1KLU D;  1FEH A;  4ANX A;  3AED B;  2BTE A;  4IC7 B;  4W9D A;  2NBV B;  3PHX B;  1N5W A;  1TTN A;  1V5O A;  2LVP A;  1WX7 A;  2FBW B;  2KLG A;  2WX1 A;  3MTN B;  1E10 A;  3AE1 B;  3U2S C;  3QK0 A;  5E6P A;  2C5L C;  1WJU A;  2DYM A;  3VAW A;  4DDG D;  3RD2 A;  4C7Y A;  2IYD B;  4K3C A;  2KYW A;  3PZ8 A;  5E6J A;  3IBE A;  1QQR A;  4YTP B;  3ZXV A;  1V2Y A;  2IO0 B;  3M62 B;  2PE6 B;  3ML8 A;  4MEM A;  3MJW A;  1E8X A;  1TZ1 A;  3U30 A;  5BMI A;  2CJO A;  3H7P B;  3BVM A;  3VRA B;  1KFY B;  2K8C A;  2SAK A;  1ZKH A;  2D3A A;  1DOX A;  2CR5 A;  4KSL C;  3NHE B;  3WAN A;  1NBF C;  1N63 A;  3H8H A;  1Q5W B;  4RM8 A;  3ABV B;  3UIN B;  3AH7 A;  3UIP B;  1OQR A;  2WDR B;  3FIL A;  1QZE A;  2WGS A;  4NJC A;  4EOY A;  2KOX A;  3TEY A;  3ZNZ B;  1U4A A;  4XC2 A;  4NY0 A;  4ANW A;  4CO7 A;  4ZDV A;  2QIE B;  3SEB A;  1KH0 A;  2BB5 A;  4W9G A;  2G3Q B;  4AP4 C;  2DLB A;  4E71 A;  4HRS A;  4EE2 A;  2L00 B;  4IWQ A;  3BVZ A;  2HDE A;  4GB9 A;  1WGY A;  3R7R A;  4RFB A;  3KQ4 A;  2REX A;  1YN3 A;  3DOW A;  1FNU A;  1OEY J;  2J0J A;  2MJ3 A;  4GSW A;  3RCZ A;  3VTW A;  1VJK A;  4BBN C;  2MJE A;  1LQB A;  2DZI A;  2Y3A A;  1LO5 D;  5DCN A;  2KDM A;  3B08 A;  5DPW A;  2RDB C;  1NYR A;  4EEW A;  3OWE B;  3JSV A;  2WDV B;  3I63 C;  3E9S A;  1JWB D;  1SEB D;  1ACC A;  2M4N A;  3RNC C;  1IGD A;  1JRU A;  4WWP A;  3V6E B;  1OQY A;  4WJP A;  3Q8E A;  4ZHP A;  4DBG A;  2KWU B;  3ZJT A;  2LHD A;  2KK8 A;  1N5X A;  2KDF B;  4IW0 A;  2WNM A;  2JUO A;  4FAD A;  3BYT B;  4ITK A;  4LNF A;  1T5X D;  2JXX A;  4XDD A;  1MJD A;  3I3T B;  1C78 A;  1Z5S B;  2LEK A;  3I5J C;  4WAF A;  2QSD A;  5AZH A;  2N1W A;  1HZ5 A;  2WS3 B;  1TYG B;  3ZTC A;  1QOA A;  3DDC B;  4YXD B;  2Z0E B;  4REZ A;  1P7F A;  2K6Q A;  4MM3 A;  4GDL A;  4K81 A;  2KZR A;  2AYO B;  4K1R B;  1P1A A;  2AQ2 B;  2FCQ A;  4II3 B;  1OEY A;  3RUI B;  2FE8 A;  1SXT A;  4E3C A;  1CZP A;  4WH4 A;  5BO4 B;  1SJH D;  3AN1 A;  3ZLZ A;  2BWE S;  1H8C A;  2NTT A;  2IO2 B;  3PS6 A;  1PUT A;  1FRR A;  2LFI A;  4PYZ A;  2MW5 A;  1GNU A;  4JWU C;  2FID A;  3A9J A;  3APC A;  2MBB B;  2IZV B;  2SEB D;  4FN2 A;  3URY A;  1ZDX A;  3DHI C;  1VDV A;  1UD7 A;  1OGW A;  4NAW A;  1WGR A;  3TSS A;  1K8R B;  4N9F 4;  1J7B A;  2NR2 A;  3QX1 A; 
#chains in the Genus database with same CATH homology
 1GB1 A;  2LUM A;  1AYF A;  2EKI A;  3HUI A;  4HEA 1;  1I4H A;  3MC0 B;  5C2T B;  1TS2 A;  1FNW A;  1QF6 A;  1HQR D;  1XXG A;  3SFE B;  1GB4 A;  1ENF A;  2L32 A;  4IOI E;  1C79 A;  3AE2 B;  2W82 A;  1D5M C;  1P7E A;  2KWD A;  4FXC A;  1RM6 C;  2JYE A;  3R2T A;  3P4R B;  3AEG B;  2LGI A;  3IT6 B;  1ZDV A;  1PYW D;  1MVK A;  1UGJ A;  1JWA D;  1IUE A;  3ZYY X;  4TSS A;  1XF5 L;  2J4X A;  3AEA B;  2PTL A;  1I4Q A;  1RFK A;  4XDC A;  1WRI A;  4L1B A;  1QKZ A;  4YTM B;  3I9V 1;  4CQN A;  3NVV A;  1SBB B;  4NAM A;  2M19 A;  2NMQ A;  3EGR A;  2RPV A;  4JPS A;  1CJE A;  4USA A;  3MP9 A;  3Q8F A;  2V0G A;  3C8Y A;  1EWC A;  4KGS A;  3KLS X;  1VLB A;  1WXQ A;  2OHF A;  2Q5W D;  3TUO A;  3PZ7 A;  4OHJ A;  1TS5 A;  4P6V F;  2D5G A;  3NZ3 A;  1SB3 C;  4WUR A;  1NEK B;  4YSY B;  2H89 B;  2X38 A;  4RGT A;  1GPX A;  1FCC C;  1I4R A;  5D7G A;  4AQ7 A;  3B2F A;  3IXS A;  1IBX B;  2K9X A;  1CK1 A;  1ZUD 2;  1KLG D;  1TY0 A;  1OQQ A;  2BYT A;  4JX1 C;  1TS3 A;  1DOY A;  1ZPS A;  3DWG C;  1DOI A;  2YEP B;  3RPF C;  2KAJ A;  1R7S A;  3U4E G;  1C4C A;  2L52 A;  3VQI A;  4US9 A;  1TY2 A;  1NEN B;  3NVW A;  1L5P A;  1MI0 A;  5HHD G;  1ZE3 D;  1GOZ A;  2KQ4 X;  3IAS 1;  5C3J B;  2QJL A;  3BII D;  4KX6 B;  4KKJ A;  5EE1 A;  4A8X C;  3AB5 A;  3BWU D;  1L0Y B;  4YSZ B;  1KTK A;  4C7Z A;  1MHX A;  4RF0 A;  2J53 A;  2OED A;  4LLG M;  2PMV A;  5G5G A;  1B9R A;  1YJI A;  5G5H A;  4ZOH C;  3HVZ A;  4N58 A;  3W5V B;  2WXK A;  2IGH A;  1GAQ B;  4MH8 A;  3SFD B;  2JQR B;  3UI3 A;  1PGA A;  3W1S A;  3BK2 A;  2MH7 A;  1EWY C;  1SE4 A;  2WU5 B;  3MFG A;  2Y5C A;  3Q69 A;  3GS2 A;  1FXI A;  1NVI D;  3W2D A;  2WXM A;  3AE5 B;  2PIA A;  5FK9 C;  3W9C B;  2I2Y A;  2XNA C;  1UWX A;  2QEJ C;  4L23 A;  1VR9 A;  2WU2 B;  1L6U A;  2V3N A;  4ZRQ A;  5EE9 A;  3L4P A;  1TKG A;  1EM7 A;  3RFZ B;  4YSX B;  2K5P A;  1E0Z A;  4NZL B;  1ZOY B;  1YJJ A;  4C80 A;  1T3Q A;  2DYO A;  4XWW A;  3VR9 B;  2ACZ B;  4OZC A;  1YN5 A;  2JSV X;  3P4S B;  5HG2 A;  1SF0 A;  2INP E;  3FAH A;  4A6Q A;  1T6B X;  1SE3 A;  2R61 A;  5HFY A;  3SR6 A;  1RYJ A;  1N61 A;  5BYR A;  5BYS A;  4P16 A;  1K50 A;  2B76 B;  3VR8 B;  3FIL B;  2RDH A;  4B0E A;  3Q8B A;  4DQO C;  1KF6 B;  3CWI A;  4J3O D;  4LTU A;  4L2Y A;  2BT6 A;  5BYQ A;  4US8 A;  1I4P A;  1XO3 A;  2WXJ A;  2WQY B;  4AS1 A;  4D2K A;  2AX5 A;  1VZ7 A;  1C9F A;  2FUG 1;  3EA6 A;  2ZW1 A;  3KWL A;  4ZYS A;  2WXP A;  1SSN A;  3AE3 B;  4YWG G;  5JXV A;  1ROE A;  2PVO D;  4GDK B;  2WXF A;  3HVD A;  4A90 A;  3IT4 B;  1L0V B;  3CIR B;  2VZK D;  5T8I A;  4C56 C;  1SIJ A;  1ET6 A;  1M4V A;  2BB6 A;  2N9K A;  2ON8 A;  2TSS A;  3AE6 B;  2BS4 B;  1BXT A;  2IJ0 A;  1QT9 A;  3AE4 B;  3P1M A;  3VRB B;  1NYQ A;  4MAC A;  4A55 A;  3MJ5 A;  1CQV A;  2JXT A;  5MPO A;  3T3N A;  1C4P A;  1AWD A;  3P4Q B;  2GRI A;  2HTM E;  1IBX A;  1K52 A;  1JAL A;  3O13 A;  2JWU A;  2RMM A;  1FRD A;  1F2R C;  3ETR A;  4Q2J A;  2JZP A;  5AUI A;  1KLU D;  1FEH A;  1WSP A;  3ZQ4 A;  2M0A A;  3AED B;  2BTE A;  2WXH A;  2INN E;  4WQM A;  4HKZ E;  1FM0 D;  1EU4 A;  1N5W A;  2FBW B;  3W5U B;  1F77 A;  4LK0 M;  1K51 A;  2IPK D;  2V4I B;  1E10 A;  3AE1 B;  1JWS D;  4DXG A;  3U2S C;  2LJI A;  2V3P A;  2PVG C;  5EE3 A;  1E6E B;  2DYM A;  1KRH A;  4M0W A;  4C7Y A;  2MJD A;  3AE7 B;  3PZ8 A;  5E6J A;  1QQR A;  4YTP B;  3BZD B;  1F2R I;  1JWU D;  2CJN A;  1ZXH A;  3FC4 A;  2JU6 X;  1Y56 A;  2CU3 A;  4XE0 A;  1K53 A;  4HKQ A;  2AQ3 B;  3R2I A;  4JE3 B;  4RCO A;  4TMA B;  1QOB A;  3P42 A;  1JML A;  1F0Z A;  3AEB B;  2I38 A;  5H8Y E;  1J7C A;  4RGO S;  2MEK A;  4RNA A;  3Q8A A;  2LHE A;  4O1N A;  4RGN A;  4ZHO A;  2L83 A;  5BMI A;  2CJO A;  5I4D A;  1TJE A;  4ARI A;  2K3U A;  1XCT L;  3BVM A;  3VRA B;  2LMC A;  1KFY B;  1JRO A;  3P63 A;  4N59 A;  2Y5P A;  2SAK A;  2ICI A;  2N9L A;  1L4Z B;  3AEF B;  1DOX A;  2W3S A;  3NRZ A;  3U52 E;  1N60 A;  1YQ3 B;  1JQ4 A;  1PGX A;  1D5Z C;  2BBC A;  2WDQ B;  1HXY D;  1XLP A;  5D3D A;  1N63 A;  3H8H A;  2RDG A;  3LYY A;  3J9C A;  4KGT A;  1FCL A;  3ABV B;  3AEC B;  1JCK B;  3GP7 A;  1HZ6 A;  1JRP A;  4RGM A;  4OZA A;  1N62 A;  1FMA D;  3AH7 A;  1OQR A;  2WDR B;  3FIL A;  4NJC A;  2XN9 C;  4N6E B;  3TEY A;  2N7J A;  2IGD A;  2WXQ A;  2ZW0 A;  3B9J A;  1TZO A;  3R8B A;  5AUK A;  2PKO A;  3Q8C A;  4H2A A;  4IKG A;  1V1P B;  2QIE B;  3AMZ A;  5LNK 1;  3SEB A;  1KH0 A;  2BB5 A;  1FO4 A;  1NI3 A;  1I4X A;  2DLB A;  1TS4 A;  4MM3 B;  2L1A A;  2ONQ A;  1RWS A;  5H92 C;  4GDL B;  4XWT A;  1V1O A;  4HRS A;  1ET9 A;  2JYT A;  4EE2 A;  1L4D B;  4HRO A;  3BVZ A;  2HDE A;  1I7H A;  5BMH A;  2W3R A;  2WXL A;  2BS3 B;  2WXR A;  5FR3 A;  2PLP A;  1E9M A;  1V97 A;  3P4P B;  4MT5 A;  1UUP A;  1L0X B;  4RFB A;  5EE0 A;  3KQ4 A;  1YN3 A;  4GLS C;  3ZJU A;  1FNU A;  2MJ3 A;  1JW9 D;  1B1Z A;  2J42 A;  1HA5 A;  4OVZ A;  1VJK A;  3KWV A;  5FKA C;  3BYY B;  4KKI A;  2MJE A;  4B0M A;  2KMM A;  2M56 B;  3I57 A;  4TQ0 A;  1PDX A;  3V05 A;  3LXF A;  4A9A A;  2DWQ A;  2Y3A A;  1LO5 D;  3V3X A;  1D6E C;  2KDM A;  2BW2 A;  2WXO A;  5TSS A;  2IGG A;  4PT5 A;  2EEL A;  1NYR A;  1WYG A;  3OWE B;  2WDV B;  3N9Y C;  1C76 A;  2JX5 A;  3E9S A;  3IAM 1;  1JWB D;  4HJG E;  4R3D A;  2AQ1 B;  1SEB D;  1VZ6 A;  1ACC A;  1AW7 A;  1TKY A;  2N0S B;  3AE8 B;  1IGD A;  4NAW B;  2GI9 A;  2NTS A;  3AV8 A;  1FIQ A;  4OW0 A;  4ARC A;  3HRD D;  3Q8E A;  1XLQ A;  4ZHP A;  1J7A A;  3ZJT A;  5BMG A;  2H88 B;  2LHD A;  1QLB B;  1BUI C;  1E7P B;  3WCQ A;  1D4B A;  3NS1 A;  1N5X A;  1DGJ A;  3E56 A;  2WNM A;  1TKE A;  3TEW A;  2WXG A;  2K0P A;  3NUH B;  3BYT B;  4ITK A;  4RF1 A;  1JWM D;  1QOG A;  1T5X D;  2WXI A;  1XLN A;  3B2G A;  4RH6 A;  4XDD A;  1MHH E;  5HI1 A;  1MPE A;  2QMT A;  2VZK B;  2WLB A;  1XCQ L;  1C78 A;  3EUB 2;  1UWM A;  2LEK A;  2PW9 A;  1C4A A;  4DXF A;  4WAF A;  2QSD A;  3U7Z A;  1OFF A;  1EU3 A;  1I4G A;  1PGB A;  1HZ5 A;  2WS3 B;  1AN8 A;  1TYG B;  3BK1 A;  1Q10 A;  4JWS C;  4IDI A;  3MHZ A;  1D5X C;  1QOA A;  3LB8 C;  1VRA B;  3AM9 A;  4YXD B;  4ZRP A;  4REZ A;  1P7F A;  1V1P A;  1WWT A;  2KN4 A;  2W54 A;  1FFU A;  1ZP0 B;  2YEP F;  1SE2 A;  3NVZ A;  2BS2 B;  2IDY A;  1QIL A;  1FD6 A;  1XLO A;  3AE9 B;  3BVG A;  3AEE B;  2AQ2 B;  2J52 A;  1FFV A;  4UDU C;  2FE8 A;  1SXT A;  1VZ8 A;  2K22 A;  4TQ1 A;  2WP9 B;  1C77 A;  1CZP A;  2QIL A;  4OZB A;  1L6V A;  4WH4 A;  1BML C;  2E3T A;  2DBY A;  1ZXI A;  2E6X A;  1SJH D;  3PO0 A;  4WWM A;  3AN1 A;  1PFD A;  1YNT E;  2NTT A;  2KAC A;  3DWM A;  1UNS A;  1YN4 A;  1PUT A;  2G1E A;  1FRR A;  2LFI A;  2WXN A;  5GXG B;  3TEX A;  1YQ4 B;  1HEZ E;  3GB1 A;  4JWU C;  3ZGZ A;  4YTN B;  3TEZ A;  3ZJV A;  1IGC A;  3NVY A;  2G9H D;  1FXA A;  2SEB D;  1DYQ A;  1FNV A;  3URY A;  1A70 A;  1QOF A;  1ZDX A;  2W55 A;  2Z8L A;  1VDV A;  4WIP A;  1XEE A;  1YMH E;  3T3O A;  3TSS A;  1ESF A;  1STE A;  1WGK A;  5D3I B;  1J7B A;  1V8C A;  4YT0 B;  2GB1 A;  4KGR A;  1SJE D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...