3RPFC

Protein-protein complex of subunit 1 and 2 of molybdopterin-converting factor from helicobacter pylori 26695
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
74
structure length
74
Chain Sequence
b'MMVEVRFFGPIKEENFFIKANDLKELRAILQEKEGLKEWLGVCAIALNDHLIDNLNTPLKDGDVISLLPPVCGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdopterin synthase catalytic subunit
publication title Protein-protein complex of subunit 1 and 2 of Molybdopterin-converting factor from Helicobacter pylori 26695
rcsb
source organism Helicobacter pylori
molecule tags Transferase
total genus 11
structure length 74
sequence length 74
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3rpfC00
1ZP0B 2BS3B 4HROA 2WLBA 4US8A 1FXIA 1JALA 1UWMA 1YQ3B 3AE2B 4C7YA 2DBYA 1PDXA 3P4PB 5C3JB 1N62A 1E9MA 1QLBB 2BT6A 3NVYA 2N0SB 3VR9B 2MJDA 2G1EA 2K9XA 1CJEA 5GXGB 3NVWA 1RFKA 2K22A 4ZOHC 4C80A 1N63A 2PKOA 2QJLA 2L83A 3NVVA 3SFDB 1ZXIA 2PIAA 3AEGB 4N6EB 1WRIA 3CIRB 3PO0A 1QOAA 3L4PA 3LXFA 4KX6B 3SFEB 1FFUA 2DWQA 4A9AA 1F0ZA 1N5WA 2E3TA 1JW9D 2WU5B 1E6EB 1AWDA 1YJJA 2B76B 3DWGC 5AUKA 2HTME 1JWBD 2BS2B 1WWTA 2M19A 4YT0B 1QOGA 1PFDA 3AEEB 1FIQA 3CWIA 2OHFA 3AB5A 3HVZA 1L0VB 4ITKA 1NENB 3DWMA 1FFVA 1E0ZA 4YTNB 4FXCA 5EE1A 3SR6A 1DOXA 3VRBB 1TKEA 1XLOA 3AE3B 3BIID 3B2FA 1QOBA 4WWMA 4LTUA 4YTMB 3LB8C 4N58A 1SF0A 1J7CA 2WS3B 1FXAA 3ZYYX 4C7ZA 1NI3A 2CJOA 1I7HA 1AYFA 1KFYB 4P6VF 5EE9A 3W5UB 2W54A 3EUB2 1FM0D 1JWAD 3P4RB 3W9CB 1DOYA 5H8YE 2EKIA 4YXDB 5EE0A 4IDIA 1J7AA 3AECB 1NVID 3FAHA 1QOFA 5C2TB 1L6UA 3ETRA 3P4SB 2PVOD 1JQ4A 1SIJA 1FRDA 1V97A 4USAA 1WGKA 3NVZA 4ZHOA 1RWSA 3AN1A 3AE4B 3AM9A 1NYRA 1A70A 3HRDD 3HUIA 1GPXA 3P63A 2M56B 4N59A 1ZUD2 5AUIA 1ROEA 1JROA 2KMMA 1VDVA 2WU2B 1OQRA 2Y5CA 3AEAB 2H89B 3B2GA 1E7PB 5G5HA 1ZOYB 2FBWB 1KRHA 3AE1B 2MH7A 3FC4A 1N60A 1IUEA 2W55A 2WDVB 3KWLA 2JX5A 3AH7A 1N61A 2ACZB 1GAQB 1VLBA 3AEDB 2K5PA 1XLNA 1OQQA 3RPFC 1NYQA 5EE3A 1TKGA 3ABVB 3VRAB 1T3QA 1YQ4B 4YSXB 3AMZA 2MJEA 1OFFA 1VJKA 1XLPA 3B9JA 3AE9B 2MJ3A 2CJNA 5G5GA 4US9A 2PVGC 4WQMA 1TKYA 1CZPA 1YJIA 3W5VB 1WYGA 3AV8A 4HRSA 1XLQA 3AE7B 3AE8B 2WP9B 2WDRB 1B9RA 2WQYB 4ZHPA 1FMAD 2QIEB 1L5PA 1TJEA 1DGJA 1KF6B 2H88B 2Q5WD 3NRZA 3VR8B 1R7SA 1WXQA 1PUTA 2AX5A 1EWYC 3P1MA 1V8CA 3AEFB 2W3SA 1L6VA 2L52A 1DOIA 1J7BA 3AE6B 2JQRB 1XO3A 2WDQB 4JWUC 5MPOA 1FRRA 4YSYB 1RYJA 1N5XA 2LEKA 1TYGB 2KAJA 4YSZB 1FO4A 4YTPB 1SB3C 5H92C 2BS4B 2W3RA 3NS1A 3WCQA 4JX1C 1QF6A 1NEKB 3P4QB 1E10A 1QT9A 3AE5B 1RM6C 3AEBB 4JWSC 2CU3A 1JRPA
chains in the Genus database with same CATH superfamily
2G9HD 4G0NB 4HPLB 1IYFA 4RH6A 1P9DU 1V2YA 2MJDA 4RF0A 1BUIC 3VQIA 3L08A 4A9AA 1ET9A 5HI1A 1WX8A 4I6NB 3KYCD 1YD8U 2IO1B 2OHFA 3WANA 4BOZB 2LRWA 4MJSA 3TL5A 1WMHB 4REZA 2WS3B 4HWIB 3SHQA 4KV2A 3TIXA 4WH4A 1T0RC 2QEJC 3W9CB 2AQ2B 2KVZA 4KGTA 4HDQA 3NS8A 1KLVA 4EEWA 1YN5A 3IAS1 4ZHOA 1HE8A 3PV1A 4ANXA 2DYOA 2LXAA 3P63A 3ENEA 3DVNV 2EMTA 3PRZA 4LLGM 3Q3FA 1F2RC 3WAPA 1VDVA 4AJWA 2O2VA 2ZW0A 3MC8A 3AH7A 2ONQA 2FAZA 2PTLA 2MBBB 1JRUA 1L2NA 2LGXA 2L3ZA 4TMAB 1E7VA 1V6EA 3AMZA 4KDLB 1OFFA 1VJKA 2IJ0A 2KJHB 2PVGC 3MTNB 4M00A 4XE0A 1SE4A 4L23A 4PK1A 2LWPA 3Q8FA 1TJEA 2MEKA 4WWNA 3DBHB 2Q5WD 4NJCA 1I4PA 2KXJA 2BPSA 3N1YC 2V3PA 2AYOB 3VH4B 2N7EA 3PREA 3UQBA 2W82A 1UF0A 2DLBA 3QA8A 1WGRA 3RT3B 2PW9A 5D2MB 3NOBA 1TS5A 5DCNA 4HEA1 5BMIA 2JZPA 2ZVNA 2KACA 3VAWA 1FD6A 1TBEA 2WLBA 3EGRA 4LJOB 2J7QB 2DBYA 1PDXA 4FJVB 2BT6A 3ZTDA 2LI5A 1RLFA 3VDZA 2J42A 2K22A 1VRAB 1YNTE 2L83A 5E6NA 1AN8A 1YJJA 5BYSA 2KYWA 4EE2A 4KGRA 4RGTA 1RFAA 2WXLA 1TKEA 3V62A 4C4VA 2NTTA 2WXNA 3PTFC 3H1UA 5H8YE 1WGYA 3PRMB 4ZDVA 1SEBD 5EE0A 5JHBA 4YWGG 1YN3A 3R66C 1XT9B 3V6EB 2N1VA 2KMMA 5IP4D 5BYQA 3IFWB 1KRHA 2M17A 3Q8BA 3VHTC 5E6PA 1XF5L 2JZ3B 2ACZB 3RYTA 5CHWA 4JPSA 4EZJA 1WE7A 3CSTA 3O65B 1XLPA 1EUVB 1YX6B 3DBLB 4W9GA 2BF8B 1R4NI 4TSSA 3FILA 2KQ4X 2WQYB 4ZHPA 1E5WA 3V61A 5LNK1 1R7SA 4W9HA 1MJDA 4WJNA 1GB4A 1Z2MA 5BO4B 3TEYA 4BKSD 2L0TA 1WYWB 2LEKA 4M0WB 1ZDVA 3ZRFA 3A1QA 2MHJA 2KANA 5IKCM 1M4VA 2GBNA 1YQ3B 1QKZA 3ZIMA 2EMSA 1MHXA 1QLBB 2EKEC 3UIPB 4BFRA 2WX0A 4W9KA 2PIAA 1OEYJ 3PO0A 4BZAA 2BBCA 2ZNVC 3DHHC 1E6EB 1AWDA 2LJIA 5AUKA 4GMVA 1JWBD 3TMPB 4ANWA 2MBOA 1MI0A 4KIKB 1FIQA 5DPSA 3T3OA 5D94A 1H4RA 1VZ8A 3LB8C 3RN9C 3GE8C 1E8YA 1ENFA 1A5RA 2DENB 1L0YB 1L6UA 3C0RB 2LZ6A 3U2SC 2KJRA 3DVGY 2RMMA 3AM9A 1WJUA 3NUHB 3KQ4A 2KWUB 4S0RA 1D4BA 2FBWB 4MDKE 2NBWB 2R2OA 1WRDB 2KHWB 2LHEA 1JMLA 2Z0EB 2Y5PA 2PEAA 4MM3A 2KFKA 5EE3A 1JWSD 4JIOU 5G5GA 1CZPA 4GB9A 2ZCBA 4XWWA 2A4ZA 2WXJA 3ECIA 4IC7B 3R7RA 3L17A 2NS5A 1UBIA 1J7BA 2WDQB 5JZEB 3ZDMC 2L76A 1TYGB 1Y56A 2MCNB 1UGMA 3I5JC 2D10A 2LGIA 1L7YA 3P2BA 2KDEB 1ZP0B 3V3XA 3BINA 3R8BA 4L1BA 4H2AA 2DZJA 3P4PB 1E8ZA 1SJED 2E6XA 1MG4A 4HLEA 3QCAA 2WYQA 1OQYA 3GZNB 3ML9A 4N6EB 3T9LA 2V0GA 4A8XC 2E3TA 3Q8EA 2WXQA 3KUCB 1PFDA 2MBHA 2JXXA 2L1AA 1WR1A 3DWMA 1FFVA 3VUYA 1UGJA 4NPNA 3BIID 4LCDE 4FN2A 5I4DA 1J7CA 2BYFA 4HVBA 2ZVOA 4G3XB 1PGXA 4IWQA 3OJ3A 1J7AA 1PGBA 4HXDA 4J3OD 4B0MA 4BOSC 2QCZA 1F52A 5CHVC 2ICIA 1IGCA 1WGKA 2RDGA 3QAQA 4CQNA 2WU2B 2H89B 2WXOA 3M63B 5BYRA 5J18A 3PT2B 1P3QU 3T8MA 1N61A 1L4ZB 1T6BX 2V3NA 4IW0A 2NPTA 2IGHA 2C7MB 2NBUA 1T3QA 4MJSB 5CHFA 2G45B 5FR3A 2RDHA 2CHZA 4WQMA 2G4DB 1NI2A 2DAFA 4M8NA 1WGGA 1WSPA 2AL6A 1K8RB 4M0WA 1IBXA 1L5PA 2H88B 3NRZA 4XWTA 2AX5A 3E56A 2KX3A 2XK5A 3IXSA 4LNIA 4RNAA 3C8YA 1SB3C 5H92C 3EECA 3R7QA 4MSQB 2O2VB 1RM6C 4JWSC 3B2GA 3IG3A 2KMCA 3IAM1 3BZDB 4OW0A 5HFYA 4BBNC 4K3BA 3I9V1 1N62A 1DYQA 4FLHA 2KQ7A 2K9XA 3MFGA 1ZXIA 3A4SC 3AEGB 1WFYA 1J8CA 2MSED 1UWXA 3SFEB 2CU1A 3ZNZB 2RPVA 5JXVA 3GOEA 1ZKHA 4GDLA 3BVZA 3PPAA 2QHOA 1WM3A 1WY8A 3J9CA 2JZZA 4A3PA 2LUEA 3Q3JA 1VD2A 3KWVA 2X8XX 4ZYSA 5HKHA 4K3CA 3TSSA 1I7HA 4ZRPA 4RGOS 4A55A 1QOFA 3P4SB 1L4DB 4GLSC 2VH1A 3BVMA 3SEBA 4DHJD 2HTHA 2WXFA 3L13A 3ZKJC 3L10B 1Q5WB 1GPXA 4JGHB 2M56B 4N59A 4PS8A 2V4LA 1D5MC 2FUG1 4MH8A 3FC4A 1WJ4A 1WX7A 2UYZB 3HVDA 4PT5A 2WXMA 2KZRA 3RZWC 1HTOA 2K6QA 1R4MI 1C77A 1TS2A 3AE9B 4HRSA 2BB5A 2GBMA 2LGYA 2WWZA 2HDEA 1PUTA 1L0XB 4YL8A 4PYUA 1XD3B 3QQ8B 4NJ6A 4JWUC 3N3KB 1T5XD 3PLVA 1T0YA 1MFWA 3A9JA 2W3RA 2K8HA 4AQ7A 4MT5A 1E10A 4K81A 2M4NA 5FK9C 5LXHA 2LGDA 3AE2B 4OZAA 3IHPC 3NVWA 1HXYD 4A90A 4ZOHC 4B9KA 3L0WB 3SFDB 3PGEA 3TEZA 2ZEQA 2RGFA 3CIRB 3U7ZA 2KQSA 2K39A 1GOZA 1KH0A 4M01A 3FILB 3V05A 2Z8LA 2G4SA 2M19A 1VZ7A 4IWOA 2HD5B 3APCA 5TR5A 2IO0B 1XLOA 2LFIA 4P6VF 1TS4A 4OHJA 1RAXA 3AULA 3A1QB 2L7RA 2DZKA 2JWUA 4J6IA 1BXTA 2IGDA 2C9WB 4RMAA 3UINB 4B95A 2M0AA 4HPPA 4FJYA 1YMHE 1E7PB 2JRHA 4RGNA 2AWTA 1VR9A 4WJOA 2BVCA 4XC2A 2HJ8A 3DDCB 4HDOA 1E90A 1I42A 2D2QA 4N9F4 2JT4B 4ARIA 4US9A 4DXAB 1YJIA 2M8SA 4HJGE 4KKJA 2IO2B 1YQBA 3U8ZA 4UDUC 2MBQA 4PS7A 3PRPB 3ZNGC 3ZO5B 4TV3A 3P42A 3BYYB 3Q8AA 1FRRA 2VZKB 2K6DB 3HM6X 4JLCA 2N1WA 1SE2A 3OLMD 2V9HA 4WWPA 3SU8X 4MM3B 5HHDG 2KFKB 3WA0A 3W1SC 1LFDA 3N9YC 1TY0A 3DBRI 2N7DA 3EFUA 4NAMA 4EZKA 1D6EC 2GBKA 1VCBA 1YX5B 3WAOA 3BK2A 1KOTA 2BQQA 2MX2A 4AWJA 4ZRIA 2D3BA 3TUOA 3QX1A 2KJ6A 1EO6A 1IP9A 2KTFA 1C4CA 2Z0DB 2V3SA 4FXCA 4KSLC 3VRBB 3B2FA 2LUMA 1SF0A 5AEKB 2FIDA 2D3CA 3DVNU 2W9NA 4DXFA 2KTRA 1KLUD 4GGQA 4YXDB 1FCLA 5D3DA 3Q3NC 1ZW7A 5AZGA 5C2TB 2PVOD 1JQ4A 4KDIC 3HRDD 1WH3A 1LXDA 2YEPF 3BY4B 4LNNA 1GC7A 2KN5A 1I35A 1IUEA 1V5OA 3DOWA 1QQRA 1OQQA 4B0EA 1YQ4B 4OZCA 3B9JA 5AZHA 2ZPYA 3W5VB 2MP2A 1WYGA 3K9PB 2KNBA 2WDTB 3NZ3A 2GBRA 5T8IA 3ZXVA 2EELA 3QJZA 1BT0A 3BWUD 4E71A 4MGIE 5GMVA 1WXVA 4G11A 4K7UA 3MJWA 3QWZB 2J0MA 5LXIB 1TZOA 3H7PA 3AE5B 4FJZA 3QC8B 2L32A 1EU4A 4US8A 1XCQL 2Y3AA 2D3GA 2NPTB 5D7GA 2N0SB 5CTRC 3IT4B 4WJPA 2N9KA 3B08A 4RM9A 2WXPA 4X57B 4MH0E 2IY0B 2J4XA 1TIFA 2D3AA 3DWGC 1T0SC 2HTME 1WWTA 4EZLA 1IBXB 4NAWA 4M02A 1STEA 3IVFA 4G50A 2XK5B 1X1MA 2IZVB 2XN9C 3LYYA 3DVGX 2INPE 2RSUA 4EFOA 2QDFA 1SSNA 3PSEB 3P4RB 1JWAD 4IDIA 2DNFA 3AECB 1NVID 5DPWA 3ZDTA 3ZVVA 1V1PA 3ETRA 4AP4C 2ZCCA 4USAA 3N1XC 3R2TA 1ESFA 5E6OA 3WIMA 1V1OA 1HZ5A 2IDYA 4E74A 3N30A 4NQKE 2DHZA 3AE1B 2D07B 3MHZA 3PZ8A 2NR2A 1ZDXA 3OAWA 1C3TA 1GUAB 2L05A 4GDLB 1YN4A 1TTNA 2WX1A 1WR6E 2JVCA 3AU4A 2L0FA 2KX0A 3CF6E 4DDGD 1SE3A 2K25A 1UZXB 5LLIA 2LD9A 4K7SA 2VZKD 4EOYA 1EWYC 2PMVA 2C5LC 3AE6B 3ZQ4A 3H6NA 2G3QB 1ZGUB 1AW7A 3V60A 1P7EA 4WAFA 2JUOA 4KGSA 1QF6A 5DPRA 3TCAA 4CHKA 1PYWD 4KZCA 3W2DA 2LHDA 3PZDA 3ZNHB 2LVOA 1V49A 1N63A 4IM0A 3LJ3A 4KSKC 3Q14C 4KX6B 1F0ZA 1FNWA 3HIZA 3DQVA 3L54A 2BS2B 3ZRCA 1QOGA 1S1QB 4A6QA 1UH6A 2PPHA 3SR6A 4GDKA 1EM7A 3OJ4B 3A9JB 2PJHA 1TT5B 1CK1A 1KFYB 3ZJVA 2YEPB 2W54A 4KKIA 2UU7A 4L2YA 3UF8A 4XDCA 2ZPNA 3V6CB 1MHHE 2FCMA 2L00B 3EA6A 3ZUNA 4JQWC 2LASA 1JROA 4URKA 3B1LX 4ZRQA 1RRBA 3JYUA 4XGAB 2KOXA 3HK0A 1Y8RC 2QSDA 1Q1OA 3C19A 3TEWA 1SJHD 3H8HA 5IN7A 5IAAC 1I4RA 2D11A 1CQVA 1UUPA 3Q3OC 4CO7A 3AV8A 2N9PC 3AE8B 4MGZE 2WXKA 3UI3A 2CKHB 1JWUD 1I4GA 3B0AA 1R4MB 4YSYB 3VVWB 4YTPB 1LQBA 2N9EB 4JX1C 2K8CA 3P4QB 4RF1A 3UQAA 4HKQA 4NZLB 1FNVA 1TZ1A 1T0QC 3GB1A 4D2KA 1XQQA 2X38A 2JYTA 4MGKE 3ZGZA 4TUUA 4E3CA 1JCKB 3QARA 4ANUA 2QJLA 2C7NB 4ZRKA 1QOAA 3L4PA 2BYTA 2KO3A 2AL3A 2GMIC 3QIJA 3RD2A 1U4AA 5EE1A 4FA6A 1HZ6A 2WHIA 4A3OA 1FXAA 3I57A 3ML8A 3Q6BA 1Q10A 2WNMA 4TQ1A 2K0PA 3CSFA 4EUTA 2KK8A 3NVZA 1P1AA 3WAMA 3AN1A 4IOIE 1E7UA 1YJ1A 2M1MA 5AUIA 5JH5C 1D3ZA 4HCPB 1N60A 2WDVB 4DWFA 4W9CA 1K51A 3VH3B 3RPFC 3ABVB 3RI7C 1D5XC 2MJEA 3GZNI 4LDTB 1XCTL 3RZFA 4BAXA 1WZ0A 2IYDB 5TSSA 3OWEB 1DGJA 2KTRB 1V80A 2ZNVB 1XEEA 2I2YA 2L52A 1EF1A 1XO3A 4MACA 1UD7A 2L8JA 2REXA 5FR6A 3UIOB 1CMXB 3TJPA 2O6VA 4XDDA 3JW0X 5JHAA 3M62B 1GB1A 3AEBB 5C1ZA 4HCNB 3K9OB 3NZUA 1BMLC 3RMKC 3R2IA 4C7YA 1WXMA 2G1EA 2PKOA 3NVVA 1WF9A 1WI0A 2J53A 1FNUA 2INDC 1KTKA 4AJYB 2MP2B 1FFUA 4A20A 3QHTA 4WIPA 2BWES 3CWIA 1NENB 2GRIA 3TEXA 1FCCC 2CS4A 3DBRB 4YTMB 3U4EG 1WGHA 3W1SA 2MBEA 3ZYYX 2XBBC 4JL9A 1AYFA 3Q2AC 5G55A 3H7PB 2EKIA 2RR9A 4P1BC 3EC8A 5D3IB 1N6ZA 1FRDA 1V97A 4P7IA 3VFKA 2FCNA 4WQOB 3AE4B 3DHGC 2M0XA 4W9LA 4XZ4A 2WXRA 1IPGA 5G5HA 3JSVB 1KJTA 4GXBA 3LDZE 1TS3A 3ZTCA 4I6PA 2DYMA 1XLNA 4NAWB 3UGBB 1TKGA 4FHKA 2AEHA 2MJ3A 2K1FA 1FPYA 4W9EA 2BYVE 3A33B 3KUZA 4ZYNA 2WDRB 3ZLZA 1KF6B 4GSWA 2IO3B 1V8CA 2W3SA 3IBEA 2J0KA 1V1PB 4GIVA 1WE6A 1NBFC 1GJZA 3I3TB 1N5XA 3ZJTA 2ZW1A 2KWDA 3NHEB 3QK0A 3PVLA 1QT9A 1Z5SB 2SEBD 2TSSA 5D6JB 4HROA 1WGDA 3VTWA 4C56C 3NJTA 5C3JB 1E9MA 3NVYA 4MGYE 1UNSA 3DPDA 3VR9B 2ON8A 4LNOA 4DHZE 4GN1A 2BKRB 2NCNA 3LXFA 1N5WA 1R4NB 1G6JA 2IBIB 2JPHA 4F8CB 1YOVB 2INCC 3R3MA 3AB5A 1V86A 3HVZA 4ITKA 4W9JA 4YTNB 4Q2JA 1QOBA 4N58A 5HG2A 2C7HA 2KDIA 2CJOA 4DQOC 1FM0D 4R3DA 2MLBA 4W9IA 1SXTA 3PHXB 4DK5A 1JWMD 5BMGA 4BVUC 2GI9A 3NG0A 1KLGD 1NYRA 1IGDA 2JF5A 1EF5A 3AEAB 5IO9A 2OJWA 1ZOYB 5L95C 2BWFA 3D32A 3SD5A 5FKAC 2JX5A 1SE9A 4LK0M 3M3JA 5DPTA 3BYTB 4LDTD 3DBSA 5KHOA 3HHMA 1NYQA 1GNUA 1QZEA 1WXSA 4GDKB 2CJNA 2BGFA 4WWOA 1XLQA 3TBLD 3AE7B 2WP9B 2JY6A 1FEHA 3A9KB 2MQJA 3EFCA 2N7JA 4PS3A 3NZSA 2ZJDA 3AEFB 2A5UA 1L6VA 1OEYA 3MC0B 3DHIC 1F1HA 3BVGA 1RYJA 3H7SA 2KDFB 2BS4B 4FHJA 4HJKA 2FE8A 3WCQA 2MRPA 2CU3A 1WXQA 3URYA 2WXGA 3RNBC 5J17A 1C76A 2BYEA 3RNEC 1JALA 1C78A 5J2RA 3RFZB 2ZZPB 5CX3A 5GXGB 1CJEA 2KT7A 4ZRJA 1RFKA 2FCSA 1MPEA 1B1ZA 1HA5A 3N1ZC 3RNFC 2B76B 2BW2A 4YT0B 1ET6A 1P7FA 2IGGA 1L0VB 2VH2A 4OZBA 2RD0A 4M8MA 1DOXA 1P98A 2OEDA 4WWMA 5KHQA 1F77A 4C7ZA 4XX5A 2GBJA 3HM3A 3EUB2 1DOYA 3VTVA 1ZXHA 3JSVA 2B3AA 3Q69A 3H9DA 2DYBA 2KWVB 4IUMB 4O1NA 1FXTB 1SIJA 3CMMB 2ASQA 2GLSA 1A70A 4BKSA 3I63C 1ROEA 3MJ5A 1C4AA 3RNCC 2CHWA 1WXAA 5BMHA 4F7ZA 4RGMA 3GE3C 3KWLA 2QILA 3FKYA 3DBHI 3X0WA 2SAKA 4KZ0A 3U7DA 3MHSD 2WGSA 1C79A 4YSXB 4MELA 2N9XA 4RFBA 3WALA 2FUHB 2KVRA 2QC8A 2FIFA 1S3SG 1MG8A 1FMAD 1EU3A 4II2B 5G2NA 4I6LB 1LGRA 5MPOA 1WMHA 1VZ6A 3APDA 2KAJA 4K1RB 1KM7A 1WIAA 3N32A 2V4IB 1V81A 4MEMA 2HJ1A 2CR5A 2PLPA 1HQRD 1E8XA 1PQSA 4LJPB 3DCGA 1ISNA 2MW5A 3KVFB 2XNAC 2CHXA 4LNKA 1Q0WB 4IWPA 4HKZE 3ZNID 4RCOA 4FADA 2NVUI 3U52E 2LXCA 2LVQA 2GOWA 1JW9D 2KFJA 4DHZB 3KLSX 4K7WA 4DHJB 3KUDB 3AE3B 2NTSA 4LTUA 1UELA 1C9FA 1NI3A 2O6VB 3T3NA 5EE9A 2MWSB 3W5UB 3RUIB 4AUQC 5EDSA 4DDID 3A4RA 4PYZA 2DZIA 3MC9A 2KWCA 3KW5B 2JU6X 3JVZX 4ANVA 2PE9A 1ZPSA 1OTRB 2Y5CA 3DBLI 4IM2A 4XYCA 4NY0A 4RM8A 2WXIA 3AXCA 4DXGA 3X23A 2KC2A 1LM8B 3AEDB 3A9KA 3KYDD 2N4FA 4FBJB 1SBBB 2N9LA 2KC1A 4ASWC 2KLCA 3ONSA 2LRUA 4IM3A 1V5TA 5AZFA 1B9RA 1HTQA 2IY1B 5C23A 3Q8CA 2BTEA 4ICUA 1MVKA 1K50A 3Q3MC 1NEKB 2OOBB 4WJQA 4WURA 1TGZB 3L16A 2D5GA 1FXIA 1OGWA 2DZMA 1M94A 3ZXRA 3BK1A 4LNFA 3ZW3A 4WAAA 2J52A 4CYEA 3EHVA 2I1KA 3SDLC 2DWQA 1TY2A 1WJNA 4GOCA 4ICVA 1J0GA 4NQLB 2FNJB 2LJ5A 4W9DA 2I1JA 3AU5A 4JE3B 4AOFA 1E8WA 1H8CA 2INNE 3VTUA 2JRIB 2XEWA 2LVPA 3FAHA 4QAYA 2YLMA 1C4PA 2MA9B 1RWSA 4NNJB 2K3UA 1GG3A 3HUIA 1ZUD2 1ZE3D 2R2QA 1OQRA 3E9SA 3AI5A 4HPMB 2DAJA 1VLBA 4IG7B 2RPQA 1P0RA 3PS6A 2K5PA 2HE7A 3N20C 1SGHA 1I4HA 2VRRB 2RDBC 5L83A 2UWQA 1TKYA 3NY5A 1F2RI 2YVCA 1WM2A 2KMAA 4FULA 2QIEB 4TKNA 5E6JA 4KIKA 3VR8B 5IA7A 3KH0A 2BB6A 3P1MA 1EWCA 1WX9A 2BKFA 2JXTA 3W1YA 2V1YA 2R61A 4YSZB 2DX5B 2KLGA 1WZ3A 2KDMA 1LO5D 4II3B 4OVUA 3RNGC 3RNAC 1FO4A 1D5ZC 4TQ0A 2BS3B 2J0JA 4BKTA 3PLUA 1UWMA 4MSMB 1SIFA 3PZ7A 1AARA 4S17A 4BBNF 4C80A 2I38A 4DBGA 1K53A 4IKGA 1NDDA 2WXHA 4EKUA 1WRIA 4BKGA 4ARCA 2GB1A 2Z59B 2WU5B 4W9FA 3ZJUA 4F1SA 1HEZE 3IT6B 3VXWA 3AEEB 2IPKD 2O6VD 4B6WA 4C00A 1E0ZA 5IOIA 4GU2A 1YIWA 3VUXA 4AS1A 2AQ3B 3U30A 3O13A 1J19A 2JSVX 3RULA 3M95A 2JWZA 2OJRA 4P16A 4OVZA 2KN4A 1WJ6A 3APFA 2LMCA 4C4VB 2C60A 4HK2A 2Y5BB 3GS2A 2KDBA 1I4XA 3ALBA 4NJ7A 4OVVA 1QILA 1GC6A 3PHWB 2K8BA 2MH7A 2JYEA 2W55A 3VUWA 2NMQA 1GAQB 1XXGA 3RCZA 3VRAB 2AQ1B 3GP7A 3MP9A 2LGSA 1K52A 3OG5A 1F9JA 1PGAA 4KVGB 1I4QA 3S2AA 4ACFA 2NBVB 1DOIA 2JQRB 2KKCA 2QMTA 1C1YB 1UBQA 3NS1A 2FCQA 4P1CC 2KD0A 1V9JA 1ACCA 2PE6B 1JRPA
chains in the Genus database with same CATH topology
2WXGA 1PYWD 1C76A 2G9HD 3W2DA 3IAM1 2LHDA 1JALA 3BZDB 4OW0A 1C78A 4RH6A 5HFYA 3I9V1 1N62A 3RFZB 1DYQA 2MJDA 2K9XA 4RF0A 1CJEA 5GXGB 1RFKA 1BUIC 3VQIA 1N63A 3MFGA 1ZXIA 3AEGB 1UWXA 4KX6B 3SFEB 1MPEA 1FNWA 4A9AA 1F0ZA 1B1ZA 1HA5A 2RPVA 1ET9A 2B76B 5JXVA 5HI1A 2BS2B 2BW2A 4YT0B 1QOGA 1ET6A 1P7FA 4A6QA 2OHFA 3BVZA 2IGGA 1L0VB 3J9CA 4OZBA 3SR6A 1DOXA 1EM7A 2OEDA 4WWMA 3KWVA 4REZA 4ZYSA 2WS3B 1F77A 4C7ZA 3TSSA 1CK1A 1I7HA 1KFYB 3ZJVA 2YEPB 4WH4A 2QEJC 2W54A 3EUB2 4KKIA 4ZRPA 4L2YA 3W9CB 1DOYA 2AQ2B 1ZXHA 4KGTA 3Q69A 4RGOS 4A55A 1QOFA 4XDCA 3P4SB 4O1NA 1JRPA 1L4DB 4GLSC 1SIJA 1YN5A 1MHHE 3BVMA 3SEBA 3IAS1 4ZHOA 2WXFA 2DYOA 1A70A 1GPXA 3P63A 2M56B 3EA6A 4N59A 4LLGM 1ROEA 3MJ5A 1F2RC 1JROA 1VDVA 1C4AA 1D5MC 2FUG1 2ZW0A 4MH8A 4ZRQA 5BMHA 3FC4A 4RGMA 3KWLA 3AH7A 2ONQA 2QILA 2PTLA 3HVDA 4PT5A 2QSDA 2SAKA 2WXMA 3TEWA 4TMAB 1SJHD 1C79A 3H8HA 3AMZA 4YSXB 1I4RA 1OFFA 1VJKA 1C77A 1TS2A 2IJ0A 3AE9B 2PVGC 1CQVA 1UUPA 4RFBA 4XE0A 2BB5A 3AV8A 4HRSA 1SE4A 4L23A 3AE8B 3UI3A 2WXKA 1FMAD 3Q8FA 1JWUD 1TJEA 2MEKA 1I4GA 2Q5WD 2HDEA 4NJCA 1I4PA 1PUTA 1L0XB 1EU3A 4JWUC 5MPOA 1T5XD 2V3PA 4YSYB 1VZ6A 2KAJA 2W82A 4YTPB 2DLBA 2W3RA 2V4IB 4AQ7A 4MT5A 2PW9A 4JX1C 3P4QB 1TS5A 1E10A 4RF1A 4HEA1 5BMIA 2JZPA 4HKQA 4NZLB 2PLPA 1FNVA 5FK9C 1HQRD 2KACA 1FD6A 2WLBA 3EGRA 3AE2B 2DBYA 4OZAA 3GB1A 1PDXA 4D2KA 2X38A 2JYTA 2BT6A 3ZGZA 3NVWA 2XNAC 2J42A 1HXYD 4A90A 1JCKB 2K22A 4ZOHC 1VRAB 4HKZE 2QJLA 1YNTE 2L83A 3SFDB 4RCOA 3TEZA 3U7ZA 3CIRB 3U52E 1QOAA 3L4PA 1GOZA 1KH0A 1AN8A 3FILB 1JW9D 1YJJA 2Z8LA 3V05A 5BYSA 2BYTA 4EE2A 2M19A 1VZ7A 4KGRA 4RGTA 3KLSX 2WXLA 5EE1A 1TKEA 1HZ6A 1XLOA 3AE3B 2NTSA 4LTUA 1C9FA 1FXAA 2LFIA 1NI3A 3T3NA 4P6VF 5EE9A 3I57A 1TS4A 2NTTA 4OHJA 3W5UB 1Q10A 2WNMA 2WXNA 4TQ1A 2K0PA 5H8YE 1SEBD 2JWUA 5EE0A 4YWGG 1YN3A 1BXTA 2IGDA 3NVZA 3AN1A 4IOIE 2JU6X 2M0AA 1ZPSA 5AUIA 2KMMA 2Y5CA 1YMHE 5BYQA 1E7PB 4RGNA 1KRHA 1VR9A 2WXIA 3Q8BA 1N60A 2WDVB 1XF5L 4DXGA 2ACZB 3AEDB 4JPSA 1K51A 3RPFC 3ABVB 1SBBB 1D5XC 2MJEA 2N9LA 1XLPA 1XCTL 4ARIA 4US9A 1YJIA 4TSSA 3FILA 4HJGE 2KQ4X 1B9RA 4KKJA 5TSSA 2WQYB 3OWEB 4ZHPA 1DGJA 4UDUC 5LNK1 1R7SA 3Q8CA 1XEEA 2I2YA 2L52A 3P42A 3TEYA 1GB4A 3BYYB 2BTEA 1XO3A 3Q8AA 1FRRA 1K50A 1MVKA 2VZKB 4MACA 2LEKA 4XDDA 1ZDVA 1SE2A 1NEKB 1GB1A 3AEBB 4WURA 2D5GA 1M4VA 1BMLC 1FXIA 3R2IA 1YQ3B 1QKZA 4C7YA 1MHXA 1QLBB 4MM3B 2G1EA 3BK1A 5HHDG 2J52A 2PKOA 3N9YC 1TY0A 3NVVA 4NAMA 2PIAA 2J53A 1FNUA 3PO0A 1D6EC 1KTKA 2BBCA 1FFUA 2DWQA 1TY2A 3BK2A 1E6EB 1AWDA 4WIPA 2LJIA 5AUKA 1JWBD 3TUOA 1MI0A 1FIQA 3CWIA 1C4CA 1NENB 2GRIA 3TEXA 1FCCC 4FXCA 3T3OA 3VRBB 3B2FA 4YTMB 2LUMA 1VZ8A 1SF0A 3LB8C 3U4EG 3W1SA 3ZYYX 4JE3B 4DXFA 1AYFA 1KLUD 2INNE 4YXDB 2EKIA 1FCLA 1ENFA 5D3DA 1L0YB 3FAHA 5C2TB 1C4PA 1L6UA 2PVOD 1JQ4A 5D3IB 1FRDA 1V97A 3U2SC 1RWSA 3AE4B 2RMMA 3AM9A 2K3UA 3HRDD 3HUIA 1ZUD2 2YEPF 3NUHB 1ZE3D 2WXRA 3KQ4A 1OQRA 1D4BA 5G5HA 2FBWB 3E9SA 1TS3A 1IUEA 2DYMA 2LHEA 1JMLA 1VLBA 2Y5PA 1QQRA 2K5PA 1XLNA 4NAWB 1OQQA 4B0EA 5EE3A 1I4HA 1TKGA 1YQ4B 4OZCA 1JWSD 3B9JA 2MJ3A 5G5GA 1TKYA 1CZPA 1F2RI 3W5VB 1WYGA 4XWWA 2WDRB 3NZ3A 2WXJA 2QIEB 1KF6B 5E6JA 5T8IA 2EELA 3VR8B 2BB6A 3P1MA 1EWCA 1V8CA 2JXTA 2W3SA 3BWUD 1J7BA 1V1PB 2WDQB 2R61A 1N5XA 1TYGB 4YSZB 3ZJTA 1Y56A 2ZW1A 2KWDA 1TZOA 2LGIA 1QT9A 1LO5D 2KDMA 3AE5B 1FO4A 1D5ZC 2SEBD 1ZP0B 4TQ0A 2TSSA 2L32A 2BS3B 1EU4A 3V3XA 4HROA 4US8A 3R8BA 1UWMA 4C56C 1XCQL 4L1BA 4H2AA 2Y3AA 3P4PB 5C3JB 1SJED 1E9MA 3NVYA 1UNSA 2N0SB 5D7GA 3VR9B 2E6XA 3IT4B 2ON8A 2N9KA 3PZ7A 4C80A 2I38A 1K53A 4IKGA 2WXPA 4N6EB 2WXHA 2V0GA 1WRIA 4ARCA 3LXFA 4A8XC 2GB1A 1N5WA 2J4XA 2E3TA 2WU5B 3Q8EA 2WXQA 3DWGC 3ZJUA 2HTME 1HEZE 1WWTA 1IBXB 3IT6B 1PFDA 3AEEB 3AB5A 2IPKD 3HVZA 1STEA 2L1AA 4ITKA 3DWMA 1FFVA 1E0ZA 4YTNB 1UGJA 4Q2JA 3BIID 1QOBA 2XN9C 4AS1A 2AQ3B 4N58A 5I4DA 5HG2A 1J7CA 3LYYA 3O13A 2INPE 2CJOA 2JSVX 1SSNA 4DQOC 1FM0D 1JWAD 3P4RB 4P16A 1PGXA 4R3DA 4OVZA 4IDIA 1J7AA 1PGBA 3AECB 1NVID 2KN4A 4J3OD 4B0MA 1V1PA 3ETRA 1SXTA 1JWMD 5BMGA 2ICIA 2LMCA 4USAA 1IGCA 1WGKA 2GI9A 2RDGA 1KLGD 3GS2A 1ESFA 3R2TA 1I4XA 1NYRA 1IGDA 1V1OA 4CQNA 1HZ5A 2IDYA 1QILA 2WU2B 3AEAB 3B2GA 2H89B 2WXOA 1ZOYB 3AE1B 5BYRA 2MH7A 2JYEA 3MHZA 3PZ8A 2W55A 5FKAC 2JX5A 1N61A 4LK0M 2NMQA 1GAQB 1ZDXA 1L4ZB 3BYTB 1T6BX 2V3NA 4GDLB 1NYQA 1XXGA 1YN4A 2IGHA 3VRAB 1T3QA 2AQ1B 4GDKB 5FR3A 2CJNA 2RDHA 4WQMA 3GP7A 1SE3A 3MP9A 1WSPA 1K52A 1XLQA 3AE7B 2WP9B 4M0WA 1FEHA 1IBXA 1L5PA 1PGAA 2H88B 2N7JA 2VZKD 3NRZA 4XWTA 1I4QA 1EWYC 2AX5A 2PMVA 3AEFB 3E56A 1L6VA 3MC0B 1DOIA 3AE6B 3ZQ4A 2JQRB 3BVGA 2QMTA 3IXSA 1RYJA 4RNAA 1AW7A 3C8YA 1SB3C 1P7EA 2BS4B 5H92C 3NS1A 2FE8A 4WAFA 3WCQA 4KGSA 1QF6A 4JWSC 1ACCA 1RM6C 2CU3A 1WXQA 3URYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZP0 B;  2BS3 B;  4HRO A;  2WLB A;  4US8 A;  1FXI A;  1JAL A;  1UWM A;  1YQ3 B;  3AE2 B;  4C7Y A;  2DBY A;  1PDX A;  3P4P B;  5C3J B;  1N62 A;  1E9M A;  1QLB B;  2BT6 A;  3NVY A;  2N0S B;  3VR9 B;  2MJD A;  2G1E A;  2K9X A;  1CJE A;  5GXG B;  3NVW A;  1RFK A;  2K22 A;  4ZOH C;  4C80 A;  1N63 A;  2PKO A;  2QJL A;  2L83 A;  3NVV A;  3SFD B;  1ZXI A;  2PIA A;  3AEG B;  4N6E B;  1WRI A;  3CIR B;  3PO0 A;  1QOA A;  3L4P A;  3LXF A;  4KX6 B;  3SFE B;  1FFU A;  2DWQ A;  4A9A A;  1F0Z A;  1N5W A;  2E3T A;  1JW9 D;  2WU5 B;  1E6E B;  1AWD A;  1YJJ A;  2B76 B;  3DWG C;  5AUK A;  2HTM E;  1JWB D;  2BS2 B;  1WWT A;  2M19 A;  4YT0 B;  1QOG A;  1PFD A;  3AEE B;  1FIQ A;  3CWI A;  2OHF A;  3AB5 A;  3HVZ A;  1L0V B;  4ITK A;  1NEN B;  3DWM A;  1FFV A;  1E0Z A;  4YTN B;  4FXC A;  5EE1 A;  3SR6 A;  1DOX A;  3VRB B;  1TKE A;  1XLO A;  3AE3 B;  3BII D;  3B2F A;  1QOB A;  4WWM A;  4LTU A;  4YTM B;  3LB8 C;  4N58 A;  1SF0 A;  1J7C A;  2WS3 B;  1FXA A;  3ZYY X;  4C7Z A;  1NI3 A;  2CJO A;  1I7H A;  1AYF A;  1KFY B;  4P6V F;  5EE9 A;  3W5U B;  2W54 A;  3EUB 2;  1FM0 D;  1JWA D;  3P4R B;  3W9C B;  1DOY A;  5H8Y E;  2EKI A;  4YXD B;  5EE0 A;  4IDI A;  1J7A A;  3AEC B;  1NVI D;  3FAH A;  1QOF A;  5C2T B;  1L6U A;  3ETR A;  3P4S B;  2PVO D;  1JQ4 A;  1SIJ A;  1FRD A;  1V97 A;  4USA A;  1WGK A;  3NVZ A;  4ZHO A;  1RWS A;  3AN1 A;  3AE4 B;  3AM9 A;  1NYR A;  1A70 A;  3HRD D;  3HUI A;  1GPX A;  3P63 A;  2M56 B;  4N59 A;  1ZUD 2;  5AUI A;  1ROE A;  1JRO A;  2KMM A;  1VDV A;  2WU2 B;  1OQR A;  2Y5C A;  3AEA B;  2H89 B;  3B2G A;  1E7P B;  5G5H A;  1ZOY B;  2FBW B;  1KRH A;  3AE1 B;  2MH7 A;  3FC4 A;  1N60 A;  1IUE A;  2W55 A;  2WDV B;  3KWL A;  2JX5 A;  3AH7 A;  1N61 A;  2ACZ B;  1GAQ B;  1VLB A;  3AED B;  2K5P A;  1XLN A;  1OQQ A;  3RPF C;  1NYQ A;  5EE3 A;  1TKG A;  3ABV B;  3VRA B;  1T3Q A;  1YQ4 B;  4YSX B;  3AMZ A;  2MJE A;  1OFF A;  1VJK A;  1XLP A;  3B9J A;  3AE9 B;  2MJ3 A;  2CJN A;  5G5G A;  4US9 A;  2PVG C;  4WQM A;  1TKY A;  1CZP A;  1YJI A;  3W5V B;  1WYG A;  3AV8 A;  4HRS A;  1XLQ A;  3AE7 B;  3AE8 B;  2WP9 B;  2WDR B;  1B9R A;  2WQY B;  4ZHP A;  1FMA D;  2QIE B;  1L5P A;  1TJE A;  1DGJ A;  1KF6 B;  2H88 B;  2Q5W D;  3NRZ A;  3VR8 B;  1R7S A;  1WXQ A;  1PUT A;  2AX5 A;  1EWY C;  3P1M A;  1V8C A;  3AEF B;  2W3S A;  1L6V A;  2L52 A;  1DOI A;  1J7B A;  3AE6 B;  2JQR B;  1XO3 A;  2WDQ B;  4JWU C;  5MPO A;  1FRR A;  4YSY B;  1RYJ A;  1N5X A;  2LEK A;  1TYG B;  2KAJ A;  4YSZ B;  1FO4 A;  4YTP B;  1SB3 C;  5H92 C;  2BS4 B;  2W3R A;  3NS1 A;  3WCQ A;  4JX1 C;  1QF6 A;  1NEK B;  3P4Q B;  1E10 A;  1QT9 A;  3AE5 B;  1RM6 C;  3AEB B;  4JWS C;  2CU3 A;  1JRP A; 
#chains in the Genus database with same CATH topology
 2G9H D;  4G0N B;  4HPL B;  1IYF A;  4RH6 A;  1P9D U;  1V2Y A;  2MJD A;  4RF0 A;  1BUI C;  3VQI A;  3L08 A;  4A9A A;  1ET9 A;  5HI1 A;  1WX8 A;  4I6N B;  3KYC D;  1YD8 U;  2IO1 B;  2OHF A;  3WAN A;  4BOZ B;  2LRW A;  4MJS A;  3TL5 A;  1WMH B;  4REZ A;  2WS3 B;  4HWI B;  3SHQ A;  4KV2 A;  3TIX A;  4WH4 A;  1T0R C;  2QEJ C;  3W9C B;  2AQ2 B;  2KVZ A;  4KGT A;  4HDQ A;  3NS8 A;  1KLV A;  4EEW A;  1YN5 A;  3IAS 1;  4ZHO A;  1HE8 A;  3PV1 A;  4ANX A;  2DYO A;  2LXA A;  3P63 A;  3ENE A;  3DVN V;  2EMT A;  3PRZ A;  4LLG M;  3Q3F A;  1F2R C;  3WAP A;  1VDV A;  4AJW A;  2O2V A;  2ZW0 A;  3MC8 A;  3AH7 A;  2ONQ A;  2FAZ A;  2PTL A;  2MBB B;  1JRU A;  1L2N A;  2LGX A;  2L3Z A;  4TMA B;  1E7V A;  1V6E A;  3AMZ A;  4KDL B;  1OFF A;  1VJK A;  2IJ0 A;  2KJH B;  2PVG C;  3MTN B;  4M00 A;  4XE0 A;  1SE4 A;  4L23 A;  4PK1 A;  2LWP A;  3Q8F A;  1TJE A;  2MEK A;  4WWN A;  3DBH B;  2Q5W D;  4NJC A;  1I4P A;  2KXJ A;  2BPS A;  3N1Y C;  2V3P A;  2AYO B;  3VH4 B;  2N7E A;  3PRE A;  3UQB A;  2W82 A;  1UF0 A;  2DLB A;  3QA8 A;  1WGR A;  3RT3 B;  2PW9 A;  5D2M B;  3NOB A;  1TS5 A;  5DCN A;  4HEA 1;  5BMI A;  2JZP A;  2ZVN A;  2KAC A;  3VAW A;  1FD6 A;  1TBE A;  2WLB A;  3EGR A;  4LJO B;  2J7Q B;  2DBY A;  1PDX A;  4FJV B;  2BT6 A;  3ZTD A;  2LI5 A;  1RLF A;  3VDZ A;  2J42 A;  2K22 A;  1VRA B;  1YNT E;  2L83 A;  5E6N A;  1AN8 A;  1YJJ A;  5BYS A;  2KYW A;  4EE2 A;  4KGR A;  4RGT A;  1RFA A;  2WXL A;  1TKE A;  3V62 A;  4C4V A;  2NTT A;  2WXN A;  3PTF C;  3H1U A;  5H8Y E;  1WGY A;  3PRM B;  4ZDV A;  1SEB D;  5EE0 A;  5JHB A;  4YWG G;  1YN3 A;  3R66 C;  1XT9 B;  3V6E B;  2N1V A;  2KMM A;  5IP4 D;  5BYQ A;  3IFW B;  1KRH A;  2M17 A;  3Q8B A;  3VHT C;  5E6P A;  1XF5 L;  2JZ3 B;  2ACZ B;  3RYT A;  5CHW A;  4JPS A;  4EZJ A;  1WE7 A;  3CST A;  3O65 B;  1XLP A;  1EUV B;  1YX6 B;  3DBL B;  4W9G A;  2BF8 B;  1R4N I;  4TSS A;  3FIL A;  2KQ4 X;  2WQY B;  4ZHP A;  1E5W A;  3V61 A;  5LNK 1;  1R7S A;  4W9H A;  1MJD A;  4WJN A;  1GB4 A;  1Z2M A;  5BO4 B;  3TEY A;  4BKS D;  2L0T A;  1WYW B;  2LEK A;  4M0W B;  1ZDV A;  3ZRF A;  3A1Q A;  2MHJ A;  2KAN A;  5IKC M;  1M4V A;  2GBN A;  1YQ3 B;  1QKZ A;  3ZIM A;  2EMS A;  1MHX A;  1QLB B;  2EKE C;  3UIP B;  4BFR A;  2WX0 A;  4W9K A;  2PIA A;  1OEY J;  3PO0 A;  4BZA A;  2BBC A;  2ZNV C;  3DHH C;  1E6E B;  1AWD A;  2LJI A;  5AUK A;  4GMV A;  1JWB D;  3TMP B;  4ANW A;  2MBO A;  1MI0 A;  4KIK B;  1FIQ A;  5DPS A;  3T3O A;  5D94 A;  1H4R A;  1VZ8 A;  3LB8 C;  3RN9 C;  3GE8 C;  1E8Y A;  1ENF A;  1A5R A;  2DEN B;  1L0Y B;  1L6U A;  3C0R B;  2LZ6 A;  3U2S C;  2KJR A;  3DVG Y;  2RMM A;  3AM9 A;  1WJU A;  3NUH B;  3KQ4 A;  2KWU B;  4S0R A;  1D4B A;  2FBW B;  4MDK E;  2NBW B;  2R2O A;  1WRD B;  2KHW B;  2LHE A;  1JML A;  2Z0E B;  2Y5P A;  2PEA A;  4MM3 A;  2KFK A;  5EE3 A;  1JWS D;  4JIO U;  5G5G A;  1CZP A;  4GB9 A;  2ZCB A;  4XWW A;  2A4Z A;  2WXJ A;  3ECI A;  4IC7 B;  3R7R A;  3L17 A;  2NS5 A;  1UBI A;  1J7B A;  2WDQ B;  5JZE B;  3ZDM C;  2L76 A;  1TYG B;  1Y56 A;  2MCN B;  1UGM A;  3I5J C;  2D10 A;  2LGI A;  1L7Y A;  3P2B A;  2KDE B;  1ZP0 B;  3V3X A;  3BIN A;  3R8B A;  4L1B A;  4H2A A;  2DZJ A;  3P4P B;  1E8Z A;  1SJE D;  2E6X A;  1MG4 A;  4HLE A;  3QCA A;  2WYQ A;  1OQY A;  3GZN B;  3ML9 A;  4N6E B;  3T9L A;  2V0G A;  4A8X C;  2E3T A;  3Q8E A;  2WXQ A;  3KUC B;  1PFD A;  2MBH A;  2JXX A;  2L1A A;  1WR1 A;  3DWM A;  1FFV A;  3VUY A;  1UGJ A;  4NPN A;  3BII D;  4LCD E;  4FN2 A;  5I4D A;  1J7C A;  2BYF A;  4HVB A;  2ZVO A;  4G3X B;  1PGX A;  4IWQ A;  3OJ3 A;  1J7A A;  1PGB A;  4HXD A;  4J3O D;  4B0M A;  4BOS C;  2QCZ A;  1F52 A;  5CHV C;  2ICI A;  1IGC A;  1WGK A;  2RDG A;  3QAQ A;  4CQN A;  2WU2 B;  2H89 B;  2WXO A;  3M63 B;  5BYR A;  5J18 A;  3PT2 B;  1P3Q U;  3T8M A;  1N61 A;  1L4Z B;  1T6B X;  2V3N A;  4IW0 A;  2NPT A;  2IGH A;  2C7M B;  2NBU A;  1T3Q A;  4MJS B;  5CHF A;  2G45 B;  5FR3 A;  2RDH A;  2CHZ A;  4WQM A;  2G4D B;  1NI2 A;  2DAF A;  4M8N A;  1WGG A;  1WSP A;  2AL6 A;  1K8R B;  4M0W A;  1IBX A;  1L5P A;  2H88 B;  3NRZ A;  4XWT A;  2AX5 A;  3E56 A;  2KX3 A;  2XK5 A;  3IXS A;  4LNI A;  4RNA A;  3C8Y A;  1SB3 C;  5H92 C;  3EEC A;  3R7Q A;  4MSQ B;  2O2V B;  1RM6 C;  4JWS C;  3B2G A;  3IG3 A;  2KMC A;  3IAM 1;  3BZD B;  4OW0 A;  5HFY A;  4BBN C;  4K3B A;  3I9V 1;  1N62 A;  1DYQ A;  4FLH A;  2KQ7 A;  2K9X A;  3MFG A;  1ZXI A;  3A4S C;  3AEG B;  1WFY A;  1J8C A;  2MSE D;  1UWX A;  3SFE B;  2CU1 A;  3ZNZ B;  2RPV A;  5JXV A;  3GOE A;  1ZKH A;  4GDL A;  3BVZ A;  3PPA A;  2QHO A;  1WM3 A;  1WY8 A;  3J9C A;  2JZZ A;  4A3P A;  2LUE A;  3Q3J A;  1VD2 A;  3KWV A;  2X8X X;  4ZYS A;  5HKH A;  4K3C A;  3TSS A;  1I7H A;  4ZRP A;  4RGO S;  4A55 A;  1QOF A;  3P4S B;  1L4D B;  4GLS C;  2VH1 A;  3BVM A;  3SEB A;  4DHJ D;  2HTH A;  2WXF A;  3L13 A;  3ZKJ C;  3L10 B;  1Q5W B;  1GPX A;  4JGH B;  2M56 B;  4N59 A;  4PS8 A;  2V4L A;  1D5M C;  2FUG 1;  4MH8 A;  3FC4 A;  1WJ4 A;  1WX7 A;  2UYZ B;  3HVD A;  4PT5 A;  2WXM A;  2KZR A;  3RZW C;  1HTO A;  2K6Q A;  1R4M I;  1C77 A;  1TS2 A;  3AE9 B;  4HRS A;  2BB5 A;  2GBM A;  2LGY A;  2WWZ A;  2HDE A;  1PUT A;  1L0X B;  4YL8 A;  4PYU A;  1XD3 B;  3QQ8 B;  4NJ6 A;  4JWU C;  3N3K B;  1T5X D;  3PLV A;  1T0Y A;  1MFW A;  3A9J A;  2W3R A;  2K8H A;  4AQ7 A;  4MT5 A;  1E10 A;  4K81 A;  2M4N A;  5FK9 C;  5LXH A;  2LGD A;  3AE2 B;  4OZA A;  3IHP C;  3NVW A;  1HXY D;  4A90 A;  4ZOH C;  4B9K A;  3L0W B;  3SFD B;  3PGE A;  3TEZ A;  2ZEQ A;  2RGF A;  3CIR B;  3U7Z A;  2KQS A;  2K39 A;  1GOZ A;  1KH0 A;  4M01 A;  3FIL B;  3V05 A;  2Z8L A;  2G4S A;  2M19 A;  1VZ7 A;  4IWO A;  2HD5 B;  3APC A;  5TR5 A;  2IO0 B;  1XLO A;  2LFI A;  4P6V F;  1TS4 A;  4OHJ A;  1RAX A;  3AUL A;  3A1Q B;  2L7R A;  2DZK A;  2JWU A;  4J6I A;  1BXT A;  2IGD A;  2C9W B;  4RMA A;  3UIN B;  4B95 A;  2M0A A;  4HPP A;  4FJY A;  1YMH E;  1E7P B;  2JRH A;  4RGN A;  2AWT A;  1VR9 A;  4WJO A;  2BVC A;  4XC2 A;  2HJ8 A;  3DDC B;  4HDO A;  1E90 A;  1I42 A;  2D2Q A;  4N9F 4;  2JT4 B;  4ARI A;  4US9 A;  4DXA B;  1YJI A;  2M8S A;  4HJG E;  4KKJ A;  2IO2 B;  1YQB A;  3U8Z A;  4UDU C;  2MBQ A;  4PS7 A;  3PRP B;  3ZNG C;  3ZO5 B;  4TV3 A;  3P42 A;  3BYY B;  3Q8A A;  1FRR A;  2VZK B;  2K6D B;  3HM6 X;  4JLC A;  2N1W A;  1SE2 A;  3OLM D;  2V9H A;  4WWP A;  3SU8 X;  4MM3 B;  5HHD G;  2KFK B;  3WA0 A;  3W1S C;  1LFD A;  3N9Y C;  1TY0 A;  3DBR I;  2N7D A;  3EFU A;  4NAM A;  4EZK A;  1D6E C;  2GBK A;  1VCB A;  1YX5 B;  3WAO A;  3BK2 A;  1KOT A;  2BQQ A;  2MX2 A;  4AWJ A;  4ZRI A;  2D3B A;  3TUO A;  3QX1 A;  2KJ6 A;  1EO6 A;  1IP9 A;  2KTF A;  1C4C A;  2Z0D B;  2V3S A;  4FXC A;  4KSL C;  3VRB B;  3B2F A;  2LUM A;  1SF0 A;  5AEK B;  2FID A;  2D3C A;  3DVN U;  2W9N A;  4DXF A;  2KTR A;  1KLU D;  4GGQ A;  4YXD B;  1FCL A;  5D3D A;  3Q3N C;  1ZW7 A;  5AZG A;  5C2T B;  2PVO D;  1JQ4 A;  4KDI C;  3HRD D;  1WH3 A;  1LXD A;  2YEP F;  3BY4 B;  4LNN A;  1GC7 A;  2KN5 A;  1I35 A;  1IUE A;  1V5O A;  3DOW A;  1QQR A;  1OQQ A;  4B0E A;  1YQ4 B;  4OZC A;  3B9J A;  5AZH A;  2ZPY A;  3W5V B;  2MP2 A;  1WYG A;  3K9P B;  2KNB A;  2WDT B;  3NZ3 A;  2GBR A;  5T8I A;  3ZXV A;  2EEL A;  3QJZ A;  1BT0 A;  3BWU D;  4E71 A;  4MGI E;  5GMV A;  1WXV A;  4G11 A;  4K7U A;  3MJW A;  3QWZ B;  2J0M A;  5LXI B;  1TZO A;  3H7P A;  3AE5 B;  4FJZ A;  3QC8 B;  2L32 A;  1EU4 A;  4US8 A;  1XCQ L;  2Y3A A;  2D3G A;  2NPT B;  5D7G A;  2N0S B;  5CTR C;  3IT4 B;  4WJP A;  2N9K A;  3B08 A;  4RM9 A;  2WXP A;  4X57 B;  4MH0 E;  2IY0 B;  2J4X A;  1TIF A;  2D3A A;  3DWG C;  1T0S C;  2HTM E;  1WWT A;  4EZL A;  1IBX B;  4NAW A;  4M02 A;  1STE A;  3IVF A;  4G50 A;  2XK5 B;  1X1M A;  2IZV B;  2XN9 C;  3LYY A;  3DVG X;  2INP E;  2RSU A;  4EFO A;  2QDF A;  1SSN A;  3PSE B;  3P4R B;  1JWA D;  4IDI A;  2DNF A;  3AEC B;  1NVI D;  5DPW A;  3ZDT A;  3ZVV A;  1V1P A;  3ETR A;  4AP4 C;  2ZCC A;  4USA A;  3N1X C;  3R2T A;  1ESF A;  5E6O A;  3WIM A;  1V1O A;  1HZ5 A;  2IDY A;  4E74 A;  3N30 A;  4NQK E;  2DHZ A;  3AE1 B;  2D07 B;  3MHZ A;  3PZ8 A;  2NR2 A;  1ZDX A;  3OAW A;  1C3T A;  1GUA B;  2L05 A;  4GDL B;  1YN4 A;  1TTN A;  2WX1 A;  1WR6 E;  2JVC A;  3AU4 A;  2L0F A;  2KX0 A;  3CF6 E;  4DDG D;  1SE3 A;  2K25 A;  1UZX B;  5LLI A;  2LD9 A;  4K7S A;  2VZK D;  4EOY A;  1EWY C;  2PMV A;  2C5L C;  3AE6 B;  3ZQ4 A;  3H6N A;  2G3Q B;  1ZGU B;  1AW7 A;  3V60 A;  1P7E A;  4WAF A;  2JUO A;  4KGS A;  1QF6 A;  5DPR A;  3TCA A;  4CHK A;  1PYW D;  4KZC A;  3W2D A;  2LHD A;  3PZD A;  3ZNH B;  2LVO A;  1V49 A;  1N63 A;  4IM0 A;  3LJ3 A;  4KSK C;  3Q14 C;  4KX6 B;  1F0Z A;  1FNW A;  3HIZ A;  3DQV A;  3L54 A;  2BS2 B;  3ZRC A;  1QOG A;  1S1Q B;  4A6Q A;  1UH6 A;  2PPH A;  3SR6 A;  4GDK A;  1EM7 A;  3OJ4 B;  3A9J B;  2PJH A;  1TT5 B;  1CK1 A;  1KFY B;  3ZJV A;  2YEP B;  2W54 A;  4KKI A;  2UU7 A;  4L2Y A;  3UF8 A;  4XDC A;  2ZPN A;  3V6C B;  1MHH E;  2FCM A;  2L00 B;  3EA6 A;  3ZUN A;  4JQW C;  2LAS A;  1JRO A;  4URK A;  3B1L X;  4ZRQ A;  1RRB A;  3JYU A;  4XGA B;  2KOX A;  3HK0 A;  1Y8R C;  2QSD A;  1Q1O A;  3C19 A;  3TEW A;  1SJH D;  3H8H A;  5IN7 A;  5IAA C;  1I4R A;  2D11 A;  1CQV A;  1UUP A;  3Q3O C;  4CO7 A;  3AV8 A;  2N9P C;  3AE8 B;  4MGZ E;  2WXK A;  3UI3 A;  2CKH B;  1JWU D;  1I4G A;  3B0A A;  1R4M B;  4YSY B;  3VVW B;  4YTP B;  1LQB A;  2N9E B;  4JX1 C;  2K8C A;  3P4Q B;  4RF1 A;  3UQA A;  4HKQ A;  4NZL B;  1FNV A;  1TZ1 A;  1T0Q C;  3GB1 A;  4D2K A;  1XQQ A;  2X38 A;  2JYT A;  4MGK E;  3ZGZ A;  4TUU A;  4E3C A;  1JCK B;  3QAR A;  4ANU A;  2QJL A;  2C7N B;  4ZRK A;  1QOA A;  3L4P A;  2BYT A;  2KO3 A;  2AL3 A;  2GMI C;  3QIJ A;  3RD2 A;  1U4A A;  5EE1 A;  4FA6 A;  1HZ6 A;  2WHI A;  4A3O A;  1FXA A;  3I57 A;  3ML8 A;  3Q6B A;  1Q10 A;  2WNM A;  4TQ1 A;  2K0P A;  3CSF A;  4EUT A;  2KK8 A;  3NVZ A;  1P1A A;  3WAM A;  3AN1 A;  4IOI E;  1E7U A;  1YJ1 A;  2M1M A;  5AUI A;  5JH5 C;  1D3Z A;  4HCP B;  1N60 A;  2WDV B;  4DWF A;  4W9C A;  1K51 A;  3VH3 B;  3RPF C;  3ABV B;  3RI7 C;  1D5X C;  2MJE A;  3GZN I;  4LDT B;  1XCT L;  3RZF A;  4BAX A;  1WZ0 A;  2IYD B;  5TSS A;  3OWE B;  1DGJ A;  2KTR B;  1V80 A;  2ZNV B;  1XEE A;  2I2Y A;  2L52 A;  1EF1 A;  1XO3 A;  4MAC A;  1UD7 A;  2L8J A;  2REX A;  5FR6 A;  3UIO B;  1CMX B;  3TJP A;  2O6V A;  4XDD A;  3JW0 X;  5JHA A;  3M62 B;  1GB1 A;  3AEB B;  5C1Z A;  4HCN B;  3K9O B;  3NZU A;  1BML C;  3RMK C;  3R2I A;  4C7Y A;  1WXM A;  2G1E A;  2PKO A;  3NVV A;  1WF9 A;  1WI0 A;  2J53 A;  1FNU A;  2IND C;  1KTK A;  4AJY B;  2MP2 B;  1FFU A;  4A20 A;  3QHT A;  4WIP A;  2BWE S;  3CWI A;  1NEN B;  2GRI A;  3TEX A;  1FCC C;  2CS4 A;  3DBR B;  4YTM B;  3U4E G;  1WGH A;  3W1S A;  2MBE A;  3ZYY X;  2XBB C;  4JL9 A;  1AYF A;  3Q2A C;  5G55 A;  3H7P B;  2EKI A;  2RR9 A;  4P1B C;  3EC8 A;  5D3I B;  1N6Z A;  1FRD A;  1V97 A;  4P7I A;  3VFK A;  2FCN A;  4WQO B;  3AE4 B;  3DHG C;  2M0X A;  4W9L A;  4XZ4 A;  2WXR A;  1IPG A;  5G5H A;  3JSV B;  1KJT A;  4GXB A;  3LDZ E;  1TS3 A;  3ZTC A;  4I6P A;  2DYM A;  1XLN A;  4NAW B;  3UGB B;  1TKG A;  4FHK A;  2AEH A;  2MJ3 A;  2K1F A;  1FPY A;  4W9E A;  2BYV E;  3A33 B;  3KUZ A;  4ZYN A;  2WDR B;  3ZLZ A;  1KF6 B;  4GSW A;  2IO3 B;  1V8C A;  2W3S A;  3IBE A;  2J0K A;  1V1P B;  4GIV A;  1WE6 A;  1NBF C;  1GJZ A;  3I3T B;  1N5X A;  3ZJT A;  2ZW1 A;  2KWD A;  3NHE B;  3QK0 A;  3PVL A;  1QT9 A;  1Z5S B;  2SEB D;  2TSS A;  5D6J B;  4HRO A;  1WGD A;  3VTW A;  4C56 C;  3NJT A;  5C3J B;  1E9M A;  3NVY A;  4MGY E;  1UNS A;  3DPD A;  3VR9 B;  2ON8 A;  4LNO A;  4DHZ E;  4GN1 A;  2BKR B;  2NCN A;  3LXF A;  1N5W A;  1R4N B;  1G6J A;  2IBI B;  2JPH A;  4F8C B;  1YOV B;  2INC C;  3R3M A;  3AB5 A;  1V86 A;  3HVZ A;  4ITK A;  4W9J A;  4YTN B;  4Q2J A;  1QOB A;  4N58 A;  5HG2 A;  2C7H A;  2KDI A;  2CJO A;  4DQO C;  1FM0 D;  4R3D A;  2MLB A;  4W9I A;  1SXT A;  3PHX B;  4DK5 A;  1JWM D;  5BMG A;  4BVU C;  2GI9 A;  3NG0 A;  1KLG D;  1NYR A;  1IGD A;  2JF5 A;  1EF5 A;  3AEA B;  5IO9 A;  2OJW A;  1ZOY B;  5L95 C;  2BWF A;  3D32 A;  3SD5 A;  5FKA C;  2JX5 A;  1SE9 A;  4LK0 M;  3M3J A;  5DPT A;  3BYT B;  4LDT D;  3DBS A;  5KHO A;  3HHM A;  1NYQ A;  1GNU A;  1QZE A;  1WXS A;  4GDK B;  2CJN A;  2BGF A;  4WWO A;  1XLQ A;  3TBL D;  3AE7 B;  2WP9 B;  2JY6 A;  1FEH A;  3A9K B;  2MQJ A;  3EFC A;  2N7J A;  4PS3 A;  3NZS A;  2ZJD A;  3AEF B;  2A5U A;  1L6V A;  1OEY A;  3MC0 B;  3DHI C;  1F1H A;  3BVG A;  1RYJ A;  3H7S A;  2KDF B;  2BS4 B;  4FHJ A;  4HJK A;  2FE8 A;  3WCQ A;  2MRP A;  2CU3 A;  1WXQ A;  3URY A;  2WXG A;  3RNB C;  5J17 A;  1C76 A;  2BYE A;  3RNE C;  1JAL A;  1C78 A;  5J2R A;  3RFZ B;  2ZZP B;  5CX3 A;  5GXG B;  1CJE A;  2KT7 A;  4ZRJ A;  1RFK A;  2FCS A;  1MPE A;  1B1Z A;  1HA5 A;  3N1Z C;  3RNF C;  2B76 B;  2BW2 A;  4YT0 B;  1ET6 A;  1P7F A;  2IGG A;  1L0V B;  2VH2 A;  4OZB A;  2RD0 A;  4M8M A;  1DOX A;  1P98 A;  2OED A;  4WWM A;  5KHQ A;  1F77 A;  4C7Z A;  4XX5 A;  2GBJ A;  3HM3 A;  3EUB 2;  1DOY A;  3VTV A;  1ZXH A;  3JSV A;  2B3A A;  3Q69 A;  3H9D A;  2DYB A;  2KWV B;  4IUM B;  4O1N A;  1FXT B;  1SIJ A;  3CMM B;  2ASQ A;  2GLS A;  1A70 A;  4BKS A;  3I63 C;  1ROE A;  3MJ5 A;  1C4A A;  3RNC C;  2CHW A;  1WXA A;  5BMH A;  4F7Z A;  4RGM A;  3GE3 C;  3KWL A;  2QIL A;  3FKY A;  3DBH I;  3X0W A;  2SAK A;  4KZ0 A;  3U7D A;  3MHS D;  2WGS A;  1C79 A;  4YSX B;  4MEL A;  2N9X A;  4RFB A;  3WAL A;  2FUH B;  2KVR A;  2QC8 A;  2FIF A;  1S3S G;  1MG8 A;  1FMA D;  1EU3 A;  4II2 B;  5G2N A;  4I6L B;  1LGR A;  5MPO A;  1WMH A;  1VZ6 A;  3APD A;  2KAJ A;  4K1R B;  1KM7 A;  1WIA A;  3N32 A;  2V4I B;  1V81 A;  4MEM A;  2HJ1 A;  2CR5 A;  2PLP A;  1HQR D;  1E8X A;  1PQS A;  4LJP B;  3DCG A;  1ISN A;  2MW5 A;  3KVF B;  2XNA C;  2CHX A;  4LNK A;  1Q0W B;  4IWP A;  4HKZ E;  3ZNI D;  4RCO A;  4FAD A;  2NVU I;  3U52 E;  2LXC A;  2LVQ A;  2GOW A;  1JW9 D;  2KFJ A;  4DHZ B;  3KLS X;  4K7W A;  4DHJ B;  3KUD B;  3AE3 B;  2NTS A;  4LTU A;  1UEL A;  1C9F A;  1NI3 A;  2O6V B;  3T3N A;  5EE9 A;  2MWS B;  3W5U B;  3RUI B;  4AUQ C;  5EDS A;  4DDI D;  3A4R A;  4PYZ A;  2DZI A;  3MC9 A;  2KWC A;  3KW5 B;  2JU6 X;  3JVZ X;  4ANV A;  2PE9 A;  1ZPS A;  1OTR B;  2Y5C A;  3DBL I;  4IM2 A;  4XYC A;  4NY0 A;  4RM8 A;  2WXI A;  3AXC A;  4DXG A;  3X23 A;  2KC2 A;  1LM8 B;  3AED B;  3A9K A;  3KYD D;  2N4F A;  4FBJ B;  1SBB B;  2N9L A;  2KC1 A;  4ASW C;  2KLC A;  3ONS A;  2LRU A;  4IM3 A;  1V5T A;  5AZF A;  1B9R A;  1HTQ A;  2IY1 B;  5C23 A;  3Q8C A;  2BTE A;  4ICU A;  1MVK A;  1K50 A;  3Q3M C;  1NEK B;  2OOB B;  4WJQ A;  4WUR A;  1TGZ B;  3L16 A;  2D5G A;  1FXI A;  1OGW A;  2DZM A;  1M94 A;  3ZXR A;  3BK1 A;  4LNF A;  3ZW3 A;  4WAA A;  2J52 A;  4CYE A;  3EHV A;  2I1K A;  3SDL C;  2DWQ A;  1TY2 A;  1WJN A;  4GOC A;  4ICV A;  1J0G A;  4NQL B;  2FNJ B;  2LJ5 A;  4W9D A;  2I1J A;  3AU5 A;  4JE3 B;  4AOF A;  1E8W A;  1H8C A;  2INN E;  3VTU A;  2JRI B;  2XEW A;  2LVP A;  3FAH A;  4QAY A;  2YLM A;  1C4P A;  2MA9 B;  1RWS A;  4NNJ B;  2K3U A;  1GG3 A;  3HUI A;  1ZUD 2;  1ZE3 D;  2R2Q A;  1OQR A;  3E9S A;  3AI5 A;  4HPM B;  2DAJ A;  1VLB A;  4IG7 B;  2RPQ A;  1P0R A;  3PS6 A;  2K5P A;  2HE7 A;  3N20 C;  1SGH A;  1I4H A;  2VRR B;  2RDB C;  5L83 A;  2UWQ A;  1TKY A;  3NY5 A;  1F2R I;  2YVC A;  1WM2 A;  2KMA A;  4FUL A;  2QIE B;  4TKN A;  5E6J A;  4KIK A;  3VR8 B;  5IA7 A;  3KH0 A;  2BB6 A;  3P1M A;  1EWC A;  1WX9 A;  2BKF A;  2JXT A;  3W1Y A;  2V1Y A;  2R61 A;  4YSZ B;  2DX5 B;  2KLG A;  1WZ3 A;  2KDM A;  1LO5 D;  4II3 B;  4OVU A;  3RNG C;  3RNA C;  1FO4 A;  1D5Z C;  4TQ0 A;  2BS3 B;  2J0J A;  4BKT A;  3PLU A;  1UWM A;  4MSM B;  1SIF A;  3PZ7 A;  1AAR A;  4S17 A;  4BBN F;  4C80 A;  2I38 A;  4DBG A;  1K53 A;  4IKG A;  1NDD A;  2WXH A;  4EKU A;  1WRI A;  4BKG A;  4ARC A;  2GB1 A;  2Z59 B;  2WU5 B;  4W9F A;  3ZJU A;  4F1S A;  1HEZ E;  3IT6 B;  3VXW A;  3AEE B;  2IPK D;  2O6V D;  4B6W A;  4C00 A;  1E0Z A;  5IOI A;  4GU2 A;  1YIW A;  3VUX A;  4AS1 A;  2AQ3 B;  3U30 A;  3O13 A;  1J19 A;  2JSV X;  3RUL A;  3M95 A;  2JWZ A;  2OJR A;  4P16 A;  4OVZ A;  2KN4 A;  1WJ6 A;  3APF A;  2LMC A;  4C4V B;  2C60 A;  4HK2 A;  2Y5B B;  3GS2 A;  2KDB A;  1I4X A;  3ALB A;  4NJ7 A;  4OVV A;  1QIL A;  1GC6 A;  3PHW B;  2K8B A;  2MH7 A;  2JYE A;  2W55 A;  3VUW A;  2NMQ A;  1GAQ B;  1XXG A;  3RCZ A;  3VRA B;  2AQ1 B;  3GP7 A;  3MP9 A;  2LGS A;  1K52 A;  3OG5 A;  1F9J A;  1PGA A;  4KVG B;  1I4Q A;  3S2A A;  4ACF A;  2NBV B;  1DOI A;  2JQR B;  2KKC A;  2QMT A;  1C1Y B;  1UBQ A;  3NS1 A;  2FCQ A;  4P1C C;  2KD0 A;  1V9J A;  1ACC A;  2PE6 B;  1JRP A; 
#chains in the Genus database with same CATH homology
 2WXG A;  1PYW D;  1C76 A;  2G9H D;  3W2D A;  3IAM 1;  2LHD A;  1JAL A;  3BZD B;  4OW0 A;  1C78 A;  4RH6 A;  5HFY A;  3I9V 1;  1N62 A;  3RFZ B;  1DYQ A;  2MJD A;  2K9X A;  4RF0 A;  1CJE A;  5GXG B;  1RFK A;  1BUI C;  3VQI A;  1N63 A;  3MFG A;  1ZXI A;  3AEG B;  1UWX A;  4KX6 B;  3SFE B;  1MPE A;  1FNW A;  4A9A A;  1F0Z A;  1B1Z A;  1HA5 A;  2RPV A;  1ET9 A;  2B76 B;  5JXV A;  5HI1 A;  2BS2 B;  2BW2 A;  4YT0 B;  1QOG A;  1ET6 A;  1P7F A;  4A6Q A;  2OHF A;  3BVZ A;  2IGG A;  1L0V B;  3J9C A;  4OZB A;  3SR6 A;  1DOX A;  1EM7 A;  2OED A;  4WWM A;  3KWV A;  4REZ A;  4ZYS A;  2WS3 B;  1F77 A;  4C7Z A;  3TSS A;  1CK1 A;  1I7H A;  1KFY B;  3ZJV A;  2YEP B;  4WH4 A;  2QEJ C;  2W54 A;  3EUB 2;  4KKI A;  4ZRP A;  4L2Y A;  3W9C B;  1DOY A;  2AQ2 B;  1ZXH A;  4KGT A;  3Q69 A;  4RGO S;  4A55 A;  1QOF A;  4XDC A;  3P4S B;  4O1N A;  1JRP A;  1L4D B;  4GLS C;  1SIJ A;  1YN5 A;  1MHH E;  3BVM A;  3SEB A;  3IAS 1;  4ZHO A;  2WXF A;  2DYO A;  1A70 A;  1GPX A;  3P63 A;  2M56 B;  3EA6 A;  4N59 A;  4LLG M;  1ROE A;  3MJ5 A;  1F2R C;  1JRO A;  1VDV A;  1C4A A;  1D5M C;  2FUG 1;  2ZW0 A;  4MH8 A;  4ZRQ A;  5BMH A;  3FC4 A;  4RGM A;  3KWL A;  3AH7 A;  2ONQ A;  2QIL A;  2PTL A;  3HVD A;  4PT5 A;  2QSD A;  2SAK A;  2WXM A;  3TEW A;  4TMA B;  1SJH D;  1C79 A;  3H8H A;  3AMZ A;  4YSX B;  1I4R A;  1OFF A;  1VJK A;  1C77 A;  1TS2 A;  2IJ0 A;  3AE9 B;  2PVG C;  1CQV A;  1UUP A;  4RFB A;  4XE0 A;  2BB5 A;  3AV8 A;  4HRS A;  1SE4 A;  4L23 A;  3AE8 B;  3UI3 A;  2WXK A;  1FMA D;  3Q8F A;  1JWU D;  1TJE A;  2MEK A;  1I4G A;  2Q5W D;  2HDE A;  4NJC A;  1I4P A;  1PUT A;  1L0X B;  1EU3 A;  4JWU C;  5MPO A;  1T5X D;  2V3P A;  4YSY B;  1VZ6 A;  2KAJ A;  2W82 A;  4YTP B;  2DLB A;  2W3R A;  2V4I B;  4AQ7 A;  4MT5 A;  2PW9 A;  4JX1 C;  3P4Q B;  1TS5 A;  1E10 A;  4RF1 A;  4HEA 1;  5BMI A;  2JZP A;  4HKQ A;  4NZL B;  2PLP A;  1FNV A;  5FK9 C;  1HQR D;  2KAC A;  1FD6 A;  2WLB A;  3EGR A;  3AE2 B;  2DBY A;  4OZA A;  3GB1 A;  1PDX A;  4D2K A;  2X38 A;  2JYT A;  2BT6 A;  3ZGZ A;  3NVW A;  2XNA C;  2J42 A;  1HXY D;  4A90 A;  1JCK B;  2K22 A;  4ZOH C;  1VRA B;  4HKZ E;  2QJL A;  1YNT E;  2L83 A;  3SFD B;  4RCO A;  3TEZ A;  3U7Z A;  3CIR B;  3U52 E;  1QOA A;  3L4P A;  1GOZ A;  1KH0 A;  1AN8 A;  3FIL B;  1JW9 D;  1YJJ A;  2Z8L A;  3V05 A;  5BYS A;  2BYT A;  4EE2 A;  2M19 A;  1VZ7 A;  4KGR A;  4RGT A;  3KLS X;  2WXL A;  5EE1 A;  1TKE A;  1HZ6 A;  1XLO A;  3AE3 B;  2NTS A;  4LTU A;  1C9F A;  1FXA A;  2LFI A;  1NI3 A;  3T3N A;  4P6V F;  5EE9 A;  3I57 A;  1TS4 A;  2NTT A;  4OHJ A;  3W5U B;  1Q10 A;  2WNM A;  2WXN A;  4TQ1 A;  2K0P A;  5H8Y E;  1SEB D;  2JWU A;  5EE0 A;  4YWG G;  1YN3 A;  1BXT A;  2IGD A;  3NVZ A;  3AN1 A;  4IOI E;  2JU6 X;  2M0A A;  1ZPS A;  5AUI A;  2KMM A;  2Y5C A;  1YMH E;  5BYQ A;  1E7P B;  4RGN A;  1KRH A;  1VR9 A;  2WXI A;  3Q8B A;  1N60 A;  2WDV B;  1XF5 L;  4DXG A;  2ACZ B;  3AED B;  4JPS A;  1K51 A;  3RPF C;  3ABV B;  1SBB B;  1D5X C;  2MJE A;  2N9L A;  1XLP A;  1XCT L;  4ARI A;  4US9 A;  1YJI A;  4TSS A;  3FIL A;  4HJG E;  2KQ4 X;  1B9R A;  4KKJ A;  5TSS A;  2WQY B;  3OWE B;  4ZHP A;  1DGJ A;  4UDU C;  5LNK 1;  1R7S A;  3Q8C A;  1XEE A;  2I2Y A;  2L52 A;  3P42 A;  3TEY A;  1GB4 A;  3BYY B;  2BTE A;  1XO3 A;  3Q8A A;  1FRR A;  1K50 A;  1MVK A;  2VZK B;  4MAC A;  2LEK A;  4XDD A;  1ZDV A;  1SE2 A;  1NEK B;  1GB1 A;  3AEB B;  4WUR A;  2D5G A;  1M4V A;  1BML C;  1FXI A;  3R2I A;  1YQ3 B;  1QKZ A;  4C7Y A;  1MHX A;  1QLB B;  4MM3 B;  2G1E A;  3BK1 A;  5HHD G;  2J52 A;  2PKO A;  3N9Y C;  1TY0 A;  3NVV A;  4NAM A;  2PIA A;  2J53 A;  1FNU A;  3PO0 A;  1D6E C;  1KTK A;  2BBC A;  1FFU A;  2DWQ A;  1TY2 A;  3BK2 A;  1E6E B;  1AWD A;  4WIP A;  2LJI A;  5AUK A;  1JWB D;  3TUO A;  1MI0 A;  1FIQ A;  3CWI A;  1C4C A;  1NEN B;  2GRI A;  3TEX A;  1FCC C;  4FXC A;  3T3O A;  3VRB B;  3B2F A;  4YTM B;  2LUM A;  1VZ8 A;  1SF0 A;  3LB8 C;  3U4E G;  3W1S A;  3ZYY X;  4JE3 B;  4DXF A;  1AYF A;  1KLU D;  2INN E;  4YXD B;  2EKI A;  1FCL A;  1ENF A;  5D3D A;  1L0Y B;  3FAH A;  5C2T B;  1C4P A;  1L6U A;  2PVO D;  1JQ4 A;  5D3I B;  1FRD A;  1V97 A;  3U2S C;  1RWS A;  3AE4 B;  2RMM A;  3AM9 A;  2K3U A;  3HRD D;  3HUI A;  1ZUD 2;  2YEP F;  3NUH B;  1ZE3 D;  2WXR A;  3KQ4 A;  1OQR A;  1D4B A;  5G5H A;  2FBW B;  3E9S A;  1TS3 A;  1IUE A;  2DYM A;  2LHE A;  1JML A;  1VLB A;  2Y5P A;  1QQR A;  2K5P A;  1XLN A;  4NAW B;  1OQQ A;  4B0E A;  5EE3 A;  1I4H A;  1TKG A;  1YQ4 B;  4OZC A;  1JWS D;  3B9J A;  2MJ3 A;  5G5G A;  1TKY A;  1CZP A;  1F2R I;  3W5V B;  1WYG A;  4XWW A;  2WDR B;  3NZ3 A;  2WXJ A;  2QIE B;  1KF6 B;  5E6J A;  5T8I A;  2EEL A;  3VR8 B;  2BB6 A;  3P1M A;  1EWC A;  1V8C A;  2JXT A;  2W3S A;  3BWU D;  1J7B A;  1V1P B;  2WDQ B;  2R61 A;  1N5X A;  1TYG B;  4YSZ B;  3ZJT A;  1Y56 A;  2ZW1 A;  2KWD A;  1TZO A;  2LGI A;  1QT9 A;  1LO5 D;  2KDM A;  3AE5 B;  1FO4 A;  1D5Z C;  2SEB D;  1ZP0 B;  4TQ0 A;  2TSS A;  2L32 A;  2BS3 B;  1EU4 A;  3V3X A;  4HRO A;  4US8 A;  3R8B A;  1UWM A;  4C56 C;  1XCQ L;  4L1B A;  4H2A A;  2Y3A A;  3P4P B;  5C3J B;  1SJE D;  1E9M A;  3NVY A;  1UNS A;  2N0S B;  5D7G A;  3VR9 B;  2E6X A;  3IT4 B;  2ON8 A;  2N9K A;  3PZ7 A;  4C80 A;  2I38 A;  1K53 A;  4IKG A;  2WXP A;  4N6E B;  2WXH A;  2V0G A;  1WRI A;  4ARC A;  3LXF A;  4A8X C;  2GB1 A;  1N5W A;  2J4X A;  2E3T A;  2WU5 B;  3Q8E A;  2WXQ A;  3DWG C;  3ZJU A;  2HTM E;  1HEZ E;  1WWT A;  1IBX B;  3IT6 B;  1PFD A;  3AEE B;  3AB5 A;  2IPK D;  3HVZ A;  1STE A;  2L1A A;  4ITK A;  3DWM A;  1FFV A;  1E0Z A;  4YTN B;  1UGJ A;  4Q2J A;  3BII D;  1QOB A;  2XN9 C;  4AS1 A;  2AQ3 B;  4N58 A;  5I4D A;  5HG2 A;  1J7C A;  3LYY A;  3O13 A;  2INP E;  2CJO A;  2JSV X;  1SSN A;  4DQO C;  1FM0 D;  1JWA D;  3P4R B;  4P16 A;  1PGX A;  4R3D A;  4OVZ A;  4IDI A;  1J7A A;  1PGB A;  3AEC B;  1NVI D;  2KN4 A;  4J3O D;  4B0M A;  1V1P A;  3ETR A;  1SXT A;  1JWM D;  5BMG A;  2ICI A;  2LMC A;  4USA A;  1IGC A;  1WGK A;  2GI9 A;  2RDG A;  1KLG D;  3GS2 A;  1ESF A;  3R2T A;  1I4X A;  1NYR A;  1IGD A;  1V1O A;  4CQN A;  1HZ5 A;  2IDY A;  1QIL A;  2WU2 B;  3AEA B;  3B2G A;  2H89 B;  2WXO A;  1ZOY B;  3AE1 B;  5BYR A;  2MH7 A;  2JYE A;  3MHZ A;  3PZ8 A;  2W55 A;  5FKA C;  2JX5 A;  1N61 A;  4LK0 M;  2NMQ A;  1GAQ B;  1ZDX A;  1L4Z B;  3BYT B;  1T6B X;  2V3N A;  4GDL B;  1NYQ A;  1XXG A;  1YN4 A;  2IGH A;  3VRA B;  1T3Q A;  2AQ1 B;  4GDK B;  5FR3 A;  2CJN A;  2RDH A;  4WQM A;  3GP7 A;  1SE3 A;  3MP9 A;  1WSP A;  1K52 A;  1XLQ A;  3AE7 B;  2WP9 B;  4M0W A;  1FEH A;  1IBX A;  1L5P A;  1PGA A;  2H88 B;  2N7J A;  2VZK D;  3NRZ A;  4XWT A;  1I4Q A;  1EWY C;  2AX5 A;  2PMV A;  3AEF B;  3E56 A;  1L6V A;  3MC0 B;  1DOI A;  3AE6 B;  3ZQ4 A;  2JQR B;  3BVG A;  2QMT A;  3IXS A;  1RYJ A;  4RNA A;  1AW7 A;  3C8Y A;  1SB3 C;  1P7E A;  2BS4 B;  5H92 C;  3NS1 A;  2FE8 A;  4WAF A;  3WCQ A;  4KGS A;  1QF6 A;  4JWS C;  1ACC A;  1RM6 C;  2CU3 A;  1WXQ A;  3URY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...