3RPFC

Protein-protein complex of subunit 1 and 2 of molybdopterin-converting factor from helicobacter pylori 26695
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
74
structure length
74
Chain Sequence
MMVEVRFFGPIKEENFFIKANDLKELRAILQEKEGLKEWLGVCAIALNDHLIDNLNTPLKDGDVISLLPPVCGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdopterin synthase catalytic subunit
publication title Protein-protein complex of subunit 1 and 2 of Molybdopterin-converting factor from Helicobacter pylori 26695
rcsb
source organism Helicobacter pylori
molecule tags Transferase
total genus 11
structure length 74
sequence length 74
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3rpfC00
1TJEA 1FFVA 1QOFA 1UWMA 1J7BA 3SFDB 4C80A 4JWSC 5H8YE 1FIQA 2MH7A 4YSZB 4N58A 2JX5A 2H89B 3HRDD 1WXQA 2MJDA 4KX6B 2Y5CA 5AUKA 1FFUA 1ZOYB 3PO0A 2PVGC 1KRHA 1L5PA 3P63A 3VRAB 5C3JB 1PDXA 1QF6A 4ZOHC 1TYGB 3AH7A 4ITKA 1DOYA 2K22A 2QIEB 4A9AA 1DGJA 1TKEA 2G1EA 1JROA 2B76B 1EWYC 1FM0D 1FMAD 2BT6A 1N60A 1SF0A 2DWQA 2H88B 2WS3B 3AMZA 4LTUA 3VR8B 4YTPB 3AEFB 4YSXB 2WQYB 4YXDB 1GPXA 1I7HA 1R7SA 3SFEB 1A70A 1XLNA 3AEEB 3EUB2 1E10A 1JQ4A 1V97A 4FXCA 1FXIA 4P6VF 2JQRB 2E3TA 4N59A 1WGKA 1N63A 2N0SB 5EE9A 1XO3A 1CJEA 1VLBA 2BS4B 3CIRB 3P4SB 5EE3A 4YSYB 3W5UB 3B2FA 4JX1C 2FBWB 3WCQA 2WDQB 1FXAA 1PUTA 1YQ3B 1N62A 1J7AA 1ZXIA 3AE1B 3AECB 4C7YA 5H92C 5C2TB 2LEKA 1WWTA 3L4PA 3LB8C 1J7CA 3AN1A 2OHFA 3NVVA 2WLBA 3NRZA 1NYRA 1L6UA 2L83A 3P1MA 3AB5A 1RFKA 1FO4A 1E9MA 1JRPA 5EE1A 3W9CB 1DOIA 1AYFA 3DWGC 1FRRA 2DBYA 1ZP0B 1L0VB 2KMMA 4USAA 3BIID 1YJIA 3AEDB 4HRSA 3AEAB 3FAHA 3NVWA 4YTMB 3P4PB 1NVID 1PFDA 3AM9A 1QOAA 1RM6C 2WP9B 4YT0B 2WU5B 1NEKB 5MPOA 3AE3B 2MJEA 3B2GA 3KWLA 3RPFC 3VRBB 1B9RA 1AWDA 3AE7B 2WDRB 2WDVB 3NVYA 4ZHOA 1JWAD 3AE9B 3AE2B 1ROEA 5AUIA 2W55A 5G5HA 2PVOD 4WWMA 2K9XA 1VJKA 2Q5WD 3FC4A 2WU2B 3HVZA 1XLQA 2MJ3A 1XLOA 1OQRA 5EE0A 4YTNB 1V8CA 2PIAA 3AE4B 1YJJA 1YQ4B 4N6EB 1NYQA 3NS1A 1JALA 1QT9A 1T3QA 1E7PB 2CJOA 2PKOA 4US9A 1N5XA 5G5GA 2CJNA 1TKGA 3AEGB 4US8A 2CU3A 1E0ZA 2BS2B 3ZYYX 1WRIA 5GXGB 3CWIA 3AEBB 2L52A 1NI3A 1ZUD2 3AE6B 1N61A 3W5VB 1QLBB 3P4RB 3ABVB 1FRDA 1TKYA 2W54A 2W3RA 1OQQA 1OFFA 2AX5A 2KAJA 1QOGA 2M19A 3NVZA 3HUIA 2HTME 3DWMA 4HROA 4IDIA 1XLPA 1VDVA 1KFYB 2ACZB 3B9JA 2W3SA 3LXFA 4JWUC 4WQMA 1N5WA 1L6VA 1JWBD 1RWSA 1RYJA 1SIJA 1CZPA 2BS3B 2K5PA 2M56B 1SB3C 2QJLA 3AE8B 3VR9B 3SR6A 1DOXA 3ETRA 1KF6B 1NENB 3AV8A 1WYGA 2EKIA 1F0ZA 1JW9D 3AE5B 4C7ZA 1E6EB 4ZHPA 1QOBA 1IUEA 3P4QB 1GAQB
chains in the Genus database with same CATH superfamily
3V6EB 2WXKA 2BF8B 2G45B 3NUHB 4A55A 3PPAA 3TUOA 4HJKA 2G3QB 3R7QA 4BOZB 2I2YA 3Q3JA 3U8ZA 3RNFC 3NY5A 2X8XX 4OW0A 1DOYA 2L3ZA 1TKEA 2IPKD 1WX9A 3TBLD 3R2TA 4MJSB 4GXBA 4BVUC 1FCCC 1I4RA 2FIFA 3PV1A 4EOYA 2E3TA 2VZKD 3P4SB 1V1OA 2WWZA 2N1WA 1UZXB 1Q5WB 3RZWC 2KTFA 1QKZA 4B6WA 1J7CA 2QILA 3AB5A 1E9MA 2RDBC 2KN4A 1GJZA 4W9CA 2NMQA 3BIID 5J17A 1GUAB 1NVID 2GB1A 3AE7B 1JWAD 5AUIA 2W55A 1VD2A 3C8YA 3A9JA 2PTLA 2J4XA 1WM3A 5EDSA 4FADA 2AL3A 5DPSA 2KFKA 4US8A 4KZ0A 2KVZA 3CWIA 4WURA 5G55A 4M02A 3TSSA 1OQQA 1E8WA 3TEWA 1UD7A 3WAPA 3PLUA 1RAXA 4NQLB 1SB3C 4IC7B 4BKSA 2AWTA 1QOFA 1MHHE 4WJOA 2Y3AA 4GMVA 1C4AA 4D2KA 4G50A 3BWUD 3PO0A 3A9KA 3KQ4A 3W2DA 1I35A 2IO3B 1TBEA 4BBNF 2OEDA 1FM0D 1GOZA 1IPGA 2H88B 2ZZPB 2FUHB 2M17A 1LM8B 1C3TA 3R3MA 3GZNI 1FXIA 3E9SA 2FBWB 5GMVA 2KACA 1SJED 4GLSC 5C2TB 3H7SA 4A6QA 1YX6B 3AN1A 2OHFA 2FCMA 3NRZA 1YX5B 2J53A 4A90A 2INDC 2LJ5A 2KQ7A 1WFYA 2IY1B 4QAYA 3RT3B 5EE1A 2B3AA 2J52A 2JYEA 1AYFA 1YN3A 2WDTB 1ZP0B 1C4CA 2W82A 2MBHA 2N9XA 2M4NA 1PFDA 1WE6A 4AWJA 3HK0A 1Y8RC 1KM7A 1MPEA 3PT2B 4RM9A 3VH4B 3H7PA 1E5WA 2LMCA 1XLOA 3D32A 4ZRJA 5T8IA 2ZVOA 4XYCA 4EEWA 2IGGA 1T0SC 1D4BA 2UU7A 2V3SA 1LO5D 4MGYE 4K7UA 2LGYA 1VZ8A 3BK2A 4RFBA 1K8RB 1TS5A 5E6PA 3AE6B 1N61A 3JSVB 5DPRA 4IWOA 3A9JB 2CR5A 4E71A 3H9DA 4GN1A 1SE3A 3PLVA 4DDGD 3LDZE 2M56B 4TQ0A 3RFZB 3ZXVA 3QC8B 2X38A 4JE3B 4W9FA 3I5JC 4YTMB 1GAQB 1FFVA 2VH1A 3KUCB 1V1PB 3W1SC 2GBNA 5CHVC 5IO9A 3R66C 5AUKA 1MJDA 2RSUA 3VRAB 3PRZA 4MT5A 4IW0A 1JROA 1FMAD 2DWQA 2C60A 3M95A 3JVZX 4NAMA 3EHVA 3VHTC 4BKSD 2RD0A 1I4HA 2JT4B 2DENB 2ZCBA 1CJEA 4MDKE 4BBNC 2WDQB 2BB6A 4BFRA 1J7AA 2LGIA 3AE1B 2BVCA 2HE7A 3APCA 4AP4C 1FNVA 3TJPA 2INNE 2DYMA 5G2NA 2L83A 5CX3A 1TS3A 2IO1B 3DVNU 3UQAA 2N9LA 4TSSA 1DOIA 3DDCB 3N1XC 2L00B 4RMAA 3V6CB 4IOIE 1D6EC 2V3PA 2KVRA 2Y5PA 3DPDA 1VJKA 4URKA 3NZUA 1XLQA 2KOXA 4DXFA 3QK0A 1FEHA 1FNUA 1ZE3D 2KFJA 3URYA 3A1QB 3BK1A 3W1YA 4LK0M 3QAQA 1SBBB 4IM2A 4WQMA 3ZRFA 2KMAA 2M8SA 3PHWB 1DOXA 3O65B 2K8CA 1WJUA 4MGIE 3CSFA 4LCDE 4BZAA 4W9HA 4K7WA 4HDOA 2LVQA 1T0RC 3UIOB 4XDDA 4HPLB 2CU1A 2ON8A 4DHJB 1WH3A 2KLGA 3ZIMA 1UBIA 2V0GA 2BWFA 3V61A 1DGJA 2KZRA 2G1EA 4DHZB 2WS3B 3LYYA 3UINB 2O2VA 3AEEB 1F2RC 4XWTA 3VTVA 4IUMB 3IAS1 2C5LC 4IG7B 4HJGE 1ZPSA 2O6VD 1V6EA 3V3XA 3N1YC 2KJHB 3U4EG 3NVVA 3HVDA 3NJTA 3Q69A 3FKYA 4RGNA 3RNCC 1EUVB 4AS1A 1L0VB 4BAXA 1VZ7A 4ZRKA 3SHQA 5LXHA 3DVNV 3AM9A 2BTEA 1TZ1A 3KVFB 1UF0A 1HZ5A 1VCBA 4B95A 2D07B 5G5HA 4WWOA 4WWMA 2K9XA 4RF0A 2BW2A 1YN4A 3QQ8B 2IGHA 4G3XB 4FN2A 3PVLA 4PS3A 1NYQA 5AZHA 4KKJA 3IXSA 2JUOA 1PGXA 3ZDMC 1CK1A 1C77A 3CMMB 4M0WA 2MP2B 2FIDA 1R4MI 1CQVA 3QA8A 2LGSA 1CZPA 2CHXA 1UGJA 4HLEA 2QJLA 1WZ3A 4PS7A 5TSSA 4DBGA 2HTHA 1HTOA 3GS2A 1VRAB 3PREA 2KQSA 4KX6B 5D6JB 2RDGA 4M01A 2J7QB 2FAZA 1S1QB 4W9GA 2E6XA 4ITKA 2A5UA 4BOSC 4E3CA 1SEBD 1V81A 1WF9A 1YN5A 2VH2A 3AEFB 4KSLC 2G9HD 1E10A 1YQBA 2IZVB 5EE3A 1XD3B 4MJSA 3B2FA 4KGSA 3WCQA 4MSQB 3AECB 2KTRA 4GSWA 1P3QU 2REXA 4DK5A 4HKQA 1V5TA 4ANWA 1FO4A 2MWSB 2NTSA 2LRWA 2Z8LA 2KMMA 4F8CB 4W9IA 5DCNA 1D5MC 5AZGA 3DBRI 1QOAA 4YT0B 3AE3B 2MJEA 1Q1OA 3VRBB 3KWVA 2YEPF 1K50A 2WDRB 2GLSA 1GB1A 1I4QA 3WIMA 1NDDA 4ICVA 1EM7A 2CJOA 5FR6A 4US9A 5G5GA 2CJNA 1WJ4A 1YIWA 2UWQA 2D11A 2W3RA 1JRUA 3Q3FA 2ICIA 4M00A 1BUIC 1TY0A 2W3SA 1KTKA 1E7VA 3QX1A 1PYWD 5HI1A 1F0ZA 1JW9D 4FULA 3B0AA 3MHSD 4HKZE 2CS4A 2MEKA 3WA0A 2LD9A 4GOCA 4Q2JA 4N9F4 3WAMA 2D5GA 4JWSC 4LJPB 2KT7A 2ZNVB 5HFYA 1TZOA 2D3AA 2XK5B 2RMMA 5C3JB 4OVVA 3L54A 2KLCA 4ZOHC 3U7ZA 2ONQA 4NAWB 1C4PA 1EWYC 5BO4B 4II3B 2BT6A 5I4DA 3L0WB 1LFDA 3QWZB 2WX0A 2N0SB 3CIRB 3W5UB 3KUZA 3PS6A 2LRUA 3WALA 2WNMA 4NZLB 1NI2A 1RFKA 3X23A 4FHJA 2JVCA 4WQOB 4EZJA 1KH0A 2TSSA 1E90A 2KHWB 2KTRB 1XCTL 4ICUA 4H2AA 2MQJA 3PZDA 1K53A 1WIAA 3ZXRA 3RNGC 4A8XC 5MPOA 2N9KA 3IHPC 4XZ4A 2LGDA 4J3OD 1ROEA 4E74A 3MTNB 4XC2A 5DPTA 3MHZA 2Q5WD 4B9KA 2MW5A 4LNOA 2Z59B 1ZGUB 4YTNB 1OTRB 3AE4B 3TEXA 3VUXA 4EKUA 1ESFA 3CF6E 1WR6E 3AEGB 3S2AA 2CU3A 3T9LA 2BS2B 3DHGC 1LQBA 4AOFA 1FRDA 4WWNA 2W54A 3JSVA 2BBCA 2XN9C 3ML9A 3SD5A 3PHXB 1AW7A 1QOBA 3P4QB 3E56A 1UWMA 4PYZA 1PGAA 3HRDD 1V49A 1XCQL 2PVGC 3U30A 1V1PA 4PS8A 3AH7A 3U7DA 4RGOS 5D2MB 1XQQA 4WIPA 4KGTA 2KC2A 4X57B 2AQ1B 4YSXB 3AULA 1R7SA 2KKCA 1XLNA 5J18A 1N6ZA 2ZJDA 2I38A 2BWES 3ZTDA 2SAKA 2D2QA 1ZXIA 2KWCA 2L0FA 4XE0A 3EGRA 2KNBA 2XBBC 1QZEA 3MFGA 3DBHI 4M8NA 2WXJA 1WSPA 4NY0A 3ECIA 2DYBA 4LNKA 2IBIB 1HA5A 1WMHB 3NZSA 4F1SA 4NQKE 1YMHE 2WU5B 3Q8EA 1HE8A 3B2GA 3KWLA 4JQWC 2JYTA 2KDMA 2J0JA 5IP4D 4XDCA 1AARA 5LXIB 4KZCA 2KYWA 4GDLB 1S3SG 2NBWB 1XEEA 4WWPA 1TKGA 4WAAA 2RPQA 4MEMA 3VTWA 1WGYA 1WRIA 3P42A 4CHKA 2GBJA 1B1ZA 3W5VB 4A3PA 1TKYA 1P9DU 1WGRA 2JF5A 2QEJC 4BKTA 5D3IB 5JH5C 4MELA 2LHDA 4JLCA 3A1QA 5D3DA 1SIJA 3VR9B 5HG2A 3T3NA 1SE9A 1MG4A 2WXRA 3WAOA 3IT6B 4K7SA 1DYQA 1V9JA 3RCZA 3RD2A 2IYDB 2ASQA 4UDUC 3A4RA 1WZ0A 2IY0B 2V4LA 3ZJUA 1ZW7A 3I9V1 2HDEA 2LXAA 3SEBA 2B76B 2WXFA 3KUDB 2L7RA 2LGXA 4G11A 2V4IB 2KDEB 1GC7A 2PMVA 4B0MA 1UBQA 2BS4B 1GNUA 3VXWA 2GBMA 5BYRA 2K0PA 1MFWA 2CKHB 4ZRQA 3L13A 1T6BX 4FJVB 1YNTE 1PQSA 3DHHC 2V1YA 3W9CB 2INCC 2J0KA 3PRPB 3DWGC 3VDZA 3DBLI 2DBYA 5LNK1 1K52A 3AEDB 3N3KB 2G4SA 4ANXA 5JHBA 3NOBA 1OQYA 2QHOA 1R4MB 4AJYB 4KDIC 2I1JA 2WU2B 2KK8A 2JXTA 2KDIA 1TS4A 1YD8U 1V8CA 1WJNA 2PIAA 1HXYD 2NR2A 3NZ3A 2PKOA 3H8HA 1JCKB 3IBEA 4MM3A 4OZAA 3K9PB 4RGTA 1QLBB 1IGDA 4C4VB 4JIOU 2ZVNA 3IAM1 1OFFA 1R4NI 2QSDA 4RGMA 5BYQA 1ENFA 4A3OA 2WXQA 4K81A 1L2NA 3TIXA 4NJ7A 2DNFA 2YVCA 1WYGA 2MP2A 3EFUA 1UH6A 3OG5A 1H4RA 4ANVA 4S17A 3ZNZB 3U52E 2MH7A 2QCZA 3AXCA 2LVOA 1Q10A 1YOVB 2KWUB 4DWFA 4NNJB 3VVWB 3ZO5B 3PTFC 1TYGB 3APFA 2K22A 2QIEB 3M62B 1SXTA 4LTUA 2M0AA 2LZ6A 3SFEB 1F9JA 1XT9B 3KLSX 1WJ6A 3IT4B 1OGWA 5BMIA 3OWEB 1WXMA 3DBRB 3M3JA 1ET6A 4CYEA 4EUTA 1WXSA 5H92C 1SE2A 2K6QA 1KLUD 2DZMA 4LNNA 2C7NB 1E8ZA 4WJNA 4DHJD 2WXHA 4MH0E 4TKNA 1NBFC 2JSVX 2C9WB 4DHZE 4YL8A 3AEAB 3NS8A 3P4PB 2ZEQA 3IFWB 1NEKB 1B9RA 4M8MA 2LWPA 3AE9B 4IKGA 3B1LX 2BYEA 2MA9B 3ZNGC 3HVZA 1F77A 2EELA 4JGHB 4PT5A 1D3ZA 1YJ1A 2KJRA 1YJJA 1YQ4B 4N6EB 3T8MA 3NS1A 1WM2A 1GB4A 1T3QA 1C76A 2PW9A 2L1AA 5LLIA 5GXGB 4YWGG 3ENEA 4DDID 3BINA 3B9JA 1KFYB 4JWUC 1JWBD 2C7MB 2LXCA 2IGDA 3DQVA 2LASA 4JPSA 1C1YB 1KF6B 1NENB 3AV8A 4C00A 4I6NB 4MM3B 2R2OA 1TJEA 2KDBA 3MC8A 4YSZB 4ANUA 3UQBA 2KO3A 2A4ZA 2Y5CA 3ZQ4A 2RGFA 1FFUA 1TY2A 1WGGA 1ZOYB 4O1NA 3IVFA 1F2RI 4A9AA 3VTUA 2INPE 1EO6A 2XK5A 1N60A 2CHZA 4YTPB 3VFKA 3C0RB 1FPYA 1I7HA 4ASWC 3M63B 3EUB2 2JXXA 1L7YA 4NAWA 1JQ4A 3NG0A 5KHQA 5EE9A 4DXAB 2FUG1 2PEAA 3VQIA 3Q6BA 4KIKB 3V60A 2LUMA 2HD5B 2VRRB 1N62A 4EZLA 2K1FA 2MBOA 4RF1A 4DXGA 3ZNHB 4EFOA 4HVBA 3BYYB 3OJ4B 4AJWA 1P1AA 3QARA 2QC8A 2LVPA 4B0EA 1YJIA 1BXTA 3ZLZA 1RM6C 1CMXB 2MSED 5E6JA 4P7IA 5FKAC 2FE8A 3DHIC 3H6NA 1IGCA 2KMCA 2MBQA 3HIZA 3PGEA 1F1HA 2DAFA 1I4GA 2K25A 2SEBD 4LDTB 3AEBB 3L10B 2KDFB 5FK9C 5E6NA 2KQ4X 3ABVB 2MBBB 2IJ0A 3EECA 1QOGA 2M19A 2HTME 1RFAA 2ACZB 4XX5A 1N5WA 4TUUA 1FD6A 3ETRA 2EKIA 3UIPB 4JL9A 3L08A 1C9FA 2LUEA 1T0YA 4C80A 3RNEC 2BYVE 3P63A 3RULA 3OAWA 1AN8A 2V3NA 1ZDVA 4WAFA 2IO2B 1OEYA 2HJ1A 2ZW1A 3BYTB 2PLPA 3GZNB 1M94A 3V62A 4ZRIA 3EA6A 4FHKA 1PGBA 1PUTA 4RCOA 5IOIA 2FCSA 2NCNA 1JMLA 1L6UA 3QJZA 4IWQA 1EU4A 2LFIA 1JWUD 1XF5L 2OJWA 4PK1A 4RNAA 3FILB 2L8JA 2AEHA 4HRSA 2GI9A 5BMHA 1UWXA 4GIVA 3J9CA 2L0TA 4HPPA 2MBEA 4OVZA 4WJQA 1A5RA 1FCLA 1H8CA 1D5XC 1AWDA 4ARIA 4KGRA 4J6IA 1RRBA 3N30A 3NVYA 4L2YA 4ZHOA 1WMHA 2NS5A 1TIFA 3PZ8A 3X0WA 1Y56A 4I6LB 1N5XA 2CHWA 4GDLA 3UGBB 4KKIA 3P4RB 4IDIA 4K3BA 1VDVA 1TTNA 4TV3A 2VZKB 4HROA 2K5PA 3VUWA 1RWSA 1RYJA 1WX7A 4OZCA 2ZCCA 1GG3A 2D10A 3DBSA 4ZHPA 3Q2AC 3Q3MC 2V9HA 3U2SC 1LGRA 4A20A 4KDLB 2BQQA 3GB1A 4LLGM 2DHZA 4GDKB 3QIJA 3KYCD 3VR8B 1FNWA 4I6PA 2WQYB 2AYOB 3DBLB 1A70A 1TS2A 2WXOA 1E7UA 1K51A 4HCNB 1D5ZC 1VLBA 2DZIA 4NJ6A 4REZA 4XWWA 2Z0EB 1YQ3B 1J8CA 1KJTA 2RDHA 5BYSA 3R7RA 3JW0X 3ZTCA 1V80A 2WLBA 3B08A 3P1MA 2XEWA 1IBXA 2L76A 1UUPA 2QMTA 2ZNVC 2KC1A 1FRRA 4IM3A 3IG3A 4USAA 1UGMA 1HEZE 2QDFA 3UI3A 3NVWA 2NPTB 3P2BA 2N4FA 2D3BA 4L1BA 1TT5B 3DOWA 2BKFA 2JY6A 1R4NB 4OVUA 3BVZA 4P16A 5CHFA 2JRHA 4CO7A 2MJ3A 2JU6X 3A4SC 4KVGB 4WH4A 3BVMA 1WYWB 4FBJB 3ZKJC 2EKEC 5TR5A 3ZGZA 4GU2A 2BGFA 2OOBB 3TL5A 3VUYA 3LXFA 4MGKE 1WGDA 1P7EA 3ONSA 4C4VA 3R2IA 1P98A 5DPWA 2MRPA 1SGHA 4N58A 1Z5SB 2JX5A 1WXQA 2LJIA 3HHMA 2WXLA 1L0XB 1L5PA 1V2YA 1MHXA 2EMTA 3L17A 3MP9A 5CTRC 1MI0A 4YXDB 4TQ1A 2I1KA 4FJYA 3RN9C 5CHWA 1I4XA 2Y5BB 1N63A 3BVGA 4IM0A 3ZUNA 4RH6A 3CSTA 4JX1C 3RNBC 2J42A 3RUIB 4GGQA 4W9DA 2LEKA 1OEYJ 1WWTA 2WHIA 2NBVB 3LB8C 4C56C 2BPSA 4CQNA 1HTQA 1WRDB 2WYQA 3L16A 5JXVA 2RPVA 3DVGY 3ZNID 1V86A 4HPMB 1WX8A 1IBXB 2K8HA 2WDVB 3R8BA 2PVOD 3AI5A 4HK2A 3TEYA 4OHJA 2KFKB 2JWUA 2NTTA 5EE0A 1JWMD 3Q8AA 2WXPA 4ZYNA 2C7HA 3HM6X 1QQRA 5J2RA 1MG8A 1NI3A 2O6VA 3N1ZC 5FR3A 1WGHA 1T0QC 1F52A 5C23A 2KJ6A 3WANA 4W9KA 3SR6A 3JYUA 4AUQC 1EF5A 1FXTB 3AE5B 4C7ZA 1C79A 2DZJA 2G4DB 2PE6B 3TEZA 2GBRA 3A9KB 3ML8A 2MCNB 2BB5A 3QHTA 2W9NA 1SIFA 2KWDA 2HJ8A 2DLBA 1WR1A 1ZKHA 2PE9A 1PDXA 3H1UA 2BKRB 2PPHA 2WXIA 3N9YC 1UNSA 2K39A 1V97A 3GOEA 4FXCA 1SSNA 3Q8CA 1HZ6A 3ZDTA 3KW5B 4YSYB 4HWIB 2ZW0A 4NJCA 1FXAA 2LHEA 4C7YA 1L4DB 2N7EA 3GE8C 3O13A 4KIKA 4L23A 4HDQA 2OJRA 3N20C 4MGZE 3C19A 1STEA 4GB9A 2Z0DB 5E6OA 1KOTA 2KXJA 4EZKA 3FAHA 2K8BA 2AL6A 3H7PB 1WY8A 2XNAC 3T3OA 1ET9A 1M4VA 2ZPYA 4F7ZA 5HKHA 3DCGA 1OQRA 2KX0A 4W9EA 5IAAC 2MX2A 4FA6A 4LNFA 2JRIB 3SDLC 2L32A 3RI7C 1J0GA 1HQRD 2L52A 3Q3OC 1ZUD2 1SE4A 3Q8FA 1KLVA 1I42A 4NPNA 1T5XD 3HUIA 3DWMA 3N32A 3UF8A 3ZJTA 3AE8B 3RNAC 2M0XA 4TMAB 2J0MA 3A33B 3VAWA 2IDYA 1ISNA 1XLPA 2O6VB 1IUEA 5HHDG 3SFDB 3OJ3A 4G0NB 3KH0A 2MJDA 5IA7A 2GMIC 3ZW3A 2KN5A 1QF6A 4DQOC 2KD0A 5L95C 1RLFA 4R3DA 1SJHD 4K3CA 4N59A 3MJ5A 3AMZA 1SF0A 3K9OB 2N7DA 1GPXA 4MH8A 2M1MA 2N9PC 4P6VF 2JQRB 1WGKA 1C78A 1L4ZB 3OLMD 5JHAA 1Z2MA 5JZEB 1Q0WB 1E8XA 3ZVVA 4EE2A 4P1CC 1NYRA 3V05A 3BY4B 2KWVB 2PJHA 4KSKC 2WXGA 2KX3A 3RYTA 1EWCA 5D7GA 1XXGA 4HCPB 4FLHA 1UELA 1GC6A 2WP9B 3HM3A 4XGAB 3FILA 1VZ6A 4ZRPA 4HXDA 1G6JA 3KYDD 4ARCA 2L05A 3Q14C 1MVKA 3FC4A 4W9LA 3Q8BA 1VR9A 1I4PA 4MACA 4FJZA 4II2B 3SU8X 1JALA 2N9EB 1QT9A 1E7PB 4LJOB 5BMGA 5D94A 2AQ3B 1WXVA 5KHOA 3ZRCA 1P0RA 3PRMB 3MJWA 2K6DB 2FCQA 2AX5A 3NVZA 1L6VA 2BS3B 3QCAA 3GP7A 4W9JA 2IO0B 1L0YB 4RM8A 2R2QA 2JZ3B 2WGSA 1LXDA 3PZ7A 5IKCM 1J7BA 1FIQA 1WI0A 2FNJB 2H89B 3I63C 1EU3A 2DAJA 1KRHA 2D3GA 2GBKA 3GE3C 3ZJVA 2O2VB 2LI5A 4LDTD 1J19A 2NBUA 4GDKA 2WX1A 1WXAA 2ZPNA 4ACFA 2N7JA 4ZDVA 2WXNA 1X1MA 5AZFA 1E8YA 1XO3A 4HEA1 3LJ3A 3PSEB 4KV2A 2JZPA 2WXMA 4MSMB 4PYUA 1ACCA 3RMKC 2YEPB 3L4PA 4WJPA 3ALBA 2GRIA 1JRPA 3DBHB 2NVUI 4S0RA 5C1ZA 3VH3B 1EF1A 2D3CA 5L83A 2JPHA 3AU4A 3RZFA 1WE7A 3TMPB 1ZXHA 3AU5A 2BYTA 3APDA 2DX5B 2FCNA 4P1BC 3DVGX 5AEKB 3I3TB 2AQ2B 3RPFC 2UYZB 3AE2B 4AQ7A 2NPTA 4ZYSA 1IYFA 4K1RB 4BKGA 3TCAA 3MC0B 1QILA 3W1SA 2R61A 1ZDXA 2K3UA 2MLBA 4M0WB 1E0ZA 2BYFA 2JZZA 3ZYYX 3EC8A 2KANA 4LNIA 2DZKA 2JWZA 2RR9A 1TGZB 1IP9A 2EMSA 1BMLC 2DYOA 2KAJA 1KLGD 2YLMA 1V5OA 1P7FA 3I57A 4IWPA 3MC9A 5H8YE 3Q3NC 3BZDB 2MHJA 3NHEB 1U4AA 5IN7A 2N1VA 1BT0A 3EFCA 4OZBA 2GOWA 1E6EB 1JWSD
chains in the Genus database with same CATH topology
3U52E 2MH7A 2WXKA 3GS2A 1VRAB 4N58A 1Q10A 2JX5A 1WXQA 2LJIA 3NUHB 4KX6B 2RDGA 2WXLA 4A55A 3TUOA 1L0XB 1L5PA 2I2YA 1MHXA 1TYGB 2E6XA 4ITKA 4OW0A 1DOYA 2K22A 2QIEB 3MP9A 1MI0A 1TKEA 1SEBD 4YXDB 2IPKD 1SXTA 4LTUA 4TQ1A 2M0AA 1YN5A 3R2TA 3AEFB 2G9HD 3SFEB 1E10A 3KLSX 3IT4B 1FCCC 1I4RA 1I4XA 5BMIA 2E3TA 3OWEB 2VZKD 1N63A 3BVGA 3P4SB 5EE3A 1V1OA 4RH6A 1ET6A 3B2FA 4JX1C 4KGSA 3WCQA 2J42A 3AECB 5H92C 1SE2A 2LEKA 1WWTA 1KLUD 1QKZA 4C56C 3LB8C 1J7CA 4HKQA 2QILA 3AB5A 4CQNA 1FO4A 1E9MA 2WXHA 2NTSA 2KN4A 2JSVX 2Z8LA 2KMMA 2NMQA 3BIID 3AEAB 1D5MC 5JXVA 3P4PB 1NVID 1QOAA 4YT0B 2RPVA 1NEKB 2GB1A 2MJEA 3AE3B 3VRBB 3KWVA 2YEPF 1B9RA 3AE7B 1K50A 2WDRB 1IBXB 2WDVB 1GB1A 1JWAD 1I4QA 3AE9B 4IKGA 5AUIA 2W55A 3R8BA 2PVOD 3TEYA 4OHJA 3HVZA 1EM7A 1F77A 3C8YA 2EELA 2JWUA 2PTLA 4PT5A 2NTTA 2J4XA 5EE0A 1JWMD 1YJJA 1YQ4B 4N6EB 3Q8AA 2WXPA 3NS1A 1GB4A 2CJOA 1T3QA 1C76A 4US9A 5G5GA 2CJNA 4US8A 2PW9A 2L1AA 5GXGB 3CWIA 1QQRA 1NI3A 5FR3A 4WURA 4YWGG 3TSSA 2W3RA 1OQQA 2ICIA 3TEWA 1BUIC 3B9JA 1KFYB 4JWUC 1TY0A 2W3SA 1KTKA 1JWBD 2IGDA 1SB3C 1PYWD 4JPSA 5HI1A 3SR6A 1KF6B 1NENB 3AV8A 1F0ZA 1JW9D 4MM3B 3AE5B 4HKZE 2MEKA 4C7ZA 1C79A 1TJEA 4Q2JA 1QOFA 1MHHE 3TEZA 2D5GA 4JWSC 2Y3AA 4YSZB 1C4AA 2BB5A 4D2KA 3BWUD 5HFYA 1TZOA 2Y5CA 3ZQ4A 2KWDA 1FFUA 1TY2A 1ZOYB 2DLBA 2RMMA 3PO0A 4O1NA 5C3JB 1PDXA 4ZOHC 3KQ4A 1F2RI 3U7ZA 3W2DA 2ONQA 4A9AA 2INPE 4NAWB 1C4PA 1EWYC 1FM0D 1GOZA 2BT6A 1N60A 2H88B 2OEDA 5I4DA 2WXIA 4YTPB 3N9YC 1UNSA 1I7HA 3EUB2 1JQ4A 1V97A 4FXCA 1FXIA 1SSNA 3E9SA 3Q8CA 1HZ6A 2N0SB 5EE9A 3CIRB 4YSYB 3W5UB 2FUG1 3VQIA 2FBWB 2LUMA 2ZW0A 4NJCA 1FXAA 1N62A 2LHEA 4C7YA 1L4DB 2KACA 1SJED 4GLSC 5C2TB 4A6QA 2WNMA 4NZLB 3AN1A 2OHFA 3NRZA 3O13A 4L23A 4RF1A 2J53A 4A90A 1RFKA 4DXGA 3BYYB 5EE1A 2J52A 1STEA 1AYFA 2JYEA 1YN3A 1KH0A 2TSSA 1ZP0B 4B0EA 1YJIA 1C4CA 1XCTL 2W82A 3FAHA 4H2AA 1K53A 1PFDA 1BXTA 1RM6C 2XNAC 4A8XC 5MPOA 5E6JA 1MPEA 3T3OA 2N9KA 1ET9A 5FKAC 4J3OD 2FE8A 1ROEA 1M4VA 3MHZA 2Q5WD 1IGCA 2LMCA 1XLOA 1OQRA 5T8IA 4YTNB 3TEXA 3AE4B 2IGGA 1D4BA 1ESFA 1I4GA 2L32A 1LO5D 3AEGB 2CU3A 2BS2B 2SEBD 1HQRD 3AEBB 1VZ8A 2L52A 3BK2A 4RFBA 1TS5A 1ZUD2 3AE6B 1N61A 1SE4A 5FK9C 2KQ4X 3ABVB 1FRDA 3Q8FA 2IJ0A 2W54A 1QOGA 2M19A 1T5XD 3HUIA 2HTME 3DWMA 1SE3A 2ACZB 1N5WA 3ZJTA 2M56B 3AE8B 4TQ0A 3RFZB 2BBCA 1FD6A 3ETRA 4TMAB 2EKIA 2IDYA 2XN9C 2X38A 4JE3B 1AW7A 1XLPA 1QOBA 1IUEA 3P4QB 1GAQB 4YTMB 1C9FA 5HHDG 3E56A 1FFVA 1UWMA 3SFDB 1V1PB 4C80A 1PGAA 3HRDD 2MJDA 1XCQL 5AUKA 2PVGC 3VRAB 3P63A 1V1PA 1QF6A 4DQOC 3AH7A 4MT5A 4R3DA 4RGOS 1SJHD 1AN8A 2V3NA 1ZDVA 1JROA 3MJ5A 4KGTA 1FMAD 4N59A 3AMZA 1SF0A 4WIPA 2DWQA 4WAFA 2AQ1B 4YSXB 1GPXA 1R7SA 2ZW1A 1XLNA 4MH8A 3BYTB 4NAMA 2PLPA 2I38A 4P6VF 2JQRB 1I4HA 1WGKA 1C78A 1L4ZB 1CJEA 2SAKA 3EA6A 2WDQB 1PGBA 1PUTA 2BB6A 1J7AA 1ZXIA 2LGIA 3AE1B 4RCOA 4XE0A 3EGRA 1FNVA 4EE2A 3MFGA 1JMLA 1NYRA 2DYMA 1L6UA 2INNE 2L83A 3V05A 1EU4A 2LFIA 2WXGA 1JWUD 1TS3A 2WXJA 1EWCA 2N9LA 4TSSA 1DOIA 1WSPA 1XF5L 5D7GA 4RNAA 3FILB 1XXGA 4HRSA 1HA5A 2GI9A 5BMHA 1UWXA 3J9CA 4IOIE 1D6EC 2WP9B 1YMHE 2WU5B 3FILA 3Q8EA 4OVZA 1VZ6A 1FCLA 2V3PA 1D5XC 3B2GA 3KWLA 1AWDA 4ARIA 2JYTA 4KGRA 3NVYA 4L2YA 2Y5PA 4ZRPA 4ZHOA 4ARCA 2KDMA 4XDCA 1VJKA 1MVKA 3FC4A 3PZ8A 3Q8BA 1XLQA 1VR9A 1I4PA 1Y56A 4GDLB 4MACA 4DXFA 1JALA 1QT9A 1E7PB 5BMGA 2AQ3B 1XEEA 1N5XA 1FEHA 1FNUA 1TKGA 1ZE3D 1WRIA 3P42A 1B1ZA 3URYA 4KKIA 3W5VB 3P4RB 1TKYA 3BK1A 2AX5A 2QEJC 4LK0M 3NVZA 4IDIA 1SBBB 1VDVA 5D3IB 2LHDA 2K5PA 2BS3B 1L6VA 1RWSA 1RYJA 1SIJA 2VZKB 4HROA 4OZCA 5D3DA 3GP7A 3VR9B 5HG2A 3T3NA 1DOXA 1L0YB 4ZHPA 2WXRA 3IT6B 1DYQA 3PZ7A 3U2SC 1J7BA 4XDDA 4UDUC 1FIQA 2ON8A 2H89B 3GB1A 1EU3A 4LLGM 4GDKB 1KRHA 2V0GA 3ZJUA 3I9V1 3ZJVA 4WQMA 2HDEA 1DGJA 3SEBA 2G1EA 2B76B 2WS3B 2WXFA 3VR8B 3LYYA 1FNWA 2V4IB 2WQYB 2N7JA 1A70A 1TS2A 2WXOA 2PMVA 3AEEB 1K51A 2WXNA 4B0MA 1F2RC 1D5ZC 1XO3A 1VLBA 2BS4B 4XWTA 4HEA1 5BYRA 2K0PA 2JZPA 4REZA 4XWWA 2WXMA 1YQ3B 3IAS1 2RDHA 1ACCA 5BYSA 2YEPB 1ZPSA 4HJGE 4ZRQA 3L4PA 3V3XA 1T6BX 3U4EG 3NVVA 3HVDA 1YNTE 2WLBA 3P1MA 1IBXA 3Q69A 2GRIA 1JRPA 1UUPA 2QMTA 4RGNA 3W9CB 3DWGC 1FRRA 4AS1A 2DBYA 1L0VB 4USAA 1HEZE 1ZXHA 1K52A 3AEDB 1VZ7A 5LNK1 3UI3A 2BYTA 3NVWA 3AM9A 2BTEA 4L1BA 2AQ2B 3RPFC 1HZ5A 3AE2B 4AQ7A 3BVZA 5G5HA 4ZYSA 4WWMA 2K9XA 4P16A 4RF0A 2WU2B 2BW2A 1YN4A 2MJ3A 2JXTA 2JU6X 1TS4A 3MC0B 1QILA 1V8CA 2IGHA 2PIAA 1HXYD 3W1SA 1NYQA 3NZ3A 2R61A 4WH4A 4KKJA 1ZDXA 2PKOA 3BVMA 3H8HA 2K3UA 3IXSA 1JCKB 1E0ZA 4OZAA 3ZYYX 1PGXA 4RGTA 1CK1A 1C77A 1QLBB 1IGDA 3ZGZA 3IAM1 4M0WA 1BMLC 1OFFA 2DYOA 2KAJA 1KLGD 2QSDA 4RGMA 1P7FA 5BYQA 1CQVA 1ENFA 3I57A 2WXQA 3LXFA 5H8YE 3BZDB 1CZPA 1P7EA 1UGJA 2QJLA 1WYGA 5TSSA 3R2IA 4OZBA 1E6EB 1JWSD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TJE A;  1FFV A;  1QOF A;  1UWM A;  1J7B A;  3SFD B;  4C80 A;  4JWS C;  5H8Y E;  1FIQ A;  2MH7 A;  4YSZ B;  4N58 A;  2JX5 A;  2H89 B;  3HRD D;  1WXQ A;  2MJD A;  4KX6 B;  2Y5C A;  5AUK A;  1FFU A;  1ZOY B;  3PO0 A;  2PVG C;  1KRH A;  1L5P A;  3P63 A;  3VRA B;  5C3J B;  1PDX A;  1QF6 A;  4ZOH C;  1TYG B;  3AH7 A;  4ITK A;  1DOY A;  2K22 A;  2QIE B;  4A9A A;  1DGJ A;  1TKE A;  2G1E A;  1JRO A;  2B76 B;  1EWY C;  1FM0 D;  1FMA D;  2BT6 A;  1N60 A;  1SF0 A;  2DWQ A;  2H88 B;  2WS3 B;  3AMZ A;  4LTU A;  3VR8 B;  4YTP B;  3AEF B;  4YSX B;  2WQY B;  4YXD B;  1GPX A;  1I7H A;  1R7S A;  3SFE B;  1A70 A;  1XLN A;  3AEE B;  3EUB 2;  1E10 A;  1JQ4 A;  1V97 A;  4FXC A;  1FXI A;  4P6V F;  2JQR B;  2E3T A;  4N59 A;  1WGK A;  1N63 A;  2N0S B;  5EE9 A;  1XO3 A;  1CJE A;  1VLB A;  2BS4 B;  3CIR B;  3P4S B;  5EE3 A;  4YSY B;  3W5U B;  3B2F A;  4JX1 C;  2FBW B;  3WCQ A;  2WDQ B;  1FXA A;  1PUT A;  1YQ3 B;  1N62 A;  1J7A A;  1ZXI A;  3AE1 B;  3AEC B;  4C7Y A;  5H92 C;  5C2T B;  2LEK A;  1WWT A;  3L4P A;  3LB8 C;  1J7C A;  3AN1 A;  2OHF A;  3NVV A;  2WLB A;  3NRZ A;  1NYR A;  1L6U A;  2L83 A;  3P1M A;  3AB5 A;  1RFK A;  1FO4 A;  1E9M A;  1JRP A;  5EE1 A;  3W9C B;  1DOI A;  1AYF A;  3DWG C;  1FRR A;  2DBY A;  1ZP0 B;  1L0V B;  2KMM A;  4USA A;  3BII D;  1YJI A;  3AED B;  4HRS A;  3AEA B;  3FAH A;  3NVW A;  4YTM B;  3P4P B;  1NVI D;  1PFD A;  3AM9 A;  1QOA A;  1RM6 C;  2WP9 B;  4YT0 B;  2WU5 B;  1NEK B;  5MPO A;  3AE3 B;  2MJE A;  3B2G A;  3KWL A;  3RPF C;  3VRB B;  1B9R A;  1AWD A;  3AE7 B;  2WDR B;  2WDV B;  3NVY A;  4ZHO A;  1JWA D;  3AE9 B;  3AE2 B;  1ROE A;  5AUI A;  2W55 A;  5G5H A;  2PVO D;  4WWM A;  2K9X A;  1VJK A;  2Q5W D;  3FC4 A;  2WU2 B;  3HVZ A;  1XLQ A;  2MJ3 A;  1XLO A;  1OQR A;  5EE0 A;  4YTN B;  1V8C A;  2PIA A;  3AE4 B;  1YJJ A;  1YQ4 B;  4N6E B;  1NYQ A;  3NS1 A;  1JAL A;  1QT9 A;  1T3Q A;  1E7P B;  2CJO A;  2PKO A;  4US9 A;  1N5X A;  5G5G A;  2CJN A;  1TKG A;  3AEG B;  4US8 A;  2CU3 A;  1E0Z A;  2BS2 B;  3ZYY X;  1WRI A;  5GXG B;  3CWI A;  3AEB B;  2L52 A;  1NI3 A;  1ZUD 2;  3AE6 B;  1N61 A;  3W5V B;  1QLB B;  3P4R B;  3ABV B;  1FRD A;  1TKY A;  2W54 A;  2W3R A;  1OQQ A;  1OFF A;  2AX5 A;  2KAJ A;  1QOG A;  2M19 A;  3NVZ A;  3HUI A;  2HTM E;  3DWM A;  4HRO A;  4IDI A;  1XLP A;  1VDV A;  1KFY B;  2ACZ B;  3B9J A;  2W3S A;  3LXF A;  4JWU C;  4WQM A;  1N5W A;  1L6V A;  1JWB D;  1RWS A;  1RYJ A;  1SIJ A;  1CZP A;  2BS3 B;  2K5P A;  2M56 B;  1SB3 C;  2QJL A;  3AE8 B;  3VR9 B;  3SR6 A;  1DOX A;  3ETR A;  1KF6 B;  1NEN B;  3AV8 A;  1WYG A;  2EKI A;  1F0Z A;  1JW9 D;  3AE5 B;  4C7Z A;  1E6E B;  4ZHP A;  1QOB A;  1IUE A;  3P4Q B;  1GAQ B; 
#chains in the Genus database with same CATH topology
 3V6E B;  2WXK A;  2BF8 B;  2G45 B;  3NUH B;  4A55 A;  3PPA A;  3TUO A;  4HJK A;  2G3Q B;  3R7Q A;  4BOZ B;  2I2Y A;  3Q3J A;  3U8Z A;  3RNF C;  3NY5 A;  2X8X X;  4OW0 A;  1DOY A;  2L3Z A;  1TKE A;  2IPK D;  1WX9 A;  3TBL D;  3R2T A;  4MJS B;  4GXB A;  4BVU C;  1FCC C;  1I4R A;  2FIF A;  3PV1 A;  4EOY A;  2E3T A;  2VZK D;  3P4S B;  1V1O A;  2WWZ A;  2N1W A;  1UZX B;  1Q5W B;  3RZW C;  2KTF A;  1QKZ A;  4B6W A;  1J7C A;  2QIL A;  3AB5 A;  1E9M A;  2RDB C;  2KN4 A;  1GJZ A;  4W9C A;  2NMQ A;  3BII D;  5J17 A;  1GUA B;  1NVI D;  2GB1 A;  3AE7 B;  1JWA D;  5AUI A;  2W55 A;  1VD2 A;  3C8Y A;  3A9J A;  2PTL A;  2J4X A;  1WM3 A;  5EDS A;  4FAD A;  2AL3 A;  5DPS A;  2KFK A;  4US8 A;  4KZ0 A;  2KVZ A;  3CWI A;  4WUR A;  5G55 A;  4M02 A;  3TSS A;  1OQQ A;  1E8W A;  3TEW A;  1UD7 A;  3WAP A;  3PLU A;  1RAX A;  4NQL B;  1SB3 C;  4IC7 B;  4BKS A;  2AWT A;  1QOF A;  1MHH E;  4WJO A;  2Y3A A;  4GMV A;  1C4A A;  4D2K A;  4G50 A;  3BWU D;  3PO0 A;  3A9K A;  3KQ4 A;  3W2D A;  1I35 A;  2IO3 B;  1TBE A;  4BBN F;  2OED A;  1FM0 D;  1GOZ A;  1IPG A;  2H88 B;  2ZZP B;  2FUH B;  2M17 A;  1LM8 B;  1C3T A;  3R3M A;  3GZN I;  1FXI A;  3E9S A;  2FBW B;  5GMV A;  2KAC A;  1SJE D;  4GLS C;  5C2T B;  3H7S A;  4A6Q A;  1YX6 B;  3AN1 A;  2OHF A;  2FCM A;  3NRZ A;  1YX5 B;  2J53 A;  4A90 A;  2IND C;  2LJ5 A;  2KQ7 A;  1WFY A;  2IY1 B;  4QAY A;  3RT3 B;  5EE1 A;  2B3A A;  2J52 A;  2JYE A;  1AYF A;  1YN3 A;  2WDT B;  1ZP0 B;  1C4C A;  2W82 A;  2MBH A;  2N9X A;  2M4N A;  1PFD A;  1WE6 A;  4AWJ A;  3HK0 A;  1Y8R C;  1KM7 A;  1MPE A;  3PT2 B;  4RM9 A;  3VH4 B;  3H7P A;  1E5W A;  2LMC A;  1XLO A;  3D32 A;  4ZRJ A;  5T8I A;  2ZVO A;  4XYC A;  4EEW A;  2IGG A;  1T0S C;  1D4B A;  2UU7 A;  2V3S A;  1LO5 D;  4MGY E;  4K7U A;  2LGY A;  1VZ8 A;  3BK2 A;  4RFB A;  1K8R B;  1TS5 A;  5E6P A;  3AE6 B;  1N61 A;  3JSV B;  5DPR A;  4IWO A;  3A9J B;  2CR5 A;  4E71 A;  3H9D A;  4GN1 A;  1SE3 A;  3PLV A;  4DDG D;  3LDZ E;  2M56 B;  4TQ0 A;  3RFZ B;  3ZXV A;  3QC8 B;  2X38 A;  4JE3 B;  4W9F A;  3I5J C;  4YTM B;  1GAQ B;  1FFV A;  2VH1 A;  3KUC B;  1V1P B;  3W1S C;  2GBN A;  5CHV C;  5IO9 A;  3R66 C;  5AUK A;  1MJD A;  2RSU A;  3VRA B;  3PRZ A;  4MT5 A;  4IW0 A;  1JRO A;  1FMA D;  2DWQ A;  2C60 A;  3M95 A;  3JVZ X;  4NAM A;  3EHV A;  3VHT C;  4BKS D;  2RD0 A;  1I4H A;  2JT4 B;  2DEN B;  2ZCB A;  1CJE A;  4MDK E;  4BBN C;  2WDQ B;  2BB6 A;  4BFR A;  1J7A A;  2LGI A;  3AE1 B;  2BVC A;  2HE7 A;  3APC A;  4AP4 C;  1FNV A;  3TJP A;  2INN E;  2DYM A;  5G2N A;  2L83 A;  5CX3 A;  1TS3 A;  2IO1 B;  3DVN U;  3UQA A;  2N9L A;  4TSS A;  1DOI A;  3DDC B;  3N1X C;  2L00 B;  4RMA A;  3V6C B;  4IOI E;  1D6E C;  2V3P A;  2KVR A;  2Y5P A;  3DPD A;  1VJK A;  4URK A;  3NZU A;  1XLQ A;  2KOX A;  4DXF A;  3QK0 A;  1FEH A;  1FNU A;  1ZE3 D;  2KFJ A;  3URY A;  3A1Q B;  3BK1 A;  3W1Y A;  4LK0 M;  3QAQ A;  1SBB B;  4IM2 A;  4WQM A;  3ZRF A;  2KMA A;  2M8S A;  3PHW B;  1DOX A;  3O65 B;  2K8C A;  1WJU A;  4MGI E;  3CSF A;  4LCD E;  4BZA A;  4W9H A;  4K7W A;  4HDO A;  2LVQ A;  1T0R C;  3UIO B;  4XDD A;  4HPL B;  2CU1 A;  2ON8 A;  4DHJ B;  1WH3 A;  2KLG A;  3ZIM A;  1UBI A;  2V0G A;  2BWF A;  3V61 A;  1DGJ A;  2KZR A;  2G1E A;  4DHZ B;  2WS3 B;  3LYY A;  3UIN B;  2O2V A;  3AEE B;  1F2R C;  4XWT A;  3VTV A;  4IUM B;  3IAS 1;  2C5L C;  4IG7 B;  4HJG E;  1ZPS A;  2O6V D;  1V6E A;  3V3X A;  3N1Y C;  2KJH B;  3U4E G;  3NVV A;  3HVD A;  3NJT A;  3Q69 A;  3FKY A;  4RGN A;  3RNC C;  1EUV B;  4AS1 A;  1L0V B;  4BAX A;  1VZ7 A;  4ZRK A;  3SHQ A;  5LXH A;  3DVN V;  3AM9 A;  2BTE A;  1TZ1 A;  3KVF B;  1UF0 A;  1HZ5 A;  1VCB A;  4B95 A;  2D07 B;  5G5H A;  4WWO A;  4WWM A;  2K9X A;  4RF0 A;  2BW2 A;  1YN4 A;  3QQ8 B;  2IGH A;  4G3X B;  4FN2 A;  3PVL A;  4PS3 A;  1NYQ A;  5AZH A;  4KKJ A;  3IXS A;  2JUO A;  1PGX A;  3ZDM C;  1CK1 A;  1C77 A;  3CMM B;  4M0W A;  2MP2 B;  2FID A;  1R4M I;  1CQV A;  3QA8 A;  2LGS A;  1CZP A;  2CHX A;  1UGJ A;  4HLE A;  2QJL A;  1WZ3 A;  4PS7 A;  5TSS A;  4DBG A;  2HTH A;  1HTO A;  3GS2 A;  1VRA B;  3PRE A;  2KQS A;  4KX6 B;  5D6J B;  2RDG A;  4M01 A;  2J7Q B;  2FAZ A;  1S1Q B;  4W9G A;  2E6X A;  4ITK A;  2A5U A;  4BOS C;  4E3C A;  1SEB D;  1V81 A;  1WF9 A;  1YN5 A;  2VH2 A;  3AEF B;  4KSL C;  2G9H D;  1E10 A;  1YQB A;  2IZV B;  5EE3 A;  1XD3 B;  4MJS A;  3B2F A;  4KGS A;  3WCQ A;  4MSQ B;  3AEC B;  2KTR A;  4GSW A;  1P3Q U;  2REX A;  4DK5 A;  4HKQ A;  1V5T A;  4ANW A;  1FO4 A;  2MWS B;  2NTS A;  2LRW A;  2Z8L A;  2KMM A;  4F8C B;  4W9I A;  5DCN A;  1D5M C;  5AZG A;  3DBR I;  1QOA A;  4YT0 B;  3AE3 B;  2MJE A;  1Q1O A;  3VRB B;  3KWV A;  2YEP F;  1K50 A;  2WDR B;  2GLS A;  1GB1 A;  1I4Q A;  3WIM A;  1NDD A;  4ICV A;  1EM7 A;  2CJO A;  5FR6 A;  4US9 A;  5G5G A;  2CJN A;  1WJ4 A;  1YIW A;  2UWQ A;  2D11 A;  2W3R A;  1JRU A;  3Q3F A;  2ICI A;  4M00 A;  1BUI C;  1TY0 A;  2W3S A;  1KTK A;  1E7V A;  3QX1 A;  1PYW D;  5HI1 A;  1F0Z A;  1JW9 D;  4FUL A;  3B0A A;  3MHS D;  4HKZ E;  2CS4 A;  2MEK A;  3WA0 A;  2LD9 A;  4GOC A;  4Q2J A;  4N9F 4;  3WAM A;  2D5G A;  4JWS C;  4LJP B;  2KT7 A;  2ZNV B;  5HFY A;  1TZO A;  2D3A A;  2XK5 B;  2RMM A;  5C3J B;  4OVV A;  3L54 A;  2KLC A;  4ZOH C;  3U7Z A;  2ONQ A;  4NAW B;  1C4P A;  1EWY C;  5BO4 B;  4II3 B;  2BT6 A;  5I4D A;  3L0W B;  1LFD A;  3QWZ B;  2WX0 A;  2N0S B;  3CIR B;  3W5U B;  3KUZ A;  3PS6 A;  2LRU A;  3WAL A;  2WNM A;  4NZL B;  1NI2 A;  1RFK A;  3X23 A;  4FHJ A;  2JVC A;  4WQO B;  4EZJ A;  1KH0 A;  2TSS A;  1E90 A;  2KHW B;  2KTR B;  1XCT L;  4ICU A;  4H2A A;  2MQJ A;  3PZD A;  1K53 A;  1WIA A;  3ZXR A;  3RNG C;  4A8X C;  5MPO A;  2N9K A;  3IHP C;  4XZ4 A;  2LGD A;  4J3O D;  1ROE A;  4E74 A;  3MTN B;  4XC2 A;  5DPT A;  3MHZ A;  2Q5W D;  4B9K A;  2MW5 A;  4LNO A;  2Z59 B;  1ZGU B;  4YTN B;  1OTR B;  3AE4 B;  3TEX A;  3VUX A;  4EKU A;  1ESF A;  3CF6 E;  1WR6 E;  3AEG B;  3S2A A;  2CU3 A;  3T9L A;  2BS2 B;  3DHG C;  1LQB A;  4AOF A;  1FRD A;  4WWN A;  2W54 A;  3JSV A;  2BBC A;  2XN9 C;  3ML9 A;  3SD5 A;  3PHX B;  1AW7 A;  1QOB A;  3P4Q B;  3E56 A;  1UWM A;  4PYZ A;  1PGA A;  3HRD D;  1V49 A;  1XCQ L;  2PVG C;  3U30 A;  1V1P A;  4PS8 A;  3AH7 A;  3U7D A;  4RGO S;  5D2M B;  1XQQ A;  4WIP A;  4KGT A;  2KC2 A;  4X57 B;  2AQ1 B;  4YSX B;  3AUL A;  1R7S A;  2KKC A;  1XLN A;  5J18 A;  1N6Z A;  2ZJD A;  2I38 A;  2BWE S;  3ZTD A;  2SAK A;  2D2Q A;  1ZXI A;  2KWC A;  2L0F A;  4XE0 A;  3EGR A;  2KNB A;  2XBB C;  1QZE A;  3MFG A;  3DBH I;  4M8N A;  2WXJ A;  1WSP A;  4NY0 A;  3ECI A;  2DYB A;  4LNK A;  2IBI B;  1HA5 A;  1WMH B;  3NZS A;  4F1S A;  4NQK E;  1YMH E;  2WU5 B;  3Q8E A;  1HE8 A;  3B2G A;  3KWL A;  4JQW C;  2JYT A;  2KDM A;  2J0J A;  5IP4 D;  4XDC A;  1AAR A;  5LXI B;  4KZC A;  2KYW A;  4GDL B;  1S3S G;  2NBW B;  1XEE A;  4WWP A;  1TKG A;  4WAA A;  2RPQ A;  4MEM A;  3VTW A;  1WGY A;  1WRI A;  3P42 A;  4CHK A;  2GBJ A;  1B1Z A;  3W5V B;  4A3P A;  1TKY A;  1P9D U;  1WGR A;  2JF5 A;  2QEJ C;  4BKT A;  5D3I B;  5JH5 C;  4MEL A;  2LHD A;  4JLC A;  3A1Q A;  5D3D A;  1SIJ A;  3VR9 B;  5HG2 A;  3T3N A;  1SE9 A;  1MG4 A;  2WXR A;  3WAO A;  3IT6 B;  4K7S A;  1DYQ A;  1V9J A;  3RCZ A;  3RD2 A;  2IYD B;  2ASQ A;  4UDU C;  3A4R A;  1WZ0 A;  2IY0 B;  2V4L A;  3ZJU A;  1ZW7 A;  3I9V 1;  2HDE A;  2LXA A;  3SEB A;  2B76 B;  2WXF A;  3KUD B;  2L7R A;  2LGX A;  4G11 A;  2V4I B;  2KDE B;  1GC7 A;  2PMV A;  4B0M A;  1UBQ A;  2BS4 B;  1GNU A;  3VXW A;  2GBM A;  5BYR A;  2K0P A;  1MFW A;  2CKH B;  4ZRQ A;  3L13 A;  1T6B X;  4FJV B;  1YNT E;  1PQS A;  3DHH C;  2V1Y A;  3W9C B;  2INC C;  2J0K A;  3PRP B;  3DWG C;  3VDZ A;  3DBL I;  2DBY A;  5LNK 1;  1K52 A;  3AED B;  3N3K B;  2G4S A;  4ANX A;  5JHB A;  3NOB A;  1OQY A;  2QHO A;  1R4M B;  4AJY B;  4KDI C;  2I1J A;  2WU2 B;  2KK8 A;  2JXT A;  2KDI A;  1TS4 A;  1YD8 U;  1V8C A;  1WJN A;  2PIA A;  1HXY D;  2NR2 A;  3NZ3 A;  2PKO A;  3H8H A;  1JCK B;  3IBE A;  4MM3 A;  4OZA A;  3K9P B;  4RGT A;  1QLB B;  1IGD A;  4C4V B;  4JIO U;  2ZVN A;  3IAM 1;  1OFF A;  1R4N I;  2QSD A;  4RGM A;  5BYQ A;  1ENF A;  4A3O A;  2WXQ A;  4K81 A;  1L2N A;  3TIX A;  4NJ7 A;  2DNF A;  2YVC A;  1WYG A;  2MP2 A;  3EFU A;  1UH6 A;  3OG5 A;  1H4R A;  4ANV A;  4S17 A;  3ZNZ B;  3U52 E;  2MH7 A;  2QCZ A;  3AXC A;  2LVO A;  1Q10 A;  1YOV B;  2KWU B;  4DWF A;  4NNJ B;  3VVW B;  3ZO5 B;  3PTF C;  1TYG B;  3APF A;  2K22 A;  2QIE B;  3M62 B;  1SXT A;  4LTU A;  2M0A A;  2LZ6 A;  3SFE B;  1F9J A;  1XT9 B;  3KLS X;  1WJ6 A;  3IT4 B;  1OGW A;  5BMI A;  3OWE B;  1WXM A;  3DBR B;  3M3J A;  1ET6 A;  4CYE A;  4EUT A;  1WXS A;  5H92 C;  1SE2 A;  2K6Q A;  1KLU D;  2DZM A;  4LNN A;  2C7N B;  1E8Z A;  4WJN A;  4DHJ D;  2WXH A;  4MH0 E;  4TKN A;  1NBF C;  2JSV X;  2C9W B;  4DHZ E;  4YL8 A;  3AEA B;  3NS8 A;  3P4P B;  2ZEQ A;  3IFW B;  1NEK B;  1B9R A;  4M8M A;  2LWP A;  3AE9 B;  4IKG A;  3B1L X;  2BYE A;  2MA9 B;  3ZNG C;  3HVZ A;  1F77 A;  2EEL A;  4JGH B;  4PT5 A;  1D3Z A;  1YJ1 A;  2KJR A;  1YJJ A;  1YQ4 B;  4N6E B;  3T8M A;  3NS1 A;  1WM2 A;  1GB4 A;  1T3Q A;  1C76 A;  2PW9 A;  2L1A A;  5LLI A;  5GXG B;  4YWG G;  3ENE A;  4DDI D;  3BIN A;  3B9J A;  1KFY B;  4JWU C;  1JWB D;  2C7M B;  2LXC A;  2IGD A;  3DQV A;  2LAS A;  4JPS A;  1C1Y B;  1KF6 B;  1NEN B;  3AV8 A;  4C00 A;  4I6N B;  4MM3 B;  2R2O A;  1TJE A;  2KDB A;  3MC8 A;  4YSZ B;  4ANU A;  3UQB A;  2KO3 A;  2A4Z A;  2Y5C A;  3ZQ4 A;  2RGF A;  1FFU A;  1TY2 A;  1WGG A;  1ZOY B;  4O1N A;  3IVF A;  1F2R I;  4A9A A;  3VTU A;  2INP E;  1EO6 A;  2XK5 A;  1N60 A;  2CHZ A;  4YTP B;  3VFK A;  3C0R B;  1FPY A;  1I7H A;  4ASW C;  3M63 B;  3EUB 2;  2JXX A;  1L7Y A;  4NAW A;  1JQ4 A;  3NG0 A;  5KHQ A;  5EE9 A;  4DXA B;  2FUG 1;  2PEA A;  3VQI A;  3Q6B A;  4KIK B;  3V60 A;  2LUM A;  2HD5 B;  2VRR B;  1N62 A;  4EZL A;  2K1F A;  2MBO A;  4RF1 A;  4DXG A;  3ZNH B;  4EFO A;  4HVB A;  3BYY B;  3OJ4 B;  4AJW A;  1P1A A;  3QAR A;  2QC8 A;  2LVP A;  4B0E A;  1YJI A;  1BXT A;  3ZLZ A;  1RM6 C;  1CMX B;  2MSE D;  5E6J A;  4P7I A;  5FKA C;  2FE8 A;  3DHI C;  3H6N A;  1IGC A;  2KMC A;  2MBQ A;  3HIZ A;  3PGE A;  1F1H A;  2DAF A;  1I4G A;  2K25 A;  2SEB D;  4LDT B;  3AEB B;  3L10 B;  2KDF B;  5FK9 C;  5E6N A;  2KQ4 X;  3ABV B;  2MBB B;  2IJ0 A;  3EEC A;  1QOG A;  2M19 A;  2HTM E;  1RFA A;  2ACZ B;  4XX5 A;  1N5W A;  4TUU A;  1FD6 A;  3ETR A;  2EKI A;  3UIP B;  4JL9 A;  3L08 A;  1C9F A;  2LUE A;  1T0Y A;  4C80 A;  3RNE C;  2BYV E;  3P63 A;  3RUL A;  3OAW A;  1AN8 A;  2V3N A;  1ZDV A;  4WAF A;  2IO2 B;  1OEY A;  2HJ1 A;  2ZW1 A;  3BYT B;  2PLP A;  3GZN B;  1M94 A;  3V62 A;  4ZRI A;  3EA6 A;  4FHK A;  1PGB A;  1PUT A;  4RCO A;  5IOI A;  2FCS A;  2NCN A;  1JML A;  1L6U A;  3QJZ A;  4IWQ A;  1EU4 A;  2LFI A;  1JWU D;  1XF5 L;  2OJW A;  4PK1 A;  4RNA A;  3FIL B;  2L8J A;  2AEH A;  4HRS A;  2GI9 A;  5BMH A;  1UWX A;  4GIV A;  3J9C A;  2L0T A;  4HPP A;  2MBE A;  4OVZ A;  4WJQ A;  1A5R A;  1FCL A;  1H8C A;  1D5X C;  1AWD A;  4ARI A;  4KGR A;  4J6I A;  1RRB A;  3N30 A;  3NVY A;  4L2Y A;  4ZHO A;  1WMH A;  2NS5 A;  1TIF A;  3PZ8 A;  3X0W A;  1Y56 A;  4I6L B;  1N5X A;  2CHW A;  4GDL A;  3UGB B;  4KKI A;  3P4R B;  4IDI A;  4K3B A;  1VDV A;  1TTN A;  4TV3 A;  2VZK B;  4HRO A;  2K5P A;  3VUW A;  1RWS A;  1RYJ A;  1WX7 A;  4OZC A;  2ZCC A;  1GG3 A;  2D10 A;  3DBS A;  4ZHP A;  3Q2A C;  3Q3M C;  2V9H A;  3U2S C;  1LGR A;  4A20 A;  4KDL B;  2BQQ A;  3GB1 A;  4LLG M;  2DHZ A;  4GDK B;  3QIJ A;  3KYC D;  3VR8 B;  1FNW A;  4I6P A;  2WQY B;  2AYO B;  3DBL B;  1A70 A;  1TS2 A;  2WXO A;  1E7U A;  1K51 A;  4HCN B;  1D5Z C;  1VLB A;  2DZI A;  4NJ6 A;  4REZ A;  4XWW A;  2Z0E B;  1YQ3 B;  1J8C A;  1KJT A;  2RDH A;  5BYS A;  3R7R A;  3JW0 X;  3ZTC A;  1V80 A;  2WLB A;  3B08 A;  3P1M A;  2XEW A;  1IBX A;  2L76 A;  1UUP A;  2QMT A;  2ZNV C;  2KC1 A;  1FRR A;  4IM3 A;  3IG3 A;  4USA A;  1UGM A;  1HEZ E;  2QDF A;  3UI3 A;  3NVW A;  2NPT B;  3P2B A;  2N4F A;  2D3B A;  4L1B A;  1TT5 B;  3DOW A;  2BKF A;  2JY6 A;  1R4N B;  4OVU A;  3BVZ A;  4P16 A;  5CHF A;  2JRH A;  4CO7 A;  2MJ3 A;  2JU6 X;  3A4S C;  4KVG B;  4WH4 A;  3BVM A;  1WYW B;  4FBJ B;  3ZKJ C;  2EKE C;  5TR5 A;  3ZGZ A;  4GU2 A;  2BGF A;  2OOB B;  3TL5 A;  3VUY A;  3LXF A;  4MGK E;  1WGD A;  1P7E A;  3ONS A;  4C4V A;  3R2I A;  1P98 A;  5DPW A;  2MRP A;  1SGH A;  4N58 A;  1Z5S B;  2JX5 A;  1WXQ A;  2LJI A;  3HHM A;  2WXL A;  1L0X B;  1L5P A;  1V2Y A;  1MHX A;  2EMT A;  3L17 A;  3MP9 A;  5CTR C;  1MI0 A;  4YXD B;  4TQ1 A;  2I1K A;  4FJY A;  3RN9 C;  5CHW A;  1I4X A;  2Y5B B;  1N63 A;  3BVG A;  4IM0 A;  3ZUN A;  4RH6 A;  3CST A;  4JX1 C;  3RNB C;  2J42 A;  3RUI B;  4GGQ A;  4W9D A;  2LEK A;  1OEY J;  1WWT A;  2WHI A;  2NBV B;  3LB8 C;  4C56 C;  2BPS A;  4CQN A;  1HTQ A;  1WRD B;  2WYQ A;  3L16 A;  5JXV A;  2RPV A;  3DVG Y;  3ZNI D;  1V86 A;  4HPM B;  1WX8 A;  1IBX B;  2K8H A;  2WDV B;  3R8B A;  2PVO D;  3AI5 A;  4HK2 A;  3TEY A;  4OHJ A;  2KFK B;  2JWU A;  2NTT A;  5EE0 A;  1JWM D;  3Q8A A;  2WXP A;  4ZYN A;  2C7H A;  3HM6 X;  1QQR A;  5J2R A;  1MG8 A;  1NI3 A;  2O6V A;  3N1Z C;  5FR3 A;  1WGH A;  1T0Q C;  1F52 A;  5C23 A;  2KJ6 A;  3WAN A;  4W9K A;  3SR6 A;  3JYU A;  4AUQ C;  1EF5 A;  1FXT B;  3AE5 B;  4C7Z A;  1C79 A;  2DZJ A;  2G4D B;  2PE6 B;  3TEZ A;  2GBR A;  3A9K B;  3ML8 A;  2MCN B;  2BB5 A;  3QHT A;  2W9N A;  1SIF A;  2KWD A;  2HJ8 A;  2DLB A;  1WR1 A;  1ZKH A;  2PE9 A;  1PDX A;  3H1U A;  2BKR B;  2PPH A;  2WXI A;  3N9Y C;  1UNS A;  2K39 A;  1V97 A;  3GOE A;  4FXC A;  1SSN A;  3Q8C A;  1HZ6 A;  3ZDT A;  3KW5 B;  4YSY B;  4HWI B;  2ZW0 A;  4NJC A;  1FXA A;  2LHE A;  4C7Y A;  1L4D B;  2N7E A;  3GE8 C;  3O13 A;  4KIK A;  4L23 A;  4HDQ A;  2OJR A;  3N20 C;  4MGZ E;  3C19 A;  1STE A;  4GB9 A;  2Z0D B;  5E6O A;  1KOT A;  2KXJ A;  4EZK A;  3FAH A;  2K8B A;  2AL6 A;  3H7P B;  1WY8 A;  2XNA C;  3T3O A;  1ET9 A;  1M4V A;  2ZPY A;  4F7Z A;  5HKH A;  3DCG A;  1OQR A;  2KX0 A;  4W9E A;  5IAA C;  2MX2 A;  4FA6 A;  4LNF A;  2JRI B;  3SDL C;  2L32 A;  3RI7 C;  1J0G A;  1HQR D;  2L52 A;  3Q3O C;  1ZUD 2;  1SE4 A;  3Q8F A;  1KLV A;  1I42 A;  4NPN A;  1T5X D;  3HUI A;  3DWM A;  3N32 A;  3UF8 A;  3ZJT A;  3AE8 B;  3RNA C;  2M0X A;  4TMA B;  2J0M A;  3A33 B;  3VAW A;  2IDY A;  1ISN A;  1XLP A;  2O6V B;  1IUE A;  5HHD G;  3SFD B;  3OJ3 A;  4G0N B;  3KH0 A;  2MJD A;  5IA7 A;  2GMI C;  3ZW3 A;  2KN5 A;  1QF6 A;  4DQO C;  2KD0 A;  5L95 C;  1RLF A;  4R3D A;  1SJH D;  4K3C A;  4N59 A;  3MJ5 A;  3AMZ A;  1SF0 A;  3K9O B;  2N7D A;  1GPX A;  4MH8 A;  2M1M A;  2N9P C;  4P6V F;  2JQR B;  1WGK A;  1C78 A;  1L4Z B;  3OLM D;  5JHA A;  1Z2M A;  5JZE B;  1Q0W B;  1E8X A;  3ZVV A;  4EE2 A;  4P1C C;  1NYR A;  3V05 A;  3BY4 B;  2KWV B;  2PJH A;  4KSK C;  2WXG A;  2KX3 A;  3RYT A;  1EWC A;  5D7G A;  1XXG A;  4HCP B;  4FLH A;  1UEL A;  1GC6 A;  2WP9 B;  3HM3 A;  4XGA B;  3FIL A;  1VZ6 A;  4ZRP A;  4HXD A;  1G6J A;  3KYD D;  4ARC A;  2L05 A;  3Q14 C;  1MVK A;  3FC4 A;  4W9L A;  3Q8B A;  1VR9 A;  1I4P A;  4MAC A;  4FJZ A;  4II2 B;  3SU8 X;  1JAL A;  2N9E B;  1QT9 A;  1E7P B;  4LJO B;  5BMG A;  5D94 A;  2AQ3 B;  1WXV A;  5KHO A;  3ZRC A;  1P0R A;  3PRM B;  3MJW A;  2K6D B;  2FCQ A;  2AX5 A;  3NVZ A;  1L6V A;  2BS3 B;  3QCA A;  3GP7 A;  4W9J A;  2IO0 B;  1L0Y B;  4RM8 A;  2R2Q A;  2JZ3 B;  2WGS A;  1LXD A;  3PZ7 A;  5IKC M;  1J7B A;  1FIQ A;  1WI0 A;  2FNJ B;  2H89 B;  3I63 C;  1EU3 A;  2DAJ A;  1KRH A;  2D3G A;  2GBK A;  3GE3 C;  3ZJV A;  2O2V B;  2LI5 A;  4LDT D;  1J19 A;  2NBU A;  4GDK A;  2WX1 A;  1WXA A;  2ZPN A;  4ACF A;  2N7J A;  4ZDV A;  2WXN A;  1X1M A;  5AZF A;  1E8Y A;  1XO3 A;  4HEA 1;  3LJ3 A;  3PSE B;  4KV2 A;  2JZP A;  2WXM A;  4MSM B;  4PYU A;  1ACC A;  3RMK C;  2YEP B;  3L4P A;  4WJP A;  3ALB A;  2GRI A;  1JRP A;  3DBH B;  2NVU I;  4S0R A;  5C1Z A;  3VH3 B;  1EF1 A;  2D3C A;  5L83 A;  2JPH A;  3AU4 A;  3RZF A;  1WE7 A;  3TMP B;  1ZXH A;  3AU5 A;  2BYT A;  3APD A;  2DX5 B;  2FCN A;  4P1B C;  3DVG X;  5AEK B;  3I3T B;  2AQ2 B;  3RPF C;  2UYZ B;  3AE2 B;  4AQ7 A;  2NPT A;  4ZYS A;  1IYF A;  4K1R B;  4BKG A;  3TCA A;  3MC0 B;  1QIL A;  3W1S A;  2R61 A;  1ZDX A;  2K3U A;  2MLB A;  4M0W B;  1E0Z A;  2BYF A;  2JZZ A;  3ZYY X;  3EC8 A;  2KAN A;  4LNI A;  2DZK A;  2JWZ A;  2RR9 A;  1TGZ B;  1IP9 A;  2EMS A;  1BML C;  2DYO A;  2KAJ A;  1KLG D;  2YLM A;  1V5O A;  1P7F A;  3I57 A;  4IWP A;  3MC9 A;  5H8Y E;  3Q3N C;  3BZD B;  2MHJ A;  3NHE B;  1U4A A;  5IN7 A;  2N1V A;  1BT0 A;  3EFC A;  4OZB A;  2GOW A;  1E6E B;  1JWS D; 
#chains in the Genus database with same CATH homology
 3U52 E;  2MH7 A;  2WXK A;  3GS2 A;  1VRA B;  4N58 A;  1Q10 A;  2JX5 A;  1WXQ A;  2LJI A;  3NUH B;  4KX6 B;  2RDG A;  2WXL A;  4A55 A;  3TUO A;  1L0X B;  1L5P A;  2I2Y A;  1MHX A;  1TYG B;  2E6X A;  4ITK A;  4OW0 A;  1DOY A;  2K22 A;  2QIE B;  3MP9 A;  1MI0 A;  1TKE A;  1SEB D;  4YXD B;  2IPK D;  1SXT A;  4LTU A;  4TQ1 A;  2M0A A;  1YN5 A;  3R2T A;  3AEF B;  2G9H D;  3SFE B;  1E10 A;  3KLS X;  3IT4 B;  1FCC C;  1I4R A;  1I4X A;  5BMI A;  2E3T A;  3OWE B;  2VZK D;  1N63 A;  3BVG A;  3P4S B;  5EE3 A;  1V1O A;  4RH6 A;  1ET6 A;  3B2F A;  4JX1 C;  4KGS A;  3WCQ A;  2J42 A;  3AEC B;  5H92 C;  1SE2 A;  2LEK A;  1WWT A;  1KLU D;  1QKZ A;  4C56 C;  3LB8 C;  1J7C A;  4HKQ A;  2QIL A;  3AB5 A;  4CQN A;  1FO4 A;  1E9M A;  2WXH A;  2NTS A;  2KN4 A;  2JSV X;  2Z8L A;  2KMM A;  2NMQ A;  3BII D;  3AEA B;  1D5M C;  5JXV A;  3P4P B;  1NVI D;  1QOA A;  4YT0 B;  2RPV A;  1NEK B;  2GB1 A;  2MJE A;  3AE3 B;  3VRB B;  3KWV A;  2YEP F;  1B9R A;  3AE7 B;  1K50 A;  2WDR B;  1IBX B;  2WDV B;  1GB1 A;  1JWA D;  1I4Q A;  3AE9 B;  4IKG A;  5AUI A;  2W55 A;  3R8B A;  2PVO D;  3TEY A;  4OHJ A;  3HVZ A;  1EM7 A;  1F77 A;  3C8Y A;  2EEL A;  2JWU A;  2PTL A;  4PT5 A;  2NTT A;  2J4X A;  5EE0 A;  1JWM D;  1YJJ A;  1YQ4 B;  4N6E B;  3Q8A A;  2WXP A;  3NS1 A;  1GB4 A;  2CJO A;  1T3Q A;  1C76 A;  4US9 A;  5G5G A;  2CJN A;  4US8 A;  2PW9 A;  2L1A A;  5GXG B;  3CWI A;  1QQR A;  1NI3 A;  5FR3 A;  4WUR A;  4YWG G;  3TSS A;  2W3R A;  1OQQ A;  2ICI A;  3TEW A;  1BUI C;  3B9J A;  1KFY B;  4JWU C;  1TY0 A;  2W3S A;  1KTK A;  1JWB D;  2IGD A;  1SB3 C;  1PYW D;  4JPS A;  5HI1 A;  3SR6 A;  1KF6 B;  1NEN B;  3AV8 A;  1F0Z A;  1JW9 D;  4MM3 B;  3AE5 B;  4HKZ E;  2MEK A;  4C7Z A;  1C79 A;  1TJE A;  4Q2J A;  1QOF A;  1MHH E;  3TEZ A;  2D5G A;  4JWS C;  2Y3A A;  4YSZ B;  1C4A A;  2BB5 A;  4D2K A;  3BWU D;  5HFY A;  1TZO A;  2Y5C A;  3ZQ4 A;  2KWD A;  1FFU A;  1TY2 A;  1ZOY B;  2DLB A;  2RMM A;  3PO0 A;  4O1N A;  5C3J B;  1PDX A;  4ZOH C;  3KQ4 A;  1F2R I;  3U7Z A;  3W2D A;  2ONQ A;  4A9A A;  2INP E;  4NAW B;  1C4P A;  1EWY C;  1FM0 D;  1GOZ A;  2BT6 A;  1N60 A;  2H88 B;  2OED A;  5I4D A;  2WXI A;  4YTP B;  3N9Y C;  1UNS A;  1I7H A;  3EUB 2;  1JQ4 A;  1V97 A;  4FXC A;  1FXI A;  1SSN A;  3E9S A;  3Q8C A;  1HZ6 A;  2N0S B;  5EE9 A;  3CIR B;  4YSY B;  3W5U B;  2FUG 1;  3VQI A;  2FBW B;  2LUM A;  2ZW0 A;  4NJC A;  1FXA A;  1N62 A;  2LHE A;  4C7Y A;  1L4D B;  2KAC A;  1SJE D;  4GLS C;  5C2T B;  4A6Q A;  2WNM A;  4NZL B;  3AN1 A;  2OHF A;  3NRZ A;  3O13 A;  4L23 A;  4RF1 A;  2J53 A;  4A90 A;  1RFK A;  4DXG A;  3BYY B;  5EE1 A;  2J52 A;  1STE A;  1AYF A;  2JYE A;  1YN3 A;  1KH0 A;  2TSS A;  1ZP0 B;  4B0E A;  1YJI A;  1C4C A;  1XCT L;  2W82 A;  3FAH A;  4H2A A;  1K53 A;  1PFD A;  1BXT A;  1RM6 C;  2XNA C;  4A8X C;  5MPO A;  5E6J A;  1MPE A;  3T3O A;  2N9K A;  1ET9 A;  5FKA C;  4J3O D;  2FE8 A;  1ROE A;  1M4V A;  3MHZ A;  2Q5W D;  1IGC A;  2LMC A;  1XLO A;  1OQR A;  5T8I A;  4YTN B;  3TEX A;  3AE4 B;  2IGG A;  1D4B A;  1ESF A;  1I4G A;  2L32 A;  1LO5 D;  3AEG B;  2CU3 A;  2BS2 B;  2SEB D;  1HQR D;  3AEB B;  1VZ8 A;  2L52 A;  3BK2 A;  4RFB A;  1TS5 A;  1ZUD 2;  3AE6 B;  1N61 A;  1SE4 A;  5FK9 C;  2KQ4 X;  3ABV B;  1FRD A;  3Q8F A;  2IJ0 A;  2W54 A;  1QOG A;  2M19 A;  1T5X D;  3HUI A;  2HTM E;  3DWM A;  1SE3 A;  2ACZ B;  1N5W A;  3ZJT A;  2M56 B;  3AE8 B;  4TQ0 A;  3RFZ B;  2BBC A;  1FD6 A;  3ETR A;  4TMA B;  2EKI A;  2IDY A;  2XN9 C;  2X38 A;  4JE3 B;  1AW7 A;  1XLP A;  1QOB A;  1IUE A;  3P4Q B;  1GAQ B;  4YTM B;  1C9F A;  5HHD G;  3E56 A;  1FFV A;  1UWM A;  3SFD B;  1V1P B;  4C80 A;  1PGA A;  3HRD D;  2MJD A;  1XCQ L;  5AUK A;  2PVG C;  3VRA B;  3P63 A;  1V1P A;  1QF6 A;  4DQO C;  3AH7 A;  4MT5 A;  4R3D A;  4RGO S;  1SJH D;  1AN8 A;  2V3N A;  1ZDV A;  1JRO A;  3MJ5 A;  4KGT A;  1FMA D;  4N59 A;  3AMZ A;  1SF0 A;  4WIP A;  2DWQ A;  4WAF A;  2AQ1 B;  4YSX B;  1GPX A;  1R7S A;  2ZW1 A;  1XLN A;  4MH8 A;  3BYT B;  4NAM A;  2PLP A;  2I38 A;  4P6V F;  2JQR B;  1I4H A;  1WGK A;  1C78 A;  1L4Z B;  1CJE A;  2SAK A;  3EA6 A;  2WDQ B;  1PGB A;  1PUT A;  2BB6 A;  1J7A A;  1ZXI A;  2LGI A;  3AE1 B;  4RCO A;  4XE0 A;  3EGR A;  1FNV A;  4EE2 A;  3MFG A;  1JML A;  1NYR A;  2DYM A;  1L6U A;  2INN E;  2L83 A;  3V05 A;  1EU4 A;  2LFI A;  2WXG A;  1JWU D;  1TS3 A;  2WXJ A;  1EWC A;  2N9L A;  4TSS A;  1DOI A;  1WSP A;  1XF5 L;  5D7G A;  4RNA A;  3FIL B;  1XXG A;  4HRS A;  1HA5 A;  2GI9 A;  5BMH A;  1UWX A;  3J9C A;  4IOI E;  1D6E C;  2WP9 B;  1YMH E;  2WU5 B;  3FIL A;  3Q8E A;  4OVZ A;  1VZ6 A;  1FCL A;  2V3P A;  1D5X C;  3B2G A;  3KWL A;  1AWD A;  4ARI A;  2JYT A;  4KGR A;  3NVY A;  4L2Y A;  2Y5P A;  4ZRP A;  4ZHO A;  4ARC A;  2KDM A;  4XDC A;  1VJK A;  1MVK A;  3FC4 A;  3PZ8 A;  3Q8B A;  1XLQ A;  1VR9 A;  1I4P A;  1Y56 A;  4GDL B;  4MAC A;  4DXF A;  1JAL A;  1QT9 A;  1E7P B;  5BMG A;  2AQ3 B;  1XEE A;  1N5X A;  1FEH A;  1FNU A;  1TKG A;  1ZE3 D;  1WRI A;  3P42 A;  1B1Z A;  3URY A;  4KKI A;  3W5V B;  3P4R B;  1TKY A;  3BK1 A;  2AX5 A;  2QEJ C;  4LK0 M;  3NVZ A;  4IDI A;  1SBB B;  1VDV A;  5D3I B;  2LHD A;  2K5P A;  2BS3 B;  1L6V A;  1RWS A;  1RYJ A;  1SIJ A;  2VZK B;  4HRO A;  4OZC A;  5D3D A;  3GP7 A;  3VR9 B;  5HG2 A;  3T3N A;  1DOX A;  1L0Y B;  4ZHP A;  2WXR A;  3IT6 B;  1DYQ A;  3PZ7 A;  3U2S C;  1J7B A;  4XDD A;  4UDU C;  1FIQ A;  2ON8 A;  2H89 B;  3GB1 A;  1EU3 A;  4LLG M;  4GDK B;  1KRH A;  2V0G A;  3ZJU A;  3I9V 1;  3ZJV A;  4WQM A;  2HDE A;  1DGJ A;  3SEB A;  2G1E A;  2B76 B;  2WS3 B;  2WXF A;  3VR8 B;  3LYY A;  1FNW A;  2V4I B;  2WQY B;  2N7J A;  1A70 A;  1TS2 A;  2WXO A;  2PMV A;  3AEE B;  1K51 A;  2WXN A;  4B0M A;  1F2R C;  1D5Z C;  1XO3 A;  1VLB A;  2BS4 B;  4XWT A;  4HEA 1;  5BYR A;  2K0P A;  2JZP A;  4REZ A;  4XWW A;  2WXM A;  1YQ3 B;  3IAS 1;  2RDH A;  1ACC A;  5BYS A;  2YEP B;  1ZPS A;  4HJG E;  4ZRQ A;  3L4P A;  3V3X A;  1T6B X;  3U4E G;  3NVV A;  3HVD A;  1YNT E;  2WLB A;  3P1M A;  1IBX A;  3Q69 A;  2GRI A;  1JRP A;  1UUP A;  2QMT A;  4RGN A;  3W9C B;  3DWG C;  1FRR A;  4AS1 A;  2DBY A;  1L0V B;  4USA A;  1HEZ E;  1ZXH A;  1K52 A;  3AED B;  1VZ7 A;  5LNK 1;  3UI3 A;  2BYT A;  3NVW A;  3AM9 A;  2BTE A;  4L1B A;  2AQ2 B;  3RPF C;  1HZ5 A;  3AE2 B;  4AQ7 A;  3BVZ A;  5G5H A;  4ZYS A;  4WWM A;  2K9X A;  4P16 A;  4RF0 A;  2WU2 B;  2BW2 A;  1YN4 A;  2MJ3 A;  2JXT A;  2JU6 X;  1TS4 A;  3MC0 B;  1QIL A;  1V8C A;  2IGH A;  2PIA A;  1HXY D;  3W1S A;  1NYQ A;  3NZ3 A;  2R61 A;  4WH4 A;  4KKJ A;  1ZDX A;  2PKO A;  3BVM A;  3H8H A;  2K3U A;  3IXS A;  1JCK B;  1E0Z A;  4OZA A;  3ZYY X;  1PGX A;  4RGT A;  1CK1 A;  1C77 A;  1QLB B;  1IGD A;  3ZGZ A;  3IAM 1;  4M0W A;  1BML C;  1OFF A;  2DYO A;  2KAJ A;  1KLG D;  2QSD A;  4RGM A;  1P7F A;  5BYQ A;  1CQV A;  1ENF A;  3I57 A;  2WXQ A;  3LXF A;  5H8Y E;  3BZD B;  1CZP A;  1P7E A;  1UGJ A;  2QJL A;  1WYG A;  5TSS A;  3R2I A;  4OZB A;  1E6E B;  1JWS D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...