3RPFC

Protein-protein complex of subunit 1 and 2 of molybdopterin-converting factor from helicobacter pylori 26695
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
74
structure length
74
Chain Sequence
MMVEVRFFGPIKEENFFIKANDLKELRAILQEKEGLKEWLGVCAIALNDHLIDNLNTPLKDGDVISLLPPVCGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein-protein complex of subunit 1 and 2 of Molybdopterin-converting factor from Helicobacter pylori 26695
rcsb
source organism Helicobacter pylori
molecule tags Transferase
molecule keywords Molybdopterin synthase catalytic subunit
total genus 11
structure length 74
sequence length 74
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3rpfC00
4KX6B 2CU3A 1NENB 5EE3A 3VRAB 3B9JA 3BIID 2W54A 3AECB 1GPXA 2WLBA 1JWBD 1AWDA 2MJEA 2N0SB 2WQYB 1ZOYB 3VR8B 1GAQB 1V8CA 5EE1A 3NVYA 3AMZA 1TKYA 3P1MA 2DWQA 3P4RB 4A9AA 1OQQA 3EUB2 1UWMA 1R7SA 1PFDA 2H88B 3AEFB 3SFDB 4ZHPA 3FAHA 1FFVA 1ZUD2 1QLBB 1SB3C 1N60A 1NVID 3AE8B 3NVVA 1JRPA 1L6UA 1WYGA 2MJ3A 2PKOA 2WDVB 4ITKA 1FO4A 1RM6C 3AE5B 3LXFA 5EE9A 4C7ZA 1JALA 3SR6A 1L0VB 3AH7A 3AE9B 3P4PB 2Q5WD 3PO0A 1TKEA 1KFYB 5H8YE 4YXDB 4ZHOA 3W5VB 3B2GA 3P4QB 1FXAA 1TKGA 3AN1A 1KF6B 3AB5A 1QOFA 1I7HA 2L83A 1ZXIA 2H89B 5G5GA 1E0ZA 1OFFA 1F0ZA 2G1EA 1N63A 3HVZA 1QOAA 4HRSA 3AV8A 3AE6B 1FFUA 3AE4B 3AEDB 2MJDA 5AUIA 3FC4A 3AE1B 2PIAA 1E10A 1FXIA 2WU5B 1FM0D 4P6VF 2HTME 3P63A 2MH7A 2QJLA 4IDIA 1DOYA 2BS3B 2M19A 2WDQB 4N58A 3CIRB 1JROA 3NVWA 1ROEA 2BS2B 2FBWB 3AEEB 2E3TA 2K9XA 2Y5CA 1B9RA 2L52A 3L4PA 4C7YA 1XLPA 1N5WA 1DGJA 1YQ4B 5C3JB 1NYQA 1TYGB 2BT6A 2B76B 4YSYB 2JQRB 3AEGB 4JX1C 5EE0A 3AE7B 1N62A 2QIEB 3AEBB 1VLBA 1JWAD 3VRBB 1PUTA 5H92C 2KMMA 4US8A 1L6VA 1RYJA 4US9A 1NEKB 2W3RA 3KWLA 1KRHA 1OQRA 1J7AA 1WGKA 2WP9B 3ABVB 4FXCA 1JQ4A 4USAA 1AYFA 2LEKA 1WWTA 1N5XA 1QOBA 2KAJA 2BS4B 1VDVA 4HROA 1CJEA 1FMAD 3AEAB 3NRZA 4YSXB 1XO3A 1NI3A 3NS1A 1QOGA 1WRIA 1QT9A 4JWUC 4LTUA 4YT0B 1RWSA 1DOXA 2W55A 2CJNA 1E9MA 1PDXA 1FRRA 2JX5A 5AUKA 1XLNA 4YSZB 1J7BA 3LB8C 1YJIA 1VJKA 1IUEA 2WDRB 1DOIA 2DBYA 2M56B 2OHFA 4N59A 5G5HA 3W9CB 1WXQA 4ZOHC 1YQ3B 3WCQA 1FRDA 3NVZA 3RPFC 3ETRA 1XLOA 1N61A 2CJOA 2K5PA 4WQMA 3AE2B 3W5UB 3DWGC 3CWIA 3B2FA 4C80A 1SF0A 2WU2B 4YTMB 5MPOA 1ZP0B 3HRDD 1E7PB 2ACZB 1SIJA 1YJJA 4YTPB 1V97A 1L5PA 1NYRA 2PVOD 5GXGB 2PVGC 4JWSC 2K22A 1TJEA 3VR9B 3HUIA 2EKIA 2W3SA 4YTNB 1QF6A 3SFEB 1XLQA 2WS3B 3ZYYX 1A70A 1J7CA 4WWMA 1FIQA 1T3QA 1CZPA 1E6EB 1RFKA 1EWYC 2AX5A 1JW9D 5C2TB 3DWMA 4N6EB 3AM9A 3AE3B 3P4SB
chains in the Genus database with same CATH superfamily
4A6QA 4F7ZA 3ZGZA 1JWBD 4JE3B 2KC2A 3EC8A 3E9SA 5J18A 2MLBA 5DPWA 3DVGX 3EUB2 3ZRCA 1TBEA 2JWZA 2PEAA 1R4NB 1SB3C 1QKZA 3AE8B 4M02A 2MJ3A 2PKOA 3SD5A 4EZJA 3WA0A 5DPRA 2RPQA 4PYZA 1UNSA 4ZHOA 2RSUA 5H8YE 2WXHA 1EU4A 3P4QB 3HIZA 3N30A 5KHQA 3AN1A 2LVQA 2LFIA 4GDLB 1ZXIA 3DBRI 4WAAA 5D7GA 2K8CA 2JYEA 2FUG1 1YNTE 4ZRJA 1V1PB 3AV8A 3BZDB 4TQ1A 1WX8A 3AU4A 2J52A 4IG7B 3B08A 3NVWA 3RN9C 2FBWB 2E3TA 4K3BA 3TEZA 1DGJA 2BB6A 5C3JB 2L3ZA 2B76B 3WALA 3KUZA 3BY4B 4IM3A 4LDTB 3DBHB 1V1OA 1WXAA 3UI3A 1N5XA 3VHTC 1V49A 1VDVA 2MBBB 2CHZA 3DPDA 4HPPA 2W55A 4HDQA 4G3XB 3LB8C 4NY0A 1UH6A 3UINB 3TIXA 1WXQA 1YQ3B 3WCQA 1T6BX 4URKA 5MPOA 4YTMB 3V05A 3ZXRA 2DLBA 2WDTB 1WYWB 2EKEC 1LXDA 2KT7A 1XLQA 2LGXA 2X38A 2QEJC 1KH0A 5JH5C 3R3MA 2AQ2B 2CU3A 2O2VA 2ZCBA 1WJ6A 1XD3B 1ZXHA 4DXAB 1OQQA 3AEFB 2BKRB 3U7ZA 3FAHA 2J42A 2WXPA 1Z2MA 1TTNA 1JWMD 2WDVB 1FO4A 3V61A 1RM6C 1JMLA 4BBNF 3P4PB 1TKEA 2BGFA 1LGRA 2ZZPB 3AB5A 2H89B 3DBRB 1TZOA 4AJWA 2MW5A 3HVZA 3RCZA 3BWUD 2C5LC 4XZ4A 3AI5A 2VH2A 2QILA 4EZKA 3W1SA 3BYYB 2RDHA 2G9HD 4C00A 2L52A 2B3AA 4BKGA 3RFZB 1TYGB 2BWES 3DVGY 4I6LB 1JWAD 3OJ4B 1E7UA 1KTKA 5D2MB 2RMMA 3TEYA 2LD9A 2NVUI 2GBRA 4ANVA 2K8BA 3ML8A 3R66C 2BS4B 1ESFA 2NTSA 4IW0A 4HLEA 3H9DA 3DBLB 1PDXA 1V9JA 4ZDVA 4W9CA 1K51A 3W9CB 4ZOHC 4WQMA 2DNFA 1GC7A 1E7PB 2BF8B 1IBXA 4S17A 2PE6B 4X57B 4FN2A 2V3SA 4MGYE 1L5PA 2K22A 2UU7A 2MEKA 4YTNB 1XT9B 4YL8A 2O6VA 3QC8B 1FIQA 2DZKA 2AX5A 3QHTA 5G55A 1XCTL 2JPHA 2HJ8A 1VZ7A 4HJGE 3DHIC 1AWDA 1VZ8A 2N0SB 2PPHA 3P1MA 5CX3A 4KKJA 2JWUA 4ZHPA 1IGDA 1VD2A 1SIFA 1C77A 2K6DB 3KVFB 4W9JA 4KIKA 4W9HA 2XK5B 1R4MB 2FUHB 4WJOA 2AYOB 1FXAA 1GNUA 2MP2B 2KOXA 1PYWD 3ZDTA 1NDDA 1D5XC 3AE4B 3AE1B 3MC8A 4P6VF 4WIPA 3C0RB 4K7UA 3DHGC 3W2DA 2IO3B 2K1FA 2KN4A 3L0WB 1KM7A 4IWOA 2RR9A 2FCNA 4RNAA 5DPSA 3L10B 2KDBA 4ARIA 3AE7B 2Z0EB 3EHVA 4MH8A 2K0PA 3R2TA 1LO5D 2KFKA 5DCNA 1WY8A 4HEA1 4KDIC 3PS6A 1MHXA 1YN4A 3SU8X 1YIWA 2WXKA 2CHXA 2FCMA 3PLUA 4PS7A 3OWEB 2LXCA 3V6EB 1HQRD 5AUKA 1I4HA 1TY0A 3D32A 2LJIA 3VQIA 2CJOA 2KJ6A 1R4MI 1C3TA 2BKFA 2MBHA 2LXAA 4FHJA 4WWOA 3PSEB 1ENFA 5GXGB 1UD7A 3HUIA 1YMHE 1F2RC 3T3OA 1T3QA 2D3BA 1NBFC 1FXTB 4H2AA 4US8A 1I35A 4DWFA 5CHVC 3ZXVA 4YWGG 2MJEA 1ZOYB 3T3NA 2R61A 4AP4C 4A9AA 1WGHA 3ML9A 3L08A 4BFRA 3T8MA 4ITKA 4W9IA 4C7ZA 1Q1OA 2D3CA 2GBKA 2KQ7A 2KQSA 2KTRA 4XDDA 1WGGA 1AARA 1KF6B 3MTNB 2MBQA 3C19A 3R8BA 1FM0D 1DOYA 2M19A 4NJ6A 3K9PB 1V5OA 1N5WA 1MJDA 4WWNA 1NYQA 1EO6A 3N3KB 4JX1C 4A20A 3RYTA 3WANA 2KANA 3Q3JA 2AQ1B 3IAM1 3VDZA 1L6VA 2ZCCA 1MG8A 2ZW1A 1J7AA 2WX1A 3T9LA 4LCDE 3PLVA 3CSFA 2XN9C 2MBEA 2MBOA 4YT0B 1DOXA 5BMHA 3RNAC 4DXFA 4DHZE 4O1NA 1QILA 1E8YA 1F9JA 3Q8FA 1D3ZA 1IPGA 3IHPC 4GLSC 4C80A 4M0WA 3KWVA 1NYRA 3HHMA 4JWSC 2NBUA 4GMVA 2N7JA 4RGOS 1IBXB 1VR9A 4L23A 1Z5SB 1J7CA 4WWMA 3VAWA 4EUTA 4B0EA 1RFKA 5IO9A 1JW9D 1EUVB 2XBBC 1WJUA 2YVCA 3NS8A 5I4DA 3V62A 2YLMA 1WE7A 2R2QA 1SE4A 3L54A 2L0TA 3Q3MC 3ZDMC 4WWPA 1UELA 3BVGA 4I6NB 1TIFA 3CF6E 3TSSA 4IWQA 1Y56A 1UWMA 1R7SA 2JT4B 4HPMB 3FKYA 1ZUD2 2KJHB 3NOBA 4K7WA 1L6UA 2QCZA 1FNWA 1STEA 5EE9A 1YX6B 3Q8BA 5LNK1 2QDFA 2R2OA 3BYTB 2WGSA 3R2IA 4GIVA 1E0ZA 3V60A 1VZ6A 2RD0A 4BVUC 3ECIA 2KACA 4ZRIA 2KVRA 2PIAA 4A8XC 2ZVOA 3DCGA 2BS3B 2JYTA 4OVVA 2JUOA 3MJWA 4WJPA 1XLPA 2KZRA 1WX7A 2BTEA 1S1QB 2WXOA 4YSYB 4OVZA 2JQRB 1SXTA 2O6VB 3I9V1 1C9FA 3UQAA 4ZRKA 3VTUA 3NZSA 2KJRA 1E5WA 3FILA 4K7SA 2N1VA 1XO3A 3A1QA 4PK1A 1WMHA 3LJ3A 3ZNZB 3PRMB 4GXBA 1VJKA 4MM3A 3PZDA 1UWXA 2AL6A 5HKHA 3N9YC 3GB1A 1WJ4A 2C7MB 3B2FA 2RGFA 1LQBA 2L1AA 1SIJA 1PQSA 1WFYA 1B1ZA 2MRPA 4A55A 2JRIB 2WS3B 4P1BC 2KDIA 1HTQA 3TEWA 1M94A 3RZFA 2C7NB 2N9EB 4LJOB 4NNJB 1OTRB 1XEEA 1WMHB 1V8CA 2RPVA 4ANWA 1IYFA 3SFDB 1AW7A 3N32A 4WURA 4HKQA 5GMVA 2HJ1A 3AE5B 2WWZA 2D3GA 3MP9A 4WQOB 3ZNHB 4DBGA 3J9CA 1IP9A 4PYUA 2CHWA 5E6OA 5BYQA 1K53A 1WXSA 1N63A 3L17A 2KWVB 1FXIA 5IAAC 2QJLA 2WDQB 1FCCC 3PRPB 3MHZA 1C4PA 2K9XA 2JSVX 2Y5BB 4NAWA 1YQ4B 4D2KA 5TR5A 3JVZX 2BT6A 2WXRA 3M95A 1WGRA 2KMMA 1L2NA 1G6JA 4EE2A 1RAXA 3VUWA 3ZJVA 4PS8A 2KN5A 2LVPA 3URYA 3AEAB 4E3CA 2WXNA 4YSXB 4ZYNA 1E9MA 1XF5L 1M4VA 1WIAA 1XLNA 3C8YA 1TS5A 5LXHA 1IUEA 2DBYA 3MHSD 1R4NI 3ETRA 2KHWB 2G4SA 5EDSA 4WH4A 2ACZB 3DBLI 3UGBB 1EWCA 1D5MC 4CHKA 1T0RC 2HE7A 4HXDA 2FNJB 4JPSA 4XC2A 3AE3B 1E7VA 5EE3A 1GPXA 1WR6E 3AECB 1L4DB 2BPSA 3B1LX 3NVYA 2JRHA 1WZ0A 2L00B 3VXWA 3TCAA 1P3QU 2KC1A 3NVVA 5CHWA 1GG3A 4IOIE 3AXCA 1LM8B 3VFKA 2WXFA 4W9DA 1UGMA 4BOZB 1RRBA 3A4SC 3DVNU 1WR1A 3DQVA 5FK9C 2ASQA 3AE6B 1FFUA 4WAFA 4LNFA 1F52A 1YQBA 4II2B 2JXXA 1HZ6A 5LLIA 2J53A 2Y5CA 4REZA 4TKNA 3U4EG 3SEBA 3VTWA 4BZAA 4DHZB 4HK2A 2OOBB 2L7RA 3UIOB 1RYJA 2Z59B 5C1ZA 1QZEA 2N1WA 4KKIA 1FNVA 4USAA 2MQJA 1VRAB 4KSKC 3PZ8A 1X1MA 2GRIA 2LUMA 4JWUC 1UF0A 3L16A 1I4QA 2K6QA 2BW2A 3KLSX 4FLHA 1J7BA 4RF0A 5G2NA 2JXTA 5G5HA 2J0KA 3N20C 4KZ0A 2IO1B 1WH3A 2NBVB 3Q8AA 3V6CB 3HVDA 2REXA 2FCSA 2OEDA 2J0JA 3QA8A 1WGDA 1C1YB 3SFEB 5J17A 1DYQA 4E74A 5T8IA 2PE9A 5CHFA 1YJ1A 4GB9A 2ZVNA 4DQOC 3GOEA 4HWIB 3OAWA 1J8CA 3PTFC 2BBCA 1SE2A 1ZPSA 2DYMA 4MACA 2D11A 3PPAA 4LLGM 2PMVA 2PLPA 3PZ7A 1JRUA 2L8JA 1C4CA 1SJHD 1YOVB 2UYZB 3RI7C 4JL9A 5FR6A 1QLBB 2IBIB 1WYGA 3GZNI 4NZLB 3Q8EA 1KLGD 1RFAA 1MHHE 4M01A 4PT5A 1SSNA 4AUQC 5G5GA 3QX1A 1P7FA 3DOWA 2I1JA 2WXQA 4HJKA 4DHJD 2HTME 3QWZB 4L2YA 3RUIB 3H1UA 3A9KA 3CIRB 2BYEA 3ZRFA 2LRWA 4C7YA 3ZKJC 3DBHI 1MG4A 4BKTA 1D4BA 2LJ5A 3KYDD 2KK8A 3X0WA 3RNEC 4US9A 3H7SA 1NEKB 2GB1A 3NZUA 4EOYA 1OQRA 3E56A 5BYRA 3V3XA 2KAJA 3R7RA 2QMTA 1BMLC 1FD6A 1XCQL 1QQRA 4A90A 2KX0A 4IWPA 2ZPYA 2M0XA 1IGCA 2VH1A 2AL3A 2G45B 4Q2JA 1F77A 3AE2B 4AOFA 1ZKHA 1ZGUB 5C23A 4NAMA 3HRDD 2QSDA 3VH4B 1YD8U 3WAMA 2A4ZA 2PVOD 2LHDA 3VR9B 2EKIA 2IGHA 1FPYA 2EMTA 3RD2A 2FIFA 4TV3A 3AULA 3A1QB 4G0NB 2X8XX 4M8MA 1C78A 3P4RB 3IT6B 4MM3B 2H88B 4IC7B 4MJSA 3OLMD 2KDEB 2K3UA 3B0AA 3Q69A 2KVZA 2INCC 2M17A 1H8CA 4RMAA 1KFYB 1WM3A 2V9HA 5D6JB 1TZ1A 4BKSD 1L7YA 3Q8CA 1HEZE 5JHBA 4ICVA 1OEYJ 1I7HA 1D6EC 3BK2A 3KW5B 5AZGA 4IM2A 1F2RI 2NS5A 1CQVA 4GSWA 4MT5A 1P1AA 2IJ0A 3P63A 2DZJA 1Q10A 2IY0B 2BWFA 5JZEB 1ROEA 2E6XA 4AWJA 1E8XA 1EM7A 4GN1A 4JQWC 3RT3B 4GOCA 1N62A 4LNOA 1ZE3D 3O65B 1WGKA 4FXCA 1JQ4A 3NG0A 3EGRA 3VTVA 2KMCA 1Q5WB 3JSVB 1WJNA 3MC0B 3SHQA 1QOBA 1CJEA 4XX5A 2LMCA 3BINA 4ANUA 1P98A 3QIJA 4YSZB 3EFUA 1HZ5A 1GB1A 4ARCA 1V2YA 2GMIC 3DWGC 2WU2B 1WZ3A 2G4DB 1F1HA 1WRDB 1KLVA 2QHOA 2JU6X 4KZCA 4S0RA 1WGYA 3ZYYX 1VCBA 2JZPA 2DAFA 1WSPA 2JVCA 1I4GA 1K8RB 1NENB 2A5UA 3ZO5B 4OHJA 5L95C 1GAQB 4MJSB 3M63B 1EU3A 4ACFA 1FNUA 1MVKA 4A3OA 4WJQA 2BB5A 1L0XB 1FFVA 1GOZA 2LI5A 3U52E 3QJZA 4N9F4 2DZMA 2BYVE 1C79A 2Q5WD 3IAS1 1V5TA 2GBMA 3B2GA 4OZCA 1QOFA 2Y5PA 2L83A 4RGTA 5AUIA 2FCQA 2Y3AA 1MI0A 3K9OB 1T0QC 2KXJA 2WU5B 3IFWB 3OJ3A 3UQBA 4N58A 2VZKD 2C9WB 3MC9A 2VZKB 3L4PA 1Q0WB 4MEMA 4DDGD 4JGHB 2M1MA 2ZNVC 2QIEB 2KYWA 3VRBB 3IVFA 1GUAB 5HG2A 2W3RA 3KUCB 4GU2A 3NZ3A 2KTRB 2DHZA 2NTTA 1AYFA 4MGIE 1K52A 1HE8A 5D3IB 3RNBC 3PGEA 1WRIA 1FRRA 3Q3OC 1YJIA 2WDRB 1DOIA 2I2YA 3DHHC 3H8HA 4W9LA 3I3TB 1UBIA 3S2AA 3W1SC 1SE9A 2N7EA 4K81A 4XDCA 2UWQA 2ZJDA 1ISNA 2AQ3B 2FIDA 2IDYA 4P7IA 2KDMA 4TQ0A 4XWWA 3M3JA 2PW9A 5J2RA 1D5ZC 3VUYA 3RNGC 2KWUB 3VUXA 3ZTDA 2LGYA 1FEHA 2IO0B 4NQKE 1WI0A 4XWTA 2MHJA 2GI9A 3GS2A 2INPE 3AMZA 4C4VB 4ZYSA 2I38A 4W9EA 2DWQA 4FJZA 4KV2A 1TT5B 2HTHA 1XQQA 2D07B 2M4NA 2HD5B 2ONQA 4II3B 4PS3A 3SR6A 2L32A 4RM9A 1L0VB 3U8ZA 3GE8C 2GBJA 4OW0A 4C4VA 4YXDB 5JHAA 4RH6A 1TKGA 2WYQA 2GOWA 2BYTA 4HCNB 5BMIA 2LASA 3P42A 4RM8A 3ENEA 4KGSA 3HM6X 4B6WA 4B9KA 1U4AA 3I57A 3TUOA 3EFCA 1UZXB 4KIKB 1KLUD 5EE0A 4BAXA 1VLBA 5H92C 2Z0DB 2M0AA 3NHEB 2W82A 2LHEA 3BVZA 2CU1A 1UUPA 3ZUNA 4CQNA 2FAZA 2LEKA 1S3SG 2XNAC 2WNMA 5IA7A 1FMAD 2K8HA 1SE3A 2DENB 1KOTA 4FULA 2YEPF 2I1KA 4NAWB 4QAYA 2SAKA 4MSQB 1WXMA 5IKCM 4BOSC 3BK1A 5HFYA 3DDCB 5JXVA 4HKZE 1ET6A 3A9JA 2ZEQA 3RNCC 2KMAA 2D10A 2LRUA 3EA6A 2V1YA 1GB4A 1UBQA 4LNIA 1P7EA 2G3QB 1ZDXA 3HK0A 4OZAA 1T5XD 4HPLB 4W9FA 2N9KA 5CTRC 1XXGA 2KX3A 2NBWB 3ZIMA 2JZ3B 1OGWA 4XE0A 4DHJB 2YEPB 5BMGA 4MGZE 1WXVA 3AH7A 2GBNA 2MX2A 1V1PA 1GJZA 5IOIA 2IZVB 4HRSA 2DYOA 2MJDA 3PHXB 3N1YC 3ZTCA 4DDID 3I63C 4R3DA 4FBJB 1PGBA 2OJWA 2WXJA 1TGZB 1K50A 2WHIA 3LDZE 1B9RA 3GP7A 1FCLA 3BVMA 2J7QB 2J0MA 2WXLA 1J0GA 3AEBB 3QAQA 1J19A 2V4LA 4ZRQA 3H6NA 2N4FA 1E8WA 3IBEA 3PT2B 4EFOA 1L4ZB 1QOGA 1QT9A 2D5GA 3JW0X 4FJVB 4N59A 3UF8A 1FRDA 2N7DA 3NVZA 3WAPA 1SF0A 2JZZA 4LDTD 2DZIA 4A3PA 1YN5A 4W9KA 4KSLC 3ONSA 2D2QA 1TJEA 1PGAA 1H4RA 1QF6A 2M8SA 4DK5A 4HVBA 3QARA 2W9NA 4EZLA 3Q3NC 1CZPA 5FR3A 1EWYC 2XEWA 4GGQA 5TSSA 4KX6B 3VRAB 2LGSA 3VR8B 2NMQA 1I42A 1OQYA 4HDOA 3RULA 1JRPA 3A9KB 1WF9A 4MH0E 4UDUC 4HCPB 1C4AA 2KLCA 1T0YA 4XGAB 2L76A 3FILB 1I4PA 2C60A 2DYBA 4OVUA 1JROA 3WAOA 2AWTA 3ZJUA 4MSMB 4ICUA 3W1YA 1SEBD 4DXGA 3MFGA 3ZQ4A 3ZJTA 2KWDA 1SJED 2KO3A 1E8ZA 3IT4B 3KUDB 3KWLA 4G50A 2WP9B 2GLSA 4EKUA 4KGTA 3PV1A 5AZHA 2ICIA 3QCAA 4IKGA 3APFA 2JX5A 2LGDA 1ZW7A 1BUIC 1EF5A 5E6NA 4G11A 3TBLD 1N61A 2LWPA 1V80A 4TUUA 2L05A 4RGMA 3ZNID 2QC8A 1V97A 2PVGC 4C56C 1V81A 2IO2B 2KLGA 2HDEA 4M00A 4ASWC 4TSSA 3A33B 5L83A 2LGIA 5DPTA 1WE6A 2IGDA 2OJRA 3DVNV 5KHOA 4B95A 2KWCA 3PREA 2EMSA 5EE1A 1ACCA 3WIMA 1PFDA 3I5JC 1KJTA 1N60A 2CKHB 5D3DA 4LNKA 3MJ5A 2AEHA 3AE9B 3X23A 2BQQA 3W5VB 2DX5B 3QQ8B 1QOAA 3JYUA 5AEKB 3FC4A 3APDA 4WJNA 1ET9A 4LNNA 2NPTA 2BS2B 4RF1A 3KQ4A 5E6JA 4M8NA 2BYFA 2RDGA 1TS4A 4TMAB 3U30A 4I6PA 4LJPB 4E71A 2K39A 4J6IA 3UIPB 1WWTA 2KDFB 2WXMA 4MELA 4LTUA 3Q2AC 4NJ7A 2INNE 2J4XA 3OG5A 3RZWC 2DAJA 4F8CB 2OHFA 2KTFA 4K3CA 3RPFC 1XLOA 2K5PA 3CWIA 1P9DU 5BYSA 2ZNVB 4NPNA 2NR2A 3NUHB 4JIOU 3TJPA 4NJCA 2KFKB 2W3SA 4RCOA 4FADA 4KVGB 4RFBA 5IN7A 1PGXA 3H7PB 2V3NA 3Q3FA 3HM3A 2WX0A 4L1BA 1N6ZA 3AM9A 1E10A 2PTLA 3BIID 2WLBA 3Q6BA 3A4RA 2V0GA 4MDKE 1CMXB 2VRRB 2LUEA 3CMMB 2N9LA 3U2SC 2V3PA 1NVID 3P2BA 3ZW3A 1WX9A 4LK0M 2LVOA 4CYEA 3LXFA 4FHKA 1OEYA 1I4XA 3O13A 1JALA 2IGGA 1TS3A 2NCNA 2KFJA 1C76A 3EECA 1MFWA 1LFDA 3H7PA 2O6VD 3N1XC 4AJYB 2L0FA 1OFFA 3APCA 1T0SC 3AEDB 3VH3B 1JWUD 1TY2A 3VVWB 1TS2A 4NQLB 1L0YB 1I4RA 1WM2A 2PJHA 3DBSA 2MA9B 2LZ6A 3AEGB 3CSTA 1SGHA 4IUMB 1PUTA 1V86A 1KRHA 3TMPB 3ZVVA 2CR5A 3M62B 4ANXA 2ZW0A 3N1ZC 2INDC 2WXGA 4HROA 3LYYA 3NS1A 1GC6A 5E6PA 1RWSA 2KKCA 3GZNB 2M56B 3GE3C 2CS4A 4FA6A 3AU5A 3IG3A 1A5RA 2IPKD 3W5UB 1YN3A 1ZP0B 5AZFA 3Q14C 3A9JB 1CK1A 1YJJA 1JCKB 2FE8A 2XK5A 2WXIA 1JWSD 4B0MA 3PVLA 2TSSA 4W9GA 3NJTA 2MCNB 1V6EA 2O2VB 1E6EB 1E90A 3PHWB 5C2TB 1AN8A 3NY5A 3DWMA 2MWSB 3JSVA 4CO7A 3P4SB 3IXSA 1BXTA 3B9JA 2W54A 4AQ7A 2WQYB 4IM0A 1P0RA 1TKYA 2EELA 4ZRPA 2BVCA 2D3AA 5HHDG 2KD0A 1RLFA 1YX5B 4RGNA 2MSED 2IY1B 4F1SA 1HA5A 4P1CC 3R7QA 4BBNC 1MPEA 5D94A 2KQ4X 2N9XA 3PO0A 2ZPNA 4JLCA 3PRZA 4KGRA 1F0ZA 2G1EA 4AS1A 1ZDVA 4OZBA 3RMKC 4GDLA 1NI2A 2MH7A 4IDIA 1EF1A 3ZLZA 4BKSA 3AEEB 1Y8RC 4FJYA 2MP2A 2V4IB 2JF5A 2NPTB 5HI1A 3RNFC 3QK0A 4KDLB 2SEBD 3ABVB 4J3OD 3L13A 2RDBC 1BT0A 3NRZA 1NI3A 2K25A 2CJNA 2Z8LA 4GDKB 2JY6A 1HXYD 1HTOA 3SDLC 3TEXA 2C7HA 2N9PC 5BO4B 2IYDB 5FKAC 4EEWA 2KNBA 4P16A 1UGJA 4YTPB 3KH0A 4MGKE 2ON8A 3ALBA 3U7DA 4GDKA 4M0WB 4XYCA 5IP4D 3ZNGC 1A70A 5LXIB 4N6EB 3KYCD 1SBBB 4K1RB 3TL5A
chains in the Genus database with same CATH topology
4KX6B 3VRAB 4A6QA 3ZGZA 1SE4A 1JWBD 4JE3B 3VR8B 3E9SA 2NMQA 3BVGA 1C78A 3P4RB 3TSSA 3IT6B 1Y56A 4MM3B 3EUB2 1UWMA 1R7SA 2H88B 1ZUD2 1SB3C 1QKZA 3AE8B 1JRPA 1L6UA 2MJ3A 1FNWA 2PKOA 1STEA 2K3UA 4UDUC 3Q69A 5EE9A 3Q8BA 5LNK1 1C4AA 3BYTB 1UNSA 4ZHOA 5H8YE 1KFYB 2WXHA 1EU4A 3P4QB 3R2IA 3Q8CA 1HEZE 3AN1A 2LFIA 1I7HA 4GDLB 1D6EC 1ZXIA 3BK2A 5D7GA 1E0ZA 2JYEA 1F2RI 1YNTE 2FUG1 1V1PB 1CQVA 3AV8A 1I4PA 1VZ6A 3BZDB 3FILB 4MT5A 4TQ1A 2KACA 2PIAA 4A8XC 2IJ0A 3P63A 2J52A 2BS3B 1Q10A 2JYTA 1JROA 3NVWA 1ROEA 2E6XA 2FBWB 3ZJUA 1EM7A 2E3TA 3TEZA 1XLPA 1DGJA 2BB6A 5C3JB 1SEBD 4DXGA 3MFGA 3ZQ4A 2WXOA 3ZJTA 2B76B 1SJED 2KWDA 4YSYB 2BTEA 4OVZA 2JQRB 1SXTA 1N62A 3IT4B 1ZE3D 3I9V1 1C9FA 3KWLA 1WGKA 2WP9B 4FXCA 1JQ4A 3EGRA 1V1OA 3UI3A 3FILA 3MC0B 1N5XA 1QOBA 4KGTA 1VDVA 1CJEA 2ICIA 1XO3A 4IKGA 2W55A 2LMCA 2JX5A 4YSZB 1BUIC 3LB8C 1VJKA 1HZ5A 1GB1A 1UWXA 1WXQA 1YQ3B 3WCQA 1T6BX 4ARCA 1N61A 3N9YC 3GB1A 5MPOA 4YTMB 3DWGC 3B2FA 3V05A 2WU2B 4RGMA 2DLBA 2L1AA 1SIJA 1V97A 1B1ZA 2PVGC 4C56C 2JU6X 4A55A 1XLQA 2WS3B 3ZYYX 2X38A 2QEJC 2HDEA 3TEWA 1KH0A 4TSSA 2JZPA 1WSPA 2LGIA 2AQ2B 1I4GA 2IGDA 2CU3A 1NENB 1XEEA 4OHJA 1GAQB 1V8CA 5EE1A 1EU3A 1ZXHA 1ACCA 2RPVA 1FNUA 1MVKA 2BB5A 1OQQA 3AEFB 1PFDA 3U7ZA 3SFDB 3FAHA 1L0XB 1AW7A 1FFVA 2J42A 2WXPA 1N60A 1GOZA 1JWMD 2WDVB 4WURA 3U52E 1FO4A 4HKQA 1RM6C 3AE5B 5D3DA 3MJ5A 1JMLA 3MP9A 3AE9B 3P4PB 2Q5WD 1C79A 1TKEA 3J9CA 3IAS1 3W5VB 3B2GA 4OZCA 3AB5A 1QOFA 2Y5PA 2L83A 4RGTA 2H89B 1K53A 5BYQA 1TZOA 1N63A 3HVZA 1QOAA 5AUIA 2Y3AA 3BWUD 3FC4A 1FXIA 1MI0A 2WU5B 2QJLA 2QILA 2WDQB 4N58A 1ET9A 1FCCC 2VZKD 3MHZA 3W1SA 1C4PA 3BYYB 2VZKB 2RDHA 2BS2B 4RF1A 2G9HD 2K9XA 2JSVX 2L52A 3L4PA 1YQ4B 3KQ4A 5E6JA 4D2KA 3RFZB 1TYGB 2BT6A 2WXRA 2QIEB 2RDGA 1JWAD 3VRBB 2KMMA 1TS4A 4TMAB 5HG2A 1KTKA 2W3RA 4EE2A 2RMMA 3TEYA 3NZ3A 3ZJVA 2NTTA 1AYFA 1WWTA 1K52A 2WXMA 3URYA 2BS4B 1ESFA 3AEAB 2NTSA 2WXNA 5D3IB 4YSXB 1WRIA 4LTUA 1E9MA 1XF5L 1PDXA 1FRRA 1M4VA 2INNE 2J4XA 1XLNA 3C8YA 1TS5A 1K51A 1YJIA 1IUEA 2WDRB 1DOIA 2DBYA 2OHFA 2I2YA 3W9CB 3H8HA 4ZOHC 3RPFC 3ETRA 1XLOA 2K5PA 4WQMA 3CWIA 5BYSA 4WH4A 4XDCA 1E7PB 1IBXA 2ACZB 2AQ3B 2IDYA 3NUHB 2KDMA 4TQ0A 1L5PA 4XWWA 4NJCA 2K22A 2MEKA 2PW9A 4YTNB 2W3SA 4RCOA 1D5ZC 1EWCA 1D5MC 4RFBA 1PGXA 2V3NA 1FIQA 2AX5A 1FEHA 4JPSA 1XCTL 4XWTA 4L1BA 2GI9A 3AM9A 3AE3B 1E10A 1VZ7A 2PTLA 4HJGE 5EE3A 3GS2A 3BIID 1GPXA 3AECB 2WLBA 1AWDA 1L4DB 1VZ8A 2INPE 2N0SB 2V0GA 3NVYA 3AMZA 4ZYSA 2I38A 3P1MA 2DWQA 4KKJA 2JWUA 4ZHPA 1IGDA 2N9LA 3U2SC 2V3PA 1NVID 3NVVA 4LK0M 4IOIE 1C77A 3LXFA 2WXFA 1I4XA 2ONQA 3O13A 1JALA 3SR6A 2L32A 1L0VB 2IGGA 1TS3A 4OW0A 4YXDB 4RH6A 1FXAA 1C76A 1TKGA 5FK9C 2BYTA 5BMIA 1OFFA 3P42A 1PYWD 3AE6B 1FFUA 1D5XC 3AE4B 3AEDB 1JWUD 4WAFA 1TY2A 3AE1B 4P6VF 1TS2A 4KGSA 4WIPA 3W2DA 2KN4A 1HZ6A 2J53A 1L0YB 2Y5CA 3I57A 3TUOA 1I4RA 4REZA 3U4EG 4RNAA 3SEBA 1KLUD 3AEGB 5EE0A 4ARIA 3AE7B 1VLBA 1PUTA 5H92C 2M0AA 1RYJA 2W82A 4MH8A 2K0PA 1KRHA 2LHEA 3BVZA 3R2TA 1UUPA 1LO5D 4KKIA 1FNVA 4HEA1 4CQNA 2ZW0A 4USAA 2LEKA 1MHXA 1YN4A 1VRAB 2WXGA 2WNMA 2WXKA 2XNAC 3LYYA 3PZ8A 4HROA 1FMAD 3OWEB 3NS1A 1SE3A 2GRIA 2LUMA 4JWUC 1RWSA 1HQRD 5AUKA 1I4QA 2BW2A 3KLSX 1J7BA 4RF0A 1I4HA 2JXTA 1TY0A 5G5HA 2M56B 2YEPF 4NAWB 2LJIA 2SAKA 2CJOA 3VQIA 3Q8AA 2IPKD 3W5UB 1YN3A 3BK1A 3HVDA 1ZP0B 5HFYA 2OEDA 1CK1A 1YJJA 5JXVA 1JCKB 2FE8A 4HKZE 1ENFA 5GXGB 1ET6A 2WXIA 3HUIA 1YMHE 1JWSD 4B0MA 3SFEB 1F2RC 3T3OA 2TSSA 1DYQA 5T8IA 1T3QA 3EA6A 1E6EB 5C2TB 1AN8A 3DWMA 1GB4A 4DQOC 4H2AA 4US8A 1P7EA 3P4SB 3IXSA 1ZDXA 1BXTA 3B9JA 2W54A 4AQ7A 2BBCA 1SE2A 1T5XD 1ZPSA 2DYMA 2MJEA 2WQYB 1ZOYB 4MACA 4OZAA 4LLGM 4YWGG 3T3NA 2R61A 1TKYA 2N9KA 2EELA 2PLPA 2PMVA 3PZ7A 1C4CA 1SJHD 4ZRPA 4A9AA 1XXGA 5HHDG 4RGNA 1QLBB 4XE0A 1HA5A 1WYGA 4ITKA 4C7ZA 4NZLB 2YEPB 5BMGA 1MPEA 3Q8EA 2KQ4X 1KLGD 3AH7A 4XDDA 3PO0A 1MHHE 1V1PA 4PT5A 1SSNA 4KGRA 1KF6B 5G5GA 1F0ZA 2G1EA 1P7FA 4AS1A 4HRSA 1ZDVA 2DYOA 2WXQA 2MJDA 4OZBA 3R8BA 4R3DA 1FM0D 2HTME 2MH7A 4IDIA 4L2YA 1DOYA 2M19A 1PGBA 3CIRB 3AEEB 2WXJA 1B9RA 1K50A 3GP7A 1FCLA 4C7YA 1N5WA 3BVMA 1NYQA 2V4IB 1D4BA 4JX1C 5HI1A 2WXLA 3AEBB 2AQ1B 3IAM1 1L6VA 4US9A 1NEKB 4ZRQA 2GB1A 2ZW1A 1OQRA 1J7AA 3E56A 2SEBD 3ABVB 4J3OD 5BYRA 3V3XA 2KAJA 2QMTA 2XN9C 1BMLC 3NRZA 1XCQL 1FD6A 1L4ZB 1NI3A 1QOGA 1QQRA 1QT9A 4YT0B 1DOXA 2D5GA 2CJNA 5BMHA 2Z8LA 4DXFA 4GDKB 4A90A 4O1NA 1QILA 1HXYD 4N59A 3Q8FA 3TEXA 1IGCA 1FRDA 3NVZA 4Q2JA 4GLSC 1F77A 3AE2B 5FKAC 4C80A 1SF0A 4P16A 4NAMA 3HRDD 1UGJA 4M0WA 2QSDA 4YTPB 1YN5A 3KWVA 2PVOD 1NYRA 4JWSC 2LHDA 2ON8A 1TJEA 3VR9B 1PGAA 2EKIA 2N7JA 1QF6A 4RGOS 1IBXB 2IGHA 1VR9A 4L23A 1A70A 1J7CA 4WWMA 1CZPA 4B0EA 1RFKA 5FR3A 1EWYC 1JW9D 4N6EB 1SBBB 5I4DA 5TSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KX6 B;  2CU3 A;  1NEN B;  5EE3 A;  3VRA B;  3B9J A;  3BII D;  2W54 A;  3AEC B;  1GPX A;  2WLB A;  1JWB D;  1AWD A;  2MJE A;  2N0S B;  2WQY B;  1ZOY B;  3VR8 B;  1GAQ B;  1V8C A;  5EE1 A;  3NVY A;  3AMZ A;  1TKY A;  3P1M A;  2DWQ A;  3P4R B;  4A9A A;  1OQQ A;  3EUB 2;  1UWM A;  1R7S A;  1PFD A;  2H88 B;  3AEF B;  3SFD B;  4ZHP A;  3FAH A;  1FFV A;  1ZUD 2;  1QLB B;  1SB3 C;  1N60 A;  1NVI D;  3AE8 B;  3NVV A;  1JRP A;  1L6U A;  1WYG A;  2MJ3 A;  2PKO A;  2WDV B;  4ITK A;  1FO4 A;  1RM6 C;  3AE5 B;  3LXF A;  5EE9 A;  4C7Z A;  1JAL A;  3SR6 A;  1L0V B;  3AH7 A;  3AE9 B;  3P4P B;  2Q5W D;  3PO0 A;  1TKE A;  1KFY B;  5H8Y E;  4YXD B;  4ZHO A;  3W5V B;  3B2G A;  3P4Q B;  1FXA A;  1TKG A;  3AN1 A;  1KF6 B;  3AB5 A;  1QOF A;  1I7H A;  2L83 A;  1ZXI A;  2H89 B;  5G5G A;  1E0Z A;  1OFF A;  1F0Z A;  2G1E A;  1N63 A;  3HVZ A;  1QOA A;  4HRS A;  3AV8 A;  3AE6 B;  1FFU A;  3AE4 B;  3AED B;  2MJD A;  5AUI A;  3FC4 A;  3AE1 B;  2PIA A;  1E10 A;  1FXI A;  2WU5 B;  1FM0 D;  4P6V F;  2HTM E;  3P63 A;  2MH7 A;  2QJL A;  4IDI A;  1DOY A;  2BS3 B;  2M19 A;  2WDQ B;  4N58 A;  3CIR B;  1JRO A;  3NVW A;  1ROE A;  2BS2 B;  2FBW B;  3AEE B;  2E3T A;  2K9X A;  2Y5C A;  1B9R A;  2L52 A;  3L4P A;  4C7Y A;  1XLP A;  1N5W A;  1DGJ A;  1YQ4 B;  5C3J B;  1NYQ A;  1TYG B;  2BT6 A;  2B76 B;  4YSY B;  2JQR B;  3AEG B;  4JX1 C;  5EE0 A;  3AE7 B;  1N62 A;  2QIE B;  3AEB B;  1VLB A;  1JWA D;  3VRB B;  1PUT A;  5H92 C;  2KMM A;  4US8 A;  1L6V A;  1RYJ A;  4US9 A;  1NEK B;  2W3R A;  3KWL A;  1KRH A;  1OQR A;  1J7A A;  1WGK A;  2WP9 B;  3ABV B;  4FXC A;  1JQ4 A;  4USA A;  1AYF A;  2LEK A;  1WWT A;  1N5X A;  1QOB A;  2KAJ A;  2BS4 B;  1VDV A;  4HRO A;  1CJE A;  1FMA D;  3AEA B;  3NRZ A;  4YSX B;  1XO3 A;  1NI3 A;  3NS1 A;  1QOG A;  1WRI A;  1QT9 A;  4JWU C;  4LTU A;  4YT0 B;  1RWS A;  1DOX A;  2W55 A;  2CJN A;  1E9M A;  1PDX A;  1FRR A;  2JX5 A;  5AUK A;  1XLN A;  4YSZ B;  1J7B A;  3LB8 C;  1YJI A;  1VJK A;  1IUE A;  2WDR B;  1DOI A;  2DBY A;  2M56 B;  2OHF A;  4N59 A;  5G5H A;  3W9C B;  1WXQ A;  4ZOH C;  1YQ3 B;  3WCQ A;  1FRD A;  3NVZ A;  3RPF C;  3ETR A;  1XLO A;  1N61 A;  2CJO A;  2K5P A;  4WQM A;  3AE2 B;  3W5U B;  3DWG C;  3CWI A;  3B2F A;  4C80 A;  1SF0 A;  2WU2 B;  4YTM B;  5MPO A;  1ZP0 B;  3HRD D;  1E7P B;  2ACZ B;  1SIJ A;  1YJJ A;  4YTP B;  1V97 A;  1L5P A;  1NYR A;  2PVO D;  5GXG B;  2PVG C;  4JWS C;  2K22 A;  1TJE A;  3VR9 B;  3HUI A;  2EKI A;  2W3S A;  4YTN B;  1QF6 A;  3SFE B;  1XLQ A;  2WS3 B;  3ZYY X;  1A70 A;  1J7C A;  4WWM A;  1FIQ A;  1T3Q A;  1CZP A;  1E6E B;  1RFK A;  1EWY C;  2AX5 A;  1JW9 D;  5C2T B;  3DWM A;  4N6E B;  3AM9 A;  3AE3 B;  3P4S B; 
#chains in the Genus database with same CATH topology
 4A6Q A;  4F7Z A;  3ZGZ A;  1JWB D;  4JE3 B;  2KC2 A;  3EC8 A;  3E9S A;  5J18 A;  2MLB A;  5DPW A;  3DVG X;  3EUB 2;  3ZRC A;  1TBE A;  2JWZ A;  2PEA A;  1R4N B;  1SB3 C;  1QKZ A;  3AE8 B;  4M02 A;  2MJ3 A;  2PKO A;  3SD5 A;  4EZJ A;  3WA0 A;  5DPR A;  2RPQ A;  4PYZ A;  1UNS A;  4ZHO A;  2RSU A;  5H8Y E;  2WXH A;  1EU4 A;  3P4Q B;  3HIZ A;  3N30 A;  5KHQ A;  3AN1 A;  2LVQ A;  2LFI A;  4GDL B;  1ZXI A;  3DBR I;  4WAA A;  5D7G A;  2K8C A;  2JYE A;  2FUG 1;  1YNT E;  4ZRJ A;  1V1P B;  3AV8 A;  3BZD B;  4TQ1 A;  1WX8 A;  3AU4 A;  2J52 A;  4IG7 B;  3B08 A;  3NVW A;  3RN9 C;  2FBW B;  2E3T A;  4K3B A;  3TEZ A;  1DGJ A;  2BB6 A;  5C3J B;  2L3Z A;  2B76 B;  3WAL A;  3KUZ A;  3BY4 B;  4IM3 A;  4LDT B;  3DBH B;  1V1O A;  1WXA A;  3UI3 A;  1N5X A;  3VHT C;  1V49 A;  1VDV A;  2MBB B;  2CHZ A;  3DPD A;  4HPP A;  2W55 A;  4HDQ A;  4G3X B;  3LB8 C;  4NY0 A;  1UH6 A;  3UIN B;  3TIX A;  1WXQ A;  1YQ3 B;  3WCQ A;  1T6B X;  4URK A;  5MPO A;  4YTM B;  3V05 A;  3ZXR A;  2DLB A;  2WDT B;  1WYW B;  2EKE C;  1LXD A;  2KT7 A;  1XLQ A;  2LGX A;  2X38 A;  2QEJ C;  1KH0 A;  5JH5 C;  3R3M A;  2AQ2 B;  2CU3 A;  2O2V A;  2ZCB A;  1WJ6 A;  1XD3 B;  1ZXH A;  4DXA B;  1OQQ A;  3AEF B;  2BKR B;  3U7Z A;  3FAH A;  2J42 A;  2WXP A;  1Z2M A;  1TTN A;  1JWM D;  2WDV B;  1FO4 A;  3V61 A;  1RM6 C;  1JML A;  4BBN F;  3P4P B;  1TKE A;  2BGF A;  1LGR A;  2ZZP B;  3AB5 A;  2H89 B;  3DBR B;  1TZO A;  4AJW A;  2MW5 A;  3HVZ A;  3RCZ A;  3BWU D;  2C5L C;  4XZ4 A;  3AI5 A;  2VH2 A;  2QIL A;  4EZK A;  3W1S A;  3BYY B;  2RDH A;  2G9H D;  4C00 A;  2L52 A;  2B3A A;  4BKG A;  3RFZ B;  1TYG B;  2BWE S;  3DVG Y;  4I6L B;  1JWA D;  3OJ4 B;  1E7U A;  1KTK A;  5D2M B;  2RMM A;  3TEY A;  2LD9 A;  2NVU I;  2GBR A;  4ANV A;  2K8B A;  3ML8 A;  3R66 C;  2BS4 B;  1ESF A;  2NTS A;  4IW0 A;  4HLE A;  3H9D A;  3DBL B;  1PDX A;  1V9J A;  4ZDV A;  4W9C A;  1K51 A;  3W9C B;  4ZOH C;  4WQM A;  2DNF A;  1GC7 A;  1E7P B;  2BF8 B;  1IBX A;  4S17 A;  2PE6 B;  4X57 B;  4FN2 A;  2V3S A;  4MGY E;  1L5P A;  2K22 A;  2UU7 A;  2MEK A;  4YTN B;  1XT9 B;  4YL8 A;  2O6V A;  3QC8 B;  1FIQ A;  2DZK A;  2AX5 A;  3QHT A;  5G55 A;  1XCT L;  2JPH A;  2HJ8 A;  1VZ7 A;  4HJG E;  3DHI C;  1AWD A;  1VZ8 A;  2N0S B;  2PPH A;  3P1M A;  5CX3 A;  4KKJ A;  2JWU A;  4ZHP A;  1IGD A;  1VD2 A;  1SIF A;  1C77 A;  2K6D B;  3KVF B;  4W9J A;  4KIK A;  4W9H A;  2XK5 B;  1R4M B;  2FUH B;  4WJO A;  2AYO B;  1FXA A;  1GNU A;  2MP2 B;  2KOX A;  1PYW D;  3ZDT A;  1NDD A;  1D5X C;  3AE4 B;  3AE1 B;  3MC8 A;  4P6V F;  4WIP A;  3C0R B;  4K7U A;  3DHG C;  3W2D A;  2IO3 B;  2K1F A;  2KN4 A;  3L0W B;  1KM7 A;  4IWO A;  2RR9 A;  2FCN A;  4RNA A;  5DPS A;  3L10 B;  2KDB A;  4ARI A;  3AE7 B;  2Z0E B;  3EHV A;  4MH8 A;  2K0P A;  3R2T A;  1LO5 D;  2KFK A;  5DCN A;  1WY8 A;  4HEA 1;  4KDI C;  3PS6 A;  1MHX A;  1YN4 A;  3SU8 X;  1YIW A;  2WXK A;  2CHX A;  2FCM A;  3PLU A;  4PS7 A;  3OWE B;  2LXC A;  3V6E B;  1HQR D;  5AUK A;  1I4H A;  1TY0 A;  3D32 A;  2LJI A;  3VQI A;  2CJO A;  2KJ6 A;  1R4M I;  1C3T A;  2BKF A;  2MBH A;  2LXA A;  4FHJ A;  4WWO A;  3PSE B;  1ENF A;  5GXG B;  1UD7 A;  3HUI A;  1YMH E;  1F2R C;  3T3O A;  1T3Q A;  2D3B A;  1NBF C;  1FXT B;  4H2A A;  4US8 A;  1I35 A;  4DWF A;  5CHV C;  3ZXV A;  4YWG G;  2MJE A;  1ZOY B;  3T3N A;  2R61 A;  4AP4 C;  4A9A A;  1WGH A;  3ML9 A;  3L08 A;  4BFR A;  3T8M A;  4ITK A;  4W9I A;  4C7Z A;  1Q1O A;  2D3C A;  2GBK A;  2KQ7 A;  2KQS A;  2KTR A;  4XDD A;  1WGG A;  1AAR A;  1KF6 B;  3MTN B;  2MBQ A;  3C19 A;  3R8B A;  1FM0 D;  1DOY A;  2M19 A;  4NJ6 A;  3K9P B;  1V5O A;  1N5W A;  1MJD A;  4WWN A;  1NYQ A;  1EO6 A;  3N3K B;  4JX1 C;  4A20 A;  3RYT A;  3WAN A;  2KAN A;  3Q3J A;  2AQ1 B;  3IAM 1;  3VDZ A;  1L6V A;  2ZCC A;  1MG8 A;  2ZW1 A;  1J7A A;  2WX1 A;  3T9L A;  4LCD E;  3PLV A;  3CSF A;  2XN9 C;  2MBE A;  2MBO A;  4YT0 B;  1DOX A;  5BMH A;  3RNA C;  4DXF A;  4DHZ E;  4O1N A;  1QIL A;  1E8Y A;  1F9J A;  3Q8F A;  1D3Z A;  1IPG A;  3IHP C;  4GLS C;  4C80 A;  4M0W A;  3KWV A;  1NYR A;  3HHM A;  4JWS C;  2NBU A;  4GMV A;  2N7J A;  4RGO S;  1IBX B;  1VR9 A;  4L23 A;  1Z5S B;  1J7C A;  4WWM A;  3VAW A;  4EUT A;  4B0E A;  1RFK A;  5IO9 A;  1JW9 D;  1EUV B;  2XBB C;  1WJU A;  2YVC A;  3NS8 A;  5I4D A;  3V62 A;  2YLM A;  1WE7 A;  2R2Q A;  1SE4 A;  3L54 A;  2L0T A;  3Q3M C;  3ZDM C;  4WWP A;  1UEL A;  3BVG A;  4I6N B;  1TIF A;  3CF6 E;  3TSS A;  4IWQ A;  1Y56 A;  1UWM A;  1R7S A;  2JT4 B;  4HPM B;  3FKY A;  1ZUD 2;  2KJH B;  3NOB A;  4K7W A;  1L6U A;  2QCZ A;  1FNW A;  1STE A;  5EE9 A;  1YX6 B;  3Q8B A;  5LNK 1;  2QDF A;  2R2O A;  3BYT B;  2WGS A;  3R2I A;  4GIV A;  1E0Z A;  3V60 A;  1VZ6 A;  2RD0 A;  4BVU C;  3ECI A;  2KAC A;  4ZRI A;  2KVR A;  2PIA A;  4A8X C;  2ZVO A;  3DCG A;  2BS3 B;  2JYT A;  4OVV A;  2JUO A;  3MJW A;  4WJP A;  1XLP A;  2KZR A;  1WX7 A;  2BTE A;  1S1Q B;  2WXO A;  4YSY B;  4OVZ A;  2JQR B;  1SXT A;  2O6V B;  3I9V 1;  1C9F A;  3UQA A;  4ZRK A;  3VTU A;  3NZS A;  2KJR A;  1E5W A;  3FIL A;  4K7S A;  2N1V A;  1XO3 A;  3A1Q A;  4PK1 A;  1WMH A;  3LJ3 A;  3ZNZ B;  3PRM B;  4GXB A;  1VJK A;  4MM3 A;  3PZD A;  1UWX A;  2AL6 A;  5HKH A;  3N9Y C;  3GB1 A;  1WJ4 A;  2C7M B;  3B2F A;  2RGF A;  1LQB A;  2L1A A;  1SIJ A;  1PQS A;  1WFY A;  1B1Z A;  2MRP A;  4A55 A;  2JRI B;  2WS3 B;  4P1B C;  2KDI A;  1HTQ A;  3TEW A;  1M94 A;  3RZF A;  2C7N B;  2N9E B;  4LJO B;  4NNJ B;  1OTR B;  1XEE A;  1WMH B;  1V8C A;  2RPV A;  4ANW A;  1IYF A;  3SFD B;  1AW7 A;  3N32 A;  4WUR A;  4HKQ A;  5GMV A;  2HJ1 A;  3AE5 B;  2WWZ A;  2D3G A;  3MP9 A;  4WQO B;  3ZNH B;  4DBG A;  3J9C A;  1IP9 A;  4PYU A;  2CHW A;  5E6O A;  5BYQ A;  1K53 A;  1WXS A;  1N63 A;  3L17 A;  2KWV B;  1FXI A;  5IAA C;  2QJL A;  2WDQ B;  1FCC C;  3PRP B;  3MHZ A;  1C4P A;  2K9X A;  2JSV X;  2Y5B B;  4NAW A;  1YQ4 B;  4D2K A;  5TR5 A;  3JVZ X;  2BT6 A;  2WXR A;  3M95 A;  1WGR A;  2KMM A;  1L2N A;  1G6J A;  4EE2 A;  1RAX A;  3VUW A;  3ZJV A;  4PS8 A;  2KN5 A;  2LVP A;  3URY A;  3AEA B;  4E3C A;  2WXN A;  4YSX B;  4ZYN A;  1E9M A;  1XF5 L;  1M4V A;  1WIA A;  1XLN A;  3C8Y A;  1TS5 A;  5LXH A;  1IUE A;  2DBY A;  3MHS D;  1R4N I;  3ETR A;  2KHW B;  2G4S A;  5EDS A;  4WH4 A;  2ACZ B;  3DBL I;  3UGB B;  1EWC A;  1D5M C;  4CHK A;  1T0R C;  2HE7 A;  4HXD A;  2FNJ B;  4JPS A;  4XC2 A;  3AE3 B;  1E7V A;  5EE3 A;  1GPX A;  1WR6 E;  3AEC B;  1L4D B;  2BPS A;  3B1L X;  3NVY A;  2JRH A;  1WZ0 A;  2L00 B;  3VXW A;  3TCA A;  1P3Q U;  2KC1 A;  3NVV A;  5CHW A;  1GG3 A;  4IOI E;  3AXC A;  1LM8 B;  3VFK A;  2WXF A;  4W9D A;  1UGM A;  4BOZ B;  1RRB A;  3A4S C;  3DVN U;  1WR1 A;  3DQV A;  5FK9 C;  2ASQ A;  3AE6 B;  1FFU A;  4WAF A;  4LNF A;  1F52 A;  1YQB A;  4II2 B;  2JXX A;  1HZ6 A;  5LLI A;  2J53 A;  2Y5C A;  4REZ A;  4TKN A;  3U4E G;  3SEB A;  3VTW A;  4BZA A;  4DHZ B;  4HK2 A;  2OOB B;  2L7R A;  3UIO B;  1RYJ A;  2Z59 B;  5C1Z A;  1QZE A;  2N1W A;  4KKI A;  1FNV A;  4USA A;  2MQJ A;  1VRA B;  4KSK C;  3PZ8 A;  1X1M A;  2GRI A;  2LUM A;  4JWU C;  1UF0 A;  3L16 A;  1I4Q A;  2K6Q A;  2BW2 A;  3KLS X;  4FLH A;  1J7B A;  4RF0 A;  5G2N A;  2JXT A;  5G5H A;  2J0K A;  3N20 C;  4KZ0 A;  2IO1 B;  1WH3 A;  2NBV B;  3Q8A A;  3V6C B;  3HVD A;  2REX A;  2FCS A;  2OED A;  2J0J A;  3QA8 A;  1WGD A;  1C1Y B;  3SFE B;  5J17 A;  1DYQ A;  4E74 A;  5T8I A;  2PE9 A;  5CHF A;  1YJ1 A;  4GB9 A;  2ZVN A;  4DQO C;  3GOE A;  4HWI B;  3OAW A;  1J8C A;  3PTF C;  2BBC A;  1SE2 A;  1ZPS A;  2DYM A;  4MAC A;  2D11 A;  3PPA A;  4LLG M;  2PMV A;  2PLP A;  3PZ7 A;  1JRU A;  2L8J A;  1C4C A;  1SJH D;  1YOV B;  2UYZ B;  3RI7 C;  4JL9 A;  5FR6 A;  1QLB B;  2IBI B;  1WYG A;  3GZN I;  4NZL B;  3Q8E A;  1KLG D;  1RFA A;  1MHH E;  4M01 A;  4PT5 A;  1SSN A;  4AUQ C;  5G5G A;  3QX1 A;  1P7F A;  3DOW A;  2I1J A;  2WXQ A;  4HJK A;  4DHJ D;  2HTM E;  3QWZ B;  4L2Y A;  3RUI B;  3H1U A;  3A9K A;  3CIR B;  2BYE A;  3ZRF A;  2LRW A;  4C7Y A;  3ZKJ C;  3DBH I;  1MG4 A;  4BKT A;  1D4B A;  2LJ5 A;  3KYD D;  2KK8 A;  3X0W A;  3RNE C;  4US9 A;  3H7S A;  1NEK B;  2GB1 A;  3NZU A;  4EOY A;  1OQR A;  3E56 A;  5BYR A;  3V3X A;  2KAJ A;  3R7R A;  2QMT A;  1BML C;  1FD6 A;  1XCQ L;  1QQR A;  4A90 A;  2KX0 A;  4IWP A;  2ZPY A;  2M0X A;  1IGC A;  2VH1 A;  2AL3 A;  2G45 B;  4Q2J A;  1F77 A;  3AE2 B;  4AOF A;  1ZKH A;  1ZGU B;  5C23 A;  4NAM A;  3HRD D;  2QSD A;  3VH4 B;  1YD8 U;  3WAM A;  2A4Z A;  2PVO D;  2LHD A;  3VR9 B;  2EKI A;  2IGH A;  1FPY A;  2EMT A;  3RD2 A;  2FIF A;  4TV3 A;  3AUL A;  3A1Q B;  4G0N B;  2X8X X;  4M8M A;  1C78 A;  3P4R B;  3IT6 B;  4MM3 B;  2H88 B;  4IC7 B;  4MJS A;  3OLM D;  2KDE B;  2K3U A;  3B0A A;  3Q69 A;  2KVZ A;  2INC C;  2M17 A;  1H8C A;  4RMA A;  1KFY B;  1WM3 A;  2V9H A;  5D6J B;  1TZ1 A;  4BKS D;  1L7Y A;  3Q8C A;  1HEZ E;  5JHB A;  4ICV A;  1OEY J;  1I7H A;  1D6E C;  3BK2 A;  3KW5 B;  5AZG A;  4IM2 A;  1F2R I;  2NS5 A;  1CQV A;  4GSW A;  4MT5 A;  1P1A A;  2IJ0 A;  3P63 A;  2DZJ A;  1Q10 A;  2IY0 B;  2BWF A;  5JZE B;  1ROE A;  2E6X A;  4AWJ A;  1E8X A;  1EM7 A;  4GN1 A;  4JQW C;  3RT3 B;  4GOC A;  1N62 A;  4LNO A;  1ZE3 D;  3O65 B;  1WGK A;  4FXC A;  1JQ4 A;  3NG0 A;  3EGR A;  3VTV A;  2KMC A;  1Q5W B;  3JSV B;  1WJN A;  3MC0 B;  3SHQ A;  1QOB A;  1CJE A;  4XX5 A;  2LMC A;  3BIN A;  4ANU A;  1P98 A;  3QIJ A;  4YSZ B;  3EFU A;  1HZ5 A;  1GB1 A;  4ARC A;  1V2Y A;  2GMI C;  3DWG C;  2WU2 B;  1WZ3 A;  2G4D B;  1F1H A;  1WRD B;  1KLV A;  2QHO A;  2JU6 X;  4KZC A;  4S0R A;  1WGY A;  3ZYY X;  1VCB A;  2JZP A;  2DAF A;  1WSP A;  2JVC A;  1I4G A;  1K8R B;  1NEN B;  2A5U A;  3ZO5 B;  4OHJ A;  5L95 C;  1GAQ B;  4MJS B;  3M63 B;  1EU3 A;  4ACF A;  1FNU A;  1MVK A;  4A3O A;  4WJQ A;  2BB5 A;  1L0X B;  1FFV A;  1GOZ A;  2LI5 A;  3U52 E;  3QJZ A;  4N9F 4;  2DZM A;  2BYV E;  1C79 A;  2Q5W D;  3IAS 1;  1V5T A;  2GBM A;  3B2G A;  4OZC A;  1QOF A;  2Y5P A;  2L83 A;  4RGT A;  5AUI A;  2FCQ A;  2Y3A A;  1MI0 A;  3K9O B;  1T0Q C;  2KXJ A;  2WU5 B;  3IFW B;  3OJ3 A;  3UQB A;  4N58 A;  2VZK D;  2C9W B;  3MC9 A;  2VZK B;  3L4P A;  1Q0W B;  4MEM A;  4DDG D;  4JGH B;  2M1M A;  2ZNV C;  2QIE B;  2KYW A;  3VRB B;  3IVF A;  1GUA B;  5HG2 A;  2W3R A;  3KUC B;  4GU2 A;  3NZ3 A;  2KTR B;  2DHZ A;  2NTT A;  1AYF A;  4MGI E;  1K52 A;  1HE8 A;  5D3I B;  3RNB C;  3PGE A;  1WRI A;  1FRR A;  3Q3O C;  1YJI A;  2WDR B;  1DOI A;  2I2Y A;  3DHH C;  3H8H A;  4W9L A;  3I3T B;  1UBI A;  3S2A A;  3W1S C;  1SE9 A;  2N7E A;  4K81 A;  4XDC A;  2UWQ A;  2ZJD A;  1ISN A;  2AQ3 B;  2FID A;  2IDY A;  4P7I A;  2KDM A;  4TQ0 A;  4XWW A;  3M3J A;  2PW9 A;  5J2R A;  1D5Z C;  3VUY A;  3RNG C;  2KWU B;  3VUX A;  3ZTD A;  2LGY A;  1FEH A;  2IO0 B;  4NQK E;  1WI0 A;  4XWT A;  2MHJ A;  2GI9 A;  3GS2 A;  2INP E;  3AMZ A;  4C4V B;  4ZYS A;  2I38 A;  4W9E A;  2DWQ A;  4FJZ A;  4KV2 A;  1TT5 B;  2HTH A;  1XQQ A;  2D07 B;  2M4N A;  2HD5 B;  2ONQ A;  4II3 B;  4PS3 A;  3SR6 A;  2L32 A;  4RM9 A;  1L0V B;  3U8Z A;  3GE8 C;  2GBJ A;  4OW0 A;  4C4V A;  4YXD B;  5JHA A;  4RH6 A;  1TKG A;  2WYQ A;  2GOW A;  2BYT A;  4HCN B;  5BMI A;  2LAS A;  3P42 A;  4RM8 A;  3ENE A;  4KGS A;  3HM6 X;  4B6W A;  4B9K A;  1U4A A;  3I57 A;  3TUO A;  3EFC A;  1UZX B;  4KIK B;  1KLU D;  5EE0 A;  4BAX A;  1VLB A;  5H92 C;  2Z0D B;  2M0A A;  3NHE B;  2W82 A;  2LHE A;  3BVZ A;  2CU1 A;  1UUP A;  3ZUN A;  4CQN A;  2FAZ A;  2LEK A;  1S3S G;  2XNA C;  2WNM A;  5IA7 A;  1FMA D;  2K8H A;  1SE3 A;  2DEN B;  1KOT A;  4FUL A;  2YEP F;  2I1K A;  4NAW B;  4QAY A;  2SAK A;  4MSQ B;  1WXM A;  5IKC M;  4BOS C;  3BK1 A;  5HFY A;  3DDC B;  5JXV A;  4HKZ E;  1ET6 A;  3A9J A;  2ZEQ A;  3RNC C;  2KMA A;  2D10 A;  2LRU A;  3EA6 A;  2V1Y A;  1GB4 A;  1UBQ A;  4LNI A;  1P7E A;  2G3Q B;  1ZDX A;  3HK0 A;  4OZA A;  1T5X D;  4HPL B;  4W9F A;  2N9K A;  5CTR C;  1XXG A;  2KX3 A;  2NBW B;  3ZIM A;  2JZ3 B;  1OGW A;  4XE0 A;  4DHJ B;  2YEP B;  5BMG A;  4MGZ E;  1WXV A;  3AH7 A;  2GBN A;  2MX2 A;  1V1P A;  1GJZ A;  5IOI A;  2IZV B;  4HRS A;  2DYO A;  2MJD A;  3PHX B;  3N1Y C;  3ZTC A;  4DDI D;  3I63 C;  4R3D A;  4FBJ B;  1PGB A;  2OJW A;  2WXJ A;  1TGZ B;  1K50 A;  2WHI A;  3LDZ E;  1B9R A;  3GP7 A;  1FCL A;  3BVM A;  2J7Q B;  2J0M A;  2WXL A;  1J0G A;  3AEB B;  3QAQ A;  1J19 A;  2V4L A;  4ZRQ A;  3H6N A;  2N4F A;  1E8W A;  3IBE A;  3PT2 B;  4EFO A;  1L4Z B;  1QOG A;  1QT9 A;  2D5G A;  3JW0 X;  4FJV B;  4N59 A;  3UF8 A;  1FRD A;  2N7D A;  3NVZ A;  3WAP A;  1SF0 A;  2JZZ A;  4LDT D;  2DZI A;  4A3P A;  1YN5 A;  4W9K A;  4KSL C;  3ONS A;  2D2Q A;  1TJE A;  1PGA A;  1H4R A;  1QF6 A;  2M8S A;  4DK5 A;  4HVB A;  3QAR A;  2W9N A;  4EZL A;  3Q3N C;  1CZP A;  5FR3 A;  1EWY C;  2XEW A;  4GGQ A;  5TSS A;  4KX6 B;  3VRA B;  2LGS A;  3VR8 B;  2NMQ A;  1I42 A;  1OQY A;  4HDO A;  3RUL A;  1JRP A;  3A9K B;  1WF9 A;  4MH0 E;  4UDU C;  4HCP B;  1C4A A;  2KLC A;  1T0Y A;  4XGA B;  2L76 A;  3FIL B;  1I4P A;  2C60 A;  2DYB A;  4OVU A;  1JRO A;  3WAO A;  2AWT A;  3ZJU A;  4MSM B;  4ICU A;  3W1Y A;  1SEB D;  4DXG A;  3MFG A;  3ZQ4 A;  3ZJT A;  2KWD A;  1SJE D;  2KO3 A;  1E8Z A;  3IT4 B;  3KUD B;  3KWL A;  4G50 A;  2WP9 B;  2GLS A;  4EKU A;  4KGT A;  3PV1 A;  5AZH A;  2ICI A;  3QCA A;  4IKG A;  3APF A;  2JX5 A;  2LGD A;  1ZW7 A;  1BUI C;  1EF5 A;  5E6N A;  4G11 A;  3TBL D;  1N61 A;  2LWP A;  1V80 A;  4TUU A;  2L05 A;  4RGM A;  3ZNI D;  2QC8 A;  1V97 A;  2PVG C;  4C56 C;  1V81 A;  2IO2 B;  2KLG A;  2HDE A;  4M00 A;  4ASW C;  4TSS A;  3A33 B;  5L83 A;  2LGI A;  5DPT A;  1WE6 A;  2IGD A;  2OJR A;  3DVN V;  5KHO A;  4B95 A;  2KWC A;  3PRE A;  2EMS A;  5EE1 A;  1ACC A;  3WIM A;  1PFD A;  3I5J C;  1KJT A;  1N60 A;  2CKH B;  5D3D A;  4LNK A;  3MJ5 A;  2AEH A;  3AE9 B;  3X23 A;  2BQQ A;  3W5V B;  2DX5 B;  3QQ8 B;  1QOA A;  3JYU A;  5AEK B;  3FC4 A;  3APD A;  4WJN A;  1ET9 A;  4LNN A;  2NPT A;  2BS2 B;  4RF1 A;  3KQ4 A;  5E6J A;  4M8N A;  2BYF A;  2RDG A;  1TS4 A;  4TMA B;  3U30 A;  4I6P A;  4LJP B;  4E71 A;  2K39 A;  4J6I A;  3UIP B;  1WWT A;  2KDF B;  2WXM A;  4MEL A;  4LTU A;  3Q2A C;  4NJ7 A;  2INN E;  2J4X A;  3OG5 A;  3RZW C;  2DAJ A;  4F8C B;  2OHF A;  2KTF A;  4K3C A;  3RPF C;  1XLO A;  2K5P A;  3CWI A;  1P9D U;  5BYS A;  2ZNV B;  4NPN A;  2NR2 A;  3NUH B;  4JIO U;  3TJP A;  4NJC A;  2KFK B;  2W3S A;  4RCO A;  4FAD A;  4KVG B;  4RFB A;  5IN7 A;  1PGX A;  3H7P B;  2V3N A;  3Q3F A;  3HM3 A;  2WX0 A;  4L1B A;  1N6Z A;  3AM9 A;  1E10 A;  2PTL A;  3BII D;  2WLB A;  3Q6B A;  3A4R A;  2V0G A;  4MDK E;  1CMX B;  2VRR B;  2LUE A;  3CMM B;  2N9L A;  3U2S C;  2V3P A;  1NVI D;  3P2B A;  3ZW3 A;  1WX9 A;  4LK0 M;  2LVO A;  4CYE A;  3LXF A;  4FHK A;  1OEY A;  1I4X A;  3O13 A;  1JAL A;  2IGG A;  1TS3 A;  2NCN A;  2KFJ A;  1C76 A;  3EEC A;  1MFW A;  1LFD A;  3H7P A;  2O6V D;  3N1X C;  4AJY B;  2L0F A;  1OFF A;  3APC A;  1T0S C;  3AED B;  3VH3 B;  1JWU D;  1TY2 A;  3VVW B;  1TS2 A;  4NQL B;  1L0Y B;  1I4R A;  1WM2 A;  2PJH A;  3DBS A;  2MA9 B;  2LZ6 A;  3AEG B;  3CST A;  1SGH A;  4IUM B;  1PUT A;  1V86 A;  1KRH A;  3TMP B;  3ZVV A;  2CR5 A;  3M62 B;  4ANX A;  2ZW0 A;  3N1Z C;  2IND C;  2WXG A;  4HRO A;  3LYY A;  3NS1 A;  1GC6 A;  5E6P A;  1RWS A;  2KKC A;  3GZN B;  2M56 B;  3GE3 C;  2CS4 A;  4FA6 A;  3AU5 A;  3IG3 A;  1A5R A;  2IPK D;  3W5U B;  1YN3 A;  1ZP0 B;  5AZF A;  3Q14 C;  3A9J B;  1CK1 A;  1YJJ A;  1JCK B;  2FE8 A;  2XK5 A;  2WXI A;  1JWS D;  4B0M A;  3PVL A;  2TSS A;  4W9G A;  3NJT A;  2MCN B;  1V6E A;  2O2V B;  1E6E B;  1E90 A;  3PHW B;  5C2T B;  1AN8 A;  3NY5 A;  3DWM A;  2MWS B;  3JSV A;  4CO7 A;  3P4S B;  3IXS A;  1BXT A;  3B9J A;  2W54 A;  4AQ7 A;  2WQY B;  4IM0 A;  1P0R A;  1TKY A;  2EEL A;  4ZRP A;  2BVC A;  2D3A A;  5HHD G;  2KD0 A;  1RLF A;  1YX5 B;  4RGN A;  2MSE D;  2IY1 B;  4F1S A;  1HA5 A;  4P1C C;  3R7Q A;  4BBN C;  1MPE A;  5D94 A;  2KQ4 X;  2N9X A;  3PO0 A;  2ZPN A;  4JLC A;  3PRZ A;  4KGR A;  1F0Z A;  2G1E A;  4AS1 A;  1ZDV A;  4OZB A;  3RMK C;  4GDL A;  1NI2 A;  2MH7 A;  4IDI A;  1EF1 A;  3ZLZ A;  4BKS A;  3AEE B;  1Y8R C;  4FJY A;  2MP2 A;  2V4I B;  2JF5 A;  2NPT B;  5HI1 A;  3RNF C;  3QK0 A;  4KDL B;  2SEB D;  3ABV B;  4J3O D;  3L13 A;  2RDB C;  1BT0 A;  3NRZ A;  1NI3 A;  2K25 A;  2CJN A;  2Z8L A;  4GDK B;  2JY6 A;  1HXY D;  1HTO A;  3SDL C;  3TEX A;  2C7H A;  2N9P C;  5BO4 B;  2IYD B;  5FKA C;  4EEW A;  2KNB A;  4P16 A;  1UGJ A;  4YTP B;  3KH0 A;  4MGK E;  2ON8 A;  3ALB A;  3U7D A;  4GDK A;  4M0W B;  4XYC A;  5IP4 D;  3ZNG C;  1A70 A;  5LXI B;  4N6E B;  3KYC D;  1SBB B;  4K1R B;  3TL5 A; 
#chains in the Genus database with same CATH homology
 4KX6 B;  3VRA B;  4A6Q A;  3ZGZ A;  1SE4 A;  1JWB D;  4JE3 B;  3VR8 B;  3E9S A;  2NMQ A;  3BVG A;  1C78 A;  3P4R B;  3TSS A;  3IT6 B;  1Y56 A;  4MM3 B;  3EUB 2;  1UWM A;  1R7S A;  2H88 B;  1ZUD 2;  1SB3 C;  1QKZ A;  3AE8 B;  1JRP A;  1L6U A;  2MJ3 A;  1FNW A;  2PKO A;  1STE A;  2K3U A;  4UDU C;  3Q69 A;  5EE9 A;  3Q8B A;  5LNK 1;  1C4A A;  3BYT B;  1UNS A;  4ZHO A;  5H8Y E;  1KFY B;  2WXH A;  1EU4 A;  3P4Q B;  3R2I A;  3Q8C A;  1HEZ E;  3AN1 A;  2LFI A;  1I7H A;  4GDL B;  1D6E C;  1ZXI A;  3BK2 A;  5D7G A;  1E0Z A;  2JYE A;  1F2R I;  1YNT E;  2FUG 1;  1V1P B;  1CQV A;  3AV8 A;  1I4P A;  1VZ6 A;  3BZD B;  3FIL B;  4MT5 A;  4TQ1 A;  2KAC A;  2PIA A;  4A8X C;  2IJ0 A;  3P63 A;  2J52 A;  2BS3 B;  1Q10 A;  2JYT A;  1JRO A;  3NVW A;  1ROE A;  2E6X A;  2FBW B;  3ZJU A;  1EM7 A;  2E3T A;  3TEZ A;  1XLP A;  1DGJ A;  2BB6 A;  5C3J B;  1SEB D;  4DXG A;  3MFG A;  3ZQ4 A;  2WXO A;  3ZJT A;  2B76 B;  1SJE D;  2KWD A;  4YSY B;  2BTE A;  4OVZ A;  2JQR B;  1SXT A;  1N62 A;  3IT4 B;  1ZE3 D;  3I9V 1;  1C9F A;  3KWL A;  1WGK A;  2WP9 B;  4FXC A;  1JQ4 A;  3EGR A;  1V1O A;  3UI3 A;  3FIL A;  3MC0 B;  1N5X A;  1QOB A;  4KGT A;  1VDV A;  1CJE A;  2ICI A;  1XO3 A;  4IKG A;  2W55 A;  2LMC A;  2JX5 A;  4YSZ B;  1BUI C;  3LB8 C;  1VJK A;  1HZ5 A;  1GB1 A;  1UWX A;  1WXQ A;  1YQ3 B;  3WCQ A;  1T6B X;  4ARC A;  1N61 A;  3N9Y C;  3GB1 A;  5MPO A;  4YTM B;  3DWG C;  3B2F A;  3V05 A;  2WU2 B;  4RGM A;  2DLB A;  2L1A A;  1SIJ A;  1V97 A;  1B1Z A;  2PVG C;  4C56 C;  2JU6 X;  4A55 A;  1XLQ A;  2WS3 B;  3ZYY X;  2X38 A;  2QEJ C;  2HDE A;  3TEW A;  1KH0 A;  4TSS A;  2JZP A;  1WSP A;  2LGI A;  2AQ2 B;  1I4G A;  2IGD A;  2CU3 A;  1NEN B;  1XEE A;  4OHJ A;  1GAQ B;  1V8C A;  5EE1 A;  1EU3 A;  1ZXH A;  1ACC A;  2RPV A;  1FNU A;  1MVK A;  2BB5 A;  1OQQ A;  3AEF B;  1PFD A;  3U7Z A;  3SFD B;  3FAH A;  1L0X B;  1AW7 A;  1FFV A;  2J42 A;  2WXP A;  1N60 A;  1GOZ A;  1JWM D;  2WDV B;  4WUR A;  3U52 E;  1FO4 A;  4HKQ A;  1RM6 C;  3AE5 B;  5D3D A;  3MJ5 A;  1JML A;  3MP9 A;  3AE9 B;  3P4P B;  2Q5W D;  1C79 A;  1TKE A;  3J9C A;  3IAS 1;  3W5V B;  3B2G A;  4OZC A;  3AB5 A;  1QOF A;  2Y5P A;  2L83 A;  4RGT A;  2H89 B;  1K53 A;  5BYQ A;  1TZO A;  1N63 A;  3HVZ A;  1QOA A;  5AUI A;  2Y3A A;  3BWU D;  3FC4 A;  1FXI A;  1MI0 A;  2WU5 B;  2QJL A;  2QIL A;  2WDQ B;  4N58 A;  1ET9 A;  1FCC C;  2VZK D;  3MHZ A;  3W1S A;  1C4P A;  3BYY B;  2VZK B;  2RDH A;  2BS2 B;  4RF1 A;  2G9H D;  2K9X A;  2JSV X;  2L52 A;  3L4P A;  1YQ4 B;  3KQ4 A;  5E6J A;  4D2K A;  3RFZ B;  1TYG B;  2BT6 A;  2WXR A;  2QIE B;  2RDG A;  1JWA D;  3VRB B;  2KMM A;  1TS4 A;  4TMA B;  5HG2 A;  1KTK A;  2W3R A;  4EE2 A;  2RMM A;  3TEY A;  3NZ3 A;  3ZJV A;  2NTT A;  1AYF A;  1WWT A;  1K52 A;  2WXM A;  3URY A;  2BS4 B;  1ESF A;  3AEA B;  2NTS A;  2WXN A;  5D3I B;  4YSX B;  1WRI A;  4LTU A;  1E9M A;  1XF5 L;  1PDX A;  1FRR A;  1M4V A;  2INN E;  2J4X A;  1XLN A;  3C8Y A;  1TS5 A;  1K51 A;  1YJI A;  1IUE A;  2WDR B;  1DOI A;  2DBY A;  2OHF A;  2I2Y A;  3W9C B;  3H8H A;  4ZOH C;  3RPF C;  3ETR A;  1XLO A;  2K5P A;  4WQM A;  3CWI A;  5BYS A;  4WH4 A;  4XDC A;  1E7P B;  1IBX A;  2ACZ B;  2AQ3 B;  2IDY A;  3NUH B;  2KDM A;  4TQ0 A;  1L5P A;  4XWW A;  4NJC A;  2K22 A;  2MEK A;  2PW9 A;  4YTN B;  2W3S A;  4RCO A;  1D5Z C;  1EWC A;  1D5M C;  4RFB A;  1PGX A;  2V3N A;  1FIQ A;  2AX5 A;  1FEH A;  4JPS A;  1XCT L;  4XWT A;  4L1B A;  2GI9 A;  3AM9 A;  3AE3 B;  1E10 A;  1VZ7 A;  2PTL A;  4HJG E;  5EE3 A;  3GS2 A;  3BII D;  1GPX A;  3AEC B;  2WLB A;  1AWD A;  1L4D B;  1VZ8 A;  2INP E;  2N0S B;  2V0G A;  3NVY A;  3AMZ A;  4ZYS A;  2I38 A;  3P1M A;  2DWQ A;  4KKJ A;  2JWU A;  4ZHP A;  1IGD A;  2N9L A;  3U2S C;  2V3P A;  1NVI D;  3NVV A;  4LK0 M;  4IOI E;  1C77 A;  3LXF A;  2WXF A;  1I4X A;  2ONQ A;  3O13 A;  1JAL A;  3SR6 A;  2L32 A;  1L0V B;  2IGG A;  1TS3 A;  4OW0 A;  4YXD B;  4RH6 A;  1FXA A;  1C76 A;  1TKG A;  5FK9 C;  2BYT A;  5BMI A;  1OFF A;  3P42 A;  1PYW D;  3AE6 B;  1FFU A;  1D5X C;  3AE4 B;  3AED B;  1JWU D;  4WAF A;  1TY2 A;  3AE1 B;  4P6V F;  1TS2 A;  4KGS A;  4WIP A;  3W2D A;  2KN4 A;  1HZ6 A;  2J53 A;  1L0Y B;  2Y5C A;  3I57 A;  3TUO A;  1I4R A;  4REZ A;  3U4E G;  4RNA A;  3SEB A;  1KLU D;  3AEG B;  5EE0 A;  4ARI A;  3AE7 B;  1VLB A;  1PUT A;  5H92 C;  2M0A A;  1RYJ A;  2W82 A;  4MH8 A;  2K0P A;  1KRH A;  2LHE A;  3BVZ A;  3R2T A;  1UUP A;  1LO5 D;  4KKI A;  1FNV A;  4HEA 1;  4CQN A;  2ZW0 A;  4USA A;  2LEK A;  1MHX A;  1YN4 A;  1VRA B;  2WXG A;  2WNM A;  2WXK A;  2XNA C;  3LYY A;  3PZ8 A;  4HRO A;  1FMA D;  3OWE B;  3NS1 A;  1SE3 A;  2GRI A;  2LUM A;  4JWU C;  1RWS A;  1HQR D;  5AUK A;  1I4Q A;  2BW2 A;  3KLS X;  1J7B A;  4RF0 A;  1I4H A;  2JXT A;  1TY0 A;  5G5H A;  2M56 B;  2YEP F;  4NAW B;  2LJI A;  2SAK A;  2CJO A;  3VQI A;  3Q8A A;  2IPK D;  3W5U B;  1YN3 A;  3BK1 A;  3HVD A;  1ZP0 B;  5HFY A;  2OED A;  1CK1 A;  1YJJ A;  5JXV A;  1JCK B;  2FE8 A;  4HKZ E;  1ENF A;  5GXG B;  1ET6 A;  2WXI A;  3HUI A;  1YMH E;  1JWS D;  4B0M A;  3SFE B;  1F2R C;  3T3O A;  2TSS A;  1DYQ A;  5T8I A;  1T3Q A;  3EA6 A;  1E6E B;  5C2T B;  1AN8 A;  3DWM A;  1GB4 A;  4DQO C;  4H2A A;  4US8 A;  1P7E A;  3P4S B;  3IXS A;  1ZDX A;  1BXT A;  3B9J A;  2W54 A;  4AQ7 A;  2BBC A;  1SE2 A;  1T5X D;  1ZPS A;  2DYM A;  2MJE A;  2WQY B;  1ZOY B;  4MAC A;  4OZA A;  4LLG M;  4YWG G;  3T3N A;  2R61 A;  1TKY A;  2N9K A;  2EEL A;  2PLP A;  2PMV A;  3PZ7 A;  1C4C A;  1SJH D;  4ZRP A;  4A9A A;  1XXG A;  5HHD G;  4RGN A;  1QLB B;  4XE0 A;  1HA5 A;  1WYG A;  4ITK A;  4C7Z A;  4NZL B;  2YEP B;  5BMG A;  1MPE A;  3Q8E A;  2KQ4 X;  1KLG D;  3AH7 A;  4XDD A;  3PO0 A;  1MHH E;  1V1P A;  4PT5 A;  1SSN A;  4KGR A;  1KF6 B;  5G5G A;  1F0Z A;  2G1E A;  1P7F A;  4AS1 A;  4HRS A;  1ZDV A;  2DYO A;  2WXQ A;  2MJD A;  4OZB A;  3R8B A;  4R3D A;  1FM0 D;  2HTM E;  2MH7 A;  4IDI A;  4L2Y A;  1DOY A;  2M19 A;  1PGB A;  3CIR B;  3AEE B;  2WXJ A;  1B9R A;  1K50 A;  3GP7 A;  1FCL A;  4C7Y A;  1N5W A;  3BVM A;  1NYQ A;  2V4I B;  1D4B A;  4JX1 C;  5HI1 A;  2WXL A;  3AEB B;  2AQ1 B;  3IAM 1;  1L6V A;  4US9 A;  1NEK B;  4ZRQ A;  2GB1 A;  2ZW1 A;  1OQR A;  1J7A A;  3E56 A;  2SEB D;  3ABV B;  4J3O D;  5BYR A;  3V3X A;  2KAJ A;  2QMT A;  2XN9 C;  1BML C;  3NRZ A;  1XCQ L;  1FD6 A;  1L4Z B;  1NI3 A;  1QOG A;  1QQR A;  1QT9 A;  4YT0 B;  1DOX A;  2D5G A;  2CJN A;  5BMH A;  2Z8L A;  4DXF A;  4GDK B;  4A90 A;  4O1N A;  1QIL A;  1HXY D;  4N59 A;  3Q8F A;  3TEX A;  1IGC A;  1FRD A;  3NVZ A;  4Q2J A;  4GLS C;  1F77 A;  3AE2 B;  5FKA C;  4C80 A;  1SF0 A;  4P16 A;  4NAM A;  3HRD D;  1UGJ A;  4M0W A;  2QSD A;  4YTP B;  1YN5 A;  3KWV A;  2PVO D;  1NYR A;  4JWS C;  2LHD A;  2ON8 A;  1TJE A;  3VR9 B;  1PGA A;  2EKI A;  2N7J A;  1QF6 A;  4RGO S;  1IBX B;  2IGH A;  1VR9 A;  4L23 A;  1A70 A;  1J7C A;  4WWM A;  1CZP A;  4B0E A;  1RFK A;  5FR3 A;  1EWY C;  1JW9 D;  4N6E B;  1SBB B;  5I4D A;  5TSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...