1TS2A

T128a mutant of toxic shock syndrome toxin-1 from s. aureus
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISALDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of five mutants of toxic shock syndrome toxin-1 with reduced biological activity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
total genus 57
structure length 194
sequence length 194
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1997-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ts2A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ts2A01
1D5ZC 1CK1A 1LTBD 2AQ1B 1DJRD 1CHQD 1JCKB 4Z9CB 1LTRD 1I4HA 1LTAD 1RDPD 3BVZA 1TY2A 1HA5A 4ZYSA 1SBBB 1UNSA 3BZDB 1PYWD 1SE2A 2NTSA 3OWEB 4L63B 1M4VA 4RGMA 1RCVD 1TS3A 4RCOA 2QEJC 2RDHA 1ESFA 1JWUD 1F77A 1TS4A 1YN3A 4RFBA 1STEA 2Z8LA 2TSSA 2WV6D 2XNAC 1L0YB 1MD2D 2O2LD 2XRSD 1BCPD 1HQRD 1SJED 1ET9A 3DWQA 4UDUC 1LT6D 1KLUD 1S5BD 1SXTA 2J4XA 3CHBD 3DWAA 3SEBA 1B1ZA 1ENFA 3O13A 1B44D 3DWPA 1LTTD 1PZID 4RHRA 1DYQA 1G8ZD 1RF2D 1KTKA 1S5FD 4RGNA 4RHSA 3BVMA 1I4GA 4O1NA 1EEID 1EWCA 2AQ2B 1S5ED 1S5DD 1ET6A 5FKAC 4L6TB 1T5XD 1LT4D 1PRTB 2IJ0A 1PTOC 1HXYD 1BCPC 4K6LA 1LO5D 1HTLD 1QILA 5ELEA 4RGTA 1RD9D 4NZLB 2R61A 1LT3D 3BYYB 1PZJD 1FNWA 1JWSD 1D6EC 3R2TA 2CHBD 1YN5A 3KLSX 1PZKD 1EEFD 1SEBD 1PRTF 1XXGA 3MC0B 1LLRD 4TSSA 1TS5A 1PTOB 5I4DA 4BWGB 1GOZA 1EU4A 1TS2A 1LTGD 1PTOF 1JR0D 3BYTB 1CQVA 1I4PA 3BVGA 2AQ3B 1FD7D 5ELDA 3R8BA 3V05A 1LTID 1SE4A 1V1OA 5D3DA 1SJHD 2IPKD 4DXGA 1LTSD 1V1PB 1CHPD 2RDGA 3W2DA 1AW7A 4DXFA 1FNVA 1D5MC 3GP7A 5FK9C 1S5CD 1PTOD 1PRTC 1I4XA 5ELCA 1FGBD 3URYA 1L0XB 2NTTA 1BXTA 2ICIA 4C56C 1PTOH 1EFID 1EU3A 3MFGA 4RGOS 2QILA 4OHJA 1I4QA 3EFXD 5ELBA 3TSSA 1V1PA 1TY0A 3EA6A 1BCPF 5TSSA 4RH6A 1FNUA 1I4RA 2XRQD 1KLGD 1SE3A 1YN4A 1BCPB 1JQYD 1PRTD 1CT1D 5ELFA 1UUPA 2SEBD 2G9HD 2XN9C 5D3IB 1XTCD 1JWMD 1D5XC 1LT5D 1AN8A 3R2IA
chains in the Genus database with same CATH superfamily
3J9CA 3RD4A 1HJPA 3TL5A 3T4AC 2R7DA 1RM6C 4DAYB 2DNCA 3IG3A 3K8AA 1RRBA 2IO3B 1ZPSA 5C44H 2M0XA 3CPWA 1Y1WG 3EBEA 3GTQH 1G291 4HTHA 1K8AC 4IFDJ 2C5CA 3M3YH 3BZDB 4A3CH 4WRDA 4PMCA 1YJNA 3L4PA 3RCZA 1PLFA 1TWAB 3TDQA 1WXVA 1EIGA 3K80C 1IBKL 4N9F4 1JWUD 2EY1A 4A3JB 3VTVA 1I6HB 4N9TA 3K81C 1NR2A 3K5OA 1WX8A 2C7NB 2NN6I 4REZA 3UQAA 4LNNA 1C7YA 3GTMB 4B08A 4FF3A 2L15A 5CV5A 2R92H 2IO0B 3DVGY 1X56A 5IN7A 2AEHA 1PH5A 1V5TA 4LJOB 4UDUC 5GAEC 2DBYA 5EDSA 5C3EH 1L6UA 3UINB 3P20A 2V1CC 5EE1A 4YSZB 4X6AH 2JXXA 2KMAA 4PYZA 4I7ZC 1XT9B 4TV3A 4AH6A 5LL6S 3DWPA 3F8TA 2D0OA 3Q2AC 4EZJA 2CJNA 1LM0A 4L5TA 1CA6A 3AH7A 3BINA 2OOBB 4EKUA 1I42A 5E6OA 1WE6A 3D31A 3QB3A 3S14B 3H3VC 3I4MB 1WJJA 1PGBA 1Y14B 4DK6C 2GN5A 1HTLD 2N9LA 1RD9D 4IDIA 2L52A 2JSOA 2ONQA 3FEWX 3G4SA 2RBMA 2UUCQ 1E0ZA 1IBLL 1DGSA 4OVZA 3DBHI 4NQLB 1QWYA 1IGDA 4JCVE 3KLSX 4OWWB 5HY6A 4LW1A 2RQXA 3I4MH 2MWSB 2Y0SB 3I70A 1MIUA 2UXDQ 1XXGA 1DXMA 1GUAB 4TSSA 2Z0DB 1ONLA 5C3EG 4OWXB 4JI0L 1XYIA 3NUHB 2NVXB 1C8CA 4Y7NB 3I5JC 5IODA 4GLXA 3ZIMA 4DV2Q 3VQIA 4YWGG 3KDFB 3UDGA 4XQJA 4GGQA 5D3DA 4OO1G 1LTSD 5D65A 1V1PB 1VQAA 1RL2A 1B4OA 1FFUA 3HM3A 3WAPA 3E0EA 3ONAB 2F0PA 3EROA 2WXJA 3G7LA 4KGRA 1VQBA 2EYOA 1QZGA 4FP5D 2Z6KC 2F0JA 3IFWB 2ENBA 4HJGE 4YSXB 3RN9C 1XWEA 3ZNID 1SLJA 1EIFA 1UEAB 2K32A 1WTVA 3PO2G 1AE3A 1HR0L 4KHVA 1LYLA 2DNEA 4KZCA 1TTNA 1AZQA 4NNJB 2R2QA 2SDFA 2DYOA 5DEHA 1UZXB 3X3MA 5KNCA 4LF8Q 4LF6L 1YHBA 2WYQA 3W5OA 5ELFA 3CQZB 4ITKA 4ANVA 1E7VA 3TEZA 2G45B 2KLGA 5IGEA 4FYDA 1SE9A 1SNMA 5BYRA 3NZ3A 3E5SA 3IFTA 3ICEA 3OJ4B 1JB3A 2IY5B 3D0FA 5LLIA 1LTBD 4J15A 3M7NA 1VQOA 4DAMA 2CU1A 4LFCQ 1RTNA 2O2VA 3VH4B 1M94A 1GKHA 3NS1A 5IGGA 1A63A 2I46A 3A1QA 2GBJA 2D3AA 1Z6HA 2BYTA 4E6IA 1UGMA 2MRPA 3D3RA 4IUTA 4YWMA 2QA4A 1XLNA 4DR2L 4QAYA 2RSUA 1Y1WH 3MXNA 1CI3M 5C3JB 2K3UA 1STEA 3HOWH 3AE8B 2N8NA 5LXHA 1TIID 4CGYB 2N7JA 1GVPA 3ZXVA 3U2SC 2DLBA 2NMQA 3CSTA 4K3CA 2WWZA 4G50A 1HQRD 3I63C 4YCWA 3VR5A 4A3DG 2E75C 2EYFA 2L5TA 3H94A 2JRHA 4A3PA 3ZJUA 3PZDA 5DLQE 5C2TB 4KVGB 1HZAA 3V96A 2BDOA 1BUVT 1PZID 3PUXA 4ID6A 3KBXA 4DNTB 1N32L 2FCQA 4LMQD 4US9A 1HZ9A 4JI3L 4HWIB 2I1JA 1HZ5A 1EO6A 1L7YA 3VYSA 2KNBA 2UYZB 1GUWA 3H6MA 1H9KA 3AEGB 1HXYD 5EPJA 4JI2Q 2NVTB 4AP4C 1QOGA 3VYTA 3B1LX 3SHQA 2K4KA 1Q1BA 3DLLA 3OMGA 4JPBW 4NZLB 5C5LA 4LJZC 2JF5A 3S17B 3S1NB 1LT3D 1SYBA 4DR6Q 3S2HH 2KFKB 1VRAB 1VQNA 4LFBL 2LGXA 2MBBB 2MFIA 4KD3A 3HK0A 4MACA 4W9HA 4ZHPA 5NUCA 2ZCBA 2K75A 3L10B 5AZGA 2H1EA 3KF6A 4JI6Q 3CCEA 2NPTB 3HGBA 3P2BA 1YNNC 4ZQ3A 4ABNA 4EE2A 4DUZL 3RZDH 4H13C 1N34L 1K3BC 3KW5B 2CS4A 4BY7G 1UWXA 3IHPC 3N1YC 3BYTB 5COYA 4GXBA 1JR0D 2Z4IA 1OQQA 2NZHA 3OW7A 3GOEA 2PNRC 4K5XA 2BS3B 3K7AH 3CCSA 2JT4B 5H8YE 1Q10A 3S1RB 2W54A 4X62Q 2F0EA 1TWGB 3G71A 2VNUD 3WALA 2MEKA 1Q82C 3S16B 1X3QA 1K83B 5IO9A 1TWCH 1E9MA 4GDLA 2PNHA 1SFOB 3U52E 2I5MX 3L3OC 5C6AA 3T1HL 3AB9A 4XTCS 1H95A 1GC6A 3MHSD 2FUG1 3AECB 2OWOA 4DHZE 3VYRA 1P7FA 5CHVC 4TKOB 1H9SA 4OHJA 5I6WA 4DHZB 3CCQA 3AB5A 3G6EA 1TY0A 2YYZA 1VR9A 4HIDA 1KC8C 1BF4A 2TMPA 2G9DA 2LKVA 1JQYD 4A3FG 4PT5A 2NR2A 1MJCA 3I3CA 5BMIA 4B9XA 3RLOA 1CKOA 3BJUA 5A2QL 1D5XC 5E6PA 3N1ZC 1HFGA 1TYGB 5LMNL 4HJ8A 1R4NB 5IGDA 1OXXK 1Z47A 3NTHA 2EYHA 1STBA 4B9KA 3CSFA 1VMCA 1QUQB 4R9WA 2Y0SE 3NK9A 1S3OA 3APCA 3RFZB 1QVGA 5C4XB 4OX9L 3P7JA 3KFUA 4APVA 2ZJRA 3K0YA 1SE2A 2XEWA 3L7ZC 1YJIA 2PTLA 2B3AA 3L16A 2RDHA 4DV7Q 1GG3A 1N9WA 3WIMA 2AUJD 4QB4A 2DJFC 1RIPA 1DGJA 1XO3A 2K39A 3CC2A 4ZRIA 4JI1Q 3M4QA 5M5WB 3KYHC 1CKMA 4POGA 1IBXB 1XLPA 2DYMA 5C23A 2K05A 4LF9Q 3ETRA 1PMRA 3SEBA 3IAM1 3HOYH 5BN4A 1GM5A 1SN8A 5LMUQ 3O13A 2J0TD 2B8GA 4A3DH 2PYKA 4I6NB 3RT3B 1Z9FA 4ZDVA 4HROA 2L7RA 1FCLA 1F9QA 4KMUC 3KJOA 4LFBQ 1JWBD 3MHBA 3AU7A 1EWCA 4A8XC 5IT9c 4OX9Q 1X65A 2B2UC 3NE5B 4K2LA 1XCQL 3RNGC 2HJ8A 2QHOA 4A3LH 4M0WB 3UDXA 4WWMA 4CO7A 5IIFA 4JI8Q 5CORA 4HJAA 1KABA 4A93B 4GS3A 1CSQA 3A8JE 3QR8A 4X66L 3BYYB 1TWFH 1G6PA 2M1MA 3FILA 3ZDMC 4XX5A 2CHBD 2PMZE 1EZ8A 5T1GA 3TJPA 4DV0Q 1N5WA 4X64L 1TZOA 2ICEC 2O6VA 1J9OA 3RULA 2LWPA 5TR5A 1GOZA 2Z6KA 3PUYA 3GZNB 1WGHA 2V3NA 3PUVA 2Z59B 1VMPA 2RVLA 3DXJC 3IRBA 1F2RC 1V6EA 4DK3C 4BY7H 3KWLA 1CHPD 1C76A 3CRKC 4A3BB 1I50B 1L1OC 3IBEA 2ZJQA 1FR3A 4JI7Q 3M95A 1HZ6A 1UH6A 4NQKE 2MGSA 1GNUA 5JJKA 4FLHA 4BOSC 5JPMC 3ALBA 4RF1A 2ACZB 2RHSB 4DNRB 1EY4A 4DNIA 1AZPA 3ZYYX 1ZGUB 3GTJB 1OTRB 2CH4A 4LUVA 3L0WB 2NVYB 3WCQA 3J81E 5I2YA 1BQQT 3HOWB 3L0OA 1XPOA 4JE3B 1X54A 2F0KA 3MFGA 3PO0A 5IP4D 4BBRG 5FLXE 3KOJA 5K5PA 2HCIA 3M85A 5G3LF 1YI2A 3EUB2 5IKCM 2LD9A 1HCZA 3PRPB 2VUMB 1WJ6A 1YX5B 5M5XB 4FF4A 2RHQB 2MJDA 3ML9A 3H15A 4IC7B 2Q8TA 2KQSA 3I8ZA 2JA8G 1UUPA 1ROEA 3I9V1 2JQRB 3QK0A 2CVRA 2BWES 2RR9A 3H7SA 4A9AA 1UGJA 3A8KE 4JBWA 4MNOA 1LT5D 4C3IB 1XMOQ 4Q2JA 4BBSH 1E22A 3U8ZA 1KAWA 4DR6L 2BW2A 1WWTA 4KKTA 1FCCC 2IO2B 1N60A 4L1BA 5CR3A 1ASYA 4C7ZA 3FP9A 4R8NA 4GZYC 3HOVG 3DEOA 3UDIA 3DVGX 1G2SA 3DVNU 2NS5A 1UF0A 4A4IA 2NVQB 1HUNA 2JE6I 3CQZH 1DD2A 1YNJD 2PZTA 4GNXB 1U5KA 1SBBB 5FR6A 2WAQG 1VQ9A 1RLFA 4L63B 2WXRA 1WYWB 2A6ED 3AN1A 4KLKA 2EMSA 4G0NB 1YN3A 3HIZA 3A4SC 1WF9A 2N55A 2JZ3B 2I07B 2JYTA 2WDTB 3A9KA 4P16A 3GQBA 5L37A 1PH1A 1D2BA 4NJ7A 2PZUA 5F2DA 3T9LA 4GSWA 4PZ6A 1EQTA 3K6OA 3EVQA 4W9DA 1T0SC 3ZJVA 3RLFA 1F9RA 4JBJA 2PW9A 3U4EG 2HT1A 1GB1A 1IBLQ 1II3A 1HUMA 1EEID 5I2XA 4TRDA 4K1RB 1XTDA 2DY7A 2KUMA 1LTLA 1T5XD 1PRTB 1WTHA 3RUZA 1M90C 1BCPC 2FIDA 2KD0A 5K36H 4MM3B 2VB2X 3GDEA 4RGTA 5C4XH 1SDFA 1SNPA 2A19A 3Q6BA 3EFCA 2IX0A 2K0PA 1A3TA 1HZCA 2EJMA 5CYUA 4DV5Q 2Y5CA 2D9UA 3R2TA 1Y1VH 4X64Q 2UUAQ 1G6ZA 4XDXA 1A3VA 4L23A 4N9PA 1NI2A 2PQEA 4MGKE 1N61A 2EYLA 1PDQA 1UWVA 1U4RA 2IHEA 1PRTF 2JXMB 3HEJA 5IGBA 1VQLA 1LLRD 1H4RA 3K7UC 3MVVA 1UEBA 3DPDA 4HEDA 5DPRA 3X3NA 4IG7B 2BDNA 4MT5A 4IKGA 3IL8A 1Y1VB 1STAA 1WXMA 5ISRA 3AEFB 1J8CA 2LMCB 2ALYB 4WWOA 2IPKD 4DR4L 1SNOA 2K52A 3TQYA 4MN3A 4A3MH 3A7AB 4KJNA 3OHXC 1QKZA 2XBBC 1PV4A 1FNVA 1YNJC 1MPEA 3TS2A 3H0GB 5DM63 3OWFA 2QF7A 1OQRA 5C4ZA 1LQBA 2Q2HA 3FKIG 2CHZA 4IW0A 2K6AA 4A3EB 3D32A 3URYA 3AYHB 1SNDA 3OTOL 5D7GA 3VTUA 2EYPA 1Z7TA 4X62L 4HJ9A 5M3FB 1SAPA 4IUPA 2VQFQ 2XIWA 2FBWB 2LRWA 3IT6B 1HTOA 3TP6A 2ZPNA 4O42A 1YNTE 2EELA 5LHY1 4HIKA 2ES2A 4JI0Q 1X32A 2NWGA 3J80i 2K7VA 2NBFA 4CDFC 2LFNA 1PRTD 5IP7G 3HOXG 1VQ6A 3AE1B 5E6JA 1EWIA 2D2CC 4K8IA 3KUCB 1CSPA 1L1OB 2G5DA 1HNWQ 3ITPA 2L55A 2E2HH 1PH9A 1JORA 1V81A 2KKCA 3RZDB 3OW2A 1WRIA 3QJYA 4IUVA 2DX5B 3CRLC 4WJWA 3TMEA 5HG2A 2MP1A 2WP9B 2F0LA 2JA8H 4GKJQ 3FPPA 2L76A 3AMUA 4N59A 1U4AA 1IBML 3AE7B 1NYRA 3V61A 3LGJA 1UE6A 3KLSA 3PLUA 4BBSG 1K8RB 1K8OA 2BB6A 2F0QA 4OVUA 4B3ML 5LMNW 3UI3A 2I5HA 1WRDB 3PHXB 4K7UA 5KHOA 2INCC 2EKEC 4RCOA 2HTHA 4JI5Q 2R7ZB 4A3KH 3BU2A 3HRZC 4FNFA 4IURA 3GTGB 4C3JB 4HIOA 2UXBQ 2ZM6Q 2IYDB 3M4OH 1K8GA 2XK5B 2CQOA 2OHFA 3BWUD 1DOIA 4HDOA 4MH8A 4HKQA 1Q90A 1VQEA 2PO4A 4F7XA 4U673 3JC66 3R3OA 2LGDA 4QQBX 2IGDA 2B2WC 4IFDI 2PJHA 1YJWA 2NZOA 2Q2IA 3SR6A 1YZ6A 2MSED 1FRRA 2B2VC 1D3ZA 2DN8A 3JSVB 3BDLA 4DAPA 2WU2B 4JV5L 4Y7NH 1F2LA 2UWQA 1GJXA 4KJOA 3AE3B 1NDDA 2JA6G 4R8IA 2HD5B 1UAPA 4RMFA 2EY2A 4WURA 2GOWA 1E2WA 5BMHA 4UY8C 4LFCL 5FLMG 3HOUB 3S1MB 4NPNA 3V3XA 1Q1OA 1NI3A 1VQJA 3BK1A 2KDMA 5BR8Q 3QX1A 5JPNC 1F2RI 3FC4A 4P71A 3RZOB 3TRZA 3ENEA 1JWSD 3L17A 1PFBA 5CBEE 4E74A 3KDFA 2Z6BA 3HS0C 2EJFC 1YJ1A 4TVAB 1MFWA 5C3XA 3ABVB 4ME3A 1Y8NB 3ECIA 2XWBB 1DOYA 2B63H 1R4MB 1MSHA 1KM7A 3HOYG 5G3LD 1G6JA 1KHIA 3E6ZX 4JI4Q 1PFSA 4EZLA 4DA2A 3MJ5A 3WOFA 3J81c 1FRDA 1CMXB 2J0KA 2KCTA 2KJRA 1AW7A 3QQ8B 3DDCB 3H7PA 3S9WA 3VUXA 2FCNA 1WGRA 4RCNA 1JJCB 1B8AA 4AQYL 3S15H 2AYOB 1YVCA 3BDCA 1HNXL 1MJDA 3QWZB 1S5CD 2E3TA 2MO0A 4J1MA 4JV5Q 4ZRPA 4W9LA 1I94Q 2V4IB 3M4YA 3P4SB 4C4VA 2PLPA 3GTOH 2L0TA 2N78A 3V62A 2BBCA 2Y5BB 3ND9A 1BDOA 3HKSA 1VDVA 4A3IG 1KL9A 2QC8A 3WA0A 1J7CA 1WTOA 2LUEA 2RDBC 4P7IA 1G91A 2KA7A 2WXQA 1VQ7A 4IFDH 3AM9A 1LV9A 3K7AB 3F1ZA 1E90A 3L08A 2MBQA 4K14A 3JAMc 4JWSC 4XDCA 3ZRFA 4OWTB 4A3JG 3ZRCA 3A8IE 4X3UA 1DOMA 4ZAIA 3GZNI 1Q8KA 4GOPC 2EJGC 4AYBE 2KXJA 3B9JA 1NSNS 1FIQA 3EN2A 4GIVA 3FVQA 2N7DA 1EIYB 4R4OA 5EKKA 5KRUA 2DNFA 4JGHB 4IPHA 2LHDA 3MJWA 2A6HC 2N0SB 4PZ7A 5IT9E 1D8LA 3I4NG 2UXCQ 3D4RA 3NVZA 3NVYA 3VUWA 4DWFA 4LNKA 1RODA 4LK0M 2QEJC 1R7SA 4YL8A 2K04A 1B9RA 1KH0A 1I35A 2KO3A 3H9DA 3I91A 3SVMA 2Z1CA 3RLNA 4CKBA 1DOXA 1BBXC 3I2ZA 3NG0A 2PMVA 3OIPA 1L0YB 3Q0AA 3CF5A 4EQNA 4IFDG 3Q69A 4C2MH 4YTNB 1K3RA 3DWQA 4A93H 2BT6A 2W3SA 4ANXA 4QMGA 3QA8A 1YOVB 1IXRA 2OTJA 1NE3A 1ZE3D 4BA1I 3J7AV 3QCAA 1QOAA 4RHSA 3LX0A 2FHTA 2QKIC 2F3IA 3RN2A 1HNXQ 3NJTA 1NUCA 2FXQA 1JW9D 4MM3A 1YQ4B 3H7PB 3VXWA 2NBWB 3Q3FA 2BB5A 4X65Q 4ZKBB 2QCZA 2CR5A 3GTGH 2MQHA 5EE9A 3MZ5A 5ELEA 4M8NA 3ZLZA 2NB0A 1UE7A 1MBYA 4QIWE 2F0OA 1R9TH 2WXPA 3A5UA 4B0EA 4DBGA 4BVUC 1WTWA 2RA4A 4FF1A 2MHVA 4LWCA 1PDXA 4FBJB 1X3FA 3EECA 1E24A 2ZTDA 2B2VA 4L8JA 4MGYE 2A74C 1PH7A 4DAVA 2E5LL 1JMLA 2FE8A 3C19A 4NAWA 1TS5A 5E7NA 2I1KA 4HDQA 2UUCL 1PTOF 1RYJA 1FEHA 4JX1C 3D4WA 1I4PA 1B7YB 2F0NA 2XSCA 3CU7A 3NZSA 4IQZA 1LTID 3VHTC 2L8JA 4WIPA 4ZHOA 5J2RA 1LGRA 2CHXA 2LRUA 3U7ZA 1JOOA 4DXGA 4J3OD 3GE8C 4S3SA 3W2DA 4DV6Q 1ZXIA 2F0MA 2JA9A 1N33L 5AJ3Q 1WI0A 1WTRA 3MFYA 2MQJA 1E7UA 5FK9C 2KC1A 2KTFA 5AZFA 2K14A 2BS4B 1JQ4A 5C44G 1PRTC 2PIAA 4A75A 5HKHA 2KN5A 4A76A 2G1EA 4XDDA 2B2UA 1TT5B 3MC8A 3AFPA 1VF5C 4YIJA 2DAFA 3QO2A 5BYSA 4G7ZC 3ULLA 2EIFA 4C1NI 2IWHA 4LUOA 4C56C 1M8AA 1ZYRC 3ERSX 2KECA 1EU3A 1P9DU 2NVUI 4YT0B 1MSGA 2HDLA 5ELBA 1WCMB 2F0TA 2KCCA 5D6JB 3PMFA 5TSSA 2CQAA 1I4RA 1WSPA 2XK5A 3UQBA 1FPYA 3VDZA 4BS9A 1KDAA 2ZXOA 4BBRH 1CT1D 4NDXA 3M7GA 2EXZA 2JA7H 3STBD 4TMAB 1VQ4A 3TZDA 4OL7A 1VQ8A 2WGSA 2LVQA 3FMCA 1Q12A 3R2IA 1MHWC 2WDRB 3VH3B 5C0XI 4K81A 3TEHB 4M8MA 2B76B 2LEKA 4ZRQA 5IA7A 3P1HA 3CCRA 1C9OA 1JOQA 2PQAA 1IBMQ 1T3QA 4IN3A 1EY7A 2GA4B 3BVZA 4OIKA 4XT1B 2NPTA 2W3RA 5JH5C 1J5EL 4BXXH 2YTYA 3HOVH 4LJPB 3ZVVA 1PYWD 5EGTA 5FLXc 2KQ3A 1OXTA 3PIO3 3HOWG 4XGAB 4QJFA 3RN5A 4OEMB 3AV8A 1IP9A 3UF8A 5AEKB 2LFIA 4JG2A 5JXVA 3SXHA 3I4NH 3DBSA 1A70A 2PPBC 4C3HG 4DV1Q 1UBQA 2R3ZA 3TEYA 5EPKA 4IM2A 1W6JA 1XMQL 2TSSA 3JW0X 4OO1I 2BPSA 2F0HA 4NXML 1L0VB 3NP8A 4DDGD 1QNKA 3CMEA 4GKKL 3PGZA 3S1NH 2HIXA 1BKBA 4WFN3 3ONSA 1MI2A 1IYUA 1D1IA 2CKZB 4ICUA 1LM8B 3T3NA 2RSOA 2RMMA 4IWPA 2JWUA 3EQLC 5EQ0A 3GV3A 1Q81C 1JE5A 4RMAA 1YBYA 2O5IC 1XJVA 3QOJA 1ZDVA 2DZKA 5HI1A 3RPFC 2KWCA 4RWSC 1KD1C 1QB5D 4PQXA 4M0WA 1EY6A 2BGFA 4JLCA 1KFYB 1QZHA 2AUKA 2WDQB 1LT4D 5IT9L 1B9NA 3BK2A 4XQQA 1LO5D 3MXGA 3CMMB 1ZYRD 1OQYA 1A0IA 4GLSC 3VAWA 2PQAB 4F8CB 3HM6X 5L83A 2LXCA 1VZ8A 3Q3JA 4IOIE 4AYBB 5K36G 2R93G 1LXDA 1TKYA 2L00B 3S2HB 1D6EC 3Q24A 1ZXHA 1GB4A 1D4BA 3AEVA 1I3QB 2N7EA 3W5VB 1F1HA 5DAUA 4AJWA 3N32A 2K9XA 2KLCA 4X3SA 3RNEC 5M9OA 2ID0A 4HCSA 1IL2A 4ZRZA 1GXDC 3E56A 1RTOA 1PA6A 2XGTA 4H44C 4WJPA 4JOIC 1STGA 1VS0A 2QEXA 1ILQA 1RFKA 3X0WA 1PH6A 2SAKA 1ZEQX 1YEZA 3TP8A 1HR0W 2XVSA 3IVFA 3BZCA 5KNBA 5DCNA 2MHJA 1D7QA 1C79A 1C1YB 3LWUA 4DHJB 4DGZA 1STHA 2BWFA 2ZJDA 4H02A 4H2AA 4GMVA 2Q8RE 2WXIA 4IUNA 4S0RA 1MI0A 4PV1C 3KJPA 1SSOA 2HQEA 2WXNA 1Q0WB 3V2TA 1I4XA 2OF1A 2FAZA 4R4CA 2VXWA 1N6ZA 2IO1B 2NTTA 3U7DA 2L9HA 2L11A 1EY9A 1VZ6A 4A3FH 3A9KB 5CHFA 4RA8A 3RYTA 4CJ0B 3ZTCA 5C4HA 5C3EB 4HLEA 4MHEA 3KUDB 4B6WA 3PSEB 1N32Q 2ZJPA 4RG1A 3I4LA 2WIIB 3B08A 3JSVA 5E3FA 4DV7L 1Q46A 2N9PC 5J3BA 3K59A 4ZLTF 4B3SL 4PMBA 3HVZA 3OLMD 1JWMD 4HPPA 4XWWA 4ANUA 2M8SA 5E4WC 1SIJA 3GTLB 4JWUC 5DPTA 3Q8EA 5G2NA 3PO3B 1GUOA 1W6KA 3HFZB 2KWUB 2W55A 4OW0A 4XZ4A 1LTRD 1I4HA 2VW9A 4B95A 1GD7A 2KX3A 1FMAD 2PVGC 1UNSA 2MUYA 1KOTA 2CCZA 1JB7A 1B3QA 3F2BA 4FULA 4DR2Q 3FHWA 3T13A 2F0SA 1ASZA 4CJ1B 1K50A 2YEPB 5KHQA 2HJ1A 1SROA 4B3MQ 1N33Q 3F2CA 4K7SA 3AU5A 1F9SA 1HA6A 4C1NK 2M4NA 4X57B 1JE4A 2WB1E 3HOXB 1E1TA 2F03A 2CHWA 4GU2A 3GTMH 4AS1A 3OPOA 2N1WA 1V97A 1PUTA 2BVCA 1WGKA 4RKLA 4DR5Q 2QDLA 1SXTA 5I9OA 4A3JH 5M5XH 1A2TA 2H89B 2N9XA 3V6EB 3ZNGC 1L1OA 2WQYB 2A68C 3T1HQ 4GDKB 1U4LA 1ENAA 4LF8L 2HUGA 1DYQA 2ZTCA 4IPGA 4ME5A 1A6XA 2SNMA 3V60A 3BVMA 3MXUA 2K5NA 1Y8RC 3A5ZB 1C0AA 2MJ3A 1V5OA 3NY5A 3R7RA 5DPWA 2E8GA 1BBUA 5AJ3L 2J0JA 3RUIB 4HMJA 3HKZB 3BG3A 4DV6L 4KDLB 2DGYA 4LDTD 4NJ6A 2VQFL 3CP0A 4NP5A 4ILWA 1EIHA 1TT2A 2Z0SA 3CCJA 1SF0A 2B3GA 3CC7A 1T0RC 2BYFA 2KVRA 3AE9B 3K9OB 4WORA 3J7A5 3Q14C 2YTXA 1HPCA 5FLMH 1FNWA 1NVID 2WX0A 5CV9A 1V8CA 4IOCA 1VLBA 4DK5A 1CQFA 4JI6L 1MG4A 2ZXRA 2BQQA 3KUPA 1I6HH 3WANA 2WLBA 3N20C 3OMCA 1K53A 2M0AA 5A35A 1J0GA 5I4DA 2AKWB 1TXYA 3DHGC 3VR4A 3TIXA 1TWAH 3E9HA 5MPOA 1Q1EA 3D6WA 3R8BA 3VR2A 4HJ5A 1U4PA 1WOCA 5AFWA 5IP9G 2VUMH 1JROA 4HSVA 2JY6A 2Z0EB 5H92C 4URKA 3I4OA 1WFYA 1ZKHA 3DCGA 2JA6B 3U30A 1RJTA 4FHJA 2MO1A 4P75A 2C9WB 4I6LB 2HCCA 5CGKA 2JA8B 2N1VA 3SR1A 4C4VB 3J81j 1HTPA 3PO2H 1JOKA 2YV5A 2OQKA 1B9MA 5BR8L 1L0XB 4H7BA 4A3CG 4DR3Q 3CCMA 2K5HA 1SNCA 3E3XA 4QUFA 2LUMA 2ZTEA 4TQUS 4J8QA 4LF9L 3HOVB 1ISNA 1EFID 1J7BA 2B29A 4F88A 3TS0A 1IBXA 4PNYA 1SMYC 1VQIA 4TUUA 3DMUA 5EBDA 1JJGA 5A2QE 4II3B 4FA6A 1CKNA 4OONA 1IYJB 1EYGA 4BY7B 4IJLA 3HOYB 4FO2A 3NS8A 4JPSA 4N8FA 5JEAJ 5I9PA 1XD3B 3DBLB 1GUSA 3J7ZC 4BKSD 3N3KB 4XE0A 1I7HA 2JZZA 1YJJA 5FJ8G 1T6BX 1C4CA 4TQ0A 5EAYA 4JBMA 4C2MB 4MEMA 2EY5A 2JJQA 1FJGL 3PRZA 2KJHB 4P2CB 2QGQA 2QJLA 2BTEA 1QUQA 4UAIA 1M1KC 1EUVB 4F7ZA 1MVKA 3OIQA 3DEPA 1V86A 4A3MB 3S2AA 2RGFA 1L4ZB 3DM3A 4Y52H 2E2DC 2OJWA 4ZRKA 3NBHA 1ACCA 2K28A 3CKIB 4AQYQ 4GN1A 4FXKC 4NAWB 4JOIA 1EL0A 4A3IB 4FJVB 4LF7Q 2BKRB 2VY3A 2LSSA 1TVXA 3SDZA 5HURA 2VZAA 2KHWB 3ZJTA 4FXGC 3I4MG 2O2LD 3S2DB 2KOXA 4UPAA 3R7QA 4A3OA 4DXAB 1KDCA 3ZUNA 2R6GA 3CPFA 1FM0D 1KIXA 4LF4L 3DWAA 1WX9A 2VS1A 1AARA 5FJ8H 2D0PA 1ENFA 2IL8A 1EY8A 1D1KA 2NN6H 4A3GH 1XQQA 4UP9A 3STBC 4IPCA 1LTTD 1E10A 1WCMH 1G8ZD 3SFEB 1WTXA 3X23A 1WGDA 3P4PB 5IGCA 1A8VA 2W82A 4QY7A 5G55A 4BY1G 4WAFA 3NSWA 1KAAA 1TZ1A 2J42A 2H5XA 4WWNA 1RKNA 1VF7A 1HHVA 2D5DA 2M00A 3O65B 3PUWA 2LS01 3J80E 1K9MC 4KK7A 3OTOQ 5M3MB 4L5QA 4CJ2C 1SE8A 4C3HH 1VDZA 2V3SA 3PHWB 4ICVA 2V4DA 3DUZA 4EGVA 1YN5A 3KVFB 1PZKD 1K52A 3M3JA 4S17A 4BA2I 2GVBA 2KFJA 2WKCA 4HN7A 4L5RC 5IOIA 2LXKA 1UWMA 1OXVA 3L9AX 5M3FG 2GI9A 3ZGZA 1BBWA 1O78A 4U68A 1PFDA 3PO2B 3KH0A 5CC4A 2MPMA 3P75A 5AUIA 1SIFA 5BN3A 2NVQH 2P5ZX 1PGAA 5HGQA 5CV7A 2Y3AA 1C77A 4BY1H 4CDDC 3GD7A 4DFAA 1OO9B 1WR1A 4JI5L 4HKZE 1JJ2A 2HE7A 3RR5A 3RZWC 2YU9H 3S2DH 2V1YA 1TU2B 1L4DB 3PO3H 4HK2A 3HOZG 4RM8A 4L2YA 3AXCA 1IYFA 4UP7A 5G5GA 5JEAG 3W1SC 3CXCA 4PMWA 2RSNA 4DV3Q 1NBWA 1C78A 3TUOA 4CHTB 4OVVA 4DK0A 2A5HA 5IP7H 3S16H 1KJTA 2JVCA 2IHFA 2PKOA 4IM0A 3H1UA 1VQGA 4IZ8A 1QG7A 1FGUA 4RH6A 4BAXA 3PV1A 2XTIA 3NTIA 3S1QH 2H4OA 1B53A 2WS3B 3RNAC 1N36L 1KF6B 2K5DA 3MXNB 3H6NA 3HUIA 2XN9C 2G9HD 3JAME 1SYEA 2LY7A 3RNUA 2GVAA 1IL8A 2B39A 4LUZA 2VQEQ 4G11A 4A3BG 3UGBB 5EKIA 3R66C 3EC8A 4PG3A 1YNND 2K50A 4KV2A 3V6CB 4BBNF 1WXQA 2KEDA 2O2VB 4O2DA 1LUZA 1JCKB 4OELB 2B2YC 2JN4A 3QIAA 2D3GA 2H88B 2GBNA 2JA5B 4W9EA 4DV1L 5EKLA 1TKGA 3N1XC 1IZ6A 2WB1B 4LNIA 1V9PA 4W9CA 5FO9B 2D10A 4DDID 1RCVD 4JQWC 2GBRA 1WI5A 3WDNA 2BOSA 2ZPYA 5EE3A 3E0JA 1HRJA 1TS4A 3S1MH 1PH8A 3LB8C 4ASWC 4A3KB 2K03A 4RFBA 2HHHQ 2DZIA 2XNAC 4DR4Q 2NCNA 3PGEA 4FVMA 4JW0A 4KV6A 1WH3A 5L95C 4HRSA 2XRSD 2WXHA 4V190 2IGGA 4YY3L 1QQRA 4ZYNA 1ET9A 2N9KA 2A68D 2MX2A 4YWLA 1KLUD 3T1YL 1R4NI 2KTRB 3ULPA 2N88A 2MLBA 4ZUIA 2SNSA 5EBCA 5JVH3 5CMDA 1P3QU 3PZ8A 2F0UA 3PREA 2LI5A 5E6NA 1S5FD 1I4GA 2EYMA 1EYAA 3H8HA 2Q2UA 4A3GG 4LAAA 5IGFA 1S5ED 2O4XA 1K73C 5JOBA 4AOFA 2IJ0A 1N8RC 3D8GA 1WJUA 2K6QA 2V9HA 4KGSA 3U50C 1TBEA 3C2PA 3OSOA 1TWGH 4DV2L 3DHIC 4OZAA 3PQIA 2JK8A 2KJ6A 1CZWA 4II2B 1BVSA 4LFAL 4JBKA 3PIP3 3B2GA 4KKUA 3HKZE 1FYCA 1FL0A 4GDLB 5CTRC 1WY8A 2BE5C 4HXDA 1SEBD 4P73A 4LLGM 3MC0B 2VRRB 4DR1L 3VR6A 4DKAC 4P6VF 4BKSA 4DV5L 5JZEB 1E7ZA 2HQLA 4LDTB 2IW3A 4BWGB 1EF5A 2B63B 1QLBB 3KWVA 5GQOA 2NBUA 1NCVA 2Q2TA 3NWTA 2AQ3B 3OYYA 3V05A 3CD6A 2G4DB 2XWJB 1SE4A 4DHJD 2ZVNA 2FJ2A 4FXDA 4K0KL 3VR9B 2CWPA 5CBAE 4DR7Q 3MP9A 4FHKA 1B70B 2F0IA 2J7ZA 3K58A 3TEXA 2WXFA 4EUTA 5LNK1 2NZ1D 1D5MC 2ZNVC 1GUGA 3UI2A 4FJZA 3DOWA 4EFOA 3MXPA 2MJ8A 2WFWA 1BMLC 4KSLC 2ZW1A 4US8A 4PS7A 2KFKA 1F2ZA 1FGBD 1VCIA 3S14H 1O7IA 2B2TA 3ZDTA 4K6DA 3H91A 4AYBG 1SMYD 3ZXRA 3RMHA 1Q7YC 1AFPA 5IY0A 1I5FA 1ZOYB 1JT8A 2QILA 3GTPB 3M62B 2DUDA 4CKEA 3KYCD 3C0RB 3SU8X 1FO4A 2R7FA 3OG5A 4UP8A 4KX6B 3MTNB 4HMIA 1PH2A 3AEDB 1ZKOA 2J52A 5C4JH 2O6VB 3I56A 1YHQA 1RHPA 5JJLA 3T3OA 1U9RA 3APDA 1U4MA 3RNFC 2A6HD 2JU6X 2KDFB 4KKSA 1ZW7A 3RNCC 3Q3NC 5FOBB 2R7ZH 2EPBA 2LMCA 1LTAD 1WXSA 4KSKC 3IT4B 4IUQA 4RAUC 1E8YA 1YD8U 3PLVA 2G3QB 3R3MA 4HSPA 2FMMA 1XMOL 2NTSA 4V0BA 5DM73 4A3FB 1S1QB 5IAAC 3UE1A 3Q6SA 3AE4B 1TS3A 1BR9A 1YJ9A 2HDMA 3CMAA 1ESFA 3RMKC 4JK1C 3PSIA 1E1OA 4WJNA 5D2MB 2X6LA 3WOEA 2JWZA 4RKBA 2PW5A 4FXCA 4G7HC 4E3CA 2WV6D 3L13A 1K28A 4YTPB 2MBHA 1BCPD 4F87A 2UUBL 4CHKA 2RPQA 1OFFA 1P0RA 1E5WA 3RZOH 4K2KA 3NBIA 5IYCH 5J39A 1C48A 1BOSA 2YEPF 3I55A 4M1UB 3VUYA 1CM9A 4IJHA 1DONA 5DPSA 1IHZA 1ZXTA 3P1MA 1EYDA 4RHRA 2BYEA 1SRUA 1KTKA 4YCVA 3NQIA 1XLQA 2WXKA 4BBSB 3OJ3A 3OAWA 1VQFA 1C9FA 4J6HA 1X3GA 3FKYA 3Q3MC 4MJSB 1LACA 2DAJA 1O7YA 4JI7L 5G5HA 1KXLA 2VZKB 3GS2A 3T51B 3J7AF 1YIWA 2OCEA 4ALPA 2O6VD 4W9IA 1STNA 4DU9A 1V1QA 1JWAD 1TJEA 4BOZB 2KX0A 4KY7A 2V0GA 2K33A 4GN3B 3HG9A 3A74A 4USAA 3J81i 1I50H 2J7QB 2QDFA 3Q8AA 4G3XB 2A6EC 4I65A 5GADC 2F0VA 2UU7A 4MSQB 2E2JH 1C4AA 1PTOB 5ELNA 1AWDA 3VA7A 4IWQA 1EU4A 1PH3A 2F3VA 1TR5A 4G57A 3BVGA 1FD7D 4GNXA 2NN6G 4LF5L 2LVPA 1DOLA 1Y8PB 2DJGC 1R4QB 1WCMG 4JI1L 5JHBA 2AWTA 3EGRA 5E1FA 4M02A 4DXFA 1HNZL 4B3RL 2REXA 2PE6B 3HKZG 2L83A 4FF2A 1LFDA 1TWFB 4JYAL 5IP9H 5J22A 3HOUG 2DZMA 4WH4A 4EZKA 4EOYA 4I7AA 1QOFA 3MTSA 2N9EB 1RFAA 1X55A 4N6EB 2ICIA 1VQPA 3EFUA 3OOCA 4UHVA 1VD2A 2C9OA 2PW7A 1QJOA 2NBVB 3C8YA 4LF5Q 4F8MA 2L32A 2YVCA 3TSSA 3P4RB 3MEHA 3VFKA 2JA7G 2M19A 4G4KA 3A4RA 2E2IB 4YHHL 5CHWA 2MBOA 1BCPB 3HP3A 3W3AA 4DF7A 1SYGA 2V4LA 3LWEA 3AE5B 4WJOA 3D6CA 1L2NA 1XTCD 3QARA 4ACFA 1AE2A 2CWAA 2WACA 4QIWB 4LFAQ 3J80L 2JRIB 3AI5A 3I57A 1TWHH 3KF6B 2ZW0A 3M63B 4LNFA 1EM7A 1AEXA 2AMCB 3NVWA 1I3QH 3PVLA 1CK1A 4C00A 4BXXG 2AQ1B 4KKIA 1DJRD 1OEYJ 5T8IA 1CUKA 3PV0A 3PPAA 2KZRA 1PFNA 4BBRB 2WXMA 3I73A 3DVNV 1E2ZA 3S24A 1QNUA 5IWAL 2GRIA 2KBNA 1BO0A 4YTMB 1I94L 3HOZH 1O7LA 1HA5A 4QGUA 3SHLA 5GROA 5JEAH 2QDBA 1M4VA 3R93A 2NVXH 4NW2A 4DQOC 1EY0A 3T8MA 3AEEB 1Y8OB 2BCOA 3TP7A 3DBHB 4RM9A 2FCMA 4HIMA 1L5PA 2K8CA 4C3IG 1PQSA 1MHHE 1VJKA 2B2YA 3A9JA 1N63A 3FILB 2KHSA 1ZP0B 2BE5D 2LVOA 1KDBA 4JI4L 3LYYA 1GUNA 4NXMQ 3SK4A 1FVIA 1YIJA 2YU9B 1LT6D 1S5BD 2R92G 4CDEC 1Q5WB 1SR3A 2LHEA 3DBRB 1HNWL 1MJEA 2E5LQ 1B3AA 1EUJA 3ZJYC 4A3MG 4JYAQ 4KI0A 4EX5A 4YCUA 3RD2A 1O7ZA 5JHAA 1VCBA 5DNFA 3GTKH 3I4NB 1ET6A 1QCBD 2BA1A 5BMGA 4I6PA 1PTOC 4K6LA 4QL5A 4JI2L 2LJ5A 1A15A 2R61A 2RPVA 1V2YA 1DM0B 2MW5A 4L5SA 1JC7A 1YX6B 1V80A 2IGHA 4AWJA 4DUZQ 1N34Q 5E4XA 5C5MA 3K5NA 2F52A 3FKIB 1MHXA 4F1SA 4A3EG 2KQ7A 5C0XG 4C80A 1UBIA 3LXFA 4GN4B 2M56B 3AE6B 4YSYB 3PUZA 1TQOA 1NNXA 2SOBA 1TS2A 4DPGA 1FFVA 1A3UA 5ELDA 3ZKJC 3W1BA 1WR6E 3HVDA 2ASBA 1Z5SB 2B2WA 4GB9A 4OGQC 3RI7C 3NPPA 3VRBB 3GE3C 2RF4A 2RKSA 1E8XA 2RDGA 4BY1B 1IYVA 2KVMA 3PCOB 4LF7L 5HFYA 4NAMA 1U0LA 4MSMB 1NTGA 4NB3A 4PS8A 2INNE 2OEDA 2E6XA 2KDBA 2K5QA 2UU9L 3E9SA 1S72A 3DWGC 2L0CA 5IYBH 1YITA 5M3MG 1FXIA 2D07B 3U4ZA 1K8MA 5C4XG 1P7EA 4NY0A 3VVWB 1BXTA 1QVFA 4DR7L 4B9WA 3NHEB 4PS3A 3PO3G 3NHHA 1Y1VG 2NUCA 3TN2A 3UIOB 3FAHA 2K8BA 1GHJA 1FJGQ 5GAHC 2JP1A 1H9SB 1V1PA 5CV8A 2K5WA 2PCFB 3MA2B 3G48A 2ZCCA 2KTRA 4K3BA 1KLGD 1E2VA 2N49A 4DR1Q 2NVTH 2HTME 2LGIA 5IYDG 3RZFA 3ZW3A 4KGTA 1L0WA 2E76C 5KIXA 1GAQB 3LJ3A 1ILPA 4DUYL 3L2PA 2MCNB 1OXUA 2E2JB 3K57A 1OEYA 2INDC 2WXLA 3HHMA 1DZ1A 1P16A 2C5LC 1E0BA 1ICWA 3MEFA 4X3KA 2A5UA 3L54A 1D5ZC 1EY5A 4DN4M 3GTKB 4LNOA 3ZO5B 4AQ7A 1EWYC 3ZQ4A 1X1MA 3PT2B 4CQNA 3H09A 3HOZB 1E8ZA 3U9SA 1RDPD 4IUUA 1N62A 1AH9A 1R9TB 2M2LA 1R4PB 5IYBG 2JA6H 3AEAB 1STYA 1H9MA 3OWEB 3BIID 4LK1C 1W2BA 4FDBA 2EXDA 1GO3E 5KYLA 1DCZA 1WMHA 4XYQA 2GBKA 2E74C 2PPHA 4RF0A 4QF4A 3KF8A 4HCEA 4HJ7A 1NENB 4A93G 4HEA1 1OTCA 4B3TQ 4LF4Q 2O5JC 1P1AA 1CTMA 3HOXH 1XEEA 3TBLD 3NUCA 2D2QA 3SDLC 4KY6A 2B2TC 2X6GA 4A90A 1QT9A 4NKLA 3CCUA 3VA5A 4KHPQ 2ATWA 2HHHL 5CX3A 5AZHA 1GUTA 4KDIC 1B1ZA 2UXDL 1WJNA 2EVBA 3VDYA 3AQQA 1GJZA 1V8QA 4RGNA 3W9CB 2KMCA 2R7ZG 5EPLA 4O1NA 2IX1A 2EMTA 2AQ2B 2WB1G 2L1BA 1MGSA 5I6YA 2JSVX 5FR3A 2B8FA 3AE2B 3VYUA 2PZWA 2PEAA 2KK8A 2W9NA 3CF6E 3KK7A 1SSNA 4K0KQ 1QILA 4N8X1 4A3DB 3SE0A 4W9FA 2I2YA 4PZ8A 4C7YA 4C3HB 1PH4A 4A3KG 4OZCA 2CH4W 4O0AA 5KYIA 1TKEA 3LNNA 1WTQA 1WGGA 2FUHB 2UU9Q 3N9YC 5LL6X 2KHIA 2ASQA 4FN2A 3TCAA 2E2IH 4G7OC 2MH7A 1NEKB 2PMZB 1QZEA 4CDCC 1IKLA 1XNQQ 4IALA 1XNQL 2VB3X 1C4PA 3TMPB 3UE0A 2FNJB 4WJQA 4P1CC 5JJZA 2L12A 2VUMG 1B2TA 4NJCA 1H8CA 2WINB 4R4IA 3A1QB 1O80A 3M4PA 4A3EH 3KF8B 3C1FA 3PF4A 4QCLA 2WNMA 2C60A 4HJKA 4AJYB 2EZVA 2LGYA 3M9BA 1S40A 2WHIA 2IDYA 2A69D 4DV0L 2UXBL 2BA0A 1YQBA 2PI2E 4XXEA 5KNDA 1LABA 4ZKCB 1VQKA 3CCLA 3S17H 1IBKQ 1CJEA 2L1AA 2QMTA 4XC2A 3T56B 3J7YW 5J18A 1GPXA 1PTOD 3HZXA 1JRUA 3NZUA 1KLVA 2C7MB 5ELCA 3APFA 2FIFA 2V3PA 1Y1WB 4XYOA 3GTLH 1Q8IA 3KYDD 4BZAA 4PK1A 3Q22A 4XQNA 1UE5A 4KHPL 1EQRA 2WAQB 4KTAA 3T1YQ 1PTOH 2DY8A 2MP2B 2WXOA 3S15B 4R4TA 2I5LX 3VRAB 3EFXD 4JVZA 2OT2A 5GAGC 5J17A 1E3PA 1BT0A 4WWPA 4NPSA 3MWYW 3CCVA 3A56A 2B63G 3CAMA 5T1IA 3EHVA 2J0MA 2QCPX 3IXSA 1CZGA 2K01A 1PVOA 2CJOA 2G4SA 2KOLA 4DV4L 5LMUL 2KMMA 1EF1A 1F9JA 5IYDH 3TEWA 1PGXA 3IAYA 3TBIB 4JL9A 2DWQA 3TP5A 2KT7A 1JMCA 3K5MA 4Z9CB 3M4OB 1VZ7A 4C3JH 4EVOA 4JIOU 3QHTA 4HCPB 3GO5A 4CBVA 3ND8A 5M5YB 2ZT9C 1TY2A 1IGCA 4GNXC 1E8WA 3Q8DA 2Q5WD 3CW2C 4RGMA 4MTNA 3N52A 1DOKA 4H0LC 4OIJA 3DWMA 1WTPA 3E9IA 3MAQA 1JRPA 3WAOA 3KLWA 2BYVE 3NXWA 2IT1A 1WYGA 3KLRA 1HH2P 4A6QA 1EFWA 2JQOA 4KKJA 4R3DA 1TKWB 2F0FA 3H3VH 3IAS1 1F2YA 3U9OA 1XNRQ 3N6RA 5LMNQ 3RNBC 3IKJA 4K8JA 3M3YB 2I0QA 2FFKB 2Y0SG 1Z2MA 5EJWA 2BH2A 1HE8A 4ZK9B 2ZZPB 2KCNA 2D5GA 3CHBD 2D3BA 3JAML 4ZOHC 4EEWA 1IKMA 1B50A 4P72A 2MNAA 1V9JA 2HD3A 4XWTA 2VH2A 3NRZA 4R1JA 1YNXA 3BDOA 4NXNL 1R4MI 2LXAA 2ZXPA 3MHZA 1WIAA 1YQ3B 3A0JA 1SYFA 5IYCG 2GMIC 3B2FA 3IFDA 4JC0A 4ARIA 4LNQA 3N30A 3NVVA 2KCMA 4XIGS 3Q8FA 1EQVA 1UD7A 4WJ4A 2L05A 1CA5A 2EQSA 3SK6A 1X9NA 2F0DA 3W5UB 2M17A 2R93H 4Q0FA 3HRDD 2IBIB 3SK5A 1MKHA 2KQ4X 1WM2A 4WQMA 5C4JB 1T5EA 3A55A 3PIPA 2A1AA 1J19A 3PTFC 4A3LG 1PHJA 4PYUA 2LASA 3SK8A 2KDIA 2KANA 1UE1A 2L0FA 3C46A 4FJYA 3BY4B 4IO9A 2A4ZA 4RNAA 5M3FH 2DHZA 3WAMA 1A5RA 5C44B 1HEZE 3DBRI 2X8XX 2EYJA 2RCFA 4W9GA 3B6YA 5C3WA 4P74A 5J1ZA 2E2HB 1P8LA 3T53B 1VQ5A 1T9HA 2RDFA 4GKKQ 2JYOA 2HDEA 1A2UA 1C4QA 1F0ZA 2K1FA 5BYQA 1HTQA 4MELA 3NEMA 1KRSA 3DBLI 3JVZX 3S1QB 4DAYA 1EWHA 2EDGA 2QW7A 3WWVA 5C0XJ 2F0WA 4DR3L 1K0SA 1E6EB 1XLOA 5M5YH 2JXTA 5GMVA 1IW7D 2AL6A 4BFRA 2X69A 3GP7A 1G2TA 2EKIA 2YLMA 2ZVOA 1EYCA 3QC8B 2GBMA 5IE8A 1GC7A 3UDFA 4EQPA 5FLXL 2A8VA 4CYEA 1S4ZA 3EIVA 3FDTA 1HNZQ 3AEBB 2F3WA 3ER0A 1WGYA 4M01A 5JVG3 3VTWA 3ZTDA 4RGOS 3H0GH 4HVBA 5IOCA 4GDKA 2JA5G 3I90A 3A33B 5C0XH 4BKGA 1BCPF 2A69C 2KHJA 2AX5A 3NOBA 4P1BC 2XRQD 1I6VC 1SE3A 4IOAA 1NMGA 1L6VA 2WAQE 2A73B 2IY1B 4IUMB 3P4QB 1V43A 3KBGA 3F2DA 1VQMA 2QIEB 2EY6A 3F2UA 1PXUA 5HHDG 5JJIA 2KVZA 2UUAL 4GOPB 2F4IA 4ULLA 2K5VA 2WX1A 2NYZD 1A62A 2PI2A 1T0YA 3Q3OC 4K5WA 1XF5L 5BN5A 1OXSC 1Y56A 2LZ6A 1ZDXA 2D62A 1KNEA 3D4DA 3Q8BA 1WZ0A 1CHQD 1Q3LA 3FKIH 2F0GA 1RAXA 2Y5PA 1ZUD2 2OEOA 3VR3A 1MG8A 2RCNA 3QOLA 2LJIA 3C1EA 5M3MH 2BF8B 4ZYSA 3W1YA 2AWOA 4DK1A 4ANWA 4ZCKA 3ZNHB 3QG1A 3PIOA 5D14A 3QJZA 2K1BA 4OXPA 2JA7B 1XX8A 1JICA 3NENA 2BH8A 4YHHQ 2JYEA 3JAMi 3CIRB 3JYUA 4DR5L 5KGUA 1MD2D 1QVCA 2UUBQ 2M9VA 4WQOB 3TREA 2AWNA 1NAPA 4C3IH 2KYWA 4GLAC 3Q8CA 2K25A 2J4XA 3QWNA 2X38A 2IX3A 2R93B 5H1SE 4E71A 4MGIE 1K51A 1HFNA 3QIJA 1B44D 2FMCA 4J6IA 1XPRA 1QOBA 4OO1H 2KN4A 1RF2D 1XCTL 2Z9HA 3U4VA 4W9JA 3GB1A 4JI8L 1S5DD 4LTUA 2F1MA 1TIFA 4HPLB 4NMZA 3B0AA 5LXIB 4YXDB 1EOVA 2NVYH 2MP2A 1SB3C 4HAEA 1KQSA 4X65L 2VL6A 3SFDB 3NQTA 1WYDA 4KZ0A 2KJXA 3I3TB 1Q86C 1XPUA 2AL3A 4JI3Q 1PZJD 2DYBA 1BNZA 4B3SQ 5FO7B 1C3TA 3EJIA 4WAAA 3FPUB 4M8AA 2L4NA 2R92B 5GXGB 4X3TA 1KRHA 4D2KA 4KHZA 3PZ7A 1K0RA 1X3PA 2IY0B 1E7PB 4GOCA 1TWHB 2FCSA 2FINB 3K5LA 2K6DB 2DENB 3ML8A 4MTKA 1YHAA 1VQDA 4QUCA 1F9PA 4A3BH 4M00A 1VQHA 2ON8A 5BO4B 4KIKA 2BS2B 3GTQB 3I72A 4K5VA 2KAJA 3A7LA 2YTVA 2AHOB 4XYCA 3GTJH 1SYCA 3K0XA 1WVLA 1SGHA 1WJ4A 3VR8B 1PYSB 2OXPA 2D11A 4BBNC 3NWSA 4R4QA 4POFA 3AMZA 2OTLA 2JPHA 1J6QA 1QF6A 1WE7A 1ENCA 2WDVB 1P98A 1I4QA 1W3SA 3ULJA 1X3EA 3G6JB 4KN4C 3EA6A 2OQ0A 3PRMB 2KENA 1SMXA 1IUEA 4XT3B 1JALA 2R2OA 3A9JB 1YN4A 3H0GG 1NR4A 2WXGA 3TZUA 1ESRA 2JA5H 3W1SA 3SD5A 1NMFA 1WD1A 5ELOA 1J7AA 5D3IB 2JX5A 1Y69U 4B0MA 4CKCA 2CW0C 5AUKA 2MBEA 4X66Q 3PS6A 2KWDA 2K22A 2KDEB 1WX7A 2N4FA 3J80c 3GV6A 2JUOA 2WU5B 1FXTB 2KC2A 2I38A 4HR7B 5IWAQ 1HR0Q 1WM3A 4KIKB 2MJEA 3QAQA 2BKFA 4B3TL 1IW7C 2EE1A 4A55A 1WMHB 2INPE 1WXAA 4OZBA 3AFQA 2CU3A 3I7FA 3AU4A 2JEBI 1FXAA 4KY5A 1F77A 1NYQA 1RWSA 4A20A 2PE9A 4HPMB 2Z8LA 3DM1A 3GTOB 3CWIA 4W9KA 1GHKA 1BUIC 4ZRJA 3A54A 2JZPA 3SGIA 3C3LA 1SFOH 4TKNA 3DQVA 4K7WA 3DHQA 1SJED 1K83H 1IPGA 3P63A 1CZPA 1J8IA 5D94A 4EQOA 4AIMA 2VQEL 4MIUA 5HGTA 4ZUJA 4DUYQ 3S1RH 4IM3A 3UIPB 4YWKA 2PVOD 3DHHC 4TQ1A 4MZ9A 3H3VI 1H9JA 1SNQA 3LDZE 4MDKE 4EQ5A 3NTKA 2UXCL 2CFMA 4C3JG 1SYDA 3BS1A 1J5EQ 2GLSA 4B3RQ 5FKAC 4FADA 1EZ6A 4L6TB 4AUQC 4DV3L 1L2FA 1YMHE 1AP0A 5CV6A 2C7HA 1QE6A 3ZNZB 2K5PA 3J81L 2LXJA 2MA9B 1WD0A 1EOTA 4WJ3M 1PFMA 1AYFA 3NBHB 3MC9A 1UELA 3KQ4A 3W1GA 1EEFD 1NJIC 1F52A 4BKTA 1N36Q 2JEAI 2HIVA 2F4VQ 1VQCA 2QSDA 4MH0E 2CW0D 1T0QC 1V49A 1KNAA 3BZKA 1LTGD 1TWCB 2C35B 3T16A 1CQVA 2KACA 2CKHB 1HZBA 3CC4A 1F2MA 1V1OA 2KWVB 1SJHD 1XNRL 1WZ3A 2KEEA 2WP8J 3PF5A 3HOUH 2ZEQA 4IWOA 2F4VL 2ZM6L 4A3GB 2ZNVB 3Q23A 1N5XA 3AULA 5M5WH 3U58A 4GLVB 1S3SG 2J53A 3P42A 4MJSA 4N58A 1G51A 2D3CA 4HCNB 5C1ZA 4ARCA 2VZKD 1H9RA 4GOPA 1CKNB 3ERQA 3GTPH 4GN5A 4LCDE 2IZVB 5KEEA 4NXNQ 1KRTA 2RD0A 1ICFB 4KD4A 2Q8IB 1EQQA 1TGZB 5FO8B 1QOHA 1WFQA 2WKDA 2K8HA 4YY3Q 4GKJL 2LGSA 4Q5VA 3KUZA 2VH1A 1PYBA 1X6OA 3FRPB 1FNUA 1XMQQ 3NELA 4ODGA 5JAVA 1CFMA 4MGZE 5EE0A 5CV4A 2Z4HA 4DV4Q 2OJRA 2DZJA 1HQMC 3K9PB 2SEBD 4A3IH 4LF6Q 1NY4A 2GB1A 2L3ZA 1NBFC 2N3SA 2EOTA 4KN7C 1FD6A 4IPDA 1AN8A 1ML0D 1OGWA
chains in the Genus database with same CATH topology
3J9CA 3RD4A 3T4AC 1RM6C 2DNCA 1ZPSA 1G291 4HTHA 4IFDJ 2C5CA 3BZDB 4WRDA 4PMCA 3L4PA 1PLFA 1TWAB 3TDQA 1EIGA 1JWUD 2EY1A 4A3JB 1I6HB 4N9TA 3K5OA 1NR2A 4REZA 2NN6I 3GTMB 4B08A 4FF3A 5CV5A 4UDUC 2DBYA 1L6UA 3P20A 4YSZB 5EE1A 4I7ZC 5LL6S 3DWPA 2CJNA 3AH7A 1CA6A 3D31A 3QB3A 3S14B 3H3VC 3I4MB 1PGBA 1HTLD 2N9LA 1RD9D 4IDIA 2L52A 2JSOA 2ONQA 3FEWX 2RBMA 1E0ZA 4OVZA 1QWYA 1IGDA 3KLSX 2RQXA 2Y0SB 3I70A 1XXGA 1DXMA 4TSSA 1ONLA 1XYIA 3NUHB 2NVXB 1C8CA 4Y7NB 5IODA 3VQIA 4YWGG 4XQJA 5D3DA 4OO1G 1LTSD 5D65A 1V1PB 1B4OA 1FFUA 3ONAB 2F0PA 3EROA 2WXJA 3G7LA 4KGRA 2EYOA 4FP5D 2F0JA 2ENBA 4HJGE 4YSXB 1XWEA 2K32A 1UEAB 1WTVA 4KHVA 2DNEA 1AZQA 2SDFA 2DYOA 5DEHA 3X3MA 5KNCA 4ITKA 5ELFA 3CQZB 3TEZA 5IGEA 4FYDA 1SNMA 5BYRA 3NZ3A 3E5SA 3IFTA 1JB3A 1LTBD 3M7NA 1RTNA 3NS1A 5IGGA 2I46A 2BYTA 1Z6HA 4E6IA 3D3RA 4IUTA 1XLNA 3MXNA 1CI3M 5C3JB 2K3UA 1STEA 3AE8B 1TIID 4CGYB 2N7JA 3U2SC 2DLBA 2NMQA 1HQRD 3VR5A 2E75C 2EYFA 2L5TA 3H94A 3ZJUA 5C2TB 3V96A 2BDOA 1BUVT 1PZID 3PUXA 4ID6A 3KBXA 4DNTB 4US9A 4LMQD 1HZ5A 3VYSA 1GUWA 3H6MA 1H9KA 3AEGB 1HXYD 5EPJA 2NVTB 1QOGA 3VYTA 1Q1BA 3OMGA 4NZLB 5C5LA 4LJZC 3S17B 3S1NB 1LT3D 1SYBA 4Q2JA 1VRAB 4MACA 4KD3A 4ZHPA 5NUCA 2H1EA 3HGBA 1YNNC 4ZQ3A 4ABNA 4EE2A 4H13C 1UWXA 3BYTB 5COYA 1JR0D 2Z4IA 1OQQA 3OW7A 2PNRC 4K5XA 2BS3B 5H8YE 1Q10A 3S1RB 2W54A 2F0EA 1TWGB 2VNUD 2MEKA 3S16B 1X3QA 1K83B 1E9MA 1SFOB 3U52E 3L3OC 5C6AA 3AB9A 4XTCS 2FUG1 3AECB 3VYRA 1P7FA 4TKOB 1H9SA 4OHJA 5I6WA 3AB5A 1TY0A 2YYZA 1VR9A 1BF4A 2TMPA 2G9DA 2LKVA 1JQYD 4PT5A 5BMIA 3I3CA 4B9XA 5A2QL 1D5XC 1HFGA 1TYGB 5IGDA 1OXXK 1Z47A 3NTHA 2EYHA 1STBA 1VMCA 4R9WA 3NK9A 3RFZB 5C4XB 3P7JA 3K0YA 1SE2A 3L7ZC 1YJIA 2PTLA 2RDHA 2AUJD 4QB4A 1DGJA 1XO3A 5M5WB 1IBXB 1XLPA 2DYMA 2K05A 3ETRA 1PMRA 3SEBA 3IAM1 5BN4A 3O13A 2J0TD 2B8GA 2PYKA 4HROA 1FCLA 1F9QA 4KMUC 1JWBD 3MHBA 3AU7A 1EWCA 4A8XC 1XCQL 2B2UC 3NE5B 4K2LA 4WWMA 5IIFA 5CORA 1KABA 4A93B 3A8JE 3FILA 3BYYB 2CHBD 1EZ8A 5T1GA 1N5WA 1TZOA 2ICEC 1J9OA 1GOZA 3PUYA 2V3NA 3PUVA 1VMPA 2RVLA 3DXJC 1F2RC 3KWLA 1CHPD 1C76A 3CRKC 4A3BB 1I50B 1FR3A 1HZ6A 2MGSA 5JPMC 4RF1A 2ACZB 4DNRB 1EY4A 1AZPA 3ZYYX 3GTJB 3WCQA 2NVYB 3J81E 5I2YA 1BQQT 3HOWB 4JE3B 2F0KA 3MFGA 3PO0A 5FLXE 5K5PA 2HCIA 3M85A 5G3LF 3EUB2 1HCZA 2VUMB 5M5XB 4FF4A 2MJDA 2Q8TA 3I8ZA 1ROEA 1UUPA 3I9V1 2JQRB 2CVRA 4A9AA 1UGJA 3A8KE 4JBWA 1LT5D 4C3IB 2BW2A 1WWTA 4KKTA 1FCCC 4L1BA 1N60A 5CR3A 4C7ZA 4R8NA 4GZYC 3DEOA 1G2SA 2NVQB 1HUNA 2JE6I 1DD2A 1YNJD 2PZTA 1SBBB 2WXRA 4L63B 2A6ED 3AN1A 1YN3A 2N55A 2I07B 2JYTA 4P16A 3GQBA 1D2BA 2PZUA 5F2DA 1EQTA 3K6OA 3EVQA 3ZJVA 3RLFA 1F9RA 2PW9A 3U4EG 1GB1A 1II3A 1HUMA 1EEID 5I2XA 4TRDA 2DY7A 2KUMA 1T5XD 3RUZA 1PRTB 1BCPC 4MM3B 5K36H 2VB2X 4RGTA 1SDFA 1SNPA 2IX0A 2K0PA 1A3TA 2EJMA 5CYUA 2Y5CA 2D9UA 3R2TA 4L23A 1G6ZA 4XDXA 1A3VA 4N9PA 2PQEA 1N61A 2EYLA 1PDQA 1U4RA 3HEJA 1PRTF 2JXMB 5IGBA 1LLRD 3MVVA 4HEDA 3X3NA 2BDNA 4MT5A 4IKGA 3IL8A 1Y1VB 1STAA 5ISRA 3AEFB 2LMCB 2IPKD 1SNOA 1QKZA 4MN3A 3A7AB 4KJNA 3OHXC 1FNVA 1YNJC 1MPEA 3H0GB 5DM63 3OWFA 2QF7A 1OQRA 5C4ZA 2K6AA 4A3EB 3URYA 5D7GA 1SNDA 2EYPA 1Z7TA 5M3FB 1SAPA 4IUPA 2XIWA 2FBWB 3IT6B 3TP6A 4O42A 1YNTE 2EELA 5LHY1 1X32A 2NWGA 3AE1B 2K7VA 2NBFA 5E6JA 2LFNA 1PRTD 2D2CC 4K8IA 3ITPA 2L55A 1JORA 3RZDB 1WRIA 3QJYA 4IUVA 3CRLC 4WJWA 3TMEA 5HG2A 2MP1A 2WP9B 2F0LA 3FPPA 3AMUA 4N59A 3AE7B 1NYRA 3KLSA 1K8OA 2BB6A 2F0QA 3UI3A 4RCOA 2R7ZB 4IURA 3HRZC 4FNFA 3GTGB 4C3JB 2OHFA 3BWUD 1DOIA 4MH8A 4HKQA 1Q90A 2PO4A 4F7XA 4U673 3R3OA 2IGDA 2B2WC 4IFDI 3SR6A 1FRRA 2B2VC 2DN8A 3BDLA 4DAPA 2WU2B 1F2LA 1GJXA 4KJOA 3AE3B 4R8IA 1UAPA 4WURA 2EY2A 1E2WA 5BMHA 3S1MB 3V3XA 3HOUB 1NI3A 3BK1A 2KDMA 5JPNC 1F2RI 3FC4A 3RZOB 1JWSD 1PFBA 5CBEE 3HS0C 2EJFC 5C3XA 3ABVB 1Y8NB 2XWBB 1DOYA 1MSHA 5G3LD 3E6ZX 4DA2A 3MJ5A 3WOFA 1FRDA 1AW7A 3S9WA 4RCNA 3BDCA 1S5CD 2E3TA 4J1MA 4ZRPA 2V4IB 3M4YA 3P4SB 2PLPA 2BBCA 3ND9A 1BDOA 1VDVA 1J7CA 1WTOA 1G91A 2KA7A 2WXQA 4IFDH 3AM9A 1LV9A 3K7AB 4JWSC 4XDCA 4K14A 3A8IE 4X3UA 1DOMA 4ZAIA 3B9JA 2EJGC 1NSNS 1FIQA 3FVQA 5EKKA 5KRUA 2LHDA 2A6HC 2N0SB 5IT9E 3D4RA 3NVZA 3NVYA 1RODA 4LK0M 2QEJC 1R7SA 2K04A 1B9RA 1KH0A 3I91A 3SVMA 2Z1CA 4CKBA 1DOXA 1BBXC 2PMVA 3OIPA 1L0YB 3Q0AA 4EQNA 4IFDG 3Q69A 4YTNB 3DWQA 2BT6A 2W3SA 4QMGA 1ZE3D 4BA1I 3J7AV 1QOAA 4RHSA 3LX0A 2FHTA 2QKIC 1NUCA 1JW9D 1YQ4B 2BB5A 4ZKBB 5EE9A 3MZ5A 5ELEA 2NB0A 1MBYA 2F0OA 2WXPA 4B0EA 1WTWA 2RA4A 4FF1A 2MHVA 1PDXA 2B2VA 4L8JA 2A74C 4DAVA 1JMLA 2FE8A 1TS5A 1PTOF 1RYJA 1FEHA 4JX1C 3D4WA 1I4PA 2F0NA 2XSCA 3CU7A 4IQZA 1LTID 4ZHOA 4WIPA 3U7ZA 1JOOA 4DXGA 4J3OD 4S3SA 3W2DA 1ZXIA 2F0MA 1WTRA 3MFYA 5FK9C 2BS4B 1JQ4A 1PRTC 2PIAA 2G1EA 4XDDA 2B2UA 4YIJA 1VF5C 3QO2A 5BYSA 4G7ZC 4C1NI 2IWHA 4C56C 1M8AA 1ZYRC 2KECA 1EU3A 4YT0B 1MSGA 2HDLA 5ELBA 1WCMB 2F0TA 2KCCA 3PMFA 5TSSA 2CQAA 1I4RA 1WSPA 4BS9A 1KDAA 2ZXOA 1CT1D 4NDXA 3M7GA 2EXZA 4TMAB 3TZDA 4OL7A 3FMCA 1Q12A 3R2IA 2WDRB 5C0XI 2B76B 2LEKA 4ZRQA 3P1HA 1JOQA 1T3QA 4IN3A 1EY7A 2GA4B 3BVZA 4OIKA 4XT1B 2W3RA 1PYWD 3PIO3 5EGTA 2KQ3A 1OXTA 3AV8A 2LFIA 5JXVA 3SXHA 1A70A 2PPBC 4C3HG 3TEYA 2R3ZA 5EPKA 1W6JA 2TSSA 4OO1I 2F0HA 1L0VB 3NP8A 1QNKA 4WFN3 1MI2A 1IYUA 1D1IA 3T3NA 2RSOA 2RMMA 2JWUA 3EQLC 5EQ0A 3GV3A 2O5IC 3QOJA 1ZDVA 5HI1A 3RPFC 4RWSC 1QB5D 4PQXA 4M0WA 1EY6A 1KFYB 2AUKA 2WDQB 1LT4D 5IT9L 1B9NA 3BK2A 4XQQA 1LO5D 3MXGA 1ZYRD 4GLSC 1VZ8A 4IOIE 4AYBB 5K36G 1TKYA 3S2HB 1D6EC 3Q24A 1ZXHA 1GB4A 1D4BA 1I3QB 3W5VB 5DAUA 2K9XA 4X3SA 5M9OA 2ID0A 4HCSA 4ZRZA 1GXDC 3E56A 1RTOA 4H44C 1STGA 1ILQA 1RFKA 2SAKA 1ZEQX 3TP8A 2XVSA 5KNBA 1C79A 3LWUA 4DGZA 1STHA 4H2AA 2Q8RE 2WXIA 4IUNA 1MI0A 4PV1C 1SSOA 2HQEA 2WXNA 3V2TA 1I4XA 2OF1A 2VXWA 2NTTA 2L9HA 2L11A 1EY9A 1VZ6A 4RA8A 4CJ0B 5C4HA 5C3EB 4MHEA 3I4LA 2WIIB 5E3FA 3K59A 4ZLTF 3HVZA 4PMBA 1JWMD 4XWWA 5E4WC 1SIJA 3GTLB 4JWUC 3Q8EA 3PO3B 1GUOA 1W6KA 2W55A 4OW0A 1LTRD 1I4HA 1FMAD 2PVGC 1UNSA 2MUYA 3T13A 2F0SA 4CJ1B 1K50A 2YEPB 1F9SA 1HA6A 4C1NK 1JE4A 3HOXB 2F03A 4AS1A 3OPOA 1V97A 1PUTA 1WGKA 4RKLA 5I9OA 1SXTA 1A2TA 2H89B 2WQYB 2A68C 4GDKB 1U4LA 1ENAA 2HUGA 1DYQA 4ME5A 1A6XA 2SNMA 3BVMA 3MXUA 2MJ3A 4HMJA 3HKZB 3BG3A 4NP5A 4ILWA 1EIHA 1TT2A 1SF0A 3AE9B 4WORA 1HPCA 1NVID 1FNWA 5CV9A 1V8CA 1VLBA 1CQFA 2ZXRA 3KUPA 2WLBA 3OMCA 1K53A 2M0AA 5A35A 5I4DA 3VR4A 5MPOA 1Q1EA 3D6WA 3R8BA 3VR2A 1U4PA 5AFWA 1JROA 4HSVA 5H92C 2JA6B 1RJTA 2HCCA 5CGKA 2JA8B 3SR1A 1HTPA 1JOKA 1B9MA 1L0XB 4H7BA 4QUFA 1SNCA 2LUMA 4TQUS 4J8QA 1J7BA 3HOVB 1EFID 4F88A 1IBXA 4PNYA 1SMYC 3DMUA 5EBDA 5A2QE 4BY7B 3HOYB 4FO2A 4JPSA 5JEAJ 5I9PA 1GUSA 4XE0A 1I7HA 1YJJA 1T6BX 1C4CA 4TQ0A 4C2MB 2EY5A 4P2CB 2QJLA 2BTEA 4UAIA 1MVKA 3OIQA 3DEPA 4A3MB 1L4ZB 2E2DC 3NBHA 1ACCA 2K28A 3CKIB 4NAWB 4FXKC 1EL0A 4A3IB 1TVXA 3SDZA 5HURA 3ZJTA 4FXGC 3S2DB 2O2LD 1KDCA 2R6GA 1FM0D 3DWAA 1ENFA 2IL8A 1EY8A 1D1KA 2NN6H 1E10A 1LTTD 3SFEB 1G8ZD 1WTXA 3P4PB 5IGCA 2W82A 4WAFA 3NSWA 1KAAA 2J42A 1RKNA 1VF7A 1HHVA 2D5DA 2M00A 3PUWA 2LS01 3J80E 4KK7A 5M3MB 4CJ2C 1VDZA 2V4DA 3DUZA 4EGVA 1YN5A 1PZKD 1K52A 4BA2I 2WKCA 4HN7A 1UWMA 1OXVA 3L9AX 2GI9A 3ZGZA 1O78A 4U68A 1PFDA 3PO2B 5CC4A 2MPMA 3P75A 5AUIA 5BN3A 1PGAA 5CV7A 2Y3AA 1C77A 3GD7A 4DFAA 1OO9B 4HKZE 1TU2B 1L4DB 4L2YA 5G5GA 5JEAG 4PMWA 2RSNA 1C78A 3TUOA 4CHTB 4DK0A 2A5HA 2PKOA 4IZ8A 1QG7A 4RH6A 3NTIA 2H4OA 1B53A 2WS3B 1KF6B 2K5DA 3HUIA 2XN9C 2G9HD 3JAME 1SYEA 2LY7A 1IL8A 2B39A 5EKIA 1YNND 1WXQA 2KEDA 1JCKB 2B2YC 2H88B 3QIAA 2JA5B 1TKGA 5EKLA 2WB1B 5FO9B 1RCVD 3WDNA 5EE3A 2BOSA 3E0JA 1HRJA 1TS4A 3LB8C 4A3KB 2K03A 4RFBA 2XNAC 4FVMA 4KV6A 4HRSA 2XRSD 2WXHA 4V190 2IGGA 1QQRA 1ET9A 2N9KA 2A68D 1KLUD 2N88A 4ZUIA 2SNSA 5EBCA 5JVH3 5CMDA 3PZ8A 2F0UA 1S5FD 1I4GA 2EYMA 1EYAA 3H8HA 4LAAA 5IGFA 1S5ED 2O4XA 5JOBA 2IJ0A 3D8GA 4KGSA 3C2PA 3OSOA 4OZAA 1CZWA 3PIP3 3B2GA 4KKUA 1FYCA 4GDLB 2BE5C 1SEBD 4LLGM 3MC0B 3VR6A 4P6VF 2IW3A 4BWGB 2B63B 1QLBB 3KWVA 1NCVA 3NWTA 3V05A 2AQ3B 2XWJB 1SE4A 2FJ2A 4FXDA 3VR9B 3MP9A 5CBAE 2J7ZA 2F0IA 3TEXA 3K58A 5LNK1 2WXFA 2NZ1D 1D5MC 1GUGA 3UI2A 3MXPA 2MJ8A 1BMLC 2ZW1A 4US8A 1F2ZA 1FGBD 1VCIA 2B2TA 4K6DA 3H91A 1SMYD 3RMHA 1AFPA 1ZOYB 2QILA 3GTPB 4CKEA 1FO4A 4KX6B 4HMIA 3AEDB 1ZKOA 2J52A 1RHPA 3T3OA 1U9RA 1U4MA 2A6HD 2JU6X 4KKSA 5FOBB 2EPBA 2LMCA 1LTAD 3IT4B 4IUQA 4RAUC 4HSPA 2FMMA 2NTSA 4V0BA 5DM73 4A3FB 3Q6SA 3AE4B 1TS3A 1BR9A 2HDMA 1ESFA 4JK1C 2X6LA 3WOEA 4RKBA 2PW5A 4FXCA 4G7HC 2WV6D 4YTPB 1BCPD 4F87A 1OFFA 4K2KA 3NBIA 5J39A 1C48A 1BOSA 2YEPF 4M1UB 1CM9A 1DONA 1IHZA 1ZXTA 3P1MA 1EYDA 4RHRA 1KTKA 3NQIA 1XLQA 2WXKA 4BBSB 1C9FA 4J6HA 1LACA 1O7YA 5G5HA 2VZKB 3GS2A 3T51B 3J7AF 1STNA 4DU9A 1JWAD 1TJEA 4KY7A 2V0GA 2K33A 3HG9A 4USAA 3Q8AA 2A6EC 4I65A 2F0VA 1C4AA 1PTOB 1AWDA 3VA7A 1EU4A 2F3VA 1TR5A 4G57A 3BVGA 1FD7D 2NN6G 1DOLA 1Y8PB 1R4QB 3EGRA 5E1FA 4DXFA 2L83A 4FF2A 1TWFB 5J22A 4WH4A 1QOFA 3MTSA 4N6EB 2ICIA 3OOCA 2C9OA 2PW7A 1QJOA 3C8YA 4F8MA 2L32A 3TSSA 3P4RB 3MEHA 2M19A 4G4KA 2E2IB 1BCPB 3HP3A 3W3AA 4DF7A 1SYGA 3LWEA 3AE5B 3D6CA 1XTCD 2WACA 4QIWB 3J80L 3I57A 2ZW0A 1EM7A 1AEXA 3NVWA 1CK1A 4KKIA 2AQ1B 1DJRD 5T8IA 3PV0A 2WXMA 1PFNA 4BBRB 3I73A 1E2ZA 1QNUA 2GRIA 1BO0A 4YTMB 1O7LA 1HA5A 3SHLA 5JEAH 2QDBA 1M4VA 3R93A 4NW2A 4DQOC 1EY0A 3AEEB 1Y8OB 2BCOA 3TP7A 1L5PA 4C3IG 1MHHE 1VJKA 2B2YA 1N63A 3FILB 2KHSA 1ZP0B 2BE5D 1KDBA 3LYYA 1GUNA 3SK4A 2YU9B 1LT6D 1S5BD 2LHEA 1B3AA 4KI0A 1O7ZA 5DNFA 3I4NB 1ET6A 1QCBD 2BA1A 5BMGA 1PTOC 4K6LA 1A15A 2R61A 2RPVA 1DM0B 1JC7A 2IGHA 5E4XA 5C5MA 3K5NA 3FKIB 1MHXA 5C0XG 4C80A 3LXFA 2M56B 3AE6B 4YSYB 3PUZA 1TQOA 2SOBA 1TS2A 1FFVA 1A3UA 5ELDA 3HVDA 2B2WA 4OGQC 3NPPA 3VRBB 2RKSA 2RDGA 4BY1B 1IYVA 2KVMA 5HFYA 4NAMA 2INNE 2OEDA 2E6XA 2K5QA 3E9SA 3DWGC 2L0CA 1FXIA 1K8MA 1P7EA 1BXTA 4B9WA 3NHHA 2NUCA 3TN2A 3FAHA 1GHJA 2JP1A 1H9SB 1V1PA 5CV8A 2K5WA 2PCFB 3MA2B 1KLGD 1E2VA 2LGIA 2HTME 4KGTA 2E76C 5KIXA 1GAQB 1ILPA 1OXUA 2E2JB 3K57A 2WXLA 1DZ1A 1E0BA 1ICWA 4X3KA 1D5ZC 1EY5A 4DN4M 3GTKB 4AQ7A 1EWYC 3ZQ4A 4CQNA 3H09A 3HOZB 3U9SA 1RDPD 4IUUA 1N62A 1R9TB 2M2LA 1R4PB 3AEAB 1STYA 1H9MA 3OWEB 3BIID 4LK1C 5KYLA 1DCZA 4XYQA 2E74C 4RF0A 4QF4A 3KF8A 4HCEA 1NENB 4HEA1 2O5JC 1CTMA 1XEEA 3NUCA 4KY6A 2B2TC 2X6GA 4A90A 1QT9A 4NKLA 3VA5A 1GUTA 1B1ZA 2EVBA 1V8QA 4RGNA 3W9CB 5EPLA 4O1NA 2IX1A 2AQ2B 5I6YA 2L1BA 1MGSA 2JSVX 5FR3A 2B8FA 3AE2B 3VYUA 2PZWA 3KK7A 1SSNA 1QILA 4A3DB 3SE0A 2I2YA 4C7YA 4C3HB 4OZCA 5KYIA 1TKEA 3LNNA 1WTQA 3N9YC 5LL6X 4G7OC 2MH7A 1NEKB 2PMZB 1IKLA 4IALA 2VB3X 1C4PA 5JJZA 2L12A 1B2TA 4NJCA 2WINB 1O80A 2WNMA 3C1FA 4QCLA 2EZVA 2IDYA 2A69D 2BA0A 5KNDA 4XXEA 1CJEA 1LABA 4ZKCB 2QMTA 2L1AA 1GPXA 3T56B 3J7YW 1PTOD 3HZXA 5ELCA 2V3PA 1Y1WB 4XYOA 1Q8IA 3Q22A 4XQNA 2WAQB 4KTAA 1PTOH 2DY8A 2WXOA 3S15B 3VRAB 3EFXD 2OT2A 3MWYW 3A56A 5T1IA 2QCPX 3IXSA 1CZGA 2K01A 2CJOA 2KOLA 2KMMA 3TEWA 1PGXA 3IAYA 3TBIB 2DWQA 3TP5A 3K5MA 4Z9CB 3M4OB 1VZ7A 4EVOA 3GO5A 4CBVA 3ND8A 5M5YB 2ZT9C 1TY2A 1IGCA 2Q5WD 4RGMA 3N52A 1DOKA 4H0LC 4OIJA 3DWMA 1WTPA 3MAQA 1JRPA 3NXWA 2IT1A 1WYGA 3KLRA 4A6QA 4KKJA 4R3DA 1TKWB 2F0FA 3IAS1 1F2YA 3U9OA 3N6RA 3IKJA 4K8JA 3M3YB 2FFKB 5EJWA 4ZK9B 2KCNA 2D5GA 3CHBD 4ZOHC 3JAML 1IKMA 1B50A 4XWTA 3NRZA 3BDOA 3MHZA 2ZXPA 1YQ3B 1SYFA 3B2FA 3IFDA 4ARIA 3NVVA 4XIGS 3Q8FA 1EQVA 1CA5A 3SK6A 2F0DA 3W5UB 4Q0FA 3HRDD 3SK5A 2KQ4X 4WQMA 5C4JB 1T5EA 3A55A 3SK8A 3C46A 4RNAA 5C44B 1HEZE 2EYJA 5C3WA 5J1ZA 2E2HB 3T53B 2RDFA 2JYOA 2HDEA 1A2UA 1C4QA 1F0ZA 5BYQA 3S1QB 4DAYA 1EWHA 2EDGA 1XLOA 5C0XJ 2F0WA 1E6EB 2JXTA 1IW7D 2X69A 3GP7A 1G2TA 2EKIA 1EYCA 4EQPA 5FLXL 1S4ZA 3AEBB 3FDTA 2F3WA 5JVG3 4RGOS 5IOCA 3I90A 5C0XH 1BCPF 2A69C 2AX5A 2XRQD 1I6VC 1SE3A 1L6VA 2A73B 3P4QB 1V43A 3KBGA 2QIEB 2EY6A 3F2UA 1PXUA 5HHDG 2F4IA 4ULLA 2NYZD 4K5WA 1XF5L 5BN5A 1OXSC 1Y56A 1ZDXA 2D62A 1KNEA 3D4DA 3Q8BA 1CHQD 1Q3LA 2F0GA 2Y5PA 1ZUD2 2OEOA 3VR3A 3QOLA 2LJIA 3C1EA 4ZYSA 2AWOA 4DK1A 3QG1A 5D14A 2K1BA 2JA7B 1XX8A 1JICA 2JYEA 3CIRB 5KGUA 1MD2D 2M9VA 2AWNA 1NAPA 3Q8CA 2J4XA 3QWNA 2X38A 2IX3A 2R93B 1K51A 1HFNA 1B44D 2FMCA 1QOBA 4OO1H 2KN4A 1RF2D 1XCTL 3GB1A 4LTUA 1S5DD 2F1MA 4NMZA 4YXDB 1SB3C 4HAEA 3SFDB 3NQTA 2KJXA 1PZJD 1BNZA 5FO7B 3EJIA 3FPUB 4M8AA 2L4NA 2R92B 5GXGB 4X3TA 1KRHA 4D2KA 4KHZA 3PZ7A 1X3PA 1E7PB 1TWHB 2FINB 3K5LA 4QUCA 1F9PA 2ON8A 2BS2B 3GTQB 3I72A 4K5VA 2KAJA 3A7LA 3VR8B 1WVLA 1SYCA 2OXPA 3NWSA 3AMZA 1QF6A 1ENCA 2WDVB 1I4QA 3G6JB 4KN4C 3EA6A 1IUEA 4XT3B 1JALA 1YN4A 2WXGA 1NR4A 3TZUA 1ESRA 3W1SA 1WD1A 1J7AA 2JX5A 5D3IB 1Y69U 4B0MA 4CKCA 2CW0C 5AUKA 2KWDA 2K22A 3GV6A 2WU5B 2I38A 4HR7B 2MJEA 1IW7C 2EE1A 4A55A 2INPE 4OZBA 2CU3A 2JEBI 1FXAA 4KY5A 1F77A 1NYQA 1RWSA 2Z8LA 3DM1A 3GTOB 3CWIA 1GHKA 1BUIC 3A54A 2JZPA 3C3LA 3DHQA 1SJED 3P63A 1CZPA 1J8IA 4EQOA 4MIUA 5HGTA 4ZUJA 2PVOD 4TQ1A