1TS2A

T128a mutant of toxic shock syndrome toxin-1 from s. aureus
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISALDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
publication title Structures of five mutants of toxic shock syndrome toxin-1 with reduced biological activity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 57
structure length 194
sequence length 194
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1997-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ts2A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ts2A01
2QILA 1S5BD 1V1OA 1FNUA 1JWSD 1CQVA 3W2DA 1V1PB 2J4XA 1HXYD 4RHSA 1PTOC 1FD7D 1ESFA 3BVGA 1KLGD 1XXGA 2NTTA 2RDHA 4O1NA 1JWUD 1HTLD 2IJ0A 3R2TA 3SEBA 2XN9C 1BCPB 4ZYSA 3DWQA 1SJHD 2G9HD 4DXGA 4DXFA 3BYTB 5ELDA 1F77A 1TS4A 1EFID 3KLSX 2O2LD 1EWCA 1I4HA 1SXTA 1L0YB 1V1PA 3O13A 4L63B 2R61A 3EFXD 3OWEB 3BVMA 1DYQA 1HQRD 1JQYD 5I4DA 1UNSA 1AW7A 5ELFA 1PYWD 1AN8A 1ENFA 1PTOD 1KTKA 1SE2A 2TSSA 1TS5A 3CHBD 1UUPA 1LTTD 1RDPD 1PRTB 1TS3A 1FGBD 1YN4A 1SJED 1LTID 1RF2D 1D5ZC 4C56C 1ET6A 1PZID 1PTOH 1LTBD 1CT1D 2AQ3B 1S5ED 4RGTA 1SBBB 1XTCD 1EEFD 5FKAC 3MC0B 1D6EC 4K6LA 1YN3A 1I4GA 4RGOS 1BCPF 2XRQD 1TS2A 1LTSD 3BZDB 2AQ1B 3V05A 1FNWA 1STEA 2XNAC 3BYYB 1BXTA 1I4QA 1MD2D 1L0XB 5D3IB 1BCPD 3MFGA 4Z9CB 1B44D 2QEJC 1QILA 1BCPC 4RGMA 1I4XA 1S5DD 4RCOA 2AQ2B 1DJRD 1TY2A 1CHPD 1D5XC 1LT6D 1M4VA 4RGNA 5ELCA 1YN5A 4UDUC 1CHQD 1G8ZD 5ELEA 1PRTF 3DWPA 2ICIA 1TY0A 3EA6A 1EU3A 3R2IA 3BVZA 1PZKD 4NZLB 4OHJA 1ET9A 5FK9C 1KLUD 1LTAD 1LTRD 3R8BA 4TSSA 1PRTD 3DWAA 1JR0D 1CK1A 1SE4A 3GP7A 1PRTC 4RFBA 1FNVA 1S5FD 4RH6A 1EU4A 2SEBD 1RD9D 1SE3A 4BWGB 1LT3D 2WV6D 1B1ZA 1D5MC 2Z8LA 1LO5D 1HA5A 1LLRD 1LT5D 3URYA 1GOZA 1T5XD 1EEID 5TSSA 1I4RA 4RHRA 5D3DA 1JWMD 1LTGD 1PTOB 1S5CD 1SEBD 1JCKB 2IPKD 2CHBD 2NTSA 4L6TB 3TSSA 2RDGA 1LT4D 2XRSD 5ELBA 1RCVD 1I4PA 1PZJD 1PTOF
chains in the Genus database with same CATH superfamily
1YQBA 1TJEA 4YY3L 2ZCCA 3G71A 2Q8TA 2ZTCA 1JWSD 2LGYA 3QIJA 2A5UA 4HKZE 1NR4A 4S0RA 4FNFA 1I94Q 2KEEA 4ZRKA 1E8ZA 1WI5A 3KOJA 1V9PA 1TKGA 4GGQA 2IYDB 4LFBL 4ALPA 3BZCA 4F8CB 1XMOL 1NE3A 1HTLD 3PIO3 3CCEA 1JRPA 2A69D 3MHSD 5DCNA 3VRAB 1P7FA 2LZ6A 2L00B 2A5HA 4HSVA 1F77A 2K28A 1TS4A 3K0XA 3Q8FA 2KEDA 3UQBA 3RNEC 1SRUA 2B29A 2PMZE 3E0JA 3S14B 5BR8L 2C35B 4JOIA 1C78A 2WHIA 3ZRFA 5C3WA 1KDAA 4X57B 4B6WA 2FCNA 2ZNVC 2R92G 1JE5A 1FL0A 4FLHA 1E1TA 2D2CC 3K5NA 4KIKB 4JI6Q 4IUTA 4GIVA 4YCVA 2Q2TA 3I4NH 2KENA 2Z9HA 4X3TA 2F0UA 3QK0A 3SXHA 1CA6A 2UUBQ 2LD9A 4IC7B 4OZAA 1KQSA 5C0XJ 2EJGC 4C56C 1TKEA 4GN1A 2J7ZA 1WCMH 4DNRB 4BY1B 1ENCA 3CAMA 3F2DA 1ZXTA 2IGHA 3I4MH 1CZPA 4DR6L 3APCA 4GN5A 1WTWA 5FKAC 3FKYA 2F0TA 4KKSA 5BYQA 3HM6X 4LWCA 3TEZA 1KNEA 2ASQA 4C1NK 3PSIA 1STNA 2WP9B 3QQ8B 4MDKE 4B3TQ 1K28A 4HIDA 4KSLC 4LNFA 2TMPA 4OGQC 5FO8B 4GOPC 2IDYA 1B44D 1MVKA 1MBYA 1DCZA 3AQQA 4KKUA 2Y3AA 3HOZB 4EE2A 1FR3A 5KIXA 2V1CC 4DV5L 4JK1C 1ROEA 1WRDB 2W55A 1G6JA 2A4ZA 2MBOA 3QJZA 1BBXC 3PZDA 1YBYA 4C3IG 3MJ5A 1WMHA 1YJJA 3ZLZA 1H9MA 1GHJA 4PZ6A 4MTNA 5ELEA 2K8HA 3T3NA 1G6PA 1ZDVA 2RHQB 1JORA 1QOFA 3ZDMC 3IFWB 4OHJA 4X66L 1GC6A 4GNXC 1X3EA 4A3KH 1E5WA 4LLGM 1XWEA 1T0SC 5DPWA 2FHTA 1SE4A 4P75A 2JK8A 5IYDG 1KOTA 4A90A 3E0EA 4HCSA 4DK5A 3VYRA 1UBQA 2VQFL 4IJHA 2NVQB 3UI2A 4DNIA 2L52A 4BWGB 1V8QA 1ZW7A 4DR3Q 4KY5A 2KDBA 2JEAI 2OJRA 4QB4A 2ENBA 4YT0B 3AE3B 3VH3B 1KM7A 4XZ4A 2A6HC 4BFRA 4DHJB 4EUTA 4BZAA 3QOJA 3DHGC 3TJPA 2QC8A 3QG1A 4J1MA 3P1MA 2IPKD 3EBEA 4RMFA 1GUWA 4G57A 4OX9Q 4IKGA 4DR2Q 2JSOA 1D4BA 1UZXB 1IHZA 4DN4M 3OTOQ 1KD1C 3VFKA 1STEA 2VUMH 3WA0A 2KFKA 2Y0SB 1NMGA 1EY7A 4DR5Q 2IZVB 3BZKA 2M00A 2KVZA 4JX1C 5EDSA 1AWDA 1IKLA 3UDIA 5CGKA 2IO3B 3JSVB 4H2AA 3SU8X 2V9HA 3NS1A 2EQSA 3CW2C 2IX3A 1GD7A 4EVOA 1TR5A 1VMCA 3VUYA 4ZRJA 5FOBB 2WX0A 3C0RB 4LMQD 4LF9Q 3RN2A 4DAYB 4A3DG 2FAZA 2KDIA 1VQ5A 2XN9C 2KXJA 3GTJB 3GTQB 2N3SA 5IWAQ 3RN9C 3WCQA 2D5GA 2N7JA 3ZXVA 3GB1A 1TU2B 2MBBB 4A3MH 4QJFA 2HDEA 2YU9H 3BK1A 4EX5A 2KTRA 4ZHOA 4GXBA 5HGQA 1WH3A 3T13A 5CR3A 2E2IH 1WXMA 1ZGUB 2IW3A 3U4ZA 4PS3A 3BVMA 2I1JA 1VZ8A 1STHA 2MWSB 4DXAB 2G45B 3DWGC 1O7YA 1N6ZA 4FJYA 3EC8A 1XX8A 5AFWA 3Q22A 3D4DA 1ENFA 2LKVA 5EE0A 1WJ4A 3RT3B 3KW5B 2BCOA 2BE5C 4FULA 1CI3M 2NVYH 2KA7A 3E9IA 2GMIC 3DBRI 2RDBC 4B3SL 3T8MA 2HCCA 2MP2B 4P7IA 3SFEB 3GTKH 1EYCA 2QEXA 2KX0A 1PZID 4PMWA 5M3MB 3A7AB 5I6WA 2Z0DB 3GTGH 1C1YB 4A93G 1NVID 2EMTA 3IXSA 2D0OA 2WB1G 1UF0A 4DHZE 5IKCM 2F0PA 1I4GA 4V0BA 4G7HC 4V190 2BS4B 2QDLA 2W9NA 2XGTA 4OIKA 4LUOA 3HOYG 2B8GA 3Q2AC 2EYPA 3ULLA 4DUZL 3IAS1 1GKHA 3PV0A 4A3PA 2UXCL 1VQEA 1DONA 4R8IA 1KNAA 4Q0FA 3VVWB 2WGSA 3Q69A 1WGYA 5BMHA 2KC1A 2K01A 2RQXA 1BOSA 4DAVA 3HIZA 4KDIC 3HHMA 3TP6A 3R3OA 3PT2B 4LNOA 2KHJA 1DOKA 2K0PA 4W9IA 4C3JG 1WVLA 4USAA 1FJGQ 3IT4B 3EROA 1WJNA 2NPTA 4HROA 3FPUB 4JGHB 4DDID 4A3IB 1QUQB 2KQ3A 4X65L 1WTXA 4KHVA 1Z6HA 1I42A 1LTRD 3DBHB 4MSMB 5BO4B 2WU5B 3HOVB 2MBEA 2FUHB 4HEDA 2WYQA 4JPBW 2UXBL 3ZJTA 3AE1B 1VQPA 2LMCA 2K8CA 2QCPX 4XGAB 1KDBA 3M3JA 2B2YC 4A3JB 1IBML 2E2DC 3S1NH 2LASA 4II2B 3D6CA 4CDCC 2WV6D 1TT5B 1RWSA 2Z8LA 5JHAA 3BS1A 5M3FG 2JA7H 3D8GA 1GOZA 3ZVVA 3OSOA 3PIPA 1YJ1A 4B3ML 5GMVA 2B2TA 1C4QA 5D3DA 1S5CD 3AEGB 1OXUA 3TP7A 1RM6C 5C44G 5BMIA 4US8A 1BVSA 5C3XA 4FXCA 2LFNA 1HTOA 1WX9A 1JQ4A 2L11A 2XRSD 4BXXH 4DK1A 4MT5A 2HIXA 5IP9G 2OJWA 3M63B 1RCVD 1I4PA 1U9RA 2Q2HA 3TS2A 2J0MA 2LFIA 1H9JA 4JOIC 1PUTA 1YZ6A 4JI5Q 1XNQL 2LGDA 3A4RA 3SGIA 1HCZA 1L4ZB 4LJPB 4W9GA 4ARIA 1SFOH 2RSUA 5G2NA 1K8OA 4GDKA 3U50C 2EELA 2F3VA 3PUZA 2OEOA 4IPGA 1J0GA 1ZP0B 2GBNA 3KBGA 4HMJA 2OCEA 4WJ4A 2JXXA 3VHTC 4QAYA 4K7SA 2NZHA 3M4OB 3KWVA 5FLMH 1XPUA 2IJ0A 2WAQB 2A6HD 2GBJA 5IA7A 1XPRA 4RM8A 5D94A 2EYOA 3BYTB 4LFBQ 1STGA 3K5OA 3VXWA 4YL8A 1QE6A 1PYBA 2O2LD 4XTCS 3CCMA 3T3OA 3M62B 2JSVX 3D31A 3O13A 4JI4Q 5C6AA 3LDZE 3I73A 2WB1E 1C9FA 4BBRG 1D7QA 2HDLA 3F2UA 1F9QA 4F88A 2W54A 2MCNB 1VQLA 3SFDB 4FXDA 2CQAA 2LHDA 4LAAA 3J7A5 3D32A 4EQNA 4A3EB 1JT8A 2BPSA 1SE2A 2J0JA 2KLGA 4JBKA 3B1LX 2KOLA 3PLVA 1PH2A 2M9VA 1X6OA 2PZTA 3W9CB 4LF5L 3NY5A 3APDA 2BKFA 1XPOA 2AMCB 4OWWB 3LB8C 4JBWA 3PUYA 4L5SA 3V6EB 4JI8Q 1FO4A 3FKIH 1CMXB 2JRIB 3PHXB 4RGTA 1Z5SB 1XTCD 2AL6A 5KEEA 3MAQA 1Q86C 2HJ1A 3SR6A 1BDOA 2FXQA 1K3BC 1FMAD 1EY0A 1TWGB 1JW9D 3RR5A 4W9CA 1QZHA 3CWIA 3N9YC 1VQDA 1R4NI 3DBLB 2VZAA 2DX5B 2BE5D 4JI2L 1UE7A 3KQ4A 3NTIA 3P42A 1KIXA 3SE0A 4C7ZA 3CCSA 3SK6A 1M1KC 4WJNA 2CKZB 2AQ2B 2RVLA 4OIJA 2KN5A 5KRUA 2JJQA 4L5RC 1QVCA 1WCMB 4G4KA 1M94A 4A8XC 2PQAA 3CQZB 3OLMD 3RZFA 3AMUA 1E2ZA 2KDMA 5ISRA 2HTHA 2WU2B 4PS7A 4C4VA 3GO5A 2K50A 4PZ7A 2IY5B 1T3QA 4TQ1A 1BBWA 2KUMA 3IAM1 4BY1G 3PO2G 2ZXRA 4TRDA 4MELA 1EUVB 2VY3A 3T4AC 4TUUA 4RH6A 3ZDTA 4AP4C 3J81j 1A2TA 3NELA 4CDDC 2JZ3B 1RD9D 4WJ3M 1I35A 5IYCH 3QC8B 1WGKA 3KUCB 4YWKA 1MFWA 3BWUD 4HR7B 1UEBA 2GN5A 3E6ZX 4F7XA 1N34Q 3AYHB 4A3CH 1T6BX 2K9XA 1TWAH 5HY6A 4LFCL 2VQFQ 4FXKC 5DPRA 1LTLA 1S3SG 5LXHA 5L83A 1SGHA 2DZMA 4FJZA 4R4TA 3HOZG 1HNZL 1O7ZA 3HEJA 1LT4D 5C5MA 5BN4A 5FJ8H 1HNXL 2IO2B 1EYGA 5AUIA 1W3SA 5C1ZA 1F9RA 1U4RA 4LFAL 1OQQA 3VQIA 1MSHA 3I90A 2E6XA 2F0IA 4K81A 3RMKC 2N8NA 4JV5L 2KTRB 4KKJA 3N1ZC 3A74A 3RN5A 5BN5A 1N36L 1L2FA 3K58A 2LVQA 1HZ6A 3MXUA 3HOWG 3TCAA 1NDDA 5IT9c 2E76C 3RZDH 2F0HA 2ASBA 2MEKA 5EKIA 4KKTA 1EWYC 4WAAA 4DXFA 2Q8IB 3ICEA 5GADC 3DCGA 1TWCB 2K52A 2BF8B 2FCMA 4FXGC 1KAWA 2VUMB 1QF6A 1HRJA 4JL9A 2PW9A 1IL8A 2BDNA 3P20A 2J7QB 2D10A 1HEZE 4GDLA 2KECA 4LW1A 1SE9A 5C4XG 2KDEB 1E7ZA 4E74A 2WXPA 2LXKA 4HXDA 3RNAC 3H91A 5LMNL 3TEWA 2JYOA 3GV3A 3UE0A 3GS2A 3CCRA 2R7ZH 3V60A 2Y0SG 4X3SA 3SHQA 3ZIMA 3RZWC 4GB9A 2BOSA 1VS0A 2D9UA 2F0WA 2JA6H 1YN4A 1X3QA 4QQBX 3I5JC 3IG3A 2AX5A 4HTHA 1D1KA 4A3MB 3GTMH 4KD3A 5IP7G 1FXAA 4DAMA 3NZ3A 4L23A 2WQYB 3F8TA 4F7ZA 4G7OC 1B53A 3G4SA 2MPMA 4JW0A 1SIFA 2UUCL 2FINB 5G5GA 3NBHB 4X64Q 1SB3C 2EIFA 2O6VB 3BYYB 5LMNW 1EY5A 5LMUL 3U2SC 4ANWA 3HKSA 3MFGA 3PRMB 5CMDA 3CPFA 3LGJA 3NRZA 2XTIA 2ZPNA 1IKMA 1Q8IA 1MJDA 2MSED 1YEZA 4DUZQ 3T9LA 3GQBA 1LQBA 3SVMA 4GLXA 2F0SA 2LMCB 3VR4A 1K73C 4P74A 1EWHA 1XLOA 1X9NA 4MJSB 4RF0A 1A8VA 3AFPA 5K36H 2A6EC 3S2AA 1IBKQ 3W1YA 3KLRA 4CBVA 1EY4A 1SSOA 3EA6A 2NVUI 1CKOA 2EXDA 3V96A 1J5EL 2JA8G 5JJKA 4X62L 2LJIA 1WRIA 4POFA 4KIKA 5E6JA 3H6MA 1CK1A 3OIQA 1R9TB 4DR7L 4F87A 2R93H 1QOAA 2PKOA 3PV1A 4IM3A 5COYA 4DR4Q 2N9XA 4JVZA 2WINB 4LNQA 3KDFB 2FNJB 3I3TB 4DV6L 1B9NA 3A8KE 4A3GG 2R2OA 3GOEA 2FCSA 4PYUA 1KDCA 3GTLH 4HKQA 1VCIA 4RKBA 1OTRB 2YV5A 3H1UA 4HLEA 3WANA 3J80E 1PTOB 2R7FA 5CYUA 3RZOB 1T0RC 3PO0A 5IE8A 1YQ3B 2CH4A 4RWSC 3S1RH 4DA2A 4B3MQ 3GZNI 3OMGA 5DLQE 1FM0D 1QQRA 2G1EA 2GLSA 3P4RB 2K75A 2D2QA 1WZ3A 5TR5A 4HJ9A 2PI2E 1E90A 4MH8A 4TKNA 1FRRA 4KGTA 2FBWB 2KD0A 3CMMB 4DWFA 4A3DB 1EL0A 1NYQA 1ZXIA 1RYJA 2N7EA 4ZDVA 4JI1L 3A8IE 1XNQQ 2M0AA 3F1ZA 1N5WA 2MJ3A 3I55A 1JICA 2Y0SE 3IHPC 1Q8KA 3R2TA 2PW7A 3NHHA 2M19A 5KHQA 4A3JG 3B0AA 1FYCA 2G9HD 1VQNA 2A19A 2WWZA 4CHTB 3UIPB 4JI3Q 4LJZC 3HZXA 5I9PA 4LF4L 3OMCA 2H4OA 3A1QB 4NXNL 5T1IA 4M8AA 4DR1Q 3OW2A 1TBEA 4K6DA 3IBEA 4NAMA 1BO0A 4IOAA 4MGYE 2H5XA 3RMHA 1GNUA 2L9HA 1QLBB 1D3ZA 3F2BA 2DYMA 4YCUA 2VH1A 4HIOA 1QZEA 4G0NB 2FIDA 4IUPA 3T16A 2YYZA 2PI2A 5LHY1 5EGTA 1BNZA 4CKEA 4K0KL 3EECA 3NXWA 2Q5WD 4K7UA 1PRTB 2BB5A 1FGBD 1ICFB 1GHKA 2D3BA 5GXGB 4A93B 2SDFA 1WM3A 1YITA 1IW7D 2VNUD 1WI0A 2XBBC 3NOBA 4UPAA 3LJ3A 4W9KA 2R3ZA 4KV2A 4AJWA 4HJGE 2WAQG 3JSVA 5D7GA 1KLVA 1EY8A 4DU9A 3GE3C 3C1EA 4GS3A 4ZHPA 3HVZA 1TQOA 1FNWA 4ME3A 3GTPB 1QT9A 4LF6L 3AE8B 1MD2D 3TDQA 3AN1A 4DAYA 1V8CA 4LUVA 3ULJA 1ISNA 3HFZB 4HVBA 4X6AH 4C3JB 3EJIA 4K5XA 3C8YA 1SDFA 4ULLA 3R66C 4XDXA 1IYUA 4RCOA 3B2GA 1ZKOA 4OVVA 1N63A 5DEHA 3U52E 1DM0B 5C3EH 2IO1B 2KJ6A 3CCQA 3MXNA 5C4ZA 3S15H 2BQQA 2EY5A 4MZ9A 1JB7A 1TWHH 3NJTA 4LDTB 2VZKB 3G6EA 2FFKB 2KLCA 3K6OA 2H1EA 5JVH3 4A3BH 1VQ9A 2INNE 1LTAD 3J7YW 3AFQA 2NVTH 1J6QA 5CBEE 2INPE 1WTOA 1II3A 2Z6KC 3K8AA 3HOUH 2BVCA 2MW5A 2IGDA 2BTEA 4RFBA 3HGBA 2N9EB 2WKDA 1LABA 1HNWL 3S24A 2JE6I 2EPBA 2L3ZA 2HDMA 3CSTA 1LV9A 3W3AA 3OPOA 1HA5A 5C44B 3R7RA 4AIMA 3DWMA 1YD8U 2GVAA 3URYA 3AMZA 2X38A 2N49A 3AEBB 3PIP3 3I4NG 2DBYA 3S1MB 2A6ED 4AQYL 1NAPA 5HHDG 4MM3B 3BJUA 2ZM6L 2BYEA 1Q0WB 2H89B 1ZUD2 4N9PA 1RFKA 1EIHA 3QB3A 2OT2A 1GB4A 1WCMG 3ZYYX 3NBIA 1PZJD 3UF8A 2QILA 1MI0A 5HKHA 3PUXA 4GZYC 1EFWA 3BU2A 1TT2A 3NQTA 2JT4B 1ZE3D 5EPLA 1YI2A 3ZJUA 3FMCA 1W6KA 4YSYB 1MHWC 3BINA 2ZZPB 3OG5A 3JAML 1RTOA 4YSZB 1S1QB 1VQIA 4GDLB 2RDHA 4O1NA 5E7NA 4K2KA 3EHVA 1QUQA 1TWAB 1EO6A 1UWXA 1BCPB 3S17H 4IWOA 1E0ZA 4TQUS 5HGTA 4IUUA 1HR0Q 2LY7A 1N36Q 4PMBA 2SAKA 3WWVA 4ZK9B 2BYFA 3C19A 2LRUA 3A9JA 1CSPA 2WAQE 3HOXH 2DYOA 1A6XA 5CV4A 1F52A 2M2LA 1NENB 2C7MB 1Y1WH 4ARCA 2IX1A 1SF0A 2AYOB 2NVXH 4DUYL 2UUAL 4DV1L 4NY0A 4IALA 4X3KA 3TL5A 4LTUA 1RDPD 3V3XA 2XWJB 2KHSA 1EY9A 1J7BA 2OQ0A 1RF2D 5D65A 3CMEA 2GRIA 1NCVA 2QIEB 1TVXA 3TEHB 3RPFC 4HK2A 2J0TD 1EIYB 3V61A 4P6VF 1OXVA 4NKLA 4FDBA 1PFNA 3T51B 4OXPA 5JEAH 2CCZA 4IURA 4B08A 2NB0A 5FR3A 1Q1OA 1ZXHA 1HZ9A 3NE5B 1SE8A 2XNAC 5K5PA 1NBFC 4C3HH 4ID6A 2CWPA 2UUCQ 2YVCA 2VUMG 1YNJC 2F1MA 2WXIA 2KWCA 1Q1BA 2B2VC 5NUCA 2MLBA 3OHXC 4PQXA 5FO9B 5LMUQ 2I07B 2LGXA 1S5DD 4NW2A 2VB3X 2O5IC 3MC8A 1F2ZA 2KVMA 3HG9A 1UE6A 3M3YB 5M5YH 2E3TA 2PVGC 3HM3A 4R4CA 4XWTA 4YWLA 4RGNA 3CC7A 2E2HH 3CRKC 3PO2B 4QCLA 1PRTF 2R6GA 4PNYA 2MX2A 1X56A 1DOXA 1SNDA 1KRHA 4ZUJA 4A3FB 4A76A 3CRLC 1E2VA 5FK9C 1JJGA 4NJCA 3KJOA 4A3MG 4KD4A 4GLVB 1MHHE 4RF1A 1JR0D 2ID0A 3GP7A 2WXKA 2G4DB 5CORA 4OONA 1LACA 1J5EQ 4LK0M 2K5NA 3UIOB 1EU4A 4G50A 5E3FA 4IOCA 1YNTE 4DK0A 5IO9A 2N88A 2R7DA 4MHEA 2JWZA 3PCOB 4LNIA 4DFAA 2LSSA 2ZNVB 4NQKE 2PIAA 1SYGA 1EEID 2JA9A 2ZW0A 1ASYA 1L1OC 3MVVA 2L12A 3DM1A 3T1HQ 4POGA 1JWMD 1LTGD 1DOMA 2G9DA 4B3RQ 3A7LA 4OVUA 2CHBD 4DV4L 4NQLB 2HD3A 3PPAA 4GLAC 4B9KA 3X0WA 2C7HA 4PT5A 1AH9A 1PH8A 4KI0A 3D6WA 4S3SA 3A5ZB 3KWLA 4G11A 2N9LA 4L5QA 4XDDA 5G5HA 4ICVA 3RNFC 2I5LX 1K9MC 3HOWB 1FXTB 1P0RA 4KVGB 2OEDA 1S4ZA 1WIAA 1GJXA 1T9HA 5IY0A 1N62A 4AYBB 1ILQA 1KLGD 3BVGA 2H88B 3L13A 2VQEL 3BIID 4IFDH 1XTDA 3Q24A 2B76B 3U7ZA 1ZKHA 4GOPB 1PGBA 2N9KA 2NUCA 2MO1A 1IXRA 3OW7A 2A74C 2DZJA 1V1PA 5C4XB 3Q3FA 2KQ7A 1ZYRC 4YCWA 1GXDC 4YWMA 2F0FA 3J81L 3VYUA 2DENB 1JQYD 3H0GH 4FHKA 2IX0A 1NTGA 2CS4A 1EOTA 1EY6A 2ON8A 1OO9B 1SROA 2AUKA 4L5TA 4KZ0A 4OVZA 4J8QA 5E4XA 3N3KB 3GDEA 3CSFA 4GNXB 1DD2A 4BBSH 1WTPA 2LXCA 5ELNA 1LTTD 2N4FA 3FHWA 1EQTA 1V86A 5CX3A 3L08A 4BY7B 3V2TA 4KJOA 3Q3OC 3VYSA 3I70A 2L05A 2F0DA 1HPCA 2D0PA 2D5DA 4G7ZC 1P1AA 2KMAA 1KAAA 3FILB 2V0GA 5KNCA 3DVGX 2R92H 1SIJA 1BCPF 2Z4IA 2K22A 4ZRIA 3I91A 3MXNB 3FRPB 1TTNA 4C2MH 1AZQA 3B08A 5E6NA 4L2YA 4BXXG 1L0XB 3ND8A 1HUMA 2NYZD 5IAAC 3AULA 2YTXA 2M0XA 3TUOA 4LF7L 2AL3A 3TS0A 4RGMA 3CCLA 2E2JB 1FEHA 3JAME 4REZA 3A4SC 5CBAE 2B3GA 1B4OA 2NBUA 3MXGA 2B63H 2KZRA 1OXSC 3TRZA 2JA8B 2ZJDA 2EXZA 5JJLA 2F0NA 1D2BA 4O42A 4DV3Q 1CHQD 5FLMG 4ZRQA 1UWVA 2N1WA 5FLXL 1IYJB 2KNBA 4IFDI 2VH2A 1ZOYB 3ZJYC 1QOBA 4ASWC 4HJAA 3NWSA 4DPGA 4Y7NH 3WAMA 4A3GB 2J0KA 1QKZA 2WXFA 3K7AB 3H09A 3N30A 3D4RA 1YNJD 4IJLA 2PVOD 2SEBD 3KK7A 3X23A 2KHIA 3PHWB 4AJYB 2HHHQ 4EQPA 3ONSA 2HQLA 1J8CA 3IAYA 3Q23A 1YJWA 5GAEC 1GM5A 4WAFA 1LLRD 4IPCA 2KOXA 2VL6A 3IVFA 1HNWQ 3ZRCA 3RUIB 2X6GA 3NBHA 2ZJPA 4KN4C 1J7AA 1PMRA 2O6VA 4XC2A 2KT7A 1OEYA 3IT6B 4IWPA 2L8JA 5M5XH 1K8MA 2ZTDA 1VQJA 2I2YA 2K5DA 2BW2A 4PYZA 3RUZA 2J53A 1AFPA 2KN4A 1BUIC 3B9JA 1CTMA 1Y8NB 4R4QA 2ZM6Q 3M95A 2A68D 2KC2A 3FAHA 3ZUNA 4R1JA 1AE2A 3N6RA 1E8WA 2VB2X 2J4XA 3ENEA 1TKYA 2PLPA 2RMMA 1K83B 5E1FA 1HUNA 3A9JB 2HT1A 4BS9A 1ESFA 2INCC 4MJSA 1LM0A 1HJPA 1SYFA 1OTCA 1OEYJ 3Q8BA 2L0TA 3OAWA 3S1QB 3NVZA 1UEAB 2JX5A 3NQIA 1L4DB 2Y5CA 1EM7A 2HTME 5HURA 2L1AA 1KF6B 1IBXB 1HTQA 1I6HB 3RNBC 1UD7A 5CV5A 4WJWA 4B9XA 1YHBA 1EYDA 1SXTA 4BA2I 1HZCA 5EQ0A 2K3UA 4JE3B 4W9HA 1QG7A 1VQ4A 1J19A 5L95C 2MJDA 1WGDA 3KDFA 1E24A 2KKCA 3L4PA 3EFCA 2QDBA 4QL5A 3J7AF 3DUZA 2M4NA 2K4KA 1UNSA 3IL8A 2K39A 4DHJD 1ML0D 4B9WA 2KACA 1TWFB 3T56B 4DV7L 1VQAA 1IYVA 1VR9A 1XD3B 2WDRB 4YY3Q 1WM2A 5I2YA 1I3QH 5HG2A 3S2DB 2JN4A 2OHFA 2F0MA 3QA8A 1VF7A 1XJVA 3BDLA 4WWOA 3FEWX 1Q12A 2DNEA 2EOTA 5M5WH 5IYCG 4K8IA 1L0VB 1LTBD 2NN6H 4BKSA 1NNXA 3S16H 1S5ED 3ERQA 4ZKBB 3RD4A 1Y1VH 1ZYRD 2PZUA 1XMOQ 1CQFA 4A3CG 3ECIA 2K5QA 4KHPL 4IDIA 4EZLA 1A5RA 4GKJL 3OYYA 1PDQA 1IBLL 1BXTA 4K5VA 2QDFA 2W82A 3M4QA 3WOFA 3AEEB 1E9MA 2WKCA 4A75A 2NVXB 4O0AA 3L16A 1G51A 2Y5PA 1JROA 2PMVA 2V4IB 2MQHA 5BR8Q 1C7YA 2WXRA 2KMCA 4HIKA 2JA5H 2AEHA 5GAHC 3VRBB 1Z47A 1EQVA 1TY2A 1CHPD 2K14A 2WXNA 4KGSA 5BYRA 1SYCA 3A1QA 1D5XC 4EOYA 3TP8A 3DEOA 3AE5B 3K80C 4LF8L 2F0EA 4NB3A 4RG1A 1JMLA 2ZCBA 1VQCA 4OEMB 2WLBA 3NP8A 1F2RC 5JVG3 1EU3A 2JZZA 3MP9A 2DAJA 2GBMA 2M1MA 1BBUA 1N60A 4HSPA 3WAOA 3J81E 4JI7L 3GTOH 1V97A 3DOWA 5CTRC 4DR6Q 3Q0AA 1ICWA 2OF1A 2KWVB 4C1NI 1Q82C 3ZGZA 3HK0A 5GQOA 2WDQB 2JRHA 4GMVA 3MZ5A 1KFYB 3I4NB 5FR6A 3GD7A 1E3PA 2ACZB 1WYWB 1E0BA 1C8CA 4WJPA 1T5XD 3SK5A 1KXLA 1X32A 4QMGA 5T1GA 3TBIB 2R7ZG 4HDQA 1I4RA 4P2CB 5EE9A 3DVGY 3OWFA 4E6IA 4II3B 3I4MB 3J9CA 2NTSA 1GVPA 3PUWA 2B2WA 2KBNA 4RM9A 1MI2A 4DV5Q 4RMAA 2K6AA 1CZGA 2SOBA 2K33A 2IHEA 4CDFC 1NUCA 1P9DU 4FP5D 3P7JA 1IZ6A 2K5VA 2WIIB 5A2QL 1JMCA 3VAWA 3CD6A 1AZPA 2BT6A 1P16A 3CF6E 2NN6I 2JF5A 3O65B 4WURA 4K14A 5M3FH 1WTRA 1V1PB 3Q8DA 4A3FG 3L3OC 4X66Q 2MNAA 1X3GA 1P3QU 1NSNS 2LWPA 3KYCD 2K5PA 3PQIA 4GN4B 2KQ4X 3HRDD 2QSDA 3A54A 5AJ3L 3Q3JA 3E3XA 2UXDL 4NP5A 5IP9H 1N32L 1S72A 3K9OB 4ZKCB 1C77A 1RLFA 1I50H 4M02A 3KLSX 2VQEQ 3KUDB 1HH2P 1V80A 2EY1A 4LK1C 5KNDA 1VQFA 5FLXE 1HZ5A 1C0AA 3DBRB 1C4PA 5K36G 3I63C 1JE4A 3KF8B 2K7VA 4A3KB 1XMQL 4JQWC 4HCNB 4YWGG 4LUZA 4WIPA 1ESRA 3PMFA 2LRWA 2BA1A 4JC0A 3H7PB 3LYYA 1AW7A 5DPSA 3QX1A 1RTNA 5ELFA 1E7UA 4OL7A 1KTKA 1PH6A 1WX7A 4EQOA 1YMHE 3P75A 4NXML 1U4LA 1A2UA 2F0JA 4J3OD 4MM3A 1PV4A 3A56A 2KWUB 2BH8A 2OTLA 2F4VL 1WF9A 1O7LA 4WWMA 1IP9A 1PGXA 1E8XA 2ZEQA 1RRBA 1RHPA 4AYBG 3J80i 1LUZA 1IW7C 4GU2A 2UU9L 1A3VA 1PDXA 3QWNA 5L37A 1Q81C 2UWQA 2JVCA 4BBNF 2PPHA 3NS8A 3M4PA 4BKTA 2XRQD 4CYEA 3H0GB 4C80A 3PO3H 4ZRPA 1X54A 2AUJD 2NCNA 3JYUA 5CV6A 1LFDA 3KUZA 2MH7A 2CHXA 3W1SA 1TKWB 2PJHA 3U4EG 4TMAB 4ZYNA 1YNNC 2P5ZX 4EZJA 4ME5A 4WRDA 1TIFA 4KX6B 3U9OA 1R4MI 1V6EA 4JI0L 1NY4A 2N0SB 3DVNV 1G2TA 2EVBA 5G3LF 4TKOB 1UAPA 5J18A 1UGJA 2EKEC 2DZKA 2WXQA 3A9KB 4M0WA 4A3OA 4I7ZC 1MHXA 3B2FA 5CV9A 2GOWA 4B3SQ 3VUXA 4FBJB 2K8BA 2YU9B 4LNNA 2KVRA 4YXDB 2PO4A 1JJCB 4BY7G 4FF3A 1B70B 1I94L 1HA6A 1CKNA 1DXMA 5D2MB 2E2IB 3HP3A 4FA6A 3VR5A 5CHWA 4C2MB 3S14H 1MIUA 1QVFA 4MIUA 1HR0W 2VXWA 1FNVA 3KJPA 1Y8OB 2CWAA 1E8YA 1PH1A 1JOKA 2AWTA 2NBFA 2NVYB 1RL2A 4P16A 4EGVA 3Q3MC 4F1SA 2CW0C 1PFBA 3GTKB 2OQKA 3S2HH 5EE1A 1HZAA 2LGSA 2UXCQ 2B2TC 3QJYA 4BOZB 4YHHL 4BY1H 3GTGB 3VR6A 4CKBA 4NDXA 4M01A 2BS2B 1HFGA 2Z0SA 3AEVA 1JB3A 2RDGA 3FPPA 3Q8CA 3QR8A 5J22A 2WDTB 3HKZB 1VQ8A 2I38A 1YJ9A 1B2TA 3W5VB 4JI6L 1NI3A 3DXJC 3Q8AA 3R93A 5EKKA 4AOFA 4W9DA 2IBIB 3BG3A 1FNUA 2UUBL 3MHZA 2CJNA 1K8GA 2FCQA 2RR9A 4IWQA 4N9F4 4X65Q 1P7EA 1WD0A 1PTOC 4GKKL 3W5UB 1BKBA 1O78A 3Q14C 1XXGA 2N55A 2R2QA 3HOZH 1AARA 2IY1B 5EBCA 2REXA 2UXBQ 2Q2IA 3NG0A 4QIWE 1K50A 4ICUA 4AUQC 1UWMA 1IBMQ 3RNUA 4BKGA 2V3SA 4RNAA 1S3OA 4AYBE 5M5XB 1EZ8A 1EWCA 2KMMA 3PSEB 1YHQA 3MEFA 1U4PA 3SK4A 3VA5A 3LX0A 4OWTB 2FUG1 1F9PA 3E5SA 3PLUA 3OWEB 3N1YC 2QJLA 1UELA 2Y5BB 4A3LG 5M9OA 2K03A 2Q2UA 1FFVA 4NMZA 4A3BG 2ZPYA 1KABA 1E6EB 2PCFB 3S1NB 2FJ2A 1IL2A 2NVQH 3OJ3A 1UUPA 3I56A 3HOUG 1TS3A 1BUVT 2JA7B 1LTID 1D5ZC 2LXJA 4DV7Q 4UY8C 2HJ8A 1OFFA 3H7SA 4ABNA 5C4HA 4JLCA 3L7ZC 3TMEA 1B7YB 3NEMA 4KY7A 2AQ3B 1B3AA 1N61A 4HWIB 4JCVE 1T0QC 1R4NB 1SBBB 4N8FA 4U68A 3A5UA 4N58A 3SDZA 2KANA 1YN3A 2HCIA 1MG4A 1TS2A 1WJUA 1LTSD 1JOQA 2AQ1B 4A9AA 2FMCA 4UAIA 5A2QE 4DR3L 1XQQA 2PE9A 2CVRA 1SFOB 3T1YL 4GOPA 1TZ1A 2G5DA 3ZNHB 4R4IA 2PNRC 4RA8A 1E7VA 2Z4HA 3J80c 3NZUA 1I4XA 1GO3E 1KHIA 2RPVA 4OX9L 1A15A 1VMPA 3NTHA 4IG7B 4A55A 4DR2L 2PPBC 4FYDA 3MTNB 3OTOL 4I6LB 1K53A 3ZTCA 1B9MA 2X69A 4DR5L 1U0LA 2JQRB 4C00A 4EKUA 2B2WC 4JYAL 4ZUIA 1STAA 4LF5Q 1S40A 2KO3A 1YOVB 2EYMA 4KN7C 5KGUA 5AUKA 1CKMA 3R2IA 5IYBG 3U9SA 4NZLB 1ET9A 4IQZA 4FVMA 1KLUD 1SYEA 4MTKA 2ZXPA 4DV2L 4TSSA 4GNXA 1FVIA 5IGBA 4IO9A 4LF8Q 1WYGA 2DWQA 1PH3A 4PS8A 1WGHA 2D3CA 1GUGA 3HOXG 5DM63 1F2MA 1S5FD 2B8FA 3SR1A 5IWAL 1YNND 3L0WB 2L83A 4JI7Q 5EPKA 4LJOB 1LT3D 1FRDA 2JZPA 5D6JB 3STBD 2WXGA 3ETRA 3FILA 4ANXA 1Q10A 4JI2Q 2O6VD 4XQQA 3OJ4B 5M3MH 1IGCA 2OOBB 3QCAA 3FKIB 4IUQA 3KLWA 4N59A 2IL8A 5H1SE 1GUAB 4RKLA 5C5LA 3E56A 2ZW1A 1WYDA 5JEAG 4TQ0A 3D4WA 1RJTA 1ZEQX 1UH6A 1WY8A 3WAPA 3H15A 2MBQA 4XT3B 1FCCC 4WQOB 2IO0B 3E9SA 2LJ5A 3ITPA 1PYSB 2BYVE 1IYFA 2CW0D 1R4PB 2BDOA 3ER0A 3MXPA 4C3HG 1OQYA 2Z0EB 1Q1EA 1V5OA 3ZQ4A 2Z6BA 2LS01 1SN8A 4N8X1 1CSQA 2F3IA 3VYTA 1L0YB 4A3IH 1DGSA 4ACFA 2EJFC 1X55A 2R61A 3LNNA 1C9OA 3BDCA 4LFCQ 3TBLD 4OO1H 2E75C 3M85A 3I4MG 1HQRD 1SNPA 3HOVH 3HS0C 1C79A 1HNZQ 1VD2A 3V6CB 1SYBA 1WFYA 1HNXQ 1JC7A 1PTOD 2F0VA 4A3JH 4CDEC 4LFAQ 2BYTA 1U4MA 5LL6S 1M8AA 2NS5A 2ONQA 5JZEB 4YTMB 2DNFA 4JV5Q 2EZVA 2X8XX 1QNUA 2F0GA 1KJTA 3TP5A 1YX5B 3I7FA 2Z1CA 3I4OA 1CT1D 4O2DA 2L5TA 2L0FA 4KY6A 1IGDA 2F0LA 2JXMB 1K8AC 4Q5VA 2FIFA 2JQOA 2KJXA 2N1VA 3U4VA 1QOHA 3VDZA 4OW0A 4M0WB 1H8CA 5JPNC 3V05A 4XYOA 1C4CA 2DN8A 3NUCA 3Q6SA 2ZJQA 1LM8B 1TGZB 4FHJA 2L15A 1SMYC 3CMAA 5C0XH 1VQBA 1CKNB 1BR9A 3KF6A 2JYTA 4A3KG 4HN7A 1B50A 3NVVA 1IBXA 3EUB2 3LXFA 2QGQA 4CO7A 4D2KA 3M4OH 1GPXA 4JBMA 1R4QB 3TZUA 5LMNQ 1N5XA 3RZDB 1OGWA 2KCCA 3P4PB 2C60A 4AH6A 1WTVA 3ULPA 1M90C 4IZ8A 4JI5L 1J7CA 4IFDG 1V9JA 5T8IA 3IFDA 2LHEA 3N20C 1C76A 1MKHA 3E9HA 1FPYA 3TEYA 1QOGA 3DQVA 3L2PA 3WALA 3PO3B 3R8BA 1PH5A 3A55A 1CFMA 3P4SB 3D3RA 1PRTD 2RCNA 1WXQA 2KJRA 3AE6B 3NUHB 1YIJA 4YTPB 4K5WA 4X3UA 4KHZA 3VTUA 3KFUA 2AKWB 4A3EH 2B2YA 2K25A 3L17A 2R7ZB 1D8LA 3BK2A 3H0GG 1B3QA 5AZGA 1IUEA 4CJ0B 1GAQB 3RULA 4OO1I 1Q90A 1LO5D 3RLOA 3DBHI 2JA6B 3GZNB 4LCDE 3SD5A 4JI4L 4W9FA 2CU3A 4BBSG 2X6LA 4CGYB 2YEPB 1LYLA 1ASZA 3PUVA 4I65A 3GTMB 1N9WA 1BQQT 2DAFA 4CQNA 3H8HA 2NWGA 4DKAC 5J1ZA 3CCUA 2F0KA 2KX3A 1UGMA 2SNMA 5ELBA 5I4DA 2KWDA 3QARA 4P1BC 4PK1A 2O2VA 4YHHQ 4KDLB 1B8AA 4HJ5A 1JWBD 2W3SA 1TWGH 2IY0B 3ZW3A 3P4QB 2XWBB 2K1BA 3N1XC 3NZSA 4WH4A 3SDLC 3EVQA 2A68C 3H3VC 3DM3A 4DK6C 3M9BA 4RHSA 5CV7A 3EFUA 4NPNA 4HIMA 4X62Q 2EYHA 4JI8L 4DQOC 2IT1A 1FXIA 1YVCA 1Q5WB 2NTTA 3S2HB 2MHJA 2VZKD 4LDTD 4DR7Q 3JAMi 4NAWB 3DBSA 5G55A 3PTFC 3H6NA 3ML9A 4XWWA 3TREA 1VDVA 4GKKQ 1SJHD 1GUSA 3EIVA 1Z9FA 3ALBA 3CQZH 4DV6Q 3DHIC 4XXEA 5C0XI 2YTVA 1I6VC 5ELDA 4Q2JA 3RCZA 4AS1A 4RAUC 2K6DB 1F9SA 3CCJA 2B63G 2NBVB 3CKIB 5D14A 3UQAA 1E22A 4M00A 1ILPA 4P73A 1DYQA 1L5PA 1L6VA 2R93B 5JEAJ 3DEPA 5C4JH 5JOBA 3SK8A 3HKZG 4QIWB 1AN8A 1NMFA 2PW5A 4HPLB 1G291 1DGJA 2QCZA 1PA6A 1VCBA 3KH0A 3GTLB 4WJOA 5JHBA 3DDCB 4JIOU 4US9A 5JXVA 3MHBA 1N8RC 3C46A 4JI1Q 3MFYA 3WIMA 3AH7A 4NJ7A 2K6QA 3I9V1 4BA1I 3MC0B 4K6LA 1L1OB 3S1RB 4I6PA 4KSKC 2YLMA 3N52A 1ONLA 1QWYA 1VQGA 3NENA 1U4AA 3BZDB 2N78A 2JXTA 4MN3A 1WXSA 2HE7A 2L7RA 3CCVA 5D3IB 5HI1A 1N34L 1BCPD 4U673 4LF4Q 1UBIA 2D3GA 3RLFA 2PNHA 4ZQ3A 3F2CA 2D62A 4NXNQ 2RA4A 1UE5A 1ZPSA 2AWNA 1VRAB 3NPPA 5JJZA 4ZAIA 4XQNA 2F03A 1DJRD 4BVUC 3T1YQ 4FF4A 3PF5A 1H9RA 1XLPA 1WXVA 3WOEA 3PF4A 1NYRA 1F2RI 3QAQA 1LT6D 3KF8A 1YN5A 2XSCA 4UDUC 4K0KQ 3DBLI 1G8ZD 3NHEB 1VQHA 2XK5B 2JA7G 1MSGA 1TY0A 1TWCH 1Q3LA 3KLSA 4DV0L 3H7PA 4I6NB 3BVZA 4HEA1 3JC66 4A6QA 1GJZA 5KHOA 4JYAQ 3B6YA 4M1UB 1XLQA 2D07B 2LUEA 1UE1A 1SMYD 4DV2Q 1SNQA 4AWJA 2MJ8A 4KMUC 4A20A 4LF6Q 1WGGA 2FE8A 1XO3A 5IOCA 5I9OA 4DGZA 1J9OA 2KHWB 1I7HA 4KV6A 3AU5A 3TZDA 1E1OA 5IT9L 4IFDJ 2B3AA 1WD1A 4HDOA 1ENAA 1A62A 4DAPA 3PREA 1L7YA 2V3NA 3AB9A 4JG2A 2NN6G 5MPOA 4W9JA 3N32A 2PYKA 2A73B 1Y1VG 4XYCA 1V1OA 1A70A 5BYSA 4IW0A 2W3RA 3C2PA 3ZNGC 2WXMA 3A9KA 5I2XA 3HKZE 2D11A 4MNOA 1FD7D 4C3IH 3U8ZA 4K8JA 1KC8C 4L1BA 2EKIA 2WNMA 3PZ8A 4CJ2C 5KYIA 2JEBI 4EZKA 1I5FA 5DAUA 1F2LA 5IGGA 3K5MA 5E4WC 2DLBA 5C3EB 5J3BA 4X64L 2OTJA 2VS1A 2K05A 3S15B 2JA5G 2VRRB 1TWHB 4HAEA 1PQSA 2O4XA 1XEEA 3A33B 1I4HA 1KRTA 5IGDA 1N33L 5IYDH 2KCTA 4WFN3 3HUIA 1EZ6A 4M8NA 2BH2A 4A3BB 2KK8A 2YEPF 2A1AA 2WXOA 2NVTB 1JOOA 2ZJRA 4AQYQ 1X1MA 3FKIG 4KZCA 1E2WA 5CV8A 3J81i 2LEKA 1PXUA 1R9TH 3JAMc 3HOUB 2M17A 3AXCA 1V49A 4QUCA 1MPEA 2EYLA 1YX6B 4BBNC 1OQRA 4WORA 3C3LA 3RLNA 1PHJA 2RSNA 3CHBD 2QHOA 2GVBA 1GB1A 2KCNA 1IBKL 2M56B 1E10A 1AEXA 1NR2A 3CF5A 2RF4A 1CJEA 2V1YA 1HZBA 4FADA 2ZVNA 1QNKA 1PTOH 2I46A 3KF6B 3RZOH 4DR4L 1LGRA 2XVSA 4FF1A 3DVNU 4C7YA 2RSOA 5EJWA 2QKIC 3AE2B 5BMGA 2MUYA 1WXAA 4A3DH 2EJMA 1J8IA 1K0SA 1TYGB 1QILA 3IKJA 2DHZA 1Y14B 4ANUA 1G6ZA 1WX8A 3CC4A 4W9EA 4KTAA 1DOYA 5CC4A 4JBJA 4FJVB 3ERSX 1VQ7A 3BY4B 1H9KA 1SNCA 1W6JA 2JP1A 3NVWA 2BS3B 4CJ1B 3KYDD 4DUYQ 3S17B 1Y8PB 4DV1Q 1W2BA 3NTKA 3C1FA 3PGZA 5I6YA 2UUAQ 3AEFB 4WJQA 4FO2A 4J6HA 2QMTA 4E71A 3EQLC 1OXXK 3DWPA 2WFWA 1MJCA 2DJGC 4HCPB 1PZKD 3HOXB 5AZFA 2JUOA 2N9PC 3DWAA 4HJKA 2F52A 1Y1WB 2MGSA 4URKA 5C2TB 5FJ8G 4XDCA 5H8YE 3FP9A 3PRPB 4FF2A 3VR8B 1PH9A 4XQJA 5DM73 2LXAA 2O2VB 1K51A 1L0WA 4JI3L 4AQ7A 3S9WA 2LI5A 1Z7TA 2M8SA 2WXJA 1V81A 1SLJA 4J6IA 3ABVB 4A93H 1A63A 4DR1L 3A0JA 4CKCA 1U5KA 1SEBD 1JCKB 1PVOA 2B2UA 5IODA 3HOYH 2KJHB 5GROA 2L55A 2E5LL 3J7ZC 1FIQA 5BN3A 1A3TA 2F0OA 3KVFB 3CU7A 1RAXA 2LGIA 3I4LA 3RNGC 3CXCA 3ZXRA 3VTVA 3VH4B 3GTPH 2SNSA 1S5BD 3FVQA 2CQOA 2JYEA 2QW7A 4C3HB 3W2DA 1Q46A 1H4RA 2F4IA 5EPJA 3RFZB 1EQQA 2RCFA 2WP8J 4IPDA 2IWHA 1X3PA 3MWYW 2CH4W 3PO3G 3P63A 1YJIA 1AYFA 2MQJA 2ZVOA 4C3JH 4K3BA 4KKIA 2I5HA 1EUJA 2NZOA 3PIOA 3AE4B 1XLNA 1JWUD 3UDFA 1PH7A 2PMZB 3J80L 1XNRL 2PEAA 5M5YB 1C4AA 2KDFB 3W1BA 3FC4A 1CUKA 1GUNA 2WXLA 4XT1B 3VA7A 2V3PA 2J52A 2E2HB 5KYLA 1AE3A 1SR3A 4EEWA 2RDFA 4F8MA 2JA6G 1XCTL 2BB6A 3MC9A 1WMHB 1E7PB 2KFJA 3AECB 5LNK1 1WTQA 1Y56A 1WE6A 1TIID 1X65A 1FGUA 4DV4Q 4UHVA 2EYJA 1OXTA 5J17A 2HD5B 1EF1A 2CHZA 1PYWD 4DNTB 2IHFA 2NMQA 1KL9A 4GN3B 4MH0E 1WE7A 3EN2A 5C44H 4YTNB 3K81C 2MFIA 4J15A 1VQOA 2C7NB 1CZWA 3S1MH 3AM9A 1P8LA 4ZOHC 3LWEA 2CFMA 3J81c 2CU1A 4B95A 1GG3A 2C5CA 1EEFD 5IT9E 3MA2B 3Q3NC 4NJ6A 5EE3A 1D6EC 2CHWA 4NNJB 4ODGA 4K3CA 3J7AV 1BMLC 2MA9B 3A8JE 4DF7A 4R3DA 5C4JB 2ZXOA 1I4QA 4H02A 3LWUA 1XYIA 1SSNA 3I2ZA 5CHFA 1NBWA 3TMPB 5JH5C 2L1BA 5F2DA 4HJ7A 2K1FA 1EOVA 2QEJC 2IGGA 2KQSA 2MBHA 2DY7A 1VQKA 2KFKB 5E6OA 3QIAA 2PQEA 2R93G 1O7IA 1WFQA 3IRBA 5JJIA 2QA4A 3NSWA 3EGRA 3M7GA 2L32A 2KAJA 4HJ8A 1GC7A 4HPPA 4EFOA 2O5JC 1C3TA 4MSQB 3ZNID 2C5LC 3ZTDA 4FN2A 4BBRH 3K5LA 5G3LD 1H95A 4K2LA 1V43A 4QGUA 2GBRA 1HE8A 4S17A 3M4YA 2EE1A 2ICIA 1F2YA 3AU7A 2JY6A 3DPDA 3V62A 5IGFA 3K0YA 1YQ4B 2MJEA 1SNOA 3Q6BA 5CHVC 3TEXA 3TIXA 4YSXB 5EAYA 4WQMA 4WWNA 1L2NA 4OELB 2Z6KA 3H9DA 2RKSA 1H9SA 1D1IA 4DV0Q 2DGYA 5ELOA 3I8ZA 1HR0L 2C9WB 4BBSB 2G3QB 4MGIE 3D0FA 1D5MC 1WSPA 1VLBA 3R7QA 4CHKA 4JWSC 1SMXA 3STBC 5TSSA 4JWUC 3PZ7A 1FCLA 5FLXc 2V4LA 1QJOA 4LF7Q 2J42A 4GLSC 2KTFA 1MGSA 1ZDXA 5IGEA 3APFA 2R92B 1XT9B 1SJED 4IM0A 3UE1A 3VUWA 4ANVA 3HRZC 2MHVA 1CQVA 2ZTEA 1TXYA 3JW0X 4B0MA 2ES2A 1A0IA 5A35A 1G91A 4DBGA 2F3WA 3AEAB 4A4IA 3NVYA 2DYBA 2GB1A 3HVDA 2RPQA 3MJWA 3P2BA 3MTSA 1HHVA 3T53B 5LL6X 1PFDA 2GBKA 1B9RA 1VDZA 3X3NA 2Z59B 3PVLA 1WTHA 1GUOA 2E74C 1WJJA 2BA0A 3H94A 3SEBA 3M3YH 2B63B 3DWQA 2N7DA 4XE0A 4XIGS 1SAPA 5JAVA 4DXGA 5J39A 1KH0A 4KGRA 4ZCKA 4JPSA 3PO2H 1CM9A 3I72A 4L63B 1XCQL 4A3FH 3VR9B 3VR2A 3K7UC 5IGCA 1WZ0A 1QZGA 1EWIA 2B39A 2RBMA 4ILWA 4Y7NB 1K52A 3QHTA 3PRZA 2NPTB 2RGFA 1N33Q 1FFUA 1CA5A 5IOIA 4GSWA 5E6PA 2I0QA 2FMMA 1EF5A 4OZBA 3TQYA 1TS5A 2K5WA 4C3IB 1F1HA 3NWTA 4IN3A 2XEWA 2QF7A 1K3RA 4H0LC 2V4DA 4DHZB 5AEKB 2GI9A 1RODA 4N6EB 4P71A 3H3VH 3RNCC 1Z2MA 4EQ5A 4BAXA 1ET6A 1DZ1A 1JALA 1SNMA 3AE7B 2ALYB 4ZRZA 4K7WA 4UP9A 3X3MA 4B3TL 1WR1A 4MGZE 1A3UA 3AV8A 1IPGA 4MEMA 2L76A 1V5TA 5C3EG 4RGOS 1BT0A 3TN2A 4NPSA 5M3MG 3VR3A 5DPTA 4PMCA 2OXPA 1NI2A 4IUNA 1WOCA 3KUPA 4NAWA 1TZOA 3BDOA 1L6UA 3CPWA 2OWOA 1T5EA 4Z9CB 3HOWH 1VZ6A 4TV3A 1PFMA 2MP1A 4PZ8A 3T1HL 1R7SA 4GOCA 2B2VA 4B3RL 4QF4A 2K04A 3U58A 3AB5A 2RHSB 4G3XB 5EKLA 4UP7A 4GDKB 5KNBA 2CJOA 2EMSA 3ZNZB 1Y8RC 1PLFA 3KYHC 2I5MX 1WGRA 2BKRB 3ND9A 2LVOA 2RD0A 1DOIA 4ITKA 1STYA 1EIFA 2B2UC 1VQ6A 2HIVA 3AEDB 1GUTA 1YIWA 5C23A 5C4XH 4R8NA 4L8JA 5EBDA 3QWZB 2K32A 1KRSA 1EQRA 1Y69U 2L0CA 4A3IG 1MJEA 2G4SA 1BF4A 1PRTC 3K59A 4PV1C 4KHPQ 1DOLA 4OO1G 1QVGA 2JWUA 1SE3A 5LLIA 4GKJQ 3QOLA 3HOVG 1WWTA 3AU4A 5J2RA 2EYFA 1I3QB 1B1ZA 1F9JA 3K9PB 1IBLQ 1PH4A 2CKHB 5IP7H 2GA4B 4R9WA 2CR5A 4BY7H 4IM2A 1L1OA 2INDC 5M5WB 4P72A 3GV6A 4RHRA 1X3FA 1V2YA 4IOIE 3GTJH 3OIPA 2A69C 3GTQH 2WX1A 3RD2A 3S16B 3L10B 3R3MA 1STBA 1Y1VB 3P1HA 3AE9B 1RIPA 2C9OA 2DY8A 4PG3A 4H44C 2BGFA 3AI5A 4LNKA 3RI7C 4K1RB 2D3AA 1YJNA 2KYWA 2JPHA 4HMIA 2ICEC 3H3VI 4DDGD 2WS3B 1RFAA 2MO0A 2AHOB 2E5LQ 1Q7YC 3U30A 2EDGA 1RKNA 4LF9L 2DUDA 4KLKA 1WJ6A 1HXYD 3UGBB 1AP0A 2E8GA 2E2JH 3W1GA 3VDYA 4IPHA 3DHQA 1Y1WG 1NJIC 2JA5B 3PGEA 5HFYA 2XK5A 4HRSA 1HQMC 5C0XG 2JU6X 4M8MA 2WB1B 4W9LA 4ZYSA 3L54A 2K5HA 2JA8H 3ML8A 1G2SA 2YTYA 3HOYB 3GE8C 4BOSC 3IFTA 2A8VA 1EFID 3L0OA 2WDVB 1NEKB 1XNRQ 5AZHA 3RYTA 3ZO5B 3QO2A 2Q8RE 3PS6A 2KCMA 4MGKE 4OWXB 2DJFC 3EFXD 3K57A 2PQAB 2BWFA 5FO7B 3UDGA 3GTOB 4A3GH 2I1KA 1LXDA 3W5OA 3K7AH 3DHHC 2HQEA 4C4VB 3G7LA 4E3CA 4XX5A 5JPMC 4H13C 4YIJA 2TSSA 1PFSA 1XF5L 2DNCA 4DV3L 3CC2A 4HCEA 3VTWA 4KJNA 1SYDA 5IIFA 3SHLA 1YHAA 1VZ7A 1VJKA 2AWOA 1C48A 4A3EG 2F0QA 2ZT9C 3Q8EA 3UINB 1HTPA 3KBXA 3MEHA 2DZIA 4DK3C 2L4NA 4A3LH 2EY2A 4UP8A 1JRUA 1P98A 4IUMB 4B0EA 1EYAA 3ZKJC 5GAGC 5AJ3Q 1PGAA 5C3JB 1EIGA 3G48A 3M7NA 2UXDQ 1R4MB 3CP0A 3JVZX 1N32Q 1T0YA 1V1QA 4QUFA 1HFNA 2HHHL 3G6JB 2MP2A 5LXIB 2EY6A 5M3FB 2XIWA 4QY7A 3W1SC 1K0RA 1MG8A 4OZCA 1K83H 4HPMB 1BCPC 3ZJVA 1FD6A 3UI3A 2PE6B 4RCNA 1XMQQ 1FJGL 3S1QH 2LVPA 3DMUA 1H9SB 1VF5C 1VQMA 1I50B 4BKSD 1M4VA 4R4OA 5ELCA 4KK7A 1I6HH 4NXMQ 1QB5D 1WR6E 2MRPA 2BBCA 3FDTA 1YNXA 2HUGA 2F4VQ 1O80A 3U7DA 4P1CC 1F0ZA 2NR2A 3ONAB 5IN7A 2ATWA 2PTLA 4MACA 1QCBD 2BWES 2NZ1D 4IUVA 2UU9Q 1K8RB 2NBWB 3I57A 4APVA 2UYZB 1JJ2A 1TWFH 3CIRB 4ZLTF 4I7AA 3NK9A 5DNFA 2VW9A 5H92C 4N9TA 4WWPA 4XYQA 3S2DH 2UU7A 4H7BA 3DLLA 1LT5D 2PZWA 5IYBH 2LUMA 3WDNA 4BBRB 5IP4D 3L9AX 1JWAD 4L6TB 3TSSA 4JI0Q 2WACA 4Y52H 2WXHA 3I3CA 4TVAB 1ACCA 3UDXA 3OOCA 1PTOF
chains in the Genus database with same CATH topology
1TJEA 2Q8TA 1JWSD 4HKZE 1NR4A 4FNFA 2KEEA 1TKGA 1HTLD 3PIO3 1JRPA 2A69D 3VRAB 1P7FA 2A5HA 4HSVA 1F77A 2K28A 1TS4A 3Q8FA 2KEDA 3E0JA 3S14B 1C78A 5C3WA 1KDAA 2D2CC 3K5NA 4IUTA 4X3TA 2F0UA 3SXHA 1CA6A 4OZAA 5C0XJ 2EJGC 4C56C 1TKEA 2J7ZA 4DNRB 4BY1B 1ENCA 2IGHA 1ZXTA 1CZPA 1WTWA 5FKAC 2F0TA 4KKSA 5BYQA 3TEZA 1KNEA 4C1NK 1STNA 2WP9B 2TMPA 4OGQC 5FO8B 2IDYA 1B44D 1MVKA 1MBYA 1DCZA 4KKUA 2Y3AA 3HOZB 4EE2A 1FR3A 5KIXA 1ROEA 4JK1C 2W55A 1BBXC 4C3IG 3MJ5A 1YJJA 1H9MA 1GHJA 5ELEA 3T3NA 1ZDVA 1JORA 1QOFA 4OHJA 4LLGM 1XWEA 2FHTA 1SE4A 4A90A 4HCSA 3VYRA 2NVQB 3UI2A 2L52A 4BWGB 1V8QA 4KY5A 2JEAI 4QB4A 2ENBA 4YT0B 3AE3B 2A6HC 3QOJA 3QG1A 4J1MA 3P1MA 2IPKD 1GUWA 4G57A 4IKGA 2JSOA 1D4BA 1IHZA 4DN4M 1STEA 2Y0SB 4JX1C 1EY7A 2M00A 1AWDA 1IKLA 5CGKA 4H2AA 3NS1A 2IX3A 4EVOA 1TR5A 1VMCA 5FOBB 4LMQD 2XN9C 3GTJB 3GTQB 3WCQA 2D5GA 2N7JA 3GB1A 1TU2B 2HDEA 3BK1A 4ZHOA 3T13A 5CR3A 2IW3A 3BVMA 1VZ8A 1STHA 3DWGC 1O7YA 1XX8A 5AFWA 3Q22A 3D4DA 1ENFA 2LKVA 5EE0A 2BCOA 2BE5C 1CI3M 2KA7A 2HCCA 3SFEB 1EYCA 1PZID 4PMWA 5M3MB 3A7AB 5I6WA 1NVID 3IXSA 2F0PA 1I4GA 4V0BA 4G7HC 4V190 2BS4B 4OIKA 2B8GA 2EYPA 3IAS1 3PV0A 1DONA 4R8IA 1KNAA 4Q0FA 3Q69A 5BMHA 2K01A 2RQXA 1BOSA 4DAVA 3TP6A 3R3OA 1DOKA 2K0PA 4C3JG 1WVLA 4USAA 3IT4B 3EROA 4HROA 3FPUB 4A3IB 2KQ3A 1WTXA 4KHVA 1Z6HA 1LTRD 2WU5B 3HOVB 4HEDA 3ZJTA 3AE1B 2LMCA 2QCPX 1KDBA 2B2YC 4A3JB 2E2DC 3D6CA 2WV6D 1RWSA 2Z8LA 3BS1A 3D8GA 1GOZA 3OSOA 5D3DA 2B2TA 1C4QA 1S5CD 3AEGB 1OXUA 3TP7A 1RM6C 5BMIA 4US8A 5C3XA 4FXCA 2LFNA 1JQ4A 2L11A 2XRSD 4DK1A 4MT5A 1RCVD 1I4PA 1U9RA 2LFIA 1H9JA 1PUTA 1L4ZB 1HCZA 4ARIA 1K8OA 2EELA 2F3VA 3PUZA 2OEOA 1ZP0B 3KBGA 4HMJA 3M4OB 3KWVA 2IJ0A 2WAQB 2A6HD 2EYOA 3BYTB 1STGA 3K5OA 1QE6A 2O2LD 4XTCS 3T3OA 2JSVX 3D31A 3O13A 5C6AA 3I73A 1C9FA 2HDLA 3F2UA 1F9QA 4F88A 2W54A 3SFDB 4FXDA 2CQAA 2LHDA 4LAAA 4EQNA 4A3EB 1SE2A 2KOLA 2M9VA 2PZTA 3W9CB 3LB8C 4JBWA 3PUYA 1FO4A 4RGTA 1XTCD 5KEEA 3MAQA 3SR6A 1BDOA 1FMAD 1EY0A 1TWGB 1JW9D 3CWIA 3N9YC 2BE5D 3KQ4A 3NTIA 3P42A 4C7ZA 3SE0A 3SK6A 2AQ2B 2RVLA 4OIJA 5KRUA 1WCMB 4G4KA 4A8XC 3CQZB 3AMUA 1E2ZA 2KDMA 5ISRA 2WU2B 3GO5A 1T3QA 4TQ1A 2KUMA 3IAM1 2ZXRA 4TRDA 3T4AC 4RH6A 1A2TA 1RD9D 1WGKA 3BWUD 4HR7B 3E6ZX 4F7XA 1T6BX 2K9XA 4FXKC 1O7ZA 3HEJA 5C5MA 1LT4D 5BN4A 5AUIA 1F9RA 1U4RA 1OQQA 3VQIA 1MSHA 3I90A 2E6XA 2F0IA 4KKJA 5BN5A 3K58A 1HZ6A 3MXUA 2E76C 2MEKA 2F0HA 5EKIA 4KKTA 1EWYC 4DXFA 2Q8IB 1TWCB 4FXGC 2VUMB 1QF6A 1HRJA 2PW9A 1IL8A 2BDNA 3P20A 1HEZE 2KECA 3TEWA 2WXPA 3H91A 2JYOA 3GV3A 3GS2A 4X3SA 2BOSA 2D9UA 2F0WA 1YN4A 1X3QA 2AX5A 4HTHA 1D1KA 4A3MB 4L23A 4KD3A 1FXAA 3NZ3A 2WQYB 4G7OC 1B53A 2MPMA 2FINB 5G5GA 1SB3C 3BYYB 1EY5A 3U2SC 3MFGA 5CMDA 3NRZA 1IKMA 1Q8IA 3GQBA 3SVMA 2F0SA 2LMCB 3VR4A 1XLOA 1EWHA 4RF0A 5K36H 2A6EC 3KLRA 4CBVA 1EY4A 1SSOA 3EA6A 3V96A 2LJIA 1WRIA 5E6JA 3H6MA 1CK1A 3OIQA 1R9TB 1QOAA 4F87A 2PKOA 5COYA 2WINB 1B9NA 3A8KE 1KDCA 4HKQA 1VCIA 4RKBA 3J80E 1PTOB 5CYUA 3RZOB 3PO0A 1YQ3B 4RWSC 4DA2A 3OMGA 3P4RB 1FM0D 1QQRA 2G1EA 4MH8A 1FRRA 4KGTA 2FBWB 4A3DB 1EL0A 1NYQA 1ZXIA 1RYJA 3A8IE 2M0AA 1N5WA 2MJ3A 1JICA 3R2TA 2PW7A 3NHHA 2M19A 1FYCA 2G9HD 4CHTB 4LJZC 3HZXA 5I9PA 3OMCA 2H4OA 5T1IA 4M8AA 4K6DA 4NAMA 1BO0A 3RMHA 1QLBB 2L9HA 2DYMA 4IUPA 3T16A 2YYZA 5LHY1 1BNZA 5EGTA 4CKEA 3NXWA 2Q5WD 1PRTB 2BB5A 1FGBD 1GHKA 5GXGB 4A93B 2SDFA 1IW7D 2VNUD 2R3ZA 4HJGE 5D7GA 1EY8A 4DU9A 3C1EA 4ZHPA 3HVZA 1TQOA 1FNWA 3GTPB 3AE8B 1QT9A 1MD2D 3TDQA 3AN1A 4DAYA 1V8CA 4C3JB 3EJIA 4K5XA 3C8YA 1SDFA 4ULLA 4XDXA 1IYUA 4RCOA 3B2GA 1ZKOA 1N63A 5DEHA 3U52E 1DM0B 3MXNA 5C4ZA 2EY5A 2VZKB 2FFKB 3K6OA 2H1EA 5JVH3 2INNE 1LTAD 3J7YW 2INPE 5CBEE 1WTOA 1II3A 2IGDA 2BTEA 4RFBA 3HGBA 2WKDA 1LABA 2JE6I 2EPBA 2HDMA 1LV9A 3W3AA 3OPOA 1HA5A 5C44B 3DWMA 3URYA 3AMZA 2X38A 3AEBB 3PIP3 2DBYA 3S1MB 2A6ED 1NAPA 5HHDG 4MM3B 2H89B 1ZUD2 4N9PA 1RFKA 1EIHA 3QB3A 2OT2A 1GB4A 3ZYYX 3NBIA 1PZJD 2QILA 1MI0A 3PUXA 4GZYC 1TT2A 3NQTA 1ZE3D 5EPLA 3ZJUA 3FMCA 1W6KA 4YSYB 3JAML 1RTOA 4YSZB 4GDLB 2RDHA 4O1NA 4K2KA 1TWAB 1UWXA 1BCPB 1E0ZA 4TQUS 5HGTA 4IUUA 2LY7A 4PMBA 2SAKA 4ZK9B 2DYOA 1A6XA 5CV4A 2M2LA 1NENB 2IX1A 1SF0A 4IALA 4X3KA 4LTUA 1RDPD 3V3XA 2XWJB 2KHSA 1EY9A 1J7BA 1RF2D 5D65A 2GRIA 2QIEB 1NCVA 3RPFC 1TVXA 2J0TD 4P6VF 1OXVA 4NKLA 1PFNA 3T51B 5JEAH 4IURA 4B08A 2NB0A 5FR3A 1ZXHA 3NE5B 2XNAC 5K5PA 4ID6A 1YNJC 2F1MA 2WXIA 1Q1BA 2B2VC 5NUCA 3OHXC 4PQXA 5FO9B 2I07B 1S5DD 4NW2A 2VB3X 2O5IC 1F2ZA 2KVMA 3HG9A 3M3YB 2PVGC 2E3TA 4XWTA 4RGNA 3CRKC 3PO2B 4QCLA 1PRTF 2R6GA 4PNYA 1DOXA 1SNDA 1KRHA 4ZUJA 4A3FB 3CRLC 1E2VA 5FK9C 4NJCA 4KD4A 1MHHE 4RF1A 1JR0D 2ID0A 3GP7A 2WXKA 5CORA 4LK0M 1LACA 1EU4A 5E3FA 1YNTE 4DK0A 2N88A 4MHEA 4DFAA 2PIAA 1SYGA 1EEID 2ZW0A 3MVVA 2L12A 3DM1A 1JWMD 1LTGD 1DOMA 2G9DA 3A7LA 2CHBD 4PT5A 4KI0A 3D6WA 4S3SA 3KWLA 4XDDA 2N9LA 5G5HA 3HOWB 2OEDA 1S4ZA 1GJXA 1N62A 4AYBB 1ILQA 1KLGD 3BVGA 2H88B 3BIID 4IFDH 3U7ZA 3Q24A 2B76B 1PGBA 2N9KA 2NUCA 3OW7A 2A74C 1V1PA 5C4XB 1ZYRC 1GXDC 2F0FA 3J81L 3VYUA 1JQYD 2IX0A 1EOTA 1EY6A 2ON8A 1OO9B 2AUKA 4OVZA 4J8QA 5E4XA 1DD2A 1WTPA 1LTTD 1EQTA 4BY7B 3V2TA 4KJOA 3VYSA 3I70A 2F0DA 1HPCA 2D5DA 4G7ZC 1KAAA 3FILB 2V0GA 5KNCA 1SIJA 1BCPF 2Z4IA 2K22A 3I91A 3FRPB 1AZQA 4L2YA 1L0XB 3ND8A 1HUMA 2NYZD 3TUOA 4RGMA 2E2JB 1FEHA 3JAME 4REZA 5CBAE 1B4OA 3MXGA 1OXSC 2JA8B 2EXZA 2F0NA 1D2BA 4O42A 1CHQD 4ZRQA 5FLXL 4IFDI 1ZOYB 1QOBA 3NWSA 4A3GB 1QKZA 2WXFA 3K7AB 3H09A 3D4RA 1YNJD 2PVOD 2SEBD 3KK7A 4EQPA 3IAYA 3Q23A 4WAFA 1LLRD 2X6GA 3NBHA 4KN4C 1J7AA 1PMRA 3IT6B 1K8MA 2I2YA 2K5DA 2BW2A 3RUZA 2J53A 1AFPA 2KN4A 1BUIC 3B9JA 1CTMA 1Y8NB 2A68D 3FAHA 3N6RA 2VB2X 2J4XA 1TKYA 2PLPA 2RMMA 1K83B 5E1FA 1HUNA 4BS9A 1ESFA 1SYFA 3Q8BA 3S1QB 3NVZA 1UEAB 2JX5A 3NQIA 1L4DB 2Y5CA 1EM7A 2HTME 5HURA 2L1AA 1KF6B 1IBXB 1I6HB 5CV5A 4WJWA 4B9XA 1EYDA 1SXTA 4BA2I 2K3UA 5EQ0A 4JE3B 1QG7A 2MJDA 3L4PA 2QDBA 3J7AF 3DUZA 1UNSA 3IL8A 1ML0D 4B9WA 2KACA 1TWFB 3T56B 1IYVA 1VR9A 2WDRB 5I2YA 5HG2A 3S2DB 2OHFA 2F0MA 1VF7A 3BDLA 3FEWX 1Q12A 2DNEA 2EOTA 4K8IA 1L0VB 1LTBD 2NN6H 1S5ED 3ERQA 4ZKBB 3RD4A 1ZYRD 2PZUA 1CQFA 2K5QA 4IDIA 1PDQA 1BXTA 4K5VA 2W82A 3WOFA 3AEEB 1E9MA 2WKCA 2NVXB 2Y5PA 1JROA 2PMVA 2V4IB 2WXRA 3VRBB 1Z47A 1EQVA 1TY2A 1CHPD 2WXNA 4KGSA 5BYRA 1SYCA 1D5XC 3TP8A 3DEOA 3AE5B 2F0EA 1JMLA 2WLBA 3NP8A 1F2RC 5JVG3 1EU3A 3MP9A 1N60A 4HSPA 3J81E 1V97A 3Q0AA 1ICWA 2OF1A 4C1NI 3ZGZA 2WDQB 3MZ5A 1KFYB 3I4NB 3GD7A 2ACZB 1E0BA 1C8CA 1T5XD 3SK5A 1X32A 4QMGA 5T1GA 3TBIB 1I4RA 4P2CB 5EE9A 3OWFA 4E6IA 3I4MB 3J9CA 2NTSA 3PUWA 2B2WA 1MI2A 2K6AA 1CZGA 2SOBA 2K33A 1NUCA 4FP5D 3P7JA 5A2QL 2WIIB 1AZPA 2BT6A 2NN6I 4WURA 4K14A 1WTRA 1V1PB 3L3OC 1NSNS 2K5PA 2KQ4X 3HRDD 2QSDA 3A54A 4NP5A 4ZKCB 1C77A 3KLSX 2EY1A 4LK1C 5KNDA 5FLXE 1HZ5A 1C4PA 5K36G 4YWGG 1JE4A 4A3KB 2K7VA 4WIPA 1ESRA 3PMFA 2BA1A 3LYYA 1AW7A 1RTNA 5ELFA 4OL7A 1KTKA 4EQOA 1YMHE 3P75A 1U4LA 1A2UA 2F0JA 4J3OD 3A56A 4WWMA 1O7LA 1PGXA 1RHPA 1IW7C 1A3VA 1PDXA 3QWNA 2XRQD 3H0GB 4C80A 4ZRPA 2AUJD 5CV6A 2MH7A 3W1SA 1TKWB 3U4EG 4TMAB 1YNNC 4ME5A 4WRDA 4KX6B 3U9OA 2N0SB 1G2TA 2EVBA 5G3LF 4TKOB 1UAPA 1UGJA 2WXQA 4M0WA 4I7ZC 1MHXA 3B2FA 5CV9A 2YU9B 4YXDB 2PO4A 4FF3A 1HA6A 1DXMA 2E2IB 3HP3A 3VR5A 4C2MB 4MIUA 2VXWA 1FNVA 1Y8OB 1JOKA 2NBFA 2NVYB 4P16A 4EGVA 2CW0C 1PFBA 3GTKB 5EE1A 2B2TC 3QJYA 3GTGB 3VR6A 4CKBA 4NDXA 2BS2B 1HFGA 1JB3A 2RDGA 3FPPA 3Q8CA 5J22A 3HKZB 2I38A 1B2TA 3W5VB 1NI3A 3Q8AA 3DXJC 3R93A 5EKKA 3BG3A 1FNUA 3MHZA 2CJNA 1P7EA 1WD0A 1PTOC 3W5UB 1O78A 1XXGA 2N55A 5EBCA 1K50A 1UWMA 4RNAA 5M5XB 1EZ8A 1EWCA 2KMMA 1U4PA 3SK4A 3VA5A 3LX0A 2FUG1 1F9PA 3E5SA 3OWEB 2QJLA 5M9OA 2K03A 1FFVA 4NMZA 1KABA 1E6EB 2PCFB 3S1NB 2FJ2A 1UUPA 1TS3A 1BUVT 2JA7B 1LTID 1D5ZC 1OFFA 4ABNA 5C4HA 3L7ZC 3TMEA 4KY7A 2AQ3B 1B3AA 1N61A 1SBBB 4U68A 4N58A 3SDZA 1YN3A 2HCIA 1TS2A 1LTSD 1JOQA 2AQ1B 4A9AA 2FMCA 4UAIA 5A2QE 2CVRA 1SFOB 2PNRC 4RA8A 2Z4HA 1I4XA 2RPVA 1A15A 1VMPA 3NTHA 4A55A 2PPBC 4FYDA 1K53A 1B9MA 2X69A 2JQRB 2B2WC 4ZUIA 1STAA 2EYMA 5KGUA 4KN7C 5AUKA 3R2IA 3U9SA 4NZLB 1ET9A 4IQZA 4FVMA 1KLUD 1SYEA 2ZXPA 2DWQA 4TSSA 1WYGA 5IGBA 1GUGA 5DM63 1F2MA 1S5FD 2B8FA 3SR1A 1YNND 2L83A 5EPKA 1LT3D 1FRDA 2JZPA 2WXGA 3ETRA 3FILA 1Q10A 4XQQA 1IGCA 3FKIB 4IUQA 4N59A 2IL8A 4RKLA 5C5LA 3E56A 2ZW1A 5JEAG 4TQ0A 3D4WA 1RJTA 1ZEQX 4XT3B 1FCCC 3E9SA 3ITPA 2CW0D 1R4PB 2BDOA 4C3HG 3MXPA 1Q1EA 3ZQ4A 2LS01 3VYTA 1L0YB 2EJFC 2R61A 3LNNA 3BDCA 4OO1H 2E75C 3M85A 1HQRD 1SNPA 3HS0C 1C79A 1SYBA 1JC7A 1PTOD 2F0VA 2BYTA 1U4MA 5LL6S 1M8AA 2ONQA 4YTMB 2EZVA 1QNUA 2F0GA 3TP5A 2Z1CA 1CT1D 2L5TA 4KY6A 1IGDA 2F0LA 2JXMB 4Q5VA 2KJXA 1QOHA 4OW0A 5JPNC 3V05A 4XYOA 1C4CA 2DN8A 3NUCA 3Q6SA 1SMYC 5C0XH 1BR9A 2JYTA 3NVVA 1IBXA 4HN7A 1B50A 3EUB2 3LXFA 4D2KA 1GPXA 1R4QB 3TZUA 1N5XA 3RZDB 3P4PB 2KCCA 1WTVA 4IZ8A 1J7CA 4IFDG 5T8IA 3IFDA 2LHEA 1C76A 3TEYA 1QOGA 3PO3B 3R8BA 3A55A 1CFMA 3P4SB 3D3RA 1PRTD 1WXQA 3NUHB 3AE6B 4YTPB 4K5WA 4X3UA 4KHZA 2B2YA 2R7ZB 3BK2A 1IUEA 4CJ0B 1GAQB 4OO1I 1Q90A 1LO5D 2JA6B 2CU3A 2YEPB 2X6LA 4CGYB 3PUVA 4I65A 3GTMB 1BQQT 4CQNA 3H8HA 2NWGA 5J1ZA 2F0KA 2SNMA 5ELBA 5I4DA 2KWDA 1JWBD 2W3SA 3P4QB 2XWBB 2K1BA 4WH4A 3EVQA 2A68C 3H3VC 5CV7A 4RHSA 2EYHA 4DQOC 2IT1A 1FXIA 2NTTA 3S2HB 2VZKD 4NAWB 4XWWA 1VDVA 1SJHD 1GUSA 4XXEA 5C0XI 5ELDA 1I6VC 4Q2JA 4AS1A 4RAUC 1F9SA 3CKIB 5D14A 1ILPA 1DYQA 1L5PA 1L6VA 2R93B 5JEAJ 3DEPA 5JOBA 3SK8A 4QIWB 1AN8A 2PW5A 1G291 1DGJA 3GTLB 4US9A 5JXVA 3MHBA 3C46A 3MFYA 3AH7A 3I9V1 4BA1I 3MC0B 4K6LA 3S1RB 3N52A 1ONLA 1QWYA 3BZDB 2JXTA 4MN3A 5D3IB 5HI1A 1BCPD 4U673 3RLFA 1ZPSA 4ZQ3A 2D62A 2RA4A 2AWNA 1VRAB 3NPPA 5JJZA 4ZAIA 4XQNA 2F03A 1DJRD 4FF4A 1XLPA 1H9RA 3WOEA 1NYRA 1F2RI 1LT6D 3KF8A 1YN5A 2XSCA 4UDUC 1G8ZD 1MSGA 1TY0A 3KLSA 1Q3LA 3BVZA 4HEA1 4A6QA 1XLQA 4M1UB 1SMYD 1SNQA 2MJ8A 4KMUC 2FE8A 1XO3A 5IOCA 5I9OA 4DGZA 1J9OA 1I7HA 4KV6A 3TZDA 5IT9L 4IFDJ 1WD1A 1ENAA 4DAPA 2V3NA 3AB9A 5MPOA 2NN6G 2PYKA 2A73B 1V1OA 1A70A 5BYSA 2W3RA 3C2PA 2WXMA 5I2XA 1FD7D 4K8JA 4L1BA 2EKIA 2WNMA 3PZ8A 4CJ2C 5KYIA 2JEBI 5DAUA 1F2LA 5IGGA 3K5MA 5E4WC 2DLBA 5C3EB 2K05A 3S15B 1TWHB 4HAEA 2O4XA 1XEEA 1I4HA 5IGDA 4WFN3 3HUIA 1EZ6A 4A3BB 2YEPF 2WXOA 2NVTB 1JOOA 1E2WA 5CV8A 2LEKA 1PXUA 3HOUB 4QUCA 1MPEA 2EYLA 1OQRA 4WORA 3C3LA 2RSNA 3CHBD 1GB1A 2KCNA 2M56B 1E10A 1AEXA 1NR2A 1CJEA 1QNKA 1PTOH 2I46A 2XVSA 4FF1A 4C7YA 2RSOA 5EJWA 2QKIC 3AE2B 5BMGA 2MUYA 2EJMA 1J8IA 1TYGB 1QILA 3IKJA 1G6ZA 4KTAA 1DOYA 5CC4A 1H9KA 1SNCA 1W6JA 2JP1A 3NVWA 2BS3B 4CJ1B 3S17B 1Y8PB 3NTKA 3C1FA 5I6YA 3AEFB 4FO2A 4J6HA 2QMTA 3EQLC 1OXXK 3DWPA 1PZKD 3HOXB 3DWAA 1Y1WB 2MGSA 5C2TB 4XDCA 5H8YE 4FF2A 3VR8B 4XQJA 5DM73 1K51A 4AQ7A 3S9WA 1Z7TA 2WXJA 3ABVB 4CKCA 1SEBD 1JCKB 2B2UA 5IODA 2L55A 1FIQA 5BN3A 1A3TA 2F0OA 3CU7A 2LGIA 3I4LA 2SNSA 1S5BD 3FVQA 2JYEA 4C3HB 3W2DA 2F4IA 5EPJA 3RFZB 2WP8J 2IWHA 1X3PA 3MWYW 3P63A 1YJIA 1AYFA 4KKIA 3AE4B 1XLNA 1JWUD 2PMZB 3J80L 5M5YB 1C4AA 3FC4A 1GUNA 2WXLA 4XT1B 3VA7A 2V3PA 2J52A 2E2HB 5KYLA 2RDFA 4F8MA 1XCTL 2BB6A 1E7PB 3AECB 5LNK1 1WTQA 1Y56A 1TIID 2EYJA 1OXTA 1PYWD 4DNTB 2NMQA 4YTNB 1CZWA 3AM9A 4ZOHC 3LWEA 2C5CA 1EEFD 5IT9E 3MA2B 5EE3A 1D6EC 4ODGA 3J7AV 1BMLC 3A8JE 4DF7A 4R3DA 5C4JB 2ZXOA 1I4QA 1XYIA 3LWUA 1SSNA 2L1BA 5F2DA 2QEJC 2IGGA 2DY7A 3QIAA 2PQEA 3NSWA 3EGRA 3M7GA 2L32A 2KAJA 2O5JC 3K5LA 5G3LD 4K2LA 1V43A 3M4YA 2EE1A 2ICIA 1F2YA 3AU7A 5IGFA 3K0YA 1YQ4B 2MJEA 1SNOA 3TEXA 4YSXB 4WQMA 2RKSA 1H9SA 1D1IA 3I8ZA 4BBSB 1D5MC 1WSPA 1VLBA 4JWSC 4JWUC 5TSSA 3PZ7A 1FCLA 1QJOA 4GLSC 2J42A 1MGSA 1ZDXA 5IGEA 2R92B 1SJED 3HRZC 2MHVA 1CQVA 4B0MA 5A35A 1G91A 2F3WA 3AEAB 3NVYA 2GB1A 3HVDA 3MTSA 1HHVA 3T53B 5LL6X 1PFDA 1B9RA 1VDZA 3X3NA 2E74C 1GUOA 3H94A 3SEBA 2BA0A 2B63B 3DWQA 4XE0A 4XIGS 1SAPA 5JAVA 4DXGA 5J39A 1KH0A 4KGRA 4JPSA 1CM9A 3I72A 4L63B 1XCQL 3VR9B 3VR2A 5IGCA 1K52A 2B39A 4ILWA 2RBMA 4Y7NB 1FFUA 1CA5A 2FMMA 4OZBA 4C3IB 1TS5A 2K5WA 3NWTA 4IN3A 2QF7A 4H0LC 2V4DA 2GI9A 1RODA 4N6EB 1ET6A 1DZ1A 1JALA 1SNMA 3AE7B 4ZRZA 3X3MA 1A3UA 3AV8A 4RGOS 3TN2A 3VR3A 4PMCA 2OXPA 4IUNA 3KUPA 1TZOA 3BDOA 1L6UA 1T5EA 4Z9CB 1VZ6A 1PFMA 2MP1A 1R7SA 2B2VA 4QF4A 2K04A 3AB5A 5EKLA 4GDKB 5KNBA 2CJOA 1PLFA 4ARCA 3ND9A 4ITKA 1DOIA 1STYA 2B2UC 3AEDB 1GUTA 4R8NA 4L8JA 5EBDA 2K32A 1Y69U 2L0CA 1BF4A 1PRTC 3K59A 4PV1C 1DOLA 4OO1G 2JWUA 1SE3A 3QOLA 1WWTA 2EYFA 1I3QB 1B1ZA 2GA4B 4R9WA 5M5WB 3GV6A 4RHRA 4IOIE 3OIPA 2A69C 3S16B 1STBA 1Y1VB 3P1HA 3AE9B 2C9OA 2DY8A 4H44C 4HMIA 2ICEC 2WS3B 2EDGA 1RKNA 1HXYD 1AP0A 3DHQA 2JA5B 5HFYA 4HRSA 1HQMC 5C0XG 2JU6X 2WB1B 4ZYSA 1G2SA 3HOYB 3IFTA 1EFID 2WDVB 1NEKB 3QO2A 2Q8RE 3EFXD 3K57A 5FO7B 3GTOB 2HQEA 3G7LA 5JPMC 4H13C 4YIJA 2TSSA 1XF5L 2DNCA 4HCEA 4KJNA 1SYDA 5IIFA 3SHLA 1VZ7A 1VJKA 2AWOA 1C48A 2F0QA