1TS2A

T128a mutant of toxic shock syndrome toxin-1 from s. aureus
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISALDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
publication title Structures of five mutants of toxic shock syndrome toxin-1 with reduced biological activity.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 57
structure length 194
sequence length 194
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1997-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ts2A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ts2A01
4RGMA 2QILA 2XN9C 1PZID 1UUPA 3R2IA 1QILA 3V05A 1MD2D 2AQ1B 3KLSX 1YN3A 3SEBA 1STEA 2IPKD 1EU4A 1RD9D 2O2LD 1FGBD 1D5XC 1V1OA 5ELDA 1LTBD 4BWGB 1TY2A 3W2DA 2SEBD 2IJ0A 4UDUC 1DYQA 1BCPF 1I4RA 5ELEA 2CHBD 1G8ZD 4L63B 1PRTF 3BYTB 1FNUA 1ENFA 2G9HD 1AW7A 1D5MC 1LTID 3BYYB 4O1NA 4OHJA 2AQ3B 1BCPD 5FKAC 1SE2A 1FNVA 1D6EC 3URYA 1L0XB 1PRTD 1TS5A 1FD7D 1GOZA 1SBBB 2R61A 2NTSA 1SE3A 4TSSA 3R2TA 1LT6D 1I4XA 1EEID 1XTCD 4K6LA 4RHSA 1TS3A 4DXFA 1B1ZA 1CT1D 1JCKB 1F77A 1I4QA 1LTAD 1BXTA 1LT4D 1M4VA 1PZKD 1S5DD 1TS4A 2TSSA 1XXGA 1CK1A 4RFBA 1YN5A 1V1PA 1KLGD 3BVGA 1AN8A 1PTOH 3R8BA 1BCPB 1ESFA 1JR0D 2J4XA 1PYWD 1PRTB 1L0YB 1V1PB 3BVZA 1D5ZC 1EEFD 1EU3A 2NTTA 4RHRA 5ELFA 5D3DA 1S5BD 1SXTA 1HTLD 5ELBA 1YN4A 3O13A 1JQYD 1CHQD 2QEJC 1CQVA 1RCVD 1S5FD 1BCPC 1SJED 1PTOF 1CHPD 1SE4A 1HA5A 1LO5D 1SJHD 3EFXD 1LLRD 3BVMA 1FNWA 3GP7A 4RH6A 3EA6A 1PTOD 3BZDB 3MC0B 2XRSD 1HQRD 2XNAC 4RCOA 5FK9C 3MFGA 4Z9CB 3CHBD 1I4GA 2AQ2B 2RDGA 5D3IB 5TSSA 1RF2D 4NZLB 1LT5D 1TY0A 1I4HA 2ICIA 1LTTD 1PZJD 4C56C 2WV6D 1LTRD 1KLUD 1S5CD 1B44D 1PTOB 4RGOS 1HXYD 1JWMD 1EFID 2XRQD 4ZYSA 1UNSA 1S5ED 1TS2A 1DJRD 1PRTC 4RGTA 5I4DA 3TSSA 4RGNA 1EWCA 1KTKA 5ELCA 3DWQA 1RDPD 1LTGD 1SEBD 1ET9A 4DXGA 3DWPA 1PTOC 1JWUD 2Z8LA 4L6TB 1ET6A 1LTSD 1LT3D 1I4PA 1JWSD 3DWAA 1T5XD 3OWEB 2RDHA
chains in the Genus database with same CATH superfamily
2ZJRA 4LJOB 3W1YA 2QILA 2Z6KA 2F3WA 3CD6A 2QEXA 2AEHA 2KZRA 4BY7G 4KY7A 4DAVA 3R2IA 2XTIA 3F2DA 3NE5B 4WWPA 4ZRPA 5M5YH 3NTKA 1GUOA 1PH4A 2OWOA 4DR3L 3HOUH 3UIPB 4IOCA 4HVBA 4K7SA 4FN2A 4E74A 4C4VB 4IKGA 1KH0A 2F0LA 4FDBA 1VQBA 4R3DA 1EYDA 4WJOA 3P4PB 2CWPA 4BWGB 3NXWA 3MHSD 2Z0SA 1BBWA 1ZP0B 2FAZA 1GB1A 3W2DA 2NBUA 3R7QA 2DZKA 1ZEQX 4FHKA 1GVPA 4WAFA 5ELEA 2MP2A 5BN4A 1TJEA 2PCFB 4L63B 2JRIB 4K81A 1DXMA 2F52A 4HPLB 2L0FA 1L2FA 1YNTE 1EY8A 1VQ7A 1GJZA 2WXGA 4GOPB 2L32A 4HJ9A 2Z9HA 1CJEA 3I57A 3FAHA 4HJ7A 3Q3MC 3A7LA 2NTSA 4RKLA 4KV6A 2J0KA 3OW7A 1PH2A 2B2YA 2EY1A 4B9XA 1TZ1A 4DXFA 5IGDA 2TSSA 2KTRB 1LT4D 4WWNA 2N9LA 2F0MA 1QB5D 3FPPA 4X6AH 2EIFA 5FJ8H 2I07B 4JI4Q 2JWZA 2K1BA 2E5LQ 3B0AA 5C5LA 3PPAA 3U9SA 4GKJQ 2V3SA 2HD3A 4JV5L 1YBYA 2CFMA 2BYVE 1W2BA 4HCEA 1PFNA 3HOWB 5CHFA 5IP7G 1VLBA 4H02A 1SYGA 4HJ5A 3AH7A 1HZBA 3RZDB 2VQEQ 1SXTA 2EXDA 4KD4A 3KUZA 3CP0A 3PT2B 3DBRI 3DHIC 2NVYH 1VQIA 1SJED 4A75A 3H7SA 3W3AA 1SE4A 1SYEA 2GVBA 5CX3A 3RN5A 5J2RA 3Q8CA 4OX9Q 3Q0AA 3RNAC 3PO2B 1WYDA 2MBHA 2QCZA 1WXQA 2Y0SB 1C77A 4MHEA 2AUKA 4UHVA 1PH1A 3QO2A 2LJ5A 5CR3A 3I4MG 1OXSC 1QOAA 2K32A 1HTPA 3ULJA 4B0EA 3HKSA 3ZO5B 3MZ5A 2A5HA 3K5LA 2ZVNA 1YHAA 5IGBA 4ZRQA 4JYAL 2L0TA 3N32A 3VQIA 1J7CA 2INDC 4DPGA 3DMUA 1WJ4A 4C2MH 2UXCL 3TBLD 2N1WA 4CDCC 3W1SA 1LTTD 4LF5L 4PS8A 1RFKA 4ID6A 4UP8A 3SFDB 3IL8A 2R93B 4W9HA 1B9RA 3NHHA 4KVGB 3PZ7A 3NWTA 3DBHI 1RL2A 3K8AA 4DV0L 3ZDMC 1Q0WB 1PH9A 4EZLA 3IRBA 4ZLTF 2NZOA 3LNNA 1ZKHA 3WWVA 3I90A 3F2UA 4LWCA 4DF7A 2ZVOA 1P8LA 1SR3A 2NN6H 4JI8L 4XXEA 2IW3A 4DXGA 4HMJA 3TZDA 1JWUD 3RUZA 3IFDA 3RI7C 2JSOA 1UD7A 1JWSD 2F0JA 2RDHA 3E6ZX 1X3PA 2XEWA 5KGUA 4P7IA 3SD5A 2GA4B 4GLAC 3GV6A 2SOBA 3I73A 4LFCL 1JW9D 1K83B 1KDAA 2YTYA 5M3MG 2BVCA 2LVOA 4V0BA 1ML0D 3R7RA 2Q8IB 1MIUA 3UQBA 4ME3A 3VDZA 3FVQA 2MBEA 5D7GA 3N30A 3S1RH 2K7VA 1YMHE 3M62B 3QCAA 1KC8C 4DV2Q 3H3VH 1V1QA 3AI5A 2ZJDA 1P7FA 2MQHA 2EYMA 2RD0A 2DGYA 4C00A 1JROA 2N7EA 4ANVA 3ZVVA 2KN5A 1WTOA 2A6HC 4KSLC 2HCCA 3QOLA 1OTRB 3W1SC 2YU9B 3MC9A 3ML8A 2Z1CA 4UPAA 3W1BA 1C4CA 2VQFQ 1YEZA 4A3DG 2ASQA 4DQOC 5BR8L 1K0SA 5CV5A 1WJ6A 2KANA 3H0GB 2L1AA 3RNUA 4LNQA 1D8LA 4DV3Q 2E2JH 4B9KA 2V1CC 5J1ZA 1FNVA 2F1MA 1CSQA 1L5PA 5GXGB 1HUNA 1XO3A 1A15A 5A2QL 1YJWA 4LNFA 3U4ZA 1TWGB 2V3NA 3UINB 1IW7D 2RCFA 1XMQQ 1N5XA 2PIAA 4J8QA 2R7ZG 3Q3JA 4DFAA 3LX0A 2QGQA 2LMCA 3J7AV 2LXKA 1FO4A 2ZJPA 3QJZA 4A3EH 5LNK1 3MXPA 3R8BA 2W3RA 5H8YE 1XNQL 1G51A 1RAXA 3H8HA 2UUBQ 4WURA 3ONSA 3DOWA 1O7IA 2J4XA 4NXNQ 2CU1A 2XWBB 4K3BA 3N20C 3BG3A 3BVZA 4LCDE 4OIKA 1CTMA 4U68A 4DU9A 1II3A 2WQYB 3M4OH 1C48A 2DAFA 1RCVD 2K8BA 1E2VA 3QHTA 4IWPA 3T9LA 3TEZA 2KECA 3VH3B 3DVNU 5IYCH 1WJUA 5CORA 3CRKC 3BJUA 2QDFA 3OPOA 1CFMA 3A74A 2JVCA 2A5UA 1EIFA 4C7YA 2NUCA 3CKIB 4A93H 1QNKA 4QL5A 1C3TA 1FCCC 3QAQA 1QLBB 3N52A 3Q23A 4Z9CB 5J17A 2WXLA 2WDTB 4DA2A 2WXJA 4U673 1EL0A 3TUOA 2VH2A 4HCNB 1NJIC 5JH5C 1L6UA 5I9PA 1ZUD2 3OJ3A 1JWBD 2MHJA 3EC8A 3K81C 1A3UA 4C3JH 3GTOH 4K14A 2VUMB 3J7AF 4GS3A 2MRPA 4BBSG 4ZUIA 3S2HB 1NSNS 4DHJB 1VZ6A 2MO1A 2FCMA 4AQ7A 3KK7A 2V3PA 4OW0A 1CZWA 4C3HG 1WJJA 1QZHA 2JUOA 2A69D 1IBLL 3LB8C 4ZRKA 3HOYH 3QOJA 2QMTA 2JYEA 2K03A 4BBRB 2A68D 4DR7L 3M4PA 1A5RA 2NS5A 2PZWA 3LXFA 1STGA 5FO7B 4WQOB 1UE7A 1QUQA 2O2VA 3CQZB 4ZDVA 1CA5A 5DPRA 3B9JA 3QB3A 1LXDA 4JK1C 4JX1C 4RF1A 4LF4Q 1Y1VB 3T13A 2ZTEA 2BYFA 5IAAC 1L0WA 3NZSA 1TWHB 1E9MA 5LL6S 1EY5A 2RKSA 1N9WA 5IA7A 3V62A 4N9TA 3M9BA 2ZW1A 5JXVA 1WCMG 4HIKA 3PV0A 3ZRCA 1K8GA 4DDID 3QIAA 1DOYA 2WNMA 3SK4A 3S17H 3J81L 2KAJA 3CU7A 4N8X1 4WJQA 3ZRFA 4A3MH 1I7HA 2KCCA 3KYCD 2DUDA 4CHKA 5M5YB 4H0LC 1J8CA 1SE9A 5E6OA 3OYYA 3P4RB 2KDIA 1PGXA 4E6IA 4XQQA 1ENFA 2G9HD 3ZIMA 2NWGA 4TKOB 4JI7Q 3HOXG 1WGDA 1BUVT 3AFPA 4J6HA 3MFYA 1RYJA 4K7UA 2JZ3B 1Y8NB 2HJ1A 1HZAA 4O42A 3PIP3 3PUXA 3T56B 2LSSA 3T1HQ 1G6PA 2GN5A 4QAYA 3DEOA 3TS2A 2K5VA 1XTCD 4K6LA 5J3BA 2Y5CA 4AYBE 2WYQA 1TS4A 1MSHA 2KCMA 3P1HA 1BUIC 4A9AA 5I2YA 1N32L 2KWVB 2WXRA 4DXAB 1SN8A 3KLRA 5DNFA 4L5SA 3SGIA 2C7NB 2D5GA 3KJPA 1OXVA 1QVGA 1FIQA 4ICVA 3AB9A 3A54A 1NI3A 2VW9A 1M1KC 3ZJUA 4FXDA 2G1EA 1H9KA 2L7RA 2EYLA 5D6JB 1OO9B 1EUVB 1EOTA 2DX5B 3P42A 5C4HA 4MTNA 1ZXHA 3T51B 3G71A 1SROA 1P3QU 2JPHA 2IGDA 1XF5L 1HE8A 1SJHD 5LXHA 1V81A 1LLRD 4NXMQ 3NBIA 2WXPA 2BPSA 1BF4A 4DV1L 3C19A 1J5EL 2F03A 1WX8A 1VQFA 3P7JA 3HOZH 5KIXA 2K5HA 2K22A 1NR2A 3A1QB 1IYFA 3NTHA 1BNZA 4IJLA 4DAPA 4LF9L 1F0ZA 4GU2A 1WXAA 5D65A 1CSPA 4M8AA 5FK9C 2D07B 1VQJA 4CJ1B 2RSNA 4MH0E 5EKKA 3A5ZB 1EQVA 3V60A 1YIWA 2QHOA 3IT4B 4BKGA 4K5WA 3D4WA 2KVZA 1UBQA 2MUYA 4JI3Q 5BMHA 1L2NA 4LF6L 2F0KA 1LTRD 1UE5A 3B2FA 1XQQA 5G55A 1MKHA 2PZTA 1VQ9A 5AUKA 3PCOB 3RFZB 4YHHQ 4Y7NH 2DY7A 4K3CA 1BT0A 3A5UA 4O0AA 3KDFA 4C3IH 2B8GA 4C2MB 1XLOA 3L2PA 3EVQA 5IT9E 1STHA 1VQAA 2B63H 5LMNL 3AEFB 1ZGUB 3I56A 3HOVG 5L95C 5CMDA 1NVID 2E74C 4IZ8A 5GAGC 3KQ4A 3J80i 5M5XB 2IO3B 1W3SA 4LNNA 2AWOA 2NCNA 3C1EA 5JEAJ 4L1BA 2LGYA 1LACA 1PA6A 1HQMC 1T3QA 3OTOQ 1YIJA 1E0ZA 1FD6A 1UGMA 4POFA 2M8SA 5C3EB 1ONLA 3ZNGC 1J0GA 3PIOA 5DPTA 4EOYA 1EIGA 4ZK9B 3Q8DA 2IY0B 4W9EA 2L00B 3BWUD 4IUPA 4R4CA 2QDLA 3KLSX 4KMUC 4C1NI 3KOJA 1STEA 1UZXB 1BDOA 1KFYB 4MGZE 2GBNA 2JXMB 2Z4IA 3AQQA 3D0FA 2JRHA 3SR1A 4NQLB 3UQAA 4IURA 4NJCA 2O4XA 5EE3A 2NMQA 2N9PC 2MQJA 4GLXA 1E1OA 1JC7A 1PMRA 1U4PA 3GTQH 3MXNB 1SYCA 4EX5A 2UU9L 1V9PA 4DR1Q 1HH2P 3M3YB 4RF0A 2INCC 4JBMA 4A3LG 3RNBC 3F2BA 2CKZB 2FCNA 1JJ2A 4F8MA 4GDKB 3JC66 4IDIA 3A0JA 2FUHB 5JVH3 4II2B 1V49A 2HDMA 2DHZA 1PDQA 3LWEA 2E2IH 4KHPQ 3VTWA 3J81c 2FHTA 2WKCA 4ZQ3A 3CCJA 1VQ8A 1UBIA 2XGTA 4DR6L 1QQRA 5DLQE 4G4KA 3PO3H 2RHSB 2KFKA 4ZHPA 4NKLA 3WANA 4A76A 1CM9A 4KKSA 1EEID 2JEAI 3MEFA 4IQZA 1D1KA 2VS1A 2JSVX 4IG7B 4TUUA 3TEXA 2E2JB 3CF6E 3VXWA 1OTCA 1TWCH 2KKCA 5IN7A 1PTOH 3KLWA 2D3CA 3A9JB 4NPNA 2WXFA 4BXXG 3L0WB 3HOWG 2R92H 1U4RA 4LNKA 1XNRQ 4HXDA 4AJYB 1FJGQ 3Q8FA 1R9TB 2MBQA 1RTOA 3U58A 4TV3A 3R3OA 3TRZA 4X64L 4F7ZA 2E2DC 3D6CA 3APCA 4JPSA 2Z6BA 1GNUA 3CAMA 4JI2Q 1YN4A 3NHEB 2V4LA 1XPOA 1D7QA 4X57B 1YVCA 4AYBB 1GHKA 3CCRA 2IHEA 2NN6I 4R4QA 1CHPD 4A3KB 1TKYA 4YCWA 2VRRB 3A9KA 3EUB2 3PO2G 2KDBA 5HG2A 3U2SC 2Y0SG 4DR2Q 1X3EA 4WH4A 3N1XC 4YTMB 1TU2B 2WXOA 1DOMA 4YCUA 3AMUA 4QIWE 2BS2B 1OEYA 1PTOD 4A3GB 4WQMA 1VMCA 4WJWA 4WIPA 1KOTA 4J15A 3UDGA 2W55A 2K0PA 3S2AA 5JHBA 2CWAA 1H9SA 4P75A 2PEAA 3O65B 1OXXK 1HR0L 2ZJQA 4PNYA 4C56C 4A93B 3JYUA 1NBFC 4M02A 2JU6X 1PFSA 4A6QA 1B3QA 3H3VI 4R8NA 1YQ4B 2HD5B 1XT9B 2N9XA 4FXCA 5D2MB 4TKNA 5BMGA 1WX7A 3VH4B 1YNNC 1IYVA 3AEEB 3K5OA 1WTXA 2B2VA 2Q2IA 4DV5L 1WY8A 4HPMB 1Y14B 3K59A 5G5GA 4IFDG 2J7ZA 5C3XA 2NB0A 4C3JB 1IBKQ 4NQKE 1Q1EA 1UAPA 2KEDA 1T0QC 2N88A 2SNSA 5C3WA 3DHGC 2D9UA 1HTOA 2NVQH 1MFWA 2W3SA 2WX0A 4YY3L 3CWIA 1WGRA 2M9VA 2EYHA 2Q2HA 4ZKCB 2FUG1 1IHZA 3WALA 1QCBD 1XJVA 2H1EA 4XTCS 1RJTA 4JVZA 2MJ8A 3SK5A 4ACFA 2HCIA 4RKBA 4J1MA 1SFOH 4PYUA 3E9SA 4IPGA 1VQ4A 2D2CC 2KHJA 4OZAA 2L83A 1D5XC 3LYYA 3KYDD 2CU3A 3Q6SA 3CMMB 2BA1A 2MJEA 1P98A 4GLVB 5JPMC 2SEBD 1A3TA 4X65Q 4A3JB 1VRAB 1XD3B 2G4DB 2WHIA 3VR6A 4BFRA 2JA7H 4PMBA 2XVSA 1UE1A 3GTLH 1LFDA 2UU7A 3Q8AA 1R4MB 3H0GG 2R2OA 4GDLA 1F2ZA 3DPDA 4MSQB 3Q69A 4DR3Q 4OZBA 3NBHA 4A3MB 2RR9A 2B2WA 1DGSA 2OCEA 4AOFA 5M3FH 1P16A 5FLMG 1GHJA 1YZ6A 2R6GA 4OO1H 2JQOA 5GAEC 1IKMA 2EKEC 1IP9A 4UY8C 1K50A 2F0IA 3UIOB 5BO4B 4A20A 1UF0A 1CT1D 2HDLA 1HRJA 4RCOA 3K5MA 3H7PA 2LXCA 4GNXA 1K53A 1KLGD 3UDIA 3B08A 3W9CB 1BCPB 1Q8IA 5HURA 2K01A 1KM7A 1MG8A 2HQLA 5G3LF 3ML9A 3JW0X 1B53A 3D6WA 5CV8A 1TGZB 3KF8B 1FRDA 3S2DB 4HLEA 2KBNA 2LHDA 3E0EA 1NMGA 3EQLC 4ZKBB 1JQYD 1D4BA 1U9RA 1Q81C 3PHXB 1PGBA 1VQLA 2KWUB 4QJFA 2BDOA 2JA8H 1HA5A 2Z0DB 4ITKA 1WE7A 1VQKA 2WXQA 1A8VA 2PW9A 3AM9A 4GSWA 2GVAA 3NUHB 4D2KA 1FVIA 1VQHA 1Y1WH 4RH6A 1M90C 2PKOA 2M2LA 5A35A 4JV5Q 4JIOU 2WS3B 5AFWA 5HKHA 1A2TA 4I7AA 1E7ZA 2IT1A 2XNAC 3I3CA 3F2CA 1STNA 1KAWA 4V190 5CYUA 4JPBW 2KO3A 4K8IA 3DVNV 3OJ4B 2OF1A 1BR9A 2Y0SE 4MNOA 2EJFC 2GOWA 1DOKA 3WAOA 4B3SL 1FMAD 3HGBA 4CJ2C 2K39A 2VZKD 1I4HA 4AQYL 1PZJD 2DZMA 3K9OB 3ERSX 4IUTA 2VUMG 3V6EB 4KDLB 2FCQA 4XDXA 1SNCA 3S1MB 4RM9A 5CHVC 2FIFA 2BQQA 1B44D 4LLGM 4W9DA 4QIWB 1SYFA 2DYOA 4IW0A 3WOFA 4KX6B 4EEWA 1LQBA 3IAYA 1VQNA 2LGIA 1JMCA 1N5WA 1QOBA 5I4DA 4BS9A 3K6OA 1KQSA 3KW5B 1KTKA 4RA8A 5JPNC 2A6HD 4BBRG 5IE8A 2HT1A 1EZ8A 2X69A 4JYAQ 4C7ZA 5HY6A 3N6RA 4HSPA 2UXCQ 4Y7NB 3I55A 4LF5Q 3VA7A 1AARA 3J81j 4XX5A 4K2KA 3P20A 4XT1B 3MAQA 1AFPA 2Z59B 2R7FA 1H9MA 1Y1VG 1S40A 2DZIA 3L7ZC 4BOZB 3K7AB 4IUMB 1PZID 2WINB 3E3XA 4DV0Q 4DV6L 2KWDA 5CTRC 2L15A 3VUWA 1U5KA 3SEBA 3JSVA 3PRMB 2CVRA 1JE4A 2IO1B 1KD1C 3M4QA 4JI8Q 5C1ZA 2O6VD 1EYCA 3A56A 4A3FH 1CZGA 3Q22A 3P1MA 1P0RA 2PE9A 1JICA 2PO4A 1XLQA 5EE0A 1FR3A 1C9OA 5JEAH 1R4QB 1L1OC 2KN4A 4LFCQ 3ZUNA 3BYTB 1FXTB 1EQRA 4O1NA 2ZPYA 4DWFA 5EDSA 1WZ0A 1I50H 3DBRB 2EYPA 2BKFA 3U4VA 3JAML 3GTPH 1TWFH 4NJ6A 2G9DA 3GTGH 3TP6A 3KH0A 5LMUL 2BF8B 3RNCC 1PRTD 2BOSA 1RM6C 1S1QB 1SIFA 2DZJA 2I2YA 1SE3A 3NENA 1OEYJ 5EPKA 1I4XA 3QIJA 5BN5A 1N62A 2LKVA 2R7DA 1D2BA 1TS3A 4YT0B 4L23A 2F0EA 4IM3A 4GOPC 2PTLA 2WGSA 5BR8Q 4DBGA 3P2BA 1LABA 4HIMA 4XE0A 1T0YA 1DOLA 2BWES 3PQIA 4LUOA 3EHVA 4P16A 4B3ML 2NTTA 5HI1A 4EQ5A 5CC4A 2BGFA 4B9WA 2JA5B 3DBHB 5ELBA 1TWCB 1WTQA 4FXKC 1EY0A 3CF5A 4OVUA 3RD2A 3X3NA 4LDTD 4G57A 4BAXA 1JMLA 3ZXRA 1YJJA 4BKTA 4QF4A 2M56B 1EWYC 1K0RA 1XPUA 1NY4A 1JORA 4KIKB 3ZNHB 1EY4A 2UXBL 4ZUJA 1MHHE 3HRDD 3A7AB 1XNQQ 5FOBB 1Z6HA 5C4XH 2PVGC 1KRHA 4R4OA 1CKMA 4OGQC 2KYWA 4LW1A 2KK8A 4JLCA 3AE8B 2CHZA 5EQ0A 3DLLA 1GUSA 2LEKA 1EYAA 1K8OA 2DBYA 5LMNW 3P63A 1MSGA 3KBGA 1YNXA 3CCEA 3L54A 1WF9A 1EQTA 3GO5A 3BDLA 1I5FA 1WD1A 1NE3A 1PLFA 3SE0A 1E8XA 4IM0A 3DUZA 2WV6D 3AU5A 2N1VA 2F0SA 2PPBC 1ZPSA 4PT5A 1D3ZA 2WB1E 4KN4C 4WFN3 1TR5A 4B3TL 1GO3E 3IT6B 1S4ZA 2ATWA 3HKZE 2XK5B 4RGOS 2XRQD 3L9AX 4YTPB 3RZFA 3ABVB 4ALPA 2WFWA 1Q3LA 2JXTA 1QOHA 4XYQA 3V61A 3GTMB 2F0DA 2IX3A 2PMZB 1CKNA 5FLXc 4W9GA 2H4OA 1KNAA 2X6GA 4RG1A 1A63A 4UAIA 2MA9B 4G7HC 4DDGD 2EMTA 1E2ZA 1JWAD 2K8HA 1RD9D 4N59A 3HRZC 3GZNI 4JI0Q 1STYA 5C3EG 1FPYA 1SGHA 2AL3A 1IBML 4ZOHC 1HNZL 1GC7A 2K14A 3S14H 4DKAC 3J81i 1QILA 2AMCB 4YIJA 2D62A 1YN3A 2DLBA 1JB7A 1IBLQ 3P4SB 3G4SA 1Q90A 5F2DA 4JI6Q 2B76B 2LY7A 2NZ1D 1EQQA 3AXCA 1IXRA 4N58A 3MTNB 4DR7Q 2AKWB 3CRLC 2X8XX 3DCGA 2I1JA 3S1NB 1K9MC 2EVBA 3H09A 2MSED 4CJ0B 3I72A 2WKDA 1F1HA 4PZ8A 1VQPA 2KT7A 2OEOA 1TKEA 4RCNA 3GS2A 2EY5A 3UDXA 3PZ8A 4ANWA 4JG2A 1Q46A 4KJNA 2O6VA 2Z0EB 3T3NA 2OTLA 4NAWA 5C44H 1D5MC 1WGGA 2MBBB 2UUAQ 1TXYA 3D32A 4IPCA 2JQRB 1TIFA 3FDTA 2MP2B 4LJPB 1UWXA 4Q2JA 3KYHC 3I4MH 1ZYRC 2IBIB 2L12A 1WTVA 4EE2A 1SE2A 4M8MA 2E76C 4ZCKA 3W1GA 1GOZA 2R61A 2V4IB 2Q2TA 2LGXA 4N9F4 2DJGC 3AEGB 4JCVE 3NZ3A 1GUAB 4GOCA 4E71A 1SNDA 3GTKB 4K7WA 1I4QA 1LTAD 5MPOA 3CW2C 1FEHA 4P73A 1ASYA 1NMFA 2HIVA 2KWCA 2LRWA 2PW7A 3VRAB 4HK2A 3JAMc 1WI0A 4HRSA 5L83A 2WAQB 2V4DA 3I4OA 1CZPA 2MHVA 4F88A 4HKZE 1QKZA 4ASWC 3GQBA 1EEFD 4O2DA 2DWQA 1G91A 1EY7A 3A4SC 1F2YA 1SAPA 4E3CA 3NP8A 2L3ZA 3O13A 4AYBG 2PI2A 3CXCA 3HHMA 3IFTA 4QMGA 4A3KG 5IWAL 2JY6A 4B3RL 3RZWC 2D5DA 1JE5A 1HR0W 1OGWA 1GXDC 3TP8A 4EGVA 1NENB 2EJGC 2Q2UA 4ABNA 3M95A 4IM2A 1N32Q 3ZNZB 4A3GG 5JVG3 1X54A 5M3MH 3APDA 4ZRZA 4MJSA 5IP4D 3T1YL 5IYCG 4IPDA 1XYIA 2AX5A 2WXHA 5HHDG 2L52A 5IP9H 5D3IB 4H44C 3B6YA 4P72A 1WTRA 4CDFC 1ILPA 2NPTA 1ENAA 2E2HH 4KK7A 2K6DB 2L76A 1G6ZA 3ALBA 4QB4A 4A93G 3NG0A 2ICIA 2INPE 1B70B 3AU7A 2KUMA 5EBCA 3M85A 4YXDB 1XMOL 2YTVA 4CKEA 5C0XG 2B2TC 4G50A 1E8YA 4DAYA 1BOSA 4ZYSA 4DV1Q 2BS3B 1MHXA 2XWJB 4GXBA 2X38A 1RRBA 1TS2A 1PH8A 1DJRD 1KAAA 1PRTC 4H2AA 1V80A 4FA6A 2JA6B 1GUWA 3I3TB 4LF9Q 4JWSC 3KUCB 4C3JG 3KF6A 2B2UC 5K36G 5G5HA 5KNCA 5L37A 2L0CA 2WLBA 1PYBA 1A6XA 3TREA 2H89B 2WDRB 2GBMA 5KRUA 4L6TB 2JF5A 4FADA 2NR2A 1C4QA 3HP3A 3I4NH 4LF6Q 5DM73 2WB1B 5FO8B 4F87A 4KKIA 2F3IA 3HKZB 2JA9A 1X9NA 2AL6A 4OO1I 4LF8L 3MC8A 3T3OA 1UUPA 4X3TA 2NVTH 2A6EC 1EY6A 3NS8A 4FVMA 4G0NB 1XCQL 1B9NA 2K25A 1RHPA 2L9HA 3NS1A 4KN7C 5LMNQ 4YWLA 2O2LD 1MJEA 4ODGA 1WYWB 4OONA 2UWQA 3PO0A 1TY2A 4X3SA 3BY4B 3J9CA 4MDKE 5E1FA 3P4QB 4A3IB 4A3JG 4WJPA 4DHZB 4QY7A 3SR6A 5T1IA 3SDZA 4GN5A 1E24A 1X6OA 3QC8B 1QG7A 1L4ZB 2N55A 1NYQA 1BCPF 1XPRA 4PQXA 5IYBH 4ILWA 3PUWA 3TJPA 3GTJH 1S3SG 4A3MG 1QOFA 2LGDA 4F7XA 4IFDJ 3PRZA 2WDVB 3RZOH 5FO9B 1WD0A 5EKLA 1L0XB 3STBC 3X23A 1FD7D 3H94A 5DM63 1C76A 5BYQA 3AU4A 1T9HA 2BE5D 2ENBA 5IGFA 3NK9A 2RA4A 4CHTB 1GM5A 3PTFC 4LNIA 2F3VA 2QW7A 4OWTB 2D3BA 2K52A 3I63C 1TTNA 1PZKD 1S5DD 3I9V1 3KVFB 4GLSC 2BDNA 1TWFB 3GTPB 3C8YA 3MHZA 3TMPB 5T8IA 3CC4A 4GMVA 2K8CA 4KZCA 4BBSH 2GLSA 3HOUB 1K73C 2FMMA 2LMCB 3PRPB 2A73B 4P2CB 3RUIB 3DVGY 1EU3A 3TP7A 4R9WA 4CGYB 4DR6Q 1WXVA 2WWZA 3CC7A 4KTAA 1HTLD 1SRUA 2N7JA 1YNND 2UUCL 4HJKA 1TWAH 3J81E 3H6MA 2NYZD 5HGTA 1DGJA 2L1BA 5IOIA 3RNGC 3T16A 4DAYB 3BVMA 3T4AC 1V5OA 1WX9A 4W9CA 2K5NA 4DV2L 3Q8EA 3NJTA 3RNEC 2W82A 2J7QB 5COYA 4IUQA 3MFGA 3HUIA 4EQNA 3I2ZA 5C5MA 4TRDA 2HJ8A 3UF8A 4HJAA 1VCIA 1WCMH 2MFIA 2ZXPA 3GD7A 2CR5A 4BBNF 3HFZB 3ZW3A 4K5VA 1WI5A 1WTWA 4IN3A 1TBEA 5C4XB 2M19A 2QF7A 2GBJA 1KHIA 3AEAB 2HE7A 3SK6A 3DQVA 3L10B 4IALA 2RMMA 2LASA 2B39A 4A90A 2GB1A 3RULA 2LXAA 1GUNA 3NELA 4ANXA 2IHFA 1Y8PB 4W9FA 2RPQA 3TSSA 1JALA 4M0WA 2A8VA 1SEBD 2IL8A 3CMEA 1Q12A 4AIMA 3A33B 1S72A 2FJ2A 3VTVA 2NVYB 4XQJA 1HR0Q 1HZ5A 1LM0A 3PUYA 4C1NK 4ZRIA 1T5XD 4KGRA 3CIRB 4RGMA 3KJOA 1I35A 1RFAA 4HN7A 2BWFA 2VB3X 2CQAA 4JE3B 1QUQB 5J22A 2O2VB 4DV5Q 3M7NA 2MLBA 4NP5A 2H5XA 1YHQA 3WOEA 4HSVA 1TZOA 3ND9A 4XQNA 4IJHA 2ONQA 3SFEB 3L16A 1EU4A 1VJKA 1E7UA 1IZ6A 2X6LA 4II3B 5ELDA 4JI5L 3DEPA 2NBFA 2LUMA 4K8JA 3DHHC 4PMCA 5IT9L 1WIAA 1DYQA 3GV3A 4Y52H 4WWMA 4OIJA 2KJXA 4PYZA 4ZHOA 4BVUC 3RLOA 2LJIA 1YHBA 3E0JA 4HIOA 2PNHA 5AEKB 4YL8A 1A62A 4OHJA 3BZCA 3V96A 5KYLA 3QA8A 2VY3A 1I6HH 2MEKA 2WACA 1C4AA 1D6EC 1H4RA 1WM2A 1WMHA 3A8IE 3ECIA 2IY1B 1WGHA 1UGJA 4TSSA 5C44B 1FXAA 5DCNA 2BKRB 4ICUA 3GE3C 1A2UA 4XT3B 1C7YA 2I0QA 5GROA 3X3MA 3V3XA 4DV4L 2LI5A 1E3PA 4OWXB 2PQAA 2E3TA 4KGSA 3NVWA 3I8ZA 4WJ4A 2REXA 3DHQA 3IKJA 3NWSA 3L4PA 2ZM6L 2E75C 5DPWA 3S1RB 2RDBC 1E6EB 2LFNA 2JA5G 5E4XA 2DNCA 4HMIA 3WAPA 2LVQA 4YWKA 1TIID 2J53A 1AH9A 4EQOA 3AECB 4L2YA 1IGCA 1YJNA 2KFJA 3HVZA 5EJWA 1VQGA 1B3AA 5ELOA 2HTME 4MACA 3C46A 2MCNB 3D4DA 3CSFA 4I7ZC 2KLGA 1E7PB 1IYUA 2KQ3A 5TSSA 3TEHB 3SVMA 4M8NA 1JQ4A 4JI1L 3I7FA 4S0RA 1NR4A 3IFWB 1E1TA 3I91A 1KLUD 4MZ9A 2O5IC 2BT6A 4TMAB 2ZNVB 3LGJA 5JOBA 4A3EB 3RMKC 5C4JH 2RVLA 1L6VA 3KUPA 1EFID 4Q0FA 1U4AA 1UNSA 3HIZA 2WP8J 4HKQA 3UE0A 5AJ3L 2QCPX 2F0QA 4A3LH 4MN3A 1HNXL 4AWJA 2HTHA 1SMYC 2IO0B 4QQBX 1EWCA 2BE5C 4KHVA 1E7VA 2EY6A 3KDFB 4X3KA 3M4OB 4B3SQ 1YITA 1AZQA 1L7YA 1YQBA 1CA6A 4AQYQ 2P5ZX 3F1ZA 3NTIA 3RLNA 1WXSA 1V8CA 2EPBA 3N3KB 3MEHA 4DNIA 2IGGA 3OG5A 1A70A 2FFKB 3I4NB 1U0LA 2ZTDA 3C2PA 4BXXH 3RD4A 3HOWH 2K05A 2OXPA 1KRTA 3ULLA 2AUJD 1QWYA 2GMIC 3PREA 4W9IA 1V1OA 2HQEA 3BINA 4R4IA 4CDDC 3RZDH 3ENEA 4MELA 3TL5A 2L05A 4Q5VA 1GC6A 3AFQA 2CHXA 3E9HA 2IJ0A 3GTOB 1HA6A 1YNJD 1V6EA 1WRDB 1ZOYB 3JAMi 1L0VB 2KDEB 4WWOA 3KUDB 1C4PA 4JL9A 4YSZB 1HTQA 1N33L 3HZXA 1VQCA 1VF7A 2L11A 4UP9A 4DV6Q 1RIPA 3CMAA 1HNWL 3DBLI 3TEYA 1Y69U 3HOYB 1RLFA 2CS4A 3SHQA 3ZDTA 4US8A 5FKAC 2J52A 1U4MA 1TS5A 2JP1A 1Q82C 4PV1C 2BBCA 5IT9c 4HDOA 4YHHL 2KX3A 2I46A 5D94A 2A19A 1VR9A 2QJLA 4RHSA 2KFKB 1CUKA 4C80A 2IY5B 1YD8U 2DENB 2G45B 4FLHA 1E22A 1VDZA 4RFBA 2R93H 3QG1A 1XXGA 1CK1A 5LL6X 3QQ8B 3ZJVA 1V1PA 4A3CG 2WAQG 3VR3A 1EWIA 2VZAA 1QF6A 1E2WA 4NNJB 3U4EG 2DNFA 3AE7B 3VYTA 4LFAL 1PYWD 2YVCA 2L5TA 1EIHA 4MH8A 2KNBA 3NUCA 1TVXA 4HR7B 4RWSC 5D3DA 4XWTA 3G6EA 3I4LA 5LMUQ 4JBKA 2N49A 3S17B 3FILA 3LDZE 1MBYA 3PGZA 1RKNA 2VXWA 2F4VL 4NAMA 1CHQD 1OQYA 4GN3B 1X3QA 4UP7A 1DONA 1S5FD 1BCPC 3S9WA 2KJHB 5IO9A 1K28A 4LF7L 2R3ZA 3HVDA 2K50A 2RBMA 4NPSA 4LFBL 3NQIA 4FF2A 1KNEA 2KHIA 4KY5A 4MGIE 1FNWA 1N61A 2ZCBA 3A9KB 1K83H 1XCTL 3NPPA 3PLUA 1EY9A 3PSEB 3PMFA 4LUZA 4FF3A 1TWAB 2JZZA 2E8GA 3BU2A 1BBXC 1N34L 1YJIA 4B3MQ 4TQ1A 4YSXB 1V5TA 5DEHA 4BA1I 2L8JA 3AV8A 2KQ4X 4P74A 4B6WA 4RNAA 2BYEA 5LLIA 2UYZB 3J80L 4BY1H 2Q5WD 1EYGA 5K5PA 1H9SB 3FEWX 2TMPA 4XZ4A 4FBJB 2C7HA 2EZVA 1S5CD 2XIWA 1HZ9A 1TT2A 2F0VA 4DAMA 1F9RA 4KHPL 2AWNA 2UXBQ 2D3GA 3EECA 2B3GA 4ULLA 4KKUA 2JA6G 2KC1A 4REZA 5EPLA 2HHHL 2RSOA 3H0GH 4L5TA 3NRZA 1J19A 3RN9C 3IBEA 1PH3A 4DNRB 2CH4A 2PNRC 3PS6A 3DWQA 5I9OA 3H15A 5G2NA 5M5WH 4NJ7A 1SSOA 5GMVA 1O7LA 2V1YA 3PIPA 2Z8LA 1C78A 5FLMH 3MWYW 2WB1G 4H7BA 4FF1A 5JZEB 2KQSA 3FKYA 3HKZG 4YWGG 2PMZE 1TWGH 2KCNA 4LAAA 4B3TQ 1NBWA 1ZYRD 3NVVA 3HOZB 4C4VA 4APVA 3JVZX 2JX5A 1L1OA 4JOIC 5KEEA 4QUFA 3V05A 4WORA 2AQ1B 5KNBA 2IX1A 1V86A 2GI9A 2MNAA 1ESRA 3D31A 5JAVA 4BBNC 4DR4L 5DPSA 3TQYA 4IWOA 1PQSA 3SDLC 2BA0A 4A3IG 1SYBA 3FKIH 2AHOB 4L5RC 2Z4HA 3ZTDA 1E0BA 2LFIA 3VRBB 5FLXE 1ACCA 3AN1A 5C0XJ 4DUZL 3PSIA 1PH7A 1JT8A 5IYDG 1NEKB 1IBMQ 2K75A 4I6PA 1HNZQ 1TYGB 4OVZA 4PK1A 4C3IB 4GOPA 3AEBB 2AQ3B 5IGCA 2B63B 2KCTA 4QGUA 4OEMB 1K8RB 3VHTC 1FCLA 2EXZA 4XDCA 4XWWA 5JEAG 4GDLB 3URYA 1Q1BA 4EVOA 4LMQD 4FJZA 3NBHB 2SNMA 3BZKA 2KHSA 2KTRA 2RF4A 4JGHB 1GAQB 3I70A 1DCZA 4OL7A 4DK0A 1WR1A 1N36L 1B1ZA 1F77A 1F2MA 1I6HB 1XWEA 4RGTA 5EBDA 3ZYYX 3J7ZC 2VUMH 2PVOD 3RCZA 4XIGS 1WFQA 3S2HH 4X62L 4I65A 3HOUG 2DYBA 1V97A 1IBKL 2FMCA 4DV7L 3H7PB 5M9OA 1F9JA 1YJ9A 4GNXB 4X66L 1IKLA 1K8AC 1R7SA 1WM3A 3CCUA 4G7ZC 1WWTA 2N9EB 3DVGX 4HCSA 5ELFA 1EIYB 3K5NA 1N60A 2I1KA 3L13A 5JJZA 1WXMA 2ON8A 2F0HA 1QZEA 1HFNA 1F2RC 2FBWB 2KXJA 4BBRH 2ES2A 2WAQE 1CQVA 5G3LD 3GE8C 1KDBA 3GTQB 1SMXA 1M94A 1MPEA 3CQZH 1DZ1A 1GD7A 1EF1A 1IBXA 3E56A 1PHJA 2EYJA 1Y1VH 5AUIA 5EAYA 3CPFA 4DHJD 2JEBI 2E2IB 3EBEA 3VDYA 3MP9A 1TT5B 3SK8A 3S15H 3GZNB 3F8TA 2CJNA 3PO3B 3Q6BA 4X65L 4A3BH 2RDGA 1YNJC 2MGSA 2F0NA 3JAME 1KXLA 1QVCA 1ROEA 2MH7A 3B1LX 2G3QB 2N7DA 3WA0A 1T0SC 1HZCA 5C4XG 2A6ED 1VS0A 5IWAQ 2OQKA 3BS1A 1X1MA 3GDEA 1BKBA 3HK0A 4FHJA 4B3RQ 5FJ8G 3CCQA 3E9IA 1AE2A 2D11A 2J0JA 4K0KL 2LZ6A 1VQDA 4YTNB 3OOCA 1PTOB 4CYEA 4AUQC 1L1OB 4JBWA 4MIUA 1C9FA 2I5LX 2R92B 1WZ3A 5E6PA 2B8FA 3RPFC 2K1FA 4RGNA 3HS0C 4B95A 4YCVA 4DR5L 5GQOA 3T1YQ 4KKJA 4M01A 5AZGA 1X55A 4MSMB 3NOBA 1LTGD 2D2QA 4IOIE 1J6QA 3J80c 5H92C 2K4KA 1TKWB 3OMGA 4BY7H 2OJRA 1HZ6A 1UWMA 5C4JB 4G11A 4FP5D 1EUJA 1QT9A 5EPJA 1I4PA 3VVWB 1QZGA 3OWEB 4DUYL 1XMOQ 2RPVA 1AP0A 1TQOA 4LUVA 2UXDL 2AWTA 3RMHA 1TKGA 5IOCA 1YI2A 3STBD 2LD9A 3GB1A 5EE9A 4GKKL 2BH2A 2PQEA 2F0WA 4P71A 1GUTA 2NBWB 5GADC 1UEBA 3X0WA 4A55A 1HPCA 3ULPA 3U9OA 1FL0A 2QA4A 1VD2A 2RDFA 1JRUA 2KD0A 1FFUA 4RMAA 3JSVB 4ANUA 3AEDB 2J0MA 1VZ8A 2WXNA 4PZ7A 2EELA 3M7GA 1O80A 2EKIA 2Z6KC 5JJKA 1WRIA 1V8QA 1MI2A 2LWPA 1CI3M 4LF8Q 1R4NI 1H9RA 3PF4A 2GBRA 1FXIA 1G8ZD 3CCLA 2PJHA 4JQWC 2M0AA 4J3OD 4DHZE 2WP9B 2HUGA 1Q8KA 1SYDA 1OXUA 2NN6G 3T8MA 1B9MA 2Q8RE 1M8AA 1AZPA 1FRRA 5TR5A 3ITPA 3AE4B 4IUVA 4M1UB 3DM1A 5C44G 3EFCA 3ICEA 3TZUA 3S16H 3DWMA 2NVQB 3S24A 4HJ8A 3AE1B 2M1MA 2KDFB 5IP7H 1CMXB 3PIO3 1IBXB 4LK1C 3J7A5 2KHWB 1YN5A 2NZHA 2PI2E 1F2RI 4FNFA 4N8FA 1MG4A 1SFOB 1VQ5A 3VR4A 1SNOA 4EZKA 1P1AA 1V9JA 4MGYE 2C60A 5C6AA 3PGEA 1D5ZC 3V2TA 2AYOB 4RHRA 1E10A 3HM6X 2B2YC 4H13C 1MJDA 3H1UA 1HFGA 5IODA 2L55A 2QEJC 5M5XH 4G7OC 3IXSA 1U4LA 4HJGE 3J7YW 2WXIA 2JA7B 3APFA 3G6JB 3GTLB 1K52A 3EFXD 2KX0A 5C3EH 1QJOA 2VNUD 2B2TA 5IGEA 3WIMA 3WAMA 1STAA 5KNDA 1PH6A 3EA6A 3NY5A 3BZDB 3MTSA 4HIDA 1HQRD 5M3FB 1LM8B 3RYTA 3ZXVA 3EIVA 2EE1A 2CW0D 1VQ6A 2JWUA 5C3JB 2LHEA 3CHBD 1I94L 1I4GA 2LS01 1Z47A 1JJCB 2B2UA 2BH8A 3D8GA 3FP9A 1RF2D 4AH6A 2UUCQ 3VTUA 2WU2B 3VYSA 1UEAB 1Y56A 3MJ5A 2KC2A 2FXQA 2LUEA 2BTEA 3UDFA 3ETRA 4A3EG 4KDIC 2ALYB 4CKCA 4ARCA 5IP9G 1BVSA 1WTPA 4CBVA 3M3YH 4HEA1 4FO2A 5EKIA 1NUCA 4XDDA 4JWUC 2CKHB 4A3PA 3TP5A 2EY2A 3PUZA 3AE2B 3Q24A 4HDQA 4LTUA 4AJWA 1PFMA 4BY1B 5ELCA 2VZKB 5E3FA 1KJTA 4P6VF 1O7ZA 2EYOA 2MJ3A 3Q3OC 2GBKA 4X3UA 4GN4B 2ZT9C 2KQ7A 3VR5A 1ET6A 2JA8B 1CKNB 2F0PA 1LT3D 1H8CA 3OMCA 3U7ZA 1BO0A 3C1FA 2EQSA 2OTJA 1PVOA 2N3SA 1N8RC 1PFBA 2CCZA 4K5XA 2W54A 2FE8A 1Y1WB 5A2QE 2ZPNA 2BW2A 5M5WB 4JBJA 2M17A 3ZTCA 3BDCA 3I4NG 3QARA 1PYSB 1IL2A 3A8KE 1J5EQ 4HWIB 5EE1A 1J8IA 4A3DH 1R9TH 3ND8A 1LTBD 4CO7A 4HEDA 3PUVA 1P7EA 3R66C 4ZYNA 4LK0M 2CH4W 4OELB 4IFDI 1T5EA 4A3KH 5J39A 2K04A 1QVFA 1EF5A 3QX1A 2CHBD 4OWWB 2VH1A 3AB5A 3AE5B 3UE1A 3PHWB 2JT4B 2Y3AA 4JI4L 2G4SA 1FNUA 2E5LL 2K3UA 1ZE3D 3BYYB 4GKJL 1BQQT 4NW2A 3FKIB 3HOYG 1B2TA 2DNEA 4NDXA 2O6VB 3HG9A 3EJIA 4A3GH 4NAWB 4W9LA 3U8ZA 2R7ZH 2F4IA 2IDYA 1WE6A 4RMFA 1WFYA 4K1RB 2RHQB 2MWSB 5AZFA 3ERQA 3EFUA 4FXGC 2VQEL 4JI5Q 3Q8BA 5IYBG 2NVXH 3N1ZC 4WRDA 5ELNA 4I6LB 4XC2A 2EMSA 1F2LA 1BBUA 2KOXA 1X56A 1PGAA 3BIID 1MHWC 3HEJA 2K5WA 1C8CA 4OX9L 2PLPA 1ZW7A 3SU8X 1LUZA 2B29A 5C0XH 1NAPA 3S1QH 2N8NA 1ESFA 4DK3C 2IYDB 5E6JA 1JR0D 2WX1A 1SNMA 1PRTB 3IHPC 1L0YB 3AYHB 4A3FB 2KDMA 2ZW0A 2RGFA 4JI0L 3K0XA 2WDQB 5K36H 1WR6E 2CJOA 4KKTA 2JE6I 2VB2X 1ENCA 4DN4M 1SB3C 4DV4Q 1MJCA 2WXMA 3A1QA 1LO5D 4HAEA 1SMYD 2L4NA 4JI6L 1I42A 1I3QH 1GPXA 1I50B 2ZTCA 5E7NA 3VUYA 5BMIA 2ZM6Q 2KMAA 1JJGA 2UU9Q 4CDEC 3MC0B 5C4ZA 4ME5A 3PF5A 3RLFA 3CCSA 2F0OA 3GTGB 1T6BX 4MM3B 2F0GA 2EJMA 4LDTB 4CQNA 1PH5A 1LT5D 4MJSB 1PXUA 5CGKA 1XX8A 3N1YC 4C3HH 2ACZB 4TQUS 4B08A 4FF4A 4DK5A 4EKUA 3TEWA 1D1IA 3RR5A 2NPTB 2OHFA 2UUAL 2CQOA 4A3JH 1VF5C 3S15B 2QIEB 3DM3A 1PV4A 3NVZA 2KJRA 2HDEA 2K5PA 4IOAA 4A3BB 1ICWA 1HXYD 1JWMD 1Y8OB 2C9OA 3U50C 1SNQA 2Y5BB 2VL6A 1J9OA 2K6QA 5CV7A 2BB5A 2YEPB 4WJNA 4S3SA 2ZCCA 1CQFA 3K80C 2MX2A 3IAM1 1K51A 1DOIA 1Q1OA 3DWPA 1ICFB 4JI1Q 2KMCA 3OSOA 1NNXA 2F0UA 2KVMA 3KF6B 1F52A 1MVKA 1LTSD 1Q10A 3KBXA 1PFDA 2RQXA 3DWAA 4KLKA 3AE6B 4FULA 4X64Q 2MJDA 4IWQA 4W9KA 1F9SA 3HOZG 3TIXA 4URKA 5IKCM 3PZDA 2KA7A 2VQFL 1H95A 3AE9B 4WAAA 3QWNA 3I5JC 3L3OC 4BY7B 4FYDA 3RNFC 5AJ3Q 5GAHC 1HNXQ 1ZXTA 1STBA 3CPWA 5E4WC 4DV3L 1IGDA 2Y5PA 3PLVA 1Z2MA 1KIXA 1FGBD 3Q2AC 2XBBC 3MXNA 3UI2A 3S2DH 4PS3A 2I5MX 4J6IA 4ZRJA 3FHWA 5IGGA 4KD3A 3HOXH 1GB4A 1NTGA 4AS1A 4UDUC 5AZHA 5KHOA 1XMQL 3FRPB 4GDKA 2D0OA 1VQEA 4R4TA 1I4RA 1O78A 4C3IG 1Q7YC 1WGYA 1VDVA 1DD2A 1SSNA 4BKSD 2CW0C 2JN4A 4MTKA 1UWVA 3B2GA 1LTID 2B63G 2UUBL 1OQQA 3R3MA 4F8CB 1XEEA 4NXNL 2KEEA 4L5QA 2C7MB 1SLJA 1GG3A 5IY0A 1BCPD 4GB9A 1RWSA 4NB3A 1SNPA 1ZXIA 3ONAB 1N6ZA 3G7LA 3ZLZA 3NZUA 1SE8A 3W5UB 2C35B 3A9JA 1WYGA 1JCKB 3S1MH 2PZUA 1BXTA 1QOGA 1N33Q 3S14B 1EO6A 3FMCA 4LJZC 3BVGA 1AN8A 4L8JA 2CHWA 4US9A 4YY3Q 1VQMA 1SF0A 4TQ0A 2KTFA 1AWDA 2N78A 1N63A 3S16B 1HNWQ 1MI0A 3ZJTA 4EUTA 3MXGA 3ZKJC 2ID0A 2A1AA 3DDCB 4NMZA 3TCAA 3OIQA 1PTOF 1KABA 1DOXA 3BK2A 1K3RA 1G2SA 2K5DA 3IG3A 3T53B 3H3VC 3P75A 3K7AH 2EYFA 3FPUB 2M0XA 1IW7C 1GKHA 3I4MB 4LFAQ 4R1JA 4P1BC 1WOCA 2XRSD 3PO3G 4WJ3M 5CBAE 4OVVA 4USAA 5KHQA 2YLMA 2HIXA 4EQPA 1ILQA 1H9JA 1B4OA 1AYFA 1OFFA 2F4VQ 2OOBB 4NZLB 4RM8A 2K9XA 1BMLC 2JJQA 4HCPB 4F1SA 2ASBA 4PMWA 2YV5A 2KACA 3CCMA 2F0TA 4LF7Q 3N9YC 3HOVH 1EM7A 4LF4L 3NVYA 3VR2A 4LFBQ 2R92G 1E8ZA 1E5WA 1E8WA 2PPHA 1VQOA 2FCSA 1X65A 3OAWA 3MXUA 4M00A 2WIIB 2IX0A 2YTXA 1N34Q 1FYCA 3U52E 1G291 2DJFC 1ET9A 4A3OA 3SHLA 1B7YB 2ZNVC 5FR3A 2SAKA 1FGUA 2NVUI 2W9NA 4M0WB 4MT5A 1C0AA 5BYRA 5J18A 1JRPA 1ZDXA 3DBLB 1YQ3B 2RSUA 1SDFA 2GRIA 3WCQA 5NUCA 5EGTA 3ZJYC 2KENA 4POGA 1AEXA 1HJPA 1KDCA 2XSCA 5M3MB 4JI7L 2BS4B 2HHHQ 1JOQA 3VR8B 1EZ6A 4HTHA 2E2HB 3LJ3A 1B8AA 1VMPA 2C9WB 2KVRA 3EGRA 5C2TB 2JXXA 3T1HL 2JA5H 2A69C 3TN2A 4EFOA 4OZCA 4KV2A 3VFKA 4KSKC 2D0PA 3EROA 1X3FA 2MP1A 1G2TA 2ZXOA 2JYTA 2YYZA 3VAWA 2A68C 3ZGZA 5DAUA 3VYRA 1QNUA 4A3DB 2M00A 1AW7A 2C5LC 1J7BA 2PMVA 2H88B 3KWVA 3KFUA 4DR4Q 4JC0A 1V2YA 4MGKE 1SBBB 2A4ZA 3Q3NC 1QE6A 4RAUC 2KLCA 4BKSA 3L08A 4I6NB 1ISNA 4MEMA 1LT6D 2V0GA 1UE6A 3C3LA 2IZVB 1WMHB 3OHXC 2DAJA 5IIFA 2O5JC 4TVAB 3DWGC 1M4VA 4DUZQ 1Z5SB 2V9HA 1V43A 2R7ZB 4NXML 1PUTA 2NVTB 5JHAA 3K58A 3QJYA 3KF8A 2K33A 1JOOA 1KRSA 2JK8A 2KOLA 5I2XA 2NVXB 3UGBB 1F9QA 4IPHA 3OW2A 2F0FA 4IO9A 1HHVA 2PQAB 3PVLA 3QK0A 3PO2H 1NYRA 3GTMH 2R93G 2IWHA 4QCLA 1XTDA 3KWLA 1S5BD 1C1YB 3K7UC 3G48A 1ZDVA 2OQ0A 4JI3L 1LV9A 4KY6A 5HGQA 3DXJC 2RCNA 1WVLA 2JA7G 4PG3A 4BA2I 3S1QB 5JJLA 4W9JA 2MBOA 1N36Q 5E6NA 2ZXRA 4YWMA 3KLSA 3VUXA 1VCBA 1RODA 4X62Q 4KJOA 3GP7A 3VYUA 3GTJB 4GIVA 1JB3A 1HUMA 1OXTA 2ICEC 4DV7Q 5M3FG 2JZPA 2I5HA 4X66Q 3RZOB 1L4DB 5KYIA 3BK1A 4OO1G 2ZEQA 2K6AA 4S17A 3UI3A 1EOVA 4DGZA 1TY0A 2D10A 1I3QB 3PV1A 3RT3B 3S1NH 3QWZB 2FINB 3MVVA 1LGRA 1EFWA 4IFDH 4IC7B 3OTOL 1HEZE 4GZYC 1EWHA 3OIPA 4P1CC 2IO2B 4BBSB 5T1GA 3AE3B 4MM3A 1OQRA 2DN8A 3MHBA 1GJXA 3HM3A 4JOIA 4XYCA 2FIDA 4G3XB 1X32A 2EOTA 4BY1G 4C3HB 2Q8TA 4N6EB 1RDPD 1NI2A 1W6KA 1K3BC 4OXPA 2BCOA 1WGKA 3TS0A 2JA8G 4FJYA 1FFVA 2OT2A 1YOVB 2PYKA 2DYMA 1J7AA 3GTKH 4R8IA 4DR1L 4K0KQ 1Y1WG 3CC2A 1PDXA 2B2VC 5HFYA 1IYJB 2XN9C 3C0RB 1KLVA 5H1SE 5JJIA 2DY8A 3D4RA 2LGSA 2E6XA 1MD2D 3D3RA 4A3CH 4K6DA 2YU9H 4HPPA 4EZJA 2IPKD 1GUGA 5D14A 4DNTB 3E5SA 4DR5Q 2QC8A 4LNOA 4DK6C 1FM0D 4XYOA 2LXJA 5C0XI 1WCMB 1B50A 3ER0A 2NBVB 4PZ6A 4DK1A 5I6YA 3H91A 1NCVA 3SXHA 4CKBA 5LHY1 3M63B 4NY0A 5CV6A 3NQTA 1CKOA 1LTLA 2K5QA 3IVFA 4DUYQ 3J80E 1DM0B 1VZ7A 1K8MA 1KL9A 2UXDQ 5C23A 4FJVB 1G6JA 1LYLA 1PRTF 2WXKA 4JW0A 3FKIG 2MO0A 1WSPA 3RN2A 3U7DA 4B0MA 2JYOA 1WJNA 4HROA 4GKKQ 3A55A 1XNRL 3MJWA 4A4IA 3GOEA 3HOXB 2LRUA 3QR8A 1I6VC 1FJGL 3H9DA 4XGAB 5CHWA 3NEMA 4PS7A 1S3OA 3VA5A 3TMEA 1Z7TA 4GN1A 2BYTA 4JI2L 3L17A 3R2TA 3IAS1 3A4RA 3ZQ4A 1RTNA 5BYSA 4K2LA 4GGQA 1C79A 2PE6B 1O7YA 3WDNA 2QSDA 1WH3A 3CCVA 3EN2A 4DR2L 1UH6A 1KF6B 3ZNID 3AMZA 2R2QA 4KI0A 2B2WC 3K57A 4IUNA 1HCZA 2D3AA 4IUUA 1XLNA 3OLMD 1V1PB 1Z9FA 5FLXL 4A3FG 2JA6H 3DBSA 3M3JA 5LXIB 2N0SB 1IUEA 1R4MI 1MGSA 1F9PA 3LWUA 2N4FA 1ZKOA 4KIKA 2B3AA 4AP4C 5FR6A 1Y8RC 2N9KA 3FILB 4A8XC 2C5CA 1SIJA 4GNXC 2FNJB 5ISRA 2A74C 3K0YA 1Q86C 1E90A 5I6WA 1X3GA 1IL8A 2QDBA 4QUCA 2I38A 2YEPF 1A3VA 5BN3A 3U30A 3W5VB 4ARIA 1JOKA 3MA2B 1YX6B 2BB6A 3FC4A 2K28A 1A0IA 1T0RC 2OJWA 1YX5B 3NSWA 2J42A 2AQ2B 4KHZA 2KJ6A 1UELA 1P9DU 5CV4A 2SDFA 3BDOA 1YJ1A 2INNE 1IPGA 2XK5A 2M4NA 1WTHA 3OWFA 4A3IH 2G5DA 2MPMA 3R93A 3AEVA 3H6NA 4KGTA 1AE3A 4BZAA 2J0TD 1NDDA 5CBEE 4A3BG 2WU5B 2PW5A 1R4PB 1S5ED 5IYDH 2MW5A 3M4YA 5CV9A 3K9PB 3V6CB 4BOSC 2KMMA 3Q14C 3W5OA 3TBIB 3L0OA 3CSTA 3AULA 3VR9B 2QKIC 1I94Q 3Q3FA 4ZAIA 1TWHH 3HOVB 3TDQA 1R4NB 2ZZPB 4YSYB 1XLPA 1PTOC 2IGHA 2LVPA 1Q5WB 2OEDA 4KZ0A 4N9PA 1W6JA 2EDGA 1ASZA 3A8JE
chains in the Genus database with same CATH topology
2QILA 2F3WA 4KY7A 4DAVA 3R2IA 4ZRPA 3NE5B 3NTKA 1GUOA 4IKGA 1KH0A 2F0LA 4R3DA 1EYDA 3P4PB 4BWGB 3NXWA 1ZP0B 1GB1A 3W2DA 1ZEQX 4WAFA 5ELEA 5BN4A 1TJEA 2PCFB 4L63B 1DXMA 1YNTE 1EY8A 2WXGA 2L32A 1CJEA 3I57A 3FAHA 3A7LA 2NTSA 4RKLA 4KV6A 3OW7A 2B2YA 2EY1A 4B9XA 4DXFA 5IGDA 2TSSA 1LT4D 2N9LA 2F0MA 1QB5D 3FPPA 2I07B 2K1BA 5C5LA 3U9SA 4HCEA 1PFNA 3HOWB 1VLBA 1SYGA 3AH7A 3RZDB 1SXTA 4KD4A 1SJED 3W3AA 1SE4A 1SYEA 3Q8CA 3Q0AA 3PO2B 1WXQA 2Y0SB 1C77A 4MHEA 2AUKA 3QO2A 5CR3A 1OXSC 1QOAA 2K32A 1HTPA 4B0EA 3MZ5A 2A5HA 3K5LA 5IGBA 4ZRQA 3VQIA 1J7CA 3DMUA 3W1SA 1LTTD 1RFKA 4ID6A 3SFDB 3IL8A 2R93B 1B9RA 3NHHA 3PZ7A 3NWTA 4ZLTF 3LNNA 3I90A 3F2UA 4DF7A 2NN6H 4XXEA 2IW3A 4DXGA 4HMJA 3TZDA 1JWUD 3RUZA 3IFDA 2JSOA 1JWSD 2F0JA 2RDHA 3E6ZX 1X3PA 5KGUA 2GA4B 3GV6A 2SOBA 3I73A 1JW9D 1K83B 1KDAA 4V0BA 1ML0D 2Q8IB 3FVQA 5D7GA 2K7VA 1YMHE 1P7FA 2EYMA 1JROA 1WTOA 2A6HC 2HCCA 3QOLA 2YU9B 2Z1CA 4DQOC 1C4CA 5CV5A 3H0GB 2L1AA 5J1ZA 1FNVA 2F1MA 1L5PA 5GXGB 1HUNA 1XO3A 1A15A 5A2QL 1TWGB 2V3NA 1IW7D 1N5XA 2PIAA 4J8QA 4DFAA 3LX0A 2LMCA 3J7AV 1FO4A 5LNK1 3MXPA 3R8BA 2W3RA 5H8YE 3H8HA 4WURA 2J4XA 2XWBB 3BG3A 3BVZA 4OIKA 1CTMA 4U68A 4DU9A 1II3A 2WQYB 1C48A 1RCVD 1E2VA 3TEZA 2KECA 5CORA 3CRKC 3OPOA 1CFMA 4C7YA 2NUCA 3CKIB 1QNKA 1FCCC 1QLBB 3N52A 3Q23A 4Z9CB 2WXLA 4DA2A 2WXJA 4U673 1EL0A 3TUOA 1L6UA 5I9PA 1ZUD2 1JWBD 1A3UA 2VUMB 4K14A 3J7AF 4ZUIA 3S2HB 1NSNS 1VZ6A 4AQ7A 3KK7A 2V3PA 4OW0A 1CZWA 4C3HG 2A69D 3LB8C 3QOJA 2QMTA 2JYEA 2K03A 4BBRB 2A68D 2PZWA 3LXFA 1STGA 5FO7B 3CQZB 1CA5A 3B9JA 3QB3A 4JK1C 4JX1C 4RF1A 1Y1VB 3T13A 1TWHB 1E9MA 5LL6S 1EY5A 2RKSA 4N9TA 2ZW1A 5JXVA 3PV0A 3QIAA 1DOYA 2WNMA 3SK4A 3J81L 2KAJA 3CU7A 1I7HA 2KCCA 5M5YB 4H0LC 3P4RB 1PGXA 4E6IA 4XQQA 1ENFA 2G9HD 2NWGA 4TKOB 1BUVT 4J6HA 3MFYA 1RYJA 1Y8NB 3PIP3 4O42A 3PUXA 3T56B 3DEOA 1XTCD 4K6LA 2Y5CA 1TS4A 1MSHA 3P1HA 1BUIC 4A9AA 5I2YA 2WXRA 3KLRA 5DNFA 2D5GA 1OXVA 1FIQA 3AB9A 3A54A 1NI3A 3ZJUA 4FXDA 2G1EA 1H9KA 2EYLA 1OO9B 1EOTA 3P42A 5C4HA 1ZXHA 3T51B 2IGDA 1XF5L 1SJHD 1LLRD 2WXPA 3NBIA 1BF4A 2F03A 3P7JA 5KIXA 2K22A 1NR2A 3NTHA 1BNZA 4DAPA 1F0ZA 5D65A 4M8AA 5FK9C 4CJ1B 2RSNA 5EKKA 1EQVA 3IT4B 4K5WA 3D4WA 2MUYA 5BMHA 2F0KA 1LTRD 3B2FA 2PZTA 5AUKA 3RFZB 2DY7A 4C2MB 2B8GA 1XLOA 3EVQA 5IT9E 1STHA 3AEFB 5CMDA 1NVID 2E74C 4IZ8A 3KQ4A 5M5XB 2AWOA 3C1EA 5JEAJ 4L1BA 1LACA 1HQMC 1T3QA 1FD6A 1E0ZA 5C3EB 1ONLA 1EIGA 4ZK9B 3BWUD 4IUPA 3KLSX 4KMUC 4C1NI 1STEA 1BDOA 1KFYB 2JXMB 2Z4IA 3SR1A 4IURA 4NJCA 2O4XA 5EE3A 2NMQA 1JC7A 1PMRA 1U4PA 1SYCA 3M3YB 4RF0A 4F8MA 4GDKB 4IDIA 5JVH3 2HDMA 1PDQA 3LWEA 2FHTA 2WKCA 4ZQ3A 1QQRA 4ZHPA 4G4KA 4NKLA 1CM9A 4KKSA 1EEID 2JEAI 4IQZA 1D1KA 2JSVX 3TEXA 2E2JB 1PTOH 2WXFA 1U4RA 3Q8FA 1R9TB 1RTOA 3R3OA 2E2DC 3D6CA 4JPSA 1YN4A 1GHKA 4AYBB 2NN6I 1CHPD 4A3KB 1TKYA 3EUB2 5HG2A 3U2SC 4YTMB 4WH4A 1TU2B 2WXOA 1DOMA 3AMUA 2BS2B 1PTOD 4A3GB 4WQMA 1VMCA 4WJWA 4WIPA 2W55A 2K0PA 1H9SA 1OXXK 4PNYA 4C56C 4A93B 2JU6X 4A6QA 4R8NA 1YQ4B 4FXCA 5BMGA 1YNNC 1IYVA 3AEEB 3K5OA 1WTXA 2B2VA 3K59A 5G5GA 4IFDG 2J7ZA 5C3XA 2NB0A 4C3JB 1Q1EA 1UAPA 2KEDA 2N88A 2SNSA 5C3WA 2D9UA 2W3SA 3CWIA 2M9VA 2EYHA 4ZKCB 2FUG1 1IHZA 1QCBD 2H1EA 4XTCS 1RJTA 2MJ8A 3SK5A 2HCIA 4RKBA 4J1MA 3E9SA 2D2CC 4OZAA 2L83A 1D5XC 3LYYA 2CU3A 3Q6SA 2BA1A 2MJEA 5JPMC 2SEBD 1A3TA 1VRAB 4A3JB 3VR6A 4PMBA 2XVSA 3Q8AA 1F2ZA 3Q69A 4OZBA 3NBHA 4A3MB 2B2WA 1GHJA 2R6GA 4OO1H 1IKMA 1K50A 2F0IA 1CT1D 2HDLA 1HRJA 4RCOA 3K5MA 1K53A 1KLGD 3W9CB 1BCPB 1Q8IA 5HURA 2K01A 5G3LF 1B53A 3D6WA 5CV8A 1FRDA 3S2DB 2LHDA 3EQLC 4ZKBB 1JQYD 1D4BA 1U9RA 1PGBA 2BDOA 1HA5A 4ITKA 2WXQA 2PW9A 3AM9A 3NUHB 4D2KA 4RH6A 2PKOA 2M2LA 5A35A 2WS3B 5AFWA 1A2TA 2IT1A 2XNAC 4V190 3I3CA 1STNA 5CYUA 4K8IA 2OF1A 1BR9A 2EJFC 1DOKA 1FMAD 3HGBA 4CJ2C 2VZKD 1I4HA 1PZJD 4IUTA 4XDXA 1SNCA 3S1MB 1B44D 4LLGM 4QIWB 1SYFA 2DYOA 3WOFA 4KX6B 3IAYA 2LGIA 1N5WA 1QOBA 5I4DA 4BS9A 3K6OA 4MM3B 1KTKA 4RA8A 5JPNC 2A6HD 1EZ8A 2X69A 4C7ZA 3N6RA 4HSPA 4Y7NB 3VA7A 4K2KA 3P20A 4XT1B 3MAQA 1AFPA 1H9MA 3L7ZC 3K7AB 1PZID 2WINB 2KWDA 3SEBA 2CVRA 1JE4A 1EYCA 3A56A 1CZGA 3Q22A 3P1MA 1JICA 2PO4A 1XLQA 5EE0A 1FR3A 5JEAH 1R4QB 2KN4A 3BYTB 4O1NA 2EYPA 3JAML 2G9DA 3TP6A 1PRTD 2BOSA 1RM6C 2I2YA 1SE3A 5EPKA 1I4XA 5BN5A 1N62A 2LKVA 1D2BA 1TS3A 4YT0B 4L23A 2F0EA 2PTLA 1LABA 4XE0A 1DOLA 4P16A 2NTTA 5HI1A 5CC4A 4B9WA 2JA5B 5ELBA 1TWCB 1WTQA 4FXKC 1EY0A 3X3NA 4G57A 1JMLA 1YJJA 4QF4A 2M56B 1EWYC 1JORA 1EY4A 4ZUJA 1MHHE 3HRDD 3A7AB 5FOBB 1Z6HA 2PVGC 1KRHA 4OGQC 3AE8B 5EQ0A 3P63A 1GUSA 2LEKA 1EYAA 1K8OA 2DBYA 1MSGA 3KBGA 1EQTA 3GO5A 3BDLA 1WD1A 4YWGG 3SE0A 1PLFA 3DUZA 2WV6D 2F0SA 2PPBC 1ZPSA 4PT5A 4KN4C 4WFN3 1TR5A 3IT6B 1S4ZA 4RGOS 2XRQD 3L9AX 4YTPB 3ABVB 1Q3LA 2JXTA 1QOHA 4XYQA 3GTMB 2F0DA 2IX3A 2PMZB 2H4OA 1KNAA 2X6GA 4UAIA 4G7HC 1E2ZA 1JWAD 1RD9D 4N59A 3HRZC 1STYA 4ZOHC 1QILA 4YIJA 2D62A 1YN3A 2DLBA 3P4SB 1Q90A 5F2DA 2B76B 2LY7A 2NZ1D 4N58A 3CRLC 3S1NB 2EVBA 3H09A 4CJ0B 3I72A 2WKDA 3GS2A 2OEOA 1TKEA 4RCNA 2EY5A 3PZ8A 4KJNA 3T3NA 1D5MC 2JQRB 3FDTA 4Q2JA 1UWXA 1ZYRC 2L12A 1WTVA 4EE2A 1SE2A 2E76C 2V4IB 1GOZA 2R61A 3AEGB 3NZ3A 1SNDA 3GTKB 1I4QA 1LTAD 5MPOA 1FEHA 2PW7A 4HRSA 2WAQB 2V4DA 1CZPA 2MHVA 4F88A 4HKZE 1QKZA 3GQBA 1EEFD 2DWQA 1G91A 1EY7A 1F2YA 1SAPA 3NP8A 3O13A 3IFTA 4QMGA 2D5DA 1GXDC 3TP8A 4EGVA 1NENB 2EJGC 4ABNA 5JVG3 4ZRZA 2WXHA 1XYIA 2AX5A 5HHDG 2L52A 5D3IB 4H44C 1WTRA 1ILPA 1ENAA 4KK7A 1G6ZA 4QB4A 2ICIA 2INPE 3AU7A 2KUMA 5EBCA 3M85A 4YXDB 4CKEA 5C0XG 2B2TC 4DAYA 1BOSA 4ZYSA 2BS3B 1MHXA 2XWJB 2X38A 4H2AA 1TS2A 1DJRD 1KAAA 1PRTC 2JA6B 1GUWA 4JWSC 4C3JG 2B2UC 5K36G 5G5HA 5KNCA 2L0CA 2WLBA 1A6XA 2H89B 2WDRB 5KRUA 4L6TB 1C4QA 3HP3A 5DM73 2WB1B 5FO8B 4F87A 4KKIA 3HKZB 4OO1I 3T3OA 1UUPA 4X3TA 2A6EC 1EY6A 4FVMA 1XCQL 1B9NA 1RHPA 2L9HA 3NS1A 4KN7C 2O2LD 4ODGA 3PO0A 1TY2A 4X3SA 3J9CA 5E1FA 3P4QB 4A3IB 3SR6A 5T1IA 3SDZA 1QG7A 1L4ZB 2N55A 1NYQA 1BCPF 4PQXA 4ILWA 3PUWA 1QOFA 4F7XA 4IFDJ 2WDVB 5FO9B 1WD0A 5EKLA 1L0XB 1FD7D 3H94A 5DM63 1C76A 5BYQA 2BE5D 2ENBA 5IGFA 3NK9A 2RA4A 4CHTB 2F3VA 1PZKD 1S5DD 3I9V1 4GLSC 2BDNA 1TWFB 3GTPB 3C8YA 3MHZA 5T8IA 3HOUB 2FMMA 2LMCB 2A73B 4P2CB 1EU3A 3TP7A 4R9WA 4CGYB 4KTAA 1HTLD 2N7JA 1YNND 3J81E 3H6MA 2NYZD 5HGTA 1DGJA 2L1BA 3T16A 3BVMA 3T4AC 3Q8EA 2W82A 5COYA 4IUQA 3MFGA 3HUIA 4EQNA 5C5MA 4TRDA 1VCIA 2ZXPA 3GD7A 4K5VA 1WTWA 4IN3A 5C4XB 2M19A 2QF7A 3AEAB 3SK6A 4IALA 2RMMA 2B39A 4A90A 2GB1A 1GUNA 1Y8PB 3TSSA 1JALA 4M0WA 1SEBD 2IL8A 1Q12A 2FJ2A 2NVYB 4XQJA 1HZ5A 3PUYA 4C1NK 1T5XD 4KGRA 3CIRB 4RGMA 4HN7A 2VB3X 2CQAA 4JE3B 5J22A 3M7NA 4NP5A 3WOEA 4HSVA 1TZOA 3ND9A 4XQNA 2ONQA 3SFEB 1EU4A 1VJKA 2X6LA 5ELDA 3DEPA 2NBFA 2LUMA 4K8JA 4PMCA 5IT9L 1DYQA 3GV3A 4WWMA 4OIJA 2KJXA 4ZHOA 2LJIA 3E0JA 4OHJA 3V96A 5KYLA 2MEKA 2WACA 1C4AA 1D6EC 3A8IE 1UGJA 4TSSA 5C44B 1FXAA 1A2UA 4XT3B 3X3MA 3V3XA 2E3TA 4KGSA 3NVWA 3I8ZA 3DHQA 3IKJA 3NWSA 3L4PA 2E75C 3S1RB 1E6EB 2LFNA 5E4XA 2DNCA 4HMIA 1TIID 2J53A 4EQOA 3AECB 4L2YA 1IGCA 3HVZA 5EJWA 1B3AA 2HTME 4MACA 3C46A 3D4DA 4I7ZC 1E7PB 1IYUA 2KQ3A 5TSSA 3SVMA 1JQ4A 1NR4A 3I91A 1KLUD 2O5IC 2BT6A 4TMAB 4A3EB 5JOBA 2RVLA 1L6VA 3KUPA 1EFID 4Q0FA 4HKQA 1UNSA 2WP8J 2QCPX 2F0QA 4MN3A 1SMYC 1EWCA 2BE5C 4KHVA 2EY6A 4X3KA 3M4OB 1AZQA 1CA6A 3NTIA 1V8CA 2EPBA 3MEHA 2IGGA 1A70A 2FFKB 3I4NB 3C2PA 3RD4A 2K05A 2OXPA 2AUJD 1QWYA 1V1OA 2HQEA 4Q5VA 3GTOB 2IJ0A 1HA6A 1YNJD 1ZOYB 1L0VB 1C4PA 4YSZB 3HZXA 1VF7A 2L11A 3TEYA 1Y69U 3HOYB 4US8A 5FKAC 2J52A 1U4MA 1TS5A 2JP1A 4PV1C 2BBCA 2I46A 2QJLA 1VR9A 4RHSA 4C80A 4RFBA 1VDZA 3QG1A 1XXGA 1CK1A 5LL6X 3ZJVA 1V1PA 3VR3A 1QF6A 1E2WA 3U4EG 3AE7B 3VYTA 1PYWD 2L5TA 1EIHA 4MH8A 3NUCA 1TVXA 4HR7B 4RWSC 5D3DA 4XWTA 3I4LA 3S17B 3FILA 1MBYA 1RKNA 2VXWA 4NAMA 1CHQD 1X3QA 1DONA 1S5FD 1BCPC 3S9WA 2R3ZA 3HVDA 2RBMA 3NQIA 4FF2A 1KNEA 4KY5A 1FNWA 1N61A 1XCTL 3NPPA 1EY9A 3PMFA 4FF3A 1TWAB 4YSXB 1BBXC 1YJIA 4TQ1A 5DEHA 4BA1I 3AV8A 2KQ4X 4RNAA 3J80L 2Q5WD 5K5PA 1H9SB 3FEWX 2TMPA 2EZVA 1S5CD 2XIWA 2F0VA 1TT2A 1F9RA 2AWNA 4ULLA 4KKUA 4REZA 5EPLA 3NRZA 2RSOA 4DNRB 2PNRC 3DWQA 5I9OA 1SSOA 1O7LA 2Z8LA 1C78A 3MWYW 4H7BA 4FF1A 2KCNA 4LAAA 1ZYRD 3NVVA 3HOZB 2JX5A 5KEEA 4QUFA 3V05A 4WORA 2AQ1B 5KNBA 2IX1A 2GI9A 1ESRA 3D31A 5JAVA 2BA0A 1SYBA 2Z4HA 1E0BA 2LFIA 3VRBB 5FLXE 1ACCA 3AN1A 5C0XJ 1NEKB 4OVZA 1TYGB 4C3IB 3AEBB 2AQ3B 5IGCA 2B63B 1FCLA 2EXZA 4XDCA 4XWWA 5JEAG 4GDLB 3URYA 1Q1BA 4EVOA 4LMQD 2SNMA 2KHSA 1GAQB 3I70A 1DCZA 4OL7A 4DK0A 1B1ZA 1F77A 1F2MA 1I6HB 1XWEA 4RGTA 5EBDA 3ZYYX 2PVOD 4XIGS 4I65A 1V97A 2FMCA 5M9OA 1WWTA 1IKLA 1R7SA 4G7ZC 4HCSA 5ELFA 3K5NA 1N60A 5JJZA 2ON8A 2F0HA 1HFNA 1F2RC 2FBWB 1CQVA 5G3LD 1KDBA 3GTQB 1MPEA 1DZ1A 1IBXA 3E56A 2EYJA 5AUIA 2JEBI 2E2IB 3MP9A 3SK8A 2CJNA 3PO3B 2RDGA 1YNJC 2MGSA 2F0NA 3JAME 2MH7A 1ROEA 2A6ED 3BS1A 4YTNB 3OOCA 1PTOB 4JBWA 4MIUA 1C9FA 2R92B 2B8FA 3RPFC 4RGNA 3HS0C 4KKJA 1LTGD 5H92C 4IOIE 1TKWB 3OMGA 1HZ6A 1UWMA 5C4JB 4FP5D 1QT9A 5EPJA 1I4PA 3OWEB 2RPVA 1AP0A 1TQOA 3RMHA 1TKGA 5IOCA 3GB1A 5EE9A 2PQEA 2F0WA 1GUTA 4A55A 1HPCA 3U9OA 2RDFA 1FFUA 3AEDB 1VZ8A 2WXNA 2EELA 3M7GA 1O80A 2EKIA 1WRIA 1V8QA 1MI2A 1CI3M 1H9RA 1FXIA 1G8ZD 2M0AA 4J3OD 2WP9B 2HUGA 1SYDA 1OXUA 2NN6G 1B9MA 2Q8RE 1M8AA 1AZPA 1FRRA 3ITPA 3AE4B 4IUVA 4M1UB 3DM1A 3TZUA 3DWMA 2NVQB 3AE1B 3PIO3 1IBXB 4LK1C 1YN5A 1F2RI 4FNFA 1SFOB 3VR4A 1SNOA 5C6AA 1D5ZC 3V2TA 4RHRA 1E10A 2B2YC 4H13C 1HFGA 5IODA 2L55A 2QEJC 4G7OC 3IXSA 1U4LA 4HJGE 3J7YW 2WXIA 2JA7B 3G6JB 3GTLB 1K52A 3EFXD 2VNUD 1QJOA 2B2TA 5IGEA 1STAA 5KNDA 3EA6A 3BZDB 3MTSA 1HQRD 5M3FB 2EE1A 2CW0D 2JWUA 5C3JB 2LHEA 3CHBD 1I4GA 2LS01 1Z47A 2B2UA 3D8GA 1RF2D 2WU2B 3VYSA 1UEAB 1Y56A 3MJ5A 2BTEA 3ETRA 4CKCA 4ARCA 1WTPA 4CBVA 4HEA1 4FO2A 5EKIA 1NUCA 4XDDA 4JWUC 3TP5A 2EY2A 3PUZA 3AE2B 3Q24A 4LTUA 1PFMA 4BY1B 5ELCA 2VZKB 5E3FA 4P6VF 1O7ZA 2EYOA 2MJ3A 4X3UA 2ZT9C 3VR5A 1ET6A 2JA8B 2F0PA 1LT3D 3OMCA 3U7ZA 1BO0A 3C1FA 1PFBA 4K5XA 2W54A 2FE8A 1Y1WB 5A2QE 2BW2A 5M5WB 3BDCA 3A8KE 5EE1A 1J8IA 3ND8A 1LTBD 4HEDA 3PUVA 1P7EA 4LK0M 4IFDI 1T5EA 5J39A 2K04A 2CHBD 3AB5A 3AE5B 2Y3AA 2K3UA 1FNUA 1ZE3D 3BYYB 1BQQT 4NW2A 3FKIB 1B2TA 2DNEA 4NDXA 3HG9A 3EJIA 4NAWB 2F4IA 2IDYA 3VRAB 3ERQA 4FXGC 3Q8BA 4WRDA 1F2LA 1PGAA 3BIID 3HEJA 1C8CA 2K5WA 2PLPA 5C0XH 1NAPA 1ESFA 5E6JA 1JR0D 1SNMA 1PRTB 1L0YB 4A3FB 2KDMA 2ZW0A 2WDQB 5K36H 2CJOA 4KKTA 2JE6I 2VB2X 1ENCA 4DN4M 1SB3C 2WXMA 1LO5D 4HAEA 1SMYD 2L4NA 1GPXA 1I50B 5BMIA 3MC0B 5C4ZA 4ME5A 1T6BX 3RLFA 3GTGB 2F0OA 2F0GA 2EJMA 4CQNA 1LT5D 1PXUA 5CGKA 1XX8A 2ACZB 3TEWA 4TQUS 4B08A 4FF4A 1D1IA 2OHFA 1VF5C 3S15B 2QIEB 3NVZA 2HDEA 2K5PA 4A3BB 1ICWA 1HXYD 1JWMD 1Y8OB 2C9OA 1SNQA 1J9OA 5CV7A 2BB5A 2YEPB 4S3SA 1CQFA 3IAM1 1K51A 1DOIA 3DWPA 3OSOA 2F0UA 2KVMA 1MVKA 1LTSD 1Q10A 3KBXA 1PFDA 2RQXA 3DWAA 3AE6B 2MJDA 1F9SA 2KA7A 3AE9B 3QWNA 3L3OC 4BY7B 4FYDA 1ZXTA 1STBA 5E4WC 1IGDA 2Y5PA 1FGBD 3MXNA 3UI2A 5IGGA 4KD3A 1GB4A 4AS1A 4UDUC 3FRPB 1I4RA 1O78A 4C3IG 1VDVA 1DD2A 1SSNA 2CW0C 3B2GA 1LTID 1OQQA 1XEEA 2KEEA 1BCPD 1RWSA 1SNPA 1ZXIA 3ONAB 3G7LA 3W5UB 1WYGA 1JCKB 2PZUA 1BXTA 1QOGA 3S14B 3FMCA 4LJZC 3BVGA 1AN8A 4L8JA 4US9A 1SF0A 4TQ0A 1AWDA 1N63A 3S16B 1MI0A 3ZJTA 3MXGA 2ID0A 4NMZA 3OIQA 1PTOF 1KABA 1DOXA 3BK2A 2K5DA 1G2SA 3T53B 3H3VC 3P75A 2EYFA 3FPUB 1IW7C 3I4MB 2XRSD 5CBAE 4USAA 4EQPA 1ILQA 1H9JA 1B4OA 1AYFA 1OFFA 4NZLB 2K9XA 1BMLC 4PMWA 2KACA 2F0TA 3N9YC 1EM7A 3NVYA 3VR2A 3MXUA 2WIIB 2IX0A 1FYCA 3U52E 1G291 1ET9A 3SHLA 5FR3A 2SAKA 4MT5A 5BYRA 1JRPA 1ZDXA 1YQ3B 1SDFA 2GRIA 3WCQA 5NUCA 5EGTA 1AEXA 1KDCA 2XSCA 5M3MB 2BS4B 1JOQA 3VR8B 1EZ6A 4HTHA 2E2HB 1VMPA 5C2TB 3EGRA 2A69C 3TN2A 4OZCA 3EROA 2MP1A 1G2TA 2ZXOA 2JYTA 2YYZA 2A68C 3ZGZA 5DAUA 3VYRA 1QNUA 4A3DB 2M00A 1AW7A 1J7BA 2PMVA 2H88B 3KWVA 1SBBB 1QE6A 4RAUC 2V0GA 1LT6D 3C3LA 3OHXC 5IIFA 2O5JC 3DWGC 1M4VA 1V43A 2R7ZB 1PUTA 2NVTB 3K58A 3QJYA 3KF8A 2K33A 1JOOA 2KOLA 5I2XA 2NVXB 1F9QA 2F0FA 1HHVA 1NYRA 2IWHA 4QCLA 3KWLA 1S5BD 1ZDVA 1LV9A 4KY6A 1WVLA 3DXJC 4BA2I 3S1QB 2ZXRA 3KLSA 1RODA 3GTJB 4KJOA 3GP7A 3VYUA 1JB3A 1HUMA 1OXTA 2ICEC 2JZPA 3RZOB 1L4DB 5KYIA 3BK1A 4OO1G 2K6AA 3UI3A 4DGZA 1TY0A 1I3QB 2FINB 3MVVA 4IFDH 1HEZE 4GZYC 1EWHA 3OIPA 4BBSB 5T1GA 3AE3B 1OQRA 2DN8A 3MHBA 1GJXA 1X32A 2EOTA 4C3HB 2Q8TA 4N6EB 1RDPD 1W6KA 2BCOA 1WGKA 1FFVA 2OT2A 2PYKA 2DYMA 1J7AA 4R8IA 1PDXA 2B2VC 5HFYA 2XN9C 2DY8A 3D4RA 2E6XA 1MD2D 3D3RA 4K6DA 2IPKD 4DNTB 1GUGA 5D14A 3E5SA 1FM0D 4XYOA 5C0XI 1B50A 1WCMB 4DK1A 5I6YA 3H91A 1NCVA 3SXHA 4CKBA 5LHY1 5CV6A 3NQTA 2K5QA 3J80E 1DM0B 1VZ7A 1K8MA 2WXKA 1PRTF 4B0MA 1WSPA 2JYOA 4HROA 3A55A 3HOXB 1I6VC 3VA5A 3TMEA 1Z7TA 2BYTA 3R2TA 3IAS1 3ZQ4A 1RTNA 5BYSA 4K2LA 1C79A 1O7YA 3WDNA 2QSDA 1KF6B 3AMZA 4KI0A 2B2WC 3K57A 4IUNA 1HCZA 4IUUA