1TS2A

T128a mutant of toxic shock syndrome toxin-1 from s. aureus
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISALDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of five mutants of toxic shock syndrome toxin-1 with reduced biological activity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
total genus 57
structure length 194
sequence length 194
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1997-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ts2A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ts2A01
3BVGA 1BCPF 1LT4D 5ELEA 1D5MC 1L0YB 1LTGD 1LO5D 3W2DA 4L63B 1I4RA 5D3IB 2AQ3B 2IPKD 1JCKB 1STEA 1S5CD 2O2LD 4C56C 4OHJA 2XRQD 1CHPD 4RGMA 1MD2D 1PRTD 1TS2A 2RDHA 1TS4A 1FGBD 1SE2A 4RHRA 4BWGB 1LLRD 1AN8A 1I4QA 1B44D 1DYQA 5ELDA 1FD7D 4NZLB 3BYTB 2TSSA 4Z9CB 1D6EC 1FNVA 1TS3A 1HQRD 1EEFD 4RHSA 5TSSA 3BVZA 1S5DD 1JWMD 1S5BD 1KTKA 1PRTB 1I4HA 1CT1D 1RD9D 3SEBA 1BCPC 1GOZA 1RF2D 4RGOS 3EA6A 3V05A 1FNWA 1D5ZC 1BXTA 5ELBA 4K6LA 1RDPD 3OWEB 1V1PA 1TY2A 1I4GA 3GP7A 1YN3A 1HA5A 5FKAC 1HTLD 3R8BA 4DXFA 2XRSD 2AQ1B 1PTOH 2SEBD 1QILA 1SJED 1BCPD 1TY0A 1EEID 3EFXD 2XNAC 1PYWD 3BZDB 2ICIA 2RDGA 1JQYD 4L6TB 1XXGA 4DXGA 4RGNA 1M4VA 1JWSD 4RFBA 1PRTF 2WV6D 4O1NA 3O13A 1G8ZD 1DJRD 1PTOC 1SXTA 1LTRD 1TS5A 2XN9C 1KLUD 5ELCA 4ZYSA 5I4DA 1CHQD 3DWAA 2NTSA 1D5XC 1V1OA 1BCPB 2QILA 2QEJC 1PTOB 1JR0D 1YN5A 3BVMA 1HXYD 4RGTA 1ENFA 3BYYB 3MC0B 1LTAD 1LT3D 1PTOD 4RCOA 1T5XD 1CQVA 1ET6A 1SBBB 1PRTC 1UUPA 1RCVD 2CHBD 3KLSX 1EWCA 3R2TA 1LTBD 1EFID 1I4PA 3URYA 1ESFA 1UNSA 1XTCD 1V1PB 1EU3A 1SE3A 1S5FD 1PZKD 1LTID 2J4XA 1I4XA 1AW7A 2G9HD 1PTOF 1KLGD 1PZID 1F77A 1SJHD 1LTSD 4TSSA 1LT5D 3R2IA 2R61A 2Z8LA 2AQ2B 1SEBD 5FK9C 2IJ0A 1B1ZA 5D3DA 2NTTA 1PZJD 4RH6A 1EU4A 1SE4A 1LTTD 3MFGA 3CHBD 1LT6D 3DWQA 1ET9A 3TSSA 1YN4A 1CK1A 5ELFA 1JWUD 1L0XB 3DWPA 4UDUC 1FNUA 1S5ED
chains in the Genus database with same CATH superfamily
2AL3A 1BF4A 4KGSA 3S16H 1HQMC 1QNUA 3CC2A 1NENB 2NPTB 3G71A 2WXHA 2N49A 3DHHC 4PS8A 3PGEA 4BAXA 1UEAB 4HVBA 4FBJB 2GI9A 4Q5VA 3PIOA 2C7NB 4RGMA 5KRUA 2PZUA 1XMQQ 4IUMB 3RNFC 2Z9HA 4M1UB 1LLRD 3FPUB 5FO7B 2K5VA 4HMIA 1GHKA 2VZKD 4DWFA 2F0NA 3FVQA 3HOZB 2FXQA 1NCVA 3NWTA 4XXEA 5JEAH 1MHXA 2BGFA 2WXNA 4S0RA 1F2RC 1J7BA 3AFQA 1CKOA 5I9PA 1VQKA 1S72A 1CSQA 4LF8L 1VZ8A 3CC4A 3PUYA 2N9PC 5IP9G 3GTJB 2MBQA 2MLBA 3GE8C 3J81c 1UD7A 2L52A 3GV6A 3HP3A 1L2FA 2EPBA 2EXZA 4BBSG 4WWOA 2WXQA 3ZNZB 4GB9A 3S24A 3I4LA 1F0ZA 4MSMB 4X62L 3PIO3 4A3GH 4NAMA 1FFUA 1TWFH 1WGKA 1C78A 4IWQA 4IUUA 1PHJA 1WX8A 2KHSA 1NYRA 4DHZB 4MHEA 4JC0A 2IHFA 2KLGA 4GS3A 1RODA 2D0PA 4JBJA 4LWCA 1VQ6A 2UXCQ 2CJNA 2X8XX 2L55A 2I1KA 4G50A 2L8JA 1PTOH 4N6EB 1SJED 2BE5D 1TY0A 5AUIA 3R93A 1WTOA 4F87A 4UPAA 1EO6A 2YYZA 4MZ9A 2FJ2A 1FJGQ 4ASWC 5GQOA 1EUJA 3SVMA 3KWLA 1U4MA 2X69A 4B3SQ 4AP4C 4W9GA 3ZRFA 1H9SA 3I9V1 4MTKA 3H15A 3BINA 1ZDVA 2INNE 2LVPA 5JHBA 3L7ZC 1D1IA 3M4PA 1ZKHA 4FVMA 2UYZB 3CQZH 3OIPA 4X64Q 2SDFA 4GNXA 1VQBA 4IPHA 1PYBA 3OW2A 4B3TQ 2N8NA 5A35A 5IY0A 2UU7A 3GTQB 4DR1Q 1PRTC 2MBHA 2B8GA 1GM5A 4V190 4GKKL 1R4QB 2XWJB 4K2LA 4PG3A 2EELA 2JY6A 4WWNA 4LFAL 3RYTA 2QDBA 2B2TA 2KCMA 4C2MB 2LSSA 4FJZA 5IAAC 1SE8A 3MTSA 1E24A 1UBQA 4OX9Q 4HEDA 4BBNF 4CHKA 3U30A 2IX0A 4OVVA 2H89B 2PYKA 5L95C 1XJVA 1KC8C 1B9RA 3IFDA 3PMFA 4K8JA 1Y1WG 5D7GA 2V0GA 2DGYA 4HSVA 4ITKA 3Q8AA 3X23A 3W1GA 2RPQA 4HDQA 2NTTA 3E0JA 4C80A 1E0ZA 1TWAB 4DV0Q 5C5LA 3N9YC 4LTUA 4K14A 1S1QB 3PUZA 4GOPB 3RNCC 1I6VC 1UELA 1WWTA 2HJ8A 5E6JA 4BS9A 4XDCA 1B3AA 3TBLD 3QB3A 3HRZC 5JEAJ 3BDLA 3UDGA 5HKHA 4ZLTF 4K3BA 1EUVB 3BVGA 4OELB 2OQ0A 4RA8A 3PSEB 2QA4A 1LTGD 4DAPA 2R7ZG 5CV4A 4HPMB 3N1ZC 4K7UA 2K5NA 5JVH3 3I4NG 1QOAA 2B2UC 2MP1A 2VRRB 2PQAA 4BY7B 4OHJA 1IBKL 1Y1WH 5DLQE 1MD2D 3I90A 2GOWA 1IW7C 4OZCA 4F7ZA 2EYPA 2ACZB 5IP4D 4P73A 1TWGH 4MJSA 3STBC 1C8CA 1TKYA 1B44D 4A93G 4IKGA 1GC7A 3T3NA 1TWHB 1II3A 4GLSC 1U9RA 5E3FA 3IBEA 2FFKB 1Q81C 2FCQA 3GTMB 5EE9A 1E2ZA 1Q1OA 3HM3A 3MJWA 1R4MI 2M0AA 4IFDI 1DM0B 2I2YA 3KYCD 1RKNA 4LDTD 1ZDXA 2FE8A 4DV4L 3SEBA 1SE9A 2WXOA 4G7HC 2AL6A 4NKLA 3MC9A 3ZVVA 4ODGA 1UH6A 5CMDA 2HE7A 3MFYA 2KEEA 5ELBA 2WAQE 5J17A 2N3SA 3ULJA 3K5NA 1PA6A 2J0TD 4ZRKA 1SB3C 1AH9A 4HJ7A 4WWMA 3PO3H 1WX7A 3R8BA 2JEAI 2MBOA 2EIFA 2RHSB 5AJ3Q 5EPJA 2A68C 3Q8CA 4KKUA 5J22A 2WXIA 2EZVA 4NMZA 3D4DA 2CHZA 2BF8B 2XTIA 1WYGA 4HJKA 1XCQL 1R4PB 2KDFB 1G6ZA 1KHIA 1DD2A 4RGNA 3H1UA 1IBLQ 4A3JH 2WV6D 2UU9Q 2F0IA 3O13A 3TP8A 1VR9A 2RR9A 1YNND 2RGFA 3ZYYX 2LWPA 1A70A 2TMPA 2JA6B 4FP5D 1MFWA 3ML9A 4C3JB 3WA0A 3AEGB 4N59A 1BCPB 2QILA 5DAUA 4DR4Q 1C4PA 3M7GA 5CC4A 3GZNB 5CTRC 1SNCA 3O65B 1J0GA 5JHAA 1B7YB 5E6NA 5BR8L 3MHBA 4GXBA 1WX9A 1JE4A 1U4AA 4OZBA 2D2CC 4UP9A 1R9TH 4FJYA 1EYDA 1SBBB 2KHJA 3T1HL 2QMTA 3H7SA 1L1OC 1X6OA 3NELA 4JI3Q 4N8FA 1E8XA 1K83H 2MO1A 2HTME 2JA7G 4DF7A 1KJTA 3Q8BA 3ZJUA 1CZGA 4M01A 4G7ZC 3S2DH 2DJFC 2FHTA 5HFYA 5E7NA 2KUMA 3APFA 1QT9A 1HNWL 2J4XA 1I4XA 3MJ5A 1WCMG 3WCQA 4A3BG 1K3BC 1O78A 4A3FG 1B53A 4DN4M 3ZDTA 4DR1L 1WJNA 2NS5A 1GXDC 1NMGA 3T1YL 2B2VA 3Q8FA 1JB3A 1Q5WB 5IKCM 4KV2A 5CHWA 3DXJC 5FLXL 1NR4A 4L5QA 4TQ0A 4WAFA 4HIOA 4W9EA 1IBXA 1N9WA 3AH7A 2KK8A 3RUZA 4ZKCB 2B63B 4JPBW 2JYTA 2MCNB 2PEAA 4F8MA 2F0KA 4HCSA 2YTYA 4A3FB 4KN7C 3M4OH 4KD4A 3DVGY 4ARIA 5JVG3 1PDQA 4HJGE 4APVA 4DK0A 1K3RA 1GO3E 2K5HA 4XDXA 3CCVA 3BS1A 1WJ6A 3HOUB 1LM0A 2BA0A 4L63B 2KO3A 2AQ3B 1E5WA 2LVOA 3KOJA 2MJEA 1WMHB 1WFQA 2A74C 3K7AH 1HNXL 1V2YA 3C46A 4X6AH 2FMCA 3EC8A 1EM7A 1PRTD 4YSXB 4KGRA 1TS4A 1A3TA 1K8GA 3AN1A 2UXCL 2F3IA 4W9CA 1YITA 1P16A 2EYOA 3AU4A 1SF0A 1YZ6A 2C5CA 3CMAA 2G3QB 4KZCA 1KRSA 1ZUD2 2V4IB 2HD5B 4TRDA 3H0GB 4AS1A 4HLEA 2LEKA 4HRSA 1Q3LA 1CSPA 4DAMA 2K5PA 4I6LB 3X3NA 2JJQA 3GTOB 1DGSA 3TRZA 2ZEQA 4DFAA 4LNFA 2JA7H 3ZJVA 4FA6A 2M56B 3ZQ4A 5M3FB 3K0XA 4KDLB 4LUOA 1P98A 5E4WC 4C3HG 3DEOA 1G6PA 3H7PA 3PPAA 3J7AV 1S3OA 2E2JB 2BS4B 1FNWA 2BDNA 1HFNA 3NWSA 1GG3A 3FHWA 1C48A 1E8ZA 3RFZB 3I4NH 5EBDA 4MGZE 2AMCB 3BWUD 1HA5A 3FILB 2WU5B 1HTLD 4CDDC 1XMQL 2RD0A 4DXFA 1WD1A 1YVCA 2Q2TA 4GN4B 1C1YB 1QILA 1E8YA 3P75A 4A3DG 1HUMA 1TKWB 2X6LA 3UDXA 3NS8A 2GMIC 1TXYA 1K73C 3OSOA 4B3RQ 3JAML 2L0FA 2N0SB 4IN3A 2PE6B 3DPDA 4OXPA 5M5WB 3DHGC 4BOZB 1EIYB 2HIVA 1ILPA 3UDIA 2O5JC 2K6QA 2LS01 5FO9B 2BKFA 4CKBA 1A3VA 2H88B 3CIRB 3KH0A 1XLQA 4X65Q 1FRRA 2KC2A 2INDC 3DBRB 2D10A 2OEDA 4YWMA 4ZYSA 1XNQL 2HDMA 2L9HA 1RIPA 2Q2HA 5H92C 1V1OA 2A1AA 1YQ3B 4IW0A 2DN8A 2QEJC 3E0EA 3AEEB 4ANXA 2Q8TA 1ENFA 1EIFA 2ZT9C 3QQ8B 4ZRIA 1LGRA 5EPKA 5ELOA 1L5PA 2V4DA 2PKOA 1PFSA 5CBEE 4FXCA 3TJPA 3GQBA 3Q2AC 3A4SC 2CHBD 1P0RA 2F1MA 2NVTH 1JOQA 2L83A 4YY3Q 3A9JA 5DNFA 4ZK9B 3AB9A 2BYEA 2WXLA 2RSNA 3TEZA 4JW0A 3PRMB 2DENB 3ND9A 3SE0A 1A0IA 4X66Q 2XEWA 2ZJQA 2ZVNA 3JSVB 3CMMB 1SJHD 2MJ3A 2REXA 4JQWC 4WAAA 2E5LL 5AEKB 4P71A 4LK0M 3SK4A 4J15A 3CMEA 4IPDA 1UGJA 3Q6SA 2LXJA 4FYDA 1X3PA 4LF4L 4BKSD 2WDRB 4IUVA 1EWHA 2KOLA 4HR7B 4A3EG 3PO2H 5CV8A 4YTPB 2Y5BB 4LW1A 1E7PB 4Y7NH 1WJUA 4DBGA 3AE6B 1VRAB 3KUZA 1DOYA 1ML0D 1GVPA 1SYGA 4DQOC 5C3WA 4MM3B 2PJHA 1L1OB 2JP1A 4QL5A 1RJTA 1EFWA 2NPTA 1VQEA 3VUWA 2FINB 4ID6A 3B0AA 4K7WA 3KDFB 5JH5C 2LJ5A 1NSNS 4C56C 2R93G 2F3VA 2XRQD 2KMMA 2JUOA 2A69C 4JI6L 4DUYQ 1SIFA 2FBWB 2ZM6L 1FCCC 2DLBA 5IGFA 3KJOA 3PUXA 1JROA 2EJMA 4OO1G 3U2SC 2OF1A 3J81E 2L11A 3TP7A 3ULPA 2QGQA 3GB1A 3S2HH 2BYVE 3S14H 1WF9A 1X65A 1ICFB 2B2YA 3PIP3 2QCPX 1PMRA 3TN2A 4LF5L 5JEAG 2NVXB 3TEYA 4OWWB 3PSIA 4GLVB 3NBHA 1VQ5A 1N8RC 5I2XA 3Q3JA 4IOIE 4AIMA 1GD7A 1XT9B 4WJ3M 2HQLA 4CKCA 4R3DA 2PMZE 1WXQA 5CHVC 2R93H 1WXAA 1V1PA 1Q8IA 4FXKC 1YX5B 3F2CA 4A3CG 2Z6KA 3GTGH 3J80i 1C7YA 4XYOA 5FKAC 2R7ZH 1KLVA 1H9KA 5FJ8G 1E22A 4F7XA 4UHVA 1YJWA 4P7IA 2F0DA 2RF4A 3A0JA 1FR3A 4A3BB 1SNDA 1YHAA 1HUNA 1SNOA 3S17B 1WTVA 3A1QA 4X57B 4KHVA 5BN3A 2ALYB 1WGHA 1M4VA 3GD7A 4LF6L 4A3EH 3PO2G 2O6VD 3KYDD 1PTOC 4NJ6A 1Q7YC 2HCCA 3HHMA 3AEBB 1IBXB 5LL6S 2KN5A 4PS3A 1N36L 4B9WA 1V80A 3GTLB 1SYBA 2E2HH 1RWSA 1SROA 1D5XC 4X65L 2KD0A 1M90C 3J80c 4B3MQ 2ZPNA 3AEDB 2EVBA 3VUYA 1Q90A 3N32A 2XIWA 2N1WA 3MXUA 1C3TA 1MGSA 3OG5A 3J7A5 4HCEA 2D3BA 2IGDA 2YEPB 1V9PA 1V8CA 2KDBA 4WWPA 1H95A 1ESFA 4DDGD 5LMUL 1I6HB 3OW7A 2JWZA 4MACA 3W5OA 2LXKA 3QJZA 2E2IB 4GGQA 4KIKB 4TKNA 3VTVA 2HHHQ 1AW7A 4QF4A 3SXHA 1QOHA 2KX0A 3HG9A 4DV7L 4GDKB 3K57A 1ENAA 3U58A 4PQXA 4J6HA 4MN3A 2JA9A 1L0VB 1E10A 5BMHA 3IT4B 3CWIA 4JWUC 3WAPA 5CBAE 4ZOHC 2AQ2B 2LASA 1PDXA 2C35B 3RNUA 5FK9C 2KCCA 2PCFB 3S1QB 2MH7A 5J3BA 3RZOB 1WM2A 3RLNA 4WURA 1GJXA 1T9HA 3LB8C 3QCAA 3RPFC 5LXHA 3MFGA 3KQ4A 4YXDB 1ET9A 2EYFA 1A62A 3Q8EA 2W55A 4USAA 1FM0D 4C3IB 2PQEA 3TZDA 3J7ZC 4A3DH 1G91A 2Z6BA 2Q2IA 4BA2I 2AWTA 4NY0A 1LT4D 2ZJRA 4KHPQ 2VQFL 1HR0W 3B2GA 3S2AA 1I4RA 1Y56A 1H9RA 4B3RL 1DONA 4XZ4A 1A3UA 1GUGA 3KJPA 1N32Q 3OMCA 3ZLZA 2ZXRA 1Q12A 5GADC 1D4BA 3GOEA 3SK8A 2RHQB 4POFA 4FF1A 1Q0WB 3M3JA 5CX3A 3V61A 4PZ8A 4IO9A 5AZGA 1UWXA 1FD6A 1JMCA 1I5FA 2L1BA 3KK7A 1V8QA 3I4MH 2EQSA 2N4FA 3A4RA 1MHHE 3WANA 1YNJC 4GOCA 3ZIMA 4IUNA 2CU3A 1QF6A 2B2UA 4JVZA 1GUSA 2DNFA 3VR9B 3ZXVA 3KYHC 2NBFA 3NVVA 5C4JH 3RZDB 4KVGB 3CW2C 1CTMA 4E71A 5M3MG 2PE9A 2ZXOA 2G45B 1Y1VH 4P16A 1IBML 2BE5C 1Z47A 1XQQA 4IWOA 1SMYD 5L37A 3AECB 2Y5PA 2DWQA 5IWAL 5GAGC 3RN5A 2QDFA 3DQVA 3H8HA 4IC7B 3OWEB 1K0RA 5EKKA 4A3MB 3H7PB 2Q8RE 2CU1A 2JXXA 2Z0DB 2F0MA 1T0QC 2AQ1B 1JQ4A 4EFOA 1HZAA 1WY8A 3RZFA 3V60A 2DAFA 3U4ZA 2V4LA 1K8RB 4I6PA 2JYEA 3HUIA 1WTRA 2ZVOA 3E56A 4TQUS 1LYLA 5I6WA 4GKJL 3VR4A 1ZGUB 3HOVG 2RDBC 1BUVT 2KCNA 3M85A 5D6JB 1XO3A 3J81j 3Q0AA 2LVQA 3NRZA 4DV2L 1DCZA 4XWTA 4BKSA 2J53A 2JA5H 3TZUA 2L7RA 3VXWA 1K0SA 4RNAA 2WXMA 3H6MA 1VQNA 1KRHA 2LKVA 1UZXB 2R92G 3UIPB 4JCVE 4RCOA 1VQJA 3NVYA 3V96A 5AUKA 3KBGA 3KLSX 1N33L 1Y8NB 3VR3A 5LLIA 1AE2A 3CF6E 4CJ2C 3K59A 3Q14C 1S5FD 2M0XA 3ONAB 5BO4B 2D3GA 1A63A 4K6DA 2G9HD 1JJGA 1BO0A 4PT5A 1KLGD 2EY2A 2B2YC 3I63C 1F77A 1UE6A 2QKIC 3I72A 3VYTA 4BBRG 3NOBA 5C4XH 1LT5D 4DAVA 3I56A 3F2DA 4XTCS 3ALBA 3IVFA 1J9OA 1SEBD 1XYIA 1WIAA 3PF4A 3HOWG 1F9RA 1OTCA 5LL6X 2W3RA 5D3DA 2WXFA 4LF7L 2F52A 4XYQA 3MP9A 4HPPA 4X3UA 4TMAB 2MW5A 4XYCA 3VAWA 4DV3L 2KENA 2ID0A 1FVIA 2NVYB 3H0GG 4L5TA 1T0YA 4B6WA 3ETRA 4ME5A 3VRAB 1ZXHA 3L0WB 5CV9A 5IYCH 1UEBA 1L0XB 1ACCA 1DGJA 2F4IA 3U4EG 4JI4L 3HFZB 1JWAD 3WAMA 1EY4A 3HK0A 4IWPA 1D5MC 3PO3G 4H2AA 4JI1Q 2J0JA 5IIFA 1TYGB 5G2NA 4I7AA 3MXGA 2RDFA 1C4AA 1VQDA 1ZOYB 4LUVA 1GAQB 2WWZA 3AE4B 3KF6A 5JZEB 3SK5A 3VYSA 1TTNA 3HVDA 4P72A 1WVLA 1ILQA 2YU9B 3PS6A 3CD6A 4RF0A 4DUZQ 2LXCA 3NBHB 3ZUNA 2CFMA 2CVRA 1NYQA 1A8VA 4ARCA 4OWTB 2BPSA 3NQTA 1AZPA 2KN4A 2XBBC 3V2TA 3ITPA 1E7UA 1EY6A 4OIJA 5C3JB 3K9PB 1MIUA 1HQRD 2IGHA 2KWCA 1P8LA 2BH8A 1STHA 2KFKB 5TSSA 2YLMA 3V6EB 4UP7A 5BYQA 5IT9c 1STBA 1KTKA 5C0XH 2WB1E 3HVZA 4LF9L 2N7EA 3BDOA 2ZTDA 1QKZA 5D14A 4NPSA 3M62B 5C6AA 5IGGA 5M5XH 4JBKA 2L76A 1VQGA 1XNRL 4K6LA 3OJ4B 2K32A 4DGZA 1VQ7A 4S17A 3WALA 4QB4A 2BYFA 2NN6I 4W9LA 1WTXA 1KFYB 3DHIC 4ZHPA 1PH9A 2KANA 1UAPA 4WJNA 5JXVA 2NN6G 3NTIA 2LUMA 4E74A 2A69D 4POGA 3OPOA 4JOIC 3KLRA 2K33A 5C1ZA 4DK6C 4HJ9A 3HGBA 1KM7A 4A75A 1XXGA 4EQPA 1WI0A 5C2TB 2IT1A 1D2BA 1V86A 4NDXA 2HT1A 4AYBG 3Q3MC 2K5DA 4BKTA 4ANWA 2N9LA 1CKNA 3NEMA 4L8JA 2DYMA 2K05A 2A19A 3SFEB 1WE7A 3FKYA 4RCNA 4IG7B 5D94A 3A5ZB 2MGSA 5C4HA 1YN5A 1SNQA 3BVMA 3APCA 2WDVB 4BY7G 1R7SA 4RGTA 4GKJQ 4R8IA 1JALA 2ZTEA 3RLFA 1Z5SB 2PO4A 4XT1B 3G6JB 3EN2A 4IUPA 4JI8Q 2D2QA 2KFJA 3VTWA 3IG3A 4HJ5A 2MRPA 3LYYA 3QOJA 1IXRA 1MSGA 2E74C 1TWAH 1I7HA 1UNSA 2M00A 3TDQA 5GROA 4GLXA 3B08A 2IL8A 2F0VA 3AQQA 1U4PA 2GB1A 3DBLB 2DNCA 5KNCA 4P1CC 3EROA 3MXNB 2DJGC 4LFAQ 4LDTB 4PNYA 2AKWB 3DOWA 3PHWB 3OTOQ 1KIXA 1LFDA 3FEWX 2RMMA 3MA2B 1LTSD 5IWAQ 1L6VA 4P75A 4R1JA 5J2RA 4A3KG 1I35A 2E2DC 4MM3A 2DHZA 1DXMA 1ZKOA 5DPWA 5IYDH 1D8LA 1FYCA 2JA5G 1K28A 2O6VB 4X64L 1VF7A 5M5YB 1Y1WB 1I3QH 5M3MB 3CP0A 1IKLA 3CF5A 2I07B 3RNEC 3PIPA 1EU4A 2LGIA 1NNXA 4K2KA 3HOYB 1U5KA 2RSOA 1ISNA 3NG0A 1UWMA 1TWHH 4QAYA 3IXSA 2E8GA 4FF3A 3W1YA 2I5HA 1FNUA 3I3CA 3HOXH 3GTMH 4HTHA 2KEDA 2MA9B 4K81A 2VL6A 3LNNA 2D0OA 2KTFA 4M0WB 2Q2UA 3BK1A 1N6ZA 4LLGM 1WTQA 4ACFA 1S4ZA 2B3GA 3EQLC 2VQEL 4AYBB 2NMQA 4HSPA 4A8XC 3A55A 3L9AX 2ZJDA 3P4RB 3HOVB 5C4XG 3IRBA 1C79A 1MG4A 3DUZA 2K25A 2IYDB 3PO3B 2KDIA 4AQYL 1CM9A 2GRIA 4DV1L 3S1MH 2D9UA 4ZAIA 3TCAA 2JT4B 4MIUA 1S5DD 4ZRZA 4JI4Q 5JAVA 3GO5A 1UE7A 4WJ4A 4V0BA 2NVQH 2E75C 2L1AA 3IL8A 2MPMA 3NBIA 2BB5A 4PV1C 3K9OB 1MJCA 2BYTA 3PRZA 3SHLA 1EIGA 1OXVA 4RWSC 4LF8Q 1NR2A 3GS2A 3S16B 1N60A 1VQHA 2QSDA 4GN3B 4DV3Q 2RVLA 3D0FA 1H8CA 3ZW3A 1PGXA 3L10B 2JSOA 4BXXG 3GP7A 3CCUA 1V43A 1YN3A 3VR8B 1HTQA 3G4SA 1X1MA 3JAME 1Q1EA 1D7QA 1HA6A 2MNAA 1DZ1A 1QOFA 3ZKJC 3Q23A 4NXNQ 1FIQA 2KAJA 3AXCA 5CHFA 1MJEA 3HOZH 1A6XA 3NS1A 3BZDB 1EYAA 3D8GA 1X56A 2RDGA 1FCLA 5CR3A 3RR5A 2I46A 3I2ZA 2O5IC 1P7EA 3BIID 3JC66 2IO0B 4WJOA 3OMGA 1PUTA 3MTNB 1RAXA 2ZNVC 3NZ3A 3J80E 2LHDA 2D3CA 3D4WA 1C9OA 4QGUA 5M9OA 1RFAA 4JL9A 1B2TA 4MJSB 2K8BA 1PLFA 2NTSA 1WXSA 2EYJA 1HE8A 1JRUA 2LD9A 1SIJA 3PO0A 2RCNA 1PFNA 4KTAA 3W1BA 4A3GB 2HIXA 2D11A 3N1XC 4N58A 1B70B 5BYSA 4MSQB 1VDZA 4A3IB 4DV6Q 3QO2A 1HR0L 1J7AA 1CA6A 2KJHB 3PVLA 2LXAA 3A5UA 1YJNA 3T9LA 1BBUA 4DV2Q 2JX5A 3ZJYC 3HKZB 4R4QA 3U9OA 2K03A 2K6DB 1O7YA 1WJJA 1MPEA 2N78A 3M4OB 4DR7Q 3MVVA 4IFDG 1C4CA 2PW7A 4GN5A 1TWCB 1HNZL 1KXLA 1FRDA 1YHBA 4WRDA 4DU9A 4K1RB 4MT5A 1X3QA 4FXDA 4JV5Q 3K7AB 1AZQA 1MJDA 2DYOA 4LF5Q 2A4ZA 3NY5A 1JC7A 2LFIA 3TMPB 4EX5A 2MUYA 4PZ7A 2I38A 3E3XA 3RNAC 4LAAA 2UWQA 1QUQA 2JU6X 1YIWA 2KVZA 3EUB2 3IHPC 5KYLA 3DWMA 3GTKH 3QR8A 2CJOA 1F2ZA 1CZWA 4KK7A 1F52A 2M8SA 1TKEA 2WXJA 1PH6A 2VZKB 2F4VQ 5C5MA 2ZXPA 1SN8A 1IYJB 4JI0L 3DVNV 1XF5L 5D3IB 3M3YH 1N34L 2RSUA 3DM1A 4KHZA 2OQKA 4G57A 5EKLA 3S1RH 2MWSB 3DMUA 3N6RA 4CJ1B 2DAJA 2FCNA 2YEPF 3EHVA 3P4SB 3SDLC 2EYMA 4DHJD 1J5EL 3NPPA 4KI0A 4J1MA 2UXBQ 5GAEC 1KH0A 1Q86C 1VS0A 3MZ5A 4TQ1A 4NZLB 4C3JG 4C7YA 5IP9H 3M4QA 4DAYB 1SLJA 2F0LA 4KHPL 1LXDA 3NENA 1S40A 1PH2A 3Q8DA 1NBWA 4FJVB 2VNUD 2GLSA 3EA6A 4DR5L 1JRPA 4P74A 3PZ7A 1D5ZC 2E5LQ 1V81A 1EZ6A 4OWXB 2E76C 2FMMA 1NUCA 4IFDJ 4YSZB 2KJ6A 5HURA 2UUAL 3VFKA 4JI5L 1SDFA 3A9KB 4RF1A 4M8MA 1YNJD 2PW5A 4WORA 4K5XA 4PS7A 3S15B 4YHHL 3B2FA 3E6ZX 1IW7D 4B95A 1E7ZA 3EFXD 2XNAC 5G55A 4C4VA 3KFUA 5T1IA 2O2VB 3DHQA 2KXJA 1WR6E 4IQZA 4BY1B 4JI5Q 4II3B 3A7AB 4GOPA 1N62A 1NEKB 3BK2A 3NE5B 4O1NA 3U9SA 2NVTB 5LMUQ 4KMUC 2F0EA 1TS5A 3NSWA 5MPOA 3HEJA 3MHZA 4E3CA 5I4DA 1PV4A 1L4ZB 4UY8C 4B9XA 2BA1A 2O4XA 2LMCA 1N61A 4JI7L 3KVFB 4LCDE 5IP7G 2BVCA 4YSYB 4R4TA 4K0KL 2WYQA 2WP9B 4K0KQ 2OOBB 1O7IA 3BYYB 2EOTA 1XLPA 4B3ML 1K50A 2KHWB 4JLCA 3W3AA 1PTOD 3S1NB 2QHOA 5LXIB 4N9F4 2C5LC 3UDFA 2K1FA 1EWCA 5LHY1 2J0KA 3PO2B 3URYA 4HCNB 3OJ3A 3NP8A 3ZTDA 5KEEA 3K58A 2WDQB 4D2KA 2VUMG 2K8HA 2FCMA 2PNHA 1ICWA 4GOPC 2BDOA 1NY4A 3SD5A 3BG3A 2MHJA 1EL0A 2R6GA 1P7FA 3ERSX 3WDNA 1YNTE 3M95A 1SGHA 1Q1BA 2OCEA 3GZNI 1GB4A 2CH4W 3TBIB 2L3ZA 4CJ0B 1ZXIA 2KX3A 3N1YC 4P6VF 1QQRA 1YBYA 4JI0Q 1RRBA 5C4ZA 2EMSA 3K6OA 4ALPA 1B9NA 1B1ZA 1E6EB 2M1MA 2KECA 1WXVA 3H09A 3B1LX 1MVKA 1JOOA 2J42A 3VYRA 3TEWA 4HAEA 1NTGA 2UUBQ 4GDLB 4CQNA 3ICEA 2R3ZA 2D3AA 1YD8U 2BCOA 1WRIA 4O2DA 3TL5A 1RM6C 1JW9D 2O2VA 2WHIA 1T5EA 3NZSA 3FAHA 3W9CB 1H4RA 3VHTC 4DDID 4DHJB 4JYAL 1N5WA 3NUCA 1B9MA 3Q3NC 4NNJB 4A3IG 4MGIE 2EY5A 1C0AA 5FO8B 1V5OA 1EWIA 1IPGA 4EZJA 3PZDA 3T16A 1PH7A 2KFKA 2F0PA 3FKIH 1JCKB 4HN7A 1STEA 4A4IA 2IY1B 4L5RC 5D2MB 4EKUA 2G9DA 1HTPA 3LJ3A 3DLLA 2UXBL 5C44B 5IYDG 1FGBD 3SR1A 2ZM6Q 3KUDB 4JI6Q 4BY1G 5BN4A 4ICVA 2BKRB 4J8QA 5ELDA 4EVOA 1K8OA 2K3UA 3ERQA 3H3VI 1HZCA 2QEXA 3H9DA 4Z9CB 4C3IG 3LWUA 3I5JC 2WGSA 2H1EA 2QF7A 4M8AA 1OXTA 2B63H 3E9HA 2PQAB 3APDA 4DV6L 4IJLA 3J81i 1CJEA 3RT3B 1R4MB 3U7DA 3G48A 2PI2E 1IL2A 3LX0A 3KUCB 3CCEA 3M4YA 4HEA1 2LGDA 2ASBA 2OWOA 3HOWB 1TIFA 1TGZB 4HIDA 1BXTA 4DA2A 1TBEA 1SFOH 3Q3OC 2JXMB 4Y52H 4EE2A 1RDPD 3HOUH 1ZEQX 1OQQA 3V62A 2B2WA 3MAQA 3RD2A 1QNKA 2BTEA 1Z7TA 1WCMB 2R7DA 2VUMB 1I50B 2SNMA 3OOCA 2B39A 2KQ7A 2EKIA 3T3OA 3CXCA 2MP2B 3QOLA 2V3PA 3UQBA 5DPRA 1BVSA 5C3EB 2GBMA 3H0GH 4C1NI 5BR8Q 4DXGA 2K04A 5CV5A 2A8VA 1VCBA 2BH2A 3QX1A 4NJ7A 4CGYB 2JPHA 2DZKA 2ICEC 3AE5B 4FF2A 3GTOH 5LMNW 4YWLA 1KF6B 2JA7B 1R4NB 4FXGC 1ZW7A 2LZ6A 4OVZA 4A3PA 2L5TA 1VQIA 3A33B 1L7YA 4TUUA 2P5ZX 3PGZA 2AUJD 2F0SA 4II2B 1I94L 1SSOA 1KRTA 4WJPA 2XWBB 1HR0Q 3IFWB 1J8CA 1EQQA 3ND8A 3U8ZA 5DPSA 2CWPA 1MBYA 1LTAD 2RA4A 2A68D 5C3EG 3I4NB 1YQ4B 2H5XA 2R2OA 1XCTL 4REZA 1FO4A 5GXGB 3S1QH 2F0TA 2Z59B 3RZOH 1XNQQ 1G2SA 3I57A 4XGAB 1RCVD 2AEHA 2CCZA 5FR6A 3TQYA 2N1VA 4ULLA 2ZW1A 3A8JE 5EKIA 4JGHB 2PVOD 1XTCD 5DCNA 4HJ8A 3NQIA 3DBHI 5DM73 4MNOA 3EECA 4A3LH 2VY3A 4QQBX 1VQPA 3IFTA 4C3IH 4A3DB 4HKQA 3ZTCA 2KJRA 4A3KB 4IJHA 2MJ8A 4AJWA 1UGMA 5HGTA 1M1KC 4HKZE 4WH4A 2K0PA 2FCSA 2PW9A 2NBWB 1P1AA 4RH6A 4BBNC 3A74A 2JQRB 3MXNA 2VH1A 4OVUA 2EYHA 4R8NA 1CZPA 4F88A 4XE0A 2M19A 3X3MA 3L17A 4R9WA 4A93B 5IOIA 1A2TA 2F03A 2L0TA 4GN1A 1L0WA 1QG7A 5ELEA 1VD2A 4DHZE 2Z0EB 3SGIA 3QG1A 3W2DA 4AQYQ 1YHQA 4PMBA 1NDDA 2VH2A 4G0NB 1IZ6A 2PZTA 2KKCA 3OTOL 3J80L 1CHPD 2I0QA 3IAYA 2A5UA 4FF4A 3N20C 4HCPB 2VB3X 3QWZB 4DAYA 1RTNA 1MSHA 3OHXC 4EQ5A 2K5QA 1GUWA 4I6NB 2JA6G 1SAPA 2Y0SE 2Z6KC 4DR3L 2ZW0A 3ML8A 3CCRA 2QW7A 2N9XA 2N9EB 5T8IA 2BOSA 2K6AA 1B3QA 1JT8A 4W9HA 3MEHA 3A54A 2JQOA 5HHDG 4ANVA 4ZRPA 3CC7A 4A3LG 5C23A 4XDDA 2F0GA 2A5HA 2ZPYA 3P4PB 5JJIA 4IPGA 3Q69A 4LFCQ 3BVZA 4IPCA 4Y7NB 2J7ZA 1WGGA 1E9MA 3DM3A 4QUCA 2W3SA 1I42A 4LFCL 2GBNA 1YJ1A 3L13A 3OWFA 1FMAD 1STGA 3PUVA 1A5RA 2N88A 4C1NK 3QIJA 1X3GA 4Q2JA 3UIOB 1K8AC 2R92H 4JE3B 3W1SC 5EE1A 2CS4A 3RCZA 4EGVA 4NJCA 1HZ6A 3NUHB 4F8CB 4FN2A 4GMVA 1G2TA 4MEMA 2SOBA 4NW2A 1WZ3A 2OTLA 2WLBA 1E1OA 1QJOA 1K53A 2KWUB 1VMPA 3M7NA 5GAHC 3CRLC 3CSFA 1W6KA 4B3TL 4L5SA 1KNEA 1PH4A 4P1BC 5EGTA 2WAQB 3NHHA 4ME3A 4RFBA 1STYA 5C44G 2NVUI 3E5SA 2KA7A 3MHSD 3A8KE 1LTRD 3EGRA 2NVXH 5GMVA 1CHQD 2M2LA 2IX3A 2CH4A 4A76A 3PV1A 1T6BX 3CPWA 4DXAB 1JOKA 4JI8L 1L2NA 3RUIB 5C4XB 3GTPB 4GDLA 3CCQA 4HIMA 4CO7A 4IALA 1VMCA 3MC0B 1YOVB 2MX2A 1LT3D 4W9KA 2QDLA 3TEXA 4GNXB 1GB1A 1K9MC 1CQVA 2WAQG 5K36H 2DYBA 3V3XA 1XPRA 2R7ZB 5C3XA 1Y8RC 2XK5A 1LTBD 3AE8B 4DR3Q 2NVYH 3S9WA 3BJUA 1BT0A 1LTID 2AUKA 5BMGA 4JBWA 2KVRA 5D65A 4EUTA 3QJYA 5EE3A 3RNGC 2JRHA 5G3LF 3CCMA 1XLNA 3R2IA 4OONA 4KKTA 4L1BA 2YVCA 2R61A 1U4RA 1EQVA 2OJWA 1FPYA 2E2HB 4C3HB 1C9FA 3Q22A 3FKIG 1WI5A 2AWOA 4BBSB 1QUQB 4FLHA 4RAUC 4NAWB 3V6CB 2B2WC 3PTFC 1CKNB 1ZYRC 4KKSA 3GTJH 1XNRQ 2MBEA 4K5VA 1XPUA 1LT6D 1X3FA 2WXKA 4PMCA 4FNFA 3TMEA 3UQAA 2WXGA 2KZRA 1LV9A 4EQOA 2L05A 3AU5A 4LF7Q 2MQHA 4LF9Q 4MH8A 2JEBI 2MHVA 1ONLA 2IY0B 3AYHB 3I70A 4KV6A 4CBVA 3RD4A 1OQRA 1V6EA 4NPNA 4PMWA 3T56B 5I6YA 4FHKA 1TWFB 5KHOA 1BNZA 2E2IH 3HRDD 2JSVX 5IN7A 2IPKD 4ZDVA 2UXDL 3ZO5B 2NWGA 4DR2L 2IO2B 1IKMA 3GDEA 5M5XB 5KGUA 2MQJA 1G51A 4RHRA 3K5LA 4YL8A 3RLOA 2V3SA 2KNBA 1AN8A 1VQMA 3JVZX 4L2YA 4ZRQA 4OGQC 2AWNA 2LY7A 2I1JA 3AB5A 1DYQA 5LMNL 4DV5L 1D1KA 4QJFA 5JJZA 2UUCQ 4IFDH 3KBXA 4QUFA 4YTNB 1FNVA 4HMJA 1TS3A 3AU7A 5ISRA 1T0SC 3AE9B 4BOSC 4JI1L 3RULA 1OXXK 2EKEC 3PLVA 1LM8B 2QC8A 5I2YA 1CT1D 2NR2A 2NZHA 1BCPC 4RGOS 1I94Q 3AEFB 3PUWA 1VCIA 1PFBA 3H3VC 2LRUA 3AE7B 4JPSA 3FILA 4OW0A 2K5WA 1CKMA 3J81L 5HGQA 5E6PA 3UF8A 1EOTA 1TY2A 1RYJA 2CKHB 2WB1G 3BDCA 2HJ1A 4IOAA 2IZVB 4GSWA 4M00A 3W5UB 1PH3A 2FNJB 4DNTB 1TZ1A 1BCPD 3WOFA 1B4OA 2B2VC 1OGWA 2PZWA 4YCUA 5M3FG 2JE6I 3A1QB 2RKSA 1DOXA 5KNDA 2VXWA 4L6TB 2WU2B 4MH0E 2WKCA 1XLOA 4DNRB 2A6HC 2CW0C 4K5WA 3AEVA 3SHQA 5C4JB 1OEYJ 2JA8H 1QOGA 3E9IA 5CORA 2E3TA 1F2LA 4I7ZC 5FJ8H 1F9JA 4A3OA 1XWEA 3VH3B 1IBMQ 1GKHA 1YEZA 4QMGA 4WIPA 1SRUA 4C4VB 5G5HA 1JICA 2V1CC 1HJPA 1PH1A 2EE1A 4A3MH 4A9AA 4A3GG 4JIOU 2F0OA 4IOCA 3M9BA 1JJCB 3E9SA 1VQ4A 4E6IA 1I3QB 5M3MH 3ZDMC 3IT6B 3K0YA 2D5DA 4Q0FA 4B3SL 1WXMA 2KBNA 1BBXC 5DEHA 2LGXA 3L54A 5FR3A 1UE1A 5IGCA 2G4DB 2GBJA 2L15A 4BY7H 4JWSC 4ICUA 4XWWA 3HOXB 1E2VA 4IUQA 3NK9A 4BBRB 5KNBA 1E7VA 2YTXA 1TWGB 2C7HA 1HFGA 1KDBA 2FUG1 5IODA 4JYAQ 3K5MA 4WQMA 3ZNHB 4YCWA 3X0WA 4KIKA 5A2QE 2UUBL 4X62Q 1X54A 3KWVA 1H9MA 1LABA 1NMFA 4G3XB 5ELFA 5IGEA 2W9NA 1TJEA 1GUOA 3Q24A 4XIGS 1NAPA 4TKOB 3S1MB 1YMHE 4GU2A 4CYEA 2K1BA 2KDEB 5KHQA 2CWAA 2D07B 3L0OA 3Q3FA 4EOYA 1DOMA 2Y0SG 5FLMG 1DOLA 3FRPB 4YHHQ 4XX5A 1ROEA 1TR5A 1G291 2RDHA 4H0LC 2HHHL 4X3TA 2UUAQ 1RTOA 3AE1B 3DBHB 4A6QA 2HCIA 5C0XG 3AE2B 2HUGA 2AYOB 2L12A 1WGRA 2N55A 2Z4HA 4XC2A 1IL8A 2L0CA 1AYFA 4DKAC 3VDZA 3QIAA 1QZGA 2VQFQ 1WTPA 1IYVA 3FC4A 1WMHA 4ILWA 3BY4B 1NVID 2K8CA 5H8YE 3UE1A 2JA6H 3J9CA 1GOZA 4KKIA 4DNIA 3AMZA 1HEZE 1VQOA 1WJ4A 2ZTCA 4YT0B 1WTWA 2ZZPB 1AARA 2KTRA 3RNBC 1Y8OB 1EOVA 3P1HA 4NXMQ 3I7FA 1R9TB 4NAWA 1QVCA 2XRSD 2I5LX 3CKIB 2MBBB 2MP2A 1VZ7A 3KF8A 4EZLA 3S2DB 1EEID 2YU9H 2ONQA 3I73A 5IYCG 1F1HA 3T13A 4G7OC 1VQCA 2ICIA 4YTMB 4DV7Q 1FL0A 4XQJA 1HZBA 1QB5D 1HCZA 1K8MA 3KLWA 5FLXE 2K9XA 5IGBA 4ZKBB 3HKZG 2QIEB 4A90A 4US8A 1PRTF 2B2TC 2F4VL 2JXTA 1Y8PB 4K3CA 5AZHA 2NUCA 1VQAA 1SXTA 1UWVA 2XN9C 3PRPB 1KLUD 4HJAA 2PIAA 1OO9B 1VQLA 2R7FA 2PPHA 2PI2A 4QIWB 4K8IA 4KY7A 1PTOB 1JR0D 1TWCH 4A3CH 4LFBQ 1VJKA 2ZNVB 1YJIA 3OAWA 2K28A 5DPTA 1WTHA 1UE5A 2KLCA 2WACA 2WXPA 4X3SA 4RM9A 1FXTB 2SNSA 3D31A 4HIKA 3K81C 3W5VB 1ET6A 1XD3B 3J7AF 2N7JA 3R2TA 3U52E 1O7ZA 4R4IA 3U50C 3FMCA 1VQFA 1EU3A 2MO0A 3PQIA 1NI3A 3EJIA 5JPMC 1PZKD 2PVGC 5KYIA 3CCSA 4GLAC 1SNPA 4LJZC 4LF6Q 1CA5A 3GTKB 4TVAB 1PYSB 1Q10A 3HZXA 4BVUC 4A3MG 3MWYW 4DK1A 3F2UA 1JJ2A 2B3AA 1XX8A 2AHOB 1HZ5A 4G4KA 1JWBD 1X32A 3QARA 3CQZB 4AH6A 2JZ3B 2NBUA 2JVCA 3EFUA 2Z8LA 4R4OA 2G1EA 4IM0A 4LNIA 5NUCA 1KAWA 3VYUA 1A2UA 4L23A 3S1RB 2JA8G 3GTQH 4KSLC 5FOBB 3K5OA 3VQIA 2XSCA 4AYBE 4PYUA 2B8FA 2CW0D 4ZQ3A 5LNK1 2F0JA 1N5XA 1WGDA 1UF0A 2JK8A 4RM8A 1WYDA 3HOXG 2KOXA 4C2MH 5M3FH 1FFVA 4LF4Q 5H1SE 1EIHA 2LJIA 2KJXA 1EZ8A 3P42A 2E2JH 2WXRA 4YWKA 5E4XA 3TP6A 3ENEA 5E1FA 3I55A 3VH4B 1P9DU 3VUXA 3RN9C 1RLFA 3F8TA 3LDZE 1HNZQ 1F2MA 1MKHA 3AFPA 5C0XJ 1GC6A 2D5GA 2FIDA 4YIJA 1PH5A 1SR3A 1WR1A 4KY6A 3M63B 1SE2A 2PNRC 4KN4C 4KJNA 3TEHB 3FDTA 1Q82C 1S3SG 3EIVA 4YY3L 1WRDB 5I9OA 4XQNA 4M02A 2JZPA 1FD7D 2DZJA 1SYCA 5M5YH 4JK1C 4HXDA 5M5WH 1E1TA 2NZOA 3H3VH 4GIVA 4ZCKA 1KOTA 5HG2A 1NJIC 3DBSA 2B29A 1FXAA 3CAMA 1C4QA 2JYOA 3TREA 1I4HA 4HWIB 4AOFA 3U7ZA 1YNXA 2YV5A 2OT2A 1NI2A 4BY1H 2KQ4X 4RG1A 1V97A 2LUEA 3BZCA 2IDYA 1GUNA 2Z4IA 3T53B 5CV7A 1K52A 3ABVB 4J6IA 4CHTB 1IGCA 1PXUA 5IOCA 4OO1I 2FIFA 4W9FA 1QCBD 2K52A 2DY8A 4DV5Q 3UINB 4KJOA 2GVAA 2DY7A 2A6ED 4FO2A 2IGGA 2SAKA 4NQKE 2OJRA 1F9PA 3CSTA 4LMQD 1WZ0A 1XMOQ 1PFMA 4DR2Q 1IGDA 2UXDQ 5HI1A 3HOVH 5IYBH 1EY9A 1QLBB 5G3LD 2HTHA 3I8ZA 2EJGC 4X66L 2GBRA 2QCZA 5JPNC 4RKBA 2RCFA 1SYEA 4DK3C 2KHIA 4J3OD 5F2DA 2MEKA 2PTLA 1DJRD 2KVMA 2XGTA 4RKLA 3HKSA 1Z9FA 2IWHA 1XPOA 2ATWA 2KQSA 4BZAA 2EY6A 3VR5A 1J6QA 5ELCA 2NVQB 1QE6A 3OYYA 4UAIA 1KABA 5IT9L 4AUQC 1ASZA 3RI7C 2KT7A 2LGSA 2KCTA 1PQSA 1JORA 4AQ7A 3LWEA 2DUDA 4R4CA 3Q6BA 3AMUA 4QIWE 5IT9E 3VDYA 2IO1B 3PCOB 3I3TB 4FHJA 3LGJA 3IKJA 1C76A 2ASQA 4DPGA 4W9DA 3BZKA 2R2QA 4A3JB 1J7CA 2CR5A 2W82A 2IW3A 3U4VA 2L00B 3QWNA 4ZHOA 3JAMi 1QZEA 1YNNC 2ZJPA 4C3JH 1PGBA 5BN5A 2VQEQ 1F2YA 4HK2A 4MGKE 4H02A 1HNXQ 1YQBA 2F0WA 3K80C 5IP7H 2C9OA 4JOIA 5CV6A 1L4DB 1GJZA 5AZFA 1MI2A 2F3WA 1BDOA 3PF5A 4W9JA 3WOEA 3FKIB 5CYUA 1N63A 4CDEC 3OIQA 1VZ6A 3G7LA 5FLMH 3KF8B 2EDGA 4IM2A 5C44H 1K83B 3JSVA 3S14B 5JOBA 1HRJA 1LTTD 4A3IH 5J18A 4IM3A 1CUKA 1EWYC 1M94A 2NYZD 1JWUD 1BUIC 2M17A 4RMAA 5C0XI 2DBYA 2BT6A 3DWPA 3KUPA 4LJPB 4ABNA 1BCPF 1IHZA 1P3QU 1WSPA 3JW0X 3DBRI 1L0YB 1OEYA 4LNKA 4LNOA 3T1YQ 3QA8A 3VTUA 4AJYB 1NE3A 2K7VA 1O7LA 1LTLA 2X38A 2WDTB 1ZPSA 4YWGG 3J7YW 3FPPA 3DVGX 3C19A 3MC8A 1W6JA 3HOWH 4DR6Q 1GUTA 2HQEA 1HNWQ 1SFOB 3AEAB 3UGBB 1H9SB 3KW5B 3P1MA 3N3KB 3AV8A 5COYA 1F9QA 4F1SA 5K5PA 4A3FH 3A8IE 2M4NA 1WCMH 4K7SA 4KSKC 1I50H 1D6EC 1GHJA 3T1HQ 1ZXTA 1EY0A 2Z1CA 2DZMA 1SYDA 1MI0A 1B50A 1PH8A 1C77A 4RHSA 2BS3B 1Q8KA 3DVNU 3H91A 5CGKA 4FADA 1JWMD 1S5BD 1SSNA 4U673 2AX5A 1TZOA 4H7BA 3CRKC 3SK6A 3NZUA 4KZ0A 1VQ9A 1W3SA 2WINB 4PK1A 3M3YB 1I4GA 3DCGA 4H44C 2NBVB 2Q5WD 2NB0A 1KDAA 3KDFA 4KD3A 3N52A 2SEBD 1YIJA 1ASYA 2NCNA 1IYFA 2JZZA 2BWFA 1EQRA 5IGDA 3P63A 4KDIC 1PYWD 5AJ3L 2VB2X 1OQYA 2LGYA 2LMCB 1JQYD 2RPVA 3DDCB 4ANUA 2WS3B 3QHTA 2KMCA 1EQTA 2J0MA 3NHEB 3ZNID 2KQ3A 4JI2Q 3CU7A 3TUOA 1BOSA 1F9SA 3CCJA 3ZRCA 4EQNA 1G8ZD 1V5TA 2PLPA 2HDLA 4JI3L 2L32A 3C1FA 4BKGA 4URKA 2H4OA 5JJKA 1Y14B 3G6EA 4A3KH 1T3QA 2WX0A 3L16A 4U68A 3VA5A 3VA7A 4HDOA 3K8AA 3NTKA 3ECIA 3PLUA 2KDMA 4FULA 2OXPA 4OZAA 4N9PA 3D32A 4DR4L 3HKZE 1TIID 3L4PA 1GPXA 1V1QA 4JG2A 3VR2A 5JJLA 5G5GA 4UP8A 2IX1A 4QY7A 1EFID 1I4PA 1LACA 4XQQA 4DUZL 3TS0A 3S15H 2YTVA 1QWYA 1V1PB 1U0LA 2UU9L 3D4RA 1IBLL 3C1EA 4JI2L 4OIKA 1PVOA 3P7JA 5K36G 1JMLA 1JE5A 5DM63 3HOYG 4A55A 1M8AA 1ZYRD 1IBKQ 2C9WB 1YI2A 2HDEA 4LNQA 1N33Q 4B0MA 4RMFA 1HH2P 2XVSA 1IP9A 3HM6X 1X3EA 1IYUA 3I4OA 1KDCA 3A7LA 3I4MB 3DWGC 2ON8A 1STAA 4I65A 5J39A 4GZYC 1J8IA 2RBMA 2VZAA 3NVZA 2ZCBA 4MELA 1QZHA 2DX5B 4GDKA 2JN4A 3C8YA 5BMIA 2K01A 2N9KA 4PYZA 1TT2A 5EPLA 1WM3A 3MXPA 2EY1A 1SE4A 1KD1C 1WH3A 2OEOA 1YN4A 1OXUA 3RZDH 1VF5C 3S1NH 1CQFA 4DV4Q 1Y1VB 1VQ8A 1NBFC 1X9NA 1S5ED 2E6XA 4C00A 1EYGA 2CKZB 2MJDA 3PV0A 5L83A 2QJLA 1STNA 1LO5D 3GE3C 3B6YA 2WX1A 1DOIA 3ZJTA 2EJFC 1E3PA 2CHWA 3HOUG 4HPLB 4NP5A 1TS2A 3RMHA 1RHPA 1AFPA 4ZUIA 5HY6A 3P20A 3TP5A 3R7RA 3IAS1 1I4QA 1Y69U 5IA7A 4DR6L 3DBLI 2WKDA 2NZ1D 3BYTB 2TSSA 4FDBA 1E2WA 3A9JB 1ENCA 5T1GA 1EEFD 2INCC 4GNXC 3N30A 2DNEA 3L08A 3MEFA 1WFYA 4CKEA 3F1ZA 1EY7A 2JA5B 1RD9D 3W1SA 3ZXRA 1RF2D 2V9HA 3WAOA 2WB1B 2KYWA 2KTRB 5EE0A 4W9IA 4DV0L 2K22A 2EXDA 4WFN3 2FUHB 3ZNGC 2GN5A 2F0UA 4ZUJA 1JB7A 1T0RC 3BU2A 3D3RA 1UBIA 2GA4B 3S2HB 2PMVA 1N32L 2G4SA 3JYUA 2JWUA 2EYLA 4O0AA 2G5DA 1EY8A 4P2CB 4JBMA 1J19A 1TVXA 4OX9L 1HHVA 1MG8A 1D3ZA 1TT5B 2I5MX 4EZKA 2J7QB 2KWVB 4B08A 3NTHA 1CFMA 4OEMB 1RFKA 1VDVA 5IYBG 3HOZG 2MSED 4A20A 3P4QB 4LFBL 2CQAA 3AI5A 2R93B 4GKKQ 1QVGA 5BYRA 3STBD 3C2PA 1ZP0B 4WJWA 4MDKE 1ZE3D 1G6JA 3B9JA 3GTGB 1BR9A 2DZIA 1FGUA 2K4KA 1E0BA 4BXXH 4WJQA 1GUAB 2BW2A 1HPCA 2CHXA 4N8X1 3C3LA 2RQXA 4A3BH 3NXWA 1BQQT 2A6HD 2BBCA 3S17H 4LUZA 1L1OA 4IDIA 4YCVA 4C3HH 2VUMH 1UUPA 2MFIA 1AP0A 3FP9A 4BBSH 2O6VA 4DK5A 4A3EB 2WIIB 5TR5A 2ES2A 4JX1C 2WP8J 1TQOA 1U4LA 2CQOA 1L6UA 5J1ZA 1KQSA 2N7DA 4CDCC 2JF5A 4NXML 3RN2A 4CDFC 5EJWA 5C3EH 2EMTA 1FJGL 3GTLH 3WWVA 2KC1A 3VVWB 1GNUA 2FAZA 3ER0A 1V49A 4OO1H 2JRIB 4TSSA 5EBCA 1K51A 1DOKA 1XMOL 2L4NA 2F0QA 2ENBA 1OXSC 4NB3A 2WFWA 4N9TA 2B76B 3R3MA 2IJ0A 4PZ6A 2A73B 5E6OA 1SYFA 1YJJA 1LQBA 1E8WA 4JI7Q 3HIZA 2LFNA 1QOBA 4MGYE 5EDSA 4KGTA 3CHBD 3DWQA 1N36Q 1CI3M 1I6HH 5AFWA 2HD3A 1CK1A 2A6EC 3ONSA 4H13C 3VR6A 4UDUC 2NN6H 5EAYA 2KWDA 1PFDA 1R4NI 3UI2A 3GV3A 4M8NA 3EVQA 3SFDB 4C7ZA 4IZ8A 3CPFA 1MHWC 1LUZA 3UI3A 1S5CD 2O2LD 1WYWB 2IBIB 3R7QA 1RL2A 4X3KA 1A15A 1WOCA 2Y0SB 2K75A 3T4AC 4BWGB 4KX6B 4LNNA 3EFCA 3TS2A 2XK5B 3JAMc 1Y1VG 1XEEA 3AE3B 1KNAA 3HS0C 4B9KA 3EBEA 1F2RI 2B63G 4QCLA 4DR5Q 2W54A 3ULLA 1PGAA 3NJTA 3LXFA 1AE3A 1WD0A 3P2BA 3PT2B 3PZ8A 3AM9A 1BKBA 1EYCA 1SMXA 5IE8A 4M0WA 1FXIA 3D6WA 1PRTB 1QVFA 3I4MG 4JV5L 3SU8X 4A93H 5EQ0A 3A9KA 4ZYNA 2F0HA 4HROA 2BQQA 5ELNA 1B8AA 2D62A 3L3OC 3V05A 2ZCCA 3IAM1 1KL9A 2JA8B 4DR7L 3RZWC 2WNMA 3K7UC 3UE0A 4ZRJA 4IUTA 4DUYL 1J5EQ 1EF1A 4BFRA 1OTRB 2Z0SA 1BMLC 1Z2MA 3A56A 2IO3B 3I91A 3KF6B 3KLSA 3R66C 1W2BA 4A3JG 1N34Q 2BB6A 1OFFA 1HZ9A 1SNMA 2BWES 3QC8B 4WQOB 3TIXA 1JWSD 4EEWA 1SMYC 2INPE 1E90A 3OLMD 3PREA 1VLBA 4TV3A 3QAQA 4NQLB 3NVWA 3DWAA 3H94A 3T51B 1TKGA 2LHEA 2Y3AA 2X6GA 4BBRH 2IHEA 2R92B 3ZGZA 2Q8IB 1AEXA 1HXYD 4XT3B 1O80A 2J52A 2LRWA 4LK1C 4S3SA 3HOYH 1H9JA 2F0FA 2LI5A 1T5XD 4B0EA 3CCLA 1TU2B 3R3OA 2C60A 1EY5A 4NXNL 4KLKA 2OHFA 3H6NA 1ESRA 1CMXB 1KAAA 2BS2B 2OTJA 2M9VA 1SE3A 1FEHA 1HTOA 1V9JA 2Y5CA 4KKJA 4US9A 2K50A 1YJ9A 3C0RB 2KACA 2PMZB 4OL7A 1PTOF 5IO9A 1WE6A 2K14A 2C7MB 4AWJA 1PZID 1Q46A 3SDZA 1WGYA 3D6CA 4LJOB 3L2PA 1X55A 4G11A 2IY5B 3QK0A 1AWDA 2WQYB 4BA1I 4O42A 1PZJD 3GTPH 3VRBB 4DV1Q 2PPBC 2K39A 4IURA 2GBKA 1XTDA 5A2QL 1BBWA 2KMAA 2V1YA 3AULA 3TSSA 3WIMA 1Z6HA 5KIXA 1YX6B 3SR6A 4MTNA 5LMNQ 3DEPA 2GVBA 2VS1A 5FLXc 2VW9A 2UUCL 4KY5A 2V3NA 3PHXB 3RMKC 3T8MA 1IUEA 1EF5A 3F2BA
chains in the Genus database with same CATH topology
1BF4A 4KGSA 1HQMC 1QNUA 1NENB 2WXHA 1UEAB 2GI9A 4Q5VA 4RGMA 5KRUA 2PZUA 4M1UB 1LLRD 3FPUB 5FO7B 4HMIA 1GHKA 2VZKD 2F0NA 3FVQA 3HOZB 1NCVA 3NWTA 4XXEA 5JEAH 1MHXA 2WXNA 1F2RC 1J7BA 5I9PA 1VZ8A 3PUYA 3GTJB 2L52A 3GV6A 3HP3A 2EPBA 2EXZA 2WXQA 3I4LA 1F0ZA 3PIO3 4NAMA 1FFUA 1WGKA 1C78A 4IUUA 2KHSA 1NYRA 4MHEA 5EE1A 1RODA 2CJNA 2L55A 1PTOH 4N6EB 1SJED 2BE5D 1TY0A 5AUIA 3R93A 1WTOA 4F87A 2YYZA 2FJ2A 3SVMA 3KWLA 1U4MA 2X69A 1H9SA 3I9V1 1ZDVA 2INNE 3L7ZC 1D1IA 4FVMA 3OIPA 2SDFA 5A35A 3GTQB 1PRTC 2B8GA 4V190 1R4QB 2XWJB 4K2LA 2EELA 2QDBA 2B2TA 4C2MB 3MTSA 4HEDA 2IX0A 2H89B 2PYKA 1B9RA 3IFDA 3PMFA 4K8JA 2V0GA 5D7GA 4HSVA 4ITKA 3Q8AA 4C80A 2NTTA 3E0JA 1E0ZA 1TWAB 5C5LA 3N9YC 4LTUA 4K14A 3PUZA 1I6VC 1WWTA 5E6JA 4BS9A 4XDCA 1B3AA 3QB3A 3HRZC 5JEAJ 3BDLA 4ZLTF 3BVGA 4RA8A 1LTGD 4DAPA 5CV4A 5JVH3 1QOAA 2B2UC 2MP1A 4BY7B 4OHJA 1MD2D 3I90A 4OZCA 1IW7C 2EYPA 2ACZB 1C8CA 1TKYA 1B44D 4IKGA 3T3NA 1TWHB 1II3A 4GLSC 1U9RA 5E3FA 2FFKB 3GTMB 5EE9A 1E2ZA 2M0AA 4IFDI 1DM0B 2I2YA 1RKNA 1ZDXA 2FE8A 3SEBA 2WXOA 4G7HC 4NKLA 4ODGA 5CMDA 3MFYA 2KEEA 5ELBA 3K5NA 2J0TD 1SB3C 4WWMA 3R8BA 2JEAI 5EPJA 2A68C 3Q8CA 4KKUA 5J22A 2WXIA 2EZVA 4NMZA 3D4DA 1WYGA 1XCQL 1R4PB 1G6ZA 1DD2A 4RGNA 2WV6D 2F0IA 3O13A 3TP8A 1VR9A 1YNND 3ZYYX 1A70A 2TMPA 2JA6B 4FP5D 4C3JB 3AEGB 4N59A 1BCPB 2QILA 5DAUA 1C4PA 3M7GA 5CC4A 1SNCA 3MHBA 1JE4A 4OZBA 2D2CC 1EYDA 1SBBB 2QMTA 2HTME 3ZJUA 4DF7A 3Q8BA 1CZGA 4G7ZC 2FHTA 5HFYA 2KUMA 1QT9A 2J4XA 1I4XA 3MJ5A 3WCQA 1O78A 1B53A 4DN4M 1GXDC 2B2VA 3Q8FA 1JB3A 3DXJC 5FLXL 1NR4A 4TQ0A 4WAFA 1IBXA 3AH7A 3RUZA 4ZKCB 2B63B 2JYTA 4F8MA 2F0KA 4HCSA 4A3FB 4KN7C 4KD4A 4ARIA 5JVG3 1PDQA 4HJGE 4DK0A 4XDXA 3BS1A 3HOUB 2BA0A 4L63B 2AQ3B 2MJEA 2A74C 3C46A 2FMCA 1EM7A 1PRTD 4YSXB 4KGRA 1TS4A 1A3TA 3AN1A 2EYOA 1SF0A 2C5CA 1ZUD2 2V4IB 4TRDA 3H0GB 4AS1A 2LEKA 4HRSA 1Q3LA 2K5PA 3X3NA 3GTOB 3ZJVA 4DFAA 2M56B 3ZQ4A 5M3FB 5E4WC 4C3HG 3DEOA 3J7AV 2BS4B 2E2JB 1FNWA 2BDNA 1HFNA 3NWSA 1C48A 3RFZB 5EBDA 3BWUD 1HA5A 3FILB 2WU5B 1HTLD 4DXFA 1WD1A 1QILA 3P75A 1HUMA 1TKWB 2X6LA 3OSOA 3JAML 2N0SB 4IN3A 5M5WB 1ILPA 2O5JC 2LS01 5FO9B 4CKBA 1A3VA 2H88B 3CIRB 1XLQA 1FRRA 2OEDA 4ZYSA 2HDMA 2L9HA 5H92C 1V1OA 1YQ3B 2DN8A 2QEJC 3AEEB 2Q8TA 1ENFA 2ZT9C 5EPKA 1L5PA 2V4DA 2PKOA 5CBEE 4FXCA 3GQBA 2CHBD 2F1MA 1JOQA 2L83A 5DNFA 4ZK9B 3AB9A 2WXLA 2RSNA 3TEZA 3ND9A 3SE0A 1SJHD 2MJ3A 4LK0M 3SK4A 1UGJA 3Q6SA 4FYDA 1X3PA 2WDRB 4IUVA 1EWHA 2KOLA 4HR7B 5CV8A 4YTPB 1E7PB 3AE6B 1VRAB 1DOYA 1ML0D 1SYGA 4DQOC 5C3WA 4MM3B 2JP1A 1RJTA 2FINB 4ID6A 1NSNS 4C56C 2F3VA 2XRQD 2KMMA 2A69C 2FBWB 1FCCC 2DLBA 5IGFA 3PUXA 1JROA 2EJMA 4OO1G 3U2SC 2OF1A 3J81E 2L11A 3TP7A 3GB1A 2B2YA 3PIP3 2QCPX 1PMRA 3TN2A 5JEAG 2NVXB 3TEYA 3NBHA 5I2XA 4IOIE 4CKCA 4R3DA 1WXQA 1V1PA 1Q8IA 4FXKC 4XYOA 5FKAC 1H9KA 4F7XA 2F0DA 1FR3A 4A3BB 1SNDA 1HUNA 1SNOA 3S17B 1WTVA 4KHVA 5BN3A 1M4VA 3GD7A 1PTOC 2HCCA 3AEBB 1IBXB 5LL6S 4B9WA 3GTLB 1SYBA 1RWSA 1D5XC 3AEDB 2EVBA 1Q90A 2XIWA 3MXUA 1MGSA 4HCEA 2IGDA 2YEPB 1V8CA 1ESFA 1I6HB 3OW7A 4MACA 2E2IB 1AW7A 4QF4A 3SXHA 1QOHA 3HG9A 4GDKB 3K57A 1ENAA 4PQXA 4J6HA 4MN3A 1L0VB 1E10A 5BMHA 3IT4B 3CWIA 4JWUC 5CBAE 4ZOHC 2AQ2B 1PDXA 5FK9C 2KCCA 2PCFB 3S1QB 2MH7A 3RZOB 4WURA 1GJXA 3LB8C 3RPFC 3MFGA 3KQ4A 4YXDB 1ET9A 2EYFA 3Q8EA 2W55A 4USAA 1FM0D 4C3IB 2PQEA 3TZDA 1G91A 4BA2I 1LT4D 3B2GA 1I4RA 1Y56A 1H9RA 1DONA 1A3UA 1GUGA 3OMCA 2ZXRA 1Q12A 1D4BA 3SK8A 4FF1A 1UWXA 1FD6A 2L1BA 3KK7A 1V8QA 1MHHE 1YNJC 4IUNA 2CU3A 1QF6A 2B2UA 1GUSA 3VR9B 2NBFA 3NVVA 3RZDB 1CTMA 2ZXOA 4P16A 2BE5C 1Z47A 1SMYD 3AECB 2Y5PA 2DWQA 3H8HA 3OWEB 5EKKA 4A3MB 2Q8RE 2F0MA 2AQ1B 1JQ4A 2JYEA 3HUIA 1WTRA 3E56A 4TQUS 5I6WA 3VR4A 1BUVT 2KCNA 3M85A 1XO3A 3Q0AA 3NRZA 1DCZA 4XWTA 2J53A 3TZUA 4RNAA 2WXMA 3H6MA 1KRHA 2LKVA 4RCOA 3NVYA 3V96A 5AUKA 3KBGA 3KLSX 1Y8NB 3VR3A 4CJ2C 3K59A 1S5FD 3ONAB 4K6DA 2G9HD 1BO0A 4PT5A 1KLGD 2EY2A 2B2YC 1F77A 2QKIC 3I72A 3VYTA 1LT5D 4DAVA 4XTCS 1J9OA 1SEBD 1XYIA 1F9RA 5LL6X 2W3RA 5D3DA 2WXFA 3MP9A 4XYQA 4TMAB 4X3UA 2ID0A 2NVYB 3ETRA 4ME5A 3VRAB 1ZXHA 5CV9A 1DGJA 3U4EG 1L0XB 1ACCA 2F4IA 1JWAD 1EY4A 1D5MC 4H2AA 5IIFA 1TYGB 3MXGA 2RDFA 1C4AA 1ZOYB 1GAQB 3AE4B 3SK5A 3VYSA 3HVDA 1WVLA 1ILQA 2YU9B 4RF0A 4ARCA 2CVRA 1NYQA 3NQTA 1AZPA 2KN4A 3V2TA 3ITPA 1EY6A 4OIJA 5C3JB 1HQRD 2IGHA 1STHA 5TSSA 5BYQA 1STBA 1KTKA 5C0XH 3HVZA 3BDOA 1QKZA 5D14A 5C6AA 5IGGA 4K6LA 2K32A 4DGZA 4QB4A 2NN6I 1WTXA 1KFYB 4ZHPA 1UAPA 5JXVA 2NN6G 3NTIA 2LUMA 2A69D 3OPOA 3KLRA 2K33A 3HGBA 4EQPA 1XXGA 5C2TB 2IT1A 1D2BA 4NDXA 2K5DA 2N9LA 4L8JA 2DYMA 2K05A 3SFEB 4RCNA 2MGSA 5C4HA 1YN5A 1SNQA 3BVMA 2WDVB 1R7SA 4RGTA 1JALA 4R8IA 3RLFA 2PO4A 4XT1B 3G6JB 4IUPA 3LYYA 3QOJA 1MSGA 2E74C 1I7HA 1UNSA 2M00A 3TDQA 2IL8A 2F0VA 2GB1A 1U4PA 5KNCA 2DNCA 3EROA 4PNYA 3FEWX 2RMMA 3MA2B 1LTSD 1L6VA 2E2DC 1DXMA 1ZKOA 1FYCA 1VF7A 5M5YB 1Y1WB 5M3MB 1IKLA 2I07B 1EU4A 2LGIA 4K2KA 3HOYB 2RSOA 1UWMA 3IXSA 4FF3A 1FNUA 3I3CA 4HTHA 2KEDA 3LNNA 4LLGM 3BK1A 1WTQA 1S4ZA 3EQLC 4AYBB 2NMQA 4HSPA 4A8XC 3A55A 3L9AX 3P4RB 3HOVB 1C79A 3DUZA 3PO3B 1CM9A 2GRIA 2D9UA 4ZAIA 4MIUA 1S5DD 4ZRZA 5JAVA 3GO5A 4V0BA 2E75C 2L1AA 3IL8A 2MPMA 3NBIA 2BB5A 4PV1C 2BYTA 3SHLA 1EIGA 1OXVA 4RWSC 1NR2A 3GS2A 3S16B 1N60A 2QSDA 2RVLA 1PGXA 2JSOA 3GP7A 1V43A 1YN3A 3VR8B 3JAME 1Q1EA 1HA6A 1DZ1A 1QOFA 3Q23A 2KAJA 1FIQA 1A6XA 3NS1A 3BZDB 1EYAA 3D8GA 2RDGA 1FCLA 5CR3A 2I46A 2O5IC 1P7EA 3BIID 3OMGA 1PUTA 3J80E 2LHDA 3D4WA 5M9OA 1B2TA 1PLFA 2NTSA 2EYJA 1SIJA 3PO0A 4N58A 1PFNA 4KTAA 4A3GB 5BYSA 1VDZA 4A3IB 3QO2A 1J7AA 1CA6A 2JX5A 3HKZB 3U9OA 2K03A 1O7YA 1MPEA 3M4OB 3MVVA 4IFDG 1C4CA 2PW7A 1TWCB 1FRDA 4WRDA 4DU9A 4MT5A 1X3QA 4FXDA 3K7AB 1AZQA 2DYOA 1JC7A 2LFIA 2MUYA 2I38A 4LAAA 3EUB2 2JU6X 5KYLA 3DWMA 2CJOA 1F2ZA 1CZWA 4KK7A 1TKEA 2WXJA 2VZKB 5C5MA 2ZXPA 1XF5L 5D3IB 3DM1A 4KHZA 5EKLA 4G57A 4CJ1B 3DMUA 3N6RA 2YEPF 3P4SB 2EYMA 3NPPA 4KI0A 4J1MA 1KH0A 3MZ5A 4TQ1A 4NZLB 4C3JG 4C7YA 2F0LA 2VNUD 3EA6A 1JRPA 3PZ7A 1D5ZC 1EZ6A 2E76C 2FMMA 1NUCA 4IFDJ 4YSZB 5HURA 1SDFA 4RF1A 1YNJD 2PW5A 4WORA 4K5XA 3S15B 3B2FA 3E6ZX 1IW7D 3EFXD 2XNAC 5T1IA 3DHQA 4IQZA 4BY1B 3A7AB 1N62A 1NEKB 3BK2A 3NE5B 4O1NA 3U9SA 2NVTB 4KMUC 2F0EA 1TS5A 3NSWA 5MPOA 3HEJA 3MHZA 5I4DA 1L4ZB 4B9XA 2BA1A 2O4XA 2LMCA 1N61A 4YSYB 2WP9B 3BYYB 2EOTA 1XLPA 1K50A 3W3AA 1PTOD 3S1NB 1EWCA 5LHY1 3PO2B 3URYA 3NP8A 5KEEA 3K58A 2WDQB 4D2KA 1ICWA 2BDOA 3BG3A 1EL0A 2R6GA 1P7FA 3WDNA 1YNTE 1Q1BA 1GB4A 3TBIB 4CJ0B 1ZXIA 4P6VF 1QQRA 5C4ZA 3K6OA 1B9NA 1B1ZA 1E6EB 2KECA 3H09A 1MVKA 1JOOA 2J42A 3VYRA 3TEWA 4HAEA 4GDLB 4CQNA 2R3ZA 2BCOA 1WRIA 1RM6C 1JW9D 3W9CB 1T5EA 3FAHA 1N5WA 3NUCA 1B9MA 2EY5A 5FO8B 3T16A 2F0PA 4HN7A 1JCKB 1STEA 2G9DA 1HTPA 5C44B 1FGBD 3SR1A 5BN4A 4J8QA 5ELDA 4EVOA 1K8OA 2K3UA 3ERQA 4Z9CB 4C3IG 3LWUA 2H1EA 2QF7A 4M8AA 1OXTA 1CJEA 3LX0A 3M4YA 4HEA1 3HOWB 1BXTA 4DA2A 2JXMB 4EE2A 1RDPD 1ZEQX 1OQQA 2B2WA 3MAQA 1QNKA 2BTEA 1Z7TA 1WCMB 2VUMB 1I50B 2SNMA 3OOCA 2B39A 2EKIA 3T3OA 3QOLA 2V3PA 5C3EB 4C1NI 4DXGA 2K04A 5CV5A 4CGYB 2ICEC 4FF2A 1KF6B 4OVZA 2JA7B 4FXGC 2L5TA 2AUJD 2F0SA 1SSOA 2XWBB 3ND8A 1MBYA 1LTAD 2RA4A 2A68D 3I4NB 4REZA 1YQ4B 1FO4A 1XCTL 5GXGB 2F0TA 3I57A 1G2SA 1RCVD 2ZW1A 4ULLA 3A8JE 5EKIA 2PVOD 1XTCD 3NQIA 5DM73 3IFTA 4A3DB 4HKQA 4A3KB 2MJ8A 5HGTA 4HKZE 4WH4A 2K0PA 2PW9A 4RH6A 2JQRB 3MXNA 2EYHA 4R8NA 1CZPA 4F88A 4XE0A 2M19A 3X3MA 4R9WA 4A93B 1A2TA 2F03A 1QG7A 5ELEA 3W2DA 3QG1A 4PMBA 2PZTA 3J80L 1CHPD 3IAYA 4FF4A 2VB3X 4DAYA 1RTNA 1MSHA 3OHXC 2K5QA 1GUWA 1SAPA 2ZW0A 5T8IA 2BOSA 2K6AA 3MEHA 3A54A 5HHDG 4ZRPA 4XDDA 2F0GA 2A5HA 3P4PB 3Q69A 3BVZA 4Y7NB 2J7ZA 1E9MA 4QUCA 2W3SA 3OWFA 1FMAD 1STGA 3PUVA 2N88A 4C1NK 4Q2JA 4JE3B 4EGVA 4NJCA 1HZ6A 3NUHB 1G2TA 2SOBA 4NW2A 2WLBA 1QJOA 1K53A 1VMPA 3M7NA 3CRLC 1W6KA 1KNEA 5EGTA 2WAQB 3NHHA 4RFBA 1STYA 3E5SA 2KA7A 3A8KE 1LTRD 3EGRA 1CHQD 2M2LA 2IX3A 1T6BX 1JOKA 5C4XB 3GTPB 4IALA 1VMCA 3MC0B 1LT3D 1GB1A 3TEXA 1CQVA 3V3XA 5K36H 2R7ZB 5C3XA 1LTBD 3AE8B 3S9WA 1LTID 2AUKA 5BMGA 4JBWA 5D65A 3QJYA 5EE3A 5G3LF 1XLNA 3R2IA 4KKTA 4L1BA 2R61A 1U4RA 1EQVA 2E2HB 4C3HB 1C9FA 3Q22A 2AWOA 4BBSB 4RAUC 4NAWB 2B2WC 1ZYRC 4KKSA 4K5VA 1LT6D 2WXKA 4PMCA 4FNFA 3TMEA 2WXGA 1LV9A 4EQOA 4MH8A 2JEBI 2MHVA 1ONLA 3I70A 4KV6A 4CBVA 3RD4A 1OQRA 4PMWA 3T56B 5I6YA 1TWFB 1BNZA 3HRDD 2JSVX 2IPKD 2NWGA 1IKMA 5M5XB 5KGUA 3K5LA 4RHRA 1AN8A 4L2YA 4ZRQA 4OGQC 2AWNA 2LY7A 3AB5A 3AE5B 1DYQA 3NZ3A 1D1KA 5JJZA 4IFDH 3KBXA 4QUFA 4YTNB 1FNVA 4HMJA 1TS3A 3AU7A 5ISRA 3AE9B 1OXXK 5I2YA 1CT1D 1BCPC 4RGOS 3AEFB 3PUWA 1VCIA 1PFBA 3H3VC 3AE7B 4JPSA 3FILA 4OW0A 2K5WA 3J81L 1EOTA 1TY2A 1RYJA 3BDCA 3W5UB 4DNTB 1BCPD 3WOFA 1B4OA 2B2VC 2PZWA 2JE6I 2RKSA 1DOXA 5KNDA 2VXWA 4L6TB 2WU2B 2WKCA 1XLOA 4DNRB 2A6HC 2CW0C 4K5WA 5C4JB 1QOGA 5CORA 2E3TA 1F2LA 4I7ZC 1XWEA 4QMGA 4WIPA 5G5HA 1JICA 2EE1A 4A9AA 2F0OA 3E9SA 4E6IA 1I3QB 3IT6B 3K0YA 2D5DA 4Q0FA 1BBXC 5DEHA 5FR3A 5IGCA 4JWSC 4XWWA 3HOXB 1E2VA 4IUQA 3NK9A 4BBRB 5KNBA 1TWGB 1HFGA 1KDBA 2FUG1 5IODA 3K5MA 4WQMA 5A2QE 3KWVA 1H9MA 1LABA 5ELFA 5IGEA 1TJEA 1GUOA 3Q24A 4XIGS 1NAPA 4TKOB 3S1MB 1YMHE 2K1BA 1DOMA 1DOLA 3FRPB 1ROEA 1TR5A 1G291 2RDHA 4H0LC 4X3TA 1RTOA 3AE1B 4A6QA 2HCIA 5C0XG 3AE2B 2HUGA 2L12A 2N55A 2Z4HA 1IL8A 2L0CA 1AYFA 3QIAA 1WTPA 1IYVA 3FC4A 4ILWA 1NVID 5H8YE 3J9CA 1GOZA 4KKIA 3AMZA 1HEZE 4YT0B 1WTWA 1Y8OB 3P1HA 1R9TB 2XRSD 3CKIB 1VZ7A 3KF8A 3S2DB 1EEID 2ONQA 3I73A 3T13A 4G7OC 2ICIA 4YTMB 4XQJA 1QB5D 1HCZA 1K8MA 5FLXE 2K9XA 5IGBA 4ZKBB 2QIEB 4A90A 4US8A 1PRTF 2B2TC 2JXTA 1Y8PB 2NUCA 1SXTA 2XN9C 1KLUD 2PIAA 1OO9B 4QIWB 4K8IA 4KY7A 1PTOB 1JR0D 1VJKA 1YJIA 2K28A 2WXPA 2WACA 4X3SA 2SNSA 3D31A 3W5VB 1ET6A 3J7AF 2N7JA 3R2TA 3U52E 1O7ZA 3FMCA 1EU3A 1NI3A 3EJIA 5JPMC 1PZKD 2PVGC 5KYIA 3GTKB 4LJZC 1SNPA 1CA5A 1Q10A 3HZXA 4DK1A 3MWYW 3F2UA 1XX8A 1HZ5A 4G4KA 1JWBD 1X32A 3CQZB 2Z8LA 2G1EA 5NUCA 3VYUA 1A2UA 4L23A 3S1RB 5FOBB 3K5OA 3VQIA 2XSCA 2B8FA 2CW0D 4ZQ3A 5LNK1 2F0JA 1N5XA 1FFVA 1EIHA 2LJIA 2KJXA 1EZ8A 3P42A 2WXRA 5E4XA 3TP6A 5E1FA 1F2MA 5C0XJ 2D5GA 4YIJA 4KY6A 1SE2A 2PNRC 4KN4C 4KJNA 3FDTA 5I9OA 4XQNA 2JZPA 1FD7D 1SYCA 4JK1C 5HG2A 1FXAA 1C4QA 2JYOA 1I4HA 3U7ZA 2OT2A 2KQ4X 1V97A 2IDYA 1GUNA 2Z4IA 3T53B 5CV7A 1K52A 3ABVB 4CHTB 1IGCA 1PXUA 5IOCA 4OO1I 1QCBD 2DY8A 4KJOA 2DY7A 2A6ED 4FO2A 2IGGA 2SAKA 1F9PA 4LMQD 1PFMA 1IGDA 5HI1A 1EY9A 1QLBB 5G3LD 3I8ZA 2EJGC 5JPNC 4RKBA 1SYEA 4J3OD 5F2DA 2MEKA 2PTLA 1DJRD 2KVMA 4RKLA 2IWHA 2EY6A 3VR5A 2NVQB 5ELCA 1QE6A 4UAIA 1KABA 5IT9L 1JORA 4AQ7A 3LWEA 3AMUA 5IT9E 3IKJA 1C76A 4A3JB 1J7CA 2W82A 2IW3A 3QWNA 4ZHOA 1YNNC 1PGBA 5BN5A 1F2YA 2F0WA 2C9OA 5CV6A 1L4DB 1MI2A 2F3WA 1BDOA 3WOEA 3FKIB 5CYUA 1N63A 3OIQA 1VZ6A 3G7LA 2EDGA 1K83B 3S14B 5JOBA 1HRJA 1LTTD 1EWYC 2NYZD 1JWUD 1BUIC 5C0XI 2DBYA 2BT6A 3DWPA 3KUPA 4ABNA 1BCPF 1IHZA 1WSPA 1L0YB 2K7VA 1O7LA 2X38A 1ZPSA 4YWGG 3J7YW 3FPPA 1W6JA 1GUTA 2HQEA 1SFOB 3AEAB 1H9SB 3P1MA 3AV8A 5COYA 1F9QA 5K5PA 3A8IE 1D6EC 1GHJA 1ZXTA 1EY0A 2Z1CA 1SYDA 1MI0A 1B50A 1C77A 2BS3B 4RHSA 3H91A 5CGKA 1JWMD 1S5BD 1SSNA 4U673 2AX5A 1TZOA 4H7BA 3CRKC 3SK6A 2WINB 3M3YB 1I4GA 4H44C 2Q5WD 2NB0A 1KDAA 4KD3A 3N52A 2SEBD 5IGDA 3P63A 1PYWD 2VB2X 2LMCB 1JQYD 2RPVA 2WS3B 1EQTA 2KQ3A 3CU7A 3TUOA 1BOSA 1F9SA 4EQNA 1G8ZD 2PLPA 2HDLA 2L32A 3C1FA 2H4OA 1T3QA 4U68A 3VA5A 3VA7A 3NTKA 2KDMA 2OXPA 4OZAA 4N9PA 1TIID 3L4PA 1GPXA 3VR2A 5G5GA 2IX1A 1EFID 1I4PA 1LACA 4XQQA 1QWYA 1V1PB 3D4RA 5K36G 3C1EA 1JMLA 4OIKA 3P7JA 5DM63 4A55A 1M8AA 1ZYRD 2HDEA 4B0MA 2XVSA 1IYUA 1KDCA 3A7LA 3I4MB 3DWGC 2ON8A 1STAA 4I65A 5J39A 4GZYC 1J8IA 2RBMA 3NVZA 3C8YA 5BMIA 2K01A 2N9KA 1TT2A 5EPLA 3MXPA 2EY1A 1SE4A 2OEOA 1YN4A 1OXUA 1VF5C 1CQFA 1Y1VB 1S5ED 2E6XA 2MJDA 3PV0A 2QJLA 1STNA 1LO5D 1DOIA 3ZJTA 2EJFC 4NP5A 1TS2A 3RMHA 1RHPA 1AFPA 4ZUIA 3P20A 3TP5A 3IAS1 1I4QA 1Y69U 2WKDA 2NZ1D 3BYTB 2TSSA 1E2WA 1ENCA 5T1GA 1EEFD 2DNEA 4CKEA 1EY7A 2JA5B 1RD9D 3W1SA 1RF2D 2WB1B 5EE0A 2K22A 4WFN3 2F0UA 4ZUJA 3D3RA 2GA4B 3S2HB 2PMVA 2JWUA 2EYLA 1EY8A 4P2CB 1TVXA 1HHVA 4B08A 3NTHA 1CFMA 1RFKA 1VDVA 3P4QB 2CQAA 2R93B 5BYRA 3C2PA 1ZP0B 4WJWA 1ZE3D 3B9JA 3GTGB 1BR9A 1E0BA 2BW2A 1HPCA 3C3LA 2RQXA 3NXWA 1BQQT 2A6HD 2BBCA 4IDIA 1UUPA 1AP0A 4A3EB 2WIIB 4JX1C 2WP8J 1TQOA 1U4LA 1L6UA 5J1ZA 5EJWA 4OO1H 4TSSA 5EBCA 1K51A 1DOKA 2L4NA 2F0QA 2ENBA 1OXSC 2B76B 4N9TA 2IJ0A 2A73B 1SYFA 1YJJA 2LFNA 1QOBA 4KGTA 3CHBD 3DWQA 1CI3M 5AFWA 1CK1A 2A6EC 4H13C 3VR6A 4UDUC 2NN6H 2KWDA 1PFDA 3UI2A 3GV3A 3EVQA 3SFDB 4C7ZA 4IZ8A 3UI3A 1S5CD 2O2LD 4X3KA 1A15A 2Y0SB 3T4AC 4BWGB 4KX6B 1XEEA 3AE3B 1KNAA 3HS0C 1F2RI 4QCLA 2W54A 1PGAA 3LXFA 1WD0A 3PZ8A 3AM9A 1EYCA 4M0WA 1FXIA 3D6WA 1PRTB 5EQ0A 2F0HA 4HROA 3V05A 2D62A 3L3OC 3IAM1 2JA8B 2WNMA 4IUTA 1BMLC 3A56A