1TS2A

T128a mutant of toxic shock syndrome toxin-1 from s. aureus
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISALDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of five mutants of toxic shock syndrome toxin-1 with reduced biological activity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
total genus 57
structure length 194
sequence length 194
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1997-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ts2A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ts2A01
2XNAC 2IJ0A 1PRTB 1SXTA 1LT6D 4K6LA 1ET6A 1L0XB 2TSSA 1BXTA 1AN8A 1HXYD 1TY2A 5D3IB 1LTGD 3BVMA 4TSSA 3BZDB 1D5ZC 4RGTA 1I4GA 2AQ2B 5FKAC 1B44D 1FD7D 2XN9C 1PRTD 1M4VA 1SE4A 1D5XC 4RGMA 1SJED 1TY0A 1LO5D 1FNWA 1HTLD 2RDHA 1BCPD 2XRSD 1YN5A 1EFID 1PRTC 1I4XA 1LT3D 2QILA 2XRQD 1JCKB 1RDPD 1G8ZD 1T5XD 1TS4A 4RFBA 1V1PB 1CQVA 1PTOF 4RHSA 1EEFD 1UUPA 1EWCA 3GP7A 1PZKD 1LTAD 1SE3A 5D3DA 1BCPB 1D5MC 1CT1D 3R2IA 2WV6D 4C56C 1YN4A 4Z9CB 1L0YB 1UNSA 1JWUD 3V05A 1S5BD 2IPKD 2ICIA 1V1PA 3R8BA 1PRTF 3BYYB 4L6TB 3DWAA 4BWGB 1PYWD 4DXFA 2Z8LA 1PTOH 2CHBD 1LLRD 1JQYD 1PTOC 2AQ3B 1I4PA 1I4QA 5ELEA 3DWPA 1XTCD 1EEID 2G9HD 1RD9D 2NTSA 4O1NA 1D6EC 1LTTD 1TS2A 1KLGD 1LTBD 1RF2D 2NTTA 1B1ZA 1KTKA 3BYTB 1GOZA 4RGOS 1JR0D 1S5DD 2RDGA 4RGNA 3MFGA 5TSSA 3O13A 2R61A 3EA6A 1PZJD 1SEBD 3EFXD 1ET9A 1SJHD 1FNVA 2O2LD 1FNUA 4L63B 1JWMD 1BCPF 1BCPC 1JWSD 1QILA 4OHJA 3SEBA 1CK1A 1TS5A 1I4RA 1LT5D 1HA5A 1SBBB 1XXGA 1STEA 1PZID 1ENFA 3CHBD 1LTRD 1YN3A 3BVGA 1CHPD 3URYA 1EU3A 5ELCA 3KLSX 1ESFA 5ELDA 5ELBA 1LT4D 5I4DA 3TSSA 1PTOB 5FK9C 1LTID 3DWQA 1LTSD 1SE2A 3MC0B 1RCVD 1HQRD 2SEBD 1KLUD 3OWEB 1S5CD 4RCOA 1CHQD 4ZYSA 1F77A 3BVZA 2J4XA 1V1OA 1AW7A 1S5FD 1S5ED 1EU4A 2AQ1B 1PTOD 4RHRA 1DYQA 1TS3A 4UDUC 4DXGA 4RH6A 1MD2D 1DJRD 2QEJC 1I4HA 3R2TA 3W2DA 5ELFA 4NZLB 1FGBD
chains in the Genus database with same CATH superfamily
3P4QB 4QB4A 4B9KA 5G3LD 2QEXA 4DUYQ 3VH3B 4W9HA 4GSWA 2B2UA 2ZVOA 1EZ8A 3M4OB 4G7ZC 1RKNA 1FCLA 2ZNVC 1D5ZC 3VA7A 3EECA 4RF0A 1WJJA 1YD8U 1B44D 2INPE 3M4YA 4DHZB 2X6LA 3PCOB 3TREA 2NR2A 3A9JB 2D11A 2WXFA 2WXHA 2L5TA 1W2BA 3AE2B 2CW0C 3VHTC 4QL5A 4GGQA 3WANA 3MHZA 1L7YA 3K8AA 4GNXB 1IBKQ 4K0KL 1WR1A 1J7BA 2PKOA 2K6DB 4OIKA 4L8JA 3JAME 3Q3MC 4HIMA 2OHFA 5HKHA 2VUMH 2CU3A 3WAMA 1EEFD 1C7YA 3KYCD 2OTJA 4A93B 1STYA 3RN5A 3RNUA 4ZHPA 2R92B 2NCNA 4N9F4 3HOZH 1SE3A 4ME3A 1TKGA 1X1MA 4BAXA 1PFSA 3IL8A 4OO1G 3CU7A 4MM3A 3FKIB 2PE6B 2UU9Q 4ODGA 3FPUB 1WX9A 3ZNHB 3ZXRA 1C9FA 3P4PB 2FAZA 2ICIA 1MKHA 3BDCA 4BWGB 4DV7L 1PUTA 4ANWA 1CKOA 3M95A 2NVQH 3NZ3A 2G5DA 2NVXH 2M19A 4AIMA 3T4AC 4KHPQ 1FXTB 4NAMA 2Z1CA 4II2B 5EJWA 1BQQT 1UGJA 3GTJH 2UXDL 1U4PA 5BN4A 5IT9E 1MJEA 3FHWA 1LTTD 5IP9H 4WQOB 1WWTA 2MH7A 4N6EB 3NUCA 4US8A 4A93G 2V1CC 1O7IA 4JIOU 1S1QB 1JR0D 4IOIE 1A63A 2JF5A 2OCEA 2HJ8A 3BINA 1AYFA 2LGXA 3ZDMC 4OZBA 4QUFA 3K7UC 3HOUB 1B53A 4FXGC 1NR2A 1YHAA 2L15A 2MBOA 3RN9C 3GTKB 1JWMD 4K2KA 1OXSC 1I3QB 1QCBD 5E3FA 2MP1A 1VQJA 4LF6L 3GTLH 1UWMA 2G45B 3SGIA 2F0PA 1CK1A 2F0FA 4A3CH 1MG8A 4HEA1 3TP5A 5EE3A 2H1EA 5E1FA 2XVSA 3H91A 4AJYB 5LHY1 3PO3H 1E8ZA 3CF6E 4ZRIA 1V86A 4GKKQ 4KZ0A 5M5YB 5IYDG 3WCQA 4A3MB 2GBKA 2GBNA 3VUYA 5ELCA 3A5UA 1PQSA 1O7YA 1A3UA 2LUMA 1K3RA 1STGA 1LM0A 3KOJA 2J0MA 2ZPNA 2F4VQ 2ZJDA 3IHPC 3SU8X 3QB3A 4LF7Q 3VH4B 2HIVA 4LF5Q 1FD6A 1JOQA 1TBEA 1F2YA 1HQRD 3G71A 2F0DA 4CGYB 4FXKC 4RKLA 2HDLA 1WRDB 2LEKA 4IUTA 4UY8C 3DPDA 4JI1L 4PNYA 3TEWA 2UXCL 4POGA 4LDTB 3U7DA 4HJ9A 3VR4A 1ZE3D 4XC2A 1WJUA 4HDOA 2WAQE 5KRUA 1JROA 3E6ZX 3WDNA 4E71A 4CDCC 4QQBX 4DAPA 5HHDG 4IPHA 3PSEB 3FMCA 3H09A 3I2ZA 4ZUIA 3J81E 2J52A 2F52A 4JI2L 2VH1A 2KTFA 3ENEA 3M7NA 1PH7A 3BJUA 1NI3A 3Q0AA 3NWTA 1KF6B 2MLBA 3H8HA 4K1RB 3K0YA 3MJ5A 1PVOA 2INNE 5AJ3Q 4GOCA 1Q12A 2BE5D 4RGTA 4HCPB 1SNCA 3ZNZB 4OEMB 4EQOA 3HOYG 1OQYA 5H8YE 4K3CA 3UI3A 1YQ3B 1I5FA 1SIJA 1V5TA 2KA7A 2Q2IA 2KDMA 4JYAL 2ZCBA 2MSED 1D4BA 1WFQA 1SJED 2REXA 3J81j 4BA1I 3CSTA 3FDTA 4P73A 1PRTC 4F7XA 1GB1A 2K33A 4QUCA 5C3WA 2GB1A 3VR6A 3U50C 4RWSC 1TS4A 1GO3E 4ANXA 4IUPA 5LL6S 1PGXA 3I56A 1XCQL 3X0WA 1G291 1WYGA 2M2LA 3P1HA 2WAQB 4FF2A 4OW0A 2Q2HA 2B2UC 3E0EA 2F03A 5D3DA 2JA5H 2WV6D 5C4JH 4I7ZC 2INCC 1X55A 4BY7B 2AKWB 3C46A 1HTOA 4F8CB 1K53A 1DOYA 1ICWA 2PE9A 4E3CA 3IXSA 4RMAA 1EM7A 1V1PA 1J7AA 2N8NA 1AE2A 4JGHB 1IL2A 3B1LX 2K4KA 2JSOA 4IUUA 2O6VA 1R4QB 3DHGC 3STBC 4R9WA 2L32A 1EYCA 2QW7A 4B95A 3GTMH 2AWNA 3KUZA 4YSYB 1PHJA 4XWWA 3S1RH 2JT4B 2K6QA 1KRTA 3RLNA 1WIAA 3AFQA 4PK1A 3HM3A 1QVGA 5KHOA 4GKJQ 5IYCG 4A3EH 1B9NA 3H0GB 4B0EA 1SJHD 4K8JA 2M4NA 3C3LA 2XIWA 3VDYA 3WA0A 5GADC 2CJOA 3HKSA 4B3ML 2JWUA 4KGRA 4JI7L 4X66Q 2MWSB 2GVBA 3PUWA 3KDFA 1ENFA 4X62L 4A75A 1OGWA 3WOFA 1VCBA 2CR5A 3NS1A 4G3XB 2KVMA 1XTDA 2XWBB 3KLSX 4US9A 2QA4A 5FLXL 4AQ7A 1LT4D 4DR4Q 3GTGB 2PEAA 2DY7A 3KFUA 1HFGA 2QIEB 2ASBA 1B8AA 1LTSD 5EPKA 1ZKOA 3CCMA 2PIAA 4MGYE 2KEDA 3A1QA 1J0GA 2QF7A 3CMEA 4ZKCB 1TIFA 4DK6C 4GKKL 1N33L 3Q69A 4HPPA 1P98A 1WTHA 4RCOA 5CORA 1Y1VH 1WX8A 1V1OA 1Y8OB 2K1BA 2VRRB 2JP1A 2PYKA 1YI2A 3PUYA 4K0KQ 1XMQQ 4JI3Q 1S40A 2Y3AA 5EKIA 2UUAQ 4JI7Q 4B3TL 3K9OB 2CS4A 4P72A 2XTIA 2ENBA 2E2JH 2KC1A 4PT5A 4WJOA 2IGGA 4WJNA 2VY3A 4C2MH 1HNZL 4LLGM 3R3MA 1LT6D 3PRZA 2A68D 4JCVE 4OGQC 2WXOA 2I5HA 4MJSB 4P1CC 2D62A 4UP9A 4YCUA 1F1HA 1T6BX 2BS2B 5J17A 4N9TA 2M1MA 4EE2A 4EQ5A 1AZPA 2DZMA 4GN4B 4ZAIA 1N33Q 5JEAJ 4LTUA 3KUCB 2N1WA 1STBA 2PTLA 1EWHA 2N0SB 1DGSA 1IKMA 2JQRB 3OYYA 4K5WA 3HKZB 2F3VA 4YIJA 4HSPA 1JCKB 1MGSA 2UUAL 1CZGA 2K0PA 2PQAB 4Q5VA 4KD4A 2QJLA 2E8GA 2I46A 4JYAQ 1EYGA 3SDLC 3T51B 3RZFA 2N3SA 4DAVA 4CKEA 1WGDA 3GTJB 3A9JA 2PI2E 3RCZA 5M3FG 2ZTEA 4ANVA 3CC4A 1HQMC 1B50A 2NS5A 2K5QA 1ZYRC 2HQEA 2E5LQ 1WTQA 3F2DA 1HZ5A 3CW2C 1YVCA 1V5OA 4DXAB 5K36H 3V60A 1JQYD 4BVUC 3MA2B 4KK7A 5HGQA 1YHBA 1WE7A 1HZCA 1E9MA 2KCMA 5L83A 1K3BC 2F0SA 3MWYW 1IBMQ 3AMUA 3E3XA 1K8AC 3L0WB 5JHBA 3D8GA 2DAJA 4J6IA 4DV4L 3PVLA 1IGDA 1KTKA 2A69C 1T0RC 3HKZE 4FJZA 4JPSA 2FE8A 3NZUA 3ZUNA 4MTNA 5GAEC 1K8MA 5BN3A 5DM63 3DBRI 4LNFA 4HROA 2JX5A 3L16A 1UGMA 1PZJD 2L4NA 3OIPA 4IUVA 1CJEA 1MHXA 2KJRA 2O2LD 1N6ZA 1KAAA 4LK0M 5TR5A 3GV6A 4K6DA 2JZZA 1HHVA 3A9KA 1SLJA 1BF4A 3IBEA 4XZ4A 2WINB 3AEBB 2MJ8A 3SDZA 1WYDA 3TRZA 2E75C 1QZHA 4MT5A 3RNCC 2RHQB 2BDOA 4XTCS 5JJIA 4CO7A 4CHKA 1HZAA 4LNOA 3DOWA 3PMFA 3RFZB 4CKCA 1SYBA 2IW3A 3TEHB 5KEEA 5L37A 4Y7NB 4F7ZA 3P7JA 1II3A 4IJLA 1V9JA 4ARIA 1IKLA 3SR6A 3I72A 3J81L 3TS0A 3HOVG 1KNAA 1QOAA 4YWGG 2KDBA 3J7ZC 4JV5Q 1WXQA 5JH5C 3I4MH 5L95C 4HTHA 5JVH3 3NENA 4EOYA 4BBSB 1YIWA 1PFDA 1S5ED 4EX5A 1EU4A 1F9RA 1V1QA 4N8X1 4UHVA 1PYBA 3U9SA 3N1ZC 3QQ8B 1WMHA 4OVZA 4C3JG 2ZM6L 2M00A 2Z0DB 1TT5B 2CVRA 5IOCA 4KKJA 1JJCB 1P8LA 5AJ3L 2ZJQA 4CBVA 3RT3B 3CKIB 2PNHA 1WY8A 2V9HA 3RLOA 4XYQA 5J39A 1RIPA 1A6XA 1FXAA 1FRRA 4H7BA 3HFZB 4JI5L 3VYUA 3PO2H 1NBFC 3X3NA 1WGYA 1EOTA 1VJKA 1HXYD 1EQTA 1LTLA 2BH2A 1AARA 2D5DA 4H44C 1T0YA 2K5PA 1GNUA 1QZGA 1TWFB 3DM1A 4HCSA 1LO5D 1VQFA 4WH4A 4JI6Q 2J0JA 1B9RA 2XRQD 1O7LA 4IM2A 4BBRH 3K7AB 1OFFA 2E2DC 2NN6I 4KY6A 1QT9A 1V1PB 4FJVB 5C4XH 1WTPA 4BY7G 1GG3A 3ZGZA 2WYQA 4P2CB 4JI8Q 1AFPA 4IZ8A 1Q10A 5IWAL 1PZKD 2F4VL 4B3RL 2MBEA 1O7ZA 3R2IA 1LQBA 3GTMB 4KHPL 3VDZA 3VTVA 3T1YL 5C3EH 3L17A 4NNJB 1Y1VB 3ULJA 3TP8A 5EBDA 2LUEA 2X38A 4RCNA 2CW0D 1VLBA 1ILQA 4NXNQ 2JZ3B 4ICUA 2DX5B 1EO6A 1NNXA 4WJ4A 1LFDA 1EIGA 2X6GA 3PUZA 1WTOA 5LMNQ 2INDC 2WDRB 1CSPA 2N9PC 4X6AH 1JRUA 2V4LA 4DV5Q 3IT4B 1WJ4A 1GUOA 3N6RA 2NN6G 5IYBH 1OXUA 2NPTB 2EIFA 1HA6A 3GOEA 5IGCA 5T1IA 3I4MG 1GUSA 2WU5B 4IJHA 3U2SC 1RF2D 4JBWA 4X3SA 3S1QH 1U4RA 1H8CA 1ASZA 3ZJUA 4EGVA 1IYFA 1S5DD 2J53A 4RGNA 1G6JA 5CGKA 5CV8A 1N5XA 3DVNV 3EQLC 4MJSA 2F0OA 1LM8B 1KOTA 5I2YA 2GN5A 1V8CA 2JSVX 2JA7G 3OG5A 3DHHC 4V190 3EGRA 1KRSA 3M3YB 2KUMA 4OELB 4IFDH 3AE3B 3HHMA 5JEAG 3KH0A 4ZYNA 4GKJL 2KDIA 3IAS1 1KAWA 4YY3Q 1C78A 4B6WA 4EUTA 2SAKA 4L5RC 1E90A 3CRKC 1A15A 4KLKA 2FMMA 2OJRA 2PW5A 2ZCCA 4OO1H 3APDA 3UF8A 3C1EA 4C3HG 3H7PB 4KDLB 5A2QL 4TQ0A 1I3QH 4K5XA 1RYJA 3NPPA 2BB5A 2Z0EB 4R4TA 3I4NB 1H4RA 4LMQD 3PIOA 1DOIA 2L0TA 5C0XJ 3GS2A 3QHTA 1Y1WG 4EZJA 2FCNA 2DYOA 2EELA 4C3JH 4M0WA 1JWAD 4J1MA 2JU6X 2F3WA 1PA6A 5CHFA 3NVYA 1JJ2A 4DV7Q 3P4RB 1FMAD 4P7IA 2AQ1B 1PTOD 2C9OA 5BYQA 1YQBA 4WAAA 4UDUC 2ZVNA 4NY0A 3HS0C 3TUOA 5M3MH 1ICFB 1DJRD 1MD2D 4IO9A 2QDFA 1NCVA 1TWCH 5IA7A 3SK5A 4WFN3 4ME5A 1BUVT 1BNZA 4F87A 4XQNA 2WNMA 1XPUA 2JQOA 4K7WA 1GD7A 2EXZA 3MHSD 1QJOA 4KIKA 3BK2A 2KENA 2TSSA 1HR0Q 4JI3L 1XMQL 2F0QA 3QO2A 1FPYA 4QY7A 2L00B 2NZOA 3TP7A 1C8CA 1I4GA 2V0GA 2WX0A 2K39A 3U4VA 1K0SA 2FCSA 1YX6B 1Q7YC 2DNEA 4GIVA 3C0RB 2NWGA 1WJ6A 2RSUA 1BCPD 3VR8B 1VQPA 1YITA 5I9PA 2K5VA 3RN2A 1S72A 2KK8A 3U4EG 4NAWA 2IWHA 1YEZA 4HMIA 3AE1B 1VS0A 3DBLB 1E6EB 1P7FA 4DV3L 2LASA 3NSWA 1CKMA 1MJCA 2RPVA 4DAYA 5IP7H 2VQEQ 1Q82C 3J9CA 1UUPA 2DAFA 1E10A 1DXMA 5C4JB 2PVGC 2PCFB 4IFDJ 1F2RI 1XQQA 5M5XB 1TVXA 2F0UA 2ID0A 3HOZG 2I1KA 2QSDA 2JA8G 2D07B 2DZJA 1MVKA 3VR9B 2EJMA 4WJWA 2L1BA 3D4DA 1WGRA 1HZ9A 4DNRB 1UE7A 4LF5L 1RWSA 2LHEA 3QOJA 3DXJC 1MG4A 4JBMA 4YCVA 3PGZA 5IKCM 2N49A 2WKDA 4YWKA 2IO1B 1PDQA 4M8AA 4KSLC 4LF8L 3A7AB 3H6MA 3S17H 1CMXB 3KF8A 2MCNB 4U673 2MP2A 2HQLA 4X57B 3ZRFA 3NEMA 4HJ5A 1N8RC 4FLHA 2KTRA 3GTQB 2M0XA 2KQ3A 5MPOA 1XTCD 3FEWX 3NTIA 4B3TQ 1NI2A 3MTNB 4W9FA 2B2WC 2NTSA 1KNEA 2KEEA 1BBWA 1V97A 2A6HC 1D6EC 1QNUA 4A3FG 3OW7A 2CH4W 2IY5B 1MFWA 1SE9A 2IZVB 4A3LH 1PH6A 4A93H 3T3NA 3M85A 1HNZQ 2ZZPB 3M3YH 3AECB 4GDLA 5J2RA 2EYPA 1OTRB 1U0LA 2ZPYA 3P75A 3T56B 1SB3C 2MP2B 5E4WC 3I57A 3TEZA 4DR2Q 1F9QA 2V4DA 3SD5A 1HR0W 2EMSA 1F52A 2KFKB 1TXYA 4AQYL 4ARCA 2GI9A 1I6VC 4BOZB 4G4KA 5K36G 3DVNU 2JPHA 3RZWC 3OJ3A 5HGTA 4A20A 1SFOB 3AEEB 3GTOB 3VXWA 4DR4L 3Q3JA 3A33B 1WX7A 1F9SA 1UAPA 3DLLA 3DVGY 4WWOA 1WI0A 2E2HB 1P7EA 2FCMA 3RUIB 4BBSH 3NOBA 2KCNA 4A9AA 2UU7A 2F0TA 5LXIB 2O5IC 1L6UA 4C3JB 3A7LA 3J81i 1SR3A 1CHPD 2EYHA 2ZT9C 3F2BA 1T0QC 5HG2A 1X3FA 1YNNC 3I9V1 1YIJA 1FIQA 2N55A 1EUJA 5IGFA 4EFOA 2BS4B 3WAPA 1GUAB 4GXBA 5AEKB 4R4CA 4R3DA 3MC0B 2QGQA 3S1MH 1ESRA 1HNXQ 3G4SA 2BKRB 1I7HA 2WU2B 5HY6A 3K5MA 3U58A 3HRZC 3FRPB 2KX0A 1UBQA 4B9WA 4I7AA 4MGKE 4DHZE 2R92H 3E9HA 4K7UA 4KD3A 1VQDA 4KV6A 2MEKA 4DV2L 2O6VD 1YNJD 3ERQA 2JEBI 4TRDA 2JYTA 1YJJA 2IGDA 2MPMA 4ZRZA 4JX1C 1C76A 3Q6BA 2XNAC 3A56A 4HJAA 1B3AA 2JXMB 1ASYA 2BBCA 1VDVA 4K81A 3MXUA 3B08A 3V2TA 3KK7A 3CD6A 4LF7L 3C19A 2B3AA 3BZDB 1LACA 3AEDB 1XLOA 1HJPA 4O42A 2L83A 5KNBA 2PQAA 1Q1OA 3HP3A 1SE4A 1D5XC 3A0JA 5C4HA 1K8GA 4B3MQ 3UE1A 3ZTCA 1EY0A 1J9OA 3OJ4B 2O5JC 4EVOA 4DR1Q 2KJ6A 2A6HD 3SR1A 4TMAB 3G6JB 3CPWA 2WB1G 1WM2A 1L1OA 3E9SA 3JSVB 3AEFB 1I42A 3ER0A 2L3ZA 2G9DA 4L5TA 3WIMA 4BBNF 3EROA 4TQ1A 4HSVA 5IO9A 4DKAC 4UAIA 1SIFA 1VQHA 2RHSB 1I6HB 5C0XG 2IPKD 2Z9HA 1JW9D 3J80E 2VQEL 4A3JG 1WTWA 3PHWB 1TR5A 3R8BA 3E56A 4L6TB 4PS8A 4APVA 3PV1A 3HG9A 5M3MB 4IG7B 1ZOYB 2MBQA 2KOLA 2R3ZA 2R93H 2WQYB 3DMUA 2KHSA 4XE0A 5C1ZA 1T0SC 2O2VB 1C4PA 3TEXA 2L9HA 2G3QB 3VVWB 4W9JA 1TZ1A 1E7VA 4JL9A 4O2DA 2ZNVB 2B63H 4ZK9B 4XQJA 5IP4D 5GAGC 2UXBL 2KECA 3OMCA 1FFUA 3UDXA 5TSSA 4N59A 3UIPB 3PLVA 5A2QE 2XSCA 4LUVA 1SNQA 3S2HH 1ZXHA 1BVSA 1ACCA 1SYEA 4H02A 1CI3M 2H89B 2GA4B 3BK1A 3L4PA 3MXPA 1T3QA 4R8IA 4XT1B 4DR5Q 2KWVB 1IL8A 2NVYB 3S16H 2UYZB 3W1SC 1YJ1A 1PDXA 3QCAA 1JWSD 1OXXK 1SSOA 2LGIA 4LW1A 4NQKE 1SBBB 1SMXA 1V8QA 4B3SQ 3ZNGC 1X3PA 1E0BA 4JBJA 2BOSA 2TMPA 2A5HA 1YBYA 3H94A 2DY8A 4ZRQA 4GLXA 1N36L 1B9MA 2GOWA 2K7VA 1H9RA 2VL6A 2PMZB 2UXBQ 4W9EA 1WD0A 4FVMA 1J8CA 1UE1A 4M8MA 1FCCC 3PTFC 3RUZA 4IOCA 3EHVA 1WYWB 1CHQD 1XCTL 3CCUA 2IGHA 3ITPA 4JPBW 1TWFH 3GO5A 4RNAA 4PZ8A 2CWAA 4C1NI 1CKNA 3U8ZA 5CMDA 2B2VC 4XDXA 3MEFA 2KQSA 1V80A 4RA8A 2KFJA 3X23A 1MSHA 2MGSA 2LWPA 2I0QA 2B2VA 2W54A 4H2AA 4KN7C 4C7ZA 2LHDA 3K59A 3OLMD 3E5SA 4X62Q 4W9KA 1XNQL 1YQ4B 2W3SA 3V3XA 4N9PA 2IJ0A 2ZTDA 3AQQA 2ALYB 4CKBA 2FIDA 4K6LA 2WXQA 3HM6X 1BXTA 1PH5A 3M62B 3GE3C 2OQKA 1KRHA 3PGEA 1PLFA 1TWAB 2EZVA 3HOYB 2HDEA 4YL8A 1L2NA 4GN3B 1VF7A 2UUBL 1XLNA 2HE7A 2L52A 2EE1A 4ZDVA 3ZLZA 3NBIA 2VB2X 4GOPA 4PMCA 2A6ED 3ZXVA 2PQEA 3I4MB 3K7AH 3FVQA 2ZW0A 4DBGA 1QG7A 4GZYC 4DU9A 1Y69U 1LT3D 2H4OA 2BDNA 4GOPC 4OVUA 4WAFA 4XIGS 3HOWH 1WSPA 1UE5A 4JBKA 2CWPA 2HIXA 2GVAA 4NXNL 1EIFA 5IODA 5C44B 1P16A 2BWFA 1EQQA 2E76C 5AFWA 4P6VF 2B76B 3A8KE 4DV5L 3NELA 2PZTA 3K57A 4IWQA 1KHIA 4YWMA 5C3JB 1L0YB 4DV3Q 2CHZA 4HK2A 2LS01 1CQFA 2AWOA 1VQBA 3PRPB 5GAHC 3N9YC 5JEAH 1HNWL 2O2VA 2F0IA 2F0MA 3DWAA 2FXQA 3PIPA 1NR4A 3O65B 2F0EA 1WXAA 2J0KA 2ONQA 1BR9A 5NUCA 3K0XA 5EE1A 4LFAQ 4BKSA 1A2UA 3NBHA 3A8JE 2ACZB 4EEWA 3I4NG 4RG1A 1CKNB 2N7JA 2YTXA 2B63B 2AL6A 2N9XA 2NTTA 1MIUA 4YCWA 2VH2A 1FRDA 2Y5CA 3Q8BA 5GQOA 4CQNA 4C3HB 5IGGA 1WXSA 2GBRA 2WGSA 1KDBA 5FLXE 4OWTB 2ZJRA 3QR8A 1HNXL 4LFBL 2CU1A 2HJ1A 3B2FA 2MFIA 3IAM1 1DM0B 1W6KA 1QE6A 4DNTB 3Q22A 1FNVA 4XWTA 2Z6KC 3KLWA 3M4QA 1S3OA 5JJZA 3Q3NC 1LV9A 3AI5A 2L0CA 3KLRA 4X3TA 3CAMA 1PFBA 4PG3A 1WJNA 1I4RA 1T9HA 1K51A 1TWAH 1D7QA 4PS7A 1NYRA 4IWOA 3KBXA 3W1SA 4C80A 1OQQA 1EY4A 2IY1B 4J6HA 2IY0B 1KD1C 2PPBC 3W1YA 2K14A 3SK6A 5ELBA 5FO7B 3S9WA 3A74A 3G7LA 4DV4Q 3L3OC 3TZUA 3U4ZA 3MJWA 4MELA 2SNMA 2BPSA 4OZCA 3BDLA 3D31A 4RM9A 4HJ7A 3AXCA 4MH0E 4WWMA 4R8NA 1E22A 4DUZQ 1FEHA 3OTOL 1AWDA 2NN6H 1V2YA 4TV3A 2NVTH 1SDFA 2DUDA 3ND9A 1S5FD 1A2TA 2V3SA 2AWTA 4YWLA 4HJ8A 4IWPA 3RI7C 3ZO5B 3CXCA 3I90A 2O4XA 2DGYA 4AYBG 2K8BA 3AE5B 4IM3A 1LYLA 2ATWA 5AZFA 5DPTA 5H1SE 1Z9FA 2SDFA 3A55A 4OVVA 1B3QA 1FGBD 2EYFA 4S3SA 2M0AA 2I5LX 4FNFA 1J6QA 1F9JA 1U4LA 4DV2Q 2KWCA 4CDEC 4II3B 1KLVA 1Y56A 2LJ5A 4DHJD 4P75A 3B9JA 1TY2A 5D3IB 3D6CA 2BYFA 3W3AA 3VFKA 1X56A 2K50A 4TSSA 4OZAA 3STBD 3PQIA 4JV5L 4HVBA 4G50A 2Y5BB 3SK4A 2AQ2B 1W3SA 3N1YC 3OTOQ 4D2KA 4R4IA 2CH4A 3ULPA 4JK1C 2BCOA 1KM7A 3CIRB 1FM0D 3VYRA 2GBMA 1PH9A 3PO2B 1DD2A 1FNWA 2WXNA 3RMHA 1EFID 3GTGH 1E8WA 2QILA 4YHHQ 3K81C 4P74A 1TTNA 1UH6A 1H95A 2K25A 3L13A 1PFMA 3SFDB 3PRMB 1EIYB 2E5LL 2NZHA 4LF8Q 2RDBC 3DEPA 5CV5A 2K05A 3TIXA 5LMNL 1WRIA 2PVOD 5J3BA 3NXWA 2F1MA 4A3FB 4KX6B 2WX1A 2LVOA 3IVFA 3BDOA 4C3IB 4DK1A 5A35A 2VUMG 1TWHH 2NB0A 4NPSA 2DENB 3IG3A 3H0GH 2KWDA 1QUQA 1FVIA 1ZEQX 1N32Q 3ZJTA 4POFA 1PH4A 2V1YA 2G4DB 2E2JB 2ICEC 1AP0A 4BY1B 1U9RA 1PTOH 1SNDA 1BMLC 3I4OA 3AE9B 3P4SB 2RR9A 3F2UA 4L1BA 2RPQA 4GDLB 4QJFA 3DHIC 3MXNA 5J18A 2G4SA 2JWZA 2DJGC 1HTQA 1O80A 4AQYQ 4O1NA 1V6EA 5IOIA 3ONAB 3PT2B 1LTBD 4WQMA 4CJ0B 1D2BA 1B1ZA 3UQBA 1EF1A 4KTAA 2LVQA 4AUQC 3ZW3A 2O6VB 4XX5A 2N9LA 3CMMB 2YU9B 3VR3A 3NVWA 5KYLA 3T16A 3J7AV 2I2YA 4KN4C 4DV0L 3S1QB 4FXCA 1OTCA 1QZEA 1QILA 1GHKA 2LD9A 2MO0A 4GN1A 3W9CB 2A68C 4LNKA 3ZTDA 2A69D 4K8IA 5FO9B 3NVZA 3HOUG 3V62A 3T8MA 1YN3A 1WTVA 4A3BB 4MACA 3S14B 3RZOB 2UUCQ 1H9SB 5DAUA 2K28A 1E1OA 1L2FA 4PQXA 2IHFA 1UWXA 1K9MC 4A3JB 2WXJA 1GJZA 1E8XA 1EL0A 1I50B 4HAEA 5HI1A 1C3TA 3AE4B 1QB5D 1VQMA 1ZUD2 2YTVA 2LMCB 5GMVA 1RJTA 4HKQA 2R7ZB 4OONA 3Q8AA 2JA5B 2GMIC 1Z6HA 2J42A 5D6JB 4LF9Q 1VQ4A 4OXPA 1WZ0A 4QMGA 5KNDA 4USAA 3QIAA 2WB1B 4HEDA 4LWCA 3HOYH 3TBIB 1XNRQ 5JPNC 1YOVB 3SE0A 1YNND 3RD2A 2RCNA 2IO0B 2JA7B 4AOFA 4JI4L 4X65L 1JC7A 5JPMC 4JOIA 3NG0A 3NS8A 1VQ7A 1HRJA 2LGDA 4L5QA 2D0OA 3RYTA 1TWGH 1P9DU 2K3UA 3ETRA 4JOIC 3P42A 4F88A 2E3TA 2QMTA 2WXIA 3KJOA 4FF4A 3F8TA 4K2LA 3DWGC 4K3BA 1R4MI 4PMWA 1GHJA 3PF4A 3HRDD 5KYIA 3H7PA 1AH9A 1SGHA 1WOCA 2PMZE 5JAVA 1FD7D 4MZ9A 1XYIA 3K5NA 5FOBB 1X3QA 3DBHI 3QX1A 2B2WA 2HD5B 2BA1A 2VZKD 4MSQB 4DV6Q 3VA5A 5C6AA 2KN4A 2YU9H 3MP9A 3ERSX 1IBML 3DHQA 2E2IH 1K83B 2CQAA 2F0JA 1VZ8A 3M3JA 4W9GA 1G8ZD 1T5XD 1XPOA 3PO0A 5T8IA 1EY5A 2R2OA 3H7SA 3VQIA 4A55A 3AB9A 4AYBB 3MTSA 1E5WA 4HWIB 5DPWA 2NBFA 4A3LG 3V61A 1A8VA 4XXEA 1E2VA 2OXPA 3TL5A 3GTPB 1XD3B 2AEHA 2K04A 3FKYA 3K6OA 4WWNA 2MUYA 1KJTA 4QF4A 2EY1A 1SRUA 4DXFA 1J5EL 2F0NA 3RZOH 4F1SA 1EIHA 1O78A 1W6JA 2K52A 5FR3A 1I4PA 3CCJA 3J7YW 2IL8A 2BW2A 3A54A 4TVAB 4DV6L 1Q5WB 3QAQA 2I07B 2G9HD 3ZRCA 4PZ6A 3KF6A 4KKUA 4IDIA 3RPFC 3CF5A 2KWUB 4MTKA 2KT7A 1KIXA 1WGHA 3CWIA 1F9PA 4MIUA 4AP4C 2EKIA 5LXHA 1Z7TA 3APCA 1SYDA 1T5EA 1EYAA 5C4ZA 3J80L 1MHWC 1JICA 3KLSA 3KWLA 1WFYA 1FO4A 3K58A 4A3MH 3DEOA 1B4OA 3NWSA 1BCPF 1BCPC 1SYGA 2N9EB 3VRBB 2A6EC 2RBMA 3HIZA 2N7EA 3H6NA 4CDDC 2DWQA 1I35A 1HUMA 1FGUA 3CHBD 1LXDA 3T13A 3TCAA 2BE5C 4MGIE 3S16B 2K5HA 3CCSA 2BQQA 5T1GA 2PI2A 2Z59B 4KJOA 1ESFA 3QJYA 4IQZA 3MXGA 4A3OA 3BU2A 3UE0A 4OWXB 5I4DA 3ZVVA 4LAAA 5C4XG 1IYVA 4IC7B 3GZNI 4G57A 2C5CA 1RODA 2YLMA 5EE9A 1GVPA 3AV8A 1CA6A 3CP0A 4REZA 1R4PB 3CQZB 1YNTE 3OOCA 2L1AA 2UU9L 3A4SC 5LMNW 1DOLA 4A3GH 3Q8EA 2L11A 2CHWA 3BVZA 4OX9Q 3I3TB 3JYUA 3QA8A 4WIPA 5GROA 1RFKA 1JOOA 1Q3LA 3CCRA 5CBEE 4AH6A 5DM73 3BIID 1VQ9A 2Q8RE 2LY7A 1HUNA 3GTOH 2QC8A 3KWVA 2IBIB 4GLAC 4KSKC 1Q8IA 3R2TA 1ML0D 3CPFA 3W2DA 1R9TH 1NJIC 2KAJA 1ONLA 5CV7A 2RQXA 2QCZA 2LVPA 2Z6KA 1PRTB 2EJFC 5IY0A 2UXCQ 2RSOA 1FFVA 4HCNB 1CTMA 5DPRA 3NJTA 4HJGE 5LLIA 4FHJA 4BY7H 1C79A 1IBKL 4A3PA 1R7SA 1TKYA 2JUOA 1EQRA 2N78A 2DHZA 3HOXB 3R93A 3S1MB 2J0TD 2R93G 4YTNB 4IUNA 3R66C 3TMPB 2JRHA 1WD1A 4GDKB 1QWYA 1VQNA 2XRSD 3ZJYC 3NTHA 1A3VA 4LFCQ 1KFYB 4X66L 4R4QA 1XF5L 2M8SA 3ECIA 3T53B 2JA9A 1PTOF 3HVZA 3C8YA 4FF1A 3SK8A 3FP9A 1Q86C 3NHHA 3E9IA 3GP7A 3MXNB 2ZJPA 1V81A 3NZSA 3UGBB 3PS6A 4HN7A 1RL2A 2BS3B 1N61A 1ZP0B 5DPSA 3HOWB 2UXDQ 2KC2A 4DK5A 4DR7Q 3J80c 1YJIA 5BO4B 4TUUA 4A3DG 4FHKA 3BYYB 1IYUA 1QOFA 2NVUI 3BG3A 3F1ZA 1PMRA 1N5WA 2KDFB 1C9OA 1A5RA 1U5KA 3D32A 3M7GA 1VDZA 2JA7H 3EVQA 1I4QA 3L08A 1EWIA 3IKJA 3BZKA 5KIXA 4OWWB 2VQFQ 1EEID 4LJZC 1PV4A 1RD9D 1JRPA 3PSIA 1UWVA 3U9OA 4DV1L 1K8OA 1L4ZB 2GBJA 1N32L 3KYDD 3LB8C 1GUGA 3JVZX 1DOMA 2MJDA 3AU7A 4CDFC 4JG2A 2KTRB 2W82A 3WALA 2VXWA 3LNNA 1JB7A 2YV5A 1IW7D 2D3CA 4W9LA 4IPDA 1I50H 2NBUA 2K8HA 3PIO3 2VS1A 2B2YC 3N52A 3HOUH 2PJHA 4EZLA 1YNXA 1KDAA 1IW7C 5EAYA 2CJNA 3B6YA 3ML8A 4CJ1B 4A3CG 3JAMc 3GZNB 3RD4A 4K5VA 1QQRA 1IXRA 2K5WA 3VR2A 2A1AA 1XNRL 4B0MA 1HA5A 1YNJC 2KFKA 1STEA 4P1BC 1GM5A 1Z5SB 1E1TA 4NB3A 2SOBA 4FYDA 2WACA 3BVGA 2IX1A 3A9KB 2EYMA 5D2MB 3KBGA 3M9BA 1A70A 2E74C 3DVGX 3TSSA 2AUKA 2KOXA 4ZHOA 3TJPA 1E2ZA 3H15A 2IYDB 5EPJA 4Q2JA 3T1YQ 3NHEB 2JA6B 3ZIMA 4M02A 2P5ZX 3AU4A 3OWEB 5G55A 4I6LB 1PH3A 1HNWQ 4DR5L 2MRPA 2WIIB 2EOTA 1AW7A 3S1NH 3CC2A 1N9WA 4G11A 3QG1A 3CCQA 3GTQH 1C4AA 2DLBA 2FIFA 3VTWA 3PREA 3LGJA 4XQQA 4A3BG 4ZRJA 2LRUA 2RVLA 3C2PA 3QC8B 3HOXG 4JWSC 2KCTA 1K73C 1NMGA 2I5MX 1YZ6A 1KQSA 2KLCA 1X3EA 1RFAA 2WXPA 3U52E 3FILB 3K80C 2DNFA 4ZRKA 3PIP3 2F4IA 1QOGA 5D65A 4A3KH 3S15H 2D3BA 2HCCA 1VQ5A 3B2GA 3HUIA 2VB3X 2WFWA 5BMGA 4IFDI 1M1KC 1LTGD 5IP7G 2MX2A 4IPGA 2QDLA 1XMOQ 2CKHB 3H1UA 2C9WB 4JQWC 2EJGC 4B08A 1JMCA 3DDCB 2UWQA 2WWZA 2Q8TA 4IN3A 2Y0SB 3KDFB 5JOBA 3UI2A 2MQHA 1LGRA 3EIVA 2E6XA 2WDQB 5FLXc 2KCCA 2MO1A 2WP8J 1Y14B 1K8RB 3Q6SA 1TY0A 3CCVA 3A1QB 2RDHA 1G2SA 1S4ZA 1TWGB 3WAOA 2BWES 1I4XA 5E7NA 1NY4A 3H3VI 2X8XX 1R4MB 4FADA 5G2NA 3UIOB 2WLBA 1GJXA 5HURA 1NSNS 4AYBE 4EQPA 2V3NA 3RNEC 1DONA 1J5EQ 1BCPB 1TYGB 4ZQ3A 3W1GA 2E2HH 1X32A 4JI0Q 2ZXRA 3S15B 2M56B 1SAPA 2N7DA 3J7AF 3AM9A 5KNCA 3I73A 4CJ2C 3J7A5 3NRZA 1BBXC 2W55A 4JI8L 4KI0A 1LLRD 5C23A 2XWJB 2AQ3B 4M1UB 1IUEA 5LMUQ 1NEKB 2FMCA 3EBEA 3QWNA 3LYYA 3PHXB 1UZXB 2FNJB 4C4VB 4AWJA 2D3GA 1J8IA 1E2WA 3GTPH 2Q8IB 1G6PA 3Q8FA 3PUVA 2KJXA 5COYA 1KLGD 4NXMQ 1XX8A 2A5UA 2LKVA 4ITKA 2L76A 5IAAC 5F2DA 2WS3B 4RGOS 1EY9A 4PYUA 1Z47A 3MFGA 3I4NH 4KHVA 1P0RA 4IALA 5C0XI 5IYBG 2K32A 1DOKA 3H3VH 1BT0A 5I6WA 4DAYB 1HE8A 4EKUA 2DYMA 1PXUA 1BKBA 1B7YB 1MSGA 1SEBD 2Z6BA 4DV1Q 4A76A 4JI0L 2G1EA 3FILA 1H9JA 3P2BA 3NK9A 5DEHA 2PZUA 3OPOA 2DZKA 2OOBB 1A3TA 2EMTA 5C5LA 3HVDA 2M17A 2Z4HA 4DQOC 3NQIA 2EY6A 3GV3A 5LMUL 2W3RA 4MN3A 4KV2A 1WF9A 3S24A 3B0AA 1AE3A 1HTPA 2CHXA 3V6CB 3LJ3A 3Q2AC 1JJGA 2KQ4X 5FK9C 4HMJA 4LF9L 1E7PB 3I3CA 3D4RA 4C1NK 1L6VA 1VRAB 1VQGA 1SE2A 1QOHA 3I7FA 3OMGA 4C3HH 1EYDA 2D9UA 4A3BH 4YXDB 4A3IG 4A8XC 3GDEA 2OF1A 1DZ1A 4J15A 2K75A 2OT2A 1YMHE 3K9PB 4NQLB 3I5JC 3N20C 4HIOA 3RZDB 4HIDA 2DN8A 1VMPA 2EXDA 4LFCL 4BXXG 3ULLA 2KYWA 2NMQA 1I94L 2R7FA 1TZOA 3Q8CA 3HGBA 2QEJC 1FXIA 2LXAA 1I4HA 2NBWB 3S17B 4MDKE 2WXRA 1V49A 4X3UA 2IX0A 5M3FH 2AYOB 5C3EG 1YJ9A 4DN4M 1RLFA 2SNSA 2EYJA 2AHOB 1EFWA 4DR6L 1KXLA 1XLQA 3DBSA 3Q3OC 4KY7A 4G0NB 1L0XB 5BYRA 3MVVA 2JE6I 5LL6X 2WHIA 1DOXA 2B63G 2A73B 1CM9A 3D6WA 5DLQE 3CSFA 4KKTA 5FKAC 2R2QA 3L0OA 2XN9C 1ISNA 2K01A 2B8GA 1OEYA 3Q3FA 3L2PA 5M5WB 4ID6A 1X9NA 1R4NB 1Q46A 2EQSA 4H13C 4ABNA 3MZ5A 3TDQA 5CHVC 3R7RA 3LX0A 2F0KA 2ZTCA 4A3EB 5KHQA 3PLUA 4UP8A 2XBBC 4LK1C 2J7QB 1MBYA 1CQVA 1D1KA 2CCZA 3QIJA 1YHQA 4DGZA 5M5YH 2WXMA 2FCQA 2ON8A 1LTAD 3PO3B 2MNAA 1CT1D 3ZDTA 1PH2A 5FLMH 1VQ8A 2PZWA 4DF7A 2FUHB 3T9LA 4N8FA 1KH0A 5IGBA 3V05A 4DPGA 5FO8B 3IAYA 3L10B 5J22A 5G5GA 1SMYD 2KX3A 2HHHQ 3NY5A 3ML9A 5CR3A 2C5LC 1GUTA 4MEMA 1NMFA 1VZ6A 2KN5A 4R4OA 2AUJD 3P20A 4ALPA 1P1AA 4J3OD 3DWPA 4DDGD 4C3IH 5IYCH 4A3EG 3FKIG 4IURA 1K28A 2F0VA 4X65Q 4YHHL 1TU2B 1TKWB 1WXMA 4P16A 2C7NB 1L1OC 4K7SA 3IFWB 4RM8A 4PZ7A 2RA4A 2KMAA 2LXKA 2KVRA 1EF5A 1TT2A 2RDGA 2MJ3A 2VZKB 4ACFA 4IM0A 1S3SG 2WXKA 2EDGA 4MGZE 4QIWE 1J7CA 2LSSA 3EA6A 1TQOA 5IIFA 4BOSC 3UDIA 4XYOA 3MFYA 1JB3A 1GKHA 1VQCA 3QARA 2MHJA 3RLFA 2B2TA 1SMYC 3RR5A 4ILWA 1QOBA 4LJPB 4BY1G 4WJPA 4E74A 5JHAA 1V9PA 3S1NB 3IFTA 1XXGA 4EQNA 3S1RB 1PZID 4B9XA 2LGYA 1M90C 1LTRD 4BKTA 2XEWA 4DUZL 4FDBA 2VUMB 2K03A 1AZQA 2D3AA 4HDQA 2JJQA 3TS2A 2YEPF 5BMHA 3ONSA 1YX5B 3AEAB 3HOVH 1Y8PB 3RNFC 3DWQA 2NVQB 3I55A 2ASQA 4P71A 1GC7A 2C7HA 1XMOL 1WR6E 5HFYA 4BBRG 1HZ6A 5AUIA 2IO3B 4L2YA 1IGCA 1KLUD 4V0BA 4G7HC 4L23A 4RKBA 1AEXA 2RGFA 4X64L 2EKEC 4DR7L 3W5UB 1MPEA 3V96A 5CX3A 3P1MA 2K9XA 2WB1E 5IT9c 1WCMG 3N32A 1OXVA 3SHLA 5I6YA 2NYZD 3M4OH 3CQZH 5CTRC 4AJWA 4KGTA 4LF4L 3SXHA 3EC8A 1ZKHA 3KW5B 3V6EB 5ELFA 5ELNA 3GB1A 3PO2G 2BH8A 1N63A 3IRBA 2B8FA 2KLGA 2DJFC 3S2DH 2ZXPA 4MH8A 3ICEA 3I4LA 3ABVB 1TJEA 4NW2A 4BA2I 4BFRA 1JMLA 4KKSA 3TZDA 1BOSA 2HD3A 1B70B 4ULLA 1YJWA 5E6NA 3HOXH 2JVCA 2JXXA 1ZGUB 5K5PA 1FR3A 1NAPA 5BN5A 2YTYA 1ZW7A 3HK0A 2B2YA 4NDXA 4CHTB 2KJHB 5EQ0A 4DUYL 3KF6B 1ZPSA 2WDTB 4BKSD 4FA6A 1HTLD 4YSZB 1X65A 3WWVA 4B3RQ 1UELA 2KO3A 1CSQA 1VQ6A 5EE0A 2MW5A 4Q0FA 1RDPD 4UPAA 4NXML 4WWPA 2IO2B 1ROEA 3S2AA 1EUVB 1N36Q 1EWCA 1WCMB 2LJIA 4LDTD 3VUWA 2NVTB 2F3IA 1C4QA 2FBWB 1ENCA 5FJ8H 4BBSG 2VZAA 1UNSA 3CMAA 3HOWG 1Q0WB 4KKIA 1S5BD 4Y52H 1PRTF 1UD7A 3HOVB 1JE5A 1PYWD 2QCPX 2Z4IA 4A3JH 2HTHA 3T1HL 4Y7NH 1JE4A 5CV6A 5CC4A 4ZUJA 2ZM6Q 4FF3A 4HPLB 5E6PA 2FHTA 1L0WA 5FR6A 2F0LA 1EY7A 1Y1WH 4GLVB 4IUMB 3RNBC 1CA5A 2Y0SG 1K52A 2KXJA 4OIJA 1OXTA 2KZRA 2NPTA 4NAWB 3H3VC 3PF5A 4HPMB 4KY5A 2NVYH 1E0ZA 5CV4A 2R7DA 2L12A 4R1JA 1WM3A 5J1ZA 2WP9B 1X3GA 1C77A 5JZEB 2GLSA 2UUCL 4XDCA 1TGZB 2DYBA 2RCFA 2PMVA 1XT9B 2KACA 2NUCA 3R3OA 1GUNA 4OHJA 3C1FA 1SSNA 1IBLQ 2PO4A 3QWZB 4MM3B 4S0RA 2F0HA 3RZDH 4PV1C 4MHEA 4M00A 2R7ZG 1N34Q 5M9OA 1SFOH 3Q8DA 2BKFA 5BYSA 2FJ2A 3URYA 4GDKA 1QVFA 2BTEA 4GOPB 5ELDA 3EJIA 4XDDA 3R7QA 3BWUD 3K5LA 4ASWC 4AS1A 1LTID 3DBRB 4IPCA 1PH1A 4HKZE 4FP5D 4GNXA 5C44G 2V4IB 4S17A 5EBCA 5KGUA 3OHXC 3HEJA 1C0AA 2JA6G 2I1JA 2CFMA 1RCVD 1JT8A 1BUIC 4ZYSA 2BF8B 3FAHA 4GS3A 1CUKA 2OTLA 2Q2TA 1E24A 4IW0A 2J4XA 1BO0A 2KBNA 4YTMB 4ANUA 2BVCA 1EQVA 4RHRA 2JXTA 1N62A 3DUZA 1HR0L 4A3GG 4NJ7A 4RH6A 2LI5A 2IX3A 3WOEA 4A6QA 5EDSA 5JJLA 2J7ZA 5C0XH 3Q24A 2KHIA 4WURA 2EYOA 4NZLB 4ZOHC 1TWHB 4I6NB 5M5WH 1TWCB 1NENB 5CV9A 3AEGB 1MI0A 5BMIA 3L7ZC 3I8ZA 2Z0SA 4HRSA 5IYDH 3OWFA 1X54A 1JORA 3OW2A 1B2TA 2RF4A 2PW9A 2JYEA 4WRDA 4CYEA 4A3FH 1UF0A 2KVZA 2NZ1D 3MC8A 2K5DA 2KQ7A 5IE8A 1NBWA 2OQ0A 2MQJA 3J80i 4JWUC 4XYCA 1PRTD 1H9MA 1WVLA 5E6JA 4A3GB 1IP9A 1FJGQ 1E3PA 3ZYYX 1YN5A 4DHJB 4GLSC 4DDID 4ZKBB 3H0GG 3H9DA 1R9TB 5CYUA 1UE6A 1SE8A 2HTME 2KHWB 2UUBQ 5JXVA 1C4CA 4ICVA 1G91A 1TKEA 1QUQB 1Q8KA 3NVVA 3SFEB 1Q90A 3I70A 3E0JA 3OSOA 3F2CA 1Z2MA 2JA8B 3G48A 1STAA 2LRWA 2VNUD 2YEPB 3HOZB 2XK5A 4M8NA 4JI5Q 2M9VA 4E6IA 4DA2A 3UDFA 3GTLB 1K50A 1R4NI 2R7ZH 2AX5A 4U68A 1M94A 4KZCA 5G5HA 1VCIA 3FPPA 1HFNA 4A3KB 3AFPA 2AL3A 2MBHA 1GC6A 1E8YA 2PLPA 3OAWA 2CKZB 3VYTA 3OIQA 1Y8RC 4UP7A 2Q5WD 4BXXH 2RD0A 3QOLA 1FJGL 1IHZA 3GE8C 1D3ZA 2MHVA 4M0WB 3D4WA 5ELOA 5ELEA 5I9OA 2B3GA 1SYFA 3U7ZA 3I63C 1GB4A 3NTKA 2N1VA 2BYEA 4JI2Q 3TP6A 2R93B 1GOZA 3K5OA 4IOAA 1VQEA 4LNNA 3O13A 5H92C 2JYOA 3CRLC 3RMKC 2NBVB 4FXDA 2W9NA 5E6OA 1H9SA 3PPAA 3EFXD 1ET9A 4WORA 4KIKB 4XT3B 4TKOB 4OO1I 1GAQB 3U30A 4KGSA 5IT9L 2LXCA 4NMZA 2MJEA 4WJ3M 3MAQA 5C3EB 5EGTA 4JI4Q 4A4IA 4DK0A 1KC8C 2B39A 1WE6A 3DCGA 1C1YB 4I65A 1QF6A 3AE6B 2WDVB 1J19A 4C7YA 1BDOA 2JA6H 4BBRB 4X64Q 2N9KA 4C2MB 4LF6Q 3PUXA 1PTOB 2KMMA 1QVCA 1IBLL 2Y5PA 3AULA 2ZEQA 3AU5A 5C2TB 4W9DA 2KDEB 1HPCA 1RHPA 1QLBB 1A62A 1JOKA 5D14A 2FFKB 4BBNC 4YT0B 1GUWA 3VYSA 4C3IG 1RAXA 1VQAA 1EZ6A 2R92G 2QKIC 2FUG1 3AEVA 3VR5A 1UEBA 2ZXOA 4PMBA 1OQRA 1LUZA 2A74C 3SHQA 1PFNA 2FINB 3AYHB 1IPGA 1DGJA 4YY3L 3ZKJC 5M3FB 2BA0A 3ND8A 1F0ZA 4GB9A 4HCEA 1XO3A 1VQIA 2F0GA 3BS1A 3T3OA 2IHEA 4DAMA 1PH8A 2N4FA 4JC0A 1KL9A 2L55A 2RDFA 3TBLD 3APFA 5C3XA 5AZHA 4HLEA 1F2MA 2H88B 5AZGA 2D10A 2K8CA 1AN8A 4KVGB 3D3RA 3KF8B 4LF4Q 4RAUC 3P63A 5LNK1 4FN2A 4JE3B 1ENAA 1XNQQ 2MA9B 4GMVA 4HJKA 4DR1L 1HZBA 4JW0A 1WCMH 1P3QU 4IFDG 1Y8NB 3FC4A 4W9IA 2MBBB 2JN4A 4LNIA 4JLCA 4RGMA 4EZKA 2OEOA 1MHHE 1Q81C 4KDIC 3W1BA 3CCEA 2AMCB 2KMCA 4NJ6A 3UINB 1SNOA 3DBLI 3MHBA 4RFBA 1SYCA 1NDDA 3LWEA 5EKLA 2DZIA 3BZCA 5G3LF 2K1FA 1FYCA 2PPHA 2HUGA 2PNRC 2JA5G 2OWOA 2KNBA 3PZ8A 5DCNA 1D5MC 1WH3A 1IBXB 1XWEA 3UDGA 2KKCA 4C00A 1UEAB 3UQAA 4QCLA 2A4ZA 2EYLA 3NE5B 1JWBD 2C35B 2N88A 3KJPA 1OEYJ 3AH7A 3PZDA 3Q14C 1M8AA 1K0RA 4BY1H 3ZNID 2VW9A 5M3MG 3A4RA 3QJZA 3EFUA 3VRAB 2JK8A 2YYZA 1Q1EA 2Z8LA 3JAML 2CHBD 3RNAC 4GN5A 4ZLTF 5BR8L 4LJOB 4KHZA 1IZ6A 1VQLA 1VMCA 1ZDVA 5IGEA 4RF1A 1Y1VG 4LFBQ 3SVMA 4PS3A 3KUPA 1A0IA 1VQKA 5M5XH 1TS2A 2GRIA 5GXGB 4K14A 4DNIA 4HXDA 3BYTB 1C48A 3TMEA 1SROA 2LFNA 2XGTA 4F8MA 1ILPA 4J8QA 1WXVA 3A5ZB 3L9AX 2A8VA 4O0AA 1CFMA 1U4MA 3AMZA 3LDZE 4DFAA 2R61A 2EY2A 1JQ4A 4IKGA 3TEYA 4B3SL 2D5GA 3IFDA 2Y0SE 4OX9L 3LWUA 1I6HH 1L5PA 3DBHB 1D1IA 3LXFA 3RNGC 1LABA 3DM3A 4NPNA 1YJNA 3BY4B 4A3DH 2BGFA 4LUOA 5JVG3 2I38A 3ALBA 1D8LA 3SEBA 2HCIA 4G7OC 3DWMA 2C7MB 1ZXIA 1EOVA 1LT5D 2XK5B 5BR8Q 4OL7A 4IUQA 5FLMG 4A90A 3TQYA 1VD2A 2JA8H 2DNCA 1EU3A 2A19A 1EWYC 4DR3L 1X6OA 1IYJB 1HH2P 1E7UA 1CZWA 2IT1A 1UBIA 2ZW1A 3ZJVA 1SN8A 4MNOA 4JI1Q 1TIID 4LNQA 2E2IB 2RKSA 2OEDA 1HCZA 1N34L 4H0LC 3S2HB 2WXLA 1EY8A 3KYHC 4LCDE 2KANA 5AUKA 1JALA 4DR2L 1HEZE 1H9KA 2F0WA 1XEEA 3FKIH 1EY6A 5IN7A 2EVBA 3NBHB 2WAQG 3M63B 4HR7B 3NUHB 4WJQA 1DCZA 1V43A 4YTPB 4DR6Q 1DYQA 1F2LA 3T1HQ 4A3IH 1TS3A 1F2RC 4FO2A 2DBYA 4DXGA 3MC9A 1SF0A 1VZ7A 5EKKA 1STHA 2K5NA 2V3PA 1WGKA 3NP8A 4X3KA 4M01A 5CBAE 5CHWA 1E7ZA 1SXTA 3AB5A 4W9CA 2JRIB 4I6PA 1ET6A 2L7RA 2QHOA 3KVFB 3IT6B 3L54A 1RRBA 5EPLA 5D7GA 4C4VA 3BVMA 4NJCA 3HZXA 1PGBA 1U4AA 4DK3C 3PZ7A 3TN2A 4GU2A 4NP5A 3N30A 3VTUA 2RSNA 4QGUA 3S2DB 1M4VA 2D2CC 3CC7A 4PYZA 3GTKH 2EY5A 1K83H 5IGDA 2H5XA 2VQFL 1G51A 4JVZA 1GXDC 4GNXC 1I94Q 2B2TC 2IDYA 3D0FA 3PV0A 4NKLA 3I91A 4RHSA 1NUCA 1RM6C 3RULA 3EUB2 2D0PA 3X3MA 1WI5A 2HHHL 1WTXA 5IP9G 4JI6L 4URKA 4A3KG 5I2XA 2C60A 4C56C 1YN4A 4A3DB 1KDCA 4BZAA 2KD0A 4Z9CB 2JEAI 2L05A 4LFAL 1WZ3A 3W5OA 4TQUS 2YVCA 1JWUD 3QK0A 4DWFA 1WTRA 2LXJA 1FL0A 3HKZG 1ZDXA 1IBXA 2JZPA 1WGGA 5JJKA 2LGSA 5ISRA 1ZXTA 5IWAQ 1VQOA 1Q1BA 2LFIA 2K22A 4A3MG 1MI2A 1PTOC 4BS9A 3G6EA 4A3IB 4MSMB 2K6AA 3CCLA 2B29A 1CZPA 1RTNA 1Y1WB 3MEHA 1RTOA 3VAWA 3EN2A 3KUDB 4XGAB 3DQVA 1KABA 2D2QA 3A8IE 5C44H 1XJVA 2KHJA 2LMCA 4FULA 4YSXB 4DV0Q 1WMHB 1BBUA 3W5VB 1NE3A 4BKGA 1NVID 4ZRPA 4QIWB 1NTGA 3GD7A 2OJWA 1STNA 2BYVE 2R6GA 1SNMA 1VF5C 1FNUA 2Q2UA 1MJDA 4KMUC 4ZCKA 4L63B 3Q23A 1N60A 2BB6A 2WKCA 3M4PA 5DNFA 1QNKA 3JW0X 1L1OB 3JSVA 1TS5A 5E4XA 2HDMA 4TKNA 2EPBA 4N58A 4RMFA 2L8JA 1L0VB 4LUZA 5FJ8G 4HIKA 2ES2A 1G2TA 4L5SA 2RMMA 2NVXB 3AE7B 3EFCA 1VR9A 3N3KB 1F2ZA 1L4DB 1XLPA 5D94A 4QAYA 1QKZA 2PW7A 3S14H 1PGAA 2SEBD 2L0FA 3N1XC 1ZYRD 1S5CD 3AN1A 2QDBA 4KJNA 3ZQ4A 1F77A 3PO3G 3GQBA 3J81c 4DR3Q 1OO9B 5C5MA 1G6ZA 2BT6A 2WXGA 3JAMi 3KQ4A 3JC66 5C4XB 2LZ6A 1XPRA 2BYTA 1NYQA 3NQTA 4FJYA 2HT1A 1SNPA 2CQOA 2JY6A 1GPXA 3VUXA 1PYSB 4FBJB 3AE8B 2X69A
chains in the Genus database with same CATH topology
3P4QB 4QB4A 5G3LD 2B2UA 1EZ8A 3M4OB 4G7ZC 1RKNA 1FCLA 1D5ZC 3VA7A 4RF0A 1B44D 2INPE 3M4YA 2X6LA 2WXFA 2WXHA 2L5TA 3AE2B 2CW0C 3MHZA 1J7BA 2PKOA 4OIKA 4L8JA 3JAME 2OHFA 2CU3A 1EEFD 4A93B 1STYA 4ZHPA 2R92B 1SE3A 1TKGA 3IL8A 4OO1G 3CU7A 3FKIB 4ODGA 3FPUB 1C9FA 3P4PB 2ICIA 3BDCA 4BWGB 1PUTA 3NZ3A 2M19A 3T4AC 4NAMA 2Z1CA 5EJWA 1BQQT 1UGJA 1U4PA 5BN4A 5IT9E 1LTTD 1WWTA 2MH7A 4N6EB 3NUCA 4US8A 1JR0D 4IOIE 1AYFA 4OZBA 4QUFA 3HOUB 1B53A 4FXGC 1NR2A 3GTKB 1JWMD 4K2KA 1OXSC 1I3QB 1QCBD 5E3FA 2MP1A 1UWMA 2F0PA 1CK1A 2F0FA 4HEA1 3TP5A 5EE3A 2H1EA 5E1FA 2XVSA 3H91A 5LHY1 5M5YB 3WCQA 4A3MB 5ELCA 1O7YA 1A3UA 2LUMA 1STGA 3QB3A 1FD6A 1JOQA 1F2YA 1HQRD 2F0DA 4CGYB 4FXKC 4RKLA 2HDLA 2LEKA 4IUTA 4PNYA 3TEWA 3VR4A 1ZE3D 5KRUA 1JROA 3E6ZX 3WDNA 4DAPA 5HHDG 3FMCA 3H09A 4ZUIA 2J52A 3J81E 3M7NA 1NI3A 3Q0AA 3NWTA 1KF6B 3H8HA 3K0YA 3MJ5A 2INNE 1Q12A 2BE5D 4RGTA 1SNCA 4EQOA 5H8YE 3UI3A 1YQ3B 1SIJA 2KA7A 2KDMA 1D4BA 1SJED 4BA1I 3FDTA 4F7XA 1PRTC 1GB1A 2K33A 4QUCA 5C3WA 2GB1A 3VR6A 4RWSC 1TS4A 4IUPA 5LL6S 1PGXA 1XCQL 1G291 1WYGA 2M2LA 3P1HA 2WAQB 4FF2A 4OW0A 2B2UC 2F03A 5D3DA 2WV6D 4I7ZC 4BY7B 3C46A 1K53A 1DOYA 1ICWA 3IXSA 1EM7A 1V1PA 1J7AA 2JSOA 4IUUA 1R4QB 4R9WA 2L32A 1EYCA 2AWNA 4YSYB 4XWWA 1B9NA 3H0GB 4B0EA 1SJHD 4K8JA 3C3LA 2XIWA 2CJOA 2JWUA 4KGRA 3PUWA 3NS1A 1ENFA 3WOFA 2KVMA 2XWBB 3KLSX 4US9A 5FLXL 4AQ7A 1LT4D 3GTGB 2DY7A 2QIEB 1HFGA 1LTSD 5EPKA 1ZKOA 2PIAA 2KEDA 2QF7A 4ZKCB 3Q69A 4RCOA 5CORA 1V1OA 1Y8OB 2K1BA 2JP1A 2PYKA 3PUYA 2Y3AA 5EKIA 2ENBA 4PT5A 2IGGA 4LLGM 1LT6D 2A68D 2WXOA 4OGQC 2D62A 2BS2B 1T6BX 4N9TA 4EE2A 1AZPA 4ZAIA 5JEAJ 4LTUA 1STBA 2PTLA 1EWHA 2N0SB 2JQRB 1IKMA 4K5WA 3HKZB 2F3VA 4YIJA 4HSPA 1JCKB 1MGSA 1CZGA 2K0PA 4Q5VA 4KD4A 2QJLA 2I46A 3T51B 4DAVA 4CKEA 3GTJB 1HQMC 1B50A 2K5QA 1ZYRC 2HQEA 1WTQA 1HZ5A 5K36H 1JQYD 3MA2B 4KK7A 1E9MA 2F0SA 3MWYW 3AMUA 3D8GA 1IGDA 1KTKA 2A69C 4JPSA 2FE8A 1K8MA 5BN3A 5DM63 4HROA 2JX5A 1PZJD 2L4NA 3OIPA 4IUVA 1CJEA 1MHXA 2O2LD 1KAAA 4LK0M 3GV6A 4K6DA 1HHVA 1BF4A 2WINB 3AEBB 2MJ8A 3SDZA 2E75C 4MT5A 2BDOA 4XTCS 3PMFA 3RFZB 4CKCA 1SYBA 5KEEA 2IW3A 4Y7NB 3P7JA 1II3A 4ARIA 1IKLA 3SR6A 3I72A 3J81L 4YWGG 1QOAA 1KNAA 1WXQA 4HTHA 5JVH3 4BBSB 1PFDA 1S5ED 1EU4A 1F9RA 3U9SA 4OVZA 4C3JG 2M00A 2CVRA 5IOCA 4KKJA 4CBVA 3CKIB 1A6XA 4XYQA 5J39A 1FXAA 1FRRA 4H7BA 3VYUA 3X3NA 1EOTA 1VJKA 1HXYD 1EQTA 2D5DA 4H44C 2K5PA 1TWFB 3DM1A 4HCSA 1LO5D 4WH4A 1B9RA 2XRQD 1O7LA 3K7AB 1OFFA 2E2DC 2NN6I 4KY6A 1QT9A 1V1PB 1WTPA 3ZGZA 4P2CB 1AFPA 4IZ8A 1Q10A 1PZKD 1O7ZA 3R2IA 3GTMB 1Y1VB 3TP8A 5EBDA 2X38A 4RCNA 2CW0D 1VLBA 1ILQA 1EIGA 2X6GA 3PUZA 1WTOA 2WDRB 3IT4B 1GUOA 3N6RA 2NN6G 1OXUA 1HA6A 5IGCA 5T1IA 2WU5B 1GUSA 3U2SC 1RF2D 4JBWA 4X3SA 1U4RA 3ZJUA 4EGVA 1S5DD 2J53A 4RGNA 5CGKA 5CV8A 1N5XA 3EQLC 2F0OA 5I2YA 1V8CA 2JSVX 4V190 3EGRA 3M3YB 2KUMA 3AE3B 4IFDH 5JEAG 3IAS1 1C78A 2SAKA 3CRKC 1A15A 2FMMA 2PW5A 4OO1H 3C1EA 4C3HG 5A2QL 4TQ0A 4K5XA 1RYJA 3NPPA 2BB5A 3I4NB 4LMQD 1DOIA 3GS2A 5C0XJ 2DYOA 2EELA 4M0WA 1JWAD 4J1MA 2JU6X 2F3WA 3NVYA 3P4RB 1FMAD 2AQ1B 1PTOD 2C9OA 5BYQA 4UDUC 3HS0C 3TUOA 1MD2D 1DJRD 1NCVA 3SK5A 4WFN3 4ME5A 1BUVT 1BNZA 4XQNA 4F87A 2WNMA 2EXZA 1QJOA 3BK2A 2TSSA 2F0QA 3QO2A 3TP7A 1C8CA 1I4GA 2V0GA 2DNEA 2NWGA 1BCPD 3VR8B 5I9PA 3U4EG 2IWHA 4HMIA 3AE1B 1E6EB 1P7FA 3NSWA 2RPVA 4DAYA 3J9CA 1E10A 1UUPA 1DXMA 5C4JB 2PVGC 2PCFB 4IFDJ 1F2RI 2QSDA 5M5XB 1TVXA 2F0UA 2ID0A 3VR9B 1MVKA 2EJMA 4WJWA 2L1BA 3D4DA 4DNRB 1RWSA 2LHEA 3QOJA 3DXJC 2WKDA 1PDQA 4M8AA 3A7AB 3H6MA 3KF8A 4U673 3GTQB 2KQ3A 5MPOA 1XTCD 3FEWX 3NTIA 2B2WC 2NTSA 1KNEA 2KEEA 1V97A 2A6HC 1D6EC 1QNUA 3OW7A 3T3NA 3M85A 3AECB 2EYPA 3P75A 3T56B 1SB3C 5E4WC 3I57A 3TEZA 1F9QA 2V4DA 4ARCA 2GI9A 1I6VC 4G4KA 5K36G 5HGTA 1SFOB 3AEEB 3GTOB 1F9SA 1UAPA 2E2HB 1P7EA 2KCNA 4A9AA 2F0TA 2O5IC 1L6UA 4C3JB 3A7LA 2ZT9C 1CHPD 2EYHA 5HG2A 3I9V1 1YNNC 1FIQA 2N55A 5IGFA 2BS4B 4R3DA 3MC0B 1ESRA 1I7HA 2WU2B 3K5MA 3HRZC 3FRPB 4B9WA 4KD3A 4KV6A 2MEKA 1YNJD 3ERQA 2JEBI 4TRDA 2JYTA 1YJJA 2IGDA 2MPMA 4ZRZA 4JX1C 1C76A 2XNAC 3A56A 1B3AA 2JXMB 2BBCA 1VDVA 3MXUA 3V2TA 3KK7A 3BZDB 1LACA 3AEDB 1XLOA 4O42A 2L83A 5KNBA 3HP3A 1SE4A 1D5XC 5C4HA 1EY0A 1J9OA 2O5JC 4EVOA 2A6HD 3SR1A 4TMAB 3G6JB 3E9SA 3AEFB 2G9DA 3EROA 4TQ1A 4HSVA 4UAIA 1I6HB 5C0XG 2IPKD 1JW9D 3J80E 1WTWA 1TR5A 3R8BA 3E56A 4L6TB 3HG9A 5M3MB 1ZOYB 2KOLA 2R3ZA 2WQYB 4XE0A 3DMUA 2KHSA 1C4PA 3TEXA 2L9HA 4ZK9B 4XQJA 1IBXB 1FFUA 2KECA 3OMCA 5TSSA 4N59A 5A2QE 2XSCA 1ZXHA 1SNQA 1ACCA 1SYEA 1CI3M 2H89B 2GA4B 3BK1A 3L4PA 3MXPA 1T3QA 4R8IA 4XT1B 1IL8A 2NVYB 1PDXA 1JWSD 1OXXK 1SSOA 2LGIA 1SBBB 1V8QA 1X3PA 1E0BA 2BOSA 2TMPA 2A5HA 3H94A 2DY8A 4ZRQA 1B9MA 2K7VA 1H9RA 2PMZB 1WD0A 4FVMA 1FCCC 3RUZA 1CHQD 1XCTL 2IGHA 4RNAA 3ITPA 3GO5A 4C1NI 5CMDA 2B2VC 4XDXA 4RA8A 1MSHA 2MGSA 2B2VA 2W54A 4H2AA 4KN7C 4C7ZA 2LHDA 3K59A 3E5SA 1YQ4B 2W3SA 3V3XA 4N9PA 2IJ0A 4CKBA 4K6LA 2WXQA 1BXTA 1KRHA 1PLFA 1TWAB 2EZVA 3HOYB 2HDEA 1VF7A 1XLNA 2L52A 2EE1A 3NBIA 2VB2X 4PMCA 2A6ED 2PQEA 3I4MB 3FVQA 2ZW0A 1QG7A 4GZYC 4DU9A 1Y69U 1LT3D 2H4OA 2BDNA 4XIGS 1WSPA 5IODA 5C44B 2E76C 5AFWA 4P6VF 2B76B 3A8KE 3K57A 2PZTA 5C3JB 1L0YB 2LS01 1CQFA 2AWOA 3N9YC 5JEAH 2F0IA 2F0MA 3DWAA 1NR4A 2F0EA 2ONQA 1BR9A 5NUCA 5EE1A 1A2UA 3NBHA 3A8JE 2ACZB 2N7JA 2B63B 2NTTA 3Q8BA 1FRDA 2Y5CA 4CQNA 4C3HB 5IGGA 1KDBA 5FLXE 3IAM1 3B2FA 1DM0B 1W6KA 1QE6A 4DNTB 3Q22A 1FNVA 4XWTA 5JJZA 1LV9A 2L0CA 3KLRA 4X3TA 1PFBA 1I4RA 1K51A 1NYRA 3KBXA 3W1SA 4C80A 1OQQA 1EY4A 4J6HA 2PPBC 3SK6A 5ELBA 3S9WA 5FO7B 3G7LA 3L3OC 3TZUA 2SNMA 4OZCA 3BDLA 3D31A 4WWMA 4R8NA 1FEHA 1AWDA 2NN6H 1SDFA 3ND9A 1S5FD 1A2TA 3I90A 2O4XA 3AE5B 2SDFA 3A55A 1FGBD 2EYFA 4S3SA 2M0AA 4FNFA 1U4LA 1Y56A 3B9JA 1TY2A 5D3IB 3D6CA 3W3AA 4TSSA 4OZAA 3SK4A 2AQ2B 4D2KA 4JK1C 2BCOA 3CIRB 1FM0D 3VYRA 3PO2B 1DD2A 1FNWA 2WXNA 3RMHA 1EFID 2QILA 3SFDB 1PFMA 3DEPA 5CV5A 2K05A 1WRIA 2PVOD 3NXWA 2F1MA 4A3FB 4KX6B 3BDOA 4C3IB 4DK1A 5A35A 2NB0A 2KWDA 1ZEQX 3ZJTA 3AE6B 2E2JB 2ICEC 1AP0A 4BY1B 1U9RA 1PTOH 1SNDA 1BMLC 3P4SB 3AE9B 3F2UA 4L1BA 4GDLB 3MXNA 1O80A 4O1NA 3ONAB 1LTBD 4WQMA 4CJ0B 1D2BA 1B1ZA 4KTAA 2N9LA 2YU9B 3VR3A 3NVWA 5KYLA 3T16A 3J7AV 2I2YA 4KN4C 3S1QB 4FXCA 1QILA 1GHKA 3W9CB 2A68C 2A69D 4K8IA 5FO9B 3NVZA 1YN3A 1WTVA 4A3BB 4MACA 3S14B 3RZOB 1H9SB 5DAUA 2K28A 4PQXA 1UWXA 4A3JB 2WXJA 1EL0A 1I50B 4HAEA 5HI1A 3AE4B 1QB5D 1ZUD2 2LMCB 1RJTA 4HKQA 2R7ZB 3Q8AA 2JA5B 1Z6HA 2J42A 4USAA 4QMGA 5KNDA 3QIAA 2WB1B 4HEDA 3TBIB 5JPNC 3SE0A 1YNND 2JA7B 1JC7A 5JPMC 1HRJA 2K3UA 3ETRA 3P42A 4F88A 2E3TA 2QMTA 2WXIA 4FF4A 4K2LA 3DWGC 4PMWA 1GHJA 3HRDD 5KYIA 5JAVA 1FD7D 1XYIA 3K5NA 5FOBB 1X3QA 2B2WA 2BA1A 2VZKD 3VA5A 5C6AA 2KN4A 3MP9A 1VZ8A 3DHQA 1K83B 2CQAA 2F0JA 5T8IA 1G8ZD 1T5XD 4A55A 3PO0A 1EY5A 3VQIA 3AB9A 4AYBB 3MTSA 2NBFA 4XXEA 1E2VA 2OXPA 3GTPB 2K04A 3K6OA 2MUYA 4QF4A 2EY1A 4DXFA 2F0NA 1EIHA 1O78A 1W6JA 5FR3A 1I4PA 3J7YW 2IL8A 2BW2A 3A54A 2I07B 2G9HD 4KKUA 4IDIA 3RPFC 3CWIA 1F9PA 4MIUA 2EKIA 1Z7TA 1SYDA 1T5EA 1EYAA 5C4ZA 3J80L 1JICA 3KLSA 3KWLA 1FO4A 3K58A 3DEOA 1B4OA 3NWSA 1BCPF 1BCPC 1SYGA 3VRBB 2A6EC 2RBMA 2DWQA 1HUMA 3CHBD 3T13A 2BE5C 3S16B 5T1GA 4KJOA 1ESFA 3MXGA 3QJYA 4IQZA 5I4DA 4LAAA 1IYVA 4G57A 2C5CA 1RODA 5EE9A 3AV8A 1CA6A 4REZA 1R4PB 3CQZB 1YNTE 3OOCA 2L1AA 1DOLA 3Q8EA 2L11A 3BVZA 4WIPA 1RFKA 1JOOA 1Q3LA 5CBEE 3BIID 5DM73 1HUNA 2Q8RE 2LY7A 3KWVA 1Q8IA 3R2TA 1ML0D 3W2DA 2KAJA 1ONLA 5CV7A 2RQXA 1PRTB 2EJFC 2RSOA 1FFVA 1CTMA 4HJGE 1C79A 1R7SA 1TKYA 3HOXB 3R93A 3S1MB 2J0TD 4YTNB 4IUNA 1WD1A 4GDKB 1QWYA 2XRSD 3NTHA 1A3VA 1KFYB 1XF5L 3T53B 1PTOF 3HVZA 3C8YA 4FF1A 3SK8A 3NHHA 3GP7A 4HN7A 2BS3B 1N61A 1ZP0B 3HOWB 1YJIA 3BYYB 1IYUA 1QOFA 4WAFA 3BG3A 1PMRA 1N5WA 3M7GA 1VDZA 3EVQA 1I4QA 3IKJA 5KIXA 1EEID 4LJZC 1RD9D 1JRPA 3U9OA 1K8OA 1L4ZB 3LB8C 1GUGA 1DOMA 2MJDA 3AU7A 2W82A 2VXWA 3LNNA 1IW7D 3PIO3 3N52A 2B2YC 1KDAA 1IW7C 2CJNA 4CJ1B 3RD4A 4K5VA 1QQRA 4B0MA 2K5WA 3VR2A 1HA5A 1YNJC 1STEA 2SOBA 4FYDA 2WACA 3BVGA 2IX1A 2EYMA 3KBGA 1A70A 2E74C 3TSSA 2AUKA 4ZHOA 1E2ZA 5EPJA 4Q2JA 2JA6B 3OWEB 2WIIB 2EOTA 1AW7A 3QG1A 2DLBA 1C4AA 4XQQA 2RVLA 3C2PA 4JWSC 2WXPA 3U52E 3FILB 3PIP3 2F4IA 1QOGA 5D65A 3B2GA 3HUIA 2HCCA 2VB3X 5BMGA 4IFDI 1LTGD 2EJGC 4B08A 2Q8TA 4IN3A 2Y0SB 5JOBA 3UI2A 2WDQB 2E6XA 2KCCA 2WP8J 3Q6SA 1TY0A 2RDHA 1G2SA 1S4ZA 1TWGB 1I4XA 2WLBA 1GJXA 5HURA 1NSNS 4EQPA 2V3NA 1DONA 1BCPB 1TYGB 4ZQ3A 3S15B 1X32A 2ZXRA 2M56B 1SAPA 3J7AF 3AM9A 5KNCA 3I73A 4CJ2C 3NRZA 1BBXC 2W55A 4KI0A 1LLRD 2XWJB 2AQ3B 4M1UB 1IUEA 1NEKB 2FMCA 3QWNA 3LYYA 1J8IA 1E2WA 2Q8IB 3Q8FA 3PUVA 2KJXA 5COYA 1KLGD 4ITKA 1XX8A 2LKVA 5F2DA 2WS3B 4RGOS 1EY9A 1Z47A 3MFGA 4KHVA 5C0XI 4IALA 2K32A 1DOKA 5I6WA 2DYMA 1PXUA 1SEBD 2G1EA 1MSGA 3FILA 1H9JA 3NK9A 5DEHA 2PZUA 3OPOA 1A3TA 5C5LA 3HVDA 2Z4HA 4DQOC 3NQIA 2EY6A 3GV3A 2W3RA 4MN3A 1HTPA 2KQ4X 5FK9C 4HMJA 1E7PB 3I3CA 3D4RA 4C1NK 1L6VA 1VRAB 1SE2A 1QOHA 3OMGA 1EYDA 2D9UA 4YXDB 4A8XC 2OF1A 1DZ1A 2OT2A 1YMHE 3RZDB 2DN8A 1VMPA 2NMQA 3Q8CA 1TZOA 3HGBA 2QEJC 1FXIA 1I4HA 3S17B 2WXRA 4X3UA 2IX0A 4DN4M 2SNSA 2EYJA 5BYRA 1XLQA 4KY7A 1L0XB 3MVVA 2JE6I 5LL6X 1DOXA 2A73B 1CM9A 3D6WA 4KKTA 5FKAC 2XN9C 2K01A 2B8GA 5M5WB 4ID6A 4H13C 4ABNA 3MZ5A 3TDQA 3LX0A 2F0KA 4A3EB 4LK1C 1MBYA 1CQVA 1D1KA 4DGZA 2WXMA 2ON8A 1LTAD 3PO3B 1CT1D 2PZWA 4DF7A 1KH0A 5IGBA 3V05A 5FO8B 3IAYA 5J22A 5G5GA 1SMYD 5CR3A 1GUTA 1VZ6A 2AUJD 3P20A 4J3OD 3DWPA 4IURA 2F0VA 1TU2B 1TKWB 4P16A 2RA4A 1TT2A 2RDGA 2MJ3A 2VZKB 2WXKA 2EDGA 1J7CA 3EA6A 1TQOA 5IIFA 4XYOA 3MFYA 1JB3A 3RLFA 2B2TA 1SMYC 4ILWA 1QOBA 3S1NB 3IFTA 1XXGA 4EQNA 3S1RB 1PZID 4B9XA 1LTRD 2VUMB 2K03A 1AZQA 5BMHA 2YEPF 3AEAB 1Y8PB 3DWQA 2NVQB 5HFYA 1HZ6A 5AUIA 4L2YA 1IGCA 1KLUD 4G7HC 4V0BA 4L23A 4RKBA 1AEXA 3W5UB 1MPEA 3V96A 3P1MA 2K9XA 1OXVA 3SHLA 5I6YA 2NYZD 4KGTA 3SXHA 5ELFA 3GB1A 1N63A 2B8FA 4MH8A 2ZXPA 3ABVB 3I4LA 1TJEA 4NW2A 4BA2I 1JMLA 4KKSA 3TZDA 1BOSA 4ULLA 5K5PA 1FR3A 1NAPA 5BN5A 2B2YA 4NDXA 4CHTB 5EQ0A 1ZPSA 4YSZB 1HTLD 5EE0A 4Q0FA 1RDPD 1ROEA 1EWCA 1WCMB 2LJIA 2NVTB 1C4QA 2FBWB 1ENCA 1UNSA 4KKIA 1S5BD 1PRTF 3HOVB 1PYWD 2QCPX 2Z4IA 1JE4A 5CV6A 5CC4A 4ZUJA 4FF3A 2FHTA 2F0LA 1EY7A 1CA5A 1K52A 4NAWB 4OIJA 1OXTA 3H3VC 4KY5A 1E0ZA 5CV4A 2L12A 2WP9B 5J1ZA 1C77A 4XDCA 2PMVA 2KACA 2NUCA 3R3OA 1GUNA 4OHJA 3C1FA 1SSNA 2PO4A 4MM3B 2F0HA 4PV1C 4MHEA 5M9OA 5BYSA 2FJ2A 3URYA 2BTEA 5ELDA 3EJIA 4XDDA 3BWUD 3K5LA 4AS1A 1LTID 4HKZE 4FP5D 2V4IB 5EBCA 5KGUA 3OHXC 3HEJA 1RCVD 1BUIC 4ZYSA 3FAHA 2J4XA 1BO0A 4YTMB 1EQVA 4RHRA 2JXTA 1N62A 3DUZA 4RH6A 2IX3A 3WOEA 4A6QA 2J7ZA 5C0XH 3Q24A 4WURA 2EYOA 4NZLB 4ZOHC 1TWHB 1NENB 1TWCB 5CV9A 3AEGB 1MI0A 5BMIA 3L7ZC 3I8ZA 4HRSA 3OWFA 1JORA 1B2TA 2PW9A 2JYEA 4WRDA 2NZ1D 2K5DA 4JWUC 5E6JA 1PRTD 1H9MA 1WVLA 4A3GB 3ZYYX 1YN5A 4GLSC 4ZKBB 1R9TB 5CYUA 2HTME 5JXVA 1C4CA 1G91A 1TKEA 3NVVA 3SFEB 1Q90A 3I70A 3E0JA 3OSOA 2JA8B 1STAA 2VNUD 2YEPB 3HOZB 2M9VA 4E6IA 4DA2A 3GTLB 1K50A 2AX5A 4U68A 5G5HA 1VCIA 3FPPA 1HFNA 4A3KB 2PLPA 3VYTA 3OIQA 2Q5WD 3QOLA 1IHZA 2MHVA 3D4WA 5ELEA 5I9OA 1SYFA 3U7ZA 1GB4A 3NTKA 3TP6A 2R93B 1GOZA 3K5OA 3O13A 5H92C 2JYOA 3CRLC 4FXDA 1H9SA 3EFXD 1ET9A 4WORA 4XT3B 4TKOB 4OO1I 1GAQB 4KGSA 5IT9L 4NMZA 2MJEA 3MAQA 5C3EB 5EGTA 4DK0A 2B39A 1QF6A 4I65A 2WDVB 4C7YA 1BDOA 4BBRB 2N9KA 4C2MB 3PUXA 1PTOB 2KMMA 2Y5PA 5C2TB 1HPCA 1RHPA 1QLBB 1JOKA 5D14A 2FFKB 4YT0B 1GUWA 3VYSA 4C3IG 1EZ6A 2QKIC 2FUG1 3VR5A 2ZXOA 4PMBA 1OQRA 2A74C 1PFNA 2FINB 1DGJA 5M3FB 2BA0A 3ND8A 1F0ZA 4HCEA 1XO3A 2F0GA 3BS1A 3T3OA 2L55A 2RDFA 5C3XA 1F2MA 2H88B 1AN8A 3D3RA 4RAUC 3P63A 5LNK1 4JE3B 1ENAA 4IFDG 1Y8NB 3FC4A 4RGMA 2OEOA 1MHHE 1SNOA 3MHBA 4RFBA 1SYCA 3LWEA 5EKLA 5G3LF 1FYCA 2HUGA 2PNRC 3PZ8A 1D5MC 1XWEA 1UEAB 4QCLA 2EYLA 3NE5B 1JWBD 3AH7A 2N88A 1M8AA 3VRAB 2YYZA 1Q1EA 2Z8LA 3JAML 2CHBD 4ZLTF 4KHZA 1VMCA 1ZDVA 5IGEA 4RF1A 3SVMA 3KUPA 1TS2A 2GRIA 5GXGB 4K14A 3BYTB 1C48A 3TMEA 2LFNA 4F8MA 1ILPA 4J8QA 3L9AX 1CFMA 1U4MA 3AMZA 4DFAA 2R61A 2EY2A 1JQ4A 4IKGA 3TEYA 2D5GA 3IFDA 3LWUA 1L5PA 1D1IA 3LXFA 1LABA 2I38A 5JVG3 3SEBA 2HCIA 4G7OC 3DWMA 1ZXIA 1LT5D 4OL7A 4IUQA 4A90A 2DNCA 1EU3A 1EWYC 2ZW1A 1CZWA 2IT1A 3ZJVA 1TIID 2E2IB 2RKSA 2OEDA 1HCZA 4H0LC 3S2HB 2WXLA 1EY8A 5AUKA 1JALA 1HEZE 1H9KA 2F0WA 1XEEA 1EY6A 2EVBA 3NUHB 4HR7B 1DCZA 1V43A 4YTPB 1DYQA 1F2LA 1TS3A 1F2RC 4FO2A 2DBYA 4DXGA 1SF0A 1VZ7A 5EKKA 1STHA 2V3PA 1WGKA 3NP8A 4X3KA 5CBAE 3AB5A 1SXTA 1ET6A 3IT6B 5D7GA 5EPLA 3BVMA 4NJCA 3HZXA 1PGBA 3PZ7A 3TN2A 4NP5A 2RSNA 3S2DB 1M4VA 2D2CC 2EY5A 5IGDA 1GXDC 2B2TC 2IDYA 3PV0A 4NKLA 3I91A 4RHSA 1NUCA 1RM6C 3EUB2 3X3MA 1WTXA 5I2XA 4C56C 1YN4A 4A3DB 1KDCA 4Z9CB 2JEAI 4TQUS 1JWUD 1WTRA 1ZDXA 1IBXA 2JZPA 5ISRA 1ZXTA 1Q1BA 2LFIA 2K22A 1MI2A 1PTOC 4BS9A 4A3IB