1TS2A

T128a mutant of toxic shock syndrome toxin-1 from s. aureus
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
194
structure length
194
Chain Sequence
b'STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISALDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
publication title Structures of five mutants of toxic shock syndrome toxin-1 with reduced biological activity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 57
structure length 194
sequence length 194
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1997-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ts2A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ts2A01
1F77A 1LO5D 1PTOB 1PZKD 1L0YB 1UNSA 3BYYB 2NTTA 1SE3A 4O1NA 1PRTF 1PZJD 1CHPD 1FNUA 1S5ED 1I4GA 1D6EC 2J4XA 1XTCD 4RH6A 1D5XC 2O2LD 1TS3A 1PYWD 1AW7A 1LTAD 1HA5A 1LTRD 1PTOF 1QILA 1SXTA 4RHRA 1L0XB 1ET6A 4K6LA 1LTTD 1CK1A 1ET9A 5D3IB 1CQVA 1JWMD 4RGNA 1UUPA 3BZDB 2RDHA 5ELFA 4C56C 1RCVD 5FK9C 3URYA 1B44D 1FNVA 4RGOS 3MC0B 1BXTA 2AQ2B 5ELCA 3KLSX 3R8BA 1CT1D 2XNAC 2XN9C 4UDUC 1V1PB 1YN4A 1TS5A 1RD9D 1D5ZC 2XRQD 1M4VA 2IJ0A 3TSSA 3MFGA 1EWCA 3W2DA 3O13A 1SJED 1TY2A 4RGMA 1FNWA 2NTSA 2Z8LA 1MD2D 1YN5A 1HQRD 3GP7A 1PRTC 4OHJA 2QILA 1PTOH 3BVMA 2ICIA 1FD7D 3EFXD 5ELBA 1BCPD 1V1OA 4DXFA 3DWAA 2AQ1B 3BVGA 1LT6D 1PTOC 1LTBD 2SEBD 1STEA 3CHBD 1BCPB 1JQYD 1I4QA 2RDGA 1EEID 2TSSA 3DWQA 1G8ZD 1HXYD 2WV6D 2IPKD 1S5CD 4RHSA 5ELDA 1I4RA 1JWUD 1S5BD 3R2TA 1DYQA 1T5XD 5D3DA 3EA6A 3V05A 1D5MC 1S5DD 1TS4A 1KLUD 1BCPF 1CHQD 1RDPD 1KTKA 4RFBA 1JCKB 1YN3A 3DWPA 1JR0D 1SEBD 1ENFA 1SBBB 1LTSD 5FKAC 1EU3A 1FGBD 1I4HA 4L6TB 1EFID 1SE2A 1TS2A 1LTID 1KLGD 5ELEA 1V1PA 1GOZA 4ZYSA 1LT4D 1SJHD 2G9HD 4RCOA 1AN8A 1LT5D 2CHBD 2XRSD 1LLRD 1PZID 5I4DA 1JWSD 1HTLD 4DXGA 4NZLB 3OWEB 1XXGA 1PRTD 4BWGB 1RF2D 4Z9CB 1LTGD 1DJRD 1I4PA 3BVZA 5TSSA 4RGTA 3SEBA 1EU4A 1PRTB 2R61A 1S5FD 3R2IA 2AQ3B 1BCPC 1ESFA 2QEJC 4TSSA 1PTOD 1I4XA 1B1ZA 1LT3D 1EEFD 3BYTB 4L63B 1SE4A 1TY0A
chains in the Genus database with same CATH superfamily
3Q8EA 2ALYB 2M2LA 1PGBA 5EJWA 5C4XG 1KDAA 5M5WH 1PZJD 5A35A 1P98A 3PIP3 1STYA 2VZKD 2GVAA 3ZNZB 3Q8DA 3H0GH 4IQZA 3TEYA 1PFNA 2N49A 5JEAJ 3B08A 4MSQB 4YIJA 2K6AA 4DU9A 2QC8A 4LF9Q 3MC8A 1CZGA 3W1BA 3TRZA 1HZAA 2K4KA 4MJSB 2CWPA 3OPOA 2NVXB 1LTTD 5G3LF 5AJ3L 1QKZA 3VYUA 4FNFA 1WYWB 4KVGB 1E7UA 3IBEA 2KUMA 2MJDA 1IBML 2KWCA 5ELFA 3PGEA 3HHMA 3FILA 3I55A 3PPAA 2A69C 4MTKA 4P7IA 4HSPA 2A73B 3A7AB 1LM8B 4DV4L 2XN9C 3VUWA 1U4LA 3KK7A 3SR1A 1D5ZC 5BYRA 2DUDA 1E2ZA 2XRQD 5M5YB 4IDIA 4B95A 4A55A 3ND8A 3KF8B 2K33A 1SJED 2AWNA 5BYQA 3MHBA 2V1CC 4X62L 2QSDA 1IW7D 1D8LA 1NSNS 1JJGA 1SDFA 4FXGC 3S1MH 1XQQA 3ZVVA 5C3EB 3ETRA 4FF1A 4ITKA 4QUCA 3CKIB 1BBUA 1FD7D 2HTHA 1DOIA 4DV3L 4KKIA 3P4QB 1XMOL 2K6QA 1GUTA 3I73A 1IBLL 2A5HA 1YJJA 3OOCA 2RGFA 4GDLB 4XDDA 2O2VB 1SE8A 1WRDB 1NR4A 2KVZA 1Q7YC 1IGDA 4NQKE 5C1ZA 3CCSA 1DZ1A 4WORA 1QUQA 2INPE 5FJ8H 4CKBA 3GTPB 2JQOA 4YSXB 2IPKD 1AE3A 1XJVA 2NVXH 2DZMA 1FCLA 2NWGA 3Q6SA 4H02A 2O5IC 1I4RA 5BN4A 2ES2A 1T5XD 3ND9A 5D3DA 2IT1A 1CKNA 2DZJA 3RULA 2IX0A 1TT5B 4DV7L 2NS5A 4LJOB 1PH5A 1M90C 2KO3A 3SU8X 1E10A 1ENFA 1MI0A 1LTSD 2UU9Q 2LASA 2CHZA 2F0NA 5M5YH 1S3SG 4US8A 4LFAQ 3WWVA 1Y8RC 2EDGA 4UPAA 2YVCA 1CQFA 2FJ2A 1E8YA 2WAQB 2UXDQ 1UZXB 5NUCA 4K7WA 5BN3A 1IYJB 2KQ4X 2JN4A 3L9AX 5C3EH 5C5MA 3S16B 2EMTA 4ZUJA 5I2XA 4A3JB 4IUNA 4LF4L 3H7PA 1PGXA 5CV5A 1EUJA 1NR2A 1WGDA 4W9FA 2KECA 1MG8A 5C4JB 2CJNA 3OJ4B 4A3IH 3H1UA 3PF5A 1Q1EA 3S24A 3OIQA 2K32A 4TQ1A 1B53A 3NHEB 3BVZA 3F2DA 3OIPA 4G3XB 4BBSB 3W1YA 3SEBA 2L12A 3MP9A 3H3VI 1QOGA 4ILWA 3R2IA 4MN3A 2B63G 4WJWA 2CKZB 5FLMG 2WXQA 1ESFA 4WJOA 1B1ZA 1EZ6A 1GUGA 3HOXB 1RODA 3UIPB 5EAYA 3M85A 2LMCB 1A5RA 2B76B 4POFA 1A3UA 1E8ZA 3J81E 2RDBC 1FNUA 4RM9A 2PVGC 1IXRA 4CGYB 5I9PA 3MAQA 4A3BB 5E6JA 2KC2A 2R7ZG 1JMLA 1Q12A 3D4DA 2B2YC 2FMCA 4X3KA 1TS3A 3T53B 2ZJPA 1X3GA 1QILA 2WXOA 3GE8C 1SYEA 1A15A 4UP7A 4RAUC 1W6JA 3M4QA 4HPMB 3VDZA 3S16H 2QHOA 3D32A 4A3JH 3BZKA 2HHHL 1VQFA 3PO3B 2PW9A 2EYOA 2MBOA 2NBUA 1ZXTA 5BYSA 1HQMC 1B3AA 3HOVB 5T1IA 5C4JH 3TL5A 4DK1A 1MFWA 4CHTB 1XMQQ 1WY8A 5G3LD 1KRSA 3A8JE 4LF7Q 3IXSA 4AYBE 1Z47A 2DY7A 1BUVT 3FPPA 3KJPA 1VCBA 4L5QA 2MX2A 4K1RB 1CT1D 1OQYA 2WP9B 2SOBA 4AOFA 4EVOA 1ZKHA 2KANA 1YX5B 2C60A 4YT0B 4X3TA 2VUMG 1H9KA 3RD4A 2K8BA 1VDVA 2F0UA 2YLMA 2DNFA 4DF7A 2DN8A 2NVUI 3FVQA 2R2OA 3H0GG 1V80A 4C7ZA 5GADC 1TIID 4WRDA 4YHHL 3KLSA 3NOBA 4XIGS 1YNJD 2EELA 5IP4D 4PV1C 1E8XA 2Q5WD 4H7BA 3I4MG 3P4RB 3IVFA 1NY4A 2AQ1B 2MA9B 1GJXA 3I3TB 3GZNI 3CHBD 2I07B 1V5OA 3RFZB 3HUIA 1STAA 1UWXA 1WI0A 2SNMA 4XYCA 4CQNA 5HGTA 1TKWB 1GVPA 2PYKA 3KYHC 1WTPA 4CDEC 2D5GA 2VNUD 4LFBQ 2HD5B 1QVCA 2BS4B 3H09A 1X56A 4MNOA 2ZM6L 3PO3H 3F2CA 1XWEA 1FXTB 3EA6A 4K2KA 3P7JA 1RLFA 2JPHA 3QK0A 5CHVC 5C0XG 1XPOA 1EFWA 1SIFA 4FP5D 3J80L 1V86A 3U8ZA 3MXGA 2MQJA 1J19A 1EUVB 4QIWE 1P8LA 4A3FH 2QDBA 3KBXA 4MZ9A 5D65A 3QCAA 3ZXRA 3JAME 1IZ6A 1GOZA 1EOTA 2QMTA 1SJHD 2A69D 4U68A 1SROA 4Q2JA 5C4HA 3K9OB 3AU4A 4USAA 2EY1A 1EF5A 2EYMA 4K6DA 4JC0A 4QJFA 1PH3A 1KJTA 1HZ6A 2L9HA 3B9JA 3LX0A 1C9FA 4NPSA 2KXJA 1IBXA 5IP7H 2K5DA 1J7AA 3KLWA 2H89B 2MBEA 3A5ZB 2A1AA 2A4ZA 2B29A 2FUG1 4HROA 2MWSB 3N9YC 4QB4A 4M8AA 2NPTB 3MHZA 1X3QA 4A3EG 2AWTA 3PHWB 3QB3A 2ZXOA 2V3PA 2R61A 3ZJUA 3WAPA 1I3QB 2AKWB 1IGCA 2HTME 2SAKA 4X64Q 2L32A 2N9LA 4GNXB 3P75A 1E90A 1CKOA 2WXNA 1NE3A 1KHIA 2K5NA 5DPSA 5BMIA 2MP2A 1L7YA 3HOWG 1TWGB 2DYBA 3CCJA 4TUUA 1WD0A 2WU2B 3AEGB 3NTKA 4HPLB 3SGIA 4KHZA 1SGHA 1D5XC 1W6KA 3V2TA 1JB7A 2VRRB 1EIYB 2ATWA 2WACA 1HR0L 3MWYW 4DGZA 3M4OH 3G4SA 4K6LA 4A3IG 1CM9A 1PMRA 1WR1A 1N62A 5D3IB 3AE9B 5G55A 4IFDG 1VRAB 2KKCA 3DHGC 1RCVD 3RNBC 2F3VA 4DR1Q 1QZGA 4FHJA 2JVCA 2GBMA 4RGOS 4ID6A 2K22A 3AEEB 5IYDH 2WXKA 4KDLB 3ZNID 1JT8A 2PZWA 4G50A 1TZOA 1CA5A 3P63A 1EYGA 3EECA 1DXMA 1I3QH 3RZWC 3KOJA 1STGA 1MD2D 1RTNA 3ABVB 3DBHI 4IW0A 3RUZA 4HKZE 3UGBB 1WH3A 2LD9A 3PRMB 1PH9A 3EJIA 3Q69A 5KNCA 1TWGH 1N34L 1QZEA 1BKBA 4GNXC 2FBWB 2LGDA 2FCMA 4K5XA 4RMFA 1M8AA 1BDOA 2LGXA 4B6WA 4LFAL 2B2TA 4ACFA 1S3OA 2I46A 1Q10A 4BFRA 2UXDL 3VH4B 4M0WA 1YMHE 4JK1C 4KD3A 2G4DB 1EY5A 4EX5A 3N1YC 1RJTA 1A3TA 1VQEA 2F0TA 3I70A 3TMEA 3K58A 4IOCA 2G9DA 3V05A 4NMZA 4A3CG 3HIZA 1DOMA 3ML9A 1YQBA 3PSEB 4NQLB 3W1SC 3QG1A 2GA4B 1IPGA 1L4DB 3TBLD 4EOYA 2PMZB 1X32A 4LNKA 3PLUA 5CGKA 1A0IA 1OTCA 1ZP0B 5AUKA 2KCMA 1SBBB 4MACA 4C3IB 2WP8J 5ELOA 1PH1A 4A3PA 2WB1B 3K5MA 2C5CA 3GTMB 3L08A 3OTOQ 3N3KB 4HTHA 1KIXA 4JW0A 1R4NB 1SN8A 4W9HA 4EZKA 3F2UA 3HFZB 4F7XA 1SSNA 1SYFA 2A6HC 1WGYA 1ZXHA 3A4RA 4XT3B 5LLIA 3F8TA 2CHBD 2XRSD 1WTWA 2FCSA 3L0OA 5I4DA 2JYEA 3UI2A 4HCEA 2KN4A 3AH7A 5HURA 2L0FA 2B3AA 3NY5A 2IO3B 2JYOA 2JA6B 3D6WA 1YHAA 1HHVA 4A4IA 2JU6X 1QOFA 2L83A 2ONQA 1OO9B 3NENA 4QAYA 3JC66 5F2DA 2FHTA 2RA4A 3ZO5B 3B0AA 4BOZB 2F0JA 5JOBA 2BW2A 2F03A 1CSPA 1N8RC 3HOUB 2Z0DB 2AQ3B 3D0FA 4OEMB 4CDDC 2PE9A 1WXVA 5CV4A 2NN6H 2VB3X 1RRBA 1KLVA 3WOFA 2V0GA 1Q86C 2CH4A 3CPWA 2KZRA 4A3FG 1TY0A 1AZQA 4A3DB 2KC1A 4LF7L 4NJCA 2OTLA 3IHPC 3S2HB 4WQMA 3AEBB 1S5ED 3MEHA 2OEOA 1XTCD 4RH6A 4HJGE 3GTMH 5IA7A 2FAZA 1JB3A 2UYZB 2ZPNA 1LM0A 2F0GA 2BDNA 4LF8Q 1TKYA 5JPNC 1U4PA 3SK4A 2K3UA 3I7FA 1V2YA 1ET6A 5BO4B 4TKOB 2KX3A 1GJZA 1SYBA 4FHKA 4E71A 4NPNA 1O80A 5IWAQ 4US9A 3S2AA 3ZIMA 1V9JA 4R4TA 5KHQA 1KQSA 3NS1A 3KWVA 3QA8A 1N36L 1SNDA 4LNQA 1K8GA 1IYVA 4LF5L 3A9JA 2JYTA 2AMCB 4KJOA 4FXCA 3M7GA 3RZDB 2ENBA 4GN3B 2IJ0A 2L1AA 4MEMA 2JX5A 4N58A 3Q8BA 2K7VA 2E2HB 2PE6B 3J81c 3ZQ4A 2YYZA 3PGZA 4JI1Q 2K8HA 3DM3A 1C1YB 4A3MB 3W1GA 4A3DH 3DBRI 4PMCA 1WX8A 1VQOA 4KN7C 2HDMA 1XD3B 2N0SB 3DQVA 3U4ZA 4ASWC 1DGSA 2C9OA 2F3WA 3HOYB 1Y1WG 4GLSC 2WV6D 2KCCA 1BF4A 2KLGA 1PYBA 1KF6B 1JROA 4G7OC 4POGA 2D3BA 2EOTA 2VQFL 1C76A 2Y5PA 4C4VA 5C4XB 1PYSB 4DK6C 5IGCA 5LL6X 4JI8Q 1UE7A 4FVMA 3LWEA 3X3MA 2C9WB 5CV8A 4GKJQ 3IFDA 4LLGM 2BBCA 1QOHA 4R8IA 1KRHA 2WKCA 2EJGC 4XWWA 1X3PA 2MO1A 3K6OA 1EQTA 3V61A 4AH6A 3K57A 1WGKA 2BB6A 2GRIA 1E1OA 2E2HH 3PLVA 2V1YA 2M56B 4DV1Q 3STBD 2PLPA 4W9IA 1A6XA 1AN8A 1HCZA 4O2DA 3S17B 2IDYA 3AEFB 4HMJA 1LUZA 1JWSD 2FXQA 2WINB 2C7MB 3ZNGC 3DEOA 1Q82C 4A3LG 1R4MI 3A55A 4A20A 4C3JH 5EGTA 5IGEA 1GC6A 1XLQA 2MJ8A 3P4PB 4G11A 3ULLA 4HRSA 4JIOU 1UH6A 4JBWA 4N9TA 4G7ZC 1I4PA 1VZ6A 4A93G 1KABA 3HOYH 3V60A 4CHKA 1PRTB 3SD5A 1WXMA 3MJWA 1HNZL 2WU5B 4DXAB 3K81C 1E24A 4HWIB 2QEJC 3F2BA 1TWFB 2G5DA 3NS8A 4W9EA 5C4XH 2B2WC 4DR1L 3F1ZA 2LJIA 2JUOA 1PTOB 3HKSA 2WKDA 1MIUA 5KNBA 3JAMc 2K8CA 3CIRB 4IKGA 1PXUA 2JP1A 2VQEQ 4LNFA 1WJUA 2KFKB 4B3ML 5LXHA 1HZ9A 3WOEA 3GQBA 1P7EA 3I4OA 2EYHA 1HZ5A 4B08A 1H9SB 2Z6KA 1QNKA 3CQZH 3CMEA 2NZ1D 2VXWA 4XT1B 1C79A 3NZ3A 4MT5A 2CH4W 1E22A 4QY7A 4L5RC 4GLAC 5J2RA 4F88A 3S17H 2KHIA 1SRUA 5KYIA 4XGAB 3FKYA 1ML0D 4IWPA 4GOCA 1B3QA 5I9OA 2KQSA 3HOZG 1E5WA 3E56A 2L00B 3PZ8A 1Z7TA 4ZRZA 2E2JB 2EKIA 4NJ6A 1EYAA 1RL2A 3DLLA 1WSPA 1NI2A 5KEEA 2IX3A 4R4QA 3NZUA 2N7JA 3VHTC 2NR2A 1YJ1A 2ZJQA 2LFIA 1TWHH 2CHXA 4DK3C 5DM63 4DUZQ 1TWFH 3AE2B 2XWJB 3TDQA 1PRTC 3VYSA 1DD2A 2I1KA 3ML8A 4GN5A 1PVOA 3MVVA 1PTOH 2JK8A 1KD1C 3N32A 4OWXB 2K1FA 2RVLA 3Q0AA 4BY7H 3OWFA 2B2VA 1PTOC 1LTBD 4BVUC 1C77A 1WWTA 2K01A 2LY7A 2B63B 3DVGY 2MCNB 1EWIA 1TR5A 2VB2X 2PKOA 3EFUA 3J81i 2EYPA 4URKA 2QIEB 5J17A 1Q8IA 1Y8PB 1S5BD 4JCVE 1Q1OA 2HT1A 2LRWA 2E75C 3FDTA 4HPPA 4KKUA 1VJKA 4AQYL 3B6YA 1YN3A 2E2JH 1Q3LA 1JR0D 3N52A 2R7ZB 3TP8A 3PZ7A 1J7CA 1FYCA 1J6QA 2MHVA 5FKAC 4EQNA 1B50A 4RM8A 3X23A 4JI3L 4CJ0B 3CRLC 2N1VA 2KOXA 4AYBG 4V0BA 1KLGD 1H95A 1EY0A 1L0WA 3KF6B 4HMIA 4M01A 1J8CA 2Z4IA 2YTVA 3EUB2 1IBKL 3T16A 4JWSC 2GMIC 4NP5A 5K36G 3KJOA 3ERQA 1S72A 2KCNA 4IUQA 2CW0C 2BWES 2KFJA 4QQBX 3T1YL 2ZTEA 1P7FA 3NTHA 2ZT9C 4I6LB 2K52A 4NZLB 4TQ0A 2K5HA 4BY1G 1UEBA 4Z9CB 1PFMA 2LGIA 2AWOA 1PH8A 2B63H 3H9DA 5FLMH 3NSWA 4CDFC 1EF1A 3K7AH 2HJ1A 5FR6A 2VUMB 4OVVA 5M5WB 3A9KA 3KUCB 4DV0L 4HIKA 2MO0A 3A8KE 3A74A 4KJNA 1WJNA 4LDTB 1EQVA 5IWAL 5IY0A 4C7YA 2EY5A 3C1FA 3H0GB 1LQBA 2WDRB 1WE6A 1EEFD 3FMCA 3J81L 1KAWA 1UGMA 4CJ1B 3H15A 2D2CC 1D2BA 3M95A 3I4MB 5CYUA 1UNSA 2N7EA 2RHQB 1SSOA 1E3PA 2R7ZH 4JI2Q 1WXSA 2KVRA 3QX1A 1Q1BA 3AU7A 4CJ2C 2L55A 4MGZE 2XK5B 4KDIC 5EDSA 1DOXA 4J6IA 5G5HA 2J7ZA 2DY8A 4GDKB 1PYWD 5CV6A 1LTAD 1VQAA 4JI1L 4FYDA 1UBQA 1BBXC 4B3TQ 4LF6Q 2N1WA 4MM3A 2HD3A 4C3JG 3K80C 2RCFA 3T1HQ 3IKJA 4IUPA 4OO1I 2BYEA 2QCZA 1NBWA 3VA7A 2O4XA 2YEPF 3MC9A 1FFUA 4LNIA 4HK2A 1FRDA 3JAMi 4JI5L 1MJEA 4G0NB 1U0LA 3AMZA 3MTNB 4JX1C 1VS0A 2OOBB 1YNNC 2E74C 2MGSA 2KDFB 4C80A 3S1MB 3P1HA 4B9WA 3A54A 2QDFA 2LHDA 3JSVB 5GXGB 1JOQA 1IYFA 3R8BA 5KIXA 3H3VH 3VR3A 1YN4A 1F9QA 2VUMH 4DUYQ 1PA6A 4MJSA 2R6GA 3W2DA 3W9CB 4JI0Q 1BO0A 1L5PA 3A1QB 3K5OA 1RFAA 3X3NA 4FF4A 3IFWB 2GB1A 1JRUA 2UUAQ 1WCMH 4JI8L 3ALBA 4XDCA 4DV5L 4OHJA 3EC8A 3I4MH 2ICIA 1MHWC 3EFCA 3G7LA 4DDGD 1C4AA 2X69A 1NMGA 3G71A 3EBEA 4KSKC 1P0RA 3C19A 1WI5A 4A3EB 4R1JA 4DR6Q 1N33Q 1STEA 3TMPB 5DCNA 2KK8A 4HVBA 4DR2L 1J7BA 2J52A 5BN5A 4HEA1 4M00A 3AFQA 1HXYD 4ZCKA 3IAM1 3RMKC 1E0ZA 2LGYA 5DLQE 3KUDB 4F8MA 4B3RQ 5C0XH 2EVBA 3HOWB 3B1LX 2ZVNA 2BTEA 5CTRC 1TWAH 1KNEA 3SK6A 1N61A 2D3CA 3Q8FA 1KTKA 4HEDA 4RFBA 3J7A5 2A6ED 3JAML 2MP1A 2XEWA 1GAQB 2ZEQA 4NXML 2M1MA 1F1HA 2N78A 4FJYA 2KJ6A 4EE2A 4P1BC 4L5SA 2H5XA 1SE2A 1TS2A 2K25A 4KLKA 4A3IB 1RTOA 1HNWQ 1Z5SB 2G9HD 4JOIC 2F0PA 4BY7G 5EE9A 5DPTA 2CKHB 3SK5A 3BDCA 4TV3A 3I3CA 1M1KC 1WJ6A 2REXA 4KY6A 1PGAA 1SAPA 3FILB 1P16A 1SYDA 2NBFA 3N6RA 4JYAQ 3DMUA 1VZ8A 2L52A 3VTVA 1FM0D 5D2MB 1PRTD 4JI7Q 4A3EH 2RR9A 1K8OA 4LJZC 1DONA 3PUVA 1X55A 3L16A 4PT5A 3QO2A 1F52A 1TKEA 3U30A 1S5FD 2DJFC 2RSOA 1K8MA 2J7QB 5J18A 3M4YA 1OQRA 1PTOD 3QWNA 3HOWH 4ICUA 3S1RB 1WF9A 2F0FA 5IYCG 1UBIA 1PFDA 3NBIA 1OXSC 1XPUA 4KKTA 1UEAB 1HR0W 2IY0B 3HZXA 3C0RB 3D8GA 2AUJD 2EYJA 2OCEA 1QUQB 4DFAA 1ROEA 4MGYE 4F8CB 3UQAA 4JV5L 3PO0A 3AN1A 4X65Q 2BVCA 3LYYA 4N8X1 3Q8CA 2HJ8A 2GLSA 1HPCA 4DV2L 4FDBA 5I6WA 1IYUA 3PVLA 2PW7A 4IFDH 4KHPL 4OONA 3KDFB 5LMUL 1HNXQ 4QL5A 1SFOB 4ZHPA 1TXYA 1ZGUB 3GB1A 3DBSA 1YHBA 4IPGA 1WGHA 1CQVA 4XQNA 1FXIA 2BYFA 4B9KA 5FLXc 1NENB 4YSYB 4BZAA 2W55A 2B2UC 4MH0E 2A68D 3EN2A 1WX9A 1VF5C 1GB4A 1CSQA 2X6LA 2QKIC 2AQ2B 1S4ZA 2Z4HA 2DWQA 2CW0D 1Y1VG 3VUXA 1O7YA 2PQAB 3ZRFA 2A8VA 1HZBA 5JJLA 1RD9D 4ME3A 1M4VA 1OGWA 3L0WB 1EIFA 4GIVA 3R7QA 2KTRA 1VQJA 2KEEA 4RKBA 1JE5A 2ZPYA 4HN7A 5D7GA 2NTSA 4II3B 3S1RH 3GP7A 3PUYA 4NXNQ 1Q0WB 1OEYJ 5C5LA 2L0TA 1WE7A 3H7PB 3FEWX 3ONSA 2KJHB 3P20A 1CJEA 3R93A 1YJ9A 2I2YA 4DA2A 5C2TB 1EWYC 3TEXA 3QOLA 2WB1E 1V9PA 4MSMB 3U52E 4IWQA 2LJ5A 1B7YB 4YWMA 4GSWA 2SEBD 1LABA 1YD8U 3AB9A 3RI7C 4REZA 1JQYD 2RDGA 1VQ9A 4S17A 4I7AA 5E4WC 3S1QB 4OX9Q 1QOAA 1GO3E 4A3CH 5BR8Q 1P9DU 1SFOH 5CR3A 4FXKC 4KD4A 4A3FB 3SXHA 4BXXH 2DYMA 3RUIB 2D5DA 1C9OA 1JJCB 1JICA 1L1OA 4LUOA 3M3YB 3NQIA 1A70A 3DEPA 3Q3OC 4N6EB 2ZTCA 5L37A 4KSLC 3WDNA 2NVTB 1PUTA 1SE9A 4GKKQ 1NJIC 4D2KA 1WRIA 3BG3A 2F1MA 3SDZA 3DBLB 2LKVA 3FHWA 1G291 4R4OA 3PO2G 1I4HA 3UDXA 4L8JA 1EFID 1WCMG 1V43A 2M8SA 2XGTA 2BA1A 1UAPA 2F0MA 2ZCBA 1G6JA 3Q3NC 1ZOYB 2LEKA 1E1TA 4YTPB 1LT4D 1YNND 1YJNA 2E3TA 2INNE 2Z1CA 4IURA 3S2DB 2I5LX 1HE8A 1D1KA 2DNEA 2F0WA 2EY2A 2NCNA 2V3SA 4M8MA 2G4SA 2WXMA 1MHHE 4X66Q 2ZW0A 2L4NA 1K83H 3CF5A 5IYBG 1XNRQ 3VQIA 4YCUA 2INDC 3L4PA 2H4OA 2UUCQ 4GB9A 4LDTD 3ZKJC 1C4PA 4RKLA 2H1EA 1T0YA 2NBWB 4KY5A 4RGTA 1UE1A 2WXRA 3T3OA 3RN9C 3PZDA 4Q5VA 1VCIA 1Z6HA 2NZOA 2TMPA 3S1QH 4AS1A 5GMVA 3N20C 4LCDE 2EYFA 4F7ZA 4HDOA 3UF8A 3VAWA 3M3YH 3AU5A 1A2UA 1NYRA 2NUCA 4JPSA 2J0MA 1RM6C 2NVTH 3M4OB 2LUEA 1ASZA 2DGYA 1SE3A 1SR3A 5C4ZA 4PZ8A 1I4GA 1YQ4B 1D6EC 3CMAA 1Y1WB 2EKEC 1V8CA 5JPMC 4P1CC 3S2DH 1C8CA 2UUAL 1GD7A 4S3SA 4GNXA 2EE1A 1KL9A 4P74A 4LF9L 2KQ7A 3BK1A 3TJPA 4EEWA 1H8CA 1J5EQ 1MVKA 2ZJDA 4OELB 1TTNA 4W9CA 4JI6Q 2MEKA 2N3SA 1U9RA 3QJYA 3BZDB 3H6MA 4W9GA 2RD0A 1MBYA 1F9SA 4R4CA 1OXUA 2F0VA 4K8JA 4KHVA 4P75A 1E8WA 3FC4A 3EHVA 1FD6A 1QT9A 3RZFA 1DOLA 3NJTA 1JOOA 1F2RC 4UDUC 4GLVB 2D3AA 5M3FG 1LXDA 4JWUC 3AE3B 3DDCB 3CF6E 4OZAA 4A8XC 2OQKA 1FNWA 5C44G 5ELNA 4H0LC 2ZNVB 4C3HG 5M3MG 4AP4C 3EFXD 2IBIB 3OSOA 3ZDTA 5D6JB 5ELBA 1C3TA 4A93B 2KHSA 3ICEA 1Y1WH 1VQNA 2WGSA 1G2SA 4A9AA 1HNWL 4DR4Q 2DHZA 1OXTA 1TQOA 4IALA 1MG4A 1ZDXA 4YTMB 2KAJA 2J0KA 1LV9A 1T5EA 1Q5WB 4DAPA 1SMYC 1S5CD 4OWWB 3VYRA 2CQOA 1MGSA 2CU1A 4FXDA 2ZXRA 4H2AA 4RMAA 3WAOA 4K0KQ 2MP2B 4ANXA 1YVCA 3H91A 3W5OA 1IUEA 3R2TA 4ZRIA 1GHKA 4IOAA 1D5MC 4ZUIA 2KMCA 2LUMA 2JRIB 1C0AA 1D1IA 1OQQA 4W9JA 1F9PA 4PYUA 3CRKC 4MIUA 2Q2TA 2Z0SA 3R66C 2VY3A 1VMCA 4NB3A 2INCC 5C3JB 3E9IA 3Q23A 4FLHA 4WURA 4NW2A 3Q3FA 2UU9L 4FA6A 3ECIA 3R3OA 3HM3A 1WJJA 3IRBA 1CZPA 4DQOC 4FBJB 2JF5A 4A3LH 2H88B 1VQGA 2DYOA 3HOZB 1ZW7A 4IM3A 5AZHA 2JT4B 5FO7B 5CC4A 4HKQA 4A93H 4I6PA 5IT9c 2ZNVC 1RF2D 1K52A 4CKCA 2Q8IB 4RNAA 4ZKCB 1SNOA 3CCMA 2RQXA 5C0XJ 4BXXG 3TZDA 1F2LA 5E3FA 4ICVA 4MGIE 2YTYA 3ERSX 3GO5A 4BKSD 1HH2P 1LT3D 1DM0B 3KUZA 3RLNA 4OIJA 2EJMA 4M8NA 5MPOA 4KTAA 3IL8A 5CBEE 4DDID 5EPJA 3OW2A 2K50A 4IJHA 5D94A 3DXJC 4GS3A 4IN3A 3UINB 1EYDA 1GUSA 2LXCA 2XIWA 2BH2A 2R3ZA 3BDOA 3TIXA 5HFYA 3A56A 3RMHA 5KNDA 4RHRA 4ME5A 2PVOD 4NAWA 1CK1A 4XTCS 3WA0A 3HOZH 1E9MA 2HCIA 1BOSA 5JZEB 1ENAA 4YWKA 3I5JC 4DAMA 3Q3MC 4FF3A 3URYA 1FNVA 4IJLA 2L1BA 2M17A 1IKLA 4EZJA 3QR8A 1XMQL 2RF4A 4KKSA 5ELCA 4AYBB 2JXXA 5IGGA 4OZBA 2O5JC 2O6VA 1DOYA 3L54A 1F0ZA 4FO2A 5JHAA 1EO6A 3ZJYC 4A3GG 3TSSA 3PTFC 1PH6A 3L17A 4HIMA 4PG3A 1FCCC 4KIKA 2KJXA 3P42A 4KI0A 3APCA 4HJKA 1PH2A 2YV5A 1KAAA 4ABNA 1WTVA 4B3SQ 3NVYA 4BY1B 1AEXA 1JORA 2LXJA 3CCLA 1F9RA 3MJ5A 3HS0C 3C8YA 3EROA 3VR9B 2WS3B 1HUMA 4KKJA 1VQIA 1HTOA 1VQKA 2WDTB 4LTUA 1QWYA 1HJPA 4IFDJ 2N9EB 1BT0A 4C2MH 4JE3B 1JJ2A 2XBBC 3H8HA 3ZDMC 3TUOA 1EEID 1N32Q 2TSSA 2B2TC 2Y0SG 3DWQA 4JPBW 4XQQA 5CBAE 5JEAH 4YWGG 5FR3A 5KRUA 2FE8A 5L83A 3PRPB 2K5WA 1M94A 1XNRL 2WDQB 2D2QA 4ANVA 2B8GA 4LFBL 2K05A 2J0TD 4OIKA 2OXPA 4TVAB 4XC2A 2QDLA 5H92C 2MFIA 1VQ4A 1WXQA 1T0RC 1XNQQ 1G2TA 1R4PB 3SDLC 4UP8A 1O78A 2Z6BA 4EQOA 3KFUA 2IGGA 4N59A 1NEKB 1KDCA 1WYDA 4PYZA 3I8ZA 5K36H 1LTID 4C3JB 1V1PA 2KVMA 5GQOA 4E6IA 4JI4Q 4NKLA 3EGRA 4ZRJA 1TIFA 3UIOB 4RCOA 4W9DA 3IFTA 3M63B 1LT5D 3U2SC 1BNZA 2BDOA 4BY1H 3U9OA 4K7SA 2VS1A 3UI3A 2UXCQ 3Q3JA 4K3BA 3ZLZA 1PH4A 1Y56A 3JW0X 3A9JB 4HJ9A 4N9F4 3DVGX 3C46A 3T9LA 4K5WA 3V96A 3HKZE 3IAYA 5JAVA 5C3XA 1V6EA 3VXWA 2JA9A 4U673 1ZXIA 5T8IA 3BY4B 1WZ3A 3PIOA 4DR7Q 3K5NA 5C23A 5EKLA 4QUFA 1I94Q 4JBMA 2V9HA 2DZKA 1YIWA 1FGUA 1K8AC 4JI6L 4MDKE 4IM2A 3ER0A 3PRZA 3LWUA 3AEVA 2L76A 3CQZB 3NELA 4X64L 2Y5BB 1L6UA 4KK7A 4A6QA 1XT9B 2CVRA 2K5PA 2OJWA 4CBVA 5IP9G 1GUWA 1LO5D 1SMYD 3D6CA 3NBHA 4TRDA 1WMHA 1MSHA 2NTTA 2GBKA 3KYCD 3T13A 1CHPD 4HJAA 3GV3A 3OLMD 3TBIB 2MSED 2LXKA 4MGKE 4AWJA 1I5FA 1CI3M 1F2MA 4A76A 2W54A 2HQEA 2KX0A 3KBGA 2KBNA 4S0RA 1H9RA 2M0AA 5AJ3Q 3K7UC 1SXTA 3K0XA 1SF0A 5FLXE 3QIJA 2ASQA 4KV2A 4C4VB 2ICEC 3J7YW 2OF1A 5JHBA 3ZJTA 2JXMB 4B9XA 1IBMQ 4AQ7A 3W3AA 2BWFA 1VDZA 1GG3A 3P4SB 1EYCA 4C56C 1TWHB 3T4AC 2FUHB 2R93H 2JZPA 2ON8A 2F0OA 2LSSA 4DV4Q 3DWGC 3W5UB 4DHJB 3KLSX 1SYCA 4XXEA 2Z0EB 3AB5A 3NQTA 4NNJB 2JXTA 4BY7B 1Q90A 2UU7A 4WH4A 5COYA 3MFGA 2JEBI 2NN6I 4X62Q 4XYQA 4K0KL 1TY2A 1K0SA 2G3QB 2K28A 2MJEA 3M3JA 2HIVA 1SB3C 4NY0A 4GOPA 1JW9D 5E1FA 3I91A 5CV9A 1NCVA 1XLOA 3NPPA 4PS3A 1VD2A 4JLCA 3MA2B 2M0XA 3MHSD 3NG0A 4OWTB 4ALPA 1ASYA 1IBLQ 3J7AV 3HRZC 3ULPA 1G6ZA 2KD0A 1BCPB 2A6HD 1R4NI 2V4LA 3W5VB 4A3OA 1WTRA 4OO1H 3IAS1 3MEFA 1YIJA 2DBYA 1K50A 2K9XA 3NWTA 5M5XH 3CPFA 2C7NB 3D4RA 1UF0A 3G6EA 2IY5B 1G51A 2KENA 3PUZA 2SNSA 4DV7Q 1YHQA 5JJIA 3NK9A 1JWBD 2WXJA 1QQRA 4PS8A 1WXAA 3AEAB 2ZXPA 2FCNA 3NEMA 1EU3A 3I57A 4DPGA 4CO7A 3SK8A 5HI1A 1AE2A 4EUTA 5JXVA 3MXNA 3V3XA 2V3NA 3OTOL 2HDEA 1X3EA 2WHIA 4BBNC 2WAQE 3PV1A 5E6OA 1HA6A 3QAQA 3K7AB 1P3QU 4TQUS 2C7HA 1WVLA 1BUIC 4DAYA 1JWAD 5DEHA 3PMFA 5CV7A 3PUXA 5EKKA 3IT6B 2UUBQ 1YOVB 3GDEA 1E7PB 3E0EA 2PIAA 1BR9A 1U5KA 1Y1VB 5JEAG 3L13A 4BWGB 1NI3A 2Q8TA 1ZEQX 2IHFA 3PUWA 1XEEA 4XZ4A 1EWHA 1VQ5A 2NMQA 4NDXA 4O42A 3M4PA 5LMNQ 4LUVA 4H44C 3ZYYX 5IYCH 1WGGA 2WNMA 3DVNV 1BCPC 4OZCA 4G4KA 5KGUA 2HE7A 4KGTA 2KMMA 3K5LA 2E6XA 1L2FA 3WAMA 2IGDA 1SE4A 2AYOB 4MELA 1LGRA 2I38A 2N88A 4JG2A 5GAHC 3BYYB 4O1NA 1PRTF 1EY6A 3RLFA 3VR5A 1TBEA 1ONLA 1BMLC 5AFWA 5M9OA 2CWAA 3CP0A 4KV6A 1MKHA 5CHFA 2KWVB 3NZSA 1EY4A 2DLBA 2WXPA 4RF0A 4MHEA 1S1QB 1LTRD 1HA5A 1PTOF 2Z6KC 1K73C 1VZ7A 4B3SL 4LF8L 2HHHQ 4K14A 4K7UA 1ET9A 1EY9A 3E0JA 5EE1A 1R9TB 5I6YA 3VR6A 2MLBA 4WAFA 3U7ZA 4X6AH 1DGJA 2KDMA 1Y1VH 2XK5A 3PO2B 3QJZA 2JA5G 3ZGZA 1D3ZA 1WCMB 2PJHA 4WWPA 1MI2A 3DVNU 1VQ6A 3U9SA 2AL6A 1TWCH 1N32L 3I2ZA 5DPRA 3CCQA 1CA6A 4LFCQ 1TKGA 1SMXA 1B9NA 1DOKA 1YN5A 2KDEB 4WJQA 2PTLA 2BYVE 2QA4A 4LJPB 3WIMA 4A90A 4IPCA 3AXCA 2D07B 1XNQL 4LNOA 1WX7A 4LK1C 3I4NG 3AQQA 3TEHB 1EIGA 3J7ZC 1SIJA 2DAJA 4GGQA 2E5LQ 2JZ3B 2GBJA 3PSIA 2RDFA 5E7NA 5K5PA 2JA7G 1VQPA 2VH2A 3JSVA 3RZOB 1VR9A 3T51B 4KY7A 1XYIA 2C5LC 2Q8RE 1AWDA 1TWAB 2J0JA 1SYGA 2B2VC 3A9KB 3A1QA 4II2B 1VQLA 1I4QA 2L3ZA 1O7ZA 5EBCA 1K3BC 2LXAA 2OEDA 3PREA 3OYYA 2ZM6Q 2QEXA 2R93G 3KH0A 1SLJA 4R9WA 1IHZA 2Q2HA 1R9TH 2UXCL 4WAAA 2KTFA 2W9NA 5IOCA 2RSNA 3D4WA 1KLUD 3TS2A 3H3VC 2EXDA 2JE6I 2YTXA 5LL6S 4GLXA 1X9NA 3PO2H 1AFPA 3MXPA 1PQSA 2KNBA 3UDIA 2WWZA 4YSZB 1K51A 1SEBD 1CUKA 2OT2A 1FPYA 4DHZB 1NAPA 2PCFB 4DR3Q 2BGFA 1EY8A 2D0OA 1E2WA 4GKJL 3Q24A 4KGSA 4PMWA 3VYTA 5HHDG 1U4RA 5IIFA 1N5XA 3TQYA 3GZNB 1XLNA 5IAAC 2A19A 1RIPA 3J80c 5IYBH 3KF8A 3NHHA 4KX6B 5J3BA 2WLBA 4DV1L 2E2IB 2A5UA 2B8FA 5IT9E 4OL7A 3RNGC 3E9HA 2ZJRA 1NYQA 1ENCA 3K0YA 4OO1G 4A75A 3RZOH 3N30A 2N7DA 3H6NA 3GTGH 3FKIH 2RPVA 4HXDA 2JY6A 1K0RA 5M3FB 2EY6A 1DJRD 3K9PB 2N8NA 2L11A 4GDLA 2R92G 3SE0A 2MH7A 2O2VA 1N6ZA 2B2UA 3RNEC 5C44B 4P71A 1ZYRC 5DNFA 1YI2A 4KGRA 1XLPA 2JSOA 5IO9A 4C3HB 5M3MB 5GAGC 1RYJA 1VLBA 4FADA 2WQYB 2N55A 2AL3A 2MBBB 4HCNB 4MH8A 1TS5A 2A74C 3ZRCA 1PZKD 4I65A 4JQWC 2FCQA 2FIFA 2X38A 3GTKH 3U4EG 2B2YA 2VQEL 3UDGA 3TN2A 3RD2A 2XTIA 2F0LA 4E74A 2O2LD 1KDBA 1HR0Q 5CHWA 4RCNA 3RNFC 4DAVA 3RNAC 4ZK9B 3AE4B 1C48A 2BKFA 2IW3A 2BH8A 4W9KA 3E5SA 5IGBA 2E2IH 4BKSA 4IZ8A 3VUYA 4RGNA 2CJOA 2DENB 4DHJD 3RNUA 4PNYA 4HCPB 1YZ6A 1WIAA 4AJYB 1PLFA 3CCEA 1XF5L 1UE5A 2F0DA 1Q81C 2LZ6A 1G91A 5E6NA 1E7VA 5M3FH 1N63A 1T9HA 2KA7A 4HDQA 3RR5A 2L05A 4I6NB 2JJQA 2X6GA 1XO3A 5C44H 3KDFA 2F0IA 1YITA 5HKHA 1R7SA 3HEJA 1FVIA 4WWNA 5CORA 1A8VA 3GTLB 3LXFA 4C3HH 5M3MH 5A2QE 1HQRD 4EFOA 4YY3Q 1AZPA 1WYGA 1PFBA 4DUZL 4GN1A 1N34Q 1TJEA 3QC8B 3A5UA 1WTOA 3QIAA 2GOWA 1BCPD 1C4CA 2LMCA 1LACA 4HJ8A 2PQAA 4EGVA 2PO4A 2KEDA 3KUPA 3LGJA 1CKNB 1AARA 3OJ3A 3SFDB 4ZDVA 5C6AA 3CC2A 4XE0A 2LHEA 1GHJA 2K1BA 3TCAA 1QVGA 2XWBB 3MFYA 1WTHA 4HJ7A 5BMGA 1RFKA 2HDLA 3VH3B 4IM0A 4NJ7A 4ZOHC 2NVYB 1QE6A 4WFN3 3CXCA 2JRHA 4GU2A 4HAEA 4OW0A 1VQMA 3WALA 2UUBL 3DBHB 3VTUA 3VRBB 2KT7A 1CHQD 3NTIA 2PMZE 1J9OA 1JCKB 1KOTA 5J1ZA 3GTPH 3UE1A 4QCLA 3L7ZC 1KFYB 3FRPB 2ZCCA 1BVSA 1K83B 2JA8G 4P72A 2D3GA 2KLCA 3VDYA 2V4IB 4GXBA 4AJWA 5LMNL 3R3MA 2Q2UA 4M02A 4ZRPA 2PI2E 3E6ZX 1WFYA 4ZYSA 5ISRA 1RAXA 1N60A 4G57A 5D14A 3GTLH 4IC7B 1A2TA 1Y8OB 3H7SA 2XSCA 4BBRG 3DM1A 2LRUA 4M1UB 1CMXB 3ZJVA 3VR4A 4XQJA 1PV4A 1VQDA 2RPQA 5EPKA 5IN7A 1WFQA 3D31A 4J8QA 1MPEA 1R4QB 2IL8A 3J7AF 3V6CB 5JJZA 1NUCA 3AYHB 3AEDB 4HIDA 3M7NA 1VQHA 4A3GB 5GROA 1K28A 5DM73 1SNMA 2MUYA 1A63A 2KTRB 3CC4A 3S14B 1B2TA 1QZHA 3ZXVA 2BPSA 3GTJB 2WXHA 3J80i 2NVYH 5C0XI 1C78A 2KWDA 1I4XA 5JVH3 4LMQD 4YCVA 4OVUA 4N9PA 3GD7A 4IPHA 4UP9A 2L15A 4A3KG 4WJ4A 1WGRA 5T1GA 5EQ0A 4L63B 2AEHA 3HVDA 5AEKB 5EE3A 4ZRQA 1YNTE 1TU2B 3VFKA 1QJOA 5IODA 1L0YB 4BBSH 1EIHA 1STNA 4ODGA 4YTNB 3FPUB 2MBHA 3B2GA 3IG3A 4LFCL 2FNJB 2WX0A 5E4XA 4JI2L 2J4XA 4WQOB 1TVXA 2Y0SB 5HY6A 2PW5A 1KNAA 5GAEC 3AE1B 1STHA 3HOXH 1KC8C 2OHFA 1NTGA 3V62A 4IUVA 3GTOB 1FR3A 1VQ8A 3N1ZC 1F2ZA 4BA1I 1ZUD2 2WXLA 1X6OA 4IUMB 2CS4A 2EYLA 1EM7A 2ZTDA 1L0XB 2IWHA 3CC7A 3UQBA 1UWVA 1L1OB 3FKIG 4L1BA 3S9WA 4IO9A 4B3TL 4LF6L 3ZUNA 1RKNA 2E5LL 3T1HL 2BS3B 1JWMD 2M9VA 1UE6A 4A3BH 1UUPA 4LK0M 5E6PA 3JYUA 1N36Q 3L2PA 5FK9C 3PHXB 2CQAA 4LF5Q 1O7LA 2EPBA 1J8IA 3NE5B 2ASBA 3UE0A 4FULA 1BQQT 4HR7B 3A7LA 4X3SA 4EQPA 4HJ5A 4A3GH 1I6HB 4K3CA 2RBMA 3A0JA 2W82A 1II3A 1UWMA 3S14H 3HKZG 2NPTA 3SVMA 3GTJH 1EWCA 3I9V1 4GZYC 3O13A 4DUYL 2BE5C 1DCZA 2HCCA 3G48A 1K9MC 3HOVH 3D3RA 2Z8LA 1YX6B 4JI0L 2FIDA 1GM5A 1FO4A 2ZZPB 4ZHOA 3ENEA 1Y14B 3BJUA 1L4ZB 4KZCA 5AUIA 4ARCA 4APVA 1HEZE 2NBVB 1EOVA 2QILA 2MW5A 1NVID 1ZYRD 1V49A 4DR3L 1JE4A 1KRTA 1ICFB 1QG7A 2HUGA 4ARIA 2DJGC 1PHJA 4DKAC 4DR6L 1N33L 3GTOH 4DN4M 2IX1A 1XCTL 3I63C 4FJVB 4IFDI 2RKSA 3CCUA 2GN5A 2Y5CA 2VQFQ 2ZW1A 3BWUD 4CYEA 4FJZA 2E2DC 5ELDA 5FJ8G 1FRRA 4KMUC 2HIXA 1V5TA 3W1SA 1JWUD 4HLEA 4B3RL 4WWMA 1DYQA 4CDCC 1JRPA 1SNQA 2OQ0A 1L1OC 1OTRB 3QQ8B 5IKCM 3CU7A 3DBRB 5EBDA 1TGZB 4TKNA 4DR5Q 2WXIA 1IBXB 1ZE3D 3QHTA 1I6HH 3VR2A 2PEAA 1UELA 3BK2A 1P1AA 2WDVB 2CCZA 1IL2A 2PMVA 2NB0A 4F87A 2M4NA 4XWTA 1YJIA 4V190 2PNHA 4DNRB 4OVZA 1JQ4A 2JEAI 2KACA 3SHQA 1UGJA 1A3VA 2VW9A 2FMMA 5C3EG 4JBKA 3N1XC 2Z59B 3OWEB 4JYAL 1XXGA 1GUNA 1QNUA 4PMBA 5I2YA 3GE3C 5LHY1 3QWZB 1B4OA 1CKMA 5AZGA 1Y69U 2K5QA 4JI7L 1XPRA 1QVFA 2BA0A 4BKGA 3AE7B 1HNZQ 2KMAA 1HRJA 3H94A 3CSFA 5G2NA 3I72A 5FO8B 1IP9A 4TSSA 1A62A 2AUKA 1LYLA 2QCPX 2XVSA 5IP9H 2QGQA 1PDXA 1RHPA 4HSVA 4J15A 3VRAB 1CZWA 3PF4A 1NNXA 3KLRA 2F4VQ 3STBC 2LVOA 4ANUA 1H9JA 1ISNA 3E9SA 5EKIA 4B3MQ 1HZCA 4EZLA 4BOSC 3O65B 1R4MB 1EL0A 1JALA 3K8AA 3P1MA 1NBFC 5FLXL 1ZPSA 3E3XA 2IY1B 1FJGQ 4YY3L 3NUHB 1L6VA 2PI2A 5AZFA 4X65L 3BU2A 3CWIA 1FMAD 1MHXA 2DZIA 5EE0A 3OMGA 4DV6Q 2G45B 1HNXL 3ZTDA 2WAQG 4YXDB 4LWCA 2MPMA 4P2CB 1MJCA 2F3IA 1WD1A 3IT4B 2D10A 1WTXA 4A3JG 4AIMA 2IHEA 3C3LA 3AV8A 3MC0B 1BXTA 3MZ5A 1JC7A 2VH1A 2GBNA 2V4DA 2R7FA 4TMAB 3S1NB 2VZAA 3NP8A 5DPWA 2JWUA 4BBSG 1FXAA 5LXIB 2MQHA 5IGDA 4C2MB 1G6PA 5CMDA 2N9XA 4M0WB 4DBGA 1T6BX 1V81A 4NXNL 3AMUA 4K81A 3ONAB 3HOXG 2BT6A 3RPFC 4GN4B 2AHOB 2IO1B 1V1OA 3DBLI 1STBA 3SR6A 1D4BA 3I90A 1HTPA 3BVGA 2LFNA 2K75A 4L23A 2D0PA 3RCZA 2Q2IA 1C4QA 3KVFB 1H4RA 3MTSA 2I1JA 4A3BG 2UXBQ 1QOBA 2GI9A 4LNNA 3RNCC 2F0KA 2GVBA 4JBJA 3LJ3A 3AI5A 2MJ3A 3LB8C 4OX9L 3TP6A 4W9LA 3BZCA 5BR8L 2IO0B 1VMPA 4PZ7A 4HCSA 3RT3B 3U50C 1F2RI 3WANA 3VA5A 3ULJA 4AQYQ 2IZVB 5FOBB 4DK0A 3UDFA 5J22A 1I6VC 3PO3G 3AECB 2KWUB 3VR8B 3OHXC 3OG5A 4RWSC 4MTNA 2LS01 3HOVG 4GKKL 1F2YA 1TZ1A 1YEZA 4JI3Q 1V97A 3A33B 4B0MA 3L3OC 1E2VA 1FGBD 2WFWA 3NXWA 3J80E 2JZZA 2QJLA 3S1NH 1NDDA 1Q46A 2BF8B 1IBKQ 1OXXK 4F1SA 3CSTA 1TYGB 4DNTB 4NAWB 2JWZA 1K53A 2FFKB 2IGHA 3T1YQ 5JJKA 4X66L 4I7ZC 3DWMA 2BB5A 2RSUA 1VF7A 1UD7A 2JA5B 4WJPA 4C3IH 4DXGA 1X1MA 2BE5D 3C1EA 3DUZA 2LI5A 1BBWA 1MSGA 1KXLA 3I56A 2WYQA 4IOIE 2WX1A 2O6VB 5IP7G 1K8RB 2QF7A 4IUTA 2UUCL 3GTQB 1XTDA 4WWOA 5KHOA 3AFPA 4DV0Q 1EU4A 2B3GA 3PQIA 3Q22A 2LWPA 5C3WA 1GUOA 1QF6A 3PS6A 2PZTA 4QIWB 4KIKB 3S15B 2OTJA 3WCQA 2JA6H 2B2WA 4ZKBB 3I4NB 2K04A 2KQ3A 1O7IA 3KWLA 4CKEA 3HRDD 3TS0A 2JA7B 2CU3A 3NWSA 1WTQA 2SDFA 3U7DA 4P73A 1Q8KA 4QF4A 1B9RA 1U4MA 3HOUH 3NRZA 4UHVA 5H1SE 2OJRA 3ZNHB 4RF1A 3APFA 4LW1A 1OEYA 1WZ0A 4PS7A 2WIIB 1T0QC 5DAUA 4J1MA 4WJ3M 2CHWA 2OWOA 2R93B 1GB1A 1ICWA 1AW7A 2VZKB 1GKHA 3BDLA 4YWLA 4PZ6A 2KHWB 1VQCA 1N5WA 1W2BA 1EY7A 4JVZA 3S2HH 3HGBA 2L5TA 1V1QA 1U4AA 1ESRA 2KDBA 3ZW3A 4DK5A 4ZQ3A 3U4VA 2JA5H 1OXVA 4QGUA 1J5EL 4JI5Q 4G7HC 2ACZB 2X8XX 3ZTCA 2K03A 2DNCA 1KM7A 1L0VB 2KOLA 3EIVA 2N9KA 2PZUA 1B44D 4GMVA 3DPDA 2ID0A 2CFMA 1J0GA 5IOIA 5L95C 1T3QA 3I4LA 3GTQH 4R4IA 2I0QA 2XNAC 4J3OD 2LVPA 1V1PB 1C7YA 4WIPA 4ZRKA 2UWQA 5IYDG 4E3CA 2K0PA 2BKRB 2N4FA 3ITPA 3CMMB 2J53A 4P6VF 3S15H 5HGQA 4LAAA 2M00A 2BYTA 4WJNA 1HFGA 1IKMA 2F0QA 3I4NH 4BS9A 4K8IA 2R7DA 4DV5Q 4FN2A 1LFDA 1QCBD 3JVZX 2JA7H 1YNXA 4DHZE 1HTQA 2BQQA 3B2FA 4Q0FA 4P16A 4DR5L 2MBQA 2L0CA 3OMCA 1X65A 3RZDH 3K59A 2PQEA 5M5XB 3AULA 1W3SA 3AE8B 3T56B 1LT6D 2EXZA 4RG1A 2R92B 2KFKA 2W3RA 4XDXA 3CCVA 4DR2Q 4DR4L 4A3MH 3APDA 1G8ZD 1H9SA 4C1NI 1S40A 1FEHA 3PV0A 1RWSA 2KN5A 3NBHB 1WMHB 3T3NA 4ANWA 1TS4A 2BCOA 2L8JA 2BOSA 1RDPD 1D7QA 2C35B 1YBYA 1Z9FA 4NXMQ 1SNCA 3T8MA 3DHQA 1XX8A 4DV3Q 2DX5B 2F4IA 1OFFA 1TT2A 1XMOQ 3DCGA 1AP0A 1B70B 1I7HA 1X54A 5ELEA 3J9CA 1JMCA 3LDZE 4FF2A 5IT9L 1ILQA 5EPLA 1E6EB 4LUZA 2KHJA 3TZUA 3Q6BA 4UY8C 2F4VL 1LLRD 2EZVA 4XX5A 1XCQL 1AYFA 2G1EA 1ILPA 4IG7B 1QLBB 2DAFA 1EQQA 1LTLA 3AE6B 2F0SA 2R92H 4Y52H 4O0AA 2F52A 2LGSA 1FJGL 1LTGD 2KJRA 4EQ5A 1IW7C 3AM9A 4EKUA 2IYDB 2A6EC 1GPXA 1PH7A 2RCNA 1FFVA 3Q8AA 2L7RA 2N9PC 4ULLA 2MRPA 4DV6L 3TREA 2D9UA 2PPBC 2D62A 4QMGA 3NVWA 2Z9HA 4GOPB 1WJ4A 3LNNA 5JVG3 1VQ7A 3HVZA 3BYTB 4KZ0A 3A8IE 3RN2A 2MHJA 1N9WA 3TP7A 2NN6G 3DOWA 3GOEA 1F77A 1NMFA 4DNIA 2WXGA 1I42A 5FO9B 4LF4Q 3HM6X 3OAWA 4JGHB 4X3UA 3P2BA 4H13C 1GNUA 2YEPB 4IUUA 3PCOB 4JV5Q 2LVQA 2HQLA 4L2YA 1HUNA 5CX3A 2MNAA 1B8AA 4DV2Q 4Y7NB 3PIPA 4DWFA 3PIO3 5TR5A 4KHPQ 4C3IG 5LMUQ 3M62B 3R7RA 2WB1G 2P5ZX 1H9MA 4N8FA 4UAIA 1TWCB 3KF6A 3AE5B 1FIQA 2QW7A 1GC7A 2RHSB 4C00A 4RA8A 3V6EB 2GBRA 3MXUA 2RDHA 3M9BA 2JA8B 2EIFA 3OW7A 5HG2A 2BS2B 3G6JB 2B39A 5J39A 4IPDA 2NYZD 1I50B 3KYDD 1X3FA 4PQXA 2JA6G 3A4SC 3GS2A 2UXBL 3L10B 5IGFA 4YL8A 5A2QL 3VTWA 3QARA 3MXNB 1E0BA 2I5MX 4K2LA 3PT2B 4AUQC 4BBRB 2ZVOA 1GXDC 1E7ZA 4BAXA 4RGMA 1Z2MA 5G5GA 3HOUG 4DAYB 2D11A 2R2QA 3J81j 4BKTA 1FL0A 2F0HA 3BVMA 3SHLA 3RN5A 2J42A 3TEWA 4GOPC 4BBNF 4OGQC 2YU9B 4X57B 1CFMA 1T0SC 1ACCA 1V8QA 3FAHA 3HG9A 3NVVA 2F0EA 1CTMA 4A3DG 4DXFA 3DWAA 5KYLA 1B9MA 2K39A 1WOCA 2A68C 1GUAB 3SFEB 4Y7NH 2PNRC 5BMHA 4ZAIA 4GDKA 3KQ4A 3Q14C 4A3KB 2NVQB 1YJWA 2VL6A 3QOJA 3CCRA 4RHSA 3C2PA 2JQRB 2KYWA 1ZKOA 3U58A 1HFNA 2E8GA 5LMNW 1I35A 3BS1A 1S5DD 3NUCA 1MJDA 2W3SA 3VVWB 1BCPF 1EZ8A 2JA8H 2KDIA 4KN4C 4R3DA 4ZYNA 2EJFC 3DWPA 1I50H 3RLOA 4YHHQ 3BIID 4B0EA 3CD6A 4L6TB 2WXFA 3NVZA 2AX5A 1Y8NB 3BINA 4BBRH 2RMMA 4JOIA 3Q2AC 2JSVX 3DHHC 2K14A 3FKIB 4HIOA 3EVQA 3GTGB 1WM3A 1JOKA 1WR6E 2EMSA 1KH0A 5H8YE 1PFSA 3CAMA 4PK1A 2K6DB 4JI4L 2PPHA 1L2NA 3EQLC 1PZID 4J6HA 4JL9A 3KW5B 2O6VD 4C1NK 1YQ3B 2YU9H 2Y0SE 1HTLD 4A3MG 1AH9A 4XYOA 3RYTA 4OXPA 2E76C 3X0WA 5LNK1 3DHIC 2EQSA 3TP5A 3HKZB 4ZLTF 1F9JA 2Y3AA 3HK0A 4NAMA 3FP9A 3GV6A 2NZHA 5TSSA 2M19A 3HP3A 4BA2I 1ZDVA 1VQBA 2IO2B 2CR5A 4A3KH 2NVQH 3GTKB 4R8NA 4DR7L 2FINB 3HOYG 1YNJC 5IE8A 3CW2C 1I94L 2KCTA 1QB5D 3TEZA 1IL8A 1EQRA 2I5HA 4K5VA 1WM2A 2K5VA 1SNPA 4MM3B 4YCWA 5JH5C 4IWOA 4L5TA 1K3RA 1PDQA
chains in the Genus database with same CATH topology
3Q8EA 2M2LA 1PGBA 5EJWA 1KDAA 1PZJD 5A35A 3PIP3 1STYA 2VZKD 4IQZA 3TEYA 1PFNA 5JEAJ 4YIJA 2K6AA 4DU9A 1CZGA 3OPOA 2NVXB 1LTTD 5G3LF 1QKZA 3VYUA 4FNFA 2KUMA 2MJDA 5ELFA 3FILA 2A69C 4HSPA 2A73B 3A7AB 2XN9C 1U4LA 3KK7A 3SR1A 1D5ZC 5BYRA 1E2ZA 2XRQD 5M5YB 4IDIA 4A55A 3ND8A 2K33A 1SJED 2AWNA 5BYQA 3MHBA 2QSDA 1IW7D 1NSNS 1SDFA 4FXGC 5C3EB 3ETRA 4FF1A 4ITKA 4QUCA 3CKIB 1FD7D 1DOIA 4KKIA 3P4QB 1GUTA 3I73A 2A5HA 1YJJA 3OOCA 4GDLB 1NR4A 1IGDA 1DZ1A 4WORA 2INPE 4CKBA 3GTPB 4YSXB 2IPKD 1FCLA 2NWGA 3Q6SA 2O5IC 1I4RA 5BN4A 1T5XD 3ND9A 5D3DA 2IT1A 2IX0A 1E10A 1ENFA 1MI0A 1LTSD 2F0NA 4US8A 2EDGA 1CQFA 2FJ2A 2WAQB 5NUCA 5BN3A 2KQ4X 3L9AX 5C5MA 3S16B 4ZUJA 5I2XA 4A3JB 4IUNA 1PGXA 5CV5A 1NR2A 2KECA 5C4JB 2CJNA 1Q1EA 3OIQA 2K32A 4TQ1A 1B53A 3BVZA 3OIPA 4BBSB 3SEBA 2L12A 3MP9A 1QOGA 4ILWA 3R2IA 4MN3A 2WXQA 4WJWA 1ESFA 1B1ZA 1EZ6A 1GUGA 3HOXB 1RODA 3M85A 2LMCB 2B76B 1A3UA 3J81E 1FNUA 2PVGC 4CGYB 5E6JA 5I9PA 3MAQA 4A3BB 1JMLA 1Q12A 3D4DA 2B2YC 2FMCA 4X3KA 1TS3A 3T53B 1QILA 2WXOA 1SYEA 1A15A 4RAUC 1W6JA 3PO3B 2PW9A 2EYOA 1ZXTA 5BYSA 1HQMC 1B3AA 3HOVB 5T1IA 4DK1A 4CHTB 5G3LD 3A8JE 3IXSA 1Z47A 2DY7A 1BUVT 3FPPA 1CT1D 2WP9B 2SOBA 4EVOA 4YT0B 4X3TA 1H9KA 3RD4A 1VDVA 2F0UA 4DF7A 2DN8A 3FVQA 4C7ZA 1TIID 4WRDA 3KLSA 4XIGS 1YNJD 2EELA 4PV1C 2Q5WD 4H7BA 3P4RB 2AQ1B 1GJXA 3RFZB 3CHBD 2I07B 3HUIA 1STAA 1UWXA 2SNMA 4CQNA 5HGTA 1TKWB 2PYKA 1WTPA 2D5GA 2VNUD 2BS4B 3H09A 1XWEA 3EA6A 4K2KA 3P7JA 5C0XG 4FP5D 3J80L 3MXGA 2QDBA 3KBXA 5D65A 3JAME 1GOZA 1EOTA 2QMTA 1SJHD 2A69D 4U68A 4Q2JA 5C4HA 4USAA 2EY1A 2EYMA 4K6DA 3B9JA 1HZ6A 2L9HA 3LX0A 1C9FA 1IBXA 2K5DA 1J7AA 2H89B 2FUG1 4HROA 3N9YC 4QB4A 4M8AA 3MHZA 1X3QA 3QB3A 2ZXOA 2V3PA 2R61A 3ZJUA 1I3QB 1IGCA 2HTME 2SAKA 2L32A 2N9LA 3P75A 2WXNA 5BMIA 1TWGB 1WD0A 2WU2B 3AEGB 3NTKA 4KHZA 1D5XC 1W6KA 3V2TA 2WACA 3MWYW 4DGZA 4K6LA 1CM9A 1PMRA 1N62A 5D3IB 3AE9B 4IFDG 1VRAB 1RCVD 2F3VA 4RGOS 4ID6A 2K22A 3AEEB 2WXKA 2PZWA 1TZOA 1CA5A 1DXMA 1STGA 1MD2D 1RTNA 3ABVB 3W9CB 3RUZA 4HKZE 3Q69A 3EJIA 5KNCA 2FBWB 4K5XA 1M8AA 1BDOA 2B2TA 2I46A 1Q10A 4M0WA 1YMHE 4JK1C 4KD3A 1EY5A 1RJTA 1A3TA 3TMEA 2F0TA 3I70A 3K58A 1B2TA 2G9DA 3V05A 4NMZA 1DOMA 3QG1A 2GA4B 1L4DB 2PMZB 1X32A 5CGKA 1ZP0B 5AUKA 1SBBB 4MACA 4C3IB 2WP8J 2WB1B 3K5MA 2C5CA 3GTMB 4HTHA 3F2UA 4F7XA 1SSNA 1ZXHA 1SYFA 2A6HC 4XT3B 2CHBD 2XRSD 1WTWA 5I4DA 2JYEA 3UI2A 4HCEA 2KN4A 3AH7A 5HURA 2JYOA 2JA6B 3D6WA 1HHVA 2ONQA 2JU6X 1QOFA 2L83A 1OO9B 5F2DA 2FHTA 2RA4A 2F0JA 5JOBA 2BW2A 2F03A 3HOUB 2AQ3B 5CV4A 2NN6H 2VB3X 3WOFA 2V0GA 1TY0A 1AZQA 4A3DB 4NJCA 3S2HB 4WQMA 3AEBB 1S5ED 3MEHA 2OEOA 1XTCD 4RH6A 4HJGE 1JB3A 2F0GA 2BDNA 1TKYA 5JPNC 1U4PA 3SK4A 2K3UA 1ET6A 4TKOB 1SYBA 1O80A 4US9A 3NS1A 3KWVA 1SNDA 1IYVA 2JYTA 4KJOA 4FXCA 3M7GA 3RZDB 2ENBA 2L1AA 2IJ0A 2JX5A 4N58A 3Q8BA 2K7VA 2E2HB 3ZQ4A 2YYZA 4A3MB 4PMCA 4KN7C 2HDMA 2N0SB 2C9OA 2F3WA 3HOYB 4GLSC 2WV6D 2KCCA 1BF4A 1KF6B 1JROA 4G7OC 2EOTA 1C76A 2Y5PA 5C4XB 5IGCA 5LL6X 4FVMA 3LWEA 3X3MA 5CV8A 3IFDA 4LLGM 2BBCA 1QOHA 4R8IA 1KRHA 2WKCA 2EJGC 4XWWA 1X3PA 3K6OA 1EQTA 3K57A 1WGKA 2BB6A 2GRIA 2M56B 2PLPA 1A6XA 1AN8A 1HCZA 3S17B 2IDYA 3AEFB 4HMJA 1JWSD 2WINB 3DEOA 3A55A 5EGTA 5IGEA 1XLQA 3P4PB 2MJ8A 4HRSA 4JBWA 4N9TA 4G7ZC 1I4PA 1VZ6A 1KABA 1PRTB 2WU5B 2QEJC 1TWFB 2B2WC 2LJIA 1PTOB 2WKDA 5KNBA 3CIRB 4IKGA 1PXUA 2JP1A 3WOEA 3GQBA 1P7EA 2EYHA 1HZ5A 4B08A 1H9SB 1QNKA 1C79A 3NZ3A 2NZ1D 2VXWA 4XT1B 4MT5A 4F88A 5KYIA 1ML0D 5I9OA 3E56A 3PZ8A 1Z7TA 4ZRZA 2E2JB 2EKIA 1EYAA 1WSPA 5KEEA 2IX3A 2N7JA 2LFIA 3AE2B 5DM63 2XWJB 3TDQA 1PRTC 3VYSA 1DD2A 3MVVA 1PTOH 2RVLA 3Q0AA 3OWFA 2B2VA 1PTOC 1LTBD 1C77A 1WWTA 2K01A 2LY7A 2B63B 1TR5A 2VB2X 2PKOA 2EYPA 2QIEB 1Q8IA 1Y8PB 1S5BD 2E75C 3FDTA 4KKUA 1VJKA 1YN3A 1Q3LA 1JR0D 3N52A 2R7ZB 3TP8A 3PZ7A 1J7CA 1FYCA 2MHVA 5FKAC 4EQNA 1B50A 4CJ0B 3CRLC 4V0BA 1KLGD 1EY0A 4HMIA 2Z4IA 3EUB2 4JWSC 3T16A 4NP5A 5K36G 3ERQA 2KCNA 4IUQA 2CW0C 1P7FA 3NTHA 2ZT9C 4NZLB 4TQ0A 4Z9CB 1PFMA 2LGIA 2AWOA 3NSWA 2VUMB 5M5WB 3A8KE 4KJNA 1EQVA 4C7YA 2EY5A 3C1FA 3H0GB 2WDRB 1EEFD 3FMCA 3J81L 4CJ1B 2D2CC 1D2BA 3I4MB 5CYUA 1UNSA 1SSOA 1Q1BA 3AU7A 4CJ2C 2L55A 1DOXA 5G5HA 2J7ZA 2DY8A 4GDKB 1PYWD 5CV6A 1LTAD 4FYDA 1BBXC 4C3JG 4OO1I 3IKJA 4IUPA 3VA7A 2O4XA 2YEPF 1FFUA 1FRDA 3AMZA 4JX1C 1YNNC 2E74C 2MGSA 4C80A 3S1MB 3P1HA 4B9WA 3A54A 2LHDA 5GXGB 1JOQA 3R8BA 5KIXA 3VR3A 1YN4A 1F9QA 2R6GA 3W2DA 1L5PA 1BO0A 3K5OA 3X3NA 4FF4A 2GB1A 4XDCA 4OHJA 2ICIA 3G7LA 1C4AA 2X69A 4A3EB 1STEA 2J52A 1J7BA 4HEA1 5BN5A 1E0ZA 1HXYD 3IAM1 4F8MA 5C0XH 2EVBA 3HOWB 2BTEA 1KNEA 3SK6A 1N61A 3Q8FA 1KTKA 4HEDA 4RFBA 2A6ED 3JAML 2MP1A 1GAQB 4EE2A 1SE2A 1TS2A 4A3IB 1RTOA 2G9HD 2F0PA 5EE9A 3SK5A 3BDCA 3I3CA 4KY6A 1PGAA 1SAPA 3FILB 1SYDA 2NBFA 3N6RA 3DMUA 1VZ8A 2L52A 1FM0D 1PRTD 1K8OA 4LJZC 1DONA 3PUVA 4PT5A 3QO2A 1TKEA 1S5FD 2RSOA 1K8MA 3M4YA 1OQRA 1PTOD 3QWNA 3S1RB 2F0FA 1PFDA 3NBIA 1OXSC 4KKTA 1UEAB 3HZXA 3D8GA 2AUJD 2EYJA 4DFAA 1ROEA 3PO0A 3AN1A 3LYYA 3Q8CA 1HPCA 5I6WA 1IYUA 2PW7A 4IFDH 1SFOB 4ZHPA 3GB1A 1CQVA 4XQNA 1FXIA 1NENB 4YSYB 2W55A 2B2UC 2A68D 1VF5C 1GB4A 2X6LA 2QKIC 2AQ2B 1S4ZA 2Z4HA 2DWQA 2CW0D 1O7YA 1RD9D 1M4VA 2KEEA 4RKBA 5D7GA 4HN7A 2NTSA 3GP7A 3PUYA 5C5LA 3FEWX 3P20A 1CJEA 3R93A 2I2YA 4DA2A 5C2TB 1EWYC 3TEXA 3QOLA 3U52E 2SEBD 1LABA 3AB9A 4REZA 1JQYD 2RDGA 5E4WC 3S1QB 1QOAA 5CR3A 4FXKC 4KD4A 4A3FB 3SXHA 2DYMA 2D5DA 1JICA 3M3YB 3NQIA 1A70A 3DEPA 4N6EB 3WDNA 2NVTB 1PUTA 4D2KA 1WRIA 2F1MA 3BG3A 3SDZA 2LKVA 1G291 1I4HA 4L8JA 1EFID 1V43A 2BA1A 1UAPA 2F0MA 1ZOYB 2LEKA 4YTPB 1LT4D 1YNND 3P63A 2E3TA 2INNE 2Z1CA 4IURA 3S2DB 1D1KA 2DNEA 2F0WA 2EY2A 2WXMA 1MHHE 2ZW0A 2L4NA 3VQIA 3L4PA 2H4OA 1C4PA 4RKLA 2H1EA 4KY5A 4RGTA 2WXRA 3T3OA 4Q5VA 1VCIA 1Z6HA 4AS1A 2TMPA 2EYFA 1A2UA 1NYRA 2NUCA 4JPSA 1RM6C 3M4OB 1SE3A 5C4ZA 1YQ4B 1I4GA 1D6EC 1Y1WB 1V8CA 5JPMC 1C8CA 4S3SA 2EE1A 3BK1A 1MVKA 2MEKA 1U9RA 3QJYA 3BZDB 3H6MA 1MBYA 1F9SA 1OXUA 2F0VA 4K8JA 4KHVA 3FC4A 1FD6A 1QT9A 1DOLA 1JOOA 1F2RC 4UDUC 4JWUC 3AE3B 4OZAA 4A8XC 1FNWA 4H0LC 4C3HG 3EFXD 3OSOA 5ELBA 4A93B 2KHSA 4A9AA 1G2SA 1OXTA 1TQOA 4IALA 1ZDXA 4YTMB 2KAJA 1LV9A 1T5EA 4DAPA 1SMYC 1S5CD 3VYRA 1MGSA 4FXDA 2ZXRA 4H2AA 3H91A 1IUEA 3R2TA 1GHKA 1D5MC 4ZUIA 2LUMA 1D1IA 1OQQA 1F9PA 3CRKC 4MIUA 1VMCA 5C3JB 3Q23A 4WURA 4NW2A 3R3OA 1CZPA 2H88B 2DYOA 3HOZB 5FO7B 5CC4A 4HKQA 1RF2D 1K52A 4CKCA 2Q8IB 4RNAA 4ZKCB 1SNOA 4XDDA 2RQXA 5C0XJ 3TZDA 1F2LA 5E3FA 3GO5A 1LT3D 1DM0B 4OIJA 2EJMA 5MPOA 4KTAA 3IL8A 5CBEE 5EPJA 3DXJC 4IN3A 1EYDA 1GUSA 2XIWA 2R3ZA 3BDOA 5HFYA 3A56A 3RMHA 5KNDA 4RHRA 4ME5A 2PVOD 1CK1A 4XTCS 1E9MA 2HCIA 1BOSA 1ENAA 4FF3A 3URYA 1FNVA 2L1BA 1IKLA 4KKSA 5ELCA 4AYBB 4OZBA 5IGGA 2O5JC 1DOYA 4FO2A 3TSSA 1FCCC 2KJXA 3P42A 4KI0A 1KAAA 4ABNA 1WTVA 3NVYA 4BY1B 1AEXA 1JORA 3MJ5A 1F9RA 3HS0C 3C8YA 3EROA 3VR9B 2WS3B 1HUMA 4KKJA 4LTUA 1QWYA 4IFDJ 4JE3B 3H8HA 3TUOA 1EEID 2TSSA 2B2TC 3DWQA 4XQQA 5CBAE 4YWGG 5JEAH 5FR3A 5KRUA 2FE8A 2K5WA 2WDQB 2B8GA 2K05A 2J0TD 4OIKA 2OXPA 5H92C 1WXQA 1G2TA 1R4PB 1O78A 4EQOA 2IGGA 4N59A 1NEKB 1KDCA 3I8ZA 5K36H 1LTID 4C3JB 1V1PA 2KVMA 4E6IA 3EGRA 4NKLA 4RCOA 3IFTA 1LT5D 3U2SC 1BNZA 2BDOA 3U9OA 3UI3A 1Y56A 3C46A 4K5WA 3V96A 3IAYA 5JAVA 5C3XA 4U673 1ZXIA 5T8IA 3K5NA 5EKLA 4QUFA 3LWUA 3CQZB 4A6QA 1L6UA 4KK7A 2CVRA 2K5PA 4CBVA 1GUWA 1LO5D 1SMYD 3D6CA 3NBHA 4TRDA 1MSHA 2NTTA 3T13A 1CHPD 3GV3A 3TBIB 1CI3M 1F2MA 2W54A 2HQEA 3KBGA 1H9RA 2M0AA 1SXTA 1SF0A 5FLXE 2ICEC 3J7YW 2OF1A 3ZJTA 2JXMB 4B9XA 4AQ7A 3W3AA 1VDZA 3P4SB 1EYCA 4C56C 1TWHB 3T4AC 2JZPA 2ON8A 2F0OA 3DWGC 3W5UB 3KLSX 1SYCA 4XXEA 3AB5A 3NQTA 2JXTA 4BY7B 1Q90A 4WH4A 5COYA 3MFGA 2JEBI 2NN6I 2MJEA 4XYQA 1TY2A 2K28A 1SB3C 1JW9D 5E1FA 3I91A 5CV9A 1NCVA 1XLOA 3NPPA 3MA2B 3J7AV 3HRZC 1G6ZA 1BCPB 2A6HD 3W5VB 1WTRA 4OO1H 3IAS1 2DBYA 1K50A 2K9XA 3NWTA 3D4RA 3PUZA 2SNSA 3NK9A 1JWBD 2WXJA 1QQRA 3AEAB 2ZXPA 3I57A 1EU3A 3SK8A 5HI1A 5JXVA 3MXNA 3V3XA 2V3NA 2HDEA 1HA6A 3K7AB 4TQUS 1WVLA 1BUIC 4DAYA 1JWAD 5DEHA 3PMFA 5CV7A 3PUXA 5EKKA 3IT6B 1E7PB 2PIAA 1BR9A 1Y1VB 5JEAG 4BWGB 1NI3A 2Q8TA 1ZEQX 3PUWA 1XEEA 1EWHA 2NMQA 4NDXA 4O42A 4H44C 3ZYYX 2WNMA 4OZCA 1BCPC 4G4KA 5KGUA 4KGTA 2KMMA 3K5LA 2E6XA 2IGDA 1SE4A 2I38A 2N88A 3BYYB 4O1NA 1PRTF 1EY6A 3RLFA 3VR5A 1ONLA 1BMLC 5AFWA 5M9OA 4KV6A 1EY4A 2DLBA 2WXPA 4RF0A 4MHEA 1LTRD 1HA5A 1PTOF 1VZ7A 4K14A 1ET9A 1EY9A 3E0JA 5EE1A 1R9TB 5I6YA 3VR6A 4WAFA 3U7ZA 1DGJA 2KDMA 3PO2B 3ZGZA 1WCMB 1MI2A 3U9SA 1CA6A 1TKGA 1B9NA 1DOKA 1YN5A 2PTLA 4A90A 4LK1C 1EIGA 1SIJA 5K5PA 2RDFA 3RZOB 1VR9A 3T51B 4KY7A 1XYIA 2Q8RE 1AWDA 1TWAB 1SYGA 2B2VC 1I4QA 1O7ZA 5EBCA 2OEDA 4R9WA 1IHZA 5IOCA 2RSNA 3D4WA 1KLUD 3H3VC 2JE6I 5LL6S 4YSZB 1AFPA 3MXPA 1K51A 1SEBD 2OT2A 1NAPA 2PCFB 1EY8A 1E2WA 3Q24A 4KGSA 4PMWA 3VYTA 5HHDG 1U4RA 5IIFA 1N5XA 1XLNA 3KF8A 3NHHA 4KX6B 2WLBA 2E2IB 2B8FA 5IT9E 4OL7A 1NYQA 1ENCA 3K0YA 4OO1G 2RPVA 5M3FB 2EY6A 1DJRD 2L11A 3SE0A 2MH7A 2B2UA 5C44B 5DNFA 1ZYRC 4KGRA 1XLPA 2JSOA 4C3HB 5M3MB 1RYJA 1VLBA 2WQYB 2N55A 4MH8A 1TS5A 2A74C 1PZKD 4I65A 2X38A 3U4EG 2B2YA 3TN2A 2F0LA 2O2LD 1KDBA 4RCNA 4DAVA 4ZK9B 3AE4B 1C48A 2IW3A 3E5SA 5IGBA 4IZ8A 4RGNA 2CJOA 4PNYA 1PLFA 1XF5L 2F0DA 1G91A 1N63A 2KA7A 2X6GA 1XO3A 2F0IA 1R7SA 3HEJA 5CORA 3LXFA 3GTLB 5A2QE 1HQRD 1AZPA 1WYGA 1PFBA 1TJEA 1WTOA 3QIAA 1BCPD 1C4CA 2LMCA 1LACA 4EGVA 2PO4A 2KEDA 3KUPA 3SFDB 5C6AA 4XE0A 2LHEA 1GHJA 2K1BA 2XWBB 3MFYA 5BMGA 1RFKA 2HDLA 4ZOHC 2NVYB 1QE6A 4WFN3 4OW0A 4HAEA 3VRBB 1CHQD 3NTIA 1J9OA 1JCKB 5J1ZA 4QCLA 3L7ZC 1KFYB 3FRPB 1K83B 2V4IB 4ZRPA 3E6ZX 4ZYSA 5ISRA 1N60A 4G57A 5D14A 1A2TA 1Y8OB 2XSCA 3DM1A 4M1UB 3ZJVA 3VR4A 4XQJA 5EPKA 3D31A 4J8QA 1MPEA 1R4QB 2IL8A 3J7AF 5JJZA 1NUCA 3AEDB 3M7NA 4A3GB 5DM73 1SNMA 2MUYA 3S14B 3GTJB 2WXHA 5C0XI 1C78A 2KWDA 1I4XA 5JVH3 4LMQD 4N9PA 3GD7A 5T1GA 5EQ0A 4L63B 3HVDA 5EE3A 4ZRQA 1YNTE 1TU2B 1QJOA 5IODA 1L0YB 1EIHA 1STNA 4ODGA 4YTNB 3FPUB 3B2GA 5E4XA 2J4XA 1TVXA 2Y0SB 2PW5A 1KNAA 3AE1B 1STHA 2OHFA 4IUVA 3GTOB 1FR3A 1F2ZA 4BA1I 1ZUD2 2WXLA 2EYLA 1EM7A 1L0XB 2IWHA 4L1BA 3S9WA 1RKNA 2BS3B 1JWMD 2M9VA 1UUPA 4LK0M 5FK9C 2CQAA 1O7LA 2EPBA 1J8IA 3NE5B 1BQQT 4HR7B 3A7LA 4X3SA 4EQPA 1I6HB 2RBMA 2W82A 1II3A 1UWMA 3SVMA 1EWCA 3I9V1 4GZYC 3O13A 2BE5C 1DCZA 2HCCA 3D3RA 2Z8LA 1FO4A 4ZHOA 4ARCA 1L4ZB 5AUIA 1HEZE 2QILA 1NVID 1ZYRD 1JE4A 1QG7A 2HUGA 4ARIA 4DN4M 2IX1A 1XCTL 4IFDI 2RKSA 2Y5CA 2ZW1A 3BWUD 2E2DC 5ELDA 1FRRA 4KMUC 3W1SA 1JWUD 4WWMA 1DYQA 1JRPA 1SNQA 3CU7A 5EBDA 1IBXB 2WXIA 1ZE3D 3VR2A 3BK2A 2WDVB 2PMVA 2NB0A 4F87A 4XWTA 1YJIA 4V190 4DNRB 4OVZA 1JQ4A 2JEAI 2KACA 1UGJA 1A3VA 2FMMA 3OWEB 1XXGA 1GUNA 1QNUA 4PMBA 5I2YA 5LHY1 1B4OA 1Y69U 2K5QA 2BA0A 3AE7B 1HRJA 3H94A 3I72A 5FO8B 4TSSA 2AUKA 2XVSA 2QCPX 1PDXA 1RHPA 4HSVA 3VRAB 1CZWA 3KLRA 1H9JA 3E9SA 5EKIA 1EL0A 1JALA 3P1MA 5FLXL 1ZPSA 3NUHB 1L6VA 3CWIA 1FMAD 1MHXA 5EE0A 3OMGA 4YXDB 2MPMA 4P2CB 1WD1A 3IT4B 1WTXA 3C3LA 3AV8A 3MC0B 1BXTA 3MZ5A 1JC7A 2V4DA 4TMAB 3S1NB 3NP8A 2JWUA 1FXAA 5IGDA 4C2MB 5CMDA 1T6BX 3AMUA 3ONAB 2BT6A 3RPFC 1V1OA 1STBA 3SR6A 1D4BA 3I90A 1HTPA 3BVGA 2LFNA 4L23A 1C4QA 3MTSA 1QOBA 2GI9A 2F0KA 3LB8C 2MJ3A 3TP6A 1VMPA 4HCSA 1F2RI 3VA5A 5FOBB 4DK0A 5J22A 1I6VC 3AECB 3VR8B 3OHXC 4RWSC 2LS01 1F2YA 1V97A 4B0MA 3L3OC 1E2VA 1FGBD 3J80E 3NXWA 2QJLA 1OXXK 1TYGB 4DNTB 4NAWB 1K53A 2FFKB 2IGHA 4I7ZC 3DWMA 2BB5A 1VF7A 2JA5B 4DXGA 2BE5D 3C1EA 3DUZA 1MSGA 4IOIE 2QF7A 4IUTA 3GTQB 1EU4A 3Q22A 5C3WA 1GUOA 1QF6A 2PZTA 4QIWB 3S15B 3WCQA 2B2WA 4ZKBB 3I4NB 2K04A 2KQ3A 3KWLA 4CKEA 3HRDD 2CU3A 2JA7B 3NWSA 1WTQA 2SDFA 4QF4A 1B9RA 1U4MA 3NRZA 4RF1A 2WIIB 5DAUA 4J1MA 2R93B 1GB1A 1ICWA 1AW7A 2VZKB 3BDLA 1N5WA 1EY7A 3HGBA 2L5TA 1ESRA 4ZQ3A 2ACZB 1OXVA 4G7HC 2K03A 2DNCA 1L0VB 2KOLA 2N9KA 2PZUA 1B44D 2ID0A 1T3QA 3I4LA 2XNAC 4J3OD 4WIPA 1V1PB 2K0PA 3ITPA 2J53A 4P6VF 4LAAA 2M00A 2BYTA 1HFGA 1IKMA 2F0QA 4BS9A 4K8IA 1QCBD 3B2FA 4Q0FA 4P16A 2L0CA 3OMCA 3K59A 2PQEA 5M5XB 3AE8B 3T56B 1LT6D 2EXZA 2R92B 2W3RA 4XDXA 1G8ZD 1H9SA 4C1NI 1FEHA 3PV0A 1RWSA 3T3NA 1TS4A 2BCOA 2BOSA 1RDPD 1SNCA 3DHQA 1XX8A 2F4IA 1OFFA 1TT2A 1AP0A 1I7HA 3J9CA 5ELEA 4FF2A 5IT9L 1ILQA 5EPLA 1E6EB 3TZUA 1LLRD 2EZVA 1XCQL 1AYFA 2G1EA 1ILPA 1QLBB 3AE6B 2F0SA 1LTGD 1IW7C 3AM9A 2A6EC 1GPXA 1FFVA 3Q8AA 4ULLA 2D9UA 2PPBC 2D62A 4QMGA 3NVWA 3LNNA 5JVG3 3HVZA 3BYTB 3A8IE 3TP7A 2NN6G 1F77A 2WXGA 5FO9B 4X3UA 4H13C 2YEPB 4L2YA 4IUUA 1F0ZA 1HUNA 4Y7NB 3PIO3 4C3IG 1H9MA 4UAIA 1TWCB 3AE5B 1FIQA 4RA8A 3MXUA 2RDHA 2JA8B 3OW7A 5HG2A 2BS2B 3G6JB 2B39A 5J39A 2NYZD 1I50B 4PQXA 3GS2A 5IGFA 5A2QL 1E0BA 4K2LA 4BBRB 1GXDC 4RGMA 5G5GA 2F0HA 3BVMA 3SHLA 2J42A 3TEWA 4OGQC 2YU9B 1CFMA 1ACCA 1V8QA 3FAHA 3HG9A 3NVVA 2F0EA 1CTMA 4DXFA 3DWAA 5KYLA 1B9MA 2A68C 3SFEB 2PNRC