1TS2A

T128a mutant of toxic shock syndrome toxin-1 from s. aureus
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISALDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
publication title Structures of five mutants of toxic shock syndrome toxin-1 with reduced biological activity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 57
structure length 194
sequence length 194
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1997-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ts2A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ts2A01
1JWSD 3BVZA 1EWCA 1TY0A 1KLUD 4Z9CB 1LLRD 5TSSA 5ELDA 2RDHA 4RCOA 1PTOD 4TSSA 5I4DA 1RF2D 1EEID 1LT6D 1PTOC 3EFXD 2O2LD 4DXGA 1L0XB 1SJED 1LTTD 1LTRD 1M4VA 1ET9A 1F77A 2SEBD 3BYYB 1S5DD 1RDPD 1ET6A 4L6TB 1JCKB 2XRSD 1UUPA 1V1OA 4RGOS 2AQ3B 1D5MC 2IJ0A 1SE3A 4RHRA 1SBBB 1FNVA 1TS2A 1UNSA 1HTLD 1KLGD 4RFBA 4BWGB 1AN8A 1T5XD 5FK9C 1SE2A 1YN3A 1CQVA 1I4RA 4RGTA 1PTOB 2J4XA 3R2IA 1L0YB 4O1NA 1BCPF 1STEA 1G8ZD 2QILA 4DXFA 1LTID 1QILA 1SE4A 1PRTD 1BXTA 2TSSA 1PRTC 2AQ1B 1B44D 1PTOH 2QEJC 2XRQD 1BCPD 1BCPC 1V1PA 1B1ZA 1JWUD 4OHJA 1PZID 1SEBD 2NTSA 5ELCA 1XXGA 1V1PB 1I4PA 4UDUC 1JR0D 5D3IB 1RD9D 3R2TA 1LT4D 2XN9C 3OWEB 1S5FD 2CHBD 1ENFA 3DWAA 1PRTF 2WV6D 1TS3A 3BZDB 3W2DA 1TY2A 4ZYSA 1LTBD 1FGBD 1I4XA 1PZJD 3URYA 3BVMA 3CHBD 1AW7A 2IPKD 3R8BA 2NTTA 1EFID 1BCPB 1HXYD 2RDGA 4L63B 3DWPA 3BYTB 1DJRD 1CK1A 3V05A 5ELBA 1D6EC 3MFGA 1YN4A 1LT3D 4C56C 4RHSA 1S5CD 1D5ZC 1D5XC 3BVGA 1I4GA 3O13A 1HA5A 1MD2D 1S5BD 2R61A 3TSSA 1LO5D 4RGNA 1YN5A 1DYQA 1S5ED 2XNAC 1FNWA 1ESFA 1KTKA 1CT1D 1CHPD 1PYWD 4RH6A 1CHQD 1EEFD 1JQYD 1FD7D 1LT5D 2ICIA 1I4QA 1SXTA 1I4HA 3SEBA 1HQRD 1PRTB 2Z8LA 1EU3A 2AQ2B 5ELFA 3DWQA 1FNUA 1SJHD 1GOZA 1PZKD 1LTSD 1EU4A 1RCVD 5FKAC 1TS5A 3GP7A 3EA6A 3KLSX 1LTGD 1JWMD 1TS4A 1XTCD 2G9HD 3MC0B 1PTOF 4RGMA 5ELEA 1LTAD 4K6LA 4NZLB 5D3DA
chains in the Genus database with same CATH superfamily
2KC1A 2VXWA 2KXJA 4HDQA 5EDSA 4K5WA 2FINB 5DAUA 5IYCG 4GU2A 5DNFA 1HR0W 1FXIA 2KCMA 1N32Q 1ASYA 1N33Q 1SE8A 3MHSD 4K7SA 3UF8A 1PFBA 4LF8L 2O2LD 2C9WB 2VQFQ 2X6LA 4R4IA 4LJPB 1MPEA 2WP9B 1Q82C 5FLXL 1VZ7A 4C3IH 1IBML 4IUUA 2CWPA 3S16B 2IWHA 1OGWA 5IYBG 4K5VA 2KK8A 2WXMA 2INDC 4YCVA 2R93G 1JCKB 4MJSB 5FLXE 3PV0A 2BA0A 4RGOS 1D5MC 4A3DB 2BWFA 3FEWX 4AUQC 2UXDL 1YJJA 2WDQB 2QIEB 4A3FB 2J0MA 4N6EB 4DR4Q 4ANUA 2A73B 2D0OA 3BG3A 3V2TA 2K5DA 1TWHH 3PHXB 4ZYNA 3AE7B 3KYCD 1E1TA 2IW3A 4A3PA 4XT3B 2JK8A 1PTOB 3HKZB 4IUQA 1K51A 2G1EA 2W3RA 3VDYA 3L0OA 4HCSA 1HNWL 3VYTA 4B3SL 1LGRA 4HK2A 3PVLA 2RBMA 4V0BA 1WVLA 3TIXA 4DN4M 1L6VA 2FE8A 2MLBA 1BMLC 4ANWA 3OIQA 3BY4B 1FCLA 2Z4HA 4WRDA 3HOVH 1FVIA 3HOXG 3AMUA 2EELA 1IYVA 4XDDA 4P16A 4NB3A 2NS5A 3AH7A 3VUWA 2M1MA 1JR0D 4OWTB 4EQOA 3AE2B 2K03A 1RD9D 4P2CB 2YVCA 3H91A 2JXXA 2R7DA 2XN9C 3A8JE 4A3MH 1QLBB 3P4QB 2PVOD 4K7WA 2H4OA 2K25A 2UUAL 4ZRKA 2B63B 1Y1VG 2VB2X 3Q2AC 1Y69U 4CHKA 3OAWA 2LKVA 4MDKE 2B2TC 3NBIA 3PO3G 2GLSA 4JG2A 3T16A 3URYA 4KHPQ 3ML8A 1Q86C 1EY6A 2F0KA 3B1LX 1AP0A 3EROA 1LFDA 2OJRA 1KL9A 3EC8A 3FHWA 2V3NA 2KHWB 4DUYQ 2J0KA 2O2VB 2RPQA 2KC2A 4K3CA 1VQ5A 2MUYA 4GIVA 4NKLA 1EYDA 5K36G 1VZ8A 1WM2A 1G51A 2JX5A 2LRWA 4MEMA 1ICFB 4RGNA 5H8YE 4BBSB 5HI1A 3VXWA 4HMIA 2D3AA 2HQEA 4GN3B 1VZ6A 1SNQA 1Z9FA 3ULLA 5LXHA 4KY7A 1P9DU 1EEFD 2CH4W 2PVGC 3ML9A 3CQZH 3SFEB 3N30A 4CDEC 3R66C 4JC0A 1GJXA 5EQ0A 1NTGA 1QZEA 1GC6A 1EY4A 1UWVA 3HGBA 2IGHA 4LF5Q 1Y1WG 5AZFA 3MAQA 1TKGA 2O5JC 2A6HD 3E0JA 4P1BC 1KIXA 1Z6HA 1MI2A 3NWSA 1N62A 1RFAA 1YJIA 2UXCQ 1VQCA 2K04A 2CQAA 3KVFB 1EQQA 2WDVB 5M3FG 3M3JA 4DBGA 1HZCA 2QEXA 5FO7B 3P42A 4BFRA 3TP8A 1C3TA 1XMQL 1YIWA 2B2YA 2A74C 2PO4A 1X1MA 2JA7G 1VJKA 3TQYA 4M0WB 1D3ZA 1EL0A 4C3HB 3E9HA 4MSMB 1JROA 3UINB 1CKNB 3DBRB 1V1QA 3OYYA 3AEVA 3VAWA 4MJSA 3QIJA 2CHZA 1HZ5A 4GS3A 1M90C 4CJ1B 4R9WA 1IW7D 4I65A 3J7ZC 2GMIC 2OJWA 4IOIE 3QJZA 2XEWA 4JI5L 3VR4A 1N33L 1QWYA 2NN6H 1N32L 1ZXHA 2M17A 3VVWB 2LJ5A 2MWSB 3TEYA 2ZNVB 3RR5A 1WGKA 2Y5CA 3F2DA 3UGBB 2JVCA 3P7JA 1F9QA 3Q6SA 1QKZA 2WQYB 3HVZA 3WANA 1SE2A 1K9MC 3Q8EA 2KO3A 1VDZA 4TKOB 4KZCA 3NZUA 1TU2B 1UEBA 3CC4A 4M8AA 1WCMB 3L7ZC 1YI2A 4CJ0B 3S1NB 2OWOA 1LTID 3K80C 5G55A 4K2LA 4DR4L 2JQRB 3A5UA 4EKUA 5NUCA 4C3IG 2GVAA 3RLOA 1PYBA 4BS9A 2AUJD 2R7ZH 1B44D 4Y52H 4A76A 1V6EA 3CF6E 4KGRA 3DMUA 1MSHA 3GB1A 2F3VA 1S40A 4AYBB 2GOWA 1GC7A 4TVAB 2MCNB 1I42A 4HPMB 4DK0A 2MJ8A 3VA7A 1ENAA 3EN2A 1WTRA 2AL6A 2BWES 1TVXA 4QIWB 1SE9A 2N4FA 2V4LA 2BW2A 4CQNA 1YQ3B 2HCIA 2KJ6A 4DV2Q 2F0PA 4BA2I 3M7GA 1F2RI 4JI8Q 5FO9B 2O5IC 1LV9A 4ZYSA 1X9NA 5E6NA 2C9OA 2MEKA 3V3XA 1TWCH 3L3OC 1HA6A 4KKJA 4APVA 1RWSA 4YSZB 3L17A 2VL6A 4A3CH 4A90A 3DBHI 2PW5A 3FP9A 2SNMA 4QUFA 4A55A 1CUKA 4DR5Q 2HCCA 3PSEB 2O2VA 4S17A 1E2ZA 1F1HA 3JW0X 4DNRB 2KN5A 2W82A 3GTOB 2BYTA 5JPNC 1D5XC 1OEYJ 2Z59B 2C7NB 2PQEA 1ENCA 2X38A 2KHJA 4A3MG 2MBHA 4OEMB 5CV9A 1XYIA 3KJPA 1QG7A 2WXOA 4DKAC 3PUWA 1XLPA 3RLFA 2LRUA 4RH6A 5KHQA 2F0EA 4DUYL 1WR6E 2KT7A 3F2UA 2BE5C 5L95C 1CI3M 1STHA 1UH6A 2D11A 3I70A 4HEA1 4U68A 4WH4A 1Z2MA 4XDCA 3V6CB 4C7ZA 1KQSA 3DWQA 3NTIA 1GM5A 3WAOA 2E2IB 4YCUA 4GN4B 3TRZA 2MBBB 2Q8TA 1ZXIA 5FKAC 2B3GA 3CWIA 4LUZA 4LNIA 2D3CA 4P75A 2EYMA 3Q8AA 1RLFA 1VQKA 4FJYA 2KTFA 2Q2IA 3L4PA 3KDFB 3H6MA 3VR2A 3NEMA 4M0WA 4X3SA 2GVBA 2JZPA 4QCLA 3BINA 4A3GB 1LLRD 1H9SB 2RPVA 5D6JB 5GMVA 4W9LA 4KHVA 4EQ5A 2LXCA 4DDGD 1RAXA 4N9PA 1Y56A 1CKNA 4IUMB 2F0VA 3NHEB 3RMKC 1VF5C 2LGSA 4BBNF 4JK1C 4O2DA 1WGDA 3S1MB 1HJPA 2K50A 4DR7Q 1O78A 1JRUA 2OTJA 4ZKCB 1WOCA 5E6OA 1VQDA 4A3JB 1EYAA 4ICVA 4DR3Q 4JBWA 4M8MA 1YNJC 4RHRA 1UNSA 3P4RB 1VQLA 1KM7A 1SDFA 2FIDA 5HURA 5FK9C 1EQRA 1YN3A 3NTHA 2VZKD 5AFWA 4RGTA 2MJDA 3FAHA 1SYBA 1WIAA 4O1NA 3PZDA 2HJ1A 3CCRA 3NVYA 4JGHB 3ULJA 3AE8B 2A68C 2LGDA 3S2HB 3ZW3A 2UU9L 4RAUC 3CCEA 3IAYA 1VMPA 1UE6A 5KIXA 2YLMA 2JT4B 3CSFA 2F0UA 1JJCB 4GOPA 1B3AA 3BU2A 1MGSA 4REZA 1QF6A 3M4OB 3AECB 3H9DA 2HDMA 3ERSX 2NN6G 1KH0A 4C2MH 3E3XA 4TQ0A 1SN8A 2IO0B 4PG3A 5IY0A 3IG3A 1DXMA 3R2TA 2XTIA 1A5RA 1A3VA 4G4KA 3DBLB 3DUZA 3DHGC 3NQIA 2LGYA 3GTMB 3MZ5A 3V61A 2NBVB 4ME3A 3RN2A 2QF7A 3N52A 3OW2A 1EWHA 1BCPB 1KNEA 4NAWB 3AEAB 1A2UA 2K33A 1E6EB 2LASA 4DV2L 4A93B 5I9PA 1ZW7A 1YD8U 1JRPA 2A6ED 4JI8L 3SVMA 1NBWA 1PDXA 1I3QB 4GZYC 2CQOA 2L1AA 3LJ3A 2EJFC 2XSCA 2ZXRA 5IP9G 3VH3B 2FCSA 2KZRA 2LMCB 2PMZB 1JWAD 3CPFA 2I1JA 3EFCA 4WJNA 5GAGC 1IKMA 2WXHA 3UIOB 2QKIC 4DR5L 4KV6A 4UP7A 1C1YB 4ARIA 2J0JA 2E2JH 3W1SA 4ZUJA 2E76C 4GSWA 4BBRH 4BKSD 3DXJC 2PNRC 5LMUQ 2RKSA 4GOCA 2FNJB 3SEBA 3J81c 4A3CG 2J0TD 2AX5A 1JORA 1ROEA 5IYDH 2L12A 3X3MA 2D07B 4TV3A 3S14H 2N0SB 1HZBA 2E8GA 4A3IB 1HUNA 4PYZA 1TT2A 1HTQA 2N8NA 2R92B 1C7YA 3QAQA 1X3GA 2G9HD 3KDFA 3SD5A 5JJKA 2EXZA 1EY5A 1JOKA 3D3RA 4IUNA 2IBIB 1N9WA 4R4QA 3VYRA 4FF2A 2HJ8A 5D3DA 4YWMA 2EYOA 4WJPA 2NVTH 4Z9CB 5AJ3Q 1RRBA 3DBRI 3KLSA 1LABA 3IL8A 1AWDA 2JA8G 4CDDC 2F0FA 2GBMA 1GHJA 1V43A 4LNQA 2FIFA 2FUG1 4W9JA 1A2TA 1QT9A 1WRIA 3T9LA 3HOWG 1IPGA 1CMXB 5JXVA 3UE0A 2DZIA 3JYUA 3W1BA 3QX1A 5IP4D 3F2BA 2MH7A 2F0LA 3PRPB 2NBFA 1WGRA 3QC8B 1P0RA 1GUNA 4HCPB 3R3MA 2DJFC 5BYSA 2KDIA 1NUCA 3Q8BA 2JPHA 1P7EA 2N9XA 1X65A 5C4JH 4I7AA 2JEAI 1I4RA 3WAPA 3MEFA 1S3OA 4DR7L 2R2OA 4DK3C 4PK1A 3QB3A 2OXPA 1Z47A 3H1UA 3OOCA 4DR3L 2JZ3B 3GTKH 2A4ZA 1PLFA 4DXFA 3SDZA 2Z9HA 3KF6B 1TWGH 2HD3A 2I07B 4GGQA 2KENA 2TSSA 1EIGA 3IFWB 2B39A 2NMQA 2CR5A 5IT9L 1ZDXA 2KQSA 5ELOA 2DX5B 2WYQA 1C78A 3D4RA 5DM63 1JWUD 1GG3A 2F3WA 1JT8A 1EFWA 4DK1A 1V8CA 4NAMA 2K32A 2XBBC 1DGSA 1MHHE 1JB3A 2A69D 4LFCL 4UY8C 3OWEB 1NSNS 4PMWA 1DOMA 4OO1H 4FXKC 4ZRIA 3RUIB 4ULLA 3ICEA 3A1QB 4HPPA 1Q1BA 1SFOB 2PIAA 1PH9A 2DZKA 4KX6B 3IXSA 1UBIA 4IWOA 2BB5A 3SDLC 2V3SA 2KCTA 2C5LC 4XQJA 1I4XA 1X56A 1UWXA 4EGVA 1I6HH 4NAWA 3W3AA 1VRAB 4PMCA 3EVQA 1Q0WB 3HRZC 2K5QA 2AL3A 4B6WA 5FR3A 1EFID 3D0FA 2EE1A 1QVCA 1M1KC 4NXNQ 2R2QA 3KUDB 3KFUA 1X3FA 3H0GH 2PPBC 1Y8OB 1BVSA 5JJLA 3BVGA 4DFAA 3DHIC 3RZOH 1YN5A 1JW9D 1IYJB 3PSIA 2VQEQ 1CA5A 1NYRA 1RFKA 4PYUA 3SU8X 5DPTA 2MBEA 1UE7A 2LD9A 2J7ZA 1U4RA 2R93B 4N58A 4R4CA 1GVPA 4DNIA 5KRUA 3KF8A 1TT5B 2KMCA 2IY5B 1E7ZA 4G7ZC 1STAA 1AE2A 2AEHA 2FMMA 3NG0A 2MW5A 1L1OB 1I50B 2VUMH 1GOZA 4W9DA 2DWQA 3CCSA 4JE3B 5JEAJ 4FYDA 2PW7A 4MH8A 1QOGA 5EPLA 1BQQT 2K5WA 4IPGA 4N8FA 3O65B 1OQYA 4P7IA 5LMUL 1WYWB 4EE2A 2CKZB 1ONLA 1DD2A 2Q2UA 2GI9A 4P74A 1PFSA 5J17A 4RM8A 1C48A 3T1HL 2B2UC 1WTOA 3CP0A 1FXAA 4G50A 2KWUB 4J8QA 4NPNA 1J0GA 5IYCH 1J9OA 4JPBW 4BBRG 1EEID 2WIIB 3HOXB 3RULA 2LY7A 2KVRA 2QMTA 5A35A 3GTGH 4XYOA 2PJHA 1LM0A 1I35A 4PT5A 4BY7H 5IYDG 2Q8RE 4AOFA 1FL0A 4YWKA 1AEXA 3T4AC 1DOKA 3BWUD 1W6KA 1TGZB 1UWMA 3BYYB 5AJ3L 2IO2B 1VCBA 2VS1A 3HFZB 5IO9A 4AQ7A 1Y1VB 1IW7C 1UUPA 1Y8NB 2OOBB 4B9WA 2Z0EB 2G45B 4B3TQ 4US9A 1C9FA 5BN4A 1XNRQ 2L32A 5IE8A 4IFDH 4QGUA 1RL2A 3PO3B 1HPCA 4FXGC 5IGBA 4QAYA 5G2NA 5IIFA 4B3MQ 1RODA 4HSPA 2E2HH 1FR3A 1ILPA 3FC4A 4FJVB 4F8CB 1QVFA 2B8FA 4E3CA 3HP3A 1WX8A 3HHMA 5C4XH 2VH2A 3KLWA 5AUKA 1RIPA 2RSOA 3DVGY 3NPPA 3PPAA 4KDLB 1CZGA 3FDTA 5C0XI 2WKDA 1TZOA 1GUSA 3K5NA 5EKIA 1XCQL 4AIMA 3DBLI 3U4VA 1IUEA 2G4DB 1OTCA 5BMIA 3T8MA 4A3EB 1PZID 5AZHA 1LUZA 3KK7A 1WRDB 2C35B 2ZJDA 2EY6A 4C7YA 3I90A 3PZ8A 1DOYA 3A1QA 3S15B 3H7SA 1G291 2XWJB 3X3NA 1FEHA 1Y1WB 2RA4A 3P75A 4B0MA 2RDFA 1P3QU 3FRPB 3QCAA 5KEEA 4DR2Q 1TY2A 1YX6B 4M01A 4QUCA 2K4KA 4IPCA 5JPMC 5LMNW 4LNKA 2BYVE 1BNZA 4F87A 3TP7A 2IPKD 1C76A 1NBFC 5M3FB 4DHJB 3K6OA 4KGSA 2RDGA 2VY3A 5I2XA 1WMHB 1ILQA 2WXRA 1ZEQX 2UUBQ 1YEZA 2AWNA 2JA7B 4K6DA 1EZ8A 1X3EA 1OQRA 2BBCA 2I1KA 4RMAA 1UD7A 4JIOU 3RNAC 3ZIMA 4O0AA 4E6IA 2V1CC 3O13A 1HA5A 3PF5A 4PZ8A 3QK0A 3JAML 2L5TA 2GB1A 1YNND 3PUXA 3VDZA 4DXAB 2Y5PA 4JOIC 1WTXA 2EMSA 3EJIA 4JI0L 2N78A 2L83A 2F0SA 2ZTCA 2I2YA 3RZDB 4AWJA 2W54A 1WJUA 3LB8C 3K9OB 3HZXA 5JEAG 1ML0D 4PS8A 5BMHA 4RM9A 3S1QH 2KOXA 3NVZA 1FD6A 3C2PA 2Q2HA 1WH3A 4X62Q 4ZK9B 1K50A 3QA8A 1J6QA 2VQEL 2RD0A 4FA6A 4IZ8A 1SYFA 2AWTA 1E90A 1E8ZA 5GROA 4HIKA 1ZUD2 4ANVA 5JHAA 1T5EA 1EYCA 4DA2A 2K5PA 3KLSX 3K5OA 3GE3C 1XPRA 2WX0A 1QJOA 1XNQL 1JOQA 4USAA 4UP9A 4IUTA 1R4PB 5GAEC 5ELEA 1N6ZA 1AZPA 4NZLB 2IZVB 1CA6A 2A19A 1EWCA 1NR4A 4R4OA 4RKLA 4LUVA 4C3IB 3VRAB 1R4MB 4B9XA 1MJEA 4RKBA 4TSSA 2D3GA 1X3QA 4JBKA 3ZUNA 2E6XA 1E5WA 4W9KA 3GZNB 1VQ7A 3ZJVA 1C9OA 1M4VA 4KD4A 3H15A 4DK5A 2AHOB 1SYGA 1TWHB 4LF6Q 1PH6A 1XQQA 1RDPD 2RCNA 2FCQA 2K52A 3Q23A 1TBEA 2AQ3B 4MELA 3ZNGC 3QARA 1JB7A 4G7OC 1OTRB 4BWGB 2MPMA 3ERQA 3Q8DA 1F2YA 1PFNA 2G3QB 4AJYB 4DU9A 1X55A 2N55A 4JV5Q 2WU5B 2L7RA 4RG1A 4HPLB 3HOVB 1SR3A 4OZAA 3MFYA 3TEXA 1G8ZD 5DEHA 4XGAB 4BKGA 4B3TL 4B3RQ 4DR1Q 2BCOA 1VDVA 3M63B 1L2FA 1WXVA 5E1FA 5JOBA 2IX0A 4BY7G 3I63C 3G48A 2PPHA 4A3MB 3C0RB 3OG5A 1JE5A 2B2VC 1Q46A 5EPKA 1BBXC 4B3ML 2YU9H 1JMCA 4DV6Q 4ZRQA 3AU7A 3CIRB 2JXMB 4OONA 1KRHA 2JP1A 2WNMA 2SOBA 4WJWA 1BUIC 4UDUC 4GKKQ 4IFDG 3PHWB 1PYSB 4W9IA 3VR8B 3UE1A 2LS01 1I7HA 1F9JA 3QIAA 1HUMA 2FMCA 2KVMA 2NVUI 4KSKC 3VYUA 3UDGA 3H3VI 3OIPA 3ZQ4A 1VQFA 5IWAL 4YHHQ 2ONQA 1JJGA 4IKGA 5DM73 2ZTDA 1YIJA 3L54A 3A8IE 4TQ1A 4C4VA 3UDIA 3W1YA 5C4XG 4L5RC 1STGA 1TXYA 3JAMi 4NP5A 4G7HC 3NBHB 3CCMA 3GD7A 5CBEE 2Z6BA 1EUVB 3LDZE 1OFFA 1WMHA 2FUHB 2JA5H 4J6IA 3M4YA 1VQ4A 1MI0A 1I5FA 1CSQA 3PTFC 2WXPA 1PMRA 3OPOA 5ELBA 3WWVA 2JYOA 1EY0A 4XT1B 2A6EC 4DR2L 3I4MH 3CQZB 1V81A 3TSSA 1SROA 1WXAA 1ZP0B 2DLBA 2KHSA 4XZ4A 4CHTB 2G9DA 2F0HA 3H09A 3WA0A 4NW2A 1P8LA 2KOLA 1WXSA 2D2QA 2F4VQ 4LMQD 5FOBB 2PZUA 2UUBL 4LLGM 1YX5B 1FD7D 3I3CA 2WWZA 3P4SB 5LHY1 2K75A 1KJTA 3I4OA 3IKJA 1SNMA 1SF0A 1T3QA 4OXPA 2WU2B 2JYEA 5J3BA 2V3PA 3AE6B 4KV2A 4NPSA 4A3BH 2BTEA 4WQMA 1SJHD 1ICWA 4XXEA 5BYRA 2ZCBA 4MNOA 4WWMA 1BKBA 5IGEA 5J39A 4BOZB 4A75A 5G5HA 1FYCA 1HZAA 5LXIB 1PHJA 4NY0A 2XIWA 1F52A 4X62L 2CJOA 5CMDA 3D31A 2YEPB 4OWXB 4HXDA 5M5XH 4ZAIA 4Q5VA 1D8LA 3F2CA 3D4DA 4KKIA 3FKIH 4ID6A 2WHIA 4HJ7A 2GN5A 2EVBA 4DV3Q 3W5OA 5JH5C 3FILA 1C4AA 4Y7NB 2N9LA 1LTRD 1WFYA 4X3KA 2K3UA 2N1VA 1L2NA 3MXGA 3PRMB 3GTPB 1F77A 1AE3A 1WXQA 3AV8A 4CDCC 1FJGQ 3P4PB 1E22A 4CKCA 1QNUA 1WGYA 3U4EG 1SNPA 3RD2A 5FLXc 2IJ0A 3PQIA 1E1OA 3N6RA 2DYBA 1TS2A 2K1BA 4HJ9A 3I9V1 1VD2A 4YSXB 1E2VA 1WTQA 3VR6A 1K8OA 3AQQA 1PUTA 3TMPB 3VFKA 3VTVA 1HNZQ 1CQVA 3Q8FA 4IC7B 2R7ZB 4RF0A 2X8XX 3TP6A 3MJ5A 3R2IA 2I5HA 2F0TA 3GV6A 3PLUA 3VA5A 1ACCA 3ZLZA 2JUOA 2PI2E 2Z6KA 2LI5A 3WIMA 1GB1A 5KYIA 4R4TA 4JI2L 1BXTA 4GNXA 2MQHA 2QCZA 4DK6C 1OXXK 3CCVA 2MHVA 3RMHA 3H8HA 4JV5L 1P98A 1WTVA 5I6YA 4IOAA 4HR7B 4J15A 2ID0A 1D7QA 4DR1L 2NBUA 1TWCB 1LT4D 4Y7NH 2GBNA 2VQFL 3ZO5B 3JSVA 2ENBA 2CHBD 1L0VB 2A69C 3GTPH 4LUOA 4TQUS 4FF4A 3DWAA 5C3XA 3DBSA 3NBHA 3TP5A 4DV6L 2Y0SG 2WINB 3BZDB 2MQJA 1R7SA 1Q12A 4HCNB 2K14A 3OW7A 3QWZB 2JSVX 4TMAB 5FR6A 2WS3B 1GUOA 3APDA 1XO3A 2BVCA 1EUJA 2OEDA 3C8YA 3DVGX 3D8GA 1YHAA 2R7FA 1A3UA 3N1ZC 1Q1EA 4YHHL 4XE0A 4PQXA 1FRRA 2IGGA 4ME5A 4UAIA 1ZYRD 1MSGA 2VW9A 2WDTB 4C3JH 4I6NB 4JLCA 5E7NA 5BN3A 2RQXA 4GOPB 4ARCA 2KECA 1I4GA 2ZJQA 3F1ZA 1FCCC 2D3BA 4XYQA 4FHKA 1NR2A 5IP9H 2V4DA 2PW9A 2B2WA 2WXLA 3CMEA 2WACA 2OT2A 3MXNB 5LL6S 3EIVA 1HE8A 4G57A 1GPXA 2LVQA 3P1MA 3AE3B 3S2AA 4P73A 5HHDG 1HHVA 1H9KA 1UZXB 1HFGA 3MEHA 1KLVA 2V1YA 2YYZA 2Z4IA 4LAAA 1E8YA 5GAHC 3RNFC 2JA5G 3IRBA 1PRTB 3ETRA 2I5LX 4N9F4 3B0AA 4B08A 3PGZA 3VH4B 3P20A 2F4VL 3LWEA 2GBJA 2HUGA 4CDFC 2QW7A 3GP7A 1R4MI 3I4MG 3EA6A 2OEOA 1TWFH 3ULPA 3QHTA 5D2MB 3MC0B 5M3MH 1DM0B 1K3BC 3W1GA 3U4ZA 4KHPL 2M0AA 3GZNI 1NNXA 2H1EA 4RMFA 1E24A 1HZ9A 3S17H 2LUEA 1MIUA 4RCOA 1PTOD 4ITKA 2WB1E 1RF2D 3I91A 1PH1A 3D6CA 3PUVA 2VH1A 4YWLA 2CHWA 2KHIA 2JA8H 1TWAH 1YHQA 2FAZA 2MX2A 4NQLB 3PO2H 2WLBA 4N59A 1K53A 1GKHA 1HRJA 4A3BG 4HKZE 2KNBA 3HOWH 2NZOA 2E3TA 4I6LB 4IM3A 3Q24A 1IYUA 3L2PA 1KD1C 3TREA 1PFDA 2XRSD 2WXQA 5F2DA 4W9CA 3HUIA 1WX7A 2FHTA 1OEYA 4DV3L 2N7EA 2KDMA 1BUVT 1T5XD 1U5KA 4XIGS 2NCNA 3MHBA 4JX1C 3A56A 1B7YB 1JOOA 1STYA 4LF5L 4AS1A 3KJOA 1FJGL 2BPSA 1UF0A 2ZVOA 4ZRPA 2CFMA 2JWZA 2N1WA 1XLNA 4FLHA 4I7ZC 3FKIG 3NQTA 3D32A 3ABVB 4C2MB 3CXCA 2UXCL 3HM6X 4HJAA 3HOYH 1YVCA 5C3EH 1SE4A 3CD6A 4LJOB 5JAVA 2M0XA 1MBYA 2ZVNA 2F03A 1VCIA 3RNBC 1YJWA 1I94Q 2LUMA 4DDID 3Q22A 1CM9A 3QR8A 2CCZA 2BA1A 4XQQA 2KFKA 4JPSA 3RI7C 1J7CA 2L00B 1JMLA 2NUCA 2CU1A 1H9MA 2QDBA 3HKSA 2PLPA 1IGCA 3NUCA 3KOJA 4DPGA 1ENFA 2JE6I 1H8CA 2LWPA 1XF5L 1Q7YC 4OZBA 3AE4B 2EYFA 5EKLA 4GLSC 4JWUC 2WAQE 4H44C 1T0QC 4WURA 1AW7A 3GTQH 3M3YB 1DOLA 2DJGC 1YNXA 1K8RB 3PO0A 1D2BA 3I4NH 3BYTB 1ZGUB 4IWPA 1QB5D 1VQ8A 3HIZA 1D6EC 4JYAQ 4HMJA 1S72A 4C56C 2CW0D 1HR0Q 2L15A 4BBRB 2E2JB 5E6JA 3MXNA 3JVZX 1HFNA 1LO5D 5L37A 4BAXA 2M8SA 1YNNC 2B2TA 3OHXC 5FJ8H 1KTKA 3S14B 3A9KA 1CHPD 4P71A 4AJWA 3EBEA 2LHDA 4KTAA 4O42A 2WXIA 1BBUA 1KRSA 1PGAA 1WM3A 2ICIA 2O6VB 4WIPA 1UAPA 3WAMA 1I4HA 1TKWB 2E75C 5C4HA 3U8ZA 4ABNA 4CGYB 3A74A 2C7MB 2L4NA 2GRIA 4GDLA 2BDNA 2NVTB 5J18A 3KBGA 4LJZC 4L23A 2J53A 3V62A 1G6PA 4C3JG 1B53A 3KUPA 4B0EA 2KCCA 1PTOF 1VQPA 1T0YA 5JJZA 4ZLTF 2NN6I 4IN3A 1VQOA 1YQBA 2PEAA 5JZEB 3M3YH 4XYCA 1HH2P 1B9MA 4IALA 3UQBA 4R8IA 1WWTA 4YL8A 4UPAA 5ELDA 5D94A 4II3B 5CV7A 4IUPA 2MFIA 4OIJA 4OVUA 1LT6D 4LK0M 3ZJTA 3MTSA 3VR3A 3STBD 2Y5BB 1L0XB 3W5UB 3R3OA 1XPOA 4LF4Q 5D7GA 4PZ6A 1XT9B 4ICUA 3KF8B 1RTNA 1S3SG 4GN5A 4WWOA 1YJNA 1E2WA 5C4JB 3M7NA 1ET6A 1GD7A 2I46A 4L6TB 3TS2A 1SMXA 5HGTA 2J7QB 2PKOA 3K0YA 4X3UA 3Q3FA 3C1EA 4M00A 5M3MG 3GTKB 4RFBA 4LFAQ 3PS6A 1QOAA 4LK1C 2QHOA 4ZHOA 1TWGB 3TZDA 2X6GA 3BJUA 4IPDA 3A5ZB 3APCA 4JQWC 2EYLA 1QZGA 1WGGA 3E6ZX 3EUB2 4C80A 3ONAB 1EIYB 1EM7A 3W5VB 2KWCA 1OXTA 2QSDA 5JJIA 1K8GA 1AH9A 3NZ3A 3PT2B 5LLIA 5C5LA 5I2YA 4DAVA 3PO2G 3GOEA 3RNEC 2HHHQ 4YY3Q 2ASBA 5I6WA 1PRTD 3J81i 1GO3E 1S1QB 2LSSA 1D1KA 1OO9B 3Q3JA 1L1OC 4H02A 3ZDTA 4BOSC 2KCNA 4HLEA 3GV3A 2NTSA 4E71A 1UE1A 4AQYQ 3D6WA 3AMZA 3QOLA 4ZHPA 4CJ2C 3M85A 1I6HB 4L5SA 2LZ6A 1MFWA 4CYEA 3S9WA 1A70A 3A4RA 1SNOA 1NAPA 2WXKA 1YHBA 1PH4A 4TRDA 4MM3B 3Q3OC 1SLJA 3I73A 5A2QL 4K14A 3H0GB 5CGKA 2ZM6Q 2DN8A 1FGUA 3NHHA 5C3EG 3HOYG 4HJKA 2AMCB 1AYFA 3BVMA 5A2QE 3RZOB 3NVWA 1YZ6A 2NTTA 3RNCC 1WF9A 1DOXA 1TR5A 3QWNA 3A55A 2WP8J 5C0XJ 3A33B 5FO8B 1WSPA 4DQOC 1FFUA 1BO0A 1UELA 1KDCA 2M00A 4IUVA 1WGHA 3ITPA 3ER0A 1YQ4B 1E0ZA 1A3TA 2D10A 5IT9E 1VQ9A 3J7A5 1IL8A 3H6NA 4KI0A 3K9PB 1YNTE 3DEPA 1DYQA 1D4BA 1ASZA 1E3PA 3HS0C 2VUMB 4XTCS 1OQQA 3AE5B 2O6VA 1CHQD 1FFVA 4P1CC 3K5MA 4JYAL 2N49A 4UP8A 1HR0L 1KNAA 5DPSA 5JEAH 1V97A 1JQ4A 2J42A 3WDNA 2LXAA 3AEDB 1AZQA 4NJCA 1F9PA 4L2YA 3I4NG 2R6GA 2KTRB 3OLMD 5C23A 1LTSD 1K83H 2KANA 1BBWA 4LF7Q 3K8AA 1TS4A 1SSNA 3M95A 3GTGB 2K39A 1B9NA 4X57B 1TKYA 4OX9Q 4IPHA 4BY7B 1C4CA 2EJMA 4HDOA 5FJ8G 3I56A 3RNGC 2IY1B 3LYYA 2NVQH 3B08A 5L83A 5M5WH 2QGQA 2L76A 3TZUA 3T53B 1QZHA 2K8BA 3HOZH 5T8IA 2WGSA 1HNXQ 4W9HA 1NCVA 2BB6A 2UU7A 4EZJA 2M4NA 3HG9A 2K7VA 3S2DH 2D9UA 1ZE3D 2DBYA 1ISNA 1NMGA 3DLLA 4IWQA 1NI3A 2E2HB 2WX1A 3SFDB 2A6HC 4A4IA 1P1AA 2HDEA 5C4XB 1A0IA 4GMVA 1Y8PB 1FNVA 4NQKE 1KLGD 1HTPA 1FO4A 4LF4L 2JXTA 4MTKA 3SHLA 5CV5A 3Q0AA 2ZJRA 3APFA 4K81A 4JCVE 4YWGG 3T13A 3VR5A 1MG4A 3PRZA 2X69A 1V2YA 1T0RC 3M4QA 3G6JB 3H7PA 4KKUA 1EY8A 2Z0SA 4GXBA 2MNAA 1CZPA 1GAQB 3CCLA 1UEAB 4F8MA 2WB1G 2PZTA 4MHEA 4DAYB 4X64Q 2XGTA 3KWLA 1XLOA 3AE9B 4R3DA 5EE3A 3QJYA 3J81j 4WJ4A 1BOSA 3U30A 1BCPD 3VUXA 4IO9A 2UXBQ 1F2RC 3ND8A 4WORA 4DHZE 1KOTA 5IP7H 5EGTA 5IT9c 5IN7A 3HK0A 2F0MA 1OXVA 3NE5B 2M2LA 1TZ1A 2HHHL 4YY3L 1RTOA 1EYGA 2Y0SE 1FRDA 1K8MA 2NPTB 4MM3A 1WYDA 2BE5D 4KZ0A 1TS3A 3KLRA 4EQPA 1HTOA 4KMUC 5M5YH 3ZNHB 2JA6H 3PIOA 3HOUH 4KGTA 2NVXH 1E0BA 4WFN3 3CKIB 1ZPSA 1PH5A 2I0QA 1HXYD 3FMCA 2KWVB 3NENA 1XX8A 3MA2B 2PZWA 1T9HA 4KK7A 4GB9A 5CYUA 3RZWC 1LT3D 3ZKJC 1IP9A 3I5JC 2BS2B 2ZM6L 2N9PC 4IJLA 3S1QB 4EUTA 3P1HA 1B8AA 1IBMQ 3LX0A 1K3RA 5IODA 2ZZPB 3WALA 5E4WC 3J7YW 2KVZA 4HAEA 2PQAA 2EPBA 1Q81C 2JY6A 2EXDA 4LWCA 4G0NB 3U7DA 1B9RA 3GTJH 4HRSA 3C19A 2L0CA 4GKJQ 3Q14C 2F3IA 4DAPA 3OTOQ 2XK5A 3PIO3 2HTHA 2Q5WD 1SXTA 2B2YC 2L1BA 1J5EQ 4NJ7A 2BF8B 5D14A 1HQRD 5E3FA 2KTRA 3NRZA 4C4VB 2DNCA 4X65Q 2CWAA 3L10B 2LXJA 2WAQG 3UIPB 3HRDD 2RHSB 2F0IA 5J1ZA 2RVLA 2EOTA 3J80L 2VNUD 3FKYA 1A6XA 4DUZQ 4NDXA 1G2TA 4P6VF 3DCGA 1HQMC 1P7FA 1SMYD 1W2BA 3U7ZA 1RJTA 1YITA 3AI5A 1NENB 3IBEA 1VQBA 3TEHB 1QE6A 3BVZA 3EQLC 2ATWA 1TY0A 3TS0A 3BZKA 2K6DB 4YXDB 3OJ4B 4K3BA 5C4ZA 3JAME 4NNJB 4HSVA 1WJJA 4NXNL 1Q3LA 4R8NA 4LF7L 4URKA 1QVGA 1PTOC 2EMTA 2KUMA 1VF7A 2V0GA 1V8QA 1PVOA 5J22A 2QCPX 4N8X1 3TUOA 3RFZB 3KBXA 3I4LA 4OX9L 2BDOA 3BIID 3G6EA 4HN7A 2FCMA 1EOTA 4PMBA 2NZ1D 3AB9A 5IGGA 3LWUA 4ODGA 1NDDA 4PV1C 1QNKA 3C3LA 4DV0Q 1EWYC 2WXNA 5HKHA 1HTLD 4OVZA 4PS7A 4MTNA 3BZCA 1YJ9A 1ZXTA 4DWFA 1N34Q 2MSED 1KFYB 4OO1I 2J4XA 3L0WB 1DOIA 2YU9B 1A15A 5C44H 2MJEA 1BCPF 3HOZG 1RKNA 1IBXB 5KNDA 4DAYA 5BN5A 4BY1H 1MHXA 1UBQA 2BH8A 2KMAA 1WI5A 4H2AA 3NS8A 2D5DA 1H9RA 2BT6A 2OQ0A 2HIVA 2JWUA 2PMVA 1HZ6A 1KF6B 2WXJA 3FILB 3DOWA 2OF1A 1PA6A 2DAFA 3G71A 5IGFA 2W55A 3M62B 3B2FA 4KKSA 4A9AA 5D3IB 2NPTA 3AE1B 4DGZA 3SK4A 2WKCA 4JBJA 4X64L 2JYTA 1Q90A 1X32A 2JA5B 4DV5Q 2QJLA 3N20C 1H95A 1JC7A 3EECA 3PUZA 5J2RA 2WV6D 1XJVA 2BGFA 4C00A 1NE3A 3DHHC 1HCZA 3T3OA 1MVKA 3I4MB 1IXRA 2JRIB 1G6ZA 1XNRL 4JBMA 4M8NA 5M9OA 4WAAA 5JVG3 1WY8A 2WXFA 1J8CA 1WJNA 2WFWA 5C3JB 4GLAC 1TKEA 2IT1A 4GNXB 1EOVA 2K8HA 3Q6BA 3S1RH 5IP7G 4ASWC 4ZUIA 2QA4A 3E9SA 1Q8IA 2CW0C 3HVDA 4BXXH 3SR6A 1MD2D 2R61A 2GBRA 4WQOB 4ILWA 5EPJA 2NVYH 3J80i 1S5ED 1WI0A 4ZQ3A 1N36Q 4YT0B 3DPDA 4LNNA 1CSPA 4A3BB 4A3KH 1B3QA 5H1SE 3PCOB 4JI5Q 1PGXA 3JAMc 3JSVB 1ZOYB 4K1RB 3GTLH 2QC8A 3RPFC 1XTDA 3IHPC 4GN1A 4HIDA 2JA6G 4HIOA 3HOUG 3TCAA 4FXCA 3NP8A 5HG2A 2K5HA 2Z8LA 1EU3A 1FNUA 3E5SA 3GDEA 3RCZA 3TBLD 4K2KA 4JI3Q 1C79A 1PZKD 2KD0A 3Q8CA 1EU4A 5M5XB 5GADC 3CMAA 3CW2C 4GLXA 4WJQA 2C60A 2D2CC 4GKJL 3OTOL 1WYGA 3RYTA 4FBJB 3P63A 2R3ZA 3PMFA 3FKIB 5E6PA 1CKMA 1J5EL 3A8KE 3R7QA 2H5XA 1JWSD 3E0EA 1E7PB 1PH3A 2LHEA 4X65L 2ZNVC 4DF7A 2Y3AA 4BA1I 4IFDI 3UQAA 3ZJUA 3IFDA 1G6JA 2RDHA 4HWIB 5ISRA 2DNFA 2B29A 4DUZL 4K0KQ 1E9MA 3CC7A 1BR9A 1L4DB 2K22A 1C4QA 2FXQA 5IAAC 1E8WA 3FVQA 2LFNA 4DXGA 1XCTL 3TJPA 1SJED 2Z1CA 1LTTD 3STBC 2HE7A 2J52A 4F88A 1EIHA 2MA9B 3K5LA 2JF5A 5GQOA 2K1FA 1EQTA 1IL2A 2RSUA 3CU7A 3A4SC 2KWDA 2LFIA 3MVVA 3VYSA 2JEBI 3CCJA 4EQNA 1G91A 2KKCA 3SK6A 2L05A 1EWIA 3DVNU 2B2UA 4PZ7A 2DY7A 2OTLA 5I9OA 2A8VA 3AN1A 1SBBB 2K6AA 4GOPC 2IY0B 4LFBQ 2KDEB 3S16H 3CCQA 3SXHA 2MBOA 4KY5A 2IHFA 4EZLA 5IGCA 1O7YA 1VQMA 1IBXA 2CH4A 1A8VA 3MWYW 4KKTA 4A3DH 1ZDVA 4E74A 4HCEA 4DV0L 2N88A 3TN2A 4A3FH 1QILA 4QMGA 1GXDC 2V4IB 4MZ9A 4MT5A 2RMMA 1VR9A 3DWGC 3QQ8B 4IOCA 4DHJD 4A3LH 1PRTC 2IX1A 1PTOH 5C6AA 3NUHB 2K05A 1O7IA 1N34L 4B95A 1K8AC 3U9SA 1PGBA 3KUZA 4WAFA 5BR8Q 3N1YC 2K28A 1XXGA 3GO5A 1V1PB 1WE7A 1IHZA 1GUAB 1C8CA 3GQBA 4KJNA 1WR1A 2BKFA 2KDBA 3N32A 4FN2A 1IYFA 1F2ZA 1Y8RC 4AYBE 2VZKB 2FFKB 2PNHA 4G11A 4A3EG 1VQEA 3P2BA 4YTNB 1JJ2A 4LF6L 1TQOA 2O4XA 3RNUA 5C44G 2HT1A 3AEGB 2P5ZX 5C1ZA 4QIWE 3A0JA 1PH2A 1U0LA 5KGUA 4X3TA 1J8IA 5BO4B 4C3JB 4BY1G 1TYGB 4WWNA 1YOVB 2DGYA 3IT4B 2NWGA 4KD3A 1J7AA 3CHBD 1SIJA 2MGSA 1FMAD 1F2MA 3W1SC 1J19A 2B63H 1V5OA 3X0WA 4DV5L 3KYHC 2UYZB 4JL9A 3ECIA 1M8AA 3M4PA 3MJWA 1CK1A 4LW1A 3I8ZA 5AUIA 3MFGA 1LXDA 1D5ZC 2JJQA 3AXCA 1S5BD 4B3RL 2AKWB 4KHZA 1QCBD 2F0GA 3GS2A 3G7LA 2KFKB 4IM0A 1ESFA 3IT6B 5DPWA 1O80A 4HVBA 2PTLA 1RM6C 3V6EB 2CU3A 2N9EB 5CHWA 4L5QA 4S3SA 5TR5A 1KAAA 2GA4B 5HFYA 1LT5D 3A54A 5DPRA 1TWFB 4L8JA 4C1NI 1O7LA 1YBYA 5M3MB 4BBSH 4RCNA 4GKKL 1B50A 1W6JA 4DV7Q 2KLGA 1N36L 3U58A 1Q1OA 3SK8A 2F0JA 1VQIA 1M94A 2UWQA 2A5UA 1N5WA 3S17B 3B6YA 1TS5A 4JOIA 4PNYA 4CKEA 3CPWA 5EAYA 3KH0A 4RNAA 1WXMA 4HEDA 2K5NA 3RN5A 4KIKB 4BXXG 1CZWA 3RZFA 3TEWA 2UU9Q 1JICA 3RT3B 2JA8B 1TWAB 2EKIA 4K6LA 1SAPA 1EZ6A 3PO2B 4K7UA 2EQSA 3DM3A 4A3KG 3HOWB 5TSSA 4JI3L 5CORA 2K0PA 2MP1A 5G3LD 4MSQB 2K5VA 2AYOB 3BDLA 3A9KB 2JRHA 2KEDA 3EFXD 5CR3A 4B9KA 4LF9Q 1NVID 2EY1A 2HIXA 2DZJA 1U4AA 1ET9A 2AWOA 2SEBD 5CV6A 1DONA 4KJOA 1LACA 3QOJA 2BKRB 3ZTDA 1N61A 1C0AA 1IBKQ 1V1OA 1NYQA 5D65A 3ZJYC 4C3HH 4K0KL 4GDLB 2ZT9C 2NYZD 2ZEQA 1A63A 3HOYB 5C3EB 4RA8A 4ZKBB 1HEZE 5LMNQ 1V80A 4OW0A 1KXLA 3I7FA 2PE6B 4PS3A 5BMGA 2V9HA 4BZAA 3BDCA 2CKHB 1GB4A 2RCFA 3J7AV 2KMMA 3ZNID 2BS3B 3V60A 2YTYA 2L0FA 3UDXA 1SNCA 4M02A 4K8IA 3DWMA 1E8XA 4LFBL 2KFJA 3ZNZB 3IFTA 3HOVG 1EY9A 2XRQD 1WCMH 4OELB 1BCPC 1KHIA 1V1PA 3S1NH 1CQFA 4AP4C 3AULA 2L9HA 3WOEA 3F8TA 1R9TB 5EE9A 1W3SA 2K01A 4IQZA 4P72A 1KC8C 1X54A 1B2TA 1S5FD 3PREA 2L8JA 4OGQC 3GTQB 2ASQA 2SAKA 2MP2B 4R1JA 3NY5A 1II3A 3AYHB 4JI7Q 2VRRB 3ZTCA 3OSOA 3I4NB 2ZTEA 4A3DG 4XC2A 1WD1A 3W2DA 4ACFA 5CV8A 5BR8L 3VUYA 2B2VA 4A3FG 2C5CA 5HGQA 3KWVA 1N60A 1ZKOA 3CCUA 4HJ5A 4WJOA 4A3LG 2KN4A 4L63B 3HKZG 4BVUC 1F9RA 2EYPA 2SDFA 1R4QB 3NTKA 2PCFB 1O7ZA 1HNZL 2Q2TA 2F0DA 2PE9A 4G3XB 1DJRD 1S4ZA 5KYLA 3K59A 1WD0A 3NELA 4YIJA 3X23A 2F4IA 2K9XA 2ALYB 5IOCA 4W9EA 5KNCA 1S5CD 2KX3A 3J9CA 4IW0A 4NMZA 2BH2A 1C77A 5CTRC 5LL6X 2W3SA 1TTNA 1CFMA 1WTPA 2AUKA 4FF1A 2JSOA 2PMZE 3NXWA 2ES2A 3NZSA 3J81L 4XWWA 4DAMA 4JI6Q 3GTOH 2OQKA 1IZ6A 3N3KB 2XWBB 5T1IA 1R9TH 2F0WA 4MN3A 1DGJA 4X66Q 3J81E 3L16A 3PIPA 4DR6Q 3QG1A 2B63G 3CRLC 4HJGE 3T3NA 3MC8A 3ZGZA 4KN4C 2XVSA 3C46A 5EBCA 3AEFB 1B4OA 4KIKA 1XPUA 1NJIC 1VS0A 3IVFA 2G5DA 1JWMD 1XTCD 4DNTB 1LYLA 2VB3X 5G3LF 1JALA 2HQLA 2IDYA 2NR2A 1SMYC 5KNBA 2QDFA 5IOIA 1EIFA 1LTAD 2KLCA 4FNFA 4FULA 3DDCB 2N9KA 2WB1B 4F1SA 3MXUA 4DV7L 2E2IH 2G4SA 3PGEA 2JN4A 2NBWB 4BKSA 1VLBA 4JWSC 2EYHA 4IDIA 4FJZA 3I55A 4A20A 5IA7A 3CRKC 1SGHA 2B76B 2EDGA 4LFCQ 4BBSG 4FVMA 3PIP3 1NI2A 3DM1A 5C3WA 3I2ZA 3U2SC 3TEZA 1H9JA 4OVVA 3DVNV 1Z7TA 4A3GH 5EBDA 2LEKA 1MJCA 3AFPA 4FDBA 3K7AB 3OJ3A 5COYA 2ZCCA 4US8A 4HIMA 1X3PA 1ZKHA 2KJHB 4KLKA 2ON8A 2PI2A 1AN8A 4LF9L 2N7DA 2F0OA 3M9BA 2H88B 2ZW1A 1VQAA 2RGFA 3S1MH 1Q10A 5FLMH 3K0XA 4A3JH 2JZZA 4AH6A 2YTVA 1IBKL 4MACA 1SNDA 1N8RC 1U4PA 2QILA 3HEJA 2Q8IB 1UE5A 1EF5A 3AM9A 4S0RA 4JI1Q 5JVH3 2L11A 2R7ZG 5LMNL 3QO2A 3BK2A 1QUQB 2N3SA 1H4RA 3H3VC 2MBQA 4JVZA 3K81C 1XMOQ 3Q3MC 2NB0A 2MHJA 2N7JA 3AB5A 5JHBA 4EX5A 5EJWA 1NMFA 2INNE 3RUZA 1B1ZA 4C3HG 3NK9A 1SIFA 1SEBD 4L1BA 4ZOHC 2BYFA 4EEWA 3AFQA 2KDFB 3S2HH 5DCNA 1YJ1A 2MP2A 2KJXA 2A5HA 3D4WA 1FIQA 5DLQE 3MP9A 4H7BA 1XD3B 3K7AH 2FCNA 4QQBX 1R4NB 2IO3B 3M4OH 1GJZA 3DEOA 3CF5A 2WAQB 1K52A 2EY2A 4TUUA 5H92C 3TL5A 5K5PA 2H89B 5C0XH 3SK5A 4EOYA 3KYDD 3MTNB 4BKTA 1DZ1A 3H7PB 1CTMA 3T1HQ 3B2GA 1WJ6A 3DHQA 3AU5A 3CMMB 4RF1A 4TKNA 4H0LC 5BYQA 3V96A 2BS4B 3GTMH 3DWPA 2LJIA 1WCMG 4JI7L 4FF3A 2Z0DB 4IM2A 2B3AA 4MIUA 2MJ3A 1GUWA 4RHSA 1N63A 2LGXA 2YEPF 4J3OD 2QDLA 1CJEA 4DV1Q 1H9SA 4LNOA 3ZDMC 3T1YQ 4QL5A 1SYCA 1PXUA 2EKEC 1ESRA 3NVVA 1SYDA 4J6HA 1F9SA 1PDQA 4A93H 1GUGA 1U9RA 4KVGB 4AYBG 1I94L 3AEEB 1I3QH 5HY6A 2UUCQ 1K83B 3Q69A 1KABA 2L52A 2EZVA 1JE4A 1L0WA 1VMCA 3NWTA 3L13A 2LGIA 1Z5SB 1VQJA 5GXGB 2F52A 3WOFA 2A1AA 2AQ2B 5IGDA 2KAJA 1P16A 4NXMQ 2NVQB 1WZ3A 5G5GA 4EFOA 5M5WB 4JI6L 1MG8A 4LCDE 3PLVA 3PZ7A 1PH7A 1N5XA 4EVOA 2EJGC 1YMHE 4RGMA 3U50C 3HOZB 4X66L 3PUYA 4H13C 4KY6A 4DR6L 2CJNA 3I72A 1WTWA 4A3IH 3S2DB 1L5PA 2KACA 2ZPNA 2LXKA 3NS1A 1TIFA 2R92H 5I4DA 3NOBA 2RSNA 1TJEA 5MPOA 3T51B 4LDTB 3VHTC 3SE0A 2PQAB 4F7XA 5CV4A 1L6UA 1STNA 4N9TA 2KQ7A 2HD5B 2LVPA 4MH0E 1BDOA 2XK5B 5CHVC 1V49A 2BOSA 3VRBB 3UI2A 4DV4Q 2IL8A 1KAWA 1XWEA 3VTUA 1SE3A 3I57A 5IKCM 4J1MA 3GE8C 1RYJA 4GDKB 2DAJA 2INPE 4HJ8A 3A7AB 2IGDA 5CX3A 3EGRA 2ZXOA 2RR9A 5ELNA 2KQ3A 4I6PA 1L0YB 2KBNA 4JI4Q 4IJHA 3HM3A 3ZRFA 1QUQA 1WFQA 2BYEA 3NJTA 4WWPA 3SR1A 2BQQA 1PV4A 4A3GG 2W9NA 4JI0Q 1SSOA 3TDQA 3UI3A 4HTHA 2QEJC 4IURA 2L0TA 2LMCA 4OHJA 4U673 1STBA 1IGDA 5ELCA 3A7LA 1I4PA 3CAMA 5M5YB 2JA6B 4JI1L 1VQ6A 3HOUB 1QOBA 3A9JB 2OHFA 2NVXB 3ZXVA 4FO2A 1LQBA 5C2TB 2EIFA 3ND9A 4ZRZA 2L3ZA 5FLMG 4A3JG 1XMOL 2RDBC 3ZRCA 4XDXA 1PRTF 1MKHA 1LTLA 1IBLQ 4F7ZA 4OWWB 1K28A 1XNQQ 2KYWA 1FGBD 3DQVA 4ZRJA 2O6VD 4LFAL 1U4LA 1NEKB 5KHOA 3AU4A 2HTME 1SFOH 2JU6X 3KQ4A 1WZ0A 1QOHA 4KN7C 1F0ZA 2CVRA 2EY5A 1A62A 3PF4A 2M9VA 2ZXPA 1AARA 2E2DC 2K6QA 2KJRA 3V05A 2D62A 2DNEA 2KX0A 2F0NA 4MGYE 3K58A 1SRUA 1L7YA 4OIKA 3GTJB 3WCQA 1WJ4A 1KDAA 1K73C 5AEKB 2VZAA 3H3VH 1SB3C 4MGIE 2L55A 4YCWA 1PH8A 1MJDA 4X6AH 4POFA 2MO1A 2KEEA 1FNWA 2XNAC 2E5LQ 5CHFA 3U52E 3VTWA 3W9CB 3TMEA 3K57A 1EY7A 4OL7A 2DHZA 1PYWD 3G4SA 4ZDVA 2F1MA 3EHVA 5C0XG 2ZJPA 3VR9B 2DYMA 3IAS1 2TMPA 1I4QA 4DV1L 4AQYL 2ICEC 4CBVA 3T1YL 3I3TB 1JWBD 1D1IA 1OXUA 5ELFA 2FBWB 5IYBH 3RN9C 2DZMA 2C7HA 2R93H 2INCC 2UUCL 4KSLC 3SHQA 3ZVVA 3N9YC 3ENEA 4ANXA 5LNK1 1PFMA 3B9JA 4ALPA 1ZYRC 2SNSA 4LF8Q 1EO6A 3OMGA 2WXGA 1FM0D 4BBNC 2RF4A 1G2SA 1UGMA 3UDFA 1WE6A 2IO1B 3AEBB 3PV1A 1I50H 3ZXRA 4EZKA 1KLUD 4A93G 2RHQB 4K8JA 1GHKA 4GLVB 1X6OA 4NXML 4W9FA 1LM8B 3KF6A 2EYJA 3H94A 2OCEA 2DUDA 3LNNA 3ONSA 1VQHA 2UXDQ 3CC2A 4QJFA 1L4ZB 2KQ4X 2IHEA 1EF1A 1DCZA 5T1GA 1C4PA 4A6QA 2D5GA 4XX5A 5IWAQ 4MGZE 4QB4A 5EE0A 1S5DD 2Z6KC 3E56A 5CC4A 4D2KA 3HOXH 3RLNA 1HNWQ 1YNJD 4K5XA 5C44B 4B3SQ 1WTHA 4WJ3M 4GDKA 4V190 4GNXC 1PQSA 3N1XC 3R7RA 3FPPA 1SYEA 4BY1B 3J80E 3LXFA 4MGKE 2DY8A 4A3IG 3T56B 2REXA 2B8GA 1XEEA 1NY4A 4YTMB 1J7BA 1Y1VH 2D0PA 3CSTA 2R92G 4DV4L 4IFDJ 4C1NK 4A3OA 1RHPA 4XQNA 2CS4A 2I38A 1STEA 2MO0A 3BDOA 3IAM1 3OWFA 4JW0A 4LNFA 2A68D 2I5MX 3PO3H 4Q0FA 1V9PA 1KRTA 4FHJA 4A8XC 2KA7A 3TBIB 1Y14B 2UUAQ 3MC9A 2AQ1B 4L5TA 1CKOA 1GNUA 1QQRA 4OZCA 4DHZB 1KDBA 2LVOA 3EFUA 2IX3A 2M56B 3J7AF 1FXTB 1R4NI 4JI4L 3A9JA 3ALBA 2Y0SB 3OMCA 4POGA 3L9AX 1I6VC 4UHVA 5AZGA 4OO1G 5K36H 1UGJA 3JC66 1HNXL 1AFPA 5E4XA 4M1UB 2ZW0A 4HKQA 3Q3NC 3VQIA 3L08A 4A3EH 2HDLA 4KDIC 1QOFA 2B2WC 1E7UA 3K7UC 2FJ2A 4LDTD 1LTBD 4RWSC 3SGIA 1T6BX 1GUTA 1L1OA 3S1RB 3S15H 4IG7B 1K0RA 1PZJD 3BK1A 3HKZE 4FADA 1BF4A 2YTXA 3MHZA 3RD4A 3R8BA 1Y1WH 2NVYB 4ZCKA 3U9OA 5CBAE 1Q8KA 2K8CA 2GBKA 4A3KB 1T0SC 3H0GG 1Q5WB 1YN4A 2IYDB 1B70B 3S24A 3ZYYX 1IBLL 3GTLB 1E7VA 1OXSC 2DENB 3DBHB 4NJ6A 1K0SA 1IKLA 2F0QA 3R93A 1V86A 1WX9A 2ACZB 5M3FH 1TIID 5EE1A 4YSYB 2PYKA 4FXDA 2NZHA 2YV5A 1FPYA 1F2LA 1CT1D 2E74C 5C5MA 4CO7A 4CKBA 2JA7H 2JA9A 4LTUA 2UXBL 4XWTA 1JQYD 3NSWA 3E9IA 1V5TA 2JQOA 2M19A 2MRPA 4W9GA 2ZPYA 4II2B 1XLQA 2VUMG 1BT0A 1V9JA 2E5LL 1XMQQ 4HROA 5EKKA 3C1FA 4FP5D 1RCVD 3LGJA 3BS1A 3RZDH 2CHXA 3KW5B 1VQGA 4YTPB 1MHWC 3MXPA 4Q2JA 1VQNA 1EQVA 1LTGD 1E10A 1U4MA 4QY7A 2WDRB 4QF4A 3FPUB 3KUCB 3J80c 4JI2Q 2DYOA
chains in the Genus database with same CATH topology
2VXWA 4K5WA 2FINB 5DAUA 5DNFA 1FXIA 1PFBA 2O2LD 2X6LA 1MPEA 2WP9B 5FLXL 1VZ7A 5E6JA 4IUUA 3S16B 2WXMA 2IWHA 4K5VA 1JCKB 5FLXE 3PV0A 2BA0A 4RGOS 1D5MC 4A3DB 3FEWX 1YJJA 2WDQB 2QIEB 4A3FB 4N6EB 2A73B 3BG3A 3V2TA 2K5DA 3AE7B 2IW3A 4XT3B 3HKZB 1PTOB 2W3RA 4IUQA 1K51A 2G1EA 4HCSA 3VYTA 2RBMA 4V0BA 1WVLA 4DN4M 1L6VA 2FE8A 1BMLC 3OIQA 1FCLA 2Z4HA 4WRDA 3AMUA 2EELA 1IYVA 4XDDA 4P16A 3AH7A 1JR0D 4EQOA 3AE2B 2K03A 1RD9D 4P2CB 3H91A 2XN9C 3A8JE 1QLBB 3P4QB 2PVOD 2H4OA 2B63B 2VB2X 1Y69U 2LKVA 2B2TC 3NBIA 3T16A 3URYA 1EY6A 2F0KA 1AP0A 3EROA 2V3NA 2MUYA 4NKLA 1EYDA 5K36G 1VZ8A 2JX5A 5HI1A 4RGNA 4BBSB 4HMIA 2HQEA 1VZ6A 1SNQA 4KY7A 1EEFD 2PVGC 3SFEB 1GJXA 5EQ0A 1EY4A 3HGBA 2IGHA 3MAQA 1TKGA 2O5JC 2A6HD 3E0JA 1Z6HA 1MI2A 3NWSA 1N62A 1YJIA 2K04A 2CQAA 2WDVB 5FO7B 3P42A 3TP8A 2B2YA 2A74C 2PO4A 1VJKA 1EL0A 4C3HB 1JROA 1HZ5A 4CJ1B 4R9WA 1IW7D 4I65A 4IOIE 3VR4A 1ZXHA 1QWYA 2NN6H 3TEYA 2Y5CA 1WGKA 3P7JA 1F9QA 3Q6SA 1QKZA 2WQYB 3HVZA 1SE2A 3Q8EA 1VDZA 4TKOB 1TU2B 4M8AA 1WCMB 3L7ZC 4CJ0B 3S1NB 1LTID 4K2LA 2JQRB 5NUCA 4C3IG 4BS9A 2AUJD 4KGRA 1B44D 3DMUA 1MSHA 3GB1A 2F3VA 4AYBB 4DK0A 2MJ8A 3VA7A 1ENAA 1WTRA 1TVXA 4QIWB 2BW2A 4CQNA 1YQ3B 2HCIA 2F0PA 4BA2I 3M7GA 1F2RI 5FO9B 2O5IC 1LV9A 4ZYSA 2C9OA 2MEKA 3V3XA 3L3OC 1HA6A 4KKJA 1RWSA 4YSZB 4A90A 2PW5A 2SNMA 4QUFA 4A55A 2HCCA 1E2ZA 4DNRB 2W82A 3GTOB 2BYTA 5JPNC 1D5XC 2PQEA 1ENCA 2X38A 5CV9A 1XYIA 1QG7A 2WXOA 3PUWA 1XLPA 3RLFA 4RH6A 2F0EA 3F2UA 2BE5C 1CI3M 1STHA 4HEA1 3I70A 4U68A 4WH4A 4XDCA 4C7ZA 3DWQA 3NTIA 2E2IB 2Q8TA 1ZXIA 5FKAC 3CWIA 2EYMA 3Q8AA 3L4PA 3VR2A 3H6MA 4M0WA 4X3SA 2JZPA 4QCLA 4A3GB 1LLRD 1H9SB 2RPVA 4KHVA 4N9PA 1Y56A 2F0VA 1VF5C 4JK1C 3S1MB 1O78A 4ZKCB 4A3JB 1EYAA 4JBWA 1YNJC 4RHRA 1UNSA 3P4RB 1SDFA 5HURA 5FK9C 1YN3A 3NTHA 2VZKD 5AFWA 4RGTA 2MJDA 3FAHA 1SYBA 4O1NA 3NVYA 3AE8B 2A68C 3S2HB 4RAUC 3IAYA 1VMPA 5KIXA 2F0UA 1B3AA 4REZA 1MGSA 1QF6A 3M4OB 3AECB 2HDMA 2NN6G 1KH0A 4TQ0A 1DXMA 3R2TA 1A3VA 4G4KA 3DUZA 3NQIA 3GTMB 3MZ5A 2QF7A 3N52A 1EWHA 1BCPB 1KNEA 4NAWB 3AEAB 1A2UA 2K33A 1E6EB 4A93B 5I9PA 1JRPA 2A6ED 3SVMA 1PDXA 1I3QB 4GZYC 2L1AA 2EJFC 2XSCA 2ZXRA 2LMCB 2PMZB 1JWAD 1IKMA 2WXHA 2QKIC 4KV6A 4ARIA 3W1SA 4ZUJA 2E76C 3DXJC 2PNRC 2RKSA 3SEBA 2AX5A 2J0TD 1JORA 1ROEA 2L12A 3X3MA 2N0SB 4A3IB 1HUNA 1TT2A 2R92B 2G9HD 2EXZA 1EY5A 1JOKA 3D3RA 4IUNA 3VYRA 4FF2A 5D3DA 2EYOA 4Z9CB 3KLSA 1LABA 3IL8A 1AWDA 2F0FA 1GHJA 1V43A 2FUG1 1A2TA 1QT9A 1WRIA 5JXVA 2MH7A 2F0LA 2NBFA 1GUNA 5BYSA 1NUCA 3Q8BA 1P7EA 2JEAI 1I4RA 3QB3A 2OXPA 1Z47A 3OOCA 1PLFA 4DXFA 3SDZA 2I07B 1EIGA 2TSSA 2B39A 2NMQA 5IT9L 1ZDXA 1C78A 3D4RA 5DM63 1JWUD 2F3WA 4DK1A 1V8CA 4NAMA 2K32A 1MHHE 1JB3A 2A69D 3OWEB 1NSNS 4PMWA 1DOMA 4OO1H 4FXKC 4ULLA 1Q1BA 1SFOB 2PIAA 4KX6B 3IXSA 2BB5A 4XQJA 1I4XA 1UWXA 4EGVA 3W3AA 1VRAB 4PMCA 3EVQA 3HRZC 2K5QA 5FR3A 1EFID 2EE1A 2PPBC 1Y8OB 3BVGA 4DFAA 1YN5A 1JW9D 1CA5A 1RFKA 1NYRA 2J7ZA 1U4RA 2R93B 4N58A 5KRUA 3KF8A 4G7ZC 1STAA 2FMMA 1I50B 1GOZA 2DWQA 4JE3B 5JEAJ 4FYDA 2PW7A 4MH8A 1QOGA 5EPLA 1BQQT 2K5WA 4EE2A 1ONLA 1DD2A 2GI9A 1C48A 2B2UC 1WTOA 1FXAA 4J8QA 1J9OA 1EEID 2WIIB 3HOXB 2LY7A 2QMTA 5A35A 4XYOA 4PT5A 2Q8RE 3T4AC 1AEXA 1DOKA 3BWUD 1W6KA 1UWMA 3BYYB 4AQ7A 1Y1VB 1IW7C 1UUPA 1Y8NB 4B9WA 4US9A 1C9FA 5BN4A 2L32A 4IFDH 3PO3B 1HPCA 4FXGC 5IGBA 5IIFA 1RODA 4HSPA 1ILPA 1FR3A 3FC4A 2B8FA 3HP3A 5AUKA 2RSOA 3NPPA 1CZGA 3FDTA 5C0XI 2WKDA 1TZOA 1GUSA 3K5NA 5EKIA 1XCQL 1IUEA 5BMIA 4A3EB 1PZID 3KK7A 2EY6A 4C7YA 3I90A 3PZ8A 1DOYA 3S15B 1G291 2XWJB 3X3NA 1FEHA 1Y1WB 2RA4A 3P75A 4B0MA 2RDFA 3FRPB 5KEEA 1TY2A 4QUCA 5JPMC 1BNZA 4F87A 3TP7A 2IPKD 1C76A 5M3FB 3K6OA 4KGSA 2RDGA 5I2XA 1ILQA 2WXRA 1ZEQX 2AWNA 2JA7B 2BBCA 4K6DA 1EZ8A 1OQRA 4E6IA 3O13A 1HA5A 3JAML 2L5TA 2GB1A 1YNND 3PUXA 2Y5PA 1WTXA 3EJIA 2L83A 2F0SA 2I2YA 3RZDB 2W54A 3LB8C 3HZXA 5JEAG 1ML0D 5BMHA 3NVZA 1FD6A 3C2PA 4ZK9B 1K50A 4IZ8A 1SYFA 1ZUD2 1T5EA 1EYCA 4DA2A 2K5PA 3KLSX 3K5OA 1QJOA 1JOQA 4USAA 4IUTA 1R4PB 5ELEA 1AZPA 4NZLB 1CA6A 1EWCA 1NR4A 4RKLA 4C3IB 4B9XA 4RKBA 4TSSA 1X3QA 2E6XA 3ZJVA 4KD4A 1M4VA 1SYGA 1TWHB 1RDPD 3Q23A 2AQ3B 4G7OC 4BWGB 2MPMA 3ERQA 1F2YA 1PFNA 4DU9A 2N55A 2WU5B 3HOVB 4OZAA 3MFYA 3TEXA 1G8ZD 5DEHA 2BCOA 1VDVA 5E1FA 5JOBA 2IX0A 4A3MB 2B2VC 5EPKA 1BBXC 4ZRQA 3AU7A 3CIRB 2JXMB 1KRHA 2JP1A 2WNMA 2SOBA 4WJWA 1BUIC 4UDUC 4IFDG 3VR8B 2LS01 1I7HA 3QIAA 1HUMA 2FMCA 2KVMA 3VYUA 3ZQ4A 3OIPA 2ONQA 4IKGA 5DM73 3A8IE 4TQ1A 1STGA 4NP5A 4G7HC 3GD7A 5CBEE 1OFFA 3M4YA 1MI0A 2WXPA 1PMRA 3OPOA 5ELBA 2JYOA 1EY0A 4XT1B 2A6EC 3CQZB 3TSSA 1ZP0B 2DLBA 2KHSA 4CHTB 2G9DA 2F0HA 3H09A 4NW2A 2KOLA 4LMQD 5FOBB 2PZUA 4LLGM 1FD7D 3I3CA 3P4SB 5LHY1 3IKJA 1SNMA 1SF0A 1T3QA 2WU2B 2JYEA 2V3PA 3AE6B 2BTEA 4WQMA 1SJHD 1ICWA 4XXEA 5BYRA 4WWMA 5IGEA 5J39A 5G5HA 1FYCA 2XIWA 2CJOA 5CMDA 3D31A 2YEPB 4ZAIA 4Q5VA 3D4DA 4KKIA 4ID6A 2EVBA 3FILA 1C4AA 4Y7NB 2N9LA 1LTRD 4X3KA 2K3UA 3MXGA 3GTPB 1F77A 1WXQA 3AV8A 3P4PB 4CKCA 1QNUA 3U4EG 1SNPA 2IJ0A 3N6RA 1TS2A 2K1BA 3I9V1 4YSXB 1E2VA 1WTQA 3VR6A 1K8OA 1PUTA 1CQVA 3Q8FA 4RF0A 2R7ZB 3TP6A 3MJ5A 3R2IA 3GV6A 2F0TA 3VA5A 1ACCA 1GB1A 5KYIA 1BXTA 1OXXK 2MHVA 3RMHA 3H8HA 1WTVA 5I6YA 4HR7B 2ID0A 1TWCB 1LT4D 2ENBA 2CHBD 1L0VB 2A69C 4TQUS 4FF4A 3DWAA 5C3XA 3NBHA 3TP5A 2WINB 3BZDB 1R7SA 1Q12A 3OW7A 4TMAB 2JSVX 2WS3B 1GUOA 3C8YA 1XO3A 2OEDA 3D8GA 1A3UA 1Q1EA 4XE0A 4PQXA 1FRRA 2IGGA 4ME5A 4UAIA 1ZYRD 1MSGA 5BN3A 2RQXA 4ARCA 2KECA 1I4GA 1FCCC 4XYQA 1NR2A 2PW9A 2V4DA 2WXLA 2B2WA 2WACA 2OT2A 5LL6S 4G57A 1GPXA 3P1MA 3AE3B 1HHVA 1H9KA 1HFGA 3MEHA 2YYZA 2Z4IA 4LAAA 1PRTB 3ETRA 4B08A 3P20A 3LWEA 2HUGA 3GP7A 3EA6A 2OEOA 3MC0B 1DM0B 2M0AA 2H1EA 4RCOA 1PTOD 4ITKA 1RF2D 3I91A 3D6CA 3PUVA 2WLBA 4N59A 1K53A 4HKZE 1HRJA 2E3TA 3Q24A 1IYUA 1PFDA 2WXQA 2XRSD 5F2DA 3HUIA 2FHTA 2KDMA 1BUVT 1T5XD 4XIGS 4JX1C 3MHBA 3A56A 1JOOA 1STYA 4AS1A 4ZRPA 1XLNA 4I7ZC 3NQTA 3ABVB 4C2MB 1SE4A 5JAVA 1MBYA 2F03A 1VCIA 2LUMA 3Q22A 1CM9A 2BA1A 4XQQA 4JPSA 1J7CA 1JMLA 2NUCA 1H9MA 2QDBA 2PLPA 1IGCA 3NUCA 1ENFA 2JE6I 1XF5L 4OZBA 3AE4B 2EYFA 5EKLA 4GLSC 4JWUC 4H44C 4WURA 1AW7A 3M3YB 1DOLA 3PO0A 1D2BA 3BYTB 1QB5D 1D6EC 2E2JB 4HMJA 4C56C 2CW0D 4BBRB 3MXNA 1HFNA 1LO5D 1YNNC 2B2TA 3OHXC 1KTKA 3S14B 1CHPD 2LHDA 4KTAA 4O42A 2WXIA 1PGAA 2ICIA 4WIPA 1UAPA 1I4HA 1TKWB 2E75C 5C4HA 4ABNA 4CGYB 2L4NA 2GRIA 2BDNA 2NVTB 3KBGA 4LJZC 4L23A 2J53A 4C3JG 1B53A 3KUPA 4B0EA 2KCCA 1PTOF 5JJZA 4ZLTF 2NN6I 4IN3A 1B9MA 4IALA 4R8IA 1WWTA 5ELDA 5CV7A 4IUPA 4OIJA 1LT6D 4LK0M 3ZJTA 3MTSA 3VR3A 1L0XB 3W5UB 3R3OA 5D7GA 1RTNA 3M7NA 1E2WA 5C4JB 3VRAB 1ET6A 2I46A 2PKOA 4L6TB 5HGTA 3K0YA 4X3UA 3C1EA 3GTKB 4RFBA 1QOAA 4LK1C 4ZHOA 1TWGB 3TZDA 2X6GA 4C80A 2EYLA 3E6ZX 3EUB2 3ONAB 1EM7A 3W5VB 1OXTA 2QSDA 3NZ3A 5C5LA 5I2YA 4DAVA 5I6WA 1PRTD 1D1KA 1OO9B 2KCNA 3GV3A 2NTSA 3D6WA 3AMZA 3QOLA 4ZHPA 4CJ2C 3M85A 1I6HB 3S9WA 1A70A 1SNOA 1NAPA 2WXKA 4TRDA 4MM3B 5A2QL 3I73A 4K14A 3H0GB 5CGKA 2DN8A 3NHHA 1AYFA 3BVMA 5A2QE 3RZOB 3NVWA 2NTTA 1DOXA 1TR5A 3QWNA 2WP8J 3A55A 5C0XJ 5FO8B 1WSPA 4DQOC 1FFUA 1BO0A 1KDCA 2M00A 4IUVA 3ITPA 1YQ4B 1E0ZA 1A3TA 5IT9E 1IL8A 4KI0A 1YNTE 3DEPA 1DYQA 1D4BA 3HS0C 2VUMB 4XTCS 1OQQA 3AE5B 1CHQD 1FFVA 3K5MA 1KNAA 5JEAH 1V97A 1JQ4A 2J42A 3WDNA 3AEDB 4NJCA 1AZQA 1F9PA 4L2YA 2R6GA 1LTSD 1TS4A 1SSNA 3GTGB 1B9NA 1TKYA 4BY7B 1C4CA 2EJMA 3LYYA 3TZUA 3T53B 5T8IA 1NCVA 2BB6A 3HG9A 2K7VA 2D9UA 1ZE3D 2DBYA 1NI3A 2E2HB 3SFDB 2A6HC 2HDEA 5C4XB 1Y8PB 1FNVA 1KLGD 1HTPA 1FO4A 2JXTA 3SHLA 3Q0AA 5CV5A 4YWGG 3T13A 3VR5A 2X69A 3G6JB 4KKUA 1EY8A 1CZPA 1GAQB 1UEAB 4F8MA 2PZTA 4MHEA 3KWLA 1XLOA 3AE9B 4R3DA 5EE3A 3QJYA 1BOSA 1BCPD 1F2RC 3ND8A 4WORA 5EGTA 2F0MA 1OXVA 3NE5B 2M2LA 1RTOA 1FRDA 1K8MA 2BE5D 1TS3A 3KLRA 4EQPA 4KMUC 4KGTA 1E0BA 4WFN3 3CKIB 1ZPSA 1HXYD 3FMCA 1XX8A 3MA2B 2PZWA 4KK7A 5CYUA 1LT3D 2BS2B 3S1QB 3P1HA 3LX0A 5IODA 5E4WC 3J7YW 4HAEA 2EPBA 1B9RA 4HRSA 2L0CA 4DAPA 3PIO3 2Q5WD 1SXTA 2B2YC 2L1BA 5D14A 1HQRD 5E3FA 3NRZA 2DNCA 3HRDD 2F0IA 5J1ZA 2RVLA 2EOTA 3J80L 2VNUD 1A6XA 4NDXA 1G2TA 4P6VF 1HQMC 1P7FA 1SMYD 3U7ZA 1RJTA 1NENB 1QE6A 3BVZA 3EQLC 1TY0A 4YXDB 5C4ZA 3JAME 4HSVA 1Q3LA 4R8NA 1PTOC 2KUMA 1VF7A 2V0GA 1V8QA 5J22A 2QCPX 3TUOA 3RFZB 3KBXA 3I4LA 2BDOA 3BIID 4HN7A 1EOTA 4PMBA 2NZ1D 3AB9A 5IGGA 3LWUA 4ODGA 4PV1C 1QNKA 3C3LA 1EWYC 2WXNA 1HTLD 4OVZA 1ZXTA 1KFYB 4OO1I 2J4XA 1DOIA 2YU9B 1A15A 2MJEA 1BCPF 1RKNA 1IBXB 5KNDA 4DAYA 5BN5A 1MHXA 4H2AA 2D5DA 1H9RA 2BT6A 2JWUA 2PMVA 1HZ6A 1KF6B 2WXJA 3FILB 2OF1A 5IGFA 2W55A 3B2FA 4KKSA 4A9AA 5D3IB 3AE1B 4DGZA 3SK4A 2WKCA 2JYTA 1Q90A 1X32A 2JA5B 2QJLA 1JC7A 3PUZA 2WV6D 3T3OA 1HCZA 1MVKA 3I4MB 1G6ZA 5M9OA 5JVG3 2WXFA 5C3JB 1TKEA 2IT1A 4ZUIA 3E9SA 3HVDA 1Q8IA 2CW0C 3SR6A 1MD2D 2R61A 4ILWA 5EPJA 1S5ED 4ZQ3A 4YT0B 4A3BB 1PGXA 1ZOYB 3RPFC 4FXCA 3NP8A 5HG2A 2Z8LA 1EU3A 1FNUA 3E5SA 4K2KA 1C79A 1PZKD 3Q8CA 1EU4A 5M5XB 2D2CC 1WYGA 3P63A 2R3ZA 3FKIB 3PMFA 3A8KE 1JWSD 2LHEA 1E7PB 4DF7A 2Y3AA 4BA1I 4IFDI 3ZJUA 3IFDA 2RDHA 5ISRA 1E9MA 1BR9A 1L4DB 2K22A 1C4QA 3FVQA 2LFNA 4DXGA 1XCTL 1SJED 2Z1CA 1LTTD 2J52A 4F88A 1EIHA 3K5LA 1EQTA 3CU7A 2KWDA 2LFIA 3MVVA 3VYSA 2JEBI 5H8YE 4EQNA 1G91A 3SK6A 2B2UA 2DY7A 5I9OA 3AN1A 1SBBB 2K6AA 3SXHA 4KY5A 5IGCA 1O7YA 1IBXA 3MWYW 4KKTA 1ZDVA 4HCEA 2N88A 3TN2A 1QILA 4QMGA 1GXDC 2V4IB 4MT5A 2RMMA 1VR9A 3DWGC 1PRTC 2IX1A 1PTOH 5C6AA 3NUHB 2K05A 3U9SA 1PGBA 4WAFA 2K28A 1XXGA 3GO5A 1V1PB 1IHZA 1C8CA 3GQBA 4KJNA 1F2ZA 2VZKB 2FFKB 4YTNB 1TQOA 2O4XA 3AEGB 5KGUA 1J8IA 4X3TA 4C3JB 1TYGB 3IT4B 2NWGA 4KD3A 1J7AA 3CHBD 1SIJA 2MGSA 1FMAD 1F2MA 1M8AA 1CK1A 3I8ZA 5AUIA 3MFGA 1D5ZC 1S5BD 4KHZA 1QCBD 2F0GA 3GS2A 3G7LA 1ESFA 3IT6B 1O80A 2PTLA 1RM6C 2CU3A 4S3SA 1KAAA 2GA4B 5HFYA 1LT5D 3A54A 1TWFB 4L8JA 4C1NI 1O7LA 5M3MB 4RCNA 1B50A 1W6JA 3SK8A 2F0JA 1N5WA 3S17B 1TS5A 4PNYA 4CKEA 4RNAA 4HEDA 3TEWA 1CZWA 1JICA 2JA8B 1TWAB 2EKIA 4K6LA 1SAPA 1EZ6A 3PO2B 3HOWB 5TSSA 5CORA 2K0PA 2MP1A 5G3LD 3BDLA 2KEDA 3EFXD 5CR3A 1NVID 2EY1A 1ET9A 2AWOA 2SEBD 5CV6A 1DONA 4KJOA 1LACA 3QOJA 1N61A 1V1OA 1NYQA 5D65A 4GDLB 2ZT9C 2NYZD 3HOYB 5C3EB 4RA8A 4ZKBB 1HEZE 4OW0A 5BMGA 3BDCA 1GB4A 3J7AV 2KMMA 2BS3B 1SNCA 4K8IA 3DWMA 3IFTA 1EY9A 2XRQD 1BCPC 1V1PA 1CQFA 2L9HA 3WOEA 1R9TB 5EE9A 2K01A 4IQZA 1B2TA 1S5FD 4OGQC 3GTQB 2SAKA 1II3A 3OSOA 3I4NB 1WD1A 3W2DA 5CV8A 2B2VA 2C5CA 3KWVA 1N60A 1ZKOA 2KN4A 4L63B 1F9RA 2EYPA 2SDFA 1R4QB 2PCFB 3NTKA 1O7ZA 2F0DA 1DJRD 1S4ZA 5KYLA 3K59A 1WD0A 4YIJA 2F4IA 2K9XA 5IOCA 5KNCA 1S5CD 3J9CA 4NMZA 1C77A 5LL6X 2W3SA 1CFMA 1WTPA 2AUKA 4FF1A 2JSOA 3NXWA 3J81L 4XWWA 2XWBB 5T1IA 1DGJA 2F0WA 4MN3A 3J81E 3QG1A 3CRLC 4HJGE 3T3NA 3ZGZA 4KN4C 2XVSA 3C46A 5EBCA 3AEFB 1B4OA 1JWMD 1XTCD 4DNTB 2VB3X 5G3LF 1JALA 2IDYA 1SMYC 5KNBA 1LTAD 4FNFA 2N9KA 2WB1B 3MXUA 1VLBA 4JWSC 2EYHA 4IDIA 3CRKC 2B76B 2EDGA 4FVMA 3PIP3 3DM1A 5C3WA 3U2SC 3TEZA 1H9JA 1Z7TA 5EBDA 2LEKA 3K7AB 5COYA 4US8A 1X3PA 2ON8A 1AN8A 2F0OA 2H88B 2ZW1A 1Q10A 4MACA 1SNDA 1U4PA 2QILA 3HEJA 2Q8IB 3AM9A 5JVH3 2L11A 3QO2A 3BK2A 3H3VC 2NB0A 3AB5A 2N7JA 5EJWA 2INNE 4C3HG 3RUZA 1B1ZA 3NK9A 4ZOHC 1SEBD 4L1BA 2KJXA 2A5HA 3D4WA 1FIQA 3MP9A 4H7BA 3DEOA 1K52A 2WAQB 2EY2A 5H92C 5K5PA 2H89B 5C0XH 3SK5A 1DZ1A 4RF1A 1CTMA 3B2GA 3DHQA 5BYQA 4H0LC 3V96A 2BS4B 3DWPA 2LJIA 4FF3A 4MIUA 2MJ3A 1GUWA 4RHSA 1N63A 2YEPF 4J3OD 1CJEA 1H9SA 1SYCA 1PXUA 1ESRA 3NVVA 1SYDA 4J6HA 1F9SA 1PDQA 1GUGA 1U9RA 3AEEB 1K83B 3Q69A 1KABA 2L52A 2EZVA 1JE4A 1VMCA 3NWTA 2LGIA 5GXGB 3WOFA 2AQ2B 5IGDA 2KAJA 2NVQB 5G5GA 5M5WB 3PZ7A 1N5XA 4EVOA 2EJGC 1YMHE 4RGMA 3HOZB 3PUYA 4H13C 4KY6A 2CJNA 3I72A 1WTWA 1L5PA 3S2DB 2KACA 3NS1A 5I4DA 5MPOA 2RSNA 1TJEA 3T51B 3SE0A 4F7XA 5CV4A 1L6UA 1STNA 4N9TA 1BDOA 2BOSA 3VRBB 3UI2A 2IL8A 1XWEA 1SE3A 3I57A 4J1MA 1RYJA 4GDKB 2INPE 3A7AB 2IGDA 3EGRA 2ZXOA 2KQ3A 1L0YB 3SR1A 1SSOA 3TDQA 3UI3A 4HTHA 2QEJC 4IURA 2LMCA 4OHJA 4U673 1STBA 1IGDA 5ELCA 3A7LA 1I4PA 5M5YB 2JA6B 1QOBA 3HOUB 2OHFA 2NVXB 4FO2A 5C2TB 3ND9A 4ZRZA 4XDXA 1PRTF 1FGBD 1U4LA 1NEKB 2HTME 2JU6X 3KQ4A 1QOHA 4KN7C 1F0ZA 2CVRA 2EY5A 2M9VA 2ZXPA 2E2DC 3V05A 2D62A 2DNEA 2F0NA 3K58A 3WCQA 4OIKA 3GTJB 1KDAA 1SB3C 2L55A 2XNAC 2KEEA 1FNWA 3U52E 3W9CB 3TMEA 3K57A 1EY7A 4OL7A 1PYWD 2F1MA 5C0XG 3VR9B 2DYMA 3IAS1 2TMPA 1I4QA 2ICEC 4CBVA 1JWBD 1D1IA 1OXUA 5ELFA 2FBWB 5LNK1 3N9YC 1PFMA 3B9JA 1ZYRC 2SNSA 3OMGA 2WXGA 1FM0D 1G2SA 3AEBB 1KLUD 4K8JA 1GHKA 2EYJA 3H94A 3LNNA 5HHDG 2KQ4X 1L4ZB 1DCZA 5T1GA 1C4PA 4A6QA 2D5GA 4QB4A 5EE0A 1S5DD 3E56A 5CC4A 4D2KA 1YNJD 4K5XA 5C44B 4V190 3FPPA 1SYEA 4BY1B 3J80E 3LXFA 2DY8A 3T56B 2B8GA 1XEEA 4YTMB 1J7BA 4IFDJ 4C1NK 1RHPA 4XQNA 2I38A 1STEA 3IAM1 3BDOA 3OWFA 2A68D 4Q0FA 4A8XC 2KA7A 3TBIB 4OZCA 2AQ1B 1QQRA 1KDBA 2IX3A 2M56B 3J7AF 2Y0SB 3OMCA 3L9AX 1I6VC 4OO1G