4WJPA

Crystal structure of sumo1 in complex with phosphorylated daxx
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
79
structure length
79
Chain Sequence
GEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYAQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of the Phosphorylation-Dependent Interaction between PML and SUMO1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/signaling protein
molecule keywords Small ubiquitin-related modifier 1
total genus 23
structure length 79
sequence length 79
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4wjpA00
1NBFC 4MJSB 3VH3B 3U8ZA 4PS3A 2MWSB 1FXTB 4IUMB 2CHXA 2O2VA 2R2OA 4OVUA 3VUXA 4A3OA 4DBGA 1WZ3A 5EDSA 1WXMA 2N7EA 4MM3A 3NZUA 3VAWA 1X1MA 1XT9B 2XK5B 2LGXA 4AP4C 2Z0DB 1AARA 2KLCA 3DVNU 3PT2B 4I6NB 3WIMA 3UINB 2BWFA 2O6VB 3NS8A 3K9OB 3SU8X 3VHTC 2KJ6A 4JL9A 2C60A 3DQVA 3VQIA 4OVVA 2WX1A 3M95A 2BGFA 4GB9A 1LXDA 3BINA 2IO3B 5E6PA 2QHOA 2N9PC 2K8BA 2BPSA 2D10A 3CSFA 4RM9A 2IYDB 4HPLB 1RFAA 3HIZA 4LJPB 2KO3A 3ZNGC 3DCGA 2AWTA 1UBIA 3H7PB 3R3MA 4NJ6A 5LXHA 2KX0A 3ZO5B 4FHJA 3GOEA 2N4FA 2KDIA 4KDIC 1KM7A 4KIKB 2N7DA 1WJ4A 4ICUA 3RYTA 1A5RA 2W9NA 3ZTDA 2KANA 1WMHB 1Q1OA 2MBHA 3B1LX 1P1AA 3EFUA 4EZKA 2YVCA 5JZEB 3QJZA 4K1RB 4E71A 4ANXA 1I42A 3V61A 4ZDVA 2KLGA 3DBSA 2GBMA 2JRHA 1WM2A 3R7RA 2BKRB 2GBNA 3U30A 3PSEB 4HCNB 2D07B 4GDLB 2DENB 2DZMA 1WY8A 2KX3A 4EFOA 4YL8A 2NPTA 3VDZA 2UWQA 3EECA 1J8CA 3KW5B 5CHWA 3A9JB 5FR6A 1WGYA 4HJKA 1HE8A 3V62A 4KZCA 5DCNA 5L95C 3UIOB 3A33B 1WMHA 3M3JA 2V1YA 5DPWA 3QK0A 4XZ4A 2WYQA 3V6CB 3W1YA 1OGWA 1S3SG 2ZCBA 1WFYA 3DOWA 1GNUA 2LGYA 2KFKA 3ZLZA 2ZCCA 3PHXB 4IM2A 1WX7A 4MSQB 2CHZA 5IAAC 2NR2A 3DVNV 1OTRB 3QAQA 3DBRI 2M8SA 2JXXA 3QC8B 3T9LA 3V60A 2KVRA 2C7HA 2IO1B 2MP2A 5CHVC 1EF5A 3WAMA 3TMPB 2FCSA 3ML8A 2M0XA 2C7MB 3AU5A 4BOZB 5D7GA 2BYEA 2LXCA 1WYWB 3A9JA 4LCDE 4FLHA 3T8MA 1P3QU 1WX8A 4BKSA 4W9FA 4MEMA 5D94A 2L0FA 1IPGA 4MGYE 4JIOU 3NY5A 2LUEA 1WR1A 1R4NI 4AJWA 1GC7A 2HTHA 2N9XA 4PS8A 2MX2A 4IWPA 2NBUA 2FNJB 2XK5A 1GC6A 3DPDA 2FCNA 1LM8B 1E8XA 3TIXA 2Z0EB 3VFKA 1ZKHA 2ASQA 2PPHA 4FJYA 4W9KA 2GBRA 4NPNA 4GDKB 1IYFA 3M63B 3Q3JA 5C23A 2AYOB 2MP2B 3K9PB 1U4AA 4TV3A 1RLFA 1G6JA 4KVGB 2WX0A 2PJHA 2ZNVC 4LDTD 2CKHB 2JF5A 3VUYA 4GU2A 4ZRKA 3DBHI 4B6WA 3ZNID 2KMCA 3KVFB 1E7VA 4DXAB 4FJZA 1UBQA 2LI5A 2DHZA 1WJ6A 3DBLI 4XX5A 5J18A 4HLEA 2MRPA 3H6NA 2A5UA 1R4MI 2O6VD 2D11A 3HM6X 3CF6E 4PYUA 3H9DA 4ZYNA 1V6EA 2FUHB 5JHAA 3NOBA 2KDBA 4DK5A 2HJ8A 2XBBC 1WM3A 1WXSA 1QZEA 2KQ7A 5AZHA 1J0GA 2KOXA 4BBNC 1KOTA 3AU4A 1YJ1A 3ONSA 2JT4B 1ZW7A 4FJVB 4GMVA 4LDTB 3HM3A 1WZ0A 3CMMB 3APFA 4KZ0A 3VTUA 2CS4A 3OJ4B 3LJ3A 2KWVB 2GOWA 1EUVB 3L10B 1V80A 3ECIA 1I35A 3QHTA 3A1QB 2K8HA 1SE9A 1YX6B 3PGEA 3SHQA 5G2NA 2KQSA 2L0TA 3IVFA 4KDLB 2L8JA 2A4ZA 4HVBA 2C7NB 2JPHA 3PV1A 4G50A 3ZRFA 2RSUA 4GIVA 5AZGA 4HCPB 4X57B 2KTRB 3VTWA 2KMAA 3ZDMC 1KJTA 4W9JA 3AULA 4BOSC 3PLVA 2M1MA 3JYUA 5LXIB 2RGFA 2DX5B 4W9DA 3NZSA 4URKA 3PPAA 4I6PA 2J0JA 4DDID 1J19A 2KWCA 2MLBA 3A4RA 2LVQA 1M94A 1JRUA 2JVCA 4G0NB 4W9GA 3R7QA 3X23A 2AL3A 2HD5B 4N9F4 2MA9B 1C3TA 4NQLB 3ML9A 3VTVA 3I3TB 1L7YA 4GOCA 4KIKA 3L08A 4F7ZA 1Z2MA 1RRBA 2KWUB 1WIAA 5CX3A 3PRMB 2G4SA 2O2VB 3WAPA 1E5WA 2ZEQA 1WGDA 1YX5B 2LD9A 2MBEA 1MG8A 3KUCB 2GMIC 2UYZB 3QX1A 3UQBA 1UZXB 4MJSA 3MTNB 3LDZE 3N32A 4NNJB 3B0AA 3JSVA 3WAOA 3ZDTA 4EZLA 2IZVB 3L16A 2FAZA 1WJUA 1TBEA 3SDLC 2KDEB 5DPTA 3CSTA 2V3SA 2AL6A 5HKHA 1WGHA 2IY0B 4WJNA 4HXDA 2KJRA 1Q0WB 1V81A 3PRZA 4E3CA 1E8WA 4IM0A 4EOYA 2CU1A 1WRDB 3JVZX 3IBEA 4IWQA 4KSLC 1WXAA 4MDKE 1P9DU 2FCMA 3QA8A 4ZRIA 2CR5A 1ISNA 1WE6A 3PREA 5DPSA 2KJHB 2KKCA 4TUUA 3A9KA 1PQSA 2WDTB 5CTRC 3RZFA 2NBWB 1CMXB 2N1WA 4K7UA 3WALA 2HE7A 4ANUA 5JHBA 4EEWA 5J2RA 2M17A 2IBIB 2NBVB 4BKGA 2V4LA 4DHZB 4J6IA 1OQYA 4XC2A 4MSMB 3RZWC 4EZJA 2DZJA 2ZVOA 3WANA 2MW5A 2JY6A 3JSVB 3N30A 3ZNZB 1V2YA 2L00B 4G11A 3JW0X 1TZ1A 3OAWA 1K8RB 1H4RA 1P0RA 1E8YA 4GSWA 3X0WA 3WA0A 4EKUA 2L3ZA 2PE6B 2RR9A 3HHMA 3OLMD 4WJPA 4K7WA 4MELA 5J17A 4WWOA 2JUOA 4IM3A 2Y5BB 3L0WB 2ZPNA 4FULA 3DVGX 3UGBB 1S1QB 4II3B 4FBJB 4M0WB 4MGKE 4TKNA 3KH0A 2KZRA 4LJOB 4WJQA 4JGHB 4GXBA 3RCZA 5KHQA 2KNBA 1NDDA 2MBQA 2NPTB 3SD5A 2LVOA 2KN5A 3VXWA 1L2NA 2BWES 2KHWB 2J0KA 3AXCA 4IG7B 3H7SA 1F9JA 2KFKB 5AZFA 4BKSD 3OJ3A 1GUAB 1ZGUB 4TQ1A 3A9KB 3PVLA 3PLUA 2ZVNA 4NAWB 2KC2A 3BY4B 2BYFA 2MSED 4GDKA 2LASA 2ZNVB 5L83A 5IA7A 5BO4B 1EF1A 5E6NA 1WGGA 2ZJDA 3PTFC 1GG3A 3MHSD 2L05A 3VH4B 3O65B 5CHFA 5DPRA 2LGDA 2IO2B 2LJ5A 4ANWA 4NJ7A 2JZ3B 4JLCA 3H1UA 2XEWA 1Y8RC 2K8CA 4BKTA 1C1YB 1YIWA 3KUZA 1UD7A 1WE7A 4WWPA 3ZVVA 4IW0A 3RD2A 2ZPYA 3DVGY 2FIFA 1YQBA 2C5LC 4NQKE 1OEYJ 2DYOA 2N9EB 4W9HA 2M4NA 5GMVA 2BKFA 3L17A 4FN2A 5LLIA 1Q5WB 2KFJA 1WX9A 2LVPA 4I6LB 3B08A 2D3GA 2REXA 4CYEA 3ZRCA 1H8CA 4NY0A 1Z5SB 2KXJA 4EUTA 3GZNI 2LRUA 2G45B 3ZKJC 4ASWC 1P98A 2GBJA 1V49A 4G3XB 4K81A 3W1SA 3UQAA 4FA6A 2J7QB 3UIPB 2NCNA 2MQJA 1GJZA 3RULA 2O6VA 4CHKA 4B95A 2LXAA 4NAWA 2K25A 3QWZB 2IY1B 3ALBA 1LQBA 1SGHA 2KC1A 3ZTCA 3VUWA 4MGZE 3APCA 3V6EB 4GDLA 4GGQA 2I1JA 2LWPA 4KV2A 2ZZPB 4KSKC 4BVUC 3UF8A 4F8CB 3PZDA 2EMTA 2WWZA 4WQOB 3Q3FA 4MH0E 2L76A 2JWZA 2B3AA 2OOBB 2DZIA 4E74A 1V5OA 3QIJA 2KK8A 2MBOA 1V9JA 1E8ZA 4M8NA 3N3KB 4K7SA 3D32A 4GN1A 2RPQA 4BFRA 2CHWA 4W9LA 2K39A 2NS5A 2D2QA 2PEAA 2NVUI 4IWOA 1OEYA 3M62B 4PYZA 2LZ6A 3ENEA 3R66C 4AWJA 1WI0A 1UGMA 2JZZA 4DHJD 1D3ZA 4BBNF 3PHWB 5D6JB 3MJWA 2L7RA 3TCAA 2Z59B 4HPMB 1XQQA 2K1FA 4JQWC 1IP9A 2DAFA 3APDA 4WWNA 3IG3A 4HWIB 5C1ZA 3DDCB 1LFDA 4RM8A 1KLVA 1EO6A 1V5TA 5D2MB 2GBKA 2K6DB 2PE9A 3QCAA 4M8MA 3QQ8B 3KYDD 2KTRA 4FADA 2R2QA 3IFWB 4WAAA 2DYMA 3IHPC 5E6OA 1SIFA 2FIDA 2LRWA 5JH5C 3A1QA 1WXVA 4IC7B 1NI2A 2IO0B 2G3QB 3KUDB 1WF9A 2YLMA 2I1KA 2K6QA 3A4SC 3HK0A 3ZNHB 4A3PA 4W9CA 4AJYB 2VRRB 3ZIMA 2BYVE 4W9IA 4DDGD 1VD2A 1UH6A 4FHKA 1XD3B 4ICVA 2KDFB 2J0MA 5KHOA 2MBBB 3TBLD 3L13A 4TQ0A 4DHZE 3W1SC 1WGRA 2AEHA 2OJRA 1BT0A 2C9WB 1YD8U 3RUIB 4II2B 3U7DA 4ZRJA 4W9EA 2MCNB 4PS7A 3PS6A 4MGIE 2JRIB 3AI5A 1E90A 1TGZB 2KD0A 4P7IA 3EHVA 1RAXA 2EKEC 4RMAA 1WH3A 2BF8B 3VVWB 4DWFA 4F1SA 4DHJB 1VCBA 4AOFA 4HDOA 2FCQA 3P2BA 4A20A 2RD0A 1TTNA 5G55A 5TR5A 2N1VA 1T0YA 2KTFA 3TL5A 3EC8A 4B9KA 2DYBA 4HK2A 2G4DB 3RT3B 4ANVA 2EMSA 4CO7A 3C0RB 3TJPA 1UELA 3NHEB 1V86A 3PRPB 3QARA 1E7UA 1WJNA 3KYCD 4AUQC 4HDQA 3ZW3A 5AEKB 3H7PA 2DZKA 3L54A 3S2AA 4WJOA 2DAJA 3ZUNA 1WR6E
chains in the Genus database with same CATH superfamily
4MJSB 3VH3B 3U8ZA 1D4BA 1FXTB 2O2VA 3VUXA 3GP7A 4RFBA 2N7EA 3NZUA 1XT9B 4LK0M 2LGXA 2VH1A 3DVNU 4I6NB 2K9XA 3N1YC 3UINB 3K9OB 2KYWA 2C60A 3DQVA 1HA5A 3M95A 3LXFA 4OVVA 4GB9A 2GLSA 3BINA 3Q8AA 3AE7B 1D6EC 4M0WA 2D10A 2BS4B 3AE8B 1QT9A 1RFAA 2KO3A 3ZNGC 1T0RC 1T3QA 3RI7C 4C00A 5LXHA 1XCQL 2KDIA 4OZBA 1KM7A 4ZYSA 3RYTA 4ICUA 2BB6A 1A5RA 2W82A 2W9NA 4KGSA 2KANA 3R8BA 4FXCA 3AMZA 2YVCA 3EA6A 3NZ3A 2IGGA 1I42A 3V61A 3AE4B 4ACFA 3R7RA 2GBNA 3GS2A 3RNGC 2CJNA 5JXVA 4GDLB 2V3PA 1I4RA 3WCQA 1L0XB 3VDZA 2UWQA 3Q8BA 1J8CA 1GB1A 1NI3A 4M00A 2WGSA 1P7EA 1WGYA 3V62A 3A33B 1JW9D 1B1ZA 4K3CA 4JE3B 3W1YA 1OGWA 3Q6BA 2ZCBA 1FEHA 1QQRA 3DVNV 1OTRB 5G5HA 1YN3A 1IGDA 2MP2A 3H8HA 5CHVC 1EF5A 3C8YA 2SEBD 5HG2A 2C7MB 1ZXIA 5D7GA 2H89B 1EU3A 2FBWB 1OFFA 2M56B 2JU6X 4FLHA 5EE9A 2L0FA 1FIQA 2LUEA 4RGNA 4AJWA 2HTHA 4IWPA 4KKIA 2FCNA 1LM8B 4IKGA 2Z0EB 2OHFA 5EE1A 2ASQA 4FJYA 4W9KA 3RPFC 3VFKA 4NPNA 2QDFA 1GOZA 3O13A 1IYFA 3M63B 1SE4A 5C23A 3K9PB 1U4AA 4KVGB 2WX0A 1BUIC 2ZNVC 4LDTD 3VUYA 2JF5A 4GU2A 2BYTA 1YJJA 3URYA 4DXAB 2DHZA 4LNOA 4HLEA 1C77A 1CK1A 4C7YA 4PYUA 2AQ3B 4B0EA 3NOBA 3ZJUA 1WM3A 1WXSA 4LNIA 3TUOA 1N62A 1ZW7A 5HKHA 4KZ0A 4RGOS 3VTUA 3APFA 1K50A 4P1BC 2KWVB 2GOWA 3DWGC 1EUVB 2DNFA 3PGEA 5G2NA 3IVFA 5BYSA 3PV1A 4G50A 1MJDA 2RSUA 4YSZB 4X57B 3VTWA 2GI9A 5D3IB 3AULA 5BYRA 4BOSC 1D5XC 4W9DA 3NZSA 1NEKB 2KT7A 4I6PA 1XLQA 2PKOA 4W9GA 1M94A 1JRUA 2AL3A 4C80A 2J4XA 1I4PA 4NQLB 2BBCA 3AH7A 3WAPA 2LD9A 1TKEA 1J7BA 1WYGA 3QX1A 1T0SC 1N5WA 2INNE 4O1NA 1YNTE 3W5VB 2PW9A 2IZVB 2MEKA 1TBEA 4RF0A 2KDEB 1JMLA 1FXAA 2BB5A 4BAXA 1V1PB 3EGRA 2KJRA 4C7ZA 2LHEA 4LTUA 4MDKE 4IWQA 4KSLC 2JSVX 2FCMA 2CR5A 4OZCA 1FXIA 2KJHB 4TUUA 4YT0B 1VRAB 4K7UA 3WALA 5J2RA 2IBIB 2NBVB 2G9HD 4DHZB 4J6IA 2QJLA 1OQYA 4XC2A 4MSMB 3AE9B 2MW5A 1V2YA 2L00B 3OAWA 3MFGA 4ARIA 1F52A 2PE6B 2ZW1A 3HHMA 1ZUD2 1BMLC 1WWTA 3DVGX 3Q3NC 4II3B 1WXQA 4LJOB 2WXLA 5HHDG 1NDDA 4AS1A 3DBRB 3H7SA 2J53A 3N1ZC 4A8XC 3RN9C 2KC2A 1UF0A 2EELA 2MSED 2ZNVB 3BWUD 4KGRA 5BO4B 2ZJDA 2WXKA 3DHIC 3O65B 2LJ5A 1QILA 2JZ3B 4JLCA 4LLGM 2XEWA 4BKTA 3FKYA 1UD7A 3RD2A 1JQ4A 1ZOYB 3DVGY 2C5LC 2M4NA 2BKFA 4FN2A 1Q5WB 1WX9A 1ROEA 2LVPA 2GRIA 2UU7A 1VZ8A 2KXJA 4EUTA 2LRUA 3ZKJC 4ASWC 4G3XB 1PGBA 3UQAA 3W1SA 2WLBA 3NVYA 1AW7A 2BS3B 2WDQB 2IY1B 2CJOA 2KC1A 4XWWA 4MGZE 4GDLA 3AV8A 1FNVA 2ZZPB 5IKCM 1T6BX 2B3AA 2OOBB 2DZIA 4MACA 1E8ZA 3N3KB 4K7SA 3D32A 3I57A 2CHWA 2KAJA 4W9LA 2D2QA 1DGJA 2ICIA 1OEYA 1WGKA 5LNK1 3L4PA 5HI1A 1JRPA 2INCC 4DHJD 4BBNF 1K53A 3AEFB 1ET6A 1XQQA 1KRHA 2WXGA 3IG3A 1FFVA 3R2TA 3DDCB 1EO6A 2KTRA 2DYMA 5FK9C 5JH5C 4IC7B 1NI2A 2WDRB 4UDUC 1LGRA 1SXTA 2K6QA 4A3PA 4W9IA 1HXYD 2J0MA 3TBLD 1OQRA 2W3RA 2KWDA 4ZRJA 2MCNB 2K22A 2JRIB 5MPOA 3KWLA 2KD0A 1L4ZB 5BMHA 2MJDA 4RMAA 1F0ZA 3DHGC 3P2BA 4A20A 2RD0A 1T0YA 4S0RA 4B9KA 3IT4B 3RT3B 2EMSA 3C0RB 2QCZA 1UELA 1FNUA 1E7UA 1WJNA 4HDQA 3L54A 2GB1A 3S2AA 2DAJA 1CQVA 1NBFC 4PS3A 2CHXA 4DBGA 1WZ3A 4MM3A 2IJ0A 3VAWA 1X1MA 2XK5B 3NVVA 4AP4C 2G1EA 3WIMA 4JL9A 2BGFA 1MG4A 2WS3B 3IAS1 1E9MA 1HTQA 2IO3B 1T0QC 5E6PA 1AYFA 2N9PC 4HKZE 4US8A 3CSFA 4HPLB 2W3SA 1JWAD 1ZP0B 1JCKB 1PFDA 1UBIA 1WJ4A 1MHHE 1Q1OA 2MBHA 1P1AA 4EZKA 1C76A 1E7PB 4ANXA 3J9CA 4L23A 3DBSA 1J7AA 2GBMA 2JRHA 4XGAB 2B76B 2BKRB 1KH0A 3PSEB 3BVZA 2N0SB 2D07B 2KX3A 1WY8A 4NJCA 2WXQA 4YL8A 2NPTA 2LFIA 3KW5B 5CHWA 5H92C 2K3UA 5FR6A 1UNSA 5L95C 3FC4A 4NAMA 1IGCA 2V1YA 5DPWA 4S17A 1EU4A 3DOWA 2LGYA 1L6VA 4MSQB 2CHZA 1YQ3B 2NR2A 2J42A 2JXXA 3T9LA 1HTOA 3WAMA 3MC8A 3ML8A 1C9FA 2KN4A 5C3JB 4A9AA 2ZW0A 3LB8C 2BYEA 3ETRA 4LCDE 1WX8A 4BKSA 2NTSA 4MEMA 3W9CB 1SIJA 3NY5A 2FNJB 1QKZA 1HZ6A 1JROA 3TIXA 3FILA 2D3BA 2LGIA 1TZOA 1TKGA 2JYTA 4ZRKA 4B6WA 3ZNID 2KMCA 3KVFB 1E7VA 4XX5A 1R4MI 2D11A 4ZYNA 3H9DA 1V6EA 2FUHB 5HFYA 4DK5A 1RYJA 3AEDB 3U7ZA 4BBNC 1YJ1A 3ONSA 4LDTB 3SU8X 4GMVA 4YTPB 1WZ0A 3CMMB 1AWDA 3OJ4B 3TEZA 1I35A 3A1QB 1I4XA 1SE9A 2L0TA 4KDLB 2L8JA 2A4ZA 2JPHA 3ZRFA 2V9HA 3ZDMC 1KJTA 4W9JA 3JYUA 5LXIB 3GE8C 2RGFA 1R7SA 3A4RA 2ON8A 3ZXVA 3R7QA 4N9F4 2MA9B 4KX6B 1XO3A 3B9JA 3ML9A 3I3TB 1L7YA 4KIKA 1Z2MA 5CX3A 5BMGA 3ZYYX 1D5ZC 2QMTA 4PK1A 1MG8A 2MH7A 2GMIC 3U4EG 3ZDTA 3N32A 3JSVA 2V0GA 3L16A 3SR6A 3ZJTA 2K5PA 3SDLC 2OEDA 3CSTA 2V3SA 2JWUA 2IY0B 4WJNA 4HXDA 3PRZA 1E8WA 4IM0A 3NVZA 3GB1A 1TY0A 3IBEA 1Q10A 4ZRIA 1WE6A 2HTME 3HVZA 2KKCA 1PQSA 2WDTB 3RZFA 1CMXB 5JHBA 2WXPA 1VZ6A 3ZGZA 3N30A 2N9LA 4GSWA 4EKUA 2RR9A 4K7WA 4TSSA 2ZPNA 4FULA 3UGBB 2HDEA 4M0WB 4MGKE 4WJQA 1T5XD 4GXBA 2INDC 2D5GA 2KNBA 2MBQA 3AE3B 1L2NA 1I4QA 1NENB 1PUTA 2KHWB 3AN1A 3AXCA 2KFKB 2XN9C 4BKSD 1GUAB 1ZGUB 2QIEB 1ZDVA 3PLUA 4GDKA 2LASA 2N9KA 1UWMA 5L83A 5IA7A 1EF1A 3PTFC 3N1XC 2LGDA 4ANWA 1IUEA 1TYGB 3NJTA 3KUZA 2HJ1A 1WE7A 4HEA1 4IW0A 2ZPYA 3I63C 2DYOA 3HUIA 1RWSA 4L2YA 4XYCA 2KFJA 4A55A 3B08A 1TS5A 2REXA 3ZRCA 1ENFA 3AEBB 1P98A 4FA6A 3UIPB 2NCNA 2KMMA 3AEGB 1XEEA 2ACZB 2JQRB 3B2GA 3BK1A 4KGTA 2K25A 3ALBA 1LQBA 3Q3OC 3RNCC 3APCA 3V6EB 1KFYB 2I1JA 2IPKD 2LWPA 4KSKC 1R4MB 2EMTA 2WWZA 3IXSA 3NG0A 2BS2B 4E74A 1V5OA 3QIJA 1UGJA 4M8NA 4GN1A 4JPSA 2PEAA 1EWYC 2CU3A 2N7JA 1L0VB 3AEEB 1D3ZA 3TCAA 2Z59B 4HPMB 1IP9A 3APDA 4WWNA 4HWIB 1EWCA 5C1ZA 1LFDA 4RM8A 1FCCC 1KLVA 2KDMA 4ZHOA 2GBKA 2K6DB 3QCAA 4M8MA 3QQ8B 3KYDD 4FADA 3U2SC 3IFWB 4WAAA 1TS2A 3PZ7A 2I2YA 2FIDA 2LRWA 2IO0B 2G3QB 2YEPF 2YLMA 2I1KA 3ZNHB 4W9CA 2VRRB 2BYVE 4DDGD 4FHKA 4XWTA 1XD3B 5KHOA 4RF1A 1BXTA 2AEHA 1IBXB 1BT0A 2C9WB 3FILB 3RUIB 2NMQA 4P7IA 1KLGD 1TY2A 4DWFA 1KF6B 4DHJB 2OJWA 4KKJA 1TTNA 3AEAB 3TL5A 3EC8A 3N20C 4ANVA 1F1HA 3QARA 4AUQC 2E6XA 1LO5D 4RGTA 2XNAC 2QEJC 3ZUNA 3X23A 2L1AA 4IUMB 4OVUA 1VJKA 5EDSA 1WXMA 1UWXA 1AARA 2KLCA 1FM0D 3NS8A 3VHTC 5D3DA 3U52E 2QHOA 2K8BA 4LNFA 2BPSA 4OHJA 4RM9A 3HIZA 3MC9A 4LJPB 4RCOA 3DCGA 4JWSC 1F2RI 4KDIC 2V4IB 4KIKB 2N7DA 2WU5B 5FR3A 3KLSX 4H2AA 3SEBA 3V3XA 3B1LX 3EFUA 3QJZA 4K1RB 1FMAD 1YMHE 2Y5PA 4WQMA 4HCNB 5IO9A 2DZMA 3KWVA 1FD6A 1R4NB 1OQQA 4HJKA 1HE8A 1WMHA 1IBXA 3QK0A 2WYQA 3V6CB 1S3SG 3DHHC 2IGHA 2ZCCA 3PHXB 4IM2A 1WX7A 5IAAC 4L1BA 3NRZA 3QC8B 3V60A 1XF5L 3TMPB 3R2IA 2M0XA 4BOZB 1YJIA 4HJGE 2LXCA 1WYWB 3A9JA 1KTKA 1P3QU 1TT5B 4W9FA 1F2RC 2LGSA 1NYQA 1L4DB 1N5XA 4MGYE 1GC7A 2N9XA 5BMIA 2BQQA 2XK5A 1L5PA 3CWIA 4GDKB 3Q3JA 2AYOB 2MP2B 1FFUA 2CKHB 3P1MA 1DYQA 2H88B 2WU2B 2ONQA 1DOIA 4ZHPA 4FJZA 2LI5A 1JWUD 1WJ6A 2PTLA 5J18A 2A5UA 2O6VD 3HM6X 4YXDB 2KDBA 2QILA 4IOIE 4P6VF 2JT4B 3HM3A 4ZRPA 3LJ3A 2DWQA 3L10B 3EUB2 2K8HA 4OW0A 2WP9B 4HVBA 1TJEA 1XCTL 4GIVA 4HCPB 2Q5WD 2KMAA 2DX5B 4P1CC 4URKA 1J19A 2JVCA 4G0NB 4HRSA 1GPXA 1GB4A 3MP9A 3VTVA 4GOCA 4F7ZA 1RRBA 2KWUB 2WHIA 1WIAA 1XLPA 3AM9A 2G4SA 2O2VB 1WGDA 1KLUD 3IT6B 4GLSC 3KUCB 4YTNB 3SFEB 3UQBA 1UZXB 4MJSA 3MTNB 3LDZE 4NNJB 3WAOA 3B0AA 3EFCA 1WRIA 2JYEA 5DPTA 3ZQ4A 1WGHA 1C4AA 3I9V1 5G5GA 4EOYA 1WRDB 2W54A 3JVZX 1V97A 1P9DU 4C56C 5CTRC 2WXHA 2N1WA 3P4RB 2HE7A 2M17A 2V4LA 1AN8A 3MHZA 4EZJA 2DZJA 3WANA 3JW0X 1ACCA 1P0RA 1H4RA 3NS1A 3OLMD 4WJPA 1E10A 4MELA 4WWOA 2X38A 4IM3A 2Y5BB 3W5UB 1STEA 1S1QB 2PVGC 3KH0A 2PIAA 2KZRA 4JGHB 3RCZA 5KHQA 3SD5A 3VXWA 2INPE 2BWES 4IG7B 5AZFA 3OJ3A 4TQ1A 1M4VA 2ZVNA 4NAWB 2BYFA 2LHDA 5E6NA 1WGGA 2L32A 1GG3A 2L05A 5IOIA 5CHFA 2IO2B 1FCLA 4Q2JA 1JWSD 2Z8LA 4PT5A 3P4QB 4NJ7A 4IDIA 4M02A 1Y8RC 2WDVB 3RNFC 3T3OA 3ZVVA 5EE3A 2PLPA 1MI0A 1OEYJ 1QOGA 3BYYB 1A70A 5GMVA 4C4VB 2PMVA 4I6LB 2AQ2B 4J3OD 3P4SB 1H8CA 1V8CA 1Z5SB 3GZNI 2G45B 1V49A 1FRDA 2KQ4X 3E9SA 3RULA 2O6VA 2LXAA 4NAWA 2RDBC 2LEKA 5T8IA 3ZTCA 1SBBB 3VUWA 4GGQA 1MHXA 4KV2A 1N63A 2QSDA 4F8CB 1MPEA 2L76A 2JWZA 2KK8A 4DQOC 1V9JA 1SEBD 4A90A 2RPQA 1YQ4B 3P42A 2NS5A 2NVUI 4IWOA 3M62B 2LZ6A 1TIFA 1UGMA 1WI0A 2JZZA 4WIPA 1TS3A 2L7RA 2YEPB 1JALA 2D3AA 4DXFA 1DOYA 4XDDA 1VZ7A 5D2MB 1V5TA 3BVMA 2W55A 3IHPC 3TEYA 1WXVA 1SSNA 3KUDB 5IN7A 3A4SC 3GE3C 3HK0A 1JWBD 4AJYB 3ZIMA 1WSPA 2LUMA 2WQYB 4ICVA 1E0ZA 4XE0A 2MBBB 1FRRA 4DHZE 3TEWA 1WGRA 1TKYA 2WNMA 1YD8U 3P4PB 3MJ5A 3U7DA 3ZXRA 4PS7A 2L83A 1ZDXA 3AI5A 1E90A 2SAKA 3RMKC 1C78A 1RAXA 5H8YE 4F1SA 1WH3A 2BF8B 3VVWB 1K52A 1VCBA 2MHJA 4AOFA 4HDOA 2KTFA 1QOAA 4YSXB 1SF0A 2G4DB 4HK2A 5FKAC 4CO7A 3HRDD 3TJPA 4D2KA 3PRPB 2Y3AA 3Q69A 4ITKA 1C4PA 3FAHA 1VLBA 1WR6E 1XLNA 3OWEB 2MWSB 3OG5A 2R2OA 4A3OA 1I4HA 2WXRA 4RNAA 1F77A 2Z0DB 3PT2B 2BWFA 2O6VB 2KJ6A 1K51A 3VQIA 2WX1A 1LXDA 3AE1B 4HKQA 2JXTA 4MT5A 3BVGA 2IYDB 2E3TA 1Y56A 2WXIA 1ESFA 2RDGA 2AWTA 3H7PB 3R3MA 4NJ6A 2LJIA 2KX0A 3ZO5B 4FHJA 2R61A 3GOEA 2N4FA 3N9YC 3I5JC 3ZTDA 3NVWA 1WMHB 5JZEB 1FO4A 1VR9A 4E71A 3AECB 4ZDVA 2KLGA 3UI3A 1WM2A 3U30A 1YOVB 2DENB 4EFOA 1RM6C 1UUPA 1PGXA 3EECA 1QOFA 3PO0A 2BW2A 3SFDB 3A9JB 4KZCA 1FNWA 5DCNA 2BVCA 1RFKA 4RGMA 3M3JA 3UIOB 3IAM1 3V05A 4XZ4A 1N61A 4HROA 3RNBC 2AQ1B 3W2DA 1WFYA 4QAYA 1NYRA 1GNUA 2KFKA 3ZLZA 3QAQA 3DBRI 2M8SA 4ZOHC 1PDXA 2KACA 2KVRA 2C7HA 2IO1B 4YSYB 2WXNA 2FCSA 2I38A 3AU5A 4US9A 5IP4D 1CJEA 1ZE3D 3T8MA 1PGAA 2QC8A 5D94A 1IPGA 4P16A 4JIOU 5AUKA 1WR1A 4WH4A 1R4NI 4PS8A 2MX2A 2NBUA 3Q8FA 1DOXA 1E6EB 1GC6A 3DPDA 1E8XA 4K3BA 1ZKHA 2PPHA 2GBRA 2JX5A 1V1OA 4TV3A 1RLFA 1G6JA 3AE5B 2PJHA 1JWMD 3DBHI 2FUG1 1UBQA 3DBLI 3RNEC 1EM7A 4CQNA 2MRPA 3H6NA 5BYQA 3CF6E 5JHAA 2MJEA 2VZKB 3Q8CA 5EE0A 5I4DA 1NVID 2D3CA 2HJ8A 2XBBC 1QZEA 2KQ7A 5AZHA 1J0GA 2JZPA 2KOXA 3VR9B 1KOTA 3AU4A 4FJVB 2CS4A 3ABVB 1V80A 3ECIA 3QHTA 2KVZA 3VRAB 1YX6B 3SHQA 2KQSA 3LYYA 2C7NB 4RH6A 4JWUC 5AZGA 2KTRB 3PLVA 2M1MA 1ZXHA 2NTTA 2Y5CA 2RDHA 3PPAA 1HEZE 2J0JA 4DDID 3DBHB 3RFZB 2KWCA 2MLBA 2LVQA 2M19A 2HD5B 1C3TA 3P63A 1CZPA 3L08A 3PRMB 1E5WA 2ZEQA 1YX5B 2MBEA 2WXOA 3RNAC 2UYZB 1L6UA 4EZLA 1SE3A 2FAZA 2X8XX 1WJUA 1P7FA 2MJ3A 3Q2AC 2EKIA 2RPVA 4MM3B 2AL6A 2WXFA 4HPPA 1L0YB 1Q0WB 1V81A 4N59A 3ZJVA 4MH8A 4E3CA 2CU1A 1N60A 1WXAA 3QA8A 4N58A 3PREA 1ISNA 5DPSA 2WXJA 3A9KA 2NBWB 1PYWD 3MC0B 2RMMA 4ANUA 3NUHB 4EEWA 4BKGA 3E56A 1C79A 3RZWC 2ZVOA 3JSVB 2JY6A 3ZNZB 4G11A 1TZ1A 1K8RB 3X0WA 1E8YA 3AB5A 3DWMA 3WA0A 2L3ZA 1SE2A 1D5MC 5J17A 2JUOA 2IGDA 3L0WB 4A6QA 1TS4A 4FBJB 4DXGA 4TKNA 4C4VA 3VR8B 2PVOD 2NPTB 2LVOA 2KN5A 2J0KA 4OZAA 1F9JA 3PZ8A 5GXGB 4BZAA 3A9KB 3PVLA 1I7HA 3BY4B 3BYTB 3VH4B 3MHSD 4AQ7A 5DPRA 4LNNA 3H1UA 2K8CA 1C1YB 1YIWA 4WWPA 2FIFA 1YQBA 4NQKE 2N9EB 4W9HA 2BT6A 1FPYA 3CIRB 3L17A 1VDVA 5LLIA 1I4GA 2D3GA 4CYEA 1ET9A 4NY0A 1SB3C 2GBJA 4K81A 2J7QB 2V3NA 2MQJA 1GJZA 2FE8A 4NZLB 4CHKA 4B95A 4USAA 2TSSA 2M0AA 3QWZB 4WAFA 3TSSA 1SGHA 3DBLB 4BVUC 3UF8A 1ZPSA 3PZDA 3Q8EA 4WQOB 3Q3FA 4MH0E 3AE6B 2MBOA 2L52A 4BFRA 1QOBA 2BTEA 2K39A 4N6EB 4PYZA 3ENEA 3AE2B 3R66C 4AWJA 1QF6A 1YN5A 3PHWB 5D6JB 3MJWA 1B9RA 1QLBB 1MVKA 4ARCA 1N6ZA 1J7CA 2K1FA 3GZNB 4JQWC 2DAFA 2IDYA 2K0PA 1YN4A 4ZRQA 4WWMA 2DLBA 5TSSA 2PE9A 3HVDA 3B2FA 4EE2A 3VRBB 2R2QA 3TEXA 2VZKD 5E6OA 1SIFA 3A1QA 1V1PA 4WURA 3T3NA 1WF9A 5E6JA 1GAQB 2VH2A 1VD2A 1UH6A 2KDFB 4YWGG 4M01A 3L13A 4TQ0A 1C4CA 3W1SC 2OJRA 1SJED 2DBYA 4II2B 3Q3MC 3BZDB 2LMCA 5AUIA 3BK2A 4W9EA 4MGIE 1SJHD 3PS6A 3C19A 4XDCA 2WXMA 1TGZB 1XXGA 4REZA 4OVZA 3EHVA 1HZ5A 4TMAB 3Q14C 2EKEC 2AX5A 4LNKA 4R3DA 2FCQA 4YTMB 5G55A 5TR5A 2N1VA 1MFWA 2DYBA 5C2TB 3NHEB 1V86A 3BIID 3KYCD 3ZW3A 5AEKB 3H7PA 2J52A 4B0MA 2DZKA 3KQ4A 4WJOA 1XLOA 1HQRD 4JX1C
chains in the Genus database with same CATH topology
1NBFC 4MJSB 3VH3B 3U8ZA 4PS3A 2MWSB 1FXTB 4IUMB 2CHXA 2O2VA 2R2OA 4OVUA 3VUXA 4A3OA 4DBGA 1WZ3A 5EDSA 1WXMA 2N7EA 4MM3A 3NZUA 3VAWA 1X1MA 1XT9B 2XK5B 2LGXA 4AP4C 2Z0DB 1AARA 2KLCA 3DVNU 3PT2B 4I6NB 3WIMA 3UINB 2BWFA 2O6VB 3NS8A 3K9OB 3SU8X 3VHTC 2KJ6A 4JL9A 2C60A 3DQVA 3VQIA 4OVVA 2WX1A 3M95A 2BGFA 4GB9A 1LXDA 3BINA 2IO3B 5E6PA 2QHOA 2N9PC 2K8BA 2BPSA 2D10A 3CSFA 4RM9A 2IYDB 4HPLB 1RFAA 3HIZA 4LJPB 2KO3A 3ZNGC 3DCGA 2AWTA 1UBIA 3H7PB 3R3MA 4NJ6A 5LXHA 2KX0A 3ZO5B 4FHJA 3GOEA 2N4FA 2KDIA 4KDIC 1KM7A 4KIKB 2N7DA 1WJ4A 4ICUA 3RYTA 1A5RA 2W9NA 3ZTDA 2KANA 1WMHB 1Q1OA 2MBHA 3B1LX 1P1AA 3EFUA 4EZKA 2YVCA 5JZEB 3QJZA 4K1RB 4E71A 4ANXA 1I42A 3V61A 4ZDVA 2KLGA 3DBSA 2GBMA 2JRHA 1WM2A 3R7RA 2BKRB 2GBNA 3U30A 3PSEB 4HCNB 2D07B 4GDLB 2DENB 2DZMA 1WY8A 2KX3A 4EFOA 4YL8A 2NPTA 3VDZA 2UWQA 3EECA 1J8CA 3KW5B 5CHWA 3A9JB 5FR6A 1WGYA 4HJKA 1HE8A 3V62A 4KZCA 5DCNA 5L95C 3UIOB 3A33B 1WMHA 3M3JA 2V1YA 5DPWA 3QK0A 4XZ4A 2WYQA 3V6CB 3W1YA 1OGWA 1S3SG 2ZCBA 1WFYA 3DOWA 1GNUA 2LGYA 2KFKA 3ZLZA 2ZCCA 3PHXB 4IM2A 1WX7A 4MSQB 2CHZA 5IAAC 2NR2A 3DVNV 1OTRB 3QAQA 3DBRI 2M8SA 2JXXA 3QC8B 3T9LA 3V60A 2KVRA 2C7HA 2IO1B 2MP2A 5CHVC 1EF5A 3WAMA 3TMPB 2FCSA 3ML8A 2M0XA 2C7MB 3AU5A 4BOZB 5D7GA 2BYEA 2LXCA 1WYWB 3A9JA 4LCDE 4FLHA 3T8MA 1P3QU 1WX8A 4BKSA 4W9FA 4MEMA 5D94A 2L0FA 1IPGA 4MGYE 4JIOU 3NY5A 2LUEA 1WR1A 1R4NI 4AJWA 1GC7A 2HTHA 2N9XA 4PS8A 2MX2A 4IWPA 2NBUA 2FNJB 2XK5A 1GC6A 3DPDA 2FCNA 1LM8B 1E8XA 3TIXA 2Z0EB 3VFKA 1ZKHA 2ASQA 2PPHA 4FJYA 4W9KA 2GBRA 4NPNA 4GDKB 1IYFA 3M63B 3Q3JA 5C23A 2AYOB 2MP2B 3K9PB 1U4AA 4TV3A 1RLFA 1G6JA 4KVGB 2WX0A 2PJHA 2ZNVC 4LDTD 2CKHB 2JF5A 3VUYA 4GU2A 4ZRKA 3DBHI 4B6WA 3ZNID 2KMCA 3KVFB 1E7VA 4DXAB 4FJZA 1UBQA 2LI5A 2DHZA 1WJ6A 3DBLI 4XX5A 5J18A 4HLEA 2MRPA 3H6NA 2A5UA 1R4MI 2O6VD 2D11A 3HM6X 3CF6E 4PYUA 3H9DA 4ZYNA 1V6EA 2FUHB 5JHAA 3NOBA 2KDBA 4DK5A 2HJ8A 2XBBC 1WM3A 1WXSA 1QZEA 2KQ7A 5AZHA 1J0GA 2KOXA 4BBNC 1KOTA 3AU4A 1YJ1A 3ONSA 2JT4B 1ZW7A 4FJVB 4GMVA 4LDTB 3HM3A 1WZ0A 3CMMB 3APFA 4KZ0A 3VTUA 2CS4A 3OJ4B 3LJ3A 2KWVB 2GOWA 1EUVB 3L10B 1V80A 3ECIA 1I35A 3QHTA 3A1QB 2K8HA 1SE9A 1YX6B 3PGEA 3SHQA 5G2NA 2KQSA 2L0TA 3IVFA 4KDLB 2L8JA 2A4ZA 4HVBA 2C7NB 2JPHA 3PV1A 4G50A 3ZRFA 2RSUA 4GIVA 5AZGA 4HCPB 4X57B 2KTRB 3VTWA 2KMAA 3ZDMC 1KJTA 4W9JA 3AULA 4BOSC 3PLVA 2M1MA 3JYUA 5LXIB 2RGFA 2DX5B 4W9DA 3NZSA 4URKA 3PPAA 4I6PA 2J0JA 4DDID 1J19A 2KWCA 2MLBA 3A4RA 2LVQA 1M94A 1JRUA 2JVCA 4G0NB 4W9GA 3R7QA 3X23A 2AL3A 2HD5B 4N9F4 2MA9B 1C3TA 4NQLB 3ML9A 3VTVA 3I3TB 1L7YA 4GOCA 4KIKA 3L08A 4F7ZA 1Z2MA 1RRBA 2KWUB 1WIAA 5CX3A 3PRMB 2G4SA 2O2VB 3WAPA 1E5WA 2ZEQA 1WGDA 1YX5B 2LD9A 2MBEA 1MG8A 3KUCB 2GMIC 2UYZB 3QX1A 3UQBA 1UZXB 4MJSA 3MTNB 3LDZE 3N32A 4NNJB 3B0AA 3JSVA 3WAOA 3ZDTA 4EZLA 2IZVB 3L16A 2FAZA 1WJUA 1TBEA 3SDLC 2KDEB 5DPTA 3CSTA 2V3SA 2AL6A 5HKHA 1WGHA 2IY0B 4WJNA 4HXDA 2KJRA 1Q0WB 1V81A 3PRZA 4E3CA 1E8WA 4IM0A 4EOYA 2CU1A 1WRDB 3JVZX 3IBEA 4IWQA 4KSLC 1WXAA 4MDKE 1P9DU 2FCMA 3QA8A 4ZRIA 2CR5A 1ISNA 1WE6A 3PREA 5DPSA 2KJHB 2KKCA 4TUUA 3A9KA 1PQSA 2WDTB 5CTRC 3RZFA 2NBWB 1CMXB 2N1WA 4K7UA 3WALA 2HE7A 4ANUA 5JHBA 4EEWA 5J2RA 2M17A 2IBIB 2NBVB 4BKGA 2V4LA 4DHZB 4J6IA 1OQYA 4XC2A 4MSMB 3RZWC 4EZJA 2DZJA 2ZVOA 3WANA 2MW5A 2JY6A 3JSVB 3N30A 3ZNZB 1V2YA 2L00B 4G11A 3JW0X 1TZ1A 3OAWA 1K8RB 1H4RA 1P0RA 1E8YA 4GSWA 3X0WA 3WA0A 4EKUA 2L3ZA 2PE6B 2RR9A 3HHMA 3OLMD 4WJPA 4K7WA 4MELA 5J17A 4WWOA 2JUOA 4IM3A 2Y5BB 3L0WB 2ZPNA 4FULA 3DVGX 3UGBB 1S1QB 4II3B 4FBJB 4M0WB 4MGKE 4TKNA 3KH0A 2KZRA 4LJOB 4WJQA 4JGHB 4GXBA 3RCZA 5KHQA 2KNBA 1NDDA 2MBQA 2NPTB 3SD5A 2LVOA 2KN5A 3VXWA 1L2NA 2BWES 2KHWB 2J0KA 3AXCA 4IG7B 3H7SA 1F9JA 2KFKB 5AZFA 4BKSD 3OJ3A 1GUAB 1ZGUB 4TQ1A 3A9KB 3PVLA 3PLUA 2ZVNA 4NAWB 2KC2A 3BY4B 2BYFA 2MSED 4GDKA 2LASA 2ZNVB 5L83A 5IA7A 5BO4B 1EF1A 5E6NA 1WGGA 2ZJDA 3PTFC 1GG3A 3MHSD 2L05A 3VH4B 3O65B 5CHFA 5DPRA 2LGDA 2IO2B 2LJ5A 4ANWA 4NJ7A 2JZ3B 4JLCA 3H1UA 2XEWA 1Y8RC 2K8CA 4BKTA 1C1YB 1YIWA 3KUZA 1UD7A 1WE7A 4WWPA 3ZVVA 4IW0A 3RD2A 2ZPYA 3DVGY 2FIFA 1YQBA 2C5LC 4NQKE 1OEYJ 2DYOA 2N9EB 4W9HA 2M4NA 5GMVA 2BKFA 3L17A 4FN2A 5LLIA 1Q5WB 2KFJA 1WX9A 2LVPA 4I6LB 3B08A 2D3GA 2REXA 4CYEA 3ZRCA 1H8CA 4NY0A 1Z5SB 2KXJA 4EUTA 3GZNI 2LRUA 2G45B 3ZKJC 4ASWC 1P98A 2GBJA 1V49A 4G3XB 4K81A 3W1SA 3UQAA 4FA6A 2J7QB 3UIPB 2NCNA 2MQJA 1GJZA 3RULA 2O6VA 4CHKA 4B95A 2LXAA 4NAWA 2K25A 3QWZB 2IY1B 3ALBA 1LQBA 1SGHA 2KC1A 3ZTCA 3VUWA 4MGZE 3APCA 3V6EB 4GDLA 4GGQA 2I1JA 2LWPA 4KV2A 2ZZPB 4KSKC 4BVUC 3UF8A 4F8CB 3PZDA 2EMTA 2WWZA 4WQOB 3Q3FA 4MH0E 2L76A 2JWZA 2B3AA 2OOBB 2DZIA 4E74A 1V5OA 3QIJA 2KK8A 2MBOA 1V9JA 1E8ZA 4M8NA 3N3KB 4K7SA 3D32A 4GN1A 2RPQA 4BFRA 2CHWA 4W9LA 2K39A 2NS5A 2D2QA 2PEAA 2NVUI 4IWOA 1OEYA 3M62B 4PYZA 2LZ6A 3ENEA 3R66C 4AWJA 1WI0A 1UGMA 2JZZA 4DHJD 1D3ZA 4BBNF 3PHWB 5D6JB 3MJWA 2L7RA 3TCAA 2Z59B 4HPMB 1XQQA 2K1FA 4JQWC 1IP9A 2DAFA 3APDA 4WWNA 3IG3A 4HWIB 5C1ZA 3DDCB 1LFDA 4RM8A 1KLVA 1EO6A 1V5TA 5D2MB 2GBKA 2K6DB 2PE9A 3QCAA 4M8MA 3QQ8B 3KYDD 2KTRA 4FADA 2R2QA 3IFWB 4WAAA 2DYMA 3IHPC 5E6OA 1SIFA 2FIDA 2LRWA 5JH5C 3A1QA 1WXVA 4IC7B 1NI2A 2IO0B 2G3QB 3KUDB 1WF9A 2YLMA 2I1KA 2K6QA 3A4SC 3HK0A 3ZNHB 4A3PA 4W9CA 4AJYB 2VRRB 3ZIMA 2BYVE 4W9IA 4DDGD 1VD2A 1UH6A 4FHKA 1XD3B 4ICVA 2KDFB 2J0MA 5KHOA 2MBBB 3TBLD 3L13A 4TQ0A 4DHZE 3W1SC 1WGRA 2AEHA 2OJRA 1BT0A 2C9WB 1YD8U 3RUIB 4II2B 3U7DA 4ZRJA 4W9EA 2MCNB 4PS7A 3PS6A 4MGIE 2JRIB 3AI5A 1E90A 1TGZB 2KD0A 4P7IA 3EHVA 1RAXA 2EKEC 4RMAA 1WH3A 2BF8B 3VVWB 4DWFA 4F1SA 4DHJB 1VCBA 4AOFA 4HDOA 2FCQA 3P2BA 4A20A 2RD0A 1TTNA 5G55A 5TR5A 2N1VA 1T0YA 2KTFA 3TL5A 3EC8A 4B9KA 2DYBA 4HK2A 2G4DB 3RT3B 4ANVA 2EMSA 4CO7A 3C0RB 3TJPA 1UELA 3NHEB 1V86A 3PRPB 3QARA 1E7UA 1WJNA 3KYCD 4AUQC 4HDQA 3ZW3A 5AEKB 3H7PA 2DZKA 3L54A 3S2AA 4WJOA 2DAJA 3ZUNA 1WR6E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NBF C;  4MJS B;  3VH3 B;  3U8Z A;  4PS3 A;  2MWS B;  1FXT B;  4IUM B;  2CHX A;  2O2V A;  2R2O A;  4OVU A;  3VUX A;  4A3O A;  4DBG A;  1WZ3 A;  5EDS A;  1WXM A;  2N7E A;  4MM3 A;  3NZU A;  3VAW A;  1X1M A;  1XT9 B;  2XK5 B;  2LGX A;  4AP4 C;  2Z0D B;  1AAR A;  2KLC A;  3DVN U;  3PT2 B;  4I6N B;  3WIM A;  3UIN B;  2BWF A;  2O6V B;  3NS8 A;  3K9O B;  3SU8 X;  3VHT C;  2KJ6 A;  4JL9 A;  2C60 A;  3DQV A;  3VQI A;  4OVV A;  2WX1 A;  3M95 A;  2BGF A;  4GB9 A;  1LXD A;  3BIN A;  2IO3 B;  5E6P A;  2QHO A;  2N9P C;  2K8B A;  2BPS A;  2D10 A;  3CSF A;  4RM9 A;  2IYD B;  4HPL B;  1RFA A;  3HIZ A;  4LJP B;  2KO3 A;  3ZNG C;  3DCG A;  2AWT A;  1UBI A;  3H7P B;  3R3M A;  4NJ6 A;  5LXH A;  2KX0 A;  3ZO5 B;  4FHJ A;  3GOE A;  2N4F A;  2KDI A;  4KDI C;  1KM7 A;  4KIK B;  2N7D A;  1WJ4 A;  4ICU A;  3RYT A;  1A5R A;  2W9N A;  3ZTD A;  2KAN A;  1WMH B;  1Q1O A;  2MBH A;  3B1L X;  1P1A A;  3EFU A;  4EZK A;  2YVC A;  5JZE B;  3QJZ A;  4K1R B;  4E71 A;  4ANX A;  1I42 A;  3V61 A;  4ZDV A;  2KLG A;  3DBS A;  2GBM A;  2JRH A;  1WM2 A;  3R7R A;  2BKR B;  2GBN A;  3U30 A;  3PSE B;  4HCN B;  2D07 B;  4GDL B;  2DEN B;  2DZM A;  1WY8 A;  2KX3 A;  4EFO A;  4YL8 A;  2NPT A;  3VDZ A;  2UWQ A;  3EEC A;  1J8C A;  3KW5 B;  5CHW A;  3A9J B;  5FR6 A;  1WGY A;  4HJK A;  1HE8 A;  3V62 A;  4KZC A;  5DCN A;  5L95 C;  3UIO B;  3A33 B;  1WMH A;  3M3J A;  2V1Y A;  5DPW A;  3QK0 A;  4XZ4 A;  2WYQ A;  3V6C B;  3W1Y A;  1OGW A;  1S3S G;  2ZCB A;  1WFY A;  3DOW A;  1GNU A;  2LGY A;  2KFK A;  3ZLZ A;  2ZCC A;  3PHX B;  4IM2 A;  1WX7 A;  4MSQ B;  2CHZ A;  5IAA C;  2NR2 A;  3DVN V;  1OTR B;  3QAQ A;  3DBR I;  2M8S A;  2JXX A;  3QC8 B;  3T9L A;  3V60 A;  2KVR A;  2C7H A;  2IO1 B;  2MP2 A;  5CHV C;  1EF5 A;  3WAM A;  3TMP B;  2FCS A;  3ML8 A;  2M0X A;  2C7M B;  3AU5 A;  4BOZ B;  5D7G A;  2BYE A;  2LXC A;  1WYW B;  3A9J A;  4LCD E;  4FLH A;  3T8M A;  1P3Q U;  1WX8 A;  4BKS A;  4W9F A;  4MEM A;  5D94 A;  2L0F A;  1IPG A;  4MGY E;  4JIO U;  3NY5 A;  2LUE A;  1WR1 A;  1R4N I;  4AJW A;  1GC7 A;  2HTH A;  2N9X A;  4PS8 A;  2MX2 A;  4IWP A;  2NBU A;  2FNJ B;  2XK5 A;  1GC6 A;  3DPD A;  2FCN A;  1LM8 B;  1E8X A;  3TIX A;  2Z0E B;  3VFK A;  1ZKH A;  2ASQ A;  2PPH A;  4FJY A;  4W9K A;  2GBR A;  4NPN A;  4GDK B;  1IYF A;  3M63 B;  3Q3J A;  5C23 A;  2AYO B;  2MP2 B;  3K9P B;  1U4A A;  4TV3 A;  1RLF A;  1G6J A;  4KVG B;  2WX0 A;  2PJH A;  2ZNV C;  4LDT D;  2CKH B;  2JF5 A;  3VUY A;  4GU2 A;  4ZRK A;  3DBH I;  4B6W A;  3ZNI D;  2KMC A;  3KVF B;  1E7V A;  4DXA B;  4FJZ A;  1UBQ A;  2LI5 A;  2DHZ A;  1WJ6 A;  3DBL I;  4XX5 A;  5J18 A;  4HLE A;  2MRP A;  3H6N A;  2A5U A;  1R4M I;  2O6V D;  2D11 A;  3HM6 X;  3CF6 E;  4PYU A;  3H9D A;  4ZYN A;  1V6E A;  2FUH B;  5JHA A;  3NOB A;  2KDB A;  4DK5 A;  2HJ8 A;  2XBB C;  1WM3 A;  1WXS A;  1QZE A;  2KQ7 A;  5AZH A;  1J0G A;  2KOX A;  4BBN C;  1KOT A;  3AU4 A;  1YJ1 A;  3ONS A;  2JT4 B;  1ZW7 A;  4FJV B;  4GMV A;  4LDT B;  3HM3 A;  1WZ0 A;  3CMM B;  3APF A;  4KZ0 A;  3VTU A;  2CS4 A;  3OJ4 B;  3LJ3 A;  2KWV B;  2GOW A;  1EUV B;  3L10 B;  1V80 A;  3ECI A;  1I35 A;  3QHT A;  3A1Q B;  2K8H A;  1SE9 A;  1YX6 B;  3PGE A;  3SHQ A;  5G2N A;  2KQS A;  2L0T A;  3IVF A;  4KDL B;  2L8J A;  2A4Z A;  4HVB A;  2C7N B;  2JPH A;  3PV1 A;  4G50 A;  3ZRF A;  2RSU A;  4GIV A;  5AZG A;  4HCP B;  4X57 B;  2KTR B;  3VTW A;  2KMA A;  3ZDM C;  1KJT A;  4W9J A;  3AUL A;  4BOS C;  3PLV A;  2M1M A;  3JYU A;  5LXI B;  2RGF A;  2DX5 B;  4W9D A;  3NZS A;  4URK A;  3PPA A;  4I6P A;  2J0J A;  4DDI D;  1J19 A;  2KWC A;  2MLB A;  3A4R A;  2LVQ A;  1M94 A;  1JRU A;  2JVC A;  4G0N B;  4W9G A;  3R7Q A;  3X23 A;  2AL3 A;  2HD5 B;  4N9F 4;  2MA9 B;  1C3T A;  4NQL B;  3ML9 A;  3VTV A;  3I3T B;  1L7Y A;  4GOC A;  4KIK A;  3L08 A;  4F7Z A;  1Z2M A;  1RRB A;  2KWU B;  1WIA A;  5CX3 A;  3PRM B;  2G4S A;  2O2V B;  3WAP A;  1E5W A;  2ZEQ A;  1WGD A;  1YX5 B;  2LD9 A;  2MBE A;  1MG8 A;  3KUC B;  2GMI C;  2UYZ B;  3QX1 A;  3UQB A;  1UZX B;  4MJS A;  3MTN B;  3LDZ E;  3N32 A;  4NNJ B;  3B0A A;  3JSV A;  3WAO A;  3ZDT A;  4EZL A;  2IZV B;  3L16 A;  2FAZ A;  1WJU A;  1TBE A;  3SDL C;  2KDE B;  5DPT A;  3CST A;  2V3S A;  2AL6 A;  5HKH A;  1WGH A;  2IY0 B;  4WJN A;  4HXD A;  2KJR A;  1Q0W B;  1V81 A;  3PRZ A;  4E3C A;  1E8W A;  4IM0 A;  4EOY A;  2CU1 A;  1WRD B;  3JVZ X;  3IBE A;  4IWQ A;  4KSL C;  1WXA A;  4MDK E;  1P9D U;  2FCM A;  3QA8 A;  4ZRI A;  2CR5 A;  1ISN A;  1WE6 A;  3PRE A;  5DPS A;  2KJH B;  2KKC A;  4TUU A;  3A9K A;  1PQS A;  2WDT B;  5CTR C;  3RZF A;  2NBW B;  1CMX B;  2N1W A;  4K7U A;  3WAL A;  2HE7 A;  4ANU A;  5JHB A;  4EEW A;  5J2R A;  2M17 A;  2IBI B;  2NBV B;  4BKG A;  2V4L A;  4DHZ B;  4J6I A;  1OQY A;  4XC2 A;  4MSM B;  3RZW C;  4EZJ A;  2DZJ A;  2ZVO A;  3WAN A;  2MW5 A;  2JY6 A;  3JSV B;  3N30 A;  3ZNZ B;  1V2Y A;  2L00 B;  4G11 A;  3JW0 X;  1TZ1 A;  3OAW A;  1K8R B;  1H4R A;  1P0R A;  1E8Y A;  4GSW A;  3X0W A;  3WA0 A;  4EKU A;  2L3Z A;  2PE6 B;  2RR9 A;  3HHM A;  3OLM D;  4WJP A;  4K7W A;  4MEL A;  5J17 A;  4WWO A;  2JUO A;  4IM3 A;  2Y5B B;  3L0W B;  2ZPN A;  4FUL A;  3DVG X;  3UGB B;  1S1Q B;  4II3 B;  4FBJ B;  4M0W B;  4MGK E;  4TKN A;  3KH0 A;  2KZR A;  4LJO B;  4WJQ A;  4JGH B;  4GXB A;  3RCZ A;  5KHQ A;  2KNB A;  1NDD A;  2MBQ A;  2NPT B;  3SD5 A;  2LVO A;  2KN5 A;  3VXW A;  1L2N A;  2BWE S;  2KHW B;  2J0K A;  3AXC A;  4IG7 B;  3H7S A;  1F9J A;  2KFK B;  5AZF A;  4BKS D;  3OJ3 A;  1GUA B;  1ZGU B;  4TQ1 A;  3A9K B;  3PVL A;  3PLU A;  2ZVN A;  4NAW B;  2KC2 A;  3BY4 B;  2BYF A;  2MSE D;  4GDK A;  2LAS A;  2ZNV B;  5L83 A;  5IA7 A;  5BO4 B;  1EF1 A;  5E6N A;  1WGG A;  2ZJD A;  3PTF C;  1GG3 A;  3MHS D;  2L05 A;  3VH4 B;  3O65 B;  5CHF A;  5DPR A;  2LGD A;  2IO2 B;  2LJ5 A;  4ANW A;  4NJ7 A;  2JZ3 B;  4JLC A;  3H1U A;  2XEW A;  1Y8R C;  2K8C A;  4BKT A;  1C1Y B;  1YIW A;  3KUZ A;  1UD7 A;  1WE7 A;  4WWP A;  3ZVV A;  4IW0 A;  3RD2 A;  2ZPY A;  3DVG Y;  2FIF A;  1YQB A;  2C5L C;  4NQK E;  1OEY J;  2DYO A;  2N9E B;  4W9H A;  2M4N A;  5GMV A;  2BKF A;  3L17 A;  4FN2 A;  5LLI A;  1Q5W B;  2KFJ A;  1WX9 A;  2LVP A;  4I6L B;  3B08 A;  2D3G A;  2REX A;  4CYE A;  3ZRC A;  1H8C A;  4NY0 A;  1Z5S B;  2KXJ A;  4EUT A;  3GZN I;  2LRU A;  2G45 B;  3ZKJ C;  4ASW C;  1P98 A;  2GBJ A;  1V49 A;  4G3X B;  4K81 A;  3W1S A;  3UQA A;  4FA6 A;  2J7Q B;  3UIP B;  2NCN A;  2MQJ A;  1GJZ A;  3RUL A;  2O6V A;  4CHK A;  4B95 A;  2LXA A;  4NAW A;  2K25 A;  3QWZ B;  2IY1 B;  3ALB A;  1LQB A;  1SGH A;  2KC1 A;  3ZTC A;  3VUW A;  4MGZ E;  3APC A;  3V6E B;  4GDL A;  4GGQ A;  2I1J A;  2LWP A;  4KV2 A;  2ZZP B;  4KSK C;  4BVU C;  3UF8 A;  4F8C B;  3PZD A;  2EMT A;  2WWZ A;  4WQO B;  3Q3F A;  4MH0 E;  2L76 A;  2JWZ A;  2B3A A;  2OOB B;  2DZI A;  4E74 A;  1V5O A;  3QIJ A;  2KK8 A;  2MBO A;  1V9J A;  1E8Z A;  4M8N A;  3N3K B;  4K7S A;  3D32 A;  4GN1 A;  2RPQ A;  4BFR A;  2CHW A;  4W9L A;  2K39 A;  2NS5 A;  2D2Q A;  2PEA A;  2NVU I;  4IWO A;  1OEY A;  3M62 B;  4PYZ A;  2LZ6 A;  3ENE A;  3R66 C;  4AWJ A;  1WI0 A;  1UGM A;  2JZZ A;  4DHJ D;  1D3Z A;  4BBN F;  3PHW B;  5D6J B;  3MJW A;  2L7R A;  3TCA A;  2Z59 B;  4HPM B;  1XQQ A;  2K1F A;  4JQW C;  1IP9 A;  2DAF A;  3APD A;  4WWN A;  3IG3 A;  4HWI B;  5C1Z A;  3DDC B;  1LFD A;  4RM8 A;  1KLV A;  1EO6 A;  1V5T A;  5D2M B;  2GBK A;  2K6D B;  2PE9 A;  3QCA A;  4M8M A;  3QQ8 B;  3KYD D;  2KTR A;  4FAD A;  2R2Q A;  3IFW B;  4WAA A;  2DYM A;  3IHP C;  5E6O A;  1SIF A;  2FID A;  2LRW A;  5JH5 C;  3A1Q A;  1WXV A;  4IC7 B;  1NI2 A;  2IO0 B;  2G3Q B;  3KUD B;  1WF9 A;  2YLM A;  2I1K A;  2K6Q A;  3A4S C;  3HK0 A;  3ZNH B;  4A3P A;  4W9C A;  4AJY B;  2VRR B;  3ZIM A;  2BYV E;  4W9I A;  4DDG D;  1VD2 A;  1UH6 A;  4FHK A;  1XD3 B;  4ICV A;  2KDF B;  2J0M A;  5KHO A;  2MBB B;  3TBL D;  3L13 A;  4TQ0 A;  4DHZ E;  3W1S C;  1WGR A;  2AEH A;  2OJR A;  1BT0 A;  2C9W B;  1YD8 U;  3RUI B;  4II2 B;  3U7D A;  4ZRJ A;  4W9E A;  2MCN B;  4PS7 A;  3PS6 A;  4MGI E;  2JRI B;  3AI5 A;  1E90 A;  1TGZ B;  2KD0 A;  4P7I A;  3EHV A;  1RAX A;  2EKE C;  4RMA A;  1WH3 A;  2BF8 B;  3VVW B;  4DWF A;  4F1S A;  4DHJ B;  1VCB A;  4AOF A;  4HDO A;  2FCQ A;  3P2B A;  4A20 A;  2RD0 A;  1TTN A;  5G55 A;  5TR5 A;  2N1V A;  1T0Y A;  2KTF A;  3TL5 A;  3EC8 A;  4B9K A;  2DYB A;  4HK2 A;  2G4D B;  3RT3 B;  4ANV A;  2EMS A;  4CO7 A;  3C0R B;  3TJP A;  1UEL A;  3NHE B;  1V86 A;  3PRP B;  3QAR A;  1E7U A;  1WJN A;  3KYC D;  4AUQ C;  4HDQ A;  3ZW3 A;  5AEK B;  3H7P A;  2DZK A;  3L54 A;  3S2A A;  4WJO A;  2DAJ A;  3ZUN A;  1WR6 E; 
#chains in the Genus database with same CATH topology
 4MJS B;  3VH3 B;  3U8Z A;  1D4B A;  1FXT B;  2O2V A;  3VUX A;  3GP7 A;  4RFB A;  2N7E A;  3NZU A;  1XT9 B;  4LK0 M;  2LGX A;  2VH1 A;  3DVN U;  4I6N B;  2K9X A;  3N1Y C;  3UIN B;  3K9O B;  2KYW A;  2C60 A;  3DQV A;  1HA5 A;  3M95 A;  3LXF A;  4OVV A;  4GB9 A;  2GLS A;  3BIN A;  3Q8A A;  3AE7 B;  1D6E C;  4M0W A;  2D10 A;  2BS4 B;  3AE8 B;  1QT9 A;  1RFA A;  2KO3 A;  3ZNG C;  1T0R C;  1T3Q A;  3RI7 C;  4C00 A;  5LXH A;  1XCQ L;  2KDI A;  4OZB A;  1KM7 A;  4ZYS A;  3RYT A;  4ICU A;  2BB6 A;  1A5R A;  2W82 A;  2W9N A;  4KGS A;  2KAN A;  3R8B A;  4FXC A;  3AMZ A;  2YVC A;  3EA6 A;  3NZ3 A;  2IGG A;  1I42 A;  3V61 A;  3AE4 B;  4ACF A;  3R7R A;  2GBN A;  3GS2 A;  3RNG C;  2CJN A;  5JXV A;  4GDL B;  2V3P A;  1I4R A;  3WCQ A;  1L0X B;  3VDZ A;  2UWQ A;  3Q8B A;  1J8C A;  1GB1 A;  1NI3 A;  4M00 A;  2WGS A;  1P7E A;  1WGY A;  3V62 A;  3A33 B;  1JW9 D;  1B1Z A;  4K3C A;  4JE3 B;  3W1Y A;  1OGW A;  3Q6B A;  2ZCB A;  1FEH A;  1QQR A;  3DVN V;  1OTR B;  5G5H A;  1YN3 A;  1IGD A;  2MP2 A;  3H8H A;  5CHV C;  1EF5 A;  3C8Y A;  2SEB D;  5HG2 A;  2C7M B;  1ZXI A;  5D7G A;  2H89 B;  1EU3 A;  2FBW B;  1OFF A;  2M56 B;  2JU6 X;  4FLH A;  5EE9 A;  2L0F A;  1FIQ A;  2LUE A;  4RGN A;  4AJW A;  2HTH A;  4IWP A;  4KKI A;  2FCN A;  1LM8 B;  4IKG A;  2Z0E B;  2OHF A;  5EE1 A;  2ASQ A;  4FJY A;  4W9K A;  3RPF C;  3VFK A;  4NPN A;  2QDF A;  1GOZ A;  3O13 A;  1IYF A;  3M63 B;  1SE4 A;  5C23 A;  3K9P B;  1U4A A;  4KVG B;  2WX0 A;  1BUI C;  2ZNV C;  4LDT D;  3VUY A;  2JF5 A;  4GU2 A;  2BYT A;  1YJJ A;  3URY A;  4DXA B;  2DHZ A;  4LNO A;  4HLE A;  1C77 A;  1CK1 A;  4C7Y A;  4PYU A;  2AQ3 B;  4B0E A;  3NOB A;  3ZJU A;  1WM3 A;  1WXS A;  4LNI A;  3TUO A;  1N62 A;  1ZW7 A;  5HKH A;  4KZ0 A;  4RGO S;  3VTU A;  3APF A;  1K50 A;  4P1B C;  2KWV B;  2GOW A;  3DWG C;  1EUV B;  2DNF A;  3PGE A;  5G2N A;  3IVF A;  5BYS A;  3PV1 A;  4G50 A;  1MJD A;  2RSU A;  4YSZ B;  4X57 B;  3VTW A;  2GI9 A;  5D3I B;  3AUL A;  5BYR A;  4BOS C;  1D5X C;  4W9D A;  3NZS A;  1NEK B;  2KT7 A;  4I6P A;  1XLQ A;  2PKO A;  4W9G A;  1M94 A;  1JRU A;  2AL3 A;  4C80 A;  2J4X A;  1I4P A;  4NQL B;  2BBC A;  3AH7 A;  3WAP A;  2LD9 A;  1TKE A;  1J7B A;  1WYG A;  3QX1 A;  1T0S C;  1N5W A;  2INN E;  4O1N A;  1YNT E;  3W5V B;  2PW9 A;  2IZV B;  2MEK A;  1TBE A;  4RF0 A;  2KDE B;  1JML A;  1FXA A;  2BB5 A;  4BAX A;  1V1P B;  3EGR A;  2KJR A;  4C7Z A;  2LHE A;  4LTU A;  4MDK E;  4IWQ A;  4KSL C;  2JSV X;  2FCM A;  2CR5 A;  4OZC A;  1FXI A;  2KJH B;  4TUU A;  4YT0 B;  1VRA B;  4K7U A;  3WAL A;  5J2R A;  2IBI B;  2NBV B;  2G9H D;  4DHZ B;  4J6I A;  2QJL A;  1OQY A;  4XC2 A;  4MSM B;  3AE9 B;  2MW5 A;  1V2Y A;  2L00 B;  3OAW A;  3MFG A;  4ARI A;  1F52 A;  2PE6 B;  2ZW1 A;  3HHM A;  1ZUD 2;  1BML C;  1WWT A;  3DVG X;  3Q3N C;  4II3 B;  1WXQ A;  4LJO B;  2WXL A;  5HHD G;  1NDD A;  4AS1 A;  3DBR B;  3H7S A;  2J53 A;  3N1Z C;  4A8X C;  3RN9 C;  2KC2 A;  1UF0 A;  2EEL A;  2MSE D;  2ZNV B;  3BWU D;  4KGR A;  5BO4 B;  2ZJD A;  2WXK A;  3DHI C;  3O65 B;  2LJ5 A;  1QIL A;  2JZ3 B;  4JLC A;  4LLG M;  2XEW A;  4BKT A;  3FKY A;  1UD7 A;  3RD2 A;  1JQ4 A;  1ZOY B;  3DVG Y;  2C5L C;  2M4N A;  2BKF A;  4FN2 A;  1Q5W B;  1WX9 A;  1ROE A;  2LVP A;  2GRI A;  2UU7 A;  1VZ8 A;  2KXJ A;  4EUT A;  2LRU A;  3ZKJ C;  4ASW C;  4G3X B;  1PGB A;  3UQA A;  3W1S A;  2WLB A;  3NVY A;  1AW7 A;  2BS3 B;  2WDQ B;  2IY1 B;  2CJO A;  2KC1 A;  4XWW A;  4MGZ E;  4GDL A;  3AV8 A;  1FNV A;  2ZZP B;  5IKC M;  1T6B X;  2B3A A;  2OOB B;  2DZI A;  4MAC A;  1E8Z A;  3N3K B;  4K7S A;  3D32 A;  3I57 A;  2CHW A;  2KAJ A;  4W9L A;  2D2Q A;  1DGJ A;  2ICI A;  1OEY A;  1WGK A;  5LNK 1;  3L4P A;  5HI1 A;  1JRP A;  2INC C;  4DHJ D;  4BBN F;  1K53 A;  3AEF B;  1ET6 A;  1XQQ A;  1KRH A;  2WXG A;  3IG3 A;  1FFV A;  3R2T A;  3DDC B;  1EO6 A;  2KTR A;  2DYM A;  5FK9 C;  5JH5 C;  4IC7 B;  1NI2 A;  2WDR B;  4UDU C;  1LGR A;  1SXT A;  2K6Q A;  4A3P A;  4W9I A;  1HXY D;  2J0M A;  3TBL D;  1OQR A;  2W3R A;  2KWD A;  4ZRJ A;  2MCN B;  2K22 A;  2JRI B;  5MPO A;  3KWL A;  2KD0 A;  1L4Z B;  5BMH A;  2MJD A;  4RMA A;  1F0Z A;  3DHG C;  3P2B A;  4A20 A;  2RD0 A;  1T0Y A;  4S0R A;  4B9K A;  3IT4 B;  3RT3 B;  2EMS A;  3C0R B;  2QCZ A;  1UEL A;  1FNU A;  1E7U A;  1WJN A;  4HDQ A;  3L54 A;  2GB1 A;  3S2A A;  2DAJ A;  1CQV A;  1NBF C;  4PS3 A;  2CHX A;  4DBG A;  1WZ3 A;  4MM3 A;  2IJ0 A;  3VAW A;  1X1M A;  2XK5 B;  3NVV A;  4AP4 C;  2G1E A;  3WIM A;  4JL9 A;  2BGF A;  1MG4 A;  2WS3 B;  3IAS 1;  1E9M A;  1HTQ A;  2IO3 B;  1T0Q C;  5E6P A;  1AYF A;  2N9P C;  4HKZ E;  4US8 A;  3CSF A;  4HPL B;  2W3S A;  1JWA D;  1ZP0 B;  1JCK B;  1PFD A;  1UBI A;  1WJ4 A;  1MHH E;  1Q1O A;  2MBH A;  1P1A A;  4EZK A;  1C76 A;  1E7P B;  4ANX A;  3J9C A;  4L23 A;  3DBS A;  1J7A A;  2GBM A;  2JRH A;  4XGA B;  2B76 B;  2BKR B;  1KH0 A;  3PSE B;  3BVZ A;  2N0S B;  2D07 B;  2KX3 A;  1WY8 A;  4NJC A;  2WXQ A;  4YL8 A;  2NPT A;  2LFI A;  3KW5 B;  5CHW A;  5H92 C;  2K3U A;  5FR6 A;  1UNS A;  5L95 C;  3FC4 A;  4NAM A;  1IGC A;  2V1Y A;  5DPW A;  4S17 A;  1EU4 A;  3DOW A;  2LGY A;  1L6V A;  4MSQ B;  2CHZ A;  1YQ3 B;  2NR2 A;  2J42 A;  2JXX A;  3T9L A;  1HTO A;  3WAM A;  3MC8 A;  3ML8 A;  1C9F A;  2KN4 A;  5C3J B;  4A9A A;  2ZW0 A;  3LB8 C;  2BYE A;  3ETR A;  4LCD E;  1WX8 A;  4BKS A;  2NTS A;  4MEM A;  3W9C B;  1SIJ A;  3NY5 A;  2FNJ B;  1QKZ A;  1HZ6 A;  1JRO A;  3TIX A;  3FIL A;  2D3B A;  2LGI A;  1TZO A;  1TKG A;  2JYT A;  4ZRK A;  4B6W A;  3ZNI D;  2KMC A;  3KVF B;  1E7V A;  4XX5 A;  1R4M I;  2D11 A;  4ZYN A;  3H9D A;  1V6E A;  2FUH B;  5HFY A;  4DK5 A;  1RYJ A;  3AED B;  3U7Z A;  4BBN C;  1YJ1 A;  3ONS A;  4LDT B;  3SU8 X;  4GMV A;  4YTP B;  1WZ0 A;  3CMM B;  1AWD A;  3OJ4 B;  3TEZ A;  1I35 A;  3A1Q B;  1I4X A;  1SE9 A;  2L0T A;  4KDL B;  2L8J A;  2A4Z A;  2JPH A;  3ZRF A;  2V9H A;  3ZDM C;  1KJT A;  4W9J A;  3JYU A;  5LXI B;  3GE8 C;  2RGF A;  1R7S A;  3A4R A;  2ON8 A;  3ZXV A;  3R7Q A;  4N9F 4;  2MA9 B;  4KX6 B;  1XO3 A;  3B9J A;  3ML9 A;  3I3T B;  1L7Y A;  4KIK A;  1Z2M A;  5CX3 A;  5BMG A;  3ZYY X;  1D5Z C;  2QMT A;  4PK1 A;  1MG8 A;  2MH7 A;  2GMI C;  3U4E G;  3ZDT A;  3N32 A;  3JSV A;  2V0G A;  3L16 A;  3SR6 A;  3ZJT A;  2K5P A;  3SDL C;  2OED A;  3CST A;  2V3S A;  2JWU A;  2IY0 B;  4WJN A;  4HXD A;  3PRZ A;  1E8W A;  4IM0 A;  3NVZ A;  3GB1 A;  1TY0 A;  3IBE A;  1Q10 A;  4ZRI A;  1WE6 A;  2HTM E;  3HVZ A;  2KKC A;  1PQS A;  2WDT B;  3RZF A;  1CMX B;  5JHB A;  2WXP A;  1VZ6 A;  3ZGZ A;  3N30 A;  2N9L A;  4GSW A;  4EKU A;  2RR9 A;  4K7W A;  4TSS A;  2ZPN A;  4FUL A;  3UGB B;  2HDE A;  4M0W B;  4MGK E;  4WJQ A;  1T5X D;  4GXB A;  2IND C;  2D5G A;  2KNB A;  2MBQ A;  3AE3 B;  1L2N A;  1I4Q A;  1NEN B;  1PUT A;  2KHW B;  3AN1 A;  3AXC A;  2KFK B;  2XN9 C;  4BKS D;  1GUA B;  1ZGU B;  2QIE B;  1ZDV A;  3PLU A;  4GDK A;  2LAS A;  2N9K A;  1UWM A;  5L83 A;  5IA7 A;  1EF1 A;  3PTF C;  3N1X C;  2LGD A;  4ANW A;  1IUE A;  1TYG B;  3NJT A;  3KUZ A;  2HJ1 A;  1WE7 A;  4HEA 1;  4IW0 A;  2ZPY A;  3I63 C;  2DYO A;  3HUI A;  1RWS A;  4L2Y A;  4XYC A;  2KFJ A;  4A55 A;  3B08 A;  1TS5 A;  2REX A;  3ZRC A;  1ENF A;  3AEB B;  1P98 A;  4FA6 A;  3UIP B;  2NCN A;  2KMM A;  3AEG B;  1XEE A;  2ACZ B;  2JQR B;  3B2G A;  3BK1 A;  4KGT A;  2K25 A;  3ALB A;  1LQB A;  3Q3O C;  3RNC C;  3APC A;  3V6E B;  1KFY B;  2I1J A;  2IPK D;  2LWP A;  4KSK C;  1R4M B;  2EMT A;  2WWZ A;  3IXS A;  3NG0 A;  2BS2 B;  4E74 A;  1V5O A;  3QIJ A;  1UGJ A;  4M8N A;  4GN1 A;  4JPS A;  2PEA A;  1EWY C;  2CU3 A;  2N7J A;  1L0V B;  3AEE B;  1D3Z A;  3TCA A;  2Z59 B;  4HPM B;  1IP9 A;  3APD A;  4WWN A;  4HWI B;  1EWC A;  5C1Z A;  1LFD A;  4RM8 A;  1FCC C;  1KLV A;  2KDM A;  4ZHO A;  2GBK A;  2K6D B;  3QCA A;  4M8M A;  3QQ8 B;  3KYD D;  4FAD A;  3U2S C;  3IFW B;  4WAA A;  1TS2 A;  3PZ7 A;  2I2Y A;  2FID A;  2LRW A;  2IO0 B;  2G3Q B;  2YEP F;  2YLM A;  2I1K A;  3ZNH B;  4W9C A;  2VRR B;  2BYV E;  4DDG D;  4FHK A;  4XWT A;  1XD3 B;  5KHO A;  4RF1 A;  1BXT A;  2AEH A;  1IBX B;  1BT0 A;  2C9W B;  3FIL B;  3RUI B;  2NMQ A;  4P7I A;  1KLG D;  1TY2 A;  4DWF A;  1KF6 B;  4DHJ B;  2OJW A;  4KKJ A;  1TTN A;  3AEA B;  3TL5 A;  3EC8 A;  3N20 C;  4ANV A;  1F1H A;  3QAR A;  4AUQ C;  2E6X A;  1LO5 D;  4RGT A;  2XNA C;  2QEJ C;  3ZUN A;  3X23 A;  2L1A A;  4IUM B;  4OVU A;  1VJK A;  5EDS A;  1WXM A;  1UWX A;  1AAR A;  2KLC A;  1FM0 D;  3NS8 A;  3VHT C;  5D3D A;  3U52 E;  2QHO A;  2K8B A;  4LNF A;  2BPS A;  4OHJ A;  4RM9 A;  3HIZ A;  3MC9 A;  4LJP B;  4RCO A;  3DCG A;  4JWS C;  1F2R I;  4KDI C;  2V4I B;  4KIK B;  2N7D A;  2WU5 B;  5FR3 A;  3KLS X;  4H2A A;  3SEB A;  3V3X A;  3B1L X;  3EFU A;  3QJZ A;  4K1R B;  1FMA D;  1YMH E;  2Y5P A;  4WQM A;  4HCN B;  5IO9 A;  2DZM A;  3KWV A;  1FD6 A;  1R4N B;  1OQQ A;  4HJK A;  1HE8 A;  1WMH A;  1IBX A;  3QK0 A;  2WYQ A;  3V6C B;  1S3S G;  3DHH C;  2IGH A;  2ZCC A;  3PHX B;  4IM2 A;  1WX7 A;  5IAA C;  4L1B A;  3NRZ A;  3QC8 B;  3V60 A;  1XF5 L;  3TMP B;  3R2I A;  2M0X A;  4BOZ B;  1YJI A;  4HJG E;  2LXC A;  1WYW B;  3A9J A;  1KTK A;  1P3Q U;  1TT5 B;  4W9F A;  1F2R C;  2LGS A;  1NYQ A;  1L4D B;  1N5X A;  4MGY E;  1GC7 A;  2N9X A;  5BMI A;  2BQQ A;  2XK5 A;  1L5P A;  3CWI A;  4GDK B;  3Q3J A;  2AYO B;  2MP2 B;  1FFU A;  2CKH B;  3P1M A;  1DYQ A;  2H88 B;  2WU2 B;  2ONQ A;  1DOI A;  4ZHP A;  4FJZ A;  2LI5 A;  1JWU D;  1WJ6 A;  2PTL A;  5J18 A;  2A5U A;  2O6V D;  3HM6 X;  4YXD B;  2KDB A;  2QIL A;  4IOI E;  4P6V F;  2JT4 B;  3HM3 A;  4ZRP A;  3LJ3 A;  2DWQ A;  3L10 B;  3EUB 2;  2K8H A;  4OW0 A;  2WP9 B;  4HVB A;  1TJE A;  1XCT L;  4GIV A;  4HCP B;  2Q5W D;  2KMA A;  2DX5 B;  4P1C C;  4URK A;  1J19 A;  2JVC A;  4G0N B;  4HRS A;  1GPX A;  1GB4 A;  3MP9 A;  3VTV A;  4GOC A;  4F7Z A;  1RRB A;  2KWU B;  2WHI A;  1WIA A;  1XLP A;  3AM9 A;  2G4S A;  2O2V B;  1WGD A;  1KLU D;  3IT6 B;  4GLS C;  3KUC B;  4YTN B;  3SFE B;  3UQB A;  1UZX B;  4MJS A;  3MTN B;  3LDZ E;  4NNJ B;  3WAO A;  3B0A A;  3EFC A;  1WRI A;  2JYE A;  5DPT A;  3ZQ4 A;  1WGH A;  1C4A A;  3I9V 1;  5G5G A;  4EOY A;  1WRD B;  2W54 A;  3JVZ X;  1V97 A;  1P9D U;  4C56 C;  5CTR C;  2WXH A;  2N1W A;  3P4R B;  2HE7 A;  2M17 A;  2V4L A;  1AN8 A;  3MHZ A;  4EZJ A;  2DZJ A;  3WAN A;  3JW0 X;  1ACC A;  1P0R A;  1H4R A;  3NS1 A;  3OLM D;  4WJP A;  1E10 A;  4MEL A;  4WWO A;  2X38 A;  4IM3 A;  2Y5B B;  3W5U B;  1STE A;  1S1Q B;  2PVG C;  3KH0 A;  2PIA A;  2KZR A;  4JGH B;  3RCZ A;  5KHQ A;  3SD5 A;  3VXW A;  2INP E;  2BWE S;  4IG7 B;  5AZF A;  3OJ3 A;  4TQ1 A;  1M4V A;  2ZVN A;  4NAW B;  2BYF A;  2LHD A;  5E6N A;  1WGG A;  2L32 A;  1GG3 A;  2L05 A;  5IOI A;  5CHF A;  2IO2 B;  1FCL A;  4Q2J A;  1JWS D;  2Z8L A;  4PT5 A;  3P4Q B;  4NJ7 A;  4IDI A;  4M02 A;  1Y8R C;  2WDV B;  3RNF C;  3T3O A;  3ZVV A;  5EE3 A;  2PLP A;  1MI0 A;  1OEY J;  1QOG A;  3BYY B;  1A70 A;  5GMV A;  4C4V B;  2PMV A;  4I6L B;  2AQ2 B;  4J3O D;  3P4S B;  1H8C A;  1V8C A;  1Z5S B;  3GZN I;  2G45 B;  1V49 A;  1FRD A;  2KQ4 X;  3E9S A;  3RUL A;  2O6V A;  2LXA A;  4NAW A;  2RDB C;  2LEK A;  5T8I A;  3ZTC A;  1SBB B;  3VUW A;  4GGQ A;  1MHX A;  4KV2 A;  1N63 A;  2QSD A;  4F8C B;  1MPE A;  2L76 A;  2JWZ A;  2KK8 A;  4DQO C;  1V9J A;  1SEB D;  4A90 A;  2RPQ A;  1YQ4 B;  3P42 A;  2NS5 A;  2NVU I;  4IWO A;  3M62 B;  2LZ6 A;  1TIF A;  1UGM A;  1WI0 A;  2JZZ A;  4WIP A;  1TS3 A;  2L7R A;  2YEP B;  1JAL A;  2D3A A;  4DXF A;  1DOY A;  4XDD A;  1VZ7 A;  5D2M B;  1V5T A;  3BVM A;  2W55 A;  3IHP C;  3TEY A;  1WXV A;  1SSN A;  3KUD B;  5IN7 A;  3A4S C;  3GE3 C;  3HK0 A;  1JWB D;  4AJY B;  3ZIM A;  1WSP A;  2LUM A;  2WQY B;  4ICV A;  1E0Z A;  4XE0 A;  2MBB B;  1FRR A;  4DHZ E;  3TEW A;  1WGR A;  1TKY A;  2WNM A;  1YD8 U;  3P4P B;  3MJ5 A;  3U7D A;  3ZXR A;  4PS7 A;  2L83 A;  1ZDX A;  3AI5 A;  1E90 A;  2SAK A;  3RMK C;  1C78 A;  1RAX A;  5H8Y E;  4F1S A;  1WH3 A;  2BF8 B;  3VVW B;  1K52 A;  1VCB A;  2MHJ A;  4AOF A;  4HDO A;  2KTF A;  1QOA A;  4YSX B;  1SF0 A;  2G4D B;  4HK2 A;  5FKA C;  4CO7 A;  3HRD D;  3TJP A;  4D2K A;  3PRP B;  2Y3A A;  3Q69 A;  4ITK A;  1C4P A;  3FAH A;  1VLB A;  1WR6 E;  1XLN A;  3OWE B;  2MWS B;  3OG5 A;  2R2O A;  4A3O A;  1I4H A;  2WXR A;  4RNA A;  1F77 A;  2Z0D B;  3PT2 B;  2BWF A;  2O6V B;  2KJ6 A;  1K51 A;  3VQI A;  2WX1 A;  1LXD A;  3AE1 B;  4HKQ A;  2JXT A;  4MT5 A;  3BVG A;  2IYD B;  2E3T A;  1Y56 A;  2WXI A;  1ESF A;  2RDG A;  2AWT A;  3H7P B;  3R3M A;  4NJ6 A;  2LJI A;  2KX0 A;  3ZO5 B;  4FHJ A;  2R61 A;  3GOE A;  2N4F A;  3N9Y C;  3I5J C;  3ZTD A;  3NVW A;  1WMH B;  5JZE B;  1FO4 A;  1VR9 A;  4E71 A;  3AEC B;  4ZDV A;  2KLG A;  3UI3 A;  1WM2 A;  3U30 A;  1YOV B;  2DEN B;  4EFO A;  1RM6 C;  1UUP A;  1PGX A;  3EEC A;  1QOF A;  3PO0 A;  2BW2 A;  3SFD B;  3A9J B;  4KZC A;  1FNW A;  5DCN A;  2BVC A;  1RFK A;  4RGM A;  3M3J A;  3UIO B;  3IAM 1;  3V05 A;  4XZ4 A;  1N61 A;  4HRO A;  3RNB C;  2AQ1 B;  3W2D A;  1WFY A;  4QAY A;  1NYR A;  1GNU A;  2KFK A;  3ZLZ A;  3QAQ A;  3DBR I;  2M8S A;  4ZOH C;  1PDX A;  2KAC A;  2KVR A;  2C7H A;  2IO1 B;  4YSY B;  2WXN A;  2FCS A;  2I38 A;  3AU5 A;  4US9 A;  5IP4 D;  1CJE A;  1ZE3 D;  3T8M A;  1PGA A;  2QC8 A;  5D94 A;  1IPG A;  4P16 A;  4JIO U;  5AUK A;  1WR1 A;  4WH4 A;  1R4N I;  4PS8 A;  2MX2 A;  2NBU A;  3Q8F A;  1DOX A;  1E6E B;  1GC6 A;  3DPD A;  1E8X A;  4K3B A;  1ZKH A;  2PPH A;  2GBR A;  2JX5 A;  1V1O A;  4TV3 A;  1RLF A;  1G6J A;  3AE5 B;  2PJH A;  1JWM D;  3DBH I;  2FUG 1;  1UBQ A;  3DBL I;  3RNE C;  1EM7 A;  4CQN A;  2MRP A;  3H6N A;  5BYQ A;  3CF6 E;  5JHA A;  2MJE A;  2VZK B;  3Q8C A;  5EE0 A;  5I4D A;  1NVI D;  2D3C A;  2HJ8 A;  2XBB C;  1QZE A;  2KQ7 A;  5AZH A;  1J0G A;  2JZP A;  2KOX A;  3VR9 B;  1KOT A;  3AU4 A;  4FJV B;  2CS4 A;  3ABV B;  1V80 A;  3ECI A;  3QHT A;  2KVZ A;  3VRA B;  1YX6 B;  3SHQ A;  2KQS A;  3LYY A;  2C7N B;  4RH6 A;  4JWU C;  5AZG A;  2KTR B;  3PLV A;  2M1M A;  1ZXH A;  2NTT A;  2Y5C A;  2RDH A;  3PPA A;  1HEZ E;  2J0J A;  4DDI D;  3DBH B;  3RFZ B;  2KWC A;  2MLB A;  2LVQ A;  2M19 A;  2HD5 B;  1C3T A;  3P63 A;  1CZP A;  3L08 A;  3PRM B;  1E5W A;  2ZEQ A;  1YX5 B;  2MBE A;  2WXO A;  3RNA C;  2UYZ B;  1L6U A;  4EZL A;  1SE3 A;  2FAZ A;  2X8X X;  1WJU A;  1P7F A;  2MJ3 A;  3Q2A C;  2EKI A;  2RPV A;  4MM3 B;  2AL6 A;  2WXF A;  4HPP A;  1L0Y B;  1Q0W B;  1V81 A;  4N59 A;  3ZJV A;  4MH8 A;  4E3C A;  2CU1 A;  1N60 A;  1WXA A;  3QA8 A;  4N58 A;  3PRE A;  1ISN A;  5DPS A;  2WXJ A;  3A9K A;  2NBW B;  1PYW D;  3MC0 B;  2RMM A;  4ANU A;  3NUH B;  4EEW A;  4BKG A;  3E56 A;  1C79 A;  3RZW C;  2ZVO A;  3JSV B;  2JY6 A;  3ZNZ B;  4G11 A;  1TZ1 A;  1K8R B;  3X0W A;  1E8Y A;  3AB5 A;  3DWM A;  3WA0 A;  2L3Z A;  1SE2 A;  1D5M C;  5J17 A;  2JUO A;  2IGD A;  3L0W B;  4A6Q A;  1TS4 A;  4FBJ B;  4DXG A;  4TKN A;  4C4V A;  3VR8 B;  2PVO D;  2NPT B;  2LVO A;  2KN5 A;  2J0K A;  4OZA A;  1F9J A;  3PZ8 A;  5GXG B;  4BZA A;  3A9K B;  3PVL A;  1I7H A;  3BY4 B;  3BYT B;  3VH4 B;  3MHS D;  4AQ7 A;  5DPR A;  4LNN A;  3H1U A;  2K8C A;  1C1Y B;  1YIW A;  4WWP A;  2FIF A;  1YQB A;  4NQK E;  2N9E B;  4W9H A;  2BT6 A;  1FPY A;  3CIR B;  3L17 A;  1VDV A;  5LLI A;  1I4G A;  2D3G A;  4CYE A;  1ET9 A;  4NY0 A;  1SB3 C;  2GBJ A;  4K81 A;  2J7Q B;  2V3N A;  2MQJ A;  1GJZ A;  2FE8 A;  4NZL B;  4CHK A;  4B95 A;  4USA A;  2TSS A;  2M0A A;  3QWZ B;  4WAF A;  3TSS A;  1SGH A;  3DBL B;  4BVU C;  3UF8 A;  1ZPS A;  3PZD A;  3Q8E A;  4WQO B;  3Q3F A;  4MH0 E;  3AE6 B;  2MBO A;  2L52 A;  4BFR A;  1QOB A;  2BTE A;  2K39 A;  4N6E B;  4PYZ A;  3ENE A;  3AE2 B;  3R66 C;  4AWJ A;  1QF6 A;  1YN5 A;  3PHW B;  5D6J B;  3MJW A;  1B9R A;  1QLB B;  1MVK A;  4ARC A;  1N6Z A;  1J7C A;  2K1F A;  3GZN B;  4JQW C;  2DAF A;  2IDY A;  2K0P A;  1YN4 A;  4ZRQ A;  4WWM A;  2DLB A;  5TSS A;  2PE9 A;  3HVD A;  3B2F A;  4EE2 A;  3VRB B;  2R2Q A;  3TEX A;  2VZK D;  5E6O A;  1SIF A;  3A1Q A;  1V1P A;  4WUR A;  3T3N A;  1WF9 A;  5E6J A;  1GAQ B;  2VH2 A;  1VD2 A;  1UH6 A;  2KDF B;  4YWG G;  4M01 A;  3L13 A;  4TQ0 A;  1C4C A;  3W1S C;  2OJR A;  1SJE D;  2DBY A;  4II2 B;  3Q3M C;  3BZD B;  2LMC A;  5AUI A;  3BK2 A;  4W9E A;  4MGI E;  1SJH D;  3PS6 A;  3C19 A;  4XDC A;  2WXM A;  1TGZ B;  1XXG A;  4REZ A;  4OVZ A;  3EHV A;  1HZ5 A;  4TMA B;  3Q14 C;  2EKE C;  2AX5 A;  4LNK A;  4R3D A;  2FCQ A;  4YTM B;  5G55 A;  5TR5 A;  2N1V A;  1MFW A;  2DYB A;  5C2T B;  3NHE B;  1V86 A;  3BII D;  3KYC D;  3ZW3 A;  5AEK B;  3H7P A;  2J52 A;  4B0M A;  2DZK A;  3KQ4 A;  4WJO A;  1XLO A;  1HQR D;  4JX1 C; 
#chains in the Genus database with same CATH homology
 1NBF C;  4MJS B;  3VH3 B;  3U8Z A;  4PS3 A;  2MWS B;  1FXT B;  4IUM B;  2CHX A;  2O2V A;  2R2O A;  4OVU A;  3VUX A;  4A3O A;  4DBG A;  1WZ3 A;  5EDS A;  1WXM A;  2N7E A;  4MM3 A;  3NZU A;  3VAW A;  1X1M A;  1XT9 B;  2XK5 B;  2LGX A;  4AP4 C;  2Z0D B;  1AAR A;  2KLC A;  3DVN U;  3PT2 B;  4I6N B;  3WIM A;  3UIN B;  2BWF A;  2O6V B;  3NS8 A;  3K9O B;  3SU8 X;  3VHT C;  2KJ6 A;  4JL9 A;  2C60 A;  3DQV A;  3VQI A;  4OVV A;  2WX1 A;  3M95 A;  2BGF A;  4GB9 A;  1LXD A;  3BIN A;  2IO3 B;  5E6P A;  2QHO A;  2N9P C;  2K8B A;  2BPS A;  2D10 A;  3CSF A;  4RM9 A;  2IYD B;  4HPL B;  1RFA A;  3HIZ A;  4LJP B;  2KO3 A;  3ZNG C;  3DCG A;  2AWT A;  1UBI A;  3H7P B;  3R3M A;  4NJ6 A;  5LXH A;  2KX0 A;  3ZO5 B;  4FHJ A;  3GOE A;  2N4F A;  2KDI A;  4KDI C;  1KM7 A;  4KIK B;  2N7D A;  1WJ4 A;  4ICU A;  3RYT A;  1A5R A;  2W9N A;  3ZTD A;  2KAN A;  1WMH B;  1Q1O A;  2MBH A;  3B1L X;  1P1A A;  3EFU A;  4EZK A;  2YVC A;  5JZE B;  3QJZ A;  4K1R B;  4E71 A;  4ANX A;  1I42 A;  3V61 A;  4ZDV A;  2KLG A;  3DBS A;  2GBM A;  2JRH A;  1WM2 A;  3R7R A;  2BKR B;  2GBN A;  3U30 A;  3PSE B;  4HCN B;  2D07 B;  4GDL B;  2DEN B;  2DZM A;  1WY8 A;  2KX3 A;  4EFO A;  4YL8 A;  2NPT A;  3VDZ A;  2UWQ A;  3EEC A;  1J8C A;  3KW5 B;  5CHW A;  3A9J B;  5FR6 A;  1WGY A;  4HJK A;  1HE8 A;  3V62 A;  4KZC A;  5DCN A;  5L95 C;  3UIO B;  3A33 B;  1WMH A;  3M3J A;  2V1Y A;  5DPW A;  3QK0 A;  4XZ4 A;  2WYQ A;  3V6C B;  3W1Y A;  1OGW A;  1S3S G;  2ZCB A;  1WFY A;  3DOW A;  1GNU A;  2LGY A;  2KFK A;  3ZLZ A;  2ZCC A;  3PHX B;  4IM2 A;  1WX7 A;  4MSQ B;  2CHZ A;  5IAA C;  2NR2 A;  3DVN V;  1OTR B;  3QAQ A;  3DBR I;  2M8S A;  2JXX A;  3QC8 B;  3T9L A;  3V60 A;  2KVR A;  2C7H A;  2IO1 B;  2MP2 A;  5CHV C;  1EF5 A;  3WAM A;  3TMP B;  2FCS A;  3ML8 A;  2M0X A;  2C7M B;  3AU5 A;  4BOZ B;  5D7G A;  2BYE A;  2LXC A;  1WYW B;  3A9J A;  4LCD E;  4FLH A;  3T8M A;  1P3Q U;  1WX8 A;  4BKS A;  4W9F A;  4MEM A;  5D94 A;  2L0F A;  1IPG A;  4MGY E;  4JIO U;  3NY5 A;  2LUE A;  1WR1 A;  1R4N I;  4AJW A;  1GC7 A;  2HTH A;  2N9X A;  4PS8 A;  2MX2 A;  4IWP A;  2NBU A;  2FNJ B;  2XK5 A;  1GC6 A;  3DPD A;  2FCN A;  1LM8 B;  1E8X A;  3TIX A;  2Z0E B;  3VFK A;  1ZKH A;  2ASQ A;  2PPH A;  4FJY A;  4W9K A;  2GBR A;  4NPN A;  4GDK B;  1IYF A;  3M63 B;  3Q3J A;  5C23 A;  2AYO B;  2MP2 B;  3K9P B;  1U4A A;  4TV3 A;  1RLF A;  1G6J A;  4KVG B;  2WX0 A;  2PJH A;  2ZNV C;  4LDT D;  2CKH B;  2JF5 A;  3VUY A;  4GU2 A;  4ZRK A;  3DBH I;  4B6W A;  3ZNI D;  2KMC A;  3KVF B;  1E7V A;  4DXA B;  4FJZ A;  1UBQ A;  2LI5 A;  2DHZ A;  1WJ6 A;  3DBL I;  4XX5 A;  5J18 A;  4HLE A;  2MRP A;  3H6N A;  2A5U A;  1R4M I;  2O6V D;  2D11 A;  3HM6 X;  3CF6 E;  4PYU A;  3H9D A;  4ZYN A;  1V6E A;  2FUH B;  5JHA A;  3NOB A;  2KDB A;  4DK5 A;  2HJ8 A;  2XBB C;  1WM3 A;  1WXS A;  1QZE A;  2KQ7 A;  5AZH A;  1J0G A;  2KOX A;  4BBN C;  1KOT A;  3AU4 A;  1YJ1 A;  3ONS A;  2JT4 B;  1ZW7 A;  4FJV B;  4GMV A;  4LDT B;  3HM3 A;  1WZ0 A;  3CMM B;  3APF A;  4KZ0 A;  3VTU A;  2CS4 A;  3OJ4 B;  3LJ3 A;  2KWV B;  2GOW A;  1EUV B;  3L10 B;  1V80 A;  3ECI A;  1I35 A;  3QHT A;  3A1Q B;  2K8H A;  1SE9 A;  1YX6 B;  3PGE A;  3SHQ A;  5G2N A;  2KQS A;  2L0T A;  3IVF A;  4KDL B;  2L8J A;  2A4Z A;  4HVB A;  2C7N B;  2JPH A;  3PV1 A;  4G50 A;  3ZRF A;  2RSU A;  4GIV A;  5AZG A;  4HCP B;  4X57 B;  2KTR B;  3VTW A;  2KMA A;  3ZDM C;  1KJT A;  4W9J A;  3AUL A;  4BOS C;  3PLV A;  2M1M A;  3JYU A;  5LXI B;  2RGF A;  2DX5 B;  4W9D A;  3NZS A;  4URK A;  3PPA A;  4I6P A;  2J0J A;  4DDI D;  1J19 A;  2KWC A;  2MLB A;  3A4R A;  2LVQ A;  1M94 A;  1JRU A;  2JVC A;  4G0N B;  4W9G A;  3R7Q A;  3X23 A;  2AL3 A;  2HD5 B;  4N9F 4;  2MA9 B;  1C3T A;  4NQL B;  3ML9 A;  3VTV A;  3I3T B;  1L7Y A;  4GOC A;  4KIK A;  3L08 A;  4F7Z A;  1Z2M A;  1RRB A;  2KWU B;  1WIA A;  5CX3 A;  3PRM B;  2G4S A;  2O2V B;  3WAP A;  1E5W A;  2ZEQ A;  1WGD A;  1YX5 B;  2LD9 A;  2MBE A;  1MG8 A;  3KUC B;  2GMI C;  2UYZ B;  3QX1 A;  3UQB A;  1UZX B;  4MJS A;  3MTN B;  3LDZ E;  3N32 A;  4NNJ B;  3B0A A;  3JSV A;  3WAO A;  3ZDT A;  4EZL A;  2IZV B;  3L16 A;  2FAZ A;  1WJU A;  1TBE A;  3SDL C;  2KDE B;  5DPT A;  3CST A;  2V3S A;  2AL6 A;  5HKH A;  1WGH A;  2IY0 B;  4WJN A;  4HXD A;  2KJR A;  1Q0W B;  1V81 A;  3PRZ A;  4E3C A;  1E8W A;  4IM0 A;  4EOY A;  2CU1 A;  1WRD B;  3JVZ X;  3IBE A;  4IWQ A;  4KSL C;  1WXA A;  4MDK E;  1P9D U;  2FCM A;  3QA8 A;  4ZRI A;  2CR5 A;  1ISN A;  1WE6 A;  3PRE A;  5DPS A;  2KJH B;  2KKC A;  4TUU A;  3A9K A;  1PQS A;  2WDT B;  5CTR C;  3RZF A;  2NBW B;  1CMX B;  2N1W A;  4K7U A;  3WAL A;  2HE7 A;  4ANU A;  5JHB A;  4EEW A;  5J2R A;  2M17 A;  2IBI B;  2NBV B;  4BKG A;  2V4L A;  4DHZ B;  4J6I A;  1OQY A;  4XC2 A;  4MSM B;  3RZW C;  4EZJ A;  2DZJ A;  2ZVO A;  3WAN A;  2MW5 A;  2JY6 A;  3JSV B;  3N30 A;  3ZNZ B;  1V2Y A;  2L00 B;  4G11 A;  3JW0 X;  1TZ1 A;  3OAW A;  1K8R B;  1H4R A;  1P0R A;  1E8Y A;  4GSW A;  3X0W A;  3WA0 A;  4EKU A;  2L3Z A;  2PE6 B;  2RR9 A;  3HHM A;  3OLM D;  4WJP A;  4K7W A;  4MEL A;  5J17 A;  4WWO A;  2JUO A;  4IM3 A;  2Y5B B;  3L0W B;  2ZPN A;  4FUL A;  3DVG X;  3UGB B;  1S1Q B;  4II3 B;  4FBJ B;  4M0W B;  4MGK E;  4TKN A;  3KH0 A;  2KZR A;  4LJO B;  4WJQ A;  4JGH B;  4GXB A;  3RCZ A;  5KHQ A;  2KNB A;  1NDD A;  2MBQ A;  2NPT B;  3SD5 A;  2LVO A;  2KN5 A;  3VXW A;  1L2N A;  2BWE S;  2KHW B;  2J0K A;  3AXC A;  4IG7 B;  3H7S A;  1F9J A;  2KFK B;  5AZF A;  4BKS D;  3OJ3 A;  1GUA B;  1ZGU B;  4TQ1 A;  3A9K B;  3PVL A;  3PLU A;  2ZVN A;  4NAW B;  2KC2 A;  3BY4 B;  2BYF A;  2MSE D;  4GDK A;  2LAS A;  2ZNV B;  5L83 A;  5IA7 A;  5BO4 B;  1EF1 A;  5E6N A;  1WGG A;  2ZJD A;  3PTF C;  1GG3 A;  3MHS D;  2L05 A;  3VH4 B;  3O65 B;  5CHF A;  5DPR A;  2LGD A;  2IO2 B;  2LJ5 A;  4ANW A;  4NJ7 A;  2JZ3 B;  4JLC A;  3H1U A;  2XEW A;  1Y8R C;  2K8C A;  4BKT A;  1C1Y B;  1YIW A;  3KUZ A;  1UD7 A;  1WE7 A;  4WWP A;  3ZVV A;  4IW0 A;  3RD2 A;  2ZPY A;  3DVG Y;  2FIF A;  1YQB A;  2C5L C;  4NQK E;  1OEY J;  2DYO A;  2N9E B;  4W9H A;  2M4N A;  5GMV A;  2BKF A;  3L17 A;  4FN2 A;  5LLI A;  1Q5W B;  2KFJ A;  1WX9 A;  2LVP A;  4I6L B;  3B08 A;  2D3G A;  2REX A;  4CYE A;  3ZRC A;  1H8C A;  4NY0 A;  1Z5S B;  2KXJ A;  4EUT A;  3GZN I;  2LRU A;  2G45 B;  3ZKJ C;  4ASW C;  1P98 A;  2GBJ A;  1V49 A;  4G3X B;  4K81 A;  3W1S A;  3UQA A;  4FA6 A;  2J7Q B;  3UIP B;  2NCN A;  2MQJ A;  1GJZ A;  3RUL A;  2O6V A;  4CHK A;  4B95 A;  2LXA A;  4NAW A;  2K25 A;  3QWZ B;  2IY1 B;  3ALB A;  1LQB A;  1SGH A;  2KC1 A;  3ZTC A;  3VUW A;  4MGZ E;  3APC A;  3V6E B;  4GDL A;  4GGQ A;  2I1J A;  2LWP A;  4KV2 A;  2ZZP B;  4KSK C;  4BVU C;  3UF8 A;  4F8C B;  3PZD A;  2EMT A;  2WWZ A;  4WQO B;  3Q3F A;  4MH0 E;  2L76 A;  2JWZ A;  2B3A A;  2OOB B;  2DZI A;  4E74 A;  1V5O A;  3QIJ A;  2KK8 A;  2MBO A;  1V9J A;  1E8Z A;  4M8N A;  3N3K B;  4K7S A;  3D32 A;  4GN1 A;  2RPQ A;  4BFR A;  2CHW A;  4W9L A;  2K39 A;  2NS5 A;  2D2Q A;  2PEA A;  2NVU I;  4IWO A;  1OEY A;  3M62 B;  4PYZ A;  2LZ6 A;  3ENE A;  3R66 C;  4AWJ A;  1WI0 A;  1UGM A;  2JZZ A;  4DHJ D;  1D3Z A;  4BBN F;  3PHW B;  5D6J B;  3MJW A;  2L7R A;  3TCA A;  2Z59 B;  4HPM B;  1XQQ A;  2K1F A;  4JQW C;  1IP9 A;  2DAF A;  3APD A;  4WWN A;  3IG3 A;  4HWI B;  5C1Z A;  3DDC B;  1LFD A;  4RM8 A;  1KLV A;  1EO6 A;  1V5T A;  5D2M B;  2GBK A;  2K6D B;  2PE9 A;  3QCA A;  4M8M A;  3QQ8 B;  3KYD D;  2KTR A;  4FAD A;  2R2Q A;  3IFW B;  4WAA A;  2DYM A;  3IHP C;  5E6O A;  1SIF A;  2FID A;  2LRW A;  5JH5 C;  3A1Q A;  1WXV A;  4IC7 B;  1NI2 A;  2IO0 B;  2G3Q B;  3KUD B;  1WF9 A;  2YLM A;  2I1K A;  2K6Q A;  3A4S C;  3HK0 A;  3ZNH B;  4A3P A;  4W9C A;  4AJY B;  2VRR B;  3ZIM A;  2BYV E;  4W9I A;  4DDG D;  1VD2 A;  1UH6 A;  4FHK A;  1XD3 B;  4ICV A;  2KDF B;  2J0M A;  5KHO A;  2MBB B;  3TBL D;  3L13 A;  4TQ0 A;  4DHZ E;  3W1S C;  1WGR A;  2AEH A;  2OJR A;  1BT0 A;  2C9W B;  1YD8 U;  3RUI B;  4II2 B;  3U7D A;  4ZRJ A;  4W9E A;  2MCN B;  4PS7 A;  3PS6 A;  4MGI E;  2JRI B;  3AI5 A;  1E90 A;  1TGZ B;  2KD0 A;  4P7I A;  3EHV A;  1RAX A;  2EKE C;  4RMA A;  1WH3 A;  2BF8 B;  3VVW B;  4DWF A;  4F1S A;  4DHJ B;  1VCB A;  4AOF A;  4HDO A;  2FCQ A;  3P2B A;  4A20 A;  2RD0 A;  1TTN A;  5G55 A;  5TR5 A;  2N1V A;  1T0Y A;  2KTF A;  3TL5 A;  3EC8 A;  4B9K A;  2DYB A;  4HK2 A;  2G4D B;  3RT3 B;  4ANV A;  2EMS A;  4CO7 A;  3C0R B;  3TJP A;  1UEL A;  3NHE B;  1V86 A;  3PRP B;  3QAR A;  1E7U A;  1WJN A;  3KYC D;  4AUQ C;  4HDQ A;  3ZW3 A;  5AEK B;  3H7P A;  2DZK A;  3L54 A;  3S2A A;  4WJO A;  2DAJ A;  3ZUN A;  1WR6 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...