4WJPA

Crystal structure of sumo1 in complex with phosphorylated daxx
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
79
structure length
79
Chain Sequence
GEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYAQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small ubiquitin-related modifier 1
publication title Structural and Functional Characterization of the Phosphorylation-Dependent Interaction between PML and SUMO1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/signaling protein
total genus 23
structure length 79
sequence length 79
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4wjpA00
2LGDA 1S3SG 2N7EA 4W9JA 2BF8B 4FA6A 3WAPA 1C1YB 3TCAA 1CMXB 1WJ4A 2MRPA 4W9EA 1SIFA 2D3GA 4ANXA 4EZJA 4G3XB 3QX1A 1HE8A 2BKFA 1UBQA 2V3SA 3A1QA 2V4LA 4MGKE 4LDTD 4EFOA 2IZVB 2Z0EB 2MBQA 2D11A 2KDIA 2PE9A 3PRPB 3UQBA 3JW0X 2M4NA 4EKUA 4EUTA 2M0XA 2K8CA 2G4DB 3TIXA 4KDIC 2KTFA 2LGXA 2DZIA 3NOBA 3JVZX 3HM3A 1GG3A 1V81A 2BWES 1Z5SB 1LM8B 2FCQA 2K8HA 3ALBA 3VTVA 5EDSA 1IYFA 4PS3A 3L54A 2LVQA 2CHXA 3WA0A 2DX5B 2MBBB 2L00B 2ZNVB 3R7RA 1OEYJ 3GOEA 3PTFC 4JIOU 3N30A 1WGHA 3CSFA 2MLBA 4BBNC 2JRHA 5J18A 4I6NB 4GU2A 2RGFA 2REXA 4PS7A 1MG8A 3QC8B 4B6WA 3OJ3A 1UZXB 4CHKA 1GC7A 2PEAA 2XK5A 2JPHA 3A9JA 4DDGD 3RZWC 3UIPB 1UBIA 2JWZA 2KTRB 3AU5A 3KUCB 2DZMA 1WIAA 4A3OA 4EZLA 4K7WA 2GBMA 4GOCA 4BOSC 3A33B 1WJ6A 1WXSA 3HK0A 3LDZE 3QARA 1UGMA 1OTRB 3WANA 2MA9B 2ZVOA 1WGRA 3QIJA 3SU8X 3X23A 3PVLA 3UIOB 2A4ZA 3EECA 1E8XA 3L10B 4NQLB 3D32A 2FUHB 2K1FA 1TBEA 2IBIB 5HKHA 1R4MI 1GC6A 2FIDA 3SDLC 1GJZA 5C1ZA 4DHZE 2EKEC 2N9XA 4GB9A 5G2NA 2NPTA 2KKCA 3K9PB 2KX3A 2MBHA 1WRDB 2KMAA 2AL6A 2C60A 2CHWA 2JT4B 2L05A 2LVOA 4AOFA 4HCPB 1R4NI 2KK8A 1P3QU 1L7YA 4MSQB 2KANA 2M17A 3L17A 2LWPA 4NPNA 2FAZA 2KJ6A 2J0JA 3VTUA 1E5WA 5D6JB 3ZNID 2K6DB 1TGZB 2KLGA 4KIKA 3KVFB 2DYOA 2HJ8A 2N7DA 4GMVA 2BGFA 1WR1A 4DHJB 3V60A 2HTHA 2BYFA 4HWIB 4KV2A 2QHOA 2MW5A 4BFRA 3PPAA 1JRUA 1YX6B 1WMHA 3V6CB 2JUOA 4RM8A 4W9LA 2FIFA 3JYUA 2GBKA 5DCNA 2DYMA 3QA8A 1D3ZA 2GBNA 1EF5A 5AZHA 4KDLB 4JL9A 4GDKB 3TL5A 5GMVA 3V62A 2EMTA 3ZW3A 3A4RA 2JF5A 3B0AA 1E7UA 1WJUA 2L7RA 2ZJDA 4KVGB 3P2BA 2KQSA 2KXJA 4GDLB 3QJZA 2KOXA 3PRMB 4PYUA 1OGWA 4K7UA 2HD5B 1E8WA 3SD5A 1X1MA 5J17A 3ECIA 2DENB 2KWCA 3APCA 2M8SA 2ASQA 2GBRA 2KN5A 3A9KA 2WYQA 3HIZA 1KJTA 3H1UA 1M94A 4FJVB 3RUIB 3OLMD 3WALA 2YVCA 1P98A 1YQBA 3L0WB 3TMPB 3VAWA 3APFA 4LJPB 3VUWA 5J2RA 2DYBA 4MELA 3B08A 3JSVB 1OQYA 3EHVA 4GN1A 3R7QA 2ZZPB 4K81A 5CTRC 4HJKA 2KVRA 2BYEA 3PGEA 4WJNA 1J19A 1WGDA 3I3TB 3DVGX 3TJPA 4F1SA 1P9DU 2AEHA 4HXDA 3RYTA 4F8CB 2CU1A 4WAAA 3AULA 1J0GA 5E6NA 1IPGA 1V49A 1ISNA 3T9LA 1RAXA 1RLFA 3L13A 1WGGA 1YJ1A 2XEWA 3ZNZB 4MGIE 1UELA 4X57B 1KM7A 2CR5A 4DWFA 1EF1A 2ZNVC 2O2VB 3ONSA 1E8ZA 4MDKE 3PLUA 2BYVE 3CSTA 4BKSA 1GNUA 2W9NA 4ZDVA 5G55A 2O6VB 2V1YA 5IA7A 2NS5A 3T8MA 5KHOA 2C7NB 1V86A 2LD9A 4KZCA 4ICUA 5E6PA 4ZYNA 4AWJA 2KX0A 1XD3B 3UINB 4BVUC 1GUAB 4MGYE 3R3MA 2HE7A 4II2B 4IWPA 4W9CA 3VHTC 3H7SA 3VUYA 1AARA 1E90A 1P0RA 1QZEA 4G50A 2N9PC 2MSED 2KTRA 3PREA 4IC7B 2AL3A 2KDBA 2DZKA 1WYWB 4NJ6A 3UF8A 2RD0A 4MJSB 1VD2A 3ZUNA 3RD2A 2J7QB 5KHQA 2KFKB 2JZZA 2MX2A 5JHBA 2D10A 2MBOA 2IO3B 3L08A 4KZ0A 2B3AA 2LVPA 2GOWA 3ZDTA 3UQAA 4W9IA 3SHQA 2K25A 3NS8A 1P1AA 2MP2B 4IUMB 3OJ4B 4MGZE 1J8CA 1ZGUB 3EC8A 2C9WB 2I1KA 4WWPA 1WH3A 2NVUI 5LLIA 4FBJB 3BY4B 1UH6A 2NR2A 4MH0E 3RZFA 4HPMB 2Z0DB 1V5TA 4NY0A 3ZLZA 3PV1A 2G45B 4EOYA 2N1VA 3DVNU 3VFKA 2FCSA 3H9DA 1LQBA 1IP9A 4IWOA 3CF6E 3IVFA 4K7SA 3DVGY 1WM2A 1L2NA 5D94A 4NQKE 5DPRA 2LXCA 3DBRI 5BO4B 4ASWC 2L3ZA 1EUVB 5DPSA 2FCMA 1KOTA 4BBNF 3UGBB 4LDTB 1TTNA 3Q3JA 3ZRCA 1RFAA 1T0YA 4IM0A 4IWQA 2WDTB 3KW5B 1NBFC 3RCZA 3AXCA 2KJHB 4K1RB 3PRZA 3U7DA 3ML9A 2CS4A 4GDKA 3WAOA 2R2QA 2A5UA 2KMCA 3GZNI 1V5OA 2LJ5A 5IAAC 5JZEB 4ZRJA 2C5LC 1EO6A 2KQ7A 4IM3A 1NI2A 2KWUB 3S2AA 4GDLA 1U4AA 2LGYA 4XZ4A 3ZDMC 2PJHA 3ZO5B 2D2QA 2LRWA 3X0WA 1WE6A 3PT2B 2KFJA 1LXDA 4AJWA 4HLEA 1LFDA 1WF9A 3H7PB 3HHMA 2BWFA 2JXXA 2EMSA 1V2YA 4BKSD 2DAFA 3DBHI 3QQ8B 2L0TA 3JSVA 3KYDD 4FHJA 3PLVA 4TUUA 4WJOA 4HK2A 1TZ1A 1WXVA 4MM3A 1WJNA 4GIVA 1OEYA 2KZRA 4J6IA 3RT3B 3O65B 4ZRIA 3ZTCA 1ZW7A 5TR5A 3IHPC 1NDDA 3WAMA 1E8YA 1PQSA 3N32A 1WGYA 1XT9B 1WFYA 3HM6X 4NAWB 3VUXA 5D7GA 4MEMA 4AP4C 5AZGA 2O2VA 3RULA 4M8MA 3VH3B 2FNJB 4TKNA 5AEKB 2J0MA 5CHWA 1I35A 4G11A 4B95A 4WJQA 2O6VA 5LXHA 2BPSA 4E71A 2AWTA 5L83A 2PPHA 3LJ3A 3PZDA 3ZRFA 3NZUA 4RMAA 5JHAA 2GMIC 3B1LX 1UD7A 3APDA 3QK0A 3ZKJC 2UWQA 4TQ0A 2RPQA 3R66C 3QAQA 1KLVA 4WWNA 4BOZB 3DPDA 1WX7A 4FJZA 4LCDE 1I42A 3VH4B 2KWVB 4ANVA 1XQQA 3IG3A 2M1MA 4GGQA 4IW0A 4KSLC 2I1JA 4MJSA 4DK5A 2FCNA 3MHSD 4FLHA 1WI0A 1WM3A 4MSMB 2IY0B 2KFKA 2KC1A 2WX0A 3VXWA 4CYEA 4ANUA 2LUEA 4CO7A 2N4FA 4JGHB 4BKGA 4TQ1A 4WWOA 2MWSB 3DOWA 3ZIMA 2LXAA 3MTNB 2G4SA 2NBWB 4AUQC 4ANWA 4URKA 2LI5A 4FULA 5D2MB 4FJYA 4GXBA 4HPLB 5DPTA 4IM2A 4NNJB 2MP2A 3A1QB 1WX8A 5AZFA 4DHJD 4FHKA 3VQIA 1Q5WB 4TV3A 3KYCD 1WE7A 3EFUA 4W9DA 2CKHB 3PHWB 4W9KA 2OJRA 1H4RA 4HCNB 5CHVC 3IBEA 5E6OA 5C23A 2MCNB 2OOBB 3K9OB 5JH5C 2C7MB 4M0WB 1Z2MA 2K6QA 4HDOA 1SE9A 2MBEA 4WQOB 2IO1B 1RRBA 4JQWC 4JLCA 3ZTDA 3BINA 3OAWA 2XBBC 2ZVNA 3TBLD 3ML8A 1YIWA 2J0KA 1YX5B 3KUDB 3AU4A 4PYZA 4W9GA 3ZNGC 4A3PA 2N9EB 4KSKC 1E7VA 3W1YA 3AI5A 4F7ZA 3U8ZA 2IO0B 2L8JA 3VTWA 2LZ6A 4B9KA 1WR6E 3H6NA 2NBUA 1WZ0A 1BT0A 1A5RA 3ZNHB 1G6JA 3VVWB 5LXIB 1WY8A 2IO2B 1SGHA 2XK5B 2Z59B 3A9JB 3NZSA 4BKTA 2VRRB 1Q1OA 1V6EA 4OVUA 4WJPA 1ZKHA 3M62B 5CX3A 2C7HA 3PS6A 4HVBA 4XX5A 2MQJA 3C0RB 3DCGA 2DZJA 1YD8U 2WX1A 4N9F4 4DHZB 3NHEB 3DDCB 3DBSA 5FR6A 2CHZA 3DBLI 1WZ3A 4XC2A 4E3CA 1VCBA 4DBGA 4I6PA 4YL8A 2GBJA 4ZRKA 4DDID 3U30A 2IY1B 2ZEQA 2DHZA 2KDFB 3H7PA 3V61A 3DVNV 4FADA 1WX9A 1WXMA 2KLCA 2NPTB 2O6VD 5L95C 3ZVVA 2Y5BB 3VDZA 5DPWA 4NJ7A 2BKRB 1Y8RC 4GSWA 2RSUA 2NBVB 4HDQA 4RM9A 2KC2A 3M63B 2KO3A 2DAJA 2K8BA 4II3B 2YLMA 3DQVA 2IYDB 4KIKB 2N1WA 3QCAA 4AJYB 1WXAA 1FXTB 2AYOB 2JRIB 2JVCA 2KD0A 3ENEA 3M95A 3N3KB 4NAWA 3WIMA 4DXAB 3L16A 2ZCBA 4FN2A 2L0FA 3Q3FA 2ZPYA 1H8CA 3V6EB 4A20A 2K39A 1WMHB 4G0NB 2RR9A 3CMMB 3NY5A 3QWZB 1K8RB 4M8NA 2KHWB 4P7IA 1F9JA 1Q0WB 2WWZA 3KUZA 4OVVA 2LASA 2KDEB 2LRUA 3KH0A 3PHXB 4W9FA 3PSEB 4LJOB 3A4SC 2UYZB 3W1SC 4EZKA 3M3JA 2L76A 2PE6B 2JY6A 2D07B 2JZ3B 2NCNA 3W1SA 4I6LB 2KNBA 4W9HA 1C3TA 3A9KB 3IFWB 3QHTA 2G3QB 2ZPNA 3MJWA 4IG7B 4EEWA 1V9JA 4E74A 4PS8A 2R2OA 1V80A 2ZCCA 1S1QB 2KJRA 4ICVA 5CHFA
chains in the Genus database with same CATH superfamily
4KKJA 4OZCA 1C1YB 4ANXA 1WYGA 2MRPA 1CJEA 4W9EA 3HRDD 4EZJA 2INPE 4Q2JA 3LXFA 2WLBA 1XCTL 4LDTD 3LB8C 3PRPB 2D11A 1Q10A 1I4PA 3UQBA 1R7SA 3MP9A 3VR8B 1ET9A 4M0WA 1JW9D 2OJWA 2YEPF 2LGSA 2DZIA 1NYQA 3ALBA 1IYFA 2J42A 4PS3A 2WXHA 1ZPSA 3CIRB 2L00B 3GOEA 1SXTA 1YNTE 1C79A 4GU2A 2KN4A 1F77A 1UZXB 2V3PA 1SJED 2JWZA 2KTRB 3H8HA 4JWSC 1WIAA 4A3OA 4GOCA 3A33B 1WXSA 2WQYB 3QARA 4KKIA 1FO4A 2WGSA 1E6EB 3BWUD 1FFUA 3ETRA 2A4ZA 2PW9A 3EECA 3L10B 4NQLB 2LJIA 5IP4D 3NS1A 1GJZA 2EKEC 4RGNA 2KKCA 3K9PB 2MBHA 2I38A 1WRDB 2AL6A 2L05A 3L4PA 4XYCA 4AOFA 3IT4B 2M17A 3L17A 2J0JA 1E5WA 2DNFA 5D6JB 3ZNID 4RNAA 2HJ8A 1C4AA 4RGTA 2BYFA 2LEKA 4KV2A 2MW5A 1WMHA 3V6CB 4HPPA 1FCCC 1F0ZA 1YJJA 2FIFA 2GBKA 2BS3B 4AQ7A 2DYMA 3QA8A 1D3ZA 1ZXHA 5AZHA 3RNEC 3V62A 2CJOA 2KOXA 2VZKD 1OGWA 1E8WA 4M01A 2DENB 2KWCA 3NVYA 3A9KA 2WYQA 3H1UA 3OLMD 2YVCA 2SAKA 1P98A 3TMPB 5J2RA 4LJPB 2K5PA 3B08A 2JQRB 3R7QA 4MM3B 1XLOA 3PGEA 2GB1A 3DVGX 3TJPA 4F1SA 1OQRA 2CU1A 5E6NA 1V49A 1RAXA 4TSSA 2XEWA 3ZNZB 1E7PB 4X57B 1KM7A 4DWFA 1E8ZA 3RNFC 1XLNA 1DOIA 4BKSA 3CSTA 1ZUD2 3R2TA 1QILA 4KZCA 5E6PA 1ESFA 3BVGA 4BVUC 1GUAB 2HE7A 1P0RA 4G50A 2PTLA 3BVZA 3OG5A 3RI7C 1WYWB 1VD2A 5C3JB 1DYQA 2D10A 2QDFA 1KLGD 3NZ3A 3NS8A 1J8CA 1UH6A 4C7ZA 1WXQA 3RZFA 4YSZB 2G45B 5D3DA 1C4CA 1YJIA 3CF6E 2XN9C 4K7SA 2JWUA 3N1XC 5D94A 1L2NA 4ASWC 2L3ZA 1LO5D 2BVCA 2FCMA 1KOTA 1N63A 1Y56A 4LDTB 3Q3JA 4IWQA 2WDTB 2WXFA 2KJHB 3Q14C 1F52A 3PRZA 3ML9A 2CS4A 4GDKA 3FILA 3T3OA 2KMCA 4JPSA 2LJ5A 1XF5L 5JZEB 1JQ4A 2KWUB 3TEZA 2KQ4X 4GDLA 3KWLA 4A55A 2PJHA 1I4QA 1T6BX 3HVDA 4TMAB 3AE4B 3H7PB 3HHMA 1V2YA 2DAFA 3DBHI 4A90A 3GE3C 4WJOA 3SFDB 1VZ8A 1K51A 3OWEB 1IUEA 3IHPC 2ON8A 1E8YA 4NAWB 2V9HA 4AP4C 2O2VA 3RULA 2FNJB 5CHWA 4B95A 2PMVA 2IDYA 3FC4A 5LXHA 2BPSA 2HTME 3LJ3A 4RMAA 3ZYYX 4TQ0A 1FFVA 3N1YC 1D4BA 3EA6A 1KLVA 4BOZB 3DPDA 4LCDE 3W2DA 1I4RA 1XQQA 2M1MA 4BZAA 4MJSA 4FLHA 1WM3A 4DQOC 4MSMB 2IY0B 2KFKA 2WX0A 1E0ZA 2LUEA 4BKGA 2NBWB 4LNFA 3AMZA 5D2MB 4LLGM 4FJYA 4HPLB 4M02A 4IM2A 1WX8A 5AZFA 3RN9C 3VQIA 1Q5WB 3KWVA 3KYCD 4HCNB 5C23A 2VZKB 5JH5C 4LNIA 1Z2MA 2AX5A 2NMQA 1RRBA 2RMMA 4JQWC 3OAWA 2XBBC 3ML8A 1YIWA 3KUDB 3ZNGC 4A3PA 2LHEA 4MH8A 1E7VA 3GS2A 1QOAA 1TT5B 3H6NA 3ZNHB 3Q8EA 1SGHA 3A9JB 1Q1OA 1V6EA 2BS2B 4OVUA 2IGGA 5G5GA 2C7HA 4MT5A 1EU4A 3DCGA 2DZJA 1YD8U 5IN7A 4DBGA 1GB4A 3DWGC 1AW7A 4LTUA 3V61A 5FR3A 1WX9A 2NPTB 2O6VD 1N5WA 4IOIE 1I4HA 4XDDA 3VRBB 2G1EA 2NBVB 2DAJA 1SEBD 3DQVA 1UGJA 2N1WA 4AJYB 2JRIB 3ENEA 3AM9A 3FAHA 5E6JA 3V6EB 4HKQA 4N6EB 5GXGB 2X38A 2AQ1B 2BTEA 2WWZA 2K9XA 2LASA 3GB1A 3PHXB 4RGOS 2Y3AA 3M3JA 1ACCA 3W1SA 2B76B 4L2YA 3W5UB 1ZOYB 4ICVA 2TSSA 5CHFA 2LGDA 2HJ1A 2N7EA 2BF8B 4FA6A 1CMXB 1SIFA 4XGAB 3AN1A 4G3XB 4ZHOA 2V3SA 2OEDA 3A1QA 2EELA 2MJDA 2INCC 2PE9A 1HQRD 2Y5PA 1MPEA 2K8CA 2G4DB 5EE3A 4KDIC 3TIXA 2K3UA 1V1PA 3HM3A 5EDSA 3V05A 3VTVA 2LVQA 4YTPB 4JIOU 3N30A 3N9YC 5J18A 4N58A 2RGFA 2I2YA 2QJLA 1F2RI 1GC7A 4DDGD 3IAM1 2JZPA 2DZMA 3U2SC 2QMTA 2GBMA 3Q3MC 3HK0A 1WJ6A 1RYJA 1UGMA 3RNAC 2PIAA 2MA9B 2ZVOA 3SU8X 1E8XA 3MJ5A 1GC6A 1YOVB 1I7HA 1TJEA 2FIDA 2WXPA 1QLBB 2AQ3B 2KT7A 2KX3A 2JT4B 1NVID 2KANA 2K22A 1N6ZA 2LWPA 2FE8A 3VTUA 1TGZB 3KVFB 1YN4A 2N7DA 2BGFA 4WWMA 2HTHA 3PPAA 1YX6B 1D5MC 2JUOA 4RM8A 1SE2A 2JYEA 3AE3B 3B2FA 2GBNA 4KDLB 4JL9A 2INDC 2EMTA 3URYA 1MI0A 1D5XC 1PYWD 2ZJDA 4P1BC 1FIQA 2KQSA 2KXJA 4PYUA 3TEWA 4K7UA 4ZRPA 1JRPA 1X1MA 3P4SB 5FKAC 3APCA 1SBBB 2ASQA 2KN5A 2M8SA 4UDUC 4L23A 1SB3C 3HIZA 2WU5B 3RUIB 3WALA 4M00A 3VAWA 3VUWA 4A9AA 5LNK1 3JSVB 4K81A 1FM0D 2BYEA 4WJNA 1J19A 1WGDA 3U7ZA 5IO9A 2AEHA 4JWUC 1VZ7A 2YEPB 1QF6A 2CR5A 2ZNVC 4DXFA 5BMIA 2BYVE 2H88B 4ZDVA 1GNUA 2O6VB 5BMGA 3T8MA 2C7NB 1V86A 1JWAD 4ZYNA 3BZDB 2QEJC 4RF1A 3UINB 1WSPA 4IWPA 3VUYA 1AARA 3ZW3A 2MSED 2KTRA 2DZKA 3UF8A 1ZE3D 3RD2A 2J7QB 1STEA 5KHQA 2IO3B 3L08A 2B3AA 3R8BA 4W9IA 2K25A 2MP2B 3Q2AC 3OJ4B 4IUMB 4MGZE 1ZGUB 2C9WB 4C56C 1WH3A 2NVUI 3PV1A 3I57A 2FCSA 2X8XX 3P1MA 4OHJA 4IWOA 1ZP0B 3MC9A 3IVFA 1WM2A 1TZOA 5DPRA 1KF6B 2BB5A 2N9LA 5DPSA 2RDHA 1TTNA 4RF0A 3ZRCA 1T0YA 4O1NA 3KW5B 1NBFC 1TS2A 4IKGA 3U7DA 3WAOA 4ZRJA 4DXGA 2KQ7A 1NI2A 3S2AA 1EWYC 1U4AA 2LRWA 1WE6A 3PT2B 1LFDA 1WF9A 4HJGE 1WRIA 4ZHPA 3QQ8B 2L0TA 3PLVA 4MM3A 3NVZA 1WJNA 2E3TA 4LK0M 4GIVA 1OEYA 2KZRA 3Q3NC 3ZTCA 2OHFA 4ZYSA 1DOYA 1N62A 1YQ3B 3IXSA 3PZ7A 2WXOA 5EE9A 1XT9B 3VUXA 4TKNA 2J0MA 1I35A 2W3SA 4WJQA 2JYTA 3TEXA 5L83A 2PPHA 1XEEA 3PZDA 3ZRFA 1JWMD 3ZKJC 5MPOA 1L5PA 4WWNA 1RM6C 1N60A 3Q69A 3VH4B 2KWVB 2PKOA 4ANVA 4GGQA 3MHSD 3AEFB 4K3BA 3VXWA 2KC1A 4CYEA 5C2TB 1HA5A 4ANUA 3Q8CA 2N4FA 4TQ1A 4WWOA 2MWSB 3MC0B 3ZIMA 2ACZB 4URKA 4GXBA 1UF0A 1JCKB 4DHJD 4MACA 1L0VB 1VR9A 4ARIA 4TV3A 1XCQL 2WXMA 2OJRA 4PT5A 1DOXA 5AUKA 3K9OB 4RGMA 1CZPA 3O13A 4WQOB 2IO1B 3TEYA 2ZVNA 3AU4A 3W1YA 1IGCA 3U8ZA 1UWMA 2L8JA 3VTWA 1PUTA 1SF0A 1WR6E 2L32A 2NBUA 3NRZA 1WZ0A 3VVWB 1WY8A 2XK5B 4BKTA 3HUIA 2MEKA 5EE1A 5CX3A 2WXGA 1L4DB 1SSNA 3ZQ4A 4N9F4 4DHZB 3ZJUA 3BIID 2CHZA 3DBLI 4LNOA 2BT6A 4E3CA 2GBJA 3Q8AA 3T3NA 4YSYB 2DHZA 4EE2A 2RPVA 3H7PA 3AB5A 1WXMA 1V97A 2PVGC 1FNWA 2KDMA 2Y5BB 5BYRA 3VDZA 1BXTA 1I4XA 3DBHB 2BKRB 1Y8RC 4GSWA 1VDVA 1UWXA 2WDQB 4AS1A 4ARCA 3M63B 4KIKB 2SEBD 5TSSA 2D5GA 4NAWA 3EGRA 3N3KB 4DXAB 1C78A 2L0FA 2K39A 4JE3B 2KMMA 2RR9A 3QWZB 1MVKA 2Z8LA 4P7IA 5HI1A 3V3XA 4OVVA 1DGJA 5HFYA 1V1OA 4LJOB 4KGRA 2UYZB 3W1SC 2L1AA 2JY6A 2D07B 3PO0A 1L6UA 4W9HA 2ZPNA 4IG7B 1V9JA 2ONQA 1S3SG 2W54A 3TCAA 1WJ4A 4NJCA 3QX1A 1HE8A 2BKFA 1UBQA 4EFOA 2MBQA 1GOZA 3ZXRA 3RPFC 4EKUA 2NTSA 3AEEB 2M0XA 2LGXA 2J4XA 1GG3A 1V81A 2BWES 2K8HA 1LM8B 2FCQA 4RCOA 2JSVX 2BYTA 3Q8BA 3L54A 2GRIA 2MBBB 3R7RA 4BBNC 2MLBA 2M0AA 4I6NB 5BYSA 3ZJTA 2REXA 4PS7A 1MG8A 3QC8B 4B6WA 4YSXB 3OJ3A 2JPHA 1UUPA 3A9JA 3RZWC 1D6EC 3AU5A 3NJTA 1T0SC 1TS3A 4K7WA 4BOSC 1HTOA 3LDZE 3WANA 3P4QB 3X23A 3PVLA 3UIOB 1HZ6A 4GLSC 1TY0A 3WCQA 1TBEA 2IBIB 4JX1C 1E10A 4YTNB 4DHZE 5I4DA 2N9XA 1J7BA 4GB9A 2NPTA 4OW0A 2KMAA 2C60A 1SE3A 2N9KA 3Q3OC 1R4NI 4HCPB 2KK8A 1P3QU 1L7YA 2IJ0A 2FAZA 3DHGC 2K6DB 2KLGA 2ICIA 3FKYA 2DYOA 1WR1A 4DHJB 2JX5A 4B0EA 3V60A 3AEGB 4HWIB 2QHOA 3EUB2 3VR9B 3JYUA 5DCNA 4US8A 5AUIA 1JROA 1EF5A 1ZXIA 1L6VA 2MJ3A 2MJEA 4WIPA 1NYRA 3A4RA 1WWTA 3B0AA 1E7UA 2L7RA 4NAMA 3P2BA 3QJZA 2VH2A 3PRMB 3MHZA 3SD5A 2HD5B 2GBRA 4YTMB 4FJVB 4HEA1 2DBYA 2RDGA 1MJDA 3APFA 5G5HA 2DYBA 2WXRA 4MELA 3EHVA 4GN1A 2ZZPB 3B9JA 4HJKA 1IBXB 1VZ6A 1T0RC 1P9DU 3ABVB 4USAA 2Q5WD 3RYTA 4F8CB 1QOFA 3MC8A 4WAAA 3BYTB 3BK1A 1RLFA 1SIJA 1WGGA 1YJ1A 1NENB 4MGIE 3KLSX 1PGAA 3LYYA 3PLUA 3SFEB 4WQMA 5G55A 3U4EG 1T5XD 2LD9A 2BB6A 3Q8FA 5H92C 1TS4A 1ZDVA 1FD6A 3B2GA 3H7SA 3AEAB 4NZLB 5IOIA 5JHBA 3PREA 4NJ6A 2RD0A 1RFKA 1FNUA 2K0PA 5BYQA 3ZUNA 4BAXA 3AE5B 2MX2A 2MBOA 2V3NA 4KZ0A 3UQAA 4OZAA 3SHQA 1P1AA 1QOBA 3J9CA 2I1KA 1SJHD 4MH0E 1ENFA 4NY0A 3ZLZA 3HVZA 4P16A 1FRRA 5JXVA 3DWMA 4EOYA 3GE8C 1SE4A 3DVNU 3VFKA 3H9DA 1LQBA 3DVGY 3TUOA 5BO4B 1C4PA 2LXCA 1PDXA 3DBRI 1K52A 1EUVB 2H89B 1TYGB 4BBNF 3UGBB 4PK1A 1RFAA 1TY2A 3GZNB 4K1RB 2WNMA 2R2QA 2A5UA 3GZNI 1V5OA 1QOGA 1EO6A 2LGYA 3ZDMC 3ZO5B 1XLQA 2D2QA 3X0WA 4HROA 1LXDA 3TSSA 2JXXA 4BKSD 1IGDA 3JSVA 3KYDD 1FRDA 4TUUA 1TZ1A 1WXVA 1KRHA 1MHXA 4C4VB 4J6IA 3RT3B 3O65B 1ZW7A 3E56A 1NDDA 3WAMA 1PFDA 1TKYA 1N5XA 5D7GA 4MEMA 5AZGA 3VH3B 3ZXVA 5AEKB 2UU7A 4D2KA 2O6VA 3P63A 3R2IA 1BUIC 2AWTA 2EKIA 4E71A 5JHAA 2GMIC 3B1LX 1QQRA 1UD7A 3APDA 3QK0A 2UWQA 2RPQA 1C77A 4N59A 4FJZA 2VH1A 4KSLC 2I1JA 4DK5A 2BQQA 1TKEA 2FCNA 1EU3A 1I4GA 3I63C 4XE0A 3BYYB 1GAQB 3P4PB 5HHDG 1J7AA 2WHIA 3ZGZA 4JGHB 3DOWA 3ZJVA 3MTNB 4AUQC 4ANWA 3AE2B 5DPTA 4NNJB 2MP2A 1MG4A 3Q6BA 2KVZA 4FHKA 1WE7A 3EFUA 4W9DA 2CKHB 3PHWB 4W9KA 4C80A 4HRSA 1H4RA 5E6OA 2MCNB 2OOBB 2C7MB 1PGBA 3AE8B 4M0WB 2K6QA 4S17A 1SE9A 1ZDXA 1C76A 5FK9C 3ZTDA 2J52A 4XWWA 3TBLD 2J0KA 1YX5B 4W9GA 1HEZE 1P7FA 4KSKC 3U52E 3AI5A 4F7ZA 4ACFA 4B9KA 5T8IA 2L83A 4YXDB 1A5RA 4OVZA 1G6JA 2KWDA 2VRRB 3NUHB 4HVBA 2LHDA 4XX5A 1YMHE 3RFZB 3C0RB 2WX1A 2PVOD 1TS5A 4XC2A 1OQQA 1GB1A 4YL8A 2CU3A 2ZEQA 5BMHA 3RNGC 2HDEA 3RNCC 3DVNV 1HXYD 1K53A 2CJNA 3ZVVA 2FBWB 4RM9A 1L0XB 1FNVA 2KC2A 2KO3A 2K8BA 4II3B 2DLBA 2YLMA 2IYDB 3QCAA 1ROEA 2BS4B 1FXTB 2JVCA 2KD0A 4RFBA 3WIMA 3E9SA 2ZCBA 3AE7B 1E9MA 3Q3FA 2ZPYA 1H8CA 4K3CA 1ET6A 1WMHB 4G0NB 3NY5A 1A70A 1K8RB 4M8NA 1F9JA 1RWSA 3AECB 2D3BA 3KUZA 2LRUA 3PSEB 3A4SC 1WGKA 2MH7A 1BMLC 4H2AA 2L76A 2PE6B 4WH4A 2NCNA 4I6LB 2KNBA 3A9KB 3QHTA 3MJWA 4EEWA 1XO3A 4E74A 2J53A 2R2OA 2ZCCA 2BBCA 2KJRA 4W9JA 2N7JA 3WAPA 1YQ4B 2D3GA 1JMLA 2V4LA 4MGKE 4YWGG 2GI9A 1GPXA 2L52A 2IZVB 2WXJA 2WXNA 2Z0EB 2KDIA 3JW0X 2M4NA 4C00A 1B9RA 4EUTA 2KTFA 1FPYA 3NOBA 4P1CC 3JVZX 1Z5SB 1LGRA 2CHXA 3WA0A 2DX5B 3W5VB 2ZNVB 3C8YA 1OEYJ 3AE1B 3PTFC 3N1ZC 1WGHA 3CSFA 2JRHA 4HKZE 1J7CA 4CHKA 3P42A 1OFFA 2PEAA 2XK5A 1CK1A 3UIPB 1UBIA 1JWUD 3KUCB 4IDIA 1VRAB 1VJKA 5D3IB 1OTRB 2QSDA 3DHIC 1WGRA 3QIJA 2V0GA 2INNE 1TKGA 1R4MB 2G9HD 3D32A 2FUHB 2K1FA 3DBLB 2D3AA 1HTQA 3RMKC 5HKHA 1R4MI 3CWIA 3SDLC 1YN5A 5C1ZA 2NTTA 5G2NA 1D5ZC 3VRAB 4LNNA 3IT6B 4J3OD 2CHWA 2LVOA 1EM7A 4MSQB 4NPNA 1AWDA 2KJ6A 4S0RA 4KIKA 4GMVA 1CQVA 1FCLA 3AE6B 4BFRA 1JRUA 3SEBA 2QILA 4W9LA 1M4VA 1XLPA 3AH7A 1T3QA 4XWTA 1NI3A 2Y5CA 3TL5A 4GDKB 1MHHE 2LMCA 3FILB 5GMVA 1V8CA 2JF5A 3AEDB 1WJUA 4KVGB 4GDLB 4REZA 5J17A 3ECIA 1FEHA 5HG2A 1KJTA 4FXCA 1M94A 4ZOHC 3IAS1 1YQBA 3L0WB 1JWSD 4R3DA 1FXIA 1OQYA 3NVWA 5CTRC 1MFWA 2KVRA 2PLPA 2KAJA 3I3TB 4ZRQA 4HXDA 3AULA 1J0GA 1IPGA 1ISNA 3T9LA 3L13A 1UELA 1EF1A 3ONSA 2O2VB 3AE9B 4MDKE 2W9NA 1L0YB 1F2RC 2V1YA 3DHHC 2NS5A 5IA7A 5EE0A 5KHOA 4ICUA 4AWJA 2KYWA 2KX0A 4KGSA 2IGHA 1XD3B 4MGYE 3R3MA 4W9CA 4II2B 3VHTC 1KH0A 1E90A 1QZEA 4EZLA 2N9PC 4IC7B 2AL3A 2KDBA 4MJSB 3RNBC 3C19A 2QCZA 2M56B 3NVVA 2KFKB 2JZZA 3ZDTA 2LVPA 2GOWA 1KTKA 1C9FA 3EFCA 3EC8A 2MHJA 3KQ4A 4WWPA 2FUG1 4FBJB 5LLIA 3BY4B 3NG0A 2NR2A 4HPMB 2Z0DB 1V5TA 4L1BA 2W55A 2N1VA 3W9CB 1IP9A 1R4NB 1TIFA 4NQKE 1QKZA 3MFGA 2QC8A 3AEBB 2JXTA 4IM0A 3RCZA 3AXCA 3SR6A 5IAAC 3BK2A 2C5LC 4IM3A 1JWBD 1KFYB 4XZ4A 4XDCA 2KFJA 4AJWA 4HLEA 1KLUD 5H8YE 2BWFA 2EMSA 2ZW1A 2V4IB 2JU6X 3P4RB 4FHJA 4HK2A 3N20C 4ZRIA 1IBXA 5TR5A 2N0SB 4B0MA 1PQSA 1VLBA 3N32A 1WGYA 1WFYA 3HM6X 1FMAD 1B1ZA 1K50A 2BW2A 4M8MA 2WU2B 2WXQA 1N61A 4G11A 1JALA 3NZUA 1L4ZB 2RDBC 2WXKA 4YT0B 3R66C 3QAQA 1FXAA 2ZW0A 1WX7A 1I42A 3IG3A 2IGDA 4IW0A 2AQ2B 1WI0A 2D3CA 4A8XC 4CO7A 1QT9A 2LXAA 2G4SA 2LI5A 4FULA 1AN8A 3A1QB 2WXIA 1YN3A 4P6VF 5CHVC 3IBEA 1T0QC 4HDOA 1V1PB 2MBEA 4JLCA 1P7EA 3BINA 4LNKA 2LFIA 4PYZA 2N9EB 2DWQA 1F1HA 1UNSA 2IO0B 2LZ6A 4CQNA 2W82A 3DBRB 3BVMA 1BT0A 2WXLA 5LXIB 2IO2B 2Z59B 3NZSA 4KGTA 2M19A 4WJPA 1ZKHA 3M62B 3PS6A 4QAYA 2MQJA 4ITKA 2WP9B 4RH6A 3NHEB 2QIEB 3DDCB 3DBSA 5FR6A 3I9V1 1WZ3A 2R61A 1VCBA 2GLSA 4I6PA 4DDID 2WDVB 4ZRKA 2LUMA 3U30A 2IY1B 1NEKB 2KDFB 2IPKD 4FADA 3I5JC 2KLCA 4WAFA 5L95C 5DPWA 4NJ7A 4C4VA 2RSUA 4HDQA 1PGXA 5IKCM 3UI3A 4C7YA 2E6XA 1WXAA 2AYOB 4OZBA 3M95A 1EWCA 1HZ5A 4KX6B 3L16A 4FN2A 2LGIA 4A20A 3CMMB 4US9A 3AV8A 3GP7A 2KHWB 1Q0WB 1AYFA 4WURA 2KDEB 3KH0A 4W9FA 4A6QA 3PZ8A 4EZKA 2KACA 1XXGA 2JZ3B 2W3RA 2WDRB 2WS3B 1C3TA 2XNAC 3IFWB 2G3QB 4PS8A 1V80A 1S1QB
chains in the Genus database with same CATH topology
2LGDA 1S3SG 2N7EA 4W9JA 2BF8B 4FA6A 3WAPA 1C1YB 3TCAA 1CMXB 1WJ4A 2MRPA 4W9EA 1SIFA 2D3GA 4ANXA 4EZJA 4G3XB 3QX1A 1HE8A 2BKFA 1UBQA 2V3SA 3A1QA 2V4LA 4MGKE 4LDTD 4EFOA 2IZVB 2Z0EB 2MBQA 2D11A 2KDIA 2PE9A 3PRPB 3UQBA 3JW0X 2M4NA 4EKUA 4EUTA 2M0XA 2K8CA 2G4DB 3TIXA 4KDIC 2KTFA 2LGXA 2DZIA 3NOBA 3JVZX 3HM3A 1GG3A 1V81A 2BWES 1Z5SB 1LM8B 2FCQA 2K8HA 3ALBA 3VTVA 5EDSA 1IYFA 4PS3A 3L54A 2LVQA 2CHXA 3WA0A 2DX5B 2MBBB 2L00B 2ZNVB 3R7RA 1OEYJ 3GOEA 3PTFC 4JIOU 3N30A 1WGHA 3CSFA 2MLBA 4BBNC 2JRHA 5J18A 4I6NB 4GU2A 2RGFA 2REXA 4PS7A 1MG8A 3QC8B 4B6WA 3OJ3A 1UZXB 4CHKA 1GC7A 2PEAA 2XK5A 2JPHA 3A9JA 4DDGD 3RZWC 3UIPB 1UBIA 2JWZA 2KTRB 3AU5A 3KUCB 2DZMA 1WIAA 4A3OA 4EZLA 4K7WA 2GBMA 4GOCA 4BOSC 3A33B 1WJ6A 1WXSA 3HK0A 3LDZE 3QARA 1UGMA 1OTRB 3WANA 2MA9B 2ZVOA 1WGRA 3QIJA 3SU8X 3X23A 3PVLA 3UIOB 2A4ZA 3EECA 1E8XA 3L10B 4NQLB 3D32A 2FUHB 2K1FA 1TBEA 2IBIB 5HKHA 1R4MI 1GC6A 2FIDA 3SDLC 1GJZA 5C1ZA 4DHZE 2EKEC 2N9XA 4GB9A 5G2NA 2NPTA 2KKCA 3K9PB 2KX3A 2MBHA 1WRDB 2KMAA 2AL6A 2C60A 2CHWA 2JT4B 2L05A 2LVOA 4AOFA 4HCPB 1R4NI 2KK8A 1P3QU 1L7YA 4MSQB 2KANA 2M17A 3L17A 2LWPA 4NPNA 2FAZA 2KJ6A 2J0JA 3VTUA 1E5WA 5D6JB 3ZNID 2K6DB 1TGZB 2KLGA 4KIKA 3KVFB 2DYOA 2HJ8A 2N7DA 4GMVA 2BGFA 1WR1A 4DHJB 3V60A 2HTHA 2BYFA 4HWIB 4KV2A 2QHOA 2MW5A 4BFRA 3PPAA 1JRUA 1YX6B 1WMHA 3V6CB 2JUOA 4RM8A 4W9LA 2FIFA 3JYUA 2GBKA 5DCNA 2DYMA 3QA8A 1D3ZA 2GBNA 1EF5A 5AZHA 4KDLB 4JL9A 4GDKB 3TL5A 5GMVA 3V62A 2EMTA 3ZW3A 3A4RA 2JF5A 3B0AA 1E7UA 1WJUA 2L7RA 2ZJDA 4KVGB 3P2BA 2KQSA 2KXJA 4GDLB 3QJZA 2KOXA 3PRMB 4PYUA 1OGWA 4K7UA 2HD5B 1E8WA 3SD5A 1X1MA 5J17A 3ECIA 2DENB 2KWCA 3APCA 2M8SA 2ASQA 2GBRA 2KN5A 3A9KA 2WYQA 3HIZA 1KJTA 3H1UA 1M94A 4FJVB 3RUIB 3OLMD 3WALA 2YVCA 1P98A 1YQBA 3L0WB 3TMPB 3VAWA 3APFA 4LJPB 3VUWA 5J2RA 2DYBA 4MELA 3B08A 3JSVB 1OQYA 3EHVA 4GN1A 3R7QA 2ZZPB 4K81A 5CTRC 4HJKA 2KVRA 2BYEA 3PGEA 4WJNA 1J19A 1WGDA 3I3TB 3DVGX 3TJPA 4F1SA 1P9DU 2AEHA 4HXDA 3RYTA 4F8CB 2CU1A 4WAAA 3AULA 1J0GA 5E6NA 1IPGA 1V49A 1ISNA 3T9LA 1RAXA 1RLFA 3L13A 1WGGA 1YJ1A 2XEWA 3ZNZB 4MGIE 1UELA 4X57B 1KM7A 2CR5A 4DWFA 1EF1A 2ZNVC 2O2VB 3ONSA 1E8ZA 4MDKE 3PLUA 2BYVE 3CSTA 4BKSA 1GNUA 2W9NA 4ZDVA 5G55A 2O6VB 2V1YA 5IA7A 2NS5A 3T8MA 5KHOA 2C7NB 1V86A 2LD9A 4KZCA 4ICUA 5E6PA 4ZYNA 4AWJA 2KX0A 1XD3B 3UINB 4BVUC 1GUAB 4MGYE 3R3MA 2HE7A 4II2B 4IWPA 4W9CA 3VHTC 3H7SA 3VUYA 1AARA 1E90A 1P0RA 1QZEA 4G50A 2N9PC 2MSED 2KTRA 3PREA 4IC7B 2AL3A 2KDBA 2DZKA 1WYWB 4NJ6A 3UF8A 2RD0A 4MJSB 1VD2A 3ZUNA 3RD2A 2J7QB 5KHQA 2KFKB 2JZZA 2MX2A 5JHBA 2D10A 2MBOA 2IO3B 3L08A 4KZ0A 2B3AA 2LVPA 2GOWA 3ZDTA 3UQAA 4W9IA 3SHQA 2K25A 3NS8A 1P1AA 2MP2B 4IUMB 3OJ4B 4MGZE 1J8CA 1ZGUB 3EC8A 2C9WB 2I1KA 4WWPA 1WH3A 2NVUI 5LLIA 4FBJB 3BY4B 1UH6A 2NR2A 4MH0E 3RZFA 4HPMB 2Z0DB 1V5TA 4NY0A 3ZLZA 3PV1A 2G45B 4EOYA 2N1VA 3DVNU 3VFKA 2FCSA 3H9DA 1LQBA 1IP9A 4IWOA 3CF6E 3IVFA 4K7SA 3DVGY 1WM2A 1L2NA 5D94A 4NQKE 5DPRA 2LXCA 3DBRI 5BO4B 4ASWC 2L3ZA 1EUVB 5DPSA 2FCMA 1KOTA 4BBNF 3UGBB 4LDTB 1TTNA 3Q3JA 3ZRCA 1RFAA 1T0YA 4IM0A 4IWQA 2WDTB 3KW5B 1NBFC 3RCZA 3AXCA 2KJHB 4K1RB 3PRZA 3U7DA 3ML9A 2CS4A 4GDKA 3WAOA 2R2QA 2A5UA 2KMCA 3GZNI 1V5OA 2LJ5A 5IAAC 5JZEB 4ZRJA 2C5LC 1EO6A 2KQ7A 4IM3A 1NI2A 2KWUB 3S2AA 4GDLA 1U4AA 2LGYA 4XZ4A 3ZDMC 2PJHA 3ZO5B 2D2QA 2LRWA 3X0WA 1WE6A 3PT2B 2KFJA 1LXDA 4AJWA 4HLEA 1LFDA 1WF9A 3H7PB 3HHMA 2BWFA 2JXXA 2EMSA 1V2YA 4BKSD 2DAFA 3DBHI 3QQ8B 2L0TA 3JSVA 3KYDD 4FHJA 3PLVA 4TUUA 4WJOA 4HK2A 1TZ1A 1WXVA 4MM3A 1WJNA 4GIVA 1OEYA 2KZRA 4J6IA 3RT3B 3O65B 4ZRIA 3ZTCA 1ZW7A 5TR5A 3IHPC 1NDDA 3WAMA 1E8YA 1PQSA 3N32A 1WGYA 1XT9B 1WFYA 3HM6X 4NAWB 3VUXA 5D7GA 4MEMA 4AP4C 5AZGA 2O2VA 3RULA 4M8MA 3VH3B 2FNJB 4TKNA 5AEKB 2J0MA 5CHWA 1I35A 4G11A 4B95A 4WJQA 2O6VA 5LXHA 2BPSA 4E71A 2AWTA 5L83A 2PPHA 3LJ3A 3PZDA 3ZRFA 3NZUA 4RMAA 5JHAA 2GMIC 3B1LX 1UD7A 3APDA 3QK0A 3ZKJC 2UWQA 4TQ0A 2RPQA 3R66C 3QAQA 1KLVA 4WWNA 4BOZB 3DPDA 1WX7A 4FJZA 4LCDE 1I42A 3VH4B 2KWVB 4ANVA 1XQQA 3IG3A 2M1MA 4GGQA 4IW0A 4KSLC 2I1JA 4MJSA 4DK5A 2FCNA 3MHSD 4FLHA 1WI0A 1WM3A 4MSMB 2IY0B 2KFKA 2KC1A 2WX0A 3VXWA 4CYEA 4ANUA 2LUEA 4CO7A 2N4FA 4JGHB 4BKGA 4TQ1A 4WWOA 2MWSB 3DOWA 3ZIMA 2LXAA 3MTNB 2G4SA 2NBWB 4AUQC 4ANWA 4URKA 2LI5A 4FULA 5D2MB 4FJYA 4GXBA 4HPLB 5DPTA 4IM2A 4NNJB 2MP2A 3A1QB 1WX8A 5AZFA 4DHJD 4FHKA 3VQIA 1Q5WB 4TV3A 3KYCD 1WE7A 3EFUA 4W9DA 2CKHB 3PHWB 4W9KA 2OJRA 1H4RA 4HCNB 5CHVC 3IBEA 5E6OA 5C23A 2MCNB 2OOBB 3K9OB 5JH5C 2C7MB 4M0WB 1Z2MA 2K6QA 4HDOA 1SE9A 2MBEA 4WQOB 2IO1B 1RRBA 4JQWC 4JLCA 3ZTDA 3BINA 3OAWA 2XBBC 2ZVNA 3TBLD 3ML8A 1YIWA 2J0KA 1YX5B 3KUDB 3AU4A 4PYZA 4W9GA 3ZNGC 4A3PA 2N9EB 4KSKC 1E7VA 3W1YA 3AI5A 4F7ZA 3U8ZA 2IO0B 2L8JA 3VTWA 2LZ6A 4B9KA 1WR6E 3H6NA 2NBUA 1WZ0A 1BT0A 1A5RA 3ZNHB 1G6JA 3VVWB 5LXIB 1WY8A 2IO2B 1SGHA 2XK5B 2Z59B 3A9JB 3NZSA 4BKTA 2VRRB 1Q1OA 1V6EA 4OVUA 4WJPA 1ZKHA 3M62B 5CX3A 2C7HA 3PS6A 4HVBA 4XX5A 2MQJA 3C0RB 3DCGA 2DZJA 1YD8U 2WX1A 4N9F4 4DHZB 3NHEB 3DDCB 3DBSA 5FR6A 2CHZA 3DBLI 1WZ3A 4XC2A 4E3CA 1VCBA 4DBGA 4I6PA 4YL8A 2GBJA 4ZRKA 4DDID 3U30A 2IY1B 2ZEQA 2DHZA 2KDFB 3H7PA 3V61A 3DVNV 4FADA 1WX9A 1WXMA 2KLCA 2NPTB 2O6VD 5L95C 3ZVVA 2Y5BB 3VDZA 5DPWA 4NJ7A 2BKRB 1Y8RC 4GSWA 2RSUA 2NBVB 4HDQA 4RM9A 2KC2A 3M63B 2KO3A 2DAJA 2K8BA 4II3B 2YLMA 3DQVA 2IYDB 4KIKB 2N1WA 3QCAA 4AJYB 1WXAA 1FXTB 2AYOB 2JRIB 2JVCA 2KD0A 3ENEA 3M95A 3N3KB 4NAWA 3WIMA 4DXAB 3L16A 2ZCBA 4FN2A 2L0FA 3Q3FA 2ZPYA 1H8CA 3V6EB 4A20A 2K39A 1WMHB 4G0NB 2RR9A 3CMMB 3NY5A 3QWZB 1K8RB 4M8NA 2KHWB 4P7IA 1F9JA 1Q0WB 2WWZA 3KUZA 4OVVA 2LASA 2KDEB 2LRUA 3KH0A 3PHXB 4W9FA 3PSEB 4LJOB 3A4SC 2UYZB 3W1SC 4EZKA 3M3JA 2L76A 2PE6B 2JY6A 2D07B 2JZ3B 2NCNA 3W1SA 4I6LB 2KNBA 4W9HA 1C3TA 3A9KB 3IFWB 3QHTA 2G3QB 2ZPNA 3MJWA 4IG7B 4EEWA 1V9JA 4E74A 4PS8A 2R2OA 1V80A 2ZCCA 1S1QB 2KJRA 4ICVA 5CHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LGD A;  1S3S G;  2N7E A;  4W9J A;  2BF8 B;  4FA6 A;  3WAP A;  1C1Y B;  3TCA A;  1CMX B;  1WJ4 A;  2MRP A;  4W9E A;  1SIF A;  2D3G A;  4ANX A;  4EZJ A;  4G3X B;  3QX1 A;  1HE8 A;  2BKF A;  1UBQ A;  2V3S A;  3A1Q A;  2V4L A;  4MGK E;  4LDT D;  4EFO A;  2IZV B;  2Z0E B;  2MBQ A;  2D11 A;  2KDI A;  2PE9 A;  3PRP B;  3UQB A;  3JW0 X;  2M4N A;  4EKU A;  4EUT A;  2M0X A;  2K8C A;  2G4D B;  3TIX A;  4KDI C;  2KTF A;  2LGX A;  2DZI A;  3NOB A;  3JVZ X;  3HM3 A;  1GG3 A;  1V81 A;  2BWE S;  1Z5S B;  1LM8 B;  2FCQ A;  2K8H A;  3ALB A;  3VTV A;  5EDS A;  1IYF A;  4PS3 A;  3L54 A;  2LVQ A;  2CHX A;  3WA0 A;  2DX5 B;  2MBB B;  2L00 B;  2ZNV B;  3R7R A;  1OEY J;  3GOE A;  3PTF C;  4JIO U;  3N30 A;  1WGH A;  3CSF A;  2MLB A;  4BBN C;  2JRH A;  5J18 A;  4I6N B;  4GU2 A;  2RGF A;  2REX A;  4PS7 A;  1MG8 A;  3QC8 B;  4B6W A;  3OJ3 A;  1UZX B;  4CHK A;  1GC7 A;  2PEA A;  2XK5 A;  2JPH A;  3A9J A;  4DDG D;  3RZW C;  3UIP B;  1UBI A;  2JWZ A;  2KTR B;  3AU5 A;  3KUC B;  2DZM A;  1WIA A;  4A3O A;  4EZL A;  4K7W A;  2GBM A;  4GOC A;  4BOS C;  3A33 B;  1WJ6 A;  1WXS A;  3HK0 A;  3LDZ E;  3QAR A;  1UGM A;  1OTR B;  3WAN A;  2MA9 B;  2ZVO A;  1WGR A;  3QIJ A;  3SU8 X;  3X23 A;  3PVL A;  3UIO B;  2A4Z A;  3EEC A;  1E8X A;  3L10 B;  4NQL B;  3D32 A;  2FUH B;  2K1F A;  1TBE A;  2IBI B;  5HKH A;  1R4M I;  1GC6 A;  2FID A;  3SDL C;  1GJZ A;  5C1Z A;  4DHZ E;  2EKE C;  2N9X A;  4GB9 A;  5G2N A;  2NPT A;  2KKC A;  3K9P B;  2KX3 A;  2MBH A;  1WRD B;  2KMA A;  2AL6 A;  2C60 A;  2CHW A;  2JT4 B;  2L05 A;  2LVO A;  4AOF A;  4HCP B;  1R4N I;  2KK8 A;  1P3Q U;  1L7Y A;  4MSQ B;  2KAN A;  2M17 A;  3L17 A;  2LWP A;  4NPN A;  2FAZ A;  2KJ6 A;  2J0J A;  3VTU A;  1E5W A;  5D6J B;  3ZNI D;  2K6D B;  1TGZ B;  2KLG A;  4KIK A;  3KVF B;  2DYO A;  2HJ8 A;  2N7D A;  4GMV A;  2BGF A;  1WR1 A;  4DHJ B;  3V60 A;  2HTH A;  2BYF A;  4HWI B;  4KV2 A;  2QHO A;  2MW5 A;  4BFR A;  3PPA A;  1JRU A;  1YX6 B;  1WMH A;  3V6C B;  2JUO A;  4RM8 A;  4W9L A;  2FIF A;  3JYU A;  2GBK A;  5DCN A;  2DYM A;  3QA8 A;  1D3Z A;  2GBN A;  1EF5 A;  5AZH A;  4KDL B;  4JL9 A;  4GDK B;  3TL5 A;  5GMV A;  3V62 A;  2EMT A;  3ZW3 A;  3A4R A;  2JF5 A;  3B0A A;  1E7U A;  1WJU A;  2L7R A;  2ZJD A;  4KVG B;  3P2B A;  2KQS A;  2KXJ A;  4GDL B;  3QJZ A;  2KOX A;  3PRM B;  4PYU A;  1OGW A;  4K7U A;  2HD5 B;  1E8W A;  3SD5 A;  1X1M A;  5J17 A;  3ECI A;  2DEN B;  2KWC A;  3APC A;  2M8S A;  2ASQ A;  2GBR A;  2KN5 A;  3A9K A;  2WYQ A;  3HIZ A;  1KJT A;  3H1U A;  1M94 A;  4FJV B;  3RUI B;  3OLM D;  3WAL A;  2YVC A;  1P98 A;  1YQB A;  3L0W B;  3TMP B;  3VAW A;  3APF A;  4LJP B;  3VUW A;  5J2R A;  2DYB A;  4MEL A;  3B08 A;  3JSV B;  1OQY A;  3EHV A;  4GN1 A;  3R7Q A;  2ZZP B;  4K81 A;  5CTR C;  4HJK A;  2KVR A;  2BYE A;  3PGE A;  4WJN A;  1J19 A;  1WGD A;  3I3T B;  3DVG X;  3TJP A;  4F1S A;  1P9D U;  2AEH A;  4HXD A;  3RYT A;  4F8C B;  2CU1 A;  4WAA A;  3AUL A;  1J0G A;  5E6N A;  1IPG A;  1V49 A;  1ISN A;  3T9L A;  1RAX A;  1RLF A;  3L13 A;  1WGG A;  1YJ1 A;  2XEW A;  3ZNZ B;  4MGI E;  1UEL A;  4X57 B;  1KM7 A;  2CR5 A;  4DWF A;  1EF1 A;  2ZNV C;  2O2V B;  3ONS A;  1E8Z A;  4MDK E;  3PLU A;  2BYV E;  3CST A;  4BKS A;  1GNU A;  2W9N A;  4ZDV A;  5G55 A;  2O6V B;  2V1Y A;  5IA7 A;  2NS5 A;  3T8M A;  5KHO A;  2C7N B;  1V86 A;  2LD9 A;  4KZC A;  4ICU A;  5E6P A;  4ZYN A;  4AWJ A;  2KX0 A;  1XD3 B;  3UIN B;  4BVU C;  1GUA B;  4MGY E;  3R3M A;  2HE7 A;  4II2 B;  4IWP A;  4W9C A;  3VHT C;  3H7S A;  3VUY A;  1AAR A;  1E90 A;  1P0R A;  1QZE A;  4G50 A;  2N9P C;  2MSE D;  2KTR A;  3PRE A;  4IC7 B;  2AL3 A;  2KDB A;  2DZK A;  1WYW B;  4NJ6 A;  3UF8 A;  2RD0 A;  4MJS B;  1VD2 A;  3ZUN A;  3RD2 A;  2J7Q B;  5KHQ A;  2KFK B;  2JZZ A;  2MX2 A;  5JHB A;  2D10 A;  2MBO A;  2IO3 B;  3L08 A;  4KZ0 A;  2B3A A;  2LVP A;  2GOW A;  3ZDT A;  3UQA A;  4W9I A;  3SHQ A;  2K25 A;  3NS8 A;  1P1A A;  2MP2 B;  4IUM B;  3OJ4 B;  4MGZ E;  1J8C A;  1ZGU B;  3EC8 A;  2C9W B;  2I1K A;  4WWP A;  1WH3 A;  2NVU I;  5LLI A;  4FBJ B;  3BY4 B;  1UH6 A;  2NR2 A;  4MH0 E;  3RZF A;  4HPM B;  2Z0D B;  1V5T A;  4NY0 A;  3ZLZ A;  3PV1 A;  2G45 B;  4EOY A;  2N1V A;  3DVN U;  3VFK A;  2FCS A;  3H9D A;  1LQB A;  1IP9 A;  4IWO A;  3CF6 E;  3IVF A;  4K7S A;  3DVG Y;  1WM2 A;  1L2N A;  5D94 A;  4NQK E;  5DPR A;  2LXC A;  3DBR I;  5BO4 B;  4ASW C;  2L3Z A;  1EUV B;  5DPS A;  2FCM A;  1KOT A;  4BBN F;  3UGB B;  4LDT B;  1TTN A;  3Q3J A;  3ZRC A;  1RFA A;  1T0Y A;  4IM0 A;  4IWQ A;  2WDT B;  3KW5 B;  1NBF C;  3RCZ A;  3AXC A;  2KJH B;  4K1R B;  3PRZ A;  3U7D A;  3ML9 A;  2CS4 A;  4GDK A;  3WAO A;  2R2Q A;  2A5U A;  2KMC A;  3GZN I;  1V5O A;  2LJ5 A;  5IAA C;  5JZE B;  4ZRJ A;  2C5L C;  1EO6 A;  2KQ7 A;  4IM3 A;  1NI2 A;  2KWU B;  3S2A A;  4GDL A;  1U4A A;  2LGY A;  4XZ4 A;  3ZDM C;  2PJH A;  3ZO5 B;  2D2Q A;  2LRW A;  3X0W A;  1WE6 A;  3PT2 B;  2KFJ A;  1LXD A;  4AJW A;  4HLE A;  1LFD A;  1WF9 A;  3H7P B;  3HHM A;  2BWF A;  2JXX A;  2EMS A;  1V2Y A;  4BKS D;  2DAF A;  3DBH I;  3QQ8 B;  2L0T A;  3JSV A;  3KYD D;  4FHJ A;  3PLV A;  4TUU A;  4WJO A;  4HK2 A;  1TZ1 A;  1WXV A;  4MM3 A;  1WJN A;  4GIV A;  1OEY A;  2KZR A;  4J6I A;  3RT3 B;  3O65 B;  4ZRI A;  3ZTC A;  1ZW7 A;  5TR5 A;  3IHP C;  1NDD A;  3WAM A;  1E8Y A;  1PQS A;  3N32 A;  1WGY A;  1XT9 B;  1WFY A;  3HM6 X;  4NAW B;  3VUX A;  5D7G A;  4MEM A;  4AP4 C;  5AZG A;  2O2V A;  3RUL A;  4M8M A;  3VH3 B;  2FNJ B;  4TKN A;  5AEK B;  2J0M A;  5CHW A;  1I35 A;  4G11 A;  4B95 A;  4WJQ A;  2O6V A;  5LXH A;  2BPS A;  4E71 A;  2AWT A;  5L83 A;  2PPH A;  3LJ3 A;  3PZD A;  3ZRF A;  3NZU A;  4RMA A;  5JHA A;  2GMI C;  3B1L X;  1UD7 A;  3APD A;  3QK0 A;  3ZKJ C;  2UWQ A;  4TQ0 A;  2RPQ A;  3R66 C;  3QAQ A;  1KLV A;  4WWN A;  4BOZ B;  3DPD A;  1WX7 A;  4FJZ A;  4LCD E;  1I42 A;  3VH4 B;  2KWV B;  4ANV A;  1XQQ A;  3IG3 A;  2M1M A;  4GGQ A;  4IW0 A;  4KSL C;  2I1J A;  4MJS A;  4DK5 A;  2FCN A;  3MHS D;  4FLH A;  1WI0 A;  1WM3 A;  4MSM B;  2IY0 B;  2KFK A;  2KC1 A;  2WX0 A;  3VXW A;  4CYE A;  4ANU A;  2LUE A;  4CO7 A;  2N4F A;  4JGH B;  4BKG A;  4TQ1 A;  4WWO A;  2MWS B;  3DOW A;  3ZIM A;  2LXA A;  3MTN B;  2G4S A;  2NBW B;  4AUQ C;  4ANW A;  4URK A;  2LI5 A;  4FUL A;  5D2M B;  4FJY A;  4GXB A;  4HPL B;  5DPT A;  4IM2 A;  4NNJ B;  2MP2 A;  3A1Q B;  1WX8 A;  5AZF A;  4DHJ D;  4FHK A;  3VQI A;  1Q5W B;  4TV3 A;  3KYC D;  1WE7 A;  3EFU A;  4W9D A;  2CKH B;  3PHW B;  4W9K A;  2OJR A;  1H4R A;  4HCN B;  5CHV C;  3IBE A;  5E6O A;  5C23 A;  2MCN B;  2OOB B;  3K9O B;  5JH5 C;  2C7M B;  4M0W B;  1Z2M A;  2K6Q A;  4HDO A;  1SE9 A;  2MBE A;  4WQO B;  2IO1 B;  1RRB A;  4JQW C;  4JLC A;  3ZTD A;  3BIN A;  3OAW A;  2XBB C;  2ZVN A;  3TBL D;  3ML8 A;  1YIW A;  2J0K A;  1YX5 B;  3KUD B;  3AU4 A;  4PYZ A;  4W9G A;  3ZNG C;  4A3P A;  2N9E B;  4KSK C;  1E7V A;  3W1Y A;  3AI5 A;  4F7Z A;  3U8Z A;  2IO0 B;  2L8J A;  3VTW A;  2LZ6 A;  4B9K A;  1WR6 E;  3H6N A;  2NBU A;  1WZ0 A;  1BT0 A;  1A5R A;  3ZNH B;  1G6J A;  3VVW B;  5LXI B;  1WY8 A;  2IO2 B;  1SGH A;  2XK5 B;  2Z59 B;  3A9J B;  3NZS A;  4BKT A;  2VRR B;  1Q1O A;  1V6E A;  4OVU A;  4WJP A;  1ZKH A;  3M62 B;  5CX3 A;  2C7H A;  3PS6 A;  4HVB A;  4XX5 A;  2MQJ A;  3C0R B;  3DCG A;  2DZJ A;  1YD8 U;  2WX1 A;  4N9F 4;  4DHZ B;  3NHE B;  3DDC B;  3DBS A;  5FR6 A;  2CHZ A;  3DBL I;  1WZ3 A;  4XC2 A;  4E3C A;  1VCB A;  4DBG A;  4I6P A;  4YL8 A;  2GBJ A;  4ZRK A;  4DDI D;  3U30 A;  2IY1 B;  2ZEQ A;  2DHZ A;  2KDF B;  3H7P A;  3V61 A;  3DVN V;  4FAD A;  1WX9 A;  1WXM A;  2KLC A;  2NPT B;  2O6V D;  5L95 C;  3ZVV A;  2Y5B B;  3VDZ A;  5DPW A;  4NJ7 A;  2BKR B;  1Y8R C;  4GSW A;  2RSU A;  2NBV B;  4HDQ A;  4RM9 A;  2KC2 A;  3M63 B;  2KO3 A;  2DAJ A;  2K8B A;  4II3 B;  2YLM A;  3DQV A;  2IYD B;  4KIK B;  2N1W A;  3QCA A;  4AJY B;  1WXA A;  1FXT B;  2AYO B;  2JRI B;  2JVC A;  2KD0 A;  3ENE A;  3M95 A;  3N3K B;  4NAW A;  3WIM A;  4DXA B;  3L16 A;  2ZCB A;  4FN2 A;  2L0F A;  3Q3F A;  2ZPY A;  1H8C A;  3V6E B;  4A20 A;  2K39 A;  1WMH B;  4G0N B;  2RR9 A;  3CMM B;  3NY5 A;  3QWZ B;  1K8R B;  4M8N A;  2KHW B;  4P7I A;  1F9J A;  1Q0W B;  2WWZ A;  3KUZ A;  4OVV A;  2LAS A;  2KDE B;  2LRU A;  3KH0 A;  3PHX B;  4W9F A;  3PSE B;  4LJO B;  3A4S C;  2UYZ B;  3W1S C;  4EZK A;  3M3J A;  2L76 A;  2PE6 B;  2JY6 A;  2D07 B;  2JZ3 B;  2NCN A;  3W1S A;  4I6L B;  2KNB A;  4W9H A;  1C3T A;  3A9K B;  3IFW B;  3QHT A;  2G3Q B;  2ZPN A;  3MJW A;  4IG7 B;  4EEW A;  1V9J A;  4E74 A;  4PS8 A;  2R2O A;  1V80 A;  2ZCC A;  1S1Q B;  2KJR A;  4ICV A;  5CHF A; 
#chains in the Genus database with same CATH topology
 4KKJ A;  4OZC A;  1C1Y B;  4ANX A;  1WYG A;  2MRP A;  1CJE A;  4W9E A;  3HRD D;  4EZJ A;  2INP E;  4Q2J A;  3LXF A;  2WLB A;  1XCT L;  4LDT D;  3LB8 C;  3PRP B;  2D11 A;  1Q10 A;  1I4P A;  3UQB A;  1R7S A;  3MP9 A;  3VR8 B;  1ET9 A;  4M0W A;  1JW9 D;  2OJW A;  2YEP F;  2LGS A;  2DZI A;  1NYQ A;  3ALB A;  1IYF A;  2J42 A;  4PS3 A;  2WXH A;  1ZPS A;  3CIR B;  2L00 B;  3GOE A;  1SXT A;  1YNT E;  1C79 A;  4GU2 A;  2KN4 A;  1F77 A;  1UZX B;  2V3P A;  1SJE D;  2JWZ A;  2KTR B;  3H8H A;  4JWS C;  1WIA A;  4A3O A;  4GOC A;  3A33 B;  1WXS A;  2WQY B;  3QAR A;  4KKI A;  1FO4 A;  2WGS A;  1E6E B;  3BWU D;  1FFU A;  3ETR A;  2A4Z A;  2PW9 A;  3EEC A;  3L10 B;  4NQL B;  2LJI A;  5IP4 D;  3NS1 A;  1GJZ A;  2EKE C;  4RGN A;  2KKC A;  3K9P B;  2MBH A;  2I38 A;  1WRD B;  2AL6 A;  2L05 A;  3L4P A;  4XYC A;  4AOF A;  3IT4 B;  2M17 A;  3L17 A;  2J0J A;  1E5W A;  2DNF A;  5D6J B;  3ZNI D;  4RNA A;  2HJ8 A;  1C4A A;  4RGT A;  2BYF A;  2LEK A;  4KV2 A;  2MW5 A;  1WMH A;  3V6C B;  4HPP A;  1FCC C;  1F0Z A;  1YJJ A;  2FIF A;  2GBK A;  2BS3 B;  4AQ7 A;  2DYM A;  3QA8 A;  1D3Z A;  1ZXH A;  5AZH A;  3RNE C;  3V62 A;  2CJO A;  2KOX A;  2VZK D;  1OGW A;  1E8W A;  4M01 A;  2DEN B;  2KWC A;  3NVY A;  3A9K A;  2WYQ A;  3H1U A;  3OLM D;  2YVC A;  2SAK A;  1P98 A;  3TMP B;  5J2R A;  4LJP B;  2K5P A;  3B08 A;  2JQR B;  3R7Q A;  4MM3 B;  1XLO A;  3PGE A;  2GB1 A;  3DVG X;  3TJP A;  4F1S A;  1OQR A;  2CU1 A;  5E6N A;  1V49 A;  1RAX A;  4TSS A;  2XEW A;  3ZNZ B;  1E7P B;  4X57 B;  1KM7 A;  4DWF A;  1E8Z A;  3RNF C;  1XLN A;  1DOI A;  4BKS A;  3CST A;  1ZUD 2;  3R2T A;  1QIL A;  4KZC A;  5E6P A;  1ESF A;  3BVG A;  4BVU C;  1GUA B;  2HE7 A;  1P0R A;  4G50 A;  2PTL A;  3BVZ A;  3OG5 A;  3RI7 C;  1WYW B;  1VD2 A;  5C3J B;  1DYQ A;  2D10 A;  2QDF A;  1KLG D;  3NZ3 A;  3NS8 A;  1J8C A;  1UH6 A;  4C7Z A;  1WXQ A;  3RZF A;  4YSZ B;  2G45 B;  5D3D A;  1C4C A;  1YJI A;  3CF6 E;  2XN9 C;  4K7S A;  2JWU A;  3N1X C;  5D94 A;  1L2N A;  4ASW C;  2L3Z A;  1LO5 D;  2BVC A;  2FCM A;  1KOT A;  1N63 A;  1Y56 A;  4LDT B;  3Q3J A;  4IWQ A;  2WDT B;  2WXF A;  2KJH B;  3Q14 C;  1F52 A;  3PRZ A;  3ML9 A;  2CS4 A;  4GDK A;  3FIL A;  3T3O A;  2KMC A;  4JPS A;  2LJ5 A;  1XF5 L;  5JZE B;  1JQ4 A;  2KWU B;  3TEZ A;  2KQ4 X;  4GDL A;  3KWL A;  4A55 A;  2PJH A;  1I4Q A;  1T6B X;  3HVD A;  4TMA B;  3AE4 B;  3H7P B;  3HHM A;  1V2Y A;  2DAF A;  3DBH I;  4A90 A;  3GE3 C;  4WJO A;  3SFD B;  1VZ8 A;  1K51 A;  3OWE B;  1IUE A;  3IHP C;  2ON8 A;  1E8Y A;  4NAW B;  2V9H A;  4AP4 C;  2O2V A;  3RUL A;  2FNJ B;  5CHW A;  4B95 A;  2PMV A;  2IDY A;  3FC4 A;  5LXH A;  2BPS A;  2HTM E;  3LJ3 A;  4RMA A;  3ZYY X;  4TQ0 A;  1FFV A;  3N1Y C;  1D4B A;  3EA6 A;  1KLV A;  4BOZ B;  3DPD A;  4LCD E;  3W2D A;  1I4R A;  1XQQ A;  2M1M A;  4BZA A;  4MJS A;  4FLH A;  1WM3 A;  4DQO C;  4MSM B;  2IY0 B;  2KFK A;  2WX0 A;  1E0Z A;  2LUE A;  4BKG A;  2NBW B;  4LNF A;  3AMZ A;  5D2M B;  4LLG M;  4FJY A;  4HPL B;  4M02 A;  4IM2 A;  1WX8 A;  5AZF A;  3RN9 C;  3VQI A;  1Q5W B;  3KWV A;  3KYC D;  4HCN B;  5C23 A;  2VZK B;  5JH5 C;  4LNI A;  1Z2M A;  2AX5 A;  2NMQ A;  1RRB A;  2RMM A;  4JQW C;  3OAW A;  2XBB C;  3ML8 A;  1YIW A;  3KUD B;  3ZNG C;  4A3P A;  2LHE A;  4MH8 A;  1E7V A;  3GS2 A;  1QOA A;  1TT5 B;  3H6N A;  3ZNH B;  3Q8E A;  1SGH A;  3A9J B;  1Q1O A;  1V6E A;  2BS2 B;  4OVU A;  2IGG A;  5G5G A;  2C7H A;  4MT5 A;  1EU4 A;  3DCG A;  2DZJ A;  1YD8 U;  5IN7 A;  4DBG A;  1GB4 A;  3DWG C;  1AW7 A;  4LTU A;  3V61 A;  5FR3 A;  1WX9 A;  2NPT B;  2O6V D;  1N5W A;  4IOI E;  1I4H A;  4XDD A;  3VRB B;  2G1E A;  2NBV B;  2DAJ A;  1SEB D;  3DQV A;  1UGJ A;  2N1W A;  4AJY B;  2JRI B;  3ENE A;  3AM9 A;  3FAH A;  5E6J A;  3V6E B;  4HKQ A;  4N6E B;  5GXG B;  2X38 A;  2AQ1 B;  2BTE A;  2WWZ A;  2K9X A;  2LAS A;  3GB1 A;  3PHX B;  4RGO S;  2Y3A A;  3M3J A;  1ACC A;  3W1S A;  2B76 B;  4L2Y A;  3W5U B;  1ZOY B;  4ICV A;  2TSS A;  5CHF A;  2LGD A;  2HJ1 A;  2N7E A;  2BF8 B;  4FA6 A;  1CMX B;  1SIF A;  4XGA B;  3AN1 A;  4G3X B;  4ZHO A;  2V3S A;  2OED A;  3A1Q A;  2EEL A;  2MJD A;  2INC C;  2PE9 A;  1HQR D;  2Y5P A;  1MPE A;  2K8C A;  2G4D B;  5EE3 A;  4KDI C;  3TIX A;  2K3U A;  1V1P A;  3HM3 A;  5EDS A;  3V05 A;  3VTV A;  2LVQ A;  4YTP B;  4JIO U;  3N30 A;  3N9Y C;  5J18 A;  4N58 A;  2RGF A;  2I2Y A;  2QJL A;  1F2R I;  1GC7 A;  4DDG D;  3IAM 1;  2JZP A;  2DZM A;  3U2S C;  2QMT A;  2GBM A;  3Q3M C;  3HK0 A;  1WJ6 A;  1RYJ A;  1UGM A;  3RNA C;  2PIA A;  2MA9 B;  2ZVO A;  3SU8 X;  1E8X A;  3MJ5 A;  1GC6 A;  1YOV B;  1I7H A;  1TJE A;  2FID A;  2WXP A;  1QLB B;  2AQ3 B;  2KT7 A;  2KX3 A;  2JT4 B;  1NVI D;  2KAN A;  2K22 A;  1N6Z A;  2LWP A;  2FE8 A;  3VTU A;  1TGZ B;  3KVF B;  1YN4 A;  2N7D A;  2BGF A;  4WWM A;  2HTH A;  3PPA A;  1YX6 B;  1D5M C;  2JUO A;  4RM8 A;  1SE2 A;  2JYE A;  3AE3 B;  3B2F A;  2GBN A;  4KDL B;  4JL9 A;  2IND C;  2EMT A;  3URY A;  1MI0 A;  1D5X C;  1PYW D;  2ZJD A;  4P1B C;  1FIQ A;  2KQS A;  2KXJ A;  4PYU A;  3TEW A;  4K7U A;  4ZRP A;  1JRP A;  1X1M A;  3P4S B;  5FKA C;  3APC A;  1SBB B;  2ASQ A;  2KN5 A;  2M8S A;  4UDU C;  4L23 A;  1SB3 C;  3HIZ A;  2WU5 B;  3RUI B;  3WAL A;  4M00 A;  3VAW A;  3VUW A;  4A9A A;  5LNK 1;  3JSV B;  4K81 A;  1FM0 D;  2BYE A;  4WJN A;  1J19 A;  1WGD A;  3U7Z A;  5IO9 A;  2AEH A;  4JWU C;  1VZ7 A;  2YEP B;  1QF6 A;  2CR5 A;  2ZNV C;  4DXF A;  5BMI A;  2BYV E;  2H88 B;  4ZDV A;  1GNU A;  2O6V B;  5BMG A;  3T8M A;  2C7N B;  1V86 A;  1JWA D;  4ZYN A;  3BZD B;  2QEJ C;  4RF1 A;  3UIN B;  1WSP A;  4IWP A;  3VUY A;  1AAR A;  3ZW3 A;  2MSE D;  2KTR A;  2DZK A;  3UF8 A;  1ZE3 D;  3RD2 A;  2J7Q B;  1STE A;  5KHQ A;  2IO3 B;  3L08 A;  2B3A A;  3R8B A;  4W9I A;  2K25 A;  2MP2 B;  3Q2A C;  3OJ4 B;  4IUM B;  4MGZ E;  1ZGU B;  2C9W B;  4C56 C;  1WH3 A;  2NVU I;  3PV1 A;  3I57 A;  2FCS A;  2X8X X;  3P1M A;  4OHJ A;  4IWO A;  1ZP0 B;  3MC9 A;  3IVF A;  1WM2 A;  1TZO A;  5DPR A;  1KF6 B;  2BB5 A;  2N9L A;  5DPS A;  2RDH A;  1TTN A;  4RF0 A;  3ZRC A;  1T0Y A;  4O1N A;  3KW5 B;  1NBF C;  1TS2 A;  4IKG A;  3U7D A;  3WAO A;  4ZRJ A;  4DXG A;  2KQ7 A;  1NI2 A;  3S2A A;  1EWY C;  1U4A A;  2LRW A;  1WE6 A;  3PT2 B;  1LFD A;  1WF9 A;  4HJG E;  1WRI A;  4ZHP A;  3QQ8 B;  2L0T A;  3PLV A;  4MM3 A;  3NVZ A;  1WJN A;  2E3T A;  4LK0 M;  4GIV A;  1OEY A;  2KZR A;  3Q3N C;  3ZTC A;  2OHF A;  4ZYS A;  1DOY A;  1N62 A;  1YQ3 B;  3IXS A;  3PZ7 A;  2WXO A;  5EE9 A;  1XT9 B;  3VUX A;  4TKN A;  2J0M A;  1I35 A;  2W3S A;  4WJQ A;  2JYT A;  3TEX A;  5L83 A;  2PPH A;  1XEE A;  3PZD A;  3ZRF A;  1JWM D;  3ZKJ C;  5MPO A;  1L5P A;  4WWN A;  1RM6 C;  1N60 A;  3Q69 A;  3VH4 B;  2KWV B;  2PKO A;  4ANV A;  4GGQ A;  3MHS D;  3AEF B;  4K3B A;  3VXW A;  2KC1 A;  4CYE A;  5C2T B;  1HA5 A;  4ANU A;  3Q8C A;  2N4F A;  4TQ1 A;  4WWO A;  2MWS B;  3MC0 B;  3ZIM A;  2ACZ B;  4URK A;  4GXB A;  1UF0 A;  1JCK B;  4DHJ D;  4MAC A;  1L0V B;  1VR9 A;  4ARI A;  4TV3 A;  1XCQ L;  2WXM A;  2OJR A;  4PT5 A;  1DOX A;  5AUK A;  3K9O B;  4RGM A;  1CZP A;  3O13 A;  4WQO B;  2IO1 B;  3TEY A;  2ZVN A;  3AU4 A;  3W1Y A;  1IGC A;  3U8Z A;  1UWM A;  2L8J A;  3VTW A;  1PUT A;  1SF0 A;  1WR6 E;  2L32 A;  2NBU A;  3NRZ A;  1WZ0 A;  3VVW B;  1WY8 A;  2XK5 B;  4BKT A;  3HUI A;  2MEK A;  5EE1 A;  5CX3 A;  2WXG A;  1L4D B;  1SSN A;  3ZQ4 A;  4N9F 4;  4DHZ B;  3ZJU A;  3BII D;  2CHZ A;  3DBL I;  4LNO A;  2BT6 A;  4E3C A;  2GBJ A;  3Q8A A;  3T3N A;  4YSY B;  2DHZ A;  4EE2 A;  2RPV A;  3H7P A;  3AB5 A;  1WXM A;  1V97 A;  2PVG C;  1FNW A;  2KDM A;  2Y5B B;  5BYR A;  3VDZ A;  1BXT A;  1I4X A;  3DBH B;  2BKR B;  1Y8R C;  4GSW A;  1VDV A;  1UWX A;  2WDQ B;  4AS1 A;  4ARC A;  3M63 B;  4KIK B;  2SEB D;  5TSS A;  2D5G A;  4NAW A;  3EGR A;  3N3K B;  4DXA B;  1C78 A;  2L0F A;  2K39 A;  4JE3 B;  2KMM A;  2RR9 A;  3QWZ B;  1MVK A;  2Z8L A;  4P7I A;  5HI1 A;  3V3X A;  4OVV A;  1DGJ A;  5HFY A;  1V1O A;  4LJO B;  4KGR A;  2UYZ B;  3W1S C;  2L1A A;  2JY6 A;  2D07 B;  3PO0 A;  1L6U A;  4W9H A;  2ZPN A;  4IG7 B;  1V9J A;  2ONQ A;  1S3S G;  2W54 A;  3TCA A;  1WJ4 A;  4NJC A;  3QX1 A;  1HE8 A;  2BKF A;  1UBQ A;  4EFO A;  2MBQ A;  1GOZ A;  3ZXR A;  3RPF C;  4EKU A;  2NTS A;  3AEE B;  2M0X A;  2LGX A;  2J4X A;  1GG3 A;  1V81 A;  2BWE S;  2K8H A;  1LM8 B;  2FCQ A;  4RCO A;  2JSV X;  2BYT A;  3Q8B A;  3L54 A;  2GRI A;  2MBB B;  3R7R A;  4BBN C;  2MLB A;  2M0A A;  4I6N B;  5BYS A;  3ZJT A;  2REX A;  4PS7 A;  1MG8 A;  3QC8 B;  4B6W A;  4YSX B;  3OJ3 A;  2JPH A;  1UUP A;  3A9J A;  3RZW C;  1D6E C;  3AU5 A;  3NJT A;  1T0S C;  1TS3 A;  4K7W A;  4BOS C;  1HTO A;  3LDZ E;  3WAN A;  3P4Q B;  3X23 A;  3PVL A;  3UIO B;  1HZ6 A;  4GLS C;  1TY0 A;  3WCQ A;  1TBE A;  2IBI B;  4JX1 C;  1E10 A;  4YTN B;  4DHZ E;  5I4D A;  2N9X A;  1J7B A;  4GB9 A;  2NPT A;  4OW0 A;  2KMA A;  2C60 A;  1SE3 A;  2N9K A;  3Q3O C;  1R4N I;  4HCP B;  2KK8 A;  1P3Q U;  1L7Y A;  2IJ0 A;  2FAZ A;  3DHG C;  2K6D B;  2KLG A;  2ICI A;  3FKY A;  2DYO A;  1WR1 A;  4DHJ B;  2JX5 A;  4B0E A;  3V60 A;  3AEG B;  4HWI B;  2QHO A;  3EUB 2;  3VR9 B;  3JYU A;  5DCN A;  4US8 A;  5AUI A;  1JRO A;  1EF5 A;  1ZXI A;  1L6V A;  2MJ3 A;  2MJE A;  4WIP A;  1NYR A;  3A4R A;  1WWT A;  3B0A A;  1E7U A;  2L7R A;  4NAM A;  3P2B A;  3QJZ A;  2VH2 A;  3PRM B;  3MHZ A;  3SD5 A;  2HD5 B;  2GBR A;  4YTM B;  4FJV B;  4HEA 1;  2DBY A;  2RDG A;  1MJD A;  3APF A;  5G5H A;  2DYB A;  2WXR A;  4MEL A;  3EHV A;  4GN1 A;  2ZZP B;  3B9J A;  4HJK A;  1IBX B;  1VZ6 A;  1T0R C;  1P9D U;  3ABV B;  4USA A;  2Q5W D;  3RYT A;  4F8C B;  1QOF A;  3MC8 A;  4WAA A;  3BYT B;  3BK1 A;  1RLF A;  1SIJ A;  1WGG A;  1YJ1 A;  1NEN B;  4MGI E;  3KLS X;  1PGA A;  3LYY A;  3PLU A;  3SFE B;  4WQM A;  5G55 A;  3U4E G;  1T5X D;  2LD9 A;  2BB6 A;  3Q8F A;  5H92 C;  1TS4 A;  1ZDV A;  1FD6 A;  3B2G A;  3H7S A;  3AEA B;  4NZL B;  5IOI A;  5JHB A;  3PRE A;  4NJ6 A;  2RD0 A;  1RFK A;  1FNU A;  2K0P A;  5BYQ A;  3ZUN A;  4BAX A;  3AE5 B;  2MX2 A;  2MBO A;  2V3N A;  4KZ0 A;  3UQA A;  4OZA A;  3SHQ A;  1P1A A;  1QOB A;  3J9C A;  2I1K A;  1SJH D;  4MH0 E;  1ENF A;  4NY0 A;  3ZLZ A;  3HVZ A;  4P16 A;  1FRR A;  5JXV A;  3DWM A;  4EOY A;  3GE8 C;  1SE4 A;  3DVN U;  3VFK A;  3H9D A;  1LQB A;  3DVG Y;  3TUO A;  5BO4 B;  1C4P A;  2LXC A;  1PDX A;  3DBR I;  1K52 A;  1EUV B;  2H89 B;  1TYG B;  4BBN F;  3UGB B;  4PK1 A;  1RFA A;  1TY2 A;  3GZN B;  4K1R B;  2WNM A;  2R2Q A;  2A5U A;  3GZN I;  1V5O A;  1QOG A;  1EO6 A;  2LGY A;  3ZDM C;  3ZO5 B;  1XLQ A;  2D2Q A;  3X0W A;  4HRO A;  1LXD A;  3TSS A;  2JXX A;  4BKS D;  1IGD A;  3JSV A;  3KYD D;  1FRD A;  4TUU A;  1TZ1 A;  1WXV A;  1KRH A;  1MHX A;  4C4V B;  4J6I A;  3RT3 B;  3O65 B;  1ZW7 A;  3E56 A;  1NDD A;  3WAM A;  1PFD A;  1TKY A;  1N5X A;  5D7G A;  4MEM A;  5AZG A;  3VH3 B;  3ZXV A;  5AEK B;  2UU7 A;  4D2K A;  2O6V A;  3P63 A;  3R2I A;  1BUI C;  2AWT A;  2EKI A;  4E71 A;  5JHA A;  2GMI C;  3B1L X;  1QQR A;  1UD7 A;  3APD A;  3QK0 A;  2UWQ A;  2RPQ A;  1C77 A;  4N59 A;  4FJZ A;  2VH1 A;  4KSL C;  2I1J A;  4DK5 A;  2BQQ A;  1TKE A;  2FCN A;  1EU3 A;  1I4G A;  3I63 C;  4XE0 A;  3BYY B;  1GAQ B;  3P4P B;  5HHD G;  1J7A A;  2WHI A;  3ZGZ A;  4JGH B;  3DOW A;  3ZJV A;  3MTN B;  4AUQ C;  4ANW A;  3AE2 B;  5DPT A;  4NNJ B;  2MP2 A;  1MG4 A;  3Q6B A;  2KVZ A;  4FHK A;  1WE7 A;  3EFU A;  4W9D A;  2CKH B;  3PHW B;  4W9K A;  4C80 A;  4HRS A;  1H4R A;  5E6O A;  2MCN B;  2OOB B;  2C7M B;  1PGB A;  3AE8 B;  4M0W B;  2K6Q A;  4S17 A;  1SE9 A;  1ZDX A;  1C76 A;  5FK9 C;  3ZTD A;  2J52 A;  4XWW A;  3TBL D;  2J0K A;  1YX5 B;  4W9G A;  1HEZ E;  1P7F A;  4KSK C;  3U52 E;  3AI5 A;  4F7Z A;  4ACF A;  4B9K A;  5T8I A;  2L83 A;  4YXD B;  1A5R A;  4OVZ A;  1G6J A;  2KWD A;  2VRR B;  3NUH B;  4HVB A;  2LHD A;  4XX5 A;  1YMH E;  3RFZ B;  3C0R B;  2WX1 A;  2PVO D;  1TS5 A;  4XC2 A;  1OQQ A;  1GB1 A;  4YL8 A;  2CU3 A;  2ZEQ A;  5BMH A;  3RNG C;  2HDE A;  3RNC C;  3DVN V;  1HXY D;  1K53 A;  2CJN A;  3ZVV A;  2FBW B;  4RM9 A;  1L0X B;  1FNV A;  2KC2 A;  2KO3 A;  2K8B A;  4II3 B;  2DLB A;  2YLM A;  2IYD B;  3QCA A;  1ROE A;  2BS4 B;  1FXT B;  2JVC A;  2KD0 A;  4RFB A;  3WIM A;  3E9S A;  2ZCB A;  3AE7 B;  1E9M A;  3Q3F A;  2ZPY A;  1H8C A;  4K3C A;  1ET6 A;  1WMH B;  4G0N B;  3NY5 A;  1A70 A;  1K8R B;  4M8N A;  1F9J A;  1RWS A;  3AEC B;  2D3B A;  3KUZ A;  2LRU A;  3PSE B;  3A4S C;  1WGK A;  2MH7 A;  1BML C;  4H2A A;  2L76 A;  2PE6 B;  4WH4 A;  2NCN A;  4I6L B;  2KNB A;  3A9K B;  3QHT A;  3MJW A;  4EEW A;  1XO3 A;  4E74 A;  2J53 A;  2R2O A;  2ZCC A;  2BBC A;  2KJR A;  4W9J A;  2N7J A;  3WAP A;  1YQ4 B;  2D3G A;  1JML A;  2V4L A;  4MGK E;  4YWG G;  2GI9 A;  1GPX A;  2L52 A;  2IZV B;  2WXJ A;  2WXN A;  2Z0E B;  2KDI A;  3JW0 X;  2M4N A;  4C00 A;  1B9R A;  4EUT A;  2KTF A;  1FPY A;  3NOB A;  4P1C C;  3JVZ X;  1Z5S B;  1LGR A;  2CHX A;  3WA0 A;  2DX5 B;  3W5V B;  2ZNV B;  3C8Y A;  1OEY J;  3AE1 B;  3PTF C;  3N1Z C;  1WGH A;  3CSF A;  2JRH A;  4HKZ E;  1J7C A;  4CHK A;  3P42 A;  1OFF A;  2PEA A;  2XK5 A;  1CK1 A;  3UIP B;  1UBI A;  1JWU D;  3KUC B;  4IDI A;  1VRA B;  1VJK A;  5D3I B;  1OTR B;  2QSD A;  3DHI C;  1WGR A;  3QIJ A;  2V0G A;  2INN E;  1TKG A;  1R4M B;  2G9H D;  3D32 A;  2FUH B;  2K1F A;  3DBL B;  2D3A A;  1HTQ A;  3RMK C;  5HKH A;  1R4M I;  3CWI A;  3SDL C;  1YN5 A;  5C1Z A;  2NTT A;  5G2N A;  1D5Z C;  3VRA B;  4LNN A;  3IT6 B;  4J3O D;  2CHW A;  2LVO A;  1EM7 A;  4MSQ B;  4NPN A;  1AWD A;  2KJ6 A;  4S0R A;  4KIK A;  4GMV A;  1CQV A;  1FCL A;  3AE6 B;  4BFR A;  1JRU A;  3SEB A;  2QIL A;  4W9L A;  1M4V A;  1XLP A;  3AH7 A;  1T3Q A;  4XWT A;  1NI3 A;  2Y5C A;  3TL5 A;  4GDK B;  1MHH E;  2LMC A;  3FIL B;  5GMV A;  1V8C A;  2JF5 A;  3AED B;  1WJU A;  4KVG B;  4GDL B;  4REZ A;  5J17 A;  3ECI A;  1FEH A;  5HG2 A;  1KJT A;  4FXC A;  1M94 A;  4ZOH C;  3IAS 1;  1YQB A;  3L0W B;  1JWS D;  4R3D A;  1FXI A;  1OQY A;  3NVW A;  5CTR C;  1MFW A;  2KVR A;  2PLP A;  2KAJ A;  3I3T B;  4ZRQ A;  4HXD A;  3AUL A;  1J0G A;  1IPG A;  1ISN A;  3T9L A;  3L13 A;  1UEL A;  1EF1 A;  3ONS A;  2O2V B;  3AE9 B;  4MDK E;  2W9N A;  1L0Y B;  1F2R C;  2V1Y A;  3DHH C;  2NS5 A;  5IA7 A;  5EE0 A;  5KHO A;  4ICU A;  4AWJ A;  2KYW A;  2KX0 A;  4KGS A;  2IGH A;  1XD3 B;  4MGY E;  3R3M A;  4W9C A;  4II2 B;  3VHT C;  1KH0 A;  1E90 A;  1QZE A;  4EZL A;  2N9P C;  4IC7 B;  2AL3 A;  2KDB A;  4MJS B;  3RNB C;  3C19 A;  2QCZ A;  2M56 B;  3NVV A;  2KFK B;  2JZZ A;  3ZDT A;  2LVP A;  2GOW A;  1KTK A;  1C9F A;  3EFC A;  3EC8 A;  2MHJ A;  3KQ4 A;  4WWP A;  2FUG 1;  4FBJ B;  5LLI A;  3BY4 B;  3NG0 A;  2NR2 A;  4HPM B;  2Z0D B;  1V5T A;  4L1B A;  2W55 A;  2N1V A;  3W9C B;  1IP9 A;  1R4N B;  1TIF A;  4NQK E;  1QKZ A;  3MFG A;  2QC8 A;  3AEB B;  2JXT A;  4IM0 A;  3RCZ A;  3AXC A;  3SR6 A;  5IAA C;  3BK2 A;  2C5L C;  4IM3 A;  1JWB D;  1KFY B;  4XZ4 A;  4XDC A;  2KFJ A;  4AJW A;  4HLE A;  1KLU D;  5H8Y E;  2BWF A;  2EMS A;  2ZW1 A;  2V4I B;  2JU6 X;  3P4R B;  4FHJ A;  4HK2 A;  3N20 C;  4ZRI A;  1IBX A;  5TR5 A;  2N0S B;  4B0M A;  1PQS A;  1VLB A;  3N32 A;  1WGY A;  1WFY A;  3HM6 X;  1FMA D;  1B1Z A;  1K50 A;  2BW2 A;  4M8M A;  2WU2 B;  2WXQ A;  1N61 A;  4G11 A;  1JAL A;  3NZU A;  1L4Z B;  2RDB C;  2WXK A;  4YT0 B;  3R66 C;  3QAQ A;  1FXA A;  2ZW0 A;  1WX7 A;  1I42 A;  3IG3 A;  2IGD A;  4IW0 A;  2AQ2 B;  1WI0 A;  2D3C A;  4A8X C;  4CO7 A;  1QT9 A;  2LXA A;  2G4S A;  2LI5 A;  4FUL A;  1AN8 A;  3A1Q B;  2WXI A;  1YN3 A;  4P6V F;  5CHV C;  3IBE A;  1T0Q C;  4HDO A;  1V1P B;  2MBE A;  4JLC A;  1P7E A;  3BIN A;  4LNK A;  2LFI A;  4PYZ A;  2N9E B;  2DWQ A;  1F1H A;  1UNS A;  2IO0 B;  2LZ6 A;  4CQN A;  2W82 A;  3DBR B;  3BVM A;  1BT0 A;  2WXL A;  5LXI B;  2IO2 B;  2Z59 B;  3NZS A;  4KGT A;  2M19 A;  4WJP A;  1ZKH A;  3M62 B;  3PS6 A;  4QAY A;  2MQJ A;  4ITK A;  2WP9 B;  4RH6 A;  3NHE B;  2QIE B;  3DDC B;  3DBS A;  5FR6 A;  3I9V 1;  1WZ3 A;  2R61 A;  1VCB A;  2GLS A;  4I6P A;  4DDI D;  2WDV B;  4ZRK A;  2LUM A;  3U30 A;  2IY1 B;  1NEK B;  2KDF B;  2IPK D;  4FAD A;  3I5J C;  2KLC A;  4WAF A;  5L95 C;  5DPW A;  4NJ7 A;  4C4V A;  2RSU A;  4HDQ A;  1PGX A;  5IKC M;  3UI3 A;  4C7Y A;  2E6X A;  1WXA A;  2AYO B;  4OZB A;  3M95 A;  1EWC A;  1HZ5 A;  4KX6 B;  3L16 A;  4FN2 A;  2LGI A;  4A20 A;  3CMM B;  4US9 A;  3AV8 A;  3GP7 A;  2KHW B;  1Q0W B;  1AYF A;  4WUR A;  2KDE B;  3KH0 A;  4W9F A;  4A6Q A;  3PZ8 A;  4EZK A;  2KAC A;  1XXG A;  2JZ3 B;  2W3R A;  2WDR B;  2WS3 B;  1C3T A;  2XNA C;  3IFW B;  2G3Q B;  4PS8 A;  1V80 A;  1S1Q B; 
#chains in the Genus database with same CATH homology
 2LGD A;  1S3S G;  2N7E A;  4W9J A;  2BF8 B;  4FA6 A;  3WAP A;  1C1Y B;  3TCA A;  1CMX B;  1WJ4 A;  2MRP A;  4W9E A;  1SIF A;  2D3G A;  4ANX A;  4EZJ A;  4G3X B;  3QX1 A;  1HE8 A;  2BKF A;  1UBQ A;  2V3S A;  3A1Q A;  2V4L A;  4MGK E;  4LDT D;  4EFO A;  2IZV B;  2Z0E B;  2MBQ A;  2D11 A;  2KDI A;  2PE9 A;  3PRP B;  3UQB A;  3JW0 X;  2M4N A;  4EKU A;  4EUT A;  2M0X A;  2K8C A;  2G4D B;  3TIX A;  4KDI C;  2KTF A;  2LGX A;  2DZI A;  3NOB A;  3JVZ X;  3HM3 A;  1GG3 A;  1V81 A;  2BWE S;  1Z5S B;  1LM8 B;  2FCQ A;  2K8H A;  3ALB A;  3VTV A;  5EDS A;  1IYF A;  4PS3 A;  3L54 A;  2LVQ A;  2CHX A;  3WA0 A;  2DX5 B;  2MBB B;  2L00 B;  2ZNV B;  3R7R A;  1OEY J;  3GOE A;  3PTF C;  4JIO U;  3N30 A;  1WGH A;  3CSF A;  2MLB A;  4BBN C;  2JRH A;  5J18 A;  4I6N B;  4GU2 A;  2RGF A;  2REX A;  4PS7 A;  1MG8 A;  3QC8 B;  4B6W A;  3OJ3 A;  1UZX B;  4CHK A;  1GC7 A;  2PEA A;  2XK5 A;  2JPH A;  3A9J A;  4DDG D;  3RZW C;  3UIP B;  1UBI A;  2JWZ A;  2KTR B;  3AU5 A;  3KUC B;  2DZM A;  1WIA A;  4A3O A;  4EZL A;  4K7W A;  2GBM A;  4GOC A;  4BOS C;  3A33 B;  1WJ6 A;  1WXS A;  3HK0 A;  3LDZ E;  3QAR A;  1UGM A;  1OTR B;  3WAN A;  2MA9 B;  2ZVO A;  1WGR A;  3QIJ A;  3SU8 X;  3X23 A;  3PVL A;  3UIO B;  2A4Z A;  3EEC A;  1E8X A;  3L10 B;  4NQL B;  3D32 A;  2FUH B;  2K1F A;  1TBE A;  2IBI B;  5HKH A;  1R4M I;  1GC6 A;  2FID A;  3SDL C;  1GJZ A;  5C1Z A;  4DHZ E;  2EKE C;  2N9X A;  4GB9 A;  5G2N A;  2NPT A;  2KKC A;  3K9P B;  2KX3 A;  2MBH A;  1WRD B;  2KMA A;  2AL6 A;  2C60 A;  2CHW A;  2JT4 B;  2L05 A;  2LVO A;  4AOF A;  4HCP B;  1R4N I;  2KK8 A;  1P3Q U;  1L7Y A;  4MSQ B;  2KAN A;  2M17 A;  3L17 A;  2LWP A;  4NPN A;  2FAZ A;  2KJ6 A;  2J0J A;  3VTU A;  1E5W A;  5D6J B;  3ZNI D;  2K6D B;  1TGZ B;  2KLG A;  4KIK A;  3KVF B;  2DYO A;  2HJ8 A;  2N7D A;  4GMV A;  2BGF A;  1WR1 A;  4DHJ B;  3V60 A;  2HTH A;  2BYF A;  4HWI B;  4KV2 A;  2QHO A;  2MW5 A;  4BFR A;  3PPA A;  1JRU A;  1YX6 B;  1WMH A;  3V6C B;  2JUO A;  4RM8 A;  4W9L A;  2FIF A;  3JYU A;  2GBK A;  5DCN A;  2DYM A;  3QA8 A;  1D3Z A;  2GBN A;  1EF5 A;  5AZH A;  4KDL B;  4JL9 A;  4GDK B;  3TL5 A;  5GMV A;  3V62 A;  2EMT A;  3ZW3 A;  3A4R A;  2JF5 A;  3B0A A;  1E7U A;  1WJU A;  2L7R A;  2ZJD A;  4KVG B;  3P2B A;  2KQS A;  2KXJ A;  4GDL B;  3QJZ A;  2KOX A;  3PRM B;  4PYU A;  1OGW A;  4K7U A;  2HD5 B;  1E8W A;  3SD5 A;  1X1M A;  5J17 A;  3ECI A;  2DEN B;  2KWC A;  3APC A;  2M8S A;  2ASQ A;  2GBR A;  2KN5 A;  3A9K A;  2WYQ A;  3HIZ A;  1KJT A;  3H1U A;  1M94 A;  4FJV B;  3RUI B;  3OLM D;  3WAL A;  2YVC A;  1P98 A;  1YQB A;  3L0W B;  3TMP B;  3VAW A;  3APF A;  4LJP B;  3VUW A;  5J2R A;  2DYB A;  4MEL A;  3B08 A;  3JSV B;  1OQY A;  3EHV A;  4GN1 A;  3R7Q A;  2ZZP B;  4K81 A;  5CTR C;  4HJK A;  2KVR A;  2BYE A;  3PGE A;  4WJN A;  1J19 A;  1WGD A;  3I3T B;  3DVG X;  3TJP A;  4F1S A;  1P9D U;  2AEH A;  4HXD A;  3RYT A;  4F8C B;  2CU1 A;  4WAA A;  3AUL A;  1J0G A;  5E6N A;  1IPG A;  1V49 A;  1ISN A;  3T9L A;  1RAX A;  1RLF A;  3L13 A;  1WGG A;  1YJ1 A;  2XEW A;  3ZNZ B;  4MGI E;  1UEL A;  4X57 B;  1KM7 A;  2CR5 A;  4DWF A;  1EF1 A;  2ZNV C;  2O2V B;  3ONS A;  1E8Z A;  4MDK E;  3PLU A;  2BYV E;  3CST A;  4BKS A;  1GNU A;  2W9N A;  4ZDV A;  5G55 A;  2O6V B;  2V1Y A;  5IA7 A;  2NS5 A;  3T8M A;  5KHO A;  2C7N B;  1V86 A;  2LD9 A;  4KZC A;  4ICU A;  5E6P A;  4ZYN A;  4AWJ A;  2KX0 A;  1XD3 B;  3UIN B;  4BVU C;  1GUA B;  4MGY E;  3R3M A;  2HE7 A;  4II2 B;  4IWP A;  4W9C A;  3VHT C;  3H7S A;  3VUY A;  1AAR A;  1E90 A;  1P0R A;  1QZE A;  4G50 A;  2N9P C;  2MSE D;  2KTR A;  3PRE A;  4IC7 B;  2AL3 A;  2KDB A;  2DZK A;  1WYW B;  4NJ6 A;  3UF8 A;  2RD0 A;  4MJS B;  1VD2 A;  3ZUN A;  3RD2 A;  2J7Q B;  5KHQ A;  2KFK B;  2JZZ A;  2MX2 A;  5JHB A;  2D10 A;  2MBO A;  2IO3 B;  3L08 A;  4KZ0 A;  2B3A A;  2LVP A;  2GOW A;  3ZDT A;  3UQA A;  4W9I A;  3SHQ A;  2K25 A;  3NS8 A;  1P1A A;  2MP2 B;  4IUM B;  3OJ4 B;  4MGZ E;  1J8C A;  1ZGU B;  3EC8 A;  2C9W B;  2I1K A;  4WWP A;  1WH3 A;  2NVU I;  5LLI A;  4FBJ B;  3BY4 B;  1UH6 A;  2NR2 A;  4MH0 E;  3RZF A;  4HPM B;  2Z0D B;  1V5T A;  4NY0 A;  3ZLZ A;  3PV1 A;  2G45 B;  4EOY A;  2N1V A;  3DVN U;  3VFK A;  2FCS A;  3H9D A;  1LQB A;  1IP9 A;  4IWO A;  3CF6 E;  3IVF A;  4K7S A;  3DVG Y;  1WM2 A;  1L2N A;  5D94 A;  4NQK E;  5DPR A;  2LXC A;  3DBR I;  5BO4 B;  4ASW C;  2L3Z A;  1EUV B;  5DPS A;  2FCM A;  1KOT A;  4BBN F;  3UGB B;  4LDT B;  1TTN A;  3Q3J A;  3ZRC A;  1RFA A;  1T0Y A;  4IM0 A;  4IWQ A;  2WDT B;  3KW5 B;  1NBF C;  3RCZ A;  3AXC A;  2KJH B;  4K1R B;  3PRZ A;  3U7D A;  3ML9 A;  2CS4 A;  4GDK A;  3WAO A;  2R2Q A;  2A5U A;  2KMC A;  3GZN I;  1V5O A;  2LJ5 A;  5IAA C;  5JZE B;  4ZRJ A;  2C5L C;  1EO6 A;  2KQ7 A;  4IM3 A;  1NI2 A;  2KWU B;  3S2A A;  4GDL A;  1U4A A;  2LGY A;  4XZ4 A;  3ZDM C;  2PJH A;  3ZO5 B;  2D2Q A;  2LRW A;  3X0W A;  1WE6 A;  3PT2 B;  2KFJ A;  1LXD A;  4AJW A;  4HLE A;  1LFD A;  1WF9 A;  3H7P B;  3HHM A;  2BWF A;  2JXX A;  2EMS A;  1V2Y A;  4BKS D;  2DAF A;  3DBH I;  3QQ8 B;  2L0T A;  3JSV A;  3KYD D;  4FHJ A;  3PLV A;  4TUU A;  4WJO A;  4HK2 A;  1TZ1 A;  1WXV A;  4MM3 A;  1WJN A;  4GIV A;  1OEY A;  2KZR A;  4J6I A;  3RT3 B;  3O65 B;  4ZRI A;  3ZTC A;  1ZW7 A;  5TR5 A;  3IHP C;  1NDD A;  3WAM A;  1E8Y A;  1PQS A;  3N32 A;  1WGY A;  1XT9 B;  1WFY A;  3HM6 X;  4NAW B;  3VUX A;  5D7G A;  4MEM A;  4AP4 C;  5AZG A;  2O2V A;  3RUL A;  4M8M A;  3VH3 B;  2FNJ B;  4TKN A;  5AEK B;  2J0M A;  5CHW A;  1I35 A;  4G11 A;  4B95 A;  4WJQ A;  2O6V A;  5LXH A;  2BPS A;  4E71 A;  2AWT A;  5L83 A;  2PPH A;  3LJ3 A;  3PZD A;  3ZRF A;  3NZU A;  4RMA A;  5JHA A;  2GMI C;  3B1L X;  1UD7 A;  3APD A;  3QK0 A;  3ZKJ C;  2UWQ A;  4TQ0 A;  2RPQ A;  3R66 C;  3QAQ A;  1KLV A;  4WWN A;  4BOZ B;  3DPD A;  1WX7 A;  4FJZ A;  4LCD E;  1I42 A;  3VH4 B;  2KWV B;  4ANV A;  1XQQ A;  3IG3 A;  2M1M A;  4GGQ A;  4IW0 A;  4KSL C;  2I1J A;  4MJS A;  4DK5 A;  2FCN A;  3MHS D;  4FLH A;  1WI0 A;  1WM3 A;  4MSM B;  2IY0 B;  2KFK A;  2KC1 A;  2WX0 A;  3VXW A;  4CYE A;  4ANU A;  2LUE A;  4CO7 A;  2N4F A;  4JGH B;  4BKG A;  4TQ1 A;  4WWO A;  2MWS B;  3DOW A;  3ZIM A;  2LXA A;  3MTN B;  2G4S A;  2NBW B;  4AUQ C;  4ANW A;  4URK A;  2LI5 A;  4FUL A;  5D2M B;  4FJY A;  4GXB A;  4HPL B;  5DPT A;  4IM2 A;  4NNJ B;  2MP2 A;  3A1Q B;  1WX8 A;  5AZF A;  4DHJ D;  4FHK A;  3VQI A;  1Q5W B;  4TV3 A;  3KYC D;  1WE7 A;  3EFU A;  4W9D A;  2CKH B;  3PHW B;  4W9K A;  2OJR A;  1H4R A;  4HCN B;  5CHV C;  3IBE A;  5E6O A;  5C23 A;  2MCN B;  2OOB B;  3K9O B;  5JH5 C;  2C7M B;  4M0W B;  1Z2M A;  2K6Q A;  4HDO A;  1SE9 A;  2MBE A;  4WQO B;  2IO1 B;  1RRB A;  4JQW C;  4JLC A;  3ZTD A;  3BIN A;  3OAW A;  2XBB C;  2ZVN A;  3TBL D;  3ML8 A;  1YIW A;  2J0K A;  1YX5 B;  3KUD B;  3AU4 A;  4PYZ A;  4W9G A;  3ZNG C;  4A3P A;  2N9E B;  4KSK C;  1E7V A;  3W1Y A;  3AI5 A;  4F7Z A;  3U8Z A;  2IO0 B;  2L8J A;  3VTW A;  2LZ6 A;  4B9K A;  1WR6 E;  3H6N A;  2NBU A;  1WZ0 A;  1BT0 A;  1A5R A;  3ZNH B;  1G6J A;  3VVW B;  5LXI B;  1WY8 A;  2IO2 B;  1SGH A;  2XK5 B;  2Z59 B;  3A9J B;  3NZS A;  4BKT A;  2VRR B;  1Q1O A;  1V6E A;  4OVU A;  4WJP A;  1ZKH A;  3M62 B;  5CX3 A;  2C7H A;  3PS6 A;  4HVB A;  4XX5 A;  2MQJ A;  3C0R B;  3DCG A;  2DZJ A;  1YD8 U;  2WX1 A;  4N9F 4;  4DHZ B;  3NHE B;  3DDC B;  3DBS A;  5FR6 A;  2CHZ A;  3DBL I;  1WZ3 A;  4XC2 A;  4E3C A;  1VCB A;  4DBG A;  4I6P A;  4YL8 A;  2GBJ A;  4ZRK A;  4DDI D;  3U30 A;  2IY1 B;  2ZEQ A;  2DHZ A;  2KDF B;  3H7P A;  3V61 A;  3DVN V;  4FAD A;  1WX9 A;  1WXM A;  2KLC A;  2NPT B;  2O6V D;  5L95 C;  3ZVV A;  2Y5B B;  3VDZ A;  5DPW A;  4NJ7 A;  2BKR B;  1Y8R C;  4GSW A;  2RSU A;  2NBV B;  4HDQ A;  4RM9 A;  2KC2 A;  3M63 B;  2KO3 A;  2DAJ A;  2K8B A;  4II3 B;  2YLM A;  3DQV A;  2IYD B;  4KIK B;  2N1W A;  3QCA A;  4AJY B;  1WXA A;  1FXT B;  2AYO B;  2JRI B;  2JVC A;  2KD0 A;  3ENE A;  3M95 A;  3N3K B;  4NAW A;  3WIM A;  4DXA B;  3L16 A;  2ZCB A;  4FN2 A;  2L0F A;  3Q3F A;  2ZPY A;  1H8C A;  3V6E B;  4A20 A;  2K39 A;  1WMH B;  4G0N B;  2RR9 A;  3CMM B;  3NY5 A;  3QWZ B;  1K8R B;  4M8N A;  2KHW B;  4P7I A;  1F9J A;  1Q0W B;  2WWZ A;  3KUZ A;  4OVV A;  2LAS A;  2KDE B;  2LRU A;  3KH0 A;  3PHX B;  4W9F A;  3PSE B;  4LJO B;  3A4S C;  2UYZ B;  3W1S C;  4EZK A;  3M3J A;  2L76 A;  2PE6 B;  2JY6 A;  2D07 B;  2JZ3 B;  2NCN A;  3W1S A;  4I6L B;  2KNB A;  4W9H A;  1C3T A;  3A9K B;  3IFW B;  3QHT A;  2G3Q B;  2ZPN A;  3MJW A;  4IG7 B;  4EEW A;  1V9J A;  4E74 A;  4PS8 A;  2R2O A;  1V80 A;  2ZCC A;  1S1Q B;  2KJR A;  4ICV A;  5CHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...