4WJPA

Crystal structure of sumo1 in complex with phosphorylated daxx
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
79
structure length
79
Chain Sequence
GEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYAQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/signaling protein
molecule keywords Small ubiquitin-related modifier 1
publication title Structural and Functional Characterization of the Phosphorylation-Dependent Interaction between PML and SUMO1.
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 79
sequence length 79
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4wjpA00
2MBEA 3N30A 4ZRIA 2IBIB 3P2BA 2IZVB 3DVNU 1E5WA 3IG3A 4NNJB 2G4DB 4W9IA 3ZNZB 2MA9B 3IVFA 4TV3A 2G4SA 4WWOA 4II3B 5L95C 2JF5A 3DVGY 2BF8B 4IM2A 2KFJA 4OVUA 2NBUA 3GOEA 5JZEB 1V5TA 3WALA 2DZMA 1M94A 2DZKA 2IY1B 2OJRA 3QCAA 4G50A 1E8YA 1V49A 4GMVA 3N32A 2L05A 4JLCA 5D6JB 2KMAA 4ZDVA 1EF5A 4NPNA 1GJZA 1WXVA 3H7PB 4II2B 1C1YB 1Q1OA 4KDLB 4EUTA 3A1QA 4W9KA 3L54A 4BKGA 3A9KA 1WM3A 4PS7A 1V80A 3HM6X 1WYWB 4GN1A 3VTVA 4FN2A 5AZFA 3U30A 3PS6A 2IO1B 4LJPB 4M8MA 5DPWA 3AU4A 2REXA 3ZNID 4FHKA 2GBRA 3DBHI 2EMTA 1LM8B 5E6PA 4B95A 1EF1A 3VH3B 3ONSA 5J18A 4KZ0A 4KIKA 3ZTCA 1Q5WB 3VTUA 2M0XA 3HIZA 1WFYA 1YX6B 2KDBA 2N7DA 3ZIMA 4WJNA 4W9CA 2DYOA 3L0WB 2AEHA 4GXBA 4ZYNA 3RD2A 2BPSA 3M95A 4LJOB 3V6CB 4MH0E 2MQJA 2LVQA 4MJSA 3ZTDA 3ZNHB 2D07B 3PHWB 3WANA 2FAZA 4BKTA 1YX5B 3L08A 5D2MB 3KYDD 2MX2A 1T0YA 2DZJA 4HPMB 3T8MA 4DK5A 3KUDB 2ZCCA 1IP9A 2R2QA 2L0FA 4BKSD 3RUIB 2KTRA 4BVUC 4ANWA 4MEMA 1GC6A 2MRPA 3NZSA 1X1MA 4E74A 1R4MI 2K6DB 4RMAA 4DDID 2C7NB 4N9F4 2RPQA 1F9JA 4I6NB 1VD2A 3VUXA 3WAPA 1WM2A 2CU1A 2IYDB 3A1QB 4KSKC 2Z59B 1WR6E 1WMHB 2BYEA 3V61A 1WX7A 1EUVB 3A9KB 4FADA 3H7SA 3AULA 4ANUA 4JL9A 1WR1A 2IO3B 2RGFA 4K81A 2KJ6A 2KD0A 2AL3A 3UQBA 3NOBA 2C9WB 2FNJB 3IFWB 3PREA 3BINA 4X57B 3UF8A 5CHFA 4KIKB 1Y8RC 3MTNB 5AZHA 2LD9A 2PEAA 4FHJA 3DVGX 5CHVC 5KHQA 3WIMA 3PRPB 3SDLC 4AOFA 3ENEA 3GZNI 5DPTA 4FJZA 3ML8A 4MJSB 5HKHA 3RCZA 4TKNA 1U4AA 2LXAA 1WGRA 4IUMB 2DAJA 3SU8X 2W9NA 3QIJA 2L7RA 3PPAA 4JIOU 2KLCA 4RM9A 1E7VA 2Y5BB 4JQWC 3H7PA 2N7EA 2M8SA 1J19A 2O6VD 2R2OA 4K7SA 5FR6A 3VH4B 2XBBC 3TBLD 3KUCB 2YLMA 2MCNB 2MWSB 4MSQB 2MLBA 2YVCA 2G45B 3KW5B 4DWFA 2WWZA 3PLVA 3U8ZA 3PZDA 2D2QA 3ZO5B 1UBIA 2KOXA 4E71A 2KC1A 3B1LX 2GMIC 2KANA 5E6NA 1J8CA 4PS8A 1OQYA 3PT2B 3AXCA 5C23A 2A4ZA 3UIOB 2MSED 3ZW3A 2KQSA 1V81A 1YQBA 4WJPA 2N9XA 3O65B 3KUZA 3IBEA 3DCGA 4MELA 1SGHA 4EZLA 1P9DU 3WAMA 5DPSA 2EKEC 2KQ7A 2JXXA 3D32A 4GDLA 4MSMB 1D3ZA 3VQIA 4HXDA 2J0KA 1ISNA 2KFKA 5G55A 1UH6A 4F8CB 2L76A 3C0RB 1WZ3A 5IA7A 2BKFA 3L17A 2JZZA 4K7WA 2N9EB 1SIFA 3ALBA 2WX1A 2EMSA 3DOWA 2LI5A 2UWQA 4I6PA 3VDZA 2IO2B 3EFUA 2O2VB 3JYUA 4DHZB 2KK8A 3U7DA 4HVBA 1ZW7A 3TJPA 1V86A 1VCBA 3VVWB 3PVLA 4FULA 3VHTC 3DBLI 1YD8U 2KC2A 4F7ZA 3JSVA 1WMHA 4XX5A 1OEYA 2JRHA 1V9JA 4AUQC 2NCNA 2PE9A 1RFAA 2KX3A 2KO3A 2BYFA 1V6EA 1WI0A 3RULA 2JRIB 2ASQA 2ZEQA 4ICVA 1KOTA 2KDEB 4DHZE 2GBJA 2CHXA 3ZRCA 4BFRA 4DXAB 1YJ1A 3HK0A 2FIDA 3K9PB 4EEWA 2N4FA 2PPHA 1E90A 1CMXB 4GGQA 3X23A 1SE9A 1GNUA 3A9JA 3OJ4B 2JPHA 4NJ6A 4A3OA 4LCDE 3WAOA 2ZNVB 4GDLB 4DHJD 4HWIB 3T9LA 4CYEA 3W1SA 2KFKB 4AP4C 2ZPNA 4B6WA 3JVZX 4IM3A 3L10B 4W9GA 2GOWA 3VUWA 2J7QB 2XK5B 3VUYA 4ANVA 1FXTB 2FCMA 2MP2A 3PTFC 2L00B 2KZRA 3UQAA 2JUOA 4I6LB 2N9PC 2M17A 2RR9A 3CSTA 3ZKJC 2V4LA 5E6OA 2N1VA 3PHXB 1RLFA 1GUAB 3M3JA 3QC8B 3ZDTA 3QAQA 2NR2A 2BKRB 3UGBB 5JHBA 3RZFA 3LDZE 4M8NA 4EZKA 1WZ0A 2ZZPB 4GSWA 2GBNA 3ZUNA 2ZVOA 3V60A 3JSVB 5AZGA 3W1YA 3DVNV 3M62B 4MM3A 2IO0B 3RZWC 4W9HA 4HLEA 2ZPYA 2I1KA 2KHWB 2D10A 1KLVA 5JH5C 2K25A 3B08A 5G2NA 2CKHB 1C3TA 3NHEB 3ZDMC 2V1YA 3H6NA 4WWNA 4IWQA 1WE7A 5LXHA 3SD5A 3S2AA 2FCNA 4M0WB 4FA6A 4NJ7A 2DENB 1UBQA 4B9KA 3PGEA 4LDTD 1EO6A 1V2YA 2FUHB 3KYCD 2NBWB 3A9JB 3PV1A 2LVPA 3QHTA 2DZIA 4IWOA 1OGWA 2LJ5A 2AL6A 2QHOA 3KH0A 3PRMB 1E8ZA 4A20A 2A5UA 2HE7A 1WF9A 2O2VA 3M63B 4MGYE 1KM7A 3RT3B 1WIAA 2BGFA 2LZ6A 1GG3A 3VFKA 4BBNC 2NPTA 2MP2B 5CX3A 2UYZB 3NY5A 3PLUA 4G3XB 2M4NA 2C60A 2DX5B 3OLMD 4E3CA 3CSFA 2DHZA 2BWFA 2KDIA 3ZVVA 3TL5A 2MBQA 3JW0X 1L7YA 2DYBA 2MBOA 4WQOB 2LVOA 3NS8A 2K6QA 3R7RA 4GU2A 1LQBA 2RSUA 1XD3B 4A3PA 1WJ4A 2I1JA 4BKSA 4TQ0A 3CF6E 2MW5A 2GBMA 2LWPA 2B3AA 4K1RB 3DPDA 4WAAA 4ZRJA 1J0GA 4HPLB 1WXSA 4JGHB 2J0MA 3DDCB 4KV2A 2FCQA 5EDSA 3KVFB 4PS3A 2KDFB 4MGKE 3SHQA 1XT9B 1P0RA 1A5RA 4YL8A 4ZRKA 1GC7A 2BYVE 1WGHA 3L16A 1IPGA 1I35A 3N3KB 1H4RA 2XK5A 5AEKB 2PE6B 1NDDA 1WH3A 3Q3FA 4RM8A 4IG7B 1LXDA 3R3MA 2ZCBA 3K9OB 3R66C 5GMVA 1TZ1A 1H8CA 3A33B 2BWES 2KX0A 2NPTB 3H9DA 1I42A 2L0TA 3A4SC 3V6EB 2AWTA 2FCSA 3V62A 4ASWC 2KNBA 3EHVA 4NY0A 3RYTA 1HE8A 1TBEA 1RRBA 3QARA 3TIXA 2CR5A 4BOSC 1WGGA 5DCNA 2CS4A 4NQKE 5C1ZA 2Z0EB 2OOBB 5IAAC 4FLHA 2O6VA 3R7QA 1E7UA 1WXAA 1WRDB 2HTHA 1OTRB 4GDKB 4NAWB 1XQQA 1YIWA 2D3GA 5KHOA 1K8RB 3X0WA 3TMPB 1KJTA 1UD7A 3PRZA 4F1SA 4MDKE 2KJHB 3QK0A 4KDIC 3NZUA 2LGYA 3A4RA 5D7GA 5LLIA 5L83A 1P1AA 3DBSA 3APDA 3DQVA 3UINB 4W9FA 4XZ4A 2KMCA 2Z0DB 1UGMA 2KJRA 1RAXA 2RD0A 2MBHA 1G6JA 2LXCA 2GBKA 3AI5A 4TQ1A 1MG8A 4URKA 3MHSD 2WX0A 4CO7A 4LDTB 2K8CA 5D94A 3APCA 1PQSA 2G3QB 2L8JA 4KSLC 4DBGA 4HCPB 3LJ3A 2ZNVC 3L13A 4HK2A 2K39A 3H1UA 2JZ3B 3UIPB 2KKCA 3IHPC 2JVCA 1Z5SB 1UELA 3VXWA 4W9DA 1WGDA 3ML9A 2ZJDA 3BY4B 2LASA 4AJYB 2ZVNA 1E8XA 2O6VB 4HDOA 1R4NI 4AWJA 1OEYJ 3ZLZA 4ANXA 3DBRI 2L3ZA 4WWPA 3ECIA 3MJWA 5TR5A 3QWZB 5JHAA 3QJZA 4WJQA 1WGYA 2AYOB 3OAWA 1E8WA 2K8HA 2M1MA 4ICUA 4CHKA 4EKUA 2XEWA 2C5LC 4GOCA 4IC7B 1WJUA 2KVRA 3EECA 2DYMA 3ZNGC 4MGIE 5J17A 2KWUB 3QX1A 2K1FA 3EC8A 4G11A 4FBJB 4AJWA 4WJOA 1P98A 1V5OA 2C7MB 2LRUA 4TUUA 3TCAA 1L2NA 4FJYA 3WA0A 1WXMA 4HCNB 1QZEA 1S1QB 4IWPA 4XC2A 5BO4B 1AARA 2V3SA 5J2RA 2D11A 2NVUI 3AU5A 2CHZA 1S3SG 2CHWA 1IYFA 4HDQA 3I3TB 4PYZA 1WE6A 3ZRFA 2WDTB 4MGZE 1ZKHA 4IM0A 1TGZB 1P3QU 2LGDA 4EOYA 4FJVB 1WX9A 2VRRB 3APFA 3W1SC 4J6IA 4NQLB 5CTRC 4K7UA 2KXJA 1NI2A 4HJKA 4BBNF 4KZCA 4GDKA 4NAWA 2HD5B 4G0NB 1BT0A 2IY0B 2NBVB 4GB9A 3VTWA 2KWCA 4PYUA 5DPRA 2LUEA 1WJNA 3OJ3A 1WJ6A 4OVVA 2JY6A 4W9JA 2JWZA 2PJHA 3VAWA 1WY8A 3HM3A 2MBBB 3Q3JA 3QQ8B 4IW0A 4BOZB 4DDGD 3PSEB 4W9EA 2KTRB 4KVGB 3B0AA 3CMMB 2FIFA 2KN5A 2KLGA 4GIVA 2HJ8A 1UZXB 5LXIB 2NS5A 2K8BA 4W9LA 4P7IA 4EFOA 1ZGUB 2J0JA 1NBFC 2KTFA 1Q0WB 1WX8A 2JT4B 2WYQA 2KWVB 2DAFA 1TTNA 2N1WA 3QA8A 4EZJA 1LFDA 3HHMA 2C7HA 2LGXA 1JRUA 5CHWA 4DHJB 1Z2MA 2LRWA
chains in the Genus database with same CATH superfamily
1JWAD 5G5HA 3DVNU 1E5WA 4TV3A 5GXGB 4II3B 3O13A 2JF5A 3FAHA 4IM2A 1V5TA 3GS2A 3DBRB 1LGRA 4A6QA 1EF5A 1K50A 3I5JC 4KDLB 1Q1OA 4EUTA 1I4RA 3AE8B 4GN1A 3HM6X 1WYWB 4YSXB 3U30A 2DWQA 2CJNA 2GBRA 2BBCA 5E6PA 3ONSA 3AB5A 4KIKA 3ZTCA 3VTUA 3HIZA 2KDBA 4WJNA 2DYOA 1PFDA 2K9XA 4MACA 1ZXIA 1ZDXA 3V6CB 4DXGA 3ZTDA 3ZNHB 3RNFC 1T0SC 2D07B 3PHWB 3WANA 3T3OA 1T0YA 1I4PA 2KAJA 2R61A 4BKSD 3RUIB 1UWMA 4K3BA 4MEMA 4ANWA 4E74A 3ZYYX 1VD2A 3VUXA 4KSKC 2Z59B 2BYEA 2QIEB 1WX7A 3ZXRA 3TSSA 1FRDA 4FADA 3BK2A 2HTME 3ABVB 1FNUA 4ANUA 1FPYA 4JL9A 4XWTA 2C9WB 4ARIA 3IFWB 3BINA 1WRIA 1SB3C 2LD9A 5CHVC 5KHQA 3TEZA 2QDFA 4AOFA 3ENEA 3ML8A 5IO9A 5C2TB 3RN9C 4IUMB 1WGRA 3SU8X 3TEWA 1VZ8A 1SJED 1ZP0B 2O6VD 2XBBC 3U7ZA 2M19A 2MCNB 2MWSB 4DWFA 3MC0B 3ZO5B 3PZDA 2KOXA 1XF5L 2WXLA 4HJGE 2RPVA 3UIOB 2KQSA 2WDQB 4HPPA 2N9XA 3O65B 2KVZA 1WXQA 4RF1A 2EKEC 3IXSA 4MH8A 4MSMB 4YTNB 1D3ZA 3LXFA 5G55A 5HHDG 2N9EB 4ZHOA 1SIFA 1MHXA 2BTEA 4I6PA 4YWGG 1C4PA 3DHIC 4DHZB 1UUPA 1ZW7A 2INPE 3PVLA 2MEKA 1V9JA 1RFAA 2KX3A 3U4EG 1WI0A 4ICVA 1IGDA 1KLUD 2X8XX 1FNVA 1CMXB 3N20C 3CIRB 2BS3B 2JPHA 4LCDE 4M01A 2WXPA 1D4BA 2QEJC 3W1SA 2OEDA 2KFKB 2DBYA 4AS1A 3BWUD 4IM3A 3L10B 1F77A 4L23A 5BMIA 5EE1A 2WP9B 3UQAA 1AWDA 2RR9A 3CSTA 2V4LA 1RLFA 2M0AA 3QAQA 2NR2A 2BS2B 3UGBB 4ZRPA 3RZFA 2LHDA 3ZUNA 2ZVOA 1ZPSA 2K3UA 5I4DA 3VRAB 1C4AA 4HKQA 4XDDA 3B08A 5G2NA 2V1YA 4WWNA 4IKGA 1F1HA 2FCNA 4M0WB 4FA6A 2BB6A 1UBQA 2GRIA 1V2YA 3A9JB 2BQQA 4XYCA 2N9KA 3NVZA 1ROEA 4XGAB 2LJ5A 1E8ZA 1C79A 3AECB 3DHGC 1PGBA 2NPTA 3NG0A 3NUHB 5CX3A 2UYZB 4G3XB 1T0RC 2JSVX 2FUG1 2DHZA 5LNK1 3TL5A 1TJEA 4ZRQA 3RMKC 3NS8A 1LQBA 4TQ0A 3P4PB 4MM3B 2GBMA 4N6EB 4ZRJA 4ITKA 2W3SA 2SEBD 1WXSA 2J0MA 3DDCB 3KVFB 4LNIA 3SHQA 1V8CA 3ZJVA 5IOIA 2AQ3B 5AEKB 1WH3A 1TY2A 3BIID 1L0YB 2BS4B 3H9DA 2MJ3A 1F2RI 3ZXVA 3V6EB 2PLPA 3RYTA 1HE8A 1T6BX 3RNCC 2PKOA 2Z0EB 2LGSA 1WRDB 4NAWB 5KHOA 3X0WA 1UD7A 4MDKE 3NZUA 3AE3B 3LB8C 1P1AA 3APDA 1JQ4A 3UINB 1YN3A 1VZ7A 1RAXA 2GBKA 4TQ1A 2WXJA 2H88B 3MHSD 3Q8EA 4CO7A 2HJ1A 2LUMA 3LJ3A 2ZNVC 4DXFA 2Q5WD 1TY0A 3H1UA 5IP4D 2KKCA 3IHPC 3VXWA 2MHJA 1WGDA 5BYSA 2KYWA 4AJYB 1E8XA 4LNNA 5E6JA 4AWJA 1OEYJ 4WWPA 3ECIA 1JWBD 5TR5A 4JWUC 1WSPA 2AYOB 1E8WA 4KGTA 4EKUA 2XEWA 2W55A 2KVRA 3EECA 1LO5D 2B76B 2J4XA 2KWUB 3SFEB 1BXTA 4RNAA 4FBJB 4WJOA 3KWVA 4TUUA 1TS4A 1S1QB 4IWPA 4XC2A 1D5XC 2D11A 4NZLB 2CHWA 2N9LA 2GLSA 4IDIA 1ZKHA 3W2DA 4FJVB 3APFA 3BVMA 2MJEA 4H2AA 5CTRC 4NAWA 1BT0A 2NBVB 4GB9A 4RCOA 3N1YC 1WY8A 2Y3AA 3Q3JA 3FC4A 5H8YE 4WWMA 2RDGA 4W9EA 2KTRB 2FIFA 4RGTA 4WAFA 1D5MC 3URYA 1ZGUB 1NBFC 4C4VA 1AN8A 4M00A 3QA8A 1C78A 1LFDA 3HHMA 1XLPA 3N1ZC 1FEHA 1JRUA 1SJHD 3N30A 5FKAC 3AE4B 4ZRIA 2IBIB 2IZVB 3Q3NC 1B1ZA 4W9IA 3ZNZB 3IVFA 5L95C 3GP7A 2KFJA 4RF0A 3FILA 1N62A 2JXTA 1HXYD 4G50A 1XXGA 3AE6B 4C7YA 3P4SB 1GPXA 3N32A 5D6JB 1V1PB 4NPNA 1WXVA 1C1YB 3A1QA 4W9KA 3A9KA 3NVYA 1SSNA 4ZHPA 2BW2A 4FN2A 3B9JA 1E7PB 4YXDB 3AU4A 3ZNID 4KKIA 1LM8B 4B95A 4A8XC 1YX6B 2N7DA 3ZIMA 4W9CA 4C80A 3RD2A 1FFUA 3P4QB 5FK9C 4OZCA 1V97A 2AX5A 1J7BA 4BKTA 3L08A 3EA6A 4DK5A 3T8MA 2ZCCA 1FCLA 2KTRA 1TZOA 1XLQA 2K6DB 1WYGA 2LEKA 2C7NB 4N9F4 2CU1A 3AM9A 3AULA 1JMLA 5D3DA 1JWSD 4RGNA 1WR1A 1AW7A 2IO3B 4K81A 1FXIA 1BMLC 3AMZA 3NOBA 3BYTB 4X57B 5CHFA 1SBBB 1Y8RC 3AV8A 4KIKB 3B2FA 2PEAA 4FHJA 2ZW0A 3SDLC 5DPTA 1GOZA 5HKHA 1YN4A 4KGSA 2W9NA 3QIJA 3PPAA 1V1PA 1E7VA 3B2GA 2M8SA 1J19A 2R2OA 4K7SA 1JROA 3KUCB 2MLBA 3RNBC 2D2QA 1UBIA 4E71A 2KC1A 2V4IB 2HDEA 5E6NA 5C3JB 1J8CA 4PS8A 4P1CC 3ZW3A 2IJ0A 1ET6A 4LK0M 1YQBA 4NJCA 1L6UA 3DBHB 3DCGA 1KFYB 5DPSA 4GDLA 2BYTA 3R8BA 1DOIA 2J0KA 1XEEA 2L76A 4F8CB 1WZ3A 2BKFA 1P7EA 4N59A 2WX1A 3HRDD 2O2VB 2D3AA 2KK8A 2GB1A 2WGSA 4HVBA 3I9V1 2IDYA 3MJ5A 3TJPA 4F7ZA 1R4MB 4AUQC 1L0VB 1EM7A 1I4XA 2KO3A 3RULA 2ASQA 4DXAB 4BFRA 1YJ1A 3HK0A 2KN4A 2PPHA 4GGQA 3X23A 1SE9A 1GNUA 4OHJA 2KT7A 3HVDA 3IT6B 1FIQA 1UF0A 4S17A 3T9LA 2VH2A 4AP4C 4B6WA 3GZNB 3E9SA 2GOWA 2XK5B 1FXTB 2BT6A 2MP2A 3PTFC 2K0PA 2XNAC 2JUOA 2N9PC 3AEGB 5E6OA 3T3NA 3M3JA 4B0EA 1TKYA 2LFIA 3LDZE 4EZKA 4YSZB 3M62B 2SAKA 4HLEA 1KLVA 2D10A 1JCKB 5JH5C 4LLGM 1C3TA 3ZDMC 3H6NA 3S2AA 2DENB 1A70A 1BUIC 2D3BA 1EO6A 3PV1A 2NBWB 2MH7A 3C8YA 3EUB2 2LVPA 2DZIA 3P1MA 2AL6A 3VRBB 2PVGC 4A20A 2A5UA 4KGRA 1P7FA 2O2VA 1KM7A 2BGFA 4CQNA 2KMMA 5EE9A 4J3OD 2EELA 5AUKA 2C60A 2DX5B 3OLMD 3CSFA 2KDIA 2BWFA 3DBLB 3JW0X 2LVOA 2WXIA 4A3PA 5EE3A 2D5GA 1SE4A 2QC8A 2B3AA 2YEPF 4WAAA 4OZBA 2WNMA 4WH4A 2AQ2B 4HPLB 2W54A 1KF6B 2WLBA 4JGHB 2FCQA 5EDSA 2J42A 1P0RA 4WQMA 1GC7A 2BYVE 3L16A 1IPGA 3N3KB 1H4RA 2JZPA 2RDBC 2XK5A 1IUEA 1LXDA 3R3MA 1TIFA 1TZ1A 3A33B 1WWTA 2BWES 3BVZA 2NPTB 4BAXA 2L0TA 3A4SC 4OVZA 4NY0A 1TBEA 1RRBA 1QQRA 1NYRA 5DCNA 1XCQL 4NQKE 5C1ZA 5IAAC 3RI7C 3SEBA 4GDKB 1KJTA 2KJHB 4HEA1 1N5XA 2INDC 3A4RA 5MPOA 3R2IA 4PT5A 3GE3C 3DBSA 1HEZE 2D3CA 1R7SA 2KJRA 5HFYA 1G6JA 3AI5A 1MG8A 4MT5A 2MJDA 4LDTB 1C4CA 5D94A 3APCA 2KACA 1PQSA 2G3QB 3NRZA 1RM6C 4ACFA 3UI3A 1UNSA 2OJWA 2JVCA 3AEEB 1TKGA 3ML9A 2LASA 4HDOA 4ANXA 3ZLZA 3DBRI 1JRPA 4HKZE 5JHAA 4WJQA 4XWWA 3AE2B 3OAWA 2K8HA 1OQQA 1HQRD 2C5LC 4IC7B 1HA5A 1FCCC 3Q2AC 2K1FA 2UU7A 4G11A 1P98A 2C7MB 1L2NA 1UGJA 2L52A 1QZEA 5BO4B 2NVUI 1S3SG 4HDQA 1I4GA 1FFVA 1QOGA 4PYZA 3ZRFA 1ZUD2 2WDTB 4MGZE 1T5XD 1P3QU 2LGDA 2K5PA 1WX9A 4K7UA 2WXOA 4BBNF 4P16A 4GDKA 2HD5B 5BYQA 5DPRA 2K22A 2LUEA 5IN7A 4A90A 1UWXA 4A55A 3N9YC 2JWZA 3AEFB 4IW0A 3J9CA 1C77A 3B0AA 4PK1A 2KN5A 3DWGC 4GIVA 4JE3B 3AEBB 2NS5A 2K8BA 4QAYA 4P7IA 3NVWA 2KTFA 1Q0WB 1WX8A 1TTNA 1J7AA 2C7HA 2JQRB 1E0ZA 5CHWA 2MBEA 4LNFA 3P2BA 2CU3A 3IG3A 4NNJB 2G4SA 3MHZA 3AH7A 3DVGY 2XN9C 4JPSA 4ZOHC 2IY1B 2OJRA 4IOIE 1PYWD 1R4NB 1E8YA 2IGGA 4GMVA 2J53A 2L05A 3AE5B 4JLCA 2KMAA 4ZDVA 3H7PB 2W3RA 4B0MA 1CQVA 1N63A 2QMTA 3L54A 1QOBA 3I63C 1MHHE 3V3XA 3TEYA 3PS6A 2IO1B 4C4VB 3RPFC 2DNFA 2BB5A 5D3IB 3HUIA 4YT0B 4ZYNA 2BPSA 4LJOB 3CWIA 2MQJA 2WDRB 2LVQA 4MJSA 1N60A 2JWUA 2MX2A 1JW9D 3KUDB 3FILB 1TYGB 4C56C 2KWDA 2RMMA 2QJLA 4S0RA 2MRPA 3W5UB 1X1MA 1JWUD 1FD6A 4RMAA 4DDID 2ZW1A 1VZ6A 3A1QB 1WR6E 1HZ6A 3V61A 3A9KB 1EUVB 4HRSA 1XO3A 4YSYB 4O1NA 2AL3A 3UQBA 1MI0A 1NI3A 3R2TA 1K52A 3PREA 3MTNB 2YEPB 3Q14C 3DVGX 2INCC 4FJZA 3DWMA 2RDHA 1U4AA 2DAJA 1OQRA 2PIAA 1VR9A 2KLCA 2Y5BB 3H7PA 2ONQA 3VH4B 2WXMA 5BMHA 3TBLD 2Y5CA 2YLMA 4MSQB 2WXNA 2G45B 2YVCA 3C19A 3KW5B 2WU2B 2WWZA 3KQ4A 1KTKA 3PLVA 4LTUA 1MG4A 2KANA 1NVID 4RGMA 1OQYA 3PT2B 1I4QA 2MSED 3AE7B 5IKCM 1Y56A 3W9CB 3IBEA 4MELA 4EZLA 1P9DU 2KQ7A 2JXXA 3D32A 5HI1A 2PTLA 1ISNA 5IA7A 2WS3B 4K7WA 2ACZB 1YQ4B 2EMSA 2LI5A 2UWQA 3W5VB 1NYQA 3VDZA 3N1XC 3JYUA 3U7DA 1MPEA 1VCBA 1PUTA 3VVWB 4FULA 1VDVA 1SEBD 2KC2A 3JSVA 4XX5A 1OEYA 1DOYA 2NCNA 2PE9A 1QLBB 1V6EA 3NVVA 1KOTA 2ZEQA 1L4DB 2KDEB 4US9A 4JX1C 4EEWA 2FIDA 3K9PB 1E90A 1RFKA 1FRRA 4NJ6A 1TT5B 5JXVA 4A3OA 3WAOA 2ZNVB 4GDLB 1SE3A 2ZPNA 1KLGD 3VUWA 4LNOA 2J7QB 4ANVA 1FNWA 2L00B 2KZRA 4I6LB 3ZJTA 3ZKJC 2N1VA 3ZDTA 1GUAB 3QC8B 2I2YA 1VJKA 4M8NA 4GSWA 2GBNA 5AZGA 3DVNV 4W9HA 3ETRA 2ZPYA 2I1KA 2KHWB 1Q10A 3LYYA 1ZXHA 1DYQA 3PZ7A 4WIPA 3KYCD 2N0SB 2IPKD 4IWOA 1OGWA 2QHOA 3PRMB 2HE7A 3GE8C 1WF9A 3M63B 4MGYE 2LHEA 1VLBA 2MP2B 1KH0A 3PLUA 2M4NA 3BK1A 2FBWB 4E3CA 1N6ZA 1SIJA 1YQ3B 4WQOB 4GU2A 2RSUA 1XD3B 4BKSA 2PW9A 1GB4A 2MW5A 1EU3A 3Q8CA 1SE2A 3DPDA 3VR9B 2WXRA 1J0GA 2EKIA 4KV2A 2J52A 4MGKE 1A5RA 4YL8A 1WGHA 4C00A 3Q69A 4RM8A 1T0QC 1C76A 4JWSC 1ZDVA 2ZCBA 3K9OB 1EU4A 3R66C 2KX0A 2AWTA 2FCSA 3BZDB 3V62A 1QILA 5G5GA 4ASWC 3EHVA 4KX6B 4RFBA 3QARA 4BOSC 2OOBB 2KDMA 2O6VA 1DGJA 1WXAA 5AUIA 1XQQA 1QKZA 2OHFA 2D3GA 1K8RB 1CZPA 3PRZA 4F1SA 3P42A 4KDIC 3AE9B 1GB1A 2LGYA 2JU6X 5L83A 1SF0A 1MFWA 3Q6BA 4W9FA 4XZ4A 2KMCA 2JYTA 3VR8B 4NAMA 3RNGC 2WDVB 4XE0A 3BVGA 3PO0A 2K8CA 5BYRA 4KSLC 4DBGA 1GAQB 2WXQA 2JZ3B 3UIPB 4UDUC 1YN5A 3ZQ4A 3NJTA 1QOFA 1AYFA 2ZJDA 3BY4B 2ZVNA 1MJDA 2V9HA 3MJWA 3QJZA 1ET9A 3TUOA 2V3PA 3P63A 4GOCA 3ZGZA 3I57A 4MGIE 3TEXA 5J17A 3QX1A 1QOAA 4AJWA 1V5OA 3TCAA 1STEA 1VRAB 2H89B 3AEDB 4FJYA 1WXMA 1PDXA 4HCNB 1AARA 1YJIA 5J2RA 2CHZA 1IYFA 2WHIA 3PZ8A 1ZOYB 4IM0A 1K53A 3Q8FA 1KRHA 4J6IA 1NI2A 4G0NB 3VTWA 2KWCA 1PGXA 3U2SC 1WJNA 1WJ6A 1T3QA 4OVVA 4W9JA 3QQ8B 4DDGD 3PSEB 3U52E 3MC8A 1FM0D 4KVGB 3CMMB 2KLGA 2HJ8A 4D2KA 1FO4A 5LXIB 4EFOA 3MFGA 2JT4B 2WYQA 2Y5PA 2KWVB 2DAFA 1OFFA 2N1WA 4USAA 4DHJB 1Z2MA 2G4DB 2LMCA 2MA9B 4WWOA 1N61A 4K3CA 3SFDB 2BF8B 1M4VA 4OVUA 2NBUA 3GOEA 5JZEB 1NEKB 3WALA 2DZMA 1M94A 2DZKA 3QCAA 1V49A 2INNE 3KWLA 1NENB 1F0ZA 1GJZA 4II2B 1RWSA 4C7ZA 4N58A 4BKGA 5H92C 2QILA 1WM3A 2Z8LA 4PS7A 2WXGA 1V80A 3VTVA 1E10A 3MC9A 1D5ZC 5AZFA 2ICIA 4LJPB 5DPWA 4M8MA 2REXA 4FHKA 4ARCA 3DBHI 2EMTA 1C9FA 1EF1A 3VH3B 2E3TA 4KZ0A 4REZA 5J18A 2W82A 1Q5WB 2M0XA 1WFYA 3E56A 4HROA 2NMQA 2LGIA 3L0WB 2AEHA 4GXBA 4YTMB 1XCTL 3M95A 4MH0E 4EE2A 3Q3MC 2FAZA 1YX5B 1TS3A 2G9HD 5D2MB 3KYDD 3EGRA 2DZJA 4HPMB 1IP9A 3ZJUA 2R2QA 2L0FA 4BVUC 1GC6A 3NZSA 2LJIA 1R4MI 3DHHC 1JWMD 2RPQA 1F9JA 2M56B 4I6NB 3WAPA 1WM2A 2IYDB 1WMHB 3H7SA 1V1OA 4R3DA 2RGFA 2KJ6A 2KD0A 2FNJB 3UF8A 3GB1A 2IGHA 5AZHA 4Q2JA 1FXAA 2E6XA 3WIMA 3PRPB 3GZNI 4TMAB 4MJSB 4YTPB 3RCZA 4TKNA 2LXAA 1YJJA 2L7RA 4TSSA 4JIOU 4RM9A 1RYJA 4JQWC 2N7EA 5FR6A 4US8A 3Q8BA 4ZYSA 3U8ZA 1PGAA 3Q3OC 4BZAA 3B1LX 2GMIC 3AXCA 5C23A 2A4ZA 3Q8AA 2NTSA 1V81A 4WJPA 2WXHA 3KUZA 1SGHA 3WAMA 1J7CA 4P1BC 2VZKB 3VQIA 4HXDA 1D6EC 1JALA 2KFKA 1UH6A 2FE8A 3KLSX 3C0RB 3L17A 3OWEB 2JZZA 1L0XB 1DOXA 3ALBA 5EE0A 3DOWA 2IO2B 3EFUA 4RH6A 1V86A 2QSDA 3VHTC 3DBLI 1YD8U 2QCZA 1L5PA 1WMHA 2JRHA 1XLNA 2BYFA 1F52A 2JRIB 1K51A 4DHZE 2GBJA 2CHXA 3ZRCA 1HTQA 4M0WA 4RGOS 2N4FA 1QT9A 3A9JA 3OJ4B 3IAM1 2V0GA 4DHJD 4HWIB 1ESFA 4CYEA 3OG5A 3JVZX 4W9GA 1EWCA 1XLOA 2V3NA 3VUYA 2FCMA 2M17A 3PHXB 4GLSC 1TKEA 2BKRB 5JHBA 4OZAA 1WZ0A 2ZZPB 3V60A 3JSVB 3W1YA 4MM3A 2IO0B 2I38A 3RZWC 2K25A 1L6VA 2CKHB 3NHEB 4IWQA 1WE7A 3V05A 3SD5A 5LXHA 4NJ7A 4B9KA 3PGEA 4LDTD 4L1BA 2FUHB 3P4RB 3QHTA 2WU5B 4AQ7A 5T8IA 3KH0A 2JYEA 1B9RA 3RT3B 1WIAA 2LZ6A 3VFKA 1GG3A 4BBNC 1N5WA 2TSSA 3NY5A 1E6EB 3NZ3A 4M02A 3ZVVA 1YNTE 2NTTA 2MBQA 1L7YA 2DYBA 2MBOA 2K6QA 3R7RA 1QF6A 1IGCA 1WJ4A 2I1JA 3CF6E 1HTOA 2G1EA 2LWPA 1SXTA 4K1RB 2VH1A 4XDCA 1CK1A 4WURA 2PVOD 2WXKA 2PMVA 3AN1A 2KDFB 4PS3A 4DQOC 1XT9B 4ZRKA 2GI9A 1I35A 4A9AA 2PE6B 4KKJA 1NDDA 3Q3FA 4IG7B 2KQ4X 1H8CA 5GMVA 2N7JA 3SR6A 5BMGA 1I42A 1EWYC 2KNBA 3TIXA 2CR5A 1WGGA 2CS4A 1YOVB 4FLHA 3R7QA 1E7UA 2DLBA 1TS5A 2WXFA 2HTHA 1OTRB 1YIWA 1ZE3D 1I7HA 3QK0A 3RNEC 5D7GA 2IGDA 5LLIA 1IBXB 3DQVA 2Z0DB 3BYYB 1UGMA 2RD0A 2MBHA 2LXCA 2VZKD 5FR3A 4URKA 2WX0A 3EFCA 5HG2A 2L8JA 4HCPB 3L13A 4HK2A 1L4ZB 2K39A 3L4PA 2L1AA 3AE1B 1MVKA 1Z5SB 1UELA 2L83A 3RNAC 4W9DA 5TSSA 1HZ5A 2O6VB 1R4NI 2L3ZA 3H8HA 4P6VF 3QWZB 1WGYA 2M1MA 1FMAD 4ICUA 3WCQA 4CHKA 1WJUA 2AQ1B 2DYMA 3ZNGC 4FXCA 3IT4B 1ACCA 1ENFA 1I4HA 2ON8A 2BVCA 3EC8A 4L2YA 1TS2A 2LRUA 3WA0A 3MP9A 3HVZA 2V3SA 3FKYA 3AU5A 3AEAB 2X38A 3I3TB 1WE6A 2L32A 3NS1A 1TGZB 1YMHE 4EOYA 2VRRB 3W1SC 1WGKA 4NQLB 2KXJA 4HJKA 4KZCA 4LNKA 2IY0B 2WQYB 4PYUA 3RFZB 3OJ3A 1F2RC 2JY6A 2PJHA 3VAWA 3IAS1 1IBXA 3HM3A 2MBBB 4BOZB 1CJEA 1E9MA 4OW0A 1UZXB 4W9LA 2CJOA 2J0JA 2JX5A 4EZJA 2LGXA 3TMPB 2LRWA
chains in the Genus database with same CATH topology
2MBEA 3N30A 4ZRIA 2IBIB 3P2BA 2IZVB 3DVNU 1E5WA 3IG3A 4NNJB 2G4DB 4W9IA 3ZNZB 2MA9B 3IVFA 4TV3A 2G4SA 4WWOA 4II3B 5L95C 2JF5A 3DVGY 2BF8B 4IM2A 2KFJA 4OVUA 2NBUA 3GOEA 5JZEB 1V5TA 3WALA 2DZMA 1M94A 2DZKA 2IY1B 2OJRA 3QCAA 4G50A 1E8YA 1V49A 4GMVA 3N32A 2L05A 4JLCA 5D6JB 2KMAA 4ZDVA 1EF5A 4NPNA 1GJZA 1WXVA 3H7PB 4II2B 1C1YB 1Q1OA 4KDLB 4EUTA 3A1QA 4W9KA 3L54A 4BKGA 3A9KA 1WM3A 4PS7A 1V80A 3HM6X 1WYWB 4GN1A 3VTVA 4FN2A 5AZFA 3U30A 3PS6A 2IO1B 4LJPB 4M8MA 5DPWA 3AU4A 2REXA 3ZNID 4FHKA 2GBRA 3DBHI 2EMTA 1LM8B 5E6PA 4B95A 1EF1A 3VH3B 3ONSA 5J18A 4KZ0A 4KIKA 3ZTCA 1Q5WB 3VTUA 2M0XA 3HIZA 1WFYA 1YX6B 2KDBA 2N7DA 3ZIMA 4WJNA 4W9CA 2DYOA 3L0WB 2AEHA 4GXBA 4ZYNA 3RD2A 2BPSA 3M95A 4LJOB 3V6CB 4MH0E 2MQJA 2LVQA 4MJSA 3ZTDA 3ZNHB 2D07B 3PHWB 3WANA 2FAZA 4BKTA 1YX5B 3L08A 5D2MB 3KYDD 2MX2A 1T0YA 2DZJA 4HPMB 3T8MA 4DK5A 3KUDB 2ZCCA 1IP9A 2R2QA 2L0FA 4BKSD 3RUIB 2KTRA 4BVUC 4ANWA 4MEMA 1GC6A 2MRPA 3NZSA 1X1MA 4E74A 1R4MI 2K6DB 4RMAA 4DDID 2C7NB 4N9F4 2RPQA 1F9JA 4I6NB 1VD2A 3VUXA 3WAPA 1WM2A 2CU1A 2IYDB 3A1QB 4KSKC 2Z59B 1WR6E 1WMHB 2BYEA 3V61A 1WX7A 1EUVB 3A9KB 4FADA 3H7SA 3AULA 4ANUA 4JL9A 1WR1A 2IO3B 2RGFA 4K81A 2KJ6A 2KD0A 2AL3A 3UQBA 3NOBA 2C9WB 2FNJB 3IFWB 3PREA 3BINA 4X57B 3UF8A 5CHFA 4KIKB 1Y8RC 3MTNB 5AZHA 2LD9A 2PEAA 4FHJA 3DVGX 5CHVC 5KHQA 3WIMA 3PRPB 3SDLC 4AOFA 3ENEA 3GZNI 5DPTA 4FJZA 3ML8A 4MJSB 5HKHA 3RCZA 4TKNA 1U4AA 2LXAA 1WGRA 4IUMB 2DAJA 3SU8X 2W9NA 3QIJA 2L7RA 3PPAA 4JIOU 2KLCA 4RM9A 1E7VA 2Y5BB 4JQWC 3H7PA 2N7EA 2M8SA 1J19A 2O6VD 2R2OA 4K7SA 5FR6A 3VH4B 2XBBC 3TBLD 3KUCB 2YLMA 2MCNB 2MWSB 4MSQB 2MLBA 2YVCA 2G45B 3KW5B 4DWFA 2WWZA 3PLVA 3U8ZA 3PZDA 2D2QA 3ZO5B 1UBIA 2KOXA 4E71A 2KC1A 3B1LX 2GMIC 2KANA 5E6NA 1J8CA 4PS8A 1OQYA 3PT2B 3AXCA 5C23A 2A4ZA 3UIOB 2MSED 3ZW3A 2KQSA 1V81A 1YQBA 4WJPA 2N9XA 3O65B 3KUZA 3IBEA 3DCGA 4MELA 1SGHA 4EZLA 1P9DU 3WAMA 5DPSA 2EKEC 2KQ7A 2JXXA 3D32A 4GDLA 4MSMB 1D3ZA 3VQIA 4HXDA 2J0KA 1ISNA 2KFKA 5G55A 1UH6A 4F8CB 2L76A 3C0RB 1WZ3A 5IA7A 2BKFA 3L17A 2JZZA 4K7WA 2N9EB 1SIFA 3ALBA 2WX1A 2EMSA 3DOWA 2LI5A 2UWQA 4I6PA 3VDZA 2IO2B 3EFUA 2O2VB 3JYUA 4DHZB 2KK8A 3U7DA 4HVBA 1ZW7A 3TJPA 1V86A 1VCBA 3VVWB 3PVLA 4FULA 3VHTC 3DBLI 1YD8U 2KC2A 4F7ZA 3JSVA 1WMHA 4XX5A 1OEYA 2JRHA 1V9JA 4AUQC 2NCNA 2PE9A 1RFAA 2KX3A 2KO3A 2BYFA 1V6EA 1WI0A 3RULA 2JRIB 2ASQA 2ZEQA 4ICVA 1KOTA 2KDEB 4DHZE 2GBJA 2CHXA 3ZRCA 4BFRA 4DXAB 1YJ1A 3HK0A 2FIDA 3K9PB 4EEWA 2N4FA 2PPHA 1E90A 1CMXB 4GGQA 3X23A 1SE9A 1GNUA 3A9JA 3OJ4B 2JPHA 4NJ6A 4A3OA 4LCDE 3WAOA 2ZNVB 4GDLB 4DHJD 4HWIB 3T9LA 4CYEA 3W1SA 2KFKB 4AP4C 2ZPNA 4B6WA 3JVZX 4IM3A 3L10B 4W9GA 2GOWA 3VUWA 2J7QB 2XK5B 3VUYA 4ANVA 1FXTB 2FCMA 2MP2A 3PTFC 2L00B 2KZRA 3UQAA 2JUOA 4I6LB 2N9PC 2M17A 2RR9A 3CSTA 3ZKJC 2V4LA 5E6OA 2N1VA 3PHXB 1RLFA 1GUAB 3M3JA 3QC8B 3ZDTA 3QAQA 2NR2A 2BKRB 3UGBB 5JHBA 3RZFA 3LDZE 4M8NA 4EZKA 1WZ0A 2ZZPB 4GSWA 2GBNA 3ZUNA 2ZVOA 3V60A 3JSVB 5AZGA 3W1YA 3DVNV 3M62B 4MM3A 2IO0B 3RZWC 4W9HA 4HLEA 2ZPYA 2I1KA 2KHWB 2D10A 1KLVA 5JH5C 2K25A 3B08A 5G2NA 2CKHB 1C3TA 3NHEB 3ZDMC 2V1YA 3H6NA 4WWNA 4IWQA 1WE7A 5LXHA 3SD5A 3S2AA 2FCNA 4M0WB 4FA6A 4NJ7A 2DENB 1UBQA 4B9KA 3PGEA 4LDTD 1EO6A 1V2YA 2FUHB 3KYCD 2NBWB 3A9JB 3PV1A 2LVPA 3QHTA 2DZIA 4IWOA 1OGWA 2LJ5A 2AL6A 2QHOA 3KH0A 3PRMB 1E8ZA 4A20A 2A5UA 2HE7A 1WF9A 2O2VA 3M63B 4MGYE 1KM7A 3RT3B 1WIAA 2BGFA 2LZ6A 1GG3A 3VFKA 4BBNC 2NPTA 2MP2B 5CX3A 2UYZB 3NY5A 3PLUA 4G3XB 2M4NA 2C60A 2DX5B 3OLMD 4E3CA 3CSFA 2DHZA 2BWFA 2KDIA 3ZVVA 3TL5A 2MBQA 3JW0X 1L7YA 2DYBA 2MBOA 4WQOB 2LVOA 3NS8A 2K6QA 3R7RA 4GU2A 1LQBA 2RSUA 1XD3B 4A3PA 1WJ4A 2I1JA 4BKSA 4TQ0A 3CF6E 2MW5A 2GBMA 2LWPA 2B3AA 4K1RB 3DPDA 4WAAA 4ZRJA 1J0GA 4HPLB 1WXSA 4JGHB 2J0MA 3DDCB 4KV2A 2FCQA 5EDSA 3KVFB 4PS3A 2KDFB 4MGKE 3SHQA 1XT9B 1P0RA 1A5RA 4YL8A 4ZRKA 1GC7A 2BYVE 1WGHA 3L16A 1IPGA 1I35A 3N3KB 1H4RA 2XK5A 5AEKB 2PE6B 1NDDA 1WH3A 3Q3FA 4RM8A 4IG7B 1LXDA 3R3MA 2ZCBA 3K9OB 3R66C 5GMVA 1TZ1A 1H8CA 3A33B 2BWES 2KX0A 2NPTB 3H9DA 1I42A 2L0TA 3A4SC 3V6EB 2AWTA 2FCSA 3V62A 4ASWC 2KNBA 3EHVA 4NY0A 3RYTA 1HE8A 1TBEA 1RRBA 3QARA 3TIXA 2CR5A 4BOSC 1WGGA 5DCNA 2CS4A 4NQKE 5C1ZA 2Z0EB 2OOBB 5IAAC 4FLHA 2O6VA 3R7QA 1E7UA 1WXAA 1WRDB 2HTHA 1OTRB 4GDKB 4NAWB 1XQQA 1YIWA 2D3GA 5KHOA 1K8RB 3X0WA 3TMPB 1KJTA 1UD7A 3PRZA 4F1SA 4MDKE 2KJHB 3QK0A 4KDIC 3NZUA 2LGYA 3A4RA 5D7GA 5LLIA 5L83A 1P1AA 3DBSA 3APDA 3DQVA 3UINB 4W9FA 4XZ4A 2KMCA 2Z0DB 1UGMA 2KJRA 1RAXA 2RD0A 2MBHA 1G6JA 2LXCA 2GBKA 3AI5A 4TQ1A 1MG8A 4URKA 3MHSD 2WX0A 4CO7A 4LDTB 2K8CA 5D94A 3APCA 1PQSA 2G3QB 2L8JA 4KSLC 4DBGA 4HCPB 3LJ3A 2ZNVC 3L13A 4HK2A 2K39A 3H1UA 2JZ3B 3UIPB 2KKCA 3IHPC 2JVCA 1Z5SB 1UELA 3VXWA 4W9DA 1WGDA 3ML9A 2ZJDA 3BY4B 2LASA 4AJYB 2ZVNA 1E8XA 2O6VB 4HDOA 1R4NI 4AWJA 1OEYJ 3ZLZA 4ANXA 3DBRI 2L3ZA 4WWPA 3ECIA 3MJWA 5TR5A 3QWZB 5JHAA 3QJZA 4WJQA 1WGYA 2AYOB 3OAWA 1E8WA 2K8HA 2M1MA 4ICUA 4CHKA 4EKUA 2XEWA 2C5LC 4GOCA 4IC7B 1WJUA 2KVRA 3EECA 2DYMA 3ZNGC 4MGIE 5J17A 2KWUB 3QX1A 2K1FA 3EC8A 4G11A 4FBJB 4AJWA 4WJOA 1P98A 1V5OA 2C7MB 2LRUA 4TUUA 3TCAA 1L2NA 4FJYA 3WA0A 1WXMA 4HCNB 1QZEA 1S1QB 4IWPA 4XC2A 5BO4B 1AARA 2V3SA 5J2RA 2D11A 2NVUI 3AU5A 2CHZA 1S3SG 2CHWA 1IYFA 4HDQA 3I3TB 4PYZA 1WE6A 3ZRFA 2WDTB 4MGZE 1ZKHA 4IM0A 1TGZB 1P3QU 2LGDA 4EOYA 4FJVB 1WX9A 2VRRB 3APFA 3W1SC 4J6IA 4NQLB 5CTRC 4K7UA 2KXJA 1NI2A 4HJKA 4BBNF 4KZCA 4GDKA 4NAWA 2HD5B 4G0NB 1BT0A 2IY0B 2NBVB 4GB9A 3VTWA 2KWCA 4PYUA 5DPRA 2LUEA 1WJNA 3OJ3A 1WJ6A 4OVVA 2JY6A 4W9JA 2JWZA 2PJHA 3VAWA 1WY8A 3HM3A 2MBBB 3Q3JA 3QQ8B 4IW0A 4BOZB 4DDGD 3PSEB 4W9EA 2KTRB 4KVGB 3B0AA 3CMMB 2FIFA 2KN5A 2KLGA 4GIVA 2HJ8A 1UZXB 5LXIB 2NS5A 2K8BA 4W9LA 4P7IA 4EFOA 1ZGUB 2J0JA 1NBFC 2KTFA 1Q0WB 1WX8A 2JT4B 2WYQA 2KWVB 2DAFA 1TTNA 2N1WA 3QA8A 4EZJA 1LFDA 3HHMA 2C7HA 2LGXA 1JRUA 5CHWA 4DHJB 1Z2MA 2LRWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MBE A;  3N30 A;  4ZRI A;  2IBI B;  3P2B A;  2IZV B;  3DVN U;  1E5W A;  3IG3 A;  4NNJ B;  2G4D B;  4W9I A;  3ZNZ B;  2MA9 B;  3IVF A;  4TV3 A;  2G4S A;  4WWO A;  4II3 B;  5L95 C;  2JF5 A;  3DVG Y;  2BF8 B;  4IM2 A;  2KFJ A;  4OVU A;  2NBU A;  3GOE A;  5JZE B;  1V5T A;  3WAL A;  2DZM A;  1M94 A;  2DZK A;  2IY1 B;  2OJR A;  3QCA A;  4G50 A;  1E8Y A;  1V49 A;  4GMV A;  3N32 A;  2L05 A;  4JLC A;  5D6J B;  2KMA A;  4ZDV A;  1EF5 A;  4NPN A;  1GJZ A;  1WXV A;  3H7P B;  4II2 B;  1C1Y B;  1Q1O A;  4KDL B;  4EUT A;  3A1Q A;  4W9K A;  3L54 A;  4BKG A;  3A9K A;  1WM3 A;  4PS7 A;  1V80 A;  3HM6 X;  1WYW B;  4GN1 A;  3VTV A;  4FN2 A;  5AZF A;  3U30 A;  3PS6 A;  2IO1 B;  4LJP B;  4M8M A;  5DPW A;  3AU4 A;  2REX A;  3ZNI D;  4FHK A;  2GBR A;  3DBH I;  2EMT A;  1LM8 B;  5E6P A;  4B95 A;  1EF1 A;  3VH3 B;  3ONS A;  5J18 A;  4KZ0 A;  4KIK A;  3ZTC A;  1Q5W B;  3VTU A;  2M0X A;  3HIZ A;  1WFY A;  1YX6 B;  2KDB A;  2N7D A;  3ZIM A;  4WJN A;  4W9C A;  2DYO A;  3L0W B;  2AEH A;  4GXB A;  4ZYN A;  3RD2 A;  2BPS A;  3M95 A;  4LJO B;  3V6C B;  4MH0 E;  2MQJ A;  2LVQ A;  4MJS A;  3ZTD A;  3ZNH B;  2D07 B;  3PHW B;  3WAN A;  2FAZ A;  4BKT A;  1YX5 B;  3L08 A;  5D2M B;  3KYD D;  2MX2 A;  1T0Y A;  2DZJ A;  4HPM B;  3T8M A;  4DK5 A;  3KUD B;  2ZCC A;  1IP9 A;  2R2Q A;  2L0F A;  4BKS D;  3RUI B;  2KTR A;  4BVU C;  4ANW A;  4MEM A;  1GC6 A;  2MRP A;  3NZS A;  1X1M A;  4E74 A;  1R4M I;  2K6D B;  4RMA A;  4DDI D;  2C7N B;  4N9F 4;  2RPQ A;  1F9J A;  4I6N B;  1VD2 A;  3VUX A;  3WAP A;  1WM2 A;  2CU1 A;  2IYD B;  3A1Q B;  4KSK C;  2Z59 B;  1WR6 E;  1WMH B;  2BYE A;  3V61 A;  1WX7 A;  1EUV B;  3A9K B;  4FAD A;  3H7S A;  3AUL A;  4ANU A;  4JL9 A;  1WR1 A;  2IO3 B;  2RGF A;  4K81 A;  2KJ6 A;  2KD0 A;  2AL3 A;  3UQB A;  3NOB A;  2C9W B;  2FNJ B;  3IFW B;  3PRE A;  3BIN A;  4X57 B;  3UF8 A;  5CHF A;  4KIK B;  1Y8R C;  3MTN B;  5AZH A;  2LD9 A;  2PEA A;  4FHJ A;  3DVG X;  5CHV C;  5KHQ A;  3WIM A;  3PRP B;  3SDL C;  4AOF A;  3ENE A;  3GZN I;  5DPT A;  4FJZ A;  3ML8 A;  4MJS B;  5HKH A;  3RCZ A;  4TKN A;  1U4A A;  2LXA A;  1WGR A;  4IUM B;  2DAJ A;  3SU8 X;  2W9N A;  3QIJ A;  2L7R A;  3PPA A;  4JIO U;  2KLC A;  4RM9 A;  1E7V A;  2Y5B B;  4JQW C;  3H7P A;  2N7E A;  2M8S A;  1J19 A;  2O6V D;  2R2O A;  4K7S A;  5FR6 A;  3VH4 B;  2XBB C;  3TBL D;  3KUC B;  2YLM A;  2MCN B;  2MWS B;  4MSQ B;  2MLB A;  2YVC A;  2G45 B;  3KW5 B;  4DWF A;  2WWZ A;  3PLV A;  3U8Z A;  3PZD A;  2D2Q A;  3ZO5 B;  1UBI A;  2KOX A;  4E71 A;  2KC1 A;  3B1L X;  2GMI C;  2KAN A;  5E6N A;  1J8C A;  4PS8 A;  1OQY A;  3PT2 B;  3AXC A;  5C23 A;  2A4Z A;  3UIO B;  2MSE D;  3ZW3 A;  2KQS A;  1V81 A;  1YQB A;  4WJP A;  2N9X A;  3O65 B;  3KUZ A;  3IBE A;  3DCG A;  4MEL A;  1SGH A;  4EZL A;  1P9D U;  3WAM A;  5DPS A;  2EKE C;  2KQ7 A;  2JXX A;  3D32 A;  4GDL A;  4MSM B;  1D3Z A;  3VQI A;  4HXD A;  2J0K A;  1ISN A;  2KFK A;  5G55 A;  1UH6 A;  4F8C B;  2L76 A;  3C0R B;  1WZ3 A;  5IA7 A;  2BKF A;  3L17 A;  2JZZ A;  4K7W A;  2N9E B;  1SIF A;  3ALB A;  2WX1 A;  2EMS A;  3DOW A;  2LI5 A;  2UWQ A;  4I6P A;  3VDZ A;  2IO2 B;  3EFU A;  2O2V B;  3JYU A;  4DHZ B;  2KK8 A;  3U7D A;  4HVB A;  1ZW7 A;  3TJP A;  1V86 A;  1VCB A;  3VVW B;  3PVL A;  4FUL A;  3VHT C;  3DBL I;  1YD8 U;  2KC2 A;  4F7Z A;  3JSV A;  1WMH A;  4XX5 A;  1OEY A;  2JRH A;  1V9J A;  4AUQ C;  2NCN A;  2PE9 A;  1RFA A;  2KX3 A;  2KO3 A;  2BYF A;  1V6E A;  1WI0 A;  3RUL A;  2JRI B;  2ASQ A;  2ZEQ A;  4ICV A;  1KOT A;  2KDE B;  4DHZ E;  2GBJ A;  2CHX A;  3ZRC A;  4BFR A;  4DXA B;  1YJ1 A;  3HK0 A;  2FID A;  3K9P B;  4EEW A;  2N4F A;  2PPH A;  1E90 A;  1CMX B;  4GGQ A;  3X23 A;  1SE9 A;  1GNU A;  3A9J A;  3OJ4 B;  2JPH A;  4NJ6 A;  4A3O A;  4LCD E;  3WAO A;  2ZNV B;  4GDL B;  4DHJ D;  4HWI B;  3T9L A;  4CYE A;  3W1S A;  2KFK B;  4AP4 C;  2ZPN A;  4B6W A;  3JVZ X;  4IM3 A;  3L10 B;  4W9G A;  2GOW A;  3VUW A;  2J7Q B;  2XK5 B;  3VUY A;  4ANV A;  1FXT B;  2FCM A;  2MP2 A;  3PTF C;  2L00 B;  2KZR A;  3UQA A;  2JUO A;  4I6L B;  2N9P C;  2M17 A;  2RR9 A;  3CST A;  3ZKJ C;  2V4L A;  5E6O A;  2N1V A;  3PHX B;  1RLF A;  1GUA B;  3M3J A;  3QC8 B;  3ZDT A;  3QAQ A;  2NR2 A;  2BKR B;  3UGB B;  5JHB A;  3RZF A;  3LDZ E;  4M8N A;  4EZK A;  1WZ0 A;  2ZZP B;  4GSW A;  2GBN A;  3ZUN A;  2ZVO A;  3V60 A;  3JSV B;  5AZG A;  3W1Y A;  3DVN V;  3M62 B;  4MM3 A;  2IO0 B;  3RZW C;  4W9H A;  4HLE A;  2ZPY A;  2I1K A;  2KHW B;  2D10 A;  1KLV A;  5JH5 C;  2K25 A;  3B08 A;  5G2N A;  2CKH B;  1C3T A;  3NHE B;  3ZDM C;  2V1Y A;  3H6N A;  4WWN A;  4IWQ A;  1WE7 A;  5LXH A;  3SD5 A;  3S2A A;  2FCN A;  4M0W B;  4FA6 A;  4NJ7 A;  2DEN B;  1UBQ A;  4B9K A;  3PGE A;  4LDT D;  1EO6 A;  1V2Y A;  2FUH B;  3KYC D;  2NBW B;  3A9J B;  3PV1 A;  2LVP A;  3QHT A;  2DZI A;  4IWO A;  1OGW A;  2LJ5 A;  2AL6 A;  2QHO A;  3KH0 A;  3PRM B;  1E8Z A;  4A20 A;  2A5U A;  2HE7 A;  1WF9 A;  2O2V A;  3M63 B;  4MGY E;  1KM7 A;  3RT3 B;  1WIA A;  2BGF A;  2LZ6 A;  1GG3 A;  3VFK A;  4BBN C;  2NPT A;  2MP2 B;  5CX3 A;  2UYZ B;  3NY5 A;  3PLU A;  4G3X B;  2M4N A;  2C60 A;  2DX5 B;  3OLM D;  4E3C A;  3CSF A;  2DHZ A;  2BWF A;  2KDI A;  3ZVV A;  3TL5 A;  2MBQ A;  3JW0 X;  1L7Y A;  2DYB A;  2MBO A;  4WQO B;  2LVO A;  3NS8 A;  2K6Q A;  3R7R A;  4GU2 A;  1LQB A;  2RSU A;  1XD3 B;  4A3P A;  1WJ4 A;  2I1J A;  4BKS A;  4TQ0 A;  3CF6 E;  2MW5 A;  2GBM A;  2LWP A;  2B3A A;  4K1R B;  3DPD A;  4WAA A;  4ZRJ A;  1J0G A;  4HPL B;  1WXS A;  4JGH B;  2J0M A;  3DDC B;  4KV2 A;  2FCQ A;  5EDS A;  3KVF B;  4PS3 A;  2KDF B;  4MGK E;  3SHQ A;  1XT9 B;  1P0R A;  1A5R A;  4YL8 A;  4ZRK A;  1GC7 A;  2BYV E;  1WGH A;  3L16 A;  1IPG A;  1I35 A;  3N3K B;  1H4R A;  2XK5 A;  5AEK B;  2PE6 B;  1NDD A;  1WH3 A;  3Q3F A;  4RM8 A;  4IG7 B;  1LXD A;  3R3M A;  2ZCB A;  3K9O B;  3R66 C;  5GMV A;  1TZ1 A;  1H8C A;  3A33 B;  2BWE S;  2KX0 A;  2NPT B;  3H9D A;  1I42 A;  2L0T A;  3A4S C;  3V6E B;  2AWT A;  2FCS A;  3V62 A;  4ASW C;  2KNB A;  3EHV A;  4NY0 A;  3RYT A;  1HE8 A;  1TBE A;  1RRB A;  3QAR A;  3TIX A;  2CR5 A;  4BOS C;  1WGG A;  5DCN A;  2CS4 A;  4NQK E;  5C1Z A;  2Z0E B;  2OOB B;  5IAA C;  4FLH A;  2O6V A;  3R7Q A;  1E7U A;  1WXA A;  1WRD B;  2HTH A;  1OTR B;  4GDK B;  4NAW B;  1XQQ A;  1YIW A;  2D3G A;  5KHO A;  1K8R B;  3X0W A;  3TMP B;  1KJT A;  1UD7 A;  3PRZ A;  4F1S A;  4MDK E;  2KJH B;  3QK0 A;  4KDI C;  3NZU A;  2LGY A;  3A4R A;  5D7G A;  5LLI A;  5L83 A;  1P1A A;  3DBS A;  3APD A;  3DQV A;  3UIN B;  4W9F A;  4XZ4 A;  2KMC A;  2Z0D B;  1UGM A;  2KJR A;  1RAX A;  2RD0 A;  2MBH A;  1G6J A;  2LXC A;  2GBK A;  3AI5 A;  4TQ1 A;  1MG8 A;  4URK A;  3MHS D;  2WX0 A;  4CO7 A;  4LDT B;  2K8C A;  5D94 A;  3APC A;  1PQS A;  2G3Q B;  2L8J A;  4KSL C;  4DBG A;  4HCP B;  3LJ3 A;  2ZNV C;  3L13 A;  4HK2 A;  2K39 A;  3H1U A;  2JZ3 B;  3UIP B;  2KKC A;  3IHP C;  2JVC A;  1Z5S B;  1UEL A;  3VXW A;  4W9D A;  1WGD A;  3ML9 A;  2ZJD A;  3BY4 B;  2LAS A;  4AJY B;  2ZVN A;  1E8X A;  2O6V B;  4HDO A;  1R4N I;  4AWJ A;  1OEY J;  3ZLZ A;  4ANX A;  3DBR I;  2L3Z A;  4WWP A;  3ECI A;  3MJW A;  5TR5 A;  3QWZ B;  5JHA A;  3QJZ A;  4WJQ A;  1WGY A;  2AYO B;  3OAW A;  1E8W A;  2K8H A;  2M1M A;  4ICU A;  4CHK A;  4EKU A;  2XEW A;  2C5L C;  4GOC A;  4IC7 B;  1WJU A;  2KVR A;  3EEC A;  2DYM A;  3ZNG C;  4MGI E;  5J17 A;  2KWU B;  3QX1 A;  2K1F A;  3EC8 A;  4G11 A;  4FBJ B;  4AJW A;  4WJO A;  1P98 A;  1V5O A;  2C7M B;  2LRU A;  4TUU A;  3TCA A;  1L2N A;  4FJY A;  3WA0 A;  1WXM A;  4HCN B;  1QZE A;  1S1Q B;  4IWP A;  4XC2 A;  5BO4 B;  1AAR A;  2V3S A;  5J2R A;  2D11 A;  2NVU I;  3AU5 A;  2CHZ A;  1S3S G;  2CHW A;  1IYF A;  4HDQ A;  3I3T B;  4PYZ A;  1WE6 A;  3ZRF A;  2WDT B;  4MGZ E;  1ZKH A;  4IM0 A;  1TGZ B;  1P3Q U;  2LGD A;  4EOY A;  4FJV B;  1WX9 A;  2VRR B;  3APF A;  3W1S C;  4J6I A;  4NQL B;  5CTR C;  4K7U A;  2KXJ A;  1NI2 A;  4HJK A;  4BBN F;  4KZC A;  4GDK A;  4NAW A;  2HD5 B;  4G0N B;  1BT0 A;  2IY0 B;  2NBV B;  4GB9 A;  3VTW A;  2KWC A;  4PYU A;  5DPR A;  2LUE A;  1WJN A;  3OJ3 A;  1WJ6 A;  4OVV A;  2JY6 A;  4W9J A;  2JWZ A;  2PJH A;  3VAW A;  1WY8 A;  3HM3 A;  2MBB B;  3Q3J A;  3QQ8 B;  4IW0 A;  4BOZ B;  4DDG D;  3PSE B;  4W9E A;  2KTR B;  4KVG B;  3B0A A;  3CMM B;  2FIF A;  2KN5 A;  2KLG A;  4GIV A;  2HJ8 A;  1UZX B;  5LXI B;  2NS5 A;  2K8B A;  4W9L A;  4P7I A;  4EFO A;  1ZGU B;  2J0J A;  1NBF C;  2KTF A;  1Q0W B;  1WX8 A;  2JT4 B;  2WYQ A;  2KWV B;  2DAF A;  1TTN A;  2N1W A;  3QA8 A;  4EZJ A;  1LFD A;  3HHM A;  2C7H A;  2LGX A;  1JRU A;  5CHW A;  4DHJ B;  1Z2M A;  2LRW A; 
#chains in the Genus database with same CATH topology
 1JWA D;  5G5H A;  3DVN U;  1E5W A;  4TV3 A;  5GXG B;  4II3 B;  3O13 A;  2JF5 A;  3FAH A;  4IM2 A;  1V5T A;  3GS2 A;  3DBR B;  1LGR A;  4A6Q A;  1EF5 A;  1K50 A;  3I5J C;  4KDL B;  1Q1O A;  4EUT A;  1I4R A;  3AE8 B;  4GN1 A;  3HM6 X;  1WYW B;  4YSX B;  3U30 A;  2DWQ A;  2CJN A;  2GBR A;  2BBC A;  5E6P A;  3ONS A;  3AB5 A;  4KIK A;  3ZTC A;  3VTU A;  3HIZ A;  2KDB A;  4WJN A;  2DYO A;  1PFD A;  2K9X A;  4MAC A;  1ZXI A;  1ZDX A;  3V6C B;  4DXG A;  3ZTD A;  3ZNH B;  3RNF C;  1T0S C;  2D07 B;  3PHW B;  3WAN A;  3T3O A;  1T0Y A;  1I4P A;  2KAJ A;  2R61 A;  4BKS D;  3RUI B;  1UWM A;  4K3B A;  4MEM A;  4ANW A;  4E74 A;  3ZYY X;  1VD2 A;  3VUX A;  4KSK C;  2Z59 B;  2BYE A;  2QIE B;  1WX7 A;  3ZXR A;  3TSS A;  1FRD A;  4FAD A;  3BK2 A;  2HTM E;  3ABV B;  1FNU A;  4ANU A;  1FPY A;  4JL9 A;  4XWT A;  2C9W B;  4ARI A;  3IFW B;  3BIN A;  1WRI A;  1SB3 C;  2LD9 A;  5CHV C;  5KHQ A;  3TEZ A;  2QDF A;  4AOF A;  3ENE A;  3ML8 A;  5IO9 A;  5C2T B;  3RN9 C;  4IUM B;  1WGR A;  3SU8 X;  3TEW A;  1VZ8 A;  1SJE D;  1ZP0 B;  2O6V D;  2XBB C;  3U7Z A;  2M19 A;  2MCN B;  2MWS B;  4DWF A;  3MC0 B;  3ZO5 B;  3PZD A;  2KOX A;  1XF5 L;  2WXL A;  4HJG E;  2RPV A;  3UIO B;  2KQS A;  2WDQ B;  4HPP A;  2N9X A;  3O65 B;  2KVZ A;  1WXQ A;  4RF1 A;  2EKE C;  3IXS A;  4MH8 A;  4MSM B;  4YTN B;  1D3Z A;  3LXF A;  5G55 A;  5HHD G;  2N9E B;  4ZHO A;  1SIF A;  1MHX A;  2BTE A;  4I6P A;  4YWG G;  1C4P A;  3DHI C;  4DHZ B;  1UUP A;  1ZW7 A;  2INP E;  3PVL A;  2MEK A;  1V9J A;  1RFA A;  2KX3 A;  3U4E G;  1WI0 A;  4ICV A;  1IGD A;  1KLU D;  2X8X X;  1FNV A;  1CMX B;  3N20 C;  3CIR B;  2BS3 B;  2JPH A;  4LCD E;  4M01 A;  2WXP A;  1D4B A;  2QEJ C;  3W1S A;  2OED A;  2KFK B;  2DBY A;  4AS1 A;  3BWU D;  4IM3 A;  3L10 B;  1F77 A;  4L23 A;  5BMI A;  5EE1 A;  2WP9 B;  3UQA A;  1AWD A;  2RR9 A;  3CST A;  2V4L A;  1RLF A;  2M0A A;  3QAQ A;  2NR2 A;  2BS2 B;  3UGB B;  4ZRP A;  3RZF A;  2LHD A;  3ZUN A;  2ZVO A;  1ZPS A;  2K3U A;  5I4D A;  3VRA B;  1C4A A;  4HKQ A;  4XDD A;  3B08 A;  5G2N A;  2V1Y A;  4WWN A;  4IKG A;  1F1H A;  2FCN A;  4M0W B;  4FA6 A;  2BB6 A;  1UBQ A;  2GRI A;  1V2Y A;  3A9J B;  2BQQ A;  4XYC A;  2N9K A;  3NVZ A;  1ROE A;  4XGA B;  2LJ5 A;  1E8Z A;  1C79 A;  3AEC B;  3DHG C;  1PGB A;  2NPT A;  3NG0 A;  3NUH B;  5CX3 A;  2UYZ B;  4G3X B;  1T0R C;  2JSV X;  2FUG 1;  2DHZ A;  5LNK 1;  3TL5 A;  1TJE A;  4ZRQ A;  3RMK C;  3NS8 A;  1LQB A;  4TQ0 A;  3P4P B;  4MM3 B;  2GBM A;  4N6E B;  4ZRJ A;  4ITK A;  2W3S A;  2SEB D;  1WXS A;  2J0M A;  3DDC B;  3KVF B;  4LNI A;  3SHQ A;  1V8C A;  3ZJV A;  5IOI A;  2AQ3 B;  5AEK B;  1WH3 A;  1TY2 A;  3BII D;  1L0Y B;  2BS4 B;  3H9D A;  2MJ3 A;  1F2R I;  3ZXV A;  3V6E B;  2PLP A;  3RYT A;  1HE8 A;  1T6B X;  3RNC C;  2PKO A;  2Z0E B;  2LGS A;  1WRD B;  4NAW B;  5KHO A;  3X0W A;  1UD7 A;  4MDK E;  3NZU A;  3AE3 B;  3LB8 C;  1P1A A;  3APD A;  1JQ4 A;  3UIN B;  1YN3 A;  1VZ7 A;  1RAX A;  2GBK A;  4TQ1 A;  2WXJ A;  2H88 B;  3MHS D;  3Q8E A;  4CO7 A;  2HJ1 A;  2LUM A;  3LJ3 A;  2ZNV C;  4DXF A;  2Q5W D;  1TY0 A;  3H1U A;  5IP4 D;  2KKC A;  3IHP C;  3VXW A;  2MHJ A;  1WGD A;  5BYS A;  2KYW A;  4AJY B;  1E8X A;  4LNN A;  5E6J A;  4AWJ A;  1OEY J;  4WWP A;  3ECI A;  1JWB D;  5TR5 A;  4JWU C;  1WSP A;  2AYO B;  1E8W A;  4KGT A;  4EKU A;  2XEW A;  2W55 A;  2KVR A;  3EEC A;  1LO5 D;  2B76 B;  2J4X A;  2KWU B;  3SFE B;  1BXT A;  4RNA A;  4FBJ B;  4WJO A;  3KWV A;  4TUU A;  1TS4 A;  1S1Q B;  4IWP A;  4XC2 A;  1D5X C;  2D11 A;  4NZL B;  2CHW A;  2N9L A;  2GLS A;  4IDI A;  1ZKH A;  3W2D A;  4FJV B;  3APF A;  3BVM A;  2MJE A;  4H2A A;  5CTR C;  4NAW A;  1BT0 A;  2NBV B;  4GB9 A;  4RCO A;  3N1Y C;  1WY8 A;  2Y3A A;  3Q3J A;  3FC4 A;  5H8Y E;  4WWM A;  2RDG A;  4W9E A;  2KTR B;  2FIF A;  4RGT A;  4WAF A;  1D5M C;  3URY A;  1ZGU B;  1NBF C;  4C4V A;  1AN8 A;  4M00 A;  3QA8 A;  1C78 A;  1LFD A;  3HHM A;  1XLP A;  3N1Z C;  1FEH A;  1JRU A;  1SJH D;  3N30 A;  5FKA C;  3AE4 B;  4ZRI A;  2IBI B;  2IZV B;  3Q3N C;  1B1Z A;  4W9I A;  3ZNZ B;  3IVF A;  5L95 C;  3GP7 A;  2KFJ A;  4RF0 A;  3FIL A;  1N62 A;  2JXT A;  1HXY D;  4G50 A;  1XXG A;  3AE6 B;  4C7Y A;  3P4S B;  1GPX A;  3N32 A;  5D6J B;  1V1P B;  4NPN A;  1WXV A;  1C1Y B;  3A1Q A;  4W9K A;  3A9K A;  3NVY A;  1SSN A;  4ZHP A;  2BW2 A;  4FN2 A;  3B9J A;  1E7P B;  4YXD B;  3AU4 A;  3ZNI D;  4KKI A;  1LM8 B;  4B95 A;  4A8X C;  1YX6 B;  2N7D A;  3ZIM A;  4W9C A;  4C80 A;  3RD2 A;  1FFU A;  3P4Q B;  5FK9 C;  4OZC A;  1V97 A;  2AX5 A;  1J7B A;  4BKT A;  3L08 A;  3EA6 A;  4DK5 A;  3T8M A;  2ZCC A;  1FCL A;  2KTR A;  1TZO A;  1XLQ A;  2K6D B;  1WYG A;  2LEK A;  2C7N B;  4N9F 4;  2CU1 A;  3AM9 A;  3AUL A;  1JML A;  5D3D A;  1JWS D;  4RGN A;  1WR1 A;  1AW7 A;  2IO3 B;  4K81 A;  1FXI A;  1BML C;  3AMZ A;  3NOB A;  3BYT B;  4X57 B;  5CHF A;  1SBB B;  1Y8R C;  3AV8 A;  4KIK B;  3B2F A;  2PEA A;  4FHJ A;  2ZW0 A;  3SDL C;  5DPT A;  1GOZ A;  5HKH A;  1YN4 A;  4KGS A;  2W9N A;  3QIJ A;  3PPA A;  1V1P A;  1E7V A;  3B2G A;  2M8S A;  1J19 A;  2R2O A;  4K7S A;  1JRO A;  3KUC B;  2MLB A;  3RNB C;  2D2Q A;  1UBI A;  4E71 A;  2KC1 A;  2V4I B;  2HDE A;  5E6N A;  5C3J B;  1J8C A;  4PS8 A;  4P1C C;  3ZW3 A;  2IJ0 A;  1ET6 A;  4LK0 M;  1YQB A;  4NJC A;  1L6U A;  3DBH B;  3DCG A;  1KFY B;  5DPS A;  4GDL A;  2BYT A;  3R8B A;  1DOI A;  2J0K A;  1XEE A;  2L76 A;  4F8C B;  1WZ3 A;  2BKF A;  1P7E A;  4N59 A;  2WX1 A;  3HRD D;  2O2V B;  2D3A A;  2KK8 A;  2GB1 A;  2WGS A;  4HVB A;  3I9V 1;  2IDY A;  3MJ5 A;  3TJP A;  4F7Z A;  1R4M B;  4AUQ C;  1L0V B;  1EM7 A;  1I4X A;  2KO3 A;  3RUL A;  2ASQ A;  4DXA B;  4BFR A;  1YJ1 A;  3HK0 A;  2KN4 A;  2PPH A;  4GGQ A;  3X23 A;  1SE9 A;  1GNU A;  4OHJ A;  2KT7 A;  3HVD A;  3IT6 B;  1FIQ A;  1UF0 A;  4S17 A;  3T9L A;  2VH2 A;  4AP4 C;  4B6W A;  3GZN B;  3E9S A;  2GOW A;  2XK5 B;  1FXT B;  2BT6 A;  2MP2 A;  3PTF C;  2K0P A;  2XNA C;  2JUO A;  2N9P C;  3AEG B;  5E6O A;  3T3N A;  3M3J A;  4B0E A;  1TKY A;  2LFI A;  3LDZ E;  4EZK A;  4YSZ B;  3M62 B;  2SAK A;  4HLE A;  1KLV A;  2D10 A;  1JCK B;  5JH5 C;  4LLG M;  1C3T A;  3ZDM C;  3H6N A;  3S2A A;  2DEN B;  1A70 A;  1BUI C;  2D3B A;  1EO6 A;  3PV1 A;  2NBW B;  2MH7 A;  3C8Y A;  3EUB 2;  2LVP A;  2DZI A;  3P1M A;  2AL6 A;  3VRB B;  2PVG C;  4A20 A;  2A5U A;  4KGR A;  1P7F A;  2O2V A;  1KM7 A;  2BGF A;  4CQN A;  2KMM A;  5EE9 A;  4J3O D;  2EEL A;  5AUK A;  2C60 A;  2DX5 B;  3OLM D;  3CSF A;  2KDI A;  2BWF A;  3DBL B;  3JW0 X;  2LVO A;  2WXI A;  4A3P A;  5EE3 A;  2D5G A;  1SE4 A;  2QC8 A;  2B3A A;  2YEP F;  4WAA A;  4OZB A;  2WNM A;  4WH4 A;  2AQ2 B;  4HPL B;  2W54 A;  1KF6 B;  2WLB A;  4JGH B;  2FCQ A;  5EDS A;  2J42 A;  1P0R A;  4WQM A;  1GC7 A;  2BYV E;  3L16 A;  1IPG A;  3N3K B;  1H4R A;  2JZP A;  2RDB C;  2XK5 A;  1IUE A;  1LXD A;  3R3M A;  1TIF A;  1TZ1 A;  3A33 B;  1WWT A;  2BWE S;  3BVZ A;  2NPT B;  4BAX A;  2L0T A;  3A4S C;  4OVZ A;  4NY0 A;  1TBE A;  1RRB A;  1QQR A;  1NYR A;  5DCN A;  1XCQ L;  4NQK E;  5C1Z A;  5IAA C;  3RI7 C;  3SEB A;  4GDK B;  1KJT A;  2KJH B;  4HEA 1;  1N5X A;  2IND C;  3A4R A;  5MPO A;  3R2I A;  4PT5 A;  3GE3 C;  3DBS A;  1HEZ E;  2D3C A;  1R7S A;  2KJR A;  5HFY A;  1G6J A;  3AI5 A;  1MG8 A;  4MT5 A;  2MJD A;  4LDT B;  1C4C A;  5D94 A;  3APC A;  2KAC A;  1PQS A;  2G3Q B;  3NRZ A;  1RM6 C;  4ACF A;  3UI3 A;  1UNS A;  2OJW A;  2JVC A;  3AEE B;  1TKG A;  3ML9 A;  2LAS A;  4HDO A;  4ANX A;  3ZLZ A;  3DBR I;  1JRP A;  4HKZ E;  5JHA A;  4WJQ A;  4XWW A;  3AE2 B;  3OAW A;  2K8H A;  1OQQ A;  1HQR D;  2C5L C;  4IC7 B;  1HA5 A;  1FCC C;  3Q2A C;  2K1F A;  2UU7 A;  4G11 A;  1P98 A;  2C7M B;  1L2N A;  1UGJ A;  2L52 A;  1QZE A;  5BO4 B;  2NVU I;  1S3S G;  4HDQ A;  1I4G A;  1FFV A;  1QOG A;  4PYZ A;  3ZRF A;  1ZUD 2;  2WDT B;  4MGZ E;  1T5X D;  1P3Q U;  2LGD A;  2K5P A;  1WX9 A;  4K7U A;  2WXO A;  4BBN F;  4P16 A;  4GDK A;  2HD5 B;  5BYQ A;  5DPR A;  2K22 A;  2LUE A;  5IN7 A;  4A90 A;  1UWX A;  4A55 A;  3N9Y C;  2JWZ A;  3AEF B;  4IW0 A;  3J9C A;  1C77 A;  3B0A A;  4PK1 A;  2KN5 A;  3DWG C;  4GIV A;  4JE3 B;  3AEB B;  2NS5 A;  2K8B A;  4QAY A;  4P7I A;  3NVW A;  2KTF A;  1Q0W B;  1WX8 A;  1TTN A;  1J7A A;  2C7H A;  2JQR B;  1E0Z A;  5CHW A;  2MBE A;  4LNF A;  3P2B A;  2CU3 A;  3IG3 A;  4NNJ B;  2G4S A;  3MHZ A;  3AH7 A;  3DVG Y;  2XN9 C;  4JPS A;  4ZOH C;  2IY1 B;  2OJR A;  4IOI E;  1PYW D;  1R4N B;  1E8Y A;  2IGG A;  4GMV A;  2J53 A;  2L05 A;  3AE5 B;  4JLC A;  2KMA A;  4ZDV A;  3H7P B;  2W3R A;  4B0M A;  1CQV A;  1N63 A;  2QMT A;  3L54 A;  1QOB A;  3I63 C;  1MHH E;  3V3X A;  3TEY A;  3PS6 A;  2IO1 B;  4C4V B;  3RPF C;  2DNF A;  2BB5 A;  5D3I B;  3HUI A;  4YT0 B;  4ZYN A;  2BPS A;  4LJO B;  3CWI A;  2MQJ A;  2WDR B;  2LVQ A;  4MJS A;  1N60 A;  2JWU A;  2MX2 A;  1JW9 D;  3KUD B;  3FIL B;  1TYG B;  4C56 C;  2KWD A;  2RMM A;  2QJL A;  4S0R A;  2MRP A;  3W5U B;  1X1M A;  1JWU D;  1FD6 A;  4RMA A;  4DDI D;  2ZW1 A;  1VZ6 A;  3A1Q B;  1WR6 E;  1HZ6 A;  3V61 A;  3A9K B;  1EUV B;  4HRS A;  1XO3 A;  4YSY B;  4O1N A;  2AL3 A;  3UQB A;  1MI0 A;  1NI3 A;  3R2T A;  1K52 A;  3PRE A;  3MTN B;  2YEP B;  3Q14 C;  3DVG X;  2INC C;  4FJZ A;  3DWM A;  2RDH A;  1U4A A;  2DAJ A;  1OQR A;  2PIA A;  1VR9 A;  2KLC A;  2Y5B B;  3H7P A;  2ONQ A;  3VH4 B;  2WXM A;  5BMH A;  3TBL D;  2Y5C A;  2YLM A;  4MSQ B;  2WXN A;  2G45 B;  2YVC A;  3C19 A;  3KW5 B;  2WU2 B;  2WWZ A;  3KQ4 A;  1KTK A;  3PLV A;  4LTU A;  1MG4 A;  2KAN A;  1NVI D;  4RGM A;  1OQY A;  3PT2 B;  1I4Q A;  2MSE D;  3AE7 B;  5IKC M;  1Y56 A;  3W9C B;  3IBE A;  4MEL A;  4EZL A;  1P9D U;  2KQ7 A;  2JXX A;  3D32 A;  5HI1 A;  2PTL A;  1ISN A;  5IA7 A;  2WS3 B;  4K7W A;  2ACZ B;  1YQ4 B;  2EMS A;  2LI5 A;  2UWQ A;  3W5V B;  1NYQ A;  3VDZ A;  3N1X C;  3JYU A;  3U7D A;  1MPE A;  1VCB A;  1PUT A;  3VVW B;  4FUL A;  1VDV A;  1SEB D;  2KC2 A;  3JSV A;  4XX5 A;  1OEY A;  1DOY A;  2NCN A;  2PE9 A;  1QLB B;  1V6E A;  3NVV A;  1KOT A;  2ZEQ A;  1L4D B;  2KDE B;  4US9 A;  4JX1 C;  4EEW A;  2FID A;  3K9P B;  1E90 A;  1RFK A;  1FRR A;  4NJ6 A;  1TT5 B;  5JXV A;  4A3O A;  3WAO A;  2ZNV B;  4GDL B;  1SE3 A;  2ZPN A;  1KLG D;  3VUW A;  4LNO A;  2J7Q B;  4ANV A;  1FNW A;  2L00 B;  2KZR A;  4I6L B;  3ZJT A;  3ZKJ C;  2N1V A;  3ZDT A;  1GUA B;  3QC8 B;  2I2Y A;  1VJK A;  4M8N A;  4GSW A;  2GBN A;  5AZG A;  3DVN V;  4W9H A;  3ETR A;  2ZPY A;  2I1K A;  2KHW B;  1Q10 A;  3LYY A;  1ZXH A;  1DYQ A;  3PZ7 A;  4WIP A;  3KYC D;  2N0S B;  2IPK D;  4IWO A;  1OGW A;  2QHO A;  3PRM B;  2HE7 A;  3GE8 C;  1WF9 A;  3M63 B;  4MGY E;  2LHE A;  1VLB A;  2MP2 B;  1KH0 A;  3PLU A;  2M4N A;  3BK1 A;  2FBW B;  4E3C A;  1N6Z A;  1SIJ A;  1YQ3 B;  4WQO B;  4GU2 A;  2RSU A;  1XD3 B;  4BKS A;  2PW9 A;  1GB4 A;  2MW5 A;  1EU3 A;  3Q8C A;  1SE2 A;  3DPD A;  3VR9 B;  2WXR A;  1J0G A;  2EKI A;  4KV2 A;  2J52 A;  4MGK E;  1A5R A;  4YL8 A;  1WGH A;  4C00 A;  3Q69 A;  4RM8 A;  1T0Q C;  1C76 A;  4JWS C;  1ZDV A;  2ZCB A;  3K9O B;  1EU4 A;  3R66 C;  2KX0 A;  2AWT A;  2FCS A;  3BZD B;  3V62 A;  1QIL A;  5G5G A;  4ASW C;  3EHV A;  4KX6 B;  4RFB A;  3QAR A;  4BOS C;  2OOB B;  2KDM A;  2O6V A;  1DGJ A;  1WXA A;  5AUI A;  1XQQ A;  1QKZ A;  2OHF A;  2D3G A;  1K8R B;  1CZP A;  3PRZ A;  4F1S A;  3P42 A;  4KDI C;  3AE9 B;  1GB1 A;  2LGY A;  2JU6 X;  5L83 A;  1SF0 A;  1MFW A;  3Q6B A;  4W9F A;  4XZ4 A;  2KMC A;  2JYT A;  3VR8 B;  4NAM A;  3RNG C;  2WDV B;  4XE0 A;  3BVG A;  3PO0 A;  2K8C A;  5BYR A;  4KSL C;  4DBG A;  1GAQ B;  2WXQ A;  2JZ3 B;  3UIP B;  4UDU C;  1YN5 A;  3ZQ4 A;  3NJT A;  1QOF A;  1AYF A;  2ZJD A;  3BY4 B;  2ZVN A;  1MJD A;  2V9H A;  3MJW A;  3QJZ A;  1ET9 A;  3TUO A;  2V3P A;  3P63 A;  4GOC A;  3ZGZ A;  3I57 A;  4MGI E;  3TEX A;  5J17 A;  3QX1 A;  1QOA A;  4AJW A;  1V5O A;  3TCA A;  1STE A;  1VRA B;  2H89 B;  3AED B;  4FJY A;  1WXM A;  1PDX A;  4HCN B;  1AAR A;  1YJI A;  5J2R A;  2CHZ A;  1IYF A;  2WHI A;  3PZ8 A;  1ZOY B;  4IM0 A;  1K53 A;  3Q8F A;  1KRH A;  4J6I A;  1NI2 A;  4G0N B;  3VTW A;  2KWC A;  1PGX A;  3U2S C;  1WJN A;  1WJ6 A;  1T3Q A;  4OVV A;  4W9J A;  3QQ8 B;  4DDG D;  3PSE B;  3U52 E;  3MC8 A;  1FM0 D;  4KVG B;  3CMM B;  2KLG A;  2HJ8 A;  4D2K A;  1FO4 A;  5LXI B;  4EFO A;  3MFG A;  2JT4 B;  2WYQ A;  2Y5P A;  2KWV B;  2DAF A;  1OFF A;  2N1W A;  4USA A;  4DHJ B;  1Z2M A;  2G4D B;  2LMC A;  2MA9 B;  4WWO A;  1N61 A;  4K3C A;  3SFD B;  2BF8 B;  1M4V A;  4OVU A;  2NBU A;  3GOE A;  5JZE B;  1NEK B;  3WAL A;  2DZM A;  1M94 A;  2DZK A;  3QCA A;  1V49 A;  2INN E;  3KWL A;  1NEN B;  1F0Z A;  1GJZ A;  4II2 B;  1RWS A;  4C7Z A;  4N58 A;  4BKG A;  5H92 C;  2QIL A;  1WM3 A;  2Z8L A;  4PS7 A;  2WXG A;  1V80 A;  3VTV A;  1E10 A;  3MC9 A;  1D5Z C;  5AZF A;  2ICI A;  4LJP B;  5DPW A;  4M8M A;  2REX A;  4FHK A;  4ARC A;  3DBH I;  2EMT A;  1C9F A;  1EF1 A;  3VH3 B;  2E3T A;  4KZ0 A;  4REZ A;  5J18 A;  2W82 A;  1Q5W B;  2M0X A;  1WFY A;  3E56 A;  4HRO A;  2NMQ A;  2LGI A;  3L0W B;  2AEH A;  4GXB A;  4YTM B;  1XCT L;  3M95 A;  4MH0 E;  4EE2 A;  3Q3M C;  2FAZ A;  1YX5 B;  1TS3 A;  2G9H D;  5D2M B;  3KYD D;  3EGR A;  2DZJ A;  4HPM B;  1IP9 A;  3ZJU A;  2R2Q A;  2L0F A;  4BVU C;  1GC6 A;  3NZS A;  2LJI A;  1R4M I;  3DHH C;  1JWM D;  2RPQ A;  1F9J A;  2M56 B;  4I6N B;  3WAP A;  1WM2 A;  2IYD B;  1WMH B;  3H7S A;  1V1O A;  4R3D A;  2RGF A;  2KJ6 A;  2KD0 A;  2FNJ B;  3UF8 A;  3GB1 A;  2IGH A;  5AZH A;  4Q2J A;  1FXA A;  2E6X A;  3WIM A;  3PRP B;  3GZN I;  4TMA B;  4MJS B;  4YTP B;  3RCZ A;  4TKN A;  2LXA A;  1YJJ A;  2L7R A;  4TSS A;  4JIO U;  4RM9 A;  1RYJ A;  4JQW C;  2N7E A;  5FR6 A;  4US8 A;  3Q8B A;  4ZYS A;  3U8Z A;  1PGA A;  3Q3O C;  4BZA A;  3B1L X;  2GMI C;  3AXC A;  5C23 A;  2A4Z A;  3Q8A A;  2NTS A;  1V81 A;  4WJP A;  2WXH A;  3KUZ A;  1SGH A;  3WAM A;  1J7C A;  4P1B C;  2VZK B;  3VQI A;  4HXD A;  1D6E C;  1JAL A;  2KFK A;  1UH6 A;  2FE8 A;  3KLS X;  3C0R B;  3L17 A;  3OWE B;  2JZZ A;  1L0X B;  1DOX A;  3ALB A;  5EE0 A;  3DOW A;  2IO2 B;  3EFU A;  4RH6 A;  1V86 A;  2QSD A;  3VHT C;  3DBL I;  1YD8 U;  2QCZ A;  1L5P A;  1WMH A;  2JRH A;  1XLN A;  2BYF A;  1F52 A;  2JRI B;  1K51 A;  4DHZ E;  2GBJ A;  2CHX A;  3ZRC A;  1HTQ A;  4M0W A;  4RGO S;  2N4F A;  1QT9 A;  3A9J A;  3OJ4 B;  3IAM 1;  2V0G A;  4DHJ D;  4HWI B;  1ESF A;  4CYE A;  3OG5 A;  3JVZ X;  4W9G A;  1EWC A;  1XLO A;  2V3N A;  3VUY A;  2FCM A;  2M17 A;  3PHX B;  4GLS C;  1TKE A;  2BKR B;  5JHB A;  4OZA A;  1WZ0 A;  2ZZP B;  3V60 A;  3JSV B;  3W1Y A;  4MM3 A;  2IO0 B;  2I38 A;  3RZW C;  2K25 A;  1L6V A;  2CKH B;  3NHE B;  4IWQ A;  1WE7 A;  3V05 A;  3SD5 A;  5LXH A;  4NJ7 A;  4B9K A;  3PGE A;  4LDT D;  4L1B A;  2FUH B;  3P4R B;  3QHT A;  2WU5 B;  4AQ7 A;  5T8I A;  3KH0 A;  2JYE A;  1B9R A;  3RT3 B;  1WIA A;  2LZ6 A;  3VFK A;  1GG3 A;  4BBN C;  1N5W A;  2TSS A;  3NY5 A;  1E6E B;  3NZ3 A;  4M02 A;  3ZVV A;  1YNT E;  2NTT A;  2MBQ A;  1L7Y A;  2DYB A;  2MBO A;  2K6Q A;  3R7R A;  1QF6 A;  1IGC A;  1WJ4 A;  2I1J A;  3CF6 E;  1HTO A;  2G1E A;  2LWP A;  1SXT A;  4K1R B;  2VH1 A;  4XDC A;  1CK1 A;  4WUR A;  2PVO D;  2WXK A;  2PMV A;  3AN1 A;  2KDF B;  4PS3 A;  4DQO C;  1XT9 B;  4ZRK A;  2GI9 A;  1I35 A;  4A9A A;  2PE6 B;  4KKJ A;  1NDD A;  3Q3F A;  4IG7 B;  2KQ4 X;  1H8C A;  5GMV A;  2N7J A;  3SR6 A;  5BMG A;  1I42 A;  1EWY C;  2KNB A;  3TIX A;  2CR5 A;  1WGG A;  2CS4 A;  1YOV B;  4FLH A;  3R7Q A;  1E7U A;  2DLB A;  1TS5 A;  2WXF A;  2HTH A;  1OTR B;  1YIW A;  1ZE3 D;  1I7H A;  3QK0 A;  3RNE C;  5D7G A;  2IGD A;  5LLI A;  1IBX B;  3DQV A;  2Z0D B;  3BYY B;  1UGM A;  2RD0 A;  2MBH A;  2LXC A;  2VZK D;  5FR3 A;  4URK A;  2WX0 A;  3EFC A;  5HG2 A;  2L8J A;  4HCP B;  3L13 A;  4HK2 A;  1L4Z B;  2K39 A;  3L4P A;  2L1A A;  3AE1 B;  1MVK A;  1Z5S B;  1UEL A;  2L83 A;  3RNA C;  4W9D A;  5TSS A;  1HZ5 A;  2O6V B;  1R4N I;  2L3Z A;  3H8H A;  4P6V F;  3QWZ B;  1WGY A;  2M1M A;  1FMA D;  4ICU A;  3WCQ A;  4CHK A;  1WJU A;  2AQ1 B;  2DYM A;  3ZNG C;  4FXC A;  3IT4 B;  1ACC A;  1ENF A;  1I4H A;  2ON8 A;  2BVC A;  3EC8 A;  4L2Y A;  1TS2 A;  2LRU A;  3WA0 A;  3MP9 A;  3HVZ A;  2V3S A;  3FKY A;  3AU5 A;  3AEA B;  2X38 A;  3I3T B;  1WE6 A;  2L32 A;  3NS1 A;  1TGZ B;  1YMH E;  4EOY A;  2VRR B;  3W1S C;  1WGK A;  4NQL B;  2KXJ A;  4HJK A;  4KZC A;  4LNK A;  2IY0 B;  2WQY B;  4PYU A;  3RFZ B;  3OJ3 A;  1F2R C;  2JY6 A;  2PJH A;  3VAW A;  3IAS 1;  1IBX A;  3HM3 A;  2MBB B;  4BOZ B;  1CJE A;  1E9M A;  4OW0 A;  1UZX B;  4W9L A;  2CJO A;  2J0J A;  2JX5 A;  4EZJ A;  2LGX A;  3TMP B;  2LRW A; 
#chains in the Genus database with same CATH homology
 2MBE A;  3N30 A;  4ZRI A;  2IBI B;  3P2B A;  2IZV B;  3DVN U;  1E5W A;  3IG3 A;  4NNJ B;  2G4D B;  4W9I A;  3ZNZ B;  2MA9 B;  3IVF A;  4TV3 A;  2G4S A;  4WWO A;  4II3 B;  5L95 C;  2JF5 A;  3DVG Y;  2BF8 B;  4IM2 A;  2KFJ A;  4OVU A;  2NBU A;  3GOE A;  5JZE B;  1V5T A;  3WAL A;  2DZM A;  1M94 A;  2DZK A;  2IY1 B;  2OJR A;  3QCA A;  4G50 A;  1E8Y A;  1V49 A;  4GMV A;  3N32 A;  2L05 A;  4JLC A;  5D6J B;  2KMA A;  4ZDV A;  1EF5 A;  4NPN A;  1GJZ A;  1WXV A;  3H7P B;  4II2 B;  1C1Y B;  1Q1O A;  4KDL B;  4EUT A;  3A1Q A;  4W9K A;  3L54 A;  4BKG A;  3A9K A;  1WM3 A;  4PS7 A;  1V80 A;  3HM6 X;  1WYW B;  4GN1 A;  3VTV A;  4FN2 A;  5AZF A;  3U30 A;  3PS6 A;  2IO1 B;  4LJP B;  4M8M A;  5DPW A;  3AU4 A;  2REX A;  3ZNI D;  4FHK A;  2GBR A;  3DBH I;  2EMT A;  1LM8 B;  5E6P A;  4B95 A;  1EF1 A;  3VH3 B;  3ONS A;  5J18 A;  4KZ0 A;  4KIK A;  3ZTC A;  1Q5W B;  3VTU A;  2M0X A;  3HIZ A;  1WFY A;  1YX6 B;  2KDB A;  2N7D A;  3ZIM A;  4WJN A;  4W9C A;  2DYO A;  3L0W B;  2AEH A;  4GXB A;  4ZYN A;  3RD2 A;  2BPS A;  3M95 A;  4LJO B;  3V6C B;  4MH0 E;  2MQJ A;  2LVQ A;  4MJS A;  3ZTD A;  3ZNH B;  2D07 B;  3PHW B;  3WAN A;  2FAZ A;  4BKT A;  1YX5 B;  3L08 A;  5D2M B;  3KYD D;  2MX2 A;  1T0Y A;  2DZJ A;  4HPM B;  3T8M A;  4DK5 A;  3KUD B;  2ZCC A;  1IP9 A;  2R2Q A;  2L0F A;  4BKS D;  3RUI B;  2KTR A;  4BVU C;  4ANW A;  4MEM A;  1GC6 A;  2MRP A;  3NZS A;  1X1M A;  4E74 A;  1R4M I;  2K6D B;  4RMA A;  4DDI D;  2C7N B;  4N9F 4;  2RPQ A;  1F9J A;  4I6N B;  1VD2 A;  3VUX A;  3WAP A;  1WM2 A;  2CU1 A;  2IYD B;  3A1Q B;  4KSK C;  2Z59 B;  1WR6 E;  1WMH B;  2BYE A;  3V61 A;  1WX7 A;  1EUV B;  3A9K B;  4FAD A;  3H7S A;  3AUL A;  4ANU A;  4JL9 A;  1WR1 A;  2IO3 B;  2RGF A;  4K81 A;  2KJ6 A;  2KD0 A;  2AL3 A;  3UQB A;  3NOB A;  2C9W B;  2FNJ B;  3IFW B;  3PRE A;  3BIN A;  4X57 B;  3UF8 A;  5CHF A;  4KIK B;  1Y8R C;  3MTN B;  5AZH A;  2LD9 A;  2PEA A;  4FHJ A;  3DVG X;  5CHV C;  5KHQ A;  3WIM A;  3PRP B;  3SDL C;  4AOF A;  3ENE A;  3GZN I;  5DPT A;  4FJZ A;  3ML8 A;  4MJS B;  5HKH A;  3RCZ A;  4TKN A;  1U4A A;  2LXA A;  1WGR A;  4IUM B;  2DAJ A;  3SU8 X;  2W9N A;  3QIJ A;  2L7R A;  3PPA A;  4JIO U;  2KLC A;  4RM9 A;  1E7V A;  2Y5B B;  4JQW C;  3H7P A;  2N7E A;  2M8S A;  1J19 A;  2O6V D;  2R2O A;  4K7S A;  5FR6 A;  3VH4 B;  2XBB C;  3TBL D;  3KUC B;  2YLM A;  2MCN B;  2MWS B;  4MSQ B;  2MLB A;  2YVC A;  2G45 B;  3KW5 B;  4DWF A;  2WWZ A;  3PLV A;  3U8Z A;  3PZD A;  2D2Q A;  3ZO5 B;  1UBI A;  2KOX A;  4E71 A;  2KC1 A;  3B1L X;  2GMI C;  2KAN A;  5E6N A;  1J8C A;  4PS8 A;  1OQY A;  3PT2 B;  3AXC A;  5C23 A;  2A4Z A;  3UIO B;  2MSE D;  3ZW3 A;  2KQS A;  1V81 A;  1YQB A;  4WJP A;  2N9X A;  3O65 B;  3KUZ A;  3IBE A;  3DCG A;  4MEL A;  1SGH A;  4EZL A;  1P9D U;  3WAM A;  5DPS A;  2EKE C;  2KQ7 A;  2JXX A;  3D32 A;  4GDL A;  4MSM B;  1D3Z A;  3VQI A;  4HXD A;  2J0K A;  1ISN A;  2KFK A;  5G55 A;  1UH6 A;  4F8C B;  2L76 A;  3C0R B;  1WZ3 A;  5IA7 A;  2BKF A;  3L17 A;  2JZZ A;  4K7W A;  2N9E B;  1SIF A;  3ALB A;  2WX1 A;  2EMS A;  3DOW A;  2LI5 A;  2UWQ A;  4I6P A;  3VDZ A;  2IO2 B;  3EFU A;  2O2V B;  3JYU A;  4DHZ B;  2KK8 A;  3U7D A;  4HVB A;  1ZW7 A;  3TJP A;  1V86 A;  1VCB A;  3VVW B;  3PVL A;  4FUL A;  3VHT C;  3DBL I;  1YD8 U;  2KC2 A;  4F7Z A;  3JSV A;  1WMH A;  4XX5 A;  1OEY A;  2JRH A;  1V9J A;  4AUQ C;  2NCN A;  2PE9 A;  1RFA A;  2KX3 A;  2KO3 A;  2BYF A;  1V6E A;  1WI0 A;  3RUL A;  2JRI B;  2ASQ A;  2ZEQ A;  4ICV A;  1KOT A;  2KDE B;  4DHZ E;  2GBJ A;  2CHX A;  3ZRC A;  4BFR A;  4DXA B;  1YJ1 A;  3HK0 A;  2FID A;  3K9P B;  4EEW A;  2N4F A;  2PPH A;  1E90 A;  1CMX B;  4GGQ A;  3X23 A;  1SE9 A;  1GNU A;  3A9J A;  3OJ4 B;  2JPH A;  4NJ6 A;  4A3O A;  4LCD E;  3WAO A;  2ZNV B;  4GDL B;  4DHJ D;  4HWI B;  3T9L A;  4CYE A;  3W1S A;  2KFK B;  4AP4 C;  2ZPN A;  4B6W A;  3JVZ X;  4IM3 A;  3L10 B;  4W9G A;  2GOW A;  3VUW A;  2J7Q B;  2XK5 B;  3VUY A;  4ANV A;  1FXT B;  2FCM A;  2MP2 A;  3PTF C;  2L00 B;  2KZR A;  3UQA A;  2JUO A;  4I6L B;  2N9P C;  2M17 A;  2RR9 A;  3CST A;  3ZKJ C;  2V4L A;  5E6O A;  2N1V A;  3PHX B;  1RLF A;  1GUA B;  3M3J A;  3QC8 B;  3ZDT A;  3QAQ A;  2NR2 A;  2BKR B;  3UGB B;  5JHB A;  3RZF A;  3LDZ E;  4M8N A;  4EZK A;  1WZ0 A;  2ZZP B;  4GSW A;  2GBN A;  3ZUN A;  2ZVO A;  3V60 A;  3JSV B;  5AZG A;  3W1Y A;  3DVN V;  3M62 B;  4MM3 A;  2IO0 B;  3RZW C;  4W9H A;  4HLE A;  2ZPY A;  2I1K A;  2KHW B;  2D10 A;  1KLV A;  5JH5 C;  2K25 A;  3B08 A;  5G2N A;  2CKH B;  1C3T A;  3NHE B;  3ZDM C;  2V1Y A;  3H6N A;  4WWN A;  4IWQ A;  1WE7 A;  5LXH A;  3SD5 A;  3S2A A;  2FCN A;  4M0W B;  4FA6 A;  4NJ7 A;  2DEN B;  1UBQ A;  4B9K A;  3PGE A;  4LDT D;  1EO6 A;  1V2Y A;  2FUH B;  3KYC D;  2NBW B;  3A9J B;  3PV1 A;  2LVP A;  3QHT A;  2DZI A;  4IWO A;  1OGW A;  2LJ5 A;  2AL6 A;  2QHO A;  3KH0 A;  3PRM B;  1E8Z A;  4A20 A;  2A5U A;  2HE7 A;  1WF9 A;  2O2V A;  3M63 B;  4MGY E;  1KM7 A;  3RT3 B;  1WIA A;  2BGF A;  2LZ6 A;  1GG3 A;  3VFK A;  4BBN C;  2NPT A;  2MP2 B;  5CX3 A;  2UYZ B;  3NY5 A;  3PLU A;  4G3X B;  2M4N A;  2C60 A;  2DX5 B;  3OLM D;  4E3C A;  3CSF A;  2DHZ A;  2BWF A;  2KDI A;  3ZVV A;  3TL5 A;  2MBQ A;  3JW0 X;  1L7Y A;  2DYB A;  2MBO A;  4WQO B;  2LVO A;  3NS8 A;  2K6Q A;  3R7R A;  4GU2 A;  1LQB A;  2RSU A;  1XD3 B;  4A3P A;  1WJ4 A;  2I1J A;  4BKS A;  4TQ0 A;  3CF6 E;  2MW5 A;  2GBM A;  2LWP A;  2B3A A;  4K1R B;  3DPD A;  4WAA A;  4ZRJ A;  1J0G A;  4HPL B;  1WXS A;  4JGH B;  2J0M A;  3DDC B;  4KV2 A;  2FCQ A;  5EDS A;  3KVF B;  4PS3 A;  2KDF B;  4MGK E;  3SHQ A;  1XT9 B;  1P0R A;  1A5R A;  4YL8 A;  4ZRK A;  1GC7 A;  2BYV E;  1WGH A;  3L16 A;  1IPG A;  1I35 A;  3N3K B;  1H4R A;  2XK5 A;  5AEK B;  2PE6 B;  1NDD A;  1WH3 A;  3Q3F A;  4RM8 A;  4IG7 B;  1LXD A;  3R3M A;  2ZCB A;  3K9O B;  3R66 C;  5GMV A;  1TZ1 A;  1H8C A;  3A33 B;  2BWE S;  2KX0 A;  2NPT B;  3H9D A;  1I42 A;  2L0T A;  3A4S C;  3V6E B;  2AWT A;  2FCS A;  3V62 A;  4ASW C;  2KNB A;  3EHV A;  4NY0 A;  3RYT A;  1HE8 A;  1TBE A;  1RRB A;  3QAR A;  3TIX A;  2CR5 A;  4BOS C;  1WGG A;  5DCN A;  2CS4 A;  4NQK E;  5C1Z A;  2Z0E B;  2OOB B;  5IAA C;  4FLH A;  2O6V A;  3R7Q A;  1E7U A;  1WXA A;  1WRD B;  2HTH A;  1OTR B;  4GDK B;  4NAW B;  1XQQ A;  1YIW A;  2D3G A;  5KHO A;  1K8R B;  3X0W A;  3TMP B;  1KJT A;  1UD7 A;  3PRZ A;  4F1S A;  4MDK E;  2KJH B;  3QK0 A;  4KDI C;  3NZU A;  2LGY A;  3A4R A;  5D7G A;  5LLI A;  5L83 A;  1P1A A;  3DBS A;  3APD A;  3DQV A;  3UIN B;  4W9F A;  4XZ4 A;  2KMC A;  2Z0D B;  1UGM A;  2KJR A;  1RAX A;  2RD0 A;  2MBH A;  1G6J A;  2LXC A;  2GBK A;  3AI5 A;  4TQ1 A;  1MG8 A;  4URK A;  3MHS D;  2WX0 A;  4CO7 A;  4LDT B;  2K8C A;  5D94 A;  3APC A;  1PQS A;  2G3Q B;  2L8J A;  4KSL C;  4DBG A;  4HCP B;  3LJ3 A;  2ZNV C;  3L13 A;  4HK2 A;  2K39 A;  3H1U A;  2JZ3 B;  3UIP B;  2KKC A;  3IHP C;  2JVC A;  1Z5S B;  1UEL A;  3VXW A;  4W9D A;  1WGD A;  3ML9 A;  2ZJD A;  3BY4 B;  2LAS A;  4AJY B;  2ZVN A;  1E8X A;  2O6V B;  4HDO A;  1R4N I;  4AWJ A;  1OEY J;  3ZLZ A;  4ANX A;  3DBR I;  2L3Z A;  4WWP A;  3ECI A;  3MJW A;  5TR5 A;  3QWZ B;  5JHA A;  3QJZ A;  4WJQ A;  1WGY A;  2AYO B;  3OAW A;  1E8W A;  2K8H A;  2M1M A;  4ICU A;  4CHK A;  4EKU A;  2XEW A;  2C5L C;  4GOC A;  4IC7 B;  1WJU A;  2KVR A;  3EEC A;  2DYM A;  3ZNG C;  4MGI E;  5J17 A;  2KWU B;  3QX1 A;  2K1F A;  3EC8 A;  4G11 A;  4FBJ B;  4AJW A;  4WJO A;  1P98 A;  1V5O A;  2C7M B;  2LRU A;  4TUU A;  3TCA A;  1L2N A;  4FJY A;  3WA0 A;  1WXM A;  4HCN B;  1QZE A;  1S1Q B;  4IWP A;  4XC2 A;  5BO4 B;  1AAR A;  2V3S A;  5J2R A;  2D11 A;  2NVU I;  3AU5 A;  2CHZ A;  1S3S G;  2CHW A;  1IYF A;  4HDQ A;  3I3T B;  4PYZ A;  1WE6 A;  3ZRF A;  2WDT B;  4MGZ E;  1ZKH A;  4IM0 A;  1TGZ B;  1P3Q U;  2LGD A;  4EOY A;  4FJV B;  1WX9 A;  2VRR B;  3APF A;  3W1S C;  4J6I A;  4NQL B;  5CTR C;  4K7U A;  2KXJ A;  1NI2 A;  4HJK A;  4BBN F;  4KZC A;  4GDK A;  4NAW A;  2HD5 B;  4G0N B;  1BT0 A;  2IY0 B;  2NBV B;  4GB9 A;  3VTW A;  2KWC A;  4PYU A;  5DPR A;  2LUE A;  1WJN A;  3OJ3 A;  1WJ6 A;  4OVV A;  2JY6 A;  4W9J A;  2JWZ A;  2PJH A;  3VAW A;  1WY8 A;  3HM3 A;  2MBB B;  3Q3J A;  3QQ8 B;  4IW0 A;  4BOZ B;  4DDG D;  3PSE B;  4W9E A;  2KTR B;  4KVG B;  3B0A A;  3CMM B;  2FIF A;  2KN5 A;  2KLG A;  4GIV A;  2HJ8 A;  1UZX B;  5LXI B;  2NS5 A;  2K8B A;  4W9L A;  4P7I A;  4EFO A;  1ZGU B;  2J0J A;  1NBF C;  2KTF A;  1Q0W B;  1WX8 A;  2JT4 B;  2WYQ A;  2KWV B;  2DAF A;  1TTN A;  2N1W A;  3QA8 A;  4EZJ A;  1LFD A;  3HHM A;  2C7H A;  2LGX A;  1JRU A;  5CHW A;  4DHJ B;  1Z2M A;  2LRW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...