4WJPA

Crystal structure of sumo1 in complex with phosphorylated daxx
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
79
structure length
79
Chain Sequence
GEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYAQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of the Phosphorylation-Dependent Interaction between PML and SUMO1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/signaling protein
molecule keywords Small ubiquitin-related modifier 1
total genus 23
structure length 79
sequence length 79
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4wjpA00
3K9OB 4II2B 3VDZA 4MM3A 3W1SC 4NY0A 1E7UA 1ZW7A 3V60A 1KLVA 1E90A 1UZXB 3RUIB 3EHVA 3T8MA 3ZNGC 4DXAB 3ZUNA 1GG3A 4WJOA 3SDLC 2RPQA 4ZDVA 1LXDA 2MBOA 3L16A 4M8MA 3W1SA 3UIPB 4LJOB 2KK8A 4E71A 2DZIA 1Z5SB 2R2OA 2WX1A 3NZSA 4GGQA 2EKEC 1KOTA 2MW5A 4KZCA 3MJWA 3L54A 5DPRA 1J8CA 2DYOA 4HDOA 3ZDTA 2K25A 3R3MA 2MWSB 1SE9A 1WJUA 4AJWA 4LCDE 3U8ZA 3NZUA 1WXSA 3BINA 5EDSA 1WJ4A 5D94A 3VTVA 2Y5BB 3U30A 2C9WB 1TBEA 4WAAA 1Y8RC 1YJ1A 3H7SA 3GZNI 1WGHA 5C23A 3PSEB 2L0FA 1M94A 1NDDA 1I35A 3DVGY 2KMCA 2KN5A 3H6NA 2FCMA 1WRDB 1P9DU 3A4RA 4WQOB 2LRWA 1S1QB 5CX3A 2DYMA 2DAJA 2MRPA 4RM9A 1WE7A 4IUMB 2UYZB 1TTNA 3DVNV 3UQAA 4W9HA 4FHKA 1L2NA 4A20A 4II3B 4MJSA 2M1MA 3OAWA 3CSFA 2BYFA 2DYBA 2R2QA 4G0NB 2UWQA 3RD2A 3A4SC 3SU8X 4HVBA 1WJ6A 1YIWA 1WZ0A 2KWUB 2AL3A 4K7WA 4KV2A 3ZW3A 4N9F4 2Z0DB 3DVGX 4GN1A 2AL6A 2HD5B 1WM2A 4GIVA 1WJNA 4OVVA 3M63B 3UF8A 4GMVA 3ML9A 3WA0A 1IYFA 3DBLI 2CHXA 2K8HA 4X57B 3A1QA 2MBHA 1XQQA 1H4RA 2JF5A 4DHJB 3IFWB 4DHZE 1YQBA 1RAXA 4B6WA 4FJVB 2KVRA 1Q0WB 2C5LC 2LGXA 2Z0EB 3VTUA 3VHTC 2LVQA 2KWCA 4JLCA 3RCZA 4K81A 3CSTA 1JRUA 2CR5A 4G3XB 2A4ZA 3KUCB 4K1RB 4CO7A 5DPWA 3PS6A 3AU5A 1S3SG 3ZO5B 4NJ6A 4WJQA 1V49A 2KTRB 5DCNA 2FCQA 2GBKA 3PPAA 5DPTA 1WE6A 2BWES 1OGWA 2C60A 3X23A 2KLCA 2MSED 4LDTD 4E3CA 5CHFA 4AP4C 2KTFA 3ENEA 2DAFA 3RZWC 3V61A 2YLMA 1LM8B 5IAAC 5AZGA 3VUXA 4GDLA 4I6PA 3LJ3A 1VD2A 5GMVA 1RLFA 2KDEB 3M62B 2WWZA 2KFKB 1P1AA 3U7DA 3ECIA 1PQSA 4KIKA 2K1FA 1F9JA 3PV1A 4B95A 2FIDA 4BFRA 2O2VA 3ONSA 3PLUA 1NI2A 2D2QA 2JWZA 3A9KB 3QK0A 3VUYA 4KDIC 3UINB 2XEWA 1I42A 5G55A 2V3SA 2IBIB 3L17A 3QWZB 2I1KA 3WAMA 4MDKE 4GDKB 2LD9A 1ZGUB 2DZMA 2BGFA 5CHWA 2IY0B 4K7SA 3QQ8B 4RMAA 3QHTA 3V6EB 2I1JA 4NAWB 1V5TA 2LGDA 3MTNB 2J7QB 2KWVB 3R66C 4PYZA 2KMAA 2KQ7A 4ANWA 4LDTB 4HLEA 3ZRCA 4WWOA 3IHPC 1OEYA 4MEMA 2DX5B 1WFYA 4ICVA 4XZ4A 1UBIA 5JHBA 4GXBA 2V1YA 2KO3A 3ML8A 3QA8A 4KVGB 2AYOB 4BKSD 1X1MA 3DDCB 4A3OA 2Z59B 2RD0A 4BKSA 5JZEB 3PGEA 3D32A 4ANVA 2N7EA 2MX2A 3Q3JA 1P0RA 2NPTA 5E6NA 4EKUA 2KX0A 2LUEA 5TR5A 4FHJA 1V81A 2ZNVB 3ZIMA 1WX7A 3KW5B 2ZPYA 2KKCA 3NOBA 3ZNID 2L7RA 2N1VA 1OQYA 1YD8U 2JY6A 5IA7A 2L3ZA 2IO0B 3DVNU 3NHEB 3JW0X 1V5OA 4JGHB 4IW0A 2K6DB 4FLHA 3ZNZB 1R4NI 3B1LX 1WH3A 2JT4B 4ICUA 1OTRB 1C1YB 3DCGA 2RGFA 3WAOA 4MELA 3UQBA 4W9CA 4FN2A 4BOZB 4F1SA 2ZEQA 2KANA 4DHJD 4LJPB 3DBSA 2KDIA 2KC1A 3C0RB 4KSLC 2NS5A 1P3QU 2IO1B 3TIXA 4HJKA 2ZZPB 4TKNA 1XT9B 4XX5A 3JSVA 4DHZB 3JSVB 2LWPA 3A9JB 3PT2B 3H1UA 4G50A 2WX0A 2IY1B 3ZLZA 3PREA 2KTRA 4F8CB 2LVOA 1MG8A 2MBBB 4HCNB 5D2MB 3EFUA 2XK5B 3KVFB 1UBQA 2PE9A 1R4MI 3HM6X 1UELA 4MGKE 3KYDD 4W9IA 4W9GA 5LXHA 2J0JA 1HE8A 4WWNA 3JVZX 1ZKHA 3QAQA 3QX1A 2IO3B 4EZLA 2KFJA 3N32A 4JL9A 4E74A 5L95C 4DK5A 2OJRA 2O2VB 1E8ZA 4ASWC 1CMXB 2DZJA 2YVCA 2EMTA 4PS3A 3WALA 5AZFA 4EZKA 3PRPB 4GSWA 3UGBB 2MA9B 4HWIB 3R7QA 1AARA 3A9KA 2KJ6A 2GBRA 3N3KB 2MCNB 5C1ZA 3KUZA 3H9DA 4M0WB 1H8CA 4J6IA 4MJSB 2L0TA 4IWOA 4I6NB 2K8CA 3DOWA 2NCNA 3HK0A 2PJHA 3ZRFA 1WR1A 3QJZA 4W9LA 3ZTDA 1FXTB 4GOCA 2ZVNA 4GDKA 1E8XA 2O6VA 3ALBA 3OJ4B 1WIAA 3DBHI 1V86A 4IM0A 4FULA 4IG7B 3AULA 2ZNVC 3RT3B 2WYQA 2BF8B 3H7PA 3QC8B 1TGZB 3A1QB 4M8NA 2ASQA 5FR6A 5BO4B 1WY8A 2BWFA 1XD3B 3M3JA 4W9JA 2KOXA 3L0WB 2KDBA 1WF9A 1GC7A 2PPHA 1WMHB 3KYCD 4DWFA 3VTWA 4MH0E 4P7IA 2J0MA 2MP2A 2GOWA 2IO2B 2NPTB 3BY4B 1V6EA 3I3TB 3AXCA 2MP2B 4WJPA 1G6JA 2K8BA 2W9NA 3IBEA 2KC2A 3MHSD 1D3ZA 2HJ8A 4FA6A 1WXAA 3GOEA 3VAWA 4IM2A 3PHXB 2CHWA 3M95A 2BKFA 3ZVVA 1EO6A 1GJZA 3OJ3A 4IC7B 2BKRB 3PTFC 3ZTCA 1IPGA 5DPSA 2LXAA 1WGDA 1V80A 2AEHA 2LZ6A 3TMPB 1EF5A 3APFA 2KFKA 1E5WA 2G3QB 2LGYA 4ZRJA 2FCSA 4ANXA 2D10A 3AU4A 4AJYB 4GDLB 3VUWA 3ZNHB 4KZ0A 3V62A 3HIZA 2HE7A 1GUAB 2MBEA 2EMSA 2V4LA 2WDTB 2KJHB 3DQVA 3LDZE 4KSKC 2LXCA 5J17A 4B9KA 3PZDA 1WGYA 1J19A 3HHMA 4AWJA 3NY5A 4CHKA 1Q5WB 2KZRA 4NPNA 3VQIA 2N7DA 3O65B 4MSMB 3X0WA 2KNBA 5AEKB 1SIFA 3QIJA 4NAWA 2IYDB 1WXVA 3KUDB 3DBRI 4EEWA 1VCBA 1UH6A 2ZPNA 5LLIA 1E7VA 3HM3A 3TCAA 2DZKA 3TBLD 3PLVA 2L00B 4W9KA 2NVUI 4ZRIA 4MGIE 2XK5A 3Q3FA 4BKGA 3H7PB 4TV3A 3WAPA 3NS8A 4FJZA 2O6VD 2NR2A 2JXXA 2BYVE 1EUVB 4IM3A 2A5UA 3JYUA 3QCAA 3VVWB 2LI5A 2M8SA 5CHVC 3RYTA 1Q1OA 1WZ3A 3SD5A 2JZ3B 3W1YA 4DDID 1GNUA 1P98A 3CMMB 2KDFB 3P2BA 2LASA 3A33B 3DPDA 3PRMB 4EUTA 5LXIB 2MQJA 2DENB 4K7UA 4WJNA 5J18A 2VRRB 2RSUA 2JUOA 4RM8A 4W9FA 1OEYJ 4BBNF 1A5RA 4CYEA 2PE6B 4TQ1A 1BT0A 5E6PA 2AWTA 5D7GA 2C7NB 5J2RA 2N9EB 2KX3A 3KH0A 3SHQA 1K8RB 3K9PB 4BKTA 2CKHB 4DDGD 2XBBC 5L83A 2C7MB 1EF1A 5JHAA 2JRIB 3OLMD 4BBNC 2O6VB 1UGMA 1J0GA 1WGRA 1IP9A 1YX5B 3EC8A 4A3PA 3RULA 3VH3B 2OOBB 4F7ZA 5JH5C 4W9EA 4IWPA 1ISNA 2L76A 1UD7A 2M4NA 4DBGA 1NBFC 2GMIC 2KQSA 1TZ1A 1WMHA 3S2AA 4EOYA 2M0XA 4JQWC 4NQLB 2KD0A 1WGGA 4PYUA 3VFKA 2LRUA 4HXDA 4ANUA 1YX6B 4NQKE 1WI0A 4URKA 2NBUA 1WR6E 2JVCA 2NBWB 2L05A 2L8JA 3PRZA 4JIOU 4PS8A 2K6QA 2D07B 3A9JA 3WANA 1LQBA 4TQ0A 4HPLB 2FUHB 2MLBA 2DHZA 3VH4B 3QARA 2GBMA 4HK2A 4AUQC 4HCPB 4FADA 2FNJB 2LJ5A 2N4FA 4NJ7A 2FIFA 4I6LB 2PEAA 4GU2A 1QZEA 2GBJA 2RR9A 2CU1A 1KJTA 2D3GA 4MSQB 3TJPA 4YL8A 2JPHA 3B0AA 3ZKJC 3T9LA 3PVLA 3IVFA 4KIKB 2FCNA 5E6OA 1KM7A 1V9JA 4HDQA 4PS7A 5KHQA 1E8YA 3EECA 1WYWB 4EZJA 2KHWB 2KJRA 3ZDMC 4FJYA 2ZJDA 1WM3A 3TL5A 1WXMA 2IZVB 1V2YA 2MBQA 2NBVB 4ZYNA 2N1WA 2C7HA 2KXJA 3APDA 4KDLB 2N9XA 1SGHA 3N30A 1LFDA 3AI5A 5KHOA 3R7RA 3L13A 2BPSA 5CTRC 2N9PC 3VXWA 4NNJB 2FAZA 3UIOB 1WX9A 4MGYE 4FBJB 1WX8A 5AZHA 4EFOA 2K39A 2M17A 3L08A 5G2NA 2HTHA 1Z2MA 4TUUA 4AOFA 4G11A 4HPMB 5HKHA 5D6JB 4ZRKA 2D11A 3CF6E 3PHWB 1E8WA 2GBNA 3RZFA 2J0KA 1T0YA 2QHOA 4IWQA 1C3TA 4OVUA 1U4AA 4WWPA 2G4DB 3V6CB 4MGZE 1GC6A 3IG3A 1L7YA 2KLGA 4XC2A 3APCA 3WIMA 2G4SA 2ZCBA 2ZVOA 4GB9A 2LVPA 3L10B 2JRHA 2JZZA 2REXA 4BOSC 4W9DA 2CHZA 2ZCCA 2BYEA 2G45B 2B3AA 2CS4A 1RRBA 1RFAA 3B08A 4BVUC
chains in the Genus database with same CATH superfamily
3AE1B 4NY0A 3V60A 1SE4A 3T8MA 1T3QA 2PVGC 3SDLC 4ZDVA 3ZJVA 5G5HA 3UIPB 2KK8A 2DZIA 3NZSA 2EKEC 1KOTA 4XWTA 2INCC 2DYOA 1XLOA 3NVYA 3R3MA 2MWSB 1WJUA 4LCDE 2L52A 1QOBA 3DBLB 2OEDA 5HHDG 1TBEA 1R7SA 3H7SA 4P1BC 5FR3A 3NS1A 1NDDA 4M01A 3DVGY 2WP9B 3HRDD 3A4RA 1P9DU 3AE5B 3NVWA 1QOFA 2DAJA 2MRPA 4RM9A 1WE7A 4IUMB 4MT5A 4XE0A 2K22A 1TS4A 4KGSA 3OAWA 4HVBA 2KWUB 5IKCM 1SF0A 2Z0DB 3DVGX 4GN1A 2AL6A 5JHBA 1WM2A 2AQ1B 2NTTA 1KLGD 1FNVA 1XQQA 2D5GA 4DHZE 3PZ8A 1L5PA 2KVRA 4FJVB 4LTUA 2Z0EB 1JWAD 2RDBC 2KWCA 3GP7A 3RCZA 4G3XB 1P7EA 3AEBB 1R4MB 2W54A 4WJQA 3PPAA 2KQ4X 3X23A 1OQQA 3VRBB 3ZYYX 4LDTD 3L4PA 2K0PA 3VUXA 4C80A 5IAAC 4S17A 3TEWA 1VD2A 4MH8A 2M0AA 1P1AA 3ECIA 1PQSA 3N1YC 3LYYA 2WLBA 1NI2A 2D2QA 3U52E 2XEWA 2V3SA 2EKIA 4LNNA 1VJKA 4MDKE 4GDKB 2LD9A 3DWMA 1JRPA 2BW2A 1E10A 2WXMA 4HPPA 1RYJA 3V6EB 2CU3A 1I4QA 2KWVB 1QF6A 4LDTB 3FILA 2MJEA 1WFYA 2KO3A 4BKSD 1MVKA 4L2YA 2WXRA 4XDDA 2QDFA 1TKEA 1GB4A 4ZRPA 4EKUA 3ZXVA 3V3XA 1FNUA 1V81A 1WX7A 3NVZA 3KW5B 3Q2AC 2ZPYA 1TY2A 2L7RA 2Y3AA 1SJHD 1JWMD 5IA7A 1FNWA 3JW0X 5EE0A 2G9HD 3BK1A 2N9KA 3DCGA 1T0RC 4CQNA 3UQBA 3RI7C 1D5MC 4DHJD 4YTMB 1SB3C 2KDIA 4OW0A 2KC1A 4KSLC 5LNK1 1P3QU 1TYGB 1KFYB 1VRAB 2QCZA 3H1UA 3PREA 2LVOA 1DOIA 4D2KA 4HCNB 1AN8A 2XK5B 1UBQA 4RGNA 1R4MI 3HM6X 4NJCA 5LXHA 1ZKHA 4P1CC 2IO3B 2KFJA 1WXQA 1E8ZA 2O2VB 3PZ7A 4GSWA 1K50A 4HWIB 3P42A 2GBRA 3N3KB 2MCNB 3R2IA 1LO5D 4M0WB 1H8CA 2L0TA 4IWOA 4I6NB 2K8CA 3ZRFA 4W9LA 2ZVNA 4GDKA 4DXGA 1SSNA 1YN5A 1WIAA 4IM0A 2VH1A 3AULA 4M02A 1Q10A 1WWTA 2ASQA 1NEKB 2GI9A 3L0WB 2IGDA 3VTWA 2MP2A 2IO2B 1T6BX 1FCCC 3BY4B 3I3TB 3U2SC 2K8BA 2W9NA 3IBEA 4A6QA 4RGTA 3EFCA 1V1PA 3SR6A 1IBXA 2BVCA 4IC7B 1ZDVA 2D3BA 4LNIA 2LGYA 1BUIC 1OFFA 4GDLB 4KZ0A 3HIZA 4IKGA 3RNGC 1GUAB 2WDTB 3DQVA 4KGTA 4K3CA 4B9KA 1FXAA 1MFWA 3PZDA 1KH0A 3X0WA 2INPE 5AEKB 2IYDB 1WXVA 3HM3A 2M19A 2DZKA 2NVUI 2H88B 4TV3A 2O6VD 2KDMA 2JXXA 1HTOA 4NAMA 3R8BA 3QCAA 3VVWB 1Q1OA 1WZ3A 3SD5A 2JZ3B 1WRIA 1GNUA 3DHHC 2WQYB 1NYRA 3CMMB 2LASA 3A33B 4EUTA 4WJNA 3B9JA 5H8YE 4W9FA 1PGAA 2PTLA 4H2AA 2WXIA 2DLBA 1K8RB 1UF0A 2CKHB 2XBBC 5L83A 3V05A 1WGRA 1YX5B 3DBRB 3BYTB 2OOBB 1F2RI 3AE4B 2WXJA 2Y5PA 1C9FA 2LJIA 2L76A 2M4NA 4GLSC 2GMIC 4EOYA 1WGGA 3VFKA 4HXDA 4ANUA 1WI0A 2NBUA 1WR6E 2JVCA 3I57A 3WANA 1LQBA 2INNE 2LGSA 4HPLB 4ACFA 2D3CA 4YSYB 3HVZA 4AUQC 4HCPB 2HJ1A 2CU1A 2D3GA 1MI0A 3GE8C 3ZKJC 3AE8B 3P4QB 2KN4A 1KM7A 2HDEA 2ON8A 4HDQA 5KHQA 1E8YA 1EM7A 2KJRA 1JMLA 2CJNA 3TL5A 1WM3A 1WXMA 2IZVB 2MBQA 4EE2A 2W55A 4KDLB 2BT6A 3P4PB 4REZA 3N30A 5KHOA 3SEBA 1KTKA 4NNJB 3AMZA 3Q8FA 4MGYE 1IUEA 3L08A 5G2NA 1WSPA 2XNAC 2V4IB 5HKHA 2ZW0A 2WHIA 3NZ3A 2J0KA 4HRSA 3WCQA 4RGOS 2G4DB 1K53A 2KLGA 3CIRB 4RNAA 2ZCBA 2LVPA 1VZ6A 1CZPA 2JRHA 1PYWD 2QMTA 3MJ5A 1I42A 4BVUC 3K9OB 3B2GA 3VDZA 1J7CA 1E7UA 1KLVA 4YTNB 3ZNGC 1GG3A 4WJOA 1LXDA 4RH6A 2WXHA 4LJOB 3HVDA 4E71A 4S0RA 5DPRA 4HDOA 2K25A 5BYQA 2RDHA 5EDSA 1FO4A 4ITKA 5D94A 3E56A 1CQVA 3VTVA 4WAAA 3GZNI 3Q3OC 2MJ3A 5C23A 2L0FA 1I35A 2KN5A 2LFIA 4WQOB 3IAS1 1PGXA 1I4XA 2DYMA 5CX3A 1EWYC 2UYZB 1ET9A 1TTNA 3UQAA 2W3RA 4MJSA 2BYFA 2R2QA 2UWQA 3RD2A 3ZW3A 4K7WA 1KF6B 3DHIC 4XDCA 4OVVA 3WA0A 1I4GA 1FM0D 4GMVA 3DBLI 2K8HA 3MHZA 2H89B 1RAXA 1NYQA 5H92C 4IDIA 2LVQA 3CSTA 3AU5A 2KACA 3ZO5B 5DPTA 2GBKA 1WE6A 2C60A 3Q8CA 4E3CA 3KLSX 4AP4C 4HEA1 2YLMA 1LM8B 4GDLA 3LJ3A 3M62B 2WWZA 2KFKB 3U7DA 2R61A 1F9JA 2QSDA 2FIDA 2ICIA 1R4NB 3PLUA 3A9KB 3VUYA 3QK0A 4US8A 4AQ7A 4KKJA 1FPYA 1ZP0B 5CHWA 4K7SA 3QQ8B 4RMAA 1YQ3B 2QC8A 4NZLB 1YQ4B 2D3AA 2KQ7A 1JWBD 2N7JA 3Q8BA 1X1MA 3Q3MC 5JZEB 3D32A 2N7EA 2NPTA 5E6NA 4WQMA 2KKCA 3NUHB 2N1VA 1K51A 2L3ZA 2RMMA 3H8HA 3NHEB 4IW0A 1RM6C 2JT4B 3B1LX 1OTRB 1C1YB 1A70A 2MEKA 1E0ZA 4W9CA 4FN2A 4YXDB 4YSXB 2KANA 1MHXA 3RNCC 1XCTL 1ZXHA 3C0RB 4N59A 4C7ZA 1UUPA 1KLUD 1D5XC 1V97A 1WGKA 4DQOC 1WYGA 3PT2B 4G50A 2NTSA 4F8CB 1IBXB 3BIID 4OZAA 1UELA 3KYDD 5MPOA 4WWNA 3QAQA 3QX1A 3N32A 4DK5A 1FRDA 4KGRA 1AYFA 1CMXB 4M0WA 3WALA 5AZFA 3UGBB 1AARA 3A9KA 2LUMA 3H9DA 1LGRA 4MJSB 3HK0A 3DOWA 2NCNA 3QJZA 4DXFA 4GOCA 1JWUD 4YSZB 1HXYD 3R2TA 3VR8B 4USAA 4C00A 3TEZA 2O6VA 4IG7B 2WYQA 3QC8B 3H7PA 1TGZB 4M8NA 5FR6A 2BWFA 4W9JA 3M3JA 4P16A 2KOXA 1JW9D 1WF9A 3KYCD 4DWFA 2K5PA 4MH0E 4P7IA 2J0MA 2NPTB 4WJPA 1G6JA 3BYYB 2KC2A 4MACA 4FA6A 3GOEA 4IM2A 3PHXB 5FK9C 3ZTCA 1V80A 5G5GA 3TMPB 2LZ6A 1EF5A 2WXLA 3AEGB 2KFKA 4LK0M 3DWGC 2D10A 3GE3C 3AU4A 3VUWA 3P4SB 3V62A 1CJEA 3N9YC 2EMSA 2V4LA 2KJHB 2E3TA 1E7PB 1FD6A 4C56C 3HHMA 4CHKA 1JQ4A 1NENB 1AW7A 4MSMB 1I7HA 1SIFA 2JU6X 3KUDB 4OZCA 3DBRI 1VCBA 1UH6A 2ZPNA 1UNSA 5LLIA 1E7VA 3TBLD 3PLVA 3I63C 4IOIE 4MGIE 1V8CA 2XK5A 2YEPF 3Q3FA 3H7PB 4BKGA 3ZJUA 2NR2A 3JYUA 2M8SA 5CHVC 3RYTA 3W1YA 4DDID 2KDFB 2KYWA 3P2BA 5LXIB 4K7UA 1DYQA 1ET6A 2VRRB 4ZOHC 2JUOA 1A5RA 1QT9A 4YT0B 5D7GA 1C78A 1DGJA 1MJDA 4BKTA 4RFBA 2C7MB 4HKZE 4BBNC 3OLMD 5JHAA 2KMMA 2O6VB 1YMHE 1EWCA 3BVZA 4A3PA 3RULA 2LMCA 3VH3B 1YN4A 4IWPA 3PO0A 1NBFC 4K3BA 4A55A 3AE3B 2BTEA 2LRUA 1QOAA 1FXIA 3PRZA 5HFYA 4JIOU 4RCOA 2K6QA 2D07B 4TQ0A 2MLBA 4XWWA 2M56B 2X38A 2FIFA 3U7ZA 4GU2A 2RR9A 4YL8A 4OHJA 2JPHA 3B0AA 2K3UA 4R3DA 3PVLA 5E6OA 3AECB 1V9JA 4EZJA 3RFZB 1T5XD 3BK2A 5T8IA 3SFDB 4ZYNA 1TKGA 3NJTA 2WS3B 5JXVA 1SGHA 2DBYA 3KQ4A 3AEDB 3AEAB 3VXWA 2E6XA 2N9PC 2FAZA 3UIOB 1WX8A 5AZHA 2M17A 2V3PA 2OHFA 2HTHA 2N9LA 2D11A 3CF6E 3PHWB 4WWMA 3RZFA 2QHOA 1C79A 5AUKA 1GC6A 3IG3A 4PT5A 3LB8C 2G4SA 2RPVA 3Q6BA 4A9AA 4BOSC 1XLQA 4W9DA 2CHZA 1HTQA 2CS4A 3B08A 5FKAC 4II2B 1JALA 2HTME 2WXFA 3W1SC 1ZW7A 3RUIB 2BB5A 3EHVA 3ZUNA 2MBOA 3L16A 1EU4A 1Z5SB 2WX1A 4GGQA 1FRRA 3NRZA 1ZXIA 2I38A 1BMLC 2WNMA 3U8ZA 1I4RA 3BINA 1WJ4A 2Y5BB 2C9WB 1Y8RC 5C2TB 4BZAA 1D5ZC 2KAJA 3PSEB 1M94A 1NI3A 2KMCA 3RNEC 1T0SC 1UGJA 4A90A 2Q5WD 1QOGA 3DVNV 3ZQ4A 1UWXA 1L2NA 1P7FA 4A20A 4II3B 1N5XA 2M1MA 3CSFA 4UDUC 2DYBA 4L23A 4G0NB 3A4SC 3SU8X 1WJ6A 1YIWA 1WZ0A 4KV2A 2AL3A 3IAM1 3BWUD 3C19A 1FMAD 2HD5B 1WJNA 3M63B 3UF8A 3ML9A 1IYFA 4X57B 3A1QA 1H4RA 2JF5A 4DHJB 3IFWB 1YQBA 3Q8AA 1Q0WB 2C5LC 2LGXA 1FIQA 3VHTC 1QKZA 1HZ6A 3ZJTA 4K1RB 2CR5A 2A4ZA 3KUCB 4CO7A 3PS6A 1TKYA 3B2FA 2WXGA 2KTRB 1SE2A 2FCQA 3IT6B 2BWES 1OGWA 2KLCA 2MSED 1XCQL 2KTFA 1ZUD2 3RZWC 3V61A 3VRAB 2KDEB 4MM3B 2K1FA 2IGGA 3PV1A 4B95A 3ONSA 4P6VF 4AS1A 2AQ2B 4BAXA 4KDIC 3QWZB 2PKOA 2JZPA 3NG0A 3RNBC 1ZGUB 2BGFA 2IY0B 2KWDA 4NAWB 2VZKB 4PYZA 1TT5B 2KMAA 2PMVA 3RNFC 3ZRCA 3IHPC 1OEYA 4MEMA 4ICVA 3I9V1 2V1YA 3QA8A 4KVGB 4A3OA 2RD0A 4BKSA 2N0SB 3PGEA 2MHJA 2PW9A 3Q3JA 1FCLA 2NMQA 4KKIA 5TR5A 3RNAC 3ZIMA 4US9A 1QLBB 1J7AA 1OQYA 2JY6A 4O1NA 1YJIA 3DVNU 5EE3A 4FLHA 1FFVA 3N20C 1E6EB 1ZPSA 2WDQB 1CK1A 2RGFA 3O13A 4BOZB 1VZ8A 4F1SA 3AE9B 2ZEQA 1PDXA 3MC0B 3DBSA 4LJPB 5D3DA 3TIXA 4HJKA 4TKNA 4XX5A 4DHZB 3N1ZC 1RFKA 2LWPA 3ETRA 3Q3NC 4QAYA 3FKYA 2IY1B 2KTRA 1MG8A 2MBBB 5D2MB 4LLGM 4W9IA 4W9GA 1HE8A 1L0XB 4KX6B 1YN3A 4E74A 2OJRA 1D6EC 3FC4A 4ASWC 2LEKA 1JWSD 5C3JB 2DZJA 2YVCA 3BVGA 2MA9B 3R7QA 3EA6A 5C1ZA 1GPXA 3KUZA 1ZOYB 5EE9A 4J6IA 2JYEA 2PLPA 1FXTB 1E8XA 3OWEB 5BMGA 1VDVA 3ALBA 3OJ4B 1MHHE 1V86A 4C4VA 4FULA 3RT3B 1EU3A 2B76B 1I4HA 2BF8B 2UU7A 1IGDA 1TS2A 3A1QB 5BO4B 1QQRA 1TS3A 1BXTA 2PPHA 1WMHB 2J52A 4LNKA 1KRHA 2LHDA 3MHSD 1WXAA 3VAWA 4Q2JA 3ZVVA 2BKFA 3OJ3A 3UI3A 3PTFC 2AEHA 2LXAA 1D4BA 3C8YA 2WXOA 1E5WA 3AM9A 2YEPB 2G3QB 4ZRJA 3T3OA 4WURA 2TSSA 2MBEA 4KSKC 2LXCA 1WGYA 1J19A 1Q5WB 2KZRA 4NPNA 2N7DA 1XLNA 3O65B 2KNBA 1N6ZA 4ZRQA 4EEWA 1SE3A 4HKQA 1HA5A 1DOYA 3FAHA 3ZXRA 3MP9A 4C4VB 3VR9B 2L00B 4W9KA 4ZRIA 3WAPA 5TSSA 4YWGG 2BYVE 3MC8A 2KVZA 1C76A 1F77A 1VLBA 1SBBB 3PRMB 3RMKC 2DENB 4WH4A 2RSUA 4RM8A 1OEYJ 4BBNF 4CYEA 2PE6B 4TQ1A 1BT0A 5E6PA 2AWTA 2X8XX 2KX3A 2CJOA 3KH0A 1SEBD 3N1XC 1EF1A 2JRIB 1STEA 1UGMA 4FXCA 2QJLA 2IPKD 4F7ZA 5JH5C 4OVZA 4OZBA 1YOVB 1UD7A 1F0ZA 1TY0A 1WMHA 3S2AA 2JWUA 2M0XA 4PYUA 4ZHPA 1PFDA 4URKA 2NBWB 4A8XC 1T0QC 5BYSA 3A9JA 1GB1A 3AB5A 5IO9A 2FUHB 2ZW1A 2DHZA 2GBMA 1L0YB 2LJ5A 3ZGZA 1TZOA 2PEAA 5AUIA 2GBJA 4MSQB 3TJPA 1FFUA 3T9LA 2WXQA 1SIJA 1ROEA 1TJEA 2AX5A 4M00A 4ARCA 2N1WA 2KXJA 3APDA 3I5JC 4J3OD 1LFDA 3R7RA 3MFGA 3L13A 4ZHOA 5CTRC 3P4RB 2IJ0A 4FBJB 2VH2A 1L4DB 2K39A 1Z2MA 4TUUA 5BMIA 1E8WA 2GBNA 3KWVA 2WU5B 4IWQA 4WWPA 3MC9A 3APCA 2JXTA 3WIMA 4N58A 1IGCA 2BYTA 3KWLA 2BS2B 3L10B 2REXA 1K52A 2GRIA 1HZ5A 1JRUA 3DDCB 4MM3A 4ZYSA 1C77A 2MJDA 1E90A 1UZXB 3ABVB 4WIPA 1MPEA 1XEEA 4DXAB 2RPQA 4M8MA 3W1SA 1L6VA 4JWUC 4L1BA 2R2OA 2ACZB 3W9CB 4C7YA 2MW5A 4KZCA 4RF0A 3DHGC 3MJWA 2BB6A 3L54A 1J8CA 3ZDTA 1SE9A 3W5VB 4AJWA 3NZUA 1WXSA 1FEHA 1N61A 1XF5L 3U30A 5IOIA 2AQ3B 2V0GA 1YJ1A 4WAFA 3U4EG 1WGHA 3Q8EA 3H6NA 2FCMA 1WRDB 2L32A 2WXPA 2LRWA 1S1QB 2J42A 2QEJC 2FE8A 1F52A 4FHKA 4W9HA 1DOXA 1N62A 1L6UA 3AN1A 3RN9C 5HI1A 4N9F4 4GIVA 1L0VB 5E6JA 2CHXA 2MBHA 4B6WA 4XYCA 3VTUA 1NVID 4JLCA 4K81A 3AEEB 5DPWA 4B0MA 2IDYA 1S3SG 3AV8A 4NJ6A 1V49A 5DCNA 2BQQA 2V9HA 5CHFA 4JE3B 4JWSC 3ENEA 2K9XA 2DAFA 5AZGA 4I6PA 3GB1A 5GMVA 1RLFA 4KIKA 2INDC 5BMHA 3IT4B 4BFRA 2O2VA 1YJJA 2JWZA 3UINB 5G55A 2L1AA 2IBIB 3L17A 2I1KA 3WAMA 2JQRB 2DZMA 3EGRA 1C4AA 3QHTA 2EELA 2I1JA 1B1ZA 1V5TA 2LGDA 2RDGA 3MTNB 2J7QB 1J7BA 3R66C 4ANWA 4HLEA 5IP4D 2SEBD 4WWOA 2DX5B 3RPFC 2Z8LA 4XZ4A 1UBIA 4GXBA 3ML8A 2AYOB 3TSSA 2Z59B 3GZNB 1M4VA 3P1MA 4ANVA 2MX2A 1P0RA 1F1HA 1TS5A 3W2DA 2KX0A 3T3NA 2LUEA 4FHJA 2ZNVB 1YNTE 2JYTA 2OJWA 3NOBA 3AE7B 3ZNID 5EE1A 1YD8U 1V1PB 2WU2B 2IO0B 2GLSA 1V5OA 3P63A 4JGHB 2VZKD 2K6DB 3ZNZB 1R4NI 1WH3A 4ICUA 2IGHA 3Q69A 3WAOA 4MELA 2WXKA 1E9MA 4PK1A 2NS5A 1N63A 1PUTA 2FUG1 2IO1B 2XN9C 3SFEB 2ZZPB 1XT9B 3JSVA 1I4PA 3JSVB 3A9JB 3CWIA 4RGMA 2KT7A 2WX0A 3ZLZA 2V3NA 3EFUA 3KVFB 1UWMA 2PE9A 1VR9A 1RWSA 4MGKE 3NVVA 3AEFB 3GS2A 2J0JA 2Y5CA 3JVZX 4EZLA 4JL9A 2BS4B 5L95C 1GOZA 2JSVX 3TUOA 2EMTA 4PS3A 4EZKA 3J9CA 3PRPB 5HG2A 3HUIA 1PGBA 2KJ6A 1QILA 2PIAA 1V1OA 1HEZE 2PJHA 1WR1A 3ZTDA 2QIEB 2QILA 1TIFA 4RF1A 3OG5A 3DBHI 1XO3A 2ZNVC 1C4PA 3FILB 1GAQB 1WY8A 1XD3B 2KDBA 1GC7A 3TEYA 2GOWA 1V6EA 3AXCA 2MP2B 1D3ZA 2HJ8A 2GB1A 3AE6B 4JPSA 2CHWA 3M95A 1GJZA 1EO6A 2BKRB 1IPGA 5DPSA 1WGDA 1ZDXA 3APFA 2SAKA 2WDVB 4TSSA 3BZDB 3TEXA 2FCSA 4ANXA 4AJYB 3ZNHB 4HJGE 4XGAB 2HE7A 3LDZE 3E9SA 1C4CA 1ZE3D 4LNOA 5J17A 2ONQA 2FBWB 5GXGB 4AWJA 3NY5A 3VQIA 4ARIA 4YTPB 3AE2B 4TMAB 3QIJA 2DWQA 4NAWA 2MH7A 2LHEA 3TCAA 4JX1C 3NS8A 4FJZA 5D3IB 1EUVB 4IM3A 2A5UA 2LI5A 1ESFA 1ENFA 1P98A 3AH7A 3DPDA 2WXNA 2MQJA 3Q14C 5J18A 2G1EA 2C7NB 5J2RA 2N9EB 1L4ZB 3SHQA 1XLPA 3K9PB 1OQRA 4DDGD 1AWDA 2J53A 2BS3B 2PVOD 1J0GA 1IP9A 3EC8A 4W9EA 1SXTA 2BBCA 1ISNA 4DBGA 2KQSA 1F2RC 1TZ1A 4B0EA 2W3SA 3EUB2 3BVMA 2KD0A 4JQWC 4NQLB 2L83A 1YX6B 4NQKE 3URYA 5IN7A 2L05A 2L8JA 4PS8A 3VH4B 3QARA 4HK2A 2WGSA 4FADA 2FNJB 2N4FA 4NJ7A 2W82A 4I6LB 1QZEA 1KJTA 2I2YA 1JROA 3IVFA 4KIKB 2FCNA 1JCKB 1HQRD 2DNFA 4PS7A 3EECA 1WYWB 2LGIA 2KHWB 3ZDMC 4FJYA 2ZJDA 1B9RA 1Y56A 1XXGA 1V2YA 1N60A 2NBVB 2C7HA 2J4XA 3W5UB 2N9XA 1MG4A 3AI5A 3DBHB 4HROA 5BYRA 2BPSA 3LXFA 3IXSA 1SJED 1WX9A 4EFOA 5I4DA 1VZ7A 4AOFA 4G11A 4HPMB 5D6JB 4ZRKA 2WDRB 1T0YA 1C3TA 4LNFA 4OVUA 1U4AA 4N6EB 3V6CB 2JX5A 4MGZE 1L7YA 4XC2A 2ZVOA 1N5WA 4GB9A 2JZZA 1ACCA 2ZCCA 2BYEA 2G45B 2B3AA 1RRBA 1RFAA
chains in the Genus database with same CATH topology
3K9OB 4II2B 3VDZA 4MM3A 3W1SC 4NY0A 1E7UA 1ZW7A 3V60A 1KLVA 1E90A 1UZXB 3RUIB 3EHVA 3T8MA 3ZNGC 4DXAB 3ZUNA 1GG3A 4WJOA 3SDLC 2RPQA 4ZDVA 1LXDA 2MBOA 3L16A 4M8MA 3W1SA 3UIPB 4LJOB 2KK8A 4E71A 2DZIA 1Z5SB 2R2OA 2WX1A 3NZSA 4GGQA 2EKEC 1KOTA 2MW5A 4KZCA 3MJWA 3L54A 5DPRA 1J8CA 2DYOA 4HDOA 3ZDTA 2K25A 3R3MA 2MWSB 1SE9A 1WJUA 4AJWA 4LCDE 3U8ZA 3NZUA 1WXSA 3BINA 5EDSA 1WJ4A 5D94A 3VTVA 2Y5BB 3U30A 2C9WB 1TBEA 4WAAA 1Y8RC 1YJ1A 3H7SA 3GZNI 1WGHA 5C23A 3PSEB 2L0FA 1M94A 1NDDA 1I35A 3DVGY 2KMCA 2KN5A 3H6NA 2FCMA 1WRDB 1P9DU 3A4RA 4WQOB 2LRWA 1S1QB 5CX3A 2DYMA 2DAJA 2MRPA 4RM9A 1WE7A 4IUMB 2UYZB 1TTNA 3DVNV 3UQAA 4W9HA 4FHKA 1L2NA 4A20A 4II3B 4MJSA 2M1MA 3OAWA 3CSFA 2BYFA 2DYBA 2R2QA 4G0NB 2UWQA 3RD2A 3A4SC 3SU8X 4HVBA 1WJ6A 1YIWA 1WZ0A 2KWUB 2AL3A 4K7WA 4KV2A 3ZW3A 4N9F4 2Z0DB 3DVGX 4GN1A 2AL6A 2HD5B 1WM2A 4GIVA 1WJNA 4OVVA 3M63B 3UF8A 4GMVA 3ML9A 3WA0A 1IYFA 3DBLI 2CHXA 2K8HA 4X57B 3A1QA 2MBHA 1XQQA 1H4RA 2JF5A 4DHJB 3IFWB 4DHZE 1YQBA 1RAXA 4B6WA 4FJVB 2KVRA 1Q0WB 2C5LC 2LGXA 2Z0EB 3VTUA 3VHTC 2LVQA 2KWCA 4JLCA 3RCZA 4K81A 3CSTA 1JRUA 2CR5A 4G3XB 2A4ZA 3KUCB 4K1RB 4CO7A 5DPWA 3PS6A 3AU5A 1S3SG 3ZO5B 4NJ6A 4WJQA 1V49A 2KTRB 5DCNA 2FCQA 2GBKA 3PPAA 5DPTA 1WE6A 2BWES 1OGWA 2C60A 3X23A 2KLCA 2MSED 4LDTD 4E3CA 5CHFA 4AP4C 2KTFA 3ENEA 2DAFA 3RZWC 3V61A 2YLMA 1LM8B 5IAAC 5AZGA 3VUXA 4GDLA 4I6PA 3LJ3A 1VD2A 5GMVA 1RLFA 2KDEB 3M62B 2WWZA 2KFKB 1P1AA 3U7DA 3ECIA 1PQSA 4KIKA 2K1FA 1F9JA 3PV1A 4B95A 2FIDA 4BFRA 2O2VA 3ONSA 3PLUA 1NI2A 2D2QA 2JWZA 3A9KB 3QK0A 3VUYA 4KDIC 3UINB 2XEWA 1I42A 5G55A 2V3SA 2IBIB 3L17A 3QWZB 2I1KA 3WAMA 4MDKE 4GDKB 2LD9A 1ZGUB 2DZMA 2BGFA 5CHWA 2IY0B 4K7SA 3QQ8B 4RMAA 3QHTA 3V6EB 2I1JA 4NAWB 1V5TA 2LGDA 3MTNB 2J7QB 2KWVB 3R66C 4PYZA 2KMAA 2KQ7A 4ANWA 4LDTB 4HLEA 3ZRCA 4WWOA 3IHPC 1OEYA 4MEMA 2DX5B 1WFYA 4ICVA 4XZ4A 1UBIA 5JHBA 4GXBA 2V1YA 2KO3A 3ML8A 3QA8A 4KVGB 2AYOB 4BKSD 1X1MA 3DDCB 4A3OA 2Z59B 2RD0A 4BKSA 5JZEB 3PGEA 3D32A 4ANVA 2N7EA 2MX2A 3Q3JA 1P0RA 2NPTA 5E6NA 4EKUA 2KX0A 2LUEA 5TR5A 4FHJA 1V81A 2ZNVB 3ZIMA 1WX7A 3KW5B 2ZPYA 2KKCA 3NOBA 3ZNID 2L7RA 2N1VA 1OQYA 1YD8U 2JY6A 5IA7A 2L3ZA 2IO0B 3DVNU 3NHEB 3JW0X 1V5OA 4JGHB 4IW0A 2K6DB 4FLHA 3ZNZB 1R4NI 3B1LX 1WH3A 2JT4B 4ICUA 1OTRB 1C1YB 3DCGA 2RGFA 3WAOA 4MELA 3UQBA 4W9CA 4FN2A 4BOZB 4F1SA 2ZEQA 2KANA 4DHJD 4LJPB 3DBSA 2KDIA 2KC1A 3C0RB 4KSLC 2NS5A 1P3QU 2IO1B 3TIXA 4HJKA 2ZZPB 4TKNA 1XT9B 4XX5A 3JSVA 4DHZB 3JSVB 2LWPA 3A9JB 3PT2B 3H1UA 4G50A 2WX0A 2IY1B 3ZLZA 3PREA 2KTRA 4F8CB 2LVOA 1MG8A 2MBBB 4HCNB 5D2MB 3EFUA 2XK5B 3KVFB 1UBQA 2PE9A 1R4MI 3HM6X 1UELA 4MGKE 3KYDD 4W9IA 4W9GA 5LXHA 2J0JA 1HE8A 4WWNA 3JVZX 1ZKHA 3QAQA 3QX1A 2IO3B 4EZLA 2KFJA 3N32A 4JL9A 4E74A 5L95C 4DK5A 2OJRA 2O2VB 1E8ZA 4ASWC 1CMXB 2DZJA 2YVCA 2EMTA 4PS3A 3WALA 5AZFA 4EZKA 3PRPB 4GSWA 3UGBB 2MA9B 4HWIB 3R7QA 1AARA 3A9KA 2KJ6A 2GBRA 3N3KB 2MCNB 5C1ZA 3KUZA 3H9DA 4M0WB 1H8CA 4J6IA 4MJSB 2L0TA 4IWOA 4I6NB 2K8CA 3DOWA 2NCNA 3HK0A 2PJHA 3ZRFA 1WR1A 3QJZA 4W9LA 3ZTDA 1FXTB 4GOCA 2ZVNA 4GDKA 1E8XA 2O6VA 3ALBA 3OJ4B 1WIAA 3DBHI 1V86A 4IM0A 4FULA 4IG7B 3AULA 2ZNVC 3RT3B 2WYQA 2BF8B 3H7PA 3QC8B 1TGZB 3A1QB 4M8NA 2ASQA 5FR6A 5BO4B 1WY8A 2BWFA 1XD3B 3M3JA 4W9JA 2KOXA 3L0WB 2KDBA 1WF9A 1GC7A 2PPHA 1WMHB 3KYCD 4DWFA 3VTWA 4MH0E 4P7IA 2J0MA 2MP2A 2GOWA 2IO2B 2NPTB 3BY4B 1V6EA 3I3TB 3AXCA 2MP2B 4WJPA 1G6JA 2K8BA 2W9NA 3IBEA 2KC2A 3MHSD 1D3ZA 2HJ8A 4FA6A 1WXAA 3GOEA 3VAWA 4IM2A 3PHXB 2CHWA 3M95A 2BKFA 3ZVVA 1EO6A 1GJZA 3OJ3A 4IC7B 2BKRB 3PTFC 3ZTCA 1IPGA 5DPSA 2LXAA 1WGDA 1V80A 2AEHA 2LZ6A 3TMPB 1EF5A 3APFA 2KFKA 1E5WA 2G3QB 2LGYA 4ZRJA 2FCSA 4ANXA 2D10A 3AU4A 4AJYB 4GDLB 3VUWA 3ZNHB 4KZ0A 3V62A 3HIZA 2HE7A 1GUAB 2MBEA 2EMSA 2V4LA 2WDTB 2KJHB 3DQVA 3LDZE 4KSKC 2LXCA 5J17A 4B9KA 3PZDA 1WGYA 1J19A 3HHMA 4AWJA 3NY5A 4CHKA 1Q5WB 2KZRA 4NPNA 3VQIA 2N7DA 3O65B 4MSMB 3X0WA 2KNBA 5AEKB 1SIFA 3QIJA 4NAWA 2IYDB 1WXVA 3KUDB 3DBRI 4EEWA 1VCBA 1UH6A 2ZPNA 5LLIA 1E7VA 3HM3A 3TCAA 2DZKA 3TBLD 3PLVA 2L00B 4W9KA 2NVUI 4ZRIA 4MGIE 2XK5A 3Q3FA 4BKGA 3H7PB 4TV3A 3WAPA 3NS8A 4FJZA 2O6VD 2NR2A 2JXXA 2BYVE 1EUVB 4IM3A 2A5UA 3JYUA 3QCAA 3VVWB 2LI5A 2M8SA 5CHVC 3RYTA 1Q1OA 1WZ3A 3SD5A 2JZ3B 3W1YA 4DDID 1GNUA 1P98A 3CMMB 2KDFB 3P2BA 2LASA 3A33B 3DPDA 3PRMB 4EUTA 5LXIB 2MQJA 2DENB 4K7UA 4WJNA 5J18A 2VRRB 2RSUA 2JUOA 4RM8A 4W9FA 1OEYJ 4BBNF 1A5RA 4CYEA 2PE6B 4TQ1A 1BT0A 5E6PA 2AWTA 5D7GA 2C7NB 5J2RA 2N9EB 2KX3A 3KH0A 3SHQA 1K8RB 3K9PB 4BKTA 2CKHB 4DDGD 2XBBC 5L83A 2C7MB 1EF1A 5JHAA 2JRIB 3OLMD 4BBNC 2O6VB 1UGMA 1J0GA 1WGRA 1IP9A 1YX5B 3EC8A 4A3PA 3RULA 3VH3B 2OOBB 4F7ZA 5JH5C 4W9EA 4IWPA 1ISNA 2L76A 1UD7A 2M4NA 4DBGA 1NBFC 2GMIC 2KQSA 1TZ1A 1WMHA 3S2AA 4EOYA 2M0XA 4JQWC 4NQLB 2KD0A 1WGGA 4PYUA 3VFKA 2LRUA 4HXDA 4ANUA 1YX6B 4NQKE 1WI0A 4URKA 2NBUA 1WR6E 2JVCA 2NBWB 2L05A 2L8JA 3PRZA 4JIOU 4PS8A 2K6QA 2D07B 3A9JA 3WANA 1LQBA 4TQ0A 4HPLB 2FUHB 2MLBA 2DHZA 3VH4B 3QARA 2GBMA 4HK2A 4AUQC 4HCPB 4FADA 2FNJB 2LJ5A 2N4FA 4NJ7A 2FIFA 4I6LB 2PEAA 4GU2A 1QZEA 2GBJA 2RR9A 2CU1A 1KJTA 2D3GA 4MSQB 3TJPA 4YL8A 2JPHA 3B0AA 3ZKJC 3T9LA 3PVLA 3IVFA 4KIKB 2FCNA 5E6OA 1KM7A 1V9JA 4HDQA 4PS7A 5KHQA 1E8YA 3EECA 1WYWB 4EZJA 2KHWB 2KJRA 3ZDMC 4FJYA 2ZJDA 1WM3A 3TL5A 1WXMA 2IZVB 1V2YA 2MBQA 2NBVB 4ZYNA 2N1WA 2C7HA 2KXJA 3APDA 4KDLB 2N9XA 1SGHA 3N30A 1LFDA 3AI5A 5KHOA 3R7RA 3L13A 2BPSA 5CTRC 2N9PC 3VXWA 4NNJB 2FAZA 3UIOB 1WX9A 4MGYE 4FBJB 1WX8A 5AZHA 4EFOA 2K39A 2M17A 3L08A 5G2NA 2HTHA 1Z2MA 4TUUA 4AOFA 4G11A 4HPMB 5HKHA 5D6JB 4ZRKA 2D11A 3CF6E 3PHWB 1E8WA 2GBNA 3RZFA 2J0KA 1T0YA 2QHOA 4IWQA 1C3TA 4OVUA 1U4AA 4WWPA 2G4DB 3V6CB 4MGZE 1GC6A 3IG3A 1L7YA 2KLGA 4XC2A 3APCA 3WIMA 2G4SA 2ZCBA 2ZVOA 4GB9A 2LVPA 3L10B 2JRHA 2JZZA 2REXA 4BOSC 4W9DA 2CHZA 2ZCCA 2BYEA 2G45B 2B3AA 2CS4A 1RRBA 1RFAA 3B08A 4BVUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K9O B;  4II2 B;  3VDZ A;  4MM3 A;  3W1S C;  4NY0 A;  1E7U A;  1ZW7 A;  3V60 A;  1KLV A;  1E90 A;  1UZX B;  3RUI B;  3EHV A;  3T8M A;  3ZNG C;  4DXA B;  3ZUN A;  1GG3 A;  4WJO A;  3SDL C;  2RPQ A;  4ZDV A;  1LXD A;  2MBO A;  3L16 A;  4M8M A;  3W1S A;  3UIP B;  4LJO B;  2KK8 A;  4E71 A;  2DZI A;  1Z5S B;  2R2O A;  2WX1 A;  3NZS A;  4GGQ A;  2EKE C;  1KOT A;  2MW5 A;  4KZC A;  3MJW A;  3L54 A;  5DPR A;  1J8C A;  2DYO A;  4HDO A;  3ZDT A;  2K25 A;  3R3M A;  2MWS B;  1SE9 A;  1WJU A;  4AJW A;  4LCD E;  3U8Z A;  3NZU A;  1WXS A;  3BIN A;  5EDS A;  1WJ4 A;  5D94 A;  3VTV A;  2Y5B B;  3U30 A;  2C9W B;  1TBE A;  4WAA A;  1Y8R C;  1YJ1 A;  3H7S A;  3GZN I;  1WGH A;  5C23 A;  3PSE B;  2L0F A;  1M94 A;  1NDD A;  1I35 A;  3DVG Y;  2KMC A;  2KN5 A;  3H6N A;  2FCM A;  1WRD B;  1P9D U;  3A4R A;  4WQO B;  2LRW A;  1S1Q B;  5CX3 A;  2DYM A;  2DAJ A;  2MRP A;  4RM9 A;  1WE7 A;  4IUM B;  2UYZ B;  1TTN A;  3DVN V;  3UQA A;  4W9H A;  4FHK A;  1L2N A;  4A20 A;  4II3 B;  4MJS A;  2M1M A;  3OAW A;  3CSF A;  2BYF A;  2DYB A;  2R2Q A;  4G0N B;  2UWQ A;  3RD2 A;  3A4S C;  3SU8 X;  4HVB A;  1WJ6 A;  1YIW A;  1WZ0 A;  2KWU B;  2AL3 A;  4K7W A;  4KV2 A;  3ZW3 A;  4N9F 4;  2Z0D B;  3DVG X;  4GN1 A;  2AL6 A;  2HD5 B;  1WM2 A;  4GIV A;  1WJN A;  4OVV A;  3M63 B;  3UF8 A;  4GMV A;  3ML9 A;  3WA0 A;  1IYF A;  3DBL I;  2CHX A;  2K8H A;  4X57 B;  3A1Q A;  2MBH A;  1XQQ A;  1H4R A;  2JF5 A;  4DHJ B;  3IFW B;  4DHZ E;  1YQB A;  1RAX A;  4B6W A;  4FJV B;  2KVR A;  1Q0W B;  2C5L C;  2LGX A;  2Z0E B;  3VTU A;  3VHT C;  2LVQ A;  2KWC A;  4JLC A;  3RCZ A;  4K81 A;  3CST A;  1JRU A;  2CR5 A;  4G3X B;  2A4Z A;  3KUC B;  4K1R B;  4CO7 A;  5DPW A;  3PS6 A;  3AU5 A;  1S3S G;  3ZO5 B;  4NJ6 A;  4WJQ A;  1V49 A;  2KTR B;  5DCN A;  2FCQ A;  2GBK A;  3PPA A;  5DPT A;  1WE6 A;  2BWE S;  1OGW A;  2C60 A;  3X23 A;  2KLC A;  2MSE D;  4LDT D;  4E3C A;  5CHF A;  4AP4 C;  2KTF A;  3ENE A;  2DAF A;  3RZW C;  3V61 A;  2YLM A;  1LM8 B;  5IAA C;  5AZG A;  3VUX A;  4GDL A;  4I6P A;  3LJ3 A;  1VD2 A;  5GMV A;  1RLF A;  2KDE B;  3M62 B;  2WWZ A;  2KFK B;  1P1A A;  3U7D A;  3ECI A;  1PQS A;  4KIK A;  2K1F A;  1F9J A;  3PV1 A;  4B95 A;  2FID A;  4BFR A;  2O2V A;  3ONS A;  3PLU A;  1NI2 A;  2D2Q A;  2JWZ A;  3A9K B;  3QK0 A;  3VUY A;  4KDI C;  3UIN B;  2XEW A;  1I42 A;  5G55 A;  2V3S A;  2IBI B;  3L17 A;  3QWZ B;  2I1K A;  3WAM A;  4MDK E;  4GDK B;  2LD9 A;  1ZGU B;  2DZM A;  2BGF A;  5CHW A;  2IY0 B;  4K7S A;  3QQ8 B;  4RMA A;  3QHT A;  3V6E B;  2I1J A;  4NAW B;  1V5T A;  2LGD A;  3MTN B;  2J7Q B;  2KWV B;  3R66 C;  4PYZ A;  2KMA A;  2KQ7 A;  4ANW A;  4LDT B;  4HLE A;  3ZRC A;  4WWO A;  3IHP C;  1OEY A;  4MEM A;  2DX5 B;  1WFY A;  4ICV A;  4XZ4 A;  1UBI A;  5JHB A;  4GXB A;  2V1Y A;  2KO3 A;  3ML8 A;  3QA8 A;  4KVG B;  2AYO B;  4BKS D;  1X1M A;  3DDC B;  4A3O A;  2Z59 B;  2RD0 A;  4BKS A;  5JZE B;  3PGE A;  3D32 A;  4ANV A;  2N7E A;  2MX2 A;  3Q3J A;  1P0R A;  2NPT A;  5E6N A;  4EKU A;  2KX0 A;  2LUE A;  5TR5 A;  4FHJ A;  1V81 A;  2ZNV B;  3ZIM A;  1WX7 A;  3KW5 B;  2ZPY A;  2KKC A;  3NOB A;  3ZNI D;  2L7R A;  2N1V A;  1OQY A;  1YD8 U;  2JY6 A;  5IA7 A;  2L3Z A;  2IO0 B;  3DVN U;  3NHE B;  3JW0 X;  1V5O A;  4JGH B;  4IW0 A;  2K6D B;  4FLH A;  3ZNZ B;  1R4N I;  3B1L X;  1WH3 A;  2JT4 B;  4ICU A;  1OTR B;  1C1Y B;  3DCG A;  2RGF A;  3WAO A;  4MEL A;  3UQB A;  4W9C A;  4FN2 A;  4BOZ B;  4F1S A;  2ZEQ A;  2KAN A;  4DHJ D;  4LJP B;  3DBS A;  2KDI A;  2KC1 A;  3C0R B;  4KSL C;  2NS5 A;  1P3Q U;  2IO1 B;  3TIX A;  4HJK A;  2ZZP B;  4TKN A;  1XT9 B;  4XX5 A;  3JSV A;  4DHZ B;  3JSV B;  2LWP A;  3A9J B;  3PT2 B;  3H1U A;  4G50 A;  2WX0 A;  2IY1 B;  3ZLZ A;  3PRE A;  2KTR A;  4F8C B;  2LVO A;  1MG8 A;  2MBB B;  4HCN B;  5D2M B;  3EFU A;  2XK5 B;  3KVF B;  1UBQ A;  2PE9 A;  1R4M I;  3HM6 X;  1UEL A;  4MGK E;  3KYD D;  4W9I A;  4W9G A;  5LXH A;  2J0J A;  1HE8 A;  4WWN A;  3JVZ X;  1ZKH A;  3QAQ A;  3QX1 A;  2IO3 B;  4EZL A;  2KFJ A;  3N32 A;  4JL9 A;  4E74 A;  5L95 C;  4DK5 A;  2OJR A;  2O2V B;  1E8Z A;  4ASW C;  1CMX B;  2DZJ A;  2YVC A;  2EMT A;  4PS3 A;  3WAL A;  5AZF A;  4EZK A;  3PRP B;  4GSW A;  3UGB B;  2MA9 B;  4HWI B;  3R7Q A;  1AAR A;  3A9K A;  2KJ6 A;  2GBR A;  3N3K B;  2MCN B;  5C1Z A;  3KUZ A;  3H9D A;  4M0W B;  1H8C A;  4J6I A;  4MJS B;  2L0T A;  4IWO A;  4I6N B;  2K8C A;  3DOW A;  2NCN A;  3HK0 A;  2PJH A;  3ZRF A;  1WR1 A;  3QJZ A;  4W9L A;  3ZTD A;  1FXT B;  4GOC A;  2ZVN A;  4GDK A;  1E8X A;  2O6V A;  3ALB A;  3OJ4 B;  1WIA A;  3DBH I;  1V86 A;  4IM0 A;  4FUL A;  4IG7 B;  3AUL A;  2ZNV C;  3RT3 B;  2WYQ A;  2BF8 B;  3H7P A;  3QC8 B;  1TGZ B;  3A1Q B;  4M8N A;  2ASQ A;  5FR6 A;  5BO4 B;  1WY8 A;  2BWF A;  1XD3 B;  3M3J A;  4W9J A;  2KOX A;  3L0W B;  2KDB A;  1WF9 A;  1GC7 A;  2PPH A;  1WMH B;  3KYC D;  4DWF A;  3VTW A;  4MH0 E;  4P7I A;  2J0M A;  2MP2 A;  2GOW A;  2IO2 B;  2NPT B;  3BY4 B;  1V6E A;  3I3T B;  3AXC A;  2MP2 B;  4WJP A;  1G6J A;  2K8B A;  2W9N A;  3IBE A;  2KC2 A;  3MHS D;  1D3Z A;  2HJ8 A;  4FA6 A;  1WXA A;  3GOE A;  3VAW A;  4IM2 A;  3PHX B;  2CHW A;  3M95 A;  2BKF A;  3ZVV A;  1EO6 A;  1GJZ A;  3OJ3 A;  4IC7 B;  2BKR B;  3PTF C;  3ZTC A;  1IPG A;  5DPS A;  2LXA A;  1WGD A;  1V80 A;  2AEH A;  2LZ6 A;  3TMP B;  1EF5 A;  3APF A;  2KFK A;  1E5W A;  2G3Q B;  2LGY A;  4ZRJ A;  2FCS A;  4ANX A;  2D10 A;  3AU4 A;  4AJY B;  4GDL B;  3VUW A;  3ZNH B;  4KZ0 A;  3V62 A;  3HIZ A;  2HE7 A;  1GUA B;  2MBE A;  2EMS A;  2V4L A;  2WDT B;  2KJH B;  3DQV A;  3LDZ E;  4KSK C;  2LXC A;  5J17 A;  4B9K A;  3PZD A;  1WGY A;  1J19 A;  3HHM A;  4AWJ A;  3NY5 A;  4CHK A;  1Q5W B;  2KZR A;  4NPN A;  3VQI A;  2N7D A;  3O65 B;  4MSM B;  3X0W A;  2KNB A;  5AEK B;  1SIF A;  3QIJ A;  4NAW A;  2IYD B;  1WXV A;  3KUD B;  3DBR I;  4EEW A;  1VCB A;  1UH6 A;  2ZPN A;  5LLI A;  1E7V A;  3HM3 A;  3TCA A;  2DZK A;  3TBL D;  3PLV A;  2L00 B;  4W9K A;  2NVU I;  4ZRI A;  4MGI E;  2XK5 A;  3Q3F A;  4BKG A;  3H7P B;  4TV3 A;  3WAP A;  3NS8 A;  4FJZ A;  2O6V D;  2NR2 A;  2JXX A;  2BYV E;  1EUV B;  4IM3 A;  2A5U A;  3JYU A;  3QCA A;  3VVW B;  2LI5 A;  2M8S A;  5CHV C;  3RYT A;  1Q1O A;  1WZ3 A;  3SD5 A;  2JZ3 B;  3W1Y A;  4DDI D;  1GNU A;  1P98 A;  3CMM B;  2KDF B;  3P2B A;  2LAS A;  3A33 B;  3DPD A;  3PRM B;  4EUT A;  5LXI B;  2MQJ A;  2DEN B;  4K7U A;  4WJN A;  5J18 A;  2VRR B;  2RSU A;  2JUO A;  4RM8 A;  4W9F A;  1OEY J;  4BBN F;  1A5R A;  4CYE A;  2PE6 B;  4TQ1 A;  1BT0 A;  5E6P A;  2AWT A;  5D7G A;  2C7N B;  5J2R A;  2N9E B;  2KX3 A;  3KH0 A;  3SHQ A;  1K8R B;  3K9P B;  4BKT A;  2CKH B;  4DDG D;  2XBB C;  5L83 A;  2C7M B;  1EF1 A;  5JHA A;  2JRI B;  3OLM D;  4BBN C;  2O6V B;  1UGM A;  1J0G A;  1WGR A;  1IP9 A;  1YX5 B;  3EC8 A;  4A3P A;  3RUL A;  3VH3 B;  2OOB B;  4F7Z A;  5JH5 C;  4W9E A;  4IWP A;  1ISN A;  2L76 A;  1UD7 A;  2M4N A;  4DBG A;  1NBF C;  2GMI C;  2KQS A;  1TZ1 A;  1WMH A;  3S2A A;  4EOY A;  2M0X A;  4JQW C;  4NQL B;  2KD0 A;  1WGG A;  4PYU A;  3VFK A;  2LRU A;  4HXD A;  4ANU A;  1YX6 B;  4NQK E;  1WI0 A;  4URK A;  2NBU A;  1WR6 E;  2JVC A;  2NBW B;  2L05 A;  2L8J A;  3PRZ A;  4JIO U;  4PS8 A;  2K6Q A;  2D07 B;  3A9J A;  3WAN A;  1LQB A;  4TQ0 A;  4HPL B;  2FUH B;  2MLB A;  2DHZ A;  3VH4 B;  3QAR A;  2GBM A;  4HK2 A;  4AUQ C;  4HCP B;  4FAD A;  2FNJ B;  2LJ5 A;  2N4F A;  4NJ7 A;  2FIF A;  4I6L B;  2PEA A;  4GU2 A;  1QZE A;  2GBJ A;  2RR9 A;  2CU1 A;  1KJT A;  2D3G A;  4MSQ B;  3TJP A;  4YL8 A;  2JPH A;  3B0A A;  3ZKJ C;  3T9L A;  3PVL A;  3IVF A;  4KIK B;  2FCN A;  5E6O A;  1KM7 A;  1V9J A;  4HDQ A;  4PS7 A;  5KHQ A;  1E8Y A;  3EEC A;  1WYW B;  4EZJ A;  2KHW B;  2KJR A;  3ZDM C;  4FJY A;  2ZJD A;  1WM3 A;  3TL5 A;  1WXM A;  2IZV B;  1V2Y A;  2MBQ A;  2NBV B;  4ZYN A;  2N1W A;  2C7H A;  2KXJ A;  3APD A;  4KDL B;  2N9X A;  1SGH A;  3N30 A;  1LFD A;  3AI5 A;  5KHO A;  3R7R A;  3L13 A;  2BPS A;  5CTR C;  2N9P C;  3VXW A;  4NNJ B;  2FAZ A;  3UIO B;  1WX9 A;  4MGY E;  4FBJ B;  1WX8 A;  5AZH A;  4EFO A;  2K39 A;  2M17 A;  3L08 A;  5G2N A;  2HTH A;  1Z2M A;  4TUU A;  4AOF A;  4G11 A;  4HPM B;  5HKH A;  5D6J B;  4ZRK A;  2D11 A;  3CF6 E;  3PHW B;  1E8W A;  2GBN A;  3RZF A;  2J0K A;  1T0Y A;  2QHO A;  4IWQ A;  1C3T A;  4OVU A;  1U4A A;  4WWP A;  2G4D B;  3V6C B;  4MGZ E;  1GC6 A;  3IG3 A;  1L7Y A;  2KLG A;  4XC2 A;  3APC A;  3WIM A;  2G4S A;  2ZCB A;  2ZVO A;  4GB9 A;  2LVP A;  3L10 B;  2JRH A;  2JZZ A;  2REX A;  4BOS C;  4W9D A;  2CHZ A;  2ZCC A;  2BYE A;  2G45 B;  2B3A A;  2CS4 A;  1RRB A;  1RFA A;  3B08 A;  4BVU C; 
#chains in the Genus database with same CATH topology
 3AE1 B;  4NY0 A;  3V60 A;  1SE4 A;  3T8M A;  1T3Q A;  2PVG C;  3SDL C;  4ZDV A;  3ZJV A;  5G5H A;  3UIP B;  2KK8 A;  2DZI A;  3NZS A;  2EKE C;  1KOT A;  4XWT A;  2INC C;  2DYO A;  1XLO A;  3NVY A;  3R3M A;  2MWS B;  1WJU A;  4LCD E;  2L52 A;  1QOB A;  3DBL B;  2OED A;  5HHD G;  1TBE A;  1R7S A;  3H7S A;  4P1B C;  5FR3 A;  3NS1 A;  1NDD A;  4M01 A;  3DVG Y;  2WP9 B;  3HRD D;  3A4R A;  1P9D U;  3AE5 B;  3NVW A;  1QOF A;  2DAJ A;  2MRP A;  4RM9 A;  1WE7 A;  4IUM B;  4MT5 A;  4XE0 A;  2K22 A;  1TS4 A;  4KGS A;  3OAW A;  4HVB A;  2KWU B;  5IKC M;  1SF0 A;  2Z0D B;  3DVG X;  4GN1 A;  2AL6 A;  5JHB A;  1WM2 A;  2AQ1 B;  2NTT A;  1KLG D;  1FNV A;  1XQQ A;  2D5G A;  4DHZ E;  3PZ8 A;  1L5P A;  2KVR A;  4FJV B;  4LTU A;  2Z0E B;  1JWA D;  2RDB C;  2KWC A;  3GP7 A;  3RCZ A;  4G3X B;  1P7E A;  3AEB B;  1R4M B;  2W54 A;  4WJQ A;  3PPA A;  2KQ4 X;  3X23 A;  1OQQ A;  3VRB B;  3ZYY X;  4LDT D;  3L4P A;  2K0P A;  3VUX A;  4C80 A;  5IAA C;  4S17 A;  3TEW A;  1VD2 A;  4MH8 A;  2M0A A;  1P1A A;  3ECI A;  1PQS A;  3N1Y C;  3LYY A;  2WLB A;  1NI2 A;  2D2Q A;  3U52 E;  2XEW A;  2V3S A;  2EKI A;  4LNN A;  1VJK A;  4MDK E;  4GDK B;  2LD9 A;  3DWM A;  1JRP A;  2BW2 A;  1E10 A;  2WXM A;  4HPP A;  1RYJ A;  3V6E B;  2CU3 A;  1I4Q A;  2KWV B;  1QF6 A;  4LDT B;  3FIL A;  2MJE A;  1WFY A;  2KO3 A;  4BKS D;  1MVK A;  4L2Y A;  2WXR A;  4XDD A;  2QDF A;  1TKE A;  1GB4 A;  4ZRP A;  4EKU A;  3ZXV A;  3V3X A;  1FNU A;  1V81 A;  1WX7 A;  3NVZ A;  3KW5 B;  3Q2A C;  2ZPY A;  1TY2 A;  2L7R A;  2Y3A A;  1SJH D;  1JWM D;  5IA7 A;  1FNW A;  3JW0 X;  5EE0 A;  2G9H D;  3BK1 A;  2N9K A;  3DCG A;  1T0R C;  4CQN A;  3UQB A;  3RI7 C;  1D5M C;  4DHJ D;  4YTM B;  1SB3 C;  2KDI A;  4OW0 A;  2KC1 A;  4KSL C;  5LNK 1;  1P3Q U;  1TYG B;  1KFY B;  1VRA B;  2QCZ A;  3H1U A;  3PRE A;  2LVO A;  1DOI A;  4D2K A;  4HCN B;  1AN8 A;  2XK5 B;  1UBQ A;  4RGN A;  1R4M I;  3HM6 X;  4NJC A;  5LXH A;  1ZKH A;  4P1C C;  2IO3 B;  2KFJ A;  1WXQ A;  1E8Z A;  2O2V B;  3PZ7 A;  4GSW A;  1K50 A;  4HWI B;  3P42 A;  2GBR A;  3N3K B;  2MCN B;  3R2I A;  1LO5 D;  4M0W B;  1H8C A;  2L0T A;  4IWO A;  4I6N B;  2K8C A;  3ZRF A;  4W9L A;  2ZVN A;  4GDK A;  4DXG A;  1SSN A;  1YN5 A;  1WIA A;  4IM0 A;  2VH1 A;  3AUL A;  4M02 A;  1Q10 A;  1WWT A;  2ASQ A;  1NEK B;  2GI9 A;  3L0W B;  2IGD A;  3VTW A;  2MP2 A;  2IO2 B;  1T6B X;  1FCC C;  3BY4 B;  3I3T B;  3U2S C;  2K8B A;  2W9N A;  3IBE A;  4A6Q A;  4RGT A;  3EFC A;  1V1P A;  3SR6 A;  1IBX A;  2BVC A;  4IC7 B;  1ZDV A;  2D3B A;  4LNI A;  2LGY A;  1BUI C;  1OFF A;  4GDL B;  4KZ0 A;  3HIZ A;  4IKG A;  3RNG C;  1GUA B;  2WDT B;  3DQV A;  4KGT A;  4K3C A;  4B9K A;  1FXA A;  1MFW A;  3PZD A;  1KH0 A;  3X0W A;  2INP E;  5AEK B;  2IYD B;  1WXV A;  3HM3 A;  2M19 A;  2DZK A;  2NVU I;  2H88 B;  4TV3 A;  2O6V D;  2KDM A;  2JXX A;  1HTO A;  4NAM A;  3R8B A;  3QCA A;  3VVW B;  1Q1O A;  1WZ3 A;  3SD5 A;  2JZ3 B;  1WRI A;  1GNU A;  3DHH C;  2WQY B;  1NYR A;  3CMM B;  2LAS A;  3A33 B;  4EUT A;  4WJN A;  3B9J A;  5H8Y E;  4W9F A;  1PGA A;  2PTL A;  4H2A A;  2WXI A;  2DLB A;  1K8R B;  1UF0 A;  2CKH B;  2XBB C;  5L83 A;  3V05 A;  1WGR A;  1YX5 B;  3DBR B;  3BYT B;  2OOB B;  1F2R I;  3AE4 B;  2WXJ A;  2Y5P A;  1C9F A;  2LJI A;  2L76 A;  2M4N A;  4GLS C;  2GMI C;  4EOY A;  1WGG A;  3VFK A;  4HXD A;  4ANU A;  1WI0 A;  2NBU A;  1WR6 E;  2JVC A;  3I57 A;  3WAN A;  1LQB A;  2INN E;  2LGS A;  4HPL B;  4ACF A;  2D3C A;  4YSY B;  3HVZ A;  4AUQ C;  4HCP B;  2HJ1 A;  2CU1 A;  2D3G A;  1MI0 A;  3GE8 C;  3ZKJ C;  3AE8 B;  3P4Q B;  2KN4 A;  1KM7 A;  2HDE A;  2ON8 A;  4HDQ A;  5KHQ A;  1E8Y A;  1EM7 A;  2KJR A;  1JML A;  2CJN A;  3TL5 A;  1WM3 A;  1WXM A;  2IZV B;  2MBQ A;  4EE2 A;  2W55 A;  4KDL B;  2BT6 A;  3P4P B;  4REZ A;  3N30 A;  5KHO A;  3SEB A;  1KTK A;  4NNJ B;  3AMZ A;  3Q8F A;  4MGY E;  1IUE A;  3L08 A;  5G2N A;  1WSP A;  2XNA C;  2V4I B;  5HKH A;  2ZW0 A;  2WHI A;  3NZ3 A;  2J0K A;  4HRS A;  3WCQ A;  4RGO S;  2G4D B;  1K53 A;  2KLG A;  3CIR B;  4RNA A;  2ZCB A;  2LVP A;  1VZ6 A;  1CZP A;  2JRH A;  1PYW D;  2QMT A;  3MJ5 A;  1I42 A;  4BVU C;  3K9O B;  3B2G A;  3VDZ A;  1J7C A;  1E7U A;  1KLV A;  4YTN B;  3ZNG C;  1GG3 A;  4WJO A;  1LXD A;  4RH6 A;  2WXH A;  4LJO B;  3HVD A;  4E71 A;  4S0R A;  5DPR A;  4HDO A;  2K25 A;  5BYQ A;  2RDH A;  5EDS A;  1FO4 A;  4ITK A;  5D94 A;  3E56 A;  1CQV A;  3VTV A;  4WAA A;  3GZN I;  3Q3O C;  2MJ3 A;  5C23 A;  2L0F A;  1I35 A;  2KN5 A;  2LFI A;  4WQO B;  3IAS 1;  1PGX A;  1I4X A;  2DYM A;  5CX3 A;  1EWY C;  2UYZ B;  1ET9 A;  1TTN A;  3UQA A;  2W3R A;  4MJS A;  2BYF A;  2R2Q A;  2UWQ A;  3RD2 A;  3ZW3 A;  4K7W A;  1KF6 B;  3DHI C;  4XDC A;  4OVV A;  3WA0 A;  1I4G A;  1FM0 D;  4GMV A;  3DBL I;  2K8H A;  3MHZ A;  2H89 B;  1RAX A;  1NYQ A;  5H92 C;  4IDI A;  2LVQ A;  3CST A;  3AU5 A;  2KAC A;  3ZO5 B;  5DPT A;  2GBK A;  1WE6 A;  2C60 A;  3Q8C A;  4E3C A;  3KLS X;  4AP4 C;  4HEA 1;  2YLM A;  1LM8 B;  4GDL A;  3LJ3 A;  3M62 B;  2WWZ A;  2KFK B;  3U7D A;  2R61 A;  1F9J A;  2QSD A;  2FID A;  2ICI A;  1R4N B;  3PLU A;  3A9K B;  3VUY A;  3QK0 A;  4US8 A;  4AQ7 A;  4KKJ A;  1FPY A;  1ZP0 B;  5CHW A;  4K7S A;  3QQ8 B;  4RMA A;  1YQ3 B;  2QC8 A;  4NZL B;  1YQ4 B;  2D3A A;  2KQ7 A;  1JWB D;  2N7J A;  3Q8B A;  1X1M A;  3Q3M C;  5JZE B;  3D32 A;  2N7E A;  2NPT A;  5E6N A;  4WQM A;  2KKC A;  3NUH B;  2N1V A;  1K51 A;  2L3Z A;  2RMM A;  3H8H A;  3NHE B;  4IW0 A;  1RM6 C;  2JT4 B;  3B1L X;  1OTR B;  1C1Y B;  1A70 A;  2MEK A;  1E0Z A;  4W9C A;  4FN2 A;  4YXD B;  4YSX B;  2KAN A;  1MHX A;  3RNC C;  1XCT L;  1ZXH A;  3C0R B;  4N59 A;  4C7Z A;  1UUP A;  1KLU D;  1D5X C;  1V97 A;  1WGK A;  4DQO C;  1WYG A;  3PT2 B;  4G50 A;  2NTS A;  4F8C B;  1IBX B;  3BII D;  4OZA A;  1UEL A;  3KYD D;  5MPO A;  4WWN A;  3QAQ A;  3QX1 A;  3N32 A;  4DK5 A;  1FRD A;  4KGR A;  1AYF A;  1CMX B;  4M0W A;  3WAL A;  5AZF A;  3UGB B;  1AAR A;  3A9K A;  2LUM A;  3H9D A;  1LGR A;  4MJS B;  3HK0 A;  3DOW A;  2NCN A;  3QJZ A;  4DXF A;  4GOC A;  1JWU D;  4YSZ B;  1HXY D;  3R2T A;  3VR8 B;  4USA A;  4C00 A;  3TEZ A;  2O6V A;  4IG7 B;  2WYQ A;  3QC8 B;  3H7P A;  1TGZ B;  4M8N A;  5FR6 A;  2BWF A;  4W9J A;  3M3J A;  4P16 A;  2KOX A;  1JW9 D;  1WF9 A;  3KYC D;  4DWF A;  2K5P A;  4MH0 E;  4P7I A;  2J0M A;  2NPT B;  4WJP A;  1G6J A;  3BYY B;  2KC2 A;  4MAC A;  4FA6 A;  3GOE A;  4IM2 A;  3PHX B;  5FK9 C;  3ZTC A;  1V80 A;  5G5G A;  3TMP B;  2LZ6 A;  1EF5 A;  2WXL A;  3AEG B;  2KFK A;  4LK0 M;  3DWG C;  2D10 A;  3GE3 C;  3AU4 A;  3VUW A;  3P4S B;  3V62 A;  1CJE A;  3N9Y C;  2EMS A;  2V4L A;  2KJH B;  2E3T A;  1E7P B;  1FD6 A;  4C56 C;  3HHM A;  4CHK A;  1JQ4 A;  1NEN B;  1AW7 A;  4MSM B;  1I7H A;  1SIF A;  2JU6 X;  3KUD B;  4OZC A;  3DBR I;  1VCB A;  1UH6 A;  2ZPN A;  1UNS A;  5LLI A;  1E7V A;  3TBL D;  3PLV A;  3I63 C;  4IOI E;  4MGI E;  1V8C A;  2XK5 A;  2YEP F;  3Q3F A;  3H7P B;  4BKG A;  3ZJU A;  2NR2 A;  3JYU A;  2M8S A;  5CHV C;  3RYT A;  3W1Y A;  4DDI D;  2KDF B;  2KYW A;  3P2B A;  5LXI B;  4K7U A;  1DYQ A;  1ET6 A;  2VRR B;  4ZOH C;  2JUO A;  1A5R A;  1QT9 A;  4YT0 B;  5D7G A;  1C78 A;  1DGJ A;  1MJD A;  4BKT A;  4RFB A;  2C7M B;  4HKZ E;  4BBN C;  3OLM D;  5JHA A;  2KMM A;  2O6V B;  1YMH E;  1EWC A;  3BVZ A;  4A3P A;  3RUL A;  2LMC A;  3VH3 B;  1YN4 A;  4IWP A;  3PO0 A;  1NBF C;  4K3B A;  4A55 A;  3AE3 B;  2BTE A;  2LRU A;  1QOA A;  1FXI A;  3PRZ A;  5HFY A;  4JIO U;  4RCO A;  2K6Q A;  2D07 B;  4TQ0 A;  2MLB A;  4XWW A;  2M56 B;  2X38 A;  2FIF A;  3U7Z A;  4GU2 A;  2RR9 A;  4YL8 A;  4OHJ A;  2JPH A;  3B0A A;  2K3U A;  4R3D A;  3PVL A;  5E6O A;  3AEC B;  1V9J A;  4EZJ A;  3RFZ B;  1T5X D;  3BK2 A;  5T8I A;  3SFD B;  4ZYN A;  1TKG A;  3NJT A;  2WS3 B;  5JXV A;  1SGH A;  2DBY A;  3KQ4 A;  3AED B;  3AEA B;  3VXW A;  2E6X A;  2N9P C;  2FAZ A;  3UIO B;  1WX8 A;  5AZH A;  2M17 A;  2V3P A;  2OHF A;  2HTH A;  2N9L A;  2D11 A;  3CF6 E;  3PHW B;  4WWM A;  3RZF A;  2QHO A;  1C79 A;  5AUK A;  1GC6 A;  3IG3 A;  4PT5 A;  3LB8 C;  2G4S A;  2RPV A;  3Q6B A;  4A9A A;  4BOS C;  1XLQ A;  4W9D A;  2CHZ A;  1HTQ A;  2CS4 A;  3B08 A;  5FKA C;  4II2 B;  1JAL A;  2HTM E;  2WXF A;  3W1S C;  1ZW7 A;  3RUI B;  2BB5 A;  3EHV A;  3ZUN A;  2MBO A;  3L16 A;  1EU4 A;  1Z5S B;  2WX1 A;  4GGQ A;  1FRR A;  3NRZ A;  1ZXI A;  2I38 A;  1BML C;  2WNM A;  3U8Z A;  1I4R A;  3BIN A;  1WJ4 A;  2Y5B B;  2C9W B;  1Y8R C;  5C2T B;  4BZA A;  1D5Z C;  2KAJ A;  3PSE B;  1M94 A;  1NI3 A;  2KMC A;  3RNE C;  1T0S C;  1UGJ A;  4A90 A;  2Q5W D;  1QOG A;  3DVN V;  3ZQ4 A;  1UWX A;  1L2N A;  1P7F A;  4A20 A;  4II3 B;  1N5X A;  2M1M A;  3CSF A;  4UDU C;  2DYB A;  4L23 A;  4G0N B;  3A4S C;  3SU8 X;  1WJ6 A;  1YIW A;  1WZ0 A;  4KV2 A;  2AL3 A;  3IAM 1;  3BWU D;  3C19 A;  1FMA D;  2HD5 B;  1WJN A;  3M63 B;  3UF8 A;  3ML9 A;  1IYF A;  4X57 B;  3A1Q A;  1H4R A;  2JF5 A;  4DHJ B;  3IFW B;  1YQB A;  3Q8A A;  1Q0W B;  2C5L C;  2LGX A;  1FIQ A;  3VHT C;  1QKZ A;  1HZ6 A;  3ZJT A;  4K1R B;  2CR5 A;  2A4Z A;  3KUC B;  4CO7 A;  3PS6 A;  1TKY A;  3B2F A;  2WXG A;  2KTR B;  1SE2 A;  2FCQ A;  3IT6 B;  2BWE S;  1OGW A;  2KLC A;  2MSE D;  1XCQ L;  2KTF A;  1ZUD 2;  3RZW C;  3V61 A;  3VRA B;  2KDE B;  4MM3 B;  2K1F A;  2IGG A;  3PV1 A;  4B95 A;  3ONS A;  4P6V F;  4AS1 A;  2AQ2 B;  4BAX A;  4KDI C;  3QWZ B;  2PKO A;  2JZP A;  3NG0 A;  3RNB C;  1ZGU B;  2BGF A;  2IY0 B;  2KWD A;  4NAW B;  2VZK B;  4PYZ A;  1TT5 B;  2KMA A;  2PMV A;  3RNF C;  3ZRC A;  3IHP C;  1OEY A;  4MEM A;  4ICV A;  3I9V 1;  2V1Y A;  3QA8 A;  4KVG B;  4A3O A;  2RD0 A;  4BKS A;  2N0S B;  3PGE A;  2MHJ A;  2PW9 A;  3Q3J A;  1FCL A;  2NMQ A;  4KKI A;  5TR5 A;  3RNA C;  3ZIM A;  4US9 A;  1QLB B;  1J7A A;  1OQY A;  2JY6 A;  4O1N A;  1YJI A;  3DVN U;  5EE3 A;  4FLH A;  1FFV A;  3N20 C;  1E6E B;  1ZPS A;  2WDQ B;  1CK1 A;  2RGF A;  3O13 A;  4BOZ B;  1VZ8 A;  4F1S A;  3AE9 B;  2ZEQ A;  1PDX A;  3MC0 B;  3DBS A;  4LJP B;  5D3D A;  3TIX A;  4HJK A;  4TKN A;  4XX5 A;  4DHZ B;  3N1Z C;  1RFK A;  2LWP A;  3ETR A;  3Q3N C;  4QAY A;  3FKY A;  2IY1 B;  2KTR A;  1MG8 A;  2MBB B;  5D2M B;  4LLG M;  4W9I A;  4W9G A;  1HE8 A;  1L0X B;  4KX6 B;  1YN3 A;  4E74 A;  2OJR A;  1D6E C;  3FC4 A;  4ASW C;  2LEK A;  1JWS D;  5C3J B;  2DZJ A;  2YVC A;  3BVG A;  2MA9 B;  3R7Q A;  3EA6 A;  5C1Z A;  1GPX A;  3KUZ A;  1ZOY B;  5EE9 A;  4J6I A;  2JYE A;  2PLP A;  1FXT B;  1E8X A;  3OWE B;  5BMG A;  1VDV A;  3ALB A;  3OJ4 B;  1MHH E;  1V86 A;  4C4V A;  4FUL A;  3RT3 B;  1EU3 A;  2B76 B;  1I4H A;  2BF8 B;  2UU7 A;  1IGD A;  1TS2 A;  3A1Q B;  5BO4 B;  1QQR A;  1TS3 A;  1BXT A;  2PPH A;  1WMH B;  2J52 A;  4LNK A;  1KRH A;  2LHD A;  3MHS D;  1WXA A;  3VAW A;  4Q2J A;  3ZVV A;  2BKF A;  3OJ3 A;  3UI3 A;  3PTF C;  2AEH A;  2LXA A;  1D4B A;  3C8Y A;  2WXO A;  1E5W A;  3AM9 A;  2YEP B;  2G3Q B;  4ZRJ A;  3T3O A;  4WUR A;  2TSS A;  2MBE A;  4KSK C;  2LXC A;  1WGY A;  1J19 A;  1Q5W B;  2KZR A;  4NPN A;  2N7D A;  1XLN A;  3O65 B;  2KNB A;  1N6Z A;  4ZRQ A;  4EEW A;  1SE3 A;  4HKQ A;  1HA5 A;  1DOY A;  3FAH A;  3ZXR A;  3MP9 A;  4C4V B;  3VR9 B;  2L00 B;  4W9K A;  4ZRI A;  3WAP A;  5TSS A;  4YWG G;  2BYV E;  3MC8 A;  2KVZ A;  1C76 A;  1F77 A;  1VLB A;  1SBB B;  3PRM B;  3RMK C;  2DEN B;  4WH4 A;  2RSU A;  4RM8 A;  1OEY J;  4BBN F;  4CYE A;  2PE6 B;  4TQ1 A;  1BT0 A;  5E6P A;  2AWT A;  2X8X X;  2KX3 A;  2CJO A;  3KH0 A;  1SEB D;  3N1X C;  1EF1 A;  2JRI B;  1STE A;  1UGM A;  4FXC A;  2QJL A;  2IPK D;  4F7Z A;  5JH5 C;  4OVZ A;  4OZB A;  1YOV B;  1UD7 A;  1F0Z A;  1TY0 A;  1WMH A;  3S2A A;  2JWU A;  2M0X A;  4PYU A;  4ZHP A;  1PFD A;  4URK A;  2NBW B;  4A8X C;  1T0Q C;  5BYS A;  3A9J A;  1GB1 A;  3AB5 A;  5IO9 A;  2FUH B;  2ZW1 A;  2DHZ A;  2GBM A;  1L0Y B;  2LJ5 A;  3ZGZ A;  1TZO A;  2PEA A;  5AUI A;  2GBJ A;  4MSQ B;  3TJP A;  1FFU A;  3T9L A;  2WXQ A;  1SIJ A;  1ROE A;  1TJE A;  2AX5 A;  4M00 A;  4ARC A;  2N1W A;  2KXJ A;  3APD A;  3I5J C;  4J3O D;  1LFD A;  3R7R A;  3MFG A;  3L13 A;  4ZHO A;  5CTR C;  3P4R B;  2IJ0 A;  4FBJ B;  2VH2 A;  1L4D B;  2K39 A;  1Z2M A;  4TUU A;  5BMI A;  1E8W A;  2GBN A;  3KWV A;  2WU5 B;  4IWQ A;  4WWP A;  3MC9 A;  3APC A;  2JXT A;  3WIM A;  4N58 A;  1IGC A;  2BYT A;  3KWL A;  2BS2 B;  3L10 B;  2REX A;  1K52 A;  2GRI A;  1HZ5 A;  1JRU A;  3DDC B;  4MM3 A;  4ZYS A;  1C77 A;  2MJD A;  1E90 A;  1UZX B;  3ABV B;  4WIP A;  1MPE A;  1XEE A;  4DXA B;  2RPQ A;  4M8M A;  3W1S A;  1L6V A;  4JWU C;  4L1B A;  2R2O A;  2ACZ B;  3W9C B;  4C7Y A;  2MW5 A;  4KZC A;  4RF0 A;  3DHG C;  3MJW A;  2BB6 A;  3L54 A;  1J8C A;  3ZDT A;  1SE9 A;  3W5V B;  4AJW A;  3NZU A;  1WXS A;  1FEH A;  1N61 A;  1XF5 L;  3U30 A;  5IOI A;  2AQ3 B;  2V0G A;  1YJ1 A;  4WAF A;  3U4E G;  1WGH A;  3Q8E A;  3H6N A;  2FCM A;  1WRD B;  2L32 A;  2WXP A;  2LRW A;  1S1Q B;  2J42 A;  2QEJ C;  2FE8 A;  1F52 A;  4FHK A;  4W9H A;  1DOX A;  1N62 A;  1L6U A;  3AN1 A;  3RN9 C;  5HI1 A;  4N9F 4;  4GIV A;  1L0V B;  5E6J A;  2CHX A;  2MBH A;  4B6W A;  4XYC A;  3VTU A;  1NVI D;  4JLC A;  4K81 A;  3AEE B;  5DPW A;  4B0M A;  2IDY A;  1S3S G;  3AV8 A;  4NJ6 A;  1V49 A;  5DCN A;  2BQQ A;  2V9H A;  5CHF A;  4JE3 B;  4JWS C;  3ENE A;  2K9X A;  2DAF A;  5AZG A;  4I6P A;  3GB1 A;  5GMV A;  1RLF A;  4KIK A;  2IND C;  5BMH A;  3IT4 B;  4BFR A;  2O2V A;  1YJJ A;  2JWZ A;  3UIN B;  5G55 A;  2L1A A;  2IBI B;  3L17 A;  2I1K A;  3WAM A;  2JQR B;  2DZM A;  3EGR A;  1C4A A;  3QHT A;  2EEL A;  2I1J A;  1B1Z A;  1V5T A;  2LGD A;  2RDG A;  3MTN B;  2J7Q B;  1J7B A;  3R66 C;  4ANW A;  4HLE A;  5IP4 D;  2SEB D;  4WWO A;  2DX5 B;  3RPF C;  2Z8L A;  4XZ4 A;  1UBI A;  4GXB A;  3ML8 A;  2AYO B;  3TSS A;  2Z59 B;  3GZN B;  1M4V A;  3P1M A;  4ANV A;  2MX2 A;  1P0R A;  1F1H A;  1TS5 A;  3W2D A;  2KX0 A;  3T3N A;  2LUE A;  4FHJ A;  2ZNV B;  1YNT E;  2JYT A;  2OJW A;  3NOB A;  3AE7 B;  3ZNI D;  5EE1 A;  1YD8 U;  1V1P B;  2WU2 B;  2IO0 B;  2GLS A;  1V5O A;  3P63 A;  4JGH B;  2VZK D;  2K6D B;  3ZNZ B;  1R4N I;  1WH3 A;  4ICU A;  2IGH A;  3Q69 A;  3WAO A;  4MEL A;  2WXK A;  1E9M A;  4PK1 A;  2NS5 A;  1N63 A;  1PUT A;  2FUG 1;  2IO1 B;  2XN9 C;  3SFE B;  2ZZP B;  1XT9 B;  3JSV A;  1I4P A;  3JSV B;  3A9J B;  3CWI A;  4RGM A;  2KT7 A;  2WX0 A;  3ZLZ A;  2V3N A;  3EFU A;  3KVF B;  1UWM A;  2PE9 A;  1VR9 A;  1RWS A;  4MGK E;  3NVV A;  3AEF B;  3GS2 A;  2J0J A;  2Y5C A;  3JVZ X;  4EZL A;  4JL9 A;  2BS4 B;  5L95 C;  1GOZ A;  2JSV X;  3TUO A;  2EMT A;  4PS3 A;  4EZK A;  3J9C A;  3PRP B;  5HG2 A;  3HUI A;  1PGB A;  2KJ6 A;  1QIL A;  2PIA A;  1V1O A;  1HEZ E;  2PJH A;  1WR1 A;  3ZTD A;  2QIE B;  2QIL A;  1TIF A;  4RF1 A;  3OG5 A;  3DBH I;  1XO3 A;  2ZNV C;  1C4P A;  3FIL B;  1GAQ B;  1WY8 A;  1XD3 B;  2KDB A;  1GC7 A;  3TEY A;  2GOW A;  1V6E A;  3AXC A;  2MP2 B;  1D3Z A;  2HJ8 A;  2GB1 A;  3AE6 B;  4JPS A;  2CHW A;  3M95 A;  1GJZ A;  1EO6 A;  2BKR B;  1IPG A;  5DPS A;  1WGD A;  1ZDX A;  3APF A;  2SAK A;  2WDV B;  4TSS A;  3BZD B;  3TEX A;  2FCS A;  4ANX A;  4AJY B;  3ZNH B;  4HJG E;  4XGA B;  2HE7 A;  3LDZ E;  3E9S A;  1C4C A;  1ZE3 D;  4LNO A;  5J17 A;  2ONQ A;  2FBW B;  5GXG B;  4AWJ A;  3NY5 A;  3VQI A;  4ARI A;  4YTP B;  3AE2 B;  4TMA B;  3QIJ A;  2DWQ A;  4NAW A;  2MH7 A;  2LHE A;  3TCA A;  4JX1 C;  3NS8 A;  4FJZ A;  5D3I B;  1EUV B;  4IM3 A;  2A5U A;  2LI5 A;  1ESF A;  1ENF A;  1P98 A;  3AH7 A;  3DPD A;  2WXN A;  2MQJ A;  3Q14 C;  5J18 A;  2G1E A;  2C7N B;  5J2R A;  2N9E B;  1L4Z B;  3SHQ A;  1XLP A;  3K9P B;  1OQR A;  4DDG D;  1AWD A;  2J53 A;  2BS3 B;  2PVO D;  1J0G A;  1IP9 A;  3EC8 A;  4W9E A;  1SXT A;  2BBC A;  1ISN A;  4DBG A;  2KQS A;  1F2R C;  1TZ1 A;  4B0E A;  2W3S A;  3EUB 2;  3BVM A;  2KD0 A;  4JQW C;  4NQL B;  2L83 A;  1YX6 B;  4NQK E;  3URY A;  5IN7 A;  2L05 A;  2L8J A;  4PS8 A;  3VH4 B;  3QAR A;  4HK2 A;  2WGS A;  4FAD A;  2FNJ B;  2N4F A;  4NJ7 A;  2W82 A;  4I6L B;  1QZE A;  1KJT A;  2I2Y A;  1JRO A;  3IVF A;  4KIK B;  2FCN A;  1JCK B;  1HQR D;  2DNF A;  4PS7 A;  3EEC A;  1WYW B;  2LGI A;  2KHW B;  3ZDM C;  4FJY A;  2ZJD A;  1B9R A;  1Y56 A;  1XXG A;  1V2Y A;  1N60 A;  2NBV B;  2C7H A;  2J4X A;  3W5U B;  2N9X A;  1MG4 A;  3AI5 A;  3DBH B;  4HRO A;  5BYR A;  2BPS A;  3LXF A;  3IXS A;  1SJE D;  1WX9 A;  4EFO A;  5I4D A;  1VZ7 A;  4AOF A;  4G11 A;  4HPM B;  5D6J B;  4ZRK A;  2WDR B;  1T0Y A;  1C3T A;  4LNF A;  4OVU A;  1U4A A;  4N6E B;  3V6C B;  2JX5 A;  4MGZ E;  1L7Y A;  4XC2 A;  2ZVO A;  1N5W A;  4GB9 A;  2JZZ A;  1ACC A;  2ZCC A;  2BYE A;  2G45 B;  2B3A A;  1RRB A;  1RFA A; 
#chains in the Genus database with same CATH homology
 3K9O B;  4II2 B;  3VDZ A;  4MM3 A;  3W1S C;  4NY0 A;  1E7U A;  1ZW7 A;  3V60 A;  1KLV A;  1E90 A;  1UZX B;  3RUI B;  3EHV A;  3T8M A;  3ZNG C;  4DXA B;  3ZUN A;  1GG3 A;  4WJO A;  3SDL C;  2RPQ A;  4ZDV A;  1LXD A;  2MBO A;  3L16 A;  4M8M A;  3W1S A;  3UIP B;  4LJO B;  2KK8 A;  4E71 A;  2DZI A;  1Z5S B;  2R2O A;  2WX1 A;  3NZS A;  4GGQ A;  2EKE C;  1KOT A;  2MW5 A;  4KZC A;  3MJW A;  3L54 A;  5DPR A;  1J8C A;  2DYO A;  4HDO A;  3ZDT A;  2K25 A;  3R3M A;  2MWS B;  1SE9 A;  1WJU A;  4AJW A;  4LCD E;  3U8Z A;  3NZU A;  1WXS A;  3BIN A;  5EDS A;  1WJ4 A;  5D94 A;  3VTV A;  2Y5B B;  3U30 A;  2C9W B;  1TBE A;  4WAA A;  1Y8R C;  1YJ1 A;  3H7S A;  3GZN I;  1WGH A;  5C23 A;  3PSE B;  2L0F A;  1M94 A;  1NDD A;  1I35 A;  3DVG Y;  2KMC A;  2KN5 A;  3H6N A;  2FCM A;  1WRD B;  1P9D U;  3A4R A;  4WQO B;  2LRW A;  1S1Q B;  5CX3 A;  2DYM A;  2DAJ A;  2MRP A;  4RM9 A;  1WE7 A;  4IUM B;  2UYZ B;  1TTN A;  3DVN V;  3UQA A;  4W9H A;  4FHK A;  1L2N A;  4A20 A;  4II3 B;  4MJS A;  2M1M A;  3OAW A;  3CSF A;  2BYF A;  2DYB A;  2R2Q A;  4G0N B;  2UWQ A;  3RD2 A;  3A4S C;  3SU8 X;  4HVB A;  1WJ6 A;  1YIW A;  1WZ0 A;  2KWU B;  2AL3 A;  4K7W A;  4KV2 A;  3ZW3 A;  4N9F 4;  2Z0D B;  3DVG X;  4GN1 A;  2AL6 A;  2HD5 B;  1WM2 A;  4GIV A;  1WJN A;  4OVV A;  3M63 B;  3UF8 A;  4GMV A;  3ML9 A;  3WA0 A;  1IYF A;  3DBL I;  2CHX A;  2K8H A;  4X57 B;  3A1Q A;  2MBH A;  1XQQ A;  1H4R A;  2JF5 A;  4DHJ B;  3IFW B;  4DHZ E;  1YQB A;  1RAX A;  4B6W A;  4FJV B;  2KVR A;  1Q0W B;  2C5L C;  2LGX A;  2Z0E B;  3VTU A;  3VHT C;  2LVQ A;  2KWC A;  4JLC A;  3RCZ A;  4K81 A;  3CST A;  1JRU A;  2CR5 A;  4G3X B;  2A4Z A;  3KUC B;  4K1R B;  4CO7 A;  5DPW A;  3PS6 A;  3AU5 A;  1S3S G;  3ZO5 B;  4NJ6 A;  4WJQ A;  1V49 A;  2KTR B;  5DCN A;  2FCQ A;  2GBK A;  3PPA A;  5DPT A;  1WE6 A;  2BWE S;  1OGW A;  2C60 A;  3X23 A;  2KLC A;  2MSE D;  4LDT D;  4E3C A;  5CHF A;  4AP4 C;  2KTF A;  3ENE A;  2DAF A;  3RZW C;  3V61 A;  2YLM A;  1LM8 B;  5IAA C;  5AZG A;  3VUX A;  4GDL A;  4I6P A;  3LJ3 A;  1VD2 A;  5GMV A;  1RLF A;  2KDE B;  3M62 B;  2WWZ A;  2KFK B;  1P1A A;  3U7D A;  3ECI A;  1PQS A;  4KIK A;  2K1F A;  1F9J A;  3PV1 A;  4B95 A;  2FID A;  4BFR A;  2O2V A;  3ONS A;  3PLU A;  1NI2 A;  2D2Q A;  2JWZ A;  3A9K B;  3QK0 A;  3VUY A;  4KDI C;  3UIN B;  2XEW A;  1I42 A;  5G55 A;  2V3S A;  2IBI B;  3L17 A;  3QWZ B;  2I1K A;  3WAM A;  4MDK E;  4GDK B;  2LD9 A;  1ZGU B;  2DZM A;  2BGF A;  5CHW A;  2IY0 B;  4K7S A;  3QQ8 B;  4RMA A;  3QHT A;  3V6E B;  2I1J A;  4NAW B;  1V5T A;  2LGD A;  3MTN B;  2J7Q B;  2KWV B;  3R66 C;  4PYZ A;  2KMA A;  2KQ7 A;  4ANW A;  4LDT B;  4HLE A;  3ZRC A;  4WWO A;  3IHP C;  1OEY A;  4MEM A;  2DX5 B;  1WFY A;  4ICV A;  4XZ4 A;  1UBI A;  5JHB A;  4GXB A;  2V1Y A;  2KO3 A;  3ML8 A;  3QA8 A;  4KVG B;  2AYO B;  4BKS D;  1X1M A;  3DDC B;  4A3O A;  2Z59 B;  2RD0 A;  4BKS A;  5JZE B;  3PGE A;  3D32 A;  4ANV A;  2N7E A;  2MX2 A;  3Q3J A;  1P0R A;  2NPT A;  5E6N A;  4EKU A;  2KX0 A;  2LUE A;  5TR5 A;  4FHJ A;  1V81 A;  2ZNV B;  3ZIM A;  1WX7 A;  3KW5 B;  2ZPY A;  2KKC A;  3NOB A;  3ZNI D;  2L7R A;  2N1V A;  1OQY A;  1YD8 U;  2JY6 A;  5IA7 A;  2L3Z A;  2IO0 B;  3DVN U;  3NHE B;  3JW0 X;  1V5O A;  4JGH B;  4IW0 A;  2K6D B;  4FLH A;  3ZNZ B;  1R4N I;  3B1L X;  1WH3 A;  2JT4 B;  4ICU A;  1OTR B;  1C1Y B;  3DCG A;  2RGF A;  3WAO A;  4MEL A;  3UQB A;  4W9C A;  4FN2 A;  4BOZ B;  4F1S A;  2ZEQ A;  2KAN A;  4DHJ D;  4LJP B;  3DBS A;  2KDI A;  2KC1 A;  3C0R B;  4KSL C;  2NS5 A;  1P3Q U;  2IO1 B;  3TIX A;  4HJK A;  2ZZP B;  4TKN A;  1XT9 B;  4XX5 A;  3JSV A;  4DHZ B;  3JSV B;  2LWP A;  3A9J B;  3PT2 B;  3H1U A;  4G50 A;  2WX0 A;  2IY1 B;  3ZLZ A;  3PRE A;  2KTR A;  4F8C B;  2LVO A;  1MG8 A;  2MBB B;  4HCN B;  5D2M B;  3EFU A;  2XK5 B;  3KVF B;  1UBQ A;  2PE9 A;  1R4M I;  3HM6 X;  1UEL A;  4MGK E;  3KYD D;  4W9I A;  4W9G A;  5LXH A;  2J0J A;  1HE8 A;  4WWN A;  3JVZ X;  1ZKH A;  3QAQ A;  3QX1 A;  2IO3 B;  4EZL A;  2KFJ A;  3N32 A;  4JL9 A;  4E74 A;  5L95 C;  4DK5 A;  2OJR A;  2O2V B;  1E8Z A;  4ASW C;  1CMX B;  2DZJ A;  2YVC A;  2EMT A;  4PS3 A;  3WAL A;  5AZF A;  4EZK A;  3PRP B;  4GSW A;  3UGB B;  2MA9 B;  4HWI B;  3R7Q A;  1AAR A;  3A9K A;  2KJ6 A;  2GBR A;  3N3K B;  2MCN B;  5C1Z A;  3KUZ A;  3H9D A;  4M0W B;  1H8C A;  4J6I A;  4MJS B;  2L0T A;  4IWO A;  4I6N B;  2K8C A;  3DOW A;  2NCN A;  3HK0 A;  2PJH A;  3ZRF A;  1WR1 A;  3QJZ A;  4W9L A;  3ZTD A;  1FXT B;  4GOC A;  2ZVN A;  4GDK A;  1E8X A;  2O6V A;  3ALB A;  3OJ4 B;  1WIA A;  3DBH I;  1V86 A;  4IM0 A;  4FUL A;  4IG7 B;  3AUL A;  2ZNV C;  3RT3 B;  2WYQ A;  2BF8 B;  3H7P A;  3QC8 B;  1TGZ B;  3A1Q B;  4M8N A;  2ASQ A;  5FR6 A;  5BO4 B;  1WY8 A;  2BWF A;  1XD3 B;  3M3J A;  4W9J A;  2KOX A;  3L0W B;  2KDB A;  1WF9 A;  1GC7 A;  2PPH A;  1WMH B;  3KYC D;  4DWF A;  3VTW A;  4MH0 E;  4P7I A;  2J0M A;  2MP2 A;  2GOW A;  2IO2 B;  2NPT B;  3BY4 B;  1V6E A;  3I3T B;  3AXC A;  2MP2 B;  4WJP A;  1G6J A;  2K8B A;  2W9N A;  3IBE A;  2KC2 A;  3MHS D;  1D3Z A;  2HJ8 A;  4FA6 A;  1WXA A;  3GOE A;  3VAW A;  4IM2 A;  3PHX B;  2CHW A;  3M95 A;  2BKF A;  3ZVV A;  1EO6 A;  1GJZ A;  3OJ3 A;  4IC7 B;  2BKR B;  3PTF C;  3ZTC A;  1IPG A;  5DPS A;  2LXA A;  1WGD A;  1V80 A;  2AEH A;  2LZ6 A;  3TMP B;  1EF5 A;  3APF A;  2KFK A;  1E5W A;  2G3Q B;  2LGY A;  4ZRJ A;  2FCS A;  4ANX A;  2D10 A;  3AU4 A;  4AJY B;  4GDL B;  3VUW A;  3ZNH B;  4KZ0 A;  3V62 A;  3HIZ A;  2HE7 A;  1GUA B;  2MBE A;  2EMS A;  2V4L A;  2WDT B;  2KJH B;  3DQV A;  3LDZ E;  4KSK C;  2LXC A;  5J17 A;  4B9K A;  3PZD A;  1WGY A;  1J19 A;  3HHM A;  4AWJ A;  3NY5 A;  4CHK A;  1Q5W B;  2KZR A;  4NPN A;  3VQI A;  2N7D A;  3O65 B;  4MSM B;  3X0W A;  2KNB A;  5AEK B;  1SIF A;  3QIJ A;  4NAW A;  2IYD B;  1WXV A;  3KUD B;  3DBR I;  4EEW A;  1VCB A;  1UH6 A;  2ZPN A;  5LLI A;  1E7V A;  3HM3 A;  3TCA A;  2DZK A;  3TBL D;  3PLV A;  2L00 B;  4W9K A;  2NVU I;  4ZRI A;  4MGI E;  2XK5 A;  3Q3F A;  4BKG A;  3H7P B;  4TV3 A;  3WAP A;  3NS8 A;  4FJZ A;  2O6V D;  2NR2 A;  2JXX A;  2BYV E;  1EUV B;  4IM3 A;  2A5U A;  3JYU A;  3QCA A;  3VVW B;  2LI5 A;  2M8S A;  5CHV C;  3RYT A;  1Q1O A;  1WZ3 A;  3SD5 A;  2JZ3 B;  3W1Y A;  4DDI D;  1GNU A;  1P98 A;  3CMM B;  2KDF B;  3P2B A;  2LAS A;  3A33 B;  3DPD A;  3PRM B;  4EUT A;  5LXI B;  2MQJ A;  2DEN B;  4K7U A;  4WJN A;  5J18 A;  2VRR B;  2RSU A;  2JUO A;  4RM8 A;  4W9F A;  1OEY J;  4BBN F;  1A5R A;  4CYE A;  2PE6 B;  4TQ1 A;  1BT0 A;  5E6P A;  2AWT A;  5D7G A;  2C7N B;  5J2R A;  2N9E B;  2KX3 A;  3KH0 A;  3SHQ A;  1K8R B;  3K9P B;  4BKT A;  2CKH B;  4DDG D;  2XBB C;  5L83 A;  2C7M B;  1EF1 A;  5JHA A;  2JRI B;  3OLM D;  4BBN C;  2O6V B;  1UGM A;  1J0G A;  1WGR A;  1IP9 A;  1YX5 B;  3EC8 A;  4A3P A;  3RUL A;  3VH3 B;  2OOB B;  4F7Z A;  5JH5 C;  4W9E A;  4IWP A;  1ISN A;  2L76 A;  1UD7 A;  2M4N A;  4DBG A;  1NBF C;  2GMI C;  2KQS A;  1TZ1 A;  1WMH A;  3S2A A;  4EOY A;  2M0X A;  4JQW C;  4NQL B;  2KD0 A;  1WGG A;  4PYU A;  3VFK A;  2LRU A;  4HXD A;  4ANU A;  1YX6 B;  4NQK E;  1WI0 A;  4URK A;  2NBU A;  1WR6 E;  2JVC A;  2NBW B;  2L05 A;  2L8J A;  3PRZ A;  4JIO U;  4PS8 A;  2K6Q A;  2D07 B;  3A9J A;  3WAN A;  1LQB A;  4TQ0 A;  4HPL B;  2FUH B;  2MLB A;  2DHZ A;  3VH4 B;  3QAR A;  2GBM A;  4HK2 A;  4AUQ C;  4HCP B;  4FAD A;  2FNJ B;  2LJ5 A;  2N4F A;  4NJ7 A;  2FIF A;  4I6L B;  2PEA A;  4GU2 A;  1QZE A;  2GBJ A;  2RR9 A;  2CU1 A;  1KJT A;  2D3G A;  4MSQ B;  3TJP A;  4YL8 A;  2JPH A;  3B0A A;  3ZKJ C;  3T9L A;  3PVL A;  3IVF A;  4KIK B;  2FCN A;  5E6O A;  1KM7 A;  1V9J A;  4HDQ A;  4PS7 A;  5KHQ A;  1E8Y A;  3EEC A;  1WYW B;  4EZJ A;  2KHW B;  2KJR A;  3ZDM C;  4FJY A;  2ZJD A;  1WM3 A;  3TL5 A;  1WXM A;  2IZV B;  1V2Y A;  2MBQ A;  2NBV B;  4ZYN A;  2N1W A;  2C7H A;  2KXJ A;  3APD A;  4KDL B;  2N9X A;  1SGH A;  3N30 A;  1LFD A;  3AI5 A;  5KHO A;  3R7R A;  3L13 A;  2BPS A;  5CTR C;  2N9P C;  3VXW A;  4NNJ B;  2FAZ A;  3UIO B;  1WX9 A;  4MGY E;  4FBJ B;  1WX8 A;  5AZH A;  4EFO A;  2K39 A;  2M17 A;  3L08 A;  5G2N A;  2HTH A;  1Z2M A;  4TUU A;  4AOF A;  4G11 A;  4HPM B;  5HKH A;  5D6J B;  4ZRK A;  2D11 A;  3CF6 E;  3PHW B;  1E8W A;  2GBN A;  3RZF A;  2J0K A;  1T0Y A;  2QHO A;  4IWQ A;  1C3T A;  4OVU A;  1U4A A;  4WWP A;  2G4D B;  3V6C B;  4MGZ E;  1GC6 A;  3IG3 A;  1L7Y A;  2KLG A;  4XC2 A;  3APC A;  3WIM A;  2G4S A;  2ZCB A;  2ZVO A;  4GB9 A;  2LVP A;  3L10 B;  2JRH A;  2JZZ A;  2REX A;  4BOS C;  4W9D A;  2CHZ A;  2ZCC A;  2BYE A;  2G45 B;  2B3A A;  2CS4 A;  1RRB A;  1RFA A;  3B08 A;  4BVU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...