4ITKA

The structure of c.reinhardtii ferredoxin 2
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
MFKVTFKTPKGEKTIDVEADKYLLDAAEEAGMDLPYSCRSGGCSTCCGKLESGTVDQSDQNMLDEDQLKQGFVLTCVAYPTSDIVILTDQESKLPIGGSENLYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and biochemical characterization of Chlamydomonas FDX2 reveal two residues that, when mutated, partially confer FDX2 the redox potential and catalytic properties of FDX1.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Electron transport
molecule keywords Apoferredoxin
total genus 24
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4itkA00
2DWQA 1L0VB 1ZP0B 3LXFA 3KWLA 3AE8B 1FFVA 1EWYC 1JALA 1XLQA 2CJNA 3AMZA 3P1MA 4WWMA 1NEKB 2K5PA 3B2GA 1XLOA 4N59A 1RWSA 5G5GA 4ZHPA 2QJLA 1E0ZA 3AE3B 2EKIA 4YTPB 2OHFA 3B2FA 1OQRA 2WLBA 3AM9A 4YT0B 3CIRB 2WDQB 1N61A 1CZPA 1E6EB 1JW9D 1V97A 4IDIA 1AWDA 1CJEA 1DOIA 1KFYB 4C7YA 3VR9B 1JWBD 1QLBB 3P4PB 1KF6B 1QT9A 4JX1C 2Y5CA 4USAA 1FMAD 1R7SA 5MPOA 1ROEA 3B9JA 3ABVB 1FO4A 4US9A 1TKGA 1WXQA 1A70A 5EE3A 1XO3A 2WDVB 2CU3A 1YJIA 2PIAA 3AEEB 1I7HA 1PUTA 2W3SA 3CWIA 1J7CA 3SFDB 4A9AA 3AH7A 1WYGA 3VRBB 3SR6A 3AE4B 3NVYA 1V8CA 2ACZB 1DOXA 1E10A 2G1EA 1TJEA 2JX5A 1N5WA 3PO0A 2AX5A 1J7AA 4JWSC 1JROA 1WWTA 1RFKA 1XLNA 3L4PA 5C2TB 3BIID 1QOGA 5EE9A 1SF0A 3WCQA 2BS4B 2MJEA 2N0SB 1TKYA 3AE2B 3AECB 1FRRA 4LTUA 5AUKA 1NVID 3W5UB 3P4QB 1GPXA 1JQ4A 2HTME 1XLPA 1WGKA 2MJ3A 3NS1A 5EE1A 3VR8B 2QIEB 1E7PB 1IUEA 1NYRA 1T3QA 1FRDA 1FXAA 3DWGC 4ITKA 1SB3C 3HUIA 1N5XA 2K22A 1VLBA 2BS3B 2W55A 3AE9B 3HVZA 3LB8C 3AEFB 5AUIA 2W3RA 3W5VB 3AEAB 5EE0A 2H89B 1E9MA 2H88B 1DGJA 1PFDA 3HRDD 4ZHOA 2LEKA 2E3TA 2L52A 1L6VA 2WP9B 2WU5B 1N60A 1VDVA 3SFEB 1ZUD2 2M56B 3P4RB 1NYQA 1NENB 5C3JB 3AEDB 1N62A 2BT6A 3ETRA 3NVZA 4C7ZA 3NVWA 2CJOA 3NRZA 4YSYB 3AE5B 1PDXA 1RYJA 2WQYB 5G5HA 1FM0D 2B76B 1VJKA 3FC4A 2MJDA 1TKEA 4YTNB 2K9XA 1B9RA 3VRAB 1DOYA 4N6EB 4YSXB 4YTMB 4YXDB 2DBYA 4P6VF 3P63A 1QOAA 1OFFA 2L83A 3AN1A 5GXGB 4ZOHC 1OQQA 1YQ3B 1F0ZA 3ZYYX 4WQMA 1UWMA 3AE6B 4HROA 2KMMA 1AYFA 4FXCA 4YSZB 1TYGB 1ZOYB 2PVGC 2WU2B 3FAHA 2WS3B 2M19A 3W9CB 1N63A 3AE7B 1FFUA 3EUB2 1L6UA 1JRPA 1KRHA 1FXIA 2MH7A 2PVOD 1QOBA 4N58A 4US8A 2FBWB 3RPFC 1NI3A 1SIJA 1ZXIA 3AEGB 4JWUC 3NVVA 1J7BA 1QF6A 1RM6C 2Q5WD 3AEBB 5H92C 2PKOA 3AV8A 2BS2B 3AB5A 3DWMA 4HRSA 2W54A 1GAQB 1WRIA 1FIQA 1YQ4B 2JQRB 2KAJA 4C80A 1JWAD 4KX6B 1QOFA 5H8YE 2WDRB 1YJJA 3P4SB 1L5PA 3AE1B
chains in the Genus database with same CATH superfamily
4IW0A 1ZP0B 3DVGY 2DYBA 1VZ6A 1P7FA 2WNMA 3A33B 5G55A 3HM6X 1A5RA 1GG3A 3QK0A 3RFZB 3QAQA 1HZ6A 3H1UA 3WALA 5T8IA 1R7SA 4B6WA 2YVCA 2KQSA 1P0RA 3VXWA 5HFYA 4RF1A 2L7RA 1MG8A 4BKGA 2LGSA 4NAMA 4MGIE 2KD0A 1N5WA 4ZRIA 3ZDMC 1OEYA 2FIFA 1SEBD 3KWVA 4XGAB 2K6QA 4KZ0A 4ANVA 1ZXHA 2V3SA 3TEZA 4L1BA 4IUMB 1NVID 2D3BA 3BZDB 1TBEA 4W9FA 4CYEA 2D10A 2PE9A 4ITKA 2NBVB 2NR2A 3AEAB 2WXHA 3ZTDA 3BK1A 2ZZPB 4ZDVA 2L76A 4BOSC 2GB1A 1D5ZC 2BYVE 4YSYB 3N32A 1RYJA 2ZVNA 3R2TA 4DHZB 2K6DB 2AEHA 2KDIA 4YTNB 4AWJA 2Z59B 1UNSA 2MWSB 5IN7A 3R7RA 5CTRC 4B9KA 2HJ1A 4HROA 1L4ZB 3UINB 2KYWA 3DHGC 2GRIA 2C7MB 1FCCC 3RPFC 2WXOA 4DWFA 3Q3OC 1KH0A 4S0RA 4KGRA 2BS2B 3AB5A 3Q3FA 5L95C 2KWUB 2PEAA 3UQAA 1V81A 1WX8A 3FKYA 4C4VA 1WJ4A 3ZVVA 3ZJTA 3VH4B 3PLVA 1M4VA 5C23A 2K5PA 1E0ZA 2EKIA 4W9LA 2I1KA 2ZEQA 1EWCA 2FUG1 2LUMA 2N7DA 2WDQB 1WGHA 1E6EB 2K1FA 2CHXA 1C1YB 2QMTA 3VR9B 1E7UA 3U4EG 5LLIA 2KDFB 2IY1B 1F77A 2W3SA 3RZWC 3U7DA 2ICIA 1T0YA 2KDEB 4RMAA 4D2KA 1TJEA 4W9CA 1EU4A 5FR6A 2NTSA 4MACA 5KHQA 4NY0A 3BIID 4WWPA 4LTUA 2M1MA 1VD2A 3VR8B 1VZ7A 3KLSX 1NYRA 1TIFA 1NDDA 3DBLI 2IGDA 3IT4B 1K8RB 2W55A 4ICUA 4LJPB 2KXJA 3VHTC 1OQYA 4RGNA 3ETRA 3PTFC 2KTRA 3LJ3A 1WM3A 2O6VA 4DBGA 2GBKA 4YSXB 3ZW3A 1EUVB 4JQWC 4J6IA 4K3CA 2YLMA 3DPDA 2WX1A 1YQ3B 3QA8A 1KJTA 1BMLC 1F2RI 2Z0DB 2WS3B 2M19A 3HK0A 1MPEA 3MHSD 1WGDA 3P42A 2L05A 2IBIB 1SIJA 1ZXIA 3CSTA 4P1CC 4OVZA 4HVBA 2LJIA 2PLPA 4KZCA 4NPNA 3IXSA 3N9YC 3ZNID 1GOZA 1J19A 4B0EA 2J0MA 2DWQA 1TZOA 3EFUA 2V1YA 2BKFA 2CR5A 1WM2A 2OHFA 1OQRA 2MX2A 2XN9C 4W9IA 1HQRD 3TSSA 3EC8A 4HCPB 2WXMA 1C9FA 2KN5A 1SIFA 5FK9C 4JX1C 5MPOA 1V80A 1NI2A 1WXQA 3OJ4B 4XZ4A 4FJYA 2QCZA 4EEWA 4GDLA 4WJOA 3PZDA 1YNTE 3PVLA 3WA0A 4XWTA 3NY5A 3NS8A 5C2TB 4G50A 3AECB 2WHIA 3RUIB 2KMAA 4KV2A 2LUEA 1R4NI 1K53A 2LGDA 5IO9A 3V6CB 2H89B 2KZRA 3PRZA 2DZJA 2J0JA 4GSWA 1ZDVA 4KSLC 3GZNB 3U30A 1D6EC 4AS1A 1PDXA 5BYRA 2WQYB 2K9XA 2J42A 3GE8C 5TSSA 5KHOA 2KOXA 1V1OA 2DBYA 2CHZA 1IGDA 1HXYD 3RMKC 2KMMA 1AYFA 4W9KA 4YSZB 3FAHA 1FXTB 1GB4A 4WJQA 2D5GA 1JRPA 2KJHB 4MEMA 4OZCA 3I3TB 1YX6B 4MSMB 4HDOA 2JUOA 3AEBB 3WAOA 3M62B 4IWPA 2KACA 1ACCA 3HUIA 1S3SG 3P4SB 1TZ1A 5J17A 3KUCB 3KYDD 4XX5A 4A90A 4TUUA 1S1QB 1CZPA 2O6VD 2V3PA 2KJ6A 1KLGD 1P9DU 2MSED 2JVCA 4AOFA 4KIKA 1IGCA 2WWZA 1WI0A 3DBHI 2WDVB 1HZ5A 1DOXA 3U52E 2DZKA 3TL5A 2AX5A 3MP9A 2DX5B 1YOVB 3HVDA 4XDCA 3MC8A 3QIJA 3DBRI 3H7PA 5EE9A 1JQ4A 3P4QB 3DQVA 1JWSD 3TEWA 2QILA 3AEFB 3W5VB 2KDMA 3URYA 2H88B 1DGJA 4IC7B 4DXAB 3GP7A 2M56B 2JRIB 4LCDE 3R8BA 3NRZA 3GE3C 3ZNGC 3VTVA 1N6ZA 4M8NA 3NUHB 2Y5PA 4NQLB 3VFKA 3P63A 2LVPA 4AJWA 4HWIB 3K9PB 3R66C 2AQ3B 1FXIA 4TV3A 1JWMD 1WMHB 3QARA 1WMHA 2ZNVB 2KVRA 1C78A 2I38A 2N1VA 2BYEA 1LFDA 2W54A 2JZPA 4K7WA 1FIQA 3OWEB 1ESFA 2OJWA 3PHWB 2G9HD 1WF9A 2UYZB 1MVKA 2BYTA 1KTKA 4RFBA 1L4DB 2LZ6A 2PW9A 4B0MA 3Q3MC 2WYQA 2AL3A 1F52A 1WGYA 4RM9A 5AZFA 2KFJA 4NAWA 1F1HA 2QSDA 1XEEA 3SEBA 3UI3A 1JWBD 4XYCA 2DNFA 3C8YA 1WZ0A 1I4QA 1I7HA 1PUTA 2DYOA 4J3OD 2LRWA 3A9JB 1FEHA 5CHFA 3V62A 4F8CB 4DDID 3AU5A 4JWSC 4FADA 4P7IA 1XLNA 4EZKA 4JGHB 3AE2B 2N9PC 2DHZA 3RNCC 1WSPA 1V2YA 1EU3A 1TTNA 4IKGA 3HVZA 3TMPB 3ZJUA 2UWQA 1C3TA 1JMLA 3LB8C 3E9SA 1MHHE 3BVGA 2L52A 1WGRA 4MGKE 2AQ1B 5C3JB 2KJRA 3M3JA 3VUXA 1E8ZA 4IOIE 4HEA1 2HD5B 1VJKA 3ZKJC 2WDTB 2BGFA 1YD8U 3GS2A 4HKZE 4MM3A 1TYGB 2ZCBA 3BYTB 3QCAA 3WIMA 3L0WB 4I6NB 4HDQA 2BB6A 4EUTA 3Q14C 1ET9A 2AWTA 2VH1A 1QF6A 4LDTD 2KQ7A 2LASA 1WJ6A 3VQIA 2M0AA 1JWAD 5H8YE 3AE1B 2N1WA 4FA6A 1XD3B 4MGYE 4PS7A 4K3BA 2IO1B 5LNK1 3Q8FA 4I6PA 2GOWA 5JXVA 5LXHA 3DDCB 3N1ZC 1I4HA 5E6JA 3ABVB 4LDTB 2LXCA 1DYQA 1WR6E 4XWWA 3QQ8B 4DXGA 1I42A 4ARIA 4NQKE 1T0RC 3N3KB 2WXJA 3ZNZB 2I1JA 4FULA 5AUKA 1JWUD 3GZNI 1SJED 4QAYA 2MHJA 3ML8A 1NBFC 4MELA 3EA6A 3M95A 1VLBA 1C4AA 4WAFA 3PZ7A 2BTEA 4MJSA 2VRRB 2J7QB 3MFGA 1L6VA 1B1ZA 1NENB 2R2OA 4M00A 1ET6A 3MC0B 3N1XC 3BYYB 2LWPA 1TKEA 4PYZA 3RZFA 5HI1A 4RGOS 3MJ5A 3O13A 4WQMA 4K7UA 1ZOYB 2NBWB 4CQNA 2L8JA 1D3ZA 2XBBC 2FCMA 3P2BA 4US8A 3TIXA 2Z8LA 3ZNHB 1C4CA 3IFWB 4TMAB 3VUWA 3B08A 1R4MB 2LHDA 4DHJD 2GBJA 4KX6B 4C7ZA 1V86A 4II3B 4MT5A 3CSFA 1I4RA 1T6BX 1QZEA 2DYMA 4YT0B 4KSKC 5CX3A 1JW9D 1V97A 2MBBB 4W9DA 3ZRCA 2D07B 3P4PB 4A3OA 3U7ZA 1ROEA 3SU8X 5JHBA 1V6EA 1TKGA 3VTWA 2RDBC 4RGMA 2QDFA 3AE4B 3NVYA 1E10A 4W9JA 2GLSA 1VCBA 4NNJB 1JCKB 1LGRA 2JZZA 3PZ8A 2JXTA 4RF0A 2ONQA 1LO5D 2SAKA 5J18A 4WH4A 4II2B 2DLBA 2HTME 4DQOC 3KUDB 3APDA 3EGRA 3DOWA 4WJNA 4GN1A 2KT7A 1K50A 3X0WA 3RYTA 5D6JB 4AJYB 4C4VB 1N60A 4MSQB 1KLUD 4E74A 3AEDB 2KX3A 3LYYA 2CJOA 4LJOB 2K8CA 3QWZB 2LJ5A 4EZJA 3AI5A 3FC4A 4ICVA 4KKIA 2N7EA 2RDHA 3D32A 1V5OA 3IBEA 4AQ7A 1UF0A 3MC9A 2OJRA 1G6JA 5G2NA 1VZ8A 1SE4A 3FILA 2N9KA 3ZYYX 4CO7A 4KIKB 3NHEB 2DZMA 2RSUA 2ZPNA 1GNUA 3W9CB 4WIPA 1HEZE 2WXFA 2INCC 1FCLA 2EMSA 4ZYSA 1Q0WB 2LD9A 4OW0A 2N9XA 4HRSA 5BMGA 2JWUA 3JYUA 3KQ4A 2WDRB 3VAWA 5JH5C 3AE8B 4WWNA 2FCSA 1L0XB 2BQQA 1J0GA 2INDC 2W9NA 3A9JA 3T9LA 3QX1A 3AM9A 2R61A 4JPSA 3ZQ4A 4OVVA 3IAM1 1DOIA 4A3PA 3U2SC 1PGBA 4EFOA 4HLEA 2KFKA 1WJNA 3U8ZA 4A20A 2MEKA 3ZIMA 3ZJVA 5D2MB 5IKCM 3SD5A 1YMHE 3K9OB 3Q8BA 2L1AA 3Q6BA 1FRRA 5E6NA 2XNAC 3A1QA 1X1MA 3OAWA 1K52A 1E7PB 2KHWB 2O2VA 1EF5A 2KO3A 2DAJA 3PPAA 3OJ3A 1TS3A 2BWES 2RDGA 2JT4B 4BVUC 2KDBA 2FNJB 3KW5B 3NG0A 1R4NB 1UGJA 3AU4A 2MW5A 4Q2JA 1FM0D 3BY4B 3ONSA 2MBEA 2UU7A 3W1YA 2JYTA 4BKTA 1STEA 4I6LB 3V3XA 1F0ZA 2AL6A 3Q8CA 2WU2B 3ENEA 4AP4C 1XQQA 1QOBA 2FBWB 3GOEA 2KMCA 4NJ7A 3SHQA 3AV8A 1Y56A 3H7PB 4JLCA 3PV1A 2V3NA 3EECA 2KQ4X 2J53A 2KVZA 1GAQB 1FPYA 5AZHA 4GXBA 4RCOA 2N9LA 3BVMA 3TUOA 3I5JC 4M0WA 2WXIA 3B0AA 3AXCA 2MA9B 4W9HA 2FE8A 4MH8A 1YQBA 3MTNB 1N61A 4PK1A 4MDKE 4PS8A 2AYOB 2RPVA 1KFYB 4HPLB 3GB1A 3V60A 5L83A 5AEKB 2YEPF 3L17A 5GMVA 1WX9A 1FMAD 4USAA 3EHVA 2IJ0A 1A70A 3ZXVA 5LXIB 4OZAA 4LNKA 1I4GA 2BVCA 2ZPYA 2ACZB 3W1SA 3QC8B 4NJ6A 1L7YA 3PO0A 2BW2A 2WX0A 2LFIA 2BBCA 3IG3A 4RNAA 1TGZB 3HM3A 3KVFB 2BF8B 4ARCA 2HJ8A 5IAAC 3L54A 2MCNB 2NTTA 1T3QA 1FXAA 4IM3A 1SE2A 1XXGA 2BS3B 2KTRB 3C0RB 1D4BA 1KM7A 1HTOA 4ZHOA 1IBXB 2TSSA 2MRPA 1VDVA 4ZRQA 2HTHA 1HE8A 1N62A 1K51A 2RMMA 2KN4A 2B76B 2LGIA 2V4IB 4L2YA 2X38A 3ZUNA 2MBOA 3PRMB 1WXVA 3ZO5B 1UWMA 3AE6B 3QJZA 2ZW1A 2PVGC 2MQJA 3KUZA 4GDLB 1FFUA 3DHHC 3EUB2 4ANWA 1UGMA 1OGWA 3AEGB 4HXDA 3TJPA 1YN3A 4MM3B 2IPKD 1WRIA 2JQRB 2KFKB 4C80A 1QOFA 1MI0A 2CJNA 1LXDA 3RNGC 4G3XB 3UGBB 4A55A 2ZVOA 2IZVB 2N9EB 4P1BC 4HPMB 1T5XD 2WXKA 1Q10A 2JZ3B 4GMVA 1UH6A 1YJ1A 2LMCA 2MLBA 5EE3A 2PMVA 4HCNB 1ZKHA 3AH7A 3RD2A 3VRBB 1RLFA 1J7AA 3EFCA 1P3QU 1JROA 5IP4D 4FN2A 3L4PA 1VR9A 2XEWA 3RNEC 2MJEA 2L0FA 2IGHA 1MHXA 2MJ3A 3NS1A 4GOCA 4W9GA 1E8WA 5C1ZA 2KWVB 3AE9B 5E6PA 2MBHA 2W3RA 2NPTB 3S2AA 3QHTA 4OVUA 3RT3B 1C77A 5DPSA 2YEPB 4ZRKA 3RNFC 1RAXA 3NVWA 4F1SA 1UUPA 3PS6A 3M63B 3C19A 4M02A 1WZ3A 4YWGG 1QKZA 2WXNA 2K25A 3VRAB 2K8BA 2FAZA 1OEYJ 4ASWC 1YX5B 1E7VA 4GLSC 4HK2A 3AN1A 5GXGB 4FHJA 3ZGZA 1EF1A 1PQSA 2REXA 2CHWA 3AE7B 1WFYA 1L6UA 4URKA 1EM7A 4LNFA 2L3ZA 2RR9A 3DVNV 2V4LA 2Q5WD 5H92C 3W2DA 5BYQA 4KGTA 2CU1A 4CHKA 1YQ4B 2D11A 2A5UA 4YXDB 1GB1A 3ECIA 1AW7A 1T0SC 1KOTA 4ZHPA 4N59A 3H6NA 3HIZA 4G11A 4FJZA 2J0KA 3ZXRA 4LNNA 3DBSA 4KGSA 4K7SA 5AZGA 2LVOA 1U4AA 1XCQL 2WXRA 3TCAA 5FKAC 1L0YB 3RCZA 2JU6X 2NCNA 4WQOB 4IWOA 3NZSA 5CHWA 2IY0B 3ZRFA 3APCA 3DVNU 1SGHA 4HJGE 4E71A 5BMHA 1UELA 5JZEB 2KLGA 3DBHB 3ZDTA 2BS4B 2LGYA 4O1NA 3TEXA 4BKSD 1XLPA 4ZRPA 4AUQC 2BKRB 4K1RB 4PYUA 4PS3A 1SE9A 2K22A 1E90A 5EE0A 4X57B 2KC2A 4MJSB 3SFEB 1Z2MA 1WY8A 4EE2A 2HE7A 2MBQA 5DPTA 2ASQA 2Y5BB 3O65B 2G45B 1I4XA 3UQBA 2D3GA 2GBNA 2IO0B 4JL9A 3FILB 3RNBC 2QEJC 1QQRA 1UD7A 2INNE 3BVZA 2XK5B 1N63A 5HG2A 2JWZA 1KRHA 1C4PA 2M0XA 3NOBA 1MJDA 2DAFA 4ACFA 2X8XX 5DPRA 1CK1A 2ZW0A 4IM0A 3KWLA 1QILA 2IO3B 5DCNA 1ZDXA 1XLOA 3A9KA 1RWSA 3DCGA 4P16A 2QJLA 3IT6B 2LVQA 1GC7A 3CIRB 5TR5A 4JIOU 5HHDG 4DHZE 2DENB 2WXQA 1HA5A 2VZKB 2PE6B 3BK2A 2JXXA 4B95A 1TY2A 3ZTCA 4YL8A 4RGTA 1XO3A 3L16A 1YJIA 2CU3A 2PIAA 3CWIA 1C76A 1J7CA 2IYDB 3PT2B 3SFDB 2C7NB 3KYCD 1SE3A 3CMMB 3SR6A 3RN9C 1AARA 2JX5A 2WXPA 3PLUA 4DXFA 2BYFA 2RD0A 1QOGA 2R2QA 5I4DA 2LRUA 3JSVB 4TQ1A 1GPXA 2LHEA 4KDLB 4HJKA 3I63C 1FNWA 2KWDA 2FCNA 4GB9A 2W82A 2K0PA 2KWCA 3NZ3A 1ZUD2 2C9WB 1NYQA 4PT5A 2BB5A 3AE5B 2I2YA 1FD6A 2EELA 3Q8AA 1UBIA 4LLGM 3UIOB 2Z0EB 5CHVC 3H9DA 1Q1OA 3W1SC 2KTFA 1CQVA 2FIDA 4JE3B 2K3UA 3KH0A 3NVVA 2PKOA 3A4RA 2O6VB 4XE0A 2LXAA 2KLCA 2KAJA 3BINA 4H2AA 3IVFA 1AN8A 3LXFA 2MP2B 1XLQA 1JALA 3AMZA 3P1MA 4XC2A 2K8HA 4GIVA 3B2GA 3AE3B 3JSVA 3NZUA 4RM8A 4IDIA 3IAS1 1AWDA 1WE6A 3OLMD 4OZBA 2KK8A 1QLBB 3VDZA 2NVUI 1KF6B 2DZIA 4C00A 4ZYNA 1F2RC 2V9HA 2M8SA 3PGEA 2FCQA 1YN4A 1H4RA 2ON8A 2QC8A 2O2VB 2WXLA 2JSVX 1WYGA 1IP9A 1V8CA 2D3AA 5J2RA 2OEDA 3N1YC 4FJVB 1SBBB 2N7JA 3ZLZA 4BFRA 1RFKA 2N0SB 1WXMA 5D3IB 1WE7A 2KX0A 3VVWB 3W5UB 2C60A 1Q5WB 1FNVA 1PGAA 2BWFA 2HDEA 4NJCA 2WGSA 3Q8EA 1PYWD 4W9EA 4EOYA 5AUIA 3H7SA 2C5LC 3HRDD 2Y3AA 4LNIA 2WU5B 3PSEB 4TQ0A 3ML9A 2JYEA 4NZLB 1T0QC 3A9KB 1MFWA 1YIWA 2IO2B 4MH0E 2RGFA 2L83A 3T3NA 3Q2AC 3N20C 3L13A 3A4SC 3WAMA 3OG5A 2MH7A 2D2QA 1WH3A 2JPHA 3N30A 3V6EB 1XF5L 3DWMA 2ZCCA 4DHJB 3PRPB 2WXGA 3Q69A 2J52A 1V5TA 3WANA 2GMIC 1FFVA 1NEKB 4EZLA 1TS5A 2J4XA 3HHMA 3WAPA 2WLBA 3L10B 4ANUA 4M0WB 1PGXA 1CJEA 4BBNC 4C7YA 4UDUC 4KDIC 1VRAB 1BUIC 4M01A 1YN5A 4FLHA 1IYFA 4IM2A 3MJWA 2A4ZA 1BT0A 4A9AA 3Q3JA 1HTQA 1UZXB 2GBMA 2OOBB 4A6QA 1WYWB 4REZA 3DHIC 1ENFA 4XDDA 2KC1A 2SEBD 1J8CA 2CS4A 1FRDA 3V61A 5D3DA 2VH2A 1PFDA 4MGZE 3L08A 3R2IA 1SSNA 4GGQA 1WIAA 1TT5B 3I57A 2MJDA 3A1QB 1RRBA 1E8YA 1DOYA 4YTMB 4LNOA 1E8XA 2LGXA 1GC6A 2NMQA 4WWOA 1OQQA 1L2NA 4FXCA 1TS2A 5EDSA 3RULA 3VH3B 3CF6E 1V49A 5IOIA 2LI5A 3T3OA 4N58A 2PVOD 5D7GA 1UBQA 4A8XC 1Z5SB 2D3CA 4JWUC 3SDLC 2BPSA 4DK5A 3VUYA 3R7QA 1SXTA 4K81A 1YJJA 3NJTA 4WURA 4WWMA 2NPTA 3PHXB 5G5GA 3UIPB 3B2FA 2NS5A 2L32A 1Y8RC 1D5XC 3IHPC 1GUAB 2INPE 1LM8B 1RFAA 1TY0A 2Y5CA 1WR1A 2C7HA 2KANA 1FO4A 3I9V1 1C79A 2K39A 4HPPA 2L0TA 2PTLA 3UF8A 1WX7A 5E6OA 2G1EA 1EO6A 3JVZX 1P1AA 2M17A 4BKSA 2JF5A 2FUHB 1WWTA 1H8CA 1ZGUB 1BXTA 4F7ZA 4GDKA 1WGKA 5EE1A 3X23A 3DWGC 1SB3C 3V05A 3DBLB 1E9MA 3RI7C 3AULA 2LEKA 1P98A 3DVGX 4RH6A 1ISNA 2EKEC 3P4RB 3NVZA 1MG4A 4R3DA 1XCTL 5BO4B 4N6EB 4GU2A 2ZNVC 5IA7A 1QOAA 1ZE3D 1OTRB 1XT9B 4ZOHC 1V1PB 1I4PA 4G0NB 1SJHD 3MHZA 1GJZA 3TBLD 2IGGA 4ANXA 1RM6C 4L23A 1V1PA 2KNBA 2GBRA 1IBXA 1JRUA 2CKHB 3ALBA 4ZRJA 1L5PA 1L0VB 3J9CA 1WGGA 2G4DB 1EWYC 3PREA 1ZW7A 4IWQA 1IPGA 4OHJA 2AQ2B 4YTPB 4HKQA 3E56A 4BOZB 2JRHA 1UWXA 2MP2A 2PJHA 2EMTA 2XK5A 4M8MA 2G4SA 1WXAA 1QT9A 2V0GA 3B9JA 4US9A 3AEEB 1WRDB 2VZKD 2L00B 3R3MA 4WAAA 2M4NA 1R4MI 2E6XA 4GDKB 1F9JA 1V9JA 4IG7B 4KVGB 3DBRB 1CMXB 4C56C 4KKJA 3JW0X 4BZAA 1WJUA 5JHAA 1TS4A 3TEYA 3WCQA 1SF0A 1KLVA 1TKYA 4WJPA 3BWUD 4BBNF 4N9F4 2QIEB 5DPWA 1IUEA 3H8HA 1D5MC 3APFA 5BYSA 4TSSA 1N5XA 1M94A 2ZJDA 2E3TA 2WP9B 4S17A 4FHKA 2RPQA 3RNAC 4EKUA 2BT6A 5FR3A 1WXSA 4NAWB 1ZPSA 3T8MA 3VTUA 2QHOA 2B3AA 5D94A 5G5HA 2PPHA 1I35A 1B9RA 4P6VF 1OFFA 1LQBA 3Q3NC 5HKHA 4DDGD 4FBJB 5BMIA 2N4FA 2JY6A 2NBUA 1NI3A 2GI9A 3B1LX 4TKNA 1E5WA 4LK0M 1J7BA 4BAXA 3LDZE 1FNUA 2G3QB 4E3CA 1P7EA 2IDYA 2KKCA
chains in the Genus database with same CATH topology
1KTKA 1ZP0B 3LXFA 3BVMA 3TUOA 4RFBA 1XLQA 1JALA 3AMZA 3P1MA 4M0WA 1L4DB 3B2GA 2WXIA 2PW9A 1VZ6A 3AE3B 4B0MA 1P7FA 2WNMA 2FE8A 4MH8A 1N61A 4IDIA 3RFZB 3IAS1 1AWDA 4OZBA 2QSDA 1HZ6A 2RPVA 1KFYB 1XEEA 3SEBA 3GB1A 3UI3A 1JWBD 1QLBB 5T8IA 2YEPF 1KF6B 4RCOA 4USAA 1FMAD 1R7SA 2IJ0A 1F2RC 3C8YA 1A70A 1I4QA 1YN4A 1I7HA 1PUTA 4OZAA 2ON8A 1I4GA 4RF1A 5HFYA 2WXLA 2DYOA 2JSVX 4J3OD 1WYGA 1V8CA 2ACZB 3W1SA 1FEHA 4NAMA 2OEDA 1N5WA 1SBBB 3PO0A 1SEBD 2BW2A 3KWVA 4JWSC 2N7JA 1XLNA 1RFKA 1ZXHA 2LFIA 2BBCA 3TEZA 4RNAA 2N0SB 3AE2B 4L1BA 5D3IB 1NVID 3W5UB 4ARCA 3BZDB 1FNVA 1PGAA 4NJCA 2HDEA 1WSPA 2NTTA 1EU3A 1T3QA 3Q8EA 1FXAA 1SE2A 1XXGA 4IKGA 3HVZA 4ITKA 1PYWD 3ZJUA 2BS3B 1JMLA 3LB8C 1D4BA 5AUIA 3E9SA 3AEAB 1MHHE 2WXHA 3HRDD 4ZHOA 3BVGA 3BK1A 2Y3AA 2TSSA 1IBXB 2L52A 2WU5B 1VDVA 4ZRQA 2AQ1B 5C3JB 4TQ0A 1N62A 2GB1A 1K51A 2RMMA 2KN4A 2JYEA 4IOIE 1D5ZC 4HEA1 4YSYB 1RYJA 3R2TA 4NZLB 2B76B 1VJKA 2LGIA 4YTNB 2V4IB 1UNSA 4L2YA 2X38A 3GS2A 2L83A 3T3NA 1UWMA 3AE6B 4HKZE 4HROA 1L4ZB 1TYGB 2ZW1A 3BYTB 2PVGC 4GDLB 2GRIA 1FFUA 3EUB2 2MH7A 1FCCC 3RPFC 2BB6A 2WXOA 3AEGB 1ET9A 1KH0A 1QF6A 4KGRA 1YN3A 2BS2B 1XF5L 3AB5A 3DWMA 4MM3B 2IPKD 1WRIA 3VQIA 2M0AA 2JQRB 4C80A 1JWAD 2WXGA 1QOFA 5H8YE 1MI0A 3Q69A 2J52A 3AE1B 3ZJTA 1FFVA 2CJNA 1NEKB 1M4VA 2K5PA 1E0ZA 1TS5A 2EKIA 2J4XA 5LNK1 2WLBA 3Q8FA 1EWCA 2FUG1 2LUMA 2WDQB 5JXVA 1E6EB 4A55A 1PGXA 1I4HA 1CJEA 4C7YA 2QMTA 3VR9B 4UDUC 1T5XD 5E6JA 2WXKA 1Q10A 1VRAB 1BUIC 3U4EG 1YN5A 3ABVB 2LMCA 5EE3A 1F77A 2PMVA 4A9AA 2W3SA 1DYQA 3AH7A 4XWWA 3VRBB 2ICIA 4D2KA 1TJEA 1EU4A 4DXGA 4ARIA 1AN8A 1J7AA 2NTSA 4MACA 1JROA 4A6QA 3L4PA 3BIID 2WXJA 1VR9A 4REZA 2MJEA 5AUKA 4LTUA 1ENFA 4XDDA 1JWUD 1SJED 2IGHA 1MHXA 2MJ3A 3NS1A 2SEBD 3VR8B 1VZ7A 3KLSX 1NYRA 1FRDA 2IGDA 3EA6A 3IT4B 2W55A 1VLBA 1C4AA 3AE9B 5D3DA 4WAFA 2W3RA 3PZ7A 2BTEA 1PFDA 3MFGA 1L6VA 1C77A 2YEPB 3R2IA 1B1ZA 1SSNA 1NENB 3ETRA 4RGNA 3NVWA 1ET6A 1UUPA 3MC0B 3I57A 4YWGG 1QKZA 3BYYB 2MJDA 1TKEA 2WXNA 1DOYA 3VRAB 4YSXB 4YTMB 4GLSC 5HI1A 2NMQA 4RGOS 3AN1A 3MJ5A 5GXGB 1OQQA 1YQ3B 3O13A 4WQMA 3ZGZA 4FXCA 1TS2A 1BMLC 1F2RI 1ZOYB 2WS3B 4CQNA 2M19A 3AE7B 1MPEA 1L6UA 3T3OA 4N58A 4US8A 2PVOD 2Z8LA 5D7GA 3P42A 1C4CA 1EM7A 1SIJA 1ZXIA 4TMAB 4A8XC 4JWUC 4OVZA 2Q5WD 2LJIA 2PLPA 5H92C 3W2DA 5BYQA 4KGTA 3IXSA 2LHDA 3N9YC 1SXTA 1YQ4B 1GOZA 4KX6B 4YXDB 1GB1A 1YJJA 4B0EA 4C7ZA 2DWQA 1AW7A 4WURA 1TZOA 4WWMA 4MT5A 4ZHPA 4N59A 5G5GA 1I4RA 1T6BX 2OHFA 3B2FA 1OQRA 2L32A 2DYMA 4YT0B 2XN9C 1D5XC 1HQRD 3TSSA 1JW9D 2INPE 1V97A 2WXMA 1C9FA 4KGSA 1TY0A 3P4PB 5FK9C 4JX1C 1XCQL 2WXRA 2Y5CA 3U7ZA 5MPOA 1ROEA 1FO4A 3I9V1 1TKGA 1WXQA 5FKAC 1C79A 1L0YB 2JU6X 2PTLA 4RGMA 3AE4B 3NVYA 1E10A 2G1EA 1YNTE 1JCKB 4HJGE 5BMHA 4XWTA 3PZ8A 2JXTA 4RF0A 2ONQA 1WWTA 5C2TB 1LO5D 2BS4B 3AECB 1BXTA 2SAKA 4O1NA 4WH4A 3TEXA 2DLBA 2HTME 4DQOC 1XLPA 3EGRA 1WGKA 5EE1A 1K50A 4ZRPA 3DWGC 1K53A 1SB3C 2K22A 3V05A 5EE0A 2H89B 1E9MA 2LEKA 1N60A 3SFEB 1KLUD 4RH6A 3P4RB 1ZDVA 3AEDB 3NVZA 3LYYA 4EE2A 2CJOA 1D6EC 4AS1A 1PDXA 4R3DA 5BYRA 2WQYB 1XCTL 3FC4A 4KKIA 2RDHA 2K9XA 2J42A 5TSSA 4N6EB 1V1OA 4AQ7A 2DBYA 1QOAA 1ZE3D 1VZ8A 1SE4A 3FILA 1IGDA 1I4XA 2N9KA 4ZOHC 3ZYYX 1HXYD 3FILB 1V1PB 1I4PA 2KMMA 1QQRA 1SJHD 1AYFA 2INNE 2QEJC 3MHZA 4YSZB 3BVZA 3FAHA 3W9CB 1GB4A 4WIPA 2D5GA 1N63A 5HG2A 1HEZE 2WXFA 1JRPA 1KRHA 1FCLA 4OZCA 1C4PA 2IGGA 4ZYSA 1RM6C 3AEBB 4OW0A 4L23A 1V1PA 4HRSA 2KACA 1IBXA 1ACCA 5BMGA 2JWUA 1CK1A 3KQ4A 2WDRB 2ZW0A 3HUIA 3P4SB 1L5PA 1L0VB 3J9CA 3KWLA 3AE8B 1QILA 1EWYC 1L0XB 1ZDXA 1XLOA 2AQ2B 1RWSA 4OHJA 4P16A 2QJLA 3IT6B 4YTPB 4A90A 4HKQA 3AM9A 2R61A 3CIRB 4JPSA 2BYTA 3ZQ4A 3E56A 5HHDG 1CZPA 1UWXA 2V3PA 2WXQA 3IAM1 1DOIA 1KLGD 1HA5A 2VZKB 3BK2A 1IGCA 1PGBA 1QT9A 3U2SC 2V0GA 1TY2A 3B9JA 4US9A 4RGTA 1XO3A 2WDVB 1HZ5A 1YJIA 2CU3A 2PIAA 2VZKD 3AEEB 3CWIA 1C76A 1J7CA 3SFDB 1SE3A 3SR6A 1DOXA 3U52E 2E6XA 2MEKA 2JX5A 4GDKB 3ZJVA 2WXPA 2AX5A 3MP9A 4DXFA 4C56C 4KKJA 3HVDA 4XDCA 1YMHE 1TS4A 3Q8BA 3TEYA 1QOGA 2L1AA 1SF0A 5EE9A 3WCQA 5I4DA 1TKYA 1FRRA 2XNAC 1JQ4A 3P4QB 4TQ1A 1GPXA 3BWUD 2LHEA 1K52A 1JWSD 2QIEB 1E7PB 1FNWA 2KWDA 1IUEA 3TEWA 3H8HA 2QILA 1D5MC 5BYSA 2W82A 2K0PA 1N5XA 4TSSA 3AEFB 3W5VB 2KDMA 1TS3A 3URYA 2H88B 1DGJA 2RDGA 2E3TA 2WP9B 3NZ3A 1ZUD2 3GP7A 2M56B 1NYQA 4PT5A 2BT6A 3R8BA 2BB5A 5FR3A 1UGJA 3NRZA 4NAWB 1ZPSA 3AE5B 2I2YA 5G5HA 4Q2JA 1FM0D 1B9RA 1FD6A 3NUHB 2JYTA 2Y5PA 2EELA 4P6VF 3P63A 1STEA 1OFFA 3Q8AA 3V3XA 1F0ZA 4LLGM 3Q8CA 2WU2B 2AQ3B 1CQVA 1FXIA 1JWMD 2K3UA 1QOBA 4JE3B 5BMIA 2FBWB 1NI3A 2GI9A 3NVVA 1C78A 1J7BA 2I38A 4LK0M 2PKOA 1Y56A 3AV8A 4XE0A 2V3NA 1FNUA 2KQ4X 2JZPA 2J53A 1GAQB 2W54A 2KAJA 1FIQA 1ESFA 3OWEB 2G9HD 1P7EA 2IDYA 4H2AA 1MVKA 2N9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DWQ A;  1L0V B;  1ZP0 B;  3LXF A;  3KWL A;  3AE8 B;  1FFV A;  1EWY C;  1JAL A;  1XLQ A;  2CJN A;  3AMZ A;  3P1M A;  4WWM A;  1NEK B;  2K5P A;  3B2G A;  1XLO A;  4N59 A;  1RWS A;  5G5G A;  4ZHP A;  2QJL A;  1E0Z A;  3AE3 B;  2EKI A;  4YTP B;  2OHF A;  3B2F A;  1OQR A;  2WLB A;  3AM9 A;  4YT0 B;  3CIR B;  2WDQ B;  1N61 A;  1CZP A;  1E6E B;  1JW9 D;  1V97 A;  4IDI A;  1AWD A;  1CJE A;  1DOI A;  1KFY B;  4C7Y A;  3VR9 B;  1JWB D;  1QLB B;  3P4P B;  1KF6 B;  1QT9 A;  4JX1 C;  2Y5C A;  4USA A;  1FMA D;  1R7S A;  5MPO A;  1ROE A;  3B9J A;  3ABV B;  1FO4 A;  4US9 A;  1TKG A;  1WXQ A;  1A70 A;  5EE3 A;  1XO3 A;  2WDV B;  2CU3 A;  1YJI A;  2PIA A;  3AEE B;  1I7H A;  1PUT A;  2W3S A;  3CWI A;  1J7C A;  3SFD B;  4A9A A;  3AH7 A;  1WYG A;  3VRB B;  3SR6 A;  3AE4 B;  3NVY A;  1V8C A;  2ACZ B;  1DOX A;  1E10 A;  2G1E A;  1TJE A;  2JX5 A;  1N5W A;  3PO0 A;  2AX5 A;  1J7A A;  4JWS C;  1JRO A;  1WWT A;  1RFK A;  1XLN A;  3L4P A;  5C2T B;  3BII D;  1QOG A;  5EE9 A;  1SF0 A;  3WCQ A;  2BS4 B;  2MJE A;  2N0S B;  1TKY A;  3AE2 B;  3AEC B;  1FRR A;  4LTU A;  5AUK A;  1NVI D;  3W5U B;  3P4Q B;  1GPX A;  1JQ4 A;  2HTM E;  1XLP A;  1WGK A;  2MJ3 A;  3NS1 A;  5EE1 A;  3VR8 B;  2QIE B;  1E7P B;  1IUE A;  1NYR A;  1T3Q A;  1FRD A;  1FXA A;  3DWG C;  4ITK A;  1SB3 C;  3HUI A;  1N5X A;  2K22 A;  1VLB A;  2BS3 B;  2W55 A;  3AE9 B;  3HVZ A;  3LB8 C;  3AEF B;  5AUI A;  2W3R A;  3W5V B;  3AEA B;  5EE0 A;  2H89 B;  1E9M A;  2H88 B;  1DGJ A;  1PFD A;  3HRD D;  4ZHO A;  2LEK A;  2E3T A;  2L52 A;  1L6V A;  2WP9 B;  2WU5 B;  1N60 A;  1VDV A;  3SFE B;  1ZUD 2;  2M56 B;  3P4R B;  1NYQ A;  1NEN B;  5C3J B;  3AED B;  1N62 A;  2BT6 A;  3ETR A;  3NVZ A;  4C7Z A;  3NVW A;  2CJO A;  3NRZ A;  4YSY B;  3AE5 B;  1PDX A;  1RYJ A;  2WQY B;  5G5H A;  1FM0 D;  2B76 B;  1VJK A;  3FC4 A;  2MJD A;  1TKE A;  4YTN B;  2K9X A;  1B9R A;  3VRA B;  1DOY A;  4N6E B;  4YSX B;  4YTM B;  4YXD B;  2DBY A;  4P6V F;  3P63 A;  1QOA A;  1OFF A;  2L83 A;  3AN1 A;  5GXG B;  4ZOH C;  1OQQ A;  1YQ3 B;  1F0Z A;  3ZYY X;  4WQM A;  1UWM A;  3AE6 B;  4HRO A;  2KMM A;  1AYF A;  4FXC A;  4YSZ B;  1TYG B;  1ZOY B;  2PVG C;  2WU2 B;  3FAH A;  2WS3 B;  2M19 A;  3W9C B;  1N63 A;  3AE7 B;  1FFU A;  3EUB 2;  1L6U A;  1JRP A;  1KRH A;  1FXI A;  2MH7 A;  2PVO D;  1QOB A;  4N58 A;  4US8 A;  2FBW B;  3RPF C;  1NI3 A;  1SIJ A;  1ZXI A;  3AEG B;  4JWU C;  3NVV A;  1J7B A;  1QF6 A;  1RM6 C;  2Q5W D;  3AEB B;  5H92 C;  2PKO A;  3AV8 A;  2BS2 B;  3AB5 A;  3DWM A;  4HRS A;  2W54 A;  1GAQ B;  1WRI A;  1FIQ A;  1YQ4 B;  2JQR B;  2KAJ A;  4C80 A;  1JWA D;  4KX6 B;  1QOF A;  5H8Y E;  2WDR B;  1YJJ A;  3P4S B;  1L5P A;  3AE1 B; 
#chains in the Genus database with same CATH topology
 4IW0 A;  1ZP0 B;  3DVG Y;  2DYB A;  1VZ6 A;  1P7F A;  2WNM A;  3A33 B;  5G55 A;  3HM6 X;  1A5R A;  1GG3 A;  3QK0 A;  3RFZ B;  3QAQ A;  1HZ6 A;  3H1U A;  3WAL A;  5T8I A;  1R7S A;  4B6W A;  2YVC A;  2KQS A;  1P0R A;  3VXW A;  5HFY A;  4RF1 A;  2L7R A;  1MG8 A;  4BKG A;  2LGS A;  4NAM A;  4MGI E;  2KD0 A;  1N5W A;  4ZRI A;  3ZDM C;  1OEY A;  2FIF A;  1SEB D;  3KWV A;  4XGA B;  2K6Q A;  4KZ0 A;  4ANV A;  1ZXH A;  2V3S A;  3TEZ A;  4L1B A;  4IUM B;  1NVI D;  2D3B A;  3BZD B;  1TBE A;  4W9F A;  4CYE A;  2D10 A;  2PE9 A;  4ITK A;  2NBV B;  2NR2 A;  3AEA B;  2WXH A;  3ZTD A;  3BK1 A;  2ZZP B;  4ZDV A;  2L76 A;  4BOS C;  2GB1 A;  1D5Z C;  2BYV E;  4YSY B;  3N32 A;  1RYJ A;  2ZVN A;  3R2T A;  4DHZ B;  2K6D B;  2AEH A;  2KDI A;  4YTN B;  4AWJ A;  2Z59 B;  1UNS A;  2MWS B;  5IN7 A;  3R7R A;  5CTR C;  4B9K A;  2HJ1 A;  4HRO A;  1L4Z B;  3UIN B;  2KYW A;  3DHG C;  2GRI A;  2C7M B;  1FCC C;  3RPF C;  2WXO A;  4DWF A;  3Q3O C;  1KH0 A;  4S0R A;  4KGR A;  2BS2 B;  3AB5 A;  3Q3F A;  5L95 C;  2KWU B;  2PEA A;  3UQA A;  1V81 A;  1WX8 A;  3FKY A;  4C4V A;  1WJ4 A;  3ZVV A;  3ZJT A;  3VH4 B;  3PLV A;  1M4V A;  5C23 A;  2K5P A;  1E0Z A;  2EKI A;  4W9L A;  2I1K A;  2ZEQ A;  1EWC A;  2FUG 1;  2LUM A;  2N7D A;  2WDQ B;  1WGH A;  1E6E B;  2K1F A;  2CHX A;  1C1Y B;  2QMT A;  3VR9 B;  1E7U A;  3U4E G;  5LLI A;  2KDF B;  2IY1 B;  1F77 A;  2W3S A;  3RZW C;  3U7D A;  2ICI A;  1T0Y A;  2KDE B;  4RMA A;  4D2K A;  1TJE A;  4W9C A;  1EU4 A;  5FR6 A;  2NTS A;  4MAC A;  5KHQ A;  4NY0 A;  3BII D;  4WWP A;  4LTU A;  2M1M A;  1VD2 A;  3VR8 B;  1VZ7 A;  3KLS X;  1NYR A;  1TIF A;  1NDD A;  3DBL I;  2IGD A;  3IT4 B;  1K8R B;  2W55 A;  4ICU A;  4LJP B;  2KXJ A;  3VHT C;  1OQY A;  4RGN A;  3ETR A;  3PTF C;  2KTR A;  3LJ3 A;  1WM3 A;  2O6V A;  4DBG A;  2GBK A;  4YSX B;  3ZW3 A;  1EUV B;  4JQW C;  4J6I A;  4K3C A;  2YLM A;  3DPD A;  2WX1 A;  1YQ3 B;  3QA8 A;  1KJT A;  1BML C;  1F2R I;  2Z0D B;  2WS3 B;  2M19 A;  3HK0 A;  1MPE A;  3MHS D;  1WGD A;  3P42 A;  2L05 A;  2IBI B;  1SIJ A;  1ZXI A;  3CST A;  4P1C C;  4OVZ A;  4HVB A;  2LJI A;  2PLP A;  4KZC A;  4NPN A;  3IXS A;  3N9Y C;  3ZNI D;  1GOZ A;  1J19 A;  4B0E A;  2J0M A;  2DWQ A;  1TZO A;  3EFU A;  2V1Y A;  2BKF A;  2CR5 A;  1WM2 A;  2OHF A;  1OQR A;  2MX2 A;  2XN9 C;  4W9I A;  1HQR D;  3TSS A;  3EC8 A;  4HCP B;  2WXM A;  1C9F A;  2KN5 A;  1SIF A;  5FK9 C;  4JX1 C;  5MPO A;  1V80 A;  1NI2 A;  1WXQ A;  3OJ4 B;  4XZ4 A;  4FJY A;  2QCZ A;  4EEW A;  4GDL A;  4WJO A;  3PZD A;  1YNT E;  3PVL A;  3WA0 A;  4XWT A;  3NY5 A;  3NS8 A;  5C2T B;  4G50 A;  3AEC B;  2WHI A;  3RUI B;  2KMA A;  4KV2 A;  2LUE A;  1R4N I;  1K53 A;  2LGD A;  5IO9 A;  3V6C B;  2H89 B;  2KZR A;  3PRZ A;  2DZJ A;  2J0J A;  4GSW A;  1ZDV A;  4KSL C;  3GZN B;  3U30 A;  1D6E C;  4AS1 A;  1PDX A;  5BYR A;  2WQY B;  2K9X A;  2J42 A;  3GE8 C;  5TSS A;  5KHO A;  2KOX A;  1V1O A;  2DBY A;  2CHZ A;  1IGD A;  1HXY D;  3RMK C;  2KMM A;  1AYF A;  4W9K A;  4YSZ B;  3FAH A;  1FXT B;  1GB4 A;  4WJQ A;  2D5G A;  1JRP A;  2KJH B;  4MEM A;  4OZC A;  3I3T B;  1YX6 B;  4MSM B;  4HDO A;  2JUO A;  3AEB B;  3WAO A;  3M62 B;  4IWP A;  2KAC A;  1ACC A;  3HUI A;  1S3S G;  3P4S B;  1TZ1 A;  5J17 A;  3KUC B;  3KYD D;  4XX5 A;  4A90 A;  4TUU A;  1S1Q B;  1CZP A;  2O6V D;  2V3P A;  2KJ6 A;  1KLG D;  1P9D U;  2MSE D;  2JVC A;  4AOF A;  4KIK A;  1IGC A;  2WWZ A;  1WI0 A;  3DBH I;  2WDV B;  1HZ5 A;  1DOX A;  3U52 E;  2DZK A;  3TL5 A;  2AX5 A;  3MP9 A;  2DX5 B;  1YOV B;  3HVD A;  4XDC A;  3MC8 A;  3QIJ A;  3DBR I;  3H7P A;  5EE9 A;  1JQ4 A;  3P4Q B;  3DQV A;  1JWS D;  3TEW A;  2QIL A;  3AEF B;  3W5V B;  2KDM A;  3URY A;  2H88 B;  1DGJ A;  4IC7 B;  4DXA B;  3GP7 A;  2M56 B;  2JRI B;  4LCD E;  3R8B A;  3NRZ A;  3GE3 C;  3ZNG C;  3VTV A;  1N6Z A;  4M8N A;  3NUH B;  2Y5P A;  4NQL B;  3VFK A;  3P63 A;  2LVP A;  4AJW A;  4HWI B;  3K9P B;  3R66 C;  2AQ3 B;  1FXI A;  4TV3 A;  1JWM D;  1WMH B;  3QAR A;  1WMH A;  2ZNV B;  2KVR A;  1C78 A;  2I38 A;  2N1V A;  2BYE A;  1LFD A;  2W54 A;  2JZP A;  4K7W A;  1FIQ A;  3OWE B;  1ESF A;  2OJW A;  3PHW B;  2G9H D;  1WF9 A;  2UYZ B;  1MVK A;  2BYT A;  1KTK A;  4RFB A;  1L4D B;  2LZ6 A;  2PW9 A;  4B0M A;  3Q3M C;  2WYQ A;  2AL3 A;  1F52 A;  1WGY A;  4RM9 A;  5AZF A;  2KFJ A;  4NAW A;  1F1H A;  2QSD A;  1XEE A;  3SEB A;  3UI3 A;  1JWB D;  4XYC A;  2DNF A;  3C8Y A;  1WZ0 A;  1I4Q A;  1I7H A;  1PUT A;  2DYO A;  4J3O D;  2LRW A;  3A9J B;  1FEH A;  5CHF A;  3V62 A;  4F8C B;  4DDI D;  3AU5 A;  4JWS C;  4FAD A;  4P7I A;  1XLN A;  4EZK A;  4JGH B;  3AE2 B;  2N9P C;  2DHZ A;  3RNC C;  1WSP A;  1V2Y A;  1EU3 A;  1TTN A;  4IKG A;  3HVZ A;  3TMP B;  3ZJU A;  2UWQ A;  1C3T A;  1JML A;  3LB8 C;  3E9S A;  1MHH E;  3BVG A;  2L52 A;  1WGR A;  4MGK E;  2AQ1 B;  5C3J B;  2KJR A;  3M3J A;  3VUX A;  1E8Z A;  4IOI E;  4HEA 1;  2HD5 B;  1VJK A;  3ZKJ C;  2WDT B;  2BGF A;  1YD8 U;  3GS2 A;  4HKZ E;  4MM3 A;  1TYG B;  2ZCB A;  3BYT B;  3QCA A;  3WIM A;  3L0W B;  4I6N B;  4HDQ A;  2BB6 A;  4EUT A;  3Q14 C;  1ET9 A;  2AWT A;  2VH1 A;  1QF6 A;  4LDT D;  2KQ7 A;  2LAS A;  1WJ6 A;  3VQI A;  2M0A A;  1JWA D;  5H8Y E;  3AE1 B;  2N1W A;  4FA6 A;  1XD3 B;  4MGY E;  4PS7 A;  4K3B A;  2IO1 B;  5LNK 1;  3Q8F A;  4I6P A;  2GOW A;  5JXV A;  5LXH A;  3DDC B;  3N1Z C;  1I4H A;  5E6J A;  3ABV B;  4LDT B;  2LXC A;  1DYQ A;  1WR6 E;  4XWW A;  3QQ8 B;  4DXG A;  1I42 A;  4ARI A;  4NQK E;  1T0R C;  3N3K B;  2WXJ A;  3ZNZ B;  2I1J A;  4FUL A;  5AUK A;  1JWU D;  3GZN I;  1SJE D;  4QAY A;  2MHJ A;  3ML8 A;  1NBF C;  4MEL A;  3EA6 A;  3M95 A;  1VLB A;  1C4A A;  4WAF A;  3PZ7 A;  2BTE A;  4MJS A;  2VRR B;  2J7Q B;  3MFG A;  1L6V A;  1B1Z A;  1NEN B;  2R2O A;  4M00 A;  1ET6 A;  3MC0 B;  3N1X C;  3BYY B;  2LWP A;  1TKE A;  4PYZ A;  3RZF A;  5HI1 A;  4RGO S;  3MJ5 A;  3O13 A;  4WQM A;  4K7U A;  1ZOY B;  2NBW B;  4CQN A;  2L8J A;  1D3Z A;  2XBB C;  2FCM A;  3P2B A;  4US8 A;  3TIX A;  2Z8L A;  3ZNH B;  1C4C A;  3IFW B;  4TMA B;  3VUW A;  3B08 A;  1R4M B;  2LHD A;  4DHJ D;  2GBJ A;  4KX6 B;  4C7Z A;  1V86 A;  4II3 B;  4MT5 A;  3CSF A;  1I4R A;  1T6B X;  1QZE A;  2DYM A;  4YT0 B;  4KSK C;  5CX3 A;  1JW9 D;  1V97 A;  2MBB B;  4W9D A;  3ZRC A;  2D07 B;  3P4P B;  4A3O A;  3U7Z A;  1ROE A;  3SU8 X;  5JHB A;  1V6E A;  1TKG A;  3VTW A;  2RDB C;  4RGM A;  2QDF A;  3AE4 B;  3NVY A;  1E10 A;  4W9J A;  2GLS A;  1VCB A;  4NNJ B;  1JCK B;  1LGR A;  2JZZ A;  3PZ8 A;  2JXT A;  4RF0 A;  2ONQ A;  1LO5 D;  2SAK A;  5J18 A;  4WH4 A;  4II2 B;  2DLB A;  2HTM E;  4DQO C;  3KUD B;  3APD A;  3EGR A;  3DOW A;  4WJN A;  4GN1 A;  2KT7 A;  1K50 A;  3X0W A;  3RYT A;  5D6J B;  4AJY B;  4C4V B;  1N60 A;  4MSQ B;  1KLU D;  4E74 A;  3AED B;  2KX3 A;  3LYY A;  2CJO A;  4LJO B;  2K8C A;  3QWZ B;  2LJ5 A;  4EZJ A;  3AI5 A;  3FC4 A;  4ICV A;  4KKI A;  2N7E A;  2RDH A;  3D32 A;  1V5O A;  3IBE A;  4AQ7 A;  1UF0 A;  3MC9 A;  2OJR A;  1G6J A;  5G2N A;  1VZ8 A;  1SE4 A;  3FIL A;  2N9K A;  3ZYY X;  4CO7 A;  4KIK B;  3NHE B;  2DZM A;  2RSU A;  2ZPN A;  1GNU A;  3W9C B;  4WIP A;  1HEZ E;  2WXF A;  2INC C;  1FCL A;  2EMS A;  4ZYS A;  1Q0W B;  2LD9 A;  4OW0 A;  2N9X A;  4HRS A;  5BMG A;  2JWU A;  3JYU A;  3KQ4 A;  2WDR B;  3VAW A;  5JH5 C;  3AE8 B;  4WWN A;  2FCS A;  1L0X B;  2BQQ A;  1J0G A;  2IND C;  2W9N A;  3A9J A;  3T9L A;  3QX1 A;  3AM9 A;  2R61 A;  4JPS A;  3ZQ4 A;  4OVV A;  3IAM 1;  1DOI A;  4A3P A;  3U2S C;  1PGB A;  4EFO A;  4HLE A;  2KFK A;  1WJN A;  3U8Z A;  4A20 A;  2MEK A;  3ZIM A;  3ZJV A;  5D2M B;  5IKC M;  3SD5 A;  1YMH E;  3K9O B;  3Q8B A;  2L1A A;  3Q6B A;  1FRR A;  5E6N A;  2XNA C;  3A1Q A;  1X1M A;  3OAW A;  1K52 A;  1E7P B;  2KHW B;  2O2V A;  1EF5 A;  2KO3 A;  2DAJ A;  3PPA A;  3OJ3 A;  1TS3 A;  2BWE S;  2RDG A;  2JT4 B;  4BVU C;  2KDB A;  2FNJ B;  3KW5 B;  3NG0 A;  1R4N B;  1UGJ A;  3AU4 A;  2MW5 A;  4Q2J A;  1FM0 D;  3BY4 B;  3ONS A;  2MBE A;  2UU7 A;  3W1Y A;  2JYT A;  4BKT A;  1STE A;  4I6L B;  3V3X A;  1F0Z A;  2AL6 A;  3Q8C A;  2WU2 B;  3ENE A;  4AP4 C;  1XQQ A;  1QOB A;  2FBW B;  3GOE A;  2KMC A;  4NJ7 A;  3SHQ A;  3AV8 A;  1Y56 A;  3H7P B;  4JLC A;  3PV1 A;  2V3N A;  3EEC A;  2KQ4 X;  2J53 A;  2KVZ A;  1GAQ B;  1FPY A;  5AZH A;  4GXB A;  4RCO A;  2N9L A;  3BVM A;  3TUO A;  3I5J C;  4M0W A;  2WXI A;  3B0A A;  3AXC A;  2MA9 B;  4W9H A;  2FE8 A;  4MH8 A;  1YQB A;  3MTN B;  1N61 A;  4PK1 A;  4MDK E;  4PS8 A;  2AYO B;  2RPV A;  1KFY B;  4HPL B;  3GB1 A;  3V60 A;  5L83 A;  5AEK B;  2YEP F;  3L17 A;  5GMV A;  1WX9 A;  1FMA D;  4USA A;  3EHV A;  2IJ0 A;  1A70 A;  3ZXV A;  5LXI B;  4OZA A;  4LNK A;  1I4G A;  2BVC A;  2ZPY A;  2ACZ B;  3W1S A;  3QC8 B;  4NJ6 A;  1L7Y A;  3PO0 A;  2BW2 A;  2WX0 A;  2LFI A;  2BBC A;  3IG3 A;  4RNA A;  1TGZ B;  3HM3 A;  3KVF B;  2BF8 B;  4ARC A;  2HJ8 A;  5IAA C;  3L54 A;  2MCN B;  2NTT A;  1T3Q A;  1FXA A;  4IM3 A;  1SE2 A;  1XXG A;  2BS3 B;  2KTR B;  3C0R B;  1D4B A;  1KM7 A;  1HTO A;  4ZHO A;  1IBX B;  2TSS A;  2MRP A;  1VDV A;  4ZRQ A;  2HTH A;  1HE8 A;  1N62 A;  1K51 A;  2RMM A;  2KN4 A;  2B76 B;  2LGI A;  2V4I B;  4L2Y A;  2X38 A;  3ZUN A;  2MBO A;  3PRM B;  1WXV A;  3ZO5 B;  1UWM A;  3AE6 B;  3QJZ A;  2ZW1 A;  2PVG C;  2MQJ A;  3KUZ A;  4GDL B;  1FFU A;  3DHH C;  3EUB 2;  4ANW A;  1UGM A;  1OGW A;  3AEG B;  4HXD A;  3TJP A;  1YN3 A;  4MM3 B;  2IPK D;  1WRI A;  2JQR B;  2KFK B;  4C80 A;  1QOF A;  1MI0 A;  2CJN A;  1LXD A;  3RNG C;  4G3X B;  3UGB B;  4A55 A;  2ZVO A;  2IZV B;  2N9E B;  4P1B C;  4HPM B;  1T5X D;  2WXK A;  1Q10 A;  2JZ3 B;  4GMV A;  1UH6 A;  1YJ1 A;  2LMC A;  2MLB A;  5EE3 A;  2PMV A;  4HCN B;  1ZKH A;  3AH7 A;  3RD2 A;  3VRB B;  1RLF A;  1J7A A;  3EFC A;  1P3Q U;  1JRO A;  5IP4 D;  4FN2 A;  3L4P A;  1VR9 A;  2XEW A;  3RNE C;  2MJE A;  2L0F A;  2IGH A;  1MHX A;  2MJ3 A;  3NS1 A;  4GOC A;  4W9G A;  1E8W A;  5C1Z A;  2KWV B;  3AE9 B;  5E6P A;  2MBH A;  2W3R A;  2NPT B;  3S2A A;  3QHT A;  4OVU A;  3RT3 B;  1C77 A;  5DPS A;  2YEP B;  4ZRK A;  3RNF C;  1RAX A;  3NVW A;  4F1S A;  1UUP A;  3PS6 A;  3M63 B;  3C19 A;  4M02 A;  1WZ3 A;  4YWG G;  1QKZ A;  2WXN A;  2K25 A;  3VRA B;  2K8B A;  2FAZ A;  1OEY J;  4ASW C;  1YX5 B;  1E7V A;  4GLS C;  4HK2 A;  3AN1 A;  5GXG B;  4FHJ A;  3ZGZ A;  1EF1 A;  1PQS A;  2REX A;  2CHW A;  3AE7 B;  1WFY A;  1L6U A;  4URK A;  1EM7 A;  4LNF A;  2L3Z A;  2RR9 A;  3DVN V;  2V4L A;  2Q5W D;  5H92 C;  3W2D A;  5BYQ A;  4KGT A;  2CU1 A;  4CHK A;  1YQ4 B;  2D11 A;  2A5U A;  4YXD B;  1GB1 A;  3ECI A;  1AW7 A;  1T0S C;  1KOT A;  4ZHP A;  4N59 A;  3H6N A;  3HIZ A;  4G11 A;  4FJZ A;  2J0K A;  3ZXR A;  4LNN A;  3DBS A;  4KGS A;  4K7S A;  5AZG A;  2LVO A;  1U4A A;  1XCQ L;  2WXR A;  3TCA A;  5FKA C;  1L0Y B;  3RCZ A;  2JU6 X;  2NCN A;  4WQO B;  4IWO A;  3NZS A;  5CHW A;  2IY0 B;  3ZRF A;  3APC A;  3DVN U;  1SGH A;  4HJG E;  4E71 A;  5BMH A;  1UEL A;  5JZE B;  2KLG A;  3DBH B;  3ZDT A;  2BS4 B;  2LGY A;  4O1N A;  3TEX A;  4BKS D;  1XLP A;  4ZRP A;  4AUQ C;  2BKR B;  4K1R B;  4PYU A;  4PS3 A;  1SE9 A;  2K22 A;  1E90 A;  5EE0 A;  4X57 B;  2KC2 A;  4MJS B;  3SFE B;  1Z2M A;  1WY8 A;  4EE2 A;  2HE7 A;  2MBQ A;  5DPT A;  2ASQ A;  2Y5B B;  3O65 B;  2G45 B;  1I4X A;  3UQB A;  2D3G A;  2GBN A;  2IO0 B;  4JL9 A;  3FIL B;  3RNB C;  2QEJ C;  1QQR A;  1UD7 A;  2INN E;  3BVZ A;  2XK5 B;  1N63 A;  5HG2 A;  2JWZ A;  1KRH A;  1C4P A;  2M0X A;  3NOB A;  1MJD A;  2DAF A;  4ACF A;  2X8X X;  5DPR A;  1CK1 A;  2ZW0 A;  4IM0 A;  3KWL A;  1QIL A;  2IO3 B;  5DCN A;  1ZDX A;  1XLO A;  3A9K A;  1RWS A;  3DCG A;  4P16 A;  2QJL A;  3IT6 B;  2LVQ A;  1GC7 A;  3CIR B;  5TR5 A;  4JIO U;  5HHD G;  4DHZ E;  2DEN B;  2WXQ A;  1HA5 A;  2VZK B;  2PE6 B;  3BK2 A;  2JXX A;  4B95 A;  1TY2 A;  3ZTC A;  4YL8 A;  4RGT A;  1XO3 A;  3L16 A;  1YJI A;  2CU3 A;  2PIA A;  3CWI A;  1C76 A;  1J7C A;  2IYD B;  3PT2 B;  3SFD B;  2C7N B;  3KYC D;  1SE3 A;  3CMM B;  3SR6 A;  3RN9 C;  1AAR A;  2JX5 A;  2WXP A;  3PLU A;  4DXF A;  2BYF A;  2RD0 A;  1QOG A;  2R2Q A;  5I4D A;  2LRU A;  3JSV B;  4TQ1 A;  1GPX A;  2LHE A;  4KDL B;  4HJK A;  3I63 C;  1FNW A;  2KWD A;  2FCN A;  4GB9 A;  2W82 A;  2K0P A;  2KWC A;  3NZ3 A;  1ZUD 2;  2C9W B;  1NYQ A;  4PT5 A;  2BB5 A;  3AE5 B;  2I2Y A;  1FD6 A;  2EEL A;  3Q8A A;  1UBI A;  4LLG M;  3UIO B;  2Z0E B;  5CHV C;  3H9D A;  1Q1O A;  3W1S C;  2KTF A;  1CQV A;  2FID A;  4JE3 B;  2K3U A;  3KH0 A;  3NVV A;  2PKO A;  3A4R A;  2O6V B;  4XE0 A;  2LXA A;  2KLC A;  2KAJ A;  3BIN A;  4H2A A;  3IVF A;  1AN8 A;  3LXF A;  2MP2 B;  1XLQ A;  1JAL A;  3AMZ A;  3P1M A;  4XC2 A;  2K8H A;  4GIV A;  3B2G A;  3AE3 B;  3JSV A;  3NZU A;  4RM8 A;  4IDI A;  3IAS 1;  1AWD A;  1WE6 A;  3OLM D;  4OZB A;  2KK8 A;  1QLB B;  3VDZ A;  2NVU I;  1KF6 B;  2DZI A;  4C00 A;  4ZYN A;  1F2R C;  2V9H A;  2M8S A;  3PGE A;  2FCQ A;  1YN4 A;  1H4R A;  2ON8 A;  2QC8 A;  2O2V B;  2WXL A;  2JSV X;  1WYG A;  1IP9 A;  1V8C A;  2D3A A;  5J2R A;  2OED A;  3N1Y C;  4FJV B;  1SBB B;  2N7J A;  3ZLZ A;  4BFR A;  1RFK A;  2N0S B;  1WXM A;  5D3I B;  1WE7 A;  2KX0 A;  3VVW B;  3W5U B;  2C60 A;  1Q5W B;  1FNV A;  1PGA A;  2BWF A;  2HDE A;  4NJC A;  2WGS A;  3Q8E A;  1PYW D;  4W9E A;  4EOY A;  5AUI A;  3H7S A;  2C5L C;  3HRD D;  2Y3A A;  4LNI A;  2WU5 B;  3PSE B;  4TQ0 A;  3ML9 A;  2JYE A;  4NZL B;  1T0Q C;  3A9K B;  1MFW A;  1YIW A;  2IO2 B;  4MH0 E;  2RGF A;  2L83 A;  3T3N A;  3Q2A C;  3N20 C;  3L13 A;  3A4S C;  3WAM A;  3OG5 A;  2MH7 A;  2D2Q A;  1WH3 A;  2JPH A;  3N30 A;  3V6E B;  1XF5 L;  3DWM A;  2ZCC A;  4DHJ B;  3PRP B;  2WXG A;  3Q69 A;  2J52 A;  1V5T A;  3WAN A;  2GMI C;  1FFV A;  1NEK B;  4EZL A;  1TS5 A;  2J4X A;  3HHM A;  3WAP A;  2WLB A;  3L10 B;  4ANU A;  4M0W B;  1PGX A;  1CJE A;  4BBN C;  4C7Y A;  4UDU C;  4KDI C;  1VRA B;  1BUI C;  4M01 A;  1YN5 A;  4FLH A;  1IYF A;  4IM2 A;  3MJW A;  2A4Z A;  1BT0 A;  4A9A A;  3Q3J A;  1HTQ A;  1UZX B;  2GBM A;  2OOB B;  4A6Q A;  1WYW B;  4REZ A;  3DHI C;  1ENF A;  4XDD A;  2KC1 A;  2SEB D;  1J8C A;  2CS4 A;  1FRD A;  3V61 A;  5D3D A;  2VH2 A;  1PFD A;  4MGZ E;  3L08 A;  3R2I A;  1SSN A;  4GGQ A;  1WIA A;  1TT5 B;  3I57 A;  2MJD A;  3A1Q B;  1RRB A;  1E8Y A;  1DOY A;  4YTM B;  4LNO A;  1E8X A;  2LGX A;  1GC6 A;  2NMQ A;  4WWO A;  1OQQ A;  1L2N A;  4FXC A;  1TS2 A;  5EDS A;  3RUL A;  3VH3 B;  3CF6 E;  1V49 A;  5IOI A;  2LI5 A;  3T3O A;  4N58 A;  2PVO D;  5D7G A;  1UBQ A;  4A8X C;  1Z5S B;  2D3C A;  4JWU C;  3SDL C;  2BPS A;  4DK5 A;  3VUY A;  3R7Q A;  1SXT A;  4K81 A;  1YJJ A;  3NJT A;  4WUR A;  4WWM A;  2NPT A;  3PHX B;  5G5G A;  3UIP B;  3B2F A;  2NS5 A;  2L32 A;  1Y8R C;  1D5X C;  3IHP C;  1GUA B;  2INP E;  1LM8 B;  1RFA A;  1TY0 A;  2Y5C A;  1WR1 A;  2C7H A;  2KAN A;  1FO4 A;  3I9V 1;  1C79 A;  2K39 A;  4HPP A;  2L0T A;  2PTL A;  3UF8 A;  1WX7 A;  5E6O A;  2G1E A;  1EO6 A;  3JVZ X;  1P1A A;  2M17 A;  4BKS A;  2JF5 A;  2FUH B;  1WWT A;  1H8C A;  1ZGU B;  1BXT A;  4F7Z A;  4GDK A;  1WGK A;  5EE1 A;  3X23 A;  3DWG C;  1SB3 C;  3V05 A;  3DBL B;  1E9M A;  3RI7 C;  3AUL A;  2LEK A;  1P98 A;  3DVG X;  4RH6 A;  1ISN A;  2EKE C;  3P4R B;  3NVZ A;  1MG4 A;  4R3D A;  1XCT L;  5BO4 B;  4N6E B;  4GU2 A;  2ZNV C;  5IA7 A;  1QOA A;  1ZE3 D;  1OTR B;  1XT9 B;  4ZOH C;  1V1P B;  1I4P A;  4G0N B;  1SJH D;  3MHZ A;  1GJZ A;  3TBL D;  2IGG A;  4ANX A;  1RM6 C;  4L23 A;  1V1P A;  2KNB A;  2GBR A;  1IBX A;  1JRU A;  2CKH B;  3ALB A;  4ZRJ A;  1L5P A;  1L0V B;  3J9C A;  1WGG A;  2G4D B;  1EWY C;  3PRE A;  1ZW7 A;  4IWQ A;  1IPG A;  4OHJ A;  2AQ2 B;  4YTP B;  4HKQ A;  3E56 A;  4BOZ B;  2JRH A;  1UWX A;  2MP2 A;  2PJH A;  2EMT A;  2XK5 A;  4M8M A;  2G4S A;  1WXA A;  1QT9 A;  2V0G A;  3B9J A;  4US9 A;  3AEE B;  1WRD B;  2VZK D;  2L00 B;  3R3M A;  4WAA A;  2M4N A;  1R4M I;  2E6X A;  4GDK B;  1F9J A;  1V9J A;  4IG7 B;  4KVG B;  3DBR B;  1CMX B;  4C56 C;  4KKJ A;  3JW0 X;  4BZA A;  1WJU A;  5JHA A;  1TS4 A;  3TEY A;  3WCQ A;  1SF0 A;  1KLV A;  1TKY A;  4WJP A;  3BWU D;  4BBN F;  4N9F 4;  2QIE B;  5DPW A;  1IUE A;  3H8H A;  1D5M C;  3APF A;  5BYS A;  4TSS A;  1N5X A;  1M94 A;  2ZJD A;  2E3T A;  2WP9 B;  4S17 A;  4FHK A;  2RPQ A;  3RNA C;  4EKU A;  2BT6 A;  5FR3 A;  1WXS A;  4NAW B;  1ZPS A;  3T8M A;  3VTU A;  2QHO A;  2B3A A;  5D94 A;  5G5H A;  2PPH A;  1I35 A;  1B9R A;  4P6V F;  1OFF A;  1LQB A;  3Q3N C;  5HKH A;  4DDG D;  4FBJ B;  5BMI A;  2N4F A;  2JY6 A;  2NBU A;  1NI3 A;  2GI9 A;  3B1L X;  4TKN A;  1E5W A;  4LK0 M;  1J7B A;  4BAX A;  3LDZ E;  1FNU A;  2G3Q B;  4E3C A;  1P7E A;  2IDY A;  2KKC A; 
#chains in the Genus database with same CATH homology
 1KTK A;  1ZP0 B;  3LXF A;  3BVM A;  3TUO A;  4RFB A;  1XLQ A;  1JAL A;  3AMZ A;  3P1M A;  4M0W A;  1L4D B;  3B2G A;  2WXI A;  2PW9 A;  1VZ6 A;  3AE3 B;  4B0M A;  1P7F A;  2WNM A;  2FE8 A;  4MH8 A;  1N61 A;  4IDI A;  3RFZ B;  3IAS 1;  1AWD A;  4OZB A;  2QSD A;  1HZ6 A;  2RPV A;  1KFY B;  1XEE A;  3SEB A;  3GB1 A;  3UI3 A;  1JWB D;  1QLB B;  5T8I A;  2YEP F;  1KF6 B;  4RCO A;  4USA A;  1FMA D;  1R7S A;  2IJ0 A;  1F2R C;  3C8Y A;  1A70 A;  1I4Q A;  1YN4 A;  1I7H A;  1PUT A;  4OZA A;  2ON8 A;  1I4G A;  4RF1 A;  5HFY A;  2WXL A;  2DYO A;  2JSV X;  4J3O D;  1WYG A;  1V8C A;  2ACZ B;  3W1S A;  1FEH A;  4NAM A;  2OED A;  1N5W A;  1SBB B;  3PO0 A;  1SEB D;  2BW2 A;  3KWV A;  4JWS C;  2N7J A;  1XLN A;  1RFK A;  1ZXH A;  2LFI A;  2BBC A;  3TEZ A;  4RNA A;  2N0S B;  3AE2 B;  4L1B A;  5D3I B;  1NVI D;  3W5U B;  4ARC A;  3BZD B;  1FNV A;  1PGA A;  4NJC A;  2HDE A;  1WSP A;  2NTT A;  1EU3 A;  1T3Q A;  3Q8E A;  1FXA A;  1SE2 A;  1XXG A;  4IKG A;  3HVZ A;  4ITK A;  1PYW D;  3ZJU A;  2BS3 B;  1JML A;  3LB8 C;  1D4B A;  5AUI A;  3E9S A;  3AEA B;  1MHH E;  2WXH A;  3HRD D;  4ZHO A;  3BVG A;  3BK1 A;  2Y3A A;  2TSS A;  1IBX B;  2L52 A;  2WU5 B;  1VDV A;  4ZRQ A;  2AQ1 B;  5C3J B;  4TQ0 A;  1N62 A;  2GB1 A;  1K51 A;  2RMM A;  2KN4 A;  2JYE A;  4IOI E;  1D5Z C;  4HEA 1;  4YSY B;  1RYJ A;  3R2T A;  4NZL B;  2B76 B;  1VJK A;  2LGI A;  4YTN B;  2V4I B;  1UNS A;  4L2Y A;  2X38 A;  3GS2 A;  2L83 A;  3T3N A;  1UWM A;  3AE6 B;  4HKZ E;  4HRO A;  1L4Z B;  1TYG B;  2ZW1 A;  3BYT B;  2PVG C;  4GDL B;  2GRI A;  1FFU A;  3EUB 2;  2MH7 A;  1FCC C;  3RPF C;  2BB6 A;  2WXO A;  3AEG B;  1ET9 A;  1KH0 A;  1QF6 A;  4KGR A;  1YN3 A;  2BS2 B;  1XF5 L;  3AB5 A;  3DWM A;  4MM3 B;  2IPK D;  1WRI A;  3VQI A;  2M0A A;  2JQR B;  4C80 A;  1JWA D;  2WXG A;  1QOF A;  5H8Y E;  1MI0 A;  3Q69 A;  2J52 A;  3AE1 B;  3ZJT A;  1FFV A;  2CJN A;  1NEK B;  1M4V A;  2K5P A;  1E0Z A;  1TS5 A;  2EKI A;  2J4X A;  5LNK 1;  2WLB A;  3Q8F A;  1EWC A;  2FUG 1;  2LUM A;  2WDQ B;  5JXV A;  1E6E B;  4A55 A;  1PGX A;  1I4H A;  1CJE A;  4C7Y A;  2QMT A;  3VR9 B;  4UDU C;  1T5X D;  5E6J A;  2WXK A;  1Q10 A;  1VRA B;  1BUI C;  3U4E G;  1YN5 A;  3ABV B;  2LMC A;  5EE3 A;  1F77 A;  2PMV A;  4A9A A;  2W3S A;  1DYQ A;  3AH7 A;  4XWW A;  3VRB B;  2ICI A;  4D2K A;  1TJE A;  1EU4 A;  4DXG A;  4ARI A;  1AN8 A;  1J7A A;  2NTS A;  4MAC A;  1JRO A;  4A6Q A;  3L4P A;  3BII D;  2WXJ A;  1VR9 A;  4REZ A;  2MJE A;  5AUK A;  4LTU A;  1ENF A;  4XDD A;  1JWU D;  1SJE D;  2IGH A;  1MHX A;  2MJ3 A;  3NS1 A;  2SEB D;  3VR8 B;  1VZ7 A;  3KLS X;  1NYR A;  1FRD A;  2IGD A;  3EA6 A;  3IT4 B;  2W55 A;  1VLB A;  1C4A A;  3AE9 B;  5D3D A;  4WAF A;  2W3R A;  3PZ7 A;  2BTE A;  1PFD A;  3MFG A;  1L6V A;  1C77 A;  2YEP B;  3R2I A;  1B1Z A;  1SSN A;  1NEN B;  3ETR A;  4RGN A;  3NVW A;  1ET6 A;  1UUP A;  3MC0 B;  3I57 A;  4YWG G;  1QKZ A;  3BYY B;  2MJD A;  1TKE A;  2WXN A;  1DOY A;  3VRA B;  4YSX B;  4YTM B;  4GLS C;  5HI1 A;  2NMQ A;  4RGO S;  3AN1 A;  3MJ5 A;  5GXG B;  1OQQ A;  1YQ3 B;  3O13 A;  4WQM A;  3ZGZ A;  4FXC A;  1TS2 A;  1BML C;  1F2R I;  1ZOY B;  2WS3 B;  4CQN A;  2M19 A;  3AE7 B;  1MPE A;  1L6U A;  3T3O A;  4N58 A;  4US8 A;  2PVO D;  2Z8L A;  5D7G A;  3P42 A;  1C4C A;  1EM7 A;  1SIJ A;  1ZXI A;  4TMA B;  4A8X C;  4JWU C;  4OVZ A;  2Q5W D;  2LJI A;  2PLP A;  5H92 C;  3W2D A;  5BYQ A;  4KGT A;  3IXS A;  2LHD A;  3N9Y C;  1SXT A;  1YQ4 B;  1GOZ A;  4KX6 B;  4YXD B;  1GB1 A;  1YJJ A;  4B0E A;  4C7Z A;  2DWQ A;  1AW7 A;  4WUR A;  1TZO A;  4WWM A;  4MT5 A;  4ZHP A;  4N59 A;  5G5G A;  1I4R A;  1T6B X;  2OHF A;  3B2F A;  1OQR A;  2L32 A;  2DYM A;  4YT0 B;  2XN9 C;  1D5X C;  1HQR D;  3TSS A;  1JW9 D;  2INP E;  1V97 A;  2WXM A;  1C9F A;  4KGS A;  1TY0 A;  3P4P B;  5FK9 C;  4JX1 C;  1XCQ L;  2WXR A;  2Y5C A;  3U7Z A;  5MPO A;  1ROE A;  1FO4 A;  3I9V 1;  1TKG A;  1WXQ A;  5FKA C;  1C79 A;  1L0Y B;  2JU6 X;  2PTL A;  4RGM A;  3AE4 B;  3NVY A;  1E10 A;  2G1E A;  1YNT E;  1JCK B;  4HJG E;  5BMH A;  4XWT A;  3PZ8 A;  2JXT A;  4RF0 A;  2ONQ A;  1WWT A;  5C2T B;  1LO5 D;  2BS4 B;  3AEC B;  1BXT A;  2SAK A;  4O1N A;  4WH4 A;  3TEX A;  2DLB A;  2HTM E;  4DQO C;  1XLP A;  3EGR A;  1WGK A;  5EE1 A;  1K50 A;  4ZRP A;  3DWG C;  1K53 A;  1SB3 C;  2K22 A;  3V05 A;  5EE0 A;  2H89 B;  1E9M A;  2LEK A;  1N60 A;  3SFE B;  1KLU D;  4RH6 A;  3P4R B;  1ZDV A;  3AED B;  3NVZ A;  3LYY A;  4EE2 A;  2CJO A;  1D6E C;  4AS1 A;  1PDX A;  4R3D A;  5BYR A;  2WQY B;  1XCT L;  3FC4 A;  4KKI A;  2RDH A;  2K9X A;  2J42 A;  5TSS A;  4N6E B;  1V1O A;  4AQ7 A;  2DBY A;  1QOA A;  1ZE3 D;  1VZ8 A;  1SE4 A;  3FIL A;  1IGD A;  1I4X A;  2N9K A;  4ZOH C;  3ZYY X;  1HXY D;  3FIL B;  1V1P B;  1I4P A;  2KMM A;  1QQR A;  1SJH D;  1AYF A;  2INN E;  2QEJ C;  3MHZ A;  4YSZ B;  3BVZ A;  3FAH A;  3W9C B;  1GB4 A;  4WIP A;  2D5G A;  1N63 A;  5HG2 A;  1HEZ E;  2WXF A;  1JRP A;  1KRH A;  1FCL A;  4OZC A;  1C4P A;  2IGG A;  4ZYS A;  1RM6 C;  3AEB B;  4OW0 A;  4L23 A;  1V1P A;  4HRS A;  2KAC A;  1IBX A;  1ACC A;  5BMG A;  2JWU A;  1CK1 A;  3KQ4 A;  2WDR B;  2ZW0 A;  3HUI A;  3P4S B;  1L5P A;  1L0V B;  3J9C A;  3KWL A;  3AE8 B;  1QIL A;  1EWY C;  1L0X B;  1ZDX A;  1XLO A;  2AQ2 B;  1RWS A;  4OHJ A;  4P16 A;  2QJL A;  3IT6 B;  4YTP B;  4A90 A;  4HKQ A;  3AM9 A;  2R61 A;  3CIR B;  4JPS A;  2BYT A;  3ZQ4 A;  3E56 A;  5HHD G;  1CZP A;  1UWX A;  2V3P A;  2WXQ A;  3IAM 1;  1DOI A;  1KLG D;  1HA5 A;  2VZK B;  3BK2 A;  1IGC A;  1PGB A;  1QT9 A;  3U2S C;  2V0G A;  1TY2 A;  3B9J A;  4US9 A;  4RGT A;  1XO3 A;  2WDV B;  1HZ5 A;  1YJI A;  2CU3 A;  2PIA A;  2VZK D;  3AEE B;  3CWI A;  1C76 A;  1J7C A;  3SFD B;  1SE3 A;  3SR6 A;  1DOX A;  3U52 E;  2E6X A;  2MEK A;  2JX5 A;  4GDK B;  3ZJV A;  2WXP A;  2AX5 A;  3MP9 A;  4DXF A;  4C56 C;  4KKJ A;  3HVD A;  4XDC A;  1YMH E;  1TS4 A;  3Q8B A;  3TEY A;  1QOG A;  2L1A A;  1SF0 A;  5EE9 A;  3WCQ A;  5I4D A;  1TKY A;  1FRR A;  2XNA C;  1JQ4 A;  3P4Q B;  4TQ1 A;  1GPX A;  3BWU D;  2LHE A;  1K52 A;  1JWS D;  2QIE B;  1E7P B;  1FNW A;  2KWD A;  1IUE A;  3TEW A;  3H8H A;  2QIL A;  1D5M C;  5BYS A;  2W82 A;  2K0P A;  1N5X A;  4TSS A;  3AEF B;  3W5V B;  2KDM A;  1TS3 A;  3URY A;  2H88 B;  1DGJ A;  2RDG A;  2E3T A;  2WP9 B;  3NZ3 A;  1ZUD 2;  3GP7 A;  2M56 B;  1NYQ A;  4PT5 A;  2BT6 A;  3R8B A;  2BB5 A;  5FR3 A;  1UGJ A;  3NRZ A;  4NAW B;  1ZPS A;  3AE5 B;  2I2Y A;  5G5H A;  4Q2J A;  1FM0 D;  1B9R A;  1FD6 A;  3NUH B;  2JYT A;  2Y5P A;  2EEL A;  4P6V F;  3P63 A;  1STE A;  1OFF A;  3Q8A A;  3V3X A;  1F0Z A;  4LLG M;  3Q8C A;  2WU2 B;  2AQ3 B;  1CQV A;  1FXI A;  1JWM D;  2K3U A;  1QOB A;  4JE3 B;  5BMI A;  2FBW B;  1NI3 A;  2GI9 A;  3NVV A;  1C78 A;  1J7B A;  2I38 A;  4LK0 M;  2PKO A;  1Y56 A;  3AV8 A;  4XE0 A;  2V3N A;  1FNU A;  2KQ4 X;  2JZP A;  2J53 A;  1GAQ B;  2W54 A;  2KAJ A;  1FIQ A;  1ESF A;  3OWE B;  2G9H D;  1P7E A;  2IDY A;  4H2A A;  1MVK A;  2N9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...