4ITKA

The structure of c.reinhardtii ferredoxin 2
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
MFKVTFKTPKGEKTIDVEADKYLLDAAEEAGMDLPYSCRSGGCSTCCGKLESGTVDQSDQNMLDEDQLKQGFVLTCVAYPTSDIVILTDQESKLPIGGSENLYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Apoferredoxin
publication title Crystal structure and biochemical characterization of Chlamydomonas FDX2 reveal two residues that, when mutated, partially confer FDX2 the redox potential and catalytic properties of FDX1.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
total genus 24
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4itkA00
2WDQB 3AE1B 1DOYA 5H92C 3VRAB 4YSYB 2WU5B 1J7CA 2Y5CA 3AEGB 3AV8A 3CIRB 1VLBA 1CZPA 1WYGA 1OQRA 1OQQA 2H89B 1YJJA 5EE0A 1DOXA 1V97A 1N5WA 2QIEB 4KX6B 2K5PA 1TYGB 2QJLA 1DGJA 1ZXIA 2PIAA 3PO0A 1SB3C 2OHFA 4US8A 5G5HA 1VJKA 1QOBA 3AE4B 3AE5B 1RYJA 1F0ZA 3LXFA 1PDXA 2CJNA 2HTME 3RPFC 1L6UA 2L83A 1QF6A 4USAA 1E0ZA 2PVOD 1RM6C 2BT6A 2MJDA 3AE3B 4ZHOA 1YQ4B 1PUTA 1KRHA 3P4QB 5AUKA 5H8YE 3NVWA 4US9A 1FFVA 1QOAA 5EE1A 2WDVB 4A9AA 4C7YA 3NVYA 2EKIA 1FO4A 1WRIA 1PFDA 1XLNA 4WWMA 3AEDB 2CU3A 2LEKA 1GAQB 2W3SA 1TKYA 1AWDA 1J7AA 1ROEA 4JWUC 1IUEA 1N5XA 3P1MA 2DBYA 1NVID 3W9CB 3ETRA 1N60A 2W55A 2WLBA 3ABVB 5EE3A 2JX5A 1ZOYB 3AEEB 3WCQA 4YSXB 3B2GA 3VRBB 3AE2B 4IDIA 3DWMA 2AX5A 1NEKB 3VR8B 3B9JA 1JRPA 2KAJA 2MH7A 1WXQA 2MJ3A 2W54A 4YT0B 1E9MA 2G1EA 3AE8B 1TKEA 2CJOA 5C3JB 2WP9B 2WU2B 3HRDD 1WWTA 1JROA 1FFUA 2L52A 4YTNB 1KF6B 1TJEA 3AE9B 1UWMA 1FRRA 3L4PA 3ZYYX 1B9RA 3HVZA 2WS3B 3AM9A 1GPXA 4N59A 1JW9D 2WQYB 3NVZA 3KWLA 4HRSA 1EWYC 5EE9A 1E7PB 1N63A 1SF0A 1QLBB 2BS4B 5MPOA 4N58A 2H88B 2MJEA 2DWQA 1JWBD 4WQMA 5GXGB 4JWSC 4C7ZA 2B76B 3SFDB 1DOIA 2E3TA 1R7SA 1E10A 1CJEA 3AMZA 3FAHA 3AH7A 1A70A 3AE6B 1SIJA 4FXCA 4JX1C 5AUIA 1TKGA 2PKOA 3LB8C 1FXAA 1NYQA 2BS3B 3VR9B 3AEAB 2ACZB 1FMAD 3AB5A 1OFFA 2JQRB 1RFKA 1AYFA 1ZP0B 1T3QA 1QT9A 1YQ3B 3P4RB 4ZHPA 4YSZB 2N0SB 5G5GA 3SR6A 4YTMB 3HUIA 2W3RA 3W5UB 3NS1A 1NYRA 2K9XA 3AEFB 3EUB2 4N6EB 2M56B 4YTPB 1I7HA 2WDRB 3BIID 4LTUA 4ZOHC 4YXDB 3P4SB 1L0VB 2Q5WD 1N62A 2K22A 1XO3A 1E6EB 1ZUD2 3AEBB 3FC4A 1FRDA 1J7BA 1NENB 3NRZA 3P63A 3NVVA 1FM0D 1N61A 2M19A 1FXIA 1WGKA 1L5PA 1QOFA 1VDVA 3AE7B 4ITKA 2BS2B 1FIQA 2KMMA 2PVGC 3AECB 4HROA 4P6VF 3W5VB 1JQ4A 1NI3A 1V8CA 1XLQA 3AN1A 1XLPA 1RWSA 4C80A 2FBWB 1JALA 3CWIA 3P4PB 3SFEB 1L6VA 1QOGA 3DWGC 1XLOA 1KFYB 1JWAD 1YJIA 3B2FA 5C2TB
chains in the Genus database with same CATH superfamily
4KDLB 3E56A 4AWJA 3AV8A 4MSMB 1OGWA 3QJZA 2PEAA 1N5WA 2KX0A 4EZJA 5BYRA 2DZJA 3PO0A 1EUVB 1JWSD 4GU2A 3BWUD 1BMLC 1RYJA 2BB5A 1ZDXA 1HE8A 1ET6A 2K25A 4WH4A 1E0ZA 4RNAA 4O1NA 5T8IA 3DQVA 2IYDB 2IY0B 1BT0A 2I1KA 2J7QB 3EC8A 4XDDA 1I42A 2N7EA 3DOWA 3SEBA 5AZGA 2E6XA 2GBMA 4IM0A 2O6VA 3T9LA 4MH0E 1T6BX 3W9CB 1KLVA 4W9FA 3DBHI 3WCQA 4FJZA 4WWPA 4GIVA 2KDFB 3VUYA 2BF8B 1TKEA 3NS8A 3ZYYX 4KSLC 2LVQA 3NY5A 2KWUB 2KVRA 1JW9D 1FNVA 4NJ6A 3H1UA 3APCA 4TV3A 1WX8A 2D07B 2BKRB 3ZNGC 5IP4D 2KTRA 2DWQA 2VZKB 2R2OA 2KFKB 4FXCA 3L17A 3AB5A 4II3B 2J4XA 4BAXA 4HPPA 2KN5A 4B0EA 1SE3A 3W5UB 2X38A 3I3TB 1P0RA 3VH4B 1ZPSA 3PSEB 1J7BA 1QILA 3NVVA 1N61A 3LDZE 5HHDG 2BS2B 1FIQA 4P6VF 2K3UA 1P98A 2LXCA 2KWVB 2MW5A 1QOGA 4GMVA 3HM6X 2KDEB 4FA6A 2V3SA 4P7IA 5DPTA 1WY8A 1VLBA 1OQQA 3R66C 2KLCA 1OTRB 1DGJA 4ZRIA 3RNCC 2N9LA 5LXIB 1E7UA 4NAWA 1IP9A 2CJNA 3RNGC 2L83A 3KW5B 4MGKE 2J0JA 4US9A 2WXIA 3ZXVA 1SGHA 5D2MB 3Q8CA 1WE7A 1SJHD 4BBNC 2LASA 5GMVA 1J7AA 4CO7A 5J17A 2REXA 2AQ2B 4LNKA 3V60A 5AEKB 2ZCCA 4KGTA 4LLGM 3Q8EA 4GN1A 4K3CA 3PTFC 2L52A 4A55A 5HI1A 2M0AA 4M8NA 2ZNVB 4EOYA 2LGSA 5EE9A 4GDKA 1QLBB 2MBOA 3L0WB 1T0RC 4DXFA 2H88B 4IKGA 1SIJA 3S2AA 4FJVB 4LK0M 4I6NB 1UWXA 2V0GA 3VUXA 2G4DB 2FUG1 4IM2A 2MBHA 2KANA 3H7PB 3WALA 2WXNA 1F2RI 4ICUA 1I4RA 2GB1A 1WGYA 1FRDA 2PE6B 3U52E 3AECB 3U4EG 3A9JA 1GC6A 4MEMA 2M0XA 2DLBA 3GOEA 4RM9A 4XZ4A 1P9DU 1WYGA 1TYGB 2KWCA 3AU4A 2PLPA 1EF1A 2PVOD 4GOCA 4BKSD 1L4DB 3BVGA 4LDTD 5AZFA 1F9JA 4HJGE 2NBVB 3NJTA 1D6EC 2LHDA 1WRIA 4WWMA 5CX3A 1ENFA 1UBQA 4FHKA 2ZW1A 5D6JB 4G0NB 2CHXA 1N5XA 2IDYA 3ENEA 5EE3A 3RD2A 2FCSA 2JX5A 4ACFA 3PRMB 4K3BA 2BYEA 3KYCD 2INPE 2AEHA 2G1EA 2PW9A 3UIOB 2TSSA 2L0TA 3V6EB 1Z5SB 1KOTA 1V80A 3K9OB 3P2BA 1WR6E 1T0QC 3SDLC 1D5MC 4MELA 1JWBD 3PLUA 4WJNA 2I1JA 2AL6A 2C9WB 3DHGC 1Q10A 3ZTCA 4TQ1A 5FR6A 4HKQA 1FMAD 3DCGA 2WXKA 2A4ZA 4YSZB 2D11A 5G5GA 5J18A 3HUIA 1V6EA 2BGFA 1P7EA 3GZNI 2CU1A 1QZEA 2A5UA 2WDRB 1OQYA 2MA9B 2JXXA 4ASWC 3U7DA 3PT2B 1FM0D 1MVKA 1P3QU 1K8RB 3Q3JA 1NI3A 2C7HA 3EHVA 2WDQB 1T5XD 4F1SA 4I6PA 3ZDTA 4NNJB 4YSYB 3HVDA 1X1MA 1PGBA 3W1YA 3BVZA 2FCNA 3N1ZC 3HHMA 4IWPA 1IGDA 3A9KA 2BWFA 3B1LX 1YNTE 1J0GA 4AP4C 2W9NA 4ANWA 2Z0DB 1I4PA 4MGZE 4DWFA 3AEDB 3TEYA 2FCQA 1GAQB 4GSWA 3ZO5B 4WQOB 2YVCA 2WXJA 3ETRA 2O2VB 2KDBA 4IDIA 1Q1OA 3DWMA 1L0XB 1NEKB 4F7ZA 1WXQA 4JIOU 4K1RB 1NDDA 2BPSA 1RRBA 2HDEA 3AE9B 4HLEA 4AS1A 1STEA 4EZKA 2KVZA 3VH3B 1FXTB 4A90A 2N9EB 2WWZA 1NYQA 2JY6A 1OFFA 1VR9A 3AXCA 4KGRA 1YQ3B 2VRRB 1NYRA 4M01A 4LJOB 1N62A 3Q8AA 4HVBA 1NENB 4MH8A 4IOIE 5FKAC 2Y5BB 2ZNVC 1C9FA 4BKSA 2C60A 2R61A 3TSSA 4WWNA 2FBWB 3CWIA 3B0AA 4RGOS 1XLOA 3W2DA 2MSED 1V5TA 1K52A 3PZDA 1S3SG 3CIRB 2Y5CA 3EFUA 5D3DA 3W1SC 3MC8A 1YJJA 2DZKA 2N4FA 4RMAA 1S1QB 2LRWA 2QJLA 4FLHA 1HXYD 1SB3C 4YWGG 5TSSA 3AE4B 1WZ3A 5IKCM 2NVUI 2HTME 1FCLA 4DXGA 4ZRQA 1QF6A 3I63C 2KX3A 3AE3B 5CHVC 1C77A 1KRHA 4S0RA 2D3GA 2CR5A 3KYDD 3PGEA 3ML9A 2DYOA 2LGDA 3VTVA 1YX5B 1K53A 1ZW7A 4A6QA 3N32A 4L2YA 1TT5B 2WXLA 1LQBA 4JWUC 1TS2A 3H9DA 1HQRD 2RPQA 2LVPA 3L13A 4X57B 3V61A 3IFWB 4R3DA 2AL3A 3Q3FA 3TCAA 3L16A 1UZXB 1LXDA 2WP9B 3IVFA 3C8YA 1XCTL 2LGYA 2JZZA 4IWQA 5JHBA 3MJ5A 1B1ZA 2ZW0A 3N9YC 4JE3B 4D2KA 4ANXA 4XE0A 4P1CC 3SFDB 2E3TA 5FK9C 2L1AA 3X23A 1D4BA 3AEAB 3DBRI 5TR5A 4EUTA 1AYFA 3P4RB 4CYEA 2WXRA 3QARA 3BYTB 3T3OA 1GJZA 2RDBC 2Q5WD 4NPNA 2MP2A 4XGAB 4G3XB 2INDC 1L5PA 2BTEA 1HTOA 1LM8B 3W5VB 3EGRA 1TY2A 1VZ7A 2M17A 4M0WB 5C2TB 2JF5A 4DQOC 4E71A 3VRAB 2IGGA 3TBLD 2WU5B 2V4LA 1UF0A 4E74A 3R8BA 1KJTA 3EECA 4C00A 3NOBA 4B9KA 4MJSA 2RDHA 2KFKA 3IAS1 3ZW3A 1YOVB 4IG7B 2BT6A 1WM3A 1C4PA 3OAWA 2IBIB 1PUTA 3T8MA 4XX5A 1WGGA 1FFVA 1VZ8A 1V5OA 2GBRA 3Q3OC 3EA6A 3P42A 5D94A 2C5LC 2AQ3B 2JUOA 2C7MB 2KC2A 2DNFA 4BOSC 3P1MA 1NVID 3ABVB 5LLIA 1I35A 2WXMA 2BVCA 3FILB 2K1FA 1WXSA 2MH7A 3ZIMA 3DBLI 4RF0A 4NQLB 2N1VA 2RMMA 1BUIC 1YMHE 2IJ0A 1Z2MA 2WXHA 3KUZA 2XEWA 2KJHB 4N58A 3UINB 2BKFA 4J3OD 4KKIA 2ACZB 1ZGUB 1WGDA 3QK0A 2V4IB 1VCBA 2K9XA 3AEFB 1YX6B 3Q2AC 4YXDB 2W82A 2HE7A 1JWUD 1ZUD2 4NQKE 5I4DA 1K51A 5DPWA 4ANUA 1IBXA 1XLQA 1RWSA 1SJED 1TBEA 2G4SA 2J0KA 2KZRA 4BVUC 3KVFB 2CHWA 3M62B 4PYUA 3E9SA 3AU5A 3L10B 4MGYE 4IW0A 4ICVA 3PLVA 3PZ7A 2Z8LA 4GXBA 1SEBD 4W9JA 2PMVA 1VJKA 3ZNZB 3JW0X 2JVCA 1F0ZA 3VHTC 4RCOA 3W1SA 4PK1A 1YJ1A 4ZHOA 2KYWA 1XQQA 1AW7A 1R4MB 4A3OA 4HCNB 1MG8A 1V1PA 1WXVA 2D3CA 3H7PA 4W9GA 1TZOA 3ZKJC 4FULA 1MHXA 3BY4B 2FAZA 3KLSX 5DPSA 1YD8U 4YSXB 2LMCA 1PGAA 1KH0A 1BXTA 4YL8A 3MC0B 1E9MA 2LHEA 3A1QB 1C78A 4NZLB 1UD7A 2KDMA 2DX5B 4ARCA 2D5GA 3PS6A 3GB1A 1LO5D 2EELA 2OOBB 2NTSA 4GDLA 4C56C 1EWYC 3GZNB 3QWZB 1N63A 2O6VB 3N1XC 2VH2A 5GXGB 4JWSC 2B76B 4BKTA 4JX1C 2FNJB 1UGMA 2GMIC 2IGDA 4MACA 3D32A 2QEJC 3Q8FA 3QX1A 4YTMB 1TGZB 3BK2A 4BOZB 1D5XC 3IXSA 4HCPB 3JVZX 3U8ZA 5IO9A 1ZDVA 3VTUA 3AE7B 3V6CB 1PGXA 1ZXHA 3DVGX 1IGCA 3AN1A 1XLPA 3PV1A 2RPVA 3SFEB 3CSTA 5D7GA 3WAPA 5IA7A 1DOYA 4W9KA 2XBBC 5EE0A 1L2NA 1F52A 2JYEA 2GBJA 3I9V1 2DAFA 3N20C 4W9CA 1J19A 4FBJB 2HD5B 3P4QB 5AUKA 3NVWA 3VXWA 1AARA 4A9AA 4DHZB 2KHWB 3VFKA 4GLSC 1FNWA 3I57A 1D3ZA 3UF8A 1LFDA 1SSNA 1AWDA 4HJKA 3A33B 2XK5A 3VVWB 2NTTA 3U2SC 2BYTA 3H7SA 4B6WA 2KKCA 4WAAA 3PZ8A 5LXHA 2ON8A 1KLUD 1JRPA 2KC1A 4LNIA 4YT0B 3QC8B 2JWUA 2WU2B 3TEWA 3L4PA 2M1MA 3UI3A 2HTHA 2WS3B 2YEPB 3MJWA 3QCAA 3H6NA 3O65B 1OEYA 2B3AA 4M8MA 5JZEB 4W9LA 2IY1B 2PPHA 2KMCA 1R4MI 2BB6A 2BS3B 4JGHB 2M8SA 3GE8C 2JQRB 4RGMA 4NY0A 3GE3C 2M4NA 4WWOA 2RD0A 1WFYA 5L95C 1Y56A 3NS1A 1JMLA 1TY0A 4EE2A 3QQ8B 1D5ZC 4OZCA 2ASQA 2QMTA 3WIMA 3RI7C 2EMTA 2O2VA 2MBQA 2KMMA 1ZE3D 1I4HA 1TS4A 2KWDA 3DWGC 1F2RC 3AE1B 4H2AA 2BQQA 2KJ6A 3ALBA 4WJPA 4C4VA 3LYYA 3NZSA 2L05A 2PIAA 1ESFA 2PJHA 2IO2B 2WDTB 4TUUA 2KOXA 4BKGA 4USAA 2KT7A 3JSVA 2KMAA 2GI9A 5EE1A 2X8XX 2UWQA 3NVYA 2JWZA 4K7UA 3L54A 5DCNA 3AULA 3SHQA 2QILA 1QQRA 2BW2A 2V3PA 1N60A 1MG4A 4K81A 1C4CA 2INNE 3O13A 2LGXA 3AE2B 4MDKE 1WJ4A 2GLSA 2DAJA 3ZNID 2EKEC 1C1YB 1WJUA 1TJEA 4ZDVA 1R4NI 3DBRB 1SXTA 2K0PA 2FCMA 4GGQA 3X0WA 3A4SC 1Q5WB 4N59A 2WQYB 1E8XA 3RNEC 3WAMA 2NS5A 2MJEA 3M63B 4PS8A 2KACA 1CJEA 3FAHA 3VQIA 3WANA 2D3AA 5E6PA 2VZKD 1FXAA 4JQWC 1WH3A 2DENB 3BINA 3QHTA 1WX9A 4OZBA 3SR6A 3RNBC 3DVNV 3VAWA 4AUQC 2K6DB 2M56B 1XEEA 3ZNHB 3BIID 1YN5A 4IWOA 2K22A 5BYSA 3M95A 1YIWA 1A5RA 3P63A 2KNBA 2XN9C 3ZLZA 2N1WA 2JSVX 3L08A 2KQ4X 2LRUA 3RT3B 1L6VA 4EKUA 2OJWA 2G3QB 1ISNA 2HJ8A 2L8JA 4Q2JA 2AWTA 4ZRKA 2V1YA 2KDIA 1CZPA 1EM7A 1M4VA 4W9DA 4XWTA 4HXDA 3BVMA 4IM3A 3AE5B 3CSFA 1PDXA 5G55A 4IUMB 1WM2A 1L6UA 2ICIA 2AQ1B 1ZKHA 1WXMA 1NBFC 1N6ZA 2WNMA 3DPDA 4AJWA 3T3NA 3QIJA 1G6JA 3ZUNA 4MM3A 4C7YA 2LD9A 2EKIA 4BFRA 3DBLB 2CKHB 3BZDB 4II2B 2ZCBA 3A9KB 2PE9A 2LUEA 4UDUC 1HTQA 2NPTB 3HK0A 4S17A 3HM3A 2KN4A 2JRHA 1FNUA 3IBEA 3ML8A 3B9JA 2KAJA 2BYVE 3AE8B 3ZRCA 2QHOA 3HRDD 3ZDMC 1FFUA 4M0WA 4KKJA 1GUAB 2MLBA 2LGIA 4HEA1 1UWMA 5KHOA 3C19A 3OLMD 2LI5A 1MJDA 3PHWB 3OJ4B 3SU8X 5IN7A 2L76A 3ZJUA 1YQBA 2SAKA 1WJ6A 3DVNU 2IGHA 2XNAC 1XD3B 1V2YA 3IAM1 2ZZPB 1RFKA 3RZFA 2LUMA 3GP7A 2W3RA 4YTPB 1XCQL 4WIPA 2D2QA 1WXAA 1E6EB 1WGRA 4RM8A 2BYFA 1TS3A 2EMSA 1SBBB 1SE9A 1WGKA 1WR1A 2ZPNA 4NJ7A 4BZAA 2G9HD 4DBGA 4C80A 1V9JA 2D3BA 1YJIA 3KUCB 2L7RA 5H92C 5IOIA 4CQNA 1V1OA 1J7CA 3TIXA 1PQSA 2GBKA 2MBBB 3OJ3A 5BMGA 1ET9A 3WA0A 1V97A 2QIEB 4DDID 5BYQA 4I6LB 3DHHC 2ONQA 1DYQA 2JT4B 3MP9A 5CHFA 3R7QA 3PRPB 5J2RA 1HZ5A 1WMHB 5L83A 5C23A 3RNAC 1GNUA 2V9HA 2KTFA 2DZMA 3I5JC 3R7RA 4KIKB 2JZ3B 1JRUA 4M02A 1I4GA 3NUHB 1T0YA 1FRRA 2WYQA 3HVZA 2QDFA 3R3MA 1WI0A 1UBIA 4OVVA 3TUOA 1E7PB 1SE2A 4P1BC 2CHZA 1GC7A 3RULA 4WQMA 2KFJA 4C7ZA 1TTNA 4EZLA 3B08A 3ZGZA 3DHIC 4FADA 2PKOA 3BYYB 4KZCA 3TJPA 4W9HA 2I38A 1E90A 3NHEB 4N6EB 3RUIB 2LZ6A 1L0VB 1Q0WB 3RZWC 3UIPB 4G50A 2DYMA 2JRIB 1E8WA 2WXFA 4DHJB 4HK2A 2JXTA 3U7ZA 3A1QA 2JU6X 1E8YA 3AEGB 5BMIA 2NMQA 3ZQ4A 2N9XA 3V62A 2HJ1A 2MP2B 3Q3NC 2K5PA 5EDSA 2WHIA 2AYOB 4US8A 5LNK1 1QKZA 4HPMB 5E6JA 5G5HA 2Z0EB 1MPEA 2LVOA 4IC7B 4ZRPA 4RFBA 1YN4A 1F77A 3V05A 4MGIE 4WAFA 1YQ4B 1V81A 3TL5A 2MHJA 3NG0A 1QOAA 4OZAA 2K8CA 3TEXA 2J0MA 2MEKA 1TKYA 1TS5A 5AZHA 3U30A 2KLGA 1ROEA 4LJPB 3TEZA 4MJSB 3ZJVA 1V86A 4OVUA 3VR8B 4OW0A 1RAXA 4HKZE 2CJOA 5C3JB 1WWTA 3Q14C 4XYCA 1GB1A 3NZ3A 3Q8BA 4HRSA 1SF0A 1GOZA 2D10A 2BS4B 1TIFA 3DVGY 4ZYSA 4E3CA 4EEWA 1ACCA 3PRZA 4HPLB 2JZPA 3URYA 1XT9B 2V3NA 2NCNA 5BO4B 1EU4A 5CTRC 3PHXB 4FN2A 1WGHA 4ZOHC 2CS4A 2FIDA 4K7SA 2L00B 3UQAA 3AEBB 3FC4A 4OVZA 3MHSD 2Z59B 2KK8A 2GRIA 4TMAB 4ZRJA 4K7WA 1VD2A 2H89B 3OWEB 5DPRA 1XF5L 2KTRB 5IAAC 3J9CA 1XXGA 1IBXB 3DDCB 4AJYB 2MX2A 5H8YE 5KHQA 2WDVB 4DDGD 4HDQA 2Y5PA 1WRDB 2N7DA 2LEKA 2W3SA 2QSDA 5BMHA 1R4NB 3NZUA 1HEZE 2LWPA 2UYZB 2WLBA 3UQBA 2MBEA 3VRBB 4G11A 2KJRA 1JWMD 3WAOA 2W54A 1V49A 1VRAB 4M00A 4TQ0A 4PS7A 1V1PB 5G2NA 1KF6B 4KGSA 2J53A 1GPXA 1P7FA 1PYWD 3R2TA 4AOFA 2N9PC 1WYWB 5FR3A 4NAWB 3BK1A 4AQ7A 1JCKB 3R2IA 1R7SA 3LJ3A 1A70A 3AE6B 5HKHA 1TKGA 3K9PB 1WF9A 3DBSA 4ZYNA 3KH0A 4DHZE 3FKYA 1LGRA 2KQ7A 2RSUA 4GDLB 1I7HA 4RH6A 3ZJTA 2WXPA 2K8BA 4ARIA 4PYZA 2PVGC 2YEPF 1V8CA 2ZVOA 3P4SB 1FPYA 1JWAD 1EU3A 2IO3B 1C79A 3Q6BA 2ZVNA 1DOXA 1TZ1A 3APDA 4KX6B 4GDKB 1GB4A 2OHFA 4RF1A 3LXFA 4TSSA 2RR9A 1RM6C 2LJ5A 2K8HA 2MJDA 2WX1A 4LNOA 1MI0A 3ZTDA 5HG2A 3RYTA 2WX0A 4L23A 2IZVB 4QAYA 1PFDA 3IT6B 1UNSA 2L0FA 5CHWA 3AI5A 3AEEB 3B2GA 3MHZA 3A9JB 2MQJA 2IO1B 2FE8A 1JROA 1EF5A 1I4XA 1MFWA 4KVGB 1E5WA 3AM9A 3CF6E 3A4RA 4JLCA 1WJNA 2J42A 3KWLA 2XK5B 1C76A 1SIFA 2INCC 2FIFA 5D3IB 2NBUA 2G45B 3MC9A 4PS3A 1EWCA 3OG5A 3AMZA 5JXVA 5AUIA 3LB8C 2DZIA 3VTWA 3IHPC 4JPSA 4NAMA 4RGTA 3Q69A 4W9IA 3VDZA 4DHJD 4NJCA 2J52A 2IPKD 1M94A 1T0SC 5E6OA 4LTUA 2OJRA 1Y8RC 1F1HA 3PVLA 2KD0A 4MSQB 4LNFA 3NRZA 4EFOA 4N9F4 4WJQA 2NPTA 2M19A 1KLGD 4ITKA 3N3KB 4HROA 1H8CA 2QC8A 3V3XA 3C0RB 3P4PB 4LNNA 1KFYB 3B2FA 4B0MA 1FEHA 2DYBA 5JHAA 3RCZA 2K39A 1UUPA 3SD5A 3MTNB 2YLMA 2N7JA 1UELA 4J6IA 1HA5A 1WZ0A 3N30A 4URKA 2KQSA 3RMKC 2ZPYA 1XLNA 4C4VB 3ONSA 4F8CB 1WE6A 2RGFA 2CU3A 2SEBD 1IUEA 1P1AA 2L32A 2W55A 4A20A 3UGBB 1ZOYB 1E7VA 1AN8A 2AX5A 3JSVB 4MT5A 2MJ3A 2QCZA 2RDGA 1RFAA 4YTNB 1IPGA 4CHKA 1L4ZB 1MHHE 4A8XC 2UU7A 3GS2A 2DHZA 4WJOA 4FJYA 3NVZA 5MPOA 4WURA 2MCNB 2MRPA 2O6VD 1DOIA 1H4RA 1OEYJ 2GBNA 3VR9B 2IO0B 1HZ6A 2K6QA 1T3QA 1QT9A 2VH1A 3RN9C 4REZA 1WMHA 3KUDB 4GB9A 1YN3A 4KZ0A 2GOWA 2JPHA 3H8HA 1CMXB 4PT5A 1EO6A 3ZVVA 3QA8A 3MFGA 2JYTA 4KDIC 1QOFA 2L3ZA 1VDVA 2MWSB 1WIAA 2LFIA 1RLFA 1JQ4A 5C1ZA 3TMPB 4KIKA 1L7YA 1WX7A 3DBHB 2R2QA 3M3JA 2KXJA 5JH5C 2FUHB 1FD6A 3N1YC 4OHJA 4KV2A 1OQRA 2NR2A 4BBNF 4HDOA 1ZXIA 1IYFA 2WXQA 1QOBA 2WXGA 3ZXRA 3PREA 1GG3A 3JYUA 3RPFC 2Y3AA 3EFCA 2WGSA 3FILA 3ZRFA 1CK1A 3Q3MC 2LJIA 4DK5A 1WSPA 1L0YB 2BWES 1SE4A 4B95A 1KTKA 1FO4A 4DXAB 3KQ4A 4RGNA 2I2YA 4P16A 2KO3A 2ZJDA 2DBYA 4ANVA 2OEDA 1VZ6A 1FCCC 4FHJA 5E6NA 3IT4B 2WXOA 1C3TA 4LDTB 3RNFC 4MM3B 4A3PA 4XWWA 5HFYA 1J8CA 1U4AA 1B9RA 4HWIB 4LCDE 1KM7A 1C4AA 4L1BA 2NBWB 3RFZB 1I4QA 1E10A 3AH7A 4TKNA 1NI2A 3QAQA 2PTLA 1K50A 1UH6A 4W9EA 1UGJA 1ZP0B 3CMMB 3ECIA 4ZHPA 2ZEQA 2N0SB 3EUB2 4XC2A 4XDCA 2LXAA 3HIZA 1XO3A 3IG3A 4KSKC 3VUWA 3PPAA 2BBCA 2C7NB 1FXIA 4JL9A 2N9KA 3APFA 1CQVA 1E8ZA 1JALA 3KWVA
chains in the Genus database with same CATH topology
3AE1B 1K52A 4H2AA 3E56A 4TMAB 3CIRB 2Y5CA 3AV8A 5D3DA 2H89B 1YJJA 1N5WA 3OWEB 3LYYA 2QJLA 2PIAA 1HXYD 5BYRA 3PO0A 1SB3C 1ESFA 4YWGG 1XF5L 5TSSA 3AE4B 1JWSD 3BWUD 1BMLC 3J9CA 1RYJA 1XXGA 2BB5A 1ZDXA 1IBXB 1ET6A 4WH4A 2HTME 1FCLA 4DXGA 4ZRQA 4USAA 1QF6A 1E0ZA 4RNAA 3AE3B 4O1NA 1C77A 1KRHA 5H8YE 2GI9A 5T8IA 5EE1A 2WDVB 2Y5PA 3NVYA 2DYOA 4XDDA 4A6QA 1K53A 2LEKA 2W3SA 4L2YA 2QSDA 3SEBA 5BMHA 2WXLA 2E6XA 1HEZE 4JWUC 1TS2A 2QILA 1QQRA 1HQRD 2BW2A 2V3PA 1T6BX 3W9CB 1N60A 2WLBA 1C4CA 4R3DA 3WCQA 2INNE 3O13A 3VRBB 3AE2B 1JWMD 2W54A 4TQ0A 1VRAB 1TKEA 2WP9B 1V1PB 1KF6B 1TJEA 3C8YA 1SXTA 3ZYYX 4KGSA 2K0PA 1XCTL 2J53A 1GPXA 4N59A 1JW9D 2WQYB 1P7FA 3MJ5A 1B1ZA 1FNVA 1PYWD 3R2TA 2ZW0A 3N9YC 4JE3B 4D2KA 4XE0A 2MJEA 2DWQA 4NAWB 5FR3A 3BK1A 2VZKB 4AQ7A 1JCKB 3SFDB 2KACA 3R2IA 2E3TA 1R7SA 5FK9C 1CJEA 3FAHA 3VQIA 1A70A 3AE6B 4FXCA 1TKGA 2L1AA 2VZKD 1FXAA 1D4BA 3AEAB 3AB5A 2J4XA 4OZBA 1AYFA 3P4RB 4B0EA 1SE3A 2WXRA 3SR6A 3W5UB 2X38A 2M56B 1XEEA 3BYTB 4GDLB 1I7HA 3BIID 3T3OA 2Q5WD 1YN5A 4RH6A 2K22A 3ZJTA 5BYSA 2WXPA 1ZPSA 1J7BA 1QILA 3P63A 3NVVA 1N61A 2XN9C 1L5PA 4ARIA 5HHDG 2BTEA 2BS2B 1FIQA 2PVGC 2JSVX 3EGRA 2YEPF 4P6VF 3W5VB 2K3UA 1TY2A 1V8CA 2KQ4X 1VZ7A 1L6VA 1QOGA 3P4SB 1JWAD 4DQOC 5C2TB 1EU3A 3VRAB 2IGGA 1C79A 2WU5B 4Q2JA 1VLBA 1CZPA 1EM7A 1OQQA 1DOXA 3R8BA 4KX6B 1M4VA 4GDKB 1GB4A 4XWTA 1DGJA 2N9LA 2OHFA 3BVMA 3AE5B 4RF1A 2RDHA 3LXFA 3IAS1 4TSSA 1PDXA 2CJNA 1L6UA 2L83A 2ICIA 2AQ1B 1RM6C 2BT6A 2MJDA 2WNMA 1C4PA 3T3NA 1PUTA 1MI0A 4US9A 1FFVA 1VZ8A 2WXIA 5HG2A 4C7YA 2EKIA 4L23A 3EA6A 3P42A 3Q8CA 1PFDA 3BZDB 2AQ3B 3IT6B 1SJHD 1UNSA 1J7AA 3P1MA 4UDUC 1NVID 3ABVB 2AQ2B 3AEEB 3B2GA 2WXMA 2KN4A 3MHZA 3FILB 1FNUA 4KGTA 4LLGM 3B9JA 2KAJA 2MH7A 3Q8EA 3AE8B 2FE8A 3HRDD 1JROA 1FFUA 2L52A 4M0WA 4RF0A 4KKJA 4A55A 2LGIA 4HEA1 1I4XA 5HI1A 1UWMA 2M0AA 3AM9A 2J42A 3KWLA 2RMMA 1C76A 5EE9A 1BUIC 1YMHE 2IJ0A 2WXHA 1QLBB 4DXFA 4N58A 2H88B 5D3IB 3ZJUA 4IKGA 1EWCA 3AMZA 2SAKA 5JXVA 4J3OD 1SIJA 4KKIA 5AUIA 3LB8C 4LK0M 1UWXA 2IGHA 2V0GA 2ACZB 2XNAC 4JPSA 4NAMA 4RGTA 3Q69A 3IAM1 4NJCA 1RFKA 2FUG1 2V4IB 2LUMA 2J52A 2IPKD 2W3RA 3GP7A 2K9XA 3AEFB 2WXNA 1XCQL 1F2RI 4WIPA 4YTPB 4LTUA 4YXDB 2W82A 1I4RA 2GB1A 1E6EB 1JWUD 1ZUD2 1FRDA 1TS3A 3NRZA 5I4DA 1K51A 1SBBB 2M19A 1KLGD 1WGKA 4ITKA 3U52E 4HROA 3AECB 2G9HD 1IBXA 3U4EG 3V3XA 1XLQA 1RWSA 1SJED 4C80A 3P4PB 2DLBA 1KFYB 3E9SA 1YJIA 3B2FA 5H92C 4B0MA 4CQNA 1FEHA 1V1OA 1J7CA 1WYGA 5BMGA 1ET9A 1V97A 1UUPA 2QIEB 1TYGB 3PZ7A 2Z8LA 5BYQA 1SEBD 2ONQA 1DYQA 2PMVA 1VJKA 2N7JA 3MP9A 1F0ZA 2PLPA 4RCOA 3W1SA 2PVOD 1HA5A 1L4DB 3BVGA 4ZHOA 1AW7A 4HJGE 1HZ5A 1V1PA 1D6EC 2LHDA 1WRIA 1XLNA 4WWMA 1ENFA 1TZOA 2CU3A 2ZW1A 2SEBD 1MHXA 1IUEA 1N5XA 2IDYA 2L32A 5EE3A 2W55A 2JX5A 3KLSX 1ZOYB 4YSXB 2LMCA 1AN8A 1PGAA 2AX5A 1KH0A 2INPE 4MT5A 1BXTA 2MJ3A 3MC0B 1E9MA 2G1EA 2LHEA 2PW9A 1C78A 2RDGA 1I4GA 4NZLB 2KDMA 4YTNB 4ARCA 3NUHB 1L4ZB 1MHHE 2D5GA 2TSSA 1FRRA 3HVZA 3GB1A 1LO5D 3GS2A 2EELA 4A8XC 2NTSA 3NVZA 4C56C 1EWYC 3TUOA 1E7PB 1N63A 1SE2A 1D5MC 5MPOA 4WURA 1JWBD 4WQMA 5GXGB 4JWSC 4C7ZA 2B76B 1DOIA 4JX1C 3ZGZA 2PKOA 1Q10A 2IGDA 3VR9B 4TQ1A 3BYYB 4MACA 4HKQA 1FMAD 2WXKA 1HZ6A 2QEJC 3Q8FA 1T3QA 1QT9A 2I38A 4REZA 4YSZB 4YTMB 5G5GA 3HUIA 1P7EA 1YN3A 4N6EB 3BK2A 3H8HA 2WDRB 4PT5A 1L0VB 1D5XC 3IXSA 3MFGA 2JYTA 1FM0D 1MVKA 2DYMA 1ZDVA 1QOFA 1VDVA 3AE7B 2LFIA 1PGXA 1ZXHA 2WXFA 1JQ4A 1IGCA 1NI3A 3AN1A 1XLPA 2RPVA 3SFEB 2JXTA 3U7ZA 5D7GA 2WDQB 2JU6X 1T5XD 1DOYA 4YSYB 3HVDA 1FD6A 3AEGB 5BMIA 2NMQA 4OHJA 3ZQ4A 1OQRA 5EE0A 1PGBA 3BVZA 2K5PA 1IGDA 1ZXIA 4US8A 5LNK1 1QKZA 2JYEA 3I9V1 2WXQA 5E6JA 5G5HA 1QOBA 2WXGA 1MPEA 4ZRPA 1YNTE 4RFBA 3RPFC 2Y3AA 1YN4A 3FILA 1F77A 1CK1A 3V05A 4WAFA 2LJIA 1WSPA 1YQ4B 1L0YB 3P4QB 5AUKA 3NVWA 1SE4A 1QOAA 4OZAA 1I4PA 3TEXA 1KTKA 4A9AA 1FO4A 2MEKA 3AEDB 3KQ4A 4GLSC 3TEYA 1FNWA 3I57A 1GAQB 1TKYA 1TS5A 1SSNA 4RGNA 1AWDA 2I2YA 4P16A 1ROEA 2NTTA 3U2SC 2WXJA 3TEZA 2DBYA 2BYTA 2OEDA 3ETRA 1VZ6A 1FCCC 3ZJVA 3IT4B 2WXOA 4IDIA 3PZ8A 3DWMA 1L0XB 1NEKB 3VR8B 4OW0A 2ON8A 1KLUD 1JRPA 4HKZE 1WXQA 4YT0B 2CJOA 2JWUA 5C3JB 2WU2B 4MM3B 1WWTA 4XWWA 5HFYA 3TEWA 2HDEA 3AE9B 3L4PA 1B9RA 3UI3A 2WS3B 1GB1A 2YEPB 3NZ3A 3Q8BA 1C4AA 4HRSA 1STEA 4AS1A 1SF0A 1GOZA 4L1BA 2BS4B 3RFZB 4A90A 1I4QA 1E10A 4ZYSA 3AH7A 2BB6A 1NYQA 2BS3B 2PTLA 1K50A 1ACCA 1OFFA 2JQRB 2JZPA 4RGMA 1UGJA 1ZP0B 1VR9A 2V3NA 4KGRA 1YQ3B 3URYA 4ZHPA 1EU4A 2N0SB 1Y56A 1NYRA 3NS1A 3EUB2 4XDCA 1JMLA 1TY0A 4ZOHC 1N62A 4EE2A 1XO3A 3AEBB 3Q8AA 3FC4A 1D5ZC 4OZCA 1NENB 2QMTA 2BBCA 4MH8A 4IOIE 4OVZA 1FXIA 5FKAC 1C9FA 2KMMA 1ZE3D 1I4HA 2N9KA 2R61A 3TSSA 1CQVA 1TS4A 2FBWB 1JALA 3CWIA 2KWDA 3DWGC 1F2RC 2GRIA 4RGOS 1XLOA 3KWVA 3W2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WDQ B;  3AE1 B;  1DOY A;  5H92 C;  3VRA B;  4YSY B;  2WU5 B;  1J7C A;  2Y5C A;  3AEG B;  3AV8 A;  3CIR B;  1VLB A;  1CZP A;  1WYG A;  1OQR A;  1OQQ A;  2H89 B;  1YJJ A;  5EE0 A;  1DOX A;  1V97 A;  1N5W A;  2QIE B;  4KX6 B;  2K5P A;  1TYG B;  2QJL A;  1DGJ A;  1ZXI A;  2PIA A;  3PO0 A;  1SB3 C;  2OHF A;  4US8 A;  5G5H A;  1VJK A;  1QOB A;  3AE4 B;  3AE5 B;  1RYJ A;  1F0Z A;  3LXF A;  1PDX A;  2CJN A;  2HTM E;  3RPF C;  1L6U A;  2L83 A;  1QF6 A;  4USA A;  1E0Z A;  2PVO D;  1RM6 C;  2BT6 A;  2MJD A;  3AE3 B;  4ZHO A;  1YQ4 B;  1PUT A;  1KRH A;  3P4Q B;  5AUK A;  5H8Y E;  3NVW A;  4US9 A;  1FFV A;  1QOA A;  5EE1 A;  2WDV B;  4A9A A;  4C7Y A;  3NVY A;  2EKI A;  1FO4 A;  1WRI A;  1PFD A;  1XLN A;  4WWM A;  3AED B;  2CU3 A;  2LEK A;  1GAQ B;  2W3S A;  1TKY A;  1AWD A;  1J7A A;  1ROE A;  4JWU C;  1IUE A;  1N5X A;  3P1M A;  2DBY A;  1NVI D;  3W9C B;  3ETR A;  1N60 A;  2W55 A;  2WLB A;  3ABV B;  5EE3 A;  2JX5 A;  1ZOY B;  3AEE B;  3WCQ A;  4YSX B;  3B2G A;  3VRB B;  3AE2 B;  4IDI A;  3DWM A;  2AX5 A;  1NEK B;  3VR8 B;  3B9J A;  1JRP A;  2KAJ A;  2MH7 A;  1WXQ A;  2MJ3 A;  2W54 A;  4YT0 B;  1E9M A;  2G1E A;  3AE8 B;  1TKE A;  2CJO A;  5C3J B;  2WP9 B;  2WU2 B;  3HRD D;  1WWT A;  1JRO A;  1FFU A;  2L52 A;  4YTN B;  1KF6 B;  1TJE A;  3AE9 B;  1UWM A;  1FRR A;  3L4P A;  3ZYY X;  1B9R A;  3HVZ A;  2WS3 B;  3AM9 A;  1GPX A;  4N59 A;  1JW9 D;  2WQY B;  3NVZ A;  3KWL A;  4HRS A;  1EWY C;  5EE9 A;  1E7P B;  1N63 A;  1SF0 A;  1QLB B;  2BS4 B;  5MPO A;  4N58 A;  2H88 B;  2MJE A;  2DWQ A;  1JWB D;  4WQM A;  5GXG B;  4JWS C;  4C7Z A;  2B76 B;  3SFD B;  1DOI A;  2E3T A;  1R7S A;  1E10 A;  1CJE A;  3AMZ A;  3FAH A;  3AH7 A;  1A70 A;  3AE6 B;  1SIJ A;  4FXC A;  4JX1 C;  5AUI A;  1TKG A;  2PKO A;  3LB8 C;  1FXA A;  1NYQ A;  2BS3 B;  3VR9 B;  3AEA B;  2ACZ B;  1FMA D;  3AB5 A;  1OFF A;  2JQR B;  1RFK A;  1AYF A;  1ZP0 B;  1T3Q A;  1QT9 A;  1YQ3 B;  3P4R B;  4ZHP A;  4YSZ B;  2N0S B;  5G5G A;  3SR6 A;  4YTM B;  3HUI A;  2W3R A;  3W5U B;  3NS1 A;  1NYR A;  2K9X A;  3AEF B;  3EUB 2;  4N6E B;  2M56 B;  4YTP B;  1I7H A;  2WDR B;  3BII D;  4LTU A;  4ZOH C;  4YXD B;  3P4S B;  1L0V B;  2Q5W D;  1N62 A;  2K22 A;  1XO3 A;  1E6E B;  1ZUD 2;  3AEB B;  3FC4 A;  1FRD A;  1J7B A;  1NEN B;  3NRZ A;  3P63 A;  3NVV A;  1FM0 D;  1N61 A;  2M19 A;  1FXI A;  1WGK A;  1L5P A;  1QOF A;  1VDV A;  3AE7 B;  4ITK A;  2BS2 B;  1FIQ A;  2KMM A;  2PVG C;  3AEC B;  4HRO A;  4P6V F;  3W5V B;  1JQ4 A;  1NI3 A;  1V8C A;  1XLQ A;  3AN1 A;  1XLP A;  1RWS A;  4C80 A;  2FBW B;  1JAL A;  3CWI A;  3P4P B;  3SFE B;  1L6V A;  1QOG A;  3DWG C;  1XLO A;  1KFY B;  1JWA D;  1YJI A;  3B2F A;  5C2T B; 
#chains in the Genus database with same CATH topology
 4KDL B;  3E56 A;  4AWJ A;  3AV8 A;  4MSM B;  1OGW A;  3QJZ A;  2PEA A;  1N5W A;  2KX0 A;  4EZJ A;  5BYR A;  2DZJ A;  3PO0 A;  1EUV B;  1JWS D;  4GU2 A;  3BWU D;  1BML C;  1RYJ A;  2BB5 A;  1ZDX A;  1HE8 A;  1ET6 A;  2K25 A;  4WH4 A;  1E0Z A;  4RNA A;  4O1N A;  5T8I A;  3DQV A;  2IYD B;  2IY0 B;  1BT0 A;  2I1K A;  2J7Q B;  3EC8 A;  4XDD A;  1I42 A;  2N7E A;  3DOW A;  3SEB A;  5AZG A;  2E6X A;  2GBM A;  4IM0 A;  2O6V A;  3T9L A;  4MH0 E;  1T6B X;  3W9C B;  1KLV A;  4W9F A;  3DBH I;  3WCQ A;  4FJZ A;  4WWP A;  4GIV A;  2KDF B;  3VUY A;  2BF8 B;  1TKE A;  3NS8 A;  3ZYY X;  4KSL C;  2LVQ A;  3NY5 A;  2KWU B;  2KVR A;  1JW9 D;  1FNV A;  4NJ6 A;  3H1U A;  3APC A;  4TV3 A;  1WX8 A;  2D07 B;  2BKR B;  3ZNG C;  5IP4 D;  2KTR A;  2DWQ A;  2VZK B;  2R2O A;  2KFK B;  4FXC A;  3L17 A;  3AB5 A;  4II3 B;  2J4X A;  4BAX A;  4HPP A;  2KN5 A;  4B0E A;  1SE3 A;  3W5U B;  2X38 A;  3I3T B;  1P0R A;  3VH4 B;  1ZPS A;  3PSE B;  1J7B A;  1QIL A;  3NVV A;  1N61 A;  3LDZ E;  5HHD G;  2BS2 B;  1FIQ A;  4P6V F;  2K3U A;  1P98 A;  2LXC A;  2KWV B;  2MW5 A;  1QOG A;  4GMV A;  3HM6 X;  2KDE B;  4FA6 A;  2V3S A;  4P7I A;  5DPT A;  1WY8 A;  1VLB A;  1OQQ A;  3R66 C;  2KLC A;  1OTR B;  1DGJ A;  4ZRI A;  3RNC C;  2N9L A;  5LXI B;  1E7U A;  4NAW A;  1IP9 A;  2CJN A;  3RNG C;  2L83 A;  3KW5 B;  4MGK E;  2J0J A;  4US9 A;  2WXI A;  3ZXV A;  1SGH A;  5D2M B;  3Q8C A;  1WE7 A;  1SJH D;  4BBN C;  2LAS A;  5GMV A;  1J7A A;  4CO7 A;  5J17 A;  2REX A;  2AQ2 B;  4LNK A;  3V60 A;  5AEK B;  2ZCC A;  4KGT A;  4LLG M;  3Q8E A;  4GN1 A;  4K3C A;  3PTF C;  2L52 A;  4A55 A;  5HI1 A;  2M0A A;  4M8N A;  2ZNV B;  4EOY A;  2LGS A;  5EE9 A;  4GDK A;  1QLB B;  2MBO A;  3L0W B;  1T0R C;  4DXF A;  2H88 B;  4IKG A;  1SIJ A;  3S2A A;  4FJV B;  4LK0 M;  4I6N B;  1UWX A;  2V0G A;  3VUX A;  2G4D B;  2FUG 1;  4IM2 A;  2MBH A;  2KAN A;  3H7P B;  3WAL A;  2WXN A;  1F2R I;  4ICU A;  1I4R A;  2GB1 A;  1WGY A;  1FRD A;  2PE6 B;  3U52 E;  3AEC B;  3U4E G;  3A9J A;  1GC6 A;  4MEM A;  2M0X A;  2DLB A;  3GOE A;  4RM9 A;  4XZ4 A;  1P9D U;  1WYG A;  1TYG B;  2KWC A;  3AU4 A;  2PLP A;  1EF1 A;  2PVO D;  4GOC A;  4BKS D;  1L4D B;  3BVG A;  4LDT D;  5AZF A;  1F9J A;  4HJG E;  2NBV B;  3NJT A;  1D6E C;  2LHD A;  1WRI A;  4WWM A;  5CX3 A;  1ENF A;  1UBQ A;  4FHK A;  2ZW1 A;  5D6J B;  4G0N B;  2CHX A;  1N5X A;  2IDY A;  3ENE A;  5EE3 A;  3RD2 A;  2FCS A;  2JX5 A;  4ACF A;  3PRM B;  4K3B A;  2BYE A;  3KYC D;  2INP E;  2AEH A;  2G1E A;  2PW9 A;  3UIO B;  2TSS A;  2L0T A;  3V6E B;  1Z5S B;  1KOT A;  1V80 A;  3K9O B;  3P2B A;  1WR6 E;  1T0Q C;  3SDL C;  1D5M C;  4MEL A;  1JWB D;  3PLU A;  4WJN A;  2I1J A;  2AL6 A;  2C9W B;  3DHG C;  1Q10 A;  3ZTC A;  4TQ1 A;  5FR6 A;  4HKQ A;  1FMA D;  3DCG A;  2WXK A;  2A4Z A;  4YSZ B;  2D11 A;  5G5G A;  5J18 A;  3HUI A;  1V6E A;  2BGF A;  1P7E A;  3GZN I;  2CU1 A;  1QZE A;  2A5U A;  2WDR B;  1OQY A;  2MA9 B;  2JXX A;  4ASW C;  3U7D A;  3PT2 B;  1FM0 D;  1MVK A;  1P3Q U;  1K8R B;  3Q3J A;  1NI3 A;  2C7H A;  3EHV A;  2WDQ B;  1T5X D;  4F1S A;  4I6P A;  3ZDT A;  4NNJ B;  4YSY B;  3HVD A;  1X1M A;  1PGB A;  3W1Y A;  3BVZ A;  2FCN A;  3N1Z C;  3HHM A;  4IWP A;  1IGD A;  3A9K A;  2BWF A;  3B1L X;  1YNT E;  1J0G A;  4AP4 C;  2W9N A;  4ANW A;  2Z0D B;  1I4P A;  4MGZ E;  4DWF A;  3AED B;  3TEY A;  2FCQ A;  1GAQ B;  4GSW A;  3ZO5 B;  4WQO B;  2YVC A;  2WXJ A;  3ETR A;  2O2V B;  2KDB A;  4IDI A;  1Q1O A;  3DWM A;  1L0X B;  1NEK B;  4F7Z A;  1WXQ A;  4JIO U;  4K1R B;  1NDD A;  2BPS A;  1RRB A;  2HDE A;  3AE9 B;  4HLE A;  4AS1 A;  1STE A;  4EZK A;  2KVZ A;  3VH3 B;  1FXT B;  4A90 A;  2N9E B;  2WWZ A;  1NYQ A;  2JY6 A;  1OFF A;  1VR9 A;  3AXC A;  4KGR A;  1YQ3 B;  2VRR B;  1NYR A;  4M01 A;  4LJO B;  1N62 A;  3Q8A A;  4HVB A;  1NEN B;  4MH8 A;  4IOI E;  5FKA C;  2Y5B B;  2ZNV C;  1C9F A;  4BKS A;  2C60 A;  2R61 A;  3TSS A;  4WWN A;  2FBW B;  3CWI A;  3B0A A;  4RGO S;  1XLO A;  3W2D A;  2MSE D;  1V5T A;  1K52 A;  3PZD A;  1S3S G;  3CIR B;  2Y5C A;  3EFU A;  5D3D A;  3W1S C;  3MC8 A;  1YJJ A;  2DZK A;  2N4F A;  4RMA A;  1S1Q B;  2LRW A;  2QJL A;  4FLH A;  1HXY D;  1SB3 C;  4YWG G;  5TSS A;  3AE4 B;  1WZ3 A;  5IKC M;  2NVU I;  2HTM E;  1FCL A;  4DXG A;  4ZRQ A;  1QF6 A;  3I63 C;  2KX3 A;  3AE3 B;  5CHV C;  1C77 A;  1KRH A;  4S0R A;  2D3G A;  2CR5 A;  3KYD D;  3PGE A;  3ML9 A;  2DYO A;  2LGD A;  3VTV A;  1YX5 B;  1K53 A;  1ZW7 A;  4A6Q A;  3N32 A;  4L2Y A;  1TT5 B;  2WXL A;  1LQB A;  4JWU C;  1TS2 A;  3H9D A;  1HQR D;  2RPQ A;  2LVP A;  3L13 A;  4X57 B;  3V61 A;  3IFW B;  4R3D A;  2AL3 A;  3Q3F A;  3TCA A;  3L16 A;  1UZX B;  1LXD A;  2WP9 B;  3IVF A;  3C8Y A;  1XCT L;  2LGY A;  2JZZ A;  4IWQ A;  5JHB A;  3MJ5 A;  1B1Z A;  2ZW0 A;  3N9Y C;  4JE3 B;  4D2K A;  4ANX A;  4XE0 A;  4P1C C;  3SFD B;  2E3T A;  5FK9 C;  2L1A A;  3X23 A;  1D4B A;  3AEA B;  3DBR I;  5TR5 A;  4EUT A;  1AYF A;  3P4R B;  4CYE A;  2WXR A;  3QAR A;  3BYT B;  3T3O A;  1GJZ A;  2RDB C;  2Q5W D;  4NPN A;  2MP2 A;  4XGA B;  4G3X B;  2IND C;  1L5P A;  2BTE A;  1HTO A;  1LM8 B;  3W5V B;  3EGR A;  1TY2 A;  1VZ7 A;  2M17 A;  4M0W B;  5C2T B;  2JF5 A;  4DQO C;  4E71 A;  3VRA B;  2IGG A;  3TBL D;  2WU5 B;  2V4L A;  1UF0 A;  4E74 A;  3R8B A;  1KJT A;  3EEC A;  4C00 A;  3NOB A;  4B9K A;  4MJS A;  2RDH A;  2KFK A;  3IAS 1;  3ZW3 A;  1YOV B;  4IG7 B;  2BT6 A;  1WM3 A;  1C4P A;  3OAW A;  2IBI B;  1PUT A;  3T8M A;  4XX5 A;  1WGG A;  1FFV A;  1VZ8 A;  1V5O A;  2GBR A;  3Q3O C;  3EA6 A;  3P42 A;  5D94 A;  2C5L C;  2AQ3 B;  2JUO A;  2C7M B;  2KC2 A;  2DNF A;  4BOS C;  3P1M A;  1NVI D;  3ABV B;  5LLI A;  1I35 A;  2WXM A;  2BVC A;  3FIL B;  2K1F A;  1WXS A;  2MH7 A;  3ZIM A;  3DBL I;  4RF0 A;  4NQL B;  2N1V A;  2RMM A;  1BUI C;  1YMH E;  2IJ0 A;  1Z2M A;  2WXH A;  3KUZ A;  2XEW A;  2KJH B;  4N58 A;  3UIN B;  2BKF A;  4J3O D;  4KKI A;  2ACZ B;  1ZGU B;  1WGD A;  3QK0 A;  2V4I B;  1VCB A;  2K9X A;  3AEF B;  1YX6 B;  3Q2A C;  4YXD B;  2W82 A;  2HE7 A;  1JWU D;  1ZUD 2;  4NQK E;  5I4D A;  1K51 A;  5DPW A;  4ANU A;  1IBX A;  1XLQ A;  1RWS A;  1SJE D;  1TBE A;  2G4S A;  2J0K A;  2KZR A;  4BVU C;  3KVF B;  2CHW A;  3M62 B;  4PYU A;  3E9S A;  3AU5 A;  3L10 B;  4MGY E;  4IW0 A;  4ICV A;  3PLV A;  3PZ7 A;  2Z8L A;  4GXB A;  1SEB D;  4W9J A;  2PMV A;  1VJK A;  3ZNZ B;  3JW0 X;  2JVC A;  1F0Z A;  3VHT C;  4RCO A;  3W1S A;  4PK1 A;  1YJ1 A;  4ZHO A;  2KYW A;  1XQQ A;  1AW7 A;  1R4M B;  4A3O A;  4HCN B;  1MG8 A;  1V1P A;  1WXV A;  2D3C A;  3H7P A;  4W9G A;  1TZO A;  3ZKJ C;  4FUL A;  1MHX A;  3BY4 B;  2FAZ A;  3KLS X;  5DPS A;  1YD8 U;  4YSX B;  2LMC A;  1PGA A;  1KH0 A;  1BXT A;  4YL8 A;  3MC0 B;  1E9M A;  2LHE A;  3A1Q B;  1C78 A;  4NZL B;  1UD7 A;  2KDM A;  2DX5 B;  4ARC A;  2D5G A;  3PS6 A;  3GB1 A;  1LO5 D;  2EEL A;  2OOB B;  2NTS A;  4GDL A;  4C56 C;  1EWY C;  3GZN B;  3QWZ B;  1N63 A;  2O6V B;  3N1X C;  2VH2 A;  5GXG B;  4JWS C;  2B76 B;  4BKT A;  4JX1 C;  2FNJ B;  1UGM A;  2GMI C;  2IGD A;  4MAC A;  3D32 A;  2QEJ C;  3Q8F A;  3QX1 A;  4YTM B;  1TGZ B;  3BK2 A;  4BOZ B;  1D5X C;  3IXS A;  4HCP B;  3JVZ X;  3U8Z A;  5IO9 A;  1ZDV A;  3VTU A;  3AE7 B;  3V6C B;  1PGX A;  1ZXH A;  3DVG X;  1IGC A;  3AN1 A;  1XLP A;  3PV1 A;  2RPV A;  3SFE B;  3CST A;  5D7G A;  3WAP A;  5IA7 A;  1DOY A;  4W9K A;  2XBB C;  5EE0 A;  1L2N A;  1F52 A;  2JYE A;  2GBJ A;  3I9V 1;  2DAF A;  3N20 C;  4W9C A;  1J19 A;  4FBJ B;  2HD5 B;  3P4Q B;  5AUK A;  3NVW A;  3VXW A;  1AAR A;  4A9A A;  4DHZ B;  2KHW B;  3VFK A;  4GLS C;  1FNW A;  3I57 A;  1D3Z A;  3UF8 A;  1LFD A;  1SSN A;  1AWD A;  4HJK A;  3A33 B;  2XK5 A;  3VVW B;  2NTT A;  3U2S C;  2BYT A;  3H7S A;  4B6W A;  2KKC A;  4WAA A;  3PZ8 A;  5LXH A;  2ON8 A;  1KLU D;  1JRP A;  2KC1 A;  4LNI A;  4YT0 B;  3QC8 B;  2JWU A;  2WU2 B;  3TEW A;  3L4P A;  2M1M A;  3UI3 A;  2HTH A;  2WS3 B;  2YEP B;  3MJW A;  3QCA A;  3H6N A;  3O65 B;  1OEY A;  2B3A A;  4M8M A;  5JZE B;  4W9L A;  2IY1 B;  2PPH A;  2KMC A;  1R4M I;  2BB6 A;  2BS3 B;  4JGH B;  2M8S A;  3GE8 C;  2JQR B;  4RGM A;  4NY0 A;  3GE3 C;  2M4N A;  4WWO A;  2RD0 A;  1WFY A;  5L95 C;  1Y56 A;  3NS1 A;  1JML A;  1TY0 A;  4EE2 A;  3QQ8 B;  1D5Z C;  4OZC A;  2ASQ A;  2QMT A;  3WIM A;  3RI7 C;  2EMT A;  2O2V A;  2MBQ A;  2KMM A;  1ZE3 D;  1I4H A;  1TS4 A;  2KWD A;  3DWG C;  1F2R C;  3AE1 B;  4H2A A;  2BQQ A;  2KJ6 A;  3ALB A;  4WJP A;  4C4V A;  3LYY A;  3NZS A;  2L05 A;  2PIA A;  1ESF A;  2PJH A;  2IO2 B;  2WDT B;  4TUU A;  2KOX A;  4BKG A;  4USA A;  2KT7 A;  3JSV A;  2KMA A;  2GI9 A;  5EE1 A;  2X8X X;  2UWQ A;  3NVY A;  2JWZ A;  4K7U A;  3L54 A;  5DCN A;  3AUL A;  3SHQ A;  2QIL A;  1QQR A;  2BW2 A;  2V3P A;  1N60 A;  1MG4 A;  4K81 A;  1C4C A;  2INN E;  3O13 A;  2LGX A;  3AE2 B;  4MDK E;  1WJ4 A;  2GLS A;  2DAJ A;  3ZNI D;  2EKE C;  1C1Y B;  1WJU A;  1TJE A;  4ZDV A;  1R4N I;  3DBR B;  1SXT A;  2K0P A;  2FCM A;  4GGQ A;  3X0W A;  3A4S C;  1Q5W B;  4N59 A;  2WQY B;  1E8X A;  3RNE C;  3WAM A;  2NS5 A;  2MJE A;  3M63 B;  4PS8 A;  2KAC A;  1CJE A;  3FAH A;  3VQI A;  3WAN A;  2D3A A;  5E6P A;  2VZK D;  1FXA A;  4JQW C;  1WH3 A;  2DEN B;  3BIN A;  3QHT A;  1WX9 A;  4OZB A;  3SR6 A;  3RNB C;  3DVN V;  3VAW A;  4AUQ C;  2K6D B;  2M56 B;  1XEE A;  3ZNH B;  3BII D;  1YN5 A;  4IWO A;  2K22 A;  5BYS A;  3M95 A;  1YIW A;  1A5R A;  3P63 A;  2KNB A;  2XN9 C;  3ZLZ A;  2N1W A;  2JSV X;  3L08 A;  2KQ4 X;  2LRU A;  3RT3 B;  1L6V A;  4EKU A;  2OJW A;  2G3Q B;  1ISN A;  2HJ8 A;  2L8J A;  4Q2J A;  2AWT A;  4ZRK A;  2V1Y A;  2KDI A;  1CZP A;  1EM7 A;  1M4V A;  4W9D A;  4XWT A;  4HXD A;  3BVM A;  4IM3 A;  3AE5 B;  3CSF A;  1PDX A;  5G55 A;  4IUM B;  1WM2 A;  1L6U A;  2ICI A;  2AQ1 B;  1ZKH A;  1WXM A;  1NBF C;  1N6Z A;  2WNM A;  3DPD A;  4AJW A;  3T3N A;  3QIJ A;  1G6J A;  3ZUN A;  4MM3 A;  4C7Y A;  2LD9 A;  2EKI A;  4BFR A;  3DBL B;  2CKH B;  3BZD B;  4II2 B;  2ZCB A;  3A9K B;  2PE9 A;  2LUE A;  4UDU C;  1HTQ A;  2NPT B;  3HK0 A;  4S17 A;  3HM3 A;  2KN4 A;  2JRH A;  1FNU A;  3IBE A;  3ML8 A;  3B9J A;  2KAJ A;  2BYV E;  3AE8 B;  3ZRC A;  2QHO A;  3HRD D;  3ZDM C;  1FFU A;  4M0W A;  4KKJ A;  1GUA B;  2MLB A;  2LGI A;  4HEA 1;  1UWM A;  5KHO A;  3C19 A;  3OLM D;  2LI5 A;  1MJD A;  3PHW B;  3OJ4 B;  3SU8 X;  5IN7 A;  2L76 A;  3ZJU A;  1YQB A;  2SAK A;  1WJ6 A;  3DVN U;  2IGH A;  2XNA C;  1XD3 B;  1V2Y A;  3IAM 1;  2ZZP B;  1RFK A;  3RZF A;  2LUM A;  3GP7 A;  2W3R A;  4YTP B;  1XCQ L;  4WIP A;  2D2Q A;  1WXA A;  1E6E B;  1WGR A;  4RM8 A;  2BYF A;  1TS3 A;  2EMS A;  1SBB B;  1SE9 A;  1WGK A;  1WR1 A;  2ZPN A;  4NJ7 A;  4BZA A;  2G9H D;  4DBG A;  4C80 A;  1V9J A;  2D3B A;  1YJI A;  3KUC B;  2L7R A;  5H92 C;  5IOI A;  4CQN A;  1V1O A;  1J7C A;  3TIX A;  1PQS A;  2GBK A;  2MBB B;  3OJ3 A;  5BMG A;  1ET9 A;  3WA0 A;  1V97 A;  2QIE B;  4DDI D;  5BYQ A;  4I6L B;  3DHH C;  2ONQ A;  1DYQ A;  2JT4 B;  3MP9 A;  5CHF A;  3R7Q A;  3PRP B;  5J2R A;  1HZ5 A;  1WMH B;  5L83 A;  5C23 A;  3RNA C;  1GNU A;  2V9H A;  2KTF A;  2DZM A;  3I5J C;  3R7R A;  4KIK B;  2JZ3 B;  1JRU A;  4M02 A;  1I4G A;  3NUH B;  1T0Y A;  1FRR A;  2WYQ A;  3HVZ A;  2QDF A;  3R3M A;  1WI0 A;  1UBI A;  4OVV A;  3TUO A;  1E7P B;  1SE2 A;  4P1B C;  2CHZ A;  1GC7 A;  3RUL A;  4WQM A;  2KFJ A;  4C7Z A;  1TTN A;  4EZL A;  3B08 A;  3ZGZ A;  3DHI C;  4FAD A;  2PKO A;  3BYY B;  4KZC A;  3TJP A;  4W9H A;  2I38 A;  1E90 A;  3NHE B;  4N6E B;  3RUI B;  2LZ6 A;  1L0V B;  1Q0W B;  3RZW C;  3UIP B;  4G50 A;  2DYM A;  2JRI B;  1E8W A;  2WXF A;  4DHJ B;  4HK2 A;  2JXT A;  3U7Z A;  3A1Q A;  2JU6 X;  1E8Y A;  3AEG B;  5BMI A;  2NMQ A;  3ZQ4 A;  2N9X A;  3V62 A;  2HJ1 A;  2MP2 B;  3Q3N C;  2K5P A;  5EDS A;  2WHI A;  2AYO B;  4US8 A;  5LNK 1;  1QKZ A;  4HPM B;  5E6J A;  5G5H A;  2Z0E B;  1MPE A;  2LVO A;  4IC7 B;  4ZRP A;  4RFB A;  1YN4 A;  1F77 A;  3V05 A;  4MGI E;  4WAF A;  1YQ4 B;  1V81 A;  3TL5 A;  2MHJ A;  3NG0 A;  1QOA A;  4OZA A;  2K8C A;  3TEX A;  2J0M A;  2MEK A;  1TKY A;  1TS5 A;  5AZH A;  3U30 A;  2KLG A;  1ROE A;  4LJP B;  3TEZ A;  4MJS B;  3ZJV A;  1V86 A;  4OVU A;  3VR8 B;  4OW0 A;  1RAX A;  4HKZ E;  2CJO A;  5C3J B;  1WWT A;  3Q14 C;  4XYC A;  1GB1 A;  3NZ3 A;  3Q8B A;  4HRS A;  1SF0 A;  1GOZ A;  2D10 A;  2BS4 B;  1TIF A;  3DVG Y;  4ZYS A;  4E3C A;  4EEW A;  1ACC A;  3PRZ A;  4HPL B;  2JZP A;  3URY A;  1XT9 B;  2V3N A;  2NCN A;  5BO4 B;  1EU4 A;  5CTR C;  3PHX B;  4FN2 A;  1WGH A;  4ZOH C;  2CS4 A;  2FID A;  4K7S A;  2L00 B;  3UQA A;  3AEB B;  3FC4 A;  4OVZ A;  3MHS D;  2Z59 B;  2KK8 A;  2GRI A;  4TMA B;  4ZRJ A;  4K7W A;  1VD2 A;  2H89 B;  3OWE B;  5DPR A;  1XF5 L;  2KTR B;  5IAA C;  3J9C A;  1XXG A;  1IBX B;  3DDC B;  4AJY B;  2MX2 A;  5H8Y E;  5KHQ A;  2WDV B;  4DDG D;  4HDQ A;  2Y5P A;  1WRD B;  2N7D A;  2LEK A;  2W3S A;  2QSD A;  5BMH A;  1R4N B;  3NZU A;  1HEZ E;  2LWP A;  2UYZ B;  2WLB A;  3UQB A;  2MBE A;  3VRB B;  4G11 A;  2KJR A;  1JWM D;  3WAO A;  2W54 A;  1V49 A;  1VRA B;  4M00 A;  4TQ0 A;  4PS7 A;  1V1P B;  5G2N A;  1KF6 B;  4KGS A;  2J53 A;  1GPX A;  1P7F A;  1PYW D;  3R2T A;  4AOF A;  2N9P C;  1WYW B;  5FR3 A;  4NAW B;  3BK1 A;  4AQ7 A;  1JCK B;  3R2I A;  1R7S A;  3LJ3 A;  1A70 A;  3AE6 B;  5HKH A;  1TKG A;  3K9P B;  1WF9 A;  3DBS A;  4ZYN A;  3KH0 A;  4DHZ E;  3FKY A;  1LGR A;  2KQ7 A;  2RSU A;  4GDL B;  1I7H A;  4RH6 A;  3ZJT A;  2WXP A;  2K8B A;  4ARI A;  4PYZ A;  2PVG C;  2YEP F;  1V8C A;  2ZVO A;  3P4S B;  1FPY A;  1JWA D;  1EU3 A;  2IO3 B;  1C79 A;  3Q6B A;  2ZVN A;  1DOX A;  1TZ1 A;  3APD A;  4KX6 B;  4GDK B;  1GB4 A;  2OHF A;  4RF1 A;  3LXF A;  4TSS A;  2RR9 A;  1RM6 C;  2LJ5 A;  2K8H A;  2MJD A;  2WX1 A;  4LNO A;  1MI0 A;  3ZTD A;  5HG2 A;  3RYT A;  2WX0 A;  4L23 A;  2IZV B;  4QAY A;  1PFD A;  3IT6 B;  1UNS A;  2L0F A;  5CHW A;  3AI5 A;  3AEE B;  3B2G A;  3MHZ A;  3A9J B;  2MQJ A;  2IO1 B;  2FE8 A;  1JRO A;  1EF5 A;  1I4X A;  1MFW A;  4KVG B;  1E5W A;  3AM9 A;  3CF6 E;  3A4R A;  4JLC A;  1WJN A;  2J42 A;  3KWL A;  2XK5 B;  1C76 A;  1SIF A;  2INC C;  2FIF A;  5D3I B;  2NBU A;  2G45 B;  3MC9 A;  4PS3 A;  1EWC A;  3OG5 A;  3AMZ A;  5JXV A;  5AUI A;  3LB8 C;  2DZI A;  3VTW A;  3IHP C;  4JPS A;  4NAM A;  4RGT A;  3Q69 A;  4W9I A;  3VDZ A;  4DHJ D;  4NJC A;  2J52 A;  2IPK D;  1M94 A;  1T0S C;  5E6O A;  4LTU A;  2OJR A;  1Y8R C;  1F1H A;  3PVL A;  2KD0 A;  4MSQ B;  4LNF A;  3NRZ A;  4EFO A;  4N9F 4;  4WJQ A;  2NPT A;  2M19 A;  1KLG D;  4ITK A;  3N3K B;  4HRO A;  1H8C A;  2QC8 A;  3V3X A;  3C0R B;  3P4P B;  4LNN A;  1KFY B;  3B2F A;  4B0M A;  1FEH A;  2DYB A;  5JHA A;  3RCZ A;  2K39 A;  1UUP A;  3SD5 A;  3MTN B;  2YLM A;  2N7J A;  1UEL A;  4J6I A;  1HA5 A;  1WZ0 A;  3N30 A;  4URK A;  2KQS A;  3RMK C;  2ZPY A;  1XLN A;  4C4V B;  3ONS A;  4F8C B;  1WE6 A;  2RGF A;  2CU3 A;  2SEB D;  1IUE A;  1P1A A;  2L32 A;  2W55 A;  4A20 A;  3UGB B;  1ZOY B;  1E7V A;  1AN8 A;  2AX5 A;  3JSV B;  4MT5 A;  2MJ3 A;  2QCZ A;  2RDG A;  1RFA A;  4YTN B;  1IPG A;  4CHK A;  1L4Z B;  1MHH E;  4A8X C;  2UU7 A;  3GS2 A;  2DHZ A;  4WJO A;  4FJY A;  3NVZ A;  5MPO A;  4WUR A;  2MCN B;  2MRP A;  2O6V D;  1DOI A;  1H4R A;  1OEY J;  2GBN A;  3VR9 B;  2IO0 B;  1HZ6 A;  2K6Q A;  1T3Q A;  1QT9 A;  2VH1 A;  3RN9 C;  4REZ A;  1WMH A;  3KUD B;  4GB9 A;  1YN3 A;  4KZ0 A;  2GOW A;  2JPH A;  3H8H A;  1CMX B;  4PT5 A;  1EO6 A;  3ZVV A;  3QA8 A;  3MFG A;  2JYT A;  4KDI C;  1QOF A;  2L3Z A;  1VDV A;  2MWS B;  1WIA A;  2LFI A;  1RLF A;  1JQ4 A;  5C1Z A;  3TMP B;  4KIK A;  1L7Y A;  1WX7 A;  3DBH B;  2R2Q A;  3M3J A;  2KXJ A;  5JH5 C;  2FUH B;  1FD6 A;  3N1Y C;  4OHJ A;  4KV2 A;  1OQR A;  2NR2 A;  4BBN F;  4HDO A;  1ZXI A;  1IYF A;  2WXQ A;  1QOB A;  2WXG A;  3ZXR A;  3PRE A;  1GG3 A;  3JYU A;  3RPF C;  2Y3A A;  3EFC A;  2WGS A;  3FIL A;  3ZRF A;  1CK1 A;  3Q3M C;  2LJI A;  4DK5 A;  1WSP A;  1L0Y B;  2BWE S;  1SE4 A;  4B95 A;  1KTK A;  1FO4 A;  4DXA B;  3KQ4 A;  4RGN A;  2I2Y A;  4P16 A;  2KO3 A;  2ZJD A;  2DBY A;  4ANV A;  2OED A;  1VZ6 A;  1FCC C;  4FHJ A;  5E6N A;  3IT4 B;  2WXO A;  1C3T A;  4LDT B;  3RNF C;  4MM3 B;  4A3P A;  4XWW A;  5HFY A;  1J8C A;  1U4A A;  1B9R A;  4HWI B;  4LCD E;  1KM7 A;  1C4A A;  4L1B A;  2NBW B;  3RFZ B;  1I4Q A;  1E10 A;  3AH7 A;  4TKN A;  1NI2 A;  3QAQ A;  2PTL A;  1K50 A;  1UH6 A;  4W9E A;  1UGJ A;  1ZP0 B;  3CMM B;  3ECI A;  4ZHP A;  2ZEQ A;  2N0S B;  3EUB 2;  4XC2 A;  4XDC A;  2LXA A;  3HIZ A;  1XO3 A;  3IG3 A;  4KSK C;  3VUW A;  3PPA A;  2BBC A;  2C7N B;  1FXI A;  4JL9 A;  2N9K A;  3APF A;  1CQV A;  1E8Z A;  1JAL A;  3KWV A; 
#chains in the Genus database with same CATH homology
 3AE1 B;  1K52 A;  4H2A A;  3E56 A;  4TMA B;  3CIR B;  2Y5C A;  3AV8 A;  5D3D A;  2H89 B;  1YJJ A;  1N5W A;  3OWE B;  3LYY A;  2QJL A;  2PIA A;  1HXY D;  5BYR A;  3PO0 A;  1SB3 C;  1ESF A;  4YWG G;  1XF5 L;  5TSS A;  3AE4 B;  1JWS D;  3BWU D;  1BML C;  3J9C A;  1RYJ A;  1XXG A;  2BB5 A;  1ZDX A;  1IBX B;  1ET6 A;  4WH4 A;  2HTM E;  1FCL A;  4DXG A;  4ZRQ A;  4USA A;  1QF6 A;  1E0Z A;  4RNA A;  3AE3 B;  4O1N A;  1C77 A;  1KRH A;  5H8Y E;  2GI9 A;  5T8I A;  5EE1 A;  2WDV B;  2Y5P A;  3NVY A;  2DYO A;  4XDD A;  4A6Q A;  1K53 A;  2LEK A;  2W3S A;  4L2Y A;  2QSD A;  3SEB A;  5BMH A;  2WXL A;  2E6X A;  1HEZ E;  4JWU C;  1TS2 A;  2QIL A;  1QQR A;  1HQR D;  2BW2 A;  2V3P A;  1T6B X;  3W9C B;  1N60 A;  2WLB A;  1C4C A;  4R3D A;  3WCQ A;  2INN E;  3O13 A;  3VRB B;  3AE2 B;  1JWM D;  2W54 A;  4TQ0 A;  1VRA B;  1TKE A;  2WP9 B;  1V1P B;  1KF6 B;  1TJE A;  3C8Y A;  1SXT A;  3ZYY X;  4KGS A;  2K0P A;  1XCT L;  2J53 A;  1GPX A;  4N59 A;  1JW9 D;  2WQY B;  1P7F A;  3MJ5 A;  1B1Z A;  1FNV A;  1PYW D;  3R2T A;  2ZW0 A;  3N9Y C;  4JE3 B;  4D2K A;  4XE0 A;  2MJE A;  2DWQ A;  4NAW B;  5FR3 A;  3BK1 A;  2VZK B;  4AQ7 A;  1JCK B;  3SFD B;  2KAC A;  3R2I A;  2E3T A;  1R7S A;  5FK9 C;  1CJE A;  3FAH A;  3VQI A;  1A70 A;  3AE6 B;  4FXC A;  1TKG A;  2L1A A;  2VZK D;  1FXA A;  1D4B A;  3AEA B;  3AB5 A;  2J4X A;  4OZB A;  1AYF A;  3P4R B;  4B0E A;  1SE3 A;  2WXR A;  3SR6 A;  3W5U B;  2X38 A;  2M56 B;  1XEE A;  3BYT B;  4GDL B;  1I7H A;  3BII D;  3T3O A;  2Q5W D;  1YN5 A;  4RH6 A;  2K22 A;  3ZJT A;  5BYS A;  2WXP A;  1ZPS A;  1J7B A;  1QIL A;  3P63 A;  3NVV A;  1N61 A;  2XN9 C;  1L5P A;  4ARI A;  5HHD G;  2BTE A;  2BS2 B;  1FIQ A;  2PVG C;  2JSV X;  3EGR A;  2YEP F;  4P6V F;  3W5V B;  2K3U A;  1TY2 A;  1V8C A;  2KQ4 X;  1VZ7 A;  1L6V A;  1QOG A;  3P4S B;  1JWA D;  4DQO C;  5C2T B;  1EU3 A;  3VRA B;  2IGG A;  1C79 A;  2WU5 B;  4Q2J A;  1VLB A;  1CZP A;  1EM7 A;  1OQQ A;  1DOX A;  3R8B A;  4KX6 B;  1M4V A;  4GDK B;  1GB4 A;  4XWT A;  1DGJ A;  2N9L A;  2OHF A;  3BVM A;  3AE5 B;  4RF1 A;  2RDH A;  3LXF A;  3IAS 1;  4TSS A;  1PDX A;  2CJN A;  1L6U A;  2L83 A;  2ICI A;  2AQ1 B;  1RM6 C;  2BT6 A;  2MJD A;  2WNM A;  1C4P A;  3T3N A;  1PUT A;  1MI0 A;  4US9 A;  1FFV A;  1VZ8 A;  2WXI A;  5HG2 A;  4C7Y A;  2EKI A;  4L23 A;  3EA6 A;  3P42 A;  3Q8C A;  1PFD A;  3BZD B;  2AQ3 B;  3IT6 B;  1SJH D;  1UNS A;  1J7A A;  3P1M A;  4UDU C;  1NVI D;  3ABV B;  2AQ2 B;  3AEE B;  3B2G A;  2WXM A;  2KN4 A;  3MHZ A;  3FIL B;  1FNU A;  4KGT A;  4LLG M;  3B9J A;  2KAJ A;  2MH7 A;  3Q8E A;  3AE8 B;  2FE8 A;  3HRD D;  1JRO A;  1FFU A;  2L52 A;  4M0W A;  4RF0 A;  4KKJ A;  4A55 A;  2LGI A;  4HEA 1;  1I4X A;  5HI1 A;  1UWM A;  2M0A A;  3AM9 A;  2J42 A;  3KWL A;  2RMM A;  1C76 A;  5EE9 A;  1BUI C;  1YMH E;  2IJ0 A;  2WXH A;  1QLB B;  4DXF A;  4N58 A;  2H88 B;  5D3I B;  3ZJU A;  4IKG A;  1EWC A;  3AMZ A;  2SAK A;  5JXV A;  4J3O D;  1SIJ A;  4KKI A;  5AUI A;  3LB8 C;  4LK0 M;  1UWX A;  2IGH A;  2V0G A;  2ACZ B;  2XNA C;  4JPS A;  4NAM A;  4RGT A;  3Q69 A;  3IAM 1;  4NJC A;  1RFK A;  2FUG 1;  2V4I B;  2LUM A;  2J52 A;  2IPK D;  2W3R A;  3GP7 A;  2K9X A;  3AEF B;  2WXN A;  1XCQ L;  1F2R I;  4WIP A;  4YTP B;  4LTU A;  4YXD B;  2W82 A;  1I4R A;  2GB1 A;  1E6E B;  1JWU D;  1ZUD 2;  1FRD A;  1TS3 A;  3NRZ A;  5I4D A;  1K51 A;  1SBB B;  2M19 A;  1KLG D;  1WGK A;  4ITK A;  3U52 E;  4HRO A;  3AEC B;  2G9H D;  1IBX A;  3U4E G;  3V3X A;  1XLQ A;  1RWS A;  1SJE D;  4C80 A;  3P4P B;  2DLB A;  1KFY B;  3E9S A;  1YJI A;  3B2F A;  5H92 C;  4B0M A;  4CQN A;  1FEH A;  1V1O A;  1J7C A;  1WYG A;  5BMG A;  1ET9 A;  1V97 A;  1UUP A;  2QIE B;  1TYG B;  3PZ7 A;  2Z8L A;  5BYQ A;  1SEB D;  2ONQ A;  1DYQ A;  2PMV A;  1VJK A;  2N7J A;  3MP9 A;  1F0Z A;  2PLP A;  4RCO A;  3W1S A;  2PVO D;  1HA5 A;  1L4D B;  3BVG A;  4ZHO A;  1AW7 A;  4HJG E;  1HZ5 A;  1V1P A;  1D6E C;  2LHD A;  1WRI A;  1XLN A;  4WWM A;  1ENF A;  1TZO A;  2CU3 A;  2ZW1 A;  2SEB D;  1MHX A;  1IUE A;  1N5X A;  2IDY A;  2L32 A;  5EE3 A;  2W55 A;  2JX5 A;  3KLS X;  1ZOY B;  4YSX B;  2LMC A;  1AN8 A;  1PGA A;  2AX5 A;  1KH0 A;  2INP E;  4MT5 A;  1BXT A;  2MJ3 A;  3MC0 B;  1E9M A;  2G1E A;  2LHE A;  2PW9 A;  1C78 A;  2RDG A;  1I4G A;  4NZL B;  2KDM A;  4YTN B;  4ARC A;  3NUH B;  1L4Z B;  1MHH E;  2D5G A;  2TSS A;  1FRR A;  3HVZ A;  3GB1 A;  1LO5 D;  3GS2 A;  2EEL A;  4A8X C;  2NTS A;  3NVZ A;  4C56 C;  1EWY C;  3TUO A;  1E7P B;  1N63 A;  1SE2 A;  1D5M C;  5MPO A;  4WUR A;  1JWB D;  4WQM A;  5GXG B;  4JWS C;  4C7Z A;  2B76 B;  1DOI A;  4JX1 C;  3ZGZ A;  2PKO A;  1Q10 A;  2IGD A;  3VR9 B;  4TQ1 A;  3BYY B;  4MAC A;  4HKQ A;  1FMA D;  2WXK A;  1HZ6 A;  2QEJ C;  3Q8F A;  1T3Q A;  1QT9 A;  2I38 A;  4REZ A;  4YSZ B;  4YTM B;  5G5G A;  3HUI A;  1P7E A;  1YN3 A;  4N6E B;  3BK2 A;  3H8H A;  2WDR B;  4PT5 A;  1L0V B;  1D5X C;  3IXS A;  3MFG A;  2JYT A;  1FM0 D;  1MVK A;  2DYM A;  1ZDV A;  1QOF A;  1VDV A;  3AE7 B;  2LFI A;  1PGX A;  1ZXH A;  2WXF A;  1JQ4 A;  1IGC A;  1NI3 A;  3AN1 A;  1XLP A;  2RPV A;  3SFE B;  2JXT A;  3U7Z A;  5D7G A;  2WDQ B;  2JU6 X;  1T5X D;  1DOY A;  4YSY B;  3HVD A;  1FD6 A;  3AEG B;  5BMI A;  2NMQ A;  4OHJ A;  3ZQ4 A;  1OQR A;  5EE0 A;  1PGB A;  3BVZ A;  2K5P A;  1IGD A;  1ZXI A;  4US8 A;  5LNK 1;  1QKZ A;  2JYE A;  3I9V 1;  2WXQ A;  5E6J A;  5G5H A;  1QOB A;  2WXG A;  1MPE A;  4ZRP A;  1YNT E;  4RFB A;  3RPF C;  2Y3A A;  1YN4 A;  3FIL A;  1F77 A;  1CK1 A;  3V05 A;  4WAF A;  2LJI A;  1WSP A;  1YQ4 B;  1L0Y B;  3P4Q B;  5AUK A;  3NVW A;  1SE4 A;  1QOA A;  4OZA A;  1I4P A;  3TEX A;  1KTK A;  4A9A A;  1FO4 A;  2MEK A;  3AED B;  3KQ4 A;  4GLS C;  3TEY A;  1FNW A;  3I57 A;  1GAQ B;  1TKY A;  1TS5 A;  1SSN A;  4RGN A;  1AWD A;  2I2Y A;  4P16 A;  1ROE A;  2NTT A;  3U2S C;  2WXJ A;  3TEZ A;  2DBY A;  2BYT A;  2OED A;  3ETR A;  1VZ6 A;  1FCC C;  3ZJV A;  3IT4 B;  2WXO A;  4IDI A;  3PZ8 A;  3DWM A;  1L0X B;  1NEK B;  3VR8 B;  4OW0 A;  2ON8 A;  1KLU D;  1JRP A;  4HKZ E;  1WXQ A;  4YT0 B;  2CJO A;  2JWU A;  5C3J B;  2WU2 B;  4MM3 B;  1WWT A;  4XWW A;  5HFY A;  3TEW A;  2HDE A;  3AE9 B;  3L4P A;  1B9R A;  3UI3 A;  2WS3 B;  1GB1 A;  2YEP B;  3NZ3 A;  3Q8B A;  1C4A A;  4HRS A;  1STE A;  4AS1 A;  1SF0 A;  1GOZ A;  4L1B A;  2BS4 B;  3RFZ B;  4A90 A;  1I4Q A;  1E10 A;  4ZYS A;  3AH7 A;  2BB6 A;  1NYQ A;  2BS3 B;  2PTL A;  1K50 A;  1ACC A;  1OFF A;  2JQR B;  2JZP A;  4RGM A;  1UGJ A;  1ZP0 B;  1VR9 A;  2V3N A;  4KGR A;  1YQ3 B;  3URY A;  4ZHP A;  1EU4 A;  2N0S B;  1Y56 A;  1NYR A;  3NS1 A;  3EUB 2;  4XDC A;  1JML A;  1TY0 A;  4ZOH C;  1N62 A;  4EE2 A;  1XO3 A;  3AEB B;  3Q8A A;  3FC4 A;  1D5Z C;  4OZC A;  1NEN B;  2QMT A;  2BBC A;  4MH8 A;  4IOI E;  4OVZ A;  1FXI A;  5FKA C;  1C9F A;  2KMM A;  1ZE3 D;  1I4H A;  2N9K A;  2R61 A;  3TSS A;  1CQV A;  1TS4 A;  2FBW B;  1JAL A;  3CWI A;  2KWD A;  3DWG C;  1F2R C;  2GRI A;  4RGO S;  1XLO A;  3KWV A;  3W2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...