4ITKA

The structure of c.reinhardtii ferredoxin 2
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
MFKVTFKTPKGEKTIDVEADKYLLDAAEEAGMDLPYSCRSGGCSTCCGKLESGTVDQSDQNMLDEDQLKQGFVLTCVAYPTSDIVILTDQESKLPIGGSENLYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apoferredoxin
publication title Crystal structure and biochemical characterization of Chlamydomonas FDX2 reveal two residues that, when mutated, partially confer FDX2 the redox potential and catalytic properties of FDX1.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Electron transport
total genus 24
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4itkA00
1FXIA 4YT0B 2Q5WD 1N5WA 5EE0A 2W3RA 1E9MA 2WP9B 4C80A 1YQ3B 1JW9D 1QOBA 4YSZB 1J7CA 1TYGB 1KFYB 1N62A 2BS2B 1TKEA 3P4PB 5AUIA 4WQMA 2HTME 4LTUA 3VR8B 1XLPA 3P63A 5H8YE 4ITKA 1ZXIA 3RPFC 3AE9B 1GPXA 3ABVB 2WS3B 2WU2B 3PO0A 3AEBB 4USAA 2N0SB 2ACZB 1JWBD 1RWSA 1QF6A 3VRBB 1J7BA 2FBWB 2MJ3A 2PKOA 4YSYB 3AEAB 1KF6B 3NS1A 3SFDB 1OQQA 1R7SA 2B76B 2BS4B 2K22A 1I7HA 1GAQB 2CJOA 1IUEA 1PFDA 3AE4B 3AECB 3B2GA 1RYJA 3ETRA 1PDXA 1QT9A 1WRIA 3ZYYX 3AE8B 3AV8A 2G1EA 2QIEB 2WDVB 1CJEA 1EWYC 2LEKA 5EE1A 1KRHA 2BS3B 2M56B 4ZHOA 2L83A 1YJIA 1B9RA 4P6VF 3SR6A 1YQ4B 3AB5A 1XO3A 3AE5B 3P4QB 4N59A 5H92C 1ROEA 1JROA 3HRDD 4N6EB 2KMMA 3AN1A 2M19A 3AEEB 1DOXA 3AEFB 2BT6A 1JQ4A 3AH7A 5AUKA 1JALA 1VLBA 5EE9A 2KAJA 1SF0A 3B9JA 1SIJA 1V8CA 3W5VB 1NEKB 4JWSC 2PVOD 1FMAD 4YTPB 4HRSA 1OQRA 2MH7A 2OHFA 2W55A 1QOGA 2EKIA 5C3JB 1YJJA 2PVGC 3AM9A 1FRRA 1DOYA 3AE3B 4N58A 5G5GA 1E6EB 4ZOHC 1VDVA 2WDRB 3DWMA 1TKYA 5EE3A 1SB3C 1FM0D 3NRZA 5MPOA 1WWTA 1RFKA 1L6VA 1XLQA 3L4PA 3NVZA 3W9CB 1FXAA 1NI3A 2W3SA 1ZUD2 1L0VB 1NENB 1L5PA 2W54A 1N63A 3AE6B 1DOIA 2CU3A 3DWGC 3FC4A 1FIQA 4ZHPA 1F0ZA 2K5PA 2JQRB 1DGJA 1CZPA 1AYFA 1WXQA 2PIAA 3SFEB 1WGKA 3CIRB 1QOAA 1N61A 4FXCA 2Y5CA 3AMZA 1OFFA 1ZP0B 2MJEA 3AE2B 4YSXB 3AEDB 3P4RB 1RM6C 1E0ZA 2L52A 1ZOYB 1TJEA 3VRAB 3AEGB 1NYRA 4YTMB 2WDQB 3HVZA 1L6UA 3AE7B 3NVYA 3NVWA 1FFUA 1JWAD 2WU5B 1JRPA 1E10A 1VJKA 1T3QA 1V97A 3LB8C 2K9XA 2H89B 2QJLA 4JX1C 4US9A 4US8A 1E7PB 2CJNA 3FAHA 2E3TA 3CWIA 2WQYB 1NVID 1WYGA 2WLBA 2DWQA 1NYQA 3P4SB 3VR9B 3NVVA 3LXFA 1FO4A 3BIID 3KWLA 1PUTA 4HROA 1N60A 2AX5A 1FFVA 3AE1B 3B2FA 4YTNB 4KX6B 4JWUC 5GXGB 1XLOA 1N5XA 1TKGA 1J7AA 3W5UB 3HUIA 4C7ZA 1A70A 1AWDA 4IDIA 1QLBB 2JX5A 5G5HA 4A9AA 3P1MA 4C7YA 1QOFA 2DBYA 3EUB2 4WWMA 2H88B 4YXDB 1FRDA 3WCQA 1UWMA 1XLNA 2MJDA 5C2TB
chains in the Genus database with same CATH superfamily
1WSPA 2KLGA 1Q1OA 4M01A 5EE0A 3U30A 3BZDB 4M00A 2AQ1B 2L0FA 5LLIA 2HTME 4DHZE 2KKCA 1TT5B 3RUIB 2Z8LA 2BTEA 1FCLA 1T6BX 4IWPA 1WGRA 3VHTC 2D3GA 1WRIA 1QT9A 3ZYYX 4DWFA 3RCZA 1AN8A 2BS3B 2L83A 4MELA 4PK1A 3AB5A 4A3PA 4MACA 3AEFB 2BT6A 1HZ6A 5E6JA 1WX9A 4HDOA 4P16A 3W5UB 2KAJA 1C4CA 2CU1A 4M0WA 1DOYA 1YD8U 1H8CA 2WDTB 3BINA 1PYWD 4ANUA 4DXGA 2IJ0A 3NVZA 5T8IA 1SXTA 1V2YA 3NOBA 3CMMB 3V60A 4OW0A 4ANWA 3HM3A 1E8YA 4HJGE 5CX3A 1ZP0B 3ZUNA 4FA6A 2L52A 1TZ1A 5JZEB 4FADA 3NVWA 1FFUA 2FNJB 2W9NA 2JWZA 2LVOA 4WWPA 1IGDA 2N9EB 4NY0A 5I4DA 1TS5A 2DNFA 3HM6X 4OHJA 3VR9B 1P7FA 3ZJVA 3QAQA 3V3XA 2V3SA 3V61A 1N5XA 1KTKA 3M62B 1J0GA 4L23A 2VZKB 4C7YA 3PS6A 3NHEB 1GB1A 4GXBA 5AZHA 3TSSA 1YQ3B 3U7DA 3APFA 5E6PA 1D3ZA 3PLVA 4WQMA 2J0MA 1ZXIA 5J17A 3WALA 2D3CA 1TIFA 3A9KA 2KMCA 3WAPA 4WJPA 2A4ZA 4K7UA 1WMHA 5HI1A 4PYZA 2L76A 3DHHC 1I7HA 2CJOA 3SDLC 2NCNA 4WAFA 3IHPC 1PDXA 3VTVA 2QC8A 4DQOC 1QQRA 2WDVB 4MGYE 2DYMA 3R7RA 1WE6A 2WXJA 2PPHA 4TKNA 1NBFC 4RGMA 4ARIA 2KANA 2CR5A 3MHZA 2KMMA 2I2YA 1YN5A 1SIJA 2MHJA 1K50A 2L32A 5D7GA 3ZO5B 1MHXA 4C4VB 2WDRB 1FEHA 3PHWB 2JXXA 1L7YA 1L6VA 4BKGA 3R3MA 3R66C 4MT5A 5BO4B 4W9GA 4W9CA 2KWUB 1ZE3D 4O1NA 3RNEC 3RN9C 4J3OD 3KH0A 4FJZA 2K8BA 4B0EA 1VJKA 4US8A 3DVNV 2LJIA 2J0JA 3Q69A 5DPTA 3L54A 1FNWA 4LLGM 4GU2A 3BIID 4NAWA 2N7JA 2BWFA 2WXPA 1XLOA 3PSEB 3WAOA 1Z5SB 4FJYA 3TUOA 4K3CA 4K7SA 3N32A 3JSVA 1XQQA 1PGXA 2G4SA 2MJDA 1EF1A 4HJKA 1ET6A 5LNK1 4C56C 3PRZA 4BBNF 2L0TA 4IC7B 3CSTA 2SAKA 4LTUA 3SU8X 1VD2A 1C4PA 2LUEA 3DDCB 2FE8A 2PMVA 3NS1A 3SFDB 5D3IB 1YMHE 1F2RI 1GAQB 5TR5A 1YN4A 4W9FA 4HCPB 1XF5L 3RNAC 1VR9A 2ICIA 2LUMA 3MJ5A 2PLPA 4MM3A 1E8ZA 1KRHA 3N20C 1EU3A 3DCGA 3P4QB 4DXAB 3ZLZA 2J42A 4BBNC 2QILA 5BYSA 2L00B 2KWCA 4IKGA 1HTQA 3A4RA 2KC1A 2MP2A 1UF0A 2DZJA 3IXSA 4XWTA 3ZIMA 3ZJTA 1TZOA 3MJWA 3H7PB 1E5WA 4GDLB 2GBMA 4ICVA 3UIOB 3P2BA 4MSQB 2BBCA 2YVCA 3VVWB 5FK9C 3UI3A 1WGKA 3ML9A 3DVNU 2Y5CA 3OWEB 2Z0DB 3JW0X 4BFRA 1RM6C 1ZOYB 3IG3A 4WJNA 3AI5A 4M02A 4JX1C 1E7PB 2MBHA 4NAMA 4ZRJA 2KX0A 4NAWB 1LXDA 5JXVA 4NQKE 3AE1B 3NZUA 1M4VA 4AJYB 2D3AA 3JSVB 1J19A 2HE7A 5G5HA 4IM3A 4I6LB 3A9JA 1UGMA 1WXMA 2JU6X 4OZBA 1V5OA 1FXIA 3ZRFA 1E9MA 4YSZB 1TYGB 4LDTB 1KFYB 1TKEA 5AUIA 1WX7A 3OJ4B 3ONSA 2E6XA 4BKTA 1J7BA 2RMMA 4KDLB 3FKYA 3JYUA 2O2VA 5IAAC 4MM3B 3DBRB 3K9OB 1EU4A 2BB6A 4PS7A 1WJ4A 4ZRPA 2M56B 2RDGA 3C19A 1U4AA 4BZAA 2MP2B 2DHZA 1UH6A 2KVRA 1OQRA 1WYWB 4WJOA 1JWMD 1YJJA 2PVGC 1K52A 2DLBA 5FR3A 3I9V1 2ZCCA 2LXAA 2BYTA 1FD6A 3BVMA 2JZPA 2C7NB 2CU3A 4F8CB 1F1HA 4LNNA 4B9KA 2KFKA 2JY6A 2KMAA 4EFOA 2RDHA 1NYRA 2DZMA 2JSVX 4IUMB 3QQ8B 3WA0A 1L2NA 2IDYA 2E3TA 3DBRI 1PGAA 2KTRA 3KLSX 3I3TB 3ZW3A 5HFYA 2KJ6A 1ZDVA 2D10A 4OVVA 4AS1A 1J7AA 1C76A 4IDIA 4QAYA 3PLUA 2V4LA 1QOFA 1UNSA 1P0RA 2H88B 3IT4B 1FRDA 1C79A 1XCQL 2GOWA 1MPEA 1NDDA 3SFEB 3OAWA 3RD2A 1IGCA 3T9LA 2BYEA 2EKEC 2Y3AA 2K6QA 3B08A 2ACZB 2O2VB 1FXTB 4RGTA 2FBWB 4UDUC 3HIZA 1V80A 2J0KA 4GGQA 3AE8B 4MGZE 4NPNA 3E56A 1CJEA 1L0XB 3QWZB 4HKQA 1Z2MA 4KDIC 2XBBC 4F7ZA 1F77A 4WWOA 1FRRA 3AE3B 5BMHA 2PW9A 2VRRB 3R2IA 3ZTDA 1WE7A 4LNKA 1HA5A 1NENB 3NZSA 1N63A 3FC4A 2KFKB 1F0ZA 2QSDA 2BVCA 2KQSA 3ZNGC 2GBJA 1F2RC 3GE8C 1E0ZA 2CHZA 1C9FA 1RFAA 3UGBB 4A8XC 4TUUA 2MBBB 2KTRB 2WXQA 3SEBA 1JRUA 3T8MA 2AX5A 1C4AA 4YTNB 1SSNA 1VZ6A 4W9JA 4RGNA 3HUIA 2KJRA 1Q5WB 3P1MA 4WWMA 1TGZB 4WH4A 4LK0M 2ZPYA 4ZHPA 1L4ZB 3Q3NC 1VRAB 1I4PA 2M4NA 4TV3A 5FKAC 1LGRA 1J7CA 2KQ7A 2PEAA 1YIWA 1PQSA 4G3XB 5H8YE 3AE9B 3ABVB 1HQRD 3RNGC 1I4HA 1MI0A 2KWDA 4YSYB 1ENFA 1BUIC 3GZNB 3ZRCA 2BWES 2BS4B 2INDC 4BVUC 1RAXA 2MX2A 1BT0A 4HK2A 4LNFA 3QARA 3TEZA 2PJHA 2GMIC 2IO1B 2K8HA 4H2AA 2JF5A 3APCA 1JQ4A 3AH7A 4XX5A 5LXIB 1Q0WB 3ZQ4A 2NBVB 3PRPB 1EWCA 1V1PB 2Z0EB 4N58A 1TKYA 2CKHB 1WR1A 3A1QB 3RYTA 2NPTB 4FHKA 1FXAA 3MHSD 1ZUD2 2FCSA 4KVGB 3IVFA 2IGGA 2KOXA 3ZKJC 1WXQA 1TTNA 4WIPA 1E90A 3Q3MC 2FCNA 1B1ZA 3FILA 2C9WB 2INNE 3DOWA 2WDQB 3HVZA 5BYRA 4HPLB 4HXDA 5E6NA 4NJCA 2V3NA 3GZNI 1HTOA 4C4VA 4OVUA 4ACFA 1WZ3A 4RCOA 2MRPA 4AUQC 1NYQA 2LI5A 2QCZA 3PZ7A 3M3JA 3OLMD 2OJWA 4ICUA 2DAFA 2D07B 3ZDTA 2IY0B 1IBXA 1WY8A 2C7HA 3MP9A 3GB1A 2BPSA 4A9AA 4KV2A 1C77A 1UWMA 1XLNA 3GP7A 1Q10A 4RM9A 2WP9B 3MFGA 3Q8BA 1T0YA 5D3DA 3P63A 3ECIA 2WNMA 4JGHB 1YOVB 1E7VA 3AEBB 4G11A 5AZGA 1QF6A 2AYOB 5HKHA 2I38A 3LJ3A 2LRUA 3TEYA 3VAWA 1V9JA 2C7MB 1WX8A 2ZVNA 1D5XC 4P6VF 3AE5B 2KDIA 3KUCB 2CS4A 2KNBA 2RGFA 3B0AA 4JWSC 2VH1A 3IFWB 4EZLA 1TS2A 2Z59B 3OG5A 2K8CA 4ZOHC 2L8JA 1TY2A 3TL5A 2W3SA 3R7QA 4Q2JA 3KYDD 2KD0A 4I6PA 4E3CA 3NZ3A 4GN1A 4TSSA 4A90A 1FNUA 2K5PA 1KJTA 3I5JC 3FILB 1AYFA 2LVPA 2QMTA 2KO3A 4I6NB 4TQ0A 1VZ8A 3MTNB 3ZXVA 1GOZA 2QJLA 2ZVOA 3TJPA 2D11A 5HG2A 1WIAA 3H7PA 4GDLA 4EE2A 2FCMA 1ESFA 1IBXB 3V05A 1VCBA 3B2FA 4II3B 2HD5B 4K81A 2V0GA 4RFBA 5JH5C 1DYQA 1CQVA 3ZNID 2LD9A 5EDSA 5C2TB 3N1XC 2K3UA 1F52A 4C80A 2JVCA 2BS2B 2ZPNA 3P4PB 2ZJDA 1J8CA 3Q3OC 2D2QA 1E8WA 2N0SB 3VRBB 2NVUI 3BVZA 3VH3B 1YN3A 3SHQA 1P98A 3CSFA 2W82A 3DBLB 3B2GA 1XEEA 2WXKA 1WH3A 1I42A 1SBBB 4FULA 4NJ6A 1JCKB 1HE8A 1OEYJ 1XO3A 1YQBA 1V86A 3AEEB 1WM2A 2NR2A 5AUKA 5EE9A 2WGSA 1NEKB 3HVDA 2MA9B 2W55A 1ISNA 2NTTA 3A4SC 5CHWA 3I57A 1E6EB 2JXTA 5EE3A 5KHQA 3RNFC 3DWGC 1L5PA 2ZCBA 3AE6B 1DOIA 3O13A 2IO3B 3AU4A 3DHIC 1KOTA 2IO0B 4EOYA 5G2NA 1CK1A 1L6UA 3NVYA 2VZKD 1E10A 4YL8A 1T3QA 2R2QA 2G4DB 3DVGY 2K9XA 4HDQA 3DBLI 2N9PC 2INCC 4HVBA 3KW5B 1ACCA 2DWQA 3P4SB 2GB1A 3TEXA 2ASQA 1V5TA 1IYFA 1GG3A 2RD0A 4AP4C 4K1RB 5GXGB 5CTRC 4C7ZA 4BAXA 1PGBA 5TSSA 4IWOA 4YXDB 2DZIA 1G6JA 1JW9D 3RZFA 2KYWA 2IPKD 2BKRB 3N3KB 4M8NA 3PZDA 3U7ZA 3PO0A 4BKSA 5JHBA 1JWBD 1K53A 1SJHD 4A20A 2Y5PA 4XDCA 3PTFC 1N6ZA 4S17A 4XWWA 1PFDA 1SEBD 2B3AA 1YJ1A 3Q8EA 2LXCA 3VXWA 3AV8A 3IT6B 2N9KA 3KWVA 4OVZA 4R3DA 2MSED 4RMAA 5EE1A 2WXOA 1YQ4B 3HRDD 2JZZA 3KVFB 2PE9A 2NS5A 4ZDVA 3AU5A 2NBWB 3QJZA 2WWZA 1QOGA 3IAM1 3PREA 2CHWA 2K6DB 4MGIE 1JWSD 2WXRA 2KWVB 1HXYD 2V9HA 2EMSA 5MPOA 3DBHB 3SD5A 3H6NA 3W9CB 2W54A 4ZRKA 1FIQA 4MH0E 2JQRB 3CIRB 2J7QB 4YSXB 3AE2B 3T3OA 3GE3C 4YTMB 3AE7B 2YEPB 1X1MA 2HJ1A 2WXFA 2GBNA 2KN5A 2WLBA 4C00A 3HHMA 3NVVA 1L4DB 2M8SA 3NUHB 1BMLC 1MJDA 4LJPB 1WGYA 4XE0A 3U2SC 3ZDMC 2DBYA 2KDEB 1OQYA 3RNBC 4DHJB 2FCQA 4GDKA 4JQWC 1N5WA 1Y56A 2JYTA 2LMCA 3B1LX 3DBHI 1K51A 3UINB 3GOEA 2JZ3B 2AWTA 4XDDA 1C3TA 2LHEA 1SIFA 2B76B 2K22A 1CMXB 5KHOA 1D6EC 2XN9C 1SE9A 3L16A 2ZNVB 1WXSA 3H9DA 1D5ZC 1KLGD 3VFKA 2LGSA 2KK8A 4CQNA 1WZ0A 3ZJUA 3B9JA 3W5VB 3Q2AC 3PT2B 5BMGA 3QCAA 2OHFA 1KLVA 5C3JB 3AM9A 2KXJA 1WF9A 1R4NI 4LJOB 2K1FA 3Q3FA 4JL9A 1V1OA 2IO2B 2DZKA 1WWTA 5CHVC 3W2DA 1NI3A 4WWNA 2VH2A 3ML8A 1CZPA 1OFFA 2G45B 4ARCA 3P4RB 2SEBD 3ZTCA 2XK5A 5IN7A 1JWAD 2D3BA 2LASA 2AQ3B 1LO5D 3WIMA 1V1PA 2N7DA 5L95C 2WQYB 4MDKE 3A1QA 2NPTA 3J9CA 1GC6A 3Q8CA 4LDTD 2MWSB 4FN2A 1STEA 4IOIE 1P9DU 1I4RA 3TCAA 4GDKB 2GBKA 1P3QU 4MJSA 4US9A 4W9DA 4YT0B 2IGHA 2KDBA 3H7SA 4HEA1 3RPFC 2DYOA 3LDZE 4ITKA 2KJHB 4YWGG 2WU2B 2L05A 2RDBC 3A33B 2BB5A 4ZYSA 3O65B 2WXHA 3TMPB 1IUEA 4RH6A 3AE4B 4G0NB 1RYJA 2X8XX 1RLFA 4XGAB 2NBUA 4KGSA 1WGHA 3DBSA 2GBRA 4KZ0A 3U52E 1IPGA 2WXIA 2N9XA 1KM7A 5IKCM 2MLBA 1SE2A 3V6EB 3RFZB 1JALA 1OGWA 1ET9A 2RSUA 4YTPB 2LGYA 1WM3A 5IO9A 2JRIB 3TBLD 3DWMA 3WAMA 1QKZA 3NRZA 3ZXRA 2O6VA 2K39A 1RFKA 4L2YA 3L4PA 4ANVA 2PE6B 3EFCA 2KDMA 4NJ7A 1DGJA 2LZ6A 1QOAA 2XK5B 4FXCA 1KH0A 1P1AA 2MJEA 2K25A 2J53A 2KX3A 4G50A 4HKZE 2FUG1 3ZNHB 4KSLC 4XC2A 3PRMB 3L0WB 2M17A 4KIKA 3LXFA 2CHXA 4KX6B 4DDID 1QZEA 1TY0A 1TKGA 3AULA 1A70A 3QIJA 5HHDG 2DX5B 4MJSB 2WX1A 2IY1B 2HJ8A 5BYQA 3Q3JA 2V4IB 3DQVA 4LNOA 1D4BA 1TBEA 4K7WA 3VQIA 1OTRB 1QOBA 2KHWB 2LGXA 1GC7A 3PPAA 3HK0A 1NI2A 1RWSA 2A5UA 4DHZB 3Q8FA 2KN4A 4IM2A 2M1MA 4KKIA 1ZDXA 3M95A 1M94A 3Q14C 4F1SA 2IZVB 3QHTA 3PGEA 4II2B 4N59A 1ROEA 4N6EB 1TS3A 4EUTA 4IW0A 2M19A 3H8HA 2WXGA 2YEPF 1FMAD 3N30A 3AXCA 1F9JA 3PV1A 3DVGX 3PVLA 2O6VB 5G5GA 2MEKA 1IP9A 1SB3C 2AEHA 2MW5A 4AQ7A 3LYYA 2JRHA 1XLQA 1I35A 2FIDA 2AL3A 1L0VB 1LFDA 4JE3B 1YX6B 2L3ZA 3TIXA 2WX0A 5E6OA 3APDA 3AEDB 1JMLA 2Y5BB 3W1SA 1EM7A 4EKUA 4FBJB 3KQ4A 1WXVA 3JVZX 4NNJB 3ALBA 3VTWA 5GMVA 1V81A 2DENB 2H89B 4KIKB 1T0RC 2WHIA 1WI0A 2R61A 2WXMA 1E7UA 3NY5A 3BVGA 1WR6E 1T5XD 4NQLB 1XD3B 3NS8A 4BOZB 1LQBA 4HWIB 1K8RB 3RT3B 1YNTE 1SGHA 3BK1A 1GB4A 1ZGUB 4J6IA 1OEYA 2GLSA 4RF0A 2ZEQA 2W3RA 2KVZA 2G9HD 2L7RA 2N4FA 4PYUA 1E8XA 1EUVB 2LGDA 4M0WB 4USAA 5DPRA 2WYQA 3VH4B 3E9SA 3NJTA 1D5MC 4IM0A 2G1EA 1S3SG 5FR6A 2LEKA 1EWYC 4REZA 1Y8RC 2ZNVC 1YJIA 4FJVB 5DPSA 3SR6A 5IA7A 4TMAB 3RULA 3AN1A 1MFWA 2N7EA 2INPE 4ZRIA 1VLBA 3T3NA 1V8CA 1XCTL 2I1JA 2GI9A 4HRSA 2EKIA 4W9IA 3UIPB 2UWQA 3V62A 5LXHA 1FM0D 3UQAA 3C8YA 2UYZB 1WJ6A 4MSMB 5C1ZA 2PIAA 4HCNB 4LCDE 1N61A 5DCNA 2XEWA 1C78A 4AWJA 1XT9B 2MBOA 3EA6A 1JRPA 1V97A 4E74A 3LB8C 1I4GA 1UBIA 4WURA 3ZGZA 4DXFA 1UBQA 4S0RA 4ANXA 1EO6A 3A9KB 1FO4A 2ONQA 4CHKA 2BGFA 1WMHB 5IP4D 3RMKC 4JWUC 2EMTA 1P7EA 2LWPA 2J4XA 2BW2A 1AWDA 4GB9A 4NZLB 2KTFA 4GMVA 2AL6A 2IBIB 2G3QB 3RZWC 3WCQA 2O6VD 2LFIA 2JUOA 2BQQA 4KKJA 2N1WA 2KQ4X 3C0RB 1N62A 4JPSA 2C5LC 3H1UA 2WS3B 5DPWA 3WANA 2TSSA 3BK2A 3BYTB 3S2AA 4OZCA 4GLSC 2JPHA 2MJ3A 2PKOA 1RRBA 4P1BC 1UWXA 3DHGC 1I4XA 3X0WA 3AECB 4AJWA 3KYCD 3TEWA 1GUAB 1GJZA 4KGTA 4WAAA 3L10B 3L08A 4FLHA 5H92C 4W9HA 2KZRA 4MEMA 1UUPA 2FIFA 2OOBB 2K0PA 4D2KA 2YLMA 3ZVVA 4WJQA 1H4RA 5D6JB 2FUHB 1KLUD 4X57B 4B6WA 1HZ5A 1UELA 1MG8A 3VRAB 4KZCA 4IWQA 3N1ZC 3BYYB 2D5GA 1GNUA 3PZ8A 1XXGA 4HPMB 3GS2A 4K3BA 4GSWA 3KUDB 4RF1A 3BY4B 1C1YB 1TJEA 3AEGB 5AZFA 1WRDB 3CF6E 3VDZA 2WU5B 2M0AA 2QEJC 1UGJA 2CJNA 3FAHA 4KGRA 1WYGA 2GRIA 1ZXHA 3EECA 1BXTA 3UF8A 3KWLA 1N60A 4P7IA 4PS8A 3IAS1 4XYCA 2J52A 2JWUA 2C60A 1QLBB 3UQBA 3EUB2 2V3PA 2QHOA 5G55A 3MC0B 2DAJA 2N9LA 2N1VA 4CO7A 2R2OA 1AARA 2M0XA 4DBGA 3EGRA 1LM8B 2BKFA 2IYDB 2ZZPB 1FCCC 5D94A 1QILA 4PS3A 1UZXB 4RM8A 3VR8B 3VUXA 3RI7C 3Q6BA 2ON8A 1TS4A 2AQ2B 3AEAB 1KF6B 3RNCC 1OQQA 1R7SA 1T0SC 1R4NB 2ZW1A 5D2MB 3N1YC 1VZ7A 2KC2A 1V6EA 3NG0A 1ZW7A 2UU7A 4JLCA 2QIEB 5J18A 1WGGA 4M8MA 3EFUA 1B9RA 4N9F4 1MG4A 1JROA 1I4QA 1DOXA 1MHHE 1SJED 4A6QA 5IOIA 1YX5B 2PVOD 2BYVE 4OZAA 3L17A 2MH7A 4W9EA 4EZKA 2KDFB 3EC8A 3U4EG 3ENEA 5C23A 3I63C 4CYEA 2MBQA 4FHJA 4HPPA 2OJRA 2MBEA 2IGDA 4WQOB 3PHXB 4LNIA 5CHFA 4XZ4A 1WGDA 1EF5A 3URYA 2HTHA 3A9JB 3MC9A 1WXAA 4E71A 4URKA 1R4MB 3P42A 2XNAC 2RPQA 3EHVA 4L1BA 5J2RA 1S1QB 3CWIA 2KFJA 2LVQA 4A55A 1T0QC 1PUTA 4HROA 4DDGD 2QDFA 1FFVA 1A5RA 3QK0A 3VUYA 4EEWA 1WJUA 2WXLA 2V1YA 2JX5A 2MQJA 2KACA 1ZPSA 2Q5WD 3K9PB 4PT5A 4GOCA 2REXA 2EELA 1XLPA 1FNVA 1MVKA 1GPXA 2NTSA 2KLCA 4ZYNA 3M63B 4TQ1A 3N9YC 3IBEA 2PTLA 2LRWA 4GIVA 5L83A 1FPYA 2BF8B 2X38A 3VTUA 3MC8A 2RR9A 3X23A 1R4MI 3KUZA 3ETRA 3QA8A 3VUWA 4DK5A 4RNAA 1UD7A 4MH8A 4RGOS 4ZHOA 1AW7A 3Q8AA 2HDEA 4EZJA 3ZNZB 4IG7B 5AEKB 5BMIA 2BYFA 3QX1A 1SF0A 1SE4A 3L13A 1L0YB 2OEDA 2FAZA 2ZW0A 1HEZE 2KT7A 1VDVA 1SE3A 2LJ5A 2JYEA 1V49A 2LGIA 5JHAA 2RPVA 3QC8B 4KSKC 2LHDA 3OJ3A 3W1SC 3AMZA 3V6CB 4B95A 4JIOU 4P1CC 3D32A 4MGKE 3W1YA 4BOSC 2I1KA 4W9KA 2MCNB 2JT4B 2NMQA 4DHJD 3BWUD 2L1AA 1NVID 4AOFA 4BKSD 1WFYA 1WJNA 4HLEA 4ASWC 2DYBA 2WXNA 4W9LA 3U8ZA 4A3OA 3DPDA 4ZRQA 1ZKHA 3R8BA 1JWUD 4B0MA 3R2TA
chains in the Genus database with same CATH topology
1IGCA 1WSPA 5EE0A 4RF0A 2W3RA 2G9HD 3BZDB 1JW9D 2IPKD 2AQ1B 2Y3AA 2HTME 3U7ZA 3PO0A 4USAA 2ACZB 1JWBD 1K53A 2Z8LA 1SJHD 4RGTA 2BTEA 2FBWB 1FCLA 2Y5PA 4XDCA 3E9SA 4UDUC 1T6BX 4XWWA 1PFDA 1SEBD 3Q8EA 1D5MC 1WRIA 1QT9A 3ZYYX 3AE8B 3AV8A 2G1EA 3E56A 3IT6B 2N9KA 3KWVA 4OVZA 1CJEA 1EWYC 2LEKA 4R3DA 1AN8A 4REZA 5EE1A 2BS3B 2WXOA 2L83A 1YJIA 1L0XB 3SR6A 1YQ4B 3AB5A 3HRDD 4MACA 4TMAB 3AN1A 4HKQA 3AEFB 2BT6A 1HZ6A 2INPE 5E6JA 1VLBA 4P16A 3W5UB 2KAJA 3T3NA 1V8CA 1C4CA 1XCTL 2GI9A 4HRSA 1QOGA 3IAM1 2EKIA 1F77A 4M0WA 1FRRA 1DOYA 1JWSD 2WXRA 3AE3B 1HXYD 5BMHA 1FM0D 1PYWD 2PW9A 3C8YA 5MPOA 3R2IA 4DXGA 2IJ0A 3NVZA 3W9CB 1HA5A 2W54A 1NENB 1N63A 3FC4A 5T8IA 1SXTA 1FIQA 1F0ZA 2JQRB 2PIAA 2QSDA 4OW0A 3CIRB 1N61A 4HJGE 1ZP0B 3AE2B 4YSXB 3T3OA 1F2RC 1E0ZA 2L52A 1C78A 4YTMB 3AE7B 1C9FA 2YEPB 3NVWA 1FFUA 3EA6A 4A8XC 1JRPA 1V97A 3LB8C 1I4GA 2WXFA 1IGDA 4WURA 2WXQA 5I4DA 3SEBA 3ZGZA 4DXFA 1TS5A 2WLBA 3VR9B 4OHJA 3NVVA 1L4DB 1FO4A 1P7FA 2ONQA 3NUHB 3ZJVA 2AX5A 3V3XA 1BMLC 1C4AA 4YTNB 1SSNA 1VZ6A 4JWUC 4XE0A 1P7EA 1N5XA 4RGNA 2J4XA 1KTKA 2BW2A 3HUIA 3U2SC 1AWDA 4L23A 2VZKB 3P1MA 4C7YA 2DBYA 4WWMA 1GB1A 4NZLB 4WH4A 4LK0M 3WCQA 2LFIA 4ZHPA 1L4ZB 1VRAB 1N5WA 1I4PA 3TSSA 4KKJA 1Y56A 1YQ3B 5FKAC 2JYTA 1J7CA 2KQ4X 2LMCA 1N62A 4JPSA 1K51A 4WQMA 5H8YE 1ZXIA 3AE9B 3ABVB 2WS3B 1HQRD 2TSSA 3BK2A 3BYTB 1I4HA 4XDDA 4OZCA 4GLSC 1MI0A 2KWDA 2MJ3A 2PKOA 4YSYB 1ENFA 2LHEA 1UWXA 1BUIC 5HI1A 2B76B 2K22A 2BS4B 1I4XA 1I7HA 2CJOA 3AECB 4WAFA 1PDXA 3TEZA 4DQOC 3TEWA 1QQRA 1D6EC 2WDVB 2DYMA 2XN9C 2WXJA 4KGTA 1D5ZC 4RGMA 4ARIA 1KLGD 5H92C 4H2AA 3MHZA 1UUPA 2KMMA 2I2YA 4CQNA 1JQ4A 3AH7A 3ZJUA 2K0PA 3B9JA 3W5VB 1YN5A 1SIJA 4D2KA 5BMGA 1K50A 2L32A 2OHFA 3ZQ4A 5D7GA 5C3JB 1MHXA 1EWCA 3AM9A 1KLUD 1V1PB 4N58A 2WDRB 1FEHA 1TKYA 1V1OA 1HZ5A 1WWTA 1L6VA 3W2DA 1FXAA 1NI3A 1ZUD2 3VRAB 3BYYB 2IGGA 2D5GA 4MT5A 1WXQA 1CZPA 3PZ8A 4WIPA 1XXGA 1ZE3D 3GS2A 4O1NA 1OFFA 4ARCA 1B1ZA 3FILA 3P4RB 4J3OD 4RF1A 2SEBD 1TJEA 3AEGB 2INNE 2WDQB 3HVZA 5BYRA 4B0EA 1JWAD 2WU5B 2M0AA 2QEJC 1VJKA 2V3NA 4NJCA 4US8A 2AQ3B 1LO5D 1UGJA 2LJIA 2CJNA 3FAHA 3Q69A 1V1PA 2WQYB 4KGRA 4RCOA 1WYGA 2GRIA 1ZXHA 1FNWA 1NYQA 1BXTA 4LLGM 3PZ7A 3Q8CA 3J9CA 3BIID 3KWLA 2N7JA 1N60A 3IAS1 2J52A 2WXPA 1STEA 1XLOA 1IBXA 4IOIE 3MP9A 2JWUA 3TUOA 3GB1A 1QLBB 1I4RA 4A9AA 3EUB2 2V3PA 4GDKB 1C77A 1PGXA 3MC0B 2N9LA 1UWMA 1XLNA 3GP7A 2MJDA 4US9A 1Q10A 3EGRA 1ET6A 4YT0B 2IGHA 4C56C 5LNK1 1FCCC 2WP9B 3MFGA 4HEA1 1QILA 3Q8BA 2SAKA 4LTUA 3VR8B 5D3DA 3RPFC 3P63A 2DYOA 4ITKA 2WNMA 4YWGG 2WU2B 1C4PA 3AEBB 2BB5A 4ZYSA 2ON8A 1QF6A 1TS4A 2AQ2B 2FE8A 2PMVA 2I38A 2WXHA 1KF6B 3AEAB 3NS1A 1OQQA 1YMHE 1R7SA 5D3IB 3SFDB 1F2RI 1GAQB 1IUEA 2ZW1A 4RH6A 1YN4A 1XF5L 3AE4B 1VZ7A 3TEYA 1VR9A 2ICIA 2LUMA 1RYJA 3MJ5A 2PLPA 2QIEB 4KGSA 1KRHA 1EU3A 1D5XC 3U52E 1B9RA 4P6VF 3P4QB 3AE5B 2J42A 5BYSA 2QILA 1JROA 1I4QA 2WXIA 1DOXA 1MHHE 1SJED 4A6QA 1SE2A 3RFZB 4IKGA 1JALA 1ET9A 4JWSC 2PVOD 4YTPB 4OZAA 2MH7A 3IXSA 3U4EG 4XWTA 1TS2A 3ZJTA 1TZOA 4ZOHC 3DWMA 1QKZA 4GDLB 1TY2A 3NRZA 1RFKA 4L2YA 3L4PA 2BBCA 2W3SA 4Q2JA 5FK9C 2KDMA 2IGDA 3NZ3A 4TSSA 4A90A 1FNUA 2K5PA 1DGJA 3FILB 1AYFA 3UI3A 1WGKA 2QMTA 1QOAA 4FXCA 2Y5CA 3OWEB 1KH0A 3URYA 2MJEA 1RM6C 2J53A 4TQ0A 1ZOYB 1VZ8A 4HKZE 3P42A 2FUG1 2XNAC 1GOZA 2QJLA 4JX1C 4L1BA 1E7PB 3CWIA 4NAMA 5HG2A 4NAWB 4EE2A 3LXFA 4A55A 1ESFA 5JXVA 1PUTA 4HROA 1IBXB 3V05A 1FFVA 3AE1B 3B2FA 4KX6B 1M4VA 1TY0A 1TKGA 2V0GA 2WXLA 4RFBA 1A70A 5HHDG 2JX5A 5G5HA 1DYQA 1CQVA 2JU6X 5BYQA 2KACA 4OZBA 2V4IB 1D4BA 5C2TB 1FXIA 1ZPSA 2K3UA 2Q5WD 3VQIA 1E9MA 4PT5A 4C80A 1QOBA 4YSZB 1TYGB 1KFYB 2BS2B 1TKEA 3P4PB 5AUIA 2EELA 1XLPA 1FNVA 1MVKA 1GPXA 2NTSA 2N0SB 4TQ1A 2E6XA 1RWSA 3N9YC 3VRBB 1J7BA 2RMMA 3BVZA 3Q8FA 2PTLA 2KN4A 1YN3A 2X38A 2W82A 4MM3B 3B2GA 4KKIA 3ETRA 1XEEA 2WXKA 1ZDXA 4RNAA 1EU4A 4MH8A 2BB6A 1SBBB 4RGOS 4ZRPA 4ZHOA 2M56B 1AW7A 2RDGA 3Q8AA 2HDEA 1JCKB 4N59A 1XO3A 1ROEA 4N6EB 1TS3A 5BMIA 2M19A 3AEEB 3H8HA 5AUKA 5EE9A 2WXGA 1SF0A 1NEKB 1SE4A 2YEPF 3HVDA 1FMAD 1OQRA 1L0YB 2W55A 1JWMD 2NTTA 2OEDA 3I57A 1YJJA 2PVGC 2ZW0A 1K52A 1HEZE 5G5GA 1E6EB 2DLBA 5FR3A 1VDVA 2JXTA 2MEKA 1SE3A 3I9V1 5EE3A 1SB3C 2JYEA 2LGIA 3LYYA 4AQ7A 2BYTA 1FD6A 1XLQA 3BVMA 2JZPA 1L0VB 3DWGC 1L5PA 3AE6B 1DOIA 2CU3A 2RPVA 3O13A 4JE3B 2LHDA 3AMZA 3AEDB 1JMLA 2RDHA 1NYRA 1EM7A 3W1SA 1CK1A 1L6UA 3NVYA 3KQ4A 2JSVX 2VZKD 1E10A 1T3QA 2K9XA 2H89B 2NMQA 2IDYA 2E3TA 1PGAA 3BWUD 2R61A 2L1AA 3KLSX 1NVID 2WXMA 1ACCA 3BVGA 2DWQA 3P4SB 2GB1A 1T5XD 3TEXA 5HFYA 1ZDVA 5GXGB 4AS1A 1YNTE 1J7AA 2WXNA 3BK1A 1C76A 4C7ZA 4IDIA 4ZRQA 1GB4A 1PGBA 1QOFA 1UNSA 3R8BA 2H88B 5TSSA 1JWUD 4B0MA 3IT4B 4YXDB 1FRDA 3R2TA 1C79A 1XCQL 1MPEA 3SFEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FXI A;  4YT0 B;  2Q5W D;  1N5W A;  5EE0 A;  2W3R A;  1E9M A;  2WP9 B;  4C80 A;  1YQ3 B;  1JW9 D;  1QOB A;  4YSZ B;  1J7C A;  1TYG B;  1KFY B;  1N62 A;  2BS2 B;  1TKE A;  3P4P B;  5AUI A;  4WQM A;  2HTM E;  4LTU A;  3VR8 B;  1XLP A;  3P63 A;  5H8Y E;  4ITK A;  1ZXI A;  3RPF C;  3AE9 B;  1GPX A;  3ABV B;  2WS3 B;  2WU2 B;  3PO0 A;  3AEB B;  4USA A;  2N0S B;  2ACZ B;  1JWB D;  1RWS A;  1QF6 A;  3VRB B;  1J7B A;  2FBW B;  2MJ3 A;  2PKO A;  4YSY B;  3AEA B;  1KF6 B;  3NS1 A;  3SFD B;  1OQQ A;  1R7S A;  2B76 B;  2BS4 B;  2K22 A;  1I7H A;  1GAQ B;  2CJO A;  1IUE A;  1PFD A;  3AE4 B;  3AEC B;  3B2G A;  1RYJ A;  3ETR A;  1PDX A;  1QT9 A;  1WRI A;  3ZYY X;  3AE8 B;  3AV8 A;  2G1E A;  2QIE B;  2WDV B;  1CJE A;  1EWY C;  2LEK A;  5EE1 A;  1KRH A;  2BS3 B;  2M56 B;  4ZHO A;  2L83 A;  1YJI A;  1B9R A;  4P6V F;  3SR6 A;  1YQ4 B;  3AB5 A;  1XO3 A;  3AE5 B;  3P4Q B;  4N59 A;  5H92 C;  1ROE A;  1JRO A;  3HRD D;  4N6E B;  2KMM A;  3AN1 A;  2M19 A;  3AEE B;  1DOX A;  3AEF B;  2BT6 A;  1JQ4 A;  3AH7 A;  5AUK A;  1JAL A;  1VLB A;  5EE9 A;  2KAJ A;  1SF0 A;  3B9J A;  1SIJ A;  1V8C A;  3W5V B;  1NEK B;  4JWS C;  2PVO D;  1FMA D;  4YTP B;  4HRS A;  1OQR A;  2MH7 A;  2OHF A;  2W55 A;  1QOG A;  2EKI A;  5C3J B;  1YJJ A;  2PVG C;  3AM9 A;  1FRR A;  1DOY A;  3AE3 B;  4N58 A;  5G5G A;  1E6E B;  4ZOH C;  1VDV A;  2WDR B;  3DWM A;  1TKY A;  5EE3 A;  1SB3 C;  1FM0 D;  3NRZ A;  5MPO A;  1WWT A;  1RFK A;  1L6V A;  1XLQ A;  3L4P A;  3NVZ A;  3W9C B;  1FXA A;  1NI3 A;  2W3S A;  1ZUD 2;  1L0V B;  1NEN B;  1L5P A;  2W54 A;  1N63 A;  3AE6 B;  1DOI A;  2CU3 A;  3DWG C;  3FC4 A;  1FIQ A;  4ZHP A;  1F0Z A;  2K5P A;  2JQR B;  1DGJ A;  1CZP A;  1AYF A;  1WXQ A;  2PIA A;  3SFE B;  1WGK A;  3CIR B;  1QOA A;  1N61 A;  4FXC A;  2Y5C A;  3AMZ A;  1OFF A;  1ZP0 B;  2MJE A;  3AE2 B;  4YSX B;  3AED B;  3P4R B;  1RM6 C;  1E0Z A;  2L52 A;  1ZOY B;  1TJE A;  3VRA B;  3AEG B;  1NYR A;  4YTM B;  2WDQ B;  3HVZ A;  1L6U A;  3AE7 B;  3NVY A;  3NVW A;  1FFU A;  1JWA D;  2WU5 B;  1JRP A;  1E10 A;  1VJK A;  1T3Q A;  1V97 A;  3LB8 C;  2K9X A;  2H89 B;  2QJL A;  4JX1 C;  4US9 A;  4US8 A;  1E7P B;  2CJN A;  3FAH A;  2E3T A;  3CWI A;  2WQY B;  1NVI D;  1WYG A;  2WLB A;  2DWQ A;  1NYQ A;  3P4S B;  3VR9 B;  3NVV A;  3LXF A;  1FO4 A;  3BII D;  3KWL A;  1PUT A;  4HRO A;  1N60 A;  2AX5 A;  1FFV A;  3AE1 B;  3B2F A;  4YTN B;  4KX6 B;  4JWU C;  5GXG B;  1XLO A;  1N5X A;  1TKG A;  1J7A A;  3W5U B;  3HUI A;  4C7Z A;  1A70 A;  1AWD A;  4IDI A;  1QLB B;  2JX5 A;  5G5H A;  4A9A A;  3P1M A;  4C7Y A;  1QOF A;  2DBY A;  3EUB 2;  4WWM A;  2H88 B;  4YXD B;  1FRD A;  3WCQ A;  1UWM A;  1XLN A;  2MJD A;  5C2T B; 
#chains in the Genus database with same CATH topology
 1WSP A;  2KLG A;  1Q1O A;  4M01 A;  5EE0 A;  3U30 A;  3BZD B;  4M00 A;  2AQ1 B;  2L0F A;  5LLI A;  2HTM E;  4DHZ E;  2KKC A;  1TT5 B;  3RUI B;  2Z8L A;  2BTE A;  1FCL A;  1T6B X;  4IWP A;  1WGR A;  3VHT C;  2D3G A;  1WRI A;  1QT9 A;  3ZYY X;  4DWF A;  3RCZ A;  1AN8 A;  2BS3 B;  2L83 A;  4MEL A;  4PK1 A;  3AB5 A;  4A3P A;  4MAC A;  3AEF B;  2BT6 A;  1HZ6 A;  5E6J A;  1WX9 A;  4HDO A;  4P16 A;  3W5U B;  2KAJ A;  1C4C A;  2CU1 A;  4M0W A;  1DOY A;  1YD8 U;  1H8C A;  2WDT B;  3BIN A;  1PYW D;  4ANU A;  4DXG A;  2IJ0 A;  3NVZ A;  5T8I A;  1SXT A;  1V2Y A;  3NOB A;  3CMM B;  3V60 A;  4OW0 A;  4ANW A;  3HM3 A;  1E8Y A;  4HJG E;  5CX3 A;  1ZP0 B;  3ZUN A;  4FA6 A;  2L52 A;  1TZ1 A;  5JZE B;  4FAD A;  3NVW A;  1FFU A;  2FNJ B;  2W9N A;  2JWZ A;  2LVO A;  4WWP A;  1IGD A;  2N9E B;  4NY0 A;  5I4D A;  1TS5 A;  2DNF A;  3HM6 X;  4OHJ A;  3VR9 B;  1P7F A;  3ZJV A;  3QAQ A;  3V3X A;  2V3S A;  3V61 A;  1N5X A;  1KTK A;  3M62 B;  1J0G A;  4L23 A;  2VZK B;  4C7Y A;  3PS6 A;  3NHE B;  1GB1 A;  4GXB A;  5AZH A;  3TSS A;  1YQ3 B;  3U7D A;  3APF A;  5E6P A;  1D3Z A;  3PLV A;  4WQM A;  2J0M A;  1ZXI A;  5J17 A;  3WAL A;  2D3C A;  1TIF A;  3A9K A;  2KMC A;  3WAP A;  4WJP A;  2A4Z A;  4K7U A;  1WMH A;  5HI1 A;  4PYZ A;  2L76 A;  3DHH C;  1I7H A;  2CJO A;  3SDL C;  2NCN A;  4WAF A;  3IHP C;  1PDX A;  3VTV A;  2QC8 A;  4DQO C;  1QQR A;  2WDV B;  4MGY E;  2DYM A;  3R7R A;  1WE6 A;  2WXJ A;  2PPH A;  4TKN A;  1NBF C;  4RGM A;  4ARI A;  2KAN A;  2CR5 A;  3MHZ A;  2KMM A;  2I2Y A;  1YN5 A;  1SIJ A;  2MHJ A;  1K50 A;  2L32 A;  5D7G A;  3ZO5 B;  1MHX A;  4C4V B;  2WDR B;  1FEH A;  3PHW B;  2JXX A;  1L7Y A;  1L6V A;  4BKG A;  3R3M A;  3R66 C;  4MT5 A;  5BO4 B;  4W9G A;  4W9C A;  2KWU B;  1ZE3 D;  4O1N A;  3RNE C;  3RN9 C;  4J3O D;  3KH0 A;  4FJZ A;  2K8B A;  4B0E A;  1VJK A;  4US8 A;  3DVN V;  2LJI A;  2J0J A;  3Q69 A;  5DPT A;  3L54 A;  1FNW A;  4LLG M;  4GU2 A;  3BII D;  4NAW A;  2N7J A;  2BWF A;  2WXP A;  1XLO A;  3PSE B;  3WAO A;  1Z5S B;  4FJY A;  3TUO A;  4K3C A;  4K7S A;  3N32 A;  3JSV A;  1XQQ A;  1PGX A;  2G4S A;  2MJD A;  1EF1 A;  4HJK A;  1ET6 A;  5LNK 1;  4C56 C;  3PRZ A;  4BBN F;  2L0T A;  4IC7 B;  3CST A;  2SAK A;  4LTU A;  3SU8 X;  1VD2 A;  1C4P A;  2LUE A;  3DDC B;  2FE8 A;  2PMV A;  3NS1 A;  3SFD B;  5D3I B;  1YMH E;  1F2R I;  1GAQ B;  5TR5 A;  1YN4 A;  4W9F A;  4HCP B;  1XF5 L;  3RNA C;  1VR9 A;  2ICI A;  2LUM A;  3MJ5 A;  2PLP A;  4MM3 A;  1E8Z A;  1KRH A;  3N20 C;  1EU3 A;  3DCG A;  3P4Q B;  4DXA B;  3ZLZ A;  2J42 A;  4BBN C;  2QIL A;  5BYS A;  2L00 B;  2KWC A;  4IKG A;  1HTQ A;  3A4R A;  2KC1 A;  2MP2 A;  1UF0 A;  2DZJ A;  3IXS A;  4XWT A;  3ZIM A;  3ZJT A;  1TZO A;  3MJW A;  3H7P B;  1E5W A;  4GDL B;  2GBM A;  4ICV A;  3UIO B;  3P2B A;  4MSQ B;  2BBC A;  2YVC A;  3VVW B;  5FK9 C;  3UI3 A;  1WGK A;  3ML9 A;  3DVN U;  2Y5C A;  3OWE B;  2Z0D B;  3JW0 X;  4BFR A;  1RM6 C;  1ZOY B;  3IG3 A;  4WJN A;  3AI5 A;  4M02 A;  4JX1 C;  1E7P B;  2MBH A;  4NAM A;  4ZRJ A;  2KX0 A;  4NAW B;  1LXD A;  5JXV A;  4NQK E;  3AE1 B;  3NZU A;  1M4V A;  4AJY B;  2D3A A;  3JSV B;  1J19 A;  2HE7 A;  5G5H A;  4IM3 A;  4I6L B;  3A9J A;  1UGM A;  1WXM A;  2JU6 X;  4OZB A;  1V5O A;  1FXI A;  3ZRF A;  1E9M A;  4YSZ B;  1TYG B;  4LDT B;  1KFY B;  1TKE A;  5AUI A;  1WX7 A;  3OJ4 B;  3ONS A;  2E6X A;  4BKT A;  1J7B A;  2RMM A;  4KDL B;  3FKY A;  3JYU A;  2O2V A;  5IAA C;  4MM3 B;  3DBR B;  3K9O B;  1EU4 A;  2BB6 A;  4PS7 A;  1WJ4 A;  4ZRP A;  2M56 B;  2RDG A;  3C19 A;  1U4A A;  4BZA A;  2MP2 B;  2DHZ A;  1UH6 A;  2KVR A;  1OQR A;  1WYW B;  4WJO A;  1JWM D;  1YJJ A;  2PVG C;  1K52 A;  2DLB A;  5FR3 A;  3I9V 1;  2ZCC A;  2LXA A;  2BYT A;  1FD6 A;  3BVM A;  2JZP A;  2C7N B;  2CU3 A;  4F8C B;  1F1H A;  4LNN A;  4B9K A;  2KFK A;  2JY6 A;  2KMA A;  4EFO A;  2RDH A;  1NYR A;  2DZM A;  2JSV X;  4IUM B;  3QQ8 B;  3WA0 A;  1L2N A;  2IDY A;  2E3T A;  3DBR I;  1PGA A;  2KTR A;  3KLS X;  3I3T B;  3ZW3 A;  5HFY A;  2KJ6 A;  1ZDV A;  2D10 A;  4OVV A;  4AS1 A;  1J7A A;  1C76 A;  4IDI A;  4QAY A;  3PLU A;  2V4L A;  1QOF A;  1UNS A;  1P0R A;  2H88 B;  3IT4 B;  1FRD A;  1C79 A;  1XCQ L;  2GOW A;  1MPE A;  1NDD A;  3SFE B;  3OAW A;  3RD2 A;  1IGC A;  3T9L A;  2BYE A;  2EKE C;  2Y3A A;  2K6Q A;  3B08 A;  2ACZ B;  2O2V B;  1FXT B;  4RGT A;  2FBW B;  4UDU C;  3HIZ A;  1V80 A;  2J0K A;  4GGQ A;  3AE8 B;  4MGZ E;  4NPN A;  3E56 A;  1CJE A;  1L0X B;  3QWZ B;  4HKQ A;  1Z2M A;  4KDI C;  2XBB C;  4F7Z A;  1F77 A;  4WWO A;  1FRR A;  3AE3 B;  5BMH A;  2PW9 A;  2VRR B;  3R2I A;  3ZTD A;  1WE7 A;  4LNK A;  1HA5 A;  1NEN B;  3NZS A;  1N63 A;  3FC4 A;  2KFK B;  1F0Z A;  2QSD A;  2BVC A;  2KQS A;  3ZNG C;  2GBJ A;  1F2R C;  3GE8 C;  1E0Z A;  2CHZ A;  1C9F A;  1RFA A;  3UGB B;  4A8X C;  4TUU A;  2MBB B;  2KTR B;  2WXQ A;  3SEB A;  1JRU A;  3T8M A;  2AX5 A;  1C4A A;  4YTN B;  1SSN A;  1VZ6 A;  4W9J A;  4RGN A;  3HUI A;  2KJR A;  1Q5W B;  3P1M A;  4WWM A;  1TGZ B;  4WH4 A;  4LK0 M;  2ZPY A;  4ZHP A;  1L4Z B;  3Q3N C;  1VRA B;  1I4P A;  2M4N A;  4TV3 A;  5FKA C;  1LGR A;  1J7C A;  2KQ7 A;  2PEA A;  1YIW A;  1PQS A;  4G3X B;  5H8Y E;  3AE9 B;  3ABV B;  1HQR D;  3RNG C;  1I4H A;  1MI0 A;  2KWD A;  4YSY B;  1ENF A;  1BUI C;  3GZN B;  3ZRC A;  2BWE S;  2BS4 B;  2IND C;  4BVU C;  1RAX A;  2MX2 A;  1BT0 A;  4HK2 A;  4LNF A;  3QAR A;  3TEZ A;  2PJH A;  2GMI C;  2IO1 B;  2K8H A;  4H2A A;  2JF5 A;  3APC A;  1JQ4 A;  3AH7 A;  4XX5 A;  5LXI B;  1Q0W B;  3ZQ4 A;  2NBV B;  3PRP B;  1EWC A;  1V1P B;  2Z0E B;  4N58 A;  1TKY A;  2CKH B;  1WR1 A;  3A1Q B;  3RYT A;  2NPT B;  4FHK A;  1FXA A;  3MHS D;  1ZUD 2;  2FCS A;  4KVG B;  3IVF A;  2IGG A;  2KOX A;  3ZKJ C;  1WXQ A;  1TTN A;  4WIP A;  1E90 A;  3Q3M C;  2FCN A;  1B1Z A;  3FIL A;  2C9W B;  2INN E;  3DOW A;  2WDQ B;  3HVZ A;  5BYR A;  4HPL B;  4HXD A;  5E6N A;  4NJC A;  2V3N A;  3GZN I;  1HTO A;  4C4V A;  4OVU A;  4ACF A;  1WZ3 A;  4RCO A;  2MRP A;  4AUQ C;  1NYQ A;  2LI5 A;  2QCZ A;  3PZ7 A;  3M3J A;  3OLM D;  2OJW A;  4ICU A;  2DAF A;  2D07 B;  3ZDT A;  2IY0 B;  1IBX A;  1WY8 A;  2C7H A;  3MP9 A;  3GB1 A;  2BPS A;  4A9A A;  4KV2 A;  1C77 A;  1UWM A;  1XLN A;  3GP7 A;  1Q10 A;  4RM9 A;  2WP9 B;  3MFG A;  3Q8B A;  1T0Y A;  5D3D A;  3P63 A;  3ECI A;  2WNM A;  4JGH B;  1YOV B;  1E7V A;  3AEB B;  4G11 A;  5AZG A;  1QF6 A;  2AYO B;  5HKH A;  2I38 A;  3LJ3 A;  2LRU A;  3TEY A;  3VAW A;  1V9J A;  2C7M B;  1WX8 A;  2ZVN A;  1D5X C;  4P6V F;  3AE5 B;  2KDI A;  3KUC B;  2CS4 A;  2KNB A;  2RGF A;  3B0A A;  4JWS C;  2VH1 A;  3IFW B;  4EZL A;  1TS2 A;  2Z59 B;  3OG5 A;  2K8C A;  4ZOH C;  2L8J A;  1TY2 A;  3TL5 A;  2W3S A;  3R7Q A;  4Q2J A;  3KYD D;  2KD0 A;  4I6P A;  4E3C A;  3NZ3 A;  4GN1 A;  4TSS A;  4A90 A;  1FNU A;  2K5P A;  1KJT A;  3I5J C;  3FIL B;  1AYF A;  2LVP A;  2QMT A;  2KO3 A;  4I6N B;  4TQ0 A;  1VZ8 A;  3MTN B;  3ZXV A;  1GOZ A;  2QJL A;  2ZVO A;  3TJP A;  2D11 A;  5HG2 A;  1WIA A;  3H7P A;  4GDL A;  4EE2 A;  2FCM A;  1ESF A;  1IBX B;  3V05 A;  1VCB A;  3B2F A;  4II3 B;  2HD5 B;  4K81 A;  2V0G A;  4RFB A;  5JH5 C;  1DYQ A;  1CQV A;  3ZNI D;  2LD9 A;  5EDS A;  5C2T B;  3N1X C;  2K3U A;  1F52 A;  4C80 A;  2JVC A;  2BS2 B;  2ZPN A;  3P4P B;  2ZJD A;  1J8C A;  3Q3O C;  2D2Q A;  1E8W A;  2N0S B;  3VRB B;  2NVU I;  3BVZ A;  3VH3 B;  1YN3 A;  3SHQ A;  1P98 A;  3CSF A;  2W82 A;  3DBL B;  3B2G A;  1XEE A;  2WXK A;  1WH3 A;  1I42 A;  1SBB B;  4FUL A;  4NJ6 A;  1JCK B;  1HE8 A;  1OEY J;  1XO3 A;  1YQB A;  1V86 A;  3AEE B;  1WM2 A;  2NR2 A;  5AUK A;  5EE9 A;  2WGS A;  1NEK B;  3HVD A;  2MA9 B;  2W55 A;  1ISN A;  2NTT A;  3A4S C;  5CHW A;  3I57 A;  1E6E B;  2JXT A;  5EE3 A;  5KHQ A;  3RNF C;  3DWG C;  1L5P A;  2ZCB A;  3AE6 B;  1DOI A;  3O13 A;  2IO3 B;  3AU4 A;  3DHI C;  1KOT A;  2IO0 B;  4EOY A;  5G2N A;  1CK1 A;  1L6U A;  3NVY A;  2VZK D;  1E10 A;  4YL8 A;  1T3Q A;  2R2Q A;  2G4D B;  3DVG Y;  2K9X A;  4HDQ A;  3DBL I;  2N9P C;  2INC C;  4HVB A;  3KW5 B;  1ACC A;  2DWQ A;  3P4S B;  2GB1 A;  3TEX A;  2ASQ A;  1V5T A;  1IYF A;  1GG3 A;  2RD0 A;  4AP4 C;  4K1R B;  5GXG B;  5CTR C;  4C7Z A;  4BAX A;  1PGB A;  5TSS A;  4IWO A;  4YXD B;  2DZI A;  1G6J A;  1JW9 D;  3RZF A;  2KYW A;  2IPK D;  2BKR B;  3N3K B;  4M8N A;  3PZD A;  3U7Z A;  3PO0 A;  4BKS A;  5JHB A;  1JWB D;  1K53 A;  1SJH D;  4A20 A;  2Y5P A;  4XDC A;  3PTF C;  1N6Z A;  4S17 A;  4XWW A;  1PFD A;  1SEB D;  2B3A A;  1YJ1 A;  3Q8E A;  2LXC A;  3VXW A;  3AV8 A;  3IT6 B;  2N9K A;  3KWV A;  4OVZ A;  4R3D A;  2MSE D;  4RMA A;  5EE1 A;  2WXO A;  1YQ4 B;  3HRD D;  2JZZ A;  3KVF B;  2PE9 A;  2NS5 A;  4ZDV A;  3AU5 A;  2NBW B;  3QJZ A;  2WWZ A;  1QOG A;  3IAM 1;  3PRE A;  2CHW A;  2K6D B;  4MGI E;  1JWS D;  2WXR A;  2KWV B;  1HXY D;  2V9H A;  2EMS A;  5MPO A;  3DBH B;  3SD5 A;  3H6N A;  3W9C B;  2W54 A;  4ZRK A;  1FIQ A;  4MH0 E;  2JQR B;  3CIR B;  2J7Q B;  4YSX B;  3AE2 B;  3T3O A;  3GE3 C;  4YTM B;  3AE7 B;  2YEP B;  1X1M A;  2HJ1 A;  2WXF A;  2GBN A;  2KN5 A;  2WLB A;  4C00 A;  3HHM A;  3NVV A;  1L4D B;  2M8S A;  3NUH B;  1BML C;  1MJD A;  4LJP B;  1WGY A;  4XE0 A;  3U2S C;  3ZDM C;  2DBY A;  2KDE B;  1OQY A;  3RNB C;  4DHJ B;  2FCQ A;  4GDK A;  4JQW C;  1N5W A;  1Y56 A;  2JYT A;  2LMC A;  3B1L X;  3DBH I;  1K51 A;  3UIN B;  3GOE A;  2JZ3 B;  2AWT A;  4XDD A;  1C3T A;  2LHE A;  1SIF A;  2B76 B;  2K22 A;  1CMX B;  5KHO A;  1D6E C;  2XN9 C;  1SE9 A;  3L16 A;  2ZNV B;  1WXS A;  3H9D A;  1D5Z C;  1KLG D;  3VFK A;  2LGS A;  2KK8 A;  4CQN A;  1WZ0 A;  3ZJU A;  3B9J A;  3W5V B;  3Q2A C;  3PT2 B;  5BMG A;  3QCA A;  2OHF A;  1KLV A;  5C3J B;  3AM9 A;  2KXJ A;  1WF9 A;  1R4N I;  4LJO B;  2K1F A;  3Q3F A;  4JL9 A;  1V1O A;  2IO2 B;  2DZK A;  1WWT A;  5CHV C;  3W2D A;  1NI3 A;  4WWN A;  2VH2 A;  3ML8 A;  1CZP A;  1OFF A;  2G45 B;  4ARC A;  3P4R B;  2SEB D;  3ZTC A;  2XK5 A;  5IN7 A;  1JWA D;  2D3B A;  2LAS A;  2AQ3 B;  1LO5 D;  3WIM A;  1V1P A;  2N7D A;  5L95 C;  2WQY B;  4MDK E;  3A1Q A;  2NPT A;  3J9C A;  1GC6 A;  3Q8C A;  4LDT D;  2MWS B;  4FN2 A;  1STE A;  4IOI E;  1P9D U;  1I4R A;  3TCA A;  4GDK B;  2GBK A;  1P3Q U;  4MJS A;  4US9 A;  4W9D A;  4YT0 B;  2IGH A;  2KDB A;  3H7S A;  4HEA 1;  3RPF C;  2DYO A;  3LDZ E;  4ITK A;  2KJH B;  4YWG G;  2WU2 B;  2L05 A;  2RDB C;  3A33 B;  2BB5 A;  4ZYS A;  3O65 B;  2WXH A;  3TMP B;  1IUE A;  4RH6 A;  3AE4 B;  4G0N B;  1RYJ A;  2X8X X;  1RLF A;  4XGA B;  2NBU A;  4KGS A;  1WGH A;  3DBS A;  2GBR A;  4KZ0 A;  3U52 E;  1IPG A;  2WXI A;  2N9X A;  1KM7 A;  5IKC M;  2MLB A;  1SE2 A;  3V6E B;  3RFZ B;  1JAL A;  1OGW A;  1ET9 A;  2RSU A;  4YTP B;  2LGY A;  1WM3 A;  5IO9 A;  2JRI B;  3TBL D;  3DWM A;  3WAM A;  1QKZ A;  3NRZ A;  3ZXR A;  2O6V A;  2K39 A;  1RFK A;  4L2Y A;  3L4P A;  4ANV A;  2PE6 B;  3EFC A;  2KDM A;  4NJ7 A;  1DGJ A;  2LZ6 A;  1QOA A;  2XK5 B;  4FXC A;  1KH0 A;  1P1A A;  2MJE A;  2K25 A;  2J53 A;  2KX3 A;  4G50 A;  4HKZ E;  2FUG 1;  3ZNH B;  4KSL C;  4XC2 A;  3PRM B;  3L0W B;  2M17 A;  4KIK A;  3LXF A;  2CHX A;  4KX6 B;  4DDI D;  1QZE A;  1TY0 A;  1TKG A;  3AUL A;  1A70 A;  3QIJ A;  5HHD G;  2DX5 B;  4MJS B;  2WX1 A;  2IY1 B;  2HJ8 A;  5BYQ A;  3Q3J A;  2V4I B;  3DQV A;  4LNO A;  1D4B A;  1TBE A;  4K7W A;  3VQI A;  1OTR B;  1QOB A;  2KHW B;  2LGX A;  1GC7 A;  3PPA A;  3HK0 A;  1NI2 A;  1RWS A;  2A5U A;  4DHZ B;  3Q8F A;  2KN4 A;  4IM2 A;  2M1M A;  4KKI A;  1ZDX A;  3M95 A;  1M94 A;  3Q14 C;  4F1S A;  2IZV B;  3QHT A;  3PGE A;  4II2 B;  4N59 A;  1ROE A;  4N6E B;  1TS3 A;  4EUT A;  4IW0 A;  2M19 A;  3H8H A;  2WXG A;  2YEP F;  1FMA D;  3N30 A;  3AXC A;  1F9J A;  3PV1 A;  3DVG X;  3PVL A;  2O6V B;  5G5G A;  2MEK A;  1IP9 A;  1SB3 C;  2AEH A;  2MW5 A;  4AQ7 A;  3LYY A;  2JRH A;  1XLQ A;  1I35 A;  2FID A;  2AL3 A;  1L0V B;  1LFD A;  4JE3 B;  1YX6 B;  2L3Z A;  3TIX A;  2WX0 A;  5E6O A;  3APD A;  3AED B;  1JML A;  2Y5B B;  3W1S A;  1EM7 A;  4EKU A;  4FBJ B;  3KQ4 A;  1WXV A;  3JVZ X;  4NNJ B;  3ALB A;  3VTW A;  5GMV A;  1V81 A;  2DEN B;  2H89 B;  4KIK B;  1T0R C;  2WHI A;  1WI0 A;  2R61 A;  2WXM A;  1E7U A;  3NY5 A;  3BVG A;  1WR6 E;  1T5X D;  4NQL B;  1XD3 B;  3NS8 A;  4BOZ B;  1LQB A;  4HWI B;  1K8R B;  3RT3 B;  1YNT E;  1SGH A;  3BK1 A;  1GB4 A;  1ZGU B;  4J6I A;  1OEY A;  2GLS A;  4RF0 A;  2ZEQ A;  2W3R A;  2KVZ A;  2G9H D;  2L7R A;  2N4F A;  4PYU A;  1E8X A;  1EUV B;  2LGD A;  4M0W B;  4USA A;  5DPR A;  2WYQ A;  3VH4 B;  3E9S A;  3NJT A;  1D5M C;  4IM0 A;  2G1E A;  1S3S G;  5FR6 A;  2LEK A;  1EWY C;  4REZ A;  1Y8R C;  2ZNV C;  1YJI A;  4FJV B;  5DPS A;  3SR6 A;  5IA7 A;  4TMA B;  3RUL A;  3AN1 A;  1MFW A;  2N7E A;  2INP E;  4ZRI A;  1VLB A;  3T3N A;  1V8C A;  1XCT L;  2I1J A;  2GI9 A;  4HRS A;  2EKI A;  4W9I A;  3UIP B;  2UWQ A;  3V62 A;  5LXH A;  1FM0 D;  3UQA A;  3C8Y A;  2UYZ B;  1WJ6 A;  4MSM B;  5C1Z A;  2PIA A;  4HCN B;  4LCD E;  1N61 A;  5DCN A;  2XEW A;  1C78 A;  4AWJ A;  1XT9 B;  2MBO A;  3EA6 A;  1JRP A;  1V97 A;  4E74 A;  3LB8 C;  1I4G A;  1UBI A;  4WUR A;  3ZGZ A;  4DXF A;  1UBQ A;  4S0R A;  4ANX A;  1EO6 A;  3A9K B;  1FO4 A;  2ONQ A;  4CHK A;  2BGF A;  1WMH B;  5IP4 D;  3RMK C;  4JWU C;  2EMT A;  1P7E A;  2LWP A;  2J4X A;  2BW2 A;  1AWD A;  4GB9 A;  4NZL B;  2KTF A;  4GMV A;  2AL6 A;  2IBI B;  2G3Q B;  3RZW C;  3WCQ A;  2O6V D;  2LFI A;  2JUO A;  2BQQ A;  4KKJ A;  2N1W A;  2KQ4 X;  3C0R B;  1N62 A;  4JPS A;  2C5L C;  3H1U A;  2WS3 B;  5DPW A;  3WAN A;  2TSS A;  3BK2 A;  3BYT B;  3S2A A;  4OZC A;  4GLS C;  2JPH A;  2MJ3 A;  2PKO A;  1RRB A;  4P1B C;  1UWX A;  3DHG C;  1I4X A;  3X0W A;  3AEC B;  4AJW A;  3KYC D;  3TEW A;  1GUA B;  1GJZ A;  4KGT A;  4WAA A;  3L10 B;  3L08 A;  4FLH A;  5H92 C;  4W9H A;  2KZR A;  4MEM A;  1UUP A;  2FIF A;  2OOB B;  2K0P A;  4D2K A;  2YLM A;  3ZVV A;  4WJQ A;  1H4R A;  5D6J B;  2FUH B;  1KLU D;  4X57 B;  4B6W A;  1HZ5 A;  1UEL A;  1MG8 A;  3VRA B;  4KZC A;  4IWQ A;  3N1Z C;  3BYY B;  2D5G A;  1GNU A;  3PZ8 A;  1XXG A;  4HPM B;  3GS2 A;  4K3B A;  4GSW A;  3KUD B;  4RF1 A;  3BY4 B;  1C1Y B;  1TJE A;  3AEG B;  5AZF A;  1WRD B;  3CF6 E;  3VDZ A;  2WU5 B;  2M0A A;  2QEJ C;  1UGJ A;  2CJN A;  3FAH A;  4KGR A;  1WYG A;  2GRI A;  1ZXH A;  3EEC A;  1BXT A;  3UF8 A;  3KWL A;  1N60 A;  4P7I A;  4PS8 A;  3IAS 1;  4XYC A;  2J52 A;  2JWU A;  2C60 A;  1QLB B;  3UQB A;  3EUB 2;  2V3P A;  2QHO A;  5G55 A;  3MC0 B;  2DAJ A;  2N9L A;  2N1V A;  4CO7 A;  2R2O A;  1AAR A;  2M0X A;  4DBG A;  3EGR A;  1LM8 B;  2BKF A;  2IYD B;  2ZZP B;  1FCC C;  5D94 A;  1QIL A;  4PS3 A;  1UZX B;  4RM8 A;  3VR8 B;  3VUX A;  3RI7 C;  3Q6B A;  2ON8 A;  1TS4 A;  2AQ2 B;  3AEA B;  1KF6 B;  3RNC C;  1OQQ A;  1R7S A;  1T0S C;  1R4N B;  2ZW1 A;  5D2M B;  3N1Y C;  1VZ7 A;  2KC2 A;  1V6E A;  3NG0 A;  1ZW7 A;  2UU7 A;  4JLC A;  2QIE B;  5J18 A;  1WGG A;  4M8M A;  3EFU A;  1B9R A;  4N9F 4;  1MG4 A;  1JRO A;  1I4Q A;  1DOX A;  1MHH E;  1SJE D;  4A6Q A;  5IOI A;  1YX5 B;  2PVO D;  2BYV E;  4OZA A;  3L17 A;  2MH7 A;  4W9E A;  4EZK A;  2KDF B;  3EC8 A;  3U4E G;  3ENE A;  5C23 A;  3I63 C;  4CYE A;  2MBQ A;  4FHJ A;  4HPP A;  2OJR A;  2MBE A;  2IGD A;  4WQO B;  3PHX B;  4LNI A;  5CHF A;  4XZ4 A;  1WGD A;  1EF5 A;  3URY A;  2HTH A;  3A9J B;  3MC9 A;  1WXA A;  4E71 A;  4URK A;  1R4M B;  3P42 A;  2XNA C;  2RPQ A;  3EHV A;  4L1B A;  5J2R A;  1S1Q B;  3CWI A;  2KFJ A;  2LVQ A;  4A55 A;  1T0Q C;  1PUT A;  4HRO A;  4DDG D;  2QDF A;  1FFV A;  1A5R A;  3QK0 A;  3VUY A;  4EEW A;  1WJU A;  2WXL A;  2V1Y A;  2JX5 A;  2MQJ A;  2KAC A;  1ZPS A;  2Q5W D;  3K9P B;  4PT5 A;  4GOC A;  2REX A;  2EEL A;  1XLP A;  1FNV A;  1MVK A;  1GPX A;  2NTS A;  2KLC A;  4ZYN A;  3M63 B;  4TQ1 A;  3N9Y C;  3IBE A;  2PTL A;  2LRW A;  4GIV A;  5L83 A;  1FPY A;  2BF8 B;  2X38 A;  3VTU A;  3MC8 A;  2RR9 A;  3X23 A;  1R4M I;  3KUZ A;  3ETR A;  3QA8 A;  3VUW A;  4DK5 A;  4RNA A;  1UD7 A;  4MH8 A;  4RGO S;  4ZHO A;  1AW7 A;  3Q8A A;  2HDE A;  4EZJ A;  3ZNZ B;  4IG7 B;  5AEK B;  5BMI A;  2BYF A;  3QX1 A;  1SF0 A;  1SE4 A;  3L13 A;  1L0Y B;  2OED A;  2FAZ A;  2ZW0 A;  1HEZ E;  2KT7 A;  1VDV A;  1SE3 A;  2LJ5 A;  2JYE A;  1V49 A;  2LGI A;  5JHA A;  2RPV A;  3QC8 B;  4KSK C;  2LHD A;  3OJ3 A;  3W1S C;  3AMZ A;  3V6C B;  4B95 A;  4JIO U;  4P1C C;  3D32 A;  4MGK E;  3W1Y A;  4BOS C;  2I1K A;  4W9K A;  2MCN B;  2JT4 B;  2NMQ A;  4DHJ D;  3BWU D;  2L1A A;  1NVI D;  4AOF A;  4BKS D;  1WFY A;  1WJN A;  4HLE A;  4ASW C;  2DYB A;  2WXN A;  4W9L A;  3U8Z A;  4A3O A;  3DPD A;  4ZRQ A;  1ZKH A;  3R8B A;  1JWU D;  4B0M A;  3R2T A; 
#chains in the Genus database with same CATH homology
 1IGC A;  1WSP A;  5EE0 A;  4RF0 A;  2W3R A;  2G9H D;  3BZD B;  1JW9 D;  2IPK D;  2AQ1 B;  2Y3A A;  2HTM E;  3U7Z A;  3PO0 A;  4USA A;  2ACZ B;  1JWB D;  1K53 A;  2Z8L A;  1SJH D;  4RGT A;  2BTE A;  2FBW B;  1FCL A;  2Y5P A;  4XDC A;  3E9S A;  4UDU C;  1T6B X;  4XWW A;  1PFD A;  1SEB D;  3Q8E A;  1D5M C;  1WRI A;  1QT9 A;  3ZYY X;  3AE8 B;  3AV8 A;  2G1E A;  3E56 A;  3IT6 B;  2N9K A;  3KWV A;  4OVZ A;  1CJE A;  1EWY C;  2LEK A;  4R3D A;  1AN8 A;  4REZ A;  5EE1 A;  2BS3 B;  2WXO A;  2L83 A;  1YJI A;  1L0X B;  3SR6 A;  1YQ4 B;  3AB5 A;  3HRD D;  4MAC A;  4TMA B;  3AN1 A;  4HKQ A;  3AEF B;  2BT6 A;  1HZ6 A;  2INP E;  5E6J A;  1VLB A;  4P16 A;  3W5U B;  2KAJ A;  3T3N A;  1V8C A;  1C4C A;  1XCT L;  2GI9 A;  4HRS A;  1QOG A;  3IAM 1;  2EKI A;  1F77 A;  4M0W A;  1FRR A;  1DOY A;  1JWS D;  2WXR A;  3AE3 B;  1HXY D;  5BMH A;  1FM0 D;  1PYW D;  2PW9 A;  3C8Y A;  5MPO A;  3R2I A;  4DXG A;  2IJ0 A;  3NVZ A;  3W9C B;  1HA5 A;  2W54 A;  1NEN B;  1N63 A;  3FC4 A;  5T8I A;  1SXT A;  1FIQ A;  1F0Z A;  2JQR B;  2PIA A;  2QSD A;  4OW0 A;  3CIR B;  1N61 A;  4HJG E;  1ZP0 B;  3AE2 B;  4YSX B;  3T3O A;  1F2R C;  1E0Z A;  2L52 A;  1C78 A;  4YTM B;  3AE7 B;  1C9F A;  2YEP B;  3NVW A;  1FFU A;  3EA6 A;  4A8X C;  1JRP A;  1V97 A;  3LB8 C;  1I4G A;  2WXF A;  1IGD A;  4WUR A;  2WXQ A;  5I4D A;  3SEB A;  3ZGZ A;  4DXF A;  1TS5 A;  2WLB A;  3VR9 B;  4OHJ A;  3NVV A;  1L4D B;  1FO4 A;  1P7F A;  2ONQ A;  3NUH B;  3ZJV A;  2AX5 A;  3V3X A;  1BML C;  1C4A A;  4YTN B;  1SSN A;  1VZ6 A;  4JWU C;  4XE0 A;  1P7E A;  1N5X A;  4RGN A;  2J4X A;  1KTK A;  2BW2 A;  3HUI A;  3U2S C;  1AWD A;  4L23 A;  2VZK B;  3P1M A;  4C7Y A;  2DBY A;  4WWM A;  1GB1 A;  4NZL B;  4WH4 A;  4LK0 M;  3WCQ A;  2LFI A;  4ZHP A;  1L4Z B;  1VRA B;  1N5W A;  1I4P A;  3TSS A;  4KKJ A;  1Y56 A;  1YQ3 B;  5FKA C;  2JYT A;  1J7C A;  2KQ4 X;  2LMC A;  1N62 A;  4JPS A;  1K51 A;  4WQM A;  5H8Y E;  1ZXI A;  3AE9 B;  3ABV B;  2WS3 B;  1HQR D;  2TSS A;  3BK2 A;  3BYT B;  1I4H A;  4XDD A;  4OZC A;  4GLS C;  1MI0 A;  2KWD A;  2MJ3 A;  2PKO A;  4YSY B;  1ENF A;  2LHE A;  1UWX A;  1BUI C;  5HI1 A;  2B76 B;  2K22 A;  2BS4 B;  1I4X A;  1I7H A;  2CJO A;  3AEC B;  4WAF A;  1PDX A;  3TEZ A;  4DQO C;  3TEW A;  1QQR A;  1D6E C;  2WDV B;  2DYM A;  2XN9 C;  2WXJ A;  4KGT A;  1D5Z C;  4RGM A;  4ARI A;  1KLG D;  5H92 C;  4H2A A;  3MHZ A;  1UUP A;  2KMM A;  2I2Y A;  4CQN A;  1JQ4 A;  3AH7 A;  3ZJU A;  2K0P A;  3B9J A;  3W5V B;  1YN5 A;  1SIJ A;  4D2K A;  5BMG A;  1K50 A;  2L32 A;  2OHF A;  3ZQ4 A;  5D7G A;  5C3J B;  1MHX A;  1EWC A;  3AM9 A;  1KLU D;  1V1P B;  4N58 A;  2WDR B;  1FEH A;  1TKY A;  1V1O A;  1HZ5 A;  1WWT A;  1L6V A;  3W2D A;  1FXA A;  1NI3 A;  1ZUD 2;  3VRA B;  3BYY B;  2IGG A;  2D5G A;  4MT5 A;  1WXQ A;  1CZP A;  3PZ8 A;  4WIP A;  1XXG A;  1ZE3 D;  3GS2 A;  4O1N A;  1OFF A;  4ARC A;  1B1Z A;  3FIL A;  3P4R B;  4J3O D;  4RF1 A;  2SEB D;  1TJE A;  3AEG B;  2INN E;  2WDQ B;  3HVZ A;  5BYR A;  4B0E A;  1JWA D;  2WU5 B;  2M0A A;  2QEJ C;  1VJK A;  2V3N A;  4NJC A;  4US8 A;  2AQ3 B;  1LO5 D;  1UGJ A;  2LJI A;  2CJN A;  3FAH A;  3Q69 A;  1V1P A;  2WQY B;  4KGR A;  4RCO A;  1WYG A;  2GRI A;  1ZXH A;  1FNW A;  1NYQ A;  1BXT A;  4LLG M;  3PZ7 A;  3Q8C A;  3J9C A;  3BII D;  3KWL A;  2N7J A;  1N60 A;  3IAS 1;  2J52 A;  2WXP A;  1STE A;  1XLO A;  1IBX A;  4IOI E;  3MP9 A;  2JWU A;  3TUO A;  3GB1 A;  1QLB B;  1I4R A;  4A9A A;  3EUB 2;  2V3P A;  4GDK B;  1C77 A;  1PGX A;  3MC0 B;  2N9L A;  1UWM A;  1XLN A;  3GP7 A;  2MJD A;  4US9 A;  1Q10 A;  3EGR A;  1ET6 A;  4YT0 B;  2IGH A;  4C56 C;  5LNK 1;  1FCC C;  2WP9 B;  3MFG A;  4HEA 1;  1QIL A;  3Q8B A;  2SAK A;  4LTU A;  3VR8 B;  5D3D A;  3RPF C;  3P63 A;  2DYO A;  4ITK A;  2WNM A;  4YWG G;  2WU2 B;  1C4P A;  3AEB B;  2BB5 A;  4ZYS A;  2ON8 A;  1QF6 A;  1TS4 A;  2AQ2 B;  2FE8 A;  2PMV A;  2I38 A;  2WXH A;  1KF6 B;  3AEA B;  3NS1 A;  1OQQ A;  1YMH E;  1R7S A;  5D3I B;  3SFD B;  1F2R I;  1GAQ B;  1IUE A;  2ZW1 A;  4RH6 A;  1YN4 A;  1XF5 L;  3AE4 B;  1VZ7 A;  3TEY A;  1VR9 A;  2ICI A;  2LUM A;  1RYJ A;  3MJ5 A;  2PLP A;  2QIE B;  4KGS A;  1KRH A;  1EU3 A;  1D5X C;  3U52 E;  1B9R A;  4P6V F;  3P4Q B;  3AE5 B;  2J42 A;  5BYS A;  2QIL A;  1JRO A;  1I4Q A;  2WXI A;  1DOX A;  1MHH E;  1SJE D;  4A6Q A;  1SE2 A;  3RFZ B;  4IKG A;  1JAL A;  1ET9 A;  4JWS C;  2PVO D;  4YTP B;  4OZA A;  2MH7 A;  3IXS A;  3U4E G;  4XWT A;  1TS2 A;  3ZJT A;  1TZO A;  4ZOH C;  3DWM A;  1QKZ A;  4GDL B;  1TY2 A;  3NRZ A;  1RFK A;  4L2Y A;  3L4P A;  2BBC A;  2W3S A;  4Q2J A;  5FK9 C;  2KDM A;  2IGD A;  3NZ3 A;  4TSS A;  4A90 A;  1FNU A;  2K5P A;  1DGJ A;  3FIL B;  1AYF A;  3UI3 A;  1WGK A;  2QMT A;  1QOA A;  4FXC A;  2Y5C A;  3OWE B;  1KH0 A;  3URY A;  2MJE A;  1RM6 C;  2J53 A;  4TQ0 A;  1ZOY B;  1VZ8 A;  4HKZ E;  3P42 A;  2FUG 1;  2XNA C;  1GOZ A;  2QJL A;  4JX1 C;  4L1B A;  1E7P B;  3CWI A;  4NAM A;  5HG2 A;  4NAW B;  4EE2 A;  3LXF A;  4A55 A;  1ESF A;  5JXV A;  1PUT A;  4HRO A;  1IBX B;  3V05 A;  1FFV A;  3AE1 B;  3B2F A;  4KX6 B;  1M4V A;  1TY0 A;  1TKG A;  2V0G A;  2WXL A;  4RFB A;  1A70 A;  5HHD G;  2JX5 A;  5G5H A;  1DYQ A;  1CQV A;  2JU6 X;  5BYQ A;  2KAC A;  4OZB A;  2V4I B;  1D4B A;  5C2T B;  1FXI A;  1ZPS A;  2K3U A;  2Q5W D;  3VQI A;  1E9M A;  4PT5 A;  4C80 A;  1QOB A;  4YSZ B;  1TYG B;  1KFY B;  2BS2 B;  1TKE A;  3P4P B;  5AUI A;  2EEL A;  1XLP A;  1FNV A;  1MVK A;  1GPX A;  2NTS A;  2N0S B;  4TQ1 A;  2E6X A;  1RWS A;  3N9Y C;  3VRB B;  1J7B A;  2RMM A;  3BVZ A;  3Q8F A;  2PTL A;  2KN4 A;  1YN3 A;  2X38 A;  2W82 A;  4MM3 B;  3B2G A;  4KKI A;  3ETR A;  1XEE A;  2WXK A;  1ZDX A;  4RNA A;  1EU4 A;  4MH8 A;  2BB6 A;  1SBB B;  4RGO S;  4ZRP A;  4ZHO A;  2M56 B;  1AW7 A;  2RDG A;  3Q8A A;  2HDE A;  1JCK B;  4N59 A;  1XO3 A;  1ROE A;  4N6E B;  1TS3 A;  5BMI A;  2M19 A;  3AEE B;  3H8H A;  5AUK A;  5EE9 A;  2WXG A;  1SF0 A;  1NEK B;  1SE4 A;  2YEP F;  3HVD A;  1FMA D;  1OQR A;  1L0Y B;  2W55 A;  1JWM D;  2NTT A;  2OED A;  3I57 A;  1YJJ A;  2PVG C;  2ZW0 A;  1K52 A;  1HEZ E;  5G5G A;  1E6E B;  2DLB A;  5FR3 A;  1VDV A;  2JXT A;  2MEK A;  1SE3 A;  3I9V 1;  5EE3 A;  1SB3 C;  2JYE A;  2LGI A;  3LYY A;  4AQ7 A;  2BYT A;  1FD6 A;  1XLQ A;  3BVM A;  2JZP A;  1L0V B;  3DWG C;  1L5P A;  3AE6 B;  1DOI A;  2CU3 A;  2RPV A;  3O13 A;  4JE3 B;  2LHD A;  3AMZ A;  3AED B;  1JML A;  2RDH A;  1NYR A;  1EM7 A;  3W1S A;  1CK1 A;  1L6U A;  3NVY A;  3KQ4 A;  2JSV X;  2VZK D;  1E10 A;  1T3Q A;  2K9X A;  2H89 B;  2NMQ A;  2IDY A;  2E3T A;  1PGA A;  3BWU D;  2R61 A;  2L1A A;  3KLS X;  1NVI D;  2WXM A;  1ACC A;  3BVG A;  2DWQ A;  3P4S B;  2GB1 A;  1T5X D;  3TEX A;  5HFY A;  1ZDV A;  5GXG B;  4AS1 A;  1YNT E;  1J7A A;  2WXN A;  3BK1 A;  1C76 A;  4C7Z A;  4IDI A;  4ZRQ A;  1GB4 A;  1PGB A;  1QOF A;  1UNS A;  3R8B A;  2H88 B;  5TSS A;  1JWU D;  4B0M A;  3IT4 B;  4YXD B;  1FRD A;  3R2T A;  1C79 A;  1XCQ L;  1MPE A;  3SFE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...