2K3UA

Structure of the tyrosine-sulfated c5a receptor n-terminus in complex with the immune evasion protein chips.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
91
structure length
91
Chain Sequence
NSGLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELLGKMYKTYFFKKGESKSSYVINGPGKTNEYAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis inhibitory protein
publication title Structure of the Tyrosine-sulfated C5a Receptor N Terminus in Complex with Chemotaxis Inhibitory Protein of Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus str. newman
molecule tags Immune system
total genus 20
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2008-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11434 CHIPS Chemotaxis-inhibiting protein CHIPS
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.390 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2k3uA01
2K3UA 1XEEA
chains in the Genus database with same CATH superfamily
3LB8C 1VCBA 2KJHB 4BKTA 3VR9B 4EZLA 3L10B 1NDDA 3GOEA 2PW9A 2FCMA 5J18A 1PGBA 1JRPA 4KDIC 2GBJA 1YQ3B 3GE3C 5JHBA 2PMVA 1D5ZC 1WM3A 5AZHA 5H8YE 1M4VA 3IAM1 4MEMA 2BQQA 3HUIA 2KX3A 3P4QB 2KYWA 2DX5B 3QQ8B 1UELA 2DENB 2Y5PA 3AE3B 3N1YC 4BBNF 1UNSA 1T3QA 3TBLD 3IG3A 3UQBA 1WXVA 3AE8B 2FUG1 1C76A 3L13A 3A4SC 1MHXA 2H88B 2KN5A 2JRIB 2WXPA 4B6WA 3NUHB 4USAA 2KVRA 3NVVA 2QEJC 5CTRC 2PE9A 5IO9A 3V05A 2DBYA 2DZJA 5BO4B 4WJPA 3Q8FA 3Q6BA 4BAXA 2KWVB 2N9EB 4WAFA 2XBBC 3X23A 1WRDB 4BKGA 3EGRA 1WYWB 4FLHA 1TJEA 4W9IA 2W54A 2IGDA 3AEDB 2WXNA 4FJZA 2A5UA 2FCNA 3QAQA 2EMTA 3I9V1 4WJOA 1VDVA 2WXIA 5D3DA 4BFRA 5J17A 2MA9B 3RNBC 2HTME 2CJNA 4E71A 2XEWA 2QC8A 2BWES 2I1JA 2NCNA 4DDID 3Q8EA 3Q14C 1C4PA 2JZPA 3DBSA 5BYQA 2SAKA 2DAFA 4ANXA 4W9KA 4WURA 1C77A 1IUEA 3IHPC 4XDDA 2HDEA 2ZZPB 1IBXB 2J0MA 4ANVA 2JVCA 1KRHA 1SE3A 2GRIA 3TIXA 1DOXA 4NJ6A 4ITKA 1HE8A 1V8CA 2WU2B 1U4AA 1C4AA 1E8ZA 1ZXIA 3RYTA 4HJGE 1FFUA 3ZTCA 1AARA 1RLFA 3P4RB 3P4SB 3IBEA 5IAAC 1WJUA 1L2NA 2M1MA 3UF8A 1N61A 2AQ2B 1MHHE 5CHFA 1V9JA 2FCSA 2BBCA 2V4IB 3PSEB 1FEHA 2QSDA 3VH3B 3DHHC 3B0AA 2V0GA 1IYFA 1QOAA 4AQ7A 3NJTA 1F52A 1F1HA 4JWSC 2Z59B 2BT6A 2BKRB 2INDC 4PT5A 2KDBA 2IZVB 2KO3A 4JWUC 4KV2A 5GMVA 1T5XD 3V61A 4PK1A 3KQ4A 1QOGA 4NAWB 2JT4B 3NRZA 2OOBB 3P63A 2PKOA 2G3QB 4JQWC 2N4FA 2IBIB 2NTTA 2Z8LA 2V3SA 3U2SC 2GOWA 3I63C 2CHWA 1JROA 5MPOA 1E7VA 3UQAA 4KGTA 2PEAA 3IVFA 3R2IA 5FKAC 4MJSA 2AWTA 2ONQA 2PIAA 4ZOHC 1FPYA 1L0YB 2LRUA 4KX6B 3TJPA 3I5JC 4P6VF 3I3TB 4IC7B 1FXTB 3C19A 2C9WB 1Q1OA 4HXDA 1TS5A 4NPNA 1WGKA 4CQNA 1PUTA 1OEYA 4HWIB 2RR9A 5EE3A 1NVID 1J7AA 1XEEA 4C4VB 1ROEA 1YN4A 3VDZA 4ARIA 4W9LA 1TS4A 2KHWB 4DXAB 4BKSA 1K8RB 2D5GA 2KZRA 4K7SA 1WFYA 3AEEB 4KZ0A 2EKIA 4RCOA 2B3AA 1NYRA 2KFKA 4ZRPA 4IM2A 4DQOC 4NY0A 3TSSA 4MGIE 2KKCA 2AQ3B 3JW0X 1VZ6A 3ZYYX 2PVOD 4JL9A 2BB6A 1WY8A 3TEZA 2WXFA 1OFFA 2WLBA 4FA6A 1FM0D 3CWIA 1EU3A 1ZKHA 3MP9A 2XK5A 5IN7A 4G11A 4N9F4 1WIAA 2N1VA 3QC8B 2O6VB 3U4EG 3LXFA 2MEKA 2O2VA 5EE0A 4KIKA 2ZW0A 3ZDTA 3P42A 2D2QA 2LD9A 2V9HA 3QHTA 4WJQA 2ZEQA 3QCAA 1FNWA 3AU4A 2RD0A 3Q3FA 4F7ZA 4LK0M 3AMZA 3ZXVA 2LGYA 1L6UA 3QJZA 2WNMA 3DWMA 2KWDA 3RNEC 4FN2A 3NZUA 2IGGA 3MTNB 2BWFA 1N5WA 2R2QA 4N59A 3N30A 2K6QA 1P0RA 2ZVNA 4RM9A 2UWQA 2E3TA 4OZBA 2N9LA 2IY0B 1VLBA 3ZW3A 2EMSA 3APFA 2O2VB 4KIKB 1GNUA 3PT2B 1TY0A 1A70A 2CHXA 3SHQA 2J53A 4P7IA 4MGKE 4DDGD 1T0RC 2IPKD 2SEBD 2WXKA 2DYBA 5IA7A 4XDCA 1I35A 2K22A 1EF5A 1WRIA 2KQSA 1ENFA 3PRZA 2K8BA 3T8MA 3H1UA 4KGSA 4XYCA 1EWYC 4IUMB 1C1YB 2KDMA 4ZRIA 2C7NB 2XNAC 1XT9B 1KF6B 4ZRKA 3AE4B 2K5PA 3KW5B 1JWSD 3E56A 5T8IA 4XGAB 5G55A 4W9HA 1UBQA 2KWCA 3M3JA 4YSYB 4HVBA 1R7SA 1F0ZA 2KFJA 1WXAA 1YMHE 2MJDA 1V97A 4IDIA 4BOSC 3A9JB 2KQ4X 4EZKA 3SU8X 1UH6A 4FHJA 4C7ZA 4WJNA 3VFKA 3UI3A 1WGDA 2AYOB 1LM8B 3U8ZA 4MM3B 2NBUA 2M0XA 1KLGD 1SEBD 1WR1A 4BOZB 3Q3NC 3DVGX 2K1FA 1HEZE 2VH2A 2JUOA 1KM7A 1QOFA 1WMHA 4NQKE 3KYDD 4K3CA 1WH3A 4M01A 4LJOB 1BUIC 4DHZE 1GB1A 4YT0B 3CSTA 2MBHA 1YD8U 3J9CA 3JSVA 3VAWA 1KFYB 2LHEA 1JALA 2LVOA 2KJ6A 3OLMD 3BVGA 1I42A 1FIQA 1M94A 3PRPB 1FO4A 1T0QC 4A3PA 1J0GA 2K8HA 3ZKJC 2QCZA 3VR8B 3H7SA 1T0SC 3HIZA 4RNAA 2BPSA 4JPSA 3C8YA 4KGRA 1ZP0B 3N1ZC 4CYEA 3BYTB 4MELA 3VVWB 2RDHA 2O6VD 2JZZA 1UWXA 4F8CB 1TIFA 1WGYA 1JW9D 5JHAA 4IM0A 4RF0A 4J6IA 4FXCA 4I6NB 4LJPB 2PPHA 2D3BA 2ZW1A 3L0WB 1D4BA 1L7YA 3MFGA 3PS6A 4NZLB 1C9FA 5BYSA 3V6CB 3NZSA 2K8CA 3N1XC 3R7RA 2WDVB 3RMKC 3PV1A 3MC8A 1ISNA 4ICUA 4AUQC 2L00B 2EELA 3BYYB 2DZKA 3IT4B 1LQBA 2K39A 2WXQA 5HFYA 4FBJB 1AW7A 2LVPA 4GSWA 3ZDMC 2N9XA 4AJWA 4IG7B 2RMMA 3PTFC 1YX6B 1NEKB 4B9KA 1WGHA 4YTMB 2G9HD 3AEAB 3LDZE 5LXHA 4IWOA 4NJCA 1MVKA 3B2GA 5LLIA 2R2OA 2LFIA 1GUAB 4KKIA 2VZKD 3AE6B 4KSLC 1I4HA 2KTFA 4HLEA 1KH0A 4ANUA 3UGBB 1ZE3D 2BW2A 4A6QA 5G5HA 4E74A 4ACFA 4GIVA 1GC6A 3PGEA 4WH4A 3VUYA 4LTUA 1TZOA 1D3ZA 4CO7A 1KTKA 3N3KB 2JZ3B 3W9CB 2WDQB 3EHVA 3H7PB 4A55A 2ZCBA 4HPLB 1JCKB 1EUVB 2CHZA 3S2AA 2LGDA 3H8HA 1WZ3A 2LGIA 2K6DB 4TQ1A 4D2KA 2KTRB 2LMCA 3FKYA 4XWTA 1CZPA 4ARCA 3AM9A 2ICIA 1OGWA 3V6EB 1FNVA 4HKZE 2UU7A 1STEA 3QX1A 1ET9A 4W9EA 2W9NA 3RI7C 1L4ZB 3LJ3A 2IDYA 2M17A 3DBRB 2RPQA 2WDTB 4JIOU 3WIMA 4HPMB 4YWGG 4MGYE 1RYJA 1I4PA 2L76A 3A4RA 2JF5A 1IBXA 4HDQA 3M62B 1C3TA 2G4SA 2M0AA 2KQ7A 3NY5A 2NMQA 1ZW7A 1DOYA 2W3RA 1ZDVA 1TBEA 4LDTD 1I7HA 2WXOA 5I4DA 3RUIB 4II2B 2MBQA 1OEYJ 1QZEA 4A20A 3PHWB 3SEBA 2G45B 4B0MA 4US8A 4XC2A 1B1ZA 2KMCA 3EFUA 3WAPA 2WU5B 2KLGA 4L1BA 4XWWA 2PJHA 3N20C 3P1MA 3DBRI 2RSUA 3NVZA 3QWZB 1HTOA 1EO6A 2NR2A 3A9KB 1ZDXA 3PREA 1E10A 4KKJA 2L52A 1FNUA 3VUXA 2BYVE 4EKUA 2CKHB 1VZ7A 3MHSD 2BYFA 4MSMB 4M02A 2MRPA 3WANA 2W55A 1LO5D 4HPPA 2K0PA 2MBOA 2WXJA 3ZNGC 3L08A 4NAWA 1ZXHA 3ZRFA 4FJVB 5DPSA 1WJ4A 3N32A 4G0NB 3VQIA 2INPE 4N58A 2NPTB 4HK2A 1HTQA 1XLQA 3B2FA 3BIID 3R3MA 1E0ZA 2IO2B 3L4PA 1CK1A 2FBWB 1E7PB 1KLUD 3EC8A 2LXAA 4MGZE 2MCNB 2KXJA 2YLMA 1EWCA 4GDLB 3DDCB 3OAWA 1LXDA 2JQRB 4N6EB 5E6OA 4HDOA 1QKZA 1GC7A 2BS3B 1WXSA 1MG8A 1V6EA 2IO3B 2IO0B 3VTVA 2M8SA 3I57A 3WAOA 4C4VA 4C80A 2VH1A 1RFAA 2G4DB 3P4PB 1I4GA 1WE6A 3SD5A 4US9A 1N62A 2YEPB 3DWGC 2CS4A 1DYQA 3KH0A 4RMAA 1QQRA 2AX5A 1L5PA 3D32A 1FXIA 1L6VA 1R4MB 2BTEA 1JQ4A 2D07B 4WWPA 4OVUA 4ASWC 2Z0EB 3AE5B 2C60A 3PLUA 2L7RA 1QILA 2RDBC 2BKFA 3URYA 3OJ4B 3R2TA 4GLSC 4UDUC 1P98A 4PS7A 3Q8BA 2ON8A 3P2BA 4ZRQA 3DBLB 2LHDA 3GP7A 3ZRCA 3Q69A 3HVZA 4YSZB 1Q5WB 1JMLA 2MQJA 2O6VA 1N63A 1TT5B 4K81A 4TMAB 2KDIA 1PQSA 1NI3A 2L0FA 4YXDB 5JZEB 4W9JA 5AEKB 3V3XA 4YTNB 1L4DB 2JU6X 4RF1A 2KD0A 1SIFA 1KOTA 5GXGB 3PHXB 1R4MI 1XD3B 4M0WB 4BVUC 2KN4A 2H89B 4GOCA 1V1PB 2WXHA 2GBNA 1QLBB 3U30A 3ML8A 2D3GA 2D3CA 2NVUI 3W1YA 2KANA 5TSSA 4ICVA 4QAYA 3CSFA 4FHKA 1E90A 1D5XC 5D3IB 4MH0E 1S3SG 3RNCC 1UWMA 4II3B 3UIOB 3ZQ4A 5CHWA 5C3JB 3DBLI 4S0RA 3NHEB 3C0RB 3HHMA 1YNTE 4LNOA 3DBHB 2KMAA 2WHIA 4M8NA 2E6XA 3APCA 1SIJA 3FILA 2MX2A 1N60A 1LFDA 4PS8A 2KDEB 1P3QU 4H2AA 3ZJUA 3BZDB 3CMMB 2J42A 4B0EA 3NVWA 1MI0A 2R61A 3BY4B 2KC2A 3SR6A 2DWQA 3UIPB 4M00A 5J2RA 2NBWB 2LI5A 1PGXA 4G50A 2JRHA 2IO1B 5BMIA 2N7JA 3VHTC 4TV3A 4A90A 4S17A 1J19A 3HM6X 4OVZA 3AXCA 1P7EA 2L32A 1YN5A 1SE4A 2N1WA 2M19A 4TQ0A 3ENEA 5KHOA 2NTSA 2KJRA 3TEWA 5D94A 3FILB 2PLPA 1KJTA 1TTNA 3DBHI 3A9JA 2MSED 4K7WA 5HHDG 1NI2A 1WGGA 5AZFA 1FMAD 2WGSA 2J7QB 4OW0A 3AE7B 4MM3A 2VZKB 2HJ8A 1LGRA 2KMMA 2JY6A 3TEYA 2JXTA 3ZXRA 2C5LC 3DCGA 1FFVA 1TKEA 1CQVA 1B9RA 1TGZB 4MH8A 1PDXA 2WXGA 1SE2A 3ZJVA 1XCQL 1EU4A 2V3PA 2WQYB 4ZYSA 4RGNA 2KACA 5EE1A 4ZHOA 1NBFC 4AWJA 1WXMA 3AU5A 3GE8C 1Z5SB 3K9PB 5C2TB 4ZRJA 1PFDA 2L8JA 2Y5CA 4HJKA 1VRAB 3DHGC 2KAJA 2OEDA 1J7BA 5AZGA 5EDSA 3IT6B 2LASA 2MW5A 2FAZA 2MP2A 2HTHA 5E6PA 1UZXB 2DNFA 2LJ5A 3DQVA 2KWUB 2X8XX 4EUTA 1MJDA 2JXXA 3FAHA 2INNE 1R4NB 2D3AA 2YVCA 3Q2AC 1L0XB 1F2RI 1XF5L 1DOIA 1BMLC 3JYUA 3T3OA 3VRBB 1JRUA 4HROA 4LDTB 5LNK1 2NBVB 3AEBB 1GG3A 1FD6A 4OVVA 2DLBA 2MWSB 2MP2B 2Z0DB 3H6NA 3ZNID 2W3SA 3EFCA 3AB5A 1TKYA 1T0YA 3AE2B 5AUIA 2HD5B 5L95C 1TY2A 1H4RA 5AUKA 3VTWA 2MJ3A 1TS2A 1RRBA 1IPGA 1XLNA 1E5WA 3B1LX 4GN1A 3MJ5A 4DBGA 5JH5C 1V86A 1ZOYB 4HRSA 2BGFA 1I4XA 5LXIB 1GJZA 1R4NI 2RGFA 3JVZX 4OZAA 3ETRA 3KUCB 5G5GA 4O1NA 2IY1B 2BVCA 1MFWA 1P7FA 1YJJA 2ZNVB 3PPAA 4IM3A 3SFEB 3K9OB 3V62A 4E3CA 4F1SA 4WWMA 5FR6A 2OJWA 4JX1C 1E8XA 3RD2A 2L05A 2JPHA 1C4CA 3H7PA 3AE9B 4J3OD 2MJEA 3APDA 1KLVA 4WWNA 3WAMA 2KLCA 2ASQA 4LNIA 1CMXB 2QMTA 2KTRA 2CU3A 1J7CA 2JSVX 3A1QB 1OQQA 4PYZA 1V2YA 2XN9C 5KHQA 5HI1A 4EE2A 1X1MA 2D11A 2GBKA 4RH6A 4DWFA 4EEWA 3B9JA 1XQQA 4NAMA 4MT5A 3ONSA 1WGRA 3RCZA 4G3XB 3FC4A 4EZJA 2CU1A 2WXLA 1EF1A 2DZIA 2BYEA 3DVNV 1I4RA 2MH7A 3TCAA 3Q3MC 3O13A 2LGXA 2KNBA 2TSSA 4GMVA 2WS3B 2FE8A 2ZVOA 4DXFA 4KZCA 4ZHPA 5BMHA 4I6LB 2GBMA 4M8MA 4RFBA 2J0JA 3MHZA 5D7GA 2C7HA 2FIDA 4JLCA 1WJ6A 4DHJB 2WX0A 1VD2A 1IGDA 4C00A 1XLOA 2WWZA 3CIRB 1E7UA 1P9DU 4KSKC 2J52A 3DVGY 4GXBA 2WYQA 4RGTA 2FNJB 1SBBB 3AH7A 3KWVA 5C23A 3RZFA 1UBIA 2DHZA 1A5RA 3A9KA 5IP4D 4PYUA 3DOWA 4HEA1 2YEPF 2WDRB 2PVGC 4TSSA 3NS8A 2J4XA 3PO0A 2IJ0A 2JYTA 1WSPA 3KYCD 2JWUA 3EECA 2L3ZA 1GPXA 1XCTL 2KT7A 1S1QB 1VZ8A 1F9JA 1NYQA 3ZUNA 4LLGM 3AN1A 2NPTA 4YSXB 3QIJA 1SF0A 3U7ZA 1YQ4B 3W1SC 1L0VB 2INCC 4RGOS 3ZVVA 1YJ1A 1E8YA 4MDKE 2FUHB 3A33B 3M95A 1BXTA 3AI5A 2C7MB 2WXMA 4P1CC 3TEXA 2N0SB 3U52E 4L2YA 4GDLA 2LEKA 2BS4B 1WE7A 2DAJA 1Q10A 3MJWA 3KWLA 4R3DA 1OQRA 1K52A 1SJHD 1WJNA 2AL3A 2REXA 2ZPNA 2K3UA 1K53A 1JWMD 3OG5A 1HZ5A 1RM6C 1N6ZA 5EE9A 2AEHA 1GB4A 4PS3A 2LZ6A 4IW0A 4KDLB 1RWSA 4LCDE 2DYMA 3N9YC 1UGMA 4DHZB 2JX5A 4IWPA 3R66C 2KOXA 4IKGA 4FADA 1MG4A 3RNGC 4ZDVA 2MHJA 1F2RC 1C79A 1GAQB 3KUDB 4WQOB 1SSNA 2D10A 5BYRA 4P1BC 3L16A 1AN8A 3NOBA 2V4LA 2L0TA 3E9SA 1JWBD 3QARA 1HA5A 1WI0A 2CR5A 4A8XC 1WX7A 3UINB 2I38A 2L1AA 4BZAA 1QF6A 2JYEA 1WX9A 2MBEA 1TS3A 3WA0A 4GB9A 4LNNA 1YOVB 1V1OA 3VXWA 1F77A 4DXGA 4YL8A 4URKA 2L83A 4GDKA 1FCLA 1YX5B 3ZTDA 4JE3B 3ZO5B 5DPTA 1FRDA 1N5XA 3DVNU 4DHJD 4M0WA 1ZPSA 1V1PA 5BMGA 1QT9A 1IGCA 2KX0A 2A4ZA 4CHKA 2M56B 2N9PC 3W5VB 3ZNZB 2QILA 4B95A 5E6JA 4C7YA 2BS2B 4GU2A 4K1RB 1YN3A 1UGJA 1RAXA 4K7UA 1SJED 3M63B 1WZ0A 3RN9C 5C1ZA 4GDKB 3ZIMA 1SXTA 5JXVA 1YIWA 1V81A 3NS1A 1OTRB 1ET6A 2V1YA 3ML9A 4MACA 2AQ1B 4L23A 1XLPA 5CHVC 5IOIA 3L17A 4K3BA 4NNJB 4IWQA 4NQLB 4W9FA 1TKGA 1G6JA 2EKEC 1HQRD 4MJSB 2CJOA 3W1SA 1YJIA 5G2NA 3Q3JA 2KDFB 2ZNVC 2RPVA 3QK0A 5FR3A 5L83A 2WP9B 1ESFA 4AOFA 1JWAD 2N7DA 4HKQA 1T6BX 3SFDB 3AEGB 1FCCC 4ANWA 3H9DA 3PZDA 2BB5A 2OJRA 3EUB2 3RT3B 5CX3A 3WALA 1CJEA 2LWPA 4LNFA 3ZNHB 1WYGA 4XE0A 3ECIA 2QHOA 3AV8A 2ZCCA 1WXQA 1JWUD 3IFWB 2LUMA 4JGHB 4IOIE 1P1AA 2KFKB 5FK9C 2OHFA 1OQYA 5H92C 1E6EB 4P16A 5DPWA 3TUOA 1VR9A 2HE7A 3BVZA 4W9CA 4REZA 5TR5A 2J0KA 3IXSA 3WCQA 4NJ7A 4YTPB 1E8WA 3ZLZA 4GGQA 1YQBA 1FXAA 4FJYA 1ZUD2 1VJKA 2XK5B 4XX5A 2BF8B 3BK2A 3Q8AA 3AECB 1SGHA 4HCPB 3VUWA 3KUZA 1E9MA 5DPRA 4C56C 1SE9A 2ZJDA 4I6PA 5E6NA 1UD7A 3AE1B 2V3NA 2GBRA 2KK8A 1IP9A 4W9GA 2FIFA 4OZCA 2I1KA 4TKNA 5HG2A 4AP4C 3RULA 1RFKA 2VRRB 3IAS1 1V80A 3RNFC 4XZ4A 1K50A 1H8CA 2N7EA 3R7QA 3ABVB 2GI9A 2PTLA 3O65B 1Q0WB 2Y5BB 1V5OA 3HVDA 3ZGZA 5D2MB 2HJ1A 3PVLA 2K25A 4TUUA 1D5MC 3TMPB 2NS5A 3QA8A 3RNAC 2GB1A 3U7DA 3GS2A 3ZJTA 2KVZA 2RDGA 3VTUA 1V5TA 1PGAA 3EA6A 5IKCM 2IGHA 1WWTA 1UF0A 2AL6A 2QJLA 1C78A 4KVGB 3KLSX 1XXGA 2Y3AA 2W82A 3Q3OC 2GMIC 2G1EA 4EOYA 3ALBA 4MSQB 4WWOA 5DCNA 1AYFA 2I2YA 2LRWA 2IYDB 4RGMA 4AJYB 1QOBA 1TYGB 1WF9A 3MC0B 1WM2A 2ACZB 3VRAB 3KVFB 4A3OA 1EM7A 3Q8CA 3GZNB 2MBBB 3NVYA 4AS1A 3PZ8A 2DZMA 3X0WA 2WX1A 3T9LA 3HK0A 1AWDA 2LVQA 3GB1A 3L54A 2KC1A 4ZYNA 4WQMA 1WR6E 4EFOA 1HZ6A 3BWUD 1BT0A 2BYTA 3LYYA 1J8CA 3R8BA 3CF6E 4LNKA 3SDLC 2LJIA 2LXCA 2N9KA 1V49A 3W5UB 5D6JB 1WMHB 4FULA 4BKSD 2WXRA 1MPEA 2X38A 2LGSA 1NENB 4WIPA 3A1QA 3OJ3A 5HKHA 4W9DA 4RM8A 4X57B 3TL5A 4BBNC 3OWEB 2M4NA 3JSVB 3PZ7A 3RFZB 1ACCA 3NZ3A 1D6EC 3NG0A 3HRDD 3W2DA 2ZPYA 2JWZA 3GZNI 1FRRA 3B08A 3V60A 1DGJA 4Q2JA 3PLVA 1I4QA 3HM3A 4A9AA 1HXYD 4WAAA 1PYWD 3T3NA 2MLBA 3MC9A 2PE6B 3AEFB 1Y56A 4HCNB 3AULA 3DHIC 2K9XA 2QIEB 1SB3C 2LUEA 1GOZA 3RPFC 1WX8A 2FCQA 1K51A 1Y8RC 3PRMB 2GLSA 4OHJA 3RZWC 1ZGUB 1Z2MA 3DPDA 1UUPA 1XO3A 3VH4B 1TZ1A 2UYZB 3BINA 4DK5A 3BK1A 2B76B 2DYOA 2Q5WD 2QDFA 3BVMA
chains in the Genus database with same CATH topology
1OQRA 1K52A 1QLBB 1SJHD 3LB8C 2K3UA 1K53A 4C7ZA 1JWMD 3VR9B 5TSSA 3UI3A 1HZ5A 1RM6C 4MM3B 1D5XC 5D3IB 1KLGD 1SEBD 5EE9A 2PW9A 1UWMA 1PGBA 3ZQ4A 1JRPA 1GB4A 1HEZE 1RWSA 5C3JB 1QOFA 2DYMA 3N9YC 1YQ3B 2PMVA 1D5ZC 2JX5A 1YNTE 4IKGA 1BUIC 1GB1A 5H8YE 1M4VA 3IAM1 4YT0B 2E6XA 3FILA 1SIJA 3HUIA 1F2RC 1C79A 3J9CA 3P4QB 1N60A 1KFYB 1GAQB 1JALA 2LHEA 4H2AA 3BVGA 1FIQA 1SSNA 3BZDB 3ZJUA 1FO4A 2Y5PA 5BYRA 1AN8A 3AE3B 2J42A 4B0EA 3NVWA 1MI0A 1UNSA 2R61A 1T3QA 3E9SA 1JWBD 1HA5A 3VR8B 4A8XC 4RNAA 2I38A 4JPSA 3C8YA 3AE8B 4KGRA 3SR6A 2DWQA 2FUG1 2L1AA 1C76A 1QF6A 1ZP0B 1PGXA 1MHXA 2H88B 2JYEA 3BYTB 5BMIA 2N7JA 2RDHA 2WXPA 1TS3A 1UWXA 3NUHB 1V1OA 4A90A 4USAA 1F77A 3NVVA 4OVZA 4DXGA 2L83A 2QEJC 1P7EA 2L32A 1YN5A 1JW9D 3V05A 1FCLA 1SE4A 2DBYA 2M19A 4RF0A 4TQ0A 4FXCA 4JE3B 2NTSA 1FRDA 1N5XA 3Q8FA 3TEWA 2ZW1A 3FILB 2PLPA 4M0WA 1D4BA 3MFGA 4NZLB 1C9FA 1ZPSA 1V1PA 5BMGA 1QT9A 5BYSA 4WAFA 1IGCA 5HHDG 3EGRA 2M56B 2WDVB 1FMAD 1TJEA 3W5VB 4OW0A 2W54A 2IGDA 2QILA 3AE7B 2WXNA 3AEDB 2VZKB 2KMMA 5E6JA 4C7YA 2BS2B 3I9V1 2EELA 1YN3A 1UGJA 1VDVA 2WXIA 5D3DA 3BYYB 3TEYA 1SJED 3IT4B 2JXTA 2HTME 2WXQA 2CJNA 5HFYA 1AW7A 1FFVA 1TKEA 1CQVA 1B9RA 4GDKB 1SXTA 3Q8EA 4MH8A 5JXVA 1PDXA 2WXGA 1C4PA 1SE2A 2JZPA 3ZJVA 1XCQL 2RMMA 3NS1A 5BYQA 1EU4A 2SAKA 1NEKB 1ET6A 2V3PA 2WQYB 4MACA 4ZYSA 4RGNA 2KACA 2AQ1B 4L23A 5EE1A 4ZHOA 4WURA 4YTMB 1XLPA 1C77A 2G9HD 3AEAB 1IUEA 4XDDA 2HDEA 1IBXB 5C2TB 1KRHA 1PFDA 1SE3A 4NJCA 2GRIA 1MVKA 3B2GA 2Y5CA 1VRAB 1DOXA 1TKGA 1HQRD 2LFIA 2KAJA 2OEDA 1J7BA 2CJOA 4ITKA 1V8CA 2VZKD 2WU2B 3AE6B 4KKIA 3W1SA 3IT6B 1YJIA 1C4AA 1ZXIA 1I4HA 1KH0A 4HJGE 2RPVA 5FR3A 1FFUA 1ZE3D 2BW2A 2WP9B 4A6QA 5G5HA 1ESFA 1JWAD 3P4RB 3P4SB 4HKQA 4WH4A 1T6BX 3SFDB 3AEGB 4LTUA 1FCCC 1TZOA 1KTKA 2BB5A 3W9CB 3EUB2 2WDQB 1N61A 1CJEA 2AQ2B 4A55A 1MHHE 3FAHA 1WYGA 1JCKB 4XE0A 2BBCA 2V4IB 2INNE 3AV8A 3H8HA 1FEHA 2QSDA 2LGIA 4TQ1A 1WXQA 1L0XB 4D2KA 1F2RI 1JWUD 1XF5L 1DOIA 1BMLC 2LMCA 2V0GA 3T3OA 1QOAA 4AQ7A 2LUMA 3VRBB 4XWTA 1CZPA 4IOIE 5FK9C 4ARCA 3AM9A 4HROA 5LNK1 2OHFA 2ICIA 4JWSC 1E6EB 5H92C 4P16A 3AEBB 1FNVA 2BT6A 4HKZE 3TUOA 1VR9A 1FD6A 4PT5A 1STEA 3BVZA 2DLBA 4REZA 1ET9A 4JWUC 3IXSA 1T5XD 3KQ4A 1L4ZB 1QOGA 3WCQA 2W3SA 4NAWB 2IDYA 4YTPB 3AB5A 1TKYA 3AE2B 5AUIA 1FXAA 3NRZA 1ZUD2 3P63A 2PKOA 1TY2A 5AUKA 1VJKA 4YWGG 1RYJA 1I4PA 2NTTA 2Z8LA 2MJ3A 1TS2A 3BK2A 3U2SC 3Q8AA 3AECB 1XLNA 3MJ5A 1IBXA 1JROA 5MPOA 4KGTA 1E9MA 1ZOYB 2M0AA 4HRSA 3R2IA 2NMQA 1DOYA 2W3RA 1ZDVA 4C56C 1I4XA 5FKAC 3AE1B 2V3NA 2ONQA 1I7HA 2PIAA 4OZAA 3ETRA 2WXOA 4ZOHC 5G5GA 1L0YB 4KX6B 4O1NA 5I4DA 4P6VF 1P7FA 1YJJA 4OZCA 3SFEB 5HG2A 1RFKA 3SEBA 1TS5A 4B0MA 4WWMA 4US8A 1WGKA 4CQNA 1PUTA 3IAS1 5EE3A 1B1ZA 4JX1C 1NVID 1J7AA 2WU5B 1K50A 1XEEA 4L1BA 1ROEA 4XWWA 1YN4A 3ABVB 1C4CA 2GI9A 2PTLA 4ARIA 3AE9B 4J3OD 1TS4A 3P1MA 2MJEA 3NVZA 3HVDA 3ZGZA 2D5GA 1ZDXA 1E10A 2QMTA 3AEEB 2CU3A 2EKIA 1J7CA 2JSVX 4RCOA 4KKJA 1NYRA 2L52A 1FNUA 1OQQA 4ZRPA 1D5MC 4DQOC 2XN9C 2GB1A 1VZ7A 5HI1A 3TSSA 3GS2A 2AQ3B 3ZJTA 1VZ6A 3ZYYX 2RDGA 4EE2A 2PVOD 4RH6A 1PGAA 2BB6A 3EA6A 3B9JA 3TEZA 2WXFA 2IGHA 2W55A 1LO5D 1WWTA 4NAMA 1OFFA 2K0PA 2WLBA 2WXJA 4MT5A 2QJLA 1ZXHA 1FM0D 3FC4A 3CWIA 1C78A 1EU3A 3VQIA 2WXLA 2INPE 3MP9A 3KLSX 4N58A 1I4RA 2MH7A 1XXGA 1XLQA 2Y3AA 2W82A 3B2FA 4R3DA 3O13A 2G1EA 3BIID 2TSSA 2WS3B 2FE8A 1AYFA 2I2YA 1E0ZA 4DXFA 3L4PA 4RGMA 1QOBA 1CK1A 3U4EG 1TYGB 3LXFA 4ZHPA 2MEKA 3MC0B 2FBWB 5EE0A 1E7PB 1KLUD 2ZW0A 5BMHA 4RFBA 3P42A 3MHZA 2ACZB 3VRAB 5D7GA 1FNWA 1EWCA 1EM7A 3Q8CA 3NVYA 1IGDA 4GDLB 4AS1A 3PZ8A 4LK0M 1XLOA 3AMZA 3CIRB 2JQRB 4N6EB 2J52A 1L6UA 1QKZA 1AWDA 2BS3B 2WNMA 3GB1A 3DWMA 2KWDA 4WQMA 1HZ6A 3I57A 3BWUD 2IGGA 4RGTA 4C80A 2BYTA 1N5WA 3LYYA 1SBBB 3AH7A 3KWVA 3P4PB 1I4GA 4N59A 3R8BA 4US9A 1N62A 2E3TA 2YEPB 2LJIA 2N9KA 3DWGC 3W5UB 1DYQA 1QQRA 4OZBA 2N9LA 2AX5A 1L5PA 1VLBA 2WXRA 1MPEA 2X38A 1FXIA 1NENB 4WIPA 1L6VA 4HEA1 2YEPF 2WDRB 1TY0A 1A70A 2PVGC 4TSSA 2BTEA 1JQ4A 2J4XA 3PO0A 2IJ0A 2JYTA 1WSPA 2J53A 2JWUA 3OWEB 3PZ7A 3AE5B 1GPXA 3RFZB 1ACCA 3NZ3A 1XCTL 1D6EC 3HRDD 2IPKD 2SEBD 3W2DA 1QILA 2WXKA 1FRRA 1VZ8A 3URYA 3R2TA 4GLSC 1NYQA 4UDUC 4LLGM 4XDCA 1DGJA 2K22A 4Q2JA 1WRIA 3AN1A 3Q8BA 2ON8A 4YSXB 1ENFA 1I4QA 4A9AA 4ZRQA 1HXYD 1PYWD 3T3NA 1SF0A 3U7ZA 1YQ4B 4KGSA 2LHDA 3AEFB 1Y56A 3GP7A 2WXHA 3HVZA 3Q69A 4YSZB 1EWYC 1L0VB 1JMLA 2K9XA 2KDMA 2QIEB 1SB3C 4RGOS 1GOZA 1N63A 4TMAB 3RPFC 2XNAC 1NI3A 1KF6B 3AE4B 2K5PA 1K51A 4YXDB 1JWSD 3E56A 5T8IA 3V3XA 4OHJA 4YTNB 1L4DB 1UUPA 2JU6X 1XO3A 1BXTA 4RF1A 4YSYB 2WXMA 1R7SA 1F0ZA 3TEXA 2N0SB 5GXGB 4L2YA 3U52E 2LEKA 1YMHE 2BS4B 3BK1A 2MJDA 2B76B 1V97A 2DYOA 2KN4A 2Q5WD 4IDIA 2H89B 2KQ4X 1V1PB 3BVMA 1Q10A 3KWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K3U A;  1XEE A; 
#chains in the Genus database with same CATH topology
 3LB8 C;  1VCB A;  2KJH B;  4BKT A;  3VR9 B;  4EZL A;  3L10 B;  1NDD A;  3GOE A;  2PW9 A;  2FCM A;  5J18 A;  1PGB A;  1JRP A;  4KDI C;  2GBJ A;  1YQ3 B;  3GE3 C;  5JHB A;  2PMV A;  1D5Z C;  1WM3 A;  5AZH A;  5H8Y E;  1M4V A;  3IAM 1;  4MEM A;  2BQQ A;  3HUI A;  2KX3 A;  3P4Q B;  2KYW A;  2DX5 B;  3QQ8 B;  1UEL A;  2DEN B;  2Y5P A;  3AE3 B;  3N1Y C;  4BBN F;  1UNS A;  1T3Q A;  3TBL D;  3IG3 A;  3UQB A;  1WXV A;  3AE8 B;  2FUG 1;  1C76 A;  3L13 A;  3A4S C;  1MHX A;  2H88 B;  2KN5 A;  2JRI B;  2WXP A;  4B6W A;  3NUH B;  4USA A;  2KVR A;  3NVV A;  2QEJ C;  5CTR C;  2PE9 A;  5IO9 A;  3V05 A;  2DBY A;  2DZJ A;  5BO4 B;  4WJP A;  3Q8F A;  3Q6B A;  4BAX A;  2KWV B;  2N9E B;  4WAF A;  2XBB C;  3X23 A;  1WRD B;  4BKG A;  3EGR A;  1WYW B;  4FLH A;  1TJE A;  4W9I A;  2W54 A;  2IGD A;  3AED B;  2WXN A;  4FJZ A;  2A5U A;  2FCN A;  3QAQ A;  2EMT A;  3I9V 1;  4WJO A;  1VDV A;  2WXI A;  5D3D A;  4BFR A;  5J17 A;  2MA9 B;  3RNB C;  2HTM E;  2CJN A;  4E71 A;  2XEW A;  2QC8 A;  2BWE S;  2I1J A;  2NCN A;  4DDI D;  3Q8E A;  3Q14 C;  1C4P A;  2JZP A;  3DBS A;  5BYQ A;  2SAK A;  2DAF A;  4ANX A;  4W9K A;  4WUR A;  1C77 A;  1IUE A;  3IHP C;  4XDD A;  2HDE A;  2ZZP B;  1IBX B;  2J0M A;  4ANV A;  2JVC A;  1KRH A;  1SE3 A;  2GRI A;  3TIX A;  1DOX A;  4NJ6 A;  4ITK A;  1HE8 A;  1V8C A;  2WU2 B;  1U4A A;  1C4A A;  1E8Z A;  1ZXI A;  3RYT A;  4HJG E;  1FFU A;  3ZTC A;  1AAR A;  1RLF A;  3P4R B;  3P4S B;  3IBE A;  5IAA C;  1WJU A;  1L2N A;  2M1M A;  3UF8 A;  1N61 A;  2AQ2 B;  1MHH E;  5CHF A;  1V9J A;  2FCS A;  2BBC A;  2V4I B;  3PSE B;  1FEH A;  2QSD A;  3VH3 B;  3DHH C;  3B0A A;  2V0G A;  1IYF A;  1QOA A;  4AQ7 A;  3NJT A;  1F52 A;  1F1H A;  4JWS C;  2Z59 B;  2BT6 A;  2BKR B;  2IND C;  4PT5 A;  2KDB A;  2IZV B;  2KO3 A;  4JWU C;  4KV2 A;  5GMV A;  1T5X D;  3V61 A;  4PK1 A;  3KQ4 A;  1QOG A;  4NAW B;  2JT4 B;  3NRZ A;  2OOB B;  3P63 A;  2PKO A;  2G3Q B;  4JQW C;  2N4F A;  2IBI B;  2NTT A;  2Z8L A;  2V3S A;  3U2S C;  2GOW A;  3I63 C;  2CHW A;  1JRO A;  5MPO A;  1E7V A;  3UQA A;  4KGT A;  2PEA A;  3IVF A;  3R2I A;  5FKA C;  4MJS A;  2AWT A;  2ONQ A;  2PIA A;  4ZOH C;  1FPY A;  1L0Y B;  2LRU A;  4KX6 B;  3TJP A;  3I5J C;  4P6V F;  3I3T B;  4IC7 B;  1FXT B;  3C19 A;  2C9W B;  1Q1O A;  4HXD A;  1TS5 A;  4NPN A;  1WGK A;  4CQN A;  1PUT A;  1OEY A;  4HWI B;  2RR9 A;  5EE3 A;  1NVI D;  1J7A A;  1XEE A;  4C4V B;  1ROE A;  1YN4 A;  3VDZ A;  4ARI A;  4W9L A;  1TS4 A;  2KHW B;  4DXA B;  4BKS A;  1K8R B;  2D5G A;  2KZR A;  4K7S A;  1WFY A;  3AEE B;  4KZ0 A;  2EKI A;  4RCO A;  2B3A A;  1NYR A;  2KFK A;  4ZRP A;  4IM2 A;  4DQO C;  4NY0 A;  3TSS A;  4MGI E;  2KKC A;  2AQ3 B;  3JW0 X;  1VZ6 A;  3ZYY X;  2PVO D;  4JL9 A;  2BB6 A;  1WY8 A;  3TEZ A;  2WXF A;  1OFF A;  2WLB A;  4FA6 A;  1FM0 D;  3CWI A;  1EU3 A;  1ZKH A;  3MP9 A;  2XK5 A;  5IN7 A;  4G11 A;  4N9F 4;  1WIA A;  2N1V A;  3QC8 B;  2O6V B;  3U4E G;  3LXF A;  2MEK A;  2O2V A;  5EE0 A;  4KIK A;  2ZW0 A;  3ZDT A;  3P42 A;  2D2Q A;  2LD9 A;  2V9H A;  3QHT A;  4WJQ A;  2ZEQ A;  3QCA A;  1FNW A;  3AU4 A;  2RD0 A;  3Q3F A;  4F7Z A;  4LK0 M;  3AMZ A;  3ZXV A;  2LGY A;  1L6U A;  3QJZ A;  2WNM A;  3DWM A;  2KWD A;  3RNE C;  4FN2 A;  3NZU A;  2IGG A;  3MTN B;  2BWF A;  1N5W A;  2R2Q A;  4N59 A;  3N30 A;  2K6Q A;  1P0R A;  2ZVN A;  4RM9 A;  2UWQ A;  2E3T A;  4OZB A;  2N9L A;  2IY0 B;  1VLB A;  3ZW3 A;  2EMS A;  3APF A;  2O2V B;  4KIK B;  1GNU A;  3PT2 B;  1TY0 A;  1A70 A;  2CHX A;  3SHQ A;  2J53 A;  4P7I A;  4MGK E;  4DDG D;  1T0R C;  2IPK D;  2SEB D;  2WXK A;  2DYB A;  5IA7 A;  4XDC A;  1I35 A;  2K22 A;  1EF5 A;  1WRI A;  2KQS A;  1ENF A;  3PRZ A;  2K8B A;  3T8M A;  3H1U A;  4KGS A;  4XYC A;  1EWY C;  4IUM B;  1C1Y B;  2KDM A;  4ZRI A;  2C7N B;  2XNA C;  1XT9 B;  1KF6 B;  4ZRK A;  3AE4 B;  2K5P A;  3KW5 B;  1JWS D;  3E56 A;  5T8I A;  4XGA B;  5G55 A;  4W9H A;  1UBQ A;  2KWC A;  3M3J A;  4YSY B;  4HVB A;  1R7S A;  1F0Z A;  2KFJ A;  1WXA A;  1YMH E;  2MJD A;  1V97 A;  4IDI A;  4BOS C;  3A9J B;  2KQ4 X;  4EZK A;  3SU8 X;  1UH6 A;  4FHJ A;  4C7Z A;  4WJN A;  3VFK A;  3UI3 A;  1WGD A;  2AYO B;  1LM8 B;  3U8Z A;  4MM3 B;  2NBU A;  2M0X A;  1KLG D;  1SEB D;  1WR1 A;  4BOZ B;  3Q3N C;  3DVG X;  2K1F A;  1HEZ E;  2VH2 A;  2JUO A;  1KM7 A;  1QOF A;  1WMH A;  4NQK E;  3KYD D;  4K3C A;  1WH3 A;  4M01 A;  4LJO B;  1BUI C;  4DHZ E;  1GB1 A;  4YT0 B;  3CST A;  2MBH A;  1YD8 U;  3J9C A;  3JSV A;  3VAW A;  1KFY B;  2LHE A;  1JAL A;  2LVO A;  2KJ6 A;  3OLM D;  3BVG A;  1I42 A;  1FIQ A;  1M94 A;  3PRP B;  1FO4 A;  1T0Q C;  4A3P A;  1J0G A;  2K8H A;  3ZKJ C;  2QCZ A;  3VR8 B;  3H7S A;  1T0S C;  3HIZ A;  4RNA A;  2BPS A;  4JPS A;  3C8Y A;  4KGR A;  1ZP0 B;  3N1Z C;  4CYE A;  3BYT B;  4MEL A;  3VVW B;  2RDH A;  2O6V D;  2JZZ A;  1UWX A;  4F8C B;  1TIF A;  1WGY A;  1JW9 D;  5JHA A;  4IM0 A;  4RF0 A;  4J6I A;  4FXC A;  4I6N B;  4LJP B;  2PPH A;  2D3B A;  2ZW1 A;  3L0W B;  1D4B A;  1L7Y A;  3MFG A;  3PS6 A;  4NZL B;  1C9F A;  5BYS A;  3V6C B;  3NZS A;  2K8C A;  3N1X C;  3R7R A;  2WDV B;  3RMK C;  3PV1 A;  3MC8 A;  1ISN A;  4ICU A;  4AUQ C;  2L00 B;  2EEL A;  3BYY B;  2DZK A;  3IT4 B;  1LQB A;  2K39 A;  2WXQ A;  5HFY A;  4FBJ B;  1AW7 A;  2LVP A;  4GSW A;  3ZDM C;  2N9X A;  4AJW A;  4IG7 B;  2RMM A;  3PTF C;  1YX6 B;  1NEK B;  4B9K A;  1WGH A;  4YTM B;  2G9H D;  3AEA B;  3LDZ E;  5LXH A;  4IWO A;  4NJC A;  1MVK A;  3B2G A;  5LLI A;  2R2O A;  2LFI A;  1GUA B;  4KKI A;  2VZK D;  3AE6 B;  4KSL C;  1I4H A;  2KTF A;  4HLE A;  1KH0 A;  4ANU A;  3UGB B;  1ZE3 D;  2BW2 A;  4A6Q A;  5G5H A;  4E74 A;  4ACF A;  4GIV A;  1GC6 A;  3PGE A;  4WH4 A;  3VUY A;  4LTU A;  1TZO A;  1D3Z A;  4CO7 A;  1KTK A;  3N3K B;  2JZ3 B;  3W9C B;  2WDQ B;  3EHV A;  3H7P B;  4A55 A;  2ZCB A;  4HPL B;  1JCK B;  1EUV B;  2CHZ A;  3S2A A;  2LGD A;  3H8H A;  1WZ3 A;  2LGI A;  2K6D B;  4TQ1 A;  4D2K A;  2KTR B;  2LMC A;  3FKY A;  4XWT A;  1CZP A;  4ARC A;  3AM9 A;  2ICI A;  1OGW A;  3V6E B;  1FNV A;  4HKZ E;  2UU7 A;  1STE A;  3QX1 A;  1ET9 A;  4W9E A;  2W9N A;  3RI7 C;  1L4Z B;  3LJ3 A;  2IDY A;  2M17 A;  3DBR B;  2RPQ A;  2WDT B;  4JIO U;  3WIM A;  4HPM B;  4YWG G;  4MGY E;  1RYJ A;  1I4P A;  2L76 A;  3A4R A;  2JF5 A;  1IBX A;  4HDQ A;  3M62 B;  1C3T A;  2G4S A;  2M0A A;  2KQ7 A;  3NY5 A;  2NMQ A;  1ZW7 A;  1DOY A;  2W3R A;  1ZDV A;  1TBE A;  4LDT D;  1I7H A;  2WXO A;  5I4D A;  3RUI B;  4II2 B;  2MBQ A;  1OEY J;  1QZE A;  4A20 A;  3PHW B;  3SEB A;  2G45 B;  4B0M A;  4US8 A;  4XC2 A;  1B1Z A;  2KMC A;  3EFU A;  3WAP A;  2WU5 B;  2KLG A;  4L1B A;  4XWW A;  2PJH A;  3N20 C;  3P1M A;  3DBR I;  2RSU A;  3NVZ A;  3QWZ B;  1HTO A;  1EO6 A;  2NR2 A;  3A9K B;  1ZDX A;  3PRE A;  1E10 A;  4KKJ A;  2L52 A;  1FNU A;  3VUX A;  2BYV E;  4EKU A;  2CKH B;  1VZ7 A;  3MHS D;  2BYF A;  4MSM B;  4M02 A;  2MRP A;  3WAN A;  2W55 A;  1LO5 D;  4HPP A;  2K0P A;  2MBO A;  2WXJ A;  3ZNG C;  3L08 A;  4NAW A;  1ZXH A;  3ZRF A;  4FJV B;  5DPS A;  1WJ4 A;  3N32 A;  4G0N B;  3VQI A;  2INP E;  4N58 A;  2NPT B;  4HK2 A;  1HTQ A;  1XLQ A;  3B2F A;  3BII D;  3R3M A;  1E0Z A;  2IO2 B;  3L4P A;  1CK1 A;  2FBW B;  1E7P B;  1KLU D;  3EC8 A;  2LXA A;  4MGZ E;  2MCN B;  2KXJ A;  2YLM A;  1EWC A;  4GDL B;  3DDC B;  3OAW A;  1LXD A;  2JQR B;  4N6E B;  5E6O A;  4HDO A;  1QKZ A;  1GC7 A;  2BS3 B;  1WXS A;  1MG8 A;  1V6E A;  2IO3 B;  2IO0 B;  3VTV A;  2M8S A;  3I57 A;  3WAO A;  4C4V A;  4C80 A;  2VH1 A;  1RFA A;  2G4D B;  3P4P B;  1I4G A;  1WE6 A;  3SD5 A;  4US9 A;  1N62 A;  2YEP B;  3DWG C;  2CS4 A;  1DYQ A;  3KH0 A;  4RMA A;  1QQR A;  2AX5 A;  1L5P A;  3D32 A;  1FXI A;  1L6V A;  1R4M B;  2BTE A;  1JQ4 A;  2D07 B;  4WWP A;  4OVU A;  4ASW C;  2Z0E B;  3AE5 B;  2C60 A;  3PLU A;  2L7R A;  1QIL A;  2RDB C;  2BKF A;  3URY A;  3OJ4 B;  3R2T A;  4GLS C;  4UDU C;  1P98 A;  4PS7 A;  3Q8B A;  2ON8 A;  3P2B A;  4ZRQ A;  3DBL B;  2LHD A;  3GP7 A;  3ZRC A;  3Q69 A;  3HVZ A;  4YSZ B;  1Q5W B;  1JML A;  2MQJ A;  2O6V A;  1N63 A;  1TT5 B;  4K81 A;  4TMA B;  2KDI A;  1PQS A;  1NI3 A;  2L0F A;  4YXD B;  5JZE B;  4W9J A;  5AEK B;  3V3X A;  4YTN B;  1L4D B;  2JU6 X;  4RF1 A;  2KD0 A;  1SIF A;  1KOT A;  5GXG B;  3PHX B;  1R4M I;  1XD3 B;  4M0W B;  4BVU C;  2KN4 A;  2H89 B;  4GOC A;  1V1P B;  2WXH A;  2GBN A;  1QLB B;  3U30 A;  3ML8 A;  2D3G A;  2D3C A;  2NVU I;  3W1Y A;  2KAN A;  5TSS A;  4ICV A;  4QAY A;  3CSF A;  4FHK A;  1E90 A;  1D5X C;  5D3I B;  4MH0 E;  1S3S G;  3RNC C;  1UWM A;  4II3 B;  3UIO B;  3ZQ4 A;  5CHW A;  5C3J B;  3DBL I;  4S0R A;  3NHE B;  3C0R B;  3HHM A;  1YNT E;  4LNO A;  3DBH B;  2KMA A;  2WHI A;  4M8N A;  2E6X A;  3APC A;  1SIJ A;  3FIL A;  2MX2 A;  1N60 A;  1LFD A;  4PS8 A;  2KDE B;  1P3Q U;  4H2A A;  3ZJU A;  3BZD B;  3CMM B;  2J42 A;  4B0E A;  3NVW A;  1MI0 A;  2R61 A;  3BY4 B;  2KC2 A;  3SR6 A;  2DWQ A;  3UIP B;  4M00 A;  5J2R A;  2NBW B;  2LI5 A;  1PGX A;  4G50 A;  2JRH A;  2IO1 B;  5BMI A;  2N7J A;  3VHT C;  4TV3 A;  4A90 A;  4S17 A;  1J19 A;  3HM6 X;  4OVZ A;  3AXC A;  1P7E A;  2L32 A;  1YN5 A;  1SE4 A;  2N1W A;  2M19 A;  4TQ0 A;  3ENE A;  5KHO A;  2NTS A;  2KJR A;  3TEW A;  5D94 A;  3FIL B;  2PLP A;  1KJT A;  1TTN A;  3DBH I;  3A9J A;  2MSE D;  4K7W A;  5HHD G;  1NI2 A;  1WGG A;  5AZF A;  1FMA D;  2WGS A;  2J7Q B;  4OW0 A;  3AE7 B;  4MM3 A;  2VZK B;  2HJ8 A;  1LGR A;  2KMM A;  2JY6 A;  3TEY A;  2JXT A;  3ZXR A;  2C5L C;  3DCG A;  1FFV A;  1TKE A;  1CQV A;  1B9R A;  1TGZ B;  4MH8 A;  1PDX A;  2WXG A;  1SE2 A;  3ZJV A;  1XCQ L;  1EU4 A;  2V3P A;  2WQY B;  4ZYS A;  4RGN A;  2KAC A;  5EE1 A;  4ZHO A;  1NBF C;  4AWJ A;  1WXM A;  3AU5 A;  3GE8 C;  1Z5S B;  3K9P B;  5C2T B;  4ZRJ A;  1PFD A;  2L8J A;  2Y5C A;  4HJK A;  1VRA B;  3DHG C;  2KAJ A;  2OED A;  1J7B A;  5AZG A;  5EDS A;  3IT6 B;  2LAS A;  2MW5 A;  2FAZ A;  2MP2 A;  2HTH A;  5E6P A;  1UZX B;  2DNF A;  2LJ5 A;  3DQV A;  2KWU B;  2X8X X;  4EUT A;  1MJD A;  2JXX A;  3FAH A;  2INN E;  1R4N B;  2D3A A;  2YVC A;  3Q2A C;  1L0X B;  1F2R I;  1XF5 L;  1DOI A;  1BML C;  3JYU A;  3T3O A;  3VRB B;  1JRU A;  4HRO A;  4LDT B;  5LNK 1;  2NBV B;  3AEB B;  1GG3 A;  1FD6 A;  4OVV A;  2DLB A;  2MWS B;  2MP2 B;  2Z0D B;  3H6N A;  3ZNI D;  2W3S A;  3EFC A;  3AB5 A;  1TKY A;  1T0Y A;  3AE2 B;  5AUI A;  2HD5 B;  5L95 C;  1TY2 A;  1H4R A;  5AUK A;  3VTW A;  2MJ3 A;  1TS2 A;  1RRB A;  1IPG A;  1XLN A;  1E5W A;  3B1L X;  4GN1 A;  3MJ5 A;  4DBG A;  5JH5 C;  1V86 A;  1ZOY B;  4HRS A;  2BGF A;  1I4X A;  5LXI B;  1GJZ A;  1R4N I;  2RGF A;  3JVZ X;  4OZA A;  3ETR A;  3KUC B;  5G5G A;  4O1N A;  2IY1 B;  2BVC A;  1MFW A;  1P7F A;  1YJJ A;  2ZNV B;  3PPA A;  4IM3 A;  3SFE B;  3K9O B;  3V62 A;  4E3C A;  4F1S A;  4WWM A;  5FR6 A;  2OJW A;  4JX1 C;  1E8X A;  3RD2 A;  2L05 A;  2JPH A;  1C4C A;  3H7P A;  3AE9 B;  4J3O D;  2MJE A;  3APD A;  1KLV A;  4WWN A;  3WAM A;  2KLC A;  2ASQ A;  4LNI A;  1CMX B;  2QMT A;  2KTR A;  2CU3 A;  1J7C A;  2JSV X;  3A1Q B;  1OQQ A;  4PYZ A;  1V2Y A;  2XN9 C;  5KHQ A;  5HI1 A;  4EE2 A;  1X1M A;  2D11 A;  2GBK A;  4RH6 A;  4DWF A;  4EEW A;  3B9J A;  1XQQ A;  4NAM A;  4MT5 A;  3ONS A;  1WGR A;  3RCZ A;  4G3X B;  3FC4 A;  4EZJ A;  2CU1 A;  2WXL A;  1EF1 A;  2DZI A;  2BYE A;  3DVN V;  1I4R A;  2MH7 A;  3TCA A;  3Q3M C;  3O13 A;  2LGX A;  2KNB A;  2TSS A;  4GMV A;  2WS3 B;  2FE8 A;  2ZVO A;  4DXF A;  4KZC A;  4ZHP A;  5BMH A;  4I6L B;  2GBM A;  4M8M A;  4RFB A;  2J0J A;  3MHZ A;  5D7G A;  2C7H A;  2FID A;  4JLC A;  1WJ6 A;  4DHJ B;  2WX0 A;  1VD2 A;  1IGD A;  4C00 A;  1XLO A;  2WWZ A;  3CIR B;  1E7U A;  1P9D U;  4KSK C;  2J52 A;  3DVG Y;  4GXB A;  2WYQ A;  4RGT A;  2FNJ B;  1SBB B;  3AH7 A;  3KWV A;  5C23 A;  3RZF A;  1UBI A;  2DHZ A;  1A5R A;  3A9K A;  5IP4 D;  4PYU A;  3DOW A;  4HEA 1;  2YEP F;  2WDR B;  2PVG C;  4TSS A;  3NS8 A;  2J4X A;  3PO0 A;  2IJ0 A;  2JYT A;  1WSP A;  3KYC D;  2JWU A;  3EEC A;  2L3Z A;  1GPX A;  1XCT L;  2KT7 A;  1S1Q B;  1VZ8 A;  1F9J A;  1NYQ A;  3ZUN A;  4LLG M;  3AN1 A;  2NPT A;  4YSX B;  3QIJ A;  1SF0 A;  3U7Z A;  1YQ4 B;  3W1S C;  1L0V B;  2INC C;  4RGO S;  3ZVV A;  1YJ1 A;  1E8Y A;  4MDK E;  2FUH B;  3A33 B;  3M95 A;  1BXT A;  3AI5 A;  2C7M B;  2WXM A;  4P1C C;  3TEX A;  2N0S B;  3U52 E;  4L2Y A;  4GDL A;  2LEK A;  2BS4 B;  1WE7 A;  2DAJ A;  1Q10 A;  3MJW A;  3KWL A;  4R3D A;  1OQR A;  1K52 A;  1SJH D;  1WJN A;  2AL3 A;  2REX A;  2ZPN A;  2K3U A;  1K53 A;  1JWM D;  3OG5 A;  1HZ5 A;  1RM6 C;  1N6Z A;  5EE9 A;  2AEH A;  1GB4 A;  4PS3 A;  2LZ6 A;  4IW0 A;  4KDL B;  1RWS A;  4LCD E;  2DYM A;  3N9Y C;  1UGM A;  4DHZ B;  2JX5 A;  4IWP A;  3R66 C;  2KOX A;  4IKG A;  4FAD A;  1MG4 A;  3RNG C;  4ZDV A;  2MHJ A;  1F2R C;  1C79 A;  1GAQ B;  3KUD B;  4WQO B;  1SSN A;  2D10 A;  5BYR A;  4P1B C;  3L16 A;  1AN8 A;  3NOB A;  2V4L A;  2L0T A;  3E9S A;  1JWB D;  3QAR A;  1HA5 A;  1WI0 A;  2CR5 A;  4A8X C;  1WX7 A;  3UIN B;  2I38 A;  2L1A A;  4BZA A;  1QF6 A;  2JYE A;  1WX9 A;  2MBE A;  1TS3 A;  3WA0 A;  4GB9 A;  4LNN A;  1YOV B;  1V1O A;  3VXW A;  1F77 A;  4DXG A;  4YL8 A;  4URK A;  2L83 A;  4GDK A;  1FCL A;  1YX5 B;  3ZTD A;  4JE3 B;  3ZO5 B;  5DPT A;  1FRD A;  1N5X A;  3DVN U;  4DHJ D;  4M0W A;  1ZPS A;  1V1P A;  5BMG A;  1QT9 A;  1IGC A;  2KX0 A;  2A4Z A;  4CHK A;  2M56 B;  2N9P C;  3W5V B;  3ZNZ B;  2QIL A;  4B95 A;  5E6J A;  4C7Y A;  2BS2 B;  4GU2 A;  4K1R B;  1YN3 A;  1UGJ A;  1RAX A;  4K7U A;  1SJE D;  3M63 B;  1WZ0 A;  3RN9 C;  5C1Z A;  4GDK B;  3ZIM A;  1SXT A;  5JXV A;  1YIW A;  1V81 A;  3NS1 A;  1OTR B;  1ET6 A;  2V1Y A;  3ML9 A;  4MAC A;  2AQ1 B;  4L23 A;  1XLP A;  5CHV C;  5IOI A;  3L17 A;  4K3B A;  4NNJ B;  4IWQ A;  4NQL B;  4W9F A;  1TKG A;  1G6J A;  2EKE C;  1HQR D;  4MJS B;  2CJO A;  3W1S A;  1YJI A;  5G2N A;  3Q3J A;  2KDF B;  2ZNV C;  2RPV A;  3QK0 A;  5FR3 A;  5L83 A;  2WP9 B;  1ESF A;  4AOF A;  1JWA D;  2N7D A;  4HKQ A;  1T6B X;  3SFD B;  3AEG B;  1FCC C;  4ANW A;  3H9D A;  3PZD A;  2BB5 A;  2OJR A;  3EUB 2;  3RT3 B;  5CX3 A;  3WAL A;  1CJE A;  2LWP A;  4LNF A;  3ZNH B;  1WYG A;  4XE0 A;  3ECI A;  2QHO A;  3AV8 A;  2ZCC A;  1WXQ A;  1JWU D;  3IFW B;  2LUM A;  4JGH B;  4IOI E;  1P1A A;  2KFK B;  5FK9 C;  2OHF A;  1OQY A;  5H92 C;  1E6E B;  4P16 A;  5DPW A;  3TUO A;  1VR9 A;  2HE7 A;  3BVZ A;  4W9C A;  4REZ A;  5TR5 A;  2J0K A;  3IXS A;  3WCQ A;  4NJ7 A;  4YTP B;  1E8W A;  3ZLZ A;  4GGQ A;  1YQB A;  1FXA A;  4FJY A;  1ZUD 2;  1VJK A;  2XK5 B;  4XX5 A;  2BF8 B;  3BK2 A;  3Q8A A;  3AEC B;  1SGH A;  4HCP B;  3VUW A;  3KUZ A;  1E9M A;  5DPR A;  4C56 C;  1SE9 A;  2ZJD A;  4I6P A;  5E6N A;  1UD7 A;  3AE1 B;  2V3N A;  2GBR A;  2KK8 A;  1IP9 A;  4W9G A;  2FIF A;  4OZC A;  2I1K A;  4TKN A;  5HG2 A;  4AP4 C;  3RUL A;  1RFK A;  2VRR B;  3IAS 1;  1V80 A;  3RNF C;  4XZ4 A;  1K50 A;  1H8C A;  2N7E A;  3R7Q A;  3ABV B;  2GI9 A;  2PTL A;  3O65 B;  1Q0W B;  2Y5B B;  1V5O A;  3HVD A;  3ZGZ A;  5D2M B;  2HJ1 A;  3PVL A;  2K25 A;  4TUU A;  1D5M C;  3TMP B;  2NS5 A;  3QA8 A;  3RNA C;  2GB1 A;  3U7D A;  3GS2 A;  3ZJT A;  2KVZ A;  2RDG A;  3VTU A;  1V5T A;  1PGA A;  3EA6 A;  5IKC M;  2IGH A;  1WWT A;  1UF0 A;  2AL6 A;  2QJL A;  1C78 A;  4KVG B;  3KLS X;  1XXG A;  2Y3A A;  2W82 A;  3Q3O C;  2GMI C;  2G1E A;  4EOY A;  3ALB A;  4MSQ B;  4WWO A;  5DCN A;  1AYF A;  2I2Y A;  2LRW A;  2IYD B;  4RGM A;  4AJY B;  1QOB A;  1TYG B;  1WF9 A;  3MC0 B;  1WM2 A;  2ACZ B;  3VRA B;  3KVF B;  4A3O A;  1EM7 A;  3Q8C A;  3GZN B;  2MBB B;  3NVY A;  4AS1 A;  3PZ8 A;  2DZM A;  3X0W A;  2WX1 A;  3T9L A;  3HK0 A;  1AWD A;  2LVQ A;  3GB1 A;  3L54 A;  2KC1 A;  4ZYN A;  4WQM A;  1WR6 E;  4EFO A;  1HZ6 A;  3BWU D;  1BT0 A;  2BYT A;  3LYY A;  1J8C A;  3R8B A;  3CF6 E;  4LNK A;  3SDL C;  2LJI A;  2LXC A;  2N9K A;  1V49 A;  3W5U B;  5D6J B;  1WMH B;  4FUL A;  4BKS D;  2WXR A;  1MPE A;  2X38 A;  2LGS A;  1NEN B;  4WIP A;  3A1Q A;  3OJ3 A;  5HKH A;  4W9D A;  4RM8 A;  4X57 B;  3TL5 A;  4BBN C;  3OWE B;  2M4N A;  3JSV B;  3PZ7 A;  3RFZ B;  1ACC A;  3NZ3 A;  1D6E C;  3NG0 A;  3HRD D;  3W2D A;  2ZPY A;  2JWZ A;  3GZN I;  1FRR A;  3B08 A;  3V60 A;  1DGJ A;  4Q2J A;  3PLV A;  1I4Q A;  3HM3 A;  4A9A A;  1HXY D;  4WAA A;  1PYW D;  3T3N A;  2MLB A;  3MC9 A;  2PE6 B;  3AEF B;  1Y56 A;  4HCN B;  3AUL A;  3DHI C;  2K9X A;  2QIE B;  1SB3 C;  2LUE A;  1GOZ A;  3RPF C;  1WX8 A;  2FCQ A;  1K51 A;  1Y8R C;  3PRM B;  2GLS A;  4OHJ A;  3RZW C;  1ZGU B;  1Z2M A;  3DPD A;  1UUP A;  1XO3 A;  3VH4 B;  1TZ1 A;  2UYZ B;  3BIN A;  4DK5 A;  3BK1 A;  2B76 B;  2DYO A;  2Q5W D;  2QDF A;  3BVM A; 
#chains in the Genus database with same CATH homology
 1OQR A;  1K52 A;  1QLB B;  1SJH D;  3LB8 C;  2K3U A;  1K53 A;  4C7Z A;  1JWM D;  3VR9 B;  5TSS A;  3UI3 A;  1HZ5 A;  1RM6 C;  4MM3 B;  1D5X C;  5D3I B;  1KLG D;  1SEB D;  5EE9 A;  2PW9 A;  1UWM A;  1PGB A;  3ZQ4 A;  1JRP A;  1GB4 A;  1HEZ E;  1RWS A;  5C3J B;  1QOF A;  2DYM A;  3N9Y C;  1YQ3 B;  2PMV A;  1D5Z C;  2JX5 A;  1YNT E;  4IKG A;  1BUI C;  1GB1 A;  5H8Y E;  1M4V A;  3IAM 1;  4YT0 B;  2E6X A;  3FIL A;  1SIJ A;  3HUI A;  1F2R C;  1C79 A;  3J9C A;  3P4Q B;  1N60 A;  1KFY B;  1GAQ B;  1JAL A;  2LHE A;  4H2A A;  3BVG A;  1FIQ A;  1SSN A;  3BZD B;  3ZJU A;  1FO4 A;  2Y5P A;  5BYR A;  1AN8 A;  3AE3 B;  2J42 A;  4B0E A;  3NVW A;  1MI0 A;  1UNS A;  2R61 A;  1T3Q A;  3E9S A;  1JWB D;  1HA5 A;  3VR8 B;  4A8X C;  4RNA A;  2I38 A;  4JPS A;  3C8Y A;  3AE8 B;  4KGR A;  3SR6 A;  2DWQ A;  2FUG 1;  2L1A A;  1C76 A;  1QF6 A;  1ZP0 B;  1PGX A;  1MHX A;  2H88 B;  2JYE A;  3BYT B;  5BMI A;  2N7J A;  2RDH A;  2WXP A;  1TS3 A;  1UWX A;  3NUH B;  1V1O A;  4A90 A;  4USA A;  1F77 A;  3NVV A;  4OVZ A;  4DXG A;  2L83 A;  2QEJ C;  1P7E A;  2L32 A;  1YN5 A;  1JW9 D;  3V05 A;  1FCL A;  1SE4 A;  2DBY A;  2M19 A;  4RF0 A;  4TQ0 A;  4FXC A;  4JE3 B;  2NTS A;  1FRD A;  1N5X A;  3Q8F A;  3TEW A;  2ZW1 A;  3FIL B;  2PLP A;  4M0W A;  1D4B A;  3MFG A;  4NZL B;  1C9F A;  1ZPS A;  1V1P A;  5BMG A;  1QT9 A;  5BYS A;  4WAF A;  1IGC A;  5HHD G;  3EGR A;  2M56 B;  2WDV B;  1FMA D;  1TJE A;  3W5V B;  4OW0 A;  2W54 A;  2IGD A;  2QIL A;  3AE7 B;  2WXN A;  3AED B;  2VZK B;  2KMM A;  5E6J A;  4C7Y A;  2BS2 B;  3I9V 1;  2EEL A;  1YN3 A;  1UGJ A;  1VDV A;  2WXI A;  5D3D A;  3BYY B;  3TEY A;  1SJE D;  3IT4 B;  2JXT A;  2HTM E;  2WXQ A;  2CJN A;  5HFY A;  1AW7 A;  1FFV A;  1TKE A;  1CQV A;  1B9R A;  4GDK B;  1SXT A;  3Q8E A;  4MH8 A;  5JXV A;  1PDX A;  2WXG A;  1C4P A;  1SE2 A;  2JZP A;  3ZJV A;  1XCQ L;  2RMM A;  3NS1 A;  5BYQ A;  1EU4 A;  2SAK A;  1NEK B;  1ET6 A;  2V3P A;  2WQY B;  4MAC A;  4ZYS A;  4RGN A;  2KAC A;  2AQ1 B;  4L23 A;  5EE1 A;  4ZHO A;  4WUR A;  4YTM B;  1XLP A;  1C77 A;  2G9H D;  3AEA B;  1IUE A;  4XDD A;  2HDE A;  1IBX B;  5C2T B;  1KRH A;  1PFD A;  1SE3 A;  4NJC A;  2GRI A;  1MVK A;  3B2G A;  2Y5C A;  1VRA B;  1DOX A;  1TKG A;  1HQR D;  2LFI A;  2KAJ A;  2OED A;  1J7B A;  2CJO A;  4ITK A;  1V8C A;  2VZK D;  2WU2 B;  3AE6 B;  4KKI A;  3W1S A;  3IT6 B;  1YJI A;  1C4A A;  1ZXI A;  1I4H A;  1KH0 A;  4HJG E;  2RPV A;  5FR3 A;  1FFU A;  1ZE3 D;  2BW2 A;  2WP9 B;  4A6Q A;  5G5H A;  1ESF A;  1JWA D;  3P4R B;  3P4S B;  4HKQ A;  4WH4 A;  1T6B X;  3SFD B;  3AEG B;  4LTU A;  1FCC C;  1TZO A;  1KTK A;  2BB5 A;  3W9C B;  3EUB 2;  2WDQ B;  1N61 A;  1CJE A;  2AQ2 B;  4A55 A;  1MHH E;  3FAH A;  1WYG A;  1JCK B;  4XE0 A;  2BBC A;  2V4I B;  2INN E;  3AV8 A;  3H8H A;  1FEH A;  2QSD A;  2LGI A;  4TQ1 A;  1WXQ A;  1L0X B;  4D2K A;  1F2R I;  1JWU D;  1XF5 L;  1DOI A;  1BML C;  2LMC A;  2V0G A;  3T3O A;  1QOA A;  4AQ7 A;  2LUM A;  3VRB B;  4XWT A;  1CZP A;  4IOI E;  5FK9 C;  4ARC A;  3AM9 A;  4HRO A;  5LNK 1;  2OHF A;  2ICI A;  4JWS C;  1E6E B;  5H92 C;  4P16 A;  3AEB B;  1FNV A;  2BT6 A;  4HKZ E;  3TUO A;  1VR9 A;  1FD6 A;  4PT5 A;  1STE A;  3BVZ A;  2DLB A;  4REZ A;  1ET9 A;  4JWU C;  3IXS A;  1T5X D;  3KQ4 A;  1L4Z B;  1QOG A;  3WCQ A;  2W3S A;  4NAW B;  2IDY A;  4YTP B;  3AB5 A;  1TKY A;  3AE2 B;  5AUI A;  1FXA A;  3NRZ A;  1ZUD 2;  3P63 A;  2PKO A;  1TY2 A;  5AUK A;  1VJK A;  4YWG G;  1RYJ A;  1I4P A;  2NTT A;  2Z8L A;  2MJ3 A;  1TS2 A;  3BK2 A;  3U2S C;  3Q8A A;  3AEC B;  1XLN A;  3MJ5 A;  1IBX A;  1JRO A;  5MPO A;  4KGT A;  1E9M A;  1ZOY B;  2M0A A;  4HRS A;  3R2I A;  2NMQ A;  1DOY A;  2W3R A;  1ZDV A;  4C56 C;  1I4X A;  5FKA C;  3AE1 B;  2V3N A;  2ONQ A;  1I7H A;  2PIA A;  4OZA A;  3ETR A;  2WXO A;  4ZOH C;  5G5G A;  1L0Y B;  4KX6 B;  4O1N A;  5I4D A;  4P6V F;  1P7F A;  1YJJ A;  4OZC A;  3SFE B;  5HG2 A;  1RFK A;  3SEB A;  1TS5 A;  4B0M A;  4WWM A;  4US8 A;  1WGK A;  4CQN A;  1PUT A;  3IAS 1;  5EE3 A;  1B1Z A;  4JX1 C;  1NVI D;  1J7A A;  2WU5 B;  1K50 A;  1XEE A;  4L1B A;  1ROE A;  4XWW A;  1YN4 A;  3ABV B;  1C4C A;  2GI9 A;  2PTL A;  4ARI A;  3AE9 B;  4J3O D;  1TS4 A;  3P1M A;  2MJE A;  3NVZ A;  3HVD A;  3ZGZ A;  2D5G A;  1ZDX A;  1E10 A;  2QMT A;  3AEE B;  2CU3 A;  2EKI A;  1J7C A;  2JSV X;  4RCO A;  4KKJ A;  1NYR A;  2L52 A;  1FNU A;  1OQQ A;  4ZRP A;  1D5M C;  4DQO C;  2XN9 C;  2GB1 A;  1VZ7 A;  5HI1 A;  3TSS A;  3GS2 A;  2AQ3 B;  3ZJT A;  1VZ6 A;  3ZYY X;  2RDG A;  4EE2 A;  2PVO D;  4RH6 A;  1PGA A;  2BB6 A;  3EA6 A;  3B9J A;  3TEZ A;  2WXF A;  2IGH A;  2W55 A;  1LO5 D;  1WWT A;  4NAM A;  1OFF A;  2K0P A;  2WLB A;  2WXJ A;  4MT5 A;  2QJL A;  1ZXH A;  1FM0 D;  3FC4 A;  3CWI A;  1C78 A;  1EU3 A;  3VQI A;  2WXL A;  2INP E;  3MP9 A;  3KLS X;  4N58 A;  1I4R A;  2MH7 A;  1XXG A;  1XLQ A;  2Y3A A;  2W82 A;  3B2F A;  4R3D A;  3O13 A;  2G1E A;  3BII D;  2TSS A;  2WS3 B;  2FE8 A;  1AYF A;  2I2Y A;  1E0Z A;  4DXF A;  3L4P A;  4RGM A;  1QOB A;  1CK1 A;  3U4E G;  1TYG B;  3LXF A;  4ZHP A;  2MEK A;  3MC0 B;  2FBW B;  5EE0 A;  1E7P B;  1KLU D;  2ZW0 A;  5BMH A;  4RFB A;  3P42 A;  3MHZ A;  2ACZ B;  3VRA B;  5D7G A;  1FNW A;  1EWC A;  1EM7 A;  3Q8C A;  3NVY A;  1IGD A;  4GDL B;  4AS1 A;  3PZ8 A;  4LK0 M;  1XLO A;  3AMZ A;  3CIR B;  2JQR B;  4N6E B;  2J52 A;  1L6U A;  1QKZ A;  1AWD A;  2BS3 B;  2WNM A;  3GB1 A;  3DWM A;  2KWD A;  4WQM A;  1HZ6 A;  3I57 A;  3BWU D;  2IGG A;  4RGT A;  4C80 A;  2BYT A;  1N5W A;  3LYY A;  1SBB B;  3AH7 A;  3KWV A;  3P4P B;  1I4G A;  4N59 A;  3R8B A;  4US9 A;  1N62 A;  2E3T A;  2YEP B;  2LJI A;  2N9K A;  3DWG C;  3W5U B;  1DYQ A;  1QQR A;  4OZB A;  2N9L A;  2AX5 A;  1L5P A;  1VLB A;  2WXR A;  1MPE A;  2X38 A;  1FXI A;  1NEN B;  4WIP A;  1L6V A;  4HEA 1;  2YEP F;  2WDR B;  1TY0 A;  1A70 A;  2PVG C;  4TSS A;  2BTE A;  1JQ4 A;  2J4X A;  3PO0 A;  2IJ0 A;  2JYT A;  1WSP A;  2J53 A;  2JWU A;  3OWE B;  3PZ7 A;  3AE5 B;  1GPX A;  3RFZ B;  1ACC A;  3NZ3 A;  1XCT L;  1D6E C;  3HRD D;  2IPK D;  2SEB D;  3W2D A;  1QIL A;  2WXK A;  1FRR A;  1VZ8 A;  3URY A;  3R2T A;  4GLS C;  1NYQ A;  4UDU C;  4LLG M;  4XDC A;  1DGJ A;  2K22 A;  4Q2J A;  1WRI A;  3AN1 A;  3Q8B A;  2ON8 A;  4YSX B;  1ENF A;  1I4Q A;  4A9A A;  4ZRQ A;  1HXY D;  1PYW D;  3T3N A;  1SF0 A;  3U7Z A;  1YQ4 B;  4KGS A;  2LHD A;  3AEF B;  1Y56 A;  3GP7 A;  2WXH A;  3HVZ A;  3Q69 A;  4YSZ B;  1EWY C;  1L0V B;  1JML A;  2K9X A;  2KDM A;  2QIE B;  1SB3 C;  4RGO S;  1GOZ A;  1N63 A;  4TMA B;  3RPF C;  2XNA C;  1NI3 A;  1KF6 B;  3AE4 B;  2K5P A;  1K51 A;  4YXD B;  1JWS D;  3E56 A;  5T8I A;  3V3X A;  4OHJ A;  4YTN B;  1L4D B;  1UUP A;  2JU6 X;  1XO3 A;  1BXT A;  4RF1 A;  4YSY B;  2WXM A;  1R7S A;  1F0Z A;  3TEX A;  2N0S B;  5GXG B;  4L2Y A;  3U52 E;  2LEK A;  1YMH E;  2BS4 B;  3BK1 A;  2MJD A;  2B76 B;  1V97 A;  2DYO A;  2KN4 A;  2Q5W D;  4IDI A;  2H89 B;  2KQ4 X;  1V1P B;  3BVM A;  1Q10 A;  3KWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...