2K3UA

Structure of the tyrosine-sulfated c5a receptor n-terminus in complex with the immune evasion protein chips.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
91
structure length
91
Chain Sequence
NSGLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELLGKMYKTYFFKKGESKSSYVINGPGKTNEYAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis inhibitory protein
publication title Structure of the Tyrosine-sulfated C5a Receptor N Terminus in Complex with Chemotaxis Inhibitory Protein of Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus str. newman
molecule tags Immune system
total genus 20
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2008-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11434 CHIPS Chemotaxis-inhibiting protein CHIPS
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.390 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2k3uA01
1XEEA 2K3UA
chains in the Genus database with same CATH superfamily
1PDXA 3RZFA 4W9CA 5IO9A 2PE9A 3RPFC 5BO4B 1V8CA 1BMLC 2M4NA 3RNCC 2JT4B 2PVOD 3KVFB 4DXGA 3HVZA 2I1KA 2INCC 2WDTB 3B2FA 4LTUA 1VJKA 1ET9A 3VH4B 3LB8C 4FULA 3Q8FA 2K6QA 4AOFA 2FIDA 2KO3A 3VRBB 2ZEQA 1WJ6A 4DDID 2WXFA 1PGAA 1P7EA 1C76A 4ARIA 4G0NB 1GUAB 1EWYC 3U30A 2KMCA 3AEDB 3IAS1 3JSVB 3L10B 2Z8LA 1DOXA 1HEZE 1TS5A 2V1YA 3LYYA 3GZNB 2WHIA 1X1MA 1V2YA 5L83A 2KJ6A 2DYMA 4MM3A 1EM7A 2N9PC 1FRDA 3MC8A 1F2RI 1VRAB 3NVVA 3AE7B 4ZDVA 3M62B 2JVCA 4A9AA 3T9LA 2KLGA 2WXLA 2XNAC 3MP9A 4EE2A 2L52A 3CSTA 2NVUI 3V6CB 2O6VA 5EE1A 4IWOA 2KTFA 2FCSA 3RFZB 5IOIA 1XLQA 1DYQA 2LGYA 4OVUA 1VLBA 2N7JA 2LJ5A 2Y5BB 1OQRA 2LEKA 3J9CA 3NVWA 2WDVB 3AEGB 1UGJA 1R4NB 1SE9A 2PMVA 2WXQA 1J7AA 1WX9A 1IBXA 1QOFA 3APDA 3MHSD 4MGYE 2IO3B 3VUYA 4KIKB 3ZKJC 1F1HA 2DZMA 3ZO5B 3W1YA 4LNKA 3PLVA 1V49A 2L00B 2C9WB 5G55A 1L6UA 3ML8A 5HKHA 1IP9A 1SF0A 3N1YC 1QOBA 4W9LA 2SAKA 5D2MB 4GXBA 4OZCA 4DXAB 2N4FA 3P63A 1D5ZC 5IA7A 3W9CB 4GMVA 1WZ3A 4IOIE 3N20C 4GGQA 4L1BA 2C7HA 3VAWA 2KWVB 4P1CC 4C56C 1ZXIA 3AULA 4M0WB 1V9JA 3DWGC 3T3NA 1QZEA 2D5GA 1OFFA 4DK5A 1PGXA 3AE5B 1FNVA 3NVZA 3PZ7A 1TT5B 3BK2A 2QJLA 1T0QC 2BBCA 2PIAA 1OQYA 4K7WA 3WA0A 3WALA 2WDQB 1JWAD 2BGFA 1P3QU 2LGXA 1I4HA 3AM9A 3A33B 2EMTA 4MJSA 3DHIC 1TKEA 4JQWC 4YSYB 1WI0A 4DBGA 4NPNA 4ANUA 4MT5A 1UZXB 4N9F4 5FK9C 2RDGA 3KYCD 4LDTB 2FCQA 1KLGD 1TYGB 2BWES 2BS2B 4WJNA 5EE3A 3N1XC 4N59A 1D4BA 5L95C 2JZ3B 4BVUC 2G1EA 2ASQA 3RI7C 3ZNHB 1WM3A 2HJ1A 2Y5CA 2K25A 4JX1C 4W9KA 2PEAA 3MJ5A 4D2KA 4ANXA 5LXHA 1A70A 3SHQA 3PVLA 2ZCBA 4W9EA 2I2YA 1DOIA 2RD0A 1SE2A 4TKNA 4NAWB 2J52A 4GDKB 1KJTA 3DBHI 3H7PA 3TEWA 2M17A 4OVZA 3TCAA 3ZVVA 4AWJA 1FEHA 1J0GA 4IW0A 1WE7A 3AEBB 4ANWA 4ICVA 3DBLI 1N60A 1UD7A 1KRHA 1VZ8A 5C3JB 2CU3A 3R3MA 3A9JB 1EF5A 2KFKB 3W1SA 4A55A 1YMHE 3I5JC 1XCQL 2KDEB 2DZIA 3UIPB 2NTSA 2I38A 5H8YE 1SIJA 3AB5A 4M00A 2PJHA 4P1BC 1WXQA 4ZRPA 4B9KA 3SFEB 1YN5A 1WM2A 3UINB 3QQ8B 4HK2A 1AN8A 2A4ZA 2TSSA 3N1ZC 1LXDA 5JHBA 1FFVA 2KDFB 4TSSA 2ZJDA 2KMMA 2MWSB 4HVBA 4HLEA 2BW2A 3WCQA 1V80A 1BT0A 2LVOA 2KVZA 1F2RC 1ZDXA 3SR6A 5KHQA 4GB9A 4DWFA 2JZZA 2KKCA 3B1LX 2AQ1B 5E6NA 4FXCA 3ZNZB 3TIXA 3U8ZA 2MBOA 1NEKB 3QAQA 3PT2B 2CU1A 3P4QB 4YWGG 2J0MA 1FIQA 2INPE 2JXTA 4YSXB 4J3OD 4GDLB 5I4DA 1V1PA 4RGMA 3APFA 4US9A 1NYQA 4EEWA 3OAWA 4ITKA 1TS4A 5AZGA 2MSED 1CMXB 5BYSA 2M19A 2M1MA 3V6EB 1WGKA 3RMKC 4NNJB 4MGKE 1KH0A 2NMQA 1I4XA 3RYTA 4C4VA 1SXTA 2K5PA 2XK5B 2V4LA 1JMLA 1T3QA 3M63B 1C4CA 2MCNB 2JY6A 2M0XA 2AWTA 3AE2B 3DVNV 3MHZA 2KXJA 2WP9B 2JF5A 1V86A 3GE8C 4KSLC 1AWDA 3SD5A 1HTOA 2N9XA 3ZRCA 1MFWA 4MSQB 1KFYB 1YJ1A 2NBWB 1OEYJ 4TQ0A 1CQVA 1S3SG 2ZW0A 2C60A 4W9GA 1BXTA 1NYRA 4WJOA 1YQBA 2MJ3A 1I4GA 1E5WA 1WJ4A 3QJZA 2GBRA 3V62A 2QIEB 3V60A 4A6QA 1UWXA 2WQYB 1T0SC 1ZXHA 4AJWA 1HXYD 3E9SA 4NAMA 3FC4A 1T0RC 2G4DB 5D3IB 1WXSA 2B76B 2MBBB 3KLSX 5CHFA 4ZRJA 1SSNA 4RM8A 2IDYA 4W9IA 2NBVB 3ZGZA 2NPTA 3BVZA 1G6JA 2LZ6A 1R4NI 2N1VA 1TS2A 5D3DA 3ZXRA 1R7SA 2HDEA 2KAJA 3APCA 3PLUA 4I6NB 3JYUA 2BB6A 4IC7B 3RZWC 4ZYNA 1FXTB 3DQVA 2J4XA 4QAYA 1SE4A 1GB4A 4KGRA 1ISNA 4B0MA 3QK0A 3GB1A 3Q8EA 3OLMD 3DBLB 4TQ1A 3C19A 4KSKC 2L8JA 1PUTA 1FNWA 2FUHB 2M8SA 1KLUD 2IGGA 4GIVA 5LLIA 2K22A 1GOZA 2KD0A 2FCMA 2D11A 2LGSA 4XGAB 1AW7A 1R4MB 2GBJA 1KOTA 1FM0D 2RDBC 1HE8A 3A4SC 4EZLA 3R7RA 1WSPA 2ZZPB 4LJOB 3QA8A 2GBKA 3Q3MC 3UQAA 3ZIMA 4FJVB 1E9MA 4AUQC 1K51A 3UI3A 1L4ZB 1C77A 4HPPA 2XEWA 4GU2A 1SB3C 4CYEA 4WWNA 2V3NA 1V81A 4JLCA 3I63C 2V4IB 1ET6A 4RF1A 4N6EB 4E3CA 3Q3NC 4A20A 1RYJA 3DDCB 3MFGA 3V05A 2K0PA 4XE0A 2H88B 3AEEB 4OZAA 3BINA 3OG5A 1XQQA 2VZKB 3WAPA 5IKCM 2DAJA 3AE1B 1WR1A 1TY0A 1Q5WB 1JROA 2KVRA 1WRIA 1N61A 3Q3OC 1Y8RC 2KJHB 2BPSA 1TKYA 2KDMA 5BYQA 2Q5WD 3HRDD 1UGMA 2IBIB 1OQQA 1P7FA 4IWQA 3PREA 3NY5A 4H2AA 3W5VB 4P7IA 5D94A 2KTRB 3H1UA 4KVGB 3V3XA 2L83A 4WQOB 4YT0B 2MH7A 4YTNB 2O2VA 2E6XA 1JALA 3ZLZA 4REZA 4X57B 4F8CB 1YQ3B 3N9YC 1I4PA 5AUIA 2BKFA 2QMTA 3AMZA 3Q8BA 4CO7A 2LVPA 1Y56A 1WWTA 3A9KA 1TJEA 4XWWA 2FAZA 1FD6A 4WAFA 4GOCA 4O1NA 3RULA 2WXOA 3S2AA 3RD2A 4WAAA 1WX8A 1RLFA 1VCBA 3KUCB 1L0YB 2JX5A 1YOVB 1WXVA 2BKRB 1YNTE 3W2DA 1HZ6A 2JSVX 1SJHD 4DQOC 1UBIA 1H4RA 1WFYA 1JWSD 2DLBA 4R3DA 2WX1A 3N30A 1WX7A 3N32A 1E8WA 1J19A 4IKGA 3H7SA 3KW5B 1HA5A 4M0WA 3BWUD 1N5WA 2D3GA 1MHHE 1YN3A 1V5OA 3I9V1 3UQBA 3VRAB 2HTHA 1J8CA 1YX5B 2CHXA 3ZTCA 5FR6A 3NHEB 4WJPA 5TSSA 3AE6B 3HM3A 3Q3FA 2AYOB 2KQ7A 3TEZA 2ZPNA 4L2YA 1PQSA 1FCLA 1M94A 3DWMA 4K3CA 3HVDA 3TUOA 5JHAA 3Q2AC 4MM3B 2GOWA 2K8HA 2WU5B 4JL9A 2MJEA 2VRRB 3ONSA 2XN9C 5BMIA 4PS3A 1P98A 2MRPA 4A90A 3GOEA 3V61A 3BYYB 2BTEA 3AI5A 3U52E 3ECIA 5CHVC 2LXAA 4NQLB 2MHJA 3LXFA 2O6VB 2BF8B 1ZP0B 4NAWA 4XZ4A 3FILA 4OW0A 2G3QB 3U7ZA 4M02A 2CHWA 2DENB 1SIFA 2BYEA 2BYVE 1RM6C 1Z2MA 4B95A 2X38A 1WXMA 2LMCA 4RF0A 5E6JA 3EHVA 3MJWA 4GLSC 3Q6BA 1VZ6A 1XLOA 3ZJVA 1RRBA 1FMAD 1SJED 1IBXB 3FKYA 3EA6A 4RMAA 1ZOYB 5HG2A 2MP2A 1L0XB 3ALBA 3PRMB 2YEPB 5TR5A 5DPTA 3QWZB 2M56B 2EKEC 1D3ZA 1NDDA 4HKZE 2J42A 1WMHA 3PS6A 2AL3A 1M4VA 2BYTA 4PYUA 4C7YA 4TV3A 2WLBA 3AECB 5BYRA 2BT6A 2K8CA 3R7QA 2N1WA 3U4EG 3EFUA 3Q14C 2KZRA 1WGHA 4K7SA 1T5XD 5G5GA 1LQBA 1SE3A 2DHZA 2EKIA 2QC8A 3KUZA 1TTNA 2RR9A 5JH5C 3PV1A 3ETRA 2ZNVB 1ZE3D 4PK1A 3RNFC 3VH3B 1L6VA 2N7DA 4FJZA 2JZPA 2J0JA 3GP7A 4KV2A 3VFKA 3KWVA 1WZ0A 1EO6A 4EKUA 4B6WA 1P9DU 3AU4A 1EF1A 1WYWB 3CSFA 2WXRA 1WGDA 1YJIA 2G45B 2BYFA 3PPAA 2EELA 5J2RA 2W82A 1N62A 1N5XA 2KC2A 3AV8A 2IO1B 2LHEA 2NR2A 3AE9B 1EU3A 2OJWA 5GMVA 4CHKA 1B9RA 2Y3AA 2NTTA 4HROA 4EUTA 1WGGA 3UF8A 4XYCA 3D32A 4EZJA 2N7EA 2WXKA 3WAOA 2LRWA 4ACFA 3ZJTA 3AEAB 5DCNA 3TEXA 3T3OA 2WU2B 2JXXA 1R4MI 2MBQA 3TL5A 5G2NA 2ACZB 1V5TA 2LXCA 4W9HA 4MACA 4MSMB 4PS8A 3AEFB 2MBEA 2SEBD 1TZOA 1TBEA 5C2TB 2PKOA 4RM9A 1FNUA 2WYQA 2ONQA 1STEA 3NZSA 5AEKB 2KWDA 4BKSD 4KZCA 3Q3JA 4ZRQA 4J6IA 3PO0A 3SFDB 1A5RA 2D10A 2AEHA 2JU6X 4AP4C 3QCAA 4LCDE 3A1QA 2PTLA 1L5PA 3W5UB 4G11A 2LWPA 4B0EA 5EE0A 3RNBC 1B1ZA 2OJRA 2GBMA 1Z5SB 2DWQA 2KX0A 1ZKHA 1KTKA 4WWMA 1E8YA 2CR5A 5JZEB 1RFKA 3CIRB 3TSSA 1RAXA 2KQ4X 2JRHA 2WGSA 3WIMA 1QOAA 1N6ZA 3CF6E 5DPRA 4KX6B 1MPEA 1E0ZA 3CWIA 1TY2A 4MH8A 3VXWA 1JQ4A 2GBNA 5CTRC 4FHJA 1OEYA 2K1FA 4JE3B 1LO5D 4ZRIA 2JQRB 1FFUA 3Q69A 4OZBA 3AN1A 1EUVB 3U2SC 4LNNA 3PSEB 2VH2A 3H6NA 1GG3A 3U7DA 3ZW3A 2WWZA 3QARA 2R61A 1JW9D 2AX5A 1ZGUB 4DDGD 3I3TB 1QLBB 3P2BA 1F0ZA 3MC9A 3EC8A 2IYDB 2LHDA 4OVVA 5IN7A 2ON8A 3QIJA 5G5HA 2HE7A 3AE3B 1T0YA 2LI5A 5DPSA 1UF0A 1QT9A 2PVGC 2N0SB 2L32A 4HDOA 5EDSA 3SU8X 4NZLB 3DBSA 2JYEA 2MEKA 2NBUA 1GC7A 1D5XC 4HEA1 2DBYA 1TIFA 2L76A 3IT6B 5EE9A 2LVQA 2V9HA 2UYZB 1YD8U 1KM7A 5C23A 1TZ1A 3NRZA 4K1RB 2DX5B 3HM6X 2EMSA 4P16A 3EFCA 3UIOB 3P4RB 2DZJA 3MTNB 2HTME 3ZDTA 3VVWB 2H89B 3LJ3A 1QILA 3DOWA 4DHZE 2UWQA 4WWOA 2MLBA 1D5MC 4IM2A 1XCTL 3K9OB 4LNFA 1V1PB 3KWLA 1C78A 2DZKA 3R8BA 2QCZA 3B08A 2FE8A 2WS3B 1I7HA 2ZVNA 3IAM1 1NENB 3IHPC 1VZ7A 4M8MA 1YJJA 1XF5L 2O6VD 3PHXB 1PYWD 5IP4D 1C9FA 2WXGA 4II3B 4MH0E 2LRUA 4C4VB 1GPXA 4YTPB 3C8YA 3DVGX 1QQRA 2IZVB 1WGRA 4PYZA 1L0VB 4EFOA 3DPDA 2L05A 1WRDB 4HWIB 2LUEA 4MGIE 3X23A 3AE4B 3DBRI 2BB5A 4TUUA 3ZXVA 4HCNB 4FN2A 2K6DB 2RDHA 2ZVOA 1FXIA 4LDTD 2ZPYA 1UWMA 3N3KB 1C4PA 2QHOA 1VDVA 3HK0A 3IVFA 1SGHA 2FNJB 4US8A 1WE6A 2J7QB 4BKGA 2J53A 3CMMB 3ZNID 2V3SA 3P4PB 2LGDA 3K9PB 3AU5A 2KN4A 3R2TA 3JSVA 3A4RA 2AQ2B 2BS3B 3NJTA 4DHJB 4HRSA 3L54A 4A3PA 2NPTB 4RH6A 2KFJA 1E8ZA 2KANA 1Q10A 2IO0B 4RGTA 1K52A 1NI2A 3DCGA 4TMAB 1T6BX 1E7VA 4LLGM 1E8XA 3VTUA 3EECA 2C5LC 1L7YA 1ZUD2 2Y5PA 2MX2A 1YQ4B 3AH7A 4IM0A 3NS1A 2DAFA 4ANVA 5J18A 4W9DA 2JYTA 1WH3A 1XEEA 1MG4A 1WY8A 1GAQB 3BVMA 4BAXA 1Q1OA 1SEBD 2GB1A 3T8MA 4YTMB 2Z0EB 4KIKA 1E7PB 4JWUC 2JPHA 3WANA 5D7GA 4ZHOA 1WF9A 3ZYYX 2V0GA 3PTFC 2GRIA 4USAA 1XD3B 1ZW7A 4EOYA 2N9LA 3VR8B 2LFIA 1WYGA 2HJ8A 3RT3B 4LNOA 3VTWA 2WXHA 4ASWC 2MW5A 3JVZX 5BMHA 1JRPA 3L13A 4PS7A 4BOSC 1E90A 2KWUB 1D6EC 3L16A 4AJYB 4K81A 1E10A 2M0AA 1YX6B 3URYA 2D3AA 3BK1A 1XXGA 4BZAA 5FKAC 2K3UA 1TGZB 5C1ZA 4W9JA 2IO2B 4G50A 4A3OA 4GSWA 2WXIA 1FXAA 5FR3A 3TJPA 4F1SA 5D6JB 2CJNA 3FAHA 2B3AA 3NZUA 4IM3A 1K50A 4I6LB 4KGSA 4JWSC 2DYBA 3AXCA 2PLPA 2GLSA 3PGEA 2LD9A 2WXNA 1WJNA 2ICIA 1Q0WB 4HXDA 4S17A 3HUIA 3IT4B 2RGFA 2O2VB 2CS4A 4BOZB 3E56A 3EGRA 3BZDB 2I1JA 2ZW1A 2W9NA 1JRUA 1PGBA 4NJCA 3DBRB 2WXJA 3ZUNA 3OWEB 3L08A 2IPKD 2L0TA 3A9KB 4WJQA 1P1AA 2D3CA 3SEBA 1GC6A 2FBWB 1AARA 1V1OA 1N63A 4IWPA 1ZPSA 2JRIB 2WNMA 3RN9C 3DVNU 4E71A 1V97A 2JWZA 3Q8AA 5IAAC 3B9JA 1F52A 4GDKA 3R2IA 4S0RA 2RMMA 3R66C 2AL6A 2L1AA 2K39A 1OTRB 1IGDA 3HIZA 2NCNA 2C7NB 3IG3A 3PRZA 5E6PA 4LNIA 3ZTDA 4I6PA 4C80A 1HTQA 1KF6B 2L0FA 3ZDMC 3C0RB 1XT9B 2N9EB 3ZJUA 1JWUD 4DHZB 3A9JA 1C4AA 2D07B 2K8BA 1WIAA 1XLPA 2LJIA 1UBQA 3VUWA 2IGHA 4JIOU 2KFKA 4NY0A 5HI1A 1EU4A 4G3XB 3NS8A 4Q2JA 1SBBB 3JW0X 4RGOS 1VR9A 1QOGA 2W55A 3M3JA 1GB1A 4W9FA 2D2QA 5AZFA 1I42A 2LUMA 2KQSA 3RCZA 3SDLC 4ARCA 2IY1B 1YIWA 2KK8A 4ZOHC 4KKJA 5LXIB 2QDFA 4OHJA 2KHWB 3TEYA 3OJ4B 2LGIA 1QF6A 3H8HA 4RCOA 2UU7A 4K7UA 2INDC 2MA9B 2KYWA 1F77A 4KKIA 1ENFA 2OEDA 3QHTA 1PFDA 4AS1A 1YN4A 4ZHPA 1MI0A 4DHJD 3DVGY 2KT7A 2DYOA 2G9HD 3BVGA 3FILB 2IJ0A 2QILA 1K53A 1JWMD 4WURA 4KDLB 2XBBC 3DHHC 1ZDVA 3B0AA 3PZ8A 4MJSB 3TBLD 4P6VF 4JGHB 4GDLA 3MC0B 2VH1A 5HFYA 2VZKD 3QC8B 5DPWA 1NI3A 1WGYA 2ZNVC 2MP2B 4K3BA 2KLCA 1HQRD 2BWFA 2KDBA 2LASA 2JWUA 2XK5A 3O13A 3RUIB 2WX0A 4FLHA 2RPVA 2Z0DB 1WMHB 4FADA 4M01A 1ESFA 1HZ5A 2OOBB 2REXA 1L2NA 5KHOA 1ACCA 1S1QB 1IUEA 3Q8CA 2MBHA 1GNUA 1UNSA 5H92C 4BFRA 3O65B 1U4AA 4MELA 2V3PA 4XDDA 3B2GA 3PRPB 1MG8A 2KN5A 2E3TA 1C79A 4XWTA 3M95A 1OGWA 3L4PA 4URKA 5J17A 2BQQA 1I4QA 3NG0A 1CZPA 3L17A 5GXGB 2KWCA 3H7PB 4N58A 4BBNC 2HD5B 2R2QA 1P0RA 3AE8B 3OJ3A 3ABVB 1XLNA 4HJKA 3PZDA 4L23A 1I4RA 5CX3A 5AUKA 4A8XC 3NZ3A 4XX5A 4M8NA 1E6EB 2YVCA 2L7RA 2YLMA 1FRRA 2WXPA 4WH4A 3IBEA 4FHKA 1RWSA 2IGDA 2ZCCA 3X0WA 2G4SA 2Z59B 3EUB2 4HDQA 4UDUC 5HHDG 2R2OA 4KZ0A 1DOYA 1KLVA 2YEPF 1J7BA 1WR6E 2AQ3B 3VHTC 2PPHA 3IXSA 1I35A 2MQJA 1RFAA 1ROEA 2CHZA 2KACA 4ZYSA 3ZQ4A 2C7MB 3PHWB 1MJDA 2DNFA 2KMAA 2PW9A 5AZHA 2CJOA 3GZNI 4AQ7A 1BUIC 3VUXA 3RNAC 3A1QB 3ZNGC 1MVKA 2W3RA 4FBJB 1AYFA 3NUHB 1XO3A 3TMPB 2GI9A 1FCCC 4MDKE 3W1SC 2J0KA 4KGTA 4MGZE 3VDZA 5BMGA 3P1MA 1H8CA 3P4SB 4IG7B 2A5UA 2W3SA 2IY0B 4NJ7A 4E74A 2FUG1 4XC2A 3IFWB 1VD2A 2KOXA 2FCNA 2KNBA 2W54A 4C00A 4WIPA 4FA6A 2PE6B 4C7ZA 4HPMB 2KC1A 5T8IA 3P42A 3RNEC 1MHXA 1IYFA 3ML9A 3ENEA 4LK0M 1IPGA 5CHWA 2KX3A 1FPYA 2WXMA 4BBNF 3BIID 4HJGE 1WXAA 2OHFA 3DBHB 3WAMA 4II2B 1QKZA 1UH6A 4LJPB 1WJUA 1DGJA 1TKGA 3GS2A 3KH0A 2GMIC 2NS5A 1LFDA 1UELA 5MPOA 2WDRB 2L3ZA 3KQ4A 4EZKA 4RNAA 4IUMB 4YL8A 4MEMA 1C1YB 3HHMA 5LNK1 4BKSA 5JXVA 4HCPB 1IGCA 4F7ZA 1NBFC 2KTRA 4GN1A 2FIFA 3RNGC 4HKQA 2KDIA 1CJEA 3I57A 4PT5A 2X8XX 1GJZA 4FJYA 1LM8B 4DXFA 1JCKB 3VQIA 4NQKE 4JPSA 4XDCA 1FO4A 4BKTA 3L0WB 2QEJC 2INNE 4ICUA 4NJ6A 1JWBD 1J7CA 2KJRA 3DHGC 1EWCA 1UUPA 4KDIC 3UGBB 4WQMA 3LDZE 3VTVA 4YXDB 4WWPA 1C3TA 2K9XA 4HPLB 4YSZB 3H9DA 3NVYA 4CQNA 4IDIA 2CKHB 2BVCA 1CK1A 4RFBA 2N9KA 4RGNA 2QSDA 2RSUA 3GE3C 1L4DB 4ZRKA 1K8RB 1NVID 3BYTB 3QX1A 2JUOA 5E6OA 3ZRFA 3NOBA 1F9JA 3KUDB 1V6EA 2BS4B 3BY4B 1LGRA 2RPQA 3KYDD 3VR9B 1TS3A 2D3BA 1E7UA 2MJDA
chains in the Genus database with same CATH topology
2WQYB 1PDXA 2ACZB 3RPFC 1N63A 1ZXHA 1V8CA 1BMLC 1HXYD 3E9SA 4MACA 1ZPSA 2WNMA 2PVOD 4DXGA 4NAMA 3FC4A 3AEFB 5D3IB 2B76B 1V97A 2SEBD 3HVZA 1TZOA 3KLSX 5C2TB 3Q8AA 2PKOA 1SSNA 1FNUA 3B9JA 3B2FA 2IDYA 3ZGZA 2ONQA 1STEA 3BVZA 4LTUA 1VJKA 1ET9A 2KWDA 3R2IA 3LB8C 2RMMA 3Q8FA 1TS2A 4ZRQA 5D3DA 2L1AA 3VRBB 1IGDA 3PO0A 3SFDB 1R7SA 2HDEA 2WXFA 2KAJA 2JU6X 1PGAA 1P7EA 1C76A 4ARIA 2PTLA 4C80A 1EWYC 2BB6A 1L5PA 3W5UB 3AEDB 1KF6B 3IAS1 2Z8LA 1DOXA 1HEZE 2J4XA 1TS5A 4B0EA 5EE0A 1B1ZA 1SE4A 3LYYA 1GB4A 4KGRA 4B0MA 3GB1A 3Q8EA 3ZJUA 1JWUD 2DYMA 2DWQA 1EM7A 1C4AA 1KTKA 4WWMA 1XLPA 2LJIA 2IGHA 1RFKA 4TQ1A 3CIRB 5HI1A 3TSSA 1EU4A 2KQ4X 1FRDA 1PUTA 1QOAA 1FNWA 1F2RI 1VRAB 3NVVA 3AE7B 4KX6B 1KLUD 2IGGA 4Q2JA 1MPEA 2K22A 1E0ZA 1GOZA 4A9AA 1SBBB 2WXLA 1TY2A 3CWIA 4MH8A 2XNAC 3MP9A 1AW7A 1JQ4A 4EE2A 2L52A 4RGOS 1VR9A 1QOGA 2W55A 1FM0D 1GB1A 4JE3B 1LO5D 1WSPA 5EE1A 2JQRB 1FFUA 2LUMA 3Q69A 4OZBA 4ARCA 3RFZB 3AN1A 1XLQA 1DYQA 3U2SC 1E9MA 4ZOHC 1VLBA 1K51A 4KKJA 4OHJA 3UI3A 2N7JA 1L4ZB 3TEYA 1OQRA 1C77A 2LEKA 3J9CA 3NVWA 2R61A 1JW9D 2LGIA 2WDVB 1QF6A 3H8HA 3AEGB 4RCOA 1UGJA 2AX5A 2PMVA 1QLBB 2WXQA 1SB3C 1F77A 1J7AA 4KKIA 1F0ZA 2V3NA 1ENFA 2OEDA 2LHDA 1PFDA 2ON8A 4AS1A 1YN4A 1IBXA 1QOFA 2V4IB 1ET6A 4RF1A 1MI0A 5G5HA 4ZHPA 3AE3B 4N6EB 1QT9A 2PVGC 1RYJA 2DYOA 2N0SB 2G9HD 2L32A 3BVGA 3FILB 2K0PA 2IJ0A 3MFGA 3V05A 2QILA 1K53A 4NZLB 4XE0A 2JYEA 2H88B 1JWMD 2MEKA 4WURA 3AEEB 4OZAA 1ZDVA 1D5XC 3PZ8A 2DBYA 4HEA1 3IT6B 4P6VF 5EE9A 3MC0B 2VZKB 1L6UA 1SF0A 5HFYA 2VZKD 3AE1B 3NRZA 1TY0A 1QOBA 4P16A 1JROA 2SAKA 1NI3A 1N61A 1WRIA 4OZCA 3P4RB 1D5ZC 3P63A 1TKYA 2KDMA 2HTME 3W9CB 1HQRD 5BYQA 2Q5WD 3HRDD 2H89B 4IOIE 1QILA 4L1BA 1OQQA 1P7FA 2JWUA 3O13A 2RPVA 1D5MC 4H2AA 3W5VB 1XCTL 4C56C 1ZXIA 1ESFA 3V3XA 2L83A 1V1PB 4YT0B 3KWLA 1C78A 1HZ5A 3R8BA 2MH7A 3DWGC 1ACCA 3T3NA 1IUEA 2D5GA 3Q8CA 4YTNB 1OFFA 1UNSA 2FE8A 2WS3B 5H92C 1PGXA 1I7HA 1FNVA 2E6XA 1JALA 3AE5B 3IAM1 3NVZA 3PZ7A 4REZA 1NENB 1VZ7A 2V3PA 3BK2A 2QJLA 1YJJA 1YQ3B 2BBCA 2PIAA 1XF5L 3B2GA 3N9YC 2E3TA 1I4PA 5AUIA 2WDQB 1C79A 2QMTA 3AMZA 3Q8BA 1PYWD 1JWAD 4XWTA 3L4PA 1Y56A 1I4HA 1C9FA 2WXGA 1GPXA 1I4QA 3AM9A 4YTPB 1WWTA 3C8YA 1CZPA 1QQRA 1TJEA 4XWWA 5GXGB 1TKEA 4YSYB 1L0VB 1FD6A 4N58A 4WAFA 4O1NA 4MT5A 2WXOA 3AE8B 3AE4B 2BB5A 3ABVB 1XLNA 1L0YB 5FK9C 2JX5A 2RDGA 2RDHA 4L23A 1I4RA 1YNTE 3W2DA 5AUKA 2JSVX 1HZ6A 1FXIA 1KLGD 3NZ3A 4A8XC 1SJHD 1TYGB 1UWMA 2BS2B 4DQOC 5EE3A 1C4PA 1E6EB 1JWSD 2DLBA 4N59A 4R3DA 1D4BA 1VDVA 1FRRA 2WXPA 4WH4A 2G1EA 1RWSA 4US8A 4XDDA 2IGDA 4IKGA 2Y5CA 4M0WA 1HA5A 2J53A 3BWUD 4JX1C 3EUB2 1N5WA 4UDUC 5HHDG 3P4PB 1MHHE 3MJ5A 4D2KA 1YN3A 1DOYA 2YEPF 1J7BA 2AQ3B 2KN4A 1A70A 3R2TA 2AQ2B 2BS3B 3I9V1 4HRSA 3IXSA 3VRAB 2I2YA 1DOIA 1ROEA 1SE2A 4NAWB 4RH6A 2J52A 2KACA 4ZYSA 4GDKB 3ZQ4A 1Q10A 5TSSA 3AE6B 3TEWA 4OVZA 4RGTA 1K52A 3TEZA 2PW9A 4TMAB 1T6BX 2CJOA 1FEHA 4L2YA 3AEBB 4LLGM 4AQ7A 1BUIC 1ZUD2 1FCLA 1MVKA 1N60A 2W3RA 3DWMA 1KRHA 1VZ8A 2Y5PA 3HVDA 1AYFA 5C3JB 3TUOA 1YQ4B 3AH7A 3NUHB 1XO3A 2CU3A 2GI9A 3NS1A 1FCCC 4KGTA 4MM3B 5BMGA 2WU5B 3P1MA 3T3OA 3P4SB 2MJEA 3W1SA 4A55A 2XN9C 1YMHE 5BMIA 1XCQL 2W3SA 2JYTA 4A90A 2FUG1 3BYYB 1XEEA 2BTEA 2NTSA 2I38A 3U52E 1GAQB 2W54A 5H8YE 1SIJA 3AB5A 3BVMA 4WIPA 1SEBD 1WXQA 2GB1A 4ZRPA 4YTMB 3LXFA 4C7ZA 3SFEB 1YN5A 1E7PB 5T8IA 1ZP0B 4JWUC 3P42A 1MHXA 5D7GA 3FILA 4OW0A 1AN8A 3U7ZA 2TSSA 3ZYYX 4ZHOA 4LK0M 2V0GA 2GRIA 1FFVA 1RM6C 4USAA 4TSSA 2KMMA 2X38A 2BW2A 3WCQA 2N9LA 2LMCA 3VR8B 2WXMA 3BIID 4HJGE 2LFIA 4RF0A 1WYGA 5E6JA 2OHFA 1F2RC 1QKZA 1ZDXA 3SR6A 4GLSC 2WXHA 1VZ6A 1DGJA 1TKGA 3GS2A 1XLOA 5BMHA 3ZJVA 1FMAD 1SJED 2AQ1B 1JRPA 5MPOA 1IBXB 2WDRB 4FXCA 3EA6A 1ZOYB 5HG2A 3KQ4A 1NEKB 4RNAA 1L0XB 1D6EC 2YEPB 1E10A 3P4QB 4YWGG 2M0AA 2M56B 5LNK1 1FIQA 2INPE 2JXTA 5JXVA 4YSXB 1IGCA 4HKZE 2J42A 4J3OD 1M4VA 3URYA 2BYTA 4GDLB 4C7YA 5I4DA 4HKQA 3I57A 1CJEA 1V1PA 2WLBA 3BK1A 3AECB 1XXGA 4RGMA 4US9A 2BT6A 5BYRA 4PT5A 5FKAC 2K3UA 4DXFA 1JCKB 3VQIA 1NYQA 3U4EG 4JPSA 4ITKA 1TS4A 1T5XD 4XDCA 1FO4A 5G5GA 5BYSA 2M19A 1SE3A 1WGKA 2EKIA 2QEJC 2INNE 2WXIA 1FXAA 5FR3A 3ETRA 1JWBD 1J7CA 1ZE3D 1KH0A 1L6VA 2NMQA 1I4XA 2JZPA 1EWCA 1UUPA 1SXTA 2K5PA 2CJNA 3FAHA 3GP7A 4WQMA 1JMLA 1K50A 1T3QA 3KWVA 4KGSA 4JWSC 1C4CA 2PLPA 4YXDB 2WXNA 2K9XA 2ICIA 2WXRA 4YSZB 1YJIA 3NVYA 3AE2B 4CQNA 4IDIA 4RFBA 1CK1A 3MHZA 3HUIA 3IT4B 2WP9B 2N9KA 4RGNA 2EELA 2QSDA 1AWDA 1L4DB 2W82A 1N62A 3E56A 3EGRA 1N5XA 1NVID 3BZDB 1KFYB 3AV8A 2LHEA 2ZW1A 3AE9B 1EU3A 3BYTB 4TQ0A 1PGBA 1B9RA 1CQVA 4NJCA 2Y3AA 2ZW0A 2WXJA 2NTTA 3OWEB 4HROA 2IPKD 1BXTA 1NYRA 2MJ3A 2WXKA 1I4GA 2BS4B 3ZJTA 3AEAB 3SEBA 2FBWB 3VR9B 2QIEB 3TEXA 1TS3A 4A6QA 1V1OA 2MJDA 2WU2B 1UWXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XEE A;  2K3U A; 
#chains in the Genus database with same CATH topology
 1PDX A;  3RZF A;  4W9C A;  5IO9 A;  2PE9 A;  3RPF C;  5BO4 B;  1V8C A;  1BML C;  2M4N A;  3RNC C;  2JT4 B;  2PVO D;  3KVF B;  4DXG A;  3HVZ A;  2I1K A;  2INC C;  2WDT B;  3B2F A;  4LTU A;  1VJK A;  1ET9 A;  3VH4 B;  3LB8 C;  4FUL A;  3Q8F A;  2K6Q A;  4AOF A;  2FID A;  2KO3 A;  3VRB B;  2ZEQ A;  1WJ6 A;  4DDI D;  2WXF A;  1PGA A;  1P7E A;  1C76 A;  4ARI A;  4G0N B;  1GUA B;  1EWY C;  3U30 A;  2KMC A;  3AED B;  3IAS 1;  3JSV B;  3L10 B;  2Z8L A;  1DOX A;  1HEZ E;  1TS5 A;  2V1Y A;  3LYY A;  3GZN B;  2WHI A;  1X1M A;  1V2Y A;  5L83 A;  2KJ6 A;  2DYM A;  4MM3 A;  1EM7 A;  2N9P C;  1FRD A;  3MC8 A;  1F2R I;  1VRA B;  3NVV A;  3AE7 B;  4ZDV A;  3M62 B;  2JVC A;  4A9A A;  3T9L A;  2KLG A;  2WXL A;  2XNA C;  3MP9 A;  4EE2 A;  2L52 A;  3CST A;  2NVU I;  3V6C B;  2O6V A;  5EE1 A;  4IWO A;  2KTF A;  2FCS A;  3RFZ B;  5IOI A;  1XLQ A;  1DYQ A;  2LGY A;  4OVU A;  1VLB A;  2N7J A;  2LJ5 A;  2Y5B B;  1OQR A;  2LEK A;  3J9C A;  3NVW A;  2WDV B;  3AEG B;  1UGJ A;  1R4N B;  1SE9 A;  2PMV A;  2WXQ A;  1J7A A;  1WX9 A;  1IBX A;  1QOF A;  3APD A;  3MHS D;  4MGY E;  2IO3 B;  3VUY A;  4KIK B;  3ZKJ C;  1F1H A;  2DZM A;  3ZO5 B;  3W1Y A;  4LNK A;  3PLV A;  1V49 A;  2L00 B;  2C9W B;  5G55 A;  1L6U A;  3ML8 A;  5HKH A;  1IP9 A;  1SF0 A;  3N1Y C;  1QOB A;  4W9L A;  2SAK A;  5D2M B;  4GXB A;  4OZC A;  4DXA B;  2N4F A;  3P63 A;  1D5Z C;  5IA7 A;  3W9C B;  4GMV A;  1WZ3 A;  4IOI E;  3N20 C;  4GGQ A;  4L1B A;  2C7H A;  3VAW A;  2KWV B;  4P1C C;  4C56 C;  1ZXI A;  3AUL A;  4M0W B;  1V9J A;  3DWG C;  3T3N A;  1QZE A;  2D5G A;  1OFF A;  4DK5 A;  1PGX A;  3AE5 B;  1FNV A;  3NVZ A;  3PZ7 A;  1TT5 B;  3BK2 A;  2QJL A;  1T0Q C;  2BBC A;  2PIA A;  1OQY A;  4K7W A;  3WA0 A;  3WAL A;  2WDQ B;  1JWA D;  2BGF A;  1P3Q U;  2LGX A;  1I4H A;  3AM9 A;  3A33 B;  2EMT A;  4MJS A;  3DHI C;  1TKE A;  4JQW C;  4YSY B;  1WI0 A;  4DBG A;  4NPN A;  4ANU A;  4MT5 A;  1UZX B;  4N9F 4;  5FK9 C;  2RDG A;  3KYC D;  4LDT B;  2FCQ A;  1KLG D;  1TYG B;  2BWE S;  2BS2 B;  4WJN A;  5EE3 A;  3N1X C;  4N59 A;  1D4B A;  5L95 C;  2JZ3 B;  4BVU C;  2G1E A;  2ASQ A;  3RI7 C;  3ZNH B;  1WM3 A;  2HJ1 A;  2Y5C A;  2K25 A;  4JX1 C;  4W9K A;  2PEA A;  3MJ5 A;  4D2K A;  4ANX A;  5LXH A;  1A70 A;  3SHQ A;  3PVL A;  2ZCB A;  4W9E A;  2I2Y A;  1DOI A;  2RD0 A;  1SE2 A;  4TKN A;  4NAW B;  2J52 A;  4GDK B;  1KJT A;  3DBH I;  3H7P A;  3TEW A;  2M17 A;  4OVZ A;  3TCA A;  3ZVV A;  4AWJ A;  1FEH A;  1J0G A;  4IW0 A;  1WE7 A;  3AEB B;  4ANW A;  4ICV A;  3DBL I;  1N60 A;  1UD7 A;  1KRH A;  1VZ8 A;  5C3J B;  2CU3 A;  3R3M A;  3A9J B;  1EF5 A;  2KFK B;  3W1S A;  4A55 A;  1YMH E;  3I5J C;  1XCQ L;  2KDE B;  2DZI A;  3UIP B;  2NTS A;  2I38 A;  5H8Y E;  1SIJ A;  3AB5 A;  4M00 A;  2PJH A;  4P1B C;  1WXQ A;  4ZRP A;  4B9K A;  3SFE B;  1YN5 A;  1WM2 A;  3UIN B;  3QQ8 B;  4HK2 A;  1AN8 A;  2A4Z A;  2TSS A;  3N1Z C;  1LXD A;  5JHB A;  1FFV A;  2KDF B;  4TSS A;  2ZJD A;  2KMM A;  2MWS B;  4HVB A;  4HLE A;  2BW2 A;  3WCQ A;  1V80 A;  1BT0 A;  2LVO A;  2KVZ A;  1F2R C;  1ZDX A;  3SR6 A;  5KHQ A;  4GB9 A;  4DWF A;  2JZZ A;  2KKC A;  3B1L X;  2AQ1 B;  5E6N A;  4FXC A;  3ZNZ B;  3TIX A;  3U8Z A;  2MBO A;  1NEK B;  3QAQ A;  3PT2 B;  2CU1 A;  3P4Q B;  4YWG G;  2J0M A;  1FIQ A;  2INP E;  2JXT A;  4YSX B;  4J3O D;  4GDL B;  5I4D A;  1V1P A;  4RGM A;  3APF A;  4US9 A;  1NYQ A;  4EEW A;  3OAW A;  4ITK A;  1TS4 A;  5AZG A;  2MSE D;  1CMX B;  5BYS A;  2M19 A;  2M1M A;  3V6E B;  1WGK A;  3RMK C;  4NNJ B;  4MGK E;  1KH0 A;  2NMQ A;  1I4X A;  3RYT A;  4C4V A;  1SXT A;  2K5P A;  2XK5 B;  2V4L A;  1JML A;  1T3Q A;  3M63 B;  1C4C A;  2MCN B;  2JY6 A;  2M0X A;  2AWT A;  3AE2 B;  3DVN V;  3MHZ A;  2KXJ A;  2WP9 B;  2JF5 A;  1V86 A;  3GE8 C;  4KSL C;  1AWD A;  3SD5 A;  1HTO A;  2N9X A;  3ZRC A;  1MFW A;  4MSQ B;  1KFY B;  1YJ1 A;  2NBW B;  1OEY J;  4TQ0 A;  1CQV A;  1S3S G;  2ZW0 A;  2C60 A;  4W9G A;  1BXT A;  1NYR A;  4WJO A;  1YQB A;  2MJ3 A;  1I4G A;  1E5W A;  1WJ4 A;  3QJZ A;  2GBR A;  3V62 A;  2QIE B;  3V60 A;  4A6Q A;  1UWX A;  2WQY B;  1T0S C;  1ZXH A;  4AJW A;  1HXY D;  3E9S A;  4NAM A;  3FC4 A;  1T0R C;  2G4D B;  5D3I B;  1WXS A;  2B76 B;  2MBB B;  3KLS X;  5CHF A;  4ZRJ A;  1SSN A;  4RM8 A;  2IDY A;  4W9I A;  2NBV B;  3ZGZ A;  2NPT A;  3BVZ A;  1G6J A;  2LZ6 A;  1R4N I;  2N1V A;  1TS2 A;  5D3D A;  3ZXR A;  1R7S A;  2HDE A;  2KAJ A;  3APC A;  3PLU A;  4I6N B;  3JYU A;  2BB6 A;  4IC7 B;  3RZW C;  4ZYN A;  1FXT B;  3DQV A;  2J4X A;  4QAY A;  1SE4 A;  1GB4 A;  4KGR A;  1ISN A;  4B0M A;  3QK0 A;  3GB1 A;  3Q8E A;  3OLM D;  3DBL B;  4TQ1 A;  3C19 A;  4KSK C;  2L8J A;  1PUT A;  1FNW A;  2FUH B;  2M8S A;  1KLU D;  2IGG A;  4GIV A;  5LLI A;  2K22 A;  1GOZ A;  2KD0 A;  2FCM A;  2D11 A;  2LGS A;  4XGA B;  1AW7 A;  1R4M B;  2GBJ A;  1KOT A;  1FM0 D;  2RDB C;  1HE8 A;  3A4S C;  4EZL A;  3R7R A;  1WSP A;  2ZZP B;  4LJO B;  3QA8 A;  2GBK A;  3Q3M C;  3UQA A;  3ZIM A;  4FJV B;  1E9M A;  4AUQ C;  1K51 A;  3UI3 A;  1L4Z B;  1C77 A;  4HPP A;  2XEW A;  4GU2 A;  1SB3 C;  4CYE A;  4WWN A;  2V3N A;  1V81 A;  4JLC A;  3I63 C;  2V4I B;  1ET6 A;  4RF1 A;  4N6E B;  4E3C A;  3Q3N C;  4A20 A;  1RYJ A;  3DDC B;  3MFG A;  3V05 A;  2K0P A;  4XE0 A;  2H88 B;  3AEE B;  4OZA A;  3BIN A;  3OG5 A;  1XQQ A;  2VZK B;  3WAP A;  5IKC M;  2DAJ A;  3AE1 B;  1WR1 A;  1TY0 A;  1Q5W B;  1JRO A;  2KVR A;  1WRI A;  1N61 A;  3Q3O C;  1Y8R C;  2KJH B;  2BPS A;  1TKY A;  2KDM A;  5BYQ A;  2Q5W D;  3HRD D;  1UGM A;  2IBI B;  1OQQ A;  1P7F A;  4IWQ A;  3PRE A;  3NY5 A;  4H2A A;  3W5V B;  4P7I A;  5D94 A;  2KTR B;  3H1U A;  4KVG B;  3V3X A;  2L83 A;  4WQO B;  4YT0 B;  2MH7 A;  4YTN B;  2O2V A;  2E6X A;  1JAL A;  3ZLZ A;  4REZ A;  4X57 B;  4F8C B;  1YQ3 B;  3N9Y C;  1I4P A;  5AUI A;  2BKF A;  2QMT A;  3AMZ A;  3Q8B A;  4CO7 A;  2LVP A;  1Y56 A;  1WWT A;  3A9K A;  1TJE A;  4XWW A;  2FAZ A;  1FD6 A;  4WAF A;  4GOC A;  4O1N A;  3RUL A;  2WXO A;  3S2A A;  3RD2 A;  4WAA A;  1WX8 A;  1RLF A;  1VCB A;  3KUC B;  1L0Y B;  2JX5 A;  1YOV B;  1WXV A;  2BKR B;  1YNT E;  3W2D A;  1HZ6 A;  2JSV X;  1SJH D;  4DQO C;  1UBI A;  1H4R A;  1WFY A;  1JWS D;  2DLB A;  4R3D A;  2WX1 A;  3N30 A;  1WX7 A;  3N32 A;  1E8W A;  1J19 A;  4IKG A;  3H7S A;  3KW5 B;  1HA5 A;  4M0W A;  3BWU D;  1N5W A;  2D3G A;  1MHH E;  1YN3 A;  1V5O A;  3I9V 1;  3UQB A;  3VRA B;  2HTH A;  1J8C A;  1YX5 B;  2CHX A;  3ZTC A;  5FR6 A;  3NHE B;  4WJP A;  5TSS A;  3AE6 B;  3HM3 A;  3Q3F A;  2AYO B;  2KQ7 A;  3TEZ A;  2ZPN A;  4L2Y A;  1PQS A;  1FCL A;  1M94 A;  3DWM A;  4K3C A;  3HVD A;  3TUO A;  5JHA A;  3Q2A C;  4MM3 B;  2GOW A;  2K8H A;  2WU5 B;  4JL9 A;  2MJE A;  2VRR B;  3ONS A;  2XN9 C;  5BMI A;  4PS3 A;  1P98 A;  2MRP A;  4A90 A;  3GOE A;  3V61 A;  3BYY B;  2BTE A;  3AI5 A;  3U52 E;  3ECI A;  5CHV C;  2LXA A;  4NQL B;  2MHJ A;  3LXF A;  2O6V B;  2BF8 B;  1ZP0 B;  4NAW A;  4XZ4 A;  3FIL A;  4OW0 A;  2G3Q B;  3U7Z A;  4M02 A;  2CHW A;  2DEN B;  1SIF A;  2BYE A;  2BYV E;  1RM6 C;  1Z2M A;  4B95 A;  2X38 A;  1WXM A;  2LMC A;  4RF0 A;  5E6J A;  3EHV A;  3MJW A;  4GLS C;  3Q6B A;  1VZ6 A;  1XLO A;  3ZJV A;  1RRB A;  1FMA D;  1SJE D;  1IBX B;  3FKY A;  3EA6 A;  4RMA A;  1ZOY B;  5HG2 A;  2MP2 A;  1L0X B;  3ALB A;  3PRM B;  2YEP B;  5TR5 A;  5DPT A;  3QWZ B;  2M56 B;  2EKE C;  1D3Z A;  1NDD A;  4HKZ E;  2J42 A;  1WMH A;  3PS6 A;  2AL3 A;  1M4V A;  2BYT A;  4PYU A;  4C7Y A;  4TV3 A;  2WLB A;  3AEC B;  5BYR A;  2BT6 A;  2K8C A;  3R7Q A;  2N1W A;  3U4E G;  3EFU A;  3Q14 C;  2KZR A;  1WGH A;  4K7S A;  1T5X D;  5G5G A;  1LQB A;  1SE3 A;  2DHZ A;  2EKI A;  2QC8 A;  3KUZ A;  1TTN A;  2RR9 A;  5JH5 C;  3PV1 A;  3ETR A;  2ZNV B;  1ZE3 D;  4PK1 A;  3RNF C;  3VH3 B;  1L6V A;  2N7D A;  4FJZ A;  2JZP A;  2J0J A;  3GP7 A;  4KV2 A;  3VFK A;  3KWV A;  1WZ0 A;  1EO6 A;  4EKU A;  4B6W A;  1P9D U;  3AU4 A;  1EF1 A;  1WYW B;  3CSF A;  2WXR A;  1WGD A;  1YJI A;  2G45 B;  2BYF A;  3PPA A;  2EEL A;  5J2R A;  2W82 A;  1N62 A;  1N5X A;  2KC2 A;  3AV8 A;  2IO1 B;  2LHE A;  2NR2 A;  3AE9 B;  1EU3 A;  2OJW A;  5GMV A;  4CHK A;  1B9R A;  2Y3A A;  2NTT A;  4HRO A;  4EUT A;  1WGG A;  3UF8 A;  4XYC A;  3D32 A;  4EZJ A;  2N7E A;  2WXK A;  3WAO A;  2LRW A;  4ACF A;  3ZJT A;  3AEA B;  5DCN A;  3TEX A;  3T3O A;  2WU2 B;  2JXX A;  1R4M I;  2MBQ A;  3TL5 A;  5G2N A;  2ACZ B;  1V5T A;  2LXC A;  4W9H A;  4MAC A;  4MSM B;  4PS8 A;  3AEF B;  2MBE A;  2SEB D;  1TZO A;  1TBE A;  5C2T B;  2PKO A;  4RM9 A;  1FNU A;  2WYQ A;  2ONQ A;  1STE A;  3NZS A;  5AEK B;  2KWD A;  4BKS D;  4KZC A;  3Q3J A;  4ZRQ A;  4J6I A;  3PO0 A;  3SFD B;  1A5R A;  2D10 A;  2AEH A;  2JU6 X;  4AP4 C;  3QCA A;  4LCD E;  3A1Q A;  2PTL A;  1L5P A;  3W5U B;  4G11 A;  2LWP A;  4B0E A;  5EE0 A;  3RNB C;  1B1Z A;  2OJR A;  2GBM A;  1Z5S B;  2DWQ A;  2KX0 A;  1ZKH A;  1KTK A;  4WWM A;  1E8Y A;  2CR5 A;  5JZE B;  1RFK A;  3CIR B;  3TSS A;  1RAX A;  2KQ4 X;  2JRH A;  2WGS A;  3WIM A;  1QOA A;  1N6Z A;  3CF6 E;  5DPR A;  4KX6 B;  1MPE A;  1E0Z A;  3CWI A;  1TY2 A;  4MH8 A;  3VXW A;  1JQ4 A;  2GBN A;  5CTR C;  4FHJ A;  1OEY A;  2K1F A;  4JE3 B;  1LO5 D;  4ZRI A;  2JQR B;  1FFU A;  3Q69 A;  4OZB A;  3AN1 A;  1EUV B;  3U2S C;  4LNN A;  3PSE B;  2VH2 A;  3H6N A;  1GG3 A;  3U7D A;  3ZW3 A;  2WWZ A;  3QAR A;  2R61 A;  1JW9 D;  2AX5 A;  1ZGU B;  4DDG D;  3I3T B;  1QLB B;  3P2B A;  1F0Z A;  3MC9 A;  3EC8 A;  2IYD B;  2LHD A;  4OVV A;  5IN7 A;  2ON8 A;  3QIJ A;  5G5H A;  2HE7 A;  3AE3 B;  1T0Y A;  2LI5 A;  5DPS A;  1UF0 A;  1QT9 A;  2PVG C;  2N0S B;  2L32 A;  4HDO A;  5EDS A;  3SU8 X;  4NZL B;  3DBS A;  2JYE A;  2MEK A;  2NBU A;  1GC7 A;  1D5X C;  4HEA 1;  2DBY A;  1TIF A;  2L76 A;  3IT6 B;  5EE9 A;  2LVQ A;  2V9H A;  2UYZ B;  1YD8 U;  1KM7 A;  5C23 A;  1TZ1 A;  3NRZ A;  4K1R B;  2DX5 B;  3HM6 X;  2EMS A;  4P16 A;  3EFC A;  3UIO B;  3P4R B;  2DZJ A;  3MTN B;  2HTM E;  3ZDT A;  3VVW B;  2H89 B;  3LJ3 A;  1QIL A;  3DOW A;  4DHZ E;  2UWQ A;  4WWO A;  2MLB A;  1D5M C;  4IM2 A;  1XCT L;  3K9O B;  4LNF A;  1V1P B;  3KWL A;  1C78 A;  2DZK A;  3R8B A;  2QCZ A;  3B08 A;  2FE8 A;  2WS3 B;  1I7H A;  2ZVN A;  3IAM 1;  1NEN B;  3IHP C;  1VZ7 A;  4M8M A;  1YJJ A;  1XF5 L;  2O6V D;  3PHX B;  1PYW D;  5IP4 D;  1C9F A;  2WXG A;  4II3 B;  4MH0 E;  2LRU A;  4C4V B;  1GPX A;  4YTP B;  3C8Y A;  3DVG X;  1QQR A;  2IZV B;  1WGR A;  4PYZ A;  1L0V B;  4EFO A;  3DPD A;  2L05 A;  1WRD B;  4HWI B;  2LUE A;  4MGI E;  3X23 A;  3AE4 B;  3DBR I;  2BB5 A;  4TUU A;  3ZXV A;  4HCN B;  4FN2 A;  2K6D B;  2RDH A;  2ZVO A;  1FXI A;  4LDT D;  2ZPY A;  1UWM A;  3N3K B;  1C4P A;  2QHO A;  1VDV A;  3HK0 A;  3IVF A;  1SGH A;  2FNJ B;  4US8 A;  1WE6 A;  2J7Q B;  4BKG A;  2J53 A;  3CMM B;  3ZNI D;  2V3S A;  3P4P B;  2LGD A;  3K9P B;  3AU5 A;  2KN4 A;  3R2T A;  3JSV A;  3A4R A;  2AQ2 B;  2BS3 B;  3NJT A;  4DHJ B;  4HRS A;  3L54 A;  4A3P A;  2NPT B;  4RH6 A;  2KFJ A;  1E8Z A;  2KAN A;  1Q10 A;  2IO0 B;  4RGT A;  1K52 A;  1NI2 A;  3DCG A;  4TMA B;  1T6B X;  1E7V A;  4LLG M;  1E8X A;  3VTU A;  3EEC A;  2C5L C;  1L7Y A;  1ZUD 2;  2Y5P A;  2MX2 A;  1YQ4 B;  3AH7 A;  4IM0 A;  3NS1 A;  2DAF A;  4ANV A;  5J18 A;  4W9D A;  2JYT A;  1WH3 A;  1XEE A;  1MG4 A;  1WY8 A;  1GAQ B;  3BVM A;  4BAX A;  1Q1O A;  1SEB D;  2GB1 A;  3T8M A;  4YTM B;  2Z0E B;  4KIK A;  1E7P B;  4JWU C;  2JPH A;  3WAN A;  5D7G A;  4ZHO A;  1WF9 A;  3ZYY X;  2V0G A;  3PTF C;  2GRI A;  4USA A;  1XD3 B;  1ZW7 A;  4EOY A;  2N9L A;  3VR8 B;  2LFI A;  1WYG A;  2HJ8 A;  3RT3 B;  4LNO A;  3VTW A;  2WXH A;  4ASW C;  2MW5 A;  3JVZ X;  5BMH A;  1JRP A;  3L13 A;  4PS7 A;  4BOS C;  1E90 A;  2KWU B;  1D6E C;  3L16 A;  4AJY B;  4K81 A;  1E10 A;  2M0A A;  1YX6 B;  3URY A;  2D3A A;  3BK1 A;  1XXG A;  4BZA A;  5FKA C;  2K3U A;  1TGZ B;  5C1Z A;  4W9J A;  2IO2 B;  4G50 A;  4A3O A;  4GSW A;  2WXI A;  1FXA A;  5FR3 A;  3TJP A;  4F1S A;  5D6J B;  2CJN A;  3FAH A;  2B3A A;  3NZU A;  4IM3 A;  1K50 A;  4I6L B;  4KGS A;  4JWS C;  2DYB A;  3AXC A;  2PLP A;  2GLS A;  3PGE A;  2LD9 A;  2WXN A;  1WJN A;  2ICI A;  1Q0W B;  4HXD A;  4S17 A;  3HUI A;  3IT4 B;  2RGF A;  2O2V B;  2CS4 A;  4BOZ B;  3E56 A;  3EGR A;  3BZD B;  2I1J A;  2ZW1 A;  2W9N A;  1JRU A;  1PGB A;  4NJC A;  3DBR B;  2WXJ A;  3ZUN A;  3OWE B;  3L08 A;  2IPK D;  2L0T A;  3A9K B;  4WJQ A;  1P1A A;  2D3C A;  3SEB A;  1GC6 A;  2FBW B;  1AAR A;  1V1O A;  1N63 A;  4IWP A;  1ZPS A;  2JRI B;  2WNM A;  3RN9 C;  3DVN U;  4E71 A;  1V97 A;  2JWZ A;  3Q8A A;  5IAA C;  3B9J A;  1F52 A;  4GDK A;  3R2I A;  4S0R A;  2RMM A;  3R66 C;  2AL6 A;  2L1A A;  2K39 A;  1OTR B;  1IGD A;  3HIZ A;  2NCN A;  2C7N B;  3IG3 A;  3PRZ A;  5E6P A;  4LNI A;  3ZTD A;  4I6P A;  4C80 A;  1HTQ A;  1KF6 B;  2L0F A;  3ZDM C;  3C0R B;  1XT9 B;  2N9E B;  3ZJU A;  1JWU D;  4DHZ B;  3A9J A;  1C4A A;  2D07 B;  2K8B A;  1WIA A;  1XLP A;  2LJI A;  1UBQ A;  3VUW A;  2IGH A;  4JIO U;  2KFK A;  4NY0 A;  5HI1 A;  1EU4 A;  4G3X B;  3NS8 A;  4Q2J A;  1SBB B;  3JW0 X;  4RGO S;  1VR9 A;  1QOG A;  2W55 A;  3M3J A;  1GB1 A;  4W9F A;  2D2Q A;  5AZF A;  1I42 A;  2LUM A;  2KQS A;  3RCZ A;  3SDL C;  4ARC A;  2IY1 B;  1YIW A;  2KK8 A;  4ZOH C;  4KKJ A;  5LXI B;  2QDF A;  4OHJ A;  2KHW B;  3TEY A;  3OJ4 B;  2LGI A;  1QF6 A;  3H8H A;  4RCO A;  2UU7 A;  4K7U A;  2IND C;  2MA9 B;  2KYW A;  1F77 A;  4KKI A;  1ENF A;  2OED A;  3QHT A;  1PFD A;  4AS1 A;  1YN4 A;  4ZHP A;  1MI0 A;  4DHJ D;  3DVG Y;  2KT7 A;  2DYO A;  2G9H D;  3BVG A;  3FIL B;  2IJ0 A;  2QIL A;  1K53 A;  1JWM D;  4WUR A;  4KDL B;  2XBB C;  3DHH C;  1ZDV A;  3B0A A;  3PZ8 A;  4MJS B;  3TBL D;  4P6V F;  4JGH B;  4GDL A;  3MC0 B;  2VH1 A;  5HFY A;  2VZK D;  3QC8 B;  5DPW A;  1NI3 A;  1WGY A;  2ZNV C;  2MP2 B;  4K3B A;  2KLC A;  1HQR D;  2BWF A;  2KDB A;  2LAS A;  2JWU A;  2XK5 A;  3O13 A;  3RUI B;  2WX0 A;  4FLH A;  2RPV A;  2Z0D B;  1WMH B;  4FAD A;  4M01 A;  1ESF A;  1HZ5 A;  2OOB B;  2REX A;  1L2N A;  5KHO A;  1ACC A;  1S1Q B;  1IUE A;  3Q8C A;  2MBH A;  1GNU A;  1UNS A;  5H92 C;  4BFR A;  3O65 B;  1U4A A;  4MEL A;  2V3P A;  4XDD A;  3B2G A;  3PRP B;  1MG8 A;  2KN5 A;  2E3T A;  1C79 A;  4XWT A;  3M95 A;  1OGW A;  3L4P A;  4URK A;  5J17 A;  2BQQ A;  1I4Q A;  3NG0 A;  1CZP A;  3L17 A;  5GXG B;  2KWC A;  3H7P B;  4N58 A;  4BBN C;  2HD5 B;  2R2Q A;  1P0R A;  3AE8 B;  3OJ3 A;  3ABV B;  1XLN A;  4HJK A;  3PZD A;  4L23 A;  1I4R A;  5CX3 A;  5AUK A;  4A8X C;  3NZ3 A;  4XX5 A;  4M8N A;  1E6E B;  2YVC A;  2L7R A;  2YLM A;  1FRR A;  2WXP A;  4WH4 A;  3IBE A;  4FHK A;  1RWS A;  2IGD A;  2ZCC A;  3X0W A;  2G4S A;  2Z59 B;  3EUB 2;  4HDQ A;  4UDU C;  5HHD G;  2R2O A;  4KZ0 A;  1DOY A;  1KLV A;  2YEP F;  1J7B A;  1WR6 E;  2AQ3 B;  3VHT C;  2PPH A;  3IXS A;  1I35 A;  2MQJ A;  1RFA A;  1ROE A;  2CHZ A;  2KAC A;  4ZYS A;  3ZQ4 A;  2C7M B;  3PHW B;  1MJD A;  2DNF A;  2KMA A;  2PW9 A;  5AZH A;  2CJO A;  3GZN I;  4AQ7 A;  1BUI C;  3VUX A;  3RNA C;  3A1Q B;  3ZNG C;  1MVK A;  2W3R A;  4FBJ B;  1AYF A;  3NUH B;  1XO3 A;  3TMP B;  2GI9 A;  1FCC C;  4MDK E;  3W1S C;  2J0K A;  4KGT A;  4MGZ E;  3VDZ A;  5BMG A;  3P1M A;  1H8C A;  3P4S B;  4IG7 B;  2A5U A;  2W3S A;  2IY0 B;  4NJ7 A;  4E74 A;  2FUG 1;  4XC2 A;  3IFW B;  1VD2 A;  2KOX A;  2FCN A;  2KNB A;  2W54 A;  4C00 A;  4WIP A;  4FA6 A;  2PE6 B;  4C7Z A;  4HPM B;  2KC1 A;  5T8I A;  3P42 A;  3RNE C;  1MHX A;  1IYF A;  3ML9 A;  3ENE A;  4LK0 M;  1IPG A;  5CHW A;  2KX3 A;  1FPY A;  2WXM A;  4BBN F;  3BII D;  4HJG E;  1WXA A;  2OHF A;  3DBH B;  3WAM A;  4II2 B;  1QKZ A;  1UH6 A;  4LJP B;  1WJU A;  1DGJ A;  1TKG A;  3GS2 A;  3KH0 A;  2GMI C;  2NS5 A;  1LFD A;  1UEL A;  5MPO A;  2WDR B;  2L3Z A;  3KQ4 A;  4EZK A;  4RNA A;  4IUM B;  4YL8 A;  4MEM A;  1C1Y B;  3HHM A;  5LNK 1;  4BKS A;  5JXV A;  4HCP B;  1IGC A;  4F7Z A;  1NBF C;  2KTR A;  4GN1 A;  2FIF A;  3RNG C;  4HKQ A;  2KDI A;  1CJE A;  3I57 A;  4PT5 A;  2X8X X;  1GJZ A;  4FJY A;  1LM8 B;  4DXF A;  1JCK B;  3VQI A;  4NQK E;  4JPS A;  4XDC A;  1FO4 A;  4BKT A;  3L0W B;  2QEJ C;  2INN E;  4ICU A;  4NJ6 A;  1JWB D;  1J7C A;  2KJR A;  3DHG C;  1EWC A;  1UUP A;  4KDI C;  3UGB B;  4WQM A;  3LDZ E;  3VTV A;  4YXD B;  4WWP A;  1C3T A;  2K9X A;  4HPL B;  4YSZ B;  3H9D A;  3NVY A;  4CQN A;  4IDI A;  2CKH B;  2BVC A;  1CK1 A;  4RFB A;  2N9K A;  4RGN A;  2QSD A;  2RSU A;  3GE3 C;  1L4D B;  4ZRK A;  1K8R B;  1NVI D;  3BYT B;  3QX1 A;  2JUO A;  5E6O A;  3ZRF A;  3NOB A;  1F9J A;  3KUD B;  1V6E A;  2BS4 B;  3BY4 B;  1LGR A;  2RPQ A;  3KYD D;  3VR9 B;  1TS3 A;  2D3B A;  1E7U A;  2MJD A; 
#chains in the Genus database with same CATH homology
 2WQY B;  1PDX A;  2ACZ B;  3RPF C;  1N63 A;  1ZXH A;  1V8C A;  1BML C;  1HXY D;  3E9S A;  4MAC A;  1ZPS A;  2WNM A;  2PVO D;  4DXG A;  4NAM A;  3FC4 A;  3AEF B;  5D3I B;  2B76 B;  1V97 A;  2SEB D;  3HVZ A;  1TZO A;  3KLS X;  5C2T B;  3Q8A A;  2PKO A;  1SSN A;  1FNU A;  3B9J A;  3B2F A;  2IDY A;  3ZGZ A;  2ONQ A;  1STE A;  3BVZ A;  4LTU A;  1VJK A;  1ET9 A;  2KWD A;  3R2I A;  3LB8 C;  2RMM A;  3Q8F A;  1TS2 A;  4ZRQ A;  5D3D A;  2L1A A;  3VRB B;  1IGD A;  3PO0 A;  3SFD B;  1R7S A;  2HDE A;  2WXF A;  2KAJ A;  2JU6 X;  1PGA A;  1P7E A;  1C76 A;  4ARI A;  2PTL A;  4C80 A;  1EWY C;  2BB6 A;  1L5P A;  3W5U B;  3AED B;  1KF6 B;  3IAS 1;  2Z8L A;  1DOX A;  1HEZ E;  2J4X A;  1TS5 A;  4B0E A;  5EE0 A;  1B1Z A;  1SE4 A;  3LYY A;  1GB4 A;  4KGR A;  4B0M A;  3GB1 A;  3Q8E A;  3ZJU A;  1JWU D;  2DYM A;  2DWQ A;  1EM7 A;  1C4A A;  1KTK A;  4WWM A;  1XLP A;  2LJI A;  2IGH A;  1RFK A;  4TQ1 A;  3CIR B;  5HI1 A;  3TSS A;  1EU4 A;  2KQ4 X;  1FRD A;  1PUT A;  1QOA A;  1FNW A;  1F2R I;  1VRA B;  3NVV A;  3AE7 B;  4KX6 B;  1KLU D;  2IGG A;  4Q2J A;  1MPE A;  2K22 A;  1E0Z A;  1GOZ A;  4A9A A;  1SBB B;  2WXL A;  1TY2 A;  3CWI A;  4MH8 A;  2XNA C;  3MP9 A;  1AW7 A;  1JQ4 A;  4EE2 A;  2L52 A;  4RGO S;  1VR9 A;  1QOG A;  2W55 A;  1FM0 D;  1GB1 A;  4JE3 B;  1LO5 D;  1WSP A;  5EE1 A;  2JQR B;  1FFU A;  2LUM A;  3Q69 A;  4OZB A;  4ARC A;  3RFZ B;  3AN1 A;  1XLQ A;  1DYQ A;  3U2S C;  1E9M A;  4ZOH C;  1VLB A;  1K51 A;  4KKJ A;  4OHJ A;  3UI3 A;  2N7J A;  1L4Z B;  3TEY A;  1OQR A;  1C77 A;  2LEK A;  3J9C A;  3NVW A;  2R61 A;  1JW9 D;  2LGI A;  2WDV B;  1QF6 A;  3H8H A;  3AEG B;  4RCO A;  1UGJ A;  2AX5 A;  2PMV A;  1QLB B;  2WXQ A;  1SB3 C;  1F77 A;  1J7A A;  4KKI A;  1F0Z A;  2V3N A;  1ENF A;  2OED A;  2LHD A;  1PFD A;  2ON8 A;  4AS1 A;  1YN4 A;  1IBX A;  1QOF A;  2V4I B;  1ET6 A;  4RF1 A;  1MI0 A;  5G5H A;  4ZHP A;  3AE3 B;  4N6E B;  1QT9 A;  2PVG C;  1RYJ A;  2DYO A;  2N0S B;  2G9H D;  2L32 A;  3BVG A;  3FIL B;  2K0P A;  2IJ0 A;  3MFG A;  3V05 A;  2QIL A;  1K53 A;  4NZL B;  4XE0 A;  2JYE A;  2H88 B;  1JWM D;  2MEK A;  4WUR A;  3AEE B;  4OZA A;  1ZDV A;  1D5X C;  3PZ8 A;  2DBY A;  4HEA 1;  3IT6 B;  4P6V F;  5EE9 A;  3MC0 B;  2VZK B;  1L6U A;  1SF0 A;  5HFY A;  2VZK D;  3AE1 B;  3NRZ A;  1TY0 A;  1QOB A;  4P16 A;  1JRO A;  2SAK A;  1NI3 A;  1N61 A;  1WRI A;  4OZC A;  3P4R B;  1D5Z C;  3P63 A;  1TKY A;  2KDM A;  2HTM E;  3W9C B;  1HQR D;  5BYQ A;  2Q5W D;  3HRD D;  2H89 B;  4IOI E;  1QIL A;  4L1B A;  1OQQ A;  1P7F A;  2JWU A;  3O13 A;  2RPV A;  1D5M C;  4H2A A;  3W5V B;  1XCT L;  4C56 C;  1ZXI A;  1ESF A;  3V3X A;  2L83 A;  1V1P B;  4YT0 B;  3KWL A;  1C78 A;  1HZ5 A;  3R8B A;  2MH7 A;  3DWG C;  1ACC A;  3T3N A;  1IUE A;  2D5G A;  3Q8C A;  4YTN B;  1OFF A;  1UNS A;  2FE8 A;  2WS3 B;  5H92 C;  1PGX A;  1I7H A;  1FNV A;  2E6X A;  1JAL A;  3AE5 B;  3IAM 1;  3NVZ A;  3PZ7 A;  4REZ A;  1NEN B;  1VZ7 A;  2V3P A;  3BK2 A;  2QJL A;  1YJJ A;  1YQ3 B;  2BBC A;  2PIA A;  1XF5 L;  3B2G A;  3N9Y C;  2E3T A;  1I4P A;  5AUI A;  2WDQ B;  1C79 A;  2QMT A;  3AMZ A;  3Q8B A;  1PYW D;  1JWA D;  4XWT A;  3L4P A;  1Y56 A;  1I4H A;  1C9F A;  2WXG A;  1GPX A;  1I4Q A;  3AM9 A;  4YTP B;  1WWT A;  3C8Y A;  1CZP A;  1QQR A;  1TJE A;  4XWW A;  5GXG B;  1TKE A;  4YSY B;  1L0V B;  1FD6 A;  4N58 A;  4WAF A;  4O1N A;  4MT5 A;  2WXO A;  3AE8 B;  3AE4 B;  2BB5 A;  3ABV B;  1XLN A;  1L0Y B;  5FK9 C;  2JX5 A;  2RDG A;  2RDH A;  4L23 A;  1I4R A;  1YNT E;  3W2D A;  5AUK A;  2JSV X;  1HZ6 A;  1FXI A;  1KLG D;  3NZ3 A;  4A8X C;  1SJH D;  1TYG B;  1UWM A;  2BS2 B;  4DQO C;  5EE3 A;  1C4P A;  1E6E B;  1JWS D;  2DLB A;  4N59 A;  4R3D A;  1D4B A;  1VDV A;  1FRR A;  2WXP A;  4WH4 A;  2G1E A;  1RWS A;  4US8 A;  4XDD A;  2IGD A;  4IKG A;  2Y5C A;  4M0W A;  1HA5 A;  2J53 A;  3BWU D;  4JX1 C;  3EUB 2;  1N5W A;  4UDU C;  5HHD G;  3P4P B;  1MHH E;  3MJ5 A;  4D2K A;  1YN3 A;  1DOY A;  2YEP F;  1J7B A;  2AQ3 B;  2KN4 A;  1A70 A;  3R2T A;  2AQ2 B;  2BS3 B;  3I9V 1;  4HRS A;  3IXS A;  3VRA B;  2I2Y A;  1DOI A;  1ROE A;  1SE2 A;  4NAW B;  4RH6 A;  2J52 A;  2KAC A;  4ZYS A;  4GDK B;  3ZQ4 A;  1Q10 A;  5TSS A;  3AE6 B;  3TEW A;  4OVZ A;  4RGT A;  1K52 A;  3TEZ A;  2PW9 A;  4TMA B;  1T6B X;  2CJO A;  1FEH A;  4L2Y A;  3AEB B;  4LLG M;  4AQ7 A;  1BUI C;  1ZUD 2;  1FCL A;  1MVK A;  1N60 A;  2W3R A;  3DWM A;  1KRH A;  1VZ8 A;  2Y5P A;  3HVD A;  1AYF A;  5C3J B;  3TUO A;  1YQ4 B;  3AH7 A;  3NUH B;  1XO3 A;  2CU3 A;  2GI9 A;  3NS1 A;  1FCC C;  4KGT A;  4MM3 B;  5BMG A;  2WU5 B;  3P1M A;  3T3O A;  3P4S B;  2MJE A;  3W1S A;  4A55 A;  2XN9 C;  1YMH E;  5BMI A;  1XCQ L;  2W3S A;  2JYT A;  4A90 A;  2FUG 1;  3BYY B;  1XEE A;  2BTE A;  2NTS A;  2I38 A;  3U52 E;  1GAQ B;  2W54 A;  5H8Y E;  1SIJ A;  3AB5 A;  3BVM A;  4WIP A;  1SEB D;  1WXQ A;  2GB1 A;  4ZRP A;  4YTM B;  3LXF A;  4C7Z A;  3SFE B;  1YN5 A;  1E7P B;  5T8I A;  1ZP0 B;  4JWU C;  3P42 A;  1MHX A;  5D7G A;  3FIL A;  4OW0 A;  1AN8 A;  3U7Z A;  2TSS A;  3ZYY X;  4ZHO A;  4LK0 M;  2V0G A;  2GRI A;  1FFV A;  1RM6 C;  4USA A;  4TSS A;  2KMM A;  2X38 A;  2BW2 A;  3WCQ A;  2N9L A;  2LMC A;  3VR8 B;  2WXM A;  3BII D;  4HJG E;  2LFI A;  4RF0 A;  1WYG A;  5E6J A;  2OHF A;  1F2R C;  1QKZ A;  1ZDX A;  3SR6 A;  4GLS C;  2WXH A;  1VZ6 A;  1DGJ A;  1TKG A;  3GS2 A;  1XLO A;  5BMH A;  3ZJV A;  1FMA D;  1SJE D;  2AQ1 B;  1JRP A;  5MPO A;  1IBX B;  2WDR B;  4FXC A;  3EA6 A;  1ZOY B;  5HG2 A;  3KQ4 A;  1NEK B;  4RNA A;  1L0X B;  1D6E C;  2YEP B;  1E10 A;  3P4Q B;  4YWG G;  2M0A A;  2M56 B;  5LNK 1;  1FIQ A;  2INP E;  2JXT A;  5JXV A;  4YSX B;  1IGC A;  4HKZ E;  2J42 A;  4J3O D;  1M4V A;  3URY A;  2BYT A;  4GDL B;  4C7Y A;  5I4D A;  4HKQ A;  3I57 A;  1CJE A;  1V1P A;  2WLB A;  3BK1 A;  3AEC B;  1XXG A;  4RGM A;  4US9 A;  2BT6 A;  5BYR A;  4PT5 A;  5FKA C;  2K3U A;  4DXF A;  1JCK B;  3VQI A;  1NYQ A;  3U4E G;  4JPS A;  4ITK A;  1TS4 A;  1T5X D;  4XDC A;  1FO4 A;  5G5G A;  5BYS A;  2M19 A;  1SE3 A;  1WGK A;  2EKI A;  2QEJ C;  2INN E;  2WXI A;  1FXA A;  5FR3 A;  3ETR A;  1JWB D;  1J7C A;  1ZE3 D;  1KH0 A;  1L6V A;  2NMQ A;  1I4X A;  2JZP A;  1EWC A;  1UUP A;  1SXT A;  2K5P A;  2CJN A;  3FAH A;  3GP7 A;  4WQM A;  1JML A;  1K50 A;  1T3Q A;  3KWV A;  4KGS A;  4JWS C;  1C4C A;  2PLP A;  4YXD B;  2WXN A;  2K9X A;  2ICI A;  2WXR A;  4YSZ B;  1YJI A;  3NVY A;  3AE2 B;  4CQN A;  4IDI A;  4RFB A;  1CK1 A;  3MHZ A;  3HUI A;  3IT4 B;  2WP9 B;  2N9K A;  4RGN A;  2EEL A;  2QSD A;  1AWD A;  1L4D B;  2W82 A;  1N62 A;  3E56 A;  3EGR A;  1N5X A;  1NVI D;  3BZD B;  1KFY B;  3AV8 A;  2LHE A;  2ZW1 A;  3AE9 B;  1EU3 A;  3BYT B;  4TQ0 A;  1PGB A;  1B9R A;  1CQV A;  4NJC A;  2Y3A A;  2ZW0 A;  2WXJ A;  2NTT A;  3OWE B;  4HRO A;  2IPK D;  1BXT A;  1NYR A;  2MJ3 A;  2WXK A;  1I4G A;  2BS4 B;  3ZJT A;  3AEA B;  3SEB A;  2FBW B;  3VR9 B;  2QIE B;  3TEX A;  1TS3 A;  4A6Q A;  1V1O A;  2MJD A;  2WU2 B;  1UWX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...