2K3UA

Structure of the tyrosine-sulfated c5a receptor n-terminus in complex with the immune evasion protein chips.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
91
structure length
91
Chain Sequence
NSGLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELLGKMYKTYFFKKGESKSSYVINGPGKTNEYAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Chemotaxis inhibitory protein
publication title Structure of the Tyrosine-sulfated C5a Receptor N Terminus in Complex with Chemotaxis Inhibitory Protein of Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus str. newman
total genus 20
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2008-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11434 CHIPS Chemotaxis-inhibiting protein CHIPS
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.390 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2k3uA01
1XEEA 2K3UA
chains in the Genus database with same CATH superfamily
2KDFB 3DBSA 2L3ZA 2CKHB 4HCNB 2MA9B 2GMIC 3N1YC 2I38A 3ZXVA 1UF0A 1RM6C 4XDDA 2MLBA 3Q3MC 3RZWC 1WJUA 1C77A 1HXYD 4RF0A 2LGYA 4AWJA 3CMMB 4WJOA 2BWES 3AEFB 4GOCA 2KWVB 3IAM1 3KYDD 1BUIC 1WF9A 3BVZA 2KTRA 3AE5B 3BYTB 3CF6E 1GC6A 1FMAD 3V6EB 1A70A 2PE6B 3ZO5B 1B9RA 1IYFA 2ZVNA 5AZFA 5DPTA 2E6XA 1E8WA 2K5PA 1WXVA 3AM9A 2AQ1B 1CK1A 5D2MB 1KLUD 3FILA 2WXFA 2BS3B 4K7WA 1SGHA 1ZW7A 3VDZA 3D32A 4EZJA 5KHOA 1XEEA 3A1QA 4WQMA 2RR9A 1QF6A 4RM9A 1E8YA 2PE9A 1JRUA 2BW2A 2VRRB 3AU5A 2V3NA 4HJKA 1IBXA 1WYWB 3I3TB 3ZNID 4MSQB 1V1PB 4JE3B 1SEBD 2D3CA 1SJED 3AE2B 1DGJA 3DBRI 1RWSA 2RDHA 5IAAC 5C2TB 3PTFC 4GDLB 2C7NB 2DYMA 1YNTE 3FAHA 1VD2A 3E56A 1E8XA 4WWMA 1MI0A 3HVDA 2HTHA 1VR9A 2LXCA 1WY8A 3DBHI 3L16A 4NAMA 2KD0A 3DVNV 3MHZA 2LUEA 2PVOD 3B2FA 3SHQA 2WHIA 3IAS1 1EO6A 1V97A 4XX5A 1XLOA 3ZTCA 1WI0A 2GBKA 4I6LB 4IM2A 4DXGA 1XLNA 5AZHA 1TBEA 3ZRFA 1E0ZA 4HROA 1E9MA 4P1CC 4LNOA 3DBLB 4IDIA 2ZPNA 3Q8AA 4IC7B 2MEKA 4A20A 1GG3A 3A9JB 1VRAB 2MQJA 5AEKB 4WJPA 3W5VB 4KKIA 3JYUA 2IO3B 4YXDB 1F9JA 3AH7A 1QOGA 3U4EG 2MSED 3SD5A 2BS4B 1OFFA 2IGDA 4ANUA 2LHEA 2JU6X 4RH6A 3HHMA 1IGDA 2KQ7A 4JPSA 1MG8A 4ZYNA 4KX6B 2NBWB 1OEYJ 1WJNA 4G11A 2DX5B 1TYGB 2INNE 4XE0A 4US9A 2JF5A 1SSNA 4HJGE 1ET9A 4IUMB 1P1AA 2KLCA 3L4PA 3P4QB 5CX3A 1K50A 1PGXA 4KIKA 4N6EB 1YQ4B 4HWIB 3Q2AC 2QEJC 4WIPA 2I2YA 5DPWA 1KM7A 3QCAA 2MBBB 1KOTA 5HI1A 3NZUA 4KSLC 4II2B 2K9XA 3N1ZC 3VR8B 1X1MA 1FRRA 4LLGM 4X57B 2BQQA 3I5JC 5BO4B 5CHFA 2DWQA 3DQVA 2N7DA 4WWOA 3RNGC 2HJ8A 2JYEA 4C00A 3HM3A 2QIEB 2WWZA 4ASWC 3APFA 3NVVA 3VH3B 1V5OA 4GB9A 1MHHE 1SE4A 1EF5A 1FEHA 2M0XA 1SIFA 5JH5C 4Q2JA 2B76B 1EU4A 2JXTA 3ML8A 2LGIA 3KYCD 3ZQ4A 3P2BA 3GB1A 3N1XC 2CJOA 5MPOA 1T6BX 1WH3A 4W9CA 4N9F4 2L1AA 3H8HA 3C19A 3M95A 3V61A 3QARA 3Q8CA 2JSVX 3IXSA 3M62B 1WXQA 4MJSB 3AMZA 1TKGA 3RN9C 2XEWA 1L5PA 2D10A 4W9EA 1C9FA 2BS2B 1JWMD 4N59A 4EKUA 3NRZA 3ZJVA 1VCBA 2M0AA 4GDKB 2N1WA 3AEAB 3WAMA 1AN8A 1ZUD2 1JRPA 4M8MA 3PSEB 3VQIA 4WJNA 1FD6A 2L0TA 3HK0A 1FNUA 3WCQA 2KTFA 2ZW1A 1ZDXA 1VJKA 3RUIB 2WGSA 2LRWA 5TSSA 2DNFA 2DZIA 3AEDB 2D5GA 1Q5WB 3W1YA 2WDTB 3OG5A 4A3PA 2N9XA 3W5UB 1I4QA 2BTEA 1M4VA 2V9HA 4KVGB 1RRBA 2NTSA 4L1BA 4XGAB 1HTQA 5LLIA 3X0WA 3AULA 4NPNA 3OJ4B 4MSMB 1GNUA 2A5UA 1F0ZA 2WDQB 4L23A 4DBGA 2IZVB 4GU2A 2WDVB 4YTNB 3PV1A 4WAFA 1YQ3B 3KWVA 1JWAD 5BYRA 2ZJDA 4KZCA 4HRSA 4ZRIA 2LWPA 1GUAB 1R4MB 2C9WB 5FKAC 1P0RA 4MH0E 2KNBA 1L2NA 1ZP0B 1H8CA 1TIFA 3B0AA 2W9NA 3AE7B 4K81A 2G4DB 4KV2A 2VZKB 1DOXA 4R3DA 1LM8B 4RGOS 5HFYA 4W9KA 5EDSA 1S1QB 5KHQA 1XLQA 2PKOA 4HDQA 2RSUA 1DOYA 2XN9C 4LNIA 2DLBA 1ISNA 1R4NB 1IGCA 2ACZB 5E6JA 2WLBA 1UNSA 4IWPA 3PRZA 3DWMA 2O2VB 2KAJA 2GBMA 1EWCA 1YN3A 4HPMB 1SB3C 4YTMB 3AEEB 1D5MC 2QDFA 3MFGA 3MP9A 2KK8A 3T3OA 2CU1A 4LNNA 3U30A 1ZOYB 2ZNVB 1J7CA 2K3UA 2RMMA 1PYWD 2KDEB 1F77A 4EFOA 3TL5A 2INDC 4F8CB 1NYQA 1TS5A 3VHTC 4S0RA 1TKYA 2BT6A 3CSFA 3NVYA 2X38A 1YQBA 3GZNB 2V3SA 2KJ6A 3TEXA 2KOXA 1ROEA 1WGKA 3HVZA 4RNAA 3HUIA 2LJIA 3AE6B 2KWDA 3KVFB 3RT3B 3JSVB 4XYCA 3RNBC 1ZGUB 4A8XC 4E3CA 5JZEB 1RAXA 3MC0B 4RFBA 2IGHA 1MPEA 2CS4A 4J6IA 4BOSC 1VZ7A 1WX7A 1UH6A 1NBFC 3O13A 2ZEQA 2GI9A 3UI3A 4DXFA 3N20C 4ANVA 4EUTA 4CYEA 1UUPA 4OVVA 2LASA 1TGZB 2LEKA 4UDUC 1QILA 2KQSA 3AU4A 1ZDVA 1TY2A 1JMLA 5D7GA 1LFDA 3Q6BA 1EWYC 3TEWA 1AW7A 2FAZA 4CQNA 4NAWB 2JQRB 4W9IA 3QX1A 2G3QB 3UINB 1TS2A 2G1EA 3C0RB 4IM3A 2KMMA 2QHOA 3EFCA 5G5GA 2V4IB 1Q10A 3DWGC 1V81A 2N7EA 3U8ZA 1P3QU 3AE4B 1ACCA 1NI3A 2Z8LA 3A9JA 2BPSA 5CHWA 2GLSA 2LJ5A 4MELA 4LDTB 3GS2A 4GGQA 4MGIE 1T0QC 1OEYA 2ZW0A 3TCAA 2KMAA 2KDBA 3ZW3A 1VZ8A 1PUTA 3U52E 3GOEA 3H7PB 4S17A 2Y5BB 3DDCB 4OW0A 1CJEA 3UIPB 4MGKE 3NG0A 2N0SB 4F1SA 4DDID 1N60A 1WJ6A 1L7YA 3L0WB 2VZKD 4USAA 2CHWA 2J0JA 4JQWC 4M0WB 3EECA 1E7UA 2CHXA 3LDZE 5H92C 3Q3FA 3VRAB 3RYTA 2HD5B 4REZA 1T5XD 3HRDD 3RZFA 1WX9A 2JY6A 3OLMD 1Z5SB 4XDCA 5GXGB 4ZRPA 5AUKA 2INPE 3QK0A 1GC7A 4W9HA 2L76A 4KGRA 2WS3B 5JXVA 3RNCC 2GBJA 3PS6A 4I6PA 5EE9A 4KZ0A 2BWFA 4EZLA 3W9CB 3R7RA 4EEWA 2OJWA 1EU3A 1WM2A 3ONSA 1TZOA 5HG2A 4BBNF 2FCQA 3P42A 4NJ7A 4HPLB 2LD9A 1TS3A 2C7HA 1Y56A 4H2AA 2NPTB 3BZDB 1C79A 2KKCA 2O6VB 3GP7A 2RDGA 5G55A 4HLEA 3DHIC 1PQSA 2XNAC 2L8JA 4TKNA 2PW9A 3M3JA 2V3PA 1E90A 1OQYA 3ZIMA 1MHXA 3R2TA 4C7YA 1OQQA 2AQ3B 4MJSA 1N6ZA 1WRDB 1KLGD 3H1UA 2W82A 1I4HA 2BF8B 2RPVA 1WGDA 1BMLC 3MTNB 1V49A 4GDKA 3NS8A 3AB5A 1HE8A 2J0MA 3PPAA 1QLBB 4ZYSA 2JPHA 3ZYYX 2FUHB 4P16A 1FIQA 3ECIA 1WR1A 1PGBA 2WXQA 2MBQA 2HTME 2NMQA 1H4RA 3NVZA 2WXPA 1FCCC 2KX3A 4ZRKA 3QHTA 4G3XB 4NZLB 2KC1A 1V1OA 1CZPA 4GXBA 3PHWB 2DBYA 2BGFA 3RMKC 2KFJA 1WR6E 3TJPA 5GMVA 3OJ3A 5IOIA 4NQLB 1STEA 3K9PB 3PZ7A 1JROA 3VTUA 3AE3B 1L0YB 4M8NA 1GAQB 4B0EA 4EE2A 4HDOA 3VUXA 1OQRA 4ZRJA 2PJHA 1KH0A 1K52A 3ETRA 2KQ4X 1JWSD 4GIVA 3L13A 4LDTD 1M94A 2BB5A 5AUIA 5HHDG 2FIDA 1HQRD 4A90A 1XXGA 3JVZX 2L00B 1IP9A 2FIFA 1UZXB 1XF5L 3P4RB 2JX5A 3BK2A 5D94A 3N30A 3VTWA 2PIAA 4M02A 1I4RA 1YOVB 2UU7A 1V9JA 2WU5B 2WX1A 1I4PA 1K53A 4C7ZA 1F1HA 1Z2MA 4BAXA 2BYEA 3Q69A 3PGEA 1RFAA 2KFKB 3AE1B 3LB8C 4XWWA 4ACFA 2O2VA 2IYDB 3IFWB 1E6EB 3QWZB 1UBQA 1JW9D 3WALA 2K1FA 2LVPA 4KGTA 1R4MI 2CJNA 1YD8U 3UQAA 1BXTA 3TBLD 2OJRA 3A4SC 2KJHB 4BVUC 1FM0D 4ZDVA 2JWUA 3MJ5A 4E74A 2GB1A 3I9V1 4A6QA 5C3JB 2GBNA 1N5WA 1D4BA 3ABVB 2O6VD 1C4PA 2Y3AA 3QQ8B 4MEMA 4US8A 4JGHB 2R2OA 1KTKA 2Y5PA 3FKYA 4L2YA 2EMTA 4PT5A 3EFUA 2N7JA 1HZ5A 4FHJA 1TZ1A 2W55A 2WNMA 1QKZA 3JSVA 2M19A 1GB1A 2JVCA 1JWUD 2JZPA 5DPSA 1KFYB 4W9DA 2M4NA 4LNFA 2IO0B 1P7EA 2Z0EB 1L0VB 4ZHPA 1WX8A 3SDLC 1YJ1A 2K25A 4II3B 3KUCB 3CIRB 3ZNGC 1GJZA 1FXAA 1A5RA 2JRIB 1YN4A 2LZ6A 3BY4B 4IWOA 3GZNI 4MT5A 1OTRB 1WZ0A 1XO3A 4I6NB 4C56C 1D5ZC 1GOZA 2MBEA 3A9KB 1N63A 1MVKA 3ZGZA 4GLSC 2NCNA 2ONQA 3P4PB 4TV3A 4HK2A 1TTNA 2CU3A 3PZ8A 3B2GA 1LO5D 2ON8A 4TQ1A 3OAWA 4P6VF 5L95C 4GN1A 2KX0A 2DZMA 4GMVA 2N9PC 4AP4C 3ZJTA 3APCA 3NHEB 2DAFA 1TJEA 2K22A 4B9KA 4FHKA 2ZPYA 4K7UA 2AL6A 2WQYB 4WURA 3PT2B 3H7PA 4KDIC 2L52A 3CSTA 4K7SA 2C60A 3UF8A 4W9GA 2R61A 1FFUA 2W54A 2FNJB 3L17A 3VTVA 5IKCM 1ENFA 1EM7A 4FJYA 4JX1C 4BFRA 5FR3A 1LGRA 2J52A 4YT0B 3EC8A 4M0WA 3IVFA 3I57A 4RM8A 3SU8X 3ZJUA 2PVGC 1UD7A 2FBWB 3LJ3A 4B6WA 4IM0A 4AJYB 4BKGA 2MP2B 5BYSA 3PLVA 2EKEC 3BVGA 1G6JA 1FFVA 1FPYA 3TIXA 2JYTA 2FCNA 1XQQA 1XT9B 2KVRA 4O1NA 4F7ZA 4B0MA 2H88B 3A4RA 2ICIA 3V6CB 4D2KA 3MC9A 3NJTA 2B3AA 1L6UA 3AV8A 4HXDA 5EE1A 4PYUA 4TSSA 1FCLA 2D3GA 3H9DA 3JW0X 1UGJA 1WGHA 3B9JA 3B08A 1J19A 4URKA 2R2QA 1ZPSA 1YIWA 4DWFA 2NPTA 2BKFA 2KC2A 4MM3B 4K3CA 4LK0M 2O6VA 1NI2A 3HM6X 4P7IA 4PYZA 4A9AA 4GSWA 3DVGY 1I7HA 3BINA 1V1PA 3AE9B 4MACA 2BYVE 3PVLA 5J17A 3N3KB 2KYWA 2WYQA 5BMGA 3N32A 4NJ6A 5FK9C 4GDLA 4BOZB 1UELA 4JLCA 2M17A 3ZVVA 1C3TA 4MGZE 3ZNZB 4DHZB 1SE2A 4TQ0A 3ZLZA 2J7QB 4LJOB 1YJIA 2IO2B 4RGMA 2N4FA 1Q1OA 1J7BA 4BZAA 2RGFA 3VFKA 1KRHA 5AZGA 3R2IA 3W1SA 2EKIA 1WIAA 1SF0A 4XZ4A 1WXAA 4HKQA 3Q8BA 3ML9A 3WANA 1K8RB 1V86A 1YX5B 1LXDA 4P1BC 3ZKJC 1T0YA 3NVWA 2OEDA 1VLBA 1N61A 2N9LA 3BVMA 2OHFA 3R8BA 4KDLB 2LRUA 5LNK1 1E7VA 3Q8FA 1ESFA 4DQOC 2MHJA 1E7PB 5BMIA 4BBNC 3NZSA 1N5XA 2REXA 2Y5CA 1ET6A 2X8XX 2D3AA 3IT4B 3ZDMC 2BBCA 4CO7A 2JWZA 2MRPA 2WXNA 1JWBD 3KWLA 1ZKHA 1VDVA 2M1MA 3PRMB 1V80A 2KN4A 4KGSA 1JALA 4ARCA 1WMHB 5EE3A 1V5TA 4JL9A 1XD3B 3DBLI 1TKEA 2GBRA 4RF1A 3L10B 4IG7B 2JT4B 4AJWA 4HCPB 4EOYA 1K51A 1NYRA 1L4ZB 1RFKA 2N1VA 2FCSA 3C8YA 3WAOA 1UWMA 3DOWA 4C4VB 2K8HA 1TY0A 4HKZE 3R7QA 3ZRCA 2KFKA 2W3SA 2K6QA 4MDKE 2IY1B 1LQBA 1WYGA 3AXCA 2KVZA 1JQ4A 4WWNA 4G50A 2L7RA 1XCQL 2WXRA 2LUMA 2NBVB 3NS1A 2KLGA 2LGSA 1TT5B 2SEBD 2UYZB 2KHWB 5FR6A 3IG3A 4B95A 2KDMA 1JCKB 1ZE3D 3B1LX 1WZ3A 3QAQA 3SEBA 1P98A 4WWPA 5C23A 3PRPB 3MJWA 1C4AA 4RMAA 2DZKA 1T0SC 3DHHC 4ZRQA 2JZZA 2NS5A 3QIJA 2KN5A 2A4ZA 4W9LA 2V4LA 3K9OB 3KUDB 2AWTA 4FADA 2I1JA 1PDXA 1WGGA 1NEKB 5E6PA 3URYA 4PK1A 3M63B 1T3QA 5H8YE 1PFDA 3KW5B 3KUZA 2L32A 1UGMA 4JIOU 3T8MA 2D11A 2D2QA 5D6JB 3P63A 1BT0A 4NY0A 3TUOA 2KWCA 4C80A 1S3SG 3E9SA 3DHGC 4AOFA 3RULA 1SE3A 3Q3OC 2WDRB 1C76A 3O65B 3RCZA 1B1ZA 3W2DA 3PHXB 4HPPA 1WWTA 2KDIA 4FN2A 2FE8A 1L6VA 1N62A 1SE9A 2TSSA 4FA6A 1T0RC 3BYYB 3EUB2 2L83A 2XK5B 3GE3C 3DPDA 2H89B 2KT7A 3A9KA 2PLPA 3T9LA 1E8ZA 3PZDA 1KF6B 2HDEA 1WRIA 3AE8B 2GRIA 2PPHA 4AS1A 5TR5A 2DZJA 2MJEA 4OZAA 4BKTA 3NY5A 4W9FA 2IY0B 2YVCA 3AI5A 5J2RA 1SXTA 1HEZE 3UQBA 2DYBA 3GE8C 5HKHA 1YJJA 3RD2A 3TEZA 2PMVA 2HE7A 3R66C 3DVGX 2Q5WD 2ZVOA 4YSYB 3A33B 2AQ2B 1MFWA 2AYOB 4LCDE 2LFIA 2WXHA 4FJZA 2VH1A 2L05A 3AEGB 4ZOHC 2BVCA 2K39A 3KQ4A 4WJQA 2LVQA 4PS3A 4OVUA 3DBRB 1RYJA 1WGRA 2KTRB 3U7ZA 2LMCA 4K1RB 3W1SC 2LHDA 5BYQA 1IPGA 2KMCA 1QT9A 3P1MA 1L0XB 3N9YC 5IO9A 3DBHB 4IOIE 1TS4A 1V8CA 4G0NB 2JRHA 3FILB 3PLUA 2G45B 5DPRA 3VR9B 4HVBA 1CMXB 3RNAC 3V05A 3S2AA 2L0FA 4KSKC 1WSPA 3Q3NC 1UWXA 3A1QB 3AN1A 3NZ3A 2KWUB 3BK1A 4NNJB 1L4DB 3ZTDA 1J0GA 1FO4A 2EELA 2MH7A 2MP2A 1IBXB 5IN7A 4PS7A 1DYQA 4OVZA 4YTPB 4MGYE 3VH4B 3PO0A 2WU2B 2D3BA 1F52A 4RCOA 2AEHA 3TEYA 3VVWB 1YMHE 4WQOB 1FNVA 1QOBA 1R4NI 2K8BA 1J7AA 3NOBA 5CHVC 2M56B 1FXTB 4FBJB 2QJLA 2IPKD 4FLHA 2UWQA 3X23A 4QAYA 5EE0A 3ENEA 2ASQA 4ICVA 4OZBA 2MJDA 1WGYA 3BWUD 3EA6A 1AWDA 4MM3A 2WXOA 4YSXB 4BKSD 1Y8RC 2G9HD 5E6NA 1HZ6A 3V62A 4ARIA 2WXJA 2LGDA 1HA5A 1VZ6A 3FC4A 2J42A 3RNFC 2M8SA 3NUHB 3BIID 3V60A 4PS8A 4LNKA 4YL8A 3I63C 3AECB 2NR2A 2E3TA 2WXLA 3IBEA 4E71A 2XBBC 1D6EC 2ZCBA 2ZZPB 5JHBA 2AL3A 2WXMA 1NENB 2G4SA 4OZCA 2YEPB 1D3ZA 3IHPC 2CR5A 1C4CA 1J8CA 1I35A 3Q3JA 3J9CA 5L83A 4NAWA 2IBIB 2DHZA 1E5WA 4HEA1 1I4GA 4EZKA 1F2RI 2PEAA 2WXKA 4DHZE 4AQ7A 1C78A 4MH8A 1QOFA 4M01A 3DVNU 3ZUNA 3SR6A 3RI7C 2NVUI 2CHZA 4DHJB 1DOIA 1U4AA 1FRDA 1RLFA 1E10A 5C1ZA 4IWQA 4NQKE 2ZCCA 3PREA 1ZXHA 4YSZB 1HTOA 2IGGA 4AUQC 1SIJA 4ICUA 4ZHOA 4KIKB 3VAWA 1ZXIA 2K6DB 2QCZA 1FXIA 2KACA 3L54A 3R3MA 2DAJA 1V6EA 1IUEA 5LXIB 2MCNB 1AARA 2QILA 3ZXRA 2MJ3A 2IJ0A 1MG4A 2D07B 1EF1A 2EMSA 4WH4A 1QZEA 1WE6A 5CTRC 3DCGA 2QSDA 4LJPB 3UIOB 2INCC 3SFDB 1EUVB 1XLPA 3LXFA 4TUUA 5T8IA 1Q0WB 4TMAB 1WMHA 5IA7A 2SAKA 4FJVB 2BKRB 2J0KA 2FUG1 3VRBB 2Z0DB 1FNWA 1YN5A 4DDGD 3L08A 4DK5A 2C7MB 2N9KA 1KLVA 3EHVA 1C1YB 3CWIA 4IW0A 2LGXA 2RDBC 1QQRA 2K8CA 2VH2A 3AEBB 3MHSD 4ITKA 3VXWA 2WXIA 1KJTA 5DCNA 3TSSA 2C5LC 1WE7A 2QC8A 4C4VA 3APDA 2KANA 2RD0A 2Z59B 4N58A 5J18A 1WJ4A 2LXAA 3WIMA 4FXCA 2GOWA 1NDDA 5LXHA 4W9JA 2HJ1A 2KZRA 2W3RA 1CQVA 1GB4A 5BMHA 2IDYA 2MX2A 2BB6A 3UGBB 3H7SA 2J4XA 2JXXA 3RPFC 5G5HA 1WXSA 3VUYA 3U7DA 2WX0A 2NTTA 3LYYA 2MW5A 3Q8EA 3ALBA 3KLSX 1P9DU 3VUWA 1WM3A 2BYFA 1GPXA 1NVID 3H6NA 1P7FA 1I42A 1MJDA 4K3BA 1WFYA 4BKSA 1D5XC 3QC8B 1QOAA 5G2NA 4IKGA 2OOBB 2QMTA 2N9EB 2YLMA 2DYOA 5D3DA 3Q14C 3ZNHB 4ANXA 5I4DA 4J3OD 5D3IB 2JZ3B 2RPQA 3T3NA 2YEPF 1XCTL 4XC2A 5E6OA 2WP9B 4FULA 1SJHD 4JWSC 3P4SB 3RFZB 3U2SC 2NBUA 4M00A 3WAPA 4A55A 2FCMA 4RGTA 3V3XA 3WA0A 1R7SA 1AYFA 2ZNVC 1V2YA 2LVOA 3QJZA 2MBOA 3EGRA 3RNEC 3QA8A 4OHJA 1YX6B 1UBIA 2K0PA 4LTUA 2V1YA 4RGNA 2MBHA 2WXGA 3OWEB 2I1KA 4KKJA 4CHKA 1SBBB 2IO1B 3HIZA 3TMPB 2PTLA 1PGAA 2AX5A 2MWSB 5IP4D 4WAAA 2JUOA 3SFEB 3ZDTA 2KXJA 5JHAA 4ANWA 4JWUC 1F2RC 1I4XA 1OGWA 2J53A 2LI5A 3KH0A 4NJCA 2KO3A 2XK5A 2DENB 4XWTA 4YWGG 2BYTA 2KJRA 2V0GA 3IT6B 4DHJD 4A3OA 3MC8A 4DXAB 1WXMA
chains in the Genus database with same CATH topology
4US8A 1ZOYB 3E9SA 1KTKA 1SE3A 2Y5PA 4L2YA 4PT5A 2WDRB 1J7CA 2I38A 1C76A 2N7JA 1HZ5A 2K3UA 2RMMA 1B1ZA 1PYWD 3W2DA 1F77A 1WWTA 1RM6C 4XDDA 2W55A 2FE8A 1L6VA 1NYQA 1QKZA 1N62A 1TS5A 2WNMA 2M19A 1TKYA 2TSSA 2BT6A 1GB1A 3BYYB 3NVYA 2X38A 1JWUD 3EUB2 2JZPA 2L83A 1C77A 1HXYD 1KFYB 4RF0A 2H89B 1P7EA 2PLPA 1L0VB 4ZHPA 1KF6B 3TEXA 3AEFB 2HDEA 1WRIA 3AE8B 3IAM1 2GRIA 4AS1A 1ROEA 2MJEA 4OZAA 1BUIC 3BVZA 3AE5B 3BYTB 1WGKA 3HVZA 1SXTA 3CIRB 4RNAA 3HUIA 1FMAD 1HEZE 2LJIA 1A70A 3AE6B 1YJJA 1FXAA 2KWDA 3TEZA 2PMVA 1B9RA 2Q5WD 1YN4A 4YSYB 2E6XA 2AQ2B 4A8XC 2K5PA 4MT5A 3AM9A 3MC0B 2AQ1B 1CK1A 4RFBA 1XO3A 4C56C 1KLUD 2LFIA 1D5ZC 3FILA 2IGHA 2WXFA 2BS3B 2WXHA 1GOZA 1MPEA 1N63A 1MVKA 3AEGB 4ZOHC 1VZ7A 3ZGZA 4GLSC 2ONQA 1XEEA 3P4PB 3KQ4A 4WQMA 1QF6A 3O13A 1RYJA 2GI9A 3U7ZA 2BW2A 2CU3A 2LMCA 3UI3A 4DXFA 3PZ8A 2V3NA 2LHDA 3B2GA 1LO5D 1UUPA 2ON8A 4TQ1A 5BYQA 4P6VF 1IBXA 1QT9A 3P1MA 2LEKA 4UDUC 1L0XB 3N9YC 1QILA 4IOIE 1TS4A 1ZDVA 1V8CA 1TY2A 1JMLA 5D7GA 1V1PB 3FILB 3ZJTA 1EWYC 3TEWA 1AW7A 3VR9B 3V05A 1TJEA 4JE3B 1SEBD 4CQNA 1SJED 1WSPA 3AE2B 2K22A 1DGJA 1UWXA 2JQRB 4NAWB 1RWSA 2RDHA 3AN1A 5C2TB 1TS2A 2G1EA 4GDLB 3NZ3A 2DYMA 3BK1A 1YNTE 2WQYB 3FAHA 4WURA 3E56A 1L4DB 2KMMA 4WWMA 1MI0A 3HVDA 1FO4A 5G5GA 2EELA 2V4IB 2L52A 2MH7A 1Q10A 3DWGC 1VR9A 1IBXB 2R61A 1DYQA 4OVZA 4YTPB 1FFUA 3AE4B 1ACCA 1NI3A 2Z8LA 4NAMA 2W54A 3PO0A 1ENFA 3MHZA 1EM7A 2WU2B 4JX1C 3GS2A 2PVOD 3B2FA 4RCOA 3IAS1 1V97A 3TEYA 1XLOA 5FR3A 2J52A 4YT0B 1YMHE 4M0WA 1FNVA 1QOBA 1J7AA 3I57A 3ZJUA 2M56B 2PVGC 2ZW0A 4DXGA 1XLNA 2FBWB 2QJLA 1E0ZA 1VZ8A 1PUTA 3U52E 2IPKD 4HROA 1E9MA 4OW0A 1CJEA 5EE0A 5BYSA 4IDIA 3Q8AA 2MEKA 4OZBA 2MJDA 3BVGA 2N0SB 3BWUD 3EA6A 1FFVA 1AWDA 1N60A 1VRAB 2JYTA 2WXOA 4YSXB 2VZKD 4O1NA 4USAA 2G9HD 3W5VB 1HZ6A 4B0MA 2H88B 4ARIA 2WXJA 4KKIA 2ICIA 1HA5A 4YXDB 4D2KA 1VZ6A 3AH7A 1QOGA 2J42A 3FC4A 3U4EG 5H92C 1L6UA 3NUHB 2BS4B 3AV8A 3BIID 1OFFA 2IGDA 5EE1A 3VRAB 2LHEA 4REZA 2JU6X 4TSSA 1FCLA 3AECB 1T5XD 3HRDD 4RH6A 1IGDA 2E3TA 1UGJA 2WXLA 4JPSA 4XDCA 3B9JA 1D6EC 5GXGB 4ZRPA 4KX6B 5AUKA 2INPE 1ZPSA 2WXMA 4MM3B 4KGRA 2WS3B 5JXVA 4LK0M 1NENB 1TYGB 2INNE 4XE0A 4US9A 5EE9A 4A9AA 1SSNA 4OZCA 2YEPB 1I7HA 1V1PA 1C4CA 4HJGE 1ET9A 3AE9B 4MACA 3J9CA 3W9CB 3L4PA 3P4QB 1K50A 4HEA1 1I4GA 1EU3A 1PGXA 5BMGA 5FK9C 1F2RI 1TZOA 5HG2A 2WXKA 4AQ7A 4N6EB 1YQ4B 1C78A 4MH8A 1QOFA 3P42A 2QEJC 4WIPA 2I2YA 1SE2A 4TQ0A 1TS3A 3SR6A 1Y56A 4H2AA 5HI1A 1YJIA 3VR8B 2K9XA 3BZDB 1C79A 1DOIA 1FRRA 4LLGM 4RGMA 3GP7A 2RDGA 1FRDA 2XNAC 1J7BA 1E10A 2DWQA 2PW9A 1KRHA 3R2IA 2V3PA 2JYEA 1ZXHA 4YSZB 3W1SA 2IGGA 2QIEB 2EKIA 1MHXA 1SF0A 1SIJA 4ZHOA 3NVVA 1ZXIA 3R2TA 4C7YA 4HKQA 1OQQA 2AQ3B 3Q8BA 1FXIA 2KACA 1MHHE 1IUEA 1SE4A 1KLGD 1FEHA 2W82A 1I4HA 2QILA 3NVWA 2MJ3A 4Q2JA 2OEDA 2IJ0A 2RPVA 1VLBA 1N61A 2B76B 2N9LA 1BMLC 1EU4A 2JXTA 2OHFA 3BVMA 3R8BA 2LGIA 3ZQ4A 4WH4A 3GB1A 5LNK1 3Q8FA 1ESFA 2CJOA 4DQOC 5MPOA 3AB5A 2QSDA 1T6BX 1QLBB 4ZYSA 3SFDB 1E7PB 2L1AA 3ZYYX 1XLPA 3H8HA 5BMIA 4P16A 1FIQA 3LXFA 1PGBA 5T8IA 2WXQA 1N5XA 4TMAB 2HTME 2Y5CA 2NMQA 3Q8CA 3NVZA 2WXPA 2JSVX 2SAKA 3IXSA 1WXQA 1ET6A 1FCCC 2FUG1 3IT4B 3VRBB 3AMZA 1TKGA 2BBCA 1FNWA 1YN5A 4NZLB 1L5PA 1V1OA 1CZPA 1C9FA 2N9KA 2WXNA 1JWBD 2BS2B 1JWMD 4N59A 3KWLA 3NRZA 2DBYA 3ZJVA 2M0AA 4GDKB 1VDVA 3CWIA 3AEAB 1QQRA 1AN8A 3AEBB 4ITKA 1ZUD2 2WXIA 1JRPA 2KN4A 3TSSA 4KGSA 1JALA 3VQIA 4ARCA 4N58A 1FD6A 1STEA 4FXCA 5EE3A 3PZ7A 1JROA 1FNUA 3AE3B 1L0YB 1GAQB 1TKEA 4B0EA 4EE2A 4RF1A 1OQRA 2W3RA 3WCQA 1CQVA 1GB4A 5BMHA 2IDYA 2ZW1A 1ZDXA 1KH0A 2BB6A 1VJKA 2J4XA 1K52A 3ETRA 2KQ4X 5TSSA 3RPFC 3AEDB 5G5HA 1K51A 1JWSD 1NYRA 2D5GA 1L4ZB 1RFKA 2NTTA 3LYYA 3Q8EA 3C8YA 3W5UB 1I4QA 2BTEA 2BB5A 3KLSX 5AUIA 1M4VA 5HHDG 1UWMA 1HQRD 1GPXA 4A90A 2NTSA 1XXGA 4L1BA 1TY0A 1NVID 4HKZE 1P7FA 2W3SA 1XF5L 3P4RB 2JX5A 1D5XC 1WYGA 1QOAA 3BK2A 2WDQB 4L23A 1F0ZA 4IKGA 2PIAA 1I4RA 2QMTA 2WDVB 4YTNB 1JQ4A 2DYOA 4WAFA 1YQ3B 5D3DA 3KWVA 1JWAD 5BYRA 1XCQL 2WXRA 2LUMA 2WU5B 5I4DA 4HRSA 3NS1A 1I4PA 4J3OD 5D3IB 1K53A 4C7ZA 2SEBD 3T3NA 2YEPF 1XCTL 2WP9B 1SJHD 3Q69A 3P4SB 4JWSC 3U2SC 5FKAC 3RFZB 4A55A 1ZP0B 2KDMA 1JCKB 3AE1B 3AE7B 4RGTA 1ZE3D 3V3XA 3LB8C 1R7SA 1AYFA 3SEBA 4XWWA 2VZKB 1DOXA 4R3DA 4RGOS 5HFYA 3EGRA 1C4AA 1E6EB 4OHJA 1JW9D 2K0PA 1XLQA 2PKOA 4LTUA 4RGNA 4ZRQA 1DOYA 2XN9C 2WXGA 3OWEB 4KGTA 2CJNA 2DLBA 4KKJA 1SBBB 1IGCA 2ACZB 2PTLA 5E6JA 1PGAA 2WLBA 1BXTA 2AX5A 1UNSA 3SFEB 1PDXA 1NEKB 3URYA 1FM0D 2JWUA 3DWMA 4JWUC 1F2RC 1I4XA 2J53A 3MJ5A 1T3QA 4NJCA 2KAJA 5H8YE 1PFDA 2GB1A 1EWCA 4XWTA 4YWGG 2BYTA 2L32A 2V0GA 1YN3A 3I9V1 4A6QA 5C3JB 1SB3C 3IT6B 4YTMB 3AEEB 1N5WA 1D5MC 3P63A 1D4BA 3ABVB 3MFGA 3MP9A 1C4PA 3T3OA 2Y3AA 3TUOA 4C80A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XEE A;  2K3U A; 
#chains in the Genus database with same CATH topology
 2KDF B;  3DBS A;  2L3Z A;  2CKH B;  4HCN B;  2MA9 B;  2GMI C;  3N1Y C;  2I38 A;  3ZXV A;  1UF0 A;  1RM6 C;  4XDD A;  2MLB A;  3Q3M C;  3RZW C;  1WJU A;  1C77 A;  1HXY D;  4RF0 A;  2LGY A;  4AWJ A;  3CMM B;  4WJO A;  2BWE S;  3AEF B;  4GOC A;  2KWV B;  3IAM 1;  3KYD D;  1BUI C;  1WF9 A;  3BVZ A;  2KTR A;  3AE5 B;  3BYT B;  3CF6 E;  1GC6 A;  1FMA D;  3V6E B;  1A70 A;  2PE6 B;  3ZO5 B;  1B9R A;  1IYF A;  2ZVN A;  5AZF A;  5DPT A;  2E6X A;  1E8W A;  2K5P A;  1WXV A;  3AM9 A;  2AQ1 B;  1CK1 A;  5D2M B;  1KLU D;  3FIL A;  2WXF A;  2BS3 B;  4K7W A;  1SGH A;  1ZW7 A;  3VDZ A;  3D32 A;  4EZJ A;  5KHO A;  1XEE A;  3A1Q A;  4WQM A;  2RR9 A;  1QF6 A;  4RM9 A;  1E8Y A;  2PE9 A;  1JRU A;  2BW2 A;  2VRR B;  3AU5 A;  2V3N A;  4HJK A;  1IBX A;  1WYW B;  3I3T B;  3ZNI D;  4MSQ B;  1V1P B;  4JE3 B;  1SEB D;  2D3C A;  1SJE D;  3AE2 B;  1DGJ A;  3DBR I;  1RWS A;  2RDH A;  5IAA C;  5C2T B;  3PTF C;  4GDL B;  2C7N B;  2DYM A;  1YNT E;  3FAH A;  1VD2 A;  3E56 A;  1E8X A;  4WWM A;  1MI0 A;  3HVD A;  2HTH A;  1VR9 A;  2LXC A;  1WY8 A;  3DBH I;  3L16 A;  4NAM A;  2KD0 A;  3DVN V;  3MHZ A;  2LUE A;  2PVO D;  3B2F A;  3SHQ A;  2WHI A;  3IAS 1;  1EO6 A;  1V97 A;  4XX5 A;  1XLO A;  3ZTC A;  1WI0 A;  2GBK A;  4I6L B;  4IM2 A;  4DXG A;  1XLN A;  5AZH A;  1TBE A;  3ZRF A;  1E0Z A;  4HRO A;  1E9M A;  4P1C C;  4LNO A;  3DBL B;  4IDI A;  2ZPN A;  3Q8A A;  4IC7 B;  2MEK A;  4A20 A;  1GG3 A;  3A9J B;  1VRA B;  2MQJ A;  5AEK B;  4WJP A;  3W5V B;  4KKI A;  3JYU A;  2IO3 B;  4YXD B;  1F9J A;  3AH7 A;  1QOG A;  3U4E G;  2MSE D;  3SD5 A;  2BS4 B;  1OFF A;  2IGD A;  4ANU A;  2LHE A;  2JU6 X;  4RH6 A;  3HHM A;  1IGD A;  2KQ7 A;  4JPS A;  1MG8 A;  4ZYN A;  4KX6 B;  2NBW B;  1OEY J;  1WJN A;  4G11 A;  2DX5 B;  1TYG B;  2INN E;  4XE0 A;  4US9 A;  2JF5 A;  1SSN A;  4HJG E;  1ET9 A;  4IUM B;  1P1A A;  2KLC A;  3L4P A;  3P4Q B;  5CX3 A;  1K50 A;  1PGX A;  4KIK A;  4N6E B;  1YQ4 B;  4HWI B;  3Q2A C;  2QEJ C;  4WIP A;  2I2Y A;  5DPW A;  1KM7 A;  3QCA A;  2MBB B;  1KOT A;  5HI1 A;  3NZU A;  4KSL C;  4II2 B;  2K9X A;  3N1Z C;  3VR8 B;  1X1M A;  1FRR A;  4LLG M;  4X57 B;  2BQQ A;  3I5J C;  5BO4 B;  5CHF A;  2DWQ A;  3DQV A;  2N7D A;  4WWO A;  3RNG C;  2HJ8 A;  2JYE A;  4C00 A;  3HM3 A;  2QIE B;  2WWZ A;  4ASW C;  3APF A;  3NVV A;  3VH3 B;  1V5O A;  4GB9 A;  1MHH E;  1SE4 A;  1EF5 A;  1FEH A;  2M0X A;  1SIF A;  5JH5 C;  4Q2J A;  2B76 B;  1EU4 A;  2JXT A;  3ML8 A;  2LGI A;  3KYC D;  3ZQ4 A;  3P2B A;  3GB1 A;  3N1X C;  2CJO A;  5MPO A;  1T6B X;  1WH3 A;  4W9C A;  4N9F 4;  2L1A A;  3H8H A;  3C19 A;  3M95 A;  3V61 A;  3QAR A;  3Q8C A;  2JSV X;  3IXS A;  3M62 B;  1WXQ A;  4MJS B;  3AMZ A;  1TKG A;  3RN9 C;  2XEW A;  1L5P A;  2D10 A;  4W9E A;  1C9F A;  2BS2 B;  1JWM D;  4N59 A;  4EKU A;  3NRZ A;  3ZJV A;  1VCB A;  2M0A A;  4GDK B;  2N1W A;  3AEA B;  3WAM A;  1AN8 A;  1ZUD 2;  1JRP A;  4M8M A;  3PSE B;  3VQI A;  4WJN A;  1FD6 A;  2L0T A;  3HK0 A;  1FNU A;  3WCQ A;  2KTF A;  2ZW1 A;  1ZDX A;  1VJK A;  3RUI B;  2WGS A;  2LRW A;  5TSS A;  2DNF A;  2DZI A;  3AED B;  2D5G A;  1Q5W B;  3W1Y A;  2WDT B;  3OG5 A;  4A3P A;  2N9X A;  3W5U B;  1I4Q A;  2BTE A;  1M4V A;  2V9H A;  4KVG B;  1RRB A;  2NTS A;  4L1B A;  4XGA B;  1HTQ A;  5LLI A;  3X0W A;  3AUL A;  4NPN A;  3OJ4 B;  4MSM B;  1GNU A;  2A5U A;  1F0Z A;  2WDQ B;  4L23 A;  4DBG A;  2IZV B;  4GU2 A;  2WDV B;  4YTN B;  3PV1 A;  4WAF A;  1YQ3 B;  3KWV A;  1JWA D;  5BYR A;  2ZJD A;  4KZC A;  4HRS A;  4ZRI A;  2LWP A;  1GUA B;  1R4M B;  2C9W B;  5FKA C;  1P0R A;  4MH0 E;  2KNB A;  1L2N A;  1ZP0 B;  1H8C A;  1TIF A;  3B0A A;  2W9N A;  3AE7 B;  4K81 A;  2G4D B;  4KV2 A;  2VZK B;  1DOX A;  4R3D A;  1LM8 B;  4RGO S;  5HFY A;  4W9K A;  5EDS A;  1S1Q B;  5KHQ A;  1XLQ A;  2PKO A;  4HDQ A;  2RSU A;  1DOY A;  2XN9 C;  4LNI A;  2DLB A;  1ISN A;  1R4N B;  1IGC A;  2ACZ B;  5E6J A;  2WLB A;  1UNS A;  4IWP A;  3PRZ A;  3DWM A;  2O2V B;  2KAJ A;  2GBM A;  1EWC A;  1YN3 A;  4HPM B;  1SB3 C;  4YTM B;  3AEE B;  1D5M C;  2QDF A;  3MFG A;  3MP9 A;  2KK8 A;  3T3O A;  2CU1 A;  4LNN A;  3U30 A;  1ZOY B;  2ZNV B;  1J7C A;  2K3U A;  2RMM A;  1PYW D;  2KDE B;  1F77 A;  4EFO A;  3TL5 A;  2IND C;  4F8C B;  1NYQ A;  1TS5 A;  3VHT C;  4S0R A;  1TKY A;  2BT6 A;  3CSF A;  3NVY A;  2X38 A;  1YQB A;  3GZN B;  2V3S A;  2KJ6 A;  3TEX A;  2KOX A;  1ROE A;  1WGK A;  3HVZ A;  4RNA A;  3HUI A;  2LJI A;  3AE6 B;  2KWD A;  3KVF B;  3RT3 B;  3JSV B;  4XYC A;  3RNB C;  1ZGU B;  4A8X C;  4E3C A;  5JZE B;  1RAX A;  3MC0 B;  4RFB A;  2IGH A;  1MPE A;  2CS4 A;  4J6I A;  4BOS C;  1VZ7 A;  1WX7 A;  1UH6 A;  1NBF C;  3O13 A;  2ZEQ A;  2GI9 A;  3UI3 A;  4DXF A;  3N20 C;  4ANV A;  4EUT A;  4CYE A;  1UUP A;  4OVV A;  2LAS A;  1TGZ B;  2LEK A;  4UDU C;  1QIL A;  2KQS A;  3AU4 A;  1ZDV A;  1TY2 A;  1JML A;  5D7G A;  1LFD A;  3Q6B A;  1EWY C;  3TEW A;  1AW7 A;  2FAZ A;  4CQN A;  4NAW B;  2JQR B;  4W9I A;  3QX1 A;  2G3Q B;  3UIN B;  1TS2 A;  2G1E A;  3C0R B;  4IM3 A;  2KMM A;  2QHO A;  3EFC A;  5G5G A;  2V4I B;  1Q10 A;  3DWG C;  1V81 A;  2N7E A;  3U8Z A;  1P3Q U;  3AE4 B;  1ACC A;  1NI3 A;  2Z8L A;  3A9J A;  2BPS A;  5CHW A;  2GLS A;  2LJ5 A;  4MEL A;  4LDT B;  3GS2 A;  4GGQ A;  4MGI E;  1T0Q C;  1OEY A;  2ZW0 A;  3TCA A;  2KMA A;  2KDB A;  3ZW3 A;  1VZ8 A;  1PUT A;  3U52 E;  3GOE A;  3H7P B;  4S17 A;  2Y5B B;  3DDC B;  4OW0 A;  1CJE A;  3UIP B;  4MGK E;  3NG0 A;  2N0S B;  4F1S A;  4DDI D;  1N60 A;  1WJ6 A;  1L7Y A;  3L0W B;  2VZK D;  4USA A;  2CHW A;  2J0J A;  4JQW C;  4M0W B;  3EEC A;  1E7U A;  2CHX A;  3LDZ E;  5H92 C;  3Q3F A;  3VRA B;  3RYT A;  2HD5 B;  4REZ A;  1T5X D;  3HRD D;  3RZF A;  1WX9 A;  2JY6 A;  3OLM D;  1Z5S B;  4XDC A;  5GXG B;  4ZRP A;  5AUK A;  2INP E;  3QK0 A;  1GC7 A;  4W9H A;  2L76 A;  4KGR A;  2WS3 B;  5JXV A;  3RNC C;  2GBJ A;  3PS6 A;  4I6P A;  5EE9 A;  4KZ0 A;  2BWF A;  4EZL A;  3W9C B;  3R7R A;  4EEW A;  2OJW A;  1EU3 A;  1WM2 A;  3ONS A;  1TZO A;  5HG2 A;  4BBN F;  2FCQ A;  3P42 A;  4NJ7 A;  4HPL B;  2LD9 A;  1TS3 A;  2C7H A;  1Y56 A;  4H2A A;  2NPT B;  3BZD B;  1C79 A;  2KKC A;  2O6V B;  3GP7 A;  2RDG A;  5G55 A;  4HLE A;  3DHI C;  1PQS A;  2XNA C;  2L8J A;  4TKN A;  2PW9 A;  3M3J A;  2V3P A;  1E90 A;  1OQY A;  3ZIM A;  1MHX A;  3R2T A;  4C7Y A;  1OQQ A;  2AQ3 B;  4MJS A;  1N6Z A;  1WRD B;  1KLG D;  3H1U A;  2W82 A;  1I4H A;  2BF8 B;  2RPV A;  1WGD A;  1BML C;  3MTN B;  1V49 A;  4GDK A;  3NS8 A;  3AB5 A;  1HE8 A;  2J0M A;  3PPA A;  1QLB B;  4ZYS A;  2JPH A;  3ZYY X;  2FUH B;  4P16 A;  1FIQ A;  3ECI A;  1WR1 A;  1PGB A;  2WXQ A;  2MBQ A;  2HTM E;  2NMQ A;  1H4R A;  3NVZ A;  2WXP A;  1FCC C;  2KX3 A;  4ZRK A;  3QHT A;  4G3X B;  4NZL B;  2KC1 A;  1V1O A;  1CZP A;  4GXB A;  3PHW B;  2DBY A;  2BGF A;  3RMK C;  2KFJ A;  1WR6 E;  3TJP A;  5GMV A;  3OJ3 A;  5IOI A;  4NQL B;  1STE A;  3K9P B;  3PZ7 A;  1JRO A;  3VTU A;  3AE3 B;  1L0Y B;  4M8N A;  1GAQ B;  4B0E A;  4EE2 A;  4HDO A;  3VUX A;  1OQR A;  4ZRJ A;  2PJH A;  1KH0 A;  1K52 A;  3ETR A;  2KQ4 X;  1JWS D;  4GIV A;  3L13 A;  4LDT D;  1M94 A;  2BB5 A;  5AUI A;  5HHD G;  2FID A;  1HQR D;  4A90 A;  1XXG A;  3JVZ X;  2L00 B;  1IP9 A;  2FIF A;  1UZX B;  1XF5 L;  3P4R B;  2JX5 A;  3BK2 A;  5D94 A;  3N30 A;  3VTW A;  2PIA A;  4M02 A;  1I4R A;  1YOV B;  2UU7 A;  1V9J A;  2WU5 B;  2WX1 A;  1I4P A;  1K53 A;  4C7Z A;  1F1H A;  1Z2M A;  4BAX A;  2BYE A;  3Q69 A;  3PGE A;  1RFA A;  2KFK B;  3AE1 B;  3LB8 C;  4XWW A;  4ACF A;  2O2V A;  2IYD B;  3IFW B;  1E6E B;  3QWZ B;  1UBQ A;  1JW9 D;  3WAL A;  2K1F A;  2LVP A;  4KGT A;  1R4M I;  2CJN A;  1YD8 U;  3UQA A;  1BXT A;  3TBL D;  2OJR A;  3A4S C;  2KJH B;  4BVU C;  1FM0 D;  4ZDV A;  2JWU A;  3MJ5 A;  4E74 A;  2GB1 A;  3I9V 1;  4A6Q A;  5C3J B;  2GBN A;  1N5W A;  1D4B A;  3ABV B;  2O6V D;  1C4P A;  2Y3A A;  3QQ8 B;  4MEM A;  4US8 A;  4JGH B;  2R2O A;  1KTK A;  2Y5P A;  3FKY A;  4L2Y A;  2EMT A;  4PT5 A;  3EFU A;  2N7J A;  1HZ5 A;  4FHJ A;  1TZ1 A;  2W55 A;  2WNM A;  1QKZ A;  3JSV A;  2M19 A;  1GB1 A;  2JVC A;  1JWU D;  2JZP A;  5DPS A;  1KFY B;  4W9D A;  2M4N A;  4LNF A;  2IO0 B;  1P7E A;  2Z0E B;  1L0V B;  4ZHP A;  1WX8 A;  3SDL C;  1YJ1 A;  2K25 A;  4II3 B;  3KUC B;  3CIR B;  3ZNG C;  1GJZ A;  1FXA A;  1A5R A;  2JRI B;  1YN4 A;  2LZ6 A;  3BY4 B;  4IWO A;  3GZN I;  4MT5 A;  1OTR B;  1WZ0 A;  1XO3 A;  4I6N B;  4C56 C;  1D5Z C;  1GOZ A;  2MBE A;  3A9K B;  1N63 A;  1MVK A;  3ZGZ A;  4GLS C;  2NCN A;  2ONQ A;  3P4P B;  4TV3 A;  4HK2 A;  1TTN A;  2CU3 A;  3PZ8 A;  3B2G A;  1LO5 D;  2ON8 A;  4TQ1 A;  3OAW A;  4P6V F;  5L95 C;  4GN1 A;  2KX0 A;  2DZM A;  4GMV A;  2N9P C;  4AP4 C;  3ZJT A;  3APC A;  3NHE B;  2DAF A;  1TJE A;  2K22 A;  4B9K A;  4FHK A;  2ZPY A;  4K7U A;  2AL6 A;  2WQY B;  4WUR A;  3PT2 B;  3H7P A;  4KDI C;  2L52 A;  3CST A;  4K7S A;  2C60 A;  3UF8 A;  4W9G A;  2R61 A;  1FFU A;  2W54 A;  2FNJ B;  3L17 A;  3VTV A;  5IKC M;  1ENF A;  1EM7 A;  4FJY A;  4JX1 C;  4BFR A;  5FR3 A;  1LGR A;  2J52 A;  4YT0 B;  3EC8 A;  4M0W A;  3IVF A;  3I57 A;  4RM8 A;  3SU8 X;  3ZJU A;  2PVG C;  1UD7 A;  2FBW B;  3LJ3 A;  4B6W A;  4IM0 A;  4AJY B;  4BKG A;  2MP2 B;  5BYS A;  3PLV A;  2EKE C;  3BVG A;  1G6J A;  1FFV A;  1FPY A;  3TIX A;  2JYT A;  2FCN A;  1XQQ A;  1XT9 B;  2KVR A;  4O1N A;  4F7Z A;  4B0M A;  2H88 B;  3A4R A;  2ICI A;  3V6C B;  4D2K A;  3MC9 A;  3NJT A;  2B3A A;  1L6U A;  3AV8 A;  4HXD A;  5EE1 A;  4PYU A;  4TSS A;  1FCL A;  2D3G A;  3H9D A;  3JW0 X;  1UGJ A;  1WGH A;  3B9J A;  3B08 A;  1J19 A;  4URK A;  2R2Q A;  1ZPS A;  1YIW A;  4DWF A;  2NPT A;  2BKF A;  2KC2 A;  4MM3 B;  4K3C A;  4LK0 M;  2O6V A;  1NI2 A;  3HM6 X;  4P7I A;  4PYZ A;  4A9A A;  4GSW A;  3DVG Y;  1I7H A;  3BIN A;  1V1P A;  3AE9 B;  4MAC A;  2BYV E;  3PVL A;  5J17 A;  3N3K B;  2KYW A;  2WYQ A;  5BMG A;  3N32 A;  4NJ6 A;  5FK9 C;  4GDL A;  4BOZ B;  1UEL A;  4JLC A;  2M17 A;  3ZVV A;  1C3T A;  4MGZ E;  3ZNZ B;  4DHZ B;  1SE2 A;  4TQ0 A;  3ZLZ A;  2J7Q B;  4LJO B;  1YJI A;  2IO2 B;  4RGM A;  2N4F A;  1Q1O A;  1J7B A;  4BZA A;  2RGF A;  3VFK A;  1KRH A;  5AZG A;  3R2I A;  3W1S A;  2EKI A;  1WIA A;  1SF0 A;  4XZ4 A;  1WXA A;  4HKQ A;  3Q8B A;  3ML9 A;  3WAN A;  1K8R B;  1V86 A;  1YX5 B;  1LXD A;  4P1B C;  3ZKJ C;  1T0Y A;  3NVW A;  2OED A;  1VLB A;  1N61 A;  2N9L A;  3BVM A;  2OHF A;  3R8B A;  4KDL B;  2LRU A;  5LNK 1;  1E7V A;  3Q8F A;  1ESF A;  4DQO C;  2MHJ A;  1E7P B;  5BMI A;  4BBN C;  3NZS A;  1N5X A;  2REX A;  2Y5C A;  1ET6 A;  2X8X X;  2D3A A;  3IT4 B;  3ZDM C;  2BBC A;  4CO7 A;  2JWZ A;  2MRP A;  2WXN A;  1JWB D;  3KWL A;  1ZKH A;  1VDV A;  2M1M A;  3PRM B;  1V80 A;  2KN4 A;  4KGS A;  1JAL A;  4ARC A;  1WMH B;  5EE3 A;  1V5T A;  4JL9 A;  1XD3 B;  3DBL I;  1TKE A;  2GBR A;  4RF1 A;  3L10 B;  4IG7 B;  2JT4 B;  4AJW A;  4HCP B;  4EOY A;  1K51 A;  1NYR A;  1L4Z B;  1RFK A;  2N1V A;  2FCS A;  3C8Y A;  3WAO A;  1UWM A;  3DOW A;  4C4V B;  2K8H A;  1TY0 A;  4HKZ E;  3R7Q A;  3ZRC A;  2KFK A;  2W3S A;  2K6Q A;  4MDK E;  2IY1 B;  1LQB A;  1WYG A;  3AXC A;  2KVZ A;  1JQ4 A;  4WWN A;  4G50 A;  2L7R A;  1XCQ L;  2WXR A;  2LUM A;  2NBV B;  3NS1 A;  2KLG A;  2LGS A;  1TT5 B;  2SEB D;  2UYZ B;  2KHW B;  5FR6 A;  3IG3 A;  4B95 A;  2KDM A;  1JCK B;  1ZE3 D;  3B1L X;  1WZ3 A;  3QAQ A;  3SEB A;  1P98 A;  4WWP A;  5C23 A;  3PRP B;  3MJW A;  1C4A A;  4RMA A;  2DZK A;  1T0S C;  3DHH C;  4ZRQ A;  2JZZ A;  2NS5 A;  3QIJ A;  2KN5 A;  2A4Z A;  4W9L A;  2V4L A;  3K9O B;  3KUD B;  2AWT A;  4FAD A;  2I1J A;  1PDX A;  1WGG A;  1NEK B;  5E6P A;  3URY A;  4PK1 A;  3M63 B;  1T3Q A;  5H8Y E;  1PFD A;  3KW5 B;  3KUZ A;  2L32 A;  1UGM A;  4JIO U;  3T8M A;  2D11 A;  2D2Q A;  5D6J B;  3P63 A;  1BT0 A;  4NY0 A;  3TUO A;  2KWC A;  4C80 A;  1S3S G;  3E9S A;  3DHG C;  4AOF A;  3RUL A;  1SE3 A;  3Q3O C;  2WDR B;  1C76 A;  3O65 B;  3RCZ A;  1B1Z A;  3W2D A;  3PHX B;  4HPP A;  1WWT A;  2KDI A;  4FN2 A;  2FE8 A;  1L6V A;  1N62 A;  1SE9 A;  2TSS A;  4FA6 A;  1T0R C;  3BYY B;  3EUB 2;  2L83 A;  2XK5 B;  3GE3 C;  3DPD A;  2H89 B;  2KT7 A;  3A9K A;  2PLP A;  3T9L A;  1E8Z A;  3PZD A;  1KF6 B;  2HDE A;  1WRI A;  3AE8 B;  2GRI A;  2PPH A;  4AS1 A;  5TR5 A;  2DZJ A;  2MJE A;  4OZA A;  4BKT A;  3NY5 A;  4W9F A;  2IY0 B;  2YVC A;  3AI5 A;  5J2R A;  1SXT A;  1HEZ E;  3UQB A;  2DYB A;  3GE8 C;  5HKH A;  1YJJ A;  3RD2 A;  3TEZ A;  2PMV A;  2HE7 A;  3R66 C;  3DVG X;  2Q5W D;  2ZVO A;  4YSY B;  3A33 B;  2AQ2 B;  1MFW A;  2AYO B;  4LCD E;  2LFI A;  2WXH A;  4FJZ A;  2VH1 A;  2L05 A;  3AEG B;  4ZOH C;  2BVC A;  2K39 A;  3KQ4 A;  4WJQ A;  2LVQ A;  4PS3 A;  4OVU A;  3DBR B;  1RYJ A;  1WGR A;  2KTR B;  3U7Z A;  2LMC A;  4K1R B;  3W1S C;  2LHD A;  5BYQ A;  1IPG A;  2KMC A;  1QT9 A;  3P1M A;  1L0X B;  3N9Y C;  5IO9 A;  3DBH B;  4IOI E;  1TS4 A;  1V8C A;  4G0N B;  2JRH A;  3FIL B;  3PLU A;  2G45 B;  5DPR A;  3VR9 B;  4HVB A;  1CMX B;  3RNA C;  3V05 A;  3S2A A;  2L0F A;  4KSK C;  1WSP A;  3Q3N C;  1UWX A;  3A1Q B;  3AN1 A;  3NZ3 A;  2KWU B;  3BK1 A;  4NNJ B;  1L4D B;  3ZTD A;  1J0G A;  1FO4 A;  2EEL A;  2MH7 A;  2MP2 A;  1IBX B;  5IN7 A;  4PS7 A;  1DYQ A;  4OVZ A;  4YTP B;  4MGY E;  3VH4 B;  3PO0 A;  2WU2 B;  2D3B A;  1F52 A;  4RCO A;  2AEH A;  3TEY A;  3VVW B;  1YMH E;  4WQO B;  1FNV A;  1QOB A;  1R4N I;  2K8B A;  1J7A A;  3NOB A;  5CHV C;  2M56 B;  1FXT B;  4FBJ B;  2QJL A;  2IPK D;  4FLH A;  2UWQ A;  3X23 A;  4QAY A;  5EE0 A;  3ENE A;  2ASQ A;  4ICV A;  4OZB A;  2MJD A;  1WGY A;  3BWU D;  3EA6 A;  1AWD A;  4MM3 A;  2WXO A;  4YSX B;  4BKS D;  1Y8R C;  2G9H D;  5E6N A;  1HZ6 A;  3V62 A;  4ARI A;  2WXJ A;  2LGD A;  1HA5 A;  1VZ6 A;  3FC4 A;  2J42 A;  3RNF C;  2M8S A;  3NUH B;  3BII D;  3V60 A;  4PS8 A;  4LNK A;  4YL8 A;  3I63 C;  3AEC B;  2NR2 A;  2E3T A;  2WXL A;  3IBE A;  4E71 A;  2XBB C;  1D6E C;  2ZCB A;  2ZZP B;  5JHB A;  2AL3 A;  2WXM A;  1NEN B;  2G4S A;  4OZC A;  2YEP B;  1D3Z A;  3IHP C;  2CR5 A;  1C4C A;  1J8C A;  1I35 A;  3Q3J A;  3J9C A;  5L83 A;  4NAW A;  2IBI B;  2DHZ A;  1E5W A;  4HEA 1;  1I4G A;  4EZK A;  1F2R I;  2PEA A;  2WXK A;  4DHZ E;  4AQ7 A;  1C78 A;  4MH8 A;  1QOF A;  4M01 A;  3DVN U;  3ZUN A;  3SR6 A;  3RI7 C;  2NVU I;  2CHZ A;  4DHJ B;  1DOI A;  1U4A A;  1FRD A;  1RLF A;  1E10 A;  5C1Z A;  4IWQ A;  4NQK E;  2ZCC A;  3PRE A;  1ZXH A;  4YSZ B;  1HTO A;  2IGG A;  4AUQ C;  1SIJ A;  4ICU A;  4ZHO A;  4KIK B;  3VAW A;  1ZXI A;  2K6D B;  2QCZ A;  1FXI A;  2KAC A;  3L54 A;  3R3M A;  2DAJ A;  1V6E A;  1IUE A;  5LXI B;  2MCN B;  1AAR A;  2QIL A;  3ZXR A;  2MJ3 A;  2IJ0 A;  1MG4 A;  2D07 B;  1EF1 A;  2EMS A;  4WH4 A;  1QZE A;  1WE6 A;  5CTR C;  3DCG A;  2QSD A;  4LJP B;  3UIO B;  2INC C;  3SFD B;  1EUV B;  1XLP A;  3LXF A;  4TUU A;  5T8I A;  1Q0W B;  4TMA B;  1WMH A;  5IA7 A;  2SAK A;  4FJV B;  2BKR B;  2J0K A;  2FUG 1;  3VRB B;  2Z0D B;  1FNW A;  1YN5 A;  4DDG D;  3L08 A;  4DK5 A;  2C7M B;  2N9K A;  1KLV A;  3EHV A;  1C1Y B;  3CWI A;  4IW0 A;  2LGX A;  2RDB C;  1QQR A;  2K8C A;  2VH2 A;  3AEB B;  3MHS D;  4ITK A;  3VXW A;  2WXI A;  1KJT A;  5DCN A;  3TSS A;  2C5L C;  1WE7 A;  2QC8 A;  4C4V A;  3APD A;  2KAN A;  2RD0 A;  2Z59 B;  4N58 A;  5J18 A;  1WJ4 A;  2LXA A;  3WIM A;  4FXC A;  2GOW A;  1NDD A;  5LXH A;  4W9J A;  2HJ1 A;  2KZR A;  2W3R A;  1CQV A;  1GB4 A;  5BMH A;  2IDY A;  2MX2 A;  2BB6 A;  3UGB B;  3H7S A;  2J4X A;  2JXX A;  3RPF C;  5G5H A;  1WXS A;  3VUY A;  3U7D A;  2WX0 A;  2NTT A;  3LYY A;  2MW5 A;  3Q8E A;  3ALB A;  3KLS X;  1P9D U;  3VUW A;  1WM3 A;  2BYF A;  1GPX A;  1NVI D;  3H6N A;  1P7F A;  1I42 A;  1MJD A;  4K3B A;  1WFY A;  4BKS A;  1D5X C;  3QC8 B;  1QOA A;  5G2N A;  4IKG A;  2OOB B;  2QMT A;  2N9E B;  2YLM A;  2DYO A;  5D3D A;  3Q14 C;  3ZNH B;  4ANX A;  5I4D A;  4J3O D;  5D3I B;  2JZ3 B;  2RPQ A;  3T3N A;  2YEP F;  1XCT L;  4XC2 A;  5E6O A;  2WP9 B;  4FUL A;  1SJH D;  4JWS C;  3P4S B;  3RFZ B;  3U2S C;  2NBU A;  4M00 A;  3WAP A;  4A55 A;  2FCM A;  4RGT A;  3V3X A;  3WA0 A;  1R7S A;  1AYF A;  2ZNV C;  1V2Y A;  2LVO A;  3QJZ A;  2MBO A;  3EGR A;  3RNE C;  3QA8 A;  4OHJ A;  1YX6 B;  1UBI A;  2K0P A;  4LTU A;  2V1Y A;  4RGN A;  2MBH A;  2WXG A;  3OWE B;  2I1K A;  4KKJ A;  4CHK A;  1SBB B;  2IO1 B;  3HIZ A;  3TMP B;  2PTL A;  1PGA A;  2AX5 A;  2MWS B;  5IP4 D;  4WAA A;  2JUO A;  3SFE B;  3ZDT A;  2KXJ A;  5JHA A;  4ANW A;  4JWU C;  1F2R C;  1I4X A;  1OGW A;  2J53 A;  2LI5 A;  3KH0 A;  4NJC A;  2KO3 A;  2XK5 A;  2DEN B;  4XWT A;  4YWG G;  2BYT A;  2KJR A;  2V0G A;  3IT6 B;  4DHJ D;  4A3O A;  3MC8 A;  4DXA B;  1WXM A; 
#chains in the Genus database with same CATH homology
 4US8 A;  1ZOY B;  3E9S A;  1KTK A;  1SE3 A;  2Y5P A;  4L2Y A;  4PT5 A;  2WDR B;  1J7C A;  2I38 A;  1C76 A;  2N7J A;  1HZ5 A;  2K3U A;  2RMM A;  1B1Z A;  1PYW D;  3W2D A;  1F77 A;  1WWT A;  1RM6 C;  4XDD A;  2W55 A;  2FE8 A;  1L6V A;  1NYQ A;  1QKZ A;  1N62 A;  1TS5 A;  2WNM A;  2M19 A;  1TKY A;  2TSS A;  2BT6 A;  1GB1 A;  3BYY B;  3NVY A;  2X38 A;  1JWU D;  3EUB 2;  2JZP A;  2L83 A;  1C77 A;  1HXY D;  1KFY B;  4RF0 A;  2H89 B;  1P7E A;  2PLP A;  1L0V B;  4ZHP A;  1KF6 B;  3TEX A;  3AEF B;  2HDE A;  1WRI A;  3AE8 B;  3IAM 1;  2GRI A;  4AS1 A;  1ROE A;  2MJE A;  4OZA A;  1BUI C;  3BVZ A;  3AE5 B;  3BYT B;  1WGK A;  3HVZ A;  1SXT A;  3CIR B;  4RNA A;  3HUI A;  1FMA D;  1HEZ E;  2LJI A;  1A70 A;  3AE6 B;  1YJJ A;  1FXA A;  2KWD A;  3TEZ A;  2PMV A;  1B9R A;  2Q5W D;  1YN4 A;  4YSY B;  2E6X A;  2AQ2 B;  4A8X C;  2K5P A;  4MT5 A;  3AM9 A;  3MC0 B;  2AQ1 B;  1CK1 A;  4RFB A;  1XO3 A;  4C56 C;  1KLU D;  2LFI A;  1D5Z C;  3FIL A;  2IGH A;  2WXF A;  2BS3 B;  2WXH A;  1GOZ A;  1MPE A;  1N63 A;  1MVK A;  3AEG B;  4ZOH C;  1VZ7 A;  3ZGZ A;  4GLS C;  2ONQ A;  1XEE A;  3P4P B;  3KQ4 A;  4WQM A;  1QF6 A;  3O13 A;  1RYJ A;  2GI9 A;  3U7Z A;  2BW2 A;  2CU3 A;  2LMC A;  3UI3 A;  4DXF A;  3PZ8 A;  2V3N A;  2LHD A;  3B2G A;  1LO5 D;  1UUP A;  2ON8 A;  4TQ1 A;  5BYQ A;  4P6V F;  1IBX A;  1QT9 A;  3P1M A;  2LEK A;  4UDU C;  1L0X B;  3N9Y C;  1QIL A;  4IOI E;  1TS4 A;  1ZDV A;  1V8C A;  1TY2 A;  1JML A;  5D7G A;  1V1P B;  3FIL B;  3ZJT A;  1EWY C;  3TEW A;  1AW7 A;  3VR9 B;  3V05 A;  1TJE A;  4JE3 B;  1SEB D;  4CQN A;  1SJE D;  1WSP A;  3AE2 B;  2K22 A;  1DGJ A;  1UWX A;  2JQR B;  4NAW B;  1RWS A;  2RDH A;  3AN1 A;  5C2T B;  1TS2 A;  2G1E A;  4GDL B;  3NZ3 A;  2DYM A;  3BK1 A;  1YNT E;  2WQY B;  3FAH A;  4WUR A;  3E56 A;  1L4D B;  2KMM A;  4WWM A;  1MI0 A;  3HVD A;  1FO4 A;  5G5G A;  2EEL A;  2V4I B;  2L52 A;  2MH7 A;  1Q10 A;  3DWG C;  1VR9 A;  1IBX B;  2R61 A;  1DYQ A;  4OVZ A;  4YTP B;  1FFU A;  3AE4 B;  1ACC A;  1NI3 A;  2Z8L A;  4NAM A;  2W54 A;  3PO0 A;  1ENF A;  3MHZ A;  1EM7 A;  2WU2 B;  4JX1 C;  3GS2 A;  2PVO D;  3B2F A;  4RCO A;  3IAS 1;  1V97 A;  3TEY A;  1XLO A;  5FR3 A;  2J52 A;  4YT0 B;  1YMH E;  4M0W A;  1FNV A;  1QOB A;  1J7A A;  3I57 A;  3ZJU A;  2M56 B;  2PVG C;  2ZW0 A;  4DXG A;  1XLN A;  2FBW B;  2QJL A;  1E0Z A;  1VZ8 A;  1PUT A;  3U52 E;  2IPK D;  4HRO A;  1E9M A;  4OW0 A;  1CJE A;  5EE0 A;  5BYS A;  4IDI A;  3Q8A A;  2MEK A;  4OZB A;  2MJD A;  3BVG A;  2N0S B;  3BWU D;  3EA6 A;  1FFV A;  1AWD A;  1N60 A;  1VRA B;  2JYT A;  2WXO A;  4YSX B;  2VZK D;  4O1N A;  4USA A;  2G9H D;  3W5V B;  1HZ6 A;  4B0M A;  2H88 B;  4ARI A;  2WXJ A;  4KKI A;  2ICI A;  1HA5 A;  4YXD B;  4D2K A;  1VZ6 A;  3AH7 A;  1QOG A;  2J42 A;  3FC4 A;  3U4E G;  5H92 C;  1L6U A;  3NUH B;  2BS4 B;  3AV8 A;  3BII D;  1OFF A;  2IGD A;  5EE1 A;  3VRA B;  2LHE A;  4REZ A;  2JU6 X;  4TSS A;  1FCL A;  3AEC B;  1T5X D;  3HRD D;  4RH6 A;  1IGD A;  2E3T A;  1UGJ A;  2WXL A;  4JPS A;  4XDC A;  3B9J A;  1D6E C;  5GXG B;  4ZRP A;  4KX6 B;  5AUK A;  2INP E;  1ZPS A;  2WXM A;  4MM3 B;  4KGR A;  2WS3 B;  5JXV A;  4LK0 M;  1NEN B;  1TYG B;  2INN E;  4XE0 A;  4US9 A;  5EE9 A;  4A9A A;  1SSN A;  4OZC A;  2YEP B;  1I7H A;  1V1P A;  1C4C A;  4HJG E;  1ET9 A;  3AE9 B;  4MAC A;  3J9C A;  3W9C B;  3L4P A;  3P4Q B;  1K50 A;  4HEA 1;  1I4G A;  1EU3 A;  1PGX A;  5BMG A;  5FK9 C;  1F2R I;  1TZO A;  5HG2 A;  2WXK A;  4AQ7 A;  4N6E B;  1YQ4 B;  1C78 A;  4MH8 A;  1QOF A;  3P42 A;  2QEJ C;  4WIP A;  2I2Y A;  1SE2 A;  4TQ0 A;  1TS3 A;  3SR6 A;  1Y56 A;  4H2A A;  5HI1 A;  1YJI A;  3VR8 B;  2K9X A;  3BZD B;  1C79 A;  1DOI A;  1FRR A;  4LLG M;  4RGM A;  3GP7 A;  2RDG A;  1FRD A;  2XNA C;  1J7B A;  1E10 A;  2DWQ A;  2PW9 A;  1KRH A;  3R2I A;  2V3P A;  2JYE A;  1ZXH A;  4YSZ B;  3W1S A;  2IGG A;  2QIE B;  2EKI A;  1MHX A;  1SF0 A;  1SIJ A;  4ZHO A;  3NVV A;  1ZXI A;  3R2T A;  4C7Y A;  4HKQ A;  1OQQ A;  2AQ3 B;  3Q8B A;  1FXI A;  2KAC A;  1MHH E;  1IUE A;  1SE4 A;  1KLG D;  1FEH A;  2W82 A;  1I4H A;  2QIL A;  3NVW A;  2MJ3 A;  4Q2J A;  2OED A;  2IJ0 A;  2RPV A;  1VLB A;  1N61 A;  2B76 B;  2N9L A;  1BML C;  1EU4 A;  2JXT A;  2OHF A;  3BVM A;  3R8B A;  2LGI A;  3ZQ4 A;  4WH4 A;  3GB1 A;  5LNK 1;  3Q8F A;  1ESF A;  2CJO A;  4DQO C;  5MPO A;  3AB5 A;  2QSD A;  1T6B X;  1QLB B;  4ZYS A;  3SFD B;  1E7P B;  2L1A A;  3ZYY X;  1XLP A;  3H8H A;  5BMI A;  4P16 A;  1FIQ A;  3LXF A;  1PGB A;  5T8I A;  2WXQ A;  1N5X A;  4TMA B;  2HTM E;  2Y5C A;  2NMQ A;  3Q8C A;  3NVZ A;  2WXP A;  2JSV X;  2SAK A;  3IXS A;  1WXQ A;  1ET6 A;  1FCC C;  2FUG 1;  3IT4 B;  3VRB B;  3AMZ A;  1TKG A;  2BBC A;  1FNW A;  1YN5 A;  4NZL B;  1L5P A;  1V1O A;  1CZP A;  1C9F A;  2N9K A;  2WXN A;  1JWB D;  2BS2 B;  1JWM D;  4N59 A;  3KWL A;  3NRZ A;  2DBY A;  3ZJV A;  2M0A A;  4GDK B;  1VDV A;  3CWI A;  3AEA B;  1QQR A;  1AN8 A;  3AEB B;  4ITK A;  1ZUD 2;  2WXI A;  1JRP A;  2KN4 A;  3TSS A;  4KGS A;  1JAL A;  3VQI A;  4ARC A;  4N58 A;  1FD6 A;  1STE A;  4FXC A;  5EE3 A;  3PZ7 A;  1JRO A;  1FNU A;  3AE3 B;  1L0Y B;  1GAQ B;  1TKE A;  4B0E A;  4EE2 A;  4RF1 A;  1OQR A;  2W3R A;  3WCQ A;  1CQV A;  1GB4 A;  5BMH A;  2IDY A;  2ZW1 A;  1ZDX A;  1KH0 A;  2BB6 A;  1VJK A;  2J4X A;  1K52 A;  3ETR A;  2KQ4 X;  5TSS A;  3RPF C;  3AED B;  5G5H A;  1K51 A;  1JWS D;  1NYR A;  2D5G A;  1L4Z B;  1RFK A;  2NTT A;  3LYY A;  3Q8E A;  3C8Y A;  3W5U B;  1I4Q A;  2BTE A;  2BB5 A;  3KLS X;  5AUI A;  1M4V A;  5HHD G;  1UWM A;  1HQR D;  1GPX A;  4A90 A;  2NTS A;  1XXG A;  4L1B A;  1TY0 A;  1NVI D;  4HKZ E;  1P7F A;  2W3S A;  1XF5 L;  3P4R B;  2JX5 A;  1D5X C;  1WYG A;  1QOA A;  3BK2 A;  2WDQ B;  4L23 A;  1F0Z A;  4IKG A;  2PIA A;  1I4R A;  2QMT A;  2WDV B;  4YTN B;  1JQ4 A;  2DYO A;  4WAF A;  1YQ3 B;  5D3D A;  3KWV A;  1JWA D;  5BYR A;  1XCQ L;  2WXR A;  2LUM A;  2WU5 B;  5I4D A;  4HRS A;  3NS1 A;  1I4P A;  4J3O D;  5D3I B;  1K53 A;  4C7Z A;  2SEB D;  3T3N A;  2YEP F;  1XCT L;  2WP9 B;  1SJH D;  3Q69 A;  3P4S B;  4JWS C;  3U2S C;  5FKA C;  3RFZ B;  4A55 A;  1ZP0 B;  2KDM A;  1JCK B;  3AE1 B;  3AE7 B;  4RGT A;  1ZE3 D;  3V3X A;  3LB8 C;  1R7S A;  1AYF A;  3SEB A;  4XWW A;  2VZK B;  1DOX A;  4R3D A;  4RGO S;  5HFY A;  3EGR A;  1C4A A;  1E6E B;  4OHJ A;  1JW9 D;  2K0P A;  1XLQ A;  2PKO A;  4LTU A;  4RGN A;  4ZRQ A;  1DOY A;  2XN9 C;  2WXG A;  3OWE B;  4KGT A;  2CJN A;  2DLB A;  4KKJ A;  1SBB B;  1IGC A;  2ACZ B;  2PTL A;  5E6J A;  1PGA A;  2WLB A;  1BXT A;  2AX5 A;  1UNS A;  3SFE B;  1PDX A;  1NEK B;  3URY A;  1FM0 D;  2JWU A;  3DWM A;  4JWU C;  1F2R C;  1I4X A;  2J53 A;  3MJ5 A;  1T3Q A;  4NJC A;  2KAJ A;  5H8Y E;  1PFD A;  2GB1 A;  1EWC A;  4XWT A;  4YWG G;  2BYT A;  2L32 A;  2V0G A;  1YN3 A;  3I9V 1;  4A6Q A;  5C3J B;  1SB3 C;  3IT6 B;  4YTM B;  3AEE B;  1N5W A;  1D5M C;  3P63 A;  1D4B A;  3ABV B;  3MFG A;  3MP9 A;  1C4P A;  3T3O A;  2Y3A A;  3TUO A;  4C80 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...