2RDBC

X-ray crystal structure of toluene/o-xylene monooxygenase hydroxylase i100w mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
TFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Toluene, o-xylene monooxygenase oxygenase subunit;alpha
publication title Dioxygen activation at non-heme diiron centers: oxidation of a proximal residue in the I100W variant of toluene/o-xylene monooxygenase hydroxylase.
pubmed doi rcsb
source organism Pseudomonas stutzeri
total genus 24
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2007-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 2rdbC00
4P1BC 3N20C 3RN9C 2INCC 3Q14C 3Q3NC 1T0RC 3DHIC 3Q3OC 3RMKC 3Q2AC 1T0QC 3I63C 1T0SC 3N1YC 4P1CC 3DHGC 3N1ZC 3Q3MC 3GE8C 3RNCC 3N1XC 3RNGC 3GE3C 3RI7C 2INDC 3RNBC 2RDBC 3RNAC 3DHHC 3I5JC 3RNFC 3RNEC
chains in the Genus database with same CATH superfamily
4WJPA 1DYQA 1B1ZA 4JWSC 4F1SA 2DNFA 3GP7A 1WXSA 1E6EB 4ZRQA 1TBEA 2JY6A 4NAWB 2BS2B 2WU5B 3ZRCA 4HCPB 1J7BA 2O2VA 3AE8B 4GXBA 4HXDA 4IUMB 3ZO5B 2N9PC 1YIWA 2KHWB 3CIRB 2I1KA 2KDIA 4FLHA 3I57A 3HK0A 2HD5B 2KN5A 4FHKA 2FUHB 4USAA 1ZDXA 2LI5A 3ONSA 1DOIA 1LQBA 1UWXA 2KDMA 2I2YA 3H1UA 4JIOU 1WIAA 2ICIA 2UWQA 3V3XA 3IT6B 3Q69A 1WXVA 4KSKC 4MJSA 3L16A 1NBFC 3I3TB 3KUZA 3APCA 3QQ8B 2MP2A 2W54A 3HM6X 1L2NA 3E9SA 4W9KA 2BYVE 5G5GA 1K51A 1D3ZA 1UGJA 2V3SA 5LXHA 1SSNA 2DYMA 2ZPYA 3H9DA 2R2OA 2KTFA 2L3ZA 1YX6B 1E7VA 2JQRB 1F9JA 2DHZA 1H8CA 1L5PA 2AQ3B 4BKSA 4WH4A 4DWFA 2FIFA 3Q8AA 5FR6A 4IOIE 3TSSA 3WA0A 4ZYNA 1ZOYB 4EOYA 5E6PA 2AX5A 3A9JB 3BIID 4LLGM 2JXXA 5H8YE 4L1BA 3TMPB 3U8ZA 1WGKA 4BBNC 4MEMA 2GBMA 2KDBA 2D3GA 1L7YA 1QOBA 3OLMD 2N7JA 3EA6A 1GC7A 1GB4A 1ZPSA 2G9HD 4ICVA 1UUPA 4JQWC 1D5MC 1N6ZA 1FNWA 1SB3C 2YEPB 5TSSA 5EE3A 1XT9B 1EF1A 3APDA 4J6IA 3AU4A 1KH0A 2WQYB 2DZKA 3R7RA 2QSDA 4OVVA 4BFRA 1GC6A 1E9MA 3BZDB 2LXCA 1ZW7A 1HTQA 4HJGE 3EGRA 4DHJB 3AE1B 4IW0A 3VR8B 1SEBD 3P4PB 2BWFA 1WE6A 1IGDA 2NBUA 4HKZE 1F77A 4PS7A 2CJNA 2VZKD 2PJHA 3AM9A 1D6EC 4MACA 1D5ZC 4D2KA 3A4RA 1QOGA 2ZJDA 1FPYA 1QILA 1BUIC 2V4IB 3SHQA 4E74A 3VRBB 5IO9A 2NPTA 2INCC 3U7ZA 3UI3A 2H89B 3DHIC 3Q3OC 3GZNI 2O6VA 2PW9A 1ESFA 3KH0A 2H88B 3DDCB 4KGSA 5AEKB 1I4GA 2WXFA 3NOBA 3O65B 3RNCC 4W9CA 2J0KA 3CWIA 2BKFA 4FJYA 3VFKA 1EO6A 2KFKB 2BBCA 3AV8A 3B2FA 1WF9A 1N61A 2LD9A 2KK8A 4AJWA 4O1NA 1E7PB 1TT5B 1ZE3D 2MBHA 3NJTA 3AEBB 1IBXB 2KVZA 2BB6A 4XDCA 1RFKA 4II3B 2MX2A 4N59A 2G4DB 1L0XB 4HEA1 2G4SA 5LLIA 4KIKA 4IM3A 4M00A 2JZZA 1GNUA 1V49A 3U7DA 3Q8EA 2AYOB 3R3MA 4KKJA 5MPOA 1C4PA 3V05A 3CMMB 2E3TA 4Q2JA 2L76A 4W9LA 1YNTE 5E6JA 4RGMA 4IG7B 1AYFA 2KDFB 1ZKHA 4RF1A 4YSYB 2BW2A 3ZRFA 2MJDA 4RH6A 1YN4A 3U30A 2X38A 3PSEB 4HPMB 1ZP0B 2CJOA 1I4XA 2ZVOA 3EHVA 4NAWA 5BYQA 1C1YB 4B9KA 3TIXA 3AULA 5DCNA 3BVMA 2LXAA 5AUIA 3VDZA 1RAXA 2ZNVC 3W2DA 4F8CB 3BK2A 4TQ0A 4CO7A 4N58A 4AQ7A 3VR9B 1TJEA 1I7HA 1RYJA 1TKYA 2QCZA 4MH8A 3HUIA 1JMLA 3NY5A 1XD3B 2BQQA 4G3XB 1K53A 4DK5A 2B3AA 1D4BA 1TIFA 4KDLB 1ISNA 1Q0WB 1VZ7A 3TJPA 3ETRA 3ZTCA 2Z0DB 4M0WA 4LJOB 2KQ7A 1VRAB 2LVPA 4W9FA 4NQLB 3VRAB 2WDTB 4LNFA 2J42A 3B1LX 2KACA 1CMXB 1ACCA 2CU1A 2FNJB 1ET6A 1WR6E 4L23A 5D2MB 4KSLC 2BB5A 4WJOA 4YL8A 4KGTA 4C56C 4LNIA 2RGFA 4P7IA 2D5GA 3QA8A 2KLGA 3SEBA 1Y56A 2R61A 1NI3A 4AJYB 4LNKA 2HTME 1TKGA 1J0GA 3TEXA 2YVCA 1JRPA 3NZSA 1Z5SB 2Y3AA 3P4RB 4XDDA 5J18A 1P1AA 1QOFA 2WHIA 2FUG1 2D3BA 2NCNA 2LGSA 3A9JA 1E10A 2D2QA 1WXAA 4WWPA 3FAHA 3KUDB 3URYA 1C79A 1ZXHA 3KLSX 3PHXB 1LM8B 2BVCA 3W9CB 5JHBA 2KTRB 1I35A 1PUTA 3H6NA 3T8MA 1OEYA 1P0RA 2M0AA 5AUKA 4BVUC 1Q5WB 1R7SA 4K7WA 4LDTD 4C4VB 1FXAA 1T0YA 4GB9A 1TKEA 4MGZE 3U4EG 2V0GA 1A5RA 1VR9A 3W1SA 3NVWA 5JH5C 2Y5CA 1OFFA 3N1YC 1GJZA 1L6UA 1QQRA 1Q10A 2WYQA 1FCCC 1C4AA 2NMQA 4PS8A 2MA9B 2C7HA 4ZRPA 3RULA 4NJ6A 4HRSA 1XCQL 4ARCA 2DYOA 2GBRA 2IO2B 2JVCA 2MW5A 5AZHA 2ON8A 3ZXVA 2BF8B 2JZ3B 4CQNA 5EE0A 1LXDA 3PRMB 3IAM1 3SDLC 1QLBB 2FCMA 2MJEA 2IGHA 4TKNA 1WGGA 4FJZA 2WS3B 1EM7A 2K6DB 1C4CA 4JLCA 2W9NA 3V62A 1LFDA 1V9JA 4R3DA 3N3KB 4N9F4 2KFKA 2MBQA 3I63C 3Q3JA 3WCQA 3VHTC 4A8XC 4MH0E 1WZ3A 2LWPA 3B9JA 4FHJA 2QMTA 4TSSA 2OJRA 1NENB 4HKQA 4MELA 3N1XC 2LHEA 2GI9A 4C7ZA 1J7CA 4RF0A 2K0PA 3QX1A 3IAS1 4IC7B 1Q1OA 3P4SB 2LRUA 3CSTA 1QZEA 3RPFC 4A3PA 2N1VA 2ZW0A 3AE3B 1EUVB 1WY8A 3DWMA 3R2TA 2EKEC 2W82A 4ANWA 2PE6B 2IBIB 3H8HA 2REXA 1KOTA 1XF5L 1PYWD 4RGOS 1MJDA 2CR5A 4DDGD 4BKTA 3K9PB 2JF5A 2BTEA 4WQOB 4ZRKA 3ML9A 3ENEA 4EEWA 1BXTA 1WM2A 3P4QB 4XWTA 4WWNA 3DHGC 1V80A 1JROA 5D7GA 4RNAA 3PS6A 5CTRC 1C77A 2LUEA 1C3TA 2LEKA 4US9A 4GDKB 4J3OD 1E8WA 2N9XA 3E56A 2ACZB 2GMIC 4XX5A 3H7PB 4CYEA 4ARIA 3L0WB 2WLBA 4ZYSA 4ANUA 4W9GA 1PGAA 1SBBB 1FFVA 2BWES 2KC2A 4GSWA 2LGDA 2PTLA 5GXGB 3RI7C 4GMVA 1TGZB 3ZNID 3LYYA 3PV1A 3R7QA 1E5WA 1YOVB 1FNVA 1FEHA 1LO5D 2J7QB 4HJKA 1JRUA 2KXJA 2PKOA 2YLMA 5E6NA 2CS4A 2GB1A 1M4VA 2J0MA 4OHJA 1QOAA 1WXMA 2N7EA 3KQ4A 1B9RA 3FILB 2KX0A 3ZUNA 1R4NI 5L95C 3PLUA 2ZPNA 3U52E 2QJLA 1HEZE 1WX7A 2KJHB 3QK0A 3L4PA 3UGBB 1NEKB 1F2RI 2KX3A 3L17A 1FXIA 1EWYC 4G50A 5DPTA 3WIMA 1TZOA 2MLBA 2GBNA 3ECIA 3TCAA 4N6EB 2GLSA 2MBOA 2MJ3A 4JGHB 1MG4A 3RUIB 1TYGB 3ZNHB 1DOXA 1P98A 1V97A 3SFEB 1E90A 2JSVX 3DBHI 2C7NB 3DCGA 2DBYA 1KLGD 4NZLB 2DZIA 3L08A 2GBJA 3V6EB 2N9LA 2N9EB 3WAOA 4DHZE 2IGDA 4WAAA 4YTMB 5HFYA 1JALA 2V4LA 3AECB 5GMVA 5IAAC 2L7RA 3VUYA 4OZBA 4ANXA 3DBLI 5BYRA 4B6WA 1FMAD 5DPRA 3RCZA 2JWUA 2Z8LA 5BMHA 2KMAA 3BVZA 2K39A 3I9V1 1R4MI 2M8SA 1L6VA 4ZHPA 5J17A 2KTRA 4MT5A 4FA6A 1VZ6A 1F52A 3PGEA 2PLPA 4XWWA 1X1MA 4XYCA 4BOSC 1T5XD 2LVQA 3GS2A 3P63A 2LJ5A 1WX9A 1K52A 3DVGX 3NS8A 3VTVA 2BT6A 4C4VA 2JT4B 4W9JA 2ONQA 2M0XA 4G0NB 2QIEB 4BZAA 4HVBA 5AZFA 3ZNGC 2LZ6A 3VAWA 5HG2A 1TS4A 2L0TA 3AEGB 4KZ0A 4DXAB 1FM0D 3LXFA 2ZCBA 2L00B 4EZJA 4RMAA 1YJ1A 1YQ4B 2OJWA 3ML8A 5D3IB 3DBRI 2IGGA 5HHDG 2EMSA 1WGYA 5D3DA 4E71A 4FADA 4ITKA 4L2YA 2RPVA 1AN8A 1GUAB 3Q8FA 2PIAA 3HVDA 2Q5WD 4A6QA 1WJ6A 4CHKA 1FFUA 2N4FA 1E7UA 2I38A 4A9AA 3TEYA 3O13A 1G6JA 2RDBC 1QT9A 4W9HA 3ZQ4A 1S1QB 1V5TA 2DX5B 3NZ3A 1JWSD 2JXTA 3CF6E 3BWUD 3MP9A 4YTNB 4JL9A 3PREA 1TZ1A 3AN1A 3VQIA 2XEWA 4ASWC 1UZXB 3BK1A 1EWCA 2O6VD 1WJNA 2IYDB 3RNAC 4KZCA 3GZNB 2W3RA 5FKAC 1WMHB 2JYTA 2FE8A 1RRBA 4K3CA 1N5XA 4C80A 4MDKE 3S2AA 2WXMA 3B0AA 3PPAA 3J9CA 2WNMA 3VTUA 2MBBB 4GGQA 2E6XA 3AI5A 3OWEB 2KOXA 4P1BC 4DDID 2OEDA 4HPPA 3UINB 3DPDA 2KMCA 3IG3A 1YN5A 3W5VB 1KFYB 1QKZA 3W5UB 3M95A 2LGYA 4ZRIA 3I5JC 3ZDTA 1V81A 4PYZA 3NZUA 4IWQA 4GDKA 3A4SC 2WDQB 1GG3A 1KM7A 2W3SA 3N20C 2N1WA 2KDEB 3PZ8A 3AE4B 5D6JB 2G3QB 2WXKA 3ALBA 3BVGA 1T3QA 5KHOA 1IYFA 1HTOA 1J7AA 1I42A 2K8CA 4DBGA 2M19A 1V6EA 1YJJA 4AUQC 4AP4C 1MVKA 4PYUA 1RLFA 2MH7A 4B95A 1HXYD 4K7UA 3ZNZB 3X23A 1LGRA 3IHPC 1SJHD 1UWMA 2FIDA 3V6CB 3ZVVA 3KUCB 1PGXA 1L0VB 4KV2A 1RFAA 3FILA 1NYRA 1WRIA 1PGBA 2JU6X 1FRRA 1CZPA 5G55A 5C23A 1SF0A 2KVRA 3RYTA 4WAFA 1TS2A 5D94A 2WX0A 5HI1A 3HHMA 2WX1A 4H2AA 2O2VB 1WYWB 1STEA 1C76A 2DENB 2NR2A 1TY0A 1GPXA 2IO3B 3MC9A 1OQYA 1MHHE 1WRDB 4EFOA 2ASQA 2PVGC 3B08A 3W1SC 3LDZE 4W9DA 2K25A 2KJRA 1XLPA 2WDVB 2K8HA 3EC8A 3QIJA 4REZA 3OJ3A 3P2BA 4WURA 1MPEA 5H92C 3MFGA 5JHAA 2IPKD 3T9LA 1FD6A 2L83A 2PEAA 4LNOA 2IY0B 4DHZB 3A1QB 2BYFA 2NTTA 4IWPA 3RNEC 2INNE 1PFDA 3K9OB 2TSSA 2KYWA 3M62B 4W9IA 2BYTA 2N7DA 3U2SC 1A70A 1MHXA 2JRHA 2JRIB 2A4ZA 2PVOD 2KZRA 2L05A 2KQSA 2K1FA 2CHZA 4P16A 1FO4A 1CJEA 4HDQA 3V61A 1YX5B 4RCOA 5JZEB 3ZIMA 1MFWA 1P3QU 2KC1A 5T8IA 2K5PA 3KVFB 4JX1C 3ZLZA 3TEZA 1WXQA 4JE3B 3SD5A 5C1ZA 2QHOA 3ZTDA 2C7MB 2NS5A 2D11A 3ZJTA 3WALA 1UBIA 3ZXRA 2FCSA 1WSPA 2XNAC 3NG0A 3TBLD 4NQKE 3N1ZC 3PT2B 1I4QA 3Q8CA 1WFYA 3GOEA 2N0SB 4IDIA 2J53A 4NPNA 2RSUA 3AH7A 1DGJA 1IP9A 3W1YA 1IGCA 2LVOA 3MC0B 1Y8RC 2BS4B 2C5LC 2WXLA 3DQVA 3SR6A 1XLNA 4MGKE 1P9DU 2VZKB 1OEYJ 1WGHA 1YQ3B 4E3CA 1F0ZA 1U4AA 2ZZPB 2WP9B 1S3SG 3UIOB 1WMHA 3RD2A 4A3OA 3PRZA 3JSVB 2J0JA 1XO3A 3AEFB 2J4XA 4AOFA 3Q3MC 3ZYYX 1WGDA 4XC2A 3TL5A 2CKHB 1PQSA 4WWOA 2PMVA 1WM3A 3PZ7A 2BGFA 3UF8A 1UBQA 2KANA 2O6VB 3OAWA 2W55A 2MWSB 1FNUA 1IBXA 3DVGY 4DXFA 1V8CA 4K81A 1OQRA 3AMZA 3FKYA 5E6OA 3HM3A 2HJ1A 1UNSA 1MI0A 2RR9A 4XGAB 1WZ0A 4BKGA 2KT7A 3C19A 1XQQA 4NJCA 2DAJA 1OQQA 1NYQA 1D5XC 4EKUA 3APFA 3Q3NC 2WXQA 2UYZB 3PLVA 1SIJA 4HDOA 1KJTA 1SE2A 5CX3A 3GB1A 3GE8C 2MSED 2MQJA 3VTWA 3VUXA 2VH2A 5DPWA 2L1AA 3AE5B 4YXDB 1MG8A 3RNFC 5IKCM 1P7FA 1GAQB 3VH4B 3OG5A 3DOWA 3MJWA 4M8NA 4BAXA 4DQOC 2WXPA 2HTHA 4S17A 1NVID 1H4RA 4ICUA 3LJ3A 4X57B 2SAKA 3AE2B 3AU5A 2LJIA 1QF6A 2LMCA 4IM2A 2FBWB 4TMAB 3UIPB 4MSMB 2QILA 3VUWA 1SXTA 3T3OA 4FBJB 1WR1A 2XK5B 4M02A 1SJED 1BMLC 2WWZA 4BOZB 3NRZA 1PDXA 4LJPB 4OVUA 2J52A 1YMHE 1WJ4A 4NJ7A 2KO3A 4LNNA 1L0YB 3KYCD 5FK9C 3OJ4B 1KRHA 3QJZA 3Q6BA 2C60A 2AL3A 3SU8X 4I6PA 1R4NB 2KJ6A 5BMIA 3VXWA 3RT3B 3DWGC 3HVZA 4RM9A 1ET9A 2LRWA 2SEBD 3TUOA 2DAFA 2JYEA 4S0RA 4I6LB 4KX6B 1SIFA 3NS1A 2WXNA 1C9FA 2WXGA 3IVFA 3AB5A 3BYTB 2FCQA 3AEEB 3CSFA 3PVLA 2V3NA 4I6NB 2BKRB 3A1QA 3MTNB 1TTNA 4ZHOA 1I4RA 2QEJC 4OW0A 2JPHA 2ZVNA 2Z59B 3AEDB 4A55A 4TUUA 2V1YA 4M0WB 1E8ZA 2GOWA 2WXRA 2WGSA 3A9KB 1N63A 5BYSA 1V1OA 3DBHB 1N60A 3N32A 3KW5B 3UQBA 1OTRB 1VCBA 3GE3C 1P7EA 2NBVB 2INPE 5CHVC 3QARA 1HZ5A 4C00A 5EE1A 3BINA 3RFZB 4BKSD 2KWUB 2LASA 3Q2AC 5HKHA 3PZDA 3DBLB 2QDFA 4MSQB 1XEEA 2AWTA 1OGWA 1VD2A 1AARA 2NVUI 1YN3A 1R4MB 2CHXA 4IWOA 4OZAA 2MBEA 2BS3B 3T3NA 5TR5A 1GB1A 3RN9C 4WJQA 4C7YA 2IO1B 2FAZA 5LXIB 3MHSD 3MC8A 3EUB2 1C78A 3B2GA 1JWMD 5DPSA 2ZNVB 2M17A 3JVZX 4A90A 2WXHA 3L10B 2OOBB 4EE2A 3MJ5A 4LDTB 4II2B 1HQRD 2JWZA 1N62A 1TY2A 2Y5PA 4RGNA 4A20A 1WJUA 2D07B 4WQMA 1WE7A 2DZJA 1CQVA 4WWMA 1WI0A 3DBRB 1Z2MA 4NY0A 3RNGC 2G45B 4W9EA 1VLBA 2KNBA 4ZOHC 1NI2A 4HCNB 3WAMA 3DBSA 3HRDD 1HA5A 1WGRA 3JYUA 3AE7B 4EUTA 3DVNU 1JWBD 2VRRB 3PO0A 1ZUD2 4KVGB 2WU2B 3JSVA 3VVWB 2WXOA 2DWQA 2INDC 3L54A 3RZFA 2JX5A 5C3JB 4M01A 4P6VF 3Q14C 2D10A 2DLBA 3Q8BA 3VH3B 2K22A 1TS5A 1UGMA 5C2TB 4GU2A 1AWDA 2VH1A 4ACFA 4GIVA 4YTPB 4EZKA 3QHTA 1UH6A 3DHHC 4XZ4A 4MM3B 2M1MA 1BT0A 1F2RC 2L8JA 2KFJA 2FCNA 2LGIA 1XLOA 4G11A 4PT5A 2JZPA 3NHEB 1KLVA 4GDLB 3V60A 1J19A 4RFBA 3LB8C 3L13A 1E0ZA 1WWTA 2PE9A 1I4PA 3ZGZA 1V1PB 3NVYA 4QAYA 4UDUC 2XN9C 4FJVB 1K50A 1FRDA 3C8YA 4WIPA 1IPGA 2M4NA 1EU3A 3RMKC 3C0RB 3H7PA 2XBBC 1SGHA 4US8A 3JW0X 2HE7A 2V3PA 3AXCA 2AEHA 2MRPA 1FIQA 2GBKA 1WYGA 4OVZA 2M56B 2IDYA 4HPLB 2IZVB 1ZDVA 2KD0A 4DXGA 1ZGUB 3R66C 2R2QA 2KQ4X 4ZRJA 3HIZA 4URKA 3UQAA 1ZXIA 1V86A 4GOCA 2XK5A 4HROA 2RPQA 4YSXB 2LGXA 4YSZB 2ZEQA 2QC8A 1RM6C 2L0FA 1KF6B 2DZMA 2ZCCA 1JQ4A 2D3CA 3SFDB 1L4ZB 5IN7A 4GN1A 3N30A 3TEWA 1T6BX 1M94A 1ROEA 4WJNA 2AQ2B 2KMMA 3P1MA 1KTKA 3PTFC 4K7SA 3PHWB 3R2IA 3EFUA 1I4HA 3RZWC 2NTSA 4BBNF 5L83A 2G1EA 5AZGA 1V5OA 1JWUD 1UELA 2IJ0A 3AE6B 3NVVA 3NUHB 2CU3A 4AS1A 4LTUA 2RDHA 1WH3A 5I4DA 1GOZA 1AW7A 3A9KA 2MHJA 1YQBA 4TQ1A 1EU4A 1XXGA 3PRPB 4MJSB 1VJKA 2GRIA 1EF5A 1XCTL 5JXVA 4F7ZA 3QC8B 1T0SC 2MP2B 2WDRB 5CHFA 4P1CC 2Z0EB 3FC4A 5G5HA 2N9KA 4PK1A 3N9YC 5LNK1 1RWSA 1SE3A 1YD8U 2HDEA 2DYBA 2IO0B 1NDDA 5J2RA 4M8MA 2KKCA 1VZ8A 2NBWB 3MHZA 4XE0A 1ENFA 2X8XX 3DVNV 1FXTB 1CK1A 4LCDE 2V9HA 2IY1B 2EMTA 3RNBC 3M3JA 2KLCA 4FXCA 5CHWA 5EE9A 2RD0A 2BYEA 5G2NA 2L32A 3IXSA 1E8YA 1TS3A 2AQ1B 3ZJVA 4AWJA 2EKIA 2RDGA 3IBEA 4DHJD 1SE4A 4HK2A 1VDVA 3ZJUA 4KDIC 2K8BA 1T0RC 2K6QA 2MEKA 2Y5BB 1YJIA 3ZKJC 1F1HA 5IOIA 4EZLA 4KKIA 4HWIB 2AL6A 2KWCA 3Q3FA 4B0MA 1DOYA 2L52A 1N5WA 2LHDA 1FCLA 2B76B 2PPHA 2A5UA 3IT4B 1IUEA 4MGIE 1WX8A 1J8CA 2EELA 4B0EA 1SE9A 2WXIA 1XLQA 4GLSC 4IM0A 3AEAB 3QAQA 3WANA 2CHWA 4MGYE 3A33B 4TV3A 2NPTB 3BYYB 3ABVB 4ANVA 3ZW3A 5BO4B 2K9XA 4MM3A 2KAJA 4K3BA 2BPSA 3EFCA 1L4DB 5IP4D 4JWUC 3ZDMC 1JCKB 2D3AA 4GDLA 4RM8A 1E8XA 3P42A 3NVZA 5BMGA 3X0WA 3D32A 3EECA 4PS3A 2KWDA 5EDSA 1V1PA 2OHFA 2YEPF 3H7SA 4HLEA 2KN4A 3WAPA 2JUOA 1UD7A 4LK0M 1T0QC 4JPSA 1KLUD 1V2YA 4YT0B 3KWVA 3AE9B 4KGRA 2ZW1A 3QCAA 2C9WB 4NNJB 1HE8A 3KYDD 4OZCA 4KIKB 2K3UA 4ZDVA 4NAMA 2MCNB 1JWAD 3KWLA 2LUMA 2UU7A 3R8BA 2I1JA 2HJ8A 4FN2A 2KWVB 4FULA 1HZ6A 3QWZB 4K1RB 4YWGG 5IA7A 1K8RB 2WXJA 3IFWB 5KHQA 1JW9D 4RGTA 1UF0A 5FR3A 3M63B 2RMMA 2LFIA 3BY4B 4IKGA
chains in the Genus database with same CATH topology
4P1BC 3N20C 3RN9C 2INCC 3Q14C 3Q3NC 1T0RC 3DHIC 3Q3OC 3RMKC 3Q2AC 1T0QC 3I63C 1T0SC 3N1YC 4P1CC 3DHGC 3N1ZC 3Q3MC 3GE8C 3RNCC 3N1XC 3RNGC 3GE3C 3RI7C 2INDC 3RNBC 2RDBC 3RNAC 3DHHC 3I5JC 3RNFC 3RNEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P1B C;  3N20 C;  3RN9 C;  2INC C;  3Q14 C;  3Q3N C;  1T0R C;  3DHI C;  3Q3O C;  3RMK C;  3Q2A C;  1T0Q C;  3I63 C;  1T0S C;  3N1Y C;  4P1C C;  3DHG C;  3N1Z C;  3Q3M C;  3GE8 C;  3RNC C;  3N1X C;  3RNG C;  3GE3 C;  3RI7 C;  2IND C;  3RNB C;  2RDB C;  3RNA C;  3DHH C;  3I5J C;  3RNF C;  3RNE C; 
#chains in the Genus database with same CATH topology
 4WJP A;  1DYQ A;  1B1Z A;  4JWS C;  4F1S A;  2DNF A;  3GP7 A;  1WXS A;  1E6E B;  4ZRQ A;  1TBE A;  2JY6 A;  4NAW B;  2BS2 B;  2WU5 B;  3ZRC A;  4HCP B;  1J7B A;  2O2V A;  3AE8 B;  4GXB A;  4HXD A;  4IUM B;  3ZO5 B;  2N9P C;  1YIW A;  2KHW B;  3CIR B;  2I1K A;  2KDI A;  4FLH A;  3I57 A;  3HK0 A;  2HD5 B;  2KN5 A;  4FHK A;  2FUH B;  4USA A;  1ZDX A;  2LI5 A;  3ONS A;  1DOI A;  1LQB A;  1UWX A;  2KDM A;  2I2Y A;  3H1U A;  4JIO U;  1WIA A;  2ICI A;  2UWQ A;  3V3X A;  3IT6 B;  3Q69 A;  1WXV A;  4KSK C;  4MJS A;  3L16 A;  1NBF C;  3I3T B;  3KUZ A;  3APC A;  3QQ8 B;  2MP2 A;  2W54 A;  3HM6 X;  1L2N A;  3E9S A;  4W9K A;  2BYV E;  5G5G A;  1K51 A;  1D3Z A;  1UGJ A;  2V3S A;  5LXH A;  1SSN A;  2DYM A;  2ZPY A;  3H9D A;  2R2O A;  2KTF A;  2L3Z A;  1YX6 B;  1E7V A;  2JQR B;  1F9J A;  2DHZ A;  1H8C A;  1L5P A;  2AQ3 B;  4BKS A;  4WH4 A;  4DWF A;  2FIF A;  3Q8A A;  5FR6 A;  4IOI E;  3TSS A;  3WA0 A;  4ZYN A;  1ZOY B;  4EOY A;  5E6P A;  2AX5 A;  3A9J B;  3BII D;  4LLG M;  2JXX A;  5H8Y E;  4L1B A;  3TMP B;  3U8Z A;  1WGK A;  4BBN C;  4MEM A;  2GBM A;  2KDB A;  2D3G A;  1L7Y A;  1QOB A;  3OLM D;  2N7J A;  3EA6 A;  1GC7 A;  1GB4 A;  1ZPS A;  2G9H D;  4ICV A;  1UUP A;  4JQW C;  1D5M C;  1N6Z A;  1FNW A;  1SB3 C;  2YEP B;  5TSS A;  5EE3 A;  1XT9 B;  1EF1 A;  3APD A;  4J6I A;  3AU4 A;  1KH0 A;  2WQY B;  2DZK A;  3R7R A;  2QSD A;  4OVV A;  4BFR A;  1GC6 A;  1E9M A;  3BZD B;  2LXC A;  1ZW7 A;  1HTQ A;  4HJG E;  3EGR A;  4DHJ B;  3AE1 B;  4IW0 A;  3VR8 B;  1SEB D;  3P4P B;  2BWF A;  1WE6 A;  1IGD A;  2NBU A;  4HKZ E;  1F77 A;  4PS7 A;  2CJN A;  2VZK D;  2PJH A;  3AM9 A;  1D6E C;  4MAC A;  1D5Z C;  4D2K A;  3A4R A;  1QOG A;  2ZJD A;  1FPY A;  1QIL A;  1BUI C;  2V4I B;  3SHQ A;  4E74 A;  3VRB B;  5IO9 A;  2NPT A;  2INC C;  3U7Z A;  3UI3 A;  2H89 B;  3DHI C;  3Q3O C;  3GZN I;  2O6V A;  2PW9 A;  1ESF A;  3KH0 A;  2H88 B;  3DDC B;  4KGS A;  5AEK B;  1I4G A;  2WXF A;  3NOB A;  3O65 B;  3RNC C;  4W9C A;  2J0K A;  3CWI A;  2BKF A;  4FJY A;  3VFK A;  1EO6 A;  2KFK B;  2BBC A;  3AV8 A;  3B2F A;  1WF9 A;  1N61 A;  2LD9 A;  2KK8 A;  4AJW A;  4O1N A;  1E7P B;  1TT5 B;  1ZE3 D;  2MBH A;  3NJT A;  3AEB B;  1IBX B;  2KVZ A;  2BB6 A;  4XDC A;  1RFK A;  4II3 B;  2MX2 A;  4N59 A;  2G4D B;  1L0X B;  4HEA 1;  2G4S A;  5LLI A;  4KIK A;  4IM3 A;  4M00 A;  2JZZ A;  1GNU A;  1V49 A;  3U7D A;  3Q8E A;  2AYO B;  3R3M A;  4KKJ A;  5MPO A;  1C4P A;  3V05 A;  3CMM B;  2E3T A;  4Q2J A;  2L76 A;  4W9L A;  1YNT E;  5E6J A;  4RGM A;  4IG7 B;  1AYF A;  2KDF B;  1ZKH A;  4RF1 A;  4YSY B;  2BW2 A;  3ZRF A;  2MJD A;  4RH6 A;  1YN4 A;  3U30 A;  2X38 A;  3PSE B;  4HPM B;  1ZP0 B;  2CJO A;  1I4X A;  2ZVO A;  3EHV A;  4NAW A;  5BYQ A;  1C1Y B;  4B9K A;  3TIX A;  3AUL A;  5DCN A;  3BVM A;  2LXA A;  5AUI A;  3VDZ A;  1RAX A;  2ZNV C;  3W2D A;  4F8C B;  3BK2 A;  4TQ0 A;  4CO7 A;  4N58 A;  4AQ7 A;  3VR9 B;  1TJE A;  1I7H A;  1RYJ A;  1TKY A;  2QCZ A;  4MH8 A;  3HUI A;  1JML A;  3NY5 A;  1XD3 B;  2BQQ A;  4G3X B;  1K53 A;  4DK5 A;  2B3A A;  1D4B A;  1TIF A;  4KDL B;  1ISN A;  1Q0W B;  1VZ7 A;  3TJP A;  3ETR A;  3ZTC A;  2Z0D B;  4M0W A;  4LJO B;  2KQ7 A;  1VRA B;  2LVP A;  4W9F A;  4NQL B;  3VRA B;  2WDT B;  4LNF A;  2J42 A;  3B1L X;  2KAC A;  1CMX B;  1ACC A;  2CU1 A;  2FNJ B;  1ET6 A;  1WR6 E;  4L23 A;  5D2M B;  4KSL C;  2BB5 A;  4WJO A;  4YL8 A;  4KGT A;  4C56 C;  4LNI A;  2RGF A;  4P7I A;  2D5G A;  3QA8 A;  2KLG A;  3SEB A;  1Y56 A;  2R61 A;  1NI3 A;  4AJY B;  4LNK A;  2HTM E;  1TKG A;  1J0G A;  3TEX A;  2YVC A;  1JRP A;  3NZS A;  1Z5S B;  2Y3A A;  3P4R B;  4XDD A;  5J18 A;  1P1A A;  1QOF A;  2WHI A;  2FUG 1;  2D3B A;  2NCN A;  2LGS A;  3A9J A;  1E10 A;  2D2Q A;  1WXA A;  4WWP A;  3FAH A;  3KUD B;  3URY A;  1C79 A;  1ZXH A;  3KLS X;  3PHX B;  1LM8 B;  2BVC A;  3W9C B;  5JHB A;  2KTR B;  1I35 A;  1PUT A;  3H6N A;  3T8M A;  1OEY A;  1P0R A;  2M0A A;  5AUK A;  4BVU C;  1Q5W B;  1R7S A;  4K7W A;  4LDT D;  4C4V B;  1FXA A;  1T0Y A;  4GB9 A;  1TKE A;  4MGZ E;  3U4E G;  2V0G A;  1A5R A;  1VR9 A;  3W1S A;  3NVW A;  5JH5 C;  2Y5C A;  1OFF A;  3N1Y C;  1GJZ A;  1L6U A;  1QQR A;  1Q10 A;  2WYQ A;  1FCC C;  1C4A A;  2NMQ A;  4PS8 A;  2MA9 B;  2C7H A;  4ZRP A;  3RUL A;  4NJ6 A;  4HRS A;  1XCQ L;  4ARC A;  2DYO A;  2GBR A;  2IO2 B;  2JVC A;  2MW5 A;  5AZH A;  2ON8 A;  3ZXV A;  2BF8 B;  2JZ3 B;  4CQN A;  5EE0 A;  1LXD A;  3PRM B;  3IAM 1;  3SDL C;  1QLB B;  2FCM A;  2MJE A;  2IGH A;  4TKN A;  1WGG A;  4FJZ A;  2WS3 B;  1EM7 A;  2K6D B;  1C4C A;  4JLC A;  2W9N A;  3V62 A;  1LFD A;  1V9J A;  4R3D A;  3N3K B;  4N9F 4;  2KFK A;  2MBQ A;  3I63 C;  3Q3J A;  3WCQ A;  3VHT C;  4A8X C;  4MH0 E;  1WZ3 A;  2LWP A;  3B9J A;  4FHJ A;  2QMT A;  4TSS A;  2OJR A;  1NEN B;  4HKQ A;  4MEL A;  3N1X C;  2LHE A;  2GI9 A;  4C7Z A;  1J7C A;  4RF0 A;  2K0P A;  3QX1 A;  3IAS 1;  4IC7 B;  1Q1O A;  3P4S B;  2LRU A;  3CST A;  1QZE A;  3RPF C;  4A3P A;  2N1V A;  2ZW0 A;  3AE3 B;  1EUV B;  1WY8 A;  3DWM A;  3R2T A;  2EKE C;  2W82 A;  4ANW A;  2PE6 B;  2IBI B;  3H8H A;  2REX A;  1KOT A;  1XF5 L;  1PYW D;  4RGO S;  1MJD A;  2CR5 A;  4DDG D;  4BKT A;  3K9P B;  2JF5 A;  2BTE A;  4WQO B;  4ZRK A;  3ML9 A;  3ENE A;  4EEW A;  1BXT A;  1WM2 A;  3P4Q B;  4XWT A;  4WWN A;  3DHG C;  1V80 A;  1JRO A;  5D7G A;  4RNA A;  3PS6 A;  5CTR C;  1C77 A;  2LUE A;  1C3T A;  2LEK A;  4US9 A;  4GDK B;  4J3O D;  1E8W A;  2N9X A;  3E56 A;  2ACZ B;  2GMI C;  4XX5 A;  3H7P B;  4CYE A;  4ARI A;  3L0W B;  2WLB A;  4ZYS A;  4ANU A;  4W9G A;  1PGA A;  1SBB B;  1FFV A;  2BWE S;  2KC2 A;  4GSW A;  2LGD A;  2PTL A;  5GXG B;  3RI7 C;  4GMV A;  1TGZ B;  3ZNI D;  3LYY A;  3PV1 A;  3R7Q A;  1E5W A;  1YOV B;  1FNV A;  1FEH A;  1LO5 D;  2J7Q B;  4HJK A;  1JRU A;  2KXJ A;  2PKO A;  2YLM A;  5E6N A;  2CS4 A;  2GB1 A;  1M4V A;  2J0M A;  4OHJ A;  1QOA A;  1WXM A;  2N7E A;  3KQ4 A;  1B9R A;  3FIL B;  2KX0 A;  3ZUN A;  1R4N I;  5L95 C;  3PLU A;  2ZPN A;  3U52 E;  2QJL A;  1HEZ E;  1WX7 A;  2KJH B;  3QK0 A;  3L4P A;  3UGB B;  1NEK B;  1F2R I;  2KX3 A;  3L17 A;  1FXI A;  1EWY C;  4G50 A;  5DPT A;  3WIM A;  1TZO A;  2MLB A;  2GBN A;  3ECI A;  3TCA A;  4N6E B;  2GLS A;  2MBO A;  2MJ3 A;  4JGH B;  1MG4 A;  3RUI B;  1TYG B;  3ZNH B;  1DOX A;  1P98 A;  1V97 A;  3SFE B;  1E90 A;  2JSV X;  3DBH I;  2C7N B;  3DCG A;  2DBY A;  1KLG D;  4NZL B;  2DZI A;  3L08 A;  2GBJ A;  3V6E B;  2N9L A;  2N9E B;  3WAO A;  4DHZ E;  2IGD A;  4WAA A;  4YTM B;  5HFY A;  1JAL A;  2V4L A;  3AEC B;  5GMV A;  5IAA C;  2L7R A;  3VUY A;  4OZB A;  4ANX A;  3DBL I;  5BYR A;  4B6W A;  1FMA D;  5DPR A;  3RCZ A;  2JWU A;  2Z8L A;  5BMH A;  2KMA A;  3BVZ A;  2K39 A;  3I9V 1;  1R4M I;  2M8S A;  1L6V A;  4ZHP A;  5J17 A;  2KTR A;  4MT5 A;  4FA6 A;  1VZ6 A;  1F52 A;  3PGE A;  2PLP A;  4XWW A;  1X1M A;  4XYC A;  4BOS C;  1T5X D;  2LVQ A;  3GS2 A;  3P63 A;  2LJ5 A;  1WX9 A;  1K52 A;  3DVG X;  3NS8 A;  3VTV A;  2BT6 A;  4C4V A;  2JT4 B;  4W9J A;  2ONQ A;  2M0X A;  4G0N B;  2QIE B;  4BZA A;  4HVB A;  5AZF A;  3ZNG C;  2LZ6 A;  3VAW A;  5HG2 A;  1TS4 A;  2L0T A;  3AEG B;  4KZ0 A;  4DXA B;  1FM0 D;  3LXF A;  2ZCB A;  2L00 B;  4EZJ A;  4RMA A;  1YJ1 A;  1YQ4 B;  2OJW A;  3ML8 A;  5D3I B;  3DBR I;  2IGG A;  5HHD G;  2EMS A;  1WGY A;  5D3D A;  4E71 A;  4FAD A;  4ITK A;  4L2Y A;  2RPV A;  1AN8 A;  1GUA B;  3Q8F A;  2PIA A;  3HVD A;  2Q5W D;  4A6Q A;  1WJ6 A;  4CHK A;  1FFU A;  2N4F A;  1E7U A;  2I38 A;  4A9A A;  3TEY A;  3O13 A;  1G6J A;  2RDB C;  1QT9 A;  4W9H A;  3ZQ4 A;  1S1Q B;  1V5T A;  2DX5 B;  3NZ3 A;  1JWS D;  2JXT A;  3CF6 E;  3BWU D;  3MP9 A;  4YTN B;  4JL9 A;  3PRE A;  1TZ1 A;  3AN1 A;  3VQI A;  2XEW A;  4ASW C;  1UZX B;  3BK1 A;  1EWC A;  2O6V D;  1WJN A;  2IYD B;  3RNA C;  4KZC A;  3GZN B;  2W3R A;  5FKA C;  1WMH B;  2JYT A;  2FE8 A;  1RRB A;  4K3C A;  1N5X A;  4C80 A;  4MDK E;  3S2A A;  2WXM A;  3B0A A;  3PPA A;  3J9C A;  2WNM A;  3VTU A;  2MBB B;  4GGQ A;  2E6X A;  3AI5 A;  3OWE B;  2KOX A;  4P1B C;  4DDI D;  2OED A;  4HPP A;  3UIN B;  3DPD A;  2KMC A;  3IG3 A;  1YN5 A;  3W5V B;  1KFY B;  1QKZ A;  3W5U B;  3M95 A;  2LGY A;  4ZRI A;  3I5J C;  3ZDT A;  1V81 A;  4PYZ A;  3NZU A;  4IWQ A;  4GDK A;  3A4S C;  2WDQ B;  1GG3 A;  1KM7 A;  2W3S A;  3N20 C;  2N1W A;  2KDE B;  3PZ8 A;  3AE4 B;  5D6J B;  2G3Q B;  2WXK A;  3ALB A;  3BVG A;  1T3Q A;  5KHO A;  1IYF A;  1HTO A;  1J7A A;  1I42 A;  2K8C A;  4DBG A;  2M19 A;  1V6E A;  1YJJ A;  4AUQ C;  4AP4 C;  1MVK A;  4PYU A;  1RLF A;  2MH7 A;  4B95 A;  1HXY D;  4K7U A;  3ZNZ B;  3X23 A;  1LGR A;  3IHP C;  1SJH D;  1UWM A;  2FID A;  3V6C B;  3ZVV A;  3KUC B;  1PGX A;  1L0V B;  4KV2 A;  1RFA A;  3FIL A;  1NYR A;  1WRI A;  1PGB A;  2JU6 X;  1FRR A;  1CZP A;  5G55 A;  5C23 A;  1SF0 A;  2KVR A;  3RYT A;  4WAF A;  1TS2 A;  5D94 A;  2WX0 A;  5HI1 A;  3HHM A;  2WX1 A;  4H2A A;  2O2V B;  1WYW B;  1STE A;  1C76 A;  2DEN B;  2NR2 A;  1TY0 A;  1GPX A;  2IO3 B;  3MC9 A;  1OQY A;  1MHH E;  1WRD B;  4EFO A;  2ASQ A;  2PVG C;  3B08 A;  3W1S C;  3LDZ E;  4W9D A;  2K25 A;  2KJR A;  1XLP A;  2WDV B;  2K8H A;  3EC8 A;  3QIJ A;  4REZ A;  3OJ3 A;  3P2B A;  4WUR A;  1MPE A;  5H92 C;  3MFG A;  5JHA A;  2IPK D;  3T9L A;  1FD6 A;  2L83 A;  2PEA A;  4LNO A;  2IY0 B;  4DHZ B;  3A1Q B;  2BYF A;  2NTT A;  4IWP A;  3RNE C;  2INN E;  1PFD A;  3K9O B;  2TSS A;  2KYW A;  3M62 B;  4W9I A;  2BYT A;  2N7D A;  3U2S C;  1A70 A;  1MHX A;  2JRH A;  2JRI B;  2A4Z A;  2PVO D;  2KZR A;  2L05 A;  2KQS A;  2K1F A;  2CHZ A;  4P16 A;  1FO4 A;  1CJE A;  4HDQ A;  3V61 A;  1YX5 B;  4RCO A;  5JZE B;  3ZIM A;  1MFW A;  1P3Q U;  2KC1 A;  5T8I A;  2K5P A;  3KVF B;  4JX1 C;  3ZLZ A;  3TEZ A;  1WXQ A;  4JE3 B;  3SD5 A;  5C1Z A;  2QHO A;  3ZTD A;  2C7M B;  2NS5 A;  2D11 A;  3ZJT A;  3WAL A;  1UBI A;  3ZXR A;  2FCS A;  1WSP A;  2XNA C;  3NG0 A;  3TBL D;  4NQK E;  3N1Z C;  3PT2 B;  1I4Q A;  3Q8C A;  1WFY A;  3GOE A;  2N0S B;  4IDI A;  2J53 A;  4NPN A;  2RSU A;  3AH7 A;  1DGJ A;  1IP9 A;  3W1Y A;  1IGC A;  2LVO A;  3MC0 B;  1Y8R C;  2BS4 B;  2C5L C;  2WXL A;  3DQV A;  3SR6 A;  1XLN A;  4MGK E;  1P9D U;  2VZK B;  1OEY J;  1WGH A;  1YQ3 B;  4E3C A;  1F0Z A;  1U4A A;  2ZZP B;  2WP9 B;  1S3S G;  3UIO B;  1WMH A;  3RD2 A;  4A3O A;  3PRZ A;  3JSV B;  2J0J A;  1XO3 A;  3AEF B;  2J4X A;  4AOF A;  3Q3M C;  3ZYY X;  1WGD A;  4XC2 A;  3TL5 A;  2CKH B;  1PQS A;  4WWO A;  2PMV A;  1WM3 A;  3PZ7 A;  2BGF A;  3UF8 A;  1UBQ A;  2KAN A;  2O6V B;  3OAW A;  2W55 A;  2MWS B;  1FNU A;  1IBX A;  3DVG Y;  4DXF A;  1V8C A;  4K81 A;  1OQR A;  3AMZ A;  3FKY A;  5E6O A;  3HM3 A;  2HJ1 A;  1UNS A;  1MI0 A;  2RR9 A;  4XGA B;  1WZ0 A;  4BKG A;  2KT7 A;  3C19 A;  1XQQ A;  4NJC A;  2DAJ A;  1OQQ A;  1NYQ A;  1D5X C;  4EKU A;  3APF A;  3Q3N C;  2WXQ A;  2UYZ B;  3PLV A;  1SIJ A;  4HDO A;  1KJT A;  1SE2 A;  5CX3 A;  3GB1 A;  3GE8 C;  2MSE D;  2MQJ A;  3VTW A;  3VUX A;  2VH2 A;  5DPW A;  2L1A A;  3AE5 B;  4YXD B;  1MG8 A;  3RNF C;  5IKC M;  1P7F A;  1GAQ B;  3VH4 B;  3OG5 A;  3DOW A;  3MJW A;  4M8N A;  4BAX A;  4DQO C;  2WXP A;  2HTH A;  4S17 A;  1NVI D;  1H4R A;  4ICU A;  3LJ3 A;  4X57 B;  2SAK A;  3AE2 B;  3AU5 A;  2LJI A;  1QF6 A;  2LMC A;  4IM2 A;  2FBW B;  4TMA B;  3UIP B;  4MSM B;  2QIL A;  3VUW A;  1SXT A;  3T3O A;  4FBJ B;  1WR1 A;  2XK5 B;  4M02 A;  1SJE D;  1BML C;  2WWZ A;  4BOZ B;  3NRZ A;  1PDX A;  4LJP B;  4OVU A;  2J52 A;  1YMH E;  1WJ4 A;  4NJ7 A;  2KO3 A;  4LNN A;  1L0Y B;  3KYC D;  5FK9 C;  3OJ4 B;  1KRH A;  3QJZ A;  3Q6B A;  2C60 A;  2AL3 A;  3SU8 X;  4I6P A;  1R4N B;  2KJ6 A;  5BMI A;  3VXW A;  3RT3 B;  3DWG C;  3HVZ A;  4RM9 A;  1ET9 A;  2LRW A;  2SEB D;  3TUO A;  2DAF A;  2JYE A;  4S0R A;  4I6L B;  4KX6 B;  1SIF A;  3NS1 A;  2WXN A;  1C9F A;  2WXG A;  3IVF A;  3AB5 A;  3BYT B;  2FCQ A;  3AEE B;  3CSF A;  3PVL A;  2V3N A;  4I6N B;  2BKR B;  3A1Q A;  3MTN B;  1TTN A;  4ZHO A;  1I4R A;  2QEJ C;  4OW0 A;  2JPH A;  2ZVN A;  2Z59 B;  3AED B;  4A55 A;  4TUU A;  2V1Y A;  4M0W B;  1E8Z A;  2GOW A;  2WXR A;  2WGS A;  3A9K B;  1N63 A;  5BYS A;  1V1O A;  3DBH B;  1N60 A;  3N32 A;  3KW5 B;  3UQB A;  1OTR B;  1VCB A;  3GE3 C;  1P7E A;  2NBV B;  2INP E;  5CHV C;  3QAR A;  1HZ5 A;  4C00 A;  5EE1 A;  3BIN A;  3RFZ B;  4BKS D;  2KWU B;  2LAS A;  3Q2A C;  5HKH A;  3PZD A;  3DBL B;  2QDF A;  4MSQ B;  1XEE A;  2AWT A;  1OGW A;  1VD2 A;  1AAR A;  2NVU I;  1YN3 A;  1R4M B;  2CHX A;  4IWO A;  4OZA A;  2MBE A;  2BS3 B;  3T3N A;  5TR5 A;  1GB1 A;  3RN9 C;  4WJQ A;  4C7Y A;  2IO1 B;  2FAZ A;  5LXI B;  3MHS D;  3MC8 A;  3EUB 2;  1C78 A;  3B2G A;  1JWM D;  5DPS A;  2ZNV B;  2M17 A;  3JVZ X;  4A90 A;  2WXH A;  3L10 B;  2OOB B;  4EE2 A;  3MJ5 A;  4LDT B;  4II2 B;  1HQR D;  2JWZ A;  1N62 A;  1TY2 A;  2Y5P A;  4RGN A;  4A20 A;  1WJU A;  2D07 B;  4WQM A;  1WE7 A;  2DZJ A;  1CQV A;  4WWM A;  1WI0 A;  3DBR B;  1Z2M A;  4NY0 A;  3RNG C;  2G45 B;  4W9E A;  1VLB A;  2KNB A;  4ZOH C;  1NI2 A;  4HCN B;  3WAM A;  3DBS A;  3HRD D;  1HA5 A;  1WGR A;  3JYU A;  3AE7 B;  4EUT A;  3DVN U;  1JWB D;  2VRR B;  3PO0 A;  1ZUD 2;  4KVG B;  2WU2 B;  3JSV A;  3VVW B;  2WXO A;  2DWQ A;  2IND C;  3L54 A;  3RZF A;  2JX5 A;  5C3J B;  4M01 A;  4P6V F;  3Q14 C;  2D10 A;  2DLB A;  3Q8B A;  3VH3 B;  2K22 A;  1TS5 A;  1UGM A;  5C2T B;  4GU2 A;  1AWD A;  2VH1 A;  4ACF A;  4GIV A;  4YTP B;  4EZK A;  3QHT A;  1UH6 A;  3DHH C;  4XZ4 A;  4MM3 B;  2M1M A;  1BT0 A;  1F2R C;  2L8J A;  2KFJ A;  2FCN A;  2LGI A;  1XLO A;  4G11 A;  4PT5 A;  2JZP A;  3NHE B;  1KLV A;  4GDL B;  3V60 A;  1J19 A;  4RFB A;  3LB8 C;  3L13 A;  1E0Z A;  1WWT A;  2PE9 A;  1I4P A;  3ZGZ A;  1V1P B;  3NVY A;  4QAY A;  4UDU C;  2XN9 C;  4FJV B;  1K50 A;  1FRD A;  3C8Y A;  4WIP A;  1IPG A;  2M4N A;  1EU3 A;  3RMK C;  3C0R B;  3H7P A;  2XBB C;  1SGH A;  4US8 A;  3JW0 X;  2HE7 A;  2V3P A;  3AXC A;  2AEH A;  2MRP A;  1FIQ A;  2GBK A;  1WYG A;  4OVZ A;  2M56 B;  2IDY A;  4HPL B;  2IZV B;  1ZDV A;  2KD0 A;  4DXG A;  1ZGU B;  3R66 C;  2R2Q A;  2KQ4 X;  4ZRJ A;  3HIZ A;  4URK A;  3UQA A;  1ZXI A;  1V86 A;  4GOC A;  2XK5 A;  4HRO A;  2RPQ A;  4YSX B;  2LGX A;  4YSZ B;  2ZEQ A;  2QC8 A;  1RM6 C;  2L0F A;  1KF6 B;  2DZM A;  2ZCC A;  1JQ4 A;  2D3C A;  3SFD B;  1L4Z B;  5IN7 A;  4GN1 A;  3N30 A;  3TEW A;  1T6B X;  1M94 A;  1ROE A;  4WJN A;  2AQ2 B;  2KMM A;  3P1M A;  1KTK A;  3PTF C;  4K7S A;  3PHW B;  3R2I A;  3EFU A;  1I4H A;  3RZW C;  2NTS A;  4BBN F;  5L83 A;  2G1E A;  5AZG A;  1V5O A;  1JWU D;  1UEL A;  2IJ0 A;  3AE6 B;  3NVV A;  3NUH B;  2CU3 A;  4AS1 A;  4LTU A;  2RDH A;  1WH3 A;  5I4D A;  1GOZ A;  1AW7 A;  3A9K A;  2MHJ A;  1YQB A;  4TQ1 A;  1EU4 A;  1XXG A;  3PRP B;  4MJS B;  1VJK A;  2GRI A;  1EF5 A;  1XCT L;  5JXV A;  4F7Z A;  3QC8 B;  1T0S C;  2MP2 B;  2WDR B;  5CHF A;  4P1C C;  2Z0E B;  3FC4 A;  5G5H A;  2N9K A;  4PK1 A;  3N9Y C;  5LNK 1;  1RWS A;  1SE3 A;  1YD8 U;  2HDE A;  2DYB A;  2IO0 B;  1NDD A;  5J2R A;  4M8M A;  2KKC A;  1VZ8 A;  2NBW B;  3MHZ A;  4XE0 A;  1ENF A;  2X8X X;  3DVN V;  1FXT B;  1CK1 A;  4LCD E;  2V9H A;  2IY1 B;  2EMT A;  3RNB C;  3M3J A;  2KLC A;  4FXC A;  5CHW A;  5EE9 A;  2RD0 A;  2BYE A;  5G2N A;  2L32 A;  3IXS A;  1E8Y A;  1TS3 A;  2AQ1 B;  3ZJV A;  4AWJ A;  2EKI A;  2RDG A;  3IBE A;  4DHJ D;  1SE4 A;  4HK2 A;  1VDV A;  3ZJU A;  4KDI C;  2K8B A;  1T0R C;  2K6Q A;  2MEK A;  2Y5B B;  1YJI A;  3ZKJ C;  1F1H A;  5IOI A;  4EZL A;  4KKI A;  4HWI B;  2AL6 A;  2KWC A;  3Q3F A;  4B0M A;  1DOY A;  2L52 A;  1N5W A;  2LHD A;  1FCL A;  2B76 B;  2PPH A;  2A5U A;  3IT4 B;  1IUE A;  4MGI E;  1WX8 A;  1J8C A;  2EEL A;  4B0E A;  1SE9 A;  2WXI A;  1XLQ A;  4GLS C;  4IM0 A;  3AEA B;  3QAQ A;  3WAN A;  2CHW A;  4MGY E;  3A33 B;  4TV3 A;  2NPT B;  3BYY B;  3ABV B;  4ANV A;  3ZW3 A;  5BO4 B;  2K9X A;  4MM3 A;  2KAJ A;  4K3B A;  2BPS A;  3EFC A;  1L4D B;  5IP4 D;  4JWU C;  3ZDM C;  1JCK B;  2D3A A;  4GDL A;  4RM8 A;  1E8X A;  3P42 A;  3NVZ A;  5BMG A;  3X0W A;  3D32 A;  3EEC A;  4PS3 A;  2KWD A;  5EDS A;  1V1P A;  2OHF A;  2YEP F;  3H7S A;  4HLE A;  2KN4 A;  3WAP A;  2JUO A;  1UD7 A;  4LK0 M;  1T0Q C;  4JPS A;  1KLU D;  1V2Y A;  4YT0 B;  3KWV A;  3AE9 B;  4KGR A;  2ZW1 A;  3QCA A;  2C9W B;  4NNJ B;  1HE8 A;  3KYD D;  4OZC A;  4KIK B;  2K3U A;  4ZDV A;  4NAM A;  2MCN B;  1JWA D;  3KWL A;  2LUM A;  2UU7 A;  3R8B A;  2I1J A;  2HJ8 A;  4FN2 A;  2KWV B;  4FUL A;  1HZ6 A;  3QWZ B;  4K1R B;  4YWG G;  5IA7 A;  1K8R B;  2WXJ A;  3IFW B;  5KHQ A;  1JW9 D;  4RGT A;  1UF0 A;  5FR3 A;  3M63 B;  2RMM A;  2LFI A;  3BY4 B;  4IKG A; 
#chains in the Genus database with same CATH homology
 4P1B C;  3N20 C;  3RN9 C;  2INC C;  3Q14 C;  3Q3N C;  1T0R C;  3DHI C;  3Q3O C;  3RMK C;  3Q2A C;  1T0Q C;  3I63 C;  1T0S C;  3N1Y C;  4P1C C;  3DHG C;  3N1Z C;  3Q3M C;  3GE8 C;  3RNC C;  3N1X C;  3RNG C;  3GE3 C;  3RI7 C;  2IND C;  3RNB C;  2RDB C;  3RNA C;  3DHH C;  3I5J C;  3RNF C;  3RNE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...