2RDBC

X-ray crystal structure of toluene/o-xylene monooxygenase hydroxylase i100w mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
TFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene, o-xylene monooxygenase oxygenase subunit;alpha
publication title Dioxygen activation at non-heme diiron centers: oxidation of a proximal residue in the I100W variant of toluene/o-xylene monooxygenase hydroxylase.
pubmed doi rcsb
source organism Pseudomonas stutzeri
molecule tags Oxidoreductase
total genus 24
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2007-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 2rdbC00
4P1CC 3RNGC 3RI7C 3Q3MC 3GE8C 3RNCC 3N1YC 3DHGC 3I5JC 3Q3NC 3RMKC 3GE3C 2INCC 4P1BC 3RNFC 1T0QC 3DHIC 3DHHC 3N20C 1T0RC 3N1XC 3RNEC 3I63C 3N1ZC 1T0SC 3RNAC 2RDBC 2INDC 3Q2AC 3RN9C 3Q3OC 3RNBC 3Q14C
chains in the Genus database with same CATH superfamily
3EFCA 4KGTA 3H1UA 1UD7A 2B76B 2GB1A 4HPLB 4A8XC 2D10A 1YN5A 2UU7A 3A9KA 3URYA 4RGOS 4PS7A 4K7SA 1HTOA 2KC2A 2R61A 1MFWA 2MBQA 3NVYA 3PRZA 2KDFB 2GBKA 4M8MA 4OVZA 4WAAA 3V05A 3T3NA 1K51A 1PGBA 1NYQA 2OJWA 3AH7A 2HTHA 5IO9A 1X1MA 4M8NA 2L0TA 2IGGA 2PTLA 3LYYA 4C4VA 4W9IA 1YIWA 1EO6A 3KYDD 3QIJA 2KX0A 2KDEB 1NVID 3SD5A 1TTNA 3RYTA 3VDZA 4A3OA 4WWNA 3VTUA 1BUIC 3ZRFA 1YQ3B 3IXSA 2IGHA 2K39A 1XLQA 4GU2A 3T3OA 4RF1A 4A3PA 1TIFA 3ZJUA 2PKOA 1VZ8A 3S2AA 2KVZA 4GDLA 2H88B 4J3OD 3UIPB 1C76A 3JYUA 1UGMA 5BMHA 2OHFA 2ZW0A 3PHXB 5BYQA 1S1QB 3UF8A 1UGJA 1KFYB 1WJNA 2C7NB 4YXDB 4ASWC 3R3MA 3FKYA 3ZNHB 2REXA 3BY4B 2KYWA 2W55A 4FHKA 3RFZB 1WM3A 2KACA 3FILA 1V2YA 2IYDB 1JALA 4DDID 1C9FA 3BIID 3L10B 4K7WA 3DPDA 3WALA 5J2RA 1I42A 1YQBA 1GC7A 2WDQB 3ALBA 1F9JA 2BBCA 3RNAC 4DK5A 2OEDA 5JHBA 5HI1A 3AI5A 1AW7A 2QIEB 4G3XB 4UDUC 4EUTA 4WJOA 4FBJB 1FNWA 2X38A 3QWZB 1I35A 4I6NB 3A1QB 1Y56A 4AWJA 2L0FA 4GDKA 5FK9C 3Q8BA 1IBXA 2D2QA 4JE3B 3AMZA 4A20A 3PLVA 4JGHB 1SGHA 1KF6B 2JRIB 3L17A 4PS3A 4DXFA 2WU2B 3IT4B 2KMAA 2MJEA 3ML8A 2K3UA 2KTRA 1GNUA 2M56B 2WXNA 4FJYA 2KANA 4LDTD 4ZRQA 2K5PA 4MT5A 3ZRCA 1YNTE 4ZYNA 3PS6A 2MBBB 3BVMA 4I6PA 4M01A 1L0YB 2BW2A 2MX2A 1D3ZA 1XXGA 4PYZA 2WDTB 1F0ZA 1ZW7A 4BKSD 3C0RB 3KLSX 3MFGA 2LWPA 2KC1A 1D6EC 2KTFA 3H9DA 4ZRPA 3DHHC 4RH6A 4NAWB 4XX5A 4URKA 2L05A 3VUYA 2WXIA 2JWZA 1V97A 2DWQA 2KN4A 1TS3A 2BKFA 3AEEB 1MJDA 1HZ6A 2KOXA 1DOYA 1EWYC 2J7QB 1JWBD 4RM9A 1V1PB 1LFDA 2ASQA 3CIRB 2TSSA 1L6VA 1WFYA 2A4ZA 2WLBA 2I2YA 4NNJB 1E8ZA 1J0GA 1OTRB 2KWUB 4G11A 3B0AA 3DVNU 2DENB 3QC8B 4B95A 1ET6A 3SEBA 3AE2B 3D32A 1TKEA 4DXAB 4ICUA 1BXTA 4HPPA 3DHIC 4P6VF 3VVWB 1YN3A 3BK1A 3ZXVA 3PSEB 1V1OA 1XLNA 5AEKB 3BVZA 5E6JA 1FNVA 4P1CC 2KDBA 1DOIA 3AE6B 1FCCC 3DBRI 2JRHA 2J0KA 2IO3B 3QAQA 5G5GA 3AE1B 4LCDE 1YD8U 4RCOA 5C3JB 3V60A 3U2SC 3A4RA 2KXJA 1UZXB 5BYRA 2K6DB 3DBRB 4ZDVA 2BB6A 2BKRB 1HEZE 4XGAB 3B9JA 2L8JA 3V6CB 4RNAA 2JYTA 3NUHB 1TGZB 2N9EB 1SIJA 4HJGE 2BWES 1C4AA 1RFKA 1YJIA 1VJKA 2N7JA 3L08A 1L4DB 1UBIA 3P4PB 1PGAA 2JVCA 3ZVVA 4XYCA 2H89B 3W1SA 3X23A 4FHJA 3M3JA 2BS2B 3GP7A 2GMIC 1DGJA 1NENB 3PVLA 3AECB 4XC2A 2JF5A 1HZ5A 1T0SC 4HWIB 1P7FA 2EKEC 3QX1A 5I4DA 5IN7A 1N62A 3KQ4A 4WH4A 2ZVOA 3Q3NC 3UINB 1WXAA 4PS8A 4TQ1A 1JROA 4MGKE 3UIOB 3VH4B 3BWUD 2GBJA 2LVQA 1E8WA 2FCQA 2L52A 4CQNA 1ESFA 3ZXRA 5AUIA 1GPXA 2N7DA 4KKIA 2NBWB 3RZFA 3RUIB 3T9LA 5DPTA 2KKCA 4OZCA 3OG5A 2QJLA 3AE8B 5D7GA 4AUQC 1FFUA 2PE9A 4GB9A 4DHZB 3AEBB 2KLCA 1MG4A 4IC7B 1ZKHA 4K7UA 4II2B 2LUEA 1QLBB 2Z0DB 1S3SG 2AQ1B 5IKCM 4USAA 2JQRB 1WR1A 3EECA 5IA7A 1Q0WB 2N1WA 3UQAA 4OHJA 2WXRA 3RMKC 2CHXA 4O1NA 2SAKA 4US9A 2KZRA 2QILA 2J42A 2D3GA 2Z8LA 5E6PA 3BINA 1UWMA 4W9KA 1WGRA 3R2TA 4ANWA 4II3B 3V6EB 3ECIA 1WJUA 4OVVA 1N5XA 3HM3A 1V8CA 1D4BA 2ICIA 2KHWB 1WXVA 2DLBA 4KGSA 4DBGA 2KD0A 3AULA 4JPSA 2LHEA 2HDEA 3HIZA 3VRAB 2WXMA 3AV8A 2WX0A 3RZWC 2GI9A 2MHJA 3EFUA 5LXIB 3N32A 1WMHB 3DBSA 2L1AA 1QQRA 2EKIA 3AE3B 3B2GA 1T5XD 5CHVC 1AARA 2HD5B 1C4PA 3DQVA 1HXYD 4XWWA 1WX7A 5EE1A 3TEXA 2G4DB 2MW5A 1R4MI 2RDBC 2CU3A 4OVUA 2JX5A 2KQ7A 3TMPB 2Y5BB 3BVGA 2AEHA 2PVGC 2O6VB 2N9XA 3VAWA 3OJ3A 3TL5A 2AL3A 2WS3B 1XEEA 4LNIA 2PEAA 3HHMA 1R4MB 5TR5A 2NPTA 3RNFC 5KHOA 2FCNA 3MC8A 3ZNID 2C7HA 2CKHB 3AN1A 1L2NA 5DPWA 4W9DA 3Q3JA 4K1RB 2O2VA 2YVCA 1KLUD 1YX5B 3EUB2 2FE8A 2XBBC 2L3ZA 4IWQA 2LVPA 1EUVB 2RDGA 3ZW3A 5AUKA 1T3QA 2KX3A 2X8XX 3IAM1 3WAMA 2IPKD 1E6EB 1UBQA 3RNCC 2OOBB 3PGEA 1B9RA 1SJED 5HG2A 2QC8A 3ZTDA 2N7EA 2D3CA 4L2YA 2VH1A 4NY0A 1ZOYB 1T0YA 3RPFC 3KW5B 4HROA 2JPHA 2IDYA 4HKZE 1ACCA 3PHWB 1V81A 1GB1A 3P4QB 2RDHA 3NOBA 4FADA 2I1JA 1HQRD 1FO4A 2G1EA 4JLCA 5E6OA 2PE6B 4MACA 2LRUA 4Q2JA 2RGFA 3V62A 1GJZA 2HTME 2PW9A 1Q1OA 2DAJA 4AQ7A 2WXQA 3ZYYX 4NJ7A 2WHIA 3H7PB 1PFDA 3NS1A 4WURA 1SE4A 2Y5PA 1E8XA 1Y8RC 1VR9A 3ZLZA 1RAXA 3Q3FA 1JRUA 4BFRA 1HTQA 2KWCA 4JL9A 2CU1A 2KDMA 1F2RC 2WXOA 2K25A 5H8YE 5C23A 2ZJDA 3SHQA 3Q69A 3ML9A 3N30A 1ZDXA 2BWFA 2B3AA 2JWUA 2YEPB 2M8SA 3PZDA 1DYQA 1KJTA 1ZGUB 2KVRA 1YOVB 2DZKA 3RNGC 4MSQB 3RI7C 2KN5A 1SF0A 2WXKA 3WAOA 3ZTCA 4IM2A 1I7HA 1E90A 4E71A 3L13A 3U7DA 1SE3A 1VCBA 2D5GA 4JX1C 4HVBA 2MP2B 4XE0A 3O65B 2IY1B 1WX8A 1L0XB 1C3TA 2K8CA 3AXCA 1R7SA 5BO4B 3NY5A 2IJ0A 5D2MB 2RD0A 1BT0A 1UNSA 3LJ3A 2G9HD 3DHGC 1HA5A 2KAJA 4BOSC 2LJ5A 3HVDA 5EDSA 2UWQA 1Q10A 3R7RA 1TZOA 2W3SA 3GB1A 4NPNA 4MJSB 4E74A 3I63C 2CHWA 3VHTC 2UYZB 4HCNB 4KZ0A 4WJQA 4ZOHC 1UH6A 1KLGD 5J17A 3TSSA 2NS5A 2DZMA 1WE7A 4M0WB 1A70A 3NRZA 4RGNA 1WYGA 3I57A 5D3IB 1ZUD2 3H7SA 1OEYA 3AEGB 2FNJB 2V3NA 3HM6X 3JSVB 5G55A 3RN9C 4A90A 2G4SA 4N9F4 2ZNVC 2M0AA 3NJTA 2V3PA 3KUZA 1A5RA 2L76A 3IFWB 2WX1A 4XDDA 3IG3A 5GMVA 3N20C 4MDKE 3VTVA 1D5MC 3CWIA 5TSSA 1OQRA 3DCGA 3VUXA 1ZE3D 4EFOA 1EWCA 2E3TA 5J18A 1FCLA 3NZSA 1WGYA 1YN4A 2KLGA 4AP4C 3HRDD 4PK1A 1V5TA 3ZGZA 3IVFA 1OQQA 1LGRA 1TZ1A 1CK1A 1NYRA 4ICVA 4BKGA 2I1KA 4HLEA 1YJ1A 4CO7A 2JXTA 1C1YB 1YX6B 2K1FA 4HPMB 4MGIE 4MELA 2RPQA 4MGZE 4LNKA 1WGKA 3U8ZA 3W2DA 4GMVA 4DXGA 1RM6C 5CX3A 4BKSA 1P98A 4RGMA 2WGSA 1EU3A 1T0QC 2CHZA 1E7VA 1GUAB 1XCTL 2D3BA 2K9XA 2A5UA 2KWDA 1JWSD 3NG0A 1MHHE 2M17A 1EF5A 2ACZB 5JZEB 3ZIMA 2FBWB 3A9JB 4YTNB 1TS5A 2PPHA 3E56A 3Q8AA 2KMMA 2CS4A 4ZHOA 4KX6B 4A9AA 1E10A 2M19A 1WX9A 4P7IA 2BTEA 4TSSA 1WXSA 4RF0A 3UQBA 3DWGC 2XK5B 4JWUC 4CYEA 2KFJA 4MH8A 4GIVA 4ZYSA 4K3BA 1F52A 1N63A 1WSPA 2WQYB 4FN2A 4IUMB 3QARA 3N9YC 3RT3B 4ZRJA 2MBHA 3GOEA 2W9NA 1IP9A 3ZJTA 1IYFA 2MCNB 1NDDA 2G3QB 1H8CA 4XWTA 3AEAB 3QJZA 1FIQA 4HEA1 2MH7A 1SE2A 5MPOA 4BOZB 2FCSA 3P2BA 4L23A 3SDLC 4DHJB 4IW0A 3DVNV 5L83A 1V5OA 4QAYA 3VR8B 3NZ3A 4HJKA 1V49A 2WXPA 1KOTA 3OLMD 2GBMA 2GBNA 4ACFA 5GXGB 2BGFA 4US8A 4FA6A 1V6EA 2K8BA 2MQJA 4KVGB 3BK2A 4F1SA 1WGGA 2BYVE 3EGRA 4MJSA 3RULA 4LLGM 2QHOA 4WWPA 3GE8C 2E6XA 1CQVA 2DBYA 3VFKA 2V1YA 3DWMA 4WQOB 2RMMA 1VDVA 1B1ZA 1WGHA 1EU4A 1TY2A 1VRAB 1JMLA 3BZDB 1OGWA 4TKNA 2LFIA 5HKHA 1WI0A 2DYOA 2KQ4X 4WAFA 1UELA 3JSVA 4ARCA 1I4QA 1JWUD 3TCAA 2KO3A 4ZRKA 3PO0A 2BPSA 2KJHB 1JW9D 4WWMA 1FPYA 4KIKB 3LDZE 4KDIC 3AEDB 1QOFA 1D5XC 3A1QA 4S17A 3NS8A 4KV2A 2LD9A 3Q3MC 1I4XA 3ZDMC 3ONSA 1JWAD 5C1ZA 2LRWA 5AZFA 1I4GA 4WJPA 3QHTA 3TUOA 3EA6A 3Q8EA 4NZLB 3CSTA 4GN1A 1LO5D 4IKGA 2XEWA 3IHPC 4GXBA 1ZXIA 2BS4B 2N0SB 3RNBC 2K22A 4IWOA 2D07B 2IY0B 4F8CB 1IGCA 5IP4D 4JWSC 4NAMA 1QT9A 2CJOA 3NHEB 4HCPB 3P4RB 3B08A 4W9JA 1ET9A 3R7QA 5JHAA 1GOZA 3Q2AC 4EZJA 2W54A 4WQMA 3RD2A 4PYUA 3DVGY 1PYWD 4DQOC 4FLHA 4RMAA 3LB8C 1HE8A 4NAWA 2JY6A 5EE0A 4JIOU 4NQKE 3Q8CA 1WRDB 2RPVA 2DYBA 2DNFA 5C2TB 1NBFC 3A9JA 2ZCBA 2QCZA 1FFVA 2C60A 1TKYA 1GB4A 2ZZPB 4F7ZA 3W5VB 4HKQA 4FXCA 3AB5A 1OEYJ 1YQ4B 1J7AA 2Y3AA 2LXAA 4MGYE 3Q14C 1WF9A 1V1PA 2HE7A 4REZA 2WNMA 2AQ3B 3GS2A 1UWXA 2JUOA 4W9HA 2K8HA 1M94A 3KYCD 1L6UA 2ZW1A 4P1BC 3QQ8B 3X0WA 3KWLA 4ZHPA 1E9MA 2ON8A 2VH2A 3FC4A 3FILB 3WIMA 4HK2A 2JZZA 1XLPA 1VLBA 3KUCB 1N61A 1Z2MA 3MJ5A 2INNE 4YT0B 2GOWA 2V4IB 4B0MA 2C9WB 3M95A 4DDGD 2LUMA 4B0EA 5CHWA 1GC6A 5FR3A 4FJVB 1P9DU 3OWEB 3B1LX 2GLSA 1FD6A 2KDIA 4B9KA 4LNOA 3NVWA 3PREA 3KUDB 2C7MB 1RRBA 4DHJD 4GDKB 1IBXB 2LASA 3AM9A 3ZKJC 1TBEA 2BB5A 1QF6A 1WY8A 3QA8A 1XCQL 1VZ7A 1E0ZA 3ZDTA 4LNNA 3SFDB 3L4PA 2JU6X 2KWVB 1TY0A 1UUPA 5H92C 3MC9A 3WA0A 2FUHB 2BYFA 4AOFA 2NCNA 3WAPA 3MJWA 2L32A 5DPRA 4PT5A 4C80A 3FAHA 1AYFA 2FAZA 1WJ4A 1K50A 4YWGG 3MHSD 2YLMA 4OW0A 3ETRA 1C79A 1M4VA 2WXLA 2CJNA 2Y5CA 3PZ7A 1J19A 2IZVB 1F2RI 5L95C 1BMLC 2VRRB 4W9LA 3TEYA 1KM7A 5FKAC 2WXGA 1LXDA 3VH3B 4NQLB 2MWSB 4HRSA 3ZNZB 1TKGA 2SEBD 1JRPA 5JH5C 1WJ6A 2HJ8A 3NZUA 4E3CA 4AJWA 3AU4A 1WYWB 2L7RA 4HXDA 1XF5L 5EE9A 1K53A 2DX5B 1ENFA 4C00A 4W9CA 3CSFA 1IGDA 2VZKB 4LNFA 4BZAA 3V61A 4N58A 2L83A 3QK0A 1QOGA 1K8RB 4B6WA 1KRHA 3VTWA 4IWPA 3BYYB 2NMQA 2MSED 2M1MA 5BYSA 4XZ4A 3DBHI 4KZCA 2BQQA 3ENEA 1WRIA 5CHFA 2BF8B 3AE9B 3ZUNA 1KLVA 1SE9A 2LEKA 4EOYA 3W1YA 4G50A 1C78A 3ZJVA 2BVCA 3DBHB 3L54A 3R8BA 4EZLA 2MJ3A 2NVUI 2V3SA 3JVZX 2BYTA 1ZPSA 2WDRB 3PPAA 1WXMA 2LHDA 1MG8A 2ZVNA 2KQSA 3PRPB 2DAFA 1ROEA 1SEBD 2N9PC 2AL6A 4G0NB 2FUG1 3TEZA 4L1BA 3ZO5B 4FJZA 2QDFA 1ZDVA 2PVOD 1F1HA 2LXCA 1FMAD 2QMTA 4P16A 2KFKB 4MSMB 1TS2A 2C5LC 1Z5SB 1XO3A 1FXAA 2LZ6A 3P4SB 1SSNA 1ZP0B 1P0RA 2K6QA 1I4HA 2I38A 2JXXA 2RR9A 1WMHA 4TUUA 3WCQA 3DVGX 4W9EA 3TIXA 5D94A 2LI5A 2D3AA 2ZNVB 3MP9A 1SXTA 3SFEB 2W82A 3RCZA 5D3DA 3MC0B 5HHDG 2BS3B 1N60A 2N1VA 4BBNF 3CMMB 1WR6E 2J0JA 5AZHA 1FNUA 2R2QA 3E9SA 2PIAA 4CHKA 4HDOA 2WU5B 3KVFB 1SB3C 2Z59B 4LK0M 3K9OB 3VQIA 1N6ZA 3O13A 5JXVA 3W1SC 1FRDA 2O6VA 2O6VD 2LGDA 2KNBA 2ZPNA 1FRRA 1FEHA 5T8IA 3T8MA 4JQWC 1WM2A 2MA9B 4A6QA 2ZPYA 3BYTB 1KTKA 3M62B 3P42A 3L16A 1MHXA 3C19A 1LM8B 1QZEA 4RGTA 3A33B 3H6NA 1L4ZB 4ANVA 4MEMA 1FXIA 2GBRA 1NI3A 1XQQA 2L00B 2IBIB 2INDC 4XDCA 3HUIA 3AU5A 3VR9B 3K9PB 3OJ4B 1QOBA 2N9LA 3PTFC 4IDIA 2FCMA 3LXFA 2WXFA 3QCAA 1UF0A 1PGXA 4RFBA 1G6JA 5BMIA 3Q6BA 2QEJC 4OZAA 4DHZE 1WIAA 1EF1A 4X57B 1XT9B 4YSYB 2JZ3B 3MHZA 4GOCA 2OJRA 3U4EG 4OZBA 3NVZA 2J53A 4YTPB 2WXJA 4MM3B 2D11A 4BBNC 4MH0E 3IAS1 1WGDA 4KGRA 2NTSA 1WWTA 1L7YA 1T0RC 1EM7A 1MVKA 2DZIA 2V0GA 2PJHA 1K52A 1F77A 2V4LA 2DHZA 3H7PA 3A4SC 1IPGA 4N59A 3APCA 5G5HA 4KSKC 3U30A 4FULA 2BYEA 3AEFB 1C4CA 2VZKD 4KKJA 2JYEA 2LMCA 4A55A 2R2OA 3SR6A 1V9JA 3C8YA 1N5WA 1L0VB 4LJOB 2KK8A 4I6LB 5IOIA 2PMVA 3B2FA 3PLUA 2WDVB 2JZPA 2MBOA 2M0XA 4C7YA 2FIFA 2MP2A 1QILA 3R66C 3TJPA 5KHQA 4GSWA 3AE5B 4ZRIA 4ANXA 3M63B 2NPTB 4KDLB 1D5ZC 2KT7A 1AN8A 2W3RA 4IOIE 4ARIA 4IM0A 1QOAA 1L5PA 2O2VB 1LQBA 2J0MA 2AX5A 1VD2A 2INPE 2IGDA 4YSXB 1E5WA 1VZ6A 1E7UA 2KFKA 2BT6A 3ABVB 3DOWA 2KJ6A 1OQYA 4D2KA 2MLBA 2N4FA 4LTUA 1AWDA 2JSVX 2Z0EB 4IG7B 1RYJA 3KH0A 1RFAA 4S0RA 4M0WA 3ZQ4A 1FXTB 1JCKB 4H2AA 2LVOA 2ZEQA 3I5JC 3W9CB 5LNK1 1RWSA 4GGQA 2AQ2B 4ITKA 1P7EA 2MBEA 2XNAC 4EZKA 2LGYA 3UGBB 2G45B 1SBBB 3CF6E 1PQSA 2WWZA 1CJEA 2IO0B 3VXWA 1PUTA 3A9KB 4EKUA 5HFYA 4BVUC 2ONQA 2N9KA 1V86A 1SIFA 4M00A 3N1XC 1CMXB 3MTNB 1NEKB 3IT6B 4RM8A 2KMCA 4KSLC 4WWOA 4K81A 1YMHE 2GRIA 3H8HA 2WYQA 4WJNA 5E6NA 3U7ZA 3DBLI 1CZPA 1I4RA 4EE2A 3WANA 1IUEA 2LGXA 2M4NA 5FR6A 3HK0A 4C4VB 1C77A 2EMTA 4YSZB 1I4PA 1JQ4A 5DCNA 3SU8X 3OAWA 4WIPA 5LXHA 3Q3OC 4NJ6A 3DBLB 1TJEA 4C7ZA 2J52A 4HDQA 2NBVB 2FIDA 3GE3C 1KH0A 4K3CA 3AE7B 1J7CA 3ZNGC 4BAXA 4DWFA 4C56C 2WP9B 1TS4A 3TBLD 1MI0A 5G2NA 1P3QU 4N6EB 5D6JB 5LLIA 3I3TB 4MM3A 1R4NI 1WZ0A 1WE6A 3P63A 1T6BX 3V3XA 3IBEA 4GDLB 3P1MA 1QKZA 4ANUA 3APDA 1YJJA 3AE4B 1E8YA 2V9HA 2PLPA 1SJHD 2INCC 2NTTA 1RLFA 1R4NB 4TMAB 5DPSA 2IO1B 2ZCCA 5AZGA 3U52E 3TEWA 2XK5A 2DZJA 1TT5B 3NVVA 4TV3A 1PDXA 3PZ8A 3J9CA 4GLSC 4BKTA 3UI3A 4YTMB 1WH3A 2AWTA 4W9FA 1XLOA 1Q5WB 3VUWA 1U4AA 2NR2A 1GAQB 3EC8A 1DOXA 2Q5WD 3I9V1 2JT4B 3EHVA 2WXHA 5BMGA 4J6IA 1STEA 1J8CA 1FM0D 2MJDA 1H4RA 1WXQA 4M02A 2DYMA 3W5UB 3Q8FA 2MEKA 1ISNA 2IO2B 2RSUA 1WZ3A 4NJCA 4AS1A 2K0PA 4EEWA 3N3KB 2XN9C 3JW0X 1P1AA 4W9GA 4TQ0A 1GG3A 1NI2A 2KTRB 5CTRC 3N1YC 4LJPB 4LDTB 3R2IA 4R3DA 1OFFA 1ZXHA 4YL8A 3GZNI 1TYGB 3L0WB 2QSDA 3RNEC 2LGIA 2AYOB 2YEPF 3DDCB 2EELA 3N1ZC 3KWVA 2HJ1A 4IM3A 1JWMD 5IAAC 2NBUA 2LJIA 1XD3B 2MRPA 1V80A 3GZNB 3HVZA 2J4XA 5EE3A 1E7PB 1J7BA 2CR5A 4AJYB 3PV1A 3APFA 1MPEA 3PRMB 3PT2B 3VRBB 2EMSA 2LGSA 2KJRA 4KIKA
chains in the Genus database with same CATH topology
4P1CC 3RNGC 3RI7C 3Q3MC 3GE8C 3RNCC 3N1YC 3DHGC 3I5JC 3Q3NC 3RMKC 3GE3C 2INCC 4P1BC 3RNFC 1T0QC 3DHIC 3DHHC 3N20C 1T0RC 3N1XC 3RNEC 3I63C 3N1ZC 1T0SC 3RNAC 2RDBC 2INDC 3Q2AC 3RN9C 3Q3OC 3RNBC 3Q14C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P1C C;  3RNG C;  3RI7 C;  3Q3M C;  3GE8 C;  3RNC C;  3N1Y C;  3DHG C;  3I5J C;  3Q3N C;  3RMK C;  3GE3 C;  2INC C;  4P1B C;  3RNF C;  1T0Q C;  3DHI C;  3DHH C;  3N20 C;  1T0R C;  3N1X C;  3RNE C;  3I63 C;  3N1Z C;  1T0S C;  3RNA C;  2RDB C;  2IND C;  3Q2A C;  3RN9 C;  3Q3O C;  3RNB C;  3Q14 C; 
#chains in the Genus database with same CATH topology
 3EFC A;  4KGT A;  3H1U A;  1UD7 A;  2B76 B;  2GB1 A;  4HPL B;  4A8X C;  2D10 A;  1YN5 A;  2UU7 A;  3A9K A;  3URY A;  4RGO S;  4PS7 A;  4K7S A;  1HTO A;  2KC2 A;  2R61 A;  1MFW A;  2MBQ A;  3NVY A;  3PRZ A;  2KDF B;  2GBK A;  4M8M A;  4OVZ A;  4WAA A;  3V05 A;  3T3N A;  1K51 A;  1PGB A;  1NYQ A;  2OJW A;  3AH7 A;  2HTH A;  5IO9 A;  1X1M A;  4M8N A;  2L0T A;  2IGG A;  2PTL A;  3LYY A;  4C4V A;  4W9I A;  1YIW A;  1EO6 A;  3KYD D;  3QIJ A;  2KX0 A;  2KDE B;  1NVI D;  3SD5 A;  1TTN A;  3RYT A;  3VDZ A;  4A3O A;  4WWN A;  3VTU A;  1BUI C;  3ZRF A;  1YQ3 B;  3IXS A;  2IGH A;  2K39 A;  1XLQ A;  4GU2 A;  3T3O A;  4RF1 A;  4A3P A;  1TIF A;  3ZJU A;  2PKO A;  1VZ8 A;  3S2A A;  2KVZ A;  4GDL A;  2H88 B;  4J3O D;  3UIP B;  1C76 A;  3JYU A;  1UGM A;  5BMH A;  2OHF A;  2ZW0 A;  3PHX B;  5BYQ A;  1S1Q B;  3UF8 A;  1UGJ A;  1KFY B;  1WJN A;  2C7N B;  4YXD B;  4ASW C;  3R3M A;  3FKY A;  3ZNH B;  2REX A;  3BY4 B;  2KYW A;  2W55 A;  4FHK A;  3RFZ B;  1WM3 A;  2KAC A;  3FIL A;  1V2Y A;  2IYD B;  1JAL A;  4DDI D;  1C9F A;  3BII D;  3L10 B;  4K7W A;  3DPD A;  3WAL A;  5J2R A;  1I42 A;  1YQB A;  1GC7 A;  2WDQ B;  3ALB A;  1F9J A;  2BBC A;  3RNA C;  4DK5 A;  2OED A;  5JHB A;  5HI1 A;  3AI5 A;  1AW7 A;  2QIE B;  4G3X B;  4UDU C;  4EUT A;  4WJO A;  4FBJ B;  1FNW A;  2X38 A;  3QWZ B;  1I35 A;  4I6N B;  3A1Q B;  1Y56 A;  4AWJ A;  2L0F A;  4GDK A;  5FK9 C;  3Q8B A;  1IBX A;  2D2Q A;  4JE3 B;  3AMZ A;  4A20 A;  3PLV A;  4JGH B;  1SGH A;  1KF6 B;  2JRI B;  3L17 A;  4PS3 A;  4DXF A;  2WU2 B;  3IT4 B;  2KMA A;  2MJE A;  3ML8 A;  2K3U A;  2KTR A;  1GNU A;  2M56 B;  2WXN A;  4FJY A;  2KAN A;  4LDT D;  4ZRQ A;  2K5P A;  4MT5 A;  3ZRC A;  1YNT E;  4ZYN A;  3PS6 A;  2MBB B;  3BVM A;  4I6P A;  4M01 A;  1L0Y B;  2BW2 A;  2MX2 A;  1D3Z A;  1XXG A;  4PYZ A;  2WDT B;  1F0Z A;  1ZW7 A;  4BKS D;  3C0R B;  3KLS X;  3MFG A;  2LWP A;  2KC1 A;  1D6E C;  2KTF A;  3H9D A;  4ZRP A;  3DHH C;  4RH6 A;  4NAW B;  4XX5 A;  4URK A;  2L05 A;  3VUY A;  2WXI A;  2JWZ A;  1V97 A;  2DWQ A;  2KN4 A;  1TS3 A;  2BKF A;  3AEE B;  1MJD A;  1HZ6 A;  2KOX A;  1DOY A;  1EWY C;  2J7Q B;  1JWB D;  4RM9 A;  1V1P B;  1LFD A;  2ASQ A;  3CIR B;  2TSS A;  1L6V A;  1WFY A;  2A4Z A;  2WLB A;  2I2Y A;  4NNJ B;  1E8Z A;  1J0G A;  1OTR B;  2KWU B;  4G11 A;  3B0A A;  3DVN U;  2DEN B;  3QC8 B;  4B95 A;  1ET6 A;  3SEB A;  3AE2 B;  3D32 A;  1TKE A;  4DXA B;  4ICU A;  1BXT A;  4HPP A;  3DHI C;  4P6V F;  3VVW B;  1YN3 A;  3BK1 A;  3ZXV A;  3PSE B;  1V1O A;  1XLN A;  5AEK B;  3BVZ A;  5E6J A;  1FNV A;  4P1C C;  2KDB A;  1DOI A;  3AE6 B;  1FCC C;  3DBR I;  2JRH A;  2J0K A;  2IO3 B;  3QAQ A;  5G5G A;  3AE1 B;  4LCD E;  1YD8 U;  4RCO A;  5C3J B;  3V60 A;  3U2S C;  3A4R A;  2KXJ A;  1UZX B;  5BYR A;  2K6D B;  3DBR B;  4ZDV A;  2BB6 A;  2BKR B;  1HEZ E;  4XGA B;  3B9J A;  2L8J A;  3V6C B;  4RNA A;  2JYT A;  3NUH B;  1TGZ B;  2N9E B;  1SIJ A;  4HJG E;  2BWE S;  1C4A A;  1RFK A;  1YJI A;  1VJK A;  2N7J A;  3L08 A;  1L4D B;  1UBI A;  3P4P B;  1PGA A;  2JVC A;  3ZVV A;  4XYC A;  2H89 B;  3W1S A;  3X23 A;  4FHJ A;  3M3J A;  2BS2 B;  3GP7 A;  2GMI C;  1DGJ A;  1NEN B;  3PVL A;  3AEC B;  4XC2 A;  2JF5 A;  1HZ5 A;  1T0S C;  4HWI B;  1P7F A;  2EKE C;  3QX1 A;  5I4D A;  5IN7 A;  1N62 A;  3KQ4 A;  4WH4 A;  2ZVO A;  3Q3N C;  3UIN B;  1WXA A;  4PS8 A;  4TQ1 A;  1JRO A;  4MGK E;  3UIO B;  3VH4 B;  3BWU D;  2GBJ A;  2LVQ A;  1E8W A;  2FCQ A;  2L52 A;  4CQN A;  1ESF A;  3ZXR A;  5AUI A;  1GPX A;  2N7D A;  4KKI A;  2NBW B;  3RZF A;  3RUI B;  3T9L A;  5DPT A;  2KKC A;  4OZC A;  3OG5 A;  2QJL A;  3AE8 B;  5D7G A;  4AUQ C;  1FFU A;  2PE9 A;  4GB9 A;  4DHZ B;  3AEB B;  2KLC A;  1MG4 A;  4IC7 B;  1ZKH A;  4K7U A;  4II2 B;  2LUE A;  1QLB B;  2Z0D B;  1S3S G;  2AQ1 B;  5IKC M;  4USA A;  2JQR B;  1WR1 A;  3EEC A;  5IA7 A;  1Q0W B;  2N1W A;  3UQA A;  4OHJ A;  2WXR A;  3RMK C;  2CHX A;  4O1N A;  2SAK A;  4US9 A;  2KZR A;  2QIL A;  2J42 A;  2D3G A;  2Z8L A;  5E6P A;  3BIN A;  1UWM A;  4W9K A;  1WGR A;  3R2T A;  4ANW A;  4II3 B;  3V6E B;  3ECI A;  1WJU A;  4OVV A;  1N5X A;  3HM3 A;  1V8C A;  1D4B A;  2ICI A;  2KHW B;  1WXV A;  2DLB A;  4KGS A;  4DBG A;  2KD0 A;  3AUL A;  4JPS A;  2LHE A;  2HDE A;  3HIZ A;  3VRA B;  2WXM A;  3AV8 A;  2WX0 A;  3RZW C;  2GI9 A;  2MHJ A;  3EFU A;  5LXI B;  3N32 A;  1WMH B;  3DBS A;  2L1A A;  1QQR A;  2EKI A;  3AE3 B;  3B2G A;  1T5X D;  5CHV C;  1AAR A;  2HD5 B;  1C4P A;  3DQV A;  1HXY D;  4XWW A;  1WX7 A;  5EE1 A;  3TEX A;  2G4D B;  2MW5 A;  1R4M I;  2RDB C;  2CU3 A;  4OVU A;  2JX5 A;  2KQ7 A;  3TMP B;  2Y5B B;  3BVG A;  2AEH A;  2PVG C;  2O6V B;  2N9X A;  3VAW A;  3OJ3 A;  3TL5 A;  2AL3 A;  2WS3 B;  1XEE A;  4LNI A;  2PEA A;  3HHM A;  1R4M B;  5TR5 A;  2NPT A;  3RNF C;  5KHO A;  2FCN A;  3MC8 A;  3ZNI D;  2C7H A;  2CKH B;  3AN1 A;  1L2N A;  5DPW A;  4W9D A;  3Q3J A;  4K1R B;  2O2V A;  2YVC A;  1KLU D;  1YX5 B;  3EUB 2;  2FE8 A;  2XBB C;  2L3Z A;  4IWQ A;  2LVP A;  1EUV B;  2RDG A;  3ZW3 A;  5AUK A;  1T3Q A;  2KX3 A;  2X8X X;  3IAM 1;  3WAM A;  2IPK D;  1E6E B;  1UBQ A;  3RNC C;  2OOB B;  3PGE A;  1B9R A;  1SJE D;  5HG2 A;  2QC8 A;  3ZTD A;  2N7E A;  2D3C A;  4L2Y A;  2VH1 A;  4NY0 A;  1ZOY B;  1T0Y A;  3RPF C;  3KW5 B;  4HRO A;  2JPH A;  2IDY A;  4HKZ E;  1ACC A;  3PHW B;  1V81 A;  1GB1 A;  3P4Q B;  2RDH A;  3NOB A;  4FAD A;  2I1J A;  1HQR D;  1FO4 A;  2G1E A;  4JLC A;  5E6O A;  2PE6 B;  4MAC A;  2LRU A;  4Q2J A;  2RGF A;  3V62 A;  1GJZ A;  2HTM E;  2PW9 A;  1Q1O A;  2DAJ A;  4AQ7 A;  2WXQ A;  3ZYY X;  4NJ7 A;  2WHI A;  3H7P B;  1PFD A;  3NS1 A;  4WUR A;  1SE4 A;  2Y5P A;  1E8X A;  1Y8R C;  1VR9 A;  3ZLZ A;  1RAX A;  3Q3F A;  1JRU A;  4BFR A;  1HTQ A;  2KWC A;  4JL9 A;  2CU1 A;  2KDM A;  1F2R C;  2WXO A;  2K25 A;  5H8Y E;  5C23 A;  2ZJD A;  3SHQ A;  3Q69 A;  3ML9 A;  3N30 A;  1ZDX A;  2BWF A;  2B3A A;  2JWU A;  2YEP B;  2M8S A;  3PZD A;  1DYQ A;  1KJT A;  1ZGU B;  2KVR A;  1YOV B;  2DZK A;  3RNG C;  4MSQ B;  3RI7 C;  2KN5 A;  1SF0 A;  2WXK A;  3WAO A;  3ZTC A;  4IM2 A;  1I7H A;  1E90 A;  4E71 A;  3L13 A;  3U7D A;  1SE3 A;  1VCB A;  2D5G A;  4JX1 C;  4HVB A;  2MP2 B;  4XE0 A;  3O65 B;  2IY1 B;  1WX8 A;  1L0X B;  1C3T A;  2K8C A;  3AXC A;  1R7S A;  5BO4 B;  3NY5 A;  2IJ0 A;  5D2M B;  2RD0 A;  1BT0 A;  1UNS A;  3LJ3 A;  2G9H D;  3DHG C;  1HA5 A;  2KAJ A;  4BOS C;  2LJ5 A;  3HVD A;  5EDS A;  2UWQ A;  1Q10 A;  3R7R A;  1TZO A;  2W3S A;  3GB1 A;  4NPN A;  4MJS B;  4E74 A;  3I63 C;  2CHW A;  3VHT C;  2UYZ B;  4HCN B;  4KZ0 A;  4WJQ A;  4ZOH C;  1UH6 A;  1KLG D;  5J17 A;  3TSS A;  2NS5 A;  2DZM A;  1WE7 A;  4M0W B;  1A70 A;  3NRZ A;  4RGN A;  1WYG A;  3I57 A;  5D3I B;  1ZUD 2;  3H7S A;  1OEY A;  3AEG B;  2FNJ B;  2V3N A;  3HM6 X;  3JSV B;  5G55 A;  3RN9 C;  4A90 A;  2G4S A;  4N9F 4;  2ZNV C;  2M0A A;  3NJT A;  2V3P A;  3KUZ A;  1A5R A;  2L76 A;  3IFW B;  2WX1 A;  4XDD A;  3IG3 A;  5GMV A;  3N20 C;  4MDK E;  3VTV A;  1D5M C;  3CWI A;  5TSS A;  1OQR A;  3DCG A;  3VUX A;  1ZE3 D;  4EFO A;  1EWC A;  2E3T A;  5J18 A;  1FCL A;  3NZS A;  1WGY A;  1YN4 A;  2KLG A;  4AP4 C;  3HRD D;  4PK1 A;  1V5T A;  3ZGZ A;  3IVF A;  1OQQ A;  1LGR A;  1TZ1 A;  1CK1 A;  1NYR A;  4ICV A;  4BKG A;  2I1K A;  4HLE A;  1YJ1 A;  4CO7 A;  2JXT A;  1C1Y B;  1YX6 B;  2K1F A;  4HPM B;  4MGI E;  4MEL A;  2RPQ A;  4MGZ E;  4LNK A;  1WGK A;  3U8Z A;  3W2D A;  4GMV A;  4DXG A;  1RM6 C;  5CX3 A;  4BKS A;  1P98 A;  4RGM A;  2WGS A;  1EU3 A;  1T0Q C;  2CHZ A;  1E7V A;  1GUA B;  1XCT L;  2D3B A;  2K9X A;  2A5U A;  2KWD A;  1JWS D;  3NG0 A;  1MHH E;  2M17 A;  1EF5 A;  2ACZ B;  5JZE B;  3ZIM A;  2FBW B;  3A9J B;  4YTN B;  1TS5 A;  2PPH A;  3E56 A;  3Q8A A;  2KMM A;  2CS4 A;  4ZHO A;  4KX6 B;  4A9A A;  1E10 A;  2M19 A;  1WX9 A;  4P7I A;  2BTE A;  4TSS A;  1WXS A;  4RF0 A;  3UQB A;  3DWG C;  2XK5 B;  4JWU C;  4CYE A;  2KFJ A;  4MH8 A;  4GIV A;  4ZYS A;  4K3B A;  1F52 A;  1N63 A;  1WSP A;  2WQY B;  4FN2 A;  4IUM B;  3QAR A;  3N9Y C;  3RT3 B;  4ZRJ A;  2MBH A;  3GOE A;  2W9N A;  1IP9 A;  3ZJT A;  1IYF A;  2MCN B;  1NDD A;  2G3Q B;  1H8C A;  4XWT A;  3AEA B;  3QJZ A;  1FIQ A;  4HEA 1;  2MH7 A;  1SE2 A;  5MPO A;  4BOZ B;  2FCS A;  3P2B A;  4L23 A;  3SDL C;  4DHJ B;  4IW0 A;  3DVN V;  5L83 A;  1V5O A;  4QAY A;  3VR8 B;  3NZ3 A;  4HJK A;  1V49 A;  2WXP A;  1KOT A;  3OLM D;  2GBM A;  2GBN A;  4ACF A;  5GXG B;  2BGF A;  4US8 A;  4FA6 A;  1V6E A;  2K8B A;  2MQJ A;  4KVG B;  3BK2 A;  4F1S A;  1WGG A;  2BYV E;  3EGR A;  4MJS A;  3RUL A;  4LLG M;  2QHO A;  4WWP A;  3GE8 C;  2E6X A;  1CQV A;  2DBY A;  3VFK A;  2V1Y A;  3DWM A;  4WQO B;  2RMM A;  1VDV A;  1B1Z A;  1WGH A;  1EU4 A;  1TY2 A;  1VRA B;  1JML A;  3BZD B;  1OGW A;  4TKN A;  2LFI A;  5HKH A;  1WI0 A;  2DYO A;  2KQ4 X;  4WAF A;  1UEL A;  3JSV A;  4ARC A;  1I4Q A;  1JWU D;  3TCA A;  2KO3 A;  4ZRK A;  3PO0 A;  2BPS A;  2KJH B;  1JW9 D;  4WWM A;  1FPY A;  4KIK B;  3LDZ E;  4KDI C;  3AED B;  1QOF A;  1D5X C;  3A1Q A;  4S17 A;  3NS8 A;  4KV2 A;  2LD9 A;  3Q3M C;  1I4X A;  3ZDM C;  3ONS A;  1JWA D;  5C1Z A;  2LRW A;  5AZF A;  1I4G A;  4WJP A;  3QHT A;  3TUO A;  3EA6 A;  3Q8E A;  4NZL B;  3CST A;  4GN1 A;  1LO5 D;  4IKG A;  2XEW A;  3IHP C;  4GXB A;  1ZXI A;  2BS4 B;  2N0S B;  3RNB C;  2K22 A;  4IWO A;  2D07 B;  2IY0 B;  4F8C B;  1IGC A;  5IP4 D;  4JWS C;  4NAM A;  1QT9 A;  2CJO A;  3NHE B;  4HCP B;  3P4R B;  3B08 A;  4W9J A;  1ET9 A;  3R7Q A;  5JHA A;  1GOZ A;  3Q2A C;  4EZJ A;  2W54 A;  4WQM A;  3RD2 A;  4PYU A;  3DVG Y;  1PYW D;  4DQO C;  4FLH A;  4RMA A;  3LB8 C;  1HE8 A;  4NAW A;  2JY6 A;  5EE0 A;  4JIO U;  4NQK E;  3Q8C A;  1WRD B;  2RPV A;  2DYB A;  2DNF A;  5C2T B;  1NBF C;  3A9J A;  2ZCB A;  2QCZ A;  1FFV A;  2C60 A;  1TKY A;  1GB4 A;  2ZZP B;  4F7Z A;  3W5V B;  4HKQ A;  4FXC A;  3AB5 A;  1OEY J;  1YQ4 B;  1J7A A;  2Y3A A;  2LXA A;  4MGY E;  3Q14 C;  1WF9 A;  1V1P A;  2HE7 A;  4REZ A;  2WNM A;  2AQ3 B;  3GS2 A;  1UWX A;  2JUO A;  4W9H A;  2K8H A;  1M94 A;  3KYC D;  1L6U A;  2ZW1 A;  4P1B C;  3QQ8 B;  3X0W A;  3KWL A;  4ZHP A;  1E9M A;  2ON8 A;  2VH2 A;  3FC4 A;  3FIL B;  3WIM A;  4HK2 A;  2JZZ A;  1XLP A;  1VLB A;  3KUC B;  1N61 A;  1Z2M A;  3MJ5 A;  2INN E;  4YT0 B;  2GOW A;  2V4I B;  4B0M A;  2C9W B;  3M95 A;  4DDG D;  2LUM A;  4B0E A;  5CHW A;  1GC6 A;  5FR3 A;  4FJV B;  1P9D U;  3OWE B;  3B1L X;  2GLS A;  1FD6 A;  2KDI A;  4B9K A;  4LNO A;  3NVW A;  3PRE A;  3KUD B;  2C7M B;  1RRB A;  4DHJ D;  4GDK B;  1IBX B;  2LAS A;  3AM9 A;  3ZKJ C;  1TBE A;  2BB5 A;  1QF6 A;  1WY8 A;  3QA8 A;  1XCQ L;  1VZ7 A;  1E0Z A;  3ZDT A;  4LNN A;  3SFD B;  3L4P A;  2JU6 X;  2KWV B;  1TY0 A;  1UUP A;  5H92 C;  3MC9 A;  3WA0 A;  2FUH B;  2BYF A;  4AOF A;  2NCN A;  3WAP A;  3MJW A;  2L32 A;  5DPR A;  4PT5 A;  4C80 A;  3FAH A;  1AYF A;  2FAZ A;  1WJ4 A;  1K50 A;  4YWG G;  3MHS D;  2YLM A;  4OW0 A;  3ETR A;  1C79 A;  1M4V A;  2WXL A;  2CJN A;  2Y5C A;  3PZ7 A;  1J19 A;  2IZV B;  1F2R I;  5L95 C;  1BML C;  2VRR B;  4W9L A;  3TEY A;  1KM7 A;  5FKA C;  2WXG A;  1LXD A;  3VH3 B;  4NQL B;  2MWS B;  4HRS A;  3ZNZ B;  1TKG A;  2SEB D;  1JRP A;  5JH5 C;  1WJ6 A;  2HJ8 A;  3NZU A;  4E3C A;  4AJW A;  3AU4 A;  1WYW B;  2L7R A;  4HXD A;  1XF5 L;  5EE9 A;  1K53 A;  2DX5 B;  1ENF A;  4C00 A;  4W9C A;  3CSF A;  1IGD A;  2VZK B;  4LNF A;  4BZA A;  3V61 A;  4N58 A;  2L83 A;  3QK0 A;  1QOG A;  1K8R B;  4B6W A;  1KRH A;  3VTW A;  4IWP A;  3BYY B;  2NMQ A;  2MSE D;  2M1M A;  5BYS A;  4XZ4 A;  3DBH I;  4KZC A;  2BQQ A;  3ENE A;  1WRI A;  5CHF A;  2BF8 B;  3AE9 B;  3ZUN A;  1KLV A;  1SE9 A;  2LEK A;  4EOY A;  3W1Y A;  4G50 A;  1C78 A;  3ZJV A;  2BVC A;  3DBH B;  3L54 A;  3R8B A;  4EZL A;  2MJ3 A;  2NVU I;  2V3S A;  3JVZ X;  2BYT A;  1ZPS A;  2WDR B;  3PPA A;  1WXM A;  2LHD A;  1MG8 A;  2ZVN A;  2KQS A;  3PRP B;  2DAF A;  1ROE A;  1SEB D;  2N9P C;  2AL6 A;  4G0N B;  2FUG 1;  3TEZ A;  4L1B A;  3ZO5 B;  4FJZ A;  2QDF A;  1ZDV A;  2PVO D;  1F1H A;  2LXC A;  1FMA D;  2QMT A;  4P16 A;  2KFK B;  4MSM B;  1TS2 A;  2C5L C;  1Z5S B;  1XO3 A;  1FXA A;  2LZ6 A;  3P4S B;  1SSN A;  1ZP0 B;  1P0R A;  2K6Q A;  1I4H A;  2I38 A;  2JXX A;  2RR9 A;  1WMH A;  4TUU A;  3WCQ A;  3DVG X;  4W9E A;  3TIX A;  5D94 A;  2LI5 A;  2D3A A;  2ZNV B;  3MP9 A;  1SXT A;  3SFE B;  2W82 A;  3RCZ A;  5D3D A;  3MC0 B;  5HHD G;  2BS3 B;  1N60 A;  2N1V A;  4BBN F;  3CMM B;  1WR6 E;  2J0J A;  5AZH A;  1FNU A;  2R2Q A;  3E9S A;  2PIA A;  4CHK A;  4HDO A;  2WU5 B;  3KVF B;  1SB3 C;  2Z59 B;  4LK0 M;  3K9O B;  3VQI A;  1N6Z A;  3O13 A;  5JXV A;  3W1S C;  1FRD A;  2O6V A;  2O6V D;  2LGD A;  2KNB A;  2ZPN A;  1FRR A;  1FEH A;  5T8I A;  3T8M A;  4JQW C;  1WM2 A;  2MA9 B;  4A6Q A;  2ZPY A;  3BYT B;  1KTK A;  3M62 B;  3P42 A;  3L16 A;  1MHX A;  3C19 A;  1LM8 B;  1QZE A;  4RGT A;  3A33 B;  3H6N A;  1L4Z B;  4ANV A;  4MEM A;  1FXI A;  2GBR A;  1NI3 A;  1XQQ A;  2L00 B;  2IBI B;  2IND C;  4XDC A;  3HUI A;  3AU5 A;  3VR9 B;  3K9P B;  3OJ4 B;  1QOB A;  2N9L A;  3PTF C;  4IDI A;  2FCM A;  3LXF A;  2WXF A;  3QCA A;  1UF0 A;  1PGX A;  4RFB A;  1G6J A;  5BMI A;  3Q6B A;  2QEJ C;  4OZA A;  4DHZ E;  1WIA A;  1EF1 A;  4X57 B;  1XT9 B;  4YSY B;  2JZ3 B;  3MHZ A;  4GOC A;  2OJR A;  3U4E G;  4OZB A;  3NVZ A;  2J53 A;  4YTP B;  2WXJ A;  4MM3 B;  2D11 A;  4BBN C;  4MH0 E;  3IAS 1;  1WGD A;  4KGR A;  2NTS A;  1WWT A;  1L7Y A;  1T0R C;  1EM7 A;  1MVK A;  2DZI A;  2V0G A;  2PJH A;  1K52 A;  1F77 A;  2V4L A;  2DHZ A;  3H7P A;  3A4S C;  1IPG A;  4N59 A;  3APC A;  5G5H A;  4KSK C;  3U30 A;  4FUL A;  2BYE A;  3AEF B;  1C4C A;  2VZK D;  4KKJ A;  2JYE A;  2LMC A;  4A55 A;  2R2O A;  3SR6 A;  1V9J A;  3C8Y A;  1N5W A;  1L0V B;  4LJO B;  2KK8 A;  4I6L B;  5IOI A;  2PMV A;  3B2F A;  3PLU A;  2WDV B;  2JZP A;  2MBO A;  2M0X A;  4C7Y A;  2FIF A;  2MP2 A;  1QIL A;  3R66 C;  3TJP A;  5KHQ A;  4GSW A;  3AE5 B;  4ZRI A;  4ANX A;  3M63 B;  2NPT B;  4KDL B;  1D5Z C;  2KT7 A;  1AN8 A;  2W3R A;  4IOI E;  4ARI A;  4IM0 A;  1QOA A;  1L5P A;  2O2V B;  1LQB A;  2J0M A;  2AX5 A;  1VD2 A;  2INP E;  2IGD A;  4YSX B;  1E5W A;  1VZ6 A;  1E7U A;  2KFK A;  2BT6 A;  3ABV B;  3DOW A;  2KJ6 A;  1OQY A;  4D2K A;  2MLB A;  2N4F A;  4LTU A;  1AWD A;  2JSV X;  2Z0E B;  4IG7 B;  1RYJ A;  3KH0 A;  1RFA A;  4S0R A;  4M0W A;  3ZQ4 A;  1FXT B;  1JCK B;  4H2A A;  2LVO A;  2ZEQ A;  3I5J C;  3W9C B;  5LNK 1;  1RWS A;  4GGQ A;  2AQ2 B;  4ITK A;  1P7E A;  2MBE A;  2XNA C;  4EZK A;  2LGY A;  3UGB B;  2G45 B;  1SBB B;  3CF6 E;  1PQS A;  2WWZ A;  1CJE A;  2IO0 B;  3VXW A;  1PUT A;  3A9K B;  4EKU A;  5HFY A;  4BVU C;  2ONQ A;  2N9K A;  1V86 A;  1SIF A;  4M00 A;  3N1X C;  1CMX B;  3MTN B;  1NEK B;  3IT6 B;  4RM8 A;  2KMC A;  4KSL C;  4WWO A;  4K81 A;  1YMH E;  2GRI A;  3H8H A;  2WYQ A;  4WJN A;  5E6N A;  3U7Z A;  3DBL I;  1CZP A;  1I4R A;  4EE2 A;  3WAN A;  1IUE A;  2LGX A;  2M4N A;  5FR6 A;  3HK0 A;  4C4V B;  1C77 A;  2EMT A;  4YSZ B;  1I4P A;  1JQ4 A;  5DCN A;  3SU8 X;  3OAW A;  4WIP A;  5LXH A;  3Q3O C;  4NJ6 A;  3DBL B;  1TJE A;  4C7Z A;  2J52 A;  4HDQ A;  2NBV B;  2FID A;  3GE3 C;  1KH0 A;  4K3C A;  3AE7 B;  1J7C A;  3ZNG C;  4BAX A;  4DWF A;  4C56 C;  2WP9 B;  1TS4 A;  3TBL D;  1MI0 A;  5G2N A;  1P3Q U;  4N6E B;  5D6J B;  5LLI A;  3I3T B;  4MM3 A;  1R4N I;  1WZ0 A;  1WE6 A;  3P63 A;  1T6B X;  3V3X A;  3IBE A;  4GDL B;  3P1M A;  1QKZ A;  4ANU A;  3APD A;  1YJJ A;  3AE4 B;  1E8Y A;  2V9H A;  2PLP A;  1SJH D;  2INC C;  2NTT A;  1RLF A;  1R4N B;  4TMA B;  5DPS A;  2IO1 B;  2ZCC A;  5AZG A;  3U52 E;  3TEW A;  2XK5 A;  2DZJ A;  1TT5 B;  3NVV A;  4TV3 A;  1PDX A;  3PZ8 A;  3J9C A;  4GLS C;  4BKT A;  3UI3 A;  4YTM B;  1WH3 A;  2AWT A;  4W9F A;  1XLO A;  1Q5W B;  3VUW A;  1U4A A;  2NR2 A;  1GAQ B;  3EC8 A;  1DOX A;  2Q5W D;  3I9V 1;  2JT4 B;  3EHV A;  2WXH A;  5BMG A;  4J6I A;  1STE A;  1J8C A;  1FM0 D;  2MJD A;  1H4R A;  1WXQ A;  4M02 A;  2DYM A;  3W5U B;  3Q8F A;  2MEK A;  1ISN A;  2IO2 B;  2RSU A;  1WZ3 A;  4NJC A;  4AS1 A;  2K0P A;  4EEW A;  3N3K B;  2XN9 C;  3JW0 X;  1P1A A;  4W9G A;  4TQ0 A;  1GG3 A;  1NI2 A;  2KTR B;  5CTR C;  3N1Y C;  4LJP B;  4LDT B;  3R2I A;  4R3D A;  1OFF A;  1ZXH A;  4YL8 A;  3GZN I;  1TYG B;  3L0W B;  2QSD A;  3RNE C;  2LGI A;  2AYO B;  2YEP F;  3DDC B;  2EEL A;  3N1Z C;  3KWV A;  2HJ1 A;  4IM3 A;  1JWM D;  5IAA C;  2NBU A;  2LJI A;  1XD3 B;  2MRP A;  1V80 A;  3GZN B;  3HVZ A;  2J4X A;  5EE3 A;  1E7P B;  1J7B A;  2CR5 A;  4AJY B;  3PV1 A;  3APF A;  1MPE A;  3PRM B;  3PT2 B;  3VRB B;  2EMS A;  2LGS A;  2KJR A;  4KIK A; 
#chains in the Genus database with same CATH homology
 4P1C C;  3RNG C;  3RI7 C;  3Q3M C;  3GE8 C;  3RNC C;  3N1Y C;  3DHG C;  3I5J C;  3Q3N C;  3RMK C;  3GE3 C;  2INC C;  4P1B C;  3RNF C;  1T0Q C;  3DHI C;  3DHH C;  3N20 C;  1T0R C;  3N1X C;  3RNE C;  3I63 C;  3N1Z C;  1T0S C;  3RNA C;  2RDB C;  2IND C;  3Q2A C;  3RN9 C;  3Q3O C;  3RNB C;  3Q14 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...