2RDBC

X-ray crystal structure of toluene/o-xylene monooxygenase hydroxylase i100w mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
TFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene, o-xylene monooxygenase oxygenase subunit;alpha
publication title Dioxygen activation at non-heme diiron centers: oxidation of a proximal residue in the I100W variant of toluene/o-xylene monooxygenase hydroxylase.
pubmed doi rcsb
source organism Pseudomonas stutzeri
molecule tags Oxidoreductase
total genus 24
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2007-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 2rdbC00
3DHGC 3Q14C 3RNGC 3N20C 3RNCC 2INCC 3Q2AC 4P1BC 3N1XC 4P1CC 3I63C 2INDC 3RMKC 1T0QC 3Q3NC 3N1YC 3N1ZC 3RNFC 3RI7C 1T0RC 3I5JC 3DHHC 1T0SC 3RNEC 3RNAC 3GE8C 3GE3C 3DHIC 2RDBC 3RN9C 3Q3OC 3RNBC 3Q3MC
chains in the Genus database with same CATH superfamily
3ZXRA 4WAAA 2KDMA 1P0RA 1C77A 3C8YA 3PLVA 3AE7B 2LVQA 3M95A 1FCLA 4B6WA 5C23A 2RPVA 2BGFA 2FNJB 2B76B 3M62B 2M4NA 2MA9B 3DBHB 2ZJDA 4M00A 1SSNA 4W9LA 1D5ZC 3NHEB 1N5WA 2QCZA 2RPQA 4HEA1 1DYQA 3R3MA 4LNNA 2W3RA 2X38A 4EUTA 3HK0A 4IDIA 4M8MA 3DQVA 4A6QA 1G6JA 4FHJA 4NQKE 2E3TA 2J42A 1CMXB 3IFWB 3DVNV 2LXAA 3ZXVA 1V6EA 4IWOA 4RGTA 3T9LA 3A33B 5CHFA 1CK1A 2MP2B 4G11A 4JPSA 5AEKB 4DQOC 3NRZA 3KUZA 5JXVA 2DZKA 3NVWA 4M0WB 2KYWA 1AWDA 2NVUI 4ZRJA 2FBWB 3P4PB 3TL5A 2LASA 2M1MA 3OJ4B 4EZJA 2KJHB 3ZLZA 1XT9B 4IOIE 1P1AA 4KKJA 3I5JC 4US8A 1HTOA 1KM7A 2RSUA 1E0ZA 2O6VB 2SEBD 5TR5A 4W9JA 4DDGD 1L0VB 4HVBA 1XO3A 1P7EA 3KYCD 3ML9A 1SGHA 4PS7A 4TQ0A 3Q3NC 2KFKA 4DXFA 2LGYA 3RNFC 4YSXB 3PV1A 3PSEB 4IKGA 4C00A 3IT4B 1Y8RC 3TEXA 4NZLB 2PE9A 3E9SA 2W82A 3OJ3A 3L54A 4R3DA 2TSSA 5L83A 2Z0EB 5DPSA 1LM8B 1T0SC 5IAAC 1UNSA 4C56C 3VDZA 5D94A 1TS5A 3H7PA 1UUPA 5DPWA 2MJDA 3J9CA 2KDFB 3UGBB 4HKQA 2LEKA 3U7ZA 1NI2A 1YX5B 1MHHE 2LUEA 1VCBA 2DYOA 2XNAC 1TJEA 2JF5A 1MFWA 2LRWA 1KRHA 5BO4B 3RI7C 1XXGA 1EU3A 3A9KA 3SEBA 3KWVA 2JRHA 5FR3A 4WH4A 5FK9C 1FNVA 3KH0A 2KWDA 4H2AA 2GBKA 4LDTD 2NBUA 4MGYE 3ZKJC 2RD0A 3DDCB 3VTVA 1KOTA 3WAMA 3FC4A 1C4AA 4ACFA 3M63B 3NG0A 1WYGA 2QMTA 3UF8A 2ZW0A 5G2NA 4UDUC 5HG2A 4LNKA 5LLIA 1YQ4B 2LGDA 4RH6A 2OHFA 2BYEA 1UBIA 2LVOA 3ZDTA 2JYEA 2GLSA 2LZ6A 3DHGC 4YWGG 1ZDVA 2PTLA 1E6EB 3EFUA 1I42A 2JZPA 2HJ1A 2LVPA 2BVCA 2W3SA 3UINB 1KTKA 2V3SA 5D3IB 4AUQC 3RMKC 2N1VA 4MH0E 1D6EC 3QAQA 3ML8A 1ZDXA 2JZ3B 3RNAC 2AQ2B 3C19A 3AULA 1SBBB 4RMAA 3IAM1 4OZCA 1VLBA 4HKZE 1PUTA 4F1SA 5GXGB 5JHAA 1PGBA 2AEHA 2A5UA 2KJ6A 1AN8A 5C2TB 3PTFC 4BOSC 1RLFA 2SAKA 4FJVB 1MPEA 4XGAB 4ITKA 2KN4A 2JWUA 2KTFA 1Q10A 1WX8A 2VH2A 1HZ5A 2J0KA 1WGRA 4MT5A 4OZBA 3IG3A 4KGTA 2NPTA 3PZDA 3AE3B 4A20A 3AN1A 4JGHB 1J7CA 1F2RC 4WWMA 3UQBA 3QHTA 5J18A 2L0FA 1XLNA 3EFCA 3VAWA 3LXFA 3B9JA 2BW2A 5AZHA 1IUEA 3L13A 4FN2A 4CO7A 5EE3A 1TKEA 4K3CA 5IN7A 4BKTA 1T6BX 4KIKA 1BMLC 3RNBC 3HUIA 3VR9B 3O13A 4JWUC 4W9FA 2VRRB 4E74A 3QIJA 3RD2A 2AYOB 5G5GA 4PS3A 2G1EA 4OZAA 2VH1A 2V4LA 1C76A 2K22A 4BBNF 2B3AA 3RNEC 4MELA 1YIWA 1L0XB 5LXIB 2KMCA 1FIQA 3A4RA 3L0WB 4I6PA 2N9PC 2HTME 1N61A 4NAWB 4XWWA 2QC8A 3MC0B 5E6JA 3PS6A 4MM3B 1V2YA 4RF1A 1AYFA 2WS3B 1K52A 3ZTDA 1H8CA 3BINA 3DVGY 2GBJA 1E7VA 1I4XA 5DCNA 3ALBA 2WU5B 1YQBA 4E71A 2E6XA 3UI3A 2I38A 4J3OD 1NEKB 1E9MA 4DHJB 2MLBA 1ZOYB 3I63C 3VFKA 2LJ5A 2L7RA 3VQIA 1RRBA 1GB4A 4PYZA 1L5PA 1I4QA 4PYUA 3MFGA 4IC7B 4PK1A 4TKNA 3NS8A 3NY5A 5IKCM 5DPTA 3H1UA 3IAS1 4DDID 2BF8B 3AU4A 1ET6A 3B0AA 1YOVB 1R4MB 2KDEB 2G4SA 2K8BA 1IBXB 3NVZA 3KYDD 4MJSA 1FFVA 4WJPA 4GDKA 4HWIB 3FILA 3VR8B 1LFDA 3IBEA 4TUUA 1T3QA 2MHJA 3P4RB 4M02A 3R8BA 4ANVA 4RNAA 1WE7A 3U2SC 1XCQL 5IOIA 2BB5A 2MEKA 3QWZB 1I4PA 3MC8A 2FUHB 2DZJA 1WXVA 3JVZX 3X0WA 3H8HA 1NYRA 4ZOHC 4FA6A 4FXCA 3AEEB 1D4BA 3JSVB 1DOYA 4NY0A 2WXPA 2KKCA 2BT6A 1WM3A 1SF0A 5EE9A 5EE0A 1VJKA 4HRSA 2WP9B 2PPHA 4NJ6A 4K7WA 2DNFA 3W5VB 2QEJC 1FXTB 1VZ7A 2J53A 4A90A 4YXDB 4ARIA 4OVUA 2VZKB 4I6LB 5BYQA 5EE1A 2MP2A 4IM0A 4GDLB 2BB6A 2MBHA 2EKIA 3AE2B 4FBJB 1SIFA 2CKHB 4WWNA 1ZE3D 1WXSA 3BK2A 4WJNA 4K81A 4BZAA 2WXRA 1IPGA 3BVMA 2INNE 2BS3B 1L6UA 2Z8LA 4A3PA 4WQOB 1OTRB 2GBRA 3FAHA 4IM3A 2V3PA 3W1YA 4GOCA 1A70A 2D3AA 3KUDB 2DZIA 2XN9C 3SFDB 2J52A 2O6VA 2N4FA 2ONQA 3AE9B 4LLGM 3L10B 5L95C 5D3DA 1JWSD 4US9A 3MHSD 3A1QB 3AE1B 4P1CC 2JPHA 2JU6X 4ZRIA 3ZUNA 3R2TA 1WFYA 1E8YA 2EKEC 2KMAA 4K1RB 3KUCB 5BYRA 3AM9A 1YN5A 1YMHE 4QAYA 3WIMA 1SXTA 1V9JA 2KHWB 1FD6A 3CMMB 3N20C 4AS1A 2ASQA 3OLMD 2G3QB 5IP4D 1R4MI 3TEYA 1JMLA 1WZ3A 2KTRA 1ZXIA 2MBEA 2KJRA 2XEWA 2ZVNA 4ICVA 2NCNA 3APDA 4IG7B 2D5GA 2KNBA 1LXDA 1GUAB 3URYA 3GB1A 4KDLB 1WJ6A 3Q14C 1NDDA 4E3CA 4N59A 3RT3B 2JZZA 3ZJTA 1YN4A 3L4PA 2BWES 2PIAA 3VTUA 3U30A 4IWPA 3IVFA 3KVFB 3ZYYX 3GOEA 5AUKA 5H92C 4ZHOA 1FNUA 2DYBA 1RYJA 5D2MB 1OEYJ 2LI5A 3QX1A 4RGNA 4ANXA 1SJHD 4WQMA 3KWLA 1E8WA 4KDIC 1XD3B 2ACZB 2GMIC 3MJWA 4MEMA 2BKFA 2IGDA 1YN3A 1TBEA 1P3QU 1N62A 4B9KA 3UQAA 2RMMA 2DBYA 2JRIB 2W55A 3ZVVA 2WDTB 2BQQA 1P7FA 1NENB 3I57A 2NTSA 3EGRA 1SE4A 4YTNB 4NQLB 2I2YA 2DAFA 4PT5A 1WM2A 2YVCA 2MJ3A 2QSDA 3AXCA 4OVVA 4IUMB 4REZA 3PRPB 4YTPB 2A4ZA 3C0RB 1JCKB 3BY4B 1FCCC 1WE6A 1XEEA 4HCNB 4C4VB 1L0YB 1WZ0A 4MGIE 3WALA 2OOBB 4AP4C 3L16A 2RDBC 3D32A 3OAWA 3WAPA 4NJCA 4NPNA 3AEAB 3PT2B 1XLPA 3NOBA 4CQNA 3B2FA 3K9OB 2M17A 2Z0DB 1WMHA 3W5UB 1V5TA 2KN5A 2ON8A 3PO0A 2Y5PA 2AWTA 5CHWA 1V81A 2C5LC 4G0NB 4FLHA 3IHPC 4MGZE 1GB1A 3L17A 2O6VD 3PZ7A 3A9JA 1MHXA 3M3JA 5BMGA 2O2VB 1EWYC 5HFYA 1UF0A 1ZP0B 2NS5A 3AU5A 1WGYA 3H9DA 3VRAB 4JIOU 3NUHB 1RWSA 2J4XA 2K6DB 1OFFA 2KZRA 4FJYA 2LMCA 3QJZA 3S2AA 2HD5B 1PGAA 4W9DA 1TIFA 3EUB2 1E7PB 1JQ4A 1ZXHA 3P63A 2RGFA 2KQ7A 3GE8C 2OJRA 2WDRB 4WWPA 3V60A 2INPE 3NZUA 1XLQA 3Q3OC 2ICIA 3KLSX 4ZDVA 3QQ8B 3R7QA 1DOIA 2CHWA 2D10A 4K7UA 2MWSB 2Z59B 5KHQA 2L83A 4GN1A 4YL8A 3U8ZA 4D2KA 3TMPB 2PKOA 1WRIA 1PFDA 2LRUA 3N32A 2KD0A 1F0ZA 2GBNA 2NR2A 1QLBB 2KFJA 1E7UA 4GU2A 1XLOA 1YJIA 1WXAA 4NAWA 4WJQA 4MM3A 1MG4A 1OGWA 1QKZA 3KQ4A 3WAOA 2JY6A 2R2QA 4N9F4 3L08A 4TMAB 1KLVA 1QQRA 2EMSA 2D11A 4PS8A 2IO3B 1K8RB 1QOAA 1P9DU 3CSTA 2L8JA 1ZGUB 2MBQA 1GPXA 3AB5A 2QDFA 4OVZA 4ARCA 4KZ0A 4XDDA 3Q8EA 4EZLA 4XDCA 1YX6B 1EM7A 1WYWB 2C9WB 1QZEA 2N9XA 3N9YC 1JWBD 1VR9A 1I4GA 1TGZB 1WXQA 3PPAA 4JQWC 2WU2B 1P98A 1UGJA 1N60A 2XK5B 2JVCA 3LJ3A 1J8CA 4EE2A 2KFKB 2YEPB 1FXAA 3BVGA 3N1ZC 1IBXA 3SR6A 1SE2A 1FO4A 1VRAB 2AQ3B 4BVUC 1DOXA 2PE6B 3BZDB 1PYWD 3AE5B 3GZNI 1VDVA 1BXTA 3VRBB 1L7YA 1SB3C 4HJKA 3VH3B 1F2RI 3ZO5B 2N9EB 2INDC 2KX3A 1E10A 4RGMA 1DGJA 1UH6A 2ZNVB 3B2GA 2M0XA 2R2OA 3JSVA 3AEDB 2KMMA 3U52E 2L52A 4BBNC 2DZMA 2EMTA 1GAQB 2H88B 2MQJA 2DLBA 3RNGC 1NI3A 3NS1A 3Q2AC 1C4PA 3W1SA 4BKGA 4DK5A 3P4SB 2QHOA 1D5XC 2V0GA 1UBQA 3PLUA 1V49A 1D3ZA 4ZYNA 5KHOA 1WGHA 2IO2B 5E6NA 2IO0B 4FHKA 3VXWA 3ZNID 4RCOA 4RFBA 1M94A 2BS4B 2INCC 3RULA 1WX7A 4B0EA 3V62A 4M01A 2KACA 4DHZB 1QILA 3TEWA 2LJIA 1C3TA 4GDLA 1N6ZA 1OQQA 1KFYB 1L4DB 5BYSA 3ZQ4A 1KH0A 2GBMA 3Q3FA 4AJYB 2GI9A 1RM6C 4EEWA 3RPFC 2PJHA 2QJLA 2KLCA 1I4HA 5TSSA 2LFIA 1ISNA 4HDOA 3LDZE 4G3XB 2LGXA 3ZJVA 3T8MA 1WGDA 1QF6A 1T0YA 1WGGA 3DBRB 3MHZA 2OEDA 3AEGB 2KWVB 3PRMB 1FRRA 4S0RA 1MJDA 2RDHA 4A3OA 2BYFA 2CR5A 2RR9A 1EF1A 1ZPSA 1GC6A 1Y56A 2BKRB 3A1QA 5H8YE 2MH7A 1WSPA 2LGSA 4P16A 4EOYA 5E6PA 2FCNA 3QCAA 2BWFA 1IYFA 1LO5D 1UELA 1ESFA 2WXQA 3WCQA 3P42A 1BT0A 2MW5A 3VUYA 1XQQA 4DXGA 3ZRCA 3U4EG 3CSFA 3DBLI 1MVKA 2KXJA 4HXDA 1J0GA 1AARA 2ZPNA 2IDYA 1PQSA 2L76A 2KO3A 3N30A 2DYMA 2OJWA 2W54A 4WURA 4C7YA 2FCQA 3VUWA 4FADA 2WXKA 2KANA 2FAZA 1QOGA 4HJGE 2DHZA 1ZW7A 4GB9A 1F77A 2ZEQA 2UWQA 3PRZA 4W9CA 1FPYA 3AH7A 2DAJA 2QIEB 3DVNU 1OQRA 5T8IA 1V1PB 4KZCA 3RYTA 2KOXA 3B08A 2ZCBA 1C9FA 1STEA 2M8SA 3V3XA 1WY8A 4MGKE 4MSMB 2IYDB 4LCDE 4I6NB 4BOZB 2WLBA 4M0WA 1TY0A 1HZ6A 3ONSA 2WDVB 2Y3AA 4IWQA 1ET9A 1Q5WB 3HM6X 2BYVE 1N63A 2Q5WD 4HPPA 4HPMB 5CHVC 1WR6E 4KGRA 2G45B 2VZKD 2LWPA 4MSQB 3NZSA 4GXBA 4TSSA 1YQ3B 5G55A 3AE4B 4C4VA 1K51A 5BMHA 1CZPA 2WDQB 1PDXA 2K6QA 3R7RA 1EWCA 3AE6B 1KF6B 3HHMA 2L05A 1V1OA 3EECA 5FKAC 2K5PA 3NJTA 4LTUA 2G9HD 4JWSC 4EKUA 2PLPA 3B1LX 1T0RC 4IW0A 3ZNZB 3FKYA 2K39A 2KVZA 1TS4A 3DBRI 1EU4A 4F8CB 4S17A 1E8XA 2LD9A 3SDLC 3I3TB 4URKA 4JE3B 4KSLC 4HPLB 4MH8A 4W9KA 3QARA 3TIXA 1YNTE 2O2VA 3Q8CA 1OEYA 1SE3A 1WJ4A 2L32A 2IBIB 2WXOA 2C7HA 4RGOS 2KC2A 3HVDA 3PVLA 2FIDA 3WA0A 1FXIA 4YTMB 4EZKA 3DWMA 4KSKC 4KV2A 1JRPA 3A4SC 2L3ZA 1NVID 5AUIA 2KDIA 2L0TA 1S3SG 4YSZB 4J6IA 1H4RA 3DCGA 3PZ8A 4JL9A 2GRIA 3H6NA 2V9HA 1D5MC 2C7NB 2CHXA 1Q1OA 3EA6A 2AL6A 1WXMA 3GP7A 1OQYA 3TUOA 4YSYB 3V6CB 3AECB 2ZPYA 2V3NA 1GOZA 1E8ZA 1L2NA 1C4CA 5JHBA 2WX0A 3HM3A 4RF0A 1WF9A 4W9HA 3TEZA 2JWZA 3W1SC 3E56A 2BPSA 2IJ0A 5J17A 2KX0A 1NBFC 2PMVA 4XZ4A 2K1FA 3SFEB 4X57B 1VZ8A 5IA7A 5CTRC 1ACCA 2V4IB 2BS2B 3P2BA 2V1YA 2AL3A 1J7BA 2R61A 2KQSA 2DX5B 4N58A 1J19A 1F1HA 3BYYB 2PVGC 2PW9A 2FIFA 1B9RA 2D2QA 3W9CB 3DOWA 4LK0M 3AE8B 3ZJUA 2RDGA 2YLMA 1TT5B 2X8XX 2IY1B 5C3JB 3NVVA 3RCZA 2K0PA 3KW5B 2MBBB 2CJNA 4FJZA 3N1YC 1EUVB 2JXTA 1X1MA 4NAMA 1FMAD 1GG3A 3GZNB 3VHTC 1WJUA 3LB8C 1E90A 2WYQA 3DVGX 5HHDG 4N6EB 2XK5A 1L4ZB 2IY0B 2WGSA 3Q69A 4BKSA 4LNIA 3VTWA 1LGRA 1AW7A 2ZZPB 3T3NA 1TS3A 3RZFA 3ZNHB 3NZ3A 3ZW3A 1QOBA 3DHIC 1TKYA 1LQBA 3O65B 5GMVA 4EFOA 5EDSA 3Q8FA 1JROA 4JLCA 3RN9C 2WHIA 3IT6B 3PGEA 1CJEA 3HVZA 3RUIB 4RM8A 3PREA 2KTRB 4HK2A 3DBSA 3TSSA 3VH4B 1YJ1A 2W9NA 1UGMA 1HQRD 4LDTB 3LYYA 3AEFB 3OG5A 2LHDA 2LUMA 1V8CA 2REXA 2BTEA 3ZNGC 5J2RA 4ZRQA 3CIRB 1F52A 3SHQA 4LNFA 1EF5A 1GNUA 3ENEA 3V61A 2JX5A 4Q2JA 1HXYD 1V97A 2FCSA 1TYGB 2KLGA 5IO9A 3BYTB 4GSWA 1WIAA 4DWFA 1I7HA 4AQ7A 4KVGB 2WX1A 2NBVB 3W2DA 2LHEA 1FFUA 2LXCA 1V5OA 1I35A 3DBHI 4W9EA 4WIPA 2M19A 3AI5A 3H7SA 4GLSC 3SD5A 4XWTA 4TV3A 1A5RA 1FNWA 1FM0D 2DENB 3K9PB 4B95A 1UWMA 2N9KA 1WI0A 2I1KA 4ANWA 4ANUA 1VZ6A 1V86A 1RAXA 4XYCA 4OW0A 1F9JA 3Q8BA 3PHXB 1GC7A 2JUOA 1UZXB 3ETRA 5CX3A 3R2IA 1C79A 2PEAA 1WH3A 1NYQA 3BVZA 5FR6A 3VUXA 2HTHA 2J0MA 4KKIA 1U4AA 2BBCA 5D6JB 2M56B 1C1YB 5JZEB 2KAJA 3AV8A 3DPDA 3P1MA 3N3KB 4L2YA 3Q3MC 3DBLB 1R4NB 2IGGA 1ZKHA 3APCA 1PGXA 1WMHB 1WRDB 2EELA 3ECIA 2C7MB 1BUIC 1VD2A 2CJOA 3X23A 2L1AA 2WNMA 2KWCA 1Q0WB 4YT0B 3QC8B 3A9JB 3AMZA 4L1BA 2K8HA 1WJNA 4P1BC 1ROEA 3ZGZA 3ZRFA 3QK0A 4MACA 2Y5BB 2FCMA 1TS2A 2L00B 3EHVA 2JSVX 4K3BA 4GMVA 1FRDA 4LJOB 3JYUA 3BIID 2GB1A 4BKSD 2N9LA 2MCNB 3H7PB 5LNK1 2IPKD 2K9XA 2GOWA 2WXNA 1KLGD 2CHZA 2WXMA 2JYTA 3Q6BA 2WXJA 4XE0A 3I9V1 2N7EA 3U7DA 3UIPB 4A8XC 1TZOA 3OWEB 1WGKA 3A9KB 1JWUD 4KGSA 1SE9A 4BFRA 4HDQA 1HEZE 4C80A 1V1PA 1WR1A 2AQ1B 1XCTL 4HCPB 2WXFA 1T5XD 3MJ5A 4TQ1A 3MP9A 4G50A 3RNCC 1JW9D 3PHWB 3V6EB 4ZHPA 2JQRB 3ABVB 1J7AA 2KDBA 3CF6E 3EC8A 5LXHA 4O1NA 3V05A 5AZFA 1JRUA 2CS4A 1R7SA 3GS2A 3ZIMA 5DPRA 4P6VF 3APFA 1KLUD 4CYEA 2MRPA 3IXSA 1B1ZA 1JALA 1XF5L 1SEBD 4M8NA 1I4RA 2WWZA 4AJWA 4XX5A 1RFAA 2ZW1A 4NJ7A 2DWQA 3P4QB 2J7QB 2KVRA 4CHKA 4WWOA 3BWUD 4P7IA 4A9AA 4DXAB 4B0MA 4II2B 3N1XC 1K53A 1WWTA 3R66C 2Y5CA 4ZYSA 2WQYB 5BMIA 4FULA 3RFZB 5AZGA 3NVYA 1MI0A 1HA5A 3ZDMC 3Q8AA 3ZTCA 4DHJD 1YD8U 5G5HA 4LNOA 4ZRPA 3MTNB 1KJTA 1Z5SB 1YJJA 1R4NI 4AWJA 2NPTB 2D07B 3T3OA 5D7GA 3TBLD 5MPOA 2XBBC 4RM9A 2M0AA 1CQVA 3MC9A 1HE8A 2WXGA 4WJOA 2KQ4X 2WXIA 3AEBB 1SIJA 2NMQA 4JX1C 1FEHA 1L6VA 2CU1A 2IGHA 3CWIA 1IGCA 3Q3JA 2JXXA 2MJEA 1E5WA 2YEPF 5HI1A 4XC2A 1ZUD2 1UD7A 1RFKA 4MDKE 1V80A 2NBWB 4GIVA 5JH5C 4II3B 2N0SB 1JWMD 3DWGC 2K25A 2N1WA 5I4DA 4OHJA 3HIZA 4KIKB 2ZNVC 3JW0X 1C78A 1QT9A 4BAXA 2JT4B 2N7DA 1MG8A 2BYTA 1GJZA 1S1QB 2AX5A 3BK1A 3HRDD 2IZVB 2J0JA 2HE7A 4L23A 3GE3C 2PVOD 2NTTA 2WXLA 2KK8A 5E6OA 2MBOA 2UU7A 4WAFA 4W9GA 1T0QC 3SU8X 4USAA 3RZWC 1TKGA 2FE8A 4NNJB 1Z2MA 2I1JA 4ASWC 1N5XA 3TCAA 2LGIA 2N7JA 4W9IA 1TY2A 2K3UA 1HTQA 2ZCCA 2H89B 3WANA 1M4VA 2C60A 4HLEA 2QILA 1QOFA 1JWAD 2D3CA 4DBGA 2ZVOA 1TZ1A 1IGDA 1TTNA 2WXHA 1SJED 4ZRKA 3UIOB 2KT7A 4IM2A 4HROA 1IP9A 4GGQA 4AOFA 2D3GA 4ICUA 4KX6B 1K50A 4LJPB 1UWXA 2KWUB 4DHZE 2MSED 2UYZB 3QA8A 5C1ZA 4MJSB 3VVWB 2FUG1 2HJ8A 4C7ZA 4GDKB 3FILB 2K8CA 3DHHC 2D3BA 2IO1B 3TJPA 4A55A 1WX9A 4K7SA 2CU3A 2KC1A 1ENFA 1EO6A 2G4DB 5HKHA 2MX2A 2HDEA 4F7ZA
chains in the Genus database with same CATH topology
3DHGC 3Q14C 3RNGC 3N20C 3RNCC 2INCC 3Q2AC 4P1BC 3N1XC 4P1CC 3I63C 2INDC 3RMKC 1T0QC 3Q3NC 3N1YC 3N1ZC 3RNFC 3RI7C 1T0RC 3I5JC 3DHHC 1T0SC 3RNEC 3RNAC 3GE8C 3GE3C 3DHIC 2RDBC 3RN9C 3Q3OC 3RNBC 3Q3MC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DHG C;  3Q14 C;  3RNG C;  3N20 C;  3RNC C;  2INC C;  3Q2A C;  4P1B C;  3N1X C;  4P1C C;  3I63 C;  2IND C;  3RMK C;  1T0Q C;  3Q3N C;  3N1Y C;  3N1Z C;  3RNF C;  3RI7 C;  1T0R C;  3I5J C;  3DHH C;  1T0S C;  3RNE C;  3RNA C;  3GE8 C;  3GE3 C;  3DHI C;  2RDB C;  3RN9 C;  3Q3O C;  3RNB C;  3Q3M C; 
#chains in the Genus database with same CATH topology
 3ZXR A;  4WAA A;  2KDM A;  1P0R A;  1C77 A;  3C8Y A;  3PLV A;  3AE7 B;  2LVQ A;  3M95 A;  1FCL A;  4B6W A;  5C23 A;  2RPV A;  2BGF A;  2FNJ B;  2B76 B;  3M62 B;  2M4N A;  2MA9 B;  3DBH B;  2ZJD A;  4M00 A;  1SSN A;  4W9L A;  1D5Z C;  3NHE B;  1N5W A;  2QCZ A;  2RPQ A;  4HEA 1;  1DYQ A;  3R3M A;  4LNN A;  2W3R A;  2X38 A;  4EUT A;  3HK0 A;  4IDI A;  4M8M A;  3DQV A;  4A6Q A;  1G6J A;  4FHJ A;  4NQK E;  2E3T A;  2J42 A;  1CMX B;  3IFW B;  3DVN V;  2LXA A;  3ZXV A;  1V6E A;  4IWO A;  4RGT A;  3T9L A;  3A33 B;  5CHF A;  1CK1 A;  2MP2 B;  4G11 A;  4JPS A;  5AEK B;  4DQO C;  3NRZ A;  3KUZ A;  5JXV A;  2DZK A;  3NVW A;  4M0W B;  2KYW A;  1AWD A;  2NVU I;  4ZRJ A;  2FBW B;  3P4P B;  3TL5 A;  2LAS A;  2M1M A;  3OJ4 B;  4EZJ A;  2KJH B;  3ZLZ A;  1XT9 B;  4IOI E;  1P1A A;  4KKJ A;  3I5J C;  4US8 A;  1HTO A;  1KM7 A;  2RSU A;  1E0Z A;  2O6V B;  2SEB D;  5TR5 A;  4W9J A;  4DDG D;  1L0V B;  4HVB A;  1XO3 A;  1P7E A;  3KYC D;  3ML9 A;  1SGH A;  4PS7 A;  4TQ0 A;  3Q3N C;  2KFK A;  4DXF A;  2LGY A;  3RNF C;  4YSX B;  3PV1 A;  3PSE B;  4IKG A;  4C00 A;  3IT4 B;  1Y8R C;  3TEX A;  4NZL B;  2PE9 A;  3E9S A;  2W82 A;  3OJ3 A;  3L54 A;  4R3D A;  2TSS A;  5L83 A;  2Z0E B;  5DPS A;  1LM8 B;  1T0S C;  5IAA C;  1UNS A;  4C56 C;  3VDZ A;  5D94 A;  1TS5 A;  3H7P A;  1UUP A;  5DPW A;  2MJD A;  3J9C A;  2KDF B;  3UGB B;  4HKQ A;  2LEK A;  3U7Z A;  1NI2 A;  1YX5 B;  1MHH E;  2LUE A;  1VCB A;  2DYO A;  2XNA C;  1TJE A;  2JF5 A;  1MFW A;  2LRW A;  1KRH A;  5BO4 B;  3RI7 C;  1XXG A;  1EU3 A;  3A9K A;  3SEB A;  3KWV A;  2JRH A;  5FR3 A;  4WH4 A;  5FK9 C;  1FNV A;  3KH0 A;  2KWD A;  4H2A A;  2GBK A;  4LDT D;  2NBU A;  4MGY E;  3ZKJ C;  2RD0 A;  3DDC B;  3VTV A;  1KOT A;  3WAM A;  3FC4 A;  1C4A A;  4ACF A;  3M63 B;  3NG0 A;  1WYG A;  2QMT A;  3UF8 A;  2ZW0 A;  5G2N A;  4UDU C;  5HG2 A;  4LNK A;  5LLI A;  1YQ4 B;  2LGD A;  4RH6 A;  2OHF A;  2BYE A;  1UBI A;  2LVO A;  3ZDT A;  2JYE A;  2GLS A;  2LZ6 A;  3DHG C;  4YWG G;  1ZDV A;  2PTL A;  1E6E B;  3EFU A;  1I42 A;  2JZP A;  2HJ1 A;  2LVP A;  2BVC A;  2W3S A;  3UIN B;  1KTK A;  2V3S A;  5D3I B;  4AUQ C;  3RMK C;  2N1V A;  4MH0 E;  1D6E C;  3QAQ A;  3ML8 A;  1ZDX A;  2JZ3 B;  3RNA C;  2AQ2 B;  3C19 A;  3AUL A;  1SBB B;  4RMA A;  3IAM 1;  4OZC A;  1VLB A;  4HKZ E;  1PUT A;  4F1S A;  5GXG B;  5JHA A;  1PGB A;  2AEH A;  2A5U A;  2KJ6 A;  1AN8 A;  5C2T B;  3PTF C;  4BOS C;  1RLF A;  2SAK A;  4FJV B;  1MPE A;  4XGA B;  4ITK A;  2KN4 A;  2JWU A;  2KTF A;  1Q10 A;  1WX8 A;  2VH2 A;  1HZ5 A;  2J0K A;  1WGR A;  4MT5 A;  4OZB A;  3IG3 A;  4KGT A;  2NPT A;  3PZD A;  3AE3 B;  4A20 A;  3AN1 A;  4JGH B;  1J7C A;  1F2R C;  4WWM A;  3UQB A;  3QHT A;  5J18 A;  2L0F A;  1XLN A;  3EFC A;  3VAW A;  3LXF A;  3B9J A;  2BW2 A;  5AZH A;  1IUE A;  3L13 A;  4FN2 A;  4CO7 A;  5EE3 A;  1TKE A;  4K3C A;  5IN7 A;  4BKT A;  1T6B X;  4KIK A;  1BML C;  3RNB C;  3HUI A;  3VR9 B;  3O13 A;  4JWU C;  4W9F A;  2VRR B;  4E74 A;  3QIJ A;  3RD2 A;  2AYO B;  5G5G A;  4PS3 A;  2G1E A;  4OZA A;  2VH1 A;  2V4L A;  1C76 A;  2K22 A;  4BBN F;  2B3A A;  3RNE C;  4MEL A;  1YIW A;  1L0X B;  5LXI B;  2KMC A;  1FIQ A;  3A4R A;  3L0W B;  4I6P A;  2N9P C;  2HTM E;  1N61 A;  4NAW B;  4XWW A;  2QC8 A;  3MC0 B;  5E6J A;  3PS6 A;  4MM3 B;  1V2Y A;  4RF1 A;  1AYF A;  2WS3 B;  1K52 A;  3ZTD A;  1H8C A;  3BIN A;  3DVG Y;  2GBJ A;  1E7V A;  1I4X A;  5DCN A;  3ALB A;  2WU5 B;  1YQB A;  4E71 A;  2E6X A;  3UI3 A;  2I38 A;  4J3O D;  1NEK B;  1E9M A;  4DHJ B;  2MLB A;  1ZOY B;  3I63 C;  3VFK A;  2LJ5 A;  2L7R A;  3VQI A;  1RRB A;  1GB4 A;  4PYZ A;  1L5P A;  1I4Q A;  4PYU A;  3MFG A;  4IC7 B;  4PK1 A;  4TKN A;  3NS8 A;  3NY5 A;  5IKC M;  5DPT A;  3H1U A;  3IAS 1;  4DDI D;  2BF8 B;  3AU4 A;  1ET6 A;  3B0A A;  1YOV B;  1R4M B;  2KDE B;  2G4S A;  2K8B A;  1IBX B;  3NVZ A;  3KYD D;  4MJS A;  1FFV A;  4WJP A;  4GDK A;  4HWI B;  3FIL A;  3VR8 B;  1LFD A;  3IBE A;  4TUU A;  1T3Q A;  2MHJ A;  3P4R B;  4M02 A;  3R8B A;  4ANV A;  4RNA A;  1WE7 A;  3U2S C;  1XCQ L;  5IOI A;  2BB5 A;  2MEK A;  3QWZ B;  1I4P A;  3MC8 A;  2FUH B;  2DZJ A;  1WXV A;  3JVZ X;  3X0W A;  3H8H A;  1NYR A;  4ZOH C;  4FA6 A;  4FXC A;  3AEE B;  1D4B A;  3JSV B;  1DOY A;  4NY0 A;  2WXP A;  2KKC A;  2BT6 A;  1WM3 A;  1SF0 A;  5EE9 A;  5EE0 A;  1VJK A;  4HRS A;  2WP9 B;  2PPH A;  4NJ6 A;  4K7W A;  2DNF A;  3W5V B;  2QEJ C;  1FXT B;  1VZ7 A;  2J53 A;  4A90 A;  4YXD B;  4ARI A;  4OVU A;  2VZK B;  4I6L B;  5BYQ A;  5EE1 A;  2MP2 A;  4IM0 A;  4GDL B;  2BB6 A;  2MBH A;  2EKI A;  3AE2 B;  4FBJ B;  1SIF A;  2CKH B;  4WWN A;  1ZE3 D;  1WXS A;  3BK2 A;  4WJN A;  4K81 A;  4BZA A;  2WXR A;  1IPG A;  3BVM A;  2INN E;  2BS3 B;  1L6U A;  2Z8L A;  4A3P A;  4WQO B;  1OTR B;  2GBR A;  3FAH A;  4IM3 A;  2V3P A;  3W1Y A;  4GOC A;  1A70 A;  2D3A A;  3KUD B;  2DZI A;  2XN9 C;  3SFD B;  2J52 A;  2O6V A;  2N4F A;  2ONQ A;  3AE9 B;  4LLG M;  3L10 B;  5L95 C;  5D3D A;  1JWS D;  4US9 A;  3MHS D;  3A1Q B;  3AE1 B;  4P1C C;  2JPH A;  2JU6 X;  4ZRI A;  3ZUN A;  3R2T A;  1WFY A;  1E8Y A;  2EKE C;  2KMA A;  4K1R B;  3KUC B;  5BYR A;  3AM9 A;  1YN5 A;  1YMH E;  4QAY A;  3WIM A;  1SXT A;  1V9J A;  2KHW B;  1FD6 A;  3CMM B;  3N20 C;  4AS1 A;  2ASQ A;  3OLM D;  2G3Q B;  5IP4 D;  1R4M I;  3TEY A;  1JML A;  1WZ3 A;  2KTR A;  1ZXI A;  2MBE A;  2KJR A;  2XEW A;  2ZVN A;  4ICV A;  2NCN A;  3APD A;  4IG7 B;  2D5G A;  2KNB A;  1LXD A;  1GUA B;  3URY A;  3GB1 A;  4KDL B;  1WJ6 A;  3Q14 C;  1NDD A;  4E3C A;  4N59 A;  3RT3 B;  2JZZ A;  3ZJT A;  1YN4 A;  3L4P A;  2BWE S;  2PIA A;  3VTU A;  3U30 A;  4IWP A;  3IVF A;  3KVF B;  3ZYY X;  3GOE A;  5AUK A;  5H92 C;  4ZHO A;  1FNU A;  2DYB A;  1RYJ A;  5D2M B;  1OEY J;  2LI5 A;  3QX1 A;  4RGN A;  4ANX A;  1SJH D;  4WQM A;  3KWL A;  1E8W A;  4KDI C;  1XD3 B;  2ACZ B;  2GMI C;  3MJW A;  4MEM A;  2BKF A;  2IGD A;  1YN3 A;  1TBE A;  1P3Q U;  1N62 A;  4B9K A;  3UQA A;  2RMM A;  2DBY A;  2JRI B;  2W55 A;  3ZVV A;  2WDT B;  2BQQ A;  1P7F A;  1NEN B;  3I57 A;  2NTS A;  3EGR A;  1SE4 A;  4YTN B;  4NQL B;  2I2Y A;  2DAF A;  4PT5 A;  1WM2 A;  2YVC A;  2MJ3 A;  2QSD A;  3AXC A;  4OVV A;  4IUM B;  4REZ A;  3PRP B;  4YTP B;  2A4Z A;  3C0R B;  1JCK B;  3BY4 B;  1FCC C;  1WE6 A;  1XEE A;  4HCN B;  4C4V B;  1L0Y B;  1WZ0 A;  4MGI E;  3WAL A;  2OOB B;  4AP4 C;  3L16 A;  2RDB C;  3D32 A;  3OAW A;  3WAP A;  4NJC A;  4NPN A;  3AEA B;  3PT2 B;  1XLP A;  3NOB A;  4CQN A;  3B2F A;  3K9O B;  2M17 A;  2Z0D B;  1WMH A;  3W5U B;  1V5T A;  2KN5 A;  2ON8 A;  3PO0 A;  2Y5P A;  2AWT A;  5CHW A;  1V81 A;  2C5L C;  4G0N B;  4FLH A;  3IHP C;  4MGZ E;  1GB1 A;  3L17 A;  2O6V D;  3PZ7 A;  3A9J A;  1MHX A;  3M3J A;  5BMG A;  2O2V B;  1EWY C;  5HFY A;  1UF0 A;  1ZP0 B;  2NS5 A;  3AU5 A;  1WGY A;  3H9D A;  3VRA B;  4JIO U;  3NUH B;  1RWS A;  2J4X A;  2K6D B;  1OFF A;  2KZR A;  4FJY A;  2LMC A;  3QJZ A;  3S2A A;  2HD5 B;  1PGA A;  4W9D A;  1TIF A;  3EUB 2;  1E7P B;  1JQ4 A;  1ZXH A;  3P63 A;  2RGF A;  2KQ7 A;  3GE8 C;  2OJR A;  2WDR B;  4WWP A;  3V60 A;  2INP E;  3NZU A;  1XLQ A;  3Q3O C;  2ICI A;  3KLS X;  4ZDV A;  3QQ8 B;  3R7Q A;  1DOI A;  2CHW A;  2D10 A;  4K7U A;  2MWS B;  2Z59 B;  5KHQ A;  2L83 A;  4GN1 A;  4YL8 A;  3U8Z A;  4D2K A;  3TMP B;  2PKO A;  1WRI A;  1PFD A;  2LRU A;  3N32 A;  2KD0 A;  1F0Z A;  2GBN A;  2NR2 A;  1QLB B;  2KFJ A;  1E7U A;  4GU2 A;  1XLO A;  1YJI A;  1WXA A;  4NAW A;  4WJQ A;  4MM3 A;  1MG4 A;  1OGW A;  1QKZ A;  3KQ4 A;  3WAO A;  2JY6 A;  2R2Q A;  4N9F 4;  3L08 A;  4TMA B;  1KLV A;  1QQR A;  2EMS A;  2D11 A;  4PS8 A;  2IO3 B;  1K8R B;  1QOA A;  1P9D U;  3CST A;  2L8J A;  1ZGU B;  2MBQ A;  1GPX A;  3AB5 A;  2QDF A;  4OVZ A;  4ARC A;  4KZ0 A;  4XDD A;  3Q8E A;  4EZL A;  4XDC A;  1YX6 B;  1EM7 A;  1WYW B;  2C9W B;  1QZE A;  2N9X A;  3N9Y C;  1JWB D;  1VR9 A;  1I4G A;  1TGZ B;  1WXQ A;  3PPA A;  4JQW C;  2WU2 B;  1P98 A;  1UGJ A;  1N60 A;  2XK5 B;  2JVC A;  3LJ3 A;  1J8C A;  4EE2 A;  2KFK B;  2YEP B;  1FXA A;  3BVG A;  3N1Z C;  1IBX A;  3SR6 A;  1SE2 A;  1FO4 A;  1VRA B;  2AQ3 B;  4BVU C;  1DOX A;  2PE6 B;  3BZD B;  1PYW D;  3AE5 B;  3GZN I;  1VDV A;  1BXT A;  3VRB B;  1L7Y A;  1SB3 C;  4HJK A;  3VH3 B;  1F2R I;  3ZO5 B;  2N9E B;  2IND C;  2KX3 A;  1E10 A;  4RGM A;  1DGJ A;  1UH6 A;  2ZNV B;  3B2G A;  2M0X A;  2R2O A;  3JSV A;  3AED B;  2KMM A;  3U52 E;  2L52 A;  4BBN C;  2DZM A;  2EMT A;  1GAQ B;  2H88 B;  2MQJ A;  2DLB A;  3RNG C;  1NI3 A;  3NS1 A;  3Q2A C;  1C4P A;  3W1S A;  4BKG A;  4DK5 A;  3P4S B;  2QHO A;  1D5X C;  2V0G A;  1UBQ A;  3PLU A;  1V49 A;  1D3Z A;  4ZYN A;  5KHO A;  1WGH A;  2IO2 B;  5E6N A;  2IO0 B;  4FHK A;  3VXW A;  3ZNI D;  4RCO A;  4RFB A;  1M94 A;  2BS4 B;  2INC C;  3RUL A;  1WX7 A;  4B0E A;  3V62 A;  4M01 A;  2KAC A;  4DHZ B;  1QIL A;  3TEW A;  2LJI A;  1C3T A;  4GDL A;  1N6Z A;  1OQQ A;  1KFY B;  1L4D B;  5BYS A;  3ZQ4 A;  1KH0 A;  2GBM A;  3Q3F A;  4AJY B;  2GI9 A;  1RM6 C;  4EEW A;  3RPF C;  2PJH A;  2QJL A;  2KLC A;  1I4H A;  5TSS A;  2LFI A;  1ISN A;  4HDO A;  3LDZ E;  4G3X B;  2LGX A;  3ZJV A;  3T8M A;  1WGD A;  1QF6 A;  1T0Y A;  1WGG A;  3DBR B;  3MHZ A;  2OED A;  3AEG B;  2KWV B;  3PRM B;  1FRR A;  4S0R A;  1MJD A;  2RDH A;  4A3O A;  2BYF A;  2CR5 A;  2RR9 A;  1EF1 A;  1ZPS A;  1GC6 A;  1Y56 A;  2BKR B;  3A1Q A;  5H8Y E;  2MH7 A;  1WSP A;  2LGS A;  4P16 A;  4EOY A;  5E6P A;  2FCN A;  3QCA A;  2BWF A;  1IYF A;  1LO5 D;  1UEL A;  1ESF A;  2WXQ A;  3WCQ A;  3P42 A;  1BT0 A;  2MW5 A;  3VUY A;  1XQQ A;  4DXG A;  3ZRC A;  3U4E G;  3CSF A;  3DBL I;  1MVK A;  2KXJ A;  4HXD A;  1J0G A;  1AAR A;  2ZPN A;  2IDY A;  1PQS A;  2L76 A;  2KO3 A;  3N30 A;  2DYM A;  2OJW A;  2W54 A;  4WUR A;  4C7Y A;  2FCQ A;  3VUW A;  4FAD A;  2WXK A;  2KAN A;  2FAZ A;  1QOG A;  4HJG E;  2DHZ A;  1ZW7 A;  4GB9 A;  1F77 A;  2ZEQ A;  2UWQ A;  3PRZ A;  4W9C A;  1FPY A;  3AH7 A;  2DAJ A;  2QIE B;  3DVN U;  1OQR A;  5T8I A;  1V1P B;  4KZC A;  3RYT A;  2KOX A;  3B08 A;  2ZCB A;  1C9F A;  1STE A;  2M8S A;  3V3X A;  1WY8 A;  4MGK E;  4MSM B;  2IYD B;  4LCD E;  4I6N B;  4BOZ B;  2WLB A;  4M0W A;  1TY0 A;  1HZ6 A;  3ONS A;  2WDV B;  2Y3A A;  4IWQ A;  1ET9 A;  1Q5W B;  3HM6 X;  2BYV E;  1N63 A;  2Q5W D;  4HPP A;  4HPM B;  5CHV C;  1WR6 E;  4KGR A;  2G45 B;  2VZK D;  2LWP A;  4MSQ B;  3NZS A;  4GXB A;  4TSS A;  1YQ3 B;  5G55 A;  3AE4 B;  4C4V A;  1K51 A;  5BMH A;  1CZP A;  2WDQ B;  1PDX A;  2K6Q A;  3R7R A;  1EWC A;  3AE6 B;  1KF6 B;  3HHM A;  2L05 A;  1V1O A;  3EEC A;  5FKA C;  2K5P A;  3NJT A;  4LTU A;  2G9H D;  4JWS C;  4EKU A;  2PLP A;  3B1L X;  1T0R C;  4IW0 A;  3ZNZ B;  3FKY A;  2K39 A;  2KVZ A;  1TS4 A;  3DBR I;  1EU4 A;  4F8C B;  4S17 A;  1E8X A;  2LD9 A;  3SDL C;  3I3T B;  4URK A;  4JE3 B;  4KSL C;  4HPL B;  4MH8 A;  4W9K A;  3QAR A;  3TIX A;  1YNT E;  2O2V A;  3Q8C A;  1OEY A;  1SE3 A;  1WJ4 A;  2L32 A;  2IBI B;  2WXO A;  2C7H A;  4RGO S;  2KC2 A;  3HVD A;  3PVL A;  2FID A;  3WA0 A;  1FXI A;  4YTM B;  4EZK A;  3DWM A;  4KSK C;  4KV2 A;  1JRP A;  3A4S C;  2L3Z A;  1NVI D;  5AUI A;  2KDI A;  2L0T A;  1S3S G;  4YSZ B;  4J6I A;  1H4R A;  3DCG A;  3PZ8 A;  4JL9 A;  2GRI A;  3H6N A;  2V9H A;  1D5M C;  2C7N B;  2CHX A;  1Q1O A;  3EA6 A;  2AL6 A;  1WXM A;  3GP7 A;  1OQY A;  3TUO A;  4YSY B;  3V6C B;  3AEC B;  2ZPY A;  2V3N A;  1GOZ A;  1E8Z A;  1L2N A;  1C4C A;  5JHB A;  2WX0 A;  3HM3 A;  4RF0 A;  1WF9 A;  4W9H A;  3TEZ A;  2JWZ A;  3W1S C;  3E56 A;  2BPS A;  2IJ0 A;  5J17 A;  2KX0 A;  1NBF C;  2PMV A;  4XZ4 A;  2K1F A;  3SFE B;  4X57 B;  1VZ8 A;  5IA7 A;  5CTR C;  1ACC A;  2V4I B;  2BS2 B;  3P2B A;  2V1Y A;  2AL3 A;  1J7B A;  2R61 A;  2KQS A;  2DX5 B;  4N58 A;  1J19 A;  1F1H A;  3BYY B;  2PVG C;  2PW9 A;  2FIF A;  1B9R A;  2D2Q A;  3W9C B;  3DOW A;  4LK0 M;  3AE8 B;  3ZJU A;  2RDG A;  2YLM A;  1TT5 B;  2X8X X;  2IY1 B;  5C3J B;  3NVV A;  3RCZ A;  2K0P A;  3KW5 B;  2MBB B;  2CJN A;  4FJZ A;  3N1Y C;  1EUV B;  2JXT A;  1X1M A;  4NAM A;  1FMA D;  1GG3 A;  3GZN B;  3VHT C;  1WJU A;  3LB8 C;  1E90 A;  2WYQ A;  3DVG X;  5HHD G;  4N6E B;  2XK5 A;  1L4Z B;  2IY0 B;  2WGS A;  3Q69 A;  4BKS A;  4LNI A;  3VTW A;  1LGR A;  1AW7 A;  2ZZP B;  3T3N A;  1TS3 A;  3RZF A;  3ZNH B;  3NZ3 A;  3ZW3 A;  1QOB A;  3DHI C;  1TKY A;  1LQB A;  3O65 B;  5GMV A;  4EFO A;  5EDS A;  3Q8F A;  1JRO A;  4JLC A;  3RN9 C;  2WHI A;  3IT6 B;  3PGE A;  1CJE A;  3HVZ A;  3RUI B;  4RM8 A;  3PRE A;  2KTR B;  4HK2 A;  3DBS A;  3TSS A;  3VH4 B;  1YJ1 A;  2W9N A;  1UGM A;  1HQR D;  4LDT B;  3LYY A;  3AEF B;  3OG5 A;  2LHD A;  2LUM A;  1V8C A;  2REX A;  2BTE A;  3ZNG C;  5J2R A;  4ZRQ A;  3CIR B;  1F52 A;  3SHQ A;  4LNF A;  1EF5 A;  1GNU A;  3ENE A;  3V61 A;  2JX5 A;  4Q2J A;  1HXY D;  1V97 A;  2FCS A;  1TYG B;  2KLG A;  5IO9 A;  3BYT B;  4GSW A;  1WIA A;  4DWF A;  1I7H A;  4AQ7 A;  4KVG B;  2WX1 A;  2NBV B;  3W2D A;  2LHE A;  1FFU A;  2LXC A;  1V5O A;  1I35 A;  3DBH I;  4W9E A;  4WIP A;  2M19 A;  3AI5 A;  3H7S A;  4GLS C;  3SD5 A;  4XWT A;  4TV3 A;  1A5R A;  1FNW A;  1FM0 D;  2DEN B;  3K9P B;  4B95 A;  1UWM A;  2N9K A;  1WI0 A;  2I1K A;  4ANW A;  4ANU A;  1VZ6 A;  1V86 A;  1RAX A;  4XYC A;  4OW0 A;  1F9J A;  3Q8B A;  3PHX B;  1GC7 A;  2JUO A;  1UZX B;  3ETR A;  5CX3 A;  3R2I A;  1C79 A;  2PEA A;  1WH3 A;  1NYQ A;  3BVZ A;  5FR6 A;  3VUX A;  2HTH A;  2J0M A;  4KKI A;  1U4A A;  2BBC A;  5D6J B;  2M56 B;  1C1Y B;  5JZE B;  2KAJ A;  3AV8 A;  3DPD A;  3P1M A;  3N3K B;  4L2Y A;  3Q3M C;  3DBL B;  1R4N B;  2IGG A;  1ZKH A;  3APC A;  1PGX A;  1WMH B;  1WRD B;  2EEL A;  3ECI A;  2C7M B;  1BUI C;  1VD2 A;  2CJO A;  3X23 A;  2L1A A;  2WNM A;  2KWC A;  1Q0W B;  4YT0 B;  3QC8 B;  3A9J B;  3AMZ A;  4L1B A;  2K8H A;  1WJN A;  4P1B C;  1ROE A;  3ZGZ A;  3ZRF A;  3QK0 A;  4MAC A;  2Y5B B;  2FCM A;  1TS2 A;  2L00 B;  3EHV A;  2JSV X;  4K3B A;  4GMV A;  1FRD A;  4LJO B;  3JYU A;  3BII D;  2GB1 A;  4BKS D;  2N9L A;  2MCN B;  3H7P B;  5LNK 1;  2IPK D;  2K9X A;  2GOW A;  2WXN A;  1KLG D;  2CHZ A;  2WXM A;  2JYT A;  3Q6B A;  2WXJ A;  4XE0 A;  3I9V 1;  2N7E A;  3U7D A;  3UIP B;  4A8X C;  1TZO A;  3OWE B;  1WGK A;  3A9K B;  1JWU D;  4KGS A;  1SE9 A;  4BFR A;  4HDQ A;  1HEZ E;  4C80 A;  1V1P A;  1WR1 A;  2AQ1 B;  1XCT L;  4HCP B;  2WXF A;  1T5X D;  3MJ5 A;  4TQ1 A;  3MP9 A;  4G50 A;  3RNC C;  1JW9 D;  3PHW B;  3V6E B;  4ZHP A;  2JQR B;  3ABV B;  1J7A A;  2KDB A;  3CF6 E;  3EC8 A;  5LXH A;  4O1N A;  3V05 A;  5AZF A;  1JRU A;  2CS4 A;  1R7S A;  3GS2 A;  3ZIM A;  5DPR A;  4P6V F;  3APF A;  1KLU D;  4CYE A;  2MRP A;  3IXS A;  1B1Z A;  1JAL A;  1XF5 L;  1SEB D;  4M8N A;  1I4R A;  2WWZ A;  4AJW A;  4XX5 A;  1RFA A;  2ZW1 A;  4NJ7 A;  2DWQ A;  3P4Q B;  2J7Q B;  2KVR A;  4CHK A;  4WWO A;  3BWU D;  4P7I A;  4A9A A;  4DXA B;  4B0M A;  4II2 B;  3N1X C;  1K53 A;  1WWT A;  3R66 C;  2Y5C A;  4ZYS A;  2WQY B;  5BMI A;  4FUL A;  3RFZ B;  5AZG A;  3NVY A;  1MI0 A;  1HA5 A;  3ZDM C;  3Q8A A;  3ZTC A;  4DHJ D;  1YD8 U;  5G5H A;  4LNO A;  4ZRP A;  3MTN B;  1KJT A;  1Z5S B;  1YJJ A;  1R4N I;  4AWJ A;  2NPT B;  2D07 B;  3T3O A;  5D7G A;  3TBL D;  5MPO A;  2XBB C;  4RM9 A;  2M0A A;  1CQV A;  3MC9 A;  1HE8 A;  2WXG A;  4WJO A;  2KQ4 X;  2WXI A;  3AEB B;  1SIJ A;  2NMQ A;  4JX1 C;  1FEH A;  1L6V A;  2CU1 A;  2IGH A;  3CWI A;  1IGC A;  3Q3J A;  2JXX A;  2MJE A;  1E5W A;  2YEP F;  5HI1 A;  4XC2 A;  1ZUD 2;  1UD7 A;  1RFK A;  4MDK E;  1V80 A;  2NBW B;  4GIV A;  5JH5 C;  4II3 B;  2N0S B;  1JWM D;  3DWG C;  2K25 A;  2N1W A;  5I4D A;  4OHJ A;  3HIZ A;  4KIK B;  2ZNV C;  3JW0 X;  1C78 A;  1QT9 A;  4BAX A;  2JT4 B;  2N7D A;  1MG8 A;  2BYT A;  1GJZ A;  1S1Q B;  2AX5 A;  3BK1 A;  3HRD D;  2IZV B;  2J0J A;  2HE7 A;  4L23 A;  3GE3 C;  2PVO D;  2NTT A;  2WXL A;  2KK8 A;  5E6O A;  2MBO A;  2UU7 A;  4WAF A;  4W9G A;  1T0Q C;  3SU8 X;  4USA A;  3RZW C;  1TKG A;  2FE8 A;  4NNJ B;  1Z2M A;  2I1J A;  4ASW C;  1N5X A;  3TCA A;  2LGI A;  2N7J A;  4W9I A;  1TY2 A;  2K3U A;  1HTQ A;  2ZCC A;  2H89 B;  3WAN A;  1M4V A;  2C60 A;  4HLE A;  2QIL A;  1QOF A;  1JWA D;  2D3C A;  4DBG A;  2ZVO A;  1TZ1 A;  1IGD A;  1TTN A;  2WXH A;  1SJE D;  4ZRK A;  3UIO B;  2KT7 A;  4IM2 A;  4HRO A;  1IP9 A;  4GGQ A;  4AOF A;  2D3G A;  4ICU A;  4KX6 B;  1K50 A;  4LJP B;  1UWX A;  2KWU B;  4DHZ E;  2MSE D;  2UYZ B;  3QA8 A;  5C1Z A;  4MJS B;  3VVW B;  2FUG 1;  2HJ8 A;  4C7Z A;  4GDK B;  3FIL B;  2K8C A;  3DHH C;  2D3B A;  2IO1 B;  3TJP A;  4A55 A;  1WX9 A;  4K7S A;  2CU3 A;  2KC1 A;  1ENF A;  1EO6 A;  2G4D B;  5HKH A;  2MX2 A;  2HDE A;  4F7Z A; 
#chains in the Genus database with same CATH homology
 3DHG C;  3Q14 C;  3RNG C;  3N20 C;  3RNC C;  2INC C;  3Q2A C;  4P1B C;  3N1X C;  4P1C C;  3I63 C;  2IND C;  3RMK C;  1T0Q C;  3Q3N C;  3N1Y C;  3N1Z C;  3RNF C;  3RI7 C;  1T0R C;  3I5J C;  3DHH C;  1T0S C;  3RNE C;  3RNA C;  3GE8 C;  3GE3 C;  3DHI C;  2RDB C;  3RN9 C;  3Q3O C;  3RNB C;  3Q3M C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...