2RDBC

X-ray crystal structure of toluene/o-xylene monooxygenase hydroxylase i100w mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
b'TFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene, o-xylene monooxygenase oxygenase subunit;alpha
publication title Dioxygen activation at non-heme diiron centers: oxidation of a proximal residue in the I100W variant of toluene/o-xylene monooxygenase hydroxylase.
pubmed doi rcsb
source organism Pseudomonas stutzeri
molecule tags Oxidoreductase
total genus 24
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2007-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 2rdbC00
3N1ZC 3I63C 3Q2AC 4P1CC 3DHHC 3N1XC 3RNCC 3GE8C 3RNEC 3DHGC 3N1YC 3N20C 3RNFC 3RNBC 3RNAC 1T0SC 3GE3C 2INDC 4P1BC 2RDBC 3RN9C 3Q3NC 1T0QC 3RI7C 3Q3OC 1T0RC 3Q14C 3RMKC 3DHIC 3RNGC 3Q3MC 2INCC 3I5JC
chains in the Genus database with same CATH superfamily
3M95A 2L32A 1WJUA 1V8CA 2BS3B 4HXDA 4A3PA 5AZGA 1MG8A 3M3JA 4IG7B 3RZWC 1GB4A 2K1FA 5D7GA 3H9DA 4KV2A 1T3QA 1E8YA 1WYWB 5DPTA 2LUMA 1L5PA 5EE0A 2N0SB 1EF1A 3KWVA 1IYFA 4K3BA 3DBRI 1IGDA 3HUIA 2Z8LA 3ML9A 1UNSA 3X0WA 1KF6B 4NNJB 4BBNF 1KTKA 4R3DA 2MJ3A 4DHJD 1V6EA 1OQQA 1WGDA 2BS2B 3I57A 4M00A 4LDTB 3T9LA 1E8XA 1XCTL 2C60A 2Y5CA 4JQWC 4C7ZA 4RF1A 2ZNVB 3LDZE 3DVGY 2XK5B 3AE8B 1E6EB 3V61A 1HTQA 2V1YA 2IPKD 2XK5A 2FUG1 2LXAA 2PTLA 2TSSA 4JLCA 3W1SA 1VZ6A 2KKCA 4E71A 2RPVA 2BYVE 2WWZA 1ISNA 3N1ZC 4CHKA 4WWMA 4N59A 3RYTA 2BW2A 3X23A 1TKEA 2MCNB 4ANVA 1PGBA 2DWQA 1XF5L 1WXSA 1DGJA 1GNUA 2E6XA 3WA0A 3NHEB 1CJEA 3AH7A 3FKYA 2WXOA 3VTUA 3T8MA 4I6NB 2MWSB 3BYTB 3Q3FA 5HHDG 2KD0A 3H1UA 4HK2A 4Q2JA 3JVZX 2JQRB 3GE8C 3M63B 1WE6A 2KX3A 2D10A 3ZIMA 3NJTA 4HLEA 2M1MA 4W9HA 3WAMA 3C8YA 3VVWB 2DYBA 2KACA 1RRBA 2LRWA 5BMHA 5C2TB 3L16A 4RGOS 4W9LA 2GBKA 3RZFA 1IBXB 4HCNB 2FIFA 1JWUD 1IBXA 5G5HA 4GXBA 5CX3A 3ZKJC 1Y8RC 4MGKE 2D3CA 3NRZA 1JRUA 2BBCA 2SAKA 2W9NA 2PLPA 5E6PA 1WGYA 3FAHA 4RM8A 2NS5A 3RUIB 1FO4A 1C4CA 3N3KB 3RD2A 1IUEA 2MSED 2N7EA 1GG3A 2SEBD 1UWXA 2INPE 4IWQA 4TQ1A 1GJZA 4NJCA 4YSZB 2HE7A 2LVOA 4XWTA 2IDYA 2QEJC 4S0RA 3EUB2 4MEMA 3UI3A 3ZUNA 5H8YE 4IOIE 2EMSA 3ENEA 4O1NA 1KOTA 2CKHB 2KTFA 1FCCC 3U2SC 3VRBB 1MFWA 4PYUA 3MP9A 4DQOC 2RPQA 3CF6E 4OZAA 5BYQA 3UQBA 1WIAA 3B1LX 1N60A 2KC2A 5MPOA 4RM9A 2V3SA 1YN3A 3EECA 2LVPA 4GDLB 3KWLA 1MHHE 4ZYNA 4GDLA 2K8HA 1HA5A 2PVOD 1LM8B 3DVNV 2JX5A 3WCQA 3P1MA 3ZVVA 3ZRFA 4KVGB 2D3AA 3DPDA 1DOYA 2OEDA 3U30A 3SD5A 1OEYJ 3AE4B 2MP2B 2GRIA 2BYEA 3PLUA 4DDGD 2BVCA 3QHTA 2MP2A 1RFKA 2DYOA 2DZKA 1T6BX 4BVUC 4WWNA 3U7ZA 2XEWA 4GSWA 1ROEA 3TCAA 2KXJA 2L52A 2ICIA 1QZEA 2H88B 4NAWB 2K6DB 3WAPA 4ZHOA 3BVMA 1EUVB 3QARA 4NAWA 1D6EC 4KZ0A 3VTWA 1VJKA 2LXCA 1XLOA 1JQ4A 3PO0A 1EWCA 4ANUA 4K3CA 1FD6A 4TMAB 4MT5A 4HDQA 4WIPA 4YL8A 3QX1A 1SEBD 1VD2A 3AECB 2MBEA 2BB5A 4BZAA 2KMCA 3RULA 2NBUA 2BYTA 3NS8A 1PDXA 1ENFA 3DCGA 3NVYA 2GOWA 1HZ6A 2Z0EB 3AMZA 1V5TA 2W82A 2GBJA 1K52A 2Y3AA 2AWTA 1E5WA 1YQ3B 3AE6B 1L6UA 1Z5SB 4RH6A 1J7BA 4EE2A 3KUDB 2L0TA 3TL5A 1WZ0A 1SF0A 2PPHA 1D5XC 2RR9A 3JW0X 3J9CA 1IP9A 1TS3A 1NI3A 2JWZA 5AZFA 2C7HA 5AZHA 4H2AA 2LI5A 2M17A 3V62A 2KDMA 3FILB 4CQNA 1YOVB 1VR9A 1PGAA 3FILA 2FE8A 4CYEA 1SGHA 4BKGA 4AUQC 2GI9A 3N30A 1FXTB 4B9KA 3QCAA 4S17A 3NVWA 4LDTD 3BK2A 2J52A 5DPWA 1WX8A 2FBWB 1WX9A 3ZQ4A 2LGDA 2JWUA 3QJZA 1PQSA 4WH4A 1XXGA 3OJ4B 4G3XB 4P1BC 3BVGA 3Q8EA 3VR8B 2CJOA 2RDGA 2VZKB 1NDDA 1UWMA 2CS4A 1VDVA 3Q2AC 3EFUA 1WH3A 4KX6B 3NZ3A 2ZEQA 4HCPB 3RNEC 3W5UB 3TSSA 4DXGA 1I4QA 1NBFC 3ABVB 3Q8CA 2I2YA 2WXKA 5IOIA 2OJRA 3TJPA 4M02A 1XO3A 1OQRA 3RMKC 3BZDB 5JZEB 3IFWB 4OVZA 2XNAC 1GOZA 1SJHD 1YX6B 1P9DU 3GZNI 4BKTA 2NR2A 4MELA 1R4MI 4HPMB 2C9WB 5I4DA 2KYWA 4WAAA 4XE0A 3ZTDA 4B6WA 3R3MA 4LLGM 3EFCA 4MGIE 2IY0B 3ZO5B 3SFDB 1ET9A 2MLBA 1Q5WB 3ZYYX 1FRDA 2Z0DB 1WXVA 2EELA 2FCQA 2BTEA 1CQVA 3TEWA 4A55A 4HROA 4FJZA 2MA9B 2HTHA 3MJWA 1R7SA 2I1KA 2GBRA 4MJSB 3RNBC 1NYQA 4HRSA 2KWUB 4MJSA 3P4SB 2NVUI 3Q3NC 4C4VB 1WXQA 3HM6X 2DZIA 4C4VA 4LNNA 3IXSA 3KLSX 3ETRA 1WR1A 1MPEA 4WQOB 4GU2A 3N32A 2K3UA 2NCNA 2RDHA 2WHIA 2D3BA 5L83A 2LGSA 2NPTB 2OOBB 4W9GA 2O6VB 2PIAA 2YLMA 4JWUC 5CHWA 2NPTA 4XZ4A 1N5WA 3DBSA 2QHOA 2O6VA 4GB9A 4RGTA 3DHHC 3VAWA 4WWPA 2N1WA 3GZNB 4E3CA 1D3ZA 2J53A 1R4MB 3AEGB 3VH4B 3B0AA 3Q8BA 5D6JB 2WX0A 1TKGA 1RWSA 2WNMA 2LGXA 3I9V1 1L7YA 2N9PC 2Q5WD 1WE7A 2N4FA 3PGEA 2B3AA 2ZZPB 2IGHA 3NVZA 2QJLA 4GDKB 4P16A 1F2RI 2ZW0A 4MGYE 1M94A 3B08A 4GDKA 3O65B 1D4BA 2LHEA 2KOXA 2ZCBA 1XLPA 4YTPB 1Z2MA 4HDOA 2A5UA 3CSFA 2KQSA 5AEKB 1TY0A 4HJGE 1J8CA 4ZYSA 4BAXA 1AW7A 1FFUA 1VZ7A 2W3RA 3ONSA 3L54A 4XYCA 1N5XA 5AUKA 1ZE3D 1WXMA 4KGSA 2JY6A 3K9OB 4II3B 4RCOA 2EKEC 3N1YC 2RSUA 3RNFC 3V3XA 4HPLB 3Q69A 3KYCD 3ZTCA 1GB1A 5HI1A 1JCKB 2X38A 3LXFA 1E10A 4J6IA 4A8XC 1XD3B 3CWIA 2ZJDA 1ZW7A 1T0YA 4KZCA 2KWCA 1FFVA 4JX1C 3HM3A 1L0XB 3P2BA 4XGAB 5BMGA 1TT5B 1N62A 1Y56A 2J0JA 2BWES 2PW9A 3PHWB 1SJED 2BKFA 2HTME 1SE9A 2CJNA 1V80A 1UD7A 1N63A 1TGZB 4JGHB 2VH1A 3U8ZA 4I6PA 2CU1A 3KUZA 3UINB 3TMPB 1WF9A 4M0WB 1GPXA 4XC2A 2HDEA 4PS8A 4IDIA 3T3NA 1I35A 1FXAA 2DBYA 2KLCA 4M0WA 1IGCA 2M0AA 4F7ZA 2Z59B 2BS4B 3VHTC 3BY4B 4IM0A 3DBLI 3QK0A 1HTOA 3DHIC 1V49A 4C56C 3B2FA 3HHMA 2WXGA 1C78A 4IWOA 5DCNA 4JWSC 2LWPA 1YN4A 2IBIB 3DQVA 2FCMA 3A4SC 3CIRB 2KAJA 3O13A 3GP7A 2JZZA 3D32A 3NVVA 2CR5A 2D5GA 1P7EA 5J2RA 1QOGA 4LJOB 1TS5A 1WYGA 3DWGC 1B9RA 3RN9C 5LNK1 4WAFA 4DK5A 1QOAA 1UF0A 3PT2B 5FR6A 2OJWA 1WM2A 1WGGA 4WJNA 2WXRA 2VZKD 3IT6B 4FLHA 4NZLB 3RFZB 3EC8A 3IT4B 1I4HA 3EGRA 3AULA 1PUTA 4K81A 1N6ZA 4FBJB 3U7DA 3P4RB 3A33B 4HKQA 1I42A 4KSKC 1RFAA 1SE3A 1KLVA 1CMXB 3AV8A 1F52A 2LGYA 2REXA 3NS1A 4ASWC 2MRPA 2K22A 2MQJA 2GB1A 1HXYD 4GMVA 4UDUC 1DOIA 1K50A 2RMMA 2ACZB 2PVGC 2WXMA 2C7NB 4URKA 4KIKB 1C79A 2OHFA 3H6NA 2MH7A 2KWDA 4KIKA 2G1EA 1F1HA 4ANXA 2V4IB 4M8MA 4A9AA 2JPHA 2KDBA 2AEHA 4HWIB 2M8SA 2JF5A 2LHDA 3V6EB 3BYYB 3DBLB 1QKZA 1HE8A 1V5OA 3N9YC 1QF6A 2LGIA 3Q8FA 3RNAC 1L4DB 2WDVB 4TV3A 2N7DA 3AU5A 2JVCA 4MH8A 4FN2A 4F1SA 3ZNZB 4HJKA 2JXXA 2WX1A 4ANWA 3PRMB 1YJ1A 2VRRB 4ZRJA 3TEZA 2LVQA 1IPGA 1OQYA 1STEA 2L83A 1I4RA 3HVZA 3BVZA 4OVUA 4HPPA 4WURA 2LMCA 3Q3OC 4WWOA 3SR6A 3Q8AA 1SE4A 2R2OA 4W9JA 4HKZE 2O6VD 1WGHA 2KWVB 5IO9A 2M0XA 1TZ1A 5TSSA 5HKHA 1SIJA 4EEWA 1FNWA 3R2TA 4XDDA 2WXNA 5LXHA 2JRHA 2UYZB 1K53A 3WANA 3DBHI 3MC9A 1PGXA 3R8BA 4NQKE 2Y5BB 2L8JA 5BYRA 2YEPF 4AOFA 1JROA 2KFKB 3HRDD 4FJYA 4US9A 2KFKA 3ML8A 2KMAA 2IGGA 2L1AA 3NUHB 5D3DA 1I4GA 1NVID 1KM7A 3SDLC 3KVFB 4ZRIA 2LEKA 4EKUA 2ZVOA 3HVDA 2KT7A 4ZRKA 1ZP0B 4K7UA 3KUCB 4L23A 3IHPC 4BKSA 3ZDTA 4QAYA 3L4PA 1TIFA 3VXWA 3DHGC 1KFYB 2WXLA 1T5XD 1FIQA 4W9EA 5C3JB 3RCZA 2PE6B 1TKYA 2W54A 4KSLC 1QILA 2WXHA 4US8A 5LLIA 2EMTA 1QT9A 3AEFB 4EZKA 2BQQA 2J0MA 2QIEB 2DNFA 3H7SA 5J17A 1S3SG 3AE5B 4RFBA 3PHXB 3AXCA 2L00B 2KJHB 1E9MA 3U52E 4C7YA 5EDSA 4YSYB 1ET6A 2KDIA 1L0VB 5T8IA 2NTTA 2KLGA 4LNIA 2QSDA 4HVBA 5G5GA 2MBOA 2L7RA 1ESFA 3DBHB 1V1PB 1C9FA 1XQQA 2G3QB 1FRRA 4G0NB 3C0RB 1V1PA 1V2YA 2PJHA 1GAQB 2WDTB 3AE2B 4FADA 2K0PA 1TYGB 3L17A 2IGDA 1ACCA 1DYQA 1SIFA 1WY8A 5BYSA 1UBIA 4IUMB 2BWFA 1T0RC 2KVRA 3Q3MC 2K8CA 5EE3A 4FA6A 4MM3B 1F9JA 1EM7A 3PRPB 3I63C 4MM3A 1UH6A 3AE9B 1XLNA 5JXVA 1ZKHA 2K9XA 2MHJA 2LUEA 2QMTA 4WJQA 2K25A 2V9HA 3BIID 4BBNC 1JMLA 3IAS1 4F8CB 4WJPA 1EF5A 3AI5A 2DENB 1TBEA 2KK8A 1QOBA 4NQLB 1FEHA 4N9F4 3UGBB 4LK0M 2ZW1A 2IYDB 2WDRB 4CO7A 4PS7A 4FXCA 3I5JC 1XCQL 1YD8U 2MX2A 5C1ZA 2KX0A 2FIDA 2KANA 3N20C 2KJ6A 4FHJA 1BMLC 2L3ZA 4NAMA 1MHXA 2WDQB 3VUXA 3DVGX 4EZJA 1P3QU 2KDEB 1BUIC 1FNVA 1PYWD 4MDKE 1YMHE 1V9JA 3IBEA 3PSEB 4W9KA 4LNOA 2WXPA 2AYOB 2W55A 1QOFA 3AEEB 3R7QA 1L2NA 3KQ4A 2JYEA 1C77A 2KJRA 5FR3A 4C00A 2KDFB 2KO3A 2H89B 4BOZB 2K8BA 1E7VA 1J19A 1ZDVA 3WIMA 4P7IA 2XN9C 5D2MB 1DOXA 1FCLA 1XLQA 1N61A 1WGRA 1JWSD 3I3TB 1NENB 3BWUD 1P98A 2BPSA 4K1RB 2KQ4X 4B0EA 2V4LA 4USAA 4B0MA 2K39A 2HJ8A 4N6EB 2LZ6A 5E6NA 5CHFA 1QLBB 1ZPSA 4E74A 3AU4A 3EHVA 2N7JA 5D3IB 2AL6A 2VH2A 1SE2A 5IKCM 4LTUA 1WZ3A 1GUAB 1K51A 4PT5A 5JHAA 2N9XA 1WJNA 1WRDB 3IG3A 4ICVA 1AWDA 4LCDE 2WXJA 1ZUD2 4A6QA 4DBGA 2M19A 4WJOA 2MW5A 5E6OA 3ZXRA 2GLSA 4GIVA 4L1BA 4W9CA 3E56A 4NJ7A 1ZOYB 3QIJA 4MH0E 3E9SA 1BT0A 1XT9B 4FULA 2J4XA 3ZNGC 4EFOA 3NZUA 2IO1B 2LFIA 2B76B 2X8XX 4A3OA 2G9HD 3OWEB 4NJ6A 5GMVA 3L0WB 1UGJA 1I4PA 4MSQB 1YNTE 3SFEB 1YQBA 4P1CC 3VFKA 5BO4B 4IM3A 4TSSA 1AYFA 3NOBA 3V05A 1GC6A 3QAQA 3QC8B 2G4SA 1T0SC 2C7MB 2INDC 2ON8A 5L95C 2XBBC 3PTFC 3DDCB 2RGFA 2YEPB 3UIPB 2JSVX 1R4NI 2ZPYA 2K6QA 4K7SA 2AX5A 3PZ8A 4YWGG 1NEKB 2L0FA 4BKSD 1CZPA 4OW0A 4MSMB 2IZVB 1LGRA 2LRUA 3A9KB 2Y5PA 4DHZB 3A9KA 3LJ3A 1YQ4B 4ZRPA 3VR9B 1NYRA 5FK9C 2NBVB 5JHBA 2JZPA 2BF8B 2PMVA 5IA7A 1JWBD 1TS4A 1C3TA 2KN5A 3AEBB 5AUIA 2DAJA 1LQBA 2BKRB 2NTSA 3VUWA 2K5PA 1Q0WB 4ARIA 1UELA 3HK0A 1P0RA 4W9IA 3AB5A 4RMAA 2WLBA 1SBBB 1WJ6A 4II2B 3KW5B 3GS2A 2AQ3B 4P6VF 4RGNA 3Q6BA 1KLUD 1RLFA 1OTRB 1LXDA 2MBBB 3Q3JA 2KHWB 1H4RA 1L6VA 4KDIC 1J7AA 3VRAB 5JH5C 2JRIB 1F2RC 2D11A 3IAM1 5H92C 3RNGC 4XX5A 1WI0A 2GBMA 4PK1A 4XWWA 1A70A 1I7HA 2RD0A 3HIZA 1R4NB 2WXIA 2ZNVC 1V1OA 2L76A 5G2NA 3H8HA 1ZGUB 2L05A 1UGMA 1WRIA 3W1SC 1J0GA 1WGKA 1D5MC 3P4QB 2ASQA 1T0QC 1E0ZA 3MTNB 4AP4C 5IN7A 4JL9A 1UBQA 3VTVA 4J3OD 1CK1A 3U4EG 2R61A 2ZVNA 3ZXVA 3OAWA 2D07B 3GB1A 2LJ5A 1SSNA 3L08A 1JALA 3H7PB 4G11A 1ZXHA 3H7PA 4W9FA 1L4ZB 3A1QB 2KC1A 2AL3A 1YJIA 3A1QA 3DBRB 1WMHB 1TTNA 3QQ8B 2JXTA 1WWTA 2G45B 1WMHA 3PS6A 4OVVA 4FJVB 4EUTA 4ACFA 2DLBA 4TUUA 1LFDA 3TBLD 1BXTA 2CHZA 5C23A 4JIOU 2N9KA 4D2KA 1XEEA 2BGFA 1LO5D 2JUOA 5LXIB 4GN1A 4G50A 3MC0B 2KNBA 4OZCA 3AEDB 3APCA 3AE7B 4OHJA 2DZJA 1EU3A 4YSXB 2WYQA 5GXGB 2I1JA 2INNE 3SEBA 2KZRA 4WQMA 2BYFA 3OLMD 4A90A 1I4XA 1WFYA 3PRZA 5KHOA 3TIXA 2N9EB 2FCNA 1NI2A 4AJYB 3VDZA 4YTNB 3AM9A 1SXTA 4YXDB 4C80A 1P1AA 5HFYA 1A5RA 4AWJA 2IO2B 1B1ZA 3M62B 2KFJA 2BB6A 2JYTA 2W3SA 1VRAB 4A20A 1FMAD 4AQ7A 3GOEA 3AN1A 4RNAA 2WXQA 1M4VA 4ZRQA 2FUHB 4XDCA 1JW9D 2KMMA 2WGSA 4GGQA 1FNUA 1TY2A 2WU5B 4JPSA 1G6JA 4IWPA 2M56B 3OJ3A 5HG2A 1QQRA 4BOSC 4N58A 3ZJTA 4KDLB 3NZSA 2NMQA 4FHKA 5EE1A 3P4PB 2QC8A 1KH0A 3MJ5A 1V97A 1V81A 3TEXA 3ZJVA 1E8WA 4M01A 2KTRB 1X1MA 3PLVA 2JU6X 2MBHA 1FXIA 5D94A 2KTRA 1FM0D 3W2DA 1C76A 3PREA 3ZDMC 3VUYA 1YX5B 2IY1B 3EA6A 2FAZA 3JSVB 2CHWA 2INCC 3JSVA 1RYJA 5CHVC 4KKIA 1OFFA 1E90A 3QWZB 4ITKA 1RAXA 1GC7A 3K9PB 1S1QB 1EO6A 1WX7A 4GOCA 4PS3A 2UU7A 3ALBA 2QCZA 4ZDVA 2IO0B 5CTRC 3BK1A 2QDFA 4HEA1 1F77A 1Q10A 4MGZE 3P63A 2DHZA 4GLSC 1J7CA 3GE3C 1L0YB 1MI0A 1YIWA 2RDBC 3V6CB 3OG5A 3BINA 4DHJB 2D2QA 1WR6E 3Q14C 3PVLA 2PKOA 1MVKA 5TR5A 3LYYA 4RF0A 3UIOB 1UUPA 1H8CA 1V86A 3WALA 4BFRA 2WXFA 3ZLZA 2MJDA 5KHQA 1VCBA 2WP9B 5DPSA 3URYA 1E8ZA 1FPYA 4I6LB 3SHQA 3P42A 3PZ7A 4NY0A 3JYUA 4MACA 3QA8A 4X57B 2ZCCA 1HQRD 1AARA 3S2AA 3N1XC 4W9DA 2J42A 1VLBA 3APDA 2MEKA 3W5VB 1HEZE 2MBQA 2LASA 3MHSD 4NPNA 2NBWB 4AS1A 2FCSA 2V3PA 2PEAA 3W1YA 4ICUA 3CSTA 3SU8X 3KH0A 2R2QA 3C19A 3W9CB 1YN5A 4LNFA 3R7RA 4DHZE 4TQ0A 3ECIA 3A9JB 1KJTA 4LJPB 2KN4A 1C4PA 3A9JA 3NY5A 1WM3A 2AQ1B 2CHXA 3AE3B 2GBNA 2CU3A 5G55A 3MFGA 1ZDXA 3KYDD 2DZMA 3B9JA 3PPAA 2BT6A 1KLGD 1HZ5A 3NG0A 1PFDA 3ZJUA 1Q1OA 5EE9A 2MJEA 2C5LC 2E3TA 4JE3B 2ZPNA 5E6JA 1VZ8A 2J7QB 4IKGA 3APFA 5BMIA 1TS2A 3TUOA 2G4DB 3VQIA 4DDID 1TZOA 4IW0A 1ZXIA 4AJWA 2IO3B 2DAFA 2WQYB 2JT4B 3PV1A 3RNCC 2V3NA 1WXAA 1AN8A 2O2VB 4ARCA 1E7UA 4OZBA 2O2VA 1P7FA 4YT0B 1JWAD 2EKIA 3FC4A 3V60A 2IJ0A 4EOYA 4DWFA 2LD9A 2QILA 1WJ4A 3LB8C 4LNKA 3DVNU 4L2YA 4IC7B 3R66C 4KKJA 2D3GA 4DXAB 2HD5B 3L13A 2DX5B 4M8NA 4PYZA 4ZHPA 1EU4A 3MC8A 3PZDA 3UQAA 1TJEA 2JZ3B 2GMIC 4DXFA 2J0KA 1C1YB 3ZNHB 2UWQA 1OGWA 1MG4A 2DYMA 1RM6C 1SB3C 4K7WA 1D5ZC 5IAAC 3UF8A 4YTMB 2LJIA 1JWMD 3CMMB 4REZA 3AE1B 2M4NA 1OEYA 4ZOHC 2WU2B 5IP4D 2HJ1A 3L10B 4KGTA 1EWYC 5FKAC 3WAOA 2AQ2B 3RI7C 3R2IA 3VH3B 3RPFC 2I38A 4EZLA 3TEYA 2KQ7A 2ONQA 1WSPA 4RGMA 3ZGZA 2YVCA 4B95A 3ZRCA 4IM2A 1E7PB 3B2GA 2N9LA 3DOWA 3A4RA 1K8RB 1UZXB 5DPRA 3RT3B 3ZNID 3IVFA 1MJDA 1YJJA 3DWMA 1C4AA 2N1VA 3MHZA 4KGRA 1KRHA 2V0GA 2A4ZA 2WS3B 3ZW3A 3T3OA 3AEAB 2PE9A 5J18A 2KVZA 1JRPA 1F0ZA 2FNJB 4TKNA 1U4AA
chains in the Genus database with same CATH topology
3N1ZC 3I63C 3Q2AC 4P1CC 3DHHC 3N1XC 3RNCC 3GE8C 3RNEC 3DHGC 3N1YC 3N20C 3RNFC 3RNBC 3RNAC 1T0SC 3GE3C 2INDC 4P1BC 2RDBC 3RN9C 3Q3NC 1T0QC 3RI7C 3Q3OC 1T0RC 3Q14C 3RMKC 3DHIC 3RNGC 3Q3MC 2INCC 3I5JC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N1Z C;  3I63 C;  3Q2A C;  4P1C C;  3DHH C;  3N1X C;  3RNC C;  3GE8 C;  3RNE C;  3DHG C;  3N1Y C;  3N20 C;  3RNF C;  3RNB C;  3RNA C;  1T0S C;  3GE3 C;  2IND C;  4P1B C;  2RDB C;  3RN9 C;  3Q3N C;  1T0Q C;  3RI7 C;  3Q3O C;  1T0R C;  3Q14 C;  3RMK C;  3DHI C;  3RNG C;  3Q3M C;  2INC C;  3I5J C; 
#chains in the Genus database with same CATH topology
 3M95 A;  2L32 A;  1WJU A;  1V8C A;  2BS3 B;  4HXD A;  4A3P A;  5AZG A;  1MG8 A;  3M3J A;  4IG7 B;  3RZW C;  1GB4 A;  2K1F A;  5D7G A;  3H9D A;  4KV2 A;  1T3Q A;  1E8Y A;  1WYW B;  5DPT A;  2LUM A;  1L5P A;  5EE0 A;  2N0S B;  1EF1 A;  3KWV A;  1IYF A;  4K3B A;  3DBR I;  1IGD A;  3HUI A;  2Z8L A;  3ML9 A;  1UNS A;  3X0W A;  1KF6 B;  4NNJ B;  4BBN F;  1KTK A;  4R3D A;  2MJ3 A;  4DHJ D;  1V6E A;  1OQQ A;  1WGD A;  2BS2 B;  3I57 A;  4M00 A;  4LDT B;  3T9L A;  1E8X A;  1XCT L;  2C60 A;  2Y5C A;  4JQW C;  4C7Z A;  4RF1 A;  2ZNV B;  3LDZ E;  3DVG Y;  2XK5 B;  3AE8 B;  1E6E B;  3V61 A;  1HTQ A;  2V1Y A;  2IPK D;  2XK5 A;  2FUG 1;  2LXA A;  2PTL A;  2TSS A;  4JLC A;  3W1S A;  1VZ6 A;  2KKC A;  4E71 A;  2RPV A;  2BYV E;  2WWZ A;  1ISN A;  3N1Z C;  4CHK A;  4WWM A;  4N59 A;  3RYT A;  2BW2 A;  3X23 A;  1TKE A;  2MCN B;  4ANV A;  1PGB A;  2DWQ A;  1XF5 L;  1WXS A;  1DGJ A;  1GNU A;  2E6X A;  3WA0 A;  3NHE B;  1CJE A;  3AH7 A;  3FKY A;  2WXO A;  3VTU A;  3T8M A;  4I6N B;  2MWS B;  3BYT B;  3Q3F A;  5HHD G;  2KD0 A;  3H1U A;  4HK2 A;  4Q2J A;  3JVZ X;  2JQR B;  3GE8 C;  3M63 B;  1WE6 A;  2KX3 A;  2D10 A;  3ZIM A;  3NJT A;  4HLE A;  2M1M A;  4W9H A;  3WAM A;  3C8Y A;  3VVW B;  2DYB A;  2KAC A;  1RRB A;  2LRW A;  5BMH A;  5C2T B;  3L16 A;  4RGO S;  4W9L A;  2GBK A;  3RZF A;  1IBX B;  4HCN B;  2FIF A;  1JWU D;  1IBX A;  5G5H A;  4GXB A;  5CX3 A;  3ZKJ C;  1Y8R C;  4MGK E;  2D3C A;  3NRZ A;  1JRU A;  2BBC A;  2SAK A;  2W9N A;  2PLP A;  5E6P A;  1WGY A;  3FAH A;  4RM8 A;  2NS5 A;  3RUI B;  1FO4 A;  1C4C A;  3N3K B;  3RD2 A;  1IUE A;  2MSE D;  2N7E A;  1GG3 A;  2SEB D;  1UWX A;  2INP E;  4IWQ A;  4TQ1 A;  1GJZ A;  4NJC A;  4YSZ B;  2HE7 A;  2LVO A;  4XWT A;  2IDY A;  2QEJ C;  4S0R A;  3EUB 2;  4MEM A;  3UI3 A;  3ZUN A;  5H8Y E;  4IOI E;  2EMS A;  3ENE A;  4O1N A;  1KOT A;  2CKH B;  2KTF A;  1FCC C;  3U2S C;  3VRB B;  1MFW A;  4PYU A;  3MP9 A;  4DQO C;  2RPQ A;  3CF6 E;  4OZA A;  5BYQ A;  3UQB A;  1WIA A;  3B1L X;  1N60 A;  2KC2 A;  5MPO A;  4RM9 A;  2V3S A;  1YN3 A;  3EEC A;  2LVP A;  4GDL B;  3KWL A;  1MHH E;  4ZYN A;  4GDL A;  2K8H A;  1HA5 A;  2PVO D;  1LM8 B;  3DVN V;  2JX5 A;  3WCQ A;  3P1M A;  3ZVV A;  3ZRF A;  4KVG B;  2D3A A;  3DPD A;  1DOY A;  2OED A;  3U30 A;  3SD5 A;  1OEY J;  3AE4 B;  2MP2 B;  2GRI A;  2BYE A;  3PLU A;  4DDG D;  2BVC A;  3QHT A;  2MP2 A;  1RFK A;  2DYO A;  2DZK A;  1T6B X;  4BVU C;  4WWN A;  3U7Z A;  2XEW A;  4GSW A;  1ROE A;  3TCA A;  2KXJ A;  2L52 A;  2ICI A;  1QZE A;  2H88 B;  4NAW B;  2K6D B;  3WAP A;  4ZHO A;  3BVM A;  1EUV B;  3QAR A;  4NAW A;  1D6E C;  4KZ0 A;  3VTW A;  1VJK A;  2LXC A;  1XLO A;  1JQ4 A;  3PO0 A;  1EWC A;  4ANU A;  4K3C A;  1FD6 A;  4TMA B;  4MT5 A;  4HDQ A;  4WIP A;  4YL8 A;  3QX1 A;  1SEB D;  1VD2 A;  3AEC B;  2MBE A;  2BB5 A;  4BZA A;  2KMC A;  3RUL A;  2NBU A;  2BYT A;  3NS8 A;  1PDX A;  1ENF A;  3DCG A;  3NVY A;  2GOW A;  1HZ6 A;  2Z0E B;  3AMZ A;  1V5T A;  2W82 A;  2GBJ A;  1K52 A;  2Y3A A;  2AWT A;  1E5W A;  1YQ3 B;  3AE6 B;  1L6U A;  1Z5S B;  4RH6 A;  1J7B A;  4EE2 A;  3KUD B;  2L0T A;  3TL5 A;  1WZ0 A;  1SF0 A;  2PPH A;  1D5X C;  2RR9 A;  3JW0 X;  3J9C A;  1IP9 A;  1TS3 A;  1NI3 A;  2JWZ A;  5AZF A;  2C7H A;  5AZH A;  4H2A A;  2LI5 A;  2M17 A;  3V62 A;  2KDM A;  3FIL B;  4CQN A;  1YOV B;  1VR9 A;  1PGA A;  3FIL A;  2FE8 A;  4CYE A;  1SGH A;  4BKG A;  4AUQ C;  2GI9 A;  3N30 A;  1FXT B;  4B9K A;  3QCA A;  4S17 A;  3NVW A;  4LDT D;  3BK2 A;  2J52 A;  5DPW A;  1WX8 A;  2FBW B;  1WX9 A;  3ZQ4 A;  2LGD A;  2JWU A;  3QJZ A;  1PQS A;  4WH4 A;  1XXG A;  3OJ4 B;  4G3X B;  4P1B C;  3BVG A;  3Q8E A;  3VR8 B;  2CJO A;  2RDG A;  2VZK B;  1NDD A;  1UWM A;  2CS4 A;  1VDV A;  3Q2A C;  3EFU A;  1WH3 A;  4KX6 B;  3NZ3 A;  2ZEQ A;  4HCP B;  3RNE C;  3W5U B;  3TSS A;  4DXG A;  1I4Q A;  1NBF C;  3ABV B;  3Q8C A;  2I2Y A;  2WXK A;  5IOI A;  2OJR A;  3TJP A;  4M02 A;  1XO3 A;  1OQR A;  3RMK C;  3BZD B;  5JZE B;  3IFW B;  4OVZ A;  2XNA C;  1GOZ A;  1SJH D;  1YX6 B;  1P9D U;  3GZN I;  4BKT A;  2NR2 A;  4MEL A;  1R4M I;  4HPM B;  2C9W B;  5I4D A;  2KYW A;  4WAA A;  4XE0 A;  3ZTD A;  4B6W A;  3R3M A;  4LLG M;  3EFC A;  4MGI E;  2IY0 B;  3ZO5 B;  3SFD B;  1ET9 A;  2MLB A;  1Q5W B;  3ZYY X;  1FRD A;  2Z0D B;  1WXV A;  2EEL A;  2FCQ A;  2BTE A;  1CQV A;  3TEW A;  4A55 A;  4HRO A;  4FJZ A;  2MA9 B;  2HTH A;  3MJW A;  1R7S A;  2I1K A;  2GBR A;  4MJS B;  3RNB C;  1NYQ A;  4HRS A;  2KWU B;  4MJS A;  3P4S B;  2NVU I;  3Q3N C;  4C4V B;  1WXQ A;  3HM6 X;  2DZI A;  4C4V A;  4LNN A;  3IXS A;  3KLS X;  3ETR A;  1WR1 A;  1MPE A;  4WQO B;  4GU2 A;  3N32 A;  2K3U A;  2NCN A;  2RDH A;  2WHI A;  2D3B A;  5L83 A;  2LGS A;  2NPT B;  2OOB B;  4W9G A;  2O6V B;  2PIA A;  2YLM A;  4JWU C;  5CHW A;  2NPT A;  4XZ4 A;  1N5W A;  3DBS A;  2QHO A;  2O6V A;  4GB9 A;  4RGT A;  3DHH C;  3VAW A;  4WWP A;  2N1W A;  3GZN B;  4E3C A;  1D3Z A;  2J53 A;  1R4M B;  3AEG B;  3VH4 B;  3B0A A;  3Q8B A;  5D6J B;  2WX0 A;  1TKG A;  1RWS A;  2WNM A;  2LGX A;  3I9V 1;  1L7Y A;  2N9P C;  2Q5W D;  1WE7 A;  2N4F A;  3PGE A;  2B3A A;  2ZZP B;  2IGH A;  3NVZ A;  2QJL A;  4GDK B;  4P16 A;  1F2R I;  2ZW0 A;  4MGY E;  1M94 A;  3B08 A;  4GDK A;  3O65 B;  1D4B A;  2LHE A;  2KOX A;  2ZCB A;  1XLP A;  4YTP B;  1Z2M A;  4HDO A;  2A5U A;  3CSF A;  2KQS A;  5AEK B;  1TY0 A;  4HJG E;  1J8C A;  4ZYS A;  4BAX A;  1AW7 A;  1FFU A;  1VZ7 A;  2W3R A;  3ONS A;  3L54 A;  4XYC A;  1N5X A;  5AUK A;  1ZE3 D;  1WXM A;  4KGS A;  2JY6 A;  3K9O B;  4II3 B;  4RCO A;  2EKE C;  3N1Y C;  2RSU A;  3RNF C;  3V3X A;  4HPL B;  3Q69 A;  3KYC D;  3ZTC A;  1GB1 A;  5HI1 A;  1JCK B;  2X38 A;  3LXF A;  1E10 A;  4J6I A;  4A8X C;  1XD3 B;  3CWI A;  2ZJD A;  1ZW7 A;  1T0Y A;  4KZC A;  2KWC A;  1FFV A;  4JX1 C;  3HM3 A;  1L0X B;  3P2B A;  4XGA B;  5BMG A;  1TT5 B;  1N62 A;  1Y56 A;  2J0J A;  2BWE S;  2PW9 A;  3PHW B;  1SJE D;  2BKF A;  2HTM E;  1SE9 A;  2CJN A;  1V80 A;  1UD7 A;  1N63 A;  1TGZ B;  4JGH B;  2VH1 A;  3U8Z A;  4I6P A;  2CU1 A;  3KUZ A;  3UIN B;  3TMP B;  1WF9 A;  4M0W B;  1GPX A;  4XC2 A;  2HDE A;  4PS8 A;  4IDI A;  3T3N A;  1I35 A;  1FXA A;  2DBY A;  2KLC A;  4M0W A;  1IGC A;  2M0A A;  4F7Z A;  2Z59 B;  2BS4 B;  3VHT C;  3BY4 B;  4IM0 A;  3DBL I;  3QK0 A;  1HTO A;  3DHI C;  1V49 A;  4C56 C;  3B2F A;  3HHM A;  2WXG A;  1C78 A;  4IWO A;  5DCN A;  4JWS C;  2LWP A;  1YN4 A;  2IBI B;  3DQV A;  2FCM A;  3A4S C;  3CIR B;  2KAJ A;  3O13 A;  3GP7 A;  2JZZ A;  3D32 A;  3NVV A;  2CR5 A;  2D5G A;  1P7E A;  5J2R A;  1QOG A;  4LJO B;  1TS5 A;  1WYG A;  3DWG C;  1B9R A;  3RN9 C;  5LNK 1;  4WAF A;  4DK5 A;  1QOA A;  1UF0 A;  3PT2 B;  5FR6 A;  2OJW A;  1WM2 A;  1WGG A;  4WJN A;  2WXR A;  2VZK D;  3IT6 B;  4FLH A;  4NZL B;  3RFZ B;  3EC8 A;  3IT4 B;  1I4H A;  3EGR A;  3AUL A;  1PUT A;  4K81 A;  1N6Z A;  4FBJ B;  3U7D A;  3P4R B;  3A33 B;  4HKQ A;  1I42 A;  4KSK C;  1RFA A;  1SE3 A;  1KLV A;  1CMX B;  3AV8 A;  1F52 A;  2LGY A;  2REX A;  3NS1 A;  4ASW C;  2MRP A;  2K22 A;  2MQJ A;  2GB1 A;  1HXY D;  4GMV A;  4UDU C;  1DOI A;  1K50 A;  2RMM A;  2ACZ B;  2PVG C;  2WXM A;  2C7N B;  4URK A;  4KIK B;  1C79 A;  2OHF A;  3H6N A;  2MH7 A;  2KWD A;  4KIK A;  2G1E A;  1F1H A;  4ANX A;  2V4I B;  4M8M A;  4A9A A;  2JPH A;  2KDB A;  2AEH A;  4HWI B;  2M8S A;  2JF5 A;  2LHD A;  3V6E B;  3BYY B;  3DBL B;  1QKZ A;  1HE8 A;  1V5O A;  3N9Y C;  1QF6 A;  2LGI A;  3Q8F A;  3RNA C;  1L4D B;  2WDV B;  4TV3 A;  2N7D A;  3AU5 A;  2JVC A;  4MH8 A;  4FN2 A;  4F1S A;  3ZNZ B;  4HJK A;  2JXX A;  2WX1 A;  4ANW A;  3PRM B;  1YJ1 A;  2VRR B;  4ZRJ A;  3TEZ A;  2LVQ A;  1IPG A;  1OQY A;  1STE A;  2L83 A;  1I4R A;  3HVZ A;  3BVZ A;  4OVU A;  4HPP A;  4WUR A;  2LMC A;  3Q3O C;  4WWO A;  3SR6 A;  3Q8A A;  1SE4 A;  2R2O A;  4W9J A;  4HKZ E;  2O6V D;  1WGH A;  2KWV B;  5IO9 A;  2M0X A;  1TZ1 A;  5TSS A;  5HKH A;  1SIJ A;  4EEW A;  1FNW A;  3R2T A;  4XDD A;  2WXN A;  5LXH A;  2JRH A;  2UYZ B;  1K53 A;  3WAN A;  3DBH I;  3MC9 A;  1PGX A;  3R8B A;  4NQK E;  2Y5B B;  2L8J A;  5BYR A;  2YEP F;  4AOF A;  1JRO A;  2KFK B;  3HRD D;  4FJY A;  4US9 A;  2KFK A;  3ML8 A;  2KMA A;  2IGG A;  2L1A A;  3NUH B;  5D3D A;  1I4G A;  1NVI D;  1KM7 A;  3SDL C;  3KVF B;  4ZRI A;  2LEK A;  4EKU A;  2ZVO A;  3HVD A;  2KT7 A;  4ZRK A;  1ZP0 B;  4K7U A;  3KUC B;  4L23 A;  3IHP C;  4BKS A;  3ZDT A;  4QAY A;  3L4P A;  1TIF A;  3VXW A;  3DHG C;  1KFY B;  2WXL A;  1T5X D;  1FIQ A;  4W9E A;  5C3J B;  3RCZ A;  2PE6 B;  1TKY A;  2W54 A;  4KSL C;  1QIL A;  2WXH A;  4US8 A;  5LLI A;  2EMT A;  1QT9 A;  3AEF B;  4EZK A;  2BQQ A;  2J0M A;  2QIE B;  2DNF A;  3H7S A;  5J17 A;  1S3S G;  3AE5 B;  4RFB A;  3PHX B;  3AXC A;  2L00 B;  2KJH B;  1E9M A;  3U52 E;  4C7Y A;  5EDS A;  4YSY B;  1ET6 A;  2KDI A;  1L0V B;  5T8I A;  2NTT A;  2KLG A;  4LNI A;  2QSD A;  4HVB A;  5G5G A;  2MBO A;  2L7R A;  1ESF A;  3DBH B;  1V1P B;  1C9F A;  1XQQ A;  2G3Q B;  1FRR A;  4G0N B;  3C0R B;  1V1P A;  1V2Y A;  2PJH A;  1GAQ B;  2WDT B;  3AE2 B;  4FAD A;  2K0P A;  1TYG B;  3L17 A;  2IGD A;  1ACC A;  1DYQ A;  1SIF A;  1WY8 A;  5BYS A;  1UBI A;  4IUM B;  2BWF A;  1T0R C;  2KVR A;  3Q3M C;  2K8C A;  5EE3 A;  4FA6 A;  4MM3 B;  1F9J A;  1EM7 A;  3PRP B;  3I63 C;  4MM3 A;  1UH6 A;  3AE9 B;  1XLN A;  5JXV A;  1ZKH A;  2K9X A;  2MHJ A;  2LUE A;  2QMT A;  4WJQ A;  2K25 A;  2V9H A;  3BII D;  4BBN C;  1JML A;  3IAS 1;  4F8C B;  4WJP A;  1EF5 A;  3AI5 A;  2DEN B;  1TBE A;  2KK8 A;  1QOB A;  4NQL B;  1FEH A;  4N9F 4;  3UGB B;  4LK0 M;  2ZW1 A;  2IYD B;  2WDR B;  4CO7 A;  4PS7 A;  4FXC A;  3I5J C;  1XCQ L;  1YD8 U;  2MX2 A;  5C1Z A;  2KX0 A;  2FID A;  2KAN A;  3N20 C;  2KJ6 A;  4FHJ A;  1BML C;  2L3Z A;  4NAM A;  1MHX A;  2WDQ B;  3VUX A;  3DVG X;  4EZJ A;  1P3Q U;  2KDE B;  1BUI C;  1FNV A;  1PYW D;  4MDK E;  1YMH E;  1V9J A;  3IBE A;  3PSE B;  4W9K A;  4LNO A;  2WXP A;  2AYO B;  2W55 A;  1QOF A;  3AEE B;  3R7Q A;  1L2N A;  3KQ4 A;  2JYE A;  1C77 A;  2KJR A;  5FR3 A;  4C00 A;  2KDF B;  2KO3 A;  2H89 B;  4BOZ B;  2K8B A;  1E7V A;  1J19 A;  1ZDV A;  3WIM A;  4P7I A;  2XN9 C;  5D2M B;  1DOX A;  1FCL A;  1XLQ A;  1N61 A;  1WGR A;  1JWS D;  3I3T B;  1NEN B;  3BWU D;  1P98 A;  2BPS A;  4K1R B;  2KQ4 X;  4B0E A;  2V4L A;  4USA A;  4B0M A;  2K39 A;  2HJ8 A;  4N6E B;  2LZ6 A;  5E6N A;  5CHF A;  1QLB B;  1ZPS A;  4E74 A;  3AU4 A;  3EHV A;  2N7J A;  5D3I B;  2AL6 A;  2VH2 A;  1SE2 A;  5IKC M;  4LTU A;  1WZ3 A;  1GUA B;  1K51 A;  4PT5 A;  5JHA A;  2N9X A;  1WJN A;  1WRD B;  3IG3 A;  4ICV A;  1AWD A;  4LCD E;  2WXJ A;  1ZUD 2;  4A6Q A;  4DBG A;  2M19 A;  4WJO A;  2MW5 A;  5E6O A;  3ZXR A;  2GLS A;  4GIV A;  4L1B A;  4W9C A;  3E56 A;  4NJ7 A;  1ZOY B;  3QIJ A;  4MH0 E;  3E9S A;  1BT0 A;  1XT9 B;  4FUL A;  2J4X A;  3ZNG C;  4EFO A;  3NZU A;  2IO1 B;  2LFI A;  2B76 B;  2X8X X;  4A3O A;  2G9H D;  3OWE B;  4NJ6 A;  5GMV A;  3L0W B;  1UGJ A;  1I4P A;  4MSQ B;  1YNT E;  3SFE B;  1YQB A;  4P1C C;  3VFK A;  5BO4 B;  4IM3 A;  4TSS A;  1AYF A;  3NOB A;  3V05 A;  1GC6 A;  3QAQ A;  3QC8 B;  2G4S A;  1T0S C;  2C7M B;  2IND C;  2ON8 A;  5L95 C;  2XBB C;  3PTF C;  3DDC B;  2RGF A;  2YEP B;  3UIP B;  2JSV X;  1R4N I;  2ZPY A;  2K6Q A;  4K7S A;  2AX5 A;  3PZ8 A;  4YWG G;  1NEK B;  2L0F A;  4BKS D;  1CZP A;  4OW0 A;  4MSM B;  2IZV B;  1LGR A;  2LRU A;  3A9K B;  2Y5P A;  4DHZ B;  3A9K A;  3LJ3 A;  1YQ4 B;  4ZRP A;  3VR9 B;  1NYR A;  5FK9 C;  2NBV B;  5JHB A;  2JZP A;  2BF8 B;  2PMV A;  5IA7 A;  1JWB D;  1TS4 A;  1C3T A;  2KN5 A;  3AEB B;  5AUI A;  2DAJ A;  1LQB A;  2BKR B;  2NTS A;  3VUW A;  2K5P A;  1Q0W B;  4ARI A;  1UEL A;  3HK0 A;  1P0R A;  4W9I A;  3AB5 A;  4RMA A;  2WLB A;  1SBB B;  1WJ6 A;  4II2 B;  3KW5 B;  3GS2 A;  2AQ3 B;  4P6V F;  4RGN A;  3Q6B A;  1KLU D;  1RLF A;  1OTR B;  1LXD A;  2MBB B;  3Q3J A;  2KHW B;  1H4R A;  1L6V A;  4KDI C;  1J7A A;  3VRA B;  5JH5 C;  2JRI B;  1F2R C;  2D11 A;  3IAM 1;  5H92 C;  3RNG C;  4XX5 A;  1WI0 A;  2GBM A;  4PK1 A;  4XWW A;  1A70 A;  1I7H A;  2RD0 A;  3HIZ A;  1R4N B;  2WXI A;  2ZNV C;  1V1O A;  2L76 A;  5G2N A;  3H8H A;  1ZGU B;  2L05 A;  1UGM A;  1WRI A;  3W1S C;  1J0G A;  1WGK A;  1D5M C;  3P4Q B;  2ASQ A;  1T0Q C;  1E0Z A;  3MTN B;  4AP4 C;  5IN7 A;  4JL9 A;  1UBQ A;  3VTV A;  4J3O D;  1CK1 A;  3U4E G;  2R61 A;  2ZVN A;  3ZXV A;  3OAW A;  2D07 B;  3GB1 A;  2LJ5 A;  1SSN A;  3L08 A;  1JAL A;  3H7P B;  4G11 A;  1ZXH A;  3H7P A;  4W9F A;  1L4Z B;  3A1Q B;  2KC1 A;  2AL3 A;  1YJI A;  3A1Q A;  3DBR B;  1WMH B;  1TTN A;  3QQ8 B;  2JXT A;  1WWT A;  2G45 B;  1WMH A;  3PS6 A;  4OVV A;  4FJV B;  4EUT A;  4ACF A;  2DLB A;  4TUU A;  1LFD A;  3TBL D;  1BXT A;  2CHZ A;  5C23 A;  4JIO U;  2N9K A;  4D2K A;  1XEE A;  2BGF A;  1LO5 D;  2JUO A;  5LXI B;  4GN1 A;  4G50 A;  3MC0 B;  2KNB A;  4OZC A;  3AED B;  3APC A;  3AE7 B;  4OHJ A;  2DZJ A;  1EU3 A;  4YSX B;  2WYQ A;  5GXG B;  2I1J A;  2INN E;  3SEB A;  2KZR A;  4WQM A;  2BYF A;  3OLM D;  4A90 A;  1I4X A;  1WFY A;  3PRZ A;  5KHO A;  3TIX A;  2N9E B;  2FCN A;  1NI2 A;  4AJY B;  3VDZ A;  4YTN B;  3AM9 A;  1SXT A;  4YXD B;  4C80 A;  1P1A A;  5HFY A;  1A5R A;  4AWJ A;  2IO2 B;  1B1Z A;  3M62 B;  2KFJ A;  2BB6 A;  2JYT A;  2W3S A;  1VRA B;  4A20 A;  1FMA D;  4AQ7 A;  3GOE A;  3AN1 A;  4RNA A;  2WXQ A;  1M4V A;  4ZRQ A;  2FUH B;  4XDC A;  1JW9 D;  2KMM A;  2WGS A;  4GGQ A;  1FNU A;  1TY2 A;  2WU5 B;  4JPS A;  1G6J A;  4IWP A;  2M56 B;  3OJ3 A;  5HG2 A;  1QQR A;  4BOS C;  4N58 A;  3ZJT A;  4KDL B;  3NZS A;  2NMQ A;  4FHK A;  5EE1 A;  3P4P B;  2QC8 A;  1KH0 A;  3MJ5 A;  1V97 A;  1V81 A;  3TEX A;  3ZJV A;  1E8W A;  4M01 A;  2KTR B;  1X1M A;  3PLV A;  2JU6 X;  2MBH A;  1FXI A;  5D94 A;  2KTR A;  1FM0 D;  3W2D A;  1C76 A;  3PRE A;  3ZDM C;  3VUY A;  1YX5 B;  2IY1 B;  3EA6 A;  2FAZ A;  3JSV B;  2CHW A;  2INC C;  3JSV A;  1RYJ A;  5CHV C;  4KKI A;  1OFF A;  1E90 A;  3QWZ B;  4ITK A;  1RAX A;  1GC7 A;  3K9P B;  1S1Q B;  1EO6 A;  1WX7 A;  4GOC A;  4PS3 A;  2UU7 A;  3ALB A;  2QCZ A;  4ZDV A;  2IO0 B;  5CTR C;  3BK1 A;  2QDF A;  4HEA 1;  1F77 A;  1Q10 A;  4MGZ E;  3P63 A;  2DHZ A;  4GLS C;  1J7C A;  3GE3 C;  1L0Y B;  1MI0 A;  1YIW A;  2RDB C;  3V6C B;  3OG5 A;  3BIN A;  4DHJ B;  2D2Q A;  1WR6 E;  3Q14 C;  3PVL A;  2PKO A;  1MVK A;  5TR5 A;  3LYY A;  4RF0 A;  3UIO B;  1UUP A;  1H8C A;  1V86 A;  3WAL A;  4BFR A;  2WXF A;  3ZLZ A;  2MJD A;  5KHQ A;  1VCB A;  2WP9 B;  5DPS A;  3URY A;  1E8Z A;  1FPY A;  4I6L B;  3SHQ A;  3P42 A;  3PZ7 A;  4NY0 A;  3JYU A;  4MAC A;  3QA8 A;  4X57 B;  2ZCC A;  1HQR D;  1AAR A;  3S2A A;  3N1X C;  4W9D A;  2J42 A;  1VLB A;  3APD A;  2MEK A;  3W5V B;  1HEZ E;  2MBQ A;  2LAS A;  3MHS D;  4NPN A;  2NBW B;  4AS1 A;  2FCS A;  2V3P A;  2PEA A;  3W1Y A;  4ICU A;  3CST A;  3SU8 X;  3KH0 A;  2R2Q A;  3C19 A;  3W9C B;  1YN5 A;  4LNF A;  3R7R A;  4DHZ E;  4TQ0 A;  3ECI A;  3A9J B;  1KJT A;  4LJP B;  2KN4 A;  1C4P A;  3A9J A;  3NY5 A;  1WM3 A;  2AQ1 B;  2CHX A;  3AE3 B;  2GBN A;  2CU3 A;  5G55 A;  3MFG A;  1ZDX A;  3KYD D;  2DZM A;  3B9J A;  3PPA A;  2BT6 A;  1KLG D;  1HZ5 A;  3NG0 A;  1PFD A;  3ZJU A;  1Q1O A;  5EE9 A;  2MJE A;  2C5L C;  2E3T A;  4JE3 B;  2ZPN A;  5E6J A;  1VZ8 A;  2J7Q B;  4IKG A;  3APF A;  5BMI A;  1TS2 A;  3TUO A;  2G4D B;  3VQI A;  4DDI D;  1TZO A;  4IW0 A;  1ZXI A;  4AJW A;  2IO3 B;  2DAF A;  2WQY B;  2JT4 B;  3PV1 A;  3RNC C;  2V3N A;  1WXA A;  1AN8 A;  2O2V B;  4ARC A;  1E7U A;  4OZB A;  2O2V A;  1P7F A;  4YT0 B;  1JWA D;  2EKI A;  3FC4 A;  3V60 A;  2IJ0 A;  4EOY A;  4DWF A;  2LD9 A;  2QIL A;  1WJ4 A;  3LB8 C;  4LNK A;  3DVN U;  4L2Y A;  4IC7 B;  3R66 C;  4KKJ A;  2D3G A;  4DXA B;  2HD5 B;  3L13 A;  2DX5 B;  4M8N A;  4PYZ A;  4ZHP A;  1EU4 A;  3MC8 A;  3PZD A;  3UQA A;  1TJE A;  2JZ3 B;  2GMI C;  4DXF A;  2J0K A;  1C1Y B;  3ZNH B;  2UWQ A;  1OGW A;  1MG4 A;  2DYM A;  1RM6 C;  1SB3 C;  4K7W A;  1D5Z C;  5IAA C;  3UF8 A;  4YTM B;  2LJI A;  1JWM D;  3CMM B;  4REZ A;  3AE1 B;  2M4N A;  1OEY A;  4ZOH C;  2WU2 B;  5IP4 D;  2HJ1 A;  3L10 B;  4KGT A;  1EWY C;  5FKA C;  3WAO A;  2AQ2 B;  3RI7 C;  3R2I A;  3VH3 B;  3RPF C;  2I38 A;  4EZL A;  3TEY A;  2KQ7 A;  2ONQ A;  1WSP A;  4RGM A;  3ZGZ A;  2YVC A;  4B95 A;  3ZRC A;  4IM2 A;  1E7P B;  3B2G A;  2N9L A;  3DOW A;  3A4R A;  1K8R B;  1UZX B;  5DPR A;  3RT3 B;  3ZNI D;  3IVF A;  1MJD A;  1YJJ A;  3DWM A;  1C4A A;  2N1V A;  3MHZ A;  4KGR A;  1KRH A;  2V0G A;  2A4Z A;  2WS3 B;  3ZW3 A;  3T3O A;  3AEA B;  2PE9 A;  5J18 A;  2KVZ A;  1JRP A;  1F0Z A;  2FNJ B;  4TKN A;  1U4A A; 
#chains in the Genus database with same CATH homology
 3N1Z C;  3I63 C;  3Q2A C;  4P1C C;  3DHH C;  3N1X C;  3RNC C;  3GE8 C;  3RNE C;  3DHG C;  3N1Y C;  3N20 C;  3RNF C;  3RNB C;  3RNA C;  1T0S C;  3GE3 C;  2IND C;  4P1B C;  2RDB C;  3RN9 C;  3Q3N C;  1T0Q C;  3RI7 C;  3Q3O C;  1T0R C;  3Q14 C;  3RMK C;  3DHI C;  3RNG C;  3Q3M C;  2INC C;  3I5J C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...