4W9GA

Pvhl:elob:eloc in complex with (2s,4r)-1-(3,3-dimethylbutanoyl)-4-hydroxy-n-(3-methyl-4-(thiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 6)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
101
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Transcription elongation factor B polypeptide 2
total genus 24
structure length 101
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4w9gA00
1EF5A 3U7DA 3NS8A 4EOYA 2ZZPB 4NPNA 1P3QU 2XEWA 2LGXA 4ZYNA 3WAOA 4JGHB 2A4ZA 2KWCA 3ZTDA 4BOZB 2FAZA 3L08A 4DK5A 4GGQA 4FULA 3ALBA 4ZRKA 1KM7A 2JZZA 2GBRA 2KFKA 1P1AA 4ANUA 1WE7A 2C9WB 1ZW7A 2JXXA 2K8BA 4BVUC 4B6WA 3L16A 4HVBA 5JHAA 4W9GA 4GIVA 1GNUA 3A4SC 3A9JA 4GN1A 2D07B 3ZNHB 1TZ1A 1WR1A 2LVPA 2MBEA 3ZKJC 2LXAA 3K9PB 2FNJB 1J0GA 2L3ZA 1RLFA 3UINB 2MRPA 3MTNB 3IG3A 3R3MA 3RZWC 3N32A 3UGBB 3P2BA 2I1JA 2MQJA 3PLUA 4EZJA 3MHSD 3TIXA 2BYEA 1PQSA 2KKCA 3WALA 2LJ5A 1I42A 1TBEA 2WX0A 4K7SA 1NDDA 2IY1B 4FJYA 2JY6A 2V4LA 2WDTB 3A1QA 4K1RB 3VH3B 3ZUNA 1ZKHA 4X57B 2IO0B 1R4NI 3V60A 2NS5A 1LM8B 3IFWB 3H9DA 1NBFC 2PE6B 5EDSA 4DXAB 4IM2A 5C1ZA 2KLCA 3HHMA 4AP4C 4CO7A 2Z0EB 4WWNA 3GZNI 3NZUA 5KHQA 4NAWA 2YLMA 1XD3B 3QJZA 2DZJA 3KUCB 4EFOA 2RGFA 1GG3A 4ANVA 4BKSA 4HWIB 3KUDB 4MELA 5J17A 5J2RA 1WGYA 2K1FA 4TV3A 4I6LB 1UBQA 4HPMB 4E71A 1WYWB 4IM3A 1E90A 2LUEA 3EECA 4WJNA 4G0NB 3IHPC 3ZNZB 3B08A 4GDLA 2RSUA 2BKRB 5AZGA 4LJPB 2L0TA 3NHEB 2DZIA 2JRIB 4G50A 3ML8A 1V81A 3VUWA 3RCZA 1P98A 1V80A 2DHZA 1AARA 2MP2A 2N7EA 4W9CA 3PPAA 4IG7B 4ANXA 2ZVNA 3M3JA 2HE7A 1U4AA 2K6QA 3M62B 2M8SA 3QK0A 1E7UA 2HTHA 3D32A 3V6EB 4FADA 2N1VA 1I35A 3C0RB 3A33B 4WJQA 3OAWA 4MJSA 4MEMA 2GBNA 2ZCCA 2ZVOA 4FHKA 3DPDA 2JVCA 2AEHA 4XC2A 5DCNA 2AYOB 1OQYA 2DYBA 2Z59B 4ICVA 5KHOA 1V5OA 3PRMB 5IAAC 2LWPA 2N1WA 4W9LA 1QZEA 4W9KA 3ZDTA 4A3PA 1IP9A 2KDEB 4I6PA 4GB9A 3RD2A 2XK5A 2IYDB 4YL8A 3V61A 2LI5A 1RFAA 4IUMB 3HM3A 3L17A 4KZCA 3JW0X 1WGGA 3Q3FA 4MDKE 4TQ1A 5DPSA 1KLVA 3ZO5B 1YX6B 4LDTD 3CF6E 1E8XA 1WIAA 2BPSA 1TGZB 3M95A 3PHWB 2LD9A 4HDOA 2KN5A 3TBLD 4HDQA 1D3ZA 2KXJA 3VTVA 4TKNA 1E8YA 4MSMB 4W9HA 2MCNB 3X0WA 5CX3A 3OJ3A 3L10B 2KTRB 5JH5C 3JSVB 4JL9A 3KVFB 1P9DU 4P7IA 3AI5A 1WJUA 2EKEC 3H7SA 4DBGA 2V1YA 1V5TA 1X1MA 2ZPNA 3R7RA 1C3TA 4TUUA 2ZNVB 4MGIE 1KOTA 3SHQA 2R2QA 2DZKA 3BINA 4GSWA 1Q1OA 3VTWA 2KDIA 4KSLC 3DBRI 3TJPA 3Q3JA 3APCA 3IVFA 1A5RA 1P0RA 4BKTA 3PTFC 3QAQA 4K7UA 3WANA 2OJRA 4KVGB 3MJWA 3AU4A 2UYZB 3PZDA 1GJZA 3ML9A 2J0JA 4WAAA 2M4NA 3ZLZA 2KJRA 4GDKA 2O6VA 1H8CA 2DENB 4URKA 4AOFA 3VQIA 5DPRA 2W9NA 3CSTA 2G4DB 5J18A 4GDKB 2IZVB 1V6EA 1WJNA 4MM3A 4NQKE 2ZNVC 2LGYA 4NAWB 4AWJA 2IO3B 1WI0A 4WJOA 1CMXB 1WMHA 2I1KA 1OGWA 3PV1A 2HD5B 2N4FA 3U30A 4ANWA 3QC8B 2DYOA 2GBJA 2OOBB 2BF8B 2V3SA 3OJ4B 3PSEB 4DHJB 2J7QB 4IWQA 1IPGA 4ASWC 2KANA 4XZ4A 2ZPYA 3QA8A 4CHKA 4HJKA 3RULA 3VFKA 3DVNU 2IO2B 3ZRFA 4A20A 2O2VB 5D94A 3DVNV 1WXAA 2WYQA 1J19A 4K81A 3S2AA 4BBNF 3L13A 2RD0A 3DBHI 1SIFA 2JWZA 4WQOB 2PPHA 3V62A 5JZEB 5JHBA 4MSQB 2M17A 4RMAA 1WM2A 2BYFA 3JVZX 3H7PB 3KH0A 4JLCA 2JZ3B 3VH4B 4E3CA 1WX9A 2PJHA 2PEAA 3ONSA 3TCAA 4NY0A 3PS6A 3SD5A 2LXCA 2NVUI 2KWUB 4N9F4 4GMVA 4WWPA 2C5LC 5BO4B 2LGDA 2NBVB 3VHTC 1YQBA 3L0WB 4GXBA 4EZLA 2KDBA 2ZEQA 4GOCA 2FIFA 3DDCB 5GMVA 2G3QB 4FBJB 3VXWA 2D10A 2NBUA 1WF9A 2Y5BB 4DWFA 3QARA 1WZ0A 4FJVB 4WWOA 2MW5A 2CU1A 2KVRA 4FLHA 4XX5A 1G6JA 3DCGA 2MBQA 3AXCA 1Q0WB 1UD7A 4IW0A 2DAFA 2C60A 3ZNID 3RZFA 3WAPA 2FCMA 5CHVC 2L7RA 5DPWA 2N7DA 3A9JB 1XT9B 3APFA 3VVWB 2WWZA 2NCNA 4KDLB 4NJ7A 2D3GA 4J6IA 1WGRA 2XK5B 3U8ZA 2FUHB 1UZXB 1IYFA 2WX1A 4M8MA 1H4RA 3R66C 2MBBB 4NQLB 2BKFA 1GC7A 3W1SA 1E8WA 3W1SC 1RAXA 2KTRA 2ZJDA 4PYZA 5LLIA 3PRZA 2RR9A 2L05A 1YX5B 3DBSA 4IWPA 3PVLA 4BKSD 4EZKA 1VD2A 2EMTA 4KSKC 4HLEA 2D11A 2KC1A 2KWVB 2J0KA 1VCBA 4FJZA 2KMAA 3NY5A 1UELA 1WZ3A 3NOBA 3ECIA 4WJPA 2BGFA 1M94A 2MBHA 3T8MA 5DPTA 5LXHA 3O65B 1WXSA 2KMCA 4OVVA 1C1YB 1KJTA 1WX8A 3NZSA 1J8CA 2NPTA 3APDA 4IM0A 3VUYA 3ENEA 3UIOB 4ZRJA 1OEYA 4K7WA 4BBNC 4II2B 1WGDA 2MWSB 5LXIB 2KTFA 2K8CA 1ISNA 1YD8U 2KQSA 1WJ6A 2CHZA 1JRUA 3H7PA 2GBKA 2KHWB 2UWQA 4BKGA 3BY4B 4AJYB 5C23A 1RRBA 4RM8A 5TR5A 4B95A 2LVOA 1S1QB 3ZIMA 4CYEA 5AEKB 1E5WA 1WXMA 3DBLI 4AJWA 2C7NB 3EFUA 2FCQA 2KOXA 3CMMB 3CSFA 1V49A 3LDZE 3QWZB 3ZDMC 1K8RB 4DHZB 2KFJA 4W9EA 3DOWA 4M8NA 2N9EB 1NI2A 1OEYJ 1WH3A 4F1SA 2L8JA 3M63B 2O6VD 3KUZA 3SU8X 1MG8A 3JSVA 4TQ0A 2KLGA 1WRDB 4KDIC 4JIOU 1WM3A 5AZFA 4AUQC 1WR6E 2BWFA 4JQWC 4RM9A 3QIJA 2DYMA 4HXDA 3RUIB 4ZDVA 4ZRIA 5HKHA 2D2QA 5D2MB 3L54A 4LDTB 2RPQA 2KJHB 3AULA 4MGKE 5L83A 2N9PC 3H6NA 3EHVA 2LVQA 4G11A 4I6NB 1GUAB 2LZ6A 3SDLC 2GOWA 3WIMA 2IY0B 2JT4B 4DDGD 5FR6A 2G4SA 2VRRB 2JF5A 2L0FA 3UF8A 4II3B 1WY8A 4W9IA 3KYCD 3N3KB 1BT0A 4A3OA 3UQAA 3HM6X 3IBEA 3A9KB 1Z2MA 3T9LA 3RYTA 3B1LX 4LCDE 2MSED 3LJ3A 1WFYA 2HJ8A 2GBMA 3VAWA 1WGHA 2NPTB 3JYUA 5CHFA 4FA6A 3QCAA 2DX5B 2FCNA 2CS4A 2FCSA 2Z0DB 3K9OB 4FHJA 3PREA 4MGZE 1Y8RC 2EMSA 4HCPB 3VUXA 3ZW3A 1UGMA 2JUOA 2JPHA 3A4RA 3UIPB 1YJ1A 1WE6A 2GMIC 1ZGUB 3QQ8B 3VDZA 2YVCA 2KX3A 3TL5A 4PS8A 3HK0A 2A5UA 4ICUA 2K6DB 4KZ0A 2LRUA 2KC2A 4OVUA 4LJOB 1WX7A 2K39A 2O6VB 3ZRCA 4W9FA 2ASQA 2KFKB 2KQ7A 5G55A 1LQBA 2MP2B 2R2OA 4HK2A 1WMHB 1TTNA 3RT3B 3I3TB 4NJ6A 3A9KA 2K25A 3WAMA 5E6OA 2NBWB 2L76A 3V6CB 1WJ4A 4FN2A 2KD0A 1EF1A 2CR5A 1L2NA 3ZVVA 2BYVE 3X23A 4B9KA 2AL6A 2L00B 3GOEA 4M0WB 2KNBA 2M1MA 4PYUA 2KDFB 2PE9A 3PGEA 5AZHA 1WXVA 3QX1A 4DHZE 2AWTA 3PHXB 3VTUA 2DZMA 3DVGY 2MBOA 1LFDA 2G45B 2KO3A 4W9JA 3OLMD 4KV2A 1LXDA 1EUVB 4G3XB 1V86A 3DVGX 3UQBA 2IO1B 5E6PA 3H1UA 4NNJB 4BFRA 2XBBC 4GU2A 2BWES 2N9XA 1F9JA 2CHWA 2FIDA 3KYDD 5L95C 1FXTB 4EKUA 3HIZA 2KK8A 5G2NA 4GDLB 1Z5SB 1Q5WB 2KZRA 3B0AA 3PLVA 1UBIA 2LRWA 5E6NA 1E8ZA 2M0XA 4IWOA 3R7QA 2C7MB 2K8HA 3PT2B 2B3AA 2C7HA 1OTRB 4F7ZA 5IA7A 1L7YA 4MJSB 1GC6A 4E74A 3KW5B 1V2YA 3QHTA 5CHWA 5D7GA 1SE9A 4EEWA 2AL3A 4BOSC 4PS7A 4DHJD 4F8CB 4HPLB 4HCNB 4IC7B 1R4MI 2IBIB 3EC8A 2ZCBA 4MH0E 3ZTCA 1XQQA 4DDID 2LASA 2CHXA 5CTRC 4MGYE 2O2VA 2MA9B 3W1YA 1E7VA 3AU5A 3A1QB 2QHOA 2KX0A 1YIWA 4KIKB 1EO6A 1SGHA 3WA0A 2DAJA 2J0MA 3ZNGC 4EUTA 1UH6A 3PRPB 2MLBA 1V9JA 2NR2A 2MX2A 1S3SG 4PS3A 5D6JB 1T0YA 4W9DA 2KJ6A 4KIKA 2CKHB 1HE8A 2REXA 3DQVA 2JRHA 3N30A 3TMPB
chains in the Genus database with same CATH superfamily
2N0SB 2GLSA 4DXGA 1UUPA 3U7DA 3NS8A 4EOYA 2ZZPB 2XEWA 4ZOHC 3WAOA 2A4ZA 4FULA 2GBRA 4WAFA 4ANUA 2I2YA 2JXXA 4BZAA 1OFFA 4HVBA 3A9JA 3A4SC 2FE8A 3NZ3A 3ZXVA 4HKQA 1J0GA 1RLFA 2MRPA 3MTNB 2D3BA 1FCLA 3P4SB 4MACA 4LNNA 2KKCA 4YWGG 4GLSC 1TBEA 2WX0A 1CJEA 4K7SA 2JY6A 3ZUNA 4X57B 3I5JC 1R4NI 5EDSA 4CO7A 1T5XD 4NAWA 4OVZA 1TYGB 1HZ5A 1RWSA 4BKSA 1ENFA 4HWIB 2INNE 1MJDA 2CJNA 1J7CA 1WYWB 3ZNZB 4G0NB 3B08A 3BZDB 4GDLA 2DZIA 4J3OD 1P98A 2IGDA 1WXQA 2MP2A 3ZYYX 2HTME 3RNGC 3GS2A 1U4AA 2K6QA 2M8SA 3MC0B 1UGJA 3V6EB 2N1VA 2E3TA 3GB1A 4WJQA 1SBBB 4S17A 1JROA 4MEMA 2WXLA 2GBNA 1FXIA 4A8XC 2JVCA 4K3CA 2Z59B 4ICVA 5KHOA 2Z8LA 2LWPA 3Q6BA 2XNAC 2KDEB 4GB9A 3ZJUA 3RD2A 5BMGA 1C77A 3BVGA 2LI5A 5DPSA 3HM3A 3L17A 3JW0X 1NVID 1YX6B 4LDTD 4P1CC 3CF6E 3L4PA 3M95A 1TGZB 4HDOA 2YEPB 3MC8A 1D3ZA 1E8YA 4W9HA 2MCNB 1TY0A 5CX3A 3OJ3A 4R3DA 3SFDB 3P4PB 1PUTA 1KLUD 2N9LA 2EKEC 3H7SA 1V5TA 2ZPNA 4HROA 4TUUA 2QDFA 2R2QA 3BINA 3VTWA 1DOIA 4IKGA 3ZGZA 1WYGA 3IVFA 4BKTA 4K7UA 3H8HA 3PZDA 1GJZA 4JX1C 2J0JA 1H8CA 3ZLZA 2KJRA 4GDKA 2DENB 5DPRA 4GDKB 3WCQA 1ROEA 1WGKA 4P6VF 1T0SC 1KFYB 2FBWB 4NQKE 5MPOA 2GRIA 1DYQA 4WJOA 3BK2A 1B1ZA 3U30A 4ANWA 3QC8B 3FILA 3OG5A 1V8CA 2BF8B 4DHJB 3PSEB 3AE3B 4ASWC 3E56A 2IO2B 1QOGA 2O2VB 5D94A 4ZRPA 1J19A 4K81A 4LLGM 3Q8CA 2N9KA 1SIFA 2JWZA 4MSQB 3JVZX 4JLCA 2JZ3B 4E3CA 4USAA 1HEZE 2PJHA 2PEAA 3TCAA 2NVUI 1C4CA 4XWTA 5TSSA 2C5LC 3Q8AA 3HVZA 4P1BC 2RPVA 3R8BA 3VHTC 5GMVA 3ZQ4A 2FIFA 1UNSA 2G3QB 4FBJB 2D10A 4PT5A 2Y5CA 1BUIC 1Q0WB 1AW7A 4IW0A 2SAKA 3V3XA 1HXYD 4Q2JA 3RZFA 5DPWA 2FCMA 2M19A 3U2SC 1C79A 1PGXA 2NCNA 4KDLB 1K50A 4J6IA 4H2AA 2XK5B 3U8ZA 4ZYSA 1IYFA 1KH0A 4M8MA 1H4RA 3AV8A 4US9A 2MBBB 4NQLB 2BKFA 5EE9A 4PYZA 1M4VA 3DBSA 4IWPA 4XGAB 3AEBB 4EZKA 4HLEA 2KC1A 1ZP0B 1DGJA 1TS2A 2KACA 4C00A 4C80A 4WJPA 4ACFA 2NTTA 4OVVA 3O13A 1C1YB 3RI7C 1J8CA 2MJEA 1UWXA 4IM0A 1TKYA 3ENEA 2KAJA 1WJ6A 2GBKA 2KHWB 1RRBA 1ZXIA 2LVOA 3ZIMA 3MC9A 1WXMA 1FRDA 2C7NB 3CSFA 3LDZE 3QWZB 1K8RB 3DOWA 4M8NA 2N9EB 3AEDB 2Y3AA 4F1SA 1N6ZA 3M63B 2O6VD 1A70A 2WXMA 3N20C 3DBHB 4YTMB 4TSSA 3J9CA 1WM3A 3NVZA 4RGTA 1Q10A 5BYQA 2BWFA 2DYMA 4ZRIA 4MGKE 2N9PC 3H6NA 3NVYA 2YEPF 2WDVB 3PZ7A 1QT9A 2LZ6A 1AWDA 2QEJC 5FR6A 2VRRB 2QMTA 2L0FA 1RFKA 4II3B 1SJHD 1WY8A 3UQAA 4HRSA 3HM6X 3A9KB 3HUIA 2WXPA 3Q8BA 3AE4B 3RYTA 4RNAA 1WFYA 2HJ8A 5CHFA 2NPTB 2FCNA 1C78A 4RF1A 2KT7A 3DHHC 1YMHE 1N63A 4CQNA 5HHDG 2NTSA 4PS8A 3W9CB 2LRUA 2WXOA 3ZRCA 4W9FA 4HK2A 3AH7A 3RMKC 1HTOA 2BTEA 5E6OA 4M02A 4A6QA 1FNVA 4FN2A 1EF1A 2CR5A 3AE9B 3ZVVA 3DWMA 2L00B 3GOEA 2PE9A 1WXVA 3QX1A 1NYRA 2DZMA 2KO3A 4W9JA 4KV2A 1V86A 3DVGX 3UQBA 1MG4A 2IO1B 5E6PA 4BFRA 4GU2A 2FIDA 3RNCC 2KK8A 4GDLB 3I9V1 1UBIA 1KRHA 4IWOA 2C7MB 2K8HA 3HRDD 1OTRB 1L7YA 4E74A 4P16A 2IDYA 3QHTA 1V2YA 4RGMA 5C2TB 1R4MI 4MH0E 4DDID 3LXFA 1VDVA 2LASA 5CTRC 3W1YA 1EO6A 3V05A 3PRPB 2MLBA 1T6BX 1V9JA 2NR2A 4W9DA 4C56C 3AB5A 3SFEB 2AX5A 4A9AA 1ZDVA 1P3QU 4ZYNA 1L0YB 4JGHB 1HQRD 3ZTDA 2I38A 3L08A 4GGQA 1KM7A 2JSVX 1P1AA 2C9WB 5G5HA 3C19A 3L16A 2JZPA 2MBEA 2E6XA 2FNJB 3UINB 3HVDA 3R3MA 4ZHPA 2MQJA 3KQ4A 4OZBA 1I42A 2IY1B 2V4LA 3VH3B 3Q3NC 3Q2AC 5AUIA 1D6EC 1NBFC 4YT0B 2IGGA 3EUB2 4DXAB 3VRAB 2HJ1A 5C1ZA 3AE7B 1ZXHA 4WWNA 3NZUA 5KHQA 4JE3B 2YLMA 1XD3B 3QJZA 2DZJA 4EFOA 1KF6B 1GG3A 1XCQL 4ITKA 5J2RA 4TV3A 4I6LB 4E71A 2B76B 2LUEA 4WJNA 1D4BA 4LJPB 3NHEB 2JQRB 1AARA 1TS4A 2N7EA 3M3JA 4QAYA 3M62B 3QK0A 1I35A 1SE3A 3A33B 5T8IA 2G9HD 1DOYA 5DCNA 2AYOB 1CZPA 3RNAC 1V5OA 1C4AA 1FNWA 3ZDTA 4I6PA 2XK5A 5BMIA 1XLOA 4KZCA 4MDKE 1K51A 5H92C 3PHWB 1Y56A 2H88B 3TBLD 4OW0A 1EU4A 4TKNA 3B2GA 2EELA 2KTRB 5JH5C 1TZOA 1P9DU 3R7RA 2ZNVB 2DZKA 1XO3A 1KTKA 3MJWA 4C7YA 4AQ7A 3AE1B 3GP7A 3VQIA 3ZXRA 2W9NA 5EE3A 5J18A 2G4DB 1V6EA 1WJNA 1K52A 2ZNVC 2LGYA 4NAWB 4AWJA 1E6EB 1WI0A 2I1KA 1WMHA 3PV1A 1OGWA 2N4FA 1T0RC 4MT5A 5IP4D 2DYOA 2V3SA 2PKOA 1WSPA 1HZ6A 2J7QB 3BYTB 1IPGA 2LHDA 2ZPYA 4XZ4A 3QA8A 2L83A 3T3OA 1WXAA 5IN7A 2WYQA 3DBRB 2V3NA 4BBNF 3RFZB 1FM0D 1WWTA 3U52E 2PPHA 5EE1A 2BYFA 1YQ3B 3KH0A 3TSSA 1TS3A 1WX9A 3ONSA 4WWPA 1FD6A 2LGDA 5FK9C 1VZ8A 3DDCB 3DWGC 3VXWA 1YNTE 1WF9A 2Y5BB 1QILA 3UI3A 4FJVB 3OWEB 2OEDA 2CU1A 3FILB 2KWDA 2MBQA 4B0MA 3Q8EA 3VR8B 4RGNA 4NAMA 2N7DA 1XT9B 3VVWB 4NJ7A 2EKIA 1WGRA 2KMMA 1QKZA 2ZW0A 4JPSA 4KGTA 3R66C 2WDRB 1GC7A 3W1SC 1YX5B 4BKSD 4XDDA 3TEWA 2D3CA 3DHGC 2D11A 1F2RC 2LHEA 2K5PA 2KMAA 3GE3C 3NY5A 2JU6X 2ON8A 1FMAD 2BGFA 2MBHA 1L4DB 5LXHA 1YJJA 1KJTA 3NZSA 1V1PB 3Q14C 5LXIB 1WGDA 2KTFA 2K8CA 2IPKD 2KQSA 3H7PA 2LGIA 3CWIA 3BY4B 4AJYB 5C23A 4RM8A 4CYEA 4AJWA 2LUMA 3CMMB 5G5GA 1V49A 4LNOA 1SB3C 3ZDMC 4W9EA 1WH3A 1NI2A 1XF5L 1ACCA 1QF6A 3KUZA 2TSSA 4TQ0A 2K22A 2KLGA 4RM9A 3QIJA 2D2QA 5D2MB 1XLPA 3L54A 4ZHOA 1TT5B 4FXCA 2LVQA 3IAS1 4XDCA 2BS3B 2GOWA 1FCCC 2G4SA 1ZOYB 2KYWA 3BIID 4A3OA 3TEYA 1QQRA 2L52A 2W3RA 1Z2MA 1JWBD 1FO4A 1UF0A 3VAWA 5HFYA 1WGHA 3JYUA 2Z0DB 3K9OB 2WXIA 4HCPB 1YOVB 1K53A 1ET9A 3NRZA 2JUOA 4ZRQA 3ZW3A 4US8A 5E6JA 3QQ8B 2W55A 2K6DB 1TY2A 4OVUA 1WRIA 1HA5A 2KC2A 1N62A 2ASQA 2KFKB 1VRAB 2R2OA 1WMHB 1F1HA 3I3TB 2K25A 2R61A 2WXNA 2L76A 1FFUA 4WURA 2BYVE 2AL6A 4PK1A 4PYUA 5AZHA 3VTUA 5IKCM 2MBOA 2MJ3A 2OJWA 2VH2A 4G3XB 4NZLB 1D5ZC 2DNFA 1GB1A 3VR9B 2XBBC 4LK0M 1F9JA 3KYDD 5L95C 4EKUA 5G2NA 1YN5A 1TKGA 1Z5SB 3I63C 3R2TA 2WDQB 3KLSX 3EA6A 2M0XA 2AQ3B 1JWUD 4YSZB 1GC6A 2J52A 3MJ5A 3AEAB 3GE8C 2AL3A 4XE0A 1V1PA 4F8CB 1EWCA 3P42A 3PZ8A 2IBIB 2JXTA 3LYYA 1XQQA 2GI9A 1D5XC 2CHXA 3A1QB 2QHOA 2KX0A 4KIKB 1SGHA 3WA0A 3ZNGC 4EUTA 2MX2A 3Q3MC 3P4QB 2CKHB 2CU3A 4NPNA 1QOFA 2LGXA 2X8XX 2KWCA 4BOZB 2FAZA 4M0WA 3ALBA 2KFKA 1ZW7A 2K8BA 2CJOA 5BYRA 4B6WA 4MH8A 5JHAA 3BWUD 3NUHB 1GNUA 4UDUC 4GN1A 2D07B 3ZNHB 1TZ1A 3ZKJC 2LXAA 2V4IB 2L3ZA 5GXGB 3B2FA 3UGBB 2I1JA 3AEEB 3MHSD 4K3BA 3TIXA 1PQSA 2WU2B 3WALA 2WU5B 4FJYA 2WDTB 4K1RB 4N6EB 1ZKHA 1GB4A 2RMMA 1SE4A 1LM8B 3IFWB 3H9DA 1E9MA 1L6UA 5D3DA 2RDBC 5I4DA 2KLCA 1ZDXA 4RCOA 5AUKA 4YSXB 1E7PB 2RGFA 2K9XA 3BVZA 3KUDB 4MELA 1UBQA 4HPMB 1E90A 3IHPC 1MI0A 2VZKD 2BKRB 2L0TA 1LGRA 2JRIB 4G50A 3ML8A 1V81A 3VUWA 1V80A 2DLBA 3C8YA 2DHZA 2V3PA 3PPAA 3EGRA 4ANXA 3KWLA 1J7AA 1NENB 4HKZE 1E7UA 1I4PA 4FADA 1YJIA 4RH6A 2LGSA 2ZCCA 2SEBD 1N60A 2ZVOA 3DPDA 4OZAA 3AN1A 1GAQB 2DYBA 3PRMB 2QC8A 1OQQA 5IAAC 2N1WA 4W9LA 1QZEA 1SSNA 4W9KA 4RGOS 2IYDB 4YTPB 4L2YA 4YL8A 1IBXA 3V61A 1RFAA 2WXQA 4TQ1A 4IUMB 4N58A 1WGGA 3ZO5B 3U7ZA 2RDHA 1NYQA 2BPSA 1WIAA 2LD9A 2J42A 1J7BA 4RFBA 2KN5A 4HDQA 2KXJA 2KVZA 3L10B 1FNUA 2BW2A 3JSVB 3B9JA 2PLPA 3AI5A 2VZKB 4DBGA 1VR9A 3SHQA 2PVGC 1Q1OA 1HTQA 2KDIA 3DBRI 3MP9A 2RDGA 4KGRA 3APCA 1P0RA 3PTFC 3WANA 2OJRA 2W3SA 3AU4A 1FPYA 1QOBA 2O6VA 4URKA 4AOFA 3IAM1 2GB1A 3CSTA 2INCC 1SXTA 1YN3A 3Q8FA 4KGSA 3BVMA 2D5GA 1EM7A 1T3QA 2IO3B 3N1YC 3GZNB 2JX5A 2OOBB 5IOIA 4CHKA 4HJKA 1SEBD 3DVNU 5EE0A 4EE2A 3ZRFA 3FAHA 1N61A 1PGBA 3AEGB 2RD0A 3AE5B 3V62A 5JZEB 1QOAA 2M17A 4RMAA 1WM2A 2K3UA 2WP9B 3VH4B 3NVWA 4NY0A 3PS6A 3SD5A 2LXCA 2KWUB 4N9F4 4GMVA 3I57A 3AM9A 5BO4B 2NBVB 1L4ZB 3L0WB 2KQ4X 4GXBA 4EZLA 1XEEA 4A90A 2KDBA 4GOCA 4DQOC 4DWFA 3QARA 1WZ0A 2MW5A 4XX5A 1G6JA 3DCGA 2X38A 4LNKA 1UD7A 1V97A 1TJEA 2C60A 3RNBC 2D3AA 1C76A 2L7RA 5CHVC 3APFA 1NEKB 2WWZA 4L23A 2FUHB 2WX1A 2WGSA 3U4EG 2AQ2B 3PO0A 3W1SA 1E8WA 1SIJA 2KTRA 2ZJDA 2BB6A 3PVLA 3AMZA 4KSKC 2EMTA 1EWYC 2KWVB 2J0KA 1VCBA 4FJZA 1UELA 1VJKA 1D5MC 1JRPA 3NOBA 4M01A 4NJCA 3T8MA 2KN4A 5DPTA 3O65B 1WXSA 2KMCA 4IOIE 2NPTA 3VUYA 4ZRJA 1OEYA 4K7WA 2AQ1B 1ISNA 2CHZA 3FKYA 4JWSC 4BKGA 4WIPA 5TR5A 1E5WA 1F2RI 2PIAA 3EFUA 2FCQA 4DHZB 4KKIA 1P7EA 2L8JA 3SU8X 2ZW1A 4KDIC 4JIOU 5AZFA 3NG0A 4AUQC 1WR6E 4JQWC 2LFIA 4HXDA 4ZDVA 2WXRA 4KKJA 3AEFB 2RPQA 2KJHB 3AULA 5L83A 1NI3A 1MHHE 3EHVA 4G11A 3WIMA 2BS2B 3SDLC 2JT4B 3N1XC 2JF5A 2LEKA 1IUEA 2BT6A 3N3KB 2G1EA 1BT0A 3FC4A 4LNFA 2WQYB 3DBLB 2QSDA 1R4NB 1L6VA 3LJ3A 1MPEA 2GBMA 3ABVB 3QCAA 2DX5B 3KWVA 2FCSA 4FHJA 1SJED 3PREA 4MGZE 1Y8RC 2EMSA 4N59A 3VUXA 1UGMA 3A4RA 1XLQA 1YJ1A 1WE6A 2XN9C 2GMIC 3VDZA 2V0GA 2YVCA 3HK0A 2A5UA 2LMCA 4LJOB 1WX7A 2K39A 1JWMD 1LQBA 2MP2B 3RT3B 4NJ6A 2M56B 2QJLA 3A9KA 2VH1A 3WAMA 1YQ4B 3IT4B 3V6CB 4REZA 1L2NA 4HEA1 2KNBA 4DHZE 2AWTA 3PHXB 4XYCA 3RN9C 3DVGY 2G45B 3TEXA 3OLMD 1LXDA 1EUVB 3TEZA 1CQVA 4TMAB 3ZJTA 2BWES 2N9XA 1YN4A 2WLBA 3BYYB 3BK1A 1TIFA 5H8YE 3HIZA 1TKEA 4OHJA 4HPPA 1Q5WB 3B0AA 3PLVA 1E0ZA 1L5PA 4C4VB 2LRWA 1E8ZA 1RM6C 2UU7A 3N9YC 2C7HA 4MJSB 2BB5A 5CHWA 1IGDA 4EEWA 4IC7B 2MHJA 3ZTCA 3RNEC 2O2VA 1E7VA 1FFVA 2DAJA 1BXTA 2BVCA 3MHZA 4PS3A 1ZPSA 2KJ6A 1HE8A 2REXA 3N30A 3E9SA 2OHFA 1OQRA 1EF5A 1IGCA 3VRBB 2W82A 1ZUD2 2QIEB 4DK5A 4ZRKA 2JZZA 2LJIA 1WE7A 4ARIA 4BVUC 4W9GA 1GOZA 4GIVA 2HDEA 4C4VA 1WR1A 2LVPA 3K9PB 5HG2A 1FIQA 3IG3A 3RZWC 3EFCA 3N32A 3P2BA 3PLUA 2L32A 1N5XA 3NJTA 4EZJA 4M00A 2BYEA 5LNK1 1PFDA 1KLGD 2LJ5A 4IDIA 1NDDA 2WHIA 3A1QA 1JCKB 2ICIA 1L0XB 2IO0B 3V60A 2NS5A 2WXHA 2PE6B 1XCTL 4IM2A 4YXDB 3HHMA 4AP4C 2Z0EB 3GZNI 1FRRA 3T3NA 3KUCB 1E10A 1MFWA 4ANVA 2M0AA 2L1AA 5J17A 1WGYA 2K1FA 3LB8C 4IM3A 5JXVA 3EECA 4ARCA 2RSUA 4BAXA 5AZGA 5BYSA 3RCZA 4C7ZA 4DXFA 2J53A 4W9CA 4A55A 4IG7B 2ZVNA 3RPFC 1MVKA 2HE7A 2HTHA 3D32A 1XXGA 3C0RB 1VLBA 3OAWA 4MJSA 4YSYB 4FHKA 2MEKA 2AEHA 4XC2A 1OQYA 3IXSA 2DBYA 4A3PA 4OZCA 1IP9A 1FXAA 5BMHA 2IGHA 3Q3FA 1KLVA 1F52A 4O1NA 1E8XA 3Q69A 3VTVA 4MSMB 3X0WA 2JYEA 3CIRB 4JL9A 3KVFB 4P7IA 1WJUA 2WS3B 4D2KA 2V1YA 1X1MA 1C3TA 3Q3OC 1RYJA 1JALA 4MGIE 1KOTA 4GSWA 1SE2A 4KSLC 3TJPA 3Q3JA 1A5RA 3QAQA 1FEHA 4KVGB 4LTUA 2WXJA 1F77A 2UYZB 3ML9A 4WAAA 2M4NA 2FUG1 3AE2B 2Q5WD 2IZVB 3DHIC 2ACZB 4S0RA 4MM3A 1CMXB 3MFGA 2HD5B 1STEA 2GBJA 3OJ4B 4IWQA 2KANA 3RULA 3VFKA 1QLBB 4A20A 3DVNV 1JQ4A 1JWSD 3S2AA 1I4HA 3L13A 4WWMA 3DBHI 4WQOB 5JHBA 2PVOD 3H7PB 1V1OA 1ET6A 1MHXA 2KDMA 2BQQA 1P7FA 1YQBA 1SF0A 2ZEQA 1JW9D 2NBUA 1TS5A 4WWOA 2KVRA 4FLHA 3AXCA 3URYA 4WH4A 2K0PA 2DAFA 4WQMA 3ZNID 4LNIA 3WAPA 4RF0A 2INPE 3A9JB 2H89B 2D3GA 2Y5PA 1UWMA 5C3JB 2NMQA 1UZXB 1T0QC 1F0ZA 1PYWD 1CK1A 1RAXA 2MJDA 3AECB 5LLIA 3PRZA 2RR9A 2L05A 1AN8A 1R4MB 4XWWA 3W5UB 1VD2A 1PGAA 2PMVA 2PTLA 3R2IA 1WZ3A 3SR6A 3ECIA 1JMLA 1M94A 2W54A 4KX6B 1WX8A 1I4XA 3APDA 2DWQA 3UIOB 4BBNC 4II2B 1IBXB 2MWSB 2ONQA 1YD8U 3ETRA 1JRUA 2UWQA 4MM3B 4B95A 1S1QB 5AEKB 2BBCA 3DBLI 2KOXA 3P4RB 3AE8B 2KFJA 1OEYJ 2WXKA 1MG8A 3JSVA 1EU3A 2JWUA 5IO9A 1AYFA 5FR3A 3ZJVA 1WRDB 1C9FA 3RUIB 3RNFC 5HKHA 4LDTB 4L1BA 4I6NB 1GUAB 1DOXA 4YTNB 2IY0B 4DDGD 5HI1A 1ESFA 3W5VB 5D3IB 3UF8A 2IJ0A 4W9IA 3KYCD 3IBEA 3T9LA 3B1LX 4LCDE 1I4QA 2MSED 4FA6A 1ZE3D 2CS4A 2QILA 2JPHA 3UIPB 2WXGA 1R7SA 2PW9A 2J4XA 1ZGUB 3TUOA 3TL5A 2KX3A 4ICUA 4KZ0A 2O6VB 2KQ7A 5G55A 1TTNA 1L0VB 2NBWB 2WXFA 1WJ4A 2KD0A 5FKAC 1LO5D 4HJGE 3P63A 3X23A 4B9KA 4AS1A 4M0WB 2M1MA 2KDFB 3PGEA 3N1ZC 2INDC 1LFDA 1I4GA 3H1UA 4NNJB 3W2DA 2BS4B 2CHWA 1B9RA 4B0EA 1FXTB 2JYTA 1GPXA 1I7HA 1VZ7A 3IT6B 3NS1A 2KZRA 2MH7A 5E6NA 3R7QA 3PT2B 3SEBA 2B3AA 4F7ZA 5IA7A 1I4RA 2QCZA 3KW5B 1XLNA 5D7GA 1SE9A 4BOSC 4PS7A 4DHJD 2V9HA 4HPLB 4HCNB 3NVVA 3EC8A 1C4PA 1JWAD 2ZCBA 2BYTA 4MGYE 2MA9B 1BMLC 3AU5A 1PDXA 1YIWA 4JWUC 2J0MA 3AE6B 1UH6A 3P1MA 1N5WA 1S3SG 5D6JB 1T0YA 2WNMA 4KIKA 3DQVA 3TMPB 2JRHA 2N7JA 1VZ6A
chains in the Genus database with same CATH topology
1EF5A 3U7DA 3NS8A 4EOYA 2ZZPB 4NPNA 1P3QU 2XEWA 2LGXA 4ZYNA 3WAOA 4JGHB 2A4ZA 2KWCA 3ZTDA 4BOZB 2FAZA 3L08A 4DK5A 4GGQA 4FULA 3ALBA 4ZRKA 1KM7A 2JZZA 2GBRA 2KFKA 1P1AA 4ANUA 1WE7A 2C9WB 1ZW7A 2JXXA 2K8BA 4BVUC 4B6WA 3L16A 4HVBA 5JHAA 4W9GA 4GIVA 1GNUA 3A4SC 3A9JA 4GN1A 2D07B 3ZNHB 1TZ1A 1WR1A 2LVPA 2MBEA 3ZKJC 2LXAA 3K9PB 2FNJB 1J0GA 2L3ZA 1RLFA 3UINB 2MRPA 3MTNB 3IG3A 3R3MA 3RZWC 3N32A 3UGBB 3P2BA 2I1JA 2MQJA 3PLUA 4EZJA 3MHSD 3TIXA 2BYEA 1PQSA 2KKCA 3WALA 2LJ5A 1I42A 1TBEA 2WX0A 4K7SA 1NDDA 2IY1B 4FJYA 2JY6A 2V4LA 2WDTB 3A1QA 4K1RB 3VH3B 3ZUNA 1ZKHA 4X57B 2IO0B 1R4NI 3V60A 2NS5A 1LM8B 3IFWB 3H9DA 1NBFC 2PE6B 5EDSA 4DXAB 4IM2A 5C1ZA 2KLCA 3HHMA 4AP4C 4CO7A 2Z0EB 4WWNA 3GZNI 3NZUA 5KHQA 4NAWA 2YLMA 1XD3B 3QJZA 2DZJA 3KUCB 4EFOA 2RGFA 1GG3A 4ANVA 4BKSA 4HWIB 3KUDB 4MELA 5J17A 5J2RA 1WGYA 2K1FA 4TV3A 4I6LB 1UBQA 4HPMB 4E71A 1WYWB 4IM3A 1E90A 2LUEA 3EECA 4WJNA 4G0NB 3IHPC 3ZNZB 3B08A 4GDLA 2RSUA 2BKRB 5AZGA 4LJPB 2L0TA 3NHEB 2DZIA 2JRIB 4G50A 3ML8A 1V81A 3VUWA 3RCZA 1P98A 1V80A 2DHZA 1AARA 2MP2A 2N7EA 4W9CA 3PPAA 4IG7B 4ANXA 2ZVNA 3M3JA 2HE7A 1U4AA 2K6QA 3M62B 2M8SA 3QK0A 1E7UA 2HTHA 3D32A 3V6EB 4FADA 2N1VA 1I35A 3C0RB 3A33B 4WJQA 3OAWA 4MJSA 4MEMA 2GBNA 2ZCCA 2ZVOA 4FHKA 3DPDA 2JVCA 2AEHA 4XC2A 5DCNA 2AYOB 1OQYA 2DYBA 2Z59B 4ICVA 5KHOA 1V5OA 3PRMB 5IAAC 2LWPA 2N1WA 4W9LA 1QZEA 4W9KA 3ZDTA 4A3PA 1IP9A 2KDEB 4I6PA 4GB9A 3RD2A 2XK5A 2IYDB 4YL8A 3V61A 2LI5A 1RFAA 4IUMB 3HM3A 3L17A 4KZCA 3JW0X 1WGGA 3Q3FA 4MDKE 4TQ1A 5DPSA 1KLVA 3ZO5B 1YX6B 4LDTD 3CF6E 1E8XA 1WIAA 2BPSA 1TGZB 3M95A 3PHWB 2LD9A 4HDOA 2KN5A 3TBLD 4HDQA 1D3ZA 2KXJA 3VTVA 4TKNA 1E8YA 4MSMB 4W9HA 2MCNB 3X0WA 5CX3A 3OJ3A 3L10B 2KTRB 5JH5C 3JSVB 4JL9A 3KVFB 1P9DU 4P7IA 3AI5A 1WJUA 2EKEC 3H7SA 4DBGA 2V1YA 1V5TA 1X1MA 2ZPNA 3R7RA 1C3TA 4TUUA 2ZNVB 4MGIE 1KOTA 3SHQA 2R2QA 2DZKA 3BINA 4GSWA 1Q1OA 3VTWA 2KDIA 4KSLC 3DBRI 3TJPA 3Q3JA 3APCA 3IVFA 1A5RA 1P0RA 4BKTA 3PTFC 3QAQA 4K7UA 3WANA 2OJRA 4KVGB 3MJWA 3AU4A 2UYZB 3PZDA 1GJZA 3ML9A 2J0JA 4WAAA 2M4NA 3ZLZA 2KJRA 4GDKA 2O6VA 1H8CA 2DENB 4URKA 4AOFA 3VQIA 5DPRA 2W9NA 3CSTA 2G4DB 5J18A 4GDKB 2IZVB 1V6EA 1WJNA 4MM3A 4NQKE 2ZNVC 2LGYA 4NAWB 4AWJA 2IO3B 1WI0A 4WJOA 1CMXB 1WMHA 2I1KA 1OGWA 3PV1A 2HD5B 2N4FA 3U30A 4ANWA 3QC8B 2DYOA 2GBJA 2OOBB 2BF8B 2V3SA 3OJ4B 3PSEB 4DHJB 2J7QB 4IWQA 1IPGA 4ASWC 2KANA 4XZ4A 2ZPYA 3QA8A 4CHKA 4HJKA 3RULA 3VFKA 3DVNU 2IO2B 3ZRFA 4A20A 2O2VB 5D94A 3DVNV 1WXAA 2WYQA 1J19A 4K81A 3S2AA 4BBNF 3L13A 2RD0A 3DBHI 1SIFA 2JWZA 4WQOB 2PPHA 3V62A 5JZEB 5JHBA 4MSQB 2M17A 4RMAA 1WM2A 2BYFA 3JVZX 3H7PB 3KH0A 4JLCA 2JZ3B 3VH4B 4E3CA 1WX9A 2PJHA 2PEAA 3ONSA 3TCAA 4NY0A 3PS6A 3SD5A 2LXCA 2NVUI 2KWUB 4N9F4 4GMVA 4WWPA 2C5LC 5BO4B 2LGDA 2NBVB 3VHTC 1YQBA 3L0WB 4GXBA 4EZLA 2KDBA 2ZEQA 4GOCA 2FIFA 3DDCB 5GMVA 2G3QB 4FBJB 3VXWA 2D10A 2NBUA 1WF9A 2Y5BB 4DWFA 3QARA 1WZ0A 4FJVB 4WWOA 2MW5A 2CU1A 2KVRA 4FLHA 4XX5A 1G6JA 3DCGA 2MBQA 3AXCA 1Q0WB 1UD7A 4IW0A 2DAFA 2C60A 3ZNID 3RZFA 3WAPA 2FCMA 5CHVC 2L7RA 5DPWA 2N7DA 3A9JB 1XT9B 3APFA 3VVWB 2WWZA 2NCNA 4KDLB 4NJ7A 2D3GA 4J6IA 1WGRA 2XK5B 3U8ZA 2FUHB 1UZXB 1IYFA 2WX1A 4M8MA 1H4RA 3R66C 2MBBB 4NQLB 2BKFA 1GC7A 3W1SA 1E8WA 3W1SC 1RAXA 2KTRA 2ZJDA 4PYZA 5LLIA 3PRZA 2RR9A 2L05A 1YX5B 3DBSA 4IWPA 3PVLA 4BKSD 4EZKA 1VD2A 2EMTA 4KSKC 4HLEA 2D11A 2KC1A 2KWVB 2J0KA 1VCBA 4FJZA 2KMAA 3NY5A 1UELA 1WZ3A 3NOBA 3ECIA 4WJPA 2BGFA 1M94A 2MBHA 3T8MA 5DPTA 5LXHA 3O65B 1WXSA 2KMCA 4OVVA 1C1YB 1KJTA 1WX8A 3NZSA 1J8CA 2NPTA 3APDA 4IM0A 3VUYA 3ENEA 3UIOB 4ZRJA 1OEYA 4K7WA 4BBNC 4II2B 1WGDA 2MWSB 5LXIB 2KTFA 2K8CA 1ISNA 1YD8U 2KQSA 1WJ6A 2CHZA 1JRUA 3H7PA 2GBKA 2KHWB 2UWQA 4BKGA 3BY4B 4AJYB 5C23A 1RRBA 4RM8A 5TR5A 4B95A 2LVOA 1S1QB 3ZIMA 4CYEA 5AEKB 1E5WA 1WXMA 3DBLI 4AJWA 2C7NB 3EFUA 2FCQA 2KOXA 3CMMB 3CSFA 1V49A 3LDZE 3QWZB 3ZDMC 1K8RB 4DHZB 2KFJA 4W9EA 3DOWA 4M8NA 2N9EB 1NI2A 1OEYJ 1WH3A 4F1SA 2L8JA 3M63B 2O6VD 3KUZA 3SU8X 1MG8A 3JSVA 4TQ0A 2KLGA 1WRDB 4KDIC 4JIOU 1WM3A 5AZFA 4AUQC 1WR6E 2BWFA 4JQWC 4RM9A 3QIJA 2DYMA 4HXDA 3RUIB 4ZDVA 4ZRIA 5HKHA 2D2QA 5D2MB 3L54A 4LDTB 2RPQA 2KJHB 3AULA 4MGKE 5L83A 2N9PC 3H6NA 3EHVA 2LVQA 4G11A 4I6NB 1GUAB 2LZ6A 3SDLC 2GOWA 3WIMA 2IY0B 2JT4B 4DDGD 5FR6A 2G4SA 2VRRB 2JF5A 2L0FA 3UF8A 4II3B 1WY8A 4W9IA 3KYCD 3N3KB 1BT0A 4A3OA 3UQAA 3HM6X 3IBEA 3A9KB 1Z2MA 3T9LA 3RYTA 3B1LX 4LCDE 2MSED 3LJ3A 1WFYA 2HJ8A 2GBMA 3VAWA 1WGHA 2NPTB 3JYUA 5CHFA 4FA6A 3QCAA 2DX5B 2FCNA 2CS4A 2FCSA 2Z0DB 3K9OB 4FHJA 3PREA 4MGZE 1Y8RC 2EMSA 4HCPB 3VUXA 3ZW3A 1UGMA 2JUOA 2JPHA 3A4RA 3UIPB 1YJ1A 1WE6A 2GMIC 1ZGUB 3QQ8B 3VDZA 2YVCA 2KX3A 3TL5A 4PS8A 3HK0A 2A5UA 4ICUA 2K6DB 4KZ0A 2LRUA 2KC2A 4OVUA 4LJOB 1WX7A 2K39A 2O6VB 3ZRCA 4W9FA 2ASQA 2KFKB 2KQ7A 5G55A 1LQBA 2MP2B 2R2OA 4HK2A 1WMHB 1TTNA 3RT3B 3I3TB 4NJ6A 3A9KA 2K25A 3WAMA 5E6OA 2NBWB 2L76A 3V6CB 1WJ4A 4FN2A 2KD0A 1EF1A 2CR5A 1L2NA 3ZVVA 2BYVE 3X23A 4B9KA 2AL6A 2L00B 3GOEA 4M0WB 2KNBA 2M1MA 4PYUA 2KDFB 2PE9A 3PGEA 5AZHA 1WXVA 3QX1A 4DHZE 2AWTA 3PHXB 3VTUA 2DZMA 3DVGY 2MBOA 1LFDA 2G45B 2KO3A 4W9JA 3OLMD 4KV2A 1LXDA 1EUVB 4G3XB 1V86A 3DVGX 3UQBA 2IO1B 5E6PA 3H1UA 4NNJB 4BFRA 2XBBC 4GU2A 2BWES 2N9XA 1F9JA 2CHWA 2FIDA 3KYDD 5L95C 1FXTB 4EKUA 3HIZA 2KK8A 5G2NA 4GDLB 1Z5SB 1Q5WB 2KZRA 3B0AA 3PLVA 1UBIA 2LRWA 5E6NA 1E8ZA 2M0XA 4IWOA 3R7QA 2C7MB 2K8HA 3PT2B 2B3AA 2C7HA 1OTRB 4F7ZA 5IA7A 1L7YA 4MJSB 1GC6A 4E74A 3KW5B 1V2YA 3QHTA 5CHWA 5D7GA 1SE9A 4EEWA 2AL3A 4BOSC 4PS7A 4DHJD 4F8CB 4HPLB 4HCNB 4IC7B 1R4MI 2IBIB 3EC8A 2ZCBA 4MH0E 3ZTCA 1XQQA 4DDID 2LASA 2CHXA 5CTRC 4MGYE 2O2VA 2MA9B 3W1YA 1E7VA 3AU5A 3A1QB 2QHOA 2KX0A 1YIWA 4KIKB 1EO6A 1SGHA 3WA0A 2DAJA 2J0MA 3ZNGC 4EUTA 1UH6A 3PRPB 2MLBA 1V9JA 2NR2A 2MX2A 1S3SG 4PS3A 5D6JB 1T0YA 4W9DA 2KJ6A 4KIKA 2CKHB 1HE8A 2REXA 3DQVA 2JRHA 3N30A 3TMPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EF5 A;  3U7D A;  3NS8 A;  4EOY A;  2ZZP B;  4NPN A;  1P3Q U;  2XEW A;  2LGX A;  4ZYN A;  3WAO A;  4JGH B;  2A4Z A;  2KWC A;  3ZTD A;  4BOZ B;  2FAZ A;  3L08 A;  4DK5 A;  4GGQ A;  4FUL A;  3ALB A;  4ZRK A;  1KM7 A;  2JZZ A;  2GBR A;  2KFK A;  1P1A A;  4ANU A;  1WE7 A;  2C9W B;  1ZW7 A;  2JXX A;  2K8B A;  4BVU C;  4B6W A;  3L16 A;  4HVB A;  5JHA A;  4W9G A;  4GIV A;  1GNU A;  3A4S C;  3A9J A;  4GN1 A;  2D07 B;  3ZNH B;  1TZ1 A;  1WR1 A;  2LVP A;  2MBE A;  3ZKJ C;  2LXA A;  3K9P B;  2FNJ B;  1J0G A;  2L3Z A;  1RLF A;  3UIN B;  2MRP A;  3MTN B;  3IG3 A;  3R3M A;  3RZW C;  3N32 A;  3UGB B;  3P2B A;  2I1J A;  2MQJ A;  3PLU A;  4EZJ A;  3MHS D;  3TIX A;  2BYE A;  1PQS A;  2KKC A;  3WAL A;  2LJ5 A;  1I42 A;  1TBE A;  2WX0 A;  4K7S A;  1NDD A;  2IY1 B;  4FJY A;  2JY6 A;  2V4L A;  2WDT B;  3A1Q A;  4K1R B;  3VH3 B;  3ZUN A;  1ZKH A;  4X57 B;  2IO0 B;  1R4N I;  3V60 A;  2NS5 A;  1LM8 B;  3IFW B;  3H9D A;  1NBF C;  2PE6 B;  5EDS A;  4DXA B;  4IM2 A;  5C1Z A;  2KLC A;  3HHM A;  4AP4 C;  4CO7 A;  2Z0E B;  4WWN A;  3GZN I;  3NZU A;  5KHQ A;  4NAW A;  2YLM A;  1XD3 B;  3QJZ A;  2DZJ A;  3KUC B;  4EFO A;  2RGF A;  1GG3 A;  4ANV A;  4BKS A;  4HWI B;  3KUD B;  4MEL A;  5J17 A;  5J2R A;  1WGY A;  2K1F A;  4TV3 A;  4I6L B;  1UBQ A;  4HPM B;  4E71 A;  1WYW B;  4IM3 A;  1E90 A;  2LUE A;  3EEC A;  4WJN A;  4G0N B;  3IHP C;  3ZNZ B;  3B08 A;  4GDL A;  2RSU A;  2BKR B;  5AZG A;  4LJP B;  2L0T A;  3NHE B;  2DZI A;  2JRI B;  4G50 A;  3ML8 A;  1V81 A;  3VUW A;  3RCZ A;  1P98 A;  1V80 A;  2DHZ A;  1AAR A;  2MP2 A;  2N7E A;  4W9C A;  3PPA A;  4IG7 B;  4ANX A;  2ZVN A;  3M3J A;  2HE7 A;  1U4A A;  2K6Q A;  3M62 B;  2M8S A;  3QK0 A;  1E7U A;  2HTH A;  3D32 A;  3V6E B;  4FAD A;  2N1V A;  1I35 A;  3C0R B;  3A33 B;  4WJQ A;  3OAW A;  4MJS A;  4MEM A;  2GBN A;  2ZCC A;  2ZVO A;  4FHK A;  3DPD A;  2JVC A;  2AEH A;  4XC2 A;  5DCN A;  2AYO B;  1OQY A;  2DYB A;  2Z59 B;  4ICV A;  5KHO A;  1V5O A;  3PRM B;  5IAA C;  2LWP A;  2N1W A;  4W9L A;  1QZE A;  4W9K A;  3ZDT A;  4A3P A;  1IP9 A;  2KDE B;  4I6P A;  4GB9 A;  3RD2 A;  2XK5 A;  2IYD B;  4YL8 A;  3V61 A;  2LI5 A;  1RFA A;  4IUM B;  3HM3 A;  3L17 A;  4KZC A;  3JW0 X;  1WGG A;  3Q3F A;  4MDK E;  4TQ1 A;  5DPS A;  1KLV A;  3ZO5 B;  1YX6 B;  4LDT D;  3CF6 E;  1E8X A;  1WIA A;  2BPS A;  1TGZ B;  3M95 A;  3PHW B;  2LD9 A;  4HDO A;  2KN5 A;  3TBL D;  4HDQ A;  1D3Z A;  2KXJ A;  3VTV A;  4TKN A;  1E8Y A;  4MSM B;  4W9H A;  2MCN B;  3X0W A;  5CX3 A;  3OJ3 A;  3L10 B;  2KTR B;  5JH5 C;  3JSV B;  4JL9 A;  3KVF B;  1P9D U;  4P7I A;  3AI5 A;  1WJU A;  2EKE C;  3H7S A;  4DBG A;  2V1Y A;  1V5T A;  1X1M A;  2ZPN A;  3R7R A;  1C3T A;  4TUU A;  2ZNV B;  4MGI E;  1KOT A;  3SHQ A;  2R2Q A;  2DZK A;  3BIN A;  4GSW A;  1Q1O A;  3VTW A;  2KDI A;  4KSL C;  3DBR I;  3TJP A;  3Q3J A;  3APC A;  3IVF A;  1A5R A;  1P0R A;  4BKT A;  3PTF C;  3QAQ A;  4K7U A;  3WAN A;  2OJR A;  4KVG B;  3MJW A;  3AU4 A;  2UYZ B;  3PZD A;  1GJZ A;  3ML9 A;  2J0J A;  4WAA A;  2M4N A;  3ZLZ A;  2KJR A;  4GDK A;  2O6V A;  1H8C A;  2DEN B;  4URK A;  4AOF A;  3VQI A;  5DPR A;  2W9N A;  3CST A;  2G4D B;  5J18 A;  4GDK B;  2IZV B;  1V6E A;  1WJN A;  4MM3 A;  4NQK E;  2ZNV C;  2LGY A;  4NAW B;  4AWJ A;  2IO3 B;  1WI0 A;  4WJO A;  1CMX B;  1WMH A;  2I1K A;  1OGW A;  3PV1 A;  2HD5 B;  2N4F A;  3U30 A;  4ANW A;  3QC8 B;  2DYO A;  2GBJ A;  2OOB B;  2BF8 B;  2V3S A;  3OJ4 B;  3PSE B;  4DHJ B;  2J7Q B;  4IWQ A;  1IPG A;  4ASW C;  2KAN A;  4XZ4 A;  2ZPY A;  3QA8 A;  4CHK A;  4HJK A;  3RUL A;  3VFK A;  3DVN U;  2IO2 B;  3ZRF A;  4A20 A;  2O2V B;  5D94 A;  3DVN V;  1WXA A;  2WYQ A;  1J19 A;  4K81 A;  3S2A A;  4BBN F;  3L13 A;  2RD0 A;  3DBH I;  1SIF A;  2JWZ A;  4WQO B;  2PPH A;  3V62 A;  5JZE B;  5JHB A;  4MSQ B;  2M17 A;  4RMA A;  1WM2 A;  2BYF A;  3JVZ X;  3H7P B;  3KH0 A;  4JLC A;  2JZ3 B;  3VH4 B;  4E3C A;  1WX9 A;  2PJH A;  2PEA A;  3ONS A;  3TCA A;  4NY0 A;  3PS6 A;  3SD5 A;  2LXC A;  2NVU I;  2KWU B;  4N9F 4;  4GMV A;  4WWP A;  2C5L C;  5BO4 B;  2LGD A;  2NBV B;  3VHT C;  1YQB A;  3L0W B;  4GXB A;  4EZL A;  2KDB A;  2ZEQ A;  4GOC A;  2FIF A;  3DDC B;  5GMV A;  2G3Q B;  4FBJ B;  3VXW A;  2D10 A;  2NBU A;  1WF9 A;  2Y5B B;  4DWF A;  3QAR A;  1WZ0 A;  4FJV B;  4WWO A;  2MW5 A;  2CU1 A;  2KVR A;  4FLH A;  4XX5 A;  1G6J A;  3DCG A;  2MBQ A;  3AXC A;  1Q0W B;  1UD7 A;  4IW0 A;  2DAF A;  2C60 A;  3ZNI D;  3RZF A;  3WAP A;  2FCM A;  5CHV C;  2L7R A;  5DPW A;  2N7D A;  3A9J B;  1XT9 B;  3APF A;  3VVW B;  2WWZ A;  2NCN A;  4KDL B;  4NJ7 A;  2D3G A;  4J6I A;  1WGR A;  2XK5 B;  3U8Z A;  2FUH B;  1UZX B;  1IYF A;  2WX1 A;  4M8M A;  1H4R A;  3R66 C;  2MBB B;  4NQL B;  2BKF A;  1GC7 A;  3W1S A;  1E8W A;  3W1S C;  1RAX A;  2KTR A;  2ZJD A;  4PYZ A;  5LLI A;  3PRZ A;  2RR9 A;  2L05 A;  1YX5 B;  3DBS A;  4IWP A;  3PVL A;  4BKS D;  4EZK A;  1VD2 A;  2EMT A;  4KSK C;  4HLE A;  2D11 A;  2KC1 A;  2KWV B;  2J0K A;  1VCB A;  4FJZ A;  2KMA A;  3NY5 A;  1UEL A;  1WZ3 A;  3NOB A;  3ECI A;  4WJP A;  2BGF A;  1M94 A;  2MBH A;  3T8M A;  5DPT A;  5LXH A;  3O65 B;  1WXS A;  2KMC A;  4OVV A;  1C1Y B;  1KJT A;  1WX8 A;  3NZS A;  1J8C A;  2NPT A;  3APD A;  4IM0 A;  3VUY A;  3ENE A;  3UIO B;  4ZRJ A;  1OEY A;  4K7W A;  4BBN C;  4II2 B;  1WGD A;  2MWS B;  5LXI B;  2KTF A;  2K8C A;  1ISN A;  1YD8 U;  2KQS A;  1WJ6 A;  2CHZ A;  1JRU A;  3H7P A;  2GBK A;  2KHW B;  2UWQ A;  4BKG A;  3BY4 B;  4AJY B;  5C23 A;  1RRB A;  4RM8 A;  5TR5 A;  4B95 A;  2LVO A;  1S1Q B;  3ZIM A;  4CYE A;  5AEK B;  1E5W A;  1WXM A;  3DBL I;  4AJW A;  2C7N B;  3EFU A;  2FCQ A;  2KOX A;  3CMM B;  3CSF A;  1V49 A;  3LDZ E;  3QWZ B;  3ZDM C;  1K8R B;  4DHZ B;  2KFJ A;  4W9E A;  3DOW A;  4M8N A;  2N9E B;  1NI2 A;  1OEY J;  1WH3 A;  4F1S A;  2L8J A;  3M63 B;  2O6V D;  3KUZ A;  3SU8 X;  1MG8 A;  3JSV A;  4TQ0 A;  2KLG A;  1WRD B;  4KDI C;  4JIO U;  1WM3 A;  5AZF A;  4AUQ C;  1WR6 E;  2BWF A;  4JQW C;  4RM9 A;  3QIJ A;  2DYM A;  4HXD A;  3RUI B;  4ZDV A;  4ZRI A;  5HKH A;  2D2Q A;  5D2M B;  3L54 A;  4LDT B;  2RPQ A;  2KJH B;  3AUL A;  4MGK E;  5L83 A;  2N9P C;  3H6N A;  3EHV A;  2LVQ A;  4G11 A;  4I6N B;  1GUA B;  2LZ6 A;  3SDL C;  2GOW A;  3WIM A;  2IY0 B;  2JT4 B;  4DDG D;  5FR6 A;  2G4S A;  2VRR B;  2JF5 A;  2L0F A;  3UF8 A;  4II3 B;  1WY8 A;  4W9I A;  3KYC D;  3N3K B;  1BT0 A;  4A3O A;  3UQA A;  3HM6 X;  3IBE A;  3A9K B;  1Z2M A;  3T9L A;  3RYT A;  3B1L X;  4LCD E;  2MSE D;  3LJ3 A;  1WFY A;  2HJ8 A;  2GBM A;  3VAW A;  1WGH A;  2NPT B;  3JYU A;  5CHF A;  4FA6 A;  3QCA A;  2DX5 B;  2FCN A;  2CS4 A;  2FCS A;  2Z0D B;  3K9O B;  4FHJ A;  3PRE A;  4MGZ E;  1Y8R C;  2EMS A;  4HCP B;  3VUX A;  3ZW3 A;  1UGM A;  2JUO A;  2JPH A;  3A4R A;  3UIP B;  1YJ1 A;  1WE6 A;  2GMI C;  1ZGU B;  3QQ8 B;  3VDZ A;  2YVC A;  2KX3 A;  3TL5 A;  4PS8 A;  3HK0 A;  2A5U A;  4ICU A;  2K6D B;  4KZ0 A;  2LRU A;  2KC2 A;  4OVU A;  4LJO B;  1WX7 A;  2K39 A;  2O6V B;  3ZRC A;  4W9F A;  2ASQ A;  2KFK B;  2KQ7 A;  5G55 A;  1LQB A;  2MP2 B;  2R2O A;  4HK2 A;  1WMH B;  1TTN A;  3RT3 B;  3I3T B;  4NJ6 A;  3A9K A;  2K25 A;  3WAM A;  5E6O A;  2NBW B;  2L76 A;  3V6C B;  1WJ4 A;  4FN2 A;  2KD0 A;  1EF1 A;  2CR5 A;  1L2N A;  3ZVV A;  2BYV E;  3X23 A;  4B9K A;  2AL6 A;  2L00 B;  3GOE A;  4M0W B;  2KNB A;  2M1M A;  4PYU A;  2KDF B;  2PE9 A;  3PGE A;  5AZH A;  1WXV A;  3QX1 A;  4DHZ E;  2AWT A;  3PHX B;  3VTU A;  2DZM A;  3DVG Y;  2MBO A;  1LFD A;  2G45 B;  2KO3 A;  4W9J A;  3OLM D;  4KV2 A;  1LXD A;  1EUV B;  4G3X B;  1V86 A;  3DVG X;  3UQB A;  2IO1 B;  5E6P A;  3H1U A;  4NNJ B;  4BFR A;  2XBB C;  4GU2 A;  2BWE S;  2N9X A;  1F9J A;  2CHW A;  2FID A;  3KYD D;  5L95 C;  1FXT B;  4EKU A;  3HIZ A;  2KK8 A;  5G2N A;  4GDL B;  1Z5S B;  1Q5W B;  2KZR A;  3B0A A;  3PLV A;  1UBI A;  2LRW A;  5E6N A;  1E8Z A;  2M0X A;  4IWO A;  3R7Q A;  2C7M B;  2K8H A;  3PT2 B;  2B3A A;  2C7H A;  1OTR B;  4F7Z A;  5IA7 A;  1L7Y A;  4MJS B;  1GC6 A;  4E74 A;  3KW5 B;  1V2Y A;  3QHT A;  5CHW A;  5D7G A;  1SE9 A;  4EEW A;  2AL3 A;  4BOS C;  4PS7 A;  4DHJ D;  4F8C B;  4HPL B;  4HCN B;  4IC7 B;  1R4M I;  2IBI B;  3EC8 A;  2ZCB A;  4MH0 E;  3ZTC A;  1XQQ A;  4DDI D;  2LAS A;  2CHX A;  5CTR C;  4MGY E;  2O2V A;  2MA9 B;  3W1Y A;  1E7V A;  3AU5 A;  3A1Q B;  2QHO A;  2KX0 A;  1YIW A;  4KIK B;  1EO6 A;  1SGH A;  3WA0 A;  2DAJ A;  2J0M A;  3ZNG C;  4EUT A;  1UH6 A;  3PRP B;  2MLB A;  1V9J A;  2NR2 A;  2MX2 A;  1S3S G;  4PS3 A;  5D6J B;  1T0Y A;  4W9D A;  2KJ6 A;  4KIK A;  2CKH B;  1HE8 A;  2REX A;  3DQV A;  2JRH A;  3N30 A;  3TMP B; 
#chains in the Genus database with same CATH topology
 2N0S B;  2GLS A;  4DXG A;  1UUP A;  3U7D A;  3NS8 A;  4EOY A;  2ZZP B;  2XEW A;  4ZOH C;  3WAO A;  2A4Z A;  4FUL A;  2GBR A;  4WAF A;  4ANU A;  2I2Y A;  2JXX A;  4BZA A;  1OFF A;  4HVB A;  3A9J A;  3A4S C;  2FE8 A;  3NZ3 A;  3ZXV A;  4HKQ A;  1J0G A;  1RLF A;  2MRP A;  3MTN B;  2D3B A;  1FCL A;  3P4S B;  4MAC A;  4LNN A;  2KKC A;  4YWG G;  4GLS C;  1TBE A;  2WX0 A;  1CJE A;  4K7S A;  2JY6 A;  3ZUN A;  4X57 B;  3I5J C;  1R4N I;  5EDS A;  4CO7 A;  1T5X D;  4NAW A;  4OVZ A;  1TYG B;  1HZ5 A;  1RWS A;  4BKS A;  1ENF A;  4HWI B;  2INN E;  1MJD A;  2CJN A;  1J7C A;  1WYW B;  3ZNZ B;  4G0N B;  3B08 A;  3BZD B;  4GDL A;  2DZI A;  4J3O D;  1P98 A;  2IGD A;  1WXQ A;  2MP2 A;  3ZYY X;  2HTM E;  3RNG C;  3GS2 A;  1U4A A;  2K6Q A;  2M8S A;  3MC0 B;  1UGJ A;  3V6E B;  2N1V A;  2E3T A;  3GB1 A;  4WJQ A;  1SBB B;  4S17 A;  1JRO A;  4MEM A;  2WXL A;  2GBN A;  1FXI A;  4A8X C;  2JVC A;  4K3C A;  2Z59 B;  4ICV A;  5KHO A;  2Z8L A;  2LWP A;  3Q6B A;  2XNA C;  2KDE B;  4GB9 A;  3ZJU A;  3RD2 A;  5BMG A;  1C77 A;  3BVG A;  2LI5 A;  5DPS A;  3HM3 A;  3L17 A;  3JW0 X;  1NVI D;  1YX6 B;  4LDT D;  4P1C C;  3CF6 E;  3L4P A;  3M95 A;  1TGZ B;  4HDO A;  2YEP B;  3MC8 A;  1D3Z A;  1E8Y A;  4W9H A;  2MCN B;  1TY0 A;  5CX3 A;  3OJ3 A;  4R3D A;  3SFD B;  3P4P B;  1PUT A;  1KLU D;  2N9L A;  2EKE C;  3H7S A;  1V5T A;  2ZPN A;  4HRO A;  4TUU A;  2QDF A;  2R2Q A;  3BIN A;  3VTW A;  1DOI A;  4IKG A;  3ZGZ A;  1WYG A;  3IVF A;  4BKT A;  4K7U A;  3H8H A;  3PZD A;  1GJZ A;  4JX1 C;  2J0J A;  1H8C A;  3ZLZ A;  2KJR A;  4GDK A;  2DEN B;  5DPR A;  4GDK B;  3WCQ A;  1ROE A;  1WGK A;  4P6V F;  1T0S C;  1KFY B;  2FBW B;  4NQK E;  5MPO A;  2GRI A;  1DYQ A;  4WJO A;  3BK2 A;  1B1Z A;  3U30 A;  4ANW A;  3QC8 B;  3FIL A;  3OG5 A;  1V8C A;  2BF8 B;  4DHJ B;  3PSE B;  3AE3 B;  4ASW C;  3E56 A;  2IO2 B;  1QOG A;  2O2V B;  5D94 A;  4ZRP A;  1J19 A;  4K81 A;  4LLG M;  3Q8C A;  2N9K A;  1SIF A;  2JWZ A;  4MSQ B;  3JVZ X;  4JLC A;  2JZ3 B;  4E3C A;  4USA A;  1HEZ E;  2PJH A;  2PEA A;  3TCA A;  2NVU I;  1C4C A;  4XWT A;  5TSS A;  2C5L C;  3Q8A A;  3HVZ A;  4P1B C;  2RPV A;  3R8B A;  3VHT C;  5GMV A;  3ZQ4 A;  2FIF A;  1UNS A;  2G3Q B;  4FBJ B;  2D10 A;  4PT5 A;  2Y5C A;  1BUI C;  1Q0W B;  1AW7 A;  4IW0 A;  2SAK A;  3V3X A;  1HXY D;  4Q2J A;  3RZF A;  5DPW A;  2FCM A;  2M19 A;  3U2S C;  1C79 A;  1PGX A;  2NCN A;  4KDL B;  1K50 A;  4J6I A;  4H2A A;  2XK5 B;  3U8Z A;  4ZYS A;  1IYF A;  1KH0 A;  4M8M A;  1H4R A;  3AV8 A;  4US9 A;  2MBB B;  4NQL B;  2BKF A;  5EE9 A;  4PYZ A;  1M4V A;  3DBS A;  4IWP A;  4XGA B;  3AEB B;  4EZK A;  4HLE A;  2KC1 A;  1ZP0 B;  1DGJ A;  1TS2 A;  2KAC A;  4C00 A;  4C80 A;  4WJP A;  4ACF A;  2NTT A;  4OVV A;  3O13 A;  1C1Y B;  3RI7 C;  1J8C A;  2MJE A;  1UWX A;  4IM0 A;  1TKY A;  3ENE A;  2KAJ A;  1WJ6 A;  2GBK A;  2KHW B;  1RRB A;  1ZXI A;  2LVO A;  3ZIM A;  3MC9 A;  1WXM A;  1FRD A;  2C7N B;  3CSF A;  3LDZ E;  3QWZ B;  1K8R B;  3DOW A;  4M8N A;  2N9E B;  3AED B;  2Y3A A;  4F1S A;  1N6Z A;  3M63 B;  2O6V D;  1A70 A;  2WXM A;  3N20 C;  3DBH B;  4YTM B;  4TSS A;  3J9C A;  1WM3 A;  3NVZ A;  4RGT A;  1Q10 A;  5BYQ A;  2BWF A;  2DYM A;  4ZRI A;  4MGK E;  2N9P C;  3H6N A;  3NVY A;  2YEP F;  2WDV B;  3PZ7 A;  1QT9 A;  2LZ6 A;  1AWD A;  2QEJ C;  5FR6 A;  2VRR B;  2QMT A;  2L0F A;  1RFK A;  4II3 B;  1SJH D;  1WY8 A;  3UQA A;  4HRS A;  3HM6 X;  3A9K B;  3HUI A;  2WXP A;  3Q8B A;  3AE4 B;  3RYT A;  4RNA A;  1WFY A;  2HJ8 A;  5CHF A;  2NPT B;  2FCN A;  1C78 A;  4RF1 A;  2KT7 A;  3DHH C;  1YMH E;  1N63 A;  4CQN A;  5HHD G;  2NTS A;  4PS8 A;  3W9C B;  2LRU A;  2WXO A;  3ZRC A;  4W9F A;  4HK2 A;  3AH7 A;  3RMK C;  1HTO A;  2BTE A;  5E6O A;  4M02 A;  4A6Q A;  1FNV A;  4FN2 A;  1EF1 A;  2CR5 A;  3AE9 B;  3ZVV A;  3DWM A;  2L00 B;  3GOE A;  2PE9 A;  1WXV A;  3QX1 A;  1NYR A;  2DZM A;  2KO3 A;  4W9J A;  4KV2 A;  1V86 A;  3DVG X;  3UQB A;  1MG4 A;  2IO1 B;  5E6P A;  4BFR A;  4GU2 A;  2FID A;  3RNC C;  2KK8 A;  4GDL B;  3I9V 1;  1UBI A;  1KRH A;  4IWO A;  2C7M B;  2K8H A;  3HRD D;  1OTR B;  1L7Y A;  4E74 A;  4P16 A;  2IDY A;  3QHT A;  1V2Y A;  4RGM A;  5C2T B;  1R4M I;  4MH0 E;  4DDI D;  3LXF A;  1VDV A;  2LAS A;  5CTR C;  3W1Y A;  1EO6 A;  3V05 A;  3PRP B;  2MLB A;  1T6B X;  1V9J A;  2NR2 A;  4W9D A;  4C56 C;  3AB5 A;  3SFE B;  2AX5 A;  4A9A A;  1ZDV A;  1P3Q U;  4ZYN A;  1L0Y B;  4JGH B;  1HQR D;  3ZTD A;  2I38 A;  3L08 A;  4GGQ A;  1KM7 A;  2JSV X;  1P1A A;  2C9W B;  5G5H A;  3C19 A;  3L16 A;  2JZP A;  2MBE A;  2E6X A;  2FNJ B;  3UIN B;  3HVD A;  3R3M A;  4ZHP A;  2MQJ A;  3KQ4 A;  4OZB A;  1I42 A;  2IY1 B;  2V4L A;  3VH3 B;  3Q3N C;  3Q2A C;  5AUI A;  1D6E C;  1NBF C;  4YT0 B;  2IGG A;  3EUB 2;  4DXA B;  3VRA B;  2HJ1 A;  5C1Z A;  3AE7 B;  1ZXH A;  4WWN A;  3NZU A;  5KHQ A;  4JE3 B;  2YLM A;  1XD3 B;  3QJZ A;  2DZJ A;  4EFO A;  1KF6 B;  1GG3 A;  1XCQ L;  4ITK A;  5J2R A;  4TV3 A;  4I6L B;  4E71 A;  2B76 B;  2LUE A;  4WJN A;  1D4B A;  4LJP B;  3NHE B;  2JQR B;  1AAR A;  1TS4 A;  2N7E A;  3M3J A;  4QAY A;  3M62 B;  3QK0 A;  1I35 A;  1SE3 A;  3A33 B;  5T8I A;  2G9H D;  1DOY A;  5DCN A;  2AYO B;  1CZP A;  3RNA C;  1V5O A;  1C4A A;  1FNW A;  3ZDT A;  4I6P A;  2XK5 A;  5BMI A;  1XLO A;  4KZC A;  4MDK E;  1K51 A;  5H92 C;  3PHW B;  1Y56 A;  2H88 B;  3TBL D;  4OW0 A;  1EU4 A;  4TKN A;  3B2G A;  2EEL A;  2KTR B;  5JH5 C;  1TZO A;  1P9D U;  3R7R A;  2ZNV B;  2DZK A;  1XO3 A;  1KTK A;  3MJW A;  4C7Y A;  4AQ7 A;  3AE1 B;  3GP7 A;  3VQI A;  3ZXR A;  2W9N A;  5EE3 A;  5J18 A;  2G4D B;  1V6E A;  1WJN A;  1K52 A;  2ZNV C;  2LGY A;  4NAW B;  4AWJ A;  1E6E B;  1WI0 A;  2I1K A;  1WMH A;  3PV1 A;  1OGW A;  2N4F A;  1T0R C;  4MT5 A;  5IP4 D;  2DYO A;  2V3S A;  2PKO A;  1WSP A;  1HZ6 A;  2J7Q B;  3BYT B;  1IPG A;  2LHD A;  2ZPY A;  4XZ4 A;  3QA8 A;  2L83 A;  3T3O A;  1WXA A;  5IN7 A;  2WYQ A;  3DBR B;  2V3N A;  4BBN F;  3RFZ B;  1FM0 D;  1WWT A;  3U52 E;  2PPH A;  5EE1 A;  2BYF A;  1YQ3 B;  3KH0 A;  3TSS A;  1TS3 A;  1WX9 A;  3ONS A;  4WWP A;  1FD6 A;  2LGD A;  5FK9 C;  1VZ8 A;  3DDC B;  3DWG C;  3VXW A;  1YNT E;  1WF9 A;  2Y5B B;  1QIL A;  3UI3 A;  4FJV B;  3OWE B;  2OED A;  2CU1 A;  3FIL B;  2KWD A;  2MBQ A;  4B0M A;  3Q8E A;  3VR8 B;  4RGN A;  4NAM A;  2N7D A;  1XT9 B;  3VVW B;  4NJ7 A;  2EKI A;  1WGR A;  2KMM A;  1QKZ A;  2ZW0 A;  4JPS A;  4KGT A;  3R66 C;  2WDR B;  1GC7 A;  3W1S C;  1YX5 B;  4BKS D;  4XDD A;  3TEW A;  2D3C A;  3DHG C;  2D11 A;  1F2R C;  2LHE A;  2K5P A;  2KMA A;  3GE3 C;  3NY5 A;  2JU6 X;  2ON8 A;  1FMA D;  2BGF A;  2MBH A;  1L4D B;  5LXH A;  1YJJ A;  1KJT A;  3NZS A;  1V1P B;  3Q14 C;  5LXI B;  1WGD A;  2KTF A;  2K8C A;  2IPK D;  2KQS A;  3H7P A;  2LGI A;  3CWI A;  3BY4 B;  4AJY B;  5C23 A;  4RM8 A;  4CYE A;  4AJW A;  2LUM A;  3CMM B;  5G5G A;  1V49 A;  4LNO A;  1SB3 C;  3ZDM C;  4W9E A;  1WH3 A;  1NI2 A;  1XF5 L;  1ACC A;  1QF6 A;  3KUZ A;  2TSS A;  4TQ0 A;  2K22 A;  2KLG A;  4RM9 A;  3QIJ A;  2D2Q A;  5D2M B;  1XLP A;  3L54 A;  4ZHO A;  1TT5 B;  4FXC A;  2LVQ A;  3IAS 1;  4XDC A;  2BS3 B;  2GOW A;  1FCC C;  2G4S A;  1ZOY B;  2KYW A;  3BII D;  4A3O A;  3TEY A;  1QQR A;  2L52 A;  2W3R A;  1Z2M A;  1JWB D;  1FO4 A;  1UF0 A;  3VAW A;  5HFY A;  1WGH A;  3JYU A;  2Z0D B;  3K9O B;  2WXI A;  4HCP B;  1YOV B;  1K53 A;  1ET9 A;  3NRZ A;  2JUO A;  4ZRQ A;  3ZW3 A;  4US8 A;  5E6J A;  3QQ8 B;  2W55 A;  2K6D B;  1TY2 A;  4OVU A;  1WRI A;  1HA5 A;  2KC2 A;  1N62 A;  2ASQ A;  2KFK B;  1VRA B;  2R2O A;  1WMH B;  1F1H A;  3I3T B;  2K25 A;  2R61 A;  2WXN A;  2L76 A;  1FFU A;  4WUR A;  2BYV E;  2AL6 A;  4PK1 A;  4PYU A;  5AZH A;  3VTU A;  5IKC M;  2MBO A;  2MJ3 A;  2OJW A;  2VH2 A;  4G3X B;  4NZL B;  1D5Z C;  2DNF A;  1GB1 A;  3VR9 B;  2XBB C;  4LK0 M;  1F9J A;  3KYD D;  5L95 C;  4EKU A;  5G2N A;  1YN5 A;  1TKG A;  1Z5S B;  3I63 C;  3R2T A;  2WDQ B;  3KLS X;  3EA6 A;  2M0X A;  2AQ3 B;  1JWU D;  4YSZ B;  1GC6 A;  2J52 A;  3MJ5 A;  3AEA B;  3GE8 C;  2AL3 A;  4XE0 A;  1V1P A;  4F8C B;  1EWC A;  3P42 A;  3PZ8 A;  2IBI B;  2JXT A;  3LYY A;  1XQQ A;  2GI9 A;  1D5X C;  2CHX A;  3A1Q B;  2QHO A;  2KX0 A;  4KIK B;  1SGH A;  3WA0 A;  3ZNG C;  4EUT A;  2MX2 A;  3Q3M C;  3P4Q B;  2CKH B;  2CU3 A;  4NPN A;  1QOF A;  2LGX A;  2X8X X;  2KWC A;  4BOZ B;  2FAZ A;  4M0W A;  3ALB A;  2KFK A;  1ZW7 A;  2K8B A;  2CJO A;  5BYR A;  4B6W A;  4MH8 A;  5JHA A;  3BWU D;  3NUH B;  1GNU A;  4UDU C;  4GN1 A;  2D07 B;  3ZNH B;  1TZ1 A;  3ZKJ C;  2LXA A;  2V4I B;  2L3Z A;  5GXG B;  3B2F A;  3UGB B;  2I1J A;  3AEE B;  3MHS D;  4K3B A;  3TIX A;  1PQS A;  2WU2 B;  3WAL A;  2WU5 B;  4FJY A;  2WDT B;  4K1R B;  4N6E B;  1ZKH A;  1GB4 A;  2RMM A;  1SE4 A;  1LM8 B;  3IFW B;  3H9D A;  1E9M A;  1L6U A;  5D3D A;  2RDB C;  5I4D A;  2KLC A;  1ZDX A;  4RCO A;  5AUK A;  4YSX B;  1E7P B;  2RGF A;  2K9X A;  3BVZ A;  3KUD B;  4MEL A;  1UBQ A;  4HPM B;  1E90 A;  3IHP C;  1MI0 A;  2VZK D;  2BKR B;  2L0T A;  1LGR A;  2JRI B;  4G50 A;  3ML8 A;  1V81 A;  3VUW A;  1V80 A;  2DLB A;  3C8Y A;  2DHZ A;  2V3P A;  3PPA A;  3EGR A;  4ANX A;  3KWL A;  1J7A A;  1NEN B;  4HKZ E;  1E7U A;  1I4P A;  4FAD A;  1YJI A;  4RH6 A;  2LGS A;  2ZCC A;  2SEB D;  1N60 A;  2ZVO A;  3DPD A;  4OZA A;  3AN1 A;  1GAQ B;  2DYB A;  3PRM B;  2QC8 A;  1OQQ A;  5IAA C;  2N1W A;  4W9L A;  1QZE A;  1SSN A;  4W9K A;  4RGO S;  2IYD B;  4YTP B;  4L2Y A;  4YL8 A;  1IBX A;  3V61 A;  1RFA A;  2WXQ A;  4TQ1 A;  4IUM B;  4N58 A;  1WGG A;  3ZO5 B;  3U7Z A;  2RDH A;  1NYQ A;  2BPS A;  1WIA A;  2LD9 A;  2J42 A;  1J7B A;  4RFB A;  2KN5 A;  4HDQ A;  2KXJ A;  2KVZ A;  3L10 B;  1FNU A;  2BW2 A;  3JSV B;  3B9J A;  2PLP A;  3AI5 A;  2VZK B;  4DBG A;  1VR9 A;  3SHQ A;  2PVG C;  1Q1O A;  1HTQ A;  2KDI A;  3DBR I;  3MP9 A;  2RDG A;  4KGR A;  3APC A;  1P0R A;  3PTF C;  3WAN A;  2OJR A;  2W3S A;  3AU4 A;  1FPY A;  1QOB A;  2O6V A;  4URK A;  4AOF A;  3IAM 1;  2GB1 A;  3CST A;  2INC C;  1SXT A;  1YN3 A;  3Q8F A;  4KGS A;  3BVM A;  2D5G A;  1EM7 A;  1T3Q A;  2IO3 B;  3N1Y C;  3GZN B;  2JX5 A;  2OOB B;  5IOI A;  4CHK A;  4HJK A;  1SEB D;  3DVN U;  5EE0 A;  4EE2 A;  3ZRF A;  3FAH A;  1N61 A;  1PGB A;  3AEG B;  2RD0 A;  3AE5 B;  3V62 A;  5JZE B;  1QOA A;  2M17 A;  4RMA A;  1WM2 A;  2K3U A;  2WP9 B;  3VH4 B;  3NVW A;  4NY0 A;  3PS6 A;  3SD5 A;  2LXC A;  2KWU B;  4N9F 4;  4GMV A;  3I57 A;  3AM9 A;  5BO4 B;  2NBV B;  1L4Z B;  3L0W B;  2KQ4 X;  4GXB A;  4EZL A;  1XEE A;  4A90 A;  2KDB A;  4GOC A;  4DQO C;  4DWF A;  3QAR A;  1WZ0 A;  2MW5 A;  4XX5 A;  1G6J A;  3DCG A;  2X38 A;  4LNK A;  1UD7 A;  1V97 A;  1TJE A;  2C60 A;  3RNB C;  2D3A A;  1C76 A;  2L7R A;  5CHV C;  3APF A;  1NEK B;  2WWZ A;  4L23 A;  2FUH B;  2WX1 A;  2WGS A;  3U4E G;  2AQ2 B;  3PO0 A;  3W1S A;  1E8W A;  1SIJ A;  2KTR A;  2ZJD A;  2BB6 A;  3PVL A;  3AMZ A;  4KSK C;  2EMT A;  1EWY C;  2KWV B;  2J0K A;  1VCB A;  4FJZ A;  1UEL A;  1VJK A;  1D5M C;  1JRP A;  3NOB A;  4M01 A;  4NJC A;  3T8M A;  2KN4 A;  5DPT A;  3O65 B;  1WXS A;  2KMC A;  4IOI E;  2NPT A;  3VUY A;  4ZRJ A;  1OEY A;  4K7W A;  2AQ1 B;  1ISN A;  2CHZ A;  3FKY A;  4JWS C;  4BKG A;  4WIP A;  5TR5 A;  1E5W A;  1F2R I;  2PIA A;  3EFU A;  2FCQ A;  4DHZ B;  4KKI A;  1P7E A;  2L8J A;  3SU8 X;  2ZW1 A;  4KDI C;  4JIO U;  5AZF A;  3NG0 A;  4AUQ C;  1WR6 E;  4JQW C;  2LFI A;  4HXD A;  4ZDV A;  2WXR A;  4KKJ A;  3AEF B;  2RPQ A;  2KJH B;  3AUL A;  5L83 A;  1NI3 A;  1MHH E;  3EHV A;  4G11 A;  3WIM A;  2BS2 B;  3SDL C;  2JT4 B;  3N1X C;  2JF5 A;  2LEK A;  1IUE A;  2BT6 A;  3N3K B;  2G1E A;  1BT0 A;  3FC4 A;  4LNF A;  2WQY B;  3DBL B;  2QSD A;  1R4N B;  1L6V A;  3LJ3 A;  1MPE A;  2GBM A;  3ABV B;  3QCA A;  2DX5 B;  3KWV A;  2FCS A;  4FHJ A;  1SJE D;  3PRE A;  4MGZ E;  1Y8R C;  2EMS A;  4N59 A;  3VUX A;  1UGM A;  3A4R A;  1XLQ A;  1YJ1 A;  1WE6 A;  2XN9 C;  2GMI C;  3VDZ A;  2V0G A;  2YVC A;  3HK0 A;  2A5U A;  2LMC A;  4LJO B;  1WX7 A;  2K39 A;  1JWM D;  1LQB A;  2MP2 B;  3RT3 B;  4NJ6 A;  2M56 B;  2QJL A;  3A9K A;  2VH1 A;  3WAM A;  1YQ4 B;  3IT4 B;  3V6C B;  4REZ A;  1L2N A;  4HEA 1;  2KNB A;  4DHZ E;  2AWT A;  3PHX B;  4XYC A;  3RN9 C;  3DVG Y;  2G45 B;  3TEX A;  3OLM D;  1LXD A;  1EUV B;  3TEZ A;  1CQV A;  4TMA B;  3ZJT A;  2BWE S;  2N9X A;  1YN4 A;  2WLB A;  3BYY B;  3BK1 A;  1TIF A;  5H8Y E;  3HIZ A;  1TKE A;  4OHJ A;  4HPP A;  1Q5W B;  3B0A A;  3PLV A;  1E0Z A;  1L5P A;  4C4V B;  2LRW A;  1E8Z A;  1RM6 C;  2UU7 A;  3N9Y C;  2C7H A;  4MJS B;  2BB5 A;  5CHW A;  1IGD A;  4EEW A;  4IC7 B;  2MHJ A;  3ZTC A;  3RNE C;  2O2V A;  1E7V A;  1FFV A;  2DAJ A;  1BXT A;  2BVC A;  3MHZ A;  4PS3 A;  1ZPS A;  2KJ6 A;  1HE8 A;  2REX A;  3N30 A;  3E9S A;  2OHF A;  1OQR A;  1EF5 A;  1IGC A;  3VRB B;  2W82 A;  1ZUD 2;  2QIE B;  4DK5 A;  4ZRK A;  2JZZ A;  2LJI A;  1WE7 A;  4ARI A;  4BVU C;  4W9G A;  1GOZ A;  4GIV A;  2HDE A;  4C4V A;  1WR1 A;  2LVP A;  3K9P B;  5HG2 A;  1FIQ A;  3IG3 A;  3RZW C;  3EFC A;  3N32 A;  3P2B A;  3PLU A;  2L32 A;  1N5X A;  3NJT A;  4EZJ A;  4M00 A;  2BYE A;  5LNK 1;  1PFD A;  1KLG D;  2LJ5 A;  4IDI A;  1NDD A;  2WHI A;  3A1Q A;  1JCK B;  2ICI A;  1L0X B;  2IO0 B;  3V60 A;  2NS5 A;  2WXH A;  2PE6 B;  1XCT L;  4IM2 A;  4YXD B;  3HHM A;  4AP4 C;  2Z0E B;  3GZN I;  1FRR A;  3T3N A;  3KUC B;  1E10 A;  1MFW A;  4ANV A;  2M0A A;  2L1A A;  5J17 A;  1WGY A;  2K1F A;  3LB8 C;  4IM3 A;  5JXV A;  3EEC A;  4ARC A;  2RSU A;  4BAX A;  5AZG A;  5BYS A;  3RCZ A;  4C7Z A;  4DXF A;  2J53 A;  4W9C A;  4A55 A;  4IG7 B;  2ZVN A;  3RPF C;  1MVK A;  2HE7 A;  2HTH A;  3D32 A;  1XXG A;  3C0R B;  1VLB A;  3OAW A;  4MJS A;  4YSY B;  4FHK A;  2MEK A;  2AEH A;  4XC2 A;  1OQY A;  3IXS A;  2DBY A;  4A3P A;  4OZC A;  1IP9 A;  1FXA A;  5BMH A;  2IGH A;  3Q3F A;  1KLV A;  1F52 A;  4O1N A;  1E8X A;  3Q69 A;  3VTV A;  4MSM B;  3X0W A;  2JYE A;  3CIR B;  4JL9 A;  3KVF B;  4P7I A;  1WJU A;  2WS3 B;  4D2K A;  2V1Y A;  1X1M A;  1C3T A;  3Q3O C;  1RYJ A;  1JAL A;  4MGI E;  1KOT A;  4GSW A;  1SE2 A;  4KSL C;  3TJP A;  3Q3J A;  1A5R A;  3QAQ A;  1FEH A;  4KVG B;  4LTU A;  2WXJ A;  1F77 A;  2UYZ B;  3ML9 A;  4WAA A;  2M4N A;  2FUG 1;  3AE2 B;  2Q5W D;  2IZV B;  3DHI C;  2ACZ B;  4S0R A;  4MM3 A;  1CMX B;  3MFG A;  2HD5 B;  1STE A;  2GBJ A;  3OJ4 B;  4IWQ A;  2KAN A;  3RUL A;  3VFK A;  1QLB B;  4A20 A;  3DVN V;  1JQ4 A;  1JWS D;  3S2A A;  1I4H A;  3L13 A;  4WWM A;  3DBH I;  4WQO B;  5JHB A;  2PVO D;  3H7P B;  1V1O A;  1ET6 A;  1MHX A;  2KDM A;  2BQQ A;  1P7F A;  1YQB A;  1SF0 A;  2ZEQ A;  1JW9 D;  2NBU A;  1TS5 A;  4WWO A;  2KVR A;  4FLH A;  3AXC A;  3URY A;  4WH4 A;  2K0P A;  2DAF A;  4WQM A;  3ZNI D;  4LNI A;  3WAP A;  4RF0 A;  2INP E;  3A9J B;  2H89 B;  2D3G A;  2Y5P A;  1UWM A;  5C3J B;  2NMQ A;  1UZX B;  1T0Q C;  1F0Z A;  1PYW D;  1CK1 A;  1RAX A;  2MJD A;  3AEC B;  5LLI A;  3PRZ A;  2RR9 A;  2L05 A;  1AN8 A;  1R4M B;  4XWW A;  3W5U B;  1VD2 A;  1PGA A;  2PMV A;  2PTL A;  3R2I A;  1WZ3 A;  3SR6 A;  3ECI A;  1JML A;  1M94 A;  2W54 A;  4KX6 B;  1WX8 A;  1I4X A;  3APD A;  2DWQ A;  3UIO B;  4BBN C;  4II2 B;  1IBX B;  2MWS B;  2ONQ A;  1YD8 U;  3ETR A;  1JRU A;  2UWQ A;  4MM3 B;  4B95 A;  1S1Q B;  5AEK B;  2BBC A;  3DBL I;  2KOX A;  3P4R B;  3AE8 B;  2KFJ A;  1OEY J;  2WXK A;  1MG8 A;  3JSV A;  1EU3 A;  2JWU A;  5IO9 A;  1AYF A;  5FR3 A;  3ZJV A;  1WRD B;  1C9F A;  3RUI B;  3RNF C;  5HKH A;  4LDT B;  4L1B A;  4I6N B;  1GUA B;  1DOX A;  4YTN B;  2IY0 B;  4DDG D;  5HI1 A;  1ESF A;  3W5V B;  5D3I B;  3UF8 A;  2IJ0 A;  4W9I A;  3KYC D;  3IBE A;  3T9L A;  3B1L X;  4LCD E;  1I4Q A;  2MSE D;  4FA6 A;  1ZE3 D;  2CS4 A;  2QIL A;  2JPH A;  3UIP B;  2WXG A;  1R7S A;  2PW9 A;  2J4X A;  1ZGU B;  3TUO A;  3TL5 A;  2KX3 A;  4ICU A;  4KZ0 A;  2O6V B;  2KQ7 A;  5G55 A;  1TTN A;  1L0V B;  2NBW B;  2WXF A;  1WJ4 A;  2KD0 A;  5FKA C;  1LO5 D;  4HJG E;  3P63 A;  3X23 A;  4B9K A;  4AS1 A;  4M0W B;  2M1M A;  2KDF B;  3PGE A;  3N1Z C;  2IND C;  1LFD A;  1I4G A;  3H1U A;  4NNJ B;  3W2D A;  2BS4 B;  2CHW A;  1B9R A;  4B0E A;  1FXT B;  2JYT A;  1GPX A;  1I7H A;  1VZ7 A;  3IT6 B;  3NS1 A;  2KZR A;  2MH7 A;  5E6N A;  3R7Q A;  3PT2 B;  3SEB A;  2B3A A;  4F7Z A;  5IA7 A;  1I4R A;  2QCZ A;  3KW5 B;  1XLN A;  5D7G A;  1SE9 A;  4BOS C;  4PS7 A;  4DHJ D;  2V9H A;  4HPL B;  4HCN B;  3NVV A;  3EC8 A;  1C4P A;  1JWA D;  2ZCB A;  2BYT A;  4MGY E;  2MA9 B;  1BML C;  3AU5 A;  1PDX A;  1YIW A;  4JWU C;  2J0M A;  3AE6 B;  1UH6 A;  3P1M A;  1N5W A;  1S3S G;  5D6J B;  1T0Y A;  2WNM A;  4KIK A;  3DQV A;  3TMP B;  2JRH A;  2N7J A;  1VZ6 A; 
#chains in the Genus database with same CATH homology
 1EF5 A;  3U7D A;  3NS8 A;  4EOY A;  2ZZP B;  4NPN A;  1P3Q U;  2XEW A;  2LGX A;  4ZYN A;  3WAO A;  4JGH B;  2A4Z A;  2KWC A;  3ZTD A;  4BOZ B;  2FAZ A;  3L08 A;  4DK5 A;  4GGQ A;  4FUL A;  3ALB A;  4ZRK A;  1KM7 A;  2JZZ A;  2GBR A;  2KFK A;  1P1A A;  4ANU A;  1WE7 A;  2C9W B;  1ZW7 A;  2JXX A;  2K8B A;  4BVU C;  4B6W A;  3L16 A;  4HVB A;  5JHA A;  4W9G A;  4GIV A;  1GNU A;  3A4S C;  3A9J A;  4GN1 A;  2D07 B;  3ZNH B;  1TZ1 A;  1WR1 A;  2LVP A;  2MBE A;  3ZKJ C;  2LXA A;  3K9P B;  2FNJ B;  1J0G A;  2L3Z A;  1RLF A;  3UIN B;  2MRP A;  3MTN B;  3IG3 A;  3R3M A;  3RZW C;  3N32 A;  3UGB B;  3P2B A;  2I1J A;  2MQJ A;  3PLU A;  4EZJ A;  3MHS D;  3TIX A;  2BYE A;  1PQS A;  2KKC A;  3WAL A;  2LJ5 A;  1I42 A;  1TBE A;  2WX0 A;  4K7S A;  1NDD A;  2IY1 B;  4FJY A;  2JY6 A;  2V4L A;  2WDT B;  3A1Q A;  4K1R B;  3VH3 B;  3ZUN A;  1ZKH A;  4X57 B;  2IO0 B;  1R4N I;  3V60 A;  2NS5 A;  1LM8 B;  3IFW B;  3H9D A;  1NBF C;  2PE6 B;  5EDS A;  4DXA B;  4IM2 A;  5C1Z A;  2KLC A;  3HHM A;  4AP4 C;  4CO7 A;  2Z0E B;  4WWN A;  3GZN I;  3NZU A;  5KHQ A;  4NAW A;  2YLM A;  1XD3 B;  3QJZ A;  2DZJ A;  3KUC B;  4EFO A;  2RGF A;  1GG3 A;  4ANV A;  4BKS A;  4HWI B;  3KUD B;  4MEL A;  5J17 A;  5J2R A;  1WGY A;  2K1F A;  4TV3 A;  4I6L B;  1UBQ A;  4HPM B;  4E71 A;  1WYW B;  4IM3 A;  1E90 A;  2LUE A;  3EEC A;  4WJN A;  4G0N B;  3IHP C;  3ZNZ B;  3B08 A;  4GDL A;  2RSU A;  2BKR B;  5AZG A;  4LJP B;  2L0T A;  3NHE B;  2DZI A;  2JRI B;  4G50 A;  3ML8 A;  1V81 A;  3VUW A;  3RCZ A;  1P98 A;  1V80 A;  2DHZ A;  1AAR A;  2MP2 A;  2N7E A;  4W9C A;  3PPA A;  4IG7 B;  4ANX A;  2ZVN A;  3M3J A;  2HE7 A;  1U4A A;  2K6Q A;  3M62 B;  2M8S A;  3QK0 A;  1E7U A;  2HTH A;  3D32 A;  3V6E B;  4FAD A;  2N1V A;  1I35 A;  3C0R B;  3A33 B;  4WJQ A;  3OAW A;  4MJS A;  4MEM A;  2GBN A;  2ZCC A;  2ZVO A;  4FHK A;  3DPD A;  2JVC A;  2AEH A;  4XC2 A;  5DCN A;  2AYO B;  1OQY A;  2DYB A;  2Z59 B;  4ICV A;  5KHO A;  1V5O A;  3PRM B;  5IAA C;  2LWP A;  2N1W A;  4W9L A;  1QZE A;  4W9K A;  3ZDT A;  4A3P A;  1IP9 A;  2KDE B;  4I6P A;  4GB9 A;  3RD2 A;  2XK5 A;  2IYD B;  4YL8 A;  3V61 A;  2LI5 A;  1RFA A;  4IUM B;  3HM3 A;  3L17 A;  4KZC A;  3JW0 X;  1WGG A;  3Q3F A;  4MDK E;  4TQ1 A;  5DPS A;  1KLV A;  3ZO5 B;  1YX6 B;  4LDT D;  3CF6 E;  1E8X A;  1WIA A;  2BPS A;  1TGZ B;  3M95 A;  3PHW B;  2LD9 A;  4HDO A;  2KN5 A;  3TBL D;  4HDQ A;  1D3Z A;  2KXJ A;  3VTV A;  4TKN A;  1E8Y A;  4MSM B;  4W9H A;  2MCN B;  3X0W A;  5CX3 A;  3OJ3 A;  3L10 B;  2KTR B;  5JH5 C;  3JSV B;  4JL9 A;  3KVF B;  1P9D U;  4P7I A;  3AI5 A;  1WJU A;  2EKE C;  3H7S A;  4DBG A;  2V1Y A;  1V5T A;  1X1M A;  2ZPN A;  3R7R A;  1C3T A;  4TUU A;  2ZNV B;  4MGI E;  1KOT A;  3SHQ A;  2R2Q A;  2DZK A;  3BIN A;  4GSW A;  1Q1O A;  3VTW A;  2KDI A;  4KSL C;  3DBR I;  3TJP A;  3Q3J A;  3APC A;  3IVF A;  1A5R A;  1P0R A;  4BKT A;  3PTF C;  3QAQ A;  4K7U A;  3WAN A;  2OJR A;  4KVG B;  3MJW A;  3AU4 A;  2UYZ B;  3PZD A;  1GJZ A;  3ML9 A;  2J0J A;  4WAA A;  2M4N A;  3ZLZ A;  2KJR A;  4GDK A;  2O6V A;  1H8C A;  2DEN B;  4URK A;  4AOF A;  3VQI A;  5DPR A;  2W9N A;  3CST A;  2G4D B;  5J18 A;  4GDK B;  2IZV B;  1V6E A;  1WJN A;  4MM3 A;  4NQK E;  2ZNV C;  2LGY A;  4NAW B;  4AWJ A;  2IO3 B;  1WI0 A;  4WJO A;  1CMX B;  1WMH A;  2I1K A;  1OGW A;  3PV1 A;  2HD5 B;  2N4F A;  3U30 A;  4ANW A;  3QC8 B;  2DYO A;  2GBJ A;  2OOB B;  2BF8 B;  2V3S A;  3OJ4 B;  3PSE B;  4DHJ B;  2J7Q B;  4IWQ A;  1IPG A;  4ASW C;  2KAN A;  4XZ4 A;  2ZPY A;  3QA8 A;  4CHK A;  4HJK A;  3RUL A;  3VFK A;  3DVN U;  2IO2 B;  3ZRF A;  4A20 A;  2O2V B;  5D94 A;  3DVN V;  1WXA A;  2WYQ A;  1J19 A;  4K81 A;  3S2A A;  4BBN F;  3L13 A;  2RD0 A;  3DBH I;  1SIF A;  2JWZ A;  4WQO B;  2PPH A;  3V62 A;  5JZE B;  5JHB A;  4MSQ B;  2M17 A;  4RMA A;  1WM2 A;  2BYF A;  3JVZ X;  3H7P B;  3KH0 A;  4JLC A;  2JZ3 B;  3VH4 B;  4E3C A;  1WX9 A;  2PJH A;  2PEA A;  3ONS A;  3TCA A;  4NY0 A;  3PS6 A;  3SD5 A;  2LXC A;  2NVU I;  2KWU B;  4N9F 4;  4GMV A;  4WWP A;  2C5L C;  5BO4 B;  2LGD A;  2NBV B;  3VHT C;  1YQB A;  3L0W B;  4GXB A;  4EZL A;  2KDB A;  2ZEQ A;  4GOC A;  2FIF A;  3DDC B;  5GMV A;  2G3Q B;  4FBJ B;  3VXW A;  2D10 A;  2NBU A;  1WF9 A;  2Y5B B;  4DWF A;  3QAR A;  1WZ0 A;  4FJV B;  4WWO A;  2MW5 A;  2CU1 A;  2KVR A;  4FLH A;  4XX5 A;  1G6J A;  3DCG A;  2MBQ A;  3AXC A;  1Q0W B;  1UD7 A;  4IW0 A;  2DAF A;  2C60 A;  3ZNI D;  3RZF A;  3WAP A;  2FCM A;  5CHV C;  2L7R A;  5DPW A;  2N7D A;  3A9J B;  1XT9 B;  3APF A;  3VVW B;  2WWZ A;  2NCN A;  4KDL B;  4NJ7 A;  2D3G A;  4J6I A;  1WGR A;  2XK5 B;  3U8Z A;  2FUH B;  1UZX B;  1IYF A;  2WX1 A;  4M8M A;  1H4R A;  3R66 C;  2MBB B;  4NQL B;  2BKF A;  1GC7 A;  3W1S A;  1E8W A;  3W1S C;  1RAX A;  2KTR A;  2ZJD A;  4PYZ A;  5LLI A;  3PRZ A;  2RR9 A;  2L05 A;  1YX5 B;  3DBS A;  4IWP A;  3PVL A;  4BKS D;  4EZK A;  1VD2 A;  2EMT A;  4KSK C;  4HLE A;  2D11 A;  2KC1 A;  2KWV B;  2J0K A;  1VCB A;  4FJZ A;  2KMA A;  3NY5 A;  1UEL A;  1WZ3 A;  3NOB A;  3ECI A;  4WJP A;  2BGF A;  1M94 A;  2MBH A;  3T8M A;  5DPT A;  5LXH A;  3O65 B;  1WXS A;  2KMC A;  4OVV A;  1C1Y B;  1KJT A;  1WX8 A;  3NZS A;  1J8C A;  2NPT A;  3APD A;  4IM0 A;  3VUY A;  3ENE A;  3UIO B;  4ZRJ A;  1OEY A;  4K7W A;  4BBN C;  4II2 B;  1WGD A;  2MWS B;  5LXI B;  2KTF A;  2K8C A;  1ISN A;  1YD8 U;  2KQS A;  1WJ6 A;  2CHZ A;  1JRU A;  3H7P A;  2GBK A;  2KHW B;  2UWQ A;  4BKG A;  3BY4 B;  4AJY B;  5C23 A;  1RRB A;  4RM8 A;  5TR5 A;  4B95 A;  2LVO A;  1S1Q B;  3ZIM A;  4CYE A;  5AEK B;  1E5W A;  1WXM A;  3DBL I;  4AJW A;  2C7N B;  3EFU A;  2FCQ A;  2KOX A;  3CMM B;  3CSF A;  1V49 A;  3LDZ E;  3QWZ B;  3ZDM C;  1K8R B;  4DHZ B;  2KFJ A;  4W9E A;  3DOW A;  4M8N A;  2N9E B;  1NI2 A;  1OEY J;  1WH3 A;  4F1S A;  2L8J A;  3M63 B;  2O6V D;  3KUZ A;  3SU8 X;  1MG8 A;  3JSV A;  4TQ0 A;  2KLG A;  1WRD B;  4KDI C;  4JIO U;  1WM3 A;  5AZF A;  4AUQ C;  1WR6 E;  2BWF A;  4JQW C;  4RM9 A;  3QIJ A;  2DYM A;  4HXD A;  3RUI B;  4ZDV A;  4ZRI A;  5HKH A;  2D2Q A;  5D2M B;  3L54 A;  4LDT B;  2RPQ A;  2KJH B;  3AUL A;  4MGK E;  5L83 A;  2N9P C;  3H6N A;  3EHV A;  2LVQ A;  4G11 A;  4I6N B;  1GUA B;  2LZ6 A;  3SDL C;  2GOW A;  3WIM A;  2IY0 B;  2JT4 B;  4DDG D;  5FR6 A;  2G4S A;  2VRR B;  2JF5 A;  2L0F A;  3UF8 A;  4II3 B;  1WY8 A;  4W9I A;  3KYC D;  3N3K B;  1BT0 A;  4A3O A;  3UQA A;  3HM6 X;  3IBE A;  3A9K B;  1Z2M A;  3T9L A;  3RYT A;  3B1L X;  4LCD E;  2MSE D;  3LJ3 A;  1WFY A;  2HJ8 A;  2GBM A;  3VAW A;  1WGH A;  2NPT B;  3JYU A;  5CHF A;  4FA6 A;  3QCA A;  2DX5 B;  2FCN A;  2CS4 A;  2FCS A;  2Z0D B;  3K9O B;  4FHJ A;  3PRE A;  4MGZ E;  1Y8R C;  2EMS A;  4HCP B;  3VUX A;  3ZW3 A;  1UGM A;  2JUO A;  2JPH A;  3A4R A;  3UIP B;  1YJ1 A;  1WE6 A;  2GMI C;  1ZGU B;  3QQ8 B;  3VDZ A;  2YVC A;  2KX3 A;  3TL5 A;  4PS8 A;  3HK0 A;  2A5U A;  4ICU A;  2K6D B;  4KZ0 A;  2LRU A;  2KC2 A;  4OVU A;  4LJO B;  1WX7 A;  2K39 A;  2O6V B;  3ZRC A;  4W9F A;  2ASQ A;  2KFK B;  2KQ7 A;  5G55 A;  1LQB A;  2MP2 B;  2R2O A;  4HK2 A;  1WMH B;  1TTN A;  3RT3 B;  3I3T B;  4NJ6 A;  3A9K A;  2K25 A;  3WAM A;  5E6O A;  2NBW B;  2L76 A;  3V6C B;  1WJ4 A;  4FN2 A;  2KD0 A;  1EF1 A;  2CR5 A;  1L2N A;  3ZVV A;  2BYV E;  3X23 A;  4B9K A;  2AL6 A;  2L00 B;  3GOE A;  4M0W B;  2KNB A;  2M1M A;  4PYU A;  2KDF B;  2PE9 A;  3PGE A;  5AZH A;  1WXV A;  3QX1 A;  4DHZ E;  2AWT A;  3PHX B;  3VTU A;  2DZM A;  3DVG Y;  2MBO A;  1LFD A;  2G45 B;  2KO3 A;  4W9J A;  3OLM D;  4KV2 A;  1LXD A;  1EUV B;  4G3X B;  1V86 A;  3DVG X;  3UQB A;  2IO1 B;  5E6P A;  3H1U A;  4NNJ B;  4BFR A;  2XBB C;  4GU2 A;  2BWE S;  2N9X A;  1F9J A;  2CHW A;  2FID A;  3KYD D;  5L95 C;  1FXT B;  4EKU A;  3HIZ A;  2KK8 A;  5G2N A;  4GDL B;  1Z5S B;  1Q5W B;  2KZR A;  3B0A A;  3PLV A;  1UBI A;  2LRW A;  5E6N A;  1E8Z A;  2M0X A;  4IWO A;  3R7Q A;  2C7M B;  2K8H A;  3PT2 B;  2B3A A;  2C7H A;  1OTR B;  4F7Z A;  5IA7 A;  1L7Y A;  4MJS B;  1GC6 A;  4E74 A;  3KW5 B;  1V2Y A;  3QHT A;  5CHW A;  5D7G A;  1SE9 A;  4EEW A;  2AL3 A;  4BOS C;  4PS7 A;  4DHJ D;  4F8C B;  4HPL B;  4HCN B;  4IC7 B;  1R4M I;  2IBI B;  3EC8 A;  2ZCB A;  4MH0 E;  3ZTC A;  1XQQ A;  4DDI D;  2LAS A;  2CHX A;  5CTR C;  4MGY E;  2O2V A;  2MA9 B;  3W1Y A;  1E7V A;  3AU5 A;  3A1Q B;  2QHO A;  2KX0 A;  1YIW A;  4KIK B;  1EO6 A;  1SGH A;  3WA0 A;  2DAJ A;  2J0M A;  3ZNG C;  4EUT A;  1UH6 A;  3PRP B;  2MLB A;  1V9J A;  2NR2 A;  2MX2 A;  1S3S G;  4PS3 A;  5D6J B;  1T0Y A;  4W9D A;  2KJ6 A;  4KIK A;  2CKH B;  1HE8 A;  2REX A;  3DQV A;  2JRH A;  3N30 A;  3TMP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...