4W9GA

Pvhl:elob:eloc in complex with (2s,4r)-1-(3,3-dimethylbutanoyl)-4-hydroxy-n-(3-methyl-4-(thiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 6)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
101
Chain Sequence
b'MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor B polypeptide 2
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 24
structure length 101
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4w9gA00
1LFDA 3DVGY 5CX3A 2MA9B 5E6OA 1WGGA 4NAWA 3VHTC 2Z59B 4OVVA 1X1MA 1WE7A 2GBKA 1V5TA 3L54A 4DBGA 2IBIB 4G3XB 2GBRA 4GDLB 1UGMA 2L7RA 3OJ3A 1E8XA 3PRZA 3CSTA 2OOBB 4MDKE 2C9WB 3QC8B 2KOXA 1OTRB 1Y8RC 4HXDA 3VXWA 1ZKHA 1V86A 4MJSA 1PQSA 2JVCA 2LASA 2C60A 3GZNI 3MTNB 3ONSA 4HK2A 3QARA 4AWJA 4MSQB 4IC7B 2A5UA 4TKNA 2Z0EB 4DHJB 4JGHB 4FBJB 2EKEC 1NI2A 4IUMB 2JZ3B 3APDA 4KDLB 2K1FA 3IBEA 1QZEA 1UH6A 2L0TA 2CKHB 2CU1A 2M17A 1RLFA 3DVNV 3SD5A 4CO7A 2C7MB 3UQAA 5CHVC 5LLIA 1WJUA 2MBHA 4LCDE 3QJZA 2LVOA 4KDIC 3ZKJC 2KDEB 3KYDD 1OEYJ 3PVLA 3TIXA 2FCQA 2XEWA 3N32A 4ZRJA 3UINB 1L7YA 4AOFA 2D07B 3RZFA 1VD2A 3UF8A 2Z0DB 1UBIA 3L08A 2N9EB 1WZ0A 4GIVA 4HDQA 4IWPA 3EECA 3VQIA 2DZKA 3JSVB 2MBBB 4W9IA 2L00B 2EMTA 2WWZA 1WI0A 3DVNU 4KZ0A 4BKSA 3IFWB 1WJ6A 3B08A 1OGWA 2N4FA 2CHWA 3V61A 3QCAA 4DHZE 4I6NB 1GG3A 3PLVA 3L10B 3QA8A 5KHQA 3KUDB 2MSED 2BYFA 2DENB 4DWFA 5J2RA 3NOBA 1RAXA 3RUIB 2DX5B 3WAPA 3PZDA 3OJ4B 2BKFA 4PYZA 1WFYA 2J7QB 2FIDA 3L17A 4IG7B 1XQQA 4IM0A 4KIKB 2CR5A 3KUCB 4E74A 3V60A 1J19A 4B9KA 5J17A 4X57B 1WIAA 3U7DA 2UYZB 2ZCBA 5DPTA 1E90A 1VCBA 1WX9A 2QHOA 3NY5A 4E71A 5DPRA 4EZLA 1J8CA 2AL6A 4ZRKA 1D3ZA 4KVGB 2KFKB 2N9XA 2KQ7A 3VUXA 3ECIA 1LM8B 4W9GA 2XK5B 4W9FA 5D94A 2O6VB 1A5RA 1UZXB 2N1VA 1UELA 1WGRA 4G0NB 4M0WB 4BBNF 3PHXB 4I6LB 1TZ1A 4KZCA 4FULA 2V3SA 4XX5A 1YIWA 4J6IA 3ENEA 3WAMA 1KOTA 2KWUB 3A9JA 4HWIB 2N7EA 2DHZA 1C3TA 3S2AA 5IAAC 2PE9A 2KTRA 2DYOA 2LRUA 1TGZB 1WXVA 4ANXA 2O2VA 4GDKB 4MGKE 3APFA 1E7UA 3TCAA 2LVQA 3HK0A 4WJOA 1V81A 1Z2MA 2KFJA 4WAAA 3ZW3A 2M1MA 4FADA 3M95A 3WAOA 3DDCB 4DHZB 4LJPB 4W9DA 4FJVB 2PPHA 4NY0A 4KV2A 4TQ1A 3H7PA 1K8RB 2PE6B 4RMAA 4EZKA 3PRMB 2JRHA 3OAWA 1WR6E 5LXHA 4HJKA 1OEYA 2GOWA 3W1YA 4NNJB 5HKHA 4FJYA 3ML9A 3UGBB 3RCZA 3TJPA 1EF1A 5E6NA 3A4RA 4N9F4 4B95A 2JRIB 3PGEA 2RPQA 4NAWB 1WY8A 2C7HA 2ZJDA 4XZ4A 3QK0A 3L13A 4RM9A 1Z5SB 1YD8U 2CHXA 1TTNA 3KVFB 1WX7A 3V6EB 3WANA 3NS8A 2BKRB 3MHSD 4K1RB 1R4MI 1SE9A 4GSWA 2G45B 3QHTA 4MEMA 4II3B 3R7RA 3T9LA 4CYEA 2NBUA 1E8ZA 3ZDTA 1Q0WB 4MJSB 2BGFA 1BT0A 1MG8A 4A3OA 2KZRA 2YVCA 2KMCA 1I42A 5CHWA 2KKCA 2KWVB 2K39A 4ZYNA 2K25A 3AULA 2LXCA 4EUTA 2WX1A 4KSKC 2IY1B 2A4ZA 3NHEB 3HM3A 3QIJA 3IVFA 4OVUA 5GMVA 3UIOB 3PTFC 3Q3FA 4FJZA 4K7UA 3RYTA 4URKA 2FNJB 2I1JA 4FHJA 2MW5A 2RSUA 4FA6A 3SU8X 4PS3A 3UQBA 2MX2A 2J0KA 2WDTB 1WM3A 4MH0E 1WE6A 2KDBA 4PS7A 3A33B 2L05A 4E3CA 3PS6A 2WYQA 2JY6A 4M8MA 1ZW7A 2MP2A 4LDTB 2LWPA 1H8CA 5DCNA 3L0WB 3ZNHB 4BOSC 4G11A 5C23A 1WXMA 3DBLI 2GBMA 5DPSA 4BOZB 2C7NB 4IWOA 2G4SA 2LD9A 4W9EA 3VAWA 3D32A 2KQSA 3QQ8B 2DZMA 3M63B 1E5WA 2MBQA 1G6JA 4HDOA 3R7QA 2N9PC 3ZVVA 4XC2A 2K6QA 5KHOA 4GMVA 4K81A 4EEWA 4NJ6A 4EZJA 2L76A 4KSLC 1Q1OA 2IO3B 2L8JA 3H7SA 4DHJD 4AJYB 3OLMD 2YLMA 2R2OA 1WM2A 2FIFA 2I1KA 4TV3A 1IPGA 2AL3A 2BPSA 2K6DB 1P3QU 1WR1A 1LXDA 4ICVA 4JIOU 4W9KA 1TBEA 2DAFA 3P2BA 4IWQA 4JQWC 1UD7A 3LDZE 2RD0A 3ZNID 3RD2A 2KJRA 4B6WA 2L3ZA 3C0RB 2FCNA 2MBOA 2AWTA 2KJHB 3DBRI 3L16A 3A4SC 3ZLZA 2K8BA 2NBWB 4K7WA 2NR2A 3CF6E 4F1SA 1M94A 5J18A 2NPTA 3A1QA 3O65B 4EKUA 2NPTB 1V2YA 3BINA 2M8SA 4BVUC 2KJ6A 3JVZX 3WALA 2BYEA 2IO0B 2B3AA 1WZ3A 2KLGA 1S3SG 1J0GA 1WMHA 4WWNA 4A3PA 1EF5A 4DDID 3PSEB 3PRPB 2ZEQA 2BWFA 4DXAB 3A9KA 1RFAA 2REXA 3SHQA 4MGZE 4GGQA 3A9JB 2RR9A 4AP4C 5IA7A 1WGHA 1V6EA 3HIZA 2LGYA 1AARA 2JT4B 2KTRB 1WYWB 3PV1A 2KXJA 4MM3A 4DK5A 3R3MA 2O2VB 2AEHA 2RGFA 4GU2A 4ANUA 1E7VA 3KH0A 5E6PA 5L83A 1T0YA 1SIFA 4HCNB 5CTRC 1IYFA 2N1WA 2N7DA 3KUZA 5AEKB 2D10A 3PT2B 5G2NA 4AJWA 2V1YA 2KANA 3HHMA 3H7PB 5JZEB 1P98A 1WX8A 2ZVOA 2M4NA 5D7GA 1YX6B 3KW5B 3VTWA 1P9DU 3SDLC 1V80A 1OQYA 4GXBA 3V62A 3ZNGC 2O6VD 1P0RA 2LGXA 4W9HA 4LJOB 4BFRA 2OJRA 5LXIB 2FCMA 2MWSB 2J0JA 1F9JA 5JH5C 3BY4B 1JRUA 3QWZB 1E8YA 3RULA 2KTFA 3AI5A 3EFUA 3H6NA 2ZPNA 3JYUA 1P1AA 2K8HA 2M0XA 2XBBC 3PHWB 3W1SC 2FAZA 5AZHA 3VH3B 2JXXA 3VUWA 2LI5A 1V5OA 1WXAA 3WIMA 4ANWA 1V49A 4II2B 2L0FA 5AZGA 4IW0A 2HE7A 1S1QB 4NQLB 2JPHA 2V4LA 4IM3A 4RM8A 3H9DA 2KLCA 3KYCD 3QX1A 5EDSA 4ZDVA 2NCNA 2DYMA 2MQJA 2J0MA 4JL9A 3DBSA 4WJQA 1KJTA 4MELA 3RT3B 4GDLA 2W9NA 2KX0A 2FUHB 3UIPB 1NDDA 3CMMB 1KM7A 2LVPA 5D6JB 3DCGA 4NJ7A 4FHKA 2WX0A 3I3TB 3R66C 4YL8A 3N30A 3ZTDA 3HM6X 1WJNA 1GC6A 3VTVA 2LRWA 4DDGD 2BWES 2MP2B 2VRRB 4NPNA 2D2QA 4FN2A 2DYBA 1YQBA 1GC7A 1H4RA 2IY0B 4EOYA 2KMAA 4K7SA 2KWCA 4WWPA 5D2MB 2MLBA 5BO4B 3ZRCA 3ALBA 4GB9A 4BKTA 1E8WA 2JWZA 4HLEA 2ZZPB 2DAJA 5FR6A 2MCNB 2FCSA 4GN1A 2ZVNA 1XT9B 4MSMB 3AU5A 2KDFB 3APCA 4HVBA 2HD5B 3NZSA 2ZCCA 4GOCA 2UWQA 2IZVB 2KVRA 2LXAA 5G55A 3IG3A 4MGYE 5AZFA 3VVWB 3ZNZB 3EC8A 3TMPB 1WF9A 3VDZA 2ZNVB 2Y5BB 3WA0A 2KO3A 3QAQA 2BF8B 2GMIC 2MBEA 3U30A 2KHWB 2KK8A 1WGYA 3AXCA 4W9JA 4WJPA 3RZWC 1V9JA 4TUUA 4TQ0A 3JSVA 3ZO5B 1R4NI 2NVUI 2KD0A 4ASWC 1HE8A 2CHZA 2G3QB 5JHAA 4PS8A 3M3JA 3ZUNA 1WRDB 2IO2B 2LUEA 1WGDA 2KX3A 3JW0X 1L2NA 4HCPB 3TBLD 4I6PA 5CHFA 4HPLB 2PEAA 1YJ1A 3T8MA 3A1QB 4LDTD 4M8NA 3VFKA 1RRBA 1EO6A 1I35A 2DZJA 3B0AA 3X23A 5C1ZA 2C5LC 1YX5B 2MRPA 2KDIA 4KIKA 3DPDA 2ZPYA 3VTUA 1WMHB 3GOEA 2NBVB 4BKSD 4JLCA 3VH4B 1EUVB 2GBJA 3ZTCA 3NZUA 2HJ8A 4ICUA 1CMXB 3H1UA 1ZGUB 3A9KB 3K9PB 1C1YB 3Q3JA 4PYUA 1ISNA 2KFKA 3PLUA 3ZDMC 3ZRFA 3TL5A 3DVGX 4WWOA 1SGHA 3CSFA 3MJWA 2JUOA 2XK5A 4IM2A 2O6VA 2EMSA 2HTHA 2IO1B 3AU4A 2ZNVC 4NQKE 3W1SA 2DZIA 2JF5A 3U8ZA 1GJZA 3X0WA 4HPMB 1IP9A 2KNBA 3N3KB 4AUQC 1FXTB 2ASQA 2LZ6A 2PJHA 4W9CA 1Q5WB 2JZZA 1GUAB 3B1LX 4BBNC 4BKGA 1WJ4A 1U4AA 3DOWA 5TR5A 4EFOA 2IYDB 2KC1A 4FLHA 2KC2A 3PREA 2R2QA 1WXSA 3K9OB 4A20A 1KLVA 4MGIE 1GNUA 2AYOB 2LJ5A 3ZIMA 3PPAA 4WQOB 1XD3B 2D3GA 2K8CA 4GDKA 2D11A 4P7IA 1WH3A 4F8CB 1LQBA 3ML8A 5DPWA 3EHVA 2GBNA 4W9LA 1NBFC 2LGDA 4CHKA 1UBQA 5L95C 4WJNA 3V6CB 2BYVE 3IHPC 3VUYA 3DQVA 4G50A 2G4DB 2CS4A 2KN5A 4ANVA 3DBHI 5JHBA 4F7ZA 4ZRIA 3M62B 2NS5A 3LJ3A
chains in the Genus database with same CATH superfamily
5CX3A 2QEJC 1X1MA 1WE7A 3I9V1 3L54A 3BZDB 4GLSC 4GDLB 2GBRA 3Q8CA 2PLPA 2WQYB 2L7RA 4HKZE 3RI7C 2OOBB 3IAS1 3QC8B 2Z8LA 3VXWA 4MJSA 3GZNI 2C60A 4HK2A 3MTNB 3ONSA 4OW0A 1FRDA 4IUMB 2ZW1A 3IBEA 2WXLA 2L0TA 3DVNV 1RLFA 3PZ7A 3Q8AA 1L5PA 3AEDB 5GXGB 2KDEB 3KYDD 2XNAC 3PVLA 1L7YA 1VD2A 3FKYA 2N9EB 4GIVA 4IWPA 2L1AA 2V3NA 2INCC 3JSVB 4W9IA 1WI0A 4BKSA 1DYQA 4TSSA 3SR6A 3V61A 3PLVA 3Q6BA 2BYFA 3RUIB 1XF5L 2DX5B 4IDIA 1L6VA 3NJTA 1ET9A 1QQRA 4IM0A 4LNIA 3V60A 1I4XA 2G1EA 1LGRA 3U7DA 2UYZB 1E90A 1VCBA 3BWUD 3NVZA 4EZLA 1IBXB 1Y56A 1HZ5A 4S17A 2KFKB 2KQ7A 3ECIA 4W9GA 1E10A 1DOXA 1UELA 4I6LB 1JCKB 4FULA 2V3SA 5IP4D 3ENEA 1L4DB 1ZPSA 3KWVA 3S2AA 4YSZB 4ANXA 4A9AA 3C8YA 4CQNA 1JWUD 2WDVB 4MGKE 1ZXHA 2WXIA 1TS5A 4WJOA 2E6XA 3WAOA 4LJPB 4EZKA 4RMAA 1NEKB 1ET6A 2JRHA 2AQ1B 1OEYA 3EGRA 4NNJB 3ML9A 2RPQA 1Z5SB 1YD8U 1OFFA 1TTNA 2QCZA 3SEBA 2BKRB 4RGNA 1R4MI 4GSWA 1JQ4A 3T9LA 4CYEA 3R7RA 2NBUA 1E8ZA 1V1PB 2LHEA 4WQMA 4A3OA 1TJEA 3EUB2 1E7PB 3GS2A 2KWVB 2K25A 3AULA 2OJWA 3TEZA 4KSKC 1FFUA 2A4ZA 3NHEB 3QIJA 1A5RA 3IVFA 4OVUA 5GMVA 3UIOB 3PTFC 5D3DA 4FA6A 2RSUA 4PS3A 3UQBA 3DHIC 2MX2A 1FMAD 1D6EC 1N6ZA 2KDBA 3W5UB 3DBHB 2L05A 4E3CA 1QOBA 3DBRB 1ZW7A 4LDTB 1H8CA 1JRPA 5C23A 1WXMA 2GBMA 2W3SA 2WXPA 4YTNB 4W9EA 2W54A 2N9PC 3ZVVA 5KHOA 4GMVA 4EEWA 4NJ6A 4EZJA 1N61A 4KSLC 2L8JA 4AJYB 2BPSA 1LXDA 5JXVA 2OEDA 3P2BA 2V9HA 3ZNID 4O1NA 2L3ZA 1F1HA 2KJHB 3L16A 3A4SC 2NMQA 2NBWB 4K7WA 3VRBB 3NRZA 3ZXRA 3A1QA 4EKUA 2NPTB 4BVUC 1WZ3A 1S3SG 3MC9A 3VR8B 3LYYA 3PRPB 1I4HA 4MGZE 4AP4C 5IA7A 2JT4B 3PV1A 4MM3A 2O2VB 4DQOC 4ANUA 1N62A 5L83A 2N1WA 5AEKB 1I7HA 2LGIA 3HHMA 1OQRA 1P98A 1WX8A 2ZVOA 5D3IB 2M4NA 3KW5B 3FC4A 1P9DU 3SDLC 3P4RB 2RDBC 4ARCA 1C79A 2LGXA 1FEHA 1F9JA 3BY4B 1JRUA 3RULA 4MGIE 1FD6A 2ZPNA 2IDYA 2FAZA 2JXXA 1FXIA 4ANWA 2HE7A 1S1QB 5EE0A 2JPHA 2V4LA 4IM3A 3KYCD 4HEA1 2HTME 3GB1A 2MQJA 4JL9A 3NS1A 4MELA 3BIID 5BYQA 4GDLA 2KX0A 1IGCA 3N20C 2BB6A 4RGTA 1YJJA 3AN1A 3R66C 2JWUA 3TUOA 4YL8A 2AX5A 3P1MA 1PDXA 1C4AA 1GC6A 2LRWA 2MP2B 2D2QA 2INNE 2V3PA 2M0AA 1YQBA 4B0MA 2DNFA 1H4RA 2KMAA 2KWCA 3ZRCA 2ICIA 1WYGA 4GB9A 5IN7A 1JROA 4M02A 4N58A 2LGSA 2ZZPB 1XT9B 1I4QA 4MSMB 3AU5A 2KDFB 4GOCA 2KVRA 1M4VA 2BBCA 2ZNVB 3QAQA 4KKJA 4WJPA 3RZWC 3DWMA 3JSVA 3Q2AC 5FR3A 1HE8A 1HXYD 2L83A 3P42A 2KX3A 2YEPB 3EFCA 3KWLA 3TEYA 4P1BC 2EKIA 1DOIA 3IT4B 1QT9A 2PEAA 1F77A 1FIQA 2DZJA 3X23A 3BVMA 2C5LC 3RN9C 1RM6C 1YX5B 2MRPA 3DBLB 3DPDA 1YQ3B 1KRHA 2SEBD 2PMVA 1T0QC 3ZTCA 4ICUA 1XCQL 1ZGUB 1JWMD 3K9PB 1IBXA 3Q3JA 1RWSA 1ISNA 2KFKA 3ZDMC 2WXJA 3DVGX 2JUOA 3AU4A 1J7BA 4HPMB 1GOZA 1TYGB 2BW2A 4BBNC 4W9CA 1TIFA 2PJHA 4BKGA 1Q5WB 1KFYB 2JZZA 3B1LX 4L1BA 3ZYYX 1WJ4A 1U4AA 2IYDB 2VH1A 2KC2A 3PREA 2KQ4X 4A20A 1KLVA 3ETRA 3GE3C 3AE5B 1AN8A 2INDC 3RNBC 1YQ4B 2JSVX 1MPEA 3FILB 2LGDA 3AV8A 1UBQA 2WDRB 3TEWA 4WJNA 1CJEA 3IHPC 1MJDA 3AE3B 3DQVA 1YMHE 3DBHI 3DBRI 1NVID 4XWTA 2IBIB 3I5JC 3OJ3A 1E8XA 3L4PA 3CSTA 4MDKE 2C9WB 2KOXA 3NVVA 1V86A 2JVCA 2LASA 2BT6A 4AWJA 2QC8A 1UWXA 2Z0EB 4WAFA 4FBJB 2IGHA 2JZ3B 1K53A 2AQ2B 4RGMA 4RF1A 2M17A 4CO7A 5TSSA 3AE8B 5CHVC 1FNUA 3AE7B 3HVDA 1TKGA 4HJGE 4NZLB 2FCQA 2WP9B 3UINB 2D07B 3RZFA 3AEAB 2M56B 3J9CA 1UBIA 3L08A 2JX5A 2JQRB 4HDQA 3TEXA 3AE6B 3MP9A 3H8HA 2CU3A 3B08A 4JWSC 2L32A 3QCAA 4I6NB 1TT5B 3N1ZC 4L23A 3AB5A 5J2RA 3NOBA 3WAPA 3OJ4B 3AE2B 2M19A 2FIDA 3RNFC 4IG7B 2R61A 1NYRA 2WGSA 4X57B 5T8IA 4NJCA 2QHOA 1J8CA 1WX9A 5DPRA 2AL6A 4ZRKA 1D3ZA 4YXDB 1UF0A 5D94A 2O6VB 1UZXB 4G0NB 4BBNF 1WGRA 1FCCC 2D5GA 3AE9B 1RFKA 5C2TB 5H92C 1KOTA 5IAAC 2EELA 2LRUA 2O2VA 2N0SB 1TS2A 4OVZA 4FADA 3PO0A 1EU4A 3HRDD 3M95A 3DDCB 4FJVB 4NY0A 2PE6B 1YN5A 3W1YA 3RCZA 3TJPA 3Q3OC 2JRIB 3PGEA 1ENFA 1D5MC 3QK0A 4RM9A 3OG5A 1E6EB 5MPOA 3KVFB 1WX7A 3V6EB 5IO9A 1KH0A 1SE9A 4MEMA 2KACA 3ZDTA 2K0PA 4OZAA 2BGFA 1SE2A 2BTEA 1KTKA 3NVYA 1I42A 2Q5WD 2WNMA 4ZYNA 4OZCA 2LXCA 4P16A 2FBWB 2IY1B 3Q3FA 4FJZA 4K7UA 2BS4B 2I1JA 2MW5A 2KMMA 4MH0E 3PS6A 2JY6A 4M8MA 2MP2A 5BYSA 2LWPA 3L0WB 4A6QA 4BOSC 4G11A 2RPVA 3DBLI 3I63C 4IWOA 2G4SA 2LD9A 3VAWA 2KQSA 3BYTB 1FXAA 2JU6X 2MBQA 4HDOA 1G6JA 1SEBD 2K6QA 2D3AA 2L76A 1Q1OA 4DHJD 3H7SA 2R2OA 4EE2A 1WM2A 4TV3A 3WCQA 1IPGA 1P3QU 2K6DB 2BB5A 4JIOU 1TBEA 2DAFA 4IWQA 4JQWC 1UD7A 2RD0A 1SXTA 3RD2A 4B6WA 4XYCA 3C0RB 3AE4B 2AWTA 2WU5B 3ZLZA 1ROEA 2J52A 2NR2A 4F1SA 1YN4A 1GAQB 4HRSA 1J7CA 2KJ6A 1QOAA 2G9HD 3DHGC 2BYEA 2IO0B 3WALA 1GB1A 4WURA 2WXNA 2KLGA 2TSSA 4WWNA 4A3PA 2BWFA 2REXA 4ITKA 3SHQA 3W2DA 4GGQA 2YEPF 3HIZA 2LGYA 2KTRB 2JZPA 2KXJA 2RGFA 5E6PA 1T0YA 4HCNB 5CTRC 1KLGD 3KUZA 1FO4A 3RMKC 5G2NA 2V1YA 5JZEB 1NENB 1UNSA 3KQ4A 1YX6B 4RFBA 5D7GA 2Y5PA 3VRAB 4TMAB 4RF0A 3ZNGC 3FILA 2ACZB 4BFRA 4W9HA 4LJOB 2OJRA 2FCMA 2H88B 1E8YA 5H8YE 3AI5A 3EFUA 1I4PA 2ZW0A 2K8HA 2M0XA 5AZHA 5AZGA 4IW0A 4LNKA 1QF6A 1BXTA 4JPSA 1RYJA 3DBSA 4WJQA 2ON8A 2FUHB 1L4ZB 4RH6A 3UIPB 3LXFA 3CMMB 3Q69A 1KM7A 2LHDA 2K3UA 3VTVA 4DDGD 2VRRB 1FPYA 4FN2A 1C4CA 3ZXVA 1VJKA 2DYBA 2HDEA 2LMCA 4K7SA 4WWPA 3P4QB 4BKTA 2JWZA 4HLEA 3AE1B 2MCNB 2FCSA 2BYTA 3APCA 1XO3A 4HVBA 1HTQA 2UWQA 3MJ5A 4JX1C 2IZVB 5AZFA 3EC8A 1WF9A 2BS2B 2Y5BB 1WGYA 2X38A 3AXCA 1V9JA 3SFEB 4TUUA 4TQ0A 3Q14C 3ZO5B 4YTPB 4ASWC 2KDMA 2G3QB 4C4VB 2IPKD 2IO2B 2PW9A 1JALA 3JW0X 3UI3A 2GI9A 4HPLB 3T8MA 1NI3A 2W82A 4M8NA 1I35A 4C00A 1XEEA 2QDFA 4BKSD 1EUVB 2PKOA 1OQQA 1YNTE 3A9KB 2K5PA 2AQ3B 3CSFA 4IM2A 2O6VA 2EMSA 2HTHA 2KYWA 2WDQB 2OHFA 2JF5A 3U8ZA 1IP9A 1QILA 1UUPA 4AUQC 2ASQA 2LZ6A 1YOVB 4KGRA 5TR5A 1T0RC 2R2QA 1WXSA 4WH4A 1GNUA 2LJ5A 4XE0A 4WQOB 4F8CB 2K8CA 5DPWA 1ACCA 2GBNA 3CIRB 4IKGA 3BK2A 3EA6A 4CHKA 4A8XC 3B2FA 3BVZA 1SB3C 4REZA 2WS3B 2KN5A 1T3QA 3MHZA 1WRIA 1BMLC 4ZRIA 4XGAB 2MA9B 5E6OA 3I57A 2GBKA 2LEKA 2I38A 4LK0M 3PRZA 4MT5A 2DBYA 4KX6B 5FK9C 5C3JB 1MG4A 1ZKHA 2LUMA 3QARA 4TKNA 1ZP0B 4USAA 4KDLB 2IGDA 1C9FA 2CKHB 2CU1A 3Q8EA 3SD5A 2WXHA 4XDCA 5LLIA 1WJUA 2WXKA 2MBHA 4LCDE 3E9SA 5I4DA 4KDIC 2RDHA 2XEWA 4C56C 3N32A 4PK1A 4AOFA 2WU2B 3AEFB 1SJHD 3UF8A 3ZJTA 1C77A 2QIEB 2MBBB 1STEA 2EMTA 3DVNU 3U2SC 3IFWB 1WJ6A 1OGWA 4AQ7A 2N4FA 3P4PB 4ARIA 1GG3A 4HPPA 1MI0A 2QMTA 3L10B 3QA8A 5KHQA 2DENB 1RAXA 1XLNA 3P63A 2BKFA 1WFYA 2J7QB 3OWEB 4YT0B 1XQQA 3NVWA 3W9CB 1KLUD 2CR5A 3KUCB 4UDUC 1J19A 4B9KA 2ZCBA 1QKZA 4E71A 3PZ8A 4S0RA 2J53A 3NUHB 2DWQA 1TY2A 5G5HA 2XK5B 4W9FA 3N1YC 4ACFA 1TZ1A 4KZCA 1SIJA 1YIWA 4J6IA 3WAMA 4YTMB 2KWUB 4N59A 1XCTL 1L0YB 2N7EA 2KTRA 2DYOA 1WXVA 3TCAA 2LVQA 3ZW3A 1V81A 4WAAA 4A55A 2PPHA 4KV2A 4TQ1A 3IXSA 3PRMB 3OAWA 3B2GA 5LXHA 2GOWA 4FJYA 4C80A 1EF1A 2W55A 3A4RA 1TS4A 4B95A 4DXFA 4NAWB 2C7HA 2ZJDA 3ABVB 3L13A 2CHXA 3WANA 3NS8A 3MHSD 4RCOA 1SJED 1V1PA 3GP7A 2JYEA 1BT0A 2KZRA 2YVCA 4M01A 5CHWA 1DGJA 2K39A 2NTTA 1ZDVA 2IGGA 4Q2JA 3HM3A 3GE8C 3VDZA 2FNJB 2VZKD 4FHJA 3SU8X 1TKEA 2J0KA 3NG0A 3R2IA 1WE6A 4PS7A 3A33B 2WYQA 1D4BA 2WXGA 1YJIA 5DCNA 1V8CA 3N1XC 4WIPA 2XN9C 1F2RC 4BOZB 2C7NB 1N63A 3Q8FA 3QQ8B 3RPFC 1MFWA 3R7QA 4XC2A 1VZ8A 4P6VF 2WHIA 3URYA 4MACA 3OLMD 2ONQA 1WSPA 1WR1A 2K22A 3RNGC 4C4VA 4RNAA 1ZOYB 3LDZE 3Q3MC 2K8BA 1M94A 2NPTA 2VH2A 1V2YA 3BINA 3RNAC 3JVZX 3HUIA 2B3AA 3Q3NC 4YSXB 1BUIC 1EF5A 2BVCA 1I4RA 3A9KA 1RFAA 1IGDA 2J42A 1XLOA 3A9JB 1WGHA 2UU7A 1AARA 1F2RI 2MJ3A 1WYWB 4DK5A 4GU2A 1QOGA 2AEHA 1E9MA 3KH0A 2V4IB 3DHHC 2N7DA 2D10A 3H7PB 4BAXA 1QLBB 3B9JA 2PTLA 3VTWA 2MHJA 5BMGA 3MC8A 4DXGA 2J4XA 4LNNA 3V62A 1SF0A 1P0RA 2MWSB 3QWZB 3BVGA 1L2NA 3H6NA 3JYUA 3W1SC 1P1AA 2WXQA 1JWSD 3VH3B 3VUWA 1V49A 2L0FA 3H9DA 3QX1A 2NCNA 3T3NA 1YN3A 3U4EG 1KJTA 2GB1A 4JE3B 3RT3B 2SAKA 3KLSX 2W3RA 5D6JB 1J7AA 3DCGA 2E3TA 4YWGG 3I3TB 1ZE3D 4LNOA 2I2YA 3ZTDA 1WJNA 4KKIA 4NPNA 1AW7A 1EM7A 1GC7A 5EE1A 5BO4B 3ALBA 1PFDA 5FR6A 3BYYB 4ZRPA 2HD5B 2WXRA 2LXAA 3ZNZB 1C4PA 2H89B 3VVWB 3TMPB 3WA0A 2BF8B 3MFGA 5HHDG 3U30A 2KK8A 4R3DA 1XLPA 1HTOA 1WGKA 3M3JA 1UGJA 2LUEA 1WGDA 5BYRA 4HCPB 3TBLD 4HROA 5CHFA 4US8A 1YJ1A 3VFKA 4LDTD 1F52A 1RRBA 2INPE 4H2AA 1C76A 3B0AA 5C1ZA 1K50A 2KDIA 3VTUA 1WMHB 4JLCA 2GBJA 3NZUA 2HJ8A 3H1UA 1V1OA 1K51A 2V0GA 5HFYA 4PYUA 3PLUA 3V3XA 3ZRFA 1PGAA 3MJWA 1FM0D 2XK5A 3W1SA 2IO1B 1N60A 4NQKE 2KNBA 1FXTB 1PGBA 3TSSA 1GUAB 3DOWA 1VDVA 4EFOA 2KC1A 5EE3A 3K9OB 2JXTA 2RMMA 3ZIMA 1EWCA 1P7EA 2IJ0A 3PPAA 2D3GA 4P7IA 2FE8A 3ML8A 4W9LA 1JW9D 5L95C 3VUYA 4G50A 2G4DB 2CS4A 2PVGC 4J3OD 5JHBA 4F7ZA 3M62B 3LJ3A 1LFDA 3DVGY 1WGGA 4NAWA 2N9KA 3VHTC 2Z59B 4OVVA 1V5TA 2BQQA 4DBGA 1VZ6A 4G3XB 4B0EA 1UGMA 1OTRB 1Y8RC 4HXDA 2N7JA 1PQSA 2HJ1A 1E0ZA 5IOIA 4MSQB 4IC7B 2A5UA 4DHJB 4JGHB 2EKEC 1NI2A 4ZYSA 3APDA 2K1FA 1QZEA 1UH6A 3IAM1 3UQAA 2C7MB 4MH8A 3QJZA 2LVOA 1NYQA 3ZKJC 1OEYJ 3U52E 3TIXA 4ZRJA 5EE9A 2WXFA 3R2TA 1TS3A 2Z0DB 1WZ0A 1ZDXA 3EECA 3VQIA 2DZKA 1XLQA 1CZPA 2D3CA 2L00B 2WWZA 3LB8C 4KZ0A 1MHXA 2CHWA 4DHZE 3KUDB 2MSED 4DWFA 1L0XB 3PZDA 2NTSA 1WXQA 4PYZA 4RGOS 2WXMA 1HQRD 3ZJUA 3L17A 1GPXA 1AYFA 4KIKB 4E74A 1EWYC 1CQVA 5J17A 3AEEB 2WLBA 1WIAA 4LLGM 1FNVA 5DPTA 3RFZB 2N9LA 3NY5A 1DOYA 1HA5A 1B1ZA 4KVGB 1TZOA 2N9XA 3VUXA 2Y3AA 4LNFA 1LM8B 2MJEA 2Y5CA 1FCLA 2GRIA 2N1VA 4M0WB 3PHXB 3ZQ4A 1R4NB 4XX5A 5FKAC 3CWIA 4QAYA 1D5ZC 2KN4A 3A9JA 4HWIB 1VRAB 2DHZA 1C3TA 4WWMA 4A90A 1K52A 2PE9A 1TGZB 4GDKB 2MEKA 3APFA 1E7UA 3HK0A 1Z2MA 2KFJA 2M1MA 4DHZB 2FUG1 4W9DA 2QJLA 3H7PA 1K8RB 1T0SC 1WR6E 4HJKA 5HKHA 2LFIA 1TY0A 3UGBB 5E6NA 4N9F4 5IKCM 1L6UA 1D5XC 1WY8A 4XZ4A 2D3BA 3ZJVA 4XWWA 4OHJA 4M00A 4K1RB 2G45B 3QHTA 4KGSA 4II3B 1F0ZA 4C7ZA 4K3BA 1Q0WB 4MJSB 1MG8A 1VLBA 5LNK1 3ZGZA 2KMCA 2KKCA 4ZRQA 4EUTA 2WX1A 1PYWD 1JWBD 3RYTA 4URKA 4XDDA 1KF6B 2WDTB 1WM3A 4N6EB 2GLSA 2KVZA 1JMLA 1WWTA 3AH7A 3ZNHB 3FAHA 5DPSA 4IOIE 3D32A 1PUTA 2QILA 2DZMA 3M63B 1E5WA 2B76B 1GB4A 2WXOA 4PT5A 1PGXA 1QOFA 4K81A 4K3CA 3GZNB 2IO3B 2YLMA 2FIFA 2I1KA 2AL3A 2PVOD 4ICVA 4W9KA 2RDGA 2KJRA 3AEBB 4L2YA 2FCNA 2MBOA 3NZ3A 5G5GA 3CF6E 1A70A 5J18A 3O65B 2MH7A 2M8SA 5AUIA 2L52A 4OZBA 4ZHOA 4KGTA 1J0GA 1WMHA 4DDID 1TKYA 3PSEB 2ZEQA 3T3OA 4DXAB 1XXGA 2RR9A 1V6EA 1V97A 4HKQA 3R3MA 5HI1A 1E7VA 3AM9A 1SIFA 1AWDA 2LJIA 1IYFA 5BMHA 4NAMA 3PT2B 4AS1A 4AJWA 2KANA 3AEGB 3HVZA 1FFVA 1Q10A 1ZXIA 4LTUA 1V80A 1OQYA 1UWMA 4GXBA 2O6VD 5LXIB 2J0JA 5JH5C 2KTFA 1GJZA 1SE4A 3PHWB 2XBBC 1T6BX 3BK1A 3MC0B 1V5OA 1WXAA 2LI5A 3WIMA 4II2B 1P7FA 4NQLB 1MHHE 4RM8A 2KLCA 5EDSA 4ZDVA 4ZOHC 2DYMA 2J0MA 3W5VB 2KAJA 2W9NA 1NDDA 1N5XA 2LVPA 1R7SA 5E6JA 4NJ7A 4FHKA 1FNWA 2WX0A 3N30A 3U7ZA 1VR9A 3HM6X 1IUEA 3RNCC 2BWES 2KWDA 2IY0B 2JYTA 4EOYA 5D2MB 1EU3A 2MLBA 1E8WA 2DAJA 2BS3B 4GN1A 1R4MB 2ZVNA 3V05A 3NZSA 2ZCCA 1MVKA 5G55A 3E56A 3IG3A 4MGYE 1SSNA 1L0VB 2KO3A 2GMIC 2MBEA 2KHWB 4W9JA 1R4NI 1B9RA 1FRRA 2KD0A 2KT7A 2NVUI 3P4SB 2CHZA 5JHAA 4PS8A 3ZUNA 1WRDB 2X8XX 3IT6B 5HG2A 5BMIA 3SFDB 4I6PA 1I4GA 3A1QB 1CK1A 1EO6A 2DLBA 3RNEC 1HZ6A 4BZAA 1ZUD2 1SBBB 4KIKA 1JWAD 2ZPYA 3GOEA 1HEZE 2NBVB 3VH4B 3VR9B 4D2KA 4ZHPA 3C19A 4JWUC 1CMXB 2MJDA 4FXCA 1C1YB 1N5WA 4YSYB 1T5XD 3TL5A 4WWOA 1SGHA 4C7YA 1LO5D 4MM3B 2ZNVC 2DZIA 4M0WA 3X0WA 1VZ7A 3N3KB 4US9A 3R8BA 4FLHA 2QSDA 2CJOA 1C78A 2AYOB 2PIAA 2CJNA 3N9YC 3O13A 1ESFA 1XD3B 4GDKA 2D11A 3Q8BA 1WH3A 1LQBA 3AMZA 3EHVA 1NBFC 3AECB 1SE3A 3V6CB 2BYVE 2K9XA 4P1CC 2VZKB 5AUKA 3DWGC 4ANVA 2NS5A
chains in the Genus database with same CATH topology
1LFDA 3DVGY 5CX3A 2MA9B 5E6OA 1WGGA 4NAWA 3VHTC 2Z59B 4OVVA 1X1MA 1WE7A 2GBKA 1V5TA 3L54A 4DBGA 2IBIB 4G3XB 2GBRA 4GDLB 1UGMA 2L7RA 3OJ3A 1E8XA 3PRZA 3CSTA 2OOBB 4MDKE 2C9WB 3QC8B 2KOXA 1OTRB 1Y8RC 4HXDA 3VXWA 1ZKHA 1V86A 4MJSA 1PQSA 2JVCA 2LASA 2C60A 3GZNI 3MTNB 3ONSA 4HK2A 3QARA 4AWJA 4MSQB 4IC7B 2A5UA 4TKNA 2Z0EB 4DHJB 4JGHB 4FBJB 2EKEC 1NI2A 4IUMB 2JZ3B 3APDA 4KDLB 2K1FA 3IBEA 1QZEA 1UH6A 2L0TA 2CKHB 2CU1A 2M17A 1RLFA 3DVNV 3SD5A 4CO7A 2C7MB 3UQAA 5CHVC 5LLIA 1WJUA 2MBHA 4LCDE 3QJZA 2LVOA 4KDIC 3ZKJC 2KDEB 3KYDD 1OEYJ 3PVLA 3TIXA 2FCQA 2XEWA 3N32A 4ZRJA 3UINB 1L7YA 4AOFA 2D07B 3RZFA 1VD2A 3UF8A 2Z0DB 1UBIA 3L08A 2N9EB 1WZ0A 4GIVA 4HDQA 4IWPA 3EECA 3VQIA 2DZKA 3JSVB 2MBBB 4W9IA 2L00B 2EMTA 2WWZA 1WI0A 3DVNU 4KZ0A 4BKSA 3IFWB 1WJ6A 3B08A 1OGWA 2N4FA 2CHWA 3V61A 3QCAA 4DHZE 4I6NB 1GG3A 3PLVA 3L10B 3QA8A 5KHQA 3KUDB 2MSED 2BYFA 2DENB 4DWFA 5J2RA 3NOBA 1RAXA 3RUIB 2DX5B 3WAPA 3PZDA 3OJ4B 2BKFA 4PYZA 1WFYA 2J7QB 2FIDA 3L17A 4IG7B 1XQQA 4IM0A 4KIKB 2CR5A 3KUCB 4E74A 3V60A 1J19A 4B9KA 5J17A 4X57B 1WIAA 3U7DA 2UYZB 2ZCBA 5DPTA 1E90A 1VCBA 1WX9A 2QHOA 3NY5A 4E71A 5DPRA 4EZLA 1J8CA 2AL6A 4ZRKA 1D3ZA 4KVGB 2KFKB 2N9XA 2KQ7A 3VUXA 3ECIA 1LM8B 4W9GA 2XK5B 4W9FA 5D94A 2O6VB 1A5RA 1UZXB 2N1VA 1UELA 1WGRA 4G0NB 4M0WB 4BBNF 3PHXB 4I6LB 1TZ1A 4KZCA 4FULA 2V3SA 4XX5A 1YIWA 4J6IA 3ENEA 3WAMA 1KOTA 2KWUB 3A9JA 4HWIB 2N7EA 2DHZA 1C3TA 3S2AA 5IAAC 2PE9A 2KTRA 2DYOA 2LRUA 1TGZB 1WXVA 4ANXA 2O2VA 4GDKB 4MGKE 3APFA 1E7UA 3TCAA 2LVQA 3HK0A 4WJOA 1V81A 1Z2MA 2KFJA 4WAAA 3ZW3A 2M1MA 4FADA 3M95A 3WAOA 3DDCB 4DHZB 4LJPB 4W9DA 4FJVB 2PPHA 4NY0A 4KV2A 4TQ1A 3H7PA 1K8RB 2PE6B 4RMAA 4EZKA 3PRMB 2JRHA 3OAWA 1WR6E 5LXHA 4HJKA 1OEYA 2GOWA 3W1YA 4NNJB 5HKHA 4FJYA 3ML9A 3UGBB 3RCZA 3TJPA 1EF1A 5E6NA 3A4RA 4N9F4 4B95A 2JRIB 3PGEA 2RPQA 4NAWB 1WY8A 2C7HA 2ZJDA 4XZ4A 3QK0A 3L13A 4RM9A 1Z5SB 1YD8U 2CHXA 1TTNA 3KVFB 1WX7A 3V6EB 3WANA 3NS8A 2BKRB 3MHSD 4K1RB 1R4MI 1SE9A 4GSWA 2G45B 3QHTA 4MEMA 4II3B 3R7RA 3T9LA 4CYEA 2NBUA 1E8ZA 3ZDTA 1Q0WB 4MJSB 2BGFA 1BT0A 1MG8A 4A3OA 2KZRA 2YVCA 2KMCA 1I42A 5CHWA 2KKCA 2KWVB 2K39A 4ZYNA 2K25A 3AULA 2LXCA 4EUTA 2WX1A 4KSKC 2IY1B 2A4ZA 3NHEB 3HM3A 3QIJA 3IVFA 4OVUA 5GMVA 3UIOB 3PTFC 3Q3FA 4FJZA 4K7UA 3RYTA 4URKA 2FNJB 2I1JA 4FHJA 2MW5A 2RSUA 4FA6A 3SU8X 4PS3A 3UQBA 2MX2A 2J0KA 2WDTB 1WM3A 4MH0E 1WE6A 2KDBA 4PS7A 3A33B 2L05A 4E3CA 3PS6A 2WYQA 2JY6A 4M8MA 1ZW7A 2MP2A 4LDTB 2LWPA 1H8CA 5DCNA 3L0WB 3ZNHB 4BOSC 4G11A 5C23A 1WXMA 3DBLI 2GBMA 5DPSA 4BOZB 2C7NB 4IWOA 2G4SA 2LD9A 4W9EA 3VAWA 3D32A 2KQSA 3QQ8B 2DZMA 3M63B 1E5WA 2MBQA 1G6JA 4HDOA 3R7QA 2N9PC 3ZVVA 4XC2A 2K6QA 5KHOA 4GMVA 4K81A 4EEWA 4NJ6A 4EZJA 2L76A 4KSLC 1Q1OA 2IO3B 2L8JA 3H7SA 4DHJD 4AJYB 3OLMD 2YLMA 2R2OA 1WM2A 2FIFA 2I1KA 4TV3A 1IPGA 2AL3A 2BPSA 2K6DB 1P3QU 1WR1A 1LXDA 4ICVA 4JIOU 4W9KA 1TBEA 2DAFA 3P2BA 4IWQA 4JQWC 1UD7A 3LDZE 2RD0A 3ZNID 3RD2A 2KJRA 4B6WA 2L3ZA 3C0RB 2FCNA 2MBOA 2AWTA 2KJHB 3DBRI 3L16A 3A4SC 3ZLZA 2K8BA 2NBWB 4K7WA 2NR2A 3CF6E 4F1SA 1M94A 5J18A 2NPTA 3A1QA 3O65B 4EKUA 2NPTB 1V2YA 3BINA 2M8SA 4BVUC 2KJ6A 3JVZX 3WALA 2BYEA 2IO0B 2B3AA 1WZ3A 2KLGA 1S3SG 1J0GA 1WMHA 4WWNA 4A3PA 1EF5A 4DDID 3PSEB 3PRPB 2ZEQA 2BWFA 4DXAB 3A9KA 1RFAA 2REXA 3SHQA 4MGZE 4GGQA 3A9JB 2RR9A 4AP4C 5IA7A 1WGHA 1V6EA 3HIZA 2LGYA 1AARA 2JT4B 2KTRB 1WYWB 3PV1A 2KXJA 4MM3A 4DK5A 3R3MA 2O2VB 2AEHA 2RGFA 4GU2A 4ANUA 1E7VA 3KH0A 5E6PA 5L83A 1T0YA 1SIFA 4HCNB 5CTRC 1IYFA 2N1WA 2N7DA 3KUZA 5AEKB 2D10A 3PT2B 5G2NA 4AJWA 2V1YA 2KANA 3HHMA 3H7PB 5JZEB 1P98A 1WX8A 2ZVOA 2M4NA 5D7GA 1YX6B 3KW5B 3VTWA 1P9DU 3SDLC 1V80A 1OQYA 4GXBA 3V62A 3ZNGC 2O6VD 1P0RA 2LGXA 4W9HA 4LJOB 4BFRA 2OJRA 5LXIB 2FCMA 2MWSB 2J0JA 1F9JA 5JH5C 3BY4B 1JRUA 3QWZB 1E8YA 3RULA 2KTFA 3AI5A 3EFUA 3H6NA 2ZPNA 3JYUA 1P1AA 2K8HA 2M0XA 2XBBC 3PHWB 3W1SC 2FAZA 5AZHA 3VH3B 2JXXA 3VUWA 2LI5A 1V5OA 1WXAA 3WIMA 4ANWA 1V49A 4II2B 2L0FA 5AZGA 4IW0A 2HE7A 1S1QB 4NQLB 2JPHA 2V4LA 4IM3A 4RM8A 3H9DA 2KLCA 3KYCD 3QX1A 5EDSA 4ZDVA 2NCNA 2DYMA 2MQJA 2J0MA 4JL9A 3DBSA 4WJQA 1KJTA 4MELA 3RT3B 4GDLA 2W9NA 2KX0A 2FUHB 3UIPB 1NDDA 3CMMB 1KM7A 2LVPA 5D6JB 3DCGA 4NJ7A 4FHKA 2WX0A 3I3TB 3R66C 4YL8A 3N30A 3ZTDA 3HM6X 1WJNA 1GC6A 3VTVA 2LRWA 4DDGD 2BWES 2MP2B 2VRRB 4NPNA 2D2QA 4FN2A 2DYBA 1YQBA 1GC7A 1H4RA 2IY0B 4EOYA 2KMAA 4K7SA 2KWCA 4WWPA 5D2MB 2MLBA 5BO4B 3ZRCA 3ALBA 4GB9A 4BKTA 1E8WA 2JWZA 4HLEA 2ZZPB 2DAJA 5FR6A 2MCNB 2FCSA 4GN1A 2ZVNA 1XT9B 4MSMB 3AU5A 2KDFB 3APCA 4HVBA 2HD5B 3NZSA 2ZCCA 4GOCA 2UWQA 2IZVB 2KVRA 2LXAA 5G55A 3IG3A 4MGYE 5AZFA 3VVWB 3ZNZB 3EC8A 3TMPB 1WF9A 3VDZA 2ZNVB 2Y5BB 3WA0A 2KO3A 3QAQA 2BF8B 2GMIC 2MBEA 3U30A 2KHWB 2KK8A 1WGYA 3AXCA 4W9JA 4WJPA 3RZWC 1V9JA 4TUUA 4TQ0A 3JSVA 3ZO5B 1R4NI 2NVUI 2KD0A 4ASWC 1HE8A 2CHZA 2G3QB 5JHAA 4PS8A 3M3JA 3ZUNA 1WRDB 2IO2B 2LUEA 1WGDA 2KX3A 3JW0X 1L2NA 4HCPB 3TBLD 4I6PA 5CHFA 4HPLB 2PEAA 1YJ1A 3T8MA 3A1QB 4LDTD 4M8NA 3VFKA 1RRBA 1EO6A 1I35A 2DZJA 3B0AA 3X23A 5C1ZA 2C5LC 1YX5B 2MRPA 2KDIA 4KIKA 3DPDA 2ZPYA 3VTUA 1WMHB 3GOEA 2NBVB 4BKSD 4JLCA 3VH4B 1EUVB 2GBJA 3ZTCA 3NZUA 2HJ8A 4ICUA 1CMXB 3H1UA 1ZGUB 3A9KB 3K9PB 1C1YB 3Q3JA 4PYUA 1ISNA 2KFKA 3PLUA 3ZDMC 3ZRFA 3TL5A 3DVGX 4WWOA 1SGHA 3CSFA 3MJWA 2JUOA 2XK5A 4IM2A 2O6VA 2EMSA 2HTHA 2IO1B 3AU4A 2ZNVC 4NQKE 3W1SA 2DZIA 2JF5A 3U8ZA 1GJZA 3X0WA 4HPMB 1IP9A 2KNBA 3N3KB 4AUQC 1FXTB 2ASQA 2LZ6A 2PJHA 4W9CA 1Q5WB 2JZZA 1GUAB 3B1LX 4BBNC 4BKGA 1WJ4A 1U4AA 3DOWA 5TR5A 4EFOA 2IYDB 2KC1A 4FLHA 2KC2A 3PREA 2R2QA 1WXSA 3K9OB 4A20A 1KLVA 4MGIE 1GNUA 2AYOB 2LJ5A 3ZIMA 3PPAA 4WQOB 1XD3B 2D3GA 2K8CA 4GDKA 2D11A 4P7IA 1WH3A 4F8CB 1LQBA 3ML8A 5DPWA 3EHVA 2GBNA 4W9LA 1NBFC 2LGDA 4CHKA 1UBQA 5L95C 4WJNA 3V6CB 2BYVE 3IHPC 3VUYA 3DQVA 4G50A 2G4DB 2CS4A 2KN5A 4ANVA 3DBHI 5JHBA 4F7ZA 4ZRIA 3M62B 2NS5A 3LJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LFD A;  3DVG Y;  5CX3 A;  2MA9 B;  5E6O A;  1WGG A;  4NAW A;  3VHT C;  2Z59 B;  4OVV A;  1X1M A;  1WE7 A;  2GBK A;  1V5T A;  3L54 A;  4DBG A;  2IBI B;  4G3X B;  2GBR A;  4GDL B;  1UGM A;  2L7R A;  3OJ3 A;  1E8X A;  3PRZ A;  3CST A;  2OOB B;  4MDK E;  2C9W B;  3QC8 B;  2KOX A;  1OTR B;  1Y8R C;  4HXD A;  3VXW A;  1ZKH A;  1V86 A;  4MJS A;  1PQS A;  2JVC A;  2LAS A;  2C60 A;  3GZN I;  3MTN B;  3ONS A;  4HK2 A;  3QAR A;  4AWJ A;  4MSQ B;  4IC7 B;  2A5U A;  4TKN A;  2Z0E B;  4DHJ B;  4JGH B;  4FBJ B;  2EKE C;  1NI2 A;  4IUM B;  2JZ3 B;  3APD A;  4KDL B;  2K1F A;  3IBE A;  1QZE A;  1UH6 A;  2L0T A;  2CKH B;  2CU1 A;  2M17 A;  1RLF A;  3DVN V;  3SD5 A;  4CO7 A;  2C7M B;  3UQA A;  5CHV C;  5LLI A;  1WJU A;  2MBH A;  4LCD E;  3QJZ A;  2LVO A;  4KDI C;  3ZKJ C;  2KDE B;  3KYD D;  1OEY J;  3PVL A;  3TIX A;  2FCQ A;  2XEW A;  3N32 A;  4ZRJ A;  3UIN B;  1L7Y A;  4AOF A;  2D07 B;  3RZF A;  1VD2 A;  3UF8 A;  2Z0D B;  1UBI A;  3L08 A;  2N9E B;  1WZ0 A;  4GIV A;  4HDQ A;  4IWP A;  3EEC A;  3VQI A;  2DZK A;  3JSV B;  2MBB B;  4W9I A;  2L00 B;  2EMT A;  2WWZ A;  1WI0 A;  3DVN U;  4KZ0 A;  4BKS A;  3IFW B;  1WJ6 A;  3B08 A;  1OGW A;  2N4F A;  2CHW A;  3V61 A;  3QCA A;  4DHZ E;  4I6N B;  1GG3 A;  3PLV A;  3L10 B;  3QA8 A;  5KHQ A;  3KUD B;  2MSE D;  2BYF A;  2DEN B;  4DWF A;  5J2R A;  3NOB A;  1RAX A;  3RUI B;  2DX5 B;  3WAP A;  3PZD A;  3OJ4 B;  2BKF A;  4PYZ A;  1WFY A;  2J7Q B;  2FID A;  3L17 A;  4IG7 B;  1XQQ A;  4IM0 A;  4KIK B;  2CR5 A;  3KUC B;  4E74 A;  3V60 A;  1J19 A;  4B9K A;  5J17 A;  4X57 B;  1WIA A;  3U7D A;  2UYZ B;  2ZCB A;  5DPT A;  1E90 A;  1VCB A;  1WX9 A;  2QHO A;  3NY5 A;  4E71 A;  5DPR A;  4EZL A;  1J8C A;  2AL6 A;  4ZRK A;  1D3Z A;  4KVG B;  2KFK B;  2N9X A;  2KQ7 A;  3VUX A;  3ECI A;  1LM8 B;  4W9G A;  2XK5 B;  4W9F A;  5D94 A;  2O6V B;  1A5R A;  1UZX B;  2N1V A;  1UEL A;  1WGR A;  4G0N B;  4M0W B;  4BBN F;  3PHX B;  4I6L B;  1TZ1 A;  4KZC A;  4FUL A;  2V3S A;  4XX5 A;  1YIW A;  4J6I A;  3ENE A;  3WAM A;  1KOT A;  2KWU B;  3A9J A;  4HWI B;  2N7E A;  2DHZ A;  1C3T A;  3S2A A;  5IAA C;  2PE9 A;  2KTR A;  2DYO A;  2LRU A;  1TGZ B;  1WXV A;  4ANX A;  2O2V A;  4GDK B;  4MGK E;  3APF A;  1E7U A;  3TCA A;  2LVQ A;  3HK0 A;  4WJO A;  1V81 A;  1Z2M A;  2KFJ A;  4WAA A;  3ZW3 A;  2M1M A;  4FAD A;  3M95 A;  3WAO A;  3DDC B;  4DHZ B;  4LJP B;  4W9D A;  4FJV B;  2PPH A;  4NY0 A;  4KV2 A;  4TQ1 A;  3H7P A;  1K8R B;  2PE6 B;  4RMA A;  4EZK A;  3PRM B;  2JRH A;  3OAW A;  1WR6 E;  5LXH A;  4HJK A;  1OEY A;  2GOW A;  3W1Y A;  4NNJ B;  5HKH A;  4FJY A;  3ML9 A;  3UGB B;  3RCZ A;  3TJP A;  1EF1 A;  5E6N A;  3A4R A;  4N9F 4;  4B95 A;  2JRI B;  3PGE A;  2RPQ A;  4NAW B;  1WY8 A;  2C7H A;  2ZJD A;  4XZ4 A;  3QK0 A;  3L13 A;  4RM9 A;  1Z5S B;  1YD8 U;  2CHX A;  1TTN A;  3KVF B;  1WX7 A;  3V6E B;  3WAN A;  3NS8 A;  2BKR B;  3MHS D;  4K1R B;  1R4M I;  1SE9 A;  4GSW A;  2G45 B;  3QHT A;  4MEM A;  4II3 B;  3R7R A;  3T9L A;  4CYE A;  2NBU A;  1E8Z A;  3ZDT A;  1Q0W B;  4MJS B;  2BGF A;  1BT0 A;  1MG8 A;  4A3O A;  2KZR A;  2YVC A;  2KMC A;  1I42 A;  5CHW A;  2KKC A;  2KWV B;  2K39 A;  4ZYN A;  2K25 A;  3AUL A;  2LXC A;  4EUT A;  2WX1 A;  4KSK C;  2IY1 B;  2A4Z A;  3NHE B;  3HM3 A;  3QIJ A;  3IVF A;  4OVU A;  5GMV A;  3UIO B;  3PTF C;  3Q3F A;  4FJZ A;  4K7U A;  3RYT A;  4URK A;  2FNJ B;  2I1J A;  4FHJ A;  2MW5 A;  2RSU A;  4FA6 A;  3SU8 X;  4PS3 A;  3UQB A;  2MX2 A;  2J0K A;  2WDT B;  1WM3 A;  4MH0 E;  1WE6 A;  2KDB A;  4PS7 A;  3A33 B;  2L05 A;  4E3C A;  3PS6 A;  2WYQ A;  2JY6 A;  4M8M A;  1ZW7 A;  2MP2 A;  4LDT B;  2LWP A;  1H8C A;  5DCN A;  3L0W B;  3ZNH B;  4BOS C;  4G11 A;  5C23 A;  1WXM A;  3DBL I;  2GBM A;  5DPS A;  4BOZ B;  2C7N B;  4IWO A;  2G4S A;  2LD9 A;  4W9E A;  3VAW A;  3D32 A;  2KQS A;  3QQ8 B;  2DZM A;  3M63 B;  1E5W A;  2MBQ A;  1G6J A;  4HDO A;  3R7Q A;  2N9P C;  3ZVV A;  4XC2 A;  2K6Q A;  5KHO A;  4GMV A;  4K81 A;  4EEW A;  4NJ6 A;  4EZJ A;  2L76 A;  4KSL C;  1Q1O A;  2IO3 B;  2L8J A;  3H7S A;  4DHJ D;  4AJY B;  3OLM D;  2YLM A;  2R2O A;  1WM2 A;  2FIF A;  2I1K A;  4TV3 A;  1IPG A;  2AL3 A;  2BPS A;  2K6D B;  1P3Q U;  1WR1 A;  1LXD A;  4ICV A;  4JIO U;  4W9K A;  1TBE A;  2DAF A;  3P2B A;  4IWQ A;  4JQW C;  1UD7 A;  3LDZ E;  2RD0 A;  3ZNI D;  3RD2 A;  2KJR A;  4B6W A;  2L3Z A;  3C0R B;  2FCN A;  2MBO A;  2AWT A;  2KJH B;  3DBR I;  3L16 A;  3A4S C;  3ZLZ A;  2K8B A;  2NBW B;  4K7W A;  2NR2 A;  3CF6 E;  4F1S A;  1M94 A;  5J18 A;  2NPT A;  3A1Q A;  3O65 B;  4EKU A;  2NPT B;  1V2Y A;  3BIN A;  2M8S A;  4BVU C;  2KJ6 A;  3JVZ X;  3WAL A;  2BYE A;  2IO0 B;  2B3A A;  1WZ3 A;  2KLG A;  1S3S G;  1J0G A;  1WMH A;  4WWN A;  4A3P A;  1EF5 A;  4DDI D;  3PSE B;  3PRP B;  2ZEQ A;  2BWF A;  4DXA B;  3A9K A;  1RFA A;  2REX A;  3SHQ A;  4MGZ E;  4GGQ A;  3A9J B;  2RR9 A;  4AP4 C;  5IA7 A;  1WGH A;  1V6E A;  3HIZ A;  2LGY A;  1AAR A;  2JT4 B;  2KTR B;  1WYW B;  3PV1 A;  2KXJ A;  4MM3 A;  4DK5 A;  3R3M A;  2O2V B;  2AEH A;  2RGF A;  4GU2 A;  4ANU A;  1E7V A;  3KH0 A;  5E6P A;  5L83 A;  1T0Y A;  1SIF A;  4HCN B;  5CTR C;  1IYF A;  2N1W A;  2N7D A;  3KUZ A;  5AEK B;  2D10 A;  3PT2 B;  5G2N A;  4AJW A;  2V1Y A;  2KAN A;  3HHM A;  3H7P B;  5JZE B;  1P98 A;  1WX8 A;  2ZVO A;  2M4N A;  5D7G A;  1YX6 B;  3KW5 B;  3VTW A;  1P9D U;  3SDL C;  1V80 A;  1OQY A;  4GXB A;  3V62 A;  3ZNG C;  2O6V D;  1P0R A;  2LGX A;  4W9H A;  4LJO B;  4BFR A;  2OJR A;  5LXI B;  2FCM A;  2MWS B;  2J0J A;  1F9J A;  5JH5 C;  3BY4 B;  1JRU A;  3QWZ B;  1E8Y A;  3RUL A;  2KTF A;  3AI5 A;  3EFU A;  3H6N A;  2ZPN A;  3JYU A;  1P1A A;  2K8H A;  2M0X A;  2XBB C;  3PHW B;  3W1S C;  2FAZ A;  5AZH A;  3VH3 B;  2JXX A;  3VUW A;  2LI5 A;  1V5O A;  1WXA A;  3WIM A;  4ANW A;  1V49 A;  4II2 B;  2L0F A;  5AZG A;  4IW0 A;  2HE7 A;  1S1Q B;  4NQL B;  2JPH A;  2V4L A;  4IM3 A;  4RM8 A;  3H9D A;  2KLC A;  3KYC D;  3QX1 A;  5EDS A;  4ZDV A;  2NCN A;  2DYM A;  2MQJ A;  2J0M A;  4JL9 A;  3DBS A;  4WJQ A;  1KJT A;  4MEL A;  3RT3 B;  4GDL A;  2W9N A;  2KX0 A;  2FUH B;  3UIP B;  1NDD A;  3CMM B;  1KM7 A;  2LVP A;  5D6J B;  3DCG A;  4NJ7 A;  4FHK A;  2WX0 A;  3I3T B;  3R66 C;  4YL8 A;  3N30 A;  3ZTD A;  3HM6 X;  1WJN A;  1GC6 A;  3VTV A;  2LRW A;  4DDG D;  2BWE S;  2MP2 B;  2VRR B;  4NPN A;  2D2Q A;  4FN2 A;  2DYB A;  1YQB A;  1GC7 A;  1H4R A;  2IY0 B;  4EOY A;  2KMA A;  4K7S A;  2KWC A;  4WWP A;  5D2M B;  2MLB A;  5BO4 B;  3ZRC A;  3ALB A;  4GB9 A;  4BKT A;  1E8W A;  2JWZ A;  4HLE A;  2ZZP B;  2DAJ A;  5FR6 A;  2MCN B;  2FCS A;  4GN1 A;  2ZVN A;  1XT9 B;  4MSM B;  3AU5 A;  2KDF B;  3APC A;  4HVB A;  2HD5 B;  3NZS A;  2ZCC A;  4GOC A;  2UWQ A;  2IZV B;  2KVR A;  2LXA A;  5G55 A;  3IG3 A;  4MGY E;  5AZF A;  3VVW B;  3ZNZ B;  3EC8 A;  3TMP B;  1WF9 A;  3VDZ A;  2ZNV B;  2Y5B B;  3WA0 A;  2KO3 A;  3QAQ A;  2BF8 B;  2GMI C;  2MBE A;  3U30 A;  2KHW B;  2KK8 A;  1WGY A;  3AXC A;  4W9J A;  4WJP A;  3RZW C;  1V9J A;  4TUU A;  4TQ0 A;  3JSV A;  3ZO5 B;  1R4N I;  2NVU I;  2KD0 A;  4ASW C;  1HE8 A;  2CHZ A;  2G3Q B;  5JHA A;  4PS8 A;  3M3J A;  3ZUN A;  1WRD B;  2IO2 B;  2LUE A;  1WGD A;  2KX3 A;  3JW0 X;  1L2N A;  4HCP B;  3TBL D;  4I6P A;  5CHF A;  4HPL B;  2PEA A;  1YJ1 A;  3T8M A;  3A1Q B;  4LDT D;  4M8N A;  3VFK A;  1RRB A;  1EO6 A;  1I35 A;  2DZJ A;  3B0A A;  3X23 A;  5C1Z A;  2C5L C;  1YX5 B;  2MRP A;  2KDI A;  4KIK A;  3DPD A;  2ZPY A;  3VTU A;  1WMH B;  3GOE A;  2NBV B;  4BKS D;  4JLC A;  3VH4 B;  1EUV B;  2GBJ A;  3ZTC A;  3NZU A;  2HJ8 A;  4ICU A;  1CMX B;  3H1U A;  1ZGU B;  3A9K B;  3K9P B;  1C1Y B;  3Q3J A;  4PYU A;  1ISN A;  2KFK A;  3PLU A;  3ZDM C;  3ZRF A;  3TL5 A;  3DVG X;  4WWO A;  1SGH A;  3CSF A;  3MJW A;  2JUO A;  2XK5 A;  4IM2 A;  2O6V A;  2EMS A;  2HTH A;  2IO1 B;  3AU4 A;  2ZNV C;  4NQK E;  3W1S A;  2DZI A;  2JF5 A;  3U8Z A;  1GJZ A;  3X0W A;  4HPM B;  1IP9 A;  2KNB A;  3N3K B;  4AUQ C;  1FXT B;  2ASQ A;  2LZ6 A;  2PJH A;  4W9C A;  1Q5W B;  2JZZ A;  1GUA B;  3B1L X;  4BBN C;  4BKG A;  1WJ4 A;  1U4A A;  3DOW A;  5TR5 A;  4EFO A;  2IYD B;  2KC1 A;  4FLH A;  2KC2 A;  3PRE A;  2R2Q A;  1WXS A;  3K9O B;  4A20 A;  1KLV A;  4MGI E;  1GNU A;  2AYO B;  2LJ5 A;  3ZIM A;  3PPA A;  4WQO B;  1XD3 B;  2D3G A;  2K8C A;  4GDK A;  2D11 A;  4P7I A;  1WH3 A;  4F8C B;  1LQB A;  3ML8 A;  5DPW A;  3EHV A;  2GBN A;  4W9L A;  1NBF C;  2LGD A;  4CHK A;  1UBQ A;  5L95 C;  4WJN A;  3V6C B;  2BYV E;  3IHP C;  3VUY A;  3DQV A;  4G50 A;  2G4D B;  2CS4 A;  2KN5 A;  4ANV A;  3DBH I;  5JHB A;  4F7Z A;  4ZRI A;  3M62 B;  2NS5 A;  3LJ3 A; 
#chains in the Genus database with same CATH topology
 5CX3 A;  2QEJ C;  1X1M A;  1WE7 A;  3I9V 1;  3L54 A;  3BZD B;  4GLS C;  4GDL B;  2GBR A;  3Q8C A;  2PLP A;  2WQY B;  2L7R A;  4HKZ E;  3RI7 C;  2OOB B;  3IAS 1;  3QC8 B;  2Z8L A;  3VXW A;  4MJS A;  3GZN I;  2C60 A;  4HK2 A;  3MTN B;  3ONS A;  4OW0 A;  1FRD A;  4IUM B;  2ZW1 A;  3IBE A;  2WXL A;  2L0T A;  3DVN V;  1RLF A;  3PZ7 A;  3Q8A A;  1L5P A;  3AED B;  5GXG B;  2KDE B;  3KYD D;  2XNA C;  3PVL A;  1L7Y A;  1VD2 A;  3FKY A;  2N9E B;  4GIV A;  4IWP A;  2L1A A;  2V3N A;  2INC C;  3JSV B;  4W9I A;  1WI0 A;  4BKS A;  1DYQ A;  4TSS A;  3SR6 A;  3V61 A;  3PLV A;  3Q6B A;  2BYF A;  3RUI B;  1XF5 L;  2DX5 B;  4IDI A;  1L6V A;  3NJT A;  1ET9 A;  1QQR A;  4IM0 A;  4LNI A;  3V60 A;  1I4X A;  2G1E A;  1LGR A;  3U7D A;  2UYZ B;  1E90 A;  1VCB A;  3BWU D;  3NVZ A;  4EZL A;  1IBX B;  1Y56 A;  1HZ5 A;  4S17 A;  2KFK B;  2KQ7 A;  3ECI A;  4W9G A;  1E10 A;  1DOX A;  1UEL A;  4I6L B;  1JCK B;  4FUL A;  2V3S A;  5IP4 D;  3ENE A;  1L4D B;  1ZPS A;  3KWV A;  3S2A A;  4YSZ B;  4ANX A;  4A9A A;  3C8Y A;  4CQN A;  1JWU D;  2WDV B;  4MGK E;  1ZXH A;  2WXI A;  1TS5 A;  4WJO A;  2E6X A;  3WAO A;  4LJP B;  4EZK A;  4RMA A;  1NEK B;  1ET6 A;  2JRH A;  2AQ1 B;  1OEY A;  3EGR A;  4NNJ B;  3ML9 A;  2RPQ A;  1Z5S B;  1YD8 U;  1OFF A;  1TTN A;  2QCZ A;  3SEB A;  2BKR B;  4RGN A;  1R4M I;  4GSW A;  1JQ4 A;  3T9L A;  4CYE A;  3R7R A;  2NBU A;  1E8Z A;  1V1P B;  2LHE A;  4WQM A;  4A3O A;  1TJE A;  3EUB 2;  1E7P B;  3GS2 A;  2KWV B;  2K25 A;  3AUL A;  2OJW A;  3TEZ A;  4KSK C;  1FFU A;  2A4Z A;  3NHE B;  3QIJ A;  1A5R A;  3IVF A;  4OVU A;  5GMV A;  3UIO B;  3PTF C;  5D3D A;  4FA6 A;  2RSU A;  4PS3 A;  3UQB A;  3DHI C;  2MX2 A;  1FMA D;  1D6E C;  1N6Z A;  2KDB A;  3W5U B;  3DBH B;  2L05 A;  4E3C A;  1QOB A;  3DBR B;  1ZW7 A;  4LDT B;  1H8C A;  1JRP A;  5C23 A;  1WXM A;  2GBM A;  2W3S A;  2WXP A;  4YTN B;  4W9E A;  2W54 A;  2N9P C;  3ZVV A;  5KHO A;  4GMV A;  4EEW A;  4NJ6 A;  4EZJ A;  1N61 A;  4KSL C;  2L8J A;  4AJY B;  2BPS A;  1LXD A;  5JXV A;  2OED A;  3P2B A;  2V9H A;  3ZNI D;  4O1N A;  2L3Z A;  1F1H A;  2KJH B;  3L16 A;  3A4S C;  2NMQ A;  2NBW B;  4K7W A;  3VRB B;  3NRZ A;  3ZXR A;  3A1Q A;  4EKU A;  2NPT B;  4BVU C;  1WZ3 A;  1S3S G;  3MC9 A;  3VR8 B;  3LYY A;  3PRP B;  1I4H A;  4MGZ E;  4AP4 C;  5IA7 A;  2JT4 B;  3PV1 A;  4MM3 A;  2O2V B;  4DQO C;  4ANU A;  1N62 A;  5L83 A;  2N1W A;  5AEK B;  1I7H A;  2LGI A;  3HHM A;  1OQR A;  1P98 A;  1WX8 A;  2ZVO A;  5D3I B;  2M4N A;  3KW5 B;  3FC4 A;  1P9D U;  3SDL C;  3P4R B;  2RDB C;  4ARC A;  1C79 A;  2LGX A;  1FEH A;  1F9J A;  3BY4 B;  1JRU A;  3RUL A;  4MGI E;  1FD6 A;  2ZPN A;  2IDY A;  2FAZ A;  2JXX A;  1FXI A;  4ANW A;  2HE7 A;  1S1Q B;  5EE0 A;  2JPH A;  2V4L A;  4IM3 A;  3KYC D;  4HEA 1;  2HTM E;  3GB1 A;  2MQJ A;  4JL9 A;  3NS1 A;  4MEL A;  3BII D;  5BYQ A;  4GDL A;  2KX0 A;  1IGC A;  3N20 C;  2BB6 A;  4RGT A;  1YJJ A;  3AN1 A;  3R66 C;  2JWU A;  3TUO A;  4YL8 A;  2AX5 A;  3P1M A;  1PDX A;  1C4A A;  1GC6 A;  2LRW A;  2MP2 B;  2D2Q A;  2INN E;  2V3P A;  2M0A A;  1YQB A;  4B0M A;  2DNF A;  1H4R A;  2KMA A;  2KWC A;  3ZRC A;  2ICI A;  1WYG A;  4GB9 A;  5IN7 A;  1JRO A;  4M02 A;  4N58 A;  2LGS A;  2ZZP B;  1XT9 B;  1I4Q A;  4MSM B;  3AU5 A;  2KDF B;  4GOC A;  2KVR A;  1M4V A;  2BBC A;  2ZNV B;  3QAQ A;  4KKJ A;  4WJP A;  3RZW C;  3DWM A;  3JSV A;  3Q2A C;  5FR3 A;  1HE8 A;  1HXY D;  2L83 A;  3P42 A;  2KX3 A;  2YEP B;  3EFC A;  3KWL A;  3TEY A;  4P1B C;  2EKI A;  1DOI A;  3IT4 B;  1QT9 A;  2PEA A;  1F77 A;  1FIQ A;  2DZJ A;  3X23 A;  3BVM A;  2C5L C;  3RN9 C;  1RM6 C;  1YX5 B;  2MRP A;  3DBL B;  3DPD A;  1YQ3 B;  1KRH A;  2SEB D;  2PMV A;  1T0Q C;  3ZTC A;  4ICU A;  1XCQ L;  1ZGU B;  1JWM D;  3K9P B;  1IBX A;  3Q3J A;  1RWS A;  1ISN A;  2KFK A;  3ZDM C;  2WXJ A;  3DVG X;  2JUO A;  3AU4 A;  1J7B A;  4HPM B;  1GOZ A;  1TYG B;  2BW2 A;  4BBN C;  4W9C A;  1TIF A;  2PJH A;  4BKG A;  1Q5W B;  1KFY B;  2JZZ A;  3B1L X;  4L1B A;  3ZYY X;  1WJ4 A;  1U4A A;  2IYD B;  2VH1 A;  2KC2 A;  3PRE A;  2KQ4 X;  4A20 A;  1KLV A;  3ETR A;  3GE3 C;  3AE5 B;  1AN8 A;  2IND C;  3RNB C;  1YQ4 B;  2JSV X;  1MPE A;  3FIL B;  2LGD A;  3AV8 A;  1UBQ A;  2WDR B;  3TEW A;  4WJN A;  1CJE A;  3IHP C;  1MJD A;  3AE3 B;  3DQV A;  1YMH E;  3DBH I;  3DBR I;  1NVI D;  4XWT A;  2IBI B;  3I5J C;  3OJ3 A;  1E8X A;  3L4P A;  3CST A;  4MDK E;  2C9W B;  2KOX A;  3NVV A;  1V86 A;  2JVC A;  2LAS A;  2BT6 A;  4AWJ A;  2QC8 A;  1UWX A;  2Z0E B;  4WAF A;  4FBJ B;  2IGH A;  2JZ3 B;  1K53 A;  2AQ2 B;  4RGM A;  4RF1 A;  2M17 A;  4CO7 A;  5TSS A;  3AE8 B;  5CHV C;  1FNU A;  3AE7 B;  3HVD A;  1TKG A;  4HJG E;  4NZL B;  2FCQ A;  2WP9 B;  3UIN B;  2D07 B;  3RZF A;  3AEA B;  2M56 B;  3J9C A;  1UBI A;  3L08 A;  2JX5 A;  2JQR B;  4HDQ A;  3TEX A;  3AE6 B;  3MP9 A;  3H8H A;  2CU3 A;  3B08 A;  4JWS C;  2L32 A;  3QCA A;  4I6N B;  1TT5 B;  3N1Z C;  4L23 A;  3AB5 A;  5J2R A;  3NOB A;  3WAP A;  3OJ4 B;  3AE2 B;  2M19 A;  2FID A;  3RNF C;  4IG7 B;  2R61 A;  1NYR A;  2WGS A;  4X57 B;  5T8I A;  4NJC A;  2QHO A;  1J8C A;  1WX9 A;  5DPR A;  2AL6 A;  4ZRK A;  1D3Z A;  4YXD B;  1UF0 A;  5D94 A;  2O6V B;  1UZX B;  4G0N B;  4BBN F;  1WGR A;  1FCC C;  2D5G A;  3AE9 B;  1RFK A;  5C2T B;  5H92 C;  1KOT A;  5IAA C;  2EEL A;  2LRU A;  2O2V A;  2N0S B;  1TS2 A;  4OVZ A;  4FAD A;  3PO0 A;  1EU4 A;  3HRD D;  3M95 A;  3DDC B;  4FJV B;  4NY0 A;  2PE6 B;  1YN5 A;  3W1Y A;  3RCZ A;  3TJP A;  3Q3O C;  2JRI B;  3PGE A;  1ENF A;  1D5M C;  3QK0 A;  4RM9 A;  3OG5 A;  1E6E B;  5MPO A;  3KVF B;  1WX7 A;  3V6E B;  5IO9 A;  1KH0 A;  1SE9 A;  4MEM A;  2KAC A;  3ZDT A;  2K0P A;  4OZA A;  2BGF A;  1SE2 A;  2BTE A;  1KTK A;  3NVY A;  1I42 A;  2Q5W D;  2WNM A;  4ZYN A;  4OZC A;  2LXC A;  4P16 A;  2FBW B;  2IY1 B;  3Q3F A;  4FJZ A;  4K7U A;  2BS4 B;  2I1J A;  2MW5 A;  2KMM A;  4MH0 E;  3PS6 A;  2JY6 A;  4M8M A;  2MP2 A;  5BYS A;  2LWP A;  3L0W B;  4A6Q A;  4BOS C;  4G11 A;  2RPV A;  3DBL I;  3I63 C;  4IWO A;  2G4S A;  2LD9 A;  3VAW A;  2KQS A;  3BYT B;  1FXA A;  2JU6 X;  2MBQ A;  4HDO A;  1G6J A;  1SEB D;  2K6Q A;  2D3A A;  2L76 A;  1Q1O A;  4DHJ D;  3H7S A;  2R2O A;  4EE2 A;  1WM2 A;  4TV3 A;  3WCQ A;  1IPG A;  1P3Q U;  2K6D B;  2BB5 A;  4JIO U;  1TBE A;  2DAF A;  4IWQ A;  4JQW C;  1UD7 A;  2RD0 A;  1SXT A;  3RD2 A;  4B6W A;  4XYC A;  3C0R B;  3AE4 B;  2AWT A;  2WU5 B;  3ZLZ A;  1ROE A;  2J52 A;  2NR2 A;  4F1S A;  1YN4 A;  1GAQ B;  4HRS A;  1J7C A;  2KJ6 A;  1QOA A;  2G9H D;  3DHG C;  2BYE A;  2IO0 B;  3WAL A;  1GB1 A;  4WUR A;  2WXN A;  2KLG A;  2TSS A;  4WWN A;  4A3P A;  2BWF A;  2REX A;  4ITK A;  3SHQ A;  3W2D A;  4GGQ A;  2YEP F;  3HIZ A;  2LGY A;  2KTR B;  2JZP A;  2KXJ A;  2RGF A;  5E6P A;  1T0Y A;  4HCN B;  5CTR C;  1KLG D;  3KUZ A;  1FO4 A;  3RMK C;  5G2N A;  2V1Y A;  5JZE B;  1NEN B;  1UNS A;  3KQ4 A;  1YX6 B;  4RFB A;  5D7G A;  2Y5P A;  3VRA B;  4TMA B;  4RF0 A;  3ZNG C;  3FIL A;  2ACZ B;  4BFR A;  4W9H A;  4LJO B;  2OJR A;  2FCM A;  2H88 B;  1E8Y A;  5H8Y E;  3AI5 A;  3EFU A;  1I4P A;  2ZW0 A;  2K8H A;  2M0X A;  5AZH A;  5AZG A;  4IW0 A;  4LNK A;  1QF6 A;  1BXT A;  4JPS A;  1RYJ A;  3DBS A;  4WJQ A;  2ON8 A;  2FUH B;  1L4Z B;  4RH6 A;  3UIP B;  3LXF A;  3CMM B;  3Q69 A;  1KM7 A;  2LHD A;  2K3U A;  3VTV A;  4DDG D;  2VRR B;  1FPY A;  4FN2 A;  1C4C A;  3ZXV A;  1VJK A;  2DYB A;  2HDE A;  2LMC A;  4K7S A;  4WWP A;  3P4Q B;  4BKT A;  2JWZ A;  4HLE A;  3AE1 B;  2MCN B;  2FCS A;  2BYT A;  3APC A;  1XO3 A;  4HVB A;  1HTQ A;  2UWQ A;  3MJ5 A;  4JX1 C;  2IZV B;  5AZF A;  3EC8 A;  1WF9 A;  2BS2 B;  2Y5B B;  1WGY A;  2X38 A;  3AXC A;  1V9J A;  3SFE B;  4TUU A;  4TQ0 A;  3Q14 C;  3ZO5 B;  4YTP B;  4ASW C;  2KDM A;  2G3Q B;  4C4V B;  2IPK D;  2IO2 B;  2PW9 A;  1JAL A;  3JW0 X;  3UI3 A;  2GI9 A;  4HPL B;  3T8M A;  1NI3 A;  2W82 A;  4M8N A;  1I35 A;  4C00 A;  1XEE A;  2QDF A;  4BKS D;  1EUV B;  2PKO A;  1OQQ A;  1YNT E;  3A9K B;  2K5P A;  2AQ3 B;  3CSF A;  4IM2 A;  2O6V A;  2EMS A;  2HTH A;  2KYW A;  2WDQ B;  2OHF A;  2JF5 A;  3U8Z A;  1IP9 A;  1QIL A;  1UUP A;  4AUQ C;  2ASQ A;  2LZ6 A;  1YOV B;  4KGR A;  5TR5 A;  1T0R C;  2R2Q A;  1WXS A;  4WH4 A;  1GNU A;  2LJ5 A;  4XE0 A;  4WQO B;  4F8C B;  2K8C A;  5DPW A;  1ACC A;  2GBN A;  3CIR B;  4IKG A;  3BK2 A;  3EA6 A;  4CHK A;  4A8X C;  3B2F A;  3BVZ A;  1SB3 C;  4REZ A;  2WS3 B;  2KN5 A;  1T3Q A;  3MHZ A;  1WRI A;  1BML C;  4ZRI A;  4XGA B;  2MA9 B;  5E6O A;  3I57 A;  2GBK A;  2LEK A;  2I38 A;  4LK0 M;  3PRZ A;  4MT5 A;  2DBY A;  4KX6 B;  5FK9 C;  5C3J B;  1MG4 A;  1ZKH A;  2LUM A;  3QAR A;  4TKN A;  1ZP0 B;  4USA A;  4KDL B;  2IGD A;  1C9F A;  2CKH B;  2CU1 A;  3Q8E A;  3SD5 A;  2WXH A;  4XDC A;  5LLI A;  1WJU A;  2WXK A;  2MBH A;  4LCD E;  3E9S A;  5I4D A;  4KDI C;  2RDH A;  2XEW A;  4C56 C;  3N32 A;  4PK1 A;  4AOF A;  2WU2 B;  3AEF B;  1SJH D;  3UF8 A;  3ZJT A;  1C77 A;  2QIE B;  2MBB B;  1STE A;  2EMT A;  3DVN U;  3U2S C;  3IFW B;  1WJ6 A;  1OGW A;  4AQ7 A;  2N4F A;  3P4P B;  4ARI A;  1GG3 A;  4HPP A;  1MI0 A;  2QMT A;  3L10 B;  3QA8 A;  5KHQ A;  2DEN B;  1RAX A;  1XLN A;  3P63 A;  2BKF A;  1WFY A;  2J7Q B;  3OWE B;  4YT0 B;  1XQQ A;  3NVW A;  3W9C B;  1KLU D;  2CR5 A;  3KUC B;  4UDU C;  1J19 A;  4B9K A;  2ZCB A;  1QKZ A;  4E71 A;  3PZ8 A;  4S0R A;  2J53 A;  3NUH B;  2DWQ A;  1TY2 A;  5G5H A;  2XK5 B;  4W9F A;  3N1Y C;  4ACF A;  1TZ1 A;  4KZC A;  1SIJ A;  1YIW A;  4J6I A;  3WAM A;  4YTM B;  2KWU B;  4N59 A;  1XCT L;  1L0Y B;  2N7E A;  2KTR A;  2DYO A;  1WXV A;  3TCA A;  2LVQ A;  3ZW3 A;  1V81 A;  4WAA A;  4A55 A;  2PPH A;  4KV2 A;  4TQ1 A;  3IXS A;  3PRM B;  3OAW A;  3B2G A;  5LXH A;  2GOW A;  4FJY A;  4C80 A;  1EF1 A;  2W55 A;  3A4R A;  1TS4 A;  4B95 A;  4DXF A;  4NAW B;  2C7H A;  2ZJD A;  3ABV B;  3L13 A;  2CHX A;  3WAN A;  3NS8 A;  3MHS D;  4RCO A;  1SJE D;  1V1P A;  3GP7 A;  2JYE A;  1BT0 A;  2KZR A;  2YVC A;  4M01 A;  5CHW A;  1DGJ A;  2K39 A;  2NTT A;  1ZDV A;  2IGG A;  4Q2J A;  3HM3 A;  3GE8 C;  3VDZ A;  2FNJ B;  2VZK D;  4FHJ A;  3SU8 X;  1TKE A;  2J0K A;  3NG0 A;  3R2I A;  1WE6 A;  4PS7 A;  3A33 B;  2WYQ A;  1D4B A;  2WXG A;  1YJI A;  5DCN A;  1V8C A;  3N1X C;  4WIP A;  2XN9 C;  1F2R C;  4BOZ B;  2C7N B;  1N63 A;  3Q8F A;  3QQ8 B;  3RPF C;  1MFW A;  3R7Q A;  4XC2 A;  1VZ8 A;  4P6V F;  2WHI A;  3URY A;  4MAC A;  3OLM D;  2ONQ A;  1WSP A;  1WR1 A;  2K22 A;  3RNG C;  4C4V A;  4RNA A;  1ZOY B;  3LDZ E;  3Q3M C;  2K8B A;  1M94 A;  2NPT A;  2VH2 A;  1V2Y A;  3BIN A;  3RNA C;  3JVZ X;  3HUI A;  2B3A A;  3Q3N C;  4YSX B;  1BUI C;  1EF5 A;  2BVC A;  1I4R A;  3A9K A;  1RFA A;  1IGD A;  2J42 A;  1XLO A;  3A9J B;  1WGH A;  2UU7 A;  1AAR A;  1F2R I;  2MJ3 A;  1WYW B;  4DK5 A;  4GU2 A;  1QOG A;  2AEH A;  1E9M A;  3KH0 A;  2V4I B;  3DHH C;  2N7D A;  2D10 A;  3H7P B;  4BAX A;  1QLB B;  3B9J A;  2PTL A;  3VTW A;  2MHJ A;  5BMG A;  3MC8 A;  4DXG A;  2J4X A;  4LNN A;  3V62 A;  1SF0 A;  1P0R A;  2MWS B;  3QWZ B;  3BVG A;  1L2N A;  3H6N A;  3JYU A;  3W1S C;  1P1A A;  2WXQ A;  1JWS D;  3VH3 B;  3VUW A;  1V49 A;  2L0F A;  3H9D A;  3QX1 A;  2NCN A;  3T3N A;  1YN3 A;  3U4E G;  1KJT A;  2GB1 A;  4JE3 B;  3RT3 B;  2SAK A;  3KLS X;  2W3R A;  5D6J B;  1J7A A;  3DCG A;  2E3T A;  4YWG G;  3I3T B;  1ZE3 D;  4LNO A;  2I2Y A;  3ZTD A;  1WJN A;  4KKI A;  4NPN A;  1AW7 A;  1EM7 A;  1GC7 A;  5EE1 A;  5BO4 B;  3ALB A;  1PFD A;  5FR6 A;  3BYY B;  4ZRP A;  2HD5 B;  2WXR A;  2LXA A;  3ZNZ B;  1C4P A;  2H89 B;  3VVW B;  3TMP B;  3WA0 A;  2BF8 B;  3MFG A;  5HHD G;  3U30 A;  2KK8 A;  4R3D A;  1XLP A;  1HTO A;  1WGK A;  3M3J A;  1UGJ A;  2LUE A;  1WGD A;  5BYR A;  4HCP B;  3TBL D;  4HRO A;  5CHF A;  4US8 A;  1YJ1 A;  3VFK A;  4LDT D;  1F52 A;  1RRB A;  2INP E;  4H2A A;  1C76 A;  3B0A A;  5C1Z A;  1K50 A;  2KDI A;  3VTU A;  1WMH B;  4JLC A;  2GBJ A;  3NZU A;  2HJ8 A;  3H1U A;  1V1O A;  1K51 A;  2V0G A;  5HFY A;  4PYU A;  3PLU A;  3V3X A;  3ZRF A;  1PGA A;  3MJW A;  1FM0 D;  2XK5 A;  3W1S A;  2IO1 B;  1N60 A;  4NQK E;  2KNB A;  1FXT B;  1PGB A;  3TSS A;  1GUA B;  3DOW A;  1VDV A;  4EFO A;  2KC1 A;  5EE3 A;  3K9O B;  2JXT A;  2RMM A;  3ZIM A;  1EWC A;  1P7E A;  2IJ0 A;  3PPA A;  2D3G A;  4P7I A;  2FE8 A;  3ML8 A;  4W9L A;  1JW9 D;  5L95 C;  3VUY A;  4G50 A;  2G4D B;  2CS4 A;  2PVG C;  4J3O D;  5JHB A;  4F7Z A;  3M62 B;  3LJ3 A;  1LFD A;  3DVG Y;  1WGG A;  4NAW A;  2N9K A;  3VHT C;  2Z59 B;  4OVV A;  1V5T A;  2BQQ A;  4DBG A;  1VZ6 A;  4G3X B;  4B0E A;  1UGM A;  1OTR B;  1Y8R C;  4HXD A;  2N7J A;  1PQS A;  2HJ1 A;  1E0Z A;  5IOI A;  4MSQ B;  4IC7 B;  2A5U A;  4DHJ B;  4JGH B;  2EKE C;  1NI2 A;  4ZYS A;  3APD A;  2K1F A;  1QZE A;  1UH6 A;  3IAM 1;  3UQA A;  2C7M B;  4MH8 A;  3QJZ A;  2LVO A;  1NYQ A;  3ZKJ C;  1OEY J;  3U52 E;  3TIX A;  4ZRJ A;  5EE9 A;  2WXF A;  3R2T A;  1TS3 A;  2Z0D B;  1WZ0 A;  1ZDX A;  3EEC A;  3VQI A;  2DZK A;  1XLQ A;  1CZP A;  2D3C A;  2L00 B;  2WWZ A;  3LB8 C;  4KZ0 A;  1MHX A;  2CHW A;  4DHZ E;  3KUD B;  2MSE D;  4DWF A;  1L0X B;  3PZD A;  2NTS A;  1WXQ A;  4PYZ A;  4RGO S;  2WXM A;  1HQR D;  3ZJU A;  3L17 A;  1GPX A;  1AYF A;  4KIK B;  4E74 A;  1EWY C;  1CQV A;  5J17 A;  3AEE B;  2WLB A;  1WIA A;  4LLG M;  1FNV A;  5DPT A;  3RFZ B;  2N9L A;  3NY5 A;  1DOY A;  1HA5 A;  1B1Z A;  4KVG B;  1TZO A;  2N9X A;  3VUX A;  2Y3A A;  4LNF A;  1LM8 B;  2MJE A;  2Y5C A;  1FCL A;  2GRI A;  2N1V A;  4M0W B;  3PHX B;  3ZQ4 A;  1R4N B;  4XX5 A;  5FKA C;  3CWI A;  4QAY A;  1D5Z C;  2KN4 A;  3A9J A;  4HWI B;  1VRA B;  2DHZ A;  1C3T A;  4WWM A;  4A90 A;  1K52 A;  2PE9 A;  1TGZ B;  4GDK B;  2MEK A;  3APF A;  1E7U A;  3HK0 A;  1Z2M A;  2KFJ A;  2M1M A;  4DHZ B;  2FUG 1;  4W9D A;  2QJL A;  3H7P A;  1K8R B;  1T0S C;  1WR6 E;  4HJK A;  5HKH A;  2LFI A;  1TY0 A;  3UGB B;  5E6N A;  4N9F 4;  5IKC M;  1L6U A;  1D5X C;  1WY8 A;  4XZ4 A;  2D3B A;  3ZJV A;  4XWW A;  4OHJ A;  4M00 A;  4K1R B;  2G45 B;  3QHT A;  4KGS A;  4II3 B;  1F0Z A;  4C7Z A;  4K3B A;  1Q0W B;  4MJS B;  1MG8 A;  1VLB A;  5LNK 1;  3ZGZ A;  2KMC A;  2KKC A;  4ZRQ A;  4EUT A;  2WX1 A;  1PYW D;  1JWB D;  3RYT A;  4URK A;  4XDD A;  1KF6 B;  2WDT B;  1WM3 A;  4N6E B;  2GLS A;  2KVZ A;  1JML A;  1WWT A;  3AH7 A;  3ZNH B;  3FAH A;  5DPS A;  4IOI E;  3D32 A;  1PUT A;  2QIL A;  2DZM A;  3M63 B;  1E5W A;  2B76 B;  1GB4 A;  2WXO A;  4PT5 A;  1PGX A;  1QOF A;  4K81 A;  4K3C A;  3GZN B;  2IO3 B;  2YLM A;  2FIF A;  2I1K A;  2AL3 A;  2PVO D;  4ICV A;  4W9K A;  2RDG A;  2KJR A;  3AEB B;  4L2Y A;  2FCN A;  2MBO A;  3NZ3 A;  5G5G A;  3CF6 E;  1A70 A;  5J18 A;  3O65 B;  2MH7 A;  2M8S A;  5AUI A;  2L52 A;  4OZB A;  4ZHO A;  4KGT A;  1J0G A;  1WMH A;  4DDI D;  1TKY A;  3PSE B;  2ZEQ A;  3T3O A;  4DXA B;  1XXG A;  2RR9 A;  1V6E A;  1V97 A;  4HKQ A;  3R3M A;  5HI1 A;  1E7V A;  3AM9 A;  1SIF A;  1AWD A;  2LJI A;  1IYF A;  5BMH A;  4NAM A;  3PT2 B;  4AS1 A;  4AJW A;  2KAN A;  3AEG B;  3HVZ A;  1FFV A;  1Q10 A;  1ZXI A;  4LTU A;  1V80 A;  1OQY A;  1UWM A;  4GXB A;  2O6V D;  5LXI B;  2J0J A;  5JH5 C;  2KTF A;  1GJZ A;  1SE4 A;  3PHW B;  2XBB C;  1T6B X;  3BK1 A;  3MC0 B;  1V5O A;  1WXA A;  2LI5 A;  3WIM A;  4II2 B;  1P7F A;  4NQL B;  1MHH E;  4RM8 A;  2KLC A;  5EDS A;  4ZDV A;  4ZOH C;  2DYM A;  2J0M A;  3W5V B;  2KAJ A;  2W9N A;  1NDD A;  1N5X A;  2LVP A;  1R7S A;  5E6J A;  4NJ7 A;  4FHK A;  1FNW A;  2WX0 A;  3N30 A;  3U7Z A;  1VR9 A;  3HM6 X;  1IUE A;  3RNC C;  2BWE S;  2KWD A;  2IY0 B;  2JYT A;  4EOY A;  5D2M B;  1EU3 A;  2MLB A;  1E8W A;  2DAJ A;  2BS3 B;  4GN1 A;  1R4M B;  2ZVN A;  3V05 A;  3NZS A;  2ZCC A;  1MVK A;  5G55 A;  3E56 A;  3IG3 A;  4MGY E;  1SSN A;  1L0V B;  2KO3 A;  2GMI C;  2MBE A;  2KHW B;  4W9J A;  1R4N I;  1B9R A;  1FRR A;  2KD0 A;  2KT7 A;  2NVU I;  3P4S B;  2CHZ A;  5JHA A;  4PS8 A;  3ZUN A;  1WRD B;  2X8X X;  3IT6 B;  5HG2 A;  5BMI A;  3SFD B;  4I6P A;  1I4G A;  3A1Q B;  1CK1 A;  1EO6 A;  2DLB A;  3RNE C;  1HZ6 A;  4BZA A;  1ZUD 2;  1SBB B;  4KIK A;  1JWA D;  2ZPY A;  3GOE A;  1HEZ E;  2NBV B;  3VH4 B;  3VR9 B;  4D2K A;  4ZHP A;  3C19 A;  4JWU C;  1CMX B;  2MJD A;  4FXC A;  1C1Y B;  1N5W A;  4YSY B;  1T5X D;  3TL5 A;  4WWO A;  1SGH A;  4C7Y A;  1LO5 D;  4MM3 B;  2ZNV C;  2DZI A;  4M0W A;  3X0W A;  1VZ7 A;  3N3K B;  4US9 A;  3R8B A;  4FLH A;  2QSD A;  2CJO A;  1C78 A;  2AYO B;  2PIA A;  2CJN A;  3N9Y C;  3O13 A;  1ESF A;  1XD3 B;  4GDK A;  2D11 A;  3Q8B A;  1WH3 A;  1LQB A;  3AMZ A;  3EHV A;  1NBF C;  3AEC B;  1SE3 A;  3V6C B;  2BYV E;  2K9X A;  4P1C C;  2VZK B;  5AUK A;  3DWG C;  4ANV A;  2NS5 A; 
#chains in the Genus database with same CATH homology
 1LFD A;  3DVG Y;  5CX3 A;  2MA9 B;  5E6O A;  1WGG A;  4NAW A;  3VHT C;  2Z59 B;  4OVV A;  1X1M A;  1WE7 A;  2GBK A;  1V5T A;  3L54 A;  4DBG A;  2IBI B;  4G3X B;  2GBR A;  4GDL B;  1UGM A;  2L7R A;  3OJ3 A;  1E8X A;  3PRZ A;  3CST A;  2OOB B;  4MDK E;  2C9W B;  3QC8 B;  2KOX A;  1OTR B;  1Y8R C;  4HXD A;  3VXW A;  1ZKH A;  1V86 A;  4MJS A;  1PQS A;  2JVC A;  2LAS A;  2C60 A;  3GZN I;  3MTN B;  3ONS A;  4HK2 A;  3QAR A;  4AWJ A;  4MSQ B;  4IC7 B;  2A5U A;  4TKN A;  2Z0E B;  4DHJ B;  4JGH B;  4FBJ B;  2EKE C;  1NI2 A;  4IUM B;  2JZ3 B;  3APD A;  4KDL B;  2K1F A;  3IBE A;  1QZE A;  1UH6 A;  2L0T A;  2CKH B;  2CU1 A;  2M17 A;  1RLF A;  3DVN V;  3SD5 A;  4CO7 A;  2C7M B;  3UQA A;  5CHV C;  5LLI A;  1WJU A;  2MBH A;  4LCD E;  3QJZ A;  2LVO A;  4KDI C;  3ZKJ C;  2KDE B;  3KYD D;  1OEY J;  3PVL A;  3TIX A;  2FCQ A;  2XEW A;  3N32 A;  4ZRJ A;  3UIN B;  1L7Y A;  4AOF A;  2D07 B;  3RZF A;  1VD2 A;  3UF8 A;  2Z0D B;  1UBI A;  3L08 A;  2N9E B;  1WZ0 A;  4GIV A;  4HDQ A;  4IWP A;  3EEC A;  3VQI A;  2DZK A;  3JSV B;  2MBB B;  4W9I A;  2L00 B;  2EMT A;  2WWZ A;  1WI0 A;  3DVN U;  4KZ0 A;  4BKS A;  3IFW B;  1WJ6 A;  3B08 A;  1OGW A;  2N4F A;  2CHW A;  3V61 A;  3QCA A;  4DHZ E;  4I6N B;  1GG3 A;  3PLV A;  3L10 B;  3QA8 A;  5KHQ A;  3KUD B;  2MSE D;  2BYF A;  2DEN B;  4DWF A;  5J2R A;  3NOB A;  1RAX A;  3RUI B;  2DX5 B;  3WAP A;  3PZD A;  3OJ4 B;  2BKF A;  4PYZ A;  1WFY A;  2J7Q B;  2FID A;  3L17 A;  4IG7 B;  1XQQ A;  4IM0 A;  4KIK B;  2CR5 A;  3KUC B;  4E74 A;  3V60 A;  1J19 A;  4B9K A;  5J17 A;  4X57 B;  1WIA A;  3U7D A;  2UYZ B;  2ZCB A;  5DPT A;  1E90 A;  1VCB A;  1WX9 A;  2QHO A;  3NY5 A;  4E71 A;  5DPR A;  4EZL A;  1J8C A;  2AL6 A;  4ZRK A;  1D3Z A;  4KVG B;  2KFK B;  2N9X A;  2KQ7 A;  3VUX A;  3ECI A;  1LM8 B;  4W9G A;  2XK5 B;  4W9F A;  5D94 A;  2O6V B;  1A5R A;  1UZX B;  2N1V A;  1UEL A;  1WGR A;  4G0N B;  4M0W B;  4BBN F;  3PHX B;  4I6L B;  1TZ1 A;  4KZC A;  4FUL A;  2V3S A;  4XX5 A;  1YIW A;  4J6I A;  3ENE A;  3WAM A;  1KOT A;  2KWU B;  3A9J A;  4HWI B;  2N7E A;  2DHZ A;  1C3T A;  3S2A A;  5IAA C;  2PE9 A;  2KTR A;  2DYO A;  2LRU A;  1TGZ B;  1WXV A;  4ANX A;  2O2V A;  4GDK B;  4MGK E;  3APF A;  1E7U A;  3TCA A;  2LVQ A;  3HK0 A;  4WJO A;  1V81 A;  1Z2M A;  2KFJ A;  4WAA A;  3ZW3 A;  2M1M A;  4FAD A;  3M95 A;  3WAO A;  3DDC B;  4DHZ B;  4LJP B;  4W9D A;  4FJV B;  2PPH A;  4NY0 A;  4KV2 A;  4TQ1 A;  3H7P A;  1K8R B;  2PE6 B;  4RMA A;  4EZK A;  3PRM B;  2JRH A;  3OAW A;  1WR6 E;  5LXH A;  4HJK A;  1OEY A;  2GOW A;  3W1Y A;  4NNJ B;  5HKH A;  4FJY A;  3ML9 A;  3UGB B;  3RCZ A;  3TJP A;  1EF1 A;  5E6N A;  3A4R A;  4N9F 4;  4B95 A;  2JRI B;  3PGE A;  2RPQ A;  4NAW B;  1WY8 A;  2C7H A;  2ZJD A;  4XZ4 A;  3QK0 A;  3L13 A;  4RM9 A;  1Z5S B;  1YD8 U;  2CHX A;  1TTN A;  3KVF B;  1WX7 A;  3V6E B;  3WAN A;  3NS8 A;  2BKR B;  3MHS D;  4K1R B;  1R4M I;  1SE9 A;  4GSW A;  2G45 B;  3QHT A;  4MEM A;  4II3 B;  3R7R A;  3T9L A;  4CYE A;  2NBU A;  1E8Z A;  3ZDT A;  1Q0W B;  4MJS B;  2BGF A;  1BT0 A;  1MG8 A;  4A3O A;  2KZR A;  2YVC A;  2KMC A;  1I42 A;  5CHW A;  2KKC A;  2KWV B;  2K39 A;  4ZYN A;  2K25 A;  3AUL A;  2LXC A;  4EUT A;  2WX1 A;  4KSK C;  2IY1 B;  2A4Z A;  3NHE B;  3HM3 A;  3QIJ A;  3IVF A;  4OVU A;  5GMV A;  3UIO B;  3PTF C;  3Q3F A;  4FJZ A;  4K7U A;  3RYT A;  4URK A;  2FNJ B;  2I1J A;  4FHJ A;  2MW5 A;  2RSU A;  4FA6 A;  3SU8 X;  4PS3 A;  3UQB A;  2MX2 A;  2J0K A;  2WDT B;  1WM3 A;  4MH0 E;  1WE6 A;  2KDB A;  4PS7 A;  3A33 B;  2L05 A;  4E3C A;  3PS6 A;  2WYQ A;  2JY6 A;  4M8M A;  1ZW7 A;  2MP2 A;  4LDT B;  2LWP A;  1H8C A;  5DCN A;  3L0W B;  3ZNH B;  4BOS C;  4G11 A;  5C23 A;  1WXM A;  3DBL I;  2GBM A;  5DPS A;  4BOZ B;  2C7N B;  4IWO A;  2G4S A;  2LD9 A;  4W9E A;  3VAW A;  3D32 A;  2KQS A;  3QQ8 B;  2DZM A;  3M63 B;  1E5W A;  2MBQ A;  1G6J A;  4HDO A;  3R7Q A;  2N9P C;  3ZVV A;  4XC2 A;  2K6Q A;  5KHO A;  4GMV A;  4K81 A;  4EEW A;  4NJ6 A;  4EZJ A;  2L76 A;  4KSL C;  1Q1O A;  2IO3 B;  2L8J A;  3H7S A;  4DHJ D;  4AJY B;  3OLM D;  2YLM A;  2R2O A;  1WM2 A;  2FIF A;  2I1K A;  4TV3 A;  1IPG A;  2AL3 A;  2BPS A;  2K6D B;  1P3Q U;  1WR1 A;  1LXD A;  4ICV A;  4JIO U;  4W9K A;  1TBE A;  2DAF A;  3P2B A;  4IWQ A;  4JQW C;  1UD7 A;  3LDZ E;  2RD0 A;  3ZNI D;  3RD2 A;  2KJR A;  4B6W A;  2L3Z A;  3C0R B;  2FCN A;  2MBO A;  2AWT A;  2KJH B;  3DBR I;  3L16 A;  3A4S C;  3ZLZ A;  2K8B A;  2NBW B;  4K7W A;  2NR2 A;  3CF6 E;  4F1S A;  1M94 A;  5J18 A;  2NPT A;  3A1Q A;  3O65 B;  4EKU A;  2NPT B;  1V2Y A;  3BIN A;  2M8S A;  4BVU C;  2KJ6 A;  3JVZ X;  3WAL A;  2BYE A;  2IO0 B;  2B3A A;  1WZ3 A;  2KLG A;  1S3S G;  1J0G A;  1WMH A;  4WWN A;  4A3P A;  1EF5 A;  4DDI D;  3PSE B;  3PRP B;  2ZEQ A;  2BWF A;  4DXA B;  3A9K A;  1RFA A;  2REX A;  3SHQ A;  4MGZ E;  4GGQ A;  3A9J B;  2RR9 A;  4AP4 C;  5IA7 A;  1WGH A;  1V6E A;  3HIZ A;  2LGY A;  1AAR A;  2JT4 B;  2KTR B;  1WYW B;  3PV1 A;  2KXJ A;  4MM3 A;  4DK5 A;  3R3M A;  2O2V B;  2AEH A;  2RGF A;  4GU2 A;  4ANU A;  1E7V A;  3KH0 A;  5E6P A;  5L83 A;  1T0Y A;  1SIF A;  4HCN B;  5CTR C;  1IYF A;  2N1W A;  2N7D A;  3KUZ A;  5AEK B;  2D10 A;  3PT2 B;  5G2N A;  4AJW A;  2V1Y A;  2KAN A;  3HHM A;  3H7P B;  5JZE B;  1P98 A;  1WX8 A;  2ZVO A;  2M4N A;  5D7G A;  1YX6 B;  3KW5 B;  3VTW A;  1P9D U;  3SDL C;  1V80 A;  1OQY A;  4GXB A;  3V62 A;  3ZNG C;  2O6V D;  1P0R A;  2LGX A;  4W9H A;  4LJO B;  4BFR A;  2OJR A;  5LXI B;  2FCM A;  2MWS B;  2J0J A;  1F9J A;  5JH5 C;  3BY4 B;  1JRU A;  3QWZ B;  1E8Y A;  3RUL A;  2KTF A;  3AI5 A;  3EFU A;  3H6N A;  2ZPN A;  3JYU A;  1P1A A;  2K8H A;  2M0X A;  2XBB C;  3PHW B;  3W1S C;  2FAZ A;  5AZH A;  3VH3 B;  2JXX A;  3VUW A;  2LI5 A;  1V5O A;  1WXA A;  3WIM A;  4ANW A;  1V49 A;  4II2 B;  2L0F A;  5AZG A;  4IW0 A;  2HE7 A;  1S1Q B;  4NQL B;  2JPH A;  2V4L A;  4IM3 A;  4RM8 A;  3H9D A;  2KLC A;  3KYC D;  3QX1 A;  5EDS A;  4ZDV A;  2NCN A;  2DYM A;  2MQJ A;  2J0M A;  4JL9 A;  3DBS A;  4WJQ A;  1KJT A;  4MEL A;  3RT3 B;  4GDL A;  2W9N A;  2KX0 A;  2FUH B;  3UIP B;  1NDD A;  3CMM B;  1KM7 A;  2LVP A;  5D6J B;  3DCG A;  4NJ7 A;  4FHK A;  2WX0 A;  3I3T B;  3R66 C;  4YL8 A;  3N30 A;  3ZTD A;  3HM6 X;  1WJN A;  1GC6 A;  3VTV A;  2LRW A;  4DDG D;  2BWE S;  2MP2 B;  2VRR B;  4NPN A;  2D2Q A;  4FN2 A;  2DYB A;  1YQB A;  1GC7 A;  1H4R A;  2IY0 B;  4EOY A;  2KMA A;  4K7S A;  2KWC A;  4WWP A;  5D2M B;  2MLB A;  5BO4 B;  3ZRC A;  3ALB A;  4GB9 A;  4BKT A;  1E8W A;  2JWZ A;  4HLE A;  2ZZP B;  2DAJ A;  5FR6 A;  2MCN B;  2FCS A;  4GN1 A;  2ZVN A;  1XT9 B;  4MSM B;  3AU5 A;  2KDF B;  3APC A;  4HVB A;  2HD5 B;  3NZS A;  2ZCC A;  4GOC A;  2UWQ A;  2IZV B;  2KVR A;  2LXA A;  5G55 A;  3IG3 A;  4MGY E;  5AZF A;  3VVW B;  3ZNZ B;  3EC8 A;  3TMP B;  1WF9 A;  3VDZ A;  2ZNV B;  2Y5B B;  3WA0 A;  2KO3 A;  3QAQ A;  2BF8 B;  2GMI C;  2MBE A;  3U30 A;  2KHW B;  2KK8 A;  1WGY A;  3AXC A;  4W9J A;  4WJP A;  3RZW C;  1V9J A;  4TUU A;  4TQ0 A;  3JSV A;  3ZO5 B;  1R4N I;  2NVU I;  2KD0 A;  4ASW C;  1HE8 A;  2CHZ A;  2G3Q B;  5JHA A;  4PS8 A;  3M3J A;  3ZUN A;  1WRD B;  2IO2 B;  2LUE A;  1WGD A;  2KX3 A;  3JW0 X;  1L2N A;  4HCP B;  3TBL D;  4I6P A;  5CHF A;  4HPL B;  2PEA A;  1YJ1 A;  3T8M A;  3A1Q B;  4LDT D;  4M8N A;  3VFK A;  1RRB A;  1EO6 A;  1I35 A;  2DZJ A;  3B0A A;  3X23 A;  5C1Z A;  2C5L C;  1YX5 B;  2MRP A;  2KDI A;  4KIK A;  3DPD A;  2ZPY A;  3VTU A;  1WMH B;  3GOE A;  2NBV B;  4BKS D;  4JLC A;  3VH4 B;  1EUV B;  2GBJ A;  3ZTC A;  3NZU A;  2HJ8 A;  4ICU A;  1CMX B;  3H1U A;  1ZGU B;  3A9K B;  3K9P B;  1C1Y B;  3Q3J A;  4PYU A;  1ISN A;  2KFK A;  3PLU A;  3ZDM C;  3ZRF A;  3TL5 A;  3DVG X;  4WWO A;  1SGH A;  3CSF A;  3MJW A;  2JUO A;  2XK5 A;  4IM2 A;  2O6V A;  2EMS A;  2HTH A;  2IO1 B;  3AU4 A;  2ZNV C;  4NQK E;  3W1S A;  2DZI A;  2JF5 A;  3U8Z A;  1GJZ A;  3X0W A;  4HPM B;  1IP9 A;  2KNB A;  3N3K B;  4AUQ C;  1FXT B;  2ASQ A;  2LZ6 A;  2PJH A;  4W9C A;  1Q5W B;  2JZZ A;  1GUA B;  3B1L X;  4BBN C;  4BKG A;  1WJ4 A;  1U4A A;  3DOW A;  5TR5 A;  4EFO A;  2IYD B;  2KC1 A;  4FLH A;  2KC2 A;  3PRE A;  2R2Q A;  1WXS A;  3K9O B;  4A20 A;  1KLV A;  4MGI E;  1GNU A;  2AYO B;  2LJ5 A;  3ZIM A;  3PPA A;  4WQO B;  1XD3 B;  2D3G A;  2K8C A;  4GDK A;  2D11 A;  4P7I A;  1WH3 A;  4F8C B;  1LQB A;  3ML8 A;  5DPW A;  3EHV A;  2GBN A;  4W9L A;  1NBF C;  2LGD A;  4CHK A;  1UBQ A;  5L95 C;  4WJN A;  3V6C B;  2BYV E;  3IHP C;  3VUY A;  3DQV A;  4G50 A;  2G4D B;  2CS4 A;  2KN5 A;  4ANV A;  3DBH I;  5JHB A;  4F7Z A;  4ZRI A;  3M62 B;  2NS5 A;  3LJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...