4W9GA

Pvhl:elob:eloc in complex with (2s,4r)-1-(3,3-dimethylbutanoyl)-4-hydroxy-n-(3-methyl-4-(thiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 6)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
101
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor B polypeptide 2
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 24
structure length 101
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4w9gA00
3KUCB 4LDTB 4NAWA 4WWNA 4BFRA 4FJVB 2I1KA 2JUOA 1WH3A 1GUAB 2JWZA 2KFKA 4E71A 3Q3JA 4OVVA 1WRDB 2RPQA 2NS5A 1FXTB 2W9NA 3PLUA 2D2QA 2I1JA 3WAPA 4CYEA 4FHJA 3ZRFA 3KVFB 4I6NB 2NPTB 4AOFA 1J0GA 3DBHI 3R7RA 2DENB 2FCMA 4NAWB 4DWFA 2WWZA 2A4ZA 1YQBA 1IP9A 2OOBB 4HWIB 2KFKB 1R4NI 2L76A 2LXAA 1RLFA 1V80A 4DHZE 3B08A 2DYBA 3UINB 4FULA 1RRBA 2MBEA 3IBEA 3M62B 2KVRA 4W9EA 5JZEB 2KTFA 4AWJA 3QA8A 3DBSA 4ANWA 1WGYA 1OEYJ 4MELA 1J19A 5EDSA 1UBIA 1UELA 4FHKA 4IW0A 2JPHA 2KX3A 5IA7A 1E8XA 1P1AA 4DDGD 2R2QA 1WY8A 3IVFA 4IWOA 3V6CB 3RZFA 2GBJA 3QC8B 3B1LX 3BINA 3ZKJC 4ANVA 1WM3A 4BOSC 2DZMA 3H7PA 1H8CA 3DCGA 3VXWA 3JSVA 1R4MI 4DHZB 4GSWA 2KDIA 2KWVB 2JXXA 3QQ8B 4IG7B 4JLCA 1EUVB 2CHZA 4A3PA 4EEWA 2L00B 2D11A 2IO3B 3PRZA 3I3TB 4PS3A 5LLIA 1I42A 2K25A 3O65B 3QX1A 4PS7A 3H7PB 3ZNID 3TBLD 2ZJDA 3T9LA 2L7RA 4LDTD 1SE9A 4MGZE 3HHMA 4JIOU 3UIPB 3V61A 4EZKA 3D32A 5DPTA 3PHWB 4RM9A 2MBBB 1AARA 2FIFA 4ASWC 3N3KB 2AYOB 2B3AA 3UIOB 4IM3A 2K6DB 3WANA 1YJ1A 5J2RA 3P2BA 2M0XA 2CHXA 1P3QU 2DZIA 1Z5SB 2NBWB 3PTFC 3QJZA 4HJKA 4AUQC 2BKFA 5DCNA 3TL5A 5JH5C 1ISNA 1V86A 1V81A 4M8MA 3WIMA 2PJHA 3QHTA 3GZNI 3C0RB 2GOWA 4ICVA 3U30A 2KMCA 2G4SA 2KXJA 1KJTA 2MLBA 4IM0A 3K9OB 4RMAA 4TUUA 2LXCA 5CX3A 2KHWB 2DAJA 4RM8A 4ZDVA 3PRPB 2MSED 1XD3B 2O6VA 2HE7A 3IFWB 4W9CA 4MGKE 3LDZE 4WWOA 1WGRA 1E7VA 5CHVC 2O2VA 4IC7B 1BT0A 4IWPA 3W1YA 4DDID 2BF8B 2DAFA 2IZVB 2KLGA 4G50A 2KTRA 1TGZB 2M17A 1JRUA 2JVCA 4P7IA 2ZNVC 4A3OA 3ZIMA 2Z0DB 2O6VB 2K39A 4TKNA 1X1MA 2ASQA 2D3GA 2WX1A 4LCDE 4WJOA 2KK8A 4EOYA 3PRMB 3SHQA 1WE7A 2O2VB 3L13A 1GJZA 4URKA 3PLVA 1WXAA 1GNUA 2KTRB 3A4RA 2ZVOA 2NBVB 4HPLB 3JVZX 4F1SA 3AULA 3RZWC 3WALA 2CHWA 4EZLA 2MRPA 3APFA 1WR1A 1I35A 1K8RB 4KVGB 5D6JB 3H1UA 4FJZA 5DPRA 2MP2A 4M8NA 3APDA 1L2NA 1E5WA 3IG3A 2WDTB 3PGEA 2K1FA 4FJYA 2KD0A 2Y5BB 3H7SA 4BKSD 4GMVA 4NPNA 4GDKA 5CHWA 1YX6B 1VCBA 2DYOA 4AJYB 2QHOA 2CU1A 2KNBA 2V1YA 1V49A 1LXDA 1V9JA 2EKEC 3DPDA 4ANUA 2KMAA 2C5LC 3WAMA 1E8WA 1UZXB 2RD0A 2N7DA 5C23A 2MP2B 3EHVA 3JYUA 5L95C 1RFAA 3S2AA 1GC6A 1P9DU 2LGDA 4WJQA 4AP4C 2N9XA 4BBNC 4GDKB 2KJ6A 1OQYA 1WXSA 2MA9B 2BYFA 3Q3FA 1OGWA 1LM8B 1S1QB 1SGHA 1WXMA 2CR5A 4AJWA 2PE9A 2LD9A 3WA0A 2ZPYA 4B95A 3L17A 1V2YA 3VTWA 3ENEA 2DZJA 2KQ7A 3KUZA 1TBEA 3OAWA 2KDEB 3QAQA 3W1SC 3NS8A 4XZ4A 1NI2A 3A33B 1V6EA 4WAAA 5LXHA 3GOEA 3ALBA 4FADA 2GBNA 2K8HA 2J0MA 4KSLC 3IHPC 5CTRC 1WX8A 1UH6A 2O6VD 1Q0WB 2RGFA 4W9DA 1WJ4A 4GDLA 1CMXB 2JRHA 3MTNB 5LXIB 3M95A 4F8CB 4HDOA 2GBRA 4GIVA 1LQBA 4GB9A 3T8MA 1WX9A 3A4SC 3R7QA 4TQ1A 2UYZB 2JY6A 5AZFA 1P0RA 4II2B 4KDIC 2L8JA 3BY4B 3DVGY 1ZW7A 4X57B 2R2OA 3QIJA 4DHJB 1ZGUB 1PQSA 3PSEB 5HKHA 4MSQB 5AEKB 3NHEB 5D2MB 1E7UA 1WM2A 1WGGA 2L05A 1M94A 2BPSA 2LZ6A 3JSVB 3NY5A 3U7DA 1H4RA 2AWTA 3U8ZA 3VH3B 4IUMB 2D10A 3A1QA 4WJPA 3OJ3A 1NDDA 4K7UA 4W9GA 3PS6A 4MDKE 2LVQA 3SU8X 3X23A 3VHTC 2KQSA 3ZTCA 2L0TA 3ZO5B 2JT4B 3ECIA 5D7GA 2GMIC 1V5OA 3ZRCA 4KDLB 1WIAA 2MWSB 1KLVA 4LJOB 1G6JA 3QK0A 2KDBA 3PREA 2D07B 2YLMA 1Y8RC 2GBMA 1UD7A 3SD5A 3RD2A 3SDLC 3A1QB 2MX2A 3CSTA 2N7EA 4HLEA 4MGYE 4EKUA 2XBBC 4K7SA 2LASA 4KZCA 3ZTDA 4PYUA 3EECA 3VTUA 4PYZA 3UQBA 3KYDD 4BOZB 1WYWB 3K9PB 5E6PA 2M4NA 3L0WB 2KOXA 3DDCB 3OJ4B 3UF8A 3HK0A 1V5TA 1WJNA 4B9KA 2DYMA 2IBIB 2NBUA 2Z59B 2UWQA 2KN5A 5GMVA 4II3B 5JHBA 2BGFA 5AZGA 1D3ZA 3OLMD 3NZSA 5TR5A 3X0WA 1U4AA 2K8CA 2WYQA 3CSFA 4ZRKA 2N9PC 4ZRJA 4G11A 2FCQA 1WZ0A 3DQVA 4HPMB 4I6PA 2IO2B 2FNJB 4E3CA 4HVBA 1XT9B 2VRRB 2EMTA 3ZDTA 3AI5A 4BKTA 4BKGA 1Z2MA 2OJRA 1E90A 2HTHA 3DVNU 4W9KA 5AZHA 1EF5A 3QWZB 4A20A 4E74A 1SIFA 4W9JA 2KJRA 4B6WA 1WR6E 1GG3A 2NVUI 1T0YA 3DVNV 5IAAC 4CHKA 1WGHA 1WXVA 2AL3A 1KM7A 3MJWA 4K7WA 4XX5A 2KZRA 1YD8U 2BKRB 2PPHA 3VTVA 2JZZA 2CS4A 3ZNGC 2MW5A 1IYFA 4IM2A 3ZDMC 1WF9A 2WX0A 1WE6A 4HCNB 4K81A 4TV3A 2ZCCA 2MQJA 3RT3B 3TIXA 3V62A 2N4FA 4GGQA 3TJPA 3VAWA 2JZ3B 1NBFC 4GN1A 4DBGA 2N9EB 2N1WA 2M1MA 2FCNA 2JRIB 3A9KA 2KX0A 5G2NA 3PHXB 1WFYA 2DHZA 3ONSA 1C1YB 2LJ5A 2FAZA 4K1RB 3L08A 2ZZPB 3M3JA 3CF6E 4G0NB 4MH0E 2G3QB 2Z0EB 4W9IA 3TCAA 2BWES 3EFUA 2KFJA 4G3XB 4PS8A 3A9KB 2NCNA 2IYDB 3PVLA 3DBLI 1KOTA 2C60A 4MJSA 2MBQA 1EO6A 2GBKA 4DXAB 4ZYNA 1TTNA 3RULA 1OTRB 3EC8A 4XC2A 3VUWA 2MBHA 5E6NA 1UBQA 3VH4B 4MSMB 5KHQA 2BWFA 3QARA 4NQKE 3VFKA 4KIKA 1HE8A 3QCAA 4EFOA 4W9LA 4EUTA 5C1ZA 4MGIE 1A5RA 2L0FA 4MJSB 2CKHB 3VUXA 3N32A 4BBNF 3H9DA 4F7ZA 4DK5A 2K8BA 3NZUA 4GU2A 4GOCA 1WJ6A 3UQAA 2FCSA 4KIKB 2C7MB 2LUEA 5G55A 3CMMB 5L83A 3RUIB 3HM3A 3DBRI 4GDLB 3VDZA 1QZEA 3LJ3A 4WQOB 2KWUB 2AL6A 1MG8A 2V4LA 2PE6B 1WMHA 3ZLZA 2ZPNA 3MHSD 1Q1OA 1LFDA 4WJNA 3ZUNA 3ML8A 2AEHA 3L10B 3APCA 4NJ7A 2C7NB 4M0WB 2HJ8A 4BKSA 2LGYA 4IWQA 4MEMA 2ZCBA 4ANXA 4FA6A 3NOBA 2ZEQA 3ZW3A 4HXDA 3KH0A 3M63B 1WMHB 3L16A 2KKCA 1XQQA 2IY0B 4NNJB 3PZDA 4KSKC 1WGDA 4W9HA 2BYVE 2LGXA 2LI5A 2EMSA 3HM6X 5D94A 2FUHB 5BO4B 1L7YA 2IO1B 3VVWB 2V3SA 4NY0A 1YX5B 2K6QA 2LRUA 2ZNVB 3AU4A 2KJHB 3KW5B 4I6LB 3ML9A 5J18A 4HK2A 2IY1B 2ZVNA 4JGHB 1OEYA 2L3ZA 4HDQA 3V6EB 2XEWA 2N1VA 1S3SG 2DZKA 4JL9A 3UGBB 2LVOA 3A9JA 2HD5B 2KDFB 4LJPB 4FLHA 3R66C 4KV2A 2KC1A 3B0AA 4ZRIA 2MCNB 3KUDB 2LRWA 2PEAA 1ZKHA 1WI0A 2RSUA 3JW0X 3DOWA 1P98A 3N30A 3ZVVA 5DPSA 2M8SA 3A9JB 2RR9A 4JQWC 2G4DB 4YL8A 2C9WB 1GC7A 5E6OA 1WX7A 1WZ3A 3R3MA 3DVGX 4KZ0A 3AXCA 2KC2A 4N9F4 1RAXA 3VQIA 4NQLB 1E8ZA 2C7HA 2KLCA 2J0JA 2A5UA 2J7QB 5CHFA 5JHAA 1UGMA 1YIWA 1EF1A 1VD2A 2LVPA 4FN2A 4DHJD 2KWCA 3PPAA 3AU5A 4OVUA 4GXBA 3V60A 4W9FA 1IPGA 2XK5A 2KANA 2LWPA 4NJ6A 5FR6A 4EZJA 2FIDA 2BYEA 3RCZA 4J6IA 5J17A 2YVCA 3VUYA 2REXA 3W1SA 3TMPB 1TZ1A 4WWPA 3KYCD 3H6NA 2MBOA 3PV1A 4FBJB 4HCPB 3WAOA 4BVUC 2G45B 4MM3A 5KHOA 3PT2B 2XK5B 2DX5B 2IO0B 2KO3A 3HIZA 1E8YA 4TQ0A 2J0KA 1F9JA 3ZNHB 4CO7A 1C3TA 2NR2A 1Q5WB 2JF5A 4ICUA 3ZNZB 2NPTA 1J8CA 5DPWA 3L54A 1WJUA 3RYTA
chains in the Genus database with same CATH superfamily
1QT9A 4NAWA 4BFRA 2WXLA 3J9CA 2N7JA 2JWZA 2KVZA 4E71A 4MM3B 3Q3JA 2NTSA 2RPQA 3HVDA 1T0RC 2I1JA 4WH4A 3KVFB 3PZ8A 3ZYYX 1T5XD 1JALA 1J0GA 3R7RA 2DENB 2FCMA 2WXFA 4HWIB 2VH1A 2AQ2B 4HJGE 2LXAA 1JWAD 1SEBD 4DHZE 5H92C 3M62B 1FCLA 5JZEB 2KTFA 4MELA 3TSSA 1SSNA 2ZW1A 4KGRA 2BS2B 1P1AA 1QF6A 5IP4D 1CJEA 2QMTA 3V6CB 2BT6A 3RZFA 2GB1A 2GBJA 3BINA 3ZKJC 1WM3A 3Q8BA 3H7PA 1KLGD 3DCGA 1C79A 1F2RI 4DHZB 4GSWA 2KDIA 3TEYA 2KWVB 1NYQA 4A3PA 4M00A 1L6VA 3I3TB 5LLIA 4PS7A 1EWCA 3TBLD 3T9LA 3ZJTA 4MGZE 3HHMA 3H8HA 5DPTA 3PHWB 4C4VB 4RM9A 1AARA 4Q2JA 3MHZA 3URYA 5J2RA 4WWMA 1P3QU 2NBWB 3AM9A 4TMAB 5DCNA 5H8YE 1V81A 2PJHA 3GZNI 3BVMA 4ICVA 2G4SA 3PZ7A 3K9OB 5CX3A 2DAJA 2PKOA 4ZDVA 1NENB 2BBCA 2MSED 2E3TA 4XGAB 2HJ1A 3IFWB 4W9CA 4MGKE 4YWGG 3W1YA 2BF8B 2IGDA 4G50A 2D5GA 3MP9A 2JVCA 2Z0DB 5E6JA 1X1MA 2ASQA 3SHQA 3L13A 1B1ZA 1GJZA 1JROA 1JCKB 1TY2A 2L83A 3P1MA 3WALA 2WXOA 3B2FA 3APDA 1VZ8A 2KQ4X 4FJYA 5CHWA 2DYOA 2QHOA 2CU1A 2EKEC 2KMAA 3WAMA 3ABVB 5C23A 2JZPA 2JYEA 3S2AA 2LGDA 3DHGC 4LNFA 2N9XA 2M0AA 2JSVX 2LGSA 4YT0B 3DBLB 1MPEA 1M4VA 3I5JC 1WXMA 2CR5A 2N0SB 2YEPF 2WXNA 4ARIA 1SE3A 2ZPYA 1SJED 1YJIA 3VTWA 3ENEA 2DZJA 3Q8AA 3KUZA 1TBEA 3QAQA 1PGXA 3W1SC 3NS8A 4WAAA 3FILB 3GOEA 4IOIE 4YTMB 5LXHA 2PW9A 2K8HA 4KSLC 2J0MA 1YQ3B 1MG4A 2O6VD 2N9LA 3MTNB 3M95A 4HDOA 4GIVA 2WXPA 1FFUA 2UYZB 2GRIA 2D3CA 1P0RA 1F0ZA 1ZGUB 1PQSA 2KDMA 5AEKB 1E7UA 3W9CB 1TKGA 1H4RA 3VH3B 4IUMB 3OJ3A 3PS6A 3ZO5B 3ZTCA 2JT4B 4EE2A 1F2RC 1ROEA 2CU3A 3SD5A 1L4DB 2N7EA 4MGYE 4N59A 4K7SA 3N20C 4KZCA 3KYDD 2B76B 4C7ZA 2KOXA 4LNKA 2IBIB 2IDYA 1AYFA 2NBUA 4II3B 2BGFA 4RGMA 3OLMD 3NVZA 2J42A 3NZSA 5TR5A 1U4AA 3CSFA 1TS4A 4ZRJA 4WURA 2FCQA 5EE0A 3ZXVA 4I6PA 2FNJB 2VRRB 2EMTA 4A55A 2AX5A 3AI5A 4BKGA 2W54A 4JX1C 1EF5A 1LGRA 1PYWD 1PFDA 2WXJA 1I4QA 1TS3A 3B2GA 4CHKA 2AL3A 1KM7A 2MEKA 1IBXB 3AE6B 4XX5A 4MT5A 4BZAA 3AN1A 1YD8U 1Q10A 1IYFA 4TV3A 2MQJA 3RT3B 3TIXA 2WLBA 4GGQA 3TJPA 3VAWA 4DXFA 1MHHE 1NBFC 2N1WA 3ZJUA 4HKQA 5G2NA 5D3IB 3NZ3A 1C1YB 2WXGA 2ZZPB 3M3JA 3P4QB 1FXAA 2Z0EB 4W9IA 2BS3B 4G3XB 3A9KB 1KOTA 3VH4B 4MSMB 3VFKA 4M02A 4KIKA 3E9SA 3QCAA 1BMLC 1GB4A 4EFOA 4W9LA 2L0FA 3BVZA 2H88B 2E6XA 2SEBD 2IGHA 2FUG1 4DK5A 4GU2A 2WXRA 4GOCA 2LHEA 4M0WA 2KWUB 2ZPNA 1Q1OA 1LFDA 1UNSA 1D5XC 4IWQA 1T0SC 3NOBA 3KH0A 2CJNA 3L16A 1XQQA 1UWMA 4LNNA 1WGDA 2LGXA 1QOBA 2FUHB 2I2YA 1L7YA 2IO1B 1ENFA 1QKZA 1SE2A 2WXKA 4YTNB 1YX5B 2ZNVB 3TEWA 1NYRA 2QEJC 2ZVNA 1OEYA 5BYRA 3U4EG 2XEWA 2HD5B 4FLHA 4LTUA 4ZRPA 1A70A 1VRAB 3C19A 3B0AA 1XCTL 3B9JA 2QCZA 1YMHE 3A9JB 3IAM1 1HQRD 2C9WB 3RNEC 2PIAA 3AE9B 2XNAC 1E8ZA 2KLCA 2WS3B 5IN7A 2A5UA 5IKCM 5CHFA 5JHAA 1VD2A 1VLBA 4OVUA 3GP7A 4HRSA 2KANA 4NJ6A 3N1YC 2BYEA 4US8A 2OEDA 3RI7C 1D5ZC 2MBOA 3AB5A 4HCPB 3WAOA 4MM3A 5KHOA 2J0KA 3ZNHB 4CO7A 4ICUA 2NR2A 3ZNZB 1J8CA 3L54A 1G6JA 1ZXIA 4JWUC 4RCOA 4WWNA 4XDDA 1GB1A 5IO9A 4ZYSA 2I1KA 2JUOA 1F77A 3AE3B 4OVVA 2L1AA 1RM6C 1J7AA 1FXTB 2QSDA 2W9NA 2D2QA 3PLUA 3WAPA 4CYEA 4I6NB 2NPTB 2DBYA 4AOFA 1MVKA 3DBHI 3WCQA 1QOFA 2V0GA 2INPE 1FM0D 2OOBB 1GAQB 4WQMA 1V80A 2MBEA 3IBEA 4AWJA 4ANWA 1Y56A 1OEYJ 1I4RA 4FHKA 3RNGC 1E8XA 5D3DA 2ONQA 4BAXA 1SJHD 2MHJA 3Q8FA 3VXWA 1TYGB 5HFYA 2CJOA 3FAHA 2JXXA 2V3PA 3QQ8B 3U52E 4JLCA 4C4VA 2CHZA 4EEWA 2M19A 1E6EB 1RFKA 3O65B 2L7RA 1K52A 4LDTD 3UIPB 4JIOU 3V61A 1I4HA 4L23A 2AYOB 2WGSA 2QIEB 4HEA1 1YJ1A 2W55A 2CHXA 2DZIA 4HJKA 2BKFA 1ISNA 1V86A 3WIMA 4M8MA 2ICIA 1WGKA 2GOWA 2Y5PA 1KH0A 2KXJA 2MLBA 3HRDD 3VDZA 4XWTA 3VRBB 1J7BA 3LDZE 4WWOA 1E7VA 5CHVC 3I57A 2DAFA 2KLGA 1TGZB 2M17A 2LMCA 4TKNA 2D3GA 3CWIA 4WJOA 1T6BX 2LFIA 3PRMB 1WE7A 2O2VB 4URKA 3PLVA 1WXAA 2KTRB 4N58A 3A4RA 2ZVOA 2NBVB 1WRIA 4HPLB 4EZLA 1RYJA 1STEA 2CHWA 3RZWC 2MRPA 2RDBC 3DHIC 4KVGB 3H1UA 4OZBA 1JMLA 4N6EB 1FCCC 2DLBA 3IG3A 2WDTB 2K1FA 1DOIA 1WSPA 5AUKA 4NPNA 1YX6B 1VCBA 4AQ7A 2V1YA 1SXTA 1K51A 3Q69A 1E8WA 1KF6B 2WXQA 1RFAA 1LO5D 1OQYA 3Q3FA 3FILA 4NAMA 1SGHA 4AJWA 3P4SB 1FXIA 2KDEB 3AEEB 1NI2A 4XZ4A 3ALBA 4FADA 3MFGA 2GBNA 2WP9B 2AQ3B 1Q0WB 1WJ4A 4GDLA 3CIRB 4F8CB 1LQBA 4GB9A 3HUIA 3T8MA 3A4SC 3R7QA 1IGCA 3PO0A 4II2B 3TEZA 2L8JA 2V3NA 1L4ZB 2R2OA 3PSEB 3DHHC 1M94A 2BPSA 1CQVA 2WU5B 3RNAC 2INDC 4B0MA 2D10A 2EKIA 4A8XC 5C2TB 4OW0A 3SU8X 3X23A 2GMIC 1V5OA 1HTOA 4A90A 2KDBA 2D07B 1Y8RC 1SF0A 4RGOS 3A1QB 2LASA 4PYUA 3VTUA 3UQBA 3BWUD 4BOZB 1L5PA 3O13A 3GB1A 3DDCB 2D3BA 3HK0A 1V5TA 3BYTB 5AZGA 1D3ZA 2LJIA 3AEGB 3X0WA 2HDEA 2N9PC 1WZ0A 3V3XA 2IO2B 1D6EC 3LXFA 3AMZA 1IBXA 1EWYC 2LEKA 2QILA 2OJRA 1FD6A 1EM7A 4RFBA 1MFWA 5AZHA 4A20A 4E74A 4P6VF 1SIFA 2KJRA 2L32A 3RPFC 1T0YA 2BTEA 1WGHA 1WXVA 2BW2A 2OHFA 3MJWA 5FKAC 2KZRA 2JZZA 2CS4A 2JQRB 1N61A 4IM2A 3ZDMC 4LK0M 3GS2A 1XXGA 2N4FA 2J4XA 2JWUA 2FCNA 2JRIB 3A9KA 3AE5B 3ZJVA 1NEKB 2DHZA 3ONSA 1JQ4A 2FAZA 2PTLA 3NVVA 5BYSA 4G0NB 2KN4A 2J53A 1XCQL 2BWES 5TSSA 2C60A 1HZ6A 3SFEB 3EC8A 5E6NA 1UBQA 2BS4B 2BWFA 3QARA 4NQKE 1HE8A 3T3NA 2VZKD 4MGIE 1A5RA 4MJSB 3VUXA 4BBNF 4YTPB 1WJ6A 1ZOYB 2C7MB 2LUEA 5L83A 3RUIB 3DBRI 4GDLB 3AH7A 1GOZA 1ZXHA 1MG8A 2V4LA 3ZLZA 3MHSD 3EGRA 1WXQA 4WJNA 3ZUNA 2VH2A 3L10B 5C3JB 2C7NB 4MEMA 2WHIA 2L52A 4IKGA 1E10A 1WMHB 4NNJB 1XF5L 3PZDA 2PVOD 4W9HA 2LI5A 2V3SA 4NY0A 1SE4A 3KW5B 3MC0B 2KJHB 5J18A 4HK2A 2L3ZA 3V6EB 4JL9A 3A9JA 2KDFB 2KC1A 1C9FA 1UWXA 4P1BC 4R3DA 2Q5WD 3Q2AC 2PEAA 1ZKHA 1TKEA 3ZVVA 2M8SA 2G4DB 2ON8A 2GLSA 5E6OA 2W82A 1C4PA 3DVGX 2KC2A 1RAXA 3VQIA 2J0JA 2J7QB 1UGMA 2LVPA 4GXBA 3V60A 5BMGA 4DXGA 1TS5A 2BB6A 2LHDA 1PDXA 3RCZA 4J6IA 5J17A 3H6NA 4ITKA 2QJLA 3C8YA 3PT2B 2XK5B 2DX5B 2G1EA 3HIZA 4TQ0A 4C80A 1F9JA 1N62A 1TJEA 1CK1A 2NPTA 4HKZE 3RYTA 3KUCB 1WH3A 1GUAB 3TEXA 1WRDB 2NS5A 4XYCA 2RPVA 4L1BA 4DWFA 2WWZA 4PK1A 2A4ZA 3AE1B 1YQBA 3NS1A 3LYYA 2KFKB 1R4NI 3EFCA 2L76A 1XLQA 3UINB 4FULA 4JE3B 1YN5A 3ZXRA 2KVRA 4W9EA 1ZP0B 4D2KA 3QA8A 3DBSA 5EDSA 2K0PA 1UBIA 1UELA 3Q3MC 2QDFA 2KX3A 5IA7A 4DDGD 3AEBB 5IOIA 2JXTA 3IVFA 4IWOA 1E9MA 1UF0A 3EUB2 3QC8B 3B1LX 4BOSC 4ANVA 2DZMA 2R61A 4IG7B 1EUVB 2L00B 2IO3B 3AE8B 4PS3A 3BK1A 1I42A 3LB8C 1SE9A 4TSSA 3U7ZA 4ARCA 1QOAA 3GE3C 2MBBB 1TZOA 1ET9A 2FIFA 1MHXA 3N3KB 1AN8A 2B3AA 3GZNB 3UIOB 1FNUA 1PGAA 2K6DB 1YN4A 3P2BA 3P4RB 1Z5SB 3QJZA 1F52A 2IJ0A 3TL5A 2H89B 4ZRQA 3QHTA 3NVWA 3C0RB 3U30A 2PVGC 1KJTA 4RMAA 2LXCA 4B0EA 4RM8A 3VRAB 3PRPB 4RH6A 4LLGM 1WGRA 2O2VA 1DGJA 1BT0A 4IWPA 2LUMA 4HROA 2KTRA 4P7IA 1C76A 2MJ3A 2V9HA 1QQRA 4A3OA 3ZIMA 1DOYA 2O6VB 4XDCA 2VZKB 3AE2B 4LCDE 2J52A 1IGDA 3KWLA 1XLOA 1BUIC 2MH7A 1C77A 1I4XA 4L2YA 4F1SA 1WR1A 2I38A 4ZOHC 1K8RB 1I35A 1KRHA 4FJZA 1FFVA 5DPRA 3BYYB 1ZE3D 3T3OA 3KQ4A 3H7SA 4BKSD 4GMVA 5EE3A 2IPKD 2KNBA 4YXDB 4ANUA 1V49A 2C5LC 4OHJA 1UZXB 2RD0A 2MP2B 3EHVA 5L95C 1P9DU 4BBNC 4GDKB 3HVZA 1WXSA 1N6ZA 2MA9B 2BYFA 4HPPA 1OGWA 2WU2B 1S1QB 2PE9A 2LD9A 3WA0A 1ACCA 4B95A 1FNVA 3AE7B 3L17A 3RMKC 2HTME 4C7YA 3A33B 1V6EA 3BIID 3IHPC 2W3RA 3AEAB 3RN9C 1ZDVA 4W9DA 2KYWA 3AECB 1CMXB 5BMIA 1DOXA 4TQ1A 3SR6A 2KAJA 5AZFA 3BY4B 4X57B 3QIJA 4MSQB 5D2MB 1AWDA 3NY5A 1WGGA 1XLNA 4FXCA 3U8ZA 4AS1A 3MJ5A 5BMHA 4PT5A 3A1QA 3MC9A 4WJPA 4K7UA 4W9GA 5EE1A 3ZRCA 3NRZA 2MWSB 1V1PB 4LJOB 3W2DA 3GE8C 1UD7A 1FIQA 3SDLC 1BXTA 2MX2A 3CSTA 2XBBC 2W3SA 4QAYA 2EELA 4PYZA 5HI1A 5E6PA 2M4NA 2WDVB 3L0WB 1WJNA 1MI0A 2KN5A 5JHBA 4LNOA 2K8CA 2WYQA 2WQYB 4G11A 3DQVA 4ACFA 1XT9B 3ZDTA 4XE0A 3RFZB 4BKTA 1Z2MA 1E90A 3DVNU 1V97A 4W9JA 3FC4A 3IAS1 4B6WA 1GG3A 2NVUI 5IAAC 1VJKA 2NTTA 4K7WA 3OG5A 1PUTA 1EU3A 1C4AA 2MJDA 3MC8A 1KLUD 2BKRB 2WDRB 3VTVA 3ZNGC 2MW5A 5JXVA 4HCNB 1WE6A 2PMVA 4K81A 2ZCCA 4DBGA 3TUOA 1P7FA 4NJCA 2N9KA 1WFYA 2LJ5A 5GXGB 4K1RB 4USAA 2D3AA 3KLSX 3CF6E 4MH0E 2G3QB 3W5VB 1R4NB 3P42A 4PS8A 2KFJA 3VR8B 2NCNA 2QC8A 4MJSA 2UU7A 1EO6A 2GBKA 1TTNA 4IDIA 4XC2A 2MBHA 5KHQA 1K50A 4EUTA 5BYQA 2CKHB 1ZUD2 4JWSC 3N32A 4GLSC 3H9DA 4C00A 4F7ZA 3NZUA 1YJJA 2DNFA 3UQAA 2FCSA 4RF1A 1JWSD 5G55A 3CMMB 3HM3A 1QZEA 2KMMA 3LJ3A 4WQOB 5G5HA 1WMHA 4P1CC 2IGGA 4LNIA 2WNMA 1L0VB 3APCA 4A9AA 3E56A 4NJ7A 4ANXA 5T8IA 3ZW3A 1SIJA 3M63B 2LGIA 4KSKC 3HM6X 2WXHA 5BO4B 3VVWB 2K6QA 2LRUA 4I6LB 4YSZB 4JGHB 1S3SG 4NZLB 3VR9B 2WXIA 4O1NA 2LVOA 4KV2A 2K3UA 2MCNB 2PLPA 3KUDB 2LRWA 1QOGA 1WI0A 2RSUA 3JW0X 2KWDA 1AW7A 1RWSA 4JQWC 2JU6X 3R3MA 4KZ0A 4N9F4 1GPXA 3SFDB 2Y5CA 1YIWA 4FN2A 4DHJD 3PPAA 4ZHOA 1IPGA 2XK5A 2YVCA 3VUYA 3W1SA 3TMPB 1TZ1A 3KYCD 3PV1A 4FBJB 4BVUC 2G45B 2RDGA 3I9V1 4KKIA 1WWTA 4P16A 1E8YA 2V4IB 1C3TA 1QILA 1Q5WB 2JF5A 3OWEB 1XEEA 4JPSA 1XO3A 4LDTB 1VDVA 3DBHB 5I4DA 4FJVB 2KFKA 4FHJA 3ZRFA 5EE9A 4NAWB 4MACA 1IP9A 3N1ZC 5G5GA 1RLFA 2JYTA 1N60A 1NI3A 3B08A 2DYBA 1RRBA 1OQRA 4XWWA 1TY0A 1WGYA 4REZA 1J19A 4ZHPA 4IW0A 2JPHA 4MH8A 2FBWB 2R2QA 1WY8A 2X38A 3FKYA 1UGJA 1H8CA 3KWVA 1SBBB 3JSVA 1F1HA 3L4PA 1R4MI 1JW9D 1C4CA 4RGNA 2D11A 3PRZA 2MJEA 2K25A 3QX1A 3ZNID 3H7PB 2ZJDA 4RNAA 1CZPA 1D4BA 1YN3A 4EZKA 3D32A 1HXYD 4ASWC 2BYTA 4M01A 1PGBA 4IM3A 3Q6BA 1OQQA 1TKYA 3WANA 3IT6B 3Q14C 2KT7A 2M0XA 1I4GA 3PTFC 4AUQC 1N5XA 3BZDB 1VZ6A 5JH5C 4KX6B 1C78A 2KMCA 4IM0A 4TUUA 2KHWB 4KGSA 1XD3B 2O6VA 2HE7A 1V1OA 1YNTE 1K53A 4IC7B 4DDID 1P7EA 2IZVB 4WAFA 2G9HD 1JRUA 2ZNVC 2K39A 3RNBC 2WX1A 3RNCC 2KK8A 4EOYA 5AUIA 3Q8CA 2BVCA 1FMAD 1GNUA 1FO4A 3JVZX 3AULA 4DQOC 1KFYB 3APFA 4K3CA 5D6JB 3DWMA 2MP2A 4M8NA 1L2NA 2FE8A 1E5WA 3PGEA 1SB3C 2KD0A 2Y5BB 4GDKA 4AJYB 3P63A 1LXDA 1V9JA 3DPDA 2RMMA 1TIFA 3BVGA 2N7DA 3R8BA 3JYUA 1GC6A 4WJQA 4AP4C 5HHDG 4A6QA 4RGTA 2KJ6A 1D5MC 1LM8B 1V2YA 2SAKA 3Q8EA 1E7PB 3U2SC 2KQ7A 4YSYB 2INCC 3OAWA 4S17A 1ZDXA 2TSSA 3AE4B 2GI9A 3IT4B 5CTRC 1WX8A 1UH6A 2RGFA 4C56C 1VR9A 2DWQA 2JRHA 5LXIB 2GBRA 1QLBB 1WX9A 1FEHA 2JY6A 2KACA 4KDIC 1R7SA 3DVGY 1ZW7A 1HZ5A 4DHJB 5HKHA 3NHEB 1WM2A 2L05A 3JSVB 1V1PA 2LZ6A 3U7DA 3R2IA 5HG2A 2AWTA 3P4PB 5FK9C 1NDDA 4MDKE 2LVQA 3VHTC 2KQSA 3RNFC 2L0TA 3ECIA 5D7GA 4RF0A 4KDLB 1WIAA 2K5PA 1KLVA 2Y3AA 3QK0A 3PREA 1N5WA 2YLMA 2GBMA 3SEBA 1XLPA 3RD2A 2JX5A 4HLEA 4EKUA 1EU4A 2INNE 3ZTDA 1OFFA 3EECA 1WYWB 3K9PB 4WIPA 3OJ4B 3UF8A 4B9KA 2DYMA 2Z59B 2UWQA 5GMVA 3UI3A 3V05A 4ZRKA 4HPMB 4K3BA 4E3CA 4HVBA 1JWBD 3AEFB 4J3OD 2HTHA 3NVYA 1ZPSA 4W9KA 3QWZB 2BB5A 3NJTA 1WR6E 3DVNV 1NVID 3DWGC 1HEZE 2OJWA 2PPHA 3AV8A 1WF9A 2WX0A 4OVZA 2K22A 3V62A 3N9YC 3ZGZA 2JZ3B 4GN1A 2N9EB 1ET6A 2M1MA 2KX0A 4OZAA 3PHXB 2AQ1B 3L08A 2ACZB 1JRPA 1UUPA 3TCAA 3EFUA 1KTKA 1FRRA 2IYDB 3PVLA 3DBLI 2MBQA 1TS2A 4DXAB 4ZYNA 3RULA 5LNK1 1OTRB 3VUWA 5C1ZA 2XN9C 3DBRB 2M56B 4KKJA 1T0QC 2K8BA 5MPOA 3ETRA 4KIKB 2WXMA 1R4MB 1DYQA 2AL6A 4S0RA 2PE6B 1B9RA 3Q3NC 2BQQA 3NG0A 3ML8A 2AEHA 3W5UB 2ZW0A 3ZQ4A 4M0WB 4BKSA 2HJ8A 2LGYA 2ZCBA 4FA6A 1HTQA 2Z8LA 1J7CA 1L6UA 2ZEQA 4HXDA 1WYGA 1ESFA 2KKCA 2IY0B 1E0ZA 2BYVE 1FRDA 1L0XB 2EMSA 3EA6A 3Q3OC 5D94A 1I4PA 1VZ7A 1JWUD 3AU4A 1L0YB 3ML9A 2IY1B 4HDQA 2N1VA 3BK2A 2DZKA 3UGBB 4UDUC 4KGTA 4LJPB 1V8CA 2X8XX 3IXSA 3R66C 3I63C 1YQ4B 2YEPB 3N1XC 4ZRIA 1MJDA 2K9XA 2RDHA 1P98A 2WDQB 3DOWA 3N30A 5DPSA 2RR9A 4YL8A 1GC7A 1WX7A 1WZ3A 1T3QA 3AEDB 3AXCA 4OZCA 4NQLB 4US9A 2C7HA 1IUEA 3NUHB 1EF1A 2KWCA 3AU5A 4W9FA 1N63A 1HA5A 2LWPA 5FR6A 3R2TA 1I7HA 2FIDA 4EZJA 2REXA 1TT5B 4WWPA 5FR3A 1YOVB 2IO0B 4H2AA 2KO3A 1JWMD 2NMQA 1FNWA 4YSXB 4CQNA 5DPWA 1WJUA 1FPYA
chains in the Genus database with same CATH topology
3KUCB 4LDTB 4NAWA 4WWNA 4BFRA 4FJVB 2I1KA 2JUOA 1WH3A 1GUAB 2JWZA 2KFKA 4E71A 3Q3JA 4OVVA 1WRDB 2RPQA 2NS5A 1FXTB 2W9NA 3PLUA 2D2QA 2I1JA 3WAPA 4CYEA 4FHJA 3ZRFA 3KVFB 4I6NB 2NPTB 4AOFA 1J0GA 3DBHI 3R7RA 2DENB 2FCMA 4NAWB 4DWFA 2WWZA 2A4ZA 1YQBA 1IP9A 2OOBB 4HWIB 2KFKB 1R4NI 2L76A 2LXAA 1RLFA 1V80A 4DHZE 3B08A 2DYBA 3UINB 4FULA 1RRBA 2MBEA 3IBEA 3M62B 2KVRA 4W9EA 5JZEB 2KTFA 4AWJA 3QA8A 3DBSA 4ANWA 1WGYA 1OEYJ 4MELA 1J19A 5EDSA 1UBIA 1UELA 4FHKA 4IW0A 2JPHA 2KX3A 5IA7A 1E8XA 1P1AA 4DDGD 2R2QA 1WY8A 3IVFA 4IWOA 3V6CB 3RZFA 2GBJA 3QC8B 3B1LX 3BINA 3ZKJC 4ANVA 1WM3A 4BOSC 2DZMA 3H7PA 1H8CA 3DCGA 3VXWA 3JSVA 1R4MI 4DHZB 4GSWA 2KDIA 2KWVB 2JXXA 3QQ8B 4IG7B 4JLCA 1EUVB 2CHZA 4A3PA 4EEWA 2L00B 2D11A 2IO3B 3PRZA 3I3TB 4PS3A 5LLIA 1I42A 2K25A 3O65B 3QX1A 4PS7A 3H7PB 3ZNID 3TBLD 2ZJDA 3T9LA 2L7RA 4LDTD 1SE9A 4MGZE 3HHMA 4JIOU 3UIPB 3V61A 4EZKA 3D32A 5DPTA 3PHWB 4RM9A 2MBBB 1AARA 2FIFA 4ASWC 3N3KB 2AYOB 2B3AA 3UIOB 4IM3A 2K6DB 3WANA 1YJ1A 5J2RA 3P2BA 2M0XA 2CHXA 1P3QU 2DZIA 1Z5SB 2NBWB 3PTFC 3QJZA 4HJKA 4AUQC 2BKFA 5DCNA 3TL5A 5JH5C 1ISNA 1V86A 1V81A 4M8MA 3WIMA 2PJHA 3QHTA 3GZNI 3C0RB 2GOWA 4ICVA 3U30A 2KMCA 2G4SA 2KXJA 1KJTA 2MLBA 4IM0A 3K9OB 4RMAA 4TUUA 2LXCA 5CX3A 2KHWB 2DAJA 4RM8A 4ZDVA 3PRPB 2MSED 1XD3B 2O6VA 2HE7A 3IFWB 4W9CA 4MGKE 3LDZE 4WWOA 1WGRA 1E7VA 5CHVC 2O2VA 4IC7B 1BT0A 4IWPA 3W1YA 4DDID 2BF8B 2DAFA 2IZVB 2KLGA 4G50A 2KTRA 1TGZB 2M17A 1JRUA 2JVCA 4P7IA 2ZNVC 4A3OA 3ZIMA 2Z0DB 2O6VB 2K39A 4TKNA 1X1MA 2ASQA 2D3GA 2WX1A 4LCDE 4WJOA 2KK8A 4EOYA 3PRMB 3SHQA 1WE7A 2O2VB 3L13A 1GJZA 4URKA 3PLVA 1WXAA 1GNUA 2KTRB 3A4RA 2ZVOA 2NBVB 4HPLB 3JVZX 4F1SA 3AULA 3RZWC 3WALA 2CHWA 4EZLA 2MRPA 3APFA 1WR1A 1I35A 1K8RB 4KVGB 5D6JB 3H1UA 4FJZA 5DPRA 2MP2A 4M8NA 3APDA 1L2NA 1E5WA 3IG3A 2WDTB 3PGEA 2K1FA 4FJYA 2KD0A 2Y5BB 3H7SA 4BKSD 4GMVA 4NPNA 4GDKA 5CHWA 1YX6B 1VCBA 2DYOA 4AJYB 2QHOA 2CU1A 2KNBA 2V1YA 1V49A 1LXDA 1V9JA 2EKEC 3DPDA 4ANUA 2KMAA 2C5LC 3WAMA 1E8WA 1UZXB 2RD0A 2N7DA 5C23A 2MP2B 3EHVA 3JYUA 5L95C 1RFAA 3S2AA 1GC6A 1P9DU 2LGDA 4WJQA 4AP4C 2N9XA 4BBNC 4GDKB 2KJ6A 1OQYA 1WXSA 2MA9B 2BYFA 3Q3FA 1OGWA 1LM8B 1S1QB 1SGHA 1WXMA 2CR5A 4AJWA 2PE9A 2LD9A 3WA0A 2ZPYA 4B95A 3L17A 1V2YA 3VTWA 3ENEA 2DZJA 2KQ7A 3KUZA 1TBEA 3OAWA 2KDEB 3QAQA 3W1SC 3NS8A 4XZ4A 1NI2A 3A33B 1V6EA 4WAAA 5LXHA 3GOEA 3ALBA 4FADA 2GBNA 2K8HA 2J0MA 4KSLC 3IHPC 5CTRC 1WX8A 1UH6A 2O6VD 1Q0WB 2RGFA 4W9DA 1WJ4A 4GDLA 1CMXB 2JRHA 3MTNB 5LXIB 3M95A 4F8CB 4HDOA 2GBRA 4GIVA 1LQBA 4GB9A 3T8MA 1WX9A 3A4SC 3R7QA 4TQ1A 2UYZB 2JY6A 5AZFA 1P0RA 4II2B 4KDIC 2L8JA 3BY4B 3DVGY 1ZW7A 4X57B 2R2OA 3QIJA 4DHJB 1ZGUB 1PQSA 3PSEB 5HKHA 4MSQB 5AEKB 3NHEB 5D2MB 1E7UA 1WM2A 1WGGA 2L05A 1M94A 2BPSA 2LZ6A 3JSVB 3NY5A 3U7DA 1H4RA 2AWTA 3U8ZA 3VH3B 4IUMB 2D10A 3A1QA 4WJPA 3OJ3A 1NDDA 4K7UA 4W9GA 3PS6A 4MDKE 2LVQA 3SU8X 3X23A 3VHTC 2KQSA 3ZTCA 2L0TA 3ZO5B 2JT4B 3ECIA 5D7GA 2GMIC 1V5OA 3ZRCA 4KDLB 1WIAA 2MWSB 1KLVA 4LJOB 1G6JA 3QK0A 2KDBA 3PREA 2D07B 2YLMA 1Y8RC 2GBMA 1UD7A 3SD5A 3RD2A 3SDLC 3A1QB 2MX2A 3CSTA 2N7EA 4HLEA 4MGYE 4EKUA 2XBBC 4K7SA 2LASA 4KZCA 3ZTDA 4PYUA 3EECA 3VTUA 4PYZA 3UQBA 3KYDD 4BOZB 1WYWB 3K9PB 5E6PA 2M4NA 3L0WB 2KOXA 3DDCB 3OJ4B 3UF8A 3HK0A 1V5TA 1WJNA 4B9KA 2DYMA 2IBIB 2NBUA 2Z59B 2UWQA 2KN5A 5GMVA 4II3B 5JHBA 2BGFA 5AZGA 1D3ZA 3OLMD 3NZSA 5TR5A 3X0WA 1U4AA 2K8CA 2WYQA 3CSFA 4ZRKA 2N9PC 4ZRJA 4G11A 2FCQA 1WZ0A 3DQVA 4HPMB 4I6PA 2IO2B 2FNJB 4E3CA 4HVBA 1XT9B 2VRRB 2EMTA 3ZDTA 3AI5A 4BKTA 4BKGA 1Z2MA 2OJRA 1E90A 2HTHA 3DVNU 4W9KA 5AZHA 1EF5A 3QWZB 4A20A 4E74A 1SIFA 4W9JA 2KJRA 4B6WA 1WR6E 1GG3A 2NVUI 1T0YA 3DVNV 5IAAC 4CHKA 1WGHA 1WXVA 2AL3A 1KM7A 3MJWA 4K7WA 4XX5A 2KZRA 1YD8U 2BKRB 2PPHA 3VTVA 2JZZA 2CS4A 3ZNGC 2MW5A 1IYFA 4IM2A 3ZDMC 1WF9A 2WX0A 1WE6A 4HCNB 4K81A 4TV3A 2ZCCA 2MQJA 3RT3B 3TIXA 3V62A 2N4FA 4GGQA 3TJPA 3VAWA 2JZ3B 1NBFC 4GN1A 4DBGA 2N9EB 2N1WA 2M1MA 2FCNA 2JRIB 3A9KA 2KX0A 5G2NA 3PHXB 1WFYA 2DHZA 3ONSA 1C1YB 2LJ5A 2FAZA 4K1RB 3L08A 2ZZPB 3M3JA 3CF6E 4G0NB 4MH0E 2G3QB 2Z0EB 4W9IA 3TCAA 2BWES 3EFUA 2KFJA 4G3XB 4PS8A 3A9KB 2NCNA 2IYDB 3PVLA 3DBLI 1KOTA 2C60A 4MJSA 2MBQA 1EO6A 2GBKA 4DXAB 4ZYNA 1TTNA 3RULA 1OTRB 3EC8A 4XC2A 3VUWA 2MBHA 5E6NA 1UBQA 3VH4B 4MSMB 5KHQA 2BWFA 3QARA 4NQKE 3VFKA 4KIKA 1HE8A 3QCAA 4EFOA 4W9LA 4EUTA 5C1ZA 4MGIE 1A5RA 2L0FA 4MJSB 2CKHB 3VUXA 3N32A 4BBNF 3H9DA 4F7ZA 4DK5A 2K8BA 3NZUA 4GU2A 4GOCA 1WJ6A 3UQAA 2FCSA 4KIKB 2C7MB 2LUEA 5G55A 3CMMB 5L83A 3RUIB 3HM3A 3DBRI 4GDLB 3VDZA 1QZEA 3LJ3A 4WQOB 2KWUB 2AL6A 1MG8A 2V4LA 2PE6B 1WMHA 3ZLZA 2ZPNA 3MHSD 1Q1OA 1LFDA 4WJNA 3ZUNA 3ML8A 2AEHA 3L10B 3APCA 4NJ7A 2C7NB 4M0WB 2HJ8A 4BKSA 2LGYA 4IWQA 4MEMA 2ZCBA 4ANXA 4FA6A 3NOBA 2ZEQA 3ZW3A 4HXDA 3KH0A 3M63B 1WMHB 3L16A 2KKCA 1XQQA 2IY0B 4NNJB 3PZDA 4KSKC 1WGDA 4W9HA 2BYVE 2LGXA 2LI5A 2EMSA 3HM6X 5D94A 2FUHB 5BO4B 1L7YA 2IO1B 3VVWB 2V3SA 4NY0A 1YX5B 2K6QA 2LRUA 2ZNVB 3AU4A 2KJHB 3KW5B 4I6LB 3ML9A 5J18A 4HK2A 2IY1B 2ZVNA 4JGHB 1OEYA 2L3ZA 4HDQA 3V6EB 2XEWA 2N1VA 1S3SG 2DZKA 4JL9A 3UGBB 2LVOA 3A9JA 2HD5B 2KDFB 4LJPB 4FLHA 3R66C 4KV2A 2KC1A 3B0AA 4ZRIA 2MCNB 3KUDB 2LRWA 2PEAA 1ZKHA 1WI0A 2RSUA 3JW0X 3DOWA 1P98A 3N30A 3ZVVA 5DPSA 2M8SA 3A9JB 2RR9A 4JQWC 2G4DB 4YL8A 2C9WB 1GC7A 5E6OA 1WX7A 1WZ3A 3R3MA 3DVGX 4KZ0A 3AXCA 2KC2A 4N9F4 1RAXA 3VQIA 4NQLB 1E8ZA 2C7HA 2KLCA 2J0JA 2A5UA 2J7QB 5CHFA 5JHAA 1UGMA 1YIWA 1EF1A 1VD2A 2LVPA 4FN2A 4DHJD 2KWCA 3PPAA 3AU5A 4OVUA 4GXBA 3V60A 4W9FA 1IPGA 2XK5A 2KANA 2LWPA 4NJ6A 5FR6A 4EZJA 2FIDA 2BYEA 3RCZA 4J6IA 5J17A 2YVCA 3VUYA 2REXA 3W1SA 3TMPB 1TZ1A 4WWPA 3KYCD 3H6NA 2MBOA 3PV1A 4FBJB 4HCPB 3WAOA 4BVUC 2G45B 4MM3A 5KHOA 3PT2B 2XK5B 2DX5B 2IO0B 2KO3A 3HIZA 1E8YA 4TQ0A 2J0KA 1F9JA 3ZNHB 4CO7A 1C3TA 2NR2A 1Q5WB 2JF5A 4ICUA 3ZNZB 2NPTA 1J8CA 5DPWA 3L54A 1WJUA 3RYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KUC B;  4LDT B;  4NAW A;  4WWN A;  4BFR A;  4FJV B;  2I1K A;  2JUO A;  1WH3 A;  1GUA B;  2JWZ A;  2KFK A;  4E71 A;  3Q3J A;  4OVV A;  1WRD B;  2RPQ A;  2NS5 A;  1FXT B;  2W9N A;  3PLU A;  2D2Q A;  2I1J A;  3WAP A;  4CYE A;  4FHJ A;  3ZRF A;  3KVF B;  4I6N B;  2NPT B;  4AOF A;  1J0G A;  3DBH I;  3R7R A;  2DEN B;  2FCM A;  4NAW B;  4DWF A;  2WWZ A;  2A4Z A;  1YQB A;  1IP9 A;  2OOB B;  4HWI B;  2KFK B;  1R4N I;  2L76 A;  2LXA A;  1RLF A;  1V80 A;  4DHZ E;  3B08 A;  2DYB A;  3UIN B;  4FUL A;  1RRB A;  2MBE A;  3IBE A;  3M62 B;  2KVR A;  4W9E A;  5JZE B;  2KTF A;  4AWJ A;  3QA8 A;  3DBS A;  4ANW A;  1WGY A;  1OEY J;  4MEL A;  1J19 A;  5EDS A;  1UBI A;  1UEL A;  4FHK A;  4IW0 A;  2JPH A;  2KX3 A;  5IA7 A;  1E8X A;  1P1A A;  4DDG D;  2R2Q A;  1WY8 A;  3IVF A;  4IWO A;  3V6C B;  3RZF A;  2GBJ A;  3QC8 B;  3B1L X;  3BIN A;  3ZKJ C;  4ANV A;  1WM3 A;  4BOS C;  2DZM A;  3H7P A;  1H8C A;  3DCG A;  3VXW A;  3JSV A;  1R4M I;  4DHZ B;  4GSW A;  2KDI A;  2KWV B;  2JXX A;  3QQ8 B;  4IG7 B;  4JLC A;  1EUV B;  2CHZ A;  4A3P A;  4EEW A;  2L00 B;  2D11 A;  2IO3 B;  3PRZ A;  3I3T B;  4PS3 A;  5LLI A;  1I42 A;  2K25 A;  3O65 B;  3QX1 A;  4PS7 A;  3H7P B;  3ZNI D;  3TBL D;  2ZJD A;  3T9L A;  2L7R A;  4LDT D;  1SE9 A;  4MGZ E;  3HHM A;  4JIO U;  3UIP B;  3V61 A;  4EZK A;  3D32 A;  5DPT A;  3PHW B;  4RM9 A;  2MBB B;  1AAR A;  2FIF A;  4ASW C;  3N3K B;  2AYO B;  2B3A A;  3UIO B;  4IM3 A;  2K6D B;  3WAN A;  1YJ1 A;  5J2R A;  3P2B A;  2M0X A;  2CHX A;  1P3Q U;  2DZI A;  1Z5S B;  2NBW B;  3PTF C;  3QJZ A;  4HJK A;  4AUQ C;  2BKF A;  5DCN A;  3TL5 A;  5JH5 C;  1ISN A;  1V86 A;  1V81 A;  4M8M A;  3WIM A;  2PJH A;  3QHT A;  3GZN I;  3C0R B;  2GOW A;  4ICV A;  3U30 A;  2KMC A;  2G4S A;  2KXJ A;  1KJT A;  2MLB A;  4IM0 A;  3K9O B;  4RMA A;  4TUU A;  2LXC A;  5CX3 A;  2KHW B;  2DAJ A;  4RM8 A;  4ZDV A;  3PRP B;  2MSE D;  1XD3 B;  2O6V A;  2HE7 A;  3IFW B;  4W9C A;  4MGK E;  3LDZ E;  4WWO A;  1WGR A;  1E7V A;  5CHV C;  2O2V A;  4IC7 B;  1BT0 A;  4IWP A;  3W1Y A;  4DDI D;  2BF8 B;  2DAF A;  2IZV B;  2KLG A;  4G50 A;  2KTR A;  1TGZ B;  2M17 A;  1JRU A;  2JVC A;  4P7I A;  2ZNV C;  4A3O A;  3ZIM A;  2Z0D B;  2O6V B;  2K39 A;  4TKN A;  1X1M A;  2ASQ A;  2D3G A;  2WX1 A;  4LCD E;  4WJO A;  2KK8 A;  4EOY A;  3PRM B;  3SHQ A;  1WE7 A;  2O2V B;  3L13 A;  1GJZ A;  4URK A;  3PLV A;  1WXA A;  1GNU A;  2KTR B;  3A4R A;  2ZVO A;  2NBV B;  4HPL B;  3JVZ X;  4F1S A;  3AUL A;  3RZW C;  3WAL A;  2CHW A;  4EZL A;  2MRP A;  3APF A;  1WR1 A;  1I35 A;  1K8R B;  4KVG B;  5D6J B;  3H1U A;  4FJZ A;  5DPR A;  2MP2 A;  4M8N A;  3APD A;  1L2N A;  1E5W A;  3IG3 A;  2WDT B;  3PGE A;  2K1F A;  4FJY A;  2KD0 A;  2Y5B B;  3H7S A;  4BKS D;  4GMV A;  4NPN A;  4GDK A;  5CHW A;  1YX6 B;  1VCB A;  2DYO A;  4AJY B;  2QHO A;  2CU1 A;  2KNB A;  2V1Y A;  1V49 A;  1LXD A;  1V9J A;  2EKE C;  3DPD A;  4ANU A;  2KMA A;  2C5L C;  3WAM A;  1E8W A;  1UZX B;  2RD0 A;  2N7D A;  5C23 A;  2MP2 B;  3EHV A;  3JYU A;  5L95 C;  1RFA A;  3S2A A;  1GC6 A;  1P9D U;  2LGD A;  4WJQ A;  4AP4 C;  2N9X A;  4BBN C;  4GDK B;  2KJ6 A;  1OQY A;  1WXS A;  2MA9 B;  2BYF A;  3Q3F A;  1OGW A;  1LM8 B;  1S1Q B;  1SGH A;  1WXM A;  2CR5 A;  4AJW A;  2PE9 A;  2LD9 A;  3WA0 A;  2ZPY A;  4B95 A;  3L17 A;  1V2Y A;  3VTW A;  3ENE A;  2DZJ A;  2KQ7 A;  3KUZ A;  1TBE A;  3OAW A;  2KDE B;  3QAQ A;  3W1S C;  3NS8 A;  4XZ4 A;  1NI2 A;  3A33 B;  1V6E A;  4WAA A;  5LXH A;  3GOE A;  3ALB A;  4FAD A;  2GBN A;  2K8H A;  2J0M A;  4KSL C;  3IHP C;  5CTR C;  1WX8 A;  1UH6 A;  2O6V D;  1Q0W B;  2RGF A;  4W9D A;  1WJ4 A;  4GDL A;  1CMX B;  2JRH A;  3MTN B;  5LXI B;  3M95 A;  4F8C B;  4HDO A;  2GBR A;  4GIV A;  1LQB A;  4GB9 A;  3T8M A;  1WX9 A;  3A4S C;  3R7Q A;  4TQ1 A;  2UYZ B;  2JY6 A;  5AZF A;  1P0R A;  4II2 B;  4KDI C;  2L8J A;  3BY4 B;  3DVG Y;  1ZW7 A;  4X57 B;  2R2O A;  3QIJ A;  4DHJ B;  1ZGU B;  1PQS A;  3PSE B;  5HKH A;  4MSQ B;  5AEK B;  3NHE B;  5D2M B;  1E7U A;  1WM2 A;  1WGG A;  2L05 A;  1M94 A;  2BPS A;  2LZ6 A;  3JSV B;  3NY5 A;  3U7D A;  1H4R A;  2AWT A;  3U8Z A;  3VH3 B;  4IUM B;  2D10 A;  3A1Q A;  4WJP A;  3OJ3 A;  1NDD A;  4K7U A;  4W9G A;  3PS6 A;  4MDK E;  2LVQ A;  3SU8 X;  3X23 A;  3VHT C;  2KQS A;  3ZTC A;  2L0T A;  3ZO5 B;  2JT4 B;  3ECI A;  5D7G A;  2GMI C;  1V5O A;  3ZRC A;  4KDL B;  1WIA A;  2MWS B;  1KLV A;  4LJO B;  1G6J A;  3QK0 A;  2KDB A;  3PRE A;  2D07 B;  2YLM A;  1Y8R C;  2GBM A;  1UD7 A;  3SD5 A;  3RD2 A;  3SDL C;  3A1Q B;  2MX2 A;  3CST A;  2N7E A;  4HLE A;  4MGY E;  4EKU A;  2XBB C;  4K7S A;  2LAS A;  4KZC A;  3ZTD A;  4PYU A;  3EEC A;  3VTU A;  4PYZ A;  3UQB A;  3KYD D;  4BOZ B;  1WYW B;  3K9P B;  5E6P A;  2M4N A;  3L0W B;  2KOX A;  3DDC B;  3OJ4 B;  3UF8 A;  3HK0 A;  1V5T A;  1WJN A;  4B9K A;  2DYM A;  2IBI B;  2NBU A;  2Z59 B;  2UWQ A;  2KN5 A;  5GMV A;  4II3 B;  5JHB A;  2BGF A;  5AZG A;  1D3Z A;  3OLM D;  3NZS A;  5TR5 A;  3X0W A;  1U4A A;  2K8C A;  2WYQ A;  3CSF A;  4ZRK A;  2N9P C;  4ZRJ A;  4G11 A;  2FCQ A;  1WZ0 A;  3DQV A;  4HPM B;  4I6P A;  2IO2 B;  2FNJ B;  4E3C A;  4HVB A;  1XT9 B;  2VRR B;  2EMT A;  3ZDT A;  3AI5 A;  4BKT A;  4BKG A;  1Z2M A;  2OJR A;  1E90 A;  2HTH A;  3DVN U;  4W9K A;  5AZH A;  1EF5 A;  3QWZ B;  4A20 A;  4E74 A;  1SIF A;  4W9J A;  2KJR A;  4B6W A;  1WR6 E;  1GG3 A;  2NVU I;  1T0Y A;  3DVN V;  5IAA C;  4CHK A;  1WGH A;  1WXV A;  2AL3 A;  1KM7 A;  3MJW A;  4K7W A;  4XX5 A;  2KZR A;  1YD8 U;  2BKR B;  2PPH A;  3VTV A;  2JZZ A;  2CS4 A;  3ZNG C;  2MW5 A;  1IYF A;  4IM2 A;  3ZDM C;  1WF9 A;  2WX0 A;  1WE6 A;  4HCN B;  4K81 A;  4TV3 A;  2ZCC A;  2MQJ A;  3RT3 B;  3TIX A;  3V62 A;  2N4F A;  4GGQ A;  3TJP A;  3VAW A;  2JZ3 B;  1NBF C;  4GN1 A;  4DBG A;  2N9E B;  2N1W A;  2M1M A;  2FCN A;  2JRI B;  3A9K A;  2KX0 A;  5G2N A;  3PHX B;  1WFY A;  2DHZ A;  3ONS A;  1C1Y B;  2LJ5 A;  2FAZ A;  4K1R B;  3L08 A;  2ZZP B;  3M3J A;  3CF6 E;  4G0N B;  4MH0 E;  2G3Q B;  2Z0E B;  4W9I A;  3TCA A;  2BWE S;  3EFU A;  2KFJ A;  4G3X B;  4PS8 A;  3A9K B;  2NCN A;  2IYD B;  3PVL A;  3DBL I;  1KOT A;  2C60 A;  4MJS A;  2MBQ A;  1EO6 A;  2GBK A;  4DXA B;  4ZYN A;  1TTN A;  3RUL A;  1OTR B;  3EC8 A;  4XC2 A;  3VUW A;  2MBH A;  5E6N A;  1UBQ A;  3VH4 B;  4MSM B;  5KHQ A;  2BWF A;  3QAR A;  4NQK E;  3VFK A;  4KIK A;  1HE8 A;  3QCA A;  4EFO A;  4W9L A;  4EUT A;  5C1Z A;  4MGI E;  1A5R A;  2L0F A;  4MJS B;  2CKH B;  3VUX A;  3N32 A;  4BBN F;  3H9D A;  4F7Z A;  4DK5 A;  2K8B A;  3NZU A;  4GU2 A;  4GOC A;  1WJ6 A;  3UQA A;  2FCS A;  4KIK B;  2C7M B;  2LUE A;  5G55 A;  3CMM B;  5L83 A;  3RUI B;  3HM3 A;  3DBR I;  4GDL B;  3VDZ A;  1QZE A;  3LJ3 A;  4WQO B;  2KWU B;  2AL6 A;  1MG8 A;  2V4L A;  2PE6 B;  1WMH A;  3ZLZ A;  2ZPN A;  3MHS D;  1Q1O A;  1LFD A;  4WJN A;  3ZUN A;  3ML8 A;  2AEH A;  3L10 B;  3APC A;  4NJ7 A;  2C7N B;  4M0W B;  2HJ8 A;  4BKS A;  2LGY A;  4IWQ A;  4MEM A;  2ZCB A;  4ANX A;  4FA6 A;  3NOB A;  2ZEQ A;  3ZW3 A;  4HXD A;  3KH0 A;  3M63 B;  1WMH B;  3L16 A;  2KKC A;  1XQQ A;  2IY0 B;  4NNJ B;  3PZD A;  4KSK C;  1WGD A;  4W9H A;  2BYV E;  2LGX A;  2LI5 A;  2EMS A;  3HM6 X;  5D94 A;  2FUH B;  5BO4 B;  1L7Y A;  2IO1 B;  3VVW B;  2V3S A;  4NY0 A;  1YX5 B;  2K6Q A;  2LRU A;  2ZNV B;  3AU4 A;  2KJH B;  3KW5 B;  4I6L B;  3ML9 A;  5J18 A;  4HK2 A;  2IY1 B;  2ZVN A;  4JGH B;  1OEY A;  2L3Z A;  4HDQ A;  3V6E B;  2XEW A;  2N1V A;  1S3S G;  2DZK A;  4JL9 A;  3UGB B;  2LVO A;  3A9J A;  2HD5 B;  2KDF B;  4LJP B;  4FLH A;  3R66 C;  4KV2 A;  2KC1 A;  3B0A A;  4ZRI A;  2MCN B;  3KUD B;  2LRW A;  2PEA A;  1ZKH A;  1WI0 A;  2RSU A;  3JW0 X;  3DOW A;  1P98 A;  3N30 A;  3ZVV A;  5DPS A;  2M8S A;  3A9J B;  2RR9 A;  4JQW C;  2G4D B;  4YL8 A;  2C9W B;  1GC7 A;  5E6O A;  1WX7 A;  1WZ3 A;  3R3M A;  3DVG X;  4KZ0 A;  3AXC A;  2KC2 A;  4N9F 4;  1RAX A;  3VQI A;  4NQL B;  1E8Z A;  2C7H A;  2KLC A;  2J0J A;  2A5U A;  2J7Q B;  5CHF A;  5JHA A;  1UGM A;  1YIW A;  1EF1 A;  1VD2 A;  2LVP A;  4FN2 A;  4DHJ D;  2KWC A;  3PPA A;  3AU5 A;  4OVU A;  4GXB A;  3V60 A;  4W9F A;  1IPG A;  2XK5 A;  2KAN A;  2LWP A;  4NJ6 A;  5FR6 A;  4EZJ A;  2FID A;  2BYE A;  3RCZ A;  4J6I A;  5J17 A;  2YVC A;  3VUY A;  2REX A;  3W1S A;  3TMP B;  1TZ1 A;  4WWP A;  3KYC D;  3H6N A;  2MBO A;  3PV1 A;  4FBJ B;  4HCP B;  3WAO A;  4BVU C;  2G45 B;  4MM3 A;  5KHO A;  3PT2 B;  2XK5 B;  2DX5 B;  2IO0 B;  2KO3 A;  3HIZ A;  1E8Y A;  4TQ0 A;  2J0K A;  1F9J A;  3ZNH B;  4CO7 A;  1C3T A;  2NR2 A;  1Q5W B;  2JF5 A;  4ICU A;  3ZNZ B;  2NPT A;  1J8C A;  5DPW A;  3L54 A;  1WJU A;  3RYT A; 
#chains in the Genus database with same CATH topology
 1QT9 A;  4NAW A;  4BFR A;  2WXL A;  3J9C A;  2N7J A;  2JWZ A;  2KVZ A;  4E71 A;  4MM3 B;  3Q3J A;  2NTS A;  2RPQ A;  3HVD A;  1T0R C;  2I1J A;  4WH4 A;  3KVF B;  3PZ8 A;  3ZYY X;  1T5X D;  1JAL A;  1J0G A;  3R7R A;  2DEN B;  2FCM A;  2WXF A;  4HWI B;  2VH1 A;  2AQ2 B;  4HJG E;  2LXA A;  1JWA D;  1SEB D;  4DHZ E;  5H92 C;  3M62 B;  1FCL A;  5JZE B;  2KTF A;  4MEL A;  3TSS A;  1SSN A;  2ZW1 A;  4KGR A;  2BS2 B;  1P1A A;  1QF6 A;  5IP4 D;  1CJE A;  2QMT A;  3V6C B;  2BT6 A;  3RZF A;  2GB1 A;  2GBJ A;  3BIN A;  3ZKJ C;  1WM3 A;  3Q8B A;  3H7P A;  1KLG D;  3DCG A;  1C79 A;  1F2R I;  4DHZ B;  4GSW A;  2KDI A;  3TEY A;  2KWV B;  1NYQ A;  4A3P A;  4M00 A;  1L6V A;  3I3T B;  5LLI A;  4PS7 A;  1EWC A;  3TBL D;  3T9L A;  3ZJT A;  4MGZ E;  3HHM A;  3H8H A;  5DPT A;  3PHW B;  4C4V B;  4RM9 A;  1AAR A;  4Q2J A;  3MHZ A;  3URY A;  5J2R A;  4WWM A;  1P3Q U;  2NBW B;  3AM9 A;  4TMA B;  5DCN A;  5H8Y E;  1V81 A;  2PJH A;  3GZN I;  3BVM A;  4ICV A;  2G4S A;  3PZ7 A;  3K9O B;  5CX3 A;  2DAJ A;  2PKO A;  4ZDV A;  1NEN B;  2BBC A;  2MSE D;  2E3T A;  4XGA B;  2HJ1 A;  3IFW B;  4W9C A;  4MGK E;  4YWG G;  3W1Y A;  2BF8 B;  2IGD A;  4G50 A;  2D5G A;  3MP9 A;  2JVC A;  2Z0D B;  5E6J A;  1X1M A;  2ASQ A;  3SHQ A;  3L13 A;  1B1Z A;  1GJZ A;  1JRO A;  1JCK B;  1TY2 A;  2L83 A;  3P1M A;  3WAL A;  2WXO A;  3B2F A;  3APD A;  1VZ8 A;  2KQ4 X;  4FJY A;  5CHW A;  2DYO A;  2QHO A;  2CU1 A;  2EKE C;  2KMA A;  3WAM A;  3ABV B;  5C23 A;  2JZP A;  2JYE A;  3S2A A;  2LGD A;  3DHG C;  4LNF A;  2N9X A;  2M0A A;  2JSV X;  2LGS A;  4YT0 B;  3DBL B;  1MPE A;  1M4V A;  3I5J C;  1WXM A;  2CR5 A;  2N0S B;  2YEP F;  2WXN A;  4ARI A;  1SE3 A;  2ZPY A;  1SJE D;  1YJI A;  3VTW A;  3ENE A;  2DZJ A;  3Q8A A;  3KUZ A;  1TBE A;  3QAQ A;  1PGX A;  3W1S C;  3NS8 A;  4WAA A;  3FIL B;  3GOE A;  4IOI E;  4YTM B;  5LXH A;  2PW9 A;  2K8H A;  4KSL C;  2J0M A;  1YQ3 B;  1MG4 A;  2O6V D;  2N9L A;  3MTN B;  3M95 A;  4HDO A;  4GIV A;  2WXP A;  1FFU A;  2UYZ B;  2GRI A;  2D3C A;  1P0R A;  1F0Z A;  1ZGU B;  1PQS A;  2KDM A;  5AEK B;  1E7U A;  3W9C B;  1TKG A;  1H4R A;  3VH3 B;  4IUM B;  3OJ3 A;  3PS6 A;  3ZO5 B;  3ZTC A;  2JT4 B;  4EE2 A;  1F2R C;  1ROE A;  2CU3 A;  3SD5 A;  1L4D B;  2N7E A;  4MGY E;  4N59 A;  4K7S A;  3N20 C;  4KZC A;  3KYD D;  2B76 B;  4C7Z A;  2KOX A;  4LNK A;  2IBI B;  2IDY A;  1AYF A;  2NBU A;  4II3 B;  2BGF A;  4RGM A;  3OLM D;  3NVZ A;  2J42 A;  3NZS A;  5TR5 A;  1U4A A;  3CSF A;  1TS4 A;  4ZRJ A;  4WUR A;  2FCQ A;  5EE0 A;  3ZXV A;  4I6P A;  2FNJ B;  2VRR B;  2EMT A;  4A55 A;  2AX5 A;  3AI5 A;  4BKG A;  2W54 A;  4JX1 C;  1EF5 A;  1LGR A;  1PYW D;  1PFD A;  2WXJ A;  1I4Q A;  1TS3 A;  3B2G A;  4CHK A;  2AL3 A;  1KM7 A;  2MEK A;  1IBX B;  3AE6 B;  4XX5 A;  4MT5 A;  4BZA A;  3AN1 A;  1YD8 U;  1Q10 A;  1IYF A;  4TV3 A;  2MQJ A;  3RT3 B;  3TIX A;  2WLB A;  4GGQ A;  3TJP A;  3VAW A;  4DXF A;  1MHH E;  1NBF C;  2N1W A;  3ZJU A;  4HKQ A;  5G2N A;  5D3I B;  3NZ3 A;  1C1Y B;  2WXG A;  2ZZP B;  3M3J A;  3P4Q B;  1FXA A;  2Z0E B;  4W9I A;  2BS3 B;  4G3X B;  3A9K B;  1KOT A;  3VH4 B;  4MSM B;  3VFK A;  4M02 A;  4KIK A;  3E9S A;  3QCA A;  1BML C;  1GB4 A;  4EFO A;  4W9L A;  2L0F A;  3BVZ A;  2H88 B;  2E6X A;  2SEB D;  2IGH A;  2FUG 1;  4DK5 A;  4GU2 A;  2WXR A;  4GOC A;  2LHE A;  4M0W A;  2KWU B;  2ZPN A;  1Q1O A;  1LFD A;  1UNS A;  1D5X C;  4IWQ A;  1T0S C;  3NOB A;  3KH0 A;  2CJN A;  3L16 A;  1XQQ A;  1UWM A;  4LNN A;  1WGD A;  2LGX A;  1QOB A;  2FUH B;  2I2Y A;  1L7Y A;  2IO1 B;  1ENF A;  1QKZ A;  1SE2 A;  2WXK A;  4YTN B;  1YX5 B;  2ZNV B;  3TEW A;  1NYR A;  2QEJ C;  2ZVN A;  1OEY A;  5BYR A;  3U4E G;  2XEW A;  2HD5 B;  4FLH A;  4LTU A;  4ZRP A;  1A70 A;  1VRA B;  3C19 A;  3B0A A;  1XCT L;  3B9J A;  2QCZ A;  1YMH E;  3A9J B;  3IAM 1;  1HQR D;  2C9W B;  3RNE C;  2PIA A;  3AE9 B;  2XNA C;  1E8Z A;  2KLC A;  2WS3 B;  5IN7 A;  2A5U A;  5IKC M;  5CHF A;  5JHA A;  1VD2 A;  1VLB A;  4OVU A;  3GP7 A;  4HRS A;  2KAN A;  4NJ6 A;  3N1Y C;  2BYE A;  4US8 A;  2OED A;  3RI7 C;  1D5Z C;  2MBO A;  3AB5 A;  4HCP B;  3WAO A;  4MM3 A;  5KHO A;  2J0K A;  3ZNH B;  4CO7 A;  4ICU A;  2NR2 A;  3ZNZ B;  1J8C A;  3L54 A;  1G6J A;  1ZXI A;  4JWU C;  4RCO A;  4WWN A;  4XDD A;  1GB1 A;  5IO9 A;  4ZYS A;  2I1K A;  2JUO A;  1F77 A;  3AE3 B;  4OVV A;  2L1A A;  1RM6 C;  1J7A A;  1FXT B;  2QSD A;  2W9N A;  2D2Q A;  3PLU A;  3WAP A;  4CYE A;  4I6N B;  2NPT B;  2DBY A;  4AOF A;  1MVK A;  3DBH I;  3WCQ A;  1QOF A;  2V0G A;  2INP E;  1FM0 D;  2OOB B;  1GAQ B;  4WQM A;  1V80 A;  2MBE A;  3IBE A;  4AWJ A;  4ANW A;  1Y56 A;  1OEY J;  1I4R A;  4FHK A;  3RNG C;  1E8X A;  5D3D A;  2ONQ A;  4BAX A;  1SJH D;  2MHJ A;  3Q8F A;  3VXW A;  1TYG B;  5HFY A;  2CJO A;  3FAH A;  2JXX A;  2V3P A;  3QQ8 B;  3U52 E;  4JLC A;  4C4V A;  2CHZ A;  4EEW A;  2M19 A;  1E6E B;  1RFK A;  3O65 B;  2L7R A;  1K52 A;  4LDT D;  3UIP B;  4JIO U;  3V61 A;  1I4H A;  4L23 A;  2AYO B;  2WGS A;  2QIE B;  4HEA 1;  1YJ1 A;  2W55 A;  2CHX A;  2DZI A;  4HJK A;  2BKF A;  1ISN A;  1V86 A;  3WIM A;  4M8M A;  2ICI A;  1WGK A;  2GOW A;  2Y5P A;  1KH0 A;  2KXJ A;  2MLB A;  3HRD D;  3VDZ A;  4XWT A;  3VRB B;  1J7B A;  3LDZ E;  4WWO A;  1E7V A;  5CHV C;  3I57 A;  2DAF A;  2KLG A;  1TGZ B;  2M17 A;  2LMC A;  4TKN A;  2D3G A;  3CWI A;  4WJO A;  1T6B X;  2LFI A;  3PRM B;  1WE7 A;  2O2V B;  4URK A;  3PLV A;  1WXA A;  2KTR B;  4N58 A;  3A4R A;  2ZVO A;  2NBV B;  1WRI A;  4HPL B;  4EZL A;  1RYJ A;  1STE A;  2CHW A;  3RZW C;  2MRP A;  2RDB C;  3DHI C;  4KVG B;  3H1U A;  4OZB A;  1JML A;  4N6E B;  1FCC C;  2DLB A;  3IG3 A;  2WDT B;  2K1F A;  1DOI A;  1WSP A;  5AUK A;  4NPN A;  1YX6 B;  1VCB A;  4AQ7 A;  2V1Y A;  1SXT A;  1K51 A;  3Q69 A;  1E8W A;  1KF6 B;  2WXQ A;  1RFA A;  1LO5 D;  1OQY A;  3Q3F A;  3FIL A;  4NAM A;  1SGH A;  4AJW A;  3P4S B;  1FXI A;  2KDE B;  3AEE B;  1NI2 A;  4XZ4 A;  3ALB A;  4FAD A;  3MFG A;  2GBN A;  2WP9 B;  2AQ3 B;  1Q0W B;  1WJ4 A;  4GDL A;  3CIR B;  4F8C B;  1LQB A;  4GB9 A;  3HUI A;  3T8M A;  3A4S C;  3R7Q A;  1IGC A;  3PO0 A;  4II2 B;  3TEZ A;  2L8J A;  2V3N A;  1L4Z B;  2R2O A;  3PSE B;  3DHH C;  1M94 A;  2BPS A;  1CQV A;  2WU5 B;  3RNA C;  2IND C;  4B0M A;  2D10 A;  2EKI A;  4A8X C;  5C2T B;  4OW0 A;  3SU8 X;  3X23 A;  2GMI C;  1V5O A;  1HTO A;  4A90 A;  2KDB A;  2D07 B;  1Y8R C;  1SF0 A;  4RGO S;  3A1Q B;  2LAS A;  4PYU A;  3VTU A;  3UQB A;  3BWU D;  4BOZ B;  1L5P A;  3O13 A;  3GB1 A;  3DDC B;  2D3B A;  3HK0 A;  1V5T A;  3BYT B;  5AZG A;  1D3Z A;  2LJI A;  3AEG B;  3X0W A;  2HDE A;  2N9P C;  1WZ0 A;  3V3X A;  2IO2 B;  1D6E C;  3LXF A;  3AMZ A;  1IBX A;  1EWY C;  2LEK A;  2QIL A;  2OJR A;  1FD6 A;  1EM7 A;  4RFB A;  1MFW A;  5AZH A;  4A20 A;  4E74 A;  4P6V F;  1SIF A;  2KJR A;  2L32 A;  3RPF C;  1T0Y A;  2BTE A;  1WGH A;  1WXV A;  2BW2 A;  2OHF A;  3MJW A;  5FKA C;  2KZR A;  2JZZ A;  2CS4 A;  2JQR B;  1N61 A;  4IM2 A;  3ZDM C;  4LK0 M;  3GS2 A;  1XXG A;  2N4F A;  2J4X A;  2JWU A;  2FCN A;  2JRI B;  3A9K A;  3AE5 B;  3ZJV A;  1NEK B;  2DHZ A;  3ONS A;  1JQ4 A;  2FAZ A;  2PTL A;  3NVV A;  5BYS A;  4G0N B;  2KN4 A;  2J53 A;  1XCQ L;  2BWE S;  5TSS A;  2C60 A;  1HZ6 A;  3SFE B;  3EC8 A;  5E6N A;  1UBQ A;  2BS4 B;  2BWF A;  3QAR A;  4NQK E;  1HE8 A;  3T3N A;  2VZK D;  4MGI E;  1A5R A;  4MJS B;  3VUX A;  4BBN F;  4YTP B;  1WJ6 A;  1ZOY B;  2C7M B;  2LUE A;  5L83 A;  3RUI B;  3DBR I;  4GDL B;  3AH7 A;  1GOZ A;  1ZXH A;  1MG8 A;  2V4L A;  3ZLZ A;  3MHS D;  3EGR A;  1WXQ A;  4WJN A;  3ZUN A;  2VH2 A;  3L10 B;  5C3J B;  2C7N B;  4MEM A;  2WHI A;  2L52 A;  4IKG A;  1E10 A;  1WMH B;  4NNJ B;  1XF5 L;  3PZD A;  2PVO D;  4W9H A;  2LI5 A;  2V3S A;  4NY0 A;  1SE4 A;  3KW5 B;  3MC0 B;  2KJH B;  5J18 A;  4HK2 A;  2L3Z A;  3V6E B;  4JL9 A;  3A9J A;  2KDF B;  2KC1 A;  1C9F A;  1UWX A;  4P1B C;  4R3D A;  2Q5W D;  3Q2A C;  2PEA A;  1ZKH A;  1TKE A;  3ZVV A;  2M8S A;  2G4D B;  2ON8 A;  2GLS A;  5E6O A;  2W82 A;  1C4P A;  3DVG X;  2KC2 A;  1RAX A;  3VQI A;  2J0J A;  2J7Q B;  1UGM A;  2LVP A;  4GXB A;  3V60 A;  5BMG A;  4DXG A;  1TS5 A;  2BB6 A;  2LHD A;  1PDX A;  3RCZ A;  4J6I A;  5J17 A;  3H6N A;  4ITK A;  2QJL A;  3C8Y A;  3PT2 B;  2XK5 B;  2DX5 B;  2G1E A;  3HIZ A;  4TQ0 A;  4C80 A;  1F9J A;  1N62 A;  1TJE A;  1CK1 A;  2NPT A;  4HKZ E;  3RYT A;  3KUC B;  1WH3 A;  1GUA B;  3TEX A;  1WRD B;  2NS5 A;  4XYC A;  2RPV A;  4L1B A;  4DWF A;  2WWZ A;  4PK1 A;  2A4Z A;  3AE1 B;  1YQB A;  3NS1 A;  3LYY A;  2KFK B;  1R4N I;  3EFC A;  2L76 A;  1XLQ A;  3UIN B;  4FUL A;  4JE3 B;  1YN5 A;  3ZXR A;  2KVR A;  4W9E A;  1ZP0 B;  4D2K A;  3QA8 A;  3DBS A;  5EDS A;  2K0P A;  1UBI A;  1UEL A;  3Q3M C;  2QDF A;  2KX3 A;  5IA7 A;  4DDG D;  3AEB B;  5IOI A;  2JXT A;  3IVF A;  4IWO A;  1E9M A;  1UF0 A;  3EUB 2;  3QC8 B;  3B1L X;  4BOS C;  4ANV A;  2DZM A;  2R61 A;  4IG7 B;  1EUV B;  2L00 B;  2IO3 B;  3AE8 B;  4PS3 A;  3BK1 A;  1I42 A;  3LB8 C;  1SE9 A;  4TSS A;  3U7Z A;  4ARC A;  1QOA A;  3GE3 C;  2MBB B;  1TZO A;  1ET9 A;  2FIF A;  1MHX A;  3N3K B;  1AN8 A;  2B3A A;  3GZN B;  3UIO B;  1FNU A;  1PGA A;  2K6D B;  1YN4 A;  3P2B A;  3P4R B;  1Z5S B;  3QJZ A;  1F52 A;  2IJ0 A;  3TL5 A;  2H89 B;  4ZRQ A;  3QHT A;  3NVW A;  3C0R B;  3U30 A;  2PVG C;  1KJT A;  4RMA A;  2LXC A;  4B0E A;  4RM8 A;  3VRA B;  3PRP B;  4RH6 A;  4LLG M;  1WGR A;  2O2V A;  1DGJ A;  1BT0 A;  4IWP A;  2LUM A;  4HRO A;  2KTR A;  4P7I A;  1C76 A;  2MJ3 A;  2V9H A;  1QQR A;  4A3O A;  3ZIM A;  1DOY A;  2O6V B;  4XDC A;  2VZK B;  3AE2 B;  4LCD E;  2J52 A;  1IGD A;  3KWL A;  1XLO A;  1BUI C;  2MH7 A;  1C77 A;  1I4X A;  4L2Y A;  4F1S A;  1WR1 A;  2I38 A;  4ZOH C;  1K8R B;  1I35 A;  1KRH A;  4FJZ A;  1FFV A;  5DPR A;  3BYY B;  1ZE3 D;  3T3O A;  3KQ4 A;  3H7S A;  4BKS D;  4GMV A;  5EE3 A;  2IPK D;  2KNB A;  4YXD B;  4ANU A;  1V49 A;  2C5L C;  4OHJ A;  1UZX B;  2RD0 A;  2MP2 B;  3EHV A;  5L95 C;  1P9D U;  4BBN C;  4GDK B;  3HVZ A;  1WXS A;  1N6Z A;  2MA9 B;  2BYF A;  4HPP A;  1OGW A;  2WU2 B;  1S1Q B;  2PE9 A;  2LD9 A;  3WA0 A;  1ACC A;  4B95 A;  1FNV A;  3AE7 B;  3L17 A;  3RMK C;  2HTM E;  4C7Y A;  3A33 B;  1V6E A;  3BII D;  3IHP C;  2W3R A;  3AEA B;  3RN9 C;  1ZDV A;  4W9D A;  2KYW A;  3AEC B;  1CMX B;  5BMI A;  1DOX A;  4TQ1 A;  3SR6 A;  2KAJ A;  5AZF A;  3BY4 B;  4X57 B;  3QIJ A;  4MSQ B;  5D2M B;  1AWD A;  3NY5 A;  1WGG A;  1XLN A;  4FXC A;  3U8Z A;  4AS1 A;  3MJ5 A;  5BMH A;  4PT5 A;  3A1Q A;  3MC9 A;  4WJP A;  4K7U A;  4W9G A;  5EE1 A;  3ZRC A;  3NRZ A;  2MWS B;  1V1P B;  4LJO B;  3W2D A;  3GE8 C;  1UD7 A;  1FIQ A;  3SDL C;  1BXT A;  2MX2 A;  3CST A;  2XBB C;  2W3S A;  4QAY A;  2EEL A;  4PYZ A;  5HI1 A;  5E6P A;  2M4N A;  2WDV B;  3L0W B;  1WJN A;  1MI0 A;  2KN5 A;  5JHB A;  4LNO A;  2K8C A;  2WYQ A;  2WQY B;  4G11 A;  3DQV A;  4ACF A;  1XT9 B;  3ZDT A;  4XE0 A;  3RFZ B;  4BKT A;  1Z2M A;  1E90 A;  3DVN U;  1V97 A;  4W9J A;  3FC4 A;  3IAS 1;  4B6W A;  1GG3 A;  2NVU I;  5IAA C;  1VJK A;  2NTT A;  4K7W A;  3OG5 A;  1PUT A;  1EU3 A;  1C4A A;  2MJD A;  3MC8 A;  1KLU D;  2BKR B;  2WDR B;  3VTV A;  3ZNG C;  2MW5 A;  5JXV A;  4HCN B;  1WE6 A;  2PMV A;  4K81 A;  2ZCC A;  4DBG A;  3TUO A;  1P7F A;  4NJC A;  2N9K A;  1WFY A;  2LJ5 A;  5GXG B;  4K1R B;  4USA A;  2D3A A;  3KLS X;  3CF6 E;  4MH0 E;  2G3Q B;  3W5V B;  1R4N B;  3P42 A;  4PS8 A;  2KFJ A;  3VR8 B;  2NCN A;  2QC8 A;  4MJS A;  2UU7 A;  1EO6 A;  2GBK A;  1TTN A;  4IDI A;  4XC2 A;  2MBH A;  5KHQ A;  1K50 A;  4EUT A;  5BYQ A;  2CKH B;  1ZUD 2;  4JWS C;  3N32 A;  4GLS C;  3H9D A;  4C00 A;  4F7Z A;  3NZU A;  1YJJ A;  2DNF A;  3UQA A;  2FCS A;  4RF1 A;  1JWS D;  5G55 A;  3CMM B;  3HM3 A;  1QZE A;  2KMM A;  3LJ3 A;  4WQO B;  5G5H A;  1WMH A;  4P1C C;  2IGG A;  4LNI A;  2WNM A;  1L0V B;  3APC A;  4A9A A;  3E56 A;  4NJ7 A;  4ANX A;  5T8I A;  3ZW3 A;  1SIJ A;  3M63 B;  2LGI A;  4KSK C;  3HM6 X;  2WXH A;  5BO4 B;  3VVW B;  2K6Q A;  2LRU A;  4I6L B;  4YSZ B;  4JGH B;  1S3S G;  4NZL B;  3VR9 B;  2WXI A;  4O1N A;  2LVO A;  4KV2 A;  2K3U A;  2MCN B;  2PLP A;  3KUD B;  2LRW A;  1QOG A;  1WI0 A;  2RSU A;  3JW0 X;  2KWD A;  1AW7 A;  1RWS A;  4JQW C;  2JU6 X;  3R3M A;  4KZ0 A;  4N9F 4;  1GPX A;  3SFD B;  2Y5C A;  1YIW A;  4FN2 A;  4DHJ D;  3PPA A;  4ZHO A;  1IPG A;  2XK5 A;  2YVC A;  3VUY A;  3W1S A;  3TMP B;  1TZ1 A;  3KYC D;  3PV1 A;  4FBJ B;  4BVU C;  2G45 B;  2RDG A;  3I9V 1;  4KKI A;  1WWT A;  4P16 A;  1E8Y A;  2V4I B;  1C3T A;  1QIL A;  1Q5W B;  2JF5 A;  3OWE B;  1XEE A;  4JPS A;  1XO3 A;  4LDT B;  1VDV A;  3DBH B;  5I4D A;  4FJV B;  2KFK A;  4FHJ A;  3ZRF A;  5EE9 A;  4NAW B;  4MAC A;  1IP9 A;  3N1Z C;  5G5G A;  1RLF A;  2JYT A;  1N60 A;  1NI3 A;  3B08 A;  2DYB A;  1RRB A;  1OQR A;  4XWW A;  1TY0 A;  1WGY A;  4REZ A;  1J19 A;  4ZHP A;  4IW0 A;  2JPH A;  4MH8 A;  2FBW B;  2R2Q A;  1WY8 A;  2X38 A;  3FKY A;  1UGJ A;  1H8C A;  3KWV A;  1SBB B;  3JSV A;  1F1H A;  3L4P A;  1R4M I;  1JW9 D;  1C4C A;  4RGN A;  2D11 A;  3PRZ A;  2MJE A;  2K25 A;  3QX1 A;  3ZNI D;  3H7P B;  2ZJD A;  4RNA A;  1CZP A;  1D4B A;  1YN3 A;  4EZK A;  3D32 A;  1HXY D;  4ASW C;  2BYT A;  4M01 A;  1PGB A;  4IM3 A;  3Q6B A;  1OQQ A;  1TKY A;  3WAN A;  3IT6 B;  3Q14 C;  2KT7 A;  2M0X A;  1I4G A;  3PTF C;  4AUQ C;  1N5X A;  3BZD B;  1VZ6 A;  5JH5 C;  4KX6 B;  1C78 A;  2KMC A;  4IM0 A;  4TUU A;  2KHW B;  4KGS A;  1XD3 B;  2O6V A;  2HE7 A;  1V1O A;  1YNT E;  1K53 A;  4IC7 B;  4DDI D;  1P7E A;  2IZV B;  4WAF A;  2G9H D;  1JRU A;  2ZNV C;  2K39 A;  3RNB C;  2WX1 A;  3RNC C;  2KK8 A;  4EOY A;  5AUI A;  3Q8C A;  2BVC A;  1FMA D;  1GNU A;  1FO4 A;  3JVZ X;  3AUL A;  4DQO C;  1KFY B;  3APF A;  4K3C A;  5D6J B;  3DWM A;  2MP2 A;  4M8N A;  1L2N A;  2FE8 A;  1E5W A;  3PGE A;  1SB3 C;  2KD0 A;  2Y5B B;  4GDK A;  4AJY B;  3P63 A;  1LXD A;  1V9J A;  3DPD A;  2RMM A;  1TIF A;  3BVG A;  2N7D A;  3R8B A;  3JYU A;  1GC6 A;  4WJQ A;  4AP4 C;  5HHD G;  4A6Q A;  4RGT A;  2KJ6 A;  1D5M C;  1LM8 B;  1V2Y A;  2SAK A;  3Q8E A;  1E7P B;  3U2S C;  2KQ7 A;  4YSY B;  2INC C;  3OAW A;  4S17 A;  1ZDX A;  2TSS A;  3AE4 B;  2GI9 A;  3IT4 B;  5CTR C;  1WX8 A;  1UH6 A;  2RGF A;  4C56 C;  1VR9 A;  2DWQ A;  2JRH A;  5LXI B;  2GBR A;  1QLB B;  1WX9 A;  1FEH A;  2JY6 A;  2KAC A;  4KDI C;  1R7S A;  3DVG Y;  1ZW7 A;  1HZ5 A;  4DHJ B;  5HKH A;  3NHE B;  1WM2 A;  2L05 A;  3JSV B;  1V1P A;  2LZ6 A;  3U7D A;  3R2I A;  5HG2 A;  2AWT A;  3P4P B;  5FK9 C;  1NDD A;  4MDK E;  2LVQ A;  3VHT C;  2KQS A;  3RNF C;  2L0T A;  3ECI A;  5D7G A;  4RF0 A;  4KDL B;  1WIA A;  2K5P A;  1KLV A;  2Y3A A;  3QK0 A;  3PRE A;  1N5W A;  2YLM A;  2GBM A;  3SEB A;  1XLP A;  3RD2 A;  2JX5 A;  4HLE A;  4EKU A;  1EU4 A;  2INN E;  3ZTD A;  1OFF A;  3EEC A;  1WYW B;  3K9P B;  4WIP A;  3OJ4 B;  3UF8 A;  4B9K A;  2DYM A;  2Z59 B;  2UWQ A;  5GMV A;  3UI3 A;  3V05 A;  4ZRK A;  4HPM B;  4K3B A;  4E3C A;  4HVB A;  1JWB D;  3AEF B;  4J3O D;  2HTH A;  3NVY A;  1ZPS A;  4W9K A;  3QWZ B;  2BB5 A;  3NJT A;  1WR6 E;  3DVN V;  1NVI D;  3DWG C;  1HEZ E;  2OJW A;  2PPH A;  3AV8 A;  1WF9 A;  2WX0 A;  4OVZ A;  2K22 A;  3V62 A;  3N9Y C;  3ZGZ A;  2JZ3 B;  4GN1 A;  2N9E B;  1ET6 A;  2M1M A;  2KX0 A;  4OZA A;  3PHX B;  2AQ1 B;  3L08 A;  2ACZ B;  1JRP A;  1UUP A;  3TCA A;  3EFU A;  1KTK A;  1FRR A;  2IYD B;  3PVL A;  3DBL I;  2MBQ A;  1TS2 A;  4DXA B;  4ZYN A;  3RUL A;  5LNK 1;  1OTR B;  3VUW A;  5C1Z A;  2XN9 C;  3DBR B;  2M56 B;  4KKJ A;  1T0Q C;  2K8B A;  5MPO A;  3ETR A;  4KIK B;  2WXM A;  1R4M B;  1DYQ A;  2AL6 A;  4S0R A;  2PE6 B;  1B9R A;  3Q3N C;  2BQQ A;  3NG0 A;  3ML8 A;  2AEH A;  3W5U B;  2ZW0 A;  3ZQ4 A;  4M0W B;  4BKS A;  2HJ8 A;  2LGY A;  2ZCB A;  4FA6 A;  1HTQ A;  2Z8L A;  1J7C A;  1L6U A;  2ZEQ A;  4HXD A;  1WYG A;  1ESF A;  2KKC A;  2IY0 B;  1E0Z A;  2BYV E;  1FRD A;  1L0X B;  2EMS A;  3EA6 A;  3Q3O C;  5D94 A;  1I4P A;  1VZ7 A;  1JWU D;  3AU4 A;  1L0Y B;  3ML9 A;  2IY1 B;  4HDQ A;  2N1V A;  3BK2 A;  2DZK A;  3UGB B;  4UDU C;  4KGT A;  4LJP B;  1V8C A;  2X8X X;  3IXS A;  3R66 C;  3I63 C;  1YQ4 B;  2YEP B;  3N1X C;  4ZRI A;  1MJD A;  2K9X A;  2RDH A;  1P98 A;  2WDQ B;  3DOW A;  3N30 A;  5DPS A;  2RR9 A;  4YL8 A;  1GC7 A;  1WX7 A;  1WZ3 A;  1T3Q A;  3AED B;  3AXC A;  4OZC A;  4NQL B;  4US9 A;  2C7H A;  1IUE A;  3NUH B;  1EF1 A;  2KWC A;  3AU5 A;  4W9F A;  1N63 A;  1HA5 A;  2LWP A;  5FR6 A;  3R2T A;  1I7H A;  2FID A;  4EZJ A;  2REX A;  1TT5 B;  4WWP A;  5FR3 A;  1YOV B;  2IO0 B;  4H2A A;  2KO3 A;  1JWM D;  2NMQ A;  1FNW A;  4YSX B;  4CQN A;  5DPW A;  1WJU A;  1FPY A; 
#chains in the Genus database with same CATH homology
 3KUC B;  4LDT B;  4NAW A;  4WWN A;  4BFR A;  4FJV B;  2I1K A;  2JUO A;  1WH3 A;  1GUA B;  2JWZ A;  2KFK A;  4E71 A;  3Q3J A;  4OVV A;  1WRD B;  2RPQ A;  2NS5 A;  1FXT B;  2W9N A;  3PLU A;  2D2Q A;  2I1J A;  3WAP A;  4CYE A;  4FHJ A;  3ZRF A;  3KVF B;  4I6N B;  2NPT B;  4AOF A;  1J0G A;  3DBH I;  3R7R A;  2DEN B;  2FCM A;  4NAW B;  4DWF A;  2WWZ A;  2A4Z A;  1YQB A;  1IP9 A;  2OOB B;  4HWI B;  2KFK B;  1R4N I;  2L76 A;  2LXA A;  1RLF A;  1V80 A;  4DHZ E;  3B08 A;  2DYB A;  3UIN B;  4FUL A;  1RRB A;  2MBE A;  3IBE A;  3M62 B;  2KVR A;  4W9E A;  5JZE B;  2KTF A;  4AWJ A;  3QA8 A;  3DBS A;  4ANW A;  1WGY A;  1OEY J;  4MEL A;  1J19 A;  5EDS A;  1UBI A;  1UEL A;  4FHK A;  4IW0 A;  2JPH A;  2KX3 A;  5IA7 A;  1E8X A;  1P1A A;  4DDG D;  2R2Q A;  1WY8 A;  3IVF A;  4IWO A;  3V6C B;  3RZF A;  2GBJ A;  3QC8 B;  3B1L X;  3BIN A;  3ZKJ C;  4ANV A;  1WM3 A;  4BOS C;  2DZM A;  3H7P A;  1H8C A;  3DCG A;  3VXW A;  3JSV A;  1R4M I;  4DHZ B;  4GSW A;  2KDI A;  2KWV B;  2JXX A;  3QQ8 B;  4IG7 B;  4JLC A;  1EUV B;  2CHZ A;  4A3P A;  4EEW A;  2L00 B;  2D11 A;  2IO3 B;  3PRZ A;  3I3T B;  4PS3 A;  5LLI A;  1I42 A;  2K25 A;  3O65 B;  3QX1 A;  4PS7 A;  3H7P B;  3ZNI D;  3TBL D;  2ZJD A;  3T9L A;  2L7R A;  4LDT D;  1SE9 A;  4MGZ E;  3HHM A;  4JIO U;  3UIP B;  3V61 A;  4EZK A;  3D32 A;  5DPT A;  3PHW B;  4RM9 A;  2MBB B;  1AAR A;  2FIF A;  4ASW C;  3N3K B;  2AYO B;  2B3A A;  3UIO B;  4IM3 A;  2K6D B;  3WAN A;  1YJ1 A;  5J2R A;  3P2B A;  2M0X A;  2CHX A;  1P3Q U;  2DZI A;  1Z5S B;  2NBW B;  3PTF C;  3QJZ A;  4HJK A;  4AUQ C;  2BKF A;  5DCN A;  3TL5 A;  5JH5 C;  1ISN A;  1V86 A;  1V81 A;  4M8M A;  3WIM A;  2PJH A;  3QHT A;  3GZN I;  3C0R B;  2GOW A;  4ICV A;  3U30 A;  2KMC A;  2G4S A;  2KXJ A;  1KJT A;  2MLB A;  4IM0 A;  3K9O B;  4RMA A;  4TUU A;  2LXC A;  5CX3 A;  2KHW B;  2DAJ A;  4RM8 A;  4ZDV A;  3PRP B;  2MSE D;  1XD3 B;  2O6V A;  2HE7 A;  3IFW B;  4W9C A;  4MGK E;  3LDZ E;  4WWO A;  1WGR A;  1E7V A;  5CHV C;  2O2V A;  4IC7 B;  1BT0 A;  4IWP A;  3W1Y A;  4DDI D;  2BF8 B;  2DAF A;  2IZV B;  2KLG A;  4G50 A;  2KTR A;  1TGZ B;  2M17 A;  1JRU A;  2JVC A;  4P7I A;  2ZNV C;  4A3O A;  3ZIM A;  2Z0D B;  2O6V B;  2K39 A;  4TKN A;  1X1M A;  2ASQ A;  2D3G A;  2WX1 A;  4LCD E;  4WJO A;  2KK8 A;  4EOY A;  3PRM B;  3SHQ A;  1WE7 A;  2O2V B;  3L13 A;  1GJZ A;  4URK A;  3PLV A;  1WXA A;  1GNU A;  2KTR B;  3A4R A;  2ZVO A;  2NBV B;  4HPL B;  3JVZ X;  4F1S A;  3AUL A;  3RZW C;  3WAL A;  2CHW A;  4EZL A;  2MRP A;  3APF A;  1WR1 A;  1I35 A;  1K8R B;  4KVG B;  5D6J B;  3H1U A;  4FJZ A;  5DPR A;  2MP2 A;  4M8N A;  3APD A;  1L2N A;  1E5W A;  3IG3 A;  2WDT B;  3PGE A;  2K1F A;  4FJY A;  2KD0 A;  2Y5B B;  3H7S A;  4BKS D;  4GMV A;  4NPN A;  4GDK A;  5CHW A;  1YX6 B;  1VCB A;  2DYO A;  4AJY B;  2QHO A;  2CU1 A;  2KNB A;  2V1Y A;  1V49 A;  1LXD A;  1V9J A;  2EKE C;  3DPD A;  4ANU A;  2KMA A;  2C5L C;  3WAM A;  1E8W A;  1UZX B;  2RD0 A;  2N7D A;  5C23 A;  2MP2 B;  3EHV A;  3JYU A;  5L95 C;  1RFA A;  3S2A A;  1GC6 A;  1P9D U;  2LGD A;  4WJQ A;  4AP4 C;  2N9X A;  4BBN C;  4GDK B;  2KJ6 A;  1OQY A;  1WXS A;  2MA9 B;  2BYF A;  3Q3F A;  1OGW A;  1LM8 B;  1S1Q B;  1SGH A;  1WXM A;  2CR5 A;  4AJW A;  2PE9 A;  2LD9 A;  3WA0 A;  2ZPY A;  4B95 A;  3L17 A;  1V2Y A;  3VTW A;  3ENE A;  2DZJ A;  2KQ7 A;  3KUZ A;  1TBE A;  3OAW A;  2KDE B;  3QAQ A;  3W1S C;  3NS8 A;  4XZ4 A;  1NI2 A;  3A33 B;  1V6E A;  4WAA A;  5LXH A;  3GOE A;  3ALB A;  4FAD A;  2GBN A;  2K8H A;  2J0M A;  4KSL C;  3IHP C;  5CTR C;  1WX8 A;  1UH6 A;  2O6V D;  1Q0W B;  2RGF A;  4W9D A;  1WJ4 A;  4GDL A;  1CMX B;  2JRH A;  3MTN B;  5LXI B;  3M95 A;  4F8C B;  4HDO A;  2GBR A;  4GIV A;  1LQB A;  4GB9 A;  3T8M A;  1WX9 A;  3A4S C;  3R7Q A;  4TQ1 A;  2UYZ B;  2JY6 A;  5AZF A;  1P0R A;  4II2 B;  4KDI C;  2L8J A;  3BY4 B;  3DVG Y;  1ZW7 A;  4X57 B;  2R2O A;  3QIJ A;  4DHJ B;  1ZGU B;  1PQS A;  3PSE B;  5HKH A;  4MSQ B;  5AEK B;  3NHE B;  5D2M B;  1E7U A;  1WM2 A;  1WGG A;  2L05 A;  1M94 A;  2BPS A;  2LZ6 A;  3JSV B;  3NY5 A;  3U7D A;  1H4R A;  2AWT A;  3U8Z A;  3VH3 B;  4IUM B;  2D10 A;  3A1Q A;  4WJP A;  3OJ3 A;  1NDD A;  4K7U A;  4W9G A;  3PS6 A;  4MDK E;  2LVQ A;  3SU8 X;  3X23 A;  3VHT C;  2KQS A;  3ZTC A;  2L0T A;  3ZO5 B;  2JT4 B;  3ECI A;  5D7G A;  2GMI C;  1V5O A;  3ZRC A;  4KDL B;  1WIA A;  2MWS B;  1KLV A;  4LJO B;  1G6J A;  3QK0 A;  2KDB A;  3PRE A;  2D07 B;  2YLM A;  1Y8R C;  2GBM A;  1UD7 A;  3SD5 A;  3RD2 A;  3SDL C;  3A1Q B;  2MX2 A;  3CST A;  2N7E A;  4HLE A;  4MGY E;  4EKU A;  2XBB C;  4K7S A;  2LAS A;  4KZC A;  3ZTD A;  4PYU A;  3EEC A;  3VTU A;  4PYZ A;  3UQB A;  3KYD D;  4BOZ B;  1WYW B;  3K9P B;  5E6P A;  2M4N A;  3L0W B;  2KOX A;  3DDC B;  3OJ4 B;  3UF8 A;  3HK0 A;  1V5T A;  1WJN A;  4B9K A;  2DYM A;  2IBI B;  2NBU A;  2Z59 B;  2UWQ A;  2KN5 A;  5GMV A;  4II3 B;  5JHB A;  2BGF A;  5AZG A;  1D3Z A;  3OLM D;  3NZS A;  5TR5 A;  3X0W A;  1U4A A;  2K8C A;  2WYQ A;  3CSF A;  4ZRK A;  2N9P C;  4ZRJ A;  4G11 A;  2FCQ A;  1WZ0 A;  3DQV A;  4HPM B;  4I6P A;  2IO2 B;  2FNJ B;  4E3C A;  4HVB A;  1XT9 B;  2VRR B;  2EMT A;  3ZDT A;  3AI5 A;  4BKT A;  4BKG A;  1Z2M A;  2OJR A;  1E90 A;  2HTH A;  3DVN U;  4W9K A;  5AZH A;  1EF5 A;  3QWZ B;  4A20 A;  4E74 A;  1SIF A;  4W9J A;  2KJR A;  4B6W A;  1WR6 E;  1GG3 A;  2NVU I;  1T0Y A;  3DVN V;  5IAA C;  4CHK A;  1WGH A;  1WXV A;  2AL3 A;  1KM7 A;  3MJW A;  4K7W A;  4XX5 A;  2KZR A;  1YD8 U;  2BKR B;  2PPH A;  3VTV A;  2JZZ A;  2CS4 A;  3ZNG C;  2MW5 A;  1IYF A;  4IM2 A;  3ZDM C;  1WF9 A;  2WX0 A;  1WE6 A;  4HCN B;  4K81 A;  4TV3 A;  2ZCC A;  2MQJ A;  3RT3 B;  3TIX A;  3V62 A;  2N4F A;  4GGQ A;  3TJP A;  3VAW A;  2JZ3 B;  1NBF C;  4GN1 A;  4DBG A;  2N9E B;  2N1W A;  2M1M A;  2FCN A;  2JRI B;  3A9K A;  2KX0 A;  5G2N A;  3PHX B;  1WFY A;  2DHZ A;  3ONS A;  1C1Y B;  2LJ5 A;  2FAZ A;  4K1R B;  3L08 A;  2ZZP B;  3M3J A;  3CF6 E;  4G0N B;  4MH0 E;  2G3Q B;  2Z0E B;  4W9I A;  3TCA A;  2BWE S;  3EFU A;  2KFJ A;  4G3X B;  4PS8 A;  3A9K B;  2NCN A;  2IYD B;  3PVL A;  3DBL I;  1KOT A;  2C60 A;  4MJS A;  2MBQ A;  1EO6 A;  2GBK A;  4DXA B;  4ZYN A;  1TTN A;  3RUL A;  1OTR B;  3EC8 A;  4XC2 A;  3VUW A;  2MBH A;  5E6N A;  1UBQ A;  3VH4 B;  4MSM B;  5KHQ A;  2BWF A;  3QAR A;  4NQK E;  3VFK A;  4KIK A;  1HE8 A;  3QCA A;  4EFO A;  4W9L A;  4EUT A;  5C1Z A;  4MGI E;  1A5R A;  2L0F A;  4MJS B;  2CKH B;  3VUX A;  3N32 A;  4BBN F;  3H9D A;  4F7Z A;  4DK5 A;  2K8B A;  3NZU A;  4GU2 A;  4GOC A;  1WJ6 A;  3UQA A;  2FCS A;  4KIK B;  2C7M B;  2LUE A;  5G55 A;  3CMM B;  5L83 A;  3RUI B;  3HM3 A;  3DBR I;  4GDL B;  3VDZ A;  1QZE A;  3LJ3 A;  4WQO B;  2KWU B;  2AL6 A;  1MG8 A;  2V4L A;  2PE6 B;  1WMH A;  3ZLZ A;  2ZPN A;  3MHS D;  1Q1O A;  1LFD A;  4WJN A;  3ZUN A;  3ML8 A;  2AEH A;  3L10 B;  3APC A;  4NJ7 A;  2C7N B;  4M0W B;  2HJ8 A;  4BKS A;  2LGY A;  4IWQ A;  4MEM A;  2ZCB A;  4ANX A;  4FA6 A;  3NOB A;  2ZEQ A;  3ZW3 A;  4HXD A;  3KH0 A;  3M63 B;  1WMH B;  3L16 A;  2KKC A;  1XQQ A;  2IY0 B;  4NNJ B;  3PZD A;  4KSK C;  1WGD A;  4W9H A;  2BYV E;  2LGX A;  2LI5 A;  2EMS A;  3HM6 X;  5D94 A;  2FUH B;  5BO4 B;  1L7Y A;  2IO1 B;  3VVW B;  2V3S A;  4NY0 A;  1YX5 B;  2K6Q A;  2LRU A;  2ZNV B;  3AU4 A;  2KJH B;  3KW5 B;  4I6L B;  3ML9 A;  5J18 A;  4HK2 A;  2IY1 B;  2ZVN A;  4JGH B;  1OEY A;  2L3Z A;  4HDQ A;  3V6E B;  2XEW A;  2N1V A;  1S3S G;  2DZK A;  4JL9 A;  3UGB B;  2LVO A;  3A9J A;  2HD5 B;  2KDF B;  4LJP B;  4FLH A;  3R66 C;  4KV2 A;  2KC1 A;  3B0A A;  4ZRI A;  2MCN B;  3KUD B;  2LRW A;  2PEA A;  1ZKH A;  1WI0 A;  2RSU A;  3JW0 X;  3DOW A;  1P98 A;  3N30 A;  3ZVV A;  5DPS A;  2M8S A;  3A9J B;  2RR9 A;  4JQW C;  2G4D B;  4YL8 A;  2C9W B;  1GC7 A;  5E6O A;  1WX7 A;  1WZ3 A;  3R3M A;  3DVG X;  4KZ0 A;  3AXC A;  2KC2 A;  4N9F 4;  1RAX A;  3VQI A;  4NQL B;  1E8Z A;  2C7H A;  2KLC A;  2J0J A;  2A5U A;  2J7Q B;  5CHF A;  5JHA A;  1UGM A;  1YIW A;  1EF1 A;  1VD2 A;  2LVP A;  4FN2 A;  4DHJ D;  2KWC A;  3PPA A;  3AU5 A;  4OVU A;  4GXB A;  3V60 A;  4W9F A;  1IPG A;  2XK5 A;  2KAN A;  2LWP A;  4NJ6 A;  5FR6 A;  4EZJ A;  2FID A;  2BYE A;  3RCZ A;  4J6I A;  5J17 A;  2YVC A;  3VUY A;  2REX A;  3W1S A;  3TMP B;  1TZ1 A;  4WWP A;  3KYC D;  3H6N A;  2MBO A;  3PV1 A;  4FBJ B;  4HCP B;  3WAO A;  4BVU C;  2G45 B;  4MM3 A;  5KHO A;  3PT2 B;  2XK5 B;  2DX5 B;  2IO0 B;  2KO3 A;  3HIZ A;  1E8Y A;  4TQ0 A;  2J0K A;  1F9J A;  3ZNH B;  4CO7 A;  1C3T A;  2NR2 A;  1Q5W B;  2JF5 A;  4ICU A;  3ZNZ B;  2NPT A;  1J8C A;  5DPW A;  3L54 A;  1WJU A;  3RYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...