4W9GA

Pvhl:elob:eloc in complex with (2s,4r)-1-(3,3-dimethylbutanoyl)-4-hydroxy-n-(3-methyl-4-(thiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 6)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
101
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Transcription elongation factor B polypeptide 2
total genus 24
structure length 101
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4w9gA00
4IW0A 2KZRA 2L76A 3HM6X 2LVQA 1WM2A 4NQLB 1PQSA 2JUOA 2LWPA 3L10B 3QHTA 4PS3A 2DZKA 1WGHA 1WR1A 2IY1B 4GSWA 1P0RA 4URKA 2RPQA 3PLVA 3PPAA 4WWPA 4GDKA 2KWUB 3RCZA 4B6WA 2DENB 1WR6E 3T9LA 2D07B 2PEAA 3QQ8B 3TJPA 4AJYB 2ZEQA 2KTRA 1WYWB 3AU4A 2BGFA 1RFAA 3WIMA 2KHWB 3A1QA 3CF6E 2LXCA 5BO4B 3DOWA 2GBMA 3A9KB 2ZPNA 4A3PA 1C3TA 1IYFA 4GB9A 3ZNHB 5JZEB 3RD2A 1Q5WB 2KDEB 2RGFA 1IP9A 3PSEB 4AP4C 3K9PB 3KVFB 2BPSA 2KO3A 5LLIA 2KLCA 4ANXA 2XEWA 3VTWA 3UQAA 2OJRA 4IUMB 3ZUNA 1V9JA 2KQ7A 2L8JA 2M17A 3ZNID 3JYUA 3ZRCA 2MP2B 1UBQA 2ZNVC 2N4FA 2MW5A 1WFYA 2O2VB 4MSQB 4IWPA 4KIKA 1OEYJ 4GOCA 1YX6B 2ZPYA 4MGYE 1OQYA 1WE7A 4WJOA 3VFKA 1YX5B 2FCNA 2NR2A 4MDKE 1F9JA 3U8ZA 3W1YA 3UQBA 1WGYA 4FN2A 2KLGA 3S2AA 4ZDVA 2KC2A 4HDQA 4HPMB 1GUAB 1GG3A 2RD0A 3HIZA 3L08A 3ZKJC 4BKSD 3RULA 4AOFA 2WWZA 2BKRB 3B1LX 1A5RA 3M3JA 2MCNB 2G4SA 2K8BA 1MG8A 2UWQA 3A4RA 1UGMA 1UZXB 2LD9A 3AI5A 3DVGY 3ZW3A 5CTRC 3QX1A 1WJUA 1WJNA 2O6VB 5L83A 2N9PC 3A9JB 4JGHB 3MTNB 4WJQA 4CYEA 2K6DB 5TR5A 4DDID 2IO1B 4LJPB 5DPRA 1V5TA 2EMSA 5JHAA 3PHWB 2K8HA 3H7PA 4E3CA 1E8ZA 1RAXA 2Z0EB 3M95A 5IAAC 4ANUA 1M94A 3O65B 3NS8A 1R4NI 3APCA 1J0GA 3AULA 5E6NA 2KVRA 5EDSA 1KLVA 2MBHA 4EKUA 4FADA 1TTNA 3A33B 3PZDA 2ZCCA 3LDZE 4MJSB 1LFDA 2JPHA 3B0AA 4IG7B 2AYOB 2KWCA 3APFA 4MH0E 1NDDA 2LGYA 3VXWA 5CHFA 2DZIA 1ZW7A 2WX1A 2K6QA 2MWSB 3SU8X 3UGBB 4K7WA 4MGKE 4HDOA 4YL8A 3ZO5B 4F1SA 4LDTD 5G55A 4EEWA 2EKEC 3CMMB 4FHJA 3ZTDA 3RZWC 1JRUA 3N32A 3QA8A 4G50A 4HWIB 3L13A 1D3ZA 4GMVA 2DZMA 1QZEA 4BOSC 4BVUC 4HVBA 1E8YA 2J0JA 3NZSA 2NBVB 2JT4B 2BKFA 3CSTA 2KDBA 2AL6A 2AL3A 3TCAA 2FNJB 1Q0WB 4NNJB 1E8XA 1XT9B 4KZCA 2DYOA 1NBFC 1V6EA 2BWFA 3JVZX 4II3B 4HJKA 4W9EA 2LRWA 4WQOB 2D3GA 2L3ZA 2PE9A 4EUTA 2XK5A 3EC8A 1SIFA 2IBIB 1P3QU 2KXJA 1KJTA 2ZZPB 5J17A 4XZ4A 2LASA 4HCPB 4RM8A 3VH3B 1H4RA 1WE6A 3MHSD 1Z5SB 2W9NA 3B08A 3VTVA 4ANWA 3RUIB 2UYZB 2D10A 3M63B 3L0WB 3DVNU 3N3KB 3LJ3A 4WJNA 2WDTB 3KYDD 1YJ1A 3PRZA 1WGDA 2KX3A 3V6CB 4GXBA 2NCNA 2KFKA 4IM3A 4KSLC 2BYVE 1KOTA 2V4LA 1HE8A 3PGEA 1RRBA 3NY5A 1WGGA 4WAAA 4XC2A 2DYMA 3PRPB 3PVLA 4K7SA 1RLFA 2REXA 4K1RB 4JLCA 2JZ3B 4LJOB 5D2MB 3U7DA 4KV2A 3WANA 1VCBA 2PJHA 2O2VA 2JWZA 5GMVA 2QHOA 3A1QB 1WX9A 4DWFA 4LDTB 4ZRJA 2C7HA 1GNUA 4BKTA 1GJZA 3QC8B 2C7MB 4NPNA 3W1SC 3WA0A 3AU5A 4BBNF 2KWVB 3K9OB 2C7NB 1V49A 4M0WB 4W9KA 4MM3A 1WX8A 2DAJA 4WWNA 3WAPA 3H7PB 5JH5C 2HJ8A 2N7DA 2NBWB 2KD0A 4BOZB 3L54A 4FJVB 4W9HA 1UH6A 4PS7A 2JXXA 1LXDA 2MP2A 4IWQA 3VAWA 1WI0A 3QIJA 2KFKB 4NJ7A 4HK2A 5KHOA 2FIFA 2NPTA 2LVOA 2BF8B 1WH3A 2CHZA 1GC6A 4JL9A 4GU2A 4KSKC 1LQBA 3GOEA 3V6EB 4GDLB 1E8WA 2MQJA 3DCGA 2JRIB 3SHQA 1CMXB 4GDKB 4ASWC 3IBEA 4BFRA 3ZTCA 2I1KA 3A4SC 5D94A 3QARA 4OVVA 2A4ZA 4RMAA 1OEYA 3A9KA 4W9LA 4G0NB 4JQWC 2G45B 1V80A 5DCNA 4W9CA 1I42A 2NPTB 2JY6A 3JSVA 2N9XA 1WY8A 3VH4B 4ICUA 2OOBB 2J0MA 1WGRA 4GGQA 4FHKA 2KDFB 2ZCBA 2Y5BB 3OAWA 3Q3FA 4G11A 3ZDTA 2MX2A 3ENEA 3IG3A 3ZDMC 4DHZB 2ZVOA 3H1UA 2LI5A 3KUZA 3R7QA 4GIVA 2HE7A 2MLBA 2K39A 2KOXA 5KHQA 2YLMA 4OVUA 3VUXA 2IO2B 5CHWA 1EUVB 3WAOA 1UD7A 2IO3B 3ZNGC 5DPWA 2CHWA 3KYCD 2J7QB 2KMCA 3H9DA 2JZZA 1TZ1A 3R7RA 2LXAA 2KMAA 3RT3B 3VUWA 1C1YB 3HK0A 3ZLZA 4DXAB 2KX0A 3PLUA 2MA9B 4MELA 1SGHA 2L05A 2R2OA 3RYTA 4I6PA 2WYQA 2LJ5A 2M1MA 1T0YA 1TGZB 2KJRA 2CKHB 1Q1OA 3APDA 4HCNB 2KJ6A 5D6JB 3D32A 2K1FA 3VVWB 4F7ZA 3U30A 4IM0A 3PTFC 1WZ3A 1WJ4A 5J18A 2KANA 4E71A 2LGDA 2DHZA 3UINB 4MEMA 2L00B 3SD5A 3GZNI 4F8CB 4WJPA 2N7EA 3DBSA 1UELA 4M8NA 1AARA 2XBBC 1OGWA 3ML8A 4KVGB 5CX3A 3UF8A 4K81A 2KJHB 3L17A 3OJ3A 3VDZA 4TV3A 2M4NA 4G3XB 4TKNA 5DPSA 3PV1A 4KDLB 2DYBA 3TBLD 3CSFA 1J19A 3NOBA 4BKGA 4DHJB 3ALBA 1LM8B 3EECA 2XK5B 2I1JA 4ZRIA 3P2BA 3SDLC 4CO7A 2ZVNA 2C9WB 2MBEA 2CHXA 1WXSA 1NI2A 5CHVC 1K8RB 2LGXA 5E6OA 3KUCB 2IYDB 4ICVA 4BBNC 4XX5A 2KTFA 3NHEB 4EZJA 3MJWA 2HD5B 1WRDB 3PREA 3TMPB 4N9F4 5LXIB 4TQ0A 3KW5B 2PPHA 2K25A 5L95C 3VQIA 3PHXB 1L2NA 1XD3B 1WM3A 1XQQA 2BYEA 4HPLB 2KDIA 3QCAA 3C0RB 4DHZE 3TL5A 4FLHA 4KIKB 5JHBA 1P98A 2D11A 1I35A 3WALA 2J0KA 3PRMB 3TIXA 4AJWA 4MGZE 2AWTA 2A5UA 2N1WA 4JIOU 2K8CA 2GMIC 3IFWB 2IY0B 4NY0A 3NZUA 5IA7A 2L0FA 2WX0A 2O6VD 4TQ1A 2KK8A 3EFUA 4FULA 1BT0A 1IPGA 3JW0X 3PS6A 5J2RA 2JF5A 4DHJD 1YQBA 2PE6B 1P1AA 4W9DA 2RSUA 3DDCB 3W1SA 1YIWA 1SE9A 3R3MA 3VHTC 3ML9A 2RR9A 3H7SA 4FBJB 1KM7A 5AZFA 2V1YA 4AWJA 2GBNA 1V81A 2L0TA 3BY4B 4W9JA 1WIAA 2IZVB 1WF9A 2G4DB 2ZNVB 4FJYA 5LXHA 2C5LC 2IO0B 3ZVVA 4DK5A 2B3AA 2GOWA 2G3QB 2JRHA 4HXDA 4BKSA 5C1ZA 4J6IA 1TBEA 3AXCA 3PT2B 1V2YA 1GC7A 1OTRB 2MBBB 2M8SA 4MGIE 2EMTA 1EF5A 2DZJA 4A20A 4DBGA 3ZRFA 2JVCA 1X1MA 4ANVA 2DX5B 2YVCA 4W9FA 2MSED 2FCSA 5HKHA 4II2B 4IC7B 3VTUA 3X23A 2LRUA 2ZJDA 1EF1A 1S1QB 3QJZA 4M8MA 3VUYA 3ECIA 2N9EB 2O6VA 2CU1A 2LVPA 3L16A 4MJSA 3QK0A 2KNBA 2R2QA 4AUQC 2BYFA 1G6JA 4KDIC 1WXAA 3V61A 1ZKHA 2GBJA 3IHPC 3ZIMA 1E7VA 2L7RA 1Z2MA 2DAFA 2KTRB 4EOYA 3IVFA 1EO6A 3UIOB 2V3SA 2BWES 1H8CA 1WX7A 2LZ6A 5AZHA 4EZKA 2CR5A 3QWZB 3QAQA 5AZGA 3EHVA 1WMHB 4K7UA 2MBOA 4EZLA 2NS5A 5FR6A 3DVNV 4B95A 1U4AA 3DPDA 3T8MA 3V62A 3I3TB 1UBIA 3X0WA 2ASQA 2MBQA 3RZFA 2FCQA 1Y8RC 2NBUA 1V86A 1S3SG 2N1VA 2KFJA 2NVUI 1ZGUB 4FA6A 4TUUA 2KQSA 1P9DU 2Z0DB 4WWOA 1J8CA 3R66C 4EFOA 3H6NA 4IM2A 4B9KA 4RM9A 4I6LB 5AEKB 4FJZA 1ISNA 4PS8A 1R4MI 3KH0A 4PYZA 2VRRB 4NQKE 4I6NB 3A9JA 4GN1A 2FAZA 4NAWA 1WMHA 1L7YA 1VD2A 2Z59B 1V5OA 5E6PA 2FUHB 4ZRKA 2AEHA 2KKCA 2FCMA 3DBHI 4X57B 2M0XA 3DBLI 1WJ6A 2KN5A 3Q3JA 4KZ0A 4W9GA 3DVGX 3HHMA 3DBRI 1WXMA 2CS4A 3JSVB 4IWOA 5D7GA 4HLEA 3BINA 1FXTB 3V60A 2HTHA 3WAMA 3OLMD 1YD8U 2GBKA 3DQVA 2KC1A 1E7UA 4A3OA 3M62B 1WZ0A 5DPTA 4P7IA 1E90A 4W9IA 4NJ6A 3UIPB 5G2NA 4NAWB 4MSMB 5C23A 4CHKA 2MRPA 3KUDB 3N30A 1E5WA 4PYUA 3ZNZB 4DDGD 4E74A 3OJ4B 4ZYNA 3ONSA 2D2QA 4GDLA 2GBRA 2LUEA 2FIDA 1WXVA 4LCDE 2C60A 3HM3A
chains in the Genus database with same CATH superfamily
1JWMD 1ZXHA 2KZRA 2LVQA 1PQSA 4PS3A 2LWPA 3L10B 1WGHA 2JQRB 2LEKA 4URKA 3AH7A 4WWPA 1R4MB 4JE3B 3RCZA 1DYQA 1WR6E 4K3CA 1XLNA 4PK1A 4KGRA 3VRBB 2ZPNA 1QLBB 5JZEB 1TKEA 2J52A 3Q8CA 3VTWA 3SR6A 1V9JA 2KQ7A 2M17A 2D3AA 2PW9A 2ZNVC 1SE3A 3IAM1 4MSQB 4IWPA 1D5XC 4WJOA 3U8ZA 4M02A 3UQBA 2KLGA 4C56C 3J9CA 2WXKA 3P4PB 2RDHA 1KRHA 3KWLA 3AEDB 1NVID 2WWZA 1L0VB 1A5RA 2K8BA 2UWQA 2LD9A 3AI5A 4RGMA 1WJUA 1VJKA 1MI0A 4JGHB 4WJQA 3MTNB 2KWDA 1KFYB 3M95A 3O65B 1TS5A 1JRPA 4DXFA 2K5PA 1GPXA 4S17A 4DQOC 2MBHA 3N1ZC 3A33B 1NI3A 1QOGA 1LGRA 1I4RA 4MH0E 1NDDA 3I57A 2WX1A 2K6QA 5IO9A 3MC0B 3SU8X 4K7WA 4MGKE 4F1SA 1TIFA 1HXYD 2KAJA 5G55A 4EEWA 2I38A 5E6JA 3ZTDA 3HVDA 3QA8A 4NJCA 1DOYA 3L13A 4HROA 3N1YC 1QZEA 2D3CA 2JT4B 1XLOA 1XT9B 4MM3B 2DYOA 2YEPB 3KLSX 4LNFA 3NVVA 1MPEA 3TEZA 4A90A 4EUTA 2JYEA 1WGKA 1P3QU 1KJTA 2ZZPB 4MACA 4DHJD 2WQYB 3VTVA 4PT5A 2UYZB 2D10A 3M63B 3N3KB 1YJ1A 2JYTA 3IAS1 5G5GA 4YSZB 4BAXA 4IM3A 2K3UA 1T5XD 1QQRA 2BYVE 2K0PA 1PFDA 1SJED 2REXA 4K1RB 2YEPF 2RPVA 3U7DA 4KV2A 2BW2A 1V1PB 3A1QB 1WX9A 1JW9D 4C7ZA 2BS3B 2PTLA 3QC8B 1KLUD 4BBNF 1FFVA 2C7NB 1WX8A 1QOBA 4WWNA 2OHFA 1ZP0B 4FJVB 3RNAC 1UH6A 4OZAA 1LXDA 3VAWA 3QIJA 4A6QA 2NPTA 2DLBA 4JL9A 4GU2A 1XCQL 4KSKC 1WWTA 4EE2A 1HEZE 4YT0B 3ZTCA 2I1KA 3A4SC 1P7EA 5D94A 2WXJA 1V97A 4GLSC 3SFDB 1C78A 2G45B 1V80A 4TSSA 4AS1A 2MJDA 1I42A 2JY6A 3VH4B 5EE0A 3T3NA 2J0MA 4GGQA 2DWQA 3IG3A 2K39A 2KOXA 4OVUA 5CHWA 4HEA1 1EUVB 3WAOA 2IO3B 2WP9B 4CQNA 3R7RA 3RT3B 1VLBA 4C7YA 5HG2A 3GZNB 3KWVA 2KX0A 3Q8BA 3LB8C 4WQMA 2WYQA 3BYYB 1N5WA 1P7FA 2K1FA 3VVWB 3U30A 2AQ2B 1WZ3A 3LYYA 3B2FA 4E71A 2LGDA 4P1CC 1UELA 2XBBC 3IXSA 1OGWA 4J3OD 1L5PA 3NZ3A 1YN4A 2MHJA 4TKNA 3ALBA 2XK5B 3SDLC 2WDRB 4CO7A 1AYFA 2C9WB 2MBEA 5CHVC 1K8RB 4ICVA 2KACA 3PREA 3TMPB 1XEEA 2WU2B 1TY2A 2W54A 1OFFA 3Q2AC 3Q3OC 1WM3A 1XQQA 3C0RB 4FLHA 4KIKB 1I35A 2WHIA 1XO3A 1ET9A 2J0KA 1T0SC 4AQ7A 1KH0A 2EELA 2BB6A 4AJWA 2AWTA 1EU3A 3VR8B 2QEJC 2L0FA 1VZ6A 2O6VD 1UF0A 3EFUA 1BT0A 3JW0X 5J2RA 2JF5A 2PE6B 2PKOA 3W1SA 1YIWA 4Q2JA 3R3MA 2IGDA 1KM7A 2GI9A 2WXPA 1FPYA 1WF9A 2ZNVB 4A55A 1GOZA 2C5LC 3ZVVA 1QILA 2EKIA 4RGNA 3ZGZA 4HXDA 1HA5A 3BWUD 4A8XC 3DHGC 3U52E 1FFUA 1ZOYB 1OTRB 1EF5A 5JXVA 2FCSA 1JWUD 3VTUA 2AX5A 2L83A 2PVGC 3DHHC 1UWMA 3ECIA 4MJSA 2LVPA 3QK0A 3KQ4A 2KNBA 4AUQC 3FILB 4B0MA 4EOYA 3ZIMA 2Y5PA 1EO6A 2BWES 1H8CA 3AEBB 4EZKA 4K7UA 4EZLA 1K53A 4XDDA 5FR6A 3C8YA 3AECB 3T8MA 3BYTB 3W5VB 1B1ZA 2NBUA 1V86A 3MC9A 4XWTA 2INNE 1P9DU 2KQSA 1FRRA 3R66C 4EFOA 2RDBC 3H6NA 5AEKB 4FJZA 4PS8A 4PYZA 4US9A 5FR3A 4I6NB 4REZA 4K3BA 2KKCA 2KN5A 3Q3JA 3HHMA 2CS4A 4HLEA 3V60A 1YOVB 2HTHA 3OLMD 1YD8U 2W82A 1F2RI 1IGCA 1WZ0A 5DPTA 1I4HA 2QDFA 4NJ6A 3NG0A 2ZW0A 4NAWB 4FXCA 4DDGD 4E74A 3OJ4B 2LUEA 2KN4A 3HRDD 4MT5A 4G11A 3HM3A 3SFEB 3B9JA 2L76A 3HM6X 1ZDVA 1BXTA 1WR1A 2IY1B 1P0RA 4GDKA 3BVZA 4B6WA 2DENB 3T9LA 1EWYC 3R8BA 3Q69A 2ZEQA 2KTRA 1WYWB 2KHWB 1MG4A 3CF6E 3DOWA 3A9KB 5IKCM 4DXGA 1C3TA 2BPSA 4ANXA 2KLCA 2SEBD 2KDMA 4IUMB 2L8JA 4KKJA 1VZ8A 2MP2B 2N4FA 3RPFC 2MW5A 4MGYE 2CJOA 1YX5B 1F9JA 2BVCA 1FXAA 4FN2A 3S2AA 3AEFB 1GG3A 3RULA 4OVZA 4AOFA 4NZLB 4L23A 3A4RA 1UZXB 5CTRC 2K9XA 4RH6A 2O6VB 3A9JB 1RWSA 4DDID 2IO1B 4LJPB 2Z0EB 4ANUA 3RFZB 1MHXA 2M19A 1F0ZA 1J0GA 3AULA 1KLVA 3NVYA 3LDZE 3B0AA 4IG7B 1E0ZA 1D6EC 3W9CB 3VXWA 5CHFA 2MWSB 3AEEB 1AWDA 4LDTD 3Q14C 1C9FA 2INDC 1MVKA 1N5XA 2WXNA 4HWIB 1N61A 1I7HA 3NZSA 1EWCA 1JROA 1MJDA 1FIQA 2RDGA 1GB1A 1KF6B 2FNJB 3ZXVA 1Q0WB 1E8XA 1FCCC 4KZCA 3JVZX 2KYWA 2BWFA 4II3B 1L4ZB 2LGSA 4IKGA 4W9EA 2LRWA 2D3GA 4RGTA 1YNTE 1TS4A 1QT9A 3EC8A 1SIFA 3AE1B 2KXJA 3HUIA 4HCPB 1RM6C 3MHSD 3B08A 4ANWA 3ZQ4A 4YTMB 2AQ1B 2WDTB 3KYDD 4LNIA 2NCNA 5IOIA 2KFKA 4ARIA 4USAA 4KSLC 1AW7A 1HE8A 3ETRA 3MHZA 4WAAA 1K52A 1RLFA 4JLCA 4LJOB 2QSDA 1Y56A 2PJHA 2O2VA 3IT6B 2QHOA 4DWFA 1L0YB 4LDTB 4ZRJA 1RYJA 3PZ7A 4HKQA 2C7MB 1XXGA 3W1SC 2VH1A 4M0WB 4MM3A 2DAJA 2WXFA 1ZXIA 3WAPA 1YN5A 3H7PB 1FD6A 2NBWB 5TSSA 2KD0A 3L54A 4W9HA 1J7AA 1HQRD 2JXXA 2KFKB 4NJ7A 4HK2A 1FCLA 2LVOA 1WH3A 2JXTA 3V6EB 2G1EA 3NRZA 3SHQA 1CMXB 4GDKB 4ASWC 3IBEA 1KTKA 3AEGB 4RMAA 1OEYA 3RNEC 2NPTB 2X8XX 3JSVA 1SSNA 1RFKA 2OOBB 3ENEA 3UI3A 4DHZB 2ZVOA 2W55A 2IGHA 5KHQA 4JWSC 2INPE 1FO4A 2KMMA 2KMCA 3H9DA 1JWSD 3P1MA 1C1YB 1N62A 3HK0A 2H88B 4OZCA 1SJHD 2WNMA 5HFYA 3ZJTA 4IDIA 2MA9B 2R2OA 3LXFA 3RYTA 3TEXA 2LJ5A 1T0YA 1TGZB 1TJEA 2CKHB 3D32A 2IGGA 3PTFC 1WJ4A 2DHZA 3UINB 2L00B 3NS1A 1E7PB 1HTQA 2HJ1A 3UF8A 5CX3A 2TSSA 4K81A 3L17A 3OJ3A 1C77A 1MFWA 3AE6B 3PV1A 4KKIA 3AV8A 3NOBA 4DHJB 3P2BA 2ZVNA 2CHXA 3RNGC 1NI2A 3KUCB 2IYDB 4L1BA 2KTFA 4EZJA 2PLPA 3I63C 3MJWA 2HD5B 2INCC 1YQ4B 4N9F4 4TQ0A 1L2NA 1XD3B 4HPLB 1F52A 2V3NA 3QCAA 1P98A 3NVWA 1DOXA 3PRMB 4MGZE 2BT6A 2A5UA 2N1WA 5FK9C 3IFWB 1F2RC 3AE9B 2WX0A 5IA7A 1FNVA 1IPGA 1SE4A 4W9DA 2RSUA 1SE9A 2RR9A 3H7SA 3EGRA 2V1YA 4AWJA 1I4GA 2WXGA 3BY4B 4W9JA 2IZVB 3GB1A 2IO0B 3RNBC 1N60A 2B3AA 1D4BA 4J6IA 3B2GA 3N20C 5BYQA 3AXCA 3U4EG 1CQVA 2LUMA 1GC7A 1JWAD 2M8SA 2FBWB 4A20A 2DZJA 3Q3MC 4DBGA 4HRSA 2JVCA 4ANVA 1FRDA 4W9FA 2MSED 4II2B 4IC7B 4MH8A 1TZOA 2ZJDA 2XNAC 3AM9A 4D2KA 4KDIC 1WXAA 4HPPA 3IHPC 2L7RA 2KTRB 5G5HA 3NJTA 1WX7A 1C76A 4YSYB 5AZHA 3QWZB 4OZBA 5AZGA 2NS5A 1STEA 3V62A 2N0SB 3RZFA 4L2YA 2SAKA 1S3SG 2KFJA 2N1VA 2NVUI 1ZGUB 2V0GA 4ZRQA 2Z0DB 3FILA 4IM2A 4B9KA 1R4MI 1FNWA 2LJIA 2WXQA 2D3BA 1A70A 5E6PA 1UGJA 4ZRKA 2AEHA 2FCMA 3TUOA 2M0XA 4S0RA 4W9GA 3U2SC 3DBRI 3JSVB 5D7GA 2LFIA 3R2IA 5BMGA 1FXTB 1XLPA 2LMCA 3E56A 2GBKA 4YWGG 1E7UA 1L0XB 5LNK1 4P7IA 1ROEA 5G2NA 2LHDA 2KVZA 4XE0A 1IGDA 1J7CA 4MSMB 5C23A 4CHKA 4ZYSA 2GB1A 3KUDB 2G9HD 3ZNZB 2GBRA 2E3TA 2C60A 1GB4A 1XCTL 4NQLB 3HVZA 3W5UB 4GSWA 2M0AA 3PPAA 2WXOA 3FKYA 2KWUB 3NVZA 1CZPA 2PEAA 3QQ8B 3TJPA 4AJYB 5C3JB 2ICIA 3GS2A 3AU4A 3P4SB 2QC8A 5C2TB 2LXCA 5BO4B 1F1HA 3U7ZA 4A3PA 3ZYYX 2KDEB 2RGFA 3PSEB 4M01A 1R7SA 2WXHA 1QKZA 4RNAA 5LLIA 1R4NB 1SXTA 3UQAA 1L6VA 4N6EB 4JWUC 3ZNID 1UBQA 1N6ZA 4C4VB 2IDYA 1WFYA 4KIKA 1OEYJ 1WE7A 2NR2A 2FCNA 4MDKE 3W1YA 1WGYA 4ZDVA 2KC2A 4HDQA 2RD0A 3L4PA 2DNFA 1WRIA 3B1LX 2BKRB 3BZDB 2MCNB 2G4SA 1MG8A 1Q10A 4RFBA 4XYCA 4BZAA 3DVGY 3ZW3A 2K6DB 4YTNB 3AE5B 2JU6X 5DPRA 5TR5A 1V5TA 2EMSA 2VZKD 3PHWB 4US8A 3H7PA 1E8ZA 5IAAC 3P63A 3NS8A 2PIAA 3APCA 3V05A 5E6NA 3MJ5A 1PGBA 4EKUA 1TTNA 3PZDA 2ZCCA 4MJSB 4QAYA 1LFDA 1UWXA 2AYOB 2KWCA 1K50A 3CIRB 4WIPA 1N63A 3UGBB 2WGSA 2UU7A 4HDOA 1T0RC 3TEWA 3AMZA 1J7BA 4JPSA 2EKEC 4FHJA 3AE4B 3N32A 4G50A 2FE8A 2DZMA 4BOSC 4BVUC 4HVBA 1E8YA 2NBVB 1ENFA 2AL6A 3TEYA 2AL3A 4LTUA 1NBFC 1V6EA 1TY0A 2J42A 4HJKA 5H8YE 4WQOB 2L3ZA 2BS4B 2AQ3B 2XK5A 4LNOA 5BMHA 1F77A 2WXRA 1ESFA 3VH3B 1H4RA 1WE6A 1V8CA 2QJLA 2W9NA 3RUIB 1YN3A 3LJ3A 3T3OA 1WGDA 2L32A 1E9MA 2OJWA 4GXBA 1KOTA 3GP7A 1E6EB 1T3QA 1RRBA 2WDQB 3NY5A 1WGGA 2DYMA 3PRPB 3PVLA 4RF0A 2JZ3B 3WANA 2C7HA 3WA0A 3Q6BA 3K9OB 2WXIA 4W9KA 1V49A 1XF5L 5JH5C 2HJ8A 4BOZB 3GE8C 4KGTA 2WXMA 3EA6A 1NYRA 4IWQA 1WI0A 5KHOA 1TKYA 2FIFA 2BF8B 2CHZA 1GC6A 3AE8B 1TYGB 3GOEA 3BK1A 2MQJA 2VH2A 3MC8A 2PMVA 4OVVA 3A9KA 3AE3B 4W9LA 5D3IB 4G0NB 4JQWC 3AE2B 1E10A 4XDCA 2N9XA 1WY8A 2QMTA 3BVMA 1SB3C 2ZCBA 3Q3FA 2Y5BB 3OAWA 3ZDTA 4OW0A 2MX2A 3ZDMC 1QOAA 3KUZA 3R7QA 4GIVA 2JWUA 2MLBA 2YLMA 1T6BX 2WS3B 3VUXA 2IO2B 5DPWA 3KYCD 2J7QB 5BYSA 2JZZA 1TZ1A 5BYRA 1HZ5A 4DXAB 2RMMA 1PDXA 2NMQA 2QILA 4P1BC 3PLUA 2L05A 4I6PA 2M1MA 1IUEA 3APDA 4HCNB 2KJ6A 4F7ZA 3Q8EA 1WXQA 4MEMA 3I9V1 3SD5A 1EU4A 2N7EA 3DBSA 4P6VF 4WWMA 5GXGB 3ML8A 1YMHE 2H89B 1VRAB 4TV3A 2M4NA 4G3XB 3V3XA 5DPSA 1JQ4A 2BB5A 1WYGA 4ACFA 1FM0D 4BKGA 3EECA 2I1JA 1XLQA 2KQ4X 1WXSA 2VZKB 3NUHB 4BBNC 4XX5A 3NHEB 3MFGA 1TT5B 1WRDB 3KW5B 1I4QA 5IP4D 2CJNA 5MPOA 4DHZE 2XN9C 2D11A 3WALA 4JIOU 1FNUA 2K8CA 4NY0A 3OG5A 2IY0B 3CWIA 4P16A 4FULA 1QOFA 3PS6A 1YQBA 1QF6A 1PUTA 3DDCB 3VHTC 2V3PA 2IJ0A 5AZFA 1JALA 1V81A 1BMLC 3IT4B 4FJYA 5LXHA 4DK5A 5FKAC 1T0QC 5C1ZA 1TBEA 1HTOA 2MBBB 1UUPA 4MGIE 5HHDG 3FC4A 2CU3A 2DX5B 2LRUA 1EF1A 2Y5CA 5EE1A 1YJJA 2O6VA 3L16A 2R2QA 5EE9A 2ZW1A 3V61A 2GBJA 2WLBA 1E7VA 1I4XA 1Z2MA 2DAFA 2JSVX 3UIOB 2V3SA 3RMKC 1CJEA 2LZ6A 3PZ8A 3QAQA 3EHVA 1WMHB 5T8IA 2MBOA 2WDVB 4B95A 1U4AA 3DPDA 1YQ3B 3I3TB 2ASQA 2MBQA 4H2AA 4N59A 1Y8RC 4FA6A 2B76B 3SEBA 4JX1C 1J8CA 4M00A 3VRAB 4I6LB 3EUB2 3Q8FA 3KH0A 5IN7A 3A9JA 2BTEA 1TKGA 4GN1A 1CK1A 1L7YA 1VD2A 1B9RA 1V5OA 1NENB 1DGJA 4X57B 3DBLI 4KZ0A 5I4DA 1WXMA 3O13A 3BINA 3WAMA 2KC1A 4ZHPA 2J53A 2Q5WD 3UIPB 1VR9A 1E5WA 4RF1A 3DWMA 4ZYNA 3ONSA 4GDLA 1PGAA 1TS3A 1EM7A 4NAMA 2FIDA 4A9AA 1ZUD2 4IW0A 1UNSA 1WM2A 2JUOA 3QHTA 2PVOD 2W3RA 2DZKA 2RPQA 3PLVA 2D07B 2L52A 1ET6A 4N58A 1L6UA 4WURA 2BGFA 1RFAA 3WIMA 1V1PA 3A1QA 2GBMA 4UDUC 1IYFA 1I4PA 4GB9A 3ZNHB 3RD2A 1Q5WB 1IP9A 3RI7C 4AP4C 3K9PB 3KVFB 2Y3AA 2KO3A 1BUIC 2XEWA 4IOIE 2V4IB 1SE2A 2OJRA 3ZUNA 3ZRCA 3JYUA 2BQQA 2O2VB 1OQQA 4RCOA 4GOCA 1YX6B 2ZPYA 3VFKA 1OQYA 5H92C 3DBLB 3C19A 1SBBB 4M0WA 4HPMB 1GUAB 3HIZA 3ZKJC 3L08A 3WCQA 3DHIC 2GLSA 3URYA 4BKSD 3EFCA 1JCKB 3M3JA 4RGOS 2GRIA 1UGMA 3QX1A 5D3DA 4YTPB 5AUIA 1WJNA 5L83A 2FUG1 2N9PC 4CYEA 2NTSA 3Q3NC 5JHAA 2K8HA 4XGAB 4E3CA 1RAXA 1M94A 2LHEA 1R4NI 2MEKA 3RN9C 3RNCC 3DBHB 2KVRA 5EDSA 4FADA 2JPHA 3P42A 3APFA 4O1NA 2LGYA 3AB5A 2OEDA 2DZIA 1ZW7A 1KLGD 4YL8A 3ZO5B 4WAFA 1FMAD 3TSSA 4C80A 1SEBD 4ARCA 3CMMB 1PYWD 3RZWC 1JRUA 1D3ZA 4GMVA 1IBXB 2J0JA 3CSTA 2BKFA 2KDBA 3TCAA 4R3DA 4NNJB 3OWEB 2D5GA 4LLGM 4LNKA 1ZDXA 1D5MC 4YXDB 3PO0A 2PE9A 3GE3C 2IBIB 2IPKD 4LK0M 5J17A 4XZ4A 2LASA 4RM8A 1FXIA 1Z5SB 2ACZB 2L1AA 3L0WB 3DVNU 4WJNA 2QCZA 2M56B 3PRZA 2KX3A 3V6CB 2V4LA 1C79A 3PGEA 2E6XA 4XC2A 4K7SA 1HZ6A 1SIJA 5D2MB 1VCBA 2R61A 2JWZA 5GMVA 1TS2A 3Q8AA 3VR9B 1DOIA 2K22A 1VDVA 1GNUA 4BKTA 1GJZA 1AN8A 1JWBD 4NPNA 4TMAB 3AU5A 2KWVB 4YSXB 2WXLA 4C00A 2N7DA 4PS7A 2MP2A 3ZXRA 1LQBA 4GDLB 1E8WA 3DCGA 2JRIB 4BFRA 4B0EA 3QARA 2A4ZA 5DCNA 3AEAB 4W9CA 4ICUA 1WGRA 4FHKA 2KDFB 3FAHA 3H1UA 5BMIA 2LI5A 2Z8LA 2HE7A 4C4VA 3AE7B 2DBYA 1UD7A 3ZNGC 2CHWA 2LXAA 2KMAA 3VUWA 3ZLZA 1MHHE 4LNNA 4MELA 1SGHA 5EE3A 2KJRA 1Q1OA 5D6JB 3DBRB 4IM0A 3MP9A 5J18A 3ZJUA 2KANA 3AN1A 3GZNI 4F8CB 4WJPA 1V1OA 3W2DA 4M8NA 1AARA 2JX5A 2N9KA 4KVGB 2KJHB 3VDZA 3N9YC 4KDLB 2DYBA 3TBLD 3CSFA 2BBCA 1J19A 1D5ZC 1WSPA 3H8HA 1LM8B 4ZRIA 2W3SA 2LGXA 5E6OA 1M4VA 1JMLA 1NYQA 5LXIB 2PPHA 4ITKA 2K25A 5L95C 3VQIA 3PHXB 2BYEA 4ZHOA 2KDIA 2I2YA 1ACCA 3TL5A 5JHBA 1NEKB 1LO5D 2NTTA 3TIXA 3BVGA 2GMIC 2BS2B 3NZUA 4TQ1A 2KK8A 4WH4A 1P1AA 2J4XA 1ZPSA 1YJIA 3ML9A 1FEHA 2MH7A 4FBJB 2GBNA 4HKZE 2L0TA 1WIAA 3E9SA 2N9LA 2G4DB 1GAQB 2HDEA 2GOWA 2LGIA 2G3QB 2JRHA 1IBXA 4BKSA 4XWWA 4KGSA 2MJ3A 3PT2B 1V2YA 2EMTA 3P4QB 3BK2A 3ABVB 1PGXA 3ZRFA 1X1MA 2YVCA 1C4PA 5HKHA 3P4RB 2QIEB 4ZRPA 3X23A 2BYTA 1S1QB 3QJZA 4M8MA 1ZE3D 3VUYA 2N9EB 2CU1A 2BYFA 3DWGC 1C4AA 2JZPA 1G6JA 2ONQA 1C4CA 1ZKHA 3ZJVA 3IVFA 2HTME 2CR5A 4KX6B 3N1XC 4HJGE 3RNFC 3BIID 3DVNV 1UBIA 3X0WA 1L4DB 2FCQA 1VZ7A 2X38A 4TUUA 4WWOA 4RM9A 1ISNA 4OHJA 2VRRB 4NQKE 4NAWA 2FAZA 1WMHA 2Z59B 2FUHB 2ON8A 2N7JA 3DBHI 1SF0A 1WJ6A 3DVGX 3R2TA 4IWOA 1OQRA 2MJEA 3DQVA 4A3OA 3M62B 4ZOHC 1E90A 4W9IA 5AUKA 5HI1A 2MRPA 3N30A 2KT7A 4PYUA 2V9HA 1K51A 2D2QA 2WU5B 3I5JC 1WXVA 4LCDE
chains in the Genus database with same CATH topology
4IW0A 2KZRA 2L76A 3HM6X 2LVQA 1WM2A 4NQLB 1PQSA 2JUOA 2LWPA 3L10B 3QHTA 4PS3A 2DZKA 1WGHA 1WR1A 2IY1B 4GSWA 1P0RA 4URKA 2RPQA 3PLVA 3PPAA 4WWPA 4GDKA 2KWUB 3RCZA 4B6WA 2DENB 1WR6E 3T9LA 2D07B 2PEAA 3QQ8B 3TJPA 4AJYB 2ZEQA 2KTRA 1WYWB 3AU4A 2BGFA 1RFAA 3WIMA 2KHWB 3A1QA 3CF6E 2LXCA 5BO4B 3DOWA 2GBMA 3A9KB 2ZPNA 4A3PA 1C3TA 1IYFA 4GB9A 3ZNHB 5JZEB 3RD2A 1Q5WB 2KDEB 2RGFA 1IP9A 3PSEB 4AP4C 3K9PB 3KVFB 2BPSA 2KO3A 5LLIA 2KLCA 4ANXA 2XEWA 3VTWA 3UQAA 2OJRA 4IUMB 3ZUNA 1V9JA 2KQ7A 2L8JA 2M17A 3ZNID 3JYUA 3ZRCA 2MP2B 1UBQA 2ZNVC 2N4FA 2MW5A 1WFYA 2O2VB 4MSQB 4IWPA 4KIKA 1OEYJ 4GOCA 1YX6B 2ZPYA 4MGYE 1OQYA 1WE7A 4WJOA 3VFKA 1YX5B 2FCNA 2NR2A 4MDKE 1F9JA 3U8ZA 3W1YA 3UQBA 1WGYA 4FN2A 2KLGA 3S2AA 4ZDVA 2KC2A 4HDQA 4HPMB 1GUAB 1GG3A 2RD0A 3HIZA 3L08A 3ZKJC 4BKSD 3RULA 4AOFA 2WWZA 2BKRB 3B1LX 1A5RA 3M3JA 2MCNB 2G4SA 2K8BA 1MG8A 2UWQA 3A4RA 1UGMA 1UZXB 2LD9A 3AI5A 3DVGY 3ZW3A 5CTRC 3QX1A 1WJUA 1WJNA 2O6VB 5L83A 2N9PC 3A9JB 4JGHB 3MTNB 4WJQA 4CYEA 2K6DB 5TR5A 4DDID 2IO1B 4LJPB 5DPRA 1V5TA 2EMSA 5JHAA 3PHWB 2K8HA 3H7PA 4E3CA 1E8ZA 1RAXA 2Z0EB 3M95A 5IAAC 4ANUA 1M94A 3O65B 3NS8A 1R4NI 3APCA 1J0GA 3AULA 5E6NA 2KVRA 5EDSA 1KLVA 2MBHA 4EKUA 4FADA 1TTNA 3A33B 3PZDA 2ZCCA 3LDZE 4MJSB 1LFDA 2JPHA 3B0AA 4IG7B 2AYOB 2KWCA 3APFA 4MH0E 1NDDA 2LGYA 3VXWA 5CHFA 2DZIA 1ZW7A 2WX1A 2K6QA 2MWSB 3SU8X 3UGBB 4K7WA 4MGKE 4HDOA 4YL8A 3ZO5B 4F1SA 4LDTD 5G55A 4EEWA 2EKEC 3CMMB 4FHJA 3ZTDA 3RZWC 1JRUA 3N32A 3QA8A 4G50A 4HWIB 3L13A 1D3ZA 4GMVA 2DZMA 1QZEA 4BOSC 4BVUC 4HVBA 1E8YA 2J0JA 3NZSA 2NBVB 2JT4B 2BKFA 3CSTA 2KDBA 2AL6A 2AL3A 3TCAA 2FNJB 1Q0WB 4NNJB 1E8XA 1XT9B 4KZCA 2DYOA 1NBFC 1V6EA 2BWFA 3JVZX 4II3B 4HJKA 4W9EA 2LRWA 4WQOB 2D3GA 2L3ZA 2PE9A 4EUTA 2XK5A 3EC8A 1SIFA 2IBIB 1P3QU 2KXJA 1KJTA 2ZZPB 5J17A 4XZ4A 2LASA 4HCPB 4RM8A 3VH3B 1H4RA 1WE6A 3MHSD 1Z5SB 2W9NA 3B08A 3VTVA 4ANWA 3RUIB 2UYZB 2D10A 3M63B 3L0WB 3DVNU 3N3KB 3LJ3A 4WJNA 2WDTB 3KYDD 1YJ1A 3PRZA 1WGDA 2KX3A 3V6CB 4GXBA 2NCNA 2KFKA 4IM3A 4KSLC 2BYVE 1KOTA 2V4LA 1HE8A 3PGEA 1RRBA 3NY5A 1WGGA 4WAAA 4XC2A 2DYMA 3PRPB 3PVLA 4K7SA 1RLFA 2REXA 4K1RB 4JLCA 2JZ3B 4LJOB 5D2MB 3U7DA 4KV2A 3WANA 1VCBA 2PJHA 2O2VA 2JWZA 5GMVA 2QHOA 3A1QB 1WX9A 4DWFA 4LDTB 4ZRJA 2C7HA 1GNUA 4BKTA 1GJZA 3QC8B 2C7MB 4NPNA 3W1SC 3WA0A 3AU5A 4BBNF 2KWVB 3K9OB 2C7NB 1V49A 4M0WB 4W9KA 4MM3A 1WX8A 2DAJA 4WWNA 3WAPA 3H7PB 5JH5C 2HJ8A 2N7DA 2NBWB 2KD0A 4BOZB 3L54A 4FJVB 4W9HA 1UH6A 4PS7A 2JXXA 1LXDA 2MP2A 4IWQA 3VAWA 1WI0A 3QIJA 2KFKB 4NJ7A 4HK2A 5KHOA 2FIFA 2NPTA 2LVOA 2BF8B 1WH3A 2CHZA 1GC6A 4JL9A 4GU2A 4KSKC 1LQBA 3GOEA 3V6EB 4GDLB 1E8WA 2MQJA 3DCGA 2JRIB 3SHQA 1CMXB 4GDKB 4ASWC 3IBEA 4BFRA 3ZTCA 2I1KA 3A4SC 5D94A 3QARA 4OVVA 2A4ZA 4RMAA 1OEYA 3A9KA 4W9LA 4G0NB 4JQWC 2G45B 1V80A 5DCNA 4W9CA 1I42A 2NPTB 2JY6A 3JSVA 2N9XA 1WY8A 3VH4B 4ICUA 2OOBB 2J0MA 1WGRA 4GGQA 4FHKA 2KDFB 2ZCBA 2Y5BB 3OAWA 3Q3FA 4G11A 3ZDTA 2MX2A 3ENEA 3IG3A 3ZDMC 4DHZB 2ZVOA 3H1UA 2LI5A 3KUZA 3R7QA 4GIVA 2HE7A 2MLBA 2K39A 2KOXA 5KHQA 2YLMA 4OVUA 3VUXA 2IO2B 5CHWA 1EUVB 3WAOA 1UD7A 2IO3B 3ZNGC 5DPWA 2CHWA 3KYCD 2J7QB 2KMCA 3H9DA 2JZZA 1TZ1A 3R7RA 2LXAA 2KMAA 3RT3B 3VUWA 1C1YB 3HK0A 3ZLZA 4DXAB 2KX0A 3PLUA 2MA9B 4MELA 1SGHA 2L05A 2R2OA 3RYTA 4I6PA 2WYQA 2LJ5A 2M1MA 1T0YA 1TGZB 2KJRA 2CKHB 1Q1OA 3APDA 4HCNB 2KJ6A 5D6JB 3D32A 2K1FA 3VVWB 4F7ZA 3U30A 4IM0A 3PTFC 1WZ3A 1WJ4A 5J18A 2KANA 4E71A 2LGDA 2DHZA 3UINB 4MEMA 2L00B 3SD5A 3GZNI 4F8CB 4WJPA 2N7EA 3DBSA 1UELA 4M8NA 1AARA 2XBBC 1OGWA 3ML8A 4KVGB 5CX3A 3UF8A 4K81A 2KJHB 3L17A 3OJ3A 3VDZA 4TV3A 2M4NA 4G3XB 4TKNA 5DPSA 3PV1A 4KDLB 2DYBA 3TBLD 3CSFA 1J19A 3NOBA 4BKGA 4DHJB 3ALBA 1LM8B 3EECA 2XK5B 2I1JA 4ZRIA 3P2BA 3SDLC 4CO7A 2ZVNA 2C9WB 2MBEA 2CHXA 1WXSA 1NI2A 5CHVC 1K8RB 2LGXA 5E6OA 3KUCB 2IYDB 4ICVA 4BBNC 4XX5A 2KTFA 3NHEB 4EZJA 3MJWA 2HD5B 1WRDB 3PREA 3TMPB 4N9F4 5LXIB 4TQ0A 3KW5B 2PPHA 2K25A 5L95C 3VQIA 3PHXB 1L2NA 1XD3B 1WM3A 1XQQA 2BYEA 4HPLB 2KDIA 3QCAA 3C0RB 4DHZE 3TL5A 4FLHA 4KIKB 5JHBA 1P98A 2D11A 1I35A 3WALA 2J0KA 3PRMB 3TIXA 4AJWA 4MGZE 2AWTA 2A5UA 2N1WA 4JIOU 2K8CA 2GMIC 3IFWB 2IY0B 4NY0A 3NZUA 5IA7A 2L0FA 2WX0A 2O6VD 4TQ1A 2KK8A 3EFUA 4FULA 1BT0A 1IPGA 3JW0X 3PS6A 5J2RA 2JF5A 4DHJD 1YQBA 2PE6B 1P1AA 4W9DA 2RSUA 3DDCB 3W1SA 1YIWA 1SE9A 3R3MA 3VHTC 3ML9A 2RR9A 3H7SA 4FBJB 1KM7A 5AZFA 2V1YA 4AWJA 2GBNA 1V81A 2L0TA 3BY4B 4W9JA 1WIAA 2IZVB 1WF9A 2G4DB 2ZNVB 4FJYA 5LXHA 2C5LC 2IO0B 3ZVVA 4DK5A 2B3AA 2GOWA 2G3QB 2JRHA 4HXDA 4BKSA 5C1ZA 4J6IA 1TBEA 3AXCA 3PT2B 1V2YA 1GC7A 1OTRB 2MBBB 2M8SA 4MGIE 2EMTA 1EF5A 2DZJA 4A20A 4DBGA 3ZRFA 2JVCA 1X1MA 4ANVA 2DX5B 2YVCA 4W9FA 2MSED 2FCSA 5HKHA 4II2B 4IC7B 3VTUA 3X23A 2LRUA 2ZJDA 1EF1A 1S1QB 3QJZA 4M8MA 3VUYA 3ECIA 2N9EB 2O6VA 2CU1A 2LVPA 3L16A 4MJSA 3QK0A 2KNBA 2R2QA 4AUQC 2BYFA 1G6JA 4KDIC 1WXAA 3V61A 1ZKHA 2GBJA 3IHPC 3ZIMA 1E7VA 2L7RA 1Z2MA 2DAFA 2KTRB 4EOYA 3IVFA 1EO6A 3UIOB 2V3SA 2BWES 1H8CA 1WX7A 2LZ6A 5AZHA 4EZKA 2CR5A 3QWZB 3QAQA 5AZGA 3EHVA 1WMHB 4K7UA 2MBOA 4EZLA 2NS5A 5FR6A 3DVNV 4B95A 1U4AA 3DPDA 3T8MA 3V62A 3I3TB 1UBIA 3X0WA 2ASQA 2MBQA 3RZFA 2FCQA 1Y8RC 2NBUA 1V86A 1S3SG 2N1VA 2KFJA 2NVUI 1ZGUB 4FA6A 4TUUA 2KQSA 1P9DU 2Z0DB 4WWOA 1J8CA 3R66C 4EFOA 3H6NA 4IM2A 4B9KA 4RM9A 4I6LB 5AEKB 4FJZA 1ISNA 4PS8A 1R4MI 3KH0A 4PYZA 2VRRB 4NQKE 4I6NB 3A9JA 4GN1A 2FAZA 4NAWA 1WMHA 1L7YA 1VD2A 2Z59B 1V5OA 5E6PA 2FUHB 4ZRKA 2AEHA 2KKCA 2FCMA 3DBHI 4X57B 2M0XA 3DBLI 1WJ6A 2KN5A 3Q3JA 4KZ0A 4W9GA 3DVGX 3HHMA 3DBRI 1WXMA 2CS4A 3JSVB 4IWOA 5D7GA 4HLEA 3BINA 1FXTB 3V60A 2HTHA 3WAMA 3OLMD 1YD8U 2GBKA 3DQVA 2KC1A 1E7UA 4A3OA 3M62B 1WZ0A 5DPTA 4P7IA 1E90A 4W9IA 4NJ6A 3UIPB 5G2NA 4NAWB 4MSMB 5C23A 4CHKA 2MRPA 3KUDB 3N30A 1E5WA 4PYUA 3ZNZB 4DDGD 4E74A 3OJ4B 4ZYNA 3ONSA 2D2QA 4GDLA 2GBRA 2LUEA 2FIDA 1WXVA 4LCDE 2C60A 3HM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IW0 A;  2KZR A;  2L76 A;  3HM6 X;  2LVQ A;  1WM2 A;  4NQL B;  1PQS A;  2JUO A;  2LWP A;  3L10 B;  3QHT A;  4PS3 A;  2DZK A;  1WGH A;  1WR1 A;  2IY1 B;  4GSW A;  1P0R A;  4URK A;  2RPQ A;  3PLV A;  3PPA A;  4WWP A;  4GDK A;  2KWU B;  3RCZ A;  4B6W A;  2DEN B;  1WR6 E;  3T9L A;  2D07 B;  2PEA A;  3QQ8 B;  3TJP A;  4AJY B;  2ZEQ A;  2KTR A;  1WYW B;  3AU4 A;  2BGF A;  1RFA A;  3WIM A;  2KHW B;  3A1Q A;  3CF6 E;  2LXC A;  5BO4 B;  3DOW A;  2GBM A;  3A9K B;  2ZPN A;  4A3P A;  1C3T A;  1IYF A;  4GB9 A;  3ZNH B;  5JZE B;  3RD2 A;  1Q5W B;  2KDE B;  2RGF A;  1IP9 A;  3PSE B;  4AP4 C;  3K9P B;  3KVF B;  2BPS A;  2KO3 A;  5LLI A;  2KLC A;  4ANX A;  2XEW A;  3VTW A;  3UQA A;  2OJR A;  4IUM B;  3ZUN A;  1V9J A;  2KQ7 A;  2L8J A;  2M17 A;  3ZNI D;  3JYU A;  3ZRC A;  2MP2 B;  1UBQ A;  2ZNV C;  2N4F A;  2MW5 A;  1WFY A;  2O2V B;  4MSQ B;  4IWP A;  4KIK A;  1OEY J;  4GOC A;  1YX6 B;  2ZPY A;  4MGY E;  1OQY A;  1WE7 A;  4WJO A;  3VFK A;  1YX5 B;  2FCN A;  2NR2 A;  4MDK E;  1F9J A;  3U8Z A;  3W1Y A;  3UQB A;  1WGY A;  4FN2 A;  2KLG A;  3S2A A;  4ZDV A;  2KC2 A;  4HDQ A;  4HPM B;  1GUA B;  1GG3 A;  2RD0 A;  3HIZ A;  3L08 A;  3ZKJ C;  4BKS D;  3RUL A;  4AOF A;  2WWZ A;  2BKR B;  3B1L X;  1A5R A;  3M3J A;  2MCN B;  2G4S A;  2K8B A;  1MG8 A;  2UWQ A;  3A4R A;  1UGM A;  1UZX B;  2LD9 A;  3AI5 A;  3DVG Y;  3ZW3 A;  5CTR C;  3QX1 A;  1WJU A;  1WJN A;  2O6V B;  5L83 A;  2N9P C;  3A9J B;  4JGH B;  3MTN B;  4WJQ A;  4CYE A;  2K6D B;  5TR5 A;  4DDI D;  2IO1 B;  4LJP B;  5DPR A;  1V5T A;  2EMS A;  5JHA A;  3PHW B;  2K8H A;  3H7P A;  4E3C A;  1E8Z A;  1RAX A;  2Z0E B;  3M95 A;  5IAA C;  4ANU A;  1M94 A;  3O65 B;  3NS8 A;  1R4N I;  3APC A;  1J0G A;  3AUL A;  5E6N A;  2KVR A;  5EDS A;  1KLV A;  2MBH A;  4EKU A;  4FAD A;  1TTN A;  3A33 B;  3PZD A;  2ZCC A;  3LDZ E;  4MJS B;  1LFD A;  2JPH A;  3B0A A;  4IG7 B;  2AYO B;  2KWC A;  3APF A;  4MH0 E;  1NDD A;  2LGY A;  3VXW A;  5CHF A;  2DZI A;  1ZW7 A;  2WX1 A;  2K6Q A;  2MWS B;  3SU8 X;  3UGB B;  4K7W A;  4MGK E;  4HDO A;  4YL8 A;  3ZO5 B;  4F1S A;  4LDT D;  5G55 A;  4EEW A;  2EKE C;  3CMM B;  4FHJ A;  3ZTD A;  3RZW C;  1JRU A;  3N32 A;  3QA8 A;  4G50 A;  4HWI B;  3L13 A;  1D3Z A;  4GMV A;  2DZM A;  1QZE A;  4BOS C;  4BVU C;  4HVB A;  1E8Y A;  2J0J A;  3NZS A;  2NBV B;  2JT4 B;  2BKF A;  3CST A;  2KDB A;  2AL6 A;  2AL3 A;  3TCA A;  2FNJ B;  1Q0W B;  4NNJ B;  1E8X A;  1XT9 B;  4KZC A;  2DYO A;  1NBF C;  1V6E A;  2BWF A;  3JVZ X;  4II3 B;  4HJK A;  4W9E A;  2LRW A;  4WQO B;  2D3G A;  2L3Z A;  2PE9 A;  4EUT A;  2XK5 A;  3EC8 A;  1SIF A;  2IBI B;  1P3Q U;  2KXJ A;  1KJT A;  2ZZP B;  5J17 A;  4XZ4 A;  2LAS A;  4HCP B;  4RM8 A;  3VH3 B;  1H4R A;  1WE6 A;  3MHS D;  1Z5S B;  2W9N A;  3B08 A;  3VTV A;  4ANW A;  3RUI B;  2UYZ B;  2D10 A;  3M63 B;  3L0W B;  3DVN U;  3N3K B;  3LJ3 A;  4WJN A;  2WDT B;  3KYD D;  1YJ1 A;  3PRZ A;  1WGD A;  2KX3 A;  3V6C B;  4GXB A;  2NCN A;  2KFK A;  4IM3 A;  4KSL C;  2BYV E;  1KOT A;  2V4L A;  1HE8 A;  3PGE A;  1RRB A;  3NY5 A;  1WGG A;  4WAA A;  4XC2 A;  2DYM A;  3PRP B;  3PVL A;  4K7S A;  1RLF A;  2REX A;  4K1R B;  4JLC A;  2JZ3 B;  4LJO B;  5D2M B;  3U7D A;  4KV2 A;  3WAN A;  1VCB A;  2PJH A;  2O2V A;  2JWZ A;  5GMV A;  2QHO A;  3A1Q B;  1WX9 A;  4DWF A;  4LDT B;  4ZRJ A;  2C7H A;  1GNU A;  4BKT A;  1GJZ A;  3QC8 B;  2C7M B;  4NPN A;  3W1S C;  3WA0 A;  3AU5 A;  4BBN F;  2KWV B;  3K9O B;  2C7N B;  1V49 A;  4M0W B;  4W9K A;  4MM3 A;  1WX8 A;  2DAJ A;  4WWN A;  3WAP A;  3H7P B;  5JH5 C;  2HJ8 A;  2N7D A;  2NBW B;  2KD0 A;  4BOZ B;  3L54 A;  4FJV B;  4W9H A;  1UH6 A;  4PS7 A;  2JXX A;  1LXD A;  2MP2 A;  4IWQ A;  3VAW A;  1WI0 A;  3QIJ A;  2KFK B;  4NJ7 A;  4HK2 A;  5KHO A;  2FIF A;  2NPT A;  2LVO A;  2BF8 B;  1WH3 A;  2CHZ A;  1GC6 A;  4JL9 A;  4GU2 A;  4KSK C;  1LQB A;  3GOE A;  3V6E B;  4GDL B;  1E8W A;  2MQJ A;  3DCG A;  2JRI B;  3SHQ A;  1CMX B;  4GDK B;  4ASW C;  3IBE A;  4BFR A;  3ZTC A;  2I1K A;  3A4S C;  5D94 A;  3QAR A;  4OVV A;  2A4Z A;  4RMA A;  1OEY A;  3A9K A;  4W9L A;  4G0N B;  4JQW C;  2G45 B;  1V80 A;  5DCN A;  4W9C A;  1I42 A;  2NPT B;  2JY6 A;  3JSV A;  2N9X A;  1WY8 A;  3VH4 B;  4ICU A;  2OOB B;  2J0M A;  1WGR A;  4GGQ A;  4FHK A;  2KDF B;  2ZCB A;  2Y5B B;  3OAW A;  3Q3F A;  4G11 A;  3ZDT A;  2MX2 A;  3ENE A;  3IG3 A;  3ZDM C;  4DHZ B;  2ZVO A;  3H1U A;  2LI5 A;  3KUZ A;  3R7Q A;  4GIV A;  2HE7 A;  2MLB A;  2K39 A;  2KOX A;  5KHQ A;  2YLM A;  4OVU A;  3VUX A;  2IO2 B;  5CHW A;  1EUV B;  3WAO A;  1UD7 A;  2IO3 B;  3ZNG C;  5DPW A;  2CHW A;  3KYC D;  2J7Q B;  2KMC A;  3H9D A;  2JZZ A;  1TZ1 A;  3R7R A;  2LXA A;  2KMA A;  3RT3 B;  3VUW A;  1C1Y B;  3HK0 A;  3ZLZ A;  4DXA B;  2KX0 A;  3PLU A;  2MA9 B;  4MEL A;  1SGH A;  2L05 A;  2R2O A;  3RYT A;  4I6P A;  2WYQ A;  2LJ5 A;  2M1M A;  1T0Y A;  1TGZ B;  2KJR A;  2CKH B;  1Q1O A;  3APD A;  4HCN B;  2KJ6 A;  5D6J B;  3D32 A;  2K1F A;  3VVW B;  4F7Z A;  3U30 A;  4IM0 A;  3PTF C;  1WZ3 A;  1WJ4 A;  5J18 A;  2KAN A;  4E71 A;  2LGD A;  2DHZ A;  3UIN B;  4MEM A;  2L00 B;  3SD5 A;  3GZN I;  4F8C B;  4WJP A;  2N7E A;  3DBS A;  1UEL A;  4M8N A;  1AAR A;  2XBB C;  1OGW A;  3ML8 A;  4KVG B;  5CX3 A;  3UF8 A;  4K81 A;  2KJH B;  3L17 A;  3OJ3 A;  3VDZ A;  4TV3 A;  2M4N A;  4G3X B;  4TKN A;  5DPS A;  3PV1 A;  4KDL B;  2DYB A;  3TBL D;  3CSF A;  1J19 A;  3NOB A;  4BKG A;  4DHJ B;  3ALB A;  1LM8 B;  3EEC A;  2XK5 B;  2I1J A;  4ZRI A;  3P2B A;  3SDL C;  4CO7 A;  2ZVN A;  2C9W B;  2MBE A;  2CHX A;  1WXS A;  1NI2 A;  5CHV C;  1K8R B;  2LGX A;  5E6O A;  3KUC B;  2IYD B;  4ICV A;  4BBN C;  4XX5 A;  2KTF A;  3NHE B;  4EZJ A;  3MJW A;  2HD5 B;  1WRD B;  3PRE A;  3TMP B;  4N9F 4;  5LXI B;  4TQ0 A;  3KW5 B;  2PPH A;  2K25 A;  5L95 C;  3VQI A;  3PHX B;  1L2N A;  1XD3 B;  1WM3 A;  1XQQ A;  2BYE A;  4HPL B;  2KDI A;  3QCA A;  3C0R B;  4DHZ E;  3TL5 A;  4FLH A;  4KIK B;  5JHB A;  1P98 A;  2D11 A;  1I35 A;  3WAL A;  2J0K A;  3PRM B;  3TIX A;  4AJW A;  4MGZ E;  2AWT A;  2A5U A;  2N1W A;  4JIO U;  2K8C A;  2GMI C;  3IFW B;  2IY0 B;  4NY0 A;  3NZU A;  5IA7 A;  2L0F A;  2WX0 A;  2O6V D;  4TQ1 A;  2KK8 A;  3EFU A;  4FUL A;  1BT0 A;  1IPG A;  3JW0 X;  3PS6 A;  5J2R A;  2JF5 A;  4DHJ D;  1YQB A;  2PE6 B;  1P1A A;  4W9D A;  2RSU A;  3DDC B;  3W1S A;  1YIW A;  1SE9 A;  3R3M A;  3VHT C;  3ML9 A;  2RR9 A;  3H7S A;  4FBJ B;  1KM7 A;  5AZF A;  2V1Y A;  4AWJ A;  2GBN A;  1V81 A;  2L0T A;  3BY4 B;  4W9J A;  1WIA A;  2IZV B;  1WF9 A;  2G4D B;  2ZNV B;  4FJY A;  5LXH A;  2C5L C;  2IO0 B;  3ZVV A;  4DK5 A;  2B3A A;  2GOW A;  2G3Q B;  2JRH A;  4HXD A;  4BKS A;  5C1Z A;  4J6I A;  1TBE A;  3AXC A;  3PT2 B;  1V2Y A;  1GC7 A;  1OTR B;  2MBB B;  2M8S A;  4MGI E;  2EMT A;  1EF5 A;  2DZJ A;  4A20 A;  4DBG A;  3ZRF A;  2JVC A;  1X1M A;  4ANV A;  2DX5 B;  2YVC A;  4W9F A;  2MSE D;  2FCS A;  5HKH A;  4II2 B;  4IC7 B;  3VTU A;  3X23 A;  2LRU A;  2ZJD A;  1EF1 A;  1S1Q B;  3QJZ A;  4M8M A;  3VUY A;  3ECI A;  2N9E B;  2O6V A;  2CU1 A;  2LVP A;  3L16 A;  4MJS A;  3QK0 A;  2KNB A;  2R2Q A;  4AUQ C;  2BYF A;  1G6J A;  4KDI C;  1WXA A;  3V61 A;  1ZKH A;  2GBJ A;  3IHP C;  3ZIM A;  1E7V A;  2L7R A;  1Z2M A;  2DAF A;  2KTR B;  4EOY A;  3IVF A;  1EO6 A;  3UIO B;  2V3S A;  2BWE S;  1H8C A;  1WX7 A;  2LZ6 A;  5AZH A;  4EZK A;  2CR5 A;  3QWZ B;  3QAQ A;  5AZG A;  3EHV A;  1WMH B;  4K7U A;  2MBO A;  4EZL A;  2NS5 A;  5FR6 A;  3DVN V;  4B95 A;  1U4A A;  3DPD A;  3T8M A;  3V62 A;  3I3T B;  1UBI A;  3X0W A;  2ASQ A;  2MBQ A;  3RZF A;  2FCQ A;  1Y8R C;  2NBU A;  1V86 A;  1S3S G;  2N1V A;  2KFJ A;  2NVU I;  1ZGU B;  4FA6 A;  4TUU A;  2KQS A;  1P9D U;  2Z0D B;  4WWO A;  1J8C A;  3R66 C;  4EFO A;  3H6N A;  4IM2 A;  4B9K A;  4RM9 A;  4I6L B;  5AEK B;  4FJZ A;  1ISN A;  4PS8 A;  1R4M I;  3KH0 A;  4PYZ A;  2VRR B;  4NQK E;  4I6N B;  3A9J A;  4GN1 A;  2FAZ A;  4NAW A;  1WMH A;  1L7Y A;  1VD2 A;  2Z59 B;  1V5O A;  5E6P A;  2FUH B;  4ZRK A;  2AEH A;  2KKC A;  2FCM A;  3DBH I;  4X57 B;  2M0X A;  3DBL I;  1WJ6 A;  2KN5 A;  3Q3J A;  4KZ0 A;  4W9G A;  3DVG X;  3HHM A;  3DBR I;  1WXM A;  2CS4 A;  3JSV B;  4IWO A;  5D7G A;  4HLE A;  3BIN A;  1FXT B;  3V60 A;  2HTH A;  3WAM A;  3OLM D;  1YD8 U;  2GBK A;  3DQV A;  2KC1 A;  1E7U A;  4A3O A;  3M62 B;  1WZ0 A;  5DPT A;  4P7I A;  1E90 A;  4W9I A;  4NJ6 A;  3UIP B;  5G2N A;  4NAW B;  4MSM B;  5C23 A;  4CHK A;  2MRP A;  3KUD B;  3N30 A;  1E5W A;  4PYU A;  3ZNZ B;  4DDG D;  4E74 A;  3OJ4 B;  4ZYN A;  3ONS A;  2D2Q A;  4GDL A;  2GBR A;  2LUE A;  2FID A;  1WXV A;  4LCD E;  2C60 A;  3HM3 A; 
#chains in the Genus database with same CATH topology
 1JWM D;  1ZXH A;  2KZR A;  2LVQ A;  1PQS A;  4PS3 A;  2LWP A;  3L10 B;  1WGH A;  2JQR B;  2LEK A;  4URK A;  3AH7 A;  4WWP A;  1R4M B;  4JE3 B;  3RCZ A;  1DYQ A;  1WR6 E;  4K3C A;  1XLN A;  4PK1 A;  4KGR A;  3VRB B;  2ZPN A;  1QLB B;  5JZE B;  1TKE A;  2J52 A;  3Q8C A;  3VTW A;  3SR6 A;  1V9J A;  2KQ7 A;  2M17 A;  2D3A A;  2PW9 A;  2ZNV C;  1SE3 A;  3IAM 1;  4MSQ B;  4IWP A;  1D5X C;  4WJO A;  3U8Z A;  4M02 A;  3UQB A;  2KLG A;  4C56 C;  3J9C A;  2WXK A;  3P4P B;  2RDH A;  1KRH A;  3KWL A;  3AED B;  1NVI D;  2WWZ A;  1L0V B;  1A5R A;  2K8B A;  2UWQ A;  2LD9 A;  3AI5 A;  4RGM A;  1WJU A;  1VJK A;  1MI0 A;  4JGH B;  4WJQ A;  3MTN B;  2KWD A;  1KFY B;  3M95 A;  3O65 B;  1TS5 A;  1JRP A;  4DXF A;  2K5P A;  1GPX A;  4S17 A;  4DQO C;  2MBH A;  3N1Z C;  3A33 B;  1NI3 A;  1QOG A;  1LGR A;  1I4R A;  4MH0 E;  1NDD A;  3I57 A;  2WX1 A;  2K6Q A;  5IO9 A;  3MC0 B;  3SU8 X;  4K7W A;  4MGK E;  4F1S A;  1TIF A;  1HXY D;  2KAJ A;  5G55 A;  4EEW A;  2I38 A;  5E6J A;  3ZTD A;  3HVD A;  3QA8 A;  4NJC A;  1DOY A;  3L13 A;  4HRO A;  3N1Y C;  1QZE A;  2D3C A;  2JT4 B;  1XLO A;  1XT9 B;  4MM3 B;  2DYO A;  2YEP B;  3KLS X;  4LNF A;  3NVV A;  1MPE A;  3TEZ A;  4A90 A;  4EUT A;  2JYE A;  1WGK A;  1P3Q U;  1KJT A;  2ZZP B;  4MAC A;  4DHJ D;  2WQY B;  3VTV A;  4PT5 A;  2UYZ B;  2D10 A;  3M63 B;  3N3K B;  1YJ1 A;  2JYT A;  3IAS 1;  5G5G A;  4YSZ B;  4BAX A;  4IM3 A;  2K3U A;  1T5X D;  1QQR A;  2BYV E;  2K0P A;  1PFD A;  1SJE D;  2REX A;  4K1R B;  2YEP F;  2RPV A;  3U7D A;  4KV2 A;  2BW2 A;  1V1P B;  3A1Q B;  1WX9 A;  1JW9 D;  4C7Z A;  2BS3 B;  2PTL A;  3QC8 B;  1KLU D;  4BBN F;  1FFV A;  2C7N B;  1WX8 A;  1QOB A;  4WWN A;  2OHF A;  1ZP0 B;  4FJV B;  3RNA C;  1UH6 A;  4OZA A;  1LXD A;  3VAW A;  3QIJ A;  4A6Q A;  2NPT A;  2DLB A;  4JL9 A;  4GU2 A;  1XCQ L;  4KSK C;  1WWT A;  4EE2 A;  1HEZ E;  4YT0 B;  3ZTC A;  2I1K A;  3A4S C;  1P7E A;  5D94 A;  2WXJ A;  1V97 A;  4GLS C;  3SFD B;  1C78 A;  2G45 B;  1V80 A;  4TSS A;  4AS1 A;  2MJD A;  1I42 A;  2JY6 A;  3VH4 B;  5EE0 A;  3T3N A;  2J0M A;  4GGQ A;  2DWQ A;  3IG3 A;  2K39 A;  2KOX A;  4OVU A;  5CHW A;  4HEA 1;  1EUV B;  3WAO A;  2IO3 B;  2WP9 B;  4CQN A;  3R7R A;  3RT3 B;  1VLB A;  4C7Y A;  5HG2 A;  3GZN B;  3KWV A;  2KX0 A;  3Q8B A;  3LB8 C;  4WQM A;  2WYQ A;  3BYY B;  1N5W A;  1P7F A;  2K1F A;  3VVW B;  3U30 A;  2AQ2 B;  1WZ3 A;  3LYY A;  3B2F A;  4E71 A;  2LGD A;  4P1C C;  1UEL A;  2XBB C;  3IXS A;  1OGW A;  4J3O D;  1L5P A;  3NZ3 A;  1YN4 A;  2MHJ A;  4TKN A;  3ALB A;  2XK5 B;  3SDL C;  2WDR B;  4CO7 A;  1AYF A;  2C9W B;  2MBE A;  5CHV C;  1K8R B;  4ICV A;  2KAC A;  3PRE A;  3TMP B;  1XEE A;  2WU2 B;  1TY2 A;  2W54 A;  1OFF A;  3Q2A C;  3Q3O C;  1WM3 A;  1XQQ A;  3C0R B;  4FLH A;  4KIK B;  1I35 A;  2WHI A;  1XO3 A;  1ET9 A;  2J0K A;  1T0S C;  4AQ7 A;  1KH0 A;  2EEL A;  2BB6 A;  4AJW A;  2AWT A;  1EU3 A;  3VR8 B;  2QEJ C;  2L0F A;  1VZ6 A;  2O6V D;  1UF0 A;  3EFU A;  1BT0 A;  3JW0 X;  5J2R A;  2JF5 A;  2PE6 B;  2PKO A;  3W1S A;  1YIW A;  4Q2J A;  3R3M A;  2IGD A;  1KM7 A;  2GI9 A;  2WXP A;  1FPY A;  1WF9 A;  2ZNV B;  4A55 A;  1GOZ A;  2C5L C;  3ZVV A;  1QIL A;  2EKI A;  4RGN A;  3ZGZ A;  4HXD A;  1HA5 A;  3BWU D;  4A8X C;  3DHG C;  3U52 E;  1FFU A;  1ZOY B;  1OTR B;  1EF5 A;  5JXV A;  2FCS A;  1JWU D;  3VTU A;  2AX5 A;  2L83 A;  2PVG C;  3DHH C;  1UWM A;  3ECI A;  4MJS A;  2LVP A;  3QK0 A;  3KQ4 A;  2KNB A;  4AUQ C;  3FIL B;  4B0M A;  4EOY A;  3ZIM A;  2Y5P A;  1EO6 A;  2BWE S;  1H8C A;  3AEB B;  4EZK A;  4K7U A;  4EZL A;  1K53 A;  4XDD A;  5FR6 A;  3C8Y A;  3AEC B;  3T8M A;  3BYT B;  3W5V B;  1B1Z A;  2NBU A;  1V86 A;  3MC9 A;  4XWT A;  2INN E;  1P9D U;  2KQS A;  1FRR A;  3R66 C;  4EFO A;  2RDB C;  3H6N A;  5AEK B;  4FJZ A;  4PS8 A;  4PYZ A;  4US9 A;  5FR3 A;  4I6N B;  4REZ A;  4K3B A;  2KKC A;  2KN5 A;  3Q3J A;  3HHM A;  2CS4 A;  4HLE A;  3V60 A;  1YOV B;  2HTH A;  3OLM D;  1YD8 U;  2W82 A;  1F2R I;  1IGC A;  1WZ0 A;  5DPT A;  1I4H A;  2QDF A;  4NJ6 A;  3NG0 A;  2ZW0 A;  4NAW B;  4FXC A;  4DDG D;  4E74 A;  3OJ4 B;  2LUE A;  2KN4 A;  3HRD D;  4MT5 A;  4G11 A;  3HM3 A;  3SFE B;  3B9J A;  2L76 A;  3HM6 X;  1ZDV A;  1BXT A;  1WR1 A;  2IY1 B;  1P0R A;  4GDK A;  3BVZ A;  4B6W A;  2DEN B;  3T9L A;  1EWY C;  3R8B A;  3Q69 A;  2ZEQ A;  2KTR A;  1WYW B;  2KHW B;  1MG4 A;  3CF6 E;  3DOW A;  3A9K B;  5IKC M;  4DXG A;  1C3T A;  2BPS A;  4ANX A;  2KLC A;  2SEB D;  2KDM A;  4IUM B;  2L8J A;  4KKJ A;  1VZ8 A;  2MP2 B;  2N4F A;  3RPF C;  2MW5 A;  4MGY E;  2CJO A;  1YX5 B;  1F9J A;  2BVC A;  1FXA A;  4FN2 A;  3S2A A;  3AEF B;  1GG3 A;  3RUL A;  4OVZ A;  4AOF A;  4NZL B;  4L23 A;  3A4R A;  1UZX B;  5CTR C;  2K9X A;  4RH6 A;  2O6V B;  3A9J B;  1RWS A;  4DDI D;  2IO1 B;  4LJP B;  2Z0E B;  4ANU A;  3RFZ B;  1MHX A;  2M19 A;  1F0Z A;  1J0G A;  3AUL A;  1KLV A;  3NVY A;  3LDZ E;  3B0A A;  4IG7 B;  1E0Z A;  1D6E C;  3W9C B;  3VXW A;  5CHF A;  2MWS B;  3AEE B;  1AWD A;  4LDT D;  3Q14 C;  1C9F A;  2IND C;  1MVK A;  1N5X A;  2WXN A;  4HWI B;  1N61 A;  1I7H A;  3NZS A;  1EWC A;  1JRO A;  1MJD A;  1FIQ A;  2RDG A;  1GB1 A;  1KF6 B;  2FNJ B;  3ZXV A;  1Q0W B;  1E8X A;  1FCC C;  4KZC A;  3JVZ X;  2KYW A;  2BWF A;  4II3 B;  1L4Z B;  2LGS A;  4IKG A;  4W9E A;  2LRW A;  2D3G A;  4RGT A;  1YNT E;  1TS4 A;  1QT9 A;  3EC8 A;  1SIF A;  3AE1 B;  2KXJ A;  3HUI A;  4HCP B;  1RM6 C;  3MHS D;  3B08 A;  4ANW A;  3ZQ4 A;  4YTM B;  2AQ1 B;  2WDT B;  3KYD D;  4LNI A;  2NCN A;  5IOI A;  2KFK A;  4ARI A;  4USA A;  4KSL C;  1AW7 A;  1HE8 A;  3ETR A;  3MHZ A;  4WAA A;  1K52 A;  1RLF A;  4JLC A;  4LJO B;  2QSD A;  1Y56 A;  2PJH A;  2O2V A;  3IT6 B;  2QHO A;  4DWF A;  1L0Y B;  4LDT B;  4ZRJ A;  1RYJ A;  3PZ7 A;  4HKQ A;  2C7M B;  1XXG A;  3W1S C;  2VH1 A;  4M0W B;  4MM3 A;  2DAJ A;  2WXF A;  1ZXI A;  3WAP A;  1YN5 A;  3H7P B;  1FD6 A;  2NBW B;  5TSS A;  2KD0 A;  3L54 A;  4W9H A;  1J7A A;  1HQR D;  2JXX A;  2KFK B;  4NJ7 A;  4HK2 A;  1FCL A;  2LVO A;  1WH3 A;  2JXT A;  3V6E B;  2G1E A;  3NRZ A;  3SHQ A;  1CMX B;  4GDK B;  4ASW C;  3IBE A;  1KTK A;  3AEG B;  4RMA A;  1OEY A;  3RNE C;  2NPT B;  2X8X X;  3JSV A;  1SSN A;  1RFK A;  2OOB B;  3ENE A;  3UI3 A;  4DHZ B;  2ZVO A;  2W55 A;  2IGH A;  5KHQ A;  4JWS C;  2INP E;  1FO4 A;  2KMM A;  2KMC A;  3H9D A;  1JWS D;  3P1M A;  1C1Y B;  1N62 A;  3HK0 A;  2H88 B;  4OZC A;  1SJH D;  2WNM A;  5HFY A;  3ZJT A;  4IDI A;  2MA9 B;  2R2O A;  3LXF A;  3RYT A;  3TEX A;  2LJ5 A;  1T0Y A;  1TGZ B;  1TJE A;  2CKH B;  3D32 A;  2IGG A;  3PTF C;  1WJ4 A;  2DHZ A;  3UIN B;  2L00 B;  3NS1 A;  1E7P B;  1HTQ A;  2HJ1 A;  3UF8 A;  5CX3 A;  2TSS A;  4K81 A;  3L17 A;  3OJ3 A;  1C77 A;  1MFW A;  3AE6 B;  3PV1 A;  4KKI A;  3AV8 A;  3NOB A;  4DHJ B;  3P2B A;  2ZVN A;  2CHX A;  3RNG C;  1NI2 A;  3KUC B;  2IYD B;  4L1B A;  2KTF A;  4EZJ A;  2PLP A;  3I63 C;  3MJW A;  2HD5 B;  2INC C;  1YQ4 B;  4N9F 4;  4TQ0 A;  1L2N A;  1XD3 B;  4HPL B;  1F52 A;  2V3N A;  3QCA A;  1P98 A;  3NVW A;  1DOX A;  3PRM B;  4MGZ E;  2BT6 A;  2A5U A;  2N1W A;  5FK9 C;  3IFW B;  1F2R C;  3AE9 B;  2WX0 A;  5IA7 A;  1FNV A;  1IPG A;  1SE4 A;  4W9D A;  2RSU A;  1SE9 A;  2RR9 A;  3H7S A;  3EGR A;  2V1Y A;  4AWJ A;  1I4G A;  2WXG A;  3BY4 B;  4W9J A;  2IZV B;  3GB1 A;  2IO0 B;  3RNB C;  1N60 A;  2B3A A;  1D4B A;  4J6I A;  3B2G A;  3N20 C;  5BYQ A;  3AXC A;  3U4E G;  1CQV A;  2LUM A;  1GC7 A;  1JWA D;  2M8S A;  2FBW B;  4A20 A;  2DZJ A;  3Q3M C;  4DBG A;  4HRS A;  2JVC A;  4ANV A;  1FRD A;  4W9F A;  2MSE D;  4II2 B;  4IC7 B;  4MH8 A;  1TZO A;  2ZJD A;  2XNA C;  3AM9 A;  4D2K A;  4KDI C;  1WXA A;  4HPP A;  3IHP C;  2L7R A;  2KTR B;  5G5H A;  3NJT A;  1WX7 A;  1C76 A;  4YSY B;  5AZH A;  3QWZ B;  4OZB A;  5AZG A;  2NS5 A;  1STE A;  3V62 A;  2N0S B;  3RZF A;  4L2Y A;  2SAK A;  1S3S G;  2KFJ A;  2N1V A;  2NVU I;  1ZGU B;  2V0G A;  4ZRQ A;  2Z0D B;  3FIL A;  4IM2 A;  4B9K A;  1R4M I;  1FNW A;  2LJI A;  2WXQ A;  2D3B A;  1A70 A;  5E6P A;  1UGJ A;  4ZRK A;  2AEH A;  2FCM A;  3TUO A;  2M0X A;  4S0R A;  4W9G A;  3U2S C;  3DBR I;  3JSV B;  5D7G A;  2LFI A;  3R2I A;  5BMG A;  1FXT B;  1XLP A;  2LMC A;  3E56 A;  2GBK A;  4YWG G;  1E7U A;  1L0X B;  5LNK 1;  4P7I A;  1ROE A;  5G2N A;  2LHD A;  2KVZ A;  4XE0 A;  1IGD A;  1J7C A;  4MSM B;  5C23 A;  4CHK A;  4ZYS A;  2GB1 A;  3KUD B;  2G9H D;  3ZNZ B;  2GBR A;  2E3T A;  2C60 A;  1GB4 A;  1XCT L;  4NQL B;  3HVZ A;  3W5U B;  4GSW A;  2M0A A;  3PPA A;  2WXO A;  3FKY A;  2KWU B;  3NVZ A;  1CZP A;  2PEA A;  3QQ8 B;  3TJP A;  4AJY B;  5C3J B;  2ICI A;  3GS2 A;  3AU4 A;  3P4S B;  2QC8 A;  5C2T B;  2LXC A;  5BO4 B;  1F1H A;  3U7Z A;  4A3P A;  3ZYY X;  2KDE B;  2RGF A;  3PSE B;  4M01 A;  1R7S A;  2WXH A;  1QKZ A;  4RNA A;  5LLI A;  1R4N B;  1SXT A;  3UQA A;  1L6V A;  4N6E B;  4JWU C;  3ZNI D;  1UBQ A;  1N6Z A;  4C4V B;  2IDY A;  1WFY A;  4KIK A;  1OEY J;  1WE7 A;  2NR2 A;  2FCN A;  4MDK E;  3W1Y A;  1WGY A;  4ZDV A;  2KC2 A;  4HDQ A;  2RD0 A;  3L4P A;  2DNF A;  1WRI A;  3B1L X;  2BKR B;  3BZD B;  2MCN B;  2G4S A;  1MG8 A;  1Q10 A;  4RFB A;  4XYC A;  4BZA A;  3DVG Y;  3ZW3 A;  2K6D B;  4YTN B;  3AE5 B;  2JU6 X;  5DPR A;  5TR5 A;  1V5T A;  2EMS A;  2VZK D;  3PHW B;  4US8 A;  3H7P A;  1E8Z A;  5IAA C;  3P63 A;  3NS8 A;  2PIA A;  3APC A;  3V05 A;  5E6N A;  3MJ5 A;  1PGB A;  4EKU A;  1TTN A;  3PZD A;  2ZCC A;  4MJS B;  4QAY A;  1LFD A;  1UWX A;  2AYO B;  2KWC A;  1K50 A;  3CIR B;  4WIP A;  1N63 A;  3UGB B;  2WGS A;  2UU7 A;  4HDO A;  1T0R C;  3TEW A;  3AMZ A;  1J7B A;  4JPS A;  2EKE C;  4FHJ A;  3AE4 B;  3N32 A;  4G50 A;  2FE8 A;  2DZM A;  4BOS C;  4BVU C;  4HVB A;  1E8Y A;  2NBV B;  1ENF A;  2AL6 A;  3TEY A;  2AL3 A;  4LTU A;  1NBF C;  1V6E A;  1TY0 A;  2J42 A;  4HJK A;  5H8Y E;  4WQO B;  2L3Z A;  2BS4 B;  2AQ3 B;  2XK5 A;  4LNO A;  5BMH A;  1F77 A;  2WXR A;  1ESF A;  3VH3 B;  1H4R A;  1WE6 A;  1V8C A;  2QJL A;  2W9N A;  3RUI B;  1YN3 A;  3LJ3 A;  3T3O A;  1WGD A;  2L32 A;  1E9M A;  2OJW A;  4GXB A;  1KOT A;  3GP7 A;  1E6E B;  1T3Q A;  1RRB A;  2WDQ B;  3NY5 A;  1WGG A;  2DYM A;  3PRP B;  3PVL A;  4RF0 A;  2JZ3 B;  3WAN A;  2C7H A;  3WA0 A;  3Q6B A;  3K9O B;  2WXI A;  4W9K A;  1V49 A;  1XF5 L;  5JH5 C;  2HJ8 A;  4BOZ B;  3GE8 C;  4KGT A;  2WXM A;  3EA6 A;  1NYR A;  4IWQ A;  1WI0 A;  5KHO A;  1TKY A;  2FIF A;  2BF8 B;  2CHZ A;  1GC6 A;  3AE8 B;  1TYG B;  3GOE A;  3BK1 A;  2MQJ A;  2VH2 A;  3MC8 A;  2PMV A;  4OVV A;  3A9K A;  3AE3 B;  4W9L A;  5D3I B;  4G0N B;  4JQW C;  3AE2 B;  1E10 A;  4XDC A;  2N9X A;  1WY8 A;  2QMT A;  3BVM A;  1SB3 C;  2ZCB A;  3Q3F A;  2Y5B B;  3OAW A;  3ZDT A;  4OW0 A;  2MX2 A;  3ZDM C;  1QOA A;  3KUZ A;  3R7Q A;  4GIV A;  2JWU A;  2MLB A;  2YLM A;  1T6B X;  2WS3 B;  3VUX A;  2IO2 B;  5DPW A;  3KYC D;  2J7Q B;  5BYS A;  2JZZ A;  1TZ1 A;  5BYR A;  1HZ5 A;  4DXA B;  2RMM A;  1PDX A;  2NMQ A;  2QIL A;  4P1B C;  3PLU A;  2L05 A;  4I6P A;  2M1M A;  1IUE A;  3APD A;  4HCN B;  2KJ6 A;  4F7Z A;  3Q8E A;  1WXQ A;  4MEM A;  3I9V 1;  3SD5 A;  1EU4 A;  2N7E A;  3DBS A;  4P6V F;  4WWM A;  5GXG B;  3ML8 A;  1YMH E;  2H89 B;  1VRA B;  4TV3 A;  2M4N A;  4G3X B;  3V3X A;  5DPS A;  1JQ4 A;  2BB5 A;  1WYG A;  4ACF A;  1FM0 D;  4BKG A;  3EEC A;  2I1J A;  1XLQ A;  2KQ4 X;  1WXS A;  2VZK B;  3NUH B;  4BBN C;  4XX5 A;  3NHE B;  3MFG A;  1TT5 B;  1WRD B;  3KW5 B;  1I4Q A;  5IP4 D;  2CJN A;  5MPO A;  4DHZ E;  2XN9 C;  2D11 A;  3WAL A;  4JIO U;  1FNU A;  2K8C A;  4NY0 A;  3OG5 A;  2IY0 B;  3CWI A;  4P16 A;  4FUL A;  1QOF A;  3PS6 A;  1YQB A;  1QF6 A;  1PUT A;  3DDC B;  3VHT C;  2V3P A;  2IJ0 A;  5AZF A;  1JAL A;  1V81 A;  1BML C;  3IT4 B;  4FJY A;  5LXH A;  4DK5 A;  5FKA C;  1T0Q C;  5C1Z A;  1TBE A;  1HTO A;  2MBB B;  1UUP A;  4MGI E;  5HHD G;  3FC4 A;  2CU3 A;  2DX5 B;  2LRU A;  1EF1 A;  2Y5C A;  5EE1 A;  1YJJ A;  2O6V A;  3L16 A;  2R2Q A;  5EE9 A;  2ZW1 A;  3V61 A;  2GBJ A;  2WLB A;  1E7V A;  1I4X A;  1Z2M A;  2DAF A;  2JSV X;  3UIO B;  2V3S A;  3RMK C;  1CJE A;  2LZ6 A;  3PZ8 A;  3QAQ A;  3EHV A;  1WMH B;  5T8I A;  2MBO A;  2WDV B;  4B95 A;  1U4A A;  3DPD A;  1YQ3 B;  3I3T B;  2ASQ A;  2MBQ A;  4H2A A;  4N59 A;  1Y8R C;  4FA6 A;  2B76 B;  3SEB A;  4JX1 C;  1J8C A;  4M00 A;  3VRA B;  4I6L B;  3EUB 2;  3Q8F A;  3KH0 A;  5IN7 A;  3A9J A;  2BTE A;  1TKG A;  4GN1 A;  1CK1 A;  1L7Y A;  1VD2 A;  1B9R A;  1V5O A;  1NEN B;  1DGJ A;  4X57 B;  3DBL I;  4KZ0 A;  5I4D A;  1WXM A;  3O13 A;  3BIN A;  3WAM A;  2KC1 A;  4ZHP A;  2J53 A;  2Q5W D;  3UIP B;  1VR9 A;  1E5W A;  4RF1 A;  3DWM A;  4ZYN A;  3ONS A;  4GDL A;  1PGA A;  1TS3 A;  1EM7 A;  4NAM A;  2FID A;  4A9A A;  1ZUD 2;  4IW0 A;  1UNS A;  1WM2 A;  2JUO A;  3QHT A;  2PVO D;  2W3R A;  2DZK A;  2RPQ A;  3PLV A;  2D07 B;  2L52 A;  1ET6 A;  4N58 A;  1L6U A;  4WUR A;  2BGF A;  1RFA A;  3WIM A;  1V1P A;  3A1Q A;  2GBM A;  4UDU C;  1IYF A;  1I4P A;  4GB9 A;  3ZNH B;  3RD2 A;  1Q5W B;  1IP9 A;  3RI7 C;  4AP4 C;  3K9P B;  3KVF B;  2Y3A A;  2KO3 A;  1BUI C;  2XEW A;  4IOI E;  2V4I B;  1SE2 A;  2OJR A;  3ZUN A;  3ZRC A;  3JYU A;  2BQQ A;  2O2V B;  1OQQ A;  4RCO A;  4GOC A;  1YX6 B;  2ZPY A;  3VFK A;  1OQY A;  5H92 C;  3DBL B;  3C19 A;  1SBB B;  4M0W A;  4HPM B;  1GUA B;  3HIZ A;  3ZKJ C;  3L08 A;  3WCQ A;  3DHI C;  2GLS A;  3URY A;  4BKS D;  3EFC A;  1JCK B;  3M3J A;  4RGO S;  2GRI A;  1UGM A;  3QX1 A;  5D3D A;  4YTP B;  5AUI A;  1WJN A;  5L83 A;  2FUG 1;  2N9P C;  4CYE A;  2NTS A;  3Q3N C;  5JHA A;  2K8H A;  4XGA B;  4E3C A;  1RAX A;  1M94 A;  2LHE A;  1R4N I;  2MEK A;  3RN9 C;  3RNC C;  3DBH B;  2KVR A;  5EDS A;  4FAD A;  2JPH A;  3P42 A;  3APF A;  4O1N A;  2LGY A;  3AB5 A;  2OED A;  2DZI A;  1ZW7 A;  1KLG D;  4YL8 A;  3ZO5 B;  4WAF A;  1FMA D;  3TSS A;  4C80 A;  1SEB D;  4ARC A;  3CMM B;  1PYW D;  3RZW C;  1JRU A;  1D3Z A;  4GMV A;  1IBX B;  2J0J A;  3CST A;  2BKF A;  2KDB A;  3TCA A;  4R3D A;  4NNJ B;  3OWE B;  2D5G A;  4LLG M;  4LNK A;  1ZDX A;  1D5M C;  4YXD B;  3PO0 A;  2PE9 A;  3GE3 C;  2IBI B;  2IPK D;  4LK0 M;  5J17 A;  4XZ4 A;  2LAS A;  4RM8 A;  1FXI A;  1Z5S B;  2ACZ B;  2L1A A;  3L0W B;  3DVN U;  4WJN A;  2QCZ A;  2M56 B;  3PRZ A;  2KX3 A;  3V6C B;  2V4L A;  1C79 A;  3PGE A;  2E6X A;  4XC2 A;  4K7S A;  1HZ6 A;  1SIJ A;  5D2M B;  1VCB A;  2R61 A;  2JWZ A;  5GMV A;  1TS2 A;  3Q8A A;  3VR9 B;  1DOI A;  2K22 A;  1VDV A;  1GNU A;  4BKT A;  1GJZ A;  1AN8 A;  1JWB D;  4NPN A;  4TMA B;  3AU5 A;  2KWV B;  4YSX B;  2WXL A;  4C00 A;  2N7D A;  4PS7 A;  2MP2 A;  3ZXR A;  1LQB A;  4GDL B;  1E8W A;  3DCG A;  2JRI B;  4BFR A;  4B0E A;  3QAR A;  2A4Z A;  5DCN A;  3AEA B;  4W9C A;  4ICU A;  1WGR A;  4FHK A;  2KDF B;  3FAH A;  3H1U A;  5BMI A;  2LI5 A;  2Z8L A;  2HE7 A;  4C4V A;  3AE7 B;  2DBY A;  1UD7 A;  3ZNG C;  2CHW A;  2LXA A;  2KMA A;  3VUW A;  3ZLZ A;  1MHH E;  4LNN A;  4MEL A;  1SGH A;  5EE3 A;  2KJR A;  1Q1O A;  5D6J B;  3DBR B;  4IM0 A;  3MP9 A;  5J18 A;  3ZJU A;  2KAN A;  3AN1 A;  3GZN I;  4F8C B;  4WJP A;  1V1O A;  3W2D A;  4M8N A;  1AAR A;  2JX5 A;  2N9K A;  4KVG B;  2KJH B;  3VDZ A;  3N9Y C;  4KDL B;  2DYB A;  3TBL D;  3CSF A;  2BBC A;  1J19 A;  1D5Z C;  1WSP A;  3H8H A;  1LM8 B;  4ZRI A;  2W3S A;  2LGX A;  5E6O A;  1M4V A;  1JML A;  1NYQ A;  5LXI B;  2PPH A;  4ITK A;  2K25 A;  5L95 C;  3VQI A;  3PHX B;  2BYE A;  4ZHO A;  2KDI A;  2I2Y A;  1ACC A;  3TL5 A;  5JHB A;  1NEK B;  1LO5 D;  2NTT A;  3TIX A;  3BVG A;  2GMI C;  2BS2 B;  3NZU A;  4TQ1 A;  2KK8 A;  4WH4 A;  1P1A A;  2J4X A;  1ZPS A;  1YJI A;  3ML9 A;  1FEH A;  2MH7 A;  4FBJ B;  2GBN A;  4HKZ E;  2L0T A;  1WIA A;  3E9S A;  2N9L A;  2G4D B;  1GAQ B;  2HDE A;  2GOW A;  2LGI A;  2G3Q B;  2JRH A;  1IBX A;  4BKS A;  4XWW A;  4KGS A;  2MJ3 A;  3PT2 B;  1V2Y A;  2EMT A;  3P4Q B;  3BK2 A;  3ABV B;  1PGX A;  3ZRF A;  1X1M A;  2YVC A;  1C4P A;  5HKH A;  3P4R B;  2QIE B;  4ZRP A;  3X23 A;  2BYT A;  1S1Q B;  3QJZ A;  4M8M A;  1ZE3 D;  3VUY A;  2N9E B;  2CU1 A;  2BYF A;  3DWG C;  1C4A A;  2JZP A;  1G6J A;  2ONQ A;  1C4C A;  1ZKH A;  3ZJV A;  3IVF A;  2HTM E;  2CR5 A;  4KX6 B;  3N1X C;  4HJG E;  3RNF C;  3BII D;  3DVN V;  1UBI A;  3X0W A;  1L4D B;  2FCQ A;  1VZ7 A;  2X38 A;  4TUU A;  4WWO A;  4RM9 A;  1ISN A;  4OHJ A;  2VRR B;  4NQK E;  4NAW A;  2FAZ A;  1WMH A;  2Z59 B;  2FUH B;  2ON8 A;  2N7J A;  3DBH I;  1SF0 A;  1WJ6 A;  3DVG X;  3R2T A;  4IWO A;  1OQR A;  2MJE A;  3DQV A;  4A3O A;  3M62 B;  4ZOH C;  1E90 A;  4W9I A;  5AUK A;  5HI1 A;  2MRP A;  3N30 A;  2KT7 A;  4PYU A;  2V9H A;  1K51 A;  2D2Q A;  2WU5 B;  3I5J C;  1WXV A;  4LCD E; 
#chains in the Genus database with same CATH homology
 4IW0 A;  2KZR A;  2L76 A;  3HM6 X;  2LVQ A;  1WM2 A;  4NQL B;  1PQS A;  2JUO A;  2LWP A;  3L10 B;  3QHT A;  4PS3 A;  2DZK A;  1WGH A;  1WR1 A;  2IY1 B;  4GSW A;  1P0R A;  4URK A;  2RPQ A;  3PLV A;  3PPA A;  4WWP A;  4GDK A;  2KWU B;  3RCZ A;  4B6W A;  2DEN B;  1WR6 E;  3T9L A;  2D07 B;  2PEA A;  3QQ8 B;  3TJP A;  4AJY B;  2ZEQ A;  2KTR A;  1WYW B;  3AU4 A;  2BGF A;  1RFA A;  3WIM A;  2KHW B;  3A1Q A;  3CF6 E;  2LXC A;  5BO4 B;  3DOW A;  2GBM A;  3A9K B;  2ZPN A;  4A3P A;  1C3T A;  1IYF A;  4GB9 A;  3ZNH B;  5JZE B;  3RD2 A;  1Q5W B;  2KDE B;  2RGF A;  1IP9 A;  3PSE B;  4AP4 C;  3K9P B;  3KVF B;  2BPS A;  2KO3 A;  5LLI A;  2KLC A;  4ANX A;  2XEW A;  3VTW A;  3UQA A;  2OJR A;  4IUM B;  3ZUN A;  1V9J A;  2KQ7 A;  2L8J A;  2M17 A;  3ZNI D;  3JYU A;  3ZRC A;  2MP2 B;  1UBQ A;  2ZNV C;  2N4F A;  2MW5 A;  1WFY A;  2O2V B;  4MSQ B;  4IWP A;  4KIK A;  1OEY J;  4GOC A;  1YX6 B;  2ZPY A;  4MGY E;  1OQY A;  1WE7 A;  4WJO A;  3VFK A;  1YX5 B;  2FCN A;  2NR2 A;  4MDK E;  1F9J A;  3U8Z A;  3W1Y A;  3UQB A;  1WGY A;  4FN2 A;  2KLG A;  3S2A A;  4ZDV A;  2KC2 A;  4HDQ A;  4HPM B;  1GUA B;  1GG3 A;  2RD0 A;  3HIZ A;  3L08 A;  3ZKJ C;  4BKS D;  3RUL A;  4AOF A;  2WWZ A;  2BKR B;  3B1L X;  1A5R A;  3M3J A;  2MCN B;  2G4S A;  2K8B A;  1MG8 A;  2UWQ A;  3A4R A;  1UGM A;  1UZX B;  2LD9 A;  3AI5 A;  3DVG Y;  3ZW3 A;  5CTR C;  3QX1 A;  1WJU A;  1WJN A;  2O6V B;  5L83 A;  2N9P C;  3A9J B;  4JGH B;  3MTN B;  4WJQ A;  4CYE A;  2K6D B;  5TR5 A;  4DDI D;  2IO1 B;  4LJP B;  5DPR A;  1V5T A;  2EMS A;  5JHA A;  3PHW B;  2K8H A;  3H7P A;  4E3C A;  1E8Z A;  1RAX A;  2Z0E B;  3M95 A;  5IAA C;  4ANU A;  1M94 A;  3O65 B;  3NS8 A;  1R4N I;  3APC A;  1J0G A;  3AUL A;  5E6N A;  2KVR A;  5EDS A;  1KLV A;  2MBH A;  4EKU A;  4FAD A;  1TTN A;  3A33 B;  3PZD A;  2ZCC A;  3LDZ E;  4MJS B;  1LFD A;  2JPH A;  3B0A A;  4IG7 B;  2AYO B;  2KWC A;  3APF A;  4MH0 E;  1NDD A;  2LGY A;  3VXW A;  5CHF A;  2DZI A;  1ZW7 A;  2WX1 A;  2K6Q A;  2MWS B;  3SU8 X;  3UGB B;  4K7W A;  4MGK E;  4HDO A;  4YL8 A;  3ZO5 B;  4F1S A;  4LDT D;  5G55 A;  4EEW A;  2EKE C;  3CMM B;  4FHJ A;  3ZTD A;  3RZW C;  1JRU A;  3N32 A;  3QA8 A;  4G50 A;  4HWI B;  3L13 A;  1D3Z A;  4GMV A;  2DZM A;  1QZE A;  4BOS C;  4BVU C;  4HVB A;  1E8Y A;  2J0J A;  3NZS A;  2NBV B;  2JT4 B;  2BKF A;  3CST A;  2KDB A;  2AL6 A;  2AL3 A;  3TCA A;  2FNJ B;  1Q0W B;  4NNJ B;  1E8X A;  1XT9 B;  4KZC A;  2DYO A;  1NBF C;  1V6E A;  2BWF A;  3JVZ X;  4II3 B;  4HJK A;  4W9E A;  2LRW A;  4WQO B;  2D3G A;  2L3Z A;  2PE9 A;  4EUT A;  2XK5 A;  3EC8 A;  1SIF A;  2IBI B;  1P3Q U;  2KXJ A;  1KJT A;  2ZZP B;  5J17 A;  4XZ4 A;  2LAS A;  4HCP B;  4RM8 A;  3VH3 B;  1H4R A;  1WE6 A;  3MHS D;  1Z5S B;  2W9N A;  3B08 A;  3VTV A;  4ANW A;  3RUI B;  2UYZ B;  2D10 A;  3M63 B;  3L0W B;  3DVN U;  3N3K B;  3LJ3 A;  4WJN A;  2WDT B;  3KYD D;  1YJ1 A;  3PRZ A;  1WGD A;  2KX3 A;  3V6C B;  4GXB A;  2NCN A;  2KFK A;  4IM3 A;  4KSL C;  2BYV E;  1KOT A;  2V4L A;  1HE8 A;  3PGE A;  1RRB A;  3NY5 A;  1WGG A;  4WAA A;  4XC2 A;  2DYM A;  3PRP B;  3PVL A;  4K7S A;  1RLF A;  2REX A;  4K1R B;  4JLC A;  2JZ3 B;  4LJO B;  5D2M B;  3U7D A;  4KV2 A;  3WAN A;  1VCB A;  2PJH A;  2O2V A;  2JWZ A;  5GMV A;  2QHO A;  3A1Q B;  1WX9 A;  4DWF A;  4LDT B;  4ZRJ A;  2C7H A;  1GNU A;  4BKT A;  1GJZ A;  3QC8 B;  2C7M B;  4NPN A;  3W1S C;  3WA0 A;  3AU5 A;  4BBN F;  2KWV B;  3K9O B;  2C7N B;  1V49 A;  4M0W B;  4W9K A;  4MM3 A;  1WX8 A;  2DAJ A;  4WWN A;  3WAP A;  3H7P B;  5JH5 C;  2HJ8 A;  2N7D A;  2NBW B;  2KD0 A;  4BOZ B;  3L54 A;  4FJV B;  4W9H A;  1UH6 A;  4PS7 A;  2JXX A;  1LXD A;  2MP2 A;  4IWQ A;  3VAW A;  1WI0 A;  3QIJ A;  2KFK B;  4NJ7 A;  4HK2 A;  5KHO A;  2FIF A;  2NPT A;  2LVO A;  2BF8 B;  1WH3 A;  2CHZ A;  1GC6 A;  4JL9 A;  4GU2 A;  4KSK C;  1LQB A;  3GOE A;  3V6E B;  4GDL B;  1E8W A;  2MQJ A;  3DCG A;  2JRI B;  3SHQ A;  1CMX B;  4GDK B;  4ASW C;  3IBE A;  4BFR A;  3ZTC A;  2I1K A;  3A4S C;  5D94 A;  3QAR A;  4OVV A;  2A4Z A;  4RMA A;  1OEY A;  3A9K A;  4W9L A;  4G0N B;  4JQW C;  2G45 B;  1V80 A;  5DCN A;  4W9C A;  1I42 A;  2NPT B;  2JY6 A;  3JSV A;  2N9X A;  1WY8 A;  3VH4 B;  4ICU A;  2OOB B;  2J0M A;  1WGR A;  4GGQ A;  4FHK A;  2KDF B;  2ZCB A;  2Y5B B;  3OAW A;  3Q3F A;  4G11 A;  3ZDT A;  2MX2 A;  3ENE A;  3IG3 A;  3ZDM C;  4DHZ B;  2ZVO A;  3H1U A;  2LI5 A;  3KUZ A;  3R7Q A;  4GIV A;  2HE7 A;  2MLB A;  2K39 A;  2KOX A;  5KHQ A;  2YLM A;  4OVU A;  3VUX A;  2IO2 B;  5CHW A;  1EUV B;  3WAO A;  1UD7 A;  2IO3 B;  3ZNG C;  5DPW A;  2CHW A;  3KYC D;  2J7Q B;  2KMC A;  3H9D A;  2JZZ A;  1TZ1 A;  3R7R A;  2LXA A;  2KMA A;  3RT3 B;  3VUW A;  1C1Y B;  3HK0 A;  3ZLZ A;  4DXA B;  2KX0 A;  3PLU A;  2MA9 B;  4MEL A;  1SGH A;  2L05 A;  2R2O A;  3RYT A;  4I6P A;  2WYQ A;  2LJ5 A;  2M1M A;  1T0Y A;  1TGZ B;  2KJR A;  2CKH B;  1Q1O A;  3APD A;  4HCN B;  2KJ6 A;  5D6J B;  3D32 A;  2K1F A;  3VVW B;  4F7Z A;  3U30 A;  4IM0 A;  3PTF C;  1WZ3 A;  1WJ4 A;  5J18 A;  2KAN A;  4E71 A;  2LGD A;  2DHZ A;  3UIN B;  4MEM A;  2L00 B;  3SD5 A;  3GZN I;  4F8C B;  4WJP A;  2N7E A;  3DBS A;  1UEL A;  4M8N A;  1AAR A;  2XBB C;  1OGW A;  3ML8 A;  4KVG B;  5CX3 A;  3UF8 A;  4K81 A;  2KJH B;  3L17 A;  3OJ3 A;  3VDZ A;  4TV3 A;  2M4N A;  4G3X B;  4TKN A;  5DPS A;  3PV1 A;  4KDL B;  2DYB A;  3TBL D;  3CSF A;  1J19 A;  3NOB A;  4BKG A;  4DHJ B;  3ALB A;  1LM8 B;  3EEC A;  2XK5 B;  2I1J A;  4ZRI A;  3P2B A;  3SDL C;  4CO7 A;  2ZVN A;  2C9W B;  2MBE A;  2CHX A;  1WXS A;  1NI2 A;  5CHV C;  1K8R B;  2LGX A;  5E6O A;  3KUC B;  2IYD B;  4ICV A;  4BBN C;  4XX5 A;  2KTF A;  3NHE B;  4EZJ A;  3MJW A;  2HD5 B;  1WRD B;  3PRE A;  3TMP B;  4N9F 4;  5LXI B;  4TQ0 A;  3KW5 B;  2PPH A;  2K25 A;  5L95 C;  3VQI A;  3PHX B;  1L2N A;  1XD3 B;  1WM3 A;  1XQQ A;  2BYE A;  4HPL B;  2KDI A;  3QCA A;  3C0R B;  4DHZ E;  3TL5 A;  4FLH A;  4KIK B;  5JHB A;  1P98 A;  2D11 A;  1I35 A;  3WAL A;  2J0K A;  3PRM B;  3TIX A;  4AJW A;  4MGZ E;  2AWT A;  2A5U A;  2N1W A;  4JIO U;  2K8C A;  2GMI C;  3IFW B;  2IY0 B;  4NY0 A;  3NZU A;  5IA7 A;  2L0F A;  2WX0 A;  2O6V D;  4TQ1 A;  2KK8 A;  3EFU A;  4FUL A;  1BT0 A;  1IPG A;  3JW0 X;  3PS6 A;  5J2R A;  2JF5 A;  4DHJ D;  1YQB A;  2PE6 B;  1P1A A;  4W9D A;  2RSU A;  3DDC B;  3W1S A;  1YIW A;  1SE9 A;  3R3M A;  3VHT C;  3ML9 A;  2RR9 A;  3H7S A;  4FBJ B;  1KM7 A;  5AZF A;  2V1Y A;  4AWJ A;  2GBN A;  1V81 A;  2L0T A;  3BY4 B;  4W9J A;  1WIA A;  2IZV B;  1WF9 A;  2G4D B;  2ZNV B;  4FJY A;  5LXH A;  2C5L C;  2IO0 B;  3ZVV A;  4DK5 A;  2B3A A;  2GOW A;  2G3Q B;  2JRH A;  4HXD A;  4BKS A;  5C1Z A;  4J6I A;  1TBE A;  3AXC A;  3PT2 B;  1V2Y A;  1GC7 A;  1OTR B;  2MBB B;  2M8S A;  4MGI E;  2EMT A;  1EF5 A;  2DZJ A;  4A20 A;  4DBG A;  3ZRF A;  2JVC A;  1X1M A;  4ANV A;  2DX5 B;  2YVC A;  4W9F A;  2MSE D;  2FCS A;  5HKH A;  4II2 B;  4IC7 B;  3VTU A;  3X23 A;  2LRU A;  2ZJD A;  1EF1 A;  1S1Q B;  3QJZ A;  4M8M A;  3VUY A;  3ECI A;  2N9E B;  2O6V A;  2CU1 A;  2LVP A;  3L16 A;  4MJS A;  3QK0 A;  2KNB A;  2R2Q A;  4AUQ C;  2BYF A;  1G6J A;  4KDI C;  1WXA A;  3V61 A;  1ZKH A;  2GBJ A;  3IHP C;  3ZIM A;  1E7V A;  2L7R A;  1Z2M A;  2DAF A;  2KTR B;  4EOY A;  3IVF A;  1EO6 A;  3UIO B;  2V3S A;  2BWE S;  1H8C A;  1WX7 A;  2LZ6 A;  5AZH A;  4EZK A;  2CR5 A;  3QWZ B;  3QAQ A;  5AZG A;  3EHV A;  1WMH B;  4K7U A;  2MBO A;  4EZL A;  2NS5 A;  5FR6 A;  3DVN V;  4B95 A;  1U4A A;  3DPD A;  3T8M A;  3V62 A;  3I3T B;  1UBI A;  3X0W A;  2ASQ A;  2MBQ A;  3RZF A;  2FCQ A;  1Y8R C;  2NBU A;  1V86 A;  1S3S G;  2N1V A;  2KFJ A;  2NVU I;  1ZGU B;  4FA6 A;  4TUU A;  2KQS A;  1P9D U;  2Z0D B;  4WWO A;  1J8C A;  3R66 C;  4EFO A;  3H6N A;  4IM2 A;  4B9K A;  4RM9 A;  4I6L B;  5AEK B;  4FJZ A;  1ISN A;  4PS8 A;  1R4M I;  3KH0 A;  4PYZ A;  2VRR B;  4NQK E;  4I6N B;  3A9J A;  4GN1 A;  2FAZ A;  4NAW A;  1WMH A;  1L7Y A;  1VD2 A;  2Z59 B;  1V5O A;  5E6P A;  2FUH B;  4ZRK A;  2AEH A;  2KKC A;  2FCM A;  3DBH I;  4X57 B;  2M0X A;  3DBL I;  1WJ6 A;  2KN5 A;  3Q3J A;  4KZ0 A;  4W9G A;  3DVG X;  3HHM A;  3DBR I;  1WXM A;  2CS4 A;  3JSV B;  4IWO A;  5D7G A;  4HLE A;  3BIN A;  1FXT B;  3V60 A;  2HTH A;  3WAM A;  3OLM D;  1YD8 U;  2GBK A;  3DQV A;  2KC1 A;  1E7U A;  4A3O A;  3M62 B;  1WZ0 A;  5DPT A;  4P7I A;  1E90 A;  4W9I A;  4NJ6 A;  3UIP B;  5G2N A;  4NAW B;  4MSM B;  5C23 A;  4CHK A;  2MRP A;  3KUD B;  3N30 A;  1E5W A;  4PYU A;  3ZNZ B;  4DDG D;  4E74 A;  3OJ4 B;  4ZYN A;  3ONS A;  2D2Q A;  4GDL A;  2GBR A;  2LUE A;  2FID A;  1WXV A;  4LCD E;  2C60 A;  3HM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...