4W9GA

Pvhl:elob:eloc in complex with (2s,4r)-1-(3,3-dimethylbutanoyl)-4-hydroxy-n-(3-methyl-4-(thiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 6)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
101
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Transcription elongation factor B polypeptide 2
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 101
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4w9gA00
3I3TB 3HIZA 4WJOA 2NVUI 1E8YA 1WYWB 2JPHA 4JIOU 4ZRKA 4GDKA 4GB9A 4NJ6A 1LM8B 2YVCA 4IWOA 2LGYA 2VRRB 1PQSA 5FR6A 3PGEA 3NY5A 3U8ZA 2GBKA 1LQBA 1X1MA 1UELA 4CHKA 3ZKJC 3UQAA 3APFA 2KLGA 1ZGUB 2L00B 3ML9A 1WGYA 2JUOA 3IBEA 3ENEA 2DYOA 1EO6A 2N1VA 3DPDA 3L54A 2PPHA 3ZRCA 4TQ0A 4B9KA 5G2NA 2L8JA 4RM8A 3WANA 2ZVOA 3W1SC 3MHSD 1K8RB 3R7QA 2BGFA 4GDLA 3QQ8B 5DCNA 2L0TA 4JQWC 3M3JA 1MG8A 3PVLA 2ZPYA 2BYEA 2MBEA 3PS6A 4DXAB 2LVQA 1VD2A 2ZCBA 1V9JA 4IM3A 3VXWA 3ZNID 3N3KB 1S3SG 4B95A 2EMTA 2RD0A 3VH3B 4KSLC 5D6JB 2MA9B 1KLVA 2JXXA 2GBJA 4YL8A 2K6QA 4BBNF 3SDLC 2QHOA 3VQIA 3H7PA 1UGMA 2FCNA 3VUXA 5E6PA 1GG3A 4HPLB 1IYFA 1WMHB 2D2QA 2N4FA 2RR9A 4FJYA 1IP9A 3CF6E 4FADA 1C3TA 2IYDB 1V5OA 2G4SA 3NHEB 2NR2A 3V6EB 2LXAA 4DK5A 2KWVB 3RD2A 1WJ4A 2NBUA 3H7SA 4KV2A 1Z5SB 1ISNA 1YX6B 4NJ7A 4WJPA 1I35A 1OGWA 3L10B 4G0NB 1WJ6A 2WX1A 3IVFA 3TCAA 2IZVB 2Y5BB 1H4RA 1HE8A 4CO7A 3SU8X 1E7UA 2LGDA 2N7DA 4WAAA 3ZLZA 4DHJD 4M8MA 2MSED 4WWNA 2KMAA 1QZEA 3JSVA 4MM3A 3DBSA 1NBFC 4A3PA 5L95C 2KZRA 1EUVB 1V49A 2C7NB 2LVOA 2KTFA 1WZ0A 4B6WA 4AOFA 4KZ0A 2WWZA 4GGQA 4TUUA 4IM2A 2K8CA 2KK8A 2EMSA 2FNJB 2I1KA 1WXVA 3TL5A 1ZW7A 4PYUA 2IY0B 1ZKHA 3PZDA 3JVZX 3VUWA 2KMCA 4MSMB 3TIXA 4EZJA 2NCNA 4I6LB 2C60A 2KFKA 5BO4B 1IPGA 3UIPB 2MBBB 4ZRIA 4MEMA 1WE7A 1WH3A 3WALA 5AEKB 2K39A 4ZYNA 2G45B 2ZNVC 1WX7A 3IFWB 3VTUA 4RM9A 4KZCA 3WAMA 1KOTA 3A9JA 4W9JA 1GJZA 1E7VA 3PSEB 4EFOA 3DVNV 3WA0A 3DBLI 3SHQA 4EZKA 1L2NA 2A5UA 4LJPB 3AU5A 2FCQA 2KVRA 2NBWB 4FJVB 4HJKA 4IM0A 4F8CB 4ANVA 3PHXB 2DHZA 2DENB 3JYUA 1RLFA 1YD8U 3Q3FA 3K9PB 4ANUA 2LGXA 1UH6A 3QC8B 1WM3A 4FHJA 3ZRFA 2DZMA 2N7EA 3EECA 4FJZA 2LRUA 3WAPA 5IA7A 3APCA 3BY4B 4GN1A 3VTVA 2R2OA 2HJ8A 2O2VA 3RULA 3PPAA 1UBIA 3GZNI 3KH0A 4KIKA 1CMXB 1LXDA 3A1QA 3P2BA 1NI2A 2L3ZA 4NNJB 3VFKA 4MGYE 3ZTCA 2DZIA 2FUHB 4AUQC 4DDID 4X57B 4ICUA 4URKA 5CTRC 1JRUA 1VCBA 3QWZB 3QHTA 4CYEA 2J0MA 3AXCA 5HKHA 4ZDVA 2CS4A 4IW0A 4PS7A 2M4NA 3V6CB 2XK5B 2GBRA 3W1SA 1GUAB 3PRMB 1WZ3A 1GNUA 2CKHB 3KYDD 4NAWB 4AJWA 2K25A 4KDLB 3RZFA 5J18A 4LDTD 5EDSA 4K81A 3LJ3A 2D10A 2NS5A 3ONSA 1WY8A 1UZXB 3UF8A 4DHZE 2KWCA 2KXJA 2MWSB 2V3SA 3S2AA 4TKNA 3MJWA 1WGDA 2R2QA 1P1AA 3KW5B 2FCMA 3PTFC 4W9LA 2B3AA 2L7RA 2ZVNA 4II3B 3PV1A 3QA8A 1SIFA 1WE6A 4GIVA 4MJSB 4W9KA 5C1ZA 2KANA 2LUEA 3RCZA 3ZUNA 5LLIA 4F1SA 2KTRA 5DPRA 2LASA 3CMMB 2M1MA 4LJOB 4AWJA 2O6VB 4GOCA 3ZDMC 1EF1A 1RRBA 5DPTA 2BKRB 2BYFA 2AEHA 4E71A 3PRZA 2JWZA 4W9GA 4N9F4 3ZVVA 3HK0A 1FXTB 3UQBA 4HCPB 2ASQA 3A4SC 3PT2B 3A9KB 4M8NA 3ZTDA 2MW5A 4W9IA 4ASWC 3VHTC 1WGHA 4FLHA 3TMPB 3JW0X 2LVPA 3ZO5B 3ZNZB 1TGZB 3UGBB 2D07B 5LXHA 3OJ4B 2BYVE 4DHZB 4GMVA 3M63B 3U30A 2C5LC 3KUDB 2MP2B 3EC8A 3HHMA 1E8ZA 3KUZA 4G11A 2BPSA 4DBGA 3UINB 5AZGA 3M62B 1YJ1A 2N9EB 4KSKC 2L05A 4GDKB 2JVCA 2LRWA 3PLVA 5KHQA 4JLCA 1J19A 4ANWA 2REXA 2NPTA 1WR1A 2RSUA 2CHZA 2KD0A 4MGKE 3Q3JA 2KX3A 1E8WA 3DVGY 4IC7B 3U7DA 3VTWA 3WIMA 1V5TA 2J7QB 1BT0A 1WM2A 4DDGD 4KDIC 5C23A 4ANXA 4XX5A 1WFYA 3OLMD 4K7SA 4XC2A 1V86A 3RYTA 3VDZA 2NBVB 2AL6A 2FIFA 5E6OA 2GBNA 4GDLB 2V1YA 2JRIB 4GSWA 2ZEQA 2MLBA 3H1UA 3QJZA 3B0AA 2CU1A 4W9CA 4EEWA 1EF5A 3IHPC 4PS3A 4PS8A 2DYMA 4XZ4A 3QK0A 4MGZE 2HD5B 3X23A 2DZKA 3AU4A 2AL3A 4EOYA 4EZLA 2BF8B 2KFJA 1Q5WB 2LI5A 2UWQA 2GOWA 3M95A 2ZPNA 2JF5A 2KX0A 1WX9A 3BINA 3DCGA 4FN2A 3H7PB 2RPQA 3LDZE 5KHOA 3QARA 3T8MA 5DPWA 2DX5B 1L7YA 2BKFA 1OTRB 1LFDA 4DHJB 1Y8RC 3ZDTA 5AZHA 2Z0EB 5L83A 4HCNB 4KVGB 3O65B 3PLUA 2UYZB 4IWQA 2Z59B 1V81A 1P98A 3NZSA 1WX8A 4MH0E 1P0RA 5IAAC 3VUYA 2FCSA 1OQYA 4BKGA 2J0JA 1OEYA 2XEWA 1J8CA 3L13A 3W1YA 2A4ZA 2GBMA 2KKCA 3DVNU 2D11A 2MBHA 1RFAA 4FHKA 1WMHA 3KYCD 3R7RA 3AULA 3OJ3A 5CHWA 1T0YA 4W9DA 1Z2MA 2KQSA 2PEAA 2IO2B 2C9WB 3A9KA 3DQVA 4NQKE 2ZJDA 2RGFA 3KUCB 2N1WA 3QIJA 4EUTA 4K7UA 1XT9B 4G50A 3B08A 4MDKE 2DYBA 3L16A 4W9EA 4IG7B 2MP2A 3PRPB 4ZRJA 2M0XA 2KOXA 3MTNB 3QCAA 1WI0A 2V4LA 2IO1B 1WR6E 1WXAA 2JY6A 3QAQA 2KFKB 2KJ6A 1Q1OA 2WX0A 2LJ5A 4AP4C 2M8SA 2LXCA 2MCNB 4I6NB 1TZ1A 2KDIA 1RAXA 2CHXA 4MELA 1KJTA 3ML8A 4FBJB 1WF9A 5TR5A 3A4RA 4EKUA 3HM6X 4E3CA 1YX5B 2N9PC 3A9JB 2CHWA 1WJUA 4BVUC 4HDOA 3A33B 2CR5A 2MX2A 4BFRA 1A5RA 4W9HA 4BKSA 2DAFA 1OEYJ 2KDEB 1UD7A 1R4MI 1WGRA 3L08A 2BWES 1WGGA 1F9JA 4HPMB 2LWPA 4W9FA 3X0WA 3D32A 2K1FA 2JRHA 2L76A 3NS8A 4II2B 4WJNA 3ZIMA 3PHWB 3WAOA 3HM3A 3NOBA 3EFUA 2KNBA 2KWUB 2KC1A 3K9OB 4E74A 2O2VB 3H6NA 2IO3B 3NZUA 4GXBA 1KM7A 3IG3A 4KIKB 3A1QB 4BKSD 4HXDA 3AI5A 2YLMA 1YQBA 2PE6B 2W9NA 2ZCCA 5D7GA 1WXMA 5CHVC 2IBIB 1G6JA 1E5WA 2KJRA 4IWPA 4LDTB 1WXSA 4WJQA 4HWIB 1WIAA 4M0WB 3L0WB 4HK2A 5JZEB 2FAZA 2JT4B 2J0KA 4WQOB 3DVGX 4I6PA 4NPNA 1NDDA 2KDFB 1H8CA 2OJRA 4A20A 2DAJA 3TJPA 5J2RA 2AWTA 3OAWA 2FIDA 2LZ6A 3KVFB 4AJYB 4BBNC 4BOZB 2JZZA 2D3GA 5DPSA 2I1JA 1U4AA 2PE9A 4NY0A 1V2YA 1WRDB 2KJHB 2IO0B 3DBRI 3VH4B 3ZW3A 1UBQA 3VVWB 3H9DA 1TTNA 4OVUA 4HDQA 1V80A 4ICVA 2K8BA 2KLCA 2PJHA 3GOEA 3B1LX 4LCDE 3CSFA 5CHFA 4HLEA 1P9DU 2C7HA 4PYZA 3L17A 5J17A 2BWFA 2DZJA 2XK5A 1Q0WB 2JZ3B 5JH5C 1D3ZA 3ZNHB 4OVVA 4RMAA 2OOBB 2WYQA 4TQ1A 3R66C 3ZNGC 3N32A 4NAWA 2KO3A 1TBEA 4K1RB 2L0FA 3VAWA 3R3MA 2MRPA 3SD5A 2ZZPB 5CX3A 2EKEC 5D94A 1GC6A 2KTRB 2HE7A 3PREA 4A3OA 4F7ZA 4MSQB 1E90A 3N30A 3ECIA 3V60A 1WJNA 2HTHA 2M17A 3V61A 4K7WA 5LXIB 3RT3B 4JL9A 1SE9A 1M94A 5GMVA 3C0RB 4WWPA 4G3XB 1S1QB 4JGHB 2K8HA 4MJSA 2K6DB 2MQJA 3QX1A 4HVBA 2KDBA 5E6NA 1P3QU 2IY1B 2LD9A 2MBQA 4NQLB 4BKTA 5JHBA 1J0GA 5G55A 2O6VA 4TV3A 2MBOA 3TBLD 3DBHI 5D2MB 2KN5A 2N9XA 2G3QB 4GU2A 4DWFA 3DOWA 4P7IA 3EHVA 1AARA 4J6IA 5AZFA 2KHWB 1GC7A 3JSVB 4WWOA 2WDTB 1SGHA 2GMIC 3APDA 3RUIB 1I42A 1R4NI 2NPTB 2XBBC 4IUMB 2O6VD 3ALBA 3T9LA 2G4DB 3DDCB 2AYOB 2Z0DB 1V6EA 2C7MB 1YIWA 2KC2A 4MGIE 4FA6A 1XD3B 2ZNVB 1C1YB 3RZWC 4BOSC 1E8XA 3V62A 4FULA 3CSTA 1XQQA 2KQ7A 3UIOB 5JHAA
chains in the Genus database with same CATH superfamily
2JSVX 3HIZA 4WJOA 4GDKA 3RNEC 5TSSA 3NY5A 1X1MA 1UELA 2B76B 1IGCA 1HZ6A 3ML9A 1WGYA 3IBEA 3NVZA 5G2NA 1YQ3B 2AQ3B 3RNFC 3W1SC 3MHSD 2ZW1A 2WDRB 5DCNA 1AYFA 3BYYB 2J4XA 1V9JA 1S3SG 3W9CB 5D6JB 2GBJA 3Q3OC 4J3OD 5FR3A 3SDLC 1FRDA 2QHOA 3H7PA 2FCNA 2AX5A 4US8A 4HPLB 1IYFA 4FJYA 3CF6E 1C3TA 1V1PA 2QCZA 3NHEB 3V6EB 3RD2A 1WGKA 2V4IB 1YX6B 4HKQA 3GP7A 2H88B 3H8HA 4G0NB 1K50A 1WXQA 1WJ6A 3IVFA 2IJ0A 5GXGB 1E7UA 4DHJD 4WWNA 4RNAA 4MM3A 2SAKA 3DBSA 1N63A 1NBFC 2KZRA 2WXPA 4IDIA 2C7NB 3AEAB 2LVOA 2KTFA 1WZ0A 2WWZA 4TUUA 1Y56A 4IM2A 2KK8A 2FNJB 2I1KA 1WXVA 3TL5A 4WH4A 2KMCA 3TIXA 2LHEA 1IPGA 3UIPB 1QILA 4L1BA 1J7CA 4XWTA 1SBBB 3B2FA 1ROEA 3IFWB 3A9JA 2PTLA 3FILB 4KKJA 2A5UA 2W54A 3AECB 4IM0A 1HEZE 2DENB 3JYUA 1B1ZA 2N7EA 4UDUC 3APCA 4GN1A 1JWUD 4HROA 3VTVA 2WXLA 3GZNI 3A1QA 3ZJUA 1NI2A 4MGYE 2DZIA 4AUQC 1TIFA 5CTRC 5H8YE 3QHTA 3TUOA 4AQ7A 2J0MA 2FUG1 3AXCA 4ZDVA 2JU6X 3V6CB 4RGOS 3W1SA 1GUAB 4MACA 1WZ3A 2CJNA 1QOAA 1FMAD 3RZFA 1MHXA 5EDSA 3RI7C 3I9V1 2NS5A 2WXRA 4LNOA 1UZXB 1STEA 1MHHE 3MJWA 3PTFC 3GS2A 2LMCA 2W55A 2KANA 3RCZA 4LNIA 1C79A 4PK1A 5LLIA 1CZPA 1FFVA 1L5PA 3CMMB 3GE3C 4LJOB 4AWJA 4GOCA 2IGGA 1L4DB 1VRAB 5I4DA 3BVMA 4ZHOA 3EA6A 3PT2B 3ZTDA 4M8NA 4ASWC 1BUIC 1WGHA 2W3RA 3JW0X 2M19A 5LXHA 4DHZB 1GB4A 4GMVA 2INCC 3M63B 2J53A 3U30A 3VRBB 2MP2B 1NI3A 1E8ZA 1C4PA 3KUZA 4G11A 3P1MA 5AZGA 4KSKC 4GDKB 2JVCA 3BWUD 3Q14C 4AS1A 1WR1A 4KGRA 2KX3A 3WIMA 3TEXA 2J7QB 1I4HA 4N59A 4KDIC 5C23A 1L0VB 1WFYA 4XX5A 4K7SA 2NMQA 2NBVB 4GSWA 3QJZA 3C8YA 5T8IA 2CU1A 4W9CA 4EEWA 1EF5A 2LHDA 1A70A 4MGZE 3X23A 2DZKA 4HRSA 3RN9C 4EOYA 2WQYB 3SR6A 2ZW0A 4FN2A 3H7PB 3Q8FA 3L4PA 3U7ZA 5KHOA 3QARA 3T8MA 5DPWA 2DX5B 1OTRB 1EU4A 1Y8RC 3ZDTA 5L83A 4HCNB 2BT6A 1SE2A 3N20C 3DWMA 2Z59B 3BVZA 1V81A 1NYQA 3E56A 3KWLA 5HHDG 3VUYA 2FCSA 1OQYA 2Y5PA 1OEYA 2GBMA 2KKCA 2MBHA 1WMHA 2KYWA 3AULA 1T0YA 2KQSA 2PEAA 2ZJDA 4EUTA 2BTEA 4K7UA 3CIRB 1XT9B 4G50A 3B08A 1GB1A 4W9EA 2M0XA 1QLBB 1DOYA 1WI0A 3MC8A 4C4VB 4ITKA 4US9A 3RMKC 2JZPA 1WXAA 2JY6A 3AE9B 2KJ6A 3GE8C 1F2RI 1JWAD 4I6NB 2CHXA 5TR5A 4EKUA 3BVGA 3HM6X 2Z8LA 2Q5WD 2VZKB 1YX5B 3R8BA 2N9PC 3A9JB 3P4RB 1L6UA 4HDOA 3A33B 1OQRA 2CR5A 3AE3B 1PYWD 4W9HA 1OEYJ 1UD7A 3L08A 5D3DA 3TEZA 3ETRA 4W9FA 2LWPA 5FKAC 4NAMA 3PHWB 3P4QB 3AN1A 2WXFA 3MFGA 4YSYB 1KM7A 1DOIA 3A1QB 4BKSD 2ZCCA 5D7GA 2HTME 2ACZB 4HPPA 5CHVC 2IBIB 4WJQA 4HWIB 1FO4A 4I6PA 1NDDA 1OQQA 2DAJA 3TJPA 4OW0A 2FIDA 4BBNC 4NY0A 1V2YA 1WRDB 3WCQA 3VH4B 3ZW3A 1XCQL 2Y3AA 1UNSA 1V80A 3GOEA 5CHFA 2KACA 2TSSA 3SEBA 1P9DU 3L17A 1FNUA 5E6JA 5EE9A 5JH5C 3ZNHB 4OVVA 4OZAA 3I63C 3N32A 1KRHA 3VAWA 1PDXA 3SD5A 1E10A 2NTTA 2WNMA 1I4XA 1E90A 3N30A 2WXOA 3ECIA 4RFBA 2HTHA 3T3NA 3RPFC 1SE9A 2KWDA 1M94A 4B0MA 1CK1A 2K8HA 4MJSA 2MQJA 2KDBA 1P3QU 2LD9A 3FC4A 4BKTA 5JHBA 2QDFA 3RNAC 1J0GA 1RFKA 4TV3A 4Q2JA 3TBLD 1VZ7A 2N9XA 4DWFA 3DOWA 5LNK1 4P7IA 1IUEA 5AZFA 1GC7A 4WWOA 1SGHA 2GMIC 3RUIB 4FXCA 1L0XB 2XBBC 2O6VD 3R2TA 2AYOB 2Z0DB 2C7MB 4FA6A 1E9MA 3V3XA 1C1YB 4WQMA 4BOSC 2IGDA 1E8XA 1IGDA 2KVZA 3CSTA 3UIOB 4P16A 3DHHC 3I3TB 4HVBA 2NVUI 1E8YA 4JIOU 1T5XD 4NJ6A 4GB9A 5FR6A 4IWOA 5BMGA 2LGYA 2VRRB 4P6VF 3U8ZA 2W3SA 4LNNA 1SE4A 4CHKA 4YT0B 3ZKJC 3UQAA 3HVDA 2RMMA 2JUOA 3ZXRA 3ZXVA 2DYOA 3AE5B 3L54A 2PPHA 1QQRA 1TKEA 2ZVOA 3MJ5A 1K8RB 3R7QA 2BGFA 3QQ8B 1FCCC 1MG8A 5IN7A 2BYEA 3PS6A 1VD2A 2ZCBA 3GB1A 2JXXA 2K6QA 1KH0A 3VQIA 3VUXA 2QEJC 1WMHB 1ZPSA 2D2QA 3P63A 4ZHPA 3HUIA 3BZDB 4FADA 1V5OA 2G4SA 3H7SA 1Z5SB 1ISNA 4C00A 1I35A 2WX1A 2QC8A 1NVID 2Y5BB 4ZRQA 1HE8A 4CO7A 2X8XX 2N7DA 4WAAA 4XGAB 4M8MA 2JYEA 3ZYYX 1YMHE 3JSVA 4A3PA 5L95C 5IO9A 1V49A 3MHZA 2J42A 1VLBA 3FKYA 2K3UA 5HI1A 1K53A 3Q6BA 2QSDA 4RGTA 5H92C 1ZW7A 4PYUA 1JW9D 2WU2B 3NRZA 1SJHD 4MT5A 4YSZB 4MEMA 2G1EA 3WALA 4ZYNA 2G45B 2ZNVC 1WX7A 3CWIA 1KOTA 4O1NA 5JXVA 3WA0A 2NBWB 4F8CB 4ANVA 3O13A 3PHXB 2DHZA 1RLFA 2LGXA 1UH6A 4ZYSA 3QC8B 4FHJA 3RULA 1UBIA 4KIKA 1CMXB 3DHIC 3IT4B 1FM0D 1N62A 2L3ZA 4NNJB 3ZTCA 4DDID 4ICUA 3SFEB 1VCBA 1E0ZA 4CYEA 3LXFA 4IW0A 3I57A 4M00A 2LGIA 3KYDD 4IOIE 4AJWA 5J18A 4LDTD 4K81A 4D2KA 3UF8A 4TKNA 2L7RA 4MJSB 1SIFA 2VH1A 1ET9A 4W9KA 1MPEA 2LUEA 2KTRA 4M01A 5DPRA 2OHFA 4S0RA 1EF1A 1T0QC 4ARIA 3DBHB 2AEHA 3PRZA 4W9GA 4N9F4 2BB5A 3PO0A 2WXJA 3Q8AA 3IAS1 1HQRD 2INNE 1EU3A 2E3TA 4RF0A 3TMPB 2LVPA 5HG2A 3ZO5B 2D07B 2BS4B 3Q8BA 4HJGE 4DBGA 1YJJA 1D6EC 3Q8EA 2L05A 2LRWA 1J19A 1PGAA 2REXA 3VTWA 1TT5B 2GB1A 1BT0A 1WM2A 4DDGD 1PGBA 3RYTA 3VDZA 1QOGA 4L2YA 2V1YA 2JRIB 2MLBA 2BS2B 3H1UA 3B0AA 4KGSA 2D3BA 1Q10A 4PS8A 4XDCA 2HD5B 3AEFB 2K5PA 2MJDA 2AL3A 1SEBD 2KFJA 1Q5WB 2UWQA 2PIAA 1WX9A 1D5MC 1D5ZC 4JWUC 1JROA 4YTNB 1F0ZA 4DHJB 5AZHA 2Z0EB 4KVGB 1YJIA 4IWQA 1P98A 1QT9A 1TS5A 4MH0E 3EFCA 5IAAC 2JWUA 2J0JA 2FBWB 2XEWA 3L13A 2YEPB 3R7RA 1UUPA 3OJ3A 5CHWA 4W9DA 3A9KA 3RFZB 1SIJA 2RGFA 1DOXA 1ET6A 2N1WA 3Q3MC 2V0GA 4NZLB 4LLGM 1V1OA 1YOVB 3AM9A 4MDKE 2DYBA 3L16A 1XLOA 1SSNA 4ZRJA 3MTNB 2IO1B 1JALA 1TJEA 3QAQA 3U52E 5BMHA 4C80A 4K3BA 1YN3A 3AE6B 1TZ1A 4MELA 1TY2A 5IOIA 4FBJB 2WU5B 4BVUC 2CHWA 3DBLB 1A5RA 4JPSA 4BKSA 1MJDA 4XE0A 2KDEB 3I5JC 4JX1C 4HPMB 3D32A 3NS8A 2L76A 2WXIA 4II2B 1C4CA 2JXTA 4WJNA 1IBXA 3HM3A 3EFUA 1K52A 2IO3B 4KIKB 4HXDA 2YLMA 1YQBA 2PE6B 1HA5A 1G6JA 2KJRA 1WXSA 4M02A 1T0RC 3L0WB 4HK2A 1C76A 2OJRA 3TSSA 2LZ6A 1N5XA 1I4RA 2N0SB 1DGJA 2RDHA 1KTKA 1TTNA 4OVUA 4HDQA 4L23A 4ICVA 2J52A 2PJHA 2R61A 4HLEA 3CSFA 2SEBD 2C7HA 5C3JB 1D4BA 2BWFA 2XK5A 3P4PB 4XYCA 1D3ZA 4RMAA 1ACCA 4NAWA 2KO3A 3KLSX 3Q2AC 1HXYD 1SXTA 2WXQA 2L1AA 2ZZPB 2KTRB 3PREA 2DBYA 4PT5A 1WJNA 5LXIB 3C0RB 4G3XB 3J9CA 3QX1A 1V1PB 1C4AA 1ZUD2 3C19A 4NQLB 4S17A 2O6VA 1SF0A 5D2MB 2D3AA 4K3CA 4C7ZA 3N1ZC 4WIPA 3NUHB 2KAJA 3NVWA 4J6IA 4MM3B 3DHGC 1I42A 1J7AA 5C2TB 3DDCB 1V6EA 2D5GA 4RH6A 4MGIE 2ZNVB 3LB8C 5BMIA 3RZWC 3AEBB 1WSPA 4M0WA 1L0YB 3IAM1 5JHAA 1ZP0B 2DWQA 2N9LA 4ZRKA 2YVCA 3PGEA 2GBKA 1D5XC 3APFA 3ZJVA 2BYTA 2L00B 3Q69A 3ENEA 1YN4A 1EO6A 2N1VA 3DPDA 3ZRCA 2RDBC 4TQ0A 2L8JA 4RM8A 3WANA 4GDLA 1SB3C 4JQWC 1EWYC 3PVLA 2ZPYA 2MBEA 2LVQA 2QIEB 2DLBA 4B95A 2RD0A 3VH3B 1F77A 4BBNF 1UGMA 2N4FA 5G5GA 2BBCA 3MC9A 2RR9A 1N60A 1M4VA 2LXAA 1XO3A 2KWVB 4WJPA 4RGNA 4DQOC 3L10B 4P1CC 2PMVA 2IZVB 1H4RA 3SU8X 2LGDA 3ZLZA 3LYYA 2KMAA 1TKYA 2WDVB 2YEPF 3IT6B 1EUVB 2NTSA 1PGXA 3W5VB 1B9RA 4KZ0A 2FE8A 2EMSA 1YN5A 1ZKHA 3JVZX 4C56C 4EZJA 3ZGZA 2NCNA 4I6LB 2DNFA 2WXKA 1WH3A 1IBXB 1XEEA 2K39A 3VTUA 4RM9A 4KZCA 4W9JA 3TEYA 1GJZA 1E7VA 1GPXA 3DVNV 4EZKA 1L2NA 4A8XC 4LJPB 3AU5A 2FCQA 1NENB 2AQ1B 4FJVB 1ZE3D 1JCKB 1MFWA 1TY0A 3Q3FA 1GOZA 1AWDA 1QF6A 4P1BC 1WM3A 3ZRFA 3EECA 4RGMA 3WAPA 3BY4B 2HJ8A 2O2VA 2GLSA 3VFKA 3DBRB 2FUHB 3HRDD 2BS3B 2WXMA 4R3DA 2CS4A 1PUTA 3RNCC 2XK5B 2PLPA 2V3PA 3NZ3A 1GNUA 2PW9A 4NAWB 3OG5A 3LJ3A 2D10A 3NVVA 4REZA 3ONSA 1WY8A 2N7JA 1P7EA 2H89B 1WGDA 5BYRA 3EGRA 2HDEA 2B3AA 4OZCA 2ZVNA 4II3B 3PV1A 1WE6A 4LK0M 3ZUNA 1N6ZA 3U2SC 2LASA 2O6VB 4H2AA 1E6EB 1RRBA 4A6QA 4LNFA 4BAXA 2M56B 3HK0A 1FXTB 3AMZA 2KDMA 4HCPB 2ASQA 4W9IA 3VHTC 4FLHA 2CJOA 1J7BA 1FNVA 2BYVE 3OJ4B 3FILA 3NS1A 2C5LC 3KUDB 3EC8A 3HHMA 2BPSA 3UINB 3M62B 1YJ1A 4C7YA 3PLVA 1AN8A 1TYGB 2EELA 2RSUA 2KD0A 4MGKE 3Q3JA 4IC7B 3DVGY 3U7DA 1FRRA 1UWMA 1HTOA 4ANXA 1FNWA 3OLMD 1V86A 5E6OA 2MH7A 4GDLB 1UWXA 4DXGA 4PS3A 1VZ8A 2DYMA 4XZ4A 3QK0A 1GAQB 1QKZA 1C77A 1FXIA 3KQ4A 5FK9C 1XF5L 4EZLA 2BF8B 2INDC 1HTQA 2LI5A 2ZPNA 4B0EA 2JF5A 2KX0A 3BINA 2RPQA 3AE4B 3LDZE 1YNTE 3O65B 2LJIA 3B2GA 2L32A 1WWTA 3NZSA 2INPE 1P0RA 4TMAB 4ZOHC 1KLUD 2A4ZA 2KN4A 2D11A 1RFAA 1Z2MA 3DQVA 1MVKA 2C9WB 2MEKA 1OFFA 1QOFA 2WXNA 1TKGA 3ZQ4A 2WS3B 4IG7B 2GI9A 2MP2A 3PRPB 3QCAA 4DXFA 2V4LA 2BVCA 1WR6E 3OWEB 1I7HA 3TEWA 1FXAA 1V8CA 1I4PA 3A4RA 2ICIA 2XN9C 4E3CA 4JWSC 1WJUA 3VRAB 1RM6C 2QJLA 2DAFA 1WGGA 1F9JA 2K1FA 2JRHA 2AQ2B 3ZIMA 1WRIA 1ZDXA 3WAOA 1XCTL 2KNBA 2KWUB 2KC1A 1R4NB 2WDQB 3AEDB 2O2VB 3H6NA 3NZUA 3VR8B 3IG3A 2KT7A 3GZNB 1R7SA 3AI5A 1WXMA 4IWPA 4LDTB 4OHJA 4RCOA 2PVGC 2V9HA 1NEKB 5JZEB 2FAZA 2JT4B 3DVGX 3BK2A 3P42A 5MPOA 1H8CA 4A20A 2LEKA 5J2RA 2AWTA 4BOZB 4AJYB 4QAYA 2LFIA 2I1JA 5DPSA 2PE9A 2KJHB 3BK1A 1UBQA 3H9DA 3IXSA 1HZ5A 2K8BA 2KLCA 4LCDE 1T6BX 1Q0WB 2JZ3B 1NYRA 2OOBB 3R66C 1TBEA 4K1RB 2L0FA 3KWVA 2BQQA 2IGHA 1JMLA 3Q8CA 4F7ZA 4MSQB 2X38A 4C4VA 3U4EG 3P4SB 3V61A 2M17A 4JL9A 3AE7B 4JGHB 2K6DB 1QOBA 4A90A 2MBQA 2IY1B 3URYA 5G55A 4JE3B 1FCLA 1TS3A 2MBOA 4KGTA 3DBHI 4ZRPA 3W2DA 2G3QB 1ZXIA 1AARA 2KHWB 3JSVB 3APDA 3RNBC 4OVZA 1R4NI 2LUMA 1FIQA 4IUMB 3ALBA 3T9LA 2WP9B 1YIWA 4ARCA 1XD3B 3V62A 1XQQA 2KQ7A 3UGBB 3VR9B 1WYWB 2JPHA 4XWWA 1K51A 1LM8B 1PQSA 1LQBA 2RPVA 2KLGA 3BIID 1ZGUB 1ZXHA 1C9FA 4B9KA 3R2IA 2OEDA 2PKOA 2I38A 2BW2A 4NJCA 2L0TA 1JWMD 3M3JA 2MHJA 2GRIA 4DXAB 4IM3A 3ZNID 3VXWA 3N3KB 2EMTA 5EE0A 2OJWA 4KSLC 2MA9B 2XNAC 1KLVA 4YL8A 4XDDA 2ON8A 2RDGA 5E6PA 1GG3A 4HKZE 2E6XA 1IP9A 2IYDB 2NR2A 4DK5A 1BMLC 1WJ4A 2NBUA 4KV2A 4NJ7A 4YTPB 5EE3A 1OGWA 1SE3A 4LTUA 3TCAA 1I4GA 1FFUA 4N58A 2MSED 1QZEA 1XLPA 4B6WA 4AOFA 4GGQA 2K8CA 1TZOA 2IY0B 3PZDA 4EE2A 3VUWA 4MSMB 2C60A 3N9YC 2KFKA 2CU3A 5BO4B 2D3CA 3NG0A 2MBBB 4ZRIA 1WE7A 4MH8A 5AEKB 1N61A 3WAMA 3PSEB 4EFOA 3DBLI 3SHQA 4N6EB 4HEA1 3AEEB 4WURA 2KVRA 1AW7A 4HJKA 1YD8U 3K9PB 4ANUA 5EE1A 2UU7A 4CQNA 2IPKD 2DZMA 4FJZA 2LRUA 5IA7A 2WXHA 3AE2B 2VZKD 4ACFA 2R2OA 3PPAA 3KH0A 1LXDA 3P2BA 4X57B 4URKA 1CJEA 2WHIA 1JRUA 3QWZB 5HKHA 1UF0A 1PFDA 1VDVA 1RWSA 2M4NA 4PS7A 3BYTB 2GBRA 4GLSC 3PRMB 2CKHB 1SJED 2K25A 4KDLB 2MJEA 3ZJTA 2EKIA 2QMTA 4DHZE 2KWCA 2KXJA 2MWSB 2V3SA 3S2AA 1L4ZB 5IKCM 3SFDB 2R2QA 1P1AA 2KMMA 3KW5B 1TS2A 2FCMA 2M0AA 4W9LA 3QA8A 4GIVA 4RF1A 3T3OA 1ESFA 5C1ZA 3UI3A 1ZOYB 4F1SA 1ZDVA 2M1MA 3V05A 1L6VA 4YXDB 1FPYA 3ZDMC 5DPTA 5D3IB 2BKRB 1V97A 2BYFA 4E71A 3N1YC 2JWZA 3ZVVA 1JWSD 2QILA 4YTMB 3UQBA 2BB6A 3A4SC 3A9KB 3RNGC 2MW5A 2IDYA 3W5UB 3AB5A 1VJKA 3ZNZB 1TGZB 1KLGD 3AH7A 2G9HD 2L52A 4WAFA 3EUB2 1JWBD 2N9EB 5KHQA 4JLCA 4ANWA 2NPTA 2CHZA 1E8WA 1VR9A 1V5TA 2K9XA 4TSSA 5AUKA 2JYTA 4XC2A 1MI0A 1R4MB 2AL6A 2FIFA 2GBNA 2WXGA 2ZEQA 1BXTA 1P7FA 3IHPC 1EWCA 3AU4A 5BYQA 3M95A 2GOWA 4OZBA 1UGJA 3DWGC 3DCGA 3N1XC 1JQ4A 2ONQA 4BZAA 1L7YA 2BKFA 2L83A 1LFDA 3PZ7A 1VZ6A 3PLUA 3MC0B 2UYZB 2JX5A 2KQ4X 1LO5D 1WX8A 1RYJA 4BKGA 1FD6A 4USAA 5G5HA 3NJTA 1J8CA 3W1YA 3AEGB 3DVNU 4FHKA 3KYCD 2W82A 4KX6B 1DYQA 3AV8A 2IO2B 4NQKE 1XLQA 3KUCB 3QIJA 4LNKA 5BYSA 1TS4A 1JRPA 2KOXA 1E7PB 4WWMA 2KFKB 2WX0A 1Q1OA 2MJ3A 2LJ5A 4AP4C 2M8SA 2LXCA 2MCNB 2KDIA 1RAXA 1KJTA 1YQ4B 3ML8A 1CQVA 1WF9A 4A55A 1XXGA 1LGRA 3ABVB 1EM7A 3PZ8A 4BFRA 2MX2A 4IKGA 2K0PA 5HFYA 1F2RC 1R4MI 1WGRA 2BWES 3X0WA 4YWGG 1I4QA 3NOBA 3B9JA 4E74A 3K9OB 4GXBA 1ENFA 1C78A 2W9NA 1E5WA 1FEHA 2N9KA 1WIAA 4M0WB 2J0KA 4KKIA 4WQOB 4YSXB 4NPNA 2KDFB 3OAWA 3KVFB 5AUIA 2WLBA 2JZZA 2D3GA 1F1HA 1U4AA 2K22A 3DBRI 3NVYA 2IO0B 3VVWB 3AE1B 3MP9A 2WGSA 2JQRB 3B1LX 1T0SC 4PYZA 5J17A 2DZJA 3HVZA 3Q3NC 2WYQA 4TQ1A 3ZNGC 1N5WA 3R3MA 2MRPA 5CX3A 3E9SA 2EKEC 5D94A 1GC6A 2HE7A 4A3OA 2V3NA 1KFYB 1T3QA 2VH2A 3V60A 3FAHA 1MG4A 4K7WA 3RT3B 5GMVA 1KF6B 2I2YA 4WWPA 1S1QB 5E6NA 2LGSA 2KN5A 4GU2A 1F52A 2HJ1A 3EHVA 2PVOD 3AE8B 2WDTB 5IP4D 2NPTB 1WYGA 2G4DB 1XLNA 2KC2A 2Y5CA 4FULA 4A9AA
chains in the Genus database with same CATH topology
3I3TB 3HIZA 4WJOA 2NVUI 1E8YA 1WYWB 2JPHA 4JIOU 4ZRKA 4GDKA 4GB9A 4NJ6A 1LM8B 2YVCA 4IWOA 2LGYA 2VRRB 1PQSA 5FR6A 3PGEA 3NY5A 3U8ZA 2GBKA 1LQBA 1X1MA 1UELA 4CHKA 3ZKJC 3UQAA 3APFA 2KLGA 1ZGUB 2L00B 3ML9A 1WGYA 2JUOA 3IBEA 3ENEA 2DYOA 1EO6A 2N1VA 3DPDA 3L54A 2PPHA 3ZRCA 4TQ0A 4B9KA 5G2NA 2L8JA 4RM8A 3WANA 2ZVOA 3W1SC 3MHSD 1K8RB 3R7QA 2BGFA 4GDLA 3QQ8B 5DCNA 2L0TA 4JQWC 3M3JA 1MG8A 3PVLA 2ZPYA 2BYEA 2MBEA 3PS6A 4DXAB 2LVQA 1VD2A 2ZCBA 1V9JA 4IM3A 3VXWA 3ZNID 3N3KB 1S3SG 4B95A 2EMTA 2RD0A 3VH3B 4KSLC 5D6JB 2MA9B 1KLVA 2JXXA 2GBJA 4YL8A 2K6QA 4BBNF 3SDLC 2QHOA 3VQIA 3H7PA 1UGMA 2FCNA 3VUXA 5E6PA 1GG3A 4HPLB 1IYFA 1WMHB 2D2QA 2N4FA 2RR9A 4FJYA 1IP9A 3CF6E 4FADA 1C3TA 2IYDB 1V5OA 2G4SA 3NHEB 2NR2A 3V6EB 2LXAA 4DK5A 2KWVB 3RD2A 1WJ4A 2NBUA 3H7SA 4KV2A 1Z5SB 1ISNA 1YX6B 4NJ7A 4WJPA 1I35A 1OGWA 3L10B 4G0NB 1WJ6A 2WX1A 3IVFA 3TCAA 2IZVB 2Y5BB 1H4RA 1HE8A 4CO7A 3SU8X 1E7UA 2LGDA 2N7DA 4WAAA 3ZLZA 4DHJD 4M8MA 2MSED 4WWNA 2KMAA 1QZEA 3JSVA 4MM3A 3DBSA 1NBFC 4A3PA 5L95C 2KZRA 1EUVB 1V49A 2C7NB 2LVOA 2KTFA 1WZ0A 4B6WA 4AOFA 4KZ0A 2WWZA 4GGQA 4TUUA 4IM2A 2K8CA 2KK8A 2EMSA 2FNJB 2I1KA 1WXVA 3TL5A 1ZW7A 4PYUA 2IY0B 1ZKHA 3PZDA 3JVZX 3VUWA 2KMCA 4MSMB 3TIXA 4EZJA 2NCNA 4I6LB 2C60A 2KFKA 5BO4B 1IPGA 3UIPB 2MBBB 4ZRIA 4MEMA 1WE7A 1WH3A 3WALA 5AEKB 2K39A 4ZYNA 2G45B 2ZNVC 1WX7A 3IFWB 3VTUA 4RM9A 4KZCA 3WAMA 1KOTA 3A9JA 4W9JA 1GJZA 1E7VA 3PSEB 4EFOA 3DVNV 3WA0A 3DBLI 3SHQA 4EZKA 1L2NA 2A5UA 4LJPB 3AU5A 2FCQA 2KVRA 2NBWB 4FJVB 4HJKA 4IM0A 4F8CB 4ANVA 3PHXB 2DHZA 2DENB 3JYUA 1RLFA 1YD8U 3Q3FA 3K9PB 4ANUA 2LGXA 1UH6A 3QC8B 1WM3A 4FHJA 3ZRFA 2DZMA 2N7EA 3EECA 4FJZA 2LRUA 3WAPA 5IA7A 3APCA 3BY4B 4GN1A 3VTVA 2R2OA 2HJ8A 2O2VA 3RULA 3PPAA 1UBIA 3GZNI 3KH0A 4KIKA 1CMXB 1LXDA 3A1QA 3P2BA 1NI2A 2L3ZA 4NNJB 3VFKA 4MGYE 3ZTCA 2DZIA 2FUHB 4AUQC 4DDID 4X57B 4ICUA 4URKA 5CTRC 1JRUA 1VCBA 3QWZB 3QHTA 4CYEA 2J0MA 3AXCA 5HKHA 4ZDVA 2CS4A 4IW0A 4PS7A 2M4NA 3V6CB 2XK5B 2GBRA 3W1SA 1GUAB 3PRMB 1WZ3A 1GNUA 2CKHB 3KYDD 4NAWB 4AJWA 2K25A 4KDLB 3RZFA 5J18A 4LDTD 5EDSA 4K81A 3LJ3A 2D10A 2NS5A 3ONSA 1WY8A 1UZXB 3UF8A 4DHZE 2KWCA 2KXJA 2MWSB 2V3SA 3S2AA 4TKNA 3MJWA 1WGDA 2R2QA 1P1AA 3KW5B 2FCMA 3PTFC 4W9LA 2B3AA 2L7RA 2ZVNA 4II3B 3PV1A 3QA8A 1SIFA 1WE6A 4GIVA 4MJSB 4W9KA 5C1ZA 2KANA 2LUEA 3RCZA 3ZUNA 5LLIA 4F1SA 2KTRA 5DPRA 2LASA 3CMMB 2M1MA 4LJOB 4AWJA 2O6VB 4GOCA 3ZDMC 1EF1A 1RRBA 5DPTA 2BKRB 2BYFA 2AEHA 4E71A 3PRZA 2JWZA 4W9GA 4N9F4 3ZVVA 3HK0A 1FXTB 3UQBA 4HCPB 2ASQA 3A4SC 3PT2B 3A9KB 4M8NA 3ZTDA 2MW5A 4W9IA 4ASWC 3VHTC 1WGHA 4FLHA 3TMPB 3JW0X 2LVPA 3ZO5B 3ZNZB 1TGZB 3UGBB 2D07B 5LXHA 3OJ4B 2BYVE 4DHZB 4GMVA 3M63B 3U30A 2C5LC 3KUDB 2MP2B 3EC8A 3HHMA 1E8ZA 3KUZA 4G11A 2BPSA 4DBGA 3UINB 5AZGA 3M62B 1YJ1A 2N9EB 4KSKC 2L05A 4GDKB 2JVCA 2LRWA 3PLVA 5KHQA 4JLCA 1J19A 4ANWA 2REXA 2NPTA 1WR1A 2RSUA 2CHZA 2KD0A 4MGKE 3Q3JA 2KX3A 1E8WA 3DVGY 4IC7B 3U7DA 3VTWA 3WIMA 1V5TA 2J7QB 1BT0A 1WM2A 4DDGD 4KDIC 5C23A 4ANXA 4XX5A 1WFYA 3OLMD 4K7SA 4XC2A 1V86A 3RYTA 3VDZA 2NBVB 2AL6A 2FIFA 5E6OA 2GBNA 4GDLB 2V1YA 2JRIB 4GSWA 2ZEQA 2MLBA 3H1UA 3QJZA 3B0AA 2CU1A 4W9CA 4EEWA 1EF5A 3IHPC 4PS3A 4PS8A 2DYMA 4XZ4A 3QK0A 4MGZE 2HD5B 3X23A 2DZKA 3AU4A 2AL3A 4EOYA 4EZLA 2BF8B 2KFJA 1Q5WB 2LI5A 2UWQA 2GOWA 3M95A 2ZPNA 2JF5A 2KX0A 1WX9A 3BINA 3DCGA 4FN2A 3H7PB 2RPQA 3LDZE 5KHOA 3QARA 3T8MA 5DPWA 2DX5B 1L7YA 2BKFA 1OTRB 1LFDA 4DHJB 1Y8RC 3ZDTA 5AZHA 2Z0EB 5L83A 4HCNB 4KVGB 3O65B 3PLUA 2UYZB 4IWQA 2Z59B 1V81A 1P98A 3NZSA 1WX8A 4MH0E 1P0RA 5IAAC 3VUYA 2FCSA 1OQYA 4BKGA 2J0JA 1OEYA 2XEWA 1J8CA 3L13A 3W1YA 2A4ZA 2GBMA 2KKCA 3DVNU 2D11A 2MBHA 1RFAA 4FHKA 1WMHA 3KYCD 3R7RA 3AULA 3OJ3A 5CHWA 1T0YA 4W9DA 1Z2MA 2KQSA 2PEAA 2IO2B 2C9WB 3A9KA 3DQVA 4NQKE 2ZJDA 2RGFA 3KUCB 2N1WA 3QIJA 4EUTA 4K7UA 1XT9B 4G50A 3B08A 4MDKE 2DYBA 3L16A 4W9EA 4IG7B 2MP2A 3PRPB 4ZRJA 2M0XA 2KOXA 3MTNB 3QCAA 1WI0A 2V4LA 2IO1B 1WR6E 1WXAA 2JY6A 3QAQA 2KFKB 2KJ6A 1Q1OA 2WX0A 2LJ5A 4AP4C 2M8SA 2LXCA 2MCNB 4I6NB 1TZ1A 2KDIA 1RAXA 2CHXA 4MELA 1KJTA 3ML8A 4FBJB 1WF9A 5TR5A 3A4RA 4EKUA 3HM6X 4E3CA 1YX5B 2N9PC 3A9JB 2CHWA 1WJUA 4BVUC 4HDOA 3A33B 2CR5A 2MX2A 4BFRA 1A5RA 4W9HA 4BKSA 2DAFA 1OEYJ 2KDEB 1UD7A 1R4MI 1WGRA 3L08A 2BWES 1WGGA 1F9JA 4HPMB 2LWPA 4W9FA 3X0WA 3D32A 2K1FA 2JRHA 2L76A 3NS8A 4II2B 4WJNA 3ZIMA 3PHWB 3WAOA 3HM3A 3NOBA 3EFUA 2KNBA 2KWUB 2KC1A 3K9OB 4E74A 2O2VB 3H6NA 2IO3B 3NZUA 4GXBA 1KM7A 3IG3A 4KIKB 3A1QB 4BKSD 4HXDA 3AI5A 2YLMA 1YQBA 2PE6B 2W9NA 2ZCCA 5D7GA 1WXMA 5CHVC 2IBIB 1G6JA 1E5WA 2KJRA 4IWPA 4LDTB 1WXSA 4WJQA 4HWIB 1WIAA 4M0WB 3L0WB 4HK2A 5JZEB 2FAZA 2JT4B 2J0KA 4WQOB 3DVGX 4I6PA 4NPNA 1NDDA 2KDFB 1H8CA 2OJRA 4A20A 2DAJA 3TJPA 5J2RA 2AWTA 3OAWA 2FIDA 2LZ6A 3KVFB 4AJYB 4BBNC 4BOZB 2JZZA 2D3GA 5DPSA 2I1JA 1U4AA 2PE9A 4NY0A 1V2YA 1WRDB 2KJHB 2IO0B 3DBRI 3VH4B 3ZW3A 1UBQA 3VVWB 3H9DA 1TTNA 4OVUA 4HDQA 1V80A 4ICVA 2K8BA 2KLCA 2PJHA 3GOEA 3B1LX 4LCDE 3CSFA 5CHFA 4HLEA 1P9DU 2C7HA 4PYZA 3L17A 5J17A 2BWFA 2DZJA 2XK5A 1Q0WB 2JZ3B 5JH5C 1D3ZA 3ZNHB 4OVVA 4RMAA 2OOBB 2WYQA 4TQ1A 3R66C 3ZNGC 3N32A 4NAWA 2KO3A 1TBEA 4K1RB 2L0FA 3VAWA 3R3MA 2MRPA 3SD5A 2ZZPB 5CX3A 2EKEC 5D94A 1GC6A 2KTRB 2HE7A 3PREA 4A3OA 4F7ZA 4MSQB 1E90A 3N30A 3ECIA 3V60A 1WJNA 2HTHA 2M17A 3V61A 4K7WA 5LXIB 3RT3B 4JL9A 1SE9A 1M94A 5GMVA 3C0RB 4WWPA 4G3XB 1S1QB 4JGHB 2K8HA 4MJSA 2K6DB 2MQJA 3QX1A 4HVBA 2KDBA 5E6NA 1P3QU 2IY1B 2LD9A 2MBQA 4NQLB 4BKTA 5JHBA 1J0GA 5G55A 2O6VA 4TV3A 2MBOA 3TBLD 3DBHI 5D2MB 2KN5A 2N9XA 2G3QB 4GU2A 4DWFA 3DOWA 4P7IA 3EHVA 1AARA 4J6IA 5AZFA 2KHWB 1GC7A 3JSVB 4WWOA 2WDTB 1SGHA 2GMIC 3APDA 3RUIB 1I42A 1R4NI 2NPTB 2XBBC 4IUMB 2O6VD 3ALBA 3T9LA 2G4DB 3DDCB 2AYOB 2Z0DB 1V6EA 2C7MB 1YIWA 2KC2A 4MGIE 4FA6A 1XD3B 2ZNVB 1C1YB 3RZWC 4BOSC 1E8XA 3V62A 4FULA 3CSTA 1XQQA 2KQ7A 3UIOB 5JHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I3T B;  3HIZ A;  4WJO A;  2NVU I;  1E8Y A;  1WYW B;  2JPH A;  4JIO U;  4ZRK A;  4GDK A;  4GB9 A;  4NJ6 A;  1LM8 B;  2YVC A;  4IWO A;  2LGY A;  2VRR B;  1PQS A;  5FR6 A;  3PGE A;  3NY5 A;  3U8Z A;  2GBK A;  1LQB A;  1X1M A;  1UEL A;  4CHK A;  3ZKJ C;  3UQA A;  3APF A;  2KLG A;  1ZGU B;  2L00 B;  3ML9 A;  1WGY A;  2JUO A;  3IBE A;  3ENE A;  2DYO A;  1EO6 A;  2N1V A;  3DPD A;  3L54 A;  2PPH A;  3ZRC A;  4TQ0 A;  4B9K A;  5G2N A;  2L8J A;  4RM8 A;  3WAN A;  2ZVO A;  3W1S C;  3MHS D;  1K8R B;  3R7Q A;  2BGF A;  4GDL A;  3QQ8 B;  5DCN A;  2L0T A;  4JQW C;  3M3J A;  1MG8 A;  3PVL A;  2ZPY A;  2BYE A;  2MBE A;  3PS6 A;  4DXA B;  2LVQ A;  1VD2 A;  2ZCB A;  1V9J A;  4IM3 A;  3VXW A;  3ZNI D;  3N3K B;  1S3S G;  4B95 A;  2EMT A;  2RD0 A;  3VH3 B;  4KSL C;  5D6J B;  2MA9 B;  1KLV A;  2JXX A;  2GBJ A;  4YL8 A;  2K6Q A;  4BBN F;  3SDL C;  2QHO A;  3VQI A;  3H7P A;  1UGM A;  2FCN A;  3VUX A;  5E6P A;  1GG3 A;  4HPL B;  1IYF A;  1WMH B;  2D2Q A;  2N4F A;  2RR9 A;  4FJY A;  1IP9 A;  3CF6 E;  4FAD A;  1C3T A;  2IYD B;  1V5O A;  2G4S A;  3NHE B;  2NR2 A;  3V6E B;  2LXA A;  4DK5 A;  2KWV B;  3RD2 A;  1WJ4 A;  2NBU A;  3H7S A;  4KV2 A;  1Z5S B;  1ISN A;  1YX6 B;  4NJ7 A;  4WJP A;  1I35 A;  1OGW A;  3L10 B;  4G0N B;  1WJ6 A;  2WX1 A;  3IVF A;  3TCA A;  2IZV B;  2Y5B B;  1H4R A;  1HE8 A;  4CO7 A;  3SU8 X;  1E7U A;  2LGD A;  2N7D A;  4WAA A;  3ZLZ A;  4DHJ D;  4M8M A;  2MSE D;  4WWN A;  2KMA A;  1QZE A;  3JSV A;  4MM3 A;  3DBS A;  1NBF C;  4A3P A;  5L95 C;  2KZR A;  1EUV B;  1V49 A;  2C7N B;  2LVO A;  2KTF A;  1WZ0 A;  4B6W A;  4AOF A;  4KZ0 A;  2WWZ A;  4GGQ A;  4TUU A;  4IM2 A;  2K8C A;  2KK8 A;  2EMS A;  2FNJ B;  2I1K A;  1WXV A;  3TL5 A;  1ZW7 A;  4PYU A;  2IY0 B;  1ZKH A;  3PZD A;  3JVZ X;  3VUW A;  2KMC A;  4MSM B;  3TIX A;  4EZJ A;  2NCN A;  4I6L B;  2C60 A;  2KFK A;  5BO4 B;  1IPG A;  3UIP B;  2MBB B;  4ZRI A;  4MEM A;  1WE7 A;  1WH3 A;  3WAL A;  5AEK B;  2K39 A;  4ZYN A;  2G45 B;  2ZNV C;  1WX7 A;  3IFW B;  3VTU A;  4RM9 A;  4KZC A;  3WAM A;  1KOT A;  3A9J A;  4W9J A;  1GJZ A;  1E7V A;  3PSE B;  4EFO A;  3DVN V;  3WA0 A;  3DBL I;  3SHQ A;  4EZK A;  1L2N A;  2A5U A;  4LJP B;  3AU5 A;  2FCQ A;  2KVR A;  2NBW B;  4FJV B;  4HJK A;  4IM0 A;  4F8C B;  4ANV A;  3PHX B;  2DHZ A;  2DEN B;  3JYU A;  1RLF A;  1YD8 U;  3Q3F A;  3K9P B;  4ANU A;  2LGX A;  1UH6 A;  3QC8 B;  1WM3 A;  4FHJ A;  3ZRF A;  2DZM A;  2N7E A;  3EEC A;  4FJZ A;  2LRU A;  3WAP A;  5IA7 A;  3APC A;  3BY4 B;  4GN1 A;  3VTV A;  2R2O A;  2HJ8 A;  2O2V A;  3RUL A;  3PPA A;  1UBI A;  3GZN I;  3KH0 A;  4KIK A;  1CMX B;  1LXD A;  3A1Q A;  3P2B A;  1NI2 A;  2L3Z A;  4NNJ B;  3VFK A;  4MGY E;  3ZTC A;  2DZI A;  2FUH B;  4AUQ C;  4DDI D;  4X57 B;  4ICU A;  4URK A;  5CTR C;  1JRU A;  1VCB A;  3QWZ B;  3QHT A;  4CYE A;  2J0M A;  3AXC A;  5HKH A;  4ZDV A;  2CS4 A;  4IW0 A;  4PS7 A;  2M4N A;  3V6C B;  2XK5 B;  2GBR A;  3W1S A;  1GUA B;  3PRM B;  1WZ3 A;  1GNU A;  2CKH B;  3KYD D;  4NAW B;  4AJW A;  2K25 A;  4KDL B;  3RZF A;  5J18 A;  4LDT D;  5EDS A;  4K81 A;  3LJ3 A;  2D10 A;  2NS5 A;  3ONS A;  1WY8 A;  1UZX B;  3UF8 A;  4DHZ E;  2KWC A;  2KXJ A;  2MWS B;  2V3S A;  3S2A A;  4TKN A;  3MJW A;  1WGD A;  2R2Q A;  1P1A A;  3KW5 B;  2FCM A;  3PTF C;  4W9L A;  2B3A A;  2L7R A;  2ZVN A;  4II3 B;  3PV1 A;  3QA8 A;  1SIF A;  1WE6 A;  4GIV A;  4MJS B;  4W9K A;  5C1Z A;  2KAN A;  2LUE A;  3RCZ A;  3ZUN A;  5LLI A;  4F1S A;  2KTR A;  5DPR A;  2LAS A;  3CMM B;  2M1M A;  4LJO B;  4AWJ A;  2O6V B;  4GOC A;  3ZDM C;  1EF1 A;  1RRB A;  5DPT A;  2BKR B;  2BYF A;  2AEH A;  4E71 A;  3PRZ A;  2JWZ A;  4W9G A;  4N9F 4;  3ZVV A;  3HK0 A;  1FXT B;  3UQB A;  4HCP B;  2ASQ A;  3A4S C;  3PT2 B;  3A9K B;  4M8N A;  3ZTD A;  2MW5 A;  4W9I A;  4ASW C;  3VHT C;  1WGH A;  4FLH A;  3TMP B;  3JW0 X;  2LVP A;  3ZO5 B;  3ZNZ B;  1TGZ B;  3UGB B;  2D07 B;  5LXH A;  3OJ4 B;  2BYV E;  4DHZ B;  4GMV A;  3M63 B;  3U30 A;  2C5L C;  3KUD B;  2MP2 B;  3EC8 A;  3HHM A;  1E8Z A;  3KUZ A;  4G11 A;  2BPS A;  4DBG A;  3UIN B;  5AZG A;  3M62 B;  1YJ1 A;  2N9E B;  4KSK C;  2L05 A;  4GDK B;  2JVC A;  2LRW A;  3PLV A;  5KHQ A;  4JLC A;  1J19 A;  4ANW A;  2REX A;  2NPT A;  1WR1 A;  2RSU A;  2CHZ A;  2KD0 A;  4MGK E;  3Q3J A;  2KX3 A;  1E8W A;  3DVG Y;  4IC7 B;  3U7D A;  3VTW A;  3WIM A;  1V5T A;  2J7Q B;  1BT0 A;  1WM2 A;  4DDG D;  4KDI C;  5C23 A;  4ANX A;  4XX5 A;  1WFY A;  3OLM D;  4K7S A;  4XC2 A;  1V86 A;  3RYT A;  3VDZ A;  2NBV B;  2AL6 A;  2FIF A;  5E6O A;  2GBN A;  4GDL B;  2V1Y A;  2JRI B;  4GSW A;  2ZEQ A;  2MLB A;  3H1U A;  3QJZ A;  3B0A A;  2CU1 A;  4W9C A;  4EEW A;  1EF5 A;  3IHP C;  4PS3 A;  4PS8 A;  2DYM A;  4XZ4 A;  3QK0 A;  4MGZ E;  2HD5 B;  3X23 A;  2DZK A;  3AU4 A;  2AL3 A;  4EOY A;  4EZL A;  2BF8 B;  2KFJ A;  1Q5W B;  2LI5 A;  2UWQ A;  2GOW A;  3M95 A;  2ZPN A;  2JF5 A;  2KX0 A;  1WX9 A;  3BIN A;  3DCG A;  4FN2 A;  3H7P B;  2RPQ A;  3LDZ E;  5KHO A;  3QAR A;  3T8M A;  5DPW A;  2DX5 B;  1L7Y A;  2BKF A;  1OTR B;  1LFD A;  4DHJ B;  1Y8R C;  3ZDT A;  5AZH A;  2Z0E B;  5L83 A;  4HCN B;  4KVG B;  3O65 B;  3PLU A;  2UYZ B;  4IWQ A;  2Z59 B;  1V81 A;  1P98 A;  3NZS A;  1WX8 A;  4MH0 E;  1P0R A;  5IAA C;  3VUY A;  2FCS A;  1OQY A;  4BKG A;  2J0J A;  1OEY A;  2XEW A;  1J8C A;  3L13 A;  3W1Y A;  2A4Z A;  2GBM A;  2KKC A;  3DVN U;  2D11 A;  2MBH A;  1RFA A;  4FHK A;  1WMH A;  3KYC D;  3R7R A;  3AUL A;  3OJ3 A;  5CHW A;  1T0Y A;  4W9D A;  1Z2M A;  2KQS A;  2PEA A;  2IO2 B;  2C9W B;  3A9K A;  3DQV A;  4NQK E;  2ZJD A;  2RGF A;  3KUC B;  2N1W A;  3QIJ A;  4EUT A;  4K7U A;  1XT9 B;  4G50 A;  3B08 A;  4MDK E;  2DYB A;  3L16 A;  4W9E A;  4IG7 B;  2MP2 A;  3PRP B;  4ZRJ A;  2M0X A;  2KOX A;  3MTN B;  3QCA A;  1WI0 A;  2V4L A;  2IO1 B;  1WR6 E;  1WXA A;  2JY6 A;  3QAQ A;  2KFK B;  2KJ6 A;  1Q1O A;  2WX0 A;  2LJ5 A;  4AP4 C;  2M8S A;  2LXC A;  2MCN B;  4I6N B;  1TZ1 A;  2KDI A;  1RAX A;  2CHX A;  4MEL A;  1KJT A;  3ML8 A;  4FBJ B;  1WF9 A;  5TR5 A;  3A4R A;  4EKU A;  3HM6 X;  4E3C A;  1YX5 B;  2N9P C;  3A9J B;  2CHW A;  1WJU A;  4BVU C;  4HDO A;  3A33 B;  2CR5 A;  2MX2 A;  4BFR A;  1A5R A;  4W9H A;  4BKS A;  2DAF A;  1OEY J;  2KDE B;  1UD7 A;  1R4M I;  1WGR A;  3L08 A;  2BWE S;  1WGG A;  1F9J A;  4HPM B;  2LWP A;  4W9F A;  3X0W A;  3D32 A;  2K1F A;  2JRH A;  2L76 A;  3NS8 A;  4II2 B;  4WJN A;  3ZIM A;  3PHW B;  3WAO A;  3HM3 A;  3NOB A;  3EFU A;  2KNB A;  2KWU B;  2KC1 A;  3K9O B;  4E74 A;  2O2V B;  3H6N A;  2IO3 B;  3NZU A;  4GXB A;  1KM7 A;  3IG3 A;  4KIK B;  3A1Q B;  4BKS D;  4HXD A;  3AI5 A;  2YLM A;  1YQB A;  2PE6 B;  2W9N A;  2ZCC A;  5D7G A;  1WXM A;  5CHV C;  2IBI B;  1G6J A;  1E5W A;  2KJR A;  4IWP A;  4LDT B;  1WXS A;  4WJQ A;  4HWI B;  1WIA A;  4M0W B;  3L0W B;  4HK2 A;  5JZE B;  2FAZ A;  2JT4 B;  2J0K A;  4WQO B;  3DVG X;  4I6P A;  4NPN A;  1NDD A;  2KDF B;  1H8C A;  2OJR A;  4A20 A;  2DAJ A;  3TJP A;  5J2R A;  2AWT A;  3OAW A;  2FID A;  2LZ6 A;  3KVF B;  4AJY B;  4BBN C;  4BOZ B;  2JZZ A;  2D3G A;  5DPS A;  2I1J A;  1U4A A;  2PE9 A;  4NY0 A;  1V2Y A;  1WRD B;  2KJH B;  2IO0 B;  3DBR I;  3VH4 B;  3ZW3 A;  1UBQ A;  3VVW B;  3H9D A;  1TTN A;  4OVU A;  4HDQ A;  1V80 A;  4ICV A;  2K8B A;  2KLC A;  2PJH A;  3GOE A;  3B1L X;  4LCD E;  3CSF A;  5CHF A;  4HLE A;  1P9D U;  2C7H A;  4PYZ A;  3L17 A;  5J17 A;  2BWF A;  2DZJ A;  2XK5 A;  1Q0W B;  2JZ3 B;  5JH5 C;  1D3Z A;  3ZNH B;  4OVV A;  4RMA A;  2OOB B;  2WYQ A;  4TQ1 A;  3R66 C;  3ZNG C;  3N32 A;  4NAW A;  2KO3 A;  1TBE A;  4K1R B;  2L0F A;  3VAW A;  3R3M A;  2MRP A;  3SD5 A;  2ZZP B;  5CX3 A;  2EKE C;  5D94 A;  1GC6 A;  2KTR B;  2HE7 A;  3PRE A;  4A3O A;  4F7Z A;  4MSQ B;  1E90 A;  3N30 A;  3ECI A;  3V60 A;  1WJN A;  2HTH A;  2M17 A;  3V61 A;  4K7W A;  5LXI B;  3RT3 B;  4JL9 A;  1SE9 A;  1M94 A;  5GMV A;  3C0R B;  4WWP A;  4G3X B;  1S1Q B;  4JGH B;  2K8H A;  4MJS A;  2K6D B;  2MQJ A;  3QX1 A;  4HVB A;  2KDB A;  5E6N A;  1P3Q U;  2IY1 B;  2LD9 A;  2MBQ A;  4NQL B;  4BKT A;  5JHB A;  1J0G A;  5G55 A;  2O6V A;  4TV3 A;  2MBO A;  3TBL D;  3DBH I;  5D2M B;  2KN5 A;  2N9X A;  2G3Q B;  4GU2 A;  4DWF A;  3DOW A;  4P7I A;  3EHV A;  1AAR A;  4J6I A;  5AZF A;  2KHW B;  1GC7 A;  3JSV B;  4WWO A;  2WDT B;  1SGH A;  2GMI C;  3APD A;  3RUI B;  1I42 A;  1R4N I;  2NPT B;  2XBB C;  4IUM B;  2O6V D;  3ALB A;  3T9L A;  2G4D B;  3DDC B;  2AYO B;  2Z0D B;  1V6E A;  2C7M B;  1YIW A;  2KC2 A;  4MGI E;  4FA6 A;  1XD3 B;  2ZNV B;  1C1Y B;  3RZW C;  4BOS C;  1E8X A;  3V62 A;  4FUL A;  3CST A;  1XQQ A;  2KQ7 A;  3UIO B;  5JHA A; 
#chains in the Genus database with same CATH topology
 2JSV X;  3HIZ A;  4WJO A;  4GDK A;  3RNE C;  5TSS A;  3NY5 A;  1X1M A;  1UEL A;  2B76 B;  1IGC A;  1HZ6 A;  3ML9 A;  1WGY A;  3IBE A;  3NVZ A;  5G2N A;  1YQ3 B;  2AQ3 B;  3RNF C;  3W1S C;  3MHS D;  2ZW1 A;  2WDR B;  5DCN A;  1AYF A;  3BYY B;  2J4X A;  1V9J A;  1S3S G;  3W9C B;  5D6J B;  2GBJ A;  3Q3O C;  4J3O D;  5FR3 A;  3SDL C;  1FRD A;  2QHO A;  3H7P A;  2FCN A;  2AX5 A;  4US8 A;  4HPL B;  1IYF A;  4FJY A;  3CF6 E;  1C3T A;  1V1P A;  2QCZ A;  3NHE B;  3V6E B;  3RD2 A;  1WGK A;  2V4I B;  1YX6 B;  4HKQ A;  3GP7 A;  2H88 B;  3H8H A;  4G0N B;  1K50 A;  1WXQ A;  1WJ6 A;  3IVF A;  2IJ0 A;  5GXG B;  1E7U A;  4DHJ D;  4WWN A;  4RNA A;  4MM3 A;  2SAK A;  3DBS A;  1N63 A;  1NBF C;  2KZR A;  2WXP A;  4IDI A;  2C7N B;  3AEA B;  2LVO A;  2KTF A;  1WZ0 A;  2WWZ A;  4TUU A;  1Y56 A;  4IM2 A;  2KK8 A;  2FNJ B;  2I1K A;  1WXV A;  3TL5 A;  4WH4 A;  2KMC A;  3TIX A;  2LHE A;  1IPG A;  3UIP B;  1QIL A;  4L1B A;  1J7C A;  4XWT A;  1SBB B;  3B2F A;  1ROE A;  3IFW B;  3A9J A;  2PTL A;  3FIL B;  4KKJ A;  2A5U A;  2W54 A;  3AEC B;  4IM0 A;  1HEZ E;  2DEN B;  3JYU A;  1B1Z A;  2N7E A;  4UDU C;  3APC A;  4GN1 A;  1JWU D;  4HRO A;  3VTV A;  2WXL A;  3GZN I;  3A1Q A;  3ZJU A;  1NI2 A;  4MGY E;  2DZI A;  4AUQ C;  1TIF A;  5CTR C;  5H8Y E;  3QHT A;  3TUO A;  4AQ7 A;  2J0M A;  2FUG 1;  3AXC A;  4ZDV A;  2JU6 X;  3V6C B;  4RGO S;  3W1S A;  1GUA B;  4MAC A;  1WZ3 A;  2CJN A;  1QOA A;  1FMA D;  3RZF A;  1MHX A;  5EDS A;  3RI7 C;  3I9V 1;  2NS5 A;  2WXR A;  4LNO A;  1UZX B;  1STE A;  1MHH E;  3MJW A;  3PTF C;  3GS2 A;  2LMC A;  2W55 A;  2KAN A;  3RCZ A;  4LNI A;  1C79 A;  4PK1 A;  5LLI A;  1CZP A;  1FFV A;  1L5P A;  3CMM B;  3GE3 C;  4LJO B;  4AWJ A;  4GOC A;  2IGG A;  1L4D B;  1VRA B;  5I4D A;  3BVM A;  4ZHO A;  3EA6 A;  3PT2 B;  3ZTD A;  4M8N A;  4ASW C;  1BUI C;  1WGH A;  2W3R A;  3JW0 X;  2M19 A;  5LXH A;  4DHZ B;  1GB4 A;  4GMV A;  2INC C;  3M63 B;  2J53 A;  3U30 A;  3VRB B;  2MP2 B;  1NI3 A;  1E8Z A;  1C4P A;  3KUZ A;  4G11 A;  3P1M A;  5AZG A;  4KSK C;  4GDK B;  2JVC A;  3BWU D;  3Q14 C;  4AS1 A;  1WR1 A;  4KGR A;  2KX3 A;  3WIM A;  3TEX A;  2J7Q B;  1I4H A;  4N59 A;  4KDI C;  5C23 A;  1L0V B;  1WFY A;  4XX5 A;  4K7S A;  2NMQ A;  2NBV B;  4GSW A;  3QJZ A;  3C8Y A;  5T8I A;  2CU1 A;  4W9C A;  4EEW A;  1EF5 A;  2LHD A;  1A70 A;  4MGZ E;  3X23 A;  2DZK A;  4HRS A;  3RN9 C;  4EOY A;  2WQY B;  3SR6 A;  2ZW0 A;  4FN2 A;  3H7P B;  3Q8F A;  3L4P A;  3U7Z A;  5KHO A;  3QAR A;  3T8M A;  5DPW A;  2DX5 B;  1OTR B;  1EU4 A;  1Y8R C;  3ZDT A;  5L83 A;  4HCN B;  2BT6 A;  1SE2 A;  3N20 C;  3DWM A;  2Z59 B;  3BVZ A;  1V81 A;  1NYQ A;  3E56 A;  3KWL A;  5HHD G;  3VUY A;  2FCS A;  1OQY A;  2Y5P A;  1OEY A;  2GBM A;  2KKC A;  2MBH A;  1WMH A;  2KYW A;  3AUL A;  1T0Y A;  2KQS A;  2PEA A;  2ZJD A;  4EUT A;  2BTE A;  4K7U A;  3CIR B;  1XT9 B;  4G50 A;  3B08 A;  1GB1 A;  4W9E A;  2M0X A;  1QLB B;  1DOY A;  1WI0 A;  3MC8 A;  4C4V B;  4ITK A;  4US9 A;  3RMK C;  2JZP A;  1WXA A;  2JY6 A;  3AE9 B;  2KJ6 A;  3GE8 C;  1F2R I;  1JWA D;  4I6N B;  2CHX A;  5TR5 A;  4EKU A;  3BVG A;  3HM6 X;  2Z8L A;  2Q5W D;  2VZK B;  1YX5 B;  3R8B A;  2N9P C;  3A9J B;  3P4R B;  1L6U A;  4HDO A;  3A33 B;  1OQR A;  2CR5 A;  3AE3 B;  1PYW D;  4W9H A;  1OEY J;  1UD7 A;  3L08 A;  5D3D A;  3TEZ A;  3ETR A;  4W9F A;  2LWP A;  5FKA C;  4NAM A;  3PHW B;  3P4Q B;  3AN1 A;  2WXF A;  3MFG A;  4YSY B;  1KM7 A;  1DOI A;  3A1Q B;  4BKS D;  2ZCC A;  5D7G A;  2HTM E;  2ACZ B;  4HPP A;  5CHV C;  2IBI B;  4WJQ A;  4HWI B;  1FO4 A;  4I6P A;  1NDD A;  1OQQ A;  2DAJ A;  3TJP A;  4OW0 A;  2FID A;  4BBN C;  4NY0 A;  1V2Y A;  1WRD B;  3WCQ A;  3VH4 B;  3ZW3 A;  1XCQ L;  2Y3A A;  1UNS A;  1V80 A;  3GOE A;  5CHF A;  2KAC A;  2TSS A;  3SEB A;  1P9D U;  3L17 A;  1FNU A;  5E6J A;  5EE9 A;  5JH5 C;  3ZNH B;  4OVV A;  4OZA A;  3I63 C;  3N32 A;  1KRH A;  3VAW A;  1PDX A;  3SD5 A;  1E10 A;  2NTT A;  2WNM A;  1I4X A;  1E90 A;  3N30 A;  2WXO A;  3ECI A;  4RFB A;  2HTH A;  3T3N A;  3RPF C;  1SE9 A;  2KWD A;  1M94 A;  4B0M A;  1CK1 A;  2K8H A;  4MJS A;  2MQJ A;  2KDB A;  1P3Q U;  2LD9 A;  3FC4 A;  4BKT A;  5JHB A;  2QDF A;  3RNA C;  1J0G A;  1RFK A;  4TV3 A;  4Q2J A;  3TBL D;  1VZ7 A;  2N9X A;  4DWF A;  3DOW A;  5LNK 1;  4P7I A;  1IUE A;  5AZF A;  1GC7 A;  4WWO A;  1SGH A;  2GMI C;  3RUI B;  4FXC A;  1L0X B;  2XBB C;  2O6V D;  3R2T A;  2AYO B;  2Z0D B;  2C7M B;  4FA6 A;  1E9M A;  3V3X A;  1C1Y B;  4WQM A;  4BOS C;  2IGD A;  1E8X A;  1IGD A;  2KVZ A;  3CST A;  3UIO B;  4P16 A;  3DHH C;  3I3T B;  4HVB A;  2NVU I;  1E8Y A;  4JIO U;  1T5X D;  4NJ6 A;  4GB9 A;  5FR6 A;  4IWO A;  5BMG A;  2LGY A;  2VRR B;  4P6V F;  3U8Z A;  2W3S A;  4LNN A;  1SE4 A;  4CHK A;  4YT0 B;  3ZKJ C;  3UQA A;  3HVD A;  2RMM A;  2JUO A;  3ZXR A;  3ZXV A;  2DYO A;  3AE5 B;  3L54 A;  2PPH A;  1QQR A;  1TKE A;  2ZVO A;  3MJ5 A;  1K8R B;  3R7Q A;  2BGF A;  3QQ8 B;  1FCC C;  1MG8 A;  5IN7 A;  2BYE A;  3PS6 A;  1VD2 A;  2ZCB A;  3GB1 A;  2JXX A;  2K6Q A;  1KH0 A;  3VQI A;  3VUX A;  2QEJ C;  1WMH B;  1ZPS A;  2D2Q A;  3P63 A;  4ZHP A;  3HUI A;  3BZD B;  4FAD A;  1V5O A;  2G4S A;  3H7S A;  1Z5S B;  1ISN A;  4C00 A;  1I35 A;  2WX1 A;  2QC8 A;  1NVI D;  2Y5B B;  4ZRQ A;  1HE8 A;  4CO7 A;  2X8X X;  2N7D A;  4WAA A;  4XGA B;  4M8M A;  2JYE A;  3ZYY X;  1YMH E;  3JSV A;  4A3P A;  5L95 C;  5IO9 A;  1V49 A;  3MHZ A;  2J42 A;  1VLB A;  3FKY A;  2K3U A;  5HI1 A;  1K53 A;  3Q6B A;  2QSD A;  4RGT A;  5H92 C;  1ZW7 A;  4PYU A;  1JW9 D;  2WU2 B;  3NRZ A;  1SJH D;  4MT5 A;  4YSZ B;  4MEM A;  2G1E A;  3WAL A;  4ZYN A;  2G45 B;  2ZNV C;  1WX7 A;  3CWI A;  1KOT A;  4O1N A;  5JXV A;  3WA0 A;  2NBW B;  4F8C B;  4ANV A;  3O13 A;  3PHX B;  2DHZ A;  1RLF A;  2LGX A;  1UH6 A;  4ZYS A;  3QC8 B;  4FHJ A;  3RUL A;  1UBI A;  4KIK A;  1CMX B;  3DHI C;  3IT4 B;  1FM0 D;  1N62 A;  2L3Z A;  4NNJ B;  3ZTC A;  4DDI D;  4ICU A;  3SFE B;  1VCB A;  1E0Z A;  4CYE A;  3LXF A;  4IW0 A;  3I57 A;  4M00 A;  2LGI A;  3KYD D;  4IOI E;  4AJW A;  5J18 A;  4LDT D;  4K81 A;  4D2K A;  3UF8 A;  4TKN A;  2L7R A;  4MJS B;  1SIF A;  2VH1 A;  1ET9 A;  4W9K A;  1MPE A;  2LUE A;  2KTR A;  4M01 A;  5DPR A;  2OHF A;  4S0R A;  1EF1 A;  1T0Q C;  4ARI A;  3DBH B;  2AEH A;  3PRZ A;  4W9G A;  4N9F 4;  2BB5 A;  3PO0 A;  2WXJ A;  3Q8A A;  3IAS 1;  1HQR D;  2INN E;  1EU3 A;  2E3T A;  4RF0 A;  3TMP B;  2LVP A;  5HG2 A;  3ZO5 B;  2D07 B;  2BS4 B;  3Q8B A;  4HJG E;  4DBG A;  1YJJ A;  1D6E C;  3Q8E A;  2L05 A;  2LRW A;  1J19 A;  1PGA A;  2REX A;  3VTW A;  1TT5 B;  2GB1 A;  1BT0 A;  1WM2 A;  4DDG D;  1PGB A;  3RYT A;  3VDZ A;  1QOG A;  4L2Y A;  2V1Y A;  2JRI B;  2MLB A;  2BS2 B;  3H1U A;  3B0A A;  4KGS A;  2D3B A;  1Q10 A;  4PS8 A;  4XDC A;  2HD5 B;  3AEF B;  2K5P A;  2MJD A;  2AL3 A;  1SEB D;  2KFJ A;  1Q5W B;  2UWQ A;  2PIA A;  1WX9 A;  1D5M C;  1D5Z C;  4JWU C;  1JRO A;  4YTN B;  1F0Z A;  4DHJ B;  5AZH A;  2Z0E B;  4KVG B;  1YJI A;  4IWQ A;  1P98 A;  1QT9 A;  1TS5 A;  4MH0 E;  3EFC A;  5IAA C;  2JWU A;  2J0J A;  2FBW B;  2XEW A;  3L13 A;  2YEP B;  3R7R A;  1UUP A;  3OJ3 A;  5CHW A;  4W9D A;  3A9K A;  3RFZ B;  1SIJ A;  2RGF A;  1DOX A;  1ET6 A;  2N1W A;  3Q3M C;  2V0G A;  4NZL B;  4LLG M;  1V1O A;  1YOV B;  3AM9 A;  4MDK E;  2DYB A;  3L16 A;  1XLO A;  1SSN A;  4ZRJ A;  3MTN B;  2IO1 B;  1JAL A;  1TJE A;  3QAQ A;  3U52 E;  5BMH A;  4C80 A;  4K3B A;  1YN3 A;  3AE6 B;  1TZ1 A;  4MEL A;  1TY2 A;  5IOI A;  4FBJ B;  2WU5 B;  4BVU C;  2CHW A;  3DBL B;  1A5R A;  4JPS A;  4BKS A;  1MJD A;  4XE0 A;  2KDE B;  3I5J C;  4JX1 C;  4HPM B;  3D32 A;  3NS8 A;  2L76 A;  2WXI A;  4II2 B;  1C4C A;  2JXT A;  4WJN A;  1IBX A;  3HM3 A;  3EFU A;  1K52 A;  2IO3 B;  4KIK B;  4HXD A;  2YLM A;  1YQB A;  2PE6 B;  1HA5 A;  1G6J A;  2KJR A;  1WXS A;  4M02 A;  1T0R C;  3L0W B;  4HK2 A;  1C76 A;  2OJR A;  3TSS A;  2LZ6 A;  1N5X A;  1I4R A;  2N0S B;  1DGJ A;  2RDH A;  1KTK A;  1TTN A;  4OVU A;  4HDQ A;  4L23 A;  4ICV A;  2J52 A;  2PJH A;  2R61 A;  4HLE A;  3CSF A;  2SEB D;  2C7H A;  5C3J B;  1D4B A;  2BWF A;  2XK5 A;  3P4P B;  4XYC A;  1D3Z A;  4RMA A;  1ACC A;  4NAW A;  2KO3 A;  3KLS X;  3Q2A C;  1HXY D;  1SXT A;  2WXQ A;  2L1A A;  2ZZP B;  2KTR B;  3PRE A;  2DBY A;  4PT5 A;  1WJN A;  5LXI B;  3C0R B;  4G3X B;  3J9C A;  3QX1 A;  1V1P B;  1C4A A;  1ZUD 2;  3C19 A;  4NQL B;  4S17 A;  2O6V A;  1SF0 A;  5D2M B;  2D3A A;  4K3C A;  4C7Z A;  3N1Z C;  4WIP A;  3NUH B;  2KAJ A;  3NVW A;  4J6I A;  4MM3 B;  3DHG C;  1I42 A;  1J7A A;  5C2T B;  3DDC B;  1V6E A;  2D5G A;  4RH6 A;  4MGI E;  2ZNV B;  3LB8 C;  5BMI A;  3RZW C;  3AEB B;  1WSP A;  4M0W A;  1L0Y B;  3IAM 1;  5JHA A;  1ZP0 B;  2DWQ A;  2N9L A;  4ZRK A;  2YVC A;  3PGE A;  2GBK A;  1D5X C;  3APF A;  3ZJV A;  2BYT A;  2L00 B;  3Q69 A;  3ENE A;  1YN4 A;  1EO6 A;  2N1V A;  3DPD A;  3ZRC A;  2RDB C;  4TQ0 A;  2L8J A;  4RM8 A;  3WAN A;  4GDL A;  1SB3 C;  4JQW C;  1EWY C;  3PVL A;  2ZPY A;  2MBE A;  2LVQ A;  2QIE B;  2DLB A;  4B95 A;  2RD0 A;  3VH3 B;  1F77 A;  4BBN F;  1UGM A;  2N4F A;  5G5G A;  2BBC A;  3MC9 A;  2RR9 A;  1N60 A;  1M4V A;  2LXA A;  1XO3 A;  2KWV B;  4WJP A;  4RGN A;  4DQO C;  3L10 B;  4P1C C;  2PMV A;  2IZV B;  1H4R A;  3SU8 X;  2LGD A;  3ZLZ A;  3LYY A;  2KMA A;  1TKY A;  2WDV B;  2YEP F;  3IT6 B;  1EUV B;  2NTS A;  1PGX A;  3W5V B;  1B9R A;  4KZ0 A;  2FE8 A;  2EMS A;  1YN5 A;  1ZKH A;  3JVZ X;  4C56 C;  4EZJ A;  3ZGZ A;  2NCN A;  4I6L B;  2DNF A;  2WXK A;  1WH3 A;  1IBX B;  1XEE A;  2K39 A;  3VTU A;  4RM9 A;  4KZC A;  4W9J A;  3TEY A;  1GJZ A;  1E7V A;  1GPX A;  3DVN V;  4EZK A;  1L2N A;  4A8X C;  4LJP B;  3AU5 A;  2FCQ A;  1NEN B;  2AQ1 B;  4FJV B;  1ZE3 D;  1JCK B;  1MFW A;  1TY0 A;  3Q3F A;  1GOZ A;  1AWD A;  1QF6 A;  4P1B C;  1WM3 A;  3ZRF A;  3EEC A;  4RGM A;  3WAP A;  3BY4 B;  2HJ8 A;  2O2V A;  2GLS A;  3VFK A;  3DBR B;  2FUH B;  3HRD D;  2BS3 B;  2WXM A;  4R3D A;  2CS4 A;  1PUT A;  3RNC C;  2XK5 B;  2PLP A;  2V3P A;  3NZ3 A;  1GNU A;  2PW9 A;  4NAW B;  3OG5 A;  3LJ3 A;  2D10 A;  3NVV A;  4REZ A;  3ONS A;  1WY8 A;  2N7J A;  1P7E A;  2H89 B;  1WGD A;  5BYR A;  3EGR A;  2HDE A;  2B3A A;  4OZC A;  2ZVN A;  4II3 B;  3PV1 A;  1WE6 A;  4LK0 M;  3ZUN A;  1N6Z A;  3U2S C;  2LAS A;  2O6V B;  4H2A A;  1E6E B;  1RRB A;  4A6Q A;  4LNF A;  4BAX A;  2M56 B;  3HK0 A;  1FXT B;  3AMZ A;  2KDM A;  4HCP B;  2ASQ A;  4W9I A;  3VHT C;  4FLH A;  2CJO A;  1J7B A;  1FNV A;  2BYV E;  3OJ4 B;  3FIL A;  3NS1 A;  2C5L C;  3KUD B;  3EC8 A;  3HHM A;  2BPS A;  3UIN B;  3M62 B;  1YJ1 A;  4C7Y A;  3PLV A;  1AN8 A;  1TYG B;  2EEL A;  2RSU A;  2KD0 A;  4MGK E;  3Q3J A;  4IC7 B;  3DVG Y;  3U7D A;  1FRR A;  1UWM A;  1HTO A;  4ANX A;  1FNW A;  3OLM D;  1V86 A;  5E6O A;  2MH7 A;  4GDL B;  1UWX A;  4DXG A;  4PS3 A;  1VZ8 A;  2DYM A;  4XZ4 A;  3QK0 A;  1GAQ B;  1QKZ A;  1C77 A;  1FXI A;  3KQ4 A;  5FK9 C;  1XF5 L;  4EZL A;  2BF8 B;  2IND C;  1HTQ A;  2LI5 A;  2ZPN A;  4B0E A;  2JF5 A;  2KX0 A;  3BIN A;  2RPQ A;  3AE4 B;  3LDZ E;  1YNT E;  3O65 B;  2LJI A;  3B2G A;  2L32 A;  1WWT A;  3NZS A;  2INP E;  1P0R A;  4TMA B;  4ZOH C;  1KLU D;  2A4Z A;  2KN4 A;  2D11 A;  1RFA A;  1Z2M A;  3DQV A;  1MVK A;  2C9W B;  2MEK A;  1OFF A;  1QOF A;  2WXN A;  1TKG A;  3ZQ4 A;  2WS3 B;  4IG7 B;  2GI9 A;  2MP2 A;  3PRP B;  3QCA A;  4DXF A;  2V4L A;  2BVC A;  1WR6 E;  3OWE B;  1I7H A;  3TEW A;  1FXA A;  1V8C A;  1I4P A;  3A4R A;  2ICI A;  2XN9 C;  4E3C A;  4JWS C;  1WJU A;  3VRA B;  1RM6 C;  2QJL A;  2DAF A;  1WGG A;  1F9J A;  2K1F A;  2JRH A;  2AQ2 B;  3ZIM A;  1WRI A;  1ZDX A;  3WAO A;  1XCT L;  2KNB A;  2KWU B;  2KC1 A;  1R4N B;  2WDQ B;  3AED B;  2O2V B;  3H6N A;  3NZU A;  3VR8 B;  3IG3 A;  2KT7 A;  3GZN B;  1R7S A;  3AI5 A;  1WXM A;  4IWP A;  4LDT B;  4OHJ A;  4RCO A;  2PVG C;  2V9H A;  1NEK B;  5JZE B;  2FAZ A;  2JT4 B;  3DVG X;  3BK2 A;  3P42 A;  5MPO A;  1H8C A;  4A20 A;  2LEK A;  5J2R A;  2AWT A;  4BOZ B;  4AJY B;  4QAY A;  2LFI A;  2I1J A;  5DPS A;  2PE9 A;  2KJH B;  3BK1 A;  1UBQ A;  3H9D A;  3IXS A;  1HZ5 A;  2K8B A;  2KLC A;  4LCD E;  1T6B X;  1Q0W B;  2JZ3 B;  1NYR A;  2OOB B;  3R66 C;  1TBE A;  4K1R B;  2L0F A;  3KWV A;  2BQQ A;  2IGH A;  1JML A;  3Q8C A;  4F7Z A;  4MSQ B;  2X38 A;  4C4V A;  3U4E G;  3P4S B;  3V61 A;  2M17 A;  4JL9 A;  3AE7 B;  4JGH B;  2K6D B;  1QOB A;  4A90 A;  2MBQ A;  2IY1 B;  3URY A;  5G55 A;  4JE3 B;  1FCL A;  1TS3 A;  2MBO A;  4KGT A;  3DBH I;  4ZRP A;  3W2D A;  2G3Q B;  1ZXI A;  1AAR A;  2KHW B;  3JSV B;  3APD A;  3RNB C;  4OVZ A;  1R4N I;  2LUM A;  1FIQ A;  4IUM B;  3ALB A;  3T9L A;  2WP9 B;  1YIW A;  4ARC A;  1XD3 B;  3V62 A;  1XQQ A;  2KQ7 A;  3UGB B;  3VR9 B;  1WYW B;  2JPH A;  4XWW A;  1K51 A;  1LM8 B;  1PQS A;  1LQB A;  2RPV A;  2KLG A;  3BII D;  1ZGU B;  1ZXH A;  1C9F A;  4B9K A;  3R2I A;  2OED A;  2PKO A;  2I38 A;  2BW2 A;  4NJC A;  2L0T A;  1JWM D;  3M3J A;  2MHJ A;  2GRI A;  4DXA B;  4IM3 A;  3ZNI D;  3VXW A;  3N3K B;  2EMT A;  5EE0 A;  2OJW A;  4KSL C;  2MA9 B;  2XNA C;  1KLV A;  4YL8 A;  4XDD A;  2ON8 A;  2RDG A;  5E6P A;  1GG3 A;  4HKZ E;  2E6X A;  1IP9 A;  2IYD B;  2NR2 A;  4DK5 A;  1BML C;  1WJ4 A;  2NBU A;  4KV2 A;  4NJ7 A;  4YTP B;  5EE3 A;  1OGW A;  1SE3 A;  4LTU A;  3TCA A;  1I4G A;  1FFU A;  4N58 A;  2MSE D;  1QZE A;  1XLP A;  4B6W A;  4AOF A;  4GGQ A;  2K8C A;  1TZO A;  2IY0 B;  3PZD A;  4EE2 A;  3VUW A;  4MSM B;  2C60 A;  3N9Y C;  2KFK A;  2CU3 A;  5BO4 B;  2D3C A;  3NG0 A;  2MBB B;  4ZRI A;  1WE7 A;  4MH8 A;  5AEK B;  1N61 A;  3WAM A;  3PSE B;  4EFO A;  3DBL I;  3SHQ A;  4N6E B;  4HEA 1;  3AEE B;  4WUR A;  2KVR A;  1AW7 A;  4HJK A;  1YD8 U;  3K9P B;  4ANU A;  5EE1 A;  2UU7 A;  4CQN A;  2IPK D;  2DZM A;  4FJZ A;  2LRU A;  5IA7 A;  2WXH A;  3AE2 B;  2VZK D;  4ACF A;  2R2O A;  3PPA A;  3KH0 A;  1LXD A;  3P2B A;  4X57 B;  4URK A;  1CJE A;  2WHI A;  1JRU A;  3QWZ B;  5HKH A;  1UF0 A;  1PFD A;  1VDV A;  1RWS A;  2M4N A;  4PS7 A;  3BYT B;  2GBR A;  4GLS C;  3PRM B;  2CKH B;  1SJE D;  2K25 A;  4KDL B;  2MJE A;  3ZJT A;  2EKI A;  2QMT A;  4DHZ E;  2KWC A;  2KXJ A;  2MWS B;  2V3S A;  3S2A A;  1L4Z B;  5IKC M;  3SFD B;  2R2Q A;  1P1A A;  2KMM A;  3KW5 B;  1TS2 A;  2FCM A;  2M0A A;  4W9L A;  3QA8 A;  4GIV A;  4RF1 A;  3T3O A;  1ESF A;  5C1Z A;  3UI3 A;  1ZOY B;  4F1S A;  1ZDV A;  2M1M A;  3V05 A;  1L6V A;  4YXD B;  1FPY A;  3ZDM C;  5DPT A;  5D3I B;  2BKR B;  1V97 A;  2BYF A;  4E71 A;  3N1Y C;  2JWZ A;  3ZVV A;  1JWS D;  2QIL A;  4YTM B;  3UQB A;  2BB6 A;  3A4S C;  3A9K B;  3RNG C;  2MW5 A;  2IDY A;  3W5U B;  3AB5 A;  1VJK A;  3ZNZ B;  1TGZ B;  1KLG D;  3AH7 A;  2G9H D;  2L52 A;  4WAF A;  3EUB 2;  1JWB D;  2N9E B;  5KHQ A;  4JLC A;  4ANW A;  2NPT A;  2CHZ A;  1E8W A;  1VR9 A;  1V5T A;  2K9X A;  4TSS A;  5AUK A;  2JYT A;  4XC2 A;  1MI0 A;  1R4M B;  2AL6 A;  2FIF A;  2GBN A;  2WXG A;  2ZEQ A;  1BXT A;  1P7F A;  3IHP C;  1EWC A;  3AU4 A;  5BYQ A;  3M95 A;  2GOW A;  4OZB A;  1UGJ A;  3DWG C;  3DCG A;  3N1X C;  1JQ4 A;  2ONQ A;  4BZA A;  1L7Y A;  2BKF A;  2L83 A;  1LFD A;  3PZ7 A;  1VZ6 A;  3PLU A;  3MC0 B;  2UYZ B;  2JX5 A;  2KQ4 X;  1LO5 D;  1WX8 A;  1RYJ A;  4BKG A;  1FD6 A;  4USA A;  5G5H A;  3NJT A;  1J8C A;  3W1Y A;  3AEG B;  3DVN U;  4FHK A;  3KYC D;  2W82 A;  4KX6 B;  1DYQ A;  3AV8 A;  2IO2 B;  4NQK E;  1XLQ A;  3KUC B;  3QIJ A;  4LNK A;  5BYS A;  1TS4 A;  1JRP A;  2KOX A;  1E7P B;  4WWM A;  2KFK B;  2WX0 A;  1Q1O A;  2MJ3 A;  2LJ5 A;  4AP4 C;  2M8S A;  2LXC A;  2MCN B;  2KDI A;  1RAX A;  1KJT A;  1YQ4 B;  3ML8 A;  1CQV A;  1WF9 A;  4A55 A;  1XXG A;  1LGR A;  3ABV B;  1EM7 A;  3PZ8 A;  4BFR A;  2MX2 A;  4IKG A;  2K0P A;  5HFY A;  1F2R C;  1R4M I;  1WGR A;  2BWE S;  3X0W A;  4YWG G;  1I4Q A;  3NOB A;  3B9J A;  4E74 A;  3K9O B;  4GXB A;  1ENF A;  1C78 A;  2W9N A;  1E5W A;  1FEH A;  2N9K A;  1WIA A;  4M0W B;  2J0K A;  4KKI A;  4WQO B;  4YSX B;  4NPN A;  2KDF B;  3OAW A;  3KVF B;  5AUI A;  2WLB A;  2JZZ A;  2D3G A;  1F1H A;  1U4A A;  2K22 A;  3DBR I;  3NVY A;  2IO0 B;  3VVW B;  3AE1 B;  3MP9 A;  2WGS A;  2JQR B;  3B1L X;  1T0S C;  4PYZ A;  5J17 A;  2DZJ A;  3HVZ A;  3Q3N C;  2WYQ A;  4TQ1 A;  3ZNG C;  1N5W A;  3R3M A;  2MRP A;  5CX3 A;  3E9S A;  2EKE C;  5D94 A;  1GC6 A;  2HE7 A;  4A3O A;  2V3N A;  1KFY B;  1T3Q A;  2VH2 A;  3V60 A;  3FAH A;  1MG4 A;  4K7W A;  3RT3 B;  5GMV A;  1KF6 B;  2I2Y A;  4WWP A;  1S1Q B;  5E6N A;  2LGS A;  2KN5 A;  4GU2 A;  1F52 A;  2HJ1 A;  3EHV A;  2PVO D;  3AE8 B;  2WDT B;  5IP4 D;  2NPT B;  1WYG A;  2G4D B;  1XLN A;  2KC2 A;  2Y5C A;  4FUL A;  4A9A A; 
#chains in the Genus database with same CATH homology
 3I3T B;  3HIZ A;  4WJO A;  2NVU I;  1E8Y A;  1WYW B;  2JPH A;  4JIO U;  4ZRK A;  4GDK A;  4GB9 A;  4NJ6 A;  1LM8 B;  2YVC A;  4IWO A;  2LGY A;  2VRR B;  1PQS A;  5FR6 A;  3PGE A;  3NY5 A;  3U8Z A;  2GBK A;  1LQB A;  1X1M A;  1UEL A;  4CHK A;  3ZKJ C;  3UQA A;  3APF A;  2KLG A;  1ZGU B;  2L00 B;  3ML9 A;  1WGY A;  2JUO A;  3IBE A;  3ENE A;  2DYO A;  1EO6 A;  2N1V A;  3DPD A;  3L54 A;  2PPH A;  3ZRC A;  4TQ0 A;  4B9K A;  5G2N A;  2L8J A;  4RM8 A;  3WAN A;  2ZVO A;  3W1S C;  3MHS D;  1K8R B;  3R7Q A;  2BGF A;  4GDL A;  3QQ8 B;  5DCN A;  2L0T A;  4JQW C;  3M3J A;  1MG8 A;  3PVL A;  2ZPY A;  2BYE A;  2MBE A;  3PS6 A;  4DXA B;  2LVQ A;  1VD2 A;  2ZCB A;  1V9J A;  4IM3 A;  3VXW A;  3ZNI D;  3N3K B;  1S3S G;  4B95 A;  2EMT A;  2RD0 A;  3VH3 B;  4KSL C;  5D6J B;  2MA9 B;  1KLV A;  2JXX A;  2GBJ A;  4YL8 A;  2K6Q A;  4BBN F;  3SDL C;  2QHO A;  3VQI A;  3H7P A;  1UGM A;  2FCN A;  3VUX A;  5E6P A;  1GG3 A;  4HPL B;  1IYF A;  1WMH B;  2D2Q A;  2N4F A;  2RR9 A;  4FJY A;  1IP9 A;  3CF6 E;  4FAD A;  1C3T A;  2IYD B;  1V5O A;  2G4S A;  3NHE B;  2NR2 A;  3V6E B;  2LXA A;  4DK5 A;  2KWV B;  3RD2 A;  1WJ4 A;  2NBU A;  3H7S A;  4KV2 A;  1Z5S B;  1ISN A;  1YX6 B;  4NJ7 A;  4WJP A;  1I35 A;  1OGW A;  3L10 B;  4G0N B;  1WJ6 A;  2WX1 A;  3IVF A;  3TCA A;  2IZV B;  2Y5B B;  1H4R A;  1HE8 A;  4CO7 A;  3SU8 X;  1E7U A;  2LGD A;  2N7D A;  4WAA A;  3ZLZ A;  4DHJ D;  4M8M A;  2MSE D;  4WWN A;  2KMA A;  1QZE A;  3JSV A;  4MM3 A;  3DBS A;  1NBF C;  4A3P A;  5L95 C;  2KZR A;  1EUV B;  1V49 A;  2C7N B;  2LVO A;  2KTF A;  1WZ0 A;  4B6W A;  4AOF A;  4KZ0 A;  2WWZ A;  4GGQ A;  4TUU A;  4IM2 A;  2K8C A;  2KK8 A;  2EMS A;  2FNJ B;  2I1K A;  1WXV A;  3TL5 A;  1ZW7 A;  4PYU A;  2IY0 B;  1ZKH A;  3PZD A;  3JVZ X;  3VUW A;  2KMC A;  4MSM B;  3TIX A;  4EZJ A;  2NCN A;  4I6L B;  2C60 A;  2KFK A;  5BO4 B;  1IPG A;  3UIP B;  2MBB B;  4ZRI A;  4MEM A;  1WE7 A;  1WH3 A;  3WAL A;  5AEK B;  2K39 A;  4ZYN A;  2G45 B;  2ZNV C;  1WX7 A;  3IFW B;  3VTU A;  4RM9 A;  4KZC A;  3WAM A;  1KOT A;  3A9J A;  4W9J A;  1GJZ A;  1E7V A;  3PSE B;  4EFO A;  3DVN V;  3WA0 A;  3DBL I;  3SHQ A;  4EZK A;  1L2N A;  2A5U A;  4LJP B;  3AU5 A;  2FCQ A;  2KVR A;  2NBW B;  4FJV B;  4HJK A;  4IM0 A;  4F8C B;  4ANV A;  3PHX B;  2DHZ A;  2DEN B;  3JYU A;  1RLF A;  1YD8 U;  3Q3F A;  3K9P B;  4ANU A;  2LGX A;  1UH6 A;  3QC8 B;  1WM3 A;  4FHJ A;  3ZRF A;  2DZM A;  2N7E A;  3EEC A;  4FJZ A;  2LRU A;  3WAP A;  5IA7 A;  3APC A;  3BY4 B;  4GN1 A;  3VTV A;  2R2O A;  2HJ8 A;  2O2V A;  3RUL A;  3PPA A;  1UBI A;  3GZN I;  3KH0 A;  4KIK A;  1CMX B;  1LXD A;  3A1Q A;  3P2B A;  1NI2 A;  2L3Z A;  4NNJ B;  3VFK A;  4MGY E;  3ZTC A;  2DZI A;  2FUH B;  4AUQ C;  4DDI D;  4X57 B;  4ICU A;  4URK A;  5CTR C;  1JRU A;  1VCB A;  3QWZ B;  3QHT A;  4CYE A;  2J0M A;  3AXC A;  5HKH A;  4ZDV A;  2CS4 A;  4IW0 A;  4PS7 A;  2M4N A;  3V6C B;  2XK5 B;  2GBR A;  3W1S A;  1GUA B;  3PRM B;  1WZ3 A;  1GNU A;  2CKH B;  3KYD D;  4NAW B;  4AJW A;  2K25 A;  4KDL B;  3RZF A;  5J18 A;  4LDT D;  5EDS A;  4K81 A;  3LJ3 A;  2D10 A;  2NS5 A;  3ONS A;  1WY8 A;  1UZX B;  3UF8 A;  4DHZ E;  2KWC A;  2KXJ A;  2MWS B;  2V3S A;  3S2A A;  4TKN A;  3MJW A;  1WGD A;  2R2Q A;  1P1A A;  3KW5 B;  2FCM A;  3PTF C;  4W9L A;  2B3A A;  2L7R A;  2ZVN A;  4II3 B;  3PV1 A;  3QA8 A;  1SIF A;  1WE6 A;  4GIV A;  4MJS B;  4W9K A;  5C1Z A;  2KAN A;  2LUE A;  3RCZ A;  3ZUN A;  5LLI A;  4F1S A;  2KTR A;  5DPR A;  2LAS A;  3CMM B;  2M1M A;  4LJO B;  4AWJ A;  2O6V B;  4GOC A;  3ZDM C;  1EF1 A;  1RRB A;  5DPT A;  2BKR B;  2BYF A;  2AEH A;  4E71 A;  3PRZ A;  2JWZ A;  4W9G A;  4N9F 4;  3ZVV A;  3HK0 A;  1FXT B;  3UQB A;  4HCP B;  2ASQ A;  3A4S C;  3PT2 B;  3A9K B;  4M8N A;  3ZTD A;  2MW5 A;  4W9I A;  4ASW C;  3VHT C;  1WGH A;  4FLH A;  3TMP B;  3JW0 X;  2LVP A;  3ZO5 B;  3ZNZ B;  1TGZ B;  3UGB B;  2D07 B;  5LXH A;  3OJ4 B;  2BYV E;  4DHZ B;  4GMV A;  3M63 B;  3U30 A;  2C5L C;  3KUD B;  2MP2 B;  3EC8 A;  3HHM A;  1E8Z A;  3KUZ A;  4G11 A;  2BPS A;  4DBG A;  3UIN B;  5AZG A;  3M62 B;  1YJ1 A;  2N9E B;  4KSK C;  2L05 A;  4GDK B;  2JVC A;  2LRW A;  3PLV A;  5KHQ A;  4JLC A;  1J19 A;  4ANW A;  2REX A;  2NPT A;  1WR1 A;  2RSU A;  2CHZ A;  2KD0 A;  4MGK E;  3Q3J A;  2KX3 A;  1E8W A;  3DVG Y;  4IC7 B;  3U7D A;  3VTW A;  3WIM A;  1V5T A;  2J7Q B;  1BT0 A;  1WM2 A;  4DDG D;  4KDI C;  5C23 A;  4ANX A;  4XX5 A;  1WFY A;  3OLM D;  4K7S A;  4XC2 A;  1V86 A;  3RYT A;  3VDZ A;  2NBV B;  2AL6 A;  2FIF A;  5E6O A;  2GBN A;  4GDL B;  2V1Y A;  2JRI B;  4GSW A;  2ZEQ A;  2MLB A;  3H1U A;  3QJZ A;  3B0A A;  2CU1 A;  4W9C A;  4EEW A;  1EF5 A;  3IHP C;  4PS3 A;  4PS8 A;  2DYM A;  4XZ4 A;  3QK0 A;  4MGZ E;  2HD5 B;  3X23 A;  2DZK A;  3AU4 A;  2AL3 A;  4EOY A;  4EZL A;  2BF8 B;  2KFJ A;  1Q5W B;  2LI5 A;  2UWQ A;  2GOW A;  3M95 A;  2ZPN A;  2JF5 A;  2KX0 A;  1WX9 A;  3BIN A;  3DCG A;  4FN2 A;  3H7P B;  2RPQ A;  3LDZ E;  5KHO A;  3QAR A;  3T8M A;  5DPW A;  2DX5 B;  1L7Y A;  2BKF A;  1OTR B;  1LFD A;  4DHJ B;  1Y8R C;  3ZDT A;  5AZH A;  2Z0E B;  5L83 A;  4HCN B;  4KVG B;  3O65 B;  3PLU A;  2UYZ B;  4IWQ A;  2Z59 B;  1V81 A;  1P98 A;  3NZS A;  1WX8 A;  4MH0 E;  1P0R A;  5IAA C;  3VUY A;  2FCS A;  1OQY A;  4BKG A;  2J0J A;  1OEY A;  2XEW A;  1J8C A;  3L13 A;  3W1Y A;  2A4Z A;  2GBM A;  2KKC A;  3DVN U;  2D11 A;  2MBH A;  1RFA A;  4FHK A;  1WMH A;  3KYC D;  3R7R A;  3AUL A;  3OJ3 A;  5CHW A;  1T0Y A;  4W9D A;  1Z2M A;  2KQS A;  2PEA A;  2IO2 B;  2C9W B;  3A9K A;  3DQV A;  4NQK E;  2ZJD A;  2RGF A;  3KUC B;  2N1W A;  3QIJ A;  4EUT A;  4K7U A;  1XT9 B;  4G50 A;  3B08 A;  4MDK E;  2DYB A;  3L16 A;  4W9E A;  4IG7 B;  2MP2 A;  3PRP B;  4ZRJ A;  2M0X A;  2KOX A;  3MTN B;  3QCA A;  1WI0 A;  2V4L A;  2IO1 B;  1WR6 E;  1WXA A;  2JY6 A;  3QAQ A;  2KFK B;  2KJ6 A;  1Q1O A;  2WX0 A;  2LJ5 A;  4AP4 C;  2M8S A;  2LXC A;  2MCN B;  4I6N B;  1TZ1 A;  2KDI A;  1RAX A;  2CHX A;  4MEL A;  1KJT A;  3ML8 A;  4FBJ B;  1WF9 A;  5TR5 A;  3A4R A;  4EKU A;  3HM6 X;  4E3C A;  1YX5 B;  2N9P C;  3A9J B;  2CHW A;  1WJU A;  4BVU C;  4HDO A;  3A33 B;  2CR5 A;  2MX2 A;  4BFR A;  1A5R A;  4W9H A;  4BKS A;  2DAF A;  1OEY J;  2KDE B;  1UD7 A;  1R4M I;  1WGR A;  3L08 A;  2BWE S;  1WGG A;  1F9J A;  4HPM B;  2LWP A;  4W9F A;  3X0W A;  3D32 A;  2K1F A;  2JRH A;  2L76 A;  3NS8 A;  4II2 B;  4WJN A;  3ZIM A;  3PHW B;  3WAO A;  3HM3 A;  3NOB A;  3EFU A;  2KNB A;  2KWU B;  2KC1 A;  3K9O B;  4E74 A;  2O2V B;  3H6N A;  2IO3 B;  3NZU A;  4GXB A;  1KM7 A;  3IG3 A;  4KIK B;  3A1Q B;  4BKS D;  4HXD A;  3AI5 A;  2YLM A;  1YQB A;  2PE6 B;  2W9N A;  2ZCC A;  5D7G A;  1WXM A;  5CHV C;  2IBI B;  1G6J A;  1E5W A;  2KJR A;  4IWP A;  4LDT B;  1WXS A;  4WJQ A;  4HWI B;  1WIA A;  4M0W B;  3L0W B;  4HK2 A;  5JZE B;  2FAZ A;  2JT4 B;  2J0K A;  4WQO B;  3DVG X;  4I6P A;  4NPN A;  1NDD A;  2KDF B;  1H8C A;  2OJR A;  4A20 A;  2DAJ A;  3TJP A;  5J2R A;  2AWT A;  3OAW A;  2FID A;  2LZ6 A;  3KVF B;  4AJY B;  4BBN C;  4BOZ B;  2JZZ A;  2D3G A;  5DPS A;  2I1J A;  1U4A A;  2PE9 A;  4NY0 A;  1V2Y A;  1WRD B;  2KJH B;  2IO0 B;  3DBR I;  3VH4 B;  3ZW3 A;  1UBQ A;  3VVW B;  3H9D A;  1TTN A;  4OVU A;  4HDQ A;  1V80 A;  4ICV A;  2K8B A;  2KLC A;  2PJH A;  3GOE A;  3B1L X;  4LCD E;  3CSF A;  5CHF A;  4HLE A;  1P9D U;  2C7H A;  4PYZ A;  3L17 A;  5J17 A;  2BWF A;  2DZJ A;  2XK5 A;  1Q0W B;  2JZ3 B;  5JH5 C;  1D3Z A;  3ZNH B;  4OVV A;  4RMA A;  2OOB B;  2WYQ A;  4TQ1 A;  3R66 C;  3ZNG C;  3N32 A;  4NAW A;  2KO3 A;  1TBE A;  4K1R B;  2L0F A;  3VAW A;  3R3M A;  2MRP A;  3SD5 A;  2ZZP B;  5CX3 A;  2EKE C;  5D94 A;  1GC6 A;  2KTR B;  2HE7 A;  3PRE A;  4A3O A;  4F7Z A;  4MSQ B;  1E90 A;  3N30 A;  3ECI A;  3V60 A;  1WJN A;  2HTH A;  2M17 A;  3V61 A;  4K7W A;  5LXI B;  3RT3 B;  4JL9 A;  1SE9 A;  1M94 A;  5GMV A;  3C0R B;  4WWP A;  4G3X B;  1S1Q B;  4JGH B;  2K8H A;  4MJS A;  2K6D B;  2MQJ A;  3QX1 A;  4HVB A;  2KDB A;  5E6N A;  1P3Q U;  2IY1 B;  2LD9 A;  2MBQ A;  4NQL B;  4BKT A;  5JHB A;  1J0G A;  5G55 A;  2O6V A;  4TV3 A;  2MBO A;  3TBL D;  3DBH I;  5D2M B;  2KN5 A;  2N9X A;  2G3Q B;  4GU2 A;  4DWF A;  3DOW A;  4P7I A;  3EHV A;  1AAR A;  4J6I A;  5AZF A;  2KHW B;  1GC7 A;  3JSV B;  4WWO A;  2WDT B;  1SGH A;  2GMI C;  3APD A;  3RUI B;  1I42 A;  1R4N I;  2NPT B;  2XBB C;  4IUM B;  2O6V D;  3ALB A;  3T9L A;  2G4D B;  3DDC B;  2AYO B;  2Z0D B;  1V6E A;  2C7M B;  1YIW A;  2KC2 A;  4MGI E;  4FA6 A;  1XD3 B;  2ZNV B;  1C1Y B;  3RZW C;  4BOS C;  1E8X A;  3V62 A;  4FUL A;  3CST A;  1XQQ A;  2KQ7 A;  3UIO B;  5JHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...