4RFBA

1.93 angstrom crystal structure of superantigen-like protein from staphylococcus aureus in complex with sialyl-lewis x.
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
194
structure length
194
Chain Sequence
HNYKSLKYYYSKPSIELKNLDGLYRQKVTDKGVYVWKDRKDYFVGLLGKDIEKYPQGEHDKQDAFLVIEEETVNGRQYSIGGLSKTNSKEFSKEVDVKVTRKIDESSEKSKDSKFKITKEEISLKELDFKLRKKLMEEEKLYGAVNNRKGKIVVKMEDDKFYTFELTKKLQPHRMGDTIDGTKIKEINVELEYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title 1.93 Angstrom Crystal Structure of Superantigen-like Protein from Staphylococcus aureus in Complex with Sialyl-Lewis X.
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Toxin
total genus 64
structure length 194
sequence length 194
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rfbA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rfbA01
1EEID 5ELDA 1B1ZA 4RFBA 1D6EC 1V1PA 2G9HD 2WV6D 1HTLD 4RH6A 1L0XB 4L6TB 1PRTF 3R8BA 3DWQA 2XNAC 4OHJA 1AW7A 4O1NA 2R61A 5I4DA 3TSSA 1BCPD 1RDPD 4BWGB 1LO5D 1KLUD 1XTCD 2AQ1B 3BVGA 1YN3A 1PTOH 1I4HA 1SJHD 3OWEB 5D3DA 4C56C 1T5XD 1LTSD 1LTBD 1DYQA 1EEFD 3O13A 1G8ZD 1I4XA 1CK1A 1D5XC 1S5BD 1AN8A 4RGMA 1HQRD 1S5ED 1EU4A 1FNWA 1RD9D 1TS3A 4K6LA 2QILA 3MC0B 1JWSD 1TY2A 4RCOA 4DXGA 1F77A 1SJED 3EA6A 1PYWD 2O2LD 1D5ZC 3MFGA 1XXGA 5ELBA 1EU3A 1UUPA 1V1PB 1PTOF 1CHQD 2XN9C 3BZDB 1SXTA 2J4XA 3BYYB 4RGNA 2QEJC 1EWCA 1PZID 1LT5D 3CHBD 1DJRD 1CQVA 2CHBD 2ICIA 3BYTB 1MD2D 1D5MC 1UNSA 1PZKD 1QILA 1V1OA 1JQYD 1FGBD 3EFXD 3GP7A 3DWPA 3URYA 1BCPF 3BVZA 1PRTC 3V05A 5TSSA 1FNUA 2IJ0A 3R2TA 5FK9C 1PRTB 5FKAC 1LLRD 4L63B 1LT3D 4RGTA 2SEBD 1ET9A 1B44D 1HA5A 1HXYD 2NTTA 1KLGD 1SE4A 1KTKA 1LTGD 3W2DA 2XRSD 2Z8LA 2TSSA 1YN4A 1PRTD 1LTRD 5ELEA 1S5CD 3SEBA 1TY0A 1GOZA 1EFID 1SE3A 2NTSA 1CT1D 4RHSA 1ET6A 4DXFA 1JWMD 1PZJD 1CHPD 1ESFA 1JWUD 1PTOC 1I4RA 1RCVD 2AQ2B 1I4GA 1TS4A 1S5DD 1PTOB 1L0YB 2RDHA 3R2IA 3BVMA 1LTID 1FD7D 1SBBB 1SE2A 1SEBD 4Z9CB 1LT6D 4RHRA 1ENFA 1STEA 4TSSA 1BXTA 1TS5A 5D3IB 1FNVA 1JR0D 1LTAD 1RF2D 4ZYSA 2RDGA 5ELCA 1BCPC 1S5FD 1M4VA 4UDUC 2IPKD 1I4QA 1TS2A 1LTTD 3KLSX 3DWAA 1BCPB 1YN5A 4NZLB 1I4PA 2XRQD 5ELFA 1LT4D 4RGOS 1JCKB 2AQ3B 1PTOD
chains in the Genus database with same CATH superfamily
1U4LA 4N9TA 1B1ZA 2FJ2A 1B4OA 4CKCA 5C4ZA 2AEHA 1JB3A 2ZVOA 4R9WA 4ZRJA 1GPXA 2UWQA 4JWUC 3IFDA 4O1NA 2K1FA 2KDMA 3I4NH 4IFDG 1QB5D 3GTKB 1EZ6A 2VH1A 2R2QA 3ERQA 3VHTC 2VQEL 1TWFH 3K5OA 2ICEC 3K80C 3ZRFA 2F3VA 1OQRA 2HUGA 3QB3A 1R9TB 3RYTA 1YNND 3F1ZA 2DZIA 3HEJA 5AZHA 3ULPA 4POFA 3WAPA 5EAYA 1XNRQ 2KN4A 3A9KB 3DBLI 1SNCA 1HR0Q 1PH6A 2C7MB 4IUTA 5JVG3 2BDOA 4IZ8A 4CKBA 1SNDA 4C7YA 1S5BD 3GZNI 4XWWA 4BBNC 1AN8A 2A6HD 4HPMB 2IZVB 4W9EA 1UWXA 4X62Q 4A3DH 1VD2A 2M56B 3DXJC 2Y5BB 5J17A 2NVQH 5CBAE 3H1UA 3K59A 3U4EG 3RMHA 3AXCA 1OXSC 1WJNA 4NQKE 2OTLA 4MH0E 4HJ8A 2A8VA 4HEA1 1I3QB 1ZOYB 3CAMA 1ILQA 4XWTA 3STBD 2PI2A 2QEJC 2XGTA 3GTOB 3JYUA 4KKTA 1WY8A 2B2UC 2VRRB 5KNBA 2VUMB 3I55A 5KHOA 4LFCQ 2V1CC 5JPNC 1YITA 2IDYA 3TEZA 1WX9A 3RZDH 3W3AA 4JV5L 1UBIA 3EECA 3PSEB 4AYBG 4V190 3OOCA 3OTOQ 2FMCA 2JF5A 1VQKA 2MHVA 1YX5B 4PS7A 2EYFA 4WJPA 2Y0SE 2BE5C 2CWAA 2CH4W 2K7VA 2KKCA 3OW7A 1QCBD 1JE4A 5HURA 1D8LA 1X3QA 2NZHA 3VRBB 4MTNA 4P75A 4PMBA 5C5LA 1N33Q 5FJ8G 1B2TA 1KLGD 4LF6Q 4JK1C 1Y1WG 1LTGD 3TEYA 3RNBC 4E71A 4HTHA 2KN5A 2Q2IA 1WM3A 3VTVA 3U50C 4LUVA 5KYIA 3P20A 4OVUA 1EQTA 1N62A 3UQBA 1V5OA 3L10B 1DOXA 2F0FA 5JVH3 1WZ0A 4WIPA 3BZCA 3M4OH 1WF9A 3S2HB 1WTRA 1BUIC 1QVFA 2NB0A 2NTSA 4V0BA 2MJ3A 1NEKB 3N1ZC 1HNZL 3N30A 3UQAA 3RD2A 4DR1L 4FO2A 4I6LB 5CV6A 4G50A 2B2YC 3NBHA 3PVLA 5GMVA 4ME5A 3MTSA 2EJGC 1ILPA 1S5DD 4WJ3M 2DJFC 2O2VA 1EM7A 4PMCA 1XWEA 1E7PB 3TP5A 1B3AA 3PZ7A 4KX6B 3ZTDA 1WXQA 5BYQA 1VMPA 3T1HQ 2WLBA 3AI5A 4WWMA 4CBVA 4LNIA 1M4VA 4H2AA 1C3TA 1CM9A 2XRQD 4G7OC 2LJIA 1LT4D 1NSNS 1V97A 3P4QB 2D2QA 2FAZA 1NR2A 1TKWB 3GQBA 1KJTA 1PGAA 1QF6A 5IP9G 1XNRL 1FXTB 1X1MA 4CKEA 1VQBA 2V3SA 1HR0L 4JI4Q 3NOBA 5EPJA 2MPMA 1PRTF 1OXUA 2KNBA 1K3RA 4OZAA 1CSPA 3S1QB 3TIXA 1DOYA 1FGUA 4X62L 1X3GA 3QO2A 4APVA 3PREA 3DM3A 1WMHB 2B2UA 2L1AA 5BR8Q 2OEDA 3QX1A 1HA6A 4M0WA 1VJKA 2MJDA 1PYBA 1EWIA 2VZKD 5D3DA 3UDIA 1UEAB 1JT8A 4PMWA 1E7VA 1VQLA 3RN5A 1S1QB 1OQYA 1IW7C 4TV3A 4BOSC 2ZTDA 2F0DA 2L0TA 5I9OA 1HQRD 1PYSB 2Z1CA 2LVOA 3FKIB 3PO2B 4IWQA 3P4RB 3SU8X 1LYLA 2FXQA 1I94Q 4JGHB 4LFCL 1C0AA 3DVNV 1I50B 3NJTA 1MG8A 2RCFA 4KI0A 2IY1B 1OFFA 5ELBA 3PZDA 1DD2A 3OTOL 2D3CA 4RKLA 5BMHA 5J39A 2KEDA 1PHJA 4XYOA 2NCNA 4EGVA 3R3MA 3L54A 1SXTA 1HTOA 3BYYB 4W9DA 1SFOB 1FCLA 2M9VA 1LT5D 1WCMH 4XDDA 3A4RA 3B0AA 5E6NA 1N33L 2KA7A 4R4TA 4BY1H 4LF6L 1STHA 3GTMH 1V81A 3HKZG 5M5YH 2A19A 2MH7A 1CTMA 2B2YA 3M4YA 3OMGA 5FLXE 1TWFB 4A3IH 3S1MH 2A5HA 5JPMC 1N60A 3AE5B 2YTVA 3N1XC 3QJZA 2V4IB 3QQ8B 2F03A 2KEEA 1XCTL 1WGHA 4MIUA 2G3QB 4EUTA 2WQYB 4NKLA 1STBA 1KTKA 3BDOA 3SGIA 2LHDA 1IYJB 5HG2A 1YNXA 3HVDA 1PH4A 2N78A 2RHQB 2ZTEA 2PNHA 4KHVA 2B3AA 4XDCA 5IOIA 5LLIA 3S2AA 4JG2A 2KXJA 2XIWA 1PRTD 1YNJC 1V49A 3P75A 2KVMA 3T1HL 1GG3A 1GOZA 5AUIA 4QMGA 1NENB 3EC8A 3E3XA 1QNUA 2WXFA 4EFOA 3S9WA 4TUUA 5C44B 1IUEA 4W9KA 2KHWB 1F2MA 3SDZA 3APCA 3Q23A 3R2IA 5IP9H 3IXSA 5CV4A 4DAYB 1LTID 4NMZA 1RM6C 3A4SC 2BF8B 3RLFA 1XPOA 1KNAA 3VRAB 3A55A 5IT9E 1VQGA 4JI4L 1EOVA 1D1IA 1NJIC 3RPFC 4ZYSA 4X3KA 1DOIA 1XCQL 4EQPA 4GOCA 1AE2A 3CC2A 3CCJA 5CV5A 2DNEA 1PFNA 1I4PA 1Z9FA 2JQOA 3BZKA 2LHEA 3I70A 5BR8L 3QCAA 3RZFA 4GN1A 1RLFA 3BK1A 1DXMA 4YCUA 5JJLA 4PK1A 2XBBC 1XO3A 3NZUA 2MQJA 1V1PA 2E74C 2QCPX 3ZIMA 4HXDA 3NPPA 4JI5Q 4B3SQ 2ZXRA 2G9DA 3HOVB 2IGGA 2UU7A 4XGAB 5M5XH 2NVTH 2ZEQA 1RHPA 1I94L 3M4OB 2NWGA 4J1MA 3I57A 4F88A 1LO5D 2AUJD 4P72A 3QK0A 4M8MA 5JHAA 5D14A 3J7AF 1HUNA 1O80A 1EUVB 1SE9A 2G4SA 3DBRI 2VH2A 3KJOA 1H95A 4J6HA 3S17H 2XK5A 2L12A 1T5XD 1WX7A 1LTBD 1DYQA 1CKOA 1EYCA 4LMQD 4OELB 3S16H 1QZGA 4KN7C 1V5TA 4HROA 2HJ8A 4HMJA 5BN4A 3Q3FA 3QARA 3RI7C 3G6JB 2M8SA 1VQAA 3AB5A 1DZ1A 4BBSG 3T1YQ 2ES2A 1JWSD 3KYHC 5E4WC 1J7AA 2I1KA 3MFGA 2JRHA 4KKJA 2MRPA 2KECA 4ZCKA 1N36Q 1M8AA 4US8A 2CJOA 3BZDB 1ZDXA 1E2WA 1JE5A 5C3EG 5D7GA 4ARCA 2SNSA 4B95A 1HTPA 2HDLA 2RHSB 4P73A 2DUDA 4OL7A 4A3KH 3AB9A 2B3GA 3ERSX 4FF3A 1K52A 2YVCA 2L0CA 3BVZA 2IJ0A 1RWSA 4LF8Q 5COYA 4HMIA 1GUNA 5L37A 3RZWC 3D32A 4PG3A 4MEMA 2IWHA 1LLRD 4DK5A 3W1YA 5HGTA 2I2YA 2J7ZA 3UDGA 3AYHB 1KIXA 1DONA 4XT3B 4A76A 2KFJA 1GB1A 4JC0A 2R7ZG 3HRDD 1HZCA 3P7JA 5JJKA 3MJWA 2C9OA 1VQOA 3U9OA 1TJEA 1GO3E 1ZGUB 4NDXA 3IBEA 4YTNB 2WDRB 1WX8A 4IC7B 3WCQA 4JI2Q 4K2LA 5JH5C 3QOJA 4HKZE 1GUGA 4DK6C 4B08A 3KH0A 1CQFA 2K6AA 3GTJH 1SNMA 1WSPA 4BY7H 4KZ0A 4K0KQ 5C3WA 3A9JB 3PUWA 4KSKC 2L00B 2X38A 3KWVA 4KY5A 4PZ6A 1EY0A 2YU9B 5M9OA 1H9SB 1JWUD 1WCMB 3LWEA 5CV9A 1TZOA 1E6EB 1U4PA 2GRIA 1TS4A 4BY1B 3GTGH 3BVMA 2MEKA 1SBBB 3KF6B 4KD4A 2JP1A 3I4OA 4IUVA 2EMSA 1RJTA 3RCZA 2LFIA 4RKBA 2WS3B 4HJGE 4FULA 5I6WA 3SFEB 4JI5L 4B3SL 1X56A 3HOUG 1T0QC 3Q6BA 3FDTA 5AZGA 3MXNB 4LTUA 1B8AA 1L1OC 2UXDQ 3TZDA 4ANVA 2EYLA 5I2XA 4YT0B 2SNMA 3WALA 1TZ1A 4IUPA 4BS9A 3NEMA 4XDXA 2EXZA 3G48A 4U68A 5CC4A 4X66Q 4AOFA 1D6EC 1SMXA 3DEPA 4G4KA 2R92G 2OHFA 3WA0A 4A20A 1YX6B 2QJLA 3PO3G 1W6KA 3NBIA 4QB4A 3HP3A 4L6TB 2WXLA 5J1ZA 3R8BA 1LABA 3L17A 2XNAC 4HEDA 4OHJA 4R4IA 5ELNA 3AU4A 4LLGM 2C7NB 1XMQQ 2UXBL 2N49A 2WXHA 3T1YL 2N7EA 4EE2A 5JEAH 2MJEA 3DCGA 4S0RA 2VB3X 2L76A 3MXUA 1Z2MA 3CQZH 3B2FA 4DV2Q 1PTOH 3AEVA 2WP8J 2DZKA 2I5MX 3AEAB 3TQYA 2F0SA 1D2BA 1N36L 3AE1B 2BGFA 2ON8A 3NS1A 2WAQB 3NELA 1FL0A 1HCZA 5IYBH 3TMEA 2DAFA 4BOZB 1C9OA 4G0NB 1WD0A 2FINB 1K0SA 1TVXA 3DHGC 4GN5A 1NUCA 3NK9A 1GJXA 1GUAB 3MEHA 4K6LA 1WTPA 4DHZE 2MP2A 4HPLB 2HTHA 3SDLC 3UI3A 4RCOA 1L6UA 1ML0D 4OIKA 4YIJA 1TKYA 4PQXA 1XXGA 2KJRA 3AEBB 4LF8L 4HCEA 1Q5WB 4CO7A 3K7AH 4DV1Q 3UGBB 2E75C 4GLVB 2EOTA 3CMEA 3CP0A 3SK8A 3F2CA 2CH4A 1VQNA 1ZUD2 4WWPA 1TWHH 2G45B 4JX1C 4GMVA 2KCNA 2VB2X 5T8IA 3ECIA 4HSPA 1WJUA 2BYTA 3NHHA 4OO1I 5LMNQ 2J0KA 4JI7Q 4DKAC 3GTPH 3DWPA 4ZLTF 2NVTB 3K9PB 2NBVB 1XLNA 5EE9A 2XTIA 3HG9A 1Q82C 4DR2L 1PRTB 4JI2L 2AWTA 2Y5CA 5EE0A 1FXAA 5M3FG 1CA6A 2GN5A 3V96A 5FKAC 2O4XA 1N32Q 4IPGA 1HRJA 2J52A 4PYZA 3S17B 4K0KL 4B3MQ 3QIJA 3S16B 3I90A 2K5QA 4H02A 4ZHPA 2UXCQ 1JMLA 2EJFC 2R3ZA 2GLSA 3OMCA 5E4XA 1L1OA 4GDKA 3D6WA 4NAWB 3E0JA 1WFYA 1XTDA 2KQ4X 2O6VA 3ML9A 3DVGX 4LJOB 2NN6G 3GDEA 4RA8A 2JA8H 2NVXH 3A0JA 3M9BA 1R4QB 1V80A 3ZJUA 4ZRPA 4IQZA 4JI8Q 4LK0M 3TDQA 4IFDJ 1PFBA 4OW0A 2UXDL 3Q8EA 1PZJD 1CHPD 3HZXA 1PTOC 3HOXH 2BKFA 2L83A 4PS3A 3APDA 4B9WA 2PKOA 4BBNF 2PIAA 4DR7Q 1FRDA 3Q8AA 2R92H 4FP5D 3PO3H 4A3KB 5I6YA 5IP7H 1YHBA 4GNXA 5BYSA 3AFPA 1FNVA 4YCVA 3V2TA 5J22A 5EPLA 1XMOQ 2NR2A 3A1QA 3T3NA 3OW2A 4X3SA 1S5FD 2MO0A 2BBCA 2IPKD 4JIOU 5HHDG 2RD0A 5IO9A 4IKGA 2L15A 4OONA 4OX9Q 2A69C 1XMQL 4HVBA 1R7SA 2WAQE 1GM5A 3KUPA 1HNWQ 4ACFA 4PV1C 4UAIA 4DV2L 5D65A 1NVID 4XXEA 1SYCA 3RLNA 2ZCCA 1EEID 3A7LA 3SR1A 2F3IA 2KHIA 4WQMA 2AL3A 3OYYA 1HH2P 5FO7B 2K50A 3MAQA 1JORA 2WIIB 2B63G 1V8QA 4JW0A 2MBBB 4BAXA 1IKLA 3Q8DA 1AZQA 1SRUA 3VR4A 3GTJB 3I56A 1RDPD 1XTCD 2VY3A 4K14A 3NQIA 4U673 4CYEA 5IODA 4C3JH 3AM9A 4DV1L 4KDIC 1TWAH 4FDBA 1EIFA 1WTQA 3GTGB 4JI3Q 4RMFA 1NI3A 2KJXA 4JPBW 5DPRA 4F1SA 5IGEA 4K8IA 2HD3A 2N3SA 2Z6BA 3A5ZB 2C35B 3LWUA 4RGMA 3NQTA 4EQNA 3I72A 2JVCA 2W9NA 3HOZB 5LMNL 4K6DA 2CHWA 1RD9D 1Q3LA 2CKHB 2K03A 1XD3B 3O65B 2LJ5A 3EA6A 1YIJA 3A56A 4DV3Q 4IG7B 3UE1A 5M3FH 3Q3MC 1K8RB 3EGRA 1SB3C 4M8NA 5GAHC 2ASBA 5C6AA 1UH6A 3JW0X 4FADA 3IT6B 2E2IH 2QCZA 4R4QA 3ZXRA 3KUZA 4DHJD 5E6PA 5LHY1 3I3CA 2UXCL 1QWYA 4ICVA 3R7RA 2OQ0A 3HM3A 2ZNVC 1Q7YC 1V1QA 2OT2A 1FD6A 5TSSA 1DOKA 3D31A 3CPWA 5IYDH 5JXVA 1C4QA 2DYOA 1K28A 2INPE 2CU1A 1V8CA 3R7QA 4EQOA 2MW5A 1LUZA 2BH8A 4JI8L 1MGSA 1IGDA 2K6DB 5HI1A 4A3CH 2J0TD 5EPKA 3CSFA 3KUDB 4DV5Q 2OWOA 2G5DA 4HN7A 1YHQA 4B3TQ 4DR7L 4KVGB 2PW5A 4EQ5A 2IY5B 1H4RA 2L7RA 3M3JA 3OAWA 4BBRH 1XLPA 4AS1A 1XMOL 4NXMQ 3VTWA 4O0AA 4DV0Q 1SE3A 3PV0A 5E1FA 1XPRA 1GD7A 4A3GH 2BS4B 4C4VA 1Q1EA 2BE5D 4LAAA 1EIYB 2LXJA 1ET6A 1Z47A 3FVQA 2UUAQ 4OX9L 4A3BG 1HNWL 1H9RA 1ESFA 2KENA 2F0KA 3VYUA 1K0RA 4RNAA 4DV4Q 3CCVA 4HRSA 5LXIB 4GB9A 3HRZC 1GUSA 2YLMA 4AP4C 1PGBA 4II3B 2KFKB 4IPDA 5C23A 2Z9HA 4WORA 2B63H 1JC7A 4I65A 3DHIC 4X65Q 3M7GA 3IT4B 1BCPC 2BQQA 5H92C 4B0EA 3M95A 3TEXA 1SSOA 1QKZA 4F7XA 2CU3A 3LB8C 1Y1VB 5BMIA 1C1YB 1B3QA 4HIMA 2KQSA 3DWMA 2IBIB 3I4MB 2AQ3B 3T16A 4OO1G 1OTRB 4XE0A 5G55A 4TKOB 4S17A 2OCEA 5DPWA 4WJOA 2WV6D 1BBWA 4JI3L 4ABNA 3HOWB 3RZOH 4A93G 1L2FA 2Y0SB 4OZBA 2KHJA 3RD4A 1STYA 2K22A 2MX2A 3D3RA 4GIVA 3DVGY 1DOLA 4GOPB 2L3ZA 2JA8B 2DY7A 3PGEA 4ZRKA 3OPOA 1JOOA 1BNZA 2R93G 2SAKA 4A3MH 4DV3L 2DWQA 2ZJQA 1MJCA 3ZNZB 1MBYA 4C3HH 2AUKA 3HOXB 4HWIB 3AULA 1LTSD 3KF8B 3GTLB 3RNEC 4FYDA 4DF7A 2AL6A 1WRIA 3B1LX 1HZAA 2I07B 1RTNA 1CI3M 2J0MA 3TBLD 3RR5A 3RLOA 4A3JG 2HJ1A 2LGDA 4NNJB 3LXFA 1II3A 1TS3A 1F2LA 3UDXA 2LWPA 3RNAC 3GV6A 1SJED 3W1SC 1FR3A 1OTCA 3LDZE 3CC7A 2IT1A 4BKTA 3W1GA 4H7BA 1EU3A 1KL9A 2F0HA 5M3MH 1OEYA 3GOEA 2J53A 2EY5A 1K8GA 1MI0A 3V3XA 4KY6A 5GADC 1VQ6A 3QA8A 3PUZA 1XJVA 2F0JA 1NNXA 2BB6A 1EYDA 1Q90A 1QVGA 1ZW7A 3IHPC 5C3XA 1IW7D 2PMZE 3J81L 2X6LA 3VYSA 2DJGC 5K36H 4DV5L 4CDFC 1VCBA 4A3EG 4WAFA 1SNOA 1WXSA 3MC8A 4II2B 4IJLA 2JPHA 4M02A 4WJNA 2JYTA 3VDZA 4H0LC 1RFAA 3PIP3 4B6WA 4NXML 2SEBD 2F0GA 1ET9A 4DV0L 1QVCA 4C3JB 3IAYA 1UD7A 2BVCA 4A3BH 3D4WA 3SHLA 1HXYD 2NTTA 5LL6X 2GOWA 2OJRA 2UUAL 3DBHI 1EYAA 3WDNA 1M1KC 1J6QA 4MN3A 4DV4L 2BCOA 4IALA 4FHKA 4HDQA 3OG5A 2L9HA 1LXDA 4FN2A 3HFZB 4ILWA 3SK5A 1YIWA 3LJ3A 3N9YC 1U5KA 3C46A 1P8LA 2KCTA 1C8CA 2MGSA 3HOYG 1E7ZA 4XTCS 2AHOB 3SEBA 4X65L 4J3OD 2WKDA 3K6OA 2CWPA 1MPEA 3X3MA 3H3VI 1B9NA 1EO6A 3B08A 4RGTA 2RSOA 3H09A 2FHTA 4Z9CB 2DZMA 2BS3B 3J80L 2ACZB 4TSSA 1CUKA 4RM8A 2C5LC 5IP4D 2LI5A 1RL2A 1WH3A 4HJ5A 1VDZA 1IL8A 1U9RA 5GQOA 2NZ1D 1Y69U 2FCQA 2AX5A 2D07B 1UGJA 2K28A 1Z6HA 2AWOA 1YNJD 3HK0A 2QKIC 3QOLA 4WAAA 4YCWA 2EY6A 5T1GA 2UU9Q 1GC6A 3H0GG 1OO9B 2F3WA 2LFNA 5JEAJ 1JCKB 1UWVA 2MNAA 4LUOA 2JA5G 1SIFA 1HJPA 1JJCB 3S15H 3S14B 4C2MB 4NXNQ 3W1SA 1EY5A 3EVQA 1I35A 2A6EC 4A3JH 3D0FA 1QOGA 2JT4B 2KWUB 2K1BA 1TTNA 4FJYA 4N9PA 3MVVA 3PZ8A 2EMTA 3P1HA 1STNA 3IG3A 1VR9A 3V6EB 4QQBX 2VZAA 3P4SB 2FFKB 3NBHB 2VQFQ 4A3FB 3RN9C 4BKGA 3CCMA 1BMLC 2PMVA 1CZPA 2ZT9C 2O2VB 1MSGA 3VFKA 4IFDH 1RTOA 3SK6A 1JALA 5FO9B 3NTKA 2NMQA 4C56C 1GB4A 1IBKQ 3FEWX 4E6IA 3FPPA 2DZJA 2IO3B 4DHJB 3NWSA 4DGZA 4IDIA 4N6EB 3GO5A 1EF5A 3GB1A 3H91A 4USAA 1FNWA 4KGTA 5CV8A 2NBUA 4K5XA 1KXLA 2WXNA 2N0SB 3G71A 3MJ5A 2JA6G 1HR0W 4JI6Q 1TWGB 4H44C 3AE3B 4PYUA 1F2RI 4LDTD 1CHQD 1WTOA 4A90A 4AJWA 4W9FA 1U4MA 1QOAA 3BK2A 2ICIA 4LF5Q 2NBWB 3EQLC 3TN2A 1I6HB 2GI9A 5A35A 2BS2B 2PI2E 3KBGA 4IUNA 1V1OA 3RZOB 4MT5A 1FM0D 4M0WB 1R4NB 3EFXD 4M00A 1YJ9A 1NI2A 1SSNA 2JA7B 2PNRC 4FJVB 4C1NI 1Q12A 1Q8IA 3HOYH 3F2BA 4A3MB 1IBLQ 3ZJTA 4L63B 5KEEA 2ID0A 2RCNA 4UP8A 1YMHE 4IWPA 2F0LA 3U4ZA 1B44D 3BY4B 1UELA 3NVYA 2OF1A 4NW2A 4OIJA 3DDCB 2JY6A 4QY7A 3H7PA 2VL6A 4E74A 1PH7A 4JBJA 4DUZQ 1SYGA 4EOYA 1K73C 3F2DA 2WB1E 3A7AB 2QF7A 3CRLC 5FJ8H 2KDFB 2WDQB 2WXPA 3C0RB 3W9CB 4AUQC 2KLCA 5IGBA 1Y1WH 1PLFA 2DN8A 4C3IG 3APFA 4RAUC 1QG7A 3T9LA 2GBJA 4G7HC 4LWCA 4KLKA 4ZKCB 1CJEA 1EFID 1MI2A 5BN5A 5M3MB 3ZNHB 3J81i 3Q3NC 1EL0A 3I4NB 1OQQA 1V86A 1RKNA 4RHSA 3BG3A 2KO3A 3QC8B 4RMAA 1RCVD 3H0GH 2LXKA 4AWJA 4K5WA 2KACA 2UU9L 4GLAC 3U7ZA 1UZXB 4DPGA 1ASYA 3T53B 1RYJA 1LM0A 4NXNL 3QAQA 1WVLA 1Q46A 1DGSA 1LTAD 2GBKA 5IKCM 3KYCD 1UE7A 2YEPB 1VQ5A 4MTKA 4W9GA 3QWNA 2JE6I 1MHHE 1VZ7A 3MA2B 4IOIE 4NZLB 4A3DB 3ZGZA 4L2YA 2VQFL 1YQBA 1N63A 5CHWA 1UGMA 2MBEA 3PHXB 2NVQB 5EE3A 5BMGA 2Q2TA 1L5PA 4RGOS 2KMCA 3T3OA 3CF5A 3ER0A 1N5XA 4WWOA 3R93A 2HCIA 1G6ZA 3GE3C 4IJHA 3AE9B 2X8XX 5HGQA 1IBKL 3J81c 4IUUA 4GS3A 2W82A 3PV1A 2Q8RE 1C76A 1GVPA 4NJ6A 2VW9A 3PLVA 5CV7A 2JA6H 5M5WH 4NP5A 3J80i 3RZDB 5IAAC 4NB3A 2KDEB 2QW7A 3S1NH 4BVUC 4OZCA 1WTHA 4DR5Q 2L4NA 4JI6L 1YN3A 2D3BA 1E10A 4XYCA 1KLVA 1TGZB 2NYZD 1IKMA 1ZKHA 3EROA 1N8RC 4CHKA 1B70B 1F9PA 2ASQA 3PLUA 2JU6X 1JMCA 1C4CA 4LF5L 1C48A 1K8OA 5LNK1 1F9SA 3VDYA 1GC7A 4KHPQ 2NPTA 3PRMB 3RNUA 5C4XG 2PQAA 3MZ5A 4DXGA 1F77A 1BBXC 4X6AH 1JQ4A 1TU2B 5E3FA 3E9HA 2J42A 1PA6A 2H1EA 4W9IA 3ZNGC 1T0RC 1V1PB 2QGQA 1PTOF 3IRBA 1IBLL 1UWMA 2JUOA 2D0OA 1KOTA 1DCZA 1FIQA 2NN6I 3KLRA 4XQJA 1T9HA 1SDFA 2MQHA 4GN4B 5CMDA 2ZW1A 1IP9A 4FBJB 3J80c 5IY0A 4I6PA 2H4OA 4QUFA 1F9JA 1MJDA 4D2KA 3AMUA 3AE4B 1Q10A 3CF6E 2N9EB 4IN3A 4C3IH 4YXDB 3VH3B 2MWSB 2KOXA 2XK5B 2PCFB 5FK9C 3CD6A 3AEFB 3VH4B 4HLEA 2JK8A 2MBOA 4MSQB 1TT2A 1K51A 1KAAA 3MP9A 1G6PA 3AEEB 2K5NA 2ZVNA 4X3UA 3LX0A 2G1EA 4WJ4A 2PEAA 4DFAA 1MHWC 4MGYE 4DQOC 2D5GA 2OJWA 2EYPA 4IW0A 2DNCA 2EYMA 1WR1A 2V4LA 3DHQA 4ZKBB 2WXGA 2Z0EB 2FBWB 4F8CB 1L0VB 3IVFA 1UE1A 3V6CB 3BWUD 1J5EQ 3C1FA 1P9DU 4HIKA 1BBUA 2Q2HA 2RPQA 4P7IA 5IE8A 3NVWA 1YJWA 1JWMD 3TP7A 2CKZB 1I4RA 1T6BX 4Q2JA 3TZUA 3PHWB 5CYUA 1A0IA 3NUCA 3T51B 5FOBB 3ULJA 3AU5A 3TJPA 4DHZB 2GBMA 4KK7A 3AEDB 1CKNA 3S1RH 1QT9A 2K25A 1K8MA 2I5HA 1E8YA 2W54A 2WDVB 3QJYA 5BN3A 1VQPA 1RF2D 2E3TA 5AZFA 2LMCB 3KVFB 2IO2B 3A8JE 3BS1A 2LGSA 4XQQA 3SE0A 2LRWA 1NYRA 4A3PA 4AYBB 1D7QA 2I0QA 2KTRB 2PZUA 1P3QU 4DR5L 1QNKA 1PTOD 3AE7B 2ZM6Q 2J0JA 2QDBA 4QJFA 1AWDA 2ZCBA 3IAS1 4A9AA 2B29A 2G9HD 1E8XA 3AN1A 1A70A 2K05A 5FLMG 1WXAA 2H88B 2JZ3B 4MJSB 2RSNA 2B2TC 1Y1WB 2KCMA 1ACCA 4ZDVA 1AW7A 5C4XH 2R61A 4A4IA 2KD0A 1BDOA 3GTMB 4GDLA 4KHPL 3PMFA 5M5YB 2C9WB 2WDTB 4MNOA 2RBMA 2AQ1B 1K8AC 3H3VH 2QDFA 1ONLA 2A69D 2KVRA 4N59A 1DGJA 3OWFA 3OWEB 1OXTA 4P71A 3E5SA 4A3IB 3S1MB 2KYWA 4K1RB 4LDTB 4R3DA 1H9SA 2INDC 4GN3B 1Y1VG 1YEZA 5DNFA 2HHHQ 1Z5SB 1KH0A 3MHSD 2RGFA 5AJ3Q 2A1AA 1O7IA 1TYGB 2MFIA 2W3SA 3OSOA 2KMMA 2LUEA 3VVWB 3ZUNA 1TY2A 4BXXG 4FJZA 3TCAA 5JJIA 3AV8A 3HOWG 5KYLA 4OXPA 2D3GA 2Y0SG 3L13A 4BBSH 2B8GA 2R7DA 2X6GA 2C5CA 3AECB 3VQIA 1CQVA 3BYTB 3EHVA 2GBNA 2LUMA 1MD2D 4GNXC 5JZEB 4KD3A 2A74C 5IOCA 2QEXA 1C79A 2L55A 1MKHA 2FUG1 5C3EH 1JRPA 1JQYD 1BCPF 3BDLA 3V05A 1VQMA 2PZTA 1V2YA 2LY7A 1D3ZA 4O2DA 3R2TA 5KRUA 2EKEC 2KJHB 1KM7A 4FXKC 2E2HH 5D94A 3FPUB 5LXHA 3P63A 2VNUD 3I4MG 2BYFA 1WJ4A 3NWTA 4RF0A 3W5OA 1J5EL 5CR3A 3Q3OC 5FR3A 2FIDA 2K9XA 3MXGA 1GXDC 5T1IA 1MFWA 1Q0WB 1SE4A 2MP2B 5E6JA 2NVYH 4ZRZA 3SR6A 3PO0A 2C7HA 2BTEA 3X3NA 2QMTA 1PH3A 5FO8B 2HDEA 2ENBA 2R7ZH 4AYBE 3J9CA 2LD9A 5C0XI 4OWTB 1WZ3A 4ICUA 2M2LA 2NUCA 2K33A 4KZCA 3UF8A 1SE8A 3A5UA 1WTXA 1SNQA 2KOLA 3NY5A 1X65A 5M5XB 1G2SA 3N52A 1QUQA 4A8XC 4C1NK 3H3VC 1UE6A 1XPUA 1ZDVA 2B2TA 4CJ0B 2AQ2B 1QOBA 2JA9A 4XX5A 2EYOA 4LJZC 3Q22A 2XVSA 1FMAD 2F0EA 3DPDA 1FD7D 3TS2A 2L1BA 2KT7A 1ENFA 4JOIA 2V1YA 2IX3A 5FLMH 3N1YC 1VQIA 3H15A 1J19A 1WRDB 4DXAB 1PFSA 2E5LQ 1IYVA 2F1MA 2R6GA 3EUB2 2HT1A 5EKKA 3J81E 4KN4C 3HKZB 2TMPA 1R4MB 4TKNA 4HR7B 5DM63 3KLSX 3DWAA 1HFGA 5G2NA 2IGHA 2VUMG 1BQQT 4N8FA 5IYCG 3HOUH 1V43A 1L1OB 1LM8B 4GDKB 1TIFA 1NMFA 4DUYQ 4DDID 2WYQA 2MSED 3VA5A 3VYRA 1WYGA 4HDOA 1NY4A 1Y14B 1B7YB 3C1EA 4GSWA 4K7SA 2DBYA 4YTPB 4ZQ3A 4EZKA 3DWGC 3I7FA 2RA4A 1GAQB 1X3FA 4RH6A 1ZPSA 4DBGA 2HHHL 3AE8B 5G5HA 1EQRA 4EKUA 2HQEA 5DPTA 5AJ3L 2BA0A 3CCLA 2EKIA 4BXXH 5BO4B 2K14A 3TUOA 4ME3A 4X66L 2GVBA 3F2UA 1UBQA 1BCPD 2WNMA 3H8HA 4A6QA 1NTGA 1WJJA 2INCC 1AP0A 1X55A 4R8IA 2UUBQ 4FXGC 4KSLC 4JBMA 1K50A 2BW2A 1I6VC 1LTLA 3SD5A 4MHEA 2B2VA 4GNXB 1FFUA 1EY7A 4DNTB 1EEFD 1K83H 1G8ZD 3O13A 1Y56A 2K8BA 4P2CB 2KTFA 3A1QB 3DBLB 5ISRA 4G3XB 2WKCA 3S1RB 4JWSC 2IL8A 2L32A 3GZNB 1BVSA 1SYDA 2WXQA 3J80E 4LJPB 1A3UA 2F4VQ 1HZBA 1VF5C 1TBEA 3SXHA 2OXPA 1VRAB 2KC1A 3EFUA 3PQIA 2ZPNA 2FCSA 3I4MH 1F2RC 3DBHB 1YJIA 5EKLA 4NQLB 4A3LG 4HCNB 1EWCA 4Y52H 1RODA 4BY7B 2M0XA 3U2SC 2CHBD 3C3LA 5J3BA 1SIJA 2KQ3A 2DX5B 2RQXA 1FGBD 2F0TA 2B8FA 3RMKC 3W5UB 1SYFA 3OHXC 4XYQA 1D4BA 1R9TH 3DHHC 3CU7A 4FA6A 4I7ZC 3L16A 1E24A 5GAEC 2ALYB 4JI7L 3GD7A 2HDMA 1G291 4ZK9B 4JLCA 2JN4A 2EXDA 3CIRB 3GE8C 4XC2A 1HZ5A 3FILA 3F8TA 1NE3A 1OXVA 2D5DA 5I9PA 5KNCA 2PE6B 3HKZE 3I4LA 3VR3A 3J7YW 3C2PA 1F2ZA 1N32L 1XF5L 1Y8OB 2EIFA 1J8IA 1E9MA 4B3ML 3HKSA 3W5VB 2TSSA 2E5LL 2Z4HA 1VQJA 1HZ6A 1MHXA 3GTOH 2A68C 1WXMA 3FC4A 4MM3B 3K81C 2K39A 4FLHA 3CMMB 3KQ4A 1EOTA 2NN6H 2VUMH 1SR3A 5FR6A 2CFMA 1TIID 4DNRB 4HJ7A 1RRBA 4YWKA 3UIOB 4CQNA 1CMXB 3DQVA 3FKIG 4IOCA 3CKIB 3PO2G 4LFBQ 3ZDMC 3CQZB 1C9FA 4DUYL 2RDHA 1PTOB 1IBXA 1GNUA 1XT9B 3IFTA 4KY7A 2N7DA 3Q8CA 1E7UA 4MACA 2B2WC 2MBHA 3ZW3A 5D3IB 3PIPA 1JR0D 4KGRA 1EWHA 2G4DB 4GKJQ 1WYWB 2E2HB 1I4QA 3CW2C 3M4PA 4KTAA 1MJEA 5CTRC 1I42A 5G5GA 2PVGC 2KANA 3ZO5B 2L05A 5CX3A 5GXGB 4KDLB 4MZ9A 2UUBL 3QHTA 2PMZB 4DA2A 1PGXA 3PGZA 3L7ZC 3VA7A 3B6YA 3K7AB 3VTUA 1EY6A 3T4AC 4RFBA 1QOHA 5A2QL 3I4NG 3HVZA 4BKSA 4DR4Q 2RSUA 2EZVA 2WACA 1IYUA 2WU2B 1TWHB 3TL5A 2KBNA 1L0XB 3S2HH 1E1TA 3BJUA 2VXWA 3W1BA 3JAML 2R7ZB 2KDBA 4IM0A 2HE7A 1I5FA 4C4VB 3JVZX 4C7ZA 1HTQA 5EGTA 3TSSA 1BUVT 4HIOA 3GTPB 1JICA 2JYOA 3ZLZA 1SYBA 3ZJVA 2F4VL 1PH1A 3TP8A 1E0ZA 4A3LH 1YNTE 1T0SC 1IPGA 4B9XA 2LVPA 1TKGA 3IKJA 3JSVA 1ZE3D 4P6VF 5C1ZA 2LGXA 1ZXTA 3CCQA 2A6ED 5C0XG 2LZ6A 2KX3A 1WTWA 2L8JA 2FE8A 2F4IA 1A63A 3U4VA 1YJ1A 2CW0C 1EF1A 5IGDA 5D6JB 5C44G 2K5WA 4RWSC 4KIKA 1L2NA 4NAMA 3ZYYX 4UY8C 1QJOA 1J9OA 3CCRA 2XN9C 2NVXB 2OOBB 3HS0C 4IWOA 3RNFC 2XSCA 4C80A 1IXRA 3NS8A 4EX5A 1HFNA 4BFRA 3AH7A 2KC2A 2O5JC 4GLXA 1D5MC 2BKRB 3AQQA 3J7A5 1P1AA 1PZKD 1ZYRC 3FKYA 1QILA 2JJQA 4OEMB 3KDFA 2K5HA 3PSIA 1V6EA 1A3TA 2R92B 3CPFA 4GOPA 2ZNVB 3PO3B 4HJ9A 3PIO3 2N55A 4ODGA 2EQSA 2JEAI 2E6XA 2PTLA 4M1UB 1LT3D 4F8MA 2K5PA 1IBMQ 4MH8A 2B2WA 4K5VA 3RN2A 2PO4A 5I2YA 3SVMA 3NVVA 3Q6SA 2E2DC 4GZYC 3ND8A 1FRRA 1QOFA 2DNFA 2GB1A 3W2DA 3HOVG 2EY1A 4K2KA 4LFBL 5K5PA 2JXXA 4OVZA 4HJAA 2W3RA 1TXYA 4IURA 3G6EA 2Z8LA 1KFYB 2JX5A 1X3PA 2PVOD 4B0MA 4KMUC 2PPHA 1RIPA 3K5LA 4L5RC 3JC66 1PH8A 3U9SA 4LK1C 1IYFA 1S5CD 1CA5A 1WGRA 2XWJB 4GKJL 2REXA 1BO0A 3ONSA 2AYOB 1CT1D 4B3TL 1NDDA 2E76C 2KK8A 1JB7A 1I4GA 1NYQA 4FHJA 2K5VA 5LL6S 4RG1A 4MDKE 3E9SA 5AFWA 3OIPA 1TWAB 1TS5A 1FPYA 1SF0A 4DR4L 3A9KA 2Z0SA 2KAJA 1L4DB 5KHQA 4YWLA 1EQQA 1D1KA 2Y3AA 2D0PA 1TS2A 3MFYA 1G6JA 1JRUA 1BCPB 1YN5A 2GBRA 5ELFA 4PT5A 4N58A 1WE7A 4HCPB 4WRDA 5M3FB 1AH9A 4EVOA 1VZ6A 1M90C 4R4CA 3C8YA 3ZRCA 1LFDA 2N9PC 2I46A 2F0IA 5F2DA 5CGKA 2HIVA 1WI0A 1WI5A 2V3NA 4FXCA 5C0XH 2E2IB 4OO1H 4HAEA 1KDCA 1Y8PB 1EWYC 1F9RA 5KGUA 5JHBA 2EVBA 3NXWA 1U0LA 3AE6B 2WWZA 2PJHA 3K57A 4A93H 4BWGB 3PF4A 2WXRA 2K4KA 5C44H 2KLGA 4NY0A 3ENEA 4I7AA 5KIXA 2PLPA 1IHZA 1SYEA 1Q81C 2FIFA 2KMAA 3GS2A 4QL5A 2WB1B 3CCUA 2ATWA 3DBRB 2R93H 4UHVA 3WOFA 5EJWA 3FHWA 1Q86C 1TR5A 2JRIB 4GXBA 1L6VA 3N20C 3PUYA 2LRUA 1S5ED 2K3UA 3VR9B 2CQAA 1HEZE 1PQSA 3X23A 2WXOA 1AE3A 1PYWD 1F2YA 1D5ZC 1WCMG 1C7YA 2DAJA 2JEBI 4K7UA 3DVNU 1S3OA 2E8GA 3I5JC 4K8JA 4L5TA 4BY1G 3M63B 4BBRB 4TQ1A 3KBXA 2KCCA 3JAMi 2D10A 1F9QA 4UP9A 1IBML 3M4QA 2K32A 4A3GB 1IZ6A 1QE6A 1SAPA 3Q2AC 3HOVH 4DR3Q 1HE8A 5DPSA 4KKIA 3VR6A 1FVIA 2KUMA 1KABA 4AH6A 2JXMB 4A3IG 2MO1A 4K3CA 2CS4A 3VUYA 1ESRA 5AEKB 1WGKA 2N9XA 3AU7A 4FXDA 3PTFC 5JAVA 2DHZA 4IUQA 4DNIA 1CKMA 5DLQE 2B63B 3N32A 4NPSA 3Q8FA 4P16A 4L1BA 2MUYA 3J7ZC 2Z0DB 4K7WA 5D2MB 4A3EH 4JCVE 1JROA 4XZ4A 3PRZA 1VQHA 3OIQA 2N7JA 3CSTA 2P5ZX 2J7QB 1VQ8A 3Q14C 3CC4A 2LGYA 1GJZA 1ZXHA 2LS01 1PUTA 1CZGA 2RF4A 3JAMc 1XLQA 2IYDB 1VQCA 3Q3JA 1KC8C 3K0YA 2YV5A 3DMUA 1J7BA 3J7AV 5ELEA 1TQOA 3NG0A 2CVRA 4TQUS 2V0GA 2ZW0A 2DYMA 1RFKA 2KDIA 1OXXK 1SMYC 4YWMA 4ALPA 2WAQG 2YTYA 3Q8BA 4YY3Q 2YTXA 3V62A 5KNDA 4MGKE 1WMHA 2BT6A 1DM0B 2WXKA 5CBEE 3U52E 4C3HB 1SE2A 1YD8U 4ZYNA 2BYVE 4A55A 4FF2A 1BXTA 2BWES 1WYDA 1JOQA 5HFYA 2RDGA 2A73B 5JJZA 4DR6Q 5L95C 5TR5A 2LXAA 4IO9A 3MHBA 1SLJA 3H7PB 1WR6E 2GMIC 1YNNC 2ZJRA 4HK2A 1S72A 1YI2A 2F0VA 4NJCA 5IA7A 2ZXOA 1E2ZA 4L23A 2CHXA 5ELDA 3E9IA 1QQRA 1T5EA 3QWZB 3I2ZA 1EIGA 1NBWA 2MP1A 2A6HC 5G3LF 1N34Q 2FCNA 3PT2B 4K81A 4WJWA 2JA5H 4B9KA 1KF6B 2V3PA 3OJ3A 2M00A 1YQ4B 3X0WA 5HKHA 1YQ3B 1WOCA 4LF9Q 2EDGA 5IIFA 2YU9H 2MLBA 4WFN3 5EDSA 1OEYJ 1A15A 3SHQA 5DCNA 3SFDB 3STBC 4ZRIA 1WFQA 5DM73 2NZOA 1EQVA 4X57B 1VDVA 4PZ8A 3S2DH 4MELA 2K8HA 1D5XC 1K53A 4A3BB 2N9KA 3PPAA 4YTMB 1NAPA 2F0OA 4DR3L 2DY8A 2ZTCA 1YJNA 1JW9D 1WD1A 3BINA 4HSVA 2LGIA 1A6XA 3UINB 3Q24A 1BOSA 3V61A 3WWVA 4WURA 3DEOA 1QZEA 2NVUI 3A8KE 3PUXA 3NENA 2KZRA 3MEFA 3FRPB 1QLBB 1GHKA 3PS6A 2PPBC 4A3KG 4CDEC 1IL2A 3ICEA 2WINB 1H9JA 1ICFB 4QCLA 1V9JA 2O6VD 2QC8A 1N5WA 2E2JH 1GUTA 1QZHA 3URYA 2WGSA 2EY2A 4DAYA 1F1HA 3P42A 2WXIA 3V60A 4X3TA 2ZZPB 3TEWA 4A93B 1FCCC 1XEEA 1A2UA 2Z6KC 2Q2UA 3NRZA 3BDCA 1ZKOA 3GV3A 1GHJA 1Q8KA 4CDCC 1Y8RC 3EJIA 4CJ2C 3WAOA 4RM9A 2DLBA 4PNYA 2R93B 4YY3L 1C77A 5EQ0A 4DAPA 2NPTB 4PZ7A 1R4PB 2PQAB 4W9JA 1VCIA 1EFWA 5GAGC 1RAXA 3P4PB 1L0WA 3M7NA 3DM1A 3VR5A 2HD5B 4GGQA 4QAYA 1CZWA 5G3LD 4AIMA 4JI1Q 2QA4A 4BY7G 1EZ8A 3S15B 1M94A 1EYGA 2IW3A 4JQWC 1OGWA 1W3SA 4AQ7A 4A3JB 1TKEA 4YSZB 4WJQA 3AEGB 4K3BA 1LGRA 1N6ZA 4DUZL 2KHSA 3T56B 1A8VA 3NSWA 2EYHA 1VQ7A 1ICWA 4DR6L 4EZJA 1EUJA 1JJ2A 4ZOHC 4HKQA 3TRZA 1VF7A 2N9LA 4N8X1 2K6QA 4DXFA 4AQYQ 2FCMA 4DV6Q 4C00A 1XQQA 2PZWA 1X32A 2I5LX 3KWLA 1GUOA 3HOZG 4ZUJA 3DUZA 2NBFA 2BH2A 2ZPYA 4IOAA 3HGBA 3E0EA 4LCDE 2LKVA 2RVLA 5IGGA 1X3EA 1HNXQ 1PMRA 2D62A 1N34L 3RULA 3EFCA 1K9MC 3HHMA 1B53A 5DAUA 1P98A 2IO0B 2KQ7A 4LNFA 2INNE 3WIMA 2MJ8A 4TVAB 1NBFC 2JYEA 1GUWA 3AMZA 3AE2B 4LF9L 1LACA 2H5XA 3BU2A 4F7ZA 1W2BA 2WX0A 2F0PA 2AWNA 2F0QA 2R7FA 5DEHA 4A3EB 2HTME 3NHEB 2V9HA 1E8ZA 4W9CA 1O78A 4ARIA 3H6NA 5C3JB 2I38A 4YSXB 1WGDA 2LASA 2UXBQ 4US9A 4HCSA 3NZ3A 4YWGG 1G91A 1HTLD 3QG1A 1IGCA 2DYBA 3PUVA 1E1OA 3IFWB 2JZZA 4W9HA 5JEAG 4BA1I 3BIID 4DU9A 1ISNA 3OLMD 3R3OA 2LSSA 2BOSA 4REZA 4A3OA 1PDXA 2HIXA 2Q8TA 2M19A 1CSQA 3BVGA 3VR8B 5HY6A 2GA4B 3FP9A 1LV9A 1I4HA 3QIAA 3K8AA 5IYBG 2FUHB 2MHJA 1CKNB 2BDNA 3HOYB 1WIAA 2SOBA 1EY9A 1TWCH 2VS1A 3A54A 2N88A 5C5MA 4Q5VA 4B3RQ 1B50A 1I7HA 3EN2A 1VLBA 3L0WB 3KW5B 1HUMA 4M8AA 1H8CA 1KD1C 3L0OA 2L5TA 2Z6KA 3AFQA 4ID6A 2O5IC 4NPNA 3CWIA 2UYZB 3VUXA 5IGCA 1UEBA 1MVKA 3LYYA 3NZSA 4WH4A 2AKWB 2AMCB 3MC0B 1PVOA 2IGDA 2LMCA 2BWFA 4ZRQA 2JQRB 1F0ZA 4POGA 4UPAA 2KTRA 1WJ6A 1VQDA 4F87A 1BKBA 1BR9A 1FFVA 4JOIC 4XIGS 3PRPB 4LFAQ 4R4OA 3A9JA 4DR2Q 1WE6A 1UNSA 4GDLB 3H0GB 5IN7A 1R4NI 2JA5B 3KK7A 1U4AA 4ZAIA 1VQ9A 4QUCA 1VZ8A 1O7ZA 4S3SA 3K9OB 5A2QE 1WXVA 4MJSA 1PRTC 1VQ4A 1UF0A 3RUIB 4JI1L 5EKIA 3TREA 3RNCC 3ALBA 1ENCA 3KF6A 3JAME 3UIPB 1C4AA 4N9F4 3EIVA 2QIEB 4L5SA 1BT0A 2R2OA 1WM2A 4BKSD 4Y7NH 4KJNA 3T13A 4DAMA 2IY0B 3I9V1 3L9AX 4G7ZC 1X9NA 1AZPA 4RF1A 2BA1A 2SDFA 3U58A 1H9KA 4URKA 2QHOA 1J8CA 3U30A 3MXNA 5C4JH 4AQYL 3S2DB 3HOZH 4P1CC 4DV6L 2WFWA 2L52A 1UAPA 3WAMA 1YHAA 2A5UA 2XRSD 1WGGA 2JZPA 3ZQ4A 2JA8G 2RMMA 2JXTA 4BA2I 4R8NA 1CFMA 2Z59B 1HNXL 2Y5PA 4QF4A 2FMMA 4LW1A 3A8IE 3HOXG 2M17A 2VZKB 3UDFA 1XYIA 4J6IA 2B2VC 1PV4A 4TMAB 4DN4M 3VUWA 4CGYB 1PH2A 4EZLA 4HIDA 4TRDA 3LGJA 4LNOA 1E5WA 3TP6A 2JA6B 5M5WB 3EBEA 5IP7G 4DV7Q 3S1NB 3KJPA 4JBKA 4XT1B 4GU2A 1L0YB 1E22A 4ZUIA 4DDGD 4RHRA 2C60A 4KV6A 3GTQH 1N61A 3IAM1 3RT3B 2E2JB 3NTIA 1WWTA 1L4ZB 4IPCA 5CORA 5ELCA 5BYRA 3ZTCA 3MWYW 3Q0AA 3H6MA 3FMCA 3DLLA 4J8QA 5C0XJ 2YYZA 3VAWA 3KYDD 2A68D 4YL8A 4FF4A 3KOJA 3MHZA 1FJGQ 4KJOA 2WX1A 3K5MA 3QR8A 3NVZA 3ZDTA 4J15A 1KHIA 1PH5A 4FNFA 1HHVA 4ANXA 1A5RA 3CRKC 1KRSA 1P7EA 2KVZA 1SNPA 4JYAQ 4B3RL 4M01A 4IM2A 2Z4IA 3WANA 2WU5B 3HUIA 3CMAA 1C78A 3L08A 2WHIA 4OVVA 1E90A 5FLXL 1K3BC 4E3CA 1J7CA 2H89B 2N1WA 1G51A 2QDLA 1QUQB 1KAWA 2JWZA 1YVCA 2ZM6L 4JI0Q 4C3JG 2F0UA 2EE1A 4JBWA 3ONAB 5C4HA 1E8WA 3C19A 4Q0FA 2UUCQ 1EY4A 1KLUD 1VS0A 2IX0A 4C3IB 2KX0A 4DAVA 1UE5A 2CR5A 3KUCB 1C4PA 2D9UA 2KWCA 2M0AA 4ASWC 1JOKA 5AUKA 1STAA 5CHVC 2K01A 1B9MA 4DK1A 2LXCA 1XNQQ 1GKHA 4JVZA 4LFAL 3R66C 1S4ZA 2Q8IB 3P2BA 3ZVVA 2XEWA 2PQEA 3CCEA 1EU4A 2O6VB 1Y8NB 2K8CA 1WGYA 4JE3B 4LF4Q 1Y1VH 5L83A 2PE9A 5MPOA 5EBDA 2O2LD 3TEHB 3M3YH 4NAWA 2PW9A 2N1VA 3A74A 2RDFA 1KRHA 3K0XA 2BYEA 1P16A 2KJ6A 2LEKA 2N8NA 2KWVB 4LNNA 1FO4A 3CHBD 1VQEA 2WP9B 3HOWH 2CHZA 4ANUA 1FEHA 5IT9L 1L7YA 4QIWB 5IYDG 1P0RA 1VQFA 1FXIA 1KDBA 2A4ZA 2WB1G 3PCOB 2RDBC 2EYJA 3GP7A 5E7NA 5ELOA 1FNUA 4YHHQ 3NP8A 3KFUA 1WTVA 1N9WA 1SGHA 4MGZE 4IFDI 1V9PA 3I91A 2CW0D 3GTLH 2DENB 4A3CG 2QSDA 3H94A 3ND9A 5E6OA 3D4DA 4DK0A 3ULLA 3N6RA 3A33B 3N3KB 1TWCB 1HA5A 2HCCA 1S3SG 2NS5A 4CDDC 3UE0A 4WWNA 5H8YE 1G2TA 2JSVX 1J0GA 2OQKA 1YBYA 4KKSA 4AJYB 4DV7L 3I3TB 4BBRG 2ZJPA 2ZXPA 3UI2A 4P74A 2F0MA 4A3FG 1O7LA 2Q5WD 1ZYRD 1EIHA 4A3GG 2JWUA 4HPPA 3T8MA 3DBSA 2IHEA 3GTKH 1ENAA 1BF4A 1KQSA 1TY0A 2MA9B 2CJNA 1O7YA 1KRTA 1AYFA 5C4XB 4DWFA 3K7UC 2B39A 3RUZA 2WXJA 4EEWA 1A62A 3WOEA 1FJGL 4O42A 4KHZA 3HIZA 4ITKA 2F0WA 5LMNW 4XQNA 1SEBD 3L2PA 1LT6D 4R1JA 3CCSA 1STEA 4JYAL 3PIOA 1JJGA 2K0PA 4LF7Q 1MSHA 3NE5B 2WXMA 4KKUA 1MIUA 2FNJB 3M62B 3TBIB 1AFPA 1W6JA 2MCNB 2RPVA 1ROEA 4JI0L 2EPBA 2OEOA 3FILB 5C2TB 4Y7NB 1XX8A 4PS8A 2K52A 2CCZA 3E56A 2UUCL 3ZNID 1I3QH 2BB5A 3OJ4B 4NJ7A 5C4JB 5IWAQ 2K75A 1A2TA 1X6OA 4BBSB 4YSYB 1KDAA 2RKSA 4UP7A 3VXWA 2D3AA 3NTHA 5IYCH 2JA7G 2K5DA 3DOWA 3ETRA 4GOPC 1Q1OA 1ZP0B 4A3MG 1XNQL 3DWQA 4GKKQ 3KLSA 2MBQA 3L4PA 2IX1A 3I63C 4LUZA 1XLOA 2W55A 5I4DA 5H1SE 3M85A 4OWWB 1T0YA 3E6ZX 4C3HG 5C3EB 4LF4L 2CQOA 3TS0A 3NUHB 2EELA 4I6NB 3VR2A 4X64Q 1E3PA 5CHFA 5LMUQ 3L3OC 4IPHA 2L0FA 4MGIE 2M1MA 1NCVA 4OWXB 4MM3A 1YZ6A 1IBXB 4QIWE 3TMPB 1SJHD 2LVQA 3LNNA 1AEXA 2YEPF 1FYCA 2D2CC 4CJ1B 1JWBD 4HJKA 1I4XA 1HZ9A 2V4DA 1CK1A 4OGQC 1SN8A 3GTQB 4GLSC 2M4NA 3H7SA 3ABVB 3D8GA 2NVYB 5M3MG 3G7LA 1JWAD 2B76B 2QILA 2VQEQ 2KWDA 1KNEA 3RNGC 1MG4A 2X69A 3I8ZA 3ITPA 4YHHL 4FVMA 1UUPA 1ZXIA 3S14H 2EJMA 4C2MH 2ZJDA 2J4XA 4RGNA 3K58A 5EE1A 1PZID 3KLWA 3K5NA 1DJRD 1VMCA 3PF5A 5K36G 5GROA 4H13C 3ZKJC 5JOBA 2F0NA 3ZXVA 1S40A 4G57A 4A3FH 4L8JA 1DOMA 4A75A 4LNKA 4A3DG 2L11A 3VYTA 3HM6X 2PYKA 2I1JA 4ANWA 2BPSA 4RCNA 1ZEQX 4CHTB 3SK4A 2KFKA 4IM3A 3JSVB 1E0BA 1PFDA 4JL9A 3P1MA 3U8ZA 3B2GA 2GVAA 1H9MA 1ASZA 5EBCA 4BZAA 3IL8A 1EY8A 3S24A 2DGYA 5NUCA 2F52A 4KV2A 1LQBA 3HOUB 3CXCA 4QGUA 1PH9A 5FLXc 1NR4A 2K04A 1U4RA 4JV5Q 1HPCA 4KIKB 5IGFA 4FF1A 4WQOB 1TWGH 4LF7L 2RR9A 4G11A 3S1QH 1YN4A 1LTRD 1T3QA 3M3YB 1E2VA 3ZJYC 3MTNB 4IUMB 1NMGA 2JSOA 4TQ0A 1PXUA 2PW7A 1I6HH 4KGSA 1F52A 2D11A 3B9JA 3KDFB 1HQMC 2N4FA 3I73A 1PFMA 3J81j 5J18A 2OTJA 3U7DA 1YJJA 3FAHA 1TT5B 3MC9A 4JPSA 3Q69A 5IWAL 4ZHOA 2JA7H 3D4RA 2IO1B 1Q1BA 1Z7TA 1SROA 3D6CA 1K83B 3FKIH 3PO2H 3KF8A 3MXPA 4P1BC 3RFZB 3ML8A 1R4MI 4L5QA 4UDUC 4GKKL 3H9DA 4MSMB 1STGA 1I50H 1HNZQ 4W9LA 1LTTD 2ONQA 4DR1Q 1X54A 4LNQA 1B9RA 1AARA 4X64L 1PDQA 5LMUL 1SMYD 2XWBB 1YOVB 5J2RA 1A3VA 2IHFA 2HQLA 1SFOH 4DK3C 1P7FA 4ULLA 3G4SA 5IT9c
chains in the Genus database with same CATH topology
1U4LA 4N9TA 1B1ZA 2FJ2A 1B4OA 4CKCA 5C4ZA 1JB3A 4R9WA 1GPXA 4JWUC 3IFDA 4O1NA 2KDMA 4IFDG 1QB5D 3GTKB 1EZ6A 3ERQA 3K5OA 2ICEC 2F3VA 1OQRA 2HUGA 3QB3A 1R9TB 1YNND 3HEJA 2KN4A 1SNCA 4IUTA 5JVG3 2BDOA 4IZ8A 4CKBA 1SNDA 4C7YA 1S5BD 4XWWA 1AN8A 2A6HD 1UWXA 2M56B 3DXJC 5CBAE 3K59A 3U4EG 3RMHA 1OXSC 4HEA1 1I3QB 1ZOYB 1ILQA 4XWTA 2QEJC 3GTOB 4KKTA 2B2UC 5KNBA 2VUMB 5JPNC 2IDYA 3TEZA 3W3AA 4V190 3OOCA 2FMCA 2MHVA 2EYFA 2BE5C 2K7VA 3OW7A 1QCBD 1JE4A 5HURA 1X3QA 3VRBB 4PMBA 5C5LA 1B2TA 1KLGD 4JK1C 3TEYA 1LTGD 4HTHA 5KYIA 3P20A 1EQTA 1N62A 1DOXA 2F0FA 5JVH3 4WIPA 3S2HB 1WTRA 1BUIC 2NB0A 4V0BA 2NTSA 2MJ3A 1NEKB 4FO2A 5CV6A 2B2YC 3NBHA 4ME5A 3MTSA 2EJGC 1ILPA 1S5DD 1EM7A 4PMCA 1XWEA 1E7PB 3TP5A 1B3AA 3PZ7A 4KX6B 1WXQA 5BYQA 1VMPA 2WLBA 4WWMA 4CBVA 1M4VA 4H2AA 1CM9A 2XRQD 4G7OC 2LJIA 1LT4D 1NSNS 1V97A 3P4QB 1NR2A 1TKWB 3GQBA 1PGAA 1QF6A 4CKEA 5EPJA 2MPMA 1PRTF 1OXUA 4OZAA 1DOYA 3S1QB 3QO2A 2B2UA 2L1AA 2OEDA 1HA6A 4M0WA 1VJKA 2MJDA 2VZKD 5D3DA 1UEAB 4PMWA 1IW7C 2F0DA 5I9OA 1HQRD 2Z1CA 3FKIB 3PO2B 3P4RB 1I50B 4KI0A 1OFFA 5ELBA 1DD2A 4RKLA 5BMHA 5J39A 2KEDA 4XYOA 4EGVA 1SXTA 3BYYB 1SFOB 1FCLA 2M9VA 1LT5D 4XDDA 2KA7A 1STHA 2MH7A 1CTMA 2B2YA 3M4YA 3OMGA 5FLXE 1TWFB 2A5HA 5JPMC 1N60A 3AE5B 2V4IB 2F03A 2KEEA 1XCTL 4MIUA 2WQYB 4NKLA 1STBA 1KTKA 3BDOA 2LHDA 5HG2A 3HVDA 4KHVA 4XDCA 2XIWA 1PRTD 1YNJC 3P75A 2KVMA 1GOZA 5AUIA 4QMGA 1NENB 1QNUA 2WXFA 3S9WA 5C44B 1IUEA 1F2MA 3SDZA 3IXSA 3Q23A 3R2IA 5CV4A 1LTID 4NMZA 1RM6C 3RLFA 1KNAA 3VRAB 3A55A 5IT9E 1D1IA 3RPFC 4ZYSA 4X3KA 1DOIA 1XCQL 4EQPA 5CV5A 2DNEA 1PFNA 1I4PA 2LHEA 3I70A 3BK1A 1DXMA 1XO3A 1V1PA 2E74C 2QCPX 3NPPA 2ZXRA 2G9DA 3HOVB 2IGGA 1RHPA 3M4OB 2NWGA 4J1MA 3I57A 4F88A 1LO5D 2AUJD 5D14A 3J7AF 1HUNA 1O80A 4J6HA 2L12A 1T5XD 1LTBD 1DYQA 1EYCA 4LMQD 4KN7C 4HROA 4HMJA 5BN4A 3G6JB 3AB5A 1DZ1A 1JWSD 5E4WC 1J7AA 3MFGA 4KKJA 2KECA 1M8AA 2CJOA 3BZDB 1ZDXA 1E2WA 5D7GA 4ARCA 2SNSA 1HTPA 2HDLA 4OL7A 4FF3A 3AB9A 1K52A 2L0CA 3BVZA 2IJ0A 1RWSA 5COYA 4HMIA 1GUNA 2IWHA 1LLRD 5HGTA 2I2YA 2J7ZA 1DONA 4XT3B 1GB1A 3HRDD 3P7JA 2C9OA 3U9OA 1TJEA 4NDXA 4YTNB 2WDRB 4K2LA 3QOJA 4HKZE 1GUGA 4B08A 1CQFA 2K6AA 1SNMA 1WSPA 5C3WA 3PUWA 2X38A 3KWVA 4KY5A 1EY0A 2YU9B 5M9OA 1H9SB 1JWUD 1WCMB 3LWEA 5CV9A 1TZOA 1E6EB 1U4PA 2GRIA 1TS4A 4BY1B 3BVMA 2MEKA 1SBBB 4KD4A 2JP1A 4IUVA 1RJTA 2LFIA 4RKBA 2WS3B 4HJGE 5I6WA 3SFEB 3FDTA 4LTUA 3TZDA 2EYLA 5I2XA 4YT0B 2SNMA 4IUPA 4BS9A 4XDXA 2EXZA 4U68A 5CC4A 1D6EC 3DEPA 4G4KA 2OHFA 2QJLA 1W6KA 3NBIA 4QB4A 3HP3A 4L6TB 2WXLA 3R8BA 5J1ZA 1LABA 2XNAC 4HEDA 4OHJA 4LLGM 2WXHA 4EE2A 5JEAH 2MJEA 2VB3X 3MXUA 3B2FA 1PTOH 2WP8J 3AEAB 2F0SA 1D2BA 3AE1B 2ON8A 3NS1A 2WAQB 1HCZA 3TMEA 1WD0A 2FINB 1TVXA 1NUCA 3NK9A 1GJXA 3MEHA 4K6LA 1WTPA 3UI3A 4RCOA 1L6UA 1ML0D 4OIKA 4YIJA 1TKYA 4PQXA 1XXGA 3AEBB 4HCEA 2E75C 2EOTA 1ZUD2 3SK8A 4JX1C 5T8IA 2KCNA 2VB2X 4HSPA 2BYTA 3NHHA 4OO1I 3DWPA 4ZLTF 2NVTB 1XLNA 5EE9A 3HG9A 2Y5CA 1PRTB 5EE0A 1FXAA 1CA6A 3V96A 5FKAC 2O4XA 1HRJA 2J52A 3S17B 3S16B 3I90A 2K5QA 4ZHPA 1JMLA 2EJFC 2R3ZA 3OMCA 5E4XA 3D6WA 4NAWB 3E0JA 2KQ4X 2NN6G 4RA8A 1R4QB 3ZJUA 4ZRPA 4IQZA 4LK0M 3TDQA 4IFDJ 1PFBA 4OW0A 3Q8EA 1PZJD 1CHPD 3HZXA 1PTOC 2L83A 4B9WA 2PKOA 2PIAA 1FRDA 3Q8AA 4FP5D 4A3KB 5I6YA 5BYSA 1FNVA 3V2TA 5J22A 5EPLA 3T3NA 2BBCA 4X3SA 1S5FD 5HHDG 2IPKD 4IKGA 2A69C 1R7SA 3KUPA 4PV1C 4UAIA 5D65A 1NVID 4XXEA 1SYCA 1EEID 3A7LA 3SR1A 4WQMA 5FO7B 1JORA 3MAQA 2WIIB 1V8QA 1IKLA 1AZQA 3VR4A 3GTJB 1RDPD 1XTCD 4K14A 3NQIA 4U673 5IODA 3AM9A 1WTQA 3GTGB 1NI3A 2KJXA 5IGEA 4K8IA 4RGMA 3LWUA 4EQNA 3NQTA 3I72A 3HOZB 4K6DA 1RD9D 1Q3LA 2K03A 3EA6A 3A56A 3EGRA 1SB3C 5C6AA 3IT6B 5LHY1 3I3CA 1QWYA 2OT2A 1FD6A 5TSSA 1DOKA 3D31A 5JXVA 1C4QA 2DYOA 2INPE 1V8CA 4EQOA 1MGSA 1IGDA 5HI1A 2J0TD 5EPKA 4HN7A 2PW5A 1XLPA 4AS1A 5E1FA 1SE3A 3PV0A 2BS4B 1Q1EA 2BE5D 4LAAA 1ET6A 1Z47A 3FVQA 1H9RA 1ESFA 2F0KA 3VYUA 4RNAA 4HRSA 3HRZC 1GUSA 1PGBA 4WORA 1JC7A 4I65A 3M7GA 3IT4B 1BCPC 5H92C 4B0EA 3TEXA 1SSOA 1QKZA 4F7XA 2CU3A 3LB8C 1Y1VB 5BMIA 3DWMA 2AQ3B 3T16A 4OO1G 4XE0A 4TKOB 2WV6D 4ABNA 3HOWB 2Y0SB 4OZBA 3RD4A 1STYA 2K22A 3D3RA 1DOLA 2JA8B 2DY7A 1JOOA 3OPOA 1BNZA 2SAKA 2DWQA 1MBYA 2AUKA 3HOXB 1LTSD 3GTLB 4FYDA 4DF7A 1WRIA 2I07B 1RTNA 1CI3M 3LXFA 1II3A 1TS3A 1F2LA 3GV6A 1SJED 1FR3A 2IT1A 4H7BA 1EU3A 2F0HA 2J53A 2EY5A 1MI0A 3V3XA 4KY6A 3PUZA 2F0JA 2BB6A 1EYDA 1Q90A 5C3XA 1IW7D 3J81L 2X6LA 3VYSA 5K36H 4WAFA 1SNOA 2JYTA 4H0LC 3PIP3 2SEBD 2F0GA 1ET9A 4C3JB 3IAYA 3D4WA 3SHLA 1HXYD 2NTTA 5LL6X 1EYAA 3WDNA 4MN3A 2BCOA 4IALA 2L9HA 4ILWA 3SK5A 3N9YC 3C46A 1C8CA 2MGSA 4XTCS 3SEBA 4J3OD 2WKDA 3K6OA 1MPEA 3X3MA 1B9NA 4RGTA 2RSOA 3H09A 2FHTA 4Z9CB 2BS3B 3J80L 2ACZB 4TSSA 1VDZA 1IL8A 1U9RA 2NZ1D 1Y69U 2AX5A 1UGJA 2K28A 1Z6HA 2AWOA 1YNJD 2QKIC 3QOLA 2EY6A 5T1GA 1OO9B 2F3WA 2LFNA 5JEAJ 1JCKB 3S14B 4C2MB 3W1SA 1EY5A 3EVQA 2A6EC 1QOGA 2K1BA 4N9PA 3MVVA 3PZ8A 3P1HA 1STNA 1VR9A 3P4SB 2FFKB 4A3FB 1BMLC 2PMVA 1CZPA 2ZT9C 1MSGA 4IFDH 1RTOA 3SK6A 1JALA 5FO9B 3NTKA 2NMQA 4C56C 1GB4A 3FEWX 4E6IA 3FPPA 3NWSA 4DGZA 4IDIA 4N6EB 3GO5A 3GB1A 3H91A 4USAA 1FNWA 4KGTA 5CV8A 4K5XA 2WXNA 2N0SB 3MJ5A 1TWGB 4H44C 3AE3B 1F2RI 1CHQD 1WTOA 4A90A 1U4MA 1QOAA 3BK2A 2ICIA 3EQLC 3TN2A 1I6HB 2GI9A 5A35A 2BS2B 3KBGA 4IUNA 1V1OA 3RZOB 4MT5A 1FM0D 3EFXD 1SSNA 2JA7B 2PNRC 4C1NI 1Q12A 1Q8IA 4A3MB 3ZJTA 4L63B 5KEEA 2ID0A 1YMHE 2F0LA 1B44D 3NVYA 2OF1A 4NW2A 4OIJA 4US8A 1SYGA 3A7AB 2QF7A 3CRLC 2WDQB 2WXPA 3W9CB 5IGBA 1PLFA 2DN8A 4C3IG 4RAUC 1QG7A 4G7HC 4ZKCB 1CJEA 1EFID 1MI2A 5BN5A 5M3MB 1EL0A 3I4NB 1OQQA 1RKNA 4RHSA 3BG3A 1RCVD 4K5WA 2KACA 3U7ZA 3T53B 1RYJA 1WVLA 1LTAD 2YEPB 3QWNA 2JE6I 1MHHE 1VZ7A 3MA2B 4IOIE 4NZLB 4A3DB 3ZGZA 4L2YA 1N63A 5EE3A 2NVQB 5BMGA 1L5PA 4RGOS 3T3OA 1N5XA 3R93A 2HCIA 1G6ZA 3AE9B 4IUUA 2W82A 2Q8RE 1C76A 5CV7A 3RZDB 4NP5A 4OZCA 1YN3A 2L4NA 1E10A 2NYZD 1IKMA 3EROA 1F9PA 2JU6X 1C4CA 1C48A 1K8OA 5LNK1 1F9SA 3MZ5A 4DXGA 1F77A 1BBXC 1JQ4A 1TU2B 5E3FA 2J42A 2H1EA 1V1PB 1UWMA 1PTOF 1DCZA 1FIQA 2NN6I 3KLRA 4XQJA 5CMDA 1SDFA 2ZW1A 2H4OA 4QUFA 4D2KA 3AMUA 3AE4B 1Q10A 4IN3A 4YXDB 2PCFB 5FK9C 3AEFB 1TT2A 1K51A 1KAAA 3MP9A 3AEEB 4X3UA 3LX0A 2G1EA 4DFAA 4DQOC 2D5GA 2EYPA 2DNCA 2EYMA 2WXGA 3DHQA 4ZKBB 2FBWB 1L0VB 3BWUD 3C1FA 3NVWA 1JWMD 3TP7A 1I4RA 1T6BX 4Q2JA 3TZUA 5CYUA 3NUCA 3T51B 5FOBB 4KK7A 3AEDB 1QT9A 1K8MA 2W54A 2WDVB 3QJYA 5BN3A 1RF2D 2E3TA 2LMCB 3A8JE 3BS1A 4XQQA 3SE0A 1NYRA 4AYBB 2PZUA 1QNKA 1PTOD 3AE7B 2QDBA 1AWDA 4A9AA 3IAS1 2G9HD 3AN1A 1A70A 2K05A 2H88B 2RSNA 2B2TC 1Y1WB 1ACCA 1AW7A 2R61A 1BDOA 3GTMB 3PMFA 5M5YB 2RBMA 2AQ1B 1ONLA 2A69D 4N59A 1DGJA 3OWFA 3OWEB 1OXTA 3E5SA 4A3IB 3S1MB 4R3DA 1H9SA 5DNFA 1KH0A 1TYGB 2W3SA 3OSOA 2KMMA 1TY2A 3AV8A 5KYLA 2B8GA 2X6GA 2C5CA 3AECB 3VQIA 1CQVA 3BYTB 2LUMA 1MD2D 4KD3A 2A74C 5IOCA 1C79A 2L55A 2FUG1 1JRPA 1JQYD 1BCPF 3BDLA 3V05A 2PZTA 2LY7A 5KRUA 3R2TA 4FXKC 3FPUB 3P63A 2VNUD 3NWTA 4RF0A 5CR3A 5FR3A 2K9XA 3MXGA 1GXDC 5T1IA 1SE4A 5E6JA 4ZRZA 3SR6A 3PO0A 2BTEA 3X3NA 2QMTA 5FO8B 2HDEA 2ENBA 3J9CA 5C0XI 2M2LA 2NUCA 2K33A 1WTXA 1SNQA 2KOLA 5M5XB 1G2SA 3N52A 4A8XC 4C1NK 3H3VC 1ZDVA 2B2TA 4CJ0B 2AQ2B 1QOBA 2EYOA 4LJZC 3Q22A 2XVSA 1FMAD 2F0EA 1FD7D 2L1BA 1ENFA 2IX3A 3EUB2 1IYVA 2F1MA 2R6GA 5EKKA 3J81E 4KN4C 3HKZB 2TMPA 4HR7B 5DM63 3KLSX 3DWAA 1HFGA 2IGHA 1BQQT 1V43A 4GDKB 3VA5A 3VYRA 1WYGA 3C1EA 4YTPB 2DBYA 4ZQ3A 3DWGC 2RA4A 1GAQB 4RH6A 1ZPSA 3AE8B 5G5HA 2HQEA 2BA0A 2EKIA 3TUOA 4A6QA 2WNMA 3F2UA 1BCPD 3H8HA 1AP0A 4R8IA 4FXGC 1K50A 2BW2A 1I6VC 4MHEA 2B2VA 1FFUA 1EY7A 4DNTB 1EEFD 3O13A 1G8ZD 1Y56A 4P2CB 5ISRA 2WKCA 3S1RB 4JWSC 2IL8A 2L32A 1SYDA 2WXQA 3J80E 1A3UA 1VRAB 1VF5C 3SXHA 2OXPA 1F2RC 1YJIA 5EKLA 1EWCA 1RODA 4BY7B 3U2SC 2CHBD 3C3LA 1SIJA 2KQ3A 2RQXA 1FGBD 2F0TA 2B8FA 3W5UB 1SYFA 3OHXC 4XYQA 1D4BA 3CU7A 4I7ZC 3GD7A 2HDMA 1G291 4ZK9B 3CIRB 1HZ5A 3FILA 5I9PA 1OXVA 2D5DA 5KNCA 3I4LA 3VR3A 3J7YW 3C2PA 1F2ZA 1XF5L 1Y8OB 1J8IA 1E9MA 3W5VB 2TSSA 2Z4HA 1HZ6A 1MHXA 2A68C 3FC4A 4MM3B 3KQ4A 1EOTA 2NN6H 4DNRB 1TIID 4CQNA 3CKIB 3CQZB 1C9FA 2RDHA 1PTOB 1IBXA 3IFTA 4KY7A 3Q8CA 4MACA 2B2WC 5D3IB 1JR0D 4KGRA 1EWHA 2E2HB 1I4QA 4KTAA 5G5GA 2PVGC 5GXGB 2PMZB 4DA2A 1PGXA 3L7ZC 3VA7A 3K7AB 1EY6A 3T4AC 4RFBA 1QOHA 5A2QL 3HVZA 2EZVA 2WACA 1IYUA 2WU2B 1TWHB 1L0XB 2R7ZB 2VXWA 3JAML 4C7ZA 5EGTA 3TSSA 1BUVT 3GTPB 1JICA 2JYOA 1SYBA 3ZJVA 3TP8A 1E0ZA 1YNTE 4B9XA 1TKGA 3IKJA 1ZE3D 4P6VF 1ZXTA 2A6ED 5C0XG 1WTWA 2FE8A 2F4IA 2CW0C 5IGDA 2K5WA 4RWSC 4NAMA 3ZYYX 1QJOA 1J9OA 2XN9C 2NVXB 3HS0C 2XSCA 4C80A 1HFNA 3AH7A 2O5JC 1D5MC 1PZKD 1ZYRC 1QILA 1A3TA 2R92B 3PO3B 3PIO3 2N55A 4ODGA 2JEAI 2E6XA 2PTLA 4M1UB 1LT3D 4F8MA 2K5PA 4MH8A 2B2WA 4K5VA 2PO4A 5I2YA 3SVMA 3NVVA 3Q6SA 2E2DC 4GZYC 3ND8A 1FRRA 1QOFA 2GB1A 3W2DA 2EY1A 4K2KA 5K5PA 4OVZA 2W3RA 4IURA 2Z8LA 1KFYB 2JX5A 1X3PA 2PVOD 4B0MA 4KMUC 3K5LA 3U9SA 4LK1C 1S5CD 1CA5A 2XWJB 1BO0A 1CT1D 2E76C 1I4GA 1NYQA 5LL6S 3E9SA 5AFWA 3OIPA 1TWAB 1TS5A 1SF0A 2KAJA 1L4DB 2Y3AA 1D1KA 1TS2A 3MFYA 1BCPB 1YN5A 5ELFA 4PT5A 4N58A 4WRDA 5M3FB 4EVOA 1VZ6A 3C8YA 2I46A 2F0IA 5F2DA 5CGKA 2V3NA 4FXCA 5C0XH 2E2IB 4OO1H 4HAEA 1KDCA 1Y8PB 1EWYC 1F9RA 5KGUA 2EVBA 3NXWA 3AE6B 3K57A 4BWGB 2WXRA 2PLPA 5KIXA 1IHZA 1SYEA 3GS2A 2WB1B 3WOFA 5EJWA 1TR5A 1L6VA 3PUYA 1S5ED 2K3UA 3VR9B 2CQAA 1HEZE 2WXOA 1PYWD 1F2YA 1D5ZC 2JEBI 4K8JA 4BBRB 4TQ1A 3KBXA 2KCCA 1F9QA 2K32A 4A3GB 1QE6A 1SAPA 4KKIA 3VR6A 2KUMA 1KABA 2JXMB 1ESRA 1WGKA 3AU7A 4FXDA 5JAVA 4IUQA 2B63B 3Q8FA 4P16A 4L1BA 2MUYA 1JROA 3OIQA 2N7JA 1ZXHA 2LS01 1PUTA 1CZGA 1XLQA 3K0YA 3DMUA 1J7BA 3J7AV 5ELEA 1TQOA 2CVRA 4TQUS 2V0GA 2ZW0A 2DYMA 1RFKA 1OXXK 1SMYC 3Q8BA 5KNDA 2BT6A 1DM0B 2WXKA 5CBEE 3U52E 4C3HB 1SE2A 4A55A 4FF2A 1BXTA 1JOQA 5HFYA 2RDGA 2A73B 5JJZA 3MHBA 1YNNC 2F0VA 4NJCA 2ZXOA 1E2ZA 4L23A 5ELDA 1QQRA 1T5EA 2MP1A 1EIGA 5G3LF 2A6HC 4WJWA 1KF6B 2V3PA 2M00A 1YQ4B 1YQ3B 2EDGA 5IIFA 4WFN3 1A15A 3SFDB 5DM73 1EQVA 1VDVA 1D5XC 1K53A 4A3BB 2N9KA 4YTMB 1NAPA 2F0OA 2DY8A 1JW9D 1WD1A 4HSVA 2LGIA 1A6XA 3Q24A 1BOSA 4WURA 3DEOA 3A8KE 3PUXA 3FRPB 1QLBB 1GHKA 2PPBC 2WINB 1H9JA 4QCLA 1N5WA 1GUTA 3URYA 2EY2A 4DAYA 3P42A 2WXIA 4X3TA 3TEWA 4A93B 1FCCC 1XEEA 1A2UA 3NRZA 3BDCA 1ZKOA 3GV3A 1GHJA 3EJIA 4CJ2C 2DLBA 4PNYA 2R93B 1C77A 5EQ0A 4DAPA 1R4PB 1VCIA 3P4PB 3M7NA 3DM1A 3VR5A 1CZWA 5G3LD 3S15B 1EZ8A 2IW3A 4AQ7A 4A3JB 1TKEA 4YSZB 3AEGB 2KHSA 3T56B 3NSWA 2EYHA 1ICWA 4HKQA 4ZOHC 2N9LA 1VF7A 4DXFA 2PZWA 1X32A 3KWLA 1GUOA 4ZUJA 3DUZA 2NBFA 3HGBA 2LKVA 2RVLA 5IGGA 1PMRA 2D62A 1B53A 5DAUA 2INNE 2MJ8A 3AMZA 2JYEA 1GUWA 3AE2B 1LACA 2F0PA 2AWNA 2F0QA 5DEHA 4A3EB 3WCQA 2HTME 4ARIA 1O78A 5C3JB 2I38A 4YSXB 4US9A 4HCSA 3NZ3A 4YWGG 1G91A 1HTLD 3QG1A 1IGCA 3PUVA 5JEAG 4BA1I 3BIID 4DU9A 3R3OA 2BOSA 4REZA 1PDXA 2Q8TA 2M19A 3BVGA 3VR8B 2GA4B 1LV9A 1I4HA 3QIAA 2BDNA 3HOYB 2SOBA 1EY9A 3A54A 4Q5VA 2N88A 5C5MA 1B50A 1I7HA 1VLBA 1HUMA 4M8AA 2L5TA 4ID6A 2O5IC 3CWIA 5IGCA 1MVKA 3LYYA 4WH4A 3MC0B 2IGDA 2LMCA 4ZRQA 2JQRB 1F0ZA 4F87A 1BR9A 1FFVA 4XIGS 1UNSA 4GDLB 3H0GB 2JA5B 3KK7A 4ZAIA 1VZ8A 4QUCA 1O7ZA 4S3SA 5A2QE 1PRTC 5EKIA 1ENCA 3JAME 1C4AA 2QIEB 4KJNA 3T13A 3I9V1 3L9AX 4G7ZC 1AZPA 4RF1A 2BA1A 2SDFA 1H9KA 3MXNA 3S2DB 2L52A 1UAPA 3ZQ4A 2XRSD 2JZPA 2RMMA 2JXTA 4BA2I 4R8NA 1CFMA 2Y5PA 4QF4A 2FMMA 3A8IE 2VZKB 1XYIA 4TMAB 2B2VC 4DN4M 4CGYB 4TRDA 3TP6A 2JA6B 5M5WB 3S1NB 4XT1B 1L0YB 4ZUIA 4RHRA 4KV6A 1N61A 3IAM1 2E2JB 3NTIA 1WWTA 1L4ZB 5CORA 5ELCA 5BYRA 3MWYW 3Q0AA 3H6MA 3FMCA 4J8QA 5C0XJ 2YYZA 2A68D 4FF4A 3MHZA 4KJOA 3NVZA 3K5MA 4FNFA 1HHVA 3CRKC 1P7EA 1SNPA 2Z4IA 2WU5B 3HUIA 1C78A 5FLXL 1J7CA 2H89B 4C3JG 2F0UA 2EE1A 4JBWA 3ONAB 5C4HA 4Q0FA 1EY4A 1KLUD 2IX0A 4C3IB 4DAVA 1C4PA 2D9UA 2M0AA 1JOKA 5AUKA 1STAA 2K01A 1B9MA 4DK1A 1S4ZA 2Q8IB 2PQEA 1EU4A 4JE3B 1Y8NB 5MPOA 5EBDA 2O2LD 2PW9A 2RDFA 1KRHA 2LEKA 1FO4A 3CHBD 2WP9B 1FEHA 5IT9L 4QIWB 1FXIA 1KDBA 2EYJA 3GP7A 1FNUA 3NP8A 1WTVA 4IFDI 3I91A 2CW0D 2QSDA 3H94A 3ND9A 3D4DA 4DK0A 3N6RA 1TWCB 1HA5A 2HCCA 5H8YE 1G2TA 2JSVX 4KKSA 2ZXPA 3UI2A 2F0MA 1O7LA 2Q5WD 1ZYRD 1EIHA 2JWUA 1ENAA 1BF4A 1TY0A 2CJNA 1O7YA 1AYFA 5C4XB 2B39A 3RUZA 2WXJA 3WOEA 4O42A 4KHZA 4ITKA 2F0WA 4XQNA 1SEBD 1LT6D 2K0PA 1STEA 1MSHA 3NE5B 2WXMA 4KKUA 3TBIB 1AFPA 1W6JA 2RPVA 1ROEA 2EPBA 2OEOA 3FILB 5C2TB 4Y7NB 1XX8A 3E56A 2BB5A 5C4JB 1A2TA 4BBSB 4YSYB 1KDAA 2RKSA 3NTHA 2K5DA 3ETRA 1ZP0B 3L4PA 3DWQA 3KLSA 2IX1A 1XLOA 2W55A 5I4DA 3M85A 3E6ZX 4C3HG 5C3EB 3NUHB 2EELA 3VR2A 3L3OC 1NCVA 1IBXB 1SJHD 3LNNA 1AEXA 2YEPF 1FYCA 2D2CC 4CJ1B 1JWBD 1I4XA 2V4DA 1CK1A 4OGQC 4GLSC 3GTQB 3ABVB 3D8GA 2NVYB 3G7LA 1JWAD 2B76B 2QILA 2KWDA 1KNEA 2X69A 3I8ZA 3ITPA 4FVMA 1UUPA 1ZXIA 2EJMA 2J4XA 4RGNA 3K58A 5EE1A 1PZID 3K5NA 1DJRD 1VMCA 5K36G