4RFBA

1.93 angstrom crystal structure of superantigen-like protein from staphylococcus aureus in complex with sialyl-lewis x.
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
194
structure length
194
Chain Sequence
HNYKSLKYYYSKPSIELKNLDGLYRQKVTDKGVYVWKDRKDYFVGLLGKDIEKYPQGEHDKQDAFLVIEEETVNGRQYSIGGLSKTNSKEFSKEVDVKVTRKIDESSEKSKDSKFKITKEEISLKELDFKLRKKLMEEEKLYGAVNNRKGKIVVKMEDDKFYTFELTKKLQPHRMGDTIDGTKIKEINVELEYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Putative uncharacterized protein
publication title 1.93 Angstrom Crystal Structure of Superantigen-like Protein from Staphylococcus aureus in Complex with Sialyl-Lewis X.
rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 64
structure length 194
sequence length 194
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rfbA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rfbA01
5ELBA 4NZLB 3V05A 3URYA 1BCPC 1JWSD 1I4GA 2XRSD 2WV6D 1TS2A 1B1ZA 3MFGA 5ELCA 1EEFD 2J4XA 1D5XC 1PZID 1S5FD 3W2DA 1LTRD 1F77A 1EU4A 1FNUA 1S5CD 3TSSA 1CHQD 2IPKD 1PRTB 3EFXD 1PYWD 3EA6A 1S5DD 3BVMA 3R8BA 1LTBD 2RDHA 1PTOB 3O13A 4RFBA 1I4RA 2Z8LA 1JCKB 4RCOA 1BXTA 1SE4A 1UUPA 3OWEB 1LTID 1HA5A 3MC0B 1LTSD 1BCPB 1LTTD 4O1NA 4RGMA 1LT4D 4RH6A 1HTLD 1RDPD 1PTOH 5FK9C 1TS4A 1TY0A 1JWMD 5D3DA 1YN3A 1LTGD 1FGBD 2AQ3B 1SEBD 1V1PA 1SBBB 5ELFA 5TSSA 1BCPF 1I4HA 3DWQA 1L0XB 1LO5D 1PRTD 4L6TB 1AW7A 1STEA 1D6EC 1I4QA 1HXYD 1TY2A 1KLGD 2NTSA 1KTKA 4Z9CB 1MD2D 1PRTF 1ESFA 2ICIA 1FNVA 3KLSX 3R2IA 1BCPD 2AQ1B 1V1OA 1EEID 1PTOF 1JR0D 2O2LD 2SEBD 1ET9A 4RHRA 1SXTA 3DWPA 1LT3D 1D5MC 1SE3A 1SJED 5D3IB 2G9HD 2XN9C 1D5ZC 1M4VA 1CHPD 1FD7D 1TS5A 1ET6A 5ELDA 1YN5A 1UNSA 2XRQD 1PZKD 1CQVA 1QILA 1TS3A 3R2TA 4TSSA 1JWUD 2XNAC 4C56C 1CT1D 3BZDB 1EWCA 2AQ2B 1FNWA 1LTAD 3DWAA 1DYQA 1HQRD 1PTOD 1G8ZD 1SE2A 2CHBD 3CHBD 1RD9D 1EU3A 1I4XA 1JQYD 1ENFA 1EFID 1SJHD 4L63B 1LT5D 2R61A 1CK1A 5FKAC 5ELEA 3SEBA 1B44D 3BYTB 1LT6D 2RDGA 1KLUD 1L0YB 2IJ0A 1XTCD 4RGNA 4UDUC 1YN4A 2QEJC 1AN8A 1XXGA 1LLRD 1PZJD 1GOZA 1PRTC 4RHSA 4RGOS 4K6LA 1S5BD 4DXFA 3GP7A 1S5ED 3BVZA 2NTTA 1PTOC 2QILA 1T5XD 1RCVD 4RGTA 3BYYB 2TSSA 1V1PB 4DXGA 4ZYSA 5I4DA 3BVGA 1DJRD 4BWGB 1RF2D 1I4PA 4OHJA
chains in the Genus database with same CATH superfamily
2Z4HA 1L6UA 3KWLA 4R4CA 2Y0SB 1PH8A 3I4NG 3PO2G 2DNFA 2K52A 3DM3A 3MWYW 1E6EB 2GVAA 3D4WA 5EE0A 1PZID 2VUMG 1X9NA 2KJHB 2Y5BB 1F77A 1EU4A 4C3IB 1Q1EA 4WAAA 1K8MA 2WFWA 2B2TC 4KV2A 2UXDL 1VCBA 1K3RA 1SYCA 4H7BA 2SDFA 3ZJYC 4HKQA 2PI2E 3IG3A 4JVZA 2VQEL 1B53A 4GDLA 3N1XC 1CFMA 4POGA 1O80A 2F0IA 4RCOA 2NVYH 1BXTA 1UUPA 2N1WA 1FXAA 4FN2A 4LLGM 4EZJA 4ZCKA 4OX9Q 2DBYA 3B1LX 4U673 5EPJA 1F1HA 1F2YA 2MQHA 1UGJA 4PZ6A 4KJOA 5E6JA 2JF5A 5I2YA 3AEAB 5HG2A 2UU7A 1JWMD 2F0PA 1V1PA 5T1GA 1JWBD 5G55A 4EQPA 4LFAQ 1GUWA 4PK1A 4G50A 3P7JA 3KF6B 5K36G 3VUYA 3C1EA 5LL6S 4CKEA 4R8IA 4IG7B 2SNMA 3PIP3 3AE5B 1J8IA 3QOJA 4FLHA 4JI8L 1TR5A 4GN1A 4C3JG 1WYDA 1Q3LA 3CCMA 3BY4B 3V6CB 2FMMA 2J52A 3ZNGC 2B2UA 3IRBA 2NBWB 1GD7A 5TR5A 1KDBA 1R4NI 4YHHQ 4CDFC 4LFCL 3KLWA 1Z6HA 1HNZL 1EY8A 5EJWA 2ICIA 2XBBC 3N1YC 1TYGB 4ANVA 4WURA 1VQPA 3AM9A 2B8FA 3G6JB 3DHHC 1VQMA 1ILPA 4P16A 4IFDJ 2JA5G 2R93B 1YN5A 4DV7L 4K2KA 4JYAQ 2NBUA 3P4PB 4ID6A 2WDVB 2G45B 4TSSA 3ZJVA 3TP8A 1XLOA 4M0WB 4PZ8A 1HUMA 2WAQG 2AQ2B 1WTHA 3D6CA 3LNNA 5T8IA 2DJGC 2EYHA 5IYCG 2NZOA 1SE2A 3L17A 4A3OA 4DV5L 1N62A 3HGBA 1I4XA 3PQIA 1FPYA 4USAA 2JA9A 3WOEA 1UWVA 2IO1B 3PIOA 2K6DB 4LF9L 2ZCBA 4ZRZA 3I4LA 1QF6A 4G57A 4NKLA 4AQYQ 4HSPA 2ATWA 3UDXA 1KLUD 3KLSA 1VQAA 2JQRB 4BS9A 1B7YB 2E2JB 1I3QB 1VR9A 2V3SA 2LMCA 4DXAB 1YNJC 3W1YA 2F0QA 1PH2A 4OWXB 4FXGC 2VNUD 1TWFH 2M8SA 2X69A 1ZE3D 1UBIA 2KWUB 3KWVA 3KYHC 3PGEA 2IO3B 4DFAA 3IHPC 1RCVD 5IGFA 3A56A 3TQYA 2FFKB 5DLQE 3M63B 1XCTL 5E6OA 3TCAA 2E5LL 1N61A 2RCNA 1EY4A 3O65B 1QLBB 3G48A 4A3FH 1I4GA 2WV6D 5IGCA 1WFYA 1XX8A 3HKZB 4V0BA 2ICEC 5ELCA 2YU9B 1G6ZA 2KX3A 2H88B 4W9HA 5LLIA 1D5XC 1A8VA 4I6LB 2LVQA 1FFVA 1WXMA 1N5XA 2Z9HA 2J7ZA 2N9XA 1V9PA 4ILWA 2OJRA 3S17H 1QB5D 4CDEC 1N60A 1MHWC 1ZYRD 4BBNF 2GBJA 3VRBB 1QNUA 3CXCA 1T5EA 4N58A 2GBKA 1J7CA 3J7YW 4QAYA 1EYDA 4LF7L 4TQ0A 2K39A 5C4ZA 5KRUA 4MGZE 3AFQA 3R7RA 3MC0B 3TBIB 3K8AA 3PZ7A 2ZZPB 2NUCA 4WQOB 3DEOA 1QQRA 1PTOH 5JJKA 3F2DA 4GB9A 3L08A 1MSGA 1UE1A 1KRSA 5IYDH 2IO0B 5CV8A 1TY0A 3VYTA 4IFDI 4XWTA 1HZ5A 4LCDE 2LY7A 4IPGA 3Q8CA 3S2HH 3A8KE 4IZ8A 3CCSA 1IKMA 2UUAL 1W6KA 3HOYH 1I4HA 1TBEA 4BOSC 3K6OA 3I4MH 4BZAA 1LO5D 3FHWA 4DHJD 3HVZA 1OTCA 1SFOH 3OMGA 3HOWG 1D6EC 4GU2A 4BY1H 2WHIA 2L83A 2NBVB 1IBKL 1WYWB 2CJNA 4DK5A 1FFUA 5CC4A 2A73B 2A68D 5AJ3L 1MD2D 4ZUIA 3HOUB 4EUTA 1JJ2A 2HT1A 4JCVE 1N34L 3UE1A 4AP4C 5KYLA 2IY5B 1YZ6A 4IJHA 2DWQA 1C4AA 2BA0A 1A3VA 2P5ZX 1C0AA 1NEKB 3GQBA 3B2FA 2SEBD 1K83H 3VHTC 2PCFB 1LT3D 4KMUC 1NCVA 2FXQA 1FXIA 2AWTA 4C80A 5D3IB 1IBLQ 4WJOA 3PIO3 1GB4A 2A6HD 1GUAB 4M01A 2EDGA 2R3ZA 2W55A 3DBHI 1SMYC 2KCMA 1B9MA 2XNAC 2DGYA 5GAGC 2HE7A 1GO3E 4A3IB 1FMAD 2LHEA 4NJ7A 2MJ8A 1A63A 2K05A 2PQEA 1MSHA 3CKIB 1G8ZD 1WH3A 1FO4A 1A62A 2PVOD 1Y1VG 1RWSA 4Q2JA 4IW0A 1SNPA 4DUZQ 4W9JA 4ANXA 4PV1C 3SFDB 1JROA 1O78A 1N6ZA 4GDLB 1I6HH 2IJ0A 3SXHA 3TEHB 4JI3Q 3ZYYX 3HG9A 1STGA 1SN8A 2A6EC 2OEOA 1D2BA 3FKIG 4HCEA 4BBRG 4LK0M 5D2MB 2KUMA 4IUNA 5IGEA 5KNCA 1Q81C 2N3SA 3J81E 4OX9L 2IYDB 2D3BA 3IT6B 4F7ZA 1OQRA 3GP7A 1K53A 3KK7A 1IPGA 2NVTB 3TS2A 3PZDA 1V1PB 4ZYSA 2RVLA 4RF1A 1X3FA 1EY5A 3FC4A 5J3BA 2CW0C 2NWGA 4KZ0A 2KN5A 4QIWB 3CPWA 2F0FA 2H1EA 4ME3A 3PO2H 3LB8C 4W9LA 5JPMC 1KOTA 4HIDA 2K75A 2L9HA 2EMTA 3TDQA 2Q5WD 1CA5A 3S2DH 1F9JA 1HFGA 5HURA 1J5EQ 1DGJA 4A3EG 5JJZA 2VUMH 3KF8A 4UP8A 4HJ8A 3VYRA 1BUVT 1FRRA 2K0PA 2EYFA 4EQOA 3S1RB 1KRTA 3QIAA 4JI0Q 2VZKD 2HDLA 3BVMA 4DK1A 4FP5D 4RKLA 2JPHA 5E3FA 3IT4B 4XDDA 4IM2A 3FKYA 4CYEA 2YV5A 1SYGA 2G1EA 2HUGA 1NI2A 3QB3A 2Z8LA 5CX3A 2JSVX 3H91A 1MHHE 2M17A 3NK9A 1LT4D 4JYAL 3DXJC 4CGYB 1P7FA 2QC8A 3S2AA 5IYBG 4JG2A 2R2OA 2V4IB 1T3QA 3M62B 1XD3B 4KZCA 3EBEA 3ZRFA 1EF1A 1WJNA 1EIHA 1PGXA 2EY1A 2I38A 4KHPQ 1XNQQ 1YIWA 2DLBA 1VF7A 4LUZA 3ZNZB 5AZHA 4NQLB 1L0XB 4EVOA 4HR7B 5K36H 1E7PB 1YIJA 3AU4A 5E4WC 4P1CC 4AQYL 5JH5C 3H3VC 4Y7NH 3AEEB 2EOTA 1RKNA 3FRPB 3WAPA 3SE0A 3N30A 3R93A 2OT2A 5I6YA 1WTXA 2BYFA 2G4SA 3U2SC 1KTKA 2NCNA 3U7ZA 4LF4Q 2KDBA 1ESRA 3KUDB 5C4XG 2KBNA 1BUIC 1SXTA 3ECIA 3Q8FA 4KTAA 3JAME 1YNND 2XN9C 1OXSC 4MGKE 3HOVG 4L23A 3J7AV 3RZDB 3BK1A 4BY7H 2UXBQ 2RHQB 3LDZE 2N9PC 4PS8A 5FLXc 4LF8Q 5KEEA 3M4OB 5M5WH 1KFYB 2KJXA 3SGIA 2RCFA 5IYCH 4CKBA 3Q6BA 1PFDA 2YYZA 3FP9A 1C1YB 1EU3A 1M8AA 3UDFA 1Q86C 2BOSA 4PT5A 3FDTA 4OXPA 2EYOA 3GOEA 3KYDD 5FO8B 4IPCA 2RDGA 4DF7A 5CBEE 5H1SE 2KHWB 4LJOB 3BS1A 4RGNA 1G6JA 4KY6A 4A3KG 5IP4D 1SNOA 1P1AA 2F0KA 1CZGA 4HCNB 2K50A 1HTPA 1VQ4A 2KDMA 2MP1A 2CFMA 2VL6A 3DM1A 1L0WA 1P16A 3J7AF 1VQOA 3NVWA 3K7AH 2DZJA 3GTLB 4PZ7A 2F4IA 5AUIA 3U4EG 3APFA 3V61A 1ZXTA 1K50A 3SR6A 2ZTDA 1TWCH 4RWSC 4AJWA 3TS0A 5IP9G 4ULLA 1X55A 1KDCA 1V5OA 4IKGA 3VUWA 3NEMA 3NP8A 3VTUA 3RNUA 5F2DA 4XQNA 1YI2A 2EY6A 3UDIA 3J80c 3GTGB 1JB7A 2A69D 3GDEA 3H0GB 1LTRD 2KCCA 4QQBX 1YJ1A 4QL5A 1HHVA 3W1SA 1KNEA 3AB9A 4DHJB 3TSSA 4ZOHC 1NVID 2IPKD 4P2CB 1B2TA 4GXBA 2HCIA 2IGHA 3H6NA 2JA6B 3VR5A 1ZW7A 2PQAA 4S17A 2ES2A 3P4RB 2EPBA 4PMCA 2B2WC 3TP6A 4BXXH 4A6QA 3P75A 2KFKA 1XJVA 4YTMB 3IFWB 4HEA1 4OW0A 1IBLL 4KHZA 3I90A 3VYUA 3J81L 3A5UA 2UUCQ 4ZYNA 4GLXA 4LF5Q 1DOIA 1HTLD 1HZCA 2JJQA 2ACZB 2Z0EB 4EOYA 5G5HA 2K32A 4HIKA 3AYHB 1ZGUB 2JRHA 3VTVA 3E9HA 2ZJQA 2PVGC 5D3DA 1PH3A 1YN3A 3NSWA 4UY8C 1SEBD 1P3QU 1NNXA 4H02A 3G7LA 4A20A 4DUZL 3DWQA 4EZKA 4MGIE 4IUTA 4RA8A 3RULA 1HNWQ 3FILA 4YWKA 3TEZA 4ZQ3A 1FEHA 4JI3L 2WB1B 1HR0W 3DHQA 3HOWH 3NJTA 4KSKC 2EYJA 4R1JA 1HXYD 3X0WA 2RKSA 3ND8A 4PYUA 2L05A 4Z9CB 3J81j 4MEMA 1MPEA 3C19A 1L4DB 4E71A 2KMCA 3AEFB 1S40A 1H9JA 3E56A 5DM63 3W3AA 1YJ9A 4GGQA 1Y8NB 3CCQA 4GOPC 3K9OB 5BMHA 2RSNA 2MO0A 2K5WA 4C3HG 4FF3A 2CWPA 4X6AH 2TMPA 1FD7D 4DAPA 1YX6B 1QILA 4GNXA 1TTNA 2K03A 1GHJA 5DEHA 1A5RA 1JWUD 1IXRA 2Q8TA 3ZDTA 3J7ZC 3KF8B 2HCCA 1J5EL 3C0RB 3Q8AA 1WIAA 2QGQA 4QB4A 1GUGA 4GS3A 4JI0L 3ZIMA 5CV7A 2LRWA 3I7FA 3STBD 3PMFA 2R92G 1CK1A 2KMMA 2AL6A 1V97A 4OWTB 4DPGA 3NY5A 3R66C 4IUMB 1YQ4B 2L11A 4UDUC 2OOBB 2B2UC 2KNBA 4BKTA 1ILQA 1BOSA 3PSIA 2ZTCA 2VZKB 4ZHOA 1WFQA 3S1MH 3T4AC 4C2MH 2F52A 1PDXA 3OLMD 1NR2A 2L15A 2F0HA 3FKIH 2VRRB 4A3FB 4RHSA 1E2VA 3Q8DA 1QWYA 5JJLA 4ZAIA 4DR7Q 2N78A 1K8RB 2WX0A 3EVQA 3QA8A 4TV3A 1D1IA 1TJEA 4HKZE 2BE5D 4DV4Q 2F0LA 2CS4A 4ODGA 3JAML 2HJ8A 2QDLA 1GUOA 4A3GH 1E24A 4KHPL 3NBHA 1STYA 3S1NH 4JE3B 1AH9A 5CTRC 1CMXB 3DPDA 1JWSD 3M3YB 4KKJA 2NVXH 1K0SA 4JI4Q 2XEWA 3HHMA 4TKNA 1NR4A 2B2VA 5J1ZA 1B1ZA 1AZQA 1MJDA 1VQDA 3PV0A 1T9HA 2WAQE 2CJOA 2E2HH 5EKIA 2L00B 4A9AA 1FNUA 2AUKA 4A3EH 1MJEA 4ZRQA 1IP9A 5JAVA 4A93G 1I5FA 5CBAE 2AEHA 4LF4L 5EAYA 2E3TA 2D11A 2PEAA 1HQMC 1PTOB 3EECA 4DQOC 1C9OA 4P71A 4WJWA 5BR8Q 2O6VA 5JEAG 3ND9A 5C23A 4IUUA 4R4QA 4L2YA 1DGSA 1SE4A 1U0LA 1IBMQ 4H13C 1RYJA 5M3FH 1VLBA 4H44C 2A4ZA 3ZKJC 3P4SB 3BDCA 3PRMB 4HROA 1FIQA 2IY1B 3HOYB 2UXBL 2FCQA 3I4MB 1TS4A 3CQZH 4K2LA 5IYBH 4LF8L 1SAPA 2M4NA 2EY5A 2VB3X 3Q8EA 1KL9A 3L13A 4ZHPA 2G4DB 1VF5C 4NMZA 1NJIC 2ZVNA 1XTDA 3QR8A 4WAFA 3K9PB 4C7ZA 3EGRA 2AWNA 4AYBB 4M02A 3HS0C 1QUQA 1PUTA 1GKHA 4HEDA 1WXAA 1P98A 2AL3A 3NQTA 3PLVA 1K83B 1CJEA 2A5HA 5FO7B 2ASQA 1ZKOA 2NVUI 4QUFA 4DAVA 3AMZA 5CYUA 4MNOA 1X6OA 2WP8J 1VMCA 4K8JA 4AJYB 1WGYA 1S72A 4W9IA 2K5QA 1Q82C 4HPLB 4P7IA 5C2TB 3E0EA 5C4XH 2IZVB 5LXIB 4F7XA 2MUYA 5IGBA 1GC6A 3OHXC 1ZYRC 2RDFA 3L54A 2O5JC 1TS5A 3NVYA 4DDID 2ALYB 2DX5B 1WZ3A 2H5XA 3N3KB 1DOXA 3K5LA 4I6PA 2K6AA 1DD2A 4A75A 2WXIA 1TWHH 3GTKH 2B3GA 3IAS1 2BT6A 4BY1G 1N8RC 2LGIA 1GG3A 4NB3A 1ZDVA 2C7NB 3B0AA 2KK8A 4KX6B 2KTRA 3ZO5B 5HGQA 3JVZX 2JYEA 3CSFA 3PO3H 2PQAB 4BBNC 3L0OA 4LMQD 4GN3B 4GKJQ 4X66L 3H8HA 1TWGH 4MM3A 3E0JA 5KYIA 2KFKB 1LT6D 2L0CA 3CRKC 4FULA 4ZK9B 2GN5A 1CA6A 2FBWB 4K5XA 3J9CA 2ZNVB 4A3KH 4MH8A 3PTFC 1U4RA 1ZKHA 2F0JA 4XQQA 1VQNA 3BJUA 1E1OA 4LF5L 4XTCS 1Y14B 1ASZA 3JSVA 3HM6X 3A7AB 3BVZA 3C46A 1ENAA 3RD4A 1JQ4A 3PO2B 3I4NB 2YEPF 4N8FA 5D65A 1UWXA 3RD2A 2KQ3A 2VZAA 3GO5A 5IT9E 3L3OC 3WALA 1AARA 1UD7A 2A68C 5BMIA 5EPLA 4YY3Q 4EE2A 1C4QA 2K28A 2WXOA 1SDFA 2C9WB 3FILB 3UINB 1D4BA 3OJ3A 1HNWL 2JE6I 3MFGA 4H0LC 1WRIA 3TN2A 1VQ6A 1PYSB 3QO2A 1IW7D 1S5FD 1WR1A 2WNMA 3A8JE 2A6HC 2KWDA 3ZW3A 1GAQB 3CAMA 1QZHA 3UQAA 3RZOB 1NSNS 3PGZA 5CR3A 3HOZG 2GBNA 3EA6A 2GRIA 3ONSA 4K8IA 1EO6A 4LW1A 3N52A 5BYQA 1STBA 2R6GA 4JI1Q 4IPDA 3A9JA 1H9KA 4WQMA 4R9WA 2ZJPA 1C9FA 2VW9A 1WGRA 1OEYJ 1F0ZA 4US9A 1C79A 3P42A 4JPSA 3BG3A 3U9SA 4GNXB 3UF8A 1V8QA 3UI2A 4B95A 3X23A 3GTQH 4KD3A 1IGDA 4JOIA 3MXUA 1LV9A 2BF8B 2F0EA 3S24A 1AP0A 5M9OA 3T53B 4FJYA 4Y7NB 3QWNA 4C3JB 1VZ6A 1Y56A 1D7QA 5JZEB 3EROA 3L4PA 2PI2A 1GUTA 2E2IH 2LGDA 2MBEA 4YWMA 2MA9B 1GXDC 2MRPA 5AZGA 4O2DA 5T1IA 2Y5CA 1EM7A 1L1OA 2B29A 3OYYA 1PRTD 3HKSA 4JBMA 5CHWA 2QKIC 1B70B 1YNXA 4NXNL 5BN3A 3ENEA 1UBQA 1HEZE 1GJXA 5IIFA 4RNAA 4HDOA 3GTPH 2X38A 3AEDB 2LKVA 2QW7A 4KDIC 5J18A 1C7YA 4IPHA 4GDKA 3DVNU 2JA5B 5M5XH 4DR7L 1FR3A 4GSWA 1YX5B 1ML0D 3R2IA 2BBCA 3I9V1 2CCZA 4M8NA 1OQQA 2HHHQ 4DV4L 1X56A 2F0TA 4XDXA 1XMOQ 1I94Q 1LYLA 1PFSA 1ZUD2 2X8XX 3NBHB 1FGUA 3RNBC 1SE3A 1S4ZA 3LWEA 2DZKA 1PFNA 4C3HH 4DAMA 2V9HA 5ELNA 2EJGC 2MSED 3GE3C 3HM3A 4N9F4 2M0AA 3VR3A 3ZUNA 3NUHB 2ID0A 4KK7A 1F9PA 3P63A 1W6JA 5HFYA 1XNRQ 4CJ2C 4LDTB 2BA1A 3A74A 3H9DA 3EIVA 1BBXC 3H7PA 5LNK1 3H7SA 2PE9A 1PDQA 2K8BA 1MGSA 1HPCA 2EKEC 1JQYD 3U4ZA 2OEDA 3A54A 1VQ8A 2A19A 1YHQA 3NVVA 2JYOA 5JJIA 1W2BA 3AE8B 2N49A 3SEBA 5FLMG 3K7AB 2R92H 3DBHB 2O6VB 5BR8L 1L0YB 4KJNA 1WYGA 4MJSA 4K5VA 4LK1C 4DK6C 5IY0A 5FJ8G 1WX7A 2LXAA 4QF4A 3TZUA 1IBML 2F3VA 4DHZB 4KSLC 2N88A 4XC2A 2AYOB 1VQJA 4XQJA 1A3TA 3QJZA 1QOBA 4WWOA 4BY7G 2G5DA 1PTOC 2INCC 3OW7A 1L4ZB 1QKZA 3BZKA 4RMFA 3RNAC 3WANA 3CRLC 2D3GA 2QCPX 1NMGA 4IJLA 4OIJA 2LHDA 1TKWB 3I72A 1RF2D 4FF2A 2JZ3B 2W3RA 3K5OA 4LUOA 1AWDA 4MELA 3AMUA 4X57B 2K5PA 2Z4IA 4KV6A 5C44B 2R2QA 5IP7H 1QUQB 4RKBA 2JZPA 4AQ7A 3NOBA 1VQGA 1X3GA 1H9MA 4MDKE 3OSOA 2MBHA 2LI5A 3V2TA 3NZ3A 1YNNC 1T0QC 4HIOA 1UEBA 1G6PA 2R7ZG 1T0RC 1S5CD 4C00A 1E7ZA 3MXNA 3N20C 4MIUA 3Q3MC 1HCZA 1STHA 2A74C 4S0RA 1PMRA 4HJGE 3VH4B 5D94A 4A93H 2W3SA 2L8JA 3R8BA 1WMHA 1NAPA 2L12A 2ZW0A 5H92C 3RYTA 1T0YA 3O13A 2RR9A 1PYBA 4WWPA 1E10A 1RTNA 3VDZA 2ZJDA 2LVPA 3PHWB 1JOKA 5JEAH 1BF4A 2JRIB 2LUMA 1D1KA 4NY0A 4CHTB 2BWES 5HGTA 1PH5A 2KACA 2RF4A 2KC1A 1WJ4A 1G2SA 4KHVA 4QJFA 2WDTB 3DBRI 2QDBA 1EUJA 4GLAC 2JWUA 4HWIB 5IT9L 2KTRB 2JP1A 3U30A 2AQ3B 4AH6A 3HOWB 2N9EB 1BVSA 2CU1A 4NAMA 2C35B 2IT1A 2K8CA 4PS7A 3C3LA 4MM3B 4R4OA 5E1FA 2OWOA 4R8NA 1VQ7A 1JB3A 4BXXG 3BIID 2R93G 3W1SC 3SK5A 1IKLA 3GTOB 2EZVA 1RODA 1Q10A 2K4KA 3A55A 1SIFA 4IUPA 1FYCA 2RBMA 5JVH3 1XO3A 4DV1Q 3JSVB 2PKOA 1GM5A 4LJZC 4KVGB 1VQ9A 4JPBW 3WOFA 2WXLA 3M95A 3QAQA 4TUUA 2FIFA 5BMGA 2A69C 2KANA 3L9AX 1RLFA 2UUBL 4I6NB 2BYTA 3MVVA 2ZNVC 4NP5A 2GBRA 3PUWA 5EE1A 1EY6A 1Y8PB 2HQLA 4YY3L 1IUEA 3K7UC 4X62Q 4Y52H 2FE8A 5IA7A 2X6LA 2KO3A 2QJLA 1Y1VB 3ITPA 3V6EB 3OIPA 4DV6L 4ARIA 2MJDA 3Q23A 1EOVA 4C56C 5C6AA 4WJ4A 2IBIB 5CGKA 4DR4Q 1Y69U 2CVRA 4B3TQ 1A70A 3E6ZX 2A8VA 2HDEA 1PFMA 3RR5A 3DEPA 3K0YA 2XGTA 2ZM6Q 2ZTEA 4BBRB 3A9JB 4L5QA 5A2QL 4LNFA 1LT5D 4JI1L 5ELEA 4UP9A 1LUZA 1WTWA 4N59A 2YEPB 3PUVA 3MTNB 1TT2A 3HFZB 1H95A 1VZ8A 1A2UA 1UE5A 4LWCA 2B63H 4HDQA 3IAM1 1EYCA 3B6YA 4DR6Q 2V1YA 5KHOA 2OQ0A 2NVXB 3H6MA 2BVCA 4K7SA 3V96A 3Q69A 1E9MA 1HZ9A 2TSSA 2WINB 2LUEA 1KJTA 4P73A 4JI5Q 2VXWA 2UU9Q 2E2HB 1E8XA 2KLGA 1L5PA 4H2AA 5EE9A 1C76A 4A3EB 3TUOA 4EEWA 3TEYA 1I35A 5GADC 4GNXC 1L1OB 3ZNID 2VB2X 3P1HA 3S16H 2VH2A 1BDOA 3T3NA 2L0FA 3HEJA 3NZUA 1EEFD 5M5YH 4JI7Q 3Q3FA 2MO1A 4ABNA 3KJPA 5J17A 1CKMA 3CCEA 2C7MB 2PE6B 1EOTA 2LD9A 1V9JA 4GDKB 2L3ZA 2Y5PA 1FJGQ 1PRTB 3HOZH 3PLUA 4REZA 4HJ7A 1R4MI 2ZXOA 2KVRA 2QDFA 3RN9C 3KLRA 1WI0A 2KVMA 1YOVB 1X65A 2HHHL 4NAWA 4JC0A 1I94L 3NE5B 1UELA 1TQOA 3CQZB 4UHVA 1F2ZA 2IL8A 2EKIA 2KC2A 4R3DA 1HFNA 4ZLTF 4A3GG 3QOLA 1SNDA 3K81C 3T13A 3K5MA 4BBSG 3PUYA 3QIJA 3STBC 4OZBA 1NUCA 4LFAL 4ZDVA 2Q2TA 1V2YA 5FK9C 5GQOA 1MKHA 3GB1A 1XNRL 4MZ9A 5KIXA 3S14H 3NPPA 3HOXH 1K8AC 5C4JH 3H7PB 1LTGD 5CORA 3RNGC 2KLCA 3PPAA 1E22A 3MHZA 2KEDA 3KOJA 1VDVA 4ZRIA 4YHHL 1J7AA 4A3LH 3K5NA 2B2VC 3QCAA 1Q7YC 2AWOA 2BYEA 2BE5C 5C5MA 1QOAA 4MJSB 3D4DA 3M3JA 2XTIA 2KQ7A 5C4XB 1V5TA 3CMEA 4X65Q 1E8WA 1Q1OA 4NPNA 1HA6A 2R7FA 5EE3A 5M3FG 2B2TA 5I9OA 2CR5A 2XWBB 4K3BA 1TIFA 1F9SA 3KUCB 1SROA 1LQBA 1FNVA 1MBYA 3HOVB 1JORA 5DPSA 1EEID 1PTOF 1X3QA 2M9VA 2NN6G 5J22A 2N0SB 4IC7B 4RHRA 1KXLA 3DWPA 4MN3A 4B0MA 2LXKA 1D5MC 1KIXA 1ZDXA 1KLVA 3I3CA 1QOHA 1F9RA 4XYQA 2EIFA 2BH2A 1M4VA 4BVUC 4FO2A 3P4QB 2LWPA 5D6JB 3UQBA 2JA8G 1NTGA 1QJOA 4PG3A 1DOKA 4IWPA 2PJHA 3WIMA 1RTOA 1YD8U 2K9XA 4A3JH 1L2FA 4OWWB 2KVZA 3ZGZA 3AN1A 3MXNB 2B2YA 1PTOD 2W9NA 3RNEC 1CM9A 3ULJA 2HQEA 5BYRA 1WMHB 3GTJH 4OVVA 4DV2Q 1EYAA 3ZVVA 1PGAA 4HPMB 1R9TH 4I65A 1J6QA 4M8AA 2LSSA 1B44D 2HIXA 1E7VA 5FLMH 2DYOA 3GTMH 3NHHA 2L76A 3MXGA 3QARA 1YN4A 3D31A 2AKWB 2WXHA 2NVQH 2QHOA 3DHGC 1KQSA 5FJ8H 4C1NI 4HN7A 4F88A 5DPWA 4IN3A 2OF1A 3H15A 5C3WA 4YCVA 1IL2A 4RMAA 2I2YA 1JE5A 4A3DB 4RGOS 2RGFA 2EE1A 3EJIA 2CQAA 4F1SA 1WWTA 1OFFA 3M4YA 4C3IH 1R7SA 1WR6E 3NELA 1V1QA 2AX5A 4LNOA 2JT4B 3IAYA 3L0WB 1C3TA 1X1MA 2GMIC 3UE0A 2WACA 3IXSA 3PO3G 3QQ8B 4GMVA 1SYDA 3G4SA 1DZ1A 5I6WA 2INNE 3X3MA 2JQOA 3W1GA 5E6NA 3VVWB 3ZTCA 2JN4A 4WFN3 4DV3Q 2IX1A 5CV4A 2PMZE 4F8CB 1RRBA 4NXMQ 1RIPA 4HJAA 2R7ZH 2V4LA 1EQQA 3UIOB 1X54A 1K28A 4DV1L 1SE8A 1CSQA 2F0MA 2WQYB 3U50C 2WXPA 1C78A 4XYCA 3U7DA 4OGQC 1LTBD 4F87A 1F2LA 1B50A 4K14A 3PCOB 3CCUA 5IKCM 1WE6A 2EXZA 4J6HA 2K7VA 2VY3A 2E76C 5GAHC 3LYYA 4DR5Q 2DZMA 4WRDA 3NVZA 2EYPA 1HA5A 3AU7A 3S1QH 4X62L 1N5WA 1QOGA 3FPUB 2RD0A 4B9KA 2BTEA 3AFPA 1K9MC 1IGCA 1UF0A 1EWHA 1JW9D 3ZQ4A 3BINA 3ERQA 5LMNQ 1NBWA 3IKJA 1YQ3B 2NN6I 5DM73 3D3RA 4DR4L 2JYTA 4B3TL 1JE4A 3OMCA 1SB3C 2KWVB 4RF0A 5TSSA 3GTPB 2NVYB 2ZM6L 4K5WA 2ENBA 1BCPF 3VA7A 5IOCA 5BYSA 1FM0D 2KTFA 3J7A5 1IBXA 3FVQA 4YSXB 4DR3Q 5M5XB 3J80i 2I0QA 5ELOA 1K51A 2MX2A 1AW7A 1DOLA 3B9JA 4KN7C 2UXCQ 1OEYA 2DNCA 3OIQA 1QCBD 5EBCA 1N36Q 4X3KA 2R93H 2Z0DB 1WVLA 5CHVC 3VH3B 1N9WA 1STNA 1EIFA 3NHEB 5E4XA 4QCLA 4C3HB 1UZXB 3H3VH 2EMSA 1SYEA 2KJ6A 3KUZA 4IDIA 2V3NA 1IW7C 1Z5SB 3R3OA 1BCPD 1Q12A 1V1OA 3U52E 4O0AA 1YBYA 2OQKA 5JPNC 3GZNI 3NENA 2O2LD 3RMKC 4A55A 1ET9A 2RSOA 3F8TA 3VYSA 1BR9A 2UU9L 3N1ZC 1HTOA 4ZKCB 1ZXIA 1CHPD 5E6PA 2GLSA 2ASBA 5GXGB 3ONAB 4FF4A 4FBJB 1TS3A 1M90C 3TZDA 2FAZA 2INPE 2F0NA 2MPMA 1AZPA 1I3QH 2ZXRA 3PUZA 2R92B 4JI7L 2LXCA 5IO9A 3Q14C 4K0KQ 3UGBB 4HLEA 2MFIA 3KQ4A 3PF4A 2QSDA 1FJGL 4P75A 1G2TA 2DHZA 1U5KA 1U4MA 2K14A 4B08A 4NAWB 4IO9A 3BYTB 2JZZA 2JXTA 3ZTDA 3A0JA 3QG1A 4OVUA 2N9LA 3G6EA 2KDIA 4WJ3M 2W82A 3MHSD 5EDSA 3ETRA 1I7HA 3DOWA 1GOZA 1PRTC 2H4OA 3NTIA 2JX5A 4E6IA 1S5BD 2YU9H 1JMCA 3P2BA 2IHFA 1BBUA 1WZ0A 3HVDA 1A15A 2QILA 4RGTA 4EQ5A 3AECB 1TWAH 2BDOA 1XCQL 3DBSA 3C2PA 3BVGA 1DJRD 2EQSA 2RHSB 1CUKA 4JBKA 1EZ6A 2K6QA 1ENFA 5ELBA 4NZLB 1PVOA 1JT8A 2XRSD 1WD1A 4MTNA 4L5RC 1TWFB 3V60A 3CCLA 4A93B 2ZEQA 1UH6A 2GI9A 3FEWX 4N9TA 2M19A 1S3SG 3W2DA 1E2ZA 2JUOA 2KYWA 4X65L 1L6VA 3AI5A 4IM0A 4L5SA 4FADA 2HD3A 2Q2HA 1PYWD 1FD6A 4KY5A 1OXVA 2HTHA 2JWZA 3AE4B 2RDHA 4FXCA 3DLLA 1UWMA 4WJPA 4TVAB 3BK2A 3D4RA 4WJQA 4A3MG 4ZUJA 1HNXQ 2N7EA 2KN4A 2MGSA 1EY9A 3KH0A 2EY2A 2YTYA 5FR6A 5G2NA 4B0EA 2PW5A 4BBSH 3DCGA 3OJ4B 3MXPA 2Y0SE 4LF6Q 1LTSD 1XNQL 2KQ4X 4O1NA 2LGXA 2MBQA 4O42A 5KGUA 4LDTD 3TIXA 5IP7G 3S17B 4JIOU 3P1MA 2WB1G 3AB5A 2DJFC 2LVOA 3DWMA 4TRDA 1Z7TA 1F2RI 4PMBA 4YCUA 1FGBD 1SRUA 1E5WA 4LTUA 1H9RA 5JOBA 2O6VD 1SBBB 1DOYA 5EQ0A 4DV0Q 1V6EA 2E74C 4DV2L 3AV8A 1BNZA 1LXDA 1D3ZA 3SU8X 2DZIA 2WYQA 4FXKC 1B9NA 3NRZA 2WXRA 1I4QA 4XWWA 2CH4W 1XLNA 4JV5Q 1PH7A 1B8AA 1XYIA 4LNQA 1NBFC 4Q5VA 2LZ6A 1MVKA 1KDAA 4G7HC 1EFWA 1VQCA 1HJPA 3AE3B 2JA7G 5JEAJ 2FIDA 4L1BA 2JK8A 1D8LA 3WA0A 3S2HB 3CU7A 3FPPA 4A3IH 1K8OA 2JU6X 4KGRA 1VQEA 1KAAA 3APCA 1QG7A 4YL8A 3Q2AC 4X64Q 4ZKBB 1QE6A 1WTOA 2NN6H 1SFOB 3H1UA 3Q8BA 3AH7A 1U9RA 1WXQA 1J8CA 3EHVA 3MJ5A 4BY1B 1TGZB 3AEGB 2PMZB 2BS2B 4JWSC 2B76B 5AFWA 5ELDA 3VA5A 2BB5A 5HI1A 1O7LA 1CQVA 2CHWA 4HCPB 3DHIC 2NZ1D 1PH1A 4KIKA 2JA8H 4EZLA 1TKEA 4FXDA 1XQQA 1K0RA 4NJ6A 4XT1B 5M3MG 3GV6A 2HJ1A 3OWFA 1DCZA 4NNJB 1I6VC 4NXML 3T3OA 1RD9D 1VCIA 2D9UA 3NWTA 4P74A 3BU2A 4JI2Q 4XXEA 4DV7Q 4KKIA 4V190 4EX5A 1LM8B 3EC8A 5C0XH 2C5CA 1Q1BA 4IWOA 4BFRA 3VTWA 4TKOB 3AU5A 3Q24A 4K6DA 2CHZA 3CC7A 2OTLA 4QY7A 3DVGX 3IL8A 4B9WA 1XXGA 4DR5L 4XE0A 3A5ZB 4JI6Q 3RLOA 4G7ZC 2AMCB 4K6LA 1MI0A 2KFJA 1YITA 1V86A 2PPHA 1QVCA 1FL0A 1X3EA 3LJ3A 2ZW1A 5LMNL 4M1UB 4ANWA 2PNHA 1I6HB 2ZPNA 1E2WA 1WTPA 3A33B 1XMQQ 3ALBA 2JSOA 4BWGB 1KM7A 4OHJA 3NWSA 1VQBA 1IBXB 5IE8A 3RMHA 2Z0SA 4OELB 4X3TA 1E90A 1XT9B 1Z2MA 2PTLA 3CMMB 3HOZB 5IN7A 4CBVA 4II2B 4DR3L 2MHVA 3PF5A 4C4VB 2UXCL 1QOFA 3OPOA 2NR2A 4AOFA 1N36L 2BKRB 2B63G 1GVPA 5FLXL 1CHQD 2DYMA 2BCOA 2KA7A 3U4VA 3SK4A 5C3EG 2UUCL 1PQSA 1SLJA 2E75C 3W9CB 4EKUA 2KCNA 3GD7A 1I4RA 3S14B 4LJPB 5D14A 3K58A 2WXQA 1RJTA 3S2DB 1JOQA 3RNCC 4XYOA 4J3OD 2VUMB 2M0XA 1YJWA 2CU3A 1BCPB 2I46A 1JWAD 4YTPB 4DWFA 3KFUA 2GOWA 1AE2A 2VS1A 3HKZE 3W5OA 1I42A 2FCMA 4RAUC 1XPOA 4PYZA 2L4NA 3S15H 2KX0A 1DOMA 4WWNA 4K0KL 2F0DA 1HZBA 2F0SA 5C5LA 4DK0A 1QZGA 1LACA 3OG5A 1N32Q 3WWVA 3AULA 3ULLA 3MEFA 1U4AA 1XLPA 5LMUQ 4KY7A 3PHXB 3ZJTA 4B3MQ 2BH8A 2EXDA 1YHBA 1FCCC 4QGUA 3R3MA 1AYFA 4R4IA 4L6TB 1IL8A 3DBRB 4D2KA 2MJEA 3J80L 2AUJD 2FUHB 4A4IA 1TY2A 4B3SQ 1XLQA 3CP0A 2NTSA 2UUAQ 2MH7A 1FCLA 2N55A 4JWUC 1PRTF 3PVLA 4LAAA 4Q0FA 3S9WA 1WX8A 2SOBA 3PT2B 3SFEB 1UEAB 4BKSD 4DDGD 1MG4A 1I50H 2B2WA 3AEVA 3HOXG 3EFCA 3M7GA 1XPUA 4WORA 2WDQB 4HK2A 1VDZA 1IBKQ 3VAWA 3U8ZA 1TU2B 3CPFA 4XX5A 2XSCA 5AJ3Q 1WCMG 3Q3OC 3DDCB 1BT0A 2EYMA 2XRQD 4DUYQ 4A3LG 2C7HA 3GTJB 4BKSA 4A8XC 4DA2A 5A2QE 1R9TB 2ZCCA 3BZDB 1E0BA 1IYJB 1P7EA 1H9SA 2NVQB 5IOIA 1SNCA 3CHBD 3CCVA 4DR2Q 2DYBA 4AIMA 1KH0A 1GNUA 4MGYE 3HUIA 1EFID 3GTLH 1ENCA 2BGFA 4N9PA 2NS5A 2R61A 4ACFA 1M1KC 3CD6A 3T1HQ 1HNXL 4BA1I 3AE2B 3NS1A 4HVBA 4BY7B 1C77A 2WS3B 1A0IA 2QEXA 2KENA 2PMVA 1KABA 2NZHA 1AN8A 5M5WB 3PS6A 4GN5A 2WAQB 2L1AA 2WXMA 1LLRD 3RLNA 4GKKQ 4LF6L 3A4SC 3C8YA 2K1FA 3GTGH 1P9DU 4FJVB 4HJ5A 3RNFC 3ZRCA 4UAIA 1Y1WG 4JI4L 1EF5A 4G3XB 2E2DC 4IOAA 3H0GH 4A3JG 4GN4B 1GJZA 1E7UA 4JLCA 1WY8A 4DXGA 1N33Q 2YTXA 2BQQA 4NJCA 1UE7A 5I4DA 4GOPA 1QVGA 2O4XA 1O7ZA 3PO0A 1C48A 1JICA 2K5HA 4DV0L 4A3BG 3SVMA 5CHFA 4B6WA 1PV4A 2JA6H 2IX3A 2R7ZB 4URKA 1KD1C 1YVCA 1NI3A 2RMMA 5I2XA 4CDDC 3RUIB 2WLBA 4M8MA 2PNRC 1VMPA 3I5JC 4IOIE 2B2YC 1EQVA 4FHKA 4JV5L 4QMGA 2V4DA 4R4TA 2IWHA 2M56B 5A35A 1WRDB 1TWCB 4NPSA 4L8JA 5COYA 2MCNB 2Y0SG 1P0RA 2IGDA 3NXWA 3S1QB 1WOCA 5KNBA 2D5DA 2JXXA 4YIJA 1HE8A 3OAWA 5KNDA 3NTKA 3NZSA 4X64L 3CCJA 4P6VF 5FR3A 1R4PB 4C3IG 4A3MH 2ZVOA 1SSNA 5IWAQ 1CZWA 3MA2B 2KMAA 3ABVB 1LTTD 2E8GA 2Q8RE 4QIWE 2IY0B 2K3UA 3KW5B 4KIKB 2K25A 1RDPD 4KN4C 1YMHE 3DMUA 1E8ZA 1R4MB 1T6BX 1DONA 4IFDG 4LFBQ 4N8X1 1IYFA 2WU5B 4G4KA 2QA4A 3DBLI 1TZOA 1WXSA 4FHJA 2NPTA 5ELFA 4JI2L 2MBBB 3B2GA 2LEKA 2A5UA 1QT9A 3I8ZA 4HPPA 4YSZB 2N9KA 5JHAA 3LGJA 2OXPA 1GPXA 1JOOA 1K3BC 1MG8A 3PRPB 1AE3A 4ANUA 1MJCA 2DY8A 4MHEA 2YTVA 4JI6L 4JBJA 1TZ1A 1KAWA 5C3XA 3FAHA 1NE3A 1MHXA 2JA7H 2G9DA 3ULPA 2L52A 4KD4A 2PZWA 5JXVA 3BDOA 2AQ1B 2D0PA 2PZTA 2MP2A 2B3AA 3TP5A 4ARCA 2KT7A 3CIRB 2ZPYA 2PYKA 2X6GA 1JJCB 1XMQL 3I57A 3EQLC 3LWUA 1FVIA 2WXKA 4HMIA 1LGRA 3Q3JA 5CMDA 4CQNA 4GKJL 2I5LX 3NTHA 4XGAB 4KLKA 1WGKA 1BKBA 4HMJA 1ZP0B 3DWAA 3K0XA 1B3AA 1DYQA 1ZXHA 5M3MH 4GIVA 4B3RQ 3M85A 2C9OA 2K5VA 4HTHA 1WF9A 1DXMA 4J15A 1IHZA 1WJJA 3HRDD 4S3SA 3N6RA 5IODA 1B9RA 1ZEQX 2PZUA 3PUXA 3TBLD 3J81c 4N6EB 4G0NB 5ISRA 1FRDA 1CZPA 1TWAB 3ML8A 5C44G 2WWZA 2IO2B 1XF5L 3M3YH 3V3XA 2ONQA 3EUB2 2F0WA 4PQXA 3RUZA 1F9QA 4DXFA 3VQIA 4MTKA 1WM2A 5HKHA 3ZJUA 4A3CH 3T1YQ 3J81i 1T5XD 4BA2I 1PH4A 1S3OA 1N32L 4DNIA 1F52A 4NQKE 3QX1A 4K7UA 3TMPB 5LMUL 1AEXA 1HZAA 2CWAA 1YJNA 3S1MB 4B3ML 4L5TA 3URYA 4C2MB 1BCPC 4IOCA 2L7RA 4WIPA 3FKIB 5DPRA 2KKCA 2NMQA 3KDFA 2LRUA 1ACCA 1HR0Q 2DN8A 1WJUA 2BS3B 2KDEB 2C60A 1H8CA 2O2VB 3RT3B 5AEKB 2A1AA 1LTLA 3A9KA 4B3SL 1EYGA 1STAA 4A3GB 3A7LA 4BBSB 4RCNA 3S1NB 3HKZG 1EQRA 5G3LF 2MJ3A 5C3EH 3U58A 2K8HA 4J8QA 3OTOQ 3UIPB 2HTME 4RFBA 1K73C 1OTRB 4W9FA 3VUXA 4DR1Q 2MWSB 4FJZA 3EN2A 3HP3A 4EQNA 1RFAA 2I5MX 1LTID 4RGMA 2INDC 4DUYL 3RPFC 3L7ZC 2LFNA 1PHJA 4IUVA 2I5HA 2WXJA 4MH0E 4KI0A 4UP7A 5G3LD 2PPBC 3OOCA 3RI7C 4GZYC 1H9SB 2D3CA 3CC4A 2OTJA 2EELA 2IDYA 3HIZA 4DU9A 4PMWA 3WAMA 4DR2L 3N9YC 3VR4A 3T8MA 5JVG3 5FO9B 5M3FB 3AE9B 1A3UA 3D8GA 3K57A 4JX1C 2D3AA 2FCSA 3JYUA 1BQQT 4YCWA 3T1HL 4XIGS 1A2TA 2K33A 4II3B 5EKLA 5D7GA 1KHIA 1RM6C 3ICEA 1KF6B 1TXYA 1XMOL 2KJRA 1NYRA 3F2CA 2BB6A 2B39A 3SDZA 1VS0A 4GKKL 4GLSC 2CHXA 2CKHB 5IGGA 4HAEA 1QVFA 3H3VI 2J0TD 3ZXVA 5J2RA 1EY0A 4F8MA 3JAMc 2MW5A 1VJKA 5BO4B 3RCZA 2JA8B 4GOPB 2Z6KA 3G71A 1T0SC 1GUSA 1N33L 1WSPA 3E9IA 3TL5A 1N63A 3I56A 1L0VB 3HOUG 5HHDG 3SHLA 1HRJA 3PREA 2J53A 4FVMA 1ET6A 5JHBA 1L2NA 3DVNV 1C8CA 1WCMH 4KDLB 1PZKD 3JAMi 3RZFA 3TEWA 5C4HA 2DAJA 5DNFA 3APDA 2F4VQ 2KD0A 2BKFA 1WI5A 2WB1E 3I73A 1EWCA 2Z6BA 2XWJB 1ONLA 2Q2IA 4GLVB 3GZNB 1TIID 1O7IA 1XWEA 5H8YE 4BKGA 2KECA 2E6XA 4W9CA 4IWQA 4ZRKA 2CH4A 4IUQA 4XZ4A 1ASYA 3HRZC 3I4NH 2F3IA 4A3IG 1MIUA 1G51A 4QUCA 2D62A 1XTCD 1YHAA 1J7BA 1Y8OB 1U4PA 1TWHB 3GTKB 2OJWA 1CQFA 2DAFA 1ICFB 2BDNA 5IWAL 3W5VB 3A4RA 4KGSA 4U68A 3T56B 1TT5B 2DY7A 1OGWA 3VXWA 3ZNHB 3KVFB 4CHKA 1G91A 3NG0A 5C1ZA 3PO3B 2C5LC 1S5ED 3I2ZA 1Y1WH 4LFBL 4OIKA 2N7JA 3T9LA 1TWGB 2NPTB 4OO1G 3RZOH 2K22A 4A3KB 1C4PA 4A3BH 1WM3A 3CSTA 1OQYA 5C0XG 2HIVA 5J39A 3VDYA 2HD5B 5CV9A 2PW9A 1VRAB 5C0XJ 2DNEA 4NW2A 2K1BA 2BWFA 2JVCA 2MEKA 2WGSA 2SNSA 1K52A 3QHTA 1E1TA 1J9OA 4KKSA 4DNTB 2GA4B 2D2QA 2K5NA 2VQFQ 3NUCA 4YWLA 1S5DD 3MEHA 1HZ6A 3A8IE 3DQVA 4RM8A 1H4RA 2MP2B 3GE8C 2LMCB 2KWCA 2LJ5A 4C3JH 1Q8IA 4JGHB 3I4OA 3MC9A 1EZ8A 3S15B 3MHBA 1NYQA 2M1MA 1MFWA 1WTVA 2VH1A 1KNAA 3KBXA 1QNKA 1YQBA 2L0TA 2WXNA 2RQXA 3AE7B 3D32A 4JQWC 1SYFA 1J0GA 2FNJB 1TKYA 1OO9B 2D5GA 3QC8B 2I07B 4OZAA 4RM9A 3MFYA 5BN5A 4IFDH 4CDCC 2KDFB 4K3CA 3CMAA 3ZLZA 3A1QA 2WIIB 4B3RL 1JRPA 2R7DA 1KC8C 2RDBC 2QMTA 1II3A 1EQTA 2ZJRA 2JA5H 2G3QB 2KEEA 1YNJD 2ZT9C 3U9OA 1WGHA 2PO4A 2J42A 1W3SA 1SF0A 3CCRA 3EFUA 4HJKA 4HXDA 4IURA 1UGMA 3GTQB 1YNTE 1RAXA 2BYVE 3SDLC 1CKOA 4IALA 1I50B 3TMEA 1SYBA 2KAJA 1RL2A 5AUKA 2SAKA 1RHPA 5GROA 2WXFA 3SK8A 2KXJA 3L2PA 2E2IB 2QIEB 2XK5A 2CQOA 1JALA 4IQZA 3T1YL 1ROEA 2L1BA 4C1NK 3N32A 2MHJA 3PZ8A 4IM3A 1JR0D 2OCEA 3Q0AA 4DGZA 5EGTA 4OONA 2F03A 3M7NA 2QCZA 4TQ1A 4JL9A 3IFTA 4FYDA 1EY7A 4W9DA 1Z9FA 3DUZA 4J1MA 2FHTA 3JC66 3F2BA 2WP9B 4AS1A 3T51B 5DAUA 1SNQA 1WX9A 1GHKA 4AYBE 3KDFB 4HIMA 4DBGA 1BBWA 3NS8A 1V43A 2EVBA 3C1FA 1HR0L 1SMXA 4P72A 3A9KB 1OXXK 4W9GA 4OO1I 1KRHA 1LFDA 1HQRD 2Y3AA 2CHBD 4X3UA 5EPKA 4A3DG 1M94A 1E3PA 2WXGA 1VD2A 3CWIA 3I3TB 1GB1A 2EJMA 4DN4M 3X3NA 1SJHD 4HSVA 4DR6L 5L95C 2BW2A 5C0XI 1PXUA 3OTOL 3IBEA 3JW0X 3H09A 4US8A 3LX0A 4ICUA 1EIGA 4DR1L 1X32A 4ASWC 3I63C 4JW0A 2HDMA 3DVGY 4NDXA 4JI5L 4YTNB 2UWQA 2J0KA 2JEBI 5C44H 1BMLC 3UDGA 2CKZB 1Q5WB 4X66Q 2LGSA 4P1BC 4OZCA 4JOIC 4DK3C 4XT3B 4K81A 3SK6A 3OW2A 2E2JH 4A76A 4POFA 2F0UA 1WGGA 3HZXA 5DCNA 2Z1CA 4PNYA 2KCTA 4EFOA 2BPSA 1G291 4A3PA 3AE1B 3I55A 2KHIA 4KGTA 3V05A 4J6IA 3RFZB 2M2LA 5FLXE 1K8GA 1B3QA 1PH9A 1TS2A 1L1OC 4OL7A 3V62A 5IGDA 4MACA 4ZRPA 3L10B 2FJ2A 4A3MB 1O7YA 2K01A 5LL6X 3AEBB 2L5TA 1HH2P 3AQQA 5EKKA 4TMAB 2DENB 5CV6A 2FINB 3NBIA 3H0GG 2EJFC 1XPRA 1SMYD 1R4QB 2W54A 1CKNA 3T16A 3UI3A 1JMLA 3SHQA 1JCKB 3I91A 3LXFA 1WXVA 3OWEB 2MLBA 1CTMA 3CF5A 2JA6G 2F0VA 3KUPA 1RFKA 4XDCA 2NB0A 2FUG1 1V49A 5LHY1 1WTQA 2F4VL 2I1JA 3PSEB 1ZPSA 3GTOH 3AXCA 1IYVA 1V81A 4E74A 4DAYA 1ICWA 2FMCA 4HCSA 4DKAC 1GC7A 2LASA 2FCNA 4W9EA 5MPOA 3DWGC 2A6ED 3J80E 1E0ZA 1GUNA 2LXJA 3M9BA 3Q6SA 3IVFA 1Q0WB 1Q90A 4KKUA 4LUVA 2JA7B 4AUQC 1V80A 2GBMA 2WX1A 2LS01 1EWYC 3TJPA 1L7YA 2EYLA 1JC7A 2XVSA 2LJIA 2IW3A 2JY6A 4C7YA 1Y1VH 2H89B 2N1VA 1NENB 2CW0D 1YJIA 2UXDQ 4G11A 1ESFA 1UE6A 4X3SA 1EWIA 1Q46A 2IHEA 2YVCA 3VR9B 4NXNQ 4FF1A 3ER0A 2VQEQ 3F2UA 3H94A 2YLMA 3VFKA 4BBRH 3IFDA 1OXTA 5M3MB 3HOUH 1VQ5A 2K04A 5LXHA 1UNSA 5E7NA 2K5DA 1FXTB 2PLPA 3PRZA 5AZFA 3GV3A 2D0OA 1VQKA 2M00A 3D6WA 2NYZD 3TP7A 4AWJA 3ML9A 2XIWA 4WH4A 2IX0A 1PGBA 4MT5A 2VQFL 4YWGG 4JK1C 2F0OA 4CJ0B 4L63B 4ALPA 2Q2UA 1QZEA 2GB1A 5CV5A 5FKAC 3KF6A 3RN2A 2MBOA 4JI8Q 2KHJA 2O5IC 3W1BA 2UYZB 1Y8RC 1P8LA 3WCQA 3KJOA 2J0JA 3VR8B 1PLFA 4I7ZC 1WTRA 1PZJD 4LFCQ 4FDBA 4DNRB 2N7DA 4W9KA 1HNZQ 5IT9c 3TRZA 3WAOA 3TREA 3MJWA 4LNNA 2J7QB 1NY4A 2PW7A 5L37A 2BS4B 3A1QB 4YT0B 4OVZA 4CO7A 2REXA 2ON8A 4MSMB 1B4OA 4OO1H 4DV3L 1SE9A 3CW2C 3ZDMC 5BN4A 4A3FG 1I4PA 1SGHA 4I7AA 2B63B 1LM0A 4HRSA 4GOCA 1CI3M 2J0MA 3RLFA 5C3EB 2NVTH 1YEZA 3MAQA 2NBFA 5GMVA 1HUNA 2J4XA 2LGYA 3HK0A 5C3JB 3K59A 4M0WA 4BAXA 4DHZE 2L55A 3WDNA 2XK5B 4DV5Q 2JEAI 1OXUA 4C4VA 3EFXD 1SSOA 4ZRJA 3RN5A 4MSQB 4LF9Q 1IZ6A 2WKCA 4A3CG 3E9SA 3K80C 3S16B 2N4FA 1BO0A 1WD0A 2F3WA 1J19A 3E5SA 2PIAA 5DPTA 3PV1A 3GS2A 5HY6A 5KHQA 1Q8KA 5M5YB 4FA6A 3S1RH 1F2RC 3BZCA 4ME5A 3MZ5A 1VQFA 4RH6A 3MTSA 1XEEA 2KOLA 4OEMB 3F1ZA 1NDDA 1MI2A 2V1CC 5EBDA 5IYDG 2RPQA 1F2MA 3M4PA 3KYCD 3NQIA 3SR1A 4BOZB 1AFPA 2E5LQ 1JJGA 2RPVA 3ZXRA 4PS3A 1R4NB 3I70A 3HOYG 3QK0A 3VRAB 3I4MG 5I9PA 3HOVH 1TVXA 2QF7A 1S1QB 2WU2B 4K1RB 1C4CA 3VR6A 3P20A 5NUCA 3Q3NC 4LNKA 4WWMA 3VR2A 1STEA 2D07B 3Q22A 2RA4A 3MC8A 3SD5A 2KQSA 3R7QA 3HOXB 3ERSX 5C4JB 1KLGD 3DBLB 3L16A 3E3XA 1WGDA 1IYUA 1YJJA 1CSPA 2V0GA 1EIYB 4AYBG 1WCMB 2WDRB 4G7OC 2L32A 3KLSX 1VQHA 2OHFA 3TEXA 1HTQA 1LABA 3PIPA 3MP9A 3W5UB 4LF7Q 1X3PA 2F0GA 1SJED 3B08A 4B9XA 4TQUS 2G9HD 2D10A 1D5ZC 2N8NA 4CJ1B 4YSYB 2RSUA 3RZWC 3KBGA 1SNMA 1EL0A 1SIJA 3R2TA 3D0FA 1NMFA 1VZ7A 2UUBQ 1CT1D 2I1KA 2LFIA 1PA6A 2DUDA 3AE6B 1E8YA 1FNWA 1LTAD 1ZOYB 4EGVA 5LMNW 3CC2A 3BWUD 2JXMB 3CF6E 1WE7A 2Q8IB 5IP9H 3QJYA 2MNAA 2KZRA 2KOXA 4A3DH 3QWZB 4UPAA 2O2VA 5G5GA 5L83A 1VQIA 2IGGA 3RZDH 4DV6Q 4K7WA 1U4LA 5FOBB 2F1MA 3M4OH 1CKNB 2KHSA 4CKCA 4KKTA 5GAEC 1Y1WB 1WJ6A 4LNIA 4WJNA 2V3PA 2AHOB 3M4QA 4A3JB 1EUVB 2QEJC 2B8GA 4RG1A 4JBWA 1TKGA 1VQLA 1UAPA 1A6XA 2MQJA 4HJ9A 4M00A 1ISNA 4A3BB 4YXDB 3FMCA 1N34Q 2WKDA 4FNFA 1Z47A 5IAAC 2GVBA 2NTTA 4A90A 2Z6KC 3BDLA 1PH6A 1V8CA 3BYYB 4ICVA 2ZXPA 4APVA 4E3CA 4DAYB 3GTMB 5K5PA 1PFBA 1SR3A 2Z59B 1JRUA 4ITKA 2D2CC 1DM0B
chains in the Genus database with same CATH topology
2Z4HA 1L6UA 3KWLA 2Y0SB 3MWYW 1E6EB 3D4WA 5EE0A 1PZID 1F77A 1EU4A 4C3IB 1Q1EA 1K8MA 2B2TC 1SYCA 4H7BA 2SDFA 4HKQA 1B53A 1CFMA 1O80A 2F0IA 4RCOA 1BXTA 1UUPA 1FXAA 4LLGM 2DBYA 4U673 5EPJA 1F2YA 1UGJA 5E6JA 4KJOA 5I2YA 3AEAB 5HG2A 1JWMD 2F0PA 1V1PA 5T1GA 1JWBD 4EQPA 1GUWA 3P7JA 5K36G 3C1EA 5LL6S 4CKEA 4R8IA 2SNMA 3PIP3 3AE5B 1J8IA 3QOJA 1TR5A 4C3JG 1Q3LA 2FMMA 2J52A 2B2UA 1KDBA 1Z6HA 1EY8A 5EJWA 2ICIA 1TYGB 4WURA 3AM9A 2B8FA 3G6JB 1ILPA 4P16A 4IFDJ 2R93B 1YN5A 4K2KA 3P4PB 4ID6A 2WDVB 4TSSA 3ZJVA 3TP8A 1XLOA 5T8IA 1HUMA 2AQ2B 3D6CA 3LNNA 2EYHA 1SE2A 1N62A 3HGBA 1I4XA 4USAA 3WOEA 1QF6A 4ZRZA 3I4LA 4G57A 4NKLA 4HSPA 1KLUD 3KLSA 2JQRB 4BS9A 2E2JB 1I3QB 1VR9A 2LMCA 1YNJC 2F0QA 4FXGC 2VNUD 2X69A 1ZE3D 3KWVA 4DFAA 1RCVD 5IGFA 3A56A 2FFKB 1XCTL 1N61A 1EY4A 1QLBB 1I4GA 2WV6D 5IGCA 1XX8A 3HKZB 4V0BA 2ICEC 5ELCA 2YU9B 1G6ZA 2H88B 1D5XC 1FFVA 1N5XA 2J7ZA 4ILWA 1QB5D 1N60A 1ZYRD 3VRBB 1QNUA 1T5EA 4N58A 1J7CA 3J7YW 1EYDA 4TQ0A 5C4ZA 5KRUA 3MC0B 3TBIB 3PZ7A 2NUCA 3DEOA 1QQRA 1PTOH 1MSGA 5CV8A 1TY0A 3VYTA 4IFDI 4XWTA 1HZ5A 2LY7A 3Q8CA 3A8KE 4IZ8A 1IKMA 1W6KA 1I4HA 3K6OA 1LO5D 3HVZA 3OMGA 1D6EC 2L83A 2CJNA 1FFUA 5CC4A 2A73B 2A68D 1MD2D 4ZUIA 3HOUB 5KYLA 2DWQA 1C4AA 2BA0A 1A3VA 1NEKB 3B2FA 3GQBA 2SEBD 2PCFB 1LT3D 4KMUC 1NCVA 1FXIA 4C80A 5D3IB 1GB4A 3PIO3 2A6HD 2EDGA 2R3ZA 2W55A 1SMYC 1B9MA 2XNAC 4A3IB 1FMAD 2LHEA 2MJ8A 2K05A 2PQEA 1MSHA 3CKIB 1G8ZD 1FO4A 2PVOD 1RWSA 4Q2JA 1SNPA 4PV1C 3SFDB 1JROA 1O78A 4GDLB 2IJ0A 3SXHA 3ZYYX 3HG9A 1STGA 2A6EC 2OEOA 1D2BA 4HCEA 4LK0M 2KUMA 4IUNA 5IGEA 5KNCA 3J81E 3IT6B 1OQRA 3GP7A 1K53A 3KK7A 2NVTB 1V1PB 4ZYSA 2RVLA 4RF1A 1EY5A 3FC4A 2CW0C 2NWGA 4QIWB 2F0FA 2H1EA 3LB8C 5JPMC 2L9HA 3TDQA 2Q5WD 1CA5A 1HFGA 5HURA 1DGJA 5JJZA 3KF8A 2K0PA 3VYRA 1BUVT 1FRRA 2EYFA 4EQOA 3S1RB 2VZKD 3QIAA 2HDLA 3BVMA 4DK1A 4FP5D 4RKLA 5E3FA 3IT4B 4XDDA 1SYGA 2G1EA 2HUGA 3QB3A 2Z8LA 2JSVX 3H91A 1MHHE 3NK9A 1LT4D 3DXJC 4CGYB 1P7FA 2V4IB 1T3QA 1EIHA 1PGXA 2EY1A 2I38A 2DLBA 1VF7A 1L0XB 4EVOA 4HR7B 5K36H 1E7PB 3H3VC 3AEEB 2EOTA 1RKNA 3FRPB 3SE0A 3R93A 2OT2A 5I6YA 1WTXA 3U2SC 1KTKA 3U7ZA 1ESRA 1BUIC 1SXTA 3Q8FA 4KTAA 3JAME 1YNND 2XN9C 1OXSC 4L23A 3J7AV 3RZDB 3BK1A 3M4OB 5KEEA 1KFYB 2KJXA 4CKBA 1PFDA 2YYZA 4PT5A 1EU3A 1M8AA 2BOSA 3FDTA 2EYOA 5FO8B 2RDGA 4DF7A 5CBEE 3BS1A 4RGNA 4KY6A 1SNOA 2F0KA 1CZGA 1HTPA 2KDMA 2MP1A 3DM1A 3J7AF 3NVWA 3GTLB 2F4IA 5AUIA 3U4EG 1ZXTA 1K50A 3SR6A 4RWSC 4ULLA 1KDCA 4IKGA 3NP8A 5F2DA 4XQNA 2EY6A 3GTGB 2A69D 3H0GB 1LTRD 2KCCA 1HHVA 3W1SA 1KNEA 3AB9A 3TSSA 4ZOHC 1NVID 2IPKD 4P2CB 1B2TA 2HCIA 2IGHA 2JA6B 3VR5A 3P4RB 2EPBA 4PMCA 2B2WC 3TP6A 4A6QA 3P75A 4YTMB 4HEA1 4OW0A 4KHZA 3I90A 3VYUA 3J81L 1DOIA 1HTLD 2ACZB 5G5HA 2K32A 2PVGC 5D3DA 1YN3A 3NSWA 1SEBD 3G7LA 3DWQA 4IUTA 4RA8A 3FILA 3TEZA 4ZQ3A 1FEHA 2WB1B 3DHQA 2EYJA 1HXYD 2RKSA 3ND8A 4Z9CB 1MPEA 1L4DB 3AEFB 1H9JA 3E56A 5DM63 3W3AA 1Y8NB 5BMHA 2K5WA 4C3HG 2RSNA 4FF3A 2TMPA 1FD7D 4DAPA 1QILA 2K03A 1GHJA 5DEHA 1JWUD 2Q8TA 2HCCA 3Q8AA 4QB4A 1GUGA 5CV7A 3PMFA 1CK1A 2KMMA 1V97A 5C2TB 1YQ4B 2L11A 4UDUC 2B2UC 1ILQA 1BOSA 2VZKB 4ZHOA 3T4AC 1PDXA 1NR2A 2F0HA 4A3FB 4RHSA 1E2VA 1QWYA 4ZAIA 3EVQA 1D1IA 1TJEA 4HKZE 2BE5D 2F0LA 4ODGA 3JAML 1GUOA 3NBHA 1STYA 4JE3B 1JWSD 3M3YB 4KKJA 1NR4A 2B2VA 5J1ZA 1B1ZA 1AZQA 3PV0A 2CJOA 5EKIA 4A9AA 1FNUA 2AUKA 4ZRQA 5JAVA 5CBAE 2E3TA 4DQOC 1HQMC 1PTOB 4WJWA 5JEAG 3ND9A 4IUUA 1SE4A 1RYJA 4H13C 1VLBA 4H44C 3P4SB 3BDCA 4HROA 1FIQA 3HOYB 3I4MB 1TS4A 4K2LA 1SAPA 2EY5A 2VB3X 3Q8EA 4ZHPA 1VF5C 4NMZA 4WAFA 4C7ZA 3EGRA 2AWNA 4AYBB 3HS0C 1PUTA 4HEDA 3NQTA 1K83B 1CJEA 2A5HA 5FO7B 1ZKOA 4QUFA 4DAVA 3AMZA 5CYUA 2WP8J 1VMCA 4K8JA 2K5QA 4F7XA 2MUYA 5IGBA 3OHXC 1ZYRC 2RDFA 2O5JC 1TS5A 3NVYA 1DOXA 3K5LA 2K6AA 1DD2A 2WXIA 3IAS1 2BT6A 2LGIA 1ZDVA 4KX6B 2JYEA 4LMQD 3H8HA 3E0JA 5KYIA 1LT6D 2L0CA 3CRKC 4ZK9B 2FBWB 1CA6A 4K5XA 3J9CA 4MH8A 1U4RA 2F0JA 4XQQA 4XTCS 3A7AB 3BVZA 3C46A 1ENAA 3RD4A 1JQ4A 3PO2B 3I4NB 2YEPF 1UWXA 5D65A 2KQ3A 3GO5A 5IT9E 3L3OC 2A68C 5BMIA 5EPLA 4EE2A 1C4QA 2K28A 2WXOA 1SDFA 3FILB 1D4BA 2JE6I 3MFGA 4H0LC 1WRIA 3TN2A 3QO2A 1IW7D 1S5FD 2WNMA 3A8JE 2A6HC 2KWDA 1GAQB 3RZOB 1NSNS 5CR3A 3EA6A 2GRIA 4K8IA 3N52A 5BYQA 1STBA 2R6GA 1H9KA 4WQMA 4R9WA 1C9FA 1F0ZA 4US9A 1C79A 3P42A 4JPSA 3BG3A 3U9SA 1V8QA 3UI2A 4KD3A 1IGDA 3MXUA 1LV9A 2F0EA 1AP0A 5M9OA 3T53B 4Y7NB 3QWNA 4C3JB 1VZ6A 1Y56A 3EROA 3L4PA 1GUTA 1GXDC 5T1IA 2Y5CA 1EM7A 1PRTD 2QKIC 5BN3A 1HEZE 1GJXA 5IIFA 4RNAA 2X38A 3AEDB 2LKVA 2JA5B 1FR3A 1ML0D 3R2IA 2BBCA 3I9V1 1OQQA 1ZUD2 2F0TA 4XDXA 1SE3A 1S4ZA 3LWEA 1PFNA 2EJGC 2M0AA 3VR3A 3NUHB 2ID0A 4KK7A 1F9PA 3P63A 1W6JA 5HFYA 4CJ2C 2BA1A 1BBXC 5LNK1 1PDQA 1MGSA 1HPCA 1JQYD 2OEDA 3A54A 3NVVA 2JYOA 3AE8B 3SEBA 3K7AB 1WYGA 1L0YB 4KJNA 4K5VA 4LK1C 4QF4A 3TZUA 2F3VA 2N88A 4XQJA 1A3TA 1QOBA 1PTOC 3OW7A 1L4ZB 1QKZA 3CRLC 2QCPX 4OIJA 2LHDA 1TKWB 3I72A 1RF2D 4FF2A 2W3RA 3K5OA 1AWDA 3AMUA 2K5PA 2Z4IA 4KV6A 5C44B 2JZPA 4RKBA 4AQ7A 1H9MA 3OSOA 3V2TA 3NZ3A 1YNNC 1S5CD 3MXNA 4MIUA 1HCZA 1STHA 2A74C 1PMRA 4HJGE 5H92C 2W3SA 3R8BA 1NAPA 2L12A 2ZW0A 3O13A 1RTNA 1JOKA 5JEAH 1BF4A 2LUMA 1D1KA 4CHTB 5HGTA 2KACA 1G2SA 4KHVA 2QDBA 2JWUA 5IT9L 2JP1A 2AQ3B 3HOWB 4NAMA 2IT1A 3C3LA 4MM3B 5E1FA 4R8NA 1JB3A 3BIID 3SK5A 1IKLA 3GTOB 2EZVA 1RODA 1Q10A 3A55A 4IUPA 1FYCA 2RBMA 5JVH3 1XO3A 2PKOA 4LJZC 5BMGA 3WOFA 2WXLA 2A69C 3L9AX 2BYTA 3MVVA 4NP5A 3PUWA 5EE1A 1EY6A 1Y8PB 1IUEA 2FE8A 2X6LA 2QJLA 1Y1VB 3ITPA 3OIPA 4ARIA 2MJDA 3Q23A 4C56C 5C6AA 5CGKA 1Y69U 2CVRA 1A70A 3E6ZX 2HDEA 1PFMA 3DEPA 3K0YA 4BBRB 5A2QL 1LT5D 5ELEA 1WTWA 4N59A 2YEPB 3PUVA 1TT2A 1VZ8A 1A2UA 3IAM1 1EYCA 2NVXB 3H6MA 3V96A 3Q69A 1E9MA 2TSSA 2WINB 2VXWA 2E2HB 3TUOA 1L5PA 4H2AA 5EE9A 1C76A 4A3EB 3TEYA 2VB2X 3P1HA 3T3NA 1BDOA 3HEJA 1EEFD 4ABNA 1EOTA 4GDKB 2Y5PA 1PRTB 4REZA 2ZXOA 3KLRA 2KVMA 1E10A 3NE5B 2EKIA 1TQOA 3CQZB 1F2ZA 2IL8A 4R3DA 1HFNA 4ZLTF 3QOLA 1SNDA 3T13A 3K5MA 3PUYA 4OZBA 1NUCA 5FK9C 3GB1A 5KIXA 3NPPA 1LTGD 5CORA 3MHZA 2KEDA 1VDVA 1J7AA 3K5NA 2B2VC 2AWOA 2BE5C 5C5MA 1QOAA 3D4DA 5C4XB 1HA6A 5EE3A 2B2TA 5I9OA 2XWBB 1F9SA 1FNVA 1MBYA 3HOVB 1JORA 1EEID 1PTOF 1X3QA 2M9VA 2NN6G 5J22A 2N0SB 4RHRA 3DWPA 4MN3A 4B0MA 1D5MC 1ZDXA 3I3CA 4XYQA 1QOHA 1F9RA 1M4VA 4FO2A 3P4QB 1QJOA 1DOKA 1RTOA 2K9XA 3ZGZA 3AN1A 2B2YA 1PTOD 1CM9A 2HQEA 5BYRA 1EYAA 1PGAA 4I65A 4L2YA 4M8AA 2DYOA 1B44D 3NHHA 3MXGA 1YN4A 3D31A 2WXHA 4C1NI 4HN7A 4F88A 4IN3A 2OF1A 5C3WA 2I2YA 4A3DB 4RGOS 2EE1A 3EJIA 2CQAA 1WWTA 1OFFA 3M4YA 1R7SA 2AX5A 3IAYA 2WACA 3IXSA 1SYDA 1DZ1A 5I6WA 2INNE 3X3MA 4WFN3 2IX1A 5CV4A 2F0MA 2WQYB 2WXPA 1C78A 4OGQC 1LTBD 4F87A 1F2LA 1B50A 4K14A 2EXZA 4J6HA 2K7VA 2E76C 3LYYA 4WRDA 3NVZA 2EYPA 1HA5A 3AU7A 1N5WA 1QOGA 3FPUB 2BTEA 1IGCA 1EWHA 1JW9D 3ZQ4A 3ERQA 3IKJA 1YQ3B 2NN6I 5DM73 3D3RA 2JYTA 1JE4A 3OMCA 1SB3C 4RF0A 5TSSA 3GTPB 2NVYB 4K5WA 2ENBA 1BCPF 3VA7A 5IOCA 5BYSA 1FM0D 1IBXA 3FVQA 4YSXB 5M5XB 1K51A 1AW7A 1DOLA 3B9JA 4KN7C 2DNCA 3OIQA 1QCBD 5EBCA 4X3KA 1WVLA 1STNA 5E4XA 4QCLA 4C3HB 4IDIA 1SYEA 2V3NA 1IW7C 3R3OA 1BCPD 1Q12A 1V1OA 3U52E 5JPNC 2O2LD 4A55A 1ET9A 2RSOA 3VYSA 1BR9A 4ZKCB 1ZXIA 1CHPD 5GXGB 3ONAB 4FF4A 1TS3A 3TZDA 2INPE 2F0NA 2MPMA 1AZPA 2ZXRA 3PUZA 2R92B 3KQ4A 2QSDA 1G2TA 1U4MA 4B08A 4NAWB 3BYTB 2JXTA 3QG1A 2N9LA 2W82A 3ETRA 1I7HA 1GOZA 1PRTC 2H4OA 3NTIA 2JX5A 4E6IA 1S5BD 3HVDA 1A15A 2QILA 4RGTA 3AECB 2BDOA 1XCQL 3C2PA 3BVGA 1DJRD 1EZ6A 1ENFA 5ELBA 4NZLB 2XRSD 1WD1A 1TWFB 4A93B 2GI9A 3FEWX 4N9TA 2M19A 3W2DA 1E2ZA 1L6VA 1PYWD 1FD6A 4KY5A 1OXVA 3AE4B 4FXCA 2RDHA 1UWMA 3BK2A 3D4RA 4ZUJA 2KN4A 2MGSA 1EY9A 2EY2A 4B0EA 2PW5A 3MXPA 2KQ4X 1LTSD 4O1NA 4O42A 5KGUA 3S17B 3P1MA 3AB5A 3DWMA 4TRDA 1Z7TA 1F2RI 4PMBA 1FGBD 4LTUA 1H9RA 5JOBA 1SBBB 1DOYA 5EQ0A 2E74C 3AV8A 1BNZA 4FXKC 1B9NA 3NRZA 2WXRA 1I4QA 4XWWA 1XLNA 1XYIA 4Q5VA 1MVKA 1KDAA 4G7HC 3AE3B 5JEAJ 4L1BA 3S2HB 3CU7A 3FPPA 2JU6X 1K8OA 4KGRA 1KAAA 1QG7A 4ZKBB 1QE6A 1WTOA 2NN6H 1SFOB 3Q8BA 3AH7A 1U9RA 1WXQA 3MJ5A 4BY1B 3AEGB 2PMZB 2BS2B 4JWSC 2B76B 5AFWA 5ELDA 3VA5A 2BB5A 5HI1A 1O7LA 1CQVA 2NZ1D 1TKEA 4FXDA 4XT1B 3GV6A 3OWFA 1DCZA 1I6VC 3T3OA 1RD9D 1VCIA 2D9UA 3NWTA 4XXEA 4KKIA 4V190 5C0XH 2C5CA 1Q1BA 4TKOB 3Q24A 4K6DA 4XE0A 4B9WA 3IL8A 1XXGA 4G7ZC 4K6LA 1MI0A 2ZW1A 4M1UB 1I6HB 1E2WA 1WTPA 2JSOA 4BWGB 4OHJA 3NWSA 1IBXB 3RMHA 2PTLA 4X3TA 3HOZB 4CBVA 2MHVA 1QOFA 3OPOA 5FLXL 1CHQD 2DYMA 2BCOA 2KA7A 3SK4A 2E75C 3W9CB 2KCNA 3GD7A 1I4RA 3S14B 5D14A 3K58A 2WXQA 1RJTA 3S2DB 1JOQA 4XYOA 4J3OD 2VUMB 2CU3A 1BCPB 2I46A 1JWAD 4YTPB 4RAUC 2L4NA 1DOMA 2F0DA 2F0SA 4DK0A 5C5LA 1LACA 1XLPA 4KY7A 3ZJTA 1FCCC 1AYFA 4L6TB 1IL8A 4D2KA 2MJEA 3J80L 2AUJD 1TY2A 1XLQA 2NTSA 2MH7A 1FCLA 2N55A 4JWUC 1PRTF 4LAAA 4Q0FA 3S9WA 3SFEB 2SOBA 1UEAB 2B2WA 3M7GA 4WORA 2WDQB 1VDZA 1TU2B 2XSCA 2EYMA 2XRQD 3GTJB 4DA2A 5A2QE 1R9TB 3BZDB 1E0BA 1P7EA 1H9SA 2NVQB 1SNCA 3CHBD 1KH0A 3HUIA 1EFID 1ENCA 4N9PA 2R61A 4BA1I 3AE2B 3NS1A 4BY7B 1C77A 2WS3B 2PMVA 1KABA 1AN8A 5M5WB 2WAQB 2L1AA 2WXMA 1LLRD 3C8YA 4UAIA 2E2DC 4DXGA 4NJCA 5I4DA 2O4XA 1O7ZA 3PO0A 1C48A 1JICA 3SVMA 2IX3A 2R7ZB 1NI3A 2RMMA 5I2XA 2WLBA 2PNRC 1VMPA 4IOIE 2B2YC 1EQVA 4QMGA 2V4DA 2IWHA 2M56B 5A35A 1TWCB 4L8JA 5COYA 2IGDA 3NXWA 3S1QB 5KNBA 2D5DA 4YIJA 5KNDA 3NTKA 5FR3A 4P6VF 1R4PB 4C3IG 1SSNA 1CZWA 3MA2B 3ABVB 1LTTD 2Q8RE 2K3UA 1RDPD 4KN4C 1YMHE 3DMUA 1T6BX 1DONA 4IFDG 2WU5B 4G4KA 1TZOA 5ELFA 3B2GA 2LEKA 1QT9A 3I8ZA 4YSZB 2N9KA 2OXPA 1GPXA 1JOOA 2DY8A 4MHEA 5C3XA 3FAHA 1MHXA 2L52A 2G9DA 4KD4A 2PZWA 5JXVA 3BDOA 2AQ1B 2PZTA 3TP5A 4ARCA 3CIRB 2PYKA 2X6GA 3I57A 3EQLC 3LWUA 2WXKA 4HMIA 5CMDA 4CQNA 3NTHA 1WGKA 4HMJA 1ZP0B 3DWAA 1B3AA 1DYQA 1ZXHA 3M85A 2C9OA 4HTHA 1DXMA 1IHZA 3HRDD 4S3SA 3N6RA 5IODA 1B9RA 1ZEQX 2PZUA 3PUXA 4N6EB 5ISRA 1FRDA 1CZPA 1TWAB 1XF5L 3V3XA 2ONQA 3EUB2 2F0WA 4PQXA 3RUZA 1F9QA 4DXFA 3VQIA 3ZJUA 1T5XD 4BA2I 1AEXA 3S1MB 4C2MB 3URYA 4WIPA 1BCPC 3FKIB 2NMQA 1ACCA 2DN8A 2BS3B 1STAA 4A3GB 3A7LA 4BBSB 4RCNA 3S1NB 5G3LF 2MJ3A 4J8QA 2HTME 4RFBA 3HP3A 4EQNA 1LTID 4RGMA 3RPFC 3L7ZC 2LFNA 4IUVA 2WXJA 4KI0A 5G3LD 2PPBC 3OOCA 4GZYC 1H9SB 2IDYA 2EELA 4DU9A 4PMWA 3N9YC 3VR4A 5JVG3 5FO9B 5M3FB 3AE9B 1A3UA 3D8GA 3K57A 4JX1C 1BQQT 4XIGS 1A2TA 2K33A 5D7GA 5EKLA 1RM6C 1KF6B 1NYRA 2BB6A 2B39A 3SDZA 4GLSC 5IGGA 4HAEA 2J0TD 1EY0A 4F8MA 1VJKA 2JA8B 1GUSA 1WSPA 1N63A 1L0VB 5HHDG 3SHLA 1HRJA 2J53A 4FVMA 1ET6A 1C8CA 1PZKD 3TEWA 5C4HA 5DNFA 3I73A 1EWCA 2XWJB 1ONLA 1TIID 1XWEA 5H8YE 2KECA 2E6XA 4IUQA 3HRZC 4QUCA 2D62A 1XTCD 1J7BA 1Y8OB 1U4PA 1TWHB 3GTKB 1CQFA 2BDNA 3W5VB 4KGSA 4U68A 3T56B 2DY7A 1G91A 3PO3B 1S5ED 4OIKA 2N7JA 1TWGB 4OO1G 2K22A 4A3KB 1C4PA 5C0XG 5J39A 5CV9A 2PW9A 1VRAB 5C0XJ 2DNEA 4NW2A 2K1BA 2MEKA 2SNSA 1K52A 1J9OA 4KKSA 4DNTB 2GA4B 3NUCA 1S5DD 3MEHA 1HZ6A 3A8IE 2LMCB 1Q8IA 1EZ8A 3S15B 3MHBA 1NYQA 1WTVA 1KNAA 3KBXA 1QNKA 2WXNA 2RQXA 3AE7B 1SYFA 1TKYA 1OO9B 2D5GA 2I07B 4OZAA 3MFYA 5BN5A 4IFDH 2WIIB 1JRPA 2QMTA 1II3A 1EQTA 2KEEA 1YNJD 2ZT9C 3U9OA 2J42A 2PO4A 1SF0A 4IURA 3GTQB 1YNTE 4IALA 1I50B 3TMEA 1SYBA 2KAJA 5AUKA 2SAKA 1RHPA 2WXFA 3SK8A 2E2IB 2QIEB 1JALA 4IQZA 1ROEA 2L1BA 4C1NK 3PZ8A 1JR0D 3Q0AA 4DGZA 5EGTA 2F03A 3M7NA 4TQ1A 3IFTA 4FYDA 1EY7A 3DUZA 4J1MA 2FHTA 2WP9B 4AS1A 3T51B 5DAUA 1SNQA 1GHKA 1V43A 2EVBA 3C1FA 1OXXK 4OO1I 1KRHA 1HQRD 2Y3AA 2CHBD 4X3UA 5EPKA 3CWIA 2WXGA 1GB1A 2EJMA 4DN4M 3X3NA 1SJHD 4HSVA 2BW2A 5C0XI 1PXUA 3H09A 4US8A 3LX0A 1EIGA 1X32A 2HDMA 4NDXA 4YTNB 2JEBI 1BMLC 4OZCA 4XT3B 3SK6A 2F0UA 3HZXA 2Z1CA 4PNYA 1G291 3AE1B 4KGTA 3RFZB 3V05A 2M2LA 5FLXE 1TS2A 4OL7A 5IGDA 4MACA 4ZRPA 2FJ2A 4A3MB 1O7YA 2K01A 5LL6X 3AEBB 2L5TA 5EKKA 4TMAB 5CV6A 2FINB 3NBIA 2EJFC 1SMYD 1R4QB 2W54A 3T16A 3UI3A 1JMLA 1JCKB 3I91A 3LXFA 3OWEB 1CTMA 1RFKA 2F0VA 3KUPA 4XDCA 2NB0A 2FUG1 5LHY1 1WTQA 1ZPSA 1IYVA 4DAYA 1ICWA 2FMCA 4HCSA 5MPOA 3DWGC 2A6ED 3J80E 1E0ZA 1GUNA 3Q6SA 1Q90A 4KKUA 2JA7B 2LS01 1EWYC 2EYLA 1JC7A 2XVSA 2LJIA 2IW3A 4C7YA 2H89B 1NENB 2CW0D 1YJIA 1ESFA 4X3SA 3VR9B 4FF1A 3F2UA 3H94A 3IFDA 1OXTA 5M3MB 2K04A 1UNSA 2K5DA 2PLPA 3GV3A 2M00A 3D6WA 2NYZD 3TP7A 2XIWA 4WH4A 2IX0A 1PGBA 4MT5A 4YWGG 4JK1C 2F0OA 4CJ0B 4L63B 2GB1A 5CV5A 5FKAC 2O5IC 3WCQA 3VR8B 1PLFA 4I7ZC 1WTRA 1PZJD 4DNRB 2BS4B 2PW7A 4YT0B 4OVZA 2ON8A 1B4OA 4OO1H 5BN4A 1I4PA 2B63B 4HRSA 1CI3M 3RLFA 5C3EB 3MAQA 2NBFA 1HUNA 2J4XA 5C3JB 3K59A 4M0WA 2L55A 3WDNA 2JEAI 1OXUA 3EFXD 1SSOA 2WKCA 3E9SA 3S16B 1BO0A 1WD0A 2F3WA 2PIAA 3E5SA 3GS2A 5M5YB 1F2RC 4ME5A 3MZ5A 4RH6A 1XEEA 3MTSA 2KOLA 1MI2A 5EBDA 1F2MA 3NQIA 3SR1A 1AFPA 2RPVA 3I70A 3VRAB 5I9PA 1TVXA 2QF7A 2WU2B 1C4CA 3VR6A 3P20A 5NUCA 4WWMA 3VR2A 1STEA 3Q22A 2RA4A 3HOXB 5C4JB 1KLGD 1IYUA 1YJJA 2V0GA 1WCMB 2WDRB 4G7OC 2L32A 3KLSX