4RFBA

1.93 angstrom crystal structure of superantigen-like protein from staphylococcus aureus in complex with sialyl-lewis x.
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
194
structure length
194
Chain Sequence
HNYKSLKYYYSKPSIELKNLDGLYRQKVTDKGVYVWKDRKDYFVGLLGKDIEKYPQGEHDKQDAFLVIEEETVNGRQYSIGGLSKTNSKEFSKEVDVKVTRKIDESSEKSKDSKFKITKEEISLKELDFKLRKKLMEEEKLYGAVNNRKGKIVVKMEDDKFYTFELTKKLQPHRMGDTIDGTKIKEINVELEYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.93 Angstrom Crystal Structure of Superantigen-like Protein from Staphylococcus aureus in Complex with Sialyl-Lewis X.
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Toxin
molecule keywords Putative uncharacterized protein
total genus 64
structure length 194
sequence length 194
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rfbA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rfbA01
1HXYD 3DWQA 4K6LA 4ZYSA 3R2IA 1ENFA 1TS4A 2G9HD 1LLRD 1ESFA 4RGOS 1EEID 5I4DA 5D3DA 1I4XA 5D3IB 4UDUC 1TY2A 4OHJA 1V1PB 3SEBA 3EFXD 1D5ZC 1SEBD 1SXTA 3KLSX 3EA6A 2RDHA 1FNUA 1S5BD 1PZKD 2CHBD 1CHQD 1LT4D 1M4VA 1TS2A 3OWEB 3BYTB 1SE4A 5FK9C 1JR0D 1BCPC 3BVZA 4BWGB 3TSSA 1EU3A 4RGMA 1PRTC 1CT1D 1XTCD 4Z9CB 1S5DD 3CHBD 1AW7A 1EU4A 1G8ZD 1KTKA 1I4HA 1BCPF 1SE2A 2WV6D 1PTOF 1PZJD 1FGBD 2AQ3B 1BCPD 5TSSA 4RGTA 1S5CD 1DYQA 4RH6A 1LTGD 3V05A 1LT6D 2ICIA 2XRQD 2SEBD 1AN8A 1FD7D 1ET6A 4L6TB 1I4GA 1GOZA 1SJED 1I4RA 3W2DA 2J4XA 3GP7A 3BYYB 2AQ2B 1D5MC 2RDGA 1HTLD 1D5XC 3R8BA 1BCPB 1UNSA 1JCKB 1JWUD 4NZLB 2O2LD 2Z8LA 3URYA 1TS3A 3BZDB 1L0YB 1BXTA 1MD2D 3BVGA 3MC0B 3R2TA 1I4PA 4C56C 2TSSA 1SBBB 1TS5A 1LTRD 1XXGA 4RHSA 2XNAC 4RGNA 1LT5D 2IJ0A 1CQVA 1S5FD 1LTTD 1YN4A 1D6EC 1UUPA 2IPKD 1KLUD 4L63B 5ELDA 2R61A 5ELBA 1FNWA 3BVMA 4RFBA 2NTSA 1YN3A 1CHPD 1JWSD 1V1PA 1PTOH 1PRTF 1SE3A 2QEJC 1RF2D 2XRSD 3MFGA 5ELEA 4DXFA 1LTAD 1PRTD 1PTOD 1EEFD 1PZID 5FKAC 1LO5D 1PTOB 2AQ1B 1CK1A 3O13A 1EWCA 1LTBD 4O1NA 5ELCA 1YN5A 1TY0A 1JQYD 1DJRD 1F77A 1EFID 1SJHD 1B44D 1B1ZA 3DWAA 1LTSD 1PTOC 4RHRA 1RD9D 1HQRD 1PRTB 5ELFA 1HA5A 1ET9A 1V1OA 1RDPD 1I4QA 1KLGD 2QILA 1RCVD 1JWMD 4DXGA 1STEA 2NTTA 1QILA 3DWPA 1T5XD 1LT3D 4RCOA 1LTID 4TSSA 2XN9C 1S5ED 1FNVA 1PYWD 1L0XB
chains in the Genus database with same CATH superfamily
1G2TA 1S72A 1K9MC 4LFAL 2WIIB 2NYZD 2FCNA 2ZM6Q 1TS4A 3H8HA 3NBIA 1LLRD 2C9OA 1LM8B 2M56B 2RSUA 4GDLB 3F2UA 1KOTA 2EOTA 2K03A 5I4DA 5IGEA 2PEAA 1STNA 4DUYL 1E24A 2HTHA 3CCRA 3APDA 1EQVA 3DVGX 3M4QA 3QQ8B 5AZGA 4IFDI 4P75A 3K0XA 1BBXC 2N4FA 2L4NA 2C35B 4JI6L 2ZJPA 3TREA 3D6WA 4J15A 2KQ4X 4Y7NH 1B3AA 3OJ3A 3H6NA 3DEOA 3P75A 1LM0A 5EKIA 3H94A 1LT4D 2F0LA 1Q8IA 3I3CA 2L76A 2PTLA 5E6NA 4ACFA 3DBHI 2K33A 3I9V1 1QE6A 2CW0C 4BBSG 3T8MA 1HNXL 2RKSA 3KYCD 1IBKL 3CSTA 1SYEA 3ZKJC 5C6AA 3D31A 2N7JA 3L0OA 4V0BA 3AE6B 1WYDA 5IP7H 2HT1A 1R4NI 1HZ6A 1VQ5A 3VRAB 4GN1A 4YY3L 1EWHA 4RGTA 4OIKA 2JJQA 3PHWB 4KKUA 4XZ4A 1LTGD 3MVVA 3A54A 3RZDB 2B76B 3VRBB 4EGVA 1O80A 2ASBA 2KN5A 1BR9A 1Z7TA 4ODGA 1J8IA 4F1SA 1TBEA 5A2QE 2BA0A 5M3FH 4HIDA 2GB1A 1K8OA 2WYQA 4PV1C 1LGRA 3NBHB 2M00A 5BR8L 3RNCC 4R3DA 2KT7A 4ZUJA 1WM2A 3L13A 1G51A 2R7ZB 3PCOB 1BVSA 1A2TA 1VQ6A 4LFCQ 3ZNHB 1CTMA 3CP0A 2VUMB 1L0YB 4R4OA 1MD2D 3CCMA 2VQFQ 1SFOH 2M8SA 3RYTA 4LF9Q 5C5MA 1FYCA 4RA8A 1BUVT 4K5WA 3DHHC 3PPAA 4RHSA 3OJ4B 1T9HA 1UAPA 4IG7B 2INCC 1VQ8A 5H8YE 1GPXA 4P16A 2FMCA 1DOYA 4JI1L 3ERQA 2KLCA 2WGSA 3HM3A 2E3TA 1V80A 3NRZA 2E75C 4D2KA 1WGGA 4DAYB 4HDQA 2LI5A 4XE0A 1BOSA 4XQQA 3ND8A 1QNUA 1M8AA 4H02A 4R8NA 1SR3A 1X1MA 2MBBB 3AE8B 2DZJA 3AEVA 2ZNVC 4KKSA 1MI2A 4YCWA 3DVGY 3WDNA 1NCVA 1F2LA 1CK1A 1LTBD 4PZ8A 5M5WH 4ULLA 1DOMA 2EDGA 1XPRA 3DBLB 4REZA 5GQOA 4KIKA 3FHWA 2Q8TA 1PXUA 2NVYH 4LMQD 2WDQB 2X8XX 2H5XA 4OVUA 2A73B 1PRTB 1WE7A 1SE9A 4A3IB 3M3JA 3GE3C 2EKIA 2B3GA 4OL7A 3FAHA 2OF1A 3L4PA 4GDLA 3PSEB 4PS3A 1JWMD 3LB8C 2F0QA 3C1FA 1X32A 1EYAA 3SGIA 1T6BX 2ZJDA 4XC2A 1S5ED 3UGBB 4WJQA 4APVA 3VTWA 4B3TQ 2BS4B 1HQMC 1IBMQ 1C77A 2C9WB 2J0MA 2ON8A 3RMKC 4CO7A 4Q0FA 4RF0A 1ICWA 4IKGA 2W9NA 2QW7A 2C7HA 3Q8FA 1WMHA 1GUOA 4G7HC 1GC6A 4CJ2C 1ENCA 4P2CB 5D3IB 2LWPA 4QL5A 1RHPA 2MLBA 3R3OA 2N7DA 2K1FA 1HZ5A 2CU1A 2ALYB 1WMHB 5C3JB 1FNUA 1NE3A 1VQMA 3ICEA 1SYFA 2WAQG 1TS2A 3HOZB 2KN4A 4RKLA 2L0FA 1JR0D 3JAMi 3PO0A 4FXCA 4E3CA 2ENBA 4TQ0A 1TWFB 4YWGG 3EJIA 4DDID 3P42A 4QUCA 1V5TA 3PO3G 2NVXH 2REXA 1S5DD 1WJUA 4FO2A 3TL5A 2DYMA 1WZ0A 3I4MH 2B2UC 1NR2A 2ZJQA 2WXLA 2NVTB 4A93G 3VXWA 4DFAA 4A3GB 1FGBD 2JA5B 1BT0A 1QOFA 1MJEA 1DYQA 5I6WA 2X6GA 2C7NB 2WXPA 4LUOA 4EX5A 1M94A 1YEZA 2F0TA 4AS1A 3IRBA 1GHJA 2BDOA 1WXQA 2CFMA 2KCMA 3B2FA 4GN3B 5CV4A 1C8CA 2JA6G 3MC8A 4OZBA 3H0GH 1KRHA 3QAQA 4NXML 2GBNA 2R2QA 1IGDA 2C5LC 3GTKB 4WJWA 3JSVA 3TCAA 4ZHOA 4EVOA 1RL2A 2F0WA 4ITKA 5JHBA 2MHVA 3DBHB 3OW7A 4I6LB 3GTJB 2ZPYA 3AM9A 1YNNC 3CCEA 1TS3A 3BZDB 4JL9A 1F2ZA 3V96A 4DK3C 4Y52H 2O6VA 2Y5CA 2ZXPA 1UE5A 5D6JB 1Z9FA 1NI3A 4HWIB 2MNAA 4H2AA 2KOLA 4QQBX 4ZRKA 2UUBL 4LNIA 2KMCA 1TS5A 4A20A 1OEYJ 2B2WC 1L4ZB 5HFYA 2LVPA 4LTUA 4A3EG 3OYYA 4JI7Q 1NENB 5MPOA 1CA5A 2KWDA 1R9TH 2WXMA 1PH8A 3GD7A 4NXNQ 3J7A5 2LJ5A 4NNJB 2LGDA 2MCNB 3TP6A 4S0RA 1WGYA 4W9GA 3ZTDA 4B3SL 2C60A 4C4VA 1FNWA 2D5GA 1D8LA 3BU2A 4L5QA 4N8FA 5I2YA 2A5HA 2IY1B 2WKCA 4XQNA 4BBNC 4YHHL 1V1PA 4BVUC 3QWZB 4E74A 1JC7A 2PO4A 2K4KA 4DXFA 1UD7A 1UH6A 4OVZA 2DZKA 1LTAD 3JC66 5IGDA 2WNMA 3T53B 4IWOA 4WJNA 1PTOB 1L1OB 4BY1G 2Y0SB 3CMMB 4F87A 2QMTA 3FPUB 1JOQA 4HIOA 1M90C 1F77A 1Y1WH 1WTPA 4LFCL 1O7YA 4RHRA 2HE7A 4O42A 3B0AA 1G291 1B3QA 2LXKA 1K8MA 4AOFA 1XLQA 3VYSA 2QEXA 1FCCC 4PG3A 3PZ7A 4HXDA 2ZXOA 2F0IA 1RDPD 5FJ8H 4UP7A 1QZGA 4ZYNA 4RMAA 2F0KA 2ICEC 1XJVA 1DD2A 1D4BA 3O65B 2BWFA 2MJ8A 3NTKA 5EGTA 1YIWA 4JX1C 4A55A 3PUVA 4X3KA 4JIOU 4JI1Q 4L5TA 1TU2B 3AEGB 2WAQE 1VQNA 4BXXH 2E2HB 4BY1B 4NMZA 1PQSA 4RNAA 1UF0A 5CHFA 1I50H 5COYA 4IFDH 4FULA 1W2BA 1SNOA 3LNNA 2A6HC 2E74C 4E71A 1KDCA 3QK0A 2KECA 1QB5D 4HEDA 4G3XB 3H3VI 1RRBA 4W9IA 4HPPA 3H1UA 4DHZB 1ZXTA 3UDIA 1YJWA 4HJGE 1WTWA 5JJZA 1VF7A 2AWTA 1PHJA 4DA2A 2QCPX 3VR4A 2KZRA 4ZKCB 2KQSA 3TEWA 3PMFA 5FLXL 5K36H 3R3MA 4OO1I 3NS1A 1HEZE 3BDOA 3I2ZA 1KABA 4B3RQ 2NN6I 3TRZA 1RIPA 2JSVX 3TSSA 2ID0A 1B9RA 1QWYA 1STYA 2FUHB 4GU2A 2WXRA 3TIXA 1KLVA 3R7QA 1SE8A 3AECB 3NTHA 1IL2A 4A3BH 2BPSA 4Y7NB 1AWDA 1P0RA 3M95A 1SDFA 1PH1A 4C2MH 1RKNA 2WXHA 1SGHA 4E6IA 1NAPA 1E6EB 1W6KA 4JV5L 3P4SB 4W9DA 2UUCL 1MHHE 3IAM1 2J0KA 2QC8A 5J39A 2PMZB 4DAMA 4DV0Q 4LF6L 2L5TA 1SMYD 4HRSA 3T1YQ 4DR6L 2MBHA 3PHXB 3H0GB 4LF8L 2Z9HA 4MTNA 1SJED 4X62Q 3MHBA 1I7HA 4BFRA 2RDGA 3GTJH 2K75A 3EN2A 4C00A 4GKKL 4QIWB 2V3NA 3C2PA 4LFBQ 3AEDB 5EPJA 3HRDD 1YNTE 2K01A 1VD2A 2HDMA 2QKIC 5J22A 1YD8U 1F2RC 4GIVA 4JYAQ 3BVGA 4M1UB 1L6VA 3HK0A 4RM9A 3LWUA 1JOKA 5CMDA 1WX7A 2GMIC 5KGUA 4JBKA 4C56C 3DBLI 4HCNB 4TQ1A 1VQ7A 1U4LA 2NN6G 4M02A 5CV8A 5CV5A 5KYLA 4YIJA 2F4VQ 4HMJA 2DYOA 2CKHB 3HS0C 2O6VD 1A3TA 5ISRA 2IJ0A 5M9OA 1BMLC 1I6VC 4MGYE 4IUTA 4BA1I 1L5PA 4RG1A 1XCQL 2MJEA 4HDOA 1E10A 3ENEA 1TZOA 3KBXA 3IG3A 2PW7A 1TR5A 1SIFA 4IC7B 3D32A 2F4IA 4JI8Q 4Q5VA 4AYBE 4MEMA 2PYKA 1PRTD 1L2FA 1HZBA 4NPSA 1H4RA 3FVQA 4GDKB 5FKAC 2Z4HA 4F8MA 2D3AA 1JOOA 1ZE3D 3ZDTA 1DGJA 2IY5B 1WSPA 2K6QA 5E7NA 1DJRD 1G6ZA 1C78A 3E5SA 1F1HA 4OGQC 1MHXA 1XTDA 4IUVA 2A5UA 5C44G 1HH2P 2I07B 1ZXHA 2KX0A 5C4HA 5CHWA 1P9DU 3HKZG 3HOVG 3OIQA 4AP4C 4USAA 2F4VL 4GXBA 2JE6I 2JA8G 2JX5A 1V1OA 4F7ZA 3N3KB 1STAA 2OEDA 2QILA 2ZTDA 3GO5A 1HUNA 5AUIA 4P6VF 3T51B 1QILA 2FE8A 1RAXA 4NAMA 3CMAA 2HCCA 2WLBA 2IO0B 3HKZE 4TSSA 1FNVA 1UGMA 3F2CA 2V3PA 4GKJL 4CDFC 2VQFL 4K6LA 1N5WA 1F2RI 3KF8B 1MG4A 2G9HD 2KTRA 1Q7YC 2CCZA 2N9KA 3P1HA 3IXSA 4G11A 4W9KA 1SSNA 1EEID 2RCNA 3Q6BA 2LUEA 5J17A 4PS7A 1L2NA 2CWPA 3A9KB 1CI3M 1XNRQ 5K36G 1YQ3B 4DF7A 3APCA 4CDDC 4NB3A 2V9HA 2DN8A 3F8TA 4DUZQ 2KENA 2IGDA 2KQ7A 3SEBA 3N9YC 4DR4L 1P16A 2MP1A 4GZYC 2CJNA 3DVNV 3ZTCA 2ZVNA 2KAJA 4J3OD 1CUKA 2NBFA 2Q2TA 3NWSA 1M4VA 2KXJA 3PQIA 5KHQA 3NVWA 2UUBQ 2HQEA 1S40A 2L8JA 1TJEA 3QARA 3DHQA 3ABVB 1K8RB 2GOWA 1J7AA 1EM7A 2BS2B 4HAEA 1VRAB 3GTLB 2ZM6L 5DPTA 3L16A 1K73C 1I4HA 4KGRA 4FF2A 3HOVH 3RNFC 4EQPA 4URKA 3Q8BA 4BY7B 2BQQA 2YLMA 2DNFA 1UE1A 2KJHB 2V4IB 5BN4A 2PVOD 2WHIA 2XRQD 3R93A 4G57A 2K8CA 3I7FA 3VA7A 1KM7A 1LYLA 3T9LA 3G4SA 3MTSA 3IHPC 3ZW3A 3B6YA 2DX5B 2MO0A 1GOZA 1I4RA 3EECA 3W2DA 2PI2E 4BOZB 1D5MC 3S2DB 3H3VC 1J7CA 3EGRA 2BCOA 4QMGA 2FINB 1ASYA 1EIYB 4UY8C 1NYQA 4A3JG 1X65A 4HR7B 3AE4B 1ZPSA 3K5NA 1DM0B 1Q8KA 1QZEA 1A70A 3FRPB 4JI2L 1X3EA 1G6PA 1VQBA 1MGSA 4MH0E 4DV4Q 2V3SA 2JA6H 2JWZA 2TSSA 4JG2A 5CORA 5E6JA 1SBBB 1ZOYB 2LS01 4IUPA 1EYGA 3PO2H 4M0WB 3TJPA 4JCVE 1O7IA 3J81E 5LMNL 1NBWA 3N6RA 5L83A 3JAMc 4NY0A 2EYLA 3QIAA 2IPKD 3KUPA 2K52A 4EQ5A 3SDLC 2A69C 4DNRB 3QJZA 3MFYA 3DPDA 4A3OA 3N30A 3ERSX 4RFBA 2WWZA 3CRLC 1XMQL 3CPFA 5JEAH 4KY5A 1LXDA 1FRDA 3S1MH 3G6JB 1KNAA 4A4IA 1PGXA 5EQ0A 4DAVA 1MI0A 3WAPA 2GBMA 4QUFA 3M4OB 1AFPA 2UYZB 1BKBA 4O1NA 2K7VA 5KRUA 2C7MB 3FPPA 3I4OA 2LEKA 2DY7A 2KHJA 1B44D 2RF4A 3D4WA 2I1KA 3CC7A 4KMUC 1OXTA 3W5VB 3TQYA 4L23A 1PFMA 4TRDA 3RNEC 4YWLA 4H13C 3BY4B 2HDEA 1QNKA 1FMAD 1N5XA 3GV3A 1V2YA 4JBWA 1JALA 3C8YA 3T56B 2W3SA 1GUSA 4DXGA 4BBRB 2JK8A 5C0XG 1YOVB 1HPCA 2XEWA 2DUDA 3A8KE 4BS9A 4C80A 2PZTA 1Y8NB 3GOEA 3FKIB 4F7XA 4PMBA 3CCLA 2RPQA 1HR0L 3PT2B 2O5JC 3L10B 2NVTH 2JA8B 4BA2I 3M4PA 4LJPB 2OTJA 2JXXA 2Q5WD 2V0GA 4NDXA 1EQRA 1WD0A 2DGYA 4XXEA 2A6HD 4K0KL 2QJLA 4B6WA 4U673 3HOWH 1SNPA 4HK2A 5M3MH 2K8BA 3N1YC 4JQWC 1SYCA 3STBC 3ONAB 1RFKA 1WXAA 3BK2A 4W9HA 1V1PB 1VQLA 1ZDXA 2N9LA 4OO1H 1D5ZC 3P20A 4IZ8A 4PYZA 1F0ZA 2AL3A 2UWQA 2VNUD 2KJ6A 2KBNA 2GVBA 5HGQA 5FLMG 1I3QH 1U5KA 2PQAA 3SK5A 3J80E 2UXDL 1FFUA 1PUTA 2V4LA 4AUQC 4KIKB 2B63B 1B9NA 3HIZA 4EUTA 4RGMA 4FF4A 2IHFA 2EY2A 2I5HA 2MEKA 1TKWB 1XTCD 1CM9A 4DV7L 2E2IB 2DBYA 5CBAE 3KJPA 2DNEA 3RZOH 4QGUA 5CX3A 3KF6B 1NSNS 1PZJD 5TSSA 1BCPD 3FMCA 2R7FA 2KVMA 2UXBQ 2D3GA 3KYHC 4IWPA 1IGCA 1QVFA 3KLSA 2F0PA 2A68C 4DV1L 1R9TB 1HNWQ 1PYBA 2K6AA 4JPBW 2EYJA 2K50A 4L6TB 4LW1A 4BKTA 3VR2A 3J81i 4LCDE 1FGUA 1H9SA 3BYYB 4BBSH 3TS2A 1EWIA 1YJIA 5BO4B 4ARIA 5IA7A 1TKYA 2MPMA 2NVYB 3GTQB 4M8NA 1EY8A 1OQQA 5BMIA 3S17B 3DXJC 2AHOB 2Y0SE 2LHEA 2L83A 1N36Q 3J7AV 2X38A 3NXWA 3HOUH 2FJ2A 1XLOA 2I1JA 3AV8A 3HVZA 5IT9c 1MSHA 1WTVA 1T0YA 4MT5A 1XXGA 1AARA 3ZO5B 3PF4A 4JC0A 4PMWA 3KBGA 4ZRJA 3BIID 5EPKA 2BYEA 4HKZE 2QIEB 4DR5Q 3HVDA 2CHZA 1UUPA 3DVNU 4KN4C 4JI6Q 3MHSD 1VZ7A 1IKLA 3PSIA 2F3VA 1YHAA 3RNUA 3BVMA 1E2WA 2MBQA 1DOXA 3DHGC 4AJWA 4IJHA 4K8JA 3AU4A 5G55A 1PRTF 2XSCA 3K7UC 3I55A 3ER0A 4J6HA 3RD4A 2AWOA 4JI3L 3LDZE 2PZWA 2LZ6A 3GTOH 5GXGB 2VQEL 5M5YH 4CGYB 3ML9A 3VHTC 5E4XA 3K9PB 2WDVB 3EC8A 1Y1VG 2VUMH 1OTRB 1ZW7A 3UDGA 1JORA 2IYDB 2Q2UA 2R7ZH 1UWMA 4FXKC 2DHZA 2A4ZA 4OW0A 4EKUA 4UPAA 3A0JA 2XTIA 3KYDD 2E8GA 4DBGA 4ME3A 1YHBA 2NTTA 4HPMB 4WJ4A 1X3QA 4J1MA 1WYWB 4DKAC 2D3CA 3AB5A 1PYWD 1EY4A 4GN4B 2Q8IB 3E9HA 1U4AA 4WWMA 4QY7A 3DWQA 4DV3L 1HZCA 1BF4A 2GLSA 2E2DC 2JP1A 5IP9H 2INPE 1Q12A 1V8QA 2LKVA 2N49A 4GLVB 2Z6BA 3G7LA 2E5LL 1NDDA 4DQOC 1V43A 5C44B 1HRJA 4O2DA 1OXSC 3D3RA 4HPLB 2MQHA 1V86A 5EBCA 3WCQA 4C7ZA 5IP4D 4CHKA 4A3CG 1V1QA 3Q3MC 5IAAC 4A3IH 3OAWA 5HGTA 3NVVA 2WB1B 4M8AA 4XX5A 3U2SC 1O78A 4LF8Q 3S16B 1RTOA 1TIID 2JSOA 1LFDA 3R66C 4P72A 3I91A 5M5WB 2CHWA 3R7RA 3PGEA 1VQHA 4A3BB 2EVBA 5CBEE 1HNZQ 2BB6A 4WWNA 1EU3A 1SYDA 2KDFB 1HHVA 1CT1D 1WWTA 1PH7A 3AB9A 1L7YA 1V97A 2Z6KC 4CHTB 5AFWA 3OHXC 4C3JH 2E5LQ 1SE2A 1PTOF 2KYWA 1WX8A 1H9MA 2HHHQ 4KLKA 2NR2A 1TZ1A 2ZXRA 3H9DA 3X3NA 1VR9A 2SNSA 2L0CA 1GVPA 4YCUA 2ZVOA 1SYBA 2J7QB 4K0KQ 3FC4A 2EJMA 3DMUA 4A3KH 1E1TA 2W82A 1NMGA 2VRRB 5BN3A 1GB4A 2UUAL 1GAQB 3M3YB 1BCPB 2VXWA 1JWUD 3KFUA 1EY7A 1HNZL 4K8IA 1WGHA 1B70B 2TMPA 1E7VA 2LGXA 3AU7A 5DLQE 4DV2Q 4JE3B 1VQOA 1OEYA 2JY6A 3W1SA 2UXCQ 1B4OA 1U9RA 3FDTA 1DOLA 4YL8A 1PH9A 2MWSB 3ZRFA 2H1EA 4WAAA 4KHPQ 2ZZPB 3C0RB 1VQCA 3QIJA 3B08A 2OJRA 2CW0D 4J6IA 5C0XH 1U0LA 2HD5B 3RZDH 1LTTD 3U58A 5T8IA 3ZJVA 2PMZE 2Z59B 3ZXVA 3CRKC 1C4AA 1Y1WB 3TBIB 1FO4A 3I73A 2C5CA 5IYDH 2I38A 1ZP0B 3AE1B 4GOCA 2DNCA 3VTUA 2YTXA 1PTOH 2XRSD 1MHWC 4KD3A 2G4SA 3EIVA 2WFWA 1JRPA 1CKNA 2EY5A 4GKKQ 2N78A 4HSPA 1J5EQ 2BKRB 2FAZA 4ZDVA 5DEHA 2PQAB 4MH8A 1Q5WB 2AQ1B 2ATWA 2B3AA 1PMRA 3A8IE 2PE9A 2QCZA 3EHVA 3L7ZC 4MGIE 2R93H 5IO9A 4OVVA 4GNXA 3NP8A 4LJZC 1J6QA 2CS4A 1EF5A 2YTVA 4KHVA 3MAQA 5EAYA 5IODA 4MSMB 1H9RA 3D0FA 4LJOB 3MEFA 4KHZA 3H7PB 3OPOA 2D10A 2M17A 1K8GA 3V62A 1KLGD 1QQRA 4OZCA 4DR2L 4POFA 3DWGC 4JVZA 4OZAA 1WD1A 1Y1VB 3P4PB 4LNKA 3ONSA 4DR5L 2IX1A 3SR6A 4LNOA 2L1AA 1OXUA 5IGBA 2FCSA 2UXBL 3VR5A 1Q3LA 1IBLL 2RBMA 1B8AA 3HFZB 2CWAA 3VUXA 4AYBB 1E5WA 3ZNGC 4R4CA 2WKDA 4RGOS 1QG7A 3I56A 1VDVA 1QT9A 1GUGA 2B2TA 1L6UA 5C23A 2JXTA 5BMGA 5HY6A 1EY6A 2HQLA 1RWSA 5G5HA 2X69A 3SFEB 2IZVB 5H1SE 2EELA 1FXTB 2YU9B 3PO3B 2VQEQ 1JWAD 1Y8PB 1SEBD 1TWCB 4HMIA 5C4XH 5JZEB 2JA5H 2PI2A 4HTHA 2D5DA 3CCJA 1IYJB 3CCVA 1DOIA 3PRZA 3SDZA 2O2VB 4YHHQ 1ML0D 1WGRA 1V81A 2JQOA 5FOBB 1PRTC 1WRIA 1YJJA 3S15B 5C3EB 1HTOA 3CHBD 3RLOA 3S14B 4ZLTF 3S1QH 1YBYA 2F0MA 4FXDA 1BCPF 3PV0A 1JJGA 3RR5A 3AH7A 3DQVA 4B0MA 4K3CA 4KKJA 3KUZA 4UP9A 3HOZG 2L32A 4C3IH 3V05A 3T1HQ 1E2ZA 1I5FA 1LT6D 4BBRG 4JI0L 3S2HB 3AULA 4KKIA 3U8ZA 3WIMA 5AZFA 3AI5A 3GS2A 2KHSA 5AUKA 4A9AA 5D94A 5IWAL 1UEAB 4PK1A 3GP7A 1SNCA 1WZ3A 4G4KA 4M01A 4ZUIA 4YTNB 2F3IA 2JF5A 1T0SC 1F9SA 1Q82C 5C4XG 1E9MA 2O2LD 2JYEA 3AE9B 4JK1C 2KANA 3QB3A 3ZYYX 2PCFB 1V9JA 2FBWB 1SNDA 3B2GA 3IAS1 1C7YA 1GNUA 3HHMA 3R2TA 1E22A 4HJ8A 1ROEA 5G5GA 2K05A 4PMCA 4ID6A 3RNGC 2HTME 2B2VC 1E3PA 3E3XA 4POGA 5AEKB 3ZJUA 4GOPA 4WRDA 1K28A 1DONA 2BF8B 1J8CA 2IW3A 2OT2A 4A3DB 5JHAA 4MJSB 5CGKA 1YN3A 5TR5A 1JWSD 5JPMC 3VFKA 5DPSA 3I57A 1E1OA 2QEJC 1RF2D 2K14A 4ZK9B 4RM8A 2DJGC 3CCSA 2Z4IA 3JW0X 4EEWA 4IOAA 2RQXA 3VAWA 4TUUA 1GKHA 2B2UA 1X3FA 3ZUNA 1VCBA 1QOHA 2UU7A 1JQYD 4JW0A 2F0JA 2N9PC 2NPTA 1MJCA 3A5UA 2M9VA 1LTSD 4K2KA 4HIMA 1XQQA 2ACZB 5DAUA 5ELFA 3UDXA 1SMYC 3QO2A 2VB2X 4X3TA 5IT9E 1Y1VH 2VUMG 2A19A 5IN7A 4XYQA 2GBJA 4FF3A 1KJTA 1A2UA 2LVOA 1MJDA 1U4MA 1H95A 1HXYD 1KH0A 4YT0B 3MHZA 4ZYSA 2LRWA 2KEEA 3ZNID 4LF4L 2PQEA 3D6CA 5IGCA 1I6HH 1N62A 2YVCA 2FHTA 3PUYA 4JPSA 1R4QB 5J1ZA 2N8NA 1ESRA 4A3JB 2BWES 3SVMA 3RI7C 1NR4A 3RMHA 4EE2A 3QCAA 2NVQB 1N34Q 4KSKC 2PKOA 2K5PA 2RMMA 1TY2A 3ITPA 4OHJA 5FO9B 2RD0A 3MJ5A 1B7YB 1SXTA 4AYBG 2E2JH 1IYUA 3KUCB 4KVGB 2OEOA 2IX0A 2JXMB 3M9BA 2EYOA 3OTOQ 3HM6X 2QF7A 1BCPC 2KDEB 1EQQA 3AFPA 3HOZH 3LWEA 3NHHA 5LMUL 2BE5C 2Q2HA 5CV7A 1YI2A 1C9OA 2MBOA 4YSYB 3S24A 3EQLC 5FLXc 4DV6L 4WQMA 4B0EA 4OX9Q 1G8ZD 3TZUA 2MW5A 1S3OA 3NPPA 3RN2A 5C4ZA 2UU9Q 3U4EG 2L55A 1R4MI 1A3UA 4RH6A 5HG2A 5BYRA 4WJOA 2V1YA 1JB3A 1EZ8A 1D1KA 1Q1OA 1P98A 2GA4B 4K7UA 3A9JA 1FVIA 2SDFA 4IJLA 2B29A 1L0WA 4LWCA 1PDQA 3K5OA 4C3HB 2EPBA 3NZ3A 2G4DB 2BGFA 1PFSA 4WFN3 4JLCA 1Q90A 1XNQL 4NW2A 1E8WA 1MIUA 1N60A 3ZRCA 2QDLA 3ML8A 5DPRA 3I70A 5C4JH 2JEBI 1EWYC 3ULLA 3FKYA 2VH1A 2WB1G 5HHDG 1HUMA 2D3BA 3IFWB 3KVFB 3J80L 4LF7L 2KFKA 1LTRD 1XMOQ 4MACA 3GTGH 3P1MA 4OO1G 4X57B 1LT5D 2K04A 2PIAA 2NZHA 5JPNC 3NE5B 1AP0A 2PZUA 2L3ZA 2MA9B 4ZQ3A 1KLUD 1QOGA 2WP9B 3PGZA 1Q81C 1JW9D 4NJCA 2F0FA 2R7DA 3Q8CA 3SU8X 4A93B 1Z2MA 2DZIA 1Y69U 1VS0A 1QJOA 1V49A 1EEFD 3HOXH 3W1YA 1RTNA 2NPTB 4DXAB 3OG5A 3ZLZA 4X3SA 1JB7A 1EY9A 4NAWB 2L7RA 2AKWB 3QOJA 3PV1A 4A3EB 3B1LX 3HOUG 1QUQA 1WTQA 4N9F4 1VQJA 3HRZC 2ZPNA 1SRUA 5NUCA 2MGSA 5ELNA 4JOIA 1WX9A 5CV9A 1C0AA 4L1BA 3TEYA 3E0EA 1F9JA 2FNJB 3N52A 4CJ1B 1WCMH 3CCUA 1L4DB 1GM5A 3N1XC 4XDDA 2A68D 1A5RA 3I4NB 1HA6A 5I6YA 2M0XA 2OQ0A 1XLPA 4HCPB 4HJ5A 4BKSD 1L0XB 4TVAB 1E0BA 1EIGA 4X6AH 3WOFA 3V3XA 1VZ8A 3STBD 3AU5A 1EIFA 3E6ZX 3CIRB 5E3FA 1SROA 1CFMA 2KNBA 2OXPA 1R4PB 1C76A 1Q10A 3A1QA 4AWJA 4KV6A 3UQBA 5DM63 5D3DA 3TBLD 3PVLA 3GTOB 4A3FG 1IBML 5AZHA 5CHVC 3DM3A 2F0DA 4UDUC 2W54A 1GUNA 3CXCA 4DK6C 2M19A 3H3VH 1DZ1A 1EO6A 3AEBB 5E6PA 3J81L 3PO2G 2N55A 3NJTA 1FFVA 1Z47A 5DCNA 1K83H 1G6JA 2KO3A 4HCSA 4BBNF 4EQOA 5I9PA 2K5HA 1UZXB 4NQLB 2NZ1D 5FK9C 2OQKA 1EY5A 1OXXK 3TMEA 2WXJA 1PDXA 3UDFA 2KOXA 5BYSA 2WXKA 2ZJRA 5ELOA 2DENB 1CSPA 1RODA 2F3WA 2BOSA 2NN6H 4LUZA 3N1ZC 3AEAB 3C19A 1V8CA 5BN5A 2WAQB 4ARCA 3VA5A 3RULA 1WY8A 5IE8A 2XVSA 1Y1WG 3BWUD 3OIPA 4FHKA 1LABA 4R4TA 1FJGL 4DR7Q 2BYTA 2ES2A 3FP9A 3MXNB 2L9HA 1E8YA 4P73A 4DR2Q 2NCNA 1AE2A 4IN3A 2NBUA 1WTHA 1I4GA 2HJ1A 4L5SA 2FIDA 4A75A 4AQYQ 3A33B 4TQUS 1D7QA 1JCKB 1VQIA 3SHLA 1PFDA 3DBRB 1NYRA 2Z8LA 2M4NA 1JWBD 5IYBG 1BXTA 3IT6B 3OMGA 1QZHA 1HR0Q 3AE7B 1TT2A 2IGHA 4JWUC 3W1SC 3DM1A 3HOWG 1IKMA 3NOBA 4UHVA 3EFCA 4MM3A 5LLIA 1P7EA 3MXUA 4HN7A 3K5LA 2H88B 5I9OA 1STHA 4DV6Q 5JOBA 4XWTA 4DK1A 2K39A 2DLBA 1OO9B 4FYDA 1WGDA 4KGTA 4FA6A 5ELBA 3Q14C 2CKZB 3AXCA 3PUXA 1YZ6A 3F1ZA 4ABNA 4FNFA 4NXNL 4WURA 4LDTD 2MO1A 1G2SA 2EKEC 4IO9A 3CPWA 2K28A 3SK6A 3CAMA 4PQXA 1NJIC 2IDYA 1PZID 1FIQA 2KWCA 1N34L 1ENAA 3CC4A 2WDRB 5LXIB 1WJJA 2K1BA 1FEHA 3K7AH 3O13A 1N32Q 5C0XI 4A3BG 2UXCL 1CZPA 1N33L 1TY0A 4MJSA 5G3LF 3TN2A 1EFID 3A9JB 3TUOA 1UWVA 1W3SA 3SK8A 2RR9A 3EFUA 3VTVA 1CKNB 1TVXA 3CW2C 5HURA 4GDKA 4CKEA 3FKIH 5D7GA 1JRUA 2JZ3B 1WI0A 3ZNZB 1K0SA 2B63G 5IOIA 1OFFA 2F0GA 2BB5A 1RCVD 4BKGA 1CA6A 3JVZX 2BYVE 1PH6A 4G7OC 1H9JA 3UF8A 1E8ZA 3ECIA 4RCOA 3AMUA 3RZFA 3S2HH 2HJ8A 3H91A 2JRIB 5E1FA 4B3SQ 3RCZA 4S17A 4YSZB 3OLMD 1EQTA 3R2IA 1Q1BA 1ENFA 1KD1C 2O5IC 3TEXA 3RD2A 3RFZB 1II3A 4KZ0A 5C3EH 4JI4L 4CBVA 4IM0A 4DR4Q 3PREA 3DBSA 5EE1A 3I4LA 4BXXG 4N58A 1JJ2A 3P2BA 3VR8B 4XDXA 3A5ZB 4LLGM 4N6EB 4A3LH 5JJIA 2XGTA 1Q0WB 1YVCA 1X3PA 3UE0A 5BMHA 3TP7A 4FJZA 3UIPB 3A1QB 5M3FG 2AX5A 4MDKE 2KFKB 1CHQD 4A6QA 5C3XA 1YIJA 3MEHA 1WTXA 2RPVA 4IPGA 4LF7Q 2HDLA 3HG9A 5L95C 1I35A 2F0OA 1S4ZA 1TT5B 3PZDA 1WJNA 1ZUD2 2BVCA 3QX1A 2BH2A 2MJDA 2D0OA 2OTLA 3P4RB 2JYOA 4XT3B 3F2BA 1NEKB 2ASQA 4XWWA 2CVRA 2WV6D 4MHEA 3AE5B 4PT5A 1F9PA 1SN8A 2M1MA 2XWJB 2KTFA 4K5XA 4DV3Q 1S5CD 4FJVB 1HCZA 1Z6HA 2NB0A 2RVLA 3C3LA 4X66L 1VLBA 4HEA1 4DWFA 4XDCA 1T3QA 4A3FB 3S2DH 4XTCS 1M1KC 2Q2IA 2H4OA 4WJ3M 3GB1A 1YITA 2K5WA 1GB1A 1TWHH 2R92B 3J7AF 3K0YA 2CR5A 2K5VA 3QHTA 3T1YL 4AQ7A 1VQ4A 2Y5PA 4IM3A 3NQIA 1A63A 2WXGA 4ICUA 4JWSC 3E9IA 1KF6B 4FJYA 1PLFA 4IDIA 4MGZE 2XNAC 2X6LA 5FLXE 2MRPA 4OONA 3PTFC 1WCMG 2R3ZA 3UINB 1SMXA 3HOXB 2VS1A 2B2VA 4G7ZC 4IW0A 3HZXA 2W55A 1Y8RC 4B3ML 3GZNI 2IWHA 1TWGH 1EL0A 3VYUA 1FD6A 3KQ4A 1TWAB 5GADC 3WAOA 1CHPD 5EBDA 2FMMA 4M0WA 3RUZA 4MZ9A 1IZ6A 4A3GG 2RSNA 3H0GG 3W1GA 3ULPA 4JGHB 1PTOD 4FDBA 2KDIA 4LF4Q 3ALBA 1XX8A 4A93H 4OX9L 5AJ3Q 4X62L 3L54A 1IBXB 3GTGB 1HFGA 5FR6A 4ANXA 1N61A 4DHJD 3K58A 3CF5A 3V60A 3EROA 1EF1A 3MC9A 3CQZB 3S9WA 2A8VA 5EE3A 4DHJB 4DV4L 1B1ZA 1TWCH 3IFTA 1XCTL 3DWAA 4JI5L 1ZGUB 3M85A 1L1OA 4KX6B 4WH4A 3X0WA 1UGJA 1J0GA 4N9TA 2UUCQ 1HA5A 1UBIA 3JSVB 1IL8A 1BUIC 3Q3NC 4C1NK 1EOTA 2A6ED 3U9OA 4WAFA 1XNQQ 2N1WA 2CH4A 3CD6A 3A7AB 2JYTA 3K5MA 2E76C 5EE0A 4YSXB 3ZIMA 1VQKA 3QA8A 2K5QA 3M4OH 2PPHA 3H7SA 2GRIA 1IBXA 3K7AB 5IKCM 4NXMQ 2AL6A 5J18A 2EMTA 2NVXB 1MVKA 2KJRA 4XT1B 1N32L 1MG8A 1Q1EA 5GROA 5CC4A 3J7YW 5BR8Q 3UI2A 3X3MA 3HGBA 3C46A 1XEEA 2R93B 1WE6A 2KCTA 4MIUA 2H89B 1K50A 1NMFA 2HCIA 3JAME 3VUYA 4JI3Q 1WM3A 3ZJYC 4A3DG 2KEDA 1DXMA 2LY7A 3AE2B 1K0RA 2G1EA 2LD9A 1A8VA 1OTCA 2JA6B 3S1NH 2D11A 2SNMA 1ZXIA 4LAAA 4DV1Q 1WTOA 2MP2B 3A4RA 1EU4A 2DAFA 1SF0A 3NUHB 1HNWL 3PUWA 1E7PB 5GAGC 3GQBA 4DK5A 4OWWB 1HTQA 1LUZA 1TWHB 2R92H 2BYFA 1HZ9A 2L12A 1JICA 3HP3A 2M0AA 2KCCA 3TEHB 1AN8A 1KXLA 3NZSA 5EDSA 1ET6A 3DLLA 2Z6KA 4LUVA 1LQBA 3G48A 1E2VA 4LK1C 3Q8AA 1FR3A 3VQIA 1EYDA 4FHJA 4TMAB 1SSOA 3RUIB 2EE1A 3VH3B 5FO8B 4BY7G 1HTLD 4C3JG 3BZKA 2WACA 4OEMB 1EOVA 1SYGA 2LGYA 3TDQA 1CZWA 4KY7A 3M3YH 1IBLQ 3OWFA 2YV5A 2G5DA 5CTRC 3LX0A 2J42A 1MSGA 2LGSA 1HZAA 3K6OA 4NKLA 1T0RC 4IM2A 1JROA 3TMPB 2B2YA 2MJ3A 2OOBB 1ZKOA 4KI0A 2SOBA 1MFWA 1CQVA 1VQAA 2ZCBA 1K52A 5FLMH 4WQOB 1ILPA 3DCGA 4QAYA 1I94L 5IGGA 2I46A 3VYTA 2LFNA 4C3JB 3BS1A 2GVAA 3WA0A 4JI0Q 4KJOA 4KK7A 4OIJA 2DY8A 1EUVB 2LGIA 4I6NB 2IO1B 1SB3C 2VW9A 1OQRA 2QHOA 1I94Q 5C5LA 5LL6S 1IBKQ 3I5JC 3UI3A 3VR6A 3P7JA 1E7ZA 1EWCA 2CQAA 2VZAA 3PIPA 1FM0D 3BDLA 5HI1A 1TTNA 2J7ZA 2XWBB 3MWYW 4GLAC 3W5OA 1PVOA 1WXSA 2WXOA 3NZUA 4N59A 3AQQA 3I72A 1SFOB 5M5XH 4BY1H 2JU6X 1C9FA 4YTPB 4RAUC 4R4IA 3I63C 4B3RL 4LDTB 5LXHA 4CKBA 4M00A 3H6MA 1WCMB 2CJOA 1FL0A 4FVMA 4L5RC 4LFBL 1X3GA 1X9NA 2ZW0A 2FIFA 4TV3A 1PGBA 2EYFA 2WX0A 3NELA 4US8A 4ASWC 5D65A 4C3IB 2A6EC 3Q8EA 4LF6Q 1Y8OB 2E2IH 3OSOA 2D62A 4A3EH 5GMVA 3MXGA 4K81A 4UP8A 3LGJA 1I4XA 4IALA 3W3AA 3TS0A 1F52A 3ETRA 1GD7A 4GN5A 1VDZA 3RNBC 2EJFC 1IYFA 4NJ7A 3VDYA 1N6ZA 2N3SA 3EFXD 2BE5D 3KUDB 2JA9A 3QG1A 4X64Q 3KWVA 4IUMB 3VUWA 2LMCA 5CYUA 2RDHA 4B9WA 1PZKD 2ZEQA 1O7LA 2CH4W 4CYEA 3NQTA 1J7BA 2OCEA 3KOJA 4P1CC 2GI9A 4W9CA 1XPUA 4KTAA 3HOWB 1P7FA 3L0WB 1EUJA 1YNJC 1WRDB 2N1VA 2F0NA 2K22A 1QUQB 3Q3OC 4Z9CB 2E2JB 3KH0A 2KMMA 1CZGA 3AEFB 1AW7A 2LXAA 3AEEB 2L1BA 1AZQA 3GTMH 2BT6A 1FRRA 1GC7A 1WIAA 2L52A 2KC2A 1EYCA 1I42A 1NTGA 3Q23A 4US9A 4R9WA 3JAML 3I4MG 4GMVA 5DNFA 5JEAG 3GTPB 4A3JH 2Y0SG 1PH5A 3PLUA 4OXPA 2EXZA 5J2RA 3U7ZA 2WXIA 5LL6X 2J4XA 4C1NI 4ZOHC 3CU7A 3F2DA 4CQNA 4LF5Q 4YWMA 3K57A 3J81j 2DWQA 4U68A 1CJEA 1L0VB 2WINB 3S17H 1OXVA 3OMCA 4KHPL 3NTIA 1EY0A 1U4PA 2QGQA 4I7ZC 2ONQA 1GJZA 3NS8A 2L05A 4BBSB 3M62B 1SNMA 2LMCB 3MXPA 5I2XA 1SIJA 2LXCA 2L00B 2B39A 2RSOA 1HE8A 2JN4A 1R4MB 5IYDG 4RGNA 2ZTCA 3G71A 3Q69A 4KD4A 4DV7Q 1A3VA 3S1MB 3HEJA 4DAYA 3BJUA 2PW5A 2GN5A 4DV5Q 2WB1E 3S1RB 1WH3A 1VJKA 1J5EL 1LTLA 1IP9A 3APFA 3PZ8A 4CJ0B 3SK4A 3A8JE 3TZDA 1HNXQ 2WXNA 4A3MB 4P71A 1N33Q 2NUCA 3MFGA 3NSWA 3U9SA 2LVQA 1K3RA 4P74A 5L37A 1S1QB 2Z0SA 2IGGA 3CSFA 4B9KA 2B63H 2KCNA 4A3MH 3ZDMC 4C7YA 2YEPF 2VZKD 5ELCA 1FXIA 1STBA 1A62A 3V2TA 2RHSB 1JE5A 2E2HH 1N8RC 3K59A 3EVQA 4WORA 2ZNVB 1A0IA 1PH2A 2AMCB 1DOKA 3GV6A 5IGFA 4X65L 1KAWA 3E56A 1H8CA 4KY6A 2QDFA 4DPGA 4DV5L 2PPBC 4II3B 3HOYH 3V61A 3KF6A 4AJYB 4RCNA 2F0EA 3DWPA 2P5ZX 1KAAA 5M3MG 3OOCA 2NZOA 1T5XD 1OQYA 1LTID 2JA8H 3PRPB 3L2PA 2M2LA 3I4NH 4JI2Q 3WOEA 4LF9L 4BY7H 1H9SB 2A1AA 2AEHA 2YYZA 1RFAA 4ZCKA 2KDBA 3RNAC 3GTLH 1XF5L 2N9XA 2D07B 4K3BA 2MSED 2D2CC 1WF9A 3T3OA 2PMVA 4GOPC 1B2TA 1D1IA 4MTKA 1JMLA 3Q24A 2O6VB 3KW5B 1ZYRC 4X66Q 1KDAA 1WI5A 1SLJA 3KLWA 4ZRQA 4H0LC 1KRSA 1MBYA 3BINA 3VR9B 1PYSB 2JEAI 3LYYA 3EA6A 4A3CH 1CKOA 3MP9A 2BKFA 3SXHA 3NVZA 2MHJA 2RA4A 3BYTB 2F0VA 4N8X1 2KFJA 4LNNA 1TGZB 2MFIA 2EYHA 5IP9G 5AJ3L 2YEPB 1QVCA 1U4RA 2EXDA 3A55A 4KN7C 1PH4A 1CMXB 2K32A 1XYIA 2B8FA 2N88A 2EZVA 1T0QC 3TP5A 1XD3B 5JEAJ 4LNFA 3UE1A 3HOXG 5C44H 5C4JB 2AQ3B 4JI4Q 3S16H 2LSSA 1C4QA 3K80C 3CWIA 4WWOA 2XK5B 4DU9A 2N0SB 5JVG3 1VQGA 1HR0W 1AEXA 1FD7D 1GXDC 3TP8A 4MSQB 4NQKE 4A3LG 1TKGA 2NMQA 3HKZB 3KF8A 2KTRB 3R8BA 4ZKBB 3U4ZA 1CSQA 2L11A 1QOBA 1TXYA 1ZYRD 3URYA 1YNXA 4C3HH 5C3EG 1RYJA 4W9FA 4A3GH 5E4WC 2EIFA 3SFDB 3IKJA 4DAPA 3W5UB 2PNRC 2A74C 4DR3L 4HVBA 4A3FH 4XIGS 3S1QB 1E0ZA 1WR1A 1CQFA 2R2OA 4G50A 1GO3E 1VMCA 1GJXA 4K2LA 2D9UA 2FCMA 3T1HL 3NHEB 2B2YC 2JUOA 1D6EC 2FCQA 1ILQA 1IXRA 3Q8DA 2VB3X 4NJ6A 3FKIG 2XIWA 1E8XA 3W1BA 1P8LA 5EKLA 3OTOL 4RWSC 2HHHL 2OJWA 1FCLA 5KNCA 3QC8B 4ANWA 2R7ZG 2KMAA 4B08A 4CDEC 3RLNA 3E9SA 4K7SA 3KLRA 4F88A 1QVGA 3L08A 2YU9H 2JA7H 1BBWA 1FPYA 1YQBA 4MNOA 2WDTB 4WJPA 3Q3JA 2EQSA 4LF5L 1AZPA 1QOAA 1YHQA 1XNRL 3WAMA 2G3QB 5IT9L 3NVYA 2F52A 4DR3Q 2BBCA 1QCBD 1ACCA 3NK9A 3D4RA 2KQ3A 3I8ZA 2LXJA 1ET9A 2J0JA 2Z1CA 3NY5A 4KZCA 4BAXA 3ULJA 3H15A 5IYCG 1AYFA 1I6HB 5KHOA 1VMPA 1K53A 4EOYA 1UEBA 4M8MA 1PV4A 1X55A 4H7BA 4ANUA 4R4QA 1WVLA 4PZ6A 3Q22A 3IT4B 1LT3D 1WOCA 1Y14B 3HOUB 3PLVA 2JRHA 4FLHA 3M7NA 1HTPA 2PNHA 4ME5A 2Z0EB 3OW2A 1C4CA 4ANVA 2HIVA 3M63B 2Q8RE 3J7ZC 3LJ3A 4JI7L 2BDNA 3CCQA 1OGWA 3MTNB 2K5DA 1YNND 3U50C 3DOWA 4K7WA 4KSLC 5D2MB 2HIXA 3UQAA 2ZT9C 2I0QA 2L0TA 3GTMB 1YX5B 4IPDA 2LFIA 4X3UA 3K81C 1EZ6A 3KWLA 2F0UA 2R6GA 3SR1A 2KDMA 4P7IA 5T1GA 4Q2JA 1K83B 2PE6B 1I3QB 1DGSA 2F0SA 4IUNA 4B9XA 4J8QA 3Q0AA 2IO2B 2JA7B 5HKHA 3U7DA 1V6EA 3OWEB 2NBVB 2V4DA 3S1NB 4HLEA 4X65Q 4AIMA 4HIKA 4EFOA 5G3LD 1JT8A 1YX6B 5KEEA 1YNJD 1P3QU 2PVGC 1UELA 4ZHPA 4YTMB 4WWPA 3T3NA 4QB4A 1KTKA 2XBBC 4YWKA 3LXFA 2DZMA 3TEZA 1X6OA 3ZGZA 1JMCA 2K3UA 4A76A 5A2QL 2EYPA 5T1IA 4DUYQ 1YMHE 2KVRA 3MJWA 4I6PA 2I2YA 2IL8A 4FN2A 1NVID 3ZJTA 1VQFA 2ZCCA 3I90A 4JBJA 1Z5SB 3VDZA 2N9EB 2VY3A 1ISNA 1AE3A 4CKCA 1XMQQ 1EIHA 4YY3Q 2FUG1 4EZJA 5IIFA 3PS6A 2PW9A 4GSWA 3E0JA 1UBQA 3V6EB 3MZ5A 3U52E 1JJCB 1WR6E 5KYIA 5EPLA 1E7UA 1TQOA 4KGSA 2OWOA 1WFYA 3C1EA 3S14H 2KHWB 2MUYA 2WQYB 5D14A 1S3SG 4GS3A 1BBUA 4XYOA 1IW7C 4YCVA 1GUTA 4GLSC 3S15H 3BK1A 4EZLA 4ZRZA 1PFBA 1VQPA 2QSDA 1V9PA 5DM73 2YTYA 2L15A 2WXFA 1D3ZA 1Q86C 5M5YB 3PIP3 4L63B 5F2DA 2KX3A 2F03A 2IX3A 5ELDA 2LJIA 1LV9A 2RHQB 4IOCA 2MQJA 2NTSA 5LMNW 4BKSA 1TKEA 4OWTB 3ND9A 4AH6A 2KKCA 4B3TL 2NS5A 1B50A 2RGFA 3AFQA 1KC8C 3AYHB 5IWAQ 4IPHA 4NP5A 1ASZA 2BA1A 4FP5D 4IWQA 5JVH3 2K9XA 1LO5D 3RN5A 3QWNA 3A4SC 1TWAH 2EMSA 3PO3H 5FO7B 1TWGB 1F2YA 1SNQA 2DYBA 4DV0L 1K8AC 2NWGA 1XMOL 4B95A 1R7SA 4RMFA 3DWMA 1B53A 4RKBA 3GTKH 3N32A 2J52A 2QDBA 1ZKHA 3N20C 2BH8A 1F9QA 5K5PA 1STEA 4AQYL 2AWNA 4ILWA 3FILA 5JJLA 1I50B 2EYMA 4IUQA 3NG0A 5IYBH 2R93G 2IHEA 2BS3B 4II2B 1J19A 4HROA 2EY6A 3KK7A 1R4NB 2F1MA 2ZW1A 1K51A 1WFQA 3DEPA 2VZKB 1ONLA 3M7GA 4G0NB 3RZWC 2JPHA 5C1ZA 1NNXA 2RCFA 3D8GA 3I4MB 2JZPA 5H92C 3CKIB 3VVWB 2KACA 3DBRI 3Q6SA 5C3WA 3DDCB 3X23A 4DDGD 5JH5C 3IL8A 1FXAA 1TWFH 1WYGA 2K25A 3KDFA 1G91A 1JE4A 4XYCA 2B2WA 1YJ9A 4FADA 2AUKA 1QLBB 4XQJA 3A9KA 1GG3A 5JXVA 3HOVB 2RDFA 2DAJA 3I4NG 4DNTB 3QJYA 3K9OB 3WANA 3BVZA 1KRTA 1L1OC 4N9PA 4BWGB 1STGA 5LNK1 4KDLB 3J80c 2A69D 1WXMA 1N9WA 2MH7A 1C3TA 4HSVA 1BO0A 1Y56A 2WU2B 1ZDVA 3NWTA 3T4AC 4O0AA 1KHIA 4HJ7A 3IAYA 2KLGA 4TKOB 4HKQA 4MELA 1PGAA 3GZNB 4LFAQ 4ALPA 4TKNA 4JI5Q 3KJOA 1IHZA 2SEBD 4JI8L 2RDBC 2KWUB 4A3KB 2F0HA 1W6JA 1AH9A 1GUAB 2Z0DB 3UIOB 2JVCA 1IPGA 3P4QB 3MA2B 3PIOA 4IUUA 4DV2L 2HUGA 5JJKA 4W9LA 4DR1Q 2AQ2B 2HD3A 2WS3B 1D5XC 3IBEA 2QA4A 5EE9A 4NZLB 4R1JA 2IY0B 5C2TB 4OWXB 2MX2A 3KDFB 4NPNA 3MC0B 2Y5BB 1PFNA 2O4XA 1H9KA 3AE3B 1YJNA 1I4PA 1N63A 3BG3A 3BDCA 3GTPH 2DJFC 1IW7D 4C3HG 3RZOB 4P1BC 2KHIA 2R92G 2KA7A 5C0XJ 1C1YB 1WXVA 4DGZA 1KFYB 3CQZH 2AUJD 4L2YA 4LNQA 3ZXRA 4S3SA 2V1CC 4A3IG 2N7EA 3EUB2 3PF5A 1BNZA 1F2MA 2KD0A 2UU9L 4GB9A 3GDEA 1GHKA 2LUMA 5JAVA 5DPWA 3AN1A 4BZAA 2MP2A 3S2AA 1MPEA 4DR1L 1VZ6A 5ELEA 1YJ1A 2FXQA 3Q3FA 1CKMA 4GOPB 4IURA 4BOSC 3IVFA 3P63A 5LMUQ 5IP7G 1WGKA 3QOLA 4W9JA 4C4VB 2LRUA 1X54A 3T13A 1T5EA 4K6DA 2WU5B 4IPCA 1WTRA 1SJHD 1GUWA 2O2VA 1PTOC 3J81c 2E6XA 2INNE 1TYGB 1RD9D 3L9AX 1C48A 4R8IA 3BZCA 4PNYA 2B8GA 2NVQH 5GAHC 3L3OC 4HJKA 4ICVA 1YQ4B 3JYUA 1KDBA 1P1AA 3WALA 4NAWA 1HJPA 1QF6A 5EKKA 4PYUA 4L8JA 3VH4B 3RN9C 3J80i 2BTEA 2JT4B 3B9JA 1A15A 4V190 1RM6C 2PJHA 3L17A 1V5OA 4WIPA 3I3TB 1A6XA 2CU3A 2LASA 4PS8A 3ZVVA 3G6EA 2B2TC 2I5MX 3HKSA 2J0TD 1ESFA 5CR3A 2K0PA 1N36L 4IQZA 3T16A 3VR3A 2EY1A 1SAPA 4I7AA 4C2MB 3M4YA 5M5XB 2KK8A 5LMNQ 2JA5G 4ZAIA 2Y3AA 1MKHA 4DN4M 1XPOA 4B3MQ 4MM3B 1VQEA 1K3BC 3KLSX 1XWEA 1KNEA 2VL6A 3ZQ4A 5C4XB 2D0PA 2K8HA 1VCIA 2D2QA 2NVUI 1S5BD 2WXQA 2CHBD 4QIWE 4IOIE 1PA6A 4HJ9A 4IFDG 4ZRPA 1UE7A 1SE4A 5KNBA 4DHZE 1X56A 2KJXA 4EQNA 3HOYG 3DHIC 5BYQA 3SHQA 5IOCA 4GNXB 4GNXC 1KL9A 4K14A 1EFWA 3PO2B 5G2NA 1UE6A 4A3PA 3CMEA 2IT1A 4A3MG 1QKZA 2K6DB 4FXGC 3MXNA 3CC2A 1ICFB 2WP8J 2JZZA 4A3DH 1RJTA 3D4DA 4HJAA 3PRMB 3IFDA 4GGQA 4JOIC 5FJ8G 3FILB 2ICIA 2IO3B 4HCEA 1PH3A 1NI2A 2KWVB 1VF5C 3A56A 4QJFA 2PLPA 4DK0A 2INDC 4K1RB 2GBRA 5GAEC 4JV5Q 2I5LX 4A8XC 4K5VA 3WWVA 1DCZA 3J9CA 1NY4A 3HOYB 5IYCH 4H44C 1FJGQ 1VQDA 4DR7L 1WJ4A 3GTQH 1KQSA 2KVZA 3GE8C 3QR8A 4JBMA 1TIFA 2J53A 2XK5A 4OELB 4W9EA 2CQOA 4FBJB 4X64L 1WJ6A 1NUCA 3NBHA 4XGAB 5FR3A 1RLFA 4KV2A 1F9RA 3PUZA 4A3KG 4RF1A 3A7LA 3VYRA 3RLFA 4KDIC 2G9DA 2GBKA 3FEWX 2ZTEA 2MBEA 2WX1A 3HUIA 5KNDA 3RT3B 3U4VA 5M3FB 2KUMA 3SE0A 2JA7G 2AYOB 4LK0M 2G45B 5E6OA 1XT9B 2VH2A 1LACA 4UAIA 4ZRIA 3RPFC 3W9CB 4QF4A 1S5FD 4FF1A 1XO3A 1YN4A 1BDOA 2SAKA 4A90A 5EJWA 2W3RA 1J9OA 2R61A 3AMZA 2UXDQ 4QCLA 4PZ7A 5J3BA 4DNIA 1VQ9A 3NEMA 5CV6A 1XLNA 1SE3A 3EBEA 3S1RH 1ZEQX 4GKJQ 5M3MB 4IFDJ 4MGKE 4F8CB 1JQ4A 3DUZA 1UWXA 1D2BA 3SD5A 3PIO3 2NBWB 3U30A 5A35A 2IBIB 2FFKB 3CF6E 4KJNA 4JYAL 1YN5A 4CDCC 1IYVA 2JWUA 2LHDA 1KIXA 1NBFC 2K5NA 1HFNA 3NENA 1O7ZA 1Q46A 4DUZL 1BQQT 2CHXA 3K8AA 1HQRD 1C79A 4BBRH 5KIXA 5IY0A 4YXDB 4C3IG 4MN3A 1I4QA 1IUEA 3Q2AC 1B9MA 2JQRB 2OHFA 3V6CB 4GLXA 4DR6Q 1E90A 4EZKA 3H09A 2EJGC 4KKTA 3A74A 5LHY1 4I65A 2KC1A 3H7PA 2XN9C 2BW2A 2UUAQ 1C4PA 3NUCA 1UNSA
chains in the Genus database with same CATH topology
1G2TA 2WIIB 2NYZD 1TS4A 3H8HA 3NBIA 1LLRD 2C9OA 2M56B 4GDLB 3F2UA 2EOTA 2K03A 5I4DA 5IGEA 1STNA 1EQVA 4IFDI 1BBXC 2L4NA 2KQ4X 3D6WA 1B3AA 3DEOA 3P75A 5EKIA 3H94A 1LT4D 2F0LA 1Q8IA 3I3CA 2PTLA 3I9V1 2K33A 1QE6A 2CW0C 2RKSA 1SYEA 5C6AA 3D31A 2N7JA 4V0BA 3AE6B 1HZ6A 3VRAB 1EWHA 4RGTA 4OIKA 3VRBB 4KKUA 1LTGD 3MVVA 3A54A 3RZDB 2B76B 4EGVA 1O80A 1BR9A 1Z7TA 4ODGA 1J8IA 5A2QE 2BA0A 2GB1A 1K8OA 4PV1C 2M00A 4R3DA 4ZUJA 2R7ZB 1A2TA 1CTMA 2VUMB 1L0YB 1MD2D 5C5MA 1FYCA 4RA8A 1BUVT 4K5WA 4RHSA 1UAPA 1GPXA 5H8YE 4P16A 2FMCA 1DOYA 3ERQA 2E3TA 3NRZA 2E75C 4D2KA 4XE0A 1BOSA 4XQQA 3ND8A 1QNUA 1M8AA 4R8NA 3AE8B 4KKSA 1MI2A 3WDNA 1NCVA 1F2LA 1CK1A 1LTBD 4ULLA 1DOMA 2EDGA 4REZA 2Q8TA 1PXUA 2WDQB 4LMQD 2A73B 1PRTB 4A3IB 2EKIA 4OL7A 3FAHA 2OF1A 3L4PA 1JWMD 3LB8C 2F0QA 3C1FA 1X32A 1EYAA 1T6BX 1S5ED 2BS4B 1HQMC 1C77A 2ON8A 4Q0FA 4RF0A 1ICWA 4IKGA 3Q8FA 1GUOA 4G7HC 4CJ2C 1ENCA 4P2CB 5D3IB 1RHPA 3R3OA 1HZ5A 1FNUA 1SYFA 1TS2A 3HOZB 2KN4A 4RKLA 1JR0D 3PO0A 4FXCA 4TQ0A 2ENBA 1TWFB 4YWGG 3EJIA 3P42A 4QUCA 1S5DD 4FO2A 2DYMA 2B2UC 1NR2A 2WXLA 2NVTB 4DFAA 4A3GB 1FGBD 2JA5B 1QOFA 1DYQA 5I6WA 2X6GA 2WXPA 2F0TA 4AS1A 1GHJA 2BDOA 1WXQA 3B2FA 5CV4A 1C8CA 4OZBA 1KRHA 1IGDA 3GTKB 4WJWA 4ZHOA 4EVOA 2F0WA 4ITKA 2MHVA 3OW7A 3GTJB 3AM9A 1YNNC 1TS3A 3BZDB 1F2ZA 3V96A 2Y5CA 2ZXPA 1NI3A 4H2AA 2KOLA 1TS5A 2B2WC 1L4ZB 5HFYA 4LTUA 1NENB 5MPOA 1CA5A 2KWDA 2WXMA 3GD7A 3TP6A 1FNWA 2D5GA 5I2YA 2A5HA 2WKCA 4XQNA 1V1PA 1JC7A 2PO4A 4DXFA 4OVZA 1LTAD 5IGDA 2WNMA 3T53B 1PTOB 2Y0SB 4F87A 2QMTA 3FPUB 1JOQA 1F77A 1WTPA 1O7YA 4RHRA 4O42A 1G291 1K8MA 1XLQA 3VYSA 1FCCC 3PZ7A 2ZXOA 2F0IA 1RDPD 2F0KA 2ICEC 1DD2A 1D4BA 2MJ8A 3NTKA 5EGTA 4A55A 4JX1C 3PUVA 4X3KA 1TU2B 3AEGB 2E2HB 4BY1B 4NMZA 4RNAA 5COYA 4IFDH 1SNOA 3LNNA 2A6HC 2E74C 1KDCA 2KECA 1QB5D 4HEDA 1ZXTA 4HJGE 1WTWA 5JJZA 1VF7A 4DA2A 2QCPX 3VR4A 4ZKCB 3TEWA 3PMFA 5FLXL 5K36H 4OO1I 3NS1A 1HEZE 3BDOA 1KABA 2NN6I 2JSVX 3TSSA 2ID0A 1B9RA 1QWYA 1STYA 2WXRA 3AECB 3NTHA 4Y7NB 1AWDA 1SDFA 2WXHA 1RKNA 4E6IA 1NAPA 1E6EB 1W6KA 3P4SB 3IAM1 1MHHE 5J39A 2PMZB 2L5TA 1SMYD 4HRSA 3H0GB 1SJED 3MHBA 1I7HA 2RDGA 4QIWB 2V3NA 3C2PA 3AEDB 5EPJA 3HRDD 1YNTE 2K01A 2HDMA 2QKIC 5J22A 1F2RC 1L6VA 3BVGA 4M1UB 3LWUA 1JOKA 5CMDA 5KGUA 4C56C 4TQ1A 1U4LA 2NN6G 5CV8A 5CV5A 5KYLA 4YIJA 4HMJA 2DYOA 3HS0C 1A3TA 5ISRA 2IJ0A 5M9OA 1BMLC 1I6VC 4IUTA 4BA1I 1L5PA 1XCQL 2MJEA 1E10A 1TZOA 3KBXA 2PW7A 1TR5A 2F4IA 4Q5VA 2PYKA 1PRTD 3FVQA 4GDKB 5FKAC 2Z4HA 4F8MA 1JOOA 1ZE3D 1DGJA 1WSPA 1DJRD 1G6ZA 1C78A 3E5SA 1MHXA 4OGQC 4IUVA 2I07B 1ZXHA 5C4HA 3OIQA 4USAA 2JE6I 2JX5A 1V1OA 1STAA 2OEDA 2QILA 3GO5A 1HUNA 5AUIA 4P6VF 3T51B 1QILA 2FE8A 4NAMA 2WLBA 2HCCA 4TSSA 1FNVA 2V3PA 4K6LA 1N5WA 1F2RI 3IXSA 2N9KA 2G9HD 5BYQA 3P1HA 1SSNA 1EEID 1CI3M 5K36G 1YQ3B 4DF7A 2DN8A 2IGDA 3SEBA 3N9YC 4GZYC 2MP1A 2CJNA 2KAJA 4J3OD 2NBFA 3NWSA 1M4VA 3NVWA 2HQEA 1TJEA 3DHQA 3ABVB 1J7AA 1EM7A 2BS2B 4HAEA 1VRAB 3GTLB 4KGRA 1I4HA 4FF2A 4EQPA 3Q8BA 4BY7B 2V4IB 5BN4A 2PVOD 2XRQD 3R93A 4G57A 3VA7A 3MTSA 1GOZA 1I4RA 3W2DA 1D5MC 3S2DB 3H3VC 1J7CA 3EGRA 2BCOA 4QMGA 2FINB 1NYQA 3AE4B 4HR7B 1ZPSA 3K5NA 1DM0B 1A70A 3FRPB 1MGSA 5E6JA 2TSSA 5CORA 1SBBB 1ZOYB 2LS01 4IUPA 3J81E 3N6RA 2EYLA 3QIAA 2IPKD 3KUPA 2A69C 4DNRB 3MFYA 4RFBA 3CRLC 5JEAH 4KY5A 1FRDA 3G6JB 1KNAA 1PGXA 5EQ0A 4DAVA 1MI0A 4QUFA 3M4OB 1AFPA 4O1NA 2K7VA 5KRUA 3FPPA 2LEKA 2DY7A 1B44D 3D4WA 4KMUC 1OXTA 3W5VB 4L23A 1PFMA 4TRDA 4H13C 2HDEA 1QNKA 1FMAD 1N5XA 3GV3A 4JBWA 1JALA 3C8YA 3T56B 2W3SA 1GUSA 4DXGA 4BBRB 5C0XG 1HPCA 3A8KE 4BS9A 4C80A 2PZTA 1Y8NB 4F7XA 3FKIB 4PMBA 2O5JC 2JA8B 4BA2I 2V0GA 2Q5WD 4NDXA 1WD0A 4XXEA 2A6HD 2QJLA 4U673 1SNPA 1SYCA 3ONAB 1RFKA 3BK2A 1V1PB 1ZDXA 2N9LA 4OO1H 1D5ZC 3P20A 4IZ8A 1F0ZA 2VNUD 3J80E 1PUTA 3SK5A 1FFUA 2B63B 1B9NA 4RGMA 4FF4A 2EY2A 2MEKA 1TKWB 1XTCD 1CM9A 2E2IB 2DBYA 5CBAE 2DNEA 1NSNS 1PZJD 5TSSA 1BCPD 3FMCA 2KVMA 1IGCA 3KLSA 2F0PA 2A68C 1R9TB 2K6AA 2EYJA 4L6TB 3VR2A 1H9SA 3BYYB 1YJIA 4ARIA 1TKYA 2MPMA 2NVYB 3GTQB 1EY8A 1OQQA 5BMIA 3S17B 3DXJC 2LHEA 2L83A 3J7AV 2X38A 3NXWA 1XLOA 2FJ2A 3AV8A 3HVZA 1MSHA 1WTVA 4MT5A 1XXGA 4PMWA 3KBGA 3BIID 5EPKA 4HKZE 2QIEB 3HVDA 1UUPA 4KN4C 1VZ7A 1IKLA 2F3VA 1DOXA 3BVMA 1E2WA 4K8JA 1PRTF 2XSCA 4J6HA 3RD4A 2AWOA 2PZWA 5GXGB 4CGYB 5E4XA 2WDVB 1JORA 1UWMA 4FXKC 4OW0A 2NTTA 1X3QA 4J1MA 3AB5A 1PYWD 1EY4A 2Q8IB 4WWMA 3DWQA 1BF4A 2E2DC 2JP1A 2INPE 1Q12A 1V8QA 2LKVA 4DQOC 3G7LA 1V43A 5C44B 1HRJA 1OXSC 3D3RA 5EBCA 3WCQA 4C7ZA 5HGTA 3NVVA 2WB1B 4M8AA 3U2SC 1O78A 3S16B 1RTOA 1TIID 2JSOA 3I91A 5M5WB 4A3BB 2EVBA 5CBEE 2BB6A 1EU3A 1SYDA 1HHVA 1CT1D 1WWTA 3AB9A 1V97A 4CHTB 5AFWA 3OHXC 1SE2A 1PTOF 1H9MA 2ZXRA 3X3NA 1VR9A 2SNSA 2L0CA 1SYBA 3FC4A 2EJMA 3DMUA 1GB4A 2W82A 5BN3A 1GAQB 3M3YB 1BCPB 2VXWA 1JWUD 1EY7A 4K8IA 2TMPA 4JE3B 3AU7A 3W1SA 1B4OA 1U9RA 3FDTA 1DOLA 2H1EA 2CW0D 5C0XH 1LTTD 5T8IA 3ZJVA 3CRKC 1C4AA 1Y1WB 3TBIB 1FO4A 3I73A 2C5CA 2I38A 1ZP0B 3AE1B 2DNCA 1PTOH 2XRSD 4KD3A 1JRPA 2EY5A 4HSPA 5DEHA 4MH8A 2AQ1B 1PMRA 3A8IE 3L7ZC 3NP8A 4LJZC 4KHVA 3MAQA 5IODA 1H9RA 4KHZA 3OPOA 1KLGD 1QQRA 4OZCA 3DWGC 4OZAA 1WD1A 1Y1VB 3P4PB 2IX1A 3SR6A 2L1AA 1OXUA 5IGBA 3VR5A 1Q3LA 2RBMA 4AYBB 2WKDA 4RGOS 1QG7A 1VDVA 1QT9A 1GUGA 2B2TA 1L6UA 2JXTA 5BMGA 1RWSA 1EY6A 5G5HA 2X69A 3SFEB 2EELA 2YU9B 3PO3B 1JWAD 1Y8PB 1SEBD 1TWCB 4HMIA 4HTHA 2D5DA 1DOIA 3SDZA 1ML0D 5FOBB 1PRTC 1WRIA 1YJJA 3S15B 5C3EB 3CHBD 3S14B 4ZLTF 4FXDA 2F0MA 3AH7A 1BCPF 3PV0A 4B0MA 4KKJA 2L32A 3V05A 3S2HB 1E2ZA 1LT6D 4KKIA 3GS2A 2KHSA 5AUKA 4A9AA 1UEAB 3GP7A 1SNCA 4G4KA 4ZUIA 4YTNB 1F9SA 1E9MA 2JYEA 3AE9B 2O2LD 4JK1C 3QB3A 3ZYYX 2PCFB 2FBWB 1SNDA 3B2GA 3IAS1 3R2TA 5G5GA 1ROEA 2K05A 4PMCA 4ID6A 2HTME 2B2VC 3ZJUA 4WRDA 1DONA 2IW3A 2OT2A 4A3DB 5CGKA 1YN3A 1JWSD 5JPMC 3I57A 2QEJC 1RF2D 4ZK9B 2Z4IA 2RQXA 2B2UA 1QOHA 1JQYD 2F0JA 2M9VA 1LTSD 4K2KA 2ACZB 5DAUA 5ELFA 1SMYC 3QO2A 2VB2X 4X3TA 5IT9E 4XYQA 4FF3A 1A2UA 1U4MA 1HXYD 1KH0A 4YT0B 3MHZA 4ZYSA 2KEEA 2PQEA 5IGCA 3D6CA 1N62A 4JPSA 2FHTA 3PUYA 1R4QB 5J1ZA 1ESRA 4A3JB 3SVMA 4EE2A 1NR4A 3RMHA 2NVQB 2PKOA 2K5PA 2RMMA 1TY2A 3ITPA 4OHJA 5FO9B 3MJ5A 1SXTA 1IYUA 2OEOA 2IX0A 2JXMB 2EYOA 2QF7A 1BCPC 3LWEA 3NHHA 2BE5C 5CV7A 4YSYB 4B0EA 3EQLC 4WQMA 1G8ZD 3TZUA 3NPPA 5C4ZA 3U4EG 2L55A 1A3UA 4RH6A 5HG2A 5BYRA 1JB3A 1EZ8A 1D1KA 2GA4B 2SDFA 1PDQA 3K5OA 4C3HB 2EPBA 3NZ3A 4WFN3 1Q90A 1N60A 4NW2A 3I70A 2JEBI 1EWYC 5HHDG 1HUMA 3J80L 1LTRD 4MACA 3P1MA 4OO1G 1LT5D 2K04A 2PIAA 5JPNC 3NE5B 1AP0A 2PZUA 4ZQ3A 1KLUD 1QOGA 2WP9B 1JW9D 4NJCA 2F0FA 3Q8CA 4A93B 1Y69U 1QJOA 1EEFD 1RTNA 4X3SA 1EY9A 4NAWB 3QOJA 4A3EB 1WTQA 3HRZC 5NUCA 2MGSA 5CV9A 4L1BA 3TEYA 3N52A 4CJ1B 1L4DB 4XDDA 2A68D 3I4NB 1HA6A 5I6YA 1XLPA 1L0XB 1E0BA 1EIGA 3WOFA 3V3XA 1VZ8A 3CIRB 3E6ZX 5E3FA 1CFMA 2OXPA 1R4PB 1C76A 1Q10A 4KV6A 5DM63 5D3DA 3GTOB 4UDUC 2F0DA 2W54A 1GUNA 2M19A 1DZ1A 3AEBB 3J81L 2N55A 1FFVA 1Z47A 4HCSA 4EQOA 5I9PA 2NZ1D 5FK9C 1EY5A 1OXXK 3TMEA 2WXJA 1PDXA 5BYSA 2WXKA 1RODA 2F3WA 2BOSA 2NN6H 3AEAB 1V8CA 5BN5A 2WAQB 4ARCA 3VA5A 2XVSA 3BWUD 3OIPA 1LABA 2BYTA 2L9HA 4IN3A 1I4GA 4TQUS 1JCKB 1PFDA 3SHLA 1NYRA 2Z8LA 1JWBD 1BXTA 3IT6B 3OMGA 3AE7B 1TT2A 2IGHA 4JWUC 3DM1A 1IKMA 1P7EA 3MXUA 4HN7A 3K5LA 2H88B 5I9OA 1STHA 5JOBA 4XWTA 4DK1A 2DLBA 1OO9B 4FYDA 4KGTA 5ELBA 3PUXA 4ABNA 4FNFA 4WURA 1G2SA 2K28A 3SK6A 4PQXA 2IDYA 1PZID 1FIQA 1ENAA 2WDRB 2K1BA 1FEHA 3O13A 5C0XI 1CZPA 1TY0A 5G3LF 3TN2A 1EFID 3TUOA 3SK8A 1TVXA 5HURA 4CKEA 5D7GA 1OFFA 2F0GA 2BB5A 1RCVD 1CA6A 4G7OC 1H9JA 4RCOA 3AMUA 3H91A 5E1FA 4YSZB 1EQTA 3R2IA 1Q1BA 1ENFA 2O5IC 3TEXA 3RFZB 1II3A 4CBVA 5EE1A 3I4LA 4N58A 3VR8B 4XDXA 4LLGM 4N6EB 5BMHA 1X3PA 3TP7A 2AX5A 1CHQD 4A6QA 5C3XA 3MEHA 1WTXA 2RPVA 2HDLA 3HG9A 2F0OA 1S4ZA 1ZUD2 2MJDA 3P4RB 2JYOA 4XT3B 1NEKB 4XWWA 2CVRA 2WV6D 4MHEA 3AE5B 4PT5A 1F9PA 2XWJB 4K5XA 1S5CD 1HCZA 1Z6HA 2NB0A 2RVLA 3C3LA 1VLBA 4HEA1 4XDCA 1T3QA 4A3FB 4XTCS 2H4OA 3GB1A 2K5WA 1GB1A 2R92B 3J7AF 3K0YA 4AQ7A 2Y5PA 3NQIA 2WXGA 4JWSC 1KF6B 4IDIA 1PLFA 2XNAC 2X6LA 5FLXE 2R3ZA 3HOXB 2B2VA 4G7ZC 3HZXA 2W55A 2IWHA 1EL0A 3VYUA 1FD6A 3KQ4A 1TWAB 1CHPD 5EBDA 2FMMA 4M0WA 3RUZA 2RSNA 1PTOD 1XX8A 1IBXB 3GTGB 1HFGA 1N61A 3K58A 3EROA 3CQZB 3S9WA 5EE3A 1B1ZA 3IFTA 1XCTL 4WH4A 3DWAA 3M85A 4KX6B 1UGJA 4N9TA 1HA5A 1IL8A 1BUIC 4C1NK 1EOTA 2A6ED 3U9OA 4WAFA 3A7AB 2JYTA 3K5MA 2E76C 5EE0A 4YSXB 2K5QA 2GRIA 3K7AB 2NVXB 1MVKA 4XT1B 1Q1EA 5CC4A 3J7YW 3C46A 3UI2A 3X3MA 3HGBA 1XEEA 2R93B 4MIUA 2H89B 1K50A 2HCIA 3JAME 2KEDA 1DXMA 2LY7A 3AE2B 2G1EA 2JA6B 2SNMA 1ZXIA 4LAAA 1WTOA 1EU4A 1SF0A 3NUHB 3PUWA 1E7PB 3GQBA 3AN1A 1TWHB 2M0AA 2L12A 3HP3A 1JICA 2KCCA 1AN8A 1ET6A 1E2VA 4LK1C 3Q8AA 1FR3A 3VQIA 1EYDA 4TMAB 1SSOA 2EE1A 5FO8B 1HTLD 4C3JG 2WACA 1SYGA 3TDQA 1CZWA 4KY7A 3OWFA 3LX0A 2J42A 1MSGA 3K6OA 4NKLA 1JROA 2B2YA 2MJ3A 1ZKOA 4KI0A 2SOBA 1CQVA 1K52A 1ILPA 5IGGA 2I46A 3VYTA 2LFNA 4C3JB 3BS1A 4KJOA 4KK7A 4OIJA 2DY8A 2LGIA 1SB3C 1OQRA 5C5LA 5LL6S 3UI3A 3VR6A 3P7JA 1EWCA 2CQAA 1FM0D 5HI1A 3BDLA 2J7ZA 2XWBB 3MWYW 2WXOA 4N59A 3I72A 1SFOB 2JU6X 1C9FA 4YTPB 4RAUC 4CKBA 3H6MA 1WCMB 2CJOA 4FVMA 2ZW0A 1PGBA 2EYFA 4US8A 5D65A 4C3IB 2A6EC 3Q8EA 1Y8OB 3OSOA 2D62A 3MXGA 1I4XA 4IALA 3W3AA 3ETRA 1VDZA 2EJFC 3EFXD 2BE5D 3QG1A 3KWVA 2LMCA 5CYUA 2RDHA 4B9WA 1PZKD 1O7LA 3NQTA 1J7BA 2GI9A 3HOWB 4KTAA 1P7FA 1YNJC 2F0NA 2K22A 4Z9CB 2E2JB 2KMMA 1CZGA 3AEFB 1AW7A 3AEEB 2L1BA 1AZQA 2BT6A 1FRRA 2L52A 1EYCA 3Q23A 4US9A 4R9WA 3JAML 5DNFA 5JEAG 3GTPB 2EXZA 3U7ZA 2WXIA 5LL6X 2J4XA 4C1NI 4ZOHC 3CU7A 4CQNA 3K57A 2DWQA 4U68A 1CJEA 1L0VB 2WINB 1OXVA 3OMCA 3NTIA 1EY0A 1U4PA 4I7ZC 2ONQA 4BBSB 1SNMA 2LMCB 3MXPA 5I2XA 1SIJA 2B39A 2RSOA 4RGNA 3Q69A 4KD4A 1A3VA 3S1MB 3HEJA 4DAYA 2PW5A 3S1RB 1VJKA 3PZ8A 4CJ0B 3SK4A 3A8JE 3TZDA 2WXNA 4A3MB 2NUCA 3MFGA 3NSWA 3U9SA 2IGGA 2KCNA 4C7YA 2YEPF 2VZKD 5ELCA 1FXIA 1STBA 3V2TA 3K59A 3EVQA 4WORA 1DOKA 3GV6A 5IGFA 3E56A 4KY6A 2PPBC 4RCNA 2F0EA 3DWPA 1KAAA 3OOCA 1T5XD 1LTID 2M2LA 3WOEA 1H9SB 2YYZA 1XF5L 3T3OA 2D2CC 2PMVA 1B2TA 1D1IA 1JMLA 3Q24A 1ZYRC 1KDAA 4ZRQA 4H0LC 3VR9B 1MBYA 2JEAI 3LYYA 3EA6A 3MP9A 3SXHA 3NVZA 2RA4A 3BYTB 2F0VA 2EYHA 2YEPB 1U4RA 3A55A 4KN7C 2K32A 1XYIA 2B8FA 2N88A 2EZVA 3TP5A 5JEAJ 5C4JB 2AQ3B 1C4QA 3CWIA 4DU9A 2N0SB 5JVG3 1AEXA 1FD7D 1GXDC 3TP8A 1TKGA 2NMQA 3HKZB 3KF8A 3R8BA 4ZKBB 2L11A 1QOBA 1ZYRD 3URYA 1RYJA 5E4WC 3SFDB 3IKJA 4DAPA 3W5UB 2PNRC 2A74C 4XIGS 3S1QB 1E0ZA 1CQFA 1VMCA 1GJXA 4K2LA 2D9UA 2B2YC 1D6EC 1ILQA 2VB3X 2XIWA 1FCLA 5EKLA 4RWSC 5KNCA 4B08A 3E9SA 3KLRA 4F88A 1AZPA 1QOAA 5IT9L 3NVYA 2BBCA 1QCBD 1ACCA 3NK9A 3D4RA 2KQ3A 3I8ZA 1ET9A 2Z1CA 1AYFA 1I6HB 1VMPA 1K53A 4H7BA 1WVLA 3Q22A 3IT4B 1LT3D 3HOUB 3M7NA 1HTPA 4ME5A 1C4CA 2Q8RE 2BDNA 2K5DA 1YNND 2ZT9C 3GTMB 2LFIA 4X3UA 1EZ6A 3KWLA 2F0UA 2R6GA 3SR1A 2KDMA 5T1GA 4Q2JA 1K83B 1I3QB 2F0SA 4IUNA 4B9XA 4J8QA 3Q0AA 2JA7B 3OWEB 2V4DA 3S1NB 5G3LD 5KEEA 1YNJD 2PVGC 4ZHPA 4YTMB 3T3NA 4QB4A 1KTKA 3LXFA 3TEZA 3ZGZA 2K3UA 5A2QL 2EYPA 5T1IA 1YMHE 2I2YA 2IL8A 3ZJTA 1NVID 3I90A 2FUG1 4CKCA 1EIHA 5IIFA 2PW9A 3E0JA 3MZ5A 3U52E 5KYIA 5EPLA 1TQOA 4KGSA 3C1EA 2MUYA 2WQYB 5D14A 4XYOA 4GLSC 1IW7C 1GUTA 3BK1A 4ZRZA 1PFBA 2QSDA 5DM73 2WXFA 5M5YB 3PIP3 4L63B 5F2DA 2F03A 2IX3A 5ELDA 2LJIA 1LV9A 2NTSA 1TKEA 3ND9A 1B50A 4NP5A 2BA1A 4FP5D 5JVH3 2K9XA 1LO5D 3QWNA 5FO7B 1TWGB 1F2YA 1SNQA 2NWGA 1R7SA 3DWMA 1B53A 4RKBA 2J52A 2QDBA 1F9QA 5K5PA 1STEA 2AWNA 4ILWA 3FILA 1I50B 2EYMA 4IUQA 2BS3B 4HROA 2EY6A 3KK7A 2F1MA 2ZW1A 1K51A 3DEPA 2VZKB 1ONLA 3M7GA 5H92C 3D8GA 3I4MB 2JZPA 3CKIB 2KACA 3Q6SA 5C3WA 3IL8A 1FXAA 1WYGA 1G91A 1JE4A 2B2WA 2AUKA 1QLBB 4XQJA 5JXVA 3HOVB 2RDFA 4DNTB 3QJYA 3BVZA 4N9PA 4BWGB 1STGA 5LNK1 2A69D 2MH7A 4HSVA 1BO0A 1Y56A 2WU2B 1ZDVA 3NWTA 3T4AC 4HKQA 3IAYA 4TKOB 1PGAA 1IHZA 2SEBD 4A3KB 2F0HA 1W6JA 3P4QB 3MA2B 4IUUA 2HUGA 2AQ2B 2WS3B 1D5XC 5EE9A 4NZLB 5C2TB 3MC0B 1PFNA 2O4XA 1H9KA 3AE3B 1I4PA 1N63A 3BG3A 3BDCA 1IW7D 4C3HG 3RZOB 2KA7A 5C0XJ 4DGZA 1KFYB 2AUJD 4L2YA 4S3SA 3EUB2 1BNZA 1F2MA 2LUMA 1GHKA 5JAVA 1MPEA 1VZ6A 5ELEA 4IURA 3P63A 1WGKA 3QOLA 3T13A 1T5EA 4K6DA 2WU5B 1WTRA 1SJHD 1GUWA 1PTOC 2E6XA 2INNE 1TYGB 1RD9D 3L9AX 1C48A 4R8IA 4PNYA 2B8GA 3L3OC 1YQ4B 1KDBA 1QF6A 5EKKA 4L8JA 2BTEA 3B9JA 1A15A 4V190 1RM6C 4WIPA 1A6XA 2CU3A 2B2TC 5CR3A 2J0TD 1ESFA 2K0PA 3T16A 4IQZA 3VR3A 2EY1A 1SAPA 4C2MB 3M4YA 5M5XB 4ZAIA 2Y3AA 4DN4M 4MM3B 1XWEA 1KNEA 3KLSX 3ZQ4A 5C4XB 1VCIA 2WXQA 1S5BD 2CHBD 4IOIE 4IFDG 4ZRPA 1IBXA 1SE4A 5KNBA 2KJXA 4EQNA 5IOCA 4K14A 3PO2B 2IT1A 1QKZA 4FXGC 3MXNA 2WP8J 1RJTA 3D4DA 3IFDA 3FILB 2ICIA 4HCEA 1VF5C 3A56A 2PLPA 4DK0A 4A8XC 4K5VA 1DCZA 3J9CA 3HOYB 4H44C 2J53A 1NUCA 3NBHA 5FR3A 1F9RA 3PUZA 4RF1A 3A7LA 3VYRA 3RLFA 2G9DA