4RFBA

1.93 angstrom crystal structure of superantigen-like protein from staphylococcus aureus in complex with sialyl-lewis x.
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
194
structure length
194
Chain Sequence
b'HNYKSLKYYYSKPSIELKNLDGLYRQKVTDKGVYVWKDRKDYFVGLLGKDIEKYPQGEHDKQDAFLVIEEETVNGRQYSIGGLSKTNSKEFSKEVDVKVTRKIDESSEKSKDSKFKITKEEISLKELDFKLRKKLMEEEKLYGAVNNRKGKIVVKMEDDKFYTFELTKKLQPHRMGDTIDGTKIKEINVELEYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title 1.93 Angstrom Crystal Structure of Superantigen-like Protein from Staphylococcus aureus in Complex with Sialyl-Lewis X.
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Toxin
total genus 64
structure length 194
sequence length 194
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rfbA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rfbA01
3BYTB 1HQRD 5TSSA 4RGTA 2QILA 1PTOH 2G9HD 1I4PA 1JWMD 1V1PB 3MFGA 1DYQA 1CQVA 1LTTD 2Z8LA 1PTOB 4RCOA 1D5MC 1PRTB 1YN3A 2XRSD 1EU3A 1B1ZA 5FKAC 3O13A 5D3DA 1ESFA 1ET9A 1TS5A 1TS3A 1SBBB 1SJHD 2AQ1B 4L63B 1PTOF 1SE4A 1M4VA 1PRTF 1V1OA 3V05A 1CK1A 1PYWD 4RFBA 1EWCA 1PZKD 1B44D 1EEID 1S5CD 1KTKA 1SEBD 1TS4A 3W2DA 1YN5A 1KLUD 1FNWA 5ELFA 2TSSA 1HTLD 4ZYSA 5ELDA 1I4HA 3DWPA 1S5BD 1BCPC 1XXGA 1JWUD 2NTSA 1T5XD 3SEBA 1L0XB 1D5ZC 1LLRD 1S5FD 4DXFA 1UUPA 1TY2A 1HA5A 1I4RA 1MD2D 1D5XC 2RDHA 2QEJC 1BCPD 1ENFA 1PZJD 1RDPD 2XNAC 1F77A 1AN8A 1GOZA 1JR0D 2RDGA 3BYYB 3R2TA 5ELCA 5I4DA 1FD7D 4RGMA 2AQ2B 2XRQD 1LTAD 1LO5D 4Z9CB 1CT1D 1JCKB 1S5DD 3MC0B 1I4XA 4OHJA 2WV6D 1S5ED 3URYA 5ELEA 1CHQD 1EFID 1D6EC 1I4QA 1LTRD 1AW7A 2AQ3B 1UNSA 4TSSA 3TSSA 3BVGA 1EEFD 1BCPB 1KLGD 1ET6A 4O1NA 5FK9C 1I4GA 3OWEB 1SE2A 1CHPD 4RHSA 3R2IA 2SEBD 1TY0A 1BCPF 2IPKD 4RH6A 1SJED 2IJ0A 4L6TB 4K6LA 4RHRA 3DWAA 1QILA 4NZLB 1TS2A 4DXGA 1JWSD 3CHBD 2ICIA 1PTOC 1DJRD 1PRTC 3EA6A 1HXYD 1LTSD 4RGNA 1G8ZD 2NTTA 3DWQA 1LT4D 1EU4A 3EFXD 3BVMA 1FGBD 1YN4A 1LT6D 1LT3D 1PTOD 1SE3A 1PRTD 1V1PA 2CHBD 3GP7A 2J4XA 1FNUA 5ELBA 1LTBD 1STEA 3BZDB 1FNVA 1JQYD 4BWGB 2O2LD 4UDUC 4RGOS 2R61A 1LTGD 1BXTA 2XN9C 1LT5D 1PZID 1RD9D 1RF2D 1L0YB 1RCVD 1XTCD 3BVZA 5D3IB 3R8BA 1SXTA 3KLSX 4C56C 1LTID
chains in the Genus database with same CATH superfamily
4ZOHC 5TR5A 1P16A 2DZJA 1Q1EA 4IDIA 3ZDMC 2EYPA 2KMMA 3A55A 3G71A 4XIGS 1P8LA 1G91A 2AHOB 2WU5B 4MEMA 4KKTA 2F4VL 3CCQA 2CU3A 1J6QA 4F1SA 1VQ9A 1PTOB 1OXVA 4C3HB 4LDTB 3BDCA 4DR3Q 1QJOA 3H8HA 2ZEQA 1LM0A 4L5RC 2Q2IA 2M0XA 1DD2A 2PYKA 1JORA 5D7GA 1QB5D 1V1OA 4OVVA 2KACA 1SYEA 3QB3A 4G3XB 4RWSC 4IWOA 4EKUA 1XD3B 1SMYC 3NZ3A 1EY9A 3GTKB 2KXJA 4RM9A 4A3LH 2B63G 1AZQA 4KHVA 5ELFA 2IO3B 2RPQA 1QNUA 3FPUB 1D1KA 2EY1A 2UUBL 2UU7A 2FAZA 2LRUA 2PE6B 3K80C 4P74A 1T5XD 5C2TB 1Q86C 4IFDG 4DQOC 1NBWA 1OEYA 3CCMA 5IT9c 1B50A 3A5UA 1Q1OA 2KT7A 4A90A 1BUIC 1PH2A 1VR9A 5AZFA 5K5PA 1ZW7A 3U9OA 4XDXA 1CA6A 3RLOA 3M85A 1A6XA 3FPPA 4MGZE 1FO4A 4O42A 2AQ2B 4RAUC 2UWQA 4LCDE 4OL7A 3RYTA 1QG7A 1DONA 3IFTA 3T1HL 2KNBA 1HQMC 2IYDB 3P63A 4LK0M 3URYA 1XLNA 2E8GA 4Y7NB 4OWXB 2LI5A 5D14A 4YHHL 1HNWQ 1L4ZB 2O6VD 1PFBA 3U4EG 5FJ8H 1CKOA 3P20A 1BBUA 3Q14C 1WF9A 4OZBA 5CBAE 2A6HC 4X62L 5JEAG 5BN5A 2NVQH 1JMLA 4A3IH 4ILWA 1FGUA 1V43A 4ZRZA 2OJRA 2N78A 2ZJRA 3JC66 2A4ZA 4KY6A 5DPRA 4M0WA 3HOVB 5I9PA 4HIMA 2L5TA 2K03A 1WE7A 3T9LA 1Y14B 2BS4B 1CTMA 2LVPA 1DJRD 3G4SA 1KLVA 1HXYD 2MBHA 2BCOA 2F0PA 5C0XI 1F9QA 2QA4A 1GJXA 3NEMA 2NTTA 1FXAA 5CTRC 2WKDA 4OXPA 2ZM6Q 3A4RA 4H7BA 1FGBD 4JVZA 2NWGA 4UP8A 5KNBA 1NI2A 4JI5Q 2L32A 2N9PC 3K6OA 1PFMA 3M3YB 2OF1A 1D8LA 5DM73 2MBEA 3WAPA 1HFGA 2WXNA 2KTFA 4CJ1B 2MHVA 2WXRA 3M3JA 1LXDA 3I63C 5E6JA 2DYMA 4KZ0A 3QQ8B 4K0KQ 5LMNW 1V9JA 3H6MA 2KFKB 4P7IA 1SFOH 5ISRA 1C8CA 5CHVC 3KLSX 3T1YQ 1P98A 3PF4A 1QOAA 3DHQA 2XK5A 5M3FG 4NP5A 4KKIA 3QJYA 3V96A 3TZUA 2CHZA 4IUVA 1BUVT 3A8JE 2QHOA 4R1JA 2PNRC 4C3IH 2K5NA 4JI1L 1N33Q 3J9CA 3O65B 1WTVA 2HJ8A 2KHIA 2J0KA 2RCFA 3J81L 1O7ZA 1X32A 1B1ZA 4G57A 1HNXQ 2BT6A 1X3PA 4CKBA 3AE7B 4ZK9B 3ND8A 1ESFA 5FLMG 2B2UC 3NHEB 5E6NA 4N6EB 2NVTB 2JRIB 2B63B 3NXWA 3GZNB 2KO3A 1QOFA 4UHVA 1M90C 2YEPF 3Q23A 3S24A 5DPWA 2MA9B 1O80A 3G6EA 5CR3A 1EEID 1O7LA 2K6AA 4K2KA 2ACZB 3T1HQ 1HTLD 1S5BD 4DV4L 2FCSA 1Y1VG 2EYHA 4M8MA 2F0DA 2F03A 4ZYNA 4ARIA 2PPBC 4UP9A 2LFIA 5EPKA 3VH3B 5C23A 4ZHOA 4NB3A 2YTYA 2PPHA 5H92C 2EJFC 1RKNA 4ZKCB 2UXDL 1X3GA 4MTNA 4X62Q 2QCPX 4WURA 1VQKA 1E7VA 1JWAD 2MO0A 1ENFA 1GO3E 2C60A 1YNJC 3VR6A 1TT2A 4BVUC 1V49A 4N9TA 3SVMA 5K36G 3PRZA 4NQKE 1A0IA 1PDXA 4EX5A 1SIJA 5LL6S 2BYFA 2PVOD 3DHGC 2A68C 3HOUH 3HUIA 3S16H 5IO9A 5KRUA 2JXXA 4M1UB 1GUNA 3DBRB 4N59A 1SN8A 3DMUA 1E6EB 4XWWA 1W3SA 2NBVB 3VYRA 3Q22A 4CHKA 1K9MC 1EYDA 3ZNHB 2E2HH 4Y52H 1HR0L 1R4QB 1I7HA 3WIMA 1I50H 2B29A 2K25A 3GTQB 4A3LG 2K5HA 2L1AA 1Y56A 4IC7B 4MH8A 1WJJA 4JPBW 4I65A 1QUQB 2DWQA 4XDDA 3JAML 4ZAIA 2Z59B 1E2ZA 2I2YA 1GM5A 4CDEC 3L0OA 4LF4L 3TZDA 3ZDTA 4ME5A 2IX3A 4YCWA 2A6EC 3S1QH 3KW5B 1WD0A 1CFMA 3AU7A 3I4NH 1Z2MA 2N88A 3LGJA 1NY4A 3BY4B 1OXSC 1ZKOA 2JE6I 5C6AA 5M3MH 3SXHA 2EJMA 2RPVA 1C9OA 1UWVA 2PMZB 1E7UA 4JI1Q 2Q2UA 5C4ZA 3CPFA 2WS3B 5D65A 4OO1H 2KD0A 5C0XG 3D4WA 3AEBB 2HIVA 2OEDA 1OTCA 3R3MA 3FILA 3OYYA 4RGOS 2EYMA 1V5OA 4WQMA 4JYAL 5M3FB 2PO4A 3TQYA 5FR6A 2L00B 3OSOA 4DV3L 1R9TH 4NJ7A 4WWMA 3RNEC 1KRTA 1K8AC 4JW0A 2VH1A 2AUJD 3TS2A 2EKEC 4P16A 4IURA 4S17A 2CU1A 1HPCA 1E3PA 2EXZA 5DEHA 2KDEB 1VZ6A 4GIVA 2L0CA 4A8XC 5JHBA 4QUCA 4MT5A 2CWAA 2Z8LA 2R2QA 2RCNA 4KMUC 3ZYYX 4AQYQ 1HUNA 2B8FA 3HG9A 5I2YA 1VQOA 1R4NI 4TV3A 2K3UA 4A3CH 1N5XA 2VQFL 2JEAI 5E4WC 3L0WB 3VRAB 1KRHA 4GDKB 3DDCB 1GUOA 1TS5A 4OO1I 1Q90A 3L7ZC 4C2MB 1PTOF 1OEYJ 2D3AA 2JZ3B 3ZQ4A 5JJZA 2EVBA 4KSLC 3OMCA 2WXJA 1Q7YC 1SE8A 3KK7A 1Y1VB 2UU9L 2H88B 2NYZD 5CHWA 3UQAA 4RFBA 1ZUD2 5CV8A 2QMTA 5IGGA 3PCOB 4KVGB 5G5HA 3U50C 1NNXA 2B2UA 2HTME 1DOIA 3Q8EA 1ZDVA 2F0SA 1FJGL 4YWGG 2GBRA 1F9SA 1U4RA 1L0XB 3SEBA 2M17A 2KWVB 4DV1Q 4KN4C 3UINB 4ZHPA 2BA0A 3A54A 1HA5A 1TVXA 3J7ZC 3AU4A 1R4MI 2DZKA 4GMVA 4NAMA 3VYTA 2WXPA 3NS8A 3VR2A 1KDAA 3GDEA 3HVZA 2LSSA 1RDPD 4OONA 3KUPA 4UP7A 5FOBB 3CCEA 1IXRA 1PGXA 5EE0A 2CJOA 1FD7D 3I72A 1TZ1A 4HEA1 1H95A 5M5WH 2BB5A 4LNOA 2UXBL 1YHBA 4C3IG 4C7ZA 3H3VH 3ZJUA 1L1OC 5GQOA 5IE8A 1I42A 4R3DA 1CHQD 1J0GA 2CH4A 3CWIA 1FXIA 2NVUI 1ACCA 4R8NA 4GSWA 1EOVA 1VQ7A 1QOBA 2HCIA 5IIFA 3MVVA 1E90A 1VZ8A 4K1RB 2LMCB 4JIOU 1E2VA 5A35A 2LXAA 2V1CC 4HCNB 3STBC 1H9SA 3I2ZA 3RZWC 2AWTA 3BIID 4ANVA 3KBXA 5L95C 1K51A 2XVSA 3RFZB 2A69C 3I91A 3K7UC 1CHPD 3TP8A 4FN2A 4NJ6A 5H8YE 3M4OB 2B2TC 2F0VA 3M4YA 5C4JH 4JYAQ 4A4IA 4RHRA 3PIO3 2ASQA 1QILA 5JAVA 4DV3Q 3VVWB 3AE5B 3U30A 4DXGA 2ZT9C 2ICIA 2NPTB 3E9HA 2L11A 3FVQA 1PRTC 2WACA 3WANA 2Y3AA 4GN3B 2BDNA 3PZ8A 5C3JB 4M8NA 2K22A 4DU9A 4G11A 4KX6B 2FJ2A 3PO0A 2D2QA 5G2NA 4L2YA 4R4IA 2E5LQ 2PLPA 2JA6H 2KCMA 1BF4A 4DHZE 4HEDA 2VW9A 3I90A 4YSZB 3S2HH 4EQ5A 4ZQ3A 3PGEA 2MCNB 5J18A 4GS3A 1WYWB 2VQFQ 2KN5A 2B3GA 5GAGC 1XNQQ 1XNRQ 1TKWB 1J7CA 2CJNA 2FIDA 1L5PA 2LZ6A 3ONSA 4AJYB 3BVZA 1Q5WB 4N8X1 3PV1A 2IX1A 1L0YB 1K3BC 1IYUA 1XTCD 4OX9Q 1B2TA 3B9JA 2UU9Q 5BYQA 1HR0W 1NVID 1HQRD 3TUOA 3C2PA 5IT9E 2M19A 2KCNA 1AEXA 1YBYA 2PQAB 4PMCA 1PTOH 5BR8L 1ZKHA 5FR3A 3A7LA 2BS3B 3OWFA 2JN4A 3AEAB 4ANXA 5COYA 1Z47A 3VA5A 2RF4A 3SDZA 1JJCB 2IGGA 2M2LA 4FP5D 4MACA 3VHTC 5KNDA 3BWUD 5IKCM 1JRPA 2N8NA 2IGHA 3CCLA 2MUYA 3TP5A 3I4NG 1D1IA 1EIHA 2W54A 4IJLA 1I35A 4ZRJA 5M3MG 2K50A 3RNAC 1TXYA 2IT1A 1PHJA 4WRDA 1XCTL 1SNMA 4JWUC 2HDEA 3E5SA 1UGMA 4KV6A 3HGBA 1VQNA 3MXUA 4MSQB 4IW0A 1NCVA 3F2CA 5EBCA 1J19A 5KEEA 2KLGA 2E75C 2KKCA 2DYBA 2J0TD 3IBEA 2JA8G 4L1BA 1F2YA 1SNPA 1TY2A 4R9WA 2SDFA 2L9HA 2I5LX 3ICEA 1CZPA 2DBYA 2QGQA 3NG0A 2MNAA 2VS1A 3IFWB 4C3IB 2KHJA 2XNAC 4U68A 1HNZQ 3HM3A 2V9HA 4GKJQ 1EQTA 1LTAD 4Y7NH 3X0WA 1WYDA 1F2RI 2KWUB 2WKCA 1N34Q 4ZRKA 3V60A 2ES2A 2KFKA 4KGSA 3PO3G 1IUEA 2VB2X 2A8VA 3K9OB 4IWPA 2EMSA 2H5XA 1D6EC 3ZGZA 1I4QA 2LXCA 4HXDA 3PUZA 2KECA 1KXLA 1O7IA 4BOSC 3SHQA 3PGZA 4LF9Q 4MM3B 1GHKA 1N6ZA 1L1OA 3QOJA 3SR1A 4NQLB 2JQRB 2V3PA 3OW2A 1B3AA 5CHFA 4DUYQ 1YNXA 1ET6A 2FIFA 4X57B 4ZRPA 1ZE3D 4B0EA 3HOVH 1KRSA 2JZPA 1Y8PB 1GB4A 1VQLA 4BOZB 3QARA 4WAAA 4AUQC 2OWOA 1N36Q 1G291 4HK2A 3DWAA 1EZ6A 2AMCB 1DOMA 1B9RA 1VDZA 1XWEA 1EY7A 4S3SA 2BWES 3T53B 4X64Q 1WTPA 3WOFA 2C5LC 5LLIA 1NJIC 2D3BA 4JE3B 4IPGA 5I9OA 1FM0D 3M3YH 5HFYA 1YNND 2R7FA 3J81c 1LT3D 2F0TA 2W3RA 2GBKA 1SE3A 2K01A 2R2OA 2DAJA 2YTVA 5EE3A 2Y5PA 4JI0L 1F2MA 2K05A 3AU5A 1LTBD 2A74C 1STEA 2X38A 4IN3A 1K8OA 1I50B 4W9CA 2K32A 5HURA 3AMUA 3BK2A 2MBQA 2F0MA 2OJWA 2K6QA 3MXNB 2ZTDA 2O5IC 4B3TL 2BTEA 1EQQA 1KJTA 1N63A 3NELA 1OQRA 2KANA 3AE1B 4XWTA 2Z6KC 1ONLA 5FO9B 4JC0A 3JYUA 3DXJC 3WOEA 3APCA 3VQIA 3ULJA 3KDFB 3GTMH 4DR7L 2VNUD 1E10A 2M56B 3S1QB 2VQEQ 3G7LA 3I4NB 5FLXE 4ZKBB 4ITKA 2Q8IB 2NVTH 5M3MB 2B63H 1R4NB 3VTWA 2BKRB 1AZPA 2KDBA 2BYVE 2AQ1B 3QAQA 3QO2A 1XJVA 1JRUA 2WXIA 1STAA 3HP3A 3L17A 3JVZX 2ZXOA 3VR9B 1QUQA 3MZ5A 4IFDH 1FFVA 2JT4B 1M1KC 1UE1A 4EQNA 3TRZA 3H9DA 4HJ7A 1TS4A 1SEBD 2UYZB 2Q8TA 3BS1A 2JA8B 2PMVA 4DAVA 3ZVVA 5T1IA 5E6OA 3P1MA 3AE9B 3E56A 2YYZA 1IBKL 1G2SA 4LUOA 1D5ZC 2B3AA 1NUCA 1WSPA 5E4XA 5JVG3 1WXVA 1BCPD 1R4MB 2XEWA 2RDBC 3T56B 5BN3A 4YWKA 3K5LA 1GOZA 5ELCA 4II3B 2C35B 1Z7TA 3P4RB 1YEZA 3QJZA 4JI6L 3PO3B 2XRQD 3JAMc 2MBOA 2YLMA 1WR6E 1LO5D 3APDA 2Z1CA 3BK1A 1I6VC 3D3RA 5JEAH 1CQFA 1OXTA 4GKKL 3PZDA 4IFDI 4WJ4A 1WIAA 1SYCA 3QA8A 4NAWB 1WGRA 2EYJA 2F4IA 2M9VA 2WWZA 4KIKA 3BDOA 1LTRD 3EFCA 2OCEA 1AE2A 2AQ3B 1I6HB 3TSSA 4DR2Q 4DV6L 3PO2H 1Q8KA 1KC8C 3GTQH 1RM6C 1UE7A 1V8QA 1XT9B 2WXFA 3TEYA 4DHZB 2JA7G 2LGYA 1LQBA 2DX5B 3E0EA 4B3SL 3Q24A 5EKLA 1JJGA 2DUDA 1EM7A 5GADC 4LFAL 4H2AA 1NAPA 4LUZA 4HJGE 2AEHA 4OVUA 3EIVA 1YNTE 3H91A 5GMVA 2IJ0A 2G3QB 2O2VA 1VQEA 4HJKA 2K0PA 2CKZB 1SRUA 1Y1WG 3OAWA 3L10B 1N32L 3UDXA 1HRJA 3CHBD 1YI2A 4B3TQ 3DBRI 3ZRCA 2BA1A 5A2QL 2O6VB 3AM9A 4IPCA 1FFUA 1JC7A 1GUSA 4OW0A 1TWAB 4XYOA 3OIQA 5G3LD 1VDVA 2B2WC 4B3RQ 4GNXC 4X66L 5LMNL 1F0ZA 3QCAA 2PZTA 4QIWE 1B3QA 3NBIA 2PTLA 3JW0X 4CDFC 4DR7Q 1MFWA 2Z0SA 3KJOA 1FEHA 3FC4A 1TWCH 4B95A 3IKJA 1XF5L 1T9HA 5M3FH 3NQIA 3ZXVA 2D62A 4EUTA 2RR9A 3ETRA 1EIFA 1QF6A 2O2LD 2EE1A 1ENAA 3BINA 1E0BA 1X3FA 1RD9D 5IOCA 2MSED 2R7DA 1LTID 1IYJB 4DV7L 1P9DU 1AH9A 3BYTB 3J80L 3EVQA 2DLBA 3K5OA 4GN1A 4ANWA 4EE2A 2EMTA 4JWSC 1MBYA 4RGTA 4A3FG 2KK8A 2LVQA 4LLGM 1GB1A 3A1QB 5EE1A 1O78A 1RTOA 1V1PB 1IBKQ 1WGKA 5DAUA 4PT5A 4ICUA 2LMCA 3RUZA 2VH2A 3Q8CA 4C2MH 1MG4A 3NVZA 1WCMG 3MA2B 5CC4A 2Z6KA 1SE9A 1ET9A 1SMXA 3HRDD 1Y1VH 3L9AX 4O2DA 1UZXB 2KWDA 2DY8A 5J2RA 4DUZL 4IPHA 1SE4A 1QZGA 2RQXA 3J81i 4JI6Q 2L0TA 4W9DA 5F2DA 4G7ZC 2BPSA 3HZXA 2R92G 1PLFA 1PZKD 4PK1A 5E7NA 1Q12A 4DR5L 1NYRA 1NTGA 3KF6A 3AI5A 2MQJA 2L12A 4UY8C 1DXMA 1YX6B 4OZAA 4BBNC 2KUMA 1JWUD 2K1BA 5K36H 2NB0A 1STBA 1SMYD 4X3SA 1WM3A 2EYLA 1PH1A 2L05A 1NE3A 3BZKA 2B76B 2RHQB 3SK6A 3W5VB 2AX5A 1LUZA 1MHXA 3R7RA 4A93G 3CD6A 3Q3NC 1L6VA 5MPOA 4KJNA 4POFA 1UGJA 2KX3A 3S2AA 3R2TA 5M5YB 2PE9A 1G6PA 4IO9A 1ILQA 1HHVA 2AL3A 4TKOB 2QCZA 2KBNA 4DFAA 1HTOA 2Z6BA 2GA4B 4FADA 1LM8B 1Q8IA 3TEXA 4K8IA 2EKIA 2P5ZX 3VTUA 1VF7A 2OOBB 3CCUA 4XYQA 4W9EA 1N32Q 1NR2A 2JA7B 2RGFA 2EQSA 4H13C 3OJ3A 1AW7A 2AWNA 1ZYRC 1QOHA 2JXMB 1OQYA 4FJYA 2KC2A 4LMQD 2DJGC 3CCSA 3H15A 3EBEA 5LMNQ 4HWIB 1IHZA 4M02A 3GTGH 4C4VB 3W1GA 3M4OH 4KI0A 5D94A 3B1LX 1HZ5A 2A6HD 2EPBA 2OT2A 1Y1WB 3R3OA 4OEMB 5JJIA 2C9WB 3KQ4A 4AP4C 2PVGC 2LRWA 3QIJA 4K6LA 3SK8A 3CQZH 1NSNS 1CKMA 3NWTA 1UBIA 5EPLA 1KH0A 4QL5A 5AEKB 3B0AA 1E7ZA 5C0XH 4DV7Q 4FJVB 3H94A 3CC7A 1LTSD 3N9YC 3I7FA 2WB1E 3JAMi 1K0RA 3W1SC 4CKCA 3PF5A 4I7AA 1T0SC 2FNJB 1E9MA 2KQ4X 5IP4D 2MJ8A 3EFXD 2FMCA 2K4KA 3H7PB 1Z9FA 3X3MA 4KLKA 1TYGB 1STHA 3EHVA 1QZEA 3GQBA 2B8GA 4N9F4 1FNVA 1EZ8A 5LL6X 1P7EA 2B2WA 1XMOQ 3J7AV 4GNXA 4X3UA 3TJPA 3NRZA 4XTCS 4DUZQ 1BXTA 1UE5A 1LT5D 2QEXA 4A3FB 2HT1A 3PO2G 2AUKA 1C4PA 1C0AA 1A2TA 2BYEA 2K1FA 3I5JC 4BBNF 4GLAC 4DDGD 4C56C 1IBML 3AE4B 2K8HA 1PYSB 4PZ7A 4KZCA 2EY2A 1RFAA 1A2UA 1T0YA 2Z4HA 4ZDVA 1YQBA 2EOTA 1PGAA 1IW7C 1WCMB 4DAYB 3KLWA 3J7A5 1EF5A 2IY1B 4C80A 2LWPA 4RCOA 2F4VQ 5KHOA 4P6VF 3LJ3A 1V6EA 1JROA 4MM3A 4NNJB 2PQEA 4NPNA 3O13A 1EFWA 2L55A 4K8JA 4BY1G 1WM2A 2KDIA 1SDFA 2WXQA 3AEDB 2R92B 4L23A 4L63B 1EY4A 4FF2A 3H3VC 1WGYA 1M4VA 4FA6A 5E6PA 3C3LA 5D2MB 1QWYA 4KY5A 1H4RA 2RBMA 1D3ZA 1SNDA 3K81C 3AFPA 1QNKA 3OLMD 5J1ZA 4ZYSA 3QHTA 1GD7A 2VZAA 4KD3A 1ENCA 1VMCA 2ID0A 1VQ8A 3S9WA 2BWFA 4A93B 1WJ6A 2BE5C 4K5XA 4K7UA 4OELB 3DOWA 4A55A 2UUBQ 1PFNA 2J7ZA 1ZOYB 3W1YA 2J53A 1YQ4B 3L54A 5G5GA 1ML0D 4DR4L 2CR5A 3IXSA 4GOPB 1GVPA 1MSHA 1YJ9A 4J15A 3AE3B 3W1BA 3SK4A 2FHTA 3GTMB 1QZHA 3RNBC 3ZJVA 4L5QA 1NMFA 3ML8A 4HN7A 3KLRA 3SHLA 2NZHA 3MEHA 3PSIA 3DVGX 1EWYC 1WI5A 2R93B 1F2LA 1YNJD 4H02A 1G6ZA 4RF1A 1JMCA 1ILPA 1YJNA 1N61A 5KGUA 1PYBA 3J81E 1XPRA 2ZNVB 2LUEA 3MHBA 3UDIA 1IGCA 4MGYE 3N32A 4FJZA 4YHHQ 3PRPB 4IOAA 3HIZA 1EUJA 1H9MA 1WR1A 4B6WA 2OHFA 3DEOA 2WB1G 1WRDB 2LS01 1X9NA 2DNEA 3I4LA 5IGEA 1LGRA 3DM3A 4DV5L 2XWBB 5BYRA 3MJWA 3GTLB 3DEPA 5HHDG 2B39A 3VRBB 4M01A 5DCNA 4ZRQA 3MHZA 4QMGA 3NP8A 3PREA 4WWOA 5JVH3 1I94L 1PTOC 4UPAA 3S17H 3CC2A 1S1QB 4P2CB 4A3MG 2IO1B 3DHIC 3Q3FA 2K39A 3K58A 4HSVA 3S14B 5C5LA 1T5EA 2M4NA 1G8ZD 1WVLA 4PZ6A 2PIAA 4BFRA 5J17A 4YIJA 4NMZA 4LF5L 4W9HA 3ULPA 1L4DB 1NYQA 4HCEA 2A6ED 5CV9A 1MVKA 4NJCA 1VQIA 3GTJB 2EY5A 4DN4M 3PO2B 1Q1BA 3A9KB 2AWOA 4N9PA 3ZTDA 3X23A 3CRLC 3W1SA 4GGQA 1FD6A 1OXXK 1UBQA 2ZJDA 4K81A 4MJSB 1AP0A 3TIXA 1WX7A 2PNHA 4HJ5A 1MHHE 2HJ1A 1T3QA 1PH8A 1K52A 2GB1A 1IBLL 4W9KA 1IBXB 4KHPL 1C4AA 1K53A 1RLFA 2MWSB 1CKNB 2MP2A 4NAWA 2W82A 4BY1B 3MXGA 4EEWA 1KF6B 2F0NA 2KTRA 1D5MC 2LJ5A 1DOLA 2DY7A 3C19A 3SR6A 4ZUIA 1MHWC 4DR4Q 3DVNV 3M63B 3V6CB 1HJPA 1IKMA 4LNKA 2WP9B 3I9V1 1TS3A 1KAAA 1VQFA 3J81j 3S2DB 4AQ7A 3HM6X 5C0XJ 1DOKA 1TWCB 4BA2I 1SYGA 1EF1A 4Q2JA 3VR5A 2JA8H 3HOWH 2IDYA 1K50A 2ZVOA 1UWXA 2PI2A 3V05A 2A5UA 4OWWB 1B44D 4LK1C 2D5DA 3PHWB 1KLUD 2WHIA 3FKIG 4JG2A 4DR1L 3VDYA 2E2JB 5C4XB 1FPYA 1B4OA 3RNGC 4Q5VA 2O6VA 4DV4Q 1LLRD 2NVXB 5KYIA 2EXDA 1ZXTA 2Q2HA 4IUQA 4H0LC 1VJKA 2ICEC 2NR2A 1V97A 3CSFA 4MDKE 2K28A 2UXDQ 1DGJA 3PO3H 1XO3A 1J8CA 1V80A 3KVFB 1JR0D 1WJNA 4US9A 4LNFA 4LFCL 1FRRA 1JWBD 1P7FA 4GU2A 2PCFB 2N9KA 5JHAA 4MGIE 2AKWB 4LNIA 1WMHB 4AOFA 2Q2TA 4CHTB 3ALBA 1IP9A 4DDID 5ELEA 1I6HH 4QCLA 2WB1B 1MJDA 2K33A 3K0XA 5C3WA 3AN1A 4AS1A 1K8GA 3BVGA 4Q0FA 1VD2A 1PH7A 3A1QA 3T3OA 4LF5Q 5AZHA 1QVFA 2F0HA 3L3OC 3M4PA 3H6NA 1HR0Q 5CGKA 3VDZA 1QT9A 4W9JA 3PIPA 4WJWA 3G48A 4R4TA 4F87A 1CI3M 3OWEB 1K28A 1U4LA 2G45B 2GBMA 2Y5BB 4DR6L 3STBD 3ZTCA 4NY0A 1UF0A 1A3VA 5IYCG 2IPKD 3U4VA 4G7HC 4A3MB 3Q8FA 3MJ5A 2V4DA 4L6TB 1EWHA 1E24A 2HIXA 3J80c 2JY6A 3AEFB 1TWAH 3LWEA 1BKBA 5AJ3L 1U4PA 1M94A 2B2VC 4AYBE 4J3OD 3LYYA 1E8WA 1G51A 2JF5A 4ABNA 4IKGA 1K73C 2K7VA 4LF4Q 1E1TA 3AE8B 1IBLQ 4B08A 1D4BA 3RD2A 3TREA 4CO7A 2KQSA 2NZOA 2KEDA 3A33B 5CX3A 1ZP0B 4X65L 1PRTD 1RFKA 3L13A 3NZSA 1WGDA 4JI3L 5BN4A 1F1HA 2WXHA 1FNUA 5ELBA 2O4XA 4IZ8A 4B9WA 3I56A 1B9MA 2YVCA 2KFJA 4WJOA 1SYBA 3GTGB 4UDUC 4X3KA 1VQAA 3E0JA 1JOQA 1PZID 3IRBA 1UE6A 3PLVA 1AYFA 4IUMB 3D4DA 3S15B 2WLBA 1WRIA 3KJPA 2SNMA 5TSSA 3AEVA 1GUTA 4TRDA 1X1MA 4JI8L 2FCQA 3L16A 4JLCA 3VUXA 3CQZB 1A8VA 3A9JB 1Z6HA 1EYCA 1PDQA 1CQVA 2WFWA 2WAQE 1SSNA 2FFKB 3R93A 4CKEA 1XPOA 3LX0A 4G7OC 3KOJA 4FF4A 2K04A 3AEEB 3M4QA 4A3PA 4YTMB 1KOTA 3OTOL 4ZCKA 1BT0A 2RA4A 2D11A 3GV6A 3NQTA 4MELA 3FKIB 1PFDA 1BMLC 5AZGA 2VY3A 4IWQA 1EWCA 1S5CD 1Y69U 3PUVA 1X6OA 4ASWC 5ELDA 1ZXHA 2WDTB 3KH0A 5JJKA 4OIJA 4NW2A 1L2FA 3HHMA 3RULA 4DV0L 1S5FD 3UDFA 1X3QA 3RI7C 1FJGQ 3P1HA 4HPPA 1P1AA 5M5YH 4M00A 3QWNA 4XQNA 1V81A 4KGTA 2FUHB 4G50A 1R4PB 3DQVA 1KQSA 1DGSA 3DBHI 4P75A 2KA7A 1E1OA 4KSKC 2F3WA 2JVCA 2IO0B 3VUWA 2SNSA 2YV5A 4BY7G 2N1WA 2UXCL 1S5DD 4P1BC 2JA7H 2UXBQ 1WTOA 3VFKA 3UI3A 2V3NA 5AJ3Q 3RT3B 4ALPA 1RYJA 4A9AA 2HCCA 1N8RC 4HMIA 3C1EA 3RZDB 4AYBG 4RKLA 1WE6A 2K9XA 1Q0WB 3NS1A 4JGHB 3HOWG 3PMFA 1TKEA 3Q8BA 4CDDC 5DPSA 1BCPB 1Y1WH 1HUMA 3PUXA 3FEWX 1V2YA 4JI3Q 3S1NB 2UUCL 4II2B 4DHJD 5FK9C 1K83B 3UIPB 1SYFA 1RIPA 2SEBD 2INPE 2N3SA 4LW1A 3I70A 5LMUL 1EUVB 4A75A 5EJWA 2OQ0A 4GDLB 1YHAA 2SAKA 2XTIA 5C3XA 4JI4L 1MGSA 3PV0A 3E9IA 2N0SB 2BDOA 2HHHL 4FLHA 2GLSA 5IAAC 2IL8A 1S3SG 4YSXB 3A74A 1FL0A 1YMHE 3Q8DA 1NI3A 2K6DB 1A70A 2L1BA 1FRDA 2MJEA 3SFDB 1WI0A 2QKIC 3ZJYC 1VMPA 2R6GA 1LABA 4WJPA 2F52A 2B2VA 2CWPA 3AE6B 4HVBA 2CVRA 4YXDB 4WJQA 4EZLA 1MKHA 2WAQG 3PSEB 3BU2A 4MNOA 2JYOA 4K2LA 4A3FH 2D3CA 4M0WB 2E2IH 3APFA 2K5QA 1VS0A 4B3ML 5DNFA 1XLQA 3NTIA 4QGUA 4BKTA 4DF7A 3IT6B 1WXAA 3CPWA 2CW0C 2ZPYA 4E74A 2WXOA 3NVWA 2KLCA 4DGZA 2HDMA 1WCMH 4W9FA 4OZCA 4A3OA 1YQ3B 2VRRB 3LXFA 1XPUA 3L4PA 1PXUA 4FVMA 2HTHA 2GOWA 4HPMB 5BR8Q 1EQVA 3IHPC 3J80i 3S17B 4BKSD 3PUWA 2YU9B 3FRPB 1NR4A 4OIKA 2R92H 2C7HA 1CJEA 3H0GG 3Q0AA 3GE8C 1HZ9A 1K8RB 2K5VA 1UAPA 3ER0A 2WDVB 3NZUA 1JB3A 1GC6A 3ZIMA 1B8AA 1DZ1A 1GC7A 1XX8A 2KOLA 3A8IE 2G9DA 4NXML 4A93H 2UXCQ 1BNZA 2D07B 2FCNA 2M1MA 4FHKA 2X6LA 3QOLA 2LEKA 4C00A 4USAA 3GV3A 4DXAB 1EY5A 4RMAA 2ENBA 3NWSA 2ATWA 2L8JA 1GKHA 4KGRA 1YVCA 4KD4A 4LWCA 3AFQA 4IG7B 4LFBL 3VXWA 2X69A 3ZNGC 2LD9A 5LHY1 1WTRA 2Z9HA 1K3RA 3NTHA 2HQLA 4DV2L 1SB3C 1SNOA 4GZYC 3GE3C 3I55A 5JXVA 1D5XC 1GUGA 3EFUA 4HIKA 1STNA 3T51B 1Y8NB 4GB9A 4BY7B 2K8CA 4JQWC 3PZ7A 1U4MA 3GB1A 2R93H 2A5HA 1YJWA 2RD0A 4RGMA 2QSDA 2JJQA 4EQOA 3RZOH 4W9IA 1CSPA 2V4LA 5FLXL 3J7AF 3ZXRA 3SD5A 2H1EA 3MC0B 2H4OA 4PMBA 5LMUQ 2NMQA 4AYBB 2BQQA 1JQ4A 4E6IA 1V5TA 4U673 5DLQE 4YSYB 1AARA 3HOWB 5EKIA 3DCGA 2L3ZA 5JPNC 3PLUA 4EZKA 2LKVA 4YY3L 3ML9A 2W9NA 2PZWA 3IL8A 1CKNA 1RRBA 2E3TA 1ZXIA 2NBFA 1KNAA 1WFYA 1E8XA 4PMWA 4NKLA 3GTLH 1GPXA 4BKGA 1PH5A 2HDLA 1EYAA 2INNE 1I4GA 4TVAB 4JPSA 2F0EA 4JI2L 3AULA 2Z4IA 1SR3A 1ASYA 1EOTA 3ERSX 3J7YW 3VR4A 4V190 1T0RC 2KC1A 4RH6A 1XCQL 4WJNA 5BO4B 3OW7A 3QIAA 2I1KA 1FMAD 3S14H 3QG1A 4A3JG 4HTHA 2C7NB 2JEBI 3LWUA 3EA6A 3I3TB 1HZAA 2PW5A 2BKFA 2WNMA 4HCPB 3G6JB 4JCVE 3MC8A 4XYCA 3GTJH 1UEBA 2WAQB 4F88A 2JPHA 4YT0B 5IGFA 4KV2A 2DZIA 5AUIA 2FUG1 4GXBA 1UEAB 3CF5A 2KCCA 1RAXA 3NOBA 3P7JA 4JI0Q 4BWGB 3PT2B 3TMPB 4WQOB 4WORA 5KIXA 4GDKA 2F0OA 2R61A 3IAM1 1LTGD 1O7YA 3RNCC 2Y0SE 4MZ9A 3TS0A 1YITA 5BYSA 3Q6SA 1H9KA 3DWPA 3VYSA 5D6JB 2A19A 3TP7A 4B9KA 5JZEB 2KDFB 3UI2A 4C1NK 4BY1H 5IA7A 3CXCA 1JOOA 1W2BA 2G9HD 5C3EG 1TZOA 3H0GB 2EYFA 3QK0A 3EROA 3EUB2 3S1RB 4FF3A 4K3CA 5HY6A 3VH4B 1TWGH 3S2DH 2MBBB 2KX0A 3FILB 2REXA 4ZRIA 3SFEB 3TEZA 1C7YA 3TCAA 1B53A 5A2QE 2E76C 2CHXA 1MG8A 3KYCD 3ZJTA 4US8A 4MTKA 2KJHB 1STYA 2E2JH 5T8IA 1PYWD 5C4XH 3IG3A 5C1ZA 2KVRA 5CV4A 3F8TA 3H09A 3W2DA 3CIRB 2WINB 3RN2A 1PH9A 3DPDA 2X8XX 3HEJA 1FVIA 2NVXH 2MEKA 3DBLI 1WZ3A 5LXHA 3V3XA 2BS2B 4EFOA 2LY7A 1F9JA 1PGBA 2JSVX 3M9BA 4URKA 4IOCA 2EYOA 2VL6A 4PZ8A 4YY3Q 2JA5G 3CMAA 1JE4A 2LXKA 3TDQA 4X6AH 1MD2D 2RDHA 2D9UA 1HFNA 2K52A 2Y5CA 2W3SA 1PZJD 2MRPA 2LHDA 3ZW3A 3J80E 4LTUA 1X3EA 2CQAA 4TKNA 3OPOA 3L08A 3W9CB 3NENA 2M0AA 4A3EH 2R7ZG 1GJZA 1ESRA 5KYLA 4PS3A 4KDLB 3DBHB 2QDFA 3VR8B 1WD1A 4YCUA 4RM8A 3VUYA 1HNWL 1RTNA 3S1MB 1WGGA 4BXXG 2N1VA 4J8QA 5HGTA 1KL9A 2MJDA 3F1ZA 1EFID 4GKKQ 1MIUA 1JW9D 3ZNZB 2RSNA 4DAPA 2NPTA 3KWVA 1WJUA 5J39A 4TSSA 3VR3A 1IYVA 2BYTA 1HTQA 4CJ0B 2D5GA 1TKGA 3HOZG 1TWFB 2Z0EB 1CMXB 1EEFD 2JP1A 5M5XH 4DV6Q 5E1FA 4YTNB 2WP8J 4WFN3 2LGSA 4R4QA 5L83A 5IP9H 1MJEA 2MGSA 2MHJA 4B3SQ 2JUOA 5CORA 4E3CA 4A3MH 1E22A 2MP1A 3QWZB 1SLJA 4C3JG 4S0RA 1IL8A 1IYFA 4A3JB 4LFAQ 4K5VA 2IWHA 3TBLD 2B2YC 4EOYA 3I57A 1BCPF 2QC8A 1SJED 4A3DG 3K5NA 2KMAA 3NPPA 1TS2A 1JWSD 4K3BA 2Y0SG 2BH8A 1KNEA 2ZM6L 4A3BG 5C4HA 2R93G 4FXCA 4ARCA 1H9SB 3E6ZX 2F1MA 1VCIA 3EJIA 4JI5L 1F9PA 2JSOA 2PQAA 2PMZE 1LT6D 4X66Q 3PVLA 4I6PA 1CSQA 2CHBD 3CAMA 3GP7A 5IWAL 3D31A 2BGFA 2J4XA 4IFDJ 1E5WA 1FYCA 4H44C 4F8CB 4PYUA 2N7DA 4K0KL 2EELA 1M8AA 1OO9B 3N3KB 3KYHC 1VQGA 5FO7B 3S15H 3I73A 3T1YL 1Q81C 2UUAL 1FCCC 2HUGA 1TGZB 3GOEA 3NJTA 4WWPA 2R3ZA 3MXPA 1QQRA 2ZVNA 4HKZE 1ROEA 4MGKE 5C3EB 5CMDA 1AWDA 1WY8A 1PH6A 3CKIB 3P4SB 1HCZA 3KFUA 4HPLB 2JRHA 1AFPA 4IALA 3AECB 3I4MG 1N33L 4YWMA 2D2CC 3EECA 4POGA 1EWIA 1P0RA 5EQ0A 3KWLA 3KF8B 2JU6X 1HNXL 1KAWA 1YIJA 2VZKD 3BZCA 1YN3A 3BJUA 2VB3X 5T1GA 2F0IA 3N6RA 5ELNA 5G3LF 4R8IA 5FKAC 2RVLA 5IGCA 3TN2A 1OGWA 1IW7D 3FKIH 4GN5A 4I6NB 5HGQA 3UIOB 1SBBB 1Q3LA 5JEAJ 5CV5A 1Y8OB 4HSPA 4PV1C 3D8GA 3CF6E 2KHWB 1XYIA 3MEFA 3CW2C 4FXGC 2E2IB 1KHIA 3HOXH 1YX5B 1AE3A 2A73B 2LGIA 2MJ3A 3FMCA 1EO6A 3M7GA 4GDLA 2JA5B 3CU7A 5NUCA 4DR5Q 5IP7G 1QVCA 1XXGA 1JB7A 3RNFC 3NBHB 2KHSA 3PIP3 5IYDG 3U7DA 3CMMB 4XXEA 4JX1C 2IZVB 3K7AB 1VQJA 1UH6A 4HDQA 3F2BA 2LUMA 1WXQA 2R7ZB 1WGHA 2RDFA 3DUZA 4DK0A 1EL0A 2VUMH 2BE5D 2QF7A 3DWGC 1MJCA 3KBGA 4KKSA 1VLBA 2KYWA 2RDGA 3BYYB 3Q69A 1H9JA 1QE6A 1VQHA 2JYEA 1K8MA 1VQCA 3D0FA 1NBFC 1S72A 3FP9A 4Z9CB 3ABVB 4IM0A 4LNNA 4PS8A 3UDGA 1E2WA 2F0JA 1ZEQX 2N9XA 1TU2B 1A62A 4AH6A 1XEEA 2F0LA 3RZDH 4TQ0A 4DNIA 3HOZB 1N5WA 3Q3JA 4OWTB 1D7QA 4HAEA 4M8AA 1KFYB 2QDBA 2L7RA 2GN5A 4JV5L 1GXDC 1KM7A 1SNCA 5IYCH 1YOVB 1SNQA 4DNTB 4WWNA 2KJRA 4C3JB 3S1NH 1TWHB 5IGDA 5C4XG 1EIYB 4LNQA 1K83H 3NE5B 1OQQA 3NVVA 4YTPB 4QQBX 3H7SA 4XDCA 4BAXA 1KDCA 2I46A 3OOCA 4A3DB 2OTJA 4AWJA 5IWAQ 1N62A 1XMQL 4W9LA 1YJ1A 2ZJQA 4FBJB 4A3KG 4JL9A 3R2IA 4FF1A 4AIMA 3FKYA 3U2SC 3W5UB 2Y0SB 4DK5A 1TIID 2HQEA 3Q6BA 4DK1A 2UUAQ 4ICVA 4A3BB 2KQ7A 1X54A 2IW3A 1PH4A 3RZOB 3MXNA 3W5OA 1TQOA 4A3EG 5EPJA 2XBBC 2XIWA 2WXLA 1L1OB 1BDOA 3DWQA 4XC2A 2B2YA 1BR9A 3HVDA 1VF5C 4L8JA 4QIWB 2A68D 4JBMA 2IBIB 3K0YA 4GOCA 3B6YA 1PTOD 5L37A 1SROA 1TIFA 2KZRA 3DBSA 3DVGY 4LDTD 2DENB 3KDFA 5AFWA 1UELA 2F3VA 1C79A 2J42A 2ON8A 3BZDB 1JQYD 3KYDD 2ALYB 3N52A 5J3BA 1X56A 3ECIA 1FIQA 3M62B 4K7SA 4JI7L 4KDIC 3ULLA 2I38A 2I5HA 1RHPA 3I4MB 2TMPA 1SXTA 4BBRG 2V4IB 1Z5SB 2FMMA 2MW5A 3MP9A 5IP9G 3OMGA 2XSCA 4NDXA 5C44G 1IBMQ 2DAFA 2LJIA 4XX5A 1JICA 2YU9H 2N4FA 2MLBA 4BS9A 5DPTA 2EIFA 2IY5B 5C5MA 4AQYL 4N8FA 1WTQA 4FYDA 1U4AA 2ZW1A 4GLSC 1C9FA 3IFDA 1NMGA 1LTTD 1E0ZA 1VQPA 4A3GH 3IT4B 3LB8C 5BMIA 1PRTB 5IGBA 2GBNA 2WDRB 1C4QA 1SSOA 3AB9A 4XZ4A 4IUUA 3IVFA 3LNNA 4XQQA 1F2RC 5LXIB 4K5WA 2JX5A 4A20A 4GLXA 3NUCA 4NPSA 5FLXc 1QOGA 2GI9A 4LJOB 4W9GA 1F9RA 5IYBH 1VQ6A 4WAFA 2NBWB 4PS7A 1KTKA 5CBEE 3N1ZC 3P75A 1TT5B 2WYQA 4IOIE 3UE0A 1HA6A 1QCBD 1I4HA 4CDCC 1EY0A 5CV7A 3DHHC 4RNAA 4EQPA 3NY5A 1C3TA 4DV1L 3DBLB 1KIXA 4CGYB 4FXKC 2XWJB 1DCZA 4IUTA 3NVYA 2NTSA 3V62A 2MFIA 2NUCA 3A56A 3RMHA 4DXFA 5HI1A 3K59A 3N1YC 4BY7H 1I4RA 2OTLA 3PQIA 4JV5Q 2FINB 1NEKB 2K8BA 3T4AC 4TMAB 3KUZA 3JAME 1C77A 1WYGA 2K5PA 2RSUA 3U7ZA 2IHFA 3WDNA 1WX9A 4V0BA 1XMQQ 1TWGB 1A3UA 2L0FA 1N9WA 2NS5A 4P1CC 2FCMA 2KENA 1CT1D 1XLPA 4QY7A 1I4XA 2GVAA 2A1AA 2CFMA 3RZFA 3FDTA 2N7EA 3WWVA 5H1SE 4RG1A 4WJ3M 4QAYA 5EE9A 2MPMA 1YD8U 3JSVB 3MC9A 3AMZA 3GTPB 4DAMA 1IGDA 1VQBA 4A3KB 2C7MB 2CKHB 4CYEA 4GLVB 3HOXG 4P71A 4JK1C 1MSGA 1B9NA 3VAWA 5FJ8G 2DGYA 4DV5Q 4HIOA 2N55A 2WXKA 3OHXC 3I3CA 1QLBB 1EY8A 3Q3MC 3GD7A 4HR7B 1GHJA 4RKBA 2N49A 4JI7Q 2F0GA 2KJXA 4A3EB 2L15A 4HDOA 4PQXA 1PA6A 4KIKB 1TKYA 4HJ9A 1OFFA 2ONQA 3T8MA 3TP6A 2VUMG 3CCRA 4A3IG 2KJ6A 2IY0B 2F0FA 2BH2A 3RPFC 1A5RA 4BBSH 1FCLA 1I94Q 4CQNA 3EC8A 2BB6A 2E5LL 1VQ4A 3V61A 1G6JA 1RL2A 3UQBA 3OG5A 4IPDA 4KTAA 2L83A 3D32A 1ZGUB 1PUTA 1VZ7A 1V1PA 3BDLA 3K57A 2RKSA 5IODA 1YJJA 1XNQL 1XNRL 2GVBA 2M8SA 2V1YA 3VA7A 4DHJB 1VQDA 2KQ3A 1B70B 3V2TA 4BBRB 5M5XB 4FXDA 2JWZA 4ULLA 2O2VB 2NZ1D 2PW9A 4OX9L 1W6KA 4WH4A 4RA8A 4DWFA 5C44B 2WX0A 4HLEA 4FO2A 2A69D 1S3OA 3H0GH 3U8ZA 5EBDA 2V3SA 2G1EA 2BF8B 3S1RH 4GOPC 4C1NI 3N1XC 4HKQA 2YTXA 4PG3A 2LASA 1MI2A 2WGSA 2M00A 4KHPQ 3U58A 3A4SC 3MAQA 1DYQA 3OJ4B 3K5MA 3E3XA 1II3A 2GMIC 1V1QA 5CYUA 1LV9A 3PTFC 3N30A 2DJFC 5D3DA 2LXJA 1HEZE 1SJHD 1A3TA 3PPAA 3D4RA 1X65A 2MQHA 4B0MA 4FDBA 2ZNVC 4P72A 3GTOH 4I7ZC 2FXQA 1NDDA 1U9RA 2D10A 2WDQB 1DOYA 2JQOA 4CBVA 3MHSD 1CA5A 4IUPA 3MTNB 4MSMB 2OEOA 1HE8A 2TSSA 3RN5A 1I5FA 1KD1C 1WTWA 2AL6A 2KAJA 4MH0E 5HKHA 4RF0A 2PEAA 4LAAA 5ELOA 4IM3A 4DR1Q 2Q5WD 1CZWA 1WWTA 3RLFA 1VCBA 2J0MA 4KN7C 3A0JA 4E71A 4FHJA 4XQJA 1HNZL 1J9OA 2V0GA 3K8AA 1CUKA 1F77A 5IY0A 1AN8A 2PW7A 1ICFB 4QB4A 1C76A 4GKJL 2EY6A 1L6UA 4DK6C 5I4DA 2W55A 3AB5A 3K9PB 3EQLC 2H89B 4C4VA 1N34L 3S1MH 2IX0A 4HIDA 3AYHB 3ITPA 3KF6B 2I0QA 1ISNA 2INDC 4FNFA 4YL8A 4ZLTF 2NVYH 2NBUA 4A3GG 4LFCQ 2HE7A 1I3QH 2WV6D 3H3VI 2F0UA 4MIUA 2WQYB 1EY6A 3ZO5B 3TL5A 1PVOA 2KVMA 2E2DC 4A76A 2K75A 1TBEA 4KJOA 3NHHA 4HJ8A 2I1JA 3AEGB 4LF9L 3HOYH 1TWFH 3A7AB 3UGBB 3DLLA 3HOXB 4HRSA 1UNSA 1HTPA 4ACFA 2IO2B 5IYBG 5EKKA 1BBWA 4DUYL 3KF8A 3HOUG 4L5SA 1Q10A 1SF0A 3B2GA 2DNCA 3KLSA 4A3JH 3H7PA 5IT9L 2NN6H 3RCZA 1KLGD 1BO0A 1WTHA 3CP0A 2F0KA 3V6EB 1OXUA 4TQUS 4QUFA 5JOBA 4R4CA 3ZNID 4NXNL 2NVQB 1N36L 1HZ6A 2PI2E 1J5EL 2OXPA 4FULA 2VUMB 1TY0A 4A3IB 2L52A 4LF7L 5CV6A 4GN4B 3OIPA 4B9XA 4DR6Q 4P73A 2PKOA 4KKJA 2KVZA 2L76A 4MN3A 2L4NA 2N9LA 3WAMA 5LNK1 4NZLB 1JT8A 1RJTA 2MH7A 4DKAC 2KCTA 4G0NB 3NSWA 4X64L 3IAS1 5G55A 4JBJA 1HH2P 4MHEA 5I6YA 1DOXA 4C3HH 1ZPSA 2F3IA 4PNYA 4F8MA 3CMEA 4ANUA 3ZRFA 1EU4A 3NBHA 3HKZE 1BQQT 2BW2A 3E9SA 3L2PA 5JH5C 4LF6L 1IKLA 2N9EB 1YHQA 1CZGA 4DAYA 2DNFA 1BVSA 2JK8A 4X65Q 3ERQA 3AV8A 1HZBA 4I6LB 4PYZA 2ZXRA 3SU8X 2KOXA 4LF8L 3RR5A 2E74C 3SDLC 2PJHA 3GTKH 2NN6I 5C3EH 2JYTA 3P2BA 1C78A 1C48A 1WX8A 2BBCA 2GRIA 1JJ2A 3D6CA 1UD7A 1V8CA 3R8BA 2K5DA 4JOIC 4OO1G 3AH7A 4LJPB 4HMJA 1WTXA 1U0LA 2HD3A 4UAIA 3B08A 1SFOB 1WH3A 1ASZA 3U9SA 5IN7A 2QW7A 5EDSA 2BOSA 1L0VB 2I5MX 1B7YB 2EJGC 4JI8Q 1JWMD 2EDGA 4EGVA 2VQEL 2CW0D 3MFGA 1MI0A 3KUCB 5GROA 2KDMA 2XRSD 1EU3A 1PH3A 2JXTA 3I4OA 2DHZA 2C5CA 4A6QA 4GNXB 3CCJA 1WXSA 4XGAB 3CSTA 4BBSG 3CC4A 4GOPA 2K14A 1E8ZA 3FHWA 1R7SA 3OTOQ 1PRTF 2WX1A 1FXTB 4XE0A 2XGTA 1EYGA 2JA5H 4XT1B 3TEHB 1YJIA 3M7NA 4A3CG 4BA1I 2GBJA 1FNWA 5J22A 3C0RB 3A8KE 3K7AH 5M9OA 5FO8B 2R7ZH 5GXGB 1EIGA 4O0AA 2ZZPB 3PUYA 4JBKA 4R4OA 3C1FA 2C9OA 5BMHA 3QC8B 4DV0Q 1P3QU 1BOSA 3SE0A 4LJZC 3KUDB 1XQQA 4BXXH 3ZLZA 1A15A 5I6WA 1KDBA 1XTDA 4A3GB 2MX2A 5KNCA 4J6IA 1X55A 4IM2A 4KHZA 4NXNQ 4QF4A 3SGIA 1J5EQ 2RMMA 4KK7A 4RMFA 4D2KA 3P4PB 1JE5A 4LF7Q 1JCKB 4OHJA 3HOZH 1ICWA 2XK5B 3B2FA 3RLNA 1NENB 2LFNA 2RHSB 4HJAA 2VXWA 2FBWB 2F0WA 5I2XA 2IGDA 2KMCA 3HOUB 4DR2L 3EGRA 4N58A 3UF8A 3TBIB 3S16B 4C3JH 1TWHH 2B2TA 2E6XA 5E3FA 3T3NA 3WA0A 3N20C 2WU2B 4A3DH 1WOCA 2INCC 2ZJPA 4C7YA 1GNUA 1FR3A 1U5KA 4DPGA 4TUUA 4LF6Q 2ZCBA 3P42A 3HKZG 1LACA 3NK9A 2E2HB 1J7BA 1PV4A 5KHQA 2CCZA 1XLOA 3ENEA 3P4QB 4IQZA 4CJ2C 4L5TA 1N60A 1K0SA 1SE2A 1L0WA 1SAPA 3F2DA 3NUHB 4RHSA 4A3BH 1H9RA 2UUCQ 4LF8Q 3A9KA 3VYUA 2O5JC 2OQKA 4OGQC 2CHWA 2LGDA 1GUWA 4MJSA 2KN4A 1EQRA 1YNNC 1RWSA 1MPEA 1PMRA 4B3RL 3M95A 2BVCA 2IHEA 4EVOA 4JI4Q 1C1YB 1Y8RC 3FAHA 3T16A 1LT4D 2HHHQ 1L2NA 2G5DA 1IBXA 3T13A 3A5ZB 3W3AA 3HS0C 1YN4A 3PHXB 3X3NA 2QJLA 3Q2AC 2LVOA 2Q8RE 4DBGA 1LTLA 3RNUA 1JOKA 1E8YA 2DN8A 3DVNU 1IL2A 3HOYG 4ODGA 3I4MH 2D0OA 1IPGA 1SIFA 1W6JA 1RF2D 2JA6G 1A63A 2WIIB 1Q46A 4B3MQ 1GG3A 3HFZB 3HK0A 2CS4A 2DYOA 3QX1A 3CRKC 1IZ6A 2QIEB 1VQMA 3C8YA 4K7WA 2NN6G 2RSOA 1WXMA 1R9TB 3WCQA 4BZAA 2JWUA 2QILA 2F0QA 2ZXPA 1I4PA 1T6BX 2LGXA 1G2TA 5JPMC 3MTSA 2K5WA 3U4ZA 3WAOA 3MWYW 3H1UA 3PIOA 4BBSB 4EZJA 4YWLA 1SYDA 3C46A 4JOIA 3JSVA 4HCSA 3IAYA 3AXCA 1YIWA 2YEPB 1VQ5A 2HD5B 3Q3OC 3WALA 4RCNA 1CM9A 1TTNA 3QR8A 3Q8AA 2AYOB 5IP7H 1ZDXA 4C3HG 2ASBA 1QVGA 4ME3A 3F2UA 4X3TA 5IYDH 2ZTEA 1OTRB 3GZNI 3LDZE 4F7XA 5IOIA 1LFDA 2JZZA 1SGHA 2ZW0A 1F52A 4QJFA 1CK1A 1J8IA 3SK5A 5HG2A 1H8CA 2D0PA 3RD4A 4XT3B 1YN5A 3RUIB 2MP2B 1WMHA 1F2ZA 2JA9A 3NTKA 5EAYA 4NXMQ 2WXMA 1BCPC 2D3GA 1D2BA 4LUVA 2KTRB 4JBWA 3PRMB 1RODA 1UUPA 5JJLA 3I8ZA 2VZKB 4LFBQ 1JALA 4DR3L 1PFSA 2WXGA 2Z0DB 1S40A 4DV2Q 2QEJC 1J7AA 4K6DA 4IJHA 5EGTA 3RMKC 4HROA 4KY7A 4APVA 1VRAB 3ND9A 3R66C 4G4KA 3PS6A 2KEEA 2G4SA 2DZMA 1GAQB 1DM0B 2PZUA 5M5WB 1S5ED 1UWMA 1WFQA 3GTOB 3R7QA 4TQ1A 3GTPH 4DNRB 3D6WA 5GAHC 1WJ4A 4A3KH 1YZ6A 3HKZB 2J7QB 5AUKA 4ID6A 2QDLA 4ZUJA 1TJEA 4J1MA 4YCVA 3DWMA 1QKZA 3U52E 2KWCA 1LYLA 3MFYA 3CCVA 1KABA 4O1NA 3ZUNA 2LHEA 4AJWA 1V9PA 3HKSA 4REZA 3AE2B 1BBXC 4JI2Q 1C4CA 3HRZC 2CH4W 3AQQA 1GUAB 3ONAB 3RN9C 4K14A 1E7PB 3BG3A 5C4JB 4WIPA 5FLMH 4DA2A 4F7ZA 3TEWA 3HOVG 3GS2A 2NVYB 4KKUA 1STGA 1L7YA 4RGNA 3GO5A 1I3QB 2G4DB 3TMEA 2ZPNA 3BVMA 3A9JA 1T0QC 3HOYB 4BBRH 3ZKJC 5DM63 4BKSA 4DK3C 2N7JA 2CQOA 1TR5A 3UE1A 2SOBA 1XMOL 2JA6B 2NCNA 5C44H 5GAEC 1PQSA 4OVZA 1ZYRD 2MO1A 2I07B 4IUNA 4J6HA 3S2HB 2ZTCA 2EZVA 1WZ0A 1S4ZA 3EN2A 2J0JA 2XN9C 5D3IB 1RCVD 1Q82C 1V86A 2FE8A 1HZCA 3DM1A 2J52A 5BMGA 3VTVA 2ZCCA 2X6GA
chains in the Genus database with same CATH topology
4ZOHC 4IDIA 1Q1EA 2EYPA 2KMMA 3A55A 4XIGS 1G91A 2WU5B 4KKTA 2CU3A 1PTOB 1OXVA 4C3HB 3BDCA 1QJOA 3H8HA 1DD2A 2PYKA 1JORA 5D7GA 1QB5D 1V1OA 2KACA 1SYEA 3QB3A 4RWSC 1SMYC 3NZ3A 1EY9A 3GTKB 1AZQA 4KHVA 5ELFA 1QNUA 3FPUB 1D1KA 2EY1A 1T5XD 5C2TB 4IFDG 4DQOC 1B50A 4A90A 1BUIC 1VR9A 5K5PA 3U9OA 4XDXA 1CA6A 3M85A 1A6XA 3FPPA 1FO4A 4O42A 2AQ2B 4RAUC 4OL7A 1QG7A 1DONA 3IFTA 3P63A 1HQMC 4LK0M 3URYA 1XLNA 4Y7NB 5D14A 1L4ZB 1PFBA 3U4EG 3P20A 4OZBA 5CBAE 2A6HC 5JEAG 5BN5A 1JMLA 4ILWA 1V43A 4ZRZA 4KY6A 4M0WA 3HOVB 5I9PA 2L5TA 2K03A 2BS4B 1CTMA 1DJRD 1HXYD 2BCOA 2F0PA 5C0XI 1F9QA 1GJXA 1FXAA 2NTTA 2WKDA 4H7BA 1FGBD 2NWGA 5KNBA 2L32A 3K6OA 1PFMA 3M3YB 2OF1A 5DM73 1HFGA 2WXNA 4CJ1B 2MHVA 2WXRA 5E6JA 2DYMA 3H6MA 5ISRA 1C8CA 3KLSX 1QOAA 3DHQA 4NP5A 4KKIA 3QJYA 3V96A 3TZUA 4IUVA 1BUVT 3A8JE 2PNRC 3J9CA 1WTVA 3J81L 1O7ZA 1X32A 1B1ZA 4G57A 2BT6A 3AE7B 1X3PA 4CKBA 4ZK9B 3ND8A 1ESFA 2B2UC 4N6EB 2NVTB 2B63B 3NXWA 1QOFA 2YEPF 3Q23A 1O80A 5CR3A 1EEID 1O7LA 2K6AA 4K2KA 2ACZB 1HTLD 1S5BD 2EYHA 4ARIA 2F0DA 2F03A 2PPBC 2LFIA 5EPKA 4ZHOA 5H92C 2EJFC 1RKNA 4ZKCB 4WURA 2QCPX 1JWAD 1ENFA 1YNJC 3VR6A 1TT2A 4N9TA 3SVMA 5K36G 1PDXA 1SIJA 5LL6S 2PVOD 2A68C 3HUIA 5KRUA 4M1UB 1GUNA 4N59A 3DMUA 1E6EB 4XWWA 3VYRA 3Q22A 1EYDA 1R4QB 1I7HA 3GTQB 2L1AA 1Y56A 4MH8A 4I65A 2DWQA 4XDDA 3JAML 4ZAIA 1E2ZA 2I2YA 3TZDA 4ME5A 2IX3A 2A6EC 1WD0A 1CFMA 3AU7A 2N88A 1OXSC 1ZKOA 2JE6I 5C6AA 3SXHA 2EJMA 2RPVA 2PMZB 5C4ZA 2WS3B 5D65A 4OO1H 5C0XG 3D4WA 3AEBB 2OEDA 3FILA 4RGOS 2EYMA 4WQMA 5M3FB 2PO4A 3OSOA 4WWMA 2AUJD 4P16A 4IURA 1HPCA 2EXZA 5DEHA 1VZ6A 4A8XC 2L0CA 4QUCA 4MT5A 2Z8LA 4KMUC 3ZYYX 1HUNA 2B8FA 3HG9A 5I2YA 2K3UA 1N5XA 2JEAI 5E4WC 3VRAB 1KRHA 4GDKB 1GUOA 1TS5A 4OO1I 1Q90A 3L7ZC 4C2MB 1PTOF 3ZQ4A 5JJZA 2EVBA 3OMCA 2WXJA 2H88B 3KK7A 1Y1VB 2NYZD 4RFBA 1ZUD2 5CV8A 2QMTA 5IGGA 5G5HA 2B2UA 2HTME 1DOIA 3Q8EA 1ZDVA 2F0SA 4YWGG 1F9SA 1U4RA 1L0XB 3SEBA 4ZHPA 4KN4C 2BA0A 3A54A 1HA5A 1TVXA 4NAMA 3VYTA 2WXPA 3VR2A 1KDAA 3HVZA 1RDPD 3KUPA 5FOBB 1PGXA 5EE0A 2CJOA 1FD7D 3I72A 4HEA1 2BB5A 4C3IG 4C7ZA 3ZJUA 4R3DA 1CHQD 3CWIA 1FXIA 1ACCA 4R8NA 1QOBA 2HCIA 5IIFA 3MVVA 1VZ8A 2LMCB 1E2VA 5A35A 1H9SA 3BIID 3KBXA 1K51A 2XVSA 3RFZB 2A69C 3I91A 1CHPD 3TP8A 5H8YE 3M4OB 2B2TC 2F0VA 3M4YA 4RHRA 3PIO3 1QILA 5JAVA 3AE5B 4DXGA 2ZT9C 2ICIA 2L11A 3FVQA 1PRTC 2WACA 2Y3AA 2BDNA 3PZ8A 5C3JB 2K22A 4DU9A 4KX6B 2FJ2A 3PO0A 4L2YA 2PLPA 1BF4A 4HEDA 3I90A 4YSZB 4ZQ3A 1J7CA 2CJNA 1TKWB 1L5PA 3BVZA 2IX1A 1L0YB 1IYUA 1XTCD 1B2TA 3B9JA 5BYQA 1NVID 1HQRD 3TUOA 3C2PA 5IT9E 2M19A 2KCNA 1AEXA 4PMCA 1PTOH 5FR3A 3A7LA 2BS3B 3OWFA 3AEAB 5COYA 1Z47A 3VA5A 3SDZA 2IGGA 2M2LA 4FP5D 4MACA 5KNDA 3BWUD 1JRPA 2IGHA 2MUYA 3TP5A 1D1IA 1EIHA 2W54A 2IT1A 1XCTL 4WRDA 1SNMA 4JWUC 2HDEA 3E5SA 4KV6A 3HGBA 3MXUA 1NCVA 5EBCA 5KEEA 2E75C 2J0TD 4L1BA 1F2YA 1SNPA 1TY2A 4R9WA 2SDFA 2L9HA 1CZPA 2DBYA 4C3IB 2XNAC 4U68A 1EQTA 1LTAD 1F2RI 2WKCA 4KGSA 1IUEA 2VB2X 1D6EC 3ZGZA 1I4QA 3PUZA 2KECA 4MM3B 1GHKA 3QOJA 3SR1A 2JQRB 2V3PA 1B3AA 4B0EA 1ET6A 4ZRPA 1ZE3D 2JZPA 1Y8PB 1GB4A 1G291 3DWAA 1EZ6A 1DOMA 1B9RA 1VDZA 1XWEA 1EY7A 4S3SA 3T53B 1WTPA 3WOFA 4JE3B 5I9OA 1FM0D 5HFYA 1YNND 1LT3D 2F0TA 2W3RA 1SE3A 2K01A 5EE3A 2Y5PA 1F2MA 2K05A 1LTBD 2A74C 1STEA 2X38A 4IN3A 1K8OA 1I50B 2K32A 5HURA 3AMUA 3BK2A 2F0MA 2O5IC 2BTEA 1N63A 4XWTA 1OQRA 3AE1B 1ONLA 5FO9B 3DXJC 3WOEA 3VQIA 2VNUD 1E10A 2M56B 3S1QB 3G7LA 3I4NB 5FLXE 4ZKBB 4ITKA 2Q8IB 5M3MB 1AZPA 2AQ1B 3QO2A 2WXIA 1STAA 3HP3A 2ZXOA 3VR9B 3MZ5A 4IFDH 1FFVA 4EQNA 1TS4A 1SEBD 2Q8TA 3BS1A 2JA8B 2PMVA 4DAVA 5T1IA 3P1MA 3AE9B 3E56A 2YYZA 1G2SA 1D5ZC 1NUCA 1WSPA 5E4XA 5JVG3 1BCPD 3T56B 5BN3A 3K5LA 1GOZA 5ELCA 1Z7TA 3P4RB 3PO3B 2XRQD 1LO5D 2Z1CA 3BK1A 1I6VC 3D3RA 5JEAH 1CQFA 1OXTA 4IFDI 1SYCA 4NAWB 2EYJA 2F4IA 2M9VA 3BDOA 1LTRD 2AQ3B 1I6HB 3TSSA 3TEYA 1RM6C 2WXFA 1V8QA 3Q24A 5EKLA 1EM7A 4H2AA 1NAPA 4HJGE 1YNTE 3H91A 2IJ0A 2K0PA 1HRJA 3CHBD 2BA1A 5A2QL 3AM9A 1FFUA 1JC7A 1GUSA 4OW0A 1TWAB 4XYOA 3OIQA 5G3LD 1VDVA 2B2WC 1F0ZA 2PZTA 3NBIA 2PTLA 3FC4A 1FEHA 3IKJA 1XF5L 3NQIA 2D62A 3ETRA 1QF6A 2O2LD 2EE1A 1ENAA 1E0BA 1RD9D 5IOCA 1LTID 2DLBA 3BYTB 3J80L 3EVQA 4EE2A 3K5OA 4JWSC 1MBYA 4RGTA 4LLGM 1GB1A 5EE1A 1O78A 1RTOA 1V1PB 1WGKA 5DAUA 4PT5A 2LMCA 3RUZA 3Q8CA 3NVZA 3MA2B 5CC4A 1ET9A 3HRDD 3L9AX 2KWDA 2DY8A 1SE4A 2RQXA 5F2DA 4G7ZC 3HZXA 1PLFA 1PZKD 1Q12A 1NYRA 2L12A 1DXMA 4OZAA 2KUMA 1JWUD 2K1BA 5K36H 2NB0A 1STBA 1SMYD 4X3SA 2EYLA 2B76B 3SK6A 3W5VB 2AX5A 1MHXA 1L6VA 5MPOA 4KJNA 1UGJA 3R2TA 5M5YB 1HHVA 1ILQA 4TKOB 4DFAA 2GA4B 1Q8IA 3TEXA 4K8IA 2EKIA 1VF7A 4XYQA 1NR2A 2JA7B 4H13C 1AW7A 2AWNA 1ZYRC 1QOHA 2JXMB 4LMQD 1IHZA 4KI0A 1HZ5A 2A6HD 2EPBA 2OT2A 1Y1WB 3R3OA 3KQ4A 2PVGC 4K6LA 3SK8A 1NSNS 3NWTA 5EPLA 1KH0A 5C0XH 3H94A 1LTSD 3N9YC 4CKCA 2KQ4X 1E9MA 2MJ8A 3EFXD 2FMCA 3X3MA 1TYGB 1STHA 3GQBA 2B8GA 1FNVA 1EZ8A 5LL6X 1P7EA 2B2WA 3J7AV 4X3UA 3NRZA 4XTCS 1BXTA 1C4PA 1LT5D 4A3FB 2AUKA 1A2TA 4C56C 3AE4B 2EY2A 1A2UA 2Z4HA 2EOTA 1PGAA 1IW7C 1WCMB 4C80A 4RCOA 4P6VF 1JROA 2PQEA 3O13A 3AEDB 2L55A 4K8JA 2WXQA 1SDFA 2R92B 4L23A 4L63B 1EY4A 4FF2A 3H3VC 1M4VA 3C3LA 1QWYA 4KY5A 2RBMA 1SNDA 1QNKA 5J1ZA 4ZYSA 4KD3A 1ENCA 1VMCA 2ID0A 3S9WA 4A93B 2BE5C 4K5XA 4A55A 1PFNA 2J7ZA 1ZOYB 2J53A 1YQ4B 5G5GA 1ML0D 3IXSA 1MSHA 3AE3B 3SK4A 2FHTA 3GTMB 3ZJVA 4HN7A 3KLRA 3SHLA 3MEHA 1EWYC 2R93B 1F2LA 1YNJD 1G6ZA 4RF1A 1ILPA 1N61A 5KGUA 3J81E 3MHBA 1IGCA 1H9MA 2OHFA 3DEOA 2LS01 2DNEA 3I4LA 5IGEA 2XWBB 5BYRA 3GTLB 3DEPA 5HHDG 2B39A 3VRBB 4ZRQA 3MHZA 4QMGA 3NP8A 5JVH3 1PTOC 4AS1A 4P2CB 3K58A 4HSVA 3S14B 5C5LA 1T5EA 2PIAA 1G8ZD 1WVLA 4YIJA 4NMZA 1L4DB 1NYQA 4HCEA 2A6ED 5CV9A 1MVKA 4NJCA 3GTJB 2EY5A 4DN4M 3PO2B 1Q1BA 2AWOA 4N9PA 3CRLC 3W1SA 1FD6A 1OXXK 1AP0A 1MHHE 1T3QA 1K52A 2GB1A 1IBXB 1C4AA 1K53A 2W82A 4BY1B 3MXGA 1KF6B 2F0NA 1D5MC 1DOLA 2DY7A 3SR6A 4ZUIA 1IKMA 2WP9B 3I9V1 1TS3A 1KAAA 4AQ7A 3S2DB 5C0XJ 1DOKA 1TWCB 4BA2I 1SYGA 4Q2JA 3VR5A 2IDYA 1K50A 1UWXA 3V05A 1B44D 4LK1C 2D5DA 1KLUD 2E2JB 5C4XB 1B4OA 4Q5VA 1LLRD 2NVXB 5KYIA 1ZXTA 4IUQA 4H0LC 1VJKA 2ICEC 1V97A 2K28A 1DGJA 1XO3A 1JR0D 4US9A 1FRRA 1JWBD 1P7FA 2PCFB 2N9KA 4CHTB 5ELEA 4QCLA 2WB1B 2K33A 5C3WA 3AN1A 3BVGA 4Q0FA 3T3OA 2F0HA 3L3OC 5CGKA 1QT9A 4WJWA 4F87A 1CI3M 3OWEB 1U4LA 1A3VA 4G7HC 2IPKD 3Q8FA 4A3MB 3MJ5A 2V4DA 4L6TB 1EWHA 3AEFB 3LWEA 1U4PA 2B2VC 4J3OD 3LYYA 4ABNA 4IKGA 2K7VA 3AE8B 4B08A 1D4BA 2KEDA 1ZP0B 1RFKA 1PRTD 5BN4A 2WXHA 4B9WA 5ELBA 1FNUA 2O4XA 4IZ8A 1B9MA 1SYBA 3GTGB 4UDUC 4X3KA 3E0JA 1JOQA 1PZID 1AYFA 3D4DA 3S15B 2WLBA 1WRIA 2SNMA 5TSSA 1GUTA 4TRDA 3CQZB 1Z6HA 1EYCA 1PDQA 1CQVA 1SSNA 2FFKB 3R93A 4CKEA 3LX0A 4G7OC 4FF4A 2K04A 3AEEB 4YTMB 2RA4A 3GV6A 3NQTA 3FKIB 1PFDA 1BMLC 1EWCA 1S5CD 1Y69U 3PUVA 5ELDA 1ZXHA 4OIJA 4NW2A 1S5FD 1X3QA 3P1HA 3QWNA 4XQNA 4KGTA 1R4PB 2KA7A 2F3WA 2SNSA 1S5DD 1WTOA 3UI3A 2V3NA 4A9AA 1RYJA 2HCCA 4HMIA 3C1EA 3RZDB 4RKLA 2K9XA 3NS1A 3PMFA 1TKEA 3Q8BA 1BCPB 1HUMA 3PUXA 3FEWX 3S1NB 5FK9C 1K83B 1SYFA 2SEBD 2INPE 3I70A 5EJWA 4GDLB 2SAKA 5C3XA 1MGSA 3PV0A 2N0SB 2BDOA 2IL8A 4YSXB 1YMHE 1NI3A 1A70A 2L1BA 1FRDA 2MJEA 3SFDB 2QKIC 1VMPA 2R6GA 1LABA 3AE6B 2B2VA 2CVRA 4YXDB 2JYOA 4K2LA 2K5QA 5DNFA 1XLQA 3NTIA 4DF7A 3IT6B 2CW0C 2WXOA 3NVWA 4DGZA 2HDMA 4OZCA 1YQ3B 3LXFA 3L4PA 1PXUA 4FVMA 1EQVA 3S17B 3PUWA 2YU9B 3FRPB 1NR4A 4OIKA 1CJEA 3Q0AA 1UAPA 2WDVB 1JB3A 1DZ1A 1XX8A 2KOLA 3A8IE 2G9DA 1BNZA 2X6LA 3QOLA 2LEKA 4USAA 3GV3A 1EY5A 2ENBA 3NWSA 4KGRA 4KD4A 2X69A 5LHY1 1WTRA 3NTHA 1SB3C 1SNOA 4GZYC 5JXVA 1D5XC 1GUGA 1STNA 3T51B 1Y8NB 4BY7B 3PZ7A 1U4MA 3GB1A 2A5HA 4RGMA 2QSDA 4EQOA 5FLXL 3J7AF 2H1EA 3MC0B 2H4OA 4PMBA 2NMQA 4AYBB 1JQ4A 4E6IA 4U673 4YSYB 3HOWB 5EKIA 5JPNC 2LKVA 2PZWA 3IL8A 2E3TA 1ZXIA 2NBFA 1KNAA 4PMWA 4NKLA 1GPXA 2HDLA 1EYAA 2INNE 1I4GA 4JPSA 2F0EA 2Z4IA 1EOTA 3J7YW 4V190 3VR4A 4RH6A 1XCQL 3OW7A 3QIAA 1FMAD 3QG1A 4HTHA 2JEBI 3LWUA 3EA6A 2PW5A 2WNMA 3G6JB 4YT0B 2WAQB 4F88A 5AUIA 5IGFA 2FUG1 1UEAB 2KCCA 3P7JA 4BWGB 4WORA 5KIXA 2F0OA 2R61A 3IAM1 1LTGD 1O7YA 5BYSA 3Q6SA 1H9KA 3DWPA 3VYSA 3TP7A 3UI2A 4C1NK 1JOOA 2G9HD 1TZOA 3H0GB 2EYFA 3EROA 3EUB2 3S1RB 4FF3A 3FILB 3SFEB 3TEZA 1B53A 5A2QE 2E76C 3ZJTA 4US8A 1STYA 5T8IA 1PYWD 5CV4A 3W2DA 3H09A 3CIRB 2WINB 3HEJA 2MEKA 3V3XA 2BS2B 2LY7A 1PGBA 2JSVX 2EYOA 1JE4A 3TDQA 1MD2D 2RDHA 2D9UA 1HFNA 2Y5CA 2W3SA 1PZJD 2LHDA 3J80E 4LTUA 3W9CB 2CQAA 3OPOA 2M0AA 1ESRA 5KYLA 3VR8B 1WD1A 1RTNA 3S1MB 4J8QA 5HGTA 2MJDA 1EFID 1JW9D 2RSNA 4DAPA 3KWVA 5J39A 4TSSA 3VR3A 1IYVA 2BYTA 4CJ0B 2D5GA 1TKGA 1TWFB 1EEFD 2JP1A 5E1FA 4YTNB 2WP8J 4WFN3 2MGSA 5CORA 2MP1A 4C3JG 1IL8A 4A3JB 4K5VA 2IWHA 2B2YC 3I57A 1BCPF 1SJED 3K5NA 3NPPA 1TS2A 1JWSD 4FXCA 1KNEA 5C4HA 4ARCA 1H9SB 3E6ZX 2F1MA 1VCIA 3EJIA 1F9PA 2JSOA 1LT6D 2CHBD 3GP7A 3D31A 2J4XA 4IFDJ 1FYCA 4H44C 2EELA 1M8AA 1OO9B 5FO7B 3I73A 1FCCC 2HUGA 2R3ZA 3MXPA 1QQRA 4HKZE 1ROEA 5C3EB 5CMDA 1AWDA 3CKIB 3P4SB 1HCZA 1AFPA 4IALA 3AECB 2D2CC 5EQ0A 3KWLA 2JU6X 2VZKD 1YN3A 2VB3X 5T1GA 2F0IA 3N6RA 5G3LF 4R8IA 5FKAC 2RVLA 5IGCA 3TN2A 1IW7D 1SBBB 1Q3LA 5JEAJ 5CV5A 1Y8OB 4HSPA 4PV1C 3D8GA 1XYIA 4FXGC 2E2IB 2A73B 2LGIA 2MJ3A 3FMCA 3M7GA 2JA5B 3CU7A 5NUCA 1XXGA 2KHSA 3PIP3 4XXEA 4JX1C 3K7AB 2LUMA 1WXQA 2R7ZB 2RDFA 3DUZA 4DK0A 1EL0A 2BE5D 2QF7A 3DWGC 4KKSA 3KBGA 1VLBA 3Q69A 2RDGA 3BYYB 1H9JA 1QE6A 2JYEA 1K8MA 4Z9CB 3ABVB 1E2WA 2F0JA 1ZEQX 1TU2B 1XEEA 2F0LA 4TQ0A 3HOZB 1N5WA 4HAEA 4M8AA 1KFYB 2QDBA 1GXDC 1SNCA 1SNQA 4DNTB 4C3JB 1TWHB 5IGDA 1OQQA 3NVVA 3NE5B 4YTPB 4XDCA 1KDCA 2I46A 3OOCA 4A3DB 1N62A 3R2IA 4FF1A 3U2SC 3W5UB 2Y0SB 1TIID 2HQEA 4DK1A 4A3BB 2IW3A 3RZOB 3MXNA 1TQOA 5EPJA 2XIWA 2WXLA 1BDOA 3DWQA 2B2YA 1BR9A 3HVDA 1VF5C 4L8JA 4QIWB 2A68D 3K0YA 1PTOD 5AFWA 2F3VA 1C79A 2J42A 2ON8A 3BZDB 1JQYD 3N52A 1FIQA 2I38A 1RHPA 3I4MB 2TMPA 1SXTA 2V4IB 2FMMA 3MP9A 3OMGA 2XSCA 4NDXA 2LJIA 1JICA 4BS9A 5C5MA 4GLSC 4FYDA 1WTQA 1C9FA 2ZW1A 3IFDA 1LTTD 1E0ZA 3IT4B 3LB8C 5BMIA 1PRTB 5IGBA 2WDRB 1C4QA 1SSOA 3AB9A 4IUUA 3LNNA 4XQQA 1F2RC 4K5WA 2JX5A 3NUCA 1QOGA 2GI9A 1F9RA 4WAFA 1KTKA 5CBEE 3P75A 4IOIE 1HA6A 1QCBD 1I4HA 1EY0A 5CV7A 4RNAA 4EQPA 4CGYB 4FXKC 2XWJB 1DCZA 4IUTA 3NVYA 2NTSA 2NUCA 3A56A 3RMHA 4DXFA 5HI1A 3K59A 1NEKB 1I4RA 2FINB 3T4AC 4TMAB 3JAME 1C77A 1WYGA 2K5PA 3U7ZA 3WDNA 4V0BA 1TWGB 1A3UA 1CT1D 1XLPA 1I4XA 3FDTA 5EE9A 2MPMA 3AMZA 3GTPB 1IGDA 4A3KB 4JK1C 1MSGA 1B9NA 2WXKA 2N55A 3OHXC 3I3CA 1QLBB 1EY8A 3GD7A 4HR7B 1GHJA 4RKBA 2F0GA 2KJXA 4A3EB 4PQXA 1TKYA 1OFFA 2ONQA 3TP6A 2F0FA 3RPFC 1FCLA 4CQNA 2BB6A 4KTAA 2L83A 1PUTA 1VZ7A 1V1PA 3BDLA 3K57A 2RKSA 5IODA 1YJJA 3VA7A 4BBRB 2KQ3A 4FXDA 3V2TA 5M5XB 4ULLA 2NZ1D 2PW9A 1W6KA 4WH4A 4RA8A 5C44B 4FO2A 2A69D 5EBDA 2G1EA 4HKQA 4C1NI 1MI2A 2M00A 3MAQA 1DYQA 3K5MA 1II3A 5CYUA 1LV9A 5D3DA 1HEZE 1SJHD 1A3TA 3D4RA 4B0MA 4I7ZC 1U9RA 2WDQB 1DOYA 4CBVA 1CA5A 4IUPA 2OEOA 2TSSA 1WTWA 2KAJA 4RF0A 4LAAA 2Q5WD 1CZWA 1WWTA 3RLFA 4KN7C 4XQJA 1J9OA 2V0GA 1F77A 1L6UA 1AN8A 2PW7A 4QB4A 1C76A 2EY6A 2W55A 5I4DA 3AB5A 3EQLC 2H89B 2IX0A 3ITPA 4FNFA 4ZLTF 2WV6D 2F0UA 4MIUA 2WQYB 1EY6A 2KVMA 2E2DC 5AUKA 3AEGB 4KJOA 3NHHA 3A7AB 3HOXB 4HRSA 1UNSA 1HTPA 5EKKA 3B2GA 3KF8A 1Q10A 1SF0A 2DNCA 3KLSA 5IT9L 2NN6H 1KLGD 1BO0A 2F0KA 1OXUA 4TQUS 4QUFA 5JOBA 2NVQB 1HZ6A 2OXPA 2VUMB 1TY0A 4A3IB 2L52A 5CV6A 3OIPA 4B9XA 4KKJA 2PKOA 2N9LA 5LNK1 4MN3A 2L4NA 4NZLB 1RJTA 2MH7A 3NSWA 3IAS1 4MHEA 5I6YA 1DOXA 1ZPSA 4PNYA 4F8MA 1EU4A 3NBHA 1BQQT 2BW2A 3E9SA 1IKLA 1CZGA 4DAYA 3ERQA 3AV8A 2ZXRA 2E74C 2NN6I 2JYTA 1C78A 1C48A 2BBCA 2GRIA 3D6CA 1V8CA 3R8BA 2K5DA 4OO1G 3AH7A 4HMJA 1WTXA 4UAIA 1SFOB 3U9SA 2BOSA 1L0VB 2EJGC 1JWMD 2EDGA 4EGVA 2CW0D 3MFGA 1MI0A 2KDMA 2XRSD 1EU3A 2JXTA 2C5CA 4A6QA 1R7SA 1PRTF 4XE0A 4XT1B 1YJIA 3M7NA 4BA1I 1FNWA 5J22A 3A8KE 5M9OA 5FO8B 5GXGB 1EIGA 3PUYA 3C1FA 2C9OA 5BMHA 1BOSA 3SE0A 4LJZC 1A15A 5I6WA 1KDBA 4A3GB 5KNCA 4KHZA 4QF4A 2RMMA 4KK7A 4D2KA 3P4PB 1JCKB 4OHJA 1ICWA 3B2FA 1NENB 2LFNA 2VXWA 2FBWB 2F0WA 5I2XA 2IGDA 3EGRA 3HOUB 4N58A 3TBIB 3S16B 2B2TA 2E6XA 5E3FA 3T3NA 2WU2B 4C7YA 1FR3A 3P42A 3NK9A 1LACA 2E2HB 1J7BA 1XLOA 3P4QB 4IQZA 4CJ2C 1N60A 1SE2A 3NUHB 1SAPA 4RHSA 1H9RA 3VYUA 2O5JC 4OGQC 1GUWA 2KN4A 1YNNC 1RWSA 1MPEA 1PMRA 4EVOA 3FAHA 3T16A 1LT4D 1IBXA 3T13A 3W3AA 3HS0C 1YN4A 3X3NA 2QJLA 2Q8RE 1JOKA 2DN8A 4ODGA 1W6JA 1RF2D 2WIIB 2DYOA 3CRKC 2QIEB 3C8YA 2NN6G 2RSOA 1R9TB 3WCQA 2JWUA 2QILA 2F0QA 2ZXPA 1I4PA 1T6BX 1G2TA 5JPMC 3MTSA 2K5WA 3MWYW 4BBSB 1SYDA 3C46A 4HCSA 3IAYA 2YEPB 4RCNA 1CM9A 3Q8AA 1ZDXA 4C3HG 3F2UA 4X3TA 4F7XA 2ZW0A 1CK1A 1J8IA 3SK5A 5HG2A 3RD4A 4XT3B 1YN5A 1F2ZA 3NTKA 2WXMA 1BCPC 1D2BA 4JBWA 1RODA 1UUPA 3I8ZA 2VZKB 1JALA 2WXGA 2QEJC 1J7AA 4K6DA 5EGTA 4HROA 4KY7A 1VRAB 3ND9A </