4RFBA

1.93 angstrom crystal structure of superantigen-like protein from staphylococcus aureus in complex with sialyl-lewis x.
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
194
structure length
194
Chain Sequence
HNYKSLKYYYSKPSIELKNLDGLYRQKVTDKGVYVWKDRKDYFVGLLGKDIEKYPQGEHDKQDAFLVIEEETVNGRQYSIGGLSKTNSKEFSKEVDVKVTRKIDESSEKSKDSKFKITKEEISLKELDFKLRKKLMEEEKLYGAVNNRKGKIVVKMEDDKFYTFELTKKLQPHRMGDTIDGTKIKEINVELEYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.93 Angstrom Crystal Structure of Superantigen-like Protein from Staphylococcus aureus in Complex with Sialyl-Lewis X.
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Toxin
molecule keywords Putative uncharacterized protein
total genus 64
structure length 194
sequence length 194
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rfbA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rfbA01
1TS5A 1TY2A 3R8BA 1D5MC 2AQ3B 2O2LD 1EU4A 4ZYSA 1EWCA 1PZID 3BVMA 1S5CD 2AQ2B 2AQ1B 1B44D 2ICIA 4UDUC 1I4HA 1DJRD 1SEBD 1CHQD 3BYTB 1TS2A 3BYYB 4RHSA 1B1ZA 1LT6D 1L0YB 1I4QA 1RDPD 1TS3A 5FK9C 1LTSD 3MFGA 1PRTF 1LTID 1LT5D 2NTTA 3KLSX 2WV6D 4TSSA 1XTCD 1I4GA 1PYWD 1LO5D 1FD7D 1S5FD 3DWQA 2RDHA 1TS4A 4L63B 4C56C 1EEID 1LTAD 1JR0D 1SBBB 1TY0A 3TSSA 4RFBA 1LTRD 1BCPC 1PTOC 1ET9A 1FNVA 2J4XA 1CK1A 2XRQD 4K6LA 2IJ0A 1HA5A 1SE3A 3OWEB 1I4PA 2SEBD 1CT1D 1D6EC 2XN9C 1QILA 1JWSD 1XXGA 1ET6A 5D3DA 1I4XA 1DYQA 1PTOF 1BCPF 2XRSD 1PTOH 2RDGA 1G8ZD 5I4DA 1V1PB 1LTGD 2CHBD 1LT4D 1RCVD 1PRTC 1RF2D 1FGBD 1HXYD 3O13A 1HTLD 1D5XC 1KLUD 3GP7A 1EFID 1LTTD 1YN4A 1S5DD 1F77A 2QEJC 2Z8LA 1KTKA 2TSSA 2XNAC 3BVZA 3DWAA 5ELCA 1LT3D 1YN3A 1MD2D 1SJHD 1SXTA 3MC0B 4L6TB 5ELEA 3V05A 4O1NA 1YN5A 4RGMA 2G9HD 1S5ED 4Z9CB 5TSSA 3SEBA 1PZKD 1ESFA 1JWMD 2QILA 5ELDA 3BVGA 1PZJD 1JCKB 1LLRD 1V1OA 3EA6A 4DXFA 1JQYD 4RGOS 5FKAC 1S5BD 2NTSA 1V1PA 1CHPD 1RD9D 3BZDB 1BXTA 1EU3A 1L0XB 1UUPA 4OHJA 4RCOA 5ELBA 1PRTB 1BCPD 1I4RA 1PTOD 1EEFD 2R61A 5D3IB 1STEA 1HQRD 1SE4A 1LTBD 5ELFA 1CQVA 3DWPA 3CHBD 1JWUD 4DXGA 1BCPB 1PRTD 1PTOB 1FNUA 4NZLB 2IPKD 3URYA 1GOZA 3EFXD 3R2IA 1T5XD 3W2DA 1ENFA 4RH6A 4BWGB 4RGNA 1SE2A 4RGTA 1SJED 3R2TA 1AW7A 1D5ZC 1AN8A 1FNWA 4RHRA 1UNSA 1KLGD 1M4VA
chains in the Genus database with same CATH superfamily
2TMPA 4FP5D 4MIUA 1YMHE 2JRHA 3I57A 3CPWA 2WDRB 3SK6A 3ZJVA 1XD3B 3I73A 4A3GH 4A20A 5FLMH 2ZEQA 3ZO5B 1QVFA 3PIO3 2RR9A 1DOLA 3KDFA 1P7EA 4GOPA 3KUDB 2PW5A 5K36H 5CHVC 4ASWC 4N9PA 3Q2AC 3CCJA 1LT6D 3KF8B 4BKSD 1KLVA 4QGUA 2BVCA 2MUYA 4KVGB 1ZGUB 4OW0A 1AE3A 4IW0A 2IWHA 3O65B 5LLIA 3PRZA 4XT1B 4JV5Q 3DBSA 1F2MA 4HCSA 2NVYB 3U9SA 3A4RA 1WY8A 1I50B 1I94Q 1N33Q 4ZRIA 1MGSA 2VUMH 3PLUA 2F0QA 1I4GA 1U4MA 3AEFB 5EGTA 4BY7B 4RA8A 1KM7A 3GTMB 5C3WA 2EVBA 3M4YA 5BN3A 5I2XA 5HY6A 3S24A 2ATWA 2F3WA 4KHPL 3FAHA 3FP9A 5ISRA 4IFDI 1TWHB 1B4OA 4IM2A 3SFDB 1K8AC 1DZ1A 1P9DU 4FDBA 2KC2A 4NDXA 5FOBB 3Q8EA 3QCAA 1TQOA 1RKNA 2IJ0A 2JYOA 3SHLA 3J81j 2HHHQ 4A75A 4LF6L 2J42A 2KJ6A 3AECB 3NVVA 5G5HA 2KX3A 4RM8A 5EDSA 3MEHA 2BQQA 2CHXA 3VVWB 3HOUB 3MXPA 4IOCA 1UBQA 3OJ3A 5IODA 2F0WA 5HURA 1BT0A 1FRDA 4JI3L 5J3BA 1KIXA 4GZYC 3A54A 1K8RB 4NPSA 2KFJA 2BBCA 1TWGB 4C3HG 3OW2A 1WGGA 4YL8A 1SF0A 1JOOA 1LQBA 2WXOA 3DBRB 1FXAA 4M0WB 5CX3A 1X56A 3S1MH 3L2PA 1H8CA 2JU6X 3JSVA 1VQ5A 1HZCA 2EMSA 1FGBD 1SNMA 3VYUA 3A9KA 2UUBQ 4LF5L 1ICWA 2ZJRA 1O78A 2PI2A 1J6QA 1SIFA 1WJNA 2B3GA 3S16H 4DHJD 1J0GA 3I4OA 3LWEA 2WU5B 4AYBG 3GTKH 1N36Q 5DM63 2YYZA 1SRUA 1B9MA 4ME3A 3PQIA 3SDLC 4X64Q 5IKCM 2JA7H 1DM0B 1SMXA 2DJFC 3N20C 3TP5A 1GXDC 3V05A 1K8OA 5C0XJ 3H7PA 4WWMA 4FF4A 1PYSB 4C4VA 2PTLA 2Y0SG 4LF5Q 1G291 5CBAE 1JCKB 2W82A 4KTAA 1KC8C 2EJFC 2F0VA 3K59A 1XT9B 4LUZA 3AN1A 2GBNA 1F9QA 5D3IB 1C1YB 1EEFD 4X65Q 1HQRD 5CV6A 4YSYB 4TMAB 2DUDA 3S1MB 1GUGA 3FPPA 4C1NK 5IGEA 1BCPB 2N7JA 1EIFA 1F9JA 5FO7B 1PHJA 2BTEA 1BF4A 1GOZA 1V9PA 1UGJA 1V49A 3W3AA 3RUZA 3NQIA 4NXML 4N9F4 2LHDA 4H0LC 5FJ8G 3JC66 2IL8A 2CHZA 5LL6X 4WQMA 3AXCA 4MT5A 2BYVE 4NJCA 4HDOA 3A7LA 4XGAB 4JBKA 1EY6A 5HG2A 1TS5A 4CBVA 2ZM6L 5GAGC 1E7VA 4MH0E 2OQKA 4POGA 1JICA 1IZ6A 2ZTCA 3S2DB 3Q69A 2MGSA 4A3MG 1WE6A 4G50A 4ZRQA 4C00A 2UXCL 2FE8A 3ULJA 3WANA 1N33L 1YNJD 5CORA 2NPTB 4DXAB 4HEDA 4KHVA 2MQHA 2L12A 4KGTA 4P6VF 4EZKA 1TZ1A 4R3DA 1PRTF 2MQJA 1SMYD 1TU2B 3E6ZX 1JW9D 5GAHC 5FR6A 4DR6L 2N55A 3MHBA 5M3FH 3DQVA 4NJ7A 4ZAIA 1DOMA 1QQRA 2EIFA 1WX8A 1FJGQ 2NN6I 3RN9C 3Q8FA 4M02A 1XMOQ 5IP7G 3ZXVA 4DV3L 2R93H 1TS4A 1K0SA 4C56C 2W3RA 2F0FA 2CJOA 4OX9Q 2PCFB 1TY0A 5NUCA 2JA5H 2K6AA 3S17H 2IYDB 4HCPB 2XWJB 4KSLC 3U52E 3E0JA 3A55A 3Q22A 2JWZA 4CJ0B 2C7HA 4MTKA 3H7SA 4DHJB 2YTVA 5M3FG 3AEBB 3S1RB 4YTPB 2L8JA 3IAYA 5FLMG 5BYSA 4S3SA 2KQ7A 5LL6S 3QR8A 1XNQQ 5JVH3 3ULLA 4MM3B 2FCMA 3Q6BA 5BMIA 4FYDA 4DFAA 4LNKA 2VQEQ 5CV5A 4HJKA 3J81i 1HNZL 3PO2H 1WTWA 1J7CA 4BXXG 3ZJYC 4A3BH 1ZDXA 2MJ3A 4WAFA 4E6IA 4AJYB 3EFUA 2N0SB 3A5UA 3N1XC 5JHBA 2K7VA 2PQAB 4ZUIA 3A5ZB 4K8IA 3Q8AA 4QAYA 5E6OA 2KWUB 4ARCA 4DN4M 4OELB 4OWXB 3AEEB 2PLPA 1XX8A 4UPAA 1UWXA 4E3CA 4YTMB 3TRZA 1Q12A 1EYAA 2G5DA 1EO6A 1F77A 3HHMA 3IHPC 2Q2IA 3VUXA 2PQEA 5IOIA 3VA7A 4I7ZC 4A3MB 3M95A 2NN6G 2KJXA 1TZOA 3X3MA 1RYJA 3BDOA 4KDLB 1SNOA 2A8VA 5C3EB 3LNNA 3M85A 3P1MA 4KKSA 2A6HD 1Q82C 2PW7A 2K05A 2V3PA 4JC0A 2HE7A 5LMNL 1MG8A 1LV9A 3CRKC 1HJPA 2K4KA 5ELBA 3F2BA 3QIJA 3MTSA 4X64L 1QZHA 1JORA 2YEPF 3ZJUA 1PFMA 1STEA 1P7FA 1OO9B 1SE4A 2NN6H 3V3XA 5C4XG 3KF6A 4EVOA 3PZ7A 3OAWA 1QJOA 2NB0A 1NBFC 3P1HA 1X1MA 4QB4A 3CD6A 1G2TA 1ESRA 5IA7A 5ELOA 3ZVVA 3GTJB 1T5XD 3PTFC 3PIPA 1T0YA 3OOCA 2EYLA 5E4WC 2F0MA 4B0EA 4RGNA 3B2GA 2RDBC 1IBKL 1GG3A 2NS5A 3KYDD 4A55A 1AW7A 1D5ZC 3ZIMA 3AU5A 2IGHA 2EPBA 4OO1H 3HG9A 3HRZC 2JA7G 1UWMA 2DZKA 3OHXC 1KH0A 1MVKA 1TT5B 2JXTA 1EWYC 2AUKA 2PNHA 2LJ5A 1GB1A 1CUKA 1WGRA 5J2RA 1P3QU 4KKTA 2O5JC 1OTRB 2RPQA 3HOUH 4CGYB 4LNFA 4LMQD 1XPRA 1TWGH 4K8JA 1CHQD 1TWCH 2C7MB 4H2AA 1CSQA 3BS1A 3C19A 3G6EA 5FK9C 2KWDA 2V1CC 4PNYA 2WXPA 2M4NA 1XPOA 2CHWA 1L7YA 1AP0A 2K8HA 3IFDA 4OZAA 1YITA 3M63B 3ZNHB 4KHPQ 4TKOB 4XQQA 1ZE3D 1E0BA 1PH5A 2IW3A 4DNRB 4UHVA 1XYIA 1XO3A 4P2CB 2DHZA 4LW1A 1HUMA 4A3EG 4BBRG 4A3EB 1EEID 2NVYH 1G51A 2OCEA 2ZZPB 2DZIA 3WOEA 4NAMA 1V6EA 4EQ5A 1BNZA 2VQEL 1VQCA 1PTOC 3PSIA 3FKIB 5F2DA 5C23A 4O0AA 2WDTB 2MO1A 2R3ZA 2ZJPA 1TGZB 1Q1OA 3AFQA 4E71A 1VQHA 2JA8H 1H9RA 5KEEA 1RTNA 3NXWA 2KCTA 4JVZA 2J0KA 4NJ6A 5DCNA 1VLBA 5EPKA 3J7AF 3M4QA 1EQTA 1J19A 1XLPA 1YHAA 4JI8Q 1NE3A 1NY4A 2IX0A 2RQXA 2WU2B 4TQUS 2KTFA 4LJPB 1J8CA 3AEVA 3S14B 1QOGA 3IVFA 2EJGC 1C0AA 4AQ7A 2GVBA 1WJ4A 5E6NA 2RDGA 4A3DH 4XXEA 1DOIA 1D4BA 3I90A 3RMHA 2OQ0A 1PRTC 4BZAA 1I50H 4LNQA 3KF6B 1QVGA 3PGZA 3HOVB 2R93G 2RD0A 2VY3A 4C3IH 3U50C 2R93B 3M3JA 4DR6Q 1NR2A 3I4LA 1ZOYB 2VRRB 1TTNA 2J0MA 2QEJC 1ZKOA 3ONAB 2JA6G 1JOKA 4LF7L 1QZEA 2ICEC 5AUKA 3UF8A 1BBWA 1ZP0B 1WJUA 3Q3FA 2WDVB 1YN5A 5G2NA 4J8QA 4CJ1B 2J7ZA 3I3CA 3VR2A 1E8ZA 4LCDE 4NMZA 3SEBA 2M00A 1T5EA 1FPYA 3H0GG 3RN2A 4Y7NB 3FVQA 1XJVA 2JPHA 2DYBA 3JAME 4KK7A 4RWSC 4MELA 1PH6A 1JALA 2GBJA 1OFFA 2NTSA 3NTIA 4KY6A 1V1PA 3K58A 4JYAQ 1OGWA 3GOEA 4XDDA 3TL5A 2X6LA 1JRPA 4EUTA 2GN5A 1PTOD 2R61A 3QWNA 2Y5PA 2JWUA 2PQAA 3PIOA 3MVVA 4K14A 1AEXA 4ODGA 2RHQB 1WYWB 2LWPA 3HM3A 3KH0A 3GV6A 2MBQA 3UE0A 2IGDA 4G7ZC 1C79A 1PA6A 1VQPA 1Z7TA 1I3QH 4GNXA 3S1QB 4DU9A 1L0WA 3G71A 3L13A 4C3JB 3TEXA 2J0TD 4DQOC 4X65L 4USAA 4MZ9A 1D2BA 1QB5D 3RFZB 3I70A 1ZDVA 3J80L 3PRPB 1UNSA 1KLGD 1E5WA 2BS3B 5IYBH 3DEPA 5IY0A 3RPFC 4K0KL 1QNKA 3H3VI 1OXVA 4A3IH 3PS6A 2EYOA 2L5TA 3MEFA 4M01A 4MGIE 4US8A 3PUYA 3T4AC 2KZRA 4B95A 2BYEA 3RULA 5T1IA 3DBRI 3DXJC 2X6GA 4PQXA 4EX5A 2VQFQ 4B9XA 2LXAA 2MEKA 4N8X1 2RCNA 1L6UA 4I65A 1VQAA 2A19A 4PMCA 4F8MA 2INNE 1CM9A 4FJZA 4OZCA 1B53A 3Q3NC 2LXKA 2JQOA 2N7DA 5IWAL 4QMGA 2PMVA 2JP1A 1XTCD 3I55A 1BUIC 2FNJB 1J7BA 5EQ0A 3PGEA 1NYQA 4WH4A 1BBXC 4IWOA 2F0KA 4C3HH 4MGZE 1EOTA 4QQBX 1KL9A 1E7ZA 2AYOB 2DY8A 5BO4B 3CAMA 1U9RA 4CHTB 1I6HH 1CK1A 4K6LA 2KHWB 3V62A 4G3XB 1HA5A 1VQKA 2MH7A 2F0JA 2KT7A 3RLFA 2XGTA 5M3MG 1K83B 1HRJA 3MP9A 4LNOA 3OWEB 2KYWA 2LFIA 4PYZA 1CT1D 5GROA 1WYGA 3CQZB 4RMFA 4WWNA 4HKQA 1PFBA 2OT2A 5EE9A 3W1YA 4DNIA 1CMXB 4A3KH 1HNWQ 2VZKB 1YNTE 1VR9A 3STBD 3PUWA 3RNCC 2A69C 4GN3B 2AL6A 3AQQA 4IUQA 3VH4B 4MGKE 3I2ZA 4FXKC 1LTGD 4BS9A 1PH8A 4HIKA 5D6JB 3VH3B 4IUNA 2N49A 1TR5A 1YZ6A 2LKVA 4RCNA 4A3JB 4LK0M 3QJYA 2MHVA 2KFKB 1MSGA 5KNDA 4HJ9A 1MJDA 2R7DA 1ILPA 1YVCA 5C0XG 1B50A 4F7ZA 3W5OA 3DWMA 4HEA1 3EC8A 2WFWA 4BY7G 3NUHB 4BBSG 2K50A 2K5NA 4KZ0A 1OXXK 4BFRA 3GTPH 3L54A 3HOZH 1VDZA 1TKEA 4RGMA 2NCNA 3GD7A 2K28A 1BBUA 3MA2B 4IWQA 3DM1A 2OXPA 3S15B 5CBEE 2PNRC 4YIJA 2D2QA 4IO9A 3VR4A 1LLRD 2D62A 4DXFA 1JQYD 3D8GA 4A3OA 1EY8A 4LUOA 1R4MB 3VUYA 4XTCS 3GTPB 5C4HA 3I63C 4WIPA 1DOYA 4LF7Q 3BZDB 4BOZB 1L0XB 4DBGA 1I4RA 3CP0A 2L05A 4QY7A 3MC9A 4K0KQ 2B8GA 2L76A 4G0NB 4K5VA 2JY6A 4DXGA 2B2WA 1ONLA 4MTNA 1AH9A 2WAQG 1X55A 3URYA 4B3ML 1P98A 3KYCD 4MHEA 1IBMQ 3KW5B 1H95A 2KJHB 4GKJQ 1ENFA 4ICUA 5JEAH 4LDTD 1SJED 1XTDA 3ETRA 2BA0A 4W9IA 2Q8TA 4L1BA 4GDLB 4A3PA 1ZKHA 4JI5Q 2F0NA 4IFDJ 3TP8A 1X32A 1JJGA 2B2VA 3T9LA 4RAUC 1X3FA 3BDLA 2Z4IA 3APCA 2N7EA 2EOTA 3H0GH 2WXGA 2GA4B 1CSPA 1WTPA 1B3QA 3P4RB 4C7YA 1U4LA 2O2VB 3CSFA 5IYDG 1TJEA 1CKMA 1Q1EA 1B1ZA 1YIJA 1E1TA 2FUHB 3Q8CA 4MJSB 4EOYA 2A68D 4HTHA 4US9A 3GV3A 1I7HA 3KFUA 2NMQA 3PIP3 3WA0A 1ZW7A 1YJJA 3DBHB 2B2WC 4A3JG 2EY6A 5C4ZA 1YJWA 3RNFC 4EE2A 3S2HB 1N34Q 1O7YA 4JL9A 2JE6I 1QF6A 1NI2A 3KF8A 1WXMA 1K28A 1BUVT 1F1HA 2ASQA 3H6NA 1DOXA 4DAMA 5IT9L 3C2PA 1TKGA 2SAKA 1X3QA 4JI2Q 3HKSA 4V190 2KMCA 1U4AA 1PDXA 3FPUB 5EPLA 3SVMA 2E3TA 5FO9B 1SE3A 4A3KB 3HUIA 1A6XA 2I07B 2QDFA 2I1KA 5HI1A 1VCBA 3W1GA 1KXLA 3UQAA 1XXGA 4A8XC 2E2DC 4B0MA 1HZBA 3J81E 3BK1A 2FINB 3AE2B 1V97A 1EZ6A 4DUZQ 1VQBA 1PTOH 2ZPNA 2BWFA 3M9BA 1U5KA 4P1BC 4C3JH 3CRLC 3QG1A 1LT4D 1YD8U 1Y8PB 3KLSA 5IGCA 1WWTA 3R93A 2ZW0A 4UP8A 2UXDL 3S2AA 2PMZB 4K5WA 1NENB 4A90A 4C4VB 3NG0A 2ZTDA 4A3BB 2YV5A 1JWAD 1WCMG 2KWVB 4TV3A 1G6PA 1AYFA 1X54A 4UP9A 3CCQA 3QARA 2VUMG 4XQNA 1HTPA 1YN3A 3M4PA 3LB8C 3MC0B 4O1NA 2B76B 3L16A 1H9KA 5C5LA 2UXBQ 1P8LA 5TSSA 1R4NB 3PT2B 1LM8B 1ENAA 5CTRC 1PZKD 1JWMD 5TR5A 4IALA 5ELDA 5G3LD 1V1OA 2E2HB 4ILWA 3T13A 3APDA 5HKHA 2K9XA 1JMCA 4JPSA 3RNBC 1BXTA 1XNQL 1I6VC 1R4MI 5KIXA 4ANUA 2L52A 1PGXA 2KDBA 1AARA 1LTBD 1D3ZA 5C44B 5JJKA 1CQVA 3Q8DA 3CSTA 3VHTC 4JX1C 2JYEA 4ZDVA 4P72A 2MRPA 1PRTD 4XX5A 2LJIA 3TMPB 4OO1I 4R8NA 4K2KA 1GJZA 3T3OA 3AEAB 2JQRB 2N9EB 3PO2B 3QA8A 4BOSC 3W2DA 2PVGC 4W9EA 5HGTA 1E0ZA 3RD4A 2LASA 2QGQA 3SR1A 1YJIA 3DHGC 3VUWA 3FHWA 4R4IA 2HQLA 3BK2A 4DR1Q 5IAAC 2H4OA 1RAXA 2PE6B 1JE4A 2V3SA 1TY2A 1WJ6A 4HPMB 4IWPA 3SK4A 2AQ3B 4NQLB 2MBHA 3RNEC 3TEZA 1EWIA 1XCQL 1S40A 5C2TB 1W3SA 1U4PA 3PV0A 1L2NA 1I4HA 2OJRA 3TJPA 4MM3A 3P63A 3S17B 2F0LA 3KLRA 3VTWA 4IUTA 1LTSD 4GNXC 4II2B 3AB9A 1WMHA 1X6OA 1XLQA 2MA9B 3HZXA 1N9WA 4C2MB 2W3SA 4OEMB 1SYDA 2PW9A 5C4JB 3PUXA 3W1SC 1A0IA 1MFWA 2O2VA 1GNUA 4WJ4A 5K5PA 1YNND 4P75A 1J5EQ 4KV6A 5AZFA 3KBGA 1R4QB 3AE6B 1FD7D 3HFZB 4IJHA 1N5XA 3HM6X 3T1HQ 2OTLA 4DAVA 3NZSA 2GBRA 2FAZA 3CMEA 4LFBQ 3K6OA 1WOCA 1VRAB 3J80E 1LTRD 1TWFB 1ET9A 1VQGA 3VR9B 4L5QA 3NVWA 1FMAD 2XRQD 5IGFA 1SSNA 5FO8B 4PYUA 2AEHA 3D32A 3H8HA 3N52A 4DV0Q 2QKIC 1C4PA 5GAEC 1C8CA 1QOHA 1NSNS 1IYUA 2NBFA 2ZXRA 4A3LG 3LXFA 3ECIA 2JYTA 4ABNA 5DPSA 3ERQA 1YJNA 3IT4B 3CCLA 1VF5C 1F9RA 3NHHA 4PZ8A 2V4DA 1WRIA 2OOBB 1ZYRC 2CU3A 1IYFA 2XIWA 4DKAC 2R2QA 1JC7A 1HH2P 1KLUD 2NWGA 2WDQB 2B2UA 1BO0A 2P5ZX 1XF5L 2ZJDA 4G57A 1FD6A 1JMLA 1YQ4B 2B3AA 3Q14C 1KTKA 4IURA 2K22A 1PH7A 1RM6C 5IP7H 3VQIA 3MC8A 3AE1B 5LMNW 1SJHD 3EVQA 1T6BX 1KDBA 2LY7A 2Z4HA 2LZ6A 2MP1A 1S5ED 3MXNB 2A74C 2H88B 3M3YB 5EKIA 2C35B 1R4NI 4YWGG 1EL0A 2ID0A 4IUPA 4KY5A 1OEYA 4DUYQ 2Q2HA 2IY5B 2R92B 2PPHA 1GUAB 4W9JA 1V1QA 4A3BG 3IRBA 3TUOA 5A2QL 2FCQA 1GPXA 5COYA 4JI5L 3J7ZC 2C60A 2F0OA 1C76A 3CHBD 1JWUD 4KI0A 1PVOA 4LF9L 2DBYA 4ZQ3A 2KJRA 4JI6Q 3A8IE 2UXDQ 5BN4A 3V6EB 4ULLA 4AJWA 2Z6KA 1Y14B 3P75A 5CMDA 1FO4A 3AE7B 1F0ZA 2UWQA 1EUVB 5EPJA 2W55A 3RN5A 4JOIA 4QJFA 2KC1A 3ZNZB 4IZ8A 1AN8A 1FNWA 3A4SC 3N1YC 1KF6B 4PT5A 4FADA 2MWSB 3VDZA 4AYBE 3R8BA 1WXSA 2J0JA 1R9TB 1YEZA 1NEKB 1PZID 1CFMA 4REZA 4ZRPA 1VQEA 4KD4A 3OSOA 3QQ8B 2ICIA 2KHIA 4UDUC 3KJPA 3TZUA 2ONQA 1HA6A 4YT0B 3S15H 1NYRA 4A3CG 5IWAQ 1XPUA 3R66C 3WOFA 3P42A 3VYSA 3QJZA 5CV7A 4DV3Q 2MHJA 3NSWA 3NPPA 1WZ0A 3MFGA 4YWKA 4XQJA 1SLJA 1LT5D 1TWFH 4UP7A 4CKBA 4X6AH 5DPRA 3ZTCA 1G2SA 4DNTB 3KLSX 4Q5VA 1WTVA 3Q23A 2K14A 2Z9HA 1N32L 4MDKE 3NS1A 2FMCA 4HJAA 1KJTA 1GUTA 2GI9A 2K5QA 3U4VA 1EQQA 3KVFB 3N32A 4W9LA 2UUAQ 4ARIA 2F4IA 4HN7A 1N34L 4A3CH 1Q10A 2IGGA 1NMGA 1DGSA 1STHA 2WXKA 2FHTA 2PKOA 1YBYA 3PCOB 1EYDA 3I4MH 3FKIG 2J4XA 1S1QB 1ZPSA 4GIVA 1CKNA 1EZ8A 5J22A 4DV1Q 4IFDG 2EY1A 2DLBA 4JPBW 2ZM6Q 1VMPA 1FXTB 3CKIB 1M1KC 2N1VA 5KHQA 4K7WA 2MFIA 5M9OA 4YHHQ 4XZ4A 5BYRA 5EKLA 3NHEB 1WCMB 4HPLB 3NEMA 1H9SB 4MSQB 5JH5C 1JWBD 1XCTL 1QILA 3ITPA 4WAAA 2B29A 2FJ2A 3MJ5A 2Y5BB 2NVUI 1DYQA 3U9OA 4FXCA 1WR6E 2ZVOA 3TP6A 1O7LA 2N9LA 2L7RA 4TQ0A 2KEEA 4V0BA 3HOXG 3P4PB 1PYBA 2G45B 4IFDH 2WQYB 1KNAA 4GKKQ 4LFAQ 1Q8IA 1WR1A 3X23A 2DY7A 2L55A 1SE9A 1SNCA 1EIHA 1UWVA 4DR3Q 1QUQA 3KLWA 1AWDA 3DMUA 1N62A 1FEHA 3K8AA 3F8TA 4KN7C 3UDFA 2XNAC 3RZDH 5IT9E 2JX5A 4GLXA 3SXHA 3AE4B 4P74A 1Z47A 1HTQA 5IP9H 4DV7Q 4DA2A 4DF7A 3GB1A 3T8MA 2G4DB 2KLCA 4EGVA 2KX0A 2M56B 4DV2L 1CZWA 1GHJA 3BVGA 3NE5B 3OMCA 3GTKB 4DR7L 3DBLB 5DEHA 2H1EA 2L15A 4QF4A 4GOPB 2V3NA 3AFPA 3CW2C 2E5LQ 5M5XB 2XBBC 2DN8A 1V8CA 1C77A 4KZCA 3J9CA 3R7QA 3NQTA 3J7YW 3U30A 1MI0A 3CC2A 4J1MA 2HDEA 3IG3A 3N3KB 1E2WA 2G9DA 2R7ZH 4BY1H 5DLQE 2IO1B 2ZXPA 5I2YA 3NWTA 4M8MA 4DK0A 2EELA 2M2LA 4IC7B 1WJJA 1RFAA 5EBCA 5C3EG 4B3TL 1GJXA 2WXJA 4AS1A 5JZEB 2DENB 4W9HA 2OEOA 1SFOB 2R92H 1QOFA 3T53B 3DM3A 2LGSA 3DWGC 3ZRCA 4MSMB 4K3BA 1JJ2A 3PF4A 4GOCA 1VQDA 2LVPA 1WXQA 5M5YH 2YU9B 2KCNA 4HDQA 2BS2B 2L0CA 3FILA 3UGBB 2UXBL 2EYMA 3CCUA 4XYQA 3C0RB 1SYEA 3BYTB 3ZW3A 1V43A 1LXDA 4IJLA 1N6ZA 3UI3A 1EIYB 1K3BC 3SR6A 1O7IA 1Y8RC 2J53A 4DR5L 1D1KA 1JQ4A 5M5XH 2KBNA 2HTME 1KDAA 2LVQA 1K8GA 2HD5B 2ZT9C 3IFTA 4G7HC 4FVMA 4OONA 2NVXH 1GAQB 1X3GA 4HMIA 4R4QA 3U4EG 3RLNA 3EFCA 1GHKA 5CHFA 2WXRA 1MSHA 4IPCA 2EXDA 3CCSA 4KMUC 1TKYA 4FHKA 1QG7A 2MNAA 1IW7D 3ZLZA 1VQ4A 1VMCA 5BMHA 4TVAB 1BCPC 2XTIA 2I5HA 2WKCA 1KRHA 4RM9A 1ZUD2 3DDCB 1A8VA 2PIAA 2WYQA 3PVLA 4LLGM 4DDID 2NZHA 2CCZA 2MBOA 2BH8A 2KAJA 2NBWB 2ON8A 4A3GB 2OF1A 4CHKA 3U58A 1EY0A 2WKDA 2QJLA 2NBVB 5EBDA 4KJOA 3HOYG 1IGDA 3EHVA 2BW2A 1XLNA 1JWSD 2RSOA 1CKNB 2F0IA 3A56A 2EXZA 2M19A 3PF5A 1EWHA 1BCPF 4K3CA 5DPTA 5C0XI 2EZVA 1FL0A 3DHHC 3TS0A 4I7AA 4MGYE 4DV0L 5I4DA 4FBJB 3Q24A 3TEYA 3UDXA 1IBML 3ULPA 3GTOH 1Q5WB 1HTLD 3MXNA 2BGFA 2X38A 2GMIC 3AE8B 3T56B 3QX1A 2DAFA 3GP7A 3NWSA 1SYBA 3D3RA 1YN4A 2UUCL 1EF1A 1K73C 4DGZA 4B9WA 2C5LC 1IXRA 2DNCA 1WFQA 5FLXL 4FF3A 3NOBA 1HZ6A 3GTLB 1PGAA 3DVNV 3Q3MC 2E5LL 4YY3L 1N61A 1MBYA 1V2YA 4BVUC 2B2UC 2KN4A 4JI2L 3IFWB 3L0OA 3C1FA 4JYAL 1XWEA 1YX5B 2BDNA 3V6CB 4JI0L 2G9HD 1Z2MA 2WXHA 3C8YA 3HK0A 4ANWA 1B9NA 2JSVX 2CH4W 3KQ4A 2B63B 4ZYNA 4EQPA 1Y1WG 1C4AA 1F2RI 1YIWA 2IZVB 3WWVA 4DPGA 3DBLI 1I35A 4A93G 1M90C 1HNZQ 2D0OA 2K5DA 2NR2A 1KOTA 2GRIA 1IYVA 1G91A 4TKNA 3EJIA 2WAQB 4KIKB 4ZRZA 3TN2A 2K39A 1UEAB 3DPDA 5D65A 2BKFA 3R2IA 2A4ZA 1RIPA 1SYFA 5GXGB 3NVYA 4KDIC 2WWZA 4X66L 2OEDA 4GOPC 2F3VA 3QWZB 4CKCA 4JI4L 3A1QB 1DONA 1OTCA 2MJEA 2PYKA 3F2DA 5A35A 4HIOA 4A93H 3MHZA 2HTHA 4B3SL 1J8IA 4JI6L 5JXVA 5D2MB 3PUVA 3ML8A 1SYCA 5FLXc 3G6JB 3HGBA 4OIJA 1MJEA 2RMMA 4IUVA 3ER0A 3W1SA 1TS2A 1EY5A 1WGHA 4BKSA 2N88A 3ZRFA 2BWES 1NR4A 1IYJB 2BYFA 4GLVB 2X8XX 2KQ4X 3GO5A 3X3NA 2WX1A 4ICVA 3K7AB 3S1NH 3PO3H 1NTGA 2LS01 2UUAL 2K04A 3L10B 4BBRH 2I2YA 2K5PA 4PS7A 4GS3A 3RNAC 4UAIA 1TWHH 1PYWD 3QC8B 1F2ZA 1UF0A 1K0RA 3K80C 2VZAA 3P20A 3WDNA 4A4IA 2RGFA 4HROA 5LNK1 1S72A 1SE8A 3NVZA 5CV4A 2Q2TA 2ZW1A 3K9PB 2CWAA 4WJWA 5CV8A 2Y0SE 2JSOA 5IGGA 2ALYB 1X3EA 1FFUA 1WD1A 2RSUA 3L08A 5JJZA 4JIOU 3FILB 3AYHB 3N1ZC 1RLFA 3A0JA 2Z1CA 3RR5A 4L5SA 3PO3G 2EYHA 2FUG1 3HVZA 1NAPA 1J9OA 5KNCA 1O7ZA 1WF9A 4XDXA 3ALBA 4KIKA 4PV1C 5DAUA 4M8NA 1NDDA 4BBNF 1ROEA 1HZ9A 2XN9C 3H15A 3M4OB 1HR0Q 1IUEA 4HWIB 2H89B 3OWFA 1QZGA 2BYTA 2EKIA 4M0WA 1ET6A 3RMKC 4OIKA 2K33A 4DR3L 4DR2L 1YQBA 1BKBA 2CHBD 2RKSA 1K53A 4IUUA 4LTUA 3E3XA 3STBC 1A63A 2KKCA 2LXCA 4Y52H 2L3ZA 3B0AA 3RNUA 2LD9A 1IBXB 1PGBA 2ACZB 3TREA 1M94A 2F0PA 1HZAA 2A5UA 2KTRA 4A3GG 1WH3A 1O80A 2VUMB 1EY4A 4DV2Q 3HRDD 3B1LX 1UEBA 4P71A 4B3RQ 2WXLA 3AE3B 5ELCA 3CWIA 3DBHI 1ENCA 3G7LA 4FN2A 3R7RA 4DHZB 5IN7A 4P73A 1VZ7A 3PSEB 2I0QA 2JA5G 1YJ1A 2ZXOA 3V61A 3M7NA 3HEJA 2HCIA 4RGOS 2WXIA 1SAPA 2C5CA 2E2JB 4FJVB 1NMFA 1SB3C 5HFYA 1VZ8A 3W5VB 1WGYA 2KMMA 3IL8A 4RCOA 1QLBB 4W9CA 1EYCA 4LJOB 2O4XA 2NZ1D 4XYCA 1PLFA 1WTQA 4MJSA 4XDCA 4YTNB 2KMAA 2C9OA 3GS2A 1HR0L 4CDEC 4GNXB 3UE1A 2F0EA 4QCLA 5JJLA 4WWPA 2EQSA 5E7NA 1PFDA 2GOWA 3EROA 2VZKD 1WI5A 3KUPA 3CCVA 1TWCB 3HOVH 3PO2G 5C4XH 1FYCA 1SDFA 4RH6A 1ASZA 4LFBL 3BINA 3S1RH 1HHVA 2E74C 1Q86C 2KDIA 3I4NG 2KCMA 4RHRA 1E7UA 4DK5A 4DK1A 1STGA 1YI2A 4RMAA 2WP8J 1T0QC 2JA9A 3OLMD 5LXIB 3I91A 2W9NA 2NVTB 4LF8Q 4D2KA 4ME5A 1Y56A 3CMMB 3BVMA 1TXYA 4R4OA 4OO1G 3OJ4B 3X0WA 2AQ1B 2AX5A 1DXMA 1DJRD 3UQBA 1RHPA 1A3VA 1Y1WH 3AI5A 3AMZA 2ZNVC 1YHBA 1GUSA 1I4QA 1SR3A 4DV4L 1ISNA 1LTID 3FKIH 2YEPB 1WTHA 2E2HH 4KD3A 2NTTA 1NUCA 2Y5CA 4HXDA 3I72A 3NZ3A 1JROA 2WV6D 5M3MB 4LF9Q 5H8YE 5IYCG 3S16B 3Q8BA 2RDHA 2F03A 4BKGA 2B2VC 2QHOA 4F87A 1KHIA 2R7FA 1VQJA 3PRMB 4PMBA 5L95C 2EYPA 1W6KA 5L37A 1XMQQ 5H1SE 4JI8L 4A3FG 1EQVA 1EM7A 4A3FB 1HTOA 3BDCA 4OL7A 2WACA 5M3MH 2FIFA 5BYQA 1OQRA 3CQZH 3NJTA 2KANA 1QOBA 3EQLC 1P16A 5IGBA 4X66Q 2YU9H 3JAMi 2KQ3A 2RVLA 1TT2A 3DOWA 2EKEC 3D4WA 2UXCQ 4HCNB 3E9IA 3FC4A 2JA6B 2L0FA 4WWOA 2JUOA 4XIGS 4H02A 2N4FA 4LF8L 2N9PC 2WHIA 1I5FA 1T3QA 5D14A 2IO3B 4XT3B 5D3DA 3ZUNA 1WYDA 4JQWC 1BOSA 1V1PB 2F0UA 2LMCB 3NK9A 1H9SA 1HNXQ 5C0XH 1MG4A 5LXHA 2KHSA 2D3BA 3O13A 3BWUD 3AMUA 3W5UB 4BY7H 1SYGA 1WTOA 3R3MA 1GO3E 2ENBA 4DUYL 1SROA 3FMCA 5C5MA 2ES2A 1QKZA 3B2FA 2GB1A 2LGIA 5IO9A 4AWJA 4MH8A 1KDCA 2DZMA 1WRDB 1K3RA 2RBMA 5J18A 2BT6A 3LWUA 1SXTA 4L6TB 1YJ9A 1BMLC 1AE2A 1CTMA 3L3OC 1Z5SB 1IL8A 1VQ9A 1PXUA 2WB1B 3AE5B 1L6VA 4K5XA 2FFKB 3NS8A 3D0FA 3SE0A 4Q0FA 4JI1L 3HOZB 4TUUA 4PS8A 4FF1A 1NVID 2K52A 3I8ZA 3AEGB 1NNXA 5CHWA 3TS2A 1L5PA 1RD9D 2O6VD 3MHSD 1EU3A 3PREA 1IBKQ 3TBLD 2HT1A 4N59A 4FA6A 2K6DB 4WJOA 3D6CA 4HR7B 5C4XB 3ZXRA 1TWAH 1HCZA 2BA1A 1IBXA 2QW7A 3DCGA 5IT9c 1TBEA 4DR1L 2JXXA 4A3LH 1VQ7A 1Z9FA 3PO0A 2B63G 3CC4A 1LABA 3GTOB 2B2TA 1L1OB 3NZUA 1Q3LA 3BG3A 3U7DA 3EUB2 4QIWB 1KRTA 2V4IB 4HKZE 4Q2JA 4KKUA 4CDDC 5CGKA 2HIXA 3AU7A 4XYOA 3JAML 2O2LD 4DV1L 2UU9Q 4QIWE 3PHWB 2K25A 1DD2A 1LACA 1HUNA 3SK5A 3J80i 4WORA 2AQ2B 2BE5D 3F2CA 1WXVA 1SIJA 4OVUA 1YX6B 2V9HA 1SEBD 1YNXA 2SNMA 3T51B 2WP9B 1TS3A 1EOVA 4GN4B 3QOJA 1YOVB 3ZJTA 1DCZA 3MXGA 5IIFA 1HPCA 3ML9A 1X9NA 3ZKJC 2EY2A 4LFCQ 2KVRA 5CR3A 5HGQA 3OG5A 2CKHB 1J7AA 4HJGE 1GB4A 2HQEA 1E2ZA 5C1ZA 5I6YA 3GE3C 2DGYA 2E2IB 3K0YA 1N5WA 2WX0A 1LO5D 4I6LB 3LJ3A 3FRPB 3C46A 2D5GA 4IG7B 5FLXE 3HKZG 5ELNA 1JR0D 4BBRB 5GADC 2ZCBA 2PZUA 2FMMA 3C1EA 4C7ZA 2EMTA 4B3MQ 1IGCA 3P2BA 3GTGH 4ZK9B 2KK8A 5DNFA 4C80A 1E3PA 1V86A 5M5YB 1SN8A 4B08A 3M3YH 4A76A 2XK5A 1L0VB 4H13C 4X3SA 1KNEA 4KN4C 4R4CA 2BH2A 2MX2A 4DK6C 4TQ1A 3KUCB 4AYBB 2D3AA 2MCNB 3Q3OC 4LF6Q 1F2YA 1CJEA 4WRDA 3CMAA 4L2YA 2KACA 1I4XA 1ICFB 1PTOF 3AM9A 1E90A 1Y1VH 3IKJA 1G8ZD 2D3GA 4GKJL 5EKKA 1RCVD 4RKLA 1RF2D 3ND9A 2EYJA 2IBIB 1VQIA 3ZYYX 2FIDA 1I94L 3TEHB 2JZPA 4EZJA 1PH1A 4C3HB 4GU2A 1F2LA 3BVZA 2HDLA 3I4MG 2M0XA 3GTGB 1UGMA 4FJYA 4YWLA 2A69D 4LWCA 3B08A 3KJOA 3CPFA 3U2SC 3I5JC 3NRZA 1F2RC 1EQRA 1V5OA 4IDIA 2ZTEA 4KV2A 3HVDA 3P7JA 2Y3AA 4F88A 4JI7Q 5I9OA 4GB9A 4WJ3M 1L4ZB 2BF8B 4YCWA 2IY1B 3NBHA 1T9HA 3E5SA 1FJGL 4IM3A 1MHXA 4JCVE 4AH6A 2WAQE 2VL6A 3TIXA 4PG3A 2LMCA 5ELFA 2O6VB 1B7YB 2AWOA 4JW0A 3A9JA 3HKZB 4DUZL 2K5VA 3P4QB 2CH4A 3DHQA 1Q46A 3MZ5A 3F1ZA 3PUZA 1OXUA 3RI7C 3ZNID 1OXTA 1UBIA 4AUQC 3UDGA 3E56A 4GDKB 1GUOA 1OQYA 3VDYA 4EZLA 2D10A 2JA8G 1B9RA 2GBKA 3UI2A 3DEOA 1WM3A 4P16A 1VQOA 1U0LA 1FM0D 3JVZX 2HDMA 3NY5A 5I6WA 4JGHB 4W9KA 3UIOB 3S1QH 1RWSA 2OJWA 4JI3Q 2KOXA 1NBWA 2REXA 1S5CD 2A73B 3NP8A 2CW0D 3OTOL 4DV5L 4NQKE 1WSPA 1E2VA 4G4KA 2CJNA 4ZRJA 3K5LA 1UZXB 4JI0Q 2LRWA 4IN3A 4PZ6A 1SSOA 2M8SA 4LF4Q 3J7A5 1A70A 2PPBC 4LNIA 3KYHC 1K51A 2Q8IB 2NPTA 3WCQA 1RODA 2LHEA 4APVA 4IPDA 4A3EH 3HIZA 4CKEA 4BY1G 2BE5C 4CQNA 4YCVA 2LGYA 2PJHA 2QDBA 2LRUA 4B9KA 1EYGA 1VQNA 1P1AA 1QOAA 2F4VL 2JZ3B 3UIPB 2J7QB 4L63B 1GUNA 2K75A 3H09A 5KYLA 1OXSC 3T1YQ 5HHDG 1SBBB 5BN5A 2NVQH 1WMHB 1FGUA 4EQNA 2JEBI 3IXSA 1Q8KA 5C3XA 3ZQ4A 1WM2A 1Y8OB 2RF4A 1N32Q 2QMTA 2EY5A 1JT8A 3QO2A 1B3AA 1QNUA 1STYA 2EDGA 2F0HA 2R6GA 4R8IA 4PS3A 3NENA 1L2FA 2LGDA 2QDLA 1RL2A 2DJGC 2ZVNA 1CI3M 4WJNA 2SEBD 4A3DB 2INCC 2IY0B 4LDTB 1HFGA 2Z0EB 1D6EC 3V2TA 2D9UA 1II3A 1TIID 1PV4A 2UYZB 2JT4B 3GTQB 4PZ7A 3QK0A 3MTNB 2XK5B 2Z59B 1D1IA 4YCUA 1SNPA 1SNDA 3DVNU 1UAPA 3MAQA 2M0AA 5IYDH 1CA5A 5DM73 1X3PA 1LGRA 1S3OA 1E9MA 4E74A 3E0EA 2JA6H 4XWWA 3ERSX 1HE8A 4HK2A 4A6QA 1E8XA 1TIFA 3ONSA 4GXBA 4RF1A 3Q6SA 2NVXB 5CYUA 4BBNC 4URKA 2TSSA 1XMQL 2I5MX 1H4RA 1ILQA 2CFMA 3LYYA 3DWAA 1GD7A 2X69A 4BBSB 1T0RC 2JZZA 2LI5A 2LSSA 3D6WA 1VZ6A 2HIVA 2L4NA 3AULA 3FKYA 5JOBA 3JYUA 2RDFA 1W2BA 2IDYA 2K03A 1JJCB 1KABA 2WLBA 3VR6A 3VTUA 2QSDA 3VTVA 2QILA 4R1JA 1L4DB 1V81A 3EA6A 3PO3B 2FCNA 1VQMA 2A68C 1N63A 4BKTA 2YTYA 4DWFA 3TEWA 2JEAI 2IHEA 3AH7A 1K83H 1PRTB 3OIQA 3RZDB 2RA4A 4AQYQ 1HQMC 4A93B 3A9KB 4B6WA 3KWLA 5AEKB 3H3VH 2F4VQ 1BQQT 4CDCC 2B8FA 1CZGA 4O2DA 4F7XA 1IPGA 1T0SC 1PTOB 1WXAA 3L9AX 2IO2B 1UD7A 4A3IB 3LDZE 3CCRA 2DNEA 3I9V1 1WIAA 1A3UA 5E1FA 2OTJA 2WXFA 4HRSA 4MACA 4R9WA 2CR5A 3H6MA 2KDEB 3IAS1 4W9DA 4BWGB 4RGTA 4NW2A 3MWYW 4FO2A 5M5WB 1UE1A 1EFWA 1RFKA 4BA2I 4N8FA 4PMWA 4HJ5A 1M4VA 2L9HA 4NXMQ 2JXMB 2LVOA 1WCMH 4QUCA 3K5MA 1GC7A 2VNUD 1P0RA 1EY7A 2CW0C 2CVRA 4ZLTF 2K5HA 1BVSA 2CWPA 2E8GA 2QF7A 2RCFA 4W9FA 4ZUJA 5CC4A 3SFEB 3HS0C 5J1ZA 3IT6B 3T1YL 3B9JA 1VQ6A 2KWCA 2JJQA 2VB3X 3MFYA 2E2JH 1UE6A 2JK8A 4EKUA 2JRIB 4NNJB 2WINB 1WX9A 2NVQB 3QB3A 2MP2B 3PLVA 3NELA 4LAAA 1F9SA 1PFNA 2AKWB 4BA1I 4NB3A 3AEDB 3ZDTA 3GZNI 4A9AA 1G6JA 3EN2A 2M9VA 5LHY1 2KECA 1MKHA 1QT9A 2I5LX 4KGRA 1TWAB 2N8NA 4R4TA 3HOWH 1R4PB 1HEZE 3CIRB 4X57B 1QUQB 3T16A 4B3RL 1STNA 2Z0DB 2KTRB 3RNGC 2XWBB 3GTLH 4LFCL 4YSXB 1I3QB 4RFBA 1LTLA 1VQLA 2GVAA 1VS0A 1ASYA 5IE8A 1XNRL 4K7UA 2EYFA 4JBWA 3TDQA 1HNXL 2BB5A 4I6NB 4IKGA 3JSVB 4A3KG 2K5WA 2N3SA 1I4PA 1VDVA 3VRAB 2A6HC 3D31A 2LUEA 1JE5A 3HKZE 4TRDA 3A8JE 5JPMC 3HOXH 3CF5A 4KGSA 3E9SA 3NTKA 4IPGA 4DV6Q 4F8CB 3Q0AA 4X3TA 3L0WB 3D4RA 3FDTA 2XRSD 3AV8A 3APFA 4LNNA 1E7PB 5AJ3L 2K0PA 1E24A 1HXYD 4L5RC 1FXIA 1A15A 3IAM1 2H5XA 3T1HL 3RUIB 5AUIA 3GDEA 2KDMA 5M5WH 1K50A 2QA4A 5FJ8H 2Z0SA 4JI7L 1J5EL 2Z8LA 1NCVA 3BZCA 3L7ZC 1JRUA 2G4SA 2A5HA 4IUMB 3UINB 1EUJA 2KENA 2LFNA 3BU2A 4JI1Q 1UE5A 2KEDA 4N9TA 1EIGA 1E1OA 1PH3A 4CO7A 1WI0A 1STBA 4EQOA 1JOQA 4A3JH 4ZKCB 1I6HB 2Y0SB 1PZJD 3TMEA 5M3FB 2L0TA 3SDZA 1CZPA 2XVSA 3GE8C 1VD2A 3M4OH 2A6ED 4FNFA 2JA7B 2Q2UA 1WVLA 4GLSC 4PK1A 3DVGY 1WD0A 5D94A 3RZWC 3P4SB 1DGJA 3U4ZA 2KVZA 3AB5A 2INDC 1E8WA 2UU9L 2F0GA 4CDFC 3H9DA 1ZXIA 1E10A 4WURA 2CQOA 1GKHA 2IO0B 4OGQC 2IPKD 1Q81C 1IW7C 1S4ZA 3VA5A 2W54A 1BDOA 3KOJA 4GKKL 5C6AA 3U7ZA 4CYEA 4M00A 4DR4L 5E6PA 4GN5A 1I42A 1LM0A 3OYYA 3R2TA 4OZBA 3RZFA 5BR8L 1WX7A 1XEEA 2E6XA 3KK7A 3G48A 5MPOA 1M8AA 1WTXA 2ZCCA 4GN1A 1F52A 1MHWC 2IX1A 4U68A 1SMYC 4XWTA 1UE7A 4RG1A 3J80c 2GLSA 4GSWA 5L83A 3K81C 5G3LF 3EGRA 2ZNVB 4DV7L 1LFDA 3ICEA 4C3JG 2QCPX 4A3IG 4KY7A 2LEKA 1L0YB 3CF6E 1RDPD 2DZJA 3PZ8A 4I6PA 2D2CC 4HJ7A 5AZHA 3CU7A 1NI3A 2L83A 4XE0A 4OWWB 3BZKA 1CQFA 2JVCA 4BXXH 2I38A 4IM0A 2BCOA 5JAVA 3L17A 2HJ1A 2VH1A 3SHQA 1XNRQ 5I9PA 4LFAL 2EE1A 2LUMA 3RD2A 5JVG3 4TSSA 2Z6BA 4LF4L 2FXQA 1C4QA 5J39A 2AHOB 4FULA 2JF5A 1D8LA 2NZOA 2F1MA 2B39A 3A74A 2K1BA 3K0XA 4C2MH 1IBLL 2MPMA 2MLBA 2V4LA 4WJQA 4HSPA 4RKBA 4DV6L 3HOVG 2L32A 1A3TA 2NVTH 4J6IA 2GBMA 2KOLA 1L1OC 3SD5A 4FF2A 3S9WA 3B6YA 5J17A 3VYTA 4DDGD 3TP7A 1QE6A 2A1AA 2YVCA 1U4RA 2V0GA 2KQSA 2B2YC 4MNOA 1MJCA 2FBWB 3PHXB 4JWSC 5C3JB 2D3CA 2K01A 5IGDA 1IBLQ 2NUCA 2SOBA 2C7NB 5EE1A 1TYGB 4X62Q 3IBEA 1QWYA 4AIMA 4LJZC 4DK3C 3A33B 3CC7A 4LUVA 5IYCH 4KJNA 2HHHL 1B2TA 1WFYA 2AMCB 2LGXA 3HOWG 3I4NB 2L11A 4Y7NH 1D5XC 3HOWB 3WALA 3S14H 1UH6A 3K7UC 2DNFA 3R3OA 1XMOL 4HAEA 3HOUG 2WXNA 5E6JA 2C9WB 4S0RA 3E9HA 2UUBL 3N30A 3RZOH 3C3LA 1FVIA 4EFOA 4X3UA 1GM5A 1VQ8A 4NXNL 3H91A 5AZGA 5C44H 3N9YC 1A2TA 1IP9A 4AQYL 2PI2E 1IL2A 2VS1A 4OVVA 3QHTA 3KDFB 3ABVB 5CV9A 1LYLA 3HOZG 3AE9B 1C9FA 2CKZB 4QL5A 3VR5A 3BY4B 2PZWA 1D7QA 1EF5A 2WNMA 4OHJA 4HMJA 3RZOB 2MJDA 5GQOA 2KVMA 5EAYA 4G11A 1X65A 4ITKA 2KHJA 3DWPA 5BR8Q 2I1JA 1S3SG 1Y69U 1GC6A 4HPPA 3DVGX 3GZNB 3S2DH 2VH2A 3JW0X 4XC2A 3RT3B 2F0DA 1XQQA 2INPE 2OHFA 3TBIB 3RLOA 4L5TA 2JA5B 4WQOB 1STAA 3A1QA 3RCZA 2KXJA 2AWTA 5T8IA 3V96A 1AFPA 4RNAA 1NJIC 2DX5B 2K3UA 2NBUA 1D5MC 2IT1A 2SDFA 5JEAG 2YTXA 1EU4A 4ZYSA 2N1WA 5G5GA 4YSZB 2AWNA 2D11A 4JV5L 1C4CA 2PEAA 1IKLA 2QEXA 3KBXA 4S17A 3WIMA 2RSNA 4O42A 3NUCA 3J81L 4H7BA 1HNWL 3OW7A 4JOIC 2UU7A 5IP9G 4OX9L 3D4DA 2B2TC 2Z6KC 4YWMA 3CCEA 1H9JA 1ZEQX 2PMZE 4C3IG 2MBEA 1Y8NB 4HLEA 3FEWX 5JHAA 1HR0W 1A2UA 4HJ8A 4MN3A 2ASBA 2K6QA 2VQFL 1V5TA 2L1AA 4A3DG 4MEMA 1C3TA 2N9XA 1QVCA 1S5FD 4CJ2C 3OTOQ 3G4SA 1XLOA 2DWQA 4DV4Q 5GMVA 5KGUA 4HIMA 1Q7YC 1E6EB 3N6RA 4YY3Q 2ZJQA 4N58A 1LTAD 5BMGA 4DAYA 4WFN3 1JB7A 3VAWA 3TSSA 1WZ3A 4ZHPA 2R7ZG 4C1NI 4KX6B 3WAPA 2BPSA 4NXNQ 1AZQA 2E2IH 5E4XA 1Y1VB 1FNVA 2VB2X 4K2LA 2MJ8A 2B63H 2A6EC 3W1BA 2KLGA 3DUZA 3AU4A 1FIQA 5C3EH 4FHJA 3ZNGC 2DYOA 1PQSA 4K81A 1PDQA 1C48A 1B70B 3MXUA 4JBMA 2R92G 1KFYB 2AL3A 2ZPYA 4AOFA 5D7GA 1RTOA 1PH9A 1OEYJ 4IOIE 2OWOA 3ENEA 2K8CA 1V8QA 4J6HA 1QCBD 1F9PA 2IHFA 2R2OA 2F0TA 1K9MC 3GTJH 2AUJD 3ND8A 3UDIA 3PMFA 4HVBA 3J81c 3T3NA 1A5RA 3HOYH 1E22A 3VXWA 3K5NA 3HOXB 2XEWA 5EE0A 2EJMA 3SK8A 5IYBG 4K7SA 2PZTA 1FCCC 1B8AA 3S2HH 1K8MA 1Q90A 2NYZD 1FCLA 1PMRA 1EFID 4KKIA 2HJ8A 5LMNQ 4JBJA 1KAAA 5FR3A 4QUFA 3VRBB 1CA6A 1IKMA 4KLKA 2KN5A 3I4MB 1C9OA 4G7OC 1N60A 1LT3D 1WE7A 2L00B 3H7PB 2KNBA 2RPVA 1YQ3B 3Q3JA 5ELEA 3QIAA 3TCAA 4Z9CB 3PPAA 3H0GB 4W9GA 3PZDA 5EJWA 1ML0D 5DPWA 1RJTA 3I7FA 4OWTB 1N36L 5K36G 1FFVA 3DLLA 3VR8B 1GUWA 4GLAC 1S5BD 3LGJA 2DAJA 4DR5Q 1CHPD 5LMUL 2D07B 3ZGZA 1KD1C 1H9MA 2BKRB 4RF0A 1Z6HA 3A7AB 1KRSA 4DR4Q 3GTQH 4U673 1KQSA 3DHIC 3I3TB 3KWVA 3M7GA 2QC8A 5KHOA 2KFKA 1R7SA 1RRBA 1BR9A 4JI4Q 1FNUA 2CU1A 4NZLB 4NAWA 1JB3A 2E75C 4DR2Q 3EFXD 1Q0WB 4HIDA 3I4NH 2N9KA 4GDLA 1R9TH 1PUTA 3K5OA 1G6ZA 3OPOA 1DOKA 1Y1VG 2WB1G 1VQFA 4ZCKA 1SE2A 5A2QE 5G55A 2PE9A 1LUZA 1FR3A 3MJWA 2JA8B 4BAXA 2K8BA 5JJIA 3NTHA 2RHSB 2BB6A 5C44G 1EWCA 3WAMA 1OQQA 2CS4A 2M1MA 3EBEA 4WJPA 1HZ5A 4NY0A 2WS3B 1CKOA 5T1GA 1B44D 4F1SA 2WIIB 2VW9A 4GGQA 3BYYB 4N6EB 4RHSA 3RYTA 2L1BA 2CQAA 4DHZE 1ACCA 4L23A 1SFOH 3L4PA 5KYIA 1WGKA 2FCSA 1W6JA 1YHQA 2I46A 2LXJA 4JK1C 1SGHA 1EY9A 4K1RB 3ZDMC 2HCCA 3H94A 2SNSA 5H92C 3VYRA 2G1EA 1PH2A 4BY1B 3SGIA 1TKWB 3GQBA 4KKJA 3CXCA 3DWQA 4A3FH 2KO3A 4FXDA 4ZOHC 1UELA 2MP2A 5KRUA 4B3TQ 3K7AH 3S1NB 2KA7A 4NPNA 4P1CC 3TZDA 1ZXTA 3OIPA 4BBSH 5E3FA 1C7YA 4FXGC 3CCMA 1IHZA 3EIVA 5AFWA 4B3SQ 2MW5A 2DYMA 4IOAA 1PH4A 2HD3A 2Q8RE 2MBBB 5EE3A 5KNBA 4HSVA 4AP4C 4H44C 4DV5Q 5IOCA 1YNJC 4X62L 5JEAJ 4OVZA 3HOYB 2YLMA 2E76C 2JN4A 4ID6A 1ZXHA 1MHHE 4OXPA 4KHZA 5AJ3Q 1V9JA 1VJKA 3BIID 4J3OD 3W9CB 2KD0A 3QOLA 3SU8X 3H3VC 1KAWA 2UUCQ 4IPHA 4K6DA 2KDFB 3K9OB 2WXMA 3EECA 2R7ZB 1FRRA 4JG2A 2PVOD 2XSCA 4X3KA 4ANVA 4DAYB 1VF7A 2PO4A 3LX0A 4P7IA 2BS4B 2K32A 3JAMc 1TVXA 3J7AV 1YNNC 1ZYRD 1LTTD 2IX3A 3ZTDA 4NAWB 1S5DD 4ZRKA 3PV1A 4ACFA 1Q1BA 4FLHA 2VXWA 5JPNC 3VR3A 3H1UA 1MI2A 4J15A 4II3B 2MO0A 5LMUQ 1VCIA 3TQYA 2WB1E 4UY8C 2D5DA 4DAPA 3I56A 4GMVA 1MD2D 3A8KE 4DR7Q 2M17A 3QAQA 1V80A 3NBHB 3OMGA 2BDOA 1A62A 4ZHOA 2G3QB 3V60A 4A3MH 4LK1C 4M8AA 1WTRA 1AZPA 1ESFA 3M62B 4JLCA 1Y1WB 2K1FA 4KSKC 2BOSA 5FKAC 3U8ZA 2KUMA 4HCEA 3WAOA 4NKLA 1MIUA 1GVPA 4NP5A 4JWUC 4YHHL 1UUPA 3VFKA 2WXQA 1BCPD 1MPEA 2MSED 2WGSA 1E8YA 5IP4D 2B2YA 3HP3A 5C4JH 3GTMH 4EEWA 2KCCA 2QCZA 3NBIA 1HFNA 4ANXA 2F0SA 2D0PA 4GDKA 1SNQA 1C78A 1PFSA 3F2UA 1K52A 2Q5WD 1L1OA 2J52A 4M1UB 3BJUA 4L8JA 2QIEB 4IQZA 3K57A 4ZKBB 2O6VA 2F3IA 2V1YA 2N78A 2F52A 4POFA 4ALPA 3A9JB 1WGDA 3KUZA 4JE3B 2O5IC 4C3IB 1N8RC 4YXDB 2HUGA
chains in the Genus database with same CATH topology
2TMPA 4FP5D 4MIUA 1YMHE 3I57A 2WDRB 3SK6A 3ZJVA 3I73A 3PIO3 1DOLA 1P7EA 2PW5A 5K36H 4N9PA 1LT6D 2MUYA 4OW0A 2IWHA 4XT1B 1F2MA 4HCSA 2NVYB 3U9SA 1I50B 1MGSA 2F0QA 1I4GA 1U4MA 3AEFB 5EGTA 4BY7B 4RA8A 3GTMB 5C3WA 2EVBA 3M4YA 5BN3A 5I2XA 2F3WA 3FAHA 5ISRA 4IFDI 1TWHB 1B4OA 3SFDB 1DZ1A 4NDXA 5FOBB 3Q8EA 1TQOA 1RKNA 2IJ0A 2JYOA 3SHLA 2J42A 3NVVA 3AECB 5G5HA 3MEHA 3HOUB 3MXPA 5IODA 2F0WA 5HURA 1FRDA 4GZYC 3A54A 2BBCA 1TWGB 4C3HG 1SF0A 1JOOA 2WXOA 1FXAA 2JU6X 1FGBD 1SNMA 3VYUA 1ICWA 1O78A 3LWEA 2WU5B 5DM63 2YYZA 1B9MA 1DM0B 3TP5A 1GXDC 3V05A 1K8OA 5C0XJ 4WWMA 4FF4A 2PTLA 1G291 5CBAE 1JCKB 2W82A 4KTAA 2EJFC 2F0VA 3K59A 3AN1A 1F9QA 5D3IB 1EEFD 1HQRD 5CV6A 4YSYB 4TMAB 3S1MB 1GUGA 3FPPA 4C1NK 5IGEA 1BCPB 2N7JA 5FO7B 2BTEA 1BF4A 1GOZA 1UGJA 3W3AA 3RUZA 3NQIA 2LHDA 4H0LC 2IL8A 5LL6X 4WQMA 4MT5A 4NJCA 3A7LA 1EY6A 5HG2A 1TS5A 4CBVA 1JICA 3S2DB 3Q69A 2MGSA 4ZRQA 2FE8A 1YNJD 5CORA 4HEDA 4KHVA 2L12A 4KGTA 4P6VF 4R3DA 1PRTF 1SMYD 1TU2B 3E6ZX 1JW9D 3U7ZA 2N55A 3MHBA 4ZAIA 1DOMA 1QQRA 2NN6I 3Q8FA 1TS4A 4C56C 2W3RA 2F0FA 2CJOA 2PCFB 1TY0A 5NUCA 4RNAA 2K6AA 3U52E 2XWJB 3A55A 3E0JA 3Q22A 4CJ0B 3AEBB 3S1RB 4YTPB 3IAYA 5BYSA 4S3SA 5LL6S 5JVH3 4MM3B 5BMIA 4FYDA 4DFAA 5CV5A 1J7CA 1WTWA 1ZDXA 2MJ3A 4WAFA 4E6IA 2N0SB 2K7VA 4ZUIA 3Q8AA 4K8IA 4DN4M 3AEEB 2PLPA 1XX8A 1UWXA 4YTMB 1Q12A 1EYAA 1F77A 2PQEA 3VA7A 4I7ZC 4A3MB 2NN6G 2KJXA 1TZOA 3X3MA 1RYJA 3BDOA 1SNOA 5C3EB 3LNNA 3M85A 3P1MA 4KKSA 2A6HD 2PW7A 2K05A 2V3PA 1LV9A 3CRKC 5ELBA 3MTSA 1JORA 2YEPF 3ZJUA 1PFMA 1STEA 1P7FA 1OO9B 1SE4A 2NN6H 3V3XA 4EVOA 3PZ7A 1QJOA 2NB0A 3P1HA 4QB4A 1G2TA 1ESRA 3GTJB 1T5XD 3OOCA 2EYLA 5E4WC 2F0MA 4B0EA 4RGNA 3B2GA 4A55A 1AW7A 1D5ZC 2IGHA 2EPBA 4OO1H 3HG9A 3HRZC 1UWMA 3OHXC 1KH0A 1MVKA 2JXTA 1EWYC 2AUKA 1GB1A 4KKTA 2O5JC 4CGYB 4LMQD 4K8JA 1CHQD 4H2AA 3BS1A 2KWDA 5FK9C 4PNYA 2WXPA 4OZAA 1AP0A 3IFDA 4TKOB 4XQQA 1ZE3D 1E0BA 2IW3A 4DNRB 1XYIA 1XO3A 4P2CB 1HUMA 4A3EB 1EEID 4NAMA 3WOEA 1BNZA 1PTOC 3FKIB 5F2DA 2R3ZA 1H9RA 5KEEA 1RTNA 3NXWA 1VLBA 5EPKA 3J7AF 1XLPA 1EQTA 2RQXA 2IX0A 2WU2B 4TQUS 4AQ7A 3S14B 1QOGA 2EJGC 2RDGA 4XXEA 1DOIA 1D4BA 3I90A 3RMHA 1PRTC 3HOVB 2R93B 1NR2A 3I4LA 1ZOYB 2QEJC 1ZKOA 3ONAB 1JOKA 2ICEC 5AUKA 1ZP0B 2WDVB 1YN5A 4J8QA 4CJ1B 2J7ZA 3I3CA 3VR2A 4NMZA 3SEBA 2M00A 1T5EA 4Y7NB 3FVQA 3JAME 4KK7A 4RWSC 1JALA 1OFFA 2NTSA 3NTIA 4KY6A 1V1PA 3K58A 4XDDA 2X6LA 1JRPA 1PTOD 2R61A 3QWNA 2Y5PA 2JWUA 3MVVA 4K14A 1AEXA 4ODGA 3GV6A 2IGDA 4G7ZC 1C79A 1Z7TA 3S1QB 4DU9A 4C3JB 3TEXA 2J0TD 4DQOC 4USAA 1D2BA 1QB5D 3RFZB 3I70A 1ZDVA 3J80L 1UNSA 1KLGD 2BS3B 3DEPA 3RPFC 1QNKA 1OXVA 2EYOA 2L5TA 4US8A 3PUYA 3T4AC 5T1IA 3DXJC 2X6GA 4PQXA 4B9XA 2MEKA 1L6UA 4I65A 4PMCA 4F8MA 2INNE 1CM9A 4OZCA 1B53A 4QMGA 2PMVA 2JP1A 1XTCD 1BUIC 1J7BA 5EQ0A 1NYQA 4WH4A 1BBXC 2F0KA 1EOTA 2DY8A 1U9RA 4CHTB 1CK1A 4K6LA 1HA5A 2MH7A 2F0JA 3MP9A 3RLFA 1HRJA 5AUIA 1K83B 3OWEB 2LFIA 1CT1D 1WYGA 3CQZB 4HKQA 1PFBA 2OT2A 5EE9A 2VZKB 1YNTE 1VR9A 3PUWA 2A69C 4IUQA 4BS9A 4FXKC 1LTGD 4IUNA 1TR5A 2LKVA 4RCNA 4A3JB 4LK0M 3QJYA 2MHVA 1MSGA 5KNDA 1ILPA 5C0XG 1B50A 3DWMA 4HEA1 3NUHB 1OXXK 1VDZA 1TKEA 4RGMA 3GD7A 2K28A 3MA2B 3DM1A 2OXPA 3S15B 5CBEE 2PNRC 4YIJA 3VR4A 1LLRD 2D62A 4DXFA 1JQYD 3D8GA 1EY8A 4XTCS 3GTPB 5C4HA 4WIPA 1DOYA 3BZDB 1L0XB 1I4RA 2B8GA 4K5VA 4DXGA 2B2WA 1ONLA 3URYA 4MHEA 1ENFA 5JEAH 1SJED 3ETRA 2BA0A 2Q8TA 4L1BA 4GDLB 2F0NA 4IFDJ 3TP8A 1X32A 2B2VA 4RAUC 3BDLA 2Z4IA 2EOTA 2WXGA 2GA4B 1WTPA 4C7YA 3P4RB 1U4LA 1TJEA 1Q1EA 1B1ZA 3Q8CA 2A68D 4HTHA 4US9A 3GV3A 1I7HA 2NMQA 3PIP3 1YJJA 2B2WC 2EY6A 5C4ZA 4EE2A 3S2HB 1O7YA 2JE6I 1QF6A 3KF8A 1BUVT 1DOXA 5IT9L 3C2PA 1TKGA 2SAKA 1X3QA 4V190 1PDXA 3FPUB 5EPLA 3SVMA 2E3TA 5FO9B 1SE3A 4A3KB 3HUIA 1A6XA 2I07B 5HI1A 1XXGA 4A8XC 2E2DC 4B0MA 3J81E 3BK1A 2FINB 3AE2B 1V97A 1EZ6A 1PTOH 3CRLC 3QG1A 1LT4D 1Y8PB 3KLSA 5IGCA 1WWTA 3R93A 2ZW0A 2PMZB 4K5WA 1NENB 4A90A 4A3BB 1JWAD 1AYFA 4XQNA 1HTPA 1YN3A 3LB8C 3MC0B 4O1NA 2B76B 1H9KA 5C5LA 5TSSA 1ENAA 1PZKD 1JWMD 4IALA 5ELDA 5G3LD 1V1OA 2E2HB 4ILWA 3T13A 2K9XA 4JPSA 1BXTA 1I6VC 5KIXA 2L52A 1PGXA 1LTBD 5C44B 1CQVA 4JX1C 2JYEA 1PRTD 2LJIA 4OO1I 4R8NA 4K2KA 3T3OA 3AEAB 2JQRB 3PO2B 1E0ZA 3W2DA 2PVGC 5HGTA 3RD4A 3SR1A 1YJIA 3BK2A 2H4OA 1JE4A 1TY2A 3SK4A 2AQ3B 3TEZA 1XCQL 5C2TB 1U4PA 3PV0A 1I4HA 3P63A 3S17B 2F0LA 3KLRA 4IUTA 1LTSD 3AB9A 1XLQA 3HZXA 4C2MB 2W3SA 1SYDA 2PW9A 5C4JB 3PUXA 5K5PA 1YNND 4KV6A 3KBGA 1R4QB 3AE6B 1FD7D 1N5XA 4DAVA 3K6OA 1VRAB 3J80E 1LTRD 1TWFB 1ET9A 3VR9B 3NVWA 1FMAD 2XRQD 5IGFA 1SSNA 5FO8B 3H8HA 3N52A 2QKIC 1C4PA 1C8CA 1QOHA 1NSNS 1IYUA 2NBFA 2ZXRA 3LXFA 2JYTA 4ABNA 3ERQA 3IT4B 1VF5C 1F9RA 3NHHA 2V4DA 1WRIA 1ZYRC 2CU3A 2XIWA 1JC7A 1KLUD 2NWGA 2WDQB 2B2UA 1BO0A 1XF5L 4G57A 1FD6A 1JMLA 1YQ4B 1KTKA 4IURA 2K22A 1RM6C 3VQIA 3AE1B 1SJHD 3EVQA 1T6BX 1KDBA 2LY7A 2Z4HA 2MP1A 1S5ED 2A74C 2H88B 3M3YB 5EKIA 4YWGG 1EL0A 2ID0A 4IUPA 4KY5A 2R92B 3TUOA 5A2QL 1GPXA 5COYA 2F0OA 1C76A 3CHBD 1JWUD 4KI0A 2DBYA 4ZQ3A 3A8IE 5BN4A 4ULLA 3P75A 5CMDA 1FO4A 3AE7B 1F0ZA 2W55A 5EPJA 4IZ8A 1AN8A 1FNWA 1KF6B 4PT5A 3R8BA 1R9TB 1NEKB 1PZID 1CFMA 4REZA 4ZRPA 4KD4A 3OSOA 4UDUC 2ICIA 3TZUA 2ONQA 1HA6A 4YT0B 1NYRA 3WOFA 3P42A 3VYSA 5CV7A 3NSWA 3NPPA 3MFGA 4XQJA 1LT5D 4CKBA 1G2SA 4DNTB 3KLSX 4Q5VA 1WTVA 3Q23A 3NS1A 2FMCA 2GI9A 1GUTA 2K5QA 4ARIA 2F4IA 4HN7A 2IGGA 1Q10A 1STHA 2WXKA 2FHTA 2PKOA 1EYDA 1ZPSA 2J4XA 5J22A 1EZ8A 4IFDG 2EY1A 2DLBA 1VMPA 3CKIB 5M9OA 5BYRA 5EKLA 1WCMB 1H9SB 1JWBD 1XCTL 1QILA 3ITPA 2FJ2A 3MJ5A 1DYQA 3U9OA 4FXCA 3TP6A 1O7LA 2N9LA 4TQ0A 2KEEA 4V0BA 3P4PB 4IFDH 2WQYB 1KNAA 1Q8IA 2DY7A 2L55A 1SNCA 1EIHA 1AWDA 3DMUA 1N62A 1FEHA 4KN7C 2XNAC 5IT9E 2JX5A 3AE4B 3SXHA 1Z47A 4DA2A 4DF7A 3GB1A 4EGVA 2M56B 1CZWA 1GHJA 3BVGA 3NE5B 3OMCA 3GTKB 5DEHA 2H1EA 4QF4A 2V3NA 5M5XB 2DN8A 1V8CA 1C77A 3J9CA 3NQTA 3J7YW 1MI0A 4J1MA 2HDEA 1E2WA 2G9DA 2ZXPA 5I2YA 3NWTA 4DK0A 2EELA 2M2LA 5EBCA 1GJXA 2WXJA 4AS1A 2OEOA 1SFOB 1QOFA 3DWGC 3T53B 1WXQA 2YU9B 2KCNA 2BS2B 2L0CA 3FILA 2EYMA 4XYQA 1SYEA 3BYTB 1V43A 3UI3A 3SR6A 1JQ4A 2J53A 1D1KA 2HTME 1KDAA 2ZT9C 3IFTA 4G7HC 4FVMA 1GAQB 4HMIA 3U4EG 1GHKA 2WXRA 1MSHA 1TKYA 4KMUC 1QG7A 1IW7D 1VMCA 5BMHA 1BCPC 2WKCA 1KRHA 1ZUD2 2PIAA 4LLGM 2KAJA 2ON8A 4A3GB 2OF1A 2QJLA 1EY0A 2WKDA 5EBDA 4KJOA 1IGDA 2BW2A 1XLNA 1JWSD 2RSOA 2F0IA 3A56A 2EXZA 2M19A 1EWHA 1BCPF 5C0XI 2EZVA 5I4DA 3Q24A 3TEYA 2X38A 1HTLD 3MXNA 3AE8B 3T56B 3GP7A 3NWSA 1SYBA 3D3RA 1YN4A 4DGZA 4B9WA 2DNCA 5FLXL 4FF3A 1HZ6A 3GTLB 1PGAA 1N61A 1MBYA 2B2UC 2KN4A 3C1FA 1XWEA 2BDNA 2G9HD 2WXHA 3C8YA 1B9NA 2JSVX 3KQ4A 2B63B 4EQPA 1C4AA 1F2RI 2K5DA 2GRIA 1IYVA 1G91A 3EJIA 2WAQB 4ZRZA 3TN2A 1UEAB 5D65A 3R2IA 1SYFA 5GXGB 3NVYA 2OEDA 2F3VA 4CKCA 1DONA 2MJEA 2PYKA 5A35A 3MHZA 1J8IA 5JXVA 3PUVA 1SYCA 3G6JB 3HGBA 4OIJA 2RMMA 4IUVA 3W1SA 1TS2A 1EY5A 2N88A 1NR4A 2KQ4X 3GO5A 3X3NA 3K7AB 2LS01 2K04A 2I2YA 2K5PA 4UAIA 1PYWD 1F2ZA 3P20A 3WDNA 4HROA 5LNK1 3NVZA 5CV4A 2ZW1A 4WJWA 5CV8A 5IGGA 2JSOA 1FFUA 1WD1A 5JJZA 3FILB 2Z1CA 2EYHA 2FUG1 3HVZA 1NAPA 1J9OA 5KNCA 1O7ZA 4XDXA 4PV1C 5DAUA 1ROEA 2XN9C 3M4OB 1IUEA 2H89B 3OWFA 2BYTA 2EKIA 4M0WA 1ET6A 4OIKA 2K33A 2CHBD 2RKSA 1K53A 4IUUA 4LTUA 1IBXB 1PGBA 2ACZB 2F0PA 1O80A 2VUMB 1EY4A 3HRDD 3AE3B 2WXLA 5ELCA 3CWIA 1ENCA 3G7LA 1VZ7A 2ZXOA 3M7NA 3HEJA 2HCIA 4RGOS 2WXIA 1SAPA 2C5CA 2E2JB 1SB3C 5HFYA 1VZ8A 3W5VB 2KMMA 3IL8A 4RCOA 1QLBB 1EYCA 2O4XA 2NZ1D 1PLFA 1WTQA 4XDCA 4YTNB 2C9OA 3GS2A 2F0EA 4QCLA 1PFDA 2VZKD 3EROA 3KUPA 1TWCB 1FYCA 1SDFA 4RH6A 1HHVA 2E74C 4RHRA 4DK1A 1STGA 2WP8J 3I91A 2NVTB 4D2KA 4ME5A 1Y56A 3BVMA 4OO1G 2AQ1B 2AX5A 1DXMA 1DJRD 1RHPA 1A3VA 3AMZA 1GUSA 1I4QA 1LTID 2YEPB 4KD3A 2NTTA 1NUCA 2Y5CA 3I72A 3NZ3A 1JROA 2WV6D 5M3MB 5H8YE 3S16B 3Q8BA 2RDHA 2F03A 2B2VC 4F87A 4PMBA 2EYPA 1W6KA 1EQVA 1EM7A 4A3FB 3BDCA 4OL7A 2WACA 5BYQA 1OQRA 1QOBA 3EQLC 5IGBA 2KQ3A 2RVLA 1TT2A 3D4WA 3FC4A 2JA6B 4XIGS 1T3QA 5D14A 4XT3B 5D3DA 1BOSA 1V1PB 2F0UA 2LMCB 3NK9A 1H9SA 5C0XH 2KHSA 3O13A 3BWUD 3AMUA 3W5UB 1SYGA 1WTOA 2ENBA 3FMCA 5C5MA 3B2FA 1QKZA 2GB1A 2LGIA 4MH8A 1KDCA 2RBMA 2BT6A 3LWUA 1SXTA 4L6TB 1BMLC 3L3OC 1CTMA 1IL8A 1PXUA 2WB1B 3AE5B 1L6VA 4K5XA 2FFKB 3SE0A 4Q0FA 3HOZB 4FF1A 1NVID 3I8ZA 3AEGB 1L5PA 1RD9D 1EU3A 4N59A 3D6CA 4HR7B 5C4XB 1HCZA 2BA1A 1IBXA 3PO0A 3GTOB 1LABA 2B2TA 1Q3LA 3BG3A 3EUB2 4QIWB 4HKZE 2V4IB 4Q2JA 4KKUA 5CGKA 3AU7A 4XYOA 3JAML 2O2LD 1DD2A 1LACA 1HUNA 3SK5A 4WORA 2AQ2B 2BE5D 1SIJA 1SEBD 2SNMA 3T51B 2WP9B 1TS3A 3QOJA 3ZJTA 1DCZA 3MXGA 5IIFA 1HPCA 2EY2A 5CR3A 4HJGE 1J7AA 1GB4A 2HQEA 1E2ZA 5I6YA 2E2IB 3K0YA 1N5WA 1LO5D 3FRPB 3C46A 2D5GA 5FLXE 4BBRB 1JR0D 2PZUA 2FMMA 3C1EA 4C7ZA 1IGCA 4ZK9B 5DNFA 4C80A 5M5YB 4B08A 1L0VB 4H13C 4X3SA 1KNEA 4KN4C 4TQ1A 4AYBB 1F2YA 1CJEA 4WRDA 4L2YA 2KACA 1I4XA 1PTOF 3AM9A 3IKJA 1G8ZD 5EKKA 1RCVD 4RKLA 1RF2D 3ND9A 2EYJA 3ZYYX 2JZPA 4C3HB 1F2LA 3BVZA 2HDLA 3GTGB 2A69D 3U2SC 3NRZA 1F2RC 4IDIA 3HVDA 3P7JA 2Y3AA 4F88A 5I9OA 1L4ZB 3NBHA 3E5SA 1MHXA 2LMCA 5ELFA 2AWOA 3HKZB 3P4QB 3DHQA 3MZ5A 3PUZA 1OXUA 1OXTA 3E56A 4GDKB 1GUOA 1B9RA 3UI2A 3DEOA 4P16A 1FM0D 2HDMA 5I6WA 1RWSA 1S5CD 2A73B 3NP8A 2CW0D 1WSPA 1E2VA 4G4KA 2CJNA 3K5LA 4IN3A 1SSOA 1A70A 2PPBC 1K51A 2Q8IB 3WCQA 1RODA 2LHEA 4CKEA 2BE5C 4CQNA 2QDBA 1QOAA 4L63B 1GUNA 3H09A 5KYLA 5HHDG 1OXSC 1SBBB 5BN5A 4EQNA 2JEBI 3IXSA 5C3XA 3ZQ4A 1Y8OB 2QMTA 2EY5A 1B3AA 1QNUA 1STYA 2R6GA 2EDGA 2F0HA 3QO2A 4R8IA 1CI3M 2SEBD 4A3DB 1HFGA 1D6EC 3V2TA 2D9UA 1II3A 1TIID 3GTQB 1D1IA 1SNPA 1SNDA 1UAPA 3MAQA 2M0AA 1CA5A 5DM73 1X3PA 1E9MA 4XWWA 4A6QA 4RF1A 3Q6SA 2NVXB 5CYUA 2TSSA 3LYYA 1ILQA 3DWAA 2X69A 4BBSB 3D6WA 1VZ6A 2L4NA 5JOBA 2RDFA 2IDYA 2K03A 1KABA 2WLBA 3VR6A 2QSDA 2QILA 1L4DB 3EA6A 3PO3B 1N63A 2A68C 3TEWA 2JEAI 3AH7A 1PRTB 3OIQA 3RZDB 2RA4A 1HQMC 4A93B 3KWLA 1BQQT 2B8FA 1CZGA 4F7XA 1PTOB 3L9AX 4A3IB 3I9V1 2DNEA 1A3UA 5E1FA 2WXFA 4HRSA 4MACA 4R9WA 3H6MA 3IAS1 4BWGB 4RGTA 4NW2A 3MWYW 4FO2A 5M5WB 1RFKA 4BA2I 4PMWA 1M4VA 2L9HA 2JXMB 4QUCA 3K5MA 2VNUD 1EY7A 2CW0C 2CVRA 4ZLTF 2QF7A 4ZUJA 5CC4A 3SFEB 3HS0C 5J1ZA 3IT6B 3B9JA 2VB3X 3MFYA 2WINB 2NVQB 3QB3A 3AEDB 4LAAA 1F9SA 1PFNA 4BA1I 4A9AA 2M9VA 5LHY1 2KECA 1QT9A 4KGRA 1TWAB 1R4PB 1HEZE 3CIRB 3T16A 1STNA 2XWBB 4YSXB 1I3QB 4RFBA 2EYFA 4JBWA 3TDQA 2BB5A 4IKGA 2K5WA 1I4PA 1VDVA 3VRAB 2A6HC 3D31A 4TRDA 3A8JE 5JPMC 4KGSA 3E9SA 3NTKA 3Q0AA 4X3TA 3D4RA 3FDTA 2XRSD 3AV8A 1E7PB 2K0PA 1HXYD 1FXIA 1A15A 3IAM1 2KDMA 1K50A 2Z8LA 1NCVA 3L7ZC 2A5HA 2LFNA 2KEDA 4N9TA 1EIGA 1STBA 4EQOA 1JOQA 4ZKCB 1I6HB 2Y0SB 1PZJD 3TMEA 5M3FB 3SDZA 1CZPA 2XVSA 2A6ED 4FNFA 2JA7B 1WVLA 4GLSC 1WD0A 3P4SB 1DGJA 3AB5A 2F0GA 1ZXIA 1E10A 4WURA 4OGQC 2IPKD 1IW7C 1S4ZA 3VA5A 2W54A 1BDOA 5C6AA 3R2TA 4OZBA 1XEEA 2E6XA 3KK7A 5MPOA 1M8AA 1WTXA 2IX1A 4U68A 1SMYC 4XWTA 5G3LF 3EGRA 4C3JG 2QCPX 2LEKA 4KY7A 1L0YB 1RDPD 3PZ8A 2D2CC 3CU7A 1NI3A 2L83A 4XE0A 1CQFA 2I38A 2BCOA 5JAVA 5I9PA 2EE1A 2LUMA 5JVG3 4TSSA 1C4QA 5J39A 2F1MA 2B39A 4ARCA 2K1BA 2MPMA 4HSPA 4RKBA 2L32A 1A3TA 2KOLA 4FF2A 3S9WA 3VYTA 3TP7A 1QE6A 1U4RA 2V0GA 2B2YC 2FBWB 4JWSC 5C3JB 2K01A 5IGDA 2NUCA 2SOBA 5EE1A 1TYGB 1QWYA 4LJZC 1B2TA 4KJNA 3I4NB 2L11A 1D5XC 3HOWB 3R3OA 4HAEA 5E6JA 2WXNA 3C3LA 4X3UA 3H91A 3N9YC 1A2TA 3ABVB 5CV9A 3AE9B 1C9FA 3VR5A 2PZWA 2WNMA 4OHJA 4HMJA 3RZOB 2MJDA 2KVMA 4ITKA 3DWPA 1Y69U 2F0DA 2INPE 2OHFA 3TBIB 2JA5B 1STAA 5T8IA 3V96A 1AFPA 2K3UA 1D5MC 2IT1A 2SDFA 5JEAG 1EU4A 4ZYSA 5G5GA 4YSZB 2AWNA 1C4CA 1IKLA 3KBXA 2RSNA 4O42A 3NUCA 3J81L 4H7BA 3OW7A 3D4DA 2B2TC 1H9JA 1ZEQX 4C3IG 1Y8NB 3FEWX 1A2UA 2L1AA 4MN3A 1S5FD 4CJ2C 2DWQA 1XLOA 5KGUA 1E6EB 3N6RA 4N58A 1LTAD 5BMGA 4DAYA 4WFN3 3TSSA 4ZHPA 4C1NI 4KX6B 1AZQA 5E4XA 1Y1VB 1FNVA 2VB2X 4K2LA 2MJ8A 2A6EC 3DUZA 1FIQA 2DYOA 1PDQA 1C48A 3MXUA 1KFYB 5D7GA 1RTOA 4IOIE 1V8QA 4J6HA 1QCBD 1F9PA 2F0TA 2AUJD 3ND8A 3PMFA 3T3NA 3K5NA 3HOXB 5EE0A 2EJMA 3SK8A 2PZTA 1FCCC 1K8MA 1Q90A 2NYZD 1FCLA 1EFID 1PMRA 4KKIA 1KAAA 5FR3A 4QUFA 3VRBB 1CA6A 1IKMA 3I4MB 4G7OC 1N60A 1LT3D 2RPVA 1YQ3B 5ELEA 3QIAA 4Z9CB 3H0GB 5EJWA 1ML0D 1RJTA 1FFVA 5K36G 3VR8B 1GUWA 1S5BD 1CHPD 3ZGZA 1H9MA 4RF0A 1Z6HA 3A7AB 4U673 3KWVA 3M7GA 1R7SA 1BR9A 1FNUA 4NZLB 1JB3A 2E75C 3EFXD 2N9KA 1PUTA 3K5OA 1G6ZA 3OPOA 1DOKA 1SE2A 5A2QE 1FR3A 2JA8B 3NTHA 2BB6A 1EWCA 1OQQA 1HZ5A 2WS3B 5T1GA 1B44D 2WIIB 3BYYB 4N6EB 4RHSA 2L1BA 2CQAA 1ACCA 4L23A 3L4PA 5KYIA 1WGKA 1W6JA 2I46A 4JK1C 1EY9A 2HCCA 3H94A 2SNSA 5H92C 3VYRA 2G1EA 4BY1B 4KKJA 1TKWB 3GQBA 3DWQA 4FXDA 4ZOHC 5KRUA 3S1NB 2KA7A 3TZDA 1ZXTA 3OIPA 5E3FA 4FXGC 1IHZA 5AFWA 2DYMA 5EE3A 2Q8RE 5KNBA 4HSVA 4H44C 5IOCA 1YNJC 5JEAJ 4OVZA 3HOYB 2E76C 4ID6A 1ZXHA 1MHHE 1VJKA 4KHZA 3BIID 4J3OD 3W9CB 3QOLA 3H3VC 4K6DA 2WXMA 2R7ZB 1FRRA 2PVOD