3OG5A

Crystal structure of bama potra45 tandem
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
160
structure length
160
Chain Sequence
AMDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Flexibility of the Complete Periplasmic Domain of BamA: The Protein Insertion Machine of the Outer Membrane
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding
molecule keywords Outer membrane protein assembly complex, YaeT protein
total genus 46
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07244 POTRA Surface antigen variable number repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 3og5A01
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 3og5A02
3MC8A 3OG5A 2VH1A 3EFCA 2VH2A 3Q6BA 2QDFA 2MHJA 4XGAB 2V9HA 2QCZA 2X8XX 4C4VB 4BZAA 4QAYA 3MC9A 4K3CA 3NJTA 4PK1A 4C4VA 4C00A 4K3BA
chains in the Genus database with same CATH superfamily
4W9LA 2G3QB 1ENFA 3BVMA 2C9WB 3K9PB 3VR8B 4MSQB 5BO4B 1QILA 2BS3B 2LGDA 5G55A 1EO6A 2RPQA 4RNAA 1VR9A 5TSSA 3NY5A 4HXDA 4C4VB 3TEYA 2VRRB 1E90A 4DBGA 2JYTA 3DVGY 2V4IB 4AQ7A 2INNE 3B2FA 1V5OA 4RGNA 4WWPA 2QDFA 3ENEA 3KVFB 3TIXA 2K9XA 4IUMB 4P1BC 1UD7A 4YWGG 1N5WA 3UINB 3DQVA 1C1YB 1WJNA 2KFKB 3A9JA 4H2AA 4NQLB 2ZNVB 4UDUC 3CMMB 1I4QA 2LRUA 2KQ4X 1JQ4A 3M62B 1YJIA 1FXIA 2KXJA 3AH7A 1T3QA 3QHTA 2NMQA 1RLFA 2MP2B 1KLGD 2LHEA 4KSKC 4RGOS 3DBRI 5MPOA 4DHJB 3O65B 2GI9A 3UIPB 1HZ5A 5JH5C 3B2GA 3I5JC 1VZ8A 4NAWA 2L8JA 2N7JA 1TIFA 1RYJA 2V1YA 2LGIA 1DOIA 2QSDA 4B6WA 1E5WA 2PE6B 5D3DA 1L2NA 5E6PA 2X38A 1NYRA 3M63B 1K53A 2N9LA 3A33B 4A6QA 4NJ6A 4K7SA 4AUQC 4KDLB 3R8BA 2LUMA 1JW9D 3LJ3A 2ACZB 1N61A 1YX5B 2WXKA 5BMIA 5LNK1 2D10A 4KX6B 3W5VB 2O6VB 2VZKB 2H89B 3RD2A 1ZE3D 4LNIA 3HVZA 3RT3B 1D6EC 4YSYB 2JSVX 2WWZA 1J0GA 3VXWA 5G5GA 3NZSA 4MJSB 2JU6X 4DDGD 3QAQA 3NZ3A 5DPRA 1CZPA 4RF1A 2MBQA 3MC0B 2MA9B 4WQOB 3CSTA 2I38A 2D3AA 2L05A 3ALBA 3ML8A 2XK5B 2O6VD 2KNBA 2HDEA 4OZCA 4ZRQA 3DPDA 1PUTA 1ZXHA 5D6JB 1ESFA 1F9JA 1E10A 4JWSC 2PVGC 3RNBC 2LGYA 3HM6X 1SSNA 4ZRIA 2K8BA 3PO0A 3T3NA 3Q14C 4XC2A 3W1SC 3NG0A 3I57A 2Z0EB 2BTEA 1WM2A 2D07B 1EWYC 1L0YB 1WH3A 3L16A 4KSLC 2X8XX 4C7ZA 1L4DB 5CHWA 5AZHA 5CTRC 2UYZB 2JXTA 3U4EG 3VRAB 2LI5A 5KHOA 3P4RB 2FE8A 3T3OA 4JE3B 3NVZA 5D3IB 1G6JA 4OVZA 3SEBA 2J52A 4MT5A 4XX5A 1C4CA 1F52A 3A1QA 3AEAB 1E7VA 2OHFA 1R4NI 1D5ZC 2A5UA 2WXPA 2WDRB 3EGRA 2BKRB 2Y5BB 3X23A 2KT7A 2NPTA 3CWIA 3P4QB 1ZGUB 3PZDA 3VQIA 2TSSA 4C56C 1C9FA 1K51A 1HTOA 4A90A 1SIJA 1XLNA 1WXMA 2KMMA 4FHKA 4JLCA 1WX9A 1SB3C 3AEBB 3DBRB 2KX0A 1K50A 1Q0WB 2Z8LA 3BY4B 2JF5A 2KAJA 2JWZA 1OFFA 3ZNHB 3AE6B 3LDZE 1E6EB 2YEPB 3KWVA 2OEDA 2BB6A 2XN9C 4ZHPA 1WWTA 3D32A 5D94A 2K6QA 3SFEB 4MH0E 4KGTA 2FAZA 2KDBA 2GBNA 2LEKA 4XGAB 3KYDD 3B1LX 1I4RA 5C23A 2JY6A 1XCTL 5HFYA 4X57B 3V61A 3J9CA 4IM0A 1FPYA 4G0NB 2MW5A 3MP9A 2FIDA 1T5XD 4K7WA 5CHVC 1VRAB 2KLCA 2IO0B 3AE9B 4E3CA 2W82A 1I4XA 2MX2A 3PLVA 3DBHI 2JZ3B 4GLSC 2K6DB 3PZ7A 3L54A 2INCC 2LXCA 2MJ3A 1C78A 5AZGA 1PYWD 3MJ5A 1V81A 3ZNZB 1GUAB 1RAXA 2V3SA 3ETRA 1VJKA 2WDTB 1YD8U 3ZYYX 1UGJA 1X1MA 2BKFA 4EOYA 3EC8A 2V9HA 3RCZA 2BYTA 2L00B 3VR9B 2BWES 1HE8A 1UF0A 2L52A 3IT4B 2PTLA 2VZKD 3BVZA 5IO9A 3OJ3A 3Q8BA 4FHJA 4DHZE 3APDA 3L17A 3CIRB 2MHJA 2PJHA 3VUYA 1RFKA 2D5GA 3DBLB 4ZYSA 4WWOA 4LNKA 2YLMA 1QOFA 4II3B 1T0QC 4CHKA 2ZCBA 4JQWC 1EUVB 2JUOA 2DYBA 3QX1A 2KO3A 4FBJB 5HKHA 3UI3A 3NVWA 2YVCA 4G11A 2PLPA 3Q6BA 2WX0A 3KUCB 1JALA 2R61A 4F7ZA 2WU5B 3HM3A 3W1YA 1TT5B 2PEAA 1TYGB 4RMAA 2NVUI 2RGFA 4FULA 3ZIMA 1EF1A 3DBHB 2GRIA 2INDC 3OWEB 4KIKA 1NBFC 1QZEA 3R2TA 3WCQA 2GLSA 4NZLB 2IDYA 3ECIA 1AN8A 4ZRPA 4IDIA 1XLQA 4BAXA 3VTUA 2I1JA 4WQMA 1RWSA 1KRHA 2ZW1A 2AWTA 4F1SA 4TUUA 2ZVOA 2KLGA 4D2KA 3W2DA 2KZRA 2QILA 5TR5A 4LK0M 2BYFA 2V4LA 1ET9A 1PGAA 5IOIA 5H8YE 4MJSA 2HD5B 1KLUD 1GAQB 3A4RA 2I2YA 1OTRB 5EDSA 5DPTA 2IBIB 2ZJDA 5HI1A 2M19A 2ON8A 2E3TA 2PMVA 2R2QA 3BIID 3PRZA 4WJNA 2LVOA 1XO3A 2AL3A 4L23A 1JWSD 2FCSA 3DHHC 3EFUA 1XF5L 3HRDD 4II2B 4W9FA 4YTMB 3AU5A 2ASQA 3Q3JA 3VTWA 1L0VB 2J0MA 5JXVA 1WX7A 1AWDA 5D2MB 4M00A 2MSED 2WXRA 4RF0A 2O2VA 4ZDVA 1WJUA 1MHXA 1PFDA 4P16A 3TL5A 1ET6A 1XLPA 2W3RA 5BYQA 3NS8A 4LCDE 2LVPA 4IKGA 4K7UA 4J3OD 1YJ1A 3S2AA 1EM7A 2MJDA 5JHAA 2L7RA 1AARA 1N63A 1IUEA 3ZTCA 3QK0A 1TZOA 3RPFC 1N62A 4CO7A 1TS3A 3KH0A 1E7PB 1FFUA 3A9KA 5LXHA 3P42A 4RH6A 5HHDG 1OEYA 2GB1A 1J7CA 2FUG1 1LFDA 5BYSA 3H8HA 1NDDA 2RPVA 2KMAA 4L1BA 4JGHB 1MI0A 4L2YA 3N9YC 3ZXVA 2KFJA 1FCLA 4NY0A 3W9CB 1WFYA 4C80A 3RULA 3WALA 3B08A 2QC8A 1SJED 1TS5A 1Y56A 2WXJA 1V1PA 5JZEB 2MQJA 2N9PC 5KHQA 2A4ZA 4HJKA 1XQQA 3CF6E 3WAPA 3ZKJC 2M0AA 2DHZA 1KM7A 4K1RB 5C1ZA 2N1VA 1WJ6A 1CMXB 2E6XA 2KYWA 3HIZA 1FNWA 2CU3A 4BKTA 1D3ZA 3N32A 2RD0A 5C2TB 2J4XA 4HWIB 1HQRD 2WX1A 2WXNA 2XEWA 1Q1OA 4ZYNA 3BYTB 3PREA 1WZ0A 3T9LA 1WR1A 4MDKE 2LJ5A 1STEA 4LNFA 4YXDB 2CHZA 3TCAA 3RYTA 4MGKE 1FD6A 2K8HA 3VHTC 1RM6C 1YJJA 2BPSA 1I42A 4URKA 3AXCA 5E6OA 4ZOHC 1E8XA 3ZNGC 3BK1A 3E56A 2K0PA 4MM3A 2OOBB 2N1WA 1LO5D 4BBNF 1L4ZB 2PIAA 1UZXB 1F2RC 2HTME 5AUIA 1TY2A 1L0XB 2KQSA 1XXGA 4LDTB 3AE4B 3VH3B 3DWMA 4DQOC 2D3BA 3AULA 3IXSA 2EKIA 2IJ0A 2JPHA 1WYGA 3RNCC 1V9JA 2DYMA 4W9JA 4HKZE 4XYCA 2FCMA 5IAAC 3UGBB 1OGWA 3ZLZA 1AYFA 4C7YA 4GDLA 2ZVNA 3MC9A 1GG3A 4HDOA 5CX3A 4TQ1A 3IBEA 3SR6A 3DHIC 1MJDA 3EHVA 1DOXA 3QA8A 2PE9A 4BKGA 1L7YA 1ZP0B 3EFCA 1PQSA 1KFYB 1VLBA 2REXA 1WGHA 1QT9A 2BBCA 2KTRB 1JWMD 1KF6B 4P6VF 4IM3A 3OJ4B 2HJ8A 2LFIA 3RZFA 2SAKA 4LNOA 1J19A 2KVZA 3N3KB 4M0WA 3VH4B 2OJRA 3NHEB 4GN1A 1E8YA 3AE7B 2MJEA 3ZJTA 4MACA 4FJYA 4WURA 4DHJD 1TTNA 3R66C 3N30A 1VZ7A 4TSSA 2CHXA 1EU3A 1H8CA 1WXAA 5IP4D 3V6EB 4BKSA 2WNMA 1Z2MA 4S17A 3IAS1 3U8ZA 1XLOA 5AEKB 1OEYJ 4LLGM 4BVUC 1WE6A 1TGZB 3ZQ4A 3OG5A 1WMHB 1E8ZA 4LNNA 2UU7A 5EE0A 1XT9B 3QC8B 3C19A 1K52A 5DPSA 2YEPF 4E74A 2KDEB 2JT4B 4QAYA 5JHBA 1WGRA 3OLMD 2W55A 4LJPB 3B0AA 4OVUA 1R4NB 4TKNA 2BGFA 1YOVB 4DXGA 3JVZX 1WX8A 1SF0A 2GBJA 2Y5PA 4IWPA 1S1QB 1WGDA 3BINA 1MFWA 1T0YA 2BB5A 4LTUA 3IG3A 4G50A 4W9KA 3AN1A 3N1YC 5LLIA 1WI0A 4GDKA 1V2YA 3ZXRA 1FRRA 1RFAA 2O2VB 2IY1B 3H7PA 4E71A 1ZDVA 4YTPB 3URYA 3GS2A 4DK5A 3VDZA 1IGDA 2DENB 1WXSA 1C79A 4RGMA 3NOBA 2N4FA 3FILB 3KLSX 2XBBC 1HA5A 1R4MI 3DBSA 1ACCA 2DAJA 2Q5WD 2MBEA 2BW2A 1I4HA 3GE3C 3U30A 3WAMA 2KDIA 1UWMA 1FEHA 2G9HD 2LUEA 2K8CA 3JYUA 4GSWA 1D4BA 4B95A 4KVGB 2KJRA 3VFKA 4DDID 4MSMB 1OQQA 2AEHA 3DDCB 3K9OB 3QWZB 4JPSA 4HPPA 3Q8CA 4HPMB 3IFWB 3HK0A 4K3BA 1F0ZA 1IBXA 2KWVB 1IP9A 4M02A 1XD3B 3L4PA 2L83A 2G4DB 4P1CC 3QARA 1FNUA 2VH2A 1SGHA 1V8CA 1MPEA 5FR3A 2KTFA 5G5HA 2D3CA 3QIJA 4BZAA 3SHQA 3Q8AA 4RM8A 2DZMA 2JVCA 4P7IA 1FNVA 3AE8B 5E6NA 2RDHA 3AEGB 1F1HA 2WXQA 2QJLA 4KIKB 3SD5A 2ZPNA 1PGXA 3NZUA 1TBEA 3QCAA 3FAHA 3PRMB 1C76A 1FM0D 3LB8C 5IKCM 2M17A 1ZUD2 3KYCD 3N1XC 4N58A 2BYEA 4NPNA 2FUHB 4ASWC 3ZJUA 4BKSD 1NI3A 2C60A 3C8YA 2MWSB 4ICVA 3SU8X 1WY8A 4B0EA 3ZO5B 1TKGA 2GBMA 2KN5A 1DYQA 4ANWA 2N0SB 1GB4A 4YL8A 3H7SA 2K39A 4W9EA 3VTVA 4WJPA 4C4VA 1V5TA 2K1FA 4M8NA 5J18A 4W9GA 3N1ZC 4TMAB 2CHWA 2B3AA 2BS2B 1XCQL 2QEJC 3IHPC 1WR6E 2VH1A 1YQ4B 2LXAA 2RMMA 3Q8EA 3L10B 4Q2JA 3UF8A 3T8MA 3UIOB 2QMTA 2DAFA 2V0GA 1MG4A 2WXMA 3ZRCA 2PKOA 3R3MA 3TBLD 4OHJA 3W1SA 3ZTDA 1XEEA 4B9KA 4IG7B 1SE9A 2LHDA 4MH8A 1WGKA 4I6LB 4WWMA 1UH6A 3Q8FA 3PLUA 2J0KA 1H4RA 4HK2A 1LXDA 2N7EA 4DHZB 1B1ZA 1IYFA 1J7AA 4GOCA 4GDLB 2WDVB 3MJWA 1SEBD 1ZPSA 2AQ2B 1N5XA 3H9DA 3AECB 3P4SB 3RNAC 3N20C 3PS6A 5LXIB 3A9KB 1K8RB 2KC1A 3TMPB 2MBHA 1DGJA 2LWPA 3AEFB 2CJOA 3KUZA 2KOXA 2XK5A 3EUB2 2C7MB 2IGGA 2WDQB 2AQ1B 2AL6A 4WJOA 2FNJB 4XE0A 1TS2A 3ZVVA 3U52E 2INPE 2EMSA 1QKZA 4G3XB 4OZBA 4ANXA 2J7QB 3AB5A 2L32A 1JWBD 1V1PB 1QF6A 2WQYB 3LXFA 2QIEB 4HJGE 5DPWA 1Q5WB 4XDDA 3H1UA 2ZPYA 1UGMA 2W54A 3TEZA 2K3UA 3AMZA 2NR2A 1YQ3B 1WYWB 2NTSA 2M8SA 2M56B 3AEDB 2BWFA 4BFRA 2JQRB 4DXFA 4PK1A 4N6EB 1Y8RC 4W9IA 3A1QB 1D5XC 4B0MA 3Q2AC 2G1EA 2BYVE 3DVNU 3CSFA 3WIMA 1P7EA 3I3TB 3AE2B 4GGQA 2KANA 2AQ3B 1EU4A 4K81A 4HCPB 3DVNV 1QLBB 2EELA 1YMHE 4NAWB 1SJHD 2DYOA 1UBIA 2CKHB 2LMCA 1PDXA 2J53A 4WAAA 3PVLA 2KKCA 1J7BA 2B76B 5HG2A 3H7PB 4YSXB 3SFDB 2ZEQA 1V1OA 2LASA 3APCA 1KJTA 3JSVA 4KZ0A 2K22A 4IC7B 4JX1C 4TV3A 2WP9B 1L6UA 2NTTA 3I9V1 3NJTA 3PT2B 3E9SA 2KVRA 1JWAD 1P1AA 1GOZA 4LDTD 3TEWA 1QQRA 1EWCA 3B9JA 2M0XA 3IT6B 4A20A 2H88B 2ZNVC 3NS1A 4XZ4A 1F2RI 3PHXB 2IGHA 3TUOA 2O6VA 3ZRFA 2FCNA 4REZA 1L6VA 4HKQA 2CR5A 2NPTB 1BUIC 2FBWB 3A4SC 1WM3A 3WANA 3PGEA 2K25A 3FC4A 4BOZB 4BBNC 4EE2A 1BT0A 3Q69A 1FXTB 3EA6A 2KN4A 1GC7A 3P2BA 4KZCA 3X0WA 2Z59B 4R3DA 2PW9A 2KHWB 4HRSA 1S3SG 3TSSA 1HEZE 4MGZE 4M01A 4WAFA 4NNJB 3V6CB 4WIPA 2L76A 1JROA 4JL9A 1JWUD 4ACFA 4HVBA 2KWUB 3WAOA 2IO3B 3BYYB 3L08A 3Q3OC 4HPLB 3ONSA 4GMVA 3NUHB 2MBBB 3P4PB 4K3CA 1TY0A 3PV1A 1LM8B 4A3OA 1EF5A 2MH7A 1J8CA 3AE5B 2LJIA 1B9RA 2NBUA 3BK2A 3UQBA 4N59A 1SXTA 4AJWA 1WZ3A 3W5UB 1WMHA 2D2QA 1FMAD 2KJHB 3DOWA 1E9MA 4HCNB 3PRPB 4US8A 2LGXA 1P98A 1FIQA 3VRBB 1MG8A 1I7HA 4C00A 3ZDTA 5G2NA 1UWXA 3P1MA 3MHSD 1VD2A 4XDCA 5AUKA 1N6ZA 4AS1A 4KDIC 1KOTA 2NBVB 4W9DA 1OQRA 4PYUA 4A9AA 1TKEA 1R7SA 4M8MA 1TJEA 3DBLI 2ZZPB 2M4NA 3P63A 1WRDB 2R2OA 2DBYA 1MHHE 1ZOYB 1Q10A 3DCGA 2DNFA 3NRZA 4KKIA 2C7NB 1QOGA 1V97A 3ZNID 3QQ8B 3AU4A 1I35A 4WH4A 2NBWB 3RZWC 4IW0A 3M3JA 4BOSC 4ARIA 4PS3A 2CU1A 4RFBA 3U2SC 2WU2B 2WXHA 4WJQA 2WLBA 5T8IA 2KK8A 2DZJA 1ZW7A 2J42A 3ML9A 1V6EA 3RNFC 4LJOB 2RDBC 3AEEB 3RUIB 2BF8B 2L1AA 1IGCA 1ZXIA 3V05A 4IOIE 3ZW3A 3VVWB 1YX6B 5FR6A 1UELA 5C3JB 4W9CA 1SBBB 4MGIE 2KX3A 3HHMA 3VUXA 1NEKB 2HJ1A 4PS7A 2J0JA 2ICIA 3PZ8A 4N9F4 3HVDA 1FCCC 4GXBA 2BT6A 2I1KA 4IM2A 4EZLA 2Y3AA 2HTHA 4YSZB 2AYOB 3APFA 3GE8C 1KTKA 2KFKA 3A9JB 4KKJA 4US9A 2N9KA 3SDLC 3GZNB 3VAWA 3RI7C 3EECA 5FKAC 1P7FA 1QOBA 5BYRA 5J17A 2WXOA 3DVGX 2WXFA 2OJWA 3ABVB 1AW7A 2MP2A 2FIFA 4DXAB 4RCOA 1TZ1A 2KD0A 1E7UA 4I6PA 2ZCCA 1T0RC 4NAMA 3GOEA 1C3TA 2LD9A 4S0RA 3RFZB 3O13A 4MM3B 1ZDXA 2BS4B 3V60A 4AOFA 1FO4A 2NS5A 3BWUD 4MGYE 4AWJA 1BXTA 2KACA 2G45B 2KMCA 4AJYB 2LGSA 4ZRJA 1Z5SB 3VUWA 4XWTA 1R4MB 2N9EB 1KLVA 3R7RA 3H6NA 2L0TA 3L13A 3GZNI 1V86A 2N7DA 2NCNA 5EE1A 4NJ7A 1LQBA 3IAM1 2RR9A 2QHOA 2WYQA 1IPGA 1RRBA 3L0WB 2JXXA 1SE3A 3ZGZA 1T0SC 1VZ6A 3C0RB 3AM9A 4WWNA 3BVGA 4JIOU 3PPAA 1DOYA 2KDMA 1UBQA 2IZVB 3AE3B 1FXAA 2N9XA 3KUDB 2C7HA 2KTRA 1WIAA 3ZJVA 4PT5A 1M4VA 1NI2A 3Q3MC 4MEMA 1T6BX 3GB1A 2WGSA 1FFVA 1V80A 4M0WB 3MHZA 2KJ6A 5EE3A 2KWDA 4DWFA 5BMGA 1C4AA 3V62A 1SIFA 2WXLA 1M94A 1BMLC 3ZDMC 5GMVA 2LRWA 3RNEC 3M95A 2JYEA 2PPHA 1V49A 2JX5A 2MRPA 3HUIA 4IWOA 1OQYA 4GB9A 4ICUA 4ITKA 4NQKE 4EUTA 3Q3FA 5CHFA 4EEWA 2KDFB 4HEA1 1WXVA 4AP4C 4EFOA 1ROEA 4IWQA 4J6IA 2XNAC 3U7ZA 1L5PA 3BZDB 1NENB 5EE9A 1JRUA 2C5LC 3AV8A 2V3NA 3FKYA 3JW0X 1F77A 2JZPA 1YQBA 1VDVA 2UWQA 3AE1B 1I4PA 4FXCA 1TKYA 1YN3A 1C77A 2BVCA 4HROA 2DWQA 2KWCA 3DWGC 2RSUA 1WRIA 1P9DU 4KGSA 1WXQA 4ZRKA 2DZIA 4JWUC 4O1NA 4FLHA 1GNUA 1UUPA 2GBRA 1JRPA 2IY0B 4A8XC 4KGRA 4USAA 1WGYA 3RNGC 3RMKC 2EKEC 4KV2A 1KH0A 4RGTA 1CK1A 4A55A 5IN7A 3OAWA 1QOAA 4PS8A 1HXYD 2D11A 2DZKA 4GU2A 1JMLA 4FADA 4F8CB 2CJNA 4RM9A 1P0RA 2WS3B 3V3XA 2IPKD 2JRHA 2FCQA 1SE2A 3KWLA 1NYQA 2QCZA 4YT0B 1YNTE 2RDGA 1A5RA 2EMTA 3GP7A 2IYDB 5L83A 3JSVB 2WXIA 4A3PA 1PGBA 1GC6A 5IA7A 2Y5CA 3MC8A 2JRIB 4CQNA 4ANVA 2MLBA 5GXGB 3RN9C 3TJPA 3KW5B 3R7QA 2BQQA 4FJVB 4FN2A 4FA6A 3MTNB 2ZW0A 3PTFC 1MVKA 1HTQA 2DLBA 1TS4A 1YIWA 2K5PA 3WA0A 4MELA 4YTNB 1GJZA 2GOWA 3ZUNA 2GBKA 3U7DA 1GB1A 1WF9A 2MBOA 1A70A 4FJZA 1P3QU 5J2RA 4HLEA 2L0FA 1JCKB 1WE7A 2M1MA 4PYZA 1FRDA 4I6NB 2HE7A 4EZJA 3QJZA 1SE4A 2AX5A 4W9HA 3LYYA 1ISNA 4TQ0A 5DCNA 4ARCA 1UNSA 1ZKHA 2IGDA 3Q3NC 5BMHA 1E8WA 1E0ZA 3NVYA 3KQ4A 5FK9C 4XWWA 3R2IA 5I4DA 5D7GA 4CYEA 1VCBA 1WSPA 2MEKA 1LGRA 2V3PA 1I4GA 1YN5A 2WHIA 1C4PA 3PHWB 3UQAA 3MFGA 3I63C 1IBXB 3DHGC 1CQVA 2SEBD 2Z0DB 2W3SA 3TEXA 2DX5B 4HDQA 4EZKA 1WJ4A 4ZHOA 4GDKB 2ONQA 3PSEB 2WXGA 3NVVA 1D5MC 1WGGA 2LVQA 2IO1B 2GMIC 2JWUA 2G4SA 1GPXA 2JZZA 1YN4A 2IO2B 2KC2A 5AZFA 2LZ6A 1HZ6A 3FILA 1N60A 5L95C 3IVFA 2CS4A 4OZAA 3AI5A 5H92C 1CJEA 4OVVA 5E6JA 4GIVA 2PVOD 4NJCA 4OW0A 1NVID 2MCNB 2L3ZA 4EKUA 2D3GA 4ANUA 2W9NA 1U4AA 2KQ7A
chains in the Genus database with same CATH topology
3MC8A 3OG5A 2VH1A 3EFCA 2VH2A 3Q6BA 2QDFA 2MHJA 4XGAB 2V9HA 2QCZA 2X8XX 4C4VB 4BZAA 4QAYA 3MC9A 4K3CA 3NJTA 4PK1A 4C4VA 4C00A 4K3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MC8 A;  3OG5 A;  2VH1 A;  3EFC A;  2VH2 A;  3Q6B A;  2QDF A;  2MHJ A;  4XGA B;  2V9H A;  2QCZ A;  2X8X X;  4C4V B;  4BZA A;  4QAY A;  3MC9 A;  4K3C A;  3NJT A;  4PK1 A;  4C4V A;  4C00 A;  4K3B A; 
#chains in the Genus database with same CATH topology
 4W9L A;  2G3Q B;  1ENF A;  3BVM A;  2C9W B;  3K9P B;  3VR8 B;  4MSQ B;  5BO4 B;  1QIL A;  2BS3 B;  2LGD A;  5G55 A;  1EO6 A;  2RPQ A;  4RNA A;  1VR9 A;  5TSS A;  3NY5 A;  4HXD A;  4C4V B;  3TEY A;  2VRR B;  1E90 A;  4DBG A;  2JYT A;  3DVG Y;  2V4I B;  4AQ7 A;  2INN E;  3B2F A;  1V5O A;  4RGN A;  4WWP A;  2QDF A;  3ENE A;  3KVF B;  3TIX A;  2K9X A;  4IUM B;  4P1B C;  1UD7 A;  4YWG G;  1N5W A;  3UIN B;  3DQV A;  1C1Y B;  1WJN A;  2KFK B;  3A9J A;  4H2A A;  4NQL B;  2ZNV B;  4UDU C;  3CMM B;  1I4Q A;  2LRU A;  2KQ4 X;  1JQ4 A;  3M62 B;  1YJI A;  1FXI A;  2KXJ A;  3AH7 A;  1T3Q A;  3QHT A;  2NMQ A;  1RLF A;  2MP2 B;  1KLG D;  2LHE A;  4KSK C;  4RGO S;  3DBR I;  5MPO A;  4DHJ B;  3O65 B;  2GI9 A;  3UIP B;  1HZ5 A;  5JH5 C;  3B2G A;  3I5J C;  1VZ8 A;  4NAW A;  2L8J A;  2N7J A;  1TIF A;  1RYJ A;  2V1Y A;  2LGI A;  1DOI A;  2QSD A;  4B6W A;  1E5W A;  2PE6 B;  5D3D A;  1L2N A;  5E6P A;  2X38 A;  1NYR A;  3M63 B;  1K53 A;  2N9L A;  3A33 B;  4A6Q A;  4NJ6 A;  4K7S A;  4AUQ C;  4KDL B;  3R8B A;  2LUM A;  1JW9 D;  3LJ3 A;  2ACZ B;  1N61 A;  1YX5 B;  2WXK A;  5BMI A;  5LNK 1;  2D10 A;  4KX6 B;  3W5V B;  2O6V B;  2VZK B;  2H89 B;  3RD2 A;  1ZE3 D;  4LNI A;  3HVZ A;  3RT3 B;  1D6E C;  4YSY B;  2JSV X;  2WWZ A;  1J0G A;  3VXW A;  5G5G A;  3NZS A;  4MJS B;  2JU6 X;  4DDG D;  3QAQ A;  3NZ3 A;  5DPR A;  1CZP A;  4RF1 A;  2MBQ A;  3MC0 B;  2MA9 B;  4WQO B;  3CST A;  2I38 A;  2D3A A;  2L05 A;  3ALB A;  3ML8 A;  2XK5 B;  2O6V D;  2KNB A;  2HDE A;  4OZC A;  4ZRQ A;  3DPD A;  1PUT A;  1ZXH A;  5D6J B;  1ESF A;  1F9J A;  1E10 A;  4JWS C;  2PVG C;  3RNB C;  2LGY A;  3HM6 X;  1SSN A;  4ZRI A;  2K8B A;  3PO0 A;  3T3N A;  3Q14 C;  4XC2 A;  3W1S C;  3NG0 A;  3I57 A;  2Z0E B;  2BTE A;  1WM2 A;  2D07 B;  1EWY C;  1L0Y B;  1WH3 A;  3L16 A;  4KSL C;  2X8X X;  4C7Z A;  1L4D B;  5CHW A;  5AZH A;  5CTR C;  2UYZ B;  2JXT A;  3U4E G;  3VRA B;  2LI5 A;  5KHO A;  3P4R B;  2FE8 A;  3T3O A;  4JE3 B;  3NVZ A;  5D3I B;  1G6J A;  4OVZ A;  3SEB A;  2J52 A;  4MT5 A;  4XX5 A;  1C4C A;  1F52 A;  3A1Q A;  3AEA B;  1E7V A;  2OHF A;  1R4N I;  1D5Z C;  2A5U A;  2WXP A;  2WDR B;  3EGR A;  2BKR B;  2Y5B B;  3X23 A;  2KT7 A;  2NPT A;  3CWI A;  3P4Q B;  1ZGU B;  3PZD A;  3VQI A;  2TSS A;  4C56 C;  1C9F A;  1K51 A;  1HTO A;  4A90 A;  1SIJ A;  1XLN A;  1WXM A;  2KMM A;  4FHK A;  4JLC A;  1WX9 A;  1SB3 C;  3AEB B;  3DBR B;  2KX0 A;  1K50 A;  1Q0W B;  2Z8L A;  3BY4 B;  2JF5 A;  2KAJ A;  2JWZ A;  1OFF A;  3ZNH B;  3AE6 B;  3LDZ E;  1E6E B;  2YEP B;  3KWV A;  2OED A;  2BB6 A;  2XN9 C;  4ZHP A;  1WWT A;  3D32 A;  5D94 A;  2K6Q A;  3SFE B;  4MH0 E;  4KGT A;  2FAZ A;  2KDB A;  2GBN A;  2LEK A;  4XGA B;  3KYD D;  3B1L X;  1I4R A;  5C23 A;  2JY6 A;  1XCT L;  5HFY A;  4X57 B;  3V61 A;  3J9C A;  4IM0 A;  1FPY A;  4G0N B;  2MW5 A;  3MP9 A;  2FID A;  1T5X D;  4K7W A;  5CHV C;  1VRA B;  2KLC A;  2IO0 B;  3AE9 B;  4E3C A;  2W82 A;  1I4X A;  2MX2 A;  3PLV A;  3DBH I;  2JZ3 B;  4GLS C;  2K6D B;  3PZ7 A;  3L54 A;  2INC C;  2LXC A;  2MJ3 A;  1C78 A;  5AZG A;  1PYW D;  3MJ5 A;  1V81 A;  3ZNZ B;  1GUA B;  1RAX A;  2V3S A;  3ETR A;  1VJK A;  2WDT B;  1YD8 U;  3ZYY X;  1UGJ A;  1X1M A;  2BKF A;  4EOY A;  3EC8 A;  2V9H A;  3RCZ A;  2BYT A;  2L00 B;  3VR9 B;  2BWE S;  1HE8 A;  1UF0 A;  2L52 A;  3IT4 B;  2PTL A;  2VZK D;  3BVZ A;  5IO9 A;  3OJ3 A;  3Q8B A;  4FHJ A;  4DHZ E;  3APD A;  3L17 A;  3CIR B;  2MHJ A;  2PJH A;  3VUY A;  1RFK A;  2D5G A;  3DBL B;  4ZYS A;  4WWO A;  4LNK A;  2YLM A;  1QOF A;  4II3 B;  1T0Q C;  4CHK A;  2ZCB A;  4JQW C;  1EUV B;  2JUO A;  2DYB A;  3QX1 A;  2KO3 A;  4FBJ B;  5HKH A;  3UI3 A;  3NVW A;  2YVC A;  4G11 A;  2PLP A;  3Q6B A;  2WX0 A;  3KUC B;  1JAL A;  2R61 A;  4F7Z A;  2WU5 B;  3HM3 A;  3W1Y A;  1TT5 B;  2PEA A;  1TYG B;  4RMA A;  2NVU I;  2RGF A;  4FUL A;  3ZIM A;  1EF1 A;  3DBH B;  2GRI A;  2IND C;  3OWE B;  4KIK A;  1NBF C;  1QZE A;  3R2T A;  3WCQ A;  2GLS A;  4NZL B;  2IDY A;  3ECI A;  1AN8 A;  4ZRP A;  4IDI A;  1XLQ A;  4BAX A;  3VTU A;  2I1J A;  4WQM A;  1RWS A;  1KRH A;  2ZW1 A;  2AWT A;  4F1S A;  4TUU A;  2ZVO A;  2KLG A;  4D2K A;  3W2D A;  2KZR A;  2QIL A;  5TR5 A;  4LK0 M;  2BYF A;  2V4L A;  1ET9 A;  1PGA A;  5IOI A;  5H8Y E;  4MJS A;  2HD5 B;  1KLU D;  1GAQ B;  3A4R A;  2I2Y A;  1OTR B;  5EDS A;  5DPT A;  2IBI B;  2ZJD A;  5HI1 A;  2M19 A;  2ON8 A;  2E3T A;  2PMV A;  2R2Q A;  3BII D;  3PRZ A;  4WJN A;  2LVO A;  1XO3 A;  2AL3 A;  4L23 A;  1JWS D;  2FCS A;  3DHH C;  3EFU A;  1XF5 L;  3HRD D;  4II2 B;  4W9F A;  4YTM B;  3AU5 A;  2ASQ A;  3Q3J A;  3VTW A;  1L0V B;  2J0M A;  5JXV A;  1WX7 A;  1AWD A;  5D2M B;  4M00 A;  2MSE D;  2WXR A;  4RF0 A;  2O2V A;  4ZDV A;  1WJU A;  1MHX A;  1PFD A;  4P16 A;  3TL5 A;  1ET6 A;  1XLP A;  2W3R A;  5BYQ A;  3NS8 A;  4LCD E;  2LVP A;  4IKG A;  4K7U A;  4J3O D;  1YJ1 A;  3S2A A;  1EM7 A;  2MJD A;  5JHA A;  2L7R A;  1AAR A;  1N63 A;  1IUE A;  3ZTC A;  3QK0 A;  1TZO A;  3RPF C;  1N62 A;  4CO7 A;  1TS3 A;  3KH0 A;  1E7P B;  1FFU A;  3A9K A;  5LXH A;  3P42 A;  4RH6 A;  5HHD G;  1OEY A;  2GB1 A;  1J7C A;  2FUG 1;  1LFD A;  5BYS A;  3H8H A;  1NDD A;  2RPV A;  2KMA A;  4L1B A;  4JGH B;  1MI0 A;  4L2Y A;  3N9Y C;  3ZXV A;  2KFJ A;  1FCL A;  4NY0 A;  3W9C B;  1WFY A;  4C80 A;  3RUL A;  3WAL A;  3B08 A;  2QC8 A;  1SJE D;  1TS5 A;  1Y56 A;  2WXJ A;  1V1P A;  5JZE B;  2MQJ A;  2N9P C;  5KHQ A;  2A4Z A;  4HJK A;  1XQQ A;  3CF6 E;  3WAP A;  3ZKJ C;  2M0A A;  2DHZ A;  1KM7 A;  4K1R B;  5C1Z A;  2N1V A;  1WJ6 A;  1CMX B;  2E6X A;  2KYW A;  3HIZ A;  1FNW A;  2CU3 A;  4BKT A;  1D3Z A;  3N32 A;  2RD0 A;  5C2T B;  2J4X A;  4HWI B;  1HQR D;  2WX1 A;  2WXN A;  2XEW A;  1Q1O A;  4ZYN A;  3BYT B;  3PRE A;  1WZ0 A;  3T9L A;  1WR1 A;  4MDK E;  2LJ5 A;  1STE A;  4LNF A;  4YXD B;  2CHZ A;  3TCA A;  3RYT A;  4MGK E;  1FD6 A;  2K8H A;  3VHT C;  1RM6 C;  1YJJ A;  2BPS A;  1I42 A;  4URK A;  3AXC A;  5E6O A;  4ZOH C;  1E8X A;  3ZNG C;  3BK1 A;  3E56 A;  2K0P A;  4MM3 A;  2OOB B;  2N1W A;  1LO5 D;  4BBN F;  1L4Z B;  2PIA A;  1UZX B;  1F2R C;  2HTM E;  5AUI A;  1TY2 A;  1L0X B;  2KQS A;  1XXG A;  4LDT B;  3AE4 B;  3VH3 B;  3DWM A;  4DQO C;  2D3B A;  3AUL A;  3IXS A;  2EKI A;  2IJ0 A;  2JPH A;  1WYG A;  3RNC C;  1V9J A;  2DYM A;  4W9J A;  4HKZ E;  4XYC A;  2FCM A;  5IAA C;  3UGB B;  1OGW A;  3ZLZ A;  1AYF A;  4C7Y A;  4GDL A;  2ZVN A;  3MC9 A;  1GG3 A;  4HDO A;  5CX3 A;  4TQ1 A;  3IBE A;  3SR6 A;  3DHI C;  1MJD A;  3EHV A;  1DOX A;  3QA8 A;  2PE9 A;  4BKG A;  1L7Y A;  1ZP0 B;  3EFC A;  1PQS A;  1KFY B;  1VLB A;  2REX A;  1WGH A;  1QT9 A;  2BBC A;  2KTR B;  1JWM D;  1KF6 B;  4P6V F;  4IM3 A;  3OJ4 B;  2HJ8 A;  2LFI A;  3RZF A;  2SAK A;  4LNO A;  1J19 A;  2KVZ A;  3N3K B;  4M0W A;  3VH4 B;  2OJR A;  3NHE B;  4GN1 A;  1E8Y A;  3AE7 B;  2MJE A;  3ZJT A;  4MAC A;  4FJY A;  4WUR A;  4DHJ D;  1TTN A;  3R66 C;  3N30 A;  1VZ7 A;  4TSS A;  2CHX A;  1EU3 A;  1H8C A;  1WXA A;  5IP4 D;  3V6E B;  4BKS A;  2WNM A;  1Z2M A;  4S17 A;  3IAS 1;  3U8Z A;  1XLO A;  5AEK B;  1OEY J;  4LLG M;  4BVU C;  1WE6 A;  1TGZ B;  3ZQ4 A;  3OG5 A;  1WMH B;  1E8Z A;  4LNN A;  2UU7 A;  5EE0 A;  1XT9 B;  3QC8 B;  3C19 A;  1K52 A;  5DPS A;  2YEP F;  4E74 A;  2KDE B;  2JT4 B;  4QAY A;  5JHB A;  1WGR A;  3OLM D;  2W55 A;  4LJP B;  3B0A A;  4OVU A;  1R4N B;  4TKN A;  2BGF A;  1YOV B;  4DXG A;  3JVZ X;  1WX8 A;  1SF0 A;  2GBJ A;  2Y5P A;  4IWP A;  1S1Q B;  1WGD A;  3BIN A;  1MFW A;  1T0Y A;  2BB5 A;  4LTU A;  3IG3 A;  4G50 A;  4W9K A;  3AN1 A;  3N1Y C;  5LLI A;  1WI0 A;  4GDK A;  1V2Y A;  3ZXR A;  1FRR A;  1RFA A;  2O2V B;  2IY1 B;  3H7P A;  4E71 A;  1ZDV A;  4YTP B;  3URY A;  3GS2 A;  4DK5 A;  3VDZ A;  1IGD A;  2DEN B;  1WXS A;  1C79 A;  4RGM A;  3NOB A;  2N4F A;  3FIL B;  3KLS X;  2XBB C;  1HA5 A;  1R4M I;  3DBS A;  1ACC A;  2DAJ A;  2Q5W D;  2MBE A;  2BW2 A;  1I4H A;  3GE3 C;  3U30 A;  3WAM A;  2KDI A;  1UWM A;  1FEH A;  2G9H D;  2LUE A;  2K8C A;  3JYU A;  4GSW A;  1D4B A;  4B95 A;  4KVG B;  2KJR A;  3VFK A;  4DDI D;  4MSM B;  1OQQ A;  2AEH A;  3DDC B;  3K9O B;  3QWZ B;  4JPS A;  4HPP A;  3Q8C A;  4HPM B;  3IFW B;  3HK0 A;  4K3B A;  1F0Z A;  1IBX A;  2KWV B;  1IP9 A;  4M02 A;  1XD3 B;  3L4P A;  2L83 A;  2G4D B;  4P1C C;  3QAR A;  1FNU A;  2VH2 A;  1SGH A;  1V8C A;  1MPE A;  5FR3 A;  2KTF A;  5G5H A;  2D3C A;  3QIJ A;  4BZA A;  3SHQ A;  3Q8A A;  4RM8 A;  2DZM A;  2JVC A;  4P7I A;  1FNV A;  3AE8 B;  5E6N A;  2RDH A;  3AEG B;  1F1H A;  2WXQ A;  2QJL A;  4KIK B;  3SD5 A;  2ZPN A;  1PGX A;  3NZU A;  1TBE A;  3QCA A;  3FAH A;  3PRM B;  1C76 A;  1FM0 D;  3LB8 C;  5IKC M;  2M17 A;  1ZUD 2;  3KYC D;  3N1X C;  4N58 A;  2BYE A;  4NPN A;  2FUH B;  4ASW C;  3ZJU A;  4BKS D;  1NI3 A;  2C60 A;  3C8Y A;  2MWS B;  4ICV A;  3SU8 X;  1WY8 A;  4B0E A;  3ZO5 B;  1TKG A;  2GBM A;  2KN5 A;  1DYQ A;  4ANW A;  2N0S B;  1GB4 A;  4YL8 A;  3H7S A;  2K39 A;  4W9E A;  3VTV A;  4WJP A;  4C4V A;  1V5T A;  2K1F A;  4M8N A;  5J18 A;  4W9G A;  3N1Z C;  4TMA B;  2CHW A;  2B3A A;  2BS2 B;  1XCQ L;  2QEJ C;  3IHP C;  1WR6 E;  2VH1 A;  1YQ4 B;  2LXA A;  2RMM A;  3Q8E A;  3L10 B;  4Q2J A;  3UF8 A;  3T8M A;  3UIO B;  2QMT A;  2DAF A;  2V0G A;  1MG4 A;  2WXM A;  3ZRC A;  2PKO A;  3R3M A;  3TBL D;  4OHJ A;  3W1S A;  3ZTD A;  1XEE A;  4B9K A;  4IG7 B;  1SE9 A;  2LHD A;  4MH8 A;  1WGK A;  4I6L B;  4WWM A;  1UH6 A;  3Q8F A;  3PLU A;  2J0K A;  1H4R A;  4HK2 A;  1LXD A;  2N7E A;  4DHZ B;  1B1Z A;  1IYF A;  1J7A A;  4GOC A;  4GDL B;  2WDV B;  3MJW A;  1SEB D;  1ZPS A;  2AQ2 B;  1N5X A;  3H9D A;  3AEC B;  3P4S B;  3RNA C;  3N20 C;  3PS6 A;  5LXI B;  3A9K B;  1K8R B;  2KC1 A;  3TMP B;  2MBH A;  1DGJ A;  2LWP A;  3AEF B;  2CJO A;  3KUZ A;  2KOX A;  2XK5 A;  3EUB 2;  2C7M B;  2IGG A;  2WDQ B;  2AQ1 B;  2AL6 A;  4WJO A;  2FNJ B;  4XE0 A;  1TS2 A;  3ZVV A;  3U52 E;  2INP E;  2EMS A;  1QKZ A;  4G3X B;  4OZB A;  4ANX A;  2J7Q B;  3AB5 A;  2L32 A;  1JWB D;  1V1P B;  1QF6 A;  2WQY B;  3LXF A;  2QIE B;  4HJG E;  5DPW A;  1Q5W B;  4XDD A;  3H1U A;  2ZPY A;  1UGM A;  2W54 A;  3TEZ A;  2K3U A;  3AMZ A;  2NR2 A;  1YQ3 B;  1WYW B;  2NTS A;  2M8S A;  2M56 B;  3AED B;  2BWF A;  4BFR A;  2JQR B;  4DXF A;  4PK1 A;  4N6E B;  1Y8R C;  4W9I A;  3A1Q B;  1D5X C;  4B0M A;  3Q2A C;  2G1E A;  2BYV E;  3DVN U;  3CSF A;  3WIM A;  1P7E A;  3I3T B;  3AE2 B;  4GGQ A;  2KAN A;  2AQ3 B;  1EU4 A;  4K81 A;  4HCP B;  3DVN V;  1QLB B;  2EEL A;  1YMH E;  4NAW B;  1SJH D;  2DYO A;  1UBI A;  2CKH B;  2LMC A;  1PDX A;  2J53 A;  4WAA A;  3PVL A;  2KKC A;  1J7B A;  2B76 B;  5HG2 A;  3H7P B;  4YSX B;  3SFD B;  2ZEQ A;  1V1O A;  2LAS A;  3APC A;  1KJT A;  3JSV A;  4KZ0 A;  2K22 A;  4IC7 B;  4JX1 C;  4TV3 A;  2WP9 B;  1L6U A;  2NTT A;  3I9V 1;  3NJT A;  3PT2 B;  3E9S A;  2KVR A;  1JWA D;  1P1A A;  1GOZ A;  4LDT D;  3TEW A;  1QQR A;  1EWC A;  3B9J A;  2M0X A;  3IT6 B;  4A20 A;  2H88 B;  2ZNV C;  3NS1 A;  4XZ4 A;  1F2R I;  3PHX B;  2IGH A;  3TUO A;  2O6V A;  3ZRF A;  2FCN A;  4REZ A;  1L6V A;  4HKQ A;  2CR5 A;  2NPT B;  1BUI C;  2FBW B;  3A4S C;  1WM3 A;  3WAN A;  3PGE A;  2K25 A;  3FC4 A;  4BOZ B;  4BBN C;  4EE2 A;  1BT0 A;  3Q69 A;  1FXT B;  3EA6 A;  2KN4 A;  1GC7 A;  3P2B A;  4KZC A;  3X0W A;  2Z59 B;  4R3D A;  2PW9 A;  2KHW B;  4HRS A;  1S3S G;  3TSS A;  1HEZ E;  4MGZ E;  4M01 A;  4WAF A;  4NNJ B;  3V6C B;  4WIP A;  2L76 A;  1JRO A;  4JL9 A;  1JWU D;  4ACF A;  4HVB A;  2KWU B;  3WAO A;  2IO3 B;  3BYY B;  3L08 A;  3Q3O C;  4HPL B;  3ONS A;  4GMV A;  3NUH B;  2MBB B;  3P4P B;  4K3C A;  1TY0 A;  3PV1 A;  1LM8 B;  4A3O A;  1EF5 A;  2MH7 A;  1J8C A;  3AE5 B;  2LJI A;  1B9R A;  2NBU A;  3BK2 A;  3UQB A;  4N59 A;  1SXT A;  4AJW A;  1WZ3 A;  3W5U B;  1WMH A;  2D2Q A;  1FMA D;  2KJH B;  3DOW A;  1E9M A;  4HCN B;  3PRP B;  4US8 A;  2LGX A;  1P98 A;  1FIQ A;  3VRB B;  1MG8 A;  1I7H A;  4C00 A;  3ZDT A;  5G2N A;  1UWX A;  3P1M A;  3MHS D;  1VD2 A;  4XDC A;  5AUK A;  1N6Z A;  4AS1 A;  4KDI C;  1KOT A;  2NBV B;  4W9D A;  1OQR A;  4PYU A;  4A9A A;  1TKE A;  1R7S A;  4M8M A;  1TJE A;  3DBL I;  2ZZP B;  2M4N A;  3P63 A;  1WRD B;  2R2O A;  2DBY A;  1MHH E;  1ZOY B;  1Q10 A;  3DCG A;  2DNF A;  3NRZ A;  4KKI A;  2C7N B;  1QOG A;  1V97 A;  3ZNI D;  3QQ8 B;  3AU4 A;  1I35 A;  4WH4 A;  2NBW B;  3RZW C;  4IW0 A;  3M3J A;  4BOS C;  4ARI A;  4PS3 A;  2CU1 A;  4RFB A;  3U2S C;  2WU2 B;  2WXH A;  4WJQ A;  2WLB A;  5T8I A;  2KK8 A;  2DZJ A;  1ZW7 A;  2J42 A;  3ML9 A;  1V6E A;  3RNF C;  4LJO B;  2RDB C;  3AEE B;  3RUI B;  2BF8 B;  2L1A A;  1IGC A;  1ZXI A;  3V05 A;  4IOI E;  3ZW3 A;  3VVW B;  1YX6 B;  5FR6 A;  1UEL A;  5C3J B;  4W9C A;  1SBB B;  4MGI E;  2KX3 A;  3HHM A;  3VUX A;  1NEK B;  2HJ1 A;  4PS7 A;  2J0J A;  2ICI A;  3PZ8 A;  4N9F 4;  3HVD A;  1FCC C;  4GXB A;  2BT6 A;  2I1K A;  4IM2 A;  4EZL A;  2Y3A A;  2HTH A;  4YSZ B;  2AYO B;  3APF A;  3GE8 C;  1KTK A;  2KFK A;  3A9J B;  4KKJ A;  4US9 A;  2N9K A;  3SDL C;  3GZN B;  3VAW A;  3RI7 C;  3EEC A;  5FKA C;  1P7F A;  1QOB A;  5BYR A;  5J17 A;  2WXO A;  3DVG X;  2WXF A;  2OJW A;  3ABV B;  1AW7 A;  2MP2 A;  2FIF A;  4DXA B;  4RCO A;  1TZ1 A;  2KD0 A;  1E7U A;  4I6P A;  2ZCC A;  1T0R C;  4NAM A;  3GOE A;  1C3T A;  2LD9 A;  4S0R A;  3RFZ B;  3O13 A;  4MM3 B;  1ZDX A;  2BS4 B;  3V60 A;  4AOF A;  1FO4 A;  2NS5 A;  3BWU D;  4MGY E;  4AWJ A;  1BXT A;  2KAC A;  2G45 B;  2KMC A;  4AJY B;  2LGS A;  4ZRJ A;  1Z5S B;  3VUW A;  4XWT A;  1R4M B;  2N9E B;  1KLV A;  3R7R A;  3H6N A;  2L0T A;  3L13 A;  3GZN I;  1V86 A;  2N7D A;  2NCN A;  5EE1 A;  4NJ7 A;  1LQB A;  3IAM 1;  2RR9 A;  2QHO A;  2WYQ A;  1IPG A;  1RRB A;  3L0W B;  2JXX A;  1SE3 A;  3ZGZ A;  1T0S C;  1VZ6 A;  3C0R B;  3AM9 A;  4WWN A;  3BVG A;  4JIO U;  3PPA A;  1DOY A;  2KDM A;  1UBQ A;  2IZV B;  3AE3 B;  1FXA A;  2N9X A;  3KUD B;  2C7H A;  2KTR A;  1WIA A;  3ZJV A;  4PT5 A;  1M4V A;  1NI2 A;  3Q3M C;  4MEM A;  1T6B X;  3GB1 A;  2WGS A;  1FFV A;  1V80 A;  4M0W B;  3MHZ A;  2KJ6 A;  5EE3 A;  2KWD A;  4DWF A;  5BMG A;  1C4A A;  3V62 A;  1SIF A;  2WXL A;  1M94 A;  1BML C;  3ZDM C;  5GMV A;  2LRW A;  3RNE C;  3M95 A;  2JYE A;  2PPH A;  1V49 A;  2JX5 A;  2MRP A;  3HUI A;  4IWO A;  1OQY A;  4GB9 A;  4ICU A;  4ITK A;  4NQK E;  4EUT A;  3Q3F A;  5CHF A;  4EEW A;  2KDF B;  4HEA 1;  1WXV A;  4AP4 C;  4EFO A;  1ROE A;  4IWQ A;  4J6I A;  2XNA C;  3U7Z A;  1L5P A;  3BZD B;  1NEN B;  5EE9 A;  1JRU A;  2C5L C;  3AV8 A;  2V3N A;  3FKY A;  3JW0 X;  1F77 A;  2JZP A;  1YQB A;  1VDV A;  2UWQ A;  3AE1 B;  1I4P A;  4FXC A;  1TKY A;  1YN3 A;  1C77 A;  2BVC A;  4HRO A;  2DWQ A;  2KWC A;  3DWG C;  2RSU A;  1WRI A;  1P9D U;  4KGS A;  1WXQ A;  4ZRK A;  2DZI A;  4JWU C;  4O1N A;  4FLH A;  1GNU A;  1UUP A;  2GBR A;  1JRP A;  2IY0 B;  4A8X C;  4KGR A;  4USA A;  1WGY A;  3RNG C;  3RMK C;  2EKE C;  4KV2 A;  1KH0 A;  4RGT A;  1CK1 A;  4A55 A;  5IN7 A;  3OAW A;  1QOA A;  4PS8 A;  1HXY D;  2D11 A;  2DZK A;  4GU2 A;  1JML A;  4FAD A;  4F8C B;  2CJN A;  4RM9 A;  1P0R A;  2WS3 B;  3V3X A;  2IPK D;  2JRH A;  2FCQ A;  1SE2 A;  3KWL A;  1NYQ A;  2QCZ A;  4YT0 B;  1YNT E;  2RDG A;  1A5R A;  2EMT A;  3GP7 A;  2IYD B;  5L83 A;  3JSV B;  2WXI A;  4A3P A;  1PGB A;  1GC6 A;  5IA7 A;  2Y5C A;  3MC8 A;  2JRI B;  4CQN A;  4ANV A;  2MLB A;  5GXG B;  3RN9 C;  3TJP A;  3KW5 B;  3R7Q A;  2BQQ A;  4FJV B;  4FN2 A;  4FA6 A;  3MTN B;  2ZW0 A;  3PTF C;  1MVK A;  1HTQ A;  2DLB A;  1TS4 A;  1YIW A;  2K5P A;  3WA0 A;  4MEL A;  4YTN B;  1GJZ A;  2GOW A;  3ZUN A;  2GBK A;  3U7D A;  1GB1 A;  1WF9 A;  2MBO A;  1A70 A;  4FJZ A;  1P3Q U;  5J2R A;  4HLE A;  2L0F A;  1JCK B;  1WE7 A;  2M1M A;  4PYZ A;  1FRD A;  4I6N B;  2HE7 A;  4EZJ A;  3QJZ A;  1SE4 A;  2AX5 A;  4W9H A;  3LYY A;  1ISN A;  4TQ0 A;  5DCN A;  4ARC A;  1UNS A;  1ZKH A;  2IGD A;  3Q3N C;  5BMH A;  1E8W A;  1E0Z A;  3NVY A;  3KQ4 A;  5FK9 C;  4XWW A;  3R2I A;  5I4D A;  5D7G A;  4CYE A;  1VCB A;  1WSP A;  2MEK A;  1LGR A;  2V3P A;  1I4G A;  1YN5 A;  2WHI A;  1C4P A;  3PHW B;  3UQA A;  3MFG A;  3I63 C;  1IBX B;  3DHG C;  1CQV A;  2SEB D;  2Z0D B;  2W3S A;  3TEX A;  2DX5 B;  4HDQ A;  4EZK A;  1WJ4 A;  4ZHO A;  4GDK B;  2ONQ A;  3PSE B;  2WXG A;  3NVV A;  1D5M C;  1WGG A;  2LVQ A;  2IO1 B;  2GMI C;  2JWU A;  2G4S A;  1GPX A;  2JZZ A;  1YN4 A;  2IO2 B;  2KC2 A;  5AZF A;  2LZ6 A;  1HZ6 A;  3FIL A;  1N60 A;  5L95 C;  3IVF A;  2CS4 A;  4OZA A;  3AI5 A;  5H92 C;  1CJE A;  4OVV A;  5E6J A;  4GIV A;  2PVO D;  4NJC A;  4OW0 A;  1NVI D;  2MCN B;  2L3Z A;  4EKU A;  2D3G A;  4ANU A;  2W9N A;  1U4A A;  2KQ7 A; 
#chains in the Genus database with same CATH homology
 3MC8 A;  3OG5 A;  2VH1 A;  3EFC A;  2VH2 A;  3Q6B A;  2QDF A;  2MHJ A;  4XGA B;  2V9H A;  2QCZ A;  2X8X X;  4C4V B;  4BZA A;  4QAY A;  3MC9 A;  4K3C A;  3NJT A;  4PK1 A;  4C4V A;  4C00 A;  4K3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...