3OG5A

Crystal structure of bama potra45 tandem
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
160
structure length
160
Chain Sequence
AMDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Outer membrane protein assembly complex, YaeT protein
publication title Structure and Flexibility of the Complete Periplasmic Domain of BamA: The Protein Insertion Machine of the Outer Membrane
pubmed doi rcsb
source organism Escherichia coli
total genus 46
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07244 POTRA Surface antigen variable number repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 3og5A01
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 3og5A02
4BZAA 2X8XX 2QDFA 2QCZA 4C00A 4K3CA 4QAYA 4C4VB 4C4VA 3EFCA 3Q6BA 4PK1A 3NJTA 4K3BA 2V9HA 2VH1A 2MHJA 4XGAB 2VH2A 3MC9A 3MC8A 3OG5A
chains in the Genus database with same CATH superfamily
4B0EA 1JWMD 4AQ7A 3PZDA 4GXBA 2DZJA 4LNIA 3NZSA 2BPSA 3QARA 2OOBB 1H8CA 1E0ZA 4G50A 1K8RB 4E74A 3NY5A 4DXFA 4K7SA 4OW0A 5IAAC 2SAKA 4B9KA 2YEPF 3IAS1 4RMAA 4KKJA 4US9A 3H8HA 4GDKB 3DBHI 3AEFB 2KD0A 1OEYJ 5AZGA 4NZLB 2L8JA 1OFFA 3U4EG 1WSPA 4JE3B 4MELA 3APFA 3GP7A 1QT9A 4P1BC 2K1FA 1WMHB 1C9FA 5FKAC 1ZE3D 1TZ1A 4O1NA 1RRBA 1IBXB 4DXGA 1FFUA 3R2IA 2O2VB 1YOVB 4FJVB 3VVWB 1GNUA 1WJ4A 3PGEA 1SB3C 2ZW1A 3Q8BA 1D3ZA 3M95A 5D7GA 2AL6A 4EZJA 4NQKE 3M62B 2JVCA 4ICVA 3H9DA 2DAJA 1XXGA 4IKGA 3P4SB 1QLBB 4PS7A 3X0WA 3ECIA 5I4DA 3ZIMA 2D5GA 4ZRQA 2GBJA 2IO0B 2MBQA 1I4XA 5CHFA 4RGMA 2V4LA 2BQQA 2BBCA 2N9XA 2RDGA 3CSFA 3P42A 4G0NB 2PKOA 4GSWA 4MDKE 1TS5A 2I1JA 2KC1A 4DXAB 1UD7A 1WM2A 3P4QB 3TEZA 2LWPA 1ZW7A 2PLPA 4NNJB 4JPSA 1M4VA 2WX0A 4HKQA 1K50A 2JUOA 3AU4A 4OVZA 2WU5B 3GE3C 2WHIA 3A33B 4RGTA 2I2YA 2WU2B 5D3DA 3VUWA 4HVBA 1KJTA 4KGRA 4FA6A 1D5XC 2MRPA 2EMSA 1C4CA 2JZZA 1P7EA 5E6NA 2MJDA 4RF1A 3L13A 1FCCC 5HG2A 4W9EA 1AW7A 2NTTA 3RZFA 4DBGA 2L52A 2HTHA 4L23A 2D3CA 2LVPA 3T3NA 2G3QB 3I5JC 2WYQA 3NVWA 4YT0B 2ACZB 3BK1A 2GRIA 2OJRA 2KYWA 3W9CB 4S0RA 4F7ZA 4IM0A 1EWYC 4RFBA 2IO3B 5G5GA 2BS3B 3RNCC 2RSUA 2PVOD 4RGNA 3Q8FA 5G2NA 5AUKA 1L4DB 1TTNA 4IG7B 1FMAD 1QOAA 1SBBB 2N0SB 1S3SG 1WF9A 2V1YA 2WWZA 3DWGC 4HJKA 1C77A 1L0XB 3T9LA 2LFIA 2AQ2B 4JL9A 5JZEB 3QK0A 3BYTB 2INDC 2ONQA 4REZA 1KLVA 2N9EB 3BK2A 3LYYA 4K3CA 4MGKE 3VTWA 1VZ8A 1F52A 5J18A 2KDEB 1BT0A 2IGDA 4JQWC 3HUIA 4BOZB 2R2OA 3PHXB 5E6JA 1SE4A 2JXXA 2JY6A 1WX8A 2WDQB 3X23A 4BVUC 1V86A 2V3PA 3SEBA 3V05A 3L10B 3VDZA 1VCBA 1LO5D 4IM2A 1RYJA 1WFYA 3SHQA 3V3XA 4AS1A 2JSVX 4W9LA 3WAOA 2KDMA 1V1PB 2LRUA 3BY4B 1Y8RC 2IBIB 2B76B 3A1QA 4WIPA 1YX6B 2XEWA 4TQ0A 2J52A 2DBYA 4GMVA 5MPOA 5DPTA 1Z5SB 3V60A 1K53A 3Q8EA 4FXCA 3FILA 2MP2B 4JLCA 2WLBA 1FO4A 3HM6X 2GBNA 2O6VD 3TEXA 2OEDA 1I4GA 3AMZA 4RM8A 2O6VA 1CK1A 4WWMA 1WM3A 4XWWA 2KLGA 1QOGA 4ANVA 2KMAA 3Q3MC 2GMIC 3VQIA 5HKHA 2KJRA 1FXTB 4XC2A 5D6JB 1HTQA 4A20A 2MQJA 1D4BA 1UBQA 1RFKA 4WQOB 3ZRCA 2KWVB 4LNFA 2ZJDA 2YEPB 1V97A 1RM6C 2XK5A 4JWUC 3IAM1 5E6OA 4OVVA 4HPPA 2WDVB 2BF8B 1F1HA 2KQ7A 1WGKA 3TJPA 2YVCA 2PW9A 1YD8U 1R7SA 5C1ZA 4JGHB 1QKZA 2L7RA 3AULA 3A1QB 2KZRA 3WALA 3TEWA 4XX5A 1FRRA 3APCA 4MGYE 2M19A 3L54A 1E8ZA 2BYVE 2W9NA 1J19A 3PZ8A 3UI3A 4B0MA 2FUG1 1T0SC 2V3SA 2JX5A 2ZNVC 4ZRKA 1J7AA 2KDIA 3FILB 2QILA 2LVOA 3NHEB 4FJYA 1XEEA 1WXVA 1XO3A 2IZVB 3N1YC 2O6VB 3U2SC 1ZXHA 3V61A 5BMGA 1DOIA 1AN8A 1T3QA 2D3AA 2OHFA 4LJPB 3SDLC 1EM7A 2K9XA 1E7VA 4N59A 2N7DA 2WXGA 3ZVVA 2CU3A 4ZHOA 3RPFC 4M02A 1C1YB 1I4HA 2N4FA 2HD5B 4WJQA 3PRZA 4W9IA 1I7HA 3KUCB 1NYQA 3R7RA 4YTMB 5LLIA 2XK5B 3HM3A 5IA7A 1GOZA 3CSTA 5J2RA 1ROEA 1KOTA 4HK2A 5DPRA 4TV3A 4M00A 4PS3A 1LXDA 3VRBB 1CJEA 5EE9A 3GOEA 2WXKA 2PPHA 4DK5A 2J53A 3P1MA 4GB9A 3ZKJC 3UQAA 1UF0A 2D07B 4XDDA 1N6ZA 2PEAA 2MA9B 2AL3A 4OZCA 3VR9B 2LUMA 1IGDA 4F8CB 1SJHD 4NPNA 1D5MC 3BINA 1A5RA 4A90A 4P1CC 2KWCA 4FN2A 3ONSA 1E10A 4XGAB 3MFGA 4A55A 4X57B 4PYUA 4HEA1 4IWPA 2K3UA 1SE3A 3JW0X 2UU7A 4URKA 3N30A 2QDFA 4W9HA 1YQBA 3DHHC 2N1VA 4RGOS 4C4VA 4D2KA 2INPE 2NMQA 3R8BA 3ENEA 2BTEA 1NVID 2L00B 3W5VB 3EGRA 1P7FA 2BYTA 2K6DB 3PTFC 3DOWA 1ENFA 1XLNA 3DPDA 3DBHB 4HXDA 2MBBB 4HJGE 3VH4B 3KUZA 3ZNID 1ZXIA 3NJTA 1L2NA 1NI2A 1WR6E 1L5PA 1QOBA 3DCGA 3OJ3A 3R66C 4BAXA 3SFDB 1MPEA 1N5XA 3GZNI 4WJPA 1FRDA 1E90A 1OGWA 2UWQA 1V9JA 1YX5B 3L4PA 3U8ZA 2AQ3B 4OHJA 4GDKA 1WJNA 3AEGB 1OQQA 3N32A 1GAQB 3J9CA 2JZ3B 1F9JA 3ZTDA 1TS3A 4JX1C 3B9JA 3VTUA 4ITKA 1F2RC 3AE5B 1IBXA 1C79A 2G4SA 4HCPB 4ANWA 3KW5B 4TSSA 4HDQA 1P9DU 3W1SA 1TBEA 1J0GA 3MJ5A 4C4VB 2DZIA 5FR6A 3EHVA 5HI1A 3MJWA 3PRPB 2IGHA 3I63C 2CHWA 4WAAA 3U52E 1TS2A 2N9PC 5FK9C 4MM3A 3CWIA 3KYCD 3B0AA 3BZDB 1GC6A 2D3BA 2GB1A 2WDTB 3EC8A 1E8XA 2KTRB 1HZ6A 4LK0M 4K7UA 4KGTA 2NCNA 3TL5A 2KMCA 2LGXA 5TR5A 2PVGC 3QX1A 5GXGB 4YTPB 3ZYYX 4LCDE 1VZ7A 1PYWD 2Z0EB 1VRAB 2QC8A 4DDGD 2IO2B 2WX1A 4C7YA 1TKYA 4ZRPA 1IYFA 4ANUA 2JYTA 1WRDB 1HA5A 1BUIC 3KUDB 1WZ0A 3B2FA 4A3PA 2BYEA 1D5ZC 5FR3A 1IGCA 2W3SA 2B3AA 2QHOA 2RDHA 2PTLA 2FCNA 1FIQA 4UDUC 4ZRIA 4EEWA 4AJWA 4W9DA 4ZHPA 3ABVB 1SJED 2NPTA 3KWLA 2PIAA 4PYZA 2N1WA 4CO7A 3ML9A 5CHWA 4ZOHC 4C80A 4MM3B 4XWTA 4E3CA 1KRHA 1XCTL 3VTVA 2GI9A 3ZNHB 1FEHA 1JQ4A 1SIFA 3AE3B 2L1AA 4HROA 3UINB 4AOFA 1WYGA 2OJWA 1K52A 3AN1A 1TS4A 1TY0A 1DOXA 3DDCB 1LQBA 2PE9A 3AE1B 2NTSA 1KH0A 4M8NA 2INNE 3MHZA 1STEA 3E9SA 1EUVB 1WE7A 4P6VF 2LI5A 1HZ5A 3PLVA 4B6WA 2MX2A 4EZLA 1L7YA 2FE8A 3MC9A 2C7HA 3RCZA 3DHGC 2I38A 3HRDD 3N3KB 5C23A 1WH3A 3DBRB 1WXAA 4GN1A 5AZFA 1I4PA 1UZXB 2WXIA 3H7PA 2WNMA 4EFOA 1JCKB 1UUPA 1B9RA 2KANA 2LVQA 2KX0A 4WWOA 1MVKA 2EKIA 2M0XA 4YL8A 4M8MA 2NPTB 2KDBA 4IUMB 1TYGB 2GBKA 4LLGM 1SSNA 4DDID 3Q2AC 2A4ZA 3TUOA 2ZCCA 3BYYB 3Q69A 2REXA 3LB8C 4NQLB 2G45B 2LGDA 4PT5A 2K8BA 1V1PA 1LGRA 4P7IA 1VDVA 3RZWC 2MWSB 3DVGY 2GBMA 2JRHA 3CIRB 3TSSA 4FULA 3ZJTA 4AUQC 3MC8A 4YXDB 4KDLB 1JWSD 2KFJA 2L3ZA 2Y5CA 2AX5A 2KHWB 3MP9A 2JXTA 1KLUD 1V80A 5T8IA 1N62A 1J8CA 2ZVOA 3ZJUA 3Q3OC 1JROA 2KT7A 2MP2A 1GB4A 4DQOC 3PSEB 4GOCA 5IO9A 3U7DA 2BS4B 3LDZE 2DENB 4DWFA 3IBEA 3BVMA 4J3OD 1WIAA 5J17A 5D3IB 2IO1B 2NBWB 5C2TB 1I4RA 1KFYB 2MJ3A 3O65B 3VUYA 3H7PB 1MG8A 3UF8A 2A5UA 3ZJVA 4BOSC 2V0GA 2KOXA 1WR1A 1V5OA 4EOYA 2K8HA 1HTOA 3Q8AA 3QHTA 2KQSA 2J0KA 1QQRA 4GGQA 2JU6X 2DHZA 2FCQA 3DBRI 1JW9D 4KKIA 3H6NA 2KQ4X 4GLSC 1NBFC 2J4XA 2N7JA 4A6QA 1I4QA 2QIEB 2WXHA 1FNUA 4LNNA 2XBBC 3HIZA 3PHWB 2XN9C 5EDSA 5AZHA 1IP9A 2LHDA 2J7QB 3RD2A 3NG0A 3AE8B 1E9MA 3KQ4A 2Z0DB 2FAZA 2W55A 3LJ3A 4W9CA 3P63A 2JF5A 5EE0A 3PLUA 3NVYA 3GE8C 2VH1A 2CU1A 3TMPB 2R2QA 3RNBC 1FNVA 4EZKA 1QF6A 2BB5A 2LEKA 3S2AA 3NUHB 5L83A 3AV8A 3VR8B 2I1KA 5JHAA 4BKTA 3N1XC 5EE1A 4BBNF 1U4AA 4RF0A 3RT3B 2JQRB 1WGDA 2DLBA 3SFEB 4DHZB 1EU3A 2HTME 2KN5A 1ISNA 3RYTA 2DAFA 3VFKA 3K9PB 1WI0A 3AE7B 3VXWA 1T0RC 3V6CB 4TMAB 3TEYA 5GMVA 1V81A 3EFCA 5JH5C 4JWSC 2QJLA 3H7SA 1F0ZA 2KN4A 2RGFA 3T3OA 3BVGA 4MGZE 1ZDVA 2KFKB 4IDIA 2LZ6A 3ZXVA 2BVCA 2YLMA 1UGMA 1FXAA 1RLFA 1WJ6A 1E8WA 4L2YA 3PO0A 2Y3AA 1VLBA 5AEKB 3RFZB 3WCQA 4NJ7A 1LM8B 3E56A 1NYRA 2BW2A 1GB1A 3N20C 4MGIE 4KZCA 2D10A 2INCC 2KJHB 1UWMA 4FHJA 1JALA 1GUAB 2L0TA 1HXYD 3UGBB 2JYEA 1UELA 1WYWB 3GZNB 1YNTE 4GIVA 1JMLA 4KVGB 3KVFB 4DHJD 1QILA 3HK0A 2LXCA 4FLHA 1JWUD 3B2GA 3OAWA 1KTKA 4K1RB 3A4SC 2N9KA 2M56B 1NEKB 3EFUA 3Q6BA 1L6UA 1TY2A 3W5UB 1L0YB 4HWIB 2FBWB 2PJHA 4NAWA 4KIKB 3IT4B 2ZVNA 3VH3B 1PGAA 4RNAA 2G1EA 4OZAA 1FD6A 4B95A 3CMMB 2Z59B 1B1ZA 3JVZX 5BMIA 1EO6A 2BWES 2BWFA 4Q2JA 1CZPA 3ZNZB 1FXIA 2KK8A 1WXQA 2AWTA 4LJOB 4WJNA 1WX9A 4MSMB 2K6QA 1ESFA 2D3GA 1Q1OA 1YIWA 3JYUA 3DVNV 2DZMA 3L08A 5EE3A 1TZOA 3BIID 1VD2A 4CHKA 1JRUA 1T5XD 2KWDA 4WJOA 3RULA 4ARIA 1V8CA 3ZGZA 1SF0A 1R4MI 2C60A 2XNAC 2WGSA 4LNOA 1FCLA 1E7UA 2C7NB 3T8MA 1CMXB 2AEHA 3RUIB 3BWUD 3N9YC 3OJ4B 2M1MA 2AYOB 4DHJB 5JHBA 2LHEA 4OVUA 2X8XX 2DWQA 5CHVC 4G11A 5IKCM 1TKGA 1SIJA 4NAWB 1AYFA 2LGSA 2M17A 3LXFA 2KTRA 3AE9B 2KXJA 1C4PA 2RDBC 2RPVA 3ZDMC 1AARA 2NVUI 4YTNB 1QZEA 2CHXA 2ZCBA 3NS1A 2WXJA 2IY0B 1P0RA 4C56C 2M4NA 3C19A 2CKHB 4MH0E 4PK1A 1XQQA 3Q3JA 2LGIA 5JXVA 3ZNGC 3RNFC 2RR9A 2IPKD 1SGHA 3AEDB 2IJ0A 2KC2A 2VZKD 3SU8X 1V2YA 4A9AA 4N58A 4TQ1A 3B08A 5G5HA 3P4PB 1VR9A 1RFAA 2W54A 3M3JA 1YN3A 1P98A 4CQNA 1CQVA 4MEMA 4AWJA 2KWUB 2WXMA 3AE2B 1F2RI 2K5PA 3R3MA 4TKNA 1WGGA 4IWOA 2CHZA 2KAJA 2L76A 4IC7B 5AUIA 1ACCA 3Q14C 1WGHA 4I6LB 2JT4B 3IVFA 1R4NI 3O13A 4I6PA 1WX7A 5DCNA 4ZYSA 2BKRB 3UIPB 4KSLC 2KX3A 2MSED 1SXTA 5IP4D 2EELA 4HPMB 2QCZA 3KYDD 4BKSD 4MSQB 3NVVA 3MTNB 4BKSA 2M8SA 4RH6A 1JWBD 3ZXRA 2L32A 1T0YA 3N1ZC 2WDRB 1OTRB 3PREA 2JWUA 1DGJA 4W9JA 1MG4A 2RD0A 2NBUA 1UGJA 1WZ3A 2VZKB 3V6EB 3KH0A 1ZDXA 1NI3A 1BMLC 1E5WA 2K8CA 2DYMA 1EF5A 5L95C 1WJUA 1VZ6A 2DX5B 1E6EB 3DBLI 3FC4A 2EMTA 1WWTA 3V62A 2VH2A 1ZGUB 1Q0WB 4DHZE 3OWEB 2WXRA 1A70A 3AU5A 1JWAD 2E3TA 1C4AA 2MBOA 1WRIA 2JZPA 5TSSA 3IT6B 1ET6A 2DZKA 1FNWA 1TT5B 5H92C 2HJ8A 5BO4B 2WQYB 4BKGA 4EE2A 1QOFA 3NZ3A 3KWVA 1DYQA 3QIJA 4OZBA 3H1UA 1AWDA 2QSDA 1L0VB 3NOBA 1ZPSA 1MHHE 3AEEB 5LXIB 3HVZA 4G3XB 2WS3B 1Q10A 3JSVA 1PUTA 1GPXA 4PS8A 2WXQA 1Q5WB 2ON8A 2KVRA 4YSZB 4J6IA 2J0MA 2UYZB 3B1LX 2FIFA 2LUEA 3OG5A 3FKYA 1WY8A 4NAMA 3IHPC 4LTUA 3A9KA 4K81A 1YQ3B 2DYOA 4IOIE 4W9GA 4BBNC 4AJYB 4JIOU 1J7BA 1SE9A 3I9V1 5IOIA 1FFVA 2BT6A 1YN5A 3I3TB 1N61A 2L0FA 3C8YA 3CF6E 1GC7A 4GDLA 2FUHB 3DHIC 4GU2A 3Q3NC 4K3BA 3W1SC 3QJZA 1UWXA 5BYSA 4HPLB 2MHJA 3M63B 1PQSA 3U30A 4E71A 4ASWC 3QWZB 2HDEA 3A4RA 3SD5A 4KDIC 4NY0A 4WAFA 3PVLA 1IUEA 3JSVB 4KX6B 3ZDTA 1SE2A 2MCNB 3I57A 1N5WA 2JPHA 4LNKA 4R3DA 4KV2A 3C0RB 2KKCA 2QEJC 3ZLZA 2IDYA 3P4RB 2IY1B 1WGRA 2LRWA 3ETRA 2V3NA 2L05A 2LMCA 4IW0A 3A9KB 1HEZE 1K51A 3AM9A 4RM9A 3ZTCA 1V49A 3DQVA 2M0AA 1PGXA 2BYFA 1KF6B 2VRRB 3IFWB 2C7MB 1N60A 2KO3A 1XLPA 1MI0A 1YJIA 3ALBA 4ANXA 1C3TA 1PGBA 4GDLB 5KHOA 2D2QA 3AXCA 4WH4A 3AEBB 3PRMB 2ZW0A 3PV1A 5HFYA 4IM3A 1NDDA 1MJDA 4FHKA 5D94A 2BB6A 2CJNA 5BMHA 1ZP0B 1I42A 2HJ1A 4M0WA 2FCSA 2KFKA 4HLEA 1XF5L 4HCNB 2MLBA 1XD3B 1WXSA 2KTFA 2ZNVB 4XZ4A 2FNJB 3AECB 2E6XA 3VAWA 1XT9B 2JWZA 1GG3A 3AEAB 5H8YE 4MJSA 3A9JA 1KLGD 3AI5A 3Q3FA 3EUB2 1RWSA 1UNSA 2LASA 5BYQA 4A8XC 1LFDA 1WE6A 4N6EB 3U7ZA 4L1BA 1OEYA 3DBSA 4HKZE 4NJCA 3ZUNA 1P3QU 2MH7A 2CS4A 1RAXA 1C76A 1H4RA 3QAQA 1FPYA 3NVZA 3AB5A 3IXSA 4S17A 2MJEA 3BVZA 2GOWA 2W82A 2GBRA 1I35A 3D32A 2DNFA 2FCMA 1MFWA 3VUXA 4C7ZA 3AE4B 2MEKA 2HE7A 3KLSX 1EWCA 3QQ8B 3EECA 2KJ6A 1TIFA 1WGYA 4M0WB 4WWNA 3DWMA 4KIKA 2ZPYA 1V5TA 2W3RA 3AE6B 1OQYA 3W1YA 2WXLA 3P2BA 2LXAA 3PS6A 4EKUA 2LGYA 1EU4A 3NZUA 3APDA 1ET9A 1R4MB 3WIMA 3WAMA 2ICIA 2KNBA 1XCQL 2GLSA 4CYEA 2N9LA 4FADA 5LNK1 4II2B 4ZDVA 3PPAA 4ICUA 2V4IB 4KSKC 4KGSA 3IG3A 2WXFA 3A9JB 4MJSB 4XDCA 3VRAB 1BXTA 4YSYB 2R61A 3GB1A 3TBLD 3ZRFA 2C9WB 3WA0A 1WXMA 1TJEA 4HDOA 1YJJA 3PZ7A 3QA8A 3SR6A 2IYDB 4MH8A 4ARCA 1IPGA 1PDXA 3TCAA 1Z2MA 2PMVA 4YWGG 4W9FA 2NBVB 4QAYA 1L6VA 1MHXA 1J7CA 3AH7A 3ZW3A 3NS8A 1VJKA 2V9HA 5CX3A 4TUUA 1PFDA 2Z8LA 2K22A 1JRPA 2KACA 1TGZB 3URYA 2KMMA 1YN4A 2NS5A 4BZAA 2RPQA 4N9F4 3ML8A 3MC0B 2FIDA 5CTRC 1E7PB 2H88B 1YJ1A 4FBJB 4USAA 2K0PA 1T6BX 1N63A 1DOYA 1ZKHA 1P1AA 2C5LC 1TKEA 2WXOA 2WXPA 1V6EA 2ZPNA 2D11A 4K7WA 4IWQA 4MACA 4LDTD 5DPSA 2K39A 3RNGC 1XLQA 1YQ4B 1NENB 1ZOYB 4I6NB 1R4NB 3DVGX 5C3JB 1S1QB 1E8YA 4ZRJA 3HVDA 2TSSA 5HHDG 4AP4C 2J0JA 1ZUD2 4WQMA 2AQ1B 2QMTA 3RN9C 2Y5PA 1UH6A 2N7EA 4WWPA 4A3OA 2X38A 3TIXA 1C78A 4MT5A 2RMMA 2CR5A 2L83A 3GS2A 4EUTA 3K9OB 1F77A 4FJZA 2MBEA 2WXNA 4XE0A 3PT2B 4BFRA 4ZYNA 3DVNU 2IGGA 2LD9A 3Q8CA 2KDFB 3UQBA 1X1MA 2ZZPB 1HE8A 2G9HD 1YMHE 2PE6B 4F1SA 1GJZA 3QCAA 3DBLB 3MHSD 5BYRA 4H2AA 4KZ0A 3ZQ4A 2Y5BB 3UIOB 2MBHA 5DPWA 1G6JA 2BS2B 2H89B 3L0WB 2BKFA 4HRSA 2SEBD 2KVZA 2DYBA 1Y56A 3W2DA 4LDTB 2CJOA 3RNEC 4C00A 3WANA 3HHMA 2EKEC 2BGFA 2ZEQA 1XLOA 3ZO5B 4YSXB 5IN7A 3EA6A 3QC8B 1M94A 5KHQA 1V1OA 4XYCA 1WMHA 3NRZA 2WP9B 1OQRA 2JRIB 4RCOA 5E6PA 3RNAC 2J42A 2LJ5A 3RMKC 5G55A 2NR2A 2O2VA 1FM0D 2ASQA 3L16A 3OLMD 4P16A 1D6EC 3RI7C 1EF1A 2MW5A 4US8A 4W9KA 2Q5WD 1SEBD 4NJ6A 3WAPA 5LXHA 3FAHA 2KLCA 3L17A 4ACFA 1T0QC 2LJIA 1HQRD 5D2MB 1UBIA 1KM7A 2G4DB 2K25A 4WURA 1L4ZB 3VHTC 3R7QA 3R2TA 4II3B 4M01A
chains in the Genus database with same CATH topology
4BZAA 2X8XX 2QDFA 2QCZA 4C00A 4K3CA 4QAYA 4C4VB 4C4VA 3EFCA 3Q6BA 4PK1A 3NJTA 4K3BA 2V9HA 2VH1A 2MHJA 4XGAB 2VH2A 3MC9A 3MC8A 3OG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BZA A;  2X8X X;  2QDF A;  2QCZ A;  4C00 A;  4K3C A;  4QAY A;  4C4V B;  4C4V A;  3EFC A;  3Q6B A;  4PK1 A;  3NJT A;  4K3B A;  2V9H A;  2VH1 A;  2MHJ A;  4XGA B;  2VH2 A;  3MC9 A;  3MC8 A;  3OG5 A; 
#chains in the Genus database with same CATH topology
 4B0E A;  1JWM D;  4AQ7 A;  3PZD A;  4GXB A;  2DZJ A;  4LNI A;  3NZS A;  2BPS A;  3QAR A;  2OOB B;  1H8C A;  1E0Z A;  4G50 A;  1K8R B;  4E74 A;  3NY5 A;  4DXF A;  4K7S A;  4OW0 A;  5IAA C;  2SAK A;  4B9K A;  2YEP F;  3IAS 1;  4RMA A;  4KKJ A;  4US9 A;  3H8H A;  4GDK B;  3DBH I;  3AEF B;  2KD0 A;  1OEY J;  5AZG A;  4NZL B;  2L8J A;  1OFF A;  3U4E G;  1WSP A;  4JE3 B;  4MEL A;  3APF A;  3GP7 A;  1QT9 A;  4P1B C;  2K1F A;  1WMH B;  1C9F A;  5FKA C;  1ZE3 D;  1TZ1 A;  4O1N A;  1RRB A;  1IBX B;  4DXG A;  1FFU A;  3R2I A;  2O2V B;  1YOV B;  4FJV B;  3VVW B;  1GNU A;  1WJ4 A;  3PGE A;  1SB3 C;  2ZW1 A;  3Q8B A;  1D3Z A;  3M95 A;  5D7G A;  2AL6 A;  4EZJ A;  4NQK E;  3M62 B;  2JVC A;  4ICV A;  3H9D A;  2DAJ A;  1XXG A;  4IKG A;  3P4S B;  1QLB B;  4PS7 A;  3X0W A;  3ECI A;  5I4D A;  3ZIM A;  2D5G A;  4ZRQ A;  2GBJ A;  2IO0 B;  2MBQ A;  1I4X A;  5CHF A;  4RGM A;  2V4L A;  2BQQ A;  2BBC A;  2N9X A;  2RDG A;  3CSF A;  3P42 A;  4G0N B;  2PKO A;  4GSW A;  4MDK E;  1TS5 A;  2I1J A;  2KC1 A;  4DXA B;  1UD7 A;  1WM2 A;  3P4Q B;  3TEZ A;  2LWP A;  1ZW7 A;  2PLP A;  4NNJ B;  4JPS A;  1M4V A;  2WX0 A;  4HKQ A;  1K50 A;  2JUO A;  3AU4 A;  4OVZ A;  2WU5 B;  3GE3 C;  2WHI A;  3A33 B;  4RGT A;  2I2Y A;  2WU2 B;  5D3D A;  3VUW A;  4HVB A;  1KJT A;  4KGR A;  4FA6 A;  1D5X C;  2MRP A;  2EMS A;  1C4C A;  2JZZ A;  1P7E A;  5E6N A;  2MJD A;  4RF1 A;  3L13 A;  1FCC C;  5HG2 A;  4W9E A;  1AW7 A;  2NTT A;  3RZF A;  4DBG A;  2L52 A;  2HTH A;  4L23 A;  2D3C A;  2LVP A;  3T3N A;  2G3Q B;  3I5J C;  2WYQ A;  3NVW A;  4YT0 B;  2ACZ B;  3BK1 A;  2GRI A;  2OJR A;  2KYW A;  3W9C B;  4S0R A;  4F7Z A;  4IM0 A;  1EWY C;  4RFB A;  2IO3 B;  5G5G A;  2BS3 B;  3RNC C;  2RSU A;  2PVO D;  4RGN A;  3Q8F A;  5G2N A;  5AUK A;  1L4D B;  1TTN A;  4IG7 B;  1FMA D;  1QOA A;  1SBB B;  2N0S B;  1S3S G;  1WF9 A;  2V1Y A;  2WWZ A;  3DWG C;  4HJK A;  1C77 A;  1L0X B;  3T9L A;  2LFI A;  2AQ2 B;  4JL9 A;  5JZE B;  3QK0 A;  3BYT B;  2IND C;  2ONQ A;  4REZ A;  1KLV A;  2N9E B;  3BK2 A;  3LYY A;  4K3C A;  4MGK E;  3VTW A;  1VZ8 A;  1F52 A;  5J18 A;  2KDE B;  1BT0 A;  2IGD A;  4JQW C;  3HUI A;  4BOZ B;  2R2O A;  3PHX B;  5E6J A;  1SE4 A;  2JXX A;  2JY6 A;  1WX8 A;  2WDQ B;  3X23 A;  4BVU C;  1V86 A;  2V3P A;  3SEB A;  3V05 A;  3L10 B;  3VDZ A;  1VCB A;  1LO5 D;  4IM2 A;  1RYJ A;  1WFY A;  3SHQ A;  3V3X A;  4AS1 A;  2JSV X;  4W9L A;  3WAO A;  2KDM A;  1V1P B;  2LRU A;  3BY4 B;  1Y8R C;  2IBI B;  2B76 B;  3A1Q A;  4WIP A;  1YX6 B;  2XEW A;  4TQ0 A;  2J52 A;  2DBY A;  4GMV A;  5MPO A;  5DPT A;  1Z5S B;  3V60 A;  1K53 A;  3Q8E A;  4FXC A;  3FIL A;  2MP2 B;  4JLC A;  2WLB A;  1FO4 A;  3HM6 X;  2GBN A;  2O6V D;  3TEX A;  2OED A;  1I4G A;  3AMZ A;  4RM8 A;  2O6V A;  1CK1 A;  4WWM A;  1WM3 A;  4XWW A;  2KLG A;  1QOG A;  4ANV A;  2KMA A;  3Q3M C;  2GMI C;  3VQI A;  5HKH A;  2KJR A;  1FXT B;  4XC2 A;  5D6J B;  1HTQ A;  4A20 A;  2MQJ A;  1D4B A;  1UBQ A;  1RFK A;  4WQO B;  3ZRC A;  2KWV B;  4LNF A;  2ZJD A;  2YEP B;  1V97 A;  1RM6 C;  2XK5 A;  4JWU C;  3IAM 1;  5E6O A;  4OVV A;  4HPP A;  2WDV B;  2BF8 B;  1F1H A;  2KQ7 A;  1WGK A;  3TJP A;  2YVC A;  2PW9 A;  1YD8 U;  1R7S A;  5C1Z A;  4JGH B;  1QKZ A;  2L7R A;  3AUL A;  3A1Q B;  2KZR A;  3WAL A;  3TEW A;  4XX5 A;  1FRR A;  3APC A;  4MGY E;  2M19 A;  3L54 A;  1E8Z A;  2BYV E;  2W9N A;  1J19 A;  3PZ8 A;  3UI3 A;  4B0M A;  2FUG 1;  1T0S C;  2V3S A;  2JX5 A;  2ZNV C;  4ZRK A;  1J7A A;  2KDI A;  3FIL B;  2QIL A;  2LVO A;  3NHE B;  4FJY A;  1XEE A;  1WXV A;  1XO3 A;  2IZV B;  3N1Y C;  2O6V B;  3U2S C;  1ZXH A;  3V61 A;  5BMG A;  1DOI A;  1AN8 A;  1T3Q A;  2D3A A;  2OHF A;  4LJP B;  3SDL C;  1EM7 A;  2K9X A;  1E7V A;  4N59 A;  2N7D A;  2WXG A;  3ZVV A;  2CU3 A;  4ZHO A;  3RPF C;  4M02 A;  1C1Y B;  1I4H A;  2N4F A;  2HD5 B;  4WJQ A;  3PRZ A;  4W9I A;  1I7H A;  3KUC B;  1NYQ A;  3R7R A;  4YTM B;  5LLI A;  2XK5 B;  3HM3 A;  5IA7 A;  1GOZ A;  3CST A;  5J2R A;  1ROE A;  1KOT A;  4HK2 A;  5DPR A;  4TV3 A;  4M00 A;  4PS3 A;  1LXD A;  3VRB B;  1CJE A;  5EE9 A;  3GOE A;  2WXK A;  2PPH A;  4DK5 A;  2J53 A;  3P1M A;  4GB9 A;  3ZKJ C;  3UQA A;  1UF0 A;  2D07 B;  4XDD A;  1N6Z A;  2PEA A;  2MA9 B;  2AL3 A;  4OZC A;  3VR9 B;  2LUM A;  1IGD A;  4F8C B;  1SJH D;  4NPN A;  1D5M C;  3BIN A;  1A5R A;  4A90 A;  4P1C C;  2KWC A;  4FN2 A;  3ONS A;  1E10 A;  4XGA B;  3MFG A;  4A55 A;  4X57 B;  4PYU A;  4HEA 1;  4IWP A;  2K3U A;  1SE3 A;  3JW0 X;  2UU7 A;  4URK A;  3N30 A;  2QDF A;  4W9H A;  1YQB A;  3DHH C;  2N1V A;  4RGO S;  4C4V A;  4D2K A;  2INP E;  2NMQ A;  3R8B A;  3ENE A;  2BTE A;  1NVI D;  2L00 B;  3W5V B;  3EGR A;  1P7F A;  2BYT A;  2K6D B;  3PTF C;  3DOW A;  1ENF A;  1XLN A;  3DPD A;  3DBH B;  4HXD A;  2MBB B;  4HJG E;  3VH4 B;  3KUZ A;  3ZNI D;  1ZXI A;  3NJT A;  1L2N A;  1NI2 A;  1WR6 E;  1L5P A;  1QOB A;  3DCG A;  3OJ3 A;  3R66 C;  4BAX A;  3SFD B;  1MPE A;  1N5X A;  3GZN I;  4WJP A;  1FRD A;  1E90 A;  1OGW A;  2UWQ A;  1V9J A;  1YX5 B;  3L4P A;  3U8Z A;  2AQ3 B;  4OHJ A;  4GDK A;  1WJN A;  3AEG B;  1OQQ A;  3N32 A;  1GAQ B;  3J9C A;  2JZ3 B;  1F9J A;  3ZTD A;  1TS3 A;  4JX1 C;  3B9J A;  3VTU A;  4ITK A;  1F2R C;  3AE5 B;  1IBX A;  1C79 A;  2G4S A;  4HCP B;  4ANW A;  3KW5 B;  4TSS A;  4HDQ A;  1P9D U;  3W1S A;  1TBE A;  1J0G A;  3MJ5 A;  4C4V B;  2DZI A;  5FR6 A;  3EHV A;  5HI1 A;  3MJW A;  3PRP B;  2IGH A;  3I63 C;  2CHW A;  4WAA A;  3U52 E;  1TS2 A;  2N9P C;  5FK9 C;  4MM3 A;  3CWI A;  3KYC D;  3B0A A;  3BZD B;  1GC6 A;  2D3B A;  2GB1 A;  2WDT B;  3EC8 A;  1E8X A;  2KTR B;  1HZ6 A;  4LK0 M;  4K7U A;  4KGT A;  2NCN A;  3TL5 A;  2KMC A;  2LGX A;  5TR5 A;  2PVG C;  3QX1 A;  5GXG B;  4YTP B;  3ZYY X;  4LCD E;  1VZ7 A;  1PYW D;  2Z0E B;  1VRA B;  2QC8 A;  4DDG D;  2IO2 B;  2WX1 A;  4C7Y A;  1TKY A;  4ZRP A;  1IYF A;  4ANU A;  2JYT A;  1WRD B;  1HA5 A;  1BUI C;  3KUD B;  1WZ0 A;  3B2F A;  4A3P A;  2BYE A;  1D5Z C;  5FR3 A;  1IGC A;  2W3S A;  2B3A A;  2QHO A;  2RDH A;  2PTL A;  2FCN A;  1FIQ A;  4UDU C;  4ZRI A;  4EEW A;  4AJW A;  4W9D A;  4ZHP A;  3ABV B;  1SJE D;  2NPT A;  3KWL A;  2PIA A;  4PYZ A;  2N1W A;  4CO7 A;  3ML9 A;  5CHW A;  4ZOH C;  4C80 A;  4MM3 B;  4XWT A;  4E3C A;  1KRH A;  1XCT L;  3VTV A;  2GI9 A;  3ZNH B;  1FEH A;  1JQ4 A;  1SIF A;  3AE3 B;  2L1A A;  4HRO A;  3UIN B;  4AOF A;  1WYG A;  2OJW A;  1K52 A;  3AN1 A;  1TS4 A;  1TY0 A;  1DOX A;  3DDC B;  1LQB A;  2PE9 A;  3AE1 B;  2NTS A;  1KH0 A;  4M8N A;  2INN E;  3MHZ A;  1STE A;  3E9S A;  1EUV B;  1WE7 A;  4P6V F;  2LI5 A;  1HZ5 A;  3PLV A;  4B6W A;  2MX2 A;  4EZL A;  1L7Y A;  2FE8 A;  3MC9 A;  2C7H A;  3RCZ A;  3DHG C;  2I38 A;  3HRD D;  3N3K B;  5C23 A;  1WH3 A;  3DBR B;  1WXA A;  4GN1 A;  5AZF A;  1I4P A;  1UZX B;  2WXI A;  3H7P A;  2WNM A;  4EFO A;  1JCK B;  1UUP A;  1B9R A;  2KAN A;  2LVQ A;  2KX0 A;  4WWO A;  1MVK A;  2EKI A;  2M0X A;  4YL8 A;  4M8M A;  2NPT B;  2KDB A;  4IUM B;  1TYG B;  2GBK A;  4LLG M;  1SSN A;  4DDI D;  3Q2A C;  2A4Z A;  3TUO A;  2ZCC A;  3BYY B;  3Q69 A;  2REX A;  3LB8 C;  4NQL B;  2G45 B;  2LGD A;  4PT5 A;  2K8B A;  1V1P A;  1LGR A;  4P7I A;  1VDV A;  3RZW C;  2MWS B;  3DVG Y;  2GBM A;  2JRH A;  3CIR B;  3TSS A;  4FUL A;  3ZJT A;  4AUQ C;  3MC8 A;  4YXD B;  4KDL B;  1JWS D;  2KFJ A;  2L3Z A;  2Y5C A;  2AX5 A;  2KHW B;  3MP9 A;  2JXT A;  1KLU D;  1V80 A;  5T8I A;  1N62 A;  1J8C A;  2ZVO A;  3ZJU A;  3Q3O C;  1JRO A;  2KT7 A;  2MP2 A;  1GB4 A;  4DQO C;  3PSE B;  4GOC A;  5IO9 A;  3U7D A;  2BS4 B;  3LDZ E;  2DEN B;  4DWF A;  3IBE A;  3BVM A;  4J3O D;  1WIA A;  5J17 A;  5D3I B;  2IO1 B;  2NBW B;  5C2T B;  1I4R A;  1KFY B;  2MJ3 A;  3O65 B;  3VUY A;  3H7P B;  1MG8 A;  3UF8 A;  2A5U A;  3ZJV A;  4BOS C;  2V0G A;  2KOX A;  1WR1 A;  1V5O A;  4EOY A;  2K8H A;  1HTO A;  3Q8A A;  3QHT A;  2KQS A;  2J0K A;  1QQR A;  4GGQ A;  2JU6 X;  2DHZ A;  2FCQ A;  3DBR I;  1JW9 D;  4KKI A;  3H6N A;  2KQ4 X;  4GLS C;  1NBF C;  2J4X A;  2N7J A;  4A6Q A;  1I4Q A;  2QIE B;  2WXH A;  1FNU A;  4LNN A;  2XBB C;  3HIZ A;  3PHW B;  2XN9 C;  5EDS A;  5AZH A;  1IP9 A;  2LHD A;  2J7Q B;  3RD2 A;  3NG0 A;  3AE8 B;  1E9M A;  3KQ4 A;  2Z0D B;  2FAZ A;  2W55 A;  3LJ3 A;  4W9C A;  3P63 A;  2JF5 A;  5EE0 A;  3PLU A;  3NVY A;  3GE8 C;  2VH1 A;  2CU1 A;  3TMP B;  2R2Q A;  3RNB C;  1FNV A;  4EZK A;  1QF6 A;  2BB5 A;  2LEK A;  3S2A A;  3NUH B;  5L83 A;  3AV8 A;  3VR8 B;  2I1K A;  5JHA A;  4BKT A;  3N1X C;  5EE1 A;  4BBN F;  1U4A A;  4RF0 A;  3RT3 B;  2JQR B;  1WGD A;  2DLB A;  3SFE B;  4DHZ B;  1EU3 A;  2HTM E;  2KN5 A;  1ISN A;  3RYT A;  2DAF A;  3VFK A;  3K9P B;  1WI0 A;  3AE7 B;  3VXW A;  1T0R C;  3V6C B;  4TMA B;  3TEY A;  5GMV A;  1V81 A;  3EFC A;  5JH5 C;  4JWS C;  2QJL A;  3H7S A;  1F0Z A;  2KN4 A;  2RGF A;  3T3O A;  3BVG A;  4MGZ E;  1ZDV A;  2KFK B;  4IDI A;  2LZ6 A;  3ZXV A;  2BVC A;  2YLM A;  1UGM A;  1FXA A;  1RLF A;  1WJ6 A;  1E8W A;  4L2Y A;  3PO0 A;  2Y3A A;  1VLB A;  5AEK B;  3RFZ B;  3WCQ A;  4NJ7 A;  1LM8 B;  3E56 A;  1NYR A;  2BW2 A;  1GB1 A;  3N20 C;  4MGI E;  4KZC A;  2D10 A;  2INC C;  2KJH B;  1UWM A;  4FHJ A;  1JAL A;  1GUA B;  2L0T A;  1HXY D;  3UGB B;  2JYE A;  1UEL A;  1WYW B;  3GZN B;  1YNT E;  4GIV A;  1JML A;  4KVG B;  3KVF B;  4DHJ D;  1QIL A;  3HK0 A;  2LXC A;  4FLH A;  1JWU D;  3B2G A;  3OAW A;  1KTK A;  4K1R B;  3A4S C;  2N9K A;  2M56 B;  1NEK B;  3EFU A;  3Q6B A;  1L6U A;  1TY2 A;  3W5U B;  1L0Y B;  4HWI B;  2FBW B;  2PJH A;  4NAW A;  4KIK B;  3IT4 B;  2ZVN A;  3VH3 B;  1PGA A;  4RNA A;  2G1E A;  4OZA A;  1FD6 A;  4B95 A;  3CMM B;  2Z59 B;  1B1Z A;  3JVZ X;  5BMI A;  1EO6 A;  2BWE S;  2BWF A;  4Q2J A;  1CZP A;  3ZNZ B;  1FXI A;  2KK8 A;  1WXQ A;  2AWT A;  4LJO B;  4WJN A;  1WX9 A;  4MSM B;  2K6Q A;  1ESF A;  2D3G A;  1Q1O A;  1YIW A;  3JYU A;  3DVN V;  2DZM A;  3L08 A;  5EE3 A;  1TZO A;  3BII D;  1VD2 A;  4CHK A;  1JRU A;  1T5X D;  2KWD A;  4WJO A;  3RUL A;  4ARI A;  1V8C A;  3ZGZ A;  1SF0 A;  1R4M I;  2C60 A;  2XNA C;  2WGS A;  4LNO A;  1FCL A;  1E7U A;  2C7N B;  3T8M A;  1CMX B;  2AEH A;  3RUI B;  3BWU D;  3N9Y C;  3OJ4 B;  2M1M A;  2AYO B;  4DHJ B;  5JHB A;  2LHE A;  4OVU A;  2X8X X;  2DWQ A;  5CHV C;  4G11 A;  5IKC M;  1TKG A;  1SIJ A;  4NAW B;  1AYF A;  2LGS A;  2M17 A;  3LXF A;  2KTR A;  3AE9 B;  2KXJ A;  1C4P A;  2RDB C;  2RPV A;  3ZDM C;  1AAR A;  2NVU I;  4YTN B;  1QZE A;  2CHX A;  2ZCB A;  3NS1 A;  2WXJ A;  2IY0 B;  1P0R A;  4C56 C;  2M4N A;  3C19 A;  2CKH B;  4MH0 E;  4PK1 A;  1XQQ A;  3Q3J A;  2LGI A;  5JXV A;  3ZNG C;  3RNF C;  2RR9 A;  2IPK D;  1SGH A;  3AED B;  2IJ0 A;  2KC2 A;  2VZK D;  3SU8 X;  1V2Y A;  4A9A A;  4N58 A;  4TQ1 A;  3B08 A;  5G5H A;  3P4P B;  1VR9 A;  1RFA A;  2W54 A;  3M3J A;  1YN3 A;  1P98 A;  4CQN A;  1CQV A;  4MEM A;  4AWJ A;  2KWU B;  2WXM A;  3AE2 B;  1F2R I;  2K5P A;  3R3M A;  4TKN A;  1WGG A;  4IWO A;  2CHZ A;  2KAJ A;  2L76 A;  4IC7 B;  5AUI A;  1ACC A;  3Q14 C;  1WGH A;  4I6L B;  2JT4 B;  3IVF A;  1R4N I;  3O13 A;  4I6P A;  1WX7 A;  5DCN A;  4ZYS A;  2BKR B;  3UIP B;  4KSL C;  2KX3 A;  2MSE D;  1SXT A;  5IP4 D;  2EEL A;  4HPM B;  2QCZ A;  3KYD D;  4BKS D;  4MSQ B;  3NVV A;  3MTN B;  4BKS A;  2M8S A;  4RH6 A;  1JWB D;  3ZXR A;  2L32 A;  1T0Y A;  3N1Z C;  2WDR B;  1OTR B;  3PRE A;  2JWU A;  1DGJ A;  4W9J A;  1MG4 A;  2RD0 A;  2NBU A;  1UGJ A;  1WZ3 A;  2VZK B;  3V6E B;  3KH0 A;  1ZDX A;  1NI3 A;  1BML C;  1E5W A;  2K8C A;  2DYM A;  1EF5 A;  5L95 C;  1WJU A;  1VZ6 A;  2DX5 B;  1E6E B;  3DBL I;  3FC4 A;  2EMT A;  1WWT A;  3V62 A;  2VH2 A;  1ZGU B;  1Q0W B;  4DHZ E;  3OWE B;  2WXR A;  1A70 A;  3AU5 A;  1JWA D;  2E3T A;  1C4A A;  2MBO A;  1WRI A;  2JZP A;  5TSS A;  3IT6 B;  1ET6 A;  2DZK A;  1FNW A;  1TT5 B;  5H92 C;  2HJ8 A;  5BO4 B;  2WQY B;  4BKG A;  4EE2 A;  1QOF A;  3NZ3 A;  3KWV A;  1DYQ A;  3QIJ A;  4OZB A;  3H1U A;  1AWD A;  2QSD A;  1L0V B;  3NOB A;  1ZPS A;  1MHH E;  3AEE B;  5LXI B;  3HVZ A;  4G3X B;  2WS3 B;  1Q10 A;  3JSV A;  1PUT A;  1GPX A;  4PS8 A;  2WXQ A;  1Q5W B;  2ON8 A;  2KVR A;  4YSZ B;  4J6I A;  2J0M A;  2UYZ B;  3B1L X;  2FIF A;  2LUE A;  3OG5 A;  3FKY A;  1WY8 A;  4NAM A;  3IHP C;  4LTU A;  3A9K A;  4K81 A;  1YQ3 B;  2DYO A;  4IOI E;  4W9G A;  4BBN C;  4AJY B;  4JIO U;  1J7B A;  1SE9 A;  3I9V 1;  5IOI A;  1FFV A;  2BT6 A;  1YN5 A;  3I3T B;  1N61 A;  2L0F A;  3C8Y A;  3CF6 E;  1GC7 A;  4GDL A;  2FUH B;  3DHI C;  4GU2 A;  3Q3N C;  4K3B A;  3W1S C;  3QJZ A;  1UWX A;  5BYS A;  4HPL B;  2MHJ A;  3M63 B;  1PQS A;  3U30 A;  4E71 A;  4ASW C;  3QWZ B;  2HDE A;  3A4R A;  3SD5 A;  4KDI C;  4NY0 A;  4WAF A;  3PVL A;  1IUE A;  3JSV B;  4KX6 B;  3ZDT A;  1SE2 A;  2MCN B;  3I57 A;  1N5W A;  2JPH A;  4LNK A;  4R3D A;  4KV2 A;  3C0R B;  2KKC A;  2QEJ C;  3ZLZ A;  2IDY A;  3P4R B;  2IY1 B;  1WGR A;  2LRW A;  3ETR A;  2V3N A;  2L05 A;  2LMC A;  4IW0 A;  3A9K B;  1HEZ E;  1K51 A;  3AM9 A;  4RM9 A;  3ZTC A;  1V49 A;  3DQV A;  2M0A A;  1PGX A;  2BYF A;  1KF6 B;  2VRR B;  3IFW B;  2C7M B;  1N60 A;  2KO3 A;  1XLP A;  1MI0 A;  1YJI A;  3ALB A;  4ANX A;  1C3T A;  1PGB A;  4GDL B;  5KHO A;  2D2Q A;  3AXC A;  4WH4 A;  3AEB B;  3PRM B;  2ZW0 A;  3PV1 A;  5HFY A;  4IM3 A;  1NDD A;  1MJD A;  4FHK A;  5D94 A;  2BB6 A;  2CJN A;  5BMH A;  1ZP0 B;  1I42 A;  2HJ1 A;  4M0W A;  2FCS A;  2KFK A;  4HLE A;  1XF5 L;  4HCN B;  2MLB A;  1XD3 B;  1WXS A;  2KTF A;  2ZNV B;  4XZ4 A;  2FNJ B;  3AEC B;  2E6X A;  3VAW A;  1XT9 B;  2JWZ A;  1GG3 A;  3AEA B;  5H8Y E;  4MJS A;  3A9J A;  1KLG D;  3AI5 A;  3Q3F A;  3EUB 2;  1RWS A;  1UNS A;  2LAS A;  5BYQ A;  4A8X C;  1LFD A;  1WE6 A;  4N6E B;  3U7Z A;  4L1B A;  1OEY A;  3DBS A;  4HKZ E;  4NJC A;  3ZUN A;  1P3Q U;  2MH7 A;  2CS4 A;  1RAX A;  1C76 A;  1H4R A;  3QAQ A;  1FPY A;  3NVZ A;  3AB5 A;  3IXS A;  4S17 A;  2MJE A;  3BVZ A;  2GOW A;  2W82 A;  2GBR A;  1I35 A;  3D32 A;  2DNF A;  2FCM A;  1MFW A;  3VUX A;  4C7Z A;  3AE4 B;  2MEK A;  2HE7 A;  3KLS X;  1EWC A;  3QQ8 B;  3EEC A;  2KJ6 A;  1TIF A;  1WGY A;  4M0W B;  4WWN A;  3DWM A;  4KIK A;  2ZPY A;  1V5T A;  2W3R A;  3AE6 B;  1OQY A;  3W1Y A;  2WXL A;  3P2B A;  2LXA A;  3PS6 A;  4EKU A;  2LGY A;  1EU4 A;  3NZU A;  3APD A;  1ET9 A;  1R4M B;  3WIM A;  3WAM A;  2ICI A;  2KNB A;  1XCQ L;  2GLS A;  4CYE A;  2N9L A;  4FAD A;  5LNK 1;  4II2 B;  4ZDV A;  3PPA A;  4ICU A;  2V4I B;  4KSK C;  4KGS A;  3IG3 A;  2WXF A;  3A9J B;  4MJS B;  4XDC A;  3VRA B;  1BXT A;  4YSY B;  2R61 A;  3GB1 A;  3TBL D;  3ZRF A;  2C9W B;  3WA0 A;  1WXM A;  1TJE A;  4HDO A;  1YJJ A;  3PZ7 A;  3QA8 A;  3SR6 A;  2IYD B;  4MH8 A;  4ARC A;  1IPG A;  1PDX A;  3TCA A;  1Z2M A;  2PMV A;  4YWG G;  4W9F A;  2NBV B;  4QAY A;  1L6V A;  1MHX A;  1J7C A;  3AH7 A;  3ZW3 A;  3NS8 A;  1VJK A;  2V9H A;  5CX3 A;  4TUU A;  1PFD A;  2Z8L A;  2K22 A;  1JRP A;  2KAC A;  1TGZ B;  3URY A;  2KMM A;  1YN4 A;  2NS5 A;  4BZA A;  2RPQ A;  4N9F 4;  3ML8 A;  3MC0 B;  2FID A;  5CTR C;  1E7P B;  2H88 B;  1YJ1 A;  4FBJ B;  4USA A;  2K0P A;  1T6B X;  1N63 A;  1DOY A;  1ZKH A;  1P1A A;  2C5L C;  1TKE A;  2WXO A;  2WXP A;  1V6E A;  2ZPN A;  2D11 A;  4K7W A;  4IWQ A;  4MAC A;  4LDT D;  5DPS A;  2K39 A;  3RNG C;  1XLQ A;  1YQ4 B;  1NEN B;  1ZOY B;  4I6N B;  1R4N B;  3DVG X;  5C3J B;  1S1Q B;  1E8Y A;  4ZRJ A;  3HVD A;  2TSS A;  5HHD G;  4AP4 C;  2J0J A;  1ZUD 2;  4WQM A;  2AQ1 B;  2QMT A;  3RN9 C;  2Y5P A;  1UH6 A;  2N7E A;  4WWP A;  4A3O A;  2X38 A;  3TIX A;  1C78 A;  4MT5 A;  2RMM A;  2CR5 A;  2L83 A;  3GS2 A;  4EUT A;  3K9O B;  1F77 A;  4FJZ A;  2MBE A;  2WXN A;  4XE0 A;  3PT2 B;  4BFR A;  4ZYN A;  3DVN U;  2IGG A;  2LD9 A;  3Q8C A;  2KDF B;  3UQB A;  1X1M A;  2ZZP B;  1HE8 A;  2G9H D;  1YMH E;  2PE6 B;  4F1S A;  1GJZ A;  3QCA A;  3DBL B;  3MHS D;  5BYR A;  4H2A A;  4KZ0 A;  3ZQ4 A;  2Y5B B;  3UIO B;  2MBH A;  5DPW A;  1G6J A;  2BS2 B;  2H89 B;  3L0W B;  2BKF A;  4HRS A;  2SEB D;  2KVZ A;  2DYB A;  1Y56 A;  3W2D A;  4LDT B;  2CJO A;  3RNE C;  4C00 A;  3WAN A;  3HHM A;  2EKE C;  2BGF A;  2ZEQ A;  1XLO A;  3ZO5 B;  4YSX B;  5IN7 A;  3EA6 A;  3QC8 B;  1M94 A;  5KHQ A;  1V1O A;  4XYC A;  1WMH A;  3NRZ A;  2WP9 B;  1OQR A;  2JRI B;  4RCO A;  5E6P A;  3RNA C;  2J42 A;  2LJ5 A;  3RMK C;  5G55 A;  2NR2 A;  2O2V A;  1FM0 D;  2ASQ A;  3L16 A;  3OLM D;  4P16 A;  1D6E C;  3RI7 C;  1EF1 A;  2MW5 A;  4US8 A;  4W9K A;  2Q5W D;  1SEB D;  4NJ6 A;  3WAP A;  5LXH A;  3FAH A;  2KLC A;  3L17 A;  4ACF A;  1T0Q C;  2LJI A;  1HQR D;  5D2M B;  1UBI A;  1KM7 A;  2G4D B;  2K25 A;  4WUR A;  1L4Z B;  3VHT C;  3R7Q A;  3R2T A;  4II3 B;  4M01 A; 
#chains in the Genus database with same CATH homology
 4BZA A;  2X8X X;  2QDF A;  2QCZ A;  4C00 A;  4K3C A;  4QAY A;  4C4V B;  4C4V A;  3EFC A;  3Q6B A;  4PK1 A;  3NJT A;  4K3B A;  2V9H A;  2VH1 A;  2MHJ A;  4XGA B;  2VH2 A;  3MC9 A;  3MC8 A;  3OG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...