3OG5A

Crystal structure of bama potra45 tandem
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
160
structure length
160
Chain Sequence
b'AMDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Outer membrane protein assembly complex, YaeT protein
publication title Structure and Flexibility of the Complete Periplasmic Domain of BamA: The Protein Insertion Machine of the Outer Membrane
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding
total genus 46
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07244 POTRA Surface antigen variable number repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 3og5A01
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 3og5A02
4K3CA 3MC8A 2MHJA 3NJTA 3Q6BA 4C4VB 3MC9A 4XGAB 4C4VA 4C00A 2X8XX 4BZAA 3EFCA 2QDFA 4QAYA 2VH2A 3OG5A 2QCZA 4K3BA 4PK1A 2V9HA 2VH1A
chains in the Genus database with same CATH superfamily
2R2OA 4FBJB 1K53A 1QZEA 3SHQA 2MW5A 4F1SA 4MM3A 4RF0A 1XT9B 4W9HA 4JE3B 3RN9C 1QQRA 3Q2AC 3GOEA 1C79A 1E8WA 1HZ5A 2KJHB 1CQVA 2LVPA 1TZ1A 2L0TA 3DHHC 2KQ4X 1IGDA 3AE5B 2B3AA 2I1KA 3D32A 4RF1A 5BO4B 2BBCA 2SEBD 1QT9A 4JWSC 3R3MA 2Y5BB 4C4VB 3AU4A 1UUPA 1UGJA 1TY0A 1ZDVA 3PPAA 3BY4B 1ZGUB 3L0WB 1ET6A 4YTPB 3SR6A 3SFEB 2WDQB 4AQ7A 4KSKC 4GLSC 2AQ1B 3EHVA 5HG2A 3FAHA 3KH0A 4WJNA 4LNFA 3B2FA 2W3RA 2ZCBA 3AI5A 2XK5B 1WI0A 4D2KA 4OVVA 3B08A 2G3QB 2YVCA 4DXFA 1P9DU 1I42A 3W1YA 2HDEA 3BWUD 4YTNB 4EFOA 4LJOB 2JSVX 4LNIA 2DAFA 3ZNID 3K9PB 1DYQA 3DVGX 4KGRA 1WYWB 2BVCA 2E3TA 3ZO5B 2AWTA 4IUMB 5GXGB 5LNK1 1WE6A 3QJZA 3VH3B 3HVZA 5EE1A 3Q8BA 1SXTA 2C7NB 1YJ1A 2FBWB 1HZ6A 1I4PA 1Y8RC 5IA7A 1J19A 2WXFA 3TBLD 5E6JA 4P1CC 3T3OA 3Q3FA 3KUDB 4K7WA 1ZE3D 4TMAB 2VRRB 2ZVNA 2K6DB 4G11A 4YSXB 3DBHB 4K3CA 4WIPA 4W9IA 3VTWA 3DBLI 2JT4B 2D07B 4DHZE 2M17A 1WXQA 4WWPA 2LXCA 2V0GA 4FHKA 3Q3MC 5C1ZA 3RT3B 4YT0B 1PGAA 1JWSD 1QOBA 2RGFA 3PLUA 5L83A 1SE3A 5DPWA 2WHIA 3AE7B 1YN5A 4P16A 4ZYNA 2BYTA 2FCSA 2K0PA 1SF0A 4HK2A 3DCGA 3W2DA 4KSLC 3DWGC 1WFYA 2IGGA 3UGBB 2FE8A 2CS4A 2QDFA 3H7SA 4NJ6A 2KAJA 1UNSA 1UD7A 3JSVA 1JWAD 4W9FA 3ML9A 4NZLB 2JYTA 3ZXRA 3Q8FA 1YJJA 4US8A 3MFGA 3AMZA 4NAMA 1YIWA 1X1MA 3FILB 1T0RC 1JQ4A 2BB5A 1WMHB 3TUOA 3PHXB 3IBEA 2N9PC 4W9GA 1I4XA 2N9LA 1V5TA 1VZ8A 1FNUA 2KWUB 2EELA 4OZCA 5G5GA 1E0ZA 2WP9B 4YL8A 3ZIMA 2M0XA 3AEGB 1G6JA 2DYBA 3AH7A 3VR9B 4DK5A 1PDXA 3QCAA 1MFWA 4LNOA 4FA6A 3FKYA 1J8CA 1XQQA 2WXQA 2CHWA 3U52E 5H8YE 1F52A 4GXBA 1YJIA 3RNBC 2I1JA 5AZGA 1YX5B 1RRBA 1L5PA 1PUTA 3UQAA 3U2SC 1N60A 4ZHPA 1V1PB 3L10B 2MJDA 1FRRA 2LJIA 2MH7A 4NY0A 4H2AA 4II2B 1SIJA 1IBXA 2MBEA 1WM2A 3HUIA 1FRDA 2JXXA 1WRDB 5HI1A 4CHKA 2LVOA 2L1AA 4NPNA 2G4SA 1I4GA 3CSTA 4Q2JA 3TL5A 4P1BC 3HHMA 1MHXA 5DPRA 4XDCA 3I5JC 4WQOB 2DX5B 2L7RA 2CHXA 5EDSA 1C4CA 5BYQA 3T3NA 1CMXB 1KJTA 1XO3A 2K25A 1F2RC 3P4SB 3CWIA 2M19A 1LGRA 2MX2A 4DQOC 1SIFA 2PPHA 1RWSA 4GSWA 4CQNA 4HPLB 5E6OA 3AE1B 5E6NA 3RYTA 2KDMA 4GGQA 1VCBA 3PO0A 3WIMA 3BVZA 4LJPB 3IT6B 3W5UB 1A70A 1EWYC 2ZNVB 2KD0A 4MH0E 1FMAD 2WXGA 4HROA 2FCNA 3ZNGC 3KUZA 1AARA 2MWSB 1VD2A 3WA0A 4GMVA 2NPTA 1KH0A 4HPPA 1ET9A 4TQ1A 4RGOS 2PLPA 2WXPA 3ZW3A 1YN3A 3ZUNA 2KACA 2RDBC 2NS5A 3A9JA 3NY5A 4XZ4A 3NS1A 1OTRB 3QHTA 2BYVE 4ZHOA 1KOTA 1WJ4A 2NBUA 2V1YA 3P4QB 3DVGY 5AUKA 1SE4A 2Y5PA 3EFUA 1V49A 1T0YA 1TGZB 1S3SG 5CHFA 2VZKD 2K1FA 2I2YA 3PZDA 4FJYA 1N6ZA 4ZRQA 1XD3B 3J9CA 3V3XA 3V6EB 1JCKB 2M1MA 1T3QA 2QC8A 1WR6E 3BIID 5AEKB 1MG8A 3ONSA 4DHZB 2KMMA 2KOXA 3ZTDA 3ZJUA 4DXAB 2PVOD 5IKCM 1R4MB 1L7YA 3R8BA 2K3UA 5HKHA 2Z0DB 3MJ5A 1AWDA 3E56A 3AV8A 5FKAC 1VZ6A 4W9CA 4WJOA 5AUIA 5IO9A 2K22A 1KFYB 1YNTE 3KQ4A 4JLCA 1WGYA 4E71A 3EUB2 5LXHA 2WXOA 2WXNA 3WAMA 3CSFA 4CYEA 1L6VA 2SAKA 5FK9C 4GDKB 1FO4A 4ARCA 1FNVA 2WS3B 1UBQA 2J0MA 2NTTA 2RDGA 1RFKA 3PGEA 4YXDB 1WYGA 3UIPB 1SJHD 3VXWA 1R4NB 3WALA 2Z0EB 1J7BA 2Y3AA 5JXVA 3ML8A 4IOIE 2K39A 1ZKHA 1I35A 1RYJA 2CU1A 2N9EB 2QEJC 1SJED 2K6QA 4A90A 1SBBB 1OFFA 4HCNB 3AEDB 2HTME 4S0RA 2ZCCA 1P3QU 2PJHA 2KNBA 1H8CA 5E6PA 1IPGA 2OOBB 2V3NA 2NBWB 2N9KA 2ONQA 2ZEQA 2X8XX 1BUIC 4A3OA 4YSYB 1YQBA 2DYMA 3SDLC 2L83A 3DBSA 2MA9B 2XN9C 2MQJA 1VZ7A 4JPSA 2G1EA 1Q10A 1IP9A 2O6VA 3B9JA 2KT7A 1AW7A 4L23A 2L05A 2HE7A 2EMTA 5TR5A 3U8ZA 1WJ6A 2L00B 2WXKA 3MTNB 3OJ3A 2OEDA 4BZAA 4FJVB 1C3TA 3URYA 2C5LC 5DCNA 3MHSD 3QAQA 3WAOA 3EC8A 1ROEA 2M56B 2G9HD 1C4PA 3N9YC 1GPXA 5IOIA 3BK1A 2A5UA 4GIVA 4R3DA 3SFDB 4IW0A 2AL6A 3I63C 3BYTB 4MGIE 3ZRFA 1SB3C 4AUQC 4J3OD 1JWBD 1V81A 2WDRB 2J52A 2DBYA 2NBVB 3R7RA 3M3JA 2MP2B 3JVZX 4OVUA 2MBQA 5JHBA 4PYUA 3W5VB 1TIFA 4OVZA 4A9AA 5FR6A 2BPSA 1DOIA 4NNJB 1XLOA 1SE2A 4BOZB 3GS2A 4HWIB 2PW9A 2WX1A 2J0KA 1EU4A 2A4ZA 4W9JA 2WX0A 3H7PB 2QMTA 1P98A 4GU2A 4FLHA 1UZXB 2FUG1 3N20C 4KKIA 2FAZA 5H92C 1GB4A 2D3BA 1WGGA 4HDOA 4W9EA 5C23A 3PT2B 4AP4C 3ZJVA 4MGYE 1LFDA 2IO2B 3FC4A 3VUXA 1QILA 1FPYA 3VVWB 2LEKA 3TSSA 2UWQA 2IGDA 2ZJDA 3P4PB 3VDZA 4IC7B 1NVID 2OHFA 4WAAA 3DBRB 3MP9A 4MELA 4MACA 1FIQA 3AEEB 3ZNHB 1MVKA 2KTRA 2LRUA 4L2YA 1WRIA 4K7SA 3O65B 1UBIA 4KZ0A 2GBRA 2JWUA 2WXLA 1L4DB 3R66C 1KRHA 2NR2A 3V62A 3N1XC 1PFDA 1P7EA 4BKGA 2QJLA 1HE8A 4LK0M 3A4RA 1MHHE 1FXAA 2LUEA 3PZ7A 4MSQB 2BS2B 2IJ0A 4G50A 4ZOHC 2KZRA 4HJKA 3TMPB 1TS2A 1E90A 1WY8A 4PK1A 3B1LX 4NAWB 2WDVB 3MHZA 3P1MA 3A1QB 1TKEA 2NVUI 1VDVA 2CKHB 1EWCA 3AE8B 2DZJA 3OJ4B 2BTEA 2GBNA 3GE3C 2KN5A 3LJ3A 2JU6X 3W1SA 1NI3A 2KLCA 2INNE 4GOCA 1GC7A 4DDID 4E3CA 3AU5A 3NZSA 1NYQA 2KMAA 2V3PA 3T9LA 3KVFB 2LFIA 3NZ3A 2KN4A 1M4VA 3N32A 4NQLB 2L32A 2YEPB 1VRAB 1ZPSA 3VRAB 1KLGD 1P0RA 1ZOYB 2WWZA 2N4FA 4ZRKA 4EZJA 3LYYA 3U7ZA 2W54A 3M62B 2D2QA 4K7UA 1Q1OA 3B2GA 3APFA 2RSUA 4KIKB 4NJ7A 1Q0WB 3L16A 1CJEA 2Q5WD 3MC8A 1T0SC 4MJSB 2CHZA 1JWMD 1C78A 4RH6A 2O2VA 3EECA 1RAXA 3KYCD 1XLPA 3KUCB 4OZBA 4ICVA 4MT5A 4KX6B 3ZDMC 3NOBA 1C77A 2IO1B 4REZA 4DWFA 2KDEB 1D3ZA 2WU5B 5D94A 4A8XC 3ZGZA 2J0JA 2XNAC 5D3DA 5J18A 1QKZA 2GMIC 2MEKA 1TKYA 4MM3B 4HKQA 3NVYA 2L52A 4A20A 1RFAA 2C9WB 2AQ3B 1YD8U 1NEKB 5TSSA 2FIDA 1WZ0A 4N59A 3P42A 2LZ6A 2CU3A 4WH4A 3VQIA 4C80A 1STEA 2IO0B 4BAXA 2Z59B 1WGKA 3Q8CA 3NJTA 1WZ3A 4WAFA 3RNGC 1UWMA 1NYRA 2QIEB 3IAS1 4ACFA 3BVMA 1TJEA 1K51A 3C8YA 4I6NB 2GBMA 4IM3A 1RM6C 3VUYA 4IWPA 2EKEC 2DLBA 4FXCA 2YEPF 3AECB 2BB6A 1N62A 3Q8EA 2UU7A 1D5XC 3SD5A 1EM7A 2KTFA 3ETRA 1IUEA 4HLEA 2NCNA 1XF5L 1I4QA 3QIJA 4WURA 3E9SA 1JW9D 3GP7A 1GC6A 3VFKA 2JUOA 2IPKD 2N9XA 4X57B 3IXSA 4MSMB 1UGMA 2TSSA 4HXDA 1MPEA 1U4AA 4WWOA 3APDA 2JRHA 3PS6A 4BVUC 3Q3NC 4GDKA 4B0EA 4KDIC 4ANVA 4ANWA 4RCOA 5BMIA 4BFRA 3ZNZB 2JZPA 1GUAB 3DWMA 2BWFA 1DOYA 1AYFA 1OEYJ 1PGBA 2DZKA 4XX5A 4A3PA 2L76A 1ENFA 2LXAA 3NVZA 4RM9A 3RZFA 1IYFA 1F1HA 2KLGA 4P7IA 1Y56A 1DGJA 1WXAA 3UI3A 1JALA 4O1NA 2M8SA 3PRZA 2VH1A 4TKNA 4DBGA 1ISNA 4M0WB 3AEBB 1RLFA 1N63A 2JWZA 2D3GA 2GRIA 3Q3OC 1I4HA 4WJQA 2LGDA 4M02A 4ITKA 5T8IA 1C1YB 3JSVB 2QCZA 1E9MA 1TS5A 2UYZB 4B9KA 2MRPA 4RM8A 4N58A 1L0YB 1WR1A 3RFZB 1L0XB 2G4DB 4B95A 2M0AA 3NZUA 2I38A 4HJGE 3RNCC 1XLQA 3A4SC 4C00A 1JROA 5AZFA 3PVLA 1QLBB 4M01A 2WGSA 4JL9A 3S2AA 3N30A 1V97A 1V2YA 2LJ5A 3AULA 4B0MA 4XC2A 3GZNI 2MJ3A 4EZLA 1K52A 2AQ2B 4JX1C 4AWJA 2V9HA 4PT5A 1TT5B 3CIRB 2JZZA 2KFKB 1ZP0B 3OAWA 2AL3A 2DENB 1J7AA 4KDLB 1BMLC 1L6UA 3PTFC 2VH2A 4K1RB 1YQ4B 1YOVB 1WGHA 2LGXA 3GB1A 2BQQA 4DXGA 4AJWA 1D5ZC 2JYEA 1HA5A 4JGHB 2PE9A 4ANUA 1ACCA 2MP2A 2REXA 2MSED 1BXTA 1WJNA 3APCA 4IDIA 1S1QB 1IBXB 3HVDA 1KLUD 2WXHA 1N61A 1WXVA 3NS8A 2GB1A 2AX5A 2KDBA 2PE6B 4TSSA 1QOFA 1FEHA 2KYWA 1GJZA 2K9XA 3LB8C 3RNFC 2M4NA 3QK0A 4II3B 2WDTB 1F77A 1YX6B 3UIOB 5EE0A 4KGTA 3AE2B 4OW0A 1HTOA 1TY2A 4FJZA 5CHVC 4M00A 4RGNA 5MPOA 4HEA1 3B0AA 3RULA 1LQBA 3ZDTA 3Q69A 3AEAB 3W9CB 1E6EB 4HPMB 1WX8A 1JRUA 3OLMD 3GE8C 1WSPA 4KGSA 1NBFC 1PYWD 2DZMA 2BYEA 4XWTA 2NPTB 2KVRA 1P1AA 4BBNC 4C4VA 3O13A 2D5GA 2LRWA 1FM0D 2H88B 2L3ZA 3W1SC 2KWCA 1HXYD 4RGMA 3A9JB 1ZXIA 1FXIA 2E6XA 4M8MA 1BT0A 2JRIB 1YQ3B 1I4RA 3DHIC 1LXDA 1UWXA 2D10A 2XK5A 5CTRC 2OJWA 2DAJA 2J42A 4UDUC 5J17A 4MGZE 1UF0A 3QQ8B 4IWOA 4AOFA 2KQSA 4PS8A 3L13A 3BK2A 3QARA 1EO6A 3ZVVA 4P6VF 2ASQA 3X23A 3A1QA 2WYQA 2MCNB 1NI2A 2ZZPB 1V80A 2NTSA 1UELA 4KV2A 1V86A 1KTKA 3NUHB 4HVBA 3SEBA 1P7FA 2BW2A 3IT4B 1WH3A 4S17A 5LLIA 3PREA 5HFYA 2BT6A 4YWGG 2PMVA 4JWUC 1FFVA 2MBHA 3DBRI 1QF6A 3BYYB 2PVGC 4EEWA 1H4RA 1Q5WB 2J7QB 3ZQ4A 4RNAA 1ESFA 1L2NA 2KX3A 3A9KB 1I7HA 2NMQA 1PGXA 2KK8A 3NRZA 2N7EA 1CK1A 2V4LA 3TCAA 4EE2A 2LMCA 3HRDD 2WXRA 4K3BA 4GDLB 5D2MB 4C7YA 1L0VB 4AJYB 4URKA 2PIAA 5BYSA 2KANA 3TEWA 2MLBA 2LGSA 2LASA 3ECIA 1WE7A 3RUIB 1T0QC 1MI0A 1DOXA 1XLNA 3UINB 1GAQB 4N6EB 2ZW1A 1TS4A 3KYDD 4PS3A 4PS7A 3H9DA 1V1OA 1HTQA 3PLVA 1AN8A 4IM0A 1Z2MA 2YLMA 2DZIA 1N5WA 3NG0A 2INPE 3Q3JA 1B1ZA 2FNJB 2LWPA 2IO3B 3RPFC 5DPTA 3KW5B 3FILA 3ZXVA 4RFBA 1WXSA 3TEXA 3AEFB 1WMHA 2AYOB 4MH8A 1ZUD2 4KVGB 3PZ8A 2O6VB 2IGHA 3V61A 3ZLZA 3DBHI 4DHJB 1F0ZA 2N1WA 5G2NA 2KX0A 1XCTL 4JIOU 4LDTB 5JHAA 1WF9A 1C4AA 3ZKJC 1CZPA 1TZOA 2WXJA 3DDCB 2KC2A 4ZRIA 1E7PB 2KDIA 4I6LB 2KVZA 2IBIB 4C7ZA 2RPVA 1SGHA 3EA6A 3I57A 4W9LA 2KDFB 5IP4D 1E7VA 4YTMB 3BVGA 3HK0A 1XXGA 3ABVB 4ARIA 2MJEA 3TJPA 1WGDA 4XE0A 1V1PA 1C9FA 3C19A 1TTNA 4FULA 3AE3B 4RMAA 4FHJA 1WGRA 1WX7A 3DPDA 3L54A 2AEHA 2X38A 3IHPC 2GLSA 2KJ6A 2JX5A 5J2RA 1R7SA 2RR9A 1PQSA 2J4XA 4IKGA 4LTUA 5JZEB 5L95C 3DOWA 2IY1B 3M95A 4NJCA 1VJKA 2N1VA 1ZDXA 4AS1A 3Q14C 2OJRA 4W9KA 4E74A 2EMSA 4LNNA 4FN2A 5DPSA 2Y5CA 1E8YA 5BYRA 2D3AA 2C7HA 1E7UA 1OEYA 2WNMA 2FCMA 4EUTA 1GB1A 2LD9A 2W55A 1WX9A 1TKGA 1XEEA 1GG3A 3NVWA 3EGRA 3AE9B 4KKJA 3Q6BA 4M0WA 3RMKC 4NQKE 5G5HA 3UF8A 3N1YC 5AZHA 1HEZE 2QHOA 4ZRJA 2BKFA 2PKOA 2LHDA 3ZJTA 2CR5A 4EZKA 1JWUD 2KTRB 4I6PA 3DBLB 5LXIB 3VRBB 2ZVOA 2PTLA 4MDKE 1WIAA 2BGFA 2RDHA 5GMVA 2WU2B 4LLGM 4OHJA 3IVFA 3R2IA 1FCLA 3PV1A 2H89B 3EFCA 3V05A 1TYGB 1SEBD 1LM8B 4N9F4 2WXMA 2JXTA 5D7GA 4HCPB 2KFKA 5D6JB 1J7CA 3QA8A 1IGCA 2RPQA 4QAYA 4TQ0A 2RMMA 2BS3B 3OG5A 3JW0X 2KWDA 4WJPA 1EF1A 4IM2A 1E8XA 2JQRB 5IAAC 1OGWA 3TIXA 2W82A 2K5PA 1FNWA 1B9RA 4JQWC 3RCZA 3IG3A 1GNUA 5HHDG 5BMHA 3N3KB 4W9DA 3RNAC 2KO3A 3MC9A 1OQQA 3PHWB 2LI5A 3L08A 3ZRCA 2LGYA 3RZWC 3DHGC 1E8ZA 2CJNA 3ZYYX 5G55A 3JYUA 4ASWC 1TBEA 2BWES 1QOGA 2KXJA 4L1BA 1KLVA 3ALBA 1FFUA 1E10A 2N7DA 4KZCA 2HD5B 1L4ZB 2KKCA 3R7QA 1TS3A 4MGKE 1K8RB 3TEYA 1HQRD 3VR8B 3VH4B 4ICUA 3H8HA 2R2QA 2MHJA 3DQVA 4F7ZA 2BYFA 4WWMA 3TEZA 3HM6X 2O2VB 2MBOA 3WCQA 3AB5A 2XEWA 2MBBB 5I4DA 2V4IB 1NDDA 3P63A 1GOZA 4M8NA 2WXIA 1R4MI 2HJ1A 2LVQA 4G0NB 3UQBA 2WQYB 3IFWB 2XBBC 4OZAA 4C56C 2ON8A 1FD6A 3AN1A 3P2BA 2GBKA 1KF6B 1C76A 1T5XD 3X0WA 4A6QA 1NENB 3L4PA 2INDC 3V60A 3PRPB 1V9JA 3V6CB 2L8JA 4TUUA 2RD0A 4G3XB 1MJDA 4HDQA 1MG4A 1FXTB 3RNEC 2C7MB 2QSDA 4WWNA 3T8MA 4BBNF 4ANXA 3DVNU 1R4NI 5BMGA 1EF5A 3U4EG 4IG7B 2FIFA 4YSZB 2R61A 3A33B 4FADA 3LDZE 2B76B 3OWEB 4ZDVA 1E5WA 1ZW7A 2D3CA 1D6EC 3QX1A 5EE9A 2KWVB 1OQRA 1VR9A 2L0FA 3SU8X 2IZVB 4DDGD 3PRMB 1XCQL 1JRPA 3DVNV 1LO5D 4HRSA 5KHOA 3U7DA 3M63B 4XDDA 4HKZE 1M94A 3I9V1 1OQYA 2W9NA 2JZ3B 4US9A 5FR3A 4XWWA 2KMCA 2IDYA 4ZYSA 3A9KA 3AE6B 3MJWA 1T6BX 4WQMA 3H7PA 4BKTA 5CX3A 1JMLA 2KHWB 3BINA 1VLBA 3HIZA 3GZNB 1D4BA 2G45B 4GDLA 5JH5C 2JPHA 2DHZA 1WXMA 3LXFA 3CMMB 1YMHE 4F8CB 4ZRPA 2ACZB 2O6VD 1EU3A 1D5MC 2KC1A 3H1UA 3ZTCA 1V6EA 2IY0B 4DHJD 2N0SB 3U30A 4PYZA 2GBJA 3KWLA 5C2TB 2ZPNA 3KWVA 1FCCC 3HM3A 4BKSD 1A5RA 4LDTD 2K8HA 1F9JA 3ENEA 4J6IA 2DNFA 3K9OB 4XGAB 3AXCA 1J0GA 4GB9A 3VHTC 3IAM1 3QC8B 5D3IB 5IN7A 2INCC 2GI9A 2KJRA 4LNKA 2KFJA 5EE3A 2C60A 2BF8B 2KQ7A 4XYCA 3VAWA 2JVCA 1UH6A 3NHEB 1SE9A 3AM9A 4MEMA 2JF5A 3C0RB 3KLSX 3N1ZC 2K8BA 2DWQA 1V5OA 4BKSA 3MC0B 4GN1A 2EKIA 1N5XA 3RI7C 4RGTA 3VTUA 4NAWA 1YN4A 2HJ8A 1WJUA 2FCQA 2LUMA 1WM3A 4TV3A 2HTHA 2IYDB 1Z5SB 2LHEA 1QOAA 1WWTA 3CF6E 4A55A 3VTVA 3PSEB 3H6NA 2GOWA 1EUVB 4LCDE 2BKRB 3P4RB 3L17A 2VZKB 4EOYA 2ZNVC 2K8CA 4BOSC 2DYOA 5CHWA 3Q8AA 1K50A 5KHQA 2PEAA 2LGIA 2ZPYA 3NVVA 4EKUA 3WANA 3BZDB 2J53A 2BS4B 4USAA 1KM7A 2W3SA 4IWQA 1F2RI 2N7JA 3WAPA 4KIKA 4CO7A 2FUHB 3AE4B 2ZW0A 3I3TB 2WLBA 3R2TA 2JY6A 2CJOA 4MJSA 2Z8LA 1SSNA 2D11A 2V3SA 1ZXHA 4K81A 3RD2A 5C3JB 3QWZB 2ICIA 1V8CA 4B6WA 3VUWA 2QILA
chains in the Genus database with same CATH topology
4K3CA 3MC8A 2MHJA 3NJTA 3Q6BA 4C4VB 3MC9A 4XGAB 4C4VA 4C00A 2X8XX 4BZAA 3EFCA 2QDFA 4QAYA 2VH2A 3OG5A 2QCZA 4K3BA 4PK1A 2V9HA 2VH1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K3C A;  3MC8 A;  2MHJ A;  3NJT A;  3Q6B A;  4C4V B;  3MC9 A;  4XGA B;  4C4V A;  4C00 A;  2X8X X;  4BZA A;  3EFC A;  2QDF A;  4QAY A;  2VH2 A;  3OG5 A;  2QCZ A;  4K3B A;  4PK1 A;  2V9H A;  2VH1 A; 
#chains in the Genus database with same CATH topology
 2R2O A;  4FBJ B;  1K53 A;  1QZE A;  3SHQ A;  2MW5 A;  4F1S A;  4MM3 A;  4RF0 A;  1XT9 B;  4W9H A;  4JE3 B;  3RN9 C;  1QQR A;  3Q2A C;  3GOE A;  1C79 A;  1E8W A;  1HZ5 A;  2KJH B;  1CQV A;  2LVP A;  1TZ1 A;  2L0T A;  3DHH C;  2KQ4 X;  1IGD A;  3AE5 B;  2B3A A;  2I1K A;  3D32 A;  4RF1 A;  5BO4 B;  2BBC A;  2SEB D;  1QT9 A;  4JWS C;  3R3M A;  2Y5B B;  4C4V B;  3AU4 A;  1UUP A;  1UGJ A;  1TY0 A;  1ZDV A;  3PPA A;  3BY4 B;  1ZGU B;  3L0W B;  1ET6 A;  4YTP B;  3SR6 A;  3SFE B;  2WDQ B;  4AQ7 A;  4KSK C;  4GLS C;  2AQ1 B;  3EHV A;  5HG2 A;  3FAH A;  3KH0 A;  4WJN A;  4LNF A;  3B2F A;  2W3R A;  2ZCB A;  3AI5 A;  2XK5 B;  1WI0 A;  4D2K A;  4OVV A;  3B08 A;  2G3Q B;  2YVC A;  4DXF A;  1P9D U;  1I42 A;  3W1Y A;  2HDE A;  3BWU D;  4YTN B;  4EFO A;  4LJO B;  2JSV X;  4LNI A;  2DAF A;  3ZNI D;  3K9P B;  1DYQ A;  3DVG X;  4KGR A;  1WYW B;  2BVC A;  2E3T A;  3ZO5 B;  2AWT A;  4IUM B;  5GXG B;  5LNK 1;  1WE6 A;  3QJZ A;  3VH3 B;  3HVZ A;  5EE1 A;  3Q8B A;  1SXT A;  2C7N B;  1YJ1 A;  2FBW B;  1HZ6 A;  1I4P A;  1Y8R C;  5IA7 A;  1J19 A;  2WXF A;  3TBL D;  5E6J A;  4P1C C;  3T3O A;  3Q3F A;  3KUD B;  4K7W A;  1ZE3 D;  4TMA B;  2VRR B;  2ZVN A;  2K6D B;  4G11 A;  4YSX B;  3DBH B;  4K3C A;  4WIP A;  4W9I A;  3VTW A;  3DBL I;  2JT4 B;  2D07 B;  4DHZ E;  2M17 A;  1WXQ A;  4WWP A;  2LXC A;  2V0G A;  4FHK A;  3Q3M C;  5C1Z A;  3RT3 B;  4YT0 B;  1PGA A;  1JWS D;  1QOB A;  2RGF A;  3PLU A;  5L83 A;  1SE3 A;  5DPW A;  2WHI A;  3AE7 B;  1YN5 A;  4P16 A;  4ZYN A;  2BYT A;  2FCS A;  2K0P A;  1SF0 A;  4HK2 A;  3DCG A;  3W2D A;  4KSL C;  3DWG C;  1WFY A;  2IGG A;  3UGB B;  2FE8 A;  2CS4 A;  2QDF A;  3H7S A;  4NJ6 A;  2KAJ A;  1UNS A;  1UD7 A;  3JSV A;  1JWA D;  4W9F A;  3ML9 A;  4NZL B;  2JYT A;  3ZXR A;  3Q8F A;  1YJJ A;  4US8 A;  3MFG A;  3AMZ A;  4NAM A;  1YIW A;  1X1M A;  3FIL B;  1T0R C;  1JQ4 A;  2BB5 A;  1WMH B;  3TUO A;  3PHX B;  3IBE A;  2N9P C;  4W9G A;  1I4X A;  2N9L A;  1V5T A;  1VZ8 A;  1FNU A;  2KWU B;  2EEL A;  4OZC A;  5G5G A;  1E0Z A;  2WP9 B;  4YL8 A;  3ZIM A;  2M0X A;  3AEG B;  1G6J A;  2DYB A;  3AH7 A;  3VR9 B;  4DK5 A;  1PDX A;  3QCA A;  1MFW A;  4LNO A;  4FA6 A;  3FKY A;  1J8C A;  1XQQ A;  2WXQ A;  2CHW A;  3U52 E;  5H8Y E;  1F52 A;  4GXB A;  1YJI A;  3RNB C;  2I1J A;  5AZG A;  1YX5 B;  1RRB A;  1L5P A;  1PUT A;  3UQA A;  3U2S C;  1N60 A;  4ZHP A;  1V1P B;  3L10 B;  2MJD A;  1FRR A;  2LJI A;  2MH7 A;  4NY0 A;  4H2A A;  4II2 B;  1SIJ A;  1IBX A;  2MBE A;  1WM2 A;  3HUI A;  1FRD A;  2JXX A;  1WRD B;  5HI1 A;  4CHK A;  2LVO A;  2L1A A;  4NPN A;  2G4S A;  1I4G A;  3CST A;  4Q2J A;  3TL5 A;  4P1B C;  3HHM A;  1MHX A;  5DPR A;  4XDC A;  3I5J C;  4WQO B;  2DX5 B;  2L7R A;  2CHX A;  5EDS A;  1C4C A;  5BYQ A;  3T3N A;  1CMX B;  1KJT A;  1XO3 A;  2K25 A;  1F2R C;  3P4S B;  3CWI A;  2M19 A;  1LGR A;  2MX2 A;  4DQO C;  1SIF A;  2PPH A;  1RWS A;  4GSW A;  4CQN A;  4HPL B;  5E6O A;  3AE1 B;  5E6N A;  3RYT A;  2KDM A;  4GGQ A;  1VCB A;  3PO0 A;  3WIM A;  3BVZ A;  4LJP B;  3IT6 B;  3W5U B;  1A70 A;  1EWY C;  2ZNV B;  2KD0 A;  4MH0 E;  1FMA D;  2WXG A;  4HRO A;  2FCN A;  3ZNG C;  3KUZ A;  1AAR A;  2MWS B;  1VD2 A;  3WA0 A;  4GMV A;  2NPT A;  1KH0 A;  4HPP A;  1ET9 A;  4TQ1 A;  4RGO S;  2PLP A;  2WXP A;  3ZW3 A;  1YN3 A;  3ZUN A;  2KAC A;  2RDB C;  2NS5 A;  3A9J A;  3NY5 A;  4XZ4 A;  3NS1 A;  1OTR B;  3QHT A;  2BYV E;  4ZHO A;  1KOT A;  1WJ4 A;  2NBU A;  2V1Y A;  3P4Q B;  3DVG Y;  5AUK A;  1SE4 A;  2Y5P A;  3EFU A;  1V49 A;  1T0Y A;  1TGZ B;  1S3S G;  5CHF A;  2VZK D;  2K1F A;  2I2Y A;  3PZD A;  4FJY A;  1N6Z A;  4ZRQ A;  1XD3 B;  3J9C A;  3V3X A;  3V6E B;  1JCK B;  2M1M A;  1T3Q A;  2QC8 A;  1WR6 E;  3BII D;  5AEK B;  1MG8 A;  3ONS A;  4DHZ B;  2KMM A;  2KOX A;  3ZTD A;  3ZJU A;  4DXA B;  2PVO D;  5IKC M;  1R4M B;  1L7Y A;  3R8B A;  2K3U A;  5HKH A;  2Z0D B;  3MJ5 A;  1AWD A;  3E56 A;  3AV8 A;  5FKA C;  1VZ6 A;  4W9C A;  4WJO A;  5AUI A;  5IO9 A;  2K22 A;  1KFY B;  1YNT E;  3KQ4 A;  4JLC A;  1WGY A;  4E71 A;  3EUB 2;  5LXH A;  2WXO A;  2WXN A;  3WAM A;  3CSF A;  4CYE A;  1L6V A;  2SAK A;  5FK9 C;  4GDK B;  1FO4 A;  4ARC A;  1FNV A;  2WS3 B;  1UBQ A;  2J0M A;  2NTT A;  2RDG A;  1RFK A;  3PGE A;  4YXD B;  1WYG A;  3UIP B;  1SJH D;  3VXW A;  1R4N B;  3WAL A;  2Z0E B;  1J7B A;  2Y3A A;  5JXV A;  3ML8 A;  4IOI E;  2K39 A;  1ZKH A;  1I35 A;  1RYJ A;  2CU1 A;  2N9E B;  2QEJ C;  1SJE D;  2K6Q A;  4A90 A;  1SBB B;  1OFF A;  4HCN B;  3AED B;  2HTM E;  4S0R A;  2ZCC A;  1P3Q U;  2PJH A;  2KNB A;  1H8C A;  5E6P A;  1IPG A;  2OOB B;  2V3N A;  2NBW B;  2N9K A;  2ONQ A;  2ZEQ A;  2X8X X;  1BUI C;  4A3O A;  4YSY B;  1YQB A;  2DYM A;  3SDL C;  2L83 A;  3DBS A;  2MA9 B;  2XN9 C;  2MQJ A;  1VZ7 A;  4JPS A;  2G1E A;  1Q10 A;  1IP9 A;  2O6V A;  3B9J A;  2KT7 A;  1AW7 A;  4L23 A;  2L05 A;  2HE7 A;  2EMT A;  5TR5 A;  3U8Z A;  1WJ6 A;  2L00 B;  2WXK A;  3MTN B;  3OJ3 A;  2OED A;  4BZA A;  4FJV B;  1C3T A;  3URY A;  2C5L C;  5DCN A;  3MHS D;  3QAQ A;  3WAO A;  3EC8 A;  1ROE A;  2M56 B;  2G9H D;  1C4P A;  3N9Y C;  1GPX A;  5IOI A;  3BK1 A;  2A5U A;  4GIV A;  4R3D A;  3SFD B;  4IW0 A;  2AL6 A;  3I63 C;  3BYT B;  4MGI E;  3ZRF A;  1SB3 C;  4AUQ C;  4J3O D;  1JWB D;  1V81 A;  2WDR B;  2J52 A;  2DBY A;  2NBV B;  3R7R A;  3M3J A;  2MP2 B;  3JVZ X;  4OVU A;  2MBQ A;  5JHB A;  4PYU A;  3W5V B;  1TIF A;  4OVZ A;  4A9A A;  5FR6 A;  2BPS A;  1DOI A;  4NNJ B;  1XLO A;  1SE2 A;  4BOZ B;  3GS2 A;  4HWI B;  2PW9 A;  2WX1 A;  2J0K A;  1EU4 A;  2A4Z A;  4W9J A;  2WX0 A;  3H7P B;  2QMT A;  1P98 A;  4GU2 A;  4FLH A;  1UZX B;  2FUG 1;  3N20 C;  4KKI A;  2FAZ A;  5H92 C;  1GB4 A;  2D3B A;  1WGG A;  4HDO A;  4W9E A;  5C23 A;  3PT2 B;  4AP4 C;  3ZJV A;  4MGY E;  1LFD A;  2IO2 B;  3FC4 A;  3VUX A;  1QIL A;  1FPY A;  3VVW B;  2LEK A;  3TSS A;  2UWQ A;  2IGD A;  2ZJD A;  3P4P B;  3VDZ A;  4IC7 B;  1NVI D;  2OHF A;  4WAA A;  3DBR B;  3MP9 A;  4MEL A;  4MAC A;  1FIQ A;  3AEE B;  3ZNH B;  1MVK A;  2KTR A;  2LRU A;  4L2Y A;  1WRI A;  4K7S A;  3O65 B;  1UBI A;  4KZ0 A;  2GBR A;  2JWU A;  2WXL A;  1L4D B;  3R66 C;  1KRH A;  2NR2 A;  3V62 A;  3N1X C;  1PFD A;  1P7E A;  4BKG A;  2QJL A;  1HE8 A;  4LK0 M;  3A4R A;  1MHH E;  1FXA A;  2LUE A;  3PZ7 A;  4MSQ B;  2BS2 B;  2IJ0 A;  4G50 A;  4ZOH C;  2KZR A;  4HJK A;  3TMP B;  1TS2 A;  1E90 A;  1WY8 A;  4PK1 A;  3B1L X;  4NAW B;  2WDV B;  3MHZ A;  3P1M A;  3A1Q B;  1TKE A;  2NVU I;  1VDV A;  2CKH B;  1EWC A;  3AE8 B;  2DZJ A;  3OJ4 B;  2BTE A;  2GBN A;  3GE3 C;  2KN5 A;  3LJ3 A;  2JU6 X;  3W1S A;  1NI3 A;  2KLC A;  2INN E;  4GOC A;  1GC7 A;  4DDI D;  4E3C A;  3AU5 A;  3NZS A;  1NYQ A;  2KMA A;  2V3P A;  3T9L A;  3KVF B;  2LFI A;  3NZ3 A;  2KN4 A;  1M4V A;  3N32 A;  4NQL B;  2L32 A;  2YEP B;  1VRA B;  1ZPS A;  3VRA B;  1KLG D;  1P0R A;  1ZOY B;  2WWZ A;  2N4F A;  4ZRK A;  4EZJ A;  3LYY A;  3U7Z A;  2W54 A;  3M62 B;  2D2Q A;  4K7U A;  1Q1O A;  3B2G A;  3APF A;  2RSU A;  4KIK B;  4NJ7 A;  1Q0W B;  3L16 A;  1CJE A;  2Q5W D;  3MC8 A;  1T0S C;  4MJS B;  2CHZ A;  1JWM D;  1C78 A;  4RH6 A;  2O2V A;  3EEC A;  1RAX A;  3KYC D;  1XLP A;  3KUC B;  4OZB A;  4ICV A;  4MT5 A;  4KX6 B;  3ZDM C;  3NOB A;  1C77 A;  2IO1 B;  4REZ A;  4DWF A;  2KDE B;  1D3Z A;  2WU5 B;  5D94 A;  4A8X C;  3ZGZ A;  2J0J A;  2XNA C;  5D3D A;  5J18 A;  1QKZ A;  2GMI C;  2MEK A;  1TKY A;  4MM3 B;  4HKQ A;  3NVY A;  2L52 A;  4A20 A;  1RFA A;  2C9W B;  2AQ3 B;  1YD8 U;  1NEK B;  5TSS A;  2FID A;  1WZ0 A;  4N59 A;  3P42 A;  2LZ6 A;  2CU3 A;  4WH4 A;  3VQI A;  4C80 A;  1STE A;  2IO0 B;  4BAX A;  2Z59 B;  1WGK A;  3Q8C A;  3NJT A;  1WZ3 A;  4WAF A;  3RNG C;  1UWM A;  1NYR A;  2QIE B;  3IAS 1;  4ACF A;  3BVM A;  1TJE A;  1K51 A;  3C8Y A;  4I6N B;  2GBM A;  4IM3 A;  1RM6 C;  3VUY A;  4IWP A;  2EKE C;  2DLB A;  4FXC A;  2YEP F;  3AEC B;  2BB6 A;  1N62 A;  3Q8E A;  2UU7 A;  1D5X C;  3SD5 A;  1EM7 A;  2KTF A;  3ETR A;  1IUE A;  4HLE A;  2NCN A;  1XF5 L;  1I4Q A;  3QIJ A;  4WUR A;  3E9S A;  1JW9 D;  3GP7 A;  1GC6 A;  3VFK A;  2JUO A;  2IPK D;  2N9X A;  4X57 B;  3IXS A;  4MSM B;  1UGM A;  2TSS A;  4HXD A;  1MPE A;  1U4A A;  4WWO A;  3APD A;  2JRH A;  3PS6 A;  4BVU C;  3Q3N C;  4GDK A;  4B0E A;  4KDI C;  4ANV A;  4ANW A;  4RCO A;  5BMI A;  4BFR A;  3ZNZ B;  2JZP A;  1GUA B;  3DWM A;  2BWF A;  1DOY A;  1AYF A;  1OEY J;  1PGB A;  2DZK A;  4XX5 A;  4A3P A;  2L76 A;  1ENF A;  2LXA A;  3NVZ A;  4RM9 A;  3RZF A;  1IYF A;  1F1H A;  2KLG A;  4P7I A;  1Y56 A;  1DGJ A;  1WXA A;  3UI3 A;  1JAL A;  4O1N A;  2M8S A;  3PRZ A;  2VH1 A;  4TKN A;  4DBG A;  1ISN A;  4M0W B;  3AEB B;  1RLF A;  1N63 A;  2JWZ A;  2D3G A;  2GRI A;  3Q3O C;  1I4H A;  4WJQ A;  2LGD A;  4M02 A;  4ITK A;  5T8I A;  1C1Y B;  3JSV B;  2QCZ A;  1E9M A;  1TS5 A;  2UYZ B;  4B9K A;  2MRP A;  4RM8 A;  4N58 A;  1L0Y B;  1WR1 A;  3RFZ B;  1L0X B;  2G4D B;  4B95 A;  2M0A A;  3NZU A;  2I38 A;  4HJG E;  3RNC C;  1XLQ A;  3A4S C;  4C00 A;  1JRO A;  5AZF A;  3PVL A;  1QLB B;  4M01 A;  2WGS A;  4JL9 A;  3S2A A;  3N30 A;  1V97 A;  1V2Y A;  2LJ5 A;  3AUL A;  4B0M A;  4XC2 A;  3GZN I;  2MJ3 A;  4EZL A;  1K52 A;  2AQ2 B;  4JX1 C;  4AWJ A;  2V9H A;  4PT5 A;  1TT5 B;  3CIR B;  2JZZ A;  2KFK B;  1ZP0 B;  3OAW A;  2AL3 A;  2DEN B;  1J7A A;  4KDL B;  1BML C;  1L6U A;  3PTF C;  2VH2 A;  4K1R B;  1YQ4 B;  1YOV B;  1WGH A;  2LGX A;  3GB1 A;  2BQQ A;  4DXG A;  4AJW A;  1D5Z C;  2JYE A;  1HA5 A;  4JGH B;  2PE9 A;  4ANU A;  1ACC A;  2MP2 A;  2REX A;  2MSE D;  1BXT A;  1WJN A;  3APC A;  4IDI A;  1S1Q B;  1IBX B;  3HVD A;  1KLU D;  2WXH A;  1N61 A;  1WXV A;  3NS8 A;  2GB1 A;  2AX5 A;  2KDB A;  2PE6 B;  4TSS A;  1QOF A;  1FEH A;  2KYW A;  1GJZ A;  2K9X A;  3LB8 C;  3RNF C;  2M4N A;  3QK0 A;  4II3 B;  2WDT B;  1F77 A;  1YX6 B;  3UIO B;  5EE0 A;  4KGT A;  3AE2 B;  4OW0 A;  1HTO A;  1TY2 A;  4FJZ A;  5CHV C;  4M00 A;  4RGN A;  5MPO A;  4HEA 1;  3B0A A;  3RUL A;  1LQB A;  3ZDT A;  3Q69 A;  3AEA B;  3W9C B;  1E6E B;  4HPM B;  1WX8 A;  1JRU A;  3OLM D;  3GE8 C;  1WSP A;  4KGS A;  1NBF C;  1PYW D;  2DZM A;  2BYE A;  4XWT A;  2NPT B;  2KVR A;  1P1A A;  4BBN C;  4C4V A;  3O13 A;  2D5G A;  2LRW A;  1FM0 D;  2H88 B;  2L3Z A;  3W1S C;  2KWC A;  1HXY D;  4RGM A;  3A9J B;  1ZXI A;  1FXI A;  2E6X A;  4M8M A;  1BT0 A;  2JRI B;  1YQ3 B;  1I4R A;  3DHI C;  1LXD A;  1UWX A;  2D10 A;  2XK5 A;  5CTR C;  2OJW A;  2DAJ A;  2J42 A;  4UDU C;  5J17 A;  4MGZ E;  1UF0 A;  3QQ8 B;  4IWO A;  4AOF A;  2KQS A;  4PS8 A;  3L13 A;  3BK2 A;  3QAR A;  1EO6 A;  3ZVV A;  4P6V F;  2ASQ A;  3X23 A;  3A1Q A;  2WYQ A;  2MCN B;  1NI2 A;  2ZZP B;  1V80 A;  2NTS A;  1UEL A;  4KV2 A;  1V86 A;  1KTK A;  3NUH B;  4HVB A;  3SEB A;  1P7F A;  2BW2 A;  3IT4 B;  1WH3 A;  4S17 A;  5LLI A;  3PRE A;  5HFY A;  2BT6 A;  4YWG G;  2PMV A;  4JWU C;  1FFV A;  2MBH A;  3DBR I;  1QF6 A;  3BYY B;  2PVG C;  4EEW A;  1H4R A;  1Q5W B;  2J7Q B;  3ZQ4 A;  4RNA A;  1ESF A;  1L2N A;  2KX3 A;  3A9K B;  1I7H A;  2NMQ A;  1PGX A;  2KK8 A;  3NRZ A;  2N7E A;  1CK1 A;  2V4L A;  3TCA A;  4EE2 A;  2LMC A;  3HRD D;  2WXR A;  4K3B A;  4GDL B;  5D2M B;  4C7Y A;  1L0V B;  4AJY B;  4URK A;  2PIA A;  5BYS A;  2KAN A;  3TEW A;  2MLB A;  2LGS A;  2LAS A;  3ECI A;  1WE7 A;  3RUI B;  1T0Q C;  1MI0 A;  1DOX A;  1XLN A;  3UIN B;  1GAQ B;  4N6E B;  2ZW1 A;  1TS4 A;  3KYD D;  4PS3 A;  4PS7 A;  3H9D A;  1V1O A;  1HTQ A;  3PLV A;  1AN8 A;  4IM0 A;  1Z2M A;  2YLM A;  2DZI A;  1N5W A;  3NG0 A;  2INP E;  3Q3J A;  1B1Z A;  2FNJ B;  2LWP A;  2IO3 B;  3RPF C;  5DPT A;  3KW5 B;  3FIL A;  3ZXV A;  4RFB A;  1WXS A;  3TEX A;  3AEF B;  1WMH A;  2AYO B;  4MH8 A;  1ZUD 2;  4KVG B;  3PZ8 A;  2O6V B;  2IGH A;  3V61 A;  3ZLZ A;  3DBH I;  4DHJ B;  1F0Z A;  2N1W A;  5G2N A;  2KX0 A;  1XCT L;  4JIO U;  4LDT B;  5JHA A;  1WF9 A;  1C4A A;  3ZKJ C;  1CZP A;  1TZO A;  2WXJ A;  3DDC B;  2KC2 A;  4ZRI A;  1E7P B;  2KDI A;  4I6L B;  2KVZ A;  2IBI B;  4C7Z A;  2RPV A;  1SGH A;  3EA6 A;  3I57 A;  4W9L A;  2KDF B;  5IP4 D;  1E7V A;  4YTM B;  3BVG A;  3HK0 A;  1XXG A;  3ABV B;  4ARI A;  2MJE A;  3TJP A;  1WGD A;  4XE0 A;  1V1P A;  1C9F A;  3C19 A;  1TTN A;  4FUL A;  3AE3 B;  4RMA A;  4FHJ A;  1WGR A;  1WX7 A;  3DPD A;  3L54 A;  2AEH A;  2X38 A;  3IHP C;  2GLS A;  2KJ6 A;  2JX5 A;  5J2R A;  1R7S A;  2RR9 A;  1PQS A;  2J4X A;  4IKG A;  4LTU A;  5JZE B;  5L95 C;  3DOW A;  2IY1 B;  3M95 A;  4NJC A;  1VJK A;  2N1V A;  1ZDX A;  4AS1 A;  3Q14 C;  2OJR A;  4W9K A;  4E74 A;  2EMS A;  4LNN A;  4FN2 A;  5DPS A;  2Y5C A;  1E8Y A;  5BYR A;  2D3A A;  2C7H A;  1E7U A;  1OEY A;  2WNM A;  2FCM A;  4EUT A;  1GB1 A;  2LD9 A;  2W55 A;  1WX9 A;  1TKG A;  1XEE A;  1GG3 A;  3NVW A;  3EGR A;  3AE9 B;  4KKJ A;  3Q6B A;  4M0W A;  3RMK C;  4NQK E;  5G5H A;  3UF8 A;  3N1Y C;  5AZH A;  1HEZ E;  2QHO A;  4ZRJ A;  2BKF A;  2PKO A;  2LHD A;  3ZJT A;  2CR5 A;  4EZK A;  1JWU D;  2KTR B;  4I6P A;  3DBL B;  5LXI B;  3VRB B;  2ZVO A;  2PTL A;  4MDK E;  1WIA A;  2BGF A;  2RDH A;  5GMV A;  2WU2 B;  4LLG M;  4OHJ A;  3IVF A;  3R2I A;  1FCL A;  3PV1 A;  2H89 B;  3EFC A;  3V05 A;  1TYG B;  1SEB D;  1LM8 B;  4N9F 4;  2WXM A;  2JXT A;  5D7G A;  4HCP B;  2KFK A;  5D6J B;  1J7C A;  3QA8 A;  1IGC A;  2RPQ A;  4QAY A;  4TQ0 A;  2RMM A;  2BS3 B;  3OG5 A;  3JW0 X;  2KWD A;  4WJP A;  1EF1 A;  4IM2 A;  1E8X A;  2JQR B;  5IAA C;  1OGW A;  3TIX A;  2W82 A;  2K5P A;  1FNW A;  1B9R A;  4JQW C;  3RCZ A;  3IG3 A;  1GNU A;  5HHD G;  5BMH A;  3N3K B;  4W9D A;  3RNA C;  2KO3 A;  3MC9 A;  1OQQ A;  3PHW B;  2LI5 A;  3L08 A;  3ZRC A;  2LGY A;  3RZW C;  3DHG C;  1E8Z A;  2CJN A;  3ZYY X;  5G55 A;  3JYU A;  4ASW C;  1TBE A;  2BWE S;  1QOG A;  2KXJ A;  4L1B A;  1KLV A;  3ALB A;  1FFU A;  1E10 A;  2N7D A;  4KZC A;  2HD5 B;  1L4Z B;  2KKC A;  3R7Q A;  1TS3 A;  4MGK E;  1K8R B;  3TEY A;  1HQR D;  3VR8 B;  3VH4 B;  4ICU A;  3H8H A;  2R2Q A;  2MHJ A;  3DQV A;  4F7Z A;  2BYF A;  4WWM A;  3TEZ A;  3HM6 X;  2O2V B;  2MBO A;  3WCQ A;  3AB5 A;  2XEW A;  2MBB B;  5I4D A;  2V4I B;  1NDD A;  3P63 A;  1GOZ A;  4M8N A;  2WXI A;  1R4M I;  2HJ1 A;  2LVQ A;  4G0N B;  3UQB A;  2WQY B;  3IFW B;  2XBB C;  4OZA A;  4C56 C;  2ON8 A;  1FD6 A;  3AN1 A;  3P2B A;  2GBK A;  1KF6 B;  1C76 A;  1T5X D;  3X0W A;  4A6Q A;  1NEN B;  3L4P A;  2IND C;  3V60 A;  3PRP B;  1V9J A;  3V6C B;  2L8J A;  4TUU A;  2RD0 A;  4G3X B;  1MJD A;  4HDQ A;  1MG4 A;  1FXT B;  3RNE C;  2C7M B;  2QSD A;  4WWN A;  3T8M A;  4BBN F;  4ANX A;  3DVN U;  1R4N I;  5BMG A;  1EF5 A;  3U4E G;  4IG7 B;  2FIF A;  4YSZ B;  2R61 A;  3A33 B;  4FAD A;  3LDZ E;  2B76 B;  3OWE B;  4ZDV A;  1E5W A;  1ZW7 A;  2D3C A;  1D6E C;  3QX1 A;  5EE9 A;  2KWV B;  1OQR A;  1VR9 A;  2L0F A;  3SU8 X;  2IZV B;  4DDG D;  3PRM B;  1XCQ L;  1JRP A;  3DVN V;  1LO5 D;  4HRS A;  5KHO A;  3U7D A;  3M63 B;  4XDD A;  4HKZ E;  1M94 A;  3I9V 1;  1OQY A;  2W9N A;  2JZ3 B;  4US9 A;  5FR3 A;  4XWW A;  2KMC A;  2IDY A;  4ZYS A;  3A9K A;  3AE6 B;  3MJW A;  1T6B X;  4WQM A;  3H7P A;  4BKT A;  5CX3 A;  1JML A;  2KHW B;  3BIN A;  1VLB A;  3HIZ A;  3GZN B;  1D4B A;  2G45 B;  4GDL A;  5JH5 C;  2JPH A;  2DHZ A;  1WXM A;  3LXF A;  3CMM B;  1YMH E;  4F8C B;  4ZRP A;  2ACZ B;  2O6V D;  1EU3 A;  1D5M C;  2KC1 A;  3H1U A;  3ZTC A;  1V6E A;  2IY0 B;  4DHJ D;  2N0S B;  3U30 A;  4PYZ A;  2GBJ A;  3KWL A;  5C2T B;  2ZPN A;  3KWV A;  1FCC C;  3HM3 A;  4BKS D;  1A5R A;  4LDT D;  2K8H A;  1F9J A;  3ENE A;  4J6I A;  2DNF A;  3K9O B;  4XGA B;  3AXC A;  1J0G A;  4GB9 A;  3VHT C;  3IAM 1;  3QC8 B;  5D3I B;  5IN7 A;  2INC C;  2GI9 A;  2KJR A;  4LNK A;  2KFJ A;  5EE3 A;  2C60 A;  2BF8 B;  2KQ7 A;  4XYC A;  3VAW A;  2JVC A;  1UH6 A;  3NHE B;  1SE9 A;  3AM9 A;  4MEM A;  2JF5 A;  3C0R B;  3KLS X;  3N1Z C;  2K8B A;  2DWQ A;  1V5O A;  4BKS A;  3MC0 B;  4GN1 A;  2EKI A;  1N5X A;  3RI7 C;  4RGT A;  3VTU A;  4NAW A;  1YN4 A;  2HJ8 A;  1WJU A;  2FCQ A;  2LUM A;  1WM3 A;  4TV3 A;  2HTH A;  2IYD B;  1Z5S B;  2LHE A;  1QOA A;  1WWT A;  3CF6 E;  4A55 A;  3VTV A;  3PSE B;  3H6N A;  2GOW A;  1EUV B;  4LCD E;  2BKR B;  3P4R B;  3L17 A;  2VZK B;  4EOY A;  2ZNV C;  2K8C A;  4BOS C;  2DYO A;  5CHW A;  3Q8A A;  1K50 A;  5KHQ A;  2PEA A;  2LGI A;  2ZPY A;  3NVV A;  4EKU A;  3WAN A;  3BZD B;  2J53 A;  2BS4 B;  4USA A;  1KM7 A;  2W3S A;  4IWQ A;  1F2R I;  2N7J A;  3WAP A;  4KIK A;  4CO7 A;  2FUH B;  3AE4 B;  2ZW0 A;  3I3T B;  2WLB A;  3R2T A;  2JY6 A;  2CJO A;  4MJS A;  2Z8L A;  1SSN A;  2D11 A;  2V3S A;  1ZXH A;  4K81 A;  3RD2 A;  5C3J B;  3QWZ B;  2ICI A;  1V8C A;  4B6W A;  3VUW A;  2QIL A; 
#chains in the Genus database with same CATH homology
 4K3C A;  3MC8 A;  2MHJ A;  3NJT A;  3Q6B A;  4C4V B;  3MC9 A;  4XGA B;  4C4V A;  4C00 A;  2X8X X;  4BZA A;  3EFC A;  2QDF A;  4QAY A;  2VH2 A;  3OG5 A;  2QCZ A;  4K3B A;  4PK1 A;  2V9H A;  2VH1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...