2LRWA

Solution structure of a ubiquitin-like protein from trypanosoma brucei
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
78
structure length
78
Chain Sequence
b'MLLKVKTVSNKVIQITSLTDDNTIAELKGKLEESEGIPGNMIRLVYQGKQLEDEKRLKDYQMSAGATFHMVVALRAGC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a ubiqutin-like protein from Trypanosoma bucei
rcsb
molecule keywords Ubiquitin, putative
source organism Trypanosoma brucei brucei
molecule tags Cell cycle
total genus 11
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2012-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2lrwA00
1WF9A 3WA0A 2L05A 1E90A 3VXWA 2KANA 1V9JA 3QAQA 3L54A 5AZGA 3ZNGC 3APDA 4MGYE 5D7GA 3K9OB 3A9KA 3SDLC 3V6EB 2RSUA 3DVNV 4AUQC 5LXIB 1TGZB 3SHQA 4I6PA 2PPHA 2I1KA 3H7PB 4EZKA 3VUWA 4BKSA 3A9JB 3A9JA 2ZCCA 1WGGA 2O6VD 1WM2A 4XZ4A 2KWUB 2NVUI 2N7DA 3VDZA 1KM7A 3WANA 2IY0B 3TMPB 3IVFA 3JW0X 3ZRCA 4HLEA 2DENB 2KFKB 4AWJA 4EFOA 1GNUA 1WMHA 2L8JA 2OOBB 1V49A 3L17A 3MJWA 2KMCA 3AU4A 4WWPA 2BYFA 3A1QA 1SE9A 2LUEA 4KVGB 1WRDB 4W9LA 4M8NA 3IHPC 4FA6A 1AARA 2KDFB 2GBRA 1E5WA 4TKNA 1V5TA 3QC8B 4LDTD 3N32A 4WJNA 3KW5B 3DBSA 4A20A 1WFYA 4AJYB 2PE9A 2UYZB 2CR5A 1SIFA 4IM0A 4MEMA 2KZRA 2ZJDA 4PS8A 2MBHA 2N9PC 2AL6A 3CSFA 3H7SA 5AZFA 2DZKA 3IG3A 3HM3A 4ANWA 2ASQA 3AXCA 1LM8B 3PREA 3V61A 2LJ5A 4OVVA 4EOYA 5DPSA 2NR2A 2O6VA 3V6CB 2J0KA 2WWZA 2ZCBA 3IBEA 2KNBA 3ZO5B 2NBUA 3T9LA 3B0AA 4HDOA 3PHXB 3C0RB 2IY1B 1WZ0A 1I35A 2JUOA 4WJQA 4NAWA 4FHKA 3KYDD 3PRZA 4NAWB 3WIMA 4NPNA 1C1YB 3P2BA 4K7WA 2Z0DB 3WALA 5JHBA 3U30A 2M1MA 4EEWA 4EKUA 1TZ1A 1J8CA 3Q3FA 4FJVB 2LVQA 2KLCA 3NS8A 3KUDB 4MELA 3SD5A 1E7UA 4GXBA 4ANUA 4WJPA 3AULA 3M63B 2CHWA 4TQ1A 3ZDTA 5IAAC 3ZIMA 4B6WA 5J2RA 1JRUA 1IYFA 2KTRA 2KTRB 2XK5B 3S2AA 2ZEQA 2C7NB 1OEYA 3QK0A 1WZ3A 2KWVB 2DHZA 4XC2A 2KDIA 1RFAA 2RGFA 5G55A 2C9WB 2N9EB 2J7QB 2LVPA 1IP9A 2CS4A 2CHZA 3HK0A 5HKHA 4FJYA 2LASA 1H4RA 2DAFA 2JRHA 4HPLB 4GIVA 4ZRIA 2K1FA 3DBRI 2LRUA 3NHEB 4FJZA 2A4ZA 4GU2A 4OVUA 5KHQA 3QJZA 4ZRKA 4BKGA 5LXHA 2NBVB 4ZRJA 3V62A 2MWSB 2DYMA 1SGHA 4FLHA 2L76A 3AU5A 2N1VA 2MSED 3PLUA 2G45B 2L0TA 4JQWC 5E6PA 5L95C 2IZVB 2QHOA 4IC7B 5LLIA 2FCNA 2W9NA 3RULA 2MBBB 5C23A 1WGDA 2KXJA 5D2MB 2GBJA 1YQBA 4MJSA 5D94A 2CU1A 4ZDVA 4LJPB 2PJHA 4G3XB 1VD2A 4IW0A 3QCAA 3ZTCA 2FCSA 1WX7A 1ZGUB 3VTVA 3ECIA 3JYUA 4PYZA 4FHJA 1YJ1A 4MGZE 2BYEA 1G6JA 3H6NA 2C5LC 2LGYA 3X0WA 5JHAA 1R4MI 1WGHA 2LXCA 2RPQA 2K8CA 3DVGX 4W9HA 2KDBA 3U7DA 2J0JA 1UD7A 2ZPNA 2BKRB 2FIFA 4KSLC 5CTRC 2LWPA 2LD9A 5CHVC 3ZNID 3JSVB 3H7PA 2HTHA 2KOXA 2KKCA 2RD0A 2FAZA 5IA7A 3NY5A 2MP2B 2BGFA 3ZKJC 2IYDB 2ZPYA 4NNJB 1OEYJ 1WGYA 2V1YA 2KFKA 4WAAA 2AWTA 1K8RB 4BVUC 4FBJB 4II3B 2DZMA 4CYEA 3RT3B 3PGEA 1Q5WB 2KJHB 3ZDMC 2G3QB 1YIWA 3R7QA 3WAOA 3L16A 1L7YA 4IG7B 4KIKB 2K8BA 3BINA 3HIZA 2KFJA 2MX2A 4ANVA 2IO3B 4EZLA 4ICUA 1EF1A 3PSEB 1D3ZA 2BWFA 3QX1A 4DHZB 1WIAA 2M8SA 2KTFA 1V5OA 2IO2B 3PPAA 3RZWC 3UQBA 2CKHB 2L3ZA 4RM9A 1WXSA 3NZUA 2KMAA 3ZNHB 4GDLB 3U8ZA 2KC2A 1LXDA 3ZVVA 1YX5B 3CMMB 1X1MA 2ZNVC 1GUAB 3CSTA 2XEWA 1E8WA 4ANXA 3PZDA 1P1AA 5JZEB 4W9DA 5AEKB 3AI5A 4M8MA 2KDEB 2DYOA 2YVCA 4JGHB 3H9DA 1ZW7A 1E8YA 3KYCD 1I42A 3UINB 4F7ZA 3ZLZA 1LQBA 4GMVA 3N30A 4WQOB 4AJWA 4MGIE 1VCBA 2WDTB 4K1RB 4KZ0A 1WR1A 5G2NA 4CHKA 3VUXA 2N1WA 5CHFA 1OGWA 2BWES 2BYVE 2GBMA 3JVZX 3K9PB 4IWOA 3EC8A 2D10A 2RR9A 2K25A 4DHZE 2MCNB 1KLVA 3OJ4B 1M94A 4IM3A 2M0XA 4MSQB 2KJ6A 2PEAA 3ML8A 1KOTA 3ZNZB 5C1ZA 2L00B 2M17A 2ZVNA 2MLBA 1WM3A 2LXAA 4GOCA 2C60A 2XK5A 4IUMB 4MGKE 3MTNB 1V2YA 4HPMB 3MHSD 3DBLI 5JH5C 4GGQA 1E7VA 1NDDA 2YLMA 4A3PA 4GDKB 2D3GA 4HWIB 4DBGA 2J0MA 4KV2A 4XX5A 3VUYA 3EHVA 1S1QB 2C7HA 5DCNA 2B3AA 4E3CA 1WY8A 4HK2A 3CF6E 3W1SA 1WX9A 1V6EA 1S3SG 2JF5A 3PHWB 2MBOA 2NS5A 3UQAA 2KD0A 2JZ3B 4DDGD 4PYUA 2BF8B 1RAXA 4FN2A 3R66C 5TR5A 2VRRB 1XQQA 2K6QA 3L10B 2FUHB 3OLMD 1E8ZA 4DHJB 4F8CB 3TJPA 3NZSA 5L83A 3PT2B 4K81A 1WYWB 1BT0A 1LFDA 3APFA 4DDID 1WXAA 2WX0A 3EFUA 3KUZA 2JZZA 3UGBB 5E6OA 2IBIB 2KWCA 2MBQA 4K7SA 5CHWA 1UBIA 4G0NB 1KJTA 1RLFA 3VH3B 3VHTC 4HJKA 4AP4C 1YX6B 2V3SA 4FADA 1Q0WB 2DZIA 1WGRA 2D07B 4I6LB 4E74A 2KQ7A 3M3JA 3PV1A 2KVRA 3L0WB 4LCDE 1WE7A 3WAPA 4HDQA 2BKFA 3SU8X 2BPSA 3RUIB 1Z5SB 1P3QU 1UGMA 1WE6A 2EMSA 5J18A 2JRIB 3HM6X 2FCQA 4MH0E 2LI5A 2MBEA 1UH6A 2LGDA 3UF8A 4JIOU 4RM8A 3M62B 4WJOA 2OJRA 2JXXA 2JT4B 3I3TB 3JSVA 4A3OA 1UELA 1V81A 4JL9A 3DVGY 2HJ8A 4KDLB 2MP2A 3A33B 3PTFC 3KH0A 2IO1B 2LZ6A 2MA9B 2R2QA 3R3MA 4CO7A 2KX3A 1FXTB 3O65B 1F9JA 3R7RA 4K7UA 2DX5B 4WWOA 2LGXA 4ZYNA 3DPDA 3VTUA 4DK5A 2CHXA 2KLGA 2REXA 4F1SA 1TTNA 3A9KB 1IPGA 4IWPA 4KIKA 2D2QA 4NQKE 3TCAA 2KC1A 2IO0B 2WYQA 2GBKA 2KO3A 1R4NI 1V80A 1WI0A 2EMTA 3DQVA 3TL5A 3VVWB 3DVNU 1WR6E 4BOSC 1WJNA 3PLVA 4IM2A 1GJZA 1RRBA 1EO6A 3BY4B 4GDLA 2NPTA 2NPTB 2L0FA 2O2VA 2O2VB 3X23A 3EECA 1WMHB 4W9GA 2Y5BB 3VAWA 1UBQA 4GB9A 5GMVA 1GC6A 3A1QB 5E6NA 3ONSA 2KK8A 3NOBA 4MSMB 3W1YA 1J0GA 1TBEA 2HD5B 2ZVOA 3IFWB 4II2B 4TQ0A 3TIXA 4HXDA 1XT9B 3RZFA 3L08A 4URKA 4B9KA 3A4RA 2Z0EB 3ZRFA 4E71A 2FIDA 4KDIC 4G50A 2KX0A 2MW5A 2K39A 4MM3A 4W9EA 1P9DU 2A5UA 3RD2A 1WJ4A 4X57B 3LJ3A 4TV3A 5EDSA 1WXVA 4HCNB 4ASWC 1V86A 1Z2MA 1P98A 1Q1OA 3V60A 2G4SA 2DYBA 4DHJD 3KVFB 4MDKE 4EUTA 2NBWB 3KUCB 3DBHI 3QIJA 4GN1A 1GG3A 3GOEA 2ZNVB 4NY0A 5DPTA 2XBBC 1ZKHA 3PS6A 4PS7A 1Y8RC 4W9JA 2HE7A 3QARA 1T0YA 2KHWB 4NJ7A 4RMAA 2GBNA 2I1JA 4BOZB 4AOFA 2O6VB 2K6DB 2V4LA 3Q3JA 2FNJB 1PQSA 3ZTDA 4W9IA 4W9KA 4KSKC 5D6JB 1A5RA 3OAWA 3ALBA 3LDZE 3UIPB 3WAMA 2KN5A 4BFRA 1OTRB 3DDCB 1EUVB 3M95A 2AYOB 3GZNI 4PS3A 1HE8A 2M4NA 1ISNA 4GDKA 3L13A 4G11A 1WX8A 2AEHA 3W1SC 4BBNC 4HCPB 3APCA 2EKEC 3ML9A 3RCZA 2K8HA 3VTWA 5AZHA 1EF5A 1C3TA 2R2OA 1H8CA 4KZCA 4LDTB 2JY6A 1GC7A 3QA8A 4LJOB 2NCNA 2N7EA 4GSWA 3RYTA 5CX3A 3N3KB 2D11A 2AL3A 3DCGA 3OJ3A 1YD8U 3QHTA 1OQYA 4EZJA 4BKTA 2L7RA 1WXMA 5DPRA 2MQJA 2N9XA 4FULA 5FR6A 3T8MA 3VQIA 3HHMA 2DAJA 3ZW3A 4W9FA 4M0WB 1NI2A 2G4DB 3ENEA 3PRMB 1L2NA 1WH3A 3A4SC 2JWZA 2C7MB 1MG8A 4YL8A 4TUUA 3PVLA 2LRWA 4BKSD 4JLCA 2GOWA 1UZXB 3B08A 3D32A 4J6IA 4N9F4 4NQLB 1P0RA 2KJRA 3H1UA 3VH4B 2WX1A 1NBFC 4IWQA 4P7IA 3QQ8B 2ZZPB 2JPHA 4NJ6A 2DZJA 2JVCA 2PE6B 2KQSA 3UIOB 1E8XA 2UWQA 3DOWA 5J17A 4DWFA 1WJ6A 1J19A 1U4AA 4I6NB 4B95A 4W9CA 2LVOA 2MRPA 5BO4B 4HVBA 4DXAB 4MJSB 1WJUA 4WWNA 4BBNF 5KHOA 2N4FA 3TBLD 4ICVA 5DPWA 3QWZB 3VFKA 2GMIC 2FCMA 3ZUNA 1QZEA 3PRPB 3B1LX 1CMXB 1XD3B 2Z59B
chains in the Genus database with same CATH superfamily
1WF9A 2RDGA 3AEFB 1SE3A 1E90A 3VXWA 2EKIA 2QC8A 2Y5CA 1E6EB 4Q2JA 3SDLC 1HZ5A 4WWMA 1PUTA 3BVZA 2KQ4X 3SHQA 4OHJA 2PPHA 2I1KA 1R4MB 3H7PB 1GB1A 1M4VA 5IP4D 4BKSA 3NJTA 1WM2A 1RYJA 2M56B 2V4IB 3WANA 3IVFA 3JW0X 2DENB 2JYTA 4LNKA 4ARCA 4R3DA 2OOBB 2KMCA 1KLUD 2LUEA 4M8NA 1ACCA 3IT6B 4FA6A 1C79A 3QC8B 4M02A 3KW5B 4HJGE 2MJEA 1LGRA 1SIFA 2J53A 4B0EA 2N9PC 4US9A 2AL6A 1FO4A 3HM3A 4ANWA 3CWIA 1ZXIA 2LJ5A 3VRAB 4EOYA 1C77A 3FAHA 1MJDA 2O6VA 3V6CB 2J0KA 3IBEA 3ZO5B 3B0AA 2JUOA 4NAWA 3PRZA 4K7WA 3WALA 1AW7A 2LHDA 4EEWA 1J8CA 1RM6C 4FJVB 2KLCA 2WXOA 4MELA 3SD5A 4GXBA 1JCKB 4LTUA 3AULA 2L83A 2CHWA 4TQ1A 3ZDTA 5J2RA 1K51A 1IYFA 2KTRB 1C4PA 2MJ3A 2DBYA 1RFKA 2C7NB 3NRZA 2PKOA 2KDIA 5G55A 3U7ZA 2J7QB 3DHHC 3LB8C 2DAFA 2JRHA 4HPLB 2WU5B 2N0SB 1E10A 3DBRI 1L4ZB 4GU2A 5KHQA 4ZRKA 5LXHA 2NBVB 3V62A 2DWQA 2L76A 3AU5A 2MSED 3PLUA 2MHJA 5E6PA 4JQWC 2IZVB 3MC8A 4YTNB 2LGIA 3FILA 3RULA 5C23A 2LEKA 3AEDB 4ZDVA 4LJPB 4HRSA 3QCAA 2FCSA 3VTVA 2W3RA 4FHJA 2BYEA 3VR8B 2WXPA 2DLBA 2KACA 5JHAA 1WGHA 1K53A 4W9HA 3P4RB 3U7DA 2R61A 3JSVB 3O13A 1JALA 5IA7A 1EWYC 2ZPYA 4NNJB 1OEYJ 1WGYA 1HXYD 4WAAA 4FBJB 4RF0A 4CYEA 1UF0A 4A90A 3PGEA 1TKEA 1VLBA 3WAOA 3RNAC 2K8BA 4ANVA 1D3ZA 4YWGG 1D5ZC 2WXJA 2L3ZA 4GDLB 2BT6A 1R4NB 3RN9C 4P16A 4ITKA 1E8WA 3PZDA 4YSXB 5AEKB 3AI5A 2KDEB 3KYCD 1I42A 3UINB 2WDTB 1VDVA 2KAJA 1MG4A 4CHKA 1C9FA 2N1WA 4IOIE 1VRAB 5D3IB 2FBWB 2GBMA 1ZXHA 5IN7A 4IWOA 2AQ2B 1IBXA 4IM3A 3NVYA 2PEAA 2WDRB 1GAQB 1F2RI 3U52E 2Y3AA 1WM3A 3BZDB 5D3DA 3MTNB 2K0PA 2D3CA 3DBLI 5JH5C 4GGQA 1B9RA 1L0VB 1YJJA 2WXFA 4GDKB 3NG0A 2J0MA 4KV2A 4XX5A 3EHVA 3DBLB 4HROA 2B3AA 1VZ7A 1N60A 1S3SG 2NS5A 4IDIA 3UQAA 1P7FA 2JZ3B 2AQ3B 4DDGD 2BF8B 3LXFA 4BZAA 1RAXA 2L32A 3R66C 4FN2A 1ZE3D 1MPEA 2FUHB 1E8ZA 3TJPA 1IGCA 4K81A 1BT0A 1WXAA 1XCQL 3GB1A 2JZZA 5E6OA 4K7SA 2KWCA 4HJKA 4FADA 1Q0WB 4E74A 2KQ7A 2KVRA 1JQ4A 4S17A 1UGMA 5J18A 4MH0E 1CZPA 2MBEA 2ZW1A 2LGDA 3UF8A 4JIOU 1IUEA 5BYSA 4JL9A 1GOZA 3DVGY 1Y56A 4US8A 3U2SC 3KH0A 2IO1B 1FXTB 1F9JA 3E56A 4WWOA 5LNK1 3DPDA 1I4XA 2CHXA 4F1SA 4IWPA 1VJKA 4KIKA 2D2QA 2KC1A 2WYQA 5IKCM 1NENB 1WI0A 1V80A 2I38A 3VVWB 1WJNA 1C78A 3PLVA 1RRBA 2NPTA 2O2VB 2Y5BB 3VAWA 1GC6A 4XWTA 2KK8A 3W1YA 2ZVOA 3FC4A 4II2B 4HXDA 1XT9B 3L08A 1J7BA 1KH0A 3A4RA 2D3AA 1N63A 1WRIA 1VZ6A 1DOIA 2KX0A 1WXVA 2QCZA 2ONQA 4HCNB 1V86A 1Z2MA 2DYBA 4MDKE 4WH4A 1YN3A 3GOEA 3MC9A 4NY0A 1T0YA 2KHWB 4N6EB 2BB5A 5FK9C 2GBNA 1FXIA 2O6VB 1PGAA 1SE4A 3Q3JA 3UIPB 2M4NA 3SFDB 1ISNA 2AEHA 1N5WA 3APCA 3ML9A 2AQ1B 4L23A 1H8CA 1E7PB 4LJOB 2LHEA 1UUPA 2WXIA 3N3KB 3OJ3A 1I4GA 4C56C 2BYTA 1OQYA 4YXDB 3DHGC 1XCTL 1WXMA 2NTSA 2N9XA 4FULA 4JWSC 3T8MA 2DAJA 4M0WA 2G4DB 5C2TB 4YL8A 4TUUA 2LRWA 4XE0A 3U4EG 2D3BA 4N9F4 2KJRA 3H1UA 1QOAA 1NBFC 3Q8FA 1EU4A 4P7IA 4NJ6A 5J17A 1E8XA 2CJNA 1J19A 3FILB 4B95A 2JZPA 4DXAB 1WJUA 3AE7B 4WWNA 4BBNF 3J9CA 3C8YA 3RFZB 3WA0A 5IO9A 4S0RA 5AZGA 3ZNGC 3APDA 3Q8BA 4MGYE 5D7GA 3P1MA 3DVNV 5LXIB 1TGZB 3W5UB 4ACFA 2X38A 3VUWA 3A9JA 2LFIA 1WGGA 2N7DA 1L4DB 3ZRCA 3TMPB 4HLEA 2IGHA 1DGJA 4EFOA 1FNUA 1WMHA 1V49A 4OVZA 1SE9A 2JWUA 3IHPC 4KX6B 5HG2A 1AARA 4NAMA 2GBRA 1E5WA 1V5TA 3URYA 3AB5A 4LDTD 4WJNA 4ZHPA 2PLPA 2YEPB 1PGXA 4IM0A 4MEMA 2KZRA 2ZJDA 3CSFA 3H7SA 5AZFA 3IG3A 3T3NA 2NR2A 4RGMA 2OJWA 3PZ8A 1T0QC 1SSNA 1TY2A 4KKIA 2NBUA 3KWLA 3C0RB 2RDHA 1WGKA 3KYDD 3WIMA 1IBXB 4A8XC 3KQ4A 4NPNA 2IPKD 3U30A 2GB1A 2D5GA 3NS8A 1E7UA 2IGDA 4WJPA 3M63B 1KLGD 4JE3B 2M0AA 4O1NA 1JRUA 3S2AA 2SAKA 3B9JA 2ZEQA 1DYQA 1I4QA 2PVOD 4XC2A 2N9EB 1K52A 2CS4A 3HK0A 3DWMA 3ABVB 1CQVA 4GIVA 4LK0M 1N62A 4FJZA 2N9KA 2A4ZA 4OVUA 3QJZA 1SGHA 3AH7A 1D6EC 2N1VA 2G45B 5L95C 3NS1A 4IC7B 5BMGA 2FCNA 3PZ7A 2MBBB 1Q10A 5D2MB 5BYRA 4ZYSA 3AE4B 2WLBA 1VD2A 3ZTCA 1WX7A 1ZGUB 4PYZA 1P7EA 2QEJC 4MGZE 3Q2AC 1TY0A 3X0WA 1R4MI 2LXCA 4QAYA 3DVGX 2KDBA 2J0JA 2XNAC 2BKRB 4M00A 4KSLC 1I4RA 1KF6B 2HTHA 4RGTA 2KOXA 3AE8B 2FAZA 4XGAB 3NY5A 2BGFA 2IYDB 3RNEC 4KKJA 1YNTE 2KFKA 2QSDA 1K8RB 1PYWD 3RT3B 3MJ5A 2KJHB 2G3QB 2PIAA 1YIWA 4IG7B 4KIKB 2MX2A 4WQMA 4EZLA 2K5PA 4N58A 1EM7A 4DHZB 2IO2B 3PPAA 1UNSA 3NZUA 3ZNHB 3U8ZA 3ZVVA 2J4XA 1YX5B 1GUAB 3CSTA 2XEWA 2MH7A 4W9DA 3N1XC 2VH1A 3AEEB 1ZW7A 3ZLZA 4GMVA 1TS4A 4WQOB 4MGIE 3BVMA 1OQQA 2VZKB 2BWES 2BYVE 2KWDA 1JMLA 2BTEA 1HQRD 3BYTB 4MH8A 2RR9A 1KLVA 2MCNB 1BXTA 1SJHD 3GE8C 1KOTA 3ZNZB 1DOXA 2MLBA 3DBHB 4IUMB 4MGKE 1V2YA 2E3TA 4HPMB 2NMQA 2ZW0A 2YLMA 1TIFA 3VUYA 4M01A 1S1QB 2XN9C 4E3CA 1ENFA 3GZNB 3CF6E 4ZRPA 3W1SA 2JF5A 2PW9A 1UWXA 2KD0A 4KGRA 1ROEA 4OZCA 5TR5A 2VRRB 4JX1C 1XQQA 2K6QA 3L10B 3OLMD 4DHJB 4F8CB 3NZSA 5L83A 1LFDA 4DDID 1FM0D 2MJDA 3KUZA 1T6BX 2MBQA 1STEA 1UBIA 1KJTA 1RLFA 1AYFA 3T3OA 1YX6B 3PV1A 1WE7A 1TS3A 2IJ0A 4A55A 3SU8X 3RUIB 3VR9B 3HVDA 2LI5A 2WXGA 2LUMA 1TZOA 3M62B 2OJRA 3I3TB 2K22A 2HTME 3A33B 3P4SB 3PTFC 3W2DA 3EGRA 2MA9B 3R3MA 3R7RA 1CJEA 2LGXA 2REXA 1J7AA 4LNFA 1OFFA 3R8BA 4IKGA 2ACZB 3NVZA 1R4NI 3TL5A 1WR6E 4BOSC 5BYQA 4IM2A 2BS3B 1WMHB 4W9GA 3RI7C 1ZDXA 1T0SC 3IFWB 4TQ0A 3SEBA 2ICIA 3AE3B 1CK1A 3RZFA 2AX5A 4E71A 4KDIC 4C00A 4MM3A 2PVGC 4W9EA 1P9DU 1FD6A 3LJ3A 5EDSA 1ET6A 3RPFC 4ASWC 1Q1OA 3V60A 3ETRA 3KVFB 3QIJA 2RDBC 2ZNVB 1FIQA 4PS7A 3BK1A 1Y8RC 2HE7A 4D2KA 3QARA 3RMKC 4NJ7A 4RMAA 2I1JA 4LNOA 1V97A 2V4LA 4MT5A 4JWUC 2FNJB 1PQSA 1SE2A 4W9IA 3ZTDA 5H8YE 5D6JB 1OTRB 1EUVB 2AYOB 2QILA 4PS3A 2JXTA 3L13A 4G11A 3B2FA 1WX8A 2WNMA 2BBCA 2JQRB 1BMLC 4RF1A 1EF5A 1C3TA 2R2OA 4DXFA 4KZCA 2NCNA 2N7EA 1ZP0B 5EE9A 1RWSA 1JW9D 4BKTA 2L7RA 4C4VA 2MQJA 3HHMA 3PRMB 3AE6B 5HFYA 3W5VB 1MG8A 1MHXA 3B08A 3D32A 4J6IA 4NQLB 3I63C 1F0ZA 4YTMB 4NJCA 4TMAB 3Q8AA 2ZZPB 2JVCA 1ET9A 2PE6B 1MFWA 1TS2A 2MRPA 2N4FA 3TBLD 4ICVA 4YSZB 3VFKA 3BK2A 1D5XC 2FCMA 3ZUNA 1QZEA 3B1LX 2G1EA 2Z59B 1NVID 3L4PA 2L05A 3EFCA 2GRIA 4REZA 2KANA 2JU6X 3A9KA 3V6EB 4AUQC 2ZCCA 1FCLA 1I4PA 2KWUB 2NVUI 2KDMA 4WIPA 2KFKB 1QQRA 2TSSA 3AU4A 4WWPA 2BYFA 4OZAA 3A1QA 4KVGB 4W9LA 1XO3A 1J7CA 2KDFB 2WDQB 4TKNA 2QDFA 2X8XX 1FXAA 4A20A 2PE9A 2UYZB 4AJYB 4PS8A 2MBHA 3N9YC 2ASQA 3AXCA 3PREA 5E6JA 1N61A 3V61A 4AQ7A 1IGDA 1YQ4B 4OVVA 1GB4A 2SEBD 3N1ZC 2WWZA 1N6ZA 3IAM1 1C4AA 3T9LA 2IY1B 4NAWB 3P2BA 5JHBA 1KFYB 2M1MA 4EKUA 1E0ZA 3Q3FA 1SXTA 3H8HA 4ZHOA 2MEKA 1HEZE 1V1PA 5IAAC 1XLOA 2KTRA 3R2IA 1WWTA 3P4PB 1OEYA 2H89B 1WZ3A 2DHZA 2KWVB 2Z8LA 1RFAA 2RGFA 2W3SA 4P6VF 4HEA1 1YMHE 2LVPA 2CHZA 2V3NA 2LASA 2IDYA 4ZRIA 1FRRA 4XWWA 4RCOA 2MWSB 3I5JC 2JX5A 2WS3B 2QHOA 1D4BA 2W9NA 1YQBA 4MJSA 4LNNA 2PJHA 4G3XB 4IW0A 1MHHE 3ECIA 3JYUA 5HI1A 3KWVA 1YJ1A 3OWEB 1G6JA 3H6NA 2RPQA 1QOBA 2INDC 2K8CA 2L1AA 5TSSA 4A9AA 1YQ3B 2BS2B 5CTRC 2LWPA 5CHVC 1HTQA 2KKCA 2RD0A 4C7YA 2VH2A 1B1ZA 2LGSA 2V1YA 4BVUC 3CIRB 2DZMA 1FEHA 4II3B 1AWDA 3ZDMC 1QT9A 1SJED 3L16A 3P63A 1JROA 1L7YA 1XLNA 3HIZA 2KFJA 4ICUA 1EF1A 3PSEB 2BWFA 1WIAA 2M8SA 1V5OA 2KTFA 4RM9A 1WXSA 2KMAA 2KC2A 5T8IA 3CMMB 1X1MA 2ZNVC 3UI3A 4ANXA 3Q14C 2K3UA 2W55A 2DYOA 2INCC 3H9DA 4JGHB 4F7ZA 3N30A 2BQQA 1JWUD 1VCBA 4K1RB 4KZ0A 1WR1A 1A70A 5G2NA 4MM3B 5EE3A 3VUXA 5CHFA 1OGWA 1F1HA 2CJOA 3EC8A 2D10A 2K25A 4DHZE 5BMIA 4YSYB 1M94A 2M0XA 4MSQB 2KJ6A 1JWAD 4LLGM 2L00B 2OHFA 2ZVNA 1QKZA 3FKYA 2I2YA 1ZDVA 2XK5A 5MPOA 1YN5A 3MHSD 4K3BA 4YT0B 1NDDA 3GE3C 4A3PA 2D3GA 4KGSA 1SF0A 5GXGB 4H2AA 5DCNA 1WY8A 1XEEA 4HK2A 4DXGA 3RNGC 2RMMA 3PHWB 2MBOA 1K50A 4FXCA 3IXSA 4C4VB 3MC0B 1WYWB 3APFA 1I4HA 3N1YC 2IBIB 3AN1A 4G0NB 4AP4C 1HA5A 2D07B 4I6LB 3WAPA 2WXNA 2EELA 1P3QU 3AE9B 4WAFA 2EMSA 2JRIB 2V9HA 3MHZA 3V3XA 2QIEB 2JT4B 4A3OA 1UELA 1V81A 3V05A 2NTTA 2BVCA 1FMAD 2MP2A 5G5GA 3AE2B 4K7UA 1HTOA 2KLGA 1TTNA 3A9KB 1IPGA 4NQKE 3TCAA 2IO0B 1L0XB 2KO3A 3LYYA 3DQVA 3DVNU 5I4DA 3BY4B 4GLSC 2NPTB 2L0FA 2O2VA 3X23A 3TEZA 3EECA 1UBQA 5GMVA 3A1QB 4WURA 3ONSA 4MSMB 2WXKA 1J0GA 1TBEA 4J3OD 3TIXA 1FNVA 1TKYA 1VZ8A 2FIDA 4K3CA 2LMCA 2MW5A 2K39A 3RD2A 4X57B 4TV3A 2G4SA 2WXHA 4GN1A 3KUCB 3DBHI 1QOFA 5HHDG 1NYRA 2XBBC 1ZKHA 1SEBD 3PS6A 4W9JA 4CQNA 4AOFA 2J52A 2K6DB 1C76A 4KSKC 3P4QB 1T5XD 3OAWA 3LDZE 3WAMA 4YTPB 3M95A 1WSPA 3GZNI 4BBNC 3W1SC 4HCPB 1KRHA 2EKEC 3RCZA 2K8HA 4RGOS 5AZHA 1MVKA 3R2TA 4LDTB 1V1PB 2JY6A 1GC7A 3QA8A 3ZJVA 5CX3A 4EZJA 2WQYB 3VQIA 5FR6A 4DQOC 5JXVA 4M0WB 1NI2A 1QILA 1L2NA 2HDEA 2JWZA 2WP9B 1JWBD 3AM9A 2C7MB 4TSSA 3PVLA 4BKSD 2UU7A 1YJIA 1UZXB 2GOWA 1P0RA 3VH4B 1VR9A 5FKAC 3DBRB 2PTLA 2BW2A 1SBBB 2PMVA 1E9MA 3DOWA 1I7HA 1WJ6A 4I6NB 4W9CA 3ZJTA 4MJSB 3AEGB 4B0MA 5DPWA 2KT7A 2GMIC 2L52A 4DK5A 1CMXB 1XD3B 1PFDA 2JSVX 1F77A 1V9JA 3QAQA 3L54A 2INNE 3K9OB 2RSUA 4I6PA 4EZKA 3TSSA 3A9JB 2O6VD 4XZ4A 4ARIA 3ZYYX 1LO5D 3VDZA 1KM7A 2IY0B 1SB3C 2ON8A 2N9LA 4USAA 3SR6A 4AWJA 1GNUA 2L8JA 3L17A 3MP9A 3MJWA 2Q5WD 3NVVA 1WRDB 5AUIA 3KLSX 1PGBA 3N32A 3DBSA 1WFYA 2CR5A 4L2YA 3NZ3A 2WHIA 2DZKA 1EU3A 4XDCA 4OZBA 1AN8A 2WXLA 1LM8B 1ZUD2 5H92C 5DPSA 3IAS1 4PT5A 3RNFC 2ZCBA 1L0YB 2KNBA 3MFGA 1NYQA 2JYEA 2DNFA 3PHXB 4HDOA 1WZ0A 1I35A 4WJQA 4FHKA 2V0GA 1C1YB 2Z0DB 1TZ1A 2LVQA 2QMTA 2HJ1A 3KUDB 3BYYB 4ANUA 4RNAA 1YN4A 4B6WA 3ZIMA 2WGSA 2XK5B 2W82A 1WYGA 1FRDA 3QK0A 2C9WB 1IP9A 1EWCA 3HUIA 5HKHA 4HPPA 1NEKB 4FJYA 1H4RA 2OEDA 3Q6BA 2K1FA 1TJEA 2LRUA 3NHEB 3N20C 4BKGA 4ZRJA 3EA6A 2J42A 1FCCC 2DYMA 4FLHA 3E9SA 1D5MC 2L0TA 5LLIA 1WGDA 2KXJA 2GBJA 5D94A 2CU1A 1WXQA 4XDDA 1FFVA 1ESFA 1XF5L 1SIJA 2C5LC 2LGYA 2W54A 2WU2B 2WXMA 1UD7A 2ZPNA 4XYCA 2FIFA 1QLBB 2LD9A 3ZNID 3H7PA 3AMZA 1PDXA 1V8CA 2MP2B 3ZKJC 2V3PA 4NZLB 4RFBA 3DHIC 2AWTA 1V1OA 1Q5WB 3R7QA 4A6QA 2LJIA 1BUIC 3ZQ4A 1UGJA 1YOVB 2QJLA 3TUOA 3P42A 3BINA 2IO3B 4HKZE 3DWGC 3QX1A 3RZWC 3UQBA 2CKHB 2FUG1 4ZOHC 1LXDA 4LNIA 2KYWA 1P1AA 3TEXA 5JZEB 1XLQA 4M8MA 1FFUA 1L5PA 2YVCA 3IT4B 1E8YA 1LQBA 2GI9A 4AJWA 4N59A 1R7SA 1N5XA 2H88B 1KTKA 3SFEB 1GPXA 3VRBB 3JVZX 3K9PB 5C3JB 3Q3OC 3AEBB 3Q8EA 3OJ4B 1JWMD 3W9CB 3NVWA 3ML8A 1L6VA 5C1ZA 3AECB 2CU3A 2M17A 1L6UA 3Q3NC 3Q8CA 1QF6A 1ZOYB 2LXAA 4GOCA 2C60A 2BB6A 1JWSD 3ZXVA 4L1BA 2GLSA 3EUB2 1E7VA 4HWIB 4DBGA 3GP7A 4EE2A 2C7HA 1DOYA 2Y5PA 5AUKA 1WX9A 1V6EA 4PYUA 3PT2B 2WX0A 3EFUA 2BS4B 3UGBB 3I9V1 4KGTA 5CHWA 3VH3B 3VHTC 2N7JA 2V3SA 2DZIA 1WGRA 3AV8A 1TS5A 3M3JA 4LCDE 3L0WB 4HDQA 2BKFA 2BPSA 1C4CA 1Z5SB 1WE6A 3HM6X 2FCQA 3C19A 3AE1B 1UH6A 4RM8A 4WJOA 2JXXA 3JSVA 2WDVB 4RH6A 2VZKD 2HJ8A 4KDLB 2LZ6A 1FPYA 4PK1A 2R2QA 1XXGA 4MACA 4CO7A 1XLPA 2KX3A 3O65B 3Q3MC 5BMHA 2G9HD 3WCQA 2WXRA 2DX5B 4ZYNA 3AE5B 3VTUA 4ZRQA 3PO0A 3GS2A 3NUHB 2GBKA 3HVZA 2IGGA 2EMTA 2WXQA 5G5HA 1TKGA 2RPVA 1GJZA 1FNWA 1EO6A 4GDLA 4UDUC 1ZPSA 3ZJUA 4P1BC 3OG5A 2INPE 4GB9A 3ZGZA 5EE1A 5E6NA 5IOIA 3NOBA 2KMMA 2HD5B 4AS1A 4URKA 3RNBC 4B9KA 2Z0EB 3ZRFA 3BVGA 4G50A 2A5UA 2FE8A 1WJ4A 3BIID 4BAXA 4RGNA 3I57A 1P98A 4P1CC 4DHJD 4EUTA 2NBWB 1GG3A 5DPTA 2K9XA 4OW0A 1F2RC 3AEAB 4HKQA 4BOZB 1HZ6A 2YEPF 3BWUD 4W9KA 1A5RA 2KVZA 3HRDD 3ALBA 1UWMA 2KN5A 4BFRA 3DDCB 1HE8A 4GDKA 1MI0A 1QOGA 1T3QA 3TEYA 3VTWA 3ZXRA 4GSWA 3RYTA 2D11A 2AL3A 3DCGA 1YD8U 3QHTA 4C7ZA 5DPRA 4C80A 1JRPA 3ZW3A 4W9FA 3ENEA 1WH3A 3A4SC 3TEWA 4JLCA 3RNCC 3Q69A 2B76B 2WX1A 1TT5B 1TYGB 1T0RC 4IWQA 1OQRA 3QQ8B 2M19A 2JPHA 2DZJA 5FR3A 2E6XA 2KQSA 1F52A 2UWQA 3UIOB 2KN4A 4DWFA 1U4AA 4JPSA 2LVOA 5BO4B 4HVBA 3B2GA 5KHOA 3QWZB 3PRPB 5EE0A 1NI3A
chains in the Genus database with same CATH topology
1WF9A 3WA0A 2L05A 1E90A 3VXWA 2KANA 1V9JA 3QAQA 3L54A 5AZGA 3ZNGC 3APDA 4MGYE 5D7GA 3K9OB 3A9KA 3SDLC 3V6EB 2RSUA 3DVNV 4AUQC 5LXIB 1TGZB 3SHQA 4I6PA 2PPHA 2I1KA 3H7PB 4EZKA 3VUWA 4BKSA 3A9JB 3A9JA 2ZCCA 1WGGA 2O6VD 1WM2A 4XZ4A 2KWUB 2NVUI 2N7DA 3VDZA 1KM7A 3WANA 2IY0B 3TMPB 3IVFA 3JW0X 3ZRCA 4HLEA 2DENB 2KFKB 4AWJA 4EFOA 1GNUA 1WMHA 2L8JA 2OOBB 1V49A 3L17A 3MJWA 2KMCA 3AU4A 4WWPA 2BYFA 3A1QA 1SE9A 2LUEA 4KVGB 1WRDB 4W9LA 4M8NA 3IHPC 4FA6A 1AARA 2KDFB 2GBRA 1E5WA 4TKNA 1V5TA 3QC8B 4LDTD 3N32A 4WJNA 3KW5B 3DBSA 4A20A 1WFYA 4AJYB 2PE9A 2UYZB 2CR5A 1SIFA 4IM0A 4MEMA 2KZRA 2ZJDA 4PS8A 2MBHA 2N9PC 2AL6A 3CSFA 3H7SA 5AZFA 2DZKA 3IG3A 3HM3A 4ANWA 2ASQA 3AXCA 1LM8B 3PREA 3V61A 2LJ5A 4OVVA 4EOYA 5DPSA 2NR2A 2O6VA 3V6CB 2J0KA 2WWZA 2ZCBA 3IBEA 2KNBA 3ZO5B 2NBUA 3T9LA 3B0AA 4HDOA 3PHXB 3C0RB 2IY1B 1WZ0A 1I35A 2JUOA 4WJQA 4NAWA 4FHKA 3KYDD 3PRZA 4NAWB 3WIMA 4NPNA 1C1YB 3P2BA 4K7WA 2Z0DB 3WALA 5JHBA 3U30A 2M1MA 4EEWA 4EKUA 1TZ1A 1J8CA 3Q3FA 4FJVB 2LVQA 2KLCA 3NS8A 3KUDB 4MELA 3SD5A 1E7UA 4GXBA 4ANUA 4WJPA 3AULA 3M63B 2CHWA 4TQ1A 3ZDTA 5IAAC 3ZIMA 4B6WA 5J2RA 1JRUA 1IYFA 2KTRA 2KTRB 2XK5B 3S2AA 2ZEQA 2C7NB 1OEYA 3QK0A 1WZ3A 2KWVB 2DHZA 4XC2A 2KDIA 1RFAA 2RGFA 5G55A 2C9WB 2N9EB 2J7QB 2LVPA 1IP9A 2CS4A 2CHZA 3HK0A 5HKHA 4FJYA 2LASA 1H4RA 2DAFA 2JRHA 4HPLB 4GIVA 4ZRIA 2K1FA 3DBRI 2LRUA 3NHEB 4FJZA 2A4ZA 4GU2A 4OVUA 5KHQA 3QJZA 4ZRKA 4BKGA 5LXHA 2NBVB 4ZRJA 3V62A 2MWSB 2DYMA 1SGHA 4FLHA 2L76A 3AU5A 2N1VA 2MSED 3PLUA 2G45B 2L0TA 4JQWC 5E6PA 5L95C 2IZVB 2QHOA 4IC7B 5LLIA 2FCNA 2W9NA 3RULA 2MBBB 5C23A 1WGDA 2KXJA 5D2MB 2GBJA 1YQBA 4MJSA 5D94A 2CU1A 4ZDVA 4LJPB 2PJHA 4G3XB 1VD2A 4IW0A 3QCAA 3ZTCA 2FCSA 1WX7A 1ZGUB 3VTVA 3ECIA 3JYUA 4PYZA 4FHJA 1YJ1A 4MGZE 2BYEA 1G6JA 3H6NA 2C5LC 2LGYA 3X0WA 5JHAA 1R4MI 1WGHA 2LXCA 2RPQA 2K8CA 3DVGX 4W9HA 2KDBA 3U7DA 2J0JA 1UD7A 2ZPNA 2BKRB 2FIFA 4KSLC 5CTRC 2LWPA 2LD9A 5CHVC 3ZNID 3JSVB 3H7PA 2HTHA 2KOXA 2KKCA 2RD0A 2FAZA 5IA7A 3NY5A 2MP2B 2BGFA 3ZKJC 2IYDB 2ZPYA 4NNJB 1OEYJ 1WGYA 2V1YA 2KFKA 4WAAA 2AWTA 1K8RB 4BVUC 4FBJB 4II3B 2DZMA 4CYEA 3RT3B 3PGEA 1Q5WB 2KJHB 3ZDMC 2G3QB 1YIWA 3R7QA 3WAOA 3L16A 1L7YA 4IG7B 4KIKB 2K8BA 3BINA 3HIZA 2KFJA 2MX2A 4ANVA 2IO3B 4EZLA 4ICUA 1EF1A 3PSEB 1D3ZA 2BWFA 3QX1A 4DHZB 1WIAA 2M8SA 2KTFA 1V5OA 2IO2B 3PPAA 3RZWC 3UQBA 2CKHB 2L3ZA 4RM9A 1WXSA 3NZUA 2KMAA 3ZNHB 4GDLB 3U8ZA 2KC2A 1LXDA 3ZVVA 1YX5B 3CMMB 1X1MA 2ZNVC 1GUAB 3CSTA 2XEWA 1E8WA 4ANXA 3PZDA 1P1AA 5JZEB 4W9DA 5AEKB 3AI5A 4M8MA 2KDEB 2DYOA 2YVCA 4JGHB 3H9DA 1ZW7A 1E8YA 3KYCD 1I42A 3UINB 4F7ZA 3ZLZA 1LQBA 4GMVA 3N30A 4WQOB 4AJWA 4MGIE 1VCBA 2WDTB 4K1RB 4KZ0A 1WR1A 5G2NA 4CHKA 3VUXA 2N1WA 5CHFA 1OGWA 2BWES 2BYVE 2GBMA 3JVZX 3K9PB 4IWOA 3EC8A 2D10A 2RR9A 2K25A 4DHZE 2MCNB 1KLVA 3OJ4B 1M94A 4IM3A 2M0XA 4MSQB 2KJ6A 2PEAA 3ML8A 1KOTA 3ZNZB 5C1ZA 2L00B 2M17A 2ZVNA 2MLBA 1WM3A 2LXAA 4GOCA 2C60A 2XK5A 4IUMB 4MGKE 3MTNB 1V2YA 4HPMB 3MHSD 3DBLI 5JH5C 4GGQA 1E7VA 1NDDA 2YLMA 4A3PA 4GDKB 2D3GA 4HWIB 4DBGA 2J0MA 4KV2A 4XX5A 3VUYA 3EHVA 1S1QB 2C7HA 5DCNA 2B3AA 4E3CA 1WY8A 4HK2A 3CF6E 3W1SA 1WX9A 1V6EA 1S3SG 2JF5A 3PHWB 2MBOA 2NS5A 3UQAA 2KD0A 2JZ3B 4DDGD 4PYUA 2BF8B 1RAXA 4FN2A 3R66C 5TR5A 2VRRB 1XQQA 2K6QA 3L10B 2FUHB 3OLMD 1E8ZA 4DHJB 4F8CB 3TJPA 3NZSA 5L83A 3PT2B 4K81A 1WYWB 1BT0A 1LFDA 3APFA 4DDID 1WXAA 2WX0A 3EFUA 3KUZA 2JZZA 3UGBB 5E6OA 2IBIB 2KWCA 2MBQA 4K7SA 5CHWA 1UBIA 4G0NB 1KJTA 1RLFA 3VH3B 3VHTC 4HJKA 4AP4C 1YX6B 2V3SA 4FADA 1Q0WB 2DZIA 1WGRA 2D07B 4I6LB 4E74A 2KQ7A 3M3JA 3PV1A 2KVRA 3L0WB 4LCDE 1WE7A 3WAPA 4HDQA 2BKFA 3SU8X 2BPSA 3RUIB 1Z5SB 1P3QU 1UGMA 1WE6A 2EMSA 5J18A 2JRIB 3HM6X 2FCQA 4MH0E 2LI5A 2MBEA 1UH6A 2LGDA 3UF8A 4JIOU 4RM8A 3M62B 4WJOA 2OJRA 2JXXA 2JT4B 3I3TB 3JSVA 4A3OA 1UELA 1V81A 4JL9A 3DVGY 2HJ8A 4KDLB 2MP2A 3A33B 3PTFC 3KH0A 2IO1B 2LZ6A 2MA9B 2R2QA 3R3MA 4CO7A 2KX3A 1FXTB 3O65B 1F9JA 3R7RA 4K7UA 2DX5B 4WWOA 2LGXA 4ZYNA 3DPDA 3VTUA 4DK5A 2CHXA 2KLGA 2REXA 4F1SA 1TTNA 3A9KB 1IPGA 4IWPA 4KIKA 2D2QA 4NQKE 3TCAA 2KC1A 2IO0B 2WYQA 2GBKA 2KO3A 1R4NI 1V80A 1WI0A 2EMTA 3DQVA 3TL5A 3VVWB 3DVNU 1WR6E 4BOSC 1WJNA 3PLVA 4IM2A 1GJZA 1RRBA 1EO6A 3BY4B 4GDLA 2NPTA 2NPTB 2L0FA 2O2VA 2O2VB 3X23A 3EECA 1WMHB 4W9GA 2Y5BB 3VAWA 1UBQA 4GB9A 5GMVA 1GC6A 3A1QB 5E6NA 3ONSA 2KK8A 3NOBA 4MSMB 3W1YA 1J0GA 1TBEA 2HD5B 2ZVOA 3IFWB 4II2B 4TQ0A 3TIXA 4HXDA 1XT9B 3RZFA 3L08A 4URKA 4B9KA 3A4RA 2Z0EB 3ZRFA 4E71A 2FIDA 4KDIC 4G50A 2KX0A 2MW5A 2K39A 4MM3A 4W9EA 1P9DU 2A5UA 3RD2A 1WJ4A 4X57B 3LJ3A 4TV3A 5EDSA 1WXVA 4HCNB 4ASWC 1V86A 1Z2MA 1P98A 1Q1OA 3V60A 2G4SA 2DYBA 4DHJD 3KVFB 4MDKE 4EUTA 2NBWB 3KUCB 3DBHI 3QIJA 4GN1A 1GG3A 3GOEA 2ZNVB 4NY0A 5DPTA 2XBBC 1ZKHA 3PS6A 4PS7A 1Y8RC 4W9JA 2HE7A 3QARA 1T0YA 2KHWB 4NJ7A 4RMAA 2GBNA 2I1JA 4BOZB 4AOFA 2O6VB 2K6DB 2V4LA 3Q3JA 2FNJB 1PQSA 3ZTDA 4W9IA 4W9KA 4KSKC 5D6JB 1A5RA 3OAWA 3ALBA 3LDZE 3UIPB 3WAMA 2KN5A 4BFRA 1OTRB 3DDCB 1EUVB 3M95A 2AYOB 3GZNI 4PS3A 1HE8A 2M4NA 1ISNA 4GDKA 3L13A 4G11A 1WX8A 2AEHA 3W1SC 4BBNC 4HCPB 3APCA 2EKEC 3ML9A 3RCZA 2K8HA 3VTWA 5AZHA 1EF5A 1C3TA 2R2OA 1H8CA 4KZCA 4LDTB 2JY6A 1GC7A 3QA8A 4LJOB 2NCNA 2N7EA 4GSWA 3RYTA 5CX3A 3N3KB 2D11A 2AL3A 3DCGA 3OJ3A 1YD8U 3QHTA 1OQYA 4EZJA 4BKTA 2L7RA 1WXMA 5DPRA 2MQJA 2N9XA 4FULA 5FR6A 3T8MA 3VQIA 3HHMA 2DAJA 3ZW3A 4W9FA 4M0WB 1NI2A 2G4DB 3ENEA 3PRMB 1L2NA 1WH3A 3A4SC 2JWZA 2C7MB 1MG8A 4YL8A 4TUUA 3PVLA 2LRWA 4BKSD 4JLCA 2GOWA 1UZXB 3B08A 3D32A 4J6IA 4N9F4 4NQLB 1P0RA 2KJRA 3H1UA 3VH4B 2WX1A 1NBFC 4IWQA 4P7IA 3QQ8B 2ZZPB 2JPHA 4NJ6A 2DZJA 2JVCA 2PE6B 2KQSA 3UIOB 1E8XA 2UWQA 3DOWA 5J17A 4DWFA 1WJ6A 1J19A 1U4AA 4I6NB 4B95A 4W9CA 2LVOA 2MRPA 5BO4B 4HVBA 4DXAB 4MJSB 1WJUA 4WWNA 4BBNF 5KHOA 2N4FA 3TBLD 4ICVA 5DPWA 3QWZB 3VFKA 2GMIC 2FCMA 3ZUNA 1QZEA 3PRPB 3B1LX 1CMXB 1XD3B 2Z59B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WF9 A;  3WA0 A;  2L05 A;  1E90 A;  3VXW A;  2KAN A;  1V9J A;  3QAQ A;  3L54 A;  5AZG A;  3ZNG C;  3APD A;  4MGY E;  5D7G A;  3K9O B;  3A9K A;  3SDL C;  3V6E B;  2RSU A;  3DVN V;  4AUQ C;  5LXI B;  1TGZ B;  3SHQ A;  4I6P A;  2PPH A;  2I1K A;  3H7P B;  4EZK A;  3VUW A;  4BKS A;  3A9J B;  3A9J A;  2ZCC A;  1WGG A;  2O6V D;  1WM2 A;  4XZ4 A;  2KWU B;  2NVU I;  2N7D A;  3VDZ A;  1KM7 A;  3WAN A;  2IY0 B;  3TMP B;  3IVF A;  3JW0 X;  3ZRC A;  4HLE A;  2DEN B;  2KFK B;  4AWJ A;  4EFO A;  1GNU A;  1WMH A;  2L8J A;  2OOB B;  1V49 A;  3L17 A;  3MJW A;  2KMC A;  3AU4 A;  4WWP A;  2BYF A;  3A1Q A;  1SE9 A;  2LUE A;  4KVG B;  1WRD B;  4W9L A;  4M8N A;  3IHP C;  4FA6 A;  1AAR A;  2KDF B;  2GBR A;  1E5W A;  4TKN A;  1V5T A;  3QC8 B;  4LDT D;  3N32 A;  4WJN A;  3KW5 B;  3DBS A;  4A20 A;  1WFY A;  4AJY B;  2PE9 A;  2UYZ B;  2CR5 A;  1SIF A;  4IM0 A;  4MEM A;  2KZR A;  2ZJD A;  4PS8 A;  2MBH A;  2N9P C;  2AL6 A;  3CSF A;  3H7S A;  5AZF A;  2DZK A;  3IG3 A;  3HM3 A;  4ANW A;  2ASQ A;  3AXC A;  1LM8 B;  3PRE A;  3V61 A;  2LJ5 A;  4OVV A;  4EOY A;  5DPS A;  2NR2 A;  2O6V A;  3V6C B;  2J0K A;  2WWZ A;  2ZCB A;  3IBE A;  2KNB A;  3ZO5 B;  2NBU A;  3T9L A;  3B0A A;  4HDO A;  3PHX B;  3C0R B;  2IY1 B;  1WZ0 A;  1I35 A;  2JUO A;  4WJQ A;  4NAW A;  4FHK A;  3KYD D;  3PRZ A;  4NAW B;  3WIM A;  4NPN A;  1C1Y B;  3P2B A;  4K7W A;  2Z0D B;  3WAL A;  5JHB A;  3U30 A;  2M1M A;  4EEW A;  4EKU A;  1TZ1 A;  1J8C A;  3Q3F A;  4FJV B;  2LVQ A;  2KLC A;  3NS8 A;  3KUD B;  4MEL A;  3SD5 A;  1E7U A;  4GXB A;  4ANU A;  4WJP A;  3AUL A;  3M63 B;  2CHW A;  4TQ1 A;  3ZDT A;  5IAA C;  3ZIM A;  4B6W A;  5J2R A;  1JRU A;  1IYF A;  2KTR A;  2KTR B;  2XK5 B;  3S2A A;  2ZEQ A;  2C7N B;  1OEY A;  3QK0 A;  1WZ3 A;  2KWV B;  2DHZ A;  4XC2 A;  2KDI A;  1RFA A;  2RGF A;  5G55 A;  2C9W B;  2N9E B;  2J7Q B;  2LVP A;  1IP9 A;  2CS4 A;  2CHZ A;  3HK0 A;  5HKH A;  4FJY A;  2LAS A;  1H4R A;  2DAF A;  2JRH A;  4HPL B;  4GIV A;  4ZRI A;  2K1F A;  3DBR I;  2LRU A;  3NHE B;  4FJZ A;  2A4Z A;  4GU2 A;  4OVU A;  5KHQ A;  3QJZ A;  4ZRK A;  4BKG A;  5LXH A;  2NBV B;  4ZRJ A;  3V62 A;  2MWS B;  2DYM A;  1SGH A;  4FLH A;  2L76 A;  3AU5 A;  2N1V A;  2MSE D;  3PLU A;  2G45 B;  2L0T A;  4JQW C;  5E6P A;  5L95 C;  2IZV B;  2QHO A;  4IC7 B;  5LLI A;  2FCN A;  2W9N A;  3RUL A;  2MBB B;  5C23 A;  1WGD A;  2KXJ A;  5D2M B;  2GBJ A;  1YQB A;  4MJS A;  5D94 A;  2CU1 A;  4ZDV A;  4LJP B;  2PJH A;  4G3X B;  1VD2 A;  4IW0 A;  3QCA A;  3ZTC A;  2FCS A;  1WX7 A;  1ZGU B;  3VTV A;  3ECI A;  3JYU A;  4PYZ A;  4FHJ A;  1YJ1 A;  4MGZ E;  2BYE A;  1G6J A;  3H6N A;  2C5L C;  2LGY A;  3X0W A;  5JHA A;  1R4M I;  1WGH A;  2LXC A;  2RPQ A;  2K8C A;  3DVG X;  4W9H A;  2KDB A;  3U7D A;  2J0J A;  1UD7 A;  2ZPN A;  2BKR B;  2FIF A;  4KSL C;  5CTR C;  2LWP A;  2LD9 A;  5CHV C;  3ZNI D;  3JSV B;  3H7P A;  2HTH A;  2KOX A;  2KKC A;  2RD0 A;  2FAZ A;  5IA7 A;  3NY5 A;  2MP2 B;  2BGF A;  3ZKJ C;  2IYD B;  2ZPY A;  4NNJ B;  1OEY J;  1WGY A;  2V1Y A;  2KFK A;  4WAA A;  2AWT A;  1K8R B;  4BVU C;  4FBJ B;  4II3 B;  2DZM A;  4CYE A;  3RT3 B;  3PGE A;  1Q5W B;  2KJH B;  3ZDM C;  2G3Q B;  1YIW A;  3R7Q A;  3WAO A;  3L16 A;  1L7Y A;  4IG7 B;  4KIK B;  2K8B A;  3BIN A;  3HIZ A;  2KFJ A;  2MX2 A;  4ANV A;  2IO3 B;  4EZL A;  4ICU A;  1EF1 A;  3PSE B;  1D3Z A;  2BWF A;  3QX1 A;  4DHZ B;  1WIA A;  2M8S A;  2KTF A;  1V5O A;  2IO2 B;  3PPA A;  3RZW C;  3UQB A;  2CKH B;  2L3Z A;  4RM9 A;  1WXS A;  3NZU A;  2KMA A;  3ZNH B;  4GDL B;  3U8Z A;  2KC2 A;  1LXD A;  3ZVV A;  1YX5 B;  3CMM B;  1X1M A;  2ZNV C;  1GUA B;  3CST A;  2XEW A;  1E8W A;  4ANX A;  3PZD A;  1P1A A;  5JZE B;  4W9D A;  5AEK B;  3AI5 A;  4M8M A;  2KDE B;  2DYO A;  2YVC A;  4JGH B;  3H9D A;  1ZW7 A;  1E8Y A;  3KYC D;  1I42 A;  3UIN B;  4F7Z A;  3ZLZ A;  1LQB A;  4GMV A;  3N30 A;  4WQO B;  4AJW A;  4MGI E;  1VCB A;  2WDT B;  4K1R B;  4KZ0 A;  1WR1 A;  5G2N A;  4CHK A;  3VUX A;  2N1W A;  5CHF A;  1OGW A;  2BWE S;  2BYV E;  2GBM A;  3JVZ X;  3K9P B;  4IWO A;  3EC8 A;  2D10 A;  2RR9 A;  2K25 A;  4DHZ E;  2MCN B;  1KLV A;  3OJ4 B;  1M94 A;  4IM3 A;  2M0X A;  4MSQ B;  2KJ6 A;  2PEA A;  3ML8 A;  1KOT A;  3ZNZ B;  5C1Z A;  2L00 B;  2M17 A;  2ZVN A;  2MLB A;  1WM3 A;  2LXA A;  4GOC A;  2C60 A;  2XK5 A;  4IUM B;  4MGK E;  3MTN B;  1V2Y A;  4HPM B;  3MHS D;  3DBL I;  5JH5 C;  4GGQ A;  1E7V A;  1NDD A;  2YLM A;  4A3P A;  4GDK B;  2D3G A;  4HWI B;  4DBG A;  2J0M A;  4KV2 A;  4XX5 A;  3VUY A;  3EHV A;  1S1Q B;  2C7H A;  5DCN A;  2B3A A;  4E3C A;  1WY8 A;  4HK2 A;  3CF6 E;  3W1S A;  1WX9 A;  1V6E A;  1S3S G;  2JF5 A;  3PHW B;  2MBO A;  2NS5 A;  3UQA A;  2KD0 A;  2JZ3 B;  4DDG D;  4PYU A;  2BF8 B;  1RAX A;  4FN2 A;  3R66 C;  5TR5 A;  2VRR B;  1XQQ A;  2K6Q A;  3L10 B;  2FUH B;  3OLM D;  1E8Z A;  4DHJ B;  4F8C B;  3TJP A;  3NZS A;  5L83 A;  3PT2 B;  4K81 A;  1WYW B;  1BT0 A;  1LFD A;  3APF A;  4DDI D;  1WXA A;  2WX0 A;  3EFU A;  3KUZ A;  2JZZ A;  3UGB B;  5E6O A;  2IBI B;  2KWC A;  2MBQ A;  4K7S A;  5CHW A;  1UBI A;  4G0N B;  1KJT A;  1RLF A;  3VH3 B;  3VHT C;  4HJK A;  4AP4 C;  1YX6 B;  2V3S A;  4FAD A;  1Q0W B;  2DZI A;  1WGR A;  2D07 B;  4I6L B;  4E74 A;  2KQ7 A;  3M3J A;  3PV1 A;  2KVR A;  3L0W B;  4LCD E;  1WE7 A;  3WAP A;  4HDQ A;  2BKF A;  3SU8 X;  2BPS A;  3RUI B;  1Z5S B;  1P3Q U;  1UGM A;  1WE6 A;  2EMS A;  5J18 A;  2JRI B;  3HM6 X;  2FCQ A;  4MH0 E;  2LI5 A;  2MBE A;  1UH6 A;  2LGD A;  3UF8 A;  4JIO U;  4RM8 A;  3M62 B;  4WJO A;  2OJR A;  2JXX A;  2JT4 B;  3I3T B;  3JSV A;  4A3O A;  1UEL A;  1V81 A;  4JL9 A;  3DVG Y;  2HJ8 A;  4KDL B;  2MP2 A;  3A33 B;  3PTF C;  3KH0 A;  2IO1 B;  2LZ6 A;  2MA9 B;  2R2Q A;  3R3M A;  4CO7 A;  2KX3 A;  1FXT B;  3O65 B;  1F9J A;  3R7R A;  4K7U A;  2DX5 B;  4WWO A;  2LGX A;  4ZYN A;  3DPD A;  3VTU A;  4DK5 A;  2CHX A;  2KLG A;  2REX A;  4F1S A;  1TTN A;  3A9K B;  1IPG A;  4IWP A;  4KIK A;  2D2Q A;  4NQK E;  3TCA A;  2KC1 A;  2IO0 B;  2WYQ A;  2GBK A;  2KO3 A;  1R4N I;  1V80 A;  1WI0 A;  2EMT A;  3DQV A;  3TL5 A;  3VVW B;  3DVN U;  1WR6 E;  4BOS C;  1WJN A;  3PLV A;  4IM2 A;  1GJZ A;  1RRB A;  1EO6 A;  3BY4 B;  4GDL A;  2NPT A;  2NPT B;  2L0F A;  2O2V A;  2O2V B;  3X23 A;  3EEC A;  1WMH B;  4W9G A;  2Y5B B;  3VAW A;  1UBQ A;  4GB9 A;  5GMV A;  1GC6 A;  3A1Q B;  5E6N A;  3ONS A;  2KK8 A;  3NOB A;  4MSM B;  3W1Y A;  1J0G A;  1TBE A;  2HD5 B;  2ZVO A;  3IFW B;  4II2 B;  4TQ0 A;  3TIX A;  4HXD A;  1XT9 B;  3RZF A;  3L08 A;  4URK A;  4B9K A;  3A4R A;  2Z0E B;  3ZRF A;  4E71 A;  2FID A;  4KDI C;  4G50 A;  2KX0 A;  2MW5 A;  2K39 A;  4MM3 A;  4W9E A;  1P9D U;  2A5U A;  3RD2 A;  1WJ4 A;  4X57 B;  3LJ3 A;  4TV3 A;  5EDS A;  1WXV A;  4HCN B;  4ASW C;  1V86 A;  1Z2M A;  1P98 A;  1Q1O A;  3V60 A;  2G4S A;  2DYB A;  4DHJ D;  3KVF B;  4MDK E;  4EUT A;  2NBW B;  3KUC B;  3DBH I;  3QIJ A;  4GN1 A;  1GG3 A;  3GOE A;  2ZNV B;  4NY0 A;  5DPT A;  2XBB C;  1ZKH A;  3PS6 A;  4PS7 A;  1Y8R C;  4W9J A;  2HE7 A;  3QAR A;  1T0Y A;  2KHW B;  4NJ7 A;  4RMA A;  2GBN A;  2I1J A;  4BOZ B;  4AOF A;  2O6V B;  2K6D B;  2V4L A;  3Q3J A;  2FNJ B;  1PQS A;  3ZTD A;  4W9I A;  4W9K A;  4KSK C;  5D6J B;  1A5R A;  3OAW A;  3ALB A;  3LDZ E;  3UIP B;  3WAM A;  2KN5 A;  4BFR A;  1OTR B;  3DDC B;  1EUV B;  3M95 A;  2AYO B;  3GZN I;  4PS3 A;  1HE8 A;  2M4N A;  1ISN A;  4GDK A;  3L13 A;  4G11 A;  1WX8 A;  2AEH A;  3W1S C;  4BBN C;  4HCP B;  3APC A;  2EKE C;  3ML9 A;  3RCZ A;  2K8H A;  3VTW A;  5AZH A;  1EF5 A;  1C3T A;  2R2O A;  1H8C A;  4KZC A;  4LDT B;  2JY6 A;  1GC7 A;  3QA8 A;  4LJO B;  2NCN A;  2N7E A;  4GSW A;  3RYT A;  5CX3 A;  3N3K B;  2D11 A;  2AL3 A;  3DCG A;  3OJ3 A;  1YD8 U;  3QHT A;  1OQY A;  4EZJ A;  4BKT A;  2L7R A;  1WXM A;  5DPR A;  2MQJ A;  2N9X A;  4FUL A;  5FR6 A;  3T8M A;  3VQI A;  3HHM A;  2DAJ A;  3ZW3 A;  4W9F A;  4M0W B;  1NI2 A;  2G4D B;  3ENE A;  3PRM B;  1L2N A;  1WH3 A;  3A4S C;  2JWZ A;  2C7M B;  1MG8 A;  4YL8 A;  4TUU A;  3PVL A;  2LRW A;  4BKS D;  4JLC A;  2GOW A;  1UZX B;  3B08 A;  3D32 A;  4J6I A;  4N9F 4;  4NQL B;  1P0R A;  2KJR A;  3H1U A;  3VH4 B;  2WX1 A;  1NBF C;  4IWQ A;  4P7I A;  3QQ8 B;  2ZZP B;  2JPH A;  4NJ6 A;  2DZJ A;  2JVC A;  2PE6 B;  2KQS A;  3UIO B;  1E8X A;  2UWQ A;  3DOW A;  5J17 A;  4DWF A;  1WJ6 A;  1J19 A;  1U4A A;  4I6N B;  4B95 A;  4W9C A;  2LVO A;  2MRP A;  5BO4 B;  4HVB A;  4DXA B;  4MJS B;  1WJU A;  4WWN A;  4BBN F;  5KHO A;  2N4F A;  3TBL D;  4ICV A;  5DPW A;  3QWZ B;  3VFK A;  2GMI C;  2FCM A;  3ZUN A;  1QZE A;  3PRP B;  3B1L X;  1CMX B;  1XD3 B;  2Z59 B; 
#chains in the Genus database with same CATH topology
 1WF9 A;  2RDG A;  3AEF B;  1SE3 A;  1E90 A;  3VXW A;  2EKI A;  2QC8 A;  2Y5C A;  1E6E B;  4Q2J A;  3SDL C;  1HZ5 A;  4WWM A;  1PUT A;  3BVZ A;  2KQ4 X;  3SHQ A;  4OHJ A;  2PPH A;  2I1K A;  1R4M B;  3H7P B;  1GB1 A;  1M4V A;  5IP4 D;  4BKS A;  3NJT A;  1WM2 A;  1RYJ A;  2M56 B;  2V4I B;  3WAN A;  3IVF A;  3JW0 X;  2DEN B;  2JYT A;  4LNK A;  4ARC A;  4R3D A;  2OOB B;  2KMC A;  1KLU D;  2LUE A;  4M8N A;  1ACC A;  3IT6 B;  4FA6 A;  1C79 A;  3QC8 B;  4M02 A;  3KW5 B;  4HJG E;  2MJE A;  1LGR A;  1SIF A;  2J53 A;  4B0E A;  2N9P C;  4US9 A;  2AL6 A;  1FO4 A;  3HM3 A;  4ANW A;  3CWI A;  1ZXI A;  2LJ5 A;  3VRA B;  4EOY A;  1C77 A;  3FAH A;  1MJD A;  2O6V A;  3V6C B;  2J0K A;  3IBE A;  3ZO5 B;  3B0A A;  2JUO A;  4NAW A;  3PRZ A;  4K7W A;  3WAL A;  1AW7 A;  2LHD A;  4EEW A;  1J8C A;  1RM6 C;  4FJV B;  2KLC A;  2WXO A;  4MEL A;  3SD5 A;  4GXB A;  1JCK B;  4LTU A;  3AUL A;  2L83 A;  2CHW A;  4TQ1 A;  3ZDT A;  5J2R A;  1K51 A;  1IYF A;  2KTR B;  1C4P A;  2MJ3 A;  2DBY A;  1RFK A;  2C7N B;  3NRZ A;  2PKO A;  2KDI A;  5G55 A;  3U7Z A;  2J7Q B;  3DHH C;  3LB8 C;  2DAF A;  2JRH A;  4HPL B;  2WU5 B;  2N0S B;  1E10 A;  3DBR I;  1L4Z B;  4GU2 A;  5KHQ A;  4ZRK A;  5LXH A;  2NBV B;  3V62 A;  2DWQ A;  2L76 A;  3AU5 A;  2MSE D;  3PLU A;  2MHJ A;  5E6P A;  4JQW C;  2IZV B;  3MC8 A;  4YTN B;  2LGI A;  3FIL A;  3RUL A;  5C23 A;  2LEK A;  3AED B;  4ZDV A;  4LJP B;  4HRS A;  3QCA A;  2FCS A;  3VTV A;  2W3R A;  4FHJ A;  2BYE A;  3VR8 B;  2WXP A;  2DLB A;  2KAC A;  5JHA A;  1WGH A;  1K53 A;  4W9H A;  3P4R B;  3U7D A;  2R61 A;  3JSV B;  3O13 A;  1JAL A;  5IA7 A;  1EWY C;  2ZPY A;  4NNJ B;  1OEY J;  1WGY A;  1HXY D;  4WAA A;  4FBJ B;  4RF0 A;  4CYE A;  1UF0 A;  4A90 A;  3PGE A;  1TKE A;  1VLB A;  3WAO A;  3RNA C;  2K8B A;  4ANV A;  1D3Z A;  4YWG G;  1D5Z C;  2WXJ A;  2L3Z A;  4GDL B;  2BT6 A;  1R4N B;  3RN9 C;  4P16 A;  4ITK A;  1E8W A;  3PZD A;  4YSX B;  5AEK B;  3AI5 A;  2KDE B;  3KYC D;  1I42 A;  3UIN B;  2WDT B;  1VDV A;  2KAJ A;  1MG4 A;  4CHK A;  1C9F A;  2N1W A;  4IOI E;  1VRA B;  5D3I B;  2FBW B;  2GBM A;  1ZXH A;  5IN7 A;  4IWO A;  2AQ2 B;  1IBX A;  4IM3 A;  3NVY A;  2PEA A;  2WDR B;  1GAQ B;  1F2R I;  3U52 E;  2Y3A A;  1WM3 A;  3BZD B;  5D3D A;  3MTN B;  2K0P A;  2D3C A;  3DBL I;  5JH5 C;  4GGQ A;  1B9R A;  1L0V B;  1YJJ A;  2WXF A;  4GDK B;  3NG0 A;  2J0M A;  4KV2 A;  4XX5 A;  3EHV A;  3DBL B;  4HRO A;  2B3A A;  1VZ7 A;  1N60 A;  1S3S G;  2NS5 A;  4IDI A;  3UQA A;  1P7F A;  2JZ3 B;  2AQ3 B;  4DDG D;  2BF8 B;  3LXF A;  4BZA A;  1RAX A;  2L32 A;  3R66 C;  4FN2 A;  1ZE3 D;  1MPE A;  2FUH B;  1E8Z A;  3TJP A;  1IGC A;  4K81 A;  1BT0 A;  1WXA A;  1XCQ L;  3GB1 A;  2JZZ A;  5E6O A;  4K7S A;  2KWC A;  4HJK A;  4FAD A;  1Q0W B;  4E74 A;  2KQ7 A;  2KVR A;  1JQ4 A;  4S17 A;  1UGM A;  5J18 A;  4MH0 E;  1CZP A;  2MBE A;  2ZW1 A;  2LGD A;  3UF8 A;  4JIO U;  1IUE A;  5BYS A;  4JL9 A;  1GOZ A;  3DVG Y;  1Y56 A;  4US8 A;  3U2S C;  3KH0 A;  2IO1 B;  1FXT B;  1F9J A;  3E56 A;  4WWO A;  5LNK 1;  3DPD A;  1I4X A;  2CHX A;  4F1S A;  4IWP A;  1VJK A;  4KIK A;  2D2Q A;  2KC1 A;  2WYQ A;  5IKC M;  1NEN B;  1WI0 A;  1V80 A;  2I38 A;  3VVW B;  1WJN A;  1C78 A;  3PLV A;  1RRB A;  2NPT A;  2O2V B;  2Y5B B;  3VAW A;  1GC6 A;  4XWT A;  2KK8 A;  3W1Y A;  2ZVO A;  3FC4 A;  4II2 B;  4HXD A;  1XT9 B;  3L08 A;  1J7B A;  1KH0 A;  3A4R A;  2D3A A;  1N63 A;  1WRI A;  1VZ6 A;  1DOI A;  2KX0 A;  1WXV A;  2QCZ A;  2ONQ A;  4HCN B;  1V86 A;  1Z2M A;  2DYB A;  4MDK E;  4WH4 A;  1YN3 A;  3GOE A;  3MC9 A;  4NY0 A;  1T0Y A;  2KHW B;  4N6E B;  2BB5 A;  5FK9 C;  2GBN A;  1FXI A;  2O6V B;  1PGA A;  1SE4 A;  3Q3J A;  3UIP B;  2M4N A;  3SFD B;  1ISN A;  2AEH A;  1N5W A;  3APC A;  3ML9 A;  2AQ1 B;  4L23 A;  1H8C A;  1E7P B;  4LJO B;  2LHE A;  1UUP A;  2WXI A;  3N3K B;  3OJ3 A;  1I4G A;  4C56 C;  2BYT A;  1OQY A;  4YXD B;  3DHG C;  1XCT L;  1WXM A;  2NTS A;  2N9X A;  4FUL A;  4JWS C;  3T8M A;  2DAJ A;  4M0W A;  2G4D B;  5C2T B;  4YL8 A;  4TUU A;  2LRW A;  4XE0 A;  3U4E G;  2D3B A;  4N9F 4;  2KJR A;  3H1U A;  1QOA A;  1NBF C;  3Q8F A;  1EU4 A;  4P7I A;  4NJ6 A;  5J17 A;  1E8X A;  2CJN A;  1J19 A;  3FIL B;  4B95 A;  2JZP A;  4DXA B;  1WJU A;  3AE7 B;  4WWN A;  4BBN F;  3J9C A;  3C8Y A;  3RFZ B;  3WA0 A;  5IO9 A;  4S0R A;  5AZG A;  3ZNG C;  3APD A;  3Q8B A;  4MGY E;  5D7G A;  3P1M A;  3DVN V;  5LXI B;  1TGZ B;  3W5U B;  4ACF A;  2X38 A;  3VUW A;  3A9J A;  2LFI A;  1WGG A;  2N7D A;  1L4D B;  3ZRC A;  3TMP B;  4HLE A;  2IGH A;  1DGJ A;  4EFO A;  1FNU A;  1WMH A;  1V49 A;  4OVZ A;  1SE9 A;  2JWU A;  3IHP C;  4KX6 B;  5HG2 A;  1AAR A;  4NAM A;  2GBR A;  1E5W A;  1V5T A;  3URY A;  3AB5 A;  4LDT D;  4WJN A;  4ZHP A;  2PLP A;  2YEP B;  1PGX A;  4IM0 A;  4MEM A;  2KZR A;  2ZJD A;  3CSF A;  3H7S A;  5AZF A;  3IG3 A;  3T3N A;  2NR2 A;  4RGM A;  2OJW A;  3PZ8 A;  1T0Q C;  1SSN A;  1TY2 A;  4KKI A;  2NBU A;  3KWL A;  3C0R B;  2RDH A;  1WGK A;  3KYD D;  3WIM A;  1IBX B;  4A8X C;  3KQ4 A;  4NPN A;  2IPK D;  3U30 A;  2GB1 A;  2D5G A;  3NS8 A;  1E7U A;  2IGD A;  4WJP A;  3M63 B;  1KLG D;  4JE3 B;  2M0A A;  4O1N A;  1JRU A;  3S2A A;  2SAK A;  3B9J A;  2ZEQ A;  1DYQ A;  1I4Q A;  2PVO D;  4XC2 A;  2N9E B;  1K52 A;  2CS4 A;  3HK0 A;  3DWM A;  3ABV B;  1CQV A;  4GIV A;  4LK0 M;  1N62 A;  4FJZ A;  2N9K A;  2A4Z A;  4OVU A;  3QJZ A;  1SGH A;  3AH7 A;  1D6E C;  2N1V A;  2G45 B;  5L95 C;  3NS1 A;  4IC7 B;  5BMG A;  2FCN A;  3PZ7 A;  2MBB B;  1Q10 A;  5D2M B;  5BYR A;  4ZYS A;  3AE4 B;  2WLB A;  1VD2 A;  3ZTC A;  1WX7 A;  1ZGU B;  4PYZ A;  1P7E A;  2QEJ C;  4MGZ E;  3Q2A C;  1TY0 A;  3X0W A;  1R4M I;  2LXC A;  4QAY A;  3DVG X;  2KDB A;  2J0J A;  2XNA C;  2BKR B;  4M00 A;  4KSL C;  1I4R A;  1KF6 B;  2HTH A;  4RGT A;  2KOX A;  3AE8 B;  2FAZ A;  4XGA B;  3NY5 A;  2BGF A;  2IYD B;  3RNE C;  4KKJ A;  1YNT E;  2KFK A;  2QSD A;  1K8R B;  1PYW D;  3RT3 B;  3MJ5 A;  2KJH B;  2G3Q B;  2PIA A;  1YIW A;  4IG7 B;  4KIK B;  2MX2 A;  4WQM A;  4EZL A;  2K5P A;  4N58 A;  1EM7 A;  4DHZ B;  2IO2 B;  3PPA A;  1UNS A;  3NZU A;  3ZNH B;  3U8Z A;  3ZVV A;  2J4X A;  1YX5 B;  1GUA B;  3CST A;  2XEW A;  2MH7 A;  4W9D A;  3N1X C;  2VH1 A;  3AEE B;  1ZW7 A;  3ZLZ A;  4GMV A;  1TS4 A;  4WQO B;  4MGI E;  3BVM A;  1OQQ A;  2VZK B;  2BWE S;  2BYV E;  2KWD A;  1JML A;  2BTE A;  1HQR D;  3BYT B;  4MH8 A;  2RR9 A;  1KLV A;  2MCN B;  1BXT A;  1SJH D;  3GE8 C;  1KOT A;  3ZNZ B;  1DOX A;  2MLB A;  3DBH B;  4IUM B;  4MGK E;  1V2Y A;  2E3T A;  4HPM B;  2NMQ A;  2ZW0 A;  2YLM A;  1TIF A;  3VUY A;  4M01 A;  1S1Q B;  2XN9 C;  4E3C A;  1ENF A;  3GZN B;  3CF6 E;  4ZRP A;  3W1S A;  2JF5 A;  2PW9 A;  1UWX A;  2KD0 A;  4KGR A;  1ROE A;  4OZC A;  5TR5 A;  2VRR B;  4JX1 C;  1XQQ A;  2K6Q A;  3L10 B;  3OLM D;  4DHJ B;  4F8C B;  3NZS A;  5L83 A;  1LFD A;  4DDI D;  1FM0 D;  2MJD A;  3KUZ A;  1T6B X;  2MBQ A;  1STE A;  1UBI A;  1KJT A;  1RLF A;  1AYF A;  3T3O A;  1YX6 B;  3PV1 A;  1WE7 A;  1TS3 A;  2IJ0 A;  4A55 A;  3SU8 X;  3RUI B;  3VR9 B;  3HVD A;  2LI5 A;  2WXG A;  2LUM A;  1TZO A;  3M62 B;  2OJR A;  3I3T B;  2K22 A;  2HTM E;  3A33 B;  3P4S B;  3PTF C;  3W2D A;  3EGR A;  2MA9 B;  3R3M A;  3R7R A;  1CJE A;  2LGX A;  2REX A;  1J7A A;  4LNF A;  1OFF A;  3R8B A;  4IKG A;  2ACZ B;  3NVZ A;  1R4N I;  3TL5 A;  1WR6 E;  4BOS C;  5BYQ A;  4IM2 A;  2BS3 B;  1WMH B;  4W9G A;  3RI7 C;  1ZDX A;  1T0S C;  3IFW B;  4TQ0 A;  3SEB A;  2ICI A;  3AE3 B;  1CK1 A;  3RZF A;  2AX5 A;  4E71 A;  4KDI C;  4C00 A;  4MM3 A;  2PVG C;  4W9E A;  1P9D U;  1FD6 A;  3LJ3 A;  5EDS A;  1ET6 A;  3RPF C;  4ASW C;  1Q1O A;  3V60 A;  3ETR A;  3KVF B;  3QIJ A;  2RDB C;  2ZNV B;  1FIQ A;  4PS7 A;  3BK1 A;  1Y8R C;  2HE7 A;  4D2K A;  3QAR A;  3RMK C;  4NJ7 A;  4RMA A;  2I1J A;  4LNO A;  1V97 A;  2V4L A;  4MT5 A;  4JWU C;  2FNJ B;  1PQS A;  1SE2 A;  4W9I A;  3ZTD A;  5H8Y E;  5D6J B;  1OTR B;  1EUV B;  2AYO B;  2QIL A;  4PS3 A;  2JXT A;  3L13 A;  4G11 A;  3B2F A;  1WX8 A;  2WNM A;  2BBC A;  2JQR B;  1BML C;  4RF1 A;  1EF5 A;  1C3T A;  2R2O A;  4DXF A;  4KZC A;  2NCN A;  2N7E A;  1ZP0 B;  5EE9 A;  1RWS A;  1JW9 D;  4BKT A;  2L7R A;  4C4V A;  2MQJ A;  3HHM A;  3PRM B;  3AE6 B;  5HFY A;  3W5V B;  1MG8 A;  1MHX A;  3B08 A;  3D32 A;  4J6I A;  4NQL B;  3I63 C;  1F0Z A;  4YTM B;  4NJC A;  4TMA B;  3Q8A A;  2ZZP B;  2JVC A;  1ET9 A;  2PE6 B;  1MFW A;  1TS2 A;  2MRP A;  2N4F A;  3TBL D;  4ICV A;  4YSZ B;  3VFK A;  3BK2 A;  1D5X C;  2FCM A;  3ZUN A;  1QZE A;  3B1L X;  2G1E A;  2Z59 B;  1NVI D;  3L4P A;  2L05 A;  3EFC A;  2GRI A;  4REZ A;  2KAN A;  2JU6 X;  3A9K A;  3V6E B;  4AUQ C;  2ZCC A;  1FCL A;  1I4P A;  2KWU B;  2NVU I;  2KDM A;  4WIP A;  2KFK B;  1QQR A;  2TSS A;  3AU4 A;  4WWP A;  2BYF A;  4OZA A;  3A1Q A;  4KVG B;  4W9L A;  1XO3 A;  1J7C A;  2KDF B;  2WDQ B;  4TKN A;  2QDF A;  2X8X X;  1FXA A;  4A20 A;  2PE9 A;  2UYZ B;  4AJY B;  4PS8 A;  2MBH A;  3N9Y C;  2ASQ A;  3AXC A;  3PRE A;  5E6J A;  1N61 A;  3V61 A;  4AQ7 A;  1IGD A;  1YQ4 B;  4OVV A;  1GB4 A;  2SEB D;  3N1Z C;  2WWZ A;  1N6Z A;  3IAM 1;  1C4A A;  3T9L A;  2IY1 B;  4NAW B;  3P2B A;  5JHB A;  1KFY B;  2M1M A;  4EKU A;  1E0Z A;  3Q3F A;  1SXT A;  3H8H A;  4ZHO A;  2MEK A;  1HEZ E;  1V1P A;  5IAA C;  1XLO A;  2KTR A;  3R2I A;  1WWT A;  3P4P B;  1OEY A;  2H89 B;  1WZ3 A;  2DHZ A;  2KWV B;  2Z8L A;  1RFA A;  2RGF A;  2W3S A;  4P6V F;  4HEA 1;  1YMH E;  2LVP A;  2CHZ A;  2V3N A;  2LAS A;  2IDY A;  4ZRI A;  1FRR A;  4XWW A;  4RCO A;  2MWS B;  3I5J C;  2JX5 A;  2WS3 B;  2QHO A;  1D4B A;  2W9N A;  1YQB A;  4MJS A;  4LNN A;  2PJH A;  4G3X B;  4IW0 A;  1MHH E;  3ECI A;  3JYU A;  5HI1 A;  3KWV A;  1YJ1 A;  3OWE B;  1G6J A;  3H6N A;  2RPQ A;  1QOB A;  2IND C;  2K8C A;  2L1A A;  5TSS A;  4A9A A;  1YQ3 B;  2BS2 B;  5CTR C;  2LWP A;  5CHV C;  1HTQ A;  2KKC A;  2RD0 A;  4C7Y A;  2VH2 A;  1B1Z A;  2LGS A;  2V1Y A;  4BVU C;  3CIR B;  2DZM A;  1FEH A;  4II3 B;  1AWD A;  3ZDM C;  1QT9 A;  1SJE D;  3L16 A;  3P63 A;  1JRO A;  1L7Y A;  1XLN A;  3HIZ A;  2KFJ A;  4ICU A;  1EF1 A;  3PSE B;  2BWF A;  1WIA A;  2M8S A;  1V5O A;  2KTF A;  4RM9 A;  1WXS A;  2KMA A;  2KC2 A;  5T8I A;  3CMM B;  1X1M A;  2ZNV C;  3UI3 A;  4ANX A;  3Q14 C;  2K3U A;  2W55 A;  2DYO A;  2INC C;  3H9D A;  4JGH B;  4F7Z A;  3N30 A;  2BQQ A;  1JWU D;  1VCB A;  4K1R B;  4KZ0 A;  1WR1 A;  1A70 A;  5G2N A;  4MM3 B;  5EE3 A;  3VUX A;  5CHF A;  1OGW A;  1F1H A;  2CJO A;  3EC8 A;  2D10 A;  2K25 A;  4DHZ E;  5BMI A;  4YSY B;  1M94 A;  2M0X A;  4MSQ B;  2KJ6 A;  1JWA D;  4LLG M;  2L00 B;  2OHF A;  2ZVN A;  1QKZ A;  3FKY A;  2I2Y A;  1ZDV A;  2XK5 A;  5MPO A;  1YN5 A;  3MHS D;  4K3B A;  4YT0 B;  1NDD A;  3GE3 C;  4A3P A;  2D3G A;  4KGS A;  1SF0 A;  5GXG B;  4H2A A;  5DCN A;  1WY8 A;  1XEE A;  4HK2 A;  4DXG A;  3RNG C;  2RMM A;  3PHW B;  2MBO A;  1K50 A;  4FXC A;  3IXS A;  4C4V B;  3MC0 B;  1WYW B;  3APF A;  1I4H A;  3N1Y C;  2IBI B;  3AN1 A;  4G0N B;  4AP4 C;  1HA5 A;  2D07 B;  4I6L B;  3WAP A;  2WXN A;  2EEL A;  1P3Q U;  3AE9 B;  4WAF A;  2EMS A;  2JRI B;  2V9H A;  3MHZ A;  3V3X A;  2QIE B;  2JT4 B;  4A3O A;  1UEL A;  1V81 A;  3V05 A;  2NTT A;  2BVC A;  1FMA D;  2MP2 A;  5G5G A;  3AE2 B;  4K7U A;  1HTO A;  2KLG A;  1TTN A;  3A9K B;  1IPG A;  4NQK E;  3TCA A;  2IO0 B;  1L0X B;  2KO3 A;  3LYY A;  3DQV A;  3DVN U;  5I4D A;  3BY4 B;  4GLS C;  2NPT B;  2L0F A;  2O2V A;  3X23 A;  3TEZ A;  3EEC A;  1UBQ A;  5GMV A;  3A1Q B;  4WUR A;  3ONS A;  4MSM B;  2WXK A;  1J0G A;  1TBE A;  4J3O D;  3TIX A;  1FNV A;  1TKY A;  1VZ8 A;  2FID A;  4K3C A;  2LMC A;  2MW5 A;  2K39 A;  3RD2 A;  4X57 B;  4TV3 A;  2G4S A;  2WXH A;  4GN1 A;  3KUC B;  3DBH I;  1QOF A;  5HHD G;  1NYR A;  2XBB C;  1ZKH A;  1SEB D;  3PS6 A;  4W9J A;  4CQN A;  4AOF A;  2J52 A;  2K6D B;  1C76 A;  4KSK C;  3P4Q B;  1T5X D;  3OAW A;  3LDZ E;  3WAM A;  4YTP B;  3M95 A;  1WSP A;  3GZN I;  4BBN C;  3W1S C;  4HCP B;  1KRH A;  2EKE C;  3RCZ A;  2K8H A;  4RGO S;  5AZH A;  1MVK A;  3R2T A;  4LDT B;  1V1P B;  2JY6 A;  1GC7 A;  3QA8 A;  3ZJV A;  5CX3 A;  4EZJ A;  2WQY B;  3VQI A;  5FR6 A;  4DQO C;  5JXV A;  4M0W B;  1NI2 A;  1QIL A;  1L2N A;  2HDE A;  2JWZ A;  2WP9 B;  1JWB D;  3AM9 A;  2C7M B;  4TSS A;  3PVL A;  4BKS D;  2UU7 A;  1YJI A;  1UZX B;  2GOW A;  1P0R A;  3VH4 B;  1VR9 A;  5FKA C;  3DBR B;  2PTL A;  2BW2 A;  1SBB B;  2PMV A;  1E9M A;  3DOW A;  1I7H A;  1WJ6 A;  4I6N B;  4W9C A;  3ZJT A;  4MJS B;  3AEG B;  4B0M A;  5DPW A;  2KT7 A;  2GMI C;  2L52 A;  4DK5 A;  1CMX B;  1XD3 B;  1PFD A;  2JSV X;  1F77 A;  1V9J A;  3QAQ A;  3L54 A;  2INN E;  3K9O B;  2RSU A;  4I6P A;  4EZK A;  3TSS A;  3A9J B;  2O6V D;  4XZ4 A;  4ARI A;  3ZYY X;  1LO5 D;  3VDZ A;  1KM7 A;  2IY0 B;  1SB3 C;  2ON8 A;  2N9L A;  4USA A;  3SR6 A;  4AWJ A;  1GNU A;  2L8J A;  3L17 A;  3MP9 A;  3MJW A;  2Q5W D;  3NVV A;  1WRD B;  5AUI A;  3KLS X;  1PGB A;  3N32 A;  3DBS A;  1WFY A;  2CR5 A;  4L2Y A;  3NZ3 A;  2WHI A;  2DZK A;  1EU3 A;  4XDC A;  4OZB A;  1AN8 A;  2WXL A;  1LM8 B;  1ZUD 2;  5H92 C;  5DPS A;  3IAS 1;  4PT5 A;  3RNF C;  2ZCB A;  1L0Y B;  2KNB A;  3MFG A;  1NYQ A;  2JYE A;  2DNF A;  3PHX B;  4HDO A;  1WZ0 A;  1I35 A;  4WJQ A;  4FHK A;  2V0G A;  1C1Y B;  2Z0D B;  1TZ1 A;  2LVQ A;  2QMT A;  2HJ1 A;  3KUD B;  3BYY B;  4ANU A;  4RNA A;  1YN4 A;  4B6W A;  3ZIM A;  2WGS A;  2XK5 B;  2W82 A;  1WYG A;  1FRD A;  3QK0 A;  2C9W B;  1IP9 A;  1EWC A;  3HUI A;  5HKH A;  4HPP A;  1NEK B;  4FJY A;  1H4R A;  2OED A;  3Q6B A;  2K1F A;  1TJE A;  2LRU A;  3NHE B;  3N20 C;  4BKG A;  4ZRJ A;  3EA6 A;  2J42 A;  1FCC C;  2DYM A;  4FLH A;  3E9S A;  1D5M C;  2L0T A;  5LLI A;  1WGD A;  2KXJ A;  2GBJ A;  5D94 A;  2CU1 A;  1WXQ A;  4XDD A;  1FFV A;  1ESF A;  1XF5 L;  1SIJ A;  2C5L C;  2LGY A;  2W54 A;  2WU2 B;  2WXM A;  1UD7 A;  2ZPN A;  4XYC A;  2FIF A;  1QLB B;  2LD9 A;  3ZNI D;  3H7P A;  3AMZ A;  1PDX A;  1V8C A;  2MP2 B;  3ZKJ C;  2V3P A;  4NZL B;  4RFB A;  3DHI C;  2AWT A;  1V1O A;  1Q5W B;  3R7Q A;  4A6Q A;  2LJI A;  1BUI C;  3ZQ4 A;  1UGJ A;  1YOV B;  2QJL A;  3TUO A;  3P42 A;  3BIN A;  2IO3 B;  4HKZ E;  3DWG C;  3QX1 A;  3RZW C;  3UQB A;  2CKH B;  2FUG 1;  4ZOH C;  1LXD A;  4LNI A;  2KYW A;  1P1A A;  3TEX A;  5JZE B;  1XLQ A;  4M8M A;  1FFU A;  1L5P A;  2YVC A;  3IT4 B;  1E8Y A;  1LQB A;  2GI9 A;  4AJW A;  4N59 A;  1R7S A;  1N5X A;  2H88 B;  1KTK A;  3SFE B;  1GPX A;  3VRB B;  3JVZ X;  3K9P B;  5C3J B;  3Q3O C;  3AEB B;  3Q8E A;  3OJ4 B;  1JWM D;  3W9C B;  3NVW A;  3ML8 A;  1L6V A;  5C1Z A;  3AEC B;  2CU3 A;  2M17 A;  1L6U A;  3Q3N C;  3Q8C A;  1QF6 A;  1ZOY B;  2LXA A;  4GOC A;  2C60 A;  2BB6 A;  1JWS D;  3ZXV A;  4L1B A;  2GLS A;  3EUB 2;  1E7V A;  4HWI B;  4DBG A;  3GP7 A;  4EE2 A;  2C7H A;  1DOY A;  2Y5P A;  5AUK A;  1WX9 A;  1V6E A;  4PYU A;  3PT2 B;  2WX0 A;  3EFU A;  2BS4 B;  3UGB B;  3I9V 1;  4KGT A;  5CHW A;  3VH3 B;  3VHT C;  2N7J A;  2V3S A;  2DZI A;  1WGR A;  3AV8 A;  1TS5 A;  3M3J A;  4LCD E;  3L0W B;  4HDQ A;  2BKF A;  2BPS A;  1C4C A;  1Z5S B;  1WE6 A;  3HM6 X;  2FCQ A;  3C19 A;  3AE1 B;  1UH6 A;  4RM8 A;  4WJO A;  2JXX A;  3JSV A;  2WDV B;  4RH6 A;  2VZK D;  2HJ8 A;  4KDL B;  2LZ6 A;  1FPY A;  4PK1 A;  2R2Q A;  1XXG A;  4MAC A;  4CO7 A;  1XLP A;  2KX3 A;  3O65 B;  3Q3M C;  5BMH A;  2G9H D;  3WCQ A;  2WXR A;  2DX5 B;  4ZYN A;  3AE5 B;  3VTU A;  4ZRQ A;  3PO0 A;  3GS2 A;  3NUH B;  2GBK A;  3HVZ A;  2IGG A;  2EMT A;  2WXQ A;  5G5H A;  1TKG A;  2RPV A;  1GJZ A;  1FNW A;  1EO6 A;  4GDL A;  4UDU C;  1ZPS A;  3ZJU A;  4P1B C;  3OG5 A;  2INP E;  4GB9 A;  3ZGZ A;  5EE1 A;  5E6N A;  5IOI A;  3NOB A;  2KMM A;  2HD5 B;  4AS1 A;  4URK A;  3RNB C;  4B9K A;  2Z0E B;  3ZRF A;  3BVG A;  4G50 A;  2A5U A;  2FE8 A;  1WJ4 A;  3BII D;  4BAX A;  4RGN A;  3I57 A;  1P98 A;  4P1C C;  4DHJ D;  4EUT A;  2NBW B;  1GG3 A;  5DPT A;  2K9X A;  4OW0 A;  1F2R C;  3AEA B;  4HKQ A;  4BOZ B;  1HZ6 A;  2YEP F;  3BWU D;  4W9K A;  1A5R A;  2KVZ A;  3HRD D;  3ALB A;  1UWM A;  2KN5 A;  4BFR A;  3DDC B;  1HE8 A;  4GDK A;  1MI0 A;  1QOG A;  1T3Q A;  3TEY A;  3VTW A;  3ZXR A;  4GSW A;  3RYT A;  2D11 A;  2AL3 A;  3DCG A;  1YD8 U;  3QHT A;  4C7Z A;  5DPR A;  4C80 A;  1JRP A;  3ZW3 A;  4W9F A;  3ENE A;  1WH3 A;  3A4S C;  3TEW A;  4JLC A;  3RNC C;  3Q69 A;  2B76 B;  2WX1 A;  1TT5 B;  1TYG B;  1T0R C;  4IWQ A;  1OQR A;  3QQ8 B;  2M19 A;  2JPH A;  2DZJ A;  5FR3 A;  2E6X A;  2KQS A;  1F52 A;  2UWQ A;  3UIO B;  2KN4 A;  4DWF A;  1U4A A;  4JPS A;  2LVO A;  5BO4 B;  4HVB A;  3B2G A;  5KHO A;  3QWZ B;  3PRP B;  5EE0 A;  1NI3 A; 
#chains in the Genus database with same CATH homology
 1WF9 A;  3WA0 A;  2L05 A;  1E90 A;  3VXW A;  2KAN A;  1V9J A;  3QAQ A;  3L54 A;  5AZG A;  3ZNG C;  3APD A;  4MGY E;  5D7G A;  3K9O B;  3A9K A;  3SDL C;  3V6E B;  2RSU A;  3DVN V;  4AUQ C;  5LXI B;  1TGZ B;  3SHQ A;  4I6P A;  2PPH A;  2I1K A;  3H7P B;  4EZK A;  3VUW A;  4BKS A;  3A9J B;  3A9J A;  2ZCC A;  1WGG A;  2O6V D;  1WM2 A;  4XZ4 A;  2KWU B;  2NVU I;  2N7D A;  3VDZ A;  1KM7 A;  3WAN A;  2IY0 B;  3TMP B;  3IVF A;  3JW0 X;  3ZRC A;  4HLE A;  2DEN B;  2KFK B;  4AWJ A;  4EFO A;  1GNU A;  1WMH A;  2L8J A;  2OOB B;  1V49 A;  3L17 A;  3MJW A;  2KMC A;  3AU4 A;  4WWP A;  2BYF A;  3A1Q A;  1SE9 A;  2LUE A;  4KVG B;  1WRD B;  4W9L A;  4M8N A;  3IHP C;  4FA6 A;  1AAR A;  2KDF B;  2GBR A;  1E5W A;  4TKN A;  1V5T A;  3QC8 B;  4LDT D;  3N32 A;  4WJN A;  3KW5 B;  3DBS A;  4A20 A;  1WFY A;  4AJY B;  2PE9 A;  2UYZ B;  2CR5 A;  1SIF A;  4IM0 A;  4MEM A;  2KZR A;  2ZJD A;  4PS8 A;  2MBH A;  2N9P C;  2AL6 A;  3CSF A;  3H7S A;  5AZF A;  2DZK A;  3IG3 A;  3HM3 A;  4ANW A;  2ASQ A;  3AXC A;  1LM8 B;  3PRE A;  3V61 A;  2LJ5 A;  4OVV A;  4EOY A;  5DPS A;  2NR2 A;  2O6V A;  3V6C B;  2J0K A;  2WWZ A;  2ZCB A;  3IBE A;  2KNB A;  3ZO5 B;  2NBU A;  3T9L A;  3B0A A;  4HDO A;  3PHX B;  3C0R B;  2IY1 B;  1WZ0 A;  1I35 A;  2JUO A;  4WJQ A;  4NAW A;  4FHK A;  3KYD D;  3PRZ A;  4NAW B;  3WIM A;  4NPN A;  1C1Y B;  3P2B A;  4K7W A;  2Z0D B;  3WAL A;  5JHB A;  3U30 A;  2M1M A;  4EEW A;  4EKU A;  1TZ1 A;  1J8C A;  3Q3F A;  4FJV B;  2LVQ A;  2KLC A;  3NS8 A;  3KUD B;  4MEL A;  3SD5 A;  1E7U A;  4GXB A;  4ANU A;  4WJP A;  3AUL A;  3M63 B;  2CHW A;  4TQ1 A;  3ZDT A;  5IAA C;  3ZIM A;  4B6W A;  5J2R A;  1JRU A;  1IYF A;  2KTR A;  2KTR B;  2XK5 B;  3S2A A;  2ZEQ A;  2C7N B;  1OEY A;  3QK0 A;  1WZ3 A;  2KWV B;  2DHZ A;  4XC2 A;  2KDI A;  1RFA A;  2RGF A;  5G55 A;  2C9W B;  2N9E B;  2J7Q B;  2LVP A;  1IP9 A;  2CS4 A;  2CHZ A;  3HK0 A;  5HKH A;  4FJY A;  2LAS A;  1H4R A;  2DAF A;  2JRH A;  4HPL B;  4GIV A;  4ZRI A;  2K1F A;  3DBR I;  2LRU A;  3NHE B;  4FJZ A;  2A4Z A;  4GU2 A;  4OVU A;  5KHQ A;  3QJZ A;  4ZRK A;  4BKG A;  5LXH A;  2NBV B;  4ZRJ A;  3V62 A;  2MWS B;  2DYM A;  1SGH A;  4FLH A;  2L76 A;  3AU5 A;  2N1V A;  2MSE D;  3PLU A;  2G45 B;  2L0T A;  4JQW C;  5E6P A;  5L95 C;  2IZV B;  2QHO A;  4IC7 B;  5LLI A;  2FCN A;  2W9N A;  3RUL A;  2MBB B;  5C23 A;  1WGD A;  2KXJ A;  5D2M B;  2GBJ A;  1YQB A;  4MJS A;  5D94 A;  2CU1 A;  4ZDV A;  4LJP B;  2PJH A;  4G3X B;  1VD2 A;  4IW0 A;  3QCA A;  3ZTC A;  2FCS A;  1WX7 A;  1ZGU B;  3VTV A;  3ECI A;  3JYU A;  4PYZ A;  4FHJ A;  1YJ1 A;  4MGZ E;  2BYE A;  1G6J A;  3H6N A;  2C5L C;  2LGY A;  3X0W A;  5JHA A;  1R4M I;  1WGH A;  2LXC A;  2RPQ A;  2K8C A;  3DVG X;  4W9H A;  2KDB A;  3U7D A;  2J0J A;  1UD7 A;  2ZPN A;  2BKR B;  2FIF A;  4KSL C;  5CTR C;  2LWP A;  2LD9 A;  5CHV C;  3ZNI D;  3JSV B;  3H7P A;  2HTH A;  2KOX A;  2KKC A;  2RD0 A;  2FAZ A;  5IA7 A;  3NY5 A;  2MP2 B;  2BGF A;  3ZKJ C;  2IYD B;  2ZPY A;  4NNJ B;  1OEY J;  1WGY A;  2V1Y A;  2KFK A;  4WAA A;  2AWT A;  1K8R B;  4BVU C;  4FBJ B;  4II3 B;  2DZM A;  4CYE A;  3RT3 B;  3PGE A;  1Q5W B;  2KJH B;  3ZDM C;  2G3Q B;  1YIW A;  3R7Q A;  3WAO A;  3L16 A;  1L7Y A;  4IG7 B;  4KIK B;  2K8B A;  3BIN A;  3HIZ A;  2KFJ A;  2MX2 A;  4ANV A;  2IO3 B;  4EZL A;  4ICU A;  1EF1 A;  3PSE B;  1D3Z A;  2BWF A;  3QX1 A;  4DHZ B;  1WIA A;  2M8S A;  2KTF A;  1V5O A;  2IO2 B;  3PPA A;  3RZW C;  3UQB A;  2CKH B;  2L3Z A;  4RM9 A;  1WXS A;  3NZU A;  2KMA A;  3ZNH B;  4GDL B;  3U8Z A;  2KC2 A;  1LXD A;  3ZVV A;  1YX5 B;  3CMM B;  1X1M A;  2ZNV C;  1GUA B;  3CST A;  2XEW A;  1E8W A;  4ANX A;  3PZD A;  1P1A A;  5JZE B;  4W9D A;  5AEK B;  3AI5 A;  4M8M A;  2KDE B;  2DYO A;  2YVC A;  4JGH B;  3H9D A;  1ZW7 A;  1E8Y A;  3KYC D;  1I42 A;  3UIN B;  4F7Z A;  3ZLZ A;  1LQB A;  4GMV A;  3N30 A;  4WQO B;  4AJW A;  4MGI E;  1VCB A;  2WDT B;  4K1R B;  4KZ0 A;  1WR1 A;  5G2N A;  4CHK A;  3VUX A;  2N1W A;  5CHF A;  1OGW A;  2BWE S;  2BYV E;  2GBM A;  3JVZ X;  3K9P B;  4IWO A;  3EC8 A;  2D10 A;  2RR9 A;  2K25 A;  4DHZ E;  2MCN B;  1KLV A;  3OJ4 B;  1M94 A;  4IM3 A;  2M0X A;  4MSQ B;  2KJ6 A;  2PEA A;  3ML8 A;  1KOT A;  3ZNZ B;  5C1Z A;  2L00 B;  2M17 A;  2ZVN A;  2MLB A;  1WM3 A;  2LXA A;  4GOC A;  2C60 A;  2XK5 A;  4IUM B;  4MGK E;  3MTN B;  1V2Y A;  4HPM B;  3MHS D;  3DBL I;  5JH5 C;  4GGQ A;  1E7V A;  1NDD A;  2YLM A;  4A3P A;  4GDK B;  2D3G A;  4HWI B;  4DBG A;  2J0M A;  4KV2 A;  4XX5 A;  3VUY A;  3EHV A;  1S1Q B;  2C7H A;  5DCN A;  2B3A A;  4E3C A;  1WY8 A;  4HK2 A;  3CF6 E;  3W1S A;  1WX9 A;  1V6E A;  1S3S G;  2JF5 A;  3PHW B;  2MBO A;  2NS5 A;  3UQA A;  2KD0 A;  2JZ3 B;  4DDG D;  4PYU A;  2BF8 B;  1RAX A;  4FN2 A;  3R66 C;  5TR5 A;  2VRR B;  1XQQ A;  2K6Q A;  3L10 B;  2FUH B;  3OLM D;  1E8Z A;  4DHJ B;  4F8C B;  3TJP A;  3NZS A;  5L83 A;  3PT2 B;  4K81 A;  1WYW B;  1BT0 A;  1LFD A;  3APF A;  4DDI D;  1WXA A;  2WX0 A;  3EFU A;  3KUZ A;  2JZZ A;  3UGB B;  5E6O A;  2IBI B;  2KWC A;  2MBQ A;  4K7S A;  5CHW A;  1UBI A;  4G0N B;  1KJT A;  1RLF A;  3VH3 B;  3VHT C;  4HJK A;  4AP4 C;  1YX6 B;  2V3S A;  4FAD A;  1Q0W B;  2DZI A;  1WGR A;  2D07 B;  4I6L B;  4E74 A;  2KQ7 A;  3M3J A;  3PV1 A;  2KVR A;  3L0W B;  4LCD E;  1WE7 A;  3WAP A;  4HDQ A;  2BKF A;  3SU8 X;  2BPS A;  3RUI B;  1Z5S B;  1P3Q U;  1UGM A;  1WE6 A;  2EMS A;  5J18 A;  2JRI B;  3HM6 X;  2FCQ A;  4MH0 E;  2LI5 A;  2MBE A;  1UH6 A;  2LGD A;  3UF8 A;  4JIO U;  4RM8 A;  3M62 B;  4WJO A;  2OJR A;  2JXX A;  2JT4 B;  3I3T B;  3JSV A;  4A3O A;  1UEL A;  1V81 A;  4JL9 A;  3DVG Y;  2HJ8 A;  4KDL B;  2MP2 A;  3A33 B;  3PTF C;  3KH0 A;  2IO1 B;  2LZ6 A;  2MA9 B;  2R2Q A;  3R3M A;  4CO7 A;  2KX3 A;  1FXT B;  3O65 B;  1F9J A;  3R7R A;  4K7U A;  2DX5 B;  4WWO A;  2LGX A;  4ZYN A;  3DPD A;  3VTU A;  4DK5 A;  2CHX A;  2KLG A;  2REX A;  4F1S A;  1TTN A;  3A9K B;  1IPG A;  4IWP A;  4KIK A;  2D2Q A;  4NQK E;  3TCA A;  2KC1 A;  2IO0 B;  2WYQ A;  2GBK A;  2KO3 A;  1R4N I;  1V80 A;  1WI0 A;  2EMT A;  3DQV A;  3TL5 A;  3VVW B;  3DVN U;  1WR6 E;  4BOS C;  1WJN A;  3PLV A;  4IM2 A;  1GJZ A;  1RRB A;  1EO6 A;  3BY4 B;  4GDL A;  2NPT A;  2NPT B;  2L0F A;  2O2V A;  2O2V B;  3X23 A;  3EEC A;  1WMH B;  4W9G A;  2Y5B B;  3VAW A;  1UBQ A;  4GB9 A;  5GMV A;  1GC6 A;  3A1Q B;  5E6N A;  3ONS A;  2KK8 A;  3NOB A;  4MSM B;  3W1Y A;  1J0G A;  1TBE A;  2HD5 B;  2ZVO A;  3IFW B;  4II2 B;  4TQ0 A;  3TIX A;  4HXD A;  1XT9 B;  3RZF A;  3L08 A;  4URK A;  4B9K A;  3A4R A;  2Z0E B;  3ZRF A;  4E71 A;  2FID A;  4KDI C;  4G50 A;  2KX0 A;  2MW5 A;  2K39 A;  4MM3 A;  4W9E A;  1P9D U;  2A5U A;  3RD2 A;  1WJ4 A;  4X57 B;  3LJ3 A;  4TV3 A;  5EDS A;  1WXV A;  4HCN B;  4ASW C;  1V86 A;  1Z2M A;  1P98 A;  1Q1O A;  3V60 A;  2G4S A;  2DYB A;  4DHJ D;  3KVF B;  4MDK E;  4EUT A;  2NBW B;  3KUC B;  3DBH I;  3QIJ A;  4GN1 A;  1GG3 A;  3GOE A;  2ZNV B;  4NY0 A;  5DPT A;  2XBB C;  1ZKH A;  3PS6 A;  4PS7 A;  1Y8R C;  4W9J A;  2HE7 A;  3QAR A;  1T0Y A;  2KHW B;  4NJ7 A;  4RMA A;  2GBN A;  2I1J A;  4BOZ B;  4AOF A;  2O6V B;  2K6D B;  2V4L A;  3Q3J A;  2FNJ B;  1PQS A;  3ZTD A;  4W9I A;  4W9K A;  4KSK C;  5D6J B;  1A5R A;  3OAW A;  3ALB A;  3LDZ E;  3UIP B;  3WAM A;  2KN5 A;  4BFR A;  1OTR B;  3DDC B;  1EUV B;  3M95 A;  2AYO B;  3GZN I;  4PS3 A;  1HE8 A;  2M4N A;  1ISN A;  4GDK A;  3L13 A;  4G11 A;  1WX8 A;  2AEH A;  3W1S C;  4BBN C;  4HCP B;  3APC A;  2EKE C;  3ML9 A;  3RCZ A;  2K8H A;  3VTW A;  5AZH A;  1EF5 A;  1C3T A;  2R2O A;  1H8C A;  4KZC A;  4LDT B;  2JY6 A;  1GC7 A;  3QA8 A;  4LJO B;  2NCN A;  2N7E A;  4GSW A;  3RYT A;  5CX3 A;  3N3K B;  2D11 A;  2AL3 A;  3DCG A;  3OJ3 A;  1YD8 U;  3QHT A;  1OQY A;  4EZJ A;  4BKT A;  2L7R A;  1WXM A;  5DPR A;  2MQJ A;  2N9X A;  4FUL A;  5FR6 A;  3T8M A;  3VQI A;  3HHM A;  2DAJ A;  3ZW3 A;  4W9F A;  4M0W B;  1NI2 A;  2G4D B;  3ENE A;  3PRM B;  1L2N A;  1WH3 A;  3A4S C;  2JWZ A;  2C7M B;  1MG8 A;  4YL8 A;  4TUU A;  3PVL A;  2LRW A;  4BKS D;  4JLC A;  2GOW A;  1UZX B;  3B08 A;  3D32 A;  4J6I A;  4N9F 4;  4NQL B;  1P0R A;  2KJR A;  3H1U A;  3VH4 B;  2WX1 A;  1NBF C;  4IWQ A;  4P7I A;  3QQ8 B;  2ZZP B;  2JPH A;  4NJ6 A;  2DZJ A;  2JVC A;  2PE6 B;  2KQS A;  3UIO B;  1E8X A;  2UWQ A;  3DOW A;  5J17 A;  4DWF A;  1WJ6 A;  1J19 A;  1U4A A;  4I6N B;  4B95 A;  4W9C A;  2LVO A;  2MRP A;  5BO4 B;  4HVB A;  4DXA B;  4MJS B;  1WJU A;  4WWN A;  4BBN F;  5KHO A;  2N4F A;  3TBL D;  4ICV A;  5DPW A;  3QWZ B;  3VFK A;  2GMI C;  2FCM A;  3ZUN A;  1QZE A;  3PRP B;  3B1L X;  1CMX B;  1XD3 B;  2Z59 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...