2LRWA

Solution structure of a ubiquitin-like protein from trypanosoma brucei
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
78
structure length
78
Chain Sequence
MLLKVKTVSNKVIQITSLTDDNTIAELKGKLEESEGIPGNMIRLVYQGKQLEDEKRLKDYQMSAGATFHMVVALRAGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin, putative
publication title Solution structure of a ubiqutin-like protein from Trypanosoma bucei
rcsb
source organism Trypanosoma brucei brucei
molecule tags Cell cycle
total genus 11
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2012-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2lrwA00
3ONSA 2KLGA 2ZVOA 4GGQA 1NDDA 3R3MA 3DDCB 2KDBA 3I3TB 3JSVB 4HCPB 4FA6A 5LXHA 4FJVB 4DHZE 2BYVE 3N3KB 2NBUA 5E6OA 2KQ7A 3AU5A 3RYTA 3RCZA 3RT3B 1WXSA 2KWCA 2KJ6A 2L3ZA 2CU1A 2D10A 1S3SG 2K1FA 2LRWA 1WXAA 1MG8A 3DBSA 4MELA 1WXVA 2N9XA 2K8CA 2J0MA 1E7UA 2L0TA 2N4FA 4W9JA 4X57B 2BKRB 4IWQA 2UYZB 2ZCBA 4EZJA 2JRHA 3VFKA 4G0NB 3SHQA 3X0WA 3ZNID 2QHOA 1ZGUB 2IY1B 2O6VD 4ANXA 2WWZA 2K6QA 2IO3B 4P7IA 2MBBB 3OJ4B 4NJ7A 1WIAA 3JYUA 4ANVA 1WR6E 4W9GA 4B9KA 2N1WA 1TZ1A 1V49A 3EHVA 2ZPYA 5GMVA 2O2VA 2MBEA 3OLMD 4I6NB 4JL9A 4WQOB 3QAQA 4A20A 2K39A 4M0WB 2GOWA 3RULA 4EZKA 3MJWA 3V6CB 3PVLA 4URKA 3ZW3A 3H7PA 2Z0DB 2KDEB 1WM3A 1J8CA 2L76A 3UIOB 2HTHA 1WXMA 3B08A 4BFRA 5CX3A 2KWVB 1WGRA 3BY4B 3ENEA 4K81A 3APDA 3IG3A 4TQ1A 3R7RA 4IM0A 4B95A 2RR9A 5E6NA 2MBOA 2WDTB 1XQQA 3MTNB 2KFKA 3VDZA 3QIJA 1HE8A 2KC1A 3A1QA 3NOBA 4OVVA 4ICVA 5AZFA 3NY5A 1Q5WB 3DBHI 3ZVVA 3PGEA 4DBGA 2IY0B 1TTNA 4JQWC 1V6EA 5IA7A 2KHWB 1WM2A 3ZO5B 4JLCA 3UGBB 2JT4B 4W9LA 1GC6A 2KTRB 1PQSA 4MJSA 1RFAA 3WAPA 1E7VA 4K7SA 2EMTA 3AI5A 1WY8A 1UZXB 3OJ3A 5DPRA 2M17A 2GBRA 2JPHA 1E90A 2K6DB 5J18A 2WX0A 1F9JA 1NI2A 2JY6A 2M1MA 4FJZA 4FADA 5JHBA 4I6PA 4G50A 2DHZA 2D2QA 1YIWA 2CS4A 2UWQA 4ZRJA 3W1YA 4ZYNA 3IBEA 3KYCD 4W9HA 3ZDTA 4XC2A 1WGDA 3ZTDA 2L8JA 4GU2A 1UBQA 4AJYB 4ZDVA 5KHQA 2J7QB 2ZCCA 2DAJA 3WIMA 4AUQC 3IHPC 4J6IA 2NR2A 2PJHA 4W9IA 2V3SA 3A4RA 4ICUA 4PS3A 4W9KA 2L05A 4IWOA 2MP2A 2A5UA 4LCDE 1S1QB 1GNUA 2DYOA 4WWOA 5C23A 2LASA 1AARA 2JXXA 2MRPA 3QK0A 3VHTC 4IC7B 1YJ1A 1ZW7A 3IFWB 2KK8A 2IBIB 2LRUA 4E71A 1V5TA 3TL5A 3B0AA 4TKNA 3DCGA 3DVNV 4MEMA 3WALA 2YVCA 4GDLA 2RSUA 3HM3A 3APFA 3GOEA 2CHXA 2KVRA 4FLHA 4KV2A 3R66C 1E8XA 2C5LC 2Z0EB 2NPTB 3QARA 2G4SA 4GB9A 2DZMA 5EDSA 3O65B 5J2RA 4JGHB 3L08A 2R2OA 2GBKA 5AZGA 3VTWA 2LJ5A 3SU8X 3VUYA 2OJRA 4WJPA 4HXDA 1E8YA 1P0RA 2ZPNA 3TMPB 1WJNA 1OTRB 3VUXA 4A3OA 4AOFA 4BKGA 1KLVA 1LM8B 1R4NI 2LVOA 3QA8A 4NY0A 1WX9A 1IP9A 1P3QU 1RLFA 1VD2A 2J0KA 4GDKB 3ZUNA 4BKSD 1WZ0A 3ZLZA 1RRBA 3PHWB 4LDTB 1U4AA 1WMHA 1NBFC 1EUVB 4FHKA 4ZRIA 4KDLB 4IUMB 4DK5A 1WR1A 4TUUA 1KM7A 1R4MI 4ZRKA 2Y5BB 2LVQA 3HIZA 2LXCA 3PZDA 4F1SA 3NHEB 3W1SC 1WI0A 5D6JB 2NCNA 4WJQA 3A4SC 1WGYA 1EF5A 3DBLI 2N7EA 2KQSA 1XD3B 3N30A 5E6PA 1D3ZA 2MW5A 4DHJB 3RZWC 2FCSA 2OOBB 5IAAC 2LVPA 2XK5A 3A9JA 1V80A 3QWZB 5FR6A 3CMMB 4XX5A 4CYEA 2MCNB 4W9CA 1GJZA 2AEHA 4B6WA 4W9DA 3ZRFA 2O2VB 1WYWB 2N9PC 1I42A 4IWPA 2KANA 5JHAA 1V9JA 1P9DU 4BOZB 3RD2A 4YL8A 4KSLC 3L54A 3RUIB 1UELA 5JZEB 3QC8B 1Z2MA 2ZJDA 2NS5A 3V60A 3X23A 4IM3A 1WGGA 2IZVB 4NQKE 4RMAA 3CSTA 3PT2B 3T9LA 2LI5A 3DBRI 1V81A 3OAWA 2W9NA 4NQLB 1WF9A 3AXCA 4G11A 2FUHB 5G2NA 5BO4B 2MX2A 3JVZX 3HHMA 5LLIA 2NBVB 2WX1A 3DVGY 3JW0X 2FAZA 2KX3A 1GC7A 3ZTCA 4GMVA 2BGFA 4KZCA 4FJYA 5LXIB 4GXBA 4LDTD 3VTUA 2BYEA 2KX0A 2DZKA 5CHVC 1YQBA 2L00B 2KMAA 4FHJA 2CKHB 5CHWA 4HWIB 4MJSB 1VCBA 1WJUA 3H6NA 4NJ6A 2B3AA 3VAWA 3ZNGC 3ML8A 4ANWA 1A5RA 3U7DA 3VVWB 3V61A 1WH3A 2KXJA 3U30A 2C7HA 2JZ3B 2KC2A 3M95A 3PRZA 2KN5A 3A33B 4BBNC 4DHJD 1M94A 4W9EA 3UIPB 2HE7A 2CHWA 4MGIE 3QQ8B 3ZNHB 4NAWB 3T8MA 3VQIA 3KW5B 4GN1A 1H8CA 1X1MA 2FNJB 5DCNA 3ECIA 3A9KA 4K7WA 4F7ZA 1E8WA 3PRMB 2EMSA 4AJWA 4MGKE 3ALBA 2N1VA 4BOSC 2A4ZA 2GBJA 1V2YA 4KSKC 2IO1B 3PTFC 4KIKA 2KDIA 2DX5B 2BWES 3ZKJC 4KZ0A 2JUOA 5TR5A 1RAXA 1YD8U 3H9DA 4PS8A 1V5OA 3KYDD 2PE6B 2JRIB 1WGHA 3NS8A 4GIVA 4ANUA 5G55A 3ZRCA 5C1ZA 2I1KA 2K25A 2DZIA 2KTFA 4II2B 3PS6A 2LGXA 3ZIMA 2GMIC 2KDFB 3KUDB 3QCAA 2KNBA 2G45B 1WJ4A 4HPLB 1FXTB 3L13A 2L7RA 1P98A 4GOCA 3K9OB 3PV1A 4RM9A 2JZZA 3SD5A 3TBLD 4MDKE 2M8SA 1XT9B 1SGHA 2FCQA 3EC8A 4WWNA 4EKUA 4M8NA 1ZKHA 3KUZA 1L7YA 2O6VA 4AP4C 1TBEA 3ML9A 4KVGB 3DQVA 4MGYE 1Y8RC 2KOXA 4AWJA 3UQBA 2GBNA 3DVGX 3L0WB 3WA0A 3AU4A 2M0XA 5D7GA 3SDLC 3B1LX 4OVUA 1H4RA 1K8RB 4HCNB 2AL3A 4G3XB 3L10B 2ZEQA 4HK2A 3QX1A 4BVUC 3WAMA 4WWPA 4FBJB 4TV3A 1KJTA 3U8ZA 2NPTA 3ZNZB 2REXA 3PLUA 4HLEA 4IW0A 3KH0A 5JH5C 4EEWA 1WX8A 3LJ3A 2PPHA 2LGYA 5DPSA 4DHZB 2C60A 2D3GA 4BKTA 1TGZB 2V1YA 2GBMA 4HDQA 2PE9A 2KFJA 2KZRA 4FN2A 3PLVA 3IVFA 1YX6B 2N9EB 4GDKA 3H1UA 3HK0A 1UH6A 2RD0A 4PYZA 5KHOA 2L0FA 2DENB 3JSVA 2BYFA 4WJOA 4EZLA 4DXAB 1JRUA 4E74A 4F8CB 4DDGD 4PYUA 4E3CA 4MM3A 5L83A 1QZEA 3QHTA 5DPTA 1I35A 4MH0E 3RZFA 3UF8A 5D2MB 4EFOA 1OQYA 2YLMA 2IYDB 1UBIA 2VRRB 3H7PB 1GG3A 2NBWB 4HVBA 1WE7A 2MQJA 5DPWA 4NPNA 3KVFB 3N32A 2MBQA 4M8MA 5AZHA 1WJ6A 2JVCA 3H7SA 4NNJB 2G3QB 2C7MB 3DVNU 3C0RB 3CF6E 2XBBC 3NZSA 2K8HA 2MSED 2KFKB 4PS7A 2JWZA 2CHZA 2G4DB 3A1QB 4IG7B 3VH3B 1UGMA 1WZ3A 5HKHA 3M62B 1G6JA 1BT0A 2AL6A 2LUEA 4CHKA 3M63B 2BKFA 1SIFA 3AULA 2KKCA 2K8BA 3VUWA 3APCA 2ZVNA 2KMCA 3M3JA 2LWPA 2LZ6A 3EFUA 3W1SA 1Q1OA 2IO0B 2LGDA 5J17A 4EOYA 4MSQB 2DAFA 3HM6X 3WAOA 3TIXA 2AYOB 3PREA 3A9KB 2DYBA 4GSWA 1L2NA 2LXAA 2FIDA 2KJHB 2DYMA 1WRDB 2FCNA 2HD5B 3Q3FA 4KIKB 3R7QA 2MWSB 2FCMA 4N9F4 1LXDA 1E8ZA 3VH4B 1EO6A 4WJNA 2MP2B 3KUCB 4K7UA 3PHXB 3TCAA 3QJZA 4II3B 2KJRA 1C3TA 3DPDA 1OEYA 2Z59B 4FULA 2RGFA 2IO2B 1T0YA 2V4LA 5AEKB 4BKSA 1P1AA 3V6EB 2MLBA 4JIOU 4ASWC 2KTRA 4GDLB 2KD0A 1J19A 3UQAA 3L16A 1LQBA 2BF8B 4XZ4A 2ASQA 3VTVA 3K9PB 2KO3A 1ISNA 2BWFA 1YX5B 4NAWA 2DZJA 2KWUB 3L17A 2M4NA 3TJPA 5L95C 2BPSA 5D94A 1Z5SB 2EKEC 1KOTA 1UD7A 1V86A 2AWTA 1OGWA 2ZNVC 1SE9A 2O6VB 3BINA 2WYQA 2C9WB 2ZZPB 2MA9B 2N7DA 1E5WA 4BBNF 5CTRC 3D32A 2D07B 3NZUA 1GUAB 2KLCA 3GZNI 3PPAA 1C1YB 5CHFA 4KDIC 1WFYA 1WMHB 4A3PA 4RM8A 2R2QA 4W9FA 3LDZE 1Q0WB 4MGZE 3VXWA 2C7NB 1OEYJ 4I6LB 1J0GA 2PEAA 2HJ8A 2J0JA 4WAAA 3UINB 1CMXB 2MBHA 2D11A 2FIFA 1WX7A 2NVUI 3P2BA 4HDOA 4LJPB 4EUTA 1EF1A 4HJKA 3ZDMC 3V62A 4CO7A 3PRPB 4K1RB 1WE6A 3WANA 3Q3JA 4IM2A 4DDID 1IPGA 4MSMB 4DWFA 3EECA 4HPMB 1LFDA 2JF5A 2RPQA 3CSFA 3PSEB 2I1JA 2XK5B 3A9JB 3DOWA 2XEWA 2LD9A 1IYFA 4TQ0A 4LJOB 2ZNVB 2CR5A 3S2AA 3MHSD
chains in the Genus database with same CATH superfamily
3Q8EA 2ZVOA 2KVZA 1FO4A 3AEGB 3DDCB 5LXHA 3JSVB 1NEKB 4FA6A 3R8BA 3N3KB 5EE3A 1FPYA 3AU5A 2K1FA 1MG8A 1JWMD 1WXVA 2K8CA 2H89B 4W9JA 3W9CB 4EZJA 1D5ZC 3ZNID 1ZGUB 3IAM1 4ANXA 1GOZA 1FEHA 1AN8A 3AV8A 4NJ7A 3NRZA 1WIAA 3N1YC 1L0YB 1WR6E 4B9KA 1FIQA 1NYQA 2MJDA 2ZPYA 5GMVA 2O2VA 1HTOA 4JL9A 3KWLA 1VZ7A 5FR3A 1QT9A 3RULA 1SF0A 4EZKA 3V6CB 4IKGA 2KDEB 2HTHA 1WXMA 4L2YA 3BY4B 2V9HA 3ENEA 2MBOA 3B2GA 1XQQA 3VDZA 1F52A 3NOBA 4ICVA 1TKYA 3NY5A 3PGEA 5IA7A 2KHWB 1WM2A 3ZO5B 4JLCA 3UGBB 2JT4B 2JYTA 4W9LA 2ACZB 4AS1A 1PQSA 1FFUA 5BYSA 1RFAA 1L4ZB 1ZP0B 3OJ3A 1E90A 3AEBB 1NI2A 3HUIA 4FJZA 3U2SC 2N9KA 1MG4A 2CS4A 2UWQA 3ABVB 3IBEA 3BVZA 3W2DA 3ZDTA 4XC2A 1WGDA 3ZTDA 4AJYB 3WIMA 2PJHA 4ICUA 2NMQA 1S1QB 1HA5A 1AARA 3VHTC 4IC7B 4L23A 4C4VB 3KQ4A 2N7JA 2KK8A 2LRUA 5FKAC 5HI1A 1N6ZA 4TKNA 3DVNV 4MEMA 1YNTE 1SE3A 2YEPF 1HTQA 1IGDA 4FLHA 4GB9A 4BAXA 1JRPA 2RPVA 2GBKA 5IO9A 3VTWA 3SU8X 4WJPA 1E8YA 2ZPNA 3TMPB 4A3OA 4AOFA 1R4NI 3ZJVA 2LVOA 3QA8A 4NY0A 1WX9A 1IP9A 1RM6C 1N60A 5C2TB 1PUTA 1ZOYB 1RRBA 3I57A 1U4AA 1EUVB 2WXOA 1OQQA 4K3CA 3ZXVA 1R4MI 4F1SA 3PZ7A 2QCZA 1EF5A 1N63A 2N7EA 3ZXRA 2LVPA 3CMMB 4W9CA 2WGSA 4BOZB 2WXJA 3RD2A 4KSLC 2OJWA 3Q3NC 3QC8B 4HRSA 4LNIA 2AX5A 1F1HA 4RMAA 3CSTA 3PT2B 4P1BC 2L1AA 2BS3B 5G2NA 5BO4B 2NBVB 3AE8B 3DVGY 3HRDD 3JW0X 4YTMB 2BGFA 4QAYA 5LXIB 4GXBA 3VTUA 2BYEA 5HFYA 5CHVC 2IJ0A 2BW2A 1YQBA 4XDDA 4M0WA 1VCBA 1WJUA 3H6NA 3NVZA 2PVGC 4ANWA 3Q8CA 3VVWB 1WH3A 4BBNC 4C56C 3M95A 3A33B 3AE1B 3Q8BA 1M94A 3UIPB 4MGIE 1I4XA 1TS2A 3KW5B 1X1MA 1DOYA 2MJEA 1FM0D 4K7WA 2EMSA 4ARIA 2INPE 3OG5A 2GBJA 5HHDG 1V2YA 4RCOA 3PTFC 4KIKA 1NENB 2JUOA 1D5MC 3KYDD 1WGHA 4GIVA 1SB3C 4ANUA 1SE2A 3NJTA 3BYTB 3ZJUA 3KUDB 3AH7A 4N59A 2KNBA 1PYWD 1WJ4A 3L13A 4GOCA 3SD5A 3CIRB 1MI0A 2M8SA 2FCQA 1OFFA 3EC8A 4M8NA 1ZKHA 5D3IB 3N9YC 2XNAC 3DQVA 1FCCC 4MGYE 1Y8RC 4Q2JA 3WA0A 3AU4A 2CJOA 3B1LX 1CK1A 2ICIA 3AE7B 2ZEQA 1XF5L 3ZYYX 1QOGA 1VZ8A 5JH5C 2LGYA 5DPSA 4DHZB 2C60A 1SIJA 2V1YA 1HQRD 3H1UA 1UH6A 4PYZA 5KHOA 3MFGA 2DENB 4WJOA 4LNOA 4DXAB 5DPTA 3UF8A 1UBIA 5C3JB 1STEA 1GG3A 5DPWA 2KYWA 2LMCA 2MBQA 2FUG1 2G3QB 3DVNU 3C0RB 2K8HA 2KFKB 3BVMA 1ZDXA 4PS7A 4WH4A 5HKHA 1WZ3A 3SFEB 1G6JA 4CHKA 3AULA 2RMMA 3Q8AA 3VUWA 4N6EB 3M3JA 2LZ6A 2JWUA 2IO0B 3GB1A 4MSQB 3HM6X 2AYOB 3A9KB 1B9RA 1FRRA 2LXAA 3DHIC 1WRDB 2MH7A 3EFCA 1LXDA 3B2FA 1EO6A 1C3TA 4II3B 2Z59B 4YTPB 2CJNA 5AEKB 2WXFA 2D5GA 2MLBA 4C7ZA 2KTRA 2KD0A 1J19A 1LQBA 3C19A 5T8IA 2ASQA 1YX5B 4TSSA 4NAWA 1AWDA 3L17A 3N1ZC 1JQ4A 4OHJA 1KOTA 1V86A 1OGWA 2M0AA 4A55A 2O6VB 2C9WB 1E5WA 4GLSC 5CTRC 4C7YA 4ITKA 4PT5A 1V8CA 3P4RB 1SJED 1C1YB 4KDIC 2HJ1A 4A3PA 2DWQA 3LDZE 4W9FA 4MGZE 3VXWA 2KAJA 2HJ8A 2OEDA 3UINB 1CMXB 3CWIA 2FIFA 3P2BA 4HDOA 4EUTA 3ZDMC 3V62A 1DYQA 3PRPB 4K1RB 3EECA 3RN9C 2I1JA 3A9JB 3E56A 4LJOB 2ZNVB 2KLGA 2KDBA 1VJKA 5E6OA 2KQ7A 2INNE 1ENFA 3RT3B 3NZ3A 4MM3B 1TIFA 2LRWA 1C77A 2QMTA 3DBSA 2PW9A 1FMAD 2LHEA 2N9XA 2BKRB 3VFKA 3X0WA 4A6QA 2O6VD 5G5GA 3OJ4B 3JYUA 1TZ1A 3EHVA 3MJ5A 4WQOB 5BYQA 2GOWA 3ZGZA 1Q10A 2QSDA 3ZW3A 1BUIC 3H7PA 2Z0DB 1WM3A 3MHZA 1C4CA 1ZUD2 1UWXA 4K81A 3APDA 3IG3A 3R7RA 3NG0A 2EKIA 2WXLA 2RR9A 1GB4A 3QIJA 3PZ8A 3TEYA 3IT4B 5AZFA 3DBHB 2IY0B 2K9XA 4JQWC 1V6EA 2BQQA 2VH2A 1T5XD 4A90A 3MC9A 4P16A 4D2KA 2GBRA 1JMLA 2WX0A 2W54A 1F9JA 1EWYC 2JY6A 2M1MA 3IT6B 3P1MA 2DHZA 2D2QA 4ZRJA 3ETRA 3KYCD 2MHJA 5KHQA 4GU2A 2ZCCA 2DAJA 4J6IA 2V3SA 3A4RA 4PS3A 2L05A 4LCDE 4BZAA 1YJ1A 1ZW7A 1ACCA 5MPOA 5BMGA 4OZAA 1V5TA 3B0AA 2ZW1A 3V05A 2RSUA 4KGRA 3GOEA 2CHXA 3IXSA 2Z0EB 3QARA 5LNK1 2W82A 1E6EB 5AZGA 2WXHA 3VUYA 2OJRA 1WJNA 4BKGA 1KLVA 1LM8B 4C00A 2KN4A 3GE8C 1RLFA 4GDKB 3ZUNA 4BKSD 3ZLZA 2WXNA 4KDLB 1T6BX 3TEZA 1XCQL 1KM7A 1UUPA 4ZRKA 4P1CC 2WXKA 2IDYA 2M56B 4JWUC 3RI7C 1E7PB 2KQSA 3FILB 2OOBB 2W3RA 4XX5A 4YTNB 1XLNA 2D3CA 3BZDB 2QDFA 3AECB 3DHGC 1HZ5A 1NYRA 1WYWB 2O2VB 4IWPA 2KANA 5JHAA 3AE4B 1I4PA 4YL8A 1AW7A 2BYTA 1Z2MA 2NS5A 2EELA 1CQVA 1NI3A 2IZVB 4NQKE 1V81A 3U52E 2KACA 3OAWA 2JX5A 2W9NA 4NQLB 1JWBD 2MX2A 1C4PA 3HHMA 1KF6B 3ZTCA 4GMVA 4FJYA 1FNUA 1FCLA 2DZKA 2WDRB 2L00B 2WXQA 2CKHB 1MHXA 4HWIB 3ZNGC 3U7DA 3R2IA 2JZ3B 3W5VB 3QQ8B 3VQIA 1QQRA 2FBWB 4F7ZA 5IN7A 3PRMB 4MGKE 3V3XA 2GLSA 2N1VA 2A4ZA 2IO1B 3MC8A 1WSPA 3BVGA 2DX5B 2BWES 3ZKJC 5BMHA 3AE3B 1V5OA 3NS8A 1RFKA 1QILA 1ZXHA 2ON8A 2I1KA 2K25A 2DZIA 2Z8LA 3ZIMA 1HXYD 2KDFB 4LTUA 4DQOC 3OWEB 1K53A 1P98A 3PV1A 4R3DA 1C9FA 1ET9A 1SGHA 3ML9A 4KVGB 4OW0A 3WCQA 2KWDA 4AWJA 2GBNA 2LFIA 4C4VA 3RNCC 1PGXA 1JALA 1H4RA 1K8RB 2I38A 3AEAB 4KGSA 1I7HA 4HK2A 4BVUC 2BB5A 4FBJB 3PLUA 4HLEA 4IW0A 5BYRA 1WX8A 3LJ3A 2PPHA 1JWUD 2X8XX 3PLVA 3IVFA 1YX6B 2WNMA 2LGSA 1XLQA 1J7BA 1V1OA 2L0FA 3H8HA 2LEKA 3Q6BA 4E74A 3URYA 4FXCA 1LGRA 3TEXA 1QZEA 1MPEA 3P4PB 1I35A 1LO5D 1WRIA 1WE7A 4O1NA 4M8MA 4DXFA 4RF1A 2INDC 2C7MB 3NZSA 2MSED 3A1QB 4IG7B 1CJEA 3C8YA 3M62B 2LUEA 4M01A 3M63B 2K22A 3APCA 3NVYA 1C4AA 1MVKA 3EFUA 4YSXB 4A8XC 3RNFC 1Q1OA 2LGDA 5J17A 2DAFA 3WAOA 4GSWA 1L2NA 2L32A 2FIDA 2HD5B 3VR9B 4KIKB 1D4BA 2FCMA 4N9F4 1KTKA 3VH4B 1E8ZA 4WJNA 2MP2B 3QJZA 1OEYA 2RGFA 2V0GA 2V4LA 1WYGA 3V6EB 4JIOU 4GDLB 1QOFA 2PIAA 2BF8B 4XZ4A 2J42A 1ZPSA 3K9PB 1ISNA 2JQRB 1VR9A 2DZJA 3TJPA 5D94A 2EKEC 2ZNVC 2WYQA 4NJCA 2ZZPB 4RGNA 5AUKA 3BWUD 4YXDB 1GUAB 3GZNI 1WFYA 1WMHB 4RM8A 1N61A 2RDHA 2GRIA 1F0ZA 4I6LB 5EE1A 2R61A 1EF1A 3EUB2 3WANA 2TSSA 4MSMB 1K52A 2RPQA 2WXRA 1TS5A 2XK5B 4PK1A 1HZ6A 1PFDA 4TQ0A 1YJIA 3S2AA 3MHSD 3ONSA 4GGQA 3R3MA 3I3TB 3RMKC 4FJVB 2BBCA 2NBUA 1B1ZA 3RYTA 3RCZA 1WXSA 2KWCA 2KJ6A 4WWMA 2L3ZA 2CU1A 1S3SG 2IGGA 3HVZA 1WXAA 2KMMA 3AE9B 4MELA 2B76B 2J0MA 1E7UA 4N58A 2N4FA 3VRBB 2LJIA 2ZCBA 2JRHA 4G0NB 2QHOA 1N5XA 2K6QA 1XEEA 4RNAA 1BMLC 2MBBB 1D6EC 4ANVA 3KWVA 1V49A 3OLMD 2PVOD 4A20A 1TKEA 4KKIA 4C80A 3PVLA 4URKA 1K51A 1J8CA 2L76A 3UIOB 3GE3C 5CX3A 2KWVB 4TQ1A 4CQNA 3T3OA 4B95A 5H92C 4NZLB 5E6NA 3RFZB 3MTNB 3UI3A 2KFKA 4OVVA 1HE8A 1ESFA 4M00A 4MACA 1KLGD 3LXFA 4DBGA 1TKGA 2QC8A 1HEZE 1I4HA 1GC6A 2KTRB 2WU2B 4MJSA 1AYFA 3WAPA 1E7VA 4K7SA 3BIID 3EA6A 1WY8A 5J18A 2JPHA 2K6DB 3L4PA 5JHBA 4G50A 1YIWA 4ZYNA 2L8JA 4ZYSA 1SBBB 1UBQA 2WP9B 1YQ3B 4WAFA 4AUQC 3IHPC 5D3DA 2NR2A 4W9IA 3VR8B 4W9KA 4IWOA 1NVID 1GNUA 2H88B 4WWOA 5C23A 2XN9C 2JXXA 3QK0A 4WIPA 1ET6A 2W55A 2YVCA 3Q2AC 2KVRA 3R66C 2NPTB 5EDSA 3O65B 5J2RA 4REZA 4JGHB 2AQ1B 2LJ5A 2QIEB 1MFWA 1P0RA 3VUXA 4YWGG 1OTRB 2N0SB 2HDEA 1R4NB 2KT7A 2PMVA 3FKYA 1XO3A 1P3QU 2J0KA 4HKZE 3PHWB 3P4QB 1R4MB 3W5UB 1WR1A 4TUUA 1XCTL 3PZDA 2LXCA 2RDBC 3P42A 1SJHD 2NCNA 3A4SC 2IGHA 1WGYA 3DBLI 4EE2A 1IBXB 3DWMA 3AEDB 2FCSA 3A9JA 3QWZB 5FR6A 1I4QA 2MCNB 1GJZA 2AEHA 4W9DA 3BYYB 5IOIA 1P9DU 3RPFC 2BVCA 1F2RC 3L54A 1V97A 3NS1A 3RUIB 5JZEB 3LB8C 4XE0A 4US8A 2ZJDA 3V60A 1GPXA 3X23A 1WGGA 4JWSC 3T9LA 2IGDA 1P7EA 3DBRI 2AQ3B 2K0PA 2NTTA 3AXCA 2FUHB 2M19A 2WX1A 2FAZA 2KX3A 4KZCA 4ZRPA 2DBYA 3AB5A 1IGCA 5CHWA 4USAA 1I4GA 3V61A 2KXJA 3U30A 2C7HA 1MHHE 1K50A 3PRZA 4W9EA 3T8MA 3AE2B 1H8CA 5DCNA 2FNJB 4L1BA 4JX1C 2RDGA 1MJDA 2WHIA 4YT0B 2WXPA 4KSKC 4LNKA 2IPKD 2KDIA 4KZ0A 1RAXA 3H9DA 1D5XC 2WXGA 3LYYA 3SEBA 4LNNA 2PE6B 2J53A 1V1PB 1VZ6A 3KLSX 3NVVA 5AUIA 1GB1A 2GMIC 1WXQA 1N62A 3QCAA 4HPLB 3NUHB 3AN1A 4P6VF 1FXTB 3K9OB 4RM9A 3TBLD 4MDKE 1DOXA 2QEJC 4EKUA 3KUZA 3AMZA 4KKJA 1TBEA 1QLBB 1TY0A 2M0XA 1FXAA 4OVUA 1VDVA 2SEBD 3GS2A 3L10B 1E9MA 4TV3A 1KJTA 3U8ZA 2REXA 2LGIA 4EEWA 1L6VA 1L4DB 1QOBA 2DLBA 2D3GA 4HDQA 4S17A 2PE9A 3TSSA 2E3TA 2KZRA 1QOAA 2VZKB 4FN2A 4GDKA 3JSVA 4AQ7A 4F8CB 4DDGD 4PYUA 1L6UA 4MH0E 3RZFA 2INCC 5D2MB 4EFOA 1OQYA 2YLMA 1PGBA 2NBWB 5TSSA 3FILA 4B0MA 5AZHA 1XXGA 2ONQA 1DGJA 3H7SA 4ZOHC 1TYGB 4LNFA 2Y3AA 3CF6E 3VH3B 2JWZA 2CHZA 2G4DB 2KDMA 1E0ZA 1SXTA 1YJJA 2AL6A 2BKFA 1SIFA 1N5WA 1JROA 2AQ2B 2KMCA 1ZE3D 5E6JA 1YMHE 2KQ4X 3PREA 4ARCA 1PGAA 2DYBA 2V3PA 2KJHB 2VZKD 3Q3FA 1JCKB 2QJLA 2L83A 2D3AA 3PHXB 3TCAA 2Y5CA 3I63C 4FULA 1T0YA 1TT5B 2X38A 1JWAD 4NAMA 4UDUC 4ASWC 3E9SA 1SSNA 5IKCM 2ZW0A 3AEEB 4LLGM 2KO3A 2BWFA 2KWUB 2M4NA 5L95C 1ZXIA 1Z5SB 1UD7A 3BINA 2MA9B 2MJ3A 3D32A 2D07B 3Q3OC 4XWWA 3PPAA 4KGTA 1J7AA 2I2YA 1Q0WB 5BMIA 1J0GA 2PEAA 2J0JA 3AEFB 3N20C 2WU5B 1T3QA 3PO0A 1DOIA 1WX7A 1Y56A 2NVUI 4S0RA 4HJKA 4CO7A 1WE6A 4HROA 3Q3JA 4DWFA 3EGRA 1IPGA 2BTEA 2NTSA 4HPMB 1FXIA 1LFDA 1YOVB 2JF5A 1JW9D 2JSVX 1IYFA 3Q3MC 1NDDA 2HTME 3TEWA 4HCPB 1A70A 4DHZE 2BYVE 2D10A 1ROEA 4RGTA 3DBLB 1KLUD 1T0QC 2L0TA 4X57B 4IWQA 2UYZB 1SEBD 4WQMA 3SHQA 2PTLA 2IY1B 1C78A 1KFYB 1KRHA 2WWZA 2IO3B 4P7IA 4W9GA 1J7CA 2N1WA 2MBEA 4ZHPA 4I6NB 1FNWA 2WQYB 3QAQA 4XDCA 2K39A 4M0WB 1IUEA 3RNAC 1TS4A 3MJWA 3DBRB 2QILA 2BT6A 1XLOA 1TZOA 3FAHA 3O13A 3I9V1 3B08A 3RNBC 4BFRA 1EU3A 2J4XA 3DWGC 1WGRA 4HJGE 2V4IB 1TS3A 4IM0A 2G9HD 3ZQ4A 2WDTB 1WWTA 2KC1A 3A1QA 4B0EA 2N9LA 1Q5WB 3DBHI 3HVDA 3ZVVA 3BK2A 1TTNA 1YQ4B 1C76A 1FFVA 2EMTA 3AI5A 1UZXB 5DPRA 2M17A 2D3BA 4XYCA 2OHFA 1E10A 4FADA 2PLPA 4I6PA 4RGMA 3W1YA 1RYJA 4W9HA 4ZDVA 4LK0M 2J7QB 1EM7A 3Q69A 5H8YE 2MP2A 2A5UA 2DYOA 2LASA 2MRPA 3BK1A 1L5PA 3IFWB 2IBIB 4E71A 2Y5PA 3TL5A 2SAKA 2PKOA 3DCGA 3WALA 3J9CA 4OZBA 4GDLA 3HM3A 3APFA 4RGOS 1FNVA 4KV2A 1E8XA 2C5LC 2G4SA 2DZMA 3L08A 2R2OA 5EE0A 2BS4B 4XGAB 1VRAB 4HXDA 3DHHC 2JXTA 2LUMA 1L0VB 2K5PA 1VD2A 4HKQA 1WZ0A 4LDTB 1WMHA 1NBFC 4FHKA 4ZRIA 1GAQB 4IUMB 4DK5A 2Y5BB 2DNFA 2LVQA 3HIZA 3NHEB 3W1SC 1WI0A 5D6JB 4WJQA 4US9A 1XD3B 3N30A 4ZRQA 5E6PA 1D3ZA 2MW5A 4HEA1 4DHJB 3RZWC 4KX6B 5IAAC 2XK5A 1V80A 3U4EG 3P63A 4CYEA 1TJEA 4B6WA 3I5JC 3ZRFA 1I42A 2N9PC 1V9JA 2UU7A 1UELA 1FRDA 3TUOA 2BS2B 2VH1A 4IM3A 1RWSA 4RF0A 2LI5A 1WF9A 3B9JA 4G11A 3JVZX 5LLIA 1WGKA 1GC7A 2Q5WD 3SR6A 1T0RC 2WLBA 4LDTD 2KX0A 4M02A 4J3OD 2KMAA 4FHJA 2FE8A 3FC4A 4MJSB 4NJ6A 1F2RI 1UNSA 2B3AA 4HPPA 3RNEC 3VAWA 3ML8A 5I4DA 1A5RA 4IDIA 4MT5A 2KC2A 2KN5A 4DHJD 2MEKA 2HE7A 2CHWA 3ZNHB 4NAWB 1EWCA 4GN1A 3ECIA 3A9KA 1QF6A 2WXIA 2WDVB 3GP7A 4XWTA 1M4VA 1E8WA 4JE3B 4AJWA 3ALBA 4BOSC 2JZPA 2WS3B 1JWSD 4MH8A 5TR5A 1YD8U 4PS8A 2JRIB 1QKZA 5G55A 3ZRCA 5C1ZA 2KTFA 4II2B 3PS6A 1R7SA 2LGXA 1P7FA 4OVZA 2G45B 2L7RA 3SFDB 1ZDVA 1C79A 2JZZA 1XT9B 4WWNA 4JPSA 2G1EA 1L7YA 3N1XC 2O6VA 4AP4C 3NVWA 1PDXA 1YN5A 2KOXA 3UQBA 3DVGX 3L0WB 3AE5B 5D7GA 3SDLC 3Q14C 4HCNB 4RH6A 2AL3A 4G3XB 1FD6A 4RFBA 2CU3A 3QX1A 3WAMA 1TY2A 4WWPA 2NPTA 3ZNZB 2J52A 1I4RA 3KH0A 2WXMA 2LHDA 4YSYB 4BKTA 1TGZB 2GBMA 1UGJA 2WDQB 2KFJA 2GI9A 2N9EB 3HK0A 4A9AA 2RD0A 4EZLA 2BYFA 5JXVA 3AM9A 1JRUA 4E3CA 4MM3A 5L83A 1L0XB 3QHTA 5EE9A 2JYEA 2IYDB 2VRRB 3H7PB 4HVBA 2MQJA 1IBXA 4NPNA 3KVFB 3N32A 3MP9A 5IP4D 1XLPA 1WJ6A 2JVCA 4NNJB 2XBBC 1T0SC 1UGMA 3VRAB 1BT0A 1EU4A 4YSZB 2KKCA 2K8BA 2GB1A 2E6XA 2ZVNA 3RNGC 4WURA 1KH0A 2LWPA 1VLBA 4ACFA 3W1SA 3U7ZA 4EOYA 1UWMA 3TIXA 1UF0A 1F77A 4IOIE 2DYMA 1OQRA 3P4SB 2L52A 5GXGB 2FCNA 3R7QA 5FK9C 2MWSB 4TMAB 3ZJTA 3KUCB 4K7UA 4K3BA 2JU6X 2KJRA 1YN4A 3DPDA 3Q8FA 2V3NA 2IO2B 4DXGA 4BKSA 1P1AA 3UQAA 3L16A 3VTVA 2BPSA 1SE4A 4H2AA 2AWTA 1SE9A 2BB6A 3R2TA 2N7DA 4BBNF 3IAS1 1YN3A 3GZNB 3NZUA 2YEPB 2KLCA 5CHFA 2W3SA 2K3UA 3T3NA 2R2QA 1CZPA 1V1PA 2C7NB 1OEYJ 5HG2A 5G5HA 4WAAA 2MBHA 3MC0B 2D11A 4OZCA 4LJPB 4IM2A 4DDID 4ZHOA 1BXTA 3CSFA 3PSEB 3AE6B 3DOWA 2XEWA 2LD9A 2CR5A
chains in the Genus database with same CATH topology
3ONSA 2KLGA 2ZVOA 4GGQA 1NDDA 3R3MA 3DDCB 2KDBA 3I3TB 3JSVB 4HCPB 4FA6A 5LXHA 4FJVB 4DHZE 2BYVE 3N3KB 2NBUA 5E6OA 2KQ7A 3AU5A 3RYTA 3RCZA 3RT3B 1WXSA 2KWCA 2KJ6A 2L3ZA 2CU1A 2D10A 1S3SG 2K1FA 2LRWA 1WXAA 1MG8A 3DBSA 4MELA 1WXVA 2N9XA 2K8CA 2J0MA 1E7UA 2L0TA 2N4FA 4W9JA 4X57B 2BKRB 4IWQA 2UYZB 2ZCBA 4EZJA 2JRHA 3VFKA 4G0NB 3SHQA 3X0WA 3ZNID 2QHOA 1ZGUB 2IY1B 2O6VD 4ANXA 2WWZA 2K6QA 2IO3B 4P7IA 2MBBB 3OJ4B 4NJ7A 1WIAA 3JYUA 4ANVA 1WR6E 4W9GA 4B9KA 2N1WA 1TZ1A 1V49A 3EHVA 2ZPYA 5GMVA 2O2VA 2MBEA 3OLMD 4I6NB 4JL9A 4WQOB 3QAQA 4A20A 2K39A 4M0WB 2GOWA 3RULA 4EZKA 3MJWA 3V6CB 3PVLA 4URKA 3ZW3A 3H7PA 2Z0DB 2KDEB 1WM3A 1J8CA 2L76A 3UIOB 2HTHA 1WXMA 3B08A 4BFRA 5CX3A 2KWVB 1WGRA 3BY4B 3ENEA 4K81A 3APDA 3IG3A 4TQ1A 3R7RA 4IM0A 4B95A 2RR9A 5E6NA 2MBOA 2WDTB 1XQQA 3MTNB 2KFKA 3VDZA 3QIJA 1HE8A 2KC1A 3A1QA 3NOBA 4OVVA 4ICVA 5AZFA 3NY5A 1Q5WB 3DBHI 3ZVVA 3PGEA 4DBGA 2IY0B 1TTNA 4JQWC 1V6EA 5IA7A 2KHWB 1WM2A 3ZO5B 4JLCA 3UGBB 2JT4B 4W9LA 1GC6A 2KTRB 1PQSA 4MJSA 1RFAA 3WAPA 1E7VA 4K7SA 2EMTA 3AI5A 1WY8A 1UZXB 3OJ3A 5DPRA 2M17A 2GBRA 2JPHA 1E90A 2K6DB 5J18A 2WX0A 1F9JA 1NI2A 2JY6A 2M1MA 4FJZA 4FADA 5JHBA 4I6PA 4G50A 2DHZA 2D2QA 1YIWA 2CS4A 2UWQA 4ZRJA 3W1YA 4ZYNA 3IBEA 3KYCD 4W9HA 3ZDTA 4XC2A 1WGDA 3ZTDA 2L8JA 4GU2A 1UBQA 4AJYB 4ZDVA 5KHQA 2J7QB 2ZCCA 2DAJA 3WIMA 4AUQC 3IHPC 4J6IA 2NR2A 2PJHA 4W9IA 2V3SA 3A4RA 4ICUA 4PS3A 4W9KA 2L05A 4IWOA 2MP2A 2A5UA 4LCDE 1S1QB 1GNUA 2DYOA 4WWOA 5C23A 2LASA 1AARA 2JXXA 2MRPA 3QK0A 3VHTC 4IC7B 1YJ1A 1ZW7A 3IFWB 2KK8A 2IBIB 2LRUA 4E71A 1V5TA 3TL5A 3B0AA 4TKNA 3DCGA 3DVNV 4MEMA 3WALA 2YVCA 4GDLA 2RSUA 3HM3A 3APFA 3GOEA 2CHXA 2KVRA 4FLHA 4KV2A 3R66C 1E8XA 2C5LC 2Z0EB 2NPTB 3QARA 2G4SA 4GB9A 2DZMA 5EDSA 3O65B 5J2RA 4JGHB 3L08A 2R2OA 2GBKA 5AZGA 3VTWA 2LJ5A 3SU8X 3VUYA 2OJRA 4WJPA 4HXDA 1E8YA 1P0RA 2ZPNA 3TMPB 1WJNA 1OTRB 3VUXA 4A3OA 4AOFA 4BKGA 1KLVA 1LM8B 1R4NI 2LVOA 3QA8A 4NY0A 1WX9A 1IP9A 1P3QU 1RLFA 1VD2A 2J0KA 4GDKB 3ZUNA 4BKSD 1WZ0A 3ZLZA 1RRBA 3PHWB 4LDTB 1U4AA 1WMHA 1NBFC 1EUVB 4FHKA 4ZRIA 4KDLB 4IUMB 4DK5A 1WR1A 4TUUA 1KM7A 1R4MI 4ZRKA 2Y5BB 2LVQA 3HIZA 2LXCA 3PZDA 4F1SA 3NHEB 3W1SC 1WI0A 5D6JB 2NCNA 4WJQA 3A4SC 1WGYA 1EF5A 3DBLI 2N7EA 2KQSA 1XD3B 3N30A 5E6PA 1D3ZA 2MW5A 4DHJB 3RZWC 2FCSA 2OOBB 5IAAC 2LVPA 2XK5A 3A9JA 1V80A 3QWZB 5FR6A 3CMMB 4XX5A 4CYEA 2MCNB 4W9CA 1GJZA 2AEHA 4B6WA 4W9DA 3ZRFA 2O2VB 1WYWB 2N9PC 1I42A 4IWPA 2KANA 5JHAA 1V9JA 1P9DU 4BOZB 3RD2A 4YL8A 4KSLC 3L54A 3RUIB 1UELA 5JZEB 3QC8B 1Z2MA 2ZJDA 2NS5A 3V60A 3X23A 4IM3A 1WGGA 2IZVB 4NQKE 4RMAA 3CSTA 3PT2B 3T9LA 2LI5A 3DBRI 1V81A 3OAWA 2W9NA 4NQLB 1WF9A 3AXCA 4G11A 2FUHB 5G2NA 5BO4B 2MX2A 3JVZX 3HHMA 5LLIA 2NBVB 2WX1A 3DVGY 3JW0X 2FAZA 2KX3A 1GC7A 3ZTCA 4GMVA 2BGFA 4KZCA 4FJYA 5LXIB 4GXBA 4LDTD 3VTUA 2BYEA 2KX0A 2DZKA 5CHVC 1YQBA 2L00B 2KMAA 4FHJA 2CKHB 5CHWA 4HWIB 4MJSB 1VCBA 1WJUA 3H6NA 4NJ6A 2B3AA 3VAWA 3ZNGC 3ML8A 4ANWA 1A5RA 3U7DA 3VVWB 3V61A 1WH3A 2KXJA 3U30A 2C7HA 2JZ3B 2KC2A 3M95A 3PRZA 2KN5A 3A33B 4BBNC 4DHJD 1M94A 4W9EA 3UIPB 2HE7A 2CHWA 4MGIE 3QQ8B 3ZNHB 4NAWB 3T8MA 3VQIA 3KW5B 4GN1A 1H8CA 1X1MA 2FNJB 5DCNA 3ECIA 3A9KA 4K7WA 4F7ZA 1E8WA 3PRMB 2EMSA 4AJWA 4MGKE 3ALBA 2N1VA 4BOSC 2A4ZA 2GBJA 1V2YA 4KSKC 2IO1B 3PTFC 4KIKA 2KDIA 2DX5B 2BWES 3ZKJC 4KZ0A 2JUOA 5TR5A 1RAXA 1YD8U 3H9DA 4PS8A 1V5OA 3KYDD 2PE6B 2JRIB 1WGHA 3NS8A 4GIVA 4ANUA 5G55A 3ZRCA 5C1ZA 2I1KA 2K25A 2DZIA 2KTFA 4II2B 3PS6A 2LGXA 3ZIMA 2GMIC 2KDFB 3KUDB 3QCAA 2KNBA 2G45B 1WJ4A 4HPLB 1FXTB 3L13A 2L7RA 1P98A 4GOCA 3K9OB 3PV1A 4RM9A 2JZZA 3SD5A 3TBLD 4MDKE 2M8SA 1XT9B 1SGHA 2FCQA 3EC8A 4WWNA 4EKUA 4M8NA 1ZKHA 3KUZA 1L7YA 2O6VA 4AP4C 1TBEA 3ML9A 4KVGB 3DQVA 4MGYE 1Y8RC 2KOXA 4AWJA 3UQBA 2GBNA 3DVGX 3L0WB 3WA0A 3AU4A 2M0XA 5D7GA 3SDLC 3B1LX 4OVUA 1H4RA 1K8RB 4HCNB 2AL3A 4G3XB 3L10B 2ZEQA 4HK2A 3QX1A 4BVUC 3WAMA 4WWPA 4FBJB 4TV3A 1KJTA 3U8ZA 2NPTA 3ZNZB 2REXA 3PLUA 4HLEA 4IW0A 3KH0A 5JH5C 4EEWA 1WX8A 3LJ3A 2PPHA 2LGYA 5DPSA 4DHZB 2C60A 2D3GA 4BKTA 1TGZB 2V1YA 2GBMA 4HDQA 2PE9A 2KFJA 2KZRA 4FN2A 3PLVA 3IVFA 1YX6B 2N9EB 4GDKA 3H1UA 3HK0A 1UH6A 2RD0A 4PYZA 5KHOA 2L0FA 2DENB 3JSVA 2BYFA 4WJOA 4EZLA 4DXAB 1JRUA 4E74A 4F8CB 4DDGD 4PYUA 4E3CA 4MM3A 5L83A 1QZEA 3QHTA 5DPTA 1I35A 4MH0E 3RZFA 3UF8A 5D2MB 4EFOA 1OQYA 2YLMA 2IYDB 1UBIA 2VRRB 3H7PB 1GG3A 2NBWB 4HVBA 1WE7A 2MQJA 5DPWA 4NPNA 3KVFB 3N32A 2MBQA 4M8MA 5AZHA 1WJ6A 2JVCA 3H7SA 4NNJB 2G3QB 2C7MB 3DVNU 3C0RB 3CF6E 2XBBC 3NZSA 2K8HA 2MSED 2KFKB 4PS7A 2JWZA 2CHZA 2G4DB 3A1QB 4IG7B 3VH3B 1UGMA 1WZ3A 5HKHA 3M62B 1G6JA 1BT0A 2AL6A 2LUEA 4CHKA 3M63B 2BKFA 1SIFA 3AULA 2KKCA 2K8BA 3VUWA 3APCA 2ZVNA 2KMCA 3M3JA 2LWPA 2LZ6A 3EFUA 3W1SA 1Q1OA 2IO0B 2LGDA 5J17A 4EOYA 4MSQB 2DAFA 3HM6X 3WAOA 3TIXA 2AYOB 3PREA 3A9KB 2DYBA 4GSWA 1L2NA 2LXAA 2FIDA 2KJHB 2DYMA 1WRDB 2FCNA 2HD5B 3Q3FA 4KIKB 3R7QA 2MWSB 2FCMA 4N9F4 1LXDA 1E8ZA 3VH4B 1EO6A 4WJNA 2MP2B 3KUCB 4K7UA 3PHXB 3TCAA 3QJZA 4II3B 2KJRA 1C3TA 3DPDA 1OEYA 2Z59B 4FULA 2RGFA 2IO2B 1T0YA 2V4LA 5AEKB 4BKSA 1P1AA 3V6EB 2MLBA 4JIOU 4ASWC 2KTRA 4GDLB 2KD0A 1J19A 3UQAA 3L16A 1LQBA 2BF8B 4XZ4A 2ASQA 3VTVA 3K9PB 2KO3A 1ISNA 2BWFA 1YX5B 4NAWA 2DZJA 2KWUB 3L17A 2M4NA 3TJPA 5L95C 2BPSA 5D94A 1Z5SB 2EKEC 1KOTA 1UD7A 1V86A 2AWTA 1OGWA 2ZNVC 1SE9A 2O6VB 3BINA 2WYQA 2C9WB 2ZZPB 2MA9B 2N7DA 1E5WA 4BBNF 5CTRC 3D32A 2D07B 3NZUA 1GUAB 2KLCA 3GZNI 3PPAA 1C1YB 5CHFA 4KDIC 1WFYA 1WMHB 4A3PA 4RM8A 2R2QA 4W9FA 3LDZE 1Q0WB 4MGZE 3VXWA 2C7NB 1OEYJ 4I6LB 1J0GA 2PEAA 2HJ8A 2J0JA 4WAAA 3UINB 1CMXB 2MBHA 2D11A 2FIFA 1WX7A 2NVUI 3P2BA 4HDOA 4LJPB 4EUTA 1EF1A 4HJKA 3ZDMC 3V62A 4CO7A 3PRPB 4K1RB 1WE6A 3WANA 3Q3JA 4IM2A 4DDID 1IPGA 4MSMB 4DWFA 3EECA 4HPMB 1LFDA 2JF5A 2RPQA 3CSFA 3PSEB 2I1JA 2XK5B 3A9JB 3DOWA 2XEWA 2LD9A 1IYFA 4TQ0A 4LJOB 2ZNVB 2CR5A 3S2AA 3MHSD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ONS A;  2KLG A;  2ZVO A;  4GGQ A;  1NDD A;  3R3M A;  3DDC B;  2KDB A;  3I3T B;  3JSV B;  4HCP B;  4FA6 A;  5LXH A;  4FJV B;  4DHZ E;  2BYV E;  3N3K B;  2NBU A;  5E6O A;  2KQ7 A;  3AU5 A;  3RYT A;  3RCZ A;  3RT3 B;  1WXS A;  2KWC A;  2KJ6 A;  2L3Z A;  2CU1 A;  2D10 A;  1S3S G;  2K1F A;  2LRW A;  1WXA A;  1MG8 A;  3DBS A;  4MEL A;  1WXV A;  2N9X A;  2K8C A;  2J0M A;  1E7U A;  2L0T A;  2N4F A;  4W9J A;  4X57 B;  2BKR B;  4IWQ A;  2UYZ B;  2ZCB A;  4EZJ A;  2JRH A;  3VFK A;  4G0N B;  3SHQ A;  3X0W A;  3ZNI D;  2QHO A;  1ZGU B;  2IY1 B;  2O6V D;  4ANX A;  2WWZ A;  2K6Q A;  2IO3 B;  4P7I A;  2MBB B;  3OJ4 B;  4NJ7 A;  1WIA A;  3JYU A;  4ANV A;  1WR6 E;  4W9G A;  4B9K A;  2N1W A;  1TZ1 A;  1V49 A;  3EHV A;  2ZPY A;  5GMV A;  2O2V A;  2MBE A;  3OLM D;  4I6N B;  4JL9 A;  4WQO B;  3QAQ A;  4A20 A;  2K39 A;  4M0W B;  2GOW A;  3RUL A;  4EZK A;  3MJW A;  3V6C B;  3PVL A;  4URK A;  3ZW3 A;  3H7P A;  2Z0D B;  2KDE B;  1WM3 A;  1J8C A;  2L76 A;  3UIO B;  2HTH A;  1WXM A;  3B08 A;  4BFR A;  5CX3 A;  2KWV B;  1WGR A;  3BY4 B;  3ENE A;  4K81 A;  3APD A;  3IG3 A;  4TQ1 A;  3R7R A;  4IM0 A;  4B95 A;  2RR9 A;  5E6N A;  2MBO A;  2WDT B;  1XQQ A;  3MTN B;  2KFK A;  3VDZ A;  3QIJ A;  1HE8 A;  2KC1 A;  3A1Q A;  3NOB A;  4OVV A;  4ICV A;  5AZF A;  3NY5 A;  1Q5W B;  3DBH I;  3ZVV A;  3PGE A;  4DBG A;  2IY0 B;  1TTN A;  4JQW C;  1V6E A;  5IA7 A;  2KHW B;  1WM2 A;  3ZO5 B;  4JLC A;  3UGB B;  2JT4 B;  4W9L A;  1GC6 A;  2KTR B;  1PQS A;  4MJS A;  1RFA A;  3WAP A;  1E7V A;  4K7S A;  2EMT A;  3AI5 A;  1WY8 A;  1UZX B;  3OJ3 A;  5DPR A;  2M17 A;  2GBR A;  2JPH A;  1E90 A;  2K6D B;  5J18 A;  2WX0 A;  1F9J A;  1NI2 A;  2JY6 A;  2M1M A;  4FJZ A;  4FAD A;  5JHB A;  4I6P A;  4G50 A;  2DHZ A;  2D2Q A;  1YIW A;  2CS4 A;  2UWQ A;  4ZRJ A;  3W1Y A;  4ZYN A;  3IBE A;  3KYC D;  4W9H A;  3ZDT A;  4XC2 A;  1WGD A;  3ZTD A;  2L8J A;  4GU2 A;  1UBQ A;  4AJY B;  4ZDV A;  5KHQ A;  2J7Q B;  2ZCC A;  2DAJ A;  3WIM A;  4AUQ C;  3IHP C;  4J6I A;  2NR2 A;  2PJH A;  4W9I A;  2V3S A;  3A4R A;  4ICU A;  4PS3 A;  4W9K A;  2L05 A;  4IWO A;  2MP2 A;  2A5U A;  4LCD E;  1S1Q B;  1GNU A;  2DYO A;  4WWO A;  5C23 A;  2LAS A;  1AAR A;  2JXX A;  2MRP A;  3QK0 A;  3VHT C;  4IC7 B;  1YJ1 A;  1ZW7 A;  3IFW B;  2KK8 A;  2IBI B;  2LRU A;  4E71 A;  1V5T A;  3TL5 A;  3B0A A;  4TKN A;  3DCG A;  3DVN V;  4MEM A;  3WAL A;  2YVC A;  4GDL A;  2RSU A;  3HM3 A;  3APF A;  3GOE A;  2CHX A;  2KVR A;  4FLH A;  4KV2 A;  3R66 C;  1E8X A;  2C5L C;  2Z0E B;  2NPT B;  3QAR A;  2G4S A;  4GB9 A;  2DZM A;  5EDS A;  3O65 B;  5J2R A;  4JGH B;  3L08 A;  2R2O A;  2GBK A;  5AZG A;  3VTW A;  2LJ5 A;  3SU8 X;  3VUY A;  2OJR A;  4WJP A;  4HXD A;  1E8Y A;  1P0R A;  2ZPN A;  3TMP B;  1WJN A;  1OTR B;  3VUX A;  4A3O A;  4AOF A;  4BKG A;  1KLV A;  1LM8 B;  1R4N I;  2LVO A;  3QA8 A;  4NY0 A;  1WX9 A;  1IP9 A;  1P3Q U;  1RLF A;  1VD2 A;  2J0K A;  4GDK B;  3ZUN A;  4BKS D;  1WZ0 A;  3ZLZ A;  1RRB A;  3PHW B;  4LDT B;  1U4A A;  1WMH A;  1NBF C;  1EUV B;  4FHK A;  4ZRI A;  4KDL B;  4IUM B;  4DK5 A;  1WR1 A;  4TUU A;  1KM7 A;  1R4M I;  4ZRK A;  2Y5B B;  2LVQ A;  3HIZ A;  2LXC A;  3PZD A;  4F1S A;  3NHE B;  3W1S C;  1WI0 A;  5D6J B;  2NCN A;  4WJQ A;  3A4S C;  1WGY A;  1EF5 A;  3DBL I;  2N7E A;  2KQS A;  1XD3 B;  3N30 A;  5E6P A;  1D3Z A;  2MW5 A;  4DHJ B;  3RZW C;  2FCS A;  2OOB B;  5IAA C;  2LVP A;  2XK5 A;  3A9J A;  1V80 A;  3QWZ B;  5FR6 A;  3CMM B;  4XX5 A;  4CYE A;  2MCN B;  4W9C A;  1GJZ A;  2AEH A;  4B6W A;  4W9D A;  3ZRF A;  2O2V B;  1WYW B;  2N9P C;  1I42 A;  4IWP A;  2KAN A;  5JHA A;  1V9J A;  1P9D U;  4BOZ B;  3RD2 A;  4YL8 A;  4KSL C;  3L54 A;  3RUI B;  1UEL A;  5JZE B;  3QC8 B;  1Z2M A;  2ZJD A;  2NS5 A;  3V60 A;  3X23 A;  4IM3 A;  1WGG A;  2IZV B;  4NQK E;  4RMA A;  3CST A;  3PT2 B;  3T9L A;  2LI5 A;  3DBR I;  1V81 A;  3OAW A;  2W9N A;  4NQL B;  1WF9 A;  3AXC A;  4G11 A;  2FUH B;  5G2N A;  5BO4 B;  2MX2 A;  3JVZ X;  3HHM A;  5LLI A;  2NBV B;  2WX1 A;  3DVG Y;  3JW0 X;  2FAZ A;  2KX3 A;  1GC7 A;  3ZTC A;  4GMV A;  2BGF A;  4KZC A;  4FJY A;  5LXI B;  4GXB A;  4LDT D;  3VTU A;  2BYE A;  2KX0 A;  2DZK A;  5CHV C;  1YQB A;  2L00 B;  2KMA A;  4FHJ A;  2CKH B;  5CHW A;  4HWI B;  4MJS B;  1VCB A;  1WJU A;  3H6N A;  4NJ6 A;  2B3A A;  3VAW A;  3ZNG C;  3ML8 A;  4ANW A;  1A5R A;  3U7D A;  3VVW B;  3V61 A;  1WH3 A;  2KXJ A;  3U30 A;  2C7H A;  2JZ3 B;  2KC2 A;  3M95 A;  3PRZ A;  2KN5 A;  3A33 B;  4BBN C;  4DHJ D;  1M94 A;  4W9E A;  3UIP B;  2HE7 A;  2CHW A;  4MGI E;  3QQ8 B;  3ZNH B;  4NAW B;  3T8M A;  3VQI A;  3KW5 B;  4GN1 A;  1H8C A;  1X1M A;  2FNJ B;  5DCN A;  3ECI A;  3A9K A;  4K7W A;  4F7Z A;  1E8W A;  3PRM B;  2EMS A;  4AJW A;  4MGK E;  3ALB A;  2N1V A;  4BOS C;  2A4Z A;  2GBJ A;  1V2Y A;  4KSK C;  2IO1 B;  3PTF C;  4KIK A;  2KDI A;  2DX5 B;  2BWE S;  3ZKJ C;  4KZ0 A;  2JUO A;  5TR5 A;  1RAX A;  1YD8 U;  3H9D A;  4PS8 A;  1V5O A;  3KYD D;  2PE6 B;  2JRI B;  1WGH A;  3NS8 A;  4GIV A;  4ANU A;  5G55 A;  3ZRC A;  5C1Z A;  2I1K A;  2K25 A;  2DZI A;  2KTF A;  4II2 B;  3PS6 A;  2LGX A;  3ZIM A;  2GMI C;  2KDF B;  3KUD B;  3QCA A;  2KNB A;  2G45 B;  1WJ4 A;  4HPL B;  1FXT B;  3L13 A;  2L7R A;  1P98 A;  4GOC A;  3K9O B;  3PV1 A;  4RM9 A;  2JZZ A;  3SD5 A;  3TBL D;  4MDK E;  2M8S A;  1XT9 B;  1SGH A;  2FCQ A;  3EC8 A;  4WWN A;  4EKU A;  4M8N A;  1ZKH A;  3KUZ A;  1L7Y A;  2O6V A;  4AP4 C;  1TBE A;  3ML9 A;  4KVG B;  3DQV A;  4MGY E;  1Y8R C;  2KOX A;  4AWJ A;  3UQB A;  2GBN A;  3DVG X;  3L0W B;  3WA0 A;  3AU4 A;  2M0X A;  5D7G A;  3SDL C;  3B1L X;  4OVU A;  1H4R A;  1K8R B;  4HCN B;  2AL3 A;  4G3X B;  3L10 B;  2ZEQ A;  4HK2 A;  3QX1 A;  4BVU C;  3WAM A;  4WWP A;  4FBJ B;  4TV3 A;  1KJT A;  3U8Z A;  2NPT A;  3ZNZ B;  2REX A;  3PLU A;  4HLE A;  4IW0 A;  3KH0 A;  5JH5 C;  4EEW A;  1WX8 A;  3LJ3 A;  2PPH A;  2LGY A;  5DPS A;  4DHZ B;  2C60 A;  2D3G A;  4BKT A;  1TGZ B;  2V1Y A;  2GBM A;  4HDQ A;  2PE9 A;  2KFJ A;  2KZR A;  4FN2 A;  3PLV A;  3IVF A;  1YX6 B;  2N9E B;  4GDK A;  3H1U A;  3HK0 A;  1UH6 A;  2RD0 A;  4PYZ A;  5KHO A;  2L0F A;  2DEN B;  3JSV A;  2BYF A;  4WJO A;  4EZL A;  4DXA B;  1JRU A;  4E74 A;  4F8C B;  4DDG D;  4PYU A;  4E3C A;  4MM3 A;  5L83 A;  1QZE A;  3QHT A;  5DPT A;  1I35 A;  4MH0 E;  3RZF A;  3UF8 A;  5D2M B;  4EFO A;  1OQY A;  2YLM A;  2IYD B;  1UBI A;  2VRR B;  3H7P B;  1GG3 A;  2NBW B;  4HVB A;  1WE7 A;  2MQJ A;  5DPW A;  4NPN A;  3KVF B;  3N32 A;  2MBQ A;  4M8M A;  5AZH A;  1WJ6 A;  2JVC A;  3H7S A;  4NNJ B;  2G3Q B;  2C7M B;  3DVN U;  3C0R B;  3CF6 E;  2XBB C;  3NZS A;  2K8H A;  2MSE D;  2KFK B;  4PS7 A;  2JWZ A;  2CHZ A;  2G4D B;  3A1Q B;  4IG7 B;  3VH3 B;  1UGM A;  1WZ3 A;  5HKH A;  3M62 B;  1G6J A;  1BT0 A;  2AL6 A;  2LUE A;  4CHK A;  3M63 B;  2BKF A;  1SIF A;  3AUL A;  2KKC A;  2K8B A;  3VUW A;  3APC A;  2ZVN A;  2KMC A;  3M3J A;  2LWP A;  2LZ6 A;  3EFU A;  3W1S A;  1Q1O A;  2IO0 B;  2LGD A;  5J17 A;  4EOY A;  4MSQ B;  2DAF A;  3HM6 X;  3WAO A;  3TIX A;  2AYO B;  3PRE A;  3A9K B;  2DYB A;  4GSW A;  1L2N A;  2LXA A;  2FID A;  2KJH B;  2DYM A;  1WRD B;  2FCN A;  2HD5 B;  3Q3F A;  4KIK B;  3R7Q A;  2MWS B;  2FCM A;  4N9F 4;  1LXD A;  1E8Z A;  3VH4 B;  1EO6 A;  4WJN A;  2MP2 B;  3KUC B;  4K7U A;  3PHX B;  3TCA A;  3QJZ A;  4II3 B;  2KJR A;  1C3T A;  3DPD A;  1OEY A;  2Z59 B;  4FUL A;  2RGF A;  2IO2 B;  1T0Y A;  2V4L A;  5AEK B;  4BKS A;  1P1A A;  3V6E B;  2MLB A;  4JIO U;  4ASW C;  2KTR A;  4GDL B;  2KD0 A;  1J19 A;  3UQA A;  3L16 A;  1LQB A;  2BF8 B;  4XZ4 A;  2ASQ A;  3VTV A;  3K9P B;  2KO3 A;  1ISN A;  2BWF A;  1YX5 B;  4NAW A;  2DZJ A;  2KWU B;  3L17 A;  2M4N A;  3TJP A;  5L95 C;  2BPS A;  5D94 A;  1Z5S B;  2EKE C;  1KOT A;  1UD7 A;  1V86 A;  2AWT A;  1OGW A;  2ZNV C;  1SE9 A;  2O6V B;  3BIN A;  2WYQ A;  2C9W B;  2ZZP B;  2MA9 B;  2N7D A;  1E5W A;  4BBN F;  5CTR C;  3D32 A;  2D07 B;  3NZU A;  1GUA B;  2KLC A;  3GZN I;  3PPA A;  1C1Y B;  5CHF A;  4KDI C;  1WFY A;  1WMH B;  4A3P A;  4RM8 A;  2R2Q A;  4W9F A;  3LDZ E;  1Q0W B;  4MGZ E;  3VXW A;  2C7N B;  1OEY J;  4I6L B;  1J0G A;  2PEA A;  2HJ8 A;  2J0J A;  4WAA A;  3UIN B;  1CMX B;  2MBH A;  2D11 A;  2FIF A;  1WX7 A;  2NVU I;  3P2B A;  4HDO A;  4LJP B;  4EUT A;  1EF1 A;  4HJK A;  3ZDM C;  3V62 A;  4CO7 A;  3PRP B;  4K1R B;  1WE6 A;  3WAN A;  3Q3J A;  4IM2 A;  4DDI D;  1IPG A;  4MSM B;  4DWF A;  3EEC A;  4HPM B;  1LFD A;  2JF5 A;  2RPQ A;  3CSF A;  3PSE B;  2I1J A;  2XK5 B;  3A9J B;  3DOW A;  2XEW A;  2LD9 A;  1IYF A;  4TQ0 A;  4LJO B;  2ZNV B;  2CR5 A;  3S2A A;  3MHS D; 
#chains in the Genus database with same CATH topology
 3Q8E A;  2ZVO A;  2KVZ A;  1FO4 A;  3AEG B;  3DDC B;  5LXH A;  3JSV B;  1NEK B;  4FA6 A;  3R8B A;  3N3K B;  5EE3 A;  1FPY A;  3AU5 A;  2K1F A;  1MG8 A;  1JWM D;  1WXV A;  2K8C A;  2H89 B;  4W9J A;  3W9C B;  4EZJ A;  1D5Z C;  3ZNI D;  1ZGU B;  3IAM 1;  4ANX A;  1GOZ A;  1FEH A;  1AN8 A;  3AV8 A;  4NJ7 A;  3NRZ A;  1WIA A;  3N1Y C;  1L0Y B;  1WR6 E;  4B9K A;  1FIQ A;  1NYQ A;  2MJD A;  2ZPY A;  5GMV A;  2O2V A;  1HTO A;  4JL9 A;  3KWL A;  1VZ7 A;  5FR3 A;  1QT9 A;  3RUL A;  1SF0 A;  4EZK A;  3V6C B;  4IKG A;  2KDE B;  2HTH A;  1WXM A;  4L2Y A;  3BY4 B;  2V9H A;  3ENE A;  2MBO A;  3B2G A;  1XQQ A;  3VDZ A;  1F52 A;  3NOB A;  4ICV A;  1TKY A;  3NY5 A;  3PGE A;  5IA7 A;  2KHW B;  1WM2 A;  3ZO5 B;  4JLC A;  3UGB B;  2JT4 B;  2JYT A;  4W9L A;  2ACZ B;  4AS1 A;  1PQS A;  1FFU A;  5BYS A;  1RFA A;  1L4Z B;  1ZP0 B;  3OJ3 A;  1E90 A;  3AEB B;  1NI2 A;  3HUI A;  4FJZ A;  3U2S C;  2N9K A;  1MG4 A;  2CS4 A;  2UWQ A;  3ABV B;  3IBE A;  3BVZ A;  3W2D A;  3ZDT A;  4XC2 A;  1WGD A;  3ZTD A;  4AJY B;  3WIM A;  2PJH A;  4ICU A;  2NMQ A;  1S1Q B;  1HA5 A;  1AAR A;  3VHT C;  4IC7 B;  4L23 A;  4C4V B;  3KQ4 A;  2N7J A;  2KK8 A;  2LRU A;  5FKA C;  5HI1 A;  1N6Z A;  4TKN A;  3DVN V;  4MEM A;  1YNT E;  1SE3 A;  2YEP F;  1HTQ A;  1IGD A;  4FLH A;  4GB9 A;  4BAX A;  1JRP A;  2RPV A;  2GBK A;  5IO9 A;  3VTW A;  3SU8 X;  4WJP A;  1E8Y A;  2ZPN A;  3TMP B;  4A3O A;  4AOF A;  1R4N I;  3ZJV A;  2LVO A;  3QA8 A;  4NY0 A;  1WX9 A;  1IP9 A;  1RM6 C;  1N60 A;  5C2T B;  1PUT A;  1ZOY B;  1RRB A;  3I57 A;  1U4A A;  1EUV B;  2WXO A;  1OQQ A;  4K3C A;  3ZXV A;  1R4M I;  4F1S A;  3PZ7 A;  2QCZ A;  1EF5 A;  1N63 A;  2N7E A;  3ZXR A;  2LVP A;  3CMM B;  4W9C A;  2WGS A;  4BOZ B;  2WXJ A;  3RD2 A;  4KSL C;  2OJW A;  3Q3N C;  3QC8 B;  4HRS A;  4LNI A;  2AX5 A;  1F1H A;  4RMA A;  3CST A;  3PT2 B;  4P1B C;  2L1A A;  2BS3 B;  5G2N A;  5BO4 B;  2NBV B;  3AE8 B;  3DVG Y;  3HRD D;  3JW0 X;  4YTM B;  2BGF A;  4QAY A;  5LXI B;  4GXB A;  3VTU A;  2BYE A;  5HFY A;  5CHV C;  2IJ0 A;  2BW2 A;  1YQB A;  4XDD A;  4M0W A;  1VCB A;  1WJU A;  3H6N A;  3NVZ A;  2PVG C;  4ANW A;  3Q8C A;  3VVW B;  1WH3 A;  4BBN C;  4C56 C;  3M95 A;  3A33 B;  3AE1 B;  3Q8B A;  1M94 A;  3UIP B;  4MGI E;  1I4X A;  1TS2 A;  3KW5 B;  1X1M A;  1DOY A;  2MJE A;  1FM0 D;  4K7W A;  2EMS A;  4ARI A;  2INP E;  3OG5 A;  2GBJ A;  5HHD G;  1V2Y A;  4RCO A;  3PTF C;  4KIK A;  1NEN B;  2JUO A;  1D5M C;  3KYD D;  1WGH A;  4GIV A;  1SB3 C;  4ANU A;  1SE2 A;  3NJT A;  3BYT B;  3ZJU A;  3KUD B;  3AH7 A;  4N59 A;  2KNB A;  1PYW D;  1WJ4 A;  3L13 A;  4GOC A;  3SD5 A;  3CIR B;  1MI0 A;  2M8S A;  2FCQ A;  1OFF A;  3EC8 A;  4M8N A;  1ZKH A;  5D3I B;  3N9Y C;  2XNA C;  3DQV A;  1FCC C;  4MGY E;  1Y8R C;  4Q2J A;  3WA0 A;  3AU4 A;  2CJO A;  3B1L X;  1CK1 A;  2ICI A;  3AE7 B;  2ZEQ A;  1XF5 L;  3ZYY X;  1QOG A;  1VZ8 A;  5JH5 C;  2LGY A;  5DPS A;  4DHZ B;  2C60 A;  1SIJ A;  2V1Y A;  1HQR D;  3H1U A;  1UH6 A;  4PYZ A;  5KHO A;  3MFG A;  2DEN B;  4WJO A;  4LNO A;  4DXA B;  5DPT A;  3UF8 A;  1UBI A;  5C3J B;  1STE A;  1GG3 A;  5DPW A;  2KYW A;  2LMC A;  2MBQ A;  2FUG 1;  2G3Q B;  3DVN U;  3C0R B;  2K8H A;  2KFK B;  3BVM A;  1ZDX A;  4PS7 A;  4WH4 A;  5HKH A;  1WZ3 A;  3SFE B;  1G6J A;  4CHK A;  3AUL A;  2RMM A;  3Q8A A;  3VUW A;  4N6E B;  3M3J A;  2LZ6 A;  2JWU A;  2IO0 B;  3GB1 A;  4MSQ B;  3HM6 X;  2AYO B;  3A9K B;  1B9R A;  1FRR A;  2LXA A;  3DHI C;  1WRD B;  2MH7 A;  3EFC A;  1LXD A;  3B2F A;  1EO6 A;  1C3T A;  4II3 B;  2Z59 B;  4YTP B;  2CJN A;  5AEK B;  2WXF A;  2D5G A;  2MLB A;  4C7Z A;  2KTR A;  2KD0 A;  1J19 A;  1LQB A;  3C19 A;  5T8I A;  2ASQ A;  1YX5 B;  4TSS A;  4NAW A;  1AWD A;  3L17 A;  3N1Z C;  1JQ4 A;  4OHJ A;  1KOT A;  1V86 A;  1OGW A;  2M0A A;  4A55 A;  2O6V B;  2C9W B;  1E5W A;  4GLS C;  5CTR C;  4C7Y A;  4ITK A;  4PT5 A;  1V8C A;  3P4R B;  1SJE D;  1C1Y B;  4KDI C;  2HJ1 A;  4A3P A;  2DWQ A;  3LDZ E;  4W9F A;  4MGZ E;  3VXW A;  2KAJ A;  2HJ8 A;  2OED A;  3UIN B;  1CMX B;  3CWI A;  2FIF A;  3P2B A;  4HDO A;  4EUT A;  3ZDM C;  3V62 A;  1DYQ A;  3PRP B;  4K1R B;  3EEC A;  3RN9 C;  2I1J A;  3A9J B;  3E56 A;  4LJO B;  2ZNV B;  2KLG A;  2KDB A;  1VJK A;  5E6O A;  2KQ7 A;  2INN E;  1ENF A;  3RT3 B;  3NZ3 A;  4MM3 B;  1TIF A;  2LRW A;  1C77 A;  2QMT A;  3DBS A;  2PW9 A;  1FMA D;  2LHE A;  2N9X A;  2BKR B;  3VFK A;  3X0W A;  4A6Q A;  2O6V D;  5G5G A;  3OJ4 B;  3JYU A;  1TZ1 A;  3EHV A;  3MJ5 A;  4WQO B;  5BYQ A;  2GOW A;  3ZGZ A;  1Q10 A;  2QSD A;  3ZW3 A;  1BUI C;  3H7P A;  2Z0D B;  1WM3 A;  3MHZ A;  1C4C A;  1ZUD 2;  1UWX A;  4K81 A;  3APD A;  3IG3 A;  3R7R A;  3NG0 A;  2EKI A;  2WXL A;  2RR9 A;  1GB4 A;  3QIJ A;  3PZ8 A;  3TEY A;  3IT4 B;  5AZF A;  3DBH B;  2IY0 B;  2K9X A;  4JQW C;  1V6E A;  2BQQ A;  2VH2 A;  1T5X D;  4A90 A;  3MC9 A;  4P16 A;  4D2K A;  2GBR A;  1JML A;  2WX0 A;  2W54 A;  1F9J A;  1EWY C;  2JY6 A;  2M1M A;  3IT6 B;  3P1M A;  2DHZ A;  2D2Q A;  4ZRJ A;  3ETR A;  3KYC D;  2MHJ A;  5KHQ A;  4GU2 A;  2ZCC A;  2DAJ A;  4J6I A;  2V3S A;  3A4R A;  4PS3 A;  2L05 A;  4LCD E;  4BZA A;  1YJ1 A;  1ZW7 A;  1ACC A;  5MPO A;  5BMG A;  4OZA A;  1V5T A;  3B0A A;  2ZW1 A;  3V05 A;  2RSU A;  4KGR A;  3GOE A;  2CHX A;  3IXS A;  2Z0E B;  3QAR A;  5LNK 1;  2W82 A;  1E6E B;  5AZG A;  2WXH A;  3VUY A;  2OJR A;  1WJN A;  4BKG A;  1KLV A;  1LM8 B;  4C00 A;  2KN4 A;  3GE8 C;  1RLF A;  4GDK B;  3ZUN A;  4BKS D;  3ZLZ A;  2WXN A;  4KDL B;  1T6B X;  3TEZ A;  1XCQ L;  1KM7 A;  1UUP A;  4ZRK A;  4P1C C;  2WXK A;  2IDY A;  2M56 B;  4JWU C;  3RI7 C;  1E7P B;  2KQS A;  3FIL B;  2OOB B;  2W3R A;  4XX5 A;  4YTN B;  1XLN A;  2D3C A;  3BZD B;  2QDF A;  3AEC B;  3DHG C;  1HZ5 A;  1NYR A;  1WYW B;  2O2V B;  4IWP A;  2KAN A;  5JHA A;  3AE4 B;  1I4P A;  4YL8 A;  1AW7 A;  2BYT A;  1Z2M A;  2NS5 A;  2EEL A;  1CQV A;  1NI3 A;  2IZV B;  4NQK E;  1V81 A;  3U52 E;  2KAC A;  3OAW A;  2JX5 A;  2W9N A;  4NQL B;  1JWB D;  2MX2 A;  1C4P A;  3HHM A;  1KF6 B;  3ZTC A;  4GMV A;  4FJY A;  1FNU A;  1FCL A;  2DZK A;  2WDR B;  2L00 B;  2WXQ A;  2CKH B;  1MHX A;  4HWI B;  3ZNG C;  3U7D A;  3R2I A;  2JZ3 B;  3W5V B;  3QQ8 B;  3VQI A;  1QQR A;  2FBW B;  4F7Z A;  5IN7 A;  3PRM B;  4MGK E;  3V3X A;  2GLS A;  2N1V A;  2A4Z A;  2IO1 B;  3MC8 A;  1WSP A;  3BVG A;  2DX5 B;  2BWE S;  3ZKJ C;  5BMH A;  3AE3 B;  1V5O A;  3NS8 A;  1RFK A;  1QIL A;  1ZXH A;  2ON8 A;  2I1K A;  2K25 A;  2DZI A;  2Z8L A;  3ZIM A;  1HXY D;  2KDF B;  4LTU A;  4DQO C;  3OWE B;  1K53 A;  1P98 A;  3PV1 A;  4R3D A;  1C9F A;  1ET9 A;  1SGH A;  3ML9 A;  4KVG B;  4OW0 A;  3WCQ A;  2KWD A;  4AWJ A;  2GBN A;  2LFI A;  4C4V A;  3RNC C;  1PGX A;  1JAL A;  1H4R A;  1K8R B;  2I38 A;  3AEA B;  4KGS A;  1I7H A;  4HK2 A;  4BVU C;  2BB5 A;  4FBJ B;  3PLU A;  4HLE A;  4IW0 A;  5BYR A;  1WX8 A;  3LJ3 A;  2PPH A;  1JWU D;  2X8X X;  3PLV A;  3IVF A;  1YX6 B;  2WNM A;  2LGS A;  1XLQ A;  1J7B A;  1V1O A;  2L0F A;  3H8H A;  2LEK A;  3Q6B A;  4E74 A;  3URY A;  4FXC A;  1LGR A;  3TEX A;  1QZE A;  1MPE A;  3P4P B;  1I35 A;  1LO5 D;  1WRI A;  1WE7 A;  4O1N A;  4M8M A;  4DXF A;  4RF1 A;  2IND C;  2C7M B;  3NZS A;  2MSE D;  3A1Q B;  4IG7 B;  1CJE A;  3C8Y A;  3M62 B;  2LUE A;  4M01 A;  3M63 B;  2K22 A;  3APC A;  3NVY A;  1C4A A;  1MVK A;  3EFU A;  4YSX B;  4A8X C;  3RNF C;  1Q1O A;  2LGD A;  5J17 A;  2DAF A;  3WAO A;  4GSW A;  1L2N A;  2L32 A;  2FID A;  2HD5 B;  3VR9 B;  4KIK B;  1D4B A;  2FCM A;  4N9F 4;  1KTK A;  3VH4 B;  1E8Z A;  4WJN A;  2MP2 B;  3QJZ A;  1OEY A;  2RGF A;  2V0G A;  2V4L A;  1WYG A;  3V6E B;  4JIO U;  4GDL B;  1QOF A;  2PIA A;  2BF8 B;  4XZ4 A;  2J42 A;  1ZPS A;  3K9P B;  1ISN A;  2JQR B;  1VR9 A;  2DZJ A;  3TJP A;  5D94 A;  2EKE C;  2ZNV C;  2WYQ A;  4NJC A;  2ZZP B;  4RGN A;  5AUK A;  3BWU D;  4YXD B;  1GUA B;  3GZN I;  1WFY A;  1WMH B;  4RM8 A;  1N61 A;  2RDH A;  2GRI A;  1F0Z A;  4I6L B;  5EE1 A;  2R61 A;  1EF1 A;  3EUB 2;  3WAN A;  2TSS A;  4MSM B;  1K52 A;  2RPQ A;  2WXR A;  1TS5 A;  2XK5 B;  4PK1 A;  1HZ6 A;  1PFD A;  4TQ0 A;  1YJI A;  3S2A A;  3MHS D;  3ONS A;  4GGQ A;  3R3M A;  3I3T B;  3RMK C;  4FJV B;  2BBC A;  2NBU A;  1B1Z A;  3RYT A;  3RCZ A;  1WXS A;  2KWC A;  2KJ6 A;  4WWM A;  2L3Z A;  2CU1 A;  1S3S G;  2IGG A;  3HVZ A;  1WXA A;  2KMM A;  3AE9 B;  4MEL A;  2B76 B;  2J0M A;  1E7U A;  4N58 A;  2N4F A;  3VRB B;  2LJI A;  2ZCB A;  2JRH A;  4G0N B;  2QHO A;  1N5X A;  2K6Q A;  1XEE A;  4RNA A;  1BML C;  2MBB B;  1D6E C;  4ANV A;  3KWV A;  1V49 A;  3OLM D;  2PVO D;  4A20 A;  1TKE A;  4KKI A;  4C80 A;  3PVL A;  4URK A;  1K51 A;  1J8C A;  2L76 A;  3UIO B;  3GE3 C;  5CX3 A;  2KWV B;  4TQ1 A;  4CQN A;  3T3O A;  4B95 A;  5H92 C;  4NZL B;  5E6N A;  3RFZ B;  3MTN B;  3UI3 A;  2KFK A;  4OVV A;  1HE8 A;  1ESF A;  4M00 A;  4MAC A;  1KLG D;  3LXF A;  4DBG A;  1TKG A;  2QC8 A;  1HEZ E;  1I4H A;  1GC6 A;  2KTR B;  2WU2 B;  4MJS A;  1AYF A;  3WAP A;  1E7V A;  4K7S A;  3BII D;  3EA6 A;  1WY8 A;  5J18 A;  2JPH A;  2K6D B;  3L4P A;  5JHB A;  4G50 A;  1YIW A;  4ZYN A;  2L8J A;  4ZYS A;  1SBB B;  1UBQ A;  2WP9 B;  1YQ3 B;  4WAF A;  4AUQ C;  3IHP C;  5D3D A;  2NR2 A;  4W9I A;  3VR8 B;  4W9K A;  4IWO A;  1NVI D;  1GNU A;  2H88 B;  4WWO A;  5C23 A;  2XN9 C;  2JXX A;  3QK0 A;  4WIP A;  1ET6 A;  2W55 A;  2YVC A;  3Q2A C;  2KVR A;  3R66 C;  2NPT B;  5EDS A;  3O65 B;  5J2R A;  4REZ A;  4JGH B;  2AQ1 B;  2LJ5 A;  2QIE B;  1MFW A;  1P0R A;  3VUX A;  4YWG G;  1OTR B;  2N0S B;  2HDE A;  1R4N B;  2KT7 A;  2PMV A;  3FKY A;  1XO3 A;  1P3Q U;  2J0K A;  4HKZ E;  3PHW B;  3P4Q B;  1R4M B;  3W5U B;  1WR1 A;  4TUU A;  1XCT L;  3PZD A;  2LXC A;  2RDB C;  3P42 A;  1SJH D;  2NCN A;  3A4S C;  2IGH A;  1WGY A;  3DBL I;  4EE2 A;  1IBX B;  3DWM A;  3AED B;  2FCS A;  3A9J A;  3QWZ B;  5FR6 A;  1I4Q A;  2MCN B;  1GJZ A;  2AEH A;  4W9D A;  3BYY B;  5IOI A;  1P9D U;  3RPF C;  2BVC A;  1F2R C;  3L54 A;  1V97 A;  3NS1 A;  3RUI B;  5JZE B;  3LB8 C;  4XE0 A;  4US8 A;  2ZJD A;  3V60 A;  1GPX A;  3X23 A;  1WGG A;  4JWS C;  3T9L A;  2IGD A;  1P7E A;  3DBR I;  2AQ3 B;  2K0P A;  2NTT A;  3AXC A;  2FUH B;  2M19 A;  2WX1 A;  2FAZ A;  2KX3 A;  4KZC A;  4ZRP A;  2DBY A;  3AB5 A;  1IGC A;  5CHW A;  4USA A;  1I4G A;  3V61 A;  2KXJ A;  3U30 A;  2C7H A;  1MHH E;  1K50 A;  3PRZ A;  4W9E A;  3T8M A;  3AE2 B;  1H8C A;  5DCN A;  2FNJ B;  4L1B A;  4JX1 C;  2RDG A;  1MJD A;  2WHI A;  4YT0 B;  2WXP A;  4KSK C;  4LNK A;  2IPK D;  2KDI A;  4KZ0 A;  1RAX A;  3H9D A;  1D5X C;  2WXG A;  3LYY A;  3SEB A;  4LNN A;  2PE6 B;  2J53 A;  1V1P B;  1VZ6 A;  3KLS X;  3NVV A;  5AUI A;  1GB1 A;  2GMI C;  1WXQ A;  1N62 A;  3QCA A;  4HPL B;  3NUH B;  3AN1 A;  4P6V F;  1FXT B;  3K9O B;  4RM9 A;  3TBL D;  4MDK E;  1DOX A;  2QEJ C;  4EKU A;  3KUZ A;  3AMZ A;  4KKJ A;  1TBE A;  1QLB B;  1TY0 A;  2M0X A;  1FXA A;  4OVU A;  1VDV A;  2SEB D;  3GS2 A;  3L10 B;  1E9M A;  4TV3 A;  1KJT A;  3U8Z A;  2REX A;  2LGI A;  4EEW A;  1L6V A;  1L4D B;  1QOB A;  2DLB A;  2D3G A;  4HDQ A;  4S17 A;  2PE9 A;  3TSS A;  2E3T A;  2KZR A;  1QOA A;  2VZK B;  4FN2 A;  4GDK A;  3JSV A;  4AQ7 A;  4F8C B;  4DDG D;  4PYU A;  1L6U A;  4MH0 E;  3RZF A;  2INC C;  5D2M B;  4EFO A;  1OQY A;  2YLM A;  1PGB A;  2NBW B;  5TSS A;  3FIL A;  4B0M A;  5AZH A;  1XXG A;  2ONQ A;  1DGJ A;  3H7S A;  4ZOH C;  1TYG B;  4LNF A;  2Y3A A;  3CF6 E;  3VH3 B;  2JWZ A;  2CHZ A;  2G4D B;  2KDM A;  1E0Z A;  1SXT A;  1YJJ A;  2AL6 A;  2BKF A;  1SIF A;  1N5W A;  1JRO A;  2AQ2 B;  2KMC A;  1ZE3 D;  5E6J A;  1YMH E;  2KQ4 X;  3PRE A;  4ARC A;  1PGA A;  2DYB A;  2V3P A;  2KJH B;  2VZK D;  3Q3F A;  1JCK B;  2QJL A;  2L83 A;  2D3A A;  3PHX B;  3TCA A;  2Y5C A;  3I63 C;  4FUL A;  1T0Y A;  1TT5 B;  2X38 A;  1JWA D;  4NAM A;  4UDU C;  4ASW C;  3E9S A;  1SSN A;  5IKC M;  2ZW0 A;  3AEE B;  4LLG M;  2KO3 A;  2BWF A;  2KWU B;  2M4N A;  5L95 C;  1ZXI A;  1Z5S B;  1UD7 A;  3BIN A;  2MA9 B;  2MJ3 A;  3D32 A;  2D07 B;  3Q3O C;  4XWW A;  3PPA A;  4KGT A;  1J7A A;  2I2Y A;  1Q0W B;  5BMI A;  1J0G A;  2PEA A;  2J0J A;  3AEF B;  3N20 C;  2WU5 B;  1T3Q A;  3PO0 A;  1DOI A;  1WX7 A;  1Y56 A;  2NVU I;  4S0R A;  4HJK A;  4CO7 A;  1WE6 A;  4HRO A;  3Q3J A;  4DWF A;  3EGR A;  1IPG A;  2BTE A;  2NTS A;  4HPM B;  1FXI A;  1LFD A;  1YOV B;  2JF5 A;  1JW9 D;  2JSV X;  1IYF A;  3Q3M C;  1NDD A;  2HTM E;  3TEW A;  4HCP B;  1A70 A;  4DHZ E;  2BYV E;  2D10 A;  1ROE A;  4RGT A;  3DBL B;  1KLU D;  1T0Q C;  2L0T A;  4X57 B;  4IWQ A;  2UYZ B;  1SEB D;  4WQM A;  3SHQ A;  2PTL A;  2IY1 B;  1C78 A;  1KFY B;  1KRH A;  2WWZ A;  2IO3 B;  4P7I A;  4W9G A;  1J7C A;  2N1W A;  2MBE A;  4ZHP A;  4I6N B;  1FNW A;  2WQY B;  3QAQ A;  4XDC A;  2K39 A;  4M0W B;  1IUE A;  3RNA C;  1TS4 A;  3MJW A;  3DBR B;  2QIL A;  2BT6 A;  1XLO A;  1TZO A;  3FAH A;  3O13 A;  3I9V 1;  3B08 A;  3RNB C;  4BFR A;  1EU3 A;  2J4X A;  3DWG C;  1WGR A;  4HJG E;  2V4I B;  1TS3 A;  4IM0 A;  2G9H D;  3ZQ4 A;  2WDT B;  1WWT A;  2KC1 A;  3A1Q A;  4B0E A;  2N9L A;  1Q5W B;  3DBH I;  3HVD A;  3ZVV A;  3BK2 A;  1TTN A;  1YQ4 B;  1C76 A;  1FFV A;  2EMT A;  3AI5 A;  1UZX B;  5DPR A;  2M17 A;  2D3B A;  4XYC A;  2OHF A;  1E10 A;  4FAD A;  2PLP A;  4I6P A;  4RGM A;  3W1Y A;  1RYJ A;  4W9H A;  4ZDV A;  4LK0 M;  2J7Q B;  1EM7 A;  3Q69 A;  5H8Y E;  2MP2 A;  2A5U A;  2DYO A;  2LAS A;  2MRP A;  3BK1 A;  1L5P A;  3IFW B;  2IBI B;  4E71 A;  2Y5P A;  3TL5 A;  2SAK A;  2PKO A;  3DCG A;  3WAL A;  3J9C A;  4OZB A;  4GDL A;  3HM3 A;  3APF A;  4RGO S;  1FNV A;  4KV2 A;  1E8X A;  2C5L C;  2G4S A;  2DZM A;  3L08 A;  2R2O A;  5EE0 A;  2BS4 B;  4XGA B;  1VRA B;  4HXD A;  3DHH C;  2JXT A;  2LUM A;  1L0V B;  2K5P A;  1VD2 A;  4HKQ A;  1WZ0 A;  4LDT B;  1WMH A;  1NBF C;  4FHK A;  4ZRI A;  1GAQ B;  4IUM B;  4DK5 A;  2Y5B B;  2DNF A;  2LVQ A;  3HIZ A;  3NHE B;  3W1S C;  1WI0 A;  5D6J B;  4WJQ A;  4US9 A;  1XD3 B;  3N30 A;  4ZRQ A;  5E6P A;  1D3Z A;  2MW5 A;  4HEA 1;  4DHJ B;  3RZW C;  4KX6 B;  5IAA C;  2XK5 A;  1V80 A;  3U4E G;  3P63 A;  4CYE A;  1TJE A;  4B6W A;  3I5J C;  3ZRF A;  1I42 A;  2N9P C;  1V9J A;  2UU7 A;  1UEL A;  1FRD A;  3TUO A;  2BS2 B;  2VH1 A;  4IM3 A;  1RWS A;  4RF0 A;  2LI5 A;  1WF9 A;  3B9J A;  4G11 A;  3JVZ X;  5LLI A;  1WGK A;  1GC7 A;  2Q5W D;  3SR6 A;  1T0R C;  2WLB A;  4LDT D;  2KX0 A;  4M02 A;  4J3O D;  2KMA A;  4FHJ A;  2FE8 A;  3FC4 A;  4MJS B;  4NJ6 A;  1F2R I;  1UNS A;  2B3A A;  4HPP A;  3RNE C;  3VAW A;  3ML8 A;  5I4D A;  1A5R A;  4IDI A;  4MT5 A;  2KC2 A;  2KN5 A;  4DHJ D;  2MEK A;  2HE7 A;  2CHW A;  3ZNH B;  4NAW B;  1EWC A;  4GN1 A;  3ECI A;  3A9K A;  1QF6 A;  2WXI A;  2WDV B;  3GP7 A;  4XWT A;  1M4V A;  1E8W A;  4JE3 B;  4AJW A;  3ALB A;  4BOS C;  2JZP A;  2WS3 B;  1JWS D;  4MH8 A;  5TR5 A;  1YD8 U;  4PS8 A;  2JRI B;  1QKZ A;  5G55 A;  3ZRC A;  5C1Z A;  2KTF A;  4II2 B;  3PS6 A;  1R7S A;  2LGX A;  1P7F A;  4OVZ A;  2G45 B;  2L7R A;  3SFD B;  1ZDV A;  1C79 A;  2JZZ A;  1XT9 B;  4WWN A;  4JPS A;  2G1E A;  1L7Y A;  3N1X C;  2O6V A;  4AP4 C;  3NVW A;  1PDX A;  1YN5 A;  2KOX A;  3UQB A;  3DVG X;  3L0W B;  3AE5 B;  5D7G A;  3SDL C;  3Q14 C;  4HCN B;  4RH6 A;  2AL3 A;  4G3X B;  1FD6 A;  4RFB A;  2CU3 A;  3QX1 A;  3WAM A;  1TY2 A;  4WWP A;  2NPT A;  3ZNZ B;  2J52 A;  1I4R A;  3KH0 A;  2WXM A;  2LHD A;  4YSY B;  4BKT A;  1TGZ B;  2GBM A;  1UGJ A;  2WDQ B;  2KFJ A;  2GI9 A;  2N9E B;  3HK0 A;  4A9A A;  2RD0 A;  4EZL A;  2BYF A;  5JXV A;  3AM9 A;  1JRU A;  4E3C A;  4MM3 A;  5L83 A;  1L0X B;  3QHT A;  5EE9 A;  2JYE A;  2IYD B;  2VRR B;  3H7P B;  4HVB A;  2MQJ A;  1IBX A;  4NPN A;  3KVF B;  3N32 A;  3MP9 A;  5IP4 D;  1XLP A;  1WJ6 A;  2JVC A;  4NNJ B;  2XBB C;  1T0S C;  1UGM A;  3VRA B;  1BT0 A;  1EU4 A;  4YSZ B;  2KKC A;  2K8B A;  2GB1 A;  2E6X A;  2ZVN A;  3RNG C;  4WUR A;  1KH0 A;  2LWP A;  1VLB A;  4ACF A;  3W1S A;  3U7Z A;  4EOY A;  1UWM A;  3TIX A;  1UF0 A;  1F77 A;  4IOI E;  2DYM A;  1OQR A;  3P4S B;  2L52 A;  5GXG B;  2FCN A;  3R7Q A;  5FK9 C;  2MWS B;  4TMA B;  3ZJT A;  3KUC B;  4K7U A;  4K3B A;  2JU6 X;  2KJR A;  1YN4 A;  3DPD A;  3Q8F A;  2V3N A;  2IO2 B;  4DXG A;  4BKS A;  1P1A A;  3UQA A;  3L16 A;  3VTV A;  2BPS A;  1SE4 A;  4H2A A;  2AWT A;  1SE9 A;  2BB6 A;  3R2T A;  2N7D A;  4BBN F;  3IAS 1;  1YN3 A;  3GZN B;  3NZU A;  2YEP B;  2KLC A;  5CHF A;  2W3S A;  2K3U A;  3T3N A;  2R2Q A;  1CZP A;  1V1P A;  2C7N B;  1OEY J;  5HG2 A;  5G5H A;  4WAA A;  2MBH A;  3MC0 B;  2D11 A;  4OZC A;  4LJP B;  4IM2 A;  4DDI D;  4ZHO A;  1BXT A;  3CSF A;  3PSE B;  3AE6 B;  3DOW A;  2XEW A;  2LD9 A;  2CR5 A; 
#chains in the Genus database with same CATH homology
 3ONS A;  2KLG A;  2ZVO A;  4GGQ A;  1NDD A;  3R3M A;  3DDC B;  2KDB A;  3I3T B;  3JSV B;  4HCP B;  4FA6 A;  5LXH A;  4FJV B;  4DHZ E;  2BYV E;  3N3K B;  2NBU A;  5E6O A;  2KQ7 A;  3AU5 A;  3RYT A;  3RCZ A;  3RT3 B;  1WXS A;  2KWC A;  2KJ6 A;  2L3Z A;  2CU1 A;  2D10 A;  1S3S G;  2K1F A;  2LRW A;  1WXA A;  1MG8 A;  3DBS A;  4MEL A;  1WXV A;  2N9X A;  2K8C A;  2J0M A;  1E7U A;  2L0T A;  2N4F A;  4W9J A;  4X57 B;  2BKR B;  4IWQ A;  2UYZ B;  2ZCB A;  4EZJ A;  2JRH A;  3VFK A;  4G0N B;  3SHQ A;  3X0W A;  3ZNI D;  2QHO A;  1ZGU B;  2IY1 B;  2O6V D;  4ANX A;  2WWZ A;  2K6Q A;  2IO3 B;  4P7I A;  2MBB B;  3OJ4 B;  4NJ7 A;  1WIA A;  3JYU A;  4ANV A;  1WR6 E;  4W9G A;  4B9K A;  2N1W A;  1TZ1 A;  1V49 A;  3EHV A;  2ZPY A;  5GMV A;  2O2V A;  2MBE A;  3OLM D;  4I6N B;  4JL9 A;  4WQO B;  3QAQ A;  4A20 A;  2K39 A;  4M0W B;  2GOW A;  3RUL A;  4EZK A;  3MJW A;  3V6C B;  3PVL A;  4URK A;  3ZW3 A;  3H7P A;  2Z0D B;  2KDE B;  1WM3 A;  1J8C A;  2L76 A;  3UIO B;  2HTH A;  1WXM A;  3B08 A;  4BFR A;  5CX3 A;  2KWV B;  1WGR A;  3BY4 B;  3ENE A;  4K81 A;  3APD A;  3IG3 A;  4TQ1 A;  3R7R A;  4IM0 A;  4B95 A;  2RR9 A;  5E6N A;  2MBO A;  2WDT B;  1XQQ A;  3MTN B;  2KFK A;  3VDZ A;  3QIJ A;  1HE8 A;  2KC1 A;  3A1Q A;  3NOB A;  4OVV A;  4ICV A;  5AZF A;  3NY5 A;  1Q5W B;  3DBH I;  3ZVV A;  3PGE A;  4DBG A;  2IY0 B;  1TTN A;  4JQW C;  1V6E A;  5IA7 A;  2KHW B;  1WM2 A;  3ZO5 B;  4JLC A;  3UGB B;  2JT4 B;  4W9L A;  1GC6 A;  2KTR B;  1PQS A;  4MJS A;  1RFA A;  3WAP A;  1E7V A;  4K7S A;  2EMT A;  3AI5 A;  1WY8 A;  1UZX B;  3OJ3 A;  5DPR A;  2M17 A;  2GBR A;  2JPH A;  1E90 A;  2K6D B;  5J18 A;  2WX0 A;  1F9J A;  1NI2 A;  2JY6 A;  2M1M A;  4FJZ A;  4FAD A;  5JHB A;  4I6P A;  4G50 A;  2DHZ A;  2D2Q A;  1YIW A;  2CS4 A;  2UWQ A;  4ZRJ A;  3W1Y A;  4ZYN A;  3IBE A;  3KYC D;  4W9H A;  3ZDT A;  4XC2 A;  1WGD A;  3ZTD A;  2L8J A;  4GU2 A;  1UBQ A;  4AJY B;  4ZDV A;  5KHQ A;  2J7Q B;  2ZCC A;  2DAJ A;  3WIM A;  4AUQ C;  3IHP C;  4J6I A;  2NR2 A;  2PJH A;  4W9I A;  2V3S A;  3A4R A;  4ICU A;  4PS3 A;  4W9K A;  2L05 A;  4IWO A;  2MP2 A;  2A5U A;  4LCD E;  1S1Q B;  1GNU A;  2DYO A;  4WWO A;  5C23 A;  2LAS A;  1AAR A;  2JXX A;  2MRP A;  3QK0 A;  3VHT C;  4IC7 B;  1YJ1 A;  1ZW7 A;  3IFW B;  2KK8 A;  2IBI B;  2LRU A;  4E71 A;  1V5T A;  3TL5 A;  3B0A A;  4TKN A;  3DCG A;  3DVN V;  4MEM A;  3WAL A;  2YVC A;  4GDL A;  2RSU A;  3HM3 A;  3APF A;  3GOE A;  2CHX A;  2KVR A;  4FLH A;  4KV2 A;  3R66 C;  1E8X A;  2C5L C;  2Z0E B;  2NPT B;  3QAR A;  2G4S A;  4GB9 A;  2DZM A;  5EDS A;  3O65 B;  5J2R A;  4JGH B;  3L08 A;  2R2O A;  2GBK A;  5AZG A;  3VTW A;  2LJ5 A;  3SU8 X;  3VUY A;  2OJR A;  4WJP A;  4HXD A;  1E8Y A;  1P0R A;  2ZPN A;  3TMP B;  1WJN A;  1OTR B;  3VUX A;  4A3O A;  4AOF A;  4BKG A;  1KLV A;  1LM8 B;  1R4N I;  2LVO A;  3QA8 A;  4NY0 A;  1WX9 A;  1IP9 A;  1P3Q U;  1RLF A;  1VD2 A;  2J0K A;  4GDK B;  3ZUN A;  4BKS D;  1WZ0 A;  3ZLZ A;  1RRB A;  3PHW B;  4LDT B;  1U4A A;  1WMH A;  1NBF C;  1EUV B;  4FHK A;  4ZRI A;  4KDL B;  4IUM B;  4DK5 A;  1WR1 A;  4TUU A;  1KM7 A;  1R4M I;  4ZRK A;  2Y5B B;  2LVQ A;  3HIZ A;  2LXC A;  3PZD A;  4F1S A;  3NHE B;  3W1S C;  1WI0 A;  5D6J B;  2NCN A;  4WJQ A;  3A4S C;  1WGY A;  1EF5 A;  3DBL I;  2N7E A;  2KQS A;  1XD3 B;  3N30 A;  5E6P A;  1D3Z A;  2MW5 A;  4DHJ B;  3RZW C;  2FCS A;  2OOB B;  5IAA C;  2LVP A;  2XK5 A;  3A9J A;  1V80 A;  3QWZ B;  5FR6 A;  3CMM B;  4XX5 A;  4CYE A;  2MCN B;  4W9C A;  1GJZ A;  2AEH A;  4B6W A;  4W9D A;  3ZRF A;  2O2V B;  1WYW B;  2N9P C;  1I42 A;  4IWP A;  2KAN A;  5JHA A;  1V9J A;  1P9D U;  4BOZ B;  3RD2 A;  4YL8 A;  4KSL C;  3L54 A;  3RUI B;  1UEL A;  5JZE B;  3QC8 B;  1Z2M A;  2ZJD A;  2NS5 A;  3V60 A;  3X23 A;  4IM3 A;  1WGG A;  2IZV B;  4NQK E;  4RMA A;  3CST A;  3PT2 B;  3T9L A;  2LI5 A;  3DBR I;  1V81 A;  3OAW A;  2W9N A;  4NQL B;  1WF9 A;  3AXC A;  4G11 A;  2FUH B;  5G2N A;  5BO4 B;  2MX2 A;  3JVZ X;  3HHM A;  5LLI A;  2NBV B;  2WX1 A;  3DVG Y;  3JW0 X;  2FAZ A;  2KX3 A;  1GC7 A;  3ZTC A;  4GMV A;  2BGF A;  4KZC A;  4FJY A;  5LXI B;  4GXB A;  4LDT D;  3VTU A;  2BYE A;  2KX0 A;  2DZK A;  5CHV C;  1YQB A;  2L00 B;  2KMA A;  4FHJ A;  2CKH B;  5CHW A;  4HWI B;  4MJS B;  1VCB A;  1WJU A;  3H6N A;  4NJ6 A;  2B3A A;  3VAW A;  3ZNG C;  3ML8 A;  4ANW A;  1A5R A;  3U7D A;  3VVW B;  3V61 A;  1WH3 A;  2KXJ A;  3U30 A;  2C7H A;  2JZ3 B;  2KC2 A;  3M95 A;  3PRZ A;  2KN5 A;  3A33 B;  4BBN C;  4DHJ D;  1M94 A;  4W9E A;  3UIP B;  2HE7 A;  2CHW A;  4MGI E;  3QQ8 B;  3ZNH B;  4NAW B;  3T8M A;  3VQI A;  3KW5 B;  4GN1 A;  1H8C A;  1X1M A;  2FNJ B;  5DCN A;  3ECI A;  3A9K A;  4K7W A;  4F7Z A;  1E8W A;  3PRM B;  2EMS A;  4AJW A;  4MGK E;  3ALB A;  2N1V A;  4BOS C;  2A4Z A;  2GBJ A;  1V2Y A;  4KSK C;  2IO1 B;  3PTF C;  4KIK A;  2KDI A;  2DX5 B;  2BWE S;  3ZKJ C;  4KZ0 A;  2JUO A;  5TR5 A;  1RAX A;  1YD8 U;  3H9D A;  4PS8 A;  1V5O A;  3KYD D;  2PE6 B;  2JRI B;  1WGH A;  3NS8 A;  4GIV A;  4ANU A;  5G55 A;  3ZRC A;  5C1Z A;  2I1K A;  2K25 A;  2DZI A;  2KTF A;  4II2 B;  3PS6 A;  2LGX A;  3ZIM A;  2GMI C;  2KDF B;  3KUD B;  3QCA A;  2KNB A;  2G45 B;  1WJ4 A;  4HPL B;  1FXT B;  3L13 A;  2L7R A;  1P98 A;  4GOC A;  3K9O B;  3PV1 A;  4RM9 A;  2JZZ A;  3SD5 A;  3TBL D;  4MDK E;  2M8S A;  1XT9 B;  1SGH A;  2FCQ A;  3EC8 A;  4WWN A;  4EKU A;  4M8N A;  1ZKH A;  3KUZ A;  1L7Y A;  2O6V A;  4AP4 C;  1TBE A;  3ML9 A;  4KVG B;  3DQV A;  4MGY E;  1Y8R C;  2KOX A;  4AWJ A;  3UQB A;  2GBN A;  3DVG X;  3L0W B;  3WA0 A;  3AU4 A;  2M0X A;  5D7G A;  3SDL C;  3B1L X;  4OVU A;  1H4R A;  1K8R B;  4HCN B;  2AL3 A;  4G3X B;  3L10 B;  2ZEQ A;  4HK2 A;  3QX1 A;  4BVU C;  3WAM A;  4WWP A;  4FBJ B;  4TV3 A;  1KJT A;  3U8Z A;  2NPT A;  3ZNZ B;  2REX A;  3PLU A;  4HLE A;  4IW0 A;  3KH0 A;  5JH5 C;  4EEW A;  1WX8 A;  3LJ3 A;  2PPH A;  2LGY A;  5DPS A;  4DHZ B;  2C60 A;  2D3G A;  4BKT A;  1TGZ B;  2V1Y A;  2GBM A;  4HDQ A;  2PE9 A;  2KFJ A;  2KZR A;  4FN2 A;  3PLV A;  3IVF A;  1YX6 B;  2N9E B;  4GDK A;  3H1U A;  3HK0 A;  1UH6 A;  2RD0 A;  4PYZ A;  5KHO A;  2L0F A;  2DEN B;  3JSV A;  2BYF A;  4WJO A;  4EZL A;  4DXA B;  1JRU A;  4E74 A;  4F8C B;  4DDG D;  4PYU A;  4E3C A;  4MM3 A;  5L83 A;  1QZE A;  3QHT A;  5DPT A;  1I35 A;  4MH0 E;  3RZF A;  3UF8 A;  5D2M B;  4EFO A;  1OQY A;  2YLM A;  2IYD B;  1UBI A;  2VRR B;  3H7P B;  1GG3 A;  2NBW B;  4HVB A;  1WE7 A;  2MQJ A;  5DPW A;  4NPN A;  3KVF B;  3N32 A;  2MBQ A;  4M8M A;  5AZH A;  1WJ6 A;  2JVC A;  3H7S A;  4NNJ B;  2G3Q B;  2C7M B;  3DVN U;  3C0R B;  3CF6 E;  2XBB C;  3NZS A;  2K8H A;  2MSE D;  2KFK B;  4PS7 A;  2JWZ A;  2CHZ A;  2G4D B;  3A1Q B;  4IG7 B;  3VH3 B;  1UGM A;  1WZ3 A;  5HKH A;  3M62 B;  1G6J A;  1BT0 A;  2AL6 A;  2LUE A;  4CHK A;  3M63 B;  2BKF A;  1SIF A;  3AUL A;  2KKC A;  2K8B A;  3VUW A;  3APC A;  2ZVN A;  2KMC A;  3M3J A;  2LWP A;  2LZ6 A;  3EFU A;  3W1S A;  1Q1O A;  2IO0 B;  2LGD A;  5J17 A;  4EOY A;  4MSQ B;  2DAF A;  3HM6 X;  3WAO A;  3TIX A;  2AYO B;  3PRE A;  3A9K B;  2DYB A;  4GSW A;  1L2N A;  2LXA A;  2FID A;  2KJH B;  2DYM A;  1WRD B;  2FCN A;  2HD5 B;  3Q3F A;  4KIK B;  3R7Q A;  2MWS B;  2FCM A;  4N9F 4;  1LXD A;  1E8Z A;  3VH4 B;  1EO6 A;  4WJN A;  2MP2 B;  3KUC B;  4K7U A;  3PHX B;  3TCA A;  3QJZ A;  4II3 B;  2KJR A;  1C3T A;  3DPD A;  1OEY A;  2Z59 B;  4FUL A;  2RGF A;  2IO2 B;  1T0Y A;  2V4L A;  5AEK B;  4BKS A;  1P1A A;  3V6E B;  2MLB A;  4JIO U;  4ASW C;  2KTR A;  4GDL B;  2KD0 A;  1J19 A;  3UQA A;  3L16 A;  1LQB A;  2BF8 B;  4XZ4 A;  2ASQ A;  3VTV A;  3K9P B;  2KO3 A;  1ISN A;  2BWF A;  1YX5 B;  4NAW A;  2DZJ A;  2KWU B;  3L17 A;  2M4N A;  3TJP A;  5L95 C;  2BPS A;  5D94 A;  1Z5S B;  2EKE C;  1KOT A;  1UD7 A;  1V86 A;  2AWT A;  1OGW A;  2ZNV C;  1SE9 A;  2O6V B;  3BIN A;  2WYQ A;  2C9W B;  2ZZP B;  2MA9 B;  2N7D A;  1E5W A;  4BBN F;  5CTR C;  3D32 A;  2D07 B;  3NZU A;  1GUA B;  2KLC A;  3GZN I;  3PPA A;  1C1Y B;  5CHF A;  4KDI C;  1WFY A;  1WMH B;  4A3P A;  4RM8 A;  2R2Q A;  4W9F A;  3LDZ E;  1Q0W B;  4MGZ E;  3VXW A;  2C7N B;  1OEY J;  4I6L B;  1J0G A;  2PEA A;  2HJ8 A;  2J0J A;  4WAA A;  3UIN B;  1CMX B;  2MBH A;  2D11 A;  2FIF A;  1WX7 A;  2NVU I;  3P2B A;  4HDO A;  4LJP B;  4EUT A;  1EF1 A;  4HJK A;  3ZDM C;  3V62 A;  4CO7 A;  3PRP B;  4K1R B;  1WE6 A;  3WAN A;  3Q3J A;  4IM2 A;  4DDI D;  1IPG A;  4MSM B;  4DWF A;  3EEC A;  4HPM B;  1LFD A;  2JF5 A;  2RPQ A;  3CSF A;  3PSE B;  2I1J A;  2XK5 B;  3A9J B;  3DOW A;  2XEW A;  2LD9 A;  1IYF A;  4TQ0 A;  4LJO B;  2ZNV B;  2CR5 A;  3S2A A;  3MHS D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...