2LRWA

Solution structure of a ubiquitin-like protein from trypanosoma brucei
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
78
structure length
78
Chain Sequence
MLLKVKTVSNKVIQITSLTDDNTIAELKGKLEESEGIPGNMIRLVYQGKQLEDEKRLKDYQMSAGATFHMVVALRAGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Ubiquitin, putative
publication title Solution structure of a ubiqutin-like protein from Trypanosoma bucei
rcsb
source organism Trypanosoma brucei brucei
total genus 11
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2012-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2lrwA00
2RGFA 3GZNI 4NAWB 4GMVA 4KVGB 4BKGA 2IBIB 4KDLB 2NBUA 2LXCA 1IP9A 4GDKA 3AI5A 3JVZX 2EMTA 4TQ0A 4AP4C 3L16A 1E7VA 5D6JB 1GNUA 1V49A 2G4SA 3ALBA 3HK0A 4JLCA 2C7HA 5IA7A 2KTRA 1SIFA 1FXTB 3MJWA 2BYEA 3APDA 4DK5A 3DPDA 3QAQA 1ISNA 3A9JA 3CF6E 3GOEA 4YL8A 2RSUA 2IO3B 3A9KA 1V9JA 4IWOA 4JL9A 3DVNV 5E6PA 1GC7A 3JSVA 3WAMA 4BOZB 1I42A 2NVUI 3ZNID 3ZVVA 1WX9A 3KYDD 1WMHB 1R4MI 4ICUA 2NPTA 1OEYA 4GDLA 1SE9A 1YD8U 2KHWB 1KM7A 1UGMA 2FAZA 3B0AA 4XX5A 4G0NB 2KWVB 4K81A 2KDBA 2RD0A 3A4RA 4BKTA 1GUAB 4FA6A 2C60A 2XK5B 2REXA 5CX3A 1R4NI 3NZSA 3A33B 3KYCD 4BKSA 1P3QU 4X57B 3DOWA 3ECIA 2RPQA 4B95A 2MP2B 1ZGUB 2NCNA 4IG7B 1WRDB 4KZ0A 1I35A 1V5TA 3T9LA 2JZZA 1WM3A 4EZLA 2K8BA 2IY1B 2MWSB 1U4AA 4B6WA 1PQSA 2LGYA 2R2QA 2WDTB 5AZGA 4KDIC 4J6IA 1WGDA 4K1RB 2BKFA 4DHZE 4HPLB 1Z2MA 2W9NA 5J2RA 1OQYA 2L76A 3CMMB 2KDEB 2JPHA 2KLCA 3BY4B 3CSFA 5DPRA 2KQ7A 3PRPB 3H9DA 3L17A 1NDDA 2HE7A 1H4RA 3L10B 2K6DB 3ONSA 2C7NB 4B9KA 3VAWA 5AEKB 5L95C 1F9JA 4FBJB 2O2VA 3LJ3A 3PHXB 3KUZA 4KZCA 1WI0A 5CTRC 2IYDB 4G11A 3B1LX 4I6PA 3U30A 3ZLZA 2ZCCA 2NR2A 3DBLI 2YVCA 4BFRA 2N7EA 2GBMA 2BYFA 2LGXA 1WGHA 2DZKA 3ZNGC 3VTWA 2FCMA 1L7YA 1WXMA 1XT9B 2AEHA 2KJRA 2MRPA 3M63B 3NOBA 4CO7A 3HHMA 4HK2A 4MJSA 2ASQA 1D3ZA 2KN5A 1P0RA 3PT2B 4DHJD 4LDTB 4WJNA 2GBJA 2LJ5A 2CHXA 2D3GA 3M3JA 1UD7A 2DYMA 3QHTA 4KIKB 2DYOA 4M0WB 3R3MA 4NPNA 4PS7A 4MGZE 3RD2A 3U8ZA 4ZRKA 1WJNA 2J0KA 3RZFA 3O65B 3WA0A 3P2BA 3VFKA 3ZDTA 1WM2A 2ZPYA 1ZKHA 4DXAB 3RULA 4JQWC 2KOXA 4W9FA 3UIPB 3VH4B 3QARA 1WF9A 2PE9A 2MBEA 3WAOA 3W1SC 4HJKA 3WANA 4OVVA 2FCSA 1ZW7A 2M0XA 2G45B 2Y5BB 2XEWA 3QCAA 3NZUA 2MBOA 2FNJB 2K8HA 4F1SA 2KJ6A 2OJRA 2PJHA 3L54A 4E71A 5LXHA 4HCNB 2DHZA 4LDTD 2V1YA 4MGKE 2GBKA 1LXDA 1WXSA 3PS6A 3QK0A 4DDID 3VXWA 4AJWA 1L2NA 4FJVB 5L83A 4GOCA 3V60A 2A4ZA 2RR9A 1T0YA 1XD3B 2KDFB 2XBBC 5CHVC 4HDOA 3VUYA 1Q5WB 4IWPA 1TZ1A 5DPSA 2KK8A 2IO1B 1C3TA 2ZVNA 5AZHA 3OJ3A 4E74A 4ZRJA 4MDKE 5LXIB 2KD0A 2KWCA 2MBQA 1Q0WB 1E8XA 5J17A 4W9LA 4WWOA 2N9XA 4MGIE 2WX0A 1WR1A 2BWES 2LVOA 3PHWB 3R7QA 4GU2A 1V2YA 3M62B 1YIWA 3A1QB 2D11A 2CHZA 4RM8A 2KVRA 4XC2A 1V6EA 1OGWA 4ZRIA 4PS3A 2VRRB 3R7RA 2FIDA 2G4DB 4P7IA 2K8CA 2LD9A 5C1ZA 2V3SA 2O6VB 3C0RB 2J0MA 3PZDA 1E5WA 2KC2A 3IVFA 3LDZE 2MCNB 1OEYJ 3ML9A 4DBGA 2KFJA 1EO6A 5E6NA 3NHEB 3PVLA 4A3PA 2KX0A 3W1SA 2K25A 2L0FA 3HIZA 1J8CA 1VCBA 1WXVA 2KC1A 3KW5B 3DBSA 3QA8A 3PLVA 4A3OA 1WIAA 4I6NB 2GBNA 2KLGA 1WGYA 2ZEQA 1WY8A 2BF8B 4MSQB 2JT4B 2DAFA 3MHSD 3ZNZB 4HXDA 1OTRB 3ZW3A 2L00B 3B08A 2YLMA 2KZRA 1V5OA 5D7GA 4WJPA 2MX2A 3SHQA 3DVGX 2LGDA 2NS5A 4NQLB 3ZTDA 3RYTA 3X0WA 2MBHA 2J7QB 2O6VD 2C7MB 1TTNA 4E3CA 3OJ4B 3H7SA 3APFA 4FLHA 4PYZA 2N1WA 5FR6A 3DCGA 1P98A 3ENEA 4LJPB 1WX8A 4GDKB 4FADA 3V6CB 1E8ZA 3OLMD 3H7PA 2D2QA 2LVPA 3L08A 3Q3JA 2JVCA 3RCZA 1CMXB 2KFKA 1WGGA 5KHQA 1WXAA 2ZNVB 4GGQA 3UINB 3K9PB 3V6EB 4W9HA 4EZKA 1TBEA 1V81A 2CS4A 2GOWA 2JWZA 4PS8A 3T8MA 3VTUA 2BGFA 2KTRB 4W9KA 1A5RA 4LJOB 2UYZB 3UQBA 1HE8A 2IO2B 3A9JB 1Y8RC 1V86A 2NBWB 3A9KB 2KTFA 2K39A 4FHJA 4JIOU 2LZ6A 3JSVB 2I1JA 4BOSC 3WALA 1WJ6A 2JRHA 3QIJA 2ZVOA 2ZCBA 4W9IA 1BT0A 4I6LB 2HTHA 3QX1A 2JF5A 3KH0A 3SD5A 1GJZA 4GSWA 4IW0A 2NPTB 2GMIC 4AWJA 4GDLB 2M4NA 2C5LC 4MM3A 3I3TB 1LM8B 3IG3A 3PV1A 3VUWA 2JY6A 5JZEB 4NAWA 5HKHA 5JHAA 4GXBA 4WJOA 4W9DA 4ANXA 4M8MA 4EEWA 4FJZA 4II2B 5D94A 2KNBA 3DVGY 2BPSA 4K7UA 5G55A 3KUDB 3RT3B 1LFDA 4A20A 2EMSA 2MBBB 2AL6A 4BVUC 3ZO5B 2Z0EB 5C23A 3EHVA 4ZDVA 2JUOA 4TQ1A 3IBEA 1RRBA 2ZJDA 1IPGA 2L0TA 4IUMB 4M8NA 1H8CA 2AYOB 5J18A 3VHTC 3JW0X 4EFOA 2IO0B 4G3XB 3U7DA 1M94A 3UQAA 4NQKE 1AARA 2KMAA 4ASWC 2L7RA 4EUTA 4AJYB 1WMHA 4BBNF 3OAWA 4ANWA 2L05A 2DX5B 5BO4B 1WX7A 2O2VB 2Z0DB 1S1QB 3VTVA 3WIMA 3PGEA 1WYWB 1X1MA 1Q1OA 5EDSA 3VUXA 2LI5A 4PYUA 3ML8A 2WWZA 1E7UA 2A5UA 2LASA 2XK5A 1KOTA 3HM3A 5D2MB 2FCQA 2LXAA 3V62A 3NY5A 5IAAC 3DBHI 1WE7A 4CHKA 5AZFA 1EUVB 2MP2A 4MJSB 4NJ7A 2WYQA 3H6NA 3TIXA 3R66C 4FULA 1J19A 4W9JA 2HJ8A 2B3AA 4MELA 1E8YA 3AULA 4AUQC 1P1AA 4HCPB 2KXJA 2JRIB 1WGRA 1RFAA 2OOBB 1RAXA 1YJ1A 2CR5A 3QQ8B 1IYFA 4KSLC 4EKUA 2WX1A 2QHOA 4MSMB 4N9F4 4F7ZA 2DAJA 3PPAA 3RZWC 5JH5C 3AXCA 2AWTA 3V61A 3S2AA 2MQJA 3L0WB 2N4FA 2J0JA 2KANA 4GN1A 2KX3A 4RM9A 1RLFA 2D07B 1YQBA 1SGHA 1WJUA 2KO3A 5GMVA 4HLEA 4MGYE 1NI2A 1GG3A 2AL3A 2HD5B 2N9PC 3DDCB 4WQOB 4K7SA 2CKHB 2JXXA 2MSED 3L13A 1S3SG 3PLUA 4BBNC 4JGHB 1XQQA 3ZIMA 3N3KB 3IFWB 1WE6A 1Z5SB 2C9WB 4IM0A 4EOYA 3DBRI 1UZXB 4IM2A 3N30A 1GC6A 4WJQA 4KIKA 1VD2A 4ANUA 4DDGD 3PREA 1KJTA 1TGZB 4FHKA 4EZJA 5DPTA 1C1YB 1UELA 3UIOB 3AU4A 4NNJB 2GBRA 3HM6X 4HPMB 4DWFA 1WZ0A 1YX6B 2NBVB 2D10A 4W9GA 4ZYNA 4NJ6A 4IC7B 4MEMA 4XZ4A 3JYUA 3ZDMC 3ZRFA 3SU8X 2Z59B 4NY0A 2I1KA 3RUIB 3K9OB 1LQBA 3AU5A 1E90A 3TL5A 2EKEC 3WAPA 3TBLD 2G3QB 5LLIA 2LUEA 3W1YA 5CHFA 5KHOA 2LRWA 1MG8A 2MW5A 1J0GA 4DHJB 4HWIB 2ZZPB 3VVWB 2L3ZA 3QWZB 2M17A 3A4SC 2R2OA 2PEAA 1K8RB 3EFUA 4CYEA 4G50A 5DCNA 3ZNHB 3Q3FA 2JZ3B 5G2NA 2PE6B 4MH0E 1QZEA 2K6QA 2UWQA 2DYBA 3VDZA 4WWNA 5E6OA 4AOFA 3H1UA 2N9EB 1WFYA 1V80A 1EF1A 1E8WA 3ZTCA 3SDLC 3IHPC 3ZKJC 4URKA 4ANVA 3TCAA 2KDIA 2N7DA 2DZJA 2FIFA 2FCNA 3UGBB 4DHZB 3CSTA 2L8JA 4FN2A 3BINA 2LVQA 2ZNVC 5CHWA 3DVNU 2LRUA 1G6JA 3QC8B 3QJZA 3M95A 3N32A 2M1MA 4TKNA 3A1QA 4GIVA 2MA9B 4OVUA 3TJPA 1UBIA 1P9DU 1WZ3A 2CU1A 2N1VA 1UH6A 1EF5A 4W9CA 4IWQA 2ZPNA 3EECA 2BYVE 2DZMA 2O6VA 3H7PB 2KJHB 1KLVA 4RMAA 4GB9A 4TV3A 1JRUA 3NS8A 2KFKB 2FUHB 3PSEB 4TUUA 3ZUNA 2IZVB 3KUCB 2PPHA 1WH3A 2K1FA 1NBFC 1UBQA 2MLBA 5DPWA 4FJYA 2LWPA 3PRMB 4BKSD 2DZIA 4KV2A 4K7WA 3ZRCA 4II3B 2DENB 4HDQA 3DQVA 3TMPB 2CHWA 3D32A 3KVFB 3VQIA 4HVBA 1WJ4A 3MTNB 2V4LA 3PRZA 1WR6E 2BKRB 2KQSA 3PTFC 4LCDE 4IM3A 4W9EA 3X23A 2KMCA 2KKCA 1YX5B 5JHBA 5TR5A 2BWFA 2M8SA 3APCA 2KWUB 3EC8A 4WWPA 4WAAA 4ICVA 4KSKC 3VH3B 2IY0B 4F8CB 3UF8A
chains in the Genus database with same CATH superfamily
3GZNI 4KDLB 2N9KA 2NBUA 3RNBC 3RNFC 3JVZX 2EMTA 1MHXA 5D6JB 4JLCA 4LLGM 4L2YA 1J7AA 1TIFA 3DPDA 1JWMD 2IO3B 3JSVA 3WAMA 1I42A 3ZNID 3BYTB 3KYDD 1WMHB 3NJTA 3ZYYX 1OEYA 2VH1A 3KWLA 1YD8U 4GDLA 1UGMA 2FAZA 3B0AA 3GZNB 4K81A 1YJJA 2KDBA 2RD0A 3NUHB 3VRBB 2REXA 2D5GA 4C80A 1A70A 1ZGUB 4IG7B 3T9LA 2JZZA 4R3DA 2IY1B 4RFBA 5AZGA 2R2QA 2WDTB 2WNMA 4J6IA 2MJ3A 4K1RB 2BKFA 4DHZE 4HPLB 1T3QA 1OQYA 2V3NA 4RCOA 3PZ8A 4MACA 2QCZA 2QEJC 1JWBD 1L4DB 3PRPB 3H9DA 1NDDA 3ONSA 1H4RA 5L95C 4L23A 1WXQA 3IAS1 1D5ZC 1NI3A 2IYDB 2WXRA 2QDFA 3DBLI 3DHHC 4BFRA 2BYFA 2AEHA 2KJRA 2MRPA 3NOBA 4RF0A 1DOXA 3MHZA 2WQYB 1NENB 3OWEB 3NS1A 4M0WB 4WJNA 5C2TB 3R3MA 3HRDD 4ZRKA 1WJNA 3PO0A 3ZDTA 3T3OA 4W9FA 5AUKA 3FC4A 1N60A 3T3NA 5D3IB 3WANA 4OVVA 4LNIA 1ENFA 3DBLB 1QOGA 3Q69A 2M0AA 1FNWA 2PJHA 1SF0A 4HCNB 2V1YA 1SJED 4AJWA 1VZ7A 3V60A 2A4ZA 2RR9A 2KDFB 4HDOA 3VUYA 1RWSA 2PVOD 3N20C 4MT5A 1C4AA 2WGSA 4ZRJA 2BQQA 2KWCA 2MBQA 2Y3AA 5J17A 2N9XA 4MGIE 2WX0A 1WR1A 3PHWB 3PZ7A 4HKQA 1V1PB 1V2YA 1YIWA 2HJ1A 3SFDB 2D11A 2X38A 1QOAA 3MP9A 1OGWA 1XLOA 2LD9A 2V3SA 2O6VB 2PVGC 1E5WA 4DBGA 1FFVA 1ZDVA 4RGOS 2KC1A 3Q3OC 3QA8A 1WIAA 4I6NB 2KLGA 1F52A 1WY8A 3FILB 4WAFA 1WYGA 1XLQA 5GXGB 5D7GA 2MX2A 2IGDA 4NQLB 2MBHA 2BVCA 1YOVB 3H7SA 4LK0M 1XF5L 1P98A 1WX8A 3RCZA 1CMXB 4ZYSA 2ZNVB 4W9HA 4EZKA 3U7ZA 4PS8A 2JWZA 2X8XX 4LJOB 3UQBA 2V9HA 1TKGA 3V05A 2KTFA 2K39A 4FHJA 4RF1A 3JSVB 1WJ6A 2JRHA 3QIJA 2ZVOA 2KT7A 2KYWA 3KH0A 3Q6BA 1GJZA 1EWYC 4IW0A 4IOIE 4GDLB 2M4NA 4K3BA 2PTLA 4P1CC 4M8MA 4FJZA 5D94A 2NTSA 4K7UA 2KQ4X 3KUDB 4D2KA 3AE8B 2YEPB 2LFIA 2AL6A 4A90A 1GB1A 2Z0EB 3MFGA 3SFEB 4TQ1A 1RRBA 4IUMB 1QLBB 4WQMA 2AYOB 3JW0X 4EFOA 3U7DA 1EU4A 4ACFA 4NQKE 5H92C 2B76B 2Z0DB 2W82A 3RNGC 4H2AA 3Q2AC 2WWZA 1N61A 2WXIA 3CWIA 3AB5A 1MHHE 2LXAA 5IOIA 2JYTA 1WE7A 4CHKA 4BAXA 5D3DA 2WYQA 2L32A 2B3AA 2J4XA 1P1AA 1L6UA 2JWUA 2QHOA 4N9F4 3RZWC 2AWTA 2JU6X 3V61A 2MQJA 5TSSA 1D5MC 1TJEA 1C76A 2D07B 5BYSA 1YQBA 1SGHA 2KO3A 5GMVA 4HLEA 1N62A 5LNK1 3PLUA 2XN9C 2RDHA 3N3KB 3IFWB 1WE6A 2C9WB 4C7ZA 5BYRA 1UZXB 3N30A 4WJQA 3ZJUA 1TT5B 4NJCA 4DDGD 1KJTA 1TGZB 1PUTA 2GBRA 4JWUC 3AECB 4A55A 2NBVB 2D10A 4ZOHC 1PGBA 3EUB2 4NJ6A 3P1MA 2WU5B 1I4GA 3JYUA 3ZDMC 3RUIB 2I1KA 3K9OB 1LQBA 2WXNA 3WAPA 3TBLD 2LUEA 2LRWA 4DHJB 1ZPSA 3VVWB 1EWCA 2SAKA 5DCNA 3B9JA 2LJIA 2ZW1A 4WWNA 5E6OA 3H1UA 1L0YB 3ZTCA 4URKA 1TS2A 5EE1A 1KH0A 3TCAA 1SSNA 2Q5WD 3Q3NC 4FN2A 1E10A 2LRUA 3M95A 4GIVA 2EELA 1T0QC 2N1VA 1UH6A 4W9CA 4IWQA 4GB9A 2QSDA 2FUHB 3PSEB 5EE3A 2WXHA 3KUCB 2PPHA 3Q8AA 5BMIA 1UBQA 2MLBA 1ET9A 3I57A 5FKAC 3ZRCA 1TKEA 2RDBC 2DENB 3TMPB 1TKYA 3AEGB 1WJ4A 2V4LA 2HTME 4YSYB 1WR6E 2BKRB 2KMCA 1PGXA 3J9CA 3VH3B 2IDYA 2IBIB 4XGAB 2LXCA 1BUIC 3AI5A 1UUPA 4C7YA 3L16A 1GNUA 1KTKA 3HK0A 4WWMA 2BYEA 3QAQA 3GOEA 2KWDA 4YL8A 4YSXB 1D4BA 1FFUA 1GOZA 1L0XB 1WX9A 2QJLA 2QMTA 1R4MI 2WHIA 4YTNB 4BKTA 3U52E 4TMAB 1GUAB 4FA6A 2C60A 2QILA 2V3PA 4O1NA 2WXPA 4BKSA 1P3QU 4X57B 1FIQA 2JSVX 3DOWA 3ECIA 2RPQA 4B95A 3BZDB 1KRHA 1WRDB 2K8BA 2MWSB 2CJNA 1YNTE 1WGDA 3LB8C 1DOIA 2D3BA 2JPHA 3CSFA 2KQ7A 1TZOA 3GS2A 2K6DB 2C7NB 4XDDA 1R4MB 4FBJB 2O2VA 2BS3B 3PHXB 1JW9D 4G11A 3B1LX 2ZCCA 1RYJA 1BMLC 1WGHA 2DZKA 4B0EA 2FCMA 3AE6B 1CZPA 4JWSC 4ZHOA 1XT9B 4MJSA 2INPE 1MPEA 3BK2A 4P1BC 2KN5A 3PT2B 4DHJD 2GBJA 1STEA 4B9KA 4C4VA 2DYMA 3TEWA 2OJWA 4KGTA 1OQRA 3RZFA 3TEXA 4JX1C 3WA0A 1VR9A 3P2BA 4DXAB 3RULA 3QARA 1WF9A 3WAOA 2NMQA 3FAHA 4HJKA 1QOBA 5H8YE 1JCKB 1DYQA 2XEWA 2JXTA 3QCAA 3NZUA 2V4IB 3LXFA 2K8HA 3MJ5A 3L54A 2DHZA 2J42A 3PS6A 1WXSA 3QK0A 3VXWA 1L2NA 5L83A 4A9AA 1SE4A 1F77A 5CHVC 1VZ8A 4IWPA 3BVZA 2ZVNA 5AZHA 1YJIA 3OJ3A 4E74A 4MDKE 5LXIB 1E8XA 4W9LA 4WWOA 1FCLA 2BWES 2LVOA 2KVRA 2WP9B 4YWGG 1QF6A 4PS3A 2VRRB 2FIDA 2G4DB 2K8CA 5C1ZA 3MC0B 3C0RB 3LDZE 1EO6A 4OZCA 3NHEB 3PVLA 2KX0A 2K25A 3KW5B 3TEYA 2GBNA 1ZUD2 2PW9A 1WGYA 2ZEQA 4HXDA 1OTRB 1V5OA 2NS5A 2J7QB 4E3CA 4WH4A 2N1WA 3BK1A 1MG4A 3OLMD 4C00A 2BTEA 2D2QA 3Q3JA 3DHIC 1FNVA 3K9PB 1V81A 2CS4A 1VRAB 1N5XA 5E6JA 1Y8RC 2NBWB 3B2GA 1TY2A 2LZ6A 2WXGA 4BOSC 2ZCBA 1WRIA 1BT0A 2AX5A 3QX1A 1Q10A 2GI9A 5EE9A 4GSWA 3ZXRA 3I3TB 2PIAA 3IG3A 2G9HD 3PV1A 3VUWA 5JZEB 4NAWA 2K0PA 4PT5A 2I2YA 4II2B 2KNBA 2BPSA 3RT3B 1LFDA 4A20A 1JWSD 5C23A 2TSSA 1K52A 2JUOA 3IBEA 4N6EB 4S0RA 2L0TA 4KGSA 5J18A 2JQRB 2IO0B 2KMAA 4EUTA 1C79A 1TYGB 4BBNF 4ANWA 2DX5B 1WX7A 1E7PB 3I5JC 2O2VB 1XEEA 3RMKC 1S1QB 4DQOC 1WYWB 3RNEC 4GLSC 3VUXA 4PYUA 2A5UA 1MVKA 4M01A 4RGNA 1DGJA 3R2IA 5IAAC 3DBHI 1EUVB 4MJSB 4NJ7A 3AEDB 3TIXA 3R66C 1J19A 4XE0A 2HJ8A 4C4VB 4MELA 1T0SC 2BB6A 3AULA 2N9LA 2KXJA 3GE8C 5IN7A 2INNE 3AE9B 1RAXA 4DXFA 2WX1A 2XNAC 4ARCA 5JH5C 3L0WB 2N4FA 4RH6A 2LHDA 2KX3A 2L83A 2N9PC 4WQOB 2JXXA 3DBHB 3L13A 5BMHA 2WDRB 1VD2A 4M02A 5DPTA 1C1YB 3P4SB 1WZ0A 4BZAA 1XLPA 1JRPA 3N1YC 4W9GA 1QOFA 2UU7A 5HFYA 3I63C 3AEAB 4ITKA 2QIEB 2G3QB 1NEKB 3W1YA 5KHOA 1MG8A 4HWIB 2ZZPB 4LTUA 2L3ZA 3QWZB 2M17A 2PLPA 2PEAA 1K8RB 3EFUA 1SJHD 4OW0A 4CYEA 4NAMA 3Q3FA 2PE6B 1KF6B 1QZEA 1B9RA 2UWQA 1ROEA 2M19A 1K53A 2N9EB 1E8WA 4MH8A 3SDLC 3IHPC 3ZKJC 2KDIA 2DZJA 2LEKA 1GB4A 1F0ZA 2J53A 5CHWA 3DVNU 1G6JA 3AH7A 5FK9C 3ZGZA 4TKNA 3A1QA 4XWTA 3C19A 1T0RC 1MJDA 2I38A 4TV3A 1JRUA 3NS8A 3BIID 4TUUA 1ESFA 3ZUNA 2IZVB 1FXIA 1JMLA 2LWPA 3PRMB 4ZRQA 4BKSD 4KV2A 4K7WA 1L4ZB 1YN4A 3KVFB 2LGIA 2WXFA 4ZHPA 3KQ4A 4IM3A 3RPFC 4TSSA 3U2SC 3UI3A 1D5XC 4WWPA 4WAAA 2IY0B 1KFYB 2NTTA 4NAWB 4GMVA 1LO5D 4BKGA 2G1EA 1PFDA 1V49A 1TY0A 2G4SA 3ALBA 2W3RA 3AV8A 2KTRA 2RMMA 1FXTB 3MJWA 4YTPB 1N6ZA 1ISNA 3A9JA 3CF6E 2RSUA 3A9KA 2CU3A 1CJEA 4BOZB 2DWQA 2NVUI 4N59A 4KKIA 3W9CB 1SE9A 5HHDG 4YTMB 1KM7A 4G0NB 1YMHE 3A4RA 4P6VF 4YSZB 4FXCA 5CX3A 1E6EB 1HEZE 3URYA 2DNFA 2NCNA 1V5TA 2H89B 1OFFA 5J2RA 2L76A 3CMMB 2KDEB 1N5WA 3P4PB 3L10B 2HE7A 5AEKB 4OZBA 4KZCA 1WI0A 5CTRC 3DHGC 3U30A 3ZLZA 2NR2A 2N7EA 2GBMA 3ZNGC 2E6XA 3M63B 4RGTA 4CO7A 1SXTA 2D3GA 2W55A 1UD7A 4PS7A 4USAA 5DPSA 2DYOA 3P42A 4MGZE 1QT9A 3IAM1 2J0KA 4Q2JA 3O65B 4LNNA 3VFKA 1HA5A 2ZPYA 1I4HA 4UDUC 4JQWC 3UIPB 3VH4B 2PE9A 3W1SC 2FCSA 3R8BA 1ZP0B 2M0XA 3P4RB 2Z8LA 4F1SA 2KJ6A 2OJRA 3GP7A 4E71A 2LGSA 1HTQA 4LDTD 2ICIA 1JWUD 1LXDA 4DDID 4FJVB 1SB3C 1T0YA 1XD3B 2XBBC 3W5UB 1TZ1A 2KK8A 4JE3B 2IGHA 2KD0A 1J7BA 1Q0WB 3ZJVA 1ZDXA 3A1QB 2CHZA 4RM8A 1ZOYB 5EE0A 4XC2A 4HKZE 3R7RA 1R7SA 3KLSX 2J0MA 4A6QA 2KC2A 2KFJA 5E6NA 1J8CA 3W1SA 1VCBA 1WXVA 3PLVA 4QAYA 2BF8B 4WURA 2JT4B 3MHSD 3O13A 4KGRA 3ZNZB 2L00B 3B08A 4XWWA 2YLMA 2KZRA 3MC9A 4WJPA 3SHQA 1VJKA 4IDIA 1PDXA 3ZTDA 3NVZA 5G5HA 1P7EA 3L4PA 3HVZA 3OJ4B 4PYZA 2WLBA 5FR6A 3DCGA 4LJPB 3ENEA 2BBCA 2WXLA 1IBXA 2WDQB 4JPSA 1WGGA 5KHQA 1WXAA 2K22A 1HZ6A 1ZXIA 1F1HA 1ZXHA 3V6EB 1TBEA 1CQVA 2GOWA 3T8MA 2BGFA 3TEZA 1F2RC 2KTRB 1A5RA 2UYZB 1HE8A 3EA6A 1L0VB 2IO2B 4DXGA 1JQ4A 1IUEA 3A9JB 1V86A 1IGDA 2LHEA 3A9KB 1QQRA 4HRSA 2I1JA 1UNSA 1KLGD 1FCCC 4W9IA 1RM6C 2HTHA 4S17A 1Y56A 4AWJA 2JYEA 4HPPA 1LM8B 2WXKA 2JY6A 3HVDA 5JHAA 2VH2A 4J3OD 3NVYA 4ANXA 4EEWA 4ARIA 2EMSA 2MBBB 1FEHA 3EHVA 3MC8A 1HQRD 5IO9A 2K5PA 1SEBD 3VHTC 4G3XB 1M94A 3U4EG 1IGCA 3UQAA 1AARA 2L7RA 4AJYB 1KLUD 1NVID 3OG5A 5BO4B 4US9A 2WU2B 4B0MA 4LNKA 4A8XC 3BWUD 3PGEA 1X1MA 3ML8A 1E7UA 2XK5A 1LGRA 2L52A 3HM3A 5D2MB 1EM7A 1YN5A 4LNFA 3NY5A 3P4QB 5HI1A 1HXYD 5AZFA 3AEEB 2MP2A 1AWDA 3H6NA 3N9YC 1V8CA 1SE2A 1E8YA 2N0SB 4AUQC 1RFAA 2OOBB 1YQ3B 2CR5A 1HZ5A 4EKUA 4MSMB 3BVGA 4F7ZA 1C77A 1V97A 2WXOA 4RM9A 1RFKA 2MJDA 4M00A 1NI2A 2AL3A 2HD5B 3DDCB 2CKHB 2MSED 3VR8B 1C4PA 4HEA1 1S3SG 4JGHB 1YN3A 1K50A 4IM2A 2KAJA 4KIKA 2W3SA 1XO3A 1UELA 3UIOB 2VZKB 3H8HA 4DWFA 3ZJTA 1YX6B 2MH7A 4MEMA 3ZRFA 2Z59B 2JX5A 2ONQA 1E90A 3TL5A 5CHFA 4KX6B 1C4CA 3A4SC 2R2OA 1WGKA 1V1OA 3WCQA 3AE4B 4G50A 3ZNHB 2K6QA 1VZ6A 2DYBA 4AOFA 1WFYA 1V80A 1EF1A 3VR9B 1QILA 2FIFA 1N63A 3UGBB 3BINA 3IT6B 4N58A 2LVQA 4WIPA 3AMZA 3V3XA 5HG2A 3QC8B 2PKOA 3N32A 4YT0B 2M1MA 1TS3A 2MA9B 4OVUA 1UBIA 1P9DU 1EF5A 3EECA 2KJHB 1KLVA 4RMAA 1IBXB 1AN8A 1WH3A 3AEFB 1NBFC 4FJYA 5AUIA 1HTOA 3DQVA 2CHWA 3D32A 3VQIA 3EFCA 3MTNB 3TSSA 3PRZA 4W9EA 3X23A 2KKCA 1YX5B 5JHBA 2SEBD 5TR5A 2M8SA 3APCA 2WXJA 4ICVA 4F8CB 3UF8A 1F2RI 2RGFA 4KVGB 1PYWD 1GAQB 1FRRA 1IP9A 1JROA 4GDKA 3DWMA 3IT4B 5G5GA 4TQ0A 4AP4C 4P16A 4ZRPA 1E7VA 4RGMA 3FKYA 2C7HA 3ZQ4A 5IA7A 1SIFA 2OEDA 3APDA 4DK5A 5C3JB 1V9JA 4IWOA 4JL9A 1FM0D 3DVNV 5E6PA 1GC7A 2KDMA 3KWVA 3ZVVA 1ACCA 4ICUA 1FRDA 2NPTA 4LNOA 1BXTA 2KHWB 3Q8FA 4XX5A 4EE2A 2KWVB 3AN1A 2XK5B 3HUIA 3R2TA 1B1ZA 1R4NI 3NZSA 4OZAA 3A33B 3KYCD 3RNCC 1AW7A 1ET6A 2D3AA 5I4DA 2MP2B 3NG0A 4KZ0A 1I35A 2GB1A 4EZLA 1WM3A 2CJOA 1U4AA 4B6WA 1PQSA 2LGYA 3E9SA 1OQQA 4KDIC 2JZPA 1C9FA 2ZW0A 1Z2MA 2W9NA 2BS2B 3AE5B 2KLCA 3BY4B 5DPRA 2YEPF 3L17A 4AQ7A 3N1XC 3W5VB 3VAWA 1T5XD 1F9JA 3LJ3A 3Q3MC 3KUZA 2M56B 4OHJA 2VZKD 1UF0A 3E56A 4I6PA 3Q8CA 3Q8BA 2YVCA 2LGXA 2J52A 3RFZB 2WXMA 3VTWA 1L7YA 1R4NB 1WXMA 2IJ0A 3HHMA 4HK2A 2ASQA 2AQ3B 2K3UA 2R61A 1P0RA 1D3ZA 4LDTB 3QHTA 2CHXA 2LJ5A 3M3JA 4KIKB 4NPNA 2MJEA 2WXQA 3RD2A 3U8ZA 2H88B 1WM2A 1ZKHA 2KOXA 3P63A 3AE7B 5BYQA 2MBEA 1NYQA 1FNUA 2KACA 1ZW7A 2Y5BB 2G45B 2DBYA 2MBOA 2FNJB 1ZE3D 2BS4B 3TUOA 5LXHA 1CK1A 2GBKA 4MGKE 2LMCA 4GOCA 3NVVA 1UWXA 1Q5WB 1XCQL 5JXVA 2PMVA 2IO1B 1C3TA 2FE8A 2E3TA 3NVWA 3R7QA 4GU2A 1VDVA 3M62B 1V6EA 3N1ZC 2WS3B 4ZRIA 3NRZA 4P7IA 1L5PA 3PZDA 2OHFA 3IVFA 2MCNB 1OEYJ 3ML9A 1XLNA 2IPKD 1MI0A 4A3PA 2L0FA 3HIZA 3DBSA 2D3CA 4A3OA 2GLSA 5IP4D 5T8IA 2L1AA 1UWMA 4KKJA 3RI7C 4MSQB 2DAFA 2KVZA 3ZW3A 3DVGX 1WWTA 2LGDA 3RYTA 3X0WA 2Y5PA 2O6VD 2C7MB 1TTNA 3APFA 4FLHA 1L6VA 3B2FA 4XDCA 2ON8A 4GDKB 4FADA 3V6CB 1E8ZA 1YQ4B 3H7PA 2LVPA 3L08A 4HROA 2JVCA 1MFWA 2KFKA 2ACZB 2EKIA 4GGQA 3UINB 1J7CA 4REZA 1TS5A 3VTUA 4W9KA 4L1BA 4JIOU 3WALA 2LUMA 2RPVA 3EGRA 4I6LB 2BT6A 2MHJA 2JF5A 3SD5A 3NZ3A 2NPTB 2GMIC 2C5LC 4MM3A 4YXDB 3CIRB 5HKHA 4GXBA 4WJOA 4W9DA 1DOYA 3SEBA 3SR6A 2QC8A 3DVGY 5G55A 2HDEA 4BVUC 3ZO5B 4IKGA 5BMGA 4ZDVA 2ZJDA 1IPGA 2V0GA 4M8NA 2BB5A 1H8CA 3I9V1 5FR3A 4HJGE 1EU3A 4ASWC 1UGJA 1WMHA 3OAWA 2L05A 3C8YA 3VTVA 3WIMA 1Q1OA 5EDSA 2LI5A 1I4RA 1SBBB 3AE1B 2LASA 1KOTA 2FCQA 3V62A 4K3CA 2DLBA 4XYCA 1C78A 4FULA 4W9JA 1NYRA 2GRIA 2MEKA 3ABVB 4C56C 3Q8EA 4HCPB 2JRIB 1WGRA 1XCTL 1YJ1A 3QQ8B 1IYFA 4KSLC 2BW2A 1I4XA 1T6BX 2DAJA 3PPAA 3AXCA 2INCC 3ETRA 3S2AA 5IKCM 2J0JA 3BYYB 2KANA 4GN1A 1RLFA 2AQ1B 1WJUA 4MGYE 1GG3A 3BVMA 4K7SA 4BBNC 1XQQA 2BYTA 3ZIMA 3VRAB 1Z5SB 4IM0A 2W54A 4EOYA 1P7FA 3DBRI 4NZLB 1JALA 1GC6A 1QKZA 4M0WA 3RN9C 4ANUA 1I4QA 3PREA 1D6EC 4FHKA 4EZJA 4PK1A 3AU4A 4NNJB 3Q14C 1I7HA 3HM6X 3IXSA 4HPMB 2AQ2B 1VLBA 2FUG1 4ZYNA 2K9XA 1E0ZA 4IC7B 1PGAA 1TS4A 4XZ4A 3SU8X 3AE2B 4NY0A 3DWGC 3AU5A 2EKEC 5LLIA 3AM9A 3GB1A 2MW5A 2N7JA 1J0GA 2Y5CA 1K51A 1JWAD 1XXGA 1E9MA 2JZ3B 1WSPA 4MH0E 3DBRB 5G2NA 1FXAA 3VDZA 5MPOA 4ANVA 2N7DA 2FCNA 4DHZB 3CSTA 2L8JA 4OVZA 1AYFA 2ZNVC 1V1PA 3AE3B 3QJZA 3ZXVA 1SE3A 1FPYA 2RDGA 3TJPA 1WZ3A 2CU1A 2WDVB 2FBWB 2ZPNA 2BYVE 4RNAA 2DZMA 1I4PA 2O6VA 3H7PB 4AS1A 2KFKB 4US8A 3GE3C 3W2DA 2K1FA 5DPWA 2DZIA 3FILA 1GPXA 4II3B 2IGGA 4HDQA 3LYYA 4HVBA 4CQNA 1FMAD 3RNAC 1FO4A 2KQSA 3PTFC 1M4VA 4LCDE 1FD6A 3AEBB 2BWFA 2KN4A 2KWUB 2KMMA 3EC8A 2INDC 1SIJA 4MM3B 4KSKC
chains in the Genus database with same CATH topology
2RGFA 3GZNI 4NAWB 4GMVA 4KVGB 4BKGA 2IBIB 4KDLB 2NBUA 2LXCA 1IP9A 4GDKA 3AI5A 3JVZX 2EMTA 4TQ0A 4AP4C 3L16A 1E7VA 5D6JB 1GNUA 1V49A 2G4SA 3ALBA 3HK0A 4JLCA 2C7HA 5IA7A 2KTRA 1SIFA 1FXTB 3MJWA 2BYEA 3APDA 4DK5A 3DPDA 3QAQA 1ISNA 3A9JA 3CF6E 3GOEA 4YL8A 2RSUA 2IO3B 3A9KA 1V9JA 4IWOA 4JL9A 3DVNV 5E6PA 1GC7A 3JSVA 3WAMA 4BOZB 1I42A 2NVUI 3ZNID 3ZVVA 1WX9A 3KYDD 1WMHB 1R4MI 4ICUA 2NPTA 1OEYA 4GDLA 1SE9A 1YD8U 2KHWB 1KM7A 1UGMA 2FAZA 3B0AA 4XX5A 4G0NB 2KWVB 4K81A 2KDBA 2RD0A 3A4RA 4BKTA 1GUAB 4FA6A 2C60A 2XK5B 2REXA 5CX3A 1R4NI 3NZSA 3A33B 3KYCD 4BKSA 1P3QU 4X57B 3DOWA 3ECIA 2RPQA 4B95A 2MP2B 1ZGUB 2NCNA 4IG7B 1WRDB 4KZ0A 1I35A 1V5TA 3T9LA 2JZZA 1WM3A 4EZLA 2K8BA 2IY1B 2MWSB 1U4AA 4B6WA 1PQSA 2LGYA 2R2QA 2WDTB 5AZGA 4KDIC 4J6IA 1WGDA 4K1RB 2BKFA 4DHZE 4HPLB 1Z2MA 2W9NA 5J2RA 1OQYA 2L76A 3CMMB 2KDEB 2JPHA 2KLCA 3BY4B 3CSFA 5DPRA 2KQ7A 3PRPB 3H9DA 3L17A 1NDDA 2HE7A 1H4RA 3L10B 2K6DB 3ONSA 2C7NB 4B9KA 3VAWA 5AEKB 5L95C 1F9JA 4FBJB 2O2VA 3LJ3A 3PHXB 3KUZA 4KZCA 1WI0A 5CTRC 2IYDB 4G11A 3B1LX 4I6PA 3U30A 3ZLZA 2ZCCA 2NR2A 3DBLI 2YVCA 4BFRA 2N7EA 2GBMA 2BYFA 2LGXA 1WGHA 2DZKA 3ZNGC 3VTWA 2FCMA 1L7YA 1WXMA 1XT9B 2AEHA 2KJRA 2MRPA 3M63B 3NOBA 4CO7A 3HHMA 4HK2A 4MJSA 2ASQA 1D3ZA 2KN5A 1P0RA 3PT2B 4DHJD 4LDTB 4WJNA 2GBJA 2LJ5A 2CHXA 2D3GA 3M3JA 1UD7A 2DYMA 3QHTA 4KIKB 2DYOA 4M0WB 3R3MA 4NPNA 4PS7A 4MGZE 3RD2A 3U8ZA 4ZRKA 1WJNA 2J0KA 3RZFA 3O65B 3WA0A 3P2BA 3VFKA 3ZDTA 1WM2A 2ZPYA 1ZKHA 4DXAB 3RULA 4JQWC 2KOXA 4W9FA 3UIPB 3VH4B 3QARA 1WF9A 2PE9A 2MBEA 3WAOA 3W1SC 4HJKA 3WANA 4OVVA 2FCSA 1ZW7A 2M0XA 2G45B 2Y5BB 2XEWA 3QCAA 3NZUA 2MBOA 2FNJB 2K8HA 4F1SA 2KJ6A 2OJRA 2PJHA 3L54A 4E71A 5LXHA 4HCNB 2DHZA 4LDTD 2V1YA 4MGKE 2GBKA 1LXDA 1WXSA 3PS6A 3QK0A 4DDID 3VXWA 4AJWA 1L2NA 4FJVB 5L83A 4GOCA 3V60A 2A4ZA 2RR9A 1T0YA 1XD3B 2KDFB 2XBBC 5CHVC 4HDOA 3VUYA 1Q5WB 4IWPA 1TZ1A 5DPSA 2KK8A 2IO1B 1C3TA 2ZVNA 5AZHA 3OJ3A 4E74A 4ZRJA 4MDKE 5LXIB 2KD0A 2KWCA 2MBQA 1Q0WB 1E8XA 5J17A 4W9LA 4WWOA 2N9XA 4MGIE 2WX0A 1WR1A 2BWES 2LVOA 3PHWB 3R7QA 4GU2A 1V2YA 3M62B 1YIWA 3A1QB 2D11A 2CHZA 4RM8A 2KVRA 4XC2A 1V6EA 1OGWA 4ZRIA 4PS3A 2VRRB 3R7RA 2FIDA 2G4DB 4P7IA 2K8CA 2LD9A 5C1ZA 2V3SA 2O6VB 3C0RB 2J0MA 3PZDA 1E5WA 2KC2A 3IVFA 3LDZE 2MCNB 1OEYJ 3ML9A 4DBGA 2KFJA 1EO6A 5E6NA 3NHEB 3PVLA 4A3PA 2KX0A 3W1SA 2K25A 2L0FA 3HIZA 1J8CA 1VCBA 1WXVA 2KC1A 3KW5B 3DBSA 3QA8A 3PLVA 4A3OA 1WIAA 4I6NB 2GBNA 2KLGA 1WGYA 2ZEQA 1WY8A 2BF8B 4MSQB 2JT4B 2DAFA 3MHSD 3ZNZB 4HXDA 1OTRB 3ZW3A 2L00B 3B08A 2YLMA 2KZRA 1V5OA 5D7GA 4WJPA 2MX2A 3SHQA 3DVGX 2LGDA 2NS5A 4NQLB 3ZTDA 3RYTA 3X0WA 2MBHA 2J7QB 2O6VD 2C7MB 1TTNA 4E3CA 3OJ4B 3H7SA 3APFA 4FLHA 4PYZA 2N1WA 5FR6A 3DCGA 1P98A 3ENEA 4LJPB 1WX8A 4GDKB 4FADA 3V6CB 1E8ZA 3OLMD 3H7PA 2D2QA 2LVPA 3L08A 3Q3JA 2JVCA 3RCZA 1CMXB 2KFKA 1WGGA 5KHQA 1WXAA 2ZNVB 4GGQA 3UINB 3K9PB 3V6EB 4W9HA 4EZKA 1TBEA 1V81A 2CS4A 2GOWA 2JWZA 4PS8A 3T8MA 3VTUA 2BGFA 2KTRB 4W9KA 1A5RA 4LJOB 2UYZB 3UQBA 1HE8A 2IO2B 3A9JB 1Y8RC 1V86A 2NBWB 3A9KB 2KTFA 2K39A 4FHJA 4JIOU 2LZ6A 3JSVB 2I1JA 4BOSC 3WALA 1WJ6A 2JRHA 3QIJA 2ZVOA 2ZCBA 4W9IA 1BT0A 4I6LB 2HTHA 3QX1A 2JF5A 3KH0A 3SD5A 1GJZA 4GSWA 4IW0A 2NPTB 2GMIC 4AWJA 4GDLB 2M4NA 2C5LC 4MM3A 3I3TB 1LM8B 3IG3A 3PV1A 3VUWA 2JY6A 5JZEB 4NAWA 5HKHA 5JHAA 4GXBA 4WJOA 4W9DA 4ANXA 4M8MA 4EEWA 4FJZA 4II2B 5D94A 2KNBA 3DVGY 2BPSA 4K7UA 5G55A 3KUDB 3RT3B 1LFDA 4A20A 2EMSA 2MBBB 2AL6A 4BVUC 3ZO5B 2Z0EB 5C23A 3EHVA 4ZDVA 2JUOA 4TQ1A 3IBEA 1RRBA 2ZJDA 1IPGA 2L0TA 4IUMB 4M8NA 1H8CA 2AYOB 5J18A 3VHTC 3JW0X 4EFOA 2IO0B 4G3XB 3U7DA 1M94A 3UQAA 4NQKE 1AARA 2KMAA 4ASWC 2L7RA 4EUTA 4AJYB 1WMHA 4BBNF 3OAWA 4ANWA 2L05A 2DX5B 5BO4B 1WX7A 2O2VB 2Z0DB 1S1QB 3VTVA 3WIMA 3PGEA 1WYWB 1X1MA 1Q1OA 5EDSA 3VUXA 2LI5A 4PYUA 3ML8A 2WWZA 1E7UA 2A5UA 2LASA 2XK5A 1KOTA 3HM3A 5D2MB 2FCQA 2LXAA 3V62A 3NY5A 5IAAC 3DBHI 1WE7A 4CHKA 5AZFA 1EUVB 2MP2A 4MJSB 4NJ7A 2WYQA 3H6NA 3TIXA 3R66C 4FULA 1J19A 4W9JA 2HJ8A 2B3AA 4MELA 1E8YA 3AULA 4AUQC 1P1AA 4HCPB 2KXJA 2JRIB 1WGRA 1RFAA 2OOBB 1RAXA 1YJ1A 2CR5A 3QQ8B 1IYFA 4KSLC 4EKUA 2WX1A 2QHOA 4MSMB 4N9F4 4F7ZA 2DAJA 3PPAA 3RZWC 5JH5C 3AXCA 2AWTA 3V61A 3S2AA 2MQJA 3L0WB 2N4FA 2J0JA 2KANA 4GN1A 2KX3A 4RM9A 1RLFA 2D07B 1YQBA 1SGHA 1WJUA 2KO3A 5GMVA 4HLEA 4MGYE 1NI2A 1GG3A 2AL3A 2HD5B 2N9PC 3DDCB 4WQOB 4K7SA 2CKHB 2JXXA 2MSED 3L13A 1S3SG 3PLUA 4BBNC 4JGHB 1XQQA 3ZIMA 3N3KB 3IFWB 1WE6A 1Z5SB 2C9WB 4IM0A 4EOYA 3DBRI 1UZXB 4IM2A 3N30A 1GC6A 4WJQA 4KIKA 1VD2A 4ANUA 4DDGD 3PREA 1KJTA 1TGZB 4FHKA 4EZJA 5DPTA 1C1YB 1UELA 3UIOB 3AU4A 4NNJB 2GBRA 3HM6X 4HPMB 4DWFA 1WZ0A 1YX6B 2NBVB 2D10A 4W9GA 4ZYNA 4NJ6A 4IC7B 4MEMA 4XZ4A 3JYUA 3ZDMC 3ZRFA 3SU8X 2Z59B 4NY0A 2I1KA 3RUIB 3K9OB 1LQBA 3AU5A 1E90A 3TL5A 2EKEC 3WAPA 3TBLD 2G3QB 5LLIA 2LUEA 3W1YA 5CHFA 5KHOA 2LRWA 1MG8A 2MW5A 1J0GA 4DHJB 4HWIB 2ZZPB 3VVWB 2L3ZA 3QWZB 2M17A 3A4SC 2R2OA 2PEAA 1K8RB 3EFUA 4CYEA 4G50A 5DCNA 3ZNHB 3Q3FA 2JZ3B 5G2NA 2PE6B 4MH0E 1QZEA 2K6QA 2UWQA 2DYBA 3VDZA 4WWNA 5E6OA 4AOFA 3H1UA 2N9EB 1WFYA 1V80A 1EF1A 1E8WA 3ZTCA 3SDLC 3IHPC 3ZKJC 4URKA 4ANVA 3TCAA 2KDIA 2N7DA 2DZJA 2FIFA 2FCNA 3UGBB 4DHZB 3CSTA 2L8JA 4FN2A 3BINA 2LVQA 2ZNVC 5CHWA 3DVNU 2LRUA 1G6JA 3QC8B 3QJZA 3M95A 3N32A 2M1MA 4TKNA 3A1QA 4GIVA 2MA9B 4OVUA 3TJPA 1UBIA 1P9DU 1WZ3A 2CU1A 2N1VA 1UH6A 1EF5A 4W9CA 4IWQA 2ZPNA 3EECA 2BYVE 2DZMA 2O6VA 3H7PB 2KJHB 1KLVA 4RMAA 4GB9A 4TV3A 1JRUA 3NS8A 2KFKB 2FUHB 3PSEB 4TUUA 3ZUNA 2IZVB 3KUCB 2PPHA 1WH3A 2K1FA 1NBFC 1UBQA 2MLBA 5DPWA 4FJYA 2LWPA 3PRMB 4BKSD 2DZIA 4KV2A 4K7WA 3ZRCA 4II3B 2DENB 4HDQA 3DQVA 3TMPB 2CHWA 3D32A 3KVFB 3VQIA 4HVBA 1WJ4A 3MTNB 2V4LA 3PRZA 1WR6E 2BKRB 2KQSA 3PTFC 4LCDE 4IM3A 4W9EA 3X23A 2KMCA 2KKCA 1YX5B 5JHBA 5TR5A 2BWFA 2M8SA 3APCA 2KWUB 3EC8A 4WWPA 4WAAA 4ICVA 4KSKC 3VH3B 2IY0B 4F8CB 3UF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RGF A;  3GZN I;  4NAW B;  4GMV A;  4KVG B;  4BKG A;  2IBI B;  4KDL B;  2NBU A;  2LXC A;  1IP9 A;  4GDK A;  3AI5 A;  3JVZ X;  2EMT A;  4TQ0 A;  4AP4 C;  3L16 A;  1E7V A;  5D6J B;  1GNU A;  1V49 A;  2G4S A;  3ALB A;  3HK0 A;  4JLC A;  2C7H A;  5IA7 A;  2KTR A;  1SIF A;  1FXT B;  3MJW A;  2BYE A;  3APD A;  4DK5 A;  3DPD A;  3QAQ A;  1ISN A;  3A9J A;  3CF6 E;  3GOE A;  4YL8 A;  2RSU A;  2IO3 B;  3A9K A;  1V9J A;  4IWO A;  4JL9 A;  3DVN V;  5E6P A;  1GC7 A;  3JSV A;  3WAM A;  4BOZ B;  1I42 A;  2NVU I;  3ZNI D;  3ZVV A;  1WX9 A;  3KYD D;  1WMH B;  1R4M I;  4ICU A;  2NPT A;  1OEY A;  4GDL A;  1SE9 A;  1YD8 U;  2KHW B;  1KM7 A;  1UGM A;  2FAZ A;  3B0A A;  4XX5 A;  4G0N B;  2KWV B;  4K81 A;  2KDB A;  2RD0 A;  3A4R A;  4BKT A;  1GUA B;  4FA6 A;  2C60 A;  2XK5 B;  2REX A;  5CX3 A;  1R4N I;  3NZS A;  3A33 B;  3KYC D;  4BKS A;  1P3Q U;  4X57 B;  3DOW A;  3ECI A;  2RPQ A;  4B95 A;  2MP2 B;  1ZGU B;  2NCN A;  4IG7 B;  1WRD B;  4KZ0 A;  1I35 A;  1V5T A;  3T9L A;  2JZZ A;  1WM3 A;  4EZL A;  2K8B A;  2IY1 B;  2MWS B;  1U4A A;  4B6W A;  1PQS A;  2LGY A;  2R2Q A;  2WDT B;  5AZG A;  4KDI C;  4J6I A;  1WGD A;  4K1R B;  2BKF A;  4DHZ E;  4HPL B;  1Z2M A;  2W9N A;  5J2R A;  1OQY A;  2L76 A;  3CMM B;  2KDE B;  2JPH A;  2KLC A;  3BY4 B;  3CSF A;  5DPR A;  2KQ7 A;  3PRP B;  3H9D A;  3L17 A;  1NDD A;  2HE7 A;  1H4R A;  3L10 B;  2K6D B;  3ONS A;  2C7N B;  4B9K A;  3VAW A;  5AEK B;  5L95 C;  1F9J A;  4FBJ B;  2O2V A;  3LJ3 A;  3PHX B;  3KUZ A;  4KZC A;  1WI0 A;  5CTR C;  2IYD B;  4G11 A;  3B1L X;  4I6P A;  3U30 A;  3ZLZ A;  2ZCC A;  2NR2 A;  3DBL I;  2YVC A;  4BFR A;  2N7E A;  2GBM A;  2BYF A;  2LGX A;  1WGH A;  2DZK A;  3ZNG C;  3VTW A;  2FCM A;  1L7Y A;  1WXM A;  1XT9 B;  2AEH A;  2KJR A;  2MRP A;  3M63 B;  3NOB A;  4CO7 A;  3HHM A;  4HK2 A;  4MJS A;  2ASQ A;  1D3Z A;  2KN5 A;  1P0R A;  3PT2 B;  4DHJ D;  4LDT B;  4WJN A;  2GBJ A;  2LJ5 A;  2CHX A;  2D3G A;  3M3J A;  1UD7 A;  2DYM A;  3QHT A;  4KIK B;  2DYO A;  4M0W B;  3R3M A;  4NPN A;  4PS7 A;  4MGZ E;  3RD2 A;  3U8Z A;  4ZRK A;  1WJN A;  2J0K A;  3RZF A;  3O65 B;  3WA0 A;  3P2B A;  3VFK A;  3ZDT A;  1WM2 A;  2ZPY A;  1ZKH A;  4DXA B;  3RUL A;  4JQW C;  2KOX A;  4W9F A;  3UIP B;  3VH4 B;  3QAR A;  1WF9 A;  2PE9 A;  2MBE A;  3WAO A;  3W1S C;  4HJK A;  3WAN A;  4OVV A;  2FCS A;  1ZW7 A;  2M0X A;  2G45 B;  2Y5B B;  2XEW A;  3QCA A;  3NZU A;  2MBO A;  2FNJ B;  2K8H A;  4F1S A;  2KJ6 A;  2OJR A;  2PJH A;  3L54 A;  4E71 A;  5LXH A;  4HCN B;  2DHZ A;  4LDT D;  2V1Y A;  4MGK E;  2GBK A;  1LXD A;  1WXS A;  3PS6 A;  3QK0 A;  4DDI D;  3VXW A;  4AJW A;  1L2N A;  4FJV B;  5L83 A;  4GOC A;  3V60 A;  2A4Z A;  2RR9 A;  1T0Y A;  1XD3 B;  2KDF B;  2XBB C;  5CHV C;  4HDO A;  3VUY A;  1Q5W B;  4IWP A;  1TZ1 A;  5DPS A;  2KK8 A;  2IO1 B;  1C3T A;  2ZVN A;  5AZH A;  3OJ3 A;  4E74 A;  4ZRJ A;  4MDK E;  5LXI B;  2KD0 A;  2KWC A;  2MBQ A;  1Q0W B;  1E8X A;  5J17 A;  4W9L A;  4WWO A;  2N9X A;  4MGI E;  2WX0 A;  1WR1 A;  2BWE S;  2LVO A;  3PHW B;  3R7Q A;  4GU2 A;  1V2Y A;  3M62 B;  1YIW A;  3A1Q B;  2D11 A;  2CHZ A;  4RM8 A;  2KVR A;  4XC2 A;  1V6E A;  1OGW A;  4ZRI A;  4PS3 A;  2VRR B;  3R7R A;  2FID A;  2G4D B;  4P7I A;  2K8C A;  2LD9 A;  5C1Z A;  2V3S A;  2O6V B;  3C0R B;  2J0M A;  3PZD A;  1E5W A;  2KC2 A;  3IVF A;  3LDZ E;  2MCN B;  1OEY J;  3ML9 A;  4DBG A;  2KFJ A;  1EO6 A;  5E6N A;  3NHE B;  3PVL A;  4A3P A;  2KX0 A;  3W1S A;  2K25 A;  2L0F A;  3HIZ A;  1J8C A;  1VCB A;  1WXV A;  2KC1 A;  3KW5 B;  3DBS A;  3QA8 A;  3PLV A;  4A3O A;  1WIA A;  4I6N B;  2GBN A;  2KLG A;  1WGY A;  2ZEQ A;  1WY8 A;  2BF8 B;  4MSQ B;  2JT4 B;  2DAF A;  3MHS D;  3ZNZ B;  4HXD A;  1OTR B;  3ZW3 A;  2L00 B;  3B08 A;  2YLM A;  2KZR A;  1V5O A;  5D7G A;  4WJP A;  2MX2 A;  3SHQ A;  3DVG X;  2LGD A;  2NS5 A;  4NQL B;  3ZTD A;  3RYT A;  3X0W A;  2MBH A;  2J7Q B;  2O6V D;  2C7M B;  1TTN A;  4E3C A;  3OJ4 B;  3H7S A;  3APF A;  4FLH A;  4PYZ A;  2N1W A;  5FR6 A;  3DCG A;  1P98 A;  3ENE A;  4LJP B;  1WX8 A;  4GDK B;  4FAD A;  3V6C B;  1E8Z A;  3OLM D;  3H7P A;  2D2Q A;  2LVP A;  3L08 A;  3Q3J A;  2JVC A;  3RCZ A;  1CMX B;  2KFK A;  1WGG A;  5KHQ A;  1WXA A;  2ZNV B;  4GGQ A;  3UIN B;  3K9P B;  3V6E B;  4W9H A;  4EZK A;  1TBE A;  1V81 A;  2CS4 A;  2GOW A;  2JWZ A;  4PS8 A;  3T8M A;  3VTU A;  2BGF A;  2KTR B;  4W9K A;  1A5R A;  4LJO B;  2UYZ B;  3UQB A;  1HE8 A;  2IO2 B;  3A9J B;  1Y8R C;  1V86 A;  2NBW B;  3A9K B;  2KTF A;  2K39 A;  4FHJ A;  4JIO U;  2LZ6 A;  3JSV B;  2I1J A;  4BOS C;  3WAL A;  1WJ6 A;  2JRH A;  3QIJ A;  2ZVO A;  2ZCB A;  4W9I A;  1BT0 A;  4I6L B;  2HTH A;  3QX1 A;  2JF5 A;  3KH0 A;  3SD5 A;  1GJZ A;  4GSW A;  4IW0 A;  2NPT B;  2GMI C;  4AWJ A;  4GDL B;  2M4N A;  2C5L C;  4MM3 A;  3I3T B;  1LM8 B;  3IG3 A;  3PV1 A;  3VUW A;  2JY6 A;  5JZE B;  4NAW A;  5HKH A;  5JHA A;  4GXB A;  4WJO A;  4W9D A;  4ANX A;  4M8M A;  4EEW A;  4FJZ A;  4II2 B;  5D94 A;  2KNB A;  3DVG Y;  2BPS A;  4K7U A;  5G55 A;  3KUD B;  3RT3 B;  1LFD A;  4A20 A;  2EMS A;  2MBB B;  2AL6 A;  4BVU C;  3ZO5 B;  2Z0E B;  5C23 A;  3EHV A;  4ZDV A;  2JUO A;  4TQ1 A;  3IBE A;  1RRB A;  2ZJD A;  1IPG A;  2L0T A;  4IUM B;  4M8N A;  1H8C A;  2AYO B;  5J18 A;  3VHT C;  3JW0 X;  4EFO A;  2IO0 B;  4G3X B;  3U7D A;  1M94 A;  3UQA A;  4NQK E;  1AAR A;  2KMA A;  4ASW C;  2L7R A;  4EUT A;  4AJY B;  1WMH A;  4BBN F;  3OAW A;  4ANW A;  2L05 A;  2DX5 B;  5BO4 B;  1WX7 A;  2O2V B;  2Z0D B;  1S1Q B;  3VTV A;  3WIM A;  3PGE A;  1WYW B;  1X1M A;  1Q1O A;  5EDS A;  3VUX A;  2LI5 A;  4PYU A;  3ML8 A;  2WWZ A;  1E7U A;  2A5U A;  2LAS A;  2XK5 A;  1KOT A;  3HM3 A;  5D2M B;  2FCQ A;  2LXA A;  3V62 A;  3NY5 A;  5IAA C;  3DBH I;  1WE7 A;  4CHK A;  5AZF A;  1EUV B;  2MP2 A;  4MJS B;  4NJ7 A;  2WYQ A;  3H6N A;  3TIX A;  3R66 C;  4FUL A;  1J19 A;  4W9J A;  2HJ8 A;  2B3A A;  4MEL A;  1E8Y A;  3AUL A;  4AUQ C;  1P1A A;  4HCP B;  2KXJ A;  2JRI B;  1WGR A;  1RFA A;  2OOB B;  1RAX A;  1YJ1 A;  2CR5 A;  3QQ8 B;  1IYF A;  4KSL C;  4EKU A;  2WX1 A;  2QHO A;  4MSM B;  4N9F 4;  4F7Z A;  2DAJ A;  3PPA A;  3RZW C;  5JH5 C;  3AXC A;  2AWT A;  3V61 A;  3S2A A;  2MQJ A;  3L0W B;  2N4F A;  2J0J A;  2KAN A;  4GN1 A;  2KX3 A;  4RM9 A;  1RLF A;  2D07 B;  1YQB A;  1SGH A;  1WJU A;  2KO3 A;  5GMV A;  4HLE A;  4MGY E;  1NI2 A;  1GG3 A;  2AL3 A;  2HD5 B;  2N9P C;  3DDC B;  4WQO B;  4K7S A;  2CKH B;  2JXX A;  2MSE D;  3L13 A;  1S3S G;  3PLU A;  4BBN C;  4JGH B;  1XQQ A;  3ZIM A;  3N3K B;  3IFW B;  1WE6 A;  1Z5S B;  2C9W B;  4IM0 A;  4EOY A;  3DBR I;  1UZX B;  4IM2 A;  3N30 A;  1GC6 A;  4WJQ A;  4KIK A;  1VD2 A;  4ANU A;  4DDG D;  3PRE A;  1KJT A;  1TGZ B;  4FHK A;  4EZJ A;  5DPT A;  1C1Y B;  1UEL A;  3UIO B;  3AU4 A;  4NNJ B;  2GBR A;  3HM6 X;  4HPM B;  4DWF A;  1WZ0 A;  1YX6 B;  2NBV B;  2D10 A;  4W9G A;  4ZYN A;  4NJ6 A;  4IC7 B;  4MEM A;  4XZ4 A;  3JYU A;  3ZDM C;  3ZRF A;  3SU8 X;  2Z59 B;  4NY0 A;  2I1K A;  3RUI B;  3K9O B;  1LQB A;  3AU5 A;  1E90 A;  3TL5 A;  2EKE C;  3WAP A;  3TBL D;  2G3Q B;  5LLI A;  2LUE A;  3W1Y A;  5CHF A;  5KHO A;  2LRW A;  1MG8 A;  2MW5 A;  1J0G A;  4DHJ B;  4HWI B;  2ZZP B;  3VVW B;  2L3Z A;  3QWZ B;  2M17 A;  3A4S C;  2R2O A;  2PEA A;  1K8R B;  3EFU A;  4CYE A;  4G50 A;  5DCN A;  3ZNH B;  3Q3F A;  2JZ3 B;  5G2N A;  2PE6 B;  4MH0 E;  1QZE A;  2K6Q A;  2UWQ A;  2DYB A;  3VDZ A;  4WWN A;  5E6O A;  4AOF A;  3H1U A;  2N9E B;  1WFY A;  1V80 A;  1EF1 A;  1E8W A;  3ZTC A;  3SDL C;  3IHP C;  3ZKJ C;  4URK A;  4ANV A;  3TCA A;  2KDI A;  2N7D A;  2DZJ A;  2FIF A;  2FCN A;  3UGB B;  4DHZ B;  3CST A;  2L8J A;  4FN2 A;  3BIN A;  2LVQ A;  2ZNV C;  5CHW A;  3DVN U;  2LRU A;  1G6J A;  3QC8 B;  3QJZ A;  3M95 A;  3N32 A;  2M1M A;  4TKN A;  3A1Q A;  4GIV A;  2MA9 B;  4OVU A;  3TJP A;  1UBI A;  1P9D U;  1WZ3 A;  2CU1 A;  2N1V A;  1UH6 A;  1EF5 A;  4W9C A;  4IWQ A;  2ZPN A;  3EEC A;  2BYV E;  2DZM A;  2O6V A;  3H7P B;  2KJH B;  1KLV A;  4RMA A;  4GB9 A;  4TV3 A;  1JRU A;  3NS8 A;  2KFK B;  2FUH B;  3PSE B;  4TUU A;  3ZUN A;  2IZV B;  3KUC B;  2PPH A;  1WH3 A;  2K1F A;  1NBF C;  1UBQ A;  2MLB A;  5DPW A;  4FJY A;  2LWP A;  3PRM B;  4BKS D;  2DZI A;  4KV2 A;  4K7W A;  3ZRC A;  4II3 B;  2DEN B;  4HDQ A;  3DQV A;  3TMP B;  2CHW A;  3D32 A;  3KVF B;  3VQI A;  4HVB A;  1WJ4 A;  3MTN B;  2V4L A;  3PRZ A;  1WR6 E;  2BKR B;  2KQS A;  3PTF C;  4LCD E;  4IM3 A;  4W9E A;  3X23 A;  2KMC A;  2KKC A;  1YX5 B;  5JHB A;  5TR5 A;  2BWF A;  2M8S A;  3APC A;  2KWU B;  3EC8 A;  4WWP A;  4WAA A;  4ICV A;  4KSK C;  3VH3 B;  2IY0 B;  4F8C B;  3UF8 A; 
#chains in the Genus database with same CATH topology
 3GZN I;  4KDL B;  2N9K A;  2NBU A;  3RNB C;  3RNF C;  3JVZ X;  2EMT A;  1MHX A;  5D6J B;  4JLC A;  4LLG M;  4L2Y A;  1J7A A;  1TIF A;  3DPD A;  1JWM D;  2IO3 B;  3JSV A;  3WAM A;  1I42 A;  3ZNI D;  3BYT B;  3KYD D;  1WMH B;  3NJT A;  3ZYY X;  1OEY A;  2VH1 A;  3KWL A;  1YD8 U;  4GDL A;  1UGM A;  2FAZ A;  3B0A A;  3GZN B;  4K81 A;  1YJJ A;  2KDB A;  2RD0 A;  3NUH B;  3VRB B;  2REX A;  2D5G A;  4C80 A;  1A70 A;  1ZGU B;  4IG7 B;  3T9L A;  2JZZ A;  4R3D A;  2IY1 B;  4RFB A;  5AZG A;  2R2Q A;  2WDT B;  2WNM A;  4J6I A;  2MJ3 A;  4K1R B;  2BKF A;  4DHZ E;  4HPL B;  1T3Q A;  1OQY A;  2V3N A;  4RCO A;  3PZ8 A;  4MAC A;  2QCZ A;  2QEJ C;  1JWB D;  1L4D B;  3PRP B;  3H9D A;  1NDD A;  3ONS A;  1H4R A;  5L95 C;  4L23 A;  1WXQ A;  3IAS 1;  1D5Z C;  1NI3 A;  2IYD B;  2WXR A;  2QDF A;  3DBL I;  3DHH C;  4BFR A;  2BYF A;  2AEH A;  2KJR A;  2MRP A;  3NOB A;  4RF0 A;  1DOX A;  3MHZ A;  2WQY B;  1NEN B;  3OWE B;  3NS1 A;  4M0W B;  4WJN A;  5C2T B;  3R3M A;  3HRD D;  4ZRK A;  1WJN A;  3PO0 A;  3ZDT A;  3T3O A;  4W9F A;  5AUK A;  3FC4 A;  1N60 A;  3T3N A;  5D3I B;  3WAN A;  4OVV A;  4LNI A;  1ENF A;  3DBL B;  1QOG A;  3Q69 A;  2M0A A;  1FNW A;  2PJH A;  1SF0 A;  4HCN B;  2V1Y A;  1SJE D;  4AJW A;  1VZ7 A;  3V60 A;  2A4Z A;  2RR9 A;  2KDF B;  4HDO A;  3VUY A;  1RWS A;  2PVO D;  3N20 C;  4MT5 A;  1C4A A;  2WGS A;  4ZRJ A;  2BQQ A;  2KWC A;  2MBQ A;  2Y3A A;  5J17 A;  2N9X A;  4MGI E;  2WX0 A;  1WR1 A;  3PHW B;  3PZ7 A;  4HKQ A;  1V1P B;  1V2Y A;  1YIW A;  2HJ1 A;  3SFD B;  2D11 A;  2X38 A;  1QOA A;  3MP9 A;  1OGW A;  1XLO A;  2LD9 A;  2V3S A;  2O6V B;  2PVG C;  1E5W A;  4DBG A;  1FFV A;  1ZDV A;  4RGO S;  2KC1 A;  3Q3O C;  3QA8 A;  1WIA A;  4I6N B;  2KLG A;  1F52 A;  1WY8 A;  3FIL B;  4WAF A;  1WYG A;  1XLQ A;  5GXG B;  5D7G A;  2MX2 A;  2IGD A;  4NQL B;  2MBH A;  2BVC A;  1YOV B;  3H7S A;  4LK0 M;  1XF5 L;  1P98 A;  1WX8 A;  3RCZ A;  1CMX B;  4ZYS A;  2ZNV B;  4W9H A;  4EZK A;  3U7Z A;  4PS8 A;  2JWZ A;  2X8X X;  4LJO B;  3UQB A;  2V9H A;  1TKG A;  3V05 A;  2KTF A;  2K39 A;  4FHJ A;  4RF1 A;  3JSV B;  1WJ6 A;  2JRH A;  3QIJ A;  2ZVO A;  2KT7 A;  2KYW A;  3KH0 A;  3Q6B A;  1GJZ A;  1EWY C;  4IW0 A;  4IOI E;  4GDL B;  2M4N A;  4K3B A;  2PTL A;  4P1C C;  4M8M A;  4FJZ A;  5D94 A;  2NTS A;  4K7U A;  2KQ4 X;  3KUD B;  4D2K A;  3AE8 B;  2YEP B;  2LFI A;  2AL6 A;  4A90 A;  1GB1 A;  2Z0E B;  3MFG A;  3SFE B;  4TQ1 A;  1RRB A;  4IUM B;  1QLB B;  4WQM A;  2AYO B;  3JW0 X;  4EFO A;  3U7D A;  1EU4 A;  4ACF A;  4NQK E;  5H92 C;  2B76 B;  2Z0D B;  2W82 A;  3RNG C;  4H2A A;  3Q2A C;  2WWZ A;  1N61 A;  2WXI A;  3CWI A;  3AB5 A;  1MHH E;  2LXA A;  5IOI A;  2JYT A;  1WE7 A;  4CHK A;  4BAX A;  5D3D A;  2WYQ A;  2L32 A;  2B3A A;  2J4X A;  1P1A A;  1L6U A;  2JWU A;  2QHO A;  4N9F 4;  3RZW C;  2AWT A;  2JU6 X;  3V61 A;  2MQJ A;  5TSS A;  1D5M C;  1TJE A;  1C76 A;  2D07 B;  5BYS A;  1YQB A;  1SGH A;  2KO3 A;  5GMV A;  4HLE A;  1N62 A;  5LNK 1;  3PLU A;  2XN9 C;  2RDH A;  3N3K B;  3IFW B;  1WE6 A;  2C9W B;  4C7Z A;  5BYR A;  1UZX B;  3N30 A;  4WJQ A;  3ZJU A;  1TT5 B;  4NJC A;  4DDG D;  1KJT A;  1TGZ B;  1PUT A;  2GBR A;  4JWU C;  3AEC B;  4A55 A;  2NBV B;  2D10 A;  4ZOH C;  1PGB A;  3EUB 2;  4NJ6 A;  3P1M A;  2WU5 B;  1I4G A;  3JYU A;  3ZDM C;  3RUI B;  2I1K A;  3K9O B;  1LQB A;  2WXN A;  3WAP A;  3TBL D;  2LUE A;  2LRW A;  4DHJ B;  1ZPS A;  3VVW B;  1EWC A;  2SAK A;  5DCN A;  3B9J A;  2LJI A;  2ZW1 A;  4WWN A;  5E6O A;  3H1U A;  1L0Y B;  3ZTC A;  4URK A;  1TS2 A;  5EE1 A;  1KH0 A;  3TCA A;  1SSN A;  2Q5W D;  3Q3N C;  4FN2 A;  1E10 A;  2LRU A;  3M95 A;  4GIV A;  2EEL A;  1T0Q C;  2N1V A;  1UH6 A;  4W9C A;  4IWQ A;  4GB9 A;  2QSD A;  2FUH B;  3PSE B;  5EE3 A;  2WXH A;  3KUC B;  2PPH A;  3Q8A A;  5BMI A;  1UBQ A;  2MLB A;  1ET9 A;  3I57 A;  5FKA C;  3ZRC A;  1TKE A;  2RDB C;  2DEN B;  3TMP B;  1TKY A;  3AEG B;  1WJ4 A;  2V4L A;  2HTM E;  4YSY B;  1WR6 E;  2BKR B;  2KMC A;  1PGX A;  3J9C A;  3VH3 B;  2IDY A;  2IBI B;  4XGA B;  2LXC A;  1BUI C;  3AI5 A;  1UUP A;  4C7Y A;  3L16 A;  1GNU A;  1KTK A;  3HK0 A;  4WWM A;  2BYE A;  3QAQ A;  3GOE A;  2KWD A;  4YL8 A;  4YSX B;  1D4B A;  1FFU A;  1GOZ A;  1L0X B;  1WX9 A;  2QJL A;  2QMT A;  1R4M I;  2WHI A;  4YTN B;  4BKT A;  3U52 E;  4TMA B;  1GUA B;  4FA6 A;  2C60 A;  2QIL A;  2V3P A;  4O1N A;  2WXP A;  4BKS A;  1P3Q U;  4X57 B;  1FIQ A;  2JSV X;  3DOW A;  3ECI A;  2RPQ A;  4B95 A;  3BZD B;  1KRH A;  1WRD B;  2K8B A;  2MWS B;  2CJN A;  1YNT E;  1WGD A;  3LB8 C;  1DOI A;  2D3B A;  2JPH A;  3CSF A;  2KQ7 A;  1TZO A;  3GS2 A;  2K6D B;  2C7N B;  4XDD A;  1R4M B;  4FBJ B;  2O2V A;  2BS3 B;  3PHX B;  1JW9 D;  4G11 A;  3B1L X;  2ZCC A;  1RYJ A;  1BML C;  1WGH A;  2DZK A;  4B0E A;  2FCM A;  3AE6 B;  1CZP A;  4JWS C;  4ZHO A;  1XT9 B;  4MJS A;  2INP E;  1MPE A;  3BK2 A;  4P1B C;  2KN5 A;  3PT2 B;  4DHJ D;  2GBJ A;  1STE A;  4B9K A;  4C4V A;  2DYM A;  3TEW A;  2OJW A;  4KGT A;  1OQR A;  3RZF A;  3TEX A;  4JX1 C;  3WA0 A;  1VR9 A;  3P2B A;  4DXA B;  3RUL A;  3QAR A;  1WF9 A;  3WAO A;  2NMQ A;  3FAH A;  4HJK A;  1QOB A;  5H8Y E;  1JCK B;  1DYQ A;  2XEW A;  2JXT A;  3QCA A;  3NZU A;  2V4I B;  3LXF A;  2K8H A;  3MJ5 A;  3L54 A;  2DHZ A;  2J42 A;  3PS6 A;  1WXS A;  3QK0 A;  3VXW A;  1L2N A;  5L83 A;  4A9A A;  1SE4 A;  1F77 A;  5CHV C;  1VZ8 A;  4IWP A;  3BVZ A;  2ZVN A;  5AZH A;  1YJI A;  3OJ3 A;  4E74 A;  4MDK E;  5LXI B;  1E8X A;  4W9L A;  4WWO A;  1FCL A;  2BWE S;  2LVO A;  2KVR A;  2WP9 B;  4YWG G;  1QF6 A;  4PS3 A;  2VRR B;  2FID A;  2G4D B;  2K8C A;  5C1Z A;  3MC0 B;  3C0R B;  3LDZ E;  1EO6 A;  4OZC A;  3NHE B;  3PVL A;  2KX0 A;  2K25 A;  3KW5 B;  3TEY A;  2GBN A;  1ZUD 2;  2PW9 A;  1WGY A;  2ZEQ A;  4HXD A;  1OTR B;  1V5O A;  2NS5 A;  2J7Q B;  4E3C A;  4WH4 A;  2N1W A;  3BK1 A;  1MG4 A;  3OLM D;  4C00 A;  2BTE A;  2D2Q A;  3Q3J A;  3DHI C;  1FNV A;  3K9P B;  1V81 A;  2CS4 A;  1VRA B;  1N5X A;  5E6J A;  1Y8R C;  2NBW B;  3B2G A;  1TY2 A;  2LZ6 A;  2WXG A;  4BOS C;  2ZCB A;  1WRI A;  1BT0 A;  2AX5 A;  3QX1 A;  1Q10 A;  2GI9 A;  5EE9 A;  4GSW A;  3ZXR A;  3I3T B;  2PIA A;  3IG3 A;  2G9H D;  3PV1 A;  3VUW A;  5JZE B;  4NAW A;  2K0P A;  4PT5 A;  2I2Y A;  4II2 B;  2KNB A;  2BPS A;  3RT3 B;  1LFD A;  4A20 A;  1JWS D;  5C23 A;  2TSS A;  1K52 A;  2JUO A;  3IBE A;  4N6E B;  4S0R A;  2L0T A;  4KGS A;  5J18 A;  2JQR B;  2IO0 B;  2KMA A;  4EUT A;  1C79 A;  1TYG B;  4BBN F;  4ANW A;  2DX5 B;  1WX7 A;  1E7P B;  3I5J C;  2O2V B;  1XEE A;  3RMK C;  1S1Q B;  4DQO C;  1WYW B;  3RNE C;  4GLS C;  3VUX A;  4PYU A;  2A5U A;  1MVK A;  4M01 A;  4RGN A;  1DGJ A;  3R2I A;  5IAA C;  3DBH I;  1EUV B;  4MJS B;  4NJ7 A;  3AED B;  3TIX A;  3R66 C;  1J19 A;  4XE0 A;  2HJ8 A;  4C4V B;  4MEL A;  1T0S C;  2BB6 A;  3AUL A;  2N9L A;  2KXJ A;  3GE8 C;  5IN7 A;  2INN E;  3AE9 B;  1RAX A;  4DXF A;  2WX1 A;  2XNA C;  4ARC A;  5JH5 C;  3L0W B;  2N4F A;  4RH6 A;  2LHD A;  2KX3 A;  2L83 A;  2N9P C;  4WQO B;  2JXX A;  3DBH B;  3L13 A;  5BMH A;  2WDR B;  1VD2 A;  4M02 A;  5DPT A;  1C1Y B;  3P4S B;  1WZ0 A;  4BZA A;  1XLP A;  1JRP A;  3N1Y C;  4W9G A;  1QOF A;  2UU7 A;  5HFY A;  3I63 C;  3AEA B;  4ITK A;  2QIE B;  2G3Q B;  1NEK B;  3W1Y A;  5KHO A;  1MG8 A;  4HWI B;  2ZZP B;  4LTU A;  2L3Z A;  3QWZ B;  2M17 A;  2PLP A;  2PEA A;  1K8R B;  3EFU A;  1SJH D;  4OW0 A;  4CYE A;  4NAM A;  3Q3F A;  2PE6 B;  1KF6 B;  1QZE A;  1B9R A;  2UWQ A;  1ROE A;  2M19 A;  1K53 A;  2N9E B;  1E8W A;  4MH8 A;  3SDL C;  3IHP C;  3ZKJ C;  2KDI A;  2DZJ A;  2LEK A;  1GB4 A;  1F0Z A;  2J53 A;  5CHW A;  3DVN U;  1G6J A;  3AH7 A;  5FK9 C;  3ZGZ A;  4TKN A;  3A1Q A;  4XWT A;  3C19 A;  1T0R C;  1MJD A;  2I38 A;  4TV3 A;  1JRU A;  3NS8 A;  3BII D;  4TUU A;  1ESF A;  3ZUN A;  2IZV B;  1FXI A;  1JML A;  2LWP A;  3PRM B;  4ZRQ A;  4BKS D;  4KV2 A;  4K7W A;  1L4Z B;  1YN4 A;  3KVF B;  2LGI A;  2WXF A;  4ZHP A;  3KQ4 A;  4IM3 A;  3RPF C;  4TSS A;  3U2S C;  3UI3 A;  1D5X C;  4WWP A;  4WAA A;  2IY0 B;  1KFY B;  2NTT A;  4NAW B;  4GMV A;  1LO5 D;  4BKG A;  2G1E A;  1PFD A;  1V49 A;  1TY0 A;  2G4S A;  3ALB A;  2W3R A;  3AV8 A;  2KTR A;  2RMM A;  1FXT B;  3MJW A;  4YTP B;  1N6Z A;  1ISN A;  3A9J A;  3CF6 E;  2RSU A;  3A9K A;  2CU3 A;  1CJE A;  4BOZ B;  2DWQ A;  2NVU I;  4N59 A;  4KKI A;  3W9C B;  1SE9 A;  5HHD G;  4YTM B;  1KM7 A;  4G0N B;  1YMH E;  3A4R A;  4P6V F;  4YSZ B;  4FXC A;  5CX3 A;  1E6E B;  1HEZ E;  3URY A;  2DNF A;  2NCN A;  1V5T A;  2H89 B;  1OFF A;  5J2R A;  2L76 A;  3CMM B;  2KDE B;  1N5W A;  3P4P B;  3L10 B;  2HE7 A;  5AEK B;  4OZB A;  4KZC A;  1WI0 A;  5CTR C;  3DHG C;  3U30 A;  3ZLZ A;  2NR2 A;  2N7E A;  2GBM A;  3ZNG C;  2E6X A;  3M63 B;  4RGT A;  4CO7 A;  1SXT A;  2D3G A;  2W55 A;  1UD7 A;  4PS7 A;  4USA A;  5DPS A;  2DYO A;  3P42 A;  4MGZ E;  1QT9 A;  3IAM 1;  2J0K A;  4Q2J A;  3O65 B;  4LNN A;  3VFK A;  1HA5 A;  2ZPY A;  1I4H A;  4UDU C;  4JQW C;  3UIP B;  3VH4 B;  2PE9 A;  3W1S C;  2FCS A;  3R8B A;  1ZP0 B;  2M0X A;  3P4R B;  2Z8L A;  4F1S A;  2KJ6 A;  2OJR A;  3GP7 A;  4E71 A;  2LGS A;  1HTQ A;  4LDT D;  2ICI A;  1JWU D;  1LXD A;  4DDI D;  4FJV B;  1SB3 C;  1T0Y A;  1XD3 B;  2XBB C;  3W5U B;  1TZ1 A;  2KK8 A;  4JE3 B;  2IGH A;  2KD0 A;  1J7B A;  1Q0W B;  3ZJV A;  1ZDX A;  3A1Q B;  2CHZ A;  4RM8 A;  1ZOY B;  5EE0 A;  4XC2 A;  4HKZ E;  3R7R A;  1R7S A;  3KLS X;  2J0M A;  4A6Q A;  2KC2 A;  2KFJ A;  5E6N A;  1J8C A;  3W1S A;  1VCB A;  1WXV A;  3PLV A;  4QAY A;  2BF8 B;  4WUR A;  2JT4 B;  3MHS D;  3O13 A;  4KGR A;  3ZNZ B;  2L00 B;  3B08 A;  4XWW A;  2YLM A;  2KZR A;  3MC9 A;  4WJP A;  3SHQ A;  1VJK A;  4IDI A;  1PDX A;  3ZTD A;  3NVZ A;  5G5H A;  1P7E A;  3L4P A;  3HVZ A;  3OJ4 B;  4PYZ A;  2WLB A;  5FR6 A;  3DCG A;  4LJP B;  3ENE A;  2BBC A;  2WXL A;  1IBX A;  2WDQ B;  4JPS A;  1WGG A;  5KHQ A;  1WXA A;  2K22 A;  1HZ6 A;  1ZXI A;  1F1H A;  1ZXH A;  3V6E B;  1TBE A;  1CQV A;  2GOW A;  3T8M A;  2BGF A;  3TEZ A;  1F2R C;  2KTR B;  1A5R A;  2UYZ B;  1HE8 A;  3EA6 A;  1L0V B;  2IO2 B;  4DXG A;  1JQ4 A;  1IUE A;  3A9J B;  1V86 A;  1IGD A;  2LHE A;  3A9K B;  1QQR A;  4HRS A;  2I1J A;  1UNS A;  1KLG D;  1FCC C;  4W9I A;  1RM6 C;  2HTH A;  4S17 A;  1Y56 A;  4AWJ A;  2JYE A;  4HPP A;  1LM8 B;  2WXK A;  2JY6 A;  3HVD A;  5JHA A;  2VH2 A;  4J3O D;  3NVY A;  4ANX A;  4EEW A;  4ARI A;  2EMS A;  2MBB B;  1FEH A;  3EHV A;  3MC8 A;  1HQR D;  5IO9 A;  2K5P A;  1SEB D;  3VHT C;  4G3X B;  1M94 A;  3U4E G;  1IGC A;  3UQA A;  1AAR A;  2L7R A;  4AJY B;  1KLU D;  1NVI D;  3OG5 A;  5BO4 B;  4US9 A;  2WU2 B;  4B0M A;  4LNK A;  4A8X C;  3BWU D;  3PGE A;  1X1M A;  3ML8 A;  1E7U A;  2XK5 A;  1LGR A;  2L52 A;  3HM3 A;  5D2M B;  1EM7 A;  1YN5 A;  4LNF A;  3NY5 A;  3P4Q B;  5HI1 A;  1HXY D;  5AZF A;  3AEE B;  2MP2 A;  1AWD A;  3H6N A;  3N9Y C;  1V8C A;  1SE2 A;  1E8Y A;  2N0S B;  4AUQ C;  1RFA A;  2OOB B;  1YQ3 B;  2CR5 A;  1HZ5 A;  4EKU A;  4MSM B;  3BVG A;  4F7Z A;  1C77 A;  1V97 A;  2WXO A;  4RM9 A;  1RFK A;  2MJD A;  4M00 A;  1NI2 A;  2AL3 A;  2HD5 B;  3DDC B;  2CKH B;  2MSE D;  3VR8 B;  1C4P A;  4HEA 1;  1S3S G;  4JGH B;  1YN3 A;  1K50 A;  4IM2 A;  2KAJ A;  4KIK A;  2W3S A;  1XO3 A;  1UEL A;  3UIO B;  2VZK B;  3H8H A;  4DWF A;  3ZJT A;  1YX6 B;  2MH7 A;  4MEM A;  3ZRF A;  2Z59 B;  2JX5 A;  2ONQ A;  1E90 A;  3TL5 A;  5CHF A;  4KX6 B;  1C4C A;  3A4S C;  2R2O A;  1WGK A;  1V1O A;  3WCQ A;  3AE4 B;  4G50 A;  3ZNH B;  2K6Q A;  1VZ6 A;  2DYB A;  4AOF A;  1WFY A;  1V80 A;  1EF1 A;  3VR9 B;  1QIL A;  2FIF A;  1N63 A;  3UGB B;  3BIN A;  3IT6 B;  4N58 A;  2LVQ A;  4WIP A;  3AMZ A;  3V3X A;  5HG2 A;  3QC8 B;  2PKO A;  3N32 A;  4YT0 B;  2M1M A;  1TS3 A;  2MA9 B;  4OVU A;  1UBI A;  1P9D U;  1EF5 A;  3EEC A;  2KJH B;  1KLV A;  4RMA A;  1IBX B;  1AN8 A;  1WH3 A;  3AEF B;  1NBF C;  4FJY A;  5AUI A;  1HTO A;  3DQV A;  2CHW A;  3D32 A;  3VQI A;  3EFC A;  3MTN B;  3TSS A;  3PRZ A;  4W9E A;  3X23 A;  2KKC A;  1YX5 B;  5JHB A;  2SEB D;  5TR5 A;  2M8S A;  3APC A;  2WXJ A;  4ICV A;  4F8C B;  3UF8 A;  1F2R I;  2RGF A;  4KVG B;  1PYW D;  1GAQ B;  1FRR A;  1IP9 A;  1JRO A;  4GDK A;  3DWM A;  3IT4 B;  5G5G A;  4TQ0 A;  4AP4 C;  4P16 A;  4ZRP A;  1E7V A;  4RGM A;  3FKY A;  2C7H A;  3ZQ4 A;  5IA7 A;  1SIF A;  2OED A;  3APD A;  4DK5 A;  5C3J B;  1V9J A;  4IWO A;  4JL9 A;  1FM0 D;  3DVN V;  5E6P A;  1GC7 A;  2KDM A;  3KWV A;  3ZVV A;  1ACC A;  4ICU A;  1FRD A;  2NPT A;  4LNO A;  1BXT A;  2KHW B;  3Q8F A;  4XX5 A;  4EE2 A;  2KWV B;  3AN1 A;  2XK5 B;  3HUI A;  3R2T A;  1B1Z A;  1R4N I;  3NZS A;  4OZA A;  3A33 B;  3KYC D;  3RNC C;  1AW7 A;  1ET6 A;  2D3A A;  5I4D A;  2MP2 B;  3NG0 A;  4KZ0 A;  1I35 A;  2GB1 A;  4EZL A;  1WM3 A;  2CJO A;  1U4A A;  4B6W A;  1PQS A;  2LGY A;  3E9S A;  1OQQ A;  4KDI C;  2JZP A;  1C9F A;  2ZW0 A;  1Z2M A;  2W9N A;  2BS2 B;  3AE5 B;  2KLC A;  3BY4 B;  5DPR A;  2YEP F;  3L17 A;  4AQ7 A;  3N1X C;  3W5V B;  3VAW A;  1T5X D;  1F9J A;  3LJ3 A;  3Q3M C;  3KUZ A;  2M56 B;  4OHJ A;  2VZK D;  1UF0 A;  3E56 A;  4I6P A;  3Q8C A;  3Q8B A;  2YVC A;  2LGX A;  2J52 A;  3RFZ B;  2WXM A;  3VTW A;  1L7Y A;  1R4N B;  1WXM A;  2IJ0 A;  3HHM A;  4HK2 A;  2ASQ A;  2AQ3 B;  2K3U A;  2R61 A;  1P0R A;  1D3Z A;  4LDT B;  3QHT A;  2CHX A;  2LJ5 A;  3M3J A;  4KIK B;  4NPN A;  2MJE A;  2WXQ A;  3RD2 A;  3U8Z A;  2H88 B;  1WM2 A;  1ZKH A;  2KOX A;  3P63 A;  3AE7 B;  5BYQ A;  2MBE A;  1NYQ A;  1FNU A;  2KAC A;  1ZW7 A;  2Y5B B;  2G45 B;  2DBY A;  2MBO A;  2FNJ B;  1ZE3 D;  2BS4 B;  3TUO A;  5LXH A;  1CK1 A;  2GBK A;  4MGK E;  2LMC A;  4GOC A;  3NVV A;  1UWX A;  1Q5W B;  1XCQ L;  5JXV A;  2PMV A;  2IO1 B;  1C3T A;  2FE8 A;  2E3T A;  3NVW A;  3R7Q A;  4GU2 A;  1VDV A;  3M62 B;  1V6E A;  3N1Z C;  2WS3 B;  4ZRI A;  3NRZ A;  4P7I A;  1L5P A;  3PZD A;  2OHF A;  3IVF A;  2MCN B;  1OEY J;  3ML9 A;  1XLN A;  2IPK D;  1MI0 A;  4A3P A;  2L0F A;  3HIZ A;  3DBS A;  2D3C A;  4A3O A;  2GLS A;  5IP4 D;  5T8I A;  2L1A A;  1UWM A;  4KKJ A;  3RI7 C;  4MSQ B;  2DAF A;  2KVZ A;  3ZW3 A;  3DVG X;  1WWT A;  2LGD A;  3RYT A;  3X0W A;  2Y5P A;  2O6V D;  2C7M B;  1TTN A;  3APF A;  4FLH A;  1L6V A;  3B2F A;  4XDC A;  2ON8 A;  4GDK B;  4FAD A;  3V6C B;  1E8Z A;  1YQ4 B;  3H7P A;  2LVP A;  3L08 A;  4HRO A;  2JVC A;  1MFW A;  2KFK A;  2ACZ B;  2EKI A;  4GGQ A;  3UIN B;  1J7C A;  4REZ A;  1TS5 A;  3VTU A;  4W9K A;  4L1B A;  4JIO U;  3WAL A;  2LUM A;  2RPV A;  3EGR A;  4I6L B;  2BT6 A;  2MHJ A;  2JF5 A;  3SD5 A;  3NZ3 A;  2NPT B;  2GMI C;  2C5L C;  4MM3 A;  4YXD B;  3CIR B;  5HKH A;  4GXB A;  4WJO A;  4W9D A;  1DOY A;  3SEB A;  3SR6 A;  2QC8 A;  3DVG Y;  5G55 A;  2HDE A;  4BVU C;  3ZO5 B;  4IKG A;  5BMG A;  4ZDV A;  2ZJD A;  1IPG A;  2V0G A;  4M8N A;  2BB5 A;  1H8C A;  3I9V 1;  5FR3 A;  4HJG E;  1EU3 A;  4ASW C;  1UGJ A;  1WMH A;  3OAW A;  2L05 A;  3C8Y A;  3VTV A;  3WIM A;  1Q1O A;  5EDS A;  2LI5 A;  1I4R A;  1SBB B;  3AE1 B;  2LAS A;  1KOT A;  2FCQ A;  3V62 A;  4K3C A;  2DLB A;  4XYC A;  1C78 A;  4FUL A;  4W9J A;  1NYR A;  2GRI A;  2MEK A;  3ABV B;  4C56 C;  3Q8E A;  4HCP B;  2JRI B;  1WGR A;  1XCT L;  1YJ1 A;  3QQ8 B;  1IYF A;  4KSL C;  2BW2 A;  1I4X A;  1T6B X;  2DAJ A;  3PPA A;  3AXC A;  2INC C;  3ETR A;  3S2A A;  5IKC M;  2J0J A;  3BYY B;  2KAN A;  4GN1 A;  1RLF A;  2AQ1 B;  1WJU A;  4MGY E;  1GG3 A;  3BVM A;  4K7S A;  4BBN C;  1XQQ A;  2BYT A;  3ZIM A;  3VRA B;  1Z5S B;  4IM0 A;  2W54 A;  4EOY A;  1P7F A;  3DBR I;  4NZL B;  1JAL A;  1GC6 A;  1QKZ A;  4M0W A;  3RN9 C;  4ANU A;  1I4Q A;  3PRE A;  1D6E C;  4FHK A;  4EZJ A;  4PK1 A;  3AU4 A;  4NNJ B;  3Q14 C;  1I7H A;  3HM6 X;  3IXS A;  4HPM B;  2AQ2 B;  1VLB A;  2FUG 1;  4ZYN A;  2K9X A;  1E0Z A;  4IC7 B;  1PGA A;  1TS4 A;  4XZ4 A;  3SU8 X;  3AE2 B;  4NY0 A;  3DWG C;  3AU5 A;  2EKE C;  5LLI A;  3AM9 A;  3GB1 A;  2MW5 A;  2N7J A;  1J0G A;  2Y5C A;  1K51 A;  1JWA D;  1XXG A;  1E9M A;  2JZ3 B;  1WSP A;  4MH0 E;  3DBR B;  5G2N A;  1FXA A;  3VDZ A;  5MPO A;  4ANV A;  2N7D A;  2FCN A;  4DHZ B;  3CST A;  2L8J A;  4OVZ A;  1AYF A;  2ZNV C;  1V1P A;  3AE3 B;  3QJZ A;  3ZXV A;  1SE3 A;  1FPY A;  2RDG A;  3TJP A;  1WZ3 A;  2CU1 A;  2WDV B;  2FBW B;  2ZPN A;  2BYV E;  4RNA A;  2DZM A;  1I4P A;  2O6V A;  3H7P B;  4AS1 A;  2KFK B;  4US8 A;  3GE3 C;  3W2D A;  2K1F A;  5DPW A;  2DZI A;  3FIL A;  1GPX A;  4II3 B;  2IGG A;  4HDQ A;  3LYY A;  4HVB A;  4CQN A;  1FMA D;  3RNA C;  1FO4 A;  2KQS A;  3PTF C;  1M4V A;  4LCD E;  1FD6 A;  3AEB B;  2BWF A;  2KN4 A;  2KWU B;  2KMM A;  3EC8 A;  2IND C;  1SIJ A;  4MM3 B;  4KSK C; 
#chains in the Genus database with same CATH homology
 2RGF A;  3GZN I;  4NAW B;  4GMV A;  4KVG B;  4BKG A;  2IBI B;  4KDL B;  2NBU A;  2LXC A;  1IP9 A;  4GDK A;  3AI5 A;  3JVZ X;  2EMT A;  4TQ0 A;  4AP4 C;  3L16 A;  1E7V A;  5D6J B;  1GNU A;  1V49 A;  2G4S A;  3ALB A;  3HK0 A;  4JLC A;  2C7H A;  5IA7 A;  2KTR A;  1SIF A;  1FXT B;  3MJW A;  2BYE A;  3APD A;  4DK5 A;  3DPD A;  3QAQ A;  1ISN A;  3A9J A;  3CF6 E;  3GOE A;  4YL8 A;  2RSU A;  2IO3 B;  3A9K A;  1V9J A;  4IWO A;  4JL9 A;  3DVN V;  5E6P A;  1GC7 A;  3JSV A;  3WAM A;  4BOZ B;  1I42 A;  2NVU I;  3ZNI D;  3ZVV A;  1WX9 A;  3KYD D;  1WMH B;  1R4M I;  4ICU A;  2NPT A;  1OEY A;  4GDL A;  1SE9 A;  1YD8 U;  2KHW B;  1KM7 A;  1UGM A;  2FAZ A;  3B0A A;  4XX5 A;  4G0N B;  2KWV B;  4K81 A;  2KDB A;  2RD0 A;  3A4R A;  4BKT A;  1GUA B;  4FA6 A;  2C60 A;  2XK5 B;  2REX A;  5CX3 A;  1R4N I;  3NZS A;  3A33 B;  3KYC D;  4BKS A;  1P3Q U;  4X57 B;  3DOW A;  3ECI A;  2RPQ A;  4B95 A;  2MP2 B;  1ZGU B;  2NCN A;  4IG7 B;  1WRD B;  4KZ0 A;  1I35 A;  1V5T A;  3T9L A;  2JZZ A;  1WM3 A;  4EZL A;  2K8B A;  2IY1 B;  2MWS B;  1U4A A;  4B6W A;  1PQS A;  2LGY A;  2R2Q A;  2WDT B;  5AZG A;  4KDI C;  4J6I A;  1WGD A;  4K1R B;  2BKF A;  4DHZ E;  4HPL B;  1Z2M A;  2W9N A;  5J2R A;  1OQY A;  2L76 A;  3CMM B;  2KDE B;  2JPH A;  2KLC A;  3BY4 B;  3CSF A;  5DPR A;  2KQ7 A;  3PRP B;  3H9D A;  3L17 A;  1NDD A;  2HE7 A;  1H4R A;  3L10 B;  2K6D B;  3ONS A;  2C7N B;  4B9K A;  3VAW A;  5AEK B;  5L95 C;  1F9J A;  4FBJ B;  2O2V A;  3LJ3 A;  3PHX B;  3KUZ A;  4KZC A;  1WI0 A;  5CTR C;  2IYD B;  4G11 A;  3B1L X;  4I6P A;  3U30 A;  3ZLZ A;  2ZCC A;  2NR2 A;  3DBL I;  2YVC A;  4BFR A;  2N7E A;  2GBM A;  2BYF A;  2LGX A;  1WGH A;  2DZK A;  3ZNG C;  3VTW A;  2FCM A;  1L7Y A;  1WXM A;  1XT9 B;  2AEH A;  2KJR A;  2MRP A;  3M63 B;  3NOB A;  4CO7 A;  3HHM A;  4HK2 A;  4MJS A;  2ASQ A;  1D3Z A;  2KN5 A;  1P0R A;  3PT2 B;  4DHJ D;  4LDT B;  4WJN A;  2GBJ A;  2LJ5 A;  2CHX A;  2D3G A;  3M3J A;  1UD7 A;  2DYM A;  3QHT A;  4KIK B;  2DYO A;  4M0W B;  3R3M A;  4NPN A;  4PS7 A;  4MGZ E;  3RD2 A;  3U8Z A;  4ZRK A;  1WJN A;  2J0K A;  3RZF A;  3O65 B;  3WA0 A;  3P2B A;  3VFK A;  3ZDT A;  1WM2 A;  2ZPY A;  1ZKH A;  4DXA B;  3RUL A;  4JQW C;  2KOX A;  4W9F A;  3UIP B;  3VH4 B;  3QAR A;  1WF9 A;  2PE9 A;  2MBE A;  3WAO A;  3W1S C;  4HJK A;  3WAN A;  4OVV A;  2FCS A;  1ZW7 A;  2M0X A;  2G45 B;  2Y5B B;  2XEW A;  3QCA A;  3NZU A;  2MBO A;  2FNJ B;  2K8H A;  4F1S A;  2KJ6 A;  2OJR A;  2PJH A;  3L54 A;  4E71 A;  5LXH A;  4HCN B;  2DHZ A;  4LDT D;  2V1Y A;  4MGK E;  2GBK A;  1LXD A;  1WXS A;  3PS6 A;  3QK0 A;  4DDI D;  3VXW A;  4AJW A;  1L2N A;  4FJV B;  5L83 A;  4GOC A;  3V60 A;  2A4Z A;  2RR9 A;  1T0Y A;  1XD3 B;  2KDF B;  2XBB C;  5CHV C;  4HDO A;  3VUY A;  1Q5W B;  4IWP A;  1TZ1 A;  5DPS A;  2KK8 A;  2IO1 B;  1C3T A;  2ZVN A;  5AZH A;  3OJ3 A;  4E74 A;  4ZRJ A;  4MDK E;  5LXI B;  2KD0 A;  2KWC A;  2MBQ A;  1Q0W B;  1E8X A;  5J17 A;  4W9L A;  4WWO A;  2N9X A;  4MGI E;  2WX0 A;  1WR1 A;  2BWE S;  2LVO A;  3PHW B;  3R7Q A;  4GU2 A;  1V2Y A;  3M62 B;  1YIW A;  3A1Q B;  2D11 A;  2CHZ A;  4RM8 A;  2KVR A;  4XC2 A;  1V6E A;  1OGW A;  4ZRI A;  4PS3 A;  2VRR B;  3R7R A;  2FID A;  2G4D B;  4P7I A;  2K8C A;  2LD9 A;  5C1Z A;  2V3S A;  2O6V B;  3C0R B;  2J0M A;  3PZD A;  1E5W A;  2KC2 A;  3IVF A;  3LDZ E;  2MCN B;  1OEY J;  3ML9 A;  4DBG A;  2KFJ A;  1EO6 A;  5E6N A;  3NHE B;  3PVL A;  4A3P A;  2KX0 A;  3W1S A;  2K25 A;  2L0F A;  3HIZ A;  1J8C A;  1VCB A;  1WXV A;  2KC1 A;  3KW5 B;  3DBS A;  3QA8 A;  3PLV A;  4A3O A;  1WIA A;  4I6N B;  2GBN A;  2KLG A;  1WGY A;  2ZEQ A;  1WY8 A;  2BF8 B;  4MSQ B;  2JT4 B;  2DAF A;  3MHS D;  3ZNZ B;  4HXD A;  1OTR B;  3ZW3 A;  2L00 B;  3B08 A;  2YLM A;  2KZR A;  1V5O A;  5D7G A;  4WJP A;  2MX2 A;  3SHQ A;  3DVG X;  2LGD A;  2NS5 A;  4NQL B;  3ZTD A;  3RYT A;  3X0W A;  2MBH A;  2J7Q B;  2O6V D;  2C7M B;  1TTN A;  4E3C A;  3OJ4 B;  3H7S A;  3APF A;  4FLH A;  4PYZ A;  2N1W A;  5FR6 A;  3DCG A;  1P98 A;  3ENE A;  4LJP B;  1WX8 A;  4GDK B;  4FAD A;  3V6C B;  1E8Z A;  3OLM D;  3H7P A;  2D2Q A;  2LVP A;  3L08 A;  3Q3J A;  2JVC A;  3RCZ A;  1CMX B;  2KFK A;  1WGG A;  5KHQ A;  1WXA A;  2ZNV B;  4GGQ A;  3UIN B;  3K9P B;  3V6E B;  4W9H A;  4EZK A;  1TBE A;  1V81 A;  2CS4 A;  2GOW A;  2JWZ A;  4PS8 A;  3T8M A;  3VTU A;  2BGF A;  2KTR B;  4W9K A;  1A5R A;  4LJO B;  2UYZ B;  3UQB A;  1HE8 A;  2IO2 B;  3A9J B;  1Y8R C;  1V86 A;  2NBW B;  3A9K B;  2KTF A;  2K39 A;  4FHJ A;  4JIO U;  2LZ6 A;  3JSV B;  2I1J A;  4BOS C;  3WAL A;  1WJ6 A;  2JRH A;  3QIJ A;  2ZVO A;  2ZCB A;  4W9I A;  1BT0 A;  4I6L B;  2HTH A;  3QX1 A;  2JF5 A;  3KH0 A;  3SD5 A;  1GJZ A;  4GSW A;  4IW0 A;  2NPT B;  2GMI C;  4AWJ A;  4GDL B;  2M4N A;  2C5L C;  4MM3 A;  3I3T B;  1LM8 B;  3IG3 A;  3PV1 A;  3VUW A;  2JY6 A;  5JZE B;  4NAW A;  5HKH A;  5JHA A;  4GXB A;  4WJO A;  4W9D A;  4ANX A;  4M8M A;  4EEW A;  4FJZ A;  4II2 B;  5D94 A;  2KNB A;  3DVG Y;  2BPS A;  4K7U A;  5G55 A;  3KUD B;  3RT3 B;  1LFD A;  4A20 A;  2EMS A;  2MBB B;  2AL6 A;  4BVU C;  3ZO5 B;  2Z0E B;  5C23 A;  3EHV A;  4ZDV A;  2JUO A;  4TQ1 A;  3IBE A;  1RRB A;  2ZJD A;  1IPG A;  2L0T A;  4IUM B;  4M8N A;  1H8C A;  2AYO B;  5J18 A;  3VHT C;  3JW0 X;  4EFO A;  2IO0 B;  4G3X B;  3U7D A;  1M94 A;  3UQA A;  4NQK E;  1AAR A;  2KMA A;  4ASW C;  2L7R A;  4EUT A;  4AJY B;  1WMH A;  4BBN F;  3OAW A;  4ANW A;  2L05 A;  2DX5 B;  5BO4 B;  1WX7 A;  2O2V B;  2Z0D B;  1S1Q B;  3VTV A;  3WIM A;  3PGE A;  1WYW B;  1X1M A;  1Q1O A;  5EDS A;  3VUX A;  2LI5 A;  4PYU A;  3ML8 A;  2WWZ A;  1E7U A;  2A5U A;  2LAS A;  2XK5 A;  1KOT A;  3HM3 A;  5D2M B;  2FCQ A;  2LXA A;  3V62 A;  3NY5 A;  5IAA C;  3DBH I;  1WE7 A;  4CHK A;  5AZF A;  1EUV B;  2MP2 A;  4MJS B;  4NJ7 A;  2WYQ A;  3H6N A;  3TIX A;  3R66 C;  4FUL A;  1J19 A;  4W9J A;  2HJ8 A;  2B3A A;  4MEL A;  1E8Y A;  3AUL A;  4AUQ C;  1P1A A;  4HCP B;  2KXJ A;  2JRI B;  1WGR A;  1RFA A;  2OOB B;  1RAX A;  1YJ1 A;  2CR5 A;  3QQ8 B;  1IYF A;  4KSL C;  4EKU A;  2WX1 A;  2QHO A;  4MSM B;  4N9F 4;  4F7Z A;  2DAJ A;  3PPA A;  3RZW C;  5JH5 C;  3AXC A;  2AWT A;  3V61 A;  3S2A A;  2MQJ A;  3L0W B;  2N4F A;  2J0J A;  2KAN A;  4GN1 A;  2KX3 A;  4RM9 A;  1RLF A;  2D07 B;  1YQB A;  1SGH A;  1WJU A;  2KO3 A;  5GMV A;  4HLE A;  4MGY E;  1NI2 A;  1GG3 A;  2AL3 A;  2HD5 B;  2N9P C;  3DDC B;  4WQO B;  4K7S A;  2CKH B;  2JXX A;  2MSE D;  3L13 A;  1S3S G;  3PLU A;  4BBN C;  4JGH B;  1XQQ A;  3ZIM A;  3N3K B;  3IFW B;  1WE6 A;  1Z5S B;  2C9W B;  4IM0 A;  4EOY A;  3DBR I;  1UZX B;  4IM2 A;  3N30 A;  1GC6 A;  4WJQ A;  4KIK A;  1VD2 A;  4ANU A;  4DDG D;  3PRE A;  1KJT A;  1TGZ B;  4FHK A;  4EZJ A;  5DPT A;  1C1Y B;  1UEL A;  3UIO B;  3AU4 A;  4NNJ B;  2GBR A;  3HM6 X;  4HPM B;  4DWF A;  1WZ0 A;  1YX6 B;  2NBV B;  2D10 A;  4W9G A;  4ZYN A;  4NJ6 A;  4IC7 B;  4MEM A;  4XZ4 A;  3JYU A;  3ZDM C;  3ZRF A;  3SU8 X;  2Z59 B;  4NY0 A;  2I1K A;  3RUI B;  3K9O B;  1LQB A;  3AU5 A;  1E90 A;  3TL5 A;  2EKE C;  3WAP A;  3TBL D;  2G3Q B;  5LLI A;  2LUE A;  3W1Y A;  5CHF A;  5KHO A;  2LRW A;  1MG8 A;  2MW5 A;  1J0G A;  4DHJ B;  4HWI B;  2ZZP B;  3VVW B;  2L3Z A;  3QWZ B;  2M17 A;  3A4S C;  2R2O A;  2PEA A;  1K8R B;  3EFU A;  4CYE A;  4G50 A;  5DCN A;  3ZNH B;  3Q3F A;  2JZ3 B;  5G2N A;  2PE6 B;  4MH0 E;  1QZE A;  2K6Q A;  2UWQ A;  2DYB A;  3VDZ A;  4WWN A;  5E6O A;  4AOF A;  3H1U A;  2N9E B;  1WFY A;  1V80 A;  1EF1 A;  1E8W A;  3ZTC A;  3SDL C;  3IHP C;  3ZKJ C;  4URK A;  4ANV A;  3TCA A;  2KDI A;  2N7D A;  2DZJ A;  2FIF A;  2FCN A;  3UGB B;  4DHZ B;  3CST A;  2L8J A;  4FN2 A;  3BIN A;  2LVQ A;  2ZNV C;  5CHW A;  3DVN U;  2LRU A;  1G6J A;  3QC8 B;  3QJZ A;  3M95 A;  3N32 A;  2M1M A;  4TKN A;  3A1Q A;  4GIV A;  2MA9 B;  4OVU A;  3TJP A;  1UBI A;  1P9D U;  1WZ3 A;  2CU1 A;  2N1V A;  1UH6 A;  1EF5 A;  4W9C A;  4IWQ A;  2ZPN A;  3EEC A;  2BYV E;  2DZM A;  2O6V A;  3H7P B;  2KJH B;  1KLV A;  4RMA A;  4GB9 A;  4TV3 A;  1JRU A;  3NS8 A;  2KFK B;  2FUH B;  3PSE B;  4TUU A;  3ZUN A;  2IZV B;  3KUC B;  2PPH A;  1WH3 A;  2K1F A;  1NBF C;  1UBQ A;  2MLB A;  5DPW A;  4FJY A;  2LWP A;  3PRM B;  4BKS D;  2DZI A;  4KV2 A;  4K7W A;  3ZRC A;  4II3 B;  2DEN B;  4HDQ A;  3DQV A;  3TMP B;  2CHW A;  3D32 A;  3KVF B;  3VQI A;  4HVB A;  1WJ4 A;  3MTN B;  2V4L A;  3PRZ A;  1WR6 E;  2BKR B;  2KQS A;  3PTF C;  4LCD E;  4IM3 A;  4W9E A;  3X23 A;  2KMC A;  2KKC A;  1YX5 B;  5JHB A;  5TR5 A;  2BWF A;  2M8S A;  3APC A;  2KWU B;  3EC8 A;  4WWP A;  4WAA A;  4ICV A;  4KSK C;  3VH3 B;  2IY0 B;  4F8C B;  3UF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...