5CHFA

Crystal structure of murine isg15 in space group p21212
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
149
structure length
149
Chain Sequence
AWDLKVKMLGGNDFLVSVTNSMTVSELKKQIAQKIGVPAFQQRLAHQTAVLQDGLTLSSLGLGPSSTVMLVVQNSSEPLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQFWLSFEGRPMEDKELLGEYGLKPQCTVIKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of murine ISG15 in space group P21212
rcsb
source organism Mus musculus
molecule tags Antiviral protein
molecule keywords Ubiquitin-like protein ISG15
total genus 38
structure length 149
sequence length 149
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5chfA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5chfA01
3A1QA 4PYUA 1IYFA 1Q5WB 2JWZA 2D3GA 1R4NI 3EHVA 3HIZA 4AJYB 4BFRA 5DPWA 3ZO5B 3ZW3A 5KHQA 1E8YA 1UELA 2JF5A 4NPNA 4XZ4A 1ZW7A 4FJVB 3OJ3A 3VXWA 4WJPA 3NOBA 5AZHA 2PE9A 4FJZA 1E7UA 1WYWB 4G3XB 4ASWC 2PJHA 4K81A 3R66C 3VH4B 5E6PA 3DCGA 3A9KB 4TQ0A 2MRPA 2WDTB 3MTNB 2NVUI 2Z59B 2KQ7A 2NPTA 2K39A 3DDCB 1TGZB 3IHPC 4K1RB 2LD9A 4F7ZA 1J19A 3HM3A 4ZRJA 5G55A 4TV3A 4BBNF 3RT3B 1Z5SB 4W9IA 3AI5A 4B6WA 4M0WB 4HDQA 2LI5A 2MA9B 1WJ4A 2MP2B 2BWES 2MP2A 2KDIA 2MBHA 5LXHA 4FHJA 2G4DB 1OEYJ 2KOXA 1V6EA 3A4SC 2Z0DB 5EDSA 4FHKA 4K7UA 1VD2A 3ZUNA 3OAWA 1XQQA 2IY1B 3DVGX 3X0WA 3ZNZB 4DHJB 1LQBA 2CHXA 3NY5A 4BKGA 1E90A 3C0RB 1WE7A 1UZXB 2KWUB 2KNBA 3CSTA 4II2B 4BKTA 2BYVE 4HVBA 3H7SA 4FJYA 1Q1OA 1H4RA 3ECIA 5C23A 4EUTA 2KWVB 2G4SA 2KFJA 3A9JB 3SU8X 2KK8A 2JY6A 1BT0A 3L0WB 3U8ZA 1S3SG 2LWPA 2O2VB 3NZSA 5G2NA 4W9DA 3UGBB 1P98A 2DAJA 4MJSA 1GUAB 3MJWA 1RRBA 2I1KA 2WYQA 4II3B 2LXAA 3IG3A 1SIFA 2KC2A 3PS6A 4IWQA 1WZ0A 3PLUA 2R2QA 2V1YA 2M8SA 3A1QB 2YLMA 3VH3B 4WAAA 1AARA 3ALBA 1OGWA 2L0TA 4MGIE 4TKNA 2O6VD 1EF5A 4WWPA 1RLFA 4CHKA 2L0FA 2HJ8A 3KYDD 5DPRA 1WXVA 5IA7A 3GOEA 2M4NA 3QX1A 3WA0A 1ZGUB 5J18A 4GSWA 2KMCA 5JHAA 2O6VA 2FCQA 2OOBB 2PE6B 3VVWB 4PYZA 3K9OB 1GC6A 3ML8A 2RPQA 3ZNGC 1WF9A 3V6EB 3WALA 2I1JA 3M63B 3T8MA 4NQLB 5TR5A 2L8JA 1A5RA 4NY0A 3ZRCA 1WE6A 3TJPA 4MDKE 2NCNA 4AP4C 1GG3A 2K6DB 4FLHA 3KH0A 3VFKA 3NZUA 2K1FA 2LJ5A 2M0XA 4JGHB 5JHBA 4A3OA 2FIFA 4NAWA 1RFAA 2VRRB 2DENB 2GOWA 3L16A 4KV2A 4PS7A 3JW0X 2LUEA 2CKHB 2OJRA 4HK2A 1IP9A 3RZFA 2ZCBA 3V61A 3KYCD 3ENEA 1G6JA 1EO6A 2KWCA 4N9F4 3UQBA 3R7QA 4EEWA 2MSED 4E71A 3HHMA 2ZEQA 3ZVVA 2FIDA 2L05A 5LXIB 3KUDB 4LJPB 2DYBA 3PTFC 3RULA 3PRPB 3APFA 3UIPB 2LVOA 5J17A 4BOSC 4DXAB 2EMTA 4DBGA 1XT9B 5D6JB 3VAWA 4IC7B 1OEYA 1J0GA 5DPTA 2J0KA 2G45B 2JT4B 4X57B 2W9NA 4K7SA 5D94A 2GBJA 1WJNA 2NBWB 1WIAA 3VTUA 3UF8A 2C60A 3N3KB 4I6LB 2RSUA 4WWNA 2MBOA 1IPGA 3SHQA 4E74A 5CHVC 2K8HA 2KKCA 5E6NA 4DWFA 1D3ZA 4BKSA 5CHWA 4GN1A 1YQBA 3W1SC 2V3SA 3NS8A 2JVCA 3BY4B 4RM9A 1J8CA 2KTRA 2NBUA 2N1VA 2M1MA 2UWQA 1WRDB 1U4AA 4ZYNA 4DDID 1WM3A 2NS5A 3QJZA 4IM0A 4NAWB 3TMPB 1LM8B 1T0YA 3M62B 4A3PA 1WFYA 3IFWB 3DBSA 4LDTD 3ZTDA 1SGHA 4EZJA 3A4RA 4ANVA 4E3CA 3DVGY 3QA8A 4OVUA 3PRMB 1KLVA 2QHOA 3JVZX 3QC8B 2DYMA 2D2QA 4B9KA 1UH6A 2KLCA 4B95A 4KZCA 3M3JA 4W9EA 3HK0A 4JLCA 3WAOA 1RAXA 4MH0E 4TQ1A 4NQKE 4IUMB 2MBQA 2XBBC 3O65B 3AXCA 1YJ1A 3A33B 2C7NB 3L54A 3N30A 3IVFA 4TUUA 2R2OA 2XEWA 3DQVA 5L95C 1KOTA 2J7QB 1WZ3A 3ZIMA 3LDZE 3QQ8B 1NI2A 2ZZPB 4KVGB 4MGZE 3P2BA 3VUWA 3EC8A 4HPMB 3I3TB 3OLMD 4RMAA 3VTVA 4EFOA 2HD5B 3VDZA 2KJ6A 2XK5A 3H6NA 2K8BA 1YD8U 1WXSA 1PQSA 4GDLB 5D2MB 2KDBA 4GDKA 2C7MB 2N9PC 3KVFB 3V6CB 4K7WA 4DK5A 1WGYA 1KM7A 3U30A 3RD2A 2LXCA 2KO3A 4HDOA 2FCNA 2AL6A 1TZ1A 4WJOA 3APCA 2DX5B 1ISNA 4ZRKA 2GBKA 2KFKA 2N7DA 2ZNVB 3B0AA 1I42A 2WX1A 4WWOA 2HTHA 1UBQA 1OQYA 1Y8RC 1V5OA 2C7HA 3PVLA 2BYFA 4ICUA 4JIOU 4JL9A 3TL5A 1OTRB 1E8WA 1I35A 2J0MA 1HE8A 4AUQC 3CF6E 1QZEA 1WMHB 3RZWC 1WXAA 3TIXA 4ANXA 2DHZA 3UQAA 2LGDA 2IBIB 2PPHA 4MELA 1L7YA 2KZRA 3PV1A 1WX8A 4G11A 2BKRB 3IBEA 3L10B 3K9PB 3ZLZA 2IZVB 1UD7A 4HWIB 4FBJB 3PREA 1LFDA 2FUHB 3AU4A 5GMVA 5E6OA 3AU5A 4DHZB 3QWZB 4IWPA 2WWZA 4YL8A 3A9KA 5DPSA 1EF1A 4G50A 4MJSB 1EUVB 1XD3B 3WIMA 2A5UA 1JRUA 5HKHA 2ZVOA 4W9CA 1P1AA 2JUOA 5J2RA 1NBFC 4EOYA 3B1LX 5AZGA 3KUZA 3MHSD 3X23A 2LASA 2MBBB 2J0JA 3H7PA 1E5WA 2IO2B 4W9KA 4WJNA 1L2NA 3EECA 2MQJA 2GBMA 1GNUA 1UBIA 2JZZA 1ZKHA 2KLGA 3R3MA 3VUXA 3QIJA 3T9LA 4EZLA 2DAFA 4LDTB 3PLVA 3QK0A 2KDEB 2L7RA 4GDLA 4M8MA 3W1YA 4BVUC 2MCNB 2KTFA 2KJRA 3PRZA 3L08A 3VUYA 2C5LC 2G3QB 4GOCA 4XC2A 2GMIC 4MEMA 3DBHI 2LRWA 3QHTA 1TTNA 1WX7A 1X1MA 2KQSA 5DCNA 4LJOB 2ZNVC 4JQWC 1K8RB 4MGYE 3TBLD 4W9LA 3ZDMC 2BGFA 4KSLC 2JRIB 3DBRI 3W1SA 1YX5B 3NHEB 3ZKJC 3PHWB 3H7PB 4GXBA 1S1QB 3H9DA 2AL3A 2FCMA 2KX3A 2N4FA 2FCSA 3OJ4B 2LZ6A 4FADA 1YX6B 5BO4B 1Z2MA 3RYTA 5C1ZA 2LVPA 3PGEA 4GB9A 4IG7B 3S2AA 3ONSA 3UIOB 3VTWA 1GC7A 2DZIA 3D32A 2A4ZA 2MBEA 3ZDTA 3QARA 1TBEA 3DBLI 2DZMA 4OVVA 2EKEC 3ZTCA 4GDKB 2ZCCA 2CHZA 2IYDB 5L83A 4ANUA 4BOZB 1WXMA 1VCBA 2BF8B 2PEAA 1WR1A 3V62A 2KFKB 2KTRB 2MLBA 4KIKA 3QCAA 3PT2B 1F9JA 5D7GA 3DOWA 5FR6A 1WJ6A 2GBRA 5AZFA 2RD0A 4G0NB 2AYOB 2BPSA 2UYZB 1WH3A 3Q3FA 4FN2A 2CR5A 1LXDA 2ZJDA 1E7VA 2HE7A 4ICVA 2NR2A 4FA6A 5KHOA 5IAAC 1E8ZA 3QAQA 2D10A 2NBVB 2KVRA 3LJ3A 2D07B 2KANA 4FULA 3M95A 2JPHA 2FNJB 4HCPB 4XX5A 4DDGD 3Q3JA 2KHWB 4AOFA 4EZKA 5AEKB 5JH5C 4HPLB 3U7DA 2D11A 4CYEA 2K8CA 1P0RA 3KUCB 2RGFA 3WAMA 1C1YB 1P3QU 4BKSD 4PS8A 2DZJA 3N32A 2DYOA 2JXXA 4KZ0A 2IY0B 2KDFB 4CO7A 2LVQA 2REXA 4W9HA 4GGQA 2CHWA 2N9EB 4KDIC 3BINA 3DPDA 2WX0A 2XK5B 4PS3A 2K6QA 1V2YA 4AJWA 3JYUA 3DVNV 5CX3A 2L00B 3DVNU 3V60A 3APDA 3ZNHB 2N9XA 4WQOB 3RCZA 3KW5B 2DZKA 3WANA 2Z0EB 3PSEB 4URKA 2EMSA 1Q0WB 2JZ3B 3SDLC 4MGKE 4LCDE 4BBNC 4AWJA 5LLIA 3ZNID 4IW0A 4P7IA 4GU2A 1R4MI 3JSVA 3JSVB 2IO3B 4DHZE 2LGYA 2KXJA 4HLEA 2V4LA 2JRHA 2L3ZA 4HJKA 2CS4A 1FXTB 4ZRIA 5CTRC 3RUIB 4EKUA 4KIKB 1MG8A 2MX2A 1WM2A 3L13A 4KSKC 2MW5A 3CMMB 4IWOA 2IO0B 3R7RA 3WAPA 2KMAA 2K25A 4GIVA 2B3AA 3L17A 1WI0A 3H1UA 4A20A 2CU1A 4MM3A 1KJTA 2O2VA 2BWFA 4KDLB 4DHJD 1UGMA 2AWTA 4I6PA 2NPTB 2YVCA 3ML9A 3A9JA 1C3TA 4F1SA 1E8XA 4NJ6A 3TCAA 2BYEA 1WR6E 2KN5A 2ZPNA 4I6NB 4NJ7A 3VQIA 1H8CA 2L76A 4HCNB 4NNJB 2GBNA 1WGHA 4M8NA 1WGRA 1V81A 1SE9A 3B08A 3HM6X 4MSQB 3GZNI 1CMXB 2ASQA 1GJZA 2C9WB 2RR9A 3CSFA 4W9FA 1WGDA 2MWSB 4GMVA 4HXDA 2KD0A 4RM8A 4F8CB 1P9DU 3AULA 2LRUA 2BKFA 1V86A 1V80A 3EFUA 2ZPYA 1V9JA 3ZRFA 5JZEB 2O6VB 3PZDA 3SD5A 2KX0A 4ANWA 4ZDVA 1WJUA 2N1WA 3PPAA 3UINB 2LGXA 1WY8A 2FAZA 2ZVNA 2M17A 4IM3A 4MSMB 4W9GA 4IM2A 2KC1A 3PHXB 2Y5BB 4J6IA 4WJQA 1V5TA 1YIWA 1WX9A 2KJHB 5CHFA 1V49A 2IO1B 1M94A 1NDDA 1WGGA 1WMHA 4W9JA 3VHTC 2N7EA 2AEHA
chains in the Genus database with same CATH superfamily
3GP7A 3A1QA 4AJYB 4BFRA 1UELA 5BYSA 4FJVB 3OJ3A 3VXWA 2PE9A 2H89B 1EM7A 2D3BA 4G3XB 4YSYB 2PJHA 3R66C 3LB8C 3DCGA 2MRPA 3MTNB 2N7JA 2NPTA 2LD9A 1SEBD 1J19A 2OEDA 3CWIA 2K0PA 1T5XD 2MJEA 1QT9A 3VR8B 3V05A 5BYRA 4FHJA 1V6EA 1QOBA 2Z0DB 4WAFA 4JWUC 2RPVA 3OAWA 3W5VB 3AE8B 3C0RB 3CSTA 2KWUB 4HVBA 2BYVE 1Q1OA 3NZ3A 3ZYYX 1QILA 2INPE 3IXSA 1AYFA 2KWVB 2OJWA 4LNKA 2PKOA 3U8ZA 2QC8A 1QOFA 4ACFA 1S3SG 5G2NA 4DXGA 2DAJA 4MJSA 1ROEA 1GB4A 2I1KA 2WYQA 4II3B 1RM6C 3PS6A 2ON8A 3P1MA 2M8SA 3A1QB 3AEGB 2YLMA 3AE6B 3ALBA 4MGIE 4TKNA 1TKYA 4B0EA 2E6XA 3QX1A 5JHAA 2FCQA 2JXTA 4WIPA 1P7EA 2PE6B 3VVWB 4D2KA 3K9OB 3ML8A 2I1JA 1XF5L 2MH7A 4AP4C 1J7CA 3KH0A 1ENFA 2K1FA 2M0XA 4R3DA 2QILA 4NAWA 2VRRB 2LUEA 2OJRA 2X38A 1IP9A 1G6JA 3U2SC 2WU5B 4Q2JA 2L05A 4LJPB 3UIPB 3RULA 5J17A 4DXAB 2EMTA 1XT9B 5D6JB 4IC7B 5DPTA 2KAJA 1WIAA 5EE3A 2C60A 4I6LB 2RSUA 4WWNA 2MBOA 1IPGA 3SHQA 5E6NA 2W3RA 4BKSA 5CHWA 4C7YA 3W1SC 2V3SA 3NS8A 5IP4D 4L23A 1J8CA 2KTRA 2E3TA 1WRDB 1WM3A 3QJZA 4IM0A 4WQMA 3GS2A 5FKAC 1LM8B 4QAYA 1F2RC 4A3PA 1WFYA 1M4VA 3A4RA 4ANVA 4E3CA 3ZGZA 2UU7A 1KLVA 1YN5A 2HDEA 2KLCA 3WAOA 4NQKE 4HKQA 3A33B 5IKCM 3IVFA 3DQVA 3FC4A 1KOTA 2JYTA 1WZ3A 1FMAD 3VUWA 2KJ6A 3DBRB 2KT7A 3H6NA 1PQSA 5D2MB 2KDBA 1PDXA 1VDVA 3KLSX 3SFEB 1N5WA 2LXCA 2IGHA 2KO3A 3Q6BA 2AL6A 1TZ1A 1ISNA 5IOIA 4ZRKA 2KFKA 3BIID 2KVZA 2OHFA 4ICUA 1OQYA 3PVLA 2DBYA 3P4PB 4JL9A 1I35A 1L0VB 1FEHA 2J0MA 3RZWC 1QZEA 1WMHB 1I4HA 3TIXA 3I9V1 2KMMA 4PT5A 2LMCA 5GXGB 3IBEA 3ZLZA 2IZVB 2I2YA 2K9XA 2SAKA 1LFDA 3AEEB 2WDQB 1NEKB 5MPOA 2L83A 2IGGA 2JUOA 1NBFC 3B1LX 1STEA 2IGDA 4YSXB 1ET6A 3NVZA 2IO2B 3NJTA 3ZJUA 2JZZA 3VUXA 1XLPA 3QIJA 4EZLA 4LDTB 3QK0A 4GDLA 4A8XC 2ONQA 2WQYB 4C56C 3AE3B 4IOIE 2MCNB 2XNAC 3EUB2 3BK1A 3B9JA 4XC2A 1ZE3D 3W9CB 1OQRA 1TTNA 1JW9D 5DCNA 1TS5A 4JQWC 4LJOB 3DBLB 1RFKA 4W9LA 2JRIB 3W1SA 4P1BC 4LTUA 3W5UB 3ZKJC 3H7PB 1IBXB 2FCMA 4BAXA 3OJ4B 4N6EB 1YX6B 2L1AA 1Z2MA 1GAQB 4IG7B 3ZJTA 1MI0A 3DBLI 3L4PA 2CHZA 2IYDB 2Z8LA 4HKZE 3PO0A 4BOZB 2J4XA 4KGTA 2LHEA 4XWWA 2PEAA 2MLBA 3ZJVA 4C4VB 1CK1A 2LFIA 2WU2B 1YJIA 1K51A 1MFWA 2HE7A 4ICVA 5KHOA 3AE1B 2H88B 4DDGD 1FRRA 1FCCC 5JH5C 1VLBA 2KHWB 4EZKA 1F0ZA 1P0RA 1C1YB 1YQ4B 3N32A 2DYOA 2EELA 1JQ4A 2JXXA 4KZ0A 2KDFB 3U52E 1PGXA 2N9EB 4ARCA 4KDIC 3NUHB 1DOYA 2K6QA 1C4AA 3DVNV 5CX3A 3N1YC 2M56B 5BYQA 4US9A 3V60A 3RCZA 3KW5B 2Z0EB 1TKGA 3BYTB 3GE3C 3IAS1 2JZ3B 1FIQA 1NYRA 1P7FA 5LLIA 4ZHPA 3AE5B 3JSVB 2IO3B 2KXJA 4HLEA 5AUIA 1T0SC 4XDCA 4OVZA 5H8YE 3TSSA 1C78A 2V3PA 3FAHA 2CU1A 4BZAA 4DHJD 2AWTA 1BUIC 5EE0A 2YVCA 4M00A 4NJ6A 2BYEA 2KN5A 4I6NB 3RNEC 3VQIA 2L76A 4HCNB 1KTKA 2GBNA 1WGHA 3MHZA 4PK1A 2DNFA 1GJZA 2GI9A 3CSFA 4GMVA 4HXDA 4F8CB 2KACA 1P9DU 2LRUA 3TEYA 2FUG1 3PZDA 3SD5A 1C77A 2N1WA 3UINB 2LGXA 4ZOHC 1E9MA 3PHXB 1WX9A 1DOIA 3RPFC 1TYGB 1FXAA 1FFVA 2JWZA 2D3GA 3HIZA 3ZW3A 1E8YA 1ZW7A 2WS3B 1WYWB 4K81A 3VH4B 4TMAB 3I63C 1A70A 1V97A 3Q2AC 2WDTB 4US8A 4YTMB 2KQ7A 2K39A 1TGZB 3URYA 4USAA 2XN9C 3C19A 4M0WB 1F77A 4HDQA 1WJ4A 2BWES 3A4SC 2KOXA 3IT4B 4ZRPA 4RGNA 1TY0A 4FHKA 3ZUNA 1D5MC 3AV8A 2BTEA 1XQQA 2IY1B 3DVGX 3TEXA 3ZNZB 2CHXA 3NY5A 4BKGA 4BKTA 2QJLA 4OZAA 3A9JB 1BT0A 4YWGG 3NZSA 1P98A 1L5PA 3IG3A 1SIFA 2KC2A 1UUPA 2V1YA 4RNAA 1C4PA 2O6VD 4IDIA 1WXQA 1FXIA 3KYDD 2HJ8A 3GOEA 1Q10A 5J18A 2TSSA 2O6VA 4PYZA 1GC6A 2RPQA 1WF9A 3V6EB 3WALA 1A5RA 3TJPA 2NCNA 3GZNB 1JWSD 2BYTA 4C00A 1GG3A 1FFUA 4B0MA 3NZUA 1TY2A 4A3OA 2FIFA 3ZXVA 3H8HA 4KV2A 4PS7A 5FR3A 3V61A 2W54A 1L4ZB 4E71A 2GB1A 3KUDB 3APFA 2LVOA 4BOSC 1FNWA 3VAWA 2R61A 3N20C 2INCC 2J0KA 1E0ZA 4J3OD 1WJNA 3VTUA 3UF8A 1QQRA 5CHVC 2KWDA 1D3ZA 1ZOYB 3N1XC 1FM0D 2M1MA 4NAWB 4LDTD 3ZTDA 1SGHA 3ZXRA 3DVGY 4HJGE 1V1OA 3T3OA 4B95A 4KZCA 4W9EA 3HK0A 1RAXA 4MH0E 4IUMB 4YTPB 2C7NB 2WXNA 2WXGA 2D3CA 2V0GA 3ZIMA 1NI2A 1R4MB 3B2FA 1XLNA 1KLGD 3OLMD 2HD5B 3NG0A 1YD8U 1CJEA 1L6VA 4EE2A 2N9PC 4JE3B 4KGRA 1MJDA 3U30A 3OWEB 3AM9A 4P16A 2FCNA 3NVYA 3APCA 2DX5B 4ZHOA 2GBKA 2ZNVB 2L52A 3B0AA 2N9LA 4WWOA 1UBQA 3Q14C 4JIOU 1V5OA 3AEBB 1V8CA 1WXAA 2WHIA 3AN1A 2WXIA 2LGDA 3ABVB 1B1ZA 5IN7A 4LNNA 4G11A 2WP9B 1IUEA 3L10B 1L6UA 3K9PB 2QMTA 3FILB 1JWUD 1FO4A 4HWIB 4FBJB 3PREA 3R2TA 2FUHB 4KX6B 5E6OA 3A9KA 5EE1A 4MJSB 1PGAA 1N6ZA 1JRUA 5HKHA 3DBHB 4WH4A 4YT0B 5BMIA 2MBBB 1E5WA 4W9KA 3RNCC 1SJED 3HVDA 2ZW1A 5BMHA 1UBIA 4A6QA 1ZKHA 2KLGA 3R3MA 2KDEB 3RNFC 5TSSA 1N60A 2KTFA 3AECB 1Y56A 2KJRA 4GOCA 2GMIC 3Q3NC 3DBHI 2LRWA 3QHTA 2KYWA 1JWMD 1JRPA 3E56A 3AEAB 2BGFA 3NVWA 4KSLC 3DBRI 2BQQA 4ARIA 2WNMA 1EWCA 1J7BA 5BO4B 3ONSA 3DWMA 1GC7A 3D32A 3Q8EA 3ZDTA 2DZMA 2ZCCA 1UGJA 1ZDXA 1BMLC 2BF8B 1VR9A 1WR1A 3V62A 4LNFA 2KTRB 1R7SA 4KIKA 3QCAA 3PT2B 3DOWA 1WJ6A 5JXVA 2RD0A 3NRZA 4G0NB 2BPSA 4RH6A 2UYZB 1WH3A 4CQNA 2CR5A 1LXDA 2NR2A 3QAQA 2D10A 2J53A 2NBVB 2KVRA 4FULA 3M95A 3V3XA 2K5PA 2JPHA 4HRSA 2VZKD 4XX5A 1KFYB 3AEFB 4CYEA 1OQQA 2VZKB 3MC9A 1KRHA 2DZJA 3AEDB 2V3NA 2REXA 4GGQA 2Y5CA 3Q69A 4PS3A 1FPYA 2FE8A 4DXFA 2QDFA 2JSVX 3RN9C 2BW2A 1RWSA 2AQ2B 2CJNA 1GB1A 2JRHA 4ZRIA 3RUIB 4KIKB 2MX2A 3RMKC 3W2DA 3WAPA 3H1UA 4A20A 3SR6A 2KQ4X 3IT6B 1C3TA 1E8XA 2Q5WD 2ZPNA 4NJ7A 1H8CA 4C7ZA 1FCLA 1N61A 2M19A 1YN4A 3BWUD 3Q8CA 4XDDA 1WGRA 3HM6X 2C9WB 1TS3A 2MWSB 3AB5A 1IGDA 4RM8A 2BKFA 1AW7A 1NYQA 2MEKA 2MHJA 3P63A 2FAZA 1DGJA 3RFZB 4MSMB 4IM2A 1MHHE 1K53A 4UDUC 2W3SA 4KGSA 2WXMA 5CHFA 1V49A 1M94A 1WMHA 4W9JA 1OFFA 4PYUA 2PIAA 3EHVA 5DPWA 5KHQA 4NPNA 4XZ4A 3NOBA 5AZHA 1E7UA 1YQ3B 5E6PA 4TQ0A 5EE9A 4O1NA 2N9KA 2NVUI 2Z59B 3DDCB 3IHPC 4K1RB 4F7ZA 4ZRJA 5G55A 4BBNF 1TIFA 1Z5SB 4W9IA 4B6WA 2LI5A 2N0SB 2MA9B 5HHDG 2MP2B 2MP2A 2KDIA 5LXHA 1OEYJ 5EDSA 3TEZA 1VD2A 4XGAB 4M02A 4DHJB 3X0WA 4XE0A 1XCQL 2LGSA 1F2RI 1WE7A 2GRIA 2ACZB 3ECIA 5C23A 1SBBB 2G4SA 3WCQA 3SU8X 2JY6A 2L32A 1ZPSA 2IJ0A 3UGBB 5D3IB 4S17A 1GUAB 4MH8A 1RRBA 3P42A 2PVOD 2Y3AA 3LYYA 1WZ0A 3PLUA 2PLPA 2R2QA 4REZA 4K3CA 1LO5D 2L0TA 3DHHC 4WWPA 1RLFA 2L0FA 2RDGA 5DPRA 5IA7A 1WXVA 3WA0A 3C8YA 1ZGUB 3OG5A 2KMCA 1ACCA 1TS2A 2JU6X 2RDBC 2AX5A 2PW9A 3M63B 1DOXA 1ZXIA 1N5XA 2V4IB 4MDKE 2WDVB 2K6DB 4FLHA 3J9CA 5HG2A 4JGHB 1RFAA 1YMHE 2GOWA 3L16A 2CKHB 3BVMA 5HI1A 2ZCBA 3KYCD 3ENEA 1EO6A 1ZP0B 1N63A 4N9F4 3R7QA 4EEWA 2ZEQA 2FIDA 5BMGA 4H2AA 1C79A 4IKGA 4DBGA 2BVCA 1OEYA 3SEBA 2G45B 2JT4B 2W9NA 4K7SA 3N3KB 4E74A 2W55A 3AE4B 2K8HA 2JQRB 4GN1A 1YQBA 2IPKD 3I5JC 2NBUA 2IDYA 1HQRD 1U4AA 4ZYNA 2NS5A 2PMVA 3TMPB 2FBWB 1T0YA 3DBSA 2J52A 2X8XX 1IGCA 4OVUA 1NENB 1T0QC 1TS4A 2QHOA 2JWUA 3QC8B 4B9KA 3M3JA 4JLCA 1SE4A 4TQ1A 2QEJC 2XBBC 3N30A 1YOVB 1D6EC 2XEWA 2J7QB 1MHXA 3QQ8B 1T6BX 4MGZE 5I4DA 3P2BA 1GOZA 3I3TB 4RMAA 3VRAB 2K8BA 2LJIA 4GDLB 2K3UA 3ETRA 3CIRB 3KVFB 4K7WA 3N1ZC 2LHDA 1BXTA 1FRDA 1L0YB 3RD2A 1XCTL 2BB6A 2NTTA 1QLBB 3BYYB 4WJOA 1ZDVA 1B9RA 2N7DA 1I42A 2WX1A 4KKIA 2HTHA 3PZ7A 1MVKA 1E6EB 1XXGA 2BYFA 2WXRA 1UWXA 1OTRB 1E8WA 4OHJA 1PYWD 4AUQC 1SE3A 3UQAA 4ITKA 2IBIB 2KDMA 2NTSA 4MELA 1L7YA 1WX8A 2BKRB 1JWBD 1UD7A 3R8BA 2AQ1B 1WSPA 3AU4A 1QOGA 4DHZB 4IWPA 4YL8A 1EUVB 1XD3B 2JZPA 5J2RA 1SSNA 1YJJA 3KUZA 3MHSD 3X23A 2LASA 2J0JA 3EECA 5LNK1 1VRAB 2GLSA 1SF0A 3DWGC 3T9LA 1L0XB 2DAFA 4TSSA 2CU3A 2YEPF 2L7RA 2BS2B 3W1YA 2W82A 3NS1A 1JROA 3VUYA 1C9FA 2CJOA 3Q8AA 1X1MA 1C76A 4MGYE 3ZDMC 3RI7C 2WXHA 4P6VF 5T8IA 1YX5B 3NHEB 1DYQA 1CQVA 2AL3A 2YEPB 2N4FA 1WGKA 2FCSA 5C1ZA 4GB9A 1KLUD 2BBCA 1T3QA 2DZIA 2A4ZA 2M0AA 2MBEA 1I4GA 3RNAC 1TBEA 4OVVA 2EKEC 3ZTCA 4GDKB 2WXOA 5L83A 4N59A 1J7AA 3SFDB 1SB3C 2WXLA 1XLQA 1CZPA 1F9JA 5D7GA 1QF6A 2LGIA 2I38A 3BZDB 2GBRA 5AZFA 2AYOB 3Q3FA 2ZJDA 4DQOC 1E7VA 4FA6A 4RFBA 3LJ3A 3Q8BA 2FNJB 4AOFA 3R2IA 2WDRB 4HPLB 4A90A 1PFDA 3KUCB 1WYGA 2RGFA 3WAMA 1P3QU 4BKSD 2DLBA 2PTLA 4PS8A 1YN3A 4RGMA 2LVQA 4AQ7A 2XK5B 1T0RC 1V2YA 4HROA 4AJWA 2L00B 3ZNHB 4WQOB 3WANA 4RF1A 3PSEB 4URKA 2G9HD 3SDLC 2INNE 4MGKE 4LCDE 1ZUD2 4AWJA 4IW0A 4P7IA 3TUOA 3JSVA 1VZ6A 2LGYA 2V4LA 2AQ3B 4HJKA 3O13A 3HVZA 2CS4A 1FXTB 4EKUA 5CTRC 1MG8A 1WM2A 3ZQ4A 3L13A 1HA5A 4KSKC 2QIEB 3R7RA 5FK9C 2KMAA 4NJCA 4GIVA 2B3AA 4HPPA 1WI0A 2WXQA 1JALA 4JWSC 3EFCA 4I6PA 5C2TB 1ESFA 1FNVA 3ML9A 1WR6E 4M8NA 4MSQB 1V81A 1SE9A 3B08A 2RDHA 2WXJA 1CMXB 2ASQA 2RR9A 2ZW0A 1UF0A 4W9FA 1ZXHA 2KD0A 3RNBC 1R4NB 3Q3OC 1AN8A 5JZEB 1JCKB 3UI3A 4ZDVA 2KX0A 4ANWA 2SEBD 1NI3A 4ZRQA 4RF0A 1TZOA 2M17A 4IM3A 1VJKA 2KC1A 1HEZE 1D5XC 4J6IA 4P1CC 1YIWA 4NZLB 2KJHB 2IO1B 1WGGA 2N7EA 2AEHA 1IYFA 1Q5WB 1R4NI 1HZ6A 3ZO5B 2JF5A 2LEKA 3RNGC 1TJEA 4WJPA 4FJZA 5IO9A 1HTQA 4ASWC 4RGTA 1WRIA 4YSZB 1NVID 1TKEA 3A9KB 3LXFA 3P4SB 3HM3A 3BK2A 4TV3A 3RT3B 1F52A 3AI5A 3T3NA 4M0WA 3AE9B 2MBHA 2G4DB 3E9SA 2HTME 4K7UA 3TEWA 2D5GA 1LQBA 4RGOS 1E90A 4II2B 1UZXB 2KNBA 3H7SA 3MFGA 4FJYA 1H4RA 1MG4A 4EUTA 4YXDB 2KFJA 2KK8A 3KQ4A 3L0WB 4MM3B 4HEA1 2O2VB 2LWPA 3PZ8A 4W9DA 3MJWA 4LLGM 2ICIA 2LXAA 1XEEA 2NMQA 4IWQA 4LNIA 3AH7A 3VH3B 4WAAA 1K50A 1AARA 1EU3A 1OGWA 1QKZA 1EF5A 1UWMA 4CHKA 1F1HA 2M4NA 1EU4A 4GSWA 2B76B 1K52A 2JX5A 2OOBB 3MJ5A 3Q3MC 4N58A 1YNTE 3ZNGC 3VRBB 3T8MA 4NQLB 5TR5A 2L8JA 4NY0A 3ZRCA 1WE6A 1SXTA 3VFKA 2LJ5A 5JHBA 1JWAD 1JMLA 2DENB 4L2YA 3JW0X 4HK2A 3RZFA 2QCZA 5G5HA 2KWCA 3UQBA 2MSED 3HHMA 3ZVVA 5LXIB 2WXPA 2DYBA 3PTFC 3PRPB 2QSDA 3U7ZA 1J0GA 5HFYA 4X57B 5D94A 2GBJA 2NBWB 1I7HA 2KKCA 1TT5B 4DWFA 1ET9A 2JVCA 3BY4B 4RM9A 2N1VA 2UWQA 3NVVA 4DDID 3M62B 4RCOA 3IFWB 1HZ5A 4K3BA 5G5GA 4EZJA 3QA8A 3IAM1 3PRMB 3JVZX 2DYMA 2D2QA 1UH6A 3MC8A 4A55A 1XO3A 1KF6B 4ZYSA 1V1PB 2KN4A 4MACA 2BS3B 2MBQA 5C3JB 3O65B 3AXCA 1YJ1A 3L54A 1E10A 4TUUA 2R2OA 5L95C 3HRDD 4NAMA 5D3DA 1SJHD 3LDZE 2ZZPB 4KVGB 1EWYC 3EC8A 4HPMB 4EFOA 4XYCA 3VTVA 3VDZA 2BS4B 2XK5A 4L1BA 1WXSA 4S0RA 3MC0B 4GDKA 2C7MB 3V6CB 1AWDA 4DK5A 1WGYA 3HUIA 1KM7A 1D5ZC 4HDOA 2WGSA 1VZ8A 4OZCA 2V9HA 5E6JA 1Y8RC 2C7HA 3MP9A 1I4PA 3TL5A 4JPSA 1HE8A 3CF6E 1FD6A 4ANXA 2DHZA 2PPHA 2KZRA 5AUKA 3PV1A 3N9YC 3FKYA 2WXKA 5GMVA 1SIJA 3AU5A 1N62A 3QWZB 2WWZA 5DPSA 2VH1A 1EF1A 4G50A 1FNUA 1SE2A 3WIMA 2A5UA 2ZVOA 4W9CA 1P1AA 1XLOA 4WWMA 4EOYA 5AZGA 3H7PA 4WJNA 1L2NA 2MQJA 1I4QA 2GBMA 1C4CA 1GNUA 3EA6A 3PLVA 2MJDA 4M8MA 4BVUC 3PRZA 3L08A 2C5LC 2G3QB 4MEMA 3AE2B 3Q8FA 1WX7A 2KQSA 1MPEA 2ZNVC 1K8RB 3TBLD 3AMZA 2D3AA 1GPXA 4YTNB 1I4RA 1E7PB 1HTOA 4JX1C 3PHWB 4GXBA 1S1QB 3FILA 3H9DA 4LK0M 2KX3A 2Y5PA 2LZ6A 4FADA 3BVGA 1PGBA 3RYTA 2LVPA 3PGEA 3S2AA 3UIOB 3VTWA 3KWVA 3QARA 2INDC 4ANUA 1WXMA 1VCBA 1QOAA 3GB1A 2LUMA 2KFKB 4M01A 5FR6A 1RYJA 4LNOA 4FN2A 2HJ1A 1I4XA 5IAAC 1E8ZA 2D07B 4OZBA 2KANA 2J42A 3DHIC 2EKIA 4HCPB 3GE8C 3Q3JA 4GLSC 5AEKB 2BB5A 3U7DA 2D11A 4MT5A 2K8CA 2WLBA 3EGRA 3KWLA 2IY0B 4CO7A 4W9HA 2CHWA 4C80A 3BINA 3DPDA 2WX0A 1UNSA 3U4EG 3JYUA 3DVNU 1PUTA 3APDA 2N9XA 2DZKA 3B2GA 4KKJA 2EMSA 1Q0WB 1WWTA 4BBNC 2K22A 3ZNID 4GU2A 1R4MI 4DHZE 2G1EA 2PVGC 1V1PA 3VR9B 2L3ZA 4XWTA 1VZ7A 3P4RB 2MJ3A 2MW5A 3CMMB 2VH2A 2IO0B 4IWOA 2K25A 1IBXA 3L17A 2JYEA 4FXCA 1D4BA 4MM3A 1KJTA 2O2VA 2BWFA 3DHGC 4KDLB 1UGMA 2RMMA 5H92C 2NPTB 4A9AA 3A9JA 4F1SA 3TCAA 3BVZA 4NNJB 1LGRA 4WURA 2BT6A 4AS1A 3GZNI 1L4DB 4OW0A 1WGDA 3AULA 3AE7B 1KH0A 1V86A 1V80A 3EFUA 2ZPYA 1V9JA 3ZRFA 4C4VA 2O6VB 1WJUA 3PPAA 2DWQA 1WY8A 3I57A 2ZVNA 2WXFA 4W9GA 1HXYD 2Y5BB 4WJQA 1V5TA 3P4QB 3VHTC 1NDDA
chains in the Genus database with same CATH topology
3A1QA 4PYUA 1IYFA 1Q5WB 2JWZA 2D3GA 1R4NI 3EHVA 3HIZA 4AJYB 4BFRA 5DPWA 3ZO5B 3ZW3A 5KHQA 1E8YA 1UELA 2JF5A 4NPNA 4XZ4A 1ZW7A 4FJVB 3OJ3A 3VXWA 4WJPA 3NOBA 5AZHA 2PE9A 4FJZA 1E7UA 1WYWB 4G3XB 4ASWC 2PJHA 4K81A 3R66C 3VH4B 5E6PA 3DCGA 3A9KB 4TQ0A 2MRPA 2WDTB 3MTNB 2NVUI 2Z59B 2KQ7A 2NPTA 2K39A 3DDCB 1TGZB 3IHPC 4K1RB 2LD9A 4F7ZA 1J19A 3HM3A 4ZRJA 5G55A 4TV3A 4BBNF 3RT3B 1Z5SB 4W9IA 3AI5A 4B6WA 4M0WB 4HDQA 2LI5A 2MA9B 1WJ4A 2MP2B 2BWES 2MP2A 2KDIA 2MBHA 5LXHA 4FHJA 2G4DB 1OEYJ 2KOXA 1V6EA 3A4SC 2Z0DB 5EDSA 4FHKA 4K7UA 1VD2A 3ZUNA 3OAWA 1XQQA 2IY1B 3DVGX 3X0WA 3ZNZB 4DHJB 1LQBA 2CHXA 3NY5A 4BKGA 1E90A 3C0RB 1WE7A 1UZXB 2KWUB 2KNBA 3CSTA 4II2B 4BKTA 2BYVE 4HVBA 3H7SA 4FJYA 1Q1OA 1H4RA 3ECIA 5C23A 4EUTA 2KWVB 2G4SA 2KFJA 3A9JB 3SU8X 2KK8A 2JY6A 1BT0A 3L0WB 3U8ZA 1S3SG 2LWPA 2O2VB 3NZSA 5G2NA 4W9DA 3UGBB 1P98A 2DAJA 4MJSA 1GUAB 3MJWA 1RRBA 2I1KA 2WYQA 4II3B 2LXAA 3IG3A 1SIFA 2KC2A 3PS6A 4IWQA 1WZ0A 3PLUA 2R2QA 2V1YA 2M8SA 3A1QB 2YLMA 3VH3B 4WAAA 1AARA 3ALBA 1OGWA 2L0TA 4MGIE 4TKNA 2O6VD 1EF5A 4WWPA 1RLFA 4CHKA 2L0FA 2HJ8A 3KYDD 5DPRA 1WXVA 5IA7A 3GOEA 2M4NA 3QX1A 3WA0A 1ZGUB 5J18A 4GSWA 2KMCA 5JHAA 2O6VA 2FCQA 2OOBB 2PE6B 3VVWB 4PYZA 3K9OB 1GC6A 3ML8A 2RPQA 3ZNGC 1WF9A 3V6EB 3WALA 2I1JA 3M63B 3T8MA 4NQLB 5TR5A 2L8JA 1A5RA 4NY0A 3ZRCA 1WE6A 3TJPA 4MDKE 2NCNA 4AP4C 1GG3A 2K6DB 4FLHA 3KH0A 3VFKA 3NZUA 2K1FA 2LJ5A 2M0XA 4JGHB 5JHBA 4A3OA 2FIFA 4NAWA 1RFAA 2VRRB 2DENB 2GOWA 3L16A 4KV2A 4PS7A 3JW0X 2LUEA 2CKHB 2OJRA 4HK2A 1IP9A 3RZFA 2ZCBA 3V61A 3KYCD 3ENEA 1G6JA 1EO6A 2KWCA 4N9F4 3UQBA 3R7QA 4EEWA 2MSED 4E71A 3HHMA 2ZEQA 3ZVVA 2FIDA 2L05A 5LXIB 3KUDB 4LJPB 2DYBA 3PTFC 3RULA 3PRPB 3APFA 3UIPB 2LVOA 5J17A 4BOSC 4DXAB 2EMTA 4DBGA 1XT9B 5D6JB 3VAWA 4IC7B 1OEYA 1J0GA 5DPTA 2J0KA 2G45B 2JT4B 4X57B 2W9NA 4K7SA 5D94A 2GBJA 1WJNA 2NBWB 1WIAA 3VTUA 3UF8A 2C60A 3N3KB 4I6LB 2RSUA 4WWNA 2MBOA 1IPGA 3SHQA 4E74A 5CHVC 2K8HA 2KKCA 5E6NA 4DWFA 1D3ZA 4BKSA 5CHWA 4GN1A 1YQBA 3W1SC 2V3SA 3NS8A 2JVCA 3BY4B 4RM9A 1J8CA 2KTRA 2NBUA 2N1VA 2M1MA 2UWQA 1WRDB 1U4AA 4ZYNA 4DDID 1WM3A 2NS5A 3QJZA 4IM0A 4NAWB 3TMPB 1LM8B 1T0YA 3M62B 4A3PA 1WFYA 3IFWB 3DBSA 4LDTD 3ZTDA 1SGHA 4EZJA 3A4RA 4ANVA 4E3CA 3DVGY 3QA8A 4OVUA 3PRMB 1KLVA 2QHOA 3JVZX 3QC8B 2DYMA 2D2QA 4B9KA 1UH6A 2KLCA 4B95A 4KZCA 3M3JA 4W9EA 3HK0A 4JLCA 3WAOA 1RAXA 4MH0E 4TQ1A 4NQKE 4IUMB 2MBQA 2XBBC 3O65B 3AXCA 1YJ1A 3A33B 2C7NB 3L54A 3N30A 3IVFA 4TUUA 2R2OA 2XEWA 3DQVA 5L95C 1KOTA 2J7QB 1WZ3A 3ZIMA 3LDZE 3QQ8B 1NI2A 2ZZPB 4KVGB 4MGZE 3P2BA 3VUWA 3EC8A 4HPMB 3I3TB 3OLMD 4RMAA 3VTVA 4EFOA 2HD5B 3VDZA 2KJ6A 2XK5A 3H6NA 2K8BA 1YD8U 1WXSA 1PQSA 4GDLB 5D2MB 2KDBA 4GDKA 2C7MB 2N9PC 3KVFB 3V6CB 4K7WA 4DK5A 1WGYA 1KM7A 3U30A 3RD2A 2LXCA 2KO3A 4HDOA 2FCNA 2AL6A 1TZ1A 4WJOA 3APCA 2DX5B 1ISNA 4ZRKA 2GBKA 2KFKA 2N7DA 2ZNVB 3B0AA 1I42A 2WX1A 4WWOA 2HTHA 1UBQA 1OQYA 1Y8RC 1V5OA 2C7HA 3PVLA 2BYFA 4ICUA 4JIOU 4JL9A 3TL5A 1OTRB 1E8WA 1I35A 2J0MA 1HE8A 4AUQC 3CF6E 1QZEA 1WMHB 3RZWC 1WXAA 3TIXA 4ANXA 2DHZA 3UQAA 2LGDA 2IBIB 2PPHA 4MELA 1L7YA 2KZRA 3PV1A 1WX8A 4G11A 2BKRB 3IBEA 3L10B 3K9PB 3ZLZA 2IZVB 1UD7A 4HWIB 4FBJB 3PREA 1LFDA 2FUHB 3AU4A 5GMVA 5E6OA 3AU5A 4DHZB 3QWZB 4IWPA 2WWZA 4YL8A 3A9KA 5DPSA 1EF1A 4G50A 4MJSB 1EUVB 1XD3B 3WIMA 2A5UA 1JRUA 5HKHA 2ZVOA 4W9CA 1P1AA 2JUOA 5J2RA 1NBFC 4EOYA 3B1LX 5AZGA 3KUZA 3MHSD 3X23A 2LASA 2MBBB 2J0JA 3H7PA 1E5WA 2IO2B 4W9KA 4WJNA 1L2NA 3EECA 2MQJA 2GBMA 1GNUA 1UBIA 2JZZA 1ZKHA 2KLGA 3R3MA 3VUXA 3QIJA 3T9LA 4EZLA 2DAFA 4LDTB 3PLVA 3QK0A 2KDEB 2L7RA 4GDLA 4M8MA 3W1YA 4BVUC 2MCNB 2KTFA 2KJRA 3PRZA 3L08A 3VUYA 2C5LC 2G3QB 4GOCA 4XC2A 2GMIC 4MEMA 3DBHI 2LRWA 3QHTA 1TTNA 1WX7A 1X1MA 2KQSA 5DCNA 4LJOB 2ZNVC 4JQWC 1K8RB 4MGYE 3TBLD 4W9LA 3ZDMC 2BGFA 4KSLC 2JRIB 3DBRI 3W1SA 1YX5B 3NHEB 3ZKJC 3PHWB 3H7PB 4GXBA 1S1QB 3H9DA 2AL3A 2FCMA 2KX3A 2N4FA 2FCSA 3OJ4B 2LZ6A 4FADA 1YX6B 5BO4B 1Z2MA 3RYTA 5C1ZA 2LVPA 3PGEA 4GB9A 4IG7B 3S2AA 3ONSA 3UIOB 3VTWA 1GC7A 2DZIA 3D32A 2A4ZA 2MBEA 3ZDTA 3QARA 1TBEA 3DBLI 2DZMA 4OVVA 2EKEC 3ZTCA 4GDKB 2ZCCA 2CHZA 2IYDB 5L83A 4ANUA 4BOZB 1WXMA 1VCBA 2BF8B 2PEAA 1WR1A 3V62A 2KFKB 2KTRB 2MLBA 4KIKA 3QCAA 3PT2B 1F9JA 5D7GA 3DOWA 5FR6A 1WJ6A 2GBRA 5AZFA 2RD0A 4G0NB 2AYOB 2BPSA 2UYZB 1WH3A 3Q3FA 4FN2A 2CR5A 1LXDA 2ZJDA 1E7VA 2HE7A 4ICVA 2NR2A 4FA6A 5KHOA 5IAAC 1E8ZA 3QAQA 2D10A 2NBVB 2KVRA 3LJ3A 2D07B 2KANA 4FULA 3M95A 2JPHA 2FNJB 4HCPB 4XX5A 4DDGD 3Q3JA 2KHWB 4AOFA 4EZKA 5AEKB 5JH5C 4HPLB 3U7DA 2D11A 4CYEA 2K8CA 1P0RA 3KUCB 2RGFA 3WAMA 1C1YB 1P3QU 4BKSD 4PS8A 2DZJA 3N32A 2DYOA 2JXXA 4KZ0A 2IY0B 2KDFB 4CO7A 2LVQA 2REXA 4W9HA 4GGQA 2CHWA 2N9EB 4KDIC 3BINA 3DPDA 2WX0A 2XK5B 4PS3A 2K6QA 1V2YA 4AJWA 3JYUA 3DVNV 5CX3A 2L00B 3DVNU 3V60A 3APDA 3ZNHB 2N9XA 4WQOB 3RCZA 3KW5B 2DZKA 3WANA 2Z0EB 3PSEB 4URKA 2EMSA 1Q0WB 2JZ3B 3SDLC 4MGKE 4LCDE 4BBNC 4AWJA 5LLIA 3ZNID 4IW0A 4P7IA 4GU2A 1R4MI 3JSVA 3JSVB 2IO3B 4DHZE 2LGYA 2KXJA 4HLEA 2V4LA 2JRHA 2L3ZA 4HJKA 2CS4A 1FXTB 4ZRIA 5CTRC 3RUIB 4EKUA 4KIKB 1MG8A 2MX2A 1WM2A 3L13A 4KSKC 2MW5A 3CMMB 4IWOA 2IO0B 3R7RA 3WAPA 2KMAA 2K25A 4GIVA 2B3AA 3L17A 1WI0A 3H1UA 4A20A 2CU1A 4MM3A 1KJTA 2O2VA 2BWFA 4KDLB 4DHJD 1UGMA 2AWTA 4I6PA 2NPTB 2YVCA 3ML9A 3A9JA 1C3TA 4F1SA 1E8XA 4NJ6A 3TCAA 2BYEA 1WR6E 2KN5A 2ZPNA 4I6NB 4NJ7A 3VQIA 1H8CA 2L76A 4HCNB 4NNJB 2GBNA 1WGHA 4M8NA 1WGRA 1V81A 1SE9A 3B08A 3HM6X 4MSQB 3GZNI 1CMXB 2ASQA 1GJZA 2C9WB 2RR9A 3CSFA 4W9FA 1WGDA 2MWSB 4GMVA 4HXDA 2KD0A 4RM8A 4F8CB 1P9DU 3AULA 2LRUA 2BKFA 1V86A 1V80A 3EFUA 2ZPYA 1V9JA 3ZRFA 5JZEB 2O6VB 3PZDA 3SD5A 2KX0A 4ANWA 4ZDVA 1WJUA 2N1WA 3PPAA 3UINB 2LGXA 1WY8A 2FAZA 2ZVNA 2M17A 4IM3A 4MSMB 4W9GA 4IM2A 2KC1A 3PHXB 2Y5BB 4J6IA 4WJQA 1V5TA 1YIWA 1WX9A 2KJHB 5CHFA 1V49A 2IO1B 1M94A 1NDDA 1WGGA 1WMHA 4W9JA 3VHTC 2N7EA 2AEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A1Q A;  4PYU A;  1IYF A;  1Q5W B;  2JWZ A;  2D3G A;  1R4N I;  3EHV A;  3HIZ A;  4AJY B;  4BFR A;  5DPW A;  3ZO5 B;  3ZW3 A;  5KHQ A;  1E8Y A;  1UEL A;  2JF5 A;  4NPN A;  4XZ4 A;  1ZW7 A;  4FJV B;  3OJ3 A;  3VXW A;  4WJP A;  3NOB A;  5AZH A;  2PE9 A;  4FJZ A;  1E7U A;  1WYW B;  4G3X B;  4ASW C;  2PJH A;  4K81 A;  3R66 C;  3VH4 B;  5E6P A;  3DCG A;  3A9K B;  4TQ0 A;  2MRP A;  2WDT B;  3MTN B;  2NVU I;  2Z59 B;  2KQ7 A;  2NPT A;  2K39 A;  3DDC B;  1TGZ B;  3IHP C;  4K1R B;  2LD9 A;  4F7Z A;  1J19 A;  3HM3 A;  4ZRJ A;  5G55 A;  4TV3 A;  4BBN F;  3RT3 B;  1Z5S B;  4W9I A;  3AI5 A;  4B6W A;  4M0W B;  4HDQ A;  2LI5 A;  2MA9 B;  1WJ4 A;  2MP2 B;  2BWE S;  2MP2 A;  2KDI A;  2MBH A;  5LXH A;  4FHJ A;  2G4D B;  1OEY J;  2KOX A;  1V6E A;  3A4S C;  2Z0D B;  5EDS A;  4FHK A;  4K7U A;  1VD2 A;  3ZUN A;  3OAW A;  1XQQ A;  2IY1 B;  3DVG X;  3X0W A;  3ZNZ B;  4DHJ B;  1LQB A;  2CHX A;  3NY5 A;  4BKG A;  1E90 A;  3C0R B;  1WE7 A;  1UZX B;  2KWU B;  2KNB A;  3CST A;  4II2 B;  4BKT A;  2BYV E;  4HVB A;  3H7S A;  4FJY A;  1Q1O A;  1H4R A;  3ECI A;  5C23 A;  4EUT A;  2KWV B;  2G4S A;  2KFJ A;  3A9J B;  3SU8 X;  2KK8 A;  2JY6 A;  1BT0 A;  3L0W B;  3U8Z A;  1S3S G;  2LWP A;  2O2V B;  3NZS A;  5G2N A;  4W9D A;  3UGB B;  1P98 A;  2DAJ A;  4MJS A;  1GUA B;  3MJW A;  1RRB A;  2I1K A;  2WYQ A;  4II3 B;  2LXA A;  3IG3 A;  1SIF A;  2KC2 A;  3PS6 A;  4IWQ A;  1WZ0 A;  3PLU A;  2R2Q A;  2V1Y A;  2M8S A;  3A1Q B;  2YLM A;  3VH3 B;  4WAA A;  1AAR A;  3ALB A;  1OGW A;  2L0T A;  4MGI E;  4TKN A;  2O6V D;  1EF5 A;  4WWP A;  1RLF A;  4CHK A;  2L0F A;  2HJ8 A;  3KYD D;  5DPR A;  1WXV A;  5IA7 A;  3GOE A;  2M4N A;  3QX1 A;  3WA0 A;  1ZGU B;  5J18 A;  4GSW A;  2KMC A;  5JHA A;  2O6V A;  2FCQ A;  2OOB B;  2PE6 B;  3VVW B;  4PYZ A;  3K9O B;  1GC6 A;  3ML8 A;  2RPQ A;  3ZNG C;  1WF9 A;  3V6E B;  3WAL A;  2I1J A;  3M63 B;  3T8M A;  4NQL B;  5TR5 A;  2L8J A;  1A5R A;  4NY0 A;  3ZRC A;  1WE6 A;  3TJP A;  4MDK E;  2NCN A;  4AP4 C;  1GG3 A;  2K6D B;  4FLH A;  3KH0 A;  3VFK A;  3NZU A;  2K1F A;  2LJ5 A;  2M0X A;  4JGH B;  5JHB A;  4A3O A;  2FIF A;  4NAW A;  1RFA A;  2VRR B;  2DEN B;  2GOW A;  3L16 A;  4KV2 A;  4PS7 A;  3JW0 X;  2LUE A;  2CKH B;  2OJR A;  4HK2 A;  1IP9 A;  3RZF A;  2ZCB A;  3V61 A;  3KYC D;  3ENE A;  1G6J A;  1EO6 A;  2KWC A;  4N9F 4;  3UQB A;  3R7Q A;  4EEW A;  2MSE D;  4E71 A;  3HHM A;  2ZEQ A;  3ZVV A;  2FID A;  2L05 A;  5LXI B;  3KUD B;  4LJP B;  2DYB A;  3PTF C;  3RUL A;  3PRP B;  3APF A;  3UIP B;  2LVO A;  5J17 A;  4BOS C;  4DXA B;  2EMT A;  4DBG A;  1XT9 B;  5D6J B;  3VAW A;  4IC7 B;  1OEY A;  1J0G A;  5DPT A;  2J0K A;  2G45 B;  2JT4 B;  4X57 B;  2W9N A;  4K7S A;  5D94 A;  2GBJ A;  1WJN A;  2NBW B;  1WIA A;  3VTU A;  3UF8 A;  2C60 A;  3N3K B;  4I6L B;  2RSU A;  4WWN A;  2MBO A;  1IPG A;  3SHQ A;  4E74 A;  5CHV C;  2K8H A;  2KKC A;  5E6N A;  4DWF A;  1D3Z A;  4BKS A;  5CHW A;  4GN1 A;  1YQB A;  3W1S C;  2V3S A;  3NS8 A;  2JVC A;  3BY4 B;  4RM9 A;  1J8C A;  2KTR A;  2NBU A;  2N1V A;  2M1M A;  2UWQ A;  1WRD B;  1U4A A;  4ZYN A;  4DDI D;  1WM3 A;  2NS5 A;  3QJZ A;  4IM0 A;  4NAW B;  3TMP B;  1LM8 B;  1T0Y A;  3M62 B;  4A3P A;  1WFY A;  3IFW B;  3DBS A;  4LDT D;  3ZTD A;  1SGH A;  4EZJ A;  3A4R A;  4ANV A;  4E3C A;  3DVG Y;  3QA8 A;  4OVU A;  3PRM B;  1KLV A;  2QHO A;  3JVZ X;  3QC8 B;  2DYM A;  2D2Q A;  4B9K A;  1UH6 A;  2KLC A;  4B95 A;  4KZC A;  3M3J A;  4W9E A;  3HK0 A;  4JLC A;  3WAO A;  1RAX A;  4MH0 E;  4TQ1 A;  4NQK E;  4IUM B;  2MBQ A;  2XBB C;  3O65 B;  3AXC A;  1YJ1 A;  3A33 B;  2C7N B;  3L54 A;  3N30 A;  3IVF A;  4TUU A;  2R2O A;  2XEW A;  3DQV A;  5L95 C;  1KOT A;  2J7Q B;  1WZ3 A;  3ZIM A;  3LDZ E;  3QQ8 B;  1NI2 A;  2ZZP B;  4KVG B;  4MGZ E;  3P2B A;  3VUW A;  3EC8 A;  4HPM B;  3I3T B;  3OLM D;  4RMA A;  3VTV A;  4EFO A;  2HD5 B;  3VDZ A;  2KJ6 A;  2XK5 A;  3H6N A;  2K8B A;  1YD8 U;  1WXS A;  1PQS A;  4GDL B;  5D2M B;  2KDB A;  4GDK A;  2C7M B;  2N9P C;  3KVF B;  3V6C B;  4K7W A;  4DK5 A;  1WGY A;  1KM7 A;  3U30 A;  3RD2 A;  2LXC A;  2KO3 A;  4HDO A;  2FCN A;  2AL6 A;  1TZ1 A;  4WJO A;  3APC A;  2DX5 B;  1ISN A;  4ZRK A;  2GBK A;  2KFK A;  2N7D A;  2ZNV B;  3B0A A;  1I42 A;  2WX1 A;  4WWO A;  2HTH A;  1UBQ A;  1OQY A;  1Y8R C;  1V5O A;  2C7H A;  3PVL A;  2BYF A;  4ICU A;  4JIO U;  4JL9 A;  3TL5 A;  1OTR B;  1E8W A;  1I35 A;  2J0M A;  1HE8 A;  4AUQ C;  3CF6 E;  1QZE A;  1WMH B;  3RZW C;  1WXA A;  3TIX A;  4ANX A;  2DHZ A;  3UQA A;  2LGD A;  2IBI B;  2PPH A;  4MEL A;  1L7Y A;  2KZR A;  3PV1 A;  1WX8 A;  4G11 A;  2BKR B;  3IBE A;  3L10 B;  3K9P B;  3ZLZ A;  2IZV B;  1UD7 A;  4HWI B;  4FBJ B;  3PRE A;  1LFD A;  2FUH B;  3AU4 A;  5GMV A;  5E6O A;  3AU5 A;  4DHZ B;  3QWZ B;  4IWP A;  2WWZ A;  4YL8 A;  3A9K A;  5DPS A;  1EF1 A;  4G50 A;  4MJS B;  1EUV B;  1XD3 B;  3WIM A;  2A5U A;  1JRU A;  5HKH A;  2ZVO A;  4W9C A;  1P1A A;  2JUO A;  5J2R A;  1NBF C;  4EOY A;  3B1L X;  5AZG A;  3KUZ A;  3MHS D;  3X23 A;  2LAS A;  2MBB B;  2J0J A;  3H7P A;  1E5W A;  2IO2 B;  4W9K A;  4WJN A;  1L2N A;  3EEC A;  2MQJ A;  2GBM A;  1GNU A;  1UBI A;  2JZZ A;  1ZKH A;  2KLG A;  3R3M A;  3VUX A;  3QIJ A;  3T9L A;  4EZL A;  2DAF A;  4LDT B;  3PLV A;  3QK0 A;  2KDE B;  2L7R A;  4GDL A;  4M8M A;  3W1Y A;  4BVU C;  2MCN B;  2KTF A;  2KJR A;  3PRZ A;  3L08 A;  3VUY A;  2C5L C;  2G3Q B;  4GOC A;  4XC2 A;  2GMI C;  4MEM A;  3DBH I;  2LRW A;  3QHT A;  1TTN A;  1WX7 A;  1X1M A;  2KQS A;  5DCN A;  4LJO B;  2ZNV C;  4JQW C;  1K8R B;  4MGY E;  3TBL D;  4W9L A;  3ZDM C;  2BGF A;  4KSL C;  2JRI B;  3DBR I;  3W1S A;  1YX5 B;  3NHE B;  3ZKJ C;  3PHW B;  3H7P B;  4GXB A;  1S1Q B;  3H9D A;  2AL3 A;  2FCM A;  2KX3 A;  2N4F A;  2FCS A;  3OJ4 B;  2LZ6 A;  4FAD A;  1YX6 B;  5BO4 B;  1Z2M A;  3RYT A;  5C1Z A;  2LVP A;  3PGE A;  4GB9 A;  4IG7 B;  3S2A A;  3ONS A;  3UIO B;  3VTW A;  1GC7 A;  2DZI A;  3D32 A;  2A4Z A;  2MBE A;  3ZDT A;  3QAR A;  1TBE A;  3DBL I;  2DZM A;  4OVV A;  2EKE C;  3ZTC A;  4GDK B;  2ZCC A;  2CHZ A;  2IYD B;  5L83 A;  4ANU A;  4BOZ B;  1WXM A;  1VCB A;  2BF8 B;  2PEA A;  1WR1 A;  3V62 A;  2KFK B;  2KTR B;  2MLB A;  4KIK A;  3QCA A;  3PT2 B;  1F9J A;  5D7G A;  3DOW A;  5FR6 A;  1WJ6 A;  2GBR A;  5AZF A;  2RD0 A;  4G0N B;  2AYO B;  2BPS A;  2UYZ B;  1WH3 A;  3Q3F A;  4FN2 A;  2CR5 A;  1LXD A;  2ZJD A;  1E7V A;  2HE7 A;  4ICV A;  2NR2 A;  4FA6 A;  5KHO A;  5IAA C;  1E8Z A;  3QAQ A;  2D10 A;  2NBV B;  2KVR A;  3LJ3 A;  2D07 B;  2KAN A;  4FUL A;  3M95 A;  2JPH A;  2FNJ B;  4HCP B;  4XX5 A;  4DDG D;  3Q3J A;  2KHW B;  4AOF A;  4EZK A;  5AEK B;  5JH5 C;  4HPL B;  3U7D A;  2D11 A;  4CYE A;  2K8C A;  1P0R A;  3KUC B;  2RGF A;  3WAM A;  1C1Y B;  1P3Q U;  4BKS D;  4PS8 A;  2DZJ A;  3N32 A;  2DYO A;  2JXX A;  4KZ0 A;  2IY0 B;  2KDF B;  4CO7 A;  2LVQ A;  2REX A;  4W9H A;  4GGQ A;  2CHW A;  2N9E B;  4KDI C;  3BIN A;  3DPD A;  2WX0 A;  2XK5 B;  4PS3 A;  2K6Q A;  1V2Y A;  4AJW A;  3JYU A;  3DVN V;  5CX3 A;  2L00 B;  3DVN U;  3V60 A;  3APD A;  3ZNH B;  2N9X A;  4WQO B;  3RCZ A;  3KW5 B;  2DZK A;  3WAN A;  2Z0E B;  3PSE B;  4URK A;  2EMS A;  1Q0W B;  2JZ3 B;  3SDL C;  4MGK E;  4LCD E;  4BBN C;  4AWJ A;  5LLI A;  3ZNI D;  4IW0 A;  4P7I A;  4GU2 A;  1R4M I;  3JSV A;  3JSV B;  2IO3 B;  4DHZ E;  2LGY A;  2KXJ A;  4HLE A;  2V4L A;  2JRH A;  2L3Z A;  4HJK A;  2CS4 A;  1FXT B;  4ZRI A;  5CTR C;  3RUI B;  4EKU A;  4KIK B;  1MG8 A;  2MX2 A;  1WM2 A;  3L13 A;  4KSK C;  2MW5 A;  3CMM B;  4IWO A;  2IO0 B;  3R7R A;  3WAP A;  2KMA A;  2K25 A;  4GIV A;  2B3A A;  3L17 A;  1WI0 A;  3H1U A;  4A20 A;  2CU1 A;  4MM3 A;  1KJT A;  2O2V A;  2BWF A;  4KDL B;  4DHJ D;  1UGM A;  2AWT A;  4I6P A;  2NPT B;  2YVC A;  3ML9 A;  3A9J A;  1C3T A;  4F1S A;  1E8X A;  4NJ6 A;  3TCA A;  2BYE A;  1WR6 E;  2KN5 A;  2ZPN A;  4I6N B;  4NJ7 A;  3VQI A;  1H8C A;  2L76 A;  4HCN B;  4NNJ B;  2GBN A;  1WGH A;  4M8N A;  1WGR A;  1V81 A;  1SE9 A;  3B08 A;  3HM6 X;  4MSQ B;  3GZN I;  1CMX B;  2ASQ A;  1GJZ A;  2C9W B;  2RR9 A;  3CSF A;  4W9F A;  1WGD A;  2MWS B;  4GMV A;  4HXD A;  2KD0 A;  4RM8 A;  4F8C B;  1P9D U;  3AUL A;  2LRU A;  2BKF A;  1V86 A;  1V80 A;  3EFU A;  2ZPY A;  1V9J A;  3ZRF A;  5JZE B;  2O6V B;  3PZD A;  3SD5 A;  2KX0 A;  4ANW A;  4ZDV A;  1WJU A;  2N1W A;  3PPA A;  3UIN B;  2LGX A;  1WY8 A;  2FAZ A;  2ZVN A;  2M17 A;  4IM3 A;  4MSM B;  4W9G A;  4IM2 A;  2KC1 A;  3PHX B;  2Y5B B;  4J6I A;  4WJQ A;  1V5T A;  1YIW A;  1WX9 A;  2KJH B;  5CHF A;  1V49 A;  2IO1 B;  1M94 A;  1NDD A;  1WGG A;  1WMH A;  4W9J A;  3VHT C;  2N7E A;  2AEH A; 
#chains in the Genus database with same CATH topology
 3GP7 A;  3A1Q A;  4AJY B;  4BFR A;  1UEL A;  5BYS A;  4FJV B;  3OJ3 A;  3VXW A;  2PE9 A;  2H89 B;  1EM7 A;  2D3B A;  4G3X B;  4YSY B;  2PJH A;  3R66 C;  3LB8 C;  3DCG A;  2MRP A;  3MTN B;  2N7J A;  2NPT A;  2LD9 A;  1SEB D;  1J19 A;  2OED A;  3CWI A;  2K0P A;  1T5X D;  2MJE A;  1QT9 A;  3VR8 B;  3V05 A;  5BYR A;  4FHJ A;  1V6E A;  1QOB A;  2Z0D B;  4WAF A;  4JWU C;  2RPV A;  3OAW A;  3W5V B;  3AE8 B;  3C0R B;  3CST A;  2KWU B;  4HVB A;  2BYV E;  1Q1O A;  3NZ3 A;  3ZYY X;  1QIL A;  2INP E;  3IXS A;  1AYF A;  2KWV B;  2OJW A;  4LNK A;  2PKO A;  3U8Z A;  2QC8 A;  1QOF A;  4ACF A;  1S3S G;  5G2N A;  4DXG A;  2DAJ A;  4MJS A;  1ROE A;  1GB4 A;  2I1K A;  2WYQ A;  4II3 B;  1RM6 C;  3PS6 A;  2ON8 A;  3P1M A;  2M8S A;  3A1Q B;  3AEG B;  2YLM A;  3AE6 B;  3ALB A;  4MGI E;  4TKN A;  1TKY A;  4B0E A;  2E6X A;  3QX1 A;  5JHA A;  2FCQ A;  2JXT A;  4WIP A;  1P7E A;  2PE6 B;  3VVW B;  4D2K A;  3K9O B;  3ML8 A;  2I1J A;  1XF5 L;  2MH7 A;  4AP4 C;  1J7C A;  3KH0 A;  1ENF A;  2K1F A;  2M0X A;  4R3D A;  2QIL A;  4NAW A;  2VRR B;  2LUE A;  2OJR A;  2X38 A;  1IP9 A;  1G6J A;  3U2S C;  2WU5 B;  4Q2J A;  2L05 A;  4LJP B;  3UIP B;  3RUL A;  5J17 A;  4DXA B;  2EMT A;  1XT9 B;  5D6J B;  4IC7 B;  5DPT A;  2KAJ A;  1WIA A;  5EE3 A;  2C60 A;  4I6L B;  2RSU A;  4WWN A;  2MBO A;  1IPG A;  3SHQ A;  5E6N A;  2W3R A;  4BKS A;  5CHW A;  4C7Y A;  3W1S C;  2V3S A;  3NS8 A;  5IP4 D;  4L23 A;  1J8C A;  2KTR A;  2E3T A;  1WRD B;  1WM3 A;  3QJZ A;  4IM0 A;  4WQM A;  3GS2 A;  5FKA C;  1LM8 B;  4QAY A;  1F2R C;  4A3P A;  1WFY A;  1M4V A;  3A4R A;  4ANV A;  4E3C A;  3ZGZ A;  2UU7 A;  1KLV A;  1YN5 A;  2HDE A;  2KLC A;  3WAO A;  4NQK E;  4HKQ A;  3A33 B;  5IKC M;  3IVF A;  3DQV A;  3FC4 A;  1KOT A;  2JYT A;  1WZ3 A;  1FMA D;  3VUW A;  2KJ6 A;  3DBR B;  2KT7 A;  3H6N A;  1PQS A;  5D2M B;  2KDB A;  1PDX A;  1VDV A;  3KLS X;  3SFE B;  1N5W A;  2LXC A;  2IGH A;  2KO3 A;  3Q6B A;  2AL6 A;  1TZ1 A;  1ISN A;  5IOI A;  4ZRK A;  2KFK A;  3BII D;  2KVZ A;  2OHF A;  4ICU A;  1OQY A;  3PVL A;  2DBY A;  3P4P B;  4JL9 A;  1I35 A;  1L0V B;  1FEH A;  2J0M A;  3RZW C;  1QZE A;  1WMH B;  1I4H A;  3TIX A;  3I9V 1;  2KMM A;  4PT5 A;  2LMC A;  5GXG B;  3IBE A;  3ZLZ A;  2IZV B;  2I2Y A;  2K9X A;  2SAK A;  1LFD A;  3AEE B;  2WDQ B;  1NEK B;  5MPO A;  2L83 A;  2IGG A;  2JUO A;  1NBF C;  3B1L X;  1STE A;  2IGD A;  4YSX B;  1ET6 A;  3NVZ A;  2IO2 B;  3NJT A;  3ZJU A;  2JZZ A;  3VUX A;  1XLP A;  3QIJ A;  4EZL A;  4LDT B;  3QK0 A;  4GDL A;  4A8X C;  2ONQ A;  2WQY B;  4C56 C;  3AE3 B;  4IOI E;  2MCN B;  2XNA C;  3EUB 2;  3BK1 A;  3B9J A;  4XC2 A;  1ZE3 D;  3W9C B;  1OQR A;  1TTN A;  1JW9 D;  5DCN A;  1TS5 A;  4JQW C;  4LJO B;  3DBL B;  1RFK A;  4W9L A;  2JRI B;  3W1S A;  4P1B C;  4LTU A;  3W5U B;  3ZKJ C;  3H7P B;  1IBX B;  2FCM A;  4BAX A;  3OJ4 B;  4N6E B;  1YX6 B;  2L1A A;  1Z2M A;  1GAQ B;  4IG7 B;  3ZJT A;  1MI0 A;  3DBL I;  3L4P A;  2CHZ A;  2IYD B;  2Z8L A;  4HKZ E;  3PO0 A;  4BOZ B;  2J4X A;  4KGT A;  2LHE A;  4XWW A;  2PEA A;  2MLB A;  3ZJV A;  4C4V B;  1CK1 A;  2LFI A;  2WU2 B;  1YJI A;  1K51 A;  1MFW A;  2HE7 A;  4ICV A;  5KHO A;  3AE1 B;  2H88 B;  4DDG D;  1FRR A;  1FCC C;  5JH5 C;  1VLB A;  2KHW B;  4EZK A;  1F0Z A;  1P0R A;  1C1Y B;  1YQ4 B;  3N32 A;  2DYO A;  2EEL A;  1JQ4 A;  2JXX A;  4KZ0 A;  2KDF B;  3U52 E;  1PGX A;  2N9E B;  4ARC A;  4KDI C;  3NUH B;  1DOY A;  2K6Q A;  1C4A A;  3DVN V;  5CX3 A;  3N1Y C;  2M56 B;  5BYQ A;  4US9 A;  3V60 A;  3RCZ A;  3KW5 B;  2Z0E B;  1TKG A;  3BYT B;  3GE3 C;  3IAS 1;  2JZ3 B;  1FIQ A;  1NYR A;  1P7F A;  5LLI A;  4ZHP A;  3AE5 B;  3JSV B;  2IO3 B;  2KXJ A;  4HLE A;  5AUI A;  1T0S C;  4XDC A;  4OVZ A;  5H8Y E;  3TSS A;  1C78 A;  2V3P A;  3FAH A;  2CU1 A;  4BZA A;  4DHJ D;  2AWT A;  1BUI C;  5EE0 A;  2YVC A;  4M00 A;  4NJ6 A;  2BYE A;  2KN5 A;  4I6N B;  3RNE C;  3VQI A;  2L76 A;  4HCN B;  1KTK A;  2GBN A;  1WGH A;  3MHZ A;  4PK1 A;  2DNF A;  1GJZ A;  2GI9 A;  3CSF A;  4GMV A;  4HXD A;  4F8C B;  2KAC A;  1P9D U;  2LRU A;  3TEY A;  2FUG 1;  3PZD A;  3SD5 A;  1C77 A;  2N1W A;  3UIN B;  2LGX A;  4ZOH C;  1E9M A;  3PHX B;  1WX9 A;  1DOI A;  3RPF C;  1TYG B;  1FXA A;  1FFV A;  2JWZ A;  2D3G A;  3HIZ A;  3ZW3 A;  1E8Y A;  1ZW7 A;  2WS3 B;  1WYW B;  4K81 A;  3VH4 B;  4TMA B;  3I63 C;  1A70 A;  1V97 A;  3Q2A C;  2WDT B;  4US8 A;  4YTM B;  2KQ7 A;  2K39 A;  1TGZ B;  3URY A;  4USA A;  2XN9 C;  3C19 A;  4M0W B;  1F77 A;  4HDQ A;  1WJ4 A;  2BWE S;  3A4S C;  2KOX A;  3IT4 B;  4ZRP A;  4RGN A;  1TY0 A;  4FHK A;  3ZUN A;  1D5M C;  3AV8 A;  2BTE A;  1XQQ A;  2IY1 B;  3DVG X;  3TEX A;  3ZNZ B;  2CHX A;  3NY5 A;  4BKG A;  4BKT A;  2QJL A;  4OZA A;  3A9J B;  1BT0 A;  4YWG G;  3NZS A;  1P98 A;  1L5P A;  3IG3 A;  1SIF A;  2KC2 A;  1UUP A;  2V1Y A;  4RNA A;  1C4P A;  2O6V D;  4IDI A;  1WXQ A;  1FXI A;  3KYD D;  2HJ8 A;  3GOE A;  1Q10 A;  5J18 A;  2TSS A;  2O6V A;  4PYZ A;  1GC6 A;  2RPQ A;  1WF9 A;  3V6E B;  3WAL A;  1A5R A;  3TJP A;  2NCN A;  3GZN B;  1JWS D;  2BYT A;  4C00 A;  1GG3 A;  1FFU A;  4B0M A;  3NZU A;  1TY2 A;  4A3O A;  2FIF A;  3ZXV A;  3H8H A;  4KV2 A;  4PS7 A;  5FR3 A;  3V61 A;  2W54 A;  1L4Z B;  4E71 A;  2GB1 A;  3KUD B;  3APF A;  2LVO A;  4BOS C;  1FNW A;  3VAW A;  2R61 A;  3N20 C;  2INC C;  2J0K A;  1E0Z A;  4J3O D;  1WJN A;  3VTU A;  3UF8 A;  1QQR A;  5CHV C;  2KWD A;  1D3Z A;  1ZOY B;  3N1X C;  1FM0 D;  2M1M A;  4NAW B;  4LDT D;  3ZTD A;  1SGH A;  3ZXR A;  3DVG Y;  4HJG E;  1V1O A;  3T3O A;  4B95 A;  4KZC A;  4W9E A;  3HK0 A;  1RAX A;  4MH0 E;  4IUM B;  4YTP B;  2C7N B;  2WXN A;  2WXG A;  2D3C A;  2V0G A;  3ZIM A;  1NI2 A;  1R4M B;  3B2F A;  1XLN A;  1KLG D;  3OLM D;  2HD5 B;  3NG0 A;  1YD8 U;  1CJE A;  1L6V A;  4EE2 A;  2N9P C;  4JE3 B;  4KGR A;  1MJD A;  3U30 A;  3OWE B;  3AM9 A;  4P16 A;  2FCN A;  3NVY A;  3APC A;  2DX5 B;  4ZHO A;  2GBK A;  2ZNV B;  2L52 A;  3B0A A;  2N9L A;  4WWO A;  1UBQ A;  3Q14 C;  4JIO U;  1V5O A;  3AEB B;  1V8C A;  1WXA A;  2WHI A;  3AN1 A;  2WXI A;  2LGD A;  3ABV B;  1B1Z A;  5IN7 A;  4LNN A;  4G11 A;  2WP9 B;  1IUE A;  3L10 B;  1L6U A;  3K9P B;  2QMT A;  3FIL B;  1JWU D;  1FO4 A;  4HWI B;  4FBJ B;  3PRE A;  3R2T A;  2FUH B;  4KX6 B;  5E6O A;  3A9K A;  5EE1 A;  4MJS B;  1PGA A;  1N6Z A;  1JRU A;  5HKH A;  3DBH B;  4WH4 A;  4YT0 B;  5BMI A;  2MBB B;  1E5W A;  4W9K A;  3RNC C;  1SJE D;  3HVD A;  2ZW1 A;  5BMH A;  1UBI A;  4A6Q A;  1ZKH A;  2KLG A;  3R3M A;  2KDE B;  3RNF C;  5TSS A;  1N60 A;  2KTF A;  3AEC B;  1Y56 A;  2KJR A;  4GOC A;  2GMI C;  3Q3N C;  3DBH I;  2LRW A;  3QHT A;  2KYW A;  1JWM D;  1JRP A;  3E56 A;  3AEA B;  2BGF A;  3NVW A;  4KSL C;  3DBR I;  2BQQ A;  4ARI A;  2WNM A;  1EWC A;  1J7B A;  5BO4 B;  3ONS A;  3DWM A;  1GC7 A;  3D32 A;  3Q8E A;  3ZDT A;  2DZM A;  2ZCC A;  1UGJ A;  1ZDX A;  1BML C;  2BF8 B;  1VR9 A;  1WR1 A;  3V62 A;  4LNF A;  2KTR B;  1R7S A;  4KIK A;  3QCA A;  3PT2 B;  3DOW A;  1WJ6 A;  5JXV A;  2RD0 A;  3NRZ A;  4G0N B;  2BPS A;  4RH6 A;  2UYZ B;  1WH3 A;  4CQN A;  2CR5 A;  1LXD A;  2NR2 A;  3QAQ A;  2D10 A;  2J53 A;  2NBV B;  2KVR A;  4FUL A;  3M95 A;  3V3X A;  2K5P A;  2JPH A;  4HRS A;  2VZK D;  4XX5 A;  1KFY B;  3AEF B;  4CYE A;  1OQQ A;  2VZK B;  3MC9 A;  1KRH A;  2DZJ A;  3AED B;  2V3N A;  2REX A;  4GGQ A;  2Y5C A;  3Q69 A;  4PS3 A;  1FPY A;  2FE8 A;  4DXF A;  2QDF A;  2JSV X;  3RN9 C;  2BW2 A;  1RWS A;  2AQ2 B;  2CJN A;  1GB1 A;  2JRH A;  4ZRI A;  3RUI B;  4KIK B;  2MX2 A;  3RMK C;  3W2D A;  3WAP A;  3H1U A;  4A20 A;  3SR6 A;  2KQ4 X;  3IT6 B;  1C3T A;  1E8X A;  2Q5W D;  2ZPN A;  4NJ7 A;  1H8C A;  4C7Z A;  1FCL A;  1N61 A;  2M19 A;  1YN4 A;  3BWU D;  3Q8C A;  4XDD A;  1WGR A;  3HM6 X;  2C9W B;  1TS3 A;  2MWS B;  3AB5 A;  1IGD A;  4RM8 A;  2BKF A;  1AW7 A;  1NYQ A;  2MEK A;  2MHJ A;  3P63 A;  2FAZ A;  1DGJ A;  3RFZ B;  4MSM B;  4IM2 A;  1MHH E;  1K53 A;  4UDU C;  2W3S A;  4KGS A;  2WXM A;  5CHF A;  1V49 A;  1M94 A;  1WMH A;  4W9J A;  1OFF A;  4PYU A;  2PIA A;  3EHV A;  5DPW A;  5KHQ A;  4NPN A;  4XZ4 A;  3NOB A;  5AZH A;  1E7U A;  1YQ3 B;  5E6P A;  4TQ0 A;  5EE9 A;  4O1N A;  2N9K A;  2NVU I;  2Z59 B;  3DDC B;  3IHP C;  4K1R B;  4F7Z A;  4ZRJ A;  5G55 A;  4BBN F;  1TIF A;  1Z5S B;  4W9I A;  4B6W A;  2LI5 A;  2N0S B;  2MA9 B;  5HHD G;  2MP2 B;  2MP2 A;  2KDI A;  5LXH A;  1OEY J;  5EDS A;  3TEZ A;  1VD2 A;  4XGA B;  4M02 A;  4DHJ B;  3X0W A;  4XE0 A;  1XCQ L;  2LGS A;  1F2R I;  1WE7 A;  2GRI A;  2ACZ B;  3ECI A;  5C23 A;  1SBB B;  2G4S A;  3WCQ A;  3SU8 X;  2JY6 A;  2L32 A;  1ZPS A;  2IJ0 A;  3UGB B;  5D3I B;  4S17 A;  1GUA B;  4MH8 A;  1RRB A;  3P42 A;  2PVO D;  2Y3A A;  3LYY A;  1WZ0 A;  3PLU A;  2PLP A;  2R2Q A;  4REZ A;  4K3C A;  1LO5 D;  2L0T A;  3DHH C;  4WWP A;  1RLF A;  2L0F A;  2RDG A;  5DPR A;  5IA7 A;  1WXV A;  3WA0 A;  3C8Y A;  1ZGU B;  3OG5 A;  2KMC A;  1ACC A;  1TS2 A;  2JU6 X;  2RDB C;  2AX5 A;  2PW9 A;  3M63 B;  1DOX A;  1ZXI A;  1N5X A;  2V4I B;  4MDK E;  2WDV B;  2K6D B;  4FLH A;  3J9C A;  5HG2 A;  4JGH B;  1RFA A;  1YMH E;  2GOW A;  3L16 A;  2CKH B;  3BVM A;  5HI1 A;  2ZCB A;  3KYC D;  3ENE A;  1EO6 A;  1ZP0 B;  1N63 A;  4N9F 4;  3R7Q A;  4EEW A;  2ZEQ A;  2FID A;  5BMG A;  4H2A A;  1C79 A;  4IKG A;  4DBG A;  2BVC A;  1OEY A;  3SEB A;  2G45 B;  2JT4 B;  2W9N A;  4K7S A;  3N3K B;  4E74 A;  2W55 A;  3AE4 B;  2K8H A;  2JQR B;  4GN1 A;  1YQB A;  2IPK D;  3I5J C;  2NBU A;  2IDY A;  1HQR D;  1U4A A;  4ZYN A;  2NS5 A;  2PMV A;  3TMP B;  2FBW B;  1T0Y A;  3DBS A;  2J52 A;  2X8X X;  1IGC A;  4OVU A;  1NEN B;  1T0Q C;  1TS4 A;  2QHO A;  2JWU A;  3QC8 B;  4B9K A;  3M3J A;  4JLC A;  1SE4 A;  4TQ1 A;  2QEJ C;  2XBB C;  3N30 A;  1YOV B;  1D6E C;  2XEW A;  2J7Q B;  1MHX A;  3QQ8 B;  1T6B X;  4MGZ E;  5I4D A;  3P2B A;  1GOZ A;  3I3T B;  4RMA A;  3VRA B;  2K8B A;  2LJI A;  4GDL B;  2K3U A;  3ETR A;  3CIR B;  3KVF B;  4K7W A;  3N1Z C;  2LHD A;  1BXT A;  1FRD A;  1L0Y B;  3RD2 A;  1XCT L;  2BB6 A;  2NTT A;  1QLB B;  3BYY B;  4WJO A;  1ZDV A;  1B9R A;  2N7D A;  1I42 A;  2WX1 A;  4KKI A;  2HTH A;  3PZ7 A;  1MVK A;  1E6E B;  1XXG A;  2BYF A;  2WXR A;  1UWX A;  1OTR B;  1E8W A;  4OHJ A;  1PYW D;  4AUQ C;  1SE3 A;  3UQA A;  4ITK A;  2IBI B;  2KDM A;  2NTS A;  4MEL A;  1L7Y A;  1WX8 A;  2BKR B;  1JWB D;  1UD7 A;  3R8B A;  2AQ1 B;  1WSP A;  3AU4 A;  1QOG A;  4DHZ B;  4IWP A;  4YL8 A;  1EUV B;  1XD3 B;  2JZP A;  5J2R A;  1SSN A;  1YJJ A;  3KUZ A;  3MHS D;  3X23 A;  2LAS A;  2J0J A;  3EEC A;  5LNK 1;  1VRA B;  2GLS A;  1SF0 A;  3DWG C;  3T9L A;  1L0X B;  2DAF A;  4TSS A;  2CU3 A;  2YEP F;  2L7R A;  2BS2 B;  3W1Y A;  2W82 A;  3NS1 A;  1JRO A;  3VUY A;  1C9F A;  2CJO A;  3Q8A A;  1X1M A;  1C76 A;  4MGY E;  3ZDM C;  3RI7 C;  2WXH A;  4P6V F;  5T8I A;  1YX5 B;  3NHE B;  1DYQ A;  1CQV A;  2AL3 A;  2YEP B;  2N4F A;  1WGK A;  2FCS A;  5C1Z A;  4GB9 A;  1KLU D;  2BBC A;  1T3Q A;  2DZI A;  2A4Z A;  2M0A A;  2MBE A;  1I4G A;  3RNA C;  1TBE A;  4OVV A;  2EKE C;  3ZTC A;  4GDK B;  2WXO A;  5L83 A;  4N59 A;  1J7A A;  3SFD B;  1SB3 C;  2WXL A;  1XLQ A;  1CZP A;  1F9J A;  5D7G A;  1QF6 A;  2LGI A;  2I38 A;  3BZD B;  2GBR A;  5AZF A;  2AYO B;  3Q3F A;  2ZJD A;  4DQO C;  1E7V A;  4FA6 A;  4RFB A;  3LJ3 A;  3Q8B A;  2FNJ B;  4AOF A;  3R2I A;  2WDR B;  4HPL B;  4A90 A;  1PFD A;  3KUC B;  1WYG A;  2RGF A;  3WAM A;  1P3Q U;  4BKS D;  2DLB A;  2PTL A;  4PS8 A;  1YN3 A;  4RGM A;  2LVQ A;  4AQ7 A;  2XK5 B;  1T0R C;  1V2Y A;  4HRO A;  4AJW A;  2L00 B;  3ZNH B;  4WQO B;  3WAN A;  4RF1 A;  3PSE B;  4URK A;  2G9H D;  3SDL C;  2INN E;  4MGK E;  4LCD E;  1ZUD 2;  4AWJ A;  4IW0 A;  4P7I A;  3TUO A;  3JSV A;  1VZ6 A;  2LGY A;  2V4L A;  2AQ3 B;  4HJK A;  3O13 A;  3HVZ A;  2CS4 A;  1FXT B;  4EKU A;  5CTR C;  1MG8 A;  1WM2 A;  3ZQ4 A;  3L13 A;  1HA5 A;  4KSK C;  2QIE B;  3R7R A;  5FK9 C;  2KMA A;  4NJC A;  4GIV A;  2B3A A;  4HPP A;  1WI0 A;  2WXQ A;  1JAL A;  4JWS C;  3EFC A;  4I6P A;  5C2T B;  1ESF A;  1FNV A;  3ML9 A;  1WR6 E;  4M8N A;  4MSQ B;  1V81 A;  1SE9 A;  3B08 A;  2RDH A;  2WXJ A;  1CMX B;  2ASQ A;  2RR9 A;  2ZW0 A;  1UF0 A;  4W9F A;  1ZXH A;  2KD0 A;  3RNB C;  1R4N B;  3Q3O C;  1AN8 A;  5JZE B;  1JCK B;  3UI3 A;  4ZDV A;  2KX0 A;  4ANW A;  2SEB D;  1NI3 A;  4ZRQ A;  4RF0 A;  1TZO A;  2M17 A;  4IM3 A;  1VJK A;  2KC1 A;  1HEZ E;  1D5X C;  4J6I A;  4P1C C;  1YIW A;  4NZL B;  2KJH B;  2IO1 B;  1WGG A;  2N7E A;  2AEH A;  1IYF A;  1Q5W B;  1R4N I;  1HZ6 A;  3ZO5 B;  2JF5 A;  2LEK A;  3RNG C;  1TJE A;  4WJP A;  4FJZ A;  5IO9 A;  1HTQ A;  4ASW C;  4RGT A;  1WRI A;  4YSZ B;  1NVI D;  1TKE A;  3A9K B;  3LXF A;  3P4S B;  3HM3 A;  3BK2 A;  4TV3 A;  3RT3 B;  1F52 A;  3AI5 A;  3T3N A;  4M0W A;  3AE9 B;  2MBH A;  2G4D B;  3E9S A;  2HTM E;  4K7U A;  3TEW A;  2D5G A;  1LQB A;  4RGO S;  1E90 A;  4II2 B;  1UZX B;  2KNB A;  3H7S A;  3MFG A;  4FJY A;  1H4R A;  1MG4 A;  4EUT A;  4YXD B;  2KFJ A;  2KK8 A;  3KQ4 A;  3L0W B;  4MM3 B;  4HEA 1;  2O2V B;  2LWP A;  3PZ8 A;  4W9D A;  3MJW A;  4LLG M;  2ICI A;  2LXA A;  1XEE A;  2NMQ A;  4IWQ A;  4LNI A;  3AH7 A;  3VH3 B;  4WAA A;  1K50 A;  1AAR A;  1EU3 A;  1OGW A;  1QKZ A;  1EF5 A;  1UWM A;  4CHK A;  1F1H A;  2M4N A;  1EU4 A;  4GSW A;  2B76 B;  1K52 A;  2JX5 A;  2OOB B;  3MJ5 A;  3Q3M C;  4N58 A;  1YNT E;  3ZNG C;  3VRB B;  3T8M A;  4NQL B;  5TR5 A;  2L8J A;  4NY0 A;  3ZRC A;  1WE6 A;  1SXT A;  3VFK A;  2LJ5 A;  5JHB A;  1JWA D;  1JML A;  2DEN B;  4L2Y A;  3JW0 X;  4HK2 A;  3RZF A;  2QCZ A;  5G5H A;  2KWC A;  3UQB A;  2MSE D;  3HHM A;  3ZVV A;  5LXI B;  2WXP A;  2DYB A;  3PTF C;  3PRP B;  2QSD A;  3U7Z A;  1J0G A;  5HFY A;  4X57 B;  5D94 A;  2GBJ A;  2NBW B;  1I7H A;  2KKC A;  1TT5 B;  4DWF A;  1ET9 A;  2JVC A;  3BY4 B;  4RM9 A;  2N1V A;  2UWQ A;  3NVV A;  4DDI D;  3M62 B;  4RCO A;  3IFW B;  1HZ5 A;  4K3B A;  5G5G A;  4EZJ A;  3QA8 A;  3IAM 1;  3PRM B;  3JVZ X;  2DYM A;  2D2Q A;  1UH6 A;  3MC8 A;  4A55 A;  1XO3 A;  1KF6 B;  4ZYS A;  1V1P B;  2KN4 A;  4MAC A;  2BS3 B;  2MBQ A;  5C3J B;  3O65 B;  3AXC A;  1YJ1 A;  3L54 A;  1E10 A;  4TUU A;  2R2O A;  5L95 C;  3HRD D;  4NAM A;  5D3D A;  1SJH D;  3LDZ E;  2ZZP B;  4KVG B;  1EWY C;  3EC8 A;  4HPM B;  4EFO A;  4XYC A;  3VTV A;  3VDZ A;  2BS4 B;  2XK5 A;  4L1B A;  1WXS A;  4S0R A;  3MC0 B;  4GDK A;  2C7M B;  3V6C B;  1AWD A;  4DK5 A;  1WGY A;  3HUI A;  1KM7 A;  1D5Z C;  4HDO A;  2WGS A;  1VZ8 A;  4OZC A;  2V9H A;  5E6J A;  1Y8R C;  2C7H A;  3MP9 A;  1I4P A;  3TL5 A;  4JPS A;  1HE8 A;  3CF6 E;  1FD6 A;  4ANX A;  2DHZ A;  2PPH A;  2KZR A;  5AUK A;  3PV1 A;  3N9Y C;  3FKY A;  2WXK A;  5GMV A;  1SIJ A;  3AU5 A;  1N62 A;  3QWZ B;  2WWZ A;  5DPS A;  2VH1 A;  1EF1 A;  4G50 A;  1FNU A;  1SE2 A;  3WIM A;  2A5U A;  2ZVO A;  4W9C A;  1P1A A;  1XLO A;  4WWM A;  4EOY A;  5AZG A;  3H7P A;  4WJN A;  1L2N A;  2MQJ A;  1I4Q A;  2GBM A;  1C4C A;  1GNU A;  3EA6 A;  3PLV A;  2MJD A;  4M8M A;  4BVU C;  3PRZ A;  3L08 A;  2C5L C;  2G3Q B;  4MEM A;  3AE2 B;  3Q8F A;  1WX7 A;  2KQS A;  1MPE A;  2ZNV C;  1K8R B;  3TBL D;  3AMZ A;  2D3A A;  1GPX A;  4YTN B;  1I4R A;  1E7P B;  1HTO A;  4JX1 C;  3PHW B;  4GXB A;  1S1Q B;  3FIL A;  3H9D A;  4LK0 M;  2KX3 A;  2Y5P A;  2LZ6 A;  4FAD A;  3BVG A;  1PGB A;  3RYT A;  2LVP A;  3PGE A;  3S2A A;  3UIO B;  3VTW A;  3KWV A;  3QAR A;  2IND C;  4ANU A;  1WXM A;  1VCB A;  1QOA A;  3GB1 A;  2LUM A;  2KFK B;  4M01 A;  5FR6 A;  1RYJ A;  4LNO A;  4FN2 A;  2HJ1 A;  1I4X A;  5IAA C;  1E8Z A;  2D07 B;  4OZB A;  2KAN A;  2J42 A;  3DHI C;  2EKI A;  4HCP B;  3GE8 C;  3Q3J A;  4GLS C;  5AEK B;  2BB5 A;  3U7D A;  2D11 A;  4MT5 A;  2K8C A;  2WLB A;  3EGR A;  3KWL A;  2IY0 B;  4CO7 A;  4W9H A;  2CHW A;  4C80 A;  3BIN A;  3DPD A;  2WX0 A;  1UNS A;  3U4E G;  3JYU A;  3DVN U;  1PUT A;  3APD A;  2N9X A;  2DZK A;  3B2G A;  4KKJ A;  2EMS A;  1Q0W B;  1WWT A;  4BBN C;  2K22 A;  3ZNI D;  4GU2 A;  1R4M I;  4DHZ E;  2G1E A;  2PVG C;  1V1P A;  3VR9 B;  2L3Z A;  4XWT A;  1VZ7 A;  3P4R B;  2MJ3 A;  2MW5 A;  3CMM B;  2VH2 A;  2IO0 B;  4IWO A;  2K25 A;  1IBX A;  3L17 A;  2JYE A;  4FXC A;  1D4B A;  4MM3 A;  1KJT A;  2O2V A;  2BWF A;  3DHG C;  4KDL B;  1UGM A;  2RMM A;  5H92 C;  2NPT B;  4A9A A;  3A9J A;  4F1S A;  3TCA A;  3BVZ A;  4NNJ B;  1LGR A;  4WUR A;  2BT6 A;  4AS1 A;  3GZN I;  1L4D B;  4OW0 A;  1WGD A;  3AUL A;  3AE7 B;  1KH0 A;  1V86 A;  1V80 A;  3EFU A;  2ZPY A;  1V9J A;  3ZRF A;  4C4V A;  2O6V B;  1WJU A;  3PPA A;  2DWQ A;  1WY8 A;  3I57 A;  2ZVN A;  2WXF A;  4W9G A;  1HXY D;  2Y5B B;  4WJQ A;  1V5T A;  3P4Q B;  3VHT C;  1NDD A; 
#chains in the Genus database with same CATH homology
 3A1Q A;  4PYU A;  1IYF A;  1Q5W B;  2JWZ A;  2D3G A;  1R4N I;  3EHV A;  3HIZ A;  4AJY B;  4BFR A;  5DPW A;  3ZO5 B;  3ZW3 A;  5KHQ A;  1E8Y A;  1UEL A;  2JF5 A;  4NPN A;  4XZ4 A;  1ZW7 A;  4FJV B;  3OJ3 A;  3VXW A;  4WJP A;  3NOB A;  5AZH A;  2PE9 A;  4FJZ A;  1E7U A;  1WYW B;  4G3X B;  4ASW C;  2PJH A;  4K81 A;  3R66 C;  3VH4 B;  5E6P A;  3DCG A;  3A9K B;  4TQ0 A;  2MRP A;  2WDT B;  3MTN B;  2NVU I;  2Z59 B;  2KQ7 A;  2NPT A;  2K39 A;  3DDC B;  1TGZ B;  3IHP C;  4K1R B;  2LD9 A;  4F7Z A;  1J19 A;  3HM3 A;  4ZRJ A;  5G55 A;  4TV3 A;  4BBN F;  3RT3 B;  1Z5S B;  4W9I A;  3AI5 A;  4B6W A;  4M0W B;  4HDQ A;  2LI5 A;  2MA9 B;  1WJ4 A;  2MP2 B;  2BWE S;  2MP2 A;  2KDI A;  2MBH A;  5LXH A;  4FHJ A;  2G4D B;  1OEY J;  2KOX A;  1V6E A;  3A4S C;  2Z0D B;  5EDS A;  4FHK A;  4K7U A;  1VD2 A;  3ZUN A;  3OAW A;  1XQQ A;  2IY1 B;  3DVG X;  3X0W A;  3ZNZ B;  4DHJ B;  1LQB A;  2CHX A;  3NY5 A;  4BKG A;  1E90 A;  3C0R B;  1WE7 A;  1UZX B;  2KWU B;  2KNB A;  3CST A;  4II2 B;  4BKT A;  2BYV E;  4HVB A;  3H7S A;  4FJY A;  1Q1O A;  1H4R A;  3ECI A;  5C23 A;  4EUT A;  2KWV B;  2G4S A;  2KFJ A;  3A9J B;  3SU8 X;  2KK8 A;  2JY6 A;  1BT0 A;  3L0W B;  3U8Z A;  1S3S G;  2LWP A;  2O2V B;  3NZS A;  5G2N A;  4W9D A;  3UGB B;  1P98 A;  2DAJ A;  4MJS A;  1GUA B;  3MJW A;  1RRB A;  2I1K A;  2WYQ A;  4II3 B;  2LXA A;  3IG3 A;  1SIF A;  2KC2 A;  3PS6 A;  4IWQ A;  1WZ0 A;  3PLU A;  2R2Q A;  2V1Y A;  2M8S A;  3A1Q B;  2YLM A;  3VH3 B;  4WAA A;  1AAR A;  3ALB A;  1OGW A;  2L0T A;  4MGI E;  4TKN A;  2O6V D;  1EF5 A;  4WWP A;  1RLF A;  4CHK A;  2L0F A;  2HJ8 A;  3KYD D;  5DPR A;  1WXV A;  5IA7 A;  3GOE A;  2M4N A;  3QX1 A;  3WA0 A;  1ZGU B;  5J18 A;  4GSW A;  2KMC A;  5JHA A;  2O6V A;  2FCQ A;  2OOB B;  2PE6 B;  3VVW B;  4PYZ A;  3K9O B;  1GC6 A;  3ML8 A;  2RPQ A;  3ZNG C;  1WF9 A;  3V6E B;  3WAL A;  2I1J A;  3M63 B;  3T8M A;  4NQL B;  5TR5 A;  2L8J A;  1A5R A;  4NY0 A;  3ZRC A;  1WE6 A;  3TJP A;  4MDK E;  2NCN A;  4AP4 C;  1GG3 A;  2K6D B;  4FLH A;  3KH0 A;  3VFK A;  3NZU A;  2K1F A;  2LJ5 A;  2M0X A;  4JGH B;  5JHB A;  4A3O A;  2FIF A;  4NAW A;  1RFA A;  2VRR B;  2DEN B;  2GOW A;  3L16 A;  4KV2 A;  4PS7 A;  3JW0 X;  2LUE A;  2CKH B;  2OJR A;  4HK2 A;  1IP9 A;  3RZF A;  2ZCB A;  3V61 A;  3KYC D;  3ENE A;  1G6J A;  1EO6 A;  2KWC A;  4N9F 4;  3UQB A;  3R7Q A;  4EEW A;  2MSE D;  4E71 A;  3HHM A;  2ZEQ A;  3ZVV A;  2FID A;  2L05 A;  5LXI B;  3KUD B;  4LJP B;  2DYB A;  3PTF C;  3RUL A;  3PRP B;  3APF A;  3UIP B;  2LVO A;  5J17 A;  4BOS C;  4DXA B;  2EMT A;  4DBG A;  1XT9 B;  5D6J B;  3VAW A;  4IC7 B;  1OEY A;  1J0G A;  5DPT A;  2J0K A;  2G45 B;  2JT4 B;  4X57 B;  2W9N A;  4K7S A;  5D94 A;  2GBJ A;  1WJN A;  2NBW B;  1WIA A;  3VTU A;  3UF8 A;  2C60 A;  3N3K B;  4I6L B;  2RSU A;  4WWN A;  2MBO A;  1IPG A;  3SHQ A;  4E74 A;  5CHV C;  2K8H A;  2KKC A;  5E6N A;  4DWF A;  1D3Z A;  4BKS A;  5CHW A;  4GN1 A;  1YQB A;  3W1S C;  2V3S A;  3NS8 A;  2JVC A;  3BY4 B;  4RM9 A;  1J8C A;  2KTR A;  2NBU A;  2N1V A;  2M1M A;  2UWQ A;  1WRD B;  1U4A A;  4ZYN A;  4DDI D;  1WM3 A;  2NS5 A;  3QJZ A;  4IM0 A;  4NAW B;  3TMP B;  1LM8 B;  1T0Y A;  3M62 B;  4A3P A;  1WFY A;  3IFW B;  3DBS A;  4LDT D;  3ZTD A;  1SGH A;  4EZJ A;  3A4R A;  4ANV A;  4E3C A;  3DVG Y;  3QA8 A;  4OVU A;  3PRM B;  1KLV A;  2QHO A;  3JVZ X;  3QC8 B;  2DYM A;  2D2Q A;  4B9K A;  1UH6 A;  2KLC A;  4B95 A;  4KZC A;  3M3J A;  4W9E A;  3HK0 A;  4JLC A;  3WAO A;  1RAX A;  4MH0 E;  4TQ1 A;  4NQK E;  4IUM B;  2MBQ A;  2XBB C;  3O65 B;  3AXC A;  1YJ1 A;  3A33 B;  2C7N B;  3L54 A;  3N30 A;  3IVF A;  4TUU A;  2R2O A;  2XEW A;  3DQV A;  5L95 C;  1KOT A;  2J7Q B;  1WZ3 A;  3ZIM A;  3LDZ E;  3QQ8 B;  1NI2 A;  2ZZP B;  4KVG B;  4MGZ E;  3P2B A;  3VUW A;  3EC8 A;  4HPM B;  3I3T B;  3OLM D;  4RMA A;  3VTV A;  4EFO A;  2HD5 B;  3VDZ A;  2KJ6 A;  2XK5 A;  3H6N A;  2K8B A;  1YD8 U;  1WXS A;  1PQS A;  4GDL B;  5D2M B;  2KDB A;  4GDK A;  2C7M B;  2N9P C;  3KVF B;  3V6C B;  4K7W A;  4DK5 A;  1WGY A;  1KM7 A;  3U30 A;  3RD2 A;  2LXC A;  2KO3 A;  4HDO A;  2FCN A;  2AL6 A;  1TZ1 A;  4WJO A;  3APC A;  2DX5 B;  1ISN A;  4ZRK A;  2GBK A;  2KFK A;  2N7D A;  2ZNV B;  3B0A A;  1I42 A;  2WX1 A;  4WWO A;  2HTH A;  1UBQ A;  1OQY A;  1Y8R C;  1V5O A;  2C7H A;  3PVL A;  2BYF A;  4ICU A;  4JIO U;  4JL9 A;  3TL5 A;  1OTR B;  1E8W A;  1I35 A;  2J0M A;  1HE8 A;  4AUQ C;  3CF6 E;  1QZE A;  1WMH B;  3RZW C;  1WXA A;  3TIX A;  4ANX A;  2DHZ A;  3UQA A;  2LGD A;  2IBI B;  2PPH A;  4MEL A;  1L7Y A;  2KZR A;  3PV1 A;  1WX8 A;  4G11 A;  2BKR B;  3IBE A;  3L10 B;  3K9P B;  3ZLZ A;  2IZV B;  1UD7 A;  4HWI B;  4FBJ B;  3PRE A;  1LFD A;  2FUH B;  3AU4 A;  5GMV A;  5E6O A;  3AU5 A;  4DHZ B;  3QWZ B;  4IWP A;  2WWZ A;  4YL8 A;  3A9K A;  5DPS A;  1EF1 A;  4G50 A;  4MJS B;  1EUV B;  1XD3 B;  3WIM A;  2A5U A;  1JRU A;  5HKH A;  2ZVO A;  4W9C A;  1P1A A;  2JUO A;  5J2R A;  1NBF C;  4EOY A;  3B1L X;  5AZG A;  3KUZ A;  3MHS D;  3X23 A;  2LAS A;  2MBB B;  2J0J A;  3H7P A;  1E5W A;  2IO2 B;  4W9K A;  4WJN A;  1L2N A;  3EEC A;  2MQJ A;  2GBM A;  1GNU A;  1UBI A;  2JZZ A;  1ZKH A;  2KLG A;  3R3M A;  3VUX A;  3QIJ A;  3T9L A;  4EZL A;  2DAF A;  4LDT B;  3PLV A;  3QK0 A;  2KDE B;  2L7R A;  4GDL A;  4M8M A;  3W1Y A;  4BVU C;  2MCN B;  2KTF A;  2KJR A;  3PRZ A;  3L08 A;  3VUY A;  2C5L C;  2G3Q B;  4GOC A;  4XC2 A;  2GMI C;  4MEM A;  3DBH I;  2LRW A;  3QHT A;  1TTN A;  1WX7 A;  1X1M A;  2KQS A;  5DCN A;  4LJO B;  2ZNV C;  4JQW C;  1K8R B;  4MGY E;  3TBL D;  4W9L A;  3ZDM C;  2BGF A;  4KSL C;  2JRI B;  3DBR I;  3W1S A;  1YX5 B;  3NHE B;  3ZKJ C;  3PHW B;  3H7P B;  4GXB A;  1S1Q B;  3H9D A;  2AL3 A;  2FCM A;  2KX3 A;  2N4F A;  2FCS A;  3OJ4 B;  2LZ6 A;  4FAD A;  1YX6 B;  5BO4 B;  1Z2M A;  3RYT A;  5C1Z A;  2LVP A;  3PGE A;  4GB9 A;  4IG7 B;  3S2A A;  3ONS A;  3UIO B;  3VTW A;  1GC7 A;  2DZI A;  3D32 A;  2A4Z A;  2MBE A;  3ZDT A;  3QAR A;  1TBE A;  3DBL I;  2DZM A;  4OVV A;  2EKE C;  3ZTC A;  4GDK B;  2ZCC A;  2CHZ A;  2IYD B;  5L83 A;  4ANU A;  4BOZ B;  1WXM A;  1VCB A;  2BF8 B;  2PEA A;  1WR1 A;  3V62 A;  2KFK B;  2KTR B;  2MLB A;  4KIK A;  3QCA A;  3PT2 B;  1F9J A;  5D7G A;  3DOW A;  5FR6 A;  1WJ6 A;  2GBR A;  5AZF A;  2RD0 A;  4G0N B;  2AYO B;  2BPS A;  2UYZ B;  1WH3 A;  3Q3F A;  4FN2 A;  2CR5 A;  1LXD A;  2ZJD A;  1E7V A;  2HE7 A;  4ICV A;  2NR2 A;  4FA6 A;  5KHO A;  5IAA C;  1E8Z A;  3QAQ A;  2D10 A;  2NBV B;  2KVR A;  3LJ3 A;  2D07 B;  2KAN A;  4FUL A;  3M95 A;  2JPH A;  2FNJ B;  4HCP B;  4XX5 A;  4DDG D;  3Q3J A;  2KHW B;  4AOF A;  4EZK A;  5AEK B;  5JH5 C;  4HPL B;  3U7D A;  2D11 A;  4CYE A;  2K8C A;  1P0R A;  3KUC B;  2RGF A;  3WAM A;  1C1Y B;  1P3Q U;  4BKS D;  4PS8 A;  2DZJ A;  3N32 A;  2DYO A;  2JXX A;  4KZ0 A;  2IY0 B;  2KDF B;  4CO7 A;  2LVQ A;  2REX A;  4W9H A;  4GGQ A;  2CHW A;  2N9E B;  4KDI C;  3BIN A;  3DPD A;  2WX0 A;  2XK5 B;  4PS3 A;  2K6Q A;  1V2Y A;  4AJW A;  3JYU A;  3DVN V;  5CX3 A;  2L00 B;  3DVN U;  3V60 A;  3APD A;  3ZNH B;  2N9X A;  4WQO B;  3RCZ A;  3KW5 B;  2DZK A;  3WAN A;  2Z0E B;  3PSE B;  4URK A;  2EMS A;  1Q0W B;  2JZ3 B;  3SDL C;  4MGK E;  4LCD E;  4BBN C;  4AWJ A;  5LLI A;  3ZNI D;  4IW0 A;  4P7I A;  4GU2 A;  1R4M I;  3JSV A;  3JSV B;  2IO3 B;  4DHZ E;  2LGY A;  2KXJ A;  4HLE A;  2V4L A;  2JRH A;  2L3Z A;  4HJK A;  2CS4 A;  1FXT B;  4ZRI A;  5CTR C;  3RUI B;  4EKU A;  4KIK B;  1MG8 A;  2MX2 A;  1WM2 A;  3L13 A;  4KSK C;  2MW5 A;  3CMM B;  4IWO A;  2IO0 B;  3R7R A;  3WAP A;  2KMA A;  2K25 A;  4GIV A;  2B3A A;  3L17 A;  1WI0 A;  3H1U A;  4A20 A;  2CU1 A;  4MM3 A;  1KJT A;  2O2V A;  2BWF A;  4KDL B;  4DHJ D;  1UGM A;  2AWT A;  4I6P A;  2NPT B;  2YVC A;  3ML9 A;  3A9J A;  1C3T A;  4F1S A;  1E8X A;  4NJ6 A;  3TCA A;  2BYE A;  1WR6 E;  2KN5 A;  2ZPN A;  4I6N B;  4NJ7 A;  3VQI A;  1H8C A;  2L76 A;  4HCN B;  4NNJ B;  2GBN A;  1WGH A;  4M8N A;  1WGR A;  1V81 A;  1SE9 A;  3B08 A;  3HM6 X;  4MSQ B;  3GZN I;  1CMX B;  2ASQ A;  1GJZ A;  2C9W B;  2RR9 A;  3CSF A;  4W9F A;  1WGD A;  2MWS B;  4GMV A;  4HXD A;  2KD0 A;  4RM8 A;  4F8C B;  1P9D U;  3AUL A;  2LRU A;  2BKF A;  1V86 A;  1V80 A;  3EFU A;  2ZPY A;  1V9J A;  3ZRF A;  5JZE B;  2O6V B;  3PZD A;  3SD5 A;  2KX0 A;  4ANW A;  4ZDV A;  1WJU A;  2N1W A;  3PPA A;  3UIN B;  2LGX A;  1WY8 A;  2FAZ A;  2ZVN A;  2M17 A;  4IM3 A;  4MSM B;  4W9G A;  4IM2 A;  2KC1 A;  3PHX B;  2Y5B B;  4J6I A;  4WJQ A;  1V5T A;  1YIW A;  1WX9 A;  2KJH B;  5CHF A;  1V49 A;  2IO1 B;  1M94 A;  1NDD A;  1WGG A;  1WMH A;  4W9J A;  3VHT C;  2N7E A;  2AEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...