5CHFA

Crystal structure of murine isg15 in space group p21212
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
149
structure length
149
Chain Sequence
AWDLKVKMLGGNDFLVSVTNSMTVSELKKQIAQKIGVPAFQQRLAHQTAVLQDGLTLSSLGLGPSSTVMLVVQNSSEPLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQFWLSFEGRPMEDKELLGEYGLKPQCTVIKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antiviral protein
molecule keywords Ubiquitin-like protein ISG15
publication title Crystal structure of murine ISG15 in space group P21212
rcsb
source organism Mus musculus
total genus 38
structure length 149
sequence length 149
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5chfA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5chfA01
5IA7A 2JVCA 2MQJA 2FCQA 1LXDA 2L0TA 3Q3JA 4IWQA 3ONSA 3SU8X 1WGYA 3PREA 2KJHB 3QAQA 4AUQC 4HPMB 3ZDMC 2KMCA 3N32A 1XT9B 1V6EA 5D2MB 4IM0A 2WDTB 2R2QA 2L00B 4BBNC 4M8NA 4MGZE 4OVUA 3ZRCA 2LRUA 2N7EA 3VTWA 1P98A 2JUOA 3PVLA 4YL8A 1T0YA 3JVZX 1E7VA 1WM3A 3PLVA 1HE8A 1H4RA 1V81A 2FCSA 2FIFA 2LVPA 2HD5B 2J0KA 4I6PA 4GDLA 4RM9A 1E7UA 3A9KB 3MJWA 1RRBA 2XBBC 5C23A 2O2VA 5DPSA 5G2NA 4W9KA 3VVWB 2K8BA 2NBWB 2HJ8A 1VD2A 3W1YA 4LJOB 5JHAA 2RSUA 2MRPA 3GZNI 3ZRFA 1P0RA 4AWJA 2GOWA 3MTNB 4FJZA 2KFJA 4G11A 1WJNA 2JWZA 4MJSA 4BKSA 2AL3A 1S3SG 3PPAA 2L8JA 4G3XB 4JL9A 1KJTA 4X57B 2D2QA 3RCZA 3WAMA 3U8ZA 3VHTC 3U7DA 3APCA 2K39A 1WGHA 1Z5SB 4E3CA 1WF9A 3DVNU 4II3B 4IW0A 2FCMA 2IO0B 2KX3A 2M0XA 2PEAA 3TBLD 1J0GA 1VCBA 1UELA 2RR9A 2ZNVB 3M95A 2V4LA 3VFKA 4BKSD 4AP4C 4K7UA 3HK0A 1WX7A 1EO6A 1WX8A 4HVBA 4WJNA 2EKEC 2DHZA 1EF1A 2LVQA 1E8ZA 1V5OA 3QCAA 4DDID 3DOWA 4F7ZA 2LRWA 3N3KB 4M8MA 4ZRIA 3WAPA 3DVGY 2PE6B 5CTRC 1Q5WB 4K1RB 3NS8A 3PV1A 3RT3B 4DBGA 4BKGA 1WYWB 1I42A 2NBVB 3I3TB 2G45B 3B0AA 3HHMA 3L08A 3JYUA 4I6NB 3HM6X 4DHZB 3R7RA 3H6NA 2ZJDA 3DPDA 3APFA 2KLGA 3QARA 3ECIA 3QWZB 3NZSA 4J6IA 2N9XA 2J0MA 2C5LC 2M1MA 2N9EB 1EUVB 5AEKB 2JRIB 4NJ7A 5IAAC 3APDA 3ZDTA 3ZO5B 2BGFA 1GG3A 5CHVC 2KK8A 2HE7A 2L76A 1X1MA 2AYOB 2FIDA 3RZFA 3A1QA 3CSTA 3WALA 3PRMB 4BOZB 1Y8RC 1YQBA 2CU1A 2KC1A 5C1ZA 3TJPA 3CMMB 4ICVA 3KUZA 3K9PB 5CHFA 4B9KA 1F9JA 1Z2MA 3R7QA 1V86A 3ZNHB 4MGYE 1V49A 1M94A 3ZVVA 2V3SA 1UZXB 2K6QA 3H7PB 1E90A 3AU4A 2C7HA 2R2OA 3VUWA 3WA0A 4CHKA 4EOYA 4F1SA 1H8CA 1IPGA 2YLMA 2BYEA 1WGGA 2MSED 1OGWA 3D32A 5BO4B 3ML8A 3DVGX 3H1UA 4MH0E 2LD9A 4BBNF 2FAZA 3KUDB 3ZNID 4M0WB 4MSQB 3ZLZA 2KWUB 2BWFA 3W1SA 4OVVA 2N1VA 3A9JB 3UQBA 1L7YA 1UD7A 1WH3A 5D6JB 1ZKHA 1KOTA 4ZRJA 1E8WA 3ZUNA 1EF5A 2KANA 2LXCA 4NAWB 5JH5C 4LDTD 2FCNA 2Z59B 2C7MB 3AXCA 2LVOA 4W9EA 4BOSC 1YIWA 2O6VB 1NDDA 2NVUI 1LFDA 3AI5A 2BPSA 4FLHA 3L13A 1V80A 2ZVOA 2KNBA 3L0WB 4XX5A 4B95A 2DYOA 5L83A 4WWNA 1WIAA 1WR1A 3DBLI 3IHPC 4GXBA 2DAJA 2KWCA 1SGHA 4W9GA 1UGMA 3QC8B 2N1WA 2GMIC 1TTNA 2N7DA 1P1AA 2KO3A 3UIOB 3VAWA 2XK5B 4WJPA 1K8RB 3OJ4B 1WMHB 1E5WA 1V9JA 3L16A 4K81A 5J2RA 2D11A 3O65B 4ICUA 3VXWA 2RPQA 3PS6A 1TZ1A 2DZMA 5D7GA 5AZHA 3CSFA 2KDEB 3L54A 4W9DA 5E6PA 4N9F4 3SDLC 3T9LA 3ZNZB 2JZ3B 4EZJA 4K7WA 4DK5A 2KJ6A 2JZZA 4WQOB 3PSEB 2GBNA 2PJHA 2DZKA 4MJSB 2C60A 3ZTCA 4IWPA 1A5RA 4GIVA 4A3PA 4JQWC 4FJVB 4G0NB 1U4AA 3QIJA 3V6EB 2DYBA 2BF8B 4II2B 3NY5A 3JSVA 2RD0A 2KKCA 2JXXA 5L95C 1D3ZA 1J8CA 2MBBB 4HCNB 4W9LA 1GNUA 4FULA 1V5TA 4JIOU 2AL6A 4PS8A 1YX6B 4TQ0A 1YD8U 3UGBB 4KVGB 3EHVA 2D10A 3KYCD 2LGYA 4MSMB 3X23A 2K25A 3R66C 2UYZB 3AULA 2DZJA 2XEWA 4KZCA 2ZEQA 4IM3A 3DCGA 2J7QB 5KHOA 5LLIA 3DBSA 2JRHA 1ZW7A 3H9DA 3OJ3A 2MW5A 4DHJB 3ZIMA 3EECA 4HWIB 3PGEA 3RYTA 3GOEA 2KTRA 3ZNGC 4LCDE 2ASQA 3UIPB 3ALBA 3RUIB 2HTHA 1CMXB 2A4ZA 2JPHA 3HM3A 4XC2A 3OAWA 4XZ4A 4ANXA 3QX1A 3K9OB 4DWFA 5LXHA 2IYDB 3UQAA 1C3TA 4WAAA 1WXAA 2B3AA 2DENB 1WR6E 2PE9A 3A1QB 2LWPA 1WX9A 3VH3B 4B6WA 1OEYJ 4W9FA 2EMSA 3TMPB 4IG7B 2KDBA 4KDLB 4KV2A 1GC6A 3ENEA 4JLCA 1P9DU 2G4DB 2LI5A 4HDQA 2GBJA 3Q3FA 1YJ1A 5AZFA 3WAOA 3KW5B 4A20A 2KVRA 4KIKB 2M17A 4PYZA 2CS4A 2Y5BB 4ANVA 4JGHB 5DPRA 1E8YA 1KLVA 1ISNA 3DBHI 4GDKA 4NJ6A 4AJWA 3PHXB 1GC7A 2ZCCA 2KX0A 3RULA 1WE6A 4MGKE 4WJOA 2VRRB 3W1SC 4HCPB 4HK2A 1SIFA 2DZIA 4GMVA 1C1YB 4EEWA 1KM7A 4LDTB 4ASWC 2G3QB 2LUEA 1MG8A 2KMAA 3VH4B 1XQQA 3PLUA 3DQVA 4TV3A 4IC7B 1RAXA 3A4SC 2AEHA 2ZCBA 1Q1OA 2KFKA 3CF6E 1ZGUB 2GBKA 4W9IA 2BYFA 3RZWC 3UINB 4A3OA 2NBUA 3A4RA 2GBMA 1WY8A 2K8CA 2MP2B 2KLCA 3VUYA 1R4NI 4MDKE 3IVFA 1WGRA 4W9CA 2IO1B 3H7PA 2IY1B 3RD2A 5HKHA 5G55A 3V6CB 1LM8B 4ANWA 1WFYA 3U30A 3V62A 4EZKA 3BINA 1V2YA 2KDFB 5J18A 3ML9A 3H7SA 2WX1A 4P7IA 5JZEB 2NPTB 2L05A 2CR5A 2V1YA 3KUCB 2J0JA 2NR2A 2D3GA 3LJ3A 4TKNA 4AJYB 1NI2A 4GGQA 4ZDVA 3WANA 4BVUC 3IG3A 4BFRA 3VDZA 3A9JA 2LGDA 2KJRA 1RLFA 2Z0EB 3VQIA 2ZPYA 2FNJB 3EFUA 4DXAB 3QA8A 4MEMA 4NAWA 2MBOA 3QJZA 3NHEB 3N30A 4GDLB 4HJKA 3V61A 2N4FA 4FBJB 4WJQA 5JHBA 4WWPA 2O6VA 3C0RB 2MBEA 3UF8A 3EC8A 1L2NA 2WX0A 2O2VB 2MA9B 3B08A 2C7NB 1QZEA 2WYQA 2PPHA 5E6OA 2ZVNA 2IY0B 1YX5B 2CKHB 4CYEA 1P3QU 2BKRB 4URKA 1WJ6A 5CHWA 3TCAA 2MLBA 4NQKE 3LDZE 4FHJA 1UH6A 2REXA 3PRZA 5LXIB 2O6VD 2OJRA 2UWQA 5E6NA 1WZ0A 4PS3A 3PT2B 4W9JA 3T8MA 2LXAA 4DDGD 1OQYA 1NBFC 1GJZA 2KQ7A 3PTFC 2ZZPB 4EUTA 2KQSA 3JSVB 2XK5A 1R4MI 2ZPNA 4EZLA 1E8XA 1WE7A 5CX3A 4EFOA 1WM2A 1WMHA 2MBHA 2BKFA 3VUXA 3ZTDA 4NQLB 3A9KA 2IO3B 4FADA 4PYUA 1IP9A 4K7SA 2CHWA 1G6JA 2IZVB 2KXJA 2M8SA 1TBEA 4KZ0A 3PHWB 3QK0A 1WJUA 4IM2A 4KDIC 3SHQA 2LJ5A 3DDCB 2AWTA 2KHWB 4HDOA 5AZGA 3BY4B 2IBIB 4HPLB 3VTVA 3ZW3A 4WWOA 3ZKJC 4GSWA 2BWES 2JY6A 2ZNVC 3TIXA 3A33B 5EDSA 2I1KA 3M63B 3SD5A 2KTFA 1Q0WB 1J19A 2A5UA 2KTRB 2CHXA 1WXVA 4NPNA 4EKUA 2CHZA 2G4SA 2KC2A 2KWVB 4GU2A 2L7RA 1OTRB 2OOBB 3OLMD 2IO2B 4GB9A 4TQ1A 2MBQA 4FN2A 4I6LB 5DPTA 2DX5B 1FXTB 2JF5A 5KHQA 3QQ8B 3S2AA 2N9PC 2QHOA 4TUUA 2GBRA 1RFAA 3KVFB 4ZYNA 4FJYA 3P2BA 4MGIE 5DPWA 4G50A 2Z0DB 1BT0A 2K6DB 1OEYA 5DCNA 2BYVE 3PRPB 1WXSA 3M3JA 4GDKB 2FUHB 4NY0A 3IFWB 3DBRI 4FHKA 3TL5A 5TR5A 3B1LX 2KN5A 3WIMA 2RGFA 2DYMA 4DHJD 3DVNV 2KOXA 3KH0A 1XD3B 5D94A 4KSLC 5GMVA 2DAFA 2LASA 2D07B 1WZ3A 2KFKB 2WWZA 2M4NA 3KYDD 3R3MA 2KZRA 5J17A 4HLEA 4KSKC 4GN1A 4GOCA 4KIKA 2MWSB 4CO7A 4FA6A 1WRDB 1WJ4A 2MCNB 4F8CB 3JW0X 3L10B 4HXDA 4IWOA 2L0FA 2L3ZA 2KDIA 1GUAB 1SE9A 1UBIA 4RM8A 2KD0A 2NS5A 2LGXA 1UBQA 3M62B 3NZUA 1S1QB 2JT4B 4W9HA 4DHZE 4PS7A 3L17A 4BKTA 1JRUA 4ZRKA 3HIZA 2C9WB 1I35A 2EMTA 4AOFA 2W9NA 3PZDA 1WXMA 4NNJB 4ANUA 3V60A 1AARA 1TGZB 1LQBA 1WGDA 1PQSA 3X0WA 2K8HA 4LJPB 2MP2A 4RMAA 3NOBA 3AU5A 4MELA 2YVCA 3VTUA 2MX2A 5FR6A 2K1FA 4E71A 4E74A 1WI0A 1IYFA 4IUMB 4MM3A 3IBEA 3MHSD 3QHTA 2NPTA 2LZ6A 2NCNA 2I1JA
chains in the Genus database with same CATH superfamily
5IA7A 3Q3JA 2LHEA 1WGYA 3QAQA 2INCC 2KMCA 5D2MB 1HTQA 1NI3A 3ABVB 4M8NA 4OVUA 2LRUA 2JUOA 1XLOA 1T0YA 3AEAB 3PLVA 1HE8A 1DOXA 4I6PA 4GDLA 1FIQA 2J52A 3MJWA 1VD2A 3W1YA 4LJOB 4US8A 4YSYB 3ZRFA 1QOAA 2KFJA 4MJSA 2L8JA 4G3XB 1KJTA 1J7BA 2D2QA 4X57B 3RCZA 2AQ3B 3U8ZA 3WAMA 1WGHA 1EU3A 1Z5SB 2KMMA 3TUOA 1WF9A 4JWSC 2KX3A 4S0RA 2RR9A 3M95A 3VFKA 3P4PB 3DWMA 5T8IA 2LVQA 2PKOA 2K5PA 3DOWA 4F7ZA 5C2TB 3N3KB 2WHIA 1XLPA 3NS8A 3AM9A 3PV1A 4DBGA 5BYQA 1I42A 2NBVB 3L08A 3B0AA 4RGNA 4JE3B 3HM6X 2KDMA 3R7RA 2ZJDA 1ESFA 3ECIA 3QWZB 2JSVX 3Q8FA 2WXFA 3V05A 1LGRA 2KK8A 2HE7A 1QF6A 2FIDA 4O1NA 3RZFA 3CSTA 4M02A 2D3CA 3WALA 2CU1A 2KC1A 5C1ZA 2KQ4X 4ZYSA 4R3DA 3KUZA 3K9PB 1F0ZA 1JCKB 1OQQA 2V3SA 2K6QA 3WA0A 1FMAD 1MJDA 2BYEA 1WGGA 1EU4A 2MSED 1L0XB 3DVGX 3H1UA 1E9MA 1TS5A 1XLNA 2L83A 2N1VA 2V3PA 3EUB2 3UQBA 4P16A 3FILB 3ETRA 3ZUNA 2GB1A 2MEKA 2LXCA 5JH5C 1FO4A 2BT6A 2C7MB 2IGGA 2LVOA 3ZYYX 3DWGC 2VZKD 2NVUI 4QAYA 1V1PA 2DBYA 1GB4A 1GB1A 2IGHA 5HI1A 1L4DB 4XX5A 3L0WB 2DYOA 3LB8C 4WWNA 1DGJA 1WR1A 3DBLI 2KWCA 3Q3MC 1FD6A 1HEZE 1AWDA 3UIOB 1CJEA 3OJ4B 4K81A 2D11A 1UF0A 3O65B 3PS6A 5D7GA 4YSZB 2X38A 3PSEB 2WXGA 2VH1A 2C60A 4L23A 3ZTCA 4IWPA 3SFEB 3QIJA 2EKIA 4II2B 3NY5A 1RYJA 5L95C 4LNNA 1D3ZA 1J8CA 4HCNB 2QIEB 1E6EB 2FBWB 4WQMA 1P7FA 3EHVA 2WXHA 2LGYA 2K25A 4Q2JA 3U2SC 2ZEQA 3OJ3A 2MW5A 3ZIMA 4HWIB 3PZ7A 2NTTA 4LLGM 3GOEA 1I4RA 3ZNGC 2WXJA 2A4ZA 1SB3C 3OAWA 2IYDB 4WAAA 2B3AA 3VH3B 3SR6A 2LWPA 1UWXA 3TMPB 2BS2B 1YJ1A 4XWTA 3KW5B 1T5XD 2M17A 4PYZA 1SE4A 2CS4A 5DPRA 5GXGB 3DBHI 3EA6A 2ZCCA 1ZOYB 3W1SC 2GRIA 4GMVA 4EEWA 1KM7A 5IKCM 4RGOS 3VH4B 1XQQA 3CF6E 2AEHA 2KFKA 2GBKA 3B2FA 3UINB 1AW7A 2NBUA 2QCZA 2K8CA 1R4NI 3H7PA 5G55A 1LM8B 1ET9A 4A55A 3ML9A 1CZPA 3N1ZC 3FC4A 3KUCB 2V1YA 4AJYB 1TJEA 2K0PA 1F52A 2GI9A 2LGSA 3IG3A 2KJRA 1RLFA 2CJNA 1FNVA 1JWAD 2FNJB 3EFUA 3QA8A 2DWQA 3AE1B 4FBJB 1LO5D 2MBEA 3UF8A 2MA9B 2WDRB 4ACFA 1QZEA 3HUIA 2MJ3A 1QQRA 2W3RA 5CHWA 2MLBA 3ZXRA 1R4MB 2OJRA 1QILA 3T8MA 3PT2B 3BK1A 4W9JA 2LXAA 4DDGD 1OQYA 1NBFC 2KQ7A 3PTFC 3JSVB 2XK5A 1XCQL 4EZLA 1E8XA 1NYQA 1FFVA 3WCQA 1WMHA 4NQLB 3A9KA 4FADA 1IP9A 1FM0D 1QLBB 1G6JA 1D4BA 4KZ0A 1WJUA 4C00A 1D5ZC 4IM2A 4KKJA 2CU3A 2LJ5A 3SHQA 5AZGA 3BY4B 3VTVA 3ZW3A 3ZKJC 2BWES 4B0EA 2LJIA 2KTFA 1L4ZB 2CHZA 2G4SA 2KWVB 2PVGC 2ZW0A 4GU2A 3OLMD 2OOBB 4TQ1A 3P4SB 4JX1C 4MH8A 1VZ8A 4ITKA 3Q3NC 2DX5B 1FXTB 2JF5A 3QQ8B 2QHOA 4TUUA 2GBRA 1RFAA 3KVFB 4ZYNA 3NVZA 3P1MA 3Q8EA 2DNFA 1OEYA 5DCNA 4P1BC 3Q8AA 1WXSA 3W2DA 2LFIA 4OZCA 4FHKA 3DVNV 2DAFA 2D07B 2RDBC 1YQ4B 4J3OD 1QOFA 4GOCA 4KIKA 4CO7A 4F8CB 2L3ZA 2KD0A 2LGXA 2JT4B 2VH2A 4M0WA 2JX5A 4ZHPA 3I9V1 5JXVA 1I35A 1JWSD 3PZDA 3AE9B 2V3NA 2ICIA 1WGDA 5EE0A 1BUIC 4MELA 2ON8A 5FR6A 1WI0A 1J7AA 1IYFA 2TSSA 2M0AA 4IUMB 2V0GA 2KYWA 3MHSD 2WXPA 2IJ0A 2I1JA 2FCQA 1LXDA 2KJHB 4HPMB 1E10A 3TEYA 4DQOC 2R2QA 1MI0A 4BBNC 3NUHB 4YL8A 1WM3A 1H4RA 1V81A 2LVPA 2HD5B 3BVZA 1V1OA 1RRBA 2XBBC 5DPSA 5G2NA 4A8XC 3RNCC 4W9KA 3RNEC 3VVWB 1VRAB 5BYRA 1TY2A 2HJ8A 5JHAA 3GZNI 1VJKA 1P7EA 4AWJA 3MTNB 4FJZA 1T0SC 4G11A 2JWZA 4BKSA 4JL9A 3ZJTA 4E3CA 1V8CA 3DVNU 1TYGB 4S17A 4IW0A 2PEAA 1ZDVA 1J0GA 1XO3A 2V4LA 2WU2B 3SEBA 1WX8A 4WJNA 2DHZA 3QCAA 3AEEB 4M8MA 4ZRIA 1IBXA 1NENB 1Q5WB 4WURA 3AE8B 3RT3B 1N5XA 3I3TB 3DBRB 4C4VA 3DPDA 1E7PB 3QARA 2N9XA 5EE9A 5IAAC 3ZO5B 2BGFA 2L76A 4CQNA 3I57A 3A1QA 3BVMA 3DHHC 4B9KA 1F9JA 1Z2MA 3MJ5A 3ZNHB 3ZVVA 3VUWA 4CHKA 3U52E 3ML8A 4BBNF 3EGRA 2FAZA 4MSQB 2AQ2B 1L5PA 2HJ1A 4OVVA 3A9JB 1ZKHA 1KOTA 1FNWA 1E8WA 2KANA 4NAWB 1TKGA 4LDTD 2FCNA 4YWGG 1N6ZA 3RN9C 1YIWA 2O6VB 4USAA 5BMHA 2KNBA 1TS3A 5L83A 4UDUC 3RFZB 4GXBA 4ARIA 3IT4B 1UGMA 3QC8B 1L0VB 1FXIA 2WXRA 3W5UB 1TTNA 3VAWA 2KO3A 1I4XA 4IDIA 2OHFA 1Y56A 4HROA 3CSFA 4W9DA 3T9LA 3ZNZB 4K7WA 2IDYA 2JZZA 4WQOB 2PJHA 4MJSB 3U4EG 1VZ7A 4GIVA 4JQWC 2PTLA 4G0NB 1KLGD 1J7CA 4YSXB 2Q5WD 3V6EB 3P4RB 3RNAC 1L6UA 2RD0A 2V4IB 4JIOU 1HZ5A 1YD8U 1XEEA 2LHDA 4MSMB 3AULA 4KZCA 4IM3A 5LLIA 2OJWA 1ZW7A 1I4PA 2WQYB 4XYCA 1YMHE 3PGEA 2MJDA 2HTHA 2JPHA 1RFKA 3HM3A 4XZ4A 4ANXA 2ACZB 1PGAA 3IAM1 1WR6E 2PE9A 1WX9A 1OEYJ 4IG7B 2MH7A 4KDLB 1GC6A 3HRDD 4JLCA 1P9DU 3VRBB 2G4DB 2GBJA 3Q3FA 3WAOA 4A20A 4KGSA 4JGHB 3HVZA 1E8YA 1KLVA 1ISNA 2R61A 4RFBA 4NJ6A 2IPKD 4AJWA 2KX0A 4AS1A 4MGKE 4WJOA 2VRRB 4HCPB 1SIFA 4LDTB 2G3QB 1MG8A 2RMMA 4IC7B 3A4SC 1RAXA 1Q1OA 1TKEA 4W9IA 2I38A 1TZOA 2BQQA 3A4RA 4RCOA 2MP2B 3VUYA 4W9CA 2KACA 2IY1B 5D3DA 2LGIA 1JALA 3V6CB 3AE7B 4ANWA 3U30A 3BINA 3UI3A 1D5XC 2KDFB 3TEWA 5JZEB 1FPYA 4ZRPA 4TKNA 2NR2A 3LJ3A 1F2RC 2X8XX 4GGQA 1T6BX 3VDZA 2LGDA 3GS2A 4PT5A 2PLPA 3FILA 4DXAB 4MEMA 3P42A 3NHEB 3N30A 4HJKA 4WWPA 4RH6A 2WX0A 2O2VB 2WXIA 2C7NB 2WYQA 2Z8LA 4JPSA 1P3QU 1SE3A 3LDZE 2WU5B 1UH6A 3ZJVA 1I4HA 3PRZA 2QMTA 4A9AA 5E6NA 1WZ0A 1GJZA 3LYYA 2ZZPB 2JQRB 2KQSA 2WDQB 1R7SA 1WM2A 2BKFA 3I5JC 2IO3B 3AEFB 4K7SA 3V3XA 1AYFA 2KXJA 2M8SA 4MT5A 1TBEA 3QK0A 4KDIC 4YT0B 2AWTA 2KHWB 4HPLB 3AMZA 4IKGA 2N7JA 2DLBA 1NVID 2ZNVC 3TIXA 3A33B 2I1KA 3M63B 5HHDG 1ZP0B 3SD5A 1Q0WB 1J19A 4REZA 2CHXA 4C56C 1WXVA 3AV8A 2L7RA 1BMLC 2IO2B 1MVKA 1XXGA 4I6LB 5DPTA 2N9PC 1F1HA 2NMQA 3P2BA 4G50A 2Z0DB 2BYVE 3TEXA 3Q3OC 2FUHB 1SBBB 4NY0A 2OEDA 3WIMA 2XNAC 3CWIA 2DYMA 4DHJD 1E0ZA 3KH0A 1XD3B 2ZW1A 1RM6C 2KFKB 1UGJA 2WWZA 2VZKB 1KF6B 5J17A 2M19A 4KSKC 3H8HA 2MWSB 1WJ4A 4IWOA 1JQ4A 1JWMD 2L0FA 2KDIA 2L32A 4RM8A 2WP9B 3NZUA 5TSSA 4W9HA 2MJEA 4ZRKA 1KH0A 3NG0A 4AOFA 2W9NA 1WXMA 1SIJA 4EE2A 3V60A 1AARA 1LQBA 4LJPB 1TS2A 3NOBA 3W5VB 3N20C 1VLBA 2YVCA 3VTUA 2MX2A 4E71A 3Q14C 1MHHE 3Q2AC 3IBEA 5AUKA 3AB5A 1BXTA 1IGCA 5IOIA 3ONSA 3PREA 3ZDMC 2Y5CA 3N32A 1XT9B 1V6EA 2CJOA 4L2YA 1CQVA 2WDTB 2L00B 4MGZE 3VTWA 1P98A 3PVLA 3Q6BA 1ACCA 2BTEA 2J0KA 3A9KB 5C23A 3Q8BA 2N9KA 2QSDA 1ZE3D 2K8BA 3TSSA 2GOWA 3NVVA 1WJNA 2AL3A 1S3SG 4YXDB 3APCA 4II3B 5FR3A 1N60A 2IO0B 4NZLB 1OQRA 2QJLA 2BS4B 1VCBA 1WSPA 1ZUD2 5IO9A 2ZNVB 1HA5A 4BKSD 4AP4C 5HG2A 3HK0A 2LMCA 3Q69A 1EO6A 2EKEC 1EF1A 1E8ZA 4YTNB 4DDID 1T0RC 1WGKA 5G5GA 2LRWA 1SXTA 3WAPA 3DVGY 5E6JA 5HFYA 3PZ8A 4K1RB 1WYWB 3HHMA 4DHZB 2G45B 3AE6B 3JYUA 4XGAB 3H6NA 3MFGA 4OHJA 3NZSA 3T3NA 1NEKB 2M1MA 2C5LC 2JRIB 4M00A 5BMGA 3ZDTA 1X1MA 2AYOB 3KWVA 3PRMB 3NRZA 4BOZB 3CMMB 5CHFA 1I4GA 4OVZA 1N63A 3R7QA 1V49A 1M94A 2FE8A 3W9CB 3AU4A 2C7HA 4F1SA 2INPE 1N5WA 2YLMA 1PGXA 1MHXA 3D32A 5BO4B 2SAKA 1B9RA 5D3IB 2LD9A 1AN8A 3GE3C 4M0WB 4C7ZA 4RF0A 3W1SA 3B9JA 4NJCA 1UNSA 5AUIA 1L7YA 1UD7A 1WH3A 3MC9A 1FCCC 5D6JB 1YN4A 4M01A 3AE3B 4BOSC 1NDDA 2BPSA 4FLHA 3L13A 2ZVOA 4B95A 1YNTE 1FFUA 1B1ZA 4XDDA 3IHPC 3NVWA 3R2IA 1SJHD 2WXMA 2GMIC 1L0YB 1SF0A 1K53A 2N7DA 1XCTL 1P1AA 4WJPA 1E5WA 1V9JA 3L16A 2BYTA 3VXWA 2DZMA 3SDLC 5E6PA 1Q10A 2JZ3B 3P63A 4US9A 4DK5A 2KJ6A 4HEA1 2DZKA 1HTOA 1A5RA 2INNE 2K9XA 4A3PA 3ZQ4A 2B76B 1N61A 2WXLA 3IAS1 4GLSC 2RDHA 2JXXA 4W9LA 1V5TA 1YX6B 2I2YA 4KVGB 2D10A 3X23A 3R66C 2DZJA 1IBXB 3RI7C 4YTMB 3DCGA 2J7QB 1VR9A 3N1XC 3DBSA 3H9DA 1JWUD 2J53A 4C4VB 3RYTA 2ONQA 5H8YE 2KTRA 3VRAB 4LCDE 2ASQA 3UIPB 3ALBA 3RUIB 4XWWA 4XC2A 1CMXB 5LXHA 3QX1A 3K9OB 1ET6A 1C3TA 1VZ6A 2DENB 3A1QB 1DOYA 4K3BA 2PIAA 1FNUA 4W9FA 2EMSA 2HDEA 4KV2A 2AX5A 4HDQA 1C77A 2KVRA 4ANVA 1JW9D 2Y5BB 1C4AA 4GDKA 4A6QA 3GE8C 2QDFA 1GC7A 3RULA 2G9HD 3GP7A 4LTUA 1NYRA 4HK2A 1C1YB 4KGRA 2KMAA 3PLUA 3TJPA 1C9FA 1ZGUB 4A3OA 3E9SA 3BZDB 3IVFA 3E56A 4N58A 1KFYB 2IO1B 3O13A 3RMKC 4HKQA 1WFYA 3V62A 4EZKA 1V2YA 2W55A 3B2GA 4MM3B 5J18A 3DBLB 3H7SA 4P7IA 2NPTB 2CR5A 2GLSA 2J0JA 2D3GA 3BWUD 1ZXHA 4BVUC 1N62A 1FRDA 4BFRA 1FEHA 3A9JA 3VQIA 4XE0A 4NAMA 2ZPYA 2D5GA 2WXKA 4H2AA 4NAWA 3QJZA 1K51A 3AH7A 4P6VF 1MG4A 4GDLB 1C79A 2O6VA 3EC8A 2PW9A 3OG5A 2PVOD 3B08A 2KWDA 5G5HA 2PPHA 5E6OA 2ZVNA 2IY0B 2UU7A 2CKHB 4CYEA 1MFWA 4ZOHC 4PK1A 3TCAA 2REXA 5LXIB 4PS3A 4EUTA 2WXNA 2SEBD 1HZ6A 2ZPNA 1WE7A 3VUXA 3ZTDA 2CHWA 2N9LA 3PHWB 3DDCB 1PGBA 4HDOA 2J42A 5C3JB 2IBIB 3LXFA 1KTKA 4YTPB 4WWOA 4GSWA 2JY6A 1HQRD 2KN4A 1QOBA 5EDSA 3AEDB 3NZ3A 4NPNA 4EKUA 1GOZA 1GAQB 4GB9A 5H92C 3PO0A 5KHQA 3S2AA 4FJYA 3I63C 1F77A 3DBHB 4MGIE 3AEBB 2QILA 3BK2A 2K6DB 4FXCA 3DBRI 1K50A 3B1LX 2KN5A 5TR5A 4HJGE 5BYSA 4WH4A 4KSLC 4D2KA 1XF5L 1R4NB 2WXOA 1ZDXA 2M4NA 3KYDD 3R3MA 2KZRA 3N1YC 3BVGA 1JRPA 4HLEA 2QEJC 2JXTA 3VR9B 1I4QA 5LNK1 3OWEB 2MCNB 2BB6A 3C19A 1UBIA 2W54A 4AQ7A 1S1QB 1V1PB 4PS7A 1SJED 3Q8CA 4BKTA 1JRUA 3AECB 2EMTA 3R2TA 5FK9C 4ANUA 3X0WA 2K8HA 5IN7A 2MP2A 4RMAA 2WS3B 3AU5A 4WWMA 2K1FA 4E74A 1PFDA 3HVDA 1C4PA 3QHTA 1UUPA 1GPXA 1T0QC 1JWBD 2JVCA 2MQJA 4IWQA 2L0TA 3SU8X 2IGDA 1ZPSA 4AUQC 1A70A 4IM0A 3R8BA 3ZRCA 2N7EA 2E6XA 3JVZX 1E7VA 2BB5A 3L4PA 2H88B 2FCSA 2FIFA 1YJIA 4RM9A 1E7UA 3URYA 2O2VA 2K3UA 1XLQA 2NBWB 2RSUA 2MRPA 1P0RA 3PPAA 3BIID 2L52A 3VHTC 3U7DA 2K39A 1KLUD 2FCMA 2M0XA 2JYTA 3TBLD 4KX6B 1EM7A 1UWMA 1UELA 4K3CA 1IGDA 4RNAA 4K7UA 1WX7A 2WGSA 4HVBA 2AQ1B 4BAXA 3EFCA 4ARCA 2PE6B 5CTRC 3C8YA 3KLSX 2D3AA 4HRSA 1WXQA 4BKGA 4I6NB 3AE5B 1ROEA 4LNOA 1TT5B 3APFA 2KLGA 1FRRA 4J6IA 2J0MA 1D5MC 2N9EB 2INDC 1EUVB 5AEKB 1FCLA 3VR8B 4NJ7A 3APDA 3NVYA 1GG3A 5CHVC 2W82A 3FAHA 4B0MA 5IP4D 1DYQA 1SSNA 1Y8RC 1YQBA 1PYWD 4WIPA 1SE2A 4ICVA 4LNFA 1VDVA 3DHIC 1V86A 2D3BA 4MGYE 3RPFC 2JYEA 1T3QA 1UZXB 3H7PB 4JWUC 1E90A 2BBCA 2FUG1 2R2OA 4EOYA 1H8CA 1IPGA 1OGWA 2J4XA 2KAJA 4MH0E 3KUDB 4ZRQA 3ZNID 3GB1A 3ZLZA 4HKZE 2KWUB 2BWFA 3NS1A 1HXYD 4P1CC 3AEGB 4OZBA 3T3OA 3AN1A 4ZRJA 1EF5A 4LNKA 1ZXIA 2Z59B 3AXCA 4W9EA 2W3SA 1LFDA 3AI5A 1QOGA 1V80A 2NTSA 1WIAA 2L1AA 2DAJA 1SGHA 4KKIA 2G1EA 4W9GA 2N1WA 3SFDB 2YEPF 4RGTA 2WNMA 2BW2A 2XK5B 1K8RB 3GZNB 1WWTA 1WMHB 5J2RA 5FKAC 4L1BA 3AE2B 4ICUA 2RPQA 1TZ1A 5AZHA 2KDEB 3L54A 4EZJA 4N9F4 2HTME 2GBNA 1L6VA 2Y3AA 2BS3B 4C7YA 5EE3A 4FJVB 1PUTA 4RGMA 1U4AA 2DYBA 1ENFA 4C80A 2BF8B 3JSVA 2JWUA 2KKCA 2MBBB 1GNUA 4FULA 1SEBD 3MP9A 2AL6A 4PS8A 4TQ0A 5BMIA 3UGBB 3KYCD 1C76A 4DXFA 2YEPB 2M56B 2UYZB 2XEWA 5KHOA 4TSSA 2JRHA 4DHJB 3EECA 4RF1A 3KQ4A 2PMVA 5I4DA 2LUMA 4DWFA 3UQAA 1FXAA 1WXAA 3BYTB 4B6WA 2BVCA 2KT7A 2JZPA 2KDBA 3KWLA 3ENEA 1CK1A 2LI5A 5AZFA 4KIKB 2WLBA 4WAFA 1TY0A 2H89B 3PHXB 1V97A 1WE6A 1PDXA 2DZIA 4ASWC 2LUEA 3DQVA 4TV3A 1JROA 2ZCBA 1YN5A 3RZWC 2BYFA 2GBMA 1WY8A 4MACA 2KLCA 4MDKE 1WGRA 3RD2A 5HKHA 3U7ZA 2XN9C 3TEZA 1RWSA 1STEA 1JMLA 2WX1A 2L05A 5MPOA 4ZDVA 3IXSA 1NI2A 2N0SB 3WANA 4LK0M 3AE4B 3ZGZA 2Z0EB 3CIRB 3P4QB 2K22A 2MBOA 4N59A 1F2RI 3V61A 5JHBA 2N4FA 4WJQA 3C0RB 1L2NA 2RDGA 1YX5B 2WDVB 2E3TA 2RPVA 2BKRB 4URKA 1WJ6A 4OW0A 1QKZA 4NQKE 4FHJA 4BZAA 3MC0B 2O6VD 2WXQA 2UWQA 4DXGA 1R4MI 4N6EB 5CX3A 4EFOA 2MBHA 4XDCA 4PYUA 1WRIA 2IZVB 1M4VA 2KVZA 1C4CA 3DHGC 1YN3A 1QT9A 4ZHOA 4IOIE 1YJJA 1TIFA 4LNIA 2A5UA 2KTRB 1WYGA 1DOIA 2KC2A 1OTRB 3IT6B 3RNBC 1TS4A 2MBQA 1YOVB 4FN2A 3MHZA 3MC8A 2V9HA 3N9YC 3RNGC 2MHJA 5DPWA 2QC8A 1BT0A 3ZJUA 4OZAA 3PRPB 3M3JA 4GDKB 3FKYA 3IFWB 3TL5A 2RGFA 3J9CA 2KOXA 5D94A 5GMVA 2LEKA 2LASA 1OFFA 1WZ3A 1I7HA 5EE1A 1D6EC 4GN1A 4TMAB 4FA6A 1WRDB 3JW0X 3L10B 4HXDA 1GUAB 4KGTA 4A90A 1C78A 1SE9A 2NS5A 1UBQA 3M62B 4DHZE 3L17A 2EELA 2JU6X 1MPEA 1EWCA 3HIZA 2C9WB 3BYYB 4NNJB 1TGZB 1PQSA 1TKYA 3NJTA 4HPPA 1YQ3B 1K52A 1EWYC 1KRHA 4MM3A 3RNFC 2Y5PA 1IUEA 2NPTA 3ZXVA 2LZ6A 2NCNA 1V5OA
chains in the Genus database with same CATH topology
5IA7A 2JVCA 2MQJA 2FCQA 1LXDA 2L0TA 3Q3JA 4IWQA 3ONSA 3SU8X 1WGYA 3PREA 2KJHB 3QAQA 4AUQC 4HPMB 3ZDMC 2KMCA 3N32A 1XT9B 1V6EA 5D2MB 4IM0A 2WDTB 2R2QA 2L00B 4BBNC 4M8NA 4MGZE 4OVUA 3ZRCA 2LRUA 2N7EA 3VTWA 1P98A 2JUOA 3PVLA 4YL8A 1T0YA 3JVZX 1E7VA 1WM3A 3PLVA 1HE8A 1H4RA 1V81A 2FCSA 2FIFA 2LVPA 2HD5B 2J0KA 4I6PA 4GDLA 4RM9A 1E7UA 3A9KB 3MJWA 1RRBA 2XBBC 5C23A 2O2VA 5DPSA 5G2NA 4W9KA 3VVWB 2K8BA 2NBWB 2HJ8A 1VD2A 3W1YA 4LJOB 5JHAA 2RSUA 2MRPA 3GZNI 3ZRFA 1P0RA 4AWJA 2GOWA 3MTNB 4FJZA 2KFJA 4G11A 1WJNA 2JWZA 4MJSA 4BKSA 2AL3A 1S3SG 3PPAA 2L8JA 4G3XB 4JL9A 1KJTA 4X57B 2D2QA 3RCZA 3WAMA 3U8ZA 3VHTC 3U7DA 3APCA 2K39A 1WGHA 1Z5SB 4E3CA 1WF9A 3DVNU 4II3B 4IW0A 2FCMA 2IO0B 2KX3A 2M0XA 2PEAA 3TBLD 1J0GA 1VCBA 1UELA 2RR9A 2ZNVB 3M95A 2V4LA 3VFKA 4BKSD 4AP4C 4K7UA 3HK0A 1WX7A 1EO6A 1WX8A 4HVBA 4WJNA 2EKEC 2DHZA 1EF1A 2LVQA 1E8ZA 1V5OA 3QCAA 4DDID 3DOWA 4F7ZA 2LRWA 3N3KB 4M8MA 4ZRIA 3WAPA 3DVGY 2PE6B 5CTRC 1Q5WB 4K1RB 3NS8A 3PV1A 3RT3B 4DBGA 4BKGA 1WYWB 1I42A 2NBVB 3I3TB 2G45B 3B0AA 3HHMA 3L08A 3JYUA 4I6NB 3HM6X 4DHZB 3R7RA 3H6NA 2ZJDA 3DPDA 3APFA 2KLGA 3QARA 3ECIA 3QWZB 3NZSA 4J6IA 2N9XA 2J0MA 2C5LC 2M1MA 2N9EB 1EUVB 5AEKB 2JRIB 4NJ7A 5IAAC 3APDA 3ZDTA 3ZO5B 2BGFA 1GG3A 5CHVC 2KK8A 2HE7A 2L76A 1X1MA 2AYOB 2FIDA 3RZFA 3A1QA 3CSTA 3WALA 3PRMB 4BOZB 1Y8RC 1YQBA 2CU1A 2KC1A 5C1ZA 3TJPA 3CMMB 4ICVA 3KUZA 3K9PB 5CHFA 4B9KA 1F9JA 1Z2MA 3R7QA 1V86A 3ZNHB 4MGYE 1V49A 1M94A 3ZVVA 2V3SA 1UZXB 2K6QA 3H7PB 1E90A 3AU4A 2C7HA 2R2OA 3VUWA 3WA0A 4CHKA 4EOYA 4F1SA 1H8CA 1IPGA 2YLMA 2BYEA 1WGGA 2MSED 1OGWA 3D32A 5BO4B 3ML8A 3DVGX 3H1UA 4MH0E 2LD9A 4BBNF 2FAZA 3KUDB 3ZNID 4M0WB 4MSQB 3ZLZA 2KWUB 2BWFA 3W1SA 4OVVA 2N1VA 3A9JB 3UQBA 1L7YA 1UD7A 1WH3A 5D6JB 1ZKHA 1KOTA 4ZRJA 1E8WA 3ZUNA 1EF5A 2KANA 2LXCA 4NAWB 5JH5C 4LDTD 2FCNA 2Z59B 2C7MB 3AXCA 2LVOA 4W9EA 4BOSC 1YIWA 2O6VB 1NDDA 2NVUI 1LFDA 3AI5A 2BPSA 4FLHA 3L13A 1V80A 2ZVOA 2KNBA 3L0WB 4XX5A 4B95A 2DYOA 5L83A 4WWNA 1WIAA 1WR1A 3DBLI 3IHPC 4GXBA 2DAJA 2KWCA 1SGHA 4W9GA 1UGMA 3QC8B 2N1WA 2GMIC 1TTNA 2N7DA 1P1AA 2KO3A 3UIOB 3VAWA 2XK5B 4WJPA 1K8RB 3OJ4B 1WMHB 1E5WA 1V9JA 3L16A 4K81A 5J2RA 2D11A 3O65B 4ICUA 3VXWA 2RPQA 3PS6A 1TZ1A 2DZMA 5D7GA 5AZHA 3CSFA 2KDEB 3L54A 4W9DA 5E6PA 4N9F4 3SDLC 3T9LA 3ZNZB 2JZ3B 4EZJA 4K7WA 4DK5A 2KJ6A 2JZZA 4WQOB 3PSEB 2GBNA 2PJHA 2DZKA 4MJSB 2C60A 3ZTCA 4IWPA 1A5RA 4GIVA 4A3PA 4JQWC 4FJVB 4G0NB 1U4AA 3QIJA 3V6EB 2DYBA 2BF8B 4II2B 3NY5A 3JSVA 2RD0A 2KKCA 2JXXA 5L95C 1D3ZA 1J8CA 2MBBB 4HCNB 4W9LA 1GNUA 4FULA 1V5TA 4JIOU 2AL6A 4PS8A 1YX6B 4TQ0A 1YD8U 3UGBB 4KVGB 3EHVA 2D10A 3KYCD 2LGYA 4MSMB 3X23A 2K25A 3R66C 2UYZB 3AULA 2DZJA 2XEWA 4KZCA 2ZEQA 4IM3A 3DCGA 2J7QB 5KHOA 5LLIA 3DBSA 2JRHA 1ZW7A 3H9DA 3OJ3A 2MW5A 4DHJB 3ZIMA 3EECA 4HWIB 3PGEA 3RYTA 3GOEA 2KTRA 3ZNGC 4LCDE 2ASQA 3UIPB 3ALBA 3RUIB 2HTHA 1CMXB 2A4ZA 2JPHA 3HM3A 4XC2A 3OAWA 4XZ4A 4ANXA 3QX1A 3K9OB 4DWFA 5LXHA 2IYDB 3UQAA 1C3TA 4WAAA 1WXAA 2B3AA 2DENB 1WR6E 2PE9A 3A1QB 2LWPA 1WX9A 3VH3B 4B6WA 1OEYJ 4W9FA 2EMSA 3TMPB 4IG7B 2KDBA 4KDLB 4KV2A 1GC6A 3ENEA 4JLCA 1P9DU 2G4DB 2LI5A 4HDQA 2GBJA 3Q3FA 1YJ1A 5AZFA 3WAOA 3KW5B 4A20A 2KVRA 4KIKB 2M17A 4PYZA 2CS4A 2Y5BB 4ANVA 4JGHB 5DPRA 1E8YA 1KLVA 1ISNA 3DBHI 4GDKA 4NJ6A 4AJWA 3PHXB 1GC7A 2ZCCA 2KX0A 3RULA 1WE6A 4MGKE 4WJOA 2VRRB 3W1SC 4HCPB 4HK2A 1SIFA 2DZIA 4GMVA 1C1YB 4EEWA 1KM7A 4LDTB 4ASWC 2G3QB 2LUEA 1MG8A 2KMAA 3VH4B 1XQQA 3PLUA 3DQVA 4TV3A 4IC7B 1RAXA 3A4SC 2AEHA 2ZCBA 1Q1OA 2KFKA 3CF6E 1ZGUB 2GBKA 4W9IA 2BYFA 3RZWC 3UINB 4A3OA 2NBUA 3A4RA 2GBMA 1WY8A 2K8CA 2MP2B 2KLCA 3VUYA 1R4NI 4MDKE 3IVFA 1WGRA 4W9CA 2IO1B 3H7PA 2IY1B 3RD2A 5HKHA 5G55A 3V6CB 1LM8B 4ANWA 1WFYA 3U30A 3V62A 4EZKA 3BINA 1V2YA 2KDFB 5J18A 3ML9A 3H7SA 2WX1A 4P7IA 5JZEB 2NPTB 2L05A 2CR5A 2V1YA 3KUCB 2J0JA 2NR2A 2D3GA 3LJ3A 4TKNA 4AJYB 1NI2A 4GGQA 4ZDVA 3WANA 4BVUC 3IG3A 4BFRA 3VDZA 3A9JA 2LGDA 2KJRA 1RLFA 2Z0EB 3VQIA 2ZPYA 2FNJB 3EFUA 4DXAB 3QA8A 4MEMA 4NAWA 2MBOA 3QJZA 3NHEB 3N30A 4GDLB 4HJKA 3V61A 2N4FA 4FBJB 4WJQA 5JHBA 4WWPA 2O6VA 3C0RB 2MBEA 3UF8A 3EC8A 1L2NA 2WX0A 2O2VB 2MA9B 3B08A 2C7NB 1QZEA 2WYQA 2PPHA 5E6OA 2ZVNA 2IY0B 1YX5B 2CKHB 4CYEA 1P3QU 2BKRB 4URKA 1WJ6A 5CHWA 3TCAA 2MLBA 4NQKE 3LDZE 4FHJA 1UH6A 2REXA 3PRZA 5LXIB 2O6VD 2OJRA 2UWQA 5E6NA 1WZ0A 4PS3A 3PT2B 4W9JA 3T8MA 2LXAA 4DDGD 1OQYA 1NBFC 1GJZA 2KQ7A 3PTFC 2ZZPB 4EUTA 2KQSA 3JSVB 2XK5A 1R4MI 2ZPNA 4EZLA 1E8XA 1WE7A 5CX3A 4EFOA 1WM2A 1WMHA 2MBHA 2BKFA 3VUXA 3ZTDA 4NQLB 3A9KA 2IO3B 4FADA 4PYUA 1IP9A 4K7SA 2CHWA 1G6JA 2IZVB 2KXJA 2M8SA 1TBEA 4KZ0A 3PHWB 3QK0A 1WJUA 4IM2A 4KDIC 3SHQA 2LJ5A 3DDCB 2AWTA 2KHWB 4HDOA 5AZGA 3BY4B 2IBIB 4HPLB 3VTVA 3ZW3A 4WWOA 3ZKJC 4GSWA 2BWES 2JY6A 2ZNVC 3TIXA 3A33B 5EDSA 2I1KA 3M63B 3SD5A 2KTFA 1Q0WB 1J19A 2A5UA 2KTRB 2CHXA 1WXVA 4NPNA 4EKUA 2CHZA 2G4SA 2KC2A 2KWVB 4GU2A 2L7RA 1OTRB 2OOBB 3OLMD 2IO2B 4GB9A 4TQ1A 2MBQA 4FN2A 4I6LB 5DPTA 2DX5B 1FXTB 2JF5A 5KHQA 3QQ8B 3S2AA 2N9PC 2QHOA 4TUUA 2GBRA 1RFAA 3KVFB 4ZYNA 4FJYA 3P2BA 4MGIE 5DPWA 4G50A 2Z0DB 1BT0A 2K6DB 1OEYA 5DCNA 2BYVE 3PRPB 1WXSA 3M3JA 4GDKB 2FUHB 4NY0A 3IFWB 3DBRI 4FHKA 3TL5A 5TR5A 3B1LX 2KN5A 3WIMA 2RGFA 2DYMA 4DHJD 3DVNV 2KOXA 3KH0A 1XD3B 5D94A 4KSLC 5GMVA 2DAFA 2LASA 2D07B 1WZ3A 2KFKB 2WWZA 2M4NA 3KYDD 3R3MA 2KZRA 5J17A 4HLEA 4KSKC 4GN1A 4GOCA 4KIKA 2MWSB 4CO7A 4FA6A 1WRDB 1WJ4A 2MCNB 4F8CB 3JW0X 3L10B 4HXDA 4IWOA 2L0FA 2L3ZA 2KDIA 1GUAB 1SE9A 1UBIA 4RM8A 2KD0A 2NS5A 2LGXA 1UBQA 3M62B 3NZUA 1S1QB 2JT4B 4W9HA 4DHZE 4PS7A 3L17A 4BKTA 1JRUA 4ZRKA 3HIZA 2C9WB 1I35A 2EMTA 4AOFA 2W9NA 3PZDA 1WXMA 4NNJB 4ANUA 3V60A 1AARA 1TGZB 1LQBA 1WGDA 1PQSA 3X0WA 2K8HA 4LJPB 2MP2A 4RMAA 3NOBA 3AU5A 4MELA 2YVCA 3VTUA 2MX2A 5FR6A 2K1FA 4E71A 4E74A 1WI0A 1IYFA 4IUMB 4MM3A 3IBEA 3MHSD 3QHTA 2NPTA 2LZ6A 2NCNA 2I1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IA7 A;  2JVC A;  2MQJ A;  2FCQ A;  1LXD A;  2L0T A;  3Q3J A;  4IWQ A;  3ONS A;  3SU8 X;  1WGY A;  3PRE A;  2KJH B;  3QAQ A;  4AUQ C;  4HPM B;  3ZDM C;  2KMC A;  3N32 A;  1XT9 B;  1V6E A;  5D2M B;  4IM0 A;  2WDT B;  2R2Q A;  2L00 B;  4BBN C;  4M8N A;  4MGZ E;  4OVU A;  3ZRC A;  2LRU A;  2N7E A;  3VTW A;  1P98 A;  2JUO A;  3PVL A;  4YL8 A;  1T0Y A;  3JVZ X;  1E7V A;  1WM3 A;  3PLV A;  1HE8 A;  1H4R A;  1V81 A;  2FCS A;  2FIF A;  2LVP A;  2HD5 B;  2J0K A;  4I6P A;  4GDL A;  4RM9 A;  1E7U A;  3A9K B;  3MJW A;  1RRB A;  2XBB C;  5C23 A;  2O2V A;  5DPS A;  5G2N A;  4W9K A;  3VVW B;  2K8B A;  2NBW B;  2HJ8 A;  1VD2 A;  3W1Y A;  4LJO B;  5JHA A;  2RSU A;  2MRP A;  3GZN I;  3ZRF A;  1P0R A;  4AWJ A;  2GOW A;  3MTN B;  4FJZ A;  2KFJ A;  4G11 A;  1WJN A;  2JWZ A;  4MJS A;  4BKS A;  2AL3 A;  1S3S G;  3PPA A;  2L8J A;  4G3X B;  4JL9 A;  1KJT A;  4X57 B;  2D2Q A;  3RCZ A;  3WAM A;  3U8Z A;  3VHT C;  3U7D A;  3APC A;  2K39 A;  1WGH A;  1Z5S B;  4E3C A;  1WF9 A;  3DVN U;  4II3 B;  4IW0 A;  2FCM A;  2IO0 B;  2KX3 A;  2M0X A;  2PEA A;  3TBL D;  1J0G A;  1VCB A;  1UEL A;  2RR9 A;  2ZNV B;  3M95 A;  2V4L A;  3VFK A;  4BKS D;  4AP4 C;  4K7U A;  3HK0 A;  1WX7 A;  1EO6 A;  1WX8 A;  4HVB A;  4WJN A;  2EKE C;  2DHZ A;  1EF1 A;  2LVQ A;  1E8Z A;  1V5O A;  3QCA A;  4DDI D;  3DOW A;  4F7Z A;  2LRW A;  3N3K B;  4M8M A;  4ZRI A;  3WAP A;  3DVG Y;  2PE6 B;  5CTR C;  1Q5W B;  4K1R B;  3NS8 A;  3PV1 A;  3RT3 B;  4DBG A;  4BKG A;  1WYW B;  1I42 A;  2NBV B;  3I3T B;  2G45 B;  3B0A A;  3HHM A;  3L08 A;  3JYU A;  4I6N B;  3HM6 X;  4DHZ B;  3R7R A;  3H6N A;  2ZJD A;  3DPD A;  3APF A;  2KLG A;  3QAR A;  3ECI A;  3QWZ B;  3NZS A;  4J6I A;  2N9X A;  2J0M A;  2C5L C;  2M1M A;  2N9E B;  1EUV B;  5AEK B;  2JRI B;  4NJ7 A;  5IAA C;  3APD A;  3ZDT A;  3ZO5 B;  2BGF A;  1GG3 A;  5CHV C;  2KK8 A;  2HE7 A;  2L76 A;  1X1M A;  2AYO B;  2FID A;  3RZF A;  3A1Q A;  3CST A;  3WAL A;  3PRM B;  4BOZ B;  1Y8R C;  1YQB A;  2CU1 A;  2KC1 A;  5C1Z A;  3TJP A;  3CMM B;  4ICV A;  3KUZ A;  3K9P B;  5CHF A;  4B9K A;  1F9J A;  1Z2M A;  3R7Q A;  1V86 A;  3ZNH B;  4MGY E;  1V49 A;  1M94 A;  3ZVV A;  2V3S A;  1UZX B;  2K6Q A;  3H7P B;  1E90 A;  3AU4 A;  2C7H A;  2R2O A;  3VUW A;  3WA0 A;  4CHK A;  4EOY A;  4F1S A;  1H8C A;  1IPG A;  2YLM A;  2BYE A;  1WGG A;  2MSE D;  1OGW A;  3D32 A;  5BO4 B;  3ML8 A;  3DVG X;  3H1U A;  4MH0 E;  2LD9 A;  4BBN F;  2FAZ A;  3KUD B;  3ZNI D;  4M0W B;  4MSQ B;  3ZLZ A;  2KWU B;  2BWF A;  3W1S A;  4OVV A;  2N1V A;  3A9J B;  3UQB A;  1L7Y A;  1UD7 A;  1WH3 A;  5D6J B;  1ZKH A;  1KOT A;  4ZRJ A;  1E8W A;  3ZUN A;  1EF5 A;  2KAN A;  2LXC A;  4NAW B;  5JH5 C;  4LDT D;  2FCN A;  2Z59 B;  2C7M B;  3AXC A;  2LVO A;  4W9E A;  4BOS C;  1YIW A;  2O6V B;  1NDD A;  2NVU I;  1LFD A;  3AI5 A;  2BPS A;  4FLH A;  3L13 A;  1V80 A;  2ZVO A;  2KNB A;  3L0W B;  4XX5 A;  4B95 A;  2DYO A;  5L83 A;  4WWN A;  1WIA A;  1WR1 A;  3DBL I;  3IHP C;  4GXB A;  2DAJ A;  2KWC A;  1SGH A;  4W9G A;  1UGM A;  3QC8 B;  2N1W A;  2GMI C;  1TTN A;  2N7D A;  1P1A A;  2KO3 A;  3UIO B;  3VAW A;  2XK5 B;  4WJP A;  1K8R B;  3OJ4 B;  1WMH B;  1E5W A;  1V9J A;  3L16 A;  4K81 A;  5J2R A;  2D11 A;  3O65 B;  4ICU A;  3VXW A;  2RPQ A;  3PS6 A;  1TZ1 A;  2DZM A;  5D7G A;  5AZH A;  3CSF A;  2KDE B;  3L54 A;  4W9D A;  5E6P A;  4N9F 4;  3SDL C;  3T9L A;  3ZNZ B;  2JZ3 B;  4EZJ A;  4K7W A;  4DK5 A;  2KJ6 A;  2JZZ A;  4WQO B;  3PSE B;  2GBN A;  2PJH A;  2DZK A;  4MJS B;  2C60 A;  3ZTC A;  4IWP A;  1A5R A;  4GIV A;  4A3P A;  4JQW C;  4FJV B;  4G0N B;  1U4A A;  3QIJ A;  3V6E B;  2DYB A;  2BF8 B;  4II2 B;  3NY5 A;  3JSV A;  2RD0 A;  2KKC A;  2JXX A;  5L95 C;  1D3Z A;  1J8C A;  2MBB B;  4HCN B;  4W9L A;  1GNU A;  4FUL A;  1V5T A;  4JIO U;  2AL6 A;  4PS8 A;  1YX6 B;  4TQ0 A;  1YD8 U;  3UGB B;  4KVG B;  3EHV A;  2D10 A;  3KYC D;  2LGY A;  4MSM B;  3X23 A;  2K25 A;  3R66 C;  2UYZ B;  3AUL A;  2DZJ A;  2XEW A;  4KZC A;  2ZEQ A;  4IM3 A;  3DCG A;  2J7Q B;  5KHO A;  5LLI A;  3DBS A;  2JRH A;  1ZW7 A;  3H9D A;  3OJ3 A;  2MW5 A;  4DHJ B;  3ZIM A;  3EEC A;  4HWI B;  3PGE A;  3RYT A;  3GOE A;  2KTR A;  3ZNG C;  4LCD E;  2ASQ A;  3UIP B;  3ALB A;  3RUI B;  2HTH A;  1CMX B;  2A4Z A;  2JPH A;  3HM3 A;  4XC2 A;  3OAW A;  4XZ4 A;  4ANX A;  3QX1 A;  3K9O B;  4DWF A;  5LXH A;  2IYD B;  3UQA A;  1C3T A;  4WAA A;  1WXA A;  2B3A A;  2DEN B;  1WR6 E;  2PE9 A;  3A1Q B;  2LWP A;  1WX9 A;  3VH3 B;  4B6W A;  1OEY J;  4W9F A;  2EMS A;  3TMP B;  4IG7 B;  2KDB A;  4KDL B;  4KV2 A;  1GC6 A;  3ENE A;  4JLC A;  1P9D U;  2G4D B;  2LI5 A;  4HDQ A;  2GBJ A;  3Q3F A;  1YJ1 A;  5AZF A;  3WAO A;  3KW5 B;  4A20 A;  2KVR A;  4KIK B;  2M17 A;  4PYZ A;  2CS4 A;  2Y5B B;  4ANV A;  4JGH B;  5DPR A;  1E8Y A;  1KLV A;  1ISN A;  3DBH I;  4GDK A;  4NJ6 A;  4AJW A;  3PHX B;  1GC7 A;  2ZCC A;  2KX0 A;  3RUL A;  1WE6 A;  4MGK E;  4WJO A;  2VRR B;  3W1S C;  4HCP B;  4HK2 A;  1SIF A;  2DZI A;  4GMV A;  1C1Y B;  4EEW A;  1KM7 A;  4LDT B;  4ASW C;  2G3Q B;  2LUE A;  1MG8 A;  2KMA A;  3VH4 B;  1XQQ A;  3PLU A;  3DQV A;  4TV3 A;  4IC7 B;  1RAX A;  3A4S C;  2AEH A;  2ZCB A;  1Q1O A;  2KFK A;  3CF6 E;  1ZGU B;  2GBK A;  4W9I A;  2BYF A;  3RZW C;  3UIN B;  4A3O A;  2NBU A;  3A4R A;  2GBM A;  1WY8 A;  2K8C A;  2MP2 B;  2KLC A;  3VUY A;  1R4N I;  4MDK E;  3IVF A;  1WGR A;  4W9C A;  2IO1 B;  3H7P A;  2IY1 B;  3RD2 A;  5HKH A;  5G55 A;  3V6C B;  1LM8 B;  4ANW A;  1WFY A;  3U30 A;  3V62 A;  4EZK A;  3BIN A;  1V2Y A;  2KDF B;  5J18 A;  3ML9 A;  3H7S A;  2WX1 A;  4P7I A;  5JZE B;  2NPT B;  2L05 A;  2CR5 A;  2V1Y A;  3KUC B;  2J0J A;  2NR2 A;  2D3G A;  3LJ3 A;  4TKN A;  4AJY B;  1NI2 A;  4GGQ A;  4ZDV A;  3WAN A;  4BVU C;  3IG3 A;  4BFR A;  3VDZ A;  3A9J A;  2LGD A;  2KJR A;  1RLF A;  2Z0E B;  3VQI A;  2ZPY A;  2FNJ B;  3EFU A;  4DXA B;  3QA8 A;  4MEM A;  4NAW A;  2MBO A;  3QJZ A;  3NHE B;  3N30 A;  4GDL B;  4HJK A;  3V61 A;  2N4F A;  4FBJ B;  4WJQ A;  5JHB A;  4WWP A;  2O6V A;  3C0R B;  2MBE A;  3UF8 A;  3EC8 A;  1L2N A;  2WX0 A;  2O2V B;  2MA9 B;  3B08 A;  2C7N B;  1QZE A;  2WYQ A;  2PPH A;  5E6O A;  2ZVN A;  2IY0 B;  1YX5 B;  2CKH B;  4CYE A;  1P3Q U;  2BKR B;  4URK A;  1WJ6 A;  5CHW A;  3TCA A;  2MLB A;  4NQK E;  3LDZ E;  4FHJ A;  1UH6 A;  2REX A;  3PRZ A;  5LXI B;  2O6V D;  2OJR A;  2UWQ A;  5E6N A;  1WZ0 A;  4PS3 A;  3PT2 B;  4W9J A;  3T8M A;  2LXA A;  4DDG D;  1OQY A;  1NBF C;  1GJZ A;  2KQ7 A;  3PTF C;  2ZZP B;  4EUT A;  2KQS A;  3JSV B;  2XK5 A;  1R4M I;  2ZPN A;  4EZL A;  1E8X A;  1WE7 A;  5CX3 A;  4EFO A;  1WM2 A;  1WMH A;  2MBH A;  2BKF A;  3VUX A;  3ZTD A;  4NQL B;  3A9K A;  2IO3 B;  4FAD A;  4PYU A;  1IP9 A;  4K7S A;  2CHW A;  1G6J A;  2IZV B;  2KXJ A;  2M8S A;  1TBE A;  4KZ0 A;  3PHW B;  3QK0 A;  1WJU A;  4IM2 A;  4KDI C;  3SHQ A;  2LJ5 A;  3DDC B;  2AWT A;  2KHW B;  4HDO A;  5AZG A;  3BY4 B;  2IBI B;  4HPL B;  3VTV A;  3ZW3 A;  4WWO A;  3ZKJ C;  4GSW A;  2BWE S;  2JY6 A;  2ZNV C;  3TIX A;  3A33 B;  5EDS A;  2I1K A;  3M63 B;  3SD5 A;  2KTF A;  1Q0W B;  1J19 A;  2A5U A;  2KTR B;  2CHX A;  1WXV A;  4NPN A;  4EKU A;  2CHZ A;  2G4S A;  2KC2 A;  2KWV B;  4GU2 A;  2L7R A;  1OTR B;  2OOB B;  3OLM D;  2IO2 B;  4GB9 A;  4TQ1 A;  2MBQ A;  4FN2 A;  4I6L B;  5DPT A;  2DX5 B;  1FXT B;  2JF5 A;  5KHQ A;  3QQ8 B;  3S2A A;  2N9P C;  2QHO A;  4TUU A;  2GBR A;  1RFA A;  3KVF B;  4ZYN A;  4FJY A;  3P2B A;  4MGI E;  5DPW A;  4G50 A;  2Z0D B;  1BT0 A;  2K6D B;  1OEY A;  5DCN A;  2BYV E;  3PRP B;  1WXS A;  3M3J A;  4GDK B;  2FUH B;  4NY0 A;  3IFW B;  3DBR I;  4FHK A;  3TL5 A;  5TR5 A;  3B1L X;  2KN5 A;  3WIM A;  2RGF A;  2DYM A;  4DHJ D;  3DVN V;  2KOX A;  3KH0 A;  1XD3 B;  5D94 A;  4KSL C;  5GMV A;  2DAF A;  2LAS A;  2D07 B;  1WZ3 A;  2KFK B;  2WWZ A;  2M4N A;  3KYD D;  3R3M A;  2KZR A;  5J17 A;  4HLE A;  4KSK C;  4GN1 A;  4GOC A;  4KIK A;  2MWS B;  4CO7 A;  4FA6 A;  1WRD B;  1WJ4 A;  2MCN B;  4F8C B;  3JW0 X;  3L10 B;  4HXD A;  4IWO A;  2L0F A;  2L3Z A;  2KDI A;  1GUA B;  1SE9 A;  1UBI A;  4RM8 A;  2KD0 A;  2NS5 A;  2LGX A;  1UBQ A;  3M62 B;  3NZU A;  1S1Q B;  2JT4 B;  4W9H A;  4DHZ E;  4PS7 A;  3L17 A;  4BKT A;  1JRU A;  4ZRK A;  3HIZ A;  2C9W B;  1I35 A;  2EMT A;  4AOF A;  2W9N A;  3PZD A;  1WXM A;  4NNJ B;  4ANU A;  3V60 A;  1AAR A;  1TGZ B;  1LQB A;  1WGD A;  1PQS A;  3X0W A;  2K8H A;  4LJP B;  2MP2 A;  4RMA A;  3NOB A;  3AU5 A;  4MEL A;  2YVC A;  3VTU A;  2MX2 A;  5FR6 A;  2K1F A;  4E71 A;  4E74 A;  1WI0 A;  1IYF A;  4IUM B;  4MM3 A;  3IBE A;  3MHS D;  3QHT A;  2NPT A;  2LZ6 A;  2NCN A;  2I1J A; 
#chains in the Genus database with same CATH topology
 5IA7 A;  3Q3J A;  2LHE A;  1WGY A;  3QAQ A;  2INC C;  2KMC A;  5D2M B;  1HTQ A;  1NI3 A;  3ABV B;  4M8N A;  4OVU A;  2LRU A;  2JUO A;  1XLO A;  1T0Y A;  3AEA B;  3PLV A;  1HE8 A;  1DOX A;  4I6P A;  4GDL A;  1FIQ A;  2J52 A;  3MJW A;  1VD2 A;  3W1Y A;  4LJO B;  4US8 A;  4YSY B;  3ZRF A;  1QOA A;  2KFJ A;  4MJS A;  2L8J A;  4G3X B;  1KJT A;  1J7B A;  2D2Q A;  4X57 B;  3RCZ A;  2AQ3 B;  3U8Z A;  3WAM A;  1WGH A;  1EU3 A;  1Z5S B;  2KMM A;  3TUO A;  1WF9 A;  4JWS C;  2KX3 A;  4S0R A;  2RR9 A;  3M95 A;  3VFK A;  3P4P B;  3DWM A;  5T8I A;  2LVQ A;  2PKO A;  2K5P A;  3DOW A;  4F7Z A;  5C2T B;  3N3K B;  2WHI A;  1XLP A;  3NS8 A;  3AM9 A;  3PV1 A;  4DBG A;  5BYQ A;  1I42 A;  2NBV B;  3L08 A;  3B0A A;  4RGN A;  4JE3 B;  3HM6 X;  2KDM A;  3R7R A;  2ZJD A;  1ESF A;  3ECI A;  3QWZ B;  2JSV X;  3Q8F A;  2WXF A;  3V05 A;  1LGR A;  2KK8 A;  2HE7 A;  1QF6 A;  2FID A;  4O1N A;  3RZF A;  3CST A;  4M02 A;  2D3C A;  3WAL A;  2CU1 A;  2KC1 A;  5C1Z A;  2KQ4 X;  4ZYS A;  4R3D A;  3KUZ A;  3K9P B;  1F0Z A;  1JCK B;  1OQQ A;  2V3S A;  2K6Q A;  3WA0 A;  1FMA D;  1MJD A;  2BYE A;  1WGG A;  1EU4 A;  2MSE D;  1L0X B;  3DVG X;  3H1U A;  1E9M A;  1TS5 A;  1XLN A;  2L83 A;  2N1V A;  2V3P A;  3EUB 2;  3UQB A;  4P16 A;  3FIL B;  3ETR A;  3ZUN A;  2GB1 A;  2MEK A;  2LXC A;  5JH5 C;  1FO4 A;  2BT6 A;  2C7M B;  2IGG A;  2LVO A;  3ZYY X;  3DWG C;  2VZK D;  2NVU I;  4QAY A;  1V1P A;  2DBY A;  1GB4 A;  1GB1 A;  2IGH A;  5HI1 A;  1L4D B;  4XX5 A;  3L0W B;  2DYO A;  3LB8 C;  4WWN A;  1DGJ A;  1WR1 A;  3DBL I;  2KWC A;  3Q3M C;  1FD6 A;  1HEZ E;  1AWD A;  3UIO B;  1CJE A;  3OJ4 B;  4K81 A;  2D11 A;  1UF0 A;  3O65 B;  3PS6 A;  5D7G A;  4YSZ B;  2X38 A;  3PSE B;  2WXG A;  2VH1 A;  2C60 A;  4L23 A;  3ZTC A;  4IWP A;  3SFE B;  3QIJ A;  2EKI A;  4II2 B;  3NY5 A;  1RYJ A;  5L95 C;  4LNN A;  1D3Z A;  1J8C A;  4HCN B;  2QIE B;  1E6E B;  2FBW B;  4WQM A;  1P7F A;  3EHV A;  2WXH A;  2LGY A;  2K25 A;  4Q2J A;  3U2S C;  2ZEQ A;  3OJ3 A;  2MW5 A;  3ZIM A;  4HWI B;  3PZ7 A;  2NTT A;  4LLG M;  3GOE A;  1I4R A;  3ZNG C;  2WXJ A;  2A4Z A;  1SB3 C;  3OAW A;  2IYD B;  4WAA A;  2B3A A;  3VH3 B;  3SR6 A;  2LWP A;  1UWX A;  3TMP B;  2BS2 B;  1YJ1 A;  4XWT A;  3KW5 B;  1T5X D;  2M17 A;  4PYZ A;  1SE4 A;  2CS4 A;  5DPR A;  5GXG B;  3DBH I;  3EA6 A;  2ZCC A;  1ZOY B;  3W1S C;  2GRI A;  4GMV A;  4EEW A;  1KM7 A;  5IKC M;  4RGO S;  3VH4 B;  1XQQ A;  3CF6 E;  2AEH A;  2KFK A;  2GBK A;  3B2F A;  3UIN B;  1AW7 A;  2NBU A;  2QCZ A;  2K8C A;  1R4N I;  3H7P A;  5G55 A;  1LM8 B;  1ET9 A;  4A55 A;  3ML9 A;  1CZP A;  3N1Z C;  3FC4 A;  3KUC B;  2V1Y A;  4AJY B;  1TJE A;  2K0P A;  1F52 A;  2GI9 A;  2LGS A;  3IG3 A;  2KJR A;  1RLF A;  2CJN A;  1FNV A;  1JWA D;  2FNJ B;  3EFU A;  3QA8 A;  2DWQ A;  3AE1 B;  4FBJ B;  1LO5 D;  2MBE A;  3UF8 A;  2MA9 B;  2WDR B;  4ACF A;  1QZE A;  3HUI A;  2MJ3 A;  1QQR A;  2W3R A;  5CHW A;  2MLB A;  3ZXR A;  1R4M B;  2OJR A;  1QIL A;  3T8M A;  3PT2 B;  3BK1 A;  4W9J A;  2LXA A;  4DDG D;  1OQY A;  1NBF C;  2KQ7 A;  3PTF C;  3JSV B;  2XK5 A;  1XCQ L;  4EZL A;  1E8X A;  1NYQ A;  1FFV A;  3WCQ A;  1WMH A;  4NQL B;  3A9K A;  4FAD A;  1IP9 A;  1FM0 D;  1QLB B;  1G6J A;  1D4B A;  4KZ0 A;  1WJU A;  4C00 A;  1D5Z C;  4IM2 A;  4KKJ A;  2CU3 A;  2LJ5 A;  3SHQ A;  5AZG A;  3BY4 B;  3VTV A;  3ZW3 A;  3ZKJ C;  2BWE S;  4B0E A;  2LJI A;  2KTF A;  1L4Z B;  2CHZ A;  2G4S A;  2KWV B;  2PVG C;  2ZW0 A;  4GU2 A;  3OLM D;  2OOB B;  4TQ1 A;  3P4S B;  4JX1 C;  4MH8 A;  1VZ8 A;  4ITK A;  3Q3N C;  2DX5 B;  1FXT B;  2JF5 A;  3QQ8 B;  2QHO A;  4TUU A;  2GBR A;  1RFA A;  3KVF B;  4ZYN A;  3NVZ A;  3P1M A;  3Q8E A;  2DNF A;  1OEY A;  5DCN A;  4P1B C;  3Q8A A;  1WXS A;  3W2D A;  2LFI A;  4OZC A;  4FHK A;  3DVN V;  2DAF A;  2D07 B;  2RDB C;  1YQ4 B;  4J3O D;  1QOF A;  4GOC A;  4KIK A;  4CO7 A;  4F8C B;  2L3Z A;  2KD0 A;  2LGX A;  2JT4 B;  2VH2 A;  4M0W A;  2JX5 A;  4ZHP A;  3I9V 1;  5JXV A;  1I35 A;  1JWS D;  3PZD A;  3AE9 B;  2V3N A;  2ICI A;  1WGD A;  5EE0 A;  1BUI C;  4MEL A;  2ON8 A;  5FR6 A;  1WI0 A;  1J7A A;  1IYF A;  2TSS A;  2M0A A;  4IUM B;  2V0G A;  2KYW A;  3MHS D;  2WXP A;  2IJ0 A;  2I1J A;  2FCQ A;  1LXD A;  2KJH B;  4HPM B;  1E10 A;  3TEY A;  4DQO C;  2R2Q A;  1MI0 A;  4BBN C;  3NUH B;  4YL8 A;  1WM3 A;  1H4R A;  1V81 A;  2LVP A;  2HD5 B;  3BVZ A;  1V1O A;  1RRB A;  2XBB C;  5DPS A;  5G2N A;  4A8X C;  3RNC C;  4W9K A;  3RNE C;  3VVW B;  1VRA B;  5BYR A;  1TY2 A;  2HJ8 A;  5JHA A;  3GZN I;  1VJK A;  1P7E A;  4AWJ A;  3MTN B;  4FJZ A;  1T0S C;  4G11 A;  2JWZ A;  4BKS A;  4JL9 A;  3ZJT A;  4E3C A;  1V8C A;  3DVN U;  1TYG B;  4S17 A;  4IW0 A;  2PEA A;  1ZDV A;  1J0G A;  1XO3 A;  2V4L A;  2WU2 B;  3SEB A;  1WX8 A;  4WJN A;  2DHZ A;  3QCA A;  3AEE B;  4M8M A;  4ZRI A;  1IBX A;  1NEN B;  1Q5W B;  4WUR A;  3AE8 B;  3RT3 B;  1N5X A;  3I3T B;  3DBR B;  4C4V A;  3DPD A;  1E7P B;  3QAR A;  2N9X A;  5EE9 A;  5IAA C;  3ZO5 B;  2BGF A;  2L76 A;  4CQN A;  3I57 A;  3A1Q A;  3BVM A;  3DHH C;  4B9K A;  1F9J A;  1Z2M A;  3MJ5 A;  3ZNH B;  3ZVV A;  3VUW A;  4CHK A;  3U52 E;  3ML8 A;  4BBN F;  3EGR A;  2FAZ A;  4MSQ B;  2AQ2 B;  1L5P A;  2HJ1 A;  4OVV A;  3A9J B;  1ZKH A;  1KOT A;  1FNW A;  1E8W A;  2KAN A;  4NAW B;  1TKG A;  4LDT D;  2FCN A;  4YWG G;  1N6Z A;  3RN9 C;  1YIW A;  2O6V B;  4USA A;  5BMH A;  2KNB A;  1TS3 A;  5L83 A;  4UDU C;  3RFZ B;  4GXB A;  4ARI A;  3IT4 B;  1UGM A;  3QC8 B;  1L0V B;  1FXI A;  2WXR A;  3W5U B;  1TTN A;  3VAW A;  2KO3 A;  1I4X A;  4IDI A;  2OHF A;  1Y56 A;  4HRO A;  3CSF A;  4W9D A;  3T9L A;  3ZNZ B;  4K7W A;  2IDY A;  2JZZ A;  4WQO B;  2PJH A;  4MJS B;  3U4E G;  1VZ7 A;  4GIV A;  4JQW C;  2PTL A;  4G0N B;  1KLG D;  1J7C A;  4YSX B;  2Q5W D;  3V6E B;  3P4R B;  3RNA C;  1L6U A;  2RD0 A;  2V4I B;  4JIO U;  1HZ5 A;  1YD8 U;  1XEE A;  2LHD A;  4MSM B;  3AUL A;  4KZC A;  4IM3 A;  5LLI A;  2OJW A;  1ZW7 A;  1I4P A;  2WQY B;  4XYC A;  1YMH E;  3PGE A;  2MJD A;  2HTH A;  2JPH A;  1RFK A;  3HM3 A;  4XZ4 A;  4ANX A;  2ACZ B;  1PGA A;  3IAM 1;  1WR6 E;  2PE9 A;  1WX9 A;  1OEY J;  4IG7 B;  2MH7 A;  4KDL B;  1GC6 A;  3HRD D;  4JLC A;  1P9D U;  3VRB B;  2G4D B;  2GBJ A;  3Q3F A;  3WAO A;  4A20 A;  4KGS A;  4JGH B;  3HVZ A;  1E8Y A;  1KLV A;  1ISN A;  2R61 A;  4RFB A;  4NJ6 A;  2IPK D;  4AJW A;  2KX0 A;  4AS1 A;  4MGK E;  4WJO A;  2VRR B;  4HCP B;  1SIF A;  4LDT B;  2G3Q B;  1MG8 A;  2RMM A;  4IC7 B;  3A4S C;  1RAX A;  1Q1O A;  1TKE A;  4W9I A;  2I38 A;  1TZO A;  2BQQ A;  3A4R A;  4RCO A;  2MP2 B;  3VUY A;  4W9C A;  2KAC A;  2IY1 B;  5D3D A;  2LGI A;  1JAL A;  3V6C B;  3AE7 B;  4ANW A;  3U30 A;  3BIN A;  3UI3 A;  1D5X C;  2KDF B;  3TEW A;  5JZE B;  1FPY A;  4ZRP A;  4TKN A;  2NR2 A;  3LJ3 A;  1F2R C;  2X8X X;  4GGQ A;  1T6B X;  3VDZ A;  2LGD A;  3GS2 A;  4PT5 A;  2PLP A;  3FIL A;  4DXA B;  4MEM A;  3P42 A;  3NHE B;  3N30 A;  4HJK A;  4WWP A;  4RH6 A;  2WX0 A;  2O2V B;  2WXI A;  2C7N B;  2WYQ A;  2Z8L A;  4JPS A;  1P3Q U;  1SE3 A;  3LDZ E;  2WU5 B;  1UH6 A;  3ZJV A;  1I4H A;  3PRZ A;  2QMT A;  4A9A A;  5E6N A;  1WZ0 A;  1GJZ A;  3LYY A;  2ZZP B;  2JQR B;  2KQS A;  2WDQ B;  1R7S A;  1WM2 A;  2BKF A;  3I5J C;  2IO3 B;  3AEF B;  4K7S A;  3V3X A;  1AYF A;  2KXJ A;  2M8S A;  4MT5 A;  1TBE A;  3QK0 A;  4KDI C;  4YT0 B;  2AWT A;  2KHW B;  4HPL B;  3AMZ A;  4IKG A;  2N7J A;  2DLB A;  1NVI D;  2ZNV C;  3TIX A;  3A33 B;  2I1K A;  3M63 B;  5HHD G;  1ZP0 B;  3SD5 A;  1Q0W B;  1J19 A;  4REZ A;  2CHX A;  4C56 C;  1WXV A;  3AV8 A;  2L7R A;  1BML C;  2IO2 B;  1MVK A;  1XXG A;  4I6L B;  5DPT A;  2N9P C;  1F1H A;  2NMQ A;  3P2B A;  4G50 A;  2Z0D B;  2BYV E;  3TEX A;  3Q3O C;  2FUH B;  1SBB B;  4NY0 A;  2OED A;  3WIM A;  2XNA C;  3CWI A;  2DYM A;  4DHJ D;  1E0Z A;  3KH0 A;  1XD3 B;  2ZW1 A;  1RM6 C;  2KFK B;  1UGJ A;  2WWZ A;  2VZK B;  1KF6 B;  5J17 A;  2M19 A;  4KSK C;  3H8H A;  2MWS B;  1WJ4 A;  4IWO A;  1JQ4 A;  1JWM D;  2L0F A;  2KDI A;  2L32 A;  4RM8 A;  2WP9 B;  3NZU A;  5TSS A;  4W9H A;  2MJE A;  4ZRK A;  1KH0 A;  3NG0 A;  4AOF A;  2W9N A;  1WXM A;  1SIJ A;  4EE2 A;  3V60 A;  1AAR A;  1LQB A;  4LJP B;  1TS2 A;  3NOB A;  3W5V B;  3N20 C;  1VLB A;  2YVC A;  3VTU A;  2MX2 A;  4E71 A;  3Q14 C;  1MHH E;  3Q2A C;  3IBE A;  5AUK A;  3AB5 A;  1BXT A;  1IGC A;  5IOI A;  3ONS A;  3PRE A;  3ZDM C;  2Y5C A;  3N32 A;  1XT9 B;  1V6E A;  2CJO A;  4L2Y A;  1CQV A;  2WDT B;  2L00 B;  4MGZ E;  3VTW A;  1P98 A;  3PVL A;  3Q6B A;  1ACC A;  2BTE A;  2J0K A;  3A9K B;  5C23 A;  3Q8B A;  2N9K A;  2QSD A;  1ZE3 D;  2K8B A;  3TSS A;  2GOW A;  3NVV A;  1WJN A;  2AL3 A;  1S3S G;  4YXD B;  3APC A;  4II3 B;  5FR3 A;  1N60 A;  2IO0 B;  4NZL B;  1OQR A;  2QJL A;  2BS4 B;  1VCB A;  1WSP A;  1ZUD 2;  5IO9 A;  2ZNV B;  1HA5 A;  4BKS D;  4AP4 C;  5HG2 A;  3HK0 A;  2LMC A;  3Q69 A;  1EO6 A;  2EKE C;  1EF1 A;  1E8Z A;  4YTN B;  4DDI D;  1T0R C;  1WGK A;  5G5G A;  2LRW A;  1SXT A;  3WAP A;  3DVG Y;  5E6J A;  5HFY A;  3PZ8 A;  4K1R B;  1WYW B;  3HHM A;  4DHZ B;  2G45 B;  3AE6 B;  3JYU A;  4XGA B;  3H6N A;  3MFG A;  4OHJ A;  3NZS A;  3T3N A;  1NEK B;  2M1M A;  2C5L C;  2JRI B;  4M00 A;  5BMG A;  3ZDT A;  1X1M A;  2AYO B;  3KWV A;  3PRM B;  3NRZ A;  4BOZ B;  3CMM B;  5CHF A;  1I4G A;  4OVZ A;  1N63 A;  3R7Q A;  1V49 A;  1M94 A;  2FE8 A;  3W9C B;  3AU4 A;  2C7H A;  4F1S A;  2INP E;  1N5W A;  2YLM A;  1PGX A;  1MHX A;  3D32 A;  5BO4 B;  2SAK A;  1B9R A;  5D3I B;  2LD9 A;  1AN8 A;  3GE3 C;  4M0W B;  4C7Z A;  4RF0 A;  3W1S A;  3B9J A;  4NJC A;  1UNS A;  5AUI A;  1L7Y A;  1UD7 A;  1WH3 A;  3MC9 A;  1FCC C;  5D6J B;  1YN4 A;  4M01 A;  3AE3 B;  4BOS C;  1NDD A;  2BPS A;  4FLH A;  3L13 A;  2ZVO A;  4B95 A;  1YNT E;  1FFU A;  1B1Z A;  4XDD A;  3IHP C;  3NVW A;  3R2I A;  1SJH D;  2WXM A;  2GMI C;  1L0Y B;  1SF0 A;  1K53 A;  2N7D A;  1XCT L;  1P1A A;  4WJP A;  1E5W A;  1V9J A;  3L16 A;  2BYT A;  3VXW A;  2DZM A;  3SDL C;  5E6P A;  1Q10 A;  2JZ3 B;  3P63 A;  4US9 A;  4DK5 A;  2KJ6 A;  4HEA 1;  2DZK A;  1HTO A;  1A5R A;  2INN E;  2K9X A;  4A3P A;  3ZQ4 A;  2B76 B;  1N61 A;  2WXL A;  3IAS 1;  4GLS C;  2RDH A;  2JXX A;  4W9L A;  1V5T A;  1YX6 B;  2I2Y A;  4KVG B;  2D10 A;  3X23 A;  3R66 C;  2DZJ A;  1IBX B;  3RI7 C;  4YTM B;  3DCG A;  2J7Q B;  1VR9 A;  3N1X C;  3DBS A;  3H9D A;  1JWU D;  2J53 A;  4C4V B;  3RYT A;  2ONQ A;  5H8Y E;  2KTR A;  3VRA B;  4LCD E;  2ASQ A;  3UIP B;  3ALB A;  3RUI B;  4XWW A;  4XC2 A;  1CMX B;  5LXH A;  3QX1 A;  3K9O B;  1ET6 A;  1C3T A;  1VZ6 A;  2DEN B;  3A1Q B;  1DOY A;  4K3B A;  2PIA A;  1FNU A;  4W9F A;  2EMS A;  2HDE A;  4KV2 A;  2AX5 A;  4HDQ A;  1C77 A;  2KVR A;  4ANV A;  1JW9 D;  2Y5B B;  1C4A A;  4GDK A;  4A6Q A;  3GE8 C;  2QDF A;  1GC7 A;  3RUL A;  2G9H D;  3GP7 A;  4LTU A;  1NYR A;  4HK2 A;  1C1Y B;  4KGR A;  2KMA A;  3PLU A;  3TJP A;  1C9F A;  1ZGU B;  4A3O A;  3E9S A;  3BZD B;  3IVF A;  3E56 A;  4N58 A;  1KFY B;  2IO1 B;  3O13 A;  3RMK C;  4HKQ A;  1WFY A;  3V62 A;  4EZK A;  1V2Y A;  2W55 A;  3B2G A;  4MM3 B;  5J18 A;  3DBL B;  3H7S A;  4P7I A;  2NPT B;  2CR5 A;  2GLS A;  2J0J A;  2D3G A;  3BWU D;  1ZXH A;  4BVU C;  1N62 A;  1FRD A;  4BFR A;  1FEH A;  3A9J A;  3VQI A;  4XE0 A;  4NAM A;  2ZPY A;  2D5G A;  2WXK A;  4H2A A;  4NAW A;  3QJZ A;  1K51 A;  3AH7 A;  4P6V F;  1MG4 A;  4GDL B;  1C79 A;  2O6V A;  3EC8 A;  2PW9 A;  3OG5 A;  2PVO D;  3B08 A;  2KWD A;  5G5H A;  2PPH A;  5E6O A;  2ZVN A;  2IY0 B;  2UU7 A;  2CKH B;  4CYE A;  1MFW A;  4ZOH C;  4PK1 A;  3TCA A;  2REX A;  5LXI B;  4PS3 A;  4EUT A;  2WXN A;  2SEB D;  1HZ6 A;  2ZPN A;  1WE7 A;  3VUX A;  3ZTD A;  2CHW A;  2N9L A;  3PHW B;  3DDC B;  1PGB A;  4HDO A;  2J42 A;  5C3J B;  2IBI B;  3LXF A;  1KTK A;  4YTP B;  4WWO A;  4GSW A;  2JY6 A;  1HQR D;  2KN4 A;  1QOB A;  5EDS A;  3AED B;  3NZ3 A;  4NPN A;  4EKU A;  1GOZ A;  1GAQ B;  4GB9 A;  5H92 C;  3PO0 A;  5KHQ A;  3S2A A;  4FJY A;  3I63 C;  1F77 A;  3DBH B;  4MGI E;  3AEB B;  2QIL A;  3BK2 A;  2K6D B;  4FXC A;  3DBR I;  1K50 A;  3B1L X;  2KN5 A;  5TR5 A;  4HJG E;  5BYS A;  4WH4 A;  4KSL C;  4D2K A;  1XF5 L;  1R4N B;  2WXO A;  1ZDX A;  2M4N A;  3KYD D;  3R3M A;  2KZR A;  3N1Y C;  3BVG A;  1JRP A;  4HLE A;  2QEJ C;  2JXT A;  3VR9 B;  1I4Q A;  5LNK 1;  3OWE B;  2MCN B;  2BB6 A;  3C19 A;  1UBI A;  2W54 A;  4AQ7 A;  1S1Q B;  1V1P B;  4PS7 A;  1SJE D;  3Q8C A;  4BKT A;  1JRU A;  3AEC B;  2EMT A;  3R2T A;  5FK9 C;  4ANU A;  3X0W A;  2K8H A;  5IN7 A;  2MP2 A;  4RMA A;  2WS3 B;  3AU5 A;  4WWM A;  2K1F A;  4E74 A;  1PFD A;  3HVD A;  1C4P A;  3QHT A;  1UUP A;  1GPX A;  1T0Q C;  1JWB D;  2JVC A;  2MQJ A;  4IWQ A;  2L0T A;  3SU8 X;  2IGD A;  1ZPS A;  4AUQ C;  1A70 A;  4IM0 A;  3R8B A;  3ZRC A;  2N7E A;  2E6X A;  3JVZ X;  1E7V A;  2BB5 A;  3L4P A;  2H88 B;  2FCS A;  2FIF A;  1YJI A;  4RM9 A;  1E7U A;  3URY A;  2O2V A;  2K3U A;  1XLQ A;  2NBW B;  2RSU A;  2MRP A;  1P0R A;  3PPA A;  3BII D;  2L52 A;  3VHT C;  3U7D A;  2K39 A;  1KLU D;  2FCM A;  2M0X A;  2JYT A;  3TBL D;  4KX6 B;  1EM7 A;  1UWM A;  1UEL A;  4K3C A;  1IGD A;  4RNA A;  4K7U A;  1WX7 A;  2WGS A;  4HVB A;  2AQ1 B;  4BAX A;  3EFC A;  4ARC A;  2PE6 B;  5CTR C;  3C8Y A;  3KLS X;  2D3A A;  4HRS A;  1WXQ A;  4BKG A;  4I6N B;  3AE5 B;  1ROE A;  4LNO A;  1TT5 B;  3APF A;  2KLG A;  1FRR A;  4J6I A;  2J0M A;  1D5M C;  2N9E B;  2IND C;  1EUV B;  5AEK B;  1FCL A;  3VR8 B;  4NJ7 A;  3APD A;  3NVY A;  1GG3 A;  5CHV C;  2W82 A;  3FAH A;  4B0M A;  5IP4 D;  1DYQ A;  1SSN A;  1Y8R C;  1YQB A;  1PYW D;  4WIP A;  1SE2 A;  4ICV A;  4LNF A;  1VDV A;  3DHI C;  1V86 A;  2D3B A;  4MGY E;  3RPF C;  2JYE A;  1T3Q A;  1UZX B;  3H7P B;  4JWU C;  1E90 A;  2BBC A;  2FUG 1;  2R2O A;  4EOY A;  1H8C A;  1IPG A;  1OGW A;  2J4X A;  2KAJ A;  4MH0 E;  3KUD B;  4ZRQ A;  3ZNI D;  3GB1 A;  3ZLZ A;  4HKZ E;  2KWU B;  2BWF A;  3NS1 A;  1HXY D;  4P1C C;  3AEG B;  4OZB A;  3T3O A;  3AN1 A;  4ZRJ A;  1EF5 A;  4LNK A;  1ZXI A;  2Z59 B;  3AXC A;  4W9E A;  2W3S A;  1LFD A;  3AI5 A;  1QOG A;  1V80 A;  2NTS A;  1WIA A;  2L1A A;  2DAJ A;  1SGH A;  4KKI A;  2G1E A;  4W9G A;  2N1W A;  3SFD B;  2YEP F;  4RGT A;  2WNM A;  2BW2 A;  2XK5 B;  1K8R B;  3GZN B;  1WWT A;  1WMH B;  5J2R A;  5FKA C;  4L1B A;  3AE2 B;  4ICU A;  2RPQ A;  1TZ1 A;  5AZH A;  2KDE B;  3L54 A;  4EZJ A;  4N9F 4;  2HTM E;  2GBN A;  1L6V A;  2Y3A A;  2BS3 B;  4C7Y A;  5EE3 A;  4FJV B;  1PUT A;  4RGM A;  1U4A A;  2DYB A;  1ENF A;  4C80 A;  2BF8 B;  3JSV A;  2JWU A;  2KKC A;  2MBB B;  1GNU A;  4FUL A;  1SEB D;  3MP9 A;  2AL6 A;  4PS8 A;  4TQ0 A;  5BMI A;  3UGB B;  3KYC D;  1C76 A;  4DXF A;  2YEP B;  2M56 B;  2UYZ B;  2XEW A;  5KHO A;  4TSS A;  2JRH A;  4DHJ B;  3EEC A;  4RF1 A;  3KQ4 A;  2PMV A;  5I4D A;  2LUM A;  4DWF A;  3UQA A;  1FXA A;  1WXA A;  3BYT B;  4B6W A;  2BVC A;  2KT7 A;  2JZP A;  2KDB A;  3KWL A;  3ENE A;  1CK1 A;  2LI5 A;  5AZF A;  4KIK B;  2WLB A;  4WAF A;  1TY0 A;  2H89 B;  3PHX B;  1V97 A;  1WE6 A;  1PDX A;  2DZI A;  4ASW C;  2LUE A;  3DQV A;  4TV3 A;  1JRO A;  2ZCB A;  1YN5 A;  3RZW C;  2BYF A;  2GBM A;  1WY8 A;  4MAC A;  2KLC A;  4MDK E;  1WGR A;  3RD2 A;  5HKH A;  3U7Z A;  2XN9 C;  3TEZ A;  1RWS A;  1STE A;  1JML A;  2WX1 A;  2L05 A;  5MPO A;  4ZDV A;  3IXS A;  1NI2 A;  2N0S B;  3WAN A;  4LK0 M;  3AE4 B;  3ZGZ A;  2Z0E B;  3CIR B;  3P4Q B;  2K22 A;  2MBO A;  4N59 A;  1F2R I;  3V61 A;  5JHB A;  2N4F A;  4WJQ A;  3C0R B;  1L2N A;  2RDG A;  1YX5 B;  2WDV B;  2E3T A;  2RPV A;  2BKR B;  4URK A;  1WJ6 A;  4OW0 A;  1QKZ A;  4NQK E;  4FHJ A;  4BZA A;  3MC0 B;  2O6V D;  2WXQ A;  2UWQ A;  4DXG A;  1R4M I;  4N6E B;  5CX3 A;  4EFO A;  2MBH A;  4XDC A;  4PYU A;  1WRI A;  2IZV B;  1M4V A;  2KVZ A;  1C4C A;  3DHG C;  1YN3 A;  1QT9 A;  4ZHO A;  4IOI E;  1YJJ A;  1TIF A;  4LNI A;  2A5U A;  2KTR B;  1WYG A;  1DOI A;  2KC2 A;  1OTR B;  3IT6 B;  3RNB C;  1TS4 A;  2MBQ A;  1YOV B;  4FN2 A;  3MHZ A;  3MC8 A;  2V9H A;  3N9Y C;  3RNG C;  2MHJ A;  5DPW A;  2QC8 A;  1BT0 A;  3ZJU A;  4OZA A;  3PRP B;  3M3J A;  4GDK B;  3FKY A;  3IFW B;  3TL5 A;  2RGF A;  3J9C A;  2KOX A;  5D94 A;  5GMV A;  2LEK A;  2LAS A;  1OFF A;  1WZ3 A;  1I7H A;  5EE1 A;  1D6E C;  4GN1 A;  4TMA B;  4FA6 A;  1WRD B;  3JW0 X;  3L10 B;  4HXD A;  1GUA B;  4KGT A;  4A90 A;  1C78 A;  1SE9 A;  2NS5 A;  1UBQ A;  3M62 B;  4DHZ E;  3L17 A;  2EEL A;  2JU6 X;  1MPE A;  1EWC A;  3HIZ A;  2C9W B;  3BYY B;  4NNJ B;  1TGZ B;  1PQS A;  1TKY A;  3NJT A;  4HPP A;  1YQ3 B;  1K52 A;  1EWY C;  1KRH A;  4MM3 A;  3RNF C;  2Y5P A;  1IUE A;  2NPT A;  3ZXV A;  2LZ6 A;  2NCN A;  1V5O A; 
#chains in the Genus database with same CATH homology
 5IA7 A;  2JVC A;  2MQJ A;  2FCQ A;  1LXD A;  2L0T A;  3Q3J A;  4IWQ A;  3ONS A;  3SU8 X;  1WGY A;  3PRE A;  2KJH B;  3QAQ A;  4AUQ C;  4HPM B;  3ZDM C;  2KMC A;  3N32 A;  1XT9 B;  1V6E A;  5D2M B;  4IM0 A;  2WDT B;  2R2Q A;  2L00 B;  4BBN C;  4M8N A;  4MGZ E;  4OVU A;  3ZRC A;  2LRU A;  2N7E A;  3VTW A;  1P98 A;  2JUO A;  3PVL A;  4YL8 A;  1T0Y A;  3JVZ X;  1E7V A;  1WM3 A;  3PLV A;  1HE8 A;  1H4R A;  1V81 A;  2FCS A;  2FIF A;  2LVP A;  2HD5 B;  2J0K A;  4I6P A;  4GDL A;  4RM9 A;  1E7U A;  3A9K B;  3MJW A;  1RRB A;  2XBB C;  5C23 A;  2O2V A;  5DPS A;  5G2N A;  4W9K A;  3VVW B;  2K8B A;  2NBW B;  2HJ8 A;  1VD2 A;  3W1Y A;  4LJO B;  5JHA A;  2RSU A;  2MRP A;  3GZN I;  3ZRF A;  1P0R A;  4AWJ A;  2GOW A;  3MTN B;  4FJZ A;  2KFJ A;  4G11 A;  1WJN A;  2JWZ A;  4MJS A;  4BKS A;  2AL3 A;  1S3S G;  3PPA A;  2L8J A;  4G3X B;  4JL9 A;  1KJT A;  4X57 B;  2D2Q A;  3RCZ A;  3WAM A;  3U8Z A;  3VHT C;  3U7D A;  3APC A;  2K39 A;  1WGH A;  1Z5S B;  4E3C A;  1WF9 A;  3DVN U;  4II3 B;  4IW0 A;  2FCM A;  2IO0 B;  2KX3 A;  2M0X A;  2PEA A;  3TBL D;  1J0G A;  1VCB A;  1UEL A;  2RR9 A;  2ZNV B;  3M95 A;  2V4L A;  3VFK A;  4BKS D;  4AP4 C;  4K7U A;  3HK0 A;  1WX7 A;  1EO6 A;  1WX8 A;  4HVB A;  4WJN A;  2EKE C;  2DHZ A;  1EF1 A;  2LVQ A;  1E8Z A;  1V5O A;  3QCA A;  4DDI D;  3DOW A;  4F7Z A;  2LRW A;  3N3K B;  4M8M A;  4ZRI A;  3WAP A;  3DVG Y;  2PE6 B;  5CTR C;  1Q5W B;  4K1R B;  3NS8 A;  3PV1 A;  3RT3 B;  4DBG A;  4BKG A;  1WYW B;  1I42 A;  2NBV B;  3I3T B;  2G45 B;  3B0A A;  3HHM A;  3L08 A;  3JYU A;  4I6N B;  3HM6 X;  4DHZ B;  3R7R A;  3H6N A;  2ZJD A;  3DPD A;  3APF A;  2KLG A;  3QAR A;  3ECI A;  3QWZ B;  3NZS A;  4J6I A;  2N9X A;  2J0M A;  2C5L C;  2M1M A;  2N9E B;  1EUV B;  5AEK B;  2JRI B;  4NJ7 A;  5IAA C;  3APD A;  3ZDT A;  3ZO5 B;  2BGF A;  1GG3 A;  5CHV C;  2KK8 A;  2HE7 A;  2L76 A;  1X1M A;  2AYO B;  2FID A;  3RZF A;  3A1Q A;  3CST A;  3WAL A;  3PRM B;  4BOZ B;  1Y8R C;  1YQB A;  2CU1 A;  2KC1 A;  5C1Z A;  3TJP A;  3CMM B;  4ICV A;  3KUZ A;  3K9P B;  5CHF A;  4B9K A;  1F9J A;  1Z2M A;  3R7Q A;  1V86 A;  3ZNH B;  4MGY E;  1V49 A;  1M94 A;  3ZVV A;  2V3S A;  1UZX B;  2K6Q A;  3H7P B;  1E90 A;  3AU4 A;  2C7H A;  2R2O A;  3VUW A;  3WA0 A;  4CHK A;  4EOY A;  4F1S A;  1H8C A;  1IPG A;  2YLM A;  2BYE A;  1WGG A;  2MSE D;  1OGW A;  3D32 A;  5BO4 B;  3ML8 A;  3DVG X;  3H1U A;  4MH0 E;  2LD9 A;  4BBN F;  2FAZ A;  3KUD B;  3ZNI D;  4M0W B;  4MSQ B;  3ZLZ A;  2KWU B;  2BWF A;  3W1S A;  4OVV A;  2N1V A;  3A9J B;  3UQB A;  1L7Y A;  1UD7 A;  1WH3 A;  5D6J B;  1ZKH A;  1KOT A;  4ZRJ A;  1E8W A;  3ZUN A;  1EF5 A;  2KAN A;  2LXC A;  4NAW B;  5JH5 C;  4LDT D;  2FCN A;  2Z59 B;  2C7M B;  3AXC A;  2LVO A;  4W9E A;  4BOS C;  1YIW A;  2O6V B;  1NDD A;  2NVU I;  1LFD A;  3AI5 A;  2BPS A;  4FLH A;  3L13 A;  1V80 A;  2ZVO A;  2KNB A;  3L0W B;  4XX5 A;  4B95 A;  2DYO A;  5L83 A;  4WWN A;  1WIA A;  1WR1 A;  3DBL I;  3IHP C;  4GXB A;  2DAJ A;  2KWC A;  1SGH A;  4W9G A;  1UGM A;  3QC8 B;  2N1W A;  2GMI C;  1TTN A;  2N7D A;  1P1A A;  2KO3 A;  3UIO B;  3VAW A;  2XK5 B;  4WJP A;  1K8R B;  3OJ4 B;  1WMH B;  1E5W A;  1V9J A;  3L16 A;  4K81 A;  5J2R A;  2D11 A;  3O65 B;  4ICU A;  3VXW A;  2RPQ A;  3PS6 A;  1TZ1 A;  2DZM A;  5D7G A;  5AZH A;  3CSF A;  2KDE B;  3L54 A;  4W9D A;  5E6P A;  4N9F 4;  3SDL C;  3T9L A;  3ZNZ B;  2JZ3 B;  4EZJ A;  4K7W A;  4DK5 A;  2KJ6 A;  2JZZ A;  4WQO B;  3PSE B;  2GBN A;  2PJH A;  2DZK A;  4MJS B;  2C60 A;  3ZTC A;  4IWP A;  1A5R A;  4GIV A;  4A3P A;  4JQW C;  4FJV B;  4G0N B;  1U4A A;  3QIJ A;  3V6E B;  2DYB A;  2BF8 B;  4II2 B;  3NY5 A;  3JSV A;  2RD0 A;  2KKC A;  2JXX A;  5L95 C;  1D3Z A;  1J8C A;  2MBB B;  4HCN B;  4W9L A;  1GNU A;  4FUL A;  1V5T A;  4JIO U;  2AL6 A;  4PS8 A;  1YX6 B;  4TQ0 A;  1YD8 U;  3UGB B;  4KVG B;  3EHV A;  2D10 A;  3KYC D;  2LGY A;  4MSM B;  3X23 A;  2K25 A;  3R66 C;  2UYZ B;  3AUL A;  2DZJ A;  2XEW A;  4KZC A;  2ZEQ A;  4IM3 A;  3DCG A;  2J7Q B;  5KHO A;  5LLI A;  3DBS A;  2JRH A;  1ZW7 A;  3H9D A;  3OJ3 A;  2MW5 A;  4DHJ B;  3ZIM A;  3EEC A;  4HWI B;  3PGE A;  3RYT A;  3GOE A;  2KTR A;  3ZNG C;  4LCD E;  2ASQ A;  3UIP B;  3ALB A;  3RUI B;  2HTH A;  1CMX B;  2A4Z A;  2JPH A;  3HM3 A;  4XC2 A;  3OAW A;  4XZ4 A;  4ANX A;  3QX1 A;  3K9O B;  4DWF A;  5LXH A;  2IYD B;  3UQA A;  1C3T A;  4WAA A;  1WXA A;  2B3A A;  2DEN B;  1WR6 E;  2PE9 A;  3A1Q B;  2LWP A;  1WX9 A;  3VH3 B;  4B6W A;  1OEY J;  4W9F A;  2EMS A;  3TMP B;  4IG7 B;  2KDB A;  4KDL B;  4KV2 A;  1GC6 A;  3ENE A;  4JLC A;  1P9D U;  2G4D B;  2LI5 A;  4HDQ A;  2GBJ A;  3Q3F A;  1YJ1 A;  5AZF A;  3WAO A;  3KW5 B;  4A20 A;  2KVR A;  4KIK B;  2M17 A;  4PYZ A;  2CS4 A;  2Y5B B;  4ANV A;  4JGH B;  5DPR A;  1E8Y A;  1KLV A;  1ISN A;  3DBH I;  4GDK A;  4NJ6 A;  4AJW A;  3PHX B;  1GC7 A;  2ZCC A;  2KX0 A;  3RUL A;  1WE6 A;  4MGK E;  4WJO A;  2VRR B;  3W1S C;  4HCP B;  4HK2 A;  1SIF A;  2DZI A;  4GMV A;  1C1Y B;  4EEW A;  1KM7 A;  4LDT B;  4ASW C;  2G3Q B;  2LUE A;  1MG8 A;  2KMA A;  3VH4 B;  1XQQ A;  3PLU A;  3DQV A;  4TV3 A;  4IC7 B;  1RAX A;  3A4S C;  2AEH A;  2ZCB A;  1Q1O A;  2KFK A;  3CF6 E;  1ZGU B;  2GBK A;  4W9I A;  2BYF A;  3RZW C;  3UIN B;  4A3O A;  2NBU A;  3A4R A;  2GBM A;  1WY8 A;  2K8C A;  2MP2 B;  2KLC A;  3VUY A;  1R4N I;  4MDK E;  3IVF A;  1WGR A;  4W9C A;  2IO1 B;  3H7P A;  2IY1 B;  3RD2 A;  5HKH A;  5G55 A;  3V6C B;  1LM8 B;  4ANW A;  1WFY A;  3U30 A;  3V62 A;  4EZK A;  3BIN A;  1V2Y A;  2KDF B;  5J18 A;  3ML9 A;  3H7S A;  2WX1 A;  4P7I A;  5JZE B;  2NPT B;  2L05 A;  2CR5 A;  2V1Y A;  3KUC B;  2J0J A;  2NR2 A;  2D3G A;  3LJ3 A;  4TKN A;  4AJY B;  1NI2 A;  4GGQ A;  4ZDV A;  3WAN A;  4BVU C;  3IG3 A;  4BFR A;  3VDZ A;  3A9J A;  2LGD A;  2KJR A;  1RLF A;  2Z0E B;  3VQI A;  2ZPY A;  2FNJ B;  3EFU A;  4DXA B;  3QA8 A;  4MEM A;  4NAW A;  2MBO A;  3QJZ A;  3NHE B;  3N30 A;  4GDL B;  4HJK A;  3V61 A;  2N4F A;  4FBJ B;  4WJQ A;  5JHB A;  4WWP A;  2O6V A;  3C0R B;  2MBE A;  3UF8 A;  3EC8 A;  1L2N A;  2WX0 A;  2O2V B;  2MA9 B;  3B08 A;  2C7N B;  1QZE A;  2WYQ A;  2PPH A;  5E6O A;  2ZVN A;  2IY0 B;  1YX5 B;  2CKH B;  4CYE A;  1P3Q U;  2BKR B;  4URK A;  1WJ6 A;  5CHW A;  3TCA A;  2MLB A;  4NQK E;  3LDZ E;  4FHJ A;  1UH6 A;  2REX A;  3PRZ A;  5LXI B;  2O6V D;  2OJR A;  2UWQ A;  5E6N A;  1WZ0 A;  4PS3 A;  3PT2 B;  4W9J A;  3T8M A;  2LXA A;  4DDG D;  1OQY A;  1NBF C;  1GJZ A;  2KQ7 A;  3PTF C;  2ZZP B;  4EUT A;  2KQS A;  3JSV B;  2XK5 A;  1R4M I;  2ZPN A;  4EZL A;  1E8X A;  1WE7 A;  5CX3 A;  4EFO A;  1WM2 A;  1WMH A;  2MBH A;  2BKF A;  3VUX A;  3ZTD A;  4NQL B;  3A9K A;  2IO3 B;  4FAD A;  4PYU A;  1IP9 A;  4K7S A;  2CHW A;  1G6J A;  2IZV B;  2KXJ A;  2M8S A;  1TBE A;  4KZ0 A;  3PHW B;  3QK0 A;  1WJU A;  4IM2 A;  4KDI C;  3SHQ A;  2LJ5 A;  3DDC B;  2AWT A;  2KHW B;  4HDO A;  5AZG A;  3BY4 B;  2IBI B;  4HPL B;  3VTV A;  3ZW3 A;  4WWO A;  3ZKJ C;  4GSW A;  2BWE S;  2JY6 A;  2ZNV C;  3TIX A;  3A33 B;  5EDS A;  2I1K A;  3M63 B;  3SD5 A;  2KTF A;  1Q0W B;  1J19 A;  2A5U A;  2KTR B;  2CHX A;  1WXV A;  4NPN A;  4EKU A;  2CHZ A;  2G4S A;  2KC2 A;  2KWV B;  4GU2 A;  2L7R A;  1OTR B;  2OOB B;  3OLM D;  2IO2 B;  4GB9 A;  4TQ1 A;  2MBQ A;  4FN2 A;  4I6L B;  5DPT A;  2DX5 B;  1FXT B;  2JF5 A;  5KHQ A;  3QQ8 B;  3S2A A;  2N9P C;  2QHO A;  4TUU A;  2GBR A;  1RFA A;  3KVF B;  4ZYN A;  4FJY A;  3P2B A;  4MGI E;  5DPW A;  4G50 A;  2Z0D B;  1BT0 A;  2K6D B;  1OEY A;  5DCN A;  2BYV E;  3PRP B;  1WXS A;  3M3J A;  4GDK B;  2FUH B;  4NY0 A;  3IFW B;  3DBR I;  4FHK A;  3TL5 A;  5TR5 A;  3B1L X;  2KN5 A;  3WIM A;  2RGF A;  2DYM A;  4DHJ D;  3DVN V;  2KOX A;  3KH0 A;  1XD3 B;  5D94 A;  4KSL C;  5GMV A;  2DAF A;  2LAS A;  2D07 B;  1WZ3 A;  2KFK B;  2WWZ A;  2M4N A;  3KYD D;  3R3M A;  2KZR A;  5J17 A;  4HLE A;  4KSK C;  4GN1 A;  4GOC A;  4KIK A;  2MWS B;  4CO7 A;  4FA6 A;  1WRD B;  1WJ4 A;  2MCN B;  4F8C B;  3JW0 X;  3L10 B;  4HXD A;  4IWO A;  2L0F A;  2L3Z A;  2KDI A;  1GUA B;  1SE9 A;  1UBI A;  4RM8 A;  2KD0 A;  2NS5 A;  2LGX A;  1UBQ A;  3M62 B;  3NZU A;  1S1Q B;  2JT4 B;  4W9H A;  4DHZ E;  4PS7 A;  3L17 A;  4BKT A;  1JRU A;  4ZRK A;  3HIZ A;  2C9W B;  1I35 A;  2EMT A;  4AOF A;  2W9N A;  3PZD A;  1WXM A;  4NNJ B;  4ANU A;  3V60 A;  1AAR A;  1TGZ B;  1LQB A;  1WGD A;  1PQS A;  3X0W A;  2K8H A;  4LJP B;  2MP2 A;  4RMA A;  3NOB A;  3AU5 A;  4MEL A;  2YVC A;  3VTU A;  2MX2 A;  5FR6 A;  2K1F A;  4E71 A;  4E74 A;  1WI0 A;  1IYF A;  4IUM B;  4MM3 A;  3IBE A;  3MHS D;  3QHT A;  2NPT A;  2LZ6 A;  2NCN A;  2I1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...