5CHFA

Crystal structure of murine isg15 in space group p21212
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
149
structure length
149
Chain Sequence
AWDLKVKMLGGNDFLVSVTNSMTVSELKKQIAQKIGVPAFQQRLAHQTAVLQDGLTLSSLGLGPSSTVMLVVQNSSEPLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQFWLSFEGRPMEDKELLGEYGLKPQCTVIKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein ISG15
publication title Crystal structure of murine ISG15 in space group P21212
rcsb
source organism Mus musculus
molecule tags Antiviral protein
total genus 38
structure length 149
sequence length 149
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5chfA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5chfA01
4KIKB 4TUUA 3DDCB 3N30A 3HIZA 4AWJA 1S3SG 4HCNB 4J6IA 2HE7A 2W9NA 4W9DA 3WA0A 4K81A 2ZCCA 5E6NA 2XEWA 1H4RA 4WWNA 3Q3JA 1EF1A 5L83A 1X1MA 3X0WA 2L7RA 1VCBA 2KJRA 2ZPYA 3HK0A 2N7EA 3PPAA 3V61A 2AL3A 2Z0DB 3DCGA 3OJ4B 3MHSD 1GUAB 3S2AA 3RT3B 3SU8X 1C3TA 3RUIB 2MBHA 3ZIMA 5G55A 3O65B 2NCNA 4KVGB 1WX7A 2C7MB 2JT4B 2FIDA 3QQ8B 2LD9A 5KHOA 2R2OA 3ALBA 3ZTDA 5GMVA 4G3XB 2N7DA 1BT0A 1FXTB 1OQYA 2ZNVB 2KDFB 3EECA 2KANA 4MJSA 4OVVA 1T0YA 3V62A 1SIFA 4WJPA 3VFKA 2LRWA 1V80A 1IP9A 3PSEB 2BPSA 1UGMA 2KN5A 3GZNI 1YQBA 2CHZA 1K8RB 2FCQA 3ZKJC 4LCDE 3IHPC 1TTNA 1WX8A 2KO3A 4IM0A 2DYBA 4MM3A 2N4FA 1WJ4A 4W9LA 3NZSA 4N9F4 3DOWA 1Q0WB 2IY1B 1WE6A 4ZRJA 3UGBB 1YX5B 4PS8A 4GDLA 4DWFA 3H1UA 1EF5A 2K39A 2DYOA 3VTUA 2NBWB 1M94A 4FJZA 4JQWC 3D32A 1RLFA 3R7RA 4DK5A 2RSUA 2KNBA 2JRHA 3RD2A 4NAWA 3LDZE 3UIOB 3ZLZA 2N1WA 3NOBA 2O6VB 2HD5B 4BKTA 3ECIA 3B08A 1GNUA 2R2QA 2LI5A 4W9KA 1A5RA 4AJWA 1SE9A 2LWPA 4I6NB 2C9WB 4EEWA 4DHZE 2KZRA 2DZMA 5D6JB 2AYOB 2NPTB 3VDZA 2DZKA 1KLVA 1GG3A 3TJPA 2JXXA 2CU1A 4IM2A 4WAAA 4CYEA 1Q5WB 5DPWA 3QC8B 3PGEA 3ML9A 4NJ7A 1V9JA 2JUOA 2BWES 4BFRA 3V6CB 2GOWA 2O2VA 4DHZB 1OTRB 1PQSA 1TGZB 2KTRA 2JZZA 2KX0A 1JRUA 3A1QB 1CMXB 1WRDB 5JHBA 5CTRC 3ONSA 3WALA 2N1VA 2ZCBA 3HM6X 1WX9A 1ZGUB 2DAJA 2WWZA 3WAOA 2I1JA 2FCMA 4PS7A 4BOSC 4LJPB 2K8HA 2DYMA 1H8CA 1UBIA 4W9JA 1WR1A 4PYZA 1P98A 2N9PC 3CSFA 4TQ0A 3PRMB 3VQIA 3ZNGC 1WXMA 1E5WA 1Z2MA 4JIOU 2J0KA 3PLUA 1D3ZA 3QK0A 3ZNHB 4A20A 5D2MB 3QA8A 3QARA 3A9KB 3L0WB 2KLGA 3C0RB 3ZUNA 4BOZB 1EO6A 4GB9A 1VD2A 5LXIB 3PRZA 2KVRA 3GOEA 5LLIA 4ANXA 2DENB 4ASWC 1L2NA 3PHWB 1WXAA 2AL6A 3A4SC 3APCA 3AXCA 3PV1A 4JLCA 4M0WB 5KHQA 1J8CA 2BGFA 2LZ6A 1WZ0A 1IPGA 1WFYA 2M4NA 2MP2B 4HPMB 4MH0E 3VHTC 3U7DA 1C1YB 2KXJA 4JGHB 1WIAA 2CHWA 2QHOA 3N32A 3SD5A 3NHEB 3N3KB 2WDTB 3H7PA 4GDKA 4HVBA 2GBRA 1RAXA 3WANA 2IO2B 3MTNB 4MDKE 1E8YA 3IVFA 1P9DU 1GJZA 1KOTA 5C1ZA 1WMHB 4RM9A 4JL9A 1LFDA 3DBRI 4ANUA 1R4MI 1U4AA 1WY8A 2KK8A 2LASA 2LVOA 2WYQA 2K6DB 2BKFA 3I3TB 4GSWA 4BKSD 3OAWA 5DPTA 2KQSA 2J0MA 4DHJD 3IFWB 3RCZA 4M8MA 2PE9A 2PJHA 4MSQB 1YIWA 4G11A 2MRPA 5LXHA 1WYWB 2Y5BB 3M3JA 3UF8A 4DHJB 5CHVC 4AJYB 4MGIE 1E7VA 2CS4A 4XZ4A 4KIKA 4NY0A 2ZPNA 3CSTA 3PHXB 4W9EA 1F9JA 2YLMA 2B3AA 3UQAA 3VTWA 2ZVNA 1ISNA 3V6EB 4HWIB 1YX6B 1ZW7A 3Q3FA 4DXAB 4IWQA 4KDIC 2KWVB 4B6WA 2G45B 4GXBA 2C7NB 1IYFA 3DBHI 4E71A 5E6OA 3VUYA 4G0NB 3W1SA 4DDGD 1E8WA 4EOYA 3PRPB 2BYEA 2BF8B 2RPQA 3QCAA 4W9GA 3PREA 3KYDD 1WXVA 4GOCA 4WJOA 1WGRA 3DQVA 2JZ3B 2C7HA 2KWUB 2KJHB 2PE6B 3CF6E 3L16A 1OEYA 2CKHB 4FJVB 4IM3A 4MGYE 4NAWB 3SDLC 1P0RA 3ZRCA 4WJQA 2O6VD 1E7UA 1GC6A 5AZHA 2K6QA 1NBFC 3K9OB 3TL5A 5JH5C 1L7YA 3JSVB 4ANVA 2MBBB 3JYUA 3KH0A 3LJ3A 2KC1A 2RR9A 2KFKB 1RFAA 4W9HA 2EMTA 3RULA 2LGYA 3A4RA 3ENEA 2VRRB 4I6LB 4NNJB 4LJOB 2A5UA 4RM8A 4M8NA 3BINA 2FUHB 1Z5SB 3PS6A 2C5LC 5C23A 1OGWA 3X23A 3KUZA 2MQJA 2JVCA 3OLMD 1I35A 1J0GA 1KM7A 1WR6E 4EKUA 2FIFA 4MGZE 3RZFA 3TCAA 2KD0A 5AEKB 4MELA 2GBJA 1NDDA 2D10A 3SHQA 5CHWA 3W1SC 2NVUI 2FNJB 4EZJA 4CO7A 3W1YA 2ZZPB 4HXDA 4ICUA 4NQLB 2N9XA 2CR5A 4KSLC 2XK5A 3VVWB 2AEHA 5AZGA 2MX2A 2IO1B 3ZDTA 4FHJA 3B1LX 4I6PA 2EKEC 4MSMB 5J18A 3EC8A 2YVCA 2JY6A 3A33B 2M8SA 3T9LA 3TBLD 4AP4C 1R4NI 2L3ZA 4B95A 4HLEA 5CHFA 3M62B 3L54A 3NY5A 1S1QB 3H9DA 3R66C 2NPTA 4XX5A 4W9CA 4NQKE 2PPHA 3APDA 2I1KA 2RD0A 3A9JA 2G4DB 3K9PB 5J17A 5DCNA 3WAMA 2IYDB 2V1YA 1V86A 3KUCB 3V60A 3ZDMC 3A1QA 4TKNA 4W9IA 1XD3B 1LQBA 3QX1A 3QAQA 2LGXA 1YJ1A 3R3MA 1XT9B 3DPDA 1V5TA 3VXWA 1WGYA 3EFUA 4FLHA 2LGDA 4GDKB 4KZ0A 4PS3A 4K1RB 1LXDA 2IBIB 2WX1A 3L10B 5BO4B 4WJNA 2LVQA 1WZ3A 4EZKA 3DBLI 3UIPB 3ZW3A 5TR5A 4AOFA 2D07B 1WM3A 2KJ6A 2IZVB 3VH3B 2A4ZA 2LJ5A 2M1MA 3EHVA 1WF9A 2IO3B 4HCPB 2C60A 3AULA 5EDSA 2HJ8A 4FA6A 4HPLB 1WJNA 2N9EB 2LXAA 2NBVB 2KFJA 3PT2B 3A9KA 4HDOA 3ZNZB 3ZVVA 2MW5A 1QZEA 5J2RA 1V49A 4BBNC 2BYVE 4NPNA 3P2BA 4BVUC 4FULA 3KUDB 1MG8A 2MBEA 2Z0EB 3DBSA 4GIVA 5E6PA 2K1FA 4NJ6A 2L0TA 5D7GA 3PTFC 1G6JA 4X57B 2BYFA 3PLVA 2G3QB 2HTHA 2LVPA 2MA9B 4BKGA 2MP2A 2JF5A 4MJSB 1KJTA 3AU5A 2MBQA 3U8ZA 1WGHA 3DVNV 3PVLA 4G50A 4II2B 4EZLA 5IA7A 3ZTCA 3VAWA 1UELA 2KOXA 1NI2A 1WJUA 4A3PA 1I42A 4FJYA 2XBBC 1ZKHA 4LDTD 3VUWA 1WI0A 4IWPA 3M63B 3QIJA 1WMHA 1TZ1A 2L05A 1WGGA 2K8BA 3BY4B 4P7IA 4ANWA 1HE8A 1UH6A 4K7SA 3U30A 2WX0A 3KYCD 2M0XA 3WAPA 1OEYJ 1WXSA 4LDTB 3HM3A 2DAFA 3ML8A 2FCNA 1TBEA 3H7SA 2LUEA 4GDLB 2UWQA 2REXA 4B9KA 4AUQC 2ZEQA 2J7QB 2KDIA 3ZRFA 2K25A 2J0JA 4FADA 1Y8RC 2DZJA 2NR2A 2MLBA 1UZXB 4K7WA 2D2QA 4A3OA 4BKSA 2L0FA 2BKRB 1WH3A 4BBNF 3IBEA 5HKHA 2KDBA 3VTVA 4F8CB 3AI5A 4ZDVA 2PEAA 4DDID 1P1AA 3KVFB 5L95C 3NS8A 2G4SA 1V6EA 2LRUA 4GGQA 4W9FA 4FHKA 4OVUA 1J19A 1E8XA 4IW0A 2V3SA 2LXCA 4WWPA 4E3CA 1GC7A 3QJZA 2FCSA 4WQOB 2KQ7A 2O2VB 4RMAA 3H6NA 3R7QA 4IC7B 4K7UA 2EMSA 2KTRB 4HDQA 4EFOA 2MCNB 3RYTA 2OOBB 1SGHA 2ZJDA 4ZRIA 2L76A 3VUXA 3L13A 4YL8A 3KW5B 2XK5B 4DBGA 5JZEB 5DPRA 1E8ZA 2GBMA 4XC2A 2IY0B 1V81A 3T8MA 2V4LA 2L00B 2JWZA 5IAAC 3UINB 3JVZX 1RRBA 5G2NA 4IUMB 4ICVA 4E74A 4GU2A 4F7ZA 4TQ1A 2IO0B 1V5OA 3JSVA 1EUVB 1UBQA 2Z59B 4FBJB 3PZDA 3HHMA 3DVGX 2O6VA 3AU4A 4GN1A 2KFKA 4PYUA 2CHXA 3A9JB 3DVNU 4KSKC 3ZNID 3UQBA 2UYZB 1YD8U 4HJKA 4MGKE 1V2YA 2D3GA 2ZNVC 3JW0X 3OJ3A 3TIXA 4KZCA 4KV2A 2DX5B 3IG3A 2D11A 2K8CA 2KDEB 1WE7A 2MBOA 4GMVA 4TV3A 3L08A 1UD7A 4WWOA 4IG7B 3QWZB 5FR6A 1AARA 2DZIA 2KKCA 5CX3A 2JRIB 3QHTA 2FAZA 3RZWC 3H7PB 4URKA 2KLCA 5DPSA 4FN2A 2MSED 2AWTA 2DHZA 2M17A 3NZUA 2L8JA 1P3QU 3VH4B 1E90A 1WJ6A 3M95A 2KC2A 2MWSB 1WGDA 3APFA 5D94A 3TMPB 2GBNA 2KX3A 2KMCA 1WM2A 4HK2A 1LM8B 3WIMA 2NBUA 4II3B 2BWFA 2KWCA 2KTFA 4ZRKA 5AZFA 4CHKA 2ASQA 1Q1OA 2KHWB 4F1SA 3B0AA 3ZO5B 4MEMA 2RGFA 4KDLB 4ZYNA 4EUTA 2OJRA 3DVGY 1XQQA 2ZVOA 2GBKA 4IWOA 2JPHA 3CMMB 3L17A 2KMAA 2NS5A 5JHAA 3MJWA 2GMIC
chains in the Genus database with same CATH superfamily
2LGSA 1HTQA 3HIZA 4AWJA 3DHHC 2W9NA 2XEWA 3V05A 1H4RA 5L83A 1X1MA 3DHIC 2L7RA 2KJRA 3ZJVA 2K0PA 2N7EA 2AL3A 3SU8X 1BXTA 3RT3B 1SBBB 2MBHA 4C4VA 3O65B 4KVGB 1I4PA 1T0SC 2FIDA 4WAFA 2BS2B 3ALBA 1QOFA 1QT9A 2WXGA 1OQYA 4KX6B 4RGTA 1T0YA 1SIFA 3Q14C 3ZGZA 4OVZA 2KN5A 2WHIA 3GZNI 5MPOA 3PZ7A 1TTNA 1WX8A 4IM0A 2N4FA 3AE2B 4USAA 3NZSA 5HG2A 3DOWA 2IY1B 4GDLA 2CJNA 3MJ5A 3VTUA 2KYWA 4FJZA 2FBWB 3D32A 1RLFA 3NVYA 2KNBA 2JRHA 4NAWA 2V3PA 4BKTA 1HXYD 3B08A 4AJWA 2DZMA 2AYOB 2DZKA 2JXXA 2CU1A 3QC8B 3ML9A 4NJ7A 3AV8A 2BWES 1TS2A 2BYTA 4NJCA 1OTRB 2JZZA 2KTRA 1JWSD 2KX0A 2HDEA 2E6XA 2BVCA 1SF0A 5EE1A 2PMVA 3WALA 2N1VA 1OQRA 2BS3B 4BOSC 4LJPB 2K8HA 2V4IB 4GLSC 1C9FA 2WDRB 1L6UA 1P98A 1RFKA 1YN3A 4TQ0A 3VQIA 3GE3C 4JIOU 1FMAD 4A20A 3ZUNA 1I7HA 3C0RB 3PRZA 2KVRA 3DBLB 3PV1A 1NVID 1FXAA 1GAQB 3RMKC 1SE4A 1WZ0A 1IPGA 2MP2B 4HPMB 4MH0E 1HQRD 2KXJA 3N32A 1MHHE 3Q8CA 3B9JA 4L23A 3BVMA 2PIAA 4HVBA 4ZRPA 3MTNB 4YXDB 1FNWA 1P9DU 1GJZA 1YN4A 3R2TA 5C1ZA 4JL9A 4ANUA 2LASA 2WYQA 2BKFA 4GSWA 3OAWA 4A9AA 2KQSA 4DHJD 4WWMA 1GOZA 1YIWA 4G11A 1A70A 5CHVC 4MGIE 1E7VA 1FO4A 1XF5L 4JWSC 2GLSA 4NY0A 1XXGA 3PHXB 4W9EA 2B3AA 1KFYB 3Q8FA 3V6EB 2K5PA 4DXAB 1MFWA 2WLBA 4LNIA 4DDGD 3RNAC 2MJ3A 1E8WA 2BYEA 3QCAA 3W9CB 3C8YA 4XDDA 1L5PA 1XLQA 3CF6E 4IM3A 3SDLC 2INDC 2O6VD 1E7UA 1GC6A 2LJIA 1T0QC 3HVDA 1JALA 1NBFC 2IJ0A 3KWLA 3JYUA 3LJ3A 1L0XB 5H8YE 2KFKB 4KGRA 1K50A 4I6LB 4NNJB 4LJOB 4RM8A 1E9MA 3AECB 5C23A 3LXFA 5EE9A 3OLMD 5BMHA 1J0GA 2J53A 4EKUA 5AEKB 4MELA 2GBJA 1RWSA 3SHQA 5CHWA 3W1SC 1T6BX 4ACFA 4CO7A 4NQLB 2XK5A 1F2RI 1N61A 2M19A 4FHJA 4I6PA 1NYRA 2EKEC 4MSMB 1AW7A 3AE6B 4REZA 2M8SA 3T9LA 3TBLD 4AP4C 2L3ZA 4WQMA 3NY5A 2NPTA 3BYYB 1L4DB 4W9CA 4US9A 2PPHA 3K9PB 2I1KA 4H2AA 2IYDB 1KH0A 3EFCA 4W9IA 1HTOA 3MP9A 3EFUA 4FLHA 4PS3A 2XN9C 2IBIB 2WX1A 1WZ3A 2ZW0A 3UIPB 5BMIA 1WM3A 2KJ6A 2A4ZA 3EHVA 2IO3B 1EWCA 3NVWA 4FA6A 2N9EB 3PT2B 3R8BA 1SJED 3NJTA 1QZEA 4BBNC 2M56B 4NPNA 3KUDB 1MG8A 1I4HA 2AX5A 2KQ4X 1JWMD 2MBEA 2K1FA 3PTFC 4X57B 3PLVA 2G3QB 1MI0A 4BKGA 1DOYA 3VR8B 1ZE3D 1FCLA 3DVNV 2HTME 3PVLA 4EZLA 3ZTCA 3RNBC 2LGIA 3AEGB 1MHXA 1I42A 3VUWA 1HE8A 1K52A 2I38A 4LDTB 2FCNA 2LUEA 2REXA 3MC8A 1FIQA 3ZRFA 2J7QB 4P1BC 2OHFA 4K7WA 4A3OA 2QCZA 4RF1A 2G4SA 4FHKA 4OVUA 3BK2A 1E8XA 2QC8A 4MACA 1ET6A 3R7QA 4HDQA 4EFOA 3RYTA 4ZRIA 2ZJDA 2L76A 1HZ6A 3L13A 1FEHA 3Q8EA 5JZEB 1E8ZA 3Q6BA 2L00B 3E9SA 5IAAC 3JVZX 4TQ1A 1EUVB 1UBQA 1WYGA 2O6VA 1ROEA 2KDMA 3UQBA 2VZKD 4P16A 2WGSA 3MHZA 1SE2A 2D3GA 4KZCA 4KV2A 2D11A 2BW2A 3IT4B 4AQ7A 3IAM1 4YSYB 1K51A 3VRAB 3RZWC 4URKA 3NS1A 1J7AA 3NZUA 1YNTE 5EE3A 3M95A 1E90A 1WJ6A 2LHDA 3APFA 5D94A 1WM2A 1ENFA 3WIMA 1YQ3B 4A6QA 2NBUA 3AE9B 2KWCA 3U2SC 3N1XC 3I9V1 4XWTA 5I4DA 4OHJA 4S0RA 5AZFA 2KHWB 1Q1OA 3B0AA 1DGJA 2L52A 4KDLB 4YWGG 3TEXA 4P1CC 4QAYA 2GBKA 4IWOA 1IBXB 2JPHA 2OEDA 3RI7C 2JYEA 2NS5A 5JHAA 5IOIA 1SEBD 1VD2A 4KIKB 2N9KA 1S3SG 4HCNB 2HE7A 1YMHE 3WA0A 4K81A 3U7ZA 2YEPF 3Q3JA 1BMLC 1EF1A 3X0WA 1VCBA 1F0ZA 1GUAB 1C3TA 3BYTB 3RUIB 3ZIMA 3P4RB 4NAMA 4DXGA 1WX7A 2C7MB 2FUG1 3QQ8B 5KHOA 3KLSX 3DBHB 4HEA1 1PYWD 2PW9A 1CK1A 4OVVA 2ZNVB 2KDFB 1XEEA 1ZDVA 4YTNB 4WJPA 3VFKA 4C56C 2RDHA 5LNK1 3PSEB 1UGMA 5BYSA 1K8RB 3LB8C 2QILA 4US8A 2JXTA 1YX5B 2WU2B 2MJDA 1EF5A 2K39A 2DYOA 2NBWB 1M94A 2GRIA 4JE3B 4DK5A 3LDZE 2BBCA 3UIOB 3NOBA 3ECIA 1GNUA 2R2QA 2K22A 2LWPA 2C9WB 3MC9A 3TSSA 1NYQA 3P63A 4L1BA 1QF6A 1GG3A 3TJPA 4WAAA 5DPWA 2BB5A 1V9JA 1V97A 2JUOA 5G5GA 2DBYA 2SEBD 2GOWA 2O2VA 3A1QB 1WRDB 1R4NB 2QJLA 2PKOA 1CZPA 3TEYA 3HM6X 1ZGUB 2WXPA 3N1YC 2FCMA 2DYMA 1H8CA 1WR1A 2INNE 1PFDA 3CSFA 3PRMB 3ZNGC 5AUKA 1WXMA 1YN5A 1SIJA 1Z2MA 3PLUA 2V0GA 3ZNHB 3QA8A 3Q3NC 3IT6B 3L0WB 1EO6A 1VZ7A 4ARCA 3AE3B 5LLIA 4ANXA 2I2YA 3Q69A 3PHWB 3A4SC 2AL6A 4JLCA 3APCA 3AXCA 1J8CA 2LZ6A 1WFYA 1V1PB 3VHTC 1C1YB 3NHEB 3N3KB 4J3OD 4C00A 4GDKA 2GBRA 1RAXA 2IO2B 4MDKE 1E8YA 1NENB 4K3CA 2J52A 4RM9A 1R4MI 1HA5A 1T0RC 2K6DB 4C4VB 2WS3B 3KQ4A 1EU3A 2J0MA 3IFWB 2ON8A 4RGMA 1WYWB 2Y5BB 4RF0A 1FNUA 3HUIA 3BVZA 5T8IA 1F9JA 2YLMA 1IGDA 3VTWA 1L0YB 3AE7B 3Q3FA 4IWQA 1EWYC 2MEKA 1T3QA 4HROA 2SAKA 4W9GA 2BF8B 2KWDA 1TY0A 1WXVA 4GOCA 1WGRA 2C7HA 2KWUB 3ZJUA 1OEYA 2CKHB 4NAWB 4HKZE 1UNSA 1MVKA 2K6QA 3KH0A 1D4BA 2J42A 3A4RA 1N62A 4M8NA 1Z5SB 2C5LC 4S17A 1OGWA 3KUZA 3KWVA 2JVCA 3NZ3A 3AEFB 1XCTL 2WNMA 3J9CA 4MGZE 3RZFA 2Q5WD 2VH2A 3Q2AC 2FNJB 3P42A 4ZYSA 4CQNA 3T3NA 4KSLC 3VVWB 5AZGA 2WU5B 2IO1B 3B1LX 4YT0B 2YVCA 1QLBB 4B95A 2WXIA 1N60A 3P1MA 3H9DA 3W2DA 2RD0A 3A9JA 2G4DB 2V1YA 3RFZB 1V86A 4OW0A 3V60A 1C4CA 1FNVA 1FRRA 2KMMA 2DNFA 1I4RA 2N0SB 3R3MA 4B0MA 3DPDA 3LYYA 2RPVA 3AEEB 1LXDA 3R2IA 4WJNA 1E10A 3DBLI 2QIEB 5TR5A 2D07B 3PO0A 2AQ2B 3AULA 2WDQB 2HJ8A 1ZDXA 2GI9A 2NBVB 4HPLB 2W82A 3ZNZB 1PGXA 1XLOA 2MW5A 2BYVE 4BVUC 2Z0EB 5E6PA 4GIVA 5D7GA 2WXNA 2BYFA 1C79A 2MP2A 1UGJA 4MJSB 1FFVA 1JMLA 1VLBA 2INCC 1ZXIA 2KOXA 3MFGA 2RMMA 1ZKHA 4LDTD 1WI0A 3VR9B 3QIJA 4P7IA 1UH6A 2IGHA 3KYCD 2M0XA 1KTKA 2DAFA 1L6VA 3H7SA 1VJKA 4AUQC 4FADA 2KDIA 2L0FA 4BBNF 5HKHA 2AQ3B 2DWQA 3VTVA 4HJGE 1QQRA 3ZXRA 1P1AA 3Q8BA 1YJJA 2W3RA 1I4QA 1ESFA 5G5HA 4IW0A 3UI3A 4WWPA 4E3CA 3BZDB 4IC7B 2EMSA 2BTEA 2WXQA 2K3UA 4YL8A 4DBGA 2XK5B 3PZ8A 3GP7A 2GBMA 3T8MA 5FK9C 5G2NA 4LTUA 4ICVA 1FRDA 4GU2A 4OZBA 2IO0B 3HHMA 2EELA 3AU4A 1HEZE 1TS5A 1WRIA 2CHXA 2KFKA 1JWAD 3ZNID 2UYZB 4DXFA 1YD8U 1JWBD 2ZNVC 1DOIA 3IG3A 4RFBA 1WE7A 3L08A 4M02A 4IG7B 2IDYA 5FR6A 2DZIA 1D5XC 1FD6A 2JRIB 3H7PB 5DPSA 1Q10A 2AWTA 3VH4B 1XLNA 4RGOS 2Y3AA 2KAJA 2GBNA 2KMCA 2KX3A 5BYRA 4D2KA 2X38A 4ZRKA 3ZO5B 4MEMA 1LGRA 1PGAA 1E7PB 2GMIC 4M0WA 3U52E 3CWIA 4J6IA 2WXJA 4W9DA 1I4GA 4YSZB 4WWNA 2IGGA 2QSDA 1YOVB 2NTTA 1F52A 3V61A 2Z0DB 3DCGA 2AQ1B 2RDGA 3BVGA 3MHSD 3S2AA 1ET9A 2JYTA 2NCNA 1Y56A 5EE0A 1TIFA 2JT4B 2PLPA 2R2OA 1UF0A 3FILA 5GMVA 4G3XB 3V62A 2MHJA 2NTSA 1V80A 1ZUD2 1V1OA 1R7SA 1FM0D 1XCQL 2FCQA 2D5GA 3V3XA 1MPEA 4MM3A 2DYBA 1WJ4A 1HZ5A 1FXIA 2EKIA 2INPE 3AE1B 3B2GA 5IKCM 3R7RA 2RSUA 4PK1A 3RD2A 3ZLZA 3W5UB 2N1WA 3UQAA 2O6VB 2LI5A 1M4VA 4I6NB 2PVGC 3VDZA 1WSPA 4IM2A 3FAHA 3SFDB 3N20C 4BFRA 3NVZA 3V6CB 3AM9A 4DHZB 1PQSA 1TS3A 4JPSA 1VZ6A 1TGZB 5C2TB 1JRUA 5JHBA 5CTRC 2ZCBA 3BWUD 3RNFC 3WAOA 1JRPA 2I1JA 3RNEC 2WXHA 1N63A 4PYZA 5GXGB 2N9PC 3ZQ4A 2J0KA 3DHGC 3A9KB 1PDXA 5LXIB 3GOEA 1WXAA 2BGFA 5E6JA 5HHDG 4JGHB 1WIAA 2QHOA 3W5VB 2N7JA 3WANA 1TKYA 1WMHB 1LFDA 3DBRI 1U4AA 2KK8A 2LVOA 2WXRA 1D6EC 3I3TB 3RCZA 2M0AA 2PE9A 2PJHA 1J7CA 1TJEA 1FPYA 5LXHA 4O1NA 4TMAB 1RM6C 4IKGA 2KVZA 4KIKA 3GS2A 2MH7A 3CSTA 5C3JB 4XYCA 4FXCA 4ZOHC 3OG5A 2ZVNA 2LUMA 2K9XA 2KWVB 4B6WA 4GXBA 1IYFA 3DBHI 4E71A 5E6OA 3W1SA 2ZW1A 1KLGD 4EOYA 2WXMA 3KYDD 2DLBA 4WJOA 3DQVA 1QOGA 2KN4A 1AN8A 2KJHB 2PE6B 3L16A 3O13A 4FJVB 4MGYE 1OFFA 5AZHA 3K9OB 4RCOA 5JH5C 1L7YA 2WXOA 3I5JC 3OWEB 3JSVB 4LNKA 1STEA 1RFAA 4W9HA 2EMTA 1ZOYB 3ENEA 1GB4A 1PUTA 4LLGM 2A5UA 3BINA 3PS6A 1ZPSA 3X23A 2MQJA 1I35A 3DWMA 1KM7A 3Q8AA 4M01A 1WR6E 2FIFA 2KD0A 2D10A 2JSVX 2NVUI 4EZJA 3W1YA 2ZZPB 4ICUA 3AH7A 2AEHA 3RNCC 1R4NI 3M62B 1VDVA 3R66C 4XX5A 1V8CA 4K3BA 4Q2JA 1GB1A 5J17A 5DCNA 3WAMA 2WXKA 3RN9C 3A1QA 4TKNA 1YJ1A 1XT9B 3VXWA 1V5TA 1ACCA 1TS4A 4GDKB 4KZ0A 5H92C 5BO4B 2LVQA 4ZRQA 2CU3A 4AOFA 4MT5A 2IZVB 2L32A 3VH3B 2LJ5A 3P4PB 1WF9A 4HCPB 3C19A 2LMCA 5EDSA 1E0ZA 4YSXB 1JQ4A 4WURA 4HDOA 2VH1A 3ZVVA 5J2RA 4FULA 3DBSA 2L0TA 4A55A 1G6JA 1R4MB 3BK1A 5D3IB 2MA9B 1F2RC 2RDBC 3BIID 1V1PA 3GE8C 1UWMA 2JF5A 3AB5A 3AU5A 2MBQA 1WGHA 3U4EG 3AE8B 4XWWA 2Y5CA 4IWPA 2QDFA 2L05A 4B0EA 4DWFA 4ANWA 3WAPA 2WX0A 1WXSA 3ABVB 1NI3A 3HM3A 3ML8A 1TBEA 4GDLB 4B9KA 2ZEQA 4WIPA 2JU6X 2K25A 4N58A 1RYJA 2NR2A 3GZNB 5HFYA 2BKRB 1WH3A 1T5XD 2KDBA 4F8CB 1N6ZA 5L95C 3RNGC 2TSSA 1V6EA 4W9FA 4C7ZA 3RPFC 2V3SA 2CJOA 3QJZA 2FCSA 3TEZA 2V9HA 4XE0A 4K7UA 2KTRB 1SGHA 3VUXA 3CIRB 2GB1A 3P4QB 2OJWA 5DPRA 2WQYB 1SJHD 3UINB 1RRBA 4OZCA 4IUMB 4F7ZA 2Z59B 4FBJB 3PZDA 3DVGX 4PYUA 3A9JB 3DVNU 4KSKC 4MGKE 4RNAA 1V2YA 3JW0X 3OJ3A 2J4XA 3NVVA 2L83A 2K8CA 1TZOA 2KDEB 4TSSA 4A8XC 4NZLB 2MBOA 4UDUC 1UD7A 1UWXA 1AARA 2KKCA 3MC0B 5CX3A 3QHTA 4KGSA 3URYA 4FN2A 4XGAB 5IP4D 3Q3OC 2DHZA 1TKGA 2M17A 2L8JA 3TMPB 2MWSB 4RGNA 1LO5D 4HK2A 1LM8B 2QEJC 1SE3A 4DQOC 1C76A 1DYQA 1AYFA 4LNOA 2OJRA 3DVGY 1ZXHA 3L17A 2KMAA 3MJWA 1YJIA 4TUUA 4MH8A 3DDCB 3N30A 2WXLA 3SEBA 2ZCCA 5E6NA 2XNAC 2ZPYA 3HK0A 2W3SA 3PPAA 2BB6A 4BZAA 3OJ4B 3NRZA 3WCQA 5G55A 4HKQA 3AN1A 1N5WA 1TYGB 5FKAC 2LD9A 1EM7A 1F77A 1PGBA 1BUIC 3ZTDA 1P7EA 2N7DA 1BT0A 1FXTB 1MG4A 3EECA 4MJSA 2KANA 1B1ZA 2LRWA 1IP9A 1XLPA 2BPSA 1L0VB 2LHEA 1YQBA 2CHZA 2YEPB 3ZKJC 3N1ZC 4LCDE 3IHPC 2KO3A 1B9RA 5BYQA 2MJEA 4W9LA 4N9F4 1Q0WB 4ZRJA 1WE6A 3UGBB 4PS8A 4N59A 1QOBA 3H1UA 4JQWC 4IDIA 1IUEA 2BS4B 1FFUA 1QKZA 1QILA 2HD5B 3P4SB 1WXQA 4W9KA 1A5RA 1SE9A 4EEWA 4DHZE 2KZRA 1DOXA 5D6JB 2NPTB 2G1EA 1KLVA 4C7YA 1AWDA 4CYEA 1Q5WB 4OZAA 3PGEA 1UUPA 2H89B 3IAS1 3TEWA 1CMXB 1J7BA 4HRSA 1MJDA 2W55A 3ONSA 3EA6A 1WX9A 2DAJA 2WWZA 4PS7A 1UBIA 4W9JA 1D5ZC 2LFIA 2X8XX 2UU7A 5IO9A 1E5WA 1D3ZA 3QK0A 4ARIA 1I4XA 2QMTA 5D2MB 1D5MC 3QARA 4BOZB 2KLGA 4GB9A 1WGKA 2IGDA 2DENB 4JX1C 4ASWC 1L2NA 4M0WB 3IXSA 5KHQA 4KGTA 2M4NA 3U7DA 2CHWA 3SD5A 1SB3C 1VR9A 4EE2A 3H8HA 2WDTB 3EUB2 3H7PA 3B2FA 1WWTA 3IVFA 1KOTA 1FCCC 1WY8A 4C80A 4LNFA 2N9LA 4BKSD 5DPTA 3SFEB 4LNNA 1YQ4B 4M8MA 3AE4B 4MSQB 4YTMB 4JWUC 2MRPA 2JX5A 2Z8LA 3FILB 3M3JA 3L4PA 3UF8A 4DHJB 4WH4A 4AJYB 3AEDB 2CS4A 4XZ4A 3E56A 2ZPNA 1ISNA 4HWIB 2HJ1A 1YX6B 1ZW7A 4KDIC 4MM3B 2G45B 2C7NB 3VUYA 4G0NB 1IGCA 3PRPB 2RPQA 3PREA 1C78A 1GPXA 1ZP0B 1JCKB 4ZHPA 2JZ3B 1QOAA 3N9YC 1SXTA 3NUHB 1P0RA 3ZRCA 4WJQA 2B76B 3TL5A 1C77A 4ANVA 2MBBB 1CQVA 2IPKD 2KC1A 2RR9A 3ETRA 1VZ8A 3RULA 1TKEA 2LGYA 2VRRB 3AE5B 2FUHB 2E3TA 4A90A 2L1AA 3TCAA 1N5XA 1NDDA 4XDCA 3ZJTA 4IOIE 4HXDA 2N9XA 3HRDD 2CR5A 3ZDTA 2MX2A 5IN7A 2PTLA 2FE8A 3Q3MC 5J18A 3EC8A 2JY6A 3A33B 4HLEA 5HI1A 5CHFA 3L54A 3DWGC 1S1QB 4M00A 2D3BA 4NQKE 2BT6A 3APDA 3GB1A 1EU4A 2D3AA 4KKIA 2ACZB 4P6VF 3KUCB 3ZDMC 1XD3B 1LQBA 3QX1A 3QAQA 2LGXA 1OQQA 2WXFA 5JXVA 1WGYA 3AEAB 1L4ZB 2LGDA 2KACA 4K1RB 4RH6A 5FR3A 3L10B 2ONQA 3VRBB 4EZKA 3ZW3A 4R3DA 2M1MA 2R61A 1NEKB 2C60A 4L2YA 1WJNA 2LXAA 2KFJA 3A9KA 4ITKA 1V49A 3P2BA 2D3CA 3NG0A 1KLUD 4NJ6A 3DBRB 4PT5A 3I63C 2HTHA 5D3DA 3FC4A 2LVPA 5AUIA 1IBXA 4ZHOA 1KJTA 3T3OA 1TT5B 3U8ZA 3EGRA 2G9HD 4II2B 2WP9B 4G50A 5IA7A 4KKJA 3VAWA 1UELA 1NI2A 4N6EB 1WJUA 4A3PA 4FJYA 2XBBC 3M63B 1WMHA 1TZ1A 1JW9D 1P7FA 1WGGA 2K8BA 3BY4B 4K7SA 3U30A 1OEYJ 1KF6B 2UWQA 2BQQA 2JQRB 2J0JA 1C4AA 1Y8RC 2PVOD 2Y5PA 2DZJA 2MLBA 1UZXB 2D2QA 4BKSA 3IBEA 2V3NA 2LEKA 3AI5A 4ZDVA 2PEAA 4DDID 3KVFB 1F1HA 2W54A 3NS8A 4BAXA 4GGQA 2LRUA 1J19A 1JWUD 2LXCA 3FKYA 1GC7A 4WQOB 1E6EB 2ICIA 2KQ7A 2O2VB 4RMAA 3H6NA 2MCNB 2OOBB 1SSNA 3SR6A 3KW5B 1CJEA 4XC2A 2IY0B 1V81A 2V4LA 3ZXVA 1KRHA 2JWZA 4E74A 1V5OA 3JSVA 1VRAB 4GN1A 2NMQA 4HJKA 1K53A 2JWUA 3AEBB 3TIXA 2DX5B 2VZKB 3AMZA 3TUOA 4GMVA 1TY2A 4TV3A 4WWOA 3ZYYX 5TSSA 3QWZB 3HVZA 2FAZA 2KLCA 2MSED 4HPPA 4AS1A 1P3QU 2H88B 2KC2A 1WGDA 2WDVB 1C4PA 1JROA 4II3B 4LK0M 2BWFA 2KTFA 2KT7A 2JZPA 4CHKA 2ASQA 4F1SA 4EUTA 1XO3A 2RGFA 4ZYNA 1XQQA 2ZVOA 3I57A 3CMMB 5BMGA 4YTPB
chains in the Genus database with same CATH topology
4KIKB 4TUUA 3DDCB 3N30A 3HIZA 4AWJA 1S3SG 4HCNB 4J6IA 2HE7A 2W9NA 4W9DA 3WA0A 4K81A 2ZCCA 5E6NA 2XEWA 1H4RA 4WWNA 3Q3JA 1EF1A 5L83A 1X1MA 3X0WA 2L7RA 1VCBA 2KJRA 2ZPYA 3HK0A 2N7EA 3PPAA 3V61A 2AL3A 2Z0DB 3DCGA 3OJ4B 3MHSD 1GUAB 3S2AA 3RT3B 3SU8X 1C3TA 3RUIB 2MBHA 3ZIMA 5G55A 3O65B 2NCNA 4KVGB 1WX7A 2C7MB 2JT4B 2FIDA 3QQ8B 2LD9A 5KHOA 2R2OA 3ALBA 3ZTDA 5GMVA 4G3XB 2N7DA 1BT0A 1FXTB 1OQYA 2ZNVB 2KDFB 3EECA 2KANA 4MJSA 4OVVA 1T0YA 3V62A 1SIFA 4WJPA 3VFKA 2LRWA 1V80A 1IP9A 3PSEB 2BPSA 1UGMA 2KN5A 3GZNI 1YQBA 2CHZA 1K8RB 2FCQA 3ZKJC 4LCDE 3IHPC 1TTNA 1WX8A 2KO3A 4IM0A 2DYBA 4MM3A 2N4FA 1WJ4A 4W9LA 3NZSA 4N9F4 3DOWA 1Q0WB 2IY1B 1WE6A 4ZRJA 3UGBB 1YX5B 4PS8A 4GDLA 4DWFA 3H1UA 1EF5A 2K39A 2DYOA 3VTUA 2NBWB 1M94A 4FJZA 4JQWC 3D32A 1RLFA 3R7RA 4DK5A 2RSUA 2KNBA 2JRHA 3RD2A 4NAWA 3LDZE 3UIOB 3ZLZA 2N1WA 3NOBA 2O6VB 2HD5B 4BKTA 3ECIA 3B08A 1GNUA 2R2QA 2LI5A 4W9KA 1A5RA 4AJWA 1SE9A 2LWPA 4I6NB 2C9WB 4EEWA 4DHZE 2KZRA 2DZMA 5D6JB 2AYOB 2NPTB 3VDZA 2DZKA 1KLVA 1GG3A 3TJPA 2JXXA 2CU1A 4IM2A 4WAAA 4CYEA 1Q5WB 5DPWA 3QC8B 3PGEA 3ML9A 4NJ7A 1V9JA 2JUOA 2BWES 4BFRA 3V6CB 2GOWA 2O2VA 4DHZB 1OTRB 1PQSA 1TGZB 2KTRA 2JZZA 2KX0A 1JRUA 3A1QB 1CMXB 1WRDB 5JHBA 5CTRC 3ONSA 3WALA 2N1VA 2ZCBA 3HM6X 1WX9A 1ZGUB 2DAJA 2WWZA 3WAOA 2I1JA 2FCMA 4PS7A 4BOSC 4LJPB 2K8HA 2DYMA 1H8CA 1UBIA 4W9JA 1WR1A 4PYZA 1P98A 2N9PC 3CSFA 4TQ0A 3PRMB 3VQIA 3ZNGC 1WXMA 1E5WA 1Z2MA 4JIOU 2J0KA 3PLUA 1D3ZA 3QK0A 3ZNHB 4A20A 5D2MB 3QA8A 3QARA 3A9KB 3L0WB 2KLGA 3C0RB 3ZUNA 4BOZB 1EO6A 4GB9A 1VD2A 5LXIB 3PRZA 2KVRA 3GOEA 5LLIA 4ANXA 2DENB 4ASWC 1L2NA 3PHWB 1WXAA 2AL6A 3A4SC 3APCA 3AXCA 3PV1A 4JLCA 4M0WB 5KHQA 1J8CA 2BGFA 2LZ6A 1WZ0A 1IPGA 1WFYA 2M4NA 2MP2B 4HPMB 4MH0E 3VHTC 3U7DA 1C1YB 2KXJA 4JGHB 1WIAA 2CHWA 2QHOA 3N32A 3SD5A 3NHEB 3N3KB 2WDTB 3H7PA 4GDKA 4HVBA 2GBRA 1RAXA 3WANA 2IO2B 3MTNB 4MDKE 1E8YA 3IVFA 1P9DU 1GJZA 1KOTA 5C1ZA 1WMHB 4RM9A 4JL9A 1LFDA 3DBRI 4ANUA 1R4MI 1U4AA 1WY8A 2KK8A 2LASA 2LVOA 2WYQA 2K6DB 2BKFA 3I3TB 4GSWA 4BKSD 3OAWA 5DPTA 2KQSA 2J0MA 4DHJD 3IFWB 3RCZA 4M8MA 2PE9A 2PJHA 4MSQB 1YIWA 4G11A 2MRPA 5LXHA 1WYWB 2Y5BB 3M3JA 3UF8A 4DHJB 5CHVC 4AJYB 4MGIE 1E7VA 2CS4A 4XZ4A 4KIKA 4NY0A 2ZPNA 3CSTA 3PHXB 4W9EA 1F9JA 2YLMA 2B3AA 3UQAA 3VTWA 2ZVNA 1ISNA 3V6EB 4HWIB 1YX6B 1ZW7A 3Q3FA 4DXAB 4IWQA 4KDIC 2KWVB 4B6WA 2G45B 4GXBA 2C7NB 1IYFA 3DBHI 4E71A 5E6OA 3VUYA 4G0NB 3W1SA 4DDGD 1E8WA 4EOYA 3PRPB 2BYEA 2BF8B 2RPQA 3QCAA 4W9GA 3PREA 3KYDD 1WXVA 4GOCA 4WJOA 1WGRA 3DQVA 2JZ3B 2C7HA 2KWUB 2KJHB 2PE6B 3CF6E 3L16A 1OEYA 2CKHB 4FJVB 4IM3A 4MGYE 4NAWB 3SDLC 1P0RA 3ZRCA 4WJQA 2O6VD 1E7UA 1GC6A 5AZHA 2K6QA 1NBFC 3K9OB 3TL5A 5JH5C 1L7YA 3JSVB 4ANVA 2MBBB 3JYUA 3KH0A 3LJ3A 2KC1A 2RR9A 2KFKB 1RFAA 4W9HA 2EMTA 3RULA 2LGYA 3A4RA 3ENEA 2VRRB 4I6LB 4NNJB 4LJOB 2A5UA 4RM8A 4M8NA 3BINA 2FUHB 1Z5SB 3PS6A 2C5LC 5C23A 1OGWA 3X23A 3KUZA 2MQJA 2JVCA 3OLMD 1I35A 1J0GA 1KM7A 1WR6E 4EKUA 2FIFA 4MGZE 3RZFA 3TCAA 2KD0A 5AEKB 4MELA 2GBJA 1NDDA 2D10A 3SHQA 5CHWA 3W1SC 2NVUI 2FNJB 4EZJA 4CO7A 3W1YA 2ZZPB 4HXDA 4ICUA 4NQLB 2N9XA 2CR5A 4KSLC 2XK5A 3VVWB 2AEHA 5AZGA 2MX2A 2IO1B 3ZDTA 4FHJA 3B1LX 4I6PA 2EKEC 4MSMB 5J18A 3EC8A 2YVCA 2JY6A 3A33B 2M8SA 3T9LA 3TBLD 4AP4C 1R4NI 2L3ZA 4B95A 4HLEA 5CHFA 3M62B 3L54A 3NY5A 1S1QB 3H9DA 3R66C 2NPTA 4XX5A 4W9CA 4NQKE 2PPHA 3APDA 2I1KA 2RD0A 3A9JA 2G4DB 3K9PB 5J17A 5DCNA 3WAMA 2IYDB 2V1YA 1V86A 3KUCB 3V60A 3ZDMC 3A1QA 4TKNA 4W9IA 1XD3B 1LQBA 3QX1A 3QAQA 2LGXA 1YJ1A 3R3MA 1XT9B 3DPDA 1V5TA 3VXWA 1WGYA 3EFUA 4FLHA 2LGDA 4GDKB 4KZ0A 4PS3A 4K1RB 1LXDA 2IBIB 2WX1A 3L10B 5BO4B 4WJNA 2LVQA 1WZ3A 4EZKA 3DBLI 3UIPB 3ZW3A 5TR5A 4AOFA 2D07B 1WM3A 2KJ6A 2IZVB 3VH3B 2A4ZA 2LJ5A 2M1MA 3EHVA 1WF9A 2IO3B 4HCPB 2C60A 3AULA 5EDSA 2HJ8A 4FA6A 4HPLB 1WJNA 2N9EB 2LXAA 2NBVB 2KFJA 3PT2B 3A9KA 4HDOA 3ZNZB 3ZVVA 2MW5A 1QZEA 5J2RA 1V49A 4BBNC 2BYVE 4NPNA 3P2BA 4BVUC 4FULA 3KUDB 1MG8A 2MBEA 2Z0EB 3DBSA 4GIVA 5E6PA 2K1FA 4NJ6A 2L0TA 5D7GA 3PTFC 1G6JA 4X57B 2BYFA 3PLVA 2G3QB 2HTHA 2LVPA 2MA9B 4BKGA 2MP2A 2JF5A 4MJSB 1KJTA 3AU5A 2MBQA 3U8ZA 1WGHA 3DVNV 3PVLA 4G50A 4II2B 4EZLA 5IA7A 3ZTCA 3VAWA 1UELA 2KOXA 1NI2A 1WJUA 4A3PA 1I42A 4FJYA 2XBBC 1ZKHA 4LDTD 3VUWA 1WI0A 4IWPA 3M63B 3QIJA 1WMHA 1TZ1A 2L05A 1WGGA 2K8BA 3BY4B 4P7IA 4ANWA 1HE8A 1UH6A 4K7SA 3U30A 2WX0A 3KYCD 2M0XA 3WAPA 1OEYJ 1WXSA 4LDTB 3HM3A 2DAFA 3ML8A 2FCNA 1TBEA 3H7SA 2LUEA 4GDLB 2UWQA 2REXA 4B9KA 4AUQC 2ZEQA 2J7QB 2KDIA 3ZRFA 2K25A 2J0JA 4FADA 1Y8RC 2DZJA 2NR2A 2MLBA 1UZXB 4K7WA 2D2QA 4A3OA 4BKSA 2L0FA 2BKRB 1WH3A 4BBNF 3IBEA 5HKHA 2KDBA 3VTVA 4F8CB 3AI5A 4ZDVA 2PEAA 4DDID 1P1AA 3KVFB 5L95C 3NS8A 2G4SA 1V6EA 2LRUA 4GGQA 4W9FA 4FHKA 4OVUA 1J19A 1E8XA 4IW0A 2V3SA 2LXCA 4WWPA 4E3CA 1GC7A 3QJZA 2FCSA 4WQOB 2KQ7A 2O2VB 4RMAA 3H6NA 3R7QA 4IC7B 4K7UA 2EMSA 2KTRB 4HDQA 4EFOA 2MCNB 3RYTA 2OOBB 1SGHA 2ZJDA 4ZRIA 2L76A 3VUXA 3L13A 4YL8A 3KW5B 2XK5B 4DBGA 5JZEB 5DPRA 1E8ZA 2GBMA 4XC2A 2IY0B 1V81A 3T8MA 2V4LA 2L00B 2JWZA 5IAAC 3UINB 3JVZX 1RRBA 5G2NA 4IUMB 4ICVA 4E74A 4GU2A 4F7ZA 4TQ1A 2IO0B 1V5OA 3JSVA 1EUVB 1UBQA 2Z59B 4FBJB 3PZDA 3HHMA 3DVGX 2O6VA 3AU4A 4GN1A 2KFKA 4PYUA 2CHXA 3A9JB 3DVNU 4KSKC 3ZNID 3UQBA 2UYZB 1YD8U 4HJKA 4MGKE 1V2YA 2D3GA 2ZNVC 3JW0X 3OJ3A 3TIXA 4KZCA 4KV2A 2DX5B 3IG3A 2D11A 2K8CA 2KDEB 1WE7A 2MBOA 4GMVA 4TV3A 3L08A 1UD7A 4WWOA 4IG7B 3QWZB 5FR6A 1AARA 2DZIA 2KKCA 5CX3A 2JRIB 3QHTA 2FAZA 3RZWC 3H7PB 4URKA 2KLCA 5DPSA 4FN2A 2MSED 2AWTA 2DHZA 2M17A 3NZUA 2L8JA 1P3QU 3VH4B 1E90A 1WJ6A 3M95A 2KC2A 2MWSB 1WGDA 3APFA 5D94A 3TMPB 2GBNA 2KX3A 2KMCA 1WM2A 4HK2A 1LM8B 3WIMA 2NBUA 4II3B 2BWFA 2KWCA 2KTFA 4ZRKA 5AZFA 4CHKA 2ASQA 1Q1OA 2KHWB 4F1SA 3B0AA 3ZO5B 4MEMA 2RGFA 4KDLB 4ZYNA 4EUTA 2OJRA 3DVGY 1XQQA 2ZVOA 2GBKA 4IWOA 2JPHA 3CMMB 3L17A 2KMAA 2NS5A 5JHAA 3MJWA 2GMIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KIK B;  4TUU A;  3DDC B;  3N30 A;  3HIZ A;  4AWJ A;  1S3S G;  4HCN B;  4J6I A;  2HE7 A;  2W9N A;  4W9D A;  3WA0 A;  4K81 A;  2ZCC A;  5E6N A;  2XEW A;  1H4R A;  4WWN A;  3Q3J A;  1EF1 A;  5L83 A;  1X1M A;  3X0W A;  2L7R A;  1VCB A;  2KJR A;  2ZPY A;  3HK0 A;  2N7E A;  3PPA A;  3V61 A;  2AL3 A;  2Z0D B;  3DCG A;  3OJ4 B;  3MHS D;  1GUA B;  3S2A A;  3RT3 B;  3SU8 X;  1C3T A;  3RUI B;  2MBH A;  3ZIM A;  5G55 A;  3O65 B;  2NCN A;  4KVG B;  1WX7 A;  2C7M B;  2JT4 B;  2FID A;  3QQ8 B;  2LD9 A;  5KHO A;  2R2O A;  3ALB A;  3ZTD A;  5GMV A;  4G3X B;  2N7D A;  1BT0 A;  1FXT B;  1OQY A;  2ZNV B;  2KDF B;  3EEC A;  2KAN A;  4MJS A;  4OVV A;  1T0Y A;  3V62 A;  1SIF A;  4WJP A;  3VFK A;  2LRW A;  1V80 A;  1IP9 A;  3PSE B;  2BPS A;  1UGM A;  2KN5 A;  3GZN I;  1YQB A;  2CHZ A;  1K8R B;  2FCQ A;  3ZKJ C;  4LCD E;  3IHP C;  1TTN A;  1WX8 A;  2KO3 A;  4IM0 A;  2DYB A;  4MM3 A;  2N4F A;  1WJ4 A;  4W9L A;  3NZS A;  4N9F 4;  3DOW A;  1Q0W B;  2IY1 B;  1WE6 A;  4ZRJ A;  3UGB B;  1YX5 B;  4PS8 A;  4GDL A;  4DWF A;  3H1U A;  1EF5 A;  2K39 A;  2DYO A;  3VTU A;  2NBW B;  1M94 A;  4FJZ A;  4JQW C;  3D32 A;  1RLF A;  3R7R A;  4DK5 A;  2RSU A;  2KNB A;  2JRH A;  3RD2 A;  4NAW A;  3LDZ E;  3UIO B;  3ZLZ A;  2N1W A;  3NOB A;  2O6V B;  2HD5 B;  4BKT A;  3ECI A;  3B08 A;  1GNU A;  2R2Q A;  2LI5 A;  4W9K A;  1A5R A;  4AJW A;  1SE9 A;  2LWP A;  4I6N B;  2C9W B;  4EEW A;  4DHZ E;  2KZR A;  2DZM A;  5D6J B;  2AYO B;  2NPT B;  3VDZ A;  2DZK A;  1KLV A;  1GG3 A;  3TJP A;  2JXX A;  2CU1 A;  4IM2 A;  4WAA A;  4CYE A;  1Q5W B;  5DPW A;  3QC8 B;  3PGE A;  3ML9 A;  4NJ7 A;  1V9J A;  2JUO A;  2BWE S;  4BFR A;  3V6C B;  2GOW A;  2O2V A;  4DHZ B;  1OTR B;  1PQS A;  1TGZ B;  2KTR A;  2JZZ A;  2KX0 A;  1JRU A;  3A1Q B;  1CMX B;  1WRD B;  5JHB A;  5CTR C;  3ONS A;  3WAL A;  2N1V A;  2ZCB A;  3HM6 X;  1WX9 A;  1ZGU B;  2DAJ A;  2WWZ A;  3WAO A;  2I1J A;  2FCM A;  4PS7 A;  4BOS C;  4LJP B;  2K8H A;  2DYM A;  1H8C A;  1UBI A;  4W9J A;  1WR1 A;  4PYZ A;  1P98 A;  2N9P C;  3CSF A;  4TQ0 A;  3PRM B;  3VQI A;  3ZNG C;  1WXM A;  1E5W A;  1Z2M A;  4JIO U;  2J0K A;  3PLU A;  1D3Z A;  3QK0 A;  3ZNH B;  4A20 A;  5D2M B;  3QA8 A;  3QAR A;  3A9K B;  3L0W B;  2KLG A;  3C0R B;  3ZUN A;  4BOZ B;  1EO6 A;  4GB9 A;  1VD2 A;  5LXI B;  3PRZ A;  2KVR A;  3GOE A;  5LLI A;  4ANX A;  2DEN B;  4ASW C;  1L2N A;  3PHW B;  1WXA A;  2AL6 A;  3A4S C;  3APC A;  3AXC A;  3PV1 A;  4JLC A;  4M0W B;  5KHQ A;  1J8C A;  2BGF A;  2LZ6 A;  1WZ0 A;  1IPG A;  1WFY A;  2M4N A;  2MP2 B;  4HPM B;  4MH0 E;  3VHT C;  3U7D A;  1C1Y B;  2KXJ A;  4JGH B;  1WIA A;  2CHW A;  2QHO A;  3N32 A;  3SD5 A;  3NHE B;  3N3K B;  2WDT B;  3H7P A;  4GDK A;  4HVB A;  2GBR A;  1RAX A;  3WAN A;  2IO2 B;  3MTN B;  4MDK E;  1E8Y A;  3IVF A;  1P9D U;  1GJZ A;  1KOT A;  5C1Z A;  1WMH B;  4RM9 A;  4JL9 A;  1LFD A;  3DBR I;  4ANU A;  1R4M I;  1U4A A;  1WY8 A;  2KK8 A;  2LAS A;  2LVO A;  2WYQ A;  2K6D B;  2BKF A;  3I3T B;  4GSW A;  4BKS D;  3OAW A;  5DPT A;  2KQS A;  2J0M A;  4DHJ D;  3IFW B;  3RCZ A;  4M8M A;  2PE9 A;  2PJH A;  4MSQ B;  1YIW A;  4G11 A;  2MRP A;  5LXH A;  1WYW B;  2Y5B B;  3M3J A;  3UF8 A;  4DHJ B;  5CHV C;  4AJY B;  4MGI E;  1E7V A;  2CS4 A;  4XZ4 A;  4KIK A;  4NY0 A;  2ZPN A;  3CST A;  3PHX B;  4W9E A;  1F9J A;  2YLM A;  2B3A A;  3UQA A;  3VTW A;  2ZVN A;  1ISN A;  3V6E B;  4HWI B;  1YX6 B;  1ZW7 A;  3Q3F A;  4DXA B;  4IWQ A;  4KDI C;  2KWV B;  4B6W A;  2G45 B;  4GXB A;  2C7N B;  1IYF A;  3DBH I;  4E71 A;  5E6O A;  3VUY A;  4G0N B;  3W1S A;  4DDG D;  1E8W A;  4EOY A;  3PRP B;  2BYE A;  2BF8 B;  2RPQ A;  3QCA A;  4W9G A;  3PRE A;  3KYD D;  1WXV A;  4GOC A;  4WJO A;  1WGR A;  3DQV A;  2JZ3 B;  2C7H A;  2KWU B;  2KJH B;  2PE6 B;  3CF6 E;  3L16 A;  1OEY A;  2CKH B;  4FJV B;  4IM3 A;  4MGY E;  4NAW B;  3SDL C;  1P0R A;  3ZRC A;  4WJQ A;  2O6V D;  1E7U A;  1GC6 A;  5AZH A;  2K6Q A;  1NBF C;  3K9O B;  3TL5 A;  5JH5 C;  1L7Y A;  3JSV B;  4ANV A;  2MBB B;  3JYU A;  3KH0 A;  3LJ3 A;  2KC1 A;  2RR9 A;  2KFK B;  1RFA A;  4W9H A;  2EMT A;  3RUL A;  2LGY A;  3A4R A;  3ENE A;  2VRR B;  4I6L B;  4NNJ B;  4LJO B;  2A5U A;  4RM8 A;  4M8N A;  3BIN A;  2FUH B;  1Z5S B;  3PS6 A;  2C5L C;  5C23 A;  1OGW A;  3X23 A;  3KUZ A;  2MQJ A;  2JVC A;  3OLM D;  1I35 A;  1J0G A;  1KM7 A;  1WR6 E;  4EKU A;  2FIF A;  4MGZ E;  3RZF A;  3TCA A;  2KD0 A;  5AEK B;  4MEL A;  2GBJ A;  1NDD A;  2D10 A;  3SHQ A;  5CHW A;  3W1S C;  2NVU I;  2FNJ B;  4EZJ A;  4CO7 A;  3W1Y A;  2ZZP B;  4HXD A;  4ICU A;  4NQL B;  2N9X A;  2CR5 A;  4KSL C;  2XK5 A;  3VVW B;  2AEH A;  5AZG A;  2MX2 A;  2IO1 B;  3ZDT A;  4FHJ A;  3B1L X;  4I6P A;  2EKE C;  4MSM B;  5J18 A;  3EC8 A;  2YVC A;  2JY6 A;  3A33 B;  2M8S A;  3T9L A;  3TBL D;  4AP4 C;  1R4N I;  2L3Z A;  4B95 A;  4HLE A;  5CHF A;  3M62 B;  3L54 A;  3NY5 A;  1S1Q B;  3H9D A;  3R66 C;  2NPT A;  4XX5 A;  4W9C A;  4NQK E;  2PPH A;  3APD A;  2I1K A;  2RD0 A;  3A9J A;  2G4D B;  3K9P B;  5J17 A;  5DCN A;  3WAM A;  2IYD B;  2V1Y A;  1V86 A;  3KUC B;  3V60 A;  3ZDM C;  3A1Q A;  4TKN A;  4W9I A;  1XD3 B;  1LQB A;  3QX1 A;  3QAQ A;  2LGX A;  1YJ1 A;  3R3M A;  1XT9 B;  3DPD A;  1V5T A;  3VXW A;  1WGY A;  3EFU A;  4FLH A;  2LGD A;  4GDK B;  4KZ0 A;  4PS3 A;  4K1R B;  1LXD A;  2IBI B;  2WX1 A;  3L10 B;  5BO4 B;  4WJN A;  2LVQ A;  1WZ3 A;  4EZK A;  3DBL I;  3UIP B;  3ZW3 A;  5TR5 A;  4AOF A;  2D07 B;  1WM3 A;  2KJ6 A;  2IZV B;  3VH3 B;  2A4Z A;  2LJ5 A;  2M1M A;  3EHV A;  1WF9 A;  2IO3 B;  4HCP B;  2C60 A;  3AUL A;  5EDS A;  2HJ8 A;  4FA6 A;  4HPL B;  1WJN A;  2N9E B;  2LXA A;  2NBV B;  2KFJ A;  3PT2 B;  3A9K A;  4HDO A;  3ZNZ B;  3ZVV A;  2MW5 A;  1QZE A;  5J2R A;  1V49 A;  4BBN C;  2BYV E;  4NPN A;  3P2B A;  4BVU C;  4FUL A;  3KUD B;  1MG8 A;  2MBE A;  2Z0E B;  3DBS A;  4GIV A;  5E6P A;  2K1F A;  4NJ6 A;  2L0T A;  5D7G A;  3PTF C;  1G6J A;  4X57 B;  2BYF A;  3PLV A;  2G3Q B;  2HTH A;  2LVP A;  2MA9 B;  4BKG A;  2MP2 A;  2JF5 A;  4MJS B;  1KJT A;  3AU5 A;  2MBQ A;  3U8Z A;  1WGH A;  3DVN V;  3PVL A;  4G50 A;  4II2 B;  4EZL A;  5IA7 A;  3ZTC A;  3VAW A;  1UEL A;  2KOX A;  1NI2 A;  1WJU A;  4A3P A;  1I42 A;  4FJY A;  2XBB C;  1ZKH A;  4LDT D;  3VUW A;  1WI0 A;  4IWP A;  3M63 B;  3QIJ A;  1WMH A;  1TZ1 A;  2L05 A;  1WGG A;  2K8B A;  3BY4 B;  4P7I A;  4ANW A;  1HE8 A;  1UH6 A;  4K7S A;  3U30 A;  2WX0 A;  3KYC D;  2M0X A;  3WAP A;  1OEY J;  1WXS A;  4LDT B;  3HM3 A;  2DAF A;  3ML8 A;  2FCN A;  1TBE A;  3H7S A;  2LUE A;  4GDL B;  2UWQ A;  2REX A;  4B9K A;  4AUQ C;  2ZEQ A;  2J7Q B;  2KDI A;  3ZRF A;  2K25 A;  2J0J A;  4FAD A;  1Y8R C;  2DZJ A;  2NR2 A;  2MLB A;  1UZX B;  4K7W A;  2D2Q A;  4A3O A;  4BKS A;  2L0F A;  2BKR B;  1WH3 A;  4BBN F;  3IBE A;  5HKH A;  2KDB A;  3VTV A;  4F8C B;  3AI5 A;  4ZDV A;  2PEA A;  4DDI D;  1P1A A;  3KVF B;  5L95 C;  3NS8 A;  2G4S A;  1V6E A;  2LRU A;  4GGQ A;  4W9F A;  4FHK A;  4OVU A;  1J19 A;  1E8X A;  4IW0 A;  2V3S A;  2LXC A;  4WWP A;  4E3C A;  1GC7 A;  3QJZ A;  2FCS A;  4WQO B;  2KQ7 A;  2O2V B;  4RMA A;  3H6N A;  3R7Q A;  4IC7 B;  4K7U A;  2EMS A;  2KTR B;  4HDQ A;  4EFO A;  2MCN B;  3RYT A;  2OOB B;  1SGH A;  2ZJD A;  4ZRI A;  2L76 A;  3VUX A;  3L13 A;  4YL8 A;  3KW5 B;  2XK5 B;  4DBG A;  5JZE B;  5DPR A;  1E8Z A;  2GBM A;  4XC2 A;  2IY0 B;  1V81 A;  3T8M A;  2V4L A;  2L00 B;  2JWZ A;  5IAA C;  3UIN B;  3JVZ X;  1RRB A;  5G2N A;  4IUM B;  4ICV A;  4E74 A;  4GU2 A;  4F7Z A;  4TQ1 A;  2IO0 B;  1V5O A;  3JSV A;  1EUV B;  1UBQ A;  2Z59 B;  4FBJ B;  3PZD A;  3HHM A;  3DVG X;  2O6V A;  3AU4 A;  4GN1 A;  2KFK A;  4PYU A;  2CHX A;  3A9J B;  3DVN U;  4KSK C;  3ZNI D;  3UQB A;  2UYZ B;  1YD8 U;  4HJK A;  4MGK E;  1V2Y A;  2D3G A;  2ZNV C;  3JW0 X;  3OJ3 A;  3TIX A;  4KZC A;  4KV2 A;  2DX5 B;  3IG3 A;  2D11 A;  2K8C A;  2KDE B;  1WE7 A;  2MBO A;  4GMV A;  4TV3 A;  3L08 A;  1UD7 A;  4WWO A;  4IG7 B;  3QWZ B;  5FR6 A;  1AAR A;  2DZI A;  2KKC A;  5CX3 A;  2JRI B;  3QHT A;  2FAZ A;  3RZW C;  3H7P B;  4URK A;  2KLC A;  5DPS A;  4FN2 A;  2MSE D;  2AWT A;  2DHZ A;  2M17 A;  3NZU A;  2L8J A;  1P3Q U;  3VH4 B;  1E90 A;  1WJ6 A;  3M95 A;  2KC2 A;  2MWS B;  1WGD A;  3APF A;  5D94 A;  3TMP B;  2GBN A;  2KX3 A;  2KMC A;  1WM2 A;  4HK2 A;  1LM8 B;  3WIM A;  2NBU A;  4II3 B;  2BWF A;  2KWC A;  2KTF A;  4ZRK A;  5AZF A;  4CHK A;  2ASQ A;  1Q1O A;  2KHW B;  4F1S A;  3B0A A;  3ZO5 B;  4MEM A;  2RGF A;  4KDL B;  4ZYN A;  4EUT A;  2OJR A;  3DVG Y;  1XQQ A;  2ZVO A;  2GBK A;  4IWO A;  2JPH A;  3CMM B;  3L17 A;  2KMA A;  2NS5 A;  5JHA A;  3MJW A;  2GMI C; 
#chains in the Genus database with same CATH topology
 2LGS A;  1HTQ A;  3HIZ A;  4AWJ A;  3DHH C;  2W9N A;  2XEW A;  3V05 A;  1H4R A;  5L83 A;  1X1M A;  3DHI C;  2L7R A;  2KJR A;  3ZJV A;  2K0P A;  2N7E A;  2AL3 A;  3SU8 X;  1BXT A;  3RT3 B;  1SBB B;  2MBH A;  4C4V A;  3O65 B;  4KVG B;  1I4P A;  1T0S C;  2FID A;  4WAF A;  2BS2 B;  3ALB A;  1QOF A;  1QT9 A;  2WXG A;  1OQY A;  4KX6 B;  4RGT A;  1T0Y A;  1SIF A;  3Q14 C;  3ZGZ A;  4OVZ A;  2KN5 A;  2WHI A;  3GZN I;  5MPO A;  3PZ7 A;  1TTN A;  1WX8 A;  4IM0 A;  2N4F A;  3AE2 B;  4USA A;  3NZS A;  5HG2 A;  3DOW A;  2IY1 B;  4GDL A;  2CJN A;  3MJ5 A;  3VTU A;  2KYW A;  4FJZ A;  2FBW B;  3D32 A;  1RLF A;  3NVY A;  2KNB A;  2JRH A;  4NAW A;  2V3P A;  4BKT A;  1HXY D;  3B08 A;  4AJW A;  2DZM A;  2AYO B;  2DZK A;  2JXX A;  2CU1 A;  3QC8 B;  3ML9 A;  4NJ7 A;  3AV8 A;  2BWE S;  1TS2 A;  2BYT A;  4NJC A;  1OTR B;  2JZZ A;  2KTR A;  1JWS D;  2KX0 A;  2HDE A;  2E6X A;  2BVC A;  1SF0 A;  5EE1 A;  2PMV A;  3WAL A;  2N1V A;  1OQR A;  2BS3 B;  4BOS C;  4LJP B;  2K8H A;  2V4I B;  4GLS C;  1C9F A;  2WDR B;  1L6U A;  1P98 A;  1RFK A;  1YN3 A;  4TQ0 A;  3VQI A;  3GE3 C;  4JIO U;  1FMA D;  4A20 A;  3ZUN A;  1I7H A;  3C0R B;  3PRZ A;  2KVR A;  3DBL B;  3PV1 A;  1NVI D;  1FXA A;  1GAQ B;  3RMK C;  1SE4 A;  1WZ0 A;  1IPG A;  2MP2 B;  4HPM B;  4MH0 E;  1HQR D;  2KXJ A;  3N32 A;  1MHH E;  3Q8C A;  3B9J A;  4L23 A;  3BVM A;  2PIA A;  4HVB A;  4ZRP A;  3MTN B;  4YXD B;  1FNW A;  1P9D U;  1GJZ A;  1YN4 A;  3R2T A;  5C1Z A;  4JL9 A;  4ANU A;  2LAS A;  2WYQ A;  2BKF A;  4GSW A;  3OAW A;  4A9A A;  2KQS A;  4DHJ D;  4WWM A;  1GOZ A;  1YIW A;  4G11 A;  1A70 A;  5CHV C;  4MGI E;  1E7V A;  1FO4 A;  1XF5 L;  4JWS C;  2GLS A;  4NY0 A;  1XXG A;  3PHX B;  4W9E A;  2B3A A;  1KFY B;  3Q8F A;  3V6E B;  2K5P A;  4DXA B;  1MFW A;  2WLB A;  4LNI A;  4DDG D;  3RNA C;  2MJ3 A;  1E8W A;  2BYE A;  3QCA A;  3W9C B;  3C8Y A;  4XDD A;  1L5P A;  1XLQ A;  3CF6 E;  4IM3 A;  3SDL C;  2IND C;  2O6V D;  1E7U A;  1GC6 A;  2LJI A;  1T0Q C;  3HVD A;  1JAL A;  1NBF C;  2IJ0 A;  3KWL A;  3JYU A;  3LJ3 A;  1L0X B;  5H8Y E;  2KFK B;  4KGR A;  1K50 A;  4I6L B;  4NNJ B;  4LJO B;  4RM8 A;  1E9M A;  3AEC B;  5C23 A;  3LXF A;  5EE9 A;  3OLM D;  5BMH A;  1J0G A;  2J53 A;  4EKU A;  5AEK B;  4MEL A;  2GBJ A;  1RWS A;  3SHQ A;  5CHW A;  3W1S C;  1T6B X;  4ACF A;  4CO7 A;  4NQL B;  2XK5 A;  1F2R I;  1N61 A;  2M19 A;  4FHJ A;  4I6P A;  1NYR A;  2EKE C;  4MSM B;  1AW7 A;  3AE6 B;  4REZ A;  2M8S A;  3T9L A;  3TBL D;  4AP4 C;  2L3Z A;  4WQM A;  3NY5 A;  2NPT A;  3BYY B;  1L4D B;  4W9C A;  4US9 A;  2PPH A;  3K9P B;  2I1K A;  4H2A A;  2IYD B;  1KH0 A;  3EFC A;  4W9I A;  1HTO A;  3MP9 A;  3EFU A;  4FLH A;  4PS3 A;  2XN9 C;  2IBI B;  2WX1 A;  1WZ3 A;  2ZW0 A;  3UIP B;  5BMI A;  1WM3 A;  2KJ6 A;  2A4Z A;  3EHV A;  2IO3 B;  1EWC A;  3NVW A;  4FA6 A;  2N9E B;  3PT2 B;  3R8B A;  1SJE D;  3NJT A;  1QZE A;  4BBN C;  2M56 B;  4NPN A;  3KUD B;  1MG8 A;  1I4H A;  2AX5 A;  2KQ4 X;  1JWM D;  2MBE A;  2K1F A;  3PTF C;  4X57 B;  3PLV A;  2G3Q B;  1MI0 A;  4BKG A;  1DOY A;  3VR8 B;  1ZE3 D;  1FCL A;  3DVN V;  2HTM E;  3PVL A;  4EZL A;  3ZTC A;  3RNB C;  2LGI A;  3AEG B;  1MHX A;  1I42 A;  3VUW A;  1HE8 A;  1K52 A;  2I38 A;  4LDT B;  2FCN A;  2LUE A;  2REX A;  3MC8 A;  1FIQ A;  3ZRF A;  2J7Q B;  4P1B C;  2OHF A;  4K7W A;  4A3O A;  2QCZ A;  4RF1 A;  2G4S A;  4FHK A;  4OVU A;  3BK2 A;  1E8X A;  2QC8 A;  4MAC A;  1ET6 A;  3R7Q A;  4HDQ A;  4EFO A;  3RYT A;  4ZRI A;  2ZJD A;  2L76 A;  1HZ6 A;  3L13 A;  1FEH A;  3Q8E A;  5JZE B;  1E8Z A;  3Q6B A;  2L00 B;  3E9S A;  5IAA C;  3JVZ X;  4TQ1 A;  1EUV B;  1UBQ A;  1WYG A;  2O6V A;  1ROE A;  2KDM A;  3UQB A;  2VZK D;  4P16 A;  2WGS A;  3MHZ A;  1SE2 A;  2D3G A;  4KZC A;  4KV2 A;  2D11 A;  2BW2 A;  3IT4 B;  4AQ7 A;  3IAM 1;  4YSY B;  1K51 A;  3VRA B;  3RZW C;  4URK A;  3NS1 A;  1J7A A;  3NZU A;  1YNT E;  5EE3 A;  3M95 A;  1E90 A;  1WJ6 A;  2LHD A;  3APF A;  5D94 A;  1WM2 A;  1ENF A;  3WIM A;  1YQ3 B;  4A6Q A;  2NBU A;  3AE9 B;  2KWC A;  3U2S C;  3N1X C;  3I9V 1;  4XWT A;  5I4D A;  4OHJ A;  4S0R A;  5AZF A;  2KHW B;  1Q1O A;  3B0A A;  1DGJ A;  2L52 A;  4KDL B;  4YWG G;  3TEX A;  4P1C C;  4QAY A;  2GBK A;  4IWO A;  1IBX B;  2JPH A;  2OED A;  3RI7 C;  2JYE A;  2NS5 A;  5JHA A;  5IOI A;  1SEB D;  1VD2 A;  4KIK B;  2N9K A;  1S3S G;  4HCN B;  2HE7 A;  1YMH E;  3WA0 A;  4K81 A;  3U7Z A;  2YEP F;  3Q3J A;  1BML C;  1EF1 A;  3X0W A;  1VCB A;  1F0Z A;  1GUA B;  1C3T A;  3BYT B;  3RUI B;  3ZIM A;  3P4R B;  4NAM A;  4DXG A;  1WX7 A;  2C7M B;  2FUG 1;  3QQ8 B;  5KHO A;  3KLS X;  3DBH B;  4HEA 1;  1PYW D;  2PW9 A;  1CK1 A;  4OVV A;  2ZNV B;  2KDF B;  1XEE A;  1ZDV A;  4YTN B;  4WJP A;  3VFK A;  4C56 C;  2RDH A;  5LNK 1;  3PSE B;  1UGM A;  5BYS A;  1K8R B;  3LB8 C;  2QIL A;  4US8 A;  2JXT A;  1YX5 B;  2WU2 B;  2MJD A;  1EF5 A;  2K39 A;  2DYO A;  2NBW B;  1M94 A;  2GRI A;  4JE3 B;  4DK5 A;  3LDZ E;  2BBC A;  3UIO B;  3NOB A;  3ECI A;  1GNU A;  2R2Q A;  2K22 A;  2LWP A;  2C9W B;  3MC9 A;  3TSS A;  1NYQ A;  3P63 A;  4L1B A;  1QF6 A;  1GG3 A;  3TJP A;  4WAA A;  5DPW A;  2BB5 A;  1V9J A;  1V97 A;  2JUO A;  5G5G A;  2DBY A;  2SEB D;  2GOW A;  2O2V A;  3A1Q B;  1WRD B;  1R4N B;  2QJL A;  2PKO A;  1CZP A;  3TEY A;  3HM6 X;  1ZGU B;  2WXP A;  3N1Y C;  2FCM A;  2DYM A;  1H8C A;  1WR1 A;  2INN E;  1PFD A;  3CSF A;  3PRM B;  3ZNG C;  5AUK A;  1WXM A;  1YN5 A;  1SIJ A;  1Z2M A;  3PLU A;  2V0G A;  3ZNH B;  3QA8 A;  3Q3N C;  3IT6 B;  3L0W B;  1EO6 A;  1VZ7 A;  4ARC A;  3AE3 B;  5LLI A;  4ANX A;  2I2Y A;  3Q69 A;  3PHW B;  3A4S C;  2AL6 A;  4JLC A;  3APC A;  3AXC A;  1J8C A;  2LZ6 A;  1WFY A;  1V1P B;  3VHT C;  1C1Y B;  3NHE B;  3N3K B;  4J3O D;  4C00 A;  4GDK A;  2GBR A;  1RAX A;  2IO2 B;  4MDK E;  1E8Y A;  1NEN B;  4K3C A;  2J52 A;  4RM9 A;  1R4M I;  1HA5 A;  1T0R C;  2K6D B;  4C4V B;  2WS3 B;  3KQ4 A;  1EU3 A;  2J0M A;  3IFW B;  2ON8 A;  4RGM A;  1WYW B;  2Y5B B;  4RF0 A;  1FNU A;  3HUI A;  3BVZ A;  5T8I A;  1F9J A;  2YLM A;  1IGD A;  3VTW A;  1L0Y B;  3AE7 B;  3Q3F A;  4IWQ A;  1EWY C;  2MEK A;  1T3Q A;  4HRO A;  2SAK A;  4W9G A;  2BF8 B;  2KWD A;  1TY0 A;  1WXV A;  4GOC A;  1WGR A;  2C7H A;  2KWU B;  3ZJU A;  1OEY A;  2CKH B;  4NAW B;  4HKZ E;  1UNS A;  1MVK A;  2K6Q A;  3KH0 A;  1D4B A;  2J42 A;  3A4R A;  1N62 A;  4M8N A;  1Z5S B;  2C5L C;  4S17 A;  1OGW A;  3KUZ A;  3KWV A;  2JVC A;  3NZ3 A;  3AEF B;  1XCT L;  2WNM A;  3J9C A;  4MGZ E;  3RZF A;  2Q5W D;  2VH2 A;  3Q2A C;  2FNJ B;  3P42 A;  4ZYS A;  4CQN A;  3T3N A;  4KSL C;  3VVW B;  5AZG A;  2WU5 B;  2IO1 B;  3B1L X;  4YT0 B;  2YVC A;  1QLB B;  4B95 A;  2WXI A;  1N60 A;  3P1M A;  3H9D A;  3W2D A;  2RD0 A;  3A9J A;  2G4D B;  2V1Y A;  3RFZ B;  1V86 A;  4OW0 A;  3V60 A;  1C4C A;  1FNV A;  1FRR A;  2KMM A;  2DNF A;  1I4R A;  2N0S B;  3R3M A;  4B0M A;  3DPD A;  3LYY A;  2RPV A;  3AEE B;  1LXD A;  3R2I A;  4WJN A;  1E10 A;  3DBL I;  2QIE B;  5TR5 A;  2D07 B;  3PO0 A;  2AQ2 B;  3AUL A;  2WDQ B;  2HJ8 A;  1ZDX A;  2GI9 A;  2NBV B;  4HPL B;  2W82 A;  3ZNZ B;  1PGX A;  1XLO A;  2MW5 A;  2BYV E;  4BVU C;  2Z0E B;  5E6P A;  4GIV A;  5D7G A;  2WXN A;  2BYF A;  1C79 A;  2MP2 A;  1UGJ A;  4MJS B;  1FFV A;  1JML A;  1VLB A;  2INC C;  1ZXI A;  2KOX A;  3MFG A;  2RMM A;  1ZKH A;  4LDT D;  1WI0 A;  3VR9 B;  3QIJ A;  4P7I A;  1UH6 A;  2IGH A;  3KYC D;  2M0X A;  1KTK A;  2DAF A;  1L6V A;  3H7S A;  1VJK A;  4AUQ C;  4FAD A;  2KDI A;  2L0F A;  4BBN F;  5HKH A;  2AQ3 B;  2DWQ A;  3VTV A;  4HJG E;  1QQR A;  3ZXR A;  1P1A A;  3Q8B A;  1YJJ A;  2W3R A;  1I4Q A;  1ESF A;  5G5H A;  4IW0 A;  3UI3 A;  4WWP A;  4E3C A;  3BZD B;  4IC7 B;  2EMS A;  2BTE A;  2WXQ A;  2K3U A;  4YL8 A;  4DBG A;  2XK5 B;  3PZ8 A;  3GP7 A;  2GBM A;  3T8M A;  5FK9 C;  5G2N A;  4LTU A;  4ICV A;  1FRD A;  4GU2 A;  4OZB A;  2IO0 B;  3HHM A;  2EEL A;  3AU4 A;  1HEZ E;  1TS5 A;  1WRI A;  2CHX A;  2KFK A;  1JWA D;  3ZNI D;  2UYZ B;  4DXF A;  1YD8 U;  1JWB D;  2ZNV C;  1DOI A;  3IG3 A;  4RFB A;  1WE7 A;  3L08 A;  4M02 A;  4IG7 B;  2IDY A;  5FR6 A;  2DZI A;  1D5X C;  1FD6 A;  2JRI B;  3H7P B;  5DPS A;  1Q10 A;  2AWT A;  3VH4 B;  1XLN A;  4RGO S;  2Y3A A;  2KAJ A;  2GBN A;  2KMC A;  2KX3 A;  5BYR A;  4D2K A;  2X38 A;  4ZRK A;  3ZO5 B;  4MEM A;  1LGR A;  1PGA A;  1E7P B;  2GMI C;  4M0W A;  3U52 E;  3CWI A;  4J6I A;  2WXJ A;  4W9D A;  1I4G A;  4YSZ B;  4WWN A;  2IGG A;  2QSD A;  1YOV B;  2NTT A;  1F52 A;  3V61 A;  2Z0D B;  3DCG A;  2AQ1 B;  2RDG A;  3BVG A;  3MHS D;  3S2A A;  1ET9 A;  2JYT A;  2NCN A;  1Y56 A;  5EE0 A;  1TIF A;  2JT4 B;  2PLP A;  2R2O A;  1UF0 A;  3FIL A;  5GMV A;  4G3X B;  3V62 A;  2MHJ A;  2NTS A;  1V80 A;  1ZUD 2;  1V1O A;  1R7S A;  1FM0 D;  1XCQ L;  2FCQ A;  2D5G A;  3V3X A;  1MPE A;  4MM3 A;  2DYB A;  1WJ4 A;  1HZ5 A;  1FXI A;  2EKI A;  2INP E;  3AE1 B;  3B2G A;  5IKC M;  3R7R A;  2RSU A;  4PK1 A;  3RD2 A;  3ZLZ A;  3W5U B;  2N1W A;  3UQA A;  2O6V B;  2LI5 A;  1M4V A;  4I6N B;  2PVG C;  3VDZ A;  1WSP A;  4IM2 A;  3FAH A;  3SFD B;  3N20 C;  4BFR A;  3NVZ A;  3V6C B;  3AM9 A;  4DHZ B;  1PQS A;  1TS3 A;  4JPS A;  1VZ6 A;  1TGZ B;  5C2T B;  1JRU A;  5JHB A;  5CTR C;  2ZCB A;  3BWU D;  3RNF C;  3WAO A;  1JRP A;  2I1J A;  3RNE C;  2WXH A;  1N63 A;  4PYZ A;  5GXG B;  2N9P C;  3ZQ4 A;  2J0K A;  3DHG C;  3A9K B;  1PDX A;  5LXI B;  3GOE A;  1WXA A;  2BGF A;  5E6J A;  5HHD G;  4JGH B;  1WIA A;  2QHO A;  3W5V B;  2N7J A;  3WAN A;  1TKY A;  1WMH B;  1LFD A;  3DBR I;  1U4A A;  2KK8 A;  2LVO A;  2WXR A;  1D6E C;  3I3T B;  3RCZ A;  2M0A A;  2PE9 A;  2PJH A;  1J7C A;  1TJE A;  1FPY A;  5LXH A;  4O1N A;  4TMA B;  1RM6 C;  4IKG A;  2KVZ A;  4KIK A;  3GS2 A;  2MH7 A;  3CST A;  5C3J B;  4XYC A;  4FXC A;  4ZOH C;  3OG5 A;  2ZVN A;  2LUM A;  2K9X A;  2KWV B;  4B6W A;  4GXB A;  1IYF A;  3DBH I;  4E71 A;  5E6O A;  3W1S A;  2ZW1 A;  1KLG D;  4EOY A;  2WXM A;  3KYD D;  2DLB A;  4WJO A;  3DQV A;  1QOG A;  2KN4 A;  1AN8 A;  2KJH B;  2PE6 B;  3L16 A;  3O13 A;  4FJV B;  4MGY E;  1OFF A;  5AZH A;  3K9O B;  4RCO A;  5JH5 C;  1L7Y A;  2WXO A;  3I5J C;  3OWE B;  3JSV B;  4LNK A;  1STE A;  1RFA A;  4W9H A;  2EMT A;  1ZOY B;  3ENE A;  1GB4 A;  1PUT A;  4LLG M;  2A5U A;  3BIN A;  3PS6 A;  1ZPS A;  3X23 A;  2MQJ A;  1I35 A;  3DWM A;  1KM7 A;  3Q8A A;  4M01 A;  1WR6 E;  2FIF A;  2KD0 A;  2D10 A;  2JSV X;  2NVU I;  4EZJ A;  3W1Y A;  2ZZP B;  4ICU A;  3AH7 A;  2AEH A;  3RNC C;  1R4N I;  3M62 B;  1VDV A;  3R66 C;  4XX5 A;  1V8C A;  4K3B A;  4Q2J A;  1GB1 A;  5J17 A;  5DCN A;  3WAM A;  2WXK A;  3RN9 C;  3A1Q A;  4TKN A;  1YJ1 A;  1XT9 B;  3VXW A;  1V5T A;  1ACC A;  1TS4 A;  4GDK B;  4KZ0 A;  5H92 C;  5BO4 B;  2LVQ A;  4ZRQ A;  2CU3 A;  4AOF A;  4MT5 A;  2IZV B;  2L32 A;  3VH3 B;  2LJ5 A;  3P4P B;  1WF9 A;  4HCP B;  3C19 A;  2LMC A;  5EDS A;  1E0Z A;  4YSX B;  1JQ4 A;  4WUR A;  4HDO A;  2VH1 A;  3ZVV A;  5J2R A;  4FUL A;  3DBS A;  2L0T A;  4A55 A;  1G6J A;  1R4M B;  3BK1 A;  5D3I B;  2MA9 B;  1F2R C;  2RDB C;  3BII D;  1V1P A;  3GE8 C;  1UWM A;  2JF5 A;  3AB5 A;  3AU5 A;  2MBQ A;  1WGH A;  3U4E G;  3AE8 B;  4XWW A;  2Y5C A;  4IWP A;  2QDF A;  2L05 A;  4B0E A;  4DWF A;  4ANW A;  3WAP A;  2WX0 A;  1WXS A;  3ABV B;  1NI3 A;  3HM3 A;  3ML8 A;  1TBE A;  4GDL B;  4B9K A;  2ZEQ A;  4WIP A;  2JU6 X;  2K25 A;  4N58 A;  1RYJ A;  2NR2 A;  3GZN B;  5HFY A;  2BKR B;  1WH3 A;  1T5X D;  2KDB A;  4F8C B;  1N6Z A;  5L95 C;  3RNG C;  2TSS A;  1V6E A;  4W9F A;  4C7Z A;  3RPF C;  2V3S A;  2CJO A;  3QJZ A;  2FCS A;  3TEZ A;  2V9H A;  4XE0 A;  4K7U A;  2KTR B;  1SGH A;  3VUX A;  3CIR B;  2GB1 A;  3P4Q B;  2OJW A;  5DPR A;  2WQY B;  1SJH D;  3UIN B;  1RRB A;  4OZC A;  4IUM B;  4F7Z A;  2Z59 B;  4FBJ B;  3PZD A;  3DVG X;  4PYU A;  3A9J B;  3DVN U;  4KSK C;  4MGK E;  4RNA A;  1V2Y A;  3JW0 X;  3OJ3 A;  2J4X A;  3NVV A;  2L83 A;  2K8C A;  1TZO A;  2KDE B;  4TSS A;  4A8X C;  4NZL B;  2MBO A;  4UDU C;  1UD7 A;  1UWX A;  1AAR A;  2KKC A;  3MC0 B;  5CX3 A;  3QHT A;  4KGS A;  3URY A;  4FN2 A;  4XGA B;  5IP4 D;  3Q3O C;  2DHZ A;  1TKG A;  2M17 A;  2L8J A;  3TMP B;  2MWS B;  4RGN A;  1LO5 D;  4HK2 A;  1LM8 B;  2QEJ C;  1SE3 A;  4DQO C;  1C76 A;  1DYQ A;  1AYF A;  4LNO A;  2OJR A;  3DVG Y;  1ZXH A;  3L17 A;  2KMA A;  3MJW A;  1YJI A;  4TUU A;  4MH8 A;  3DDC B;  3N30 A;  2WXL A;  3SEB A;  2ZCC A;  5E6N A;  2XNA C;  2ZPY A;  3HK0 A;  2W3S A;  3PPA A;  2BB6 A;  4BZA A;  3OJ4 B;  3NRZ A;  3WCQ A;  5G55 A;  4HKQ A;  3AN1 A;  1N5W A;  1TYG B;  5FKA C;  2LD9 A;  1EM7 A;  1F77 A;  1PGB A;  1BUI C;  3ZTD A;  1P7E A;  2N7D A;  1BT0 A;  1FXT B;  1MG4 A;  3EEC A;  4MJS A;  2KAN A;  1B1Z A;  2LRW A;  1IP9 A;  1XLP A;  2BPS A;  1L0V B;  2LHE A;  1YQB A;  2CHZ A;  2YEP B;  3ZKJ C;  3N1Z C;  4LCD E;  3IHP C;  2KO3 A;  1B9R A;  5BYQ A;  2MJE A;  4W9L A;  4N9F 4;  1Q0W B;  4ZRJ A;  1WE6 A;  3UGB B;  4PS8 A;  4N59 A;  1QOB A;  3H1U A;  4JQW C;  4IDI A;  1IUE A;  2BS4 B;  1FFU A;  1QKZ A;  1QIL A;  2HD5 B;  3P4S B;  1WXQ A;  4W9K A;  1A5R A;  1SE9 A;  4EEW A;  4DHZ E;  2KZR A;  1DOX A;  5D6J B;  2NPT B;  2G1E A;  1KLV A;  4C7Y A;  1AWD A;  4CYE A;  1Q5W B;  4OZA A;  3PGE A;  1UUP A;  2H89 B;  3IAS 1;  3TEW A;  1CMX B;  1J7B A;  4HRS A;  1MJD A;  2W55 A;  3ONS A;  3EA6 A;  1WX9 A;  2DAJ A;  2WWZ A;  4PS7 A;  1UBI A;  4W9J A;  1D5Z C;  2LFI A;  2X8X X;  2UU7 A;  5IO9 A;  1E5W A;  1D3Z A;  3QK0 A;  4ARI A;  1I4X A;  2QMT A;  5D2M B;  1D5M C;  3QAR A;  4BOZ B;  2KLG A;  4GB9 A;  1WGK A;  2IGD A;  2DEN B;  4JX1 C;  4ASW C;  1L2N A;  4M0W B;  3IXS A;  5KHQ A;  4KGT A;  2M4N A;  3U7D A;  2CHW A;  3SD5 A;  1SB3 C;  1VR9 A;  4EE2 A;  3H8H A;  2WDT B;  3EUB 2;  3H7P A;  3B2F A;  1WWT A;  3IVF A;  1KOT A;  1FCC C;  1WY8 A;  4C80 A;  4LNF A;  2N9L A;  4BKS D;  5DPT A;  3SFE B;  4LNN A;  1YQ4 B;  4M8M A;  3AE4 B;  4MSQ B;  4YTM B;  4JWU C;  2MRP A;  2JX5 A;  2Z8L A;  3FIL B;  3M3J A;  3L4P A;  3UF8 A;  4DHJ B;  4WH4 A;  4AJY B;  3AED B;  2CS4 A;  4XZ4 A;  3E56 A;  2ZPN A;  1ISN A;  4HWI B;  2HJ1 A;  1YX6 B;  1ZW7 A;  4KDI C;  4MM3 B;  2G45 B;  2C7N B;  3VUY A;  4G0N B;  1IGC A;  3PRP B;  2RPQ A;  3PRE A;  1C78 A;  1GPX A;  1ZP0 B;  1JCK B;  4ZHP A;  2JZ3 B;  1QOA A;  3N9Y C;  1SXT A;  3NUH B;  1P0R A;  3ZRC A;  4WJQ A;  2B76 B;  3TL5 A;  1C77 A;  4ANV A;  2MBB B;  1CQV A;  2IPK D;  2KC1 A;  2RR9 A;  3ETR A;  1VZ8 A;  3RUL A;  1TKE A;  2LGY A;  2VRR B;  3AE5 B;  2FUH B;  2E3T A;  4A90 A;  2L1A A;  3TCA A;  1N5X A;  1NDD A;  4XDC A;  3ZJT A;  4IOI E;  4HXD A;  2N9X A;  3HRD D;  2CR5 A;  3ZDT A;  2MX2 A;  5IN7 A;  2PTL A;  2FE8 A;  3Q3M C;  5J18 A;  3EC8 A;  2JY6 A;  3A33 B;  4HLE A;  5HI1 A;  5CHF A;  3L54 A;  3DWG C;  1S1Q B;  4M00 A;  2D3B A;  4NQK E;  2BT6 A;  3APD A;  3GB1 A;  1EU4 A;  2D3A A;  4KKI A;  2ACZ B;  4P6V F;  3KUC B;  3ZDM C;  1XD3 B;  1LQB A;  3QX1 A;  3QAQ A;  2LGX A;  1OQQ A;  2WXF A;  5JXV A;  1WGY A;  3AEA B;  1L4Z B;  2LGD A;  2KAC A;  4K1R B;  4RH6 A;  5FR3 A;  3L10 B;  2ONQ A;  3VRB B;  4EZK A;  3ZW3 A;  4R3D A;  2M1M A;  2R61 A;  1NEK B;  2C60 A;  4L2Y A;  1WJN A;  2LXA A;  2KFJ A;  3A9K A;  4ITK A;  1V49 A;  3P2B A;  2D3C A;  3NG0 A;  1KLU D;  4NJ6 A;  3DBR B;  4PT5 A;  3I63 C;  2HTH A;  5D3D A;  3FC4 A;  2LVP A;  5AUI A;  1IBX A;  4ZHO A;  1KJT A;  3T3O A;  1TT5 B;  3U8Z A;  3EGR A;  2G9H D;  4II2 B;  2WP9 B;  4G50 A;  5IA7 A;  4KKJ A;  3VAW A;  1UEL A;  1NI2 A;  4N6E B;  1WJU A;  4A3P A;  4FJY A;  2XBB C;  3M63 B;  1WMH A;  1TZ1 A;  1JW9 D;  1P7F A;  1WGG A;  2K8B A;  3BY4 B;  4K7S A;  3U30 A;  1OEY J;  1KF6 B;  2UWQ A;  2BQQ A;  2JQR B;  2J0J A;  1C4A A;  1Y8R C;  2PVO D;  2Y5P A;  2DZJ A;  2MLB A;  1UZX B;  2D2Q A;  4BKS A;  3IBE A;  2V3N A;  2LEK A;  3AI5 A;  4ZDV A;  2PEA A;  4DDI D;  3KVF B;  1F1H A;  2W54 A;  3NS8 A;  4BAX A;  4GGQ A;  2LRU A;  1J19 A;  1JWU D;  2LXC A;  3FKY A;  1GC7 A;  4WQO B;  1E6E B;  2ICI A;  2KQ7 A;  2O2V B;  4RMA A;  3H6N A;  2MCN B;  2OOB B;  1SSN A;  3SR6 A;  3KW5 B;  1CJE A;  4XC2 A;  2IY0 B;  1V81 A;  2V4L A;  3ZXV A;  1KRH A;  2JWZ A;  4E74 A;  1V5O A;  3JSV A;  1VRA B;  4GN1 A;  2NMQ A;  4HJK A;  1K53 A;  2JWU A;  3AEB B;  3TIX A;  2DX5 B;  2VZK B;  3AMZ A;  3TUO A;  4GMV A;  1TY2 A;  4TV3 A;  4WWO A;  3ZYY X;  5TSS A;  3QWZ B;  3HVZ A;  2FAZ A;  2KLC A;  2MSE D;  4HPP A;  4AS1 A;  1P3Q U;  2H88 B;  2KC2 A;  1WGD A;  2WDV B;  1C4P A;  1JRO A;  4II3 B;  4LK0 M;  2BWF A;  2KTF A;  2KT7 A;  2JZP A;  4CHK A;  2ASQ A;  4F1S A;  4EUT A;  1XO3 A;  2RGF A;  4ZYN A;  1XQQ A;  2ZVO A;  3I57 A;  3CMM B;  5BMG A;  4YTP B; 
#chains in the Genus database with same CATH homology
 4KIK B;  4TUU A;  3DDC B;  3N30 A;  3HIZ A;  4AWJ A;  1S3S G;  4HCN B;  4J6I A;  2HE7 A;  2W9N A;  4W9D A;  3WA0 A;  4K81 A;  2ZCC A;  5E6N A;  2XEW A;  1H4R A;  4WWN A;  3Q3J A;  1EF1 A;  5L83 A;  1X1M A;  3X0W A;  2L7R A;  1VCB A;  2KJR A;  2ZPY A;  3HK0 A;  2N7E A;  3PPA A;  3V61 A;  2AL3 A;  2Z0D B;  3DCG A;  3OJ4 B;  3MHS D;  1GUA B;  3S2A A;  3RT3 B;  3SU8 X;  1C3T A;  3RUI B;  2MBH A;  3ZIM A;  5G55 A;  3O65 B;  2NCN A;  4KVG B;  1WX7 A;  2C7M B;  2JT4 B;  2FID A;  3QQ8 B;  2LD9 A;  5KHO A;  2R2O A;  3ALB A;  3ZTD A;  5GMV A;  4G3X B;  2N7D A;  1BT0 A;  1FXT B;  1OQY A;  2ZNV B;  2KDF B;  3EEC A;  2KAN A;  4MJS A;  4OVV A;  1T0Y A;  3V62 A;  1SIF A;  4WJP A;  3VFK A;  2LRW A;  1V80 A;  1IP9 A;  3PSE B;  2BPS A;  1UGM A;  2KN5 A;  3GZN I;  1YQB A;  2CHZ A;  1K8R B;  2FCQ A;  3ZKJ C;  4LCD E;  3IHP C;  1TTN A;  1WX8 A;  2KO3 A;  4IM0 A;  2DYB A;  4MM3 A;  2N4F A;  1WJ4 A;  4W9L A;  3NZS A;  4N9F 4;  3DOW A;  1Q0W B;  2IY1 B;  1WE6 A;  4ZRJ A;  3UGB B;  1YX5 B;  4PS8 A;  4GDL A;  4DWF A;  3H1U A;  1EF5 A;  2K39 A;  2DYO A;  3VTU A;  2NBW B;  1M94 A;  4FJZ A;  4JQW C;  3D32 A;  1RLF A;  3R7R A;  4DK5 A;  2RSU A;  2KNB A;  2JRH A;  3RD2 A;  4NAW A;  3LDZ E;  3UIO B;  3ZLZ A;  2N1W A;  3NOB A;  2O6V B;  2HD5 B;  4BKT A;  3ECI A;  3B08 A;  1GNU A;  2R2Q A;  2LI5 A;  4W9K A;  1A5R A;  4AJW A;  1SE9 A;  2LWP A;  4I6N B;  2C9W B;  4EEW A;  4DHZ E;  2KZR A;  2DZM A;  5D6J B;  2AYO B;  2NPT B;  3VDZ A;  2DZK A;  1KLV A;  1GG3 A;  3TJP A;  2JXX A;  2CU1 A;  4IM2 A;  4WAA A;  4CYE A;  1Q5W B;  5DPW A;  3QC8 B;  3PGE A;  3ML9 A;  4NJ7 A;  1V9J A;  2JUO A;  2BWE S;  4BFR A;  3V6C B;  2GOW A;  2O2V A;  4DHZ B;  1OTR B;  1PQS A;  1TGZ B;  2KTR A;  2JZZ A;  2KX0 A;  1JRU A;  3A1Q B;  1CMX B;  1WRD B;  5JHB A;  5CTR C;  3ONS A;  3WAL A;  2N1V A;  2ZCB A;  3HM6 X;  1WX9 A;  1ZGU B;  2DAJ A;  2WWZ A;  3WAO A;  2I1J A;  2FCM A;  4PS7 A;  4BOS C;  4LJP B;  2K8H A;  2DYM A;  1H8C A;  1UBI A;  4W9J A;  1WR1 A;  4PYZ A;  1P98 A;  2N9P C;  3CSF A;  4TQ0 A;  3PRM B;  3VQI A;  3ZNG C;  1WXM A;  1E5W A;  1Z2M A;  4JIO U;  2J0K A;  3PLU A;  1D3Z A;  3QK0 A;  3ZNH B;  4A20 A;  5D2M B;  3QA8 A;  3QAR A;  3A9K B;  3L0W B;  2KLG A;  3C0R B;  3ZUN A;  4BOZ B;  1EO6 A;  4GB9 A;  1VD2 A;  5LXI B;  3PRZ A;  2KVR A;  3GOE A;  5LLI A;  4ANX A;  2DEN B;  4ASW C;  1L2N A;  3PHW B;  1WXA A;  2AL6 A;  3A4S C;  3APC A;  3AXC A;  3PV1 A;  4JLC A;  4M0W B;  5KHQ A;  1J8C A;  2BGF A;  2LZ6 A;  1WZ0 A;  1IPG A;  1WFY A;  2M4N A;  2MP2 B;  4HPM B;  4MH0 E;  3VHT C;  3U7D A;  1C1Y B;  2KXJ A;  4JGH B;  1WIA A;  2CHW A;  2QHO A;  3N32 A;  3SD5 A;  3NHE B;  3N3K B;  2WDT B;  3H7P A;  4GDK A;  4HVB A;  2GBR A;  1RAX A;  3WAN A;  2IO2 B;  3MTN B;  4MDK E;  1E8Y A;  3IVF A;  1P9D U;  1GJZ A;  1KOT A;  5C1Z A;  1WMH B;  4RM9 A;  4JL9 A;  1LFD A;  3DBR I;  4ANU A;  1R4M I;  1U4A A;  1WY8 A;  2KK8 A;  2LAS A;  2LVO A;  2WYQ A;  2K6D B;  2BKF A;  3I3T B;  4GSW A;  4BKS D;  3OAW A;  5DPT A;  2KQS A;  2J0M A;  4DHJ D;  3IFW B;  3RCZ A;  4M8M A;  2PE9 A;  2PJH A;  4MSQ B;  1YIW A;  4G11 A;  2MRP A;  5LXH A;  1WYW B;  2Y5B B;  3M3J A;  3UF8 A;  4DHJ B;  5CHV C;  4AJY B;  4MGI E;  1E7V A;  2CS4 A;  4XZ4 A;  4KIK A;  4NY0 A;  2ZPN A;  3CST A;  3PHX B;  4W9E A;  1F9J A;  2YLM A;  2B3A A;  3UQA A;  3VTW A;  2ZVN A;  1ISN A;  3V6E B;  4HWI B;  1YX6 B;  1ZW7 A;  3Q3F A;  4DXA B;  4IWQ A;  4KDI C;  2KWV B;  4B6W A;  2G45 B;  4GXB A;  2C7N B;  1IYF A;  3DBH I;  4E71 A;  5E6O A;  3VUY A;  4G0N B;  3W1S A;  4DDG D;  1E8W A;  4EOY A;  3PRP B;  2BYE A;  2BF8 B;  2RPQ A;  3QCA A;  4W9G A;  3PRE A;  3KYD D;  1WXV A;  4GOC A;  4WJO A;  1WGR A;  3DQV A;  2JZ3 B;  2C7H A;  2KWU B;  2KJH B;  2PE6 B;  3CF6 E;  3L16 A;  1OEY A;  2CKH B;  4FJV B;  4IM3 A;  4MGY E;  4NAW B;  3SDL C;  1P0R A;  3ZRC A;  4WJQ A;  2O6V D;  1E7U A;  1GC6 A;  5AZH A;  2K6Q A;  1NBF C;  3K9O B;  3TL5 A;  5JH5 C;  1L7Y A;  3JSV B;  4ANV A;  2MBB B;  3JYU A;  3KH0 A;  3LJ3 A;  2KC1 A;  2RR9 A;  2KFK B;  1RFA A;  4W9H A;  2EMT A;  3RUL A;  2LGY A;  3A4R A;  3ENE A;  2VRR B;  4I6L B;  4NNJ B;  4LJO B;  2A5U A;  4RM8 A;  4M8N A;  3BIN A;  2FUH B;  1Z5S B;  3PS6 A;  2C5L C;  5C23 A;  1OGW A;  3X23 A;  3KUZ A;  2MQJ A;  2JVC A;  3OLM D;  1I35 A;  1J0G A;  1KM7 A;  1WR6 E;  4EKU A;  2FIF A;  4MGZ E;  3RZF A;  3TCA A;  2KD0 A;  5AEK B;  4MEL A;  2GBJ A;  1NDD A;  2D10 A;  3SHQ A;  5CHW A;  3W1S C;  2NVU I;  2FNJ B;  4EZJ A;  4CO7 A;  3W1Y A;  2ZZP B;  4HXD A;  4ICU A;  4NQL B;  2N9X A;  2CR5 A;  4KSL C;  2XK5 A;  3VVW B;  2AEH A;  5AZG A;  2MX2 A;  2IO1 B;  3ZDT A;  4FHJ A;  3B1L X;  4I6P A;  2EKE C;  4MSM B;  5J18 A;  3EC8 A;  2YVC A;  2JY6 A;  3A33 B;  2M8S A;  3T9L A;  3TBL D;  4AP4 C;  1R4N I;  2L3Z A;  4B95 A;  4HLE A;  5CHF A;  3M62 B;  3L54 A;  3NY5 A;  1S1Q B;  3H9D A;  3R66 C;  2NPT A;  4XX5 A;  4W9C A;  4NQK E;  2PPH A;  3APD A;  2I1K A;  2RD0 A;  3A9J A;  2G4D B;  3K9P B;  5J17 A;  5DCN A;  3WAM A;  2IYD B;  2V1Y A;  1V86 A;  3KUC B;  3V60 A;  3ZDM C;  3A1Q A;  4TKN A;  4W9I A;  1XD3 B;  1LQB A;  3QX1 A;  3QAQ A;  2LGX A;  1YJ1 A;  3R3M A;  1XT9 B;  3DPD A;  1V5T A;  3VXW A;  1WGY A;  3EFU A;  4FLH A;  2LGD A;  4GDK B;  4KZ0 A;  4PS3 A;  4K1R B;  1LXD A;  2IBI B;  2WX1 A;  3L10 B;  5BO4 B;  4WJN A;  2LVQ A;  1WZ3 A;  4EZK A;  3DBL I;  3UIP B;  3ZW3 A;  5TR5 A;  4AOF A;  2D07 B;  1WM3 A;  2KJ6 A;  2IZV B;  3VH3 B;  2A4Z A;  2LJ5 A;  2M1M A;  3EHV A;  1WF9 A;  2IO3 B;  4HCP B;  2C60 A;  3AUL A;  5EDS A;  2HJ8 A;  4FA6 A;  4HPL B;  1WJN A;  2N9E B;  2LXA A;  2NBV B;  2KFJ A;  3PT2 B;  3A9K A;  4HDO A;  3ZNZ B;  3ZVV A;  2MW5 A;  1QZE A;  5J2R A;  1V49 A;  4BBN C;  2BYV E;  4NPN A;  3P2B A;  4BVU C;  4FUL A;  3KUD B;  1MG8 A;  2MBE A;  2Z0E B;  3DBS A;  4GIV A;  5E6P A;  2K1F A;  4NJ6 A;  2L0T A;  5D7G A;  3PTF C;  1G6J A;  4X57 B;  2BYF A;  3PLV A;  2G3Q B;  2HTH A;  2LVP A;  2MA9 B;  4BKG A;  2MP2 A;  2JF5 A;  4MJS B;  1KJT A;  3AU5 A;  2MBQ A;  3U8Z A;  1WGH A;  3DVN V;  3PVL A;  4G50 A;  4II2 B;  4EZL A;  5IA7 A;  3ZTC A;  3VAW A;  1UEL A;  2KOX A;  1NI2 A;  1WJU A;  4A3P A;  1I42 A;  4FJY A;  2XBB C;  1ZKH A;  4LDT D;  3VUW A;  1WI0 A;  4IWP A;  3M63 B;  3QIJ A;  1WMH A;  1TZ1 A;  2L05 A;  1WGG A;  2K8B A;  3BY4 B;  4P7I A;  4ANW A;  1HE8 A;  1UH6 A;  4K7S A;  3U30 A;  2WX0 A;  3KYC D;  2M0X A;  3WAP A;  1OEY J;  1WXS A;  4LDT B;  3HM3 A;  2DAF A;  3ML8 A;  2FCN A;  1TBE A;  3H7S A;  2LUE A;  4GDL B;  2UWQ A;  2REX A;  4B9K A;  4AUQ C;  2ZEQ A;  2J7Q B;  2KDI A;  3ZRF A;  2K25 A;  2J0J A;  4FAD A;  1Y8R C;  2DZJ A;  2NR2 A;  2MLB A;  1UZX B;  4K7W A;  2D2Q A;  4A3O A;  4BKS A;  2L0F A;  2BKR B;  1WH3 A;  4BBN F;  3IBE A;  5HKH A;  2KDB A;  3VTV A;  4F8C B;  3AI5 A;  4ZDV A;  2PEA A;  4DDI D;  1P1A A;  3KVF B;  5L95 C;  3NS8 A;  2G4S A;  1V6E A;  2LRU A;  4GGQ A;  4W9F A;  4FHK A;  4OVU A;  1J19 A;  1E8X A;  4IW0 A;  2V3S A;  2LXC A;  4WWP A;  4E3C A;  1GC7 A;  3QJZ A;  2FCS A;  4WQO B;  2KQ7 A;  2O2V B;  4RMA A;  3H6N A;  3R7Q A;  4IC7 B;  4K7U A;  2EMS A;  2KTR B;  4HDQ A;  4EFO A;  2MCN B;  3RYT A;  2OOB B;  1SGH A;  2ZJD A;  4ZRI A;  2L76 A;  3VUX A;  3L13 A;  4YL8 A;  3KW5 B;  2XK5 B;  4DBG A;  5JZE B;  5DPR A;  1E8Z A;  2GBM A;  4XC2 A;  2IY0 B;  1V81 A;  3T8M A;  2V4L A;  2L00 B;  2JWZ A;  5IAA C;  3UIN B;  3JVZ X;  1RRB A;  5G2N A;  4IUM B;  4ICV A;  4E74 A;  4GU2 A;  4F7Z A;  4TQ1 A;  2IO0 B;  1V5O A;  3JSV A;  1EUV B;  1UBQ A;  2Z59 B;  4FBJ B;  3PZD A;  3HHM A;  3DVG X;  2O6V A;  3AU4 A;  4GN1 A;  2KFK A;  4PYU A;  2CHX A;  3A9J B;  3DVN U;  4KSK C;  3ZNI D;  3UQB A;  2UYZ B;  1YD8 U;  4HJK A;  4MGK E;  1V2Y A;  2D3G A;  2ZNV C;  3JW0 X;  3OJ3 A;  3TIX A;  4KZC A;  4KV2 A;  2DX5 B;  3IG3 A;  2D11 A;  2K8C A;  2KDE B;  1WE7 A;  2MBO A;  4GMV A;  4TV3 A;  3L08 A;  1UD7 A;  4WWO A;  4IG7 B;  3QWZ B;  5FR6 A;  1AAR A;  2DZI A;  2KKC A;  5CX3 A;  2JRI B;  3QHT A;  2FAZ A;  3RZW C;  3H7P B;  4URK A;  2KLC A;  5DPS A;  4FN2 A;  2MSE D;  2AWT A;  2DHZ A;  2M17 A;  3NZU A;  2L8J A;  1P3Q U;  3VH4 B;  1E90 A;  1WJ6 A;  3M95 A;  2KC2 A;  2MWS B;  1WGD A;  3APF A;  5D94 A;  3TMP B;  2GBN A;  2KX3 A;  2KMC A;  1WM2 A;  4HK2 A;  1LM8 B;  3WIM A;  2NBU A;  4II3 B;  2BWF A;  2KWC A;  2KTF A;  4ZRK A;  5AZF A;  4CHK A;  2ASQ A;  1Q1O A;  2KHW B;  4F1S A;  3B0A A;  3ZO5 B;  4MEM A;  2RGF A;  4KDL B;  4ZYN A;  4EUT A;  2OJR A;  3DVG Y;  1XQQ A;  2ZVO A;  2GBK A;  4IWO A;  2JPH A;  3CMM B;  3L17 A;  2KMA A;  2NS5 A;  5JHA A;  3MJW A;  2GMI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...