5CHFA

Crystal structure of murine isg15 in space group p21212
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
149
structure length
149
Chain Sequence
AWDLKVKMLGGNDFLVSVTNSMTVSELKKQIAQKIGVPAFQQRLAHQTAVLQDGLTLSSLGLGPSSTVMLVVQNSSEPLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQFWLSFEGRPMEDKELLGEYGLKPQCTVIKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein ISG15
publication title Crystal structure of murine ISG15 in space group P21212
rcsb
source organism Mus musculus
molecule tags Antiviral protein
total genus 38
structure length 149
sequence length 149
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5chfA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5chfA01
4FJVB 5L95C 4DWFA 4EFOA 1WX8A 5DPTA 3DDCB 3QQ8B 4DHZB 3DPDA 3LDZE 1G6JA 3WIMA 2JT4B 2N1WA 3M63B 2K8BA 2RR9A 5D7GA 1J19A 2OOBB 3SD5A 2ZPYA 2ZJDA 2MWSB 4OVUA 2Z0DB 1V6EA 2C60A 4RMAA 2MX2A 4FA6A 1WH3A 2NPTB 1KLVA 2G45B 1V5OA 3A1QA 4NAWA 2KX0A 2KMAA 4FN2A 1UGMA 2M8SA 1WMHA 4OVVA 3IFWB 2KNBA 3PTFC 3X0WA 3OJ3A 2BGFA 2KLCA 2CHXA 4NNJB 3PRPB 4BOSC 3MHSD 3W1SA 2D10A 3H9DA 1SIFA 2GBJA 4W9JA 3QC8B 3A9JA 5AEKB 3IHPC 2O2VA 2QHOA 4BKSA 4B95A 3U7DA 3VXWA 1FXTB 1WXMA 1TTNA 4I6NB 2LXCA 3M3JA 3GZNI 4RM8A 3RZWC 1WZ0A 3M62B 2HJ8A 2JPHA 4IWPA 3ZKJC 2WWZA 1UELA 2KQ7A 4IM0A 3PREA 3NS8A 4ZYNA 4DDGD 3A33B 4P7IA 5J18A 1WZ3A 1XT9B 3CF6E 2WDTB 4K7WA 4E71A 4BBNF 4BKTA 1WY8A 4GOCA 4HJKA 4II2B 3L17A 5C23A 2JVCA 2BYFA 2V1YA 2V3SA 1GC7A 2ZCCA 3VVWB 3UGBB 3B08A 2IO3B 1EO6A 3A1QB 2LJ5A 5CHFA 4GDLA 1ZGUB 2DX5B 3L0WB 3L08A 3V6EB 2BF8B 3QAQA 3V60A 3VUYA 1K8RB 1V9JA 1GG3A 3N3KB 2O6VB 3L10B 1V80A 4G0NB 3TBLD 2EMSA 3K9OB 3HK0A 4PS8A 4EZLA 2JRIB 2K8CA 2IBIB 2ZEQA 4N9F4 3A9JB 4G50A 1WE6A 4HCNB 2O2VB 3TJPA 3V6CB 3ONSA 2K6QA 4MGIE 1Q1OA 1YX5B 2ZNVC 2CU1A 3VUWA 4W9HA 4A3OA 5JH5C 4LDTB 2BYEA 5EDSA 1V2YA 3ZVVA 2KXJA 4DK5A 1EF5A 5DPSA 3APFA 2FCNA 2RD0A 3PRMB 2GBRA 3A4SC 3H7PA 1L7YA 3U8ZA 2BWFA 3RD2A 3DVGX 3H6NA 4KIKA 4AOFA 1IPGA 2KK8A 1Z2MA 1WJ4A 3PPAA 2DZJA 4B9KA 2LRUA 3NY5A 5L83A 4MEMA 2YVCA 2ASQA 4HWIB 3R66C 2IO2B 1E8YA 4GDLB 4IM3A 2AYOB 3EFUA 5CX3A 4XC2A 4A20A 2VRRB 1NBFC 3A4RA 4IW0A 4CO7A 2L8JA 4MGZE 4TKNA 5JZEB 1ZW7A 1E8ZA 3UIOB 2M1MA 2XEWA 1WYWB 2D07B 1WR1A 2KANA 3VHTC 4MELA 1LFDA 4KV2A 2JF5A 3ZNID 2AL6A 2KZRA 2NBWB 2N1VA 4FADA 1P0RA 3SU8X 2FAZA 3K9PB 1OEYA 1D3ZA 3ENEA 3A9KB 3DBSA 4HPMB 3EC8A 2PPHA 3H7PB 4I6LB 2JZ3B 4KDIC 1PQSA 1EUVB 2MA9B 5G55A 2M17A 4KIKB 4W9FA 2KWCA 3DBLI 4PYUA 4MDKE 1VD2A 3RYTA 4E74A 1BT0A 2J0KA 4I6PA 2MP2A 3IG3A 4M8NA 4CYEA 4WJOA 1R4MI 3ZTDA 3JSVA 3PGEA 3PVLA 3QA8A 4NJ7A 2LRWA 3VFKA 3WA0A 1TBEA 3WANA 4FBJB 2GBNA 2RGFA 1ZKHA 2O6VD 3VQIA 2EMTA 1LXDA 3WALA 4DHJB 4DXAB 1XQQA 2UYZB 5E6OA 2L00B 2IY1B 2CKHB 3D32A 3VH4B 2JUOA 2I1KA 1H4RA 2XK5B 4MGYE 2D11A 2HE7A 4HDQA 3RCZA 4LDTD 4GSWA 3QX1A 2N9XA 4W9EA 3ZDMC 1WM3A 2PE9A 2B3AA 4GIVA 3R7QA 2KWUB 4KSLC 4M0WB 2GBMA 3O65B 4MSMB 2LXAA 3EHVA 2FUHB 1E8XA 2R2QA 2BWES 1V49A 2BPSA 3ZRCA 3I3TB 2KN5A 4IUMB 3P2BA 2LGDA 3KUCB 1C3TA 4JGHB 1SE9A 3UQAA 3KVFB 2DYBA 2MBBB 3ZTCA 2MRPA 3ZO5B 2M4NA 2LWPA 5G2NA 3DQVA 3WAOA 4NAWB 3N30A 2DZIA 3B1LX 3RZFA 2DAJA 1WMHB 3QCAA 4NJ6A 3VTWA 3X23A 3PSEB 3JSVB 2ZVNA 3V61A 2XBBC 5JHAA 3PT2B 1E8WA 4TV3A 4HCPB 4IM2A 1KJTA 3ZIMA 4K1RB 3LJ3A 2REXA 1WGRA 2BYVE 2KTRA 3KH0A 1UBIA 3ALBA 4MJSA 2W9NA 3T9LA 4BKGA 3VUXA 4EEWA 2GMIC 1OGWA 2KOXA 5D94A 3V62A 3QWZB 3HIZA 4ZDVA 3APCA 3VTUA 4WAAA 4EZKA 2K8HA 2JZZA 3CSTA 5HKHA 1RFAA 2FCQA 4KVGB 3OJ4B 2HTHA 3ZW3A 2C5LC 2MBEA 1SGHA 2KDFB 3GOEA 1UBQA 2MBHA 2N7DA 2D2QA 2D3GA 2KDIA 2LVOA 2OJRA 3PZDA 5DPWA 4ANXA 1J8CA 4EZJA 4FJZA 1Z5SB 3VTVA 2IYDB 3PHWB 2A4ZA 2LASA 5DCNA 4B6WA 4AUQC 4IWOA 5J2RA 1YIWA 1WXAA 3AULA 2PEAA 4GGQA 4K81A 1RRBA 1WI0A 2DENB 2L05A 1OQYA 2NBUA 2I1JA 3TCAA 3L13A 4BVUC 3QIJA 4JL9A 2PE6B 3BINA 3SHQA 3NZSA 2J7QB 1XD3B 4BOZB 4DBGA 1Y8RC 1P98A 3ZLZA 4E3CA 4DHJD 2KO3A 3PV1A 1WM2A 2AWTA 1GUAB 2KQSA 4TQ1A 4TUUA 4ANWA 4MJSB 2C7NB 2LVPA 1GJZA 1WX7A 2YLMA 4IC7B 2WX0A 4X57B 2WX1A 4FLHA 4AP4C 2C7HA 2DYMA 2C7MB 3DVNU 3PS6A 2AL3A 4LJPB 3VDZA 2AEHA 4FHJA 3UINB 4FULA 1WGDA 2IZVB 3VAWA 3PRZA 5LLIA 2ZNVB 2IY0B 3DCGA 3DVNV 4ANUA 3KW5B 1P9DU 4GU2A 4RM9A 4WWOA 3W1YA 2BKFA 4NY0A 3DBHI 4W9GA 2M0XA 4MSQB 3M95A 4K7UA 2N7EA 3Q3JA 2KLGA 3JYUA 5CHVC 2KJ6A 4HLEA 4LJOB 2K39A 2Y5BB 1T0YA 4F8CB 2FCSA 3ZDTA 1R4NI 2GBKA 1I35A 2CHZA 2EKEC 2KMCA 3AI5A 4M8MA 2A5UA 5D2MB 2LGXA 2KJRA 4W9IA 3SDLC 4IG7B 2KDEB 2DZKA 2KVRA 1WX9A 3BY4B 2MQJA 1YQBA 5DPRA 4K7SA 3H7SA 4II3B 2J0MA 4JQWC 2G3QB 1WFYA 3NOBA 4WJQA 2ZPNA 4ZRJA 5E6PA 1WGHA 2R2OA 1TGZB 1AARA 2L76A 1WE7A 2RPQA 3ZNHB 3RUIB 2KKCA 3OLMD 2NVUI 3C0RB 4GN1A 1H8CA 2ZCBA 2PJHA 3DBRI 4BKSD 2FCMA 1YD8U 4GMVA 2G4DB 4MGKE 1WR6E 2V4LA 3L54A 4HDOA 5BO4B 3QK0A 2NCNA 5CTRC 4PYZA 5IAAC 2IO0B 4W9CA 3W1SC 3ZUNA 3ZNGC 1E90A 1V5TA 3MJWA 2O6VA 2MBQA 3JVZX 3PHXB 1E5WA 3JW0X 3H1UA 2KD0A 2UWQA 3L16A 3QHTA 4ZRIA 3HM3A 1U4AA 3R3MA 1CMXB 3DVGY 4ANVA 3MTNB 3S2AA 5JHBA 1IYFA 2DYOA 1QZEA 4F7ZA 1UD7A 3IVFA 4IWQA 1E7UA 2K6DB 2JWZA 2MW5A 1WRDB 1WJUA 2KC2A 4W9KA 4YL8A 4AJWA 4DHZE 1A5RA 1WIAA 2LUEA 1TZ1A 3N32A 2LD9A 2MP2B 2NS5A 3KYDD 3WAMA 2CR5A 1P1AA 4KZCA 4BFRA 3R7RA 1V81A 1E7VA 1WGGA 3PLVA 1UH6A 1OTRB 2KFKA 4ZRKA 3UQBA 4EOYA 1X1MA 3KUDB 4TQ0A 2HD5B 2MBOA 4WQOB 2IO1B 3ZRFA 2KHWB 4ASWC 1P3QU 4XZ4A 4HK2A 4NQLB 2C9WB 4GDKA 4WJNA 2JRHA 2L7RA 3EECA 3AXCA 4ICVA 4URKA 5J17A 2WYQA 5CHWA 1VCBA 2FNJB 2MSED 1J0GA 2NR2A 2LGYA 1C1YB 1GC6A 1NDDA 2DAFA 4WWNA 4XX5A 1NI2A 1Q5WB 4DDID 3HHMA 2FIFA 4MM3A 4NPNA 4NQKE 2L0FA 2BKRB 5GMVA 5TR5A 4BBNC 5C1ZA 5FR6A 5LXHA 1GNUA 4EKUA 4HPLB 1RLFA 3QJZA 4LCDE 3IBEA 2MLBA 1MG8A 4GXBA 4AJYB 4FHKA 3ML8A 1YX6B 1M94A 2KFJA 2RSUA 4W9DA 3UIPB 3APDA 4EUTA 2JY6A 2MCNB 1IP9A 2KWVB 5AZGA 2LI5A 1Q0WB 5KHQA 2KDBA 2KTFA 4MH0E 5LXIB 4CHKA 1S1QB 4KDLB 2K25A 1HE8A 3ECIA 1V86A 2Z59B 3ML9A 3Q3FA 4J6IA 1WJNA 3RT3B 4GB9A 2N9EB 3A9KA 4G11A 2ZVOA 1WF9A 3KYCD 2NBVB 2KFKB 1JRUA 4WWPA 3HM6X 2CHWA 2KX3A 3KUZA 4PS3A 3CMMB 2KTRB 4PS7A 2Z0EB 2G4SA 2LZ6A 4G3XB 1WGYA 4GDKB 3U30A 2J0JA 2JXXA 3VH3B 1LQBA 2NPTA 1UZXB 5D6JB 1WJ6A 2DZMA 3PLUA 1YJ1A 2DHZA 5AZHA 2ZZPB 1LM8B 3T8MA 4KZ0A 4A3PA 3ZNZB 4FJYA 3AU5A 3NHEB 2KJHB 5KHOA 2N4FA 3WAPA 2L0TA 1S3SG 4KSKC 2L3ZA 1KM7A 4JLCA 4W9LA 3CSFA 2CS4A 2LVQA 3TIXA 3TL5A 1ISNA 4F1SA 3UF8A 2KC1A 5E6NA 1WXSA 1WXVA 5AZFA 3OAWA 4AWJA 4WJPA 1L2NA 3NZUA 1EF1A 2N9PC 4HXDA 3AU4A 4HVBA 1RAXA 1OEYJ 3RULA 2GOWA 1F9JA 4ICUA 1KOTA 2K1FA 3DOWA 3B0AA 2XK5A 5IA7A 3QARA 4JIOU 2FIDA 1I42A 3TMPB
chains in the Genus database with same CATH superfamily
1WX8A 2KWDA 3WIMA 3TEZA 1SBBB 2QCZA 3URYA 2K8BA 2ICIA 3SD5A 1AW7A 3NG0A 5G5GA 4RMAA 2ZW0A 2MX2A 1QKZA 3DWMA 1KLVA 1V5OA 2M8SA 2IPKD 1WMHA 4OVVA 3X0WA 2KNBA 3PTFC 4A9AA 3OJ3A 2KLCA 3N20C 4Q2JA 3E9SA 3MHSD 3OG5A 1KF6B 1SIFA 2IJ0A 4W9JA 3EFCA 2K5PA 5AEKB 1YNTE 2V3PA 4TMAB 4RM8A 1WZ0A 2HJ8A 3IAM1 2JPHA 1UELA 3CF6E 2WDTB 1XLPA 1WY8A 5HHDG 2V1YA 4LK0M 4YSZB 2V3SA 1GC7A 1E9MA 5H92C 5CHFA 3L08A 3L0WB 2BF8B 3V60A 3AECB 1V9JA 1C9FA 5HI1A 3K9OB 3HK0A 4EZLA 2JRIB 2ZEQA 2IBIB 4N9F4 4RGTA 1VZ8A 3FC4A 3ZJVA 2O2VB 3TJPA 1XF5L 3ONSA 2QMTA 1TJEA 1YX5B 5DPSA 3TUOA 2K0PA 2FCNA 1FNVA 3H7PA 4N59A 1A70A 2BWFA 1FXIA 3H6NA 1IPGA 2KK8A 1WJ4A 4OZAA 3NY5A 1FMAD 2NTTA 2WXNA 4HWIB 5AUKA 4B0MA 1JWBD 4IM3A 1Y56A 4KGRA 1ET9A 4MM3B 4XC2A 4A6QA 3TEWA 4OZCA 1NBFC 5JZEB 2LFIA 1ZW7A 1V1OA 2D07B 1WR1A 1YQ3B 4MELA 3VRBB 3ZNID 2N1VA 2NMQA 1P0RA 3SU8X 3A9KB 1HQRD 1ZOYB 4IDIA 2JZ3B 2MA9B 5G55A 3DBLI 4PYUA 4MDKE 3AEBB 4E74A 4I6PA 2MP2A 4CYEA 1T0QC 3ZTDA 3QA8A 3VFKA 1TBEA 2GBNA 2RGFA 3SR6A 5FK9C 1LXDA 3WALA 4DHJB 2D5GA 4RGNA 3AMZA 2UYZB 1KFYB 2JWUA 4OVZA 2OEDA 4L23A 3VH4B 2BS4B 2KVZA 2KACA 1IBXA 4N58A 3QX1A 4NZLB 3R7QA 3O65B 3N1YC 2QIEB 4JE3B 2JU6X 3I3TB 4ZRPA 2LGDA 3KUCB 4ZHOA 2DYBA 3ZTCA 3ZO5B 2MRPA 3DQVA 3WAOA 3B1LX 1TS2A 1WMHB 3VTWA 4NJ6A 1PUTA 3JSVB 2XBBC 5JHAA 3PT2B 4TV3A 3R2IA 2PW9A 2ZW1A 5C2TB 1XLOA 1CQVA 3ALBA 3T9LA 2W9NA 4BKGA 1GB4A 3CIRB 1OGWA 2KOXA 3HIZA 1UGJA 2M0AA 2AX5A 3APCA 3VTUA 4WAAA 1D5MC 2DBYA 4EZKA 2WLBA 1FO4A 3OJ4B 4A55A 2MBEA 2KDFB 2VH2A 2D3GA 2OJRA 4WH4A 4EZJA 1J8CA 1P7EA 1TKYA 1Z5SB 1LO5D 3PHWB 2WXFA 4IWOA 5J2RA 1YIWA 4K81A 1WI0A 2L05A 3FILA 3L13A 4BVUC 2JYTA 3ZLZA 3PV1A 3RFZB 2RDBC 2V3NA 2C7NB 1GJZA 2PLPA 4AP4C 2C7HA 4LJPB 3DVNU 2AL3A 2PVOD 3VDZA 2AEHA 4FHJA 3PRZA 5LLIA 3DCGA 3DVNV 3R2TA 4L2YA 2KYWA 3W1YA 2WXMA 4K7UA 3Q3JA 5CHVC 3B2GA 2Y5BB 1T0YA 2GBKA 2A5UA 2WU5B 2KVRA 3BY4B 3DBHB 1YQBA 1E0ZA 3H8HA 3MJ5A 3AE4B 4JQWC 2RPQA 3RUIB 3C0RB 1H8CA 2M56B 4RF1A 1J7AA 1MFWA 2FCMA 3DBRI 4BKSD 3MC9A 4LLGM 4W9CA 3U7ZA 1HXYD 1QT9A 3JVZX 3PHXB 3L16A 4ANVA 4ZRIA 2BT6A 3HM3A 1CMXB 3DVGY 3Q2AC 4F7ZA 3ZQ4A 4YTMB 2K6DB 4DHZE 1CJEA 1KLUD 5G5HA 1TZ1A 2MP2B 2J53A 3EA6A 5FKAC 2INNE 3R7RA 1UH6A 1PGAA 2C9WB 2XNAC 4WJNA 1SJED 3AXCA 1TKEA 2WYQA 1VCBA 2NR2A 1D4BA 1NDDA 3RNCC 1NI2A 1WYGA 1IBXB 2L0FA 3Q69A 5GMVA 5LXHA 3RMKC 2IGHA 1RLFA 4LCDE 4FHKA 1MHHE 1YX6B 2JX5A 3APDA 2JY6A 2MCNB 4P1CC 1TY2A 2KWVB 5AZGA 2LI5A 3P1MA 4MH0E 4CHKA 2K25A 3ML9A 4J6IA 5D3DA 3RT3B 2SEBD 4JWUC 4MH8A 2NBVB 1JRUA 3HM6X 2KX3A 4BZAA 3C8YA 4AQ7A 4PS3A 2D3AA 2FE8A 2Z0EB 2LZ6A 4GDKB 3VH3B 1T6BX 2H88B 4P16A 4KZ0A 3T8MA 5KHOA 3Q8AA 2L0TA 1S3SG 3CSFA 2LVQA 3UF8A 1L2NA 1AWDA 5FR3A 4CQNA 1FCLA 4LNOA 3B0AA 2XK5A 4L1BA 2MHJA 3DDCB 4HEA1 3AV8A 2WXKA 3QQ8B 3DPDA 3LDZE 4DHZB 2N1WA 3M63B 1YQ4B 3ZXVA 1T3QA 1XLNA 1WRIA 5EE9A 2ZPYA 2MWSB 5HG2A 1FPYA 1V6EA 1DOIA 4ZRQA 3AH7A 2G45B 1TS4A 4NAWA 2KX0A 1UGMA 1TY0A 1XCTL 1I4XA 3BVMA 2BGFA 2E3TA 4BOSC 3RPFC 3W1SA 2D10A 4HPPA 2BW2A 3QC8B 2BTEA 3TSSA 2O2VA 1V97A 4BKSA 4B95A 1TT5B 1YJIA 3GZNI 3RZWC 3BYYB 4USAA 2WWZA 3PREA 4DDGD 4P7IA 1XT9B 2WU2B 4BKTA 1P7FA 3NJTA 2BYFA 1TZOA 2K3UA 4REZA 1ZGUB 1K8RB 1R7SA 5HFYA 3N3KB 3TBLD 3U2SC 2EMSA 4PS8A 4MACA 2K8CA 2VZKB 3A9JB 2GRIA 2ZNVC 2CU1A 4A3OA 4W9HA 5EDSA 3KWLA 3ZVVA 5EE0A 4DK5A 3APFA 2RD0A 3PRMB 3AE9B 3A4SC 4O1NA 4M02A 3U4EG 2AQ3B 3BK2A 3I9V1 3RD2A 1N5WA 3HUIA 3DVGX 3ZJTA 4AOFA 4JX1C 3PPAA 4C7ZA 4B9KA 1N60A 2ASQA 3I63C 2IO2B 4WIPA 4GDLB 5I4DA 5CX3A 1FIQA 3NVZA 4A20A 3LYYA 4IW0A 1E8ZA 3UIOB 1PYWD 2LHDA 1WYWB 1I4PA 3NVVA 1JRPA 1ZUD2 1PFDA 1AN8A 1LFDA 4KV2A 4LNKA 3MP9A 1ACCA 4ITKA 4GLSC 4XWTA 2PPHA 4I6LB 1EUVB 3P4PB 2KWCA 1C4CA 3RYTA 1OQRA 1BT0A 2BS2B 2J4XA 4WJOA 1FD6A 4NJCA 1R4MI 1QF6A 3JSVA 3PGEA 3PVLA 2LRWA 2O6VD 2QC8A 2L32A 2EMTA 1BUIC 1N61A 5E6OA 2IGGA 2IY1B 2L00B 3P63A 2JUOA 2LUMA 3W5UB 2JYEA 2XK5B 1H4RA 4HDQA 4W9EA 2PE9A 4GIVA 2VH1A 3VR8B 4MSMB 4HJGE 2LGIA 1E8XA 1NENB 2V4IB 4JGHB 3UQAA 1OFFA 1YMHE 5G2NA 3GB1A 4NAWB 3N30A 2DAJA 3QCAA 3P4QB 2ON8A 3X23A 1E8WA 2DWQA 1GOZA 4K1RB 2KTRA 1B9RA 3VUXA 4EEWA 3EUB2 4C4VA 5D94A 2QSDA 3QWZB 4KKJA 3AEFB 2G1EA 1TYGB 3CSTA 5HKHA 2X38A 2HTME 4KVGB 2HTHA 3DHGC 1VLBA 2GI9A 2KDIA 3Q3NC 2INPE 1J7CA 5DCNA 4AUQC 4XDCA 4GGQA 2KDMA 1YJJA 2NBUA 1PGXA 2PE6B 4M00A 2J7QB 3E56A 4DBGA 1Y8RC 1NEKB 4E3CA 2AWTA 1GUAB 4TQ1A 2G9HD 1L0VB 2LVPA 1WX7A 2MH7A 2WX0A 1T0SC 3PS6A 2C7MB 4P6VF 4FULA 3AE5B 4JPSA 2IZVB 1I4RA 4GU2A 2LGSA 4WWOA 4DQOC 4NY0A 4W9GA 3PZ8A 1YOVB 2KLGA 4HLEA 2W3SA 3W9CB 2K39A 4F8CB 3ABVB 1I35A 3LXFA 2LGXA 2WXPA 1FNWA 4K7SA 3H7SA 1SF0A 1TGZB 1D6EC 3ZNHB 1R4NB 4GN1A 2WGSA 2PJHA 2G4DB 3L54A 5BO4B 1Q10A 3QK0A 4RFBA 1F52A 3AEAB 2O6VA 2MBQA 3QHTA 3S2AA 5JHBA 2N9LA 1E7UA 2JWZA 2MW5A 1WRDB 2KC2A 4YTPB 4AJWA 4P1BC 2LUEA 4YXDB 2LD9A 3KYDD 2PKOA 4HRSA 4ZOHC 1V81A 3PLVA 1X1MA 2KHWB 5BMGA 4HK2A 2DNFA 4GDKA 1KH0A 4RCOA 2L7RA 4URKA 5J17A 1J7BA 5CHWA 1J0GA 2FNJB 2DAFA 4WWNA 4XX5A 4DXGA 1Q5WB 2WXLA 4DDID 3HHMA 2FIFA 4NQKE 4BBNC 4EKUA 1BXTA 3QJZA 1ZPSA 2MLBA 4GXBA 4AJYB 1I4GA 4QAYA 2X8XX 3KWVA 1Q0WB 2KDBA 5LXIB 2MJ3A 3DHIC 1S1QB 4S17A 4KDLB 4ACFA 2MEKA 1NYQA 4G11A 3KYCD 2KFKB 3CWIA 4BAXA 2MJEA 3KUZA 3CMMB 2KTRB 4PS7A 1QOGA 2G4SA 4G3XB 1WGYA 4LNIA 2JXXA 1LQBA 4C4VB 2DHZA 2ZZPB 3AE7B 3AU5A 3NHEB 2N4FA 2CS4A 4B0EA 4F1SA 5BYSA 1ISNA 2AQ1B 2KC1A 4D2KA 1WXVA 4OZBA 3OAWA 4WJPA 1EF1A 3AU4A 3AEEB 1KOTA 5IA7A 5IN7A 3VR9B 1N6ZA 2FIDA 3TMPB 4FJVB 1FFUA 4DWFA 1QOAA 5L95C 2NTSA 1I4QA 5DPTA 1IGCA 4M0WA 1G6JA 5D7GA 1J19A 1K50A 1ENFA 4WURA 4OVUA 4HKQA 1SE3A 4FA6A 3MC0B 1NYRA 2IGDA 2BB5A 4ARIA 2CHXA 3Q8BA 3AN1A 3PRPB 3SFDB 3IT6B 2WP9B 3V05A 3A9JA 2QDFA 3GP7A 3IHPC 1KTKA 4RF0A 1I7HA 2QHOA 1YN5A 3U7DA 3VXWA 4C80A 1FXTB 1C79A 1WXMA 2LXCA 4FXCA 4UDUC 1L0YB 1CZPA 3BVGA 3NS8A 4HKZE 2B76B 4K7WA 4BBNF 1V8CA 4HJKA 4II2B 1JW9D 2JVCA 2ZCCA 1RFKA 3A1QB 2LJ5A 1SJHD 4GDLA 2DX5B 4XYCA 3VUYA 4AS1A 2WXGA 1GG3A 1UWXA 2RDHA 2O6VB 3L10B 1V80A 4G0NB 2Q5WD 4C00A 2Z8LA 3L4PA 4G50A 3IXSA 2L52A 1WE6A 3TEXA 3V6CB 2BVCA 2K6QA 4MGIE 1Q1OA 2FUG1 5JH5C 3PZ7A 1ZXIA 1FFVA 5IKCM 2GBRA 1FXAA 3Q3OC 1C77A 2WXRA 2LRUA 2OHFA 1STEA 3V3XA 1JMLA 4MEMA 2YVCA 2BYTA 1T0RC 2AYOB 3EFUA 3GE8C 2J52A 2VRRB 2MJDA 4CO7A 2L8JA 4LTUA 4MGZE 4TKNA 2I38A 1K51A 2XEWA 3N9YC 3N1XC 2KANA 3VHTC 2I2YA 1FEHA 1UF0A 5H8YE 1L6VA 1HTOA 2AL6A 4S0RA 2NBWB 3AE2B 2FAZA 3K9PB 1OEYA 1N63A 4HPMB 2R61A 3EC8A 4PK1A 4LNFA 2GLSA 2M17A 4KIKB 4W9FA 2W3RA 1VD2A 2N0SB 2J0KA 4M8NA 3BVZA 1XXGA 3RNFC 1ZDXA 1BMLC 2INDC 3WANA 2WXIA 4FBJB 1ZKHA 3VQIA 1NI3A 3RNBC 1IGDA 1XQQA 3DBLB 3FAHA 3RN9C 2E6XA 5C3JB 2I1KA 4MGYE 3RCZA 4LDTD 4GSWA 2N9XA 3ZDMC 3O13A 1WM3A 5BMIA 2KWUB 4IOIE 4KSLC 4M0WB 2GBMA 3NZ3A 5TSSA 2LXAA 1FRDA 3EHVA 1V49A 2BPSA 1EWYC 2KN5A 1C3TA 2MBBB 1RM6C 2M4NA 1MHXA 1MVKA 2DZIA 1QLBB 3I5JC 4OHJA 3V61A 3FKYA 1V1PA 3LJ3A 3P42A 3Q8CA 1UBIA 2KN4A 4RNAA 3V62A 3U52E 1ZDVA 2K8HA 1T5XD 1XCQL 2JZZA 2FCQA 1DGJA 3ZW3A 2C5LC 1SGHA 1YN3A 3GOEA 1UBQA 2MBHA 3VTVA 2IYDB 2A4ZA 4B6WA 4J3OD 3NRZA 3AULA 5GXGB 1TKGA 2SAKA 1RRBA 2DENB 1TS5A 1CK1A 1OQYA 2WXHA 3QIJA 1FCCC 1UUPA 3SHQA 3NZSA 3AEDB 3NVYA 4YT0B 1WM2A 2KQSA 3R8BA 4A90A 1TS3A 4K3BA 4TUUA 4MJSB 2RDGA 1QOBA 1DOXA 2WX1A 4FLHA 5EE3A 2DYMA 2CJNA 4RGMA 2ZNVB 1ZE3D 3KW5B 2QILA 1C78A 3NVWA 4RM9A 1E7PB 2BKFA 3DBHI 4MSQB 1K53A 1EU3A 1HA5A 3JYUA 2KJ6A 4LJOB 2JQRB 2FCSA 4YTNB 3ZDTA 2PVGC 3AI5A 2EKEC 5D2MB 4W9IA 3SDLC 2FBWB 1WX9A 2MQJA 2YEPF 4WJQA 2G3QB 4ZRJA 3ZXRA 2ZPNA 1WGHA 2R2OA 1AARA 2L76A 1WE7A 3OLMD 2W54A 2JZPA 1PDXA 4GMVA 3UI3A 5CTRC 5IAAC 3ZUNA 2IO0B 3W1SC 2INCC 3ZNGC 1E90A 1V5TA 1E5WA 4YWGG 3H1UA 2UWQA 2N9KA 3SFEB 1U4AA 3R3MA 1IYFA 1LGRA 3DBRB 1UD7A 4IWQA 1F2RI 5MPOA 1EWCA 2V0GA 1WIAA 1DYQA 1YN4A 3RNGC 3N32A 1MPEA 2CR5A 4BFRA 1WWTA 1OTRB 2KFKA 4KGSA 2UU7A 2HD5B 2MBOA 4WQOB 1P3QU 1VJKA 4NQLB 1JWAD 2JRHA 2MSED 2LGYA 1C1YB 3BWUD 5T8IA 1UWMA 5BYRA 4NPNA 5C1ZA 2BKRB 1GNUA 2LHEA 1N62A 1MG8A 1M94A 2RSUA 4W9DA 3Q3MC 1VZ7A 1RYJA 1QOFA 3Q8EA 3C19A 1L5PA 3ECIA 1HE8A 1V86A 2Z59B 3Q3FA 2BQQA 2N9EB 4M01A 1WGKA 1WF9A 1FM0D 1V1PB 4WWPA 3GE3C 2D3CA 2TSSA 3U30A 2J0JA 5D6JB 1UZXB 5AZHA 1LM8B 1XLQA 3ZNZB 2KJHB 1L4ZB 3ETRA 1VZ6A 4KSKC 4H2AA 1KM7A 4W9LA 3TIXA 2PMVA 5E6NA 3LB8C 3P4RB 1WXSA 5AZFA 4AWJA 4HXDA 2N9PC 1KRHA 1RAXA 1OEYJ 1F9JA 3EGRA 4ICUA 2K1FA 3DOWA 3DWGC 3QARA 4KGTA 1JCKB 1PGBA 4EFOA 1I4HA 2JT4B 4EE2A 2CU3A 2RR9A 2OOBB 2KMMA 2ZJDA 2Z0DB 2C60A 2WDRB 1SB3C 1WH3A 3RNAC 1F0ZA 1ZP0B 1K52A 1WXQA 2NPTB 3A1QA 2KMAA 3HVDA 4FN2A 3IFWB 5D3IB 4XGAB 1SE4A 4NNJB 3H9DA 2GBJA 1D5XC 3Q6BA 1B1ZA 2VZKD 3Q8FA 4WQMA 1AYFA 1TTNA 4I6NB 3HRDD 1HZ5A 3M3JA 3M62B 2WDQB 3P4SB 1C4PA 4IWPA 3ZKJC 2KQ7A 4IM0A 3HVZA 1F1HA 4ZYNA 3A33B 3W5VB 5J18A 1QQRA 1WZ3A 3NUHB 4E71A 4GOCA 3L17A 5C23A 1ESFA 1JWMD 3GZNB 2JSVX 3VVWB 3T3OA 3UGBB 3B08A 2IO3B 1EO6A 2AQ2B 4ARCA 3V6EB 3QAQA 2QJLA 2PTLA 1WSPA 1F77A 4R3DA 5IP4D 1QILA 1VR9A 5IO9A 1SSNA 4HCNB 4OW0A 4YSYB 1GB1A 2OJWA 3VUWA 2WXOA 4LDTB 2BYEA 4LNNA 1V2YA 3T3NA 2HDEA 2KXJA 1EF5A 1MI0A 1L0XB 1N5XA 1L7YA 3U8ZA 4XWWA 4KIKA 1Z2MA 1C76A 2DZJA 5L83A 1HTQA 3AEGB 3R66C 4HROA 1E8YA 3I57A 3A4RA 4K3CA 2M1MA 4DXFA 3NS1A 3BK1A 2BBCA 3AE3B 4RH6A 3IT4B 1FNUA 1GPXA 4ZYSA 1E10A 2JF5A 2KZRA 2L83A 4FADA 1KLGD 1UNSA 1D3ZA 3ENEA 3DBSA 2DLBA 1M4VA 2QEJC 3H7PB 4KDIC 1PQSA 1FRRA 4RGOS 4NAMA 4YSXB 5BYQA 5IOIA 3IG3A 2WQYB 3BZDB 1L6UA 4NJ7A 2ACZB 3WA0A 1OQQA 2WXQA 1F2RC 4US8A 3Q14C 4DXAB 5EE1A 2GB1A 2WS3B 2EKIA 1NVID 2CKHB 3D32A 1DOYA 1R4MB 2D11A 1ET6A 2HE7A 3TEYA 1GAQB 1ZXHA 1JQ4A 1MG4A 2H89B 2JXTA 2B3AA 2HJ1A 4PT5A 1TIFA 3ZGZA 2FUHB 2R2QA 2BWES 3ZRCA 4IUMB 3P2BA 1SE9A 3KVFB 3KLSX 2LWPA 3RZFA 2CJOA 3PSEB 2ZVNA 1ROEA 4HCPB 4IM2A 1KJTA 3ZIMA 1SXTA 2REXA 1XEEA 1WGRA 2BYVE 3KH0A 4MJSA 4A8XC 4KKIA 3B9JA 2GMIC 4JWSC 5LNK1 4C7YA 2BS3B 3AB5A 4ZDVA 2ONQA 2WHIA 1SEBD 2Y5CA 4IKGA 1RFAA 2RMMA 1VDVA 2N7DA 2IDYA 2D2QA 2LVOA 3DHHC 3PZDA 5DPWA 4ANXA 4FJZA 3AM9A 4ZHPA 2LASA 2WXJA 2V9HA 5AUIA 1WXAA 1C4AA 2EELA 2K9XA 2PEAA 2LJIA 2BB6A 3PO0A 2I1JA 3TCAA 1D5ZC 4JL9A 3BINA 4BOZB 3AE1B 1XD3B 1P98A 2WDVB 2KO3A 4DHJD 1JALA 4ANWA 1JROA 5BMHA 3VRAB 2L1AA 1EU4A 4KX6B 2YLMA 4IC7B 4X57B 2WNMA 3UINB 3SEBA 1WGDA 3VAWA 2LMCA 2IY0B 2LEKA 4ANUA 1P9DU 1HZ6A 2M0XA 3GS2A 3M95A 3IAS1 2N7EA 5JXVA 2KQ4X 4TSSA 3OWEB 1R4NI 2CHZA 2KMCA 4M8MA 2KJRA 4IG7B 2KDEB 2DZKA 3FILB 5DPRA 4II3B 3AE6B 2J0MA 3NOBA 1WFYA 5E6PA 2KKCA 5E6JA 2NVUI 2M19A 2ZCBA 4MGKE 1YD8U 1SE2A 1WR6E 2V4LA 2KT7A 2N7JA 3MC8A 4HDOA 2NCNA 2W55A 1L4DB 4PYZA 4WAFA 4N6EB 1MJDA 3MJWA 3JW0X 2KD0A 1JWUD 3MTNB 2DYOA 3N1ZC 2W82A 3WCQA 1QZEA 1SIJA 3IVFA 1JWSD 3ZJUA 1HEZE 1WJUA 4W9KA 4YL8A 1A5RA 2KAJA 1E6EB 3WAMA 2NS5A 1P1AA 4KZCA 4ZRKA 1E7VA 1WGGA 1IUEA 3UQBA 4EOYA 3KUDB 4TQ0A 3W2DA 2IO1B 3ZRFA 4US9A 4XDDA 4ASWC 4XZ4A 3EECA 4ICVA 1GC6A 3KQ4A 2YEPB 4MM3A 5TR5A 5FR6A 4HPLB 3IBEA 1XO3A 3AE8B 1VRAB 3MHZA 3ML8A 2KFJA 2RPVA 3UIPB 1RWSA 4EUTA 3ZYYX 1IP9A 5KHQA 2KTFA 2D3BA 3RI7C 4WWMA 2PIAA 1WJNA 2Y3AA 2K22A 4GB9A 4MT5A 3A9KA 2ZVOA 3B2FA 3MFGA 2CHWA 2NPTA 1WJ6A 2DZMA 3PLUA 1YJ1A 4A3PA 4FJYA 2J42A 3WAPA 2XN9C 2L3ZA 4JLCA 3BYTB 3TL5A 3J9CA 3RNEC 1EM7A 3BIID 3NZUA 4HVBA 2Y5PA 3RULA 4XE0A 2GOWA 4JIOU 4C56C 1I42A
chains in the Genus database with same CATH topology
4FJVB 5L95C 4DWFA 4EFOA 1WX8A 5DPTA 3DDCB 3QQ8B 4DHZB 3DPDA 3LDZE 1G6JA 3WIMA 2JT4B 2N1WA 3M63B 2K8BA 2RR9A 5D7GA 1J19A 2OOBB 3SD5A 2ZPYA 2ZJDA 2MWSB 4OVUA 2Z0DB 1V6EA 2C60A 4RMAA 2MX2A 4FA6A 1WH3A 2NPTB 1KLVA 2G45B 1V5OA 3A1QA 4NAWA 2KX0A 2KMAA 4FN2A 1UGMA 2M8SA 1WMHA 4OVVA 3IFWB 2KNBA 3PTFC 3X0WA 3OJ3A 2BGFA 2KLCA 2CHXA 4NNJB 3PRPB 4BOSC 3MHSD 3W1SA 2D10A 3H9DA 1SIFA 2GBJA 4W9JA 3QC8B 3A9JA 5AEKB 3IHPC 2O2VA 2QHOA 4BKSA 4B95A 3U7DA 3VXWA 1FXTB 1WXMA 1TTNA 4I6NB 2LXCA 3M3JA 3GZNI 4RM8A 3RZWC 1WZ0A 3M62B 2HJ8A 2JPHA 4IWPA 3ZKJC 2WWZA 1UELA 2KQ7A 4IM0A 3PREA 3NS8A 4ZYNA 4DDGD 3A33B 4P7IA 5J18A 1WZ3A 1XT9B 3CF6E 2WDTB 4K7WA 4E71A 4BBNF 4BKTA 1WY8A 4GOCA 4HJKA 4II2B 3L17A 5C23A 2JVCA 2BYFA 2V1YA 2V3SA 1GC7A 2ZCCA 3VVWB 3UGBB 3B08A 2IO3B 1EO6A 3A1QB 2LJ5A 5CHFA 4GDLA 1ZGUB 2DX5B 3L0WB 3L08A 3V6EB 2BF8B 3QAQA 3V60A 3VUYA 1K8RB 1V9JA 1GG3A 3N3KB 2O6VB 3L10B 1V80A 4G0NB 3TBLD 2EMSA 3K9OB 3HK0A 4PS8A 4EZLA 2JRIB 2K8CA 2IBIB 2ZEQA 4N9F4 3A9JB 4G50A 1WE6A 4HCNB 2O2VB 3TJPA 3V6CB 3ONSA 2K6QA 4MGIE 1Q1OA 1YX5B 2ZNVC 2CU1A 3VUWA 4W9HA 4A3OA 5JH5C 4LDTB 2BYEA 5EDSA 1V2YA 3ZVVA 2KXJA 4DK5A 1EF5A 5DPSA 3APFA 2FCNA 2RD0A 3PRMB 2GBRA 3A4SC 3H7PA 1L7YA 3U8ZA 2BWFA 3RD2A 3DVGX 3H6NA 4KIKA 4AOFA 1IPGA 2KK8A 1Z2MA 1WJ4A 3PPAA 2DZJA 4B9KA 2LRUA 3NY5A 5L83A 4MEMA 2YVCA 2ASQA 4HWIB 3R66C 2IO2B 1E8YA 4GDLB 4IM3A 2AYOB 3EFUA 5CX3A 4XC2A 4A20A 2VRRB 1NBFC 3A4RA 4IW0A 4CO7A 2L8JA 4MGZE 4TKNA 5JZEB 1ZW7A 1E8ZA 3UIOB 2M1MA 2XEWA 1WYWB 2D07B 1WR1A 2KANA 3VHTC 4MELA 1LFDA 4KV2A 2JF5A 3ZNID 2AL6A 2KZRA 2NBWB 2N1VA 4FADA 1P0RA 3SU8X 2FAZA 3K9PB 1OEYA 1D3ZA 3ENEA 3A9KB 3DBSA 4HPMB 3EC8A 2PPHA 3H7PB 4I6LB 2JZ3B 4KDIC 1PQSA 1EUVB 2MA9B 5G55A 2M17A 4KIKB 4W9FA 2KWCA 3DBLI 4PYUA 4MDKE 1VD2A 3RYTA 4E74A 1BT0A 2J0KA 4I6PA 2MP2A 3IG3A 4M8NA 4CYEA 4WJOA 1R4MI 3ZTDA 3JSVA 3PGEA 3PVLA 3QA8A 4NJ7A 2LRWA 3VFKA 3WA0A 1TBEA 3WANA 4FBJB 2GBNA 2RGFA 1ZKHA 2O6VD 3VQIA 2EMTA 1LXDA 3WALA 4DHJB 4DXAB 1XQQA 2UYZB 5E6OA 2L00B 2IY1B 2CKHB 3D32A 3VH4B 2JUOA 2I1KA 1H4RA 2XK5B 4MGYE 2D11A 2HE7A 4HDQA 3RCZA 4LDTD 4GSWA 3QX1A 2N9XA 4W9EA 3ZDMC 1WM3A 2PE9A 2B3AA 4GIVA 3R7QA 2KWUB 4KSLC 4M0WB 2GBMA 3O65B 4MSMB 2LXAA 3EHVA 2FUHB 1E8XA 2R2QA 2BWES 1V49A 2BPSA 3ZRCA 3I3TB 2KN5A 4IUMB 3P2BA 2LGDA 3KUCB 1C3TA 4JGHB 1SE9A 3UQAA 3KVFB 2DYBA 2MBBB 3ZTCA 2MRPA 3ZO5B 2M4NA 2LWPA 5G2NA 3DQVA 3WAOA 4NAWB 3N30A 2DZIA 3B1LX 3RZFA 2DAJA 1WMHB 3QCAA 4NJ6A 3VTWA 3X23A 3PSEB 3JSVB 2ZVNA 3V61A 2XBBC 5JHAA 3PT2B 1E8WA 4TV3A 4HCPB 4IM2A 1KJTA 3ZIMA 4K1RB 3LJ3A 2REXA 1WGRA 2BYVE 2KTRA 3KH0A 1UBIA 3ALBA 4MJSA 2W9NA 3T9LA 4BKGA 3VUXA 4EEWA 2GMIC 1OGWA 2KOXA 5D94A 3V62A 3QWZB 3HIZA 4ZDVA 3APCA 3VTUA 4WAAA 4EZKA 2K8HA 2JZZA 3CSTA 5HKHA 1RFAA 2FCQA 4KVGB 3OJ4B 2HTHA 3ZW3A 2C5LC 2MBEA 1SGHA 2KDFB 3GOEA 1UBQA 2MBHA 2N7DA 2D2QA 2D3GA 2KDIA 2LVOA 2OJRA 3PZDA 5DPWA 4ANXA 1J8CA 4EZJA 4FJZA 1Z5SB 3VTVA 2IYDB 3PHWB 2A4ZA 2LASA 5DCNA 4B6WA 4AUQC 4IWOA 5J2RA 1YIWA 1WXAA 3AULA 2PEAA 4GGQA 4K81A 1RRBA 1WI0A 2DENB 2L05A 1OQYA 2NBUA 2I1JA 3TCAA 3L13A 4BVUC 3QIJA 4JL9A 2PE6B 3BINA 3SHQA 3NZSA 2J7QB 1XD3B 4BOZB 4DBGA 1Y8RC 1P98A 3ZLZA 4E3CA 4DHJD 2KO3A 3PV1A 1WM2A 2AWTA 1GUAB 2KQSA 4TQ1A 4TUUA 4ANWA 4MJSB 2C7NB 2LVPA 1GJZA 1WX7A 2YLMA 4IC7B 2WX0A 4X57B 2WX1A 4FLHA 4AP4C 2C7HA 2DYMA 2C7MB 3DVNU 3PS6A 2AL3A 4LJPB 3VDZA 2AEHA 4FHJA 3UINB 4FULA 1WGDA 2IZVB 3VAWA 3PRZA 5LLIA 2ZNVB 2IY0B 3DCGA 3DVNV 4ANUA 3KW5B 1P9DU 4GU2A 4RM9A 4WWOA 3W1YA 2BKFA 4NY0A 3DBHI 4W9GA 2M0XA 4MSQB 3M95A 4K7UA 2N7EA 3Q3JA 2KLGA 3JYUA 5CHVC 2KJ6A 4HLEA 4LJOB 2K39A 2Y5BB 1T0YA 4F8CB 2FCSA 3ZDTA 1R4NI 2GBKA 1I35A 2CHZA 2EKEC 2KMCA 3AI5A 4M8MA 2A5UA 5D2MB 2LGXA 2KJRA 4W9IA 3SDLC 4IG7B 2KDEB 2DZKA 2KVRA 1WX9A 3BY4B 2MQJA 1YQBA 5DPRA 4K7SA 3H7SA 4II3B 2J0MA 4JQWC 2G3QB 1WFYA 3NOBA 4WJQA 2ZPNA 4ZRJA 5E6PA 1WGHA 2R2OA 1TGZB 1AARA 2L76A 1WE7A 2RPQA 3ZNHB 3RUIB 2KKCA 3OLMD 2NVUI 3C0RB 4GN1A 1H8CA 2ZCBA 2PJHA 3DBRI 4BKSD 2FCMA 1YD8U 4GMVA 2G4DB 4MGKE 1WR6E 2V4LA 3L54A 4HDOA 5BO4B 3QK0A 2NCNA 5CTRC 4PYZA 5IAAC 2IO0B 4W9CA 3W1SC 3ZUNA 3ZNGC 1E90A 1V5TA 3MJWA 2O6VA 2MBQA 3JVZX 3PHXB 1E5WA 3JW0X 3H1UA 2KD0A 2UWQA 3L16A 3QHTA 4ZRIA 3HM3A 1U4AA 3R3MA 1CMXB 3DVGY 4ANVA 3MTNB 3S2AA 5JHBA 1IYFA 2DYOA 1QZEA 4F7ZA 1UD7A 3IVFA 4IWQA 1E7UA 2K6DB 2JWZA 2MW5A 1WRDB 1WJUA 2KC2A 4W9KA 4YL8A 4AJWA 4DHZE 1A5RA 1WIAA 2LUEA 1TZ1A 3N32A 2LD9A 2MP2B 2NS5A 3KYDD 3WAMA 2CR5A 1P1AA 4KZCA 4BFRA 3R7RA 1V81A 1E7VA 1WGGA 3PLVA 1UH6A 1OTRB 2KFKA 4ZRKA 3UQBA 4EOYA 1X1MA 3KUDB 4TQ0A 2HD5B 2MBOA 4WQOB 2IO1B 3ZRFA 2KHWB 4ASWC 1P3QU 4XZ4A 4HK2A 4NQLB 2C9WB 4GDKA 4WJNA 2JRHA 2L7RA 3EECA 3AXCA 4ICVA 4URKA 5J17A 2WYQA 5CHWA 1VCBA 2FNJB 2MSED 1J0GA 2NR2A 2LGYA 1C1YB 1GC6A 1NDDA 2DAFA 4WWNA 4XX5A 1NI2A 1Q5WB 4DDID 3HHMA 2FIFA 4MM3A 4NPNA 4NQKE 2L0FA 2BKRB 5GMVA 5TR5A 4BBNC 5C1ZA 5FR6A 5LXHA 1GNUA 4EKUA 4HPLB 1RLFA 3QJZA 4LCDE 3IBEA 2MLBA 1MG8A 4GXBA 4AJYB 4FHKA 3ML8A 1YX6B 1M94A 2KFJA 2RSUA 4W9DA 3UIPB 3APDA 4EUTA 2JY6A 2MCNB 1IP9A 2KWVB 5AZGA 2LI5A 1Q0WB 5KHQA 2KDBA 2KTFA 4MH0E 5LXIB 4CHKA 1S1QB 4KDLB 2K25A 1HE8A 3ECIA 1V86A 2Z59B 3ML9A 3Q3FA 4J6IA 1WJNA 3RT3B 4GB9A 2N9EB 3A9KA 4G11A 2ZVOA 1WF9A 3KYCD 2NBVB 2KFKB 1JRUA 4WWPA 3HM6X 2CHWA 2KX3A 3KUZA 4PS3A 3CMMB 2KTRB 4PS7A 2Z0EB 2G4SA 2LZ6A 4G3XB 1WGYA 4GDKB 3U30A 2J0JA 2JXXA 3VH3B 1LQBA 2NPTA 1UZXB 5D6JB 1WJ6A 2DZMA 3PLUA 1YJ1A 2DHZA 5AZHA 2ZZPB 1LM8B 3T8MA 4KZ0A 4A3PA 3ZNZB 4FJYA 3AU5A 3NHEB 2KJHB 5KHOA 2N4FA 3WAPA 2L0TA 1S3SG 4KSKC 2L3ZA 1KM7A 4JLCA 4W9LA 3CSFA 2CS4A 2LVQA 3TIXA 3TL5A 1ISNA 4F1SA 3UF8A 2KC1A 5E6NA 1WXSA 1WXVA 5AZFA 3OAWA 4AWJA 4WJPA 1L2NA 3NZUA 1EF1A 2N9PC 4HXDA 3AU4A 4HVBA 1RAXA 1OEYJ 3RULA 2GOWA 1F9JA 4ICUA 1KOTA 2K1FA 3DOWA 3B0AA 2XK5A 5IA7A 3QARA 4JIOU 2FIDA 1I42A 3TMPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FJV B;  5L95 C;  4DWF A;  4EFO A;  1WX8 A;  5DPT A;  3DDC B;  3QQ8 B;  4DHZ B;  3DPD A;  3LDZ E;  1G6J A;  3WIM A;  2JT4 B;  2N1W A;  3M63 B;  2K8B A;  2RR9 A;  5D7G A;  1J19 A;  2OOB B;  3SD5 A;  2ZPY A;  2ZJD A;  2MWS B;  4OVU A;  2Z0D B;  1V6E A;  2C60 A;  4RMA A;  2MX2 A;  4FA6 A;  1WH3 A;  2NPT B;  1KLV A;  2G45 B;  1V5O A;  3A1Q A;  4NAW A;  2KX0 A;  2KMA A;  4FN2 A;  1UGM A;  2M8S A;  1WMH A;  4OVV A;  3IFW B;  2KNB A;  3PTF C;  3X0W A;  3OJ3 A;  2BGF A;  2KLC A;  2CHX A;  4NNJ B;  3PRP B;  4BOS C;  3MHS D;  3W1S A;  2D10 A;  3H9D A;  1SIF A;  2GBJ A;  4W9J A;  3QC8 B;  3A9J A;  5AEK B;  3IHP C;  2O2V A;  2QHO A;  4BKS A;  4B95 A;  3U7D A;  3VXW A;  1FXT B;  1WXM A;  1TTN A;  4I6N B;  2LXC A;  3M3J A;  3GZN I;  4RM8 A;  3RZW C;  1WZ0 A;  3M62 B;  2HJ8 A;  2JPH A;  4IWP A;  3ZKJ C;  2WWZ A;  1UEL A;  2KQ7 A;  4IM0 A;  3PRE A;  3NS8 A;  4ZYN A;  4DDG D;  3A33 B;  4P7I A;  5J18 A;  1WZ3 A;  1XT9 B;  3CF6 E;  2WDT B;  4K7W A;  4E71 A;  4BBN F;  4BKT A;  1WY8 A;  4GOC A;  4HJK A;  4II2 B;  3L17 A;  5C23 A;  2JVC A;  2BYF A;  2V1Y A;  2V3S A;  1GC7 A;  2ZCC A;  3VVW B;  3UGB B;  3B08 A;  2IO3 B;  1EO6 A;  3A1Q B;  2LJ5 A;  5CHF A;  4GDL A;  1ZGU B;  2DX5 B;  3L0W B;  3L08 A;  3V6E B;  2BF8 B;  3QAQ A;  3V60 A;  3VUY A;  1K8R B;  1V9J A;  1GG3 A;  3N3K B;  2O6V B;  3L10 B;  1V80 A;  4G0N B;  3TBL D;  2EMS A;  3K9O B;  3HK0 A;  4PS8 A;  4EZL A;  2JRI B;  2K8C A;  2IBI B;  2ZEQ A;  4N9F 4;  3A9J B;  4G50 A;  1WE6 A;  4HCN B;  2O2V B;  3TJP A;  3V6C B;  3ONS A;  2K6Q A;  4MGI E;  1Q1O A;  1YX5 B;  2ZNV C;  2CU1 A;  3VUW A;  4W9H A;  4A3O A;  5JH5 C;  4LDT B;  2BYE A;  5EDS A;  1V2Y A;  3ZVV A;  2KXJ A;  4DK5 A;  1EF5 A;  5DPS A;  3APF A;  2FCN A;  2RD0 A;  3PRM B;  2GBR A;  3A4S C;  3H7P A;  1L7Y A;  3U8Z A;  2BWF A;  3RD2 A;  3DVG X;  3H6N A;  4KIK A;  4AOF A;  1IPG A;  2KK8 A;  1Z2M A;  1WJ4 A;  3PPA A;  2DZJ A;  4B9K A;  2LRU A;  3NY5 A;  5L83 A;  4MEM A;  2YVC A;  2ASQ A;  4HWI B;  3R66 C;  2IO2 B;  1E8Y A;  4GDL B;  4IM3 A;  2AYO B;  3EFU A;  5CX3 A;  4XC2 A;  4A20 A;  2VRR B;  1NBF C;  3A4R A;  4IW0 A;  4CO7 A;  2L8J A;  4MGZ E;  4TKN A;  5JZE B;  1ZW7 A;  1E8Z A;  3UIO B;  2M1M A;  2XEW A;  1WYW B;  2D07 B;  1WR1 A;  2KAN A;  3VHT C;  4MEL A;  1LFD A;  4KV2 A;  2JF5 A;  3ZNI D;  2AL6 A;  2KZR A;  2NBW B;  2N1V A;  4FAD A;  1P0R A;  3SU8 X;  2FAZ A;  3K9P B;  1OEY A;  1D3Z A;  3ENE A;  3A9K B;  3DBS A;  4HPM B;  3EC8 A;  2PPH A;  3H7P B;  4I6L B;  2JZ3 B;  4KDI C;  1PQS A;  1EUV B;  2MA9 B;  5G55 A;  2M17 A;  4KIK B;  4W9F A;  2KWC A;  3DBL I;  4PYU A;  4MDK E;  1VD2 A;  3RYT A;  4E74 A;  1BT0 A;  2J0K A;  4I6P A;  2MP2 A;  3IG3 A;  4M8N A;  4CYE A;  4WJO A;  1R4M I;  3ZTD A;  3JSV A;  3PGE A;  3PVL A;  3QA8 A;  4NJ7 A;  2LRW A;  3VFK A;  3WA0 A;  1TBE A;  3WAN A;  4FBJ B;  2GBN A;  2RGF A;  1ZKH A;  2O6V D;  3VQI A;  2EMT A;  1LXD A;  3WAL A;  4DHJ B;  4DXA B;  1XQQ A;  2UYZ B;  5E6O A;  2L00 B;  2IY1 B;  2CKH B;  3D32 A;  3VH4 B;  2JUO A;  2I1K A;  1H4R A;  2XK5 B;  4MGY E;  2D11 A;  2HE7 A;  4HDQ A;  3RCZ A;  4LDT D;  4GSW A;  3QX1 A;  2N9X A;  4W9E A;  3ZDM C;  1WM3 A;  2PE9 A;  2B3A A;  4GIV A;  3R7Q A;  2KWU B;  4KSL C;  4M0W B;  2GBM A;  3O65 B;  4MSM B;  2LXA A;  3EHV A;  2FUH B;  1E8X A;  2R2Q A;  2BWE S;  1V49 A;  2BPS A;  3ZRC A;  3I3T B;  2KN5 A;  4IUM B;  3P2B A;  2LGD A;  3KUC B;  1C3T A;  4JGH B;  1SE9 A;  3UQA A;  3KVF B;  2DYB A;  2MBB B;  3ZTC A;  2MRP A;  3ZO5 B;  2M4N A;  2LWP A;  5G2N A;  3DQV A;  3WAO A;  4NAW B;  3N30 A;  2DZI A;  3B1L X;  3RZF A;  2DAJ A;  1WMH B;  3QCA A;  4NJ6 A;  3VTW A;  3X23 A;  3PSE B;  3JSV B;  2ZVN A;  3V61 A;  2XBB C;  5JHA A;  3PT2 B;  1E8W A;  4TV3 A;  4HCP B;  4IM2 A;  1KJT A;  3ZIM A;  4K1R B;  3LJ3 A;  2REX A;  1WGR A;  2BYV E;  2KTR A;  3KH0 A;  1UBI A;  3ALB A;  4MJS A;  2W9N A;  3T9L A;  4BKG A;  3VUX A;  4EEW A;  2GMI C;  1OGW A;  2KOX A;  5D94 A;  3V62 A;  3QWZ B;  3HIZ A;  4ZDV A;  3APC A;  3VTU A;  4WAA A;  4EZK A;  2K8H A;  2JZZ A;  3CST A;  5HKH A;  1RFA A;  2FCQ A;  4KVG B;  3OJ4 B;  2HTH A;  3ZW3 A;  2C5L C;  2MBE A;  1SGH A;  2KDF B;  3GOE A;  1UBQ A;  2MBH A;  2N7D A;  2D2Q A;  2D3G A;  2KDI A;  2LVO A;  2OJR A;  3PZD A;  5DPW A;  4ANX A;  1J8C A;  4EZJ A;  4FJZ A;  1Z5S B;  3VTV A;  2IYD B;  3PHW B;  2A4Z A;  2LAS A;  5DCN A;  4B6W A;  4AUQ C;  4IWO A;  5J2R A;  1YIW A;  1WXA A;  3AUL A;  2PEA A;  4GGQ A;  4K81 A;  1RRB A;  1WI0 A;  2DEN B;  2L05 A;  1OQY A;  2NBU A;  2I1J A;  3TCA A;  3L13 A;  4BVU C;  3QIJ A;  4JL9 A;  2PE6 B;  3BIN A;  3SHQ A;  3NZS A;  2J7Q B;  1XD3 B;  4BOZ B;  4DBG A;  1Y8R C;  1P98 A;  3ZLZ A;  4E3C A;  4DHJ D;  2KO3 A;  3PV1 A;  1WM2 A;  2AWT A;  1GUA B;  2KQS A;  4TQ1 A;  4TUU A;  4ANW A;  4MJS B;  2C7N B;  2LVP A;  1GJZ A;  1WX7 A;  2YLM A;  4IC7 B;  2WX0 A;  4X57 B;  2WX1 A;  4FLH A;  4AP4 C;  2C7H A;  2DYM A;  2C7M B;  3DVN U;  3PS6 A;  2AL3 A;  4LJP B;  3VDZ A;  2AEH A;  4FHJ A;  3UIN B;  4FUL A;  1WGD A;  2IZV B;  3VAW A;  3PRZ A;  5LLI A;  2ZNV B;  2IY0 B;  3DCG A;  3DVN V;  4ANU A;  3KW5 B;  1P9D U;  4GU2 A;  4RM9 A;  4WWO A;  3W1Y A;  2BKF A;  4NY0 A;  3DBH I;  4W9G A;  2M0X A;  4MSQ B;  3M95 A;  4K7U A;  2N7E A;  3Q3J A;  2KLG A;  3JYU A;  5CHV C;  2KJ6 A;  4HLE A;  4LJO B;  2K39 A;  2Y5B B;  1T0Y A;  4F8C B;  2FCS A;  3ZDT A;  1R4N I;  2GBK A;  1I35 A;  2CHZ A;  2EKE C;  2KMC A;  3AI5 A;  4M8M A;  2A5U A;  5D2M B;  2LGX A;  2KJR A;  4W9I A;  3SDL C;  4IG7 B;  2KDE B;  2DZK A;  2KVR A;  1WX9 A;  3BY4 B;  2MQJ A;  1YQB A;  5DPR A;  4K7S A;  3H7S A;  4II3 B;  2J0M A;  4JQW C;  2G3Q B;  1WFY A;  3NOB A;  4WJQ A;  2ZPN A;  4ZRJ A;  5E6P A;  1WGH A;  2R2O A;  1TGZ B;  1AAR A;  2L76 A;  1WE7 A;  2RPQ A;  3ZNH B;  3RUI B;  2KKC A;  3OLM D;  2NVU I;  3C0R B;  4GN1 A;  1H8C A;  2ZCB A;  2PJH A;  3DBR I;  4BKS D;  2FCM A;  1YD8 U;  4GMV A;  2G4D B;  4MGK E;  1WR6 E;  2V4L A;  3L54 A;  4HDO A;  5BO4 B;  3QK0 A;  2NCN A;  5CTR C;  4PYZ A;  5IAA C;  2IO0 B;  4W9C A;  3W1S C;  3ZUN A;  3ZNG C;  1E90 A;  1V5T A;  3MJW A;  2O6V A;  2MBQ A;  3JVZ X;  3PHX B;  1E5W A;  3JW0 X;  3H1U A;  2KD0 A;  2UWQ A;  3L16 A;  3QHT A;  4ZRI A;  3HM3 A;  1U4A A;  3R3M A;  1CMX B;  3DVG Y;  4ANV A;  3MTN B;  3S2A A;  5JHB A;  1IYF A;  2DYO A;  1QZE A;  4F7Z A;  1UD7 A;  3IVF A;  4IWQ A;  1E7U A;  2K6D B;  2JWZ A;  2MW5 A;  1WRD B;  1WJU A;  2KC2 A;  4W9K A;  4YL8 A;  4AJW A;  4DHZ E;  1A5R A;  1WIA A;  2LUE A;  1TZ1 A;  3N32 A;  2LD9 A;  2MP2 B;  2NS5 A;  3KYD D;  3WAM A;  2CR5 A;  1P1A A;  4KZC A;  4BFR A;  3R7R A;  1V81 A;  1E7V A;  1WGG A;  3PLV A;  1UH6 A;  1OTR B;  2KFK A;  4ZRK A;  3UQB A;  4EOY A;  1X1M A;  3KUD B;  4TQ0 A;  2HD5 B;  2MBO A;  4WQO B;  2IO1 B;  3ZRF A;  2KHW B;  4ASW C;  1P3Q U;  4XZ4 A;  4HK2 A;  4NQL B;  2C9W B;  4GDK A;  4WJN A;  2JRH A;  2L7R A;  3EEC A;  3AXC A;  4ICV A;  4URK A;  5J17 A;  2WYQ A;  5CHW A;  1VCB A;  2FNJ B;  2MSE D;  1J0G A;  2NR2 A;  2LGY A;  1C1Y B;  1GC6 A;  1NDD A;  2DAF A;  4WWN A;  4XX5 A;  1NI2 A;  1Q5W B;  4DDI D;  3HHM A;  2FIF A;  4MM3 A;  4NPN A;  4NQK E;  2L0F A;  2BKR B;  5GMV A;  5TR5 A;  4BBN C;  5C1Z A;  5FR6 A;  5LXH A;  1GNU A;  4EKU A;  4HPL B;  1RLF A;  3QJZ A;  4LCD E;  3IBE A;  2MLB A;  1MG8 A;  4GXB A;  4AJY B;  4FHK A;  3ML8 A;  1YX6 B;  1M94 A;  2KFJ A;  2RSU A;  4W9D A;  3UIP B;  3APD A;  4EUT A;  2JY6 A;  2MCN B;  1IP9 A;  2KWV B;  5AZG A;  2LI5 A;  1Q0W B;  5KHQ A;  2KDB A;  2KTF A;  4MH0 E;  5LXI B;  4CHK A;  1S1Q B;  4KDL B;  2K25 A;  1HE8 A;  3ECI A;  1V86 A;  2Z59 B;  3ML9 A;  3Q3F A;  4J6I A;  1WJN A;  3RT3 B;  4GB9 A;  2N9E B;  3A9K A;  4G11 A;  2ZVO A;  1WF9 A;  3KYC D;  2NBV B;  2KFK B;  1JRU A;  4WWP A;  3HM6 X;  2CHW A;  2KX3 A;  3KUZ A;  4PS3 A;  3CMM B;  2KTR B;  4PS7 A;  2Z0E B;  2G4S A;  2LZ6 A;  4G3X B;  1WGY A;  4GDK B;  3U30 A;  2J0J A;  2JXX A;  3VH3 B;  1LQB A;  2NPT A;  1UZX B;  5D6J B;  1WJ6 A;  2DZM A;  3PLU A;  1YJ1 A;  2DHZ A;  5AZH A;  2ZZP B;  1LM8 B;  3T8M A;  4KZ0 A;  4A3P A;  3ZNZ B;  4FJY A;  3AU5 A;  3NHE B;  2KJH B;  5KHO A;  2N4F A;  3WAP A;  2L0T A;  1S3S G;  4KSK C;  2L3Z A;  1KM7 A;  4JLC A;  4W9L A;  3CSF A;  2CS4 A;  2LVQ A;  3TIX A;  3TL5 A;  1ISN A;  4F1S A;  3UF8 A;  2KC1 A;  5E6N A;  1WXS A;  1WXV A;  5AZF A;  3OAW A;  4AWJ A;  4WJP A;  1L2N A;  3NZU A;  1EF1 A;  2N9P C;  4HXD A;  3AU4 A;  4HVB A;  1RAX A;  1OEY J;  3RUL A;  2GOW A;  1F9J A;  4ICU A;  1KOT A;  2K1F A;  3DOW A;  3B0A A;  2XK5 A;  5IA7 A;  3QAR A;  4JIO U;  2FID A;  1I42 A;  3TMP B; 
#chains in the Genus database with same CATH topology
 1WX8 A;  2KWD A;  3WIM A;  3TEZ A;  1SBB B;  2QCZ A;  3URY A;  2K8B A;  2ICI A;  3SD5 A;  1AW7 A;  3NG0 A;  5G5G A;  4RMA A;  2ZW0 A;  2MX2 A;  1QKZ A;  3DWM A;  1KLV A;  1V5O A;  2M8S A;  2IPK D;  1WMH A;  4OVV A;  3X0W A;  2KNB A;  3PTF C;  4A9A A;  3OJ3 A;  2KLC A;  3N20 C;  4Q2J A;  3E9S A;  3MHS D;  3OG5 A;  1KF6 B;  1SIF A;  2IJ0 A;  4W9J A;  3EFC A;  2K5P A;  5AEK B;  1YNT E;  2V3P A;  4TMA B;  4RM8 A;  1WZ0 A;  2HJ8 A;  3IAM 1;  2JPH A;  1UEL A;  3CF6 E;  2WDT B;  1XLP A;  1WY8 A;  5HHD G;  2V1Y A;  4LK0 M;  4YSZ B;  2V3S A;  1GC7 A;  1E9M A;  5H92 C;  5CHF A;  3L08 A;  3L0W B;  2BF8 B;  3V60 A;  3AEC B;  1V9J A;  1C9F A;  5HI1 A;  3K9O B;  3HK0 A;  4EZL A;  2JRI B;  2ZEQ A;  2IBI B;  4N9F 4;  4RGT A;  1VZ8 A;  3FC4 A;  3ZJV A;  2O2V B;  3TJP A;  1XF5 L;  3ONS A;  2QMT A;  1TJE A;  1YX5 B;  5DPS A;  3TUO A;  2K0P A;  2FCN A;  1FNV A;  3H7P A;  4N59 A;  1A70 A;  2BWF A;  1FXI A;  3H6N A;  1IPG A;  2KK8 A;  1WJ4 A;  4OZA A;  3NY5 A;  1FMA D;  2NTT A;  2WXN A;  4HWI B;  5AUK A;  4B0M A;  1JWB D;  4IM3 A;  1Y56 A;  4KGR A;  1ET9 A;  4MM3 B;  4XC2 A;  4A6Q A;  3TEW A;  4OZC A;  1NBF C;  5JZE B;  2LFI A;  1ZW7 A;  1V1O A;  2D07 B;  1WR1 A;  1YQ3 B;  4MEL A;  3VRB B;  3ZNI D;  2N1V A;  2NMQ A;  1P0R A;  3SU8 X;  3A9K B;  1HQR D;  1ZOY B;  4IDI A;  2JZ3 B;  2MA9 B;  5G55 A;  3DBL I;  4PYU A;  4MDK E;  3AEB B;  4E74 A;  4I6P A;  2MP2 A;  4CYE A;  1T0Q C;  3ZTD A;  3QA8 A;  3VFK A;  1TBE A;  2GBN A;  2RGF A;  3SR6 A;  5FK9 C;  1LXD A;  3WAL A;  4DHJ B;  2D5G A;  4RGN A;  3AMZ A;  2UYZ B;  1KFY B;  2JWU A;  4OVZ A;  2OED A;  4L23 A;  3VH4 B;  2BS4 B;  2KVZ A;  2KAC A;  1IBX A;  4N58 A;  3QX1 A;  4NZL B;  3R7Q A;  3O65 B;  3N1Y C;  2QIE B;  4JE3 B;  2JU6 X;  3I3T B;  4ZRP A;  2LGD A;  3KUC B;  4ZHO A;  2DYB A;  3ZTC A;  3ZO5 B;  2MRP A;  3DQV A;  3WAO A;  3B1L X;  1TS2 A;  1WMH B;  3VTW A;  4NJ6 A;  1PUT A;  3JSV B;  2XBB C;  5JHA A;  3PT2 B;  4TV3 A;  3R2I A;  2PW9 A;  2ZW1 A;  5C2T B;  1XLO A;  1CQV A;  3ALB A;  3T9L A;  2W9N A;  4BKG A;  1GB4 A;  3CIR B;  1OGW A;  2KOX A;  3HIZ A;  1UGJ A;  2M0A A;  2AX5 A;  3APC A;  3VTU A;  4WAA A;  1D5M C;  2DBY A;  4EZK A;  2WLB A;  1FO4 A;  3OJ4 B;  4A55 A;  2MBE A;  2KDF B;  2VH2 A;  2D3G A;  2OJR A;  4WH4 A;  4EZJ A;  1J8C A;  1P7E A;  1TKY A;  1Z5S B;  1LO5 D;  3PHW B;  2WXF A;  4IWO A;  5J2R A;  1YIW A;  4K81 A;  1WI0 A;  2L05 A;  3FIL A;  3L13 A;  4BVU C;  2JYT A;  3ZLZ A;  3PV1 A;  3RFZ B;  2RDB C;  2V3N A;  2C7N B;  1GJZ A;  2PLP A;  4AP4 C;  2C7H A;  4LJP B;  3DVN U;  2AL3 A;  2PVO D;  3VDZ A;  2AEH A;  4FHJ A;  3PRZ A;  5LLI A;  3DCG A;  3DVN V;  3R2T A;  4L2Y A;  2KYW A;  3W1Y A;  2WXM A;  4K7U A;  3Q3J A;  5CHV C;  3B2G A;  2Y5B B;  1T0Y A;  2GBK A;  2A5U A;  2WU5 B;  2KVR A;  3BY4 B;  3DBH B;  1YQB A;  1E0Z A;  3H8H A;  3MJ5 A;  3AE4 B;  4JQW C;  2RPQ A;  3RUI B;  3C0R B;  1H8C A;  2M56 B;  4RF1 A;  1J7A A;  1MFW A;  2FCM A;  3DBR I;  4BKS D;  3MC9 A;  4LLG M;  4W9C A;  3U7Z A;  1HXY D;  1QT9 A;  3JVZ X;  3PHX B;  3L16 A;  4ANV A;  4ZRI A;  2BT6 A;  3HM3 A;  1CMX B;  3DVG Y;  3Q2A C;  4F7Z A;  3ZQ4 A;  4YTM B;  2K6D B;  4DHZ E;  1CJE A;  1KLU D;  5G5H A;  1TZ1 A;  2MP2 B;  2J53 A;  3EA6 A;  5FKA C;  2INN E;  3R7R A;  1UH6 A;  1PGA A;  2C9W B;  2XNA C;  4WJN A;  1SJE D;  3AXC A;  1TKE A;  2WYQ A;  1VCB A;  2NR2 A;  1D4B A;  1NDD A;  3RNC C;  1NI2 A;  1WYG A;  1IBX B;  2L0F A;  3Q69 A;  5GMV A;  5LXH A;  3RMK C;  2IGH A;  1RLF A;  4LCD E;  4FHK A;  1MHH E;  1YX6 B;  2JX5 A;  3APD A;  2JY6 A;  2MCN B;  4P1C C;  1TY2 A;  2KWV B;  5AZG A;  2LI5 A;  3P1M A;  4MH0 E;  4CHK A;  2K25 A;  3ML9 A;  4J6I A;  5D3D A;  3RT3 B;  2SEB D;  4JWU C;  4MH8 A;  2NBV B;  1JRU A;  3HM6 X;  2KX3 A;  4BZA A;  3C8Y A;  4AQ7 A;  4PS3 A;  2D3A A;  2FE8 A;  2Z0E B;  2LZ6 A;  4GDK B;  3VH3 B;  1T6B X;  2H88 B;  4P16 A;  4KZ0 A;  3T8M A;  5KHO A;  3Q8A A;  2L0T A;  1S3S G;  3CSF A;  2LVQ A;  3UF8 A;  1L2N A;  1AWD A;  5FR3 A;  4CQN A;  1FCL A;  4LNO A;  3B0A A;  2XK5 A;  4L1B A;  2MHJ A;  3DDC B;  4HEA 1;  3AV8 A;  2WXK A;  3QQ8 B;  3DPD A;  3LDZ E;  4DHZ B;  2N1W A;  3M63 B;  1YQ4 B;  3ZXV A;  1T3Q A;  1XLN A;  1WRI A;  5EE9 A;  2ZPY A;  2MWS B;  5HG2 A;  1FPY A;  1V6E A;  1DOI A;  4ZRQ A;  3AH7 A;  2G45 B;  1TS4 A;  4NAW A;  2KX0 A;  1UGM A;  1TY0 A;  1XCT L;  1I4X A;  3BVM A;  2BGF A;  2E3T A;  4BOS C;  3RPF C;  3W1S A;  2D10 A;  4HPP A;  2BW2 A;  3QC8 B;  2BTE A;  3TSS A;  2O2V A;  1V97 A;  4BKS A;  4B95 A;  1TT5 B;  1YJI A;  3GZN I;  3RZW C;  3BYY B;  4USA A;  2WWZ A;  3PRE A;  4DDG D;  4P7I A;  1XT9 B;  2WU2 B;  4BKT A;  1P7F A;  3NJT A;  2BYF A;  1TZO A;  2K3U A;  4REZ A;  1ZGU B;  1K8R B;  1R7S A;  5HFY A;  3N3K B;  3TBL D;  3U2S C;  2EMS A;  4PS8 A;  4MAC A;  2K8C A;  2VZK B;  3A9J B;  2GRI A;  2ZNV C;  2CU1 A;  4A3O A;  4W9H A;  5EDS A;  3KWL A;  3ZVV A;  5EE0 A;  4DK5 A;  3APF A;  2RD0 A;  3PRM B;  3AE9 B;  3A4S C;  4O1N A;  4M02 A;  3U4E G;  2AQ3 B;  3BK2 A;  3I9V 1;  3RD2 A;  1N5W A;  3HUI A;  3DVG X;  3ZJT A;  4AOF A;  4JX1 C;  3PPA A;  4C7Z A;  4B9K A;  1N60 A;  2ASQ A;  3I63 C;  2IO2 B;  4WIP A;  4GDL B;  5I4D A;  5CX3 A;  1FIQ A;  3NVZ A;  4A20 A;  3LYY A;  4IW0 A;  1E8Z A;  3UIO B;  1PYW D;  2LHD A;  1WYW B;  1I4P A;  3NVV A;  1JRP A;  1ZUD 2;  1PFD A;  1AN8 A;  1LFD A;  4KV2 A;  4LNK A;  3MP9 A;  1ACC A;  4ITK A;  4GLS C;  4XWT A;  2PPH A;  4I6L B;  1EUV B;  3P4P B;  2KWC A;  1C4C A;  3RYT A;  1OQR A;  1BT0 A;  2BS2 B;  2J4X A;  4WJO A;  1FD6 A;  4NJC A;  1R4M I;  1QF6 A;  3JSV A;  3PGE A;  3PVL A;  2LRW A;  2O6V D;  2QC8 A;  2L32 A;  2EMT A;  1BUI C;  1N61 A;  5E6O A;  2IGG A;  2IY1 B;  2L00 B;  3P63 A;  2JUO A;  2LUM A;  3W5U B;  2JYE A;  2XK5 B;  1H4R A;  4HDQ A;  4W9E A;  2PE9 A;  4GIV A;  2VH1 A;  3VR8 B;  4MSM B;  4HJG E;  2LGI A;  1E8X A;  1NEN B;  2V4I B;  4JGH B;  3UQA A;  1OFF A;  1YMH E;  5G2N A;  3GB1 A;  4NAW B;  3N30 A;  2DAJ A;  3QCA A;  3P4Q B;  2ON8 A;  3X23 A;  1E8W A;  2DWQ A;  1GOZ A;  4K1R B;  2KTR A;  1B9R A;  3VUX A;  4EEW A;  3EUB 2;  4C4V A;  5D94 A;  2QSD A;  3QWZ B;  4KKJ A;  3AEF B;  2G1E A;  1TYG B;  3CST A;  5HKH A;  2X38 A;  2HTM E;  4KVG B;  2HTH A;  3DHG C;  1VLB A;  2GI9 A;  2KDI A;  3Q3N C;  2INP E;  1J7C A;  5DCN A;  4AUQ C;  4XDC A;  4GGQ A;  2KDM A;  1YJJ A;  2NBU A;  1PGX A;  2PE6 B;  4M00 A;  2J7Q B;  3E56 A;  4DBG A;  1Y8R C;  1NEK B;  4E3C A;  2AWT A;  1GUA B;  4TQ1 A;  2G9H D;  1L0V B;  2LVP A;  1WX7 A;  2MH7 A;  2WX0 A;  1T0S C;  3PS6 A;  2C7M B;  4P6V F;  4FUL A;  3AE5 B;  4JPS A;  2IZV B;  1I4R A;  4GU2 A;  2LGS A;  4WWO A;  4DQO C;  4NY0 A;  4W9G A;  3PZ8 A;  1YOV B;  2KLG A;  4HLE A;  2W3S A;  3W9C B;  2K39 A;  4F8C B;  3ABV B;  1I35 A;  3LXF A;  2LGX A;  2WXP A;  1FNW A;  4K7S A;  3H7S A;  1SF0 A;  1TGZ B;  1D6E C;  3ZNH B;  1R4N B;  4GN1 A;  2WGS A;  2PJH A;  2G4D B;  3L54 A;  5BO4 B;  1Q10 A;  3QK0 A;  4RFB A;  1F52 A;  3AEA B;  2O6V A;  2MBQ A;  3QHT A;  3S2A A;  5JHB A;  2N9L A;  1E7U A;  2JWZ A;  2MW5 A;  1WRD B;  2KC2 A;  4YTP B;  4AJW A;  4P1B C;  2LUE A;  4YXD B;  2LD9 A;  3KYD D;  2PKO A;  4HRS A;  4ZOH C;  1V81 A;  3PLV A;  1X1M A;  2KHW B;  5BMG A;  4HK2 A;  2DNF A;  4GDK A;  1KH0 A;  4RCO A;  2L7R A;  4URK A;  5J17 A;  1J7B A;  5CHW A;  1J0G A;  2FNJ B;  2DAF A;  4WWN A;  4XX5 A;  4DXG A;  1Q5W B;  2WXL A;  4DDI D;  3HHM A;  2FIF A;  4NQK E;  4BBN C;  4EKU A;  1BXT A;  3QJZ A;  1ZPS A;  2MLB A;  4GXB A;  4AJY B;  1I4G A;  4QAY A;  2X8X X;  3KWV A;  1Q0W B;  2KDB A;  5LXI B;  2MJ3 A;  3DHI C;  1S1Q B;  4S17 A;  4KDL B;  4ACF A;  2MEK A;  1NYQ A;  4G11 A;  3KYC D;  2KFK B;  3CWI A;  4BAX A;  2MJE A;  3KUZ A;  3CMM B;  2KTR B;  4PS7 A;  1QOG A;  2G4S A;  4G3X B;  1WGY A;  4LNI A;  2JXX A;  1LQB A;  4C4V B;  2DHZ A;  2ZZP B;  3AE7 B;  3AU5 A;  3NHE B;  2N4F A;  2CS4 A;  4B0E A;  4F1S A;  5BYS A;  1ISN A;  2AQ1 B;  2KC1 A;  4D2K A;  1WXV A;  4OZB A;  3OAW A;  4WJP A;  1EF1 A;  3AU4 A;  3AEE B;  1KOT A;  5IA7 A;  5IN7 A;  3VR9 B;  1N6Z A;  2FID A;  3TMP B;  4FJV B;  1FFU A;  4DWF A;  1QOA A;  5L95 C;  2NTS A;  1I4Q A;  5DPT A;  1IGC A;  4M0W A;  1G6J A;  5D7G A;  1J19 A;  1K50 A;  1ENF A;  4WUR A;  4OVU A;  4HKQ A;  1SE3 A;  4FA6 A;  3MC0 B;  1NYR A;  2IGD A;  2BB5 A;  4ARI A;  2CHX A;  3Q8B A;  3AN1 A;  3PRP B;  3SFD B;  3IT6 B;  2WP9 B;  3V05 A;  3A9J A;  2QDF A;  3GP7 A;  3IHP C;  1KTK A;  4RF0 A;  1I7H A;  2QHO A;  1YN5 A;  3U7D A;  3VXW A;  4C80 A;  1FXT B;  1C79 A;  1WXM A;  2LXC A;  4FXC A;  4UDU C;  1L0Y B;  1CZP A;  3BVG A;  3NS8 A;  4HKZ E;  2B76 B;  4K7W A;  4BBN F;  1V8C A;  4HJK A;  4II2 B;  1JW9 D;  2JVC A;  2ZCC A;  1RFK A;  3A1Q B;  2LJ5 A;  1SJH D;  4GDL A;  2DX5 B;  4XYC A;  3VUY A;  4AS1 A;  2WXG A;  1GG3 A;  1UWX A;  2RDH A;  2O6V B;  3L10 B;  1V80 A;  4G0N B;  2Q5W D;  4C00 A;  2Z8L A;  3L4P A;  4G50 A;  3IXS A;  2L52 A;  1WE6 A;  3TEX A;  3V6C B;  2BVC A;  2K6Q A;  4MGI E;  1Q1O A;  2FUG 1;  5JH5 C;  3PZ7 A;  1ZXI A;  1FFV A;  5IKC M;  2GBR A;  1FXA A;  3Q3O C;  1C77 A;  2WXR A;  2LRU A;  2OHF A;  1STE A;  3V3X A;  1JML A;  4MEM A;  2YVC A;  2BYT A;  1T0R C;  2AYO B;  3EFU A;  3GE8 C;  2J52 A;  2VRR B;  2MJD A;  4CO7 A;  2L8J A;  4LTU A;  4MGZ E;  4TKN A;  2I38 A;  1K51 A;  2XEW A;  3N9Y C;  3N1X C;  2KAN A;  3VHT C;  2I2Y A;  1FEH A;  1UF0 A;  5H8Y E;  1L6V A;  1HTO A;  2AL6 A;  4S0R A;  2NBW B;  3AE2 B;  2FAZ A;  3K9P B;  1OEY A;  1N63 A;  4HPM B;  2R61 A;  3EC8 A;  4PK1 A;  4LNF A;  2GLS A;  2M17 A;  4KIK B;  4W9F A;  2W3R A;  1VD2 A;  2N0S B;  2J0K A;  4M8N A;  3BVZ A;  1XXG A;  3RNF C;  1ZDX A;  1BML C;  2IND C;  3WAN A;  2WXI A;  4FBJ B;  1ZKH A;  3VQI A;  1NI3 A;  3RNB C;  1IGD A;  1XQQ A;  3DBL B;  3FAH A;  3RN9 C;  2E6X A;  5C3J B;  2I1K A;  4MGY E;  3RCZ A;  4LDT D;  4GSW A;  2N9X A;  3ZDM C;  3O13 A;  1WM3 A;  5BMI A;  2KWU B;  4IOI E;  4KSL C;  4M0W B;  2GBM A;  3NZ3 A;  5TSS A;  2LXA A;  1FRD A;  3EHV A;  1V49 A;  2BPS A;  1EWY C;  2KN5 A;  1C3T A;  2MBB B;  1RM6 C;  2M4N A;  1MHX A;  1MVK A;  2DZI A;  1QLB B;  3I5J C;  4OHJ A;  3V61 A;  3FKY A;  1V1P A;  3LJ3 A;  3P42 A;  3Q8C A;  1UBI A;  2KN4 A;  4RNA A;  3V62 A;  3U52 E;  1ZDV A;  2K8H A;  1T5X D;  1XCQ L;  2JZZ A;  2FCQ A;  1DGJ A;  3ZW3 A;  2C5L C;  1SGH A;  1YN3 A;  3GOE A;  1UBQ A;  2MBH A;  3VTV A;  2IYD B;  2A4Z A;  4B6W A;  4J3O D;  3NRZ A;  3AUL A;  5GXG B;  1TKG A;  2SAK A;  1RRB A;  2DEN B;  1TS5 A;  1CK1 A;  1OQY A;  2WXH A;  3QIJ A;  1FCC C;  1UUP A;  3SHQ A;  3NZS A;  3AED B;  3NVY A;  4YT0 B;  1WM2 A;  2KQS A;  3R8B A;  4A90 A;  1TS3 A;  4K3B A;  4TUU A;  4MJS B;  2RDG A;  1QOB A;  1DOX A;  2WX1 A;  4FLH A;  5EE3 A;  2DYM A;  2CJN A;  4RGM A;  2ZNV B;  1ZE3 D;  3KW5 B;  2QIL A;  1C78 A;  3NVW A;  4RM9 A;  1E7P B;  2BKF A;  3DBH I;  4MSQ B;  1K53 A;  1EU3 A;  1HA5 A;  3JYU A;  2KJ6 A;  4LJO B;  2JQR B;  2FCS A;  4YTN B;  3ZDT A;  2PVG C;  3AI5 A;  2EKE C;  5D2M B;  4W9I A;  3SDL C;  2FBW B;  1WX9 A;  2MQJ A;  2YEP F;  4WJQ A;  2G3Q B;  4ZRJ A;  3ZXR A;  2ZPN A;  1WGH A;  2R2O A;  1AAR A;  2L76 A;  1WE7 A;  3OLM D;  2W54 A;  2JZP A;  1PDX A;  4GMV A;  3UI3 A;  5CTR C;  5IAA C;  3ZUN A;  2IO0 B;  3W1S C;  2INC C;  3ZNG C;  1E90 A;  1V5T A;  1E5W A;  4YWG G;  3H1U A;  2UWQ A;  2N9K A;  3SFE B;  1U4A A;  3R3M A;  1IYF A;  1LGR A;  3DBR B;  1UD7 A;  4IWQ A;  1F2R I;  5MPO A;  1EWC A;  2V0G A;  1WIA A;  1DYQ A;  1YN4 A;  3RNG C;  3N32 A;  1MPE A;  2CR5 A;  4BFR A;  1WWT A;  1OTR B;  2KFK A;  4KGS A;  2UU7 A;  2HD5 B;  2MBO A;  4WQO B;  1P3Q U;  1VJK A;  4NQL B;  1JWA D;  2JRH A;  2MSE D;  2LGY A;  1C1Y B;  3BWU D;  5T8I A;  1UWM A;  5BYR A;  4NPN A;  5C1Z A;  2BKR B;  1GNU A;  2LHE A;  1N62 A;  1MG8 A;  1M94 A;  2RSU A;  4W9D A;  3Q3M C;  1VZ7 A;  1RYJ A;  1QOF A;  3Q8E A;  3C19 A;  1L5P A;  3ECI A;  1HE8 A;  1V86 A;  2Z59 B;  3Q3F A;  2BQQ A;  2N9E B;  4M01 A;  1WGK A;  1WF9 A;  1FM0 D;  1V1P B;  4WWP A;  3GE3 C;  2D3C A;  2TSS A;  3U30 A;  2J0J A;  5D6J B;  1UZX B;  5AZH A;  1LM8 B;  1XLQ A;  3ZNZ B;  2KJH B;  1L4Z B;  3ETR A;  1VZ6 A;  4KSK C;  4H2A A;  1KM7 A;  4W9L A;  3TIX A;  2PMV A;  5E6N A;  3LB8 C;  3P4R B;  1WXS A;  5AZF A;  4AWJ A;  4HXD A;  2N9P C;  1KRH A;  1RAX A;  1OEY J;  1F9J A;  3EGR A;  4ICU A;  2K1F A;  3DOW A;  3DWG C;  3QAR A;  4KGT A;  1JCK B;  1PGB A;  4EFO A;  1I4H A;  2JT4 B;  4EE2 A;  2CU3 A;  2RR9 A;  2OOB B;  2KMM A;  2ZJD A;  2Z0D B;  2C60 A;  2WDR B;  1SB3 C;  1WH3 A;  3RNA C;  1F0Z A;  1ZP0 B;  1K52 A;  1WXQ A;  2NPT B;  3A1Q A;  2KMA A;  3HVD A;  4FN2 A;  3IFW B;  5D3I B;  4XGA B;  1SE4 A;  4NNJ B;  3H9D A;  2GBJ A;  1D5X C;  3Q6B A;  1B1Z A;  2VZK D;  3Q8F A;  4WQM A;  1AYF A;  1TTN A;  4I6N B;  3HRD D;  1HZ5 A;  3M3J A;  3M62 B;  2WDQ B;  3P4S B;  1C4P A;  4IWP A;  3ZKJ C;  2KQ7 A;  4IM0 A;  3HVZ A;  1F1H A;  4ZYN A;  3A33 B;  3W5V B;  5J18 A;  1QQR A;  1WZ3 A;  3NUH B;  4E71 A;  4GOC A;  3L17 A;  5C23 A;  1ESF A;  1JWM D;  3GZN B;  2JSV X;  3VVW B;  3T3O A;  3UGB B;  3B08 A;  2IO3 B;  1EO6 A;  2AQ2 B;  4ARC A;  3V6E B;  3QAQ A;  2QJL A;  2PTL A;  1WSP A;  1F77 A;  4R3D A;  5IP4 D;  1QIL A;  1VR9 A;  5IO9 A;  1SSN A;  4HCN B;  4OW0 A;  4YSY B;  1GB1 A;  2OJW A;  3VUW A;  2WXO A;  4LDT B;  2BYE A;  4LNN A;  1V2Y A;  3T3N A;  2HDE A;  2KXJ A;  1EF5 A;  1MI0 A;  1L0X B;  1N5X A;  1L7Y A;  3U8Z A;  4XWW A;  4KIK A;  1Z2M A;  1C76 A;  2DZJ A;  5L83 A;  1HTQ A;  3AEG B;  3R66 C;  4HRO A;  1E8Y A;  3I57 A;  3A4R A;  4K3C A;  2M1M A;  4DXF A;  3NS1 A;  3BK1 A;  2BBC A;  3AE3 B;  4RH6 A;  3IT4 B;  1FNU A;  1GPX A;  4ZYS A;  1E10 A;  2JF5 A;  2KZR A;  2L83 A;  4FAD A;  1KLG D;  1UNS A;  1D3Z A;  3ENE A;  3DBS A;  2DLB A;  1M4V A;  2QEJ C;  3H7P B;  4KDI C;  1PQS A;  1FRR A;  4RGO S;  4NAM A;  4YSX B;  5BYQ A;  5IOI A;  3IG3 A;  2WQY B;  3BZD B;  1L6U A;  4NJ7 A;  2ACZ B;  3WA0 A;  1OQQ A;  2WXQ A;  1F2R C;  4US8 A;  3Q14 C;  4DXA B;  5EE1 A;  2GB1 A;  2WS3 B;  2EKI A;  1NVI D;  2CKH B;  3D32 A;  1DOY A;  1R4M B;  2D11 A;  1ET6 A;  2HE7 A;  3TEY A;  1GAQ B;  1ZXH A;  1JQ4 A;  1MG4 A;  2H89 B;  2JXT A;  2B3A A;  2HJ1 A;  4PT5 A;  1TIF A;  3ZGZ A;  2FUH B;  2R2Q A;  2BWE S;  3ZRC A;  4IUM B;  3P2B A;  1SE9 A;  3KVF B;  3KLS X;  2LWP A;  3RZF A;  2CJO A;  3PSE B;  2ZVN A;  1ROE A;  4HCP B;  4IM2 A;  1KJT A;  3ZIM A;  1SXT A;  2REX A;  1XEE A;  1WGR A;  2BYV E;  3KH0 A;  4MJS A;  4A8X C;  4KKI A;  3B9J A;  2GMI C;  4JWS C;  5LNK 1;  4C7Y A;  2BS3 B;  3AB5 A;  4ZDV A;  2ONQ A;  2WHI A;  1SEB D;  2Y5C A;  4IKG A;  1RFA A;  2RMM A;  1VDV A;  2N7D A;  2IDY A;  2D2Q A;  2LVO A;  3DHH C;  3PZD A;  5DPW A;  4ANX A;  4FJZ A;  3AM9 A;  4ZHP A;  2LAS A;  2WXJ A;  2V9H A;  5AUI A;  1WXA A;  1C4A A;  2EEL A;  2K9X A;  2PEA A;  2LJI A;  2BB6 A;  3PO0 A;  2I1J A;  3TCA A;  1D5Z C;  4JL9 A;  3BIN A;  4BOZ B;  3AE1 B;  1XD3 B;  1P98 A;  2WDV B;  2KO3 A;  4DHJ D;  1JAL A;  4ANW A;  1JRO A;  5BMH A;  3VRA B;  2L1A A;  1EU4 A;  4KX6 B;  2YLM A;  4IC7 B;  4X57 B;  2WNM A;  3UIN B;  3SEB A;  1WGD A;  3VAW A;  2LMC A;  2IY0 B;  2LEK A;  4ANU A;  1P9D U;  1HZ6 A;  2M0X A;  3GS2 A;  3M95 A;  3IAS 1;  2N7E A;  5JXV A;  2KQ4 X;  4TSS A;  3OWE B;  1R4N I;  2CHZ A;  2KMC A;  4M8M A;  2KJR A;  4IG7 B;  2KDE B;  2DZK A;  3FIL B;  5DPR A;  4II3 B;  3AE6 B;  2J0M A;  3NOB A;  1WFY A;  5E6P A;  2KKC A;  5E6J A;  2NVU I;  2M19 A;  2ZCB A;  4MGK E;  1YD8 U;  1SE2 A;  1WR6 E;  2V4L A;  2KT7 A;  2N7J A;  3MC8 A;  4HDO A;  2NCN A;  2W55 A;  1L4D B;  4PYZ A;  4WAF A;  4N6E B;  1MJD A;  3MJW A;  3JW0 X;  2KD0 A;  1JWU D;  3MTN B;  2DYO A;  3N1Z C;  2W82 A;  3WCQ A;  1QZE A;  1SIJ A;  3IVF A;  1JWS D;  3ZJU A;  1HEZ E;  1WJU A;  4W9K A;  4YL8 A;  1A5R A;  2KAJ A;  1E6E B;  3WAM A;  2NS5 A;  1P1A A;  4KZC A;  4ZRK A;  1E7V A;  1WGG A;  1IUE A;  3UQB A;  4EOY A;  3KUD B;  4TQ0 A;  3W2D A;  2IO1 B;  3ZRF A;  4US9 A;  4XDD A;  4ASW C;  4XZ4 A;  3EEC A;  4ICV A;  1GC6 A;  3KQ4 A;  2YEP B;  4MM3 A;  5TR5 A;  5FR6 A;  4HPL B;  3IBE A;  1XO3 A;  3AE8 B;  1VRA B;  3MHZ A;  3ML8 A;  2KFJ A;  2RPV A;  3UIP B;  1RWS A;  4EUT A;  3ZYY X;  1IP9 A;  5KHQ A;  2KTF A;  2D3B A;  3RI7 C;  4WWM A;  2PIA A;  1WJN A;  2Y3A A;  2K22 A;  4GB9 A;  4MT5 A;  3A9K A;  2ZVO A;  3B2F A;  3MFG A;  2CHW A;  2NPT A;  1WJ6 A;  2DZM A;  3PLU A;  1YJ1 A;  4A3P A;  4FJY A;  2J42 A;  3WAP A;  2XN9 C;  2L3Z A;  4JLC A;  3BYT B;  3TL5 A;  3J9C A;  3RNE C;  1EM7 A;  3BII D;  3NZU A;  4HVB A;  2Y5P A;  3RUL A;  4XE0 A;  2GOW A;  4JIO U;  4C56 C;  1I42 A; 
#chains in the Genus database with same CATH homology
 4FJV B;  5L95 C;  4DWF A;  4EFO A;  1WX8 A;  5DPT A;  3DDC B;  3QQ8 B;  4DHZ B;  3DPD A;  3LDZ E;  1G6J A;  3WIM A;  2JT4 B;  2N1W A;  3M63 B;  2K8B A;  2RR9 A;  5D7G A;  1J19 A;  2OOB B;  3SD5 A;  2ZPY A;  2ZJD A;  2MWS B;  4OVU A;  2Z0D B;  1V6E A;  2C60 A;  4RMA A;  2MX2 A;  4FA6 A;  1WH3 A;  2NPT B;  1KLV A;  2G45 B;  1V5O A;  3A1Q A;  4NAW A;  2KX0 A;  2KMA A;  4FN2 A;  1UGM A;  2M8S A;  1WMH A;  4OVV A;  3IFW B;  2KNB A;  3PTF C;  3X0W A;  3OJ3 A;  2BGF A;  2KLC A;  2CHX A;  4NNJ B;  3PRP B;  4BOS C;  3MHS D;  3W1S A;  2D10 A;  3H9D A;  1SIF A;  2GBJ A;  4W9J A;  3QC8 B;  3A9J A;  5AEK B;  3IHP C;  2O2V A;  2QHO A;  4BKS A;  4B95 A;  3U7D A;  3VXW A;  1FXT B;  1WXM A;  1TTN A;  4I6N B;  2LXC A;  3M3J A;  3GZN I;  4RM8 A;  3RZW C;  1WZ0 A;  3M62 B;  2HJ8 A;  2JPH A;  4IWP A;  3ZKJ C;  2WWZ A;  1UEL A;  2KQ7 A;  4IM0 A;  3PRE A;  3NS8 A;  4ZYN A;  4DDG D;  3A33 B;  4P7I A;  5J18 A;  1WZ3 A;  1XT9 B;  3CF6 E;  2WDT B;  4K7W A;  4E71 A;  4BBN F;  4BKT A;  1WY8 A;  4GOC A;  4HJK A;  4II2 B;  3L17 A;  5C23 A;  2JVC A;  2BYF A;  2V1Y A;  2V3S A;  1GC7 A;  2ZCC A;  3VVW B;  3UGB B;  3B08 A;  2IO3 B;  1EO6 A;  3A1Q B;  2LJ5 A;  5CHF A;  4GDL A;  1ZGU B;  2DX5 B;  3L0W B;  3L08 A;  3V6E B;  2BF8 B;  3QAQ A;  3V60 A;  3VUY A;  1K8R B;  1V9J A;  1GG3 A;  3N3K B;  2O6V B;  3L10 B;  1V80 A;  4G0N B;  3TBL D;  2EMS A;  3K9O B;  3HK0 A;  4PS8 A;  4EZL A;  2JRI B;  2K8C A;  2IBI B;  2ZEQ A;  4N9F 4;  3A9J B;  4G50 A;  1WE6 A;  4HCN B;  2O2V B;  3TJP A;  3V6C B;  3ONS A;  2K6Q A;  4MGI E;  1Q1O A;  1YX5 B;  2ZNV C;  2CU1 A;  3VUW A;  4W9H A;  4A3O A;  5JH5 C;  4LDT B;  2BYE A;  5EDS A;  1V2Y A;  3ZVV A;  2KXJ A;  4DK5 A;  1EF5 A;  5DPS A;  3APF A;  2FCN A;  2RD0 A;  3PRM B;  2GBR A;  3A4S C;  3H7P A;  1L7Y A;  3U8Z A;  2BWF A;  3RD2 A;  3DVG X;  3H6N A;  4KIK A;  4AOF A;  1IPG A;  2KK8 A;  1Z2M A;  1WJ4 A;  3PPA A;  2DZJ A;  4B9K A;  2LRU A;  3NY5 A;  5L83 A;  4MEM A;  2YVC A;  2ASQ A;  4HWI B;  3R66 C;  2IO2 B;  1E8Y A;  4GDL B;  4IM3 A;  2AYO B;  3EFU A;  5CX3 A;  4XC2 A;  4A20 A;  2VRR B;  1NBF C;  3A4R A;  4IW0 A;  4CO7 A;  2L8J A;  4MGZ E;  4TKN A;  5JZE B;  1ZW7 A;  1E8Z A;  3UIO B;  2M1M A;  2XEW A;  1WYW B;  2D07 B;  1WR1 A;  2KAN A;  3VHT C;  4MEL A;  1LFD A;  4KV2 A;  2JF5 A;  3ZNI D;  2AL6 A;  2KZR A;  2NBW B;  2N1V A;  4FAD A;  1P0R A;  3SU8 X;  2FAZ A;  3K9P B;  1OEY A;  1D3Z A;  3ENE A;  3A9K B;  3DBS A;  4HPM B;  3EC8 A;  2PPH A;  3H7P B;  4I6L B;  2JZ3 B;  4KDI C;  1PQS A;  1EUV B;  2MA9 B;  5G55 A;  2M17 A;  4KIK B;  4W9F A;  2KWC A;  3DBL I;  4PYU A;  4MDK E;  1VD2 A;  3RYT A;  4E74 A;  1BT0 A;  2J0K A;  4I6P A;  2MP2 A;  3IG3 A;  4M8N A;  4CYE A;  4WJO A;  1R4M I;  3ZTD A;  3JSV A;  3PGE A;  3PVL A;  3QA8 A;  4NJ7 A;  2LRW A;  3VFK A;  3WA0 A;  1TBE A;  3WAN A;  4FBJ B;  2GBN A;  2RGF A;  1ZKH A;  2O6V D;  3VQI A;  2EMT A;  1LXD A;  3WAL A;  4DHJ B;  4DXA B;  1XQQ A;  2UYZ B;  5E6O A;  2L00 B;  2IY1 B;  2CKH B;  3D32 A;  3VH4 B;  2JUO A;  2I1K A;  1H4R A;  2XK5 B;  4MGY E;  2D11 A;  2HE7 A;  4HDQ A;  3RCZ A;  4LDT D;  4GSW A;  3QX1 A;  2N9X A;  4W9E A;  3ZDM C;  1WM3 A;  2PE9 A;  2B3A A;  4GIV A;  3R7Q A;  2KWU B;  4KSL C;  4M0W B;  2GBM A;  3O65 B;  4MSM B;  2LXA A;  3EHV A;  2FUH B;  1E8X A;  2R2Q A;  2BWE S;  1V49 A;  2BPS A;  3ZRC A;  3I3T B;  2KN5 A;  4IUM B;  3P2B A;  2LGD A;  3KUC B;  1C3T A;  4JGH B;  1SE9 A;  3UQA A;  3KVF B;  2DYB A;  2MBB B;  3ZTC A;  2MRP A;  3ZO5 B;  2M4N A;  2LWP A;  5G2N A;  3DQV A;  3WAO A;  4NAW B;  3N30 A;  2DZI A;  3B1L X;  3RZF A;  2DAJ A;  1WMH B;  3QCA A;  4NJ6 A;  3VTW A;  3X23 A;  3PSE B;  3JSV B;  2ZVN A;  3V61 A;  2XBB C;  5JHA A;  3PT2 B;  1E8W A;  4TV3 A;  4HCP B;  4IM2 A;  1KJT A;  3ZIM A;  4K1R B;  3LJ3 A;  2REX A;  1WGR A;  2BYV E;  2KTR A;  3KH0 A;  1UBI A;  3ALB A;  4MJS A;  2W9N A;  3T9L A;  4BKG A;  3VUX A;  4EEW A;  2GMI C;  1OGW A;  2KOX A;  5D94 A;  3V62 A;  3QWZ B;  3HIZ A;  4ZDV A;  3APC A;  3VTU A;  4WAA A;  4EZK A;  2K8H A;  2JZZ A;  3CST A;  5HKH A;  1RFA A;  2FCQ A;  4KVG B;  3OJ4 B;  2HTH A;  3ZW3 A;  2C5L C;  2MBE A;  1SGH A;  2KDF B;  3GOE A;  1UBQ A;  2MBH A;  2N7D A;  2D2Q A;  2D3G A;  2KDI A;  2LVO A;  2OJR A;  3PZD A;  5DPW A;  4ANX A;  1J8C A;  4EZJ A;  4FJZ A;  1Z5S B;  3VTV A;  2IYD B;  3PHW B;  2A4Z A;  2LAS A;  5DCN A;  4B6W A;  4AUQ C;  4IWO A;  5J2R A;  1YIW A;  1WXA A;  3AUL A;  2PEA A;  4GGQ A;  4K81 A;  1RRB A;  1WI0 A;  2DEN B;  2L05 A;  1OQY A;  2NBU A;  2I1J A;  3TCA A;  3L13 A;  4BVU C;  3QIJ A;  4JL9 A;  2PE6 B;  3BIN A;  3SHQ A;  3NZS A;  2J7Q B;  1XD3 B;  4BOZ B;  4DBG A;  1Y8R C;  1P98 A;  3ZLZ A;  4E3C A;  4DHJ D;  2KO3 A;  3PV1 A;  1WM2 A;  2AWT A;  1GUA B;  2KQS A;  4TQ1 A;  4TUU A;  4ANW A;  4MJS B;  2C7N B;  2LVP A;  1GJZ A;  1WX7 A;  2YLM A;  4IC7 B;  2WX0 A;  4X57 B;  2WX1 A;  4FLH A;  4AP4 C;  2C7H A;  2DYM A;  2C7M B;  3DVN U;  3PS6 A;  2AL3 A;  4LJP B;  3VDZ A;  2AEH A;  4FHJ A;  3UIN B;  4FUL A;  1WGD A;  2IZV B;  3VAW A;  3PRZ A;  5LLI A;  2ZNV B;  2IY0 B;  3DCG A;  3DVN V;  4ANU A;  3KW5 B;  1P9D U;  4GU2 A;  4RM9 A;  4WWO A;  3W1Y A;  2BKF A;  4NY0 A;  3DBH I;  4W9G A;  2M0X A;  4MSQ B;  3M95 A;  4K7U A;  2N7E A;  3Q3J A;  2KLG A;  3JYU A;  5CHV C;  2KJ6 A;  4HLE A;  4LJO B;  2K39 A;  2Y5B B;  1T0Y A;  4F8C B;  2FCS A;  3ZDT A;  1R4N I;  2GBK A;  1I35 A;  2CHZ A;  2EKE C;  2KMC A;  3AI5 A;  4M8M A;  2A5U A;  5D2M B;  2LGX A;  2KJR A;  4W9I A;  3SDL C;  4IG7 B;  2KDE B;  2DZK A;  2KVR A;  1WX9 A;  3BY4 B;  2MQJ A;  1YQB A;  5DPR A;  4K7S A;  3H7S A;  4II3 B;  2J0M A;  4JQW C;  2G3Q B;  1WFY A;  3NOB A;  4WJQ A;  2ZPN A;  4ZRJ A;  5E6P A;  1WGH A;  2R2O A;  1TGZ B;  1AAR A;  2L76 A;  1WE7 A;  2RPQ A;  3ZNH B;  3RUI B;  2KKC A;  3OLM D;  2NVU I;  3C0R B;  4GN1 A;  1H8C A;  2ZCB A;  2PJH A;  3DBR I;  4BKS D;  2FCM A;  1YD8 U;  4GMV A;  2G4D B;  4MGK E;  1WR6 E;  2V4L A;  3L54 A;  4HDO A;  5BO4 B;  3QK0 A;  2NCN A;  5CTR C;  4PYZ A;  5IAA C;  2IO0 B;  4W9C A;  3W1S C;  3ZUN A;  3ZNG C;  1E90 A;  1V5T A;  3MJW A;  2O6V A;  2MBQ A;  3JVZ X;  3PHX B;  1E5W A;  3JW0 X;  3H1U A;  2KD0 A;  2UWQ A;  3L16 A;  3QHT A;  4ZRI A;  3HM3 A;  1U4A A;  3R3M A;  1CMX B;  3DVG Y;  4ANV A;  3MTN B;  3S2A A;  5JHB A;  1IYF A;  2DYO A;  1QZE A;  4F7Z A;  1UD7 A;  3IVF A;  4IWQ A;  1E7U A;  2K6D B;  2JWZ A;  2MW5 A;  1WRD B;  1WJU A;  2KC2 A;  4W9K A;  4YL8 A;  4AJW A;  4DHZ E;  1A5R A;  1WIA A;  2LUE A;  1TZ1 A;  3N32 A;  2LD9 A;  2MP2 B;  2NS5 A;  3KYD D;  3WAM A;  2CR5 A;  1P1A A;  4KZC A;  4BFR A;  3R7R A;  1V81 A;  1E7V A;  1WGG A;  3PLV A;  1UH6 A;  1OTR B;  2KFK A;  4ZRK A;  3UQB A;  4EOY A;  1X1M A;  3KUD B;  4TQ0 A;  2HD5 B;  2MBO A;  4WQO B;  2IO1 B;  3ZRF A;  2KHW B;  4ASW C;  1P3Q U;  4XZ4 A;  4HK2 A;  4NQL B;  2C9W B;  4GDK A;  4WJN A;  2JRH A;  2L7R A;  3EEC A;  3AXC A;  4ICV A;  4URK A;  5J17 A;  2WYQ A;  5CHW A;  1VCB A;  2FNJ B;  2MSE D;  1J0G A;  2NR2 A;  2LGY A;  1C1Y B;  1GC6 A;  1NDD A;  2DAF A;  4WWN A;  4XX5 A;  1NI2 A;  1Q5W B;  4DDI D;  3HHM A;  2FIF A;  4MM3 A;  4NPN A;  4NQK E;  2L0F A;  2BKR B;  5GMV A;  5TR5 A;  4BBN C;  5C1Z A;  5FR6 A;  5LXH A;  1GNU A;  4EKU A;  4HPL B;  1RLF A;  3QJZ A;  4LCD E;  3IBE A;  2MLB A;  1MG8 A;  4GXB A;  4AJY B;  4FHK A;  3ML8 A;  1YX6 B;  1M94 A;  2KFJ A;  2RSU A;  4W9D A;  3UIP B;  3APD A;  4EUT A;  2JY6 A;  2MCN B;  1IP9 A;  2KWV B;  5AZG A;  2LI5 A;  1Q0W B;  5KHQ A;  2KDB A;  2KTF A;  4MH0 E;  5LXI B;  4CHK A;  1S1Q B;  4KDL B;  2K25 A;  1HE8 A;  3ECI A;  1V86 A;  2Z59 B;  3ML9 A;  3Q3F A;  4J6I A;  1WJN A;  3RT3 B;  4GB9 A;  2N9E B;  3A9K A;  4G11 A;  2ZVO A;  1WF9 A;  3KYC D;  2NBV B;  2KFK B;  1JRU A;  4WWP A;  3HM6 X;  2CHW A;  2KX3 A;  3KUZ A;  4PS3 A;  3CMM B;  2KTR B;  4PS7 A;  2Z0E B;  2G4S A;  2LZ6 A;  4G3X B;  1WGY A;  4GDK B;  3U30 A;  2J0J A;  2JXX A;  3VH3 B;  1LQB A;  2NPT A;  1UZX B;  5D6J B;  1WJ6 A;  2DZM A;  3PLU A;  1YJ1 A;  2DHZ A;  5AZH A;  2ZZP B;  1LM8 B;  3T8M A;  4KZ0 A;  4A3P A;  3ZNZ B;  4FJY A;  3AU5 A;  3NHE B;  2KJH B;  5KHO A;  2N4F A;  3WAP A;  2L0T A;  1S3S G;  4KSK C;  2L3Z A;  1KM7 A;  4JLC A;  4W9L A;  3CSF A;  2CS4 A;  2LVQ A;  3TIX A;  3TL5 A;  1ISN A;  4F1S A;  3UF8 A;  2KC1 A;  5E6N A;  1WXS A;  1WXV A;  5AZF A;  3OAW A;  4AWJ A;  4WJP A;  1L2N A;  3NZU A;  1EF1 A;  2N9P C;  4HXD A;  3AU4 A;  4HVB A;  1RAX A;  1OEY J;  3RUL A;  2GOW A;  1F9J A;  4ICU A;  1KOT A;  2K1F A;  3DOW A;  3B0A A;  2XK5 A;  5IA7 A;  3QAR A;  4JIO U;  2FID A;  1I42 A;  3TMP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...