5IP4D

X-ray structure of the c-terminal domain of human doublecortin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
80
structure length
80
Chain Sequence
KDFVRPKLVTIIRSGVKPRKAVRVLLNKKTAHSFEQVLTDITEAIKLETGVVKKLYTLDGKQVTCLHDFFGDDDVFIACG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords XA4551 NANOBODY AGAINST C-DCX
publication title Crystal Structures of the Human Doublecortin C- and N-terminal Domains in Complex with Specific Antibodies.
pubmed doi rcsb
source organism Lama glama
total genus 17
structure length 80
sequence length 80
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF03607 DCX Doublecortin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.230 Alpha Beta Roll Ubiquitin-like (UB roll) Doublecortin domain 5ip4D00
1MFWA 2DNFA 5IKCM 2BQQA 5IOIA 5IN7A 5IO9A 1UF0A 5IP4D 1MG4A 1MJDA
chains in the Genus database with same CATH superfamily
5EE9A 2ZW1A 3LB8C 1GC6A 2J0KA 3B2GA 2PPHA 1JALA 1QOBA 1SE2A 4FHKA 1HA5A 4IM2A 3JVZX 3Q2AC 2BT6A 2V3SA 4C7ZA 4P1CC 1AWDA 1UNSA 3ENEA 3ZXRA 2FE8A 4WAFA 1F77A 1TYGB 4XWWA 2G4DB 1SSNA 5IOIA 2DENB 3MC8A 3OJ3A 2LRWA 2R2QA 5BMGA 2KTFA 3A9KB 5C3JB 3MFGA 2MBBB 4G11A 2KC2A 3K9OB 3RNEC 2REXA 3QC8B 3U4EG 1V1PB 3IAM1 3M3JA 2VRRB 5CX3A 4FJVB 2LGDA 5J18A 1AARA 2ZNVC 3H7PB 1ZGUB 1IP9A 3ZGZA 1QOAA 2IBIB 1YNTE 3OG5A 4WQMA 1TJEA 4DDGD 4RFBA 3VR9B 3FILA 5D2MB 5BMIA 3C0RB 2M8SA 2DZIA 3Q3MC 2OHFA 2AL3A 2RSUA 1QILA 1XLQA 2JY6A 3TBLD 1B9RA 4K3BA 1FMAD 1WGDA 3HM3A 1QOFA 1GNUA 3I63C 4ZYSA 1F2RI 2XBBC 3NUHB 3GS2A 4XWTA 3ZNHB 3TCAA 3JW0X 2I38A 3PRMB 2W54A 1E9MA 2KVRA 3KYCD 3QQ8B 3LYYA 4ZRIA 1FCLA 1OFFA 4BKGA 2C7HA 2KC1A 4FADA 1KOTA 1XCQL 3U30A 3R3MA 3QIJA 1P98A 2I1JA 1WXSA 4AUQC 1RRBA 3DVNU 4LNOA 5IN7A 1R4MI 4LTUA 4IOIE 2KHWB 4HJKA 4HKQA 3TEXA 2YLMA 3KLSX 4YWGG 5EE0A 4L23A 1R7SA 3CWIA 2PJHA 1TIFA 4GN1A 2DYMA 4AS1A 2WXQA 4TUUA 3EA6A 2FCQA 1PQSA 5DPTA 3AEDB 2KQ7A 1WF9A 2KO3A 2QMTA 5AZHA 3Q8BA 2JSVX 2DNFA 2WX0A 4REZA 1XT9B 3QAQA 2KN5A 2FCSA 3DQVA 1WR1A 3QCAA 4HPMB 3X0WA 3PZ7A 4US9A 4E3CA 3H9DA 3Q8FA 1UWMA 5LXHA 1WGYA 2HDEA 4QAYA 4BKTA 3CIRB 2GB1A 1MHXA 3FILB 2JF5A 4M01A 3NVZA 3LDZE 5E6OA 1QKZA 2LWPA 2IY0B 2BPSA 1T0YA 5HFYA 2BTEA 4MSQB 2JQRB 2Q5WD 2CKHB 4H2AA 1WXMA 1I35A 1PGXA 2WXOA 1IGCA 2N9PC 3P4SB 2J53A 1OEYA 3EC8A 4IM0A 4JWUC 1E8WA 5JZEB 2DHZA 3NZUA 3IT6B 2VZKD 5EDSA 4MH0E 2E6XA 2Y5BB 4BOZB 2TSSA 3PZDA 3ZW3A 4LJPB 2GBNA 4DXAB 3APCA 2MA9B 3AEAB 1ZOYB 3ALBA 4OHJA 2QEJC 4JPSA 1V6EA 2N7EA 3AB5A 4YSZB 1JRPA 3R8BA 3FAHA 3DVGX 3L4PA 2C7NB 5J17A 3S2AA 1BUIC 2WXGA 4ICVA 2KT7A 4K7WA 3SR6A 1KFYB 2JUOA 4IW0A 4F1SA 2LXAA 3VAWA 3FC4A 3ZLZA 4L2YA 1YX5B 4A55A 3SDLC 1TY2A 4S0RA 3KUDB 1D4BA 4A9AA 1JMLA 4M00A 3UINB 4WAAA 2WP9B 2NTTA 1A5RA 3Q3NC 4PK1A 1K51A 3IT4B 2LMCA 4KDLB 1ZKHA 3Q3JA 3EFCA 2MP2A 1K53A 3ZNID 2X38A 3N3KB 3B2FA 1I4RA 3KWLA 2W3RA 4KV2A 1EO6A 2MCNB 4JWSC 2PIAA 2G4SA 3UQBA 1F1HA 5JHAA 2WXMA 4IWOA 2CS4A 3MC0B 4NPNA 4F8CB 1RM6C 3CMMB 3U2SC 2C5LC 4EFOA 1EM7A 2FCNA 5LNK1 3PRPB 1ISNA 3RFZB 2QSDA 2DYOA 3SFDB 1N61A 2O6VB 1NBFC 2XNAC 4M8MA 3DVGY 3DOWA 2MJDA 5H8YE 4K81A 2LASA 2LZ6A 3DBRI 1LO5D 1TS4A 2N9EB 4GMVA 2I1KA 2IY1B 3RULA 2A5UA 3CSFA 4N9F4 3ZNZB 2H88B 2ZJDA 1FD6A 1N5XA 2WXIA 1HZ6A 3PSEB 2FCMA 4DQOC 1G6JA 2L00B 2ZCBA 4GU2A 4WJPA 2D11A 4MELA 3N32A 4BOSC 3DBHB 1RWSA 2LUMA 4MM3B 3A33B 2WXFA 4GIVA 3RNCC 3MJWA 2ICIA 4B6WA 4W9KA 3DBLI 3MC9A 2K5PA 4MJSB 2FIFA 5GXGB 1UF0A 4C7YA 1TGZB 4PS7A 1TT5B 1IBXB 2ZZPB 3AH7A 3HRDD 2E3TA 4HKZE 2Y5CA 2AQ3B 1J19A 4TMAB 1T0RC 2I2YA 3RMKC 2MP2B 4EE2A 4HEA1 3NZ3A 1SB3C 1MFWA 1YD8U 2CR5A 3R7RA 2JRHA 4KGTA 1C77A 2N1VA 4TSSA 3R2TA 3B1LX 4RNAA 5GMVA 3GP7A 3ZTDA 2DZMA 3AV8A 1XD3B 1WH3A 3ZTCA 3ML9A 1YIWA 3WAOA 3VVWB 2KMMA 3DVNV 3PTFC 2AEHA 4WJNA 5CHVC 1I7HA 1K52A 3HM6X 2WDRB 3N20C 1YQ4B 2WWZA 2M56B 1TTNA 3QHTA 4GXBA 3H7SA 4XDCA 2OEDA 1GB4A 2IGGA 4DHZB 4OVUA 1N6ZA 3VTWA 3ML8A 3R7QA 2L8JA 3SHQA 2JWZA 5CHWA 1YN4A 3KUCB 2G45B 4YXDB 2N7JA 4FN2A 1GG3A 1I4QA 2LGSA 3SU8X 4MEMA 1V81A 2SAKA 1FRDA 2RDHA 1HXYD 1XLOA 3A9KA 1JQ4A 1SJED 2INCC 4XZ4A 2KDEB 5C1ZA 2RR9A 5DCNA 1V1PA 1C78A 4UDUC 2D3BA 3V3XA 4NJ6A 1SF0A 5G5GA 3DBSA 2HD5B 2JPHA 5L83A 3H7PA 4ITKA 3ZJUA 4L1BA 1XEEA 2J4XA 3V61A 4N59A 4IWQA 3ZO5B 3O65B 3P4PB 2G1EA 2WGSA 3W1SA 2CJOA 1BMLC 1F52A 4WJOA 3OWEB 4USAA 2V3NA 4JIOU 4W9FA 1FPYA 1ZDXA 2BKFA 1YJJA 4I6LB 1K8RB 1WJUA 1FCCC 4JQWC 1H4RA 2YEPF 1BXTA 2BYVE 2LVOA 1HQRD 4NAWA 2INPE 4NJ7A 5E6JA 3QK0A 2OJWA 4F7ZA 2IGDA 2IZVB 5FR3A 2JYTA 4WWPA 4HVBA 2R61A 4LNKA 4IDIA 1SE9A 3E56A 2M17A 3PHWB 1WM3A 1CK1A 4GGQA 2W55A 4NNJB 4ANXA 5EE1A 3Q8EA 2BS2B 4YTMB 3DCGA 3C19A 5TSSA 3RI7C 3N9YC 4XE0A 2QIEB 2WXNA 3WA0A 3VFKA 4WWMA 1WJ6A 1N63A 5CHFA 2D07B 3AE4B 3UIOB 3AE2B 1E7UA 1WMHB 2MBOA 1NEKB 2BBCA 2FAZA 3RZWC 5KHQA 2CHXA 2MLBA 3ZVVA 1WZ3A 2WNMA 3RPFC 1WM2A 3DPDA 2L76A 2M0XA 3IFWB 4ZRPA 4FULA 3D32A 2JRIB 1TBEA 1DOYA 1WFYA 5AZGA 3BY4B 3OJ4B 4AWJA 1UH6A 2WXRA 4J6IA 2AYOB 4HCNB 1T3QA 2ASQA 2N0SB 2PVOD 2BW2A 3PT2B 3LJ3A 3W5VB 4YSYB 2DAJA 1HEZE 3WCQA 2M19A 2ZW0A 4GB9A 3OLMD 5E6PA 1VZ8A 2JXXA 2RMMA 1CZPA 2KDBA 1VD2A 2IO3B 3EHVA 2KX3A 2Z8LA 3X23A 2NBVB 2WYQA 2XK5B 1PGBA 1U4AA 2GLSA 1V5TA 4XDDA 3OAWA 3NHEB 2MHJA 3A1QB 1WY8A 3DHGC 5CTRC 2KANA 4NAWB 2KOXA 3IHPC 3ZNGC 1R4NI 1E8ZA 2JT4B 2KACA 4WIPA 2KK8A 2IJ0A 3AE5B 1P1AA 3PO0A 2LVQA 4RF0A 3HK0A 3TMPB 4GLSC 2WHIA 5BMHA 4JX1C 4LLGM 2GI9A 4A6QA 4C56C 1HTQA 5D6JB 2D2QA 1FRRA 3ETRA 4EKUA 1MG4A 4GDKB 1L6UA 1WX9A 1J7BA 4TQ1A 1P7FA 5D3DA 2LRUA 1WE7A 3HUIA 1GB1A 3N1YC 4ZHPA 1GC7A 1DOXA 4I6NB 1KLUD 2ON8A 3TEWA 1Z2MA 1C4PA 2IDYA 4KDIC 2L52A 2BWES 4RF1A 1E8XA 1SGHA 1E7VA 3SFEB 3TL5A 2L05A 1J0GA 2BYTA 3BINA 2L32A 4IUMB 2MBQA 1ZE3D 1KF6B 4ARCA 2DLBA 4MGIE 3AE3B 2J0MA 2O6VD 4II2B 3NS1A 3Q8CA 2MSED 3H8HA 1T6BX 1RFKA 1LM8B 1EUVB 1YQBA 1I42A 1C4AA 4CQNA 2WXHA 3P4RB 3PZ8A 3P42A 3MJ5A 1WXVA 3Q6BA 3LXFA 4GDLB 4RGMA 1R4MB 1WJ4A 2QILA 2NTSA 5IP4D 3T8MA 2O6VA 1IUEA 3U52E 4OZAA 2ONQA 3BZDB 1C4CA 4DK5A 4M8NA 3EUB2 4W9EA 4DXFA 1NENB 4W9HA 1NVID 2QCZA 2K39A 1GPXA 2AQ2B 2V1YA 3UIPB 3TUOA 1DYQA 4WWNA 3ZJVA 1MHHE 1JROA 2EMSA 5TR5A 3A9JB 4ZRQA 5IKCM 4MGZE 5DPRA 4LNIA 4XGAB 2KFKA 1SEBD 1FXAA 5AUIA 1XXGA 4BBNC 3P4QB 2AWTA 1HZ5A 3E9SA 4IKGA 3L13A 1FO4A 3B9JA 4HROA 3PLVA 4KKJA 3AN1A 4DBGA 2KWUB 3AEBB 2INNE 2L0TA 4DHJB 2O2VA 4MM3A 1GOZA 4ACFA 3RUIB 2RDBC 2KWVB 1WJNA 2FIDA 2JZZA 3ZJTA 2J52A 3APFA 1S3SG 4MJSA 5G2NA 4KSLC 4NY0A 4ANUA 2HE7A 1IBXA 2N9KA 4CYEA 2GBJA 1Q1OA 3HVZA 5FR6A 3U7DA 1N5WA 1T0SC 4KGRA 1YQ3B 3TIXA 2LD9A 2KWDA 1UZXB 2Z0DB 4BVUC 4RM9A 1FIQA 1ESFA 3ZIMA 1L6VA 2J0JA 4K7SA 1I4XA 1WWTA 2MWSB 1LXDA 2W9NA 1H8CA 4WURA 2EMTA 4HLEA 3BYYB 4JE3B 2KZRA 2L7RA 1WGKA 1VDVA 2ZEQA 1KLVA 2JU6X 4OZBA 1X1MA 5LLIA 1KLGD 3C8YA 1WGHA 4ZRKA 1WE6A 1V49A 1TZ1A 1MG8A 5H92C 2W82A 3IVFA 3QJZA 1DGJA 2MEKA 1WXQA 4II3B 1V9JA 3NY5A 4C4VB 4MT5A 2KMAA 2PLPA 1VZ7A 4K3CA 4IM3A 2B76B 2G9HD 2MX2A 5DPSA 2DBYA 3P1MA 1ZDVA 3MTNB 1PYWD 1Q10A 1OQQA 1T5XD 3L0WB 4HJGE 3GB1A 2K6QA 2N1WA 2KFJA 3T3NA 2KFKB 2LEKA 1ZW7A 3PGEA 1Y8RC 1YMHE 1ZXIA 4R3DA 4LJOB 2BB6A 2KWCA 1QZEA 4AJYB 4GOCA 2LXCA 1I4HA 3O13A 1UGJA 2O2VB 1SJHD 3NG0A 4MACA 3NS8A 1ZPSA 1JWMD 2BWFA 1V86A 2K8HA 1E6EB 1JWAD 2HTME 3VHTC 2JWUA 2LJ5A 3RYTA 2MQJA 4HRSA 1N62A 1I4PA 1I4GA 2PE9A 3DBRB 1M94A 5IAAC 1FFUA 2LGIA 4DDID 3RZFA 1WGRA 2RDGA 2K6DB 3KQ4A 3KW5B 5EE3A 4FBJB 1P7EA 3WIMA 4E71A 1E7PB 2LI5A 5DPWA 1F0ZA 4B0EA 4S17A 2KN4A 2VH1A 3VUWA 1NDDA 5BYQA 3IXSA 1LGRA 4YSXB 2QC8A 4NQLB 3I3TB 1ACCA 2N7DA 3TEZA 2CHWA 2NS5A 1E0ZA 2CU3A 3JYUA 1E5WA 5HG2A 2WDTB 3PHXB 3DBLB 3TSSA 5D3IB 3V6CB 3W1YA 1ENFA 4PYZA 1OQYA 5J2RA 1Z5SB 1WIAA 1E90A 4EZKA 3AE7B 4PYUA 1VZ6A 1EU4A 3VTVA 1WMHA 2VH2A 1QOGA 2LFIA 2NBUA 2PKOA 1L0VB 4C80A 4EOYA 1MI0A 1VJKA 1OEYJ 5IO9A 2V4LA 3AULA 5FK9C 2JX5A 3UGBB 1C3TA 4BBNF 3I57A 3Q3FA 3GZNI 4NJCA 1TS3A 2K1FA 3W1SC 3FKYA 4FA6A 1KRHA 4D2KA 2KMCA 3KUZA 4PS8A 3B08A 1WRIA 2WXLA 3V60A 2KLGA 3UI3A 3RT3B 3NOBA 3ZRCA 4G50A 1XO3A 5G5HA 4AP4C 1IYFA 2BYFA 1Q5WB 2CHZA 2XK5A 2L3ZA 2FUG1 3HVDA 4RCOA 2M4NA 2V0GA 4KGSA 1E10A 1YJ1A 3BK1A 3A1QA 2XEWA 3W5UB 1SIJA 3V6EB 1FNWA 4W9LA 5C23A 1RAXA 1WYWB 3VR8B 2BB5A 4WWOA 1SBBB 2ZVNA 3CF6E 2DWQA 2PW9A 4HXDA 2KYWA 3BVGA 2BGFA 1YX6B 1RFAA 4CO7A 4HDQA 1KTKA 3QA8A 4XYCA 2MW5A 1SE4A 2K8CA 3DHHC 2J42A 2JVCA 2LGXA 3BWUD 1CMXB 5HHDG 3WANA 4GDKA 1J7CA 1CJEA 2G3QB 1NI3A 4FJZA 2KJHB 3RNAC 3AE1B 2EELA 3HHMA 2MBEA 3BK2A 4X57B 3AU4A 4KVGB 4AJWA 1JWBD 1L4DB 1XF5L 2DYBA 3L08A 3MHZA 1JCKB 1P9DU 2KQSA 3KH0A 2IGHA 1LQBA 4NAMA 1OTRB 4O1NA 2CJNA 3I5JC 2C9WB 3ZDTA 1WI0A 4YL8A 1L0XB 1NYQA 1PUTA 2D3GA 2JXTA 4P7IA 4LDTB 4LNNA 4K1RB 2YVCA 4FLHA 3GE8C 1WSPA 2HJ8A 2UU7A 3AXCA 1WX7A 1D5XC 4DHZE 2GBMA 1MJDA 2HTHA 1GAQB 4IWPA 3MP9A 4URKA 1AYFA 2A4ZA 1SIFA 3HIZA 3BVZA 1HTOA 2Y5PA 4GDLA 3ZRFA 1UWXA 3RNBC 1UUPA 4A8XC 4YTPB 1VCBA 2L83A 4DWFA 4EUTA 1UD7A 2DZJA 2QJLA 3DDCB 1FEHA 4P1BC 5MPOA 2FUHB 4FHJA 4ZHOA 2JZPA 3ONSA 4ZRJA 2JZ3B 3I9V1 1GJZA 2PTLA 4P16A 4JL9A 3WAPA 1OQRA 3QWZB 4DHJD 4I6PA 4B0MA 2SEBD 3A9JA 4HPLB 2N9XA 4RM8A 2QDFA 3M63B 2AX5A 4HDOA 4DXGA 1KJTA 2RD0A 4AQ7A 2EKEC 3DWMA 1EF5A 2BYEA 3NJTA 4E74A 1QT9A 3IG3A 1IPGA 4W9GA 4KIKB 2KDFB 1V8CA 5LXIB 1XCTL 3NVVA 5AEKB 3NZSA 2PE6B 4RMAA 2K9XA 3JSVB 1EWCA 2DAFA 2K3UA 3VUXA 4A90A 1ROEA 5G55A 2Z0EB 1FNUA 2ZPNA 4N58A 4XX5A 4OVVA 1P3QU 2AQ1B 2KX0A 2K25A 4TKNA 4A20A 4YTNB 2B3AA 3VTUA 2W3SA 1EWYC 2L1AA 1IGDA 1C9FA 2LGYA 1NI2A 1YJIA 4KX6B 1R4NB 2IYDB 2KKCA 1ET9A 3AE8B 5D94A 5JHBA 2GOWA 3BIID 2NCNA 4BAXA 3B0AA 1D3ZA 2LUEA 5T8IA 3NVYA 2RPQA 1V5OA 3RNGC 4XC2A 3AM9A 1WX8A 5L95C 4K7UA 2KJ6A 3MHSD 2FNJB 3RD2A 5FKAC 3R66C 1AW7A 4TV3A 2D3AA 4HK2A 1K50A 3P2BA 2M0AA 4IC7B 4C4VA 3N1ZC 2KJRA 5AUKA 3PV1A 3QARA 3VRAB 2DZKA 1JWUD 4US8A 4MGYE 1A70A 4LNFA 2BS4B 2ZNVB 2LVPA 4KZ0A 4MDKE 4W9CA 3VH3B 4W9JA 1QQRA 2GMIC 3KYDD 3VUYA 2C60A 2ZVOA 1WGGA 1FXTB 3T9LA 2WX1A 5JH5C 1L7YA 3J9CA 2NMQA 3AI5A 1TS2A 4Q2JA 4YT0B 1VLBA 2NR2A 4C00A 5BYSA 2WXKA 3PRZA 2WDVB 1HE8A 1EF1A 1JRUA 1RLFA 3BVMA 3KWVA 1L2NA 3A4RA 2GRIA 2MH7A 2NPTA 1YOVB 4M02A 3TEYA 1CQVA 2KNBA 4JLCA 4WQOB 3NRZA 3L17A 1M4VA 1YN3A 2IO0B 2WU5B 5HI1A 1E8YA 4LCDE 3L10B 4J3OD 3KVFB 3BYTB 2J7QB 2DX5B 3IAS1 3H6NA 2H89B 1TKEA 1F9JA 2QHOA 5E6NA 4M0WA 1B1ZA 4RGTA 3U8ZA 2WXJA 3ZQ4A 1V97A 4A3OA 4JGHB 1ZP0B 1TZOA 3ABVB 3VH4B 4HWIB 1MVKA 3V62A 2MBHA 2WDQB 2Y3AA 4BFRA 5BO4B 2N9LA 1AN8A 3M95A 1Q0WB 5KHOA 1Y56A 3N1XC 1J7AA 4MGKE 4FXCA 3DHIC 2XN9C 3W9CB 4WJQA 4EEWA 2FBWB 1FM0D 1C1YB 1UGMA 4B9KA 2C7MB 3U7ZA 4OVZA 2V4IB 1V1OA 2KD0A 1TKGA 2GBRA 3AE6B 2ACZB 2IO1B 4ZOHC 2OJRA 3AEEB 3UQAA 2KVZA 4ASWC 3DBHI 4IG7B 5C2TB 1WZ0A 2BQQA 3EFUA 4G3XB 2PVGC 3VDZA 1V2YA 2MRPA 5AZFA 2AL6A 2KDIA 1XLNA 4ICUA 1VR9A 3H1UA 3Q69A 4N6EB 3L16A 3EGRA 1WRDB 2OOBB 1OGWA 3Q8AA 1TS5A 5JXVA 3GE3C 2WU2B 1L4ZB 2K22A 3PREA 2PEAA 2WXPA 3ECIA 1QF6A 2BVCA 2NPTB 2LJIA 4ZDVA 1L0YB 4ANWA 1KM7A 1XLPA 3L54A 1GUAB 1DOIA 3K9PB 2KXJA 1MPEA 1P0RA 2LHDA 1L5PA 3VXWA 1LFDA 1UBIA 2K0PA 2VZKB 2UWQA 1N60A 4M0WB 4KZCA 2RPVA 2WQYB 4PT5A 3NVWA 3VQIA 2Z59B 3PLUA 2ZCCA 4ARIA 1ZUD2 2D10A 2MJ3A 2M1MA 2CU1A 4ZYNA 5IA7A 2BKRB 1YN5A 1SE3A 2YEPB 2HJ1A 3M62B 2KAJA 4TQ0A 2KTRA 4ANVA 3AEFB 1ET6A 1PGAA 3CSTA 4HPPA 1EU3A 1JWSD 3URYA 4AOFA 4LDTD 2BF8B 2PMVA 3VRBB 2LHEA 3PS6A 1PDXA 3PPAA 3IBEA 1FFVA 1D5ZC 3TJPA 3QX1A 3R2IA 1QLBB 4KKIA 4RGNA 3SEBA 3WAMA 3UF8A 2L0FA 3AECB 1C79A 4B95A 3APDA 1PFDA 1V80A 4LK0M 1T0QC 2EKIA 2NVUI 4OW0A 1FXIA 4EZJA 3Q14C 2KDMA 4NZLB 2MJEA 4RH6A 2RGFA 3A4SC 1WR6E 1FNVA 2WS3B 3V05A 4BZAA 1VRAB 3EECA 2V3PA 3WALA 3Q3OC 2D3CA 1KH0A 3SD5A 4PS3A 1TKYA 3GOEA 3ZYYX 2K8BA 3T3OA 5BYRA 3N30A 5D7GA 1J8CA 2D5GA 3AMZA 1D5MC 3RCZA 4EZLA 3RN9C 2V9HA 3AE9B 2GBKA 1ZXHA 2WLBA 5HKHA 2UYZB 2NBWB 4HCPB 4WH4A 1RYJA 4BKSD 3AU5A 1JW9D 2INDC 2X8XX 3W2DA 4CHKA 1XQQA 1NYRA 4G0NB 3GZNB 1BT0A 3ZKJC 3ZUNA 4NQKE 2R2OA 3P63A 1UBQA 2ZPYA 1UELA 1S1QB 4KIKA 4FJYA 4GSWA 2KTRB 4W9IA 4RGOS 4KSKC 3PVLA 3ZDMC 1C76A 3JSVA 3RNFC 2KQ4X 5I4DA 3ZXVA 1D6EC 4W9DA 4MSMB 1F2RC 4BKSA 2IO2B 4MH8A 1STEA 2N4FA 3DWGC 4A3PA 4P6VF 4OZCA 2KLCA 1WXAA 1SXTA 2IPKD 3AEGB 2JYEA 1TY0A 1WYGA 2BS3B
chains in the Genus database with same CATH topology
1MFWA 2DNFA 5IKCM 2BQQA 5IOIA 5IN7A 5IO9A 1UF0A 5IP4D 1MG4A 1MJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MFW A;  2DNF A;  5IKC M;  2BQQ A;  5IOI A;  5IN7 A;  5IO9 A;  1UF0 A;  5IP4 D;  1MG4 A;  1MJD A; 
#chains in the Genus database with same CATH topology
 5EE9 A;  2ZW1 A;  3LB8 C;  1GC6 A;  2J0K A;  3B2G A;  2PPH A;  1JAL A;  1QOB A;  1SE2 A;  4FHK A;  1HA5 A;  4IM2 A;  3JVZ X;  3Q2A C;  2BT6 A;  2V3S A;  4C7Z A;  4P1C C;  1AWD A;  1UNS A;  3ENE A;  3ZXR A;  2FE8 A;  4WAF A;  1F77 A;  1TYG B;  4XWW A;  2G4D B;  1SSN A;  5IOI A;  2DEN B;  3MC8 A;  3OJ3 A;  2LRW A;  2R2Q A;  5BMG A;  2KTF A;  3A9K B;  5C3J B;  3MFG A;  2MBB B;  4G11 A;  2KC2 A;  3K9O B;  3RNE C;  2REX A;  3QC8 B;  3U4E G;  1V1P B;  3IAM 1;  3M3J A;  2VRR B;  5CX3 A;  4FJV B;  2LGD A;  5J18 A;  1AAR A;  2ZNV C;  3H7P B;  1ZGU B;  1IP9 A;  3ZGZ A;  1QOA A;  2IBI B;  1YNT E;  3OG5 A;  4WQM A;  1TJE A;  4DDG D;  4RFB A;  3VR9 B;  3FIL A;  5D2M B;  5BMI A;  3C0R B;  2M8S A;  2DZI A;  3Q3M C;  2OHF A;  2AL3 A;  2RSU A;  1QIL A;  1XLQ A;  2JY6 A;  3TBL D;  1B9R A;  4K3B A;  1FMA D;  1WGD A;  3HM3 A;  1QOF A;  1GNU A;  3I63 C;  4ZYS A;  1F2R I;  2XBB C;  3NUH B;  3GS2 A;  4XWT A;  3ZNH B;  3TCA A;  3JW0 X;  2I38 A;  3PRM B;  2W54 A;  1E9M A;  2KVR A;  3KYC D;  3QQ8 B;  3LYY A;  4ZRI A;  1FCL A;  1OFF A;  4BKG A;  2C7H A;  2KC1 A;  4FAD A;  1KOT A;  1XCQ L;  3U30 A;  3R3M A;  3QIJ A;  1P98 A;  2I1J A;  1WXS A;  4AUQ C;  1RRB A;  3DVN U;  4LNO A;  5IN7 A;  1R4M I;  4LTU A;  4IOI E;  2KHW B;  4HJK A;  4HKQ A;  3TEX A;  2YLM A;  3KLS X;  4YWG G;  5EE0 A;  4L23 A;  1R7S A;  3CWI A;  2PJH A;  1TIF A;  4GN1 A;  2DYM A;  4AS1 A;  2WXQ A;  4TUU A;  3EA6 A;  2FCQ A;  1PQS A;  5DPT A;  3AED B;  2KQ7 A;  1WF9 A;  2KO3 A;  2QMT A;  5AZH A;  3Q8B A;  2JSV X;  2DNF A;  2WX0 A;  4REZ A;  1XT9 B;  3QAQ A;  2KN5 A;  2FCS A;  3DQV A;  1WR1 A;  3QCA A;  4HPM B;  3X0W A;  3PZ7 A;  4US9 A;  4E3C A;  3H9D A;  3Q8F A;  1UWM A;  5LXH A;  1WGY A;  2HDE A;  4QAY A;  4BKT A;  3CIR B;  2GB1 A;  1MHX A;  3FIL B;  2JF5 A;  4M01 A;  3NVZ A;  3LDZ E;  5E6O A;  1QKZ A;  2LWP A;  2IY0 B;  2BPS A;  1T0Y A;  5HFY A;  2BTE A;  4MSQ B;  2JQR B;  2Q5W D;  2CKH B;  4H2A A;  1WXM A;  1I35 A;  1PGX A;  2WXO A;  1IGC A;  2N9P C;  3P4S B;  2J53 A;  1OEY A;  3EC8 A;  4IM0 A;  4JWU C;  1E8W A;  5JZE B;  2DHZ A;  3NZU A;  3IT6 B;  2VZK D;  5EDS A;  4MH0 E;  2E6X A;  2Y5B B;  4BOZ B;  2TSS A;  3PZD A;  3ZW3 A;  4LJP B;  2GBN A;  4DXA B;  3APC A;  2MA9 B;  3AEA B;  1ZOY B;  3ALB A;  4OHJ A;  2QEJ C;  4JPS A;  1V6E A;  2N7E A;  3AB5 A;  4YSZ B;  1JRP A;  3R8B A;  3FAH A;  3DVG X;  3L4P A;  2C7N B;  5J17 A;  3S2A A;  1BUI C;  2WXG A;  4ICV A;  2KT7 A;  4K7W A;  3SR6 A;  1KFY B;  2JUO A;  4IW0 A;  4F1S A;  2LXA A;  3VAW A;  3FC4 A;  3ZLZ A;  4L2Y A;  1YX5 B;  4A55 A;  3SDL C;  1TY2 A;  4S0R A;  3KUD B;  1D4B A;  4A9A A;  1JML A;  4M00 A;  3UIN B;  4WAA A;  2WP9 B;  2NTT A;  1A5R A;  3Q3N C;  4PK1 A;  1K51 A;  3IT4 B;  2LMC A;  4KDL B;  1ZKH A;  3Q3J A;  3EFC A;  2MP2 A;  1K53 A;  3ZNI D;  2X38 A;  3N3K B;  3B2F A;  1I4R A;  3KWL A;  2W3R A;  4KV2 A;  1EO6 A;  2MCN B;  4JWS C;  2PIA A;  2G4S A;  3UQB A;  1F1H A;  5JHA A;  2WXM A;  4IWO A;  2CS4 A;  3MC0 B;  4NPN A;  4F8C B;  1RM6 C;  3CMM B;  3U2S C;  2C5L C;  4EFO A;  1EM7 A;  2FCN A;  5LNK 1;  3PRP B;  1ISN A;  3RFZ B;  2QSD A;  2DYO A;  3SFD B;  1N61 A;  2O6V B;  1NBF C;  2XNA C;  4M8M A;  3DVG Y;  3DOW A;  2MJD A;  5H8Y E;  4K81 A;  2LAS A;  2LZ6 A;  3DBR I;  1LO5 D;  1TS4 A;  2N9E B;  4GMV A;  2I1K A;  2IY1 B;  3RUL A;  2A5U A;  3CSF A;  4N9F 4;  3ZNZ B;  2H88 B;  2ZJD A;  1FD6 A;  1N5X A;  2WXI A;  1HZ6 A;  3PSE B;  2FCM A;  4DQO C;  1G6J A;  2L00 B;  2ZCB A;  4GU2 A;  4WJP A;  2D11 A;  4MEL A;  3N32 A;  4BOS C;  3DBH B;  1RWS A;  2LUM A;  4MM3 B;  3A33 B;  2WXF A;  4GIV A;  3RNC C;  3MJW A;  2ICI A;  4B6W A;  4W9K A;  3DBL I;  3MC9 A;  2K5P A;  4MJS B;  2FIF A;  5GXG B;  1UF0 A;  4C7Y A;  1TGZ B;  4PS7 A;  1TT5 B;  1IBX B;  2ZZP B;  3AH7 A;  3HRD D;  2E3T A;  4HKZ E;  2Y5C A;  2AQ3 B;  1J19 A;  4TMA B;  1T0R C;  2I2Y A;  3RMK C;  2MP2 B;  4EE2 A;  4HEA 1;  3NZ3 A;  1SB3 C;  1MFW A;  1YD8 U;  2CR5 A;  3R7R A;  2JRH A;  4KGT A;  1C77 A;  2N1V A;  4TSS A;  3R2T A;  3B1L X;  4RNA A;  5GMV A;  3GP7 A;  3ZTD A;  2DZM A;  3AV8 A;  1XD3 B;  1WH3 A;  3ZTC A;  3ML9 A;  1YIW A;  3WAO A;  3VVW B;  2KMM A;  3DVN V;  3PTF C;  2AEH A;  4WJN A;  5CHV C;  1I7H A;  1K52 A;  3HM6 X;  2WDR B;  3N20 C;  1YQ4 B;  2WWZ A;  2M56 B;  1TTN A;  3QHT A;  4GXB A;  3H7S A;  4XDC A;  2OED A;  1GB4 A;  2IGG A;  4DHZ B;  4OVU A;  1N6Z A;  3VTW A;  3ML8 A;  3R7Q A;  2L8J A;  3SHQ A;  2JWZ A;  5CHW A;  1YN4 A;  3KUC B;  2G45 B;  4YXD B;  2N7J A;  4FN2 A;  1GG3 A;  1I4Q A;  2LGS A;  3SU8 X;  4MEM A;  1V81 A;  2SAK A;  1FRD A;  2RDH A;  1HXY D;  1XLO A;  3A9K A;  1JQ4 A;  1SJE D;  2INC C;  4XZ4 A;  2KDE B;  5C1Z A;  2RR9 A;  5DCN A;  1V1P A;  1C78 A;  4UDU C;  2D3B A;  3V3X A;  4NJ6 A;  1SF0 A;  5G5G A;  3DBS A;  2HD5 B;  2JPH A;  5L83 A;  3H7P A;  4ITK A;  3ZJU A;  4L1B A;  1XEE A;  2J4X A;  3V61 A;  4N59 A;  4IWQ A;  3ZO5 B;  3O65 B;  3P4P B;  2G1E A;  2WGS A;  3W1S A;  2CJO A;  1BML C;  1F52 A;  4WJO A;  3OWE B;  4USA A;  2V3N A;  4JIO U;  4W9F A;  1FPY A;  1ZDX A;  2BKF A;  1YJJ A;  4I6L B;  1K8R B;  1WJU A;  1FCC C;  4JQW C;  1H4R A;  2YEP F;  1BXT A;  2BYV E;  2LVO A;  1HQR D;  4NAW A;  2INP E;  4NJ7 A;  5E6J A;  3QK0 A;  2OJW A;  4F7Z A;  2IGD A;  2IZV B;  5FR3 A;  2JYT A;  4WWP A;  4HVB A;  2R61 A;  4LNK A;  4IDI A;  1SE9 A;  3E56 A;  2M17 A;  3PHW B;  1WM3 A;  1CK1 A;  4GGQ A;  2W55 A;  4NNJ B;  4ANX A;  5EE1 A;  3Q8E A;  2BS2 B;  4YTM B;  3DCG A;  3C19 A;  5TSS A;  3RI7 C;  3N9Y C;  4XE0 A;  2QIE B;  2WXN A;  3WA0 A;  3VFK A;  4WWM A;  1WJ6 A;  1N63 A;  5CHF A;  2D07 B;  3AE4 B;  3UIO B;  3AE2 B;  1E7U A;  1WMH B;  2MBO A;  1NEK B;  2BBC A;  2FAZ A;  3RZW C;  5KHQ A;  2CHX A;  2MLB A;  3ZVV A;  1WZ3 A;  2WNM A;  3RPF C;  1WM2 A;  3DPD A;  2L76 A;  2M0X A;  3IFW B;  4ZRP A;  4FUL A;  3D32 A;  2JRI B;  1TBE A;  1DOY A;  1WFY A;  5AZG A;  3BY4 B;  3OJ4 B;  4AWJ A;  1UH6 A;  2WXR A;  4J6I A;  2AYO B;  4HCN B;  1T3Q A;  2ASQ A;  2N0S B;  2PVO D;  2BW2 A;  3PT2 B;  3LJ3 A;  3W5V B;  4YSY B;  2DAJ A;  1HEZ E;  3WCQ A;  2M19 A;  2ZW0 A;  4GB9 A;  3OLM D;  5E6P A;  1VZ8 A;  2JXX A;  2RMM A;  1CZP A;  2KDB A;  1VD2 A;  2IO3 B;  3EHV A;  2KX3 A;  2Z8L A;  3X23 A;  2NBV B;  2WYQ A;  2XK5 B;  1PGB A;  1U4A A;  2GLS A;  1V5T A;  4XDD A;  3OAW A;  3NHE B;  2MHJ A;  3A1Q B;  1WY8 A;  3DHG C;  5CTR C;  2KAN A;  4NAW B;  2KOX A;  3IHP C;  3ZNG C;  1R4N I;  1E8Z A;  2JT4 B;  2KAC A;  4WIP A;  2KK8 A;  2IJ0 A;  3AE5 B;  1P1A A;  3PO0 A;  2LVQ A;  4RF0 A;  3HK0 A;  3TMP B;  4GLS C;  2WHI A;  5BMH A;  4JX1 C;  4LLG M;  2GI9 A;  4A6Q A;  4C56 C;  1HTQ A;  5D6J B;  2D2Q A;  1FRR A;  3ETR A;  4EKU A;  1MG4 A;  4GDK B;  1L6U A;  1WX9 A;  1J7B A;  4TQ1 A;  1P7F A;  5D3D A;  2LRU A;  1WE7 A;  3HUI A;  1GB1 A;  3N1Y C;  4ZHP A;  1GC7 A;  1DOX A;  4I6N B;  1KLU D;  2ON8 A;  3TEW A;  1Z2M A;  1C4P A;  2IDY A;  4KDI C;  2L52 A;  2BWE S;  4RF1 A;  1E8X A;  1SGH A;  1E7V A;  3SFE B;  3TL5 A;  2L05 A;  1J0G A;  2BYT A;  3BIN A;  2L32 A;  4IUM B;  2MBQ A;  1ZE3 D;  1KF6 B;  4ARC A;  2DLB A;  4MGI E;  3AE3 B;  2J0M A;  2O6V D;  4II2 B;  3NS1 A;  3Q8C A;  2MSE D;  3H8H A;  1T6B X;  1RFK A;  1LM8 B;  1EUV B;  1YQB A;  1I42 A;  1C4A A;  4CQN A;  2WXH A;  3P4R B;  3PZ8 A;  3P42 A;  3MJ5 A;  1WXV A;  3Q6B A;  3LXF A;  4GDL B;  4RGM A;  1R4M B;  1WJ4 A;  2QIL A;  2NTS A;  5IP4 D;  3T8M A;  2O6V A;  1IUE A;  3U52 E;  4OZA A;  2ONQ A;  3BZD B;  1C4C A;  4DK5 A;  4M8N A;  3EUB 2;  4W9E A;  4DXF A;  1NEN B;  4W9H A;  1NVI D;  2QCZ A;  2K39 A;  1GPX A;  2AQ2 B;  2V1Y A;  3UIP B;  3TUO A;  1DYQ A;  4WWN A;  3ZJV A;  1MHH E;  1JRO A;  2EMS A;  5TR5 A;  3A9J B;  4ZRQ A;  5IKC M;  4MGZ E;  5DPR A;  4LNI A;  4XGA B;  2KFK A;  1SEB D;  1FXA A;  5AUI A;  1XXG A;  4BBN C;  3P4Q B;  2AWT A;  1HZ5 A;  3E9S A;  4IKG A;  3L13 A;  1FO4 A;  3B9J A;  4HRO A;  3PLV A;  4KKJ A;  3AN1 A;  4DBG A;  2KWU B;  3AEB B;  2INN E;  2L0T A;  4DHJ B;  2O2V A;  4MM3 A;  1GOZ A;  4ACF A;  3RUI B;  2RDB C;  2KWV B;  1WJN A;  2FID A;  2JZZ A;  3ZJT A;  2J52 A;  3APF A;  1S3S G;  4MJS A;  5G2N A;  4KSL C;  4NY0 A;  4ANU A;  2HE7 A;  1IBX A;  2N9K A;  4CYE A;  2GBJ A;  1Q1O A;  3HVZ A;  5FR6 A;  3U7D A;  1N5W A;  1T0S C;  4KGR A;  1YQ3 B;  3TIX A;  2LD9 A;  2KWD A;  1UZX B;  2Z0D B;  4BVU C;  4RM9 A;  1FIQ A;  1ESF A;  3ZIM A;  1L6V A;  2J0J A;  4K7S A;  1I4X A;  1WWT A;  2MWS B;  1LXD A;  2W9N A;  1H8C A;  4WUR A;  2EMT A;  4HLE A;  3BYY B;  4JE3 B;  2KZR A;  2L7R A;  1WGK A;  1VDV A;  2ZEQ A;  1KLV A;  2JU6 X;  4OZB A;  1X1M A;  5LLI A;  1KLG D;  3C8Y A;  1WGH A;  4ZRK A;  1WE6 A;  1V49 A;  1TZ1 A;  1MG8 A;  5H92 C;  2W82 A;  3IVF A;  3QJZ A;  1DGJ A;  2MEK A;  1WXQ A;  4II3 B;  1V9J A;  3NY5 A;  4C4V B;  4MT5 A;  2KMA A;  2PLP A;  1VZ7 A;  4K3C A;  4IM3 A;  2B76 B;  2G9H D;  2MX2 A;  5DPS A;  2DBY A;  3P1M A;  1ZDV A;  3MTN B;  1PYW D;  1Q10 A;  1OQQ A;  1T5X D;  3L0W B;  4HJG E;  3GB1 A;  2K6Q A;  2N1W A;  2KFJ A;  3T3N A;  2KFK B;  2LEK A;  1ZW7 A;  3PGE A;  1Y8R C;  1YMH E;  1ZXI A;  4R3D A;  4LJO B;  2BB6 A;  2KWC A;  1QZE A;  4AJY B;  4GOC A;  2LXC A;  1I4H A;  3O13 A;  1UGJ A;  2O2V B;  1SJH D;  3NG0 A;  4MAC A;  3NS8 A;  1ZPS A;  1JWM D;  2BWF A;  1V86 A;  2K8H A;  1E6E B;  1JWA D;  2HTM E;  3VHT C;  2JWU A;  2LJ5 A;  3RYT A;  2MQJ A;  4HRS A;  1N62 A;  1I4P A;  1I4G A;  2PE9 A;  3DBR B;  1M94 A;  5IAA C;  1FFU A;  2LGI A;  4DDI D;  3RZF A;  1WGR A;  2RDG A;  2K6D B;  3KQ4 A;  3KW5 B;  5EE3 A;  4FBJ B;  1P7E A;  3WIM A;  4E71 A;  1E7P B;  2LI5 A;  5DPW A;  1F0Z A;  4B0E A;  4S17 A;  2KN4 A;  2VH1 A;  3VUW A;  1NDD A;  5BYQ A;  3IXS A;  1LGR A;  4YSX B;  2QC8 A;  4NQL B;  3I3T B;  1ACC A;  2N7D A;  3TEZ A;  2CHW A;  2NS5 A;  1E0Z A;  2CU3 A;  3JYU A;  1E5W A;  5HG2 A;  2WDT B;  3PHX B;  3DBL B;  3TSS A;  5D3I B;  3V6C B;  3W1Y A;  1ENF A;  4PYZ A;  1OQY A;  5J2R A;  1Z5S B;  1WIA A;  1E90 A;  4EZK A;  3AE7 B;  4PYU A;  1VZ6 A;  1EU4 A;  3VTV A;  1WMH A;  2VH2 A;  1QOG A;  2LFI A;  2NBU A;  2PKO A;  1L0V B;  4C80 A;  4EOY A;  1MI0 A;  1VJK A;  1OEY J;  5IO9 A;  2V4L A;  3AUL A;  5FK9 C;  2JX5 A;  3UGB B;  1C3T A;  4BBN F;  3I57 A;  3Q3F A;  3GZN I;  4NJC A;  1TS3 A;  2K1F A;  3W1S C;  3FKY A;  4FA6 A;  1KRH A;  4D2K A;  2KMC A;  3KUZ A;  4PS8 A;  3B08 A;  1WRI A;  2WXL A;  3V60 A;  2KLG A;  3UI3 A;  3RT3 B;  3NOB A;  3ZRC A;  4G50 A;  1XO3 A;  5G5H A;  4AP4 C;  1IYF A;  2BYF A;  1Q5W B;  2CHZ A;  2XK5 A;  2L3Z A;  2FUG 1;  3HVD A;  4RCO A;  2M4N A;  2V0G A;  4KGS A;  1E10 A;  1YJ1 A;  3BK1 A;  3A1Q A;  2XEW A;  3W5U B;  1SIJ A;  3V6E B;  1FNW A;  4W9L A;  5C23 A;  1RAX A;  1WYW B;  3VR8 B;  2BB5 A;  4WWO A;  1SBB B;  2ZVN A;  3CF6 E;  2DWQ A;  2PW9 A;  4HXD A;  2KYW A;  3BVG A;  2BGF A;  1YX6 B;  1RFA A;  4CO7 A;  4HDQ A;  1KTK A;  3QA8 A;  4XYC A;  2MW5 A;  1SE4 A;  2K8C A;  3DHH C;  2J42 A;  2JVC A;  2LGX A;  3BWU D;  1CMX B;  5HHD G;  3WAN A;  4GDK A;  1J7C A;  1CJE A;  2G3Q B;  1NI3 A;  4FJZ A;  2KJH B;  3RNA C;  3AE1 B;  2EEL A;  3HHM A;  2MBE A;  3BK2 A;  4X57 B;  3AU4 A;  4KVG B;  4AJW A;  1JWB D;  1L4D B;  1XF5 L;  2DYB A;  3L08 A;  3MHZ A;  1JCK B;  1P9D U;  2KQS A;  3KH0 A;  2IGH A;  1LQB A;  4NAM A;  1OTR B;  4O1N A;  2CJN A;  3I5J C;  2C9W B;  3ZDT A;  1WI0 A;  4YL8 A;  1L0X B;  1NYQ A;  1PUT A;  2D3G A;  2JXT A;  4P7I A;  4LDT B;  4LNN A;  4K1R B;  2YVC A;  4FLH A;  3GE8 C;  1WSP A;  2HJ8 A;  2UU7 A;  3AXC A;  1WX7 A;  1D5X C;  4DHZ E;  2GBM A;  1MJD A;  2HTH A;  1GAQ B;  4IWP A;  3MP9 A;  4URK A;  1AYF A;  2A4Z A;  1SIF A;  3HIZ A;  3BVZ A;  1HTO A;  2Y5P A;  4GDL A;  3ZRF A;  1UWX A;  3RNB C;  1UUP A;  4A8X C;  4YTP B;  1VCB A;  2L83 A;  4DWF A;  4EUT A;  1UD7 A;  2DZJ A;  2QJL A;  3DDC B;  1FEH A;  4P1B C;  5MPO A;  2FUH B;  4FHJ A;  4ZHO A;  2JZP A;  3ONS A;  4ZRJ A;  2JZ3 B;  3I9V 1;  1GJZ A;  2PTL A;  4P16 A;  4JL9 A;  3WAP A;  1OQR A;  3QWZ B;  4DHJ D;  4I6P A;  4B0M A;  2SEB D;  3A9J A;  4HPL B;  2N9X A;  4RM8 A;  2QDF A;  3M63 B;  2AX5 A;  4HDO A;  4DXG A;  1KJT A;  2RD0 A;  4AQ7 A;  2EKE C;  3DWM A;  1EF5 A;  2BYE A;  3NJT A;  4E74 A;  1QT9 A;  3IG3 A;  1IPG A;  4W9G A;  4KIK B;  2KDF B;  1V8C A;  5LXI B;  1XCT L;  3NVV A;  5AEK B;  3NZS A;  2PE6 B;  4RMA A;  2K9X A;  3JSV B;  1EWC A;  2DAF A;  2K3U A;  3VUX A;  4A90 A;  1ROE A;  5G55 A;  2Z0E B;  1FNU A;  2ZPN A;  4N58 A;  4XX5 A;  4OVV A;  1P3Q U;  2AQ1 B;  2KX0 A;  2K25 A;  4TKN A;  4A20 A;  4YTN B;  2B3A A;  3VTU A;  2W3S A;  1EWY C;  2L1A A;  1IGD A;  1C9F A;  2LGY A;  1NI2 A;  1YJI A;  4KX6 B;  1R4N B;  2IYD B;  2KKC A;  1ET9 A;  3AE8 B;  5D94 A;  5JHB A;  2GOW A;  3BII D;  2NCN A;  4BAX A;  3B0A A;  1D3Z A;  2LUE A;  5T8I A;  3NVY A;  2RPQ A;  1V5O A;  3RNG C;  4XC2 A;  3AM9 A;  1WX8 A;  5L95 C;  4K7U A;  2KJ6 A;  3MHS D;  2FNJ B;  3RD2 A;  5FKA C;  3R66 C;  1AW7 A;  4TV3 A;  2D3A A;  4HK2 A;  1K50 A;  3P2B A;  2M0A A;  4IC7 B;  4C4V A;  3N1Z C;  2KJR A;  5AUK A;  3PV1 A;  3QAR A;  3VRA B;  2DZK A;  1JWU D;  4US8 A;  4MGY E;  1A70 A;  4LNF A;  2BS4 B;  2ZNV B;  2LVP A;  4KZ0 A;  4MDK E;  4W9C A;  3VH3 B;  4W9J A;  1QQR A;  2GMI C;  3KYD D;  3VUY A;  2C60 A;  2ZVO A;  1WGG A;  1FXT B;  3T9L A;  2WX1 A;  5JH5 C;  1L7Y A;  3J9C A;  2NMQ A;  3AI5 A;  1TS2 A;  4Q2J A;  4YT0 B;  1VLB A;  2NR2 A;  4C00 A;  5BYS A;  2WXK A;  3PRZ A;  2WDV B;  1HE8 A;  1EF1 A;  1JRU A;  1RLF A;  3BVM A;  3KWV A;  1L2N A;  3A4R A;  2GRI A;  2MH7 A;  2NPT A;  1YOV B;  4M02 A;  3TEY A;  1CQV A;  2KNB A;  4JLC A;  4WQO B;  3NRZ A;  3L17 A;  1M4V A;  1YN3 A;  2IO0 B;  2WU5 B;  5HI1 A;  1E8Y A;  4LCD E;  3L10 B;  4J3O D;  3KVF B;  3BYT B;  2J7Q B;  2DX5 B;  3IAS 1;  3H6N A;  2H89 B;  1TKE A;  1F9J A;  2QHO A;  5E6N A;  4M0W A;  1B1Z A;  4RGT A;  3U8Z A;  2WXJ A;  3ZQ4 A;  1V97 A;  4A3O A;  4JGH B;  1ZP0 B;  1TZO A;  3ABV B;  3VH4 B;  4HWI B;  1MVK A;  3V62 A;  2MBH A;  2WDQ B;  2Y3A A;  4BFR A;  5BO4 B;  2N9L A;  1AN8 A;  3M95 A;  1Q0W B;  5KHO A;  1Y56 A;  3N1X C;  1J7A A;  4MGK E;  4FXC A;  3DHI C;  2XN9 C;  3W9C B;  4WJQ A;  4EEW A;  2FBW B;  1FM0 D;  1C1Y B;  1UGM A;  4B9K A;  2C7M B;  3U7Z A;  4OVZ A;  2V4I B;  1V1O A;  2KD0 A;  1TKG A;  2GBR A;  3AE6 B;  2ACZ B;  2IO1 B;  4ZOH C;  2OJR A;  3AEE B;  3UQA A;  2KVZ A;  4ASW C;  3DBH I;  4IG7 B;  5C2T B;  1WZ0 A;  2BQQ A;  3EFU A;  4G3X B;  2PVG C;  3VDZ A;  1V2Y A;  2MRP A;  5AZF A;  2AL6 A;  2KDI A;  1XLN A;  4ICU A;  1VR9 A;  3H1U A;  3Q69 A;  4N6E B;  3L16 A;  3EGR A;  1WRD B;  2OOB B;  1OGW A;  3Q8A A;  1TS5 A;  5JXV A;  3GE3 C;  2WU2 B;  1L4Z B;  2K22 A;  3PRE A;  2PEA A;  2WXP A;  3ECI A;  1QF6 A;  2BVC A;  2NPT B;  2LJI A;  4ZDV A;  1L0Y B;  4ANW A;  1KM7 A;  1XLP A;  3L54 A;  1GUA B;  1DOI A;  3K9P B;  2KXJ A;  1MPE A;  1P0R A;  2LHD A;  1L5P A;  3VXW A;  1LFD A;  1UBI A;  2K0P A;  2VZK B;  2UWQ A;  1N60 A;  4M0W B;  4KZC A;  2RPV A;  2WQY B;  4PT5 A;  3NVW A;  3VQI A;  2Z59 B;  3PLU A;  2ZCC A;  4ARI A;  1ZUD 2;  2D10 A;  2MJ3 A;  2M1M A;  2CU1 A;  4ZYN A;  5IA7 A;  2BKR B;  1YN5 A;  1SE3 A;  2YEP B;  2HJ1 A;  3M62 B;  2KAJ A;  4TQ0 A;  2KTR A;  4ANV A;  3AEF B;  1ET6 A;  1PGA A;  3CST A;  4HPP A;  1EU3 A;  1JWS D;  3URY A;  4AOF A;  4LDT D;  2BF8 B;  2PMV A;  3VRB B;  2LHE A;  3PS6 A;  1PDX A;  3PPA A;  3IBE A;  1FFV A;  1D5Z C;  3TJP A;  3QX1 A;  3R2I A;  1QLB B;  4KKI A;  4RGN A;  3SEB A;  3WAM A;  3UF8 A;  2L0F A;  3AEC B;  1C79 A;  4B95 A;  3APD A;  1PFD A;  1V80 A;  4LK0 M;  1T0Q C;  2EKI A;  2NVU I;  4OW0 A;  1FXI A;  4EZJ A;  3Q14 C;  2KDM A;  4NZL B;  2MJE A;  4RH6 A;  2RGF A;  3A4S C;  1WR6 E;  1FNV A;  2WS3 B;  3V05 A;  4BZA A;  1VRA B;  3EEC A;  2V3P A;  3WAL A;  3Q3O C;  2D3C A;  1KH0 A;  3SD5 A;  4PS3 A;  1TKY A;  3GOE A;  3ZYY X;  2K8B A;  3T3O A;  5BYR A;  3N30 A;  5D7G A;  1J8C A;  2D5G A;  3AMZ A;  1D5M C;  3RCZ A;  4EZL A;  3RN9 C;  2V9H A;  3AE9 B;  2GBK A;  1ZXH A;  2WLB A;  5HKH A;  2UYZ B;  2NBW B;  4HCP B;  4WH4 A;  1RYJ A;  4BKS D;  3AU5 A;  1JW9 D;  2IND C;  2X8X X;  3W2D A;  4CHK A;  1XQQ A;  1NYR A;  4G0N B;  3GZN B;  1BT0 A;  3ZKJ C;  3ZUN A;  4NQK E;  2R2O A;  3P63 A;  1UBQ A;  2ZPY A;  1UEL A;  1S1Q B;  4KIK A;  4FJY A;  4GSW A;  2KTR B;  4W9I A;  4RGO S;  4KSK C;  3PVL A;  3ZDM C;  1C76 A;  3JSV A;  3RNF C;  2KQ4 X;  5I4D A;  3ZXV A;  1D6E C;  4W9D A;  4MSM B;  1F2R C;  4BKS A;  2IO2 B;  4MH8 A;  1STE A;  2N4F A;  3DWG C;  4A3P A;  4P6V F;  4OZC A;  2KLC A;  1WXA A;  1SXT A;  2IPK D;  3AEG B;  2JYE A;  1TY0 A;  1WYG A;  2BS3 B; 
#chains in the Genus database with same CATH homology
 1MFW A;  2DNF A;  5IKC M;  2BQQ A;  5IOI A;  5IN7 A;  5IO9 A;  1UF0 A;  5IP4 D;  1MG4 A;  1MJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...