5IP4D

X-ray structure of the c-terminal domain of human doublecortin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
80
structure length
80
Chain Sequence
KDFVRPKLVTIIRSGVKPRKAVRVLLNKKTAHSFEQVLTDITEAIKLETGVVKKLYTLDGKQVTCLHDFFGDDDVFIACG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords XA4551 NANOBODY AGAINST C-DCX
publication title Crystal Structures of the Human Doublecortin C- and N-terminal Domains in Complex with Specific Antibodies.
pubmed doi rcsb
source organism Lama glama
molecule tags Transferase
total genus 17
structure length 80
sequence length 80
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF03607 DCX Doublecortin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.230 Alpha Beta Roll Ubiquitin-like (UB roll) Doublecortin domain 5ip4D00
1MJDA 2BQQA 5IKCM 5IP4D 1MFWA 2DNFA 1UF0A 1MG4A 5IO9A 5IN7A 5IOIA
chains in the Genus database with same CATH superfamily
3I57A 3GOEA 2G4DB 1FRDA 2LVPA 4MM3B 1TS4A 1C9FA 1L0VB 1MG8A 2CHZA 2A5UA 2IO3B 1I4PA 1ZPSA 1I42A 1R4MB 3U30A 2DHZA 1I4HA 1EM7A 1UWXA 2V4LA 2PTLA 2BGFA 1E9MA 2LXCA 3PRPB 4JPSA 3UIPB 2KJ6A 2GBMA 1KFYB 1C1YB 1N6ZA 2ZW1A 3SR6A 5AUIA 3RFZB 2OHFA 3ZNGC 1E6EB 1UUPA 1WWTA 1ZUD2 2JRIB 4K7SA 1EF1A 1V80A 2N9XA 4MSMB 1DYQA 1E7UA 3A9KB 5AZFA 1YD8U 3M3JA 4GGQA 3NVYA 1JCKB 1WMHA 3ZTCA 1VZ6A 4GIVA 2GBKA 4RM9A 2LI5A 2BPSA 1WGDA 2JPHA 2MRPA 4HKZE 2BBCA 1SE4A 3HHMA 5IA7A 3VQIA 4CQNA 3RNGC 4ZRIA 4EZLA 2WXHA 4A6QA 3NHEB 3ML8A 1TKEA 1KTKA 1EWYC 2MJDA 3H1UA 3Q8CA 3TEWA 3BK2A 3VRAB 1VZ8A 2HTME 4IM0A 3B2GA 3ZQ4A 1EU3A 2KDIA 5JZEB 2KYWA 1WX9A 1ET9A 2ZPYA 2NMQA 3Q14C 3RNEC 1WMHB 2MBQA 4BFRA 3MJ5A 1KLGD 1SIFA 2M19A 2IGGA 3EHVA 1AN8A 2DZIA 3Q8AA 1HXYD 1HE8A 3MHSD 1KLVA 2J0KA 3HVDA 2WS3B 1DOIA 3A1QA 3P4RB 4W9JA 3UF8A 4ACFA 1UD7A 4TMAB 3C0RB 2XEWA 3L13A 2RDHA 3AE1B 4WWOA 2WP9B 4IWPA 3N30A 4B95A 4KGSA 4RGTA 2GMIC 2AEHA 2PIAA 4EUTA 1SBBB 4K7WA 4OVVA 4EKUA 2RGFA 2KQ7A 1XXGA 3AE4B 1C3TA 1TS5A 4ZRPA 1WR1A 2WXGA 2Y5BB 2CU3A 1UH6A 1WE6A 4GN1A 1P0RA 1YMHE 2MBHA 3EA6A 2QIEB 4A55A 3ZDMC 3A1QB 3M95A 5C2TB 1V5TA 3AULA 2AWTA 4AUQC 3AU4A 2KC1A 2HDEA 2ZW0A 3PZ7A 1Z2MA 1DOXA 4DWFA 2M1MA 2K8HA 2C9WB 2NVUI 1C79A 4EFOA 4BKSD 2JVCA 3IHPC 5C1ZA 4ANXA 3Q69A 4HPLB 5CHFA 4GOCA 2KLCA 3JW0X 1FD6A 4P6VF 4LLGM 1R4MI 4N59A 2IY0B 3Q3NC 3QA8A 5CX3A 4RF0A 3HRDD 2WXFA 4M0WA 4J6IA 3UQBA 2IY1B 2DYOA 2Y5PA 4B0EA 3ZGZA 4IW0A 3ZYYX 3KYCD 3PO0A 3PLVA 1LGRA 2KMMA 4IWOA 2V3SA 4TQ0A 3PGEA 2XK5A 2WQYB 2DYMA 2Z0EB 3AEBB 1JQ4A 3AEGB 3DVGY 1VDVA 2PLPA 4G0NB 3DBRI 2REXA 4HDOA 1I4XA 1JWBD 4KKIA 3WCQA 4PK1A 2K9XA 1C4PA 1QKZA 4KX6B 4MGKE 2K22A 2O2VA 3QARA 1A5RA 4E3CA 4L23A 3QQ8B 2IGDA 1GC6A 3WAPA 2VH2A 2I1JA 4FLHA 2HJ1A 4S17A 4R3DA 3HIZA 1QLBB 1KM7A 5HHDG 1ISNA 4XGAB 5BO4B 4OVZA 1V2YA 4M0WB 2MSED 1K53A 2IGHA 2WDVB 3W1SA 2C7MB 3VTUA 3IAS1 4G11A 4AWJA 5C3JB 1P9DU 2BQQA 2KZRA 4GLSC 2XK5B 5FR6A 3URYA 3V62A 3SFDB 4LJOB 5BYQA 3T9LA 5C23A 2ZEQA 5E6JA 4A8XC 2WGSA 1FNVA 4Q2JA 5J18A 1D5MC 1QZEA 3IBEA 4GU2A 1N5WA 2O2VB 4NJCA 2FCMA 3QK0A 1WM2A 3ABVB 4J3OD 3TMPB 2VRRB 2KX0A 3X23A 2ICIA 3H7SA 4HEA1 3RUIB 5FKAC 1BXTA 3A33B 4W9HA 3H7PA 2ZPNA 2MBEA 1GG3A 1RWSA 1Q5WB 1WXSA 1EWCA 4IC7B 2BB5A 5DPSA 1FO4A 3DHGC 5DPTA 3MJWA 3WAOA 1E8XA 3W1YA 3C19A 4XWTA 2KN4A 3P4SB 3NRZA 1S1QB 3W9CB 2WXOA 1S3SG 2ASQA 4RCOA 2NS5A 2AL3A 2IO1B 3ZRCA 5JHAA 5G5HA 1T5XD 3DCGA 1TS2A 4US8A 1JROA 2DWQA 3RPFC 1Z5SB 1SGHA 4LNNA 2RR9A 2Z59B 2LUMA 4PYZA 4ITKA 3QAQA 4OHJA 4FXCA 3N32A 3H7PB 1HZ5A 2PVOD 2RSUA 3TSSA 1D3ZA 1FPYA 3NJTA 1XF5L 2KT7A 2INPE 3ZLZA 2I2YA 3SFEB 5D3IB 2WXIA 4XDDA 4C7ZA 3ZJVA 2V1YA 2BTEA 1PDXA 3OLMD 4B0MA 3N3KB 3U2SC 1V97A 3KH0A 2BKRB 3CIRB 4WJOA 4YSXB 1XEEA 2BS4B 1T0RC 2LD9A 2MJEA 3ZW3A 4KDLB 2O6VD 4NJ6A 3NVVA 1WJNA 1L2NA 2MW5A 2QHOA 3TEXA 1BT0A 2J53A 2L0TA 3AE3B 1ESFA 4ZYNA 2NPTA 3V61A 3N20C 1FFUA 5D2MB 2N1VA 5EE0A 4WH4A 1VRAB 2KK8A 5BMGA 4ANUA 3HK0A 2N9EB 2MA9B 3R2IA 3I9V1 2OEDA 3PT2B 2R2OA 1AW7A 4MJSA 1SEBD 1I7HA 1IPGA 4LNOA 3ZNHB 2WU2B 3NY5A 1CK1A 1ACCA 4MH0E 4WJNA 3BWUD 4PYUA 2MCNB 4ICUA 1FNUA 1SSNA 4YTMB 1J7BA 3NZ3A 1WM3A 2WDRB 4GXBA 1TTNA 2LVQA 4D2KA 3V60A 4NNJB 1YIWA 4KV2A 4FHJA 1L6VA 3ALBA 3PLUA 4BBNC 2LASA 2LZ6A 2NPTB 3HM6X 3IVFA 1NI3A 4W9GA 1YNTE 5IP4D 3MFGA 4IUMB 1L4ZB 5LNK1 3VHTC 2JYTA 2BYFA 4OZAA 3QIJA 4W9FA 4MJSB 2WXLA 3DVNV 5E6OA 4HDQA 2V9HA 4ZRQA 4YXDB 1GOZA 2KX3A 3P63A 5AEKB 3U8ZA 2NR2A 3R2TA 2C60A 5I4DA 3L10B 1UBIA 2DAFA 3BY4B 3NZUA 3VVWB 3L17A 1F2RI 4IG7B 1YN4A 3AI5A 1GPXA 1K8RB 4LDTB 4RH6A 1JWAD 1ENFA 4EZKA 2L3ZA 4II3B 3LDZE 2ZNVB 2FUG1 4USAA 4BOSC 3BYYB 1EF5A 4FHKA 2KWVB 2PE6B 1WRIA 1WF9A 1XQQA 4AS1A 1XLNA 4G50A 1RFAA 2GBNA 3AE5B 2BW2A 2PKOA 3RULA 3APDA 2DZKA 3KW5B 1F77A 3AE2B 3APCA 1OTRB 2D5GA 4HVBA 3NS1A 5D7GA 2WXRA 1KOTA 2QCZA 1HTQA 4PT5A 3UGBB 3KQ4A 4ZYSA 2D10A 1YJ1A 4DQOC 1WI0A 4C7YA 4KIKA 1YN5A 1FNWA 3KWLA 1SXTA 4FN2A 4UDUC 1NVID 1WJUA 1WX7A 3P2BA 1D5ZC 3L4PA 1MG4A 2J4XA 2M4NA 4M01A 1IGCA 3PTFC 3DBRB 3ZXRA 2AQ3B 3UQAA 2KOXA 4JGHB 2E6XA 4FJZA 2K3UA 1FEHA 3CF6E 1V9JA 2KN5A 4RGOS 1AYFA 2BYTA 3GS2A 4F1SA 1ZW7A 1CMXB 3WA0A 3VTWA 4LNFA 2KANA 2NCNA 4DXGA 2LXAA 4EOYA 2L05A 5GXGB 2HJ8A 2DLBA 1T0QC 2QMTA 1VCBA 3V3XA 4YWGG 2FBWB 4MGYE 5LXIB 2LGXA 3ZJUA 2RMMA 4JWUC 4KIKB 3ZIMA 3BVZA 3PZ8A 2D07B 1YOVB 2QJLA 1FM0D 1GAQB 3AMZA 4HCPB 2BYEA 2IPKD 4W9IA 3FILA 1TZOA 3AEFB 1WH3A 4WWMA 1WE7A 2QEJC 1F0ZA 4DK5A 2V3PA 2DENB 2KDMA 3R7QA 3MP9A 2J52A 1ROEA 3TUOA 1K50A 1L0XB 2KD0A 1Q0WB 4DDID 3H9DA 1JWSD 4F8CB 2JUOA 1IGDA 4P1CC 3T3OA 3GZNI 2WXJA 3MTNB 4YTPB 3AM9A 1WGGA 4LK0M 2MHJA 1YJJA 3DHIC 1IUEA 4GDKA 4NJ7A 5E6PA 1BUIC 1MI0A 1IYFA 1WR6E 1KRHA 3V6CB 1HEZE 2JRHA 2KNBA 2PPHA 3UIOB 3FILB 3T3NA 4ZRKA 3MC0B 1M4VA 1SJHD 5EE3A 4GSWA 4AJWA 2ZJDA 2DX5B 2QILA 1FIQA 3VR9B 2W9NA 3CSFA 1RM6C 2ONQA 3IT6B 2IO2B 4BKTA 4NAMA 1PFDA 2CJNA 1XLPA 3N1XC 2JZ3B 3VUWA 1U4AA 2G3QB 2KJRA 4GDKB 1TT5B 3NVZA 2PMVA 1V86A 3KUZA 1WYWB 2VH1A 4CHKA 1ZDVA 4O1NA 5AZGA 4MGZE 1GB1A 1RYJA 4WJQA 3MC9A 1N62A 2K0PA 3DBHB 2KMCA 3PRZA 1FXIA 2ZCCA 4EEWA 1YJIA 1I4QA 4P16A 2QDFA 2LRWA 4LNIA 4A90A 2N9LA 1WXVA 1K51A 3L54A 4JQWC 2D11A 2DZMA 3MC8A 5LLIA 1WGYA 2BYVE 3WIMA 2BS3B 2FCNA 3ZNZB 2M8SA 3R7RA 1E7VA 1E0ZA 3GE3C 2EMTA 3ZO5B 1L0YB 3Q6BA 3A4RA 3M62B 1V6EA 2M17A 3Q8BA 2EELA 2I1KA 2W55A 3VUYA 4IM2A 3DDCB 2OOBB 1KH0A 1D4BA 1PGXA 3VTVA 1NDDA 2BKFA 2MEKA 2L00B 1FCCC 3BVMA 2D3GA 1T0SC 1Y56A 1VZ7A 2JWZA 3KVFB 3RI7C 4MACA 2JXTA 1ZXHA 4P1BC 3RNBC 1HZ6A 3EGRA 3UINB 2IBIB 4YL8A 4JIOU 4A3OA 1WX8A 3PREA 2JX5A 3FC4A 1WGHA 2JWUA 1NEKB 1PQSA 1WXMA 3A9JA 1SJED 4GMVA 1YX6B 1E8ZA 2LFIA 1JW9D 2DBYA 2RPVA 3AXCA 3PHXB 4K3BA 5AUKA 4QAYA 1ZP0B 2JZPA 2LHDA 1L6UA 2W82A 3KWVA 4JL9A 3B08A 3SHQA 1SB3C 5DPRA 1HTOA 3OAWA 2FE8A 5BMHA 1F9JA 2LWPA 3ZJTA 1F52A 1JWUD 1LM8B 2BS2B 2RDGA 2N9KA 1YX5B 2N0SB 1YQ3B 3DVNU 2YVCA 3HM3A 3BYTB 1E8YA 1CZPA 3ZVVA 1WYGA 1PGAA 4W9LA 4MDKE 2KDFB 2LEKA 4RGMA 1JALA 4KDIC 1JMLA 1OQYA 4E74A 2GBJA 3ZTDA 1H4RA 2KWUB 1ZOYB 3A9JB 1GC7A 2A4ZA 3PS6A 2AQ1B 2LJIA 1OEYA 2LGSA 3Q3OC 3W5VB 5E6NA 1QOFA 4DBGA 2WXMA 3H6NA 3B0AA 3P4QB 2E3TA 3DBLB 3W1SC 3NOBA 1J8CA 1ZE3D 2FNJB 1F2RC 1XD3B 5H8YE 3OJ3A 4TKNA 5D94A 5FK9C 3AEEB 5HI1A 2KQ4X 1P7FA 2HD5B 3ENEA 2SAKA 5EE1A 4II2B 5CHVC 1MJDA 4EZJA 5GMVA 2KTFA 3Q3JA 4HRSA 3M63B 2GLSA 2MBOA 1UWMA 3DBHI 5JH5C 3PSEB 2WYQA 3DWMA 2ZCBA 1WJ6A 4WAAA 3VRBB 3PVLA 1C77A 3AE9B 2WXKA 4ZDVA 2C5LC 3EC8A 1TY0A 3FAHA 3L0WB 2W3RA 2D3CA 2BVCA 1L5PA 1C4CA 2NBUA 5J2RA 4FA6A 2BWFA 2JXXA 2OJRA 1C76A 2J7QB 2K6DB 2JZZA 2JSVX 1WJ4A 3K9PB 5G55A 4EE2A 3D32A 1WIAA 4HPMB 2D3BA 4C56C 1WY8A 1YN3A 1XLOA 4JWSC 3LJ3A 4N9F4 2OJWA 3VXWA 2N9PC 3U7DA 4AJYB 4MT5A 1XT9B 1UBQA 1L7YA 2Z0DB 1TY2A 4IKGA 4L2YA 1R7SA 3BK1A 1N5XA 1V49A 2CS4A 3TJPA 2KKCA 3VFKA 2PEAA 4RGNA 2KWCA 1GNUA 1FXTB 3QCAA 5D3DA 2I38A 1TKGA 2IZVB 2YLMA 1E8WA 3H8HA 3T8MA 3ETRA 4WIPA 3Q2AC 2SEBD 1NBFC 4N58A 1WGKA 3UI3A 4DHJB 1MVKA 1DOYA 3PZDA 4PS8A 5JHBA 3AB5A 2VZKB 3GZNB 2LJ5A 2K6QA 3ML9A 2X8XX 2V3NA 1SE3A 2BWES 3JVZX 4HPPA 4K1RB 3SEBA 4OZBA 2K5PA 1FCLA 4HXDA 2M56B 3DQVA 2KDBA 2PJHA 1XCTL 4HLEA 2L0FA 3Q8FA 2FCQA 3QWZB 5CTRC 4I6NB 1YQ4B 2MWSB 5IKCM 1VR9A 3EUB2 3SU8X 2AYOB 5KHOA 2JQRB 4XZ4A 1OFFA 2FCSA 4JX1C 1WSPA 1RLFA 4KKJA 1SIJA 4XDCA 2W54A 4KGTA 1TJEA 1QOBA 1RAXA 2Q5WD 2R61A 3WANA 1NYQA 1TKYA 3B2FA 2J0MA 2LGYA 2NTSA 3TCAA 4WAFA 3DBLI 1JRPA 3P42A 3BINA 1NI2A 2DZJA 3NZSA 2GB1A 3IT4B 4CO7A 3AE6B 3DPDA 3BZDB 2ZNVC 3I63C 3HVZA 4MGIE 5IOIA 2LGIA 1I35A 4DXAB 2IYDB 1ZXIA 2M0AA 4LNKA 2JYEA 1UF0A 1EU4A 2C7NB 4GDLA 2Z8LA 1E10A 3N1ZC 1NENB 3P4PB 2G45B 5L83A 5TR5A 2WX1A 2K25A 1LQBA 1UNSA 2WDQB 4HK2A 2KHWB 4FJYA 2WHIA 1RRBA 3LXFA 1YQBA 2J42A 2MJ3A 2N4FA 2RD0A 2WXPA 4MSQB 1IP9A 4FBJB 4JE3B 2TSSA 2KLGA 4WWNA 4K81A 2N1WA 5T8IA 3AEDB 1TS3A 2KC2A 1F1HA 2WWZA 3AEAB 1OEYJ 2LMCA 3EFCA 1AARA 1VLBA 3QX1A 3C8YA 3APFA 4RM8A 4RNAA 1TZ1A 3QHTA 1KLUD 4ZHPA 5DCNA 3RYTA 2MQJA 5G2NA 1C78A 1D5XC 2XN9C 3W5UB 4ANWA 4GDLB 1J7AA 1BMLC 2LVOA 2KTRA 4KGRA 2PW9A 2KXJA 4WQOB 2DNFA 3BIID 3BVGA 3U52E 3TEZA 4DDGD 2NBWB 4BAXA 1DGJA 3ZNID 5D6JB 1PYWD 4KVGB 4NZLB 3ECIA 2K1FA 3RNAC 1T3QA 4P7IA 3RCZA 4F7ZA 4A20A 2MX2A 3JYUA 4DHZE 2KVZA 2FAZA 3CMMB 2WNMA 3VH4B 4YTNB 3R8BA 3X0WA 5DPWA 3ONSA 1V1OA 2FIFA 2DAJA 1P1AA 3RNFC 4XWWA 2KFJA 3TBLD 2KTRB 3HUIA 2IO0B 3RN9C 1R4NI 3SD5A 1N63A 4K3CA 1PGBA 4W9KA 2KO3A 2DYBA 3AE8B 2KQSA 2CR5A 4BKSA 1SE2A 2BB6A 3N9YC 2J0JA 3IFWB 3ZKJC 2CHXA 2G9HD 2IDYA 3K9OB 5IAAC 3JSVA 3OG5A 3Q3MC 3PHWB 3IXSA 1XLQA 3NS8A 1GUAB 2H89B 1VJKA 5CHWA 3GE8C 4TV3A 4HKQA 2WU5B 4B9KA 4AP4C 4WURA 3EFUA 3V05A 4ZRJA 1V8CA 4JLCA 1ZGUB 2EKEC 4MH8A 1MFWA 2N7DA 4IOIE 5FR3A 4XYCA 1IBXA 1TBEA 3R66C 2L76A 2KACA 1MPEA 1FMAD 2G4SA 2K39A 1FXAA 4M02A 2KVRA 1J0GA 3JSVB 4NAWA 4A9AA 2LRUA 3TEYA 2INNE 5L95C 2UWQA 5HFYA 2N7JA 3ZRFA 2ZZPB 1JWMD 2B3AA 3I3TB 3NUHB 4HWIB 2L8JA 4OVUA 2N7EA 2L1AA 2JY6A 4IDIA 3NVWA 3PPAA 3CSTA 4HCNB 1KF6B 4US9A 1WZ3A 2G1EA 2HTHA 1QOGA 3KUCB 1E7PB 2BT6A 1IBXB 4ZHOA 4HROA 4N6EB 1STEA 1EUVB 2KJHB 1Q10A 3OWEB 1XO3A 4K7UA 1ZDXA 3O65B 4KSKC 2WXQA 2NTTA 4NAWB 2AX5A 4LCDE 2KMAA 2V4IB 1J7CA 2KFKA 1QILA 1H8CA 4ANVA 1ET6A 3RZFA 3E56A 4KZCA 3VDZA 3WAMA 2JF5A 4FJVB 4GB9A 3B1LX 1SF0A 2CKHB 2HE7A 3S2AA 5BYRA 3W2DA 2L7RA 3KYDD 3RNCC 3DOWA 3AU5A 4URKA 3EECA 1UGJA 2YEPF 2GBRA 1I4GA 4TUUA 4I6PA 3V6EB 2KWDA 1N61A 2X38A 3N1YC 2GOWA 2R2QA 3L16A 5TSSA 4W9DA 3Q8EA 3R3MA 3RD2A 4DXFA 4A3PA 2XNAC 2C7HA 3L08A 4OW0A 4M8MA 4XC2A 2D2QA 1CJEA 1K52A 4C4VA 1WZ0A 4TQ1A 1A70A 2KFKB 4HJGE 4ASWC 1AWDA 4XX5A 1TGZB 3DBSA 4E71A 3ZXVA 2PE9A 5JXVA 2M0XA 3GP7A 4WWPA 2K8CA 3DVGX 2EMSA 3A4SC 4ARIA 2YEPB 3QJZA 4AQ7A 4KZ0A 2AQ2B 3P1MA 3QC8B 2ACZB 3U4EG 1JRUA 2CJOA 4KSLC 4M00A 4LJPB 4DHZB 1QT9A 1XCQL 2H88B 2GRIA 2PVGC 1OGWA 3NG0A 1WFYA 3AV8A 3IG3A 4PS3A 2LGDA 2JT4B 4YSZB 1KJTA 4HJKA 1UGMA 1QQRA 1X1MA 4M8NA 3ZUNA 2FUHB 3GB1A 4WQMA 5BMIA 5H92C 1NYRA 4C80A 3AE7B 5MPOA 5IN7A 5HKHA 3PRMB 2QSDA 1V81A 4BZAA 1FRRA 3E9SA 2O6VA 4C4VB 4IWQA 2D3AA 2INCC 4B6WA 5EE9A 1HQRD 3PV1A 1T0YA 1OQQA 2KDEB 2GI9A 3CWIA 3I5JC 2QC8A 1J19A 1I4RA 3VUXA 2AL6A 2L83A 1MHXA 3FKYA 5KHQA 4REZA 2EKIA 1EO6A 4XE0A 1VD2A 4ARCA 5LXHA 1GJZA 1MHHE 2BF8B 1P98A 4W9CA 4BBNF 2WX0A 1LXDA 1L4DB 5EDSA 1V1PA 2CHWA 1Q1OA 2WLBA 1P3QU 2WDTB 4G3XB 1GB4A 4IM3A 1ZKHA 2O6VB 2Y5CA 4YT0B 3RT3B 3LB8C 2Y3AA 1CQVA 2L32A 3O13A 5J17A 4OZCA 3VAWA 4NQKE 3DHHC 3MHZA 4LTUA 3LYYA 4FULA 3KLSX 2IJ0A 2NBVB 3TIXA 4ZOHC 2MP2A 3AECB 3VR8B 1E90A 2INDC 4CYEA 1B1ZA 3OJ4B 2ZVOA 2FIDA 2CU1A 3AH7A 1PUTA 1V1PB 4RF1A 1FFVA 1Y8RC 3U7ZA 3IAM1 1QF6A 4DHJD 4BOZB 4YSYB 1M94A 4NY0A 3VH3B 1G6JA 3ZDTA 4WJPA 2VZKD 4AOFA 4W9EA 3TL5A 2W3SA 4FADA 5AZHA 1R4NB 1HA5A 4C00A 4BKGA 4RFBA 2ZVNA 2RDBC 5HG2A 5G5GA 4ICVA 2V0GA 2MBBB 1T6BX 4BVUC 1E5WA 1WGRA 1WRDB 2MP2B 4S0RA 2ON8A 4PS7A 1D6EC 1P7EA 2MLBA 3KUDB 4H2AA 1TIFA 4MM3A 1V5OA 1B9RA 2JU6X 3Q3FA 2UYZB 2L52A 1TYGB 4I6LB 1RFKA 1WXAA 3WALA 4LDTD 2LUEA 5IO9A 2WXNA 3DWGC 4NQLB 1C4AA 1UELA 4MELA 2XBBC 3RMKC 4TSSA 2LHEA 4L1BA 4NPNA 1LO5D 1WXQA 2MH7A 3J9CA 1SE9A 3B9JA 1QOAA 4MEMA 2RPQA 3AN1A 2UU7A 4RMAA 4X57B 3SDLC 1UZXB 2B76B 1N60A 2K8BA 3RZWC 1LFDA 3A9KA 5BYSA 2KAJA 1OQRA
chains in the Genus database with same CATH topology
1MJDA 2BQQA 5IKCM 5IP4D 1MFWA 2DNFA 1UF0A 1MG4A 5IO9A 5IN7A 5IOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MJD A;  2BQQ A;  5IKC M;  5IP4 D;  1MFW A;  2DNF A;  1UF0 A;  1MG4 A;  5IO9 A;  5IN7 A;  5IOI A; 
#chains in the Genus database with same CATH topology
 3I57 A;  3GOE A;  2G4D B;  1FRD A;  2LVP A;  4MM3 B;  1TS4 A;  1C9F A;  1L0V B;  1MG8 A;  2CHZ A;  2A5U A;  2IO3 B;  1I4P A;  1ZPS A;  1I42 A;  1R4M B;  3U30 A;  2DHZ A;  1I4H A;  1EM7 A;  1UWX A;  2V4L A;  2PTL A;  2BGF A;  1E9M A;  2LXC A;  3PRP B;  4JPS A;  3UIP B;  2KJ6 A;  2GBM A;  1KFY B;  1C1Y B;  1N6Z A;  2ZW1 A;  3SR6 A;  5AUI A;  3RFZ B;  2OHF A;  3ZNG C;  1E6E B;  1UUP A;  1WWT A;  1ZUD 2;  2JRI B;  4K7S A;  1EF1 A;  1V80 A;  2N9X A;  4MSM B;  1DYQ A;  1E7U A;  3A9K B;  5AZF A;  1YD8 U;  3M3J A;  4GGQ A;  3NVY A;  1JCK B;  1WMH A;  3ZTC A;  1VZ6 A;  4GIV A;  2GBK A;  4RM9 A;  2LI5 A;  2BPS A;  1WGD A;  2JPH A;  2MRP A;  4HKZ E;  2BBC A;  1SE4 A;  3HHM A;  5IA7 A;  3VQI A;  4CQN A;  3RNG C;  4ZRI A;  4EZL A;  2WXH A;  4A6Q A;  3NHE B;  3ML8 A;  1TKE A;  1KTK A;  1EWY C;  2MJD A;  3H1U A;  3Q8C A;  3TEW A;  3BK2 A;  3VRA B;  1VZ8 A;  2HTM E;  4IM0 A;  3B2G A;  3ZQ4 A;  1EU3 A;  2KDI A;  5JZE B;  2KYW A;  1WX9 A;  1ET9 A;  2ZPY A;  2NMQ A;  3Q14 C;  3RNE C;  1WMH B;  2MBQ A;  4BFR A;  3MJ5 A;  1KLG D;  1SIF A;  2M19 A;  2IGG A;  3EHV A;  1AN8 A;  2DZI A;  3Q8A A;  1HXY D;  1HE8 A;  3MHS D;  1KLV A;  2J0K A;  3HVD A;  2WS3 B;  1DOI A;  3A1Q A;  3P4R B;  4W9J A;  3UF8 A;  4ACF A;  1UD7 A;  4TMA B;  3C0R B;  2XEW A;  3L13 A;  2RDH A;  3AE1 B;  4WWO A;  2WP9 B;  4IWP A;  3N30 A;  4B95 A;  4KGS A;  4RGT A;  2GMI C;  2AEH A;  2PIA A;  4EUT A;  1SBB B;  4K7W A;  4OVV A;  4EKU A;  2RGF A;  2KQ7 A;  1XXG A;  3AE4 B;  1C3T A;  1TS5 A;  4ZRP A;  1WR1 A;  2WXG A;  2Y5B B;  2CU3 A;  1UH6 A;  1WE6 A;  4GN1 A;  1P0R A;  1YMH E;  2MBH A;  3EA6 A;  2QIE B;  4A55 A;  3ZDM C;  3A1Q B;  3M95 A;  5C2T B;  1V5T A;  3AUL A;  2AWT A;  4AUQ C;  3AU4 A;  2KC1 A;  2HDE A;  2ZW0 A;  3PZ7 A;  1Z2M A;  1DOX A;  4DWF A;  2M1M A;  2K8H A;  2C9W B;  2NVU I;  1C79 A;  4EFO A;  4BKS D;  2JVC A;  3IHP C;  5C1Z A;  4ANX A;  3Q69 A;  4HPL B;  5CHF A;  4GOC A;  2KLC A;  3JW0 X;  1FD6 A;  4P6V F;  4LLG M;  1R4M I;  4N59 A;  2IY0 B;  3Q3N C;  3QA8 A;  5CX3 A;  4RF0 A;  3HRD D;  2WXF A;  4M0W A;  4J6I A;  3UQB A;  2IY1 B;  2DYO A;  2Y5P A;  4B0E A;  3ZGZ A;  4IW0 A;  3ZYY X;  3KYC D;  3PO0 A;  3PLV A;  1LGR A;  2KMM A;  4IWO A;  2V3S A;  4TQ0 A;  3PGE A;  2XK5 A;  2WQY B;  2DYM A;  2Z0E B;  3AEB B;  1JQ4 A;  3AEG B;  3DVG Y;  1VDV A;  2PLP A;  4G0N B;  3DBR I;  2REX A;  4HDO A;  1I4X A;  1JWB D;  4KKI A;  3WCQ A;  4PK1 A;  2K9X A;  1C4P A;  1QKZ A;  4KX6 B;  4MGK E;  2K22 A;  2O2V A;  3QAR A;  1A5R A;  4E3C A;  4L23 A;  3QQ8 B;  2IGD A;  1GC6 A;  3WAP A;  2VH2 A;  2I1J A;  4FLH A;  2HJ1 A;  4S17 A;  4R3D A;  3HIZ A;  1QLB B;  1KM7 A;  5HHD G;  1ISN A;  4XGA B;  5BO4 B;  4OVZ A;  1V2Y A;  4M0W B;  2MSE D;  1K53 A;  2IGH A;  2WDV B;  3W1S A;  2C7M B;  3VTU A;  3IAS 1;  4G11 A;  4AWJ A;  5C3J B;  1P9D U;  2BQQ A;  2KZR A;  4GLS C;  2XK5 B;  5FR6 A;  3URY A;  3V62 A;  3SFD B;  4LJO B;  5BYQ A;  3T9L A;  5C23 A;  2ZEQ A;  5E6J A;  4A8X C;  2WGS A;  1FNV A;  4Q2J A;  5J18 A;  1D5M C;  1QZE A;  3IBE A;  4GU2 A;  1N5W A;  2O2V B;  4NJC A;  2FCM A;  3QK0 A;  1WM2 A;  3ABV B;  4J3O D;  3TMP B;  2VRR B;  2KX0 A;  3X23 A;  2ICI A;  3H7S A;  4HEA 1;  3RUI B;  5FKA C;  1BXT A;  3A33 B;  4W9H A;  3H7P A;  2ZPN A;  2MBE A;  1GG3 A;  1RWS A;  1Q5W B;  1WXS A;  1EWC A;  4IC7 B;  2BB5 A;  5DPS A;  1FO4 A;  3DHG C;  5DPT A;  3MJW A;  3WAO A;  1E8X A;  3W1Y A;  3C19 A;  4XWT A;  2KN4 A;  3P4S B;  3NRZ A;  1S1Q B;  3W9C B;  2WXO A;  1S3S G;  2ASQ A;  4RCO A;  2NS5 A;  2AL3 A;  2IO1 B;  3ZRC A;  5JHA A;  5G5H A;  1T5X D;  3DCG A;  1TS2 A;  4US8 A;  1JRO A;  2DWQ A;  3RPF C;  1Z5S B;  1SGH A;  4LNN A;  2RR9 A;  2Z59 B;  2LUM A;  4PYZ A;  4ITK A;  3QAQ A;  4OHJ A;  4FXC A;  3N32 A;  3H7P B;  1HZ5 A;  2PVO D;  2RSU A;  3TSS A;  1D3Z A;  1FPY A;  3NJT A;  1XF5 L;  2KT7 A;  2INP E;  3ZLZ A;  2I2Y A;  3SFE B;  5D3I B;  2WXI A;  4XDD A;  4C7Z A;  3ZJV A;  2V1Y A;  2BTE A;  1PDX A;  3OLM D;  4B0M A;  3N3K B;  3U2S C;  1V97 A;  3KH0 A;  2BKR B;  3CIR B;  4WJO A;  4YSX B;  1XEE A;  2BS4 B;  1T0R C;  2LD9 A;  2MJE A;  3ZW3 A;  4KDL B;  2O6V D;  4NJ6 A;  3NVV A;  1WJN A;  1L2N A;  2MW5 A;  2QHO A;  3TEX A;  1BT0 A;  2J53 A;  2L0T A;  3AE3 B;  1ESF A;  4ZYN A;  2NPT A;  3V61 A;  3N20 C;  1FFU A;  5D2M B;  2N1V A;  5EE0 A;  4WH4 A;  1VRA B;  2KK8 A;  5BMG A;  4ANU A;  3HK0 A;  2N9E B;  2MA9 B;  3R2I A;  3I9V 1;  2OED A;  3PT2 B;  2R2O A;  1AW7 A;  4MJS A;  1SEB D;  1I7H A;  1IPG A;  4LNO A;  3ZNH B;  2WU2 B;  3NY5 A;  1CK1 A;  1ACC A;  4MH0 E;  4WJN A;  3BWU D;  4PYU A;  2MCN B;  4ICU A;  1FNU A;  1SSN A;  4YTM B;  1J7B A;  3NZ3 A;  1WM3 A;  2WDR B;  4GXB A;  1TTN A;  2LVQ A;  4D2K A;  3V60 A;  4NNJ B;  1YIW A;  4KV2 A;  4FHJ A;  1L6V A;  3ALB A;  3PLU A;  4BBN C;  2LAS A;  2LZ6 A;  2NPT B;  3HM6 X;  3IVF A;  1NI3 A;  4W9G A;  1YNT E;  5IP4 D;  3MFG A;  4IUM B;  1L4Z B;  5LNK 1;  3VHT C;  2JYT A;  2BYF A;  4OZA A;  3QIJ A;  4W9F A;  4MJS B;  2WXL A;  3DVN V;  5E6O A;  4HDQ A;  2V9H A;  4ZRQ A;  4YXD B;  1GOZ A;  2KX3 A;  3P63 A;  5AEK B;  3U8Z A;  2NR2 A;  3R2T A;  2C60 A;  5I4D A;  3L10 B;  1UBI A;  2DAF A;  3BY4 B;  3NZU A;  3VVW B;  3L17 A;  1F2R I;  4IG7 B;  1YN4 A;  3AI5 A;  1GPX A;  1K8R B;  4LDT B;  4RH6 A;  1JWA D;  1ENF A;  4EZK A;  2L3Z A;  4II3 B;  3LDZ E;  2ZNV B;  2FUG 1;  4USA A;  4BOS C;  3BYY B;  1EF5 A;  4FHK A;  2KWV B;  2PE6 B;  1WRI A;  1WF9 A;  1XQQ A;  4AS1 A;  1XLN A;  4G50 A;  1RFA A;  2GBN A;  3AE5 B;  2BW2 A;  2PKO A;  3RUL A;  3APD A;  2DZK A;  3KW5 B;  1F77 A;  3AE2 B;  3APC A;  1OTR B;  2D5G A;  4HVB A;  3NS1 A;  5D7G A;  2WXR A;  1KOT A;  2QCZ A;  1HTQ A;  4PT5 A;  3UGB B;  3KQ4 A;  4ZYS A;  2D10 A;  1YJ1 A;  4DQO C;  1WI0 A;  4C7Y A;  4KIK A;  1YN5 A;  1FNW A;  3KWL A;  1SXT A;  4FN2 A;  4UDU C;  1NVI D;  1WJU A;  1WX7 A;  3P2B A;  1D5Z C;  3L4P A;  1MG4 A;  2J4X A;  2M4N A;  4M01 A;  1IGC A;  3PTF C;  3DBR B;  3ZXR A;  2AQ3 B;  3UQA A;  2KOX A;  4JGH B;  2E6X A;  4FJZ A;  2K3U A;  1FEH A;  3CF6 E;  1V9J A;  2KN5 A;  4RGO S;  1AYF A;  2BYT A;  3GS2 A;  4F1S A;  1ZW7 A;  1CMX B;  3WA0 A;  3VTW A;  4LNF A;  2KAN A;  2NCN A;  4DXG A;  2LXA A;  4EOY A;  2L05 A;  5GXG B;  2HJ8 A;  2DLB A;  1T0Q C;  2QMT A;  1VCB A;  3V3X A;  4YWG G;  2FBW B;  4MGY E;  5LXI B;  2LGX A;  3ZJU A;  2RMM A;  4JWU C;  4KIK B;  3ZIM A;  3BVZ A;  3PZ8 A;  2D07 B;  1YOV B;  2QJL A;  1FM0 D;  1GAQ B;  3AMZ A;  4HCP B;  2BYE A;  2IPK D;  4W9I A;  3FIL A;  1TZO A;  3AEF B;  1WH3 A;  4WWM A;  1WE7 A;  2QEJ C;  1F0Z A;  4DK5 A;  2V3P A;  2DEN B;  2KDM A;  3R7Q A;  3MP9 A;  2J52 A;  1ROE A;  3TUO A;  1K50 A;  1L0X B;  2KD0 A;  1Q0W B;  4DDI D;  3H9D A;  1JWS D;  4F8C B;  2JUO A;  1IGD A;  4P1C C;  3T3O A;  3GZN I;  2WXJ A;  3MTN B;  4YTP B;  3AM9 A;  1WGG A;  4LK0 M;  2MHJ A;  1YJJ A;  3DHI C;  1IUE A;  4GDK A;  4NJ7 A;  5E6P A;  1BUI C;  1MI0 A;  1IYF A;  1WR6 E;  1KRH A;  3V6C B;  1HEZ E;  2JRH A;  2KNB A;  2PPH A;  3UIO B;  3FIL B;  3T3N A;  4ZRK A;  3MC0 B;  1M4V A;  1SJH D;  5EE3 A;  4GSW A;  4AJW A;  2ZJD A;  2DX5 B;  2QIL A;  1FIQ A;  3VR9 B;  2W9N A;  3CSF A;  1RM6 C;  2ONQ A;  3IT6 B;  2IO2 B;  4BKT A;  4NAM A;  1PFD A;  2CJN A;  1XLP A;  3N1X C;  2JZ3 B;  3VUW A;  1U4A A;  2G3Q B;  2KJR A;  4GDK B;  1TT5 B;  3NVZ A;  2PMV A;  1V86 A;  3KUZ A;  1WYW B;  2VH1 A;  4CHK A;  1ZDV A;  4O1N A;  5AZG A;  4MGZ E;  1GB1 A;  1RYJ A;  4WJQ A;  3MC9 A;  1N62 A;  2K0P A;  3DBH B;  2KMC A;  3PRZ A;  1FXI A;  2ZCC A;  4EEW A;  1YJI A;  1I4Q A;  4P16 A;  2QDF A;  2LRW A;  4LNI A;  4A90 A;  2N9L A;  1WXV A;  1K51 A;  3L54 A;  4JQW C;  2D11 A;  2DZM A;  3MC8 A;  5LLI A;  1WGY A;  2BYV E;  3WIM A;  2BS3 B;  2FCN A;  3ZNZ B;  2M8S A;  3R7R A;  1E7V A;  1E0Z A;  3GE3 C;  2EMT A;  3ZO5 B;  1L0Y B;  3Q6B A;  3A4R A;  3M62 B;  1V6E A;  2M17 A;  3Q8B A;  2EEL A;  2I1K A;  2W55 A;  3VUY A;  4IM2 A;  3DDC B;  2OOB B;  1KH0 A;  1D4B A;  1PGX A;  3VTV A;  1NDD A;  2BKF A;  2MEK A;  2L00 B;  1FCC C;  3BVM A;  2D3G A;  1T0S C;  1Y56 A;  1VZ7 A;  2JWZ A;  3KVF B;  3RI7 C;  4MAC A;  2JXT A;  1ZXH A;  4P1B C;  3RNB C;  1HZ6 A;  3EGR A;  3UIN B;  2IBI B;  4YL8 A;  4JIO U;  4A3O A;  1WX8 A;  3PRE A;  2JX5 A;  3FC4 A;  1WGH A;  2JWU A;  1NEK B;  1PQS A;  1WXM A;  3A9J A;  1SJE D;  4GMV A;  1YX6 B;  1E8Z A;  2LFI A;  1JW9 D;  2DBY A;  2RPV A;  3AXC A;  3PHX B;  4K3B A;  5AUK A;  4QAY A;  1ZP0 B;  2JZP A;  2LHD A;  1L6U A;  2W82 A;  3KWV A;  4JL9 A;  3B08 A;  3SHQ A;  1SB3 C;  5DPR A;  1HTO A;  3OAW A;  2FE8 A;  5BMH A;  1F9J A;  2LWP A;  3ZJT A;  1F52 A;  1JWU D;  1LM8 B;  2BS2 B;  2RDG A;  2N9K A;  1YX5 B;  2N0S B;  1YQ3 B;  3DVN U;  2YVC A;  3HM3 A;  3BYT B;  1E8Y A;  1CZP A;  3ZVV A;  1WYG A;  1PGA A;  4W9L A;  4MDK E;  2KDF B;  2LEK A;  4RGM A;  1JAL A;  4KDI C;  1JML A;  1OQY A;  4E74 A;  2GBJ A;  3ZTD A;  1H4R A;  2KWU B;  1ZOY B;  3A9J B;  1GC7 A;  2A4Z A;  3PS6 A;  2AQ1 B;  2LJI A;  1OEY A;  2LGS A;  3Q3O C;  3W5V B;  5E6N A;  1QOF A;  4DBG A;  2WXM A;  3H6N A;  3B0A A;  3P4Q B;  2E3T A;  3DBL B;  3W1S C;  3NOB A;  1J8C A;  1ZE3 D;  2FNJ B;  1F2R C;  1XD3 B;  5H8Y E;  3OJ3 A;  4TKN A;  5D94 A;  5FK9 C;  3AEE B;  5HI1 A;  2KQ4 X;  1P7F A;  2HD5 B;  3ENE A;  2SAK A;  5EE1 A;  4II2 B;  5CHV C;  1MJD A;  4EZJ A;  5GMV A;  2KTF A;  3Q3J A;  4HRS A;  3M63 B;  2GLS A;  2MBO A;  1UWM A;  3DBH I;  5JH5 C;  3PSE B;  2WYQ A;  3DWM A;  2ZCB A;  1WJ6 A;  4WAA A;  3VRB B;  3PVL A;  1C77 A;  3AE9 B;  2WXK A;  4ZDV A;  2C5L C;  3EC8 A;  1TY0 A;  3FAH A;  3L0W B;  2W3R A;  2D3C A;  2BVC A;  1L5P A;  1C4C A;  2NBU A;  5J2R A;  4FA6 A;  2BWF A;  2JXX A;  2OJR A;  1C76 A;  2J7Q B;  2K6D B;  2JZZ A;  2JSV X;  1WJ4 A;  3K9P B;  5G55 A;  4EE2 A;  3D32 A;  1WIA A;  4HPM B;  2D3B A;  4C56 C;  1WY8 A;  1YN3 A;  1XLO A;  4JWS C;  3LJ3 A;  4N9F 4;  2OJW A;  3VXW A;  2N9P C;  3U7D A;  4AJY B;  4MT5 A;  1XT9 B;  1UBQ A;  1L7Y A;  2Z0D B;  1TY2 A;  4IKG A;  4L2Y A;  1R7S A;  3BK1 A;  1N5X A;  1V49 A;  2CS4 A;  3TJP A;  2KKC A;  3VFK A;  2PEA A;  4RGN A;  2KWC A;  1GNU A;  1FXT B;  3QCA A;  5D3D A;  2I38 A;  1TKG A;  2IZV B;  2YLM A;  1E8W A;  3H8H A;  3T8M A;  3ETR A;  4WIP A;  3Q2A C;  2SEB D;  1NBF C;  4N58 A;  1WGK A;  3UI3 A;  4DHJ B;  1MVK A;  1DOY A;  3PZD A;  4PS8 A;  5JHB A;  3AB5 A;  2VZK B;  3GZN B;  2LJ5 A;  2K6Q A;  3ML9 A;  2X8X X;  2V3N A;  1SE3 A;  2BWE S;  3JVZ X;  4HPP A;  4K1R B;  3SEB A;  4OZB A;  2K5P A;  1FCL A;  4HXD A;  2M56 B;  3DQV A;  2KDB A;  2PJH A;  1XCT L;  4HLE A;  2L0F A;  3Q8F A;  2FCQ A;  3QWZ B;  5CTR C;  4I6N B;  1YQ4 B;  2MWS B;  5IKC M;  1VR9 A;  3EUB 2;  3SU8 X;  2AYO B;  5KHO A;  2JQR B;  4XZ4 A;  1OFF A;  2FCS A;  4JX1 C;  1WSP A;  1RLF A;  4KKJ A;  1SIJ A;  4XDC A;  2W54 A;  4KGT A;  1TJE A;  1QOB A;  1RAX A;  2Q5W D;  2R61 A;  3WAN A;  1NYQ A;  1TKY A;  3B2F A;  2J0M A;  2LGY A;  2NTS A;  3TCA A;  4WAF A;  3DBL I;  1JRP A;  3P42 A;  3BIN A;  1NI2 A;  2DZJ A;  3NZS A;  2GB1 A;  3IT4 B;  4CO7 A;  3AE6 B;  3DPD A;  3BZD B;  2ZNV C;  3I63 C;  3HVZ A;  4MGI E;  5IOI A;  2LGI A;  1I35 A;  4DXA B;  2IYD B;  1ZXI A;  2M0A A;  4LNK A;  2JYE A;  1UF0 A;  1EU4 A;  2C7N B;  4GDL A;  2Z8L A;  1E10 A;  3N1Z C;  1NEN B;  3P4P B;  2G45 B;  5L83 A;  5TR5 A;  2WX1 A;  2K25 A;  1LQB A;  1UNS A;  2WDQ B;  4HK2 A;  2KHW B;  4FJY A;  2WHI A;  1RRB A;  3LXF A;  1YQB A;  2J42 A;  2MJ3 A;  2N4F A;  2RD0 A;  2WXP A;  4MSQ B;  1IP9 A;  4FBJ B;  4JE3 B;  2TSS A;  2KLG A;  4WWN A;  4K81 A;  2N1W A;  5T8I A;  3AED B;  1TS3 A;  2KC2 A;  1F1H A;  2WWZ A;  3AEA B;  1OEY J;  2LMC A;  3EFC A;  1AAR A;  1VLB A;  3QX1 A;  3C8Y A;  3APF A;  4RM8 A;  4RNA A;  1TZ1 A;  3QHT A;  1KLU D;  4ZHP A;  5DCN A;  3RYT A;  2MQJ A;  5G2N A;  1C78 A;  1D5X C;  2XN9 C;  3W5U B;  4ANW A;  4GDL B;  1J7A A;  1BML C;  2LVO A;  2KTR A;  4KGR A;  2PW9 A;  2KXJ A;  4WQO B;  2DNF A;  3BII D;  3BVG A;  3U52 E;  3TEZ A;  4DDG D;  2NBW B;  4BAX A;  1DGJ A;  3ZNI D;  5D6J B;  1PYW D;  4KVG B;  4NZL B;  3ECI A;  2K1F A;  3RNA C;  1T3Q A;  4P7I A;  3RCZ A;  4F7Z A;  4A20 A;  2MX2 A;  3JYU A;  4DHZ E;  2KVZ A;  2FAZ A;  3CMM B;  2WNM A;  3VH4 B;  4YTN B;  3R8B A;  3X0W A;  5DPW A;  3ONS A;  1V1O A;  2FIF A;  2DAJ A;  1P1A A;  3RNF C;  4XWW A;  2KFJ A;  3TBL D;  2KTR B;  3HUI A;  2IO0 B;  3RN9 C;  1R4N I;  3SD5 A;  1N63 A;  4K3C A;  1PGB A;  4W9K A;  2KO3 A;  2DYB A;  3AE8 B;  2KQS A;  2CR5 A;  4BKS A;  1SE2 A;  2BB6 A;  3N9Y C;  2J0J A;  3IFW B;  3ZKJ C;  2CHX A;  2G9H D;  2IDY A;  3K9O B;  5IAA C;  3JSV A;  3OG5 A;  3Q3M C;  3PHW B;  3IXS A;  1XLQ A;  3NS8 A;  1GUA B;  2H89 B;  1VJK A;  5CHW A;  3GE8 C;  4TV3 A;  4HKQ A;  2WU5 B;  4B9K A;  4AP4 C;  4WUR A;  3EFU A;  3V05 A;  4ZRJ A;  1V8C A;  4JLC A;  1ZGU B;  2EKE C;  4MH8 A;  1MFW A;  2N7D A;  4IOI E;  5FR3 A;  4XYC A;  1IBX A;  1TBE A;  3R66 C;  2L76 A;  2KAC A;  1MPE A;  1FMA D;  2G4S A;  2K39 A;  1FXA A;  4M02 A;  2KVR A;  1J0G A;  3JSV B;  4NAW A;  4A9A A;  2LRU A;  3TEY A;  2INN E;  5L95 C;  2UWQ A;  5HFY A;  2N7J A;  3ZRF A;  2ZZP B;  1JWM D;  2B3A A;  3I3T B;  3NUH B;  4HWI B;  2L8J A;  4OVU A;  2N7E A;  2L1A A;  2JY6 A;  4IDI A;  3NVW A;  3PPA A;  3CST A;  4HCN B;  1KF6 B;  4US9 A;  1WZ3 A;  2G1E A;  2HTH A;  1QOG A;  3KUC B;  1E7P B;  2BT6 A;  1IBX B;  4ZHO A;  4HRO A;  4N6E B;  1STE A;  1EUV B;  2KJH B;  1Q10 A;  3OWE B;  1XO3 A;  4K7U A;  1ZDX A;  3O65 B;  4KSK C;  2WXQ A;  2NTT A;  4NAW B;  2AX5 A;  4LCD E;  2KMA A;  2V4I B;  1J7C A;  2KFK A;  1QIL A;  1H8C A;  4ANV A;  1ET6 A;  3RZF A;  3E56 A;  4KZC A;  3VDZ A;  3WAM A;  2JF5 A;  4FJV B;  4GB9 A;  3B1L X;  1SF0 A;  2CKH B;  2HE7 A;  3S2A A;  5BYR A;  3W2D A;  2L7R A;  3KYD D;  3RNC C;  3DOW A;  3AU5 A;  4URK A;  3EEC A;  1UGJ A;  2YEP F;  2GBR A;  1I4G A;  4TUU A;  4I6P A;  3V6E B;  2KWD A;  1N61 A;  2X38 A;  3N1Y C;  2GOW A;  2R2Q A;  3L16 A;  5TSS A;  4W9D A;  3Q8E A;  3R3M A;  3RD2 A;  4DXF A;  4A3P A;  2XNA C;  2C7H A;  3L08 A;  4OW0 A;  4M8M A;  4XC2 A;  2D2Q A;  1CJE A;  1K52 A;  4C4V A;  1WZ0 A;  4TQ1 A;  1A70 A;  2KFK B;  4HJG E;  4ASW C;  1AWD A;  4XX5 A;  1TGZ B;  3DBS A;  4E71 A;  3ZXV A;  2PE9 A;  5JXV A;  2M0X A;  3GP7 A;  4WWP A;  2K8C A;  3DVG X;  2EMS A;  3A4S C;  4ARI A;  2YEP B;  3QJZ A;  4AQ7 A;  4KZ0 A;  2AQ2 B;  3P1M A;  3QC8 B;  2ACZ B;  3U4E G;  1JRU A;  2CJO A;  4KSL C;  4M00 A;  4LJP B;  4DHZ B;  1QT9 A;  1XCQ L;  2H88 B;  2GRI A;  2PVG C;  1OGW A;  3NG0 A;  1WFY A;  3AV8 A;  3IG3 A;  4PS3 A;  2LGD A;  2JT4 B;  4YSZ B;  1KJT A;  4HJK A;  1UGM A;  1QQR A;  1X1M A;  4M8N A;  3ZUN A;  2FUH B;  3GB1 A;  4WQM A;  5BMI A;  5H92 C;  1NYR A;  4C80 A;  3AE7 B;  5MPO A;  5IN7 A;  5HKH A;  3PRM B;  2QSD A;  1V81 A;  4BZA A;  1FRR A;  3E9S A;  2O6V A;  4C4V B;  4IWQ A;  2D3A A;  2INC C;  4B6W A;  5EE9 A;  1HQR D;  3PV1 A;  1T0Y A;  1OQQ A;  2KDE B;  2GI9 A;  3CWI A;  3I5J C;  2QC8 A;  1J19 A;  1I4R A;  3VUX A;  2AL6 A;  2L83 A;  1MHX A;  3FKY A;  5KHQ A;  4REZ A;  2EKI A;  1EO6 A;  4XE0 A;  1VD2 A;  4ARC A;  5LXH A;  1GJZ A;  1MHH E;  2BF8 B;  1P98 A;  4W9C A;  4BBN F;  2WX0 A;  1LXD A;  1L4D B;  5EDS A;  1V1P A;  2CHW A;  1Q1O A;  2WLB A;  1P3Q U;  2WDT B;  4G3X B;  1GB4 A;  4IM3 A;  1ZKH A;  2O6V B;  2Y5C A;  4YT0 B;  3RT3 B;  3LB8 C;  2Y3A A;  1CQV A;  2L32 A;  3O13 A;  5J17 A;  4OZC A;  3VAW A;  4NQK E;  3DHH C;  3MHZ A;  4LTU A;  3LYY A;  4FUL A;  3KLS X;  2IJ0 A;  2NBV B;  3TIX A;  4ZOH C;  2MP2 A;  3AEC B;  3VR8 B;  1E90 A;  2IND C;  4CYE A;  1B1Z A;  3OJ4 B;  2ZVO A;  2FID A;  2CU1 A;  3AH7 A;  1PUT A;  1V1P B;  4RF1 A;  1FFV A;  1Y8R C;  3U7Z A;  3IAM 1;  1QF6 A;  4DHJ D;  4BOZ B;  4YSY B;  1M94 A;  4NY0 A;  3VH3 B;  1G6J A;  3ZDT A;  4WJP A;  2VZK D;  4AOF A;  4W9E A;  3TL5 A;  2W3S A;  4FAD A;  5AZH A;  1R4N B;  1HA5 A;  4C00 A;  4BKG A;  4RFB A;  2ZVN A;  2RDB C;  5HG2 A;  5G5G A;  4ICV A;  2V0G A;  2MBB B;  1T6B X;  4BVU C;  1E5W A;  1WGR A;  1WRD B;  2MP2 B;  4S0R A;  2ON8 A;  4PS7 A;  1D6E C;  1P7E A;  2MLB A;  3KUD B;  4H2A A;  1TIF A;  4MM3 A;  1V5O A;  1B9R A;  2JU6 X;  3Q3F A;  2UYZ B;  2L52 A;  1TYG B;  4I6L B;  1RFK A;  1WXA A;  3WAL A;  4LDT D;  2LUE A;  5IO9 A;  2WXN A;  3DWG C;  4NQL B;  1C4A A;  1UEL A;  4MEL A;  2XBB C;  3RMK C;  4TSS A;  2LHE A;  4L1B A;  4NPN A;  1LO5 D;  1WXQ A;  2MH7 A;  3J9C A;  1SE9 A;  3B9J A;  1QOA A;  4MEM A;  2RPQ A;  3AN1 A;  2UU7 A;  4RMA A;  4X57 B;  3SDL C;  1UZX B;  2B76 B;  1N60 A;  2K8B A;  3RZW C;  1LFD A;  3A9K A;  5BYS A;  2KAJ A;  1OQR A; 
#chains in the Genus database with same CATH homology
 1MJD A;  2BQQ A;  5IKC M;  5IP4 D;  1MFW A;  2DNF A;  1UF0 A;  1MG4 A;  5IO9 A;  5IN7 A;  5IOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...