1L4ZB

X-ray crystal structure of the complex of microplasminogen with alpha domain of streptokinase in the presence cadmium ions
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
136
structure length
125
Chain Sequence
MIAGPEALLDRPSVNNSQLVVSVAGTVEGTNQDISLKFFEIDLTSRAMPHKLEKADLLKAIQEQLIANVHSNDDYFEVIDFASDATITDRNGKVYFADKDGSVTLPTQPVQEFLLSGHVRVRPYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/blood clotting
molecule keywords Plasminogen
publication title Effects of deletion of streptokinase residues 48-59 on plasminogen activation.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 125
sequence length 136
ec nomenclature
pdb deposition date 2002-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.180 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1l4zB00
1L4ZB 1QQRA 1BMLC 1L4DB 1C4PA
chains in the Genus database with same CATH superfamily
2K25A 4ZRPA 5FR3A 2ON8A 2D3AA 2W54A 1DGJA 1MFWA 1YN3A 4B0MA 2Y5BB 4KZ0A 3U7DA 2WYQA 1AW7A 3I9V1 2A4ZA 4JWSC 5BMGA 1WM2A 3FAHA 1FXIA 3A9JA 3P4QB 3AV8A 1R4MI 2LVPA 2Y5CA 4ZRJA 1KTKA 2REXA 2AWTA 1LFDA 2MCNB 3NS8A 1VZ7A 1WFYA 4HDOA 2KJRA 2FBWB 3H7SA 4WJPA 3PS6A 2K39A 4ZRKA 1K52A 3DBRI 2BBCA 2L3ZA 1L6VA 5IA7A 4GDLB 1VLBA 3V6CB 2NVUI 4O1NA 1WJNA 2K8BA 3E56A 2C5LC 3AE1B 2N9LA 2L52A 2Z8LA 3QAQA 4RNAA 4JIOU 2CU3A 2PVGC 3A33B 2YEPB 4QAYA 4II2B 2RR9A 2KT7A 3SHQA 2BYEA 3PPAA 1YQ3B 2WP9B 2LD9A 4E3CA 1WMHB 2C7NB 4JGHB 3ONSA 2RGFA 2RDBC 3P2BA 4N6EB 4MJSA 4KKIA 3QK0A 4TQ0A 1KLVA 2LMCA 2WWZA 5EE3A 1ZDXA 3QJZA 4ICUA 2KO3A 2KWDA 1ROEA 3PGEA 3I57A 3LYYA 3AE4B 2ZVOA 4YTPB 3PSEB 2XEWA 3N1ZC 3PHWB 1QZEA 2KX3A 2NBUA 2Z0DB 4OVUA 3L16A 4F7ZA 1NEKB 3DHHC 3U8ZA 2ZCCA 1E8WA 5TSSA 3LB8C 2ZJDA 1TS4A 4ITKA 3FILA 1E7VA 1TS5A 1E10A 2KTRB 5J17A 3AULA 2LRUA 3Q3NC 5IOIA 2IGHA 3VXWA 1PGXA 4BVUC 4AS1A 1XLNA 5AZFA 1EWYC 3LXFA 4USAA 3MJ5A 5L83A 1J7CA 2HTME 1C1YB 5BYQA 4TUUA 3RNCC 1F52A 2N7JA 2KWVB 2DX5B 2KFKA 1SB3C 1LO5D 2K9XA 2K5PA 1GUAB 4BKGA 3B1LX 1TKYA 4OZCA 1WGDA 2IZVB 1TGZB 3TEXA 2DWQA 3ZNGC 4ZOHC 3ZGZA 1WH3A 4L23A 1PDXA 5AEKB 1N5WA 3C19A 1V49A 4NJ7A 1XD3B 3AEDB 2NCNA 3KUDB 3KUZA 4WWNA 3B2GA 3ABVB 2N9EB 3MC8A 4PYZA 3VUWA 4S17A 1SJHD 1IBXA 3TL5A 4JPSA 4FADA 3DBRB 4C00A 2KN5A 3SR6A 2PLPA 2AX5A 2INPE 3TSSA 3AEGB 1DYQA 1RYJA 2FUG1 1WGGA 4HCNB 3I5JC 3APFA 4FJVB 4ZHPA 3T3NA 5IKCM 1FNWA 3SEBA 4HVBA 4RGOS 1ZKHA 1KH0A 1PGBA 2GRIA 2HE7A 2J0MA 4MACA 2J53A 3DBHB 1QKZA 3MC0B 1TY2A 2HTHA 1WJ6A 4W9IA 4KSLC 4IG7B 1DOIA 1JALA 4AWJA 1VDVA 3QHTA 2RSUA 1XCQL 2QHOA 1E8YA 1WE6A 2DZKA 4HROA 4DXGA 3CF6E 1R7SA 1HTQA 2WX1A 4TV3A 2DBYA 1H4RA 3W1YA 1I42A 3AN1A 3IG3A 3I63C 4ANXA 1K53A 2ICIA 1UF0A 2QEJC 3SFEB 2JRHA 2K8HA 4BFRA 2JF5A 2FNJB 2RPQA 4WAFA 3DPDA 3N30A 3MHSD 2WX0A 2LGIA 4UDUC 2DZMA 4US8A 1IP9A 3KUCB 2MJDA 1CK1A 1C79A 2BKFA 1YD8U 4H2AA 2IO0B 2K22A 3OWEB 3ZJUA 2QSDA 5CHWA 4FN2A 1YQBA 4JQWC 3KW5B 1JWUD 5EE0A 2IGDA 3X23A 1E8XA 2IY1B 3H6NA 3V60A 4G11A 1I4RA 2WLBA 3RUIB 5E6OA 2ZCBA 4ZYNA 1HTOA 5D3IB 1SJED 1AWDA 2L0TA 5E6JA 4IM0A 4DXAB 2D10A 3TCAA 4ARIA 3ZLZA 2KKCA 4MGIE 1N61A 2KDEB 2BS2B 3VQIA 2AYOB 2W82A 1L0VB 2JY6A 2ACZB 5D3DA 3SDLC 1L0YB 1V2YA 2WU2B 1H8CA 4KV2A 5AUKA 5IN7A 2BYTA 2CR5A 2N7DA 4EEWA 3AEEB 2JX5A 3CIRB 1OQYA 2BPSA 2JXTA 3HVZA 1YJIA 1VZ8A 1SE4A 2D2QA 2AQ2B 3ZYYX 4WJNA 3L17A 5HKHA 4MM3A 1HXYD 2KZRA 1UELA 1MJDA 1VZ6A 2X8XX 4NPNA 1ZE3D 3ZUNA 2KXJA 1BMLC 3B2FA 1UBIA 2Q5WD 1JROA 2MBBB 4N58A 1XQQA 3GE3C 4HKZE 1LQBA 2CJOA 1ISNA 2R2OA 1WE7A 3ZQ4A 3DWGC 5LLIA 4NJ6A 1NYQA 2EMTA 2GI9A 2GBJA 2LGXA 2O6VD 3NJTA 1R4NB 1V80A 4HPMB 2B3AA 1L4DB 4B0EA 2L8JA 3NS1A 2FAZA 1E7UA 4A20A 1FXAA 2VZKD 1PGAA 1BUIC 4EKUA 4US9A 2KDFB 1FM0D 2J52A 2RD0A 1YX6B 1OEYJ 3IAM1 4DQOC 4DDGD 4LNFA 3UINB 2V3SA 1V6EA 2WDVB 3A9KB 3DHIC 1K51A 2FCMA 1YOVB 3GP7A 3L08A 4HJKA 4HPLB 3RZFA 1WR6E 1KOTA 4URKA 2GOWA 3P4RB 2SEBD 1QT9A 2GB1A 3ZNID 3ZO5B 2OOBB 3H8HA 1SF0A 3RNAC 2TSSA 1SE2A 2ZZPB 1C78A 2LHEA 1ZOYB 1I4HA 3A4RA 4P1BC 3DBLB 3ML8A 4W9JA 1QQRA 2K3UA 1FMAD 3GZNB 2DZIA 3Q3FA 3APCA 4GB9A 4NAWA 2C7HA 5HFYA 4YXDB 4W9FA 2FIFA 3MJWA 4CQNA 2QC8A 2IO1B 3PZ8A 1XXGA 1WGKA 2PE9A 1NI2A 1M4VA 4KDLB 1UWXA 5FKAC 2INNE 4RFBA 1EO6A 3WAPA 2BT6A 2QIEB 4PS3A 2GBRA 4AUQC 1NVID 1MG8A 2G9HD 3QX1A 3TEZA 2MBEA 1ZUD2 4FA6A 3NG0A 1QILA 3TMPB 4BZAA 1D3ZA 3A1QB 4LLGM 1HZ5A 3ZNHB 3HIZA 2Z59B 2G3QB 4JE3B 1EU4A 2L76A 3SFDB 4EUTA 5GMVA 1E6EB 2NTSA 4IKGA 1EWCA 2MHJA 3NVZA 3WAOA 1TKGA 3HUIA 2KFJA 1C77A 3Q3JA 2LGDA 2UYZB 1GB4A 3N9YC 1WYWB 3OJ4B 2CU1A 1WXSA 1GJZA 2WXKA 4GDKB 2MBHA 1JW9D 1Y56A 1FNUA 3LJ3A 5LNK1 1UD7A 3RNGC 1WZ3A 3QARA 3I3TB 1JWSD 1F77A 2O6VB 2MSED 2XNAC 1EUVB 2LGYA 4ZDVA 3IHPC 3DVNU 1YJ1A 1JWMD 1WF9A 2N7EA 1T0RC 4DDID 1IGCA 4XX5A 2WXLA 1KM7A 4BOSC 2VZKB 1WWTA 1XEEA 5L95C 3Q8BA 3P4PB 3RI7C 3VUYA 4A55A 1RFAA 5LXHA 5CX3A 4ZYSA 3NZ3A 3Q14C 4YTMB 2L7RA 4F8CB 2IPKD 2R2QA 1F2RC 3IT4B 3H7PB 2NPTB 5DPTA 1IUEA 1WSPA 4IUMB 2VH1A 1WRDB 1WXMA 1HQRD 4WJQA 2KQ4X 4DWFA 3W5VB 2NS5A 4LNNA 3TBLD 4KKJA 2V3PA 2JUOA 3IXSA 1C4AA 2ZNVC 3JYUA 1KFYB 4K1RB 2MEKA 1Z2MA 1YN5A 2WXJA 1SIFA 1XLQA 2IO2B 2MWSB 3VR8B 5MPOA 3BY4B 1XO3A 2LI5A 3KWLA 3H1UA 4EE2A 3VRBB 3VRAB 5EDSA 4A6QA 2ZPNA 4ICVA 3T8MA 5HG2A 2KDMA 4TQ1A 1STEA 3DBHI 1WY8A 4WIPA 1J0GA 4DHJD 1MHHE 3UI3A 2CHXA 4BOZB 1LM8B 1E7PB 1YN4A 3A9JB 2AQ1B 3PZDA 2GBNA 3RN9C 4ANVA 1TIFA 1QF6A 2WXQA 1D6EC 3V3XA 3QCAA 3ZXVA 2L00B 1XLPA 1J7BA 3J9CA 2INCC 4LDTD 3VHTC 3LDZE 2FUHB 3MC9A 1L4ZB 2CKHB 5AZGA 1FIQA 1XCTL 2D5GA 2JXXA 3RD2A 3AEBB 3PVLA 4DK5A 4YWGG 2KJHB 1V5TA 5BYRA 1E0ZA 2LXAA 1X1MA 3EFUA 3DVGY 4GOCA 5G55A 1RLFA 4ZHOA 2KX0A 4J3OD 5KHQA 2EKIA 1UNSA 2BW2A 4LJPB 3U4EG 2G4DB 4YSYB 5C23A 1Q10A 4EOYA 3RT3B 4MT5A 3ZVVA 2JZZA 1S1QB 1TY0A 2IBIB 2QMTA 4AP4C 4MJSB 2I2YA 1YMHE 3ALBA 4ASWC 3ZNZB 1NBFC 1TZOA 4LNIA 2DENB 3AXCA 1QLBB 2GMIC 4GXBA 2RDGA 1DOXA 3CSFA 2D3GA 2BYVE 5E6NA 2AL6A 3IBEA 2BTEA 4HCPB 1NYRA 3B9JA 2YLMA 3K9OB 4W9LA 4LK0M 4IOIE 3ZDTA 1FD6A 4I6LB 2G4SA 3HK0A 1GNUA 3FILB 4GN1A 3R66C 2K6QA 1V5OA 4Q2JA 2WNMA 3PHXB 1C76A 3EA6A 3ML9A 1E9MA 1G6JA 1D5ZC 1WM3A 4EZKA 2PMVA 3RULA 5C1ZA 1MVKA 5H8YE 4OHJA 1I4GA 1WI0A 4AJWA 1KLUD 2DNFA 1V81A 2KFKB 4W9KA 3VDZA 3Q2AC 1ENFA 1I35A 2WXRA 3OJ3A 4NZLB 2I38A 2HJ8A 3IFWB 3Q3MC 2E3TA 1FCCC 1WIAA 1JWAD 1V86A 3JW0X 3Q8CA 4WQMA 1WXQA 4WWMA 4DHJB 4MGKE 1DOYA 1T6BX 2JZPA 2M17A 5G5HA 1GOZA 4L1BA 3NOBA 2PIAA 1ZP0B 1JRPA 3UF8A 1R4NI 2X38A 1F9JA 4M01A 1SE3A 3AE8B 4OVVA 4JL9A 2BWES 1IBXB 2O2VA 4LDTB 3VH3B 4OW0A 4YSXB 1C4PA 3N20C 3ZTCA 4P16A 4HJGE 2YVCA 4AJYB 2LRWA 2AL3A 1WJUA 2MBOA 4FHJA 2WXGA 3RNFC 4FHKA 3FKYA 4PK1A 1TTNA 1Q5WB 4RF0A 3L54A 1WX8A 5EE9A 4HK2A 3BINA 1TZ1A 2WXPA 3V62A 4MSMB 3AU4A 2JRIB 4W9GA 1LGRA 4JLCA 2ASQA 2PKOA 4M0WA 1YJJA 2LASA 4L2YA 1OEYA 3KVFB 3L13A 5JH5C 3DBLI 2BB6A 4ZRIA 3GZNI 1MHXA 3NUHB 3U2SC 1WYGA 2KLGA 3CMMB 2FIDA 3BZDB 3R8BA 3DVGX 1T0QC 2KMAA 1WGYA 1UZXB 2LHDA 2NBVB 2IY0B 2IO3B 2KC1A 1J7AA 2JYTA 2WXOA 1XT9B 3AU5A 4BAXA 3TUOA 3HM3A 1UBQA 4IDIA 5BMIA 3AE7B 2BVCA 2YEPF 2KAJA 2KOXA 3ENEA 2VRRB 3EECA 4C4VA 2IGGA 5JHBA 3ETRA 2WS3B 2V9HA 4K3CA 5JZEB 3WAMA 2KYWA 3IAS1 4K3BA 4P7IA 5I4DA 3M3JA 1TT5B 4ACFA 3B0AA 2KWCA 3WANA 2K6DB 4WWPA 1V8CA 4E74A 2K0PA 5CTRC 1FO4A 2JYEA 3SD5A 2J7QB 3VVWB 1I4QA 4PS7A 4DBGA 3A9KA 1K8RB 1Q0WB 4IW0A 4B95A 1T5XD 3PLVA 1F0ZA 3ZDMC 1L2NA 5BO4B 2BF8B 2N9XA 2NR2A 2BQQA 1P7FA 3JSVA 4RGMA 2H88B 2UU7A 4GLSC 3S2AA 1FEHA 2XK5A 1SIJA 2ZVNA 3DOWA 4XDCA 1RAXA 3R3MA 2VH2A 3RZWC 3VUXA 2MP2A 1MPEA 2CHZA 1JRUA 2KK8A 1ACCA 2CS4A 2WXFA 2WDRB 4FJYA 1F1HA 2LXCA 4MM3B 2D07B 1Q1OA 2KTFA 3HHMA 3GB1A 4C7ZA 3IVFA 4ZRQA 1UH6A 3Q3OC 3UGBB 2FCNA 4KIKA 4XWWA 2OEDA 1CMXB 2BYFA 3ZIMA 5HHDG 5JHAA 3GOEA 4TKNA 3NHEB 1UGJA 4F1SA 1J19A 1QOAA 2FCSA 1E5WA 3U7ZA 2GBKA 4AOFA 5IO9A 2BS3B 1GAQB 4CHKA 3VTUA 4MEMA 5HI1A 3VFKA 3AH7A 2JWUA 3ZW3A 1L5PA 2M19A 1S3SG 2RMMA 1D5XC 3P63A 1VD2A 4K7UA 3DCGA 3WA0A 3PT2B 4WWOA 1ZXHA 4K7WA 2FCQA 4DHZB 4B9KA 1IGDA 3B08A 4EZJA 4KX6B 4CYEA 2JZ3B 3TIXA 1FXTB 4KVGB 5DPWA 4GGQA 4OZAA 3U30A 4RM8A 1YQ4B 3CSTA 3OLMD 4BKSA 1GB1A 1OGWA 2PTLA 2KNBA 1YIWA 3AE6B 1SBBB 2NMQA 3RFZB 4NAWB 2V0GA 2IDYA 4MELA 2KACA 5D2MB 2DYBA 4KSKC 2JT4B 1XLOA 2DYOA 3URYA 3FC4A 3TJPA 4BBNF 2L1AA 2V4LA 3HRDD 1CJEA 5T8IA 4XGAB 3L0WB 1U4AA 3UIOB 1EU3A 4HDQA 1TKEA 3KWVA 3HM6X 2KWUB 2PW9A 5E6PA 2ZNVB 5CHFA 3T9LA 4KGRA 2BB5A 2KN4A 4A90A 2MRPA 2CHWA 1HZ6A 3Q6BA 4OVZA 3VTVA 4G0NB 2IJ0A 3E9SA 3D32A 1SGHA 1ET6A 4GDLA 2JPHA 4YTNB 1YX5B 3BIID 3N32A 3PRPB 4FLHA 2LGSA 2DYMA 1SSNA 3PRMB 1L7YA 2INDC 4KGTA 4R3DA 4XZ4A 3NRZA 4LCDE 3TEYA 4NQLB 1TJEA 1FRRA 3AE9B 4RGNA 4NJCA 3APDA 2PJHA 3M62B 3V6EB 1WMHA 2SAKA 3Q8EA 1C4CA 1GPXA 2N4FA 3RYTA 1JWBD 4W9HA 2H89B 1E8ZA 5H92C 4A3PA 3EC8A 1V1PB 3AECB 3KLSX 1D4BA 1WXVA 2W3RA 4A8XC 2KHWB 3NY5A 2HD5B 3K9PB 1TS2A 2J0KA 2AQ3B 2W3SA 1ZDVA 4M02A 1E90A 1A70A 1OTRB 3PV1A 4WQOB 3PLUA 2N9PC 1TBEA 2ONQA 4XWTA 3AI5A 3DWMA 2OJWA 2PVOD 2ZW1A 2KTRA 1KRHA 3T3OA 4IM2A 1N62A 3IT6B 2CJNA 4XC2A 1WRIA 2OJRA 4LNKA 2HDEA 4M8MA 3MP9A 5DCNA 1XF5L 1WR1A 1WZ0A 2MBQA 4II3B 4C56C 1OQQA 1K50A 1L6UA 2KVRA 4GMVA 2BKRB 1PQSA 3DHGC 1N6ZA 5G5GA 4HEA1 2D11A 2Y5PA 4BKTA 1CQVA 4N9F4 2QJLA 3MTNB 3GS2A 3O65B 3QIJA 1NI3A 2DLBA 4LJOB 5J2RA 1FRDA 5IP4D 4C7YA 2V3NA 2IYDB 3RNBC 3H9DA 4G3XB 1TS3A 3BWUD 1ZPSA 3AEFB 2WDQB 4W9DA 4RGTA 4AQ7A 2JWZA 1HE8A 5LXIB 2MH7A 3BYYB 2LFIA 1EF5A 3NVWA 3BVZA 2LVOA 3RPFC 4RCOA 1EM7A 2M0AA 3EHVA 1BT0A 2C60A 3UQBA 3DQVA 1V9JA 3BYTB 2LJIA 2WU5B 4OZBA 1KJTA 3WIMA 2MJ3A 4K7SA 1JCKB 1P0RA 3WALA 3BK2A 3SU8X 1KF6B 1I4XA 3R2IA 2M0XA 3N1YC 4HRSA 1R4MB 1P3QU 1HEZE 2ZPYA 3PZ7A 4K81A 2UWQA 4MDKE 1ZXIA 2MQJA 3BK1A 4MSQB 5DPRA 4DHZE 4IWOA 2WDTB 2E6XA 5TR5A 4NY0A 2G1EA 4EZLA 2ZEQA 3ZJVA 3EFCA 1EF1A 2V4IB 3Q8AA 4ANWA 3W5UB 2N1VA 5C2TB 4YT0B 3W1SA 4ARCA 1P9DU 2LZ6A 1WGRA 2LUMA 3RCZA 2KVZA 3P1MA 1Y8RC 4M00A 3M95A 3C8YA 2A5UA 2EELA 3VR9B 4IWQA 1KLGD 3L10B 2RPVA 1RWSA 3DBSA 2I1KA 1MI0A 4IWPA 4RF1A 4A9AA 3VH4B 2QILA 4HKQA 4J6IA 3QQ8B 1HA5A 3R7QA 2JU6X 1WGHA 2KDIA 1OFFA 3AEAB 4KDIC 4B6WA 1RM6C 2NBWB 3KYDD 3AE3B 4WURA 2KANA 2JSVX 2KDBA 1QOGA 4PS8A 2L83A 4IM3A 1V97A 3UIPB 1VRAB 4DXFA 2KJ6A 3NZUA 1GG3A 2M8SA 5KHOA 2PEAA 1PYWD 4CO7A 2Z0EB 3PO0A 4G50A 3V05A 3BVGA 2WXIA 2N0SB 1WX7A 1FNVA 2O2VB 4XE0A 1RRBA 2WXHA 3ZRFA 2WXNA 2N9KA 2K1FA 3NVYA 4BBNC 2MLBA 1UWMA 2KMMA 2BWFA 2KD0A 4JWUC 2B76B 4GIVA 2M4NA 4EFOA 3W1SC 5D7GA 1VJKA 1PUTA 1ZW7A 3EGRA 4RH6A 1T0YA 4I6NB 1L0XB 2EMSA 2M1MA 2LJ5A 4E71A 3ZKJC 3QWZB 1SEBD 4WAAA 2LVQA 2QCZA 1I4PA 2J42A 4M0WB 3KYCD 2MA9B 2LEKA 2EKEC 5J18A 4RM9A 1MG4A 4TMAB 4HPPA 2I1JA 2R61A 4REZA 1A5RA 3EUB2 3R2TA 2N1WA 5DPSA 2D3BA 4FULA 2K8CA 1B9RA 3M63B 2MW5A 1F2RI 4RMAA 4YL8A 3DDCB 1WJ4A 4IC7B 4MGYE 2AEHA 1NENB 4NAMA 3PTFC 1GC6A 3P4SB 1T3QA 5BYSA 2MX2A 2D3CA 4NNJB 5CHVC 1UUPA 5G2NA 3Q69A 3AB5A 3PREA 2G45B 1VR9A 4GU2A 3RMKC 1I7HA 2V1YA 4FBJB 2M56B 1T0SC 2WXMA 2NTTA 4JX1C 1AN8A 1AARA 2KQSA 4KGSA 4MH0E 2DHZA 3NZSA 4C4VB 3QA8A 2J0JA 1N5XA 3CWIA 5BMHA 1VCBA 1OQRA 1SXTA 3U52E 2DAJA 2LUEA 4BKSD 2DAFA 3V61A 2W9NA 3KQ4A 5AZHA 1RFKA 3P42A 1AYFA 2KMCA 3HVDA 4HWIB 1TYGB 1C3TA 2XBBC 3Q8FA 4M8NA 4HXDA 3KH0A 2FE8A 4ANUA 1FPYA 4S0RA 3VTWA 1IPGA 1WX9A 3MHZA 2ZW0A 4GSWA 3DVNV 2KLCA 3AE5B 3A1QA 5D94A 1SE9A 5FK9C 1JQ4A 2BS4B 3JSVB 2L32A 3PRZA 4C80A 1FFVA 3W9CB 2C9WB 3L4PA 3X0WA 2XK5B 4NQKE 2JQRB 2PPHA 3N1XC 1FCLA 4A3OA 4YSZB 1V1OA 2OHFA 4N59A 1N63A 2MP2B 3ZRCA 1P1AA 4MGZE 1J8CA 2GLSA 1BXTA 4LNOA 3RNEC 1FFUA 5C3JB 4PYUA 1Z5SB 2L0FA 3WCQA 4GDKA 4MH8A 3N3KB 2GBMA 3AM9A 1ZGUB 2WQYB 4KIKB 3A4SC 2J4XA 4LTUA 2O6VA 3R7RA 4WJOA 3JVZX 1D5MC 1GC7A 2Y3AA 2WHIA 4XYCA 2RDHA 3TEWA 2HJ1A 1JMLA 4HLEA 1QOFA 3AMZA 2XN9C 5D6JB 4W9EA 4X57B 1N60A 3O13A 1LXDA 3ZXRA 2L05A 2DZJA 1P98A 2QDFA 4W9CA 2C7MB 2JVCA 4I6PA 3ECIA 2PE6B 1ET9A 3VAWA 1PFDA 3H7PA 2NPTA 2MJEA 1ESFA 5GXGB 4KZCA 3OG5A 1B1ZA 3MFGA 5AUIA 1YNTE 4WH4A 3C0RB 3GE8C 1CZPA 3W2DA 4D2KA 2KQ7A 5IAAC 2BGFA 4P1CC 1IYFA 1WXAA 3BVMA 3ZJTA 5EE1A 5JXVA 4FJZA 1M94A 1V1PA 3UQAA 4P6VF 1P7EA 3QC8B 5FR6A 3ZTDA 2LWPA 3NVVA 1NDDA 3AE2B 2W55A 4FXCA 4TSSA 1QOBA 1UGMA 3OAWA 4PT5A 4XDDA 2WGSA 2KC2A 1C9FA
chains in the Genus database with same CATH topology
3BWUD 1ZPSA 3AEFB 2WDQB 4RGTA 4AQ7A 4ZRPA 2PKOA 5FR3A 2MH7A 3BYYB 4M0WA 1YJJA 2LFIA 4L2YA 3NVWA 2ON8A 3BVZA 3RPFC 2BB6A 3P4RB 2W54A 4RCOA 1DGJA 1QT9A 2GB1A 1YN3A 1EM7A 2SEBD 4B0MA 3H8HA 1SF0A 1MHXA 2M0AA 2TSSA 3NUHB 3U2SC 1SE2A 1WYGA 1AW7A 3I9V1 3BYTB 2LJIA 4JWSC 1C78A 2LHEA 5BMGA 1ZOYB 2WU5B 1I4HA 4OZBA 3FAHA 1FXIA 3BZDB 2MJ3A 3R8BA 3P4QB 1JCKB 1QQRA 2K3UA 3AV8A 1FMAD 2Y5CA 1KTKA 2LHDA 5HFYA 3BK2A 4YXDB 1KF6B 4CQNA 1VZ7A 1I4XA 3PZ8A 1XXGA 1WGKA 3R2IA 2FBWB 1M4VA 1J7AA 2JYTA 2WXOA 1K52A 5FKAC 1UWXA 4HRSA 2BBCA 2INNE 4RFBA 3TUOA 1L6VA 2BT6A 2QIEB 1HEZE 3PZ7A 4IDIA 4GDLB 5BMIA 3AE7B 1VLBA 1NVID 1ZXIA 2YEPF 3BK1A 2KAJA 4O1NA 3E56A 3AE1B 2G9HD 2N9LA 2L52A 2E6XA 2Z8LA 4RNAA 2G1EA 2CU3A 2IGGA 2PVGC 3TEZA 3ZJVA 3ETRA 3Q8AA 2V4IB 1ZUD2 2YEPB 3W5UB 2WS3B 1QILA 5C2TB 4YT0B 4LLGM 1HZ5A 1YQ3B 3W1SA 4ARCA 2WP9B 3IAS1 5I4DA 4JE3B 1EU4A 2LUMA 3P1MA 3SFDB 1V8CA 4N6EB 1E6EB 2K0PA 2NTSA 1FO4A 4KKIA 4IKGA 1EWCA 4TQ0A 3C8YA 3NVZA 2EELA 2JYEA 3VR9B 1I4QA 1TKGA 2LMCA 3HUIA 5EE3A 1ZDXA 1C77A 1KLGD 1T5XD 1F0ZA 2RPVA 1RWSA 1GB4A 1MI0A 1ROEA 2KWDA 3N9YC 3I57A 4RF1A 4A9AA 3LYYA 3AE4B 4YTPB 2QILA 4HKQA 1P7FA 1HA5A 2WXKA 4RGMA 2H88B 4GDKB 2JU6X 1JW9D 4GLSC 1OFFA 1Y56A 1NEKB 3AEAB 1FEHA 1FNUA 1SIJA 1RM6C 5LNK1 4XDCA 5TSSA 3AE3B 4WURA 2JSVX 1JWSD 1F77A 1MPEA 3LB8C 1QOGA 1TS4A 2XNAC 4ITKA 3FILA 1TS5A 1E10A 1ACCA 2L83A 1JWMD 1V97A 2WXFA 2WDRB 1IGCA 4MM3B 2IGHA 2WXLA 3GB1A 1VRAB 4DXFA 1PGXA 2VZKB 1WWTA 4C7ZA 4AS1A 4ZRQA 1XLNA 1XEEA 1EWYC 3Q8BA 3P4PB 3LXFA 4USAA 3MJ5A 4XWWA 1J7CA 2HTME 4A55A 5BYQA 2OEDA 4ZYSA 3NZ3A 1PYWD 2N7JA 5HHDG 4YTMB 3PO0A 3V05A 2IPKD 3BVGA 1C9FA 1SB3C 1F2RC 2WXIA 1LO5D 3IT4B 2K9XA 1UGJA 2N0SB 2K5PA 1IUEA 1WSPA 1QOAA 1FNVA 3U7ZA 4XE0A 1TKYA 2WXHA 4OZCA 2BS3B 1HQRD 2WXNA 2N9KA 3TEXA 1GAQB 2KQ4X 3W5VB 2DWQA 4ZOHC 3NVYA 2V3PA 3IXSA 4KKJA 3ZGZA 1C4AA 1UWMA 4L23A 1PDXA 2KMMA 5HI1A 1N5WA 3AH7A 3AEDB 2JWUA 1KFYB 1L5PA 2MEKA 4JWUC 2B76B 2M19A 1YN5A 2WXJA 3B2GA 1XLQA 3ABVB 2RMMA 5D7GA 1VJKA 1D5XC 1PUTA 3EGRA 4RH6A 3P63A 3VR8B 1IBXA 1SJHD 5MPOA 1L0XB 4JPSA 1XO3A 3KWLA 4EE2A 1SEBD 2PLPA 3SR6A 3VRBB 3VRAB 1ZXHA 4A6QA 1I4PA 2AX5A 2J42A 2INPE 3TSSA 3AEGB 1IGDA 2LEKA 1DYQA 4KX6B 1RYJA 2FUG1 5HG2A 2KDMA 4TQ1A 4TMAB 1STEA 4WIPA 2R61A 4REZA 3EUB2 4ZHPA 1MHHE 3R2TA 3T3NA 1FNWA 3SEBA 4OZAA 4RGOS 3UI3A 1KH0A 1PGBA 2GRIA 1YQ4B 1B9RA 4MACA 2J53A 1GB1A 1E7PB 1YN4A 1F2RI 2AQ1B 1QKZA 3MC0B 1TY2A 2PTLA 1QF6A 3AE6B 1SBBB 2NMQA 1NENB 2WXQA 4NAWB 1D6EC 4NAMA 3V3XA 3RFZB 2V0GA 2IDYA 2KACA 3P4SB 1XLPA 1DOIA 1T3QA 1J7BA 1JALA 5BYSA 1VDVA 3J9CA 1UUPA 1XLOA 1XCQL 2DYOA 3Q69A 3URYA 3AB5A 1L4ZB 1VR9A 3FC4A 4HROA 2L1AA 4DXGA 1FIQA 1I7HA 1XCTL 2D5GA 1R7SA 2M56B 3HRDD 1CJEA 2WXMA 3AEBB 2NTTA 2DBYA 4JX1C 5T8IA 1AN8A 4YWGG 4KGSA 5BYRA 1EU3A 1E0ZA 3AN1A 1TKEA 3KWVA 1N5XA 4ZHOA 2PW9A 3CWIA 5BMHA 4J3OD 1OQRA 2EKIA 1K53A 1SXTA 4KGRA 1UNSA 2BW2A 3U52E 2BB5A 3U4EG 4YSYB 2KN4A 2ICIA 4A90A 2QEJC 1HZ6A 3SFEB 4OVZA 1Q10A 3KQ4A 2IJ0A 1RFKA 3E9SA 4MT5A 1TY0A 4WAFA 3P42A 2QMTA 1AYFA 2LGIA 4UDUC 3HVDA 1ET6A 1TYGB 4US8A 3Q8FA 2I2YA 4YTNB 1YMHE 2MJDA 3BIID 1TZOA 1CK1A 2FE8A 1QLBB 1C79A 2DYMA 1SSNA 4H2AA 2K22A 3OWEB 4KGTA 3MHZA 4R3DA 2ZW0A 3NRZA 3TEYA 3AE5B 3ZJUA 1TJEA 1FRRA 3AE9B 4RGNA 2RDGA 2QSDA 4NJCA 5FK9C 1DOXA 1JWUD 1JQ4A 2BS4B 2SAKA 2L32A 3Q8EA 5EE0A 2IGDA 4C80A 1FFVA 3W9CB 1C4CA 1GPXA 2BTEA 3L4PA 1I4RA 1NYRA 2JQRB 2WLBA 1FCLA 1JWBD 3B9JA 4YSZB 1V1OA 2OHFA 2H89B 4LK0M 4N59A 4IOIE 5D3IB 5H92C 1V1PB 1FD6A 1N63A 1SJED 3AECB 1AWDA 3KLSX 3FILB 1D4BA 4Q2JA 5E6JA 2WNMA 2W3RA 4ARIA 1BXTA 4A8XC 1C76A 1FFUA 3EA6A 5C3JB 1E9MA 1D5ZC 1N61A 3WCQA 4MH8A 2BS2B 3VQIA 2PMVA 3AM9A 2W82A 1L0VB 1TS2A 2ACZB 2WQYB 5D3DA 1L0YB 2AQ3B 2WU2B 5AUKA 2J4XA 1MVKA 2W3SA 2BYTA 5H8YE 1ZDVA 1A70A 3AEEB 4LTUA 2JX5A 2ONQA 4OHJA 3CIRB 1I4GA 4XWTA 1KLUD 1D5MC 3DWMA 2JXTA 3HVZA 1YJIA 2PVOD 2ZW1A 1VZ8A 2Y3AA 1SE4A 2AQ2B 1ENFA 2WXRA 1KRHA 2RDHA 3ZYYX 4NZLB 3TEWA 3T3OA 2I38A 1N62A 1HXYD 2CJNA 1JMLA 3IT6B 1QOFA 1WRIA 3AMZA 2XN9C 2E3TA 1FCCC 1N60A 2HDEA 3MP9A 1JWAD 1VZ6A 3O13A 1XF5L 1ZE3D 3Q8CA 4WQMA 1BMLC 1WXQA 3B2FA 4WWMA 1DOYA 1T6BX 2JZPA 4C56C 2Q5WD 1JROA 5G5HA 1GOZA 4L1BA 2PIAA 1OQQA 1ZP0B 4N58A 1K50A 4HKZE 1JRPA 2CJOA 2X38A 1L6UA 1SE3A 3AE8B 1ET9A 3ZQ4A 1PFDA 3DWGC 2MJEA 1ESFA 1NYQA 1IBXB 2GI9A 5GXGB 1B1ZA 5G5GA 3MFGA 5AUIA 1YNTE 4OW0A 4WH4A 4HEA1 2Y5PA 4YSXB 1L4DB 1CZPA 3W2DA 1C4PA 4B0EA 4D2KA 1CQVA 4P16A 2QJLA 3NS1A 4HJGE 3GS2A 3BVMA 1NI3A 3ZJTA 5EE1A 1FXAA 2VZKD 2DLBA 1PGAA 2WXGA 1BUIC 5JXVA 1FRDA 1V1PA 4US9A 4P6VF 1FM0D 1P7EA 2J52A 4RF0A 5EE9A 3IAM1 4DQOC 2V3NA 4C7YA 3NVVA 2WXPA 3AE2B 2W55A 2WDVB 4FXCA 4TSSA 1K51A 1QOBA 4PT5A 1TS3A 4XDDA 3GP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L4Z B;  1QQR A;  1BML C;  1L4D B;  1C4P A; 
#chains in the Genus database with same CATH topology
 2K25 A;  4ZRP A;  5FR3 A;  2ON8 A;  2D3A A;  2W54 A;  1DGJ A;  1MFW A;  1YN3 A;  4B0M A;  2Y5B B;  4KZ0 A;  3U7D A;  2WYQ A;  1AW7 A;  3I9V 1;  2A4Z A;  4JWS C;  5BMG A;  1WM2 A;  3FAH A;  1FXI A;  3A9J A;  3P4Q B;  3AV8 A;  1R4M I;  2LVP A;  2Y5C A;  4ZRJ A;  1KTK A;  2REX A;  2AWT A;  1LFD A;  2MCN B;  3NS8 A;  1VZ7 A;  1WFY A;  4HDO A;  2KJR A;  2FBW B;  3H7S A;  4WJP A;  3PS6 A;  2K39 A;  4ZRK A;  1K52 A;  3DBR I;  2BBC A;  2L3Z A;  1L6V A;  5IA7 A;  4GDL B;  1VLB A;  3V6C B;  2NVU I;  4O1N A;  1WJN A;  2K8B A;  3E56 A;  2C5L C;  3AE1 B;  2N9L A;  2L52 A;  2Z8L A;  3QAQ A;  4RNA A;  4JIO U;  2CU3 A;  2PVG C;  3A33 B;  2YEP B;  4QAY A;  4II2 B;  2RR9 A;  2KT7 A;  3SHQ A;  2BYE A;  3PPA A;  1YQ3 B;  2WP9 B;  2LD9 A;  4E3C A;  1WMH B;  2C7N B;  4JGH B;  3ONS A;  2RGF A;  2RDB C;  3P2B A;  4N6E B;  4MJS A;  4KKI A;  3QK0 A;  4TQ0 A;  1KLV A;  2LMC A;  2WWZ A;  5EE3 A;  1ZDX A;  3QJZ A;  4ICU A;  2KO3 A;  2KWD A;  1ROE A;  3PGE A;  3I57 A;  3LYY A;  3AE4 B;  2ZVO A;  4YTP B;  3PSE B;  2XEW A;  3N1Z C;  3PHW B;  1QZE A;  2KX3 A;  2NBU A;  2Z0D B;  4OVU A;  3L16 A;  4F7Z A;  1NEK B;  3DHH C;  3U8Z A;  2ZCC A;  1E8W A;  5TSS A;  3LB8 C;  2ZJD A;  1TS4 A;  4ITK A;  3FIL A;  1E7V A;  1TS5 A;  1E10 A;  2KTR B;  5J17 A;  3AUL A;  2LRU A;  3Q3N C;  5IOI A;  2IGH A;  3VXW A;  1PGX A;  4BVU C;  4AS1 A;  1XLN A;  5AZF A;  1EWY C;  3LXF A;  4USA A;  3MJ5 A;  5L83 A;  1J7C A;  2HTM E;  1C1Y B;  5BYQ A;  4TUU A;  3RNC C;  1F52 A;  2N7J A;  2KWV B;  2DX5 B;  2KFK A;  1SB3 C;  1LO5 D;  2K9X A;  2K5P A;  1GUA B;  4BKG A;  3B1L X;  1TKY A;  4OZC A;  1WGD A;  2IZV B;  1TGZ B;  3TEX A;  2DWQ A;  3ZNG C;  4ZOH C;  3ZGZ A;  1WH3 A;  4L23 A;  1PDX A;  5AEK B;  1N5W A;  3C19 A;  1V49 A;  4NJ7 A;  1XD3 B;  3AED B;  2NCN A;  3KUD B;  3KUZ A;  4WWN A;  3B2G A;  3ABV B;  2N9E B;  3MC8 A;  4PYZ A;  3VUW A;  4S17 A;  1SJH D;  1IBX A;  3TL5 A;  4JPS A;  4FAD A;  3DBR B;  4C00 A;  2KN5 A;  3SR6 A;  2PLP A;  2AX5 A;  2INP E;  3TSS A;  3AEG B;  1DYQ A;  1RYJ A;  2FUG 1;  1WGG A;  4HCN B;  3I5J C;  3APF A;  4FJV B;  4ZHP A;  3T3N A;  5IKC M;  1FNW A;  3SEB A;  4HVB A;  4RGO S;  1ZKH A;  1KH0 A;  1PGB A;  2GRI A;  2HE7 A;  2J0M A;  4MAC A;  2J53 A;  3DBH B;  1QKZ A;  3MC0 B;  1TY2 A;  2HTH A;  1WJ6 A;  4W9I A;  4KSL C;  4IG7 B;  1DOI A;  1JAL A;  4AWJ A;  1VDV A;  3QHT A;  2RSU A;  1XCQ L;  2QHO A;  1E8Y A;  1WE6 A;  2DZK A;  4HRO A;  4DXG A;  3CF6 E;  1R7S A;  1HTQ A;  2WX1 A;  4TV3 A;  2DBY A;  1H4R A;  3W1Y A;  1I42 A;  3AN1 A;  3IG3 A;  3I63 C;  4ANX A;  1K53 A;  2ICI A;  1UF0 A;  2QEJ C;  3SFE B;  2JRH A;  2K8H A;  4BFR A;  2JF5 A;  2FNJ B;  2RPQ A;  4WAF A;  3DPD A;  3N30 A;  3MHS D;  2WX0 A;  2LGI A;  4UDU C;  2DZM A;  4US8 A;  1IP9 A;  3KUC B;  2MJD A;  1CK1 A;  1C79 A;  2BKF A;  1YD8 U;  4H2A A;  2IO0 B;  2K22 A;  3OWE B;  3ZJU A;  2QSD A;  5CHW A;  4FN2 A;  1YQB A;  4JQW C;  3KW5 B;  1JWU D;  5EE0 A;  2IGD A;  3X23 A;  1E8X A;  2IY1 B;  3H6N A;  3V60 A;  4G11 A;  1I4R A;  2WLB A;  3RUI B;  5E6O A;  2ZCB A;  4ZYN A;  1HTO A;  5D3I B;  1SJE D;  1AWD A;  2L0T A;  5E6J A;  4IM0 A;  4DXA B;  2D10 A;  3TCA A;  4ARI A;  3ZLZ A;  2KKC A;  4MGI E;  1N61 A;  2KDE B;  2BS2 B;  3VQI A;  2AYO B;  2W82 A;  1L0V B;  2JY6 A;  2ACZ B;  5D3D A;  3SDL C;  1L0Y B;  1V2Y A;  2WU2 B;  1H8C A;  4KV2 A;  5AUK A;  5IN7 A;  2BYT A;  2CR5 A;  2N7D A;  4EEW A;  3AEE B;  2JX5 A;  3CIR B;  1OQY A;  2BPS A;  2JXT A;  3HVZ A;  1YJI A;  1VZ8 A;  1SE4 A;  2D2Q A;  2AQ2 B;  3ZYY X;  4WJN A;  3L17 A;  5HKH A;  4MM3 A;  1HXY D;  2KZR A;  1UEL A;  1MJD A;  1VZ6 A;  2X8X X;  4NPN A;  1ZE3 D;  3ZUN A;  2KXJ A;  1BML C;  3B2F A;  1UBI A;  2Q5W D;  1JRO A;  2MBB B;  4N58 A;  1XQQ A;  3GE3 C;  4HKZ E;  1LQB A;  2CJO A;  1ISN A;  2R2O A;  1WE7 A;  3ZQ4 A;  3DWG C;  5LLI A;  4NJ6 A;  1NYQ A;  2EMT A;  2GI9 A;  2GBJ A;  2LGX A;  2O6V D;  3NJT A;  1R4N B;  1V80 A;  4HPM B;  2B3A A;  1L4D B;  4B0E A;  2L8J A;  3NS1 A;  2FAZ A;  1E7U A;  4A20 A;  1FXA A;  2VZK D;  1PGA A;  1BUI C;  4EKU A;  4US9 A;  2KDF B;  1FM0 D;  2J52 A;  2RD0 A;  1YX6 B;  1OEY J;  3IAM 1;  4DQO C;  4DDG D;  4LNF A;  3UIN B;  2V3S A;  1V6E A;  2WDV B;  3A9K B;  3DHI C;  1K51 A;  2FCM A;  1YOV B;  3GP7 A;  3L08 A;  4HJK A;  4HPL B;  3RZF A;  1WR6 E;  1KOT A;  4URK A;  2GOW A;  3P4R B;  2SEB D;  1QT9 A;  2GB1 A;  3ZNI D;  3ZO5 B;  2OOB B;  3H8H A;  1SF0 A;  3RNA C;  2TSS A;  1SE2 A;  2ZZP B;  1C78 A;  2LHE A;  1ZOY B;  1I4H A;  3A4R A;  4P1B C;  3DBL B;  3ML8 A;  4W9J A;  1QQR A;  2K3U A;  1FMA D;  3GZN B;  2DZI A;  3Q3F A;  3APC A;  4GB9 A;  4NAW A;  2C7H A;  5HFY A;  4YXD B;  4W9F A;  2FIF A;  3MJW A;  4CQN A;  2QC8 A;  2IO1 B;  3PZ8 A;  1XXG A;  1WGK A;  2PE9 A;  1NI2 A;  1M4V A;  4KDL B;  1UWX A;  5FKA C;  2INN E;  4RFB A;  1EO6 A;  3WAP A;  2BT6 A;  2QIE B;  4PS3 A;  2GBR A;  4AUQ C;  1NVI D;  1MG8 A;  2G9H D;  3QX1 A;  3TEZ A;  2MBE A;  1ZUD 2;  4FA6 A;  3NG0 A;  1QIL A;  3TMP B;  4BZA A;  1D3Z A;  3A1Q B;  4LLG M;  1HZ5 A;  3ZNH B;  3HIZ A;  2Z59 B;  2G3Q B;  4JE3 B;  1EU4 A;  2L76 A;  3SFD B;  4EUT A;  5GMV A;  1E6E B;  2NTS A;  4IKG A;  1EWC A;  2MHJ A;  3NVZ A;  3WAO A;  1TKG A;  3HUI A;  2KFJ A;  1C77 A;  3Q3J A;  2LGD A;  2UYZ B;  1GB4 A;  3N9Y C;  1WYW B;  3OJ4 B;  2CU1 A;  1WXS A;  1GJZ A;  2WXK A;  4GDK B;  2MBH A;  1JW9 D;  1Y56 A;  1FNU A;  3LJ3 A;  5LNK 1;  1UD7 A;  3RNG C;  1WZ3 A;  3QAR A;  3I3T B;  1JWS D;  1F77 A;  2O6V B;  2MSE D;  2XNA C;  1EUV B;  2LGY A;  4ZDV A;  3IHP C;  3DVN U;  1YJ1 A;  1JWM D;  1WF9 A;  2N7E A;  1T0R C;  4DDI D;  1IGC A;  4XX5 A;  2WXL A;  1KM7 A;  4BOS C;  2VZK B;  1WWT A;  1XEE A;  5L95 C;  3Q8B A;  3P4P B;  3RI7 C;  3VUY A;  4A55 A;  1RFA A;  5LXH A;  5CX3 A;  4ZYS A;  3NZ3 A;  3Q14 C;  4YTM B;  2L7R A;  4F8C B;  2IPK D;  2R2Q A;  1F2R C;  3IT4 B;  3H7P B;  2NPT B;  5DPT A;  1IUE A;  1WSP A;  4IUM B;  2VH1 A;  1WRD B;  1WXM A;  1HQR D;  4WJQ A;  2KQ4 X;  4DWF A;  3W5V B;  2NS5 A;  4LNN A;  3TBL D;  4KKJ A;  2V3P A;  2JUO A;  3IXS A;  1C4A A;  2ZNV C;  3JYU A;  1KFY B;  4K1R B;  2MEK A;  1Z2M A;  1YN5 A;  2WXJ A;  1SIF A;  1XLQ A;  2IO2 B;  2MWS B;  3VR8 B;  5MPO A;  3BY4 B;  1XO3 A;  2LI5 A;  3KWL A;  3H1U A;  4EE2 A;  3VRB B;  3VRA B;  5EDS A;  4A6Q A;  2ZPN A;  4ICV A;  3T8M A;  5HG2 A;  2KDM A;  4TQ1 A;  1STE A;  3DBH I;  1WY8 A;  4WIP A;  1J0G A;  4DHJ D;  1MHH E;  3UI3 A;  2CHX A;  4BOZ B;  1LM8 B;  1E7P B;  1YN4 A;  3A9J B;  2AQ1 B;  3PZD A;  2GBN A;  3RN9 C;  4ANV A;  1TIF A;  1QF6 A;  2WXQ A;  1D6E C;  3V3X A;  3QCA A;  3ZXV A;  2L00 B;  1XLP A;  1J7B A;  3J9C A;  2INC C;  4LDT D;  3VHT C;  3LDZ E;  2FUH B;  3MC9 A;  1L4Z B;  2CKH B;  5AZG A;  1FIQ A;  1XCT L;  2D5G A;  2JXX A;  3RD2 A;  3AEB B;  3PVL A;  4DK5 A;  4YWG G;  2KJH B;  1V5T A;  5BYR A;  1E0Z A;  2LXA A;  1X1M A;  3EFU A;  3DVG Y;  4GOC A;  5G55 A;  1RLF A;  4ZHO A;  2KX0 A;  4J3O D;  5KHQ A;  2EKI A;  1UNS A;  2BW2 A;  4LJP B;  3U4E G;  2G4D B;  4YSY B;  5C23 A;  1Q10 A;  4EOY A;  3RT3 B;  4MT5 A;  3ZVV A;  2JZZ A;  1S1Q B;  1TY0 A;  2IBI B;  2QMT A;  4AP4 C;  4MJS B;  2I2Y A;  1YMH E;  3ALB A;  4ASW C;  3ZNZ B;  1NBF C;  1TZO A;  4LNI A;  2DEN B;  3AXC A;  1QLB B;  2GMI C;  4GXB A;  2RDG A;  1DOX A;  3CSF A;  2D3G A;  2BYV E;  5E6N A;  2AL6 A;  3IBE A;  2BTE A;  4HCP B;  1NYR A;  3B9J A;  2YLM A;  3K9O B;  4W9L A;  4LK0 M;  4IOI E;  3ZDT A;  1FD6 A;  4I6L B;  2G4S A;  3HK0 A;  1GNU A;  3FIL B;  4GN1 A;  3R66 C;  2K6Q A;  1V5O A;  4Q2J A;  2WNM A;  3PHX B;  1C76 A;  3EA6 A;  3ML9 A;  1E9M A;  1G6J A;  1D5Z C;  1WM3 A;  4EZK A;  2PMV A;  3RUL A;  5C1Z A;  1MVK A;  5H8Y E;  4OHJ A;  1I4G A;  1WI0 A;  4AJW A;  1KLU D;  2DNF A;  1V81 A;  2KFK B;  4W9K A;  3VDZ A;  3Q2A C;  1ENF A;  1I35 A;  2WXR A;  3OJ3 A;  4NZL B;  2I38 A;  2HJ8 A;  3IFW B;  3Q3M C;  2E3T A;  1FCC C;  1WIA A;  1JWA D;  1V86 A;  3JW0 X;  3Q8C A;  4WQM A;  1WXQ A;  4WWM A;  4DHJ B;  4MGK E;  1DOY A;  1T6B X;  2JZP A;  2M17 A;  5G5H A;  1GOZ A;  4L1B A;  3NOB A;  2PIA A;  1ZP0 B;  1JRP A;  3UF8 A;  1R4N I;  2X38 A;  1F9J A;  4M01 A;  1SE3 A;  3AE8 B;  4OVV A;  4JL9 A;  2BWE S;  1IBX B;  2O2V A;  4LDT B;  3VH3 B;  4OW0 A;  4YSX B;  1C4P A;  3N20 C;  3ZTC A;  4P16 A;  4HJG E;  2YVC A;  4AJY B;  2LRW A;  2AL3 A;  1WJU A;  2MBO A;  4FHJ A;  2WXG A;  3RNF C;  4FHK A;  3FKY A;  4PK1 A;  1TTN A;  1Q5W B;  4RF0 A;  3L54 A;  1WX8 A;  5EE9 A;  4HK2 A;  3BIN A;  1TZ1 A;  2WXP A;  3V62 A;  4MSM B;  3AU4 A;  2JRI B;  4W9G A;  1LGR A;  4JLC A;  2ASQ A;  2PKO A;  4M0W A;  1YJJ A;  2LAS A;  4L2Y A;  1OEY A;  3KVF B;  3L13 A;  5JH5 C;  3DBL I;  2BB6 A;  4ZRI A;  3GZN I;  1MHX A;  3NUH B;  3U2S C;  1WYG A;  2KLG A;  3CMM B;  2FID A;  3BZD B;  3R8B A;  3DVG X;  1T0Q C;  2KMA A;  1WGY A;  1UZX B;  2LHD A;  2NBV B;  2IY0 B;  2IO3 B;  2KC1 A;  1J7A A;  2JYT A;  2WXO A;  1XT9 B;  3AU5 A;  4BAX A;  3TUO A;  3HM3 A;  1UBQ A;  4IDI A;  5BMI A;  3AE7 B;  2BVC A;  2YEP F;  2KAJ A;  2KOX A;  3ENE A;  2VRR B;  3EEC A;  4C4V A;  2IGG A;  5JHB A;  3ETR A;  2WS3 B;  2V9H A;  4K3C A;  5JZE B;  3WAM A;  2KYW A;  3IAS 1;  4K3B A;  4P7I A;  5I4D A;  3M3J A;  1TT5 B;  4ACF A;  3B0A A;  2KWC A;  3WAN A;  2K6D B;  4WWP A;  1V8C A;  4E74 A;  2K0P A;  5CTR C;  1FO4 A;  2JYE A;  3SD5 A;  2J7Q B;  3VVW B;  1I4Q A;  4PS7 A;  4DBG A;  3A9K A;  1K8R B;  1Q0W B;  4IW0 A;  4B95 A;  1T5X D;  3PLV A;  1F0Z A;  3ZDM C;  1L2N A;  5BO4 B;  2BF8 B;  2N9X A;  2NR2 A;  2BQQ A;  1P7F A;  3JSV A;  4RGM A;  2H88 B;  2UU7 A;  4GLS C;  3S2A A;  1FEH A;  2XK5 A;  1SIJ A;  2ZVN A;  3DOW A;  4XDC A;  1RAX A;  3R3M A;  2VH2 A;  3RZW C;  3VUX A;  2MP2 A;  1MPE A;  2CHZ A;  1JRU A;  2KK8 A;  1ACC A;  2CS4 A;  2WXF A;  2WDR B;  4FJY A;  1F1H A;  2LXC A;  4MM3 B;  2D07 B;  1Q1O A;  2KTF A;  3HHM A;  3GB1 A;  4C7Z A;  3IVF A;  4ZRQ A;  1UH6 A;  3Q3O C;  3UGB B;  2FCN A;  4KIK A;  4XWW A;  2OED A;  1CMX B;  2BYF A;  3ZIM A;  5HHD G;  5JHA A;  3GOE A;  4TKN A;  3NHE B;  1UGJ A;  4F1S A;  1J19 A;  1QOA A;  2FCS A;  1E5W A;  3U7Z A;  2GBK A;  4AOF A;  5IO9 A;  2BS3 B;  1GAQ B;  4CHK A;  3VTU A;  4MEM A;  5HI1 A;  3VFK A;  3AH7 A;  2JWU A;  3ZW3 A;  1L5P A;  2M19 A;  1S3S G;  2RMM A;  1D5X C;  3P63 A;  1VD2 A;  4K7U A;  3DCG A;  3WA0 A;  3PT2 B;  4WWO A;  1ZXH A;  4K7W A;  2FCQ A;  4DHZ B;  4B9K A;  1IGD A;  3B08 A;  4EZJ A;  4KX6 B;  4CYE A;  2JZ3 B;  3TIX A;  1FXT B;  4KVG B;  5DPW A;  4GGQ A;  4OZA A;  3U30 A;  4RM8 A;  1YQ4 B;  3CST A;  3OLM D;  4BKS A;  1GB1 A;  1OGW A;  2PTL A;  2KNB A;  1YIW A;  3AE6 B;  1SBB B;  2NMQ A;  3RFZ B;  4NAW B;  2V0G A;  2IDY A;  4MEL A;  2KAC A;  5D2M B;  2DYB A;  4KSK C;  2JT4 B;  1XLO A;  2DYO A;  3URY A;  3FC4 A;  3TJP A;  4BBN F;  2L1A A;  2V4L A;  3HRD D;  1CJE A;  5T8I A;  4XGA B;  3L0W B;  1U4A A;  3UIO B;  1EU3 A;  4HDQ A;  1TKE A;  3KWV A;  3HM6 X;  2KWU B;  2PW9 A;  5E6P A;  2ZNV B;  5CHF A;  3T9L A;  4KGR A;  2BB5 A;  2KN4 A;  4A90 A;  2MRP A;  2CHW A;  1HZ6 A;  3Q6B A;  4OVZ A;  3VTV A;  4G0N B;  2IJ0 A;  3E9S A;  3D32 A;  1SGH A;  1ET6 A;  4GDL A;  2JPH A;  4YTN B;  1YX5 B;  3BII D;  3N32 A;  3PRP B;  4FLH A;  2LGS A;  2DYM A;  1SSN A;  3PRM B;  1L7Y A;  2IND C;  4KGT A;  4R3D A;  4XZ4 A;  3NRZ A;  4LCD E;  3TEY A;  4NQL B;  1TJE A;  1FRR A;  3AE9 B;  4RGN A;  4NJC A;  3APD A;  2PJH A;  3M62 B;  3V6E B;  1WMH A;  2SAK A;  3Q8E A;  1C4C A;  1GPX A;  2N4F A;  3RYT A;  1JWB D;  4W9H A;  2H89 B;  1E8Z A;  5H92 C;  4A3P A;  3EC8 A;  1V1P B;  3AEC B;  3KLS X;  1D4B A;  1WXV A;  2W3R A;  4A8X C;  2KHW B;  3NY5 A;  2HD5 B;  3K9P B;  1TS2 A;  2J0K A;  2AQ3 B;  2W3S A;  1ZDV A;  4M02 A;  1E90 A;  1A70 A;  1OTR B;  3PV1 A;  4WQO B;  3PLU A;  2N9P C;  1TBE A;  2ONQ A;  4XWT A;  3AI5 A;  3DWM A;  2OJW A;  2PVO D;  2ZW1 A;  2KTR A;  1KRH A;  3T3O A;  4IM2 A;  1N62 A;  3IT6 B;  2CJN A;  4XC2 A;  1WRI A;  2OJR A;  4LNK A;  2HDE A;  4M8M A;  3MP9 A;  5DCN A;  1XF5 L;  1WR1 A;  1WZ0 A;  2MBQ A;  4II3 B;  4C56 C;  1OQQ A;  1K50 A;  1L6U A;  2KVR A;  4GMV A;  2BKR B;  1PQS A;  3DHG C;  1N6Z A;  5G5G A;  4HEA 1;  2D11 A;  2Y5P A;  4BKT A;  1CQV A;  4N9F 4;  2QJL A;  3MTN B;  3GS2 A;  3O65 B;  3QIJ A;  1NI3 A;  2DLB A;  4LJO B;  5J2R A;  1FRD A;  5IP4 D;  4C7Y A;  2V3N A;  2IYD B;  3RNB C;  3H9D A;  4G3X B;  1TS3 A;  3BWU D;  1ZPS A;  3AEF B;  2WDQ B;  4W9D A;  4RGT A;  4AQ7 A;  2JWZ A;  1HE8 A;  5LXI B;  2MH7 A;  3BYY B;  2LFI A;  1EF5 A;  3NVW A;  3BVZ A;  2LVO A;  3RPF C;  4RCO A;  1EM7 A;  2M0A A;  3EHV A;  1BT0 A;  2C60 A;  3UQB A;  3DQV A;  1V9J A;  3BYT B;  2LJI A;  2WU5 B;  4OZB A;  1KJT A;  3WIM A;  2MJ3 A;  4K7S A;  1JCK B;  1P0R A;  3WAL A;  3BK2 A;  3SU8 X;  1KF6 B;  1I4X A;  3R2I A;  2M0X A;  3N1Y C;  4HRS A;  1R4M B;  1P3Q U;  1HEZ E;  2ZPY A;  3PZ7 A;  4K81 A;  2UWQ A;  4MDK E;  1ZXI A;  2MQJ A;  3BK1 A;  4MSQ B;  5DPR A;  4DHZ E;  4IWO A;  2WDT B;  2E6X A;  5TR5 A;  4NY0 A;  2G1E A;  4EZL A;  2ZEQ A;  3ZJV A;  3EFC A;  1EF1 A;  2V4I B;  3Q8A A;  4ANW A;  3W5U B;  2N1V A;  5C2T B;  4YT0 B;  3W1S A;  4ARC A;  1P9D U;  2LZ6 A;  1WGR A;  2LUM A;  3RCZ A;  2KVZ A;  3P1M A;  1Y8R C;  4M00 A;  3M95 A;  3C8Y A;  2A5U A;  2EEL A;  3VR9 B;  4IWQ A;  1KLG D;  3L10 B;  2RPV A;  1RWS A;  3DBS A;  2I1K A;  1MI0 A;  4IWP A;  4RF1 A;  4A9A A;  3VH4 B;  2QIL A;  4HKQ A;  4J6I A;  3QQ8 B;  1HA5 A;  3R7Q A;  2JU6 X;  1WGH A;  2KDI A;  1OFF A;  3AEA B;  4KDI C;  4B6W A;  1RM6 C;  2NBW B;  3KYD D;  3AE3 B;  4WUR A;  2KAN A;  2JSV X;  2KDB A;  1QOG A;  4PS8 A;  2L83 A;  4IM3 A;  1V97 A;  3UIP B;  1VRA B;  4DXF A;  2KJ6 A;  3NZU A;  1GG3 A;  2M8S A;  5KHO A;  2PEA A;  1PYW D;  4CO7 A;  2Z0E B;  3PO0 A;  4G50 A;  3V05 A;  3BVG A;  2WXI A;  2N0S B;  1WX7 A;  1FNV A;  2O2V B;  4XE0 A;  1RRB A;  2WXH A;  3ZRF A;  2WXN A;  2N9K A;  2K1F A;  3NVY A;  4BBN C;  2MLB A;  1UWM A;  2KMM A;  2BWF A;  2KD0 A;  4JWU C;  2B76 B;  4GIV A;  2M4N A;  4EFO A;  3W1S C;  5D7G A;  1VJK A;  1PUT A;  1ZW7 A;  3EGR A;  4RH6 A;  1T0Y A;  4I6N B;  1L0X B;  2EMS A;  2M1M A;  2LJ5 A;  4E71 A;  3ZKJ C;  3QWZ B;  1SEB D;  4WAA A;  2LVQ A;  2QCZ A;  1I4P A;  2J42 A;  4M0W B;  3KYC D;  2MA9 B;  2LEK A;  2EKE C;  5J18 A;  4RM9 A;  1MG4 A;  4TMA B;  4HPP A;  2I1J A;  2R61 A;  4REZ A;  1A5R A;  3EUB 2;  3R2T A;  2N1W A;  5DPS A;  2D3B A;  4FUL A;  2K8C A;  1B9R A;  3M63 B;  2MW5 A;  1F2R I;  4RMA A;  4YL8 A;  3DDC B;  1WJ4 A;  4IC7 B;  4MGY E;  2AEH A;  1NEN B;  4NAM A;  3PTF C;  1GC6 A;  3P4S B;  1T3Q A;  5BYS A;  2MX2 A;  2D3C A;  4NNJ B;  5CHV C;  1UUP A;  5G2N A;  3Q69 A;  3AB5 A;  3PRE A;  2G45 B;  1VR9 A;  4GU2 A;  3RMK C;  1I7H A;  2V1Y A;  4FBJ B;  2M56 B;  1T0S C;  2WXM A;  2NTT A;  4JX1 C;  1AN8 A;  1AAR A;  2KQS A;  4KGS A;  4MH0 E;  2DHZ A;  3NZS A;  4C4V B;  3QA8 A;  2J0J A;  1N5X A;  3CWI A;  5BMH A;  1VCB A;  1OQR A;  1SXT A;  3U52 E;  2DAJ A;  2LUE A;  4BKS D;  2DAF A;  3V61 A;  2W9N A;  3KQ4 A;  5AZH A;  1RFK A;  3P42 A;  1AYF A;  2KMC A;  3HVD A;  4HWI B;  1TYG B;  1C3T A;  2XBB C;  3Q8F A;  4M8N A;  4HXD A;  3KH0 A;  2FE8 A;  4ANU A;  1FPY A;  4S0R A;  3VTW A;  1IPG A;  1WX9 A;  3MHZ A;  2ZW0 A;  4GSW A;  3DVN V;  2KLC A;  3AE5 B;  3A1Q A;  5D94 A;  1SE9 A;  5FK9 C;  1JQ4 A;  2BS4 B;  3JSV B;  2L32 A;  3PRZ A;  4C80 A;  1FFV A;  3W9C B;  2C9W B;  3L4P A;  3X0W A;  2XK5 B;  4NQK E;  2JQR B;  2PPH A;  3N1X C;  1FCL A;  4A3O A;  4YSZ B;  1V1O A;  2OHF A;  4N59 A;  1N63 A;  2MP2 B;  3ZRC A;  1P1A A;  4MGZ E;  1J8C A;  2GLS A;  1BXT A;  4LNO A;  3RNE C;  1FFU A;  5C3J B;  4PYU A;  1Z5S B;  2L0F A;  3WCQ A;  4GDK A;  4MH8 A;  3N3K B;  2GBM A;  3AM9 A;  1ZGU B;  2WQY B;  4KIK B;  3A4S C;  2J4X A;  4LTU A;  2O6V A;  3R7R A;  4WJO A;  3JVZ X;  1D5M C;  1GC7 A;  2Y3A A;  2WHI A;  4XYC A;  2RDH A;  3TEW A;  2HJ1 A;  1JML A;  4HLE A;  1QOF A;  3AMZ A;  2XN9 C;  5D6J B;  4W9E A;  4X57 B;  1N60 A;  3O13 A;  1LXD A;  3ZXR A;  2L05 A;  2DZJ A;  1P98 A;  2QDF A;  4W9C A;  2C7M B;  2JVC A;  4I6P A;  3ECI A;  2PE6 B;  1ET9 A;  3VAW A;  1PFD A;  3H7P A;  2NPT A;  2MJE A;  1ESF A;  5GXG B;  4KZC A;  3OG5 A;  1B1Z A;  3MFG A;  5AUI A;  1YNT E;  4WH4 A;  3C0R B;  3GE8 C;  1CZP A;  3W2D A;  4D2K A;  2KQ7 A;  5IAA C;  2BGF A;  4P1C C;  1IYF A;  1WXA A;  3BVM A;  3ZJT A;  5EE1 A;  5JXV A;  4FJZ A;  1M94 A;  1V1P A;  3UQA A;  4P6V F;  1P7E A;  3QC8 B;  5FR6 A;  3ZTD A;  2LWP A;  3NVV A;  1NDD A;  3AE2 B;  2W55 A;  4FXC A;  4TSS A;  1QOB A;  1UGM A;  3OAW A;  4PT5 A;  4XDD A;  2WGS A;  2KC2 A;  1C9F A; 
#chains in the Genus database with same CATH homology
 3BWU D;  1ZPS A;  3AEF B;  2WDQ B;  4RGT A;  4AQ7 A;  4ZRP A;  2PKO A;  5FR3 A;  2MH7 A;  3BYY B;  4M0W A;  1YJJ A;  2LFI A;  4L2Y A;  3NVW A;  2ON8 A;  3BVZ A;  3RPF C;  2BB6 A;  3P4R B;  2W54 A;  4RCO A;  1DGJ A;  1QT9 A;  2GB1 A;  1YN3 A;  1EM7 A;  2SEB D;  4B0M A;  3H8H A;  1SF0 A;  1MHX A;  2M0A A;  2TSS A;  3NUH B;  3U2S C;  1SE2 A;  1WYG A;  1AW7 A;  3I9V 1;  3BYT B;  2LJI A;  4JWS C;  1C78 A;  2LHE A;  5BMG A;  1ZOY B;  2WU5 B;  1I4H A;  4OZB A;  3FAH A;  1FXI A;  3BZD B;  2MJ3 A;  3R8B A;  3P4Q B;  1JCK B;  1QQR A;  2K3U A;  3AV8 A;  1FMA D;  2Y5C A;  1KTK A;  2LHD A;  5HFY A;  3BK2 A;  4YXD B;  1KF6 B;  4CQN A;  1VZ7 A;  1I4X A;  3PZ8 A;  1XXG A;  1WGK A;  3R2I A;  2FBW B;  1M4V A;  1J7A A;  2JYT A;  2WXO A;  1K52 A;  5FKA C;  1UWX A;  4HRS A;  2BBC A;  2INN E;  4RFB A;  3TUO A;  1L6V A;  2BT6 A;  2QIE B;  1HEZ E;  3PZ7 A;  4IDI A;  4GDL B;  5BMI A;  3AE7 B;  1VLB A;  1NVI D;  1ZXI A;  2YEP F;  3BK1 A;  2KAJ A;  4O1N A;  3E56 A;  3AE1 B;  2G9H D;  2N9L A;  2L52 A;  2E6X A;  2Z8L A;  4RNA A;  2G1E A;  2CU3 A;  2IGG A;  2PVG C;  3TEZ A;  3ZJV A;  3ETR A;  3Q8A A;  2V4I B;  1ZUD 2;  2YEP B;  3W5U B;  2WS3 B;  1QIL A;  5C2T B;  4YT0 B;  4LLG M;  1HZ5 A;  1YQ3 B;  3W1S A;  4ARC A;  2WP9 B;  3IAS 1;  5I4D A;  4JE3 B;  1EU4 A;  2LUM A;  3P1M A;  3SFD B;  1V8C A;  4N6E B;  1E6E B;  2K0P A;  2NTS A;  1FO4 A;  4KKI A;  4IKG A;  1EWC A;  4TQ0 A;  3C8Y A;  3NVZ A;  2EEL A;  2JYE A;  3VR9 B;  1I4Q A;  1TKG A;  2LMC A;  3HUI A;  5EE3 A;  1ZDX A;  1C77 A;  1KLG D;  1T5X D;  1F0Z A;  2RPV A;  1RWS A;  1GB4 A;  1MI0 A;  1ROE A;  2KWD A;  3N9Y C;  3I57 A;  4RF1 A;  4A9A A;  3LYY A;  3AE4 B;  4YTP B;  2QIL A;  4HKQ A;  1P7F A;  1HA5 A;  2WXK A;  4RGM A;  2H88 B;  4GDK B;  2JU6 X;  1JW9 D;  4GLS C;  1OFF A;  1Y56 A;  1NEK B;  3AEA B;  1FEH A;  1FNU A;  1SIJ A;  1RM6 C;  5LNK 1;  4XDC A;  5TSS A;  3AE3 B;  4WUR A;  2JSV X;  1JWS D;  1F77 A;  1MPE A;  3LB8 C;  1QOG A;  1TS4 A;  2XNA C;  4ITK A;  3FIL A;  1TS5 A;  1E10 A;  1ACC A;  2L83 A;  1JWM D;  1V97 A;  2WXF A;  2WDR B;  1IGC A;  4MM3 B;  2IGH A;  2WXL A;  3GB1 A;  1VRA B;  4DXF A;  1PGX A;  2VZK B;  1WWT A;  4C7Z A;  4AS1 A;  4ZRQ A;  1XLN A;  1XEE A;  1EWY C;  3Q8B A;  3P4P B;  3LXF A;  4USA A;  3MJ5 A;  4XWW A;  1J7C A;  2HTM E;  4A55 A;  5BYQ A;  2OED A;  4ZYS A;  3NZ3 A;  1PYW D;  2N7J A;  5HHD G;  4YTM B;  3PO0 A;  3V05 A;  2IPK D;  3BVG A;  1C9F A;  1SB3 C;  1F2R C;  2WXI A;  1LO5 D;  3IT4 B;  2K9X A;  1UGJ A;  2N0S B;  2K5P A;  1IUE A;  1WSP A;  1QOA A;  1FNV A;  3U7Z A;  4XE0 A;  1TKY A;  2WXH A;  4OZC A;  2BS3 B;  1HQR D;  2WXN A;  2N9K A;  3TEX A;  1GAQ B;  2KQ4 X;  3W5V B;  2DWQ A;  4ZOH C;  3NVY A;  2V3P A;  3IXS A;  4KKJ A;  3ZGZ A;  1C4A A;  1UWM A;  4L23 A;  1PDX A;  2KMM A;  5HI1 A;  1N5W A;  3AH7 A;  3AED B;  2JWU A;  1KFY B;  1L5P A;  2MEK A;  4JWU C;  2B76 B;  2M19 A;  1YN5 A;  2WXJ A;  3B2G A;  1XLQ A;  3ABV B;  2RMM A;  5D7G A;  1VJK A;  1D5X C;  1PUT A;  3EGR A;  4RH6 A;  3P63 A;  3VR8 B;  1IBX A;  1SJH D;  5MPO A;  1L0X B;  4JPS A;  1XO3 A;  3KWL A;  4EE2 A;  1SEB D;  2PLP A;  3SR6 A;  3VRB B;  3VRA B;  1ZXH A;  4A6Q A;  1I4P A;  2AX5 A;  2J42 A;  2INP E;  3TSS A;  3AEG B;  1IGD A;  2LEK A;  1DYQ A;  4KX6 B;  1RYJ A;  2FUG 1;  5HG2 A;  2KDM A;  4TQ1 A;  4TMA B;  1STE A;  4WIP A;  2R61 A;  4REZ A;  3EUB 2;  4ZHP A;  1MHH E;  3R2T A;  3T3N A;  1FNW A;  3SEB A;  4OZA A;  4RGO S;  3UI3 A;  1KH0 A;  1PGB A;  2GRI A;  1YQ4 B;  1B9R A;  4MAC A;  2J53 A;  1GB1 A;  1E7P B;  1YN4 A;  1F2R I;  2AQ1 B;  1QKZ A;  3MC0 B;  1TY2 A;  2PTL A;  1QF6 A;  3AE6 B;  1SBB B;  2NMQ A;  1NEN B;  2WXQ A;  4NAW B;  1D6E C;  4NAM A;  3V3X A;  3RFZ B;  2V0G A;  2IDY A;  2KAC A;  3P4S B;  1XLP A;  1DOI A;  1T3Q A;  1J7B A;  1JAL A;  5BYS A;  1VDV A;  3J9C A;  1UUP A;  1XLO A;  1XCQ L;  2DYO A;  3Q69 A;  3URY A;  3AB5 A;  1L4Z B;  1VR9 A;  3FC4 A;  4HRO A;  2L1A A;  4DXG A;  1FIQ A;  1I7H A;  1XCT L;  2D5G A;  1R7S A;  2M56 B;  3HRD D;  1CJE A;  2WXM A;  3AEB B;  2NTT A;  2DBY A;  4JX1 C;  5T8I A;  1AN8 A;  4YWG G;  4KGS A;  5BYR A;  1EU3 A;  1E0Z A;  3AN1 A;  1TKE A;  3KWV A;  1N5X A;  4ZHO A;  2PW9 A;  3CWI A;  5BMH A;  4J3O D;  1OQR A;  2EKI A;  1K53 A;  1SXT A;  4KGR A;  1UNS A;  2BW2 A;  3U52 E;  2BB5 A;  3U4E G;  4YSY B;  2KN4 A;  2ICI A;  4A90 A;  2QEJ C;  1HZ6 A;  3SFE B;  4OVZ A;  1Q10 A;  3KQ4 A;  2IJ0 A;  1RFK A;  3E9S A;  4MT5 A;  1TY0 A;  4WAF A;  3P42 A;  2QMT A;  1AYF A;  2LGI A;  4UDU C;  3HVD A;  1ET6 A;  1TYG B;  4US8 A;  3Q8F A;  2I2Y A;  4YTN B;  1YMH E;  2MJD A;  3BII D;  1TZO A;  1CK1 A;  2FE8 A;  1QLB B;  1C79 A;  2DYM A;  1SSN A;  4H2A A;  2K22 A;  3OWE B;  4KGT A;  3MHZ A;  4R3D A;  2ZW0 A;  3NRZ A;  3TEY A;  3AE5 B;  3ZJU A;  1TJE A;  1FRR A;  3AE9 B;  4RGN A;  2RDG A;  2QSD A;  4NJC A;  5FK9 C;  1DOX A;  1JWU D;  1JQ4 A;  2BS4 B;  2SAK A;  2L32 A;  3Q8E A;  5EE0 A;  2IGD A;  4C80 A;  1FFV A;  3W9C B;  1C4C A;  1GPX A;  2BTE A;  3L4P A;  1I4R A;  1NYR A;  2JQR B;  2WLB A;  1FCL A;  1JWB D;  3B9J A;  4YSZ B;  1V1O A;  2OHF A;  2H89 B;  4LK0 M;  4N59 A;  4IOI E;  5D3I B;  5H92 C;  1V1P B;  1FD6 A;  1N63 A;  1SJE D;  3AEC B;  1AWD A;  3KLS X;  3FIL B;  1D4B A;  4Q2J A;  5E6J A;  2WNM A;  2W3R A;  4ARI A;  1BXT A;  4A8X C;  1C76 A;  1FFU A;  3EA6 A;  5C3J B;  1E9M A;  1D5Z C;  1N61 A;  3WCQ A;  4MH8 A;  2BS2 B;  3VQI A;  2PMV A;  3AM9 A;  2W82 A;  1L0V B;  1TS2 A;  2ACZ B;  2WQY B;  5D3D A;  1L0Y B;  2AQ3 B;  2WU2 B;  5AUK A;  2J4X A;  1MVK A;  2W3S A;  2BYT A;  5H8Y E;  1ZDV A;  1A70 A;  3AEE B;  4LTU A;  2JX5 A;  2ONQ A;  4OHJ A;  3CIR B;  1I4G A;  4XWT A;  1KLU D;  1D5M C;  3DWM A;  2JXT A;  3HVZ A;  1YJI A;  2PVO D;  2ZW1 A;  1VZ8 A;  2Y3A A;  1SE4 A;  2AQ2 B;  1ENF A;  2WXR A;  1KRH A;  2RDH A;  3ZYY X;  4NZL B;  3TEW A;  3T3O A;  2I38 A;  1N62 A;  1HXY D;  2CJN A;  1JML A;  3IT6 B;  1QOF A;  1WRI A;  3AMZ A;  2XN9 C;  2E3T A;  1FCC C;  1N60 A;  2HDE A;  3MP9 A;  1JWA D;  1VZ6 A;  3O13 A;  1XF5 L;  1ZE3 D;  3Q8C A;  4WQM A;  1BML C;  1WXQ A;  3B2F A;  4WWM A;  1DOY A;  1T6B X;  2JZP A;  4C56 C;  2Q5W D;  1JRO A;  5G5H A;  1GOZ A;  4L1B A;  2PIA A;  1OQQ A;  1ZP0 B;  4N58 A;  1K50 A;  4HKZ E;  1JRP A;  2CJO A;  2X38 A;  1L6U A;  1SE3 A;  3AE8 B;  1ET9 A;  3ZQ4 A;  1PFD A;  3DWG C;  2MJE A;  1ESF A;  1NYQ A;  1IBX B;  2GI9 A;  5GXG B;  1B1Z A;  5G5G A;  3MFG A;  5AUI A;  1YNT E;  4OW0 A;  4WH4 A;  4HEA 1;  2Y5P A;  4YSX B;  1L4D B;  1CZP A;  3W2D A;  1C4P A;  4B0E A;  4D2K A;  1CQV A;  4P16 A;  2QJL A;  3NS1 A;  4HJG E;  3GS2 A;  3BVM A;  1NI3 A;  3ZJT A;  5EE1 A;  1FXA A;  2VZK D;  2DLB A;  1PGA A;  2WXG A;  1BUI C;  5JXV A;  1FRD A;  1V1P A;  4US9 A;  4P6V F;  1FM0 D;  1P7E A;  2J52 A;  4RF0 A;  5EE9 A;  3IAM 1;  4DQO C;  2V3N A;  4C7Y A;  3NVV A;  2WXP A;  3AE2 B;  2W55 A;  2WDV B;  4FXC A;  4TSS A;  1K51 A;  1QOB A;  4PT5 A;  1TS3 A;  4XDD A;  3GP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...