1L4ZB

X-ray crystal structure of the complex of microplasminogen with alpha domain of streptokinase in the presence cadmium ions
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
136
structure length
125
Chain Sequence
MIAGPEALLDRPSVNNSQLVVSVAGTVEGTNQDISLKFFEIDLTSRAMPHKLEKADLLKAIQEQLIANVHSNDDYFEVIDFASDATITDRNGKVYFADKDGSVTLPTQPVQEFLLSGHVRVRPYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plasminogen
publication title Effects of deletion of streptokinase residues 48-59 on plasminogen activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/blood clotting
total genus 29
structure length 125
sequence length 136
ec nomenclature
pdb deposition date 2002-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.180 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1l4zB00
1QQRA 1C4PA 1L4ZB 1BMLC 1L4DB
chains in the Genus database with same CATH superfamily
2PE9A 2PVGC 1KFYB 4P6VF 1NEKB 1Y8RC 4L1BA 2LGSA 4RF1A 4IM2A 4PS7A 3J9CA 3KYDD 1OEYA 2C60A 2O6VB 3AU4A 2HJ8A 1C79A 1ZKHA 3GZNB 3DQVA 3N1XC 1LQBA 1YJ1A 4OZBA 4WQOB 4IM0A 3GB1A 2JZ3B 1PDXA 1YMHE 1UF0A 5IAAC 3AE4B 3APDA 3B0AA 4FJYA 1ESFA 1ENFA 5BYQA 3DBRB 3ZRCA 1GB4A 3A9JB 1H8CA 3H1UA 5L83A 1VZ6A 1L0VB 1EO6A 2FAZA 4GDLB 1NENB 3ONSA 3AEBB 4XWTA 1QZEA 5DPWA 4OVUA 1I4HA 3M3JA 3A33B 1NYQA 3L16A 2OHFA 3ZUNA 5KHQA 4ACFA 4IDIA 1VD2A 4W9IA 1Q0WB 1QKZA 5D7GA 5E6OA 1SE2A 2RGFA 5AZGA 2JQRB 2KANA 3FILA 4B95A 4ANUA 2MA9B 2Y5CA 1UUPA 1C3TA 4FLHA 5BMGA 4M8MA 1OEYJ 2O2VB 1ZDVA 4WWOA 5GMVA 2ZW1A 2KJ6A 1F77A 2KT7A 4MH8A 4P1BC 4HK2A 1LFDA 1TYGB 1JQ4A 3U8ZA 1VJKA 1I4XA 1FMAD 5C1ZA 2GBMA 2J0MA 2G1EA 2BGFA 1L6UA 2RDGA 3W1YA 2LD9A 2LGDA 1FXAA 1WI0A 2Y5PA 3URYA 3VVWB 4YTPB 2WU5B 3WIMA 3IAS1 1BMLC 4C4VB 3DBHB 2JUOA 1JALA 3JSVA 3KUCB 2G9HD 1YX5B 2N1VA 3LB8C 4NNJB 4N59A 4LDTB 3M95A 2WGSA 3HRDD 3UINB 1D5XC 3VTWA 3L54A 2G45B 2N9LA 3W5VB 1E10A 3DHGC 2QHOA 2KLGA 1WX8A 2ZVOA 1AWDA 3SFEB 3ZDMC 3PLUA 4ZRQA 4AUQC 2MJDA 3UQBA 3M63B 2N9KA 3RNGC 3C19A 1XQQA 2LXCA 4GIVA 1PFDA 3MC8A 5AZFA 2LGYA 3IT4B 2LVPA 3AI5A 2W82A 4BZAA 3HK0A 2KQSA 2K0PA 3I5JC 4D2KA 1ZDXA 4H2AA 3SDLC 2OJRA 4FJVB 4W9KA 1UGMA 1WMHA 2WXRA 3QARA 1T0RC 3PV1A 2DZMA 1RFAA 3N9YC 3H9DA 3IHPC 2MP2B 3KWVA 1XF5L 2IGDA 2KTRB 3NRZA 3NVVA 3AN1A 3TBLD 2MBQA 3ZDTA 1ACCA 1L4ZB 1FRDA 2WQYB 5FR3A 3U52E 3UI3A 4MSQB 1XLPA 1M4VA 3OAWA 5CTRC 2L05A 2IPKD 2WDQB 3ZJVA 2MQJA 4EFOA 3LJ3A 3Q3FA 4G3XB 2LI5A 2R2QA 3KH0A 4M00A 2JWUA 3V6CB 2KQ7A 2RPVA 1F9JA 2MWSB 1WH3A 2MW5A 4OVVA 2EKIA 2IO0B 3IAM1 2WXHA 4URKA 2L76A 4EZJA 2GLSA 1D4BA 1P0RA 2KLCA 2LRWA 4XZ4A 2KDEB 2ZNVC 1TZOA 1UNSA 1F2RC 1WXVA 4NAWA 1WM2A 3ZVVA 2K1FA 1PGAA 4IC7B 1STEA 1RFKA 1K50A 2KC2A 1L4DB 5EE0A 2O6VA 3ZNZB 1FIQA 2KZRA 2MBOA 1UZXB 4LNNA 4RGNA 1UD7A 4GDKA 2FCNA 1JWMD 2CJOA 2KK8A 1X1MA 1WE6A 3BYYB 1AYFA 3PVLA 2KKCA 3V6EB 1PGXA 3VUXA 1EF1A 4F8CB 2LZ6A 3KWLA 5DPSA 3HHMA 3A9JA 4DXAB 2L32A 3UF8A 3GP7A 1I4RA 2JZPA 2KDIA 1KLUD 3ABVB 4BKSD 2PIAA 2OEDA 3K9PB 4HXDA 3H7SA 3NY5A 2QIEB 1XLNA 1HQRD 4N9F4 2BT6A 3P4SB 4W9CA 1E9MA 4A3OA 1FFUA 1T0QC 2LUMA 3CMMB 4O1NA 1N62A 1RRBA 1WXSA 4W9LA 1ZE3D 5JHBA 2BKFA 2WDTB 2OJWA 4E71A 3EHVA 4YSXB 1QOAA 2LGXA 4C7ZA 1DYQA 2LGIA 1HA5A 3AE5B 1ZUD2 3TCAA 1FEHA 2ZCBA 1WWTA 2PVOD 4YSYB 3AEFB 1ISNA 1J0GA 1SE9A 1F52A 1MPEA 2BB5A 5EDSA 3MTNB 3ZLZA 4MELA 4GOCA 5LNK1 1C4CA 2NCNA 3ZTDA 4BAXA 1FCLA 2M4NA 4BKTA 2NTSA 2WXGA 3IT6B 1I4PA 4IG7B 4PS8A 4HPPA 5AUKA 3ZTCA 3QWZB 2FNJB 1SE4A 4NJCA 4YXDB 2VZKB 4DHJD 4AJYB 1V5TA 4N58A 5G5GA 4C4VA 3FILB 3DWMA 4HJGE 1Q5WB 1NI3A 5IOIA 3MJ5A 5C3JB 2WXQA 4GN1A 1MHXA 2GOWA 3AE1B 3E9SA 4HCPB 1DGJA 2L1AA 1SIJA 2K39A 3Q2AC 1TKEA 4JWUC 4ZYNA 1WGRA 1N5XA 1GJZA 1JW9D 2KD0A 2CU1A 3RT3B 1U4AA 3BVGA 1K8RB 1E8XA 4HEA1 2QC8A 4DHZB 3O65B 2UYZB 2VH1A 4AWJA 4A90A 1Z5SB 3PO0A 1WRIA 5DPTA 1EF5A 3KYCD 4ICUA 1XLOA 5I4DA 1CQVA 1FPYA 3UGBB 3JSVB 3NUHB 1OFFA 1FRRA 1K53A 3NHEB 3AE9B 4XE0A 3GE8C 2KWCA 4F7ZA 2A4ZA 3P63A 2DHZA 3Q8BA 1I4QA 2RPQA 4HVBA 4L23A 3H8HA 4PT5A 1WXMA 2NMQA 1WGHA 2K22A 1ZPSA 3NG0A 4GSWA 3L08A 3VH4B 2KC1A 3B9JA 1KM7A 1YN4A 4ARCA 4US9A 3C0RB 4ITKA 1J7CA 1N63A 2C7MB 5J17A 4GMVA 3VDZA 2FCMA 5D6JB 5DPRA 1UWMA 4FJZA 4WJNA 1E0ZA 2ZNVB 2H89B 1L2NA 3MHSD 3BK1A 1C9FA 5LLIA 3RZFA 4YL8A 2DYMA 4A6QA 2ON8A 4JX1C 4RCOA 4EEWA 1L0XB 4BOSC 1YX6B 3B1LX 3ZJUA 4KIKA 4K7SA 4JQWC 2L52A 2PPHA 2LUEA 4KKJA 2MX2A 1C1YB 4IWQA 3WA0A 3TMPB 2IY0B 3CF6E 4IKGA 4JGHB 4HROA 5CHVC 2C9WB 3PPAA 2JPHA 2WXPA 4TSSA 1EU4A 1VLBA 4K3CA 1IGDA 2NBUA 1FM0D 1E7UA 3DBSA 4L2YA 3HM3A 1WM3A 1TY0A 1JWSD 1YJIA 3ZW3A 3ZNGC 1FD6A 2AQ3B 4M01A 1WXAA 1RM6C 2K6QA 4OZAA 2XEWA 2JRIB 3WAPA 3AE8B 2KO3A 1UH6A 4ZOHC 1ZP0B 4ZRKA 4NAWB 1XEEA 2VRRB 4MGZE 3NVWA 1MJDA 3ZXRA 3KUDB 1Y56A 4X57B 3N3KB 3TIXA 4KGRA 4CO7A 2WNMA 3RNEC 4OVZA 4A20A 2KHWB 3EUB2 4LJOB 3P42A 3VRAB 4BVUC 2W54A 4GDKB 3VFKA 4KVGB 1ZW7A 2DLBA 3A4RA 2FIDA 2D3BA 1HZ6A 3E56A 3RNCC 2JZZA 1AARA 1KTKA 2N9XA 2BS2B 2D3CA 1V1OA 1QOBA 1SEBD 1D3ZA 5KHOA 4PK1A 4GU2A 1HZ5A 2AL6A 2L3ZA 1D5ZC 3RNBC 2E6XA 1GG3A 2ZPNA 1NYRA 4NJ6A 3TEWA 4S17A 2E3TA 3HVZA 2WDRB 4YWGG 1WSPA 1MVKA 4FA6A 2L0TA 2R2OA 1BXTA 3RD2A 3FAHA 4EE2A 4EUTA 3ETRA 2KOXA 2RDHA 1XO3A 2JF5A 1Z2MA 3AM9A 2M1MA 3W5UB 2AYOB 3NS1A 2GMIC 3H6NA 2NPTA 1EWCA 2RR9A 3EC8A 1SB3C 2WXIA 4PYUA 3A9KA 3HUIA 2J0JA 2YVCA 1DOXA 3P2BA 3GE3C 3PHWB 3W1SC 2D3GA 2PMVA 5EE3A 2IDYA 5DCNA 1UBIA 3IXSA 4IWPA 3Q69A 4A9AA 2IY1B 1OTRB 1T6BX 4YSZB 1GAQB 4FADA 2DAJA 2K6DB 1JRUA 2C5LC 5CX3A 4WQMA 2KX0A 3VHTC 5BMHA 1HEZE 1TKYA 1WYWB 3UQAA 3AEEB 3VXWA 2LHDA 2K8BA 2KDBA 2LVQA 1B9RA 2ZW0A 3U30A 1WGDA 1TS2A 4W9GA 5EE9A 2GBKA 2WP9B 3QA8A 2JX5A 3DOWA 4JWSC 3BK2A 1JWUD 4KX6B 1A70A 1YQBA 2WWZA 2KDMA 4KDIC 1YJJA 2BVCA 1DOIA 2KJRA 5CHWA 3CWIA 4I6NB 4M02A 2LMCA 1E5WA 1J19A 2JXXA 4II2B 3QAQA 2N1WA 3A1QA 1NDDA 4W9JA 2G3QB 4LK0M 4TKNA 1V9JA 2GBNA 4JPSA 1E90A 1T0SC 1TZ1A 1F2RI 2HDEA 1YQ3B 2DENB 2LWPA 3H7PA 4DXGA 3PZ7A 4BBNF 2J7QB 2DX5B 3O13A 5LXHA 3SU8X 4WJQA 4TV3A 3ZQ4A 2QILA 2MBBB 2NBVB 2ICIA 1E8ZA 1TKGA 1UWXA 2M17A 5JZEB 4GGQA 3AEAB 1S1QB 3P4PB 2FCSA 3EA6A 3SFDB 1P7FA 2GI9A 2WLBA 2KYWA 2XNAC 2LJIA 3MFGA 2M0AA 4EZKA 3ML8A 3AE2B 2RSUA 1CMXB 3OWEB 5IA7A 4WJOA 5E6NA 3NJTA 4DHZE 2PJHA 4FBJB 3BIID 2KNBA 1CZPA 3TSSA 2KWDA 4II3B 3UIPB 1WXQA 3PRPB 4RGTA 3OJ4B 4KIKB 4G11A 4ZRIA 3L10B 3N1YC 1ZXIA 1FNVA 5AZHA 4IWOA 3UIOB 1WX7A 1L7YA 5AEKB 1KF6B 4DHJB 1MFWA 3B2GA 1AW7A 1PYWD 1ZOYB 1A5RA 3Q14C 5H92C 2V4IB 4A55A 4DQOC 2MRPA 2BQQA 1IPGA 3V60A 3SD5A 2DZJA 3PSEB 5IO9A 3LXFA 2KFJA 4OW0A 3IG3A 2K9XA 3BZDB 3R2IA 1HXYD 3AE3B 2MSED 1YIWA 4LTUA 4KGSA 4K3BA 2BS4B 2IYDB 2JWZA 4DBGA 1T0YA 4FHJA 4MM3A 3L0WB 1YN5A 4GXBA 1VRAB 4FXCA 4PYZA 3APFA 1LGRA 2ZCCA 2MJ3A 4IOIE 5J18A 2MEKA 2D07B 1XLQA 2L83A 2H88B 1E7VA 1E7PB 1ET6A 5MPOA 2NR2A 3PZ8A 2YEPF 2DAFA 5G5HA 2HE7A 1KH0A 4YT0B 2JT4B 3Q3OC 2AL3A 3AE7B 4LNKA 4RNAA 1GOZA 3R8BA 3W9CB 1QLBB 4K81A 4KZCA 2EMSA 2OOBB 5TR5A 1C4AA 5HG2A 4W9HA 3DHHC 4PS3A 1VZ8A 5C23A 2JSVX 4JL9A 3DPDA 2JYTA 2JY6A 4KKIA 3OJ3A 1TY2A 2FCQA 1MHHE 2WXOA 3TJPA 2LFIA 1F0ZA 4MGKE 4DDGD 3VUWA 1R4MI 3ZNHB 3N1ZC 2D10A 4W9DA 3DWGC 1JWBD 4C56C 4RFBA 4G0NB 4A8XC 1IBXB 2AQ1B 3QHTA 4KZ0A 1WYGA 2INNE 3AEGB 4M8NA 3ML9A 2NPTB 1SF0A 3P4RB 1LM8B 1YNTE 2SAKA 1H4RA 1NI2A 3A9KB 2MJEA 2N4FA 2BS3B 1T3QA 5CHFA 1GPXA 2WXMA 1C76A 3PS6A 2K25A 3MC9A 3DBLI 2DZKA 2Y5BB 5IKCM 1TJEA 5BO4B 1JRPA 2LEKA 2G4DB 4WJPA 1V1PB 2WXJA 1N6ZA 2MLBA 4WH4A 4US8A 3T3OA 4HDOA 2KXJA 2CHXA 5D94A 4BKGA 3NZSA 4MGIE 3VH3B 2WU2B 3OG5A 3FKYA 1N5WA 2KMMA 3CSTA 2QSDA 4XX5A 3WAMA 4FULA 4W9FA 2RMMA 3RI7C 1ZXHA 2WS3B 3X23A 2KAJA 1GC7A 2AX5A 1WFYA 2KJHB 2B76B 2V4LA 1R7SA 2IJ0A 2V9HA 2L8JA 4BKSA 1SSNA 4BOZB 2EKEC 2TSSA 3PRZA 1FNWA 1YQ4B 3EECA 2HTME 1PGBA 2NTTA 3ZO5B 1TTNA 2INCC 2BWES 1J7AA 3I57A 2GRIA 3GOEA 5H8YE 3MP9A 3A1QB 1L6VA 3QQ8B 5BYSA 2KWUB 3CSFA 3R66C 3H7PB 3SEBA 1B1ZA 3QIJA 3TEXA 2WXFA 1C4PA 2MH7A 4ZDVA 4MH0E 2RDBC 4XYCA 3AH7A 4HPLB 1Q1OA 3U2SC 5JXVA 3JW0X 3SR6A 1OGWA 4B0MA 1WJUA 3V61A 2LVOA 2IGHA 2ZJDA 2KVZA 3ZIMA 1I42A 1I4GA 4NPNA 2JRHA 1PQSA 1IYFA 3PREA 5BYRA 2FUG1 3AULA 2INDC 3PHXB 3TL5A 2Z0EB 4MSMB 3I9V1 3DVNV 4N6EB 1WZ3A 3RUIB 4WAAA 2CKHB 3AB5A 1K51A 3CIRB 1XCTL 1CJEA 1JCKB 2DNFA 3ZKJC 2ZVNA 4EZLA 3ZXVA 4BBNC 2LJ5A 3AECB 1K52A 3C8YA 1FXTB 4CHKA 2N9PC 1OQQA 3APCA 2D11A 3U7DA 3JYUA 2N7EA 4CYEA 2M19A 2WDVB 4Q2JA 4ICVA 4K1RB 4XC2A 3Q8FA 3W1SA 1SE3A 2DBYA 4ANWA 2BTEA 1F1HA 1E8WA 3PTFC 4RF0A 1SJED 4NQKE 4C00A 1TBEA 2N0SB 2XK5B 1SBBB 4KSKC 5E6JA 3KLSX 1DOYA 2XN9C 2I1KA 4KGTA 1ET9A 2W55A 2V0GA 1WE7A 2DZIA 3ENEA 4MJSA 1TS4A 4MM3B 5FK9C 1UGJA 2PE6B 2C7NB 1V5OA 2PTLA 3S2AA 1KLVA 1BT0A 2N7JA 3BVMA 3MHZA 1YN3A 2I38A 4B0EA 1OQYA 5GXGB 3V05A 2REXA 3BWUD 3IVFA 4NAMA 1Q10A 1EM7A 3N30A 3R2TA 1L5PA 1WRDB 2MHJA 3R3MA 1IBXA 2FBWB 4FHKA 1GB1A 2AWTA 2W3SA 4AJWA 1HTOA 2YLMA 4E74A 2NS5A 2J42A 1EWYC 3AEDB 5D3DA 2BBCA 2INPE 1LXDA 2CHZA 5G55A 4WIPA 4AP4C 2BWFA 4P1CC 4TMAB 1J8CA 5FR6A 4ZYSA 2MBHA 4R3DA 5FKAC 1N61A 4MEMA 1R4MB 2IO2B 4DDID 4AS1A 3WAOA 5D2MB 1QT9A 4ANXA 1G6JA 1V1PA 1WF9A 1WY8A 3DCGA 4JIOU 3DVGY 3VAWA 1C78A 2BPSA 4HPMB 4WWMA 4XWWA 3VTUA 1WJNA 3BYTB 1P9DU 3OLMD 5E6PA 3LYYA 1QOFA 1RYJA 3NS8A 3KUZA 5JH5C 2I1JA 2KFKA 2R61A 3DBLB 4FN2A 3B2FA 4MACA 1MG8A 3PGEA 2Z59B 4GB9A 1PUTA 2BW2A 4NZLB 4QAYA 5JHAA 4NY0A 1WR6E 4ZHOA 1M94A 3L13A 4EOYA 3AE6B 3L17A 4S0RA 3KVFB 2ZPYA 3RMKC 1TS5A 1UBQA 3L4PA 2O6VD 3PRMB 4LJPB 2HJ1A 4RMAA 3FC4A 2KN4A 1QQRA 3EFCA 5HI1A 1I7HA 3T3NA 2WXKA 4KV2A 5AUIA 4B6WA 3IFWB 2Z0DB 3QC8B 2SEBD 3DDCB 1XT9B 4BFRA 2JYEA 2W9NA 4LNFA 2V3NA 2KACA 5L95C 3RNFC 1GC6A 3X0WA 3JVZX 2IO1B 2KN5A 2PKOA 4J6IA 4HKZE 4E3CA 2V3PA 2NBWB 4RM8A 3VTVA 1P7EA 4K7WA 3W2DA 1YD8U 4C80A 1R4NB 4DXFA 3AMZA 2QJLA 3P4QB 1SJHD 4OHJA 2DWQA 3MC0B 3MJWA 4RH6A 4HLEA 2FIFA 3Q3JA 1XCQL 2J53A 1SXTA 1IP9A 3NVYA 1V8CA 4LCDE 1VCBA 2UU7A 3VR9B 3U7ZA 4IUMB 2QEJC 3N32A 3DHIC 2BYFA 3Q8CA 4HDQA 1XXGA 3AU5A 2KWVB 2BYEA 2MBEA 2MCNB 1UELA 2DYBA 4TUUA 4OZCA 3DVNU 2BYVE 3A4SC 3IBEA 2Z8LA 2J4XA 1RLFA 2FE8A 1WGYA 1FXIA 2LASA 4K7UA 4LLGM 5T8IA 1V2YA 3HIZA 5TSSA 3V3XA 3K9OB 4MT5A 4UDUC 2W3RA 1WJ4A 1MI0A 4B9KA 1ZGUB 4RGOS 4ZHPA 3DVGX 1YOVB 1D5MC 3KQ4A 4LDTD 1WGGA 1NBFC 3GS2A 1WGKA 1QOGA 4YTMB 2KTFA 2KDFB 2KMCA 2L00B 2XK5A 2G4SA 3BY4B 3ECIA 2GB1A 4M0WB 4WWPA 4LNIA 5EE1A 2WXNA 2HD5B 2M0XA 2K8HA 3GZNI 3NOBA 2M8SA 3RN9C 3T8MA 1BUIC 1XD3B 3Q3MC 5G2NA 1KLGD 2X38A 2CS4A 4USAA 2QDFA 2KQ4X 4NJ7A 3Q8AA 2LRUA 4ZRPA 2IO3B 3RNAC 4TQ0A 3DBRI 1VR9A 3QK0A 1N60A 3RYTA 3ZNID 1E6EB 3HVDA 4GDLA 3VRBB 3VR8B 2EELA 2GBJA 2AQ2B 2BB6A 3KW5B 4MJSB 1IGCA 1LO5D 3PZDA 1KOTA 4MGYE 2YEPB 1NVID 1VDVA 4IW0A 3N20C 5IP4D 3T9LA 1WR1A 2CHWA 3VQIA 4HWIB 1EUVB 2BKRB 3B08A 3NVZA 4ANVA 1WZ0A 1ROEA 4EKUA 2HTHA 2C7HA 4CQNA 3TUOA 4XDCA 2V3SA 3ZRFA 2JXTA 2KMAA 3RCZA 4ARIA 2J0KA 2O2VA 4W9EA 2L7RA 4P7IA 1T5XD 2ZEQA 5C2TB 4JLCA 2UWQA 4NQLB 3ZJTA 2IBIB 1FCCC 3V62A 1D6EC 1TGZB 4F1SA 1JWAD 2N9EB 2FUHB 4WAFA 1E8YA 5LXIB 3RFZB 1KJTA 1TS3A 1JROA 2WHIA 2D2QA 1P3QU 1WJ6A 1CK1A 3I63C 3EFUA 2VH2A 1FO4A 2CU3A 3AXCA 3DBHI 4WURA 1GNUA 3TEYA 1L0YB 2JVCA 3RPFC 3I3TB 1MG4A 3LDZE 4GLSC 4XDDA 3RZWC 2PW9A 4ASWC 3P1MA 4HRSA 1WIAA 5BMIA 2LHEA 4J3OD 1RAXA 4AOFA 1IUEA 3RULA 1HE8A 1V81A 5D3IB 2WYQA 4C7YA 3Q8EA 2KFKB 3U4EG 3QX1A 5HKHA 4JE3B 2LXAA 4HJKA 1OQRA 1TIFA 2CR5A 3QJZA 4ZRJA 1S3SG 2X8XX 1V97A 4YTNB 2PLPA 2WXLA 3NZUA 4MDKE 3PT2B 2DYOA 1R4NI 5HFYA 3M62B 1RWSA 3D32A 1GUAB 3WCQA 4RM9A 2QMTA 4KSLC 2ACZB 2J52A 2MP2A 1V6EA 4REZA 2IZVB 4RGMA 1EU3A 2EMTA 4TQ1A 2KTRA 1V80A 1FFVA 1AN8A 3ZYYX 2WX1A 4LNOA 1TT5B 2D5GA 4P16A 2RD0A 2V1YA 3QCAA 1V49A 2NVUI 2JU6X 3Q6BA 2GBRA 1J7BA 2K3UA 1SGHA 2KVRA 2PEAA 1HTQA 1KRHA 3VUYA 1JMLA 3Q3NC 1WMHB 4KDLB 3R7QA 4WWNA 1SIFA 2AEHA 2VZKD 1FNUA 2ONQA 1C77A 3R7RA 2IGGA 3WALA 2N7DA 2CJNA 3BINA 4HCNB 2ZZPB 1P98A 4DK5A 4I6PA 4I6LB 3SHQA 4AQ7A 3EGRA 3TEZA 3HM6X 5HHDG 3WANA 2Q5WD 4IM3A 2B3AA 2L0FA 4G50A 4M0WA 1P1AA 2Y3AA 4XGAB 2M56B 1I35A 3ALBA 2KX3A 5IN7A 1WX9A 2XBBC 2A5UA 1QF6A 3AV8A 2K5PA 4HKQA 3PLVA 2BYTA 1VZ7A 1QILA 4DWFA 1V86A 3NZ3A 2K8CA 2I2YA 2QCZA 3BVZA 2WX0A 2D3AA 2BF8B 2ASQA 4A3PA 5J2RA 3ZGZA
chains in the Genus database with same CATH topology
1XLOA 5I4DA 1CQVA 2PVGC 1KFYB 4P6VF 1NEKB 4L1BA 3FC4A 2KN4A 1QQRA 1YN5A 1OFFA 3NUHB 1FRRA 5HI1A 4RF1A 1K53A 3AE9B 1I7HA 1VRAB 4FXCA 4XE0A 3J9CA 3T3NA 2MJ3A 2WXKA 3P63A 4IOIE 1C79A 3Q8BA 1I4QA 2MEKA 5AUIA 4L23A 3H8HA 4PT5A 1XLQA 2L83A 2H88B 4OZBA 2NMQA 2K22A 1ZPSA 2SEBD 1E7PB 1ET6A 3GB1A 2JYEA 3PZ8A 5MPOA 1PDXA 1YMHE 2KACA 2V3NA 2YEPF 5G5HA 1KH0A 4YT0B 3AE4B 3B9JA 1YN4A 1ESFA 4ARCA 1ENFA 3AE7B 4US9A 4ITKA 5BYQA 2PKOA 1J7CA 4HKZE 4RNAA 2V3PA 1N63A 1GOZA 3R8BA 3W9CB 1QLBB 1P7EA 1GB4A 3W2DA 4C80A 4DXFA 1UWMA 3AMZA 1VZ6A 1L0VB 1E0ZA 2QJLA 2H89B 1C4AA 3P4QB 5HG2A 1SJHD 3BK1A 4GDLB 4OHJA 1NENB 1C9FA 2DWQA 3MC0B 3AEBB 4XWTA 1VZ8A 2DYMA 2JSVX 4A6QA 2JYTA 4KKIA 2ON8A 1I4HA 4RH6A 4JX1C 1NYQA 4RCOA 1TY2A 1L0XB 1XCQL 2J53A 2OHFA 1SXTA 4IDIA 1MHHE 2WXOA 2LFIA 3ZJUA 1F0ZA 3NVYA 5D7GA 1QKZA 1V8CA 3DWGC 1JWBD 4C56C 1SE2A 4RFBA 2L52A 3VR9B 2JQRB 4A8XC 3U7ZA 1IBXB 4KKJA 2QEJC 2AQ1B 3FILA 3Q8CA 1WYGA 2INNE 3AEGB 1XXGA 4IKGA 4HROA 2Y5CA 1UUPA 5BMGA 1ZDVA 2ZW1A 1SF0A 3P4RB 4OZCA 1YNTE 1F77A 2SAKA 2WXPA 4TSSA 4MH8A 1EU4A 1TYGB 1VLBA 2MJEA 2BS3B 1IGDA 1JQ4A 2Z8LA 1T3QA 2J4XA 1FM0D 1I4XA 2FE8A 1VJKA 1FMAD 1FXIA 2WXMA 4LLGM 4L2YA 5T8IA 5TSSA 1C76A 3V3XA 1TY0A 4MT5A 4UDUC 1JWSD 2W3RA 1MI0A 2G1EA 1L6UA 1YJIA 2RDGA 4RGOS 1FXAA 1FD6A 2Y5PA 4ZHPA 2AQ3B 1TJEA 3URYA 1JRPA 2LEKA 1D5MC 3KQ4A 4YTPB 2WU5B 3GS2A 1WGKA 3IAS1 1RM6C 1QOGA 1V1PB 4YTMB 2WXJA 1BMLC 4OZAA 3AE8B 4WH4A 1JALA 4US8A 3T3OA 4ZOHC 2G9HD 3LB8C 1ZP0B 2GB1A 4N59A 2WU2B 4NAWB 5EE1A 1XEEA 3HRDD 1D5XC 1N5WA 2WXNA 3NVWA 2N9LA 3W5VB 2KMMA 1Y56A 1E10A 2QSDA 1BUIC 4KGRA 1KLGD 2WNMA 2RMMA 1ZXHA 4OVZA 2WS3B 2X38A 4USAA 2KAJA 3EUB2 3VRAB 3P42A 2AX5A 2W54A 4GDKB 1AWDA 2KQ4X 3SFEB 2DLBA 3Q8AA 2B76B 4ZRPA 1R7SA 4ZRQA 2IJ0A 1SSNA 1HZ6A 3E56A 4TQ0A 2TSSA 1FNWA 1YQ4B 2HTME 1PGBA 2MJDA 2NTTA 1VR9A 1KTKA 2N9KA 1N60A 1E6EB 2BS2B 3HVDA 1PFDA 3VRBB 1V1OA 3VR8B 1J7AA 1QOBA 3IT4B 2EELA 3I57A 2AQ2B 1SEBD 2BB6A 2GRIA 5H8YE 3MP9A 1IGCA 2W82A 1LO5D 1L6VA 1HZ5A 2K0PA 4D2KA 5BYSA 1ZDXA 4H2AA 1D5ZC 2E6XA 2YEPB 2WXRA 1NYRA 1NVID 3SEBA 3TEWA 1B1ZA 1VDVA 2E3TA 2WXFA 1C4PA 2MH7A 3HVZA 3N9YC 2WDRB 3TEXA 3VQIA 3KWVA 4YWGG 1WSPA 3NVZA 1MVKA 1XF5L 2IGDA 3AH7A 3NRZA 1ROEA 3NVVA 1BXTA 4CQNA 3AN1A 3TUOA 3FAHA 3U2SC 4XDCA 4EE2A 1ACCA 5JXVA 3SR6A 1L4ZB 2JXTA 1FRDA 4B0MA 2WQYB 3ETRA 2RDHA 5FR3A 1XO3A 4ARIA 3U52E 3UI3A 3AM9A 3W5UB 1XLPA 1M4VA 3NS1A 1EWCA 2IGHA 2IPKD 1SB3C 2WXIA 2WDQB 3ZJVA 1T5XD 3HUIA 5C2TB 1I4GA 1DOXA 3ZJTA 2JWUA 1FCCC 5BYRA 2FUG1 1D6EC 1JWAD 2PMVA 2RPVA 5EE3A 2IDYA 4WAFA 3IXSA 3RFZB 3Q69A 2EKIA 4A9AA 1TS3A 1JROA 2WXHA 3I9V1 3IAM1 1T6BX 4N6EB 1D4BA 4YSZB 1CK1A 3AB5A 1K51A 3CIRB 1GAQB 1XCTL 1CJEA 1FO4A 1JCKB 2CU3A 4WURA 3TEYA 1L0YB 1TZOA 1UNSA 4WQMA 1F2RC 3AECB 5BMHA 3RPFC 1K52A 1HEZE 1TKYA 3C8YA 4GLSC 3AEEB 4XDDA 2PW9A 2LHDA 1PGAA 1OQQA 1STEA 2ZW0A 1RFKA 3P1MA 4HRSA 1B9RA 5BMIA 2LHEA 1TS2A 1K50A 4J3OD 1L4DB 5EE0A 1FIQA 5EE9A 1IUEA 2M19A 2WDVB 4Q2JA 2WP9B 4RGNA 5D3IB 4C7YA 2JX5A 4JWSC 3Q8EA 1JWMD 3BK2A 2CJOA 1JWUD 3Q8FA 4KX6B 3U4EG 1A70A 3W1SA 1SE3A 2DBYA 1GPXA 2BTEA 3BYYB 1AYFA 2KDMA 4JE3B 1YJJA 4RF0A 1SJED 1DOIA 1OQRA 1PGXA 2N0SB 1SBBB 3CWIA 5E6JA 3KLSX 2LMCA 1DOYA 2XN9C 4KGTA 1ET9A 2W55A 3KWLA 2V0GA 1V97A 4YTNB 2PLPA 2WXLA 2L32A 3GP7A 1TS4A 4MM3B 5FK9C 2DYOA 1UGJA 5HFYA 4LK0M 1I4RA 2JZPA 2PTLA 4JPSA 1RWSA 2N7JA 3BVMA 1F2RI 2HDEA 1YQ3B 4DXGA 1KLUD 3MHZA 3WCQA 1YN3A 3PZ7A 3ABVB 2QMTA 2J52A 2ACZB 2I38A 3O13A 2PIAA 4REZA 4B0EA 2OEDA 4RGMA 5GXGB 1EU3A 3V05A 3ZQ4A 2QILA 2QIEB 4TQ1A 1XLNA 2ICIA 1HQRD 3BWUD 4NAMA 1TKGA 1Q10A 1FFVA 1UWXA 1EM7A 2BT6A 3P4SB 1E9MA 3R2TA 1FFUA 1L5PA 2LUMA 4O1NA 1AN8A 1N62A 3AEAB 3ZYYX 1ZE3D 1IBXA 2FBWB 3P4PB 1GB1A 3EA6A 3SFDB 1P7FA 2GI9A 2D5GA 2WLBA 4P16A 2W3SA 4YSXB 1QOAA 4C7ZA 1DYQA 2JU6X 2LGIA 2J42A 1HA5A 2XNAC 2LJIA 3AE5B 1ZUD2 3MFGA 2M0AA 1FEHA 1WWTA 1J7BA 2PVOD 4YSYB 1EWYC 3AEFB 2K3UA 3AE2B 3AEDB 3OWEB 5D3DA 2BBCA 1MPEA 1KRHA 2INPE 1JMLA 2BB5A 3BIID 4WIPA 5LNK1 1CZPA 1C4CA 2VZKD 3TSSA 1FCLA 2KWDA 4TMAB 1FNUA 2ONQA 1C77A 2NTSA 2WXGA 4ZYSA 3IT6B 2IGGA 4R3DA 5FKAC 1I4PA 1WXQA 1N61A 4RGTA 2CJNA 5AUKA 4AS1A 1SE4A 4NJCA 1QT9A 4YXDB 2VZKB 1V1PA 4AQ7A 3EGRA 4N58A 5G5GA 5HHDG 3TEZA 3FILB 1C78A 3DWMA 4HJGE 4WWMA 2Q5WD 1ZXIA 4XWWA 1FNVA 1NI3A 3BYTB 4M0WA 3MJ5A 5C3JB 1KF6B 2WXQA 2Y3AA 3B2GA 1MHXA 1AW7A 3AE1B 1PYWD 3E9SA 2M56B 3LYYA 1DGJA 1QOFA 1ZOYB 2L1AA 1RYJA 1SIJA 4JWUC 1TKEA 5H92C 2V4IB 1N5XA 4A55A 4DQOC 1QF6A 3AV8A 1JW9D 2K5PA 2R61A 4HKQA 4MACA 2BYTA 3B2FA 1VZ7A 1QILA 3BVGA 3NZ3A 1PUTA 2BW2A 4NZLB 4HEA1 3LXFA 4OW0A 2I2YA 4ZHOA 2K9XA 3BZDB 3BVZA 3R2IA 3AE6B 1HXYD 4A90A 3AE3B 3PO0A 4LTUA 1WRIA 4KGSA 1TS5A 2BS4B 3L4PA 3ZGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QQR A;  1C4P A;  1L4Z B;  1BML C;  1L4D B; 
#chains in the Genus database with same CATH topology
 2PE9 A;  2PVG C;  1KFY B;  4P6V F;  1NEK B;  1Y8R C;  4L1B A;  2LGS A;  4RF1 A;  4IM2 A;  4PS7 A;  3J9C A;  3KYD D;  1OEY A;  2C60 A;  2O6V B;  3AU4 A;  2HJ8 A;  1C79 A;  1ZKH A;  3GZN B;  3DQV A;  3N1X C;  1LQB A;  1YJ1 A;  4OZB A;  4WQO B;  4IM0 A;  3GB1 A;  2JZ3 B;  1PDX A;  1YMH E;  1UF0 A;  5IAA C;  3AE4 B;  3APD A;  3B0A A;  4FJY A;  1ESF A;  1ENF A;  5BYQ A;  3DBR B;  3ZRC A;  1GB4 A;  3A9J B;  1H8C A;  3H1U A;  5L83 A;  1VZ6 A;  1L0V B;  1EO6 A;  2FAZ A;  4GDL B;  1NEN B;  3ONS A;  3AEB B;  4XWT A;  1QZE A;  5DPW A;  4OVU A;  1I4H A;  3M3J A;  3A33 B;  1NYQ A;  3L16 A;  2OHF A;  3ZUN A;  5KHQ A;  4ACF A;  4IDI A;  1VD2 A;  4W9I A;  1Q0W B;  1QKZ A;  5D7G A;  5E6O A;  1SE2 A;  2RGF A;  5AZG A;  2JQR B;  2KAN A;  3FIL A;  4B95 A;  4ANU A;  2MA9 B;  2Y5C A;  1UUP A;  1C3T A;  4FLH A;  5BMG A;  4M8M A;  1OEY J;  2O2V B;  1ZDV A;  4WWO A;  5GMV A;  2ZW1 A;  2KJ6 A;  1F77 A;  2KT7 A;  4MH8 A;  4P1B C;  4HK2 A;  1LFD A;  1TYG B;  1JQ4 A;  3U8Z A;  1VJK A;  1I4X A;  1FMA D;  5C1Z A;  2GBM A;  2J0M A;  2G1E A;  2BGF A;  1L6U A;  2RDG A;  3W1Y A;  2LD9 A;  2LGD A;  1FXA A;  1WI0 A;  2Y5P A;  3URY A;  3VVW B;  4YTP B;  2WU5 B;  3WIM A;  3IAS 1;  1BML C;  4C4V B;  3DBH B;  2JUO A;  1JAL A;  3JSV A;  3KUC B;  2G9H D;  1YX5 B;  2N1V A;  3LB8 C;  4NNJ B;  4N59 A;  4LDT B;  3M95 A;  2WGS A;  3HRD D;  3UIN B;  1D5X C;  3VTW A;  3L54 A;  2G45 B;  2N9L A;  3W5V B;  1E10 A;  3DHG C;  2QHO A;  2KLG A;  1WX8 A;  2ZVO A;  1AWD A;  3SFE B;  3ZDM C;  3PLU A;  4ZRQ A;  4AUQ C;  2MJD A;  3UQB A;  3M63 B;  2N9K A;  3RNG C;  3C19 A;  1XQQ A;  2LXC A;  4GIV A;  1PFD A;  3MC8 A;  5AZF A;  2LGY A;  3IT4 B;  2LVP A;  3AI5 A;  2W82 A;  4BZA A;  3HK0 A;  2KQS A;  2K0P A;  3I5J C;  4D2K A;  1ZDX A;  4H2A A;  3SDL C;  2OJR A;  4FJV B;  4W9K A;  1UGM A;  1WMH A;  2WXR A;  3QAR A;  1T0R C;  3PV1 A;  2DZM A;  1RFA A;  3N9Y C;  3H9D A;  3IHP C;  2MP2 B;  3KWV A;  1XF5 L;  2IGD A;  2KTR B;  3NRZ A;  3NVV A;  3AN1 A;  3TBL D;  2MBQ A;  3ZDT A;  1ACC A;  1L4Z B;  1FRD A;  2WQY B;  5FR3 A;  3U52 E;  3UI3 A;  4MSQ B;  1XLP A;  1M4V A;  3OAW A;  5CTR C;  2L05 A;  2IPK D;  2WDQ B;  3ZJV A;  2MQJ A;  4EFO A;  3LJ3 A;  3Q3F A;  4G3X B;  2LI5 A;  2R2Q A;  3KH0 A;  4M00 A;  2JWU A;  3V6C B;  2KQ7 A;  2RPV A;  1F9J A;  2MWS B;  1WH3 A;  2MW5 A;  4OVV A;  2EKI A;  2IO0 B;  3IAM 1;  2WXH A;  4URK A;  2L76 A;  4EZJ A;  2GLS A;  1D4B A;  1P0R A;  2KLC A;  2LRW A;  4XZ4 A;  2KDE B;  2ZNV C;  1TZO A;  1UNS A;  1F2R C;  1WXV A;  4NAW A;  1WM2 A;  3ZVV A;  2K1F A;  1PGA A;  4IC7 B;  1STE A;  1RFK A;  1K50 A;  2KC2 A;  1L4D B;  5EE0 A;  2O6V A;  3ZNZ B;  1FIQ A;  2KZR A;  2MBO A;  1UZX B;  4LNN A;  4RGN A;  1UD7 A;  4GDK A;  2FCN A;  1JWM D;  2CJO A;  2KK8 A;  1X1M A;  1WE6 A;  3BYY B;  1AYF A;  3PVL A;  2KKC A;  3V6E B;  1PGX A;  3VUX A;  1EF1 A;  4F8C B;  2LZ6 A;  3KWL A;  5DPS A;  3HHM A;  3A9J A;  4DXA B;  2L32 A;  3UF8 A;  3GP7 A;  1I4R A;  2JZP A;  2KDI A;  1KLU D;  3ABV B;  4BKS D;  2PIA A;  2OED A;  3K9P B;  4HXD A;  3H7S A;  3NY5 A;  2QIE B;  1XLN A;  1HQR D;  4N9F 4;  2BT6 A;  3P4S B;  4W9C A;  1E9M A;  4A3O A;  1FFU A;  1T0Q C;  2LUM A;  3CMM B;  4O1N A;  1N62 A;  1RRB A;  1WXS A;  4W9L A;  1ZE3 D;  5JHB A;  2BKF A;  2WDT B;  2OJW A;  4E71 A;  3EHV A;  4YSX B;  1QOA A;  2LGX A;  4C7Z A;  1DYQ A;  2LGI A;  1HA5 A;  3AE5 B;  1ZUD 2;  3TCA A;  1FEH A;  2ZCB A;  1WWT A;  2PVO D;  4YSY B;  3AEF B;  1ISN A;  1J0G A;  1SE9 A;  1F52 A;  1MPE A;  2BB5 A;  5EDS A;  3MTN B;  3ZLZ A;  4MEL A;  4GOC A;  5LNK 1;  1C4C A;  2NCN A;  3ZTD A;  4BAX A;  1FCL A;  2M4N A;  4BKT A;  2NTS A;  2WXG A;  3IT6 B;  1I4P A;  4IG7 B;  4PS8 A;  4HPP A;  5AUK A;  3ZTC A;  3QWZ B;  2FNJ B;  1SE4 A;  4NJC A;  4YXD B;  2VZK B;  4DHJ D;  4AJY B;  1V5T A;  4N58 A;  5G5G A;  4C4V A;  3FIL B;  3DWM A;  4HJG E;  1Q5W B;  1NI3 A;  5IOI A;  3MJ5 A;  5C3J B;  2WXQ A;  4GN1 A;  1MHX A;  2GOW A;  3AE1 B;  3E9S A;  4HCP B;  1DGJ A;  2L1A A;  1SIJ A;  2K39 A;  3Q2A C;  1TKE A;  4JWU C;  4ZYN A;  1WGR A;  1N5X A;  1GJZ A;  1JW9 D;  2KD0 A;  2CU1 A;  3RT3 B;  1U4A A;  3BVG A;  1K8R B;  1E8X A;  4HEA 1;  2QC8 A;  4DHZ B;  3O65 B;  2UYZ B;  2VH1 A;  4AWJ A;  4A90 A;  1Z5S B;  3PO0 A;  1WRI A;  5DPT A;  1EF5 A;  3KYC D;  4ICU A;  1XLO A;  5I4D A;  1CQV A;  1FPY A;  3UGB B;  3JSV B;  3NUH B;  1OFF A;  1FRR A;  1K53 A;  3NHE B;  3AE9 B;  4XE0 A;  3GE8 C;  2KWC A;  4F7Z A;  2A4Z A;  3P63 A;  2DHZ A;  3Q8B A;  1I4Q A;  2RPQ A;  4HVB A;  4L23 A;  3H8H A;  4PT5 A;  1WXM A;  2NMQ A;  1WGH A;  2K22 A;  1ZPS A;  3NG0 A;  4GSW A;  3L08 A;  3VH4 B;  2KC1 A;  3B9J A;  1KM7 A;  1YN4 A;  4ARC A;  4US9 A;  3C0R B;  4ITK A;  1J7C A;  1N63 A;  2C7M B;  5J17 A;  4GMV A;  3VDZ A;  2FCM A;  5D6J B;  5DPR A;  1UWM A;  4FJZ A;  4WJN A;  1E0Z A;  2ZNV B;  2H89 B;  1L2N A;  3MHS D;  3BK1 A;  1C9F A;  5LLI A;  3RZF A;  4YL8 A;  2DYM A;  4A6Q A;  2ON8 A;  4JX1 C;  4RCO A;  4EEW A;  1L0X B;  4BOS C;  1YX6 B;  3B1L X;  3ZJU A;  4KIK A;  4K7S A;  4JQW C;  2L52 A;  2PPH A;  2LUE A;  4KKJ A;  2MX2 A;  1C1Y B;  4IWQ A;  3WA0 A;  3TMP B;  2IY0 B;  3CF6 E;  4IKG A;  4JGH B;  4HRO A;  5CHV C;  2C9W B;  3PPA A;  2JPH A;  2WXP A;  4TSS A;  1EU4 A;  1VLB A;  4K3C A;  1IGD A;  2NBU A;  1FM0 D;  1E7U A;  3DBS A;  4L2Y A;  3HM3 A;  1WM3 A;  1TY0 A;  1JWS D;  1YJI A;  3ZW3 A;  3ZNG C;  1FD6 A;  2AQ3 B;  4M01 A;  1WXA A;  1RM6 C;  2K6Q A;  4OZA A;  2XEW A;  2JRI B;  3WAP A;  3AE8 B;  2KO3 A;  1UH6 A;  4ZOH C;  1ZP0 B;  4ZRK A;  4NAW B;  1XEE A;  2VRR B;  4MGZ E;  3NVW A;  1MJD A;  3ZXR A;  3KUD B;  1Y56 A;  4X57 B;  3N3K B;  3TIX A;  4KGR A;  4CO7 A;  2WNM A;  3RNE C;  4OVZ A;  4A20 A;  2KHW B;  3EUB 2;  4LJO B;  3P42 A;  3VRA B;  4BVU C;  2W54 A;  4GDK B;  3VFK A;  4KVG B;  1ZW7 A;  2DLB A;  3A4R A;  2FID A;  2D3B A;  1HZ6 A;  3E56 A;  3RNC C;  2JZZ A;  1AAR A;  1KTK A;  2N9X A;  2BS2 B;  2D3C A;  1V1O A;  1QOB A;  1SEB D;  1D3Z A;  5KHO A;  4PK1 A;  4GU2 A;  1HZ5 A;  2AL6 A;  2L3Z A;  1D5Z C;  3RNB C;  2E6X A;  1GG3 A;  2ZPN A;  1NYR A;  4NJ6 A;  3TEW A;  4S17 A;  2E3T A;  3HVZ A;  2WDR B;  4YWG G;  1WSP A;  1MVK A;  4FA6 A;  2L0T A;  2R2O A;  1BXT A;  3RD2 A;  3FAH A;  4EE2 A;  4EUT A;  3ETR A;  2KOX A;  2RDH A;  1XO3 A;  2JF5 A;  1Z2M A;  3AM9 A;  2M1M A;  3W5U B;  2AYO B;  3NS1 A;  2GMI C;  3H6N A;  2NPT A;  1EWC A;  2RR9 A;  3EC8 A;  1SB3 C;  2WXI A;  4PYU A;  3A9K A;  3HUI A;  2J0J A;  2YVC A;  1DOX A;  3P2B A;  3GE3 C;  3PHW B;  3W1S C;  2D3G A;  2PMV A;  5EE3 A;  2IDY A;  5DCN A;  1UBI A;  3IXS A;  4IWP A;  3Q69 A;  4A9A A;  2IY1 B;  1OTR B;  1T6B X;  4YSZ B;  1GAQ B;  4FAD A;  2DAJ A;  2K6D B;  1JRU A;  2C5L C;  5CX3 A;  4WQM A;  2KX0 A;  3VHT C;  5BMH A;  1HEZ E;  1TKY A;  1WYW B;  3UQA A;  3AEE B;  3VXW A;  2LHD A;  2K8B A;  2KDB A;  2LVQ A;  1B9R A;  2ZW0 A;  3U30 A;  1WGD A;  1TS2 A;  4W9G A;  5EE9 A;  2GBK A;  2WP9 B;  3QA8 A;  2JX5 A;  3DOW A;  4JWS C;  3BK2 A;  1JWU D;  4KX6 B;  1A70 A;  1YQB A;  2WWZ A;  2KDM A;  4KDI C;  1YJJ A;  2BVC A;  1DOI A;  2KJR A;  5CHW A;  3CWI A;  4I6N B;  4M02 A;  2LMC A;  1E5W A;  1J19 A;  2JXX A;  4II2 B;  3QAQ A;  2N1W A;  3A1Q A;  1NDD A;  4W9J A;  2G3Q B;  4LK0 M;  4TKN A;  1V9J A;  2GBN A;  4JPS A;  1E90 A;  1T0S C;  1TZ1 A;  1F2R I;  2HDE A;  1YQ3 B;  2DEN B;  2LWP A;  3H7P A;  4DXG A;  3PZ7 A;  4BBN F;  2J7Q B;  2DX5 B;  3O13 A;  5LXH A;  3SU8 X;  4WJQ A;  4TV3 A;  3ZQ4 A;  2QIL A;  2MBB B;  2NBV B;  2ICI A;  1E8Z A;  1TKG A;  1UWX A;  2M17 A;  5JZE B;  4GGQ A;  3AEA B;  1S1Q B;  3P4P B;  2FCS A;  3EA6 A;  3SFD B;  1P7F A;  2GI9 A;  2WLB A;  2KYW A;  2XNA C;  2LJI A;  3MFG A;  2M0A A;  4EZK A;  3ML8 A;  3AE2 B;  2RSU A;  1CMX B;  3OWE B;  5IA7 A;  4WJO A;  5E6N A;  3NJT A;  4DHZ E;  2PJH A;  4FBJ B;  3BII D;  2KNB A;  1CZP A;  3TSS A;  2KWD A;  4II3 B;  3UIP B;  1WXQ A;  3PRP B;  4RGT A;  3OJ4 B;  4KIK B;  4G11 A;  4ZRI A;  3L10 B;  3N1Y C;  1ZXI A;  1FNV A;  5AZH A;  4IWO A;  3UIO B;  1WX7 A;  1L7Y A;  5AEK B;  1KF6 B;  4DHJ B;  1MFW A;  3B2G A;  1AW7 A;  1PYW D;  1ZOY B;  1A5R A;  3Q14 C;  5H92 C;  2V4I B;  4A55 A;  4DQO C;  2MRP A;  2BQQ A;  1IPG A;  3V60 A;  3SD5 A;  2DZJ A;  3PSE B;  5IO9 A;  3LXF A;  2KFJ A;  4OW0 A;  3IG3 A;  2K9X A;  3BZD B;  3R2I A;  1HXY D;  3AE3 B;  2MSE D;  1YIW A;  4LTU A;  4KGS A;  4K3B A;  2BS4 B;  2IYD B;  2JWZ A;  4DBG A;  1T0Y A;  4FHJ A;  4MM3 A;  3L0W B;  1YN5 A;  4GXB A;  1VRA B;  4FXC A;  4PYZ A;  3APF A;  1LGR A;  2ZCC A;  2MJ3 A;  4IOI E;  5J18 A;  2MEK A;  2D07 B;  1XLQ A;  2L83 A;  2H88 B;  1E7V A;  1E7P B;  1ET6 A;  5MPO A;  2NR2 A;  3PZ8 A;  2YEP F;  2DAF A;  5G5H A;  2HE7 A;  1KH0 A;  4YT0 B;  2JT4 B;  3Q3O C;  2AL3 A;  3AE7 B;  4LNK A;  4RNA A;  1GOZ A;  3R8B A;  3W9C B;  1QLB B;  4K81 A;  4KZC A;  2EMS A;  2OOB B;  5TR5 A;  1C4A A;  5HG2 A;  4W9H A;  3DHH C;  4PS3 A;  1VZ8 A;  5C23 A;  2JSV X;  4JL9 A;  3DPD A;  2JYT A;  2JY6 A;  4KKI A;  3OJ3 A;  1TY2 A;  2FCQ A;  1MHH E;  2WXO A;  3TJP A;  2LFI A;  1F0Z A;  4MGK E;  4DDG D;  3VUW A;  1R4M I;  3ZNH B;  3N1Z C;  2D10 A;  4W9D A;  3DWG C;  1JWB D;  4C56 C;  4RFB A;  4G0N B;  4A8X C;  1IBX B;  2AQ1 B;  3QHT A;  4KZ0 A;  1WYG A;  2INN E;  3AEG B;  4M8N A;  3ML9 A;  2NPT B;  1SF0 A;  3P4R B;  1LM8 B;  1YNT E;  2SAK A;  1H4R A;  1NI2 A;  3A9K B;  2MJE A;  2N4F A;  2BS3 B;  1T3Q A;  5CHF A;  1GPX A;  2WXM A;  1C76 A;  3PS6 A;  2K25 A;  3MC9 A;  3DBL I;  2DZK A;  2Y5B B;  5IKC M;  1TJE A;  5BO4 B;  1JRP A;  2LEK A;  2G4D B;  4WJP A;  1V1P B;  2WXJ A;  1N6Z A;  2MLB A;  4WH4 A;  4US8 A;  3T3O A;  4HDO A;  2KXJ A;  2CHX A;  5D94 A;  4BKG A;  3NZS A;  4MGI E;  3VH3 B;  2WU2 B;  3OG5 A;  3FKY A;  1N5W A;  2KMM A;  3CST A;  2QSD A;  4XX5 A;  3WAM A;  4FUL A;  4W9F A;  2RMM A;  3RI7 C;  1ZXH A;  2WS3 B;  3X23 A;  2KAJ A;  1GC7 A;  2AX5 A;  1WFY A;  2KJH B;  2B76 B;  2V4L A;  1R7S A;  2IJ0 A;  2V9H A;  2L8J A;  4BKS A;  1SSN A;  4BOZ B;  2EKE C;  2TSS A;  3PRZ A;  1FNW A;  1YQ4 B;  3EEC A;  2HTM E;  1PGB A;  2NTT A;  3ZO5 B;  1TTN A;  2INC C;  2BWE S;  1J7A A;  3I57 A;  2GRI A;  3GOE A;  5H8Y E;  3MP9 A;  3A1Q B;  1L6V A;  3QQ8 B;  5BYS A;  2KWU B;  3CSF A;  3R66 C;  3H7P B;  3SEB A;  1B1Z A;  3QIJ A;  3TEX A;  2WXF A;  1C4P A;  2MH7 A;  4ZDV A;  4MH0 E;  2RDB C;  4XYC A;  3AH7 A;  4HPL B;  1Q1O A;  3U2S C;  5JXV A;  3JW0 X;  3SR6 A;  1OGW A;  4B0M A;  1WJU A;  3V61 A;  2LVO A;  2IGH A;  2ZJD A;  2KVZ A;  3ZIM A;  1I42 A;  1I4G A;  4NPN A;  2JRH A;  1PQS A;  1IYF A;  3PRE A;  5BYR A;  2FUG 1;  3AUL A;  2IND C;  3PHX B;  3TL5 A;  2Z0E B;  4MSM B;  3I9V 1;  3DVN V;  4N6E B;  1WZ3 A;  3RUI B;  4WAA A;  2CKH B;  3AB5 A;  1K51 A;  3CIR B;  1XCT L;  1CJE A;  1JCK B;  2DNF A;  3ZKJ C;  2ZVN A;  4EZL A;  3ZXV A;  4BBN C;  2LJ5 A;  3AEC B;  1K52 A;  3C8Y A;  1FXT B;  4CHK A;  2N9P C;  1OQQ A;  3APC A;  2D11 A;  3U7D A;  3JYU A;  2N7E A;  4CYE A;  2M19 A;  2WDV B;  4Q2J A;  4ICV A;  4K1R B;  4XC2 A;  3Q8F A;  3W1S A;  1SE3 A;  2DBY A;  4ANW A;  2BTE A;  1F1H A;  1E8W A;  3PTF C;  4RF0 A;  1SJE D;  4NQK E;  4C00 A;  1TBE A;  2N0S B;  2XK5 B;  1SBB B;  4KSK C;  5E6J A;  3KLS X;  1DOY A;  2XN9 C;  2I1K A;  4KGT A;  1ET9 A;  2W55 A;  2V0G A;  1WE7 A;  2DZI A;  3ENE A;  4MJS A;  1TS4 A;  4MM3 B;  5FK9 C;  1UGJ A;  2PE6 B;  2C7N B;  1V5O A;  2PTL A;  3S2A A;  1KLV A;  1BT0 A;  2N7J A;  3BVM A;  3MHZ A;  1YN3 A;  2I38 A;  4B0E A;  1OQY A;  5GXG B;  3V05 A;  2REX A;  3BWU D;  3IVF A;  4NAM A;  1Q10 A;  1EM7 A;  3N30 A;  3R2T A;  1L5P A;  1WRD B;  2MHJ A;  3R3M A;  1IBX A;  2FBW B;  4FHK A;  1GB1 A;  2AWT A;  2W3S A;  4AJW A;  1HTO A;  2YLM A;  4E74 A;  2NS5 A;  2J42 A;  1EWY C;  3AED B;  5D3D A;  2BBC A;  2INP E;  1LXD A;  2CHZ A;  5G55 A;  4WIP A;  4AP4 C;  2BWF A;  4P1C C;  4TMA B;  1J8C A;  5FR6 A;  4ZYS A;  2MBH A;  4R3D A;  5FKA C;  1N61 A;  4MEM A;  1R4M B;  2IO2 B;  4DDI D;  4AS1 A;  3WAO A;  5D2M B;  1QT9 A;  4ANX A;  1G6J A;  1V1P A;  1WF9 A;  1WY8 A;  3DCG A;  4JIO U;  3DVG Y;  3VAW A;  1C78 A;  2BPS A;  4HPM B;  4WWM A;  4XWW A;  3VTU A;  1WJN A;  3BYT B;  1P9D U;  3OLM D;  5E6P A;  3LYY A;  1QOF A;  1RYJ A;  3NS8 A;  3KUZ A;  5JH5 C;  2I1J A;  2KFK A;  2R61 A;  3DBL B;  4FN2 A;  3B2F A;  4MAC A;  1MG8 A;  3PGE A;  2Z59 B;  4GB9 A;  1PUT A;  2BW2 A;  4NZL B;  4QAY A;  5JHA A;  4NY0 A;  1WR6 E;  4ZHO A;  1M94 A;  3L13 A;  4EOY A;  3AE6 B;  3L17 A;  4S0R A;  3KVF B;  2ZPY A;  3RMK C;  1TS5 A;  1UBQ A;  3L4P A;  2O6V D;  3PRM B;  4LJP B;  2HJ1 A;  4RMA A;  3FC4 A;  2KN4 A;  1QQR A;  3EFC A;  5HI1 A;  1I7H A;  3T3N A;  2WXK A;  4KV2 A;  5AUI A;  4B6W A;  3IFW B;  2Z0D B;  3QC8 B;  2SEB D;  3DDC B;  1XT9 B;  4BFR A;  2JYE A;  2W9N A;  4LNF A;  2V3N A;  2KAC A;  5L95 C;  3RNF C;  1GC6 A;  3X0W A;  3JVZ X;  2IO1 B;  2KN5 A;  2PKO A;  4J6I A;  4HKZ E;  4E3C A;  2V3P A;  2NBW B;  4RM8 A;  3VTV A;  1P7E A;  4K7W A;  3W2D A;  1YD8 U;  4C80 A;  1R4N B;  4DXF A;  3AMZ A;  2QJL A;  3P4Q B;  1SJH D;  4OHJ A;  2DWQ A;  3MC0 B;  3MJW A;  4RH6 A;  4HLE A;  2FIF A;  3Q3J A;  1XCQ L;  2J53 A;  1SXT A;  1IP9 A;  3NVY A;  1V8C A;  4LCD E;  1VCB A;  2UU7 A;  3VR9 B;  3U7Z A;  4IUM B;  2QEJ C;  3N32 A;  3DHI C;  2BYF A;  3Q8C A;  4HDQ A;  1XXG A;  3AU5 A;  2KWV B;  2BYE A;  2MBE A;  2MCN B;  1UEL A;  2DYB A;  4TUU A;  4OZC A;  3DVN U;  2BYV E;  3A4S C;  3IBE A;  2Z8L A;  2J4X A;  1RLF A;  2FE8 A;  1WGY A;  1FXI A;  2LAS A;  4K7U A;  4LLG M;  5T8I A;  1V2Y A;  3HIZ A;  5TSS A;  3V3X A;  3K9O B;  4MT5 A;  4UDU C;  2W3R A;  1WJ4 A;  1MI0 A;  4B9K A;  1ZGU B;  4RGO S;  4ZHP A;  3DVG X;  1YOV B;  1D5M C;  3KQ4 A;  4LDT D;  1WGG A;  1NBF C;  3GS2 A;  1WGK A;  1QOG A;  4YTM B;  2KTF A;  2KDF B;  2KMC A;  2L00 B;  2XK5 A;  2G4S A;  3BY4 B;  3ECI A;  2GB1 A;  4M0W B;  4WWP A;  4LNI A;  5EE1 A;  2WXN A;  2HD5 B;  2M0X A;  2K8H A;  3GZN I;  3NOB A;  2M8S A;  3RN9 C;  3T8M A;  1BUI C;  1XD3 B;  3Q3M C;  5G2N A;  1KLG D;  2X38 A;  2CS4 A;  4USA A;  2QDF A;  2KQ4 X;  4NJ7 A;  3Q8A A;  2LRU A;  4ZRP A;  2IO3 B;  3RNA C;  4TQ0 A;  3DBR I;  1VR9 A;  3QK0 A;  1N60 A;  3RYT A;  3ZNI D;  1E6E B;  3HVD A;  4GDL A;  3VRB B;  3VR8 B;  2EEL A;  2GBJ A;  2AQ2 B;  2BB6 A;  3KW5 B;  4MJS B;  1IGC A;  1LO5 D;  3PZD A;  1KOT A;  4MGY E;  2YEP B;  1NVI D;  1VDV A;  4IW0 A;  3N20 C;  5IP4 D;  3T9L A;  1WR1 A;  2CHW A;  3VQI A;  4HWI B;  1EUV B;  2BKR B;  3B08 A;  3NVZ A;  4ANV A;  1WZ0 A;  1ROE A;  4EKU A;  2HTH A;  2C7H A;  4CQN A;  3TUO A;  4XDC A;  2V3S A;  3ZRF A;  2JXT A;  2KMA A;  3RCZ A;  4ARI A;  2J0K A;  2O2V A;  4W9E A;  2L7R A;  4P7I A;  1T5X D;  2ZEQ A;  5C2T B;  4JLC A;  2UWQ A;  4NQL B;  3ZJT A;  2IBI B;  1FCC C;  3V62 A;  1D6E C;  1TGZ B;  4F1S A;  1JWA D;  2N9E B;  2FUH B;  4WAF A;  1E8Y A;  5LXI B;  3RFZ B;  1KJT A;  1TS3 A;  1JRO A;  2WHI A;  2D2Q A;  1P3Q U;  1WJ6 A;  1CK1 A;  3I63 C;  3EFU A;  2VH2 A;  1FO4 A;  2CU3 A;  3AXC A;  3DBH I;  4WUR A;  1GNU A;  3TEY A;  1L0Y B;  2JVC A;  3RPF C;  3I3T B;  1MG4 A;  3LDZ E;  4GLS C;  4XDD A;  3RZW C;  2PW9 A;  4ASW C;  3P1M A;  4HRS A;  1WIA A;  5BMI A;  2LHE A;  4J3O D;  1RAX A;  4AOF A;  1IUE A;  3RUL A;  1HE8 A;  1V81 A;  5D3I B;  2WYQ A;  4C7Y A;  3Q8E A;  2KFK B;  3U4E G;  3QX1 A;  5HKH A;  4JE3 B;  2LXA A;  4HJK A;  1OQR A;  1TIF A;  2CR5 A;  3QJZ A;  4ZRJ A;  1S3S G;  2X8X X;  1V97 A;  4YTN B;  2PLP A;  2WXL A;  3NZU A;  4MDK E;  3PT2 B;  2DYO A;  1R4N I;  5HFY A;  3M62 B;  1RWS A;  3D32 A;  1GUA B;  3WCQ A;  4RM9 A;  2QMT A;  4KSL C;  2ACZ B;  2J52 A;  2MP2 A;  1V6E A;  4REZ A;  2IZV B;  4RGM A;  1EU3 A;  2EMT A;  4TQ1 A;  2KTR A;  1V80 A;  1FFV A;  1AN8 A;  3ZYY X;  2WX1 A;  4LNO A;  1TT5 B;  2D5G A;  4P16 A;  2RD0 A;  2V1Y A;  3QCA A;  1V49 A;  2NVU I;  2JU6 X;  3Q6B A;  2GBR A;  1J7B A;  2K3U A;  1SGH A;  2KVR A;  2PEA A;  1HTQ A;  1KRH A;  3VUY A;  1JML A;  3Q3N C;  1WMH B;  4KDL B;  3R7Q A;  4WWN A;  1SIF A;  2AEH A;  2VZK D;  1FNU A;  2ONQ A;  1C77 A;  3R7R A;  2IGG A;  3WAL A;  2N7D A;  2CJN A;  3BIN A;  4HCN B;  2ZZP B;  1P98 A;  4DK5 A;  4I6P A;  4I6L B;  3SHQ A;  4AQ7 A;  3EGR A;  3TEZ A;  3HM6 X;  5HHD G;  3WAN A;  2Q5W D;  4IM3 A;  2B3A A;  2L0F A;  4G50 A;  4M0W A;  1P1A A;  2Y3A A;  4XGA B;  2M56 B;  1I35 A;  3ALB A;  2KX3 A;  5IN7 A;  1WX9 A;  2XBB C;  2A5U A;  1QF6 A;  3AV8 A;  2K5P A;  4HKQ A;  3PLV A;  2BYT A;  1VZ7 A;  1QIL A;  4DWF A;  1V86 A;  3NZ3 A;  2K8C A;  2I2Y A;  2QCZ A;  3BVZ A;  2WX0 A;  2D3A A;  2BF8 B;  2ASQ A;  4A3P A;  5J2R A;  3ZGZ A; 
#chains in the Genus database with same CATH homology
 1XLO A;  5I4D A;  1CQV A;  2PVG C;  1KFY B;  4P6V F;  1NEK B;  4L1B A;  3FC4 A;  2KN4 A;  1QQR A;  1YN5 A;  1OFF A;  3NUH B;  1FRR A;  5HI1 A;  4RF1 A;  1K53 A;  3AE9 B;  1I7H A;  1VRA B;  4FXC A;  4XE0 A;  3J9C A;  3T3N A;  2MJ3 A;  2WXK A;  3P63 A;  4IOI E;  1C79 A;  3Q8B A;  1I4Q A;  2MEK A;  5AUI A;  4L23 A;  3H8H A;  4PT5 A;  1XLQ A;  2L83 A;  2H88 B;  4OZB A;  2NMQ A;  2K22 A;  1ZPS A;  2SEB D;  1E7P B;  1ET6 A;  3GB1 A;  2JYE A;  3PZ8 A;  5MPO A;  1PDX A;  1YMH E;  2KAC A;  2V3N A;  2YEP F;  5G5H A;  1KH0 A;  4YT0 B;  3AE4 B;  3B9J A;  1YN4 A;  1ESF A;  4ARC A;  1ENF A;  3AE7 B;  4US9 A;  4ITK A;  5BYQ A;  2PKO A;  1J7C A;  4HKZ E;  4RNA A;  2V3P A;  1N63 A;  1GOZ A;  3R8B A;  3W9C B;  1QLB B;  1P7E A;  1GB4 A;  3W2D A;  4C80 A;  4DXF A;  1UWM A;  3AMZ A;  1VZ6 A;  1L0V B;  1E0Z A;  2QJL A;  2H89 B;  1C4A A;  3P4Q B;  5HG2 A;  1SJH D;  3BK1 A;  4GDL B;  4OHJ A;  1NEN B;  1C9F A;  2DWQ A;  3MC0 B;  3AEB B;  4XWT A;  1VZ8 A;  2DYM A;  2JSV X;  4A6Q A;  2JYT A;  4KKI A;  2ON8 A;  1I4H A;  4RH6 A;  4JX1 C;  1NYQ A;  4RCO A;  1TY2 A;  1L0X B;  1XCQ L;  2J53 A;  2OHF A;  1SXT A;  4IDI A;  1MHH E;  2WXO A;  2LFI A;  3ZJU A;  1F0Z A;  3NVY A;  5D7G A;  1QKZ A;  1V8C A;  3DWG C;  1JWB D;  4C56 C;  1SE2 A;  4RFB A;  2L52 A;  3VR9 B;  2JQR B;  4A8X C;  3U7Z A;  1IBX B;  4KKJ A;  2QEJ C;  2AQ1 B;  3FIL A;  3Q8C A;  1WYG A;  2INN E;  3AEG B;  1XXG A;  4IKG A;  4HRO A;  2Y5C A;  1UUP A;  5BMG A;  1ZDV A;  2ZW1 A;  1SF0 A;  3P4R B;  4OZC A;  1YNT E;  1F77 A;  2SAK A;  2WXP A;  4TSS A;  4MH8 A;  1EU4 A;  1TYG B;  1VLB A;  2MJE A;  2BS3 B;  1IGD A;  1JQ4 A;  2Z8L A;  1T3Q A;  2J4X A;  1FM0 D;  1I4X A;  2FE8 A;  1VJK A;  1FMA D;  1FXI A;  2WXM A;  4LLG M;  4L2Y A;  5T8I A;  5TSS A;  1C76 A;  3V3X A;  1TY0 A;  4MT5 A;  4UDU C;  1JWS D;  2W3R A;  1MI0 A;  2G1E A;  1L6U A;  1YJI A;  2RDG A;  4RGO S;  1FXA A;  1FD6 A;  2Y5P A;  4ZHP A;  2AQ3 B;  1TJE A;  3URY A;  1JRP A;  2LEK A;  1D5M C;  3KQ4 A;  4YTP B;  2WU5 B;  3GS2 A;  1WGK A;  3IAS 1;  1RM6 C;  1QOG A;  1V1P B;  4YTM B;  2WXJ A;  1BML C;  4OZA A;  3AE8 B;  4WH4 A;  1JAL A;  4US8 A;  3T3O A;  4ZOH C;  2G9H D;  3LB8 C;  1ZP0 B;  2GB1 A;  4N59 A;  2WU2 B;  4NAW B;  5EE1 A;  1XEE A;  3HRD D;  1D5X C;  1N5W A;  2WXN A;  3NVW A;  2N9L A;  3W5V B;  2KMM A;  1Y56 A;  1E10 A;  2QSD A;  1BUI C;  4KGR A;  1KLG D;  2WNM A;  2RMM A;  1ZXH A;  4OVZ A;  2WS3 B;  2X38 A;  4USA A;  2KAJ A;  3EUB 2;  3VRA B;  3P42 A;  2AX5 A;  2W54 A;  4GDK B;  1AWD A;  2KQ4 X;  3SFE B;  2DLB A;  3Q8A A;  2B76 B;  4ZRP A;  1R7S A;  4ZRQ A;  2IJ0 A;  1SSN A;  1HZ6 A;  3E56 A;  4TQ0 A;  2TSS A;  1FNW A;  1YQ4 B;  2HTM E;  1PGB A;  2MJD A;  2NTT A;  1VR9 A;  1KTK A;  2N9K A;  1N60 A;  1E6E B;  2BS2 B;  3HVD A;  1PFD A;  3VRB B;  1V1O A;  3VR8 B;  1J7A A;  1QOB A;  3IT4 B;  2EEL A;  3I57 A;  2AQ2 B;  1SEB D;  2BB6 A;  2GRI A;  5H8Y E;  3MP9 A;  1IGC A;  2W82 A;  1LO5 D;  1L6V A;  1HZ5 A;  2K0P A;  4D2K A;  5BYS A;  1ZDX A;  4H2A A;  1D5Z C;  2E6X A;  2YEP B;  2WXR A;  1NYR A;  1NVI D;  3SEB A;  3TEW A;  1B1Z A;  1VDV A;  2E3T A;  2WXF A;  1C4P A;  2MH7 A;  3HVZ A;  3N9Y C;  2WDR B;  3TEX A;  3VQI A;  3KWV A;  4YWG G;  1WSP A;  3NVZ A;  1MVK A;  1XF5 L;  2IGD A;  3AH7 A;  3NRZ A;  1ROE A;  3NVV A;  1BXT A;  4CQN A;  3AN1 A;  3TUO A;  3FAH A;  3U2S C;  4XDC A;  4EE2 A;  1ACC A;  5JXV A;  3SR6 A;  1L4Z B;  2JXT A;  1FRD A;  4B0M A;  2WQY B;  3ETR A;  2RDH A;  5FR3 A;  1XO3 A;  4ARI A;  3U52 E;  3UI3 A;  3AM9 A;  3W5U B;  1XLP A;  1M4V A;  3NS1 A;  1EWC A;  2IGH A;  2IPK D;  1SB3 C;  2WXI A;  2WDQ B;  3ZJV A;  1T5X D;  3HUI A;  5C2T B;  1I4G A;  1DOX A;  3ZJT A;  2JWU A;  1FCC C;  5BYR A;  2FUG 1;  1D6E C;  1JWA D;  2PMV A;  2RPV A;  5EE3 A;  2IDY A;  4WAF A;  3IXS A;  3RFZ B;  3Q69 A;  2EKI A;  4A9A A;  1TS3 A;  1JRO A;  2WXH A;  3I9V 1;  3IAM 1;  1T6B X;  4N6E B;  1D4B A;  4YSZ B;  1CK1 A;  3AB5 A;  1K51 A;  3CIR B;  1GAQ B;  1XCT L;  1CJE A;  1FO4 A;  1JCK B;  2CU3 A;  4WUR A;  3TEY A;  1L0Y B;  1TZO A;  1UNS A;  4WQM A;  1F2R C;  3AEC B;  5BMH A;  3RPF C;  1K52 A;  1HEZ E;  1TKY A;  3C8Y A;  4GLS C;  3AEE B;  4XDD A;  2PW9 A;  2LHD A;  1PGA A;  1OQQ A;  1STE A;  2ZW0 A;  1RFK A;  3P1M A;  4HRS A;  1B9R A;  5BMI A;  2LHE A;  1TS2 A;  1K50 A;  4J3O D;  1L4D B;  5EE0 A;  1FIQ A;  5EE9 A;  1IUE A;  2M19 A;  2WDV B;  4Q2J A;  2WP9 B;  4RGN A;  5D3I B;  4C7Y A;  2JX5 A;  4JWS C;  3Q8E A;  1JWM D;  3BK2 A;  2CJO A;  1JWU D;  3Q8F A;  4KX6 B;  3U4E G;  1A70 A;  3W1S A;  1SE3 A;  2DBY A;  1GPX A;  2BTE A;  3BYY B;  1AYF A;  2KDM A;  4JE3 B;  1YJJ A;  4RF0 A;  1SJE D;  1DOI A;  1OQR A;  1PGX A;  2N0S B;  1SBB B;  3CWI A;  5E6J A;  3KLS X;  2LMC A;  1DOY A;  2XN9 C;  4KGT A;  1ET9 A;  2W55 A;  3KWL A;  2V0G A;  1V97 A;  4YTN B;  2PLP A;  2WXL A;  2L32 A;  3GP7 A;  1TS4 A;  4MM3 B;  5FK9 C;  2DYO A;  1UGJ A;  5HFY A;  4LK0 M;  1I4R A;  2JZP A;  2PTL A;  4JPS A;  1RWS A;  2N7J A;  3BVM A;  1F2R I;  2HDE A;  1YQ3 B;  4DXG A;  1KLU D;  3MHZ A;  3WCQ A;  1YN3 A;  3PZ7 A;  3ABV B;  2QMT A;  2J52 A;  2ACZ B;  2I38 A;  3O13 A;  2PIA A;  4REZ A;  4B0E A;  2OED A;  4RGM A;  5GXG B;  1EU3 A;  3V05 A;  3ZQ4 A;  2QIL A;  2QIE B;  4TQ1 A;  1XLN A;  2ICI A;  1HQR D;  3BWU D;  4NAM A;  1TKG A;  1Q10 A;  1FFV A;  1UWX A;  1EM7 A;  2BT6 A;  3P4S B;  1E9M A;  3R2T A;  1FFU A;  1L5P A;  2LUM A;  4O1N A;  1AN8 A;  1N62 A;  3AEA B;  3ZYY X;  1ZE3 D;  1IBX A;  2FBW B;  3P4P B;  1GB1 A;  3EA6 A;  3SFD B;  1P7F A;  2GI9 A;  2D5G A;  2WLB A;  4P16 A;  2W3S A;  4YSX B;  1QOA A;  4C7Z A;  1DYQ A;  2JU6 X;  2LGI A;  2J42 A;  1HA5 A;  2XNA C;  2LJI A;  3AE5 B;  1ZUD 2;  3MFG A;  2M0A A;  1FEH A;  1WWT A;  1J7B A;  2PVO D;  4YSY B;  1EWY C;  3AEF B;  2K3U A;  3AE2 B;  3AED B;  3OWE B;  5D3D A;  2BBC A;  1MPE A;  1KRH A;  2INP E;  1JML A;  2BB5 A;  3BII D;  4WIP A;  5LNK 1;  1CZP A;  1C4C A;  2VZK D;  3TSS A;  1FCL A;  2KWD A;  4TMA B;  1FNU A;  2ONQ A;  1C77 A;  2NTS A;  2WXG A;  4ZYS A;  3IT6 B;  2IGG A;  4R3D A;  5FKA C;  1I4P A;  1WXQ A;  1N61 A;  4RGT A;  2CJN A;  5AUK A;  4AS1 A;  1SE4 A;  4NJC A;  1QT9 A;  4YXD B;  2VZK B;  1V1P A;  4AQ7 A;  3EGR A;  4N58 A;  5G5G A;  5HHD G;  3TEZ A;  3FIL B;  1C78 A;  3DWM A;  4HJG E;  4WWM A;  2Q5W D;  1ZXI A;  4XWW A;  1FNV A;  1NI3 A;  3BYT B;  4M0W A;  3MJ5 A;  5C3J B;  1KF6 B;  2WXQ A;  2Y3A A;  3B2G A;  1MHX A;  1AW7 A;  3AE1 B;  1PYW D;  3E9S A;  2M56 B;  3LYY A;  1DGJ A;  1QOF A;  1ZOY B;  2L1A A;  1RYJ A;  1SIJ A;  4JWU C;  1TKE A;  5H92 C;  2V4I B;  1N5X A;  4A55 A;  4DQO C;  1QF6 A;  3AV8 A;  1JW9 D;  2K5P A;  2R61 A;  4HKQ A;  4MAC A;  2BYT A;  3B2F A;  1VZ7 A;  1QIL A;  3BVG A;  3NZ3 A;  1PUT A;  2BW2 A;  4NZL B;  4HEA 1;  3LXF A;  4OW0 A;  2I2Y A;  4ZHO A;  2K9X A;  3BZD B;  3BVZ A;  3R2I A;  3AE6 B;  1HXY D;  4A90 A;  3AE3 B;  3PO0 A;  4LTU A;  1WRI A;  4KGS A;  1TS5 A;  2BS4 B;  3L4P A;  3ZGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...