1L4ZB

X-ray crystal structure of the complex of microplasminogen with alpha domain of streptokinase in the presence cadmium ions
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
136
structure length
125
Chain Sequence
b'MIAGPEALLDRPSVNNSQLVVSVAGTVEGTNQDISLKFFEIDLTSRAMPHKLEKADLLKAIQEQLIANVHSNDDYFEVIDFASDATITDRNGKVYFADKDGSVTLPTQPVQEFLLSGHVRVRPYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plasminogen
publication title Effects of deletion of streptokinase residues 48-59 on plasminogen activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/blood clotting
total genus 29
structure length 125
sequence length 136
ec nomenclature
pdb deposition date 2002-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.180 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1l4zB00
1BMLC 1C4PA 1L4DB 1L4ZB 1QQRA
chains in the Genus database with same CATH superfamily
2Y3AA 2LFIA 2IY1B 3TMPB 2CU1A 2V9HA 3KUZA 4BFRA 3RN9C 4P16A 4ZHOA 2J7QB 1VZ6A 4P1CC 2Z8LA 1V97A 5GMVA 1XLNA 3L0WB 3DQVA 1X1MA 1WX8A 3TEYA 4S0RA 1JALA 2AQ1B 3TCAA 4G50A 3R2IA 3DHIC 3JW0X 4DHZB 2HD5B 2L3ZA 1I7HA 2JF5A 3BVMA 3I5JC 2ZVNA 2HJ1A 2KWCA 1AARA 4HROA 3N9YC 1I4HA 2VZKB 1EWYC 3WAPA 2WU5B 2Z0DB 1XF5L 4DXGA 2Y5CA 2BTEA 4IW0A 1PGBA 3E9SA 4KX6B 1F1HA 5AUIA 1C1YB 2BYEA 2NTTA 1XLQA 1L4ZB 2KDMA 1A5RA 5LXHA 1R4NI 2KANA 3ZJVA 1P7FA 3KWVA 4W9JA 3N3KB 2QEJC 3B08A 2RDGA 3Q2AC 4EFOA 1MVKA 1TZOA 1UWMA 4FHJA 4TSSA 5C23A 2CHZA 1N5XA 4NPNA 5AUKA 3AN1A 2JXTA 2C7NB 3AM9A 3GS2A 5FK9C 1UBIA 2IBIB 2AQ2B 3SU8X 5DPSA 5HI1A 3SEBA 3BYTB 1NYQA 1FNVA 2BBCA 2E3TA 4B0MA 2Q5WD 2BW2A 2KT7A 1B9RA 4MDKE 2LVQA 3TSSA 2HE7A 3AE5B 3ZVVA 1V81A 2IO2B 3NVWA 5D3IB 4RM8A 1V9JA 1CMXB 4M02A 2G3QB 4FA6A 2A4ZA 1CQVA 2INNE 3QIJA 4MH8A 3GE8C 5E6OA 3PHWB 3WANA 1GAQB 1MJDA 2PJHA 4XZ4A 1D6EC 3HUIA 4JWSC 2WXNA 3AI5A 1E9MA 3AE3B 3B9JA 5E6PA 4AJYB 1WYGA 4WWPA 1CZPA 1P98A 1C76A 3SFEB 1IUEA 2D2QA 3SDLC 4YT0B 1YNTE 4L1BA 2WHIA 2KKCA 4RF1A 4FULA 4K7UA 1TY0A 1SB3C 2G4SA 3NHEB 1XCTL 2K3UA 3SR6A 3ZO5B 5BMHA 1RM6C 1ZPSA 2GBKA 3AE9B 3OJ3A 2DYOA 1TKGA 3VHTC 2M8SA 3T3OA 3AEFB 2WP9B 3ZKJC 5IP4D 3JSVB 5EE1A 2BYTA 2KZRA 3JSVA 5BO4B 1XQQA 3NJTA 4I6LB 2PVGC 1NENB 4PS7A 2JRIB 2G4DB 2LUEA 2BS3B 2INCC 3NS8A 1ZGUB 5CHVC 4BBNC 5J17A 4IOIE 2ICIA 3V60A 3U2SC 4LNOA 3RNGC 2V4IB 2OHFA 3P4RB 2AL6A 3ENEA 2BQQA 1GUAB 1N5WA 4HPPA 4A20A 2GI9A 3WAOA 1P3QU 1F9JA 2WXOA 2KFKB 4GDKB 2KFKA 3L16A 3EFCA 2WXGA 2G1EA 4GDKA 1YJ1A 2RDHA 4WIPA 2MSED 2H89B 4YSXB 4IDIA 2LJIA 4RGMA 4P7IA 2IPKD 2LMCA 2Y5PA 3AEEB 2QJLA 1H8CA 2AYOB 4LTUA 3AU4A 2PE6B 3TEXA 4WJNA 3H7SA 2JWZA 3QX1A 4C80A 1IGCA 5IAAC 2KHWB 2XBBC 2K5PA 3W1YA 4AUQC 5JXVA 1TGZB 1RAXA 1S3SG 3VFKA 1DGJA 4ZRKA 1WSPA 3MJWA 4W9KA 4ZRJA 2ON8A 2DZMA 1D5XC 4RCOA 5LNK1 1SJHD 2LGSA 2CHWA 4FLHA 2XN9C 4YXDB 2RPQA 4ZRQA 1AW7A 2JT4B 4BKGA 4RGOS 2ZW1A 2I38A 4WWOA 3TEWA 1WXVA 2CKHB 3UQAA 2BF8B 5EE9A 3AEGB 2LVPA 5TSSA 2QSDA 3DBRI 3NVYA 2G9HD 3IT4B 3R2TA 5D2MB 1GG3A 1PDXA 3DOWA 4KIKB 1ACCA 4KVGB 4EOYA 1KH0A 4KIKA 2BKFA 1EU4A 1JWBD 1WGGA 5JHAA 5C3JB 4GB9A 1QOGA 4QAYA 2WDTB 1D5MC 2J52A 3P63A 2VH1A 4FADA 2DLBA 3EGRA 1E8XA 2KJHB 3ZRFA 2H88B 2L76A 1PFDA 5C2TB 2ZZPB 2RGFA 3BVZA 1GC6A 2DX5B 2PEAA 4NY0A 3MTNB 2D3CA 3VUYA 2BWES 1KLUD 4GN1A 2XEWA 1OFFA 3B2GA 2J53A 4DDID 1E8YA 3R66C 4BKSA 3ZW3A 5HHDG 1LO5D 3I9V1 4YWGG 1HTQA 3ECIA 3AE1B 1Q1OA 2WLBA 3QWZB 1ZW7A 5AZGA 2WDRB 1J8CA 4YSZB 1JRUA 2BB6A 4DXAB 4DK5A 1Q10A 2ZNVC 4TQ1A 1MG8A 1S1QB 2D3BA 3Q6BA 4MT5A 2KC1A 4K3BA 3EC8A 2MLBA 1MHHE 2BVCA 1WE6A 1C9FA 1SE3A 4DQOC 1P9DU 1AWDA 1WGYA 3KYDD 3NZ3A 2WNMA 3ZDTA 2KVZA 4DDGD 2G45B 2WXLA 3GB1A 2N9LA 4EKUA 4D2KA 1ET9A 2LGDA 3ZJTA 1KLGD 2L0FA 3UF8A 1E7UA 1H4RA 4HXDA 3PZ7A 1WJ4A 2M1MA 2FCSA 1FFVA 1HA5A 2REXA 3UQBA 1R4MI 2PE9A 4A6QA 3N32A 1U4AA 1V1PA 4TUUA 4HDOA 3TBLD 3APCA 1ZE3D 5LLIA 3DDCB 3RUIB 1XD3B 2UU7A 2KJ6A 3RZWC 1QOBA 3NS1A 3MJ5A 1WF9A 4BVUC 2MWSB 4LNNA 4KKIA 2OEDA 4JPSA 3GE3C 1VDVA 2FBWB 3RNAC 2ACZB 3W5VB 1UH6A 4HPLB 4HRSA 1I4QA 1VJKA 1WXSA 3Q3NC 4MACA 3QARA 3Q8AA 2JZPA 4R3DA 4ZRIA 3QC8B 5GXGB 4KKJA 3APFA 1VLBA 1WFYA 3L17A 4LNFA 1DOXA 1C3TA 1GOZA 1XCQL 3UGBB 4B0EA 2KWDA 1DYQA 3ALBA 3FC4A 3V05A 1C77A 4RF0A 5MPOA 1IGDA 3K9OB 4XE0A 4W9HA 1HZ6A 1FXAA 4G11A 1FPYA 3VRAB 2GOWA 4YSYB 2N9XA 5BMIA 4C4VB 5DPRA 1KTKA 5BYSA 1L0YB 4C4VA 4XC2A 2JSVX 1OQRA 2PLPA 2IGGA 3ONSA 4US8A 4KGTA 3U30A 3OAWA 1T5XD 5H8YE 3URYA 3AEAB 4EEWA 1FNWA 2WXQA 3S2AA 2MBOA 3MHZA 2FUG1 4EZLA 4ARCA 4IWPA 1MHXA 1JW9D 4ZDVA 1UF0A 2N1VA 2K6DB 4IUMB 1F52A 3HM6X 3NY5A 4TMAB 4HPMB 3B1LX 3HM3A 2WDQB 1E6EB 4BOSC 4LJPB 2JWUA 1WRIA 1I4PA 3A9KB 2LEKA 3NUHB 2DNFA 5IA7A 1V5TA 4BKSD 2N7EA 2RMMA 4B6WA 3A9KA 3Q14C 4JIOU 4ICUA 3P42A 1ET6A 4DBGA 1WX9A 4DWFA 2KNBA 2KQ7A 4H2AA 4RMAA 3IHPC 2D5GA 1YIWA 3PZDA 3DBSA 2WXPA 1CJEA 4EZKA 5FR6A 1GC7A 1WYWB 3DBRB 1XO3A 2GBMA 3PREA 5IO9A 4G3XB 3M3JA 1TKEA 3GZNI 4K1RB 3PS6A 1Z2MA 1VD2A 4HCNB 4OVUA 2BYFA 3N1XC 3C19A 3PHXB 3FAHA 2BPSA 3P4PB 3AXCA 1F2RI 1WXAA 4RGTA 1SE9A 4LLGM 1V49A 4LDTB 5H92C 2GRIA 1LFDA 3CMMB 3NG0A 2L7RA 1OGWA 2WX0A 2EMSA 2FE8A 2KQ4X 3BK1A 4M8MA 5L95C 4USAA 3TUOA 3CSTA 1UELA 2MA9B 4GLSC 4OVZA 2XNAC 3Q3OC 1L0XB 5G5GA 3T9LA 1FCLA 2HJ8A 3ZYYX 1I35A 4IM0A 3TJPA 3CSFA 3C0RB 3VTVA 3VRBB 2WXIA 2R2QA 4NAMA 4X57B 2QC8A 3AEBB 3DVNU 4IWOA 1WR6E 4L2YA 1WR1A 1J7CA 4IKGA 1L5PA 2JX5A 1N61A 2DWQA 2K22A 3VUXA 3KUCB 4L23A 3UINB 4W9FA 2DHZA 3W1SA 4AP4C 3R7RA 4MM3B 4ZHPA 4DHZE 3ML9A 3U4EG 3VH4B 2KWVB 4MM3A 3R7QA 3IAS1 2NBWB 3RULA 3PGEA 4M0WB 5AEKB 3VXWA 4M0WA 3DWMA 1LM8B 2JRHA 2LVOA 4KSKC 2MEKA 3Q8BA 4LCDE 2WS3B 2JZ3B 2KLCA 4W9GA 1R4MB 3DHGC 4WAFA 4A3PA 2YLMA 4A90A 4OW0A 3DVGX 4PT5A 1E8ZA 4MSQB 3N20C 4OZCA 3PRZA 2NBVB 1OQYA 3ZNHB 1PUTA 1WJNA 2RPVA 4F8CB 3IVFA 2GBJA 1RYJA 1SSNA 2EELA 3FKYA 1J19A 4MJSB 2K9XA 2KACA 2B3AA 4MJSA 2I1JA 2L0TA 4HJKA 2HTHA 2IO0B 1RRBA 2QCZA 2OJRA 2ONQA 3N1YC 2QHOA 3ZRCA 4EZJA 3ZLZA 2V1YA 1TS5A 3L4PA 2GMIC 4US9A 3IG3A 2UYZB 1L2NA 3VUWA 1YJJA 1MI0A 1TS2A 3AB5A 1SBBB 4GIVA 2JVCA 4MGZE 3DCGA 5I4DA 1GPXA 3ZNZB 4C7ZA 5HKHA 4OHJA 4IWQA 1YX5B 2KX0A 2NPTB 3H6NA 2VZKD 2N1WA 2NPTA 1JWSD 3KVFB 3PZ8A 3ML8A 2IO1B 4S17A 3RD2A 2WWZA 1WWTA 3RNEC 2DYBA 1WGKA 4ZYSA 1XEEA 1ISNA 3LDZE 2X8XX 1B1ZA 3HK0A 2MJ3A 1ZOYB 3PTFC 1Z5SB 1I4GA 2CJNA 1GJZA 1FD6A 2I1KA 1PYWD 3RMKC 5G2NA 4C7YA 3PRPB 1T0RC 3GP7A 1UUPA 4RM9A 1FNUA 2WXHA 3P1MA 1TZ1A 3VVWB 1YQBA 2DYMA 2MJEA 4WURA 2KD0A 1WH3A 2KTFA 1WXQA 3RZFA 1HTOA 1QILA 2C60A 4MH0E 2C7HA 3B0AA 3HVZA 2PTLA 1HXYD 1WXMA 3Q69A 3ZDMC 1J7BA 1NBFC 2JU6X 2L32A 4M8NA 1YD8U 5FR3A 2FIFA 2K8BA 2INPE 1A70A 2LJ5A 3BY4B 2M0AA 1Y8RC 5AZFA 4C00A 3PVLA 2O6VB 4BKTA 2O6VA 2LRWA 2J42A 2KJRA 3ZQ4A 4MELA 2KVRA 2FNJB 4M01A 4GGQA 1WE7A 2N4FA 4GXBA 3I63C 4GMVA 3GZNB 2M0XA 4KDIC 5LXIB 3HRDD 3W9CB 1N63A 3A4SC 3ZXRA 1L7YA 1HZ5A 4PS8A 2B76B 3CIRB 5CHFA 4WQMA 1JWMD 3H7PB 5DCNA 2L00B 2WU2B 3H7PA 4OZAA 4II2B 3QAQA 1HQRD 1OEYJ 1ZP0B 3A9JB 3W5UB 3OLMD 3A9JA 4ANUA 5EDSA 3RNFC 5JHBA 1XLOA 3VTWA 3R3MA 3RCZA 4HKQA 3ZJUA 5T8IA 1T3QA 1C4PA 3UIOB 3PPAA 2LGYA 1UZXB 2CHXA 3W2DA 3HHMA 2M56B 4FXCA 4AOFA 4BOZB 5EE0A 4TQ0A 2KQSA 1I42A 1TS3A 2GBNA 5D7GA 2LGIA 1HEZE 3L13A 2N9EB 1FFUA 3IT6B 2KMMA 4HCPB 1OTRB 3T8MA 3V6EB 4MGKE 2BT6A 1EUVB 2KMCA 2KDBA 2K39A 1AN8A 1OEYA 2ZVOA 3DBLI 3UIPB 3DVGY 2MX2A 2MQJA 3NZUA 4HVBA 4YTPB 4GOCA 4BZAA 4N59A 3OWEB 4RH6A 2FCNA 4Q2JA 4EUTA 3AE7B 2BS2B 4LNIA 4RFBA 4JL9A 4NJ6A 1WGDA 3A33B 3VH3B 1GB1A 2JPHA 1SXTA 5CTRC 3KW5B 1AYFA 1TKYA 3AE6B 4XDCA 3IFWB 2ZCCA 1PGXA 4ANWA 1V1PB 5D3DA 1STEA 3L10B 1C78A 3X23A 1TIFA 3RPFC 3N1ZC 1SE2A 4MEMA 4PS3A 2D3GA 1WIAA 2J4XA 1YN3A 2N7DA 3BVGA 2ZPYA 1F0ZA 2ZEQA 2N0SB 3VTUA 1J7AA 2FCMA 2KK8A 1IPGA 4OZBA 1QT9A 3LXFA 5E6NA 1TY2A 3K9PB 5BMGA 1QOAA 1VZ8A 4FJZA 3V6CB 3U7DA 2FCQA 2LASA 4ITKA 1SJED 3L54A 2BYVE 1YN5A 2PW9A 3KWLA 1XLPA 1T6BX 1WZ3A 4KDLB 4N6EB 4MGYE 3WIMA 2MP2B 4NQKE 2MP2A 3MFGA 3DWGC 1WI0A 4XWWA 2HTME 1FMAD 1E7PB 2DZIA 3UI3A 1D5ZC 3ABVB 5J2RA 5IOIA 4W9CA 3D32A 1FRRA 2KOXA 1KM7A 2J0MA 1DOIA 3DPDA 2VRRB 5BYRA 4AS1A 1ENFA 1C79A 4HK2A 3NRZA 2ZCBA 1TYGB 1FXTB 1V5OA 4XWTA 2LD9A 3Q3FA 3Q8EA 5BYQA 2MBHA 2K8HA 4IM2A 2BWFA 1WY8A 2DBYA 2KAJA 2MJDA 2TSSA 1YQ3B 2YEPF 5E6JA 2GB1A 2ZW0A 3P4QB 1N6ZA 3O13A 3CF6E 2C7MB 3TL5A 4FJVB 4P6VF 1K52A 4PK1A 1EM7A 2KN4A 4B9KA 1ZXIA 2W55A 4HLEA 3Q8FA 1VZ7A 3I57A 4J3OD 4WQOB 1N62A 1YOVB 5HG2A 1WZ0A 2PKOA 2L52A 1RLFA 1EF5A 4G0NB 3BINA 2M4NA 2RDBC 3Q8CA 1WJ6A 3LYYA 3VR8B 1BUIC 3Q3JA 2MHJA 2KFJA 3MC0B 2ZPNA 2WDVB 4MSMB 2D3AA 4II3B 2L1AA 3TEZA 2CU3A 5D6JB 3PT2B 1QOFA 3QCAA 3MP9A 3MC9A 4JWUC 4KV2A 2X38A 3EFUA 2MBQA 1FO4A 3ZUNA 2BS4B 4BAXA 3W1SC 1TTNA 4NJCA 2KN5A 2MH7A 3ZGZA 2OOBB 1NYRA 4F1SA 4LJOB 2FIDA 3NVZA 2WXMA 2UWQA 3EHVA 4LNKA 3ZXVA 3BYYB 4KZ0A 4ZRPA 2CR5A 4XYCA 2GBRA 1UGJA 2QMTA 3V3XA 4HJGE 2ZJDA 1SIJA 2RR9A 4IC7B 2L05A 4FN2A 1T0YA 4NQLB 5KHOA 4N58A 3L08A 4N9F4 3OJ4B 4ICVA 1FM0D 2L8JA 2KDEB 4FJYA 1PQSA 2IYDB 4DHJB 1WGRA 3PRMB 4HDQA 2FAZA 4OVVA 4FBJB 1Q5WB 4I6PA 3E56A 2MBEA 2MBBB 4KSLC 3DBHB 2NVUI 4HEA1 3AE2B 1QKZA 1JQ4A 2M19A 4UDUC 2IGHA 2KLGA 2WGSA 1V1OA 1P7EA 3NZSA 1FIQA 3TIXA 3ZNGC 1NI3A 3VQIA 4YTMB 4NNJB 4JE3B 1SGHA 2WXKA 3BZDB 1D4BA 4P1BC 4NAWB 4XDDA 1JRPA 4NAWA 2DZJA 4JLCA 4JQWC 1RFAA 4M00A 1V86A 1EWCA 3M95A 1QZEA 3DBLB 1N60A 2BB5A 2LUMA 5G55A 4NJ7A 4URKA 3AV8A 1JROA 3OG5A 4YL8A 1XT9B 3JVZX 3P4SB 2NMQA 1LQBA 1OQQA 2E6XA 1PGAA 2AQ3B 4MGIE 2AEHA 4GSWA 3HVDA 2ASQA 3AMZA 2KXJA 3BIID 1IBXB 1V2YA 3QQ8B 1IBXA 2L83A 1JCKB 3X0WA 2KX3A 4E74A 1ZKHA 2N7JA 2NBUA 2RD0A 3A4RA 4IG7B 4B95A 3P2BA 4C56C 1HE8A 1K50A 2LXAA 3H9DA 2MW5A 1XXGA 2EMTA 3B2FA 2V0GA 3BWUD 1UNSA 4GU2A 5CHWA 2JQRB 2XK5B 2XK5A 3GOEA 2KDIA 5JZEB 1C4AA 1E7VA 3WA0A 2R61A 2BGFA 4XX5A 1DOYA 1UD7A 4ANVA 3PSEB 3ETRA 2AL3A 2FUHB 3DHHC 2J0KA 2IY0B 1RFKA 4K3CA 5C1ZA 2Z59B 1FXIA 4O1NA 1ESFA 2NCNA 1SEBD 3U7ZA 2KDFB 1R7SA 3QHTA 2JYEA 2OJWA 1FEHA 1WRDB 4A9AA 4K7WA 5IN7A 2IDYA 1Q0WB 1ZXHA 3WCQA 1EF1A 5D94A 3RFZB 1V6EA 2NR2A 2DZKA 4TV3A 2C9WB 4KZCA 5KHQA 1K53A 1EO6A 1K8RB 1P0RA 4AWJA 4W9LA 3T3NA 3M62B 2JY6A 1SIFA 3AEDB 1BXTA 1V8CA 3KH0A 3AULA 1QLBB 3PLVA 3AU5A 2RSUA 2QDFA 3U52E 1P1AA 2W9NA 1G6JA 2CS4A 4ACFA 2BKRB 1NVID 4WWMA 1K51A 3A1QB 4CQNA 3RNBC 3MHSD 3A1QA 5JH5C 4HKZE 1T0QC 2D10A 1FCCC 1WX7A 2D07B 5G5HA 2LZ6A 2K1FA 4LDTD 3EECA 3QA8A 2KTRB 1TS4A 4W9IA 1BMLC 2KTRA 1F2RC 1IYFA 2V3PA 4IM3A 3LB8C 4RGNA 5HFYA 1I4RA 4WJOA 3Q3MC 3VR9B 2LHDA 1MG4A 2KC2A 2LI5A 2V3SA 3H1UA 2WXFA 4DHJD 5FKAC 2LRUA 2WXRA 4I6NB 4CYEA 4DXFA 2DAFA 1UWXA 1WMHB 3V61A 4HWIB 4W9DA 4KGSA 1WMHA 1F77A 1E8WA 5J18A 2Z0EB 2N9PC 2C5LC 4WJQA 2SEBD 3HIZA 3LJ3A 2EKIA 1VRAB 1YMHE 4A3OA 1WGHA 2PMVA 4FHKA 3N30A 3NOBA 3MC8A 1KFYB 3ZTCA 3AE4B 4ANXA 1LXDA 2A5UA 3VAWA 2K25A 3PLUA 2V3NA 4LK0M 3BK2A 1TT5B 2AWTA 1JWAD 4K7SA 3R8BA 1R4NB 2W82A 2PIAA 2AX5A 3IBEA 1ZDXA 1JMLA 4ASWC 2Y5BB 2MCNB 2KWUB 1UBQA 3DBHI 2PVOD 2LHEA 2YEPB 1KF6B 3J9CA 2M17A 4J6IA 2QILA 1SE4A 3ZIMA 2DAJA 1UGMA 2K8CA 1L6VA 1YN4A 1YX6B 5AZHA 3U8ZA 3QK0A 1E90A 2VH2A 4TKNA 1E5WA 4REZA 2JXXA 4F7ZA 2WQYB 3QJZA 1VR9A 2O2VB 1KLVA 2O2VA 2IJ0A 3WAMA 4XGAB 1WM2A 3JYUA 2EKEC 4E3CA 3EA6A 3IXSA 3DVNV 3APDA 2MRPA 1TJEA 2KYWA 4PYZA 1ROEA 3SFDB 2I2YA 2D11A 1I4XA 1T0SC 5DPTA 3FILB 1NDDA 3FILA 2SAKA 4A8XC 4JX1C 1ZUD2 4CO7A 1LGRA 1C4CA 2W3SA 1FRDA 1E0ZA 3EUB2 3M63B 3RT3B 4WAAA 1IP9A 3KYCD 4BBNF 3KUDB 3RI7C 2JYTA 2QIEB 2K0PA 2HDEA 3ZTDA 1TBEA 4GDLB 1L4DB 4YTNB 2WYQA 2IGDA 2J0JA 4GDLA 4EE2A 1WM3A 3H8HA 4KGRA 2JZZA 3AECB 2WX1A 4E71A 1BT0A 1NEKB 3V62A 2DENB 1M94A 2KMAA 3SD5A 5EE3A 3WALA 4AJWA 1J0GA 5CX3A 2W3RA 1SF0A 1MPEA 3AH7A 3C8YA 3CWIA 2JUOA 2INDC 2NTSA 2LGXA 1GNUA 2CJOA 2YVCA 3ZNID 3AE8B 1EU3A 1QQRA 2ZNVB 2PPHA 4NZLB 1NI2A 3KQ4A 1QF6A 1GB4A 1KOTA 2W54A 2IZVB 1YQ4B 4A55A 1L0VB 2LXCA 5TR5A 4WWNA 4JGHB 3IAM1 1KJTA 2NS5A 3O65B 2K6QA 3RYTA 3I3TB 2R2OA 4ZOHC 2KO3A 5L83A 2GLSA 3VDZA 1YJIA 4ARIA 1V80A 1MFWA 2WXJA 2O6VD 1Y56A 2IO3B 4K81A 4AQ7A 5DPWA 3PO0A 4WJPA 3RNCC 1WJUA 1RWSA 4ZYNA 1ZDVA 2N9KA 3SHQA 2LWPA 5IKCM 4WH4A 3NVVA 1VCBA 1D3ZA 4W9EA 4CHKA 4RNAA 1M4VA 2V4LA 3KLSX 3PV1A 1CK1A 1JWUD 1E10A 1L6UA 1KRHA 4PYUA
chains in the Genus database with same CATH topology
1FNUA 2Y3AA 2WXHA 4MT5A 1N60A 2BB5A 2LUMA 3P1MA 2LFIA 3AV8A 2DYMA 1MHHE 2MJEA 1JROA 4WURA 1C9FA 1SE3A 4DQOC 4P16A 1WXQA 1AWDA 4ZHOA 1QILA 1VZ6A 3NZ3A 2WNMA 2Z8LA 3P4SB 3HVZA 2NMQA 2PTLA 1HXYD 1OQQA 2E6XA 1V97A 1PGAA 3Q69A 1J7BA 2WXLA 2JU6X 1XLNA 2AQ3B 2L32A 2N9LA 3GB1A 5FR3A 3HVDA 4D2KA 1ET9A 3AMZA 1IBXB 3BIID 2INPE 1A70A 3ZJTA 2M0AA 1IBXA 2L83A 1JCKB 3TEYA 1KLGD 1JALA 2AQ1B 3PZ7A 3R2IA 1FFVA 1HA5A 2N7JA 1I7HA 3BVMA 4A6QA 1V1PA 2J42A 1K50A 4C56C 4HROA 3N9YC 1XXGA 1ZE3D 1I4HA 2VZKB 3B2FA 1EWYC 3ZQ4A 2V0GA 3BWUD 2WU5B 1UNSA 1XF5L 4DXGA 2Y5CA 2JQRB 2BTEA 1PGBA 3E9SA 1QOBA 4KX6B 3NS1A 5AUIA 3MJ5A 1C4AA 2NTTA 3HRDD 3W9CB 1XLQA 1L4ZB 1N63A 2KDMA 2OEDA 2R61A 4KKIA 4JPSA 1VDVA 2FBWB 3ZJVA 1P7FA 3KWVA 1HZ5A 1DOYA 2ACZB 3W5VB 2QEJC 2B76B 3CIRB 4WQMA 4HRSA 1JWMD 2RDGA 1I4QA 1VJKA 3ETRA 1MVKA 1TZOA 1UWMA 2WU2B 4MACA 4TSSA 4OZAA 3Q8AA 1N5XA 5AUKA 1RFKA 3AN1A 2JXTA 1HQRD 2JZPA 1FXIA 4O1NA 1ESFA 3AM9A 4R3DA 1ZP0B 3GS2A 5FK9C 1SEBD 5GXGB 3U7ZA 3W5UB 1R7SA 4KKJA 2JYEA 1FEHA 1VLBA 4A9AA 2AQ2B 1DOXA 5HI1A 1GOZA 1XCQL 3SEBA 2IDYA 1XLOA 4B0EA 1ZXHA 2KWDA 1DYQA 3FC4A 3BYTB 3WCQA 4HKQA 1NYQA 1FNVA 2BBCA 3ZJUA 2E3TA 3V05A 4B0MA 1C77A 5T8IA 1T3QA 1C4PA 4RF0A 5MPOA 3RFZB 1IGDA 4XE0A 2Q5WD 2BW2A 3W2DA 1HZ6A 1FXAA 1B9RA 2M56B 4FXCA 3VRAB 4YSYB 1K53A 3TSSA 5BMIA 5EE0A 4TQ0A 1KTKA 1TS3A 5BYSA 1L0YB 5D7GA 3T3NA 3AE5B 2LGIA 3AEDB 1HEZE 2JSVX 3NVWA 1BXTA 1OQRA 1V8CA 2PLPA 5D3IB 1FFUA 2IGGA 3IT6B 2KMMA 1QLBB 3U52E 4US8A 4KGTA 1NVID 2BT6A 1CQVA 2INNE 1T5XD 4WWMA 1AN8A 1K51A 4CQNA 4MH8A 5H8YE 3URYA 3AEAB 1FNWA 2WXQA 3MHZA 1GAQB 2FUG1 4HKZE 4YTPB 4N59A 4ARCA 3OWEB 4RH6A 1D6EC 1MHXA 4Q2JA 1FCCC 3AE7B 1JW9D 2BS2B 5G5HA 3HUIA 4JWSC 2WXNA 1TS4A 1E9MA 3AE3B 1BMLC 3B9JA 1F2RC 4RFBA 2V3PA 4TMAB 3LB8C 1WYGA 1CZPA 4RGNA 5HFYA 1C76A 3SFEB 1I4RA 1IUEA 3VR9B 2WDQB 1GB1A 2LHDA 1SXTA 4YT0B 1E6EB 1AYFA 1YNTE 4L1BA 2JWUA 2WXFA 1TKYA 1WRIA 3AE6B 1I4PA 4XDCA 2LEKA 3NUHB 4RF1A 1PGXA 1TY0A 2RMMA 1SB3C 5FKAC 1XCTL 2WXRA 3P42A 1V1PB 5D3DA 2K3UA 3SR6A 1STEA 4DXFA 1C78A 1ET6A 5BMHA 1RM6C 1ZPSA 1UWXA 3RPFC 3AE9B 4H2AA 1SE2A 4KGSA 2J4XA 2DYOA 1TKGA 1F77A 1YN3A 2D5GA 3T3OA 2SEBD 3BVGA 2WXPA 1CJEA 3AEFB 2WP9B 1F0ZA 2EKIA 1VRAB 1YMHE 1XO3A 2N0SB 2PMVA 1J7AA 1TKEA 4OZBA 5EE1A 1QT9A 2BYTA 3LXFA 1KFYB 1TY2A 3AE4B 5BMGA 1QOAA 1VZ8A 2PVGC 1NENB 4ITKA 4LK0M 2V3NA 2BS3B 1SJED 2PW9A 1YN5A 3KWLA 1XLPA 3FAHA 3BK2A 4IOIE 1T6BX 2ICIA 3P4PB 3U2SC 1F2RI 4N6EB 1JWAD 4RGTA 4LLGM 3R8BA 2W82A 2V4IB 2PIAA 2AX5A 2OHFA 3MFGA 3P4RB 1ZDXA 1JMLA 3DWGC 5H92C 1N5WA 4XWWA 2GI9A 2HTME 2GRIA 1FMAD 1E7PB 2WXOA 3UI3A 1D5ZC 2PVOD 3ABVB 2FE8A 2KQ4X 2LHEA 2YEPB 3BK1A 4GDKB 1KF6B 1FRRA 4USAA 2WXGA 2G1EA 3J9CA 1DOIA 3TUOA 2RDHA 2QILA 4WIPA 5BYRA 4GLSC 4AS1A 2H89B 1ENFA 1C79A 4OVZA 1SE4A 4YSXB 2XNAC 3NRZA 1L6VA 1YN4A 1TYGB 1L0XB 5G5GA 4XWTA 4IDIA 3Q8EA 2LJIA 4RGMA 2IPKD 1FCLA 2LMCA 2Y5PA 5BYQA 3AEEB 4REZA 2QJLA 3ZYYX 4LTUA 2WQYB 1VR9A 2DBYA 2KAJA 2MJDA 2TSSA 3TEXA 1YQ3B 2YEPF 5E6JA 2GB1A 2WXIA 3VRBB 2IJ0A 2ZW0A 3P4QB 3O13A 4NAMA 4C80A 1IGCA 3EA6A 3IXSA 3AEBB 4P6VF 1K52A 1TJEA 2K5PA 1EM7A 2KN4A 1ROEA 5JXVA 4L2YA 1J7CA 1ZXIA 1L5PA 4IKGA 2JX5A 2W55A 3SFDB 2I2YA 1N61A 2DWQA 2K22A 4L23A 1I4XA 3FILB 3Q8FA 1VZ7A 3I57A 1DGJA 3W1SA 3FILA 4J3OD 2SAKA 4A8XC 1N62A 1WSPA 4MM3B 4ZHPA 4JX1C 5HG2A 3U4EG 1ZUD2 2ON8A 2PKOA 1D5XC 3IAS1 4RCOA 5LNK1 2L52A 1SJHD 1C4CA 2W3SA 3Q8CA 1FRDA 1E0ZA 3LYYA 3EUB2 2XN9C 4YXDB 4M0WA 4ZRQA 3DWMA 3VR8B 1AW7A 1BUIC 2JYTA 2QIEB 4RGOS 2K0PA 2HDEA 2ZW1A 2I38A 4GDLB 1L4DB 2MEKA 3TEWA 4YTNB 3MC0B 2IGDA 3Q8BA 4EE2A 3H8HA 2WS3B 4KGRA 2WDVB 3AECB 5EE9A 3AEGB 1NEKB 5TSSA 2QSDA 3NVYA 2G9HD 3IT4B 3R2TA 2L1AA 4WAFA 4A90A 4OW0A 1PDXA 5EE3A 3TEZA 2CU3A 1ACCA 4PT5A 1KH0A 1EU4A 1JWBD 1QOFA 2W3RA 1SF0A 3MP9A 4OZCA 1MPEA 3AH7A 3C8YA 5C3JB 3CWIA 1QOGA 1PUTA 4JWUC 2NTSA 2X38A 2CJOA 2RPVA 1FO4A 1D5MC 2J52A 2BS4B 3P63A 1RYJA 1SSNA 2DLBA 3AE8B 2EELA 1EU3A 3ZGZA 1QQRA 4NJCA 2MH7A 4NZLB 1NYRA 2K9XA 2KACA 3EGRA 3KQ4A 1QF6A 1GB4A 3NVZA 2WXMA 2W54A 1YQ4B 2H88B 1PFDA 3BYYB 4ZRPA 5C2TB 4A55A 2ONQA 1L0VB 1UGJA 2QMTA 3BVZA 3V3XA 4HJGE 3IAM1 1SIJA 1TS5A 3L4PA 4US9A 4ZOHC 1YJJA 1MI0A 1TS2A 1YJIA 3AB5A 1KLUD 4N58A 4ARIA 1SBBB 2WXJA 1OFFA 5I4DA 1FM0D 3B2GA 1Y56A 2J53A 1GPXA 4C7ZA 4AQ7A 4OHJA 3E56A 3PO0A 5HHDG 1RWSA 3GP7A 1LO5D 1ZDVA 2VZKD 3I9V1 4HEA1 3AE2B 1QKZA 2N9KA 4YWGG 1JQ4A 1JWSD 2M19A 3PZ8A 2IGHA 4UDUC 3AE1B 2WLBA 1WWTA 1V1OA 4WH4A 1WGKA 1P7EA 4ZYSA 1FIQA 1XEEA 3NVVA 1NI3A 3VQIA 4YTMB 4JE3B 2WDRB 4RNAA 1B1ZA 1M4VA 2WXKA 2MJ3A 3BZDB 1ZOYB 3KLSX 4YSZB 4NAWB 2BB6A 4XDDA 1D4BA 1JRPA 1I4GA 1CK1A 2CJNA 1FD6A 1JWUD 1PYWD 1E10A 1L6UA 1Q10A 1KRHA 4C7YA 4TQ1A 1UUPA 1EWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BML C;  1C4P A;  1L4D B;  1L4Z B;  1QQR A; 
#chains in the Genus database with same CATH topology
 2Y3A A;  2LFI A;  2IY1 B;  3TMP B;  2CU1 A;  2V9H A;  3KUZ A;  4BFR A;  3RN9 C;  4P16 A;  4ZHO A;  2J7Q B;  1VZ6 A;  4P1C C;  2Z8L A;  1V97 A;  5GMV A;  1XLN A;  3L0W B;  3DQV A;  1X1M A;  1WX8 A;  3TEY A;  4S0R A;  1JAL A;  2AQ1 B;  3TCA A;  4G50 A;  3R2I A;  3DHI C;  3JW0 X;  4DHZ B;  2HD5 B;  2L3Z A;  1I7H A;  2JF5 A;  3BVM A;  3I5J C;  2ZVN A;  2HJ1 A;  2KWC A;  1AAR A;  4HRO A;  3N9Y C;  1I4H A;  2VZK B;  1EWY C;  3WAP A;  2WU5 B;  2Z0D B;  1XF5 L;  4DXG A;  2Y5C A;  2BTE A;  4IW0 A;  1PGB A;  3E9S A;  4KX6 B;  1F1H A;  5AUI A;  1C1Y B;  2BYE A;  2NTT A;  1XLQ A;  1L4Z B;  2KDM A;  1A5R A;  5LXH A;  1R4N I;  2KAN A;  3ZJV A;  1P7F A;  3KWV A;  4W9J A;  3N3K B;  2QEJ C;  3B08 A;  2RDG A;  3Q2A C;  4EFO A;  1MVK A;  1TZO A;  1UWM A;  4FHJ A;  4TSS A;  5C23 A;  2CHZ A;  1N5X A;  4NPN A;  5AUK A;  3AN1 A;  2JXT A;  2C7N B;  3AM9 A;  3GS2 A;  5FK9 C;  1UBI A;  2IBI B;  2AQ2 B;  3SU8 X;  5DPS A;  5HI1 A;  3SEB A;  3BYT B;  1NYQ A;  1FNV A;  2BBC A;  2E3T A;  4B0M A;  2Q5W D;  2BW2 A;  2KT7 A;  1B9R A;  4MDK E;  2LVQ A;  3TSS A;  2HE7 A;  3AE5 B;  3ZVV A;  1V81 A;  2IO2 B;  3NVW A;  5D3I B;  4RM8 A;  1V9J A;  1CMX B;  4M02 A;  2G3Q B;  4FA6 A;  2A4Z A;  1CQV A;  2INN E;  3QIJ A;  4MH8 A;  3GE8 C;  5E6O A;  3PHW B;  3WAN A;  1GAQ B;  1MJD A;  2PJH A;  4XZ4 A;  1D6E C;  3HUI A;  4JWS C;  2WXN A;  3AI5 A;  1E9M A;  3AE3 B;  3B9J A;  5E6P A;  4AJY B;  1WYG A;  4WWP A;  1CZP A;  1P98 A;  1C76 A;  3SFE B;  1IUE A;  2D2Q A;  3SDL C;  4YT0 B;  1YNT E;  4L1B A;  2WHI A;  2KKC A;  4RF1 A;  4FUL A;  4K7U A;  1TY0 A;  1SB3 C;  2G4S A;  3NHE B;  1XCT L;  2K3U A;  3SR6 A;  3ZO5 B;  5BMH A;  1RM6 C;  1ZPS A;  2GBK A;  3AE9 B;  3OJ3 A;  2DYO A;  1TKG A;  3VHT C;  2M8S A;  3T3O A;  3AEF B;  2WP9 B;  3ZKJ C;  5IP4 D;  3JSV B;  5EE1 A;  2BYT A;  2KZR A;  3JSV A;  5BO4 B;  1XQQ A;  3NJT A;  4I6L B;  2PVG C;  1NEN B;  4PS7 A;  2JRI B;  2G4D B;  2LUE A;  2BS3 B;  2INC C;  3NS8 A;  1ZGU B;  5CHV C;  4BBN C;  5J17 A;  4IOI E;  2ICI A;  3V60 A;  3U2S C;  4LNO A;  3RNG C;  2V4I B;  2OHF A;  3P4R B;  2AL6 A;  3ENE A;  2BQQ A;  1GUA B;  1N5W A;  4HPP A;  4A20 A;  2GI9 A;  3WAO A;  1P3Q U;  1F9J A;  2WXO A;  2KFK B;  4GDK B;  2KFK A;  3L16 A;  3EFC A;  2WXG A;  2G1E A;  4GDK A;  1YJ1 A;  2RDH A;  4WIP A;  2MSE D;  2H89 B;  4YSX B;  4IDI A;  2LJI A;  4RGM A;  4P7I A;  2IPK D;  2LMC A;  2Y5P A;  3AEE B;  2QJL A;  1H8C A;  2AYO B;  4LTU A;  3AU4 A;  2PE6 B;  3TEX A;  4WJN A;  3H7S A;  2JWZ A;  3QX1 A;  4C80 A;  1IGC A;  5IAA C;  2KHW B;  2XBB C;  2K5P A;  3W1Y A;  4AUQ C;  5JXV A;  1TGZ B;  1RAX A;  1S3S G;  3VFK A;  1DGJ A;  4ZRK A;  1WSP A;  3MJW A;  4W9K A;  4ZRJ A;  2ON8 A;  2DZM A;  1D5X C;  4RCO A;  5LNK 1;  1SJH D;  2LGS A;  2CHW A;  4FLH A;  2XN9 C;  4YXD B;  2RPQ A;  4ZRQ A;  1AW7 A;  2JT4 B;  4BKG A;  4RGO S;  2ZW1 A;  2I38 A;  4WWO A;  3TEW A;  1WXV A;  2CKH B;  3UQA A;  2BF8 B;  5EE9 A;  3AEG B;  2LVP A;  5TSS A;  2QSD A;  3DBR I;  3NVY A;  2G9H D;  3IT4 B;  3R2T A;  5D2M B;  1GG3 A;  1PDX A;  3DOW A;  4KIK B;  1ACC A;  4KVG B;  4EOY A;  1KH0 A;  4KIK A;  2BKF A;  1EU4 A;  1JWB D;  1WGG A;  5JHA A;  5C3J B;  4GB9 A;  1QOG A;  4QAY A;  2WDT B;  1D5M C;  2J52 A;  3P63 A;  2VH1 A;  4FAD A;  2DLB A;  3EGR A;  1E8X A;  2KJH B;  3ZRF A;  2H88 B;  2L76 A;  1PFD A;  5C2T B;  2ZZP B;  2RGF A;  3BVZ A;  1GC6 A;  2DX5 B;  2PEA A;  4NY0 A;  3MTN B;  2D3C A;  3VUY A;  2BWE S;  1KLU D;  4GN1 A;  2XEW A;  1OFF A;  3B2G A;  2J53 A;  4DDI D;  1E8Y A;  3R66 C;  4BKS A;  3ZW3 A;  5HHD G;  1LO5 D;  3I9V 1;  4YWG G;  1HTQ A;  3ECI A;  3AE1 B;  1Q1O A;  2WLB A;  3QWZ B;  1ZW7 A;  5AZG A;  2WDR B;  1J8C A;  4YSZ B;  1JRU A;  2BB6 A;  4DXA B;  4DK5 A;  1Q10 A;  2ZNV C;  4TQ1 A;  1MG8 A;  1S1Q B;  2D3B A;  3Q6B A;  4MT5 A;  2KC1 A;  4K3B A;  3EC8 A;  2MLB A;  1MHH E;  2BVC A;  1WE6 A;  1C9F A;  1SE3 A;  4DQO C;  1P9D U;  1AWD A;  1WGY A;  3KYD D;  3NZ3 A;  2WNM A;  3ZDT A;  2KVZ A;  4DDG D;  2G45 B;  2WXL A;  3GB1 A;  2N9L A;  4EKU A;  4D2K A;  1ET9 A;  2LGD A;  3ZJT A;  1KLG D;  2L0F A;  3UF8 A;  1E7U A;  1H4R A;  4HXD A;  3PZ7 A;  1WJ4 A;  2M1M A;  2FCS A;  1FFV A;  1HA5 A;  2REX A;  3UQB A;  1R4M I;  2PE9 A;  4A6Q A;  3N32 A;  1U4A A;  1V1P A;  4TUU A;  4HDO A;  3TBL D;  3APC A;  1ZE3 D;  5LLI A;  3DDC B;  3RUI B;  1XD3 B;  2UU7 A;  2KJ6 A;  3RZW C;  1QOB A;  3NS1 A;  3MJ5 A;  1WF9 A;  4BVU C;  2MWS B;  4LNN A;  4KKI A;  2OED A;  4JPS A;  3GE3 C;  1VDV A;  2FBW B;  3RNA C;  2ACZ B;  3W5V B;  1UH6 A;  4HPL B;  4HRS A;  1I4Q A;  1VJK A;  1WXS A;  3Q3N C;  4MAC A;  3QAR A;  3Q8A A;  2JZP A;  4R3D A;  4ZRI A;  3QC8 B;  5GXG B;  4KKJ A;  3APF A;  1VLB A;  1WFY A;  3L17 A;  4LNF A;  1DOX A;  1C3T A;  1GOZ A;  1XCQ L;  3UGB B;  4B0E A;  2KWD A;  1DYQ A;  3ALB A;  3FC4 A;  3V05 A;  1C77 A;  4RF0 A;  5MPO A;  1IGD A;  3K9O B;  4XE0 A;  4W9H A;  1HZ6 A;  1FXA A;  4G11 A;  1FPY A;  3VRA B;  2GOW A;  4YSY B;  2N9X A;  5BMI A;  4C4V B;  5DPR A;  1KTK A;  5BYS A;  1L0Y B;  4C4V A;  4XC2 A;  2JSV X;  1OQR A;  2PLP A;  2IGG A;  3ONS A;  4US8 A;  4KGT A;  3U30 A;  3OAW A;  1T5X D;  5H8Y E;  3URY A;  3AEA B;  4EEW A;  1FNW A;  2WXQ A;  3S2A A;  2MBO A;  3MHZ A;  2FUG 1;  4EZL A;  4ARC A;  4IWP A;  1MHX A;  1JW9 D;  4ZDV A;  1UF0 A;  2N1V A;  2K6D B;  4IUM B;  1F52 A;  3HM6 X;  3NY5 A;  4TMA B;  4HPM B;  3B1L X;  3HM3 A;  2WDQ B;  1E6E B;  4BOS C;  4LJP B;  2JWU A;  1WRI A;  1I4P A;  3A9K B;  2LEK A;  3NUH B;  2DNF A;  5IA7 A;  1V5T A;  4BKS D;  2N7E A;  2RMM A;  4B6W A;  3A9K A;  3Q14 C;  4JIO U;  4ICU A;  3P42 A;  1ET6 A;  4DBG A;  1WX9 A;  4DWF A;  2KNB A;  2KQ7 A;  4H2A A;  4RMA A;  3IHP C;  2D5G A;  1YIW A;  3PZD A;  3DBS A;  2WXP A;  1CJE A;  4EZK A;  5FR6 A;  1GC7 A;  1WYW B;  3DBR B;  1XO3 A;  2GBM A;  3PRE A;  5IO9 A;  4G3X B;  3M3J A;  1TKE A;  3GZN I;  4K1R B;  3PS6 A;  1Z2M A;  1VD2 A;  4HCN B;  4OVU A;  2BYF A;  3N1X C;  3C19 A;  3PHX B;  3FAH A;  2BPS A;  3P4P B;  3AXC A;  1F2R I;  1WXA A;  4RGT A;  1SE9 A;  4LLG M;  1V49 A;  4LDT B;  5H92 C;  2GRI A;  1LFD A;  3CMM B;  3NG0 A;  2L7R A;  1OGW A;  2WX0 A;  2EMS A;  2FE8 A;  2KQ4 X;  3BK1 A;  4M8M A;  5L95 C;  4USA A;  3TUO A;  3CST A;  1UEL A;  2MA9 B;  4GLS C;  4OVZ A;  2XNA C;  3Q3O C;  1L0X B;  5G5G A;  3T9L A;  1FCL A;  2HJ8 A;  3ZYY X;  1I35 A;  4IM0 A;  3TJP A;  3CSF A;  3C0R B;  3VTV A;  3VRB B;  2WXI A;  2R2Q A;  4NAM A;  4X57 B;  2QC8 A;  3AEB B;  3DVN U;  4IWO A;  1WR6 E;  4L2Y A;  1WR1 A;  1J7C A;  4IKG A;  1L5P A;  2JX5 A;  1N61 A;  2DWQ A;  2K22 A;  3VUX A;  3KUC B;  4L23 A;  3UIN B;  4W9F A;  2DHZ A;  3W1S A;  4AP4 C;  3R7R A;  4MM3 B;  4ZHP A;  4DHZ E;  3ML9 A;  3U4E G;  3VH4 B;  2KWV B;  4MM3 A;  3R7Q A;  3IAS 1;  2NBW B;  3RUL A;  3PGE A;  4M0W B;  5AEK B;  3VXW A;  4M0W A;  3DWM A;  1LM8 B;  2JRH A;  2LVO A;  4KSK C;  2MEK A;  3Q8B A;  4LCD E;  2WS3 B;  2JZ3 B;  2KLC A;  4W9G A;  1R4M B;  3DHG C;  4WAF A;  4A3P A;  2YLM A;  4A90 A;  4OW0 A;  3DVG X;  4PT5 A;  1E8Z A;  4MSQ B;  3N20 C;  4OZC A;  3PRZ A;  2NBV B;  1OQY A;  3ZNH B;  1PUT A;  1WJN A;  2RPV A;  4F8C B;  3IVF A;  2GBJ A;  1RYJ A;  1SSN A;  2EEL A;  3FKY A;  1J19 A;  4MJS B;  2K9X A;  2KAC A;  2B3A A;  4MJS A;  2I1J A;  2L0T A;  4HJK A;  2HTH A;  2IO0 B;  1RRB A;  2QCZ A;  2OJR A;  2ONQ A;  3N1Y C;  2QHO A;  3ZRC A;  4EZJ A;  3ZLZ A;  2V1Y A;  1TS5 A;  3L4P A;  2GMI C;  4US9 A;  3IG3 A;  2UYZ B;  1L2N A;  3VUW A;  1YJJ A;  1MI0 A;  1TS2 A;  3AB5 A;  1SBB B;  4GIV A;  2JVC A;  4MGZ E;  3DCG A;  5I4D A;  1GPX A;  3ZNZ B;  4C7Z A;  5HKH A;  4OHJ A;  4IWQ A;  1YX5 B;  2KX0 A;  2NPT B;  3H6N A;  2VZK D;  2N1W A;  2NPT A;  1JWS D;  3KVF B;  3PZ8 A;  3ML8 A;  2IO1 B;  4S17 A;  3RD2 A;  2WWZ A;  1WWT A;  3RNE C;  2DYB A;  1WGK A;  4ZYS A;  1XEE A;  1ISN A;  3LDZ E;  2X8X X;  1B1Z A;  3HK0 A;  2MJ3 A;  1ZOY B;  3PTF C;  1Z5S B;  1I4G A;  2CJN A;  1GJZ A;  1FD6 A;  2I1K A;  1PYW D;  3RMK C;  5G2N A;  4C7Y A;  3PRP B;  1T0R C;  3GP7 A;  1UUP A;  4RM9 A;  1FNU A;  2WXH A;  3P1M A;  1TZ1 A;  3VVW B;  1YQB A;  2DYM A;  2MJE A;  4WUR A;  2KD0 A;  1WH3 A;  2KTF A;  1WXQ A;  3RZF A;  1HTO A;  1QIL A;  2C60 A;  4MH0 E;  2C7H A;  3B0A A;  3HVZ A;  2PTL A;  1HXY D;  1WXM A;  3Q69 A;  3ZDM C;  1J7B A;  1NBF C;  2JU6 X;  2L32 A;  4M8N A;  1YD8 U;  5FR3 A;  2FIF A;  2K8B A;  2INP E;  1A70 A;  2LJ5 A;  3BY4 B;  2M0A A;  1Y8R C;  5AZF A;  4C00 A;  3PVL A;  2O6V B;  4BKT A;  2O6V A;  2LRW A;  2J42 A;  2KJR A;  3ZQ4 A;  4MEL A;  2KVR A;  2FNJ B;  4M01 A;  4GGQ A;  1WE7 A;  2N4F A;  4GXB A;  3I63 C;  4GMV A;  3GZN B;  2M0X A;  4KDI C;  5LXI B;  3HRD D;  3W9C B;  1N63 A;  3A4S C;  3ZXR A;  1L7Y A;  1HZ5 A;  4PS8 A;  2B76 B;  3CIR B;  5CHF A;  4WQM A;  1JWM D;  3H7P B;  5DCN A;  2L00 B;  2WU2 B;  3H7P A;  4OZA A;  4II2 B;  3QAQ A;  1HQR D;  1OEY J;  1ZP0 B;  3A9J B;  3W5U B;  3OLM D;  3A9J A;  4ANU A;  5EDS A;  3RNF C;  5JHB A;  1XLO A;  3VTW A;  3R3M A;  3RCZ A;  4HKQ A;  3ZJU A;  5T8I A;  1T3Q A;  1C4P A;  3UIO B;  3PPA A;  2LGY A;  1UZX B;  2CHX A;  3W2D A;  3HHM A;  2M56 B;  4FXC A;  4AOF A;  4BOZ B;  5EE0 A;  4TQ0 A;  2KQS A;  1I42 A;  1TS3 A;  2GBN A;  5D7G A;  2LGI A;  1HEZ E;  3L13 A;  2N9E B;  1FFU A;  3IT6 B;  2KMM A;  4HCP B;  1OTR B;  3T8M A;  3V6E B;  4MGK E;  2BT6 A;  1EUV B;  2KMC A;  2KDB A;  2K39 A;  1AN8 A;  1OEY A;  2ZVO A;  3DBL I;  3UIP B;  3DVG Y;  2MX2 A;  2MQJ A;  3NZU A;  4HVB A;  4YTP B;  4GOC A;  4BZA A;  4N59 A;  3OWE B;  4RH6 A;  2FCN A;  4Q2J A;  4EUT A;  3AE7 B;  2BS2 B;  4LNI A;  4RFB A;  4JL9 A;  4NJ6 A;  1WGD A;  3A33 B;  3VH3 B;  1GB1 A;  2JPH A;  1SXT A;  5CTR C;  3KW5 B;  1AYF A;  1TKY A;  3AE6 B;  4XDC A;  3IFW B;  2ZCC A;  1PGX A;  4ANW A;  1V1P B;  5D3D A;  1STE A;  3L10 B;  1C78 A;  3X23 A;  1TIF A;  3RPF C;  3N1Z C;  1SE2 A;  4MEM A;  4PS3 A;  2D3G A;  1WIA A;  2J4X A;  1YN3 A;  2N7D A;  3BVG A;  2ZPY A;  1F0Z A;  2ZEQ A;  2N0S B;  3VTU A;  1J7A A;  2FCM A;  2KK8 A;  1IPG A;  4OZB A;  1QT9 A;  3LXF A;  5E6N A;  1TY2 A;  3K9P B;  5BMG A;  1QOA A;  1VZ8 A;  4FJZ A;  3V6C B;  3U7D A;  2FCQ A;  2LAS A;  4ITK A;  1SJE D;  3L54 A;  2BYV E;  1YN5 A;  2PW9 A;  3KWL A;  1XLP A;  1T6B X;  1WZ3 A;  4KDL B;  4N6E B;  4MGY E;  3WIM A;  2MP2 B;  4NQK E;  2MP2 A;  3MFG A;  3DWG C;  1WI0 A;  4XWW A;  2HTM E;  1FMA D;  1E7P B;  2DZI A;  3UI3 A;  1D5Z C;  3ABV B;  5J2R A;  5IOI A;  4W9C A;  3D32 A;  1FRR A;  2KOX A;  1KM7 A;  2J0M A;  1DOI A;  3DPD A;  2VRR B;  5BYR A;  4AS1 A;  1ENF A;  1C79 A;  4HK2 A;  3NRZ A;  2ZCB A;  1TYG B;  1FXT B;  1V5O A;  4XWT A;  2LD9 A;  3Q3F A;  3Q8E A;  5BYQ A;  2MBH A;  2K8H A;  4IM2 A;  2BWF A;  1WY8 A;  2DBY A;  2KAJ A;  2MJD A;  2TSS A;  1YQ3 B;  2YEP F;  5E6J A;  2GB1 A;  2ZW0 A;  3P4Q B;  1N6Z A;  3O13 A;  3CF6 E;  2C7M B;  3TL5 A;  4FJV B;  4P6V F;  1K52 A;  4PK1 A;  1EM7 A;  2KN4 A;  4B9K A;  1ZXI A;  2W55 A;  4HLE A;  3Q8F A;  1VZ7 A;  3I57 A;  4J3O D;  4WQO B;  1N62 A;  1YOV B;  5HG2 A;  1WZ0 A;  2PKO A;  2L52 A;  1RLF A;  1EF5 A;  4G0N B;  3BIN A;  2M4N A;  2RDB C;  3Q8C A;  1WJ6 A;  3LYY A;  3VR8 B;  1BUI C;  3Q3J A;  2MHJ A;  2KFJ A;  3MC0 B;  2ZPN A;  2WDV B;  4MSM B;  2D3A A;  4II3 B;  2L1A A;  3TEZ A;  2CU3 A;  5D6J B;  3PT2 B;  1QOF A;  3QCA A;  3MP9 A;  3MC9 A;  4JWU C;  4KV2 A;  2X38 A;  3EFU A;  2MBQ A;  1FO4 A;  3ZUN A;  2BS4 B;  4BAX A;  3W1S C;  1TTN A;  4NJC A;  2KN5 A;  2MH7 A;  3ZGZ A;  2OOB B;  1NYR A;  4F1S A;  4LJO B;  2FID A;  3NVZ A;  2WXM A;  2UWQ A;  3EHV A;  4LNK A;  3ZXV A;  3BYY B;  4KZ0 A;  4ZRP A;  2CR5 A;  4XYC A;  2GBR A;  1UGJ A;  2QMT A;  3V3X A;  4HJG E;  2ZJD A;  1SIJ A;  2RR9 A;  4IC7 B;  2L05 A;  4FN2 A;  1T0Y A;  4NQL B;  5KHO A;  4N58 A;  3L08 A;  4N9F 4;  3OJ4 B;  4ICV A;  1FM0 D;  2L8J A;  2KDE B;  4FJY A;  1PQS A;  2IYD B;  4DHJ B;  1WGR A;  3PRM B;  4HDQ A;  2FAZ A;  4OVV A;  4FBJ B;  1Q5W B;  4I6P A;  3E56 A;  2MBE A;  2MBB B;  4KSL C;  3DBH B;  2NVU I;  4HEA 1;  3AE2 B;  1QKZ A;  1JQ4 A;  2M19 A;  4UDU C;  2IGH A;  2KLG A;  2WGS A;  1V1O A;  1P7E A;  3NZS A;  1FIQ A;  3TIX A;  3ZNG C;  1NI3 A;  3VQI A;  4YTM B;  4NNJ B;  4JE3 B;  1SGH A;  2WXK A;  3BZD B;  1D4B A;  4P1B C;  4NAW B;  4XDD A;  1JRP A;  4NAW A;  2DZJ A;  4JLC A;  4JQW C;  1RFA A;  4M00 A;  1V86 A;  1EWC A;  3M95 A;  1QZE A;  3DBL B;  1N60 A;  2BB5 A;  2LUM A;  5G55 A;  4NJ7 A;  4URK A;  3AV8 A;  1JRO A;  3OG5 A;  4YL8 A;  1XT9 B;  3JVZ X;  3P4S B;  2NMQ A;  1LQB A;  1OQQ A;  2E6X A;  1PGA A;  2AQ3 B;  4MGI E;  2AEH A;  4GSW A;  3HVD A;  2ASQ A;  3AMZ A;  2KXJ A;  3BII D;  1IBX B;  1V2Y A;  3QQ8 B;  1IBX A;  2L83 A;  1JCK B;  3X0W A;  2KX3 A;  4E74 A;  1ZKH A;  2N7J A;  2NBU A;  2RD0 A;  3A4R A;  4IG7 B;  4B95 A;  3P2B A;  4C56 C;  1HE8 A;  1K50 A;  2LXA A;  3H9D A;  2MW5 A;  1XXG A;  2EMT A;  3B2F A;  2V0G A;  3BWU D;  1UNS A;  4GU2 A;  5CHW A;  2JQR B;  2XK5 B;  2XK5 A;  3GOE A;  2KDI A;  5JZE B;  1C4A A;  1E7V A;  3WA0 A;  2R61 A;  2BGF A;  4XX5 A;  1DOY A;  1UD7 A;  4ANV A;  3PSE B;  3ETR A;  2AL3 A;  2FUH B;  3DHH C;  2J0K A;  2IY0 B;  1RFK A;  4K3C A;  5C1Z A;  2Z59 B;  1FXI A;  4O1N A;  1ESF A;  2NCN A;  1SEB D;  3U7Z A;  2KDF B;  1R7S A;  3QHT A;  2JYE A;  2OJW A;  1FEH A;  1WRD B;  4A9A A;  4K7W A;  5IN7 A;  2IDY A;  1Q0W B;  1ZXH A;  3WCQ A;  1EF1 A;  5D94 A;  3RFZ B;  1V6E A;  2NR2 A;  2DZK A;  4TV3 A;  2C9W B;  4KZC A;  5KHQ A;  1K53 A;  1EO6 A;  1K8R B;  1P0R A;  4AWJ A;  4W9L A;  3T3N A;  3M62 B;  2JY6 A;  1SIF A;  3AED B;  1BXT A;  1V8C A;  3KH0 A;  3AUL A;  1QLB B;  3PLV A;  3AU5 A;  2RSU A;  2QDF A;  3U52 E;  1P1A A;  2W9N A;  1G6J A;  2CS4 A;  4ACF A;  2BKR B;  1NVI D;  4WWM A;  1K51 A;  3A1Q B;  4CQN A;  3RNB C;  3MHS D;  3A1Q A;  5JH5 C;  4HKZ E;  1T0Q C;  2D10 A;  1FCC C;  1WX7 A;  2D07 B;  5G5H A;  2LZ6 A;  2K1F A;  4LDT D;  3EEC A;  3QA8 A;  2KTR B;  1TS4 A;  4W9I A;  1BML C;  2KTR A;  1F2R C;  1IYF A;  2V3P A;  4IM3 A;  3LB8 C;  4RGN A;  5HFY A;  1I4R A;  4WJO A;  3Q3M C;  3VR9 B;  2LHD A;  1MG4 A;  2KC2 A;  2LI5 A;  2V3S A;  3H1U A;  2WXF A;  4DHJ D;  5FKA C;  2LRU A;  2WXR A;  4I6N B;  4CYE A;  4DXF A;  2DAF A;  1UWX A;  1WMH B;  3V61 A;  4HWI B;  4W9D A;  4KGS A;  1WMH A;  1F77 A;  1E8W A;  5J18 A;  2Z0E B;  2N9P C;  2C5L C;  4WJQ A;  2SEB D;  3HIZ A;  3LJ3 A;  2EKI A;  1VRA B;  1YMH E;  4A3O A;  1WGH A;  2PMV A;  4FHK A;  3N30 A;  3NOB A;  3MC8 A;  1KFY B;  3ZTC A;  3AE4 B;  4ANX A;  1LXD A;  2A5U A;  3VAW A;  2K25 A;  3PLU A;  2V3N A;  4LK0 M;  3BK2 A;  1TT5 B;  2AWT A;  1JWA D;  4K7S A;  3R8B A;  1R4N B;  2W82 A;  2PIA A;  2AX5 A;  3IBE A;  1ZDX A;  1JML A;  4ASW C;  2Y5B B;  2MCN B;  2KWU B;  1UBQ A;  3DBH I;  2PVO D;  2LHE A;  2YEP B;  1KF6 B;  3J9C A;  2M17 A;  4J6I A;  2QIL A;  1SE4 A;  3ZIM A;  2DAJ A;  1UGM A;  2K8C A;  1L6V A;  1YN4 A;  1YX6 B;  5AZH A;  3U8Z A;  3QK0 A;  1E90 A;  2VH2 A;  4TKN A;  1E5W A;  4REZ A;  2JXX A;  4F7Z A;  2WQY B;  3QJZ A;  1VR9 A;  2O2V B;  1KLV A;  2O2V A;  2IJ0 A;  3WAM A;  4XGA B;  1WM2 A;  3JYU A;  2EKE C;  4E3C A;  3EA6 A;  3IXS A;  3DVN V;  3APD A;  2MRP A;  1TJE A;  2KYW A;  4PYZ A;  1ROE A;  3SFD B;  2I2Y A;  2D11 A;  1I4X A;  1T0S C;  5DPT A;  3FIL B;  1NDD A;  3FIL A;  2SAK A;  4A8X C;  4JX1 C;  1ZUD 2;  4CO7 A;  1LGR A;  1C4C A;  2W3S A;  1FRD A;  1E0Z A;  3EUB 2;  3M63 B;  3RT3 B;  4WAA A;  1IP9 A;  3KYC D;  4BBN F;  3KUD B;  3RI7 C;  2JYT A;  2QIE B;  2K0P A;  2HDE A;  3ZTD A;  1TBE A;  4GDL B;  1L4D B;  4YTN B;  2WYQ A;  2IGD A;  2J0J A;  4GDL A;  4EE2 A;  1WM3 A;  3H8H A;  4KGR A;  2JZZ A;  3AEC B;  2WX1 A;  4E71 A;  1BT0 A;  1NEK B;  3V62 A;  2DEN B;  1M94 A;  2KMA A;  3SD5 A;  5EE3 A;  3WAL A;  4AJW A;  1J0G A;  5CX3 A;  2W3R A;  1SF0 A;  1MPE A;  3AH7 A;  3C8Y A;  3CWI A;  2JUO A;  2IND C;  2NTS A;  2LGX A;  1GNU A;  2CJO A;  2YVC A;  3ZNI D;  3AE8 B;  1EU3 A;  1QQR A;  2ZNV B;  2PPH A;  4NZL B;  1NI2 A;  3KQ4 A;  1QF6 A;  1GB4 A;  1KOT A;  2W54 A;  2IZV B;  1YQ4 B;  4A55 A;  1L0V B;  2LXC A;  5TR5 A;  4WWN A;  4JGH B;  3IAM 1;  1KJT A;  2NS5 A;  3O65 B;  2K6Q A;  3RYT A;  3I3T B;  2R2O A;  4ZOH C;  2KO3 A;  5L83 A;  2GLS A;  3VDZ A;  1YJI A;  4ARI A;  1V80 A;  1MFW A;  2WXJ A;  2O6V D;  1Y56 A;  2IO3 B;  4K81 A;  4AQ7 A;  5DPW A;  3PO0 A;  4WJP A;  3RNC C;  1WJU A;  1RWS A;  4ZYN A;  1ZDV A;  2N9K A;  3SHQ A;  2LWP A;  5IKC M;  4WH4 A;  3NVV A;  1VCB A;  1D3Z A;  4W9E A;  4CHK A;  4RNA A;  1M4V A;  2V4L A;  3KLS X;  3PV1 A;  1CK1 A;  1JWU D;  1E10 A;  1L6U A;  1KRH A;  4PYU A; 
#chains in the Genus database with same CATH homology
 1FNU A;  2Y3A A;  2WXH A;  4MT5 A;  1N60 A;  2BB5 A;  2LUM A;  3P1M A;  2LFI A;  3AV8 A;  2DYM A;  1MHH E;  2MJE A;  1JRO A;  4WUR A;  1C9F A;  1SE3 A;  4DQO C;  4P16 A;  1WXQ A;  1AWD A;  4ZHO A;  1QIL A;  1VZ6 A;  3NZ3 A;  2WNM A;  2Z8L A;  3P4S B;  3HVZ A;  2NMQ A;  2PTL A;  1HXY D;  1OQQ A;  2E6X A;  1V97 A;  1PGA A;  3Q69 A;  1J7B A;  2WXL A;  2JU6 X;  1XLN A;  2AQ3 B;  2L32 A;  2N9L A;  3GB1 A;  5FR3 A;  3HVD A;  4D2K A;  1ET9 A;  3AMZ A;  1IBX B;  3BII D;  2INP E;  1A70 A;  3ZJT A;  2M0A A;  1IBX A;  2L83 A;  1JCK B;  3TEY A;  1KLG D;  1JAL A;  2AQ1 B;  3PZ7 A;  3R2I A;  1FFV A;  1HA5 A;  2N7J A;  1I7H A;  3BVM A;  4A6Q A;  1V1P A;  2J42 A;  1K50 A;  4C56 C;  4HRO A;  3N9Y C;  1XXG A;  1ZE3 D;  1I4H A;  2VZK B;  3B2F A;  1EWY C;  3ZQ4 A;  2V0G A;  3BWU D;  2WU5 B;  1UNS A;  1XF5 L;  4DXG A;  2Y5C A;  2JQR B;  2BTE A;  1PGB A;  3E9S A;  1QOB A;  4KX6 B;  3NS1 A;  5AUI A;  3MJ5 A;  1C4A A;  2NTT A;  3HRD D;  3W9C B;  1XLQ A;  1L4Z B;  1N63 A;  2KDM A;  2OED A;  2R61 A;  4KKI A;  4JPS A;  1VDV A;  2FBW B;  3ZJV A;  1P7F A;  3KWV A;  1HZ5 A;  1DOY A;  2ACZ B;  3W5V B;  2QEJ C;  2B76 B;  3CIR B;  4WQM A;  4HRS A;  1JWM D;  2RDG A;  1I4Q A;  1VJK A;  3ETR A;  1MVK A;  1TZO A;  1UWM A;  2WU2 B;  4MAC A;  4TSS A;  4OZA A;  3Q8A A;  1N5X A;  5AUK A;  1RFK A;  3AN1 A;  2JXT A;  1HQR D;  2JZP A;  1FXI A;  4O1N A;  1ESF A;  3AM9 A;  4R3D A;  1ZP0 B;  3GS2 A;  5FK9 C;  1SEB D;  5GXG B;  3U7Z A;  3W5U B;  1R7S A;  4KKJ A;  2JYE A;  1FEH A;  1VLB A;  4A9A A;  2AQ2 B;  1DOX A;  5HI1 A;  1GOZ A;  1XCQ L;  3SEB A;  2IDY A;  1XLO A;  4B0E A;  1ZXH A;  2KWD A;  1DYQ A;  3FC4 A;  3BYT B;  3WCQ A;  4HKQ A;  1NYQ A;  1FNV A;  2BBC A;  3ZJU A;  2E3T A;  3V05 A;  4B0M A;  1C77 A;  5T8I A;  1T3Q A;  1C4P A;  4RF0 A;  5MPO A;  3RFZ B;  1IGD A;  4XE0 A;  2Q5W D;  2BW2 A;  3W2D A;  1HZ6 A;  1FXA A;  1B9R A;  2M56 B;  4FXC A;  3VRA B;  4YSY B;  1K53 A;  3TSS A;  5BMI A;  5EE0 A;  4TQ0 A;  1KTK A;  1TS3 A;  5BYS A;  1L0Y B;  5D7G A;  3T3N A;  3AE5 B;  2LGI A;  3AED B;  1HEZ E;  2JSV X;  3NVW A;  1BXT A;  1OQR A;  1V8C A;  2PLP A;  5D3I B;  1FFU A;  2IGG A;  3IT6 B;  2KMM A;  1QLB B;  3U52 E;  4US8 A;  4KGT A;  1NVI D;  2BT6 A;  1CQV A;  2INN E;  1T5X D;  4WWM A;  1AN8 A;  1K51 A;  4CQN A;  4MH8 A;  5H8Y E;  3URY A;  3AEA B;  1FNW A;  2WXQ A;  3MHZ A;  1GAQ B;  2FUG 1;  4HKZ E;  4YTP B;  4N59 A;  4ARC A;  3OWE B;  4RH6 A;  1D6E C;  1MHX A;  4Q2J A;  1FCC C;  3AE7 B;  1JW9 D;  2BS2 B;  5G5H A;  3HUI A;  4JWS C;  2WXN A;  1TS4 A;  1E9M A;  3AE3 B;  1BML C;  3B9J A;  1F2R C;  4RFB A;  2V3P A;  4TMA B;  3LB8 C;  1WYG A;  1CZP A;  4RGN A;  5HFY A;  1C76 A;  3SFE B;  1I4R A;  1IUE A;  3VR9 B;  2WDQ B;  1GB1 A;  2LHD A;  1SXT A;  4YT0 B;  1E6E B;  1AYF A;  1YNT E;  4L1B A;  2JWU A;  2WXF A;  1TKY A;  1WRI A;  3AE6 B;  1I4P A;  4XDC A;  2LEK A;  3NUH B;  4RF1 A;  1PGX A;  1TY0 A;  2RMM A;  1SB3 C;  5FKA C;  1XCT L;  2WXR A;  3P42 A;  1V1P B;  5D3D A;  2K3U A;  3SR6 A;  1STE A;  4DXF A;  1C78 A;  1ET6 A;  5BMH A;  1RM6 C;  1ZPS A;  1UWX A;  3RPF C;  3AE9 B;  4H2A A;  1SE2 A;  4KGS A;  2J4X A;  2DYO A;  1TKG A;  1F77 A;  1YN3 A;  2D5G A;  3T3O A;  2SEB D;  3BVG A;  2WXP A;  1CJE A;  3AEF B;  2WP9 B;  1F0Z A;  2EKI A;  1VRA B;  1YMH E;  1XO3 A;  2N0S B;  2PMV A;  1J7A A;  1TKE A;  4OZB A;  5EE1 A;  1QT9 A;  2BYT A;  3LXF A;  1KFY B;  1TY2 A;  3AE4 B;  5BMG A;  1QOA A;  1VZ8 A;  2PVG C;  1NEN B;  4ITK A;  4LK0 M;  2V3N A;  2BS3 B;  1SJE D;  2PW9 A;  1YN5 A;  3KWL A;  1XLP A;  3FAH A;  3BK2 A;  4IOI E;  1T6B X;  2ICI A;  3P4P B;  3U2S C;  1F2R I;  4N6E B;  1JWA D;  4RGT A;  4LLG M;  3R8B A;  2W82 A;  2V4I B;  2PIA A;  2AX5 A;  2OHF A;  3MFG A;  3P4R B;  1ZDX A;  1JML A;  3DWG C;  5H92 C;  1N5W A;  4XWW A;  2GI9 A;  2HTM E;  2GRI A;  1FMA D;  1E7P B;  2WXO A;  3UI3 A;  1D5Z C;  2PVO D;  3ABV B;  2FE8 A;  2KQ4 X;  2LHE A;  2YEP B;  3BK1 A;  4GDK B;  1KF6 B;  1FRR A;  4USA A;  2WXG A;  2G1E A;  3J9C A;  1DOI A;  3TUO A;  2RDH A;  2QIL A;  4WIP A;  5BYR A;  4GLS C;  4AS1 A;  2H89 B;  1ENF A;  1C79 A;  4OVZ A;  1SE4 A;  4YSX B;  2XNA C;  3NRZ A;  1L6V A;  1YN4 A;  1TYG B;  1L0X B;  5G5G A;  4XWT A;  4IDI A;  3Q8E A;  2LJI A;  4RGM A;  2IPK D;  1FCL A;  2LMC A;  2Y5P A;  5BYQ A;  3AEE B;  4REZ A;  2QJL A;  3ZYY X;  4LTU A;  2WQY B;  1VR9 A;  2DBY A;  2KAJ A;  2MJD A;  2TSS A;  3TEX A;  1YQ3 B;  2YEP F;  5E6J A;  2GB1 A;  2WXI A;  3VRB B;  2IJ0 A;  2ZW0 A;  3P4Q B;  3O13 A;  4NAM A;  4C80 A;  1IGC A;  3EA6 A;  3IXS A;  3AEB B;  4P6V F;  1K52 A;  1TJE A;  2K5P A;  1EM7 A;  2KN4 A;  1ROE A;  5JXV A;  4L2Y A;  1J7C A;  1ZXI A;  1L5P A;  4IKG A;  2JX5 A;  2W55 A;  3SFD B;  2I2Y A;  1N61 A;  2DWQ A;  2K22 A;  4L23 A;  1I4X A;  3FIL B;  3Q8F A;  1VZ7 A;  3I57 A;  1DGJ A;  3W1S A;  3FIL A;  4J3O D;  2SAK A;  4A8X C;  1N62 A;  1WSP A;  4MM3 B;  4ZHP A;  4JX1 C;  5HG2 A;  3U4E G;  1ZUD 2;  2ON8 A;  2PKO A;  1D5X C;  3IAS 1;  4RCO A;  5LNK 1;  2L52 A;  1SJH D;  1C4C A;  2W3S A;  3Q8C A;  1FRD A;  1E0Z A;  3LYY A;  3EUB 2;  2XN9 C;  4YXD B;  4M0W A;  4ZRQ A;  3DWM A;  3VR8 B;  1AW7 A;  1BUI C;  2JYT A;  2QIE B;  4RGO S;  2K0P A;  2HDE A;  2ZW1 A;  2I38 A;  4GDL B;  1L4D B;  2MEK A;  3TEW A;  4YTN B;  3MC0 B;  2IGD A;  3Q8B A;  4EE2 A;  3H8H A;  2WS3 B;  4KGR A;  2WDV B;  3AEC B;  5EE9 A;  3AEG B;  1NEK B;  5TSS A;  2QSD A;  3NVY A;  2G9H D;  3IT4 B;  3R2T A;  2L1A A;  4WAF A;  4A90 A;  4OW0 A;  1PDX A;  5EE3 A;  3TEZ A;  2CU3 A;  1ACC A;  4PT5 A;  1KH0 A;  1EU4 A;  1JWB D;  1QOF A;  2W3R A;  1SF0 A;  3MP9 A;  4OZC A;  1MPE A;  3AH7 A;  3C8Y A;  5C3J B;  3CWI A;  1QOG A;  1PUT A;  4JWU C;  2NTS A;  2X38 A;  2CJO A;  2RPV A;  1FO4 A;  1D5M C;  2J52 A;  2BS4 B;  3P63 A;  1RYJ A;  1SSN A;  2DLB A;  3AE8 B;  2EEL A;  1EU3 A;  3ZGZ A;  1QQR A;  4NJC A;  2MH7 A;  4NZL B;  1NYR A;  2K9X A;  2KAC A;  3EGR A;  3KQ4 A;  1QF6 A;  1GB4 A;  3NVZ A;  2WXM A;  2W54 A;  1YQ4 B;  2H88 B;  1PFD A;  3BYY B;  4ZRP A;  5C2T B;  4A55 A;  2ONQ A;  1L0V B;  1UGJ A;  2QMT A;  3BVZ A;  3V3X A;  4HJG E;  3IAM 1;  1SIJ A;  1TS5 A;  3L4P A;  4US9 A;  4ZOH C;  1YJJ A;  1MI0 A;  1TS2 A;  1YJI A;  3AB5 A;  1KLU D;  4N58 A;  4ARI A;  1SBB B;  2WXJ A;  1OFF A;  5I4D A;  1FM0 D;  3B2G A;  1Y56 A;  2J53 A;  1GPX A;  4C7Z A;  4AQ7 A;  4OHJ A;  3E56 A;  3PO0 A;  5HHD G;  1RWS A;  3GP7 A;  1LO5 D;  1ZDV A;  2VZK D;  3I9V 1;  4HEA 1;  3AE2 B;  1QKZ A;  2N9K A;  4YWG G;  1JQ4 A;  1JWS D;  2M19 A;  3PZ8 A;  2IGH A;  4UDU C;  3AE1 B;  2WLB A;  1WWT A;  1V1O A;  4WH4 A;  1WGK A;  1P7E A;  4ZYS A;  1FIQ A;  1XEE A;  3NVV A;  1NI3 A;  3VQI A;  4YTM B;  4JE3 B;  2WDR B;  4RNA A;  1B1Z A;  1M4V A;  2WXK A;  2MJ3 A;  3BZD B;  1ZOY B;  3KLS X;  4YSZ B;  4NAW B;  2BB6 A;  4XDD A;  1D4B A;  1JRP A;  1I4G A;  1CK1 A;  2CJN A;  1FD6 A;  1JWU D;  1PYW D;  1E10 A;  1L6U A;  1Q10 A;  1KRH A;  4C7Y A;  4TQ1 A;  1UUP A;  1EWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...