3PO0A

Crystal structure of samp1 from haloferax volcanii
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
89
structure length
89
Chain Sequence
GSMEWKLFADLAEVAGSRTVRVDVDGDATVGDALDALVGAHPALESRVFGDDGELYDHINVLRNGEAAALGEATAAGDELALFPPVSGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of ubiquitin-like small archaeal modifier protein 1 (SAMP1) from Haloferax volcanii.
pubmed doi rcsb
source organism Haloferax volcanii
molecule tags Protein binding
molecule keywords Small archaeal modifier protein 1
total genus 23
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3po0A00
4WQMA 1YQ4B 3VRAB 3LXFA 1QOBA 1XLOA 2PKOA 2WDQB 1FFVA 3B2GA 1OQRA 3P1MA 1PFDA 1ROEA 2OHFA 1RWSA 1VDVA 1RYJA 3AE1B 5H92C 1N60A 2LEKA 1SF0A 1JALA 3PO0A 4P6VF 1E9MA 3AEAB 1AYFA 3RPFC 3CWIA 4YXDB 2N0SB 2WDRB 3SFDB 2H89B 1B9RA 4YT0B 1VLBA 1E6EB 1XLNA 1JROA 1AWDA 1KF6B 1L6UA 2JX5A 3B2FA 3L4PA 4C7YA 3AB5A 5MPOA 3W5UB 2DBYA 4YSZB 1J7BA 4USAA 4JWSC 1TYGB 1PUTA 2WP9B 2BS4B 1L5PA 2WS3B 2MJDA 2E3TA 1J7AA 2MJEA 1JWBD 2W55A 1XLPA 2BS2B 2QIEB 1I7HA 2L52A 2WU5B 5C3JB 1SB3C 1WWTA 3AEDB 3AE5B 1ZP0B 1FRRA 5C2TB 4ZHOA 4N58A 4YSYB 5EE3A 1CJEA 1QT9A 1FMAD 2W3RA 4US8A 3HRDD 3CIRB 1DOXA 2ACZB 1EWYC 1N5XA 2M56B 3AE9B 1GAQB 1KFYB 1PDXA 1QLBB 2CJNA 2G1EA 1ZXIA 3AN1A 3B9JA 3VR9B 3NRZA 3KWLA 4WWMA 1ZOYB 1YQ3B 4YTNB 5G5GA 1OQQA 1GPXA 1VJKA 4JX1C 2M19A 1FXIA 1QOGA 1FO4A 4YTPB 1IUEA 1NENB 2H88B 2DWQA 3AEGB 1NEKB 1FM0D 2MJ3A 1T3QA 3AE8B 4JWUC 2AX5A 1RM6C 5EE0A 1FRDA 1E10A 1WXQA 2BS3B 1WYGA 3NVWA 2L83A 1N62A 2MH7A 3AE3B 1V8CA 2QJLA 4FXCA 3AEEB 3AV8A 2PVGC 3HUIA 1JQ4A 1L0VB 3WCQA 3AEFB 1UWMA 2JQRB 5AUIA 2W3SA 1CZPA 3ZYYX 1N5WA 1DOYA 2Q5WD 3DWGC 1JWAD 3AM9A 2K9XA 1XO3A 4YSXB 5EE1A 3AE4B 1J7CA 1FFUA 1TJEA 1F0ZA 1JRPA 4HROA 1FIQA 4C80A 2FBWB 3AE6B 3P4SB 3BIID 4HRSA 1R7SA 1TKYA 2KAJA 1L6VA 1QOAA 2B76B 2KMMA 1YJIA 4IDIA 4ZHPA 1E0ZA 3NVZA 2K22A 1TKGA 3AE7B 3ABVB 4N59A 3NVYA 3AECB 3AMZA 2PVOD 3VRBB 2CU3A 2Y5CA 3EUB2 2BT6A 2CJOA 2W54A 4A9AA 3AH7A 3SFEB 5H8YE 2K5PA 1WRIA 1E7PB 1ZUD2 3AEBB 5AUKA 1JW9D 2WDVB 4ZOHC 3DWMA 1QF6A 1N61A 1SIJA 1TKEA 1XLQA 2WQYB 3HVZA 2WU2B 4KX6B 1NYQA 2EKIA 3FAHA 1DGJA 2HTME 1RFKA 3W9CB 3ETRA 1OFFA 4C7ZA 1A70A 1YJJA 5EE9A 3VR8B 3P4RB 3AE2B 1N63A 1NVID 1FXAA 1QOFA 3FC4A 3P4QB 5G5HA 3W5VB 4ITKA 1DOIA 1V97A 2PIAA 3SR6A 1NYRA 3P4PB 4YTMB 1NI3A 4N6EB 1KRHA 2WLBA 5GXGB 3P63A 4US9A 3LB8C 1WGKA 3NS1A 3NVVA 4LTUA
chains in the Genus database with same CATH superfamily
1YIWA 1XLOA 4J6IA 4M02A 2RPQA 4B0EA 2ZVNA 4GXBA 5DPRA 1D4BA 4P6VF 4OVUA 1XLNA 1L6UA 2DYMA 3AB5A 3UGBB 4P1CC 1MI0A 1LQBA 2RMMA 1L5PA 1XD3B 2W55A 2DHZA 2L52A 3A9KA 2WDTB 3L16A 2IO1B 5C2TB 2M0AA 2WXIA 3QJZA 4E74A 2DZIA 1PYWD 5JZEB 1SE2A 1WJ4A 3DQVA 1TS5A 2BGFA 1F1HA 2V0GA 3AEGB 3L0WB 4NJCA 1WGGA 2BS3B 1WYGA 2M0XA 1JMLA 2E6XA 2BQQA 4MJSA 4RGTA 2JQRB 1XCQL 3ZYYX 4WJNA 2CKHB 2QILA 2K8HA 2JSVX 2KFKB 4C00A 3V6EB 1ZE3D 2ZPYA 4B95A 3RNGC 2KTFA 2EMTA 2QEJC 2I1KA 4MSQB 3X23A 4KGRA 3R2TA 4NQKE 1V1PB 1ZGUB 3DVNV 1QF6A 1N61A 4XZ4A 3GS2A 2LD9A 1LGRA 2ZZPB 1TBEA 2HTME 4MGKE 2QCZA 4LLGM 3AE2B 3EFUA 1DOIA 1NYRA 3CMMB 3PPAA 2G9HD 3RULA 4HCPB 3VUWA 4NAMA 2KD0A 1YN4A 1I4PA 1HTQA 2GRIA 2QDFA 3IAM1 2N1WA 3AE1B 2JY6A 1JALA 1MHXA 2KJRA 3L13A 1E9MA 1AYFA 4M8NA 4M01A 1B9RA 4JPSA 2IGDA 1S1QB 3DBHB 3APFA 5BMIA 2IO3B 3Q3NC 4FADA 2MX2A 4BKGA 3PTFC 2BS4B 2B3AA 3N32A 2RPVA 4JGHB 4KVGB 4TV3A 4N58A 3M62B 1QT9A 1FMAD 3Q8AA 4G0NB 4US8A 1DOXA 1ZXIA 3RYTA 4WWMA 4KSKC 2MBHA 3QX1A 3KLSX 4HKZE 4MM3A 4MSMB 4GN1A 4YTPB 3IT6B 3D32A 3JW0X 1KLUD 3NUHB 2JYTA 4S17A 4PS8A 4ZRJA 3PVLA 2JRHA 5JH5C 5IKCM 1UELA 3AM9A 2D07B 2MW5A 1WH3A 3PS6A 4II2B 3AE6B 3ML9A 2FCQA 1BXTA 2XEWA 4I6NB 1QOAA 4ZHPA 1J8CA 5BMGA 4X57B 2LMCA 2LUMA 5AZFA 1RLFA 1ZUD2 2R61A 1F77A 2KDMA 3HIZA 2WQYB 4KGSA 3FAHA 4C7ZA 1WF9A 1SIFA 1OFFA 4EUTA 3MJ5A 3TSSA 1WE7A 4GOCA 3LB8C 3NS1A 4G3XB 2MBBB 1MFWA 4W9EA 2DX5B 3P1MA 1PFDA 2NPTA 2L8JA 3PZ7A 3L10B 2OEDA 1HE8A 2IGGA 2LZ6A 1P3QU 1C4PA 5L95C 5MPOA 1IBXA 3VTWA 4JWSC 2AYOB 1HEZE 1KLVA 5D94A 2E3TA 2MJEA 4REZA 2K25A 2INDC 2V9HA 4M00A 4GLSC 2D3CA 2O6VA 2I2YA 1E8XA 2WXQA 1EWYC 3BYYB 1T0QC 2D5GA 1WXAA 2DAJA 1ZOYB 3GZNB 4LDTD 2K0PA 1GPXA 2LASA 2M19A 2MBEA 3ZJVA 2L0TA 2XN9C 2ASQA 1WXQA 2N7DA 3GB1A 1E8ZA 3AV8A 2NBWB 2PPHA 3FKYA 3RZFA 3GZNI 3OJ3A 1F0ZA 5LXIB 2VRRB 2G3QB 3WA0A 1JRUA 3ZIMA 2ZNVC 1L6VA 1WR6E 1ZXHA 2KC1A 2CU3A 2Y5CA 2V1YA 1Q0WB 2K5PA 5TSSA 1EF1A 1I4GA 4DHZB 1TKEA 1RRBA 1RFKA 4K7UA 3R7QA 3Q14C 4ICVA 2AEHA 1WGYA 2N9PC 3N20C 1WGKA 4MGYE 2BWFA 2NPTB 3A1QA 2M4NA 2WNMA 2BYFA 2N7JA 3IVFA 4HPMB 1UBIA 2ZCCA 2N0SB 4IM0A 3B2FA 4C7YA 3ZNZB 2QMTA 2DBYA 3V6CB 5J17A 1J7BA 2BPSA 2LGXA 4WWNA 1ZP0B 1GB1A 4IWOA 5EE3A 3IT4B 3ZDMC 4OZBA 4HKQA 1I4QA 3DBSA 1MVKA 1T0RC 2Y3AA 4XYCA 3NJTA 2C9WB 4DHJD 2QHOA 1JWUD 1FXIA 3VQIA 1TZ1A 1XXGA 1LO5D 3RNBC 2IO0B 3UINB 3BVMA 3ZNHB 2HDEA 1CQVA 3FILB 2KWUB 3AE3B 4ACFA 2A5UA 2FIDA 1N5WA 3PHWB 4GDLB 1TIFA 4MJSB 1JRPA 3IBEA 4NZLB 2KN4A 4HRSA 5AZHA 4DQOC 2LGDA 4NJ6A 1SJHD 3TEXA 2WXHA 3NOBA 4KSLC 2JWUA 4W9IA 3NVYA 2CJOA 2VZKB 4CHKA 3BVZA 3C19A 3PRMB 3DWMA 2INCC 1VR9A 2PTLA 4XWWA 2LXAA 4IW0A 1ESFA 2C7NB 2GBJA 2EKEC 3P4RB 2V3SA 4AP4C 3H8HA 1TS3A 1CMXB 3U2SC 4KKJA 3NZ3A 4XDCA 1M4VA 5FR3A 1V6EA 2N7EA 4WQMA 4C56C 2DAFA 4EE2A 1C9FA 2WDQB 1ROEA 2OHFA 2NTSA 4IC7B 2KTRA 3CF6E 3DHGC 2KQSA 5DPTA 2TSSA 1WJUA 1FCCC 2O2VB 1V49A 1ZDVA 1BUIC 2KDEB 2JVCA 2WP9B 4NJ7A 1FPYA 4DWFA 4L23A 4ARIA 2KMCA 2PJHA 2LVOA 4YSYB 1WMHB 1WZ0A 2Y5BB 4ZDVA 1IP9A 4BVUC 4RGMA 2K8CA 5E6PA 1K51A 3DHIC 4BZAA 3WALA 3V62A 4C4VA 4MEMA 1J19A 3FILA 4ANXA 2H88B 2KMAA 3V3XA 2MJ3A 2J0KA 3Q8EA 2M17A 2PMVA 3P42A 2QSDA 1WXMA 4FJZA 5JXVA 1CZPA 3BINA 3LDZE 3AE4B 5DPWA 1XF5L 3VXWA 4GMVA 2AQ2B 4CO7A 4FJYA 3BY4B 5FKAC 4A9AA 3GE8C 3K9PB 2IPKD 1WRIA 3AEBB 2BF8B 3TBLD 2CHWA 3SHQA 2MWSB 4AS1A 2WXRA 3ZUNA 3Q3FA 1N63A 1SGHA 3W5VB 2N9KA 1GG3A 3OJ4B 1C78A 3HHMA 2MP2B 2XBBC 4G11A 4J3OD 3ZO5B 4N9F4 1LM8B 3NZUA 2O2VA 5AEKB 1MHHE 3ONSA 1YQBA 4GDLA 3L4PA 3JSVA 3W5UB 2YEPF 2MSED 4S0RA 1FNUA 3W1YA 4ASWC 2GBKA 1E8WA 2IY0B 4Q2JA 2NTTA 4TSSA 3B1LX 4B6WA 1I4HA 4HK2A 3Q69A 1WWTA 1I35A 3WAMA 1CJEA 4TQ0A 2ACZB 4EFOA 1PGXA 2O6VB 1Z2MA 1XCTL 2CU1A 5CX3A 1L0YB 1UF0A 1ET6A 3DBLB 2J0JA 4MDKE 1CK1A 4JWUC 3RUIB 1N62A 3EHVA 3TIXA 1IPGA 3SEBA 5AUIA 3C8YA 2K9XA 1XO3A 2KJHB 4A90A 3U4EG 4A6QA 5CHVC 1D5XC 3N30A 1WX7A 2NBUA 1UGJA 4TQ1A 2WXNA 2KNBA 5G2NA 2K22A 3VVWB 3SFEB 1D5ZC 2N9XA 4HDQA 3A9KB 3KVFB 1JW9D 2L32A 2WDVB 3ALBA 1OEYA 4JL9A 1RFAA 2YVCA 1I4XA 1VCBA 2K8BA 3A9JA 3I63C 3DBLI 2WX1A 4YTMB 1WXVA 3N1ZC 3TCAA 4DXAB 2BTEA 3WANA 2LHEA 1E7VA 2JF5A 1KLGD 2J53A 1RYJA 5H92C 2G45B 4XC2A 3ZNGC 3A1QB 2LGYA 3U7DA 4P1BC 1V81A 3IG3A 3KUZA 4LNKA 3HVDA 4NY0A 2KFKA 2KYWA 3OG5A 1SE3A 4ARCA 1JWBD 1XLPA 3APDA 1WXSA 3N1XC 1YD8U 2V4LA 3AE9B 1GAQB 2ON8A 4KZ0A 2C7MB 4CYEA 3DCGA 1HXYD 4OVVA 4BOSC 1OQQA 4RM8A 4BKSA 1NENB 4GDKA 3A33B 4K7WA 3R66C 3H1UA 1PGBA 5FR6A 2KQ4X 1E10A 1LFDA 1V8CA 1QZEA 3HUIA 3WCQA 1M94A 2D3BA 4W9CA 1DOYA 2Q5WD 4W9GA 2FCMA 3VH4B 2J52A 2FCSA 4ZRKA 3BIID 1SJED 1WX9A 3MHSD 3TMPB 2LVPA 3PSEB 2WXJA 2REXA 2K1FA 4ZOHC 4WJOA 4IWQA 1K52A 2PLPA 3R8BA 4MGZE 4LDTB 3QC8B 1UH6A 2ONQA 3P4QB 1NI3A 5GXGB 2FE8A 3B0AA 2MRPA 1T0YA 4HJKA 2LWPA 3UIOB 4A3OA 2KHWB 3AU5A 3IAS1 2LEKA 3E9SA 2HE7A 1A5RA 4HCNB 4YXDB 1KOTA 3HM6X 1WM3A 4WIPA 5EDSA 1R4MB 1VZ6A 2JUOA 4USAA 2JZ3B 1L4ZB 3M63B 3H9DA 1SB3C 4W9HA 4DXGA 3T3NA 2GBRA 2KKCA 3R3MA 3AN1A 5KHQA 3B9JA 2RD0A 2XNAC 4KZCA 4LNNA 1VJKA 4LNIA 2J0MA 3APCA 3NHEB 2WXFA 2R2QA 4LNOA 2KWCA 2ICIA 3AE8B 4BAXA 5LLIA 5EE0A 2X38A 2OOBB 1UZXB 2PVGC 4RM9A 2K6QA 4LCDE 4URKA 3DBRB 2PE6B 3I57A 2MA9B 2RR9A 3KYDD 4B0MA 3PZ8A 4BKTA 4YSXB 1TJEA 2FUHB 5HFYA 1FIQA 4JQWC 4FHKA 4IM3A 2LJ5A 2KN5A 3O13A 3P4SB 2N1VA 4ANUA 4RMAA 1TKYA 4LJPB 3ZJTA 4JLCA 1E0ZA 4PS3A 2V4IB 1WM2A 1Q1OA 2KTRB 2PVOD 3JVZX 2W54A 4DXFA 1V80A 3AH7A 4A3PA 1OTRB 4P7IA 1IGCA 1GNUA 1SIJA 1WR1A 2WU2B 1NYQA 5J18A 3MJWA 2IGHA 5BYQA 2N9LA 1C3TA 4XDDA 5D7GA 2PIAA 1H4RA 2V3NA 2W82A 2MBQA 4DHJB 3TUOA 3BYTB 2FIFA 3OLMD 3JYUA 4RGOS 3LXFA 2L1AA 2LFIA 3CSTA 4MT5A 1QKZA 3CSFA 3OAWA 2KVRA 2K6DB 4GIVA 2J42A 3BWUD 3ZTCA 1C76A 5IA7A 3I9V1 2HJ1A 2KWVB 2WGSA 2D3AA 2DZKA 4KIKB 3KUDB 2GB1A 1PGAA 1MG4A 4E3CA 4KDLB 1MPEA 3HRDD 1N5XA 4IG7B 1PDXA 1QLBB 2G1EA 3H6NA 3VR9B 1WY8A 3QAQA 2CHZA 1EM7A 2KT7A 3VH3B 4JX1C 5E6OA 1QQRA 4MGIE 1FM0D 1JWSD 3VTUA 3LJ3A 4WWPA 3MC0B 4H2AA 4XGAB 3PT2B 2KOXA 4WAFA 2KDBA 4D2KA 1D5MC 4RGNA 5EE1A 4F7ZA 2GMIC 1GC7A 3QK0A 2HTHA 4NAWB 2XK5A 4FJVB 2KAJA 2IZVB 4N59A 3ABVB 4WURA 3KYCD 2JXTA 3Q6BA 3AULA 1E90A 4II3B 3HVZA 2MLBA 1P1AA 2KANA 1DGJA 3H7SA 3DVGY 3GP7A 5G5HA 4YL8A 3PGEA 5IOIA 1J0GA 4OHJA 1D3ZA 1TY0A 3NVVA 4EOYA 3VRAB 2SEBD 2BB6A 1FEHA 4RNAA 4WH4A 3MTNB 2NS5A 2WX0A 3W2DA 5HKHA 3QA8A 2WDRB 1AWDA 2CHXA 1P9DU 4IKGA 3KW5B 3VDZA 1TYGB 1ZW7A 2WS3B 3MP9A 3NS8A 1BMLC 1WGRA 2Y5PA 3ZGZA 2WU5B 2Z0EB 1GJZA 3MFGA 1V9JA 5DPSA 3FC4A 2M56B 4AWJA 4JE3B 2C5LC 2AQ1B 3NRZA 1SSNA 2BVCA 3ENEA 3T8MA 4WWOA 2D3GA 3RI7C 2Z0DB 4W9FA 5I4DA 3QHTA 3N9YC 4FXCA 2D11A 4WJPA 1G6JA 3VUXA 3TJPA 2MBOA 1UUPA 3RMKC 3RNAC 1XT9B 3A4RA 2G4SA 2ZJDA 5FK9C 3J9CA 4HWIB 2PW9A 1J7CA 3MC8A 2NCNA 2EELA 4PS7A 1SE4A 2VH2A 1WRDB 4OVZA 4IDIA 2B76B 4FN2A 2KX3A 2LVQA 5IN7A 3VAWA 2JU6X 4DK5A 3DBRI 1WMHA 3QARA 4EZKA 4R3DA 2RDGA 4FLHA 4CQNA 3ZDTA 2PEAA 1KM7A 1R4MI 2KJ6A 2MQJA 1ZKHA 2FAZA 1N6ZA 4LK0M 1C4CA 4LTUA 1VDVA 2ZW1A 1R4NB 3U30A 1IGDA 1IYFA 3DDCB 1XEEA 4FULA 1E6EB 1JROA 3SU8X 2WXMA 1HTOA 4OZAA 4IWPA 1V86A 4K81A 3RNFC 1FNVA 2RSUA 1I7HA 2BYTA 2L05A 1F2RC 2DENB 5IO9A 1JWMD 1MJDA 2L3ZA 1YNTE 1Q10A 4ICUA 2D10A 2D2QA 1D6EC 4F1SA 3DVGX 2LJIA 3PLVA 3KWLA 1EWCA 3U52E 2KWDA 3TEZA 3A4SC 5BYRA 1ACCA 1ZDXA 4K3CA 3X0WA 1TGZB 3VTVA 1S3SG 4L1BA 4EZLA 5L83A 3EGRA 1WJ6A 3AEEB 1E7UA 4C4VB 4B9KA 2W3SA 3RCZA 1WJNA 4YWGG 3K9OB 1TS4A 2YLMA 3SDLC 1R4NI 2KFJA 3T3OA 2KDFB 1YX5B 1EF5A 2J7QB 1P7EA 4KKIA 5CTRC 5D3IB 4IUMB 2GBMA 3QIJA 5BMHA 5E6NA 4WJQA 2K39A 3EUB2 3ZVVA 1K50A 1T5XD 4WAAA 2BKRB 1E7PB 4A8XC 2MP2A 1T6BX 1U4AA 5HHDG 2X8XX 3ZRFA 3WAPA 1P0RA 4XWTA 1V1PA 1KTKA 2ZVOA 2L76A 2I38A 2N9EB 4K7SA 2WLBA 2YEPB 2CR5A 3P63A 1T0SC 4FA6A 2WHIA 3BK2A 4XX5A 1AW7A 2IY1B 3NG0A 1FFVA 1KH0A 1XQQA 3Q8FA 1RWSA 4BFRA 2UYZB 4NNJB 2HD5B 5LNK1 2BYEA 1F2RI 3IXSA 1VLBA 2GBNA 1HQRD 3LYYA 4ZRIA 2L7RA 1F52A 4KGTA 2WWZA 3BZDB 5HG2A 3N1YC 2BS2B 4RFBA 4MM3B 4OW0A 4AQ7A 1X1MA 3NY5A 3DHHC 4AUQC 2L0FA 3ZKJC 2KXJA 2MHJA 5GMVA 1FO4A 2WYQA 3A9JB 3QQ8B 2NMQA 4I6PA 2RDBC 2O6VD 4KDIC 2IO2B 1NEKB 1C77A 2IBIB 1HZ5A 3M3JA 1EUVB 4BBNC 3DWGC 1C1YB 2BWES 1YN3A 1C79A 1V5TA 2MCNB 4M8MA 1YMHE 1ZPSA 2ZEQA 1YX6B 1R7SA 4DBGA 3ZW3A 3PRZA 4RH6A 2Z8LA 2SAKA 4PK1A 3NVZA 3WAOA 1TKGA 3AE7B 2GOWA 3AMZA 1TTNA 3VFKA 1WIAA 3AI5A 3SD5A 4ANVA 1XLQA 2K3UA 4KX6B 4HPPA 2KZRA 2GLSA 3W9CB 2BYVE 4HEA1 4HPLB 1A70A 1YJJA 3VR8B 4EZJA 3S2AA 1FXAA 3ZNID 2M1MA 1V97A 2G4DB 2PE9A 2LRUA 3DPDA 2C60A 2N4FA 3PHXB 3I5JC 2LXCA 4US9A 2KLGA 1GB4A 2LI5A 4TUUA 1QOBA 1OQRA 5JHBA 3RD2A 1N60A 4ZRQA 2BKFA 2R2OA 3EECA 1FXTB 4PYUA 4RCOA 1LXDA 1C4AA 3EFCA 1WGHA 1OGWA 4RF1A 4ANWA 3BK1A 3AU4A 4A55A 4ZHOA 3AE5B 1IBXB 3R7RA 3EC8A 4BKSD 4EEWA 3ZXRA 3CIRB 4XE0A 1E8YA 2CJNA 3L08A 4LJOB 4DDID 4YTNB 2XK5B 2NR2A 2WXKA 3QWZB 1KJTA 3L54A 4ZRPA 2A4ZA 4W9KA 1RM6C 5C1ZA 1YN5A 2QJLA 5BO4B 2AL6A 4OZCA 2FCNA 1WE6A 3I3TB 4RF0A 4G50A 5TR5A 4MH8A 1FFUA 4C80A 2FBWB 3H7PB 1WFYA 1Q5WB 3RN9C 1WSPA 2NVUI 2KMMA 3Q8CA 4HXDA 5AUKA 5C23A 1V2YA 2IDYA 4W9LA 1UWXA 4GB9A 4W9JA 3KQ4A 5IP4D 3P4PB 3OWEB 5IAAC 1BT0A 4IOIE 3Q3JA 3NZSA 2WXOA 1UNSA 3E56A 3U8ZA 1I42A 3PO0A 3AEAB 3RPFC 3CWIA 1MG8A 3SFDB 3URYA 4HJGE 2JZZA 1OQYA 4F8CB 4PYZA 1J7AA 2VH1A 3MC9A 2RGFA 1FRRA 1FNWA 2L00B 1AN8A 2NBVB 2LGSA 1UGMA 3TEYA 1DYQA 1WZ3A 1QOGA 4E71A 2J4XA 3PREA 4M0WB 2IYDB 1L7YA 1T3QA 1GC6A 2AX5A 3IHPC 3UQAA 2HJ8A 3DVNU 2L83A 3NVWA 2MH7A 1JQ4A 1WYWB 3RNEC 2FNJB 4JIOU 1FD6A 2JZPA 4UDUC 3EA6A 2DNFA 2I1JA 2BBCA 2FUG1 2GI9A 1SXTA 1SE9A 4A20A 2DYBA 3L17A 4P16A 3VRBB 4EKUA 5HI1A 5DCNA 5KHOA 2LHDA 2KDIA 2JWZA 2MEKA 1P98A 2UWQA 2JYEA 3V05A 1EO6A 1PQSA 1NVID 2INPE 4HVBA 4ITKA 4AJYB 4GSWA 3KWVA 3DOWA 1NDDA 3RT3B 1P7FA 3Q8BA 4TKNA 4FHJA 1H8CA 3ZXVA 2WXGA 4L2YA 3B2GA 1L4DB 3V60A 3MHZA 1SF0A 4LNFA 3W1SA 4TMAB 4YT0B 2UU7A 3KH0A 2JX5A 1KF6B 1NI2A 4K3BA 1FCLA 4BBNF 1PUTA 2EMSA 3H7PA 3UQBA 3R2IA 2MJDA 3IFWB 2AWTA 5E6JA 3ZTDA 2QIEB 1TT5B 2KX0A 3U7ZA 1WGDA 3AEDB 1TS2A 4IM2A 2W3RA 3UIPB 1OEYJ 1AARA 2JXXA 3M95A 3ZRCA 5G5GA 2KK8A 3GE3C 2KLCA 1RAXA 4GU2A 2DWQA 1F9JA 1QILA 2Z59B 2LGIA 1JCKB 1FRDA 4BOZB 2DLBA 3VUYA 2DZJA 4O1NA 4NAWA 3AEFB 1UWMA 2CS4A 4GGQA 5D6JB 3KUCB 1K53A 5D3DA 2IJ0A 2W9NA 4HROA 5CHFA 2LUEA 2AQ3B 3ZLZA 3TEWA 2ZPNA 1NBFC 3PRPB 5JHAA 3AECB 4GDKB 1YOVB 3AXCA 2BT6A 2WXPA 3WIMA 4NQLB 5AZGA 2V3PA 4ZYSA 1L0XB 4AJWA 2EKIA 4MH0E 4KV2A 3TL5A 2BW2A 2M8SA 1WI0A 4ZYNA 1QOFA 1B1ZA 1ISNA 3SR6A 1Y56A 3O65B 2OJWA 1VRAB 2KO3A 4M0WA 5T8IA 1YQ4B 1WX8A 3C0RB 2PKOA 3V61A 1L2NA 2JRIB 1V5OA 3RZWC 4MACA 3UF8A 2BB5A 2H89B 2JPHA 1GOZA 3ML8A 5CHWA 5D2MB 3HM3A 4YSZB 4WQOB 1ET9A 1TZOA 2QC8A 2KACA 1K8RB 5C3JB 5LXHA 1EU4A 1E5WA 4W9DA 3T9LA 1Y8RC 3BVGA 4DDGD 3RFZB 1Z5SB 2KQ7A 3ECIA 1KFYB 4MELA 4I6LB 2JT4B 1V1OA 5BYSA 1YQ3B 3Q3MC 2WXLA 1SBBB 2DYOA 5J2RA 4PT5A 1IUEA 2C7HA 3Q3OC 2AL3A 1HA5A 1ENFA 2ZCBA 3HK0A 1UBQA 2VZKD 2INNE 3PV1A 3ZJUA 3N3KB 1EU3A 4NPNA 1L0VB 3GOEA 2RDHA 1I4RA 1GUAB 3B08A 4DHZE 1JWAD 3VHTC 1VD2A 3JSVB 2DZMA 2KVZA 1TY2A 4FBJB 3P2BA 4QAYA 1VZ8A 1YJIA 2LRWA 4HDOA 1HZ6A 1YJ1A 2OJRA 5H8YE 1UD7A 3UI3A 5G55A 1SEBD 2KC2A 4HLEA 3QCAA 3RNCC 3ETRA 5EE9A 4K1RB 3PZDA 2ZNVB 1VZ7A 4KIKA 3Q2AC 3DBHI 4AOFA 4N6EB 1KRHA 1STEA 3W1SC 3ZQ4A 2ZW0A 3PLUA
chains in the Genus database with same CATH topology
1GB4A 4WQMA 3LXFA 4C56C 1QOBA 1XLOA 2L1AA 4EE2A 1C9FA 2WDQB 1OQRA 1ROEA 2LFIA 2OHFA 2NTSA 4MT5A 1N60A 1QKZA 4ZRQA 4B0EA 1D4BA 4P6VF 1XLNA 1L6UA 2DYMA 3AB5A 2TSSA 4RCOA 2J42A 1C4AA 1FCCC 1MI0A 1ZDVA 3BWUD 1BUIC 1C76A 2WP9B 2RMMA 1L5PA 3I9V1 4L23A 4ARIA 2W55A 4RF1A 2L52A 3BK1A 4A55A 4ZHOA 3AE5B 2GB1A 5C2TB 1PGAA 2M0AA 4YSYB 2WXIA 1IBXB 1PYWD 1MPEA 3CIRB 3HRDD 1N5XA 4XE0A 1PDXA 1QLBB 2G1EA 2CJNA 3VR9B 4RGMA 1SE2A 1EM7A 4YTNB 1K51A 4JX1C 1TS5A 2WXKA 1QQRA 3FILA 2V0GA 2H88B 3AEGB 3V3XA 1FM0D 2MJ3A 4ZRPA 3Q8EA 4NJCA 1JWSD 1RM6C 2BS3B 1WYGA 2PMVA 3MC0B 1YN5A 2QJLA 3P42A 1JMLA 2E6XA 2QSDA 4OZCA 4RGTA 4H2AA 2JQRB 5JXVA 4RF0A 1XCQL 1CZPA 4WAFA 3ZYYX 4D2KA 2QILA 1D5MC 4RGNA 5EE1A 3AE4B 4MH8A 1FFUA 2JSVX 1XF5L 4C80A 2FBWB 1ZE3D 2AQ2B 4NAWB 1WSPA 2KAJA 2KMMA 2QEJC 4N59A 3ABVB 4WURA 3Q8CA 4KGRA 2JXTA 5FKAC 3R2TA 4A9AA 1V1PB 2IPKD 1WRIA 3AEBB 5AUKA 1QF6A 1N61A 3HVZA 3GS2A 4AS1A 1DGJA 2HTME 2IDYA 1UWXA 2WXRA 3GP7A 4LLGM 3AE2B 1N63A 3KQ4A 3W5VB 5G5HA 2N9KA 1DOIA 1C78A 1NYRA 3P4PB 3OWEB 4OHJA 2G9HD 1TY0A 4J3OD 4IOIE 4NAMA 3NVVA 1YN4A 1I4PA 2SEBD 2BB6A 2GRIA 3VRAB 1FEHA 4RNAA 4WH4A 3IAM1 3AE1B 2WXOA 1UNSA 3E56A 3W2DA 1JALA 1MHXA 3PO0A 1E9MA 3AEAB 1AYFA 3RPFC 3CWIA 2WDRB 3SFDB 1B9RA 4JPSA 3URYA 4HJGE 2IGDA 1AWDA 1MHHE 3L4PA 3W5UB 2YEPF 5BMIA 4IKGA 1FNUA 1TYGB 2BS4B 4Q2JA 2NTTA 2WS3B 4TSSA 3MP9A 1J7AA 1BMLC 2Y5PA 2RPVA 3ZGZA 1I4HA 2WU5B 3Q69A 1WWTA 1FRRA 3MFGA 1FNWA 4N58A 1AN8A 1CJEA 1QT9A 1FMAD 3Q8AA 4TQ0A 4US8A 1DOXA 2ACZB 3FC4A 2M56B 1ZXIA 4JE3B 3TEYA 1PGXA 1DYQA 2AQ1B 3NRZA 4WWMA 1SSNA 3KLSX 1QOGA 4HKZE 1XCTL 2J4XA 4YTPB 3IT6B 1L0YB 1ET6A 1KLUD 1T3QA 1CK1A 4JWUC 3NUHB 2AX5A 2JYTA 5I4DA 3NVWA 2L83A 1N62A 2MH7A 3N9YC 4FXCA 1JQ4A 3SEBA 1UUPA 5AUIA 3C8YA 3AM9A 5FK9C 2K9XA 3J9CA 1FD6A 1XO3A 2PW9A 1J7CA 2JZPA 4UDUC 4A90A 3EA6A 3U4EG 4A6QA 1D5XC 2EELA 2BBCA 3AE6B 1BXTA 2FUG1 1SE4A 2GI9A 1UGJA 4OVZA 4TQ1A 1QOAA 1SXTA 2B76B 2WXNA 4IDIA 4ZHPA 5BMGA 4P16A 2K22A 2LMCA 2LUMA 3VRBB 3SFEB 1D5ZC 1ZUD2 5HI1A 1JW9D 2L32A 2R61A 2LHDA 1F77A 2JU6X 2WDVB 2KDMA 2MEKA 2WQYB 4KGSA 3FAHA 4C7ZA 1I4XA 4R3DA 1OFFA 2JYEA 2RDGA 3V05A 1NVID 2INPE 4CQNA 4ITKA 3KWVA 3MJ5A 3TSSA 4YTMB 1P7FA 3Q8BA 2BTEA 3LB8C 2LHEA 3NS1A 4LK0M 1C4CA 4LTUA 2WXGA 4L2YA 1KLGD 3B2GA 1L4DB 3P1MA 1PFDA 2J53A 1VDVA 3MHZA 1RYJA 2ZW1A 5H92C 1SF0A 3W1SA 3PZ7A 4TMAB 1IGDA 4YT0B 1XEEA 1E6EB 2JX5A 1JROA 1KF6B 2OEDA 2IGGA 1C4PA 5MPOA 3HVDA 1IBXA 1FCLA 4JWSC 2WXMA 1PUTA 4OZAA 1SE3A 1HEZE 3R2IA 4ARCA 2MJDA 2E3TA 2MJEA 1JWBD 4REZA 1XLPA 5E6JA 1FNVA 2QIEB 1I7HA 2BYTA 1F2RC 4GLSC 3U7ZA 3AEDB 1JWMD 1TS2A 1YNTE 2I2YA 1Q10A 2W3RA 2WXQA 1D6EC 1EWYC 3AE9B 3BYYB 1GAQB 2D5GA 2LJIA 2ON8A 3KWLA 1ZOYB 1HXYD 1EWCA 5G5GA 1OQQA 2KWDA 2K0PA 3U52E 3TEZA 1GPXA 2M19A 5BYRA 3ZJVA 1NENB 2DWQA 1ACCA 1ZDXA 1PGBA 2XN9C 1QILA 2LGIA 2KQ4X 1JCKB 1FRDA 1E10A 1WXQA 2DLBA 4L1BA 1V8CA 3GB1A 3EGRA 3AEEB 3AV8A 3HUIA 4O1NA 3WCQA 3AEFB 1UWMA 2W3SA 1DOYA 1K53A 2Q5WD 5D3DA 4YWGG 2IJ0A 1TS4A 1F0ZA 4HROA 2J52A 3T3OA 3BIID 1SJED 1P7EA 4KKIA 5D3IB 1L6VA 2AQ3B 5BMHA 3TEWA 1ZXHA 3AECB 4GDKB 2CU3A 2Y5CA 2WXJA 2BT6A 2WXPA 3EUB2 1K50A 1T5XD 2K5PA 1E7PB 4A8XC 5TSSA 2V3PA 4ZOHC 1I4GA 1T6BX 1K52A 2PLPA 4ZYSA 1TKEA 3R8BA 1L0XB 2EKIA 5HHDG 1RFKA 2BW2A 2ONQA 3P4QB 1QOFA 4XWTA 1V1PA 1B1ZA 3SR6A 1KTKA 1Y56A 2I38A 1NI3A 1VRAB 2WLBA 5GXGB 4M0WA 2FE8A 2YEPB 3P63A 1WGKA 3BK2A 5T8IA 1AW7A 1YQ4B 2PKOA 2WNMA 1FFVA 1KH0A 3Q8FA 2N7JA 1RWSA 3IAS1 2LEKA 3E9SA 4MACA 5LNK1 2BB5A 1F2RI 4YXDB 2N0SB 3IXSA 2H89B 1VLBA 3B2FA 1GOZA 4WIPA 4C7YA 1HQRD 2QMTA 3LYYA 2DBYA 1VZ6A 4YSZB 1J7BA 4KGTA 4USAA 1ET9A 3BZDB 1L4ZB 5HG2A 1TZOA 2KACA 2BS2B 4RFBA 5C3JB 4MM3B 1EU4A 1SB3C 4OW0A 4AQ7A 1ZP0B 1GB1A 5EE3A 3BVGA 3IT4B 4DXGA 3RFZB 3T3NA 4OZBA 4HKQA 1I4QA 1KFYB 3AN1A 1MVKA 2Y3AA 3B9JA 1V1OA 2XNAC 5BYSA 1YQ3B 2WXLA 1SBBB 1VJKA 2DYOA 1JWUD 1FXIA 1FO4A 3VQIA 1XXGA 1LO5D 2WXFA 4PT5A 1IUEA 2NMQA 1HA5A 1ENFA 1NEKB 3BVMA 1C77A 2ICIA 2HDEA 3AE8B 2VZKD 5EE0A 2X38A 1CQVA 1HZ5A 2INNE 3FILB 3AE3B 3ZJUA 1EU3A 2PVGC 1L0VB 2RDHA 1I4RA 3I57A 4B0MA 1N5WA 3PZ8A 3DWGC 1JWAD 4GDLB 1YN3A 4YSXB 1C79A 1TJEA 1JRPA 5HFYA 1FIQA 4NZLB 1TY2A 1YMHE 3O13A 3P4SB 1ZPSA 2KN4A 4HRSA 4DQOC 1R7SA 1TKYA 1VZ8A 1SJHD 3TEXA 3ZJTA 2WXHA 4RH6A 1E0ZA 1YJIA 2Z8LA 2SAKA 3NVZA 1HZ6A 1TKGA 2V4IB 2JWUA 3AE7B 3NVYA 3AMZA 2PVOD 2CJOA 2VZKB 2W54A 4DXFA 3AH7A 5H8YE 3BVZA 3UI3A 1IGCA 3DWMA 1SEBD 1SIJA 1VR9A 1XLQA 2K3UA 2PTLA 4XWWA 2WU2B 4KX6B 1NYQA 1ESFA 3W9CB 2IGHA 3ETRA 4HEA1 5BYQA 1A70A 1YJJA 5EE9A 2N9LA 3VR8B 3P4RB 4XDDA 1FXAA 5D7GA 3H8HA 1VZ7A 1V97A 2PIAA 1TS3A 3U2SC 2V3NA 2W82A 4KKJA 4N6EB 3NZ3A 1KRHA 1STEA 4XDCA 3TUOA 1M4VA 3BYTB 4US9A 5FR3A 3ZQ4A 2ZW0A 4RGOS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WQM A;  1YQ4 B;  3VRA B;  3LXF A;  1QOB A;  1XLO A;  2PKO A;  2WDQ B;  1FFV A;  3B2G A;  1OQR A;  3P1M A;  1PFD A;  1ROE A;  2OHF A;  1RWS A;  1VDV A;  1RYJ A;  3AE1 B;  5H92 C;  1N60 A;  2LEK A;  1SF0 A;  1JAL A;  3PO0 A;  4P6V F;  1E9M A;  3AEA B;  1AYF A;  3RPF C;  3CWI A;  4YXD B;  2N0S B;  2WDR B;  3SFD B;  2H89 B;  1B9R A;  4YT0 B;  1VLB A;  1E6E B;  1XLN A;  1JRO A;  1AWD A;  1KF6 B;  1L6U A;  2JX5 A;  3B2F A;  3L4P A;  4C7Y A;  3AB5 A;  5MPO A;  3W5U B;  2DBY A;  4YSZ B;  1J7B A;  4USA A;  4JWS C;  1TYG B;  1PUT A;  2WP9 B;  2BS4 B;  1L5P A;  2WS3 B;  2MJD A;  2E3T A;  1J7A A;  2MJE A;  1JWB D;  2W55 A;  1XLP A;  2BS2 B;  2QIE B;  1I7H A;  2L52 A;  2WU5 B;  5C3J B;  1SB3 C;  1WWT A;  3AED B;  3AE5 B;  1ZP0 B;  1FRR A;  5C2T B;  4ZHO A;  4N58 A;  4YSY B;  5EE3 A;  1CJE A;  1QT9 A;  1FMA D;  2W3R A;  4US8 A;  3HRD D;  3CIR B;  1DOX A;  2ACZ B;  1EWY C;  1N5X A;  2M56 B;  3AE9 B;  1GAQ B;  1KFY B;  1PDX A;  1QLB B;  2CJN A;  2G1E A;  1ZXI A;  3AN1 A;  3B9J A;  3VR9 B;  3NRZ A;  3KWL A;  4WWM A;  1ZOY B;  1YQ3 B;  4YTN B;  5G5G A;  1OQQ A;  1GPX A;  1VJK A;  4JX1 C;  2M19 A;  1FXI A;  1QOG A;  1FO4 A;  4YTP B;  1IUE A;  1NEN B;  2H88 B;  2DWQ A;  3AEG B;  1NEK B;  1FM0 D;  2MJ3 A;  1T3Q A;  3AE8 B;  4JWU C;  2AX5 A;  1RM6 C;  5EE0 A;  1FRD A;  1E10 A;  1WXQ A;  2BS3 B;  1WYG A;  3NVW A;  2L83 A;  1N62 A;  2MH7 A;  3AE3 B;  1V8C A;  2QJL A;  4FXC A;  3AEE B;  3AV8 A;  2PVG C;  3HUI A;  1JQ4 A;  1L0V B;  3WCQ A;  3AEF B;  1UWM A;  2JQR B;  5AUI A;  2W3S A;  1CZP A;  3ZYY X;  1N5W A;  1DOY A;  2Q5W D;  3DWG C;  1JWA D;  3AM9 A;  2K9X A;  1XO3 A;  4YSX B;  5EE1 A;  3AE4 B;  1J7C A;  1FFU A;  1TJE A;  1F0Z A;  1JRP A;  4HRO A;  1FIQ A;  4C80 A;  2FBW B;  3AE6 B;  3P4S B;  3BII D;  4HRS A;  1R7S A;  1TKY A;  2KAJ A;  1L6V A;  1QOA A;  2B76 B;  2KMM A;  1YJI A;  4IDI A;  4ZHP A;  1E0Z A;  3NVZ A;  2K22 A;  1TKG A;  3AE7 B;  3ABV B;  4N59 A;  3NVY A;  3AEC B;  3AMZ A;  2PVO D;  3VRB B;  2CU3 A;  2Y5C A;  3EUB 2;  2BT6 A;  2CJO A;  2W54 A;  4A9A A;  3AH7 A;  3SFE B;  5H8Y E;  2K5P A;  1WRI A;  1E7P B;  1ZUD 2;  3AEB B;  5AUK A;  1JW9 D;  2WDV B;  4ZOH C;  3DWM A;  1QF6 A;  1N61 A;  1SIJ A;  1TKE A;  1XLQ A;  2WQY B;  3HVZ A;  2WU2 B;  4KX6 B;  1NYQ A;  2EKI A;  3FAH A;  1DGJ A;  2HTM E;  1RFK A;  3W9C B;  3ETR A;  1OFF A;  4C7Z A;  1A70 A;  1YJJ A;  5EE9 A;  3VR8 B;  3P4R B;  3AE2 B;  1N63 A;  1NVI D;  1FXA A;  1QOF A;  3FC4 A;  3P4Q B;  5G5H A;  3W5V B;  4ITK A;  1DOI A;  1V97 A;  2PIA A;  3SR6 A;  1NYR A;  3P4P B;  4YTM B;  1NI3 A;  4N6E B;  1KRH A;  2WLB A;  5GXG B;  3P63 A;  4US9 A;  3LB8 C;  1WGK A;  3NS1 A;  3NVV A;  4LTU A; 
#chains in the Genus database with same CATH topology
 1YIW A;  1XLO A;  4J6I A;  4M02 A;  2RPQ A;  4B0E A;  2ZVN A;  4GXB A;  5DPR A;  1D4B A;  4P6V F;  4OVU A;  1XLN A;  1L6U A;  2DYM A;  3AB5 A;  3UGB B;  4P1C C;  1MI0 A;  1LQB A;  2RMM A;  1L5P A;  1XD3 B;  2W55 A;  2DHZ A;  2L52 A;  3A9K A;  2WDT B;  3L16 A;  2IO1 B;  5C2T B;  2M0A A;  2WXI A;  3QJZ A;  4E74 A;  2DZI A;  1PYW D;  5JZE B;  1SE2 A;  1WJ4 A;  3DQV A;  1TS5 A;  2BGF A;  1F1H A;  2V0G A;  3AEG B;  3L0W B;  4NJC A;  1WGG A;  2BS3 B;  1WYG A;  2M0X A;  1JML A;  2E6X A;  2BQQ A;  4MJS A;  4RGT A;  2JQR B;  1XCQ L;  3ZYY X;  4WJN A;  2CKH B;  2QIL A;  2K8H A;  2JSV X;  2KFK B;  4C00 A;  3V6E B;  1ZE3 D;  2ZPY A;  4B95 A;  3RNG C;  2KTF A;  2EMT A;  2QEJ C;  2I1K A;  4MSQ B;  3X23 A;  4KGR A;  3R2T A;  4NQK E;  1V1P B;  1ZGU B;  3DVN V;  1QF6 A;  1N61 A;  4XZ4 A;  3GS2 A;  2LD9 A;  1LGR A;  2ZZP B;  1TBE A;  2HTM E;  4MGK E;  2QCZ A;  4LLG M;  3AE2 B;  3EFU A;  1DOI A;  1NYR A;  3CMM B;  3PPA A;  2G9H D;  3RUL A;  4HCP B;  3VUW A;  4NAM A;  2KD0 A;  1YN4 A;  1I4P A;  1HTQ A;  2GRI A;  2QDF A;  3IAM 1;  2N1W A;  3AE1 B;  2JY6 A;  1JAL A;  1MHX A;  2KJR A;  3L13 A;  1E9M A;  1AYF A;  4M8N A;  4M01 A;  1B9R A;  4JPS A;  2IGD A;  1S1Q B;  3DBH B;  3APF A;  5BMI A;  2IO3 B;  3Q3N C;  4FAD A;  2MX2 A;  4BKG A;  3PTF C;  2BS4 B;  2B3A A;  3N32 A;  2RPV A;  4JGH B;  4KVG B;  4TV3 A;  4N58 A;  3M62 B;  1QT9 A;  1FMA D;  3Q8A A;  4G0N B;  4US8 A;  1DOX A;  1ZXI A;  3RYT A;  4WWM A;  4KSK C;  2MBH A;  3QX1 A;  3KLS X;  4HKZ E;  4MM3 A;  4MSM B;  4GN1 A;  4YTP B;  3IT6 B;  3D32 A;  3JW0 X;  1KLU D;  3NUH B;  2JYT A;  4S17 A;  4PS8 A;  4ZRJ A;  3PVL A;  2JRH A;  5JH5 C;  5IKC M;  1UEL A;  3AM9 A;  2D07 B;  2MW5 A;  1WH3 A;  3PS6 A;  4II2 B;  3AE6 B;  3ML9 A;  2FCQ A;  1BXT A;  2XEW A;  4I6N B;  1QOA A;  4ZHP A;  1J8C A;  5BMG A;  4X57 B;  2LMC A;  2LUM A;  5AZF A;  1RLF A;  1ZUD 2;  2R61 A;  1F77 A;  2KDM A;  3HIZ A;  2WQY B;  4KGS A;  3FAH A;  4C7Z A;  1WF9 A;  1SIF A;  1OFF A;  4EUT A;  3MJ5 A;  3TSS A;  1WE7 A;  4GOC A;  3LB8 C;  3NS1 A;  4G3X B;  2MBB B;  1MFW A;  4W9E A;  2DX5 B;  3P1M A;  1PFD A;  2NPT A;  2L8J A;  3PZ7 A;  3L10 B;  2OED A;  1HE8 A;  2IGG A;  2LZ6 A;  1P3Q U;  1C4P A;  5L95 C;  5MPO A;  1IBX A;  3VTW A;  4JWS C;  2AYO B;  1HEZ E;  1KLV A;  5D94 A;  2E3T A;  2MJE A;  4REZ A;  2K25 A;  2IND C;  2V9H A;  4M00 A;  4GLS C;  2D3C A;  2O6V A;  2I2Y A;  1E8X A;  2WXQ A;  1EWY C;  3BYY B;  1T0Q C;  2D5G A;  1WXA A;  2DAJ A;  1ZOY B;  3GZN B;  4LDT D;  2K0P A;  1GPX A;  2LAS A;  2M19 A;  2MBE A;  3ZJV A;  2L0T A;  2XN9 C;  2ASQ A;  1WXQ A;  2N7D A;  3GB1 A;  1E8Z A;  3AV8 A;  2NBW B;  2PPH A;  3FKY A;  3RZF A;  3GZN I;  3OJ3 A;  1F0Z A;  5LXI B;  2VRR B;  2G3Q B;  3WA0 A;  1JRU A;  3ZIM A;  2ZNV C;  1L6V A;  1WR6 E;  1ZXH A;  2KC1 A;  2CU3 A;  2Y5C A;  2V1Y A;  1Q0W B;  2K5P A;  5TSS A;  1EF1 A;  1I4G A;  4DHZ B;  1TKE A;  1RRB A;  1RFK A;  4K7U A;  3R7Q A;  3Q14 C;  4ICV A;  2AEH A;  1WGY A;  2N9P C;  3N20 C;  1WGK A;  4MGY E;  2BWF A;  2NPT B;  3A1Q A;  2M4N A;  2WNM A;  2BYF A;  2N7J A;  3IVF A;  4HPM B;  1UBI A;  2ZCC A;  2N0S B;  4IM0 A;  3B2F A;  4C7Y A;  3ZNZ B;  2QMT A;  2DBY A;  3V6C B;  5J17 A;  1J7B A;  2BPS A;  2LGX A;  4WWN A;  1ZP0 B;  1GB1 A;  4IWO A;  5EE3 A;  3IT4 B;  3ZDM C;  4OZB A;  4HKQ A;  1I4Q A;  3DBS A;  1MVK A;  1T0R C;  2Y3A A;  4XYC A;  3NJT A;  2C9W B;  4DHJ D;  2QHO A;  1JWU D;  1FXI A;  3VQI A;  1TZ1 A;  1XXG A;  1LO5 D;  3RNB C;  2IO0 B;  3UIN B;  3BVM A;  3ZNH B;  2HDE A;  1CQV A;  3FIL B;  2KWU B;  3AE3 B;  4ACF A;  2A5U A;  2FID A;  1N5W A;  3PHW B;  4GDL B;  1TIF A;  4MJS B;  1JRP A;  3IBE A;  4NZL B;  2KN4 A;  4HRS A;  5AZH A;  4DQO C;  2LGD A;  4NJ6 A;  1SJH D;  3TEX A;  2WXH A;  3NOB A;  4KSL C;  2JWU A;  4W9I A;  3NVY A;  2CJO A;  2VZK B;  4CHK A;  3BVZ A;  3C19 A;  3PRM B;  3DWM A;  2INC C;  1VR9 A;  2PTL A;  4XWW A;  2LXA A;  4IW0 A;  1ESF A;  2C7N B;  2GBJ A;  2EKE C;  3P4R B;  2V3S A;  4AP4 C;  3H8H A;  1TS3 A;  1CMX B;  3U2S C;  4KKJ A;  3NZ3 A;  4XDC A;  1M4V A;  5FR3 A;  1V6E A;  2N7E A;  4WQM A;  4C56 C;  2DAF A;  4EE2 A;  1C9F A;  2WDQ B;  1ROE A;  2OHF A;  2NTS A;  4IC7 B;  2KTR A;  3CF6 E;  3DHG C;  2KQS A;  5DPT A;  2TSS A;  1WJU A;  1FCC C;  2O2V B;  1V49 A;  1ZDV A;  1BUI C;  2KDE B;  2JVC A;  2WP9 B;  4NJ7 A;  1FPY A;  4DWF A;  4L23 A;  4ARI A;  2KMC A;  2PJH A;  2LVO A;  4YSY B;  1WMH B;  1WZ0 A;  2Y5B B;  4ZDV A;  1IP9 A;  4BVU C;  4RGM A;  2K8C A;  5E6P A;  1K51 A;  3DHI C;  4BZA A;  3WAL A;  3V62 A;  4C4V A;  4MEM A;  1J19 A;  3FIL A;  4ANX A;  2H88 B;  2KMA A;  3V3X A;  2MJ3 A;  2J0K A;  3Q8E A;  2M17 A;  2PMV A;  3P42 A;  2QSD A;  1WXM A;  4FJZ A;  5JXV A;  1CZP A;  3BIN A;  3LDZ E;  3AE4 B;  5DPW A;  1XF5 L;  3VXW A;  4GMV A;  2AQ2 B;  4CO7 A;  4FJY A;  3BY4 B;  5FKA C;  4A9A A;  3GE8 C;  3K9P B;  2IPK D;  1WRI A;  3AEB B;  2BF8 B;  3TBL D;  2CHW A;  3SHQ A;  2MWS B;  4AS1 A;  2WXR A;  3ZUN A;  3Q3F A;  1N63 A;  1SGH A;  3W5V B;  2N9K A;  1GG3 A;  3OJ4 B;  1C78 A;  3HHM A;  2MP2 B;  2XBB C;  4G11 A;  4J3O D;  3ZO5 B;  4N9F 4;  1LM8 B;  3NZU A;  2O2V A;  5AEK B;  1MHH E;  3ONS A;  1YQB A;  4GDL A;  3L4P A;  3JSV A;  3W5U B;  2YEP F;  2MSE D;  4S0R A;  1FNU A;  3W1Y A;  4ASW C;  2GBK A;  1E8W A;  2IY0 B;  4Q2J A;  2NTT A;  4TSS A;  3B1L X;  4B6W A;  1I4H A;  4HK2 A;  3Q69 A;  1WWT A;  1I35 A;  3WAM A;  1CJE A;  4TQ0 A;  2ACZ B;  4EFO A;  1PGX A;  2O6V B;  1Z2M A;  1XCT L;  2CU1 A;  5CX3 A;  1L0Y B;  1UF0 A;  1ET6 A;  3DBL B;  2J0J A;  4MDK E;  1CK1 A;  4JWU C;  3RUI B;  1N62 A;  3EHV A;  3TIX A;  1IPG A;  3SEB A;  5AUI A;  3C8Y A;  2K9X A;  1XO3 A;  2KJH B;  4A90 A;  3U4E G;  4A6Q A;  5CHV C;  1D5X C;  3N30 A;  1WX7 A;  2NBU A;  1UGJ A;  4TQ1 A;  2WXN A;  2KNB A;  5G2N A;  2K22 A;  3VVW B;  3SFE B;  1D5Z C;  2N9X A;  4HDQ A;  3A9K B;  3KVF B;  1JW9 D;  2L32 A;  2WDV B;  3ALB A;  1OEY A;  4JL9 A;  1RFA A;  2YVC A;  1I4X A;  1VCB A;  2K8B A;  3A9J A;  3I63 C;  3DBL I;  2WX1 A;  4YTM B;  1WXV A;  3N1Z C;  3TCA A;  4DXA B;  2BTE A;  3WAN A;  2LHE A;  1E7V A;  2JF5 A;  1KLG D;  2J53 A;  1RYJ A;  5H92 C;  2G45 B;  4XC2 A;  3ZNG C;  3A1Q B;  2LGY A;  3U7D A;  4P1B C;  1V81 A;  3IG3 A;  3KUZ A;  4LNK A;  3HVD A;  4NY0 A;  2KFK A;  2KYW A;  3OG5 A;  1SE3 A;  4ARC A;  1JWB D;  1XLP A;  3APD A;  1WXS A;  3N1X C;  1YD8 U;  2V4L A;  3AE9 B;  1GAQ B;  2ON8 A;  4KZ0 A;  2C7M B;  4CYE A;  3DCG A;  1HXY D;  4OVV A;  4BOS C;  1OQQ A;  4RM8 A;  4BKS A;  1NEN B;  4GDK A;  3A33 B;  4K7W A;  3R66 C;  3H1U A;  1PGB A;  5FR6 A;  2KQ4 X;  1E10 A;  1LFD A;  1V8C A;  1QZE A;  3HUI A;  3WCQ A;  1M94 A;  2D3B A;  4W9C A;  1DOY A;  2Q5W D;  4W9G A;  2FCM A;  3VH4 B;  2J52 A;  2FCS A;  4ZRK A;  3BII D;  1SJE D;  1WX9 A;  3MHS D;  3TMP B;  2LVP A;  3PSE B;  2WXJ A;  2REX A;  2K1F A;  4ZOH C;  4WJO A;  4IWQ A;  1K52 A;  2PLP A;  3R8B A;  4MGZ E;  4LDT B;  3QC8 B;  1UH6 A;  2ONQ A;  3P4Q B;  1NI3 A;  5GXG B;  2FE8 A;  3B0A A;  2MRP A;  1T0Y A;  4HJK A;  2LWP A;  3UIO B;  4A3O A;  2KHW B;  3AU5 A;  3IAS 1;  2LEK A;  3E9S A;  2HE7 A;  1A5R A;  4HCN B;  4YXD B;  1KOT A;  3HM6 X;  1WM3 A;  4WIP A;  5EDS A;  1R4M B;  1VZ6 A;  2JUO A;  4USA A;  2JZ3 B;  1L4Z B;  3M63 B;  3H9D A;  1SB3 C;  4W9H A;  4DXG A;  3T3N A;  2GBR A;  2KKC A;  3R3M A;  3AN1 A;  5KHQ A;  3B9J A;  2RD0 A;  2XNA C;  4KZC A;  4LNN A;  1VJK A;  4LNI A;  2J0M A;  3APC A;  3NHE B;  2WXF A;  2R2Q A;  4LNO A;  2KWC A;  2ICI A;  3AE8 B;  4BAX A;  5LLI A;  5EE0 A;  2X38 A;  2OOB B;  1UZX B;  2PVG C;  4RM9 A;  2K6Q A;  4LCD E;  4URK A;  3DBR B;  2PE6 B;  3I57 A;  2MA9 B;  2RR9 A;  3KYD D;  4B0M A;  3PZ8 A;  4BKT A;  4YSX B;  1TJE A;  2FUH B;  5HFY A;  1FIQ A;  4JQW C;  4FHK A;  4IM3 A;  2LJ5 A;  2KN5 A;  3O13 A;  3P4S B;  2N1V A;  4ANU A;  4RMA A;  1TKY A;  4LJP B;  3ZJT A;  4JLC A;  1E0Z A;  4PS3 A;  2V4I B;  1WM2 A;  1Q1O A;  2KTR B;  2PVO D;  3JVZ X;  2W54 A;  4DXF A;  1V80 A;  3AH7 A;  4A3P A;  1OTR B;  4P7I A;  1IGC A;  1GNU A;  1SIJ A;  1WR1 A;  2WU2 B;  1NYQ A;  5J18 A;  3MJW A;  2IGH A;  5BYQ A;  2N9L A;  1C3T A;  4XDD A;  5D7G A;  2PIA A;  1H4R A;  2V3N A;  2W82 A;  2MBQ A;  4DHJ B;  3TUO A;  3BYT B;  2FIF A;  3OLM D;  3JYU A;  4RGO S;  3LXF A;  2L1A A;  2LFI A;  3CST A;  4MT5 A;  1QKZ A;  3CSF A;  3OAW A;  2KVR A;  2K6D B;  4GIV A;  2J42 A;  3BWU D;  3ZTC A;  1C76 A;  5IA7 A;  3I9V 1;  2HJ1 A;  2KWV B;  2WGS A;  2D3A A;  2DZK A;  4KIK B;  3KUD B;  2GB1 A;  1PGA A;  1MG4 A;  4E3C A;  4KDL B;  1MPE A;  3HRD D;  1N5X A;  4IG7 B;  1PDX A;  1QLB B;  2G1E A;  3H6N A;  3VR9 B;  1WY8 A;  3QAQ A;  2CHZ A;  1EM7 A;  2KT7 A;  3VH3 B;  4JX1 C;  5E6O A;  1QQR A;  4MGI E;  1FM0 D;  1JWS D;  3VTU A;  3LJ3 A;  4WWP A;  3MC0 B;  4H2A A;  4XGA B;  3PT2 B;  2KOX A;  4WAF A;  2KDB A;  4D2K A;  1D5M C;  4RGN A;  5EE1 A;  4F7Z A;  2GMI C;  1GC7 A;  3QK0 A;  2HTH A;  4NAW B;  2XK5 A;  4FJV B;  2KAJ A;  2IZV B;  4N59 A;  3ABV B;  4WUR A;  3KYC D;  2JXT A;  3Q6B A;  3AUL A;  1E90 A;  4II3 B;  3HVZ A;  2MLB A;  1P1A A;  2KAN A;  1DGJ A;  3H7S A;  3DVG Y;  3GP7 A;  5G5H A;  4YL8 A;  3PGE A;  5IOI A;  1J0G A;  4OHJ A;  1D3Z A;  1TY0 A;  3NVV A;  4EOY A;  3VRA B;  2SEB D;  2BB6 A;  1FEH A;  4RNA A;  4WH4 A;  3MTN B;  2NS5 A;  2WX0 A;  3W2D A;  5HKH A;  3QA8 A;  2WDR B;  1AWD A;  2CHX A;  1P9D U;  4IKG A;  3KW5 B;  3VDZ A;  1TYG B;  1ZW7 A;  2WS3 B;  3MP9 A;  3NS8 A;  1BML C;  1WGR A;  2Y5P A;  3ZGZ A;  2WU5 B;  2Z0E B;  1GJZ A;  3MFG A;  1V9J A;  5DPS A;  3FC4 A;  2M56 B;  4AWJ A;  4JE3 B;  2C5L C;  2AQ1 B;  3NRZ A;  1SSN A;  2BVC A;  3ENE A;  3T8M A;  4WWO A;  2D3G A;  3RI7 C;  2Z0D B;  4W9F A;  5I4D A;  3QHT A;  3N9Y C;  4FXC A;  2D11 A;  4WJP A;  1G6J A;  3VUX A;  3TJP A;  2MBO A;  1UUP A;  3RMK C;  3RNA C;  1XT9 B;  3A4R A;  2G4S A;  2ZJD A;  5FK9 C;  3J9C A;  4HWI B;  2PW9 A;  1J7C A;  3MC8 A;  2NCN A;  2EEL A;  4PS7 A;  1SE4 A;  2VH2 A;  1WRD B;  4OVZ A;  4IDI A;  2B76 B;  4FN2 A;  2KX3 A;  2LVQ A;  5IN7 A;  3VAW A;  2JU6 X;  4DK5 A;  3DBR I;  1WMH A;  3QAR A;  4EZK A;  4R3D A;  2RDG A;  4FLH A;  4CQN A;  3ZDT A;  2PEA A;  1KM7 A;  1R4M I;  2KJ6 A;  2MQJ A;  1ZKH A;  2FAZ A;  1N6Z A;  4LK0 M;  1C4C A;  4LTU A;  1VDV A;  2ZW1 A;  1R4N B;  3U30 A;  1IGD A;  1IYF A;  3DDC B;  1XEE A;  4FUL A;  1E6E B;  1JRO A;  3SU8 X;  2WXM A;  1HTO A;  4OZA A;  4IWP A;  1V86 A;  4K81 A;  3RNF C;  1FNV A;  2RSU A;  1I7H A;  2BYT A;  2L05 A;  1F2R C;  2DEN B;  5IO9 A;  1JWM D;  1MJD A;  2L3Z A;  1YNT E;  1Q10 A;  4ICU A;  2D10 A;  2D2Q A;  1D6E C;  4F1S A;  3DVG X;  2LJI A;  3PLV A;  3KWL A;  1EWC A;  3U52 E;  2KWD A;  3TEZ A;  3A4S C;  5BYR A;  1ACC A;  1ZDX A;  4K3C A;  3X0W A;  1TGZ B;  3VTV A;  1S3S G;  4L1B A;  4EZL A;  5L83 A;  3EGR A;  1WJ6 A;  3AEE B;  1E7U A;  4C4V B;  4B9K A;  2W3S A;  3RCZ A;  1WJN A;  4YWG G;  3K9O B;  1TS4 A;  2YLM A;  3SDL C;  1R4N I;  2KFJ A;  3T3O A;  2KDF B;  1YX5 B;  1EF5 A;  2J7Q B;  1P7E A;  4KKI A;  5CTR C;  5D3I B;  4IUM B;  2GBM A;  3QIJ A;  5BMH A;  5E6N A;  4WJQ A;  2K39 A;  3EUB 2;  3ZVV A;  1K50 A;  1T5X D;  4WAA A;  2BKR B;  1E7P B;  4A8X C;  2MP2 A;  1T6B X;  1U4A A;  5HHD G;  2X8X X;  3ZRF A;  3WAP A;  1P0R A;  4XWT A;  1V1P A;  1KTK A;  2ZVO A;  2L76 A;  2I38 A;  2N9E B;  4K7S A;  2WLB A;  2YEP B;  2CR5 A;  3P63 A;  1T0S C;  4FA6 A;  2WHI A;  3BK2 A;  4XX5 A;  1AW7 A;  2IY1 B;  3NG0 A;  1FFV A;  1KH0 A;  1XQQ A;  3Q8F A;  1RWS A;  4BFR A;  2UYZ B;  4NNJ B;  2HD5 B;  5LNK 1;  2BYE A;  1F2R I;  3IXS A;  1VLB A;  2GBN A;  1HQR D;  3LYY A;  4ZRI A;  2L7R A;  1F52 A;  4KGT A;  2WWZ A;  3BZD B;  5HG2 A;  3N1Y C;  2BS2 B;  4RFB A;  4MM3 B;  4OW0 A;  4AQ7 A;  1X1M A;  3NY5 A;  3DHH C;  4AUQ C;  2L0F A;  3ZKJ C;  2KXJ A;  2MHJ A;  5GMV A;  1FO4 A;  2WYQ A;  3A9J B;  3QQ8 B;  2NMQ A;  4I6P A;  2RDB C;  2O6V D;  4KDI C;  2IO2 B;  1NEK B;  1C77 A;  2IBI B;  1HZ5 A;  3M3J A;  1EUV B;  4BBN C;  3DWG C;  1C1Y B;  2BWE S;  1YN3 A;  1C79 A;  1V5T A;  2MCN B;  4M8M A;  1YMH E;  1ZPS A;  2ZEQ A;  1YX6 B;  1R7S A;  4DBG A;  3ZW3 A;  3PRZ A;  4RH6 A;  2Z8L A;  2SAK A;  4PK1 A;  3NVZ A;  3WAO A;  1TKG A;  3AE7 B;  2GOW A;  3AMZ A;  1TTN A;  3VFK A;  1WIA A;  3AI5 A;  3SD5 A;  4ANV A;  1XLQ A;  2K3U A;  4KX6 B;  4HPP A;  2KZR A;  2GLS A;  3W9C B;  2BYV E;  4HEA 1;  4HPL B;  1A70 A;  1YJJ A;  3VR8 B;  4EZJ A;  3S2A A;  1FXA A;  3ZNI D;  2M1M A;  1V97 A;  2G4D B;  2PE9 A;  2LRU A;  3DPD A;  2C60 A;  2N4F A;  3PHX B;  3I5J C;  2LXC A;  4US9 A;  2KLG A;  1GB4 A;  2LI5 A;  4TUU A;  1QOB A;  1OQR A;  5JHB A;  3RD2 A;  1N60 A;  4ZRQ A;  2BKF A;  2R2O A;  3EEC A;  1FXT B;  4PYU A;  4RCO A;  1LXD A;  1C4A A;  3EFC A;  1WGH A;  1OGW A;  4RF1 A;  4ANW A;  3BK1 A;  3AU4 A;  4A55 A;  4ZHO A;  3AE5 B;  1IBX B;  3R7R A;  3EC8 A;  4BKS D;  4EEW A;  3ZXR A;  3CIR B;  4XE0 A;  1E8Y A;  2CJN A;  3L08 A;  4LJO B;  4DDI D;  4YTN B;  2XK5 B;  2NR2 A;  2WXK A;  3QWZ B;  1KJT A;  3L54 A;  4ZRP A;  2A4Z A;  4W9K A;  1RM6 C;  5C1Z A;  1YN5 A;  2QJL A;  5BO4 B;  2AL6 A;  4OZC A;  2FCN A;  1WE6 A;  3I3T B;  4RF0 A;  4G50 A;  5TR5 A;  4MH8 A;  1FFU A;  4C80 A;  2FBW B;  3H7P B;  1WFY A;  1Q5W B;  3RN9 C;  1WSP A;  2NVU I;  2KMM A;  3Q8C A;  4HXD A;  5AUK A;  5C23 A;  1V2Y A;  2IDY A;  4W9L A;  1UWX A;  4GB9 A;  4W9J A;  3KQ4 A;  5IP4 D;  3P4P B;  3OWE B;  5IAA C;  1BT0 A;  4IOI E;  3Q3J A;  3NZS A;  2WXO A;  1UNS A;  3E56 A;  3U8Z A;  1I42 A;  3PO0 A;  3AEA B;  3RPF C;  3CWI A;  1MG8 A;  3SFD B;  3URY A;  4HJG E;  2JZZ A;  1OQY A;  4F8C B;  4PYZ A;  1J7A A;  2VH1 A;  3MC9 A;  2RGF A;  1FRR A;  1FNW A;  2L00 B;  1AN8 A;  2NBV B;  2LGS A;  1UGM A;  3TEY A;  1DYQ A;  1WZ3 A;  1QOG A;  4E71 A;  2J4X A;  3PRE A;  4M0W B;  2IYD B;  1L7Y A;  1T3Q A;  1GC6 A;  2AX5 A;  3IHP C;  3UQA A;  2HJ8 A;  3DVN U;  2L83 A;  3NVW A;  2MH7 A;  1JQ4 A;  1WYW B;  3RNE C;  2FNJ B;  4JIO U;  1FD6 A;  2JZP A;  4UDU C;  3EA6 A;  2DNF A;  2I1J A;  2BBC A;  2FUG 1;  2GI9 A;  1SXT A;  1SE9 A;  4A20 A;  2DYB A;  3L17 A;  4P16 A;  3VRB B;  4EKU A;  5HI1 A;  5DCN A;  5KHO A;  2LHD A;  2KDI A;  2JWZ A;  2MEK A;  1P98 A;  2UWQ A;  2JYE A;  3V05 A;  1EO6 A;  1PQS A;  1NVI D;  2INP E;  4HVB A;  4ITK A;  4AJY B;  4GSW A;  3KWV A;  3DOW A;  1NDD A;  3RT3 B;  1P7F A;  3Q8B A;  4TKN A;  4FHJ A;  1H8C A;  3ZXV A;  2WXG A;  4L2Y A;  3B2G A;  1L4D B;  3V60 A;  3MHZ A;  1SF0 A;  4LNF A;  3W1S A;  4TMA B;  4YT0 B;  2UU7 A;  3KH0 A;  2JX5 A;  1KF6 B;  1NI2 A;  4K3B A;  1FCL A;  4BBN F;  1PUT A;  2EMS A;  3H7P A;  3UQB A;  3R2I A;  2MJD A;  3IFW B;  2AWT A;  5E6J A;  3ZTD A;  2QIE B;  1TT5 B;  2KX0 A;  3U7Z A;  1WGD A;  3AED B;  1TS2 A;  4IM2 A;  2W3R A;  3UIP B;  1OEY J;  1AAR A;  2JXX A;  3M95 A;  3ZRC A;  5G5G A;  2KK8 A;  3GE3 C;  2KLC A;  1RAX A;  4GU2 A;  2DWQ A;  1F9J A;  1QIL A;  2Z59 B;  2LGI A;  1JCK B;  1FRD A;  4BOZ B;  2DLB A;  3VUY A;  2DZJ A;  4O1N A;  4NAW A;  3AEF B;  1UWM A;  2CS4 A;  4GGQ A;  5D6J B;  3KUC B;  1K53 A;  5D3D A;  2IJ0 A;  2W9N A;  4HRO A;  5CHF A;  2LUE A;  2AQ3 B;  3ZLZ A;  3TEW A;  2ZPN A;  1NBF C;  3PRP B;  5JHA A;  3AEC B;  4GDK B;  1YOV B;  3AXC A;  2BT6 A;  2WXP A;  3WIM A;  4NQL B;  5AZG A;  2V3P A;  4ZYS A;  1L0X B;  4AJW A;  2EKI A;  4MH0 E;  4KV2 A;  3TL5 A;  2BW2 A;  2M8S A;  1WI0 A;  4ZYN A;  1QOF A;  1B1Z A;  1ISN A;  3SR6 A;  1Y56 A;  3O65 B;  2OJW A;  1VRA B;  2KO3 A;  4M0W A;  5T8I A;  1YQ4 B;  1WX8 A;  3C0R B;  2PKO A;  3V61 A;  1L2N A;  2JRI B;  1V5O A;  3RZW C;  4MAC A;  3UF8 A;  2BB5 A;  2H89 B;  2JPH A;  1GOZ A;  3ML8 A;  5CHW A;  5D2M B;  3HM3 A;  4YSZ B;  4WQO B;  1ET9 A;  1TZO A;  2QC8 A;  2KAC A;  1K8R B;  5C3J B;  5LXH A;  1EU4 A;  1E5W A;  4W9D A;  3T9L A;  1Y8R C;  3BVG A;  4DDG D;  3RFZ B;  1Z5S B;  2KQ7 A;  3ECI A;  1KFY B;  4MEL A;  4I6L B;  2JT4 B;  1V1O A;  5BYS A;  1YQ3 B;  3Q3M C;  2WXL A;  1SBB B;  2DYO A;  5J2R A;  4PT5 A;  1IUE A;  2C7H A;  3Q3O C;  2AL3 A;  1HA5 A;  1ENF A;  2ZCB A;  3HK0 A;  1UBQ A;  2VZK D;  2INN E;  3PV1 A;  3ZJU A;  3N3K B;  1EU3 A;  4NPN A;  1L0V B;  3GOE A;  2RDH A;  1I4R A;  1GUA B;  3B08 A;  4DHZ E;  1JWA D;  3VHT C;  1VD2 A;  3JSV B;  2DZM A;  2KVZ A;  1TY2 A;  4FBJ B;  3P2B A;  4QAY A;  1VZ8 A;  1YJI A;  2LRW A;  4HDO A;  1HZ6 A;  1YJ1 A;  2OJR A;  5H8Y E;  1UD7 A;  3UI3 A;  5G55 A;  1SEB D;  2KC2 A;  4HLE A;  3QCA A;  3RNC C;  3ETR A;  5EE9 A;  4K1R B;  3PZD A;  2ZNV B;  1VZ7 A;  4KIK A;  3Q2A C;  3DBH I;  4AOF A;  4N6E B;  1KRH A;  1STE A;  3W1S C;  3ZQ4 A;  2ZW0 A;  3PLU A; 
#chains in the Genus database with same CATH homology
 1GB4 A;  4WQM A;  3LXF A;  4C56 C;  1QOB A;  1XLO A;  2L1A A;  4EE2 A;  1C9F A;  2WDQ B;  1OQR A;  1ROE A;  2LFI A;  2OHF A;  2NTS A;  4MT5 A;  1N60 A;  1QKZ A;  4ZRQ A;  4B0E A;  1D4B A;  4P6V F;  1XLN A;  1L6U A;  2DYM A;  3AB5 A;  2TSS A;  4RCO A;  2J42 A;  1C4A A;  1FCC C;  1MI0 A;  1ZDV A;  3BWU D;  1BUI C;  1C76 A;  2WP9 B;  2RMM A;  1L5P A;  3I9V 1;  4L23 A;  4ARI A;  2W55 A;  4RF1 A;  2L52 A;  3BK1 A;  4A55 A;  4ZHO A;  3AE5 B;  2GB1 A;  5C2T B;  1PGA A;  2M0A A;  4YSY B;  2WXI A;  1IBX B;  1PYW D;  1MPE A;  3CIR B;  3HRD D;  1N5X A;  4XE0 A;  1PDX A;  1QLB B;  2G1E A;  2CJN A;  3VR9 B;  4RGM A;  1SE2 A;  1EM7 A;  4YTN B;  1K51 A;  4JX1 C;  1TS5 A;  2WXK A;  1QQR A;  3FIL A;  2V0G A;  2H88 B;  3AEG B;  3V3X A;  1FM0 D;  2MJ3 A;  4ZRP A;  3Q8E A;  4NJC A;  1JWS D;  1RM6 C;  2BS3 B;  1WYG A;  2PMV A;  3MC0 B;  1YN5 A;  2QJL A;  3P42 A;  1JML A;  2E6X A;  2QSD A;  4OZC A;  4RGT A;  4H2A A;  2JQR B;  5JXV A;  4RF0 A;  1XCQ L;  1CZP A;  4WAF A;  3ZYY X;  4D2K A;  2QIL A;  1D5M C;  4RGN A;  5EE1 A;  3AE4 B;  4MH8 A;  1FFU A;  2JSV X;  1XF5 L;  4C80 A;  2FBW B;  1ZE3 D;  2AQ2 B;  4NAW B;  1WSP A;  2KAJ A;  2KMM A;  2QEJ C;  4N59 A;  3ABV B;  4WUR A;  3Q8C A;  4KGR A;  2JXT A;  5FKA C;  3R2T A;  4A9A A;  1V1P B;  2IPK D;  1WRI A;  3AEB B;  5AUK A;  1QF6 A;  1N61 A;  3HVZ A;  3GS2 A;  4AS1 A;  1DGJ A;  2HTM E;  2IDY A;  1UWX A;  2WXR A;  3GP7 A;  4LLG M;  3AE2 B;  1N63 A;  3KQ4 A;  3W5V B;  5G5H A;  2N9K A;  1DOI A;  1C78 A;  1NYR A;  3P4P B;  3OWE B;  4OHJ A;  2G9H D;  1TY0 A;  4J3O D;  4IOI E;  4NAM A;  3NVV A;  1YN4 A;  1I4P A;  2SEB D;  2BB6 A;  2GRI A;  3VRA B;  1FEH A;  4RNA A;  4WH4 A;  3IAM 1;  3AE1 B;  2WXO A;  1UNS A;  3E56 A;  3W2D A;  1JAL A;  1MHX A;  3PO0 A;  1E9M A;  3AEA B;  1AYF A;  3RPF C;  3CWI A;  2WDR B;  3SFD B;  1B9R A;  4JPS A;  3URY A;  4HJG E;  2IGD A;  1AWD A;  1MHH E;  3L4P A;  3W5U B;  2YEP F;  5BMI A;  4IKG A;  1FNU A;  1TYG B;  2BS4 B;  4Q2J A;  2NTT A;  2WS3 B;  4TSS A;  3MP9 A;  1J7A A;  1BML C;  2Y5P A;  2RPV A;  3ZGZ A;  1I4H A;  2WU5 B;  3Q69 A;  1WWT A;  1FRR A;  3MFG A;  1FNW A;  4N58 A;  1AN8 A;  1CJE A;  1QT9 A;  1FMA D;  3Q8A A;  4TQ0 A;  4US8 A;  1DOX A;  2ACZ B;  3FC4 A;  2M56 B;  1ZXI A;  4JE3 B;  3TEY A;  1PGX A;  1DYQ A;  2AQ1 B;  3NRZ A;  4WWM A;  1SSN A;  3KLS X;  1QOG A;  4HKZ E;  1XCT L;  2J4X A;  4YTP B;  3IT6 B;  1L0Y B;  1ET6 A;  1KLU D;  1T3Q A;  1CK1 A;  4JWU C;  3NUH B;  2AX5 A;  2JYT A;  5I4D A;  3NVW A;  2L83 A;  1N62 A;  2MH7 A;  3N9Y C;  4FXC A;  1JQ4 A;  3SEB A;  1UUP A;  5AUI A;  3C8Y A;  3AM9 A;  5FK9 C;  2K9X A;  3J9C A;  1FD6 A;  1XO3 A;  2PW9 A;  1J7C A;  2JZP A;  4UDU C;  4A90 A;  3EA6 A;  3U4E G;  4A6Q A;  1D5X C;  2EEL A;  2BBC A;  3AE6 B;  1BXT A;  2FUG 1;  1SE4 A;  2GI9 A;  1UGJ A;  4OVZ A;  4TQ1 A;  1QOA A;  1SXT A;  2B76 B;  2WXN A;  4IDI A;  4ZHP A;  5BMG A;  4P16 A;  2K22 A;  2LMC A;  2LUM A;  3VRB B;  3SFE B;  1D5Z C;  1ZUD 2;  5HI1 A;  1JW9 D;  2L32 A;  2R61 A;  2LHD A;  1F77 A;  2JU6 X;  2WDV B;  2KDM A;  2MEK A;  2WQY B;  4KGS A;  3FAH A;  4C7Z A;  1I4X A;  4R3D A;  1OFF A;  2JYE A;  2RDG A;  3V05 A;  1NVI D;  2INP E;  4CQN A;  4ITK A;  3KWV A;  3MJ5 A;  3TSS A;  4YTM B;  1P7F A;  3Q8B A;  2BTE A;  3LB8 C;  2LHE A;  3NS1 A;  4LK0 M;  1C4C A;  4LTU A;  2WXG A;  4L2Y A;  1KLG D;  3B2G A;  1L4D B;  3P1M A;  1PFD A;  2J53 A;  1VDV A;  3MHZ A;  1RYJ A;  2ZW1 A;  5H92 C;  1SF0 A;  3W1S A;  3PZ7 A;  4TMA B;  1IGD A;  4YT0 B;  1XEE A;  1E6E B;  2JX5 A;  1JRO A;  1KF6 B;  2OED A;  2IGG A;  1C4P A;  5MPO A;  3HVD A;  1IBX A;  1FCL A;  4JWS C;  2WXM A;  1PUT A;  4OZA A;  1SE3 A;  1HEZ E;  3R2I A;  4ARC A;  2MJD A;  2E3T A;  2MJE A;  1JWB D;  4REZ A;  1XLP A;  5E6J A;  1FNV A;  2QIE B;  1I7H A;  2BYT A;  1F2R C;  4GLS C;  3U7Z A;  3AED B;  1JWM D;  1TS2 A;  1YNT E;  2I2Y A;  1Q10 A;  2W3R A;  2WXQ A;  1D6E C;  1EWY C;  3AE9 B;  3BYY B;  1GAQ B;  2D5G A;  2LJI A;  2ON8 A;  3KWL A;  1ZOY B;  1HXY D;  1EWC A;  5G5G A;  1OQQ A;  2KWD A;  2K0P A;  3U52 E;  3TEZ A;  1GPX A;  2M19 A;  5BYR A;  3ZJV A;  1NEN B;  2DWQ A;  1ACC A;  1ZDX A;  1PGB A;  2XN9 C;  1QIL A;  2LGI A;  2KQ4 X;  1JCK B;  1FRD A;  1E10 A;  1WXQ A;  2DLB A;  4L1B A;  1V8C A;  3GB1 A;  3EGR A;  3AEE B;  3AV8 A;  3HUI A;  4O1N A;  3WCQ A;  3AEF B;  1UWM A;  2W3S A;  1DOY A;  1K53 A;  2Q5W D;  5D3D A;  4YWG G;  2IJ0 A;  1TS4 A;  1F0Z A;  4HRO A;  2J52 A;  3T3O A;  3BII D;  1SJE D;  1P7E A;  4KKI A;  5D3I B;  1L6V A;  2AQ3 B;  5BMH A;  3TEW A;  1ZXH A;  3AEC B;  4GDK B;  2CU3 A;  2Y5C A;  2WXJ A;  2BT6 A;  2WXP A;  3EUB 2;  1K50 A;  1T5X D;  2K5P A;  1E7P B;  4A8X C;  5TSS A;  2V3P A;  4ZOH C;  1I4G A;  1T6B X;  1K52 A;  2PLP A;  4ZYS A;  1TKE A;  3R8B A;  1L0X B;  2EKI A;  5HHD G;  1RFK A;  2BW2 A;  2ONQ A;  3P4Q B;  1QOF A;  4XWT A;  1V1P A;  1B1Z A;  3SR6 A;  1KTK A;  1Y56 A;  2I38 A;  1NI3 A;  1VRA B;  2WLB A;  5GXG B;  4M0W A;  2FE8 A;  2YEP B;  3P63 A;  1WGK A;  3BK2 A;  5T8I A;  1AW7 A;  1YQ4 B;  2PKO A;  2WNM A;  1FFV A;  1KH0 A;  3Q8F A;  2N7J A;  1RWS A;  3IAS 1;  2LEK A;  3E9S A;  4MAC A;  5LNK 1;  2BB5 A;  1F2R I;  4YXD B;  2N0S B;  3IXS A;  2H89 B;  1VLB A;  3B2F A;  1GOZ A;  4WIP A;  4C7Y A;  1HQR D;  2QMT A;  3LYY A;  2DBY A;  1VZ6 A;  4YSZ B;  1J7B A;  4KGT A;  4USA A;  1ET9 A;  3BZD B;  1L4Z B;  5HG2 A;  1TZO A;  2KAC A;  2BS2 B;  4RFB A;  5C3J B;  4MM3 B;  1EU4 A;  1SB3 C;  4OW0 A;  4AQ7 A;  1ZP0 B;  1GB1 A;  5EE3 A;  3BVG A;  3IT4 B;  4DXG A;  3RFZ B;  3T3N A;  4OZB A;  4HKQ A;  1I4Q A;  1KFY B;  3AN1 A;  1MVK A;  2Y3A A;  3B9J A;  1V1O A;  2XNA C;  5BYS A;  1YQ3 B;  2WXL A;  1SBB B;  1VJK A;  2DYO A;  1JWU D;  1FXI A;  1FO4 A;  3VQI A;  1XXG A;  1LO5 D;  2WXF A;  4PT5 A;  1IUE A;  2NMQ A;  1HA5 A;  1ENF A;  1NEK B;  3BVM A;  1C77 A;  2ICI A;  2HDE A;  3AE8 B;  2VZK D;  5EE0 A;  2X38 A;  1CQV A;  1HZ5 A;  2INN E;  3FIL B;  3AE3 B;  3ZJU A;  1EU3 A;  2PVG C;  1L0V B;  2RDH A;  1I4R A;  3I57 A;  4B0M A;  1N5W A;  3PZ8 A;  3DWG C;  1JWA D;  4GDL B;  1YN3 A;  4YSX B;  1C79 A;  1TJE A;  1JRP A;  5HFY A;  1FIQ A;  4NZL B;  1TY2 A;  1YMH E;  3O13 A;  3P4S B;  1ZPS A;  2KN4 A;  4HRS A;  4DQO C;  1R7S A;  1TKY A;  1VZ8 A;  1SJH D;  3TEX A;  3ZJT A;  2WXH A;  4RH6 A;  1E0Z A;  1YJI A;  2Z8L A;  2SAK A;  3NVZ A;  1HZ6 A;  1TKG A;  2V4I B;  2JWU A;  3AE7 B;  3NVY A;  3AMZ A;  2PVO D;  2CJO A;  2VZK B;  2W54 A;  4DXF A;  3AH7 A;  5H8Y E;  3BVZ A;  3UI3 A;  1IGC A;  3DWM A;  1SEB D;  1SIJ A;  1VR9 A;  1XLQ A;  2K3U A;  2PTL A;  4XWW A;  2WU2 B;  4KX6 B;  1NYQ A;  1ESF A;  3W9C B;  2IGH A;  3ETR A;  4HEA 1;  5BYQ A;  1A70 A;  1YJJ A;  5EE9 A;  2N9L A;  3VR8 B;  3P4R B;  4XDD A;  1FXA A;  5D7G A;  3H8H A;  1VZ7 A;  1V97 A;  2PIA A;  1TS3 A;  3U2S C;  2V3N A;  2W82 A;  4KKJ A;  4N6E B;  3NZ3 A;  1KRH A;  1STE A;  4XDC A;  3TUO A;  1M4V A;  3BYT B;  4US9 A;  5FR3 A;  3ZQ4 A;  2ZW0 A;  4RGO S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...