3PO0A

Crystal structure of samp1 from haloferax volcanii
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
89
structure length
89
Chain Sequence
b'GSMEWKLFADLAEVAGSRTVRVDVDGDATVGDALDALVGAHPALESRVFGDDGELYDHINVLRNGEAAALGEATAAGDELALFPPVSGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small archaeal modifier protein 1
publication title Crystal structure of ubiquitin-like small archaeal modifier protein 1 (SAMP1) from Haloferax volcanii.
pubmed doi rcsb
source organism Haloferax volcanii
molecule tags Protein binding
total genus 23
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3po0A00
4IDIA 1JRPA 1ZUD2 2Y5CA 4YTNB 5H92C 4C7ZA 1J7BA 2BS3B 2MJEA 1J7CA 1RWSA 1N5XA 3BIID 1FIQA 1GAQB 1DGJA 1QOBA 1EWYC 3AB5A 3AV8A 2JQRB 2G1EA 2WDRB 1OQRA 1E6EB 1RYJA 2WU5B 4ZOHC 1B9RA 3NVWA 2L83A 1TYGB 3DWGC 1KFYB 3VRBB 1T3QA 3P4PB 2H89B 1JQ4A 2WU2B 2CJNA 1WGKA 1XLOA 4N58A 3AEEB 1AWDA 1RFKA 5EE0A 3SFEB 1ROEA 2MH7A 3CIRB 1R7SA 1SB3C 2QIEB 1YQ3B 1YJJA 2H88B 1QOAA 4JX1C 3AE5B 3VRAB 1NENB 2WP9B 1XLQA 3W5VB 1FFUA 2BS4B 1IUEA 2WDQB 1QT9A 1XLPA 1ZOYB 1L6VA 1QLBB 2CU3A 3B9JA 1DOXA 1GPXA 3NVYA 1AYFA 1L5PA 3NRZA 3FC4A 2KAJA 1JALA 3AM9A 3CWIA 5AUIA 1E10A 2E3TA 4ITKA 3SFDB 5G5HA 1F0ZA 1FRRA 4A9AA 3AEFB 5H8YE 1VJKA 5C2TB 3RPFC 3WCQA 1QF6A 2WLBA 3AE1B 3LB8C 1L6UA 2WQYB 1JW9D 1UWMA 1KF6B 1N60A 1TKYA 2M19A 3AE2B 2DBYA 3ABVB 3ETRA 1FMAD 1OQQA 2QJLA 1J7AA 1N61A 3EUB2 2MJ3A 1N63A 3HVZA 3W5UB 1N5WA 2DWQA 3HUIA 2PVOD 1ZXIA 3VR8B 3KWLA 3W9CB 1WXQA 4FXCA 1L0VB 1DOYA 4KX6B 2PIAA 4US8A 1E0ZA 1SIJA 2K9XA 4HROA 1XO3A 1E7PB 1FXAA 2LEKA 2WS3B 1CJEA 2CJOA 2PKOA 1VDVA 4WWMA 3AE3B 2L52A 4YTMB 3AEAB 3AMZA 1NYRA 3AE7B 2JX5A 3AE4B 3PO0A 4YSXB 1JWAD 1V97A 1SF0A 4C7YA 3AH7A 5MPOA 4YT0B 1NI3A 4LTUA 4WQMA 3AEBB 4C80A 3LXFA 4YSZB 3P1MA 2FBWB 2KMMA 2HTME 1DOIA 2W3RA 1QOFA 2PVGC 1FFVA 1FXIA 3AEDB 3DWMA 4N59A 4YSYB 3P4QB 3ZYYX 4JWSC 4YXDB 4ZHPA 1RM6C 3P4SB 1WYGA 2WDVB 1VLBA 3AE9B 1ZP0B 2K22A 1TKGA 2ACZB 3NS1A 4US9A 1FM0D 2W55A 2MJDA 1I7HA 1QOGA 3AE6B 2N0SB 3FAHA 2AX5A 3HRDD 4P6VF 1WRIA 1E9MA 2W54A 2W3SA 1WWTA 5EE3A 5EE9A 5AUKA 3SR6A 5C3JB 1PDXA 2EKIA 2Q5WD 3B2GA 3P4RB 4HRSA 4ZHOA 3P63A 1NEKB 1PUTA 3B2FA 1PFDA 2M56B 1KRHA 2K5PA 3L4PA 3NVZA 1CZPA 4N6EB 4USAA 5GXGB 1TKEA 3AE8B 1JWBD 1N62A 2BT6A 3AECB 4YTPB 4JWUC 5EE1A 3VR9B 3NVVA 2OHFA 3AEGB 1V8CA 2B76B 1NVID 1YJIA 1FRDA 1OFFA 1A70A 1FO4A 2BS2B 1JROA 1YQ4B 5G5GA 1XLNA 1NYQA 3AN1A 1TJEA
chains in the Genus database with same CATH superfamily
5IA7A 1ZKHA 3GZNI 2KDBA 2MSED 2MWSB 4MH8A 2WWZA 3L17A 1I4GA 3NZSA 3NZUA 2BYFA 2H88B 1FFUA 5KHQA 1KH0A 3VUYA 4IUMB 2V4IB 1GB1A 4M8MA 3PT2B 4EZKA 2K0PA 3KWVA 4IC7B 1NBFC 3L10B 1A5RA 4HK2A 2SEBD 3PSEB 3WCQA 5JH5C 4WAAA 3I5JC 2IGDA 1FMAD 4DBGA 1XQQA 1WSPA 1WMHA 5FR6A 4NJ7A 5IOIA 3TCAA 1KTKA 2G9HD 2C60A 1JWAD 4EFOA 1XD3B 2DLBA 4CO7A 1IBXA 4IWOA 1L4DB 3X23A 4P16A 2V3NA 4A90A 2KD0A 4BKSD 3QQ8B 3BK1A 1FM0D 1HZ5A 2K8CA 3IVFA 1QOGA 4OW0A 1C4PA 2D3CA 1WGDA 3SDLC 2LASA 1Y56A 5EE1A 4BKTA 1WR1A 2DHZA 4JIOU 1TZOA 4WH4A 5JXVA 1SJHD 1RWSA 4RGMA 1UZXB 1KLUD 1T5XD 4HLEA 1OQRA 2WU5B 3NVWA 2LGSA 2KZRA 5CHVC 3SEBA 1V2YA 3UINB 3SFEB 4BFRA 2RR9A 3PV1A 1ZOYB 1L6VA 2D5GA 2CU3A 2WXGA 1V5OA 2O6VB 3KVFB 2RDGA 3ZNID 1AARA 3UIOB 3MHZA 5D2MB 3AI5A 3R7QA 2DZJA 1QF6A 1C9FA 1L6UA 2J0MA 2M19A 4TSSA 1EWCA 3KQ4A 2RGFA 2VH1A 1WR6E 1BT0A 3DHGC 1V5TA 3N32A 3DBLI 4M0WB 2OJRA 1EF1A 2VZKD 2VRRB 1E5WA 4RH6A 1MI0A 2NBWB 3V62A 1QZEA 1P1AA 3RD2A 1Y8RC 3IT4B 1L7YA 2N9KA 3WAPA 2KT7A 1R4NB 1OEYJ 2KTRB 5DPRA 4LNFA 2LHEA 5CHFA 3CMMB 1ZP0B 3VTVA 2C7NB 4DHJB 5LXHA 3AE6B 2AX5A 5EE3A 3B2GA 1SBBB 4IW0A 1SXTA 3DVNV 4GXBA 2BQQA 3TMPB 3L13A 4AP4C 1LFDA 1Q10A 2PJHA 1WFYA 5I4DA 1OFFA 2BS2B 3PVLA 1TBEA 2FCQA 3SD5A 4IDIA 4HCPB 3PRZA 3IBEA 2JXTA 4AWJA 3IAS1 1JMLA 3NG0A 1X1MA 3NUHB 1P7EA 2M0AA 2ZVOA 3A1QA 4HEA1 2BS4B 2ZW1A 4ZRIA 4RFBA 3Q8EA 2J0JA 1LXDA 2LGYA 1Z2MA 4OZAA 2NBUA 1AW7A 1R4MB 5AUIA 4MEMA 3WA0A 3CF6E 2V3PA 3AEFB 5C2TB 2HTHA 3PZDA 3LB8C 3EECA 2FIFA 1N60A 3E56A 1I35A 3TEZA 4NY0A 4BBNC 4K3BA 4TMAB 3ZNHB 1GG3A 1E8XA 3VR8B 4NAMA 3VXWA 2ON8A 2K9XA 3R2IA 5EDSA 1V1OA 1LGRA 2LI5A 4XWTA 3KYCD 3A33B 3WAMA 1E7UA 1NYRA 1F52A 4LLGM 4CYEA 1V97A 1HE8A 5MPOA 2KANA 4LTUA 3I63C 2AL6A 2W3RA 3TBLD 5BYSA 3ZNZB 1FXIA 4YXDB 2GMIC 3P2BA 4MJSB 1SE9A 2N9LA 4BBNF 5TR5A 3HRDD 2AYOB 3PZ7A 5AUKA 2KLGA 2EKIA 2Q5WD 2L05A 2JYTA 2XNAC 4C4VB 2W82A 2M56B 4JQWC 4H2AA 4JWUC 4KV2A 4WURA 1E90A 2WNMA 2WXJA 2QEJC 3U2SC 1GC6A 1JROA 1YQ4B 4NJ6A 1N6ZA 1E8YA 4MM3B 1NYQA 1IYFA 2ZCBA 3JSVA 2AL3A 3Q3MC 1D5MC 3ZO5B 4D2KA 3I57A 4RM8A 4MSQB 4FJYA 2LFIA 4K3CA 3DVGX 1WJ6A 1I4XA 3JYUA 3EGRA 3ZLZA 3OLMD 2IO2B 1C3TA 1SIFA 1UNSA 2WP9B 1I4RA 2BYVE 1GUAB 3LYYA 1OTRB 1QLBB 2I2YA 1HQRD 4MDKE 3U4EG 3DBHI 3NS8A 2REXA 2VH2A 3RPFC 3Q6BA 1P3QU 4KSKC 1R4NI 1EUVB 2WGSA 2ZVNA 4BOSC 5IO9A 3TJPA 4ZRKA 2N1VA 3HM3A 4HJKA 1VD2A 4TQ1A 4LK0M 2K1FA 2YLMA 5E6OA 1E7PB 2B3AA 2QC8A 4TV3A 2JF5A 5AZGA 3RT3B 1YQBA 1GNUA 4JGHB 1RFAA 4DK5A 1RRBA 3PLVA 4WIPA 1C4CA 1QOFA 3QK0A 4I6NB 3R8BA 4PS3A 3ZYYX 4WJNA 3Q2AC 5HI1A 1VZ6A 2WDVB 2GBJA 2JT4B 1ZE3D 2GB1A 4CQNA 3FAHA 1TZ1A 2K39A 4P6VF 3Q8CA 4NAWA 4NPNA 5C3JB 5D94A 4KSLC 1FNWA 3K9PB 1OQYA 1PFDA 3DVGY 1V1PA 2KFJA 1SEBD 4FLHA 3RYTA 4PT5A 4PYZA 1F9JA 1R4MI 4ANWA 1H4RA 4P1CC 3PRMB 1UH6A 1L2NA 1F2RC 4EE2A 3GOEA 1CMXB 5L83A 3C0RB 3Q8AA 4C00A 2GBKA 1UBQA 4W9HA 3VAWA 1RFKA 4W9EA 2NPTB 2GBMA 2L0FA 4CHKA 5AZHA 2MRPA 2KC1A 1WXVA 2MP2B 1GPXA 3URYA 1AYFA 3KH0A 3NRZA 3BY4B 2QSDA 1SJED 1WM2A 2RMMA 4F8CB 4K7WA 4ZRPA 3ETRA 2LGIA 5BYRA 1SE4A 1TT5B 4MELA 1IPGA 2IDYA 4FXCA 5C23A 2PIAA 2VZKB 3GS2A 2RPVA 2UYZB 3NY5A 3QAQA 4TQ0A 1FPYA 2E6XA 1J19A 2M17A 3QHTA 1NI3A 4XGAB 5LNK1 1YN4A 4YSZB 3BZDB 2NBVB 1VZ7A 4ICVA 4JWSC 2RPQA 3ALBA 1SE2A 2BWES 2IY1B 2JVCA 3ZQ4A 1ZW7A 3RFZB 5BYQA 4DDGD 2KLCA 1PUTA 1JRUA 4ARIA 4N6EB 2KJRA 3RI7C 1V8CA 1C79A 1NVID 1VRAB 1FRDA 1C77A 3S2AA 4URKA 3ZRCA 1XLNA 1P7FA 4PK1A 1J7BA 1GAQB 2BKFA 5LXIB 4ZRJA 2LD9A 2CJNA 1WE7A 3MC9A 4KZCA 1WZ3A 2Z59B 3LJ3A 4IM3A 3RNBC 2BYEA 2LGDA 2PMVA 1FNUA 3T8MA 2RDHA 3GB1A 3MJWA 4ITKA 3VVWB 1FRRA 4A9AA 4IKGA 2KN5A 3DQVA 2R61A 4GDKA 1EF5A 1YJ1A 1DYQA 2JYEA 4M01A 2QJLA 2LXAA 2AWTA 3IT6B 1WXQA 2IO0B 4JPSA 4DHZB 2V3SA 1FXAA 3RNEC 1VZ8A 1FCLA 2JY6A 3RNFC 4RF1A 4KIKB 4RM9A 2KMMA 1WI0A 1KOTA 3GE3C 5J17A 4G0NB 1CK1A 1WX8A 1Z5SB 1PGXA 2DNFA 4WWPA 3RN9C 3Q8BA 3H1UA 2NTSA 2ONQA 2LUEA 1KJTA 4YTPB 1WY8A 3Q3JA 4B0EA 2MCNB 1QILA 4LDTD 4BVUC 2O2VA 4K7UA 3ZTDA 1FO4A 1C1YB 1BMLC 1T0RC 5IP4D 3DDCB 1ZUD2 2XK5A 2YEPF 4FHJA 1IGCA 1QOBA 2L0TA 1DGJA 4KDLB 3VQIA 3QWZB 5BMIA 1KM7A 2MBEA 4G11A 2Y5PA 1KFYB 4ANXA 2H89B 2RDBC 2JWZA 1P0RA 2LUMA 3AEEB 3EC8A 3WIMA 2MH7A 3C19A 3AE5B 1IUEA 2GI9A 2MA9B 4DDID 2CS4A 2N7DA 5L95C 2LVQA 3QX1A 3ML9A 1YNTE 1LQBA 3FC4A 2KAJA 1I42A 2D3GA 4XDCA 3SFDB 5G5HA 3ZXRA 4PS8A 3RUIB 2MHJA 3MHSD 4FHKA 4A20A 3AE1B 1LO5D 2IZVB 2QILA 3NZ3A 2DBYA 4QAYA 4BOZB 4M8NA 4F7ZA 2Y3AA 2PE6B 3I9V1 4PS7A 1GOZA 2FCMA 3R2TA 1OEYA 1CJEA 1VDVA 1RLFA 1GB4A 1PGAA 1L0XB 1AN8A 1P98A 3I3TB 2DAFA 2KWUB 1QQRA 3AEBB 2DYOA 4C80A 2BYTA 5G55A 1PGBA 4FA6A 4KGRA 1DOIA 3Q3OC 2D2QA 2KWVB 2KX0A 2QDFA 1ISNA 2K22A 1S3SG 2ZJDA 2AQ1B 4B95A 3R66C 1E9MA 3U8ZA 2LJ5A 4MGIE 1YMHE 2NR2A 3BINA 4XE0A 4USAA 3ZJTA 2KFKA 4RMAA 2LVOA 4OZCA 3MFGA 2KVRA 5IN7A 2JWUA 1VCBA 2ZZPB 1ZPSA 2X38A 1FEHA 2D3BA 2BS3B 2LZ6A 3QARA 4W9JA 1EU4A 1D5XC 4EZJA 1YN5A 2C7HA 2FCSA 2JQRB 4OHJA 2INPE 3P4PB 2I38A 5EE0A 2V9HA 1WM3A 1T0YA 1E8ZA 3GP7A 4FJVB 1XLQA 2CR5A 3APFA 3TIXA 1HEZE 3A9KA 3KUCB 4REZA 4FBJB 2LJIA 1XT9B 3FILB 3DBSA 1HTQA 2KDEB 3LDZE 1JW9D 1UWMA 1TKYA 3O65B 1K8RB 2LWPA 2WXHA 1N5WA 3WALA 2ZNVB 4GDLB 2J4XA 2WXRA 3KWLA 1L0VB 2N9EB 4HROA 2KWDA 4JE3B 4MH0E 2KQ7A 4F1SA 2TSSA 3ML8A 2JRHA 2G4DB 2FBWB 2IYDB 2YVCA 1ESFA 3AE9B 1CQVA 4DWFA 1HA5A 1LM8B 3TSSA 2W3SA 4OVVA 2MBOA 3B2FA 3N1XC 1JWSD 4JL9A 2DYBA 1K53A 1M4VA 1F1HA 3A9JB 1I4PA 3QIJA 1ZDXA 1MFWA 1SE3A 4YWGG 3FKYA 1JRPA 4YTNB 2ZPYA 5HKHA 4C7ZA 3BIID 1J7CA 3VDZA 2KX3A 1FIQA 3OWEB 2MLBA 3AU5A 2HJ8A 4WJQA 3R7RA 1IP9A 2WXOA 2N4FA 4N58A 4L2YA 3L16A 4BAXA 1YJJA 1UBIA 2DZMA 3EHVA 3VRAB 5C1ZA 4GDKB 1QT9A 2FIDA 2BW2A 4LNKA 5J2RA 2EMSA 3QC8B 1K52A 1V80A 2JSVX 1D5ZC 1WXAA 3CWIA 2Z8LA 1MG4A 1VJKA 2FAZA 2MBHA 3RCZA 1EO6A 4B9KA 4HPMB 3PRPB 3KW5B 1STEA 3VH4B 2K8BA 1E0ZA 2IGGA 4IG7B 1WH3A 2PKOA 4GOCA 4MGKE 3V60A 1WMHB 2PTLA 3AE7B 4FJZA 2JX5A 4WJPA 2KOXA 1D6EC 3RULA 3ONSA 1K50A 4AJYB 3DWMA 4I6LB 5GMVA 2IO3B 1UUPA 3RNGC 3M3JA 3V6CB 1IBXB 2O2VB 2W54A 4MGZE 2INNE 1PDXA 2EELA 5IKCM 2C9WB 3P63A 1NEKB 1NDDA 2M0XA 5J18A 2FCNA 1FCCC 4LDTB 3AXCA 2OHFA 2FUG1 3ECIA 4KVGB 4RNAA 3HHMA 2CHWA 3NVYA 4HCNB 4PYUA 3IXSA 2J53A 2G1EA 2WDRB 4ZOHC 2ZEQA 5D7GA 3UGBB 2L83A 1TYGB 1T3QA 2WU2B 5E6PA 1WRDB 1TS3A 3DOWA 2O6VA 3WAOA 1R7SA 2N1WA 4B6WA 3L08A 2XEWA 2KACA 3T3OA 4A3PA 2ZPNA 2I1JA 4W9GA 5KHOA 2N9XA 2LGXA 3H9DA 3NJTA 2SAKA 4WJOA 1F0ZA 3DHIC 4MACA 5H8YE 3A4RA 4K7SA 1OGWA 3N9YC 5E6JA 3HM6X 5D6JB 2WQYB 2WXLA 1KF6B 5BMGA 1MHXA 3ABVB 2M8SA 4M0WA 1FD6A 4EZLA 2KKCA 1T0QC 4HJGE 1DOYA 4US8A 4ASWC 1XO3A 4AQ7A 3EFCA 2CU1A 4HKQA 2L1AA 4P1BC 3BVGA 3AE4B 3PO0A 4DQOC 3E9SA 2KVZA 3RZFA 2Z0EB 1WJUA 4GIVA 4A55A 3J9CA 3Q8FA 4NZLB 4ZHPA 1SGHA 1P9DU 5BO4B 4HPLB 3OJ3A 3NHEB 2KFKB 3KYDD 2RD0A 3ZKJC 2JXXA 2MX2A 5EE9A 1UWXA 1WWTA 4ARCA 1TS4A 4HRSA 4OZBA 4I6PA 3AE8B 1JWBD 4GN1A 3M95A 1HTOA 3NVVA 3KUDB 5G5GA 1E10A 2GBRA 3QJZA 1N5XA 3DHHC 2LMCA 3U7ZA 1B9RA 1E6EB 5IAAC 3MJ5A 4S17A 3ZNGC 2KC2A 2IO1B 4II2B 4MGYE 2W9NA 3Q69A 1T6BX 4R3DA 1YQ3B 4GSWA 4JX1C 2OOBB 1ACCA 2KHWB 4IWPA 3R3MA 4EOYA 3A1QB 2KMCA 3AM9A 2E3TA 3ZRFA 2JUOA 2OEDA 4J3OD 2BTEA 2AQ2B 1ZGUB 3D32A 3Q3NC 3HVDA 4J6IA 1L0YB 3V3XA 4W9CA 1V9JA 3TL5A 3DBRB 3DCGA 1N63A 2V0GA 4KDIC 1ZXIA 4WAFA 2MQJA 4RGNA 2ICIA 2INCC 4L23A 3IHPC 4B0MA 3W1SC 3AMZA 3AULA 4MJSA 3VTWA 4C7YA 2GBNA 4LNOA 2D11A 3UQAA 1I4HA 2WXFA 1SSNA 1C78A 1ZXHA 3BVMA 1FFVA 3BVZA 2WXMA 4GGQA 1RM6C 2AQ3B 3PLUA 4C4VA 3IAM1 1EU3A 2W55A 2MJDA 4ZRQA 2HD5B 4ZHOA 3CSFA 2JZ3B 1KRHA 2K5PA 4MM3A 3VH3B 1TKEA 1ENFA 1N62A 1WZ0A 2UU7A 1L4ZB 2IPKD 2D3AA 5E6NA 4EEWA 4W9FA 1A70A 4ACFA 2IJ0A 3H7PA 4O1NA 4NNJB 1S1QB 4ZYSA 2V1YA 4AS1A 4UDUC 5D3DA 2M4NA 4M02A 3OJ4B 2K3UA 2CHZA 3JSVB 3QA8A 4W9IA 1F77A 2LRUA 1XLOA 1AWDA 1ROEA 3CIRB 3DPDA 4LNNA 4OVZA 4DXFA 1FXTB 2MBQA 1XLPA 4A8XC 1IGDA 3UQBA 2DENB 3CSTA 4G3XB 1JWUD 1YOVB 5D3IB 1V81A 2LVPA 1WXMA 4DXGA 2JU6X 3ZXVA 4FN2A 1J7AA 3MC8A 2BB5A 1WX7A 3VUWA 1J8CA 2BWFA 1XEEA 3SHQA 3V6EB 4XWWA 1V86A 1WXSA 4Q2JA 1NI2A 2EMTA 3AE3B 4BKSA 2UWQA 4LCDE 4ANUA 2KYWA 2C5LC 3ZW3A 4WQMA 2HTME 2KDMA 2PVGC 2J42A 5CX3A 3AEDB 3KLSX 4N59A 1TGZB 4OVUA 3JVZX 3TUOA 5BMHA 2CHXA 1KLVA 2KXJA 1I7HA 2KQSA 2A5UA 3SR6A 2KK8A 3P4RB 3V61A 1EM7A 2WX1A 3L54A 2BT6A 4NAWB 2IBIB 4HVBA 5AEKB 2NS5A 1YJIA 4XC2A 1XF5L 1WGRA 2WXKA 1FNVA 3AN1A 3L4PA 1V1PB 2Y5CA 2KQ4X 5HFYA 3ZTCA 3OAWA 1XXGA 2NPTA 3N20C 2FUHB 4IWQA 1H8CA 3DBRI 4W9LA 2MP2A 3PREA 3A4SC 2ZW0A 2G45B 3H8HA 2IY0B 1QOAA 3P42A 4K1RB 2GRIA 3W5VB 3VFKA 2WDQB 3IFWB 4DHZE 5HG2A 2BVCA 3ZIMA 1JALA 1MJDA 3TEXA 3N1YC 3RNAC 1WX9A 5DPWA 1YX6B 2IGHA 2HJ1A 4X57B 1WGYA 1JCKB 3DBHB 3ENEA 4KGSA 3W1SA 1WYWB 2J0KA 1OQQA 2JRIB 1N61A 3M63B 3HVZA 4LNIA 3U52E 3ZJUA 3RZWC 2KDFB 1YN3A 2A4ZA 1UD7A 5HHDG 4ANVA 1KLGD 3ZVVA 1TS5A 3H6NA 2L52A 1UELA 4IM0A 1G6JA 2Y5BB 4A6QA 3Q14C 3ZJVA 4G50A 2N7JA 2X8XX 4BZAA 1MG8A 2HDEA 1Q5WB 1JWMD 3P4QB 3APDA 3HIZA 2FNJB 4AUQC 1MHHE 3RNCC 3VTUA 4HPPA 3BYYB 2N0SB 2JZZA 1UGMA 1UF0A 3ZUNA 2ZCCA 1Q1OA 2BKRB 1V6EA 3PGEA 2L3ZA 4RGOS 1ET9A 3IG3A 4S0RA 3VHTC 3HK0A 2B76B 2GLSA 2KNBA 3L0WB 2KJHB 4TUUA 4ICUA 2DYMA 3PS6A 4XYCA 5FK9C 2PEAA 4E3CA 2LRWA 2HE7A 2KDIA 4MSMB 3H7SA 1WGHA 4C56C 4MT5A 1BXTA 2R2QA 2BF8B 4LJPB 4LJOB 4N9F4 2G4SA 2LXCA 2WX0A 1DOXA 2WDTB 2PPHA 1L5PA 3KUZA 2NVUI 5DPTA 4RGTA 2NTTA 3PTFC 2XBBC 2LHDA 1YIWA 4FADA 3TEWA 1TS2A 2J52A 3MP9A 3T9LA 2BGFA 3AE2B 1WJ4A 3EUB2 4NJCA 5CHWA 5FKAC 3PHWB 2DWQA 2PVOD 3U30A 3W9CB 3Q3FA 3VUXA 1HXYD 2LEKA 4A3OA 2ZNVC 4NQKE 3U7DA 4KIKA 3V05A 3PHXB 4YTMB 2JPHA 2KN4A 1SF0A 3AH7A 3C8YA 1D4BA 1XCTL 4P7IA 1TY2A 4YSYB 1RAXA 2KWCA 3P4SB 2L76A 2XN9C 1VLBA 2EKEC 4WWNA 3OG5A 1TKGA 2QCZA 3N30A 5CTRC 1GJZA 2ASQA 1E8WA 3H7PB 2NMQA 1CZPA 3B08A 3AECB 4EUTA 2WXIA 3AEGB 2WXPA 2G3QB 3B1LX 1WGGA 5FR3A 2J7QB 3W2DA 3AU4A 1TJEA 2WXNA 1E7VA 3SU8X 5H92C 3UIPB 3UF8A 3T3NA 1Q0WB 1I4QA 3BK2A 2MJEA 2NCNA 4IM2A 4W9DA 3AV8A 1EWYC 5JHBA 2PLPA 1ZDVA 4XDDA 1JQ4A 3ZDMC 4GLSC 4L1BA 1WGKA 2XK5B 1T0SC 1C4AA 1TY0A 1SB3C 1NENB 3EFUA 2L32A 3N3KB 5DPSA 5LLIA 4KKJA 2KO3A 4KGTA 3B9JA 1WJNA 1YX5B 4KZ0A 5JZEB 2L00B 4HXDA 1YD8U 2O6VD 4II3B 3GZNB 4ZYNA 4E71A 1U4AA 5G2NA 4GMVA 2OJWA 4RCOA 3M62B 4YL8A 3W5UB 3HUIA 4W9KA 1HZ6A 4TKNA 3O13A 2K6DB 2CJOA 2C7MB 3JW0X 4WWMA 2AEHA 2PE9A 4FULA 1QKZA 1M94A 3BWUD 1BUIC 1WE6A 2K25A 2Z0DB 3LXFA 4KKIA 1TTNA 2QMTA 4RF0A 2MBBB 2KTFA 4NQLB 3ZDTA 2PW9A 1WYGA 4E74A 1VR9A 1ET6A 1C76A 4DHJD 4WWOA 1XCQL 2KTRA 3NVZA 2D10A 2INDC 2BB6A 2V4LA 3B0AA 2DAJA 5JHAA 4HDOA 3PPAA 1PYWD 3DVNU 2M1MA 1J0GA 4M00A 4EKUA 3MTNB 3AB5A 4DXAB 3APCA 1RYJA 3BYTB 2L8JA 3X0WA 2KMAA 3DWGC 3VRBB 2GOWA 4GU2A 1UGJA 1MVKA 3GE8C 3QCAA 2QIEB 5T8IA 4WQOB 1WIAA 3PZ8A 3FILA 3K9OB 2RSUA 5DCNA 1PQSA 3N1ZC 2I1KA 1K51A 3W1YA 3EA6A 2MW5A 3MC0B 1D3ZA 4GDLA 2WLBA 3A9KB 2BPSA 2K8HA 4K81A 2FE8A 2MJ3A 5AZFA 4BKGA 4IOIE 4KX6B 1WF9A 1SIJA 2WS3B 1GC7A 4AJWA 1TIFA 3AEAB 2JZPA 2N9PC 2K6QA 4HWIB 4YSXB 2DZIA 1MPEA 4HKZE 4YT0B 2YEPB 3NOBA 1F2RI 2DZKA 3P1MA 2L7RA 2D07B 2WXQA 4XZ4A 4HDQA 2ACZB 2WYQA 3NS1A 4JLCA 2CKHB 4US9A 2QHOA 2BBCA 1WRIA 2N7EA 2DX5B 2R2OA 4ZDVA 3A9JA 3DBLB 1B1ZA 2KJ6A 5GXGB 3TEYA 3VR9B 2WHIA 3WANA 4GB9A 2MEKA 4XX5A 3ZGZA 1V49A 4AOFA 5TSSA 3RMKC 3UI3A
chains in the Genus database with same CATH topology
1V1PB 1JRPA 2Y5CA 4YTNB 2KQ4X 4C7ZA 1F2RC 3BIID 1J7CA 5HFYA 1FIQA 1XXGA 4EE2A 3OWEB 4MH8A 3Q8AA 2WXOA 1I4GA 4N58A 2ZW0A 1RFKA 4L2YA 3H8HA 1YJJA 2H88B 1QOAA 3P42A 3VRAB 2GRIA 3W5VB 1FFUA 4GDKB 1KH0A 2WDQB 1QT9A 2BW2A 2V4IB 1GB1A 5HG2A 1GPXA 1K52A 3URYA 1AYFA 3NRZA 2K0PA 2JSVX 1D5ZC 1JALA 3CWIA 3TEXA 3KWVA 2IGHA 2Z8LA 2QSDA 1VJKA 1SJED 2SEBD 3WCQA 1JCKB 2RMMA 4KGSA 3W1SA 4ZRPA 2IGDA 3ETRA 1FMAD 1OQQA 2LGIA 1N61A 5BYRA 1STEA 1WSPA 3HVZA 3U52E 1SE4A 1KTKA 2G9HD 3ZJUA 2IDYA 1YN3A 4FXCA 5HHDG 1KLGD 2PIAA 1E0ZA 2VZKB 2IGGA 3GS2A 2PKOA 1TS5A 2RPVA 2L52A 4TQ0A 2PTLA 4A6QA 3AE7B 2JX5A 2E6XA 1JWAD 1NI3A 5LNK1 3ZJVA 1D6EC 1YN4A 4YSZB 2DLBA 3BZDB 1VZ7A 2N7JA 1IBXA 1K50A 2HDEA 1L4DB 3DWMA 1JWMD 3P4QB 4JWSC 2V3NA 4P16A 4A90A 1UUPA 4YWGG 3BK1A 1SE2A 1FM0D 1HZ5A 1MHHE 3BYYB 1QOGA 4OW0A 2N0SB 1C4PA 3ZQ4A 1IBXB 2W54A 2INNE 3RFZB 1PDXA 5BYQA 2EELA 3P63A 1NEKB 1PUTA 4ARIA 4N6EB 1FCCC 1Y56A 4RGOS 5EE1A 1ET9A 2OHFA 1V8CA 2FUG1 1C79A 4RNAA 2B76B 1NVID 1VRAB 1FRDA 1C77A 1XLNA 3NVYA 1P7FA 1TZOA 4WH4A 5JXVA 1SJHD 1J7BA 1RWSA 2DYMA 4RGMA 1GAQB 1KLUD 1T5XD 3IXSA 5FK9C 2J53A 2G1EA 2WDRB 1OQRA 2WU5B 4ZOHC 5D7GA 3NVWA 2L83A 1TYGB 1T3QA 2WU2B 2CJNA 3SEBA 1TS3A 3SFEB 1R7SA 4C56C 4MT5A 1BXTA 2KACA 3T3OA 1ZOYB 1L6VA 2D5GA 2CU3A 1DOXA 2PMVA 2WXGA 2SAKA 1FNUA 1L5PA 2RDHA 3GB1A 1F0ZA 4RGTA 4ITKA 2RDGA 1FRRA 4A9AA 3MHZA 4MACA 2NTTA 4IKGA 5H8YE 2LHDA 3N9YC 2R61A 5E6JA 1QF6A 1C9FA 1L6UA 2WQYB 2WXLA 3TEWA 1TS2A 1KF6B 2J52A 2M19A 1MHXA 3MP9A 4TSSA 3AE2B 5BMGA 1EWCA 1DYQA 3ABVB 2JYEA 2QJLA 3KQ4A 4M0WA 3EUB2 4NJCA 5FKAC 2DWQA 2PVOD 1FD6A 3IT6B 4HJGE 3W9CB 1WXQA 4JPSA 1DOYA 1HXYD 4US8A 1XO3A 4AQ7A 1FXAA 2LEKA 1VZ8A 2VZKD 2L1AA 3V05A 4HKQA 1FCLA 4YTMB 4RH6A 1MI0A 3BVGA 3AE4B 3PO0A 2KN4A 4DQOC 3E9SA 1SF0A 3AH7A 3C8YA 1D4BA 4RF1A 1XCTL 3IT4B 2KMMA 4A55A 2N9KA 3J9CA 1TY2A 3Q8FA 4NZLB 4YSYB 4ZHPA 2LHEA 3P4SB 2XN9C 1VLBA 1ZP0B 1TKGA 1CK1A 3AE6B 2AX5A 5EE3A 1PGXA 1UWXA 5EE9A 1WWTA 4ARCA 1TS4A 3B2GA 4HRSA 3Q8BA 1SBBB 2NTSA 1SXTA 4OZBA 2ONQA 2NMQA 1CZPA 3AE8B 1JWBD 4YTPB 3AECB 2WXIA 3NVVA 4B0EA 3AEGB 1QILA 2WXPA 1Q10A 5I4DA 1OFFA 1FO4A 2BS2B 5FR3A 5G5GA 3W2DA 1BMLC 1TJEA 1E10A 2WXNA 4IDIA 1ZUD2 5H92C 3T3NA 2YEPF 1I4QA 2JXTA 1N5XA 2MJEA 2LMCA 3BK2A 1IGCA 1QOBA 3AV8A 1DGJA 3VQIA 1EWYC 3U7ZA 2PLPA 5BMIA 1B9RA 1E6EB 3IAS1 1JMLA 3MJ5A 2Y5PA 3NUHB 1KFYB 1ZDVA 1P7EA 2H89B 4XDDA 1JQ4A 4GLSC 4L1BA 2M0AA 1WGKA 2LUMA 1C4AA 3AEEB 3Q69A 1T6BX 2MH7A 4HEA1 1TY0A 1SB3C 4R3DA 1YQ3B 4JX1C 3AE5B 1NENB 2L32A 2BS4B 1IUEA 1ACCA 2GI9A 2ZW1A 4RFBA 4KKJA 3Q8EA 4KGTA 3B9JA 4OZAA 1YNTE 1AW7A 3FC4A 2KAJA 3AM9A 5AUIA 2E3TA 4XDCA 3SFDB 2V3PA 5G5HA 2OEDA 3AEFB 4J3OD 2BTEA 2AQ2B 5C2TB 3AE1B 3LB8C 1LO5D 3HVDA 1L0YB 2QILA 3V3XA 1N60A 3NZ3A 3E56A 2DBYA 4RCOA 3TEZA 1N63A 4TMAB 2V0GA 2Y3AA 3W5UB 3HUIA 3I9V1 1ZXIA 4WAFA 3VR8B 1HZ6A 4RGNA 4NAMA 2ICIA 2ON8A 1GOZA 3R2TA 2K9XA 3O13A 3R2IA 1CJEA 2CJOA 1VDVA 1V1OA 4L23A 4WWMA 1GB4A 1PGAA 4XWTA 1L0XB 4B0MA 1AN8A 3AMZA 1NYRA 1QKZA 3BWUD 4LLGM 1BUIC 1V97A 4C7YA 5MPOA 1QQRA 4LTUA 3AEBB 1I4HA 2DYOA 2WXFA 3LXFA 1PGBA 4C80A 1SSNA 2BYTA 4KGRA 4KKIA 2W3RA 1DOIA 1C78A 1ZXHA 2QMTA 4RF0A 5BYSA 3BVMA 1FFVA 1FXIA 3BVZA 4YXDB 2WXMA 1RM6C 2AQ3B 2PW9A 1WYGA 3IAM1 1VR9A 2K22A 2N9LA 1ET6A 1C76A 2AQ1B 1EU3A 2W55A 2MJDA 4ZRQA 3HRDD 3PZ7A 1E9MA 5AUKA 2EKIA 2Q5WD 2JYTA 2XNAC 1XCQL 4ZHOA 2W82A 1YMHE 2M56B 1KRHA 2K5PA 4XE0A 3NVZA 4USAA 3ZJTA 1TKEA 1ENFA 1N62A 2BB6A 4H2AA 4JWUC 4WURA 1L4ZB 2IPKD 2WNMA 4OZCA 2WXJA 3MFGA 2QEJC 1A70A 3U2SC 1JROA 1YQ4B 2JWUA 2IJ0A 1PYWD 4MM3B 1NYQA 4O1NA 1ZPSA 2X38A 4ZYSA 1FEHA 2BS3B 1D5MC 4AS1A 1EU4A 1D5XC 4UDUC 5D3DA 3AB5A 1YN5A 4D2KA 3I57A 2JQRB 4OHJA 1RYJA 3BYTB 2INPE 2LFIA 3DWGC 3VRBB 3P4PB 2K3UA 1I4XA 1UGJA 1F77A 1XLOA 1AWDA 2I38A 3EGRA 1MVKA 5EE0A 1ROEA 3CIRB 2QIEB 5T8IA 3GP7A 3PZ8A 1UNSA 1XLQA 2WP9B 4OVZA 3FILA 4DXFA 1I4RA 4A8XC 1XLPA 3LYYA 1IGDA 1HEZE 1JWUD 1QLBB 2I2YA 4REZA 1HQRD 5D3IB 1K51A 2LJIA 3EA6A 3U4EG 3MC0B 3FILB 4DXGA 2JU6X 3RPFC 2WLBA 1JW9D 1UWMA 1TKYA 1J7AA 2FE8A 2BB5A 2MJ3A 2WXHA 1N5WA 4TQ1A 4GDLB 4LK0M 2J4XA 2WXRA 3KWLA 1XEEA 4IOIE 1L0VB 4KX6B 4XWWA 1SIJA 4HROA 1E7PB 4Q2JA 2WS3B 2KWDA 3AE3B 4JE3B 3AEAB 2JZPA 2TSSA 4YSXB 1MPEA 4HKZE 4YT0B 4WIPA 2YEPB 4WQMA 1C4CA 1F2RI 3P1MA 2FBWB 2HTME 1QOFA 2KDMA 2PVGC 2J42A 3AEDB 3R8BA 3KLSX 4N59A 3ZYYX 1ESFA 5HI1A 1VZ6A 2WDVB 2WXQA 3AE9B 5BMHA 1CQVA 2ACZB 3NS1A 1HA5A 4US9A 3TUOA 3TSSA 1ZE3D 2BBCA 2GB1A 1I7HA 4CQNA 3FAHA 4P6VF 1WRIA 3Q8CA 2W3SA 3SR6A 5C3JB 3P4RB 1FNWA 3B2FA 1B1ZA 1PFDA 1EM7A 5GXGB 3TEYA 1V1PA 2BT6A 3VR9B 1JWSD 1SEBD 4NAWB 4PT5A 1K53A 2MEKA 3ZGZA 1M4VA 1YJIA 1I4PA 1XF5L 5TSSA 1ZDXA 3UI3A 1SE3A 2WXKA 1FNVA 3AN1A 3L4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IDI A;  1JRP A;  1ZUD 2;  2Y5C A;  4YTN B;  5H92 C;  4C7Z A;  1J7B A;  2BS3 B;  2MJE A;  1J7C A;  1RWS A;  1N5X A;  3BII D;  1FIQ A;  1GAQ B;  1DGJ A;  1QOB A;  1EWY C;  3AB5 A;  3AV8 A;  2JQR B;  2G1E A;  2WDR B;  1OQR A;  1E6E B;  1RYJ A;  2WU5 B;  4ZOH C;  1B9R A;  3NVW A;  2L83 A;  1TYG B;  3DWG C;  1KFY B;  3VRB B;  1T3Q A;  3P4P B;  2H89 B;  1JQ4 A;  2WU2 B;  2CJN A;  1WGK A;  1XLO A;  4N58 A;  3AEE B;  1AWD A;  1RFK A;  5EE0 A;  3SFE B;  1ROE A;  2MH7 A;  3CIR B;  1R7S A;  1SB3 C;  2QIE B;  1YQ3 B;  1YJJ A;  2H88 B;  1QOA A;  4JX1 C;  3AE5 B;  3VRA B;  1NEN B;  2WP9 B;  1XLQ A;  3W5V B;  1FFU A;  2BS4 B;  1IUE A;  2WDQ B;  1QT9 A;  1XLP A;  1ZOY B;  1L6V A;  1QLB B;  2CU3 A;  3B9J A;  1DOX A;  1GPX A;  3NVY A;  1AYF A;  1L5P A;  3NRZ A;  3FC4 A;  2KAJ A;  1JAL A;  3AM9 A;  3CWI A;  5AUI A;  1E10 A;  2E3T A;  4ITK A;  3SFD B;  5G5H A;  1F0Z A;  1FRR A;  4A9A A;  3AEF B;  5H8Y E;  1VJK A;  5C2T B;  3RPF C;  3WCQ A;  1QF6 A;  2WLB A;  3AE1 B;  3LB8 C;  1L6U A;  2WQY B;  1JW9 D;  1UWM A;  1KF6 B;  1N60 A;  1TKY A;  2M19 A;  3AE2 B;  2DBY A;  3ABV B;  3ETR A;  1FMA D;  1OQQ A;  2QJL A;  1J7A A;  1N61 A;  3EUB 2;  2MJ3 A;  1N63 A;  3HVZ A;  3W5U B;  1N5W A;  2DWQ A;  3HUI A;  2PVO D;  1ZXI A;  3VR8 B;  3KWL A;  3W9C B;  1WXQ A;  4FXC A;  1L0V B;  1DOY A;  4KX6 B;  2PIA A;  4US8 A;  1E0Z A;  1SIJ A;  2K9X A;  4HRO A;  1XO3 A;  1E7P B;  1FXA A;  2LEK A;  2WS3 B;  1CJE A;  2CJO A;  2PKO A;  1VDV A;  4WWM A;  3AE3 B;  2L52 A;  4YTM B;  3AEA B;  3AMZ A;  1NYR A;  3AE7 B;  2JX5 A;  3AE4 B;  3PO0 A;  4YSX B;  1JWA D;  1V97 A;  1SF0 A;  4C7Y A;  3AH7 A;  5MPO A;  4YT0 B;  1NI3 A;  4LTU A;  4WQM A;  3AEB B;  4C80 A;  3LXF A;  4YSZ B;  3P1M A;  2FBW B;  2KMM A;  2HTM E;  1DOI A;  2W3R A;  1QOF A;  2PVG C;  1FFV A;  1FXI A;  3AED B;  3DWM A;  4N59 A;  4YSY B;  3P4Q B;  3ZYY X;  4JWS C;  4YXD B;  4ZHP A;  1RM6 C;  3P4S B;  1WYG A;  2WDV B;  1VLB A;  3AE9 B;  1ZP0 B;  2K22 A;  1TKG A;  2ACZ B;  3NS1 A;  4US9 A;  1FM0 D;  2W55 A;  2MJD A;  1I7H A;  1QOG A;  3AE6 B;  2N0S B;  3FAH A;  2AX5 A;  3HRD D;  4P6V F;  1WRI A;  1E9M A;  2W54 A;  2W3S A;  1WWT A;  5EE3 A;  5EE9 A;  5AUK A;  3SR6 A;  5C3J B;  1PDX A;  2EKI A;  2Q5W D;  3B2G A;  3P4R B;  4HRS A;  4ZHO A;  3P63 A;  1NEK B;  1PUT A;  3B2F A;  1PFD A;  2M56 B;  1KRH A;  2K5P A;  3L4P A;  3NVZ A;  1CZP A;  4N6E B;  4USA A;  5GXG B;  1TKE A;  3AE8 B;  1JWB D;  1N62 A;  2BT6 A;  3AEC B;  4YTP B;  4JWU C;  5EE1 A;  3VR9 B;  3NVV A;  2OHF A;  3AEG B;  1V8C A;  2B76 B;  1NVI D;  1YJI A;  1FRD A;  1OFF A;  1A70 A;  1FO4 A;  2BS2 B;  1JRO A;  1YQ4 B;  5G5G A;  1XLN A;  1NYQ A;  3AN1 A;  1TJE A; 
#chains in the Genus database with same CATH topology
 5IA7 A;  1ZKH A;  3GZN I;  2KDB A;  2MSE D;  2MWS B;  4MH8 A;  2WWZ A;  3L17 A;  1I4G A;  3NZS A;  3NZU A;  2BYF A;  2H88 B;  1FFU A;  5KHQ A;  1KH0 A;  3VUY A;  4IUM B;  2V4I B;  1GB1 A;  4M8M A;  3PT2 B;  4EZK A;  2K0P A;  3KWV A;  4IC7 B;  1NBF C;  3L10 B;  1A5R A;  4HK2 A;  2SEB D;  3PSE B;  3WCQ A;  5JH5 C;  4WAA A;  3I5J C;  2IGD A;  1FMA D;  4DBG A;  1XQQ A;  1WSP A;  1WMH A;  5FR6 A;  4NJ7 A;  5IOI A;  3TCA A;  1KTK A;  2G9H D;  2C60 A;  1JWA D;  4EFO A;  1XD3 B;  2DLB A;  4CO7 A;  1IBX A;  4IWO A;  1L4D B;  3X23 A;  4P16 A;  2V3N A;  4A90 A;  2KD0 A;  4BKS D;  3QQ8 B;  3BK1 A;  1FM0 D;  1HZ5 A;  2K8C A;  3IVF A;  1QOG A;  4OW0 A;  1C4P A;  2D3C A;  1WGD A;  3SDL C;  2LAS A;  1Y56 A;  5EE1 A;  4BKT A;  1WR1 A;  2DHZ A;  4JIO U;  1TZO A;  4WH4 A;  5JXV A;  1SJH D;  1RWS A;  4RGM A;  1UZX B;  1KLU D;  1T5X D;  4HLE A;  1OQR A;  2WU5 B;  3NVW A;  2LGS A;  2KZR A;  5CHV C;  3SEB A;  1V2Y A;  3UIN B;  3SFE B;  4BFR A;  2RR9 A;  3PV1 A;  1ZOY B;  1L6V A;  2D5G A;  2CU3 A;  2WXG A;  1V5O A;  2O6V B;  3KVF B;  2RDG A;  3ZNI D;  1AAR A;  3UIO B;  3MHZ A;  5D2M B;  3AI5 A;  3R7Q A;  2DZJ A;  1QF6 A;  1C9F A;  1L6U A;  2J0M A;  2M19 A;  4TSS A;  1EWC A;  3KQ4 A;  2RGF A;  2VH1 A;  1WR6 E;  1BT0 A;  3DHG C;  1V5T A;  3N32 A;  3DBL I;  4M0W B;  2OJR A;  1EF1 A;  2VZK D;  2VRR B;  1E5W A;  4RH6 A;  1MI0 A;  2NBW B;  3V62 A;  1QZE A;  1P1A A;  3RD2 A;  1Y8R C;  3IT4 B;  1L7Y A;  2N9K A;  3WAP A;  2KT7 A;  1R4N B;  1OEY J;  2KTR B;  5DPR A;  4LNF A;  2LHE A;  5CHF A;  3CMM B;  1ZP0 B;  3VTV A;  2C7N B;  4DHJ B;  5LXH A;  3AE6 B;  2AX5 A;  5EE3 A;  3B2G A;  1SBB B;  4IW0 A;  1SXT A;  3DVN V;  4GXB A;  2BQQ A;  3TMP B;  3L13 A;  4AP4 C;  1LFD A;  1Q10 A;  2PJH A;  1WFY A;  5I4D A;  1OFF A;  2BS2 B;  3PVL A;  1TBE A;  2FCQ A;  3SD5 A;  4IDI A;  4HCP B;  3PRZ A;  3IBE A;  2JXT A;  4AWJ A;  3IAS 1;  1JML A;  3NG0 A;  1X1M A;  3NUH B;  1P7E A;  2M0A A;  2ZVO A;  3A1Q A;  4HEA 1;  2BS4 B;  2ZW1 A;  4ZRI A;  4RFB A;  3Q8E A;  2J0J A;  1LXD A;  2LGY A;  1Z2M A;  4OZA A;  2NBU A;  1AW7 A;  1R4M B;  5AUI A;  4MEM A;  3WA0 A;  3CF6 E;  2V3P A;  3AEF B;  5C2T B;  2HTH A;  3PZD A;  3LB8 C;  3EEC A;  2FIF A;  1N60 A;  3E56 A;  1I35 A;  3TEZ A;  4NY0 A;  4BBN C;  4K3B A;  4TMA B;  3ZNH B;  1GG3 A;  1E8X A;  3VR8 B;  4NAM A;  3VXW A;  2ON8 A;  2K9X A;  3R2I A;  5EDS A;  1V1O A;  1LGR A;  2LI5 A;  4XWT A;  3KYC D;  3A33 B;  3WAM A;  1E7U A;  1NYR A;  1F52 A;  4LLG M;  4CYE A;  1V97 A;  1HE8 A;  5MPO A;  2KAN A;  4LTU A;  3I63 C;  2AL6 A;  2W3R A;  3TBL D;  5BYS A;  3ZNZ B;  1FXI A;  4YXD B;  2GMI C;  3P2B A;  4MJS B;  1SE9 A;  2N9L A;  4BBN F;  5TR5 A;  3HRD D;  2AYO B;  3PZ7 A;  5AUK A;  2KLG A;  2EKI A;  2Q5W D;  2L05 A;  2JYT A;  2XNA C;  4C4V B;  2W82 A;  2M56 B;  4JQW C;  4H2A A;  4JWU C;  4KV2 A;  4WUR A;  1E90 A;  2WNM A;  2WXJ A;  2QEJ C;  3U2S C;  1GC6 A;  1JRO A;  1YQ4 B;  4NJ6 A;  1N6Z A;  1E8Y A;  4MM3 B;  1NYQ A;  1IYF A;  2ZCB A;  3JSV A;  2AL3 A;  3Q3M C;  1D5M C;  3ZO5 B;  4D2K A;  3I57 A;  4RM8 A;  4MSQ B;  4FJY A;  2LFI A;  4K3C A;  3DVG X;  1WJ6 A;  1I4X A;  3JYU A;  3EGR A;  3ZLZ A;  3OLM D;  2IO2 B;  1C3T A;  1SIF A;  1UNS A;  2WP9 B;  1I4R A;  2BYV E;  1GUA B;  3LYY A;  1OTR B;  1QLB B;  2I2Y A;  1HQR D;  4MDK E;  3U4E G;  3DBH I;  3NS8 A;  2REX A;  2VH2 A;  3RPF C;  3Q6B A;  1P3Q U;  4KSK C;  1R4N I;  1EUV B;  2WGS A;  2ZVN A;  4BOS C;  5IO9 A;  3TJP A;  4ZRK A;  2N1V A;  3HM3 A;  4HJK A;  1VD2 A;  4TQ1 A;  4LK0 M;  2K1F A;  2YLM A;  5E6O A;  1E7P B;  2B3A A;  2QC8 A;  4TV3 A;  2JF5 A;  5AZG A;  3RT3 B;  1YQB A;  1GNU A;  4JGH B;  1RFA A;  4DK5 A;  1RRB A;  3PLV A;  4WIP A;  1C4C A;  1QOF A;  3QK0 A;  4I6N B;  3R8B A;  4PS3 A;  3ZYY X;  4WJN A;  3Q2A C;  5HI1 A;  1VZ6 A;  2WDV B;  2GBJ A;  2JT4 B;  1ZE3 D;  2GB1 A;  4CQN A;  3FAH A;  1TZ1 A;  2K39 A;  4P6V F;  3Q8C A;  4NAW A;  4NPN A;  5C3J B;  5D94 A;  4KSL C;  1FNW A;  3K9P B;  1OQY A;  1PFD A;  3DVG Y;  1V1P A;  2KFJ A;  1SEB D;  4FLH A;  3RYT A;  4PT5 A;  4PYZ A;  1F9J A;  1R4M I;  4ANW A;  1H4R A;  4P1C C;  3PRM B;  1UH6 A;  1L2N A;  1F2R C;  4EE2 A;  3GOE A;  1CMX B;  5L83 A;  3C0R B;  3Q8A A;  4C00 A;  2GBK A;  1UBQ A;  4W9H A;  3VAW A;  1RFK A;  4W9E A;  2NPT B;  2GBM A;  2L0F A;  4CHK A;  5AZH A;  2MRP A;  2KC1 A;  1WXV A;  2MP2 B;  1GPX A;  3URY A;  1AYF A;  3KH0 A;  3NRZ A;  3BY4 B;  2QSD A;  1SJE D;  1WM2 A;  2RMM A;  4F8C B;  4K7W A;  4ZRP A;  3ETR A;  2LGI A;  5BYR A;  1SE4 A;  1TT5 B;  4MEL A;  1IPG A;  2IDY A;  4FXC A;  5C23 A;  2PIA A;  2VZK B;  3GS2 A;  2RPV A;  2UYZ B;  3NY5 A;  3QAQ A;  4TQ0 A;  1FPY A;  2E6X A;  1J19 A;  2M17 A;  3QHT A;  1NI3 A;  4XGA B;  5LNK 1;  1YN4 A;  4YSZ B;  3BZD B;  2NBV B;  1VZ7 A;  4ICV A;  4JWS C;  2RPQ A;  3ALB A;  1SE2 A;  2BWE S;  2IY1 B;  2JVC A;  3ZQ4 A;  1ZW7 A;  3RFZ B;  5BYQ A;  4DDG D;  2KLC A;  1PUT A;  1JRU A;  4ARI A;  4N6E B;  2KJR A;  3RI7 C;  1V8C A;  1C79 A;  1NVI D;  1VRA B;  1FRD A;  1C77 A;  3S2A A;  4URK A;  3ZRC A;  1XLN A;  1P7F A;  4PK1 A;  1J7B A;  1GAQ B;  2BKF A;  5LXI B;  4ZRJ A;  2LD9 A;  2CJN A;  1WE7 A;  3MC9 A;  4KZC A;  1WZ3 A;  2Z59 B;  3LJ3 A;  4IM3 A;  3RNB C;  2BYE A;  2LGD A;  2PMV A;  1FNU A;  3T8M A;  2RDH A;  3GB1 A;  3MJW A;  4ITK A;  3VVW B;  1FRR A;  4A9A A;  4IKG A;  2KN5 A;  3DQV A;  2R61 A;  4GDK A;  1EF5 A;  1YJ1 A;  1DYQ A;  2JYE A;  4M01 A;  2QJL A;  2LXA A;  2AWT A;  3IT6 B;  1WXQ A;  2IO0 B;  4JPS A;  4DHZ B;  2V3S A;  1FXA A;  3RNE C;  1VZ8 A;  1FCL A;  2JY6 A;  3RNF C;  4RF1 A;  4KIK B;  4RM9 A;  2KMM A;  1WI0 A;  1KOT A;  3GE3 C;  5J17 A;  4G0N B;  1CK1 A;  1WX8 A;  1Z5S B;  1PGX A;  2DNF A;  4WWP A;  3RN9 C;  3Q8B A;  3H1U A;  2NTS A;  2ONQ A;  2LUE A;  1KJT A;  4YTP B;  1WY8 A;  3Q3J A;  4B0E A;  2MCN B;  1QIL A;  4LDT D;  4BVU C;  2O2V A;  4K7U A;  3ZTD A;  1FO4 A;  1C1Y B;  1BML C;  1T0R C;  5IP4 D;  3DDC B;  1ZUD 2;  2XK5 A;  2YEP F;  4FHJ A;  1IGC A;  1QOB A;  2L0T A;  1DGJ A;  4KDL B;  3VQI A;  3QWZ B;  5BMI A;  1KM7 A;  2MBE A;  4G11 A;  2Y5P A;  1KFY B;  4ANX A;  2H89 B;  2RDB C;  2JWZ A;  1P0R A;  2LUM A;  3AEE B;  3EC8 A;  3WIM A;  2MH7 A;  3C19 A;  3AE5 B;  1IUE A;  2GI9 A;  2MA9 B;  4DDI D;  2CS4 A;  2N7D A;  5L95 C;  2LVQ A;  3QX1 A;  3ML9 A;  1YNT E;  1LQB A;  3FC4 A;  2KAJ A;  1I42 A;  2D3G A;  4XDC A;  3SFD B;  5G5H A;  3ZXR A;  4PS8 A;  3RUI B;  2MHJ A;  3MHS D;  4FHK A;  4A20 A;  3AE1 B;  1LO5 D;  2IZV B;  2QIL A;  3NZ3 A;  2DBY A;  4QAY A;  4BOZ B;  4M8N A;  4F7Z A;  2Y3A A;  2PE6 B;  3I9V 1;  4PS7 A;  1GOZ A;  2FCM A;  3R2T A;  1OEY A;  1CJE A;  1VDV A;  1RLF A;  1GB4 A;  1PGA A;  1L0X B;  1AN8 A;  1P98 A;  3I3T B;  2DAF A;  2KWU B;  1QQR A;  3AEB B;  2DYO A;  4C80 A;  2BYT A;  5G55 A;  1PGB A;  4FA6 A;  4KGR A;  1DOI A;  3Q3O C;  2D2Q A;  2KWV B;  2KX0 A;  2QDF A;  1ISN A;  2K22 A;  1S3S G;  2ZJD A;  2AQ1 B;  4B95 A;  3R66 C;  1E9M A;  3U8Z A;  2LJ5 A;  4MGI E;  1YMH E;  2NR2 A;  3BIN A;  4XE0 A;  4USA A;  3ZJT A;  2KFK A;  4RMA A;  2LVO A;  4OZC A;  3MFG A;  2KVR A;  5IN7 A;  2JWU A;  1VCB A;  2ZZP B;  1ZPS A;  2X38 A;  1FEH A;  2D3B A;  2BS3 B;  2LZ6 A;  3QAR A;  4W9J A;  1EU4 A;  1D5X C;  4EZJ A;  1YN5 A;  2C7H A;  2FCS A;  2JQR B;  4OHJ A;  2INP E;  3P4P B;  2I38 A;  5EE0 A;  2V9H A;  1WM3 A;  1T0Y A;  1E8Z A;  3GP7 A;  4FJV B;  1XLQ A;  2CR5 A;  3APF A;  3TIX A;  1HEZ E;  3A9K A;  3KUC B;  4REZ A;  4FBJ B;  2LJI A;  1XT9 B;  3FIL B;  3DBS A;  1HTQ A;  2KDE B;  3LDZ E;  1JW9 D;  1UWM A;  1TKY A;  3O65 B;  1K8R B;  2LWP A;  2WXH A;  1N5W A;  3WAL A;  2ZNV B;  4GDL B;  2J4X A;  2WXR A;  3KWL A;  1L0V B;  2N9E B;  4HRO A;  2KWD A;  4JE3 B;  4MH0 E;  2KQ7 A;  4F1S A;  2TSS A;  3ML8 A;  2JRH A;  2G4D B;  2FBW B;  2IYD B;  2YVC A;  1ESF A;  3AE9 B;  1CQV A;  4DWF A;  1HA5 A;  1LM8 B;  3TSS A;  2W3S A;  4OVV A;  2MBO A;  3B2F A;  3N1X C;  1JWS D;  4JL9 A;  2DYB A;  1K53 A;  1M4V A;  1F1H A;  3A9J B;  1I4P A;  3QIJ A;  1ZDX A;  1MFW A;  1SE3 A;  4YWG G;  3FKY A;  1JRP A;  4YTN B;  2ZPY A;  5HKH A;  4C7Z A;  3BII D;  1J7C A;  3VDZ A;  2KX3 A;  1FIQ A;  3OWE B;  2MLB A;  3AU5 A;  2HJ8 A;  4WJQ A;  3R7R A;  1IP9 A;  2WXO A;  2N4F A;  4N58 A;  4L2Y A;  3L16 A;  4BAX A;  1YJJ A;  1UBI A;  2DZM A;  3EHV A;  3VRA B;  5C1Z A;  4GDK B;  1QT9 A;  2FID A;  2BW2 A;  4LNK A;  5J2R A;  2EMS A;  3QC8 B;  1K52 A;  1V80 A;  2JSV X;  1D5Z C;  1WXA A;  3CWI A;  2Z8L A;  1MG4 A;  1VJK A;  2FAZ A;  2MBH A;  3RCZ A;  1EO6 A;  4B9K A;  4HPM B;  3PRP B;  3KW5 B;  1STE A;  3VH4 B;  2K8B A;  1E0Z A;  2IGG A;  4IG7 B;  1WH3 A;  2PKO A;  4GOC A;  4MGK E;  3V60 A;  1WMH B;  2PTL A;  3AE7 B;  4FJZ A;  2JX5 A;  4WJP A;  2KOX A;  1D6E C;  3RUL A;  3ONS A;  1K50 A;  4AJY B;  3DWM A;  4I6L B;  5GMV A;  2IO3 B;  1UUP A;  3RNG C;  3M3J A;  3V6C B;  1IBX B;  2O2V B;  2W54 A;  4MGZ E;  2INN E;  1PDX A;  2EEL A;  5IKC M;  2C9W B;  3P63 A;  1NEK B;  1NDD A;  2M0X A;  5J18 A;  2FCN A;  1FCC C;  4LDT B;  3AXC A;  2OHF A;  2FUG 1;  3ECI A;  4KVG B;  4RNA A;  3HHM A;  2CHW A;  3NVY A;  4HCN B;  4PYU A;  3IXS A;  2J53 A;  2G1E A;  2WDR B;  4ZOH C;  2ZEQ A;  5D7G A;  3UGB B;  2L83 A;  1TYG B;  1T3Q A;  2WU2 B;  5E6P A;  1WRD B;  1TS3 A;  3DOW A;  2O6V A;  3WAO A;  1R7S A;  2N1W A;  4B6W A;  3L08 A;  2XEW A;  2KAC A;  3T3O A;  4A3P A;  2ZPN A;  2I1J A;  4W9G A;  5KHO A;  2N9X A;  2LGX A;  3H9D A;  3NJT A;  2SAK A;  4WJO A;  1F0Z A;  3DHI C;  4MAC A;  5H8Y E;  3A4R A;  4K7S A;  1OGW A;  3N9Y C;  5E6J A;  3HM6 X;  5D6J B;  2WQY B;  2WXL A;  1KF6 B;  5BMG A;  1MHX A;  3ABV B;  2M8S A;  4M0W A;  1FD6 A;  4EZL A;  2KKC A;  1T0Q C;  4HJG E;  1DOY A;  4US8 A;  4ASW C;  1XO3 A;  4AQ7 A;  3EFC A;  2CU1 A;  4HKQ A;  2L1A A;  4P1B C;  3BVG A;  3AE4 B;  3PO0 A;  4DQO C;  3E9S A;  2KVZ A;  3RZF A;  2Z0E B;  1WJU A;  4GIV A;  4A55 A;  3J9C A;  3Q8F A;  4NZL B;  4ZHP A;  1SGH A;  1P9D U;  5BO4 B;  4HPL B;  3OJ3 A;  3NHE B;  2KFK B;  3KYD D;  2RD0 A;  3ZKJ C;  2JXX A;  2MX2 A;  5EE9 A;  1UWX A;  1WWT A;  4ARC A;  1TS4 A;  4HRS A;  4OZB A;  4I6P A;  3AE8 B;  1JWB D;  4GN1 A;  3M95 A;  1HTO A;  3NVV A;  3KUD B;  5G5G A;  1E10 A;  2GBR A;  3QJZ A;  1N5X A;  3DHH C;  2LMC A;  3U7Z A;  1B9R A;  1E6E B;  5IAA C;  3MJ5 A;  4S17 A;  3ZNG C;  2KC2 A;  2IO1 B;  4II2 B;  4MGY E;  2W9N A;  3Q69 A;  1T6B X;  4R3D A;  1YQ3 B;  4GSW A;  4JX1 C;  2OOB B;  1ACC A;  2KHW B;  4IWP A;  3R3M A;  4EOY A;  3A1Q B;  2KMC A;  3AM9 A;  2E3T A;  3ZRF A;  2JUO A;  2OED A;  4J3O D;  2BTE A;  2AQ2 B;  1ZGU B;  3D32 A;  3Q3N C;  3HVD A;  4J6I A;  1L0Y B;  3V3X A;  4W9C A;  1V9J A;  3TL5 A;  3DBR B;  3DCG A;  1N63 A;  2V0G A;  4KDI C;  1ZXI A;  4WAF A;  2MQJ A;  4RGN A;  2ICI A;  2INC C;  4L23 A;  3IHP C;  4B0M A;  3W1S C;  3AMZ A;  3AUL A;  4MJS A;  3VTW A;  4C7Y A;  2GBN A;  4LNO A;  2D11 A;  3UQA A;  1I4H A;  2WXF A;  1SSN A;  1C78 A;  1ZXH A;  3BVM A;  1FFV A;  3BVZ A;  2WXM A;  4GGQ A;  1RM6 C;  2AQ3 B;  3PLU A;  4C4V A;  3IAM 1;  1EU3 A;  2W55 A;  2MJD A;  4ZRQ A;  2HD5 B;  4ZHO A;  3CSF A;  2JZ3 B;  1KRH A;  2K5P A;  4MM3 A;  3VH3 B;  1TKE A;  1ENF A;  1N62 A;  1WZ0 A;  2UU7 A;  1L4Z B;  2IPK D;  2D3A A;  5E6N A;  4EEW A;  4W9F A;  1A70 A;  4ACF A;  2IJ0 A;  3H7P A;  4O1N A;  4NNJ B;  1S1Q B;  4ZYS A;  2V1Y A;  4AS1 A;  4UDU C;  5D3D A;  2M4N A;  4M02 A;  3OJ4 B;  2K3U A;  2CHZ A;  3JSV B;  3QA8 A;  4W9I A;  1F77 A;  2LRU A;  1XLO A;  1AWD A;  1ROE A;  3CIR B;  3DPD A;  4LNN A;  4OVZ A;  4DXF A;  1FXT B;  2MBQ A;  1XLP A;  4A8X C;  1IGD A;  3UQB A;  2DEN B;  3CST A;  4G3X B;  1JWU D;  1YOV B;  5D3I B;  1V81 A;  2LVP A;  1WXM A;  4DXG A;  2JU6 X;  3ZXV A;  4FN2 A;  1J7A A;  3MC8 A;  2BB5 A;  1WX7 A;  3VUW A;  1J8C A;  2BWF A;  1XEE A;  3SHQ A;  3V6E B;  4XWW A;  1V86 A;  1WXS A;  4Q2J A;  1NI2 A;  2EMT A;  3AE3 B;  4BKS A;  2UWQ A;  4LCD E;  4ANU A;  2KYW A;  2C5L C;  3ZW3 A;  4WQM A;  2HTM E;  2KDM A;  2PVG C;  2J42 A;  5CX3 A;  3AED B;  3KLS X;  4N59 A;  1TGZ B;  4OVU A;  3JVZ X;  3TUO A;  5BMH A;  2CHX A;  1KLV A;  2KXJ A;  1I7H A;  2KQS A;  2A5U A;  3SR6 A;  2KK8 A;  3P4R B;  3V61 A;  1EM7 A;  2WX1 A;  3L54 A;  2BT6 A;  4NAW B;  2IBI B;  4HVB A;  5AEK B;  2NS5 A;  1YJI A;  4XC2 A;  1XF5 L;  1WGR A;  2WXK A;  1FNV A;  3AN1 A;  3L4P A;  1V1P B;  2Y5C A;  2KQ4 X;  5HFY A;  3ZTC A;  3OAW A;  1XXG A;  2NPT A;  3N20 C;  2FUH B;  4IWQ A;  1H8C A;  3DBR I;  4W9L A;  2MP2 A;  3PRE A;  3A4S C;  2ZW0 A;  2G45 B;  3H8H A;  2IY0 B;  1QOA A;  3P42 A;  4K1R B;  2GRI A;  3W5V B;  3VFK A;  2WDQ B;  3IFW B;  4DHZ E;  5HG2 A;  2BVC A;  3ZIM A;  1JAL A;  1MJD A;  3TEX A;  3N1Y C;  3RNA C;  1WX9 A;  5DPW A;  1YX6 B;  2IGH A;  2HJ1 A;  4X57 B;  1WGY A;  1JCK B;  3DBH B;  3ENE A;  4KGS A;  3W1S A;  1WYW B;  2J0K A;  1OQQ A;  2JRI B;  1N61 A;  3M63 B;  3HVZ A;  4LNI A;  3U52 E;  3ZJU A;  3RZW C;  2KDF B;  1YN3 A;  2A4Z A;  1UD7 A;  5HHD G;  4ANV A;  1KLG D;  3ZVV A;  1TS5 A;  3H6N A;  2L52 A;  1UEL A;  4IM0 A;  1G6J A;  2Y5B B;  4A6Q A;  3Q14 C;  3ZJV A;  4G50 A;  2N7J A;  2X8X X;  4BZA A;  1MG8 A;  2HDE A;  1Q5W B;  1JWM D;  3P4Q B;  3APD A;  3HIZ A;  2FNJ B;  4AUQ C;  1MHH E;  3RNC C;  3VTU A;  4HPP A;  3BYY B;  2N0S B;  2JZZ A;  1UGM A;  1UF0 A;  3ZUN A;  2ZCC A;  1Q1O A;  2BKR B;  1V6E A;  3PGE A;  2L3Z A;  4RGO S;  1ET9 A;  3IG3 A;  4S0R A;  3VHT C;  3HK0 A;  2B76 B;  2GLS A;  2KNB A;  3L0W B;  2KJH B;  4TUU A;  4ICU A;  2DYM A;  3PS6 A;  4XYC A;  5FK9 C;  2PEA A;  4E3C A;  2LRW A;  2HE7 A;  2KDI A;  4MSM B;  3H7S A;  1WGH A;  4C56 C;  4MT5 A;  1BXT A;  2R2Q A;  2BF8 B;  4LJP B;  4LJO B;  4N9F 4;  2G4S A;  2LXC A;  2WX0 A;  1DOX A;  2WDT B;  2PPH A;  1L5P A;  3KUZ A;  2NVU I;  5DPT A;  4RGT A;  2NTT A;  3PTF C;  2XBB C;  2LHD A;  1YIW A;  4FAD A;  3TEW A;  1TS2 A;  2J52 A;  3MP9 A;  3T9L A;  2BGF A;  3AE2 B;  1WJ4 A;  3EUB 2;  4NJC A;  5CHW A;  5FKA C;  3PHW B;  2DWQ A;  2PVO D;  3U30 A;  3W9C B;  3Q3F A;  3VUX A;  1HXY D;  2LEK A;  4A3O A;  2ZNV C;  4NQK E;  3U7D A;  4KIK A;  3V05 A;  3PHX B;  4YTM B;  2JPH A;  2KN4 A;  1SF0 A;  3AH7 A;  3C8Y A;  1D4B A;  1XCT L;  4P7I A;  1TY2 A;  4YSY B;  1RAX A;  2KWC A;  3P4S B;  2L76 A;  2XN9 C;  1VLB A;  2EKE C;  4WWN A;  3OG5 A;  1TKG A;  2QCZ A;  3N30 A;  5CTR C;  1GJZ A;  2ASQ A;  1E8W A;  3H7P B;  2NMQ A;  1CZP A;  3B08 A;  3AEC B;  4EUT A;  2WXI A;  3AEG B;  2WXP A;  2G3Q B;  3B1L X;  1WGG A;  5FR3 A;  2J7Q B;  3W2D A;  3AU4 A;  1TJE A;  2WXN A;  1E7V A;  3SU8 X;  5H92 C;  3UIP B;  3UF8 A;  3T3N A;  1Q0W B;  1I4Q A;  3BK2 A;  2MJE A;  2NCN A;  4IM2 A;  4W9D A;  3AV8 A;  1EWY C;  5JHB A;  2PLP A;  1ZDV A;  4XDD A;  1JQ4 A;  3ZDM C;  4GLS C;  4L1B A;  1WGK A;  2XK5 B;  1T0S C;  1C4A A;  1TY0 A;  1SB3 C;  1NEN B;  3EFU A;  2L32 A;  3N3K B;  5DPS A;  5LLI A;  4KKJ A;  2KO3 A;  4KGT A;  3B9J A;  1WJN A;  1YX5 B;  4KZ0 A;  5JZE B;  2L00 B;  4HXD A;  1YD8 U;  2O6V D;  4II3 B;  3GZN B;  4ZYN A;  4E71 A;  1U4A A;  5G2N A;  4GMV A;  2OJW A;  4RCO A;  3M62 B;  4YL8 A;  3W5U B;  3HUI A;  4W9K A;  1HZ6 A;  4TKN A;  3O13 A;  2K6D B;  2CJO A;  2C7M B;  3JW0 X;  4WWM A;  2AEH A;  2PE9 A;  4FUL A;  1QKZ A;  1M94 A;  3BWU D;  1BUI C;  1WE6 A;  2K25 A;  2Z0D B;  3LXF A;  4KKI A;  1TTN A;  2QMT A;  4RF0 A;  2MBB B;  2KTF A;  4NQL B;  3ZDT A;  2PW9 A;  1WYG A;  4E74 A;  1VR9 A;  1ET6 A;  1C76 A;  4DHJ D;  4WWO A;  1XCQ L;  2KTR A;  3NVZ A;  2D10 A;  2IND C;  2BB6 A;  2V4L A;  3B0A A;  2DAJ A;  5JHA A;  4HDO A;  3PPA A;  1PYW D;  3DVN U;  2M1M A;  1J0G A;  4M00 A;  4EKU A;  3MTN B;  3AB5 A;  4DXA B;  3APC A;  1RYJ A;  3BYT B;  2L8J A;  3X0W A;  2KMA A;  3DWG C;  3VRB B;  2GOW A;  4GU2 A;  1UGJ A;  1MVK A;  3GE8 C;  3QCA A;  2QIE B;  5T8I A;  4WQO B;  1WIA A;  3PZ8 A;  3FIL A;  3K9O B;  2RSU A;  5DCN A;  1PQS A;  3N1Z C;  2I1K A;  1K51 A;  3W1Y A;  3EA6 A;  2MW5 A;  3MC0 B;  1D3Z A;  4GDL A;  2WLB A;  3A9K B;  2BPS A;  2K8H A;  4K81 A;  2FE8 A;  2MJ3 A;  5AZF A;  4BKG A;  4IOI E;  4KX6 B;  1WF9 A;  1SIJ A;  2WS3 B;  1GC7 A;  4AJW A;  1TIF A;  3AEA B;  2JZP A;  2N9P C;  2K6Q A;  4HWI B;  4YSX B;  2DZI A;  1MPE A;  4HKZ E;  4YT0 B;  2YEP B;  3NOB A;  1F2R I;  2DZK A;  3P1M A;  2L7R A;  2D07 B;  2WXQ A;  4XZ4 A;  4HDQ A;  2ACZ B;  2WYQ A;  3NS1 A;  4JLC A;  2CKH B;  4US9 A;  2QHO A;  2BBC A;  1WRI A;  2N7E A;  2DX5 B;  2R2O A;  4ZDV A;  3A9J A;  3DBL B;  1B1Z A;  2KJ6 A;  5GXG B;  3TEY A;  3VR9 B;  2WHI A;  3WAN A;  4GB9 A;  2MEK A;  4XX5 A;  3ZGZ A;  1V49 A;  4AOF A;  5TSS A;  3RMK C;  3UI3 A; 
#chains in the Genus database with same CATH homology
 1V1P B;  1JRP A;  2Y5C A;  4YTN B;  2KQ4 X;  4C7Z A;  1F2R C;  3BII D;  1J7C A;  5HFY A;  1FIQ A;  1XXG A;  4EE2 A;  3OWE B;  4MH8 A;  3Q8A A;  2WXO A;  1I4G A;  4N58 A;  2ZW0 A;  1RFK A;  4L2Y A;  3H8H A;  1YJJ A;  2H88 B;  1QOA A;  3P42 A;  3VRA B;  2GRI A;  3W5V B;  1FFU A;  4GDK B;  1KH0 A;  2WDQ B;  1QT9 A;  2BW2 A;  2V4I B;  1GB1 A;  5HG2 A;  1GPX A;  1K52 A;  3URY A;  1AYF A;  3NRZ A;  2K0P A;  2JSV X;  1D5Z C;  1JAL A;  3CWI A;  3TEX A;  3KWV A;  2IGH A;  2Z8L A;  2QSD A;  1VJK A;  1SJE D;  2SEB D;  3WCQ A;  1JCK B;  2RMM A;  4KGS A;  3W1S A;  4ZRP A;  2IGD A;  3ETR A;  1FMA D;  1OQQ A;  2LGI A;  1N61 A;  5BYR A;  1STE A;  1WSP A;  3HVZ A;  3U52 E;  1SE4 A;  1KTK A;  2G9H D;  3ZJU A;  2IDY A;  1YN3 A;  4FXC A;  5HHD G;  1KLG D;  2PIA A;  1E0Z A;  2VZK B;  2IGG A;  3GS2 A;  2PKO A;  1TS5 A;  2RPV A;  2L52 A;  4TQ0 A;  2PTL A;  4A6Q A;  3AE7 B;  2JX5 A;  2E6X A;  1JWA D;  1NI3 A;  5LNK 1;  3ZJV A;  1D6E C;  1YN4 A;  4YSZ B;  2DLB A;  3BZD B;  1VZ7 A;  2N7J A;  1IBX A;  1K50 A;  2HDE A;  1L4D B;  3DWM A;  1JWM D;  3P4Q B;  4JWS C;  2V3N A;  4P16 A;  4A90 A;  1UUP A;  4YWG G;  3BK1 A;  1SE2 A;  1FM0 D;  1HZ5 A;  1MHH E;  3BYY B;  1QOG A;  4OW0 A;  2N0S B;  1C4P A;  3ZQ4 A;  1IBX B;  2W54 A;  2INN E;  3RFZ B;  1PDX A;  5BYQ A;  2EEL A;  3P63 A;  1NEK B;  1PUT A;  4ARI A;  4N6E B;  1FCC C;  1Y56 A;  4RGO S;  5EE1 A;  1ET9 A;  2OHF A;  1V8C A;  2FUG 1;  1C79 A;  4RNA A;  2B76 B;  1NVI D;  1VRA B;  1FRD A;  1C77 A;  1XLN A;  3NVY A;  1P7F A;  1TZO A;  4WH4 A;  5JXV A;  1SJH D;  1J7B A;  1RWS A;  2DYM A;  4RGM A;  1GAQ B;  1KLU D;  1T5X D;  3IXS A;  5FK9 C;  2J53 A;  2G1E A;  2WDR B;  1OQR A;  2WU5 B;  4ZOH C;  5D7G A;  3NVW A;  2L83 A;  1TYG B;  1T3Q A;  2WU2 B;  2CJN A;  3SEB A;  1TS3 A;  3SFE B;  1R7S A;  4C56 C;  4MT5 A;  1BXT A;  2KAC A;  3T3O A;  1ZOY B;  1L6V A;  2D5G A;  2CU3 A;  1DOX A;  2PMV A;  2WXG A;  2SAK A;  1FNU A;  1L5P A;  2RDH A;  3GB1 A;  1F0Z A;  4RGT A;  4ITK A;  2RDG A;  1FRR A;  4A9A A;  3MHZ A;  4MAC A;  2NTT A;  4IKG A;  5H8Y E;  2LHD A;  3N9Y C;  2R61 A;  5E6J A;  1QF6 A;  1C9F A;  1L6U A;  2WQY B;  2WXL A;  3TEW A;  1TS2 A;  1KF6 B;  2J52 A;  2M19 A;  1MHX A;  3MP9 A;  4TSS A;  3AE2 B;  5BMG A;  1EWC A;  1DYQ A;  3ABV B;  2JYE A;  2QJL A;  3KQ4 A;  4M0W A;  3EUB 2;  4NJC A;  5FKA C;  2DWQ A;  2PVO D;  1FD6 A;  3IT6 B;  4HJG E;  3W9C B;  1WXQ A;  4JPS A;  1DOY A;  1HXY D;  4US8 A;  1XO3 A;  4AQ7 A;  1FXA A;  2LEK A;  1VZ8 A;  2VZK D;  2L1A A;  3V05 A;  4HKQ A;  1FCL A;  4YTM B;  4RH6 A;  1MI0 A;  3BVG A;  3AE4 B;  3PO0 A;  2KN4 A;  4DQO C;  3E9S A;  1SF0 A;  3AH7 A;  3C8Y A;  1D4B A;  4RF1 A;  1XCT L;  3IT4 B;  2KMM A;  4A55 A;  2N9K A;  3J9C A;  1TY2 A;  3Q8F A;  4NZL B;  4YSY B;  4ZHP A;  2LHE A;  3P4S B;  2XN9 C;  1VLB A;  1ZP0 B;  1TKG A;  1CK1 A;  3AE6 B;  2AX5 A;  5EE3 A;  1PGX A;  1UWX A;  5EE9 A;  1WWT A;  4ARC A;  1TS4 A;  3B2G A;  4HRS A;  3Q8B A;  1SBB B;  2NTS A;  1SXT A;  4OZB A;  2ONQ A;  2NMQ A;  1CZP A;  3AE8 B;  1JWB D;  4YTP B;  3AEC B;  2WXI A;  3NVV A;  4B0E A;  3AEG B;  1QIL A;  2WXP A;  1Q10 A;  5I4D A;  1OFF A;  1FO4 A;  2BS2 B;  5FR3 A;  5G5G A;  3W2D A;  1BML C;  1TJE A;  1E10 A;  2WXN A;  4IDI A;  1ZUD 2;  5H92 C;  3T3N A;  2YEP F;  1I4Q A;  2JXT A;  1N5X A;  2MJE A;  2LMC A;  3BK2 A;  1IGC A;  1QOB A;  3AV8 A;  1DGJ A;  3VQI A;  1EWY C;  3U7Z A;  2PLP A;  5BMI A;  1B9R A;  1E6E B;  3IAS 1;  1JML A;  3MJ5 A;  2Y5P A;  3NUH B;  1KFY B;  1ZDV A;  1P7E A;  2H89 B;  4XDD A;  1JQ4 A;  4GLS C;  4L1B A;  2M0A A;  1WGK A;  2LUM A;  1C4A A;  3AEE B;  3Q69 A;  1T6B X;  2MH7 A;  4HEA 1;  1TY0 A;  1SB3 C;  4R3D A;  1YQ3 B;  4JX1 C;  3AE5 B;  1NEN B;  2L32 A;  2BS4 B;  1IUE A;  1ACC A;  2GI9 A;  2ZW1 A;  4RFB A;  4KKJ A;  3Q8E A;  4KGT A;  3B9J A;  4OZA A;  1YNT E;  1AW7 A;  3FC4 A;  2KAJ A;  3AM9 A;  5AUI A;  2E3T A;  4XDC A;  3SFD B;  2V3P A;  5G5H A;  2OED A;  3AEF B;  4J3O D;  2BTE A;  2AQ2 B;  5C2T B;  3AE1 B;  3LB8 C;  1LO5 D;  3HVD A;  1L0Y B;  2QIL A;  3V3X A;  1N60 A;  3NZ3 A;  3E56 A;  2DBY A;  4RCO A;  3TEZ A;  1N63 A;  4TMA B;  2V0G A;  2Y3A A;  3W5U B;  3HUI A;  3I9V 1;  1ZXI A;  4WAF A;  3VR8 B;  1HZ6 A;  4RGN A;  4NAM A;  2ICI A;  2ON8 A;  1GOZ A;  3R2T A;  2K9X A;  3O13 A;  3R2I A;  1CJE A;  2CJO A;  1VDV A;  1V1O A;  4L23 A;  4WWM A;  1GB4 A;  1PGA A;  4XWT A;  1L0X B;  4B0M A;  1AN8 A;  3AMZ A;  1NYR A;  1QKZ A;  3BWU D;  4LLG M;  1BUI C;  1V97 A;  4C7Y A;  5MPO A;  1QQR A;  4LTU A;  3AEB B;  1I4H A;  2DYO A;  2WXF A;  3LXF A;  1PGB A;  4C80 A;  1SSN A;  2BYT A;  4KGR A;  4KKI A;  2W3R A;  1DOI A;  1C78 A;  1ZXH A;  2QMT A;  4RF0 A;  5BYS A;  3BVM A;  1FFV A;  1FXI A;  3BVZ A;  4YXD B;  2WXM A;  1RM6 C;  2AQ3 B;  2PW9 A;  1WYG A;  3IAM 1;  1VR9 A;  2K22 A;  2N9L A;  1ET6 A;  1C76 A;  2AQ1 B;  1EU3 A;  2W55 A;  2MJD A;  4ZRQ A;  3HRD D;  3PZ7 A;  1E9M A;  5AUK A;  2EKI A;  2Q5W D;  2JYT A;  2XNA C;  1XCQ L;  4ZHO A;  2W82 A;  1YMH E;  2M56 B;  1KRH A;  2K5P A;  4XE0 A;  3NVZ A;  4USA A;  3ZJT A;  1TKE A;  1ENF A;  1N62 A;  2BB6 A;  4H2A A;  4JWU C;  4WUR A;  1L4Z B;  2IPK D;  2WNM A;  4OZC A;  2WXJ A;  3MFG A;  2QEJ C;  1A70 A;  3U2S C;  1JRO A;  1YQ4 B;  2JWU A;  2IJ0 A;  1PYW D;  4MM3 B;  1NYQ A;  4O1N A;  1ZPS A;  2X38 A;  4ZYS A;  1FEH A;  2BS3 B;  1D5M C;  4AS1 A;  1EU4 A;  1D5X C;  4UDU C;  5D3D A;  3AB5 A;  1YN5 A;  4D2K A;  3I57 A;  2JQR B;  4OHJ A;  1RYJ A;  3BYT B;  2INP E;  2LFI A;  3DWG C;  3VRB B;  3P4P B;  2K3U A;  1I4X A;  1UGJ A;  1F77 A;  1XLO A;  1AWD A;  2I38 A;  3EGR A;  1MVK A;  5EE0 A;  1ROE A;  3CIR B;  2QIE B;  5T8I A;  3GP7 A;  3PZ8 A;  1UNS A;  1XLQ A;  2WP9 B;  4OVZ A;  3FIL A;  4DXF A;  1I4R A;  4A8X C;  1XLP A;  3LYY A;  1IGD A;  1HEZ E;  1JWU D;  1QLB B;  2I2Y A;  4REZ A;  1HQR D;  5D3I B;  1K51 A;  2LJI A;  3EA6 A;  3U4E G;  3MC0 B;  3FIL B;  4DXG A;  2JU6 X;  3RPF C;  2WLB A;  1JW9 D;  1UWM A;  1TKY A;  1J7A A;  2FE8 A;  2BB5 A;  2MJ3 A;  2WXH A;  1N5W A;  4TQ1 A;  4GDL B;  4LK0 M;  2J4X A;  2WXR A;  3KWL A;  1XEE A;  4IOI E;  1L0V B;  4KX6 B;  4XWW A;  1SIJ A;  4HRO A;  1E7P B;  4Q2J A;  2WS3 B;  2KWD A;  3AE3 B;  4JE3 B;  3AEA B;  2JZP A;  2TSS A;  4YSX B;  1MPE A;  4HKZ E;  4YT0 B;  4WIP A;  2YEP B;  4WQM A;  1C4C A;  1F2R I;  3P1M A;  2FBW B;  2HTM E;  1QOF A;  2KDM A;  2PVG C;  2J42 A;  3AED B;  3R8B A;  3KLS X;  4N59 A;  3ZYY X;  1ESF A;  5HI1 A;  1VZ6 A;  2WDV B;  2WXQ A;  3AE9 B;  5BMH A;  1CQV A;  2ACZ B;  3NS1 A;  1HA5 A;  4US9 A;  3TUO A;  3TSS A;  1ZE3 D;  2BBC A;  2GB1 A;  1I7H A;  4CQN A;  3FAH A;  4P6V F;  1WRI A;  3Q8C A;  2W3S A;  3SR6 A;  5C3J B;  3P4R B;  1FNW A;  3B2F A;  1B1Z A;  1PFD A;  1EM7 A;  5GXG B;  3TEY A;  1V1P A;  2BT6 A;  3VR9 B;  1JWS D;  1SEB D;  4NAW B;  4PT5 A;  1K53 A;  2MEK A;  3ZGZ A;  1M4V A;  1YJI A;  1I4P A;  1XF5 L;  5TSS A;  1ZDX A;  3UI3 A;  1SE3 A;  2WXK A;  1FNV A;  3AN1 A;  3L4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...