3PO0A

Crystal structure of samp1 from haloferax volcanii
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
89
structure length
89
Chain Sequence
GSMEWKLFADLAEVAGSRTVRVDVDGDATVGDALDALVGAHPALESRVFGDDGELYDHINVLRNGEAAALGEATAAGDELALFPPVSGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Small archaeal modifier protein 1
publication title Crystal structure of ubiquitin-like small archaeal modifier protein 1 (SAMP1) from Haloferax volcanii.
pubmed doi rcsb
source organism Haloferax volcanii
total genus 23
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3po0A00
1KRHA 3W5UB 1V8CA 1GAQB 1RYJA 4C7YA 2LEKA 1VJKA 4JX1C 1TKEA 3AE9B 4IDIA 4KX6B 4FXCA 3AV8A 2OHFA 4ZHPA 1FXIA 1OFFA 4WWMA 2BS4B 2PVGC 2K22A 3FAHA 1SB3C 3AE2B 3NVYA 2QJLA 1JWAD 2K9XA 3ZYYX 3HRDD 1JQ4A 2BS2B 1OQQA 3B2FA 2WU2B 4YT0B 1TYGB 1V97A 1FXAA 3HUIA 4WQMA 3AE6B 3DWGC 1FMAD 2K5PA 4JWUC 2B76B 2PKOA 5H92C 4YTMB 1J7BA 1N62A 3AEBB 3VR8B 4HROA 1SF0A 2N0SB 2WS3B 2M56B 2MH7A 3AEFB 3P1MA 4P6VF 1ZOYB 5H8YE 2QIEB 1J7CA 2WQYB 4N59A 4YXDB 5MPOA 2W54A 1AWDA 3AE1B 1TJEA 1L6VA 3AE7B 1DOYA 3PO0A 1E6EB 4YSZB 1KFYB 2WU5B 1QOBA 1I7HA 1QF6A 3AH7A 1FRRA 1JWBD 1YQ3B 2W3SA 3VRBB 3W9CB 1XLNA 1YJJA 3LB8C 3AEEB 1JW9D 1J7AA 1B9RA 5EE1A 2JQRB 1VLBA 1R7SA 1N61A 4US8A 3KWLA 2MJEA 1E7PB 1E9MA 2W3RA 1NYRA 2W55A 1PDXA 3EUB2 4JWSC 3L4PA 4US9A 3P4SB 5C3JB 1T3QA 1L0VB 1RFKA 2CJOA 1KF6B 3VRAB 3NVWA 1DOXA 1YQ4B 1FM0D 4N6EB 1JRPA 1RM6C 2Y5CA 1RWSA 2BS3B 4ZOHC 1A70A 2EKIA 1AYFA 1N5XA 3P4PB 1E0ZA 1CJEA 1F0ZA 3AEGB 3B2GA 1JROA 1FIQA 2BT6A 1JALA 3FC4A 4C7ZA 1SIJA 3AECB 2WP9B 3P4RB 4HRSA 2H89B 1UWMA 3AN1A 2E3TA 2WDRB 1XLOA 3DWMA 2KMMA 5EE3A 2JX5A 2H88B 1GPXA 1E10A 2CJNA 2G1EA 3ETRA 2L52A 1FFVA 3WCQA 1PUTA 3BIID 1WGKA 2PIAA 2HTME 2WDVB 3NVZA 2CU3A 3B9JA 2M19A 1XO3A 3AEAB 3P63A 1QOAA 4YSYB 1QOFA 3AMZA 4USAA 1NVID 1YJIA 2WLBA 3AE5B 4YSXB 1EWYC 1PFDA 1N63A 1WRIA 3RPFC 4ZHOA 1ZXIA 4A9AA 1FO4A 5EE9A 1NI3A 3SR6A 4LTUA 1ROEA 5G5GA 3SFDB 3NS1A 1N60A 2WDQB 5AUKA 1XLQA 1ZUD2 2FBWB 2DWQA 3AE3B 4N58A 1QLBB 1NYQA 2MJ3A 3AE8B 3CWIA 5EE0A 1QOGA 3ABVB 5GXGB 3VR9B 1WXQA 3LXFA 5G5HA 1OQRA 3AEDB 3HVZA 4YTPB 2AX5A 3W5VB 3AM9A 2PVOD 1TKGA 5AUIA 3NVVA 1N5WA 4C80A 4ITKA 1ZP0B 1NENB 1FFUA 1FRDA 3NRZA 4YTNB 1L6UA 3AB5A 1VDVA 2Q5WD 2KAJA 1DGJA 3CIRB 1DOIA 3AE4B 3SFEB 1XLPA 1TKYA 2DBYA 1QT9A 1CZPA 1L5PA 2L83A 2MJDA 3P4QB 2ACZB 1NEKB 1WWTA 1WYGA 1IUEA 5C2TB
chains in the Genus database with same CATH superfamily
2GB1A 4HVBA 2KTFA 2PLPA 1F2RI 1R4MI 2JYEA 1C78A 2KFJA 4JX1C 4IDIA 3A4RA 1V80A 1FXIA 2PVGC 4NJ7A 3PRPB 3KQ4A 3LJ3A 3ZRFA 4TQ0A 3HUIA 4WQMA 2BF8B 3VR8B 5H8YE 1E7UA 1QQRA 3NZUA 4HDOA 3PLUA 4W9HA 3HHMA 2W3SA 4WQOB 4MSQB 3AEEB 3PTFC 3SU8X 2BWFA 2KJ6A 4ANWA 2PMVA 1K52A 3N1ZC 3QCAA 2CJOA 1BUIC 1GB4A 1TY2A 1T0YA 1HTQA 1RM6C 2AL3A 4HCPB 1KOTA 3B2GA 1MHXA 3O65B 2J4XA 2WDRB 1XLOA 1WZ0A 4EZJA 2CJNA 4KIKB 1PUTA 1VD2A 2PIAA 2RR9A 4LDTD 1FCCC 3SDLC 3KYCD 1XCTL 3Q3MC 4MSMB 2MP2A 3TMPB 3D32A 4XDDA 5G5GA 1WGRA 2VZKB 4FHJA 2FUG1 2IDYA 2MHJA 4IOIE 1JCKB 1ZP0B 2DYMA 1L4DB 2L8JA 2Q5WD 2RMMA 3AULA 1YOVB 4ZRIA 3RNCC 2MJDA 4WJPA 1TY0A 2GBJA 3MJ5A 1UGJA 4G3XB 1OEYA 1WZ3A 4K7UA 1DYQA 3OJ4B 1E7VA 4FULA 3WIMA 2I2YA 4ZRJA 3LDZE 1GC7A 2KLGA 2DZIA 3ZUNA 3V3XA 1JQ4A 1GB1A 3ENEA 3R7QA 1J7BA 4KZCA 4ZRKA 4LNOA 3IAS1 5I4DA 2NBWB 3DVNV 1WX7A 1YQ3B 3Q3JA 5EE1A 4KGTA 3Q8AA 2W55A 3QAQA 3U7ZA 4AJWA 1PDXA 4DXFA 3TJPA 2K39A 3Q8EA 3VTVA 1I4QA 3MP9A 1JROA 4ICUA 4LDTB 2D11A 2WP9B 1TS3A 1FXTB 3ZXVA 2BVCA 2JXTA 4LNNA 4NAMA 3PZ7A 1OEYJ 2BB5A 1WGDA 1M4VA 3AXCA 1WGGA 1ZDVA 3VAWA 1NI3A 2AWTA 3I9V1 1ROEA 1KLUD 2MBOA 3AE3B 4IM2A 1C77A 1ET9A 3R66C 1WXQA 2PVOD 5HI1A 4HDQA 4C80A 1HQRD 2MX2A 1R4NB 2JT4B 1TKYA 4IM0A 3AEGB 5BYSA 3IHPC 1EM7A 5C23A 2NBUA 2K6QA 5T8IA 2D07B 2QJLA 3AE6B 2K5PA 4JWUC 4KIKA 2AYOB 2LJ5A 1FNWA 4MJSA 1TS4A 2V3PA 1SJED 4HPLB 1JWBD 5TSSA 4M0WB 5BO4B 4OW0A 3U7DA 1J7AA 2K6DB 1MJDA 1FNVA 4MGZE 2RSUA 4NZLB 4ZYNA 2RDGA 2D10A 2GBNA 3RNAC 4US9A 1C4PA 2WXQA 4G0NB 4DHZB 1EO6A 1JRPA 2ZVOA 3EFUA 2DZKA 3HK0A 1UWXA 2DAFA 2X38A 4DDGD 3DBLI 2KWDA 2E6XA 3P4PB 2FCMA 3WAMA 5IKCM 4B95A 4A55A 4A6QA 3AN1A 1PQSA 3GS2A 1I4GA 1HA5A 3IBEA 2J0KA 2RPVA 2V3SA 1FFVA 1BT0A 3BIID 4GDKA 3TEZA 1NDDA 5CTRC 1UGMA 3PGEA 4YSXB 2NS5A 1WXSA 3S2AA 5EE9A 2V9HA 5LNK1 2M0XA 3AE8B 4GOCA 2MBBB 2WXHA 2LJIA 2QSDA 3L17A 5DPWA 1L6UA 2PE9A 2KVRA 2LGXA 3AE4B 3K9OB 4JPSA 4P16A 2ZCBA 4XWTA 1FD6A 1SIFA 4FLHA 2G4DB 3BINA 1WWTA 3W5UB 2IO2B 2L7RA 1V6EA 1GC6A 3MFGA 1H8CA 1J8CA 4WH4A 4XGAB 1UD7A 3DPDA 4WWPA 1VZ7A 1SB3C 2IGGA 2IBIB 2D3AA 2BPSA 4II3B 5AZFA 3N9YC 2Z59B 1TZOA 2LRUA 3TEYA 4M8NA 4N59A 4YL8A 4FBJB 4NJCA 1EF5A 1QOBA 2NPTB 3U4EG 4UDUC 2DYBA 3UIOB 3Q3FA 4JIOU 1MFWA 2KFKB 3VH4B 3RNFC 2MJEA 1WI0A 3VRAB 3DHHC 3RD2A 3Q8FA 4GMVA 2K25A 3NHEB 3ZRCA 1WY8A 3RNEC 4GN1A 2KX0A 2H88B 1EU4A 3L10B 1P7EA 3X0WA 3ZKJC 4FJZA 4ANVA 2L52A 4E74A 4XE0A 4TSSA 3AU5A 2C7HA 4IWQA 1WF9A 1NVID 3AE5B 3V6EB 2MSED 3VUYA 1WR6E 2LXCA 3QHTA 4A9AA 4B0EA 4WWNA 1IGCA 4IWPA 1I4PA 3DBRI 3AEDB 4JLCA 1R4NI 1K51A 1UUPA 1F9JA 1LO5D 2L0TA 4DQOC 5D7GA 3H1UA 4URKA 5BYRA 4NNJB 4M0WA 4HEA1 3Q3OC 3DVGX 2LD9A 1IYFA 2K1FA 3UI3A 2WXMA 1YQBA 4LJPB 1P3QU 4BAXA 3Q69A 1SE9A 5JXVA 2J53A 2Y5BB 3JSVB 4M8MA 2WXKA 2KACA 3TL5A 3W2DA 1WJUA 3VHTC 2W54A 1AWDA 3E56A 1DOYA 1STEA 1Z5SB 4HK2A 3TSSA 1KFYB 4BKGA 1I4HA 1I7HA 1LFDA 1F1HA 1EWCA 4AQ7A 2WX0A 3B0AA 1WR1A 4KDIC 1N61A 3KWLA 1E7PB 3T8MA 5D94A 2KDIA 3MC8A 2RDBC 3ML9A 3R8BA 2PTLA 1GJZA 4REZA 3Q2AC 2HDEA 3PRMB 1WGKA 4PS8A 2GBMA 2KN5A 1IP9A 1V2YA 1QOFA 2WNMA 4USAA 2WLBA 4ZHOA 3ZNZB 2GMIC 3IT4B 4OZAA 4I6NB 2Z8LA 2DWQA 3CWIA 4TKNA 3PT2B 3A1QA 1OGWA 3A9KB 5FR6A 4ARIA 4PT5A 1HZ6A 3PHXB 4B9KA 1WGYA 2NPTA 3EA6A 1DGJA 2K8BA 3C0RB 3ETRA 4L23A 5C2TB 1GAQB 4DK5A 3P2BA 3DDCB 3MC9A 3AE9B 3B1LX 2BYVE 3U8ZA 1OTRB 4TV3A 4EZKA 3W1SA 1L4ZB 2K9XA 2RDHA 3HRDD 3HIZA 1MHHE 2OEDA 2VZKD 2AQ2B 4O1NA 2B76B 4CQNA 2ZEQA 3VR9B 3R2TA 2M56B 2LVOA 5D2MB 3L0WB 3M63B 3KYDD 4W9GA 1XLNA 2HD5B 2JSVX 4DHJB 1XXGA 2LMCA 1NYRA 2LHEA 3B08A 5C3JB 1T3QA 5JHBA 1JWSD 2O2VB 1Q5WB 3M3JA 3V62A 2KNBA 4HCNB 4I6LB 3VFKA 3ZLZA 2ZW1A 2LGYA 4J3OD 3UINB 2BQQA 2MA9B 3IVFA 1FPYA 3N3KB 2CHXA 1VRAB 2IJ0A 1RAXA 4ZRPA 2M19A 1E8XA 1CMXB 2JF5A 3U2SC 3ZQ4A 2RD0A 4WAAA 3RULA 1D5MC 3JSVA 4LTUA 3VTWA 2JZPA 2WDQB 3BK1A 2VRRB 5GXGB 5DPSA 1ESFA 1JWMD 1OQRA 3W5VB 2GBRA 1N5WA 3BYYB 3RNGC 3H7PB 1Y8RC 1UBQA 3NRZA 4GU2A 2QC8A 3NZSA 4HPPA 1RFAA 4MJSB 4AP4C 3KUCB 2L83A 2MBHA 2BB6A 3NS8A 1IBXB 3OWEB 3R2IA 2CR5A 4F1SA 4AS1A 3AV8A 3ZXRA 2L1AA 2DAJA 3MHZA 2BYTA 1EUVB 1SXTA 2IGHA 1MG4A 2NTSA 4RCOA 3ZW3A 5FK9C 3B2FA 1FXAA 2FCNA 3T3OA 5H92C 3SEBA 5CHFA 2LXAA 4ICVA 4GXBA 2MH7A 2QDFA 1ZOYB 3ZNID 5MPOA 1GNUA 4R3DA 3GZNB 4GDKB 3TUOA 1YNTE 2WU5B 1EF1A 2PJHA 2YLMA 3BZDB 4LLGM 4WAFA 2FIDA 1JW9D 3FKYA 4P1CC 5D3IB 3QA8A 3Q8BA 5BMHA 3X23A 1C9FA 3RYTA 1V9JA 5BMIA 3U30A 3IG3A 3A9KA 1YQ4B 4N6EB 5J17A 1BXTA 3Q3NC 3ZNGC 1AYFA 3DBHB 3UQAA 3AECB 3R7RA 1TZ1A 2JX5A 2CS4A 1N6ZA 4WJOA 4AOFA 2D5GA 3QC8B 2KMCA 3A33B 1QOAA 3AMZA 2IPKD 3DBSA 1FO4A 3GB1A 2C5LC 4IW0A 1F77A 3U52E 4N58A 1C79A 4OZCA 3OLMD 1S1QB 1ZDXA 2V4LA 3MC0B 3WAOA 1FRDA 3HVDA 2QEJC 2K8CA 4W9IA 3CIRB 4A90A 2M1MA 2WDTB 3ML8A 4NY0A 2W82A 1CZPA 5J2RA 2CU3A 2BKRB 2NMQA 2C7MB 1IPGA 2ZW0A 1A5RA 2IY0B 2K8HA 2MLBA 3BY4B 4RNAA 1VJKA 1TKEA 4S17A 2O2VA 4M01A 2JYTA 4DBGA 5L95C 4CYEA 4DWFA 3ZDMC 3RZWC 4BVUC 3PZDA 3NJTA 1FMAD 3GP7A 3UIPB 1XCQL 3AEFB 4FHKA 1WJNA 2O6VD 2WQYB 4JL9A 3AE7B 2KJHB 3UGBB 2KXJA 3O13A 3HM6X 3H7SA 1FRRA 3W9CB 3ZVVA 1VCBA 3A4SC 2HE7A 3W1SC 1D5ZC 1K53A 1T0QC 3TCAA 2KDMA 1WM3A 1WE7A 3ZJUA 5AEKB 1YD8U 1L0VB 2JRIB 1DOXA 2KTRB 1FM0D 1RWSA 3H7PA 1FCLA 4NPNA 1QILA 1JALA 1L7YA 3FC4A 2IO1B 3A9JB 2NCNA 2DYOA 5CHWA 2LGDA 1UH6A 3RUIB 1IBXA 4OVZA 4K1RB 3RCZA 2M8SA 3B9JA 4II2B 4TMAB 1YJIA 2C60A 5LLIA 1ZXIA 2HJ8A 2GBKA 5TR5A 2FBWB 5HFYA 3V61A 3WA0A 1WJ4A 4L1BA 3LXFA 4A8XC 4WWOA 3KVFB 1F52A 1E8ZA 3H8HA 4HXDA 4ITKA 3PRZA 3QQ8B 2A5UA 1MI0A 4K3BA 3CSFA 4IC7B 3P4QB 3R3MA 4YWGG 1KRHA 4NQLB 2M4NA 2D3CA 2MEKA 3VVWB 2QHOA 2K22A 3NVYA 1CQVA 4E71A 1JWAD 2MWSB 2O6VB 2PW9A 3MJWA 2I1JA 4OZBA 4TQ1A 1TT5B 2JPHA 4G50A 2VH2A 1N62A 3DCGA 1S3SG 2IYDB 2WS3B 4HJGE 2ONQA 1ET6A 4M02A 3ZGZA 3ALBA 2ZCCA 3L08A 4GIVA 5C1ZA 3BYTB 3LB8C 3DQVA 3C8YA 4TUUA 2N9LA 2JQRB 2CHZA 3ECIA 4Q2JA 2BYEA 4JE3B 2AQ1B 4HPMB 1ACCA 2B3AA 4KSKC 5BYQA 5E6JA 3A1QB 4ARCA 1UZXB 1XEEA 2QMTA 1SIJA 4LNFA 2KQ4X 2G3QB 4EUTA 4XDCA 2E3TA 4HLEA 2KDEB 5G2NA 3PVLA 3HM3A 4OVVA 4K3CA 4C56C 3AEAB 4ANUA 2JWZA 2WYQA 1MVKA 4BKTA 4EEWA 4OHJA 4ACFA 4LJOB 3TEXA 1VZ6A 3V6CB 4AWJA 3EHVA 1N60A 1ZUD2 2L05A 4IM3A 4LNIA 2MJ3A 5EE0A 3NUHB 1QOGA 3ABVB 2IGDA 2KT7A 4EFOA 2JWUA 1JRUA 1TKGA 1TTNA 2BTEA 3SHQA 4BBNC 4RFBA 1C4CA 2L00B 1V81A 4JQWC 1WXAA 3JVZX 2ZNVC 1V8CA 4RF1A 1SE3A 2I38A 2LHDA 1HTOA 3DHIC 1C76A 2KTRA 4FXCA 1P98A 2XEWA 2Z0DB 1OFFA 1SSNA 2XBBC 2QILA 4PYZA 2KC2A 2WU2B 5JH5C 4PYUA 3A9JA 3QWZB 3APCA 4AUQC 4YTMB 3AEBB 1SGHA 2UWQA 2JXXA 2KHWB 2KC1A 1J7CA 3PO0A 3CSTA 5L83A 2JY6A 1PGAA 1KH0A 3PPAA 4KKIA 4WIPA 4RGMA 1PGXA 4KSLC 2BBCA 4JWSC 3ZJVA 4P1BC 1KF6B 4KZ0A 3NVWA 2Y3AA 5LXIB 1A70A 4CHKA 4C4VA 1N5XA 2DNFA 1E0ZA 3IFWB 4C7ZA 3V60A 1UWMA 1ZE3D 1GOZA 1P7FA 3ZIMA 1AW7A 1E8YA 3M95A 1WYWB 1Q0WB 2WX1A 4WJQA 2ZZPB 1WRIA 2UYZB 3L16A 4DHJD 2O6VA 4W9JA 3I5JC 4KV2A 4RM9A 5KHOA 1D6EC 1RLFA 3TEWA 2LUEA 1WRDB 1HE8A 5IA7A 1IGDA 4B6WA 5JHAA 3BK2A 1V5TA 4EKUA 2LASA 2DBYA 1J19A 1NEKB 1WYGA 2YEPB 1NBFC 1RYJA 3BWUD 4GGQA 3OG5A 3PHWB 4ANXA 4KKJA 1Q1OA 2C7NB 2G9HD 2GRIA 4YT0B 2WXNA 1ENFA 3WALA 3P1MA 2LZ6A 4KGSA 5E6OA 2DENB 3Q6BA 4YXDB 2BW2A 1TJEA 3GE8C 3CF6E 3V05A 4XX5A 1YJJA 3AU4A 5D6JB 1T0RC 2IY1B 3NOBA 3NY5A 4IG7B 4RF0A 1R7SA 1YN3A 2W3RA 1FEHA 4W9DA 2ZNVB 4W9KA 2N7DA 4XYCA 2KD0A 2EKIA 1P9DU 3VTUA 1WX8A 1G6JA 1P1AA 3I57A 2X8XX 2KANA 4BZAA 1GPXA 5FR3A 2MBQA 1AARA 1V49A 3RZFA 2KQSA 1LGRA 2WGSA 1C3TA 2M17A 4BFRA 1P0RA 1EWYC 2C9WB 2I1KA 2WXIA 2L3ZA 4FA6A 4OVUA 3NS1A 3MTNB 1WE6A 1XLQA 2AL6A 4IKGA 1SEBD 1QLBB 2D3BA 1WSPA 4MDKE 2QCZA 3VXWA 2LUMA 2YVCA 1BMLC 3RT3B 1WGHA 4X57B 3NVVA 4ZYSA 2KZRA 1X1MA 1VDVA 1LM8B 3EECA 4HKZE 2D3GA 3APFA 4AJYB 3CMMB 3KUDB 3J9CA 1L5PA 1LXDA 1IUEA 1JMLA 4PS7A 2INDC 2NR2A 2M0AA 2NBVB 3ZJTA 2ZPYA 4MGIE 2R2OA 2D2QA 4KX6B 1K50A 1MG8A 2ON8A 2KMAA 1WXVA 2TSSA 2BS2B 4G11A 2IZVB 1UF0A 3LYYA 4XWWA 1ZGUB 3ZTDA 1XD3B 3I3TB 1WH3A 1KM7A 3AE1B 1L6VA 3OAWA 3DBLB 3T3NA 3T9LA 2J42A 1U4AA 4MH0E 3MHSD 3EGRA 1VLBA 3FILB 4YTNB 2GI9A 2WXPA 2FNJB 4FJVB 1SJHD 1RFKA 1YN4A 2SAKA 4MACA 4DHZE 1KJTA 1XQQA 2ZJDA 2EMTA 3VUXA 4W9LA 2FAZA 2IO0B 4W9CA 1PGBA 3UF8A 3P4RB 3ZDTA 2DZMA 3DWMA 3RNBC 3VQIA 1E10A 3QJZA 1D4BA 3PSEB 3GOEA 3N30A 1E8WA 3WAPA 2XK5B 2RPQA 3SR6A 1GUAB 5AUKA 5DPRA 4MH8A 4D2KA 2AX5A 3AM9A 3VDZA 3EFCA 2MCNB 2WXJA 1TS2A 2BWES 1WM2A 2EKEC 2PEAA 4DXGA 1Q10A 5IOIA 1RRBA 3KWVA 1QT9A 4LK0M 1WX9A 1OQYA 2L76A 2OJRA 4PS3A 1Z2MA 2LEKA 3QK0A 2DLBA 1B1ZA 4KVGB 5HKHA 1TBEA 2MW5A 2HTHA 2OHFA 3BVGA 4XZ4A 4N9F4 5IAAC 2KQ7A 3E9SA 1T0SC 1V1PB 1TYGB 4J6IA 3PLVA 3TBLD 4HROA 1T6BX 4CO7A 4F8CB 2KOXA 1E90A 1WJ6A 1ZXHA 1V1OA 3VRBB 3NZ3A 4ZRQA 2YEPF 4RM8A 2MRPA 3RMKC 3DVGY 3L4PA 5AZGA 4FADA 4ZOHC 2AQ3B 5E6PA 2ZVNA 3BVZA 1HEZE 3SD5A 2Y5PA 4K7SA 4HRSA 3Q8CA 2UU7A 2N4FA 3TIXA 1WMHB 2LGSA 4DXAB 3DBRB 2HTME 4A3PA 3NVZA 1F2RC 2WXGA 4K7WA 4K81A 1XO3A 4NAWB 5CHVC 2ZPNA 4JGHB 1LQBA 4F7ZA 3H9DA 4E3CA 2KLCA 1EU3A 4PK1A 2WXOA 4BBNF 3SFDB 2V0GA 1I4XA 2J52A 2OOBB 2KN4A 1K8RB 1QKZA 5G5HA 4B0MA 2HJ1A 1FFUA 3VH3B 4P7IA 2L32A 3H6NA 1I35A 3AI5A 3RN9C 4EZLA 5J18A 3UQBA 1ISNA 1AN8A 3FILA 2JRHA 2G4SA 1FNUA 1L0YB 1CK1A 3C19A 1YX5B 1H4RA 3BVMA 4C4VB 4FJYA 1OQQA 2W9NA 3N1XC 1V97A 3DWGC 1WFYA 4KDLB 2SEBD 2KK8A 2N0SB 4GDLB 4P6VF 1VZ8A 1YX6B 4GLSC 4YSZB 1QF6A 4H2AA 3NG0A 4RGNA 3PZ8A 2XK5A 3PV1A 2FIFA 5D3DA 3QX1A 3QARA 4GSWA 2JZ3B 4BKSD 1B9RA 3N20C 3IXSA 3GE3C 2V3NA 1YMHE 4MELA 1WXMA 2V4IB 3GZNI 2JVCA 2FCQA 2LWPA 2H89B 2KMMA 2XNAC 4HWIB 1J0GA 4KGRA 1XF5L 4EOYA 2A4ZA 3IAM1 2N1VA 1QZEA 2R61A 2N7JA 2ICIA 3DBHI 2L0FA 3KUZA 3RPFC 4MM3B 4BOZB 1V1PA 4IWOA 4EE2A 2CKHB 4IUMB 1HXYD 4ASWC 2WWZA 2EELA 4M00A 4YTPB 1SBBB 5AUIA 2N7EA 1NENB 2KDFB 1L0XB 2LRWA 2WXLA 3AB5A 3JYUA 1JWUD 3ZO5B 5G55A 3ZTCA 5DPTA 4MEMA 4ZDVA 2FCSA 2ACZB 4C7YA 2KYWA 1L2NA 2MQJA 3IT6B 1VR9A 2V1YA 2WXRA 1C4AA 4RMAA 1R4MB 1MPEA 3FAHA 3KH0A 2BS4B 2DHZA 4LCDE 4WJNA 4C00A 3RFZB 5HHDG 4W9FA 2INCC 2DZJA 4QAYA 1ZPSA 1Y56A 4WURA 2KVZA 2N9KA 2EMSA 2LFIA 1WMHA 2PKOA 1GG3A 1SF0A 2QIEB 2N9XA 2AEHA 4NAWA 1E6EB 3L13A 1SE4A 2N1WA 1I4RA 4RH6A 3K9PB 3DOWA 2ASQA 2G45B 3EUB2 2NTTA 5IO9A 3P4SB 2XN9C 2K3UA 2KWVB 2PE6B 1ZW7A 2VH1A 1D3ZA 2BS3B 1WIAA 2JU6X 2KO3A 4LNKA 2BT6A 4MGKE 2KDBA 1D5XC 3RI7C 5DCNA 5E6NA 1PYWD 5EE3A 2G1EA 4FN2A 2LVQA 5GMVA 4A20A 3N32A 4MT5A 2WDVB 3DVNU 5BMGA 1NI2A 3QIJA 4YSYB 1TIFA 5KHQA 2MBEA 4A3OA 3PREA 1ZKHA 2KX3A 4RGOS 3URYA 3OJ3A 1V86A 1NYQA 2PPHA 1V5OA 1HZ5A 4GDLA 3Q14C 3ONSA 1XT9B 2INPE 2OJWA 1KTKA 2JZZA 5CX3A 2KAJA 4I6PA 2J7QB 4NQKE 2JUOA 5IN7A 4HKQA 2WHIA 2J0JA 2LGIA 2INNE 3WANA 5AZHA 4ZHPA 3VUWA 2CU1A 4S0RA 4NJ6A 4WWMA 2IO3B 3AE2B 2MP2B 3ZYYX 2LVPA 2GOWA 1YN5A 2WXFA 2FE8A 2KWUB 1KLVA 2BKFA 2CHWA 3APDA 1TS5A 1YIWA 4HJKA 1SE2A 2RGFA 3AH7A 3W1YA 2R2QA 3L54A 4MM3A 1C1YB 5JZEB 1UELA 2FUHB 3EC8A 4US8A 2LI5A 1E9MA 2KJRA 3DHGC 4L2YA 1TGZB 2BGFA 2Y5CA 3P42A 2KKCA 4BOSC 2KWCA 1F0ZA 1CJEA 4W9EA 1FIQA 1I42A 4DDID 3N1YC 1T5XD 3KW5B 3PS6A 3WCQA 2DX5B 3ZNHB 3P63A 5EDSA 5LXHA 1M94A 3KLSX 1PFDA 2KFKA 1N63A 2GLSA 4RGTA 4GB9A 3JW0X 5IP4D 2K0PA 5HG2A 2NVUI 2Z0EB 1KLGD 2BYFA 3HVZA 4BKSA 4XC2A 1YJ1A 3I63C 4MGYE 5FKAC 3M62B 2J0MA 1UBIA 1UNSA 1DOIA 1E5WA 2N9EB 2N9PC 2REXA 3SFEB 1XLPA
chains in the Genus database with same CATH topology
2GB1A 4YWGG 1KRHA 2PLPA 2LEKA 1F2RI 2DLBA 2JYEA 1C78A 3UI3A 4JX1C 1B1ZA 2WXMA 4IDIA 2OHFA 3Q69A 3BVGA 1FXIA 2MEKA 2PVGC 2K22A 5JXVA 3NVYA 1CQVA 2J53A 1JWAD 2PW9A 3E9SA 3KQ4A 2WXKA 1V1PB 4TQ0A 1TYGB 2KACA 3HUIA 4OZBA 4TQ1A 4WQMA 3W2DA 1N62A 3VR8B 4HROA 2WS3B 4HJGE 5H8YE 1T6BX 2ONQA 1QQRA 2W54A 1AWDA 1ET6A 3E56A 1DOYA 1STEA 3ZGZA 1ZXHA 3TSSA 1V1OA 1KFYB 1I4HA 1I7HA 2W3SA 3VRBB 3BYTB 3LB8C 3AEEB 1EWCA 3C8YA 3NZ3A 4ZRQA 2YEPF 4AQ7A 2N9LA 2JQRB 4Q2JA 4JE3B 1N61A 2PMVA 3KWLA 1E7PB 1K52A 2AQ1B 3L4PA 2CJOA 1BUIC 1GB4A 1TY2A 1RM6C 4ZOHC 2AQ3B 1ACCA 5BYQA 3R8BA 4ARCA 5E6JA 1XEEA 2PTLA 3B2GA 3BVZA 1MHXA 2QMTA 1HEZE 1SIJA 4REZA 2Y5PA 2KQ4X 4HRSA 4XDCA 2J4XA 2E3TA 2WDRB 1XLOA 3Q8CA 2CJNA 2HDEA 1PUTA 1WGKA 2PIAA 2HTME 3NVZA 1F2RC 2WXGA 4C56C 1XO3A 3AEAB 1FCCC 4NAWB 1QOFA 2WNMA 1XCTL 4USAA 2WLBA 1MVKA 4OHJA 4ZHOA 1EU3A 2WXOA 3TEXA 1VZ6A 3IT4B 4XDDA 5G5GA 3SFDB 4OZAA 2Z8LA 1N60A 2V0GA 1I4XA 1ZUD2 2J52A 2DWQA 2KN4A 2VZKB 3CWIA 2MJ3A 5EE0A 3NUHB 1QKZA 1QOGA 2FUG1 3ABVB 2IGDA 2IDYA 2JWUA 5G5HA 4B0MA 1TKGA 4IOIE 1JCKB 4ARIA 4PT5A 1ZP0B 2DYMA 1HZ6A 1FFUA 2BTEA 1L4DB 2Q5WD 3EA6A 1DGJA 2RMMA 2L32A 4RFBA 1C4CA 2MJDA 3ETRA 1AN8A 4L23A 5C2TB 3FILA 1TY0A 3MJ5A 1V8CA 4RF1A 1SE3A 1GAQB 1UGJA 2I38A 2LHDA 1DYQA 1C76A 1FNUA 1L0YB 1CK1A 3AE9B 2I2YA 4FXCA 3BVMA 1OFFA 1SSNA 3V3XA 2QILA 1L4ZB 2K9XA 2RDHA 3HRDD 3W1SA 1JQ4A 1OQQA 1GB1A 2WU2B 1V97A 1MHHE 2OEDA 2VZKD 2AQ2B 3DWGC 4O1NA 2B76B 2SEBD 4YTMB 4CQNA 1J7BA 3AEBB 3VR9B 2N0SB 3R2TA 2M56B 4GDLB 4P6VF 1J7CA 1VZ8A 3IAS1 5I4DA 3PO0A 4GLSC 4YSZB 1QF6A 4H2AA 4RGNA 1PGAA 3PZ8A 1KH0A 1YQ3B 4KKIA 5D3DA 1XLNA 4WIPA 4RGMA 1PGXA 2JSVX 1XXGA 2BBCA 5EE1A 1B9RA 4KGTA 2LMCA 3IXSA 3Q8AA 4JWSC 2W55A 3U7ZA 1NYRA 2V3NA 1PDXA 3ZJVA 2LHEA 5C3JB 1T3QA 4DXFA 1KF6B 1YMHE 3NVWA 1JWSD 3Q8EA 2Y3AA 2V4IB 1A70A 1I4QA 3MP9A 1N5XA 1E0ZA 1JROA 4C7ZA 2ZW1A 2WP9B 1TS3A 2H89B 1UWMA 1ZE3D 2KMMA 1GOZA 2JXTA 2XNAC 4J3OD 1P7FA 4NAMA 3PZ7A 4KGRA 1XF5L 1AW7A 2BB5A 1VRAB 3IAM1 2IJ0A 4ZRPA 2M19A 2N7JA 2R61A 3U2SC 3ZQ4A 1M4VA 2ICIA 1D5MC 1ZDVA 1WRIA 3RPFC 4MM3B 1NI3A 3I9V1 1ROEA 1KLUD 4LTUA 2JZPA 1V1PA 2WDQB 3AE3B 4EE2A 3BK1A 1HXYD 1C77A 1ET9A 5GXGB 1WXQA 1D6EC 3TEWA 1ESFA 1JWMD 1OQRA 2EELA 1SBBB 4YTPB 3W5VB 2PVOD 5AUIA 3BYYB 1N5WA 5HI1A 4C80A 1NENB 1L0XB 1HQRD 3NRZA 1IGDA 2WXLA 3AB5A 1JWUD 3BK2A 1TKYA 2DBYA 2L83A 2ACZB 1NEKB 3AEGB 1WYGA 2YEPB 2BB6A 5BYSA 1IBXB 3OWEB 1RYJA 3R2IA 3BWUD 4C7YA 4AS1A 3IT6B 1EM7A 3AV8A 4KKJA 1VR9A 2L1AA 2WXRA 1C4AA 3MHZA 1MPEA 2BS4B 3FAHA 1SXTA 5T8IA 2IGHA 2G9HD 2NTSA 2QJLA 3RFZB 5HHDG 2GRIA 4RCOA 5FK9C 3B2FA 4YT0B 1ZPSA 1FXAA 1Y56A 4WURA 2WXNA 2N9KA 3AE6B 2K5PA 1ENFA 2LFIA 4JWUC 2PKOA 5H92C 3SEBA 3T3OA 1SF0A 3P1MA 2MH7A 4KGSA 1ZOYB 1FNWA 2QIEB 5MPOA 4YXDB 2BW2A 1TJEA 4R3DA 1E6EB 1TS4A 2V3PA 4GDKB 1YNTE 1SE4A 3TUOA 1SJED 2WU5B 3V05A 1JWBD 5TSSA 3BZDB 4LLGM 1I4RA 4WAFA 1YJJA 4OW0A 4RH6A 1JW9D 1J7AA 5D3IB 1FNVA 4RF0A 3Q8BA 1R7SA 5BMHA 1C9FA 1YN3A 4NZLB 2RDGA 3EUB2 2NTTA 2W3RA 4US9A 1C4PA 5BMIA 3P4SB 2WXQA 2XN9C 1FEHA 2K3UA 1YQ4B 4N6EB 1JRPA 1BXTA 2BS3B 1UWXA 2JU6X 2X38A 2EKIA 1AYFA 2KWDA 2E6XA 3P4PB 2BT6A 3AECB 3I57A 1D5XC 4A55A 4A6QA 1PYWD 3AN1A 5EE3A 3GS2A 2JX5A 1GPXA 5FR3A 1I4GA 1HA5A 2G1EA 2RPVA 1FFVA 3BIID 2D5GA 2WDVB 4MT5A 3TEZA 5BMGA 1QOAA 4YSYB 3AMZA 4YSXB 2IPKD 1EWYC 2WXIA 1FO4A 4RGOS 3URYA 5EE9A 3GB1A 3NS1A 1F77A 3U52E 1XLQA 4N58A 4IKGA 1C79A 4OZCA 1SEBD 1QLBB 1NYQA 3AE8B 1WSPA 5LNK1 2LUMA 1HZ5A 1BMLC 1ZDXA 2WXHA 3NVVA 2INPE 2LJIA 3MC0B 1FRDA 2QSDA 1KTKA 2QEJC 3HVDA 4ZYSA 1L6UA 1VDVA 3CIRB 2KAJA 4A90A 3AE4B 4HKZE 4JPSA 4P16A 2W82A 4XWTA 1FD6A 3J9CA 1CZPA 1L5PA 2CU3A 2NMQA 1WWTA 4HKQA 1IUEA 1JMLA 2ZW0A 2M0AA 3W5UB 2LGIA 2INNE 4RNAA 3MFGA 1VJKA 3ZJTA 1TKEA 4KX6B 1K50A 4WH4A 2JYTA 4ZHPA 4WWMA 2ON8A 1VZ7A 1SB3C 3AE2B 2IGGA 3ZYYX 2TSSA 2BS2B 1YN5A 2WXFA 4XWWA 3LYYA 2FE8A 3N9YC 1FMAD 1TZOA 3GP7A 3TEYA 1XCQL 3AEFB 2WQYB 4N59A 1TS5A 3AE1B 1L6VA 3AE7B 3O13A 4NJCA 1SE2A 1QOBA 3T3NA 3AH7A 1FRRA 2J42A 3U4EG 3W9CB 4UDUC 3EGRA 1D5ZC 1VLBA 1K53A 3FILB 2KDMA 4US8A 2MJEA 3ZJUA 1E9MA 4YTNB 2GI9A 2WXPA 1SJHD 4L2YA 1L0VB 1RFKA 1YN4A 2SAKA 4MACA 3VRAB 1DOXA 1FM0D 2Y5CA 1RWSA 3P42A 3Q8FA 1FCLA 1F0ZA 1CJEA 1QILA 1FIQA 1JALA 3FC4A 1PGBA 3P4RB 1T5XD 3DWMA 2DYOA 2H88B 1EU4A 3VQIA 1P7EA 1E10A 2L52A 3WCQA 1IBXA 4XE0A 4OVZA 4TSSA 1D4BA 3B9JA 3P63A 4TMAB 1NVID 1YJIA 3AE5B 3KLSX 1PFDA 1N63A 4RGTA 1ZXIA 4A9AA 4B0EA 3SR6A 2BYTA 5AUKA 2FBWB 2K0PA 5HFYA 1IGCA 5HG2A 4MH8A 4D2KA 4L1BA 3LXFA 1I4PA 1KLGD 4A8XC 3HVZA 3AEDB 2AX5A 3AM9A 3H8HA 4ITKA 1K51A 1UUPA 2WXJA 1TS2A 5FKAC 1LO5D 4DQOC 5D7GA 1UNSA 5BYRA 1DOIA 4DXGA 1MI0A 4M0WA 1Q10A 4HEA1 3SFEB 1XLPA 3KWVA 1QT9A 3P4QB 4LK0M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KRH A;  3W5U B;  1V8C A;  1GAQ B;  1RYJ A;  4C7Y A;  2LEK A;  1VJK A;  4JX1 C;  1TKE A;  3AE9 B;  4IDI A;  4KX6 B;  4FXC A;  3AV8 A;  2OHF A;  4ZHP A;  1FXI A;  1OFF A;  4WWM A;  2BS4 B;  2PVG C;  2K22 A;  3FAH A;  1SB3 C;  3AE2 B;  3NVY A;  2QJL A;  1JWA D;  2K9X A;  3ZYY X;  3HRD D;  1JQ4 A;  2BS2 B;  1OQQ A;  3B2F A;  2WU2 B;  4YT0 B;  1TYG B;  1V97 A;  1FXA A;  3HUI A;  4WQM A;  3AE6 B;  3DWG C;  1FMA D;  2K5P A;  4JWU C;  2B76 B;  2PKO A;  5H92 C;  4YTM B;  1J7B A;  1N62 A;  3AEB B;  3VR8 B;  4HRO A;  1SF0 A;  2N0S B;  2WS3 B;  2M56 B;  2MH7 A;  3AEF B;  3P1M A;  4P6V F;  1ZOY B;  5H8Y E;  2QIE B;  1J7C A;  2WQY B;  4N59 A;  4YXD B;  5MPO A;  2W54 A;  1AWD A;  3AE1 B;  1TJE A;  1L6V A;  3AE7 B;  1DOY A;  3PO0 A;  1E6E B;  4YSZ B;  1KFY B;  2WU5 B;  1QOB A;  1I7H A;  1QF6 A;  3AH7 A;  1FRR A;  1JWB D;  1YQ3 B;  2W3S A;  3VRB B;  3W9C B;  1XLN A;  1YJJ A;  3LB8 C;  3AEE B;  1JW9 D;  1J7A A;  1B9R A;  5EE1 A;  2JQR B;  1VLB A;  1R7S A;  1N61 A;  4US8 A;  3KWL A;  2MJE A;  1E7P B;  1E9M A;  2W3R A;  1NYR A;  2W55 A;  1PDX A;  3EUB 2;  4JWS C;  3L4P A;  4US9 A;  3P4S B;  5C3J B;  1T3Q A;  1L0V B;  1RFK A;  2CJO A;  1KF6 B;  3VRA B;  3NVW A;  1DOX A;  1YQ4 B;  1FM0 D;  4N6E B;  1JRP A;  1RM6 C;  2Y5C A;  1RWS A;  2BS3 B;  4ZOH C;  1A70 A;  2EKI A;  1AYF A;  1N5X A;  3P4P B;  1E0Z A;  1CJE A;  1F0Z A;  3AEG B;  3B2G A;  1JRO A;  1FIQ A;  2BT6 A;  1JAL A;  3FC4 A;  4C7Z A;  1SIJ A;  3AEC B;  2WP9 B;  3P4R B;  4HRS A;  2H89 B;  1UWM A;  3AN1 A;  2E3T A;  2WDR B;  1XLO A;  3DWM A;  2KMM A;  5EE3 A;  2JX5 A;  2H88 B;  1GPX A;  1E10 A;  2CJN A;  2G1E A;  3ETR A;  2L52 A;  1FFV A;  3WCQ A;  1PUT A;  3BII D;  1WGK A;  2PIA A;  2HTM E;  2WDV B;  3NVZ A;  2CU3 A;  3B9J A;  2M19 A;  1XO3 A;  3AEA B;  3P63 A;  1QOA A;  4YSY B;  1QOF A;  3AMZ A;  4USA A;  1NVI D;  1YJI A;  2WLB A;  3AE5 B;  4YSX B;  1EWY C;  1PFD A;  1N63 A;  1WRI A;  3RPF C;  4ZHO A;  1ZXI A;  4A9A A;  1FO4 A;  5EE9 A;  1NI3 A;  3SR6 A;  4LTU A;  1ROE A;  5G5G A;  3SFD B;  3NS1 A;  1N60 A;  2WDQ B;  5AUK A;  1XLQ A;  1ZUD 2;  2FBW B;  2DWQ A;  3AE3 B;  4N58 A;  1QLB B;  1NYQ A;  2MJ3 A;  3AE8 B;  3CWI A;  5EE0 A;  1QOG A;  3ABV B;  5GXG B;  3VR9 B;  1WXQ A;  3LXF A;  5G5H A;  1OQR A;  3AED B;  3HVZ A;  4YTP B;  2AX5 A;  3W5V B;  3AM9 A;  2PVO D;  1TKG A;  5AUI A;  3NVV A;  1N5W A;  4C80 A;  4ITK A;  1ZP0 B;  1NEN B;  1FFU A;  1FRD A;  3NRZ A;  4YTN B;  1L6U A;  3AB5 A;  1VDV A;  2Q5W D;  2KAJ A;  1DGJ A;  3CIR B;  1DOI A;  3AE4 B;  3SFE B;  1XLP A;  1TKY A;  2DBY A;  1QT9 A;  1CZP A;  1L5P A;  2L83 A;  2MJD A;  3P4Q B;  2ACZ B;  1NEK B;  1WWT A;  1WYG A;  1IUE A;  5C2T B; 
#chains in the Genus database with same CATH topology
 2GB1 A;  4HVB A;  2KTF A;  2PLP A;  1F2R I;  1R4M I;  2JYE A;  1C78 A;  2KFJ A;  4JX1 C;  4IDI A;  3A4R A;  1V80 A;  1FXI A;  2PVG C;  4NJ7 A;  3PRP B;  3KQ4 A;  3LJ3 A;  3ZRF A;  4TQ0 A;  3HUI A;  4WQM A;  2BF8 B;  3VR8 B;  5H8Y E;  1E7U A;  1QQR A;  3NZU A;  4HDO A;  3PLU A;  4W9H A;  3HHM A;  2W3S A;  4WQO B;  4MSQ B;  3AEE B;  3PTF C;  3SU8 X;  2BWF A;  2KJ6 A;  4ANW A;  2PMV A;  1K52 A;  3N1Z C;  3QCA A;  2CJO A;  1BUI C;  1GB4 A;  1TY2 A;  1T0Y A;  1HTQ A;  1RM6 C;  2AL3 A;  4HCP B;  1KOT A;  3B2G A;  1MHX A;  3O65 B;  2J4X A;  2WDR B;  1XLO A;  1WZ0 A;  4EZJ A;  2CJN A;  4KIK B;  1PUT A;  1VD2 A;  2PIA A;  2RR9 A;  4LDT D;  1FCC C;  3SDL C;  3KYC D;  1XCT L;  3Q3M C;  4MSM B;  2MP2 A;  3TMP B;  3D32 A;  4XDD A;  5G5G A;  1WGR A;  2VZK B;  4FHJ A;  2FUG 1;  2IDY A;  2MHJ A;  4IOI E;  1JCK B;  1ZP0 B;  2DYM A;  1L4D B;  2L8J A;  2Q5W D;  2RMM A;  3AUL A;  1YOV B;  4ZRI A;  3RNC C;  2MJD A;  4WJP A;  1TY0 A;  2GBJ A;  3MJ5 A;  1UGJ A;  4G3X B;  1OEY A;  1WZ3 A;  4K7U A;  1DYQ A;  3OJ4 B;  1E7V A;  4FUL A;  3WIM A;  2I2Y A;  4ZRJ A;  3LDZ E;  1GC7 A;  2KLG A;  2DZI A;  3ZUN A;  3V3X A;  1JQ4 A;  1GB1 A;  3ENE A;  3R7Q A;  1J7B A;  4KZC A;  4ZRK A;  4LNO A;  3IAS 1;  5I4D A;  2NBW B;  3DVN V;  1WX7 A;  1YQ3 B;  3Q3J A;  5EE1 A;  4KGT A;  3Q8A A;  2W55 A;  3QAQ A;  3U7Z A;  4AJW A;  1PDX A;  4DXF A;  3TJP A;  2K39 A;  3Q8E A;  3VTV A;  1I4Q A;  3MP9 A;  1JRO A;  4ICU A;  4LDT B;  2D11 A;  2WP9 B;  1TS3 A;  1FXT B;  3ZXV A;  2BVC A;  2JXT A;  4LNN A;  4NAM A;  3PZ7 A;  1OEY J;  2BB5 A;  1WGD A;  1M4V A;  3AXC A;  1WGG A;  1ZDV A;  3VAW A;  1NI3 A;  2AWT A;  3I9V 1;  1ROE A;  1KLU D;  2MBO A;  3AE3 B;  4IM2 A;  1C77 A;  1ET9 A;  3R66 C;  1WXQ A;  2PVO D;  5HI1 A;  4HDQ A;  4C80 A;  1HQR D;  2MX2 A;  1R4N B;  2JT4 B;  1TKY A;  4IM0 A;  3AEG B;  5BYS A;  3IHP C;  1EM7 A;  5C23 A;  2NBU A;  2K6Q A;  5T8I A;  2D07 B;  2QJL A;  3AE6 B;  2K5P A;  4JWU C;  4KIK A;  2AYO B;  2LJ5 A;  1FNW A;  4MJS A;  1TS4 A;  2V3P A;  1SJE D;  4HPL B;  1JWB D;  5TSS A;  4M0W B;  5BO4 B;  4OW0 A;  3U7D A;  1J7A A;  2K6D B;  1MJD A;  1FNV A;  4MGZ E;  2RSU A;  4NZL B;  4ZYN A;  2RDG A;  2D10 A;  2GBN A;  3RNA C;  4US9 A;  1C4P A;  2WXQ A;  4G0N B;  4DHZ B;  1EO6 A;  1JRP A;  2ZVO A;  3EFU A;  2DZK A;  3HK0 A;  1UWX A;  2DAF A;  2X38 A;  4DDG D;  3DBL I;  2KWD A;  2E6X A;  3P4P B;  2FCM A;  3WAM A;  5IKC M;  4B95 A;  4A55 A;  4A6Q A;  3AN1 A;  1PQS A;  3GS2 A;  1I4G A;  1HA5 A;  3IBE A;  2J0K A;  2RPV A;  2V3S A;  1FFV A;  1BT0 A;  3BII D;  4GDK A;  3TEZ A;  1NDD A;  5CTR C;  1UGM A;  3PGE A;  4YSX B;  2NS5 A;  1WXS A;  3S2A A;  5EE9 A;  2V9H A;  5LNK 1;  2M0X A;  3AE8 B;  4GOC A;  2MBB B;  2WXH A;  2LJI A;  2QSD A;  3L17 A;  5DPW A;  1L6U A;  2PE9 A;  2KVR A;  2LGX A;  3AE4 B;  3K9O B;  4JPS A;  4P16 A;  2ZCB A;  4XWT A;  1FD6 A;  1SIF A;  4FLH A;  2G4D B;  3BIN A;  1WWT A;  3W5U B;  2IO2 B;  2L7R A;  1V6E A;  1GC6 A;  3MFG A;  1H8C A;  1J8C A;  4WH4 A;  4XGA B;  1UD7 A;  3DPD A;  4WWP A;  1VZ7 A;  1SB3 C;  2IGG A;  2IBI B;  2D3A A;  2BPS A;  4II3 B;  5AZF A;  3N9Y C;  2Z59 B;  1TZO A;  2LRU A;  3TEY A;  4M8N A;  4N59 A;  4YL8 A;  4FBJ B;  4NJC A;  1EF5 A;  1QOB A;  2NPT B;  3U4E G;  4UDU C;  2DYB A;  3UIO B;  3Q3F A;  4JIO U;  1MFW A;  2KFK B;  3VH4 B;  3RNF C;  2MJE A;  1WI0 A;  3VRA B;  3DHH C;  3RD2 A;  3Q8F A;  4GMV A;  2K25 A;  3NHE B;  3ZRC A;  1WY8 A;  3RNE C;  4GN1 A;  2KX0 A;  2H88 B;  1EU4 A;  3L10 B;  1P7E A;  3X0W A;  3ZKJ C;  4FJZ A;  4ANV A;  2L52 A;  4E74 A;  4XE0 A;  4TSS A;  3AU5 A;  2C7H A;  4IWQ A;  1WF9 A;  1NVI D;  3AE5 B;  3V6E B;  2MSE D;  3VUY A;  1WR6 E;  2LXC A;  3QHT A;  4A9A A;  4B0E A;  4WWN A;  1IGC A;  4IWP A;  1I4P A;  3DBR I;  3AED B;  4JLC A;  1R4N I;  1K51 A;  1UUP A;  1F9J A;  1LO5 D;  2L0T A;  4DQO C;  5D7G A;  3H1U A;  4URK A;  5BYR A;  4NNJ B;  4M0W A;  4HEA 1;  3Q3O C;  3DVG X;  2LD9 A;  1IYF A;  2K1F A;  3UI3 A;  2WXM A;  1YQB A;  4LJP B;  1P3Q U;  4BAX A;  3Q69 A;  1SE9 A;  5JXV A;  2J53 A;  2Y5B B;  3JSV B;  4M8M A;  2WXK A;  2KAC A;  3TL5 A;  3W2D A;  1WJU A;  3VHT C;  2W54 A;  1AWD A;  3E56 A;  1DOY A;  1STE A;  1Z5S B;  4HK2 A;  3TSS A;  1KFY B;  4BKG A;  1I4H A;  1I7H A;  1LFD A;  1F1H A;  1EWC A;  4AQ7 A;  2WX0 A;  3B0A A;  1WR1 A;  4KDI C;  1N61 A;  3KWL A;  1E7P B;  3T8M A;  5D94 A;  2KDI A;  3MC8 A;  2RDB C;  3ML9 A;  3R8B A;  2PTL A;  1GJZ A;  4REZ A;  3Q2A C;  2HDE A;  3PRM B;  1WGK A;  4PS8 A;  2GBM A;  2KN5 A;  1IP9 A;  1V2Y A;  1QOF A;  2WNM A;  4USA A;  2WLB A;  4ZHO A;  3ZNZ B;  2GMI C;  3IT4 B;  4OZA A;  4I6N B;  2Z8L A;  2DWQ A;  3CWI A;  4TKN A;  3PT2 B;  3A1Q A;  1OGW A;  3A9K B;  5FR6 A;  4ARI A;  4PT5 A;  1HZ6 A;  3PHX B;  4B9K A;  1WGY A;  2NPT A;  3EA6 A;  1DGJ A;  2K8B A;  3C0R B;  3ETR A;  4L23 A;  5C2T B;  1GAQ B;  4DK5 A;  3P2B A;  3DDC B;  3MC9 A;  3AE9 B;  3B1L X;  2BYV E;  3U8Z A;  1OTR B;  4TV3 A;  4EZK A;  3W1S A;  1L4Z B;  2K9X A;  2RDH A;  3HRD D;  3HIZ A;  1MHH E;  2OED A;  2VZK D;  2AQ2 B;  4O1N A;  2B76 B;  4CQN A;  2ZEQ A;  3VR9 B;  3R2T A;  2M56 B;  2LVO A;  5D2M B;  3L0W B;  3M63 B;  3KYD D;  4W9G A;  1XLN A;  2HD5 B;  2JSV X;  4DHJ B;  1XXG A;  2LMC A;  1NYR A;  2LHE A;  3B08 A;  5C3J B;  1T3Q A;  5JHB A;  1JWS D;  2O2V B;  1Q5W B;  3M3J A;  3V62 A;  2KNB A;  4HCN B;  4I6L B;  3VFK A;  3ZLZ A;  2ZW1 A;  2LGY A;  4J3O D;  3UIN B;  2BQQ A;  2MA9 B;  3IVF A;  1FPY A;  3N3K B;  2CHX A;  1VRA B;  2IJ0 A;  1RAX A;  4ZRP A;  2M19 A;  1E8X A;  1CMX B;  2JF5 A;  3U2S C;  3ZQ4 A;  2RD0 A;  4WAA A;  3RUL A;  1D5M C;  3JSV A;  4LTU A;  3VTW A;  2JZP A;  2WDQ B;  3BK1 A;  2VRR B;  5GXG B;  5DPS A;  1ESF A;  1JWM D;  1OQR A;  3W5V B;  2GBR A;  1N5W A;  3BYY B;  3RNG C;  3H7P B;  1Y8R C;  1UBQ A;  3NRZ A;  4GU2 A;  2QC8 A;  3NZS A;  4HPP A;  1RFA A;  4MJS B;  4AP4 C;  3KUC B;  2L83 A;  2MBH A;  2BB6 A;  3NS8 A;  1IBX B;  3OWE B;  3R2I A;  2CR5 A;  4F1S A;  4AS1 A;  3AV8 A;  3ZXR A;  2L1A A;  2DAJ A;  3MHZ A;  2BYT A;  1EUV B;  1SXT A;  2IGH A;  1MG4 A;  2NTS A;  4RCO A;  3ZW3 A;  5FK9 C;  3B2F A;  1FXA A;  2FCN A;  3T3O A;  5H92 C;  3SEB A;  5CHF A;  2LXA A;  4ICV A;  4GXB A;  2MH7 A;  2QDF A;  1ZOY B;  3ZNI D;  5MPO A;  1GNU A;  4R3D A;  3GZN B;  4GDK B;  3TUO A;  1YNT E;  2WU5 B;  1EF1 A;  2PJH A;  2YLM A;  3BZD B;  4LLG M;  4WAF A;  2FID A;  1JW9 D;  3FKY A;  4P1C C;  5D3I B;  3QA8 A;  3Q8B A;  5BMH A;  3X23 A;  1C9F A;  3RYT A;  1V9J A;  5BMI A;  3U30 A;  3IG3 A;  3A9K A;  1YQ4 B;  4N6E B;  5J17 A;  1BXT A;  3Q3N C;  3ZNG C;  1AYF A;  3DBH B;  3UQA A;  3AEC B;  3R7R A;  1TZ1 A;  2JX5 A;  2CS4 A;  1N6Z A;  4WJO A;  4AOF A;  2D5G A;  3QC8 B;  2KMC A;  3A33 B;  1QOA A;  3AMZ A;  2IPK D;  3DBS A;  1FO4 A;  3GB1 A;  2C5L C;  4IW0 A;  1F77 A;  3U52 E;  4N58 A;  1C79 A;  4OZC A;  3OLM D;  1S1Q B;  1ZDX A;  2V4L A;  3MC0 B;  3WAO A;  1FRD A;  3HVD A;  2QEJ C;  2K8C A;  4W9I A;  3CIR B;  4A90 A;  2M1M A;  2WDT B;  3ML8 A;  4NY0 A;  2W82 A;  1CZP A;  5J2R A;  2CU3 A;  2BKR B;  2NMQ A;  2C7M B;  1IPG A;  2ZW0 A;  1A5R A;  2IY0 B;  2K8H A;  2MLB A;  3BY4 B;  4RNA A;  1VJK A;  1TKE A;  4S17 A;  2O2V A;  4M01 A;  2JYT A;  4DBG A;  5L95 C;  4CYE A;  4DWF A;  3ZDM C;  3RZW C;  4BVU C;  3PZD A;  3NJT A;  1FMA D;  3GP7 A;  3UIP B;  1XCQ L;  3AEF B;  4FHK A;  1WJN A;  2O6V D;  2WQY B;  4JL9 A;  3AE7 B;  2KJH B;  3UGB B;  2KXJ A;  3O13 A;  3HM6 X;  3H7S A;  1FRR A;  3W9C B;  3ZVV A;  1VCB A;  3A4S C;  2HE7 A;  3W1S C;  1D5Z C;  1K53 A;  1T0Q C;  3TCA A;  2KDM A;  1WM3 A;  1WE7 A;  3ZJU A;  5AEK B;  1YD8 U;  1L0V B;  2JRI B;  1DOX A;  2KTR B;  1FM0 D;  1RWS A;  3H7P A;  1FCL A;  4NPN A;  1QIL A;  1JAL A;  1L7Y A;  3FC4 A;  2IO1 B;  3A9J B;  2NCN A;  2DYO A;  5CHW A;  2LGD A;  1UH6 A;  3RUI B;  1IBX A;  4OVZ A;  4K1R B;  3RCZ A;  2M8S A;  3B9J A;  4II2 B;  4TMA B;  1YJI A;  2C60 A;  5LLI A;  1ZXI A;  2HJ8 A;  2GBK A;  5TR5 A;  2FBW B;  5HFY A;  3V61 A;  3WA0 A;  1WJ4 A;  4L1B A;  3LXF A;  4A8X C;  4WWO A;  3KVF B;  1F52 A;  1E8Z A;  3H8H A;  4HXD A;  4ITK A;  3PRZ A;  3QQ8 B;  2A5U A;  1MI0 A;  4K3B A;  3CSF A;  4IC7 B;  3P4Q B;  3R3M A;  4YWG G;  1KRH A;  4NQL B;  2M4N A;  2D3C A;  2MEK A;  3VVW B;  2QHO A;  2K22 A;  3NVY A;  1CQV A;  4E71 A;  1JWA D;  2MWS B;  2O6V B;  2PW9 A;  3MJW A;  2I1J A;  4OZB A;  4TQ1 A;  1TT5 B;  2JPH A;  4G50 A;  2VH2 A;  1N62 A;  3DCG A;  1S3S G;  2IYD B;  2WS3 B;  4HJG E;  2ONQ A;  1ET6 A;  4M02 A;  3ZGZ A;  3ALB A;  2ZCC A;  3L08 A;  4GIV A;  5C1Z A;  3BYT B;  3LB8 C;  3DQV A;  3C8Y A;  4TUU A;  2N9L A;  2JQR B;  2CHZ A;  3ECI A;  4Q2J A;  2BYE A;  4JE3 B;  2AQ1 B;  4HPM B;  1ACC A;  2B3A A;  4KSK C;  5BYQ A;  5E6J A;  3A1Q B;  4ARC A;  1UZX B;  1XEE A;  2QMT A;  1SIJ A;  4LNF A;  2KQ4 X;  2G3Q B;  4EUT A;  4XDC A;  2E3T A;  4HLE A;  2KDE B;  5G2N A;  3PVL A;  3HM3 A;  4OVV A;  4K3C A;  4C56 C;  3AEA B;  4ANU A;  2JWZ A;  2WYQ A;  1MVK A;  4BKT A;  4EEW A;  4OHJ A;  4ACF A;  4LJO B;  3TEX A;  1VZ6 A;  3V6C B;  4AWJ A;  3EHV A;  1N60 A;  1ZUD 2;  2L05 A;  4IM3 A;  4LNI A;  2MJ3 A;  5EE0 A;  3NUH B;  1QOG A;  3ABV B;  2IGD A;  2KT7 A;  4EFO A;  2JWU A;  1JRU A;  1TKG A;  1TTN A;  2BTE A;  3SHQ A;  4BBN C;  4RFB A;  1C4C A;  2L00 B;  1V81 A;  4JQW C;  1WXA A;  3JVZ X;  2ZNV C;  1V8C A;  4RF1 A;  1SE3 A;  2I38 A;  2LHD A;  1HTO A;  3DHI C;  1C76 A;  2KTR A;  4FXC A;  1P98 A;  2XEW A;  2Z0D B;  1OFF A;  1SSN A;  2XBB C;  2QIL A;  4PYZ A;  2KC2 A;  2WU2 B;  5JH5 C;  4PYU A;  3A9J A;  3QWZ B;  3APC A;  4AUQ C;  4YTM B;  3AEB B;  1SGH A;  2UWQ A;  2JXX A;  2KHW B;  2KC1 A;  1J7C A;  3PO0 A;  3CST A;  5L83 A;  2JY6 A;  1PGA A;  1KH0 A;  3PPA A;  4KKI A;  4WIP A;  4RGM A;  1PGX A;  4KSL C;  2BBC A;  4JWS C;  3ZJV A;  4P1B C;  1KF6 B;  4KZ0 A;  3NVW A;  2Y3A A;  5LXI B;  1A70 A;  4CHK A;  4C4V A;  1N5X A;  2DNF A;  1E0Z A;  3IFW B;  4C7Z A;  3V60 A;  1UWM A;  1ZE3 D;  1GOZ A;  1P7F A;  3ZIM A;  1AW7 A;  1E8Y A;  3M95 A;  1WYW B;  1Q0W B;  2WX1 A;  4WJQ A;  2ZZP B;  1WRI A;  2UYZ B;  3L16 A;  4DHJ D;  2O6V A;  4W9J A;  3I5J C;  4KV2 A;  4RM9 A;  5KHO A;  1D6E C;  1RLF A;  3TEW A;  2LUE A;  1WRD B;  1HE8 A;  5IA7 A;  1IGD A;  4B6W A;  5JHA A;  3BK2 A;  1V5T A;  4EKU A;  2LAS A;  2DBY A;  1J19 A;  1NEK B;  1WYG A;  2YEP B;  1NBF C;  1RYJ A;  3BWU D;  4GGQ A;  3OG5 A;  3PHW B;  4ANX A;  4KKJ A;  1Q1O A;  2C7N B;  2G9H D;  2GRI A;  4YT0 B;  2WXN A;  1ENF A;  3WAL A;  3P1M A;  2LZ6 A;  4KGS A;  5E6O A;  2DEN B;  3Q6B A;  4YXD B;  2BW2 A;  1TJE A;  3GE8 C;  3CF6 E;  3V05 A;  4XX5 A;  1YJJ A;  3AU4 A;  5D6J B;  1T0R C;  2IY1 B;  3NOB A;  3NY5 A;  4IG7 B;  4RF0 A;  1R7S A;  1YN3 A;  2W3R A;  1FEH A;  4W9D A;  2ZNV B;  4W9K A;  2N7D A;  4XYC A;  2KD0 A;  2EKI A;  1P9D U;  3VTU A;  1WX8 A;  1G6J A;  1P1A A;  3I57 A;  2X8X X;  2KAN A;  4BZA A;  1GPX A;  5FR3 A;  2MBQ A;  1AAR A;  1V49 A;  3RZF A;  2KQS A;  1LGR A;  2WGS A;  1C3T A;  2M17 A;  4BFR A;  1P0R A;  1EWY C;  2C9W B;  2I1K A;  2WXI A;  2L3Z A;  4FA6 A;  4OVU A;  3NS1 A;  3MTN B;  1WE6 A;  1XLQ A;  2AL6 A;  4IKG A;  1SEB D;  1QLB B;  2D3B A;  1WSP A;  4MDK E;  2QCZ A;  3VXW A;  2LUM A;  2YVC A;  1BML C;  3RT3 B;  1WGH A;  4X57 B;  3NVV A;  4ZYS A;  2KZR A;  1X1M A;  1VDV A;  1LM8 B;  3EEC A;  4HKZ E;  2D3G A;  3APF A;  4AJY B;  3CMM B;  3KUD B;  3J9C A;  1L5P A;  1LXD A;  1IUE A;  1JML A;  4PS7 A;  2IND C;  2NR2 A;  2M0A A;  2NBV B;  3ZJT A;  2ZPY A;  4MGI E;  2R2O A;  2D2Q A;  4KX6 B;  1K50 A;  1MG8 A;  2ON8 A;  2KMA A;  1WXV A;  2TSS A;  2BS2 B;  4G11 A;  2IZV B;  1UF0 A;  3LYY A;  4XWW A;  1ZGU B;  3ZTD A;  1XD3 B;  3I3T B;  1WH3 A;  1KM7 A;  3AE1 B;  1L6V A;  3OAW A;  3DBL B;  3T3N A;  3T9L A;  2J42 A;  1U4A A;  4MH0 E;  3MHS D;  3EGR A;  1VLB A;  3FIL B;  4YTN B;  2GI9 A;  2WXP A;  2FNJ B;  4FJV B;  1SJH D;  1RFK A;  1YN4 A;  2SAK A;  4MAC A;  4DHZ E;  1KJT A;  1XQQ A;  2ZJD A;  2EMT A;  3VUX A;  4W9L A;  2FAZ A;  2IO0 B;  4W9C A;  1PGB A;  3UF8 A;  3P4R B;  3ZDT A;  2DZM A;  3DWM A;  3RNB C;  3VQI A;  1E10 A;  3QJZ A;  1D4B A;  3PSE B;  3GOE A;  3N30 A;  1E8W A;  3WAP A;  2XK5 B;  2RPQ A;  3SR6 A;  1GUA B;  5AUK A;  5DPR A;  4MH8 A;  4D2K A;  2AX5 A;  3AM9 A;  3VDZ A;  3EFC A;  2MCN B;  2WXJ A;  1TS2 A;  2BWE S;  1WM2 A;  2EKE C;  2PEA A;  4DXG A;  1Q10 A;  5IOI A;  1RRB A;  3KWV A;  1QT9 A;  4LK0 M;  1WX9 A;  1OQY A;  2L76 A;  2OJR A;  4PS3 A;  1Z2M A;  2LEK A;  3QK0 A;  2DLB A;  1B1Z A;  4KVG B;  5HKH A;  1TBE A;  2MW5 A;  2HTH A;  2OHF A;  3BVG A;  4XZ4 A;  4N9F 4;  5IAA C;  2KQ7 A;  3E9S A;  1T0S C;  1V1P B;  1TYG B;  4J6I A;  3PLV A;  3TBL D;  4HRO A;  1T6B X;  4CO7 A;  4F8C B;  2KOX A;  1E90 A;  1WJ6 A;  1ZXH A;  1V1O A;  3VRB B;  3NZ3 A;  4ZRQ A;  2YEP F;  4RM8 A;  2MRP A;  3RMK C;  3DVG Y;  3L4P A;  5AZG A;  4FAD A;  4ZOH C;  2AQ3 B;  5E6P A;  2ZVN A;  3BVZ A;  1HEZ E;  3SD5 A;  2Y5P A;  4K7S A;  4HRS A;  3Q8C A;  2UU7 A;  2N4F A;  3TIX A;  1WMH B;  2LGS A;  4DXA B;  3DBR B;  2HTM E;  4A3P A;  3NVZ A;  1F2R C;  2WXG A;  4K7W A;  4K81 A;  1XO3 A;  4NAW B;  5CHV C;  2ZPN A;  4JGH B;  1LQB A;  4F7Z A;  3H9D A;  4E3C A;  2KLC A;  1EU3 A;  4PK1 A;  2WXO A;  4BBN F;  3SFD B;  2V0G A;  1I4X A;  2J52 A;  2OOB B;  2KN4 A;  1K8R B;  1QKZ A;  5G5H A;  4B0M A;  2HJ1 A;  1FFU A;  3VH3 B;  4P7I A;  2L32 A;  3H6N A;  1I35 A;  3AI5 A;  3RN9 C;  4EZL A;  5J18 A;  3UQB A;  1ISN A;  1AN8 A;  3FIL A;  2JRH A;  2G4S A;  1FNU A;  1L0Y B;  1CK1 A;  3C19 A;  1YX5 B;  1H4R A;  3BVM A;  4C4V B;  4FJY A;  1OQQ A;  2W9N A;  3N1X C;  1V97 A;  3DWG C;  1WFY A;  4KDL B;  2SEB D;  2KK8 A;  2N0S B;  4GDL B;  4P6V F;  1VZ8 A;  1YX6 B;  4GLS C;  4YSZ B;  1QF6 A;  4H2A A;  3NG0 A;  4RGN A;  3PZ8 A;  2XK5 A;  3PV1 A;  2FIF A;  5D3D A;  3QX1 A;  3QAR A;  4GSW A;  2JZ3 B;  4BKS D;  1B9R A;  3N20 C;  3IXS A;  3GE3 C;  2V3N A;  1YMH E;  4MEL A;  1WXM A;  2V4I B;  3GZN I;  2JVC A;  2FCQ A;  2LWP A;  2H89 B;  2KMM A;  2XNA C;  4HWI B;  1J0G A;  4KGR A;  1XF5 L;  4EOY A;  2A4Z A;  3IAM 1;  2N1V A;  1QZE A;  2R61 A;  2N7J A;  2ICI A;  3DBH I;  2L0F A;  3KUZ A;  3RPF C;  4MM3 B;  4BOZ B;  1V1P A;  4IWO A;  4EE2 A;  2CKH B;  4IUM B;  1HXY D;  4ASW C;  2WWZ A;  2EEL A;  4M00 A;  4YTP B;  1SBB B;  5AUI A;  2N7E A;  1NEN B;  2KDF B;  1L0X B;  2LRW A;  2WXL A;  3AB5 A;  3JYU A;  1JWU D;  3ZO5 B;  5G55 A;  3ZTC A;  5DPT A;  4MEM A;  4ZDV A;  2FCS A;  2ACZ B;  4C7Y A;  2KYW A;  1L2N A;  2MQJ A;  3IT6 B;  1VR9 A;  2V1Y A;  2WXR A;  1C4A A;  4RMA A;  1R4M B;  1MPE A;  3FAH A;  3KH0 A;  2BS4 B;  2DHZ A;  4LCD E;  4WJN A;  4C00 A;  3RFZ B;  5HHD G;  4W9F A;  2INC C;  2DZJ A;  4QAY A;  1ZPS A;  1Y56 A;  4WUR A;  2KVZ A;  2N9K A;  2EMS A;  2LFI A;  1WMH A;  2PKO A;  1GG3 A;  1SF0 A;  2QIE B;  2N9X A;  2AEH A;  4NAW A;  1E6E B;  3L13 A;  1SE4 A;  2N1W A;  1I4R A;  4RH6 A;  3K9P B;  3DOW A;  2ASQ A;  2G45 B;  3EUB 2;  2NTT A;  5IO9 A;  3P4S B;  2XN9 C;  2K3U A;  2KWV B;  2PE6 B;  1ZW7 A;  2VH1 A;  1D3Z A;  2BS3 B;  1WIA A;  2JU6 X;  2KO3 A;  4LNK A;  2BT6 A;  4MGK E;  2KDB A;  1D5X C;  3RI7 C;  5DCN A;  5E6N A;  1PYW D;  5EE3 A;  2G1E A;  4FN2 A;  2LVQ A;  5GMV A;  4A20 A;  3N32 A;  4MT5 A;  2WDV B;  3DVN U;  5BMG A;  1NI2 A;  3QIJ A;  4YSY B;  1TIF A;  5KHQ A;  2MBE A;  4A3O A;  3PRE A;  1ZKH A;  2KX3 A;  4RGO S;  3URY A;  3OJ3 A;  1V86 A;  1NYQ A;  2PPH A;  1V5O A;  1HZ5 A;  4GDL A;  3Q14 C;  3ONS A;  1XT9 B;  2INP E;  2OJW A;  1KTK A;  2JZZ A;  5CX3 A;  2KAJ A;  4I6P A;  2J7Q B;  4NQK E;  2JUO A;  5IN7 A;  4HKQ A;  2WHI A;  2J0J A;  2LGI A;  2INN E;  3WAN A;  5AZH A;  4ZHP A;  3VUW A;  2CU1 A;  4S0R A;  4NJ6 A;  4WWM A;  2IO3 B;  3AE2 B;  2MP2 B;  3ZYY X;  2LVP A;  2GOW A;  1YN5 A;  2WXF A;  2FE8 A;  2KWU B;  1KLV A;  2BKF A;  2CHW A;  3APD A;  1TS5 A;  1YIW A;  4HJK A;  1SE2 A;  2RGF A;  3AH7 A;  3W1Y A;  2R2Q A;  3L54 A;  4MM3 A;  1C1Y B;  5JZE B;  1UEL A;  2FUH B;  3EC8 A;  4US8 A;  2LI5 A;  1E9M A;  2KJR A;  3DHG C;  4L2Y A;  1TGZ B;  2BGF A;  2Y5C A;  3P42 A;  2KKC A;  4BOS C;  2KWC A;  1F0Z A;  1CJE A;  4W9E A;  1FIQ A;  1I42 A;  4DDI D;  3N1Y C;  1T5X D;  3KW5 B;  3PS6 A;  3WCQ A;  2DX5 B;  3ZNH B;  3P63 A;  5EDS A;  5LXH A;  1M94 A;  3KLS X;  1PFD A;  2KFK A;  1N63 A;  2GLS A;  4RGT A;  4GB9 A;  3JW0 X;  5IP4 D;  2K0P A;  5HG2 A;  2NVU I;  2Z0E B;  1KLG D;  2BYF A;  3HVZ A;  4BKS A;  4XC2 A;  1YJ1 A;  3I63 C;  4MGY E;  5FKA C;  3M62 B;  2J0M A;  1UBI A;  1UNS A;  1DOI A;  1E5W A;  2N9E B;  2N9P C;  2REX A;  3SFE B;  1XLP A; 
#chains in the Genus database with same CATH homology
 2GB1 A;  4YWG G;  1KRH A;  2PLP A;  2LEK A;  1F2R I;  2DLB A;  2JYE A;  1C78 A;  3UI3 A;  4JX1 C;  1B1Z A;  2WXM A;  4IDI A;  2OHF A;  3Q69 A;  3BVG A;  1FXI A;  2MEK A;  2PVG C;  2K22 A;  5JXV A;  3NVY A;  1CQV A;  2J53 A;  1JWA D;  2PW9 A;  3E9S A;  3KQ4 A;  2WXK A;  1V1P B;  4TQ0 A;  1TYG B;  2KAC A;  3HUI A;  4OZB A;  4TQ1 A;  4WQM A;  3W2D A;  1N62 A;  3VR8 B;  4HRO A;  2WS3 B;  4HJG E;  5H8Y E;  1T6B X;  2ONQ A;  1QQR A;  2W54 A;  1AWD A;  1ET6 A;  3E56 A;  1DOY A;  1STE A;  3ZGZ A;  1ZXH A;  3TSS A;  1V1O A;  1KFY B;  1I4H A;  1I7H A;  2W3S A;  3VRB B;  3BYT B;  3LB8 C;  3AEE B;  1EWC A;  3C8Y A;  3NZ3 A;  4ZRQ A;  2YEP F;  4AQ7 A;  2N9L A;  2JQR B;  4Q2J A;  4JE3 B;  1N61 A;  2PMV A;  3KWL A;  1E7P B;  1K52 A;  2AQ1 B;  3L4P A;  2CJO A;  1BUI C;  1GB4 A;  1TY2 A;  1RM6 C;  4ZOH C;  2AQ3 B;  1ACC A;  5BYQ A;  3R8B A;  4ARC A;  5E6J A;  1XEE A;  2PTL A;  3B2G A;  3BVZ A;  1MHX A;  2QMT A;  1HEZ E;  1SIJ A;  4REZ A;  2Y5P A;  2KQ4 X;  4HRS A;  4XDC A;  2J4X A;  2E3T A;  2WDR B;  1XLO A;  3Q8C A;  2CJN A;  2HDE A;  1PUT A;  1WGK A;  2PIA A;  2HTM E;  3NVZ A;  1F2R C;  2WXG A;  4C56 C;  1XO3 A;  3AEA B;  1FCC C;  4NAW B;  1QOF A;  2WNM A;  1XCT L;  4USA A;  2WLB A;  1MVK A;  4OHJ A;  4ZHO A;  1EU3 A;  2WXO A;  3TEX A;  1VZ6 A;  3IT4 B;  4XDD A;  5G5G A;  3SFD B;  4OZA A;  2Z8L A;  1N60 A;  2V0G A;  1I4X A;  1ZUD 2;  2J52 A;  2DWQ A;  2KN4 A;  2VZK B;  3CWI A;  2MJ3 A;  5EE0 A;  3NUH B;  1QKZ A;  1QOG A;  2FUG 1;  3ABV B;  2IGD A;  2IDY A;  2JWU A;  5G5H A;  4B0M A;  1TKG A;  4IOI E;  1JCK B;  4ARI A;  4PT5 A;  1ZP0 B;  2DYM A;  1HZ6 A;  1FFU A;  2BTE A;  1L4D B;  2Q5W D;  3EA6 A;  1DGJ A;  2RMM A;  2L32 A;  4RFB A;  1C4C A;  2MJD A;  3ETR A;  1AN8 A;  4L23 A;  5C2T B;  3FIL A;  1TY0 A;  3MJ5 A;  1V8C A;  4RF1 A;  1SE3 A;  1GAQ B;  1UGJ A;  2I38 A;  2LHD A;  1DYQ A;  1C76 A;  1FNU A;  1L0Y B;  1CK1 A;  3AE9 B;  2I2Y A;  4FXC A;  3BVM A;  1OFF A;  1SSN A;  3V3X A;  2QIL A;  1L4Z B;  2K9X A;  2RDH A;  3HRD D;  3W1S A;  1JQ4 A;  1OQQ A;  1GB1 A;  2WU2 B;  1V97 A;  1MHH E;  2OED A;  2VZK D;  2AQ2 B;  3DWG C;  4O1N A;  2B76 B;  2SEB D;  4YTM B;  4CQN A;  1J7B A;  3AEB B;  3VR9 B;  2N0S B;  3R2T A;  2M56 B;  4GDL B;  4P6V F;  1J7C A;  1VZ8 A;  3IAS 1;  5I4D A;  3PO0 A;  4GLS C;  4YSZ B;  1QF6 A;  4H2A A;  4RGN A;  1PGA A;  3PZ8 A;  1KH0 A;  1YQ3 B;  4KKI A;  5D3D A;  1XLN A;  4WIP A;  4RGM A;  1PGX A;  2JSV X;  1XXG A;  2BBC A;  5EE1 A;  1B9R A;  4KGT A;  2LMC A;  3IXS A;  3Q8A A;  4JWS C;  2W55 A;  3U7Z A;  1NYR A;  2V3N A;  1PDX A;  3ZJV A;  2LHE A;  5C3J B;  1T3Q A;  4DXF A;  1KF6 B;  1YMH E;  3NVW A;  1JWS D;  3Q8E A;  2Y3A A;  2V4I B;  1A70 A;  1I4Q A;  3MP9 A;  1N5X A;  1E0Z A;  1JRO A;  4C7Z A;  2ZW1 A;  2WP9 B;  1TS3 A;  2H89 B;  1UWM A;  1ZE3 D;  2KMM A;  1GOZ A;  2JXT A;  2XNA C;  4J3O D;  1P7F A;  4NAM A;  3PZ7 A;  4KGR A;  1XF5 L;  1AW7 A;  2BB5 A;  1VRA B;  3IAM 1;  2IJ0 A;  4ZRP A;  2M19 A;  2N7J A;  2R61 A;  3U2S C;  3ZQ4 A;  1M4V A;  2ICI A;  1D5M C;  1ZDV A;  1WRI A;  3RPF C;  4MM3 B;  1NI3 A;  3I9V 1;  1ROE A;  1KLU D;  4LTU A;  2JZP A;  1V1P A;  2WDQ B;  3AE3 B;  4EE2 A;  3BK1 A;  1HXY D;  1C77 A;  1ET9 A;  5GXG B;  1WXQ A;  1D6E C;  3TEW A;  1ESF A;  1JWM D;  1OQR A;  2EEL A;  1SBB B;  4YTP B;  3W5V B;  2PVO D;  5AUI A;  3BYY B;  1N5W A;  5HI1 A;  4C80 A;  1NEN B;  1L0X B;  1HQR D;  3NRZ A;  1IGD A;  2WXL A;  3AB5 A;  1JWU D;  3BK2 A;  1TKY A;  2DBY A;  2L83 A;  2ACZ B;  1NEK B;  3AEG B;  1WYG A;  2YEP B;  2BB6 A;  5BYS A;  1IBX B;  3OWE B;  1RYJ A;  3R2I A;  3BWU D;  4C7Y A;  4AS1 A;  3IT6 B;  1EM7 A;  3AV8 A;  4KKJ A;  1VR9 A;  2L1A A;  2WXR A;  1C4A A;  3MHZ A;  1MPE A;  2BS4 B;  3FAH A;  1SXT A;  5T8I A;  2IGH A;  2G9H D;  2NTS A;  2QJL A;  3RFZ B;  5HHD G;  2GRI A;  4RCO A;  5FK9 C;  3B2F A;  4YT0 B;  1ZPS A;  1FXA A;  1Y56 A;  4WUR A;  2WXN A;  2N9K A;  3AE6 B;  2K5P A;  1ENF A;  2LFI A;  4JWU C;  2PKO A;  5H92 C;  3SEB A;  3T3O A;  1SF0 A;  3P1M A;  2MH7 A;  4KGS A;  1ZOY B;  1FNW A;  2QIE B;  5MPO A;  4YXD B;  2BW2 A;  1TJE A;  4R3D A;  1E6E B;  1TS4 A;  2V3P A;  4GDK B;  1YNT E;  1SE4 A;  3TUO A;  1SJE D;  2WU5 B;  3V05 A;  1JWB D;  5TSS A;  3BZD B;  4LLG M;  1I4R A;  4WAF A;  1YJJ A;  4OW0 A;  4RH6 A;  1JW9 D;  1J7A A;  5D3I B;  1FNV A;  4RF0 A;  3Q8B A;  1R7S A;  5BMH A;  1C9F A;  1YN3 A;  4NZL B;  2RDG A;  3EUB 2;  2NTT A;  2W3R A;  4US9 A;  1C4P A;  5BMI A;  3P4S B;  2WXQ A;  2XN9 C;  1FEH A;  2K3U A;  1YQ4 B;  4N6E B;  1JRP A;  1BXT A;  2BS3 B;  1UWX A;  2JU6 X;  2X38 A;  2EKI A;  1AYF A;  2KWD A;  2E6X A;  3P4P B;  2BT6 A;  3AEC B;  3I57 A;  1D5X C;  4A55 A;  4A6Q A;  1PYW D;  3AN1 A;  5EE3 A;  3GS2 A;  2JX5 A;  1GPX A;  5FR3 A;  1I4G A;  1HA5 A;  2G1E A;  2RPV A;  1FFV A;  3BII D;  2D5G A;  2WDV B;  4MT5 A;  3TEZ A;  5BMG A;  1QOA A;  4YSY B;  3AMZ A;  4YSX B;  2IPK D;  1EWY C;  2WXI A;  1FO4 A;  4RGO S;  3URY A;  5EE9 A;  3GB1 A;  3NS1 A;  1F77 A;  3U52 E;  1XLQ A;  4N58 A;  4IKG A;  1C79 A;  4OZC A;  1SEB D;  1QLB B;  1NYQ A;  3AE8 B;  1WSP A;  5LNK 1;  2LUM A;  1HZ5 A;  1BML C;  1ZDX A;  2WXH A;  3NVV A;  2INP E;  2LJI A;  3MC0 B;  1FRD A;  2QSD A;  1KTK A;  2QEJ C;  3HVD A;  4ZYS A;  1L6U A;  1VDV A;  3CIR B;  2KAJ A;  4A90 A;  3AE4 B;  4HKZ E;  4JPS A;  4P16 A;  2W82 A;  4XWT A;  1FD6 A;  3J9C A;  1CZP A;  1L5P A;  2CU3 A;  2NMQ A;  1WWT A;  4HKQ A;  1IUE A;  1JML A;  2ZW0 A;  2M0A A;  3W5U B;  2LGI A;  2INN E;  4RNA A;  3MFG A;  1VJK A;  3ZJT A;  1TKE A;  4KX6 B;  1K50 A;  4WH4 A;  2JYT A;  4ZHP A;  4WWM A;  2ON8 A;  1VZ7 A;  1SB3 C;  3AE2 B;  2IGG A;  3ZYY X;  2TSS A;  2BS2 B;  1YN5 A;  2WXF A;  4XWW A;  3LYY A;  2FE8 A;  3N9Y C;  1FMA D;  1TZO A;  3GP7 A;  3TEY A;  1XCQ L;  3AEF B;  2WQY B;  4N59 A;  1TS5 A;  3AE1 B;  1L6V A;  3AE7 B;  3O13 A;  4NJC A;  1SE2 A;  1QOB A;  3T3N A;  3AH7 A;  1FRR A;  2J42 A;  3U4E G;  3W9C B;  4UDU C;  3EGR A;  1D5Z C;  1VLB A;  1K53 A;  3FIL B;  2KDM A;  4US8 A;  2MJE A;  3ZJU A;  1E9M A;  4YTN B;  2GI9 A;  2WXP A;  1SJH D;  4L2Y A;  1L0V B;  1RFK A;  1YN4 A;  2SAK A;  4MAC A;  3VRA B;  1DOX A;  1FM0 D;  2Y5C A;  1RWS A;  3P42 A;  3Q8F A;  1FCL A;  1F0Z A;  1CJE A;  1QIL A;  1FIQ A;  1JAL A;  3FC4 A;  1PGB A;  3P4R B;  1T5X D;  3DWM A;  2DYO A;  2H88 B;  1EU4 A;  3VQI A;  1P7E A;  1E10 A;  2L52 A;  3WCQ A;  1IBX A;  4XE0 A;  4OVZ A;  4TSS A;  1D4B A;  3B9J A;  3P63 A;  4TMA B;  1NVI D;  1YJI A;  3AE5 B;  3KLS X;  1PFD A;  1N63 A;  4RGT A;  1ZXI A;  4A9A A;  4B0E A;  3SR6 A;  2BYT A;  5AUK A;  2FBW B;  2K0P A;  5HFY A;  1IGC A;  5HG2 A;  4MH8 A;  4D2K A;  4L1B A;  3LXF A;  1I4P A;  1KLG D;  4A8X C;  3HVZ A;  3AED B;  2AX5 A;  3AM9 A;  3H8H A;  4ITK A;  1K51 A;  1UUP A;  2WXJ A;  1TS2 A;  5FKA C;  1LO5 D;  4DQO C;  5D7G A;  1UNS A;  5BYR A;  1DOI A;  4DXG A;  1MI0 A;  4M0W A;  1Q10 A;  4HEA 1;  3SFE B;  1XLP A;  3KWV A;  1QT9 A;  3P4Q B;  4LK0 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...