3PO0A

Crystal structure of samp1 from haloferax volcanii
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
89
structure length
89
Chain Sequence
GSMEWKLFADLAEVAGSRTVRVDVDGDATVGDALDALVGAHPALESRVFGDDGELYDHINVLRNGEAAALGEATAAGDELALFPPVSGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small archaeal modifier protein 1
publication title Crystal structure of ubiquitin-like small archaeal modifier protein 1 (SAMP1) from Haloferax volcanii.
pubmed doi rcsb
source organism Haloferax volcanii
molecule tags Protein binding
total genus 23
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3po0A00
1FFUA 1FIQA 3P4QB 5MPOA 2BT6A 3AEGB 4WWMA 4ZOHC 1E7PB 1A70A 1V8CA 1SIJA 4FXCA 1J7BA 3VRAB 2BS3B 4ZHOA 1NEKB 2ACZB 3NVZA 4LTUA 4US8A 1JQ4A 1GAQB 2Q5WD 1QOBA 3AE1B 1E10A 4P6VF 3B2FA 5EE1A 2KMMA 1JW9D 3P4RB 4US9A 1KFYB 2M56B 3BIID 2K9XA 1I7HA 2L52A 2PIAA 1YQ3B 4YSZB 3AE5B 2PVGC 3W5UB 3AV8A 4HROA 4HRSA 1WYGA 5GXGB 2PVOD 1GPXA 1KRHA 1RYJA 2WDQB 2WP9B 2W54A 3AE8B 3KWLA 2H89B 4N58A 3W5VB 2WQYB 2M19A 1QOGA 1FFVA 2DBYA 3CIRB 1KF6B 4USAA 2FBWB 1WXQA 1R7SA 3CWIA 1OQRA 1QT9A 1FRDA 1ROEA 1ZOYB 2HTME 2K22A 3FAHA 2CU3A 4C7ZA 1E0ZA 1PDXA 1N62A 2CJOA 1NYQA 3AE9B 2K5PA 2AX5A 5EE0A 1FMAD 2WDVB 3AEDB 1RFKA 2DWQA 4WQMA 1B9RA 4A9AA 2CJNA 2JX5A 2G1EA 4YTMB 2KAJA 1CJEA 1FXIA 2MJEA 3AE4B 3FC4A 2EKIA 1EWYC 4IDIA 3RPFC 3VR8B 1N63A 4JX1C 1SF0A 1DOXA 3B2GA 1TKYA 1V97A 4YSYB 1JWBD 1DGJA 3SFDB 1CZPA 3AE7B 5G5GA 1PUTA 4ZHPA 3AE3B 5H92C 3W9CB 3AE2B 1JWAD 1TKGA 1NENB 1NYRA 5EE9A 3AH7A 5AUIA 4YT0B 1L6VA 1DOIA 3ETRA 2W3SA 3P63A 4N6EB 4C80A 1DOYA 1N5XA 2B76B 2BS4B 2WS3B 1FRRA 1VJKA 2QJLA 2WU5B 4JWUC 5C2TB 2WU2B 1QLBB 1XLOA 1NVID 3HVZA 1E9MA 3AECB 3NVWA 1L5PA 4YTPB 1F0ZA 1XLPA 3SR6A 1L0VB 1FM0D 2N0SB 1UWMA 3EUB2 5EE3A 3AEAB 3DWMA 1NI3A 1ZP0B 4YTNB 5G5HA 4N59A 2MJ3A 1JROA 1WWTA 1N61A 1VDVA 3WCQA 3L4PA 1T3QA 3VR9B 1WGKA 5C3JB 1ZUD2 3P4SB 3ZYYX 1QOAA 1XLNA 3HUIA 1VLBA 4KX6B 1FXAA 2QIEB 1WRIA 1XLQA 1ZXIA 2LEKA 3AE6B 1L6UA 1RWSA 3AEBB 3VRBB 3AEFB 2W55A 1AWDA 3SFEB 2L83A 3LXFA 1YJIA 2WLBA 1J7CA 2BS2B 3B9JA 4C7YA 1QF6A 1RM6C 3DWGC 3P1MA 3AB5A 3AMZA 2Y5CA 1J7AA 2MH7A 1QOFA 3AM9A 3NVVA 1JRPA 3NVYA 1TYGB 1TJEA 5AUKA 1SB3C 3NRZA 2JQRB 3PO0A 1PFDA 4YSXB 1YJJA 1XO3A 2OHFA 3LB8C 5H8YE 1N60A 3NS1A 2H88B 4ITKA 2E3TA 1OQQA 4JWSC 1E6EB 4YXDB 3ABVB 1TKEA 1IUEA 1FO4A 2MJDA 2W3RA 1AYFA 1N5WA 2WDRB 3P4PB 3AN1A 1YQ4B 3HRDD 3AEEB 1JALA 2PKOA 1OFFA
chains in the Genus database with same CATH superfamily
1HA5A 3P4QB 5JHBA 1E7PB 1T0QC 3Q8BA 1I35A 3FILB 3LYYA 4DHJD 2XK5B 2HE7A 1KFYB 2L8JA 3JSVB 1D4BA 1WX7A 2PVGC 2MHJA 1C79A 1I4QA 1HXYD 3P2BA 4L23A 4XDDA 1LXDA 3JYUA 2M19A 2IY0B 2RMMA 1C9FA 2WXHA 1KF6B 4USAA 1LO5D 2PPHA 4F7ZA 3UGBB 1FRDA 1GUAB 2CU3A 3RUIB 2AX5A 2YVCA 3AEDB 5E6PA 3FILA 1C77A 2BGFA 2XK5A 5D7GA 5IP4D 3AE4B 2KC1A 3OG5A 3T3NA 3JSVA 1JWMD 1TZOA 3RN9C 3C0RB 3AH7A 4LNKA 2WDTB 3IT4B 3NVWA 1L5PA 3VTVA 1ZP0B 3CMMB 5DPRA 2PE6B 4RCOA 5BYRA 4ANVA 2WX0A 3IAS1 1JWUD 4HCPB 2D3CA 2WXLA 2DAJA 4MDKE 1AARA 3N9YC 2CHXA 3QARA 2RD0A 3DWGC 1FCCC 2N1VA 3VQIA 2MH7A 2BWES 1SB3C 1LFDA 2KANA 1OGWA 4RMAA 2FE8A 4ICVA 4ITKA 4JWSC 1V5TA 1GJZA 3HVDA 1FO4A 2DYOA 4WH4A 1XEEA 1CK1A 3KVFB 4ZOHC 1T6BX 1UGJA 2KJ6A 1ISNA 2IO3B 2IZVB 1V81A 2XBBC 3MHSD 4OZAA 4MT5A 5BO4B 1JWSD 2DZIA 2IBIB 2PVOD 3R2IA 2JWUA 2QSDA 3C8YA 3H1UA 2KVRA 3JW0X 2DENB 4WAFA 2J42A 4KZ0A 1QKZA 1MFWA 1WYWB 4ANUA 4XYCA 2D3AA 1WE6A 1RFKA 4K7UA 2DNFA 3IAM1 2N9PC 1JWBD 2IGHA 2AEHA 1WXMA 5C2TB 2QJLA 3MHZA 1KJTA 2LGSA 2M17A 1SSNA 4LNNA 2MSED 4YTPB 2WGSA 1UWMA 3RZFA 1TBEA 1FXTB 1E7UA 4N59A 2MJ3A 2W82A 5E6JA 2JZZA 2NS5A 2PJHA 2BYFA 3VR9B 3QIJA 2K6DB 4G3XB 3HUIA 4KX6B 2KLCA 3DVGY 4ASWC 3N20C 3SU8X 4XWTA 3TIXA 4XZ4A 3I3TB 3WALA 1EF5A 3UF8A 3IFWB 1ZDVA 5D6JB 4AWJA 2JRHA 4BOZB 3NRZA 2PEAA 4GLSC 2KX0A 5JXVA 3LB8C 1UBIA 4LJPB 1V9JA 2D3GA 2JUOA 1AYFA 2WDRB 1OFFA 1J8CA 4I6PA 2L00B 3OWEB 3ZJVA 1OEYJ 4FBJB 4IW0A 5AZHA 1XD3B 2BS3B 4ZHOA 1HEZE 2KMMA 3CSTA 1WGYA 2MLBA 1MI0A 2PIAA 1ZDXA 3GE3C 5FR6A 1T5XD 1D3ZA 1UBQA 2M1MA 1F2RI 2KWCA 2N7DA 3SHQA 4NY0A 4AUQC 1KLVA 3MFGA 2GBNA 1QT9A 3PV1A 2RDGA 5LXHA 1D5ZC 2KOXA 1PGXA 3EGRA 2CJNA 2KWVB 2LWPA 2J0KA 2M0AA 1DGJA 1PUTA 3AE3B 5AEKB 3ETRA 5KHQA 1N5XA 1VZ6A 1L4DB 1XLOA 3IXSA 2KK8A 4L2YA 1HQRD 4FHKA 5EE3A 1YN4A 3DWMA 1NI3A 1N61A 1VDVA 4MH0E 4EZKA 4K3CA 4OZBA 3UQAA 3AU5A 2WWZA 3AE6B 3T8MA 3VH3B 3QA8A 4I6LB 2ZCBA 2JXXA 2IO0B 2IPKD 1QF6A 3WAOA 3PRZA 3HIZA 5IN7A 1QZEA 1X1MA 5J17A 2JQRB 3I63C 3GOEA 3Q3OC 1TKEA 3MJ5A 1M94A 3MC9A 1IPGA 4OHJA 1F2RC 3WAPA 4DHZE 1OEYA 5DPWA 5BMHA 3VRAB 1OTRB 2CHWA 1TZ1A 3H6NA 2C60A 2IJ0A 1T0YA 1E8XA 4RM9A 4W9IA 3DBLB 2K8CA 2D11A 2NTSA 1K53A 2K9XA 1IBXB 4KIKA 4A3PA 1TY2A 3KWVA 3DQVA 1KRHA 4RGMA 1WIAA 3W5VB 1WRDB 4W9LA 3APDA 1WXAA 2FBWB 1WR6E 4K3BA 3X23A 5CX3A 1N62A 5HKHA 2DLBA 3EA6A 2N7JA 1B9RA 1M4VA 2KMCA 3GZNB 3H9DA 4BOSC 3OLMD 1UD7A 3VR8B 1IBXA 2ZZPB 2B3AA 4M01A 4KDIC 2R61A 2HJ1A 2D2QA 2Y5BB 1XCQL 1TKGA 5AUIA 4FJYA 1D5XC 3Q8CA 3BK1A 4G0NB 4WJPA 2WXIA 3AECB 1EO6A 3ALBA 4DDGD 2ASQA 3PTFC 4LNFA 3ZRFA 4BAXA 2INCC 4JLCA 1JROA 4JQWC 3EECA 2SEBD 2J53A 2K3UA 1WGKA 2V9HA 4MGZE 5I4DA 1XLNA 3N1XC 1WRIA 2JZ3B 2L32A 3AEFB 4ACFA 2OJWA 4KZCA 1I4RA 2J7QB 3RZWC 3L13A 2KACA 2BYTA 4BKTA 1GB4A 3NVYA 2KN5A 1SE3A 2JF5A 3ZJUA 2IGDA 2G3QB 3I5JC 3ZGZA 2C9WB 5H8YE 3N1ZC 4ANXA 3L0WB 1L2NA 1RRBA 1HZ5A 2MA9B 4XGAB 1TIFA 3L54A 2G4DB 3RFZB 3B2FA 3PZ8A 3TEWA 4RFBA 3ZDMC 3W5UB 1K8RB 4AJYB 4OVZA 4WURA 3AE8B 3KWLA 3BZDB 4FULA 2LVPA 3BVGA 3ENEA 1OQRA 2HTME 1ROEA 4C7ZA 2KT7A 4JPSA 3QC8B 4PYUA 4LJOB 1E5WA 4FADA 2G1EA 1TY0A 2KAJA 2I1KA 5T8IA 1EWYC 3RPFC 1L0YB 2LHEA 2N4FA 3EFCA 3ZXVA 4OVVA 2WXKA 1P98A 2Z59B 4KSKC 1NENB 1R4MI 5KHOA 2DHZA 2WU5B 3OAWA 4FHJA 2G4SA 1KTKA 3C19A 5CHFA 2N0SB 1KM7A 2DYBA 1WWTA 4KV2A 3VFKA 3DPDA 2L1AA 2BBCA 1VLBA 4MGYE 4HPLB 1A5RA 3V60A 4LK0M 3U4EG 4GMVA 1J7CA 2FCQA 2CS4A 4RH6A 4YSXB 4XX5A 4JL9A 2LHDA 4B0MA 1E6EB 3ABVB 5HFYA 2MJDA 2WNMA 2KFKB 5LXIB 4HKQA 2HJ8A 3ZW3A 1ZPSA 3PSEB 3NUHB 2ZVNA 2EMSA 1A70A 4FXCA 1D5MC 1E10A 1QOBA 2GBKA 4AQ7A 3TJPA 3A1QB 2L05A 4GSWA 1KLGD 2D5GA 3AE5B 2WYQA 3ZNHB 4JIOU 1WXVA 2JVCA 2IO1B 2X8XX 1RYJA 2CHZA 4S0RA 3I57A 4O1NA 1XXGA 1LQBA 2KFKA 2RR9A 5JZEB 3PZ7A 3H7SA 4HK2A 4NJ7A 3DBHI 3UINB 1ZOYB 2K22A 3U2SC 1NYQA 2WX1A 1WZ3A 3Q69A 4GN1A 4P16A 1WR1A 2DX5B 1WJNA 1SE2A 3AI5A 2DWQA 4XC2A 4B6WA 2G9HD 2JX5A 4HVBA 3A1QA 1XF5L 4JX1C 4RF0A 1Y8RC 1KLUD 4M02A 1WJUA 4IM3A 5DCNA 5EE9A 1ZKHA 4RNAA 2W9NA 1DOIA 2ZW1A 3GE8C 1HZ6A 2CR5A 4EFOA 3EUB2 1SGHA 1CMXB 3APFA 4Q2JA 3NHEB 2N9EB 4ZDVA 1ENFA 5C3JB 3PRMB 3RNGC 3PLUA 3ML8A 5TSSA 2C7MB 4RM8A 1L6UA 5D3DA 5JHAA 2L83A 2BS2B 3B9JA 4URKA 5D94A 3QJZA 3W1SC 3BY4B 2QEJC 2INPE 3A33B 2GBMA 1TJEA 4EE2A 1I4GA 2H88B 2E3TA 2ZNVB 1SE9A 2LZ6A 1C4AA 2WXFA 4W9KA 1Q10A 5IO9A 2WXOA 1ZW7A 2BT6A 3WA0A 4EZLA 1VD2A 1EUVB 3LJ3A 4LDTB 2MBBB 2KMAA 3IBEA 3A4RA 4JGHB 1EU3A 3Q3MC 4AP4C 1TS4A 4HRSA 4ICUA 2EKEC 1GPXA 1H8CA 3SD5A 3QK0A 3PHWB 3TSSA 2SAKA 3AULA 4HWIB 5BMGA 2YEPF 2QDFA 2BPSA 2JSVX 1E0ZA 3VHTC 1UUPA 3PS6A 2V3SA 1UZXB 4DXGA 1E90A 3FC4A 2AYOB 2EKIA 2KFJA 4ZRPA 3VDZA 1KH0A 2O6VB 1CZPA 2PW9A 5H92C 5C23A 3TMPB 4KKJA 4MGIE 4K7SA 2OOBB 4BVUC 2J0MA 3T9LA 1E8ZA 1WM3A 2KKCA 2KX3A 3Q8EA 1FM0D 4PS7A 3ZNGC 3SEBA 3EC8A 2MBHA 2K1FA 2N9KA 1TS3A 3L08A 2LJ5A 1I4PA 4M0WA 2O6VA 1FEHA 4P1CC 1ZXIA 3HM6X 4BKSA 3M62B 1ZE3D 3NS8A 3Q14C 2V3NA 1P1AA 1TS5A 1JRPA 3LDZE 1TYGB 2A5UA 4LNOA 3NOBA 2L0TA 1S1QB 2FUHB 4YXDB 2GI9A 2LGYA 4BZAA 4IUMB 3ZRCA 1WGHA 1ET9A 2JXTA 2C7NB 2BQQA 5DPSA 2NCNA 4US8A 2FIFA 3APCA 3QX1A 3CSFA 3BINA 4II3B 1I7HA 1MVKA 3QQ8B 1MG8A 5GXGB 1ACCA 3VAWA 1ESFA 3DBRI 3MC8A 2JYEA 1N6ZA 4YWGG 2KDFB 4NAMA 3QAQA 2WDVB 2K25A 4W9FA 2KDEB 3U8ZA 3ONSA 2MX2A 2JRIB 2KD0A 4ZHPA 4E3CA 2INNE 1FPYA 1DOYA 2RSUA 2VZKB 4LLGM 3RULA 4G11A 2Z0DB 4HPPA 4K7WA 2KQ7A 1HTOA 3O65B 4C00A 4A20A 1BT0A 3VXWA 2BW2A 3GZNI 2AQ1B 1WGGA 4FJVB 3DBSA 2FCSA 4PS8A 1R4NI 4IKGA 4PYZA 4A3OA 2GLSA 3Q8AA 3HK0A 2L0FA 1YJIA 1VR9A 3AXCA 1BMLC 2UYZB 4PK1A 2OHFA 2MWSB 1WSPA 1WY8A 5GMVA 3KQ4A 1OQQA 2AQ3B 3VTWA 1PQSA 4M8MA 3P4PB 1QILA 3AEGB 3KUZA 2MBQA 1GC6A 1PGBA 1SIJA 4ZRJA 4B9KA 1JW9D 5LLIA 4S17A 1C3TA 4KIKB 1PGAA 3PZDA 3AV8A 4IC7B 3NY5A 2IY1B 2WDQB 3RCZA 2ZEQA 4REZA 2LXAA 2W54A 3ZNID 4N58A 2RPQA 1AW7A 3DVNU 1UELA 3PHXB 5HHDG 4W9DA 5FKAC 2MRPA 1U4AA 2LMCA 4WQMA 2HTHA 4YTMB 5EDSA 2D10A 3VH4B 1WF9A 2KNBA 3ZJTA 3B08A 3V61A 3L10B 4NAWA 4DXAB 1YX5B 2LGIA 4ZYSA 5G2NA 1WH3A 4G50A 3PPAA 1XQQA 1Z5SB 5D3IB 3WCQA 2ZW0A 3Q8FA 2D3BA 5IAAC 3P4SB 4X57B 1ZXHA 2QIEB 2KDIA 1IGCA 1V2YA 3AEBB 4RGTA 5HI1A 1GNUA 1F9JA 1IP9A 3WAMA 4MGKE 1TGZB 2OEDA 2LJIA 1FNUA 3CF6E 1IGDA 1YMHE 2MEKA 1N5WA 2L76A 2NR2A 2GBJA 2J0JA 1AN8A 4TMAB 1J7BA 3RNAC 4LTUA 1JQ4A 2KJHB 5E6NA 3TL5A 2BKRB 3O13A 4N9F4 4P6VF 4XWWA 3SDLC 4A8XC 3BIID 5CTRC 3M95A 2MQJA 4C4VB 4NPNA 3GB1A 1T0SC 3WANA 1QOGA 2DBYA 5BMIA 1WXQA 3H8HA 3OJ4B 4ARIA 1PDXA 3L17A 1EU4A 3DHHC 3ZVVA 2K5PA 3R7RA 2ZPNA 3OJ3A 2V4LA 2O6VD 4WJQA 2KTRB 3BYYB 4LNIA 2PMVA 3Q2AC 1N63A 4HDOA 1SF0A 4BKSD 1DOXA 2KLGA 2K6QA 4DBGA 4TKNA 1P7EA 4C4VA 3KUDB 3KYDD 2RDBC 4TV3A 1E8WA 1SE4A 2C7HA 3PREA 3X0WA 2KWUB 3BVZA 5G5HA 3DHIC 1S3SG 2RDHA 1JMLA 5TR5A 3KH0A 2KTRA 4W9HA 3VUXA 4DXFA 3RI7C 1C4CA 1RLFA 4DHZB 2JU6X 1QQRA 4A90A 3DCGA 1XLQA 1RWSA 4A55A 4C56C 3U7ZA 3V3XA 1P0RA 3RNEC 3PO0A 3MTNB 4NZLB 2UWQA 3R8BA 1WM2A 4KKIA 2KQSA 5AZGA 1HE8A 2NMQA 2PKOA 3ZUNA 1C1YB 1YD8U 1J0GA 2WXRA 1Z2MA 4WJNA 3ML9A 2XNAC 1YN3A 1DYQA 5EE1A 1I42A 3NZUA 3P4RB 4HPMB 3VTUA 1EM7A 1YQ3B 5L83A 1JRUA 4HEA1 2O2VB 4GIVA 4FA6A 3QWZB 1GG3A 4KGSA 4KSLC 1VZ8A 2LFIA 3DHGC 3BVMA 2MP2A 3RT3B 3U30A 2QHOA 4J6IA 2JPHA 5EE0A 3TEZA 4CYEA 3GP7A 2MJEA 1YJ1A 4IDIA 4W9EA 2AWTA 2IO2B 1EF1A 2MW5A 4IWPA 3AE7B 2VZKD 2O2VA 3QHTA 2UU7A 3B1LX 2FUG1 4KGRA 2NTTA 4MH8A 1V1PB 1VRAB 4F8CB 3SR6A 3KYCD 4XDCA 3VVWB 1YNTE 3L4PA 5IKCM 2X38A 1WZ0A 3IT6B 4PS3A 4MJSB 5C1ZA 5FK9C 1FXAA 2I38A 3VRBB 4KVGB 3LXFA 4GXBA 2INDC 3Q3JA 1F52A 2M4NA 2FCMA 3AMZA 2GBRA 3AM9A 4GDLB 3NVVA 1V1PA 2BKFA 1PYWD 2FCNA 3U52E 4JE3B 3MP9A 2DZMA 3NS1A 2ZCCA 1F77A 2LGDA 2ZNVC 4MJSA 1R4MB 1FIQA 3E9SA 4FN2A 1K50A 2JYTA 3ZTCA 2GMIC 3BK2A 2J4XA 3RNBC 3AE1B 3NZ3A 1LM8B 2YLMA 2CU1A 4GDLA 3R7QA 4NQKE 4E71A 2L52A 2LRWA 3V6EB 2GRIA 2HDEA 4RF1A 2C5LC 2QCZA 4AOFA 4EOYA 3FKYA 4W9JA 4BBNC 2NBUA 4DK5A 3JVZX 4CO7A 3ZXRA 4P1BC 1V86A 2CJOA 5J18A 2Z0EB 5CHWA 3ZTDA 1UWXA 4MELA 2LI5A 2WXGA 4HJGE 3KUCB 1C4PA 4WQOB 3AE2B 4H2AA 1JWAD 3P63A 4ZRIA 2I2YA 2BS4B 2AL3A 2I1JA 2WU2B 1QLBB 2YEPB 3HVZA 1F0ZA 3Q6BA 1TT5B 4MSMB 4GOCA 2IDYA 4IG7B 2K8HA 3DVGX 1T3QA 1UGMA 4NQLB 3H7PB 1QOAA 2NBWB 2G45B 1ZGUB 5D2MB 4M0WB 4BBNF 1MHHE 2LEKA 2LVQA 5DPTA 3DBHB 2ZVOA 3HHMA 4HJKA 3A9JB 3PT2B 3IHPC 3W1SA 2CKHB 3P1MA 2RPVA 1NDDA 4EEWA 5AUKA 3R2TA 1WI0A 5LNK1 3V6CB 3PVLA 2LGXA 3DDCB 3H7PA 3WIMA 1VCBA 4HXDA 2GOWA 4J3OD 3T3OA 4UDUC 4A6QA 4WWMA 3IG3A 4K1RB 1V8CA 3EHVA 3A9JA 2E6XA 1WE7A 5HG2A 1FNWA 3NVZA 1GAQB 4II2B 4DQOC 1V6EA 1YOVB 1YX6B 1TS2A 3ECIA 4YSZB 3RD2A 3PGEA 2MCNB 1D6EC 2LASA 2WP9B 1V49A 2BYVE 1XCTL 2H89B 1VZ7A 2MBOA 3A4SC 2Y5PA 3N3KB 2NBVB 3ZNZB 3J9CA 2Y3AA 2XN9C 3AU4A 1Y56A 2K39A 3TEYA 2N9XA 2LUMA 4WIPA 1NI2A 4DDID 1TKYA 2BVCA 3R3MA 3MJWA 1KOTA 4MACA 4GDKB 4OVUA 1L6VA 4IWOA 2PTLA 4W9GA 2B76B 2NVUI 2WXPA 4JWUC 3DOWA 2BF8B 1NVID 1E9MA 2WXNA 3KW5B 3UIOB 5IOIA 1E8YA 2ICIA 3DBLI 3V62A 4B95A 3URYA 1LGRA 3IVFA 3D32A 4R3DA 2R2QA 4GDKA 3SFEB 3E56A 1MPEA 4RGNA 2EMTA 4TUUA 4F1SA 4ZYNA 1H4RA 3N1YC 3RNCC 3NZSA 4WAAA 4OW0A 2V1YA 1SJHD 5MPOA 2QC8A 1J19A 1OQYA 4HDQA 1WJ4A 5FR3A 2L7RA 1GB1A 1V80A 2N7EA 4US9A 1TTNA 1K51A 2AL6A 4EZJA 2BWFA 4DHJB 4HROA 1P7FA 3L16A 5JH5C 4EUTA 5L95C 1SXTA 1SIFA 1SEBD 2WQYB 3A9KB 3TUOA 1FFVA 4WWNA 2LD9A 1WGRA 1L4ZB 2QMTA 4RGOS 3AE9B 1FMAD 2JZPA 2KDMA 3ZKJC 3ZDTA 1FNVA 1SBBB 2KXJA 1GC7A 1Q5WB 3SFDB 3W2DA 2JT4B 1T0RC 1WX8A 4YT0B 2JY6A 2W3SA 4C80A 2K0PA 4NAWB 2KJRA 1FRRA 3A9KA 4LCDE 2D07B 3TBLD 1C78A 3W1YA 3VUWA 2FNJB 3QCAA 2KWDA 4YTNB 3N32A 2KN4A 2DZJA 4ZRKA 2REXA 4M8NA 1BUIC 3DBRB 2OJRA 2NPTB 2KTFA 2A4ZA 2Y5CA 1J7AA 2VH2A 1QOFA 3ZIMA 4NNJB 2WXMA 4MM3B 3K9OB 1N60A 1G6JA 2KO3A 2KVZA 1IUEA 3N30A 3Q3NC 4NJ6A 1B1ZA 3V05A 3VUYA 3TCAA 2NPTA 2ACZB 4B0EA 4CQNA 1UH6A 3RNFC 5AZFA 4HLEA 4GB9A 4MM3A 1Q1OA 3Q3FA 3NG0A 1R4NB 2V3PA 1RAXA 2ONQA 3M63B 4IM0A 4LDTD 4W9CA 4OZCA 3K9PB 4E74A 1YIWA 4HCNB 2KQ4X 3ZQ4A 1MHXA 1V5OA 5CHVC 1F1HA 4TQ0A 3PLVA 2LVOA 2BYEA 5BYSA 3KLSX 1FXIA 1FCLA 2GB1A 4HKZE 1YQBA 5BYQA 2N9LA 4QAYA 5IA7A 2WXJA 4YSYB 1C76A 2M8SA 4KDLB 5G5GA 4IWQA 3ZO5B 5J2RA 1JCKB 2WS3B 1WJ6A 1WFYA 3UIPB 1L0XB 2IYDB 1P3QU 2FIDA 3AEAB 2RGFA 3P42A 4DWFA 1WX9A 1UF0A 2BTEA 4FJZA 4IOIE 4WJOA 1XT9B 2KZRA 1BXTA 2AQ2B 3DVNV 2W55A 4L1BA 1AWDA 2N1WA 1RFAA 3TEXA 2WLBA 3RMKC 4C7YA 1RM6C 3AB5A 3HM3A 2Z8LA 4NJCA 1STEA 1PFDA 4D2KA 1K52A 1P9DU 3S2AA 2PE9A 1Q0WB 2K8BA 1I4XA 1YN5A 1EWCA 2W3RA 3AN1A 1YQ4B 3GS2A 1FFUA 4TSSA 3M3JA 2TSSA 4K81A 2WXQA 4GU2A 2LRUA 1NEKB 2JWZA 2Q5WD 2J52A 4AS1A 4PT5A 4M00A 2DZKA 2KC2A 4GGQA 2M56B 4ARCA 3BYTB 4TQ1A 2XEWA 4YL8A 1MJDA 1L7YA 2ZPYA 1WYGA 4CHKA 4IM2A 1ET6A 3MC0B 2KYWA 1CQVA 1WMHB 2MP2B 3CIRB 2LXCA 1I4HA 1R7SA 4MSQB 3CWIA 4XE0A 3FAHA 1WGDA 1SJED 2LUEA 2BB6A 2WHIA 4A9AA 3U7DA 2MBEA 1CJEA 2ZJDA 1HTQA 2DYMA 1V1OA 2V4IB 3B2GA 4BKGA 1V97A 1IYFA 3W9CB 1UNSA 1WXSA 2KDBA 1NYRA 2R2OA 2DAFA 2EELA 1FD6A 4N6EB 3EFUA 1VJKA 1WMHA 2VH1A 4I6NB 4WWPA 4ZRQA 1XLPA 1L0VB 4KGTA 2BB5A 2L3ZA 2FAZA 4WWOA 4EKUA 3NJTA 5E6OA 2M0XA 1GOZA 2ON8A 1MG4A 1ZUD2 3I9V1 3ZYYX 4BFRA 4FLHA 4MEMA 3UQBA 4ANWA 5G55A 3RYTA 2HD5B 2KHWB 3BWUD 1E7VA 1NBFC 3B0AA 3R66C 3UI3A 2VRRB 3ZLZA 2IGGA 4P7IA 1YJJA 1XO3A 3PRPB 2PLPA 2QILA 2V0GA 3HRDD 3AEEB 1JALA 4AJWA
chains in the Genus database with same CATH topology
1HA5A 4J3OD 3T3OA 4UDUC 3P4QB 4A6QA 3AEGB 4WWMA 1E7PB 1HZ5A 1V8CA 1PGBA 1SIJA 2E6XA 5HG2A 1FNWA 3NVZA 3Q8BA 1GAQB 3FILB 3LYYA 3RFZB 3B2FA 3PZ8A 3TEWA 1JW9D 4DQOC 1KFYB 4RFBA 1TS2A 4YSZB 1PGAA 1D4BA 3W5UB 2PVGC 3AV8A 1C79A 1D6EC 1I4QA 1HXYD 4OVZA 2WP9B 2WDQB 4WURA 4REZA 2W54A 1XCTL 3AE8B 3BZDB 2H89B 3KWLA 1VZ7A 4N58A 4L23A 4XDDA 3BVGA 2M19A 2Y5PA 1AW7A 2RMMA 1C9FA 2WXHA 1KF6B 4USAA 1LO5D 1OQRA 2HTME 1FRDA 1ROEA 4C7ZA 3J9CA 2CU3A 4JPSA 2Y3AA 5HHDG 2AX5A 2XN9C 5FKAC 3AEDB 3FILA 1C77A 1Y56A 2LMCA 3TEYA 4WQMA 2LUMA 4YTMB 2G1EA 1TY0A 2KAJA 5D7GA 3AE4B 5T8IA 3T3NA 1EWYC 3RPFC 4WIPA 1L0YB 2LHEA 1TKYA 1JWMD 1TZOA 2WXKA 3ZJTA 4MACA 4GDKB 1NENB 3AH7A 1L6VA 2PTLA 2B76B 2WU5B 2WXPA 4JWUC 3IT4B 2LGIA 1NVID 1E9MA 2WXNA 3NVWA 1L5PA 4ZYSA 1KTKA 2N0SB 1ZP0B 1WWTA 5D3IB 2ICIA 3WCQA 2ZW0A 3Q8FA 3URYA 2L1AA 4RCOA 3P4SB 5BYRA 1ZXHA 2BBCA 3IAS1 4R3DA 1JWUD 1VLBA 2QIEB 1IGCA 2WXLA 3AEBB 4RGTA 5HI1A 3SFEB 3N9YC 3E56A 4LK0M 3U4EG 1MPEA 1J7CA 4RGNA 3DWGC 1FCCC 3VQIA 2MH7A 1SB3C 2OEDA 2LJIA 4RH6A 4YSXB 1FNUA 2FE8A 2LHDA 4ITKA 4B0MA 4JWSC 1E6EB 3ABVB 1IGDA 1YMHE 2MEKA 2MJDA 2WNMA 1N5WA 5HFYA 4HKQA 3HVDA 1FO4A 2DYOA 4OW0A 1ZPSA 1XEEA 4WH4A 1CK1A 3NUHB 1SJHD 1AN8A 5MPOA 4ZOHC 1A70A 4TMAB 4FXCA 1J7BA 1T6BX 1UGJA 1D5MC 4LTUA 1JQ4A 1E10A 1QOBA 3O13A 4P6VF 4AQ7A 5FR3A 4XWWA 1GB1A 4A8XC 4US9A 3BIID 1K51A 4OZAA 4MT5A 1KLGD 1JWSD 2D5GA 3AE5B 4HROA 1P7FA 2PVOD 3R2IA 1RYJA 2JWUA 2QSDA 3GB1A 3I57A 3C8YA 1XXGA 4O1NA 1SXTA 1SEBD 3PZ7A 2WQYB 4WAFA 3TUOA 1QOGA 1FFVA 2DBYA 5BMIA 1WXQA 2J42A 1L4ZB 2QMTA 1QKZA 4RGOS 1ZOYB 2K22A 3H8HA 3U2SC 4ARIA 1PDXA 1EU4A 1NYQA 3AE9B 2K5PA 3Q69A 4P16A 1FMAD 2JZPA 2KDMA 1SE2A 1RFKA 2DWQA 2G9HD 2JX5A 1FNVA 1SBBB 3BYYB 1XF5L 2PMVA 3IAM1 1N63A 4JX1C 1SF0A 4RF0A 1DOXA 1JWBD 1KLUD 3SFDB 3W2DA 1P7EA 2IGHA 5EE9A 4YT0B 4RNAA 1DOIA 2W3SA 4C80A 2K0PA 4NAWB 5C2TB 1FRRA 2QJLA 2ZW1A 1SE4A 3MHZA 1C78A 1SSNA 1HZ6A 4YTPB 3BVZA 1UWMA 3EUB2 2KWDA 5G5HA 4YTNB 4N59A 2MJ3A 2W82A 4Q2JA 5E6JA 2RDHA 1JMLA 1ENFA 3VR9B 2KN4A 4DXFA 5C3JB 1C4CA 2JU6X 1QQRA 3HUIA 4A90A 4KX6B 5TSSA 1BUIC 1XLQA 1L6UA 1RWSA 5D3DA 4XWTA 2L83A 4A55A 4C56C 2BS2B 3B9JA 1ZDVA 3U7ZA 2QEJC 2Y5CA 1J7AA 2INPE 1QOFA 3V3XA 1TJEA 3NRZA 4EE2A 3PO0A 1I4GA 2WXMA 4MM3B 4GLSC 4NZLB 5JXVA 3R8BA 3LB8C 1N60A 2H88B 4KKIA 2E3TA 1IUEA 1AYFA 2WDRB 1C4AA 2WXFA 2NMQA 1Q10A 1OFFA 2PKOA 2WXOA 1B1ZA 3OWEB 3ZJVA 3V05A 2BT6A 2WXRA 2XNAC 2BS3B 4ZHOA 2ACZB 4B0EA 4CQNA 1YN3A 1DYQA 1HEZE 5EE1A 2KMMA 3P4RB 1EU3A 1EM7A 1MI0A 2PIAA 1YQ3B 1ZDXA 1TS4A 4HRSA 4HEA1 1GPXA 1T5XD 2V3PA 1F2RI 2ONQA 4KGSA 1VZ8A 4OZCA 2LFIA 3TSSA 2SAKA 3BVMA 5BMGA 2YEPF 3MFGA 2JSVX 1QT9A 2KQ4X 3ZQ4A 1MHXA 1E0ZA 1UUPA 4TQ0A 2RDGA 5EE0A 1D5ZC 3TEZA 1PGXA 3EGRA 5BYSA 4DXGA 2CJNA 3KLSX 3GP7A 1FXIA 1FCLA 2GB1A 2MJEA 3FC4A 4HKZE 5BYQA 2EKIA 4IDIA 2M0AA 4ZRPA 2N9LA 1KH0A 2WXJA 4YSYB 1C76A 1DGJA 1CZPA 2PW9A 3AE7B 1PUTA 5G5GA 3AE3B 2VZKD 5H92C 4KKJA 3ETRA 1JCKB 1N5XA 2WS3B 1VZ6A 1L4DB 2FUG1 4KGRA 1XLOA 3IXSA 2NTTA 4MH8A 3Q8EA 1V1PB 1VRAB 4L2YA 3SR6A 4XDCA 1FM0D 1HQRD 1L0XB 5EE3A 1YN4A 3AEAB 3DWMA 1NI3A 3SEBA 3P42A 1N61A 1VDVA 1YNTE 3L4PA 2BTEA 2X38A 2N9KA 4IOIE 1TS3A 3IT6B 5FK9C 4OZBA 1I4PA 4M0WA 1FXAA 1FEHA 2I38A 1ZXIA 3AE6B 3VRBB 1BXTA 2AQ2B 2W55A 4L1BA 1AWDA 3TEXA 3LXFA 2WLBA 4C7YA 2IPKD 1ZE3D 1QF6A 1RM6C 2V3NA 3AB5A 3AMZA 3AM9A 1TS5A 4GDLB 1V1PA 3NVVA 1JRPA 1TYGB 1PYWD 2Z8LA 4NJCA 2JQRB 3U52E 1STEA 1PFDA 4D2KA 1K52A 4JE3B 3MP9A 3NS1A 4YXDB 1TKEA 3MJ5A 2GI9A 1I4XA 1F77A 1EWCA 1YN5A 2W3RA 3AN1A 1YQ4B 4OHJA 1F2RC 3GS2A 1FFUA 1FIQA 3E9SA 4TSSA 2TSSA 1ET9A 2JXTA 2WXQA 1K50A 2JYTA 5BMHA 3VRAB 3BK2A 1NEKB 2J4XA 4US8A 2Q5WD 4AS1A 2J52A 3AE1B 4PT5A 3NZ3A 2IJ0A 2M56B 2NTSA 1K53A 4ARCA 2K9XA 3BYTB 4TQ1A 1I7HA 1IBXB 2L52A 1MVKA 2GRIA 2HDEA 1TY2A 1WYGA 3KWVA 5GXGB 1ET6A 4RF1A 1KRHA 4RGMA 3MC0B 1ACCA 3W5VB 1CQVA 1ESFA 3CIRB 1I4HA 2FBWB 2JYEA 1R7SA 3CWIA 4XE0A 3FAHA 4YWGG 1N62A 2CJOA 4NAMA 1SJED 2WDVB 2BB6A 2DLBA 3EA6A 2N7JA 1B9RA 1M4VA 4A9AA 1CJEA 2DYMA 1V1OA 1UWXA 3VR8B 2V4IB 2WXGA 4HJGE 1IBXA 3B2GA 1V97A 1C4PA 2R61A 4ZHPA 3W9CB 1UNSA 1XCQL 3AE2B 4H2AA 1JWAD 1TKGA 1NYRA 2INNE 5AUIA 2EELA 1FD6A 1D5XC 3P63A 3Q8CA 4N6EB 2I2YA 4LLGM 2VZKB 2BS4B 3BK1A 1DOYA 1VJKA 2WU2B 1QLBB 4ZRQA 2WXIA 2YEPB 3HVZA 3AECB 1F0ZA 1XLPA 1L0VB 4KGTA 2BB5A 1JROA 2IDYA 1GOZA 2SEBD 2J53A 1T3QA 2BW2A 2K3UA 2ON8A 1WGKA 2AQ1B 1ZUD2 3I9V1 5I4DA 3ZYYX 1QOAA 1XLNA 1MHHE 1WRIA 2LEKA 4IKGA 2L32A 3AEFB 3BWUD 3Q8AA 1I4RA 1YJIA 2KACA 1VR9A 2BYTA 3W1SA 3P1MA 3UI3A 1GB4A 2RPVA 3NVYA 1SE3A 5AUKA 1BMLC 3R2TA 2IGDA 3ZJUA 2IGGA 3ZGZA 1YJJA 1XO3A 2OHFA 5H8YE 5LNK1 1WSPA 3KQ4A 1OQQA 2AQ3B 2PLPA 2QILA 2V0GA 3P4PB 1QILA 3HRDD 3AEEB 1JALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FFU A;  1FIQ A;  3P4Q B;  5MPO A;  2BT6 A;  3AEG B;  4WWM A;  4ZOH C;  1E7P B;  1A70 A;  1V8C A;  1SIJ A;  4FXC A;  1J7B A;  3VRA B;  2BS3 B;  4ZHO A;  1NEK B;  2ACZ B;  3NVZ A;  4LTU A;  4US8 A;  1JQ4 A;  1GAQ B;  2Q5W D;  1QOB A;  3AE1 B;  1E10 A;  4P6V F;  3B2F A;  5EE1 A;  2KMM A;  1JW9 D;  3P4R B;  4US9 A;  1KFY B;  2M56 B;  3BII D;  2K9X A;  1I7H A;  2L52 A;  2PIA A;  1YQ3 B;  4YSZ B;  3AE5 B;  2PVG C;  3W5U B;  3AV8 A;  4HRO A;  4HRS A;  1WYG A;  5GXG B;  2PVO D;  1GPX A;  1KRH A;  1RYJ A;  2WDQ B;  2WP9 B;  2W54 A;  3AE8 B;  3KWL A;  2H89 B;  4N58 A;  3W5V B;  2WQY B;  2M19 A;  1QOG A;  1FFV A;  2DBY A;  3CIR B;  1KF6 B;  4USA A;  2FBW B;  1WXQ A;  1R7S A;  3CWI A;  1OQR A;  1QT9 A;  1FRD A;  1ROE A;  1ZOY B;  2HTM E;  2K22 A;  3FAH A;  2CU3 A;  4C7Z A;  1E0Z A;  1PDX A;  1N62 A;  2CJO A;  1NYQ A;  3AE9 B;  2K5P A;  2AX5 A;  5EE0 A;  1FMA D;  2WDV B;  3AED B;  1RFK A;  2DWQ A;  4WQM A;  1B9R A;  4A9A A;  2CJN A;  2JX5 A;  2G1E A;  4YTM B;  2KAJ A;  1CJE A;  1FXI A;  2MJE A;  3AE4 B;  3FC4 A;  2EKI A;  1EWY C;  4IDI A;  3RPF C;  3VR8 B;  1N63 A;  4JX1 C;  1SF0 A;  1DOX A;  3B2G A;  1TKY A;  1V97 A;  4YSY B;  1JWB D;  1DGJ A;  3SFD B;  1CZP A;  3AE7 B;  5G5G A;  1PUT A;  4ZHP A;  3AE3 B;  5H92 C;  3W9C B;  3AE2 B;  1JWA D;  1TKG A;  1NEN B;  1NYR A;  5EE9 A;  3AH7 A;  5AUI A;  4YT0 B;  1L6V A;  1DOI A;  3ETR A;  2W3S A;  3P63 A;  4N6E B;  4C80 A;  1DOY A;  1N5X A;  2B76 B;  2BS4 B;  2WS3 B;  1FRR A;  1VJK A;  2QJL A;  2WU5 B;  4JWU C;  5C2T B;  2WU2 B;  1QLB B;  1XLO A;  1NVI D;  3HVZ A;  1E9M A;  3AEC B;  3NVW A;  1L5P A;  4YTP B;  1F0Z A;  1XLP A;  3SR6 A;  1L0V B;  1FM0 D;  2N0S B;  1UWM A;  3EUB 2;  5EE3 A;  3AEA B;  3DWM A;  1NI3 A;  1ZP0 B;  4YTN B;  5G5H A;  4N59 A;  2MJ3 A;  1JRO A;  1WWT A;  1N61 A;  1VDV A;  3WCQ A;  3L4P A;  1T3Q A;  3VR9 B;  1WGK A;  5C3J B;  1ZUD 2;  3P4S B;  3ZYY X;  1QOA A;  1XLN A;  3HUI A;  1VLB A;  4KX6 B;  1FXA A;  2QIE B;  1WRI A;  1XLQ A;  1ZXI A;  2LEK A;  3AE6 B;  1L6U A;  1RWS A;  3AEB B;  3VRB B;  3AEF B;  2W55 A;  1AWD A;  3SFE B;  2L83 A;  3LXF A;  1YJI A;  2WLB A;  1J7C A;  2BS2 B;  3B9J A;  4C7Y A;  1QF6 A;  1RM6 C;  3DWG C;  3P1M A;  3AB5 A;  3AMZ A;  2Y5C A;  1J7A A;  2MH7 A;  1QOF A;  3AM9 A;  3NVV A;  1JRP A;  3NVY A;  1TYG B;  1TJE A;  5AUK A;  1SB3 C;  3NRZ A;  2JQR B;  3PO0 A;  1PFD A;  4YSX B;  1YJJ A;  1XO3 A;  2OHF A;  3LB8 C;  5H8Y E;  1N60 A;  3NS1 A;  2H88 B;  4ITK A;  2E3T A;  1OQQ A;  4JWS C;  1E6E B;  4YXD B;  3ABV B;  1TKE A;  1IUE A;  1FO4 A;  2MJD A;  2W3R A;  1AYF A;  1N5W A;  2WDR B;  3P4P B;  3AN1 A;  1YQ4 B;  3HRD D;  3AEE B;  1JAL A;  2PKO A;  1OFF A; 
#chains in the Genus database with same CATH topology
 1HA5 A;  3P4Q B;  5JHB A;  1E7P B;  1T0Q C;  3Q8B A;  1I35 A;  3FIL B;  3LYY A;  4DHJ D;  2XK5 B;  2HE7 A;  1KFY B;  2L8J A;  3JSV B;  1D4B A;  1WX7 A;  2PVG C;  2MHJ A;  1C79 A;  1I4Q A;  1HXY D;  3P2B A;  4L23 A;  4XDD A;  1LXD A;  3JYU A;  2M19 A;  2IY0 B;  2RMM A;  1C9F A;  2WXH A;  1KF6 B;  4USA A;  1LO5 D;  2PPH A;  4F7Z A;  3UGB B;  1FRD A;  1GUA B;  2CU3 A;  3RUI B;  2AX5 A;  2YVC A;  3AED B;  5E6P A;  3FIL A;  1C77 A;  2BGF A;  2XK5 A;  5D7G A;  5IP4 D;  3AE4 B;  2KC1 A;  3OG5 A;  3T3N A;  3JSV A;  1JWM D;  1TZO A;  3RN9 C;  3C0R B;  3AH7 A;  4LNK A;  2WDT B;  3IT4 B;  3NVW A;  1L5P A;  3VTV A;  1ZP0 B;  3CMM B;  5DPR A;  2PE6 B;  4RCO A;  5BYR A;  4ANV A;  2WX0 A;  3IAS 1;  1JWU D;  4HCP B;  2D3C A;  2WXL A;  2DAJ A;  4MDK E;  1AAR A;  3N9Y C;  2CHX A;  3QAR A;  2RD0 A;  3DWG C;  1FCC C;  2N1V A;  3VQI A;  2MH7 A;  2BWE S;  1SB3 C;  1LFD A;  2KAN A;  1OGW A;  4RMA A;  2FE8 A;  4ICV A;  4ITK A;  4JWS C;  1V5T A;  1GJZ A;  3HVD A;  1FO4 A;  2DYO A;  4WH4 A;  1XEE A;  1CK1 A;  3KVF B;  4ZOH C;  1T6B X;  1UGJ A;  2KJ6 A;  1ISN A;  2IO3 B;  2IZV B;  1V81 A;  2XBB C;  3MHS D;  4OZA A;  4MT5 A;  5BO4 B;  1JWS D;  2DZI A;  2IBI B;  2PVO D;  3R2I A;  2JWU A;  2QSD A;  3C8Y A;  3H1U A;  2KVR A;  3JW0 X;  2DEN B;  4WAF A;  2J42 A;  4KZ0 A;  1QKZ A;  1MFW A;  1WYW B;  4ANU A;  4XYC A;  2D3A A;  1WE6 A;  1RFK A;  4K7U A;  2DNF A;  3IAM 1;  2N9P C;  1JWB D;  2IGH A;  2AEH A;  1WXM A;  5C2T B;  2QJL A;  3MHZ A;  1KJT A;  2LGS A;  2M17 A;  1SSN A;  4LNN A;  2MSE D;  4YTP B;  2WGS A;  1UWM A;  3RZF A;  1TBE A;  1FXT B;  1E7U A;  4N59 A;  2MJ3 A;  2W82 A;  5E6J A;  2JZZ A;  2NS5 A;  2PJH A;  2BYF A;  3VR9 B;  3QIJ A;  2K6D B;  4G3X B;  3HUI A;  4KX6 B;  2KLC A;  3DVG Y;  4ASW C;  3N20 C;  3SU8 X;  4XWT A;  3TIX A;  4XZ4 A;  3I3T B;  3WAL A;  1EF5 A;  3UF8 A;  3IFW B;  1ZDV A;  5D6J B;  4AWJ A;  2JRH A;  4BOZ B;  3NRZ A;  2PEA A;  4GLS C;  2KX0 A;  5JXV A;  3LB8 C;  1UBI A;  4LJP B;  1V9J A;  2D3G A;  2JUO A;  1AYF A;  2WDR B;  1OFF A;  1J8C A;  4I6P A;  2L00 B;  3OWE B;  3ZJV A;  1OEY J;  4FBJ B;  4IW0 A;  5AZH A;  1XD3 B;  2BS3 B;  4ZHO A;  1HEZ E;  2KMM A;  3CST A;  1WGY A;  2MLB A;  1MI0 A;  2PIA A;  1ZDX A;  3GE3 C;  5FR6 A;  1T5X D;  1D3Z A;  1UBQ A;  2M1M A;  1F2R I;  2KWC A;  2N7D A;  3SHQ A;  4NY0 A;  4AUQ C;  1KLV A;  3MFG A;  2GBN A;  1QT9 A;  3PV1 A;  2RDG A;  5LXH A;  1D5Z C;  2KOX A;  1PGX A;  3EGR A;  2CJN A;  2KWV B;  2LWP A;  2J0K A;  2M0A A;  1DGJ A;  1PUT A;  3AE3 B;  5AEK B;  3ETR A;  5KHQ A;  1N5X A;  1VZ6 A;  1L4D B;  1XLO A;  3IXS A;  2KK8 A;  4L2Y A;  1HQR D;  4FHK A;  5EE3 A;  1YN4 A;  3DWM A;  1NI3 A;  1N61 A;  1VDV A;  4MH0 E;  4EZK A;  4K3C A;  4OZB A;  3UQA A;  3AU5 A;  2WWZ A;  3AE6 B;  3T8M A;  3VH3 B;  3QA8 A;  4I6L B;  2ZCB A;  2JXX A;  2IO0 B;  2IPK D;  1QF6 A;  3WAO A;  3PRZ A;  3HIZ A;  5IN7 A;  1QZE A;  1X1M A;  5J17 A;  2JQR B;  3I63 C;  3GOE A;  3Q3O C;  1TKE A;  3MJ5 A;  1M94 A;  3MC9 A;  1IPG A;  4OHJ A;  1F2R C;  3WAP A;  4DHZ E;  1OEY A;  5DPW A;  5BMH A;  3VRA B;  1OTR B;  2CHW A;  1TZ1 A;  3H6N A;  2C60 A;  2IJ0 A;  1T0Y A;  1E8X A;  4RM9 A;  4W9I A;  3DBL B;  2K8C A;  2D11 A;  2NTS A;  1K53 A;  2K9X A;  1IBX B;  4KIK A;  4A3P A;  1TY2 A;  3KWV A;  3DQV A;  1KRH A;  4RGM A;  1WIA A;  3W5V B;  1WRD B;  4W9L A;  3APD A;  1WXA A;  2FBW B;  1WR6 E;  4K3B A;  3X23 A;  5CX3 A;  1N62 A;  5HKH A;  2DLB A;  3EA6 A;  2N7J A;  1B9R A;  1M4V A;  2KMC A;  3GZN B;  3H9D A;  4BOS C;  3OLM D;  1UD7 A;  3VR8 B;  1IBX A;  2ZZP B;  2B3A A;  4M01 A;  4KDI C;  2R61 A;  2HJ1 A;  2D2Q A;  2Y5B B;  1XCQ L;  1TKG A;  5AUI A;  4FJY A;  1D5X C;  3Q8C A;  3BK1 A;  4G0N B;  4WJP A;  2WXI A;  3AEC B;  1EO6 A;  3ALB A;  4DDG D;  2ASQ A;  3PTF C;  4LNF A;  3ZRF A;  4BAX A;  2INC C;  4JLC A;  1JRO A;  4JQW C;  3EEC A;  2SEB D;  2J53 A;  2K3U A;  1WGK A;  2V9H A;  4MGZ E;  5I4D A;  1XLN A;  3N1X C;  1WRI A;  2JZ3 B;  2L32 A;  3AEF B;  4ACF A;  2OJW A;  4KZC A;  1I4R A;  2J7Q B;  3RZW C;  3L13 A;  2KAC A;  2BYT A;  4BKT A;  1GB4 A;  3NVY A;  2KN5 A;  1SE3 A;  2JF5 A;  3ZJU A;  2IGD A;  2G3Q B;  3I5J C;  3ZGZ A;  2C9W B;  5H8Y E;  3N1Z C;  4ANX A;  3L0W B;  1L2N A;  1RRB A;  1HZ5 A;  2MA9 B;  4XGA B;  1TIF A;  3L54 A;  2G4D B;  3RFZ B;  3B2F A;  3PZ8 A;  3TEW A;  4RFB A;  3ZDM C;  3W5U B;  1K8R B;  4AJY B;  4OVZ A;  4WUR A;  3AE8 B;  3KWL A;  3BZD B;  4FUL A;  2LVP A;  3BVG A;  3ENE A;  1OQR A;  2HTM E;  1ROE A;  4C7Z A;  2KT7 A;  4JPS A;  3QC8 B;  4PYU A;  4LJO B;  1E5W A;  4FAD A;  2G1E A;  1TY0 A;  2KAJ A;  2I1K A;  5T8I A;  1EWY C;  3RPF C;  1L0Y B;  2LHE A;  2N4F A;  3EFC A;  3ZXV A;  4OVV A;  2WXK A;  1P98 A;  2Z59 B;  4KSK C;  1NEN B;  1R4M I;  5KHO A;  2DHZ A;  2WU5 B;  3OAW A;  4FHJ A;  2G4S A;  1KTK A;  3C19 A;  5CHF A;  2N0S B;  1KM7 A;  2DYB A;  1WWT A;  4KV2 A;  3VFK A;  3DPD A;  2L1A A;  2BBC A;  1VLB A;  4MGY E;  4HPL B;  1A5R A;  3V60 A;  4LK0 M;  3U4E G;  4GMV A;  1J7C A;  2FCQ A;  2CS4 A;  4RH6 A;  4YSX B;  4XX5 A;  4JL9 A;  2LHD A;  4B0M A;  1E6E B;  3ABV B;  5HFY A;  2MJD A;  2WNM A;  2KFK B;  5LXI B;  4HKQ A;  2HJ8 A;  3ZW3 A;  1ZPS A;  3PSE B;  3NUH B;  2ZVN A;  2EMS A;  1A70 A;  4FXC A;  1D5M C;  1E10 A;  1QOB A;  2GBK A;  4AQ7 A;  3TJP A;  3A1Q B;  2L05 A;  4GSW A;  1KLG D;  2D5G A;  3AE5 B;  2WYQ A;  3ZNH B;  4JIO U;  1WXV A;  2JVC A;  2IO1 B;  2X8X X;  1RYJ A;  2CHZ A;  4S0R A;  3I57 A;  4O1N A;  1XXG A;  1LQB A;  2KFK A;  2RR9 A;  5JZE B;  3PZ7 A;  3H7S A;  4HK2 A;  4NJ7 A;  3DBH I;  3UIN B;  1ZOY B;  2K22 A;  3U2S C;  1NYQ A;  2WX1 A;  1WZ3 A;  3Q69 A;  4GN1 A;  4P16 A;  1WR1 A;  2DX5 B;  1WJN A;  1SE2 A;  3AI5 A;  2DWQ A;  4XC2 A;  4B6W A;  2G9H D;  2JX5 A;  4HVB A;  3A1Q A;  1XF5 L;  4JX1 C;  4RF0 A;  1Y8R C;  1KLU D;  4M02 A;  1WJU A;  4IM3 A;  5DCN A;  5EE9 A;  1ZKH A;  4RNA A;  2W9N A;  1DOI A;  2ZW1 A;  3GE8 C;  1HZ6 A;  2CR5 A;  4EFO A;  3EUB 2;  1SGH A;  1CMX B;  3APF A;  4Q2J A;  3NHE B;  2N9E B;  4ZDV A;  1ENF A;  5C3J B;  3PRM B;  3RNG C;  3PLU A;  3ML8 A;  5TSS A;  2C7M B;  4RM8 A;  1L6U A;  5D3D A;  5JHA A;  2L83 A;  2BS2 B;  3B9J A;  4URK A;  5D94 A;  3QJZ A;  3W1S C;  3BY4 B;  2QEJ C;  2INP E;  3A33 B;  2GBM A;  1TJE A;  4EE2 A;  1I4G A;  2H88 B;  2E3T A;  2ZNV B;  1SE9 A;  2LZ6 A;  1C4A A;  2WXF A;  4W9K A;  1Q10 A;  5IO9 A;  2WXO A;  1ZW7 A;  2BT6 A;  3WA0 A;  4EZL A;  1VD2 A;  1EUV B;  3LJ3 A;  4LDT B;  2MBB B;  2KMA A;  3IBE A;  3A4R A;  4JGH B;  1EU3 A;  3Q3M C;  4AP4 C;  1TS4 A;  4HRS A;  4ICU A;  2EKE C;  1GPX A;  1H8C A;  3SD5 A;  3QK0 A;  3PHW B;  3TSS A;  2SAK A;  3AUL A;  4HWI B;  5BMG A;  2YEP F;  2QDF A;  2BPS A;  2JSV X;  1E0Z A;  3VHT C;  1UUP A;  3PS6 A;  2V3S A;  1UZX B;  4DXG A;  1E90 A;  3FC4 A;  2AYO B;  2EKI A;  2KFJ A;  4ZRP A;  3VDZ A;  1KH0 A;  2O6V B;  1CZP A;  2PW9 A;  5H92 C;  5C23 A;  3TMP B;  4KKJ A;  4MGI E;  4K7S A;  2OOB B;  4BVU C;  2J0M A;  3T9L A;  1E8Z A;  1WM3 A;  2KKC A;  2KX3 A;  3Q8E A;  1FM0 D;  4PS7 A;  3ZNG C;  3SEB A;  3EC8 A;  2MBH A;  2K1F A;  2N9K A;  1TS3 A;  3L08 A;  2LJ5 A;  1I4P A;  4M0W A;  2O6V A;  1FEH A;  4P1C C;  1ZXI A;  3HM6 X;  4BKS A;  3M62 B;  1ZE3 D;  3NS8 A;  3Q14 C;  2V3N A;  1P1A A;  1TS5 A;  1JRP A;  3LDZ E;  1TYG B;  2A5U A;  4LNO A;  3NOB A;  2L0T A;  1S1Q B;  2FUH B;  4YXD B;  2GI9 A;  2LGY A;  4BZA A;  4IUM B;  3ZRC A;  1WGH A;  1ET9 A;  2JXT A;  2C7N B;  2BQQ A;  5DPS A;  2NCN A;  4US8 A;  2FIF A;  3APC A;  3QX1 A;  3CSF A;  3BIN A;  4II3 B;  1I7H A;  1MVK A;  3QQ8 B;  1MG8 A;  5GXG B;  1ACC A;  3VAW A;  1ESF A;  3DBR I;  3MC8 A;  2JYE A;  1N6Z A;  4YWG G;  2KDF B;  4NAM A;  3QAQ A;  2WDV B;  2K25 A;  4W9F A;  2KDE B;  3U8Z A;  3ONS A;  2MX2 A;  2JRI B;  2KD0 A;  4ZHP A;  4E3C A;  2INN E;  1FPY A;  1DOY A;  2RSU A;  2VZK B;  4LLG M;  3RUL A;  4G11 A;  2Z0D B;  4HPP A;  4K7W A;  2KQ7 A;  1HTO A;  3O65 B;  4C00 A;  4A20 A;  1BT0 A;  3VXW A;  2BW2 A;  3GZN I;  2AQ1 B;  1WGG A;  4FJV B;  3DBS A;  2FCS A;  4PS8 A;  1R4N I;  4IKG A;  4PYZ A;  4A3O A;  2GLS A;  3Q8A A;  3HK0 A;  2L0F A;  1YJI A;  1VR9 A;  3AXC A;  1BML C;  2UYZ B;  4PK1 A;  2OHF A;  2MWS B;  1WSP A;  1WY8 A;  5GMV A;  3KQ4 A;  1OQQ A;  2AQ3 B;  3VTW A;  1PQS A;  4M8M A;  3P4P B;  1QIL A;  3AEG B;  3KUZ A;  2MBQ A;  1GC6 A;  1PGB A;  1SIJ A;  4ZRJ A;  4B9K A;  1JW9 D;  5LLI A;  4S17 A;  1C3T A;  4KIK B;  1PGA A;  3PZD A;  3AV8 A;  4IC7 B;  3NY5 A;  2IY1 B;  2WDQ B;  3RCZ A;  2ZEQ A;  4REZ A;  2LXA A;  2W54 A;  3ZNI D;  4N58 A;  2RPQ A;  1AW7 A;  3DVN U;  1UEL A;  3PHX B;  5HHD G;  4W9D A;  5FKA C;  2MRP A;  1U4A A;  2LMC A;  4WQM A;  2HTH A;  4YTM B;  5EDS A;  2D10 A;  3VH4 B;  1WF9 A;  2KNB A;  3ZJT A;  3B08 A;  3V61 A;  3L10 B;  4NAW A;  4DXA B;  1YX5 B;  2LGI A;  4ZYS A;  5G2N A;  1WH3 A;  4G50 A;  3PPA A;  1XQQ A;  1Z5S B;  5D3I B;  3WCQ A;  2ZW0 A;  3Q8F A;  2D3B A;  5IAA C;  3P4S B;  4X57 B;  1ZXH A;  2QIE B;  2KDI A;  1IGC A;  1V2Y A;  3AEB B;  4RGT A;  5HI1 A;  1GNU A;  1F9J A;  1IP9 A;  3WAM A;  4MGK E;  1TGZ B;  2OED A;  2LJI A;  1FNU A;  3CF6 E;  1IGD A;  1YMH E;  2MEK A;  1N5W A;  2L76 A;  2NR2 A;  2GBJ A;  2J0J A;  1AN8 A;  4TMA B;  1J7B A;  3RNA C;  4LTU A;  1JQ4 A;  2KJH B;  5E6N A;  3TL5 A;  2BKR B;  3O13 A;  4N9F 4;  4P6V F;  4XWW A;  3SDL C;  4A8X C;  3BII D;  5CTR C;  3M95 A;  2MQJ A;  4C4V B;  4NPN A;  3GB1 A;  1T0S C;  3WAN A;  1QOG A;  2DBY A;  5BMI A;  1WXQ A;  3H8H A;  3OJ4 B;  4ARI A;  1PDX A;  3L17 A;  1EU4 A;  3DHH C;  3ZVV A;  2K5P A;  3R7R A;  2ZPN A;  3OJ3 A;  2V4L A;  2O6V D;  4WJQ A;  2KTR B;  3BYY B;  4LNI A;  2PMV A;  3Q2A C;  1N63 A;  4HDO A;  1SF0 A;  4BKS D;  1DOX A;  2KLG A;  2K6Q A;  4DBG A;  4TKN A;  1P7E A;  4C4V A;  3KUD B;  3KYD D;  2RDB C;  4TV3 A;  1E8W A;  1SE4 A;  2C7H A;  3PRE A;  3X0W A;  2KWU B;  3BVZ A;  5G5H A;  3DHI C;  1S3S G;  2RDH A;  1JML A;  5TR5 A;  3KH0 A;  2KTR A;  4W9H A;  3VUX A;  4DXF A;  3RI7 C;  1C4C A;  1RLF A;  4DHZ B;  2JU6 X;  1QQR A;  4A90 A;  3DCG A;  1XLQ A;  1RWS A;  4A55 A;  4C56 C;  3U7Z A;  3V3X A;  1P0R A;  3RNE C;  3PO0 A;  3MTN B;  4NZL B;  2UWQ A;  3R8B A;  1WM2 A;  4KKI A;  2KQS A;  5AZG A;  1HE8 A;  2NMQ A;  2PKO A;  3ZUN A;  1C1Y B;  1YD8 U;  1J0G A;  2WXR A;  1Z2M A;  4WJN A;  3ML9 A;  2XNA C;  1YN3 A;  1DYQ A;  5EE1 A;  1I42 A;  3NZU A;  3P4R B;  4HPM B;  3VTU A;  1EM7 A;  1YQ3 B;  5L83 A;  1JRU A;  4HEA 1;  2O2V B;  4GIV A;  4FA6 A;  3QWZ B;  1GG3 A;  4KGS A;  4KSL C;  1VZ8 A;  2LFI A;  3DHG C;  3BVM A;  2MP2 A;  3RT3 B;  3U30 A;  2QHO A;  4J6I A;  2JPH A;  5EE0 A;  3TEZ A;  4CYE A;  3GP7 A;  2MJE A;  1YJ1 A;  4IDI A;  4W9E A;  2AWT A;  2IO2 B;  1EF1 A;  2MW5 A;  4IWP A;  3AE7 B;  2VZK D;  2O2V A;  3QHT A;  2UU7 A;  3B1L X;  2FUG 1;  4KGR A;  2NTT A;  4MH8 A;  1V1P B;  1VRA B;  4F8C B;  3SR6 A;  3KYC D;  4XDC A;  3VVW B;  1YNT E;  3L4P A;  5IKC M;  2X38 A;  1WZ0 A;  3IT6 B;  4PS3 A;  4MJS B;  5C1Z A;  5FK9 C;  1FXA A;  2I38 A;  3VRB B;  4KVG B;  3LXF A;  4GXB A;  2IND C;  3Q3J A;  1F52 A;  2M4N A;  2FCM A;  3AMZ A;  2GBR A;  3AM9 A;  4GDL B;  3NVV A;  1V1P A;  2BKF A;  1PYW D;  2FCN A;  3U52 E;  4JE3 B;  3MP9 A;  2DZM A;  3NS1 A;  2ZCC A;  1F77 A;  2LGD A;  2ZNV C;  4MJS A;  1R4M B;  1FIQ A;  3E9S A;  4FN2 A;  1K50 A;  2JYT A;  3ZTC A;  2GMI C;  3BK2 A;  2J4X A;  3RNB C;  3AE1 B;  3NZ3 A;  1LM8 B;  2YLM A;  2CU1 A;  4GDL A;  3R7Q A;  4NQK E;  4E71 A;  2L52 A;  2LRW A;  3V6E B;  2GRI A;  2HDE A;  4RF1 A;  2C5L C;  2QCZ A;  4AOF A;  4EOY A;  3FKY A;  4W9J A;  4BBN C;  2NBU A;  4DK5 A;  3JVZ X;  4CO7 A;  3ZXR A;  4P1B C;  1V86 A;  2CJO A;  5J18 A;  2Z0E B;  5CHW A;  3ZTD A;  1UWX A;  4MEL A;  2LI5 A;  2WXG A;  4HJG E;  3KUC B;  1C4P A;  4WQO B;  3AE2 B;  4H2A A;  1JWA D;  3P63 A;  4ZRI A;  2I2Y A;  2BS4 B;  2AL3 A;  2I1J A;  2WU2 B;  1QLB B;  2YEP B;  3HVZ A;  1F0Z A;  3Q6B A;  1TT5 B;  4MSM B;  4GOC A;  2IDY A;  4IG7 B;  2K8H A;  3DVG X;  1T3Q A;  1UGM A;  4NQL B;  3H7P B;  1QOA A;  2NBW B;  2G45 B;  1ZGU B;  5D2M B;  4M0W B;  4BBN F;  1MHH E;  2LEK A;  2LVQ A;  5DPT A;  3DBH B;  2ZVO A;  3HHM A;  4HJK A;  3A9J B;  3PT2 B;  3IHP C;  3W1S A;  2CKH B;  3P1M A;  2RPV A;  1NDD A;  4EEW A;  5AUK A;  3R2T A;  1WI0 A;  5LNK 1;  3V6C B;  3PVL A;  2LGX A;  3DDC B;  3H7P A;  3WIM A;  1VCB A;  4HXD A;  2GOW A;  4J3O D;  3T3O A;  4UDU C;  4A6Q A;  4WWM A;  3IG3 A;  4K1R B;  1V8C A;  3EHV A;  3A9J A;  2E6X A;  1WE7 A;  5HG2 A;  1FNW A;  3NVZ A;  1GAQ B;  4II2 B;  4DQO C;  1V6E A;  1YOV B;  1YX6 B;  1TS2 A;  3ECI A;  4YSZ B;  3RD2 A;  3PGE A;  2MCN B;  1D6E C;  2LAS A;  2WP9 B;  1V49 A;  2BYV E;  1XCT L;  2H89 B;  1VZ7 A;  2MBO A;  3A4S C;  2Y5P A;  3N3K B;  2NBV B;  3ZNZ B;  3J9C A;  2Y3A A;  2XN9 C;  3AU4 A;  1Y56 A;  2K39 A;  3TEY A;  2N9X A;  2LUM A;  4WIP A;  1NI2 A;  4DDI D;  1TKY A;  2BVC A;  3R3M A;  3MJW A;  1KOT A;  4MAC A;  4GDK B;  4OVU A;  1L6V A;  4IWO A;  2PTL A;  4W9G A;  2B76 B;  2NVU I;  2WXP A;  4JWU C;  3DOW A;  2BF8 B;  1NVI D;  1E9M A;  2WXN A;  3KW5 B;  3UIO B;  5IOI A;  1E8Y A;  2ICI A;  3DBL I;  3V62 A;  4B95 A;  3URY A;  1LGR A;  3IVF A;  3D32 A;  4R3D A;  2R2Q A;  4GDK A;  3SFE B;  3E56 A;  1MPE A;  4RGN A;  2EMT A;  4TUU A;  4F1S A;  4ZYN A;  1H4R A;  3N1Y C;  3RNC C;  3NZS A;  4WAA A;  4OW0 A;  2V1Y A;  1SJH D;  5MPO A;  2QC8 A;  1J19 A;  1OQY A;  4HDQ A;  1WJ4 A;  5FR3 A;  2L7R A;  1GB1 A;  1V80 A;  2N7E A;  4US9 A;  1TTN A;  1K51 A;  2AL6 A;  4EZJ A;  2BWF A;  4DHJ B;  4HRO A;  1P7F A;  3L16 A;  5JH5 C;  4EUT A;  5L95 C;  1SXT A;  1SIF A;  1SEB D;  2WQY B;  3A9K B;  3TUO A;  1FFV A;  4WWN A;  2LD9 A;  1WGR A;  1L4Z B;  2QMT A;  4RGO S;  3AE9 B;  1FMA D;  2JZP A;  2KDM A;  3ZKJ C;  3ZDT A;  1FNV A;  1SBB B;  2KXJ A;  1GC7 A;  1Q5W B;  3SFD B;  3W2D A;  2JT4 B;  1T0R C;  1WX8 A;  4YT0 B;  2JY6 A;  2W3S A;  4C80 A;  2K0P A;  4NAW B;  2KJR A;  1FRR A;  3A9K A;  4LCD E;  2D07 B;  3TBL D;  1C78 A;  3W1Y A;  3VUW A;  2FNJ B;  3QCA A;  2KWD A;  4YTN B;  3N32 A;  2KN4 A;  2DZJ A;  4ZRK A;  2REX A;  4M8N A;  1BUI C;  3DBR B;  2OJR A;  2NPT B;  2KTF A;  2A4Z A;  2Y5C A;  1J7A A;  2VH2 A;  1QOF A;  3ZIM A;  4NNJ B;  2WXM A;  4MM3 B;  3K9O B;  1N60 A;  1G6J A;  2KO3 A;  2KVZ A;  1IUE A;  3N30 A;  3Q3N C;  4NJ6 A;  1B1Z A;  3V05 A;  3VUY A;  3TCA A;  2NPT A;  2ACZ B;  4B0E A;  4CQN A;  1UH6 A;  3RNF C;  5AZF A;  4HLE A;  4GB9 A;  4MM3 A;  1Q1O A;  3Q3F A;  3NG0 A;  1R4N B;  2V3P A;  1RAX A;  2ONQ A;  3M63 B;  4IM0 A;  4LDT D;  4W9C A;  4OZC A;  3K9P B;  4E74 A;  1YIW A;  4HCN B;  2KQ4 X;  3ZQ4 A;  1MHX A;  1V5O A;  5CHV C;  1F1H A;  4TQ0 A;  3PLV A;  2LVO A;  2BYE A;  5BYS A;  3KLS X;  1FXI A;  1FCL A;  2GB1 A;  4HKZ E;  1YQB A;  5BYQ A;  2N9L A;  4QAY A;  5IA7 A;  2WXJ A;  4YSY B;  1C76 A;  2M8S A;  4KDL B;  5G5G A;  4IWQ A;  3ZO5 B;  5J2R A;  1JCK B;  2WS3 B;  1WJ6 A;  1WFY A;  3UIP B;  1L0X B;  2IYD B;  1P3Q U;  2FID A;  3AEA B;  2RGF A;  3P42 A;  4DWF A;  1WX9 A;  1UF0 A;  2BTE A;  4FJZ A;  4IOI E;  4WJO A;  1XT9 B;  2KZR A;  1BXT A;  2AQ2 B;  3DVN V;  2W55 A;  4L1B A;  1AWD A;  2N1W A;  1RFA A;  3TEX A;  2WLB A;  3RMK C;  4C7Y A;  1RM6 C;  3AB5 A;  3HM3 A;  2Z8L A;  4NJC A;  1STE A;  1PFD A;  4D2K A;  1K52 A;  1P9D U;  3S2A A;  2PE9 A;  1Q0W B;  2K8B A;  1I4X A;  1YN5 A;  1EWC A;  2W3R A;  3AN1 A;  1YQ4 B;  3GS2 A;  1FFU A;  4TSS A;  3M3J A;  2TSS A;  4K81 A;  2WXQ A;  4GU2 A;  2LRU A;  1NEK B;  2JWZ A;  2Q5W D;  2J52 A;  4AS1 A;  4PT5 A;  4M00 A;  2DZK A;  2KC2 A;  4GGQ A;  2M56 B;  4ARC A;  3BYT B;  4TQ1 A;  2XEW A;  4YL8 A;  1MJD A;  1L7Y A;  2ZPY A;  1WYG A;  4CHK A;  4IM2 A;  1ET6 A;  3MC0 B;  2KYW A;  1CQV A;  1WMH B;  2MP2 B;  3CIR B;  2LXC A;  1I4H A;  1R7S A;  4MSQ B;  3CWI A;  4XE0 A;  3FAH A;  1WGD A;  1SJE D;  2LUE A;  2BB6 A;  2WHI A;  4A9A A;  3U7D A;  2MBE A;  1CJE A;  2ZJD A;  1HTQ A;  2DYM A;  1V1O A;  2V4I B;  3B2G A;  4BKG A;  1V97 A;  1IYF A;  3W9C B;  1UNS A;  1WXS A;  2KDB A;  1NYR A;  2R2O A;  2DAF A;  2EEL A;  1FD6 A;  4N6E B;  3EFU A;  1VJK A;  1WMH A;  2VH1 A;  4I6N B;  4WWP A;  4ZRQ A;  1XLP A;  1L0V B;  4KGT A;  2BB5 A;  2L3Z A;  2FAZ A;  4WWO A;  4EKU A;  3NJT A;  5E6O A;  2M0X A;  1GOZ A;  2ON8 A;  1MG4 A;  1ZUD 2;  3I9V 1;  3ZYY X;  4BFR A;  4FLH A;  4MEM A;  3UQB A;  4ANW A;  5G55 A;  3RYT A;  2HD5 B;  2KHW B;  3BWU D;  1E7V A;  1NBF C;  3B0A A;  3R66 C;  3UI3 A;  2VRR B;  3ZLZ A;  2IGG A;  4P7I A;  1YJJ A;  1XO3 A;  3PRP B;  2PLP A;  2QIL A;  2V0G A;  3HRD D;  3AEE B;  1JAL A;  4AJW A; 
#chains in the Genus database with same CATH homology
 1HA5 A;  4J3O D;  3T3O A;  4UDU C;  3P4Q B;  4A6Q A;  3AEG B;  4WWM A;  1E7P B;  1HZ5 A;  1V8C A;  1PGB A;  1SIJ A;  2E6X A;  5HG2 A;  1FNW A;  3NVZ A;  3Q8B A;  1GAQ B;  3FIL B;  3LYY A;  3RFZ B;  3B2F A;  3PZ8 A;  3TEW A;  1JW9 D;  4DQO C;  1KFY B;  4RFB A;  1TS2 A;  4YSZ B;  1PGA A;  1D4B A;  3W5U B;  2PVG C;  3AV8 A;  1C79 A;  1D6E C;  1I4Q A;  1HXY D;  4OVZ A;  2WP9 B;  2WDQ B;  4WUR A;  4REZ A;  2W54 A;  1XCT L;  3AE8 B;  3BZD B;  2H89 B;  3KWL A;  1VZ7 A;  4N58 A;  4L23 A;  4XDD A;  3BVG A;  2M19 A;  2Y5P A;  1AW7 A;  2RMM A;  1C9F A;  2WXH A;  1KF6 B;  4USA A;  1LO5 D;  1OQR A;  2HTM E;  1FRD A;  1ROE A;  4C7Z A;  3J9C A;  2CU3 A;  4JPS A;  2Y3A A;  5HHD G;  2AX5 A;  2XN9 C;  5FKA C;  3AED B;  3FIL A;  1C77 A;  1Y56 A;  2LMC A;  3TEY A;  4WQM A;  2LUM A;  4YTM B;  2G1E A;  1TY0 A;  2KAJ A;  5D7G A;  3AE4 B;  5T8I A;  3T3N A;  1EWY C;  3RPF C;  4WIP A;  1L0Y B;  2LHE A;  1TKY A;  1JWM D;  1TZO A;  2WXK A;  3ZJT A;  4MAC A;  4GDK B;  1NEN B;  3AH7 A;  1L6V A;  2PTL A;  2B76 B;  2WU5 B;  2WXP A;  4JWU C;  3IT4 B;  2LGI A;  1NVI D;  1E9M A;  2WXN A;  3NVW A;  1L5P A;  4ZYS A;  1KTK A;  2N0S B;  1ZP0 B;  1WWT A;  5D3I B;  2ICI A;  3WCQ A;  2ZW0 A;  3Q8F A;  3URY A;  2L1A A;  4RCO A;  3P4S B;  5BYR A;  1ZXH A;  2BBC A;  3IAS 1;  4R3D A;  1JWU D;  1VLB A;  2QIE B;  1IGC A;  2WXL A;  3AEB B;  4RGT A;  5HI1 A;  3SFE B;  3N9Y C;  3E56 A;  4LK0 M;  3U4E G;  1MPE A;  1J7C A;  4RGN A;  3DWG C;  1FCC C;  3VQI A;  2MH7 A;  1SB3 C;  2OED A;  2LJI A;  4RH6 A;  4YSX B;  1FNU A;  2FE8 A;  2LHD A;  4ITK A;  4B0M A;  4JWS C;  1E6E B;  3ABV B;  1IGD A;  1YMH E;  2MEK A;  2MJD A;  2WNM A;  1N5W A;  5HFY A;  4HKQ A;  3HVD A;  1FO4 A;  2DYO A;  4OW0 A;  1ZPS A;  1XEE A;  4WH4 A;  1CK1 A;  3NUH B;  1SJH D;  1AN8 A;  5MPO A;  4ZOH C;  1A70 A;  4TMA B;  4FXC A;  1J7B A;  1T6B X;  1UGJ A;  1D5M C;  4LTU A;  1JQ4 A;  1E10 A;  1QOB A;  3O13 A;  4P6V F;  4AQ7 A;  5FR3 A;  4XWW A;  1GB1 A;  4A8X C;  4US9 A;  3BII D;  1K51 A;  4OZA A;  4MT5 A;  1KLG D;  1JWS D;  2D5G A;  3AE5 B;  4HRO A;  1P7F A;  2PVO D;  3R2I A;  1RYJ A;  2JWU A;  2QSD A;  3GB1 A;  3I57 A;  3C8Y A;  1XXG A;  4O1N A;  1SXT A;  1SEB D;  3PZ7 A;  2WQY B;  4WAF A;  3TUO A;  1QOG A;  1FFV A;  2DBY A;  5BMI A;  1WXQ A;  2J42 A;  1L4Z B;  2QMT A;  1QKZ A;  4RGO S;  1ZOY B;  2K22 A;  3H8H A;  3U2S C;  4ARI A;  1PDX A;  1EU4 A;  1NYQ A;  3AE9 B;  2K5P A;  3Q69 A;  4P16 A;  1FMA D;  2JZP A;  2KDM A;  1SE2 A;  1RFK A;  2DWQ A;  2G9H D;  2JX5 A;  1FNV A;  1SBB B;  3BYY B;  1XF5 L;  2PMV A;  3IAM 1;  1N63 A;  4JX1 C;  1SF0 A;  4RF0 A;  1DOX A;  1JWB D;  1KLU D;  3SFD B;  3W2D A;  1P7E A;  2IGH A;  5EE9 A;  4YT0 B;  4RNA A;  1DOI A;  2W3S A;  4C80 A;  2K0P A;  4NAW B;  5C2T B;  1FRR A;  2QJL A;  2ZW1 A;  1SE4 A;  3MHZ A;  1C78 A;  1SSN A;  1HZ6 A;  4YTP B;  3BVZ A;  1UWM A;  3EUB 2;  2KWD A;  5G5H A;  4YTN B;  4N59 A;  2MJ3 A;  2W82 A;  4Q2J A;  5E6J A;  2RDH A;  1JML A;  1ENF A;  3VR9 B;  2KN4 A;  4DXF A;  5C3J B;  1C4C A;  2JU6 X;  1QQR A;  3HUI A;  4A90 A;  4KX6 B;  5TSS A;  1BUI C;  1XLQ A;  1L6U A;  1RWS A;  5D3D A;  4XWT A;  2L83 A;  4A55 A;  4C56 C;  2BS2 B;  3B9J A;  1ZDV A;  3U7Z A;  2QEJ C;  2Y5C A;  1J7A A;  2INP E;  1QOF A;  3V3X A;  1TJE A;  3NRZ A;  4EE2 A;  3PO0 A;  1I4G A;  2WXM A;  4MM3 B;  4GLS C;  4NZL B;  5JXV A;  3R8B A;  3LB8 C;  1N60 A;  2H88 B;  4KKI A;  2E3T A;  1IUE A;  1AYF A;  2WDR B;  1C4A A;  2WXF A;  2NMQ A;  1Q10 A;  1OFF A;  2PKO A;  2WXO A;  1B1Z A;  3OWE B;  3ZJV A;  3V05 A;  2BT6 A;  2WXR A;  2XNA C;  2BS3 B;  4ZHO A;  2ACZ B;  4B0E A;  4CQN A;  1YN3 A;  1DYQ A;  1HEZ E;  5EE1 A;  2KMM A;  3P4R B;  1EU3 A;  1EM7 A;  1MI0 A;  2PIA A;  1YQ3 B;  1ZDX A;  1TS4 A;  4HRS A;  4HEA 1;  1GPX A;  1T5X D;  2V3P A;  1F2R I;  2ONQ A;  4KGS A;  1VZ8 A;  4OZC A;  2LFI A;  3TSS A;  2SAK A;  3BVM A;  5BMG A;  2YEP F;  3MFG A;  2JSV X;  1QT9 A;  2KQ4 X;  3ZQ4 A;  1MHX A;  1E0Z A;  1UUP A;  4TQ0 A;  2RDG A;  5EE0 A;  1D5Z C;  3TEZ A;  1PGX A;  3EGR A;  5BYS A;  4DXG A;  2CJN A;  3KLS X;  3GP7 A;  1FXI A;  1FCL A;  2GB1 A;  2MJE A;  3FC4 A;  4HKZ E;  5BYQ A;  2EKI A;  4IDI A;  2M0A A;  4ZRP A;  2N9L A;  1KH0 A;  2WXJ A;  4YSY B;  1C76 A;  1DGJ A;  1CZP A;  2PW9 A;  3AE7 B;  1PUT A;  5G5G A;  3AE3 B;  2VZK D;  5H92 C;  4KKJ A;  3ETR A;  1JCK B;  1N5X A;  2WS3 B;  1VZ6 A;  1L4D B;  2FUG 1;  4KGR A;  1XLO A;  3IXS A;  2NTT A;  4MH8 A;  3Q8E A;  1V1P B;  1VRA B;  4L2Y A;  3SR6 A;  4XDC A;  1FM0 D;  1HQR D;  1L0X B;  5EE3 A;  1YN4 A;  3AEA B;  3DWM A;  1NI3 A;  3SEB A;  3P42 A;  1N61 A;  1VDV A;  1YNT E;  3L4P A;  2BTE A;  2X38 A;  2N9K A;  4IOI E;  1TS3 A;  3IT6 B;  5FK9 C;  4OZB A;  1I4P A;  4M0W A;  1FXA A;  1FEH A;  2I38 A;  1ZXI A;  3AE6 B;  3VRB B;  1BXT A;  2AQ2 B;  2W55 A;  4L1B A;  1AWD A;  3TEX A;  3LXF A;  2WLB A;  4C7Y A;  2IPK D;  1ZE3 D;  1QF6 A;  1RM6 C;  2V3N A;  3AB5 A;  3AMZ A;  3AM9 A;  1TS5 A;  4GDL B;  1V1P A;  3NVV A;  1JRP A;  1TYG B;  1PYW D;  2Z8L A;  4NJC A;  2JQR B;  3U52 E;  1STE A;  1PFD A;  4D2K A;  1K52 A;  4JE3 B;  3MP9 A;  3NS1 A;  4YXD B;  1TKE A;  3MJ5 A;  2GI9 A;  1I4X A;  1F77 A;  1EWC A;  1YN5 A;  2W3R A;  3AN1 A;  1YQ4 B;  4OHJ A;  1F2R C;  3GS2 A;  1FFU A;  1FIQ A;  3E9S A;  4TSS A;  2TSS A;  1ET9 A;  2JXT A;  2WXQ A;  1K50 A;  2JYT A;  5BMH A;  3VRA B;  3BK2 A;  1NEK B;  2J4X A;  4US8 A;  2Q5W D;  4AS1 A;  2J52 A;  3AE1 B;  4PT5 A;  3NZ3 A;  2IJ0 A;  2M56 B;  2NTS A;  1K53 A;  4ARC A;  2K9X A;  3BYT B;  4TQ1 A;  1I7H A;  1IBX B;  2L52 A;  1MVK A;  2GRI A;  2HDE A;  1TY2 A;  1WYG A;  3KWV A;  5GXG B;  1ET6 A;  4RF1 A;  1KRH A;  4RGM A;  3MC0 B;  1ACC A;  3W5V B;  1CQV A;  1ESF A;  3CIR B;  1I4H A;  2FBW B;  2JYE A;  1R7S A;  3CWI A;  4XE0 A;  3FAH A;  4YWG G;  1N62 A;  2CJO A;  4NAM A;  1SJE D;  2WDV B;  2BB6 A;  2DLB A;  3EA6 A;  2N7J A;  1B9R A;  1M4V A;  4A9A A;  1CJE A;  2DYM A;  1V1O A;  1UWX A;  3VR8 B;  2V4I B;  2WXG A;  4HJG E;  1IBX A;  3B2G A;  1V97 A;  1C4P A;  2R61 A;  4ZHP A;  3W9C B;  1UNS A;  1XCQ L;  3AE2 B;  4H2A A;  1JWA D;  1TKG A;  1NYR A;  2INN E;  5AUI A;  2EEL A;  1FD6 A;  1D5X C;  3P63 A;  3Q8C A;  4N6E B;  2I2Y A;  4LLG M;  2VZK B;  2BS4 B;  3BK1 A;  1DOY A;  1VJK A;  2WU2 B;  1QLB B;  4ZRQ A;  2WXI A;  2YEP B;  3HVZ A;  3AEC B;  1F0Z A;  1XLP A;  1L0V B;  4KGT A;  2BB5 A;  1JRO A;  2IDY A;  1GOZ A;  2SEB D;  2J53 A;  1T3Q A;  2BW2 A;  2K3U A;  2ON8 A;  1WGK A;  2AQ1 B;  1ZUD 2;  3I9V 1;  5I4D A;  3ZYY X;  1QOA A;  1XLN A;  1MHH E;  1WRI A;  2LEK A;  4IKG A;  2L32 A;  3AEF B;  3BWU D;  3Q8A A;  1I4R A;  1YJI A;  2KAC A;  1VR9 A;  2BYT A;  3W1S A;  3P1M A;  3UI3 A;  1GB4 A;  2RPV A;  3NVY A;  1SE3 A;  5AUK A;  1BML C;  3R2T A;  2IGD A;  3ZJU A;  2IGG A;  3ZGZ A;  1YJJ A;  1XO3 A;  2OHF A;  5H8Y E;  5LNK 1;  1WSP A;  3KQ4 A;  1OQQ A;  2AQ3 B;  2PLP A;  2QIL A;  2V0G A;  3P4P B;  1QIL A;  3HRD D;  3AEE B;  1JAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...