1FMAD

Molybdopterin synthase (moad/moae)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
MIKVLFFAQVRELVGTDATEVAADFPTVEALRQHMAAQSDRWALALEDGKLLAAVNQTLVSFDHPLTDGDEVAFFPPVTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOLYBDOPTERIN CONVERTING FACTOR, SUBUNIT 1
publication title Crystal structure of molybdopterin synthase and its evolutionary relationship to ubiquitin activation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 22
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2000-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fmaD00
5AUKA 3B9JA 5GXGB 2AX5A 1WXQA 3AE8B 3KWLA 3AE2B 2WDQB 3AEDB 1WWTA 1SIJA 3AEFB 2PVOD 3AE4B 1FFUA 2HTME 3HVZA 4FXCA 4WQMA 2DWQA 1V8CA 2B76B 2WU2B 1JALA 1B9RA 1RM6C 1JROA 3AEGB 1NENB 1NYQA 1QOFA 2KMMA 3RPFC 3CIRB 4US8A 1YJJA 1E7PB 3AV8A 3HUIA 1ZUD2 1JW9D 4ZOHC 3P63A 3VR8B 2K22A 5AUIA 3PO0A 3AE3B 3VRBB 3AE7B 2CJNA 4YXDB 2DBYA 5C3JB 1OQRA 1FIQA 1JWBD 3P1MA 3HRDD 1YQ4B 4YSZB 1FO4A 1GPXA 4YT0B 1N61A 2WS3B 4YTNB 1AWDA 1DGJA 2L83A 3P4SB 2JX5A 1EWYC 4N58A 1KRHA 3AEBB 5C2TB 3VRAB 1E0ZA 2FBWB 2BS3B 3P4RB 3W5VB 1XLPA 1CJEA 4N6EB 5G5HA 1XLNA 1KF6B 1JRPA 2WLBA 1J7AA 2MH7A 1QLBB 1XLQA 3AMZA 1IUEA 2L52A 1JWAD 1N60A 3DWMA 3SFDB 4HRSA 4C80A 4ZHPA 2WP9B 1AYFA 3BIID 3AN1A 2KAJA 1L6UA 4ZHOA 1GAQB 2ACZB 3FC4A 3P4PB 3W5UB 3AE1B 3AE9B 2M56B 2MJEA 1PDXA 2BT6A 4US9A 4YSXB 3B2FA 2OHFA 1QF6A 2Q5WD 1T3QA 2CJOA 3AE5B 1JQ4A 1KFYB 1QOAA 3LB8C 2K5PA 1ZP0B 2QJLA 3NRZA 3NVZA 4WWMA 4KX6B 1WGKA 1FXAA 1NYRA 5H92C 1L5PA 2QIEB 1VJKA 1TYGB 3P4QB 1CZPA 2WDRB 1ZXIA 2H88B 4YSYB 4ITKA 1A70A 5G5GA 2BS4B 1QT9A 4IDIA 1FRDA 4A9AA 3EUB2 1L0VB 1N5WA 2K9XA 2Y5CA 3NS1A 2PVGC 1QOGA 2WU5B 1TKGA 2BS2B 1FM0D 4YTPB 1FRRA 3L4PA 1QOBA 1SB3C 1FFVA 1XLOA 2W3SA 3CWIA 1NVID 3W9CB 2W55A 4JX1C 4HROA 2G1EA 1FXIA 3DWGC 4C7YA 5EE3A 1PFDA 5EE9A 2WDVB 3AB5A 3SR6A 4JWSC 1NI3A 1TJEA 2M19A 1I7HA 3ABVB 1RFKA 1L6VA 4LTUA 4P6VF 2W54A 4JWUC 1OQQA 2PIAA 1J7BA 2MJDA 5H8YE 1DOYA 3AECB 1TKYA 1YQ3B 1E9MA 3VR9B 3AEEB 4N59A 2W3RA 1RYJA 3AEAB 1N62A 3SFEB 2MJ3A 2N0SB 3NVVA 3AH7A 5MPOA 1F0ZA 2JQRB 1WYGA 1VDVA 1N63A 2WQYB 1VLBA 3ETRA 5EE1A 1N5XA 1DOXA 1SF0A 1ZOYB 2EKIA 3AE6B 1R7SA 2E3TA 1FMAD 1RWSA 1WRIA 4C7ZA 2H89B 1YJIA 4YTMB 1E10A 5EE0A 3ZYYX 1TKEA 1J7CA 1E6EB 3FAHA 2LEKA 1XO3A 1UWMA 1ROEA 2CU3A 1PUTA 1DOIA 1V97A 3NVWA 3LXFA 2PKOA 3WCQA 1NEKB 3AM9A 3B2GA 4USAA 3NVYA 1OFFA
chains in the Genus database with same CATH superfamily
1T6BX 4ICUA 3MHSD 4KVGB 1FNVA 1GB1A 1B9RA 1I4GA 4IOIE 4OZCA 4ARCA 4I6NB 1C79A 1KLUD 4GN1A 1FCCC 4I6LB 4CYEA 1SEBD 2CJNA 3Q8EA 4YT0B 1SJED 1XT9B 2LHEA 2FCQA 2FBWB 4G11A 2CR5A 2NCNA 1UZXB 2O2VA 1WJNA 1QLBB 2IBIB 2LUEA 1HE8A 1V9JA 1AARA 3SHQA 4EOYA 4GMVA 4HPMB 2N9LA 2FE8A 4KSLC 2LVOA 3ZRFA 2D3GA 2UYZB 4HKQA 1PGAA 2AQ2B 4PS7A 2WXPA 4LJOB 1FCLA 1P1AA 1TYGB 3Q6BA 1ZXIA 3DQVA 1WIAA 4IWOA 2WXJA 2G9HD 4HWIB 4A3PA 1WX7A 4KKIA 5IOIA 5CHWA 5D2MB 2PW9A 2FUHB 1NI3A 1TJEA 2M19A 1I7HA 5BMIA 1ZW7A 2MJDA 2AL6A 2ZW0A 2N7JA 3EECA 1EUVB 3BWUD 5TSSA 3RFZB 3SFEB 2D11A 3VDZA 1C4PA 2KD0A 1LGRA 3R8BA 2L00B 1FMAD 1U4AA 1YJIA 4HK2A 1XO3A 4D2KA 2KKCA 3Q3MC 3UIPB 3T8MA 1WMHA 3BK2A 2GLSA 2ZVNA 4AS1A 2ZPNA 2DAFA 4QAYA 2ON8A 1TZ1A 1K50A 2KACA 1C77A 1JROA 1YMHE 2IY0B 4XE0A 3CF6E 1OTRB 4JGHB 2HTHA 2IY1B 4US8A 4ZOHC 4YWGG 2N9XA 2IO1B 4IKGA 4MM3B 2GRIA 3RZFA 1N61A 1AWDA 2M0XA 3P4SB 3TSSA 1BMLC 2J0MA 3VUWA 2KXJA 4N6EB 3RNGC 5IAAC 2MP2A 2IO3B 2KQSA 4DHJB 1YN4A 2NS5A 2WNMA 1VRAB 5J17A 3B1LX 2N9EB 4G50A 3AN1A 1MG4A 3AU5A 3OLMD 5FR3A 2JXTA 3B0AA 3WA0A 1HZ5A 3IVFA 4MH0E 4M02A 2KDBA 2BQQA 2NBVB 3NZSA 1J19A 3PT2B 2BS4B 4HJKA 2K6DB 4XYCA 2D10A 1E8ZA 2N7DA 3NZUA 3C19A 4H2AA 1ENFA 1H4RA 1TT5B 1V86A 1PFDA 2ICIA 2BPSA 4WIPA 4P6VF 2DZJA 2LD9A 4NAMA 2R2OA 4BKGA 1NI2A 1Q10A 1N5XA 4GOCA 3PLUA 4C7ZA 2M1MA 3A33B 5EE0A 1MJDA 1R4NB 2WX0A 2LEKA 3QK0A 1Z2MA 1JWUD 4XWTA 4UDUC 2BW2A 3AM9A 4IM3A 4HVBA 3AULA 3AEDB 1UUPA 4F1SA 1SE2A 3UF8A 2IO2B 2C7NB 3EFUA 3AV8A 2INCC 1UWXA 4NJCA 5IN7A 1F2RI 3M62B 3VAWA 2WDTB 2IGGA 1CJEA 4WJOA 3GE8C 2KZRA 3RNEC 4RMAA 1D5XC 1HXYD 2DLBA 3H7PB 1FXAA 2GB1A 4MM3A 3T9LA 3DBHB 3DBSA 1KTKA 3RZWC 3PLVA 4GDKB 5D94A 2LUMA 4W9GA 3QQ8B 2N9PC 1EF5A 1UBQA 1SB3C 3CWIA 3W9CB 4TSSA 4HROA 3B08A 3MTNB 4TUUA 2K3UA 2LJ5A 3SR6A 3PRMB 2FIFA 1MHHE 2KDEB 3PZDA 5H8YE 5C23A 3LYYA 2BYVE 1KH0A 4N59A 1N62A 1UGMA 4MGIE 2L7RA 2EKEC 2BKRB 1IYFA 3W1YA 3IXSA 2H89B 4W9FA 3TBLD 3PVLA 2K8CA 2KDFB 1F52A 2E6XA 4GDLB 4PT5A 5BO4B 2M4NA 3VTVA 2IZVB 4L23A 4WQMA 2N4FA 2NBWB 1RM6C 4E3CA 4X57B 1WE7A 3AE3B 1XD3B 3AE7B 1F9JA 1GUAB 3P1MA 1GPXA 3ZNID 1MPEA 4ZRQA 2L83A 2PE9A 2N1WA 3VRAB 1E0ZA 1P9DU 1LQBA 2BS3B 2KMCA 4KGSA 5G5HA 3SU8X 1WGGA 1J7AA 4MEMA 1WH3A 2INNE 2MA9B 3Q3FA 4ZHPA 3UGBB 1L6UA 4K7WA 2EMSA 4ZHOA 4MACA 2BT6A 3T3OA 4DHZE 1D5MC 1YIWA 4DDGD 1WJ6A 3DDCB 3V3XA 1WGKA 5H92C 3PZ8A 1KJTA 1CMXB 4ITKA 5JXVA 3TL5A 4RGMA 4HDQA 3M95A 2LGYA 3ZKJC 1L4DB 4DQOC 1C9FA 3JSVB 2KQ7A 2KTRB 4HCNB 4MGKE 1OQQA 1J7BA 3KVFB 3NG0A 3PSEB 1J8CA 2ONQA 3VHTC 4CQNA 3AEAB 4AP4C 1V49A 2V3PA 3H7PA 3ZDMC 4TQ0A 1WR6E 2DX5B 2CU1A 4GIVA 4GDKA 3ZYYX 2KNBA 2LVPA 3OG5A 2QSDA 1PGXA 5JHBA 4II3B 2ZNVC 3LXFA 3U52E 1WGDA 3MFGA 3TEZA 1S1QB 3AE8B 3KWLA 2AYOB 1V8CA 4DXFA 2G4SA 5HI1A 3N1XC 3BY4B 3W1SA 3RPFC 4DXGA 5IA7A 1ZE3D 1WM3A 3DBRB 1KOTA 3RNFC 1JCKB 3VVWB 1UELA 4B95A 5GMVA 4DDID 3KUZA 3QC8B 2WS3B 1DGJA 1KRHA 2MBQA 1CK1A 5HG2A 4EUTA 2BF8B 3GB1A 3BIID 4W9DA 2L32A 4S17A 1HQRD 3W5UB 1YN5A 4WH4A 1JQ4A 3IG3A 2CJOA 2N7EA 1T0QC 2QJLA 3ZJUA 3ZNZB 4K7SA 3BYTB 1CQVA 1A70A 4K3CA 3I9V1 2L3ZA 2IGHA 2WU5B 2BS2B 3H9DA 1NDDA 1KM7A 3ECIA 3UIOB 2JSVX 5EE9A 1MG8A 1PYWD 1JMLA 2W54A 4JWUC 3U7ZA 4BFRA 1P98A 2WXHA 2PJHA 4Q2JA 1RFAA 1VLBA 1X1MA 2CKHB 1WRIA 4F7ZA 2L0TA 1D3ZA 4W9LA 3B2GA 4EZKA 4USAA 4J3OD 4W9HA 2AX5A 1WXQA 3W2DA 1VZ8A 2MBHA 1WWTA 3A4RA 3JSVA 1TGZB 2J52A 2KTRA 2DWQA 2FCSA 4FJYA 2OJRA 3AEGB 4M0WA 1C3TA 1IBXA 2L05A 1SE9A 4FBJB 1ET6A 1WRDB 1RAXA 3VH4B 2LRUA 2TSSA 1K52A 1KF6B 2ZZPB 2L52A 1WI0A 4C80A 2RGFA 3S2AA 2KAJA 4RFBA 2KJRA 2ACZB 5L95C 2M56B 2HJ8A 1MFWA 2ZJDA 1XCQL 2KWVB 1VJKA 2LRWA 5G5GA 1FRDA 1XEEA 4ANVA 1TKGA 4JIOU 4TMAB 3L4PA 2RDHA 4CHKA 3D32A 1L7YA 4K1RB 5D7GA 1K8RB 2BYEA 2JRIB 2INPE 3N9YC 4ASWC 2JQRB 1WYGA 5KHOA 4B0EA 3DPDA 3ETRA 3NJTA 5FK9C 1C4AA 2W9NA 4ZRJA 1ZOYB 3BVMA 4XC2A 3H1UA 2X38A 3ONSA 1H8CA 1T0RC 5IP4D 5DPWA 4CO7A 1J7CA 1F1HA 2QEJC 2AQ3B 3V62A 4AOFA 2G45B 3AE2B 2WDQB 4REZA 1FFUA 1UD7A 4OVUA 2KHWB 4LNOA 4C00A 3VUXA 2VRRB 1ZUD2 4KGRA 2V9HA 3RMKC 5KHQA 5JH5C 2WHIA 4IWPA 2JZZA 1FIQA 4YSZB 4MELA 4K7UA 1E8WA 3I63C 1JWMD 2K1FA 1HEZE 5C1ZA 3A9JB 3DWMA 3APFA 2PMVA 2R61A 1AYFA 1F77A 1YOVB 3ZO5B 3H7SA 3AE9B 2Z0DB 2Q5WD 2K25A 1WSPA 3LB8C 3NRZA 3K9PB 4P1CC 2FIDA 3SDLC 4B9KA 2OJWA 4OW0A 3P4QB 2WDRB 1OQYA 4YSYB 3WALA 1LO5D 3NHEB 1TBEA 3AXCA 1N5WA 1QOGA 3RN9C 1D5ZC 4YTPB 5AZHA 1EO6A 1NVID 1MHXA 2W55A 3U4EG 1FXIA 3KH0A 2MX2A 3MHZA 4C56C 3SEBA 2KN4A 1R4MI 2J0JA 3AEEB 1RYJA 2DYBA 4XDCA 5MPOA 1UGJA 5HFYA 3RULA 4NQLB 3JYUA 3TEXA 4HLEA 1DOXA 4KDLB 2E3TA 1SIFA 2C5LC 4MH8A 3V6CB 4S0RA 1Z5SB 1ZXHA 1IGDA 4DXAB 4M01A 1V97A 4BOSC 2KWCA 3DVGY 3EHVA 4BBNC 2WXIA 5JHAA 2FCMA 5D3DA 3LJ3A 3AE4B 2ZCBA 1V80A 2ZW1A 2LZ6A 1SGHA 3I5JC 4G3XB 1G6JA 1C78A 1B1ZA 3X0WA 1VZ7A 4A6QA 2BYFA 2C7MB 2V3NA 3PRPB 3C8YA 4XX5A 1EWYC 4RCOA 3ZW3A 1LM8B 5J18A 4LDTD 3ZUNA 2NTSA 2KJHB 4A90A 4ZRPA 1XLNA 1JRPA 3V6EB 4ZRIA 3ZVVA 2KC2A 1AW7A 2HD5B 2WP9B 3APCA 4EZJA 3H8HA 2N1VA 1WE6A 2LXAA 3WIMA 3MC0B 2DYMA 2GMIC 4YSXB 1P7FA 2XK5B 1QKZA 1WY8A 3RNAC 1GG3A 3C0RB 5J2RA 2QIEB 1HTQA 1LXDA 2RMMA 2BWFA 1V81A 2KFJA 4EZLA 3DVGX 4NJ6A 2ASQA 2DENB 4AUQC 1A5RA 1WGYA 2DZMA 1FM0D 1C4CA 4FADA 4PK1A 2KOXA 2D5GA 1TY2A 5DPSA 4ZDVA 1FD6A 2J53A 2WDVB 3N1YC 3A9JA 1WX8A 3AECB 1TKYA 1UF0A 3QARA 3ML8A 5CHFA 2OOBB 2BBCA 1P3QU 1VD2A 1UBIA 5EE1A 1SF0A 2NTTA 3Q2AC 4YTMB 2KWUB 3R2TA 1PUTA 5E6JA 4KSKC 2VH1A 2HDEA 2L0FA 2N9KA 3HVDA 2BKFA 2KDMA 2K6QA 3VTUA 3JW0X 5CTRC 1QOFA 2QILA 3HUIA 3KYCD 2GBKA 3L17A 3TJPA 2DHZA 4MSMB 2LFIA 2JYTA 2JT4B 2REXA 3HRDD 4EEWA 2SEBD 2HE7A 3W1SC 4RH6A 1PGBA 3RT3B 5E6PA 4W9CA 1WJ4A 4NJ7A 1Q1OA 1I35A 1EU4A 1YD8U 2K8HA 4WQOB 1GAQB 3P4PB 2MQJA 4US9A 2YVCA 3I57A 1XQQA 4XDDA 2IJ0A 2I1JA 4J6IA 1L5PA 2FNJB 4IW0A 3VTWA 4LJPB 4WWNA 1R4NI 4E74A 1GJZA 1QT9A 1K53A 3TUOA 1XCTL 2Y5CA 5DPTA 2PVGC 1FRRA 1FEHA 1JRUA 3DCGA 3IFWB 4BVUC 1YX6B 3ZNGC 4C7YA 4RNAA 4JWSC 1QILA 2KWDA 3HM6X 1IPGA 2LWPA 2V1YA 3VR9B 1VR9A 2BVCA 2W3RA 2XK5A 2JVCA 3DVNV 3TMPB 2LI5A 2AEHA 2WXNA 3BINA 3U30A 1ROEA 2NPTB 3WCQA 2KANA 1L4ZB 5LLIA 4FLHA 4ANXA 4TKNA 4MJSB 3HVZA 3L0WB 2WXOA 3K9OB 3SD5A 2WXFA 3EGRA 1NENB 3CIRB 1GNUA 5BMGA 1GOZA 3P63A 2V3SA 3DBLB 1GC6A 3N1ZC 1JWBD 2Z8LA 3Q8CA 4A55A 4KDIC 3FILB 3RD2A 2QC8A 1DYQA 3QA8A 4GSWA 3RNBC 1N60A 2IDYA 4GB9A 3VFKA 4EE2A 5CX3A 4C4VB 4DK5A 3GE3C 2MWSB 3VH3B 1TS5A 2W82A 1QZEA 3P2BA 1STEA 2I1KA 3GZNI 2CS4A 2LXCA 4IDIA 4GDLA 2RPQA 3EUB2 3GP7A 2R2QA 4LDTB 3EA6A 4OZBA 4P16A 1QOBA 5BYQA 1UNSA 2BB5A 2LVQA 3DVNU 2LGIA 2LHDA 2VZKD 3N20C 1PQSA 1HTOA 1SSNA 5AEKB 1F0ZA 3PREA 3Q14C 5IKCM 3ZGZA 1D4BA 2VH2A 2EKIA 3AE6B 3L10B 3NS8A 5AZFA 3OJ4B 4BZAA 2MEKA 3L54A 4KKJA 1UWMA 2Y5BB 1DOIA 3MJWA 5AUKA 4BKSD 2Y3AA 3AEFB 2KO3A 3R7QA 2WU2B 2DZIA 2EELA 2BYTA 4HCPB 3A4SC 1NBFC 1E5WA 4RM8A 2CHZA 2LGSA 3V61A 3NZ3A 1XXGA 3NY5A 3PZ7A 1Y56A 3ML9A 4DHZB 2ZEQA 5E6OA 2KJ6A 1WZ0A 3IBEA 2JY6A 3ALBA 3QWZB 3ZIMA 2NPTA 5CHVC 1HA5A 3AMZA 4B6WA 4KGTA 3QX1A 2M0AA 2OEDA 1WMHB 4EFOA 4MJSA 2JWUA 2MLBA 1T3QA 3WAMA 3QAQA 1QOAA 4FHJA 3NVZA 4KIKB 2KYWA 2WX1A 3GOEA 2WXLA 3CMMB 4WWPA 4XGAB 3UINB 1ET9A 2FCNA 1L0XB 2CHXA 2GBJA 1YX5B 2ZPYA 1WZ3A 2EMTA 1WGHA 2JYEA 2IGDA 1FFVA 1BXTA 1RRBA 2G1EA 1TS4A 1WXMA 2RDGA 2MP2B 1V2YA 4IC7B 2RD0A 4C4VA 3DBRI 5HKHA 3APDA 2NR2A 3KQ4A 4WJPA 4FHKA 1V1PB 4NZLB 1N63A 3KWVA 1WM2A 1OEYJ 4LNFA 2GBRA 1R7SA 1LFDA 5LXIB 3LDZE 1R4MB 4LNKA 2HJ1A 4M00A 2CU3A 2WGSA 3IHPC 3IAS1 2MBOA 4RF1A 3URYA 2KQ4X 4FXCA 4WAAA 3R7RA 3I3TB 3KUCB 4KZCA 1JALA 1EWCA 3Q3NC 4ZRKA 1SXTA 2KMMA 1WJUA 3MC8A 3TEWA 2KX3A 2WWZA 1JW9D 2K22A 3PO0A 3PHWB 2RSUA 1OQRA 4KV2A 3A1QB 2JZ3B 3PPAA 3AEBB 3R2IA 2L76A 5G2NA 1IUEA 1P0RA 4K81A 3SFDB 4AJYB 1TS2A 1PDXA 3B2FA 2OHFA 1ACCA 2L1AA 1KFYB 4G0NB 3UQBA 4RF0A 4KX6B 4PYUA 4BOZB 2J0KA 1OEYA 3PTFC 1TY0A 2H88B 3EC8A 2AWTA 3H6NA 4AWJA 2XNAC 2K9XA 3NS1A 1KLVA 3IAM1 2J7QB 2JUOA 2O6VD 3N30A 1MVKA 2W3SA 1WFYA 2KN5A 2Y5PA 5DCNA 2YEPF 1FNUA 1QQRA 2JWZA 4ACFA 3AB5A 3AU4A 2DNFA 2UWQA 4NNJB 1T5XD 2KLGA 4JL9A 2D3BA 3N3KB 2D2QA 5BYRA 1ISNA 4ANWA 1SE4A 3VUYA 2YLMA 1F2RC 1V5TA 3U7DA 4JPSA 3IT4B 3DHIC 4KIKA 2M8SA 5T8IA 1WXVA 2D07B 4WJQA 4A3OA 1SE3A 3WAPA 4N9F4 1JWSD 4DBGA 3MP9A 2PPHA 1E6EB 4PS8A 3Q8FA 4MGZE 1L2NA 2PTLA 1TS3A 4M8NA 4TQ1A 2M17A 3HHMA 2PKOA 5I4DA 4O1NA 1V5OA 3NVYA 3KW5B 3QHTA 2VZKB 2WYQA 2KX0A 1E8YA 1ZGUB 3PV1A 4WURA 2K39A 2HTME 1L0YB 2B76B 1E90A 2PEAA 5L83A 1OGWA 2A5UA 4OZAA 5D6JB 1YJJA 1V1PA 3VR8B 2G3QB 3ZXRA 3Q69A 4AJWA 3DHGC 4RGOS 1BUIC 1FNWA 2RDBC 2JX5A 5C2TB 4JLCA 4XWWA 3EFCA 3NUHB 3P4RB 1XLPA 1WYWB 4ANUA 1AN8A 2GOWA 3PRZA 2DYOA 2XEWA 2KK8A 4ICVA 1TIFA 2JRHA 4HXDA 4GU2A 1QF6A 3AE5B 4LNIA 2K5PA 2QDFA 1NYRA 2D3CA 3R66C 1C1YB 4BAXA 2LGDA 4FJZA 3ZQ4A 4F8CB 4NAWB 3WANA 2RR9A 1L0VB 3A1QA 2CHWA 3L16A 2QMTA 2A4ZA 1N6ZA 2Z0EB 1ZDVA 3QJZA 1I4XA 3KYDD 4FN2A 3ZLZA 2D3AA 2NMQA 2WXGA 3VQIA 2IO0B 1E9MA 4HPLB 5BMHA 3BZDB 3ZNHB 1S3SG 2MJ3A 1VDVA 3DHHC 3FKYA 2JPHA 3UQAA 2MCNB 5TR5A 1IP9A 4MDKE 4LNNA 1D6EC 1EM7A 4JE3B 4LCDE 3OAWA 3NVWA 1GB4A 3BVGA 2ZVOA 4WJNA 3A9KB 4R3DA 4A8XC 2PLPA 2PVOD 3PHXB 3KUDB 1YN3A 5JZEB 3TEYA 3OWEB 2X8XX 2JF5A 2GBNA 3TIXA 5DPRA 2MHJA 2WXMA 1I4HA 3VXWA 4URKA 2C9WB 2LGXA 1YNTE 4YXDB 1C76A 5C3JB 2BWES 2BGFA 1YQ4B 4YTNB 4N58A 1GC7A 1FXTB 4MSQB 2MW5A 2AQ1B 2WLBA 2WXQA 1XLQA 3DOWA 2KFKB 3E9SA 4HPPA 3E56A 2K0PA 1M94A 2IPKD 3AE1B 1I4RA 3ZTCA 4GLSC 4IM0A 1BT0A 4WAFA 1YJ1A 4A20A 1XF5L 4FA6A 4ZYNA 4B0MA 4HDOA 2L8JA 2KVRA 1ESFA 3GZNB 2MSED 3DWGC 4BKSA 1RFKA 1L6VA 4LTUA 4L1BA 4OVZA 4BBNF 2PIAA 3V05A 2RPVA 2INDC 1SJHD 4RGTA 2DAJA 2IYDB 3N32A 2N0SB 1E7VA 3Q8BA 3ZTDA 2KVZA 3ZXVA 4NQKE 4ZYSA 2MBBB 3WAOA 4BKTA 1WR1A 4P7IA 2KDIA 1Q0WB 4NAWA 2JU6X 5LNK1 2BB6A 4RGNA 1I4PA 2O6VB 3X23A 2V4LA 1RLFA 3B9JA 2XN9C 5GXGB 5FKAC 1T0SC 2KC1A 1WGRA 2C7HA 1KLGD 2MRPA 1I4QA 1NYQA 3HM3A 2QHOA 2XBBC 1P7EA 1E7PB 3U2SC 5AUIA 4PYZA 4MT5A 2FAZA 1Y8RC 1FO4A 3L13A 3ZRCA 5D3IB 1E8XA 4PS3A 3W5VB 5IO9A 2MH7A 3BK1A 1JWAD 2NBUA 1V6EA 4W9IA 4NY0A 3A9KA 3PS6A 2WXKA 2J42A 3ZJVA 3FC4A 3DBHI 3L08A 1IGCA 4TV3A 3ZJTA 1ZP0B 2K8BA 2ZNVB 4M0WB 4WWOA 1IBXB 3HK0A 4IWQA 3CSTA 5G55A 2G4DB 1UH6A 1WX9A 4A9AA 3KLSX 2J4XA 3O65B 3QIJA 2KMAA 5EDSA 3J9CA 1ZPSA 2I2YA 3Q8AA 3IT6B 2KFKA 2BTEA 4OHJA 1WF9A 1DOYA 4W9KA 4LK0M 4II2B 1EU3A 3M3JA 3NVVA 3AH7A 2LASA 4M8MA 4HJGE 4XZ4A 1MI0A 2ZCCA 5FR6A 2GI9A 4HEA1 1RWSA 5HHDG 3BVZA 3V60A 1TKEA 5AZGA 2UU7A 3FAHA 2O2VB 4FJVB 4HKZE 4MGYE 1VZ6A 2SAKA 4RM9A 3PGEA 2V4IB 1VCBA 4DHJD 3OJ3A 1OFFA 2NVUI 4LLGM 3TCAA 2MBEA 1FPYA 1SIJA 4IM2A 3AI5A 4GXBA 4P1BC 3MC9A 3QCAA 1J0GA 3ZDTA 2QCZA 5LXHA 3VRBB 2KT7A 2DBYA 4ARIA 4IUMB 4FULA 4L2YA 2KLCA 3BYYB 3RYTA 3T3NA 3UI3A 4W9EA 1WXAA 1TTNA 2O6VA 2V0GA 4EKUA 4E71A 1E7UA 4HRSA 1Q5WB 3U8ZA 4OVVA 2MJEA 3JVZX 4YL8A 2YEPB 3R3MA 1TZOA 3CSFA 3RNCC 4WWMA 3ENEA 4GGQA 1HZ6A 2GBMA 3NOBA 5BYSA 1CZPA 3HIZA 1ZKHA 2JZPA 3RI7C 2C60A 2Z59B 1EF1A 3O13A 3Q3JA 4W9JA 2LMCA 2AL3A 2WXRA 4NPNA 4IG7B 3Q3OC 1XLOA 2B3AA 2KTFA 4JX1C 3RUIB 3P42A 3GS2A 3RCZA 1V1OA 5EE3A 1YQBA 2JXXA 3ABVB 3M63B 1YQ3B 3DBLI 1I42A 4KZ0A 1ZDXA 4I6PA 2WQYB 4JQWC 2FUG1 3MJ5A 2I38A 4K3BA 2LJIA 1M4VA 5E6NA 3FILA 1K51A 1E10A 4AQ7A 1T0YA 1SBBB 2DZKA 4DWFA 1NEKB 2PE6B 1WXSA
chains in the Genus database with same CATH topology
3MFGA 2VZKB 3TEZA 1T6BX 3AE8B 3KWLA 2HDEA 2N9KA 4WURA 2HTME 1FNVA 1L0YB 1V8CA 2B76B 2KDMA 3HVDA 1GB1A 4DXFA 1B9RA 4OZAA 1I4GA 1QOFA 5HI1A 4IOIE 3W1SA 3RPFC 4DXGA 2QILA 1ZE3D 4OZCA 4ARCA 1YJJA 3HUIA 1C79A 1V1PA 1KLUD 3VR8B 1JCKB 2LFIA 3Q69A 1FCCC 2JYTA 1SEBD 2CJNA 4RGOS 3Q8EA 3HRDD 1BUIC 1FNWA 2SEBD 2WS3B 4YT0B 1SJED 1DGJA 5C2TB 2JX5A 2LHEA 4XWWA 1KRHA 3NUHB 2FBWB 4RH6A 3P4RB 1CK1A 1PGBA 1XLPA 5HG2A 1AN8A 1QLBB 2DYOA 3GB1A 1EU4A 3BIID 2L32A 2N9LA 2FE8A 1GAQB 1HQRD 3P4PB 3W5UB 1YN5A 4US9A 4WH4A 1QF6A 1JQ4A 2CJOA 3AE5B 3I57A 1PGAA 2AQ2B 4HKQA 4XDDA 2WXPA 2K5PA 2QJLA 3ZJUA 2IJ0A 1NYRA 3BYTB 1CQVA 1L5PA 1FCLA 1TYGB 3ZQ4A 1ZXIA 4NAWB 1A70A 1QT9A 1K53A 3I9V1 3TUOA 1L0VB 1XCTL 2Y5CA 2PVGC 2IGHA 2WU5B 2BS2B 2WXJA 1FRRA 1FEHA 2G9HD 2QMTA 4KKIA 1ZDVA 2JSVX 5EE9A 4C7YA 4RNAA 2PW9A 1I4XA 4JWSC 1NI3A 1TJEA 2M19A 1I7HA 1QILA 2NMQA 5BMIA 1PYWD 1JMLA 2W54A 2KWDA 4JWUC 2WXGA 3U7ZA 2MJDA 3VQIA 2ZW0A 2N7JA 3VR9B 1E9MA 3BWUD 5TSSA 5BMHA 3BZDB 1VR9A 3RFZB 2W3RA 3SFEB 2MJ3A 2WXHA 1VDVA 4Q2JA 1VLBA 1C4PA 3R8BA 1FMAD 1WRIA 2WXNA 1YJIA 1D6EC 1EM7A 1XO3A 4JE3B 1ROEA 4D2KA 3NVWA 3WCQA 3B2GA 3BK2A 3BVGA 1GB4A 4USAA 1L4ZB 4J3OD 4AS1A 2AX5A 1WXQA 3W2DA 1VZ8A 4R3DA 2ON8A 4A8XC 1WWTA 3HVZA 2PLPA 1K50A 2PVOD 1YN3A 2J52A 2DWQA 2WXOA 3OWEB 3TEYA 2WXFA 2KACA 3AEGB 1C77A 1JROA 3EGRA 4M0WA 1NENB 1YMHE 4XE0A 3CIRB 4US8A 2WXMA 5BMGA 1IBXA 1GOZA 1I4HA 4ZOHC 3P63A 4IKGA 4YWGG 4MM3B 2GRIA 1YNTE 1ET6A 4YXDB 1C76A 5C3JB 1JWBD 1YQ4B 2Z8LA 1N61A 4YTNB 3Q8CA 1AWDA 3TSSA 3P4SB 4N58A 4A55A 1BMLC 2TSSA 1K52A 2AQ1B 3FILB 4N6EB 1KF6B 2WLBA 2WXQA 1DYQA 1XLQA 1YN4A 2L52A 2WNMA 1VRAB 1N60A 3E9SA 3E56A 2IDYA 4C80A 2K0PA 3AN1A 4EE2A 2KAJA 4RFBA 5FR3A 2JXTA 2ACZB 2IPKD 3AE1B 1I4RA 2M56B 1HZ5A 4GLSC 1TS5A 2W82A 1XCQL 1VJKA 1STEA 4WAFA 1XF5L 5G5GA 2BS4B 4IDIA 1FRDA 1XEEA 3EUB2 3GP7A 4B0MA 1TKGA 3EA6A 4TMAB 4OZBA 3L4PA 4P16A 1QOBA 5BYQA 1UNSA 4H2AA 1ENFA 2BB5A 1ESFA 2RDHA 3DWGC 2LGIA 2LHDA 1PFDA 2VZKD 2ICIA 1RFKA 1L6VA 4LTUA 4WIPA 4L1BA 4P6VF 4OVZA 5D7GA 2PIAA 3V05A 2RPVA 1SJHD 4RGTA 1SSNA 2INPE 3N9YC 2N0SB 3Q8BA 1F0ZA 2JQRB 1WYGA 4B0EA 4NAMA 3ETRA 5FK9C 4ZYSA 1C4AA 1Q10A 3ZGZA 1N5XA 1D4BA 1ZOYB 3BVMA 2EKIA 3AE6B 2X38A 4C7ZA 2JU6X 5LNK1 2BB6A 4RGNA 5EE0A 1J7CA 1I4PA 2MEKA 4KKJA 2LEKA 1UWMA 2QEJC 1JWUD 4XWTA 1DOIA 4UDUC 2AQ3B 2BW2A 3AM9A 5AUKA 3B9JA 2XN9C 5GXGB 5FKAC 2Y3AA 3AE2B 2WDQB 4REZA 3AEDB 3AEFB 1UUPA 1FFUA 1KLGD 1SE2A 2WU2B 2EELA 1I4QA 2BYTA 1NYQA 1P7EA 3AV8A 1E7PB 1ZUD2 1UWXA 4KGRA 3U2SC 3NZ3A 5AUIA 4NJCA 1XXGA 4MT5A 3PZ7A 1Y56A 1F2RI 1FIQA 4YSZB 1FO4A 5D3IB 2IGGA 3W5VB 1CJEA 1JWMD 1HA5A 2MH7A 1HEZE 3AMZA 4KGTA 3BK1A 1JWAD 2M0AA 3DWMA 2OEDA 2PMVA 2R61A 1AYFA 1F77A 2WXKA 1D5XC 2J42A 3ZJVA 3FC4A 3AE9B 2JWUA 1IGCA 1HXYD 1T3QA 1WSPA 2Q5WD 2DLBA 3ZJTA 1QOAA 3LB8C 1ZP0B 3NRZA 3NVZA 1FXAA 2GB1A 4OW0A 1IBXB 2WXLA 3P4QB 2WDRB 1KTKA 4YSYB 4GDKB 1LO5D 2LUMA 1ET9A 4A9AA 1L0XB 1N5WA 1QOGA 1D5ZC 3KLSX 4YTPB 2J4XA 2JYEA 2IGDA 1SB3C 1FFVA 3CWIA 3W9CB 1BXTA 1MHXA 1NVID 2W55A 4TSSA 3U4EG 3J9CA 2G1EA 1TS4A 4HROA 1FXIA 1ZPSA 2I2YA 3Q8AA 3IT6B 2RDGA 2K3UA 3SR6A 2BTEA 4OHJA 1MHHE 5H8YE 3MHZA 1DOYA 4C56C 3KQ4A 3SEBA 2KN4A 3LYYA 4LK0M 3AEEB 1KH0A 4N59A 1EU3A 1RYJA 1N62A 1V1PB 3NVVA 3AH7A 4XDCA 5MPOA 4NZLB 1N63A 1UGJA 3KWVA 5HFYA 4HJGE 3TEXA 1MI0A 1DOXA 2GI9A 4HEA1 1R7SA 2E3TA 4MH8A 1RWSA 5HHDG 3IXSA 2H89B 3BVZA 1TKEA 3FAHA 1ZXHA 2CU3A 4HKZE 2E6XA 1IGDA 4GDLB 4PT5A 1VZ6A 1V97A 2SAKA 2V4IB 3IAS1 4RF1A 2WXIA 1OFFA 4LLGM 4L23A 5D3DA 3URYA 1SIJA 2KQ4X 3AE4B 4WQMA 4FXCA 2ZW1A 1JALA 1EWCA 1RM6C 1SXTA 2KMMA 3TEWA 1JW9D 1C78A 2K22A 1B1ZA 3PO0A 3AE3B 3VRBB 3AE7B 1VZ7A 2DBYA 4A6QA 1OQRA 4ARIA 3P1MA 2V3NA 4L2YA 1GPXA 1MPEA 3BYYB 4ZRQA 2L83A 3C8YA 1EWYC 4RCOA 3AEBB 3VRAB 3R2IA 3T3NA 1E0ZA 3UI3A 2BS3B 2NTSA 4KGSA 5G5HA 4A90A 4ZRPA 1XLNA 1JRPA 1J7AA 2V0GA 1IUEA 1AW7A 2INNE 3SFDB 4HRSA 4ZHPA 2WP9B 1L6UA 3H8HA 1TS2A 4ZHOA 3MC0B 2DYMA 2MJEA 1PDXA 2BT6A 4MACA 4YSXB 3B2FA 2OHFA 2YEPB 1ACCA 1P7FA 3T3OA 1D5MC 1TZOA 2L1AA 1QKZA 1KFYB 4RF0A 3V3XA 4WWMA 4KX6B 1WGKA 5H92C 3PZ8A 1HZ6A 2QIEB 2RMMA 5BYSA 1CZPA 1TY0A 2H88B 4ITKA 2JZPA 5JXVA 2XNAC 2K9XA 3NS1A 4RGMA 3IAM1 3O13A 1FM0D 2LMCA 2WXRA 1C4CA 1MVKA 1XLOA 2W3SA 2Y5PA 4JX1C 2D5GA 2YEPF 1TY2A 3P42A 1FNUA 3GS2A 1QQRA 1FD6A 1L4DB 1V1OA 5EE3A 4DQOC 2J53A 2WDVB 3AB5A 1C9FA 3ABVB 1T5XD 1OQQA 1J7BA 3AECB 1TKYA 2ONQA 1YQ3B 5BYRA 4CQNA 3AEAB 2BBCA 1SE4A 1ZDXA 1F2RC 2V3PA 2WQYB 2FUG1 3IT4B 4JPSA 5EE1A 4TQ0A 1SF0A 3MJ5A 5T8IA 2I38A 2NTTA 2LJIA 1M4VA 1SE3A 3FILA 1K51A 4YTMB 1E10A 1JWSD 3ZYYX 3MP9A 1E6EB 4AQ7A 3Q8FA 2QSDA 1PGXA 1SBBB 2PTLA 1PUTA 1TS3A 3R2TA 4TQ1A 3LXFA 2PKOA 1NEKB 5E6JA 5I4DA 4O1NA 3U52E 3NVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AUK A;  3B9J A;  5GXG B;  2AX5 A;  1WXQ A;  3AE8 B;  3KWL A;  3AE2 B;  2WDQ B;  3AED B;  1WWT A;  1SIJ A;  3AEF B;  2PVO D;  3AE4 B;  1FFU A;  2HTM E;  3HVZ A;  4FXC A;  4WQM A;  2DWQ A;  1V8C A;  2B76 B;  2WU2 B;  1JAL A;  1B9R A;  1RM6 C;  1JRO A;  3AEG B;  1NEN B;  1NYQ A;  1QOF A;  2KMM A;  3RPF C;  3CIR B;  4US8 A;  1YJJ A;  1E7P B;  3AV8 A;  3HUI A;  1ZUD 2;  1JW9 D;  4ZOH C;  3P63 A;  3VR8 B;  2K22 A;  5AUI A;  3PO0 A;  3AE3 B;  3VRB B;  3AE7 B;  2CJN A;  4YXD B;  2DBY A;  5C3J B;  1OQR A;  1FIQ A;  1JWB D;  3P1M A;  3HRD D;  1YQ4 B;  4YSZ B;  1FO4 A;  1GPX A;  4YT0 B;  1N61 A;  2WS3 B;  4YTN B;  1AWD A;  1DGJ A;  2L83 A;  3P4S B;  2JX5 A;  1EWY C;  4N58 A;  1KRH A;  3AEB B;  5C2T B;  3VRA B;  1E0Z A;  2FBW B;  2BS3 B;  3P4R B;  3W5V B;  1XLP A;  1CJE A;  4N6E B;  5G5H A;  1XLN A;  1KF6 B;  1JRP A;  2WLB A;  1J7A A;  2MH7 A;  1QLB B;  1XLQ A;  3AMZ A;  1IUE A;  2L52 A;  1JWA D;  1N60 A;  3DWM A;  3SFD B;  4HRS A;  4C80 A;  4ZHP A;  2WP9 B;  1AYF A;  3BII D;  3AN1 A;  2KAJ A;  1L6U A;  4ZHO A;  1GAQ B;  2ACZ B;  3FC4 A;  3P4P B;  3W5U B;  3AE1 B;  3AE9 B;  2M56 B;  2MJE A;  1PDX A;  2BT6 A;  4US9 A;  4YSX B;  3B2F A;  2OHF A;  1QF6 A;  2Q5W D;  1T3Q A;  2CJO A;  3AE5 B;  1JQ4 A;  1KFY B;  1QOA A;  3LB8 C;  2K5P A;  1ZP0 B;  2QJL A;  3NRZ A;  3NVZ A;  4WWM A;  4KX6 B;  1WGK A;  1FXA A;  1NYR A;  5H92 C;  1L5P A;  2QIE B;  1VJK A;  1TYG B;  3P4Q B;  1CZP A;  2WDR B;  1ZXI A;  2H88 B;  4YSY B;  4ITK A;  1A70 A;  5G5G A;  2BS4 B;  1QT9 A;  4IDI A;  1FRD A;  4A9A A;  3EUB 2;  1L0V B;  1N5W A;  2K9X A;  2Y5C A;  3NS1 A;  2PVG C;  1QOG A;  2WU5 B;  1TKG A;  2BS2 B;  1FM0 D;  4YTP B;  1FRR A;  3L4P A;  1QOB A;  1SB3 C;  1FFV A;  1XLO A;  2W3S A;  3CWI A;  1NVI D;  3W9C B;  2W55 A;  4JX1 C;  4HRO A;  2G1E A;  1FXI A;  3DWG C;  4C7Y A;  5EE3 A;  1PFD A;  5EE9 A;  2WDV B;  3AB5 A;  3SR6 A;  4JWS C;  1NI3 A;  1TJE A;  2M19 A;  1I7H A;  3ABV B;  1RFK A;  1L6V A;  4LTU A;  4P6V F;  2W54 A;  4JWU C;  1OQQ A;  2PIA A;  1J7B A;  2MJD A;  5H8Y E;  1DOY A;  3AEC B;  1TKY A;  1YQ3 B;  1E9M A;  3VR9 B;  3AEE B;  4N59 A;  2W3R A;  1RYJ A;  3AEA B;  1N62 A;  3SFE B;  2MJ3 A;  2N0S B;  3NVV A;  3AH7 A;  5MPO A;  1F0Z A;  2JQR B;  1WYG A;  1VDV A;  1N63 A;  2WQY B;  1VLB A;  3ETR A;  5EE1 A;  1N5X A;  1DOX A;  1SF0 A;  1ZOY B;  2EKI A;  3AE6 B;  1R7S A;  2E3T A;  1FMA D;  1RWS A;  1WRI A;  4C7Z A;  2H89 B;  1YJI A;  4YTM B;  1E10 A;  5EE0 A;  3ZYY X;  1TKE A;  1J7C A;  1E6E B;  3FAH A;  2LEK A;  1XO3 A;  1UWM A;  1ROE A;  2CU3 A;  1PUT A;  1DOI A;  1V97 A;  3NVW A;  3LXF A;  2PKO A;  3WCQ A;  1NEK B;  3AM9 A;  3B2G A;  4USA A;  3NVY A;  1OFF A; 
#chains in the Genus database with same CATH topology
 1T6B X;  4ICU A;  3MHS D;  4KVG B;  1FNV A;  1GB1 A;  1B9R A;  1I4G A;  4IOI E;  4OZC A;  4ARC A;  4I6N B;  1C79 A;  1KLU D;  4GN1 A;  1FCC C;  4I6L B;  4CYE A;  1SEB D;  2CJN A;  3Q8E A;  4YT0 B;  1SJE D;  1XT9 B;  2LHE A;  2FCQ A;  2FBW B;  4G11 A;  2CR5 A;  2NCN A;  1UZX B;  2O2V A;  1WJN A;  1QLB B;  2IBI B;  2LUE A;  1HE8 A;  1V9J A;  1AAR A;  3SHQ A;  4EOY A;  4GMV A;  4HPM B;  2N9L A;  2FE8 A;  4KSL C;  2LVO A;  3ZRF A;  2D3G A;  2UYZ B;  4HKQ A;  1PGA A;  2AQ2 B;  4PS7 A;  2WXP A;  4LJO B;  1FCL A;  1P1A A;  1TYG B;  3Q6B A;  1ZXI A;  3DQV A;  1WIA A;  4IWO A;  2WXJ A;  2G9H D;  4HWI B;  4A3P A;  1WX7 A;  4KKI A;  5IOI A;  5CHW A;  5D2M B;  2PW9 A;  2FUH B;  1NI3 A;  1TJE A;  2M19 A;  1I7H A;  5BMI A;  1ZW7 A;  2MJD A;  2AL6 A;  2ZW0 A;  2N7J A;  3EEC A;  1EUV B;  3BWU D;  5TSS A;  3RFZ B;  3SFE B;  2D11 A;  3VDZ A;  1C4P A;  2KD0 A;  1LGR A;  3R8B A;  2L00 B;  1FMA D;  1U4A A;  1YJI A;  4HK2 A;  1XO3 A;  4D2K A;  2KKC A;  3Q3M C;  3UIP B;  3T8M A;  1WMH A;  3BK2 A;  2GLS A;  2ZVN A;  4AS1 A;  2ZPN A;  2DAF A;  4QAY A;  2ON8 A;  1TZ1 A;  1K50 A;  2KAC A;  1C77 A;  1JRO A;  1YMH E;  2IY0 B;  4XE0 A;  3CF6 E;  1OTR B;  4JGH B;  2HTH A;  2IY1 B;  4US8 A;  4ZOH C;  4YWG G;  2N9X A;  2IO1 B;  4IKG A;  4MM3 B;  2GRI A;  3RZF A;  1N61 A;  1AWD A;  2M0X A;  3P4S B;  3TSS A;  1BML C;  2J0M A;  3VUW A;  2KXJ A;  4N6E B;  3RNG C;  5IAA C;  2MP2 A;  2IO3 B;  2KQS A;  4DHJ B;  1YN4 A;  2NS5 A;  2WNM A;  1VRA B;  5J17 A;  3B1L X;  2N9E B;  4G50 A;  3AN1 A;  1MG4 A;  3AU5 A;  3OLM D;  5FR3 A;  2JXT A;  3B0A A;  3WA0 A;  1HZ5 A;  3IVF A;  4MH0 E;  4M02 A;  2KDB A;  2BQQ A;  2NBV B;  3NZS A;  1J19 A;  3PT2 B;  2BS4 B;  4HJK A;  2K6D B;  4XYC A;  2D10 A;  1E8Z A;  2N7D A;  3NZU A;  3C19 A;  4H2A A;  1ENF A;  1H4R A;  1TT5 B;  1V86 A;  1PFD A;  2ICI A;  2BPS A;  4WIP A;  4P6V F;  2DZJ A;  2LD9 A;  4NAM A;  2R2O A;  4BKG A;  1NI2 A;  1Q10 A;  1N5X A;  4GOC A;  3PLU A;  4C7Z A;  2M1M A;  3A33 B;  5EE0 A;  1MJD A;  1R4N B;  2WX0 A;  2LEK A;  3QK0 A;  1Z2M A;  1JWU D;  4XWT A;  4UDU C;  2BW2 A;  3AM9 A;  4IM3 A;  4HVB A;  3AUL A;  3AED B;  1UUP A;  4F1S A;  1SE2 A;  3UF8 A;  2IO2 B;  2C7N B;  3EFU A;  3AV8 A;  2INC C;  1UWX A;  4NJC A;  5IN7 A;  1F2R I;  3M62 B;  3VAW A;  2WDT B;  2IGG A;  1CJE A;  4WJO A;  3GE8 C;  2KZR A;  3RNE C;  4RMA A;  1D5X C;  1HXY D;  2DLB A;  3H7P B;  1FXA A;  2GB1 A;  4MM3 A;  3T9L A;  3DBH B;  3DBS A;  1KTK A;  3RZW C;  3PLV A;  4GDK B;  5D94 A;  2LUM A;  4W9G A;  3QQ8 B;  2N9P C;  1EF5 A;  1UBQ A;  1SB3 C;  3CWI A;  3W9C B;  4TSS A;  4HRO A;  3B08 A;  3MTN B;  4TUU A;  2K3U A;  2LJ5 A;  3SR6 A;  3PRM B;  2FIF A;  1MHH E;  2KDE B;  3PZD A;  5H8Y E;  5C23 A;  3LYY A;  2BYV E;  1KH0 A;  4N59 A;  1N62 A;  1UGM A;  4MGI E;  2L7R A;  2EKE C;  2BKR B;  1IYF A;  3W1Y A;  3IXS A;  2H89 B;  4W9F A;  3TBL D;  3PVL A;  2K8C A;  2KDF B;  1F52 A;  2E6X A;  4GDL B;  4PT5 A;  5BO4 B;  2M4N A;  3VTV A;  2IZV B;  4L23 A;  4WQM A;  2N4F A;  2NBW B;  1RM6 C;  4E3C A;  4X57 B;  1WE7 A;  3AE3 B;  1XD3 B;  3AE7 B;  1F9J A;  1GUA B;  3P1M A;  1GPX A;  3ZNI D;  1MPE A;  4ZRQ A;  2L83 A;  2PE9 A;  2N1W A;  3VRA B;  1E0Z A;  1P9D U;  1LQB A;  2BS3 B;  2KMC A;  4KGS A;  5G5H A;  3SU8 X;  1WGG A;  1J7A A;  4MEM A;  1WH3 A;  2INN E;  2MA9 B;  3Q3F A;  4ZHP A;  3UGB B;  1L6U A;  4K7W A;  2EMS A;  4ZHO A;  4MAC A;  2BT6 A;  3T3O A;  4DHZ E;  1D5M C;  1YIW A;  4DDG D;  1WJ6 A;  3DDC B;  3V3X A;  1WGK A;  5H92 C;  3PZ8 A;  1KJT A;  1CMX B;  4ITK A;  5JXV A;  3TL5 A;  4RGM A;  4HDQ A;  3M95 A;  2LGY A;  3ZKJ C;  1L4D B;  4DQO C;  1C9F A;  3JSV B;  2KQ7 A;  2KTR B;  4HCN B;  4MGK E;  1OQQ A;  1J7B A;  3KVF B;  3NG0 A;  3PSE B;  1J8C A;  2ONQ A;  3VHT C;  4CQN A;  3AEA B;  4AP4 C;  1V49 A;  2V3P A;  3H7P A;  3ZDM C;  4TQ0 A;  1WR6 E;  2DX5 B;  2CU1 A;  4GIV A;  4GDK A;  3ZYY X;  2KNB A;  2LVP A;  3OG5 A;  2QSD A;  1PGX A;  5JHB A;  4II3 B;  2ZNV C;  3LXF A;  3U52 E;  1WGD A;  3MFG A;  3TEZ A;  1S1Q B;  3AE8 B;  3KWL A;  2AYO B;  1V8C A;  4DXF A;  2G4S A;  5HI1 A;  3N1X C;  3BY4 B;  3W1S A;  3RPF C;  4DXG A;  5IA7 A;  1ZE3 D;  1WM3 A;  3DBR B;  1KOT A;  3RNF C;  1JCK B;  3VVW B;  1UEL A;  4B95 A;  5GMV A;  4DDI D;  3KUZ A;  3QC8 B;  2WS3 B;  1DGJ A;  1KRH A;  2MBQ A;  1CK1 A;  5HG2 A;  4EUT A;  2BF8 B;  3GB1 A;  3BII D;  4W9D A;  2L32 A;  4S17 A;  1HQR D;  3W5U B;  1YN5 A;  4WH4 A;  1JQ4 A;  3IG3 A;  2CJO A;  2N7E A;  1T0Q C;  2QJL A;  3ZJU A;  3ZNZ B;  4K7S A;  3BYT B;  1CQV A;  1A70 A;  4K3C A;  3I9V 1;  2L3Z A;  2IGH A;  2WU5 B;  2BS2 B;  3H9D A;  1NDD A;  1KM7 A;  3ECI A;  3UIO B;  2JSV X;  5EE9 A;  1MG8 A;  1PYW D;  1JML A;  2W54 A;  4JWU C;  3U7Z A;  4BFR A;  1P98 A;  2WXH A;  2PJH A;  4Q2J A;  1RFA A;  1VLB A;  1X1M A;  2CKH B;  1WRI A;  4F7Z A;  2L0T A;  1D3Z A;  4W9L A;  3B2G A;  4EZK A;  4USA A;  4J3O D;  4W9H A;  2AX5 A;  1WXQ A;  3W2D A;  1VZ8 A;  2MBH A;  1WWT A;  3A4R A;  3JSV A;  1TGZ B;  2J52 A;  2KTR A;  2DWQ A;  2FCS A;  4FJY A;  2OJR A;  3AEG B;  4M0W A;  1C3T A;  1IBX A;  2L05 A;  1SE9 A;  4FBJ B;  1ET6 A;  1WRD B;  1RAX A;  3VH4 B;  2LRU A;  2TSS A;  1K52 A;  1KF6 B;  2ZZP B;  2L52 A;  1WI0 A;  4C80 A;  2RGF A;  3S2A A;  2KAJ A;  4RFB A;  2KJR A;  2ACZ B;  5L95 C;  2M56 B;  2HJ8 A;  1MFW A;  2ZJD A;  1XCQ L;  2KWV B;  1VJK A;  2LRW A;  5G5G A;  1FRD A;  1XEE A;  4ANV A;  1TKG A;  4JIO U;  4TMA B;  3L4P A;  2RDH A;  4CHK A;  3D32 A;  1L7Y A;  4K1R B;  5D7G A;  1K8R B;  2BYE A;  2JRI B;  2INP E;  3N9Y C;  4ASW C;  2JQR B;  1WYG A;  5KHO A;  4B0E A;  3DPD A;  3ETR A;  3NJT A;  5FK9 C;  1C4A A;  2W9N A;  4ZRJ A;  1ZOY B;  3BVM A;  4XC2 A;  3H1U A;  2X38 A;  3ONS A;  1H8C A;  1T0R C;  5IP4 D;  5DPW A;  4CO7 A;  1J7C A;  1F1H A;  2QEJ C;  2AQ3 B;  3V62 A;  4AOF A;  2G45 B;  3AE2 B;  2WDQ B;  4REZ A;  1FFU A;  1UD7 A;  4OVU A;  2KHW B;  4LNO A;  4C00 A;  3VUX A;  2VRR B;  1ZUD 2;  4KGR A;  2V9H A;  3RMK C;  5KHQ A;  5JH5 C;  2WHI A;  4IWP A;  2JZZ A;  1FIQ A;  4YSZ B;  4MEL A;  4K7U A;  1E8W A;  3I63 C;  1JWM D;  2K1F A;  1HEZ E;  5C1Z A;  3A9J B;  3DWM A;  3APF A;  2PMV A;  2R61 A;  1AYF A;  1F77 A;  1YOV B;  3ZO5 B;  3H7S A;  3AE9 B;  2Z0D B;  2Q5W D;  2K25 A;  1WSP A;  3LB8 C;  3NRZ A;  3K9P B;  4P1C C;  2FID A;  3SDL C;  4B9K A;  2OJW A;  4OW0 A;  3P4Q B;  2WDR B;  1OQY A;  4YSY B;  3WAL A;  1LO5 D;  3NHE B;  1TBE A;  3AXC A;  1N5W A;  1QOG A;  3RN9 C;  1D5Z C;  4YTP B;  5AZH A;  1EO6 A;  1NVI D;  1MHX A;  2W55 A;  3U4E G;  1FXI A;  3KH0 A;  2MX2 A;  3MHZ A;  4C56 C;  3SEB A;  2KN4 A;  1R4M I;  2J0J A;  3AEE B;  1RYJ A;  2DYB A;  4XDC A;  5MPO A;  1UGJ A;  5HFY A;  3RUL A;  4NQL B;  3JYU A;  3TEX A;  4HLE A;  1DOX A;  4KDL B;  2E3T A;  1SIF A;  2C5L C;  4MH8 A;  3V6C B;  4S0R A;  1Z5S B;  1ZXH A;  1IGD A;  4DXA B;  4M01 A;  1V97 A;  4BOS C;  2KWC A;  3DVG Y;  3EHV A;  4BBN C;  2WXI A;  5JHA A;  2FCM A;  5D3D A;  3LJ3 A;  3AE4 B;  2ZCB A;  1V80 A;  2ZW1 A;  2LZ6 A;  1SGH A;  3I5J C;  4G3X B;  1G6J A;  1C78 A;  1B1Z A;  3X0W A;  1VZ7 A;  4A6Q A;  2BYF A;  2C7M B;  2V3N A;  3PRP B;  3C8Y A;  4XX5 A;  1EWY C;  4RCO A;  3ZW3 A;  1LM8 B;  5J18 A;  4LDT D;  3ZUN A;  2NTS A;  2KJH B;  4A90 A;  4ZRP A;  1XLN A;  1JRP A;  3V6E B;  4ZRI A;  3ZVV A;  2KC2 A;  1AW7 A;  2HD5 B;  2WP9 B;  3APC A;  4EZJ A;  3H8H A;  2N1V A;  1WE6 A;  2LXA A;  3WIM A;  3MC0 B;  2DYM A;  2GMI C;  4YSX B;  1P7F A;  2XK5 B;  1QKZ A;  1WY8 A;  3RNA C;  1GG3 A;  3C0R B;  5J2R A;  2QIE B;  1HTQ A;  1LXD A;  2RMM A;  2BWF A;  1V81 A;  2KFJ A;  4EZL A;  3DVG X;  4NJ6 A;  2ASQ A;  2DEN B;  4AUQ C;  1A5R A;  1WGY A;  2DZM A;  1FM0 D;  1C4C A;  4FAD A;  4PK1 A;  2KOX A;  2D5G A;  1TY2 A;  5DPS A;  4ZDV A;  1FD6 A;  2J53 A;  2WDV B;  3N1Y C;  3A9J A;  1WX8 A;  3AEC B;  1TKY A;  1UF0 A;  3QAR A;  3ML8 A;  5CHF A;  2OOB B;  2BBC A;  1P3Q U;  1VD2 A;  1UBI A;  5EE1 A;  1SF0 A;  2NTT A;  3Q2A C;  4YTM B;  2KWU B;  3R2T A;  1PUT A;  5E6J A;  4KSK C;  2VH1 A;  2HDE A;  2L0F A;  2N9K A;  3HVD A;  2BKF A;  2KDM A;  2K6Q A;  3VTU A;  3JW0 X;  5CTR C;  1QOF A;  2QIL A;  3HUI A;  3KYC D;  2GBK A;  3L17 A;  3TJP A;  2DHZ A;  4MSM B;  2LFI A;  2JYT A;  2JT4 B;  2REX A;  3HRD D;  4EEW A;  2SEB D;  2HE7 A;  3W1S C;  4RH6 A;  1PGB A;  3RT3 B;  5E6P A;  4W9C A;  1WJ4 A;  4NJ7 A;  1Q1O A;  1I35 A;  1EU4 A;  1YD8 U;  2K8H A;  4WQO B;  1GAQ B;  3P4P B;  2MQJ A;  4US9 A;  2YVC A;  3I57 A;  1XQQ A;  4XDD A;  2IJ0 A;  2I1J A;  4J6I A;  1L5P A;  2FNJ B;  4IW0 A;  3VTW A;  4LJP B;  4WWN A;  1R4N I;  4E74 A;  1GJZ A;  1QT9 A;  1K53 A;  3TUO A;  1XCT L;  2Y5C A;  5DPT A;  2PVG C;  1FRR A;  1FEH A;  1JRU A;  3DCG A;  3IFW B;  4BVU C;  1YX6 B;  3ZNG C;  4C7Y A;  4RNA A;  4JWS C;  1QIL A;  2KWD A;  3HM6 X;  1IPG A;  2LWP A;  2V1Y A;  3VR9 B;  1VR9 A;  2BVC A;  2W3R A;  2XK5 A;  2JVC A;  3DVN V;  3TMP B;  2LI5 A;  2AEH A;  2WXN A;  3BIN A;  3U30 A;  1ROE A;  2NPT B;  3WCQ A;  2KAN A;  1L4Z B;  5LLI A;  4FLH A;  4ANX A;  4TKN A;  4MJS B;  3HVZ A;  3L0W B;  2WXO A;  3K9O B;  3SD5 A;  2WXF A;  3EGR A;  1NEN B;  3CIR B;  1GNU A;  5BMG A;  1GOZ A;  3P63 A;  2V3S A;  3DBL B;  1GC6 A;  3N1Z C;  1JWB D;  2Z8L A;  3Q8C A;  4A55 A;  4KDI C;  3FIL B;  3RD2 A;  2QC8 A;  1DYQ A;  3QA8 A;  4GSW A;  3RNB C;  1N60 A;  2IDY A;  4GB9 A;  3VFK A;  4EE2 A;  5CX3 A;  4C4V B;  4DK5 A;  3GE3 C;  2MWS B;  3VH3 B;  1TS5 A;  2W82 A;  1QZE A;  3P2B A;  1STE A;  2I1K A;  3GZN I;  2CS4 A;  2LXC A;  4IDI A;  4GDL A;  2RPQ A;  3EUB 2;  3GP7 A;  2R2Q A;  4LDT B;  3EA6 A;  4OZB A;  4P16 A;  1QOB A;  5BYQ A;  1UNS A;  2BB5 A;  2LVQ A;  3DVN U;  2LGI A;  2LHD A;  2VZK D;  3N20 C;  1PQS A;  1HTO A;  1SSN A;  5AEK B;  1F0Z A;  3PRE A;  3Q14 C;  5IKC M;  3ZGZ A;  1D4B A;  2VH2 A;  2EKI A;  3AE6 B;  3L10 B;  3NS8 A;  5AZF A;  3OJ4 B;  4BZA A;  2MEK A;  3L54 A;  4KKJ A;  1UWM A;  2Y5B B;  1DOI A;  3MJW A;  5AUK A;  4BKS D;  2Y3A A;  3AEF B;  2KO3 A;  3R7Q A;  2WU2 B;  2DZI A;  2EEL A;  2BYT A;  4HCP B;  3A4S C;  1NBF C;  1E5W A;  4RM8 A;  2CHZ A;  2LGS A;  3V61 A;  3NZ3 A;  1XXG A;  3NY5 A;  3PZ7 A;  1Y56 A;  3ML9 A;  4DHZ B;  2ZEQ A;  5E6O A;  2KJ6 A;  1WZ0 A;  3IBE A;  2JY6 A;  3ALB A;  3QWZ B;  3ZIM A;  2NPT A;  5CHV C;  1HA5 A;  3AMZ A;  4B6W A;  4KGT A;  3QX1 A;  2M0A A;  2OED A;  1WMH B;  4EFO A;  4MJS A;  2JWU A;  2MLB A;  1T3Q A;  3WAM A;  3QAQ A;  1QOA A;  4FHJ A;  3NVZ A;  4KIK B;  2KYW A;  2WX1 A;  3GOE A;  2WXL A;  3CMM B;  4WWP A;  4XGA B;  3UIN B;  1ET9 A;  2FCN A;  1L0X B;  2CHX A;  2GBJ A;  1YX5 B;  2ZPY A;  1WZ3 A;  2EMT A;  1WGH A;  2JYE A;  2IGD A;  1FFV A;  1BXT A;  1RRB A;  2G1E A;  1TS4 A;  1WXM A;  2RDG A;  2MP2 B;  1V2Y A;  4IC7 B;  2RD0 A;  4C4V A;  3DBR I;  5HKH A;  3APD A;  2NR2 A;  3KQ4 A;  4WJP A;  4FHK A;  1V1P B;  4NZL B;  1N63 A;  3KWV A;  1WM2 A;  1OEY J;  4LNF A;  2GBR A;  1R7S A;  1LFD A;  5LXI B;  3LDZ E;  1R4M B;  4LNK A;  2HJ1 A;  4M00 A;  2CU3 A;  2WGS A;  3IHP C;  3IAS 1;  2MBO A;  4RF1 A;  3URY A;  2KQ4 X;  4FXC A;  4WAA A;  3R7R A;  3I3T B;  3KUC B;  4KZC A;  1JAL A;  1EWC A;  3Q3N C;  4ZRK A;  1SXT A;  2KMM A;  1WJU A;  3MC8 A;  3TEW A;  2KX3 A;  2WWZ A;  1JW9 D;  2K22 A;  3PO0 A;  3PHW B;  2RSU A;  1OQR A;  4KV2 A;  3A1Q B;  2JZ3 B;  3PPA A;  3AEB B;  3R2I A;  2L76 A;  5G2N A;  1IUE A;  1P0R A;  4K81 A;  3SFD B;  4AJY B;  1TS2 A;  1PDX A;  3B2F A;  2OHF A;  1ACC A;  2L1A A;  1KFY B;  4G0N B;  3UQB A;  4RF0 A;  4KX6 B;  4PYU A;  4BOZ B;  2J0K A;  1OEY A;  3PTF C;  1TY0 A;  2H88 B;  3EC8 A;  2AWT A;  3H6N A;  4AWJ A;  2XNA C;  2K9X A;  3NS1 A;  1KLV A;  3IAM 1;  2J7Q B;  2JUO A;  2O6V D;  3N30 A;  1MVK A;  2W3S A;  1WFY A;  2KN5 A;  2Y5P A;  5DCN A;  2YEP F;  1FNU A;  1QQR A;  2JWZ A;  4ACF A;  3AB5 A;  3AU4 A;  2DNF A;  2UWQ A;  4NNJ B;  1T5X D;  2KLG A;  4JL9 A;  2D3B A;  3N3K B;  2D2Q A;  5BYR A;  1ISN A;  4ANW A;  1SE4 A;  3VUY A;  2YLM A;  1F2R C;  1V5T A;  3U7D A;  4JPS A;  3IT4 B;  3DHI C;  4KIK A;  2M8S A;  5T8I A;  1WXV A;  2D07 B;  4WJQ A;  4A3O A;  1SE3 A;  3WAP A;  4N9F 4;  1JWS D;  4DBG A;  3MP9 A;  2PPH A;  1E6E B;  4PS8 A;  3Q8F A;  4MGZ E;  1L2N A;  2PTL A;  1TS3 A;  4M8N A;  4TQ1 A;  2M17 A;  3HHM A;  2PKO A;  5I4D A;  4O1N A;  1V5O A;  3NVY A;  3KW5 B;  3QHT A;  2VZK B;  2WYQ A;  2KX0 A;  1E8Y A;  1ZGU B;  3PV1 A;  4WUR A;  2K39 A;  2HTM E;  1L0Y B;  2B76 B;  1E90 A;  2PEA A;  5L83 A;  1OGW A;  2A5U A;  4OZA A;  5D6J B;  1YJJ A;  1V1P A;  3VR8 B;  2G3Q B;  3ZXR A;  3Q69 A;  4AJW A;  3DHG C;  4RGO S;  1BUI C;  1FNW A;  2RDB C;  2JX5 A;  5C2T B;  4JLC A;  4XWW A;  3EFC A;  3NUH B;  3P4R B;  1XLP A;  1WYW B;  4ANU A;  1AN8 A;  2GOW A;  3PRZ A;  2DYO A;  2XEW A;  2KK8 A;  4ICV A;  1TIF A;  2JRH A;  4HXD A;  4GU2 A;  1QF6 A;  3AE5 B;  4LNI A;  2K5P A;  2QDF A;  1NYR A;  2D3C A;  3R66 C;  1C1Y B;  4BAX A;  2LGD A;  4FJZ A;  3ZQ4 A;  4F8C B;  4NAW B;  3WAN A;  2RR9 A;  1L0V B;  3A1Q A;  2CHW A;  3L16 A;  2QMT A;  2A4Z A;  1N6Z A;  2Z0E B;  1ZDV A;  3QJZ A;  1I4X A;  3KYD D;  4FN2 A;  3ZLZ A;  2D3A A;  2NMQ A;  2WXG A;  3VQI A;  2IO0 B;  1E9M A;  4HPL B;  5BMH A;  3BZD B;  3ZNH B;  1S3S G;  2MJ3 A;  1VDV A;  3DHH C;  3FKY A;  2JPH A;  3UQA A;  2MCN B;  5TR5 A;  1IP9 A;  4MDK E;  4LNN A;  1D6E C;  1EM7 A;  4JE3 B;  4LCD E;  3OAW A;  3NVW A;  1GB4 A;  3BVG A;  2ZVO A;  4WJN A;  3A9K B;  4R3D A;  4A8X C;  2PLP A;  2PVO D;  3PHX B;  3KUD B;  1YN3 A;  5JZE B;  3TEY A;  3OWE B;  2X8X X;  2JF5 A;  2GBN A;  3TIX A;  5DPR A;  2MHJ A;  2WXM A;  1I4H A;  3VXW A;  4URK A;  2C9W B;  2LGX A;  1YNT E;  4YXD B;  1C76 A;  5C3J B;  2BWE S;  2BGF A;  1YQ4 B;  4YTN B;  4N58 A;  1GC7 A;  1FXT B;  4MSQ B;  2MW5 A;  2AQ1 B;  2WLB A;  2WXQ A;  1XLQ A;  3DOW A;  2KFK B;  3E9S A;  4HPP A;  3E56 A;  2K0P A;  1M94 A;  2IPK D;  3AE1 B;  1I4R A;  3ZTC A;  4GLS C;  4IM0 A;  1BT0 A;  4WAF A;  1YJ1 A;  4A20 A;  1XF5 L;  4FA6 A;  4ZYN A;  4B0M A;  4HDO A;  2L8J A;  2KVR A;  1ESF A;  3GZN B;  2MSE D;  3DWG C;  4BKS A;  1RFK A;  1L6V A;  4LTU A;  4L1B A;  4OVZ A;  4BBN F;  2PIA A;  3V05 A;  2RPV A;  2IND C;  1SJH D;  4RGT A;  2DAJ A;  2IYD B;  3N32 A;  2N0S B;  1E7V A;  3Q8B A;  3ZTD A;  2KVZ A;  3ZXV A;  4NQK E;  4ZYS A;  2MBB B;  3WAO A;  4BKT A;  1WR1 A;  4P7I A;  2KDI A;  1Q0W B;  4NAW A;  2JU6 X;  5LNK 1;  2BB6 A;  4RGN A;  1I4P A;  2O6V B;  3X23 A;  2V4L A;  1RLF A;  3B9J A;  2XN9 C;  5GXG B;  5FKA C;  1T0S C;  2KC1 A;  1WGR A;  2C7H A;  1KLG D;  2MRP A;  1I4Q A;  1NYQ A;  3HM3 A;  2QHO A;  2XBB C;  1P7E A;  1E7P B;  3U2S C;  5AUI A;  4PYZ A;  4MT5 A;  2FAZ A;  1Y8R C;  1FO4 A;  3L13 A;  3ZRC A;  5D3I B;  1E8X A;  4PS3 A;  3W5V B;  5IO9 A;  2MH7 A;  3BK1 A;  1JWA D;  2NBU A;  1V6E A;  4W9I A;  4NY0 A;  3A9K A;  3PS6 A;  2WXK A;  2J42 A;  3ZJV A;  3FC4 A;  3DBH I;  3L08 A;  1IGC A;  4TV3 A;  3ZJT A;  1ZP0 B;  2K8B A;  2ZNV B;  4M0W B;  4WWO A;  1IBX B;  3HK0 A;  4IWQ A;  3CST A;  5G55 A;  2G4D B;  1UH6 A;  1WX9 A;  4A9A A;  3KLS X;  2J4X A;  3O65 B;  3QIJ A;  2KMA A;  5EDS A;  3J9C A;  1ZPS A;  2I2Y A;  3Q8A A;  3IT6 B;  2KFK A;  2BTE A;  4OHJ A;  1WF9 A;  1DOY A;  4W9K A;  4LK0 M;  4II2 B;  1EU3 A;  3M3J A;  3NVV A;  3AH7 A;  2LAS A;  4M8M A;  4HJG E;  4XZ4 A;  1MI0 A;  2ZCC A;  5FR6 A;  2GI9 A;  4HEA 1;  1RWS A;  5HHD G;  3BVZ A;  3V60 A;  1TKE A;  5AZG A;  2UU7 A;  3FAH A;  2O2V B;  4FJV B;  4HKZ E;  4MGY E;  1VZ6 A;  2SAK A;  4RM9 A;  3PGE A;  2V4I B;  1VCB A;  4DHJ D;  3OJ3 A;  1OFF A;  2NVU I;  4LLG M;  3TCA A;  2MBE A;  1FPY A;  1SIJ A;  4IM2 A;  3AI5 A;  4GXB A;  4P1B C;  3MC9 A;  3QCA A;  1J0G A;  3ZDT A;  2QCZ A;  5LXH A;  3VRB B;  2KT7 A;  2DBY A;  4ARI A;  4IUM B;  4FUL A;  4L2Y A;  2KLC A;  3BYY B;  3RYT A;  3T3N A;  3UI3 A;  4W9E A;  1WXA A;  1TTN A;  2O6V A;  2V0G A;  4EKU A;  4E71 A;  1E7U A;  4HRS A;  1Q5W B;  3U8Z A;  4OVV A;  2MJE A;  3JVZ X;  4YL8 A;  2YEP B;  3R3M A;  1TZO A;  3CSF A;  3RNC C;  4WWM A;  3ENE A;  4GGQ A;  1HZ6 A;  2GBM A;  3NOB A;  5BYS A;  1CZP A;  3HIZ A;  1ZKH A;  2JZP A;  3RI7 C;  2C60 A;  2Z59 B;  1EF1 A;  3O13 A;  3Q3J A;  4W9J A;  2LMC A;  2AL3 A;  2WXR A;  4NPN A;  4IG7 B;  3Q3O C;  1XLO A;  2B3A A;  2KTF A;  4JX1 C;  3RUI B;  3P42 A;  3GS2 A;  3RCZ A;  1V1O A;  5EE3 A;  1YQB A;  2JXX A;  3ABV B;  3M63 B;  1YQ3 B;  3DBL I;  1I42 A;  4KZ0 A;  1ZDX A;  4I6P A;  2WQY B;  4JQW C;  2FUG 1;  3MJ5 A;  2I38 A;  4K3B A;  2LJI A;  1M4V A;  5E6N A;  3FIL A;  1K51 A;  1E10 A;  4AQ7 A;  1T0Y A;  1SBB B;  2DZK A;  4DWF A;  1NEK B;  2PE6 B;  1WXS A; 
#chains in the Genus database with same CATH homology
 3MFG A;  2VZK B;  3TEZ A;  1T6B X;  3AE8 B;  3KWL A;  2HDE A;  2N9K A;  4WUR A;  2HTM E;  1FNV A;  1L0Y B;  1V8C A;  2B76 B;  2KDM A;  3HVD A;  1GB1 A;  4DXF A;  1B9R A;  4OZA A;  1I4G A;  1QOF A;  5HI1 A;  4IOI E;  3W1S A;  3RPF C;  4DXG A;  2QIL A;  1ZE3 D;  4OZC A;  4ARC A;  1YJJ A;  3HUI A;  1C79 A;  1V1P A;  1KLU D;  3VR8 B;  1JCK B;  2LFI A;  3Q69 A;  1FCC C;  2JYT A;  1SEB D;  2CJN A;  4RGO S;  3Q8E A;  3HRD D;  1BUI C;  1FNW A;  2SEB D;  2WS3 B;  4YT0 B;  1SJE D;  1DGJ A;  5C2T B;  2JX5 A;  2LHE A;  4XWW A;  1KRH A;  3NUH B;  2FBW B;  4RH6 A;  3P4R B;  1CK1 A;  1PGB A;  1XLP A;  5HG2 A;  1AN8 A;  1QLB B;  2DYO A;  3GB1 A;  1EU4 A;  3BII D;  2L32 A;  2N9L A;  2FE8 A;  1GAQ B;  1HQR D;  3P4P B;  3W5U B;  1YN5 A;  4US9 A;  4WH4 A;  1QF6 A;  1JQ4 A;  2CJO A;  3AE5 B;  3I57 A;  1PGA A;  2AQ2 B;  4HKQ A;  4XDD A;  2WXP A;  2K5P A;  2QJL A;  3ZJU A;  2IJ0 A;  1NYR A;  3BYT B;  1CQV A;  1L5P A;  1FCL A;  1TYG B;  3ZQ4 A;  1ZXI A;  4NAW B;  1A70 A;  1QT9 A;  1K53 A;  3I9V 1;  3TUO A;  1L0V B;  1XCT L;  2Y5C A;  2PVG C;  2IGH A;  2WU5 B;  2BS2 B;  2WXJ A;  1FRR A;  1FEH A;  2G9H D;  2QMT A;  4KKI A;  1ZDV A;  2JSV X;  5EE9 A;  4C7Y A;  4RNA A;  2PW9 A;  1I4X A;  4JWS C;  1NI3 A;  1TJE A;  2M19 A;  1I7H A;  1QIL A;  2NMQ A;  5BMI A;  1PYW D;  1JML A;  2W54 A;  2KWD A;  4JWU C;  2WXG A;  3U7Z A;  2MJD A;  3VQI A;  2ZW0 A;  2N7J A;  3VR9 B;  1E9M A;  3BWU D;  5TSS A;  5BMH A;  3BZD B;  1VR9 A;  3RFZ B;  2W3R A;  3SFE B;  2MJ3 A;  2WXH A;  1VDV A;  4Q2J A;  1VLB A;  1C4P A;  3R8B A;  1FMA D;  1WRI A;  2WXN A;  1YJI A;  1D6E C;  1EM7 A;  1XO3 A;  4JE3 B;  1ROE A;  4D2K A;  3NVW A;  3WCQ A;  3B2G A;  3BK2 A;  3BVG A;  1GB4 A;  4USA A;  1L4Z B;  4J3O D;  4AS1 A;  2AX5 A;  1WXQ A;  3W2D A;  1VZ8 A;  4R3D A;  2ON8 A;  4A8X C;  1WWT A;  3HVZ A;  2PLP A;  1K50 A;  2PVO D;  1YN3 A;  2J52 A;  2DWQ A;  2WXO A;  3OWE B;  3TEY A;  2WXF A;  2KAC A;  3AEG B;  1C77 A;  1JRO A;  3EGR A;  4M0W A;  1NEN B;  1YMH E;  4XE0 A;  3CIR B;  4US8 A;  2WXM A;  5BMG A;  1IBX A;  1GOZ A;  1I4H A;  4ZOH C;  3P63 A;  4IKG A;  4YWG G;  4MM3 B;  2GRI A;  1YNT E;  1ET6 A;  4YXD B;  1C76 A;  5C3J B;  1JWB D;  1YQ4 B;  2Z8L A;  1N61 A;  4YTN B;  3Q8C A;  1AWD A;  3TSS A;  3P4S B;  4N58 A;  4A55 A;  1BML C;  2TSS A;  1K52 A;  2AQ1 B;  3FIL B;  4N6E B;  1KF6 B;  2WLB A;  2WXQ A;  1DYQ A;  1XLQ A;  1YN4 A;  2L52 A;  2WNM A;  1VRA B;  1N60 A;  3E9S A;  3E56 A;  2IDY A;  4C80 A;  2K0P A;  3AN1 A;  4EE2 A;  2KAJ A;  4RFB A;  5FR3 A;  2JXT A;  2ACZ B;  2IPK D;  3AE1 B;  1I4R A;  2M56 B;  1HZ5 A;  4GLS C;  1TS5 A;  2W82 A;  1XCQ L;  1VJK A;  1STE A;  4WAF A;  1XF5 L;  5G5G A;  2BS4 B;  4IDI A;  1FRD A;  1XEE A;  3EUB 2;  3GP7 A;  4B0M A;  1TKG A;  3EA6 A;  4TMA B;  4OZB A;  3L4P A;  4P16 A;  1QOB A;  5BYQ A;  1UNS A;  4H2A A;  1ENF A;  2BB5 A;  1ESF A;  2RDH A;  3DWG C;  2LGI A;  2LHD A;  1PFD A;  2VZK D;  2ICI A;  1RFK A;  1L6V A;  4LTU A;  4WIP A;  4L1B A;  4P6V F;  4OVZ A;  5D7G A;  2PIA A;  3V05 A;  2RPV A;  1SJH D;  4RGT A;  1SSN A;  2INP E;  3N9Y C;  2N0S B;  3Q8B A;  1F0Z A;  2JQR B;  1WYG A;  4B0E A;  4NAM A;  3ETR A;  5FK9 C;  4ZYS A;  1C4A A;  1Q10 A;  3ZGZ A;  1N5X A;  1D4B A;  1ZOY B;  3BVM A;  2EKI A;  3AE6 B;  2X38 A;  4C7Z A;  2JU6 X;  5LNK 1;  2BB6 A;  4RGN A;  5EE0 A;  1J7C A;  1I4P A;  2MEK A;  4KKJ A;  2LEK A;  1UWM A;  2QEJ C;  1JWU D;  4XWT A;  1DOI A;  4UDU C;  2AQ3 B;  2BW2 A;  3AM9 A;  5AUK A;  3B9J A;  2XN9 C;  5GXG B;  5FKA C;  2Y3A A;  3AE2 B;  2WDQ B;  4REZ A;  3AED B;  3AEF B;  1UUP A;  1FFU A;  1KLG D;  1SE2 A;  2WU2 B;  2EEL A;  1I4Q A;  2BYT A;  1NYQ A;  1P7E A;  3AV8 A;  1E7P B;  1ZUD 2;  1UWX A;  4KGR A;  3U2S C;  3NZ3 A;  5AUI A;  4NJC A;  1XXG A;  4MT5 A;  3PZ7 A;  1Y56 A;  1F2R I;  1FIQ A;  4YSZ B;  1FO4 A;  5D3I B;  2IGG A;  3W5V B;  1CJE A;  1JWM D;  1HA5 A;  2MH7 A;  1HEZ E;  3AMZ A;  4KGT A;  3BK1 A;  1JWA D;  2M0A A;  3DWM A;  2OED A;  2PMV A;  2R61 A;  1AYF A;  1F77 A;  2WXK A;  1D5X C;  2J42 A;  3ZJV A;  3FC4 A;  3AE9 B;  2JWU A;  1IGC A;  1HXY D;  1T3Q A;  1WSP A;  2Q5W D;  2DLB A;  3ZJT A;  1QOA A;  3LB8 C;  1ZP0 B;  3NRZ A;  3NVZ A;  1FXA A;  2GB1 A;  4OW0 A;  1IBX B;  2WXL A;  3P4Q B;  2WDR B;  1KTK A;  4YSY B;  4GDK B;  1LO5 D;  2LUM A;  1ET9 A;  4A9A A;  1L0X B;  1N5W A;  1QOG A;  1D5Z C;  3KLS X;  4YTP B;  2J4X A;  2JYE A;  2IGD A;  1SB3 C;  1FFV A;  3CWI A;  3W9C B;  1BXT A;  1MHX A;  1NVI D;  2W55 A;  4TSS A;  3U4E G;  3J9C A;  2G1E A;  1TS4 A;  4HRO A;  1FXI A;  1ZPS A;  2I2Y A;  3Q8A A;  3IT6 B;  2RDG A;  2K3U A;  3SR6 A;  2BTE A;  4OHJ A;  1MHH E;  5H8Y E;  3MHZ A;  1DOY A;  4C56 C;  3KQ4 A;  3SEB A;  2KN4 A;  3LYY A;  4LK0 M;  3AEE B;  1KH0 A;  4N59 A;  1EU3 A;  1RYJ A;  1N62 A;  1V1P B;  3NVV A;  3AH7 A;  4XDC A;  5MPO A;  4NZL B;  1N63 A;  1UGJ A;  3KWV A;  5HFY A;  4HJG E;  3TEX A;  1MI0 A;  1DOX A;  2GI9 A;  4HEA 1;  1R7S A;  2E3T A;  4MH8 A;  1RWS A;  5HHD G;  3IXS A;  2H89 B;  3BVZ A;  1TKE A;  3FAH A;  1ZXH A;  2CU3 A;  4HKZ E;  2E6X A;  1IGD A;  4GDL B;  4PT5 A;  1VZ6 A;  1V97 A;  2SAK A;  2V4I B;  3IAS 1;  4RF1 A;  2WXI A;  1OFF A;  4LLG M;  4L23 A;  5D3D A;  3URY A;  1SIJ A;  2KQ4 X;  3AE4 B;  4WQM A;  4FXC A;  2ZW1 A;  1JAL A;  1EWC A;  1RM6 C;  1SXT A;  2KMM A;  3TEW A;  1JW9 D;  1C78 A;  2K22 A;  1B1Z A;  3PO0 A;  3AE3 B;  3VRB B;  3AE7 B;  1VZ7 A;  2DBY A;  4A6Q A;  1OQR A;  4ARI A;  3P1M A;  2V3N A;  4L2Y A;  1GPX A;  1MPE A;  3BYY B;  4ZRQ A;  2L83 A;  3C8Y A;  1EWY C;  4RCO A;  3AEB B;  3VRA B;  3R2I A;  3T3N A;  1E0Z A;  3UI3 A;  2BS3 B;  2NTS A;  4KGS A;  5G5H A;  4A90 A;  4ZRP A;  1XLN A;  1JRP A;  1J7A A;  2V0G A;  1IUE A;  1AW7 A;  2INN E;  3SFD B;  4HRS A;  4ZHP A;  2WP9 B;  1L6U A;  3H8H A;  1TS2 A;  4ZHO A;  3MC0 B;  2DYM A;  2MJE A;  1PDX A;  2BT6 A;  4MAC A;  4YSX B;  3B2F A;  2OHF A;  2YEP B;  1ACC A;  1P7F A;  3T3O A;  1D5M C;  1TZO A;  2L1A A;  1QKZ A;  1KFY B;  4RF0 A;  3V3X A;  4WWM A;  4KX6 B;  1WGK A;  5H92 C;  3PZ8 A;  1HZ6 A;  2QIE B;  2RMM A;  5BYS A;  1CZP A;  1TY0 A;  2H88 B;  4ITK A;  2JZP A;  5JXV A;  2XNA C;  2K9X A;  3NS1 A;  4RGM A;  3IAM 1;  3O13 A;  1FM0 D;  2LMC A;  2WXR A;  1C4C A;  1MVK A;  1XLO A;  2W3S A;  2Y5P A;  4JX1 C;  2D5G A;  2YEP F;  1TY2 A;  3P42 A;  1FNU A;  3GS2 A;  1QQR A;  1FD6 A;  1L4D B;  1V1O A;  5EE3 A;  4DQO C;  2J53 A;  2WDV B;  3AB5 A;  1C9F A;  3ABV B;  1T5X D;  1OQQ A;  1J7B A;  3AEC B;  1TKY A;  2ONQ A;  1YQ3 B;  5BYR A;  4CQN A;  3AEA B;  2BBC A;  1SE4 A;  1ZDX A;  1F2R C;  2V3P A;  2WQY B;  2FUG 1;  3IT4 B;  4JPS A;  5EE1 A;  4TQ0 A;  1SF0 A;  3MJ5 A;  5T8I A;  2I38 A;  2NTT A;  2LJI A;  1M4V A;  1SE3 A;  3FIL A;  1K51 A;  4YTM B;  1E10 A;  1JWS D;  3ZYY X;  3MP9 A;  1E6E B;  4AQ7 A;  3Q8F A;  2QSD A;  1PGX A;  1SBB B;  2PTL A;  1PUT A;  1TS3 A;  3R2T A;  4TQ1 A;  3LXF A;  2PKO A;  1NEK B;  5E6J A;  5I4D A;  4O1N A;  3U52 E;  3NVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...