1FMAD

Molybdopterin synthase (moad/moae)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
b'MIKVLFFAQVRELVGTDATEVAADFPTVEALRQHMAAQSDRWALALEDGKLLAAVNQTLVSFDHPLTDGDEVAFFPPVTGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOLYBDOPTERIN CONVERTING FACTOR, SUBUNIT 1
publication title Crystal structure of molybdopterin synthase and its evolutionary relationship to ubiquitin activation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 22
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2000-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fmaD00
1WWTA 2G1EA 2JQRB 4YSXB 1B9RA 1TYGB 3AEBB 1N63A 1TJEA 2ACZB 3VRAB 1VJKA 2KMMA 2BT6A 3AB5A 1FFVA 4HROA 5EE9A 3AE9B 2B76B 3B2FA 1VLBA 2MH7A 1ZOYB 3KWLA 3NVVA 1A70A 1E0ZA 4ZHPA 1N61A 1FIQA 2DWQA 2PVOD 1N62A 3AEFB 1J7CA 3HRDD 2K9XA 3P4PB 1XLQA 3AV8A 2WDRB 1YJIA 3AEEB 1FRDA 1J7BA 2HTME 1AYFA 3AE3B 1I7HA 3VR8B 4LTUA 1NI3A 1SIJA 1N5XA 1OFFA 1YQ3B 2BS2B 2PVGC 3EUB2 4WQMA 5G5HA 1L5PA 3VR9B 1JWBD 1F0ZA 1KF6B 1QT9A 3AN1A 4KX6B 1TKEA 3FAHA 4YSZB 2WQYB 4US9A 2JX5A 4N58A 4ZHOA 1WRIA 2L52A 4US8A 1KRHA 2FBWB 3CIRB 1PFDA 3NVZA 2W3SA 3W5UB 3AE4B 1ZP0B 1YJJA 1SF0A 1E9MA 1JW9D 2W54A 2Y5CA 1DOYA 1VDVA 2DBYA 4YTMB 1QOAA 5AUIA 1L6VA 1NEKB 1XLOA 3AE7B 3P4QB 3BIID 3AE1B 1NVID 1N60A 1IUEA 1YQ4B 4YTPB 5AUKA 1CZPA 4C80A 2MJEA 2WU5B 3DWMA 3NRZA 3AMZA 4JX1C 4JWUC 3AECB 2W3RA 4JWSC 1QF6A 1RWSA 5EE1A 2K5PA 1WYGA 3AE8B 1WGKA 2M19A 3NVWA 2CU3A 1JALA 1RYJA 1KFYB 4IDIA 1JWAD 1QLBB 2LEKA 2MJ3A 1E10A 1V97A 1AWDA 2AX5A 4C7YA 1JRPA 1ZUD2 1ZXIA 4N59A 3AE6B 3AEGB 1NENB 1E7PB 3FC4A 3SR6A 4A9AA 3CWIA 4YSYB 2H89B 1OQQA 2QIEB 1NYQA 1OQRA 3B9JA 3ZYYX 1ROEA 4ZOHC 1NYRA 3ABVB 3LB8C 1RM6C 4YXDB 3P4SB 2W55A 2EKIA 1GAQB 1TKYA 1V8CA 2WDQB 2Q5WD 5H8YE 1TKGA 3WCQA 1FFUA 3AH7A 3P63A 2WP9B 1T3QA 1PUTA 2M56B 2WLBA 3SFDB 4YTNB 1CJEA 1FO4A 2OHFA 1E6EB 2MJDA 3AE5B 3DWGC 5H92C 3NVYA 1UWMA 1DOXA 2QJLA 5C2TB 3W5VB 3AEDB 1QOGA 3W9CB 3AM9A 1EWYC 2WDVB 3P4RB 1XLNA 3RPFC 3P1MA 2WU2B 1L0VB 1GPXA 5C3JB 2E3TA 1JROA 5MPOA 2PKOA 2BS4B 1DOIA 3LXFA 2H88B 4FXCA 3NS1A 2L83A 4ITKA 2WS3B 1R7SA 5G5GA 1DGJA 1J7AA 5EE0A 3VRBB 4N6EB 1FXIA 4C7ZA 3ETRA 3AE2B 1XLPA 4USAA 4P6VF 2PIAA 1PDXA 3HVZA 1FM0D 1XO3A 2N0SB 2CJNA 2KAJA 4YT0B 2BS3B 5GXGB 1FRRA 1L6UA 4HRSA 1JQ4A 1WXQA 1FMAD 3AEAB 3B2GA 3L4PA 2CJOA 2K22A 3PO0A 3HUIA 1QOBA 1RFKA 1FXAA 1N5WA 1SB3C 1QOFA 3SFEB 5EE3A 4WWMA
chains in the Genus database with same CATH superfamily
3WAPA 3ZIMA 1FFVA 2KK8A 3MC8A 1F52A 2FCQA 1M4VA 4L23A 5IOIA 2PMVA 2FNJB 5BMGA 1N62A 3IT4B 4IUMB 5DCNA 1LQBA 2WDRB 3VAWA 1T0QC 1T0SC 3VR8B 1SIJA 2YEPB 5G5HA 1P7FA 3I3TB 1KF6B 4YSZB 4JIOU 2CHWA 4NY0A 1ZDVA 2KLGA 1ENFA 2K0PA 4NQKE 3AE7B 1UH6A 2LXCA 1I35A 3DWMA 4JX1C 4FJZA 4CQNA 2KD0A 3NVWA 3TJPA 3DPDA 1UD7A 2RPVA 1I42A 1BMLC 1JWAD 4DXAB 3J9CA 1AWDA 2WNMA 4ZOHC 5BYQA 5L95C 4F1SA 4FHJA 4J3OD 2KWVB 4K7SA 4WIPA 3BYYB 2KKCA 2WP9B 3X23A 1BXTA 4M02A 3IT6B 3APFA 4HK2A 1WXVA 2KJHB 1RAXA 1L0VB 2E3TA 2KX0A 2L83A 4OZCA 4D2KA 3FKYA 2PIAA 5IN7A 3AI5A 4GDKA 2DNFA 2J53A 4HCNB 3AEAB 3PO0A 1N5WA 1VRAB 1SB3C 1HTQA 2AQ3B 5BYSA 3RULA 1N63A 4DWFA 2KMMA 5IO9A 3CSTA 4BAXA 2XEWA 4ZYNA 3DBHI 1UBIA 3P4PB 1I4XA 3JSVB 3ZVVA 3MP9A 3W1SA 4J6IA 3PT2B 4ZRJA 4N58A 5BO4B 2O2VA 2RDGA 3AE4B 4A3PA 3ZNGC 1L6VA 1ET9A 2PTLA 3RNGC 2BKRB 1R4NB 4EOYA 4GSWA 4IDIA 2MX2A 3AE6B 2KFKB 2CU1A 3A33B 1IPGA 3H6NA 3H8HA 5AZFA 2DYBA 2Q5WD 5D6JB 5LXIB 4YTNB 1ACCA 3B1LX 2C7HA 2ZCBA 2DAJA 1BT0A 1C4PA 4C4VA 3MFGA 3U30A 2GLSA 4LJOB 4K7WA 4LK0M 3QARA 1MI0A 1TY2A 3ZUNA 3FILB 5G5GA 5EE0A 2VH2A 3SEBA 2VZKB 1F2RC 1YN3A 1XT9B 2WXFA 5CHVC 4ASWC 1SE3A 1FM0D 1VZ6A 4GDLA 1WXQA 4NPNA 2IZVB 4OVVA 1GC6A 3A9JB 2N9PC 3ZO5B 3EA6A 4FHKA 2G1EA 5HI1A 1GB1A 3Q2AC 1LM8B 2KNBA 3NY5A 4GGQA 2OJRA 3R8BA 1V1OA 1UGJA 4N9F4 2GB1A 4K1RB 3AV8A 2DENB 1ZPSA 2JF5A 3PRMB 4JPSA 2KVZA 2WXNA 4B0EA 1XQQA 2JZZA 3H1UA 4OZAA 2BYVE 5HG2A 4IWOA 2I2YA 2UU7A 2J0KA 2MP2B 5BMHA 1E5WA 1JW9D 1NEKB 2VZKD 4ANVA 2LVQA 1F9JA 2K8BA 3JYUA 3AECB 1RWSA 2C60A 2JXXA 1WGGA 3N3KB 3ZDMC 1SJHD 3RMKC 4C7YA 5J2RA 4LNOA 1KLGD 4YSYB 3DHGC 1QKZA 2ZW1A 3L54A 3BVMA 3M62B 1KOTA 2BVCA 2GBJA 2O6VB 4A3OA 1V8CA 2D2QA 3MHSD 3AH7A 4HPLB 1WX8A 2C9WB 5H92C 3NVYA 1F1HA 1OEYJ 2M8SA 1WJ4A 1WXAA 4ZRKA 1WR6E 2V1YA 1SE9A 2LHDA 3RNEC 1EWYC 3P4RB 2CS4A 1CMXB 4C00A 1EWCA 1V1PB 5T8IA 4LCDE 4GLSC 2WXRA 1GJZA 5G2NA 2IGGA 3PS6A 1PDXA 1WZ0A 3KVFB 1K52A 2KAJA 1J19A 3NZSA 4RM8A 5CX3A 3BVZA 3GOEA 2D3GA 3N1YC 2KTRB 3U8ZA 4GXBA 4MH8A 3VHTC 3DHIC 3EECA 4IM0A 5E6PA 2NCNA 2MHJA 1TIFA 3PLUA 4AUQC 5D2MB 4EUTA 4NAMA 4RF1A 4QAYA 1ZW7A 3TBLD 2ONQA 2VH1A 2Z0EB 2WX0A 3PZ7A 1HZ5A 2O6VD 3C0RB 2BBCA 1MPEA 2GBMA 5FK9C 3V3XA 4LTUA 3RNFC 5KHOA 2HJ1A 4ARIA 2QC8A 4ANXA 3DBRB 1F2RI 2N7EA 3DOWA 3NHEB 4FJYA 3RZWC 4HPMB 1KJTA 2LXAA 2LI5A 3EGRA 5HKHA 3GP7A 2PE6B 2IGDA 2SAKA 3PLVA 5JXVA 4WJQA 3JSVA 1QQRA 1SBBB 3DBLI 3U4EG 3ZTDA 3Q3NC 1TZ1A 2WXMA 2XNAC 3QCAA 3BK2A 2E6XA 1I4HA 2V3NA 1ISNA 3I63C 4M01A 4JGHB 4GN1A 5H8YE 3WA0A 2R2QA 1PUTA 3DWGC 3DDCB 2MBBB 2DZKA 3S2AA 3TEXA 1QOGA 3W9CB 1XCQL 1S3SG 2KFKA 3DVNU 3Q69A 2NBVB 4KDIC 2DX5B 1R4NI 3VQIA 4HPPA 2JXTA 3T8MA 3VRBB 4X57B 3IAS1 2KWCA 1JWSD 5GXGB 3CMMB 3TUOA 3SD5A 1FXAA 3E9SA 1E0ZA 4WWMA 4JLCA 3URYA 1I4QA 3FILA 2RMMA 1VLBA 3MHZA 1TY0A 3EFUA 4K7UA 1YX6B 2NS5A 3MTNB 4B95A 1VD2A 3HRDD 2UWQA 2N9EB 1K8RB 2A4ZA 3A9JA 4WURA 1NI3A 3TEWA 3QJZA 1YQ3B 3EUB2 3AN1A 4CO7A 4IG7B 1TS4A 1IBXB 2FBWB 2HDEA 2O2VB 4P16A 1VZ8A 3U7ZA 3X0WA 2DZJA 1I4PA 3L17A 3R3MA 3N20C 4IWQA 4GU2A 2JYEA 1K51A 4AOFA 2PE9A 3EC8A 5TSSA 2MP2A 1E8YA 1D5MC 1E7PB 1C4CA 3SU8X 1RM6C 3ZLZA 4AWJA 1MFWA 1GC7A 1TBEA 2NTTA 3VUXA 3WCQA 1GB4A 1EUVB 2K25A 3MJ5A 2INPE 2BYEA 4IOIE 2GBNA 4B6WA 2ZW0A 5MPOA 2G45B 2O6VA 4MJSB 2KJ6A 3UIOB 3AULA 4BKSA 2BYFA 2WXPA 3A1QB 5BMIA 2B76B 1EF5A 3U2SC 4GB9A 1FNWA 3C8YA 1PYWD 3AE9B 1YMHE 3RD2A 3KWLA 4B9KA 2IJ0A 2FE8A 4BZAA 3BINA 1J0GA 2L3ZA 3ZJVA 2RDHA 2K6DB 4ACFA 4B0MA 3AEEB 2VRRB 1FNUA 2KHWB 3JVZX 5BYRA 2JU6X 2ZZPB 4XX5A 4PYUA 4KX6B 2JPHA 3MC9A 2D10A 1X1MA 3Q14C 2MLBA 2JWUA 4US8A 2Y5PA 3TMPB 3TEZA 3PPAA 1ZKHA 1SF0A 2W54A 2Y5BB 2Y5CA 4YTMB 1E8WA 1LXDA 2KLCA 2L0TA 2K1FA 3BVGA 4JWSC 4XC2A 2K5PA 2JVCA 2LFIA 4DHZE 1WGHA 2L1AA 1HEZE 2LRUA 3MC0B 1F77A 1Q10A 1NENB 1UZXB 2MQJA 3ZGZA 3ZYYX 2K39A 3JW0X 3DBRI 2AWTA 1MVKA 5JHAA 1NI2A 1CJEA 2G4SA 4EZJA 4JL9A 3NUHB 1SGHA 4MDKE 4F7ZA 3Q8AA 1FNVA 4MGKE 1IP9A 2BWES 2JSVX 1DOIA 2H88B 1C4AA 3P2BA 2K3UA 2INDC 3ETRA 2GBKA 1YOVB 1WF9A 1XO3A 3ONSA 2D11A 4YT0B 2BS3B 1K53A 1ZE3D 1JQ4A 3QA8A 3B2GA 2K22A 4DK5A 3HK0A 1WH3A 5AEKB 1K50A 5JHBA 2R61A 3R2IA 2WGSA 3K9OB 2DHZA 3ZKJC 2JZPA 4IWPA 4FADA 1WMHB 3W2DA 4AJYB 1YJIA 5CTRC 1WJNA 5LNK1 4NQLB 3KUZA 2KWDA 3V61A 4BKTA 2JY6A 1RRBA 1TKEA 3VDZA 2KWUB 2WQYB 4CYEA 2Z0DB 3TEYA 1KLUD 4HJGE 2FAZA 1CQVA 4OZBA 4II2B 3DBLB 4NJ7A 2RDBC 2QSDA 1SE4A 4I6NB 4KV2A 3RT3B 2BPSA 3SDLC 3N30A 4OHJA 1YD8U 1IBXA 2LGXA 1ZXIA 4K81A 4XWWA 1D6EC 2LD9A 1V9JA 4YXDB 4HJKA 3P4SB 1P98A 5J18A 4HKQA 2MRPA 2GOWA 2TSSA 1V81A 2G9HD 3KH0A 1UWMA 2IPKD 4RGMA 3W5VB 4BOZB 1XLNA 2IDYA 2KDFB 4URKA 1J8CA 2LGIA 1V80A 2YEPF 1LO5D 4TKNA 4C7ZA 1WJUA 3V6CB 4P6VF 2N0SB 2LVOA 1FRRA 2QHOA 4L1BA 2CHZA 3L4PA 3R7RA 3KYCD 1QOBA 2DZIA 1T0YA 2JT4B 1WX9A 4W9FA 1FD6A 2KJRA 1C76A 4EZKA 3DVGX 3R2TA 1C3TA 3C19A 4MJSA 1A70A 1FPYA 2FUG1 3KW5B 3D32A 3NOBA 5C1ZA 1GNUA 1EM7A 2K9XA 5E6JA 3A1QA 3Q3MC 1L4ZB 3HM6X 1WI0A 3UGBB 3VR9B 1F0ZA 4W9LA 1B1ZA 4O1NA 2V3PA 1T5XD 2RR9A 4ZHOA 4E74A 2FCMA 3WAOA 3IG3A 3B08A 3ENEA 1ESFA 3NVZA 1ZP0B 1H4RA 5C23A 1WJ6A 4OW0A 4HXDA 2JZ3B 3BIID 2WXGA 5AUKA 4HDQA 2MJEA 2WU5B 2KANA 4FBJB 4BOSC 4TSSA 1KFYB 5GMVA 2H89B 1OQQA 1E90A 3ZQ4A 3B9JA 1AARA 1FXTB 1WM3A 2WDQB 1CK1A 1P0RA 4TMAB 2WLBA 3AE5B 3M3JA 1YN5A 2KDEB 3CSFA 4TV3A 2AL3A 3P1MA 4K3CA 1IGCA 2LRWA 1XEEA 2PKOA 2N4FA 2BQQA 3VTWA 4RNAA 4WWNA 3PSEB 4NNJB 3ZJTA 2DYMA 3O13A 3KLSX 3M63B 1E7VA 1L6UA 1P1AA 3H7PA 4XGAB 2M0AA 3P42A 2L32A 3RNCC 4BKGA 2BTEA 2ZPNA 4PS8A 4HLEA 2MH7A 2ZJDA 1TGZB 2WHIA 1J7CA 1FRDA 3AE3B 2QCZA 4A90A 2X8XX 1OEYA 3AU5A 1GOZA 1JWBD 1HTOA 3FAHA 1T0RC 3GS2A 3HVDA 4OVUA 2JX5A 3Q8CA 4NJCA 3UF8A 3SHQA 1WMHA 2ZNVC 2LHEA 3GB1A 1MG8A 1VDVA 2DBYA 1D5ZC 5E6NA 1QOAA 1Y56A 2DYOA 2IO0B 2L7RA 2IYDB 5EE1A 4E3CA 1FEHA 4GOCA 2WX1A 4KGTA 1U4AA 4HKZE 2L8JA 1E10A 4BKSD 2OJWA 4IKGA 3V6EB 1ZUD2 4G50A 4DHZB 4PK1A 1NYQA 1ROEA 1E7UA 3Q3JA 4M00A 2CKHB 1I4RA 3QQ8B 3HM3A 2ZEQA 1D3ZA 3OJ3A 3Q6BA 4NAWB 4RF0A 4BVUC 4E71A 2WXJA 4M8MA 2MEKA 2V4IB 5C3JB 1SE2A 1JROA 3VTUA 5CHFA 2BS4B 3PHXB 1YX5B 2C5LC 4MT5A 2N7JA 4LDTB 4RFBA 3M95A 1LFDA 2LJ5A 3HVZA 1YNTE 3A4RA 2K8CA 4XWTA 1VR9A 5DPWA 1AW7A 1FMAD 1M94A 1OGWA 3UINB 2OHFA 1Z2MA 4YSXB 3VRAB 4HROA 2L05A 3NVVA 1P9DU 1MHHE 2KACA 2I1JA 4P1CC 1XLQA 4ANWA 4OVZA 1PGAA 5DPSA 1J7BA 3WALA 3DVNV 2J42A 3K9PB 4KSLC 2EMSA 4BBNF 3L10B 2MW5A 3RNBC 2KQSA 1EU3A 4C56C 2YLMA 3W5UB 4EEWA 2X38A 4KZCA 1N6ZA 1EU4A 5AUIA 3AE1B 5LLIA 3AMZA 2OEDA 2W3RA 4A20A 1JALA 3OG5A 1P3QU 2LEKA 2LGDA 4H2AA 5LXHA 2MA9B 5JZEB 2KOXA 1OQRA 4M0WB 1NYRA 3ABVB 3RN9C 4MGYE 4WWOA 4MSMB 4PYZA 1R4MB 3P63A 1MJDA 3RI7C 3OAWA 4RM9A 3DHHC 3R7QA 2WDVB 3RPFC 3BK1A 1GPXA 2DZMA 2WXOA 4P1BC 2BKFA 4WWPA 1Y8RC 1HZ6A 5D3IB 3ZDTA 2FCNA 5HFYA 2N1VA 4W9GA 3WAMA 1JWMD 1JWUD 3VH3B 1VCBA 2BB5A 2WXHA 1WE6A 2MBEA 1RFKA 1QILA 1QOFA 4Q2JA 1Q5WB 2PPHA 1L0YB 1WWTA 2JQRB 3IAM1 4R3DA 1B9RA 3AEBB 1VJKA 2JRIB 4REZA 4TQ0A 1PQSA 4ZHPA 1N61A 3NZ3A 1V6EA 1Q0WB 2N9XA 3GE3C 2HTME 3PRPB 1OFFA 3ZXRA 4DXGA 3KQ4A 4RCOA 4NJ6A 5L83A 4US9A 4IM3A 4DDID 1L0XB 1WRIA 2KFJA 2ZCCA 3N1ZC 4AS1A 3BYTB 2J0MA 4I6PA 1EO6A 4TQ1A 1L2NA 2IO2B 3R66C 1TS5A 1SXTA 3A9KB 1TZOA 1V86A 1QF6A 2B3AA 4HVBA 2MWSB 4ICUA 1LGRA 1V49A 2GMIC 3AEGB 3WANA 2QIEB 2MBHA 3UQAA 1OTRB 5IAAC 3PZDA 2NPTB 2KX3A 4KDLB 3LB8C 4DDGD 1WE7A 1C9FA 3A4SC 4DXFA 3TIXA 2FIFA 4ARCA 1E6EB 3W1SC 2QEJC 3VVWB 2KN4A 3CF6E 2KTFA 2WU2B 4KKIA 4EZLA 3ZNZB 3QK0A 1WR1A 3QAQA 1NDDA 2G3QB 1AN8A 1J7AA 1DGJA 2V4LA 5CHWA 3AE2B 4USAA 5HHDG 5D7GA 3DBSA 4NAWA 4KGRA 3UI3A 2CJOA 3PZ8A 3RNAC 4AQ7A 2WXLA 2KC2A 2G4DB 2FIDA 2BT6A 3H7PB 4MEMA 3QWZB 1Q1OA 2IY0B 2KO3A 2PEAA 3L16A 1MHXA 1PGBA 1YJ1A 3I5JC 2LUEA 5FR3A 3VH4B 3APCA 4ZRPA 4WJOA 1I4GA 2K8HA 2N9KA 1YJJA 4KSKC 1TTNA 4A6QA 3P4QB 3DQVA 1YQ4B 3GZNB 2NTSA 2YVCA 2WWZA 2OOBB 5FKAC 3AE8B 4W9EA 1RYJA 2M0XA 4KVGB 2L00B 4XDDA 1EF1A 4HDOA 3MJWA 1VZ7A 1WIAA 5EDSA 2J4XA 3BY4B 3PRZA 3NJTA 2M17A 2EKIA 2FUHB 2SEBD 3T3NA 5IKCM 1T3QA 3SFDB 2WXIA 2J7QB 1ZGUB 2GI9A 5C2TB 4W9IA 2I38A 1S1QB 1TS2A 4M0WA 2BW2A 4ANUA 4FXCA 3NS1A 4XDCA 4ITKA 2WS3B 1T6BX 2PW9A 1XLPA 1STEA 2LASA 2LJIA 4WAFA 3QIJA 1C79A 1BUIC 2GBRA 2IO3B 3ZTCA 1SSNA 1TYGB 1IYFA 1R4MI 4HCPB 2ACZB 3AU4A 1GUAB 1WX7A 5EE9A 2NMQA 3B2FA 1ZOYB 3IXSA 1FIQA 1NBFC 3AEFB 1C1YB 2CR5A 4MGZE 2LMCA 1ZXHA 4WAAA 3UIPB 1H8CA 4G3XB 1I7HA 2N1WA 1L4DB 2PVGC 1L5PA 3N9YC 2M1MA 2BF8B 2Z8LA 2KC1A 2MSED 1HA5A 5G55A 2KQ7A 3Q3OC 4ZYSA 4IW0A 3PREA 3VFKA 4LNKA 1UELA 2INNE 1KM7A 1WXMA 2KN5A 2V9HA 3PHWB 5I4DA 1N60A 4YTPB 4PS3A 3QHTA 1CZPA 3B0AA 3PGEA 2ICIA 1L7YA 2QILA 1WYGA 2MBOA 4GIVA 1WY8A 1JCKB 2JWZA 1SEBD 4S0RA 2R2OA 4XYCA 3FC4A 5JH5C 2KXJA 1KH0A 4MELA 1WYWB 3A9KA 2ZNVB 3V62A 1FFUA 3KUDB 4RGOS 3V05A 3TCAA 5TR5A 2RGFA 4W9CA 3RFZB 2W82A 4WJPA 4W9HA 4DBGA 4I6LB 2C7NB 2BYTA 3NS8A 1RFAA 2NPTA 3PVLA 2INCC 1GG3A 2XK5B 2D07B 2DLBA 3NG0A 3U7DA 3LYYA 4KIKB 2CJNA 2ASQA 2HJ8A 5DPRA 1TS3A 4JQWC 3T9LA 1DYQA 2FCSA 2KQ4X 4DHJB 3CIRB 1KLVA 2HTHA 3NZUA 4LNIA 4MSQB 1TJEA 3TL5A 2BGFA 2N9LA 3ALBA 2GRIA 4LNNA 3KYDD 2UYZB 3OWEB 1WFYA 2WYQA 1UWXA 2AEHA 2LGYA 4DQOC 1V5OA 2MBQA 3IBEA 2KMAA 2Z59B 2JYTA 4EE2A 4W9KA 4BFRA 1A5RA 1XD3B 3Q8BA 3LDZE 2K6QA 1WZ3A 3ZJUA 4PT5A 2L52A 4UDUC 4ZDVA 1KRHA 1PFDA 2N7DA 1DOYA 3Q8EA 3HIZA 2WXQA 3V60A 1IUEA 4AJWA 3NRZA 2M19A 1QLBB 2KYWA 2MJ3A 4FN2A 4MM3B 4DHJD 3IHPC 2J52A 1V97A 4KGSA 3N32A 1Z5SB 3BZDB 3CWIA 4MGIE 2V3SA 5D94A 4WJNA 4ZRQA 3IVFA 1YN4A 3IFWB 4G0NB 2V0GA 2HE7A 1XF5L 2M56B 2JRHA 1JRUA 3EHVA 4LNFA 4RH6A 2REXA 2ZVNA 2NBWB 1E8ZA 3GZNI 3I57A 5AZHA 4NZLB 3UQBA 2D3CA 3U52E 2AL6A 4XZ4A 1R7SA 3APDA 1FXIA 2C7MB 2HD5B 3ZRFA 3DCGA 1FCCC 5FR6A 2IBIB 4PS7A 1WXSA 3L08A 4XE0A 5EE3A 1JMLA 2W9NA 3N1XC 1C77A 4P7IA 2RD0A 2NR2A 2RPQA 3W1YA 3AB5A 4HWIB 4FA6A 4WQOB 2DWQA 2PVOD 4JE3B 1UNSA 4II3B 1YQBA 3OJ4B 1AYFA 3KUCB 1QZEA 3EFCA 4WQMA 4BBNC 1FCLA 3I9V1 2LVPA 4FJVB 2NVUI 2I1KA 3VXWA 2ZPYA 1XXGA 4K3BA 2J0JA 4M8NA 2W3SA 2NBUA 1E8XA 3QX1A 4ICVA 1E9MA 4LLGM 4IC7B 2KVRA 1XLOA 2PJHA 3RCZA 4RGTA 4C80A 2XBBC 1WGDA 1WGKA 4S17A 5D3DA 5IA7A 3H9DA 2KDIA 2AX5A 3QC8B 1JRPA 4A9AA 5KHQA 3SR6A 3L0WB 3PTFC 1WGYA 2EMTA 4RMAA 2W55A 1GAQB 1TKYA 3Q3FA 4LDTD 1TKGA 3Q8FA 2QMTA 4HEA1 3ZXVA 3BWUD 1WSPA 2MJDA 4GDKB 4WH4A 3KWVA 2KDMA 2IY1B 3RZFA 1HXYD 2QJLA 1DOXA 1G6JA 3AEDB 3AM9A 4YL8A 3DBHB 1C78A 3LXFA 2LZ6A 2BB6A 1OQYA 1UUPA 4N6EB 1ZDXA 3WIMA 2AQ1B 4F8CB 2RSUA 1XCTL 4HRSA 3RUIB 4RGNA 2AYOB 3ML8A 4A8XC 3HUIA 3SFEB 5IP4D 2IGHA 2CHXA 3ZNHB 3VTVA 4GMVA 4MH0E 2XK5A 2EKEC 3E56A 3H7SA 4EKUA 2LUMA 2D3AA 4KIKA 1UBQA 2AQ2B 2KT7A 4L2YA 1KTKA 1TT5B 2EELA 3PV1A 2L76A 3VUYA 1P7EA 4YWGG 1N5XA 1D4BA 2BS2B 1UF0A 1UGMA 4AP4C 2LGSA 5AZGA 1QT9A 2PLPA 4W9JA 4EFOA 3RYTA 4W9DA 4ZRIA 3VUWA 4CHKA 2KDBA 2DAFA 1SJED 2Y3AA 2WXKA 2LWPA 2BWFA 1WM2A 1V2YA 2ZVOA 4TUUA 3ZRCA 3O65B 3GE8C 1NVID 3HHMA 5DPTA 1PGXA 1IGDA 2XN9C 3L13A 2M4NA 4JWUC 2QDFA 5E6OA 3ZNID 1WRDB 3DVGY 2KZRA 2CU3A 3TSSA 1RLFA 4N59A 2KMCA 4KZ0A 2D5GA 2JUOA 4KKJA 4C4VB 1MG4A 1HE8A 3ECIA 1D5XC 1WGRA 4FULA 3T3OA 3AXCA 3OLMD 4A55A 1FO4A 1HQRD 4MM3A 4IM2A 2WDTB 1ET6A 4GDLB 4LJPB 2ON8A 1V1PA 1YIWA 2IO1B 4MACA 2A5UA 3ML9A 1V5TA 2D3BA 4G11A 3ZW3A 5J17A 2MCNB 2L0FA 2KTRA 1SIFA 3LJ3A 4FLHA
chains in the Genus database with same CATH topology
1TYGB 2ACZB 2M0AA 3P42A 1FFVA 5EE9A 2L32A 3URYA 1M4VA 4L23A 1I4QA 3FILA 2BTEA 2RMMA 2NMQA 3B2FA 1VLBA 2MH7A 1TY0A 1ZOYB 3MHZA 1E0ZA 2PMVA 3IXSA 1FIQA 5BMGA 1N62A 3AEFB 3IT4B 1J7CA 3HRDD 2LMCA 2WDRB 1ZXHA 1FRDA 3AE3B 1I7HA 3VR8B 4WURA 1NI3A 3TEWA 1SIJA 2YEPB 1YQ3B 5G5HA 1L4DB 2PVGC 4A90A 3EUB2 1L5PA 1GOZA 1P7FA 3N9YC 1JWBD 1KF6B 3AN1A 3FAHA 4YSZB 3HVDA 3GS2A 2Z8LA 1TS4A 2JX5A 1HA5A 1ZDVA 3Q8CA 4NJCA 4ZYSA 1IBXB 2FBWB 2HDEA 2LHEA 3GB1A 1ENFA 2K0PA 1VDVA 2DBYA 1D5ZC 2INNE 1QOAA 1Y56A 2DYOA 3AE7B 4P16A 5I4DA 1VZ8A 3U7ZA 1N60A 4YTPB 1CZPA 3DWMA 4JX1C 1I4PA 2ICIA 4CQNA 5EE1A 1FEHA 4KGTA 2QILA 1WYGA 2JYEA 3NVWA 1JCKB 4HKZE 2RPVA 1K51A 1SEBD 1BMLC 1JWAD 1E10A 5TSSA 3J9CA 1AWDA 4IKGA 1ZUD2 3FC4A 1D5MC 1E7PB 1C4CA 2WNMA 1NYQA 1ROEA 4ZOHC 5BYQA 1KH0A 1RM6C 4J3OD 1I4RA 2NTTA 4WIPA 3WCQA 1FFUA 3BYYB 4RGOS 2WP9B 1GB4A 3MJ5A 3V05A 2INPE 1BXTA 3RFZB 4NAWB 2W82A 4RF0A 3IT6B 2WXJA 2BYTA 2MEKA 2V4IB 4IOIE 1L0VB 2ZW0A 1SE2A 1JROA 2E3TA 5C3JB 5MPOA 2BS4B 2L83A 4OZCA 4D2KA 4MT5A 2N7JA 4RFBA 2DLBA 3LYYA 2PIAA 3HVZA 1YNTE 2CJNA 4XWTA 1VR9A 2J53A 1AW7A 1TS3A 2WXPA 1FMAD 3AEAB 1DYQA 3PO0A 5BMIA 1N5WA 1VRAB 1SB3C 2B76B 2KQ4X 2OHFA 3CIRB 2AQ3B 3U2SC 4YSXB 5BYSA 1FNWA 1N63A 1TJEA 3VRAB 2KMMA 3C8YA 4HROA 2N9LA 1PYWD 2GRIA 3AE9B 1YMHE 3NVVA 3KWLA 3OWEB 2IJ0A 2FE8A 1MHHE 1UWXA 3ZJVA 2RDHA 2KACA 4B0MA 3P4PB 4DQOC 1XLQA 4OVZA 1PGAA 3AEEB 1J7BA 1I4XA 1FNUA 4EE2A 2JYTA 2J42A 3MP9A 5BYRA 2JU6X 3W1SA 3Q8BA 4KX6B 3ZJUA 1EU3A 4PT5A 4N58A 2JWUA 4C56C 2L52A 4UDUC 4US8A 1KRHA 2Y5PA 1PFDA 3TEZA 2RDGA 3W5UB 3AE4B 2X38A 1SF0A 2W54A 2Y5CA 1DOYA 4YTMB 3Q8EA 1EU4A 2WXQA 1L6VA 5AUIA 3AE1B 1IUEA 1ET9A 3NRZA 3AMZA 3BVGA 2OEDA 2W3RA 4JWSC 2PTLA 2K5PA 2LFIA 2M19A 1JALA 2L1AA 1HEZE 4IDIA 1QLBB 2LEKA 2MJ3A 4MM3B 3MC0B 2J52A 1V97A 1F77A 4KGSA 4H2AA 1Q10A 3AE6B 1NENB 3BZDB 3CWIA 3ZGZA 1OQRA 3ZYYX 1NYRA 3ABVB 3H8HA 4ZRQA 1MVKA 1YN4A 2Q5WD 2V0GA 3P63A 1XF5L 2M56B 4YTNB 1CJEA 1ACCA 4RH6A 3NUHB 3Q8AA 3I57A 1FNVA 2WDVB 4NZLB 3RPFC 1C4PA 3BK1A 1GPXA 3MFGA 2JSVX 2WXOA 1DOIA 2H88B 3U52E 4LK0M 1MI0A 1TY2A 1C4AA 1HZ6A 2K3UA 1R7SA 3FILB 5EE0A 2VZKB 5G5GA 3SEBA 1F2RC 1FXIA 1YN3A 5D3IB 3ETRA 2WXFA 5HFYA 1FCCC 1SE3A 1FM0D 1XO3A 5EE3A 4YT0B 1VZ6A 2BS3B 1K53A 1ZE3D 1JWMD 1JQ4A 1JWUD 1WXQA 3B2GA 2BB5A 2K22A 2WXHA 1RFKA 1QILA 1QOFA 4XE0A 4Q2JA 1K50A 3EA6A 1L0YB 1WWTA 1JMLA 2G1EA 2JQRB 3IAM1 1C77A 4R3DA 3AEBB 5HI1A 1B9RA 2R61A 3R2IA 1VJKA 3AB5A 1GB1A 4REZA 4TQ0A 2JZPA 4ZHPA 1N61A 2DWQA 2PVOD 3NZ3A 4JE3B 3R8BA 3W2DA 1UNSA 1V1OA 1UGJA 2GB1A 3AV8A 1YJIA 1ZPSA 2HTME 1AYFA 5LNK1 4JPSA 1OFFA 2KWDA 4WQMA 1FCLA 3I9V1 2WXNA 4B0EA 4DXGA 3KQ4A 1TKEA 4RCOA 4OZAA 2WQYB 4US9A 1L0XB 1WRIA 5HG2A 2I2YA 1XXGA 5BMHA 2W3SA 3TEYA 1KLUD 4AS1A 1E9MA 1JW9D 4LLGM 4HJGE 3BYTB 1CQVA 4OZBA 1XLOA 1NEKB 2VZKD 4TQ1A 2QSDA 1SE4A 4RGTA 4C80A 1TS5A 1SXTA 3AECB 1TZOA 1QF6A 1RWSA 1WGKA 5D3DA 4OHJA 1SJHD 1IBXA 4C7YA 2AX5A 1JRPA 1ZXIA 1KLGD 3AEGB 4A9AA 4XWWA 3SR6A 4YSYB 1D6EC 2QIEB 1QKZA 2ZW1A 3BVMA 3LB8C 4YXDB 1C9FA 3P4SB 2W55A 1GAQB 1TKYA 1V8CA 4HKQA 4DXFA 1TKGA 3AH7A 2TSSA 2QMTA 3Q8FA 4HEA1 3BWUD 1WSPA 2G9HD 1E6EB 2MJDA 4ARCA 2QEJC 5H92C 4GDKB 3NVYA 1UWMA 4WH4A 2IPKD 2KN4A 3KWVA 2KDMA 4RGMA 1HXYD 2QJLA 3W5VB 1DOXA 3AEDB 2LHDA 3AM9A 1EWYC 3P4RB 1XLNA 2IDYA 2WU2B 4KKIA 1EWCA 1C78A 1V1PB 3LXFA 2BB6A 5T8IA 4GLSC 2LGIA 1UUPA 1AN8A 1J7AA 1DGJA 2WXRA 1LO5D 2YEPF 4N6EB 4C7ZA 3AE2B 1ZDXA 4USAA 2IGGA 4P6VF 1PDXA 2AQ1B 5D7GA 5HHDG 1K52A 2N0SB 2KAJA 3BVZA 1FRRA 4L1BA 4HRSA 1XCTL 3L4PA 4RGNA 4KGRA 3UI3A 2CJOA 3PZ8A 4A8XC 3HUIA 1QOBA 4MH8A 2WXLA 3SFEB 4AQ7A 2IGHA 1FD6A 1C76A 2BT6A 3R2TA 3E56A 4NAMA 4RF1A 2LUMA 1A70A 2FUG1 1MHXA 2ONQA 1PGBA 2AQ2B 3PZ7A 1HZ5A 4L2YA 1EM7A 2K9XA 2BBCA 1MPEA 1KTKA 5E6JA 2EELA 5FK9C 3V3XA 1P7EA 1L4ZB 4YWGG 4LTUA 1N5XA 1D4BA 2BS2B 3VR9B 1F0ZA 1QT9A 5FR3A 1B1ZA 4O1NA 2PLPA 4ARIA 2V3PA 4ZRPA 1T5XD 1F2RI 4ZHOA 1I4GA 3EGRA 1SJED 3GP7A 2N9KA 1ESFA 2Y3AA 2IGDA 3NVZA 1ZP0B 2SAKA 1YJJA 2WXKA 5JXVA 4OW0A 4A6QA 3P4QB 3BIID 2WXGA 1NVID 1YQ4B 5AUKA 2NTSA 1PGXA 2MJEA 2WU5B 1IGDA 1QQRA 2XN9C 4JWUC 5FKAC 3AE8B 4TSSA 1SBBB 3U4EG 2CU3A 1RYJA 1KFYB 4XDDA 3TSSA 4N59A 2WXMA 2XNAC 3BK2A 2H89B 1VZ7A 1OQQA 2E6XA 1I4HA 2D5GA 3ZQ4A 2V3NA 3B9JA 2J4XA 4KKJA 1D5XC 2EKIA 2WDQB 1CK1A 2SEBD 5H8YE 3T3OA 3T3NA 4TMAB 4A55A 1T3QA 1PUTA 2WLBA 3SFDB 2WXIA 1FO4A 3DWGC 3AE5B 1HQRD 1YN5A 1ET6A 2GI9A 4GDLB 5C2TB 2I38A 3TEXA 1QOGA 3W9CB 1XCQL 2ON8A 3Q69A 1V1PA 3P1MA 1IGCA 1TS2A 4M0WA 4MACA 2BW2A 1XEEA 2PKOA 4FXCA 3VQIA 3NS1A 4XDCA 4ITKA 2WS3B 1T6BX 2JXTA 2PW9A 3VRBB 1XLPA 4RNAA 3IAS1 3ZJTA 1STEA 2DYMA 3O13A 2LJIA 1JWSD 3KLSX 5GXGB 4WAFA 1L6UA 3TUOA 1C79A 1BUIC 1FXAA 3E9SA 1SSNA 4WWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WWT A;  2G1E A;  2JQR B;  4YSX B;  1B9R A;  1TYG B;  3AEB B;  1N63 A;  1TJE A;  2ACZ B;  3VRA B;  1VJK A;  2KMM A;  2BT6 A;  3AB5 A;  1FFV A;  4HRO A;  5EE9 A;  3AE9 B;  2B76 B;  3B2F A;  1VLB A;  2MH7 A;  1ZOY B;  3KWL A;  3NVV A;  1A70 A;  1E0Z A;  4ZHP A;  1N61 A;  1FIQ A;  2DWQ A;  2PVO D;  1N62 A;  3AEF B;  1J7C A;  3HRD D;  2K9X A;  3P4P B;  1XLQ A;  3AV8 A;  2WDR B;  1YJI A;  3AEE B;  1FRD A;  1J7B A;  2HTM E;  1AYF A;  3AE3 B;  1I7H A;  3VR8 B;  4LTU A;  1NI3 A;  1SIJ A;  1N5X A;  1OFF A;  1YQ3 B;  2BS2 B;  2PVG C;  3EUB 2;  4WQM A;  5G5H A;  1L5P A;  3VR9 B;  1JWB D;  1F0Z A;  1KF6 B;  1QT9 A;  3AN1 A;  4KX6 B;  1TKE A;  3FAH A;  4YSZ B;  2WQY B;  4US9 A;  2JX5 A;  4N58 A;  4ZHO A;  1WRI A;  2L52 A;  4US8 A;  1KRH A;  2FBW B;  3CIR B;  1PFD A;  3NVZ A;  2W3S A;  3W5U B;  3AE4 B;  1ZP0 B;  1YJJ A;  1SF0 A;  1E9M A;  1JW9 D;  2W54 A;  2Y5C A;  1DOY A;  1VDV A;  2DBY A;  4YTM B;  1QOA A;  5AUI A;  1L6V A;  1NEK B;  1XLO A;  3AE7 B;  3P4Q B;  3BII D;  3AE1 B;  1NVI D;  1N60 A;  1IUE A;  1YQ4 B;  4YTP B;  5AUK A;  1CZP A;  4C80 A;  2MJE A;  2WU5 B;  3DWM A;  3NRZ A;  3AMZ A;  4JX1 C;  4JWU C;  3AEC B;  2W3R A;  4JWS C;  1QF6 A;  1RWS A;  5EE1 A;  2K5P A;  1WYG A;  3AE8 B;  1WGK A;  2M19 A;  3NVW A;  2CU3 A;  1JAL A;  1RYJ A;  1KFY B;  4IDI A;  1JWA D;  1QLB B;  2LEK A;  2MJ3 A;  1E10 A;  1V97 A;  1AWD A;  2AX5 A;  4C7Y A;  1JRP A;  1ZUD 2;  1ZXI A;  4N59 A;  3AE6 B;  3AEG B;  1NEN B;  1E7P B;  3FC4 A;  3SR6 A;  4A9A A;  3CWI A;  4YSY B;  2H89 B;  1OQQ A;  2QIE B;  1NYQ A;  1OQR A;  3B9J A;  3ZYY X;  1ROE A;  4ZOH C;  1NYR A;  3ABV B;  3LB8 C;  1RM6 C;  4YXD B;  3P4S B;  2W55 A;  2EKI A;  1GAQ B;  1TKY A;  1V8C A;  2WDQ B;  2Q5W D;  5H8Y E;  1TKG A;  3WCQ A;  1FFU A;  3AH7 A;  3P63 A;  2WP9 B;  1T3Q A;  1PUT A;  2M56 B;  2WLB A;  3SFD B;  4YTN B;  1CJE A;  1FO4 A;  2OHF A;  1E6E B;  2MJD A;  3AE5 B;  3DWG C;  5H92 C;  3NVY A;  1UWM A;  1DOX A;  2QJL A;  5C2T B;  3W5V B;  3AED B;  1QOG A;  3W9C B;  3AM9 A;  1EWY C;  2WDV B;  3P4R B;  1XLN A;  3RPF C;  3P1M A;  2WU2 B;  1L0V B;  1GPX A;  5C3J B;  2E3T A;  1JRO A;  5MPO A;  2PKO A;  2BS4 B;  1DOI A;  3LXF A;  2H88 B;  4FXC A;  3NS1 A;  2L83 A;  4ITK A;  2WS3 B;  1R7S A;  5G5G A;  1DGJ A;  1J7A A;  5EE0 A;  3VRB B;  4N6E B;  1FXI A;  4C7Z A;  3ETR A;  3AE2 B;  1XLP A;  4USA A;  4P6V F;  2PIA A;  1PDX A;  3HVZ A;  1FM0 D;  1XO3 A;  2N0S B;  2CJN A;  2KAJ A;  4YT0 B;  2BS3 B;  5GXG B;  1FRR A;  1L6U A;  4HRS A;  1JQ4 A;  1WXQ A;  1FMA D;  3AEA B;  3B2G A;  3L4P A;  2CJO A;  2K22 A;  3PO0 A;  3HUI A;  1QOB A;  1RFK A;  1FXA A;  1N5W A;  1SB3 C;  1QOF A;  3SFE B;  5EE3 A;  4WWM A; 
#chains in the Genus database with same CATH topology
 3WAP A;  3ZIM A;  1FFV A;  2KK8 A;  3MC8 A;  1F52 A;  2FCQ A;  1M4V A;  4L23 A;  5IOI A;  2PMV A;  2FNJ B;  5BMG A;  1N62 A;  3IT4 B;  4IUM B;  5DCN A;  1LQB A;  2WDR B;  3VAW A;  1T0Q C;  1T0S C;  3VR8 B;  1SIJ A;  2YEP B;  5G5H A;  1P7F A;  3I3T B;  1KF6 B;  4YSZ B;  4JIO U;  2CHW A;  4NY0 A;  1ZDV A;  2KLG A;  1ENF A;  2K0P A;  4NQK E;  3AE7 B;  1UH6 A;  2LXC A;  1I35 A;  3DWM A;  4JX1 C;  4FJZ A;  4CQN A;  2KD0 A;  3NVW A;  3TJP A;  3DPD A;  1UD7 A;  2RPV A;  1I42 A;  1BML C;  1JWA D;  4DXA B;  3J9C A;  1AWD A;  2WNM A;  4ZOH C;  5BYQ A;  5L95 C;  4F1S A;  4FHJ A;  4J3O D;  2KWV B;  4K7S A;  4WIP A;  3BYY B;  2KKC A;  2WP9 B;  3X23 A;  1BXT A;  4M02 A;  3IT6 B;  3APF A;  4HK2 A;  1WXV A;  2KJH B;  1RAX A;  1L0V B;  2E3T A;  2KX0 A;  2L83 A;  4OZC A;  4D2K A;  3FKY A;  2PIA A;  5IN7 A;  3AI5 A;  4GDK A;  2DNF A;  2J53 A;  4HCN B;  3AEA B;  3PO0 A;  1N5W A;  1VRA B;  1SB3 C;  1HTQ A;  2AQ3 B;  5BYS A;  3RUL A;  1N63 A;  4DWF A;  2KMM A;  5IO9 A;  3CST A;  4BAX A;  2XEW A;  4ZYN A;  3DBH I;  1UBI A;  3P4P B;  1I4X A;  3JSV B;  3ZVV A;  3MP9 A;  3W1S A;  4J6I A;  3PT2 B;  4ZRJ A;  4N58 A;  5BO4 B;  2O2V A;  2RDG A;  3AE4 B;  4A3P A;  3ZNG C;  1L6V A;  1ET9 A;  2PTL A;  3RNG C;  2BKR B;  1R4N B;  4EOY A;  4GSW A;  4IDI A;  2MX2 A;  3AE6 B;  2KFK B;  2CU1 A;  3A33 B;  1IPG A;  3H6N A;  3H8H A;  5AZF A;  2DYB A;  2Q5W D;  5D6J B;  5LXI B;  4YTN B;  1ACC A;  3B1L X;  2C7H A;  2ZCB A;  2DAJ A;  1BT0 A;  1C4P A;  4C4V A;  3MFG A;  3U30 A;  2GLS A;  4LJO B;  4K7W A;  4LK0 M;  3QAR A;  1MI0 A;  1TY2 A;  3ZUN A;  3FIL B;  5G5G A;  5EE0 A;  2VH2 A;  3SEB A;  2VZK B;  1F2R C;  1YN3 A;  1XT9 B;  2WXF A;  5CHV C;  4ASW C;  1SE3 A;  1FM0 D;  1VZ6 A;  4GDL A;  1WXQ A;  4NPN A;  2IZV B;  4OVV A;  1GC6 A;  3A9J B;  2N9P C;  3ZO5 B;  3EA6 A;  4FHK A;  2G1E A;  5HI1 A;  1GB1 A;  3Q2A C;  1LM8 B;  2KNB A;  3NY5 A;  4GGQ A;  2OJR A;  3R8B A;  1V1O A;  1UGJ A;  4N9F 4;  2GB1 A;  4K1R B;  3AV8 A;  2DEN B;  1ZPS A;  2JF5 A;  3PRM B;  4JPS A;  2KVZ A;  2WXN A;  4B0E A;  1XQQ A;  2JZZ A;  3H1U A;  4OZA A;  2BYV E;  5HG2 A;  4IWO A;  2I2Y A;  2UU7 A;  2J0K A;  2MP2 B;  5BMH A;  1E5W A;  1JW9 D;  1NEK B;  2VZK D;  4ANV A;  2LVQ A;  1F9J A;  2K8B A;  3JYU A;  3AEC B;  1RWS A;  2C60 A;  2JXX A;  1WGG A;  3N3K B;  3ZDM C;  1SJH D;  3RMK C;  4C7Y A;  5J2R A;  4LNO A;  1KLG D;  4YSY B;  3DHG C;  1QKZ A;  2ZW1 A;  3L54 A;  3BVM A;  3M62 B;  1KOT A;  2BVC A;  2GBJ A;  2O6V B;  4A3O A;  1V8C A;  2D2Q A;  3MHS D;  3AH7 A;  4HPL B;  1WX8 A;  2C9W B;  5H92 C;  3NVY A;  1F1H A;  1OEY J;  2M8S A;  1WJ4 A;  1WXA A;  4ZRK A;  1WR6 E;  2V1Y A;  1SE9 A;  2LHD A;  3RNE C;  1EWY C;  3P4R B;  2CS4 A;  1CMX B;  4C00 A;  1EWC A;  1V1P B;  5T8I A;  4LCD E;  4GLS C;  2WXR A;  1GJZ A;  5G2N A;  2IGG A;  3PS6 A;  1PDX A;  1WZ0 A;  3KVF B;  1K52 A;  2KAJ A;  1J19 A;  3NZS A;  4RM8 A;  5CX3 A;  3BVZ A;  3GOE A;  2D3G A;  3N1Y C;  2KTR B;  3U8Z A;  4GXB A;  4MH8 A;  3VHT C;  3DHI C;  3EEC A;  4IM0 A;  5E6P A;  2NCN A;  2MHJ A;  1TIF A;  3PLU A;  4AUQ C;  5D2M B;  4EUT A;  4NAM A;  4RF1 A;  4QAY A;  1ZW7 A;  3TBL D;  2ONQ A;  2VH1 A;  2Z0E B;  2WX0 A;  3PZ7 A;  1HZ5 A;  2O6V D;  3C0R B;  2BBC A;  1MPE A;  2GBM A;  5FK9 C;  3V3X A;  4LTU A;  3RNF C;  5KHO A;  2HJ1 A;  4ARI A;  2QC8 A;  4ANX A;  3DBR B;  1F2R I;  2N7E A;  3DOW A;  3NHE B;  4FJY A;  3RZW C;  4HPM B;  1KJT A;  2LXA A;  2LI5 A;  3EGR A;  5HKH A;  3GP7 A;  2PE6 B;  2IGD A;  2SAK A;  3PLV A;  5JXV A;  4WJQ A;  3JSV A;  1QQR A;  1SBB B;  3DBL I;  3U4E G;  3ZTD A;  3Q3N C;  1TZ1 A;  2WXM A;  2XNA C;  3QCA A;  3BK2 A;  2E6X A;  1I4H A;  2V3N A;  1ISN A;  3I63 C;  4M01 A;  4JGH B;  4GN1 A;  5H8Y E;  3WA0 A;  2R2Q A;  1PUT A;  3DWG C;  3DDC B;  2MBB B;  2DZK A;  3S2A A;  3TEX A;  1QOG A;  3W9C B;  1XCQ L;  1S3S G;  2KFK A;  3DVN U;  3Q69 A;  2NBV B;  4KDI C;  2DX5 B;  1R4N I;  3VQI A;  4HPP A;  2JXT A;  3T8M A;  3VRB B;  4X57 B;  3IAS 1;  2KWC A;  1JWS D;  5GXG B;  3CMM B;  3TUO A;  3SD5 A;  1FXA A;  3E9S A;  1E0Z A;  4WWM A;  4JLC A;  3URY A;  1I4Q A;  3FIL A;  2RMM A;  1VLB A;  3MHZ A;  1TY0 A;  3EFU A;  4K7U A;  1YX6 B;  2NS5 A;  3MTN B;  4B95 A;  1VD2 A;  3HRD D;  2UWQ A;  2N9E B;  1K8R B;  2A4Z A;  3A9J A;  4WUR A;  1NI3 A;  3TEW A;  3QJZ A;  1YQ3 B;  3EUB 2;  3AN1 A;  4CO7 A;  4IG7 B;  1TS4 A;  1IBX B;  2FBW B;  2HDE A;  2O2V B;  4P16 A;  1VZ8 A;  3U7Z A;  3X0W A;  2DZJ A;  1I4P A;  3L17 A;  3R3M A;  3N20 C;  4IWQ A;  4GU2 A;  2JYE A;  1K51 A;  4AOF A;  2PE9 A;  3EC8 A;  5TSS A;  2MP2 A;  1E8Y A;  1D5M C;  1E7P B;  1C4C A;  3SU8 X;  1RM6 C;  3ZLZ A;  4AWJ A;  1MFW A;  1GC7 A;  1TBE A;  2NTT A;  3VUX A;  3WCQ A;  1GB4 A;  1EUV B;  2K25 A;  3MJ5 A;  2INP E;  2BYE A;  4IOI E;  2GBN A;  4B6W A;  2ZW0 A;  5MPO A;  2G45 B;  2O6V A;  4MJS B;  2KJ6 A;  3UIO B;  3AUL A;  4BKS A;  2BYF A;  2WXP A;  3A1Q B;  5BMI A;  2B76 B;  1EF5 A;  3U2S C;  4GB9 A;  1FNW A;  3C8Y A;  1PYW D;  3AE9 B;  1YMH E;  3RD2 A;  3KWL A;  4B9K A;  2IJ0 A;  2FE8 A;  4BZA A;  3BIN A;  1J0G A;  2L3Z A;  3ZJV A;  2RDH A;  2K6D B;  4ACF A;  4B0M A;  3AEE B;  2VRR B;  1FNU A;  2KHW B;  3JVZ X;  5BYR A;  2JU6 X;  2ZZP B;  4XX5 A;  4PYU A;  4KX6 B;  2JPH A;  3MC9 A;  2D10 A;  1X1M A;  3Q14 C;  2MLB A;  2JWU A;  4US8 A;  2Y5P A;  3TMP B;  3TEZ A;  3PPA A;  1ZKH A;  1SF0 A;  2W54 A;  2Y5B B;  2Y5C A;  4YTM B;  1E8W A;  1LXD A;  2KLC A;  2L0T A;  2K1F A;  3BVG A;  4JWS C;  4XC2 A;  2K5P A;  2JVC A;  2LFI A;  4DHZ E;  1WGH A;  2L1A A;  1HEZ E;  2LRU A;  3MC0 B;  1F77 A;  1Q10 A;  1NEN B;  1UZX B;  2MQJ A;  3ZGZ A;  3ZYY X;  2K39 A;  3JW0 X;  3DBR I;  2AWT A;  1MVK A;  5JHA A;  1NI2 A;  1CJE A;  2G4S A;  4EZJ A;  4JL9 A;  3NUH B;  1SGH A;  4MDK E;  4F7Z A;  3Q8A A;  1FNV A;  4MGK E;  1IP9 A;  2BWE S;  2JSV X;  1DOI A;  2H88 B;  1C4A A;  3P2B A;  2K3U A;  2IND C;  3ETR A;  2GBK A;  1YOV B;  1WF9 A;  1XO3 A;  3ONS A;  2D11 A;  4YT0 B;  2BS3 B;  1K53 A;  1ZE3 D;  1JQ4 A;  3QA8 A;  3B2G A;  2K22 A;  4DK5 A;  3HK0 A;  1WH3 A;  5AEK B;  1K50 A;  5JHB A;  2R61 A;  3R2I A;  2WGS A;  3K9O B;  2DHZ A;  3ZKJ C;  2JZP A;  4IWP A;  4FAD A;  1WMH B;  3W2D A;  4AJY B;  1YJI A;  5CTR C;  1WJN A;  5LNK 1;  4NQL B;  3KUZ A;  2KWD A;  3V61 A;  4BKT A;  2JY6 A;  1RRB A;  1TKE A;  3VDZ A;  2KWU B;  2WQY B;  4CYE A;  2Z0D B;  3TEY A;  1KLU D;  4HJG E;  2FAZ A;  1CQV A;  4OZB A;  4II2 B;  3DBL B;  4NJ7 A;  2RDB C;  2QSD A;  1SE4 A;  4I6N B;  4KV2 A;  3RT3 B;  2BPS A;  3SDL C;  3N30 A;  4OHJ A;  1YD8 U;  1IBX A;  2LGX A;  1ZXI A;  4K81 A;  4XWW A;  1D6E C;  2LD9 A;  1V9J A;  4YXD B;  4HJK A;  3P4S B;  1P98 A;  5J18 A;  4HKQ A;  2MRP A;  2GOW A;  2TSS A;  1V81 A;  2G9H D;  3KH0 A;  1UWM A;  2IPK D;  4RGM A;  3W5V B;  4BOZ B;  1XLN A;  2IDY A;  2KDF B;  4URK A;  1J8C A;  2LGI A;  1V80 A;  2YEP F;  1LO5 D;  4TKN A;  4C7Z A;  1WJU A;  3V6C B;  4P6V F;  2N0S B;  2LVO A;  1FRR A;  2QHO A;  4L1B A;  2CHZ A;  3L4P A;  3R7R A;  3KYC D;  1QOB A;  2DZI A;  1T0Y A;  2JT4 B;  1WX9 A;  4W9F A;  1FD6 A;  2KJR A;  1C76 A;  4EZK A;  3DVG X;  3R2T A;  1C3T A;  3C19 A;  4MJS A;  1A70 A;  1FPY A;  2FUG 1;  3KW5 B;  3D32 A;  3NOB A;  5C1Z A;  1GNU A;  1EM7 A;  2K9X A;  5E6J A;  3A1Q A;  3Q3M C;  1L4Z B;  3HM6 X;  1WI0 A;  3UGB B;  3VR9 B;  1F0Z A;  4W9L A;  1B1Z A;  4O1N A;  2V3P A;  1T5X D;  2RR9 A;  4ZHO A;  4E74 A;  2FCM A;  3WAO A;  3IG3 A;  3B08 A;  3ENE A;  1ESF A;  3NVZ A;  1ZP0 B;  1H4R A;  5C23 A;  1WJ6 A;  4OW0 A;  4HXD A;  2JZ3 B;  3BII D;  2WXG A;  5AUK A;  4HDQ A;  2MJE A;  2WU5 B;  2KAN A;  4FBJ B;  4BOS C;  4TSS A;  1KFY B;  5GMV A;  2H89 B;  1OQQ A;  1E90 A;  3ZQ4 A;  3B9J A;  1AAR A;  1FXT B;  1WM3 A;  2WDQ B;  1CK1 A;  1P0R A;  4TMA B;  2WLB A;  3AE5 B;  3M3J A;  1YN5 A;  2KDE B;  3CSF A;  4TV3 A;  2AL3 A;  3P1M A;  4K3C A;  1IGC A;  2LRW A;  1XEE A;  2PKO A;  2N4F A;  2BQQ A;  3VTW A;  4RNA A;  4WWN A;  3PSE B;  4NNJ B;  3ZJT A;  2DYM A;  3O13 A;  3KLS X;  3M63 B;  1E7V A;  1L6U A;  1P1A A;  3H7P A;  4XGA B;  2M0A A;  3P42 A;  2L32 A;  3RNC C;  4BKG A;  2BTE A;  2ZPN A;  4PS8 A;  4HLE A;  2MH7 A;  2ZJD A;  1TGZ B;  2WHI A;  1J7C A;  1FRD A;  3AE3 B;  2QCZ A;  4A90 A;  2X8X X;  1OEY A;  3AU5 A;  1GOZ A;  1JWB D;  1HTO A;  3FAH A;  1T0R C;  3GS2 A;  3HVD A;  4OVU A;  2JX5 A;  3Q8C A;  4NJC A;  3UF8 A;  3SHQ A;  1WMH A;  2ZNV C;  2LHE A;  3GB1 A;  1MG8 A;  1VDV A;  2DBY A;  1D5Z C;  5E6N A;  1QOA A;  1Y56 A;  2DYO A;  2IO0 B;  2L7R A;  2IYD B;  5EE1 A;  4E3C A;  1FEH A;  4GOC A;  2WX1 A;  4KGT A;  1U4A A;  4HKZ E;  2L8J A;  1E10 A;  4BKS D;  2OJW A;  4IKG A;  3V6E B;  1ZUD 2;  4G50 A;  4DHZ B;  4PK1 A;  1NYQ A;  1ROE A;  1E7U A;  3Q3J A;  4M00 A;  2CKH B;  1I4R A;  3QQ8 B;  3HM3 A;  2ZEQ A;  1D3Z A;  3OJ3 A;  3Q6B A;  4NAW B;  4RF0 A;  4BVU C;  4E71 A;  2WXJ A;  4M8M A;  2MEK A;  2V4I B;  5C3J B;  1SE2 A;  1JRO A;  3VTU A;  5CHF A;  2BS4 B;  3PHX B;  1YX5 B;  2C5L C;  4MT5 A;  2N7J A;  4LDT B;  4RFB A;  3M95 A;  1LFD A;  2LJ5 A;  3HVZ A;  1YNT E;  3A4R A;  2K8C A;  4XWT A;  1VR9 A;  5DPW A;  1AW7 A;  1FMA D;  1M94 A;  1OGW A;  3UIN B;  2OHF A;  1Z2M A;  4YSX B;  3VRA B;  4HRO A;  2L05 A;  3NVV A;  1P9D U;  1MHH E;  2KAC A;  2I1J A;  4P1C C;  1XLQ A;  4ANW A;  4OVZ A;  1PGA A;  5DPS A;  1J7B A;  3WAL A;  3DVN V;  2J42 A;  3K9P B;  4KSL C;  2EMS A;  4BBN F;  3L10 B;  2MW5 A;  3RNB C;  2KQS A;  1EU3 A;  4C56 C;  2YLM A;  3W5U B;  4EEW A;  2X38 A;  4KZC A;  1N6Z A;  1EU4 A;  5AUI A;  3AE1 B;  5LLI A;  3AMZ A;  2OED A;  2W3R A;  4A20 A;  1JAL A;  3OG5 A;  1P3Q U;  2LEK A;  2LGD A;  4H2A A;  5LXH A;  2MA9 B;  5JZE B;  2KOX A;  1OQR A;  4M0W B;  1NYR A;  3ABV B;  3RN9 C;  4MGY E;  4WWO A;  4MSM B;  4PYZ A;  1R4M B;  3P63 A;  1MJD A;  3RI7 C;  3OAW A;  4RM9 A;  3DHH C;  3R7Q A;  2WDV B;  3RPF C;  3BK1 A;  1GPX A;  2DZM A;  2WXO A;  4P1B C;  2BKF A;  4WWP A;  1Y8R C;  1HZ6 A;  5D3I B;  3ZDT A;  2FCN A;  5HFY A;  2N1V A;  4W9G A;  3WAM A;  1JWM D;  1JWU D;  3VH3 B;  1VCB A;  2BB5 A;  2WXH A;  1WE6 A;  2MBE A;  1RFK A;  1QIL A;  1QOF A;  4Q2J A;  1Q5W B;  2PPH A;  1L0Y B;  1WWT A;  2JQR B;  3IAM 1;  4R3D A;  1B9R A;  3AEB B;  1VJK A;  2JRI B;  4REZ A;  4TQ0 A;  1PQS A;  4ZHP A;  1N61 A;  3NZ3 A;  1V6E A;  1Q0W B;  2N9X A;  3GE3 C;  2HTM E;  3PRP B;  1OFF A;  3ZXR A;  4DXG A;  3KQ4 A;  4RCO A;  4NJ6 A;  5L83 A;  4US9 A;  4IM3 A;  4DDI D;  1L0X B;  1WRI A;  2KFJ A;  2ZCC A;  3N1Z C;  4AS1 A;  3BYT B;  2J0M A;  4I6P A;  1EO6 A;  4TQ1 A;  1L2N A;  2IO2 B;  3R66 C;  1TS5 A;  1SXT A;  3A9K B;  1TZO A;  1V86 A;  1QF6 A;  2B3A A;  4HVB A;  2MWS B;  4ICU A;  1LGR A;  1V49 A;  2GMI C;  3AEG B;  3WAN A;  2QIE B;  2MBH A;  3UQA A;  1OTR B;  5IAA C;  3PZD A;  2NPT B;  2KX3 A;  4KDL B;  3LB8 C;  4DDG D;  1WE7 A;  1C9F A;  3A4S C;  4DXF A;  3TIX A;  2FIF A;  4ARC A;  1E6E B;  3W1S C;  2QEJ C;  3VVW B;  2KN4 A;  3CF6 E;  2KTF A;  2WU2 B;  4KKI A;  4EZL A;  3ZNZ B;  3QK0 A;  1WR1 A;  3QAQ A;  1NDD A;  2G3Q B;  1AN8 A;  1J7A A;  1DGJ A;  2V4L A;  5CHW A;  3AE2 B;  4USA A;  5HHD G;  5D7G A;  3DBS A;  4NAW A;  4KGR A;  3UI3 A;  2CJO A;  3PZ8 A;  3RNA C;  4AQ7 A;  2WXL A;  2KC2 A;  2G4D B;  2FID A;  2BT6 A;  3H7P B;  4MEM A;  3QWZ B;  1Q1O A;  2IY0 B;  2KO3 A;  2PEA A;  3L16 A;  1MHX A;  1PGB A;  1YJ1 A;  3I5J C;  2LUE A;  5FR3 A;  3VH4 B;  3APC A;  4ZRP A;  4WJO A;  1I4G A;  2K8H A;  2N9K A;  1YJJ A;  4KSK C;  1TTN A;  4A6Q A;  3P4Q B;  3DQV A;  1YQ4 B;  3GZN B;  2NTS A;  2YVC A;  2WWZ A;  2OOB B;  5FKA C;  3AE8 B;  4W9E A;  1RYJ A;  2M0X A;  4KVG B;  2L00 B;  4XDD A;  1EF1 A;  4HDO A;  3MJW A;  1VZ7 A;  1WIA A;  5EDS A;  2J4X A;  3BY4 B;  3PRZ A;  3NJT A;  2M17 A;  2EKI A;  2FUH B;  2SEB D;  3T3N A;  5IKC M;  1T3Q A;  3SFD B;  2WXI A;  2J7Q B;  1ZGU B;  2GI9 A;  5C2T B;  4W9I A;  2I38 A;  1S1Q B;  1TS2 A;  4M0W A;  2BW2 A;  4ANU A;  4FXC A;  3NS1 A;  4XDC A;  4ITK A;  2WS3 B;  1T6B X;  2PW9 A;  1XLP A;  1STE A;  2LAS A;  2LJI A;  4WAF A;  3QIJ A;  1C79 A;  1BUI C;  2GBR A;  2IO3 B;  3ZTC A;  1SSN A;  1TYG B;  1IYF A;  1R4M I;  4HCP B;  2ACZ B;  3AU4 A;  1GUA B;  1WX7 A;  5EE9 A;  2NMQ A;  3B2F A;  1ZOY B;  3IXS A;  1FIQ A;  1NBF C;  3AEF B;  1C1Y B;  2CR5 A;  4MGZ E;  2LMC A;  1ZXH A;  4WAA A;  3UIP B;  1H8C A;  4G3X B;  1I7H A;  2N1W A;  1L4D B;  2PVG C;  1L5P A;  3N9Y C;  2M1M A;  2BF8 B;  2Z8L A;  2KC1 A;  2MSE D;  1HA5 A;  5G55 A;  2KQ7 A;  3Q3O C;  4ZYS A;  4IW0 A;  3PRE A;  3VFK A;  4LNK A;  1UEL A;  2INN E;  1KM7 A;  1WXM A;  2KN5 A;  2V9H A;  3PHW B;  5I4D A;  1N60 A;  4YTP B;  4PS3 A;  3QHT A;  1CZP A;  3B0A A;  3PGE A;  2ICI A;  1L7Y A;  2QIL A;  1WYG A;  2MBO A;  4GIV A;  1WY8 A;  1JCK B;  2JWZ A;  1SEB D;  4S0R A;  2R2O A;  4XYC A;  3FC4 A;  5JH5 C;  2KXJ A;  1KH0 A;  4MEL A;  1WYW B;  3A9K A;  2ZNV B;  3V62 A;  1FFU A;  3KUD B;  4RGO S;  3V05 A;  3TCA A;  5TR5 A;  2RGF A;  4W9C A;  3RFZ B;  2W82 A;  4WJP A;  4W9H A;  4DBG A;  4I6L B;  2C7N B;  2BYT A;  3NS8 A;  1RFA A;  2NPT A;  3PVL A;  2INC C;  1GG3 A;  2XK5 B;  2D07 B;  2DLB A;  3NG0 A;  3U7D A;  3LYY A;  4KIK B;  2CJN A;  2ASQ A;  2HJ8 A;  5DPR A;  1TS3 A;  4JQW C;  3T9L A;  1DYQ A;  2FCS A;  2KQ4 X;  4DHJ B;  3CIR B;  1KLV A;  2HTH A;  3NZU A;  4LNI A;  4MSQ B;  1TJE A;  3TL5 A;  2BGF A;  2N9L A;  3ALB A;  2GRI A;  4LNN A;  3KYD D;  2UYZ B;  3OWE B;  1WFY A;  2WYQ A;  1UWX A;  2AEH A;  2LGY A;  4DQO C;  1V5O A;  2MBQ A;  3IBE A;  2KMA A;  2Z59 B;  2JYT A;  4EE2 A;  4W9K A;  4BFR A;  1A5R A;  1XD3 B;  3Q8B A;  3LDZ E;  2K6Q A;  1WZ3 A;  3ZJU A;  4PT5 A;  2L52 A;  4UDU C;  4ZDV A;  1KRH A;  1PFD A;  2N7D A;  1DOY A;  3Q8E A;  3HIZ A;  2WXQ A;  3V60 A;  1IUE A;  4AJW A;  3NRZ A;  2M19 A;  1QLB B;  2KYW A;  2MJ3 A;  4FN2 A;  4MM3 B;  4DHJ D;  3IHP C;  2J52 A;  1V97 A;  4KGS A;  3N32 A;  1Z5S B;  3BZD B;  3CWI A;  4MGI E;  2V3S A;  5D94 A;  4WJN A;  4ZRQ A;  3IVF A;  1YN4 A;  3IFW B;  4G0N B;  2V0G A;  2HE7 A;  1XF5 L;  2M56 B;  2JRH A;  1JRU A;  3EHV A;  4LNF A;  4RH6 A;  2REX A;  2ZVN A;  2NBW B;  1E8Z A;  3GZN I;  3I57 A;  5AZH A;  4NZL B;  3UQB A;  2D3C A;  3U52 E;  2AL6 A;  4XZ4 A;  1R7S A;  3APD A;  1FXI A;  2C7M B;  2HD5 B;  3ZRF A;  3DCG A;  1FCC C;  5FR6 A;  2IBI B;  4PS7 A;  1WXS A;  3L08 A;  4XE0 A;  5EE3 A;  1JML A;  2W9N A;  3N1X C;  1C77 A;  4P7I A;  2RD0 A;  2NR2 A;  2RPQ A;  3W1Y A;  3AB5 A;  4HWI B;  4FA6 A;  4WQO B;  2DWQ A;  2PVO D;  4JE3 B;  1UNS A;  4II3 B;  1YQB A;  3OJ4 B;  1AYF A;  3KUC B;  1QZE A;  3EFC A;  4WQM A;  4BBN C;  1FCL A;  3I9V 1;  2LVP A;  4FJV B;  2NVU I;  2I1K A;  3VXW A;  2ZPY A;  1XXG A;  4K3B A;  2J0J A;  4M8N A;  2W3S A;  2NBU A;  1E8X A;  3QX1 A;  4ICV A;  1E9M A;  4LLG M;  4IC7 B;  2KVR A;  1XLO A;  2PJH A;  3RCZ A;  4RGT A;  4C80 A;  2XBB C;  1WGD A;  1WGK A;  4S17 A;  5D3D A;  5IA7 A;  3H9D A;  2KDI A;  2AX5 A;  3QC8 B;  1JRP A;  4A9A A;  5KHQ A;  3SR6 A;  3L0W B;  3PTF C;  1WGY A;  2EMT A;  4RMA A;  2W55 A;  1GAQ B;  1TKY A;  3Q3F A;  4LDT D;  1TKG A;  3Q8F A;  2QMT A;  4HEA 1;  3ZXV A;  3BWU D;  1WSP A;  2MJD A;  4GDK B;  4WH4 A;  3KWV A;  2KDM A;  2IY1 B;  3RZF A;  1HXY D;  2QJL A;  1DOX A;  1G6J A;  3AED B;  3AM9 A;  4YL8 A;  3DBH B;  1C78 A;  3LXF A;  2LZ6 A;  2BB6 A;  1OQY A;  1UUP A;  4N6E B;  1ZDX A;  3WIM A;  2AQ1 B;  4F8C B;  2RSU A;  1XCT L;  4HRS A;  3RUI B;  4RGN A;  2AYO B;  3ML8 A;  4A8X C;  3HUI A;  3SFE B;  5IP4 D;  2IGH A;  2CHX A;  3ZNH B;  3VTV A;  4GMV A;  4MH0 E;  2XK5 A;  2EKE C;  3E56 A;  3H7S A;  4EKU A;  2LUM A;  2D3A A;  4KIK A;  1UBQ A;  2AQ2 B;  2KT7 A;  4L2Y A;  1KTK A;  1TT5 B;  2EEL A;  3PV1 A;  2L76 A;  3VUY A;  1P7E A;  4YWG G;  1N5X A;  1D4B A;  2BS2 B;  1UF0 A;  1UGM A;  4AP4 C;  2LGS A;  5AZG A;  1QT9 A;  2PLP A;  4W9J A;  4EFO A;  3RYT A;  4W9D A;  4ZRI A;  3VUW A;  4CHK A;  2KDB A;  2DAF A;  1SJE D;  2Y3A A;  2WXK A;  2LWP A;  2BWF A;  1WM2 A;  1V2Y A;  2ZVO A;  4TUU A;  3ZRC A;  3O65 B;  3GE8 C;  1NVI D;  3HHM A;  5DPT A;  1PGX A;  1IGD A;  2XN9 C;  3L13 A;  2M4N A;  4JWU C;  2QDF A;  5E6O A;  3ZNI D;  1WRD B;  3DVG Y;  2KZR A;  2CU3 A;  3TSS A;  1RLF A;  4N59 A;  2KMC A;  4KZ0 A;  2D5G A;  2JUO A;  4KKJ A;  4C4V B;  1MG4 A;  1HE8 A;  3ECI A;  1D5X C;  1WGR A;  4FUL A;  3T3O A;  3AXC A;  3OLM D;  4A55 A;  1FO4 A;  1HQR D;  4MM3 A;  4IM2 A;  2WDT B;  1ET6 A;  4GDL B;  4LJP B;  2ON8 A;  1V1P A;  1YIW A;  2IO1 B;  4MAC A;  2A5U A;  3ML9 A;  1V5T A;  2D3B A;  4G11 A;  3ZW3 A;  5J17 A;  2MCN B;  2L0F A;  2KTR A;  1SIF A;  3LJ3 A;  4FLH A; 
#chains in the Genus database with same CATH homology
 1TYG B;  2ACZ B;  2M0A A;  3P42 A;  1FFV A;  5EE9 A;  2L32 A;  3URY A;  1M4V A;  4L23 A;  1I4Q A;  3FIL A;  2BTE A;  2RMM A;  2NMQ A;  3B2F A;  1VLB A;  2MH7 A;  1TY0 A;  1ZOY B;  3MHZ A;  1E0Z A;  2PMV A;  3IXS A;  1FIQ A;  5BMG A;  1N62 A;  3AEF B;  3IT4 B;  1J7C A;  3HRD D;  2LMC A;  2WDR B;  1ZXH A;  1FRD A;  3AE3 B;  1I7H A;  3VR8 B;  4WUR A;  1NI3 A;  3TEW A;  1SIJ A;  2YEP B;  1YQ3 B;  5G5H A;  1L4D B;  2PVG C;  4A90 A;  3EUB 2;  1L5P A;  1GOZ A;  1P7F A;  3N9Y C;  1JWB D;  1KF6 B;  3AN1 A;  3FAH A;  4YSZ B;  3HVD A;  3GS2 A;  2Z8L A;  1TS4 A;  2JX5 A;  1HA5 A;  1ZDV A;  3Q8C A;  4NJC A;  4ZYS A;  1IBX B;  2FBW B;  2HDE A;  2LHE A;  3GB1 A;  1ENF A;  2K0P A;  1VDV A;  2DBY A;  1D5Z C;  2INN E;  1QOA A;  1Y56 A;  2DYO A;  3AE7 B;  4P16 A;  5I4D A;  1VZ8 A;  3U7Z A;  1N60 A;  4YTP B;  1CZP A;  3DWM A;  4JX1 C;  1I4P A;  2ICI A;  4CQN A;  5EE1 A;  1FEH A;  4KGT A;  2QIL A;  1WYG A;  2JYE A;  3NVW A;  1JCK B;  4HKZ E;  2RPV A;  1K51 A;  1SEB D;  1BML C;  1JWA D;  1E10 A;  5TSS A;  3J9C A;  1AWD A;  4IKG A;  1ZUD 2;  3FC4 A;  1D5M C;  1E7P B;  1C4C A;  2WNM A;  1NYQ A;  1ROE A;  4ZOH C;  5BYQ A;  1KH0 A;  1RM6 C;  4J3O D;  1I4R A;  2NTT A;  4WIP A;  3WCQ A;  1FFU A;  3BYY B;  4RGO S;  2WP9 B;  1GB4 A;  3MJ5 A;  3V05 A;  2INP E;  1BXT A;  3RFZ B;  4NAW B;  2W82 A;  4RF0 A;  3IT6 B;  2WXJ A;  2BYT A;  2MEK A;  2V4I B;  4IOI E;  1L0V B;  2ZW0 A;  1SE2 A;  1JRO A;  2E3T A;  5C3J B;  5MPO A;  2BS4 B;  2L83 A;  4OZC A;  4D2K A;  4MT5 A;  2N7J A;  4RFB A;  2DLB A;  3LYY A;  2PIA A;  3HVZ A;  1YNT E;  2CJN A;  4XWT A;  1VR9 A;  2J53 A;  1AW7 A;  1TS3 A;  2WXP A;  1FMA D;  3AEA B;  1DYQ A;  3PO0 A;  5BMI A;  1N5W A;  1VRA B;  1SB3 C;  2B76 B;  2KQ4 X;  2OHF A;  3CIR B;  2AQ3 B;  3U2S C;  4YSX B;  5BYS A;  1FNW A;  1N63 A;  1TJE A;  3VRA B;  2KMM A;  3C8Y A;  4HRO A;  2N9L A;  1PYW D;  2GRI A;  3AE9 B;  1YMH E;  3NVV A;  3KWL A;  3OWE B;  2IJ0 A;  2FE8 A;  1MHH E;  1UWX A;  3ZJV A;  2RDH A;  2KAC A;  4B0M A;  3P4P B;  4DQO C;  1XLQ A;  4OVZ A;  1PGA A;  3AEE B;  1J7B A;  1I4X A;  1FNU A;  4EE2 A;  2JYT A;  2J42 A;  3MP9 A;  5BYR A;  2JU6 X;  3W1S A;  3Q8B A;  4KX6 B;  3ZJU A;  1EU3 A;  4PT5 A;  4N58 A;  2JWU A;  4C56 C;  2L52 A;  4UDU C;  4US8 A;  1KRH A;  2Y5P A;  1PFD A;  3TEZ A;  2RDG A;  3W5U B;  3AE4 B;  2X38 A;  1SF0 A;  2W54 A;  2Y5C A;  1DOY A;  4YTM B;  3Q8E A;  1EU4 A;  2WXQ A;  1L6V A;  5AUI A;  3AE1 B;  1IUE A;  1ET9 A;  3NRZ A;  3AMZ A;  3BVG A;  2OED A;  2W3R A;  4JWS C;  2PTL A;  2K5P A;  2LFI A;  2M19 A;  1JAL A;  2L1A A;  1HEZ E;  4IDI A;  1QLB B;  2LEK A;  2MJ3 A;  4MM3 B;  3MC0 B;  2J52 A;  1V97 A;  1F77 A;  4KGS A;  4H2A A;  1Q10 A;  3AE6 B;  1NEN B;  3BZD B;  3CWI A;  3ZGZ A;  1OQR A;  3ZYY X;  1NYR A;  3ABV B;  3H8H A;  4ZRQ A;  1MVK A;  1YN4 A;  2Q5W D;  2V0G A;  3P63 A;  1XF5 L;  2M56 B;  4YTN B;  1CJE A;  1ACC A;  4RH6 A;  3NUH B;  3Q8A A;  3I57 A;  1FNV A;  2WDV B;  4NZL B;  3RPF C;  1C4P A;  3BK1 A;  1GPX A;  3MFG A;  2JSV X;  2WXO A;  1DOI A;  2H88 B;  3U52 E;  4LK0 M;  1MI0 A;  1TY2 A;  1C4A A;  1HZ6 A;  2K3U A;  1R7S A;  3FIL B;  5EE0 A;  2VZK B;  5G5G A;  3SEB A;  1F2R C;  1FXI A;  1YN3 A;  5D3I B;  3ETR A;  2WXF A;  5HFY A;  1FCC C;  1SE3 A;  1FM0 D;  1XO3 A;  5EE3 A;  4YT0 B;  1VZ6 A;  2BS3 B;  1K53 A;  1ZE3 D;  1JWM D;  1JQ4 A;  1JWU D;  1WXQ A;  3B2G A;  2BB5 A;  2K22 A;  2WXH A;  1RFK A;  1QIL A;  1QOF A;  4XE0 A;  4Q2J A;  1K50 A;  3EA6 A;  1L0Y B;  1WWT A;  1JML A;  2G1E A;  2JQR B;  3IAM 1;  1C77 A;  4R3D A;  3AEB B;  5HI1 A;  1B9R A;  2R61 A;  3R2I A;  1VJK A;  3AB5 A;  1GB1 A;  4REZ A;  4TQ0 A;  2JZP A;  4ZHP A;  1N61 A;  2DWQ A;  2PVO D;  3NZ3 A;  4JE3 B;  3R8B A;  3W2D A;  1UNS A;  1V1O A;  1UGJ A;  2GB1 A;  3AV8 A;  1YJI A;  1ZPS A;  2HTM E;  1AYF A;  5LNK 1;  4JPS A;  1OFF A;  2KWD A;  4WQM A;  1FCL A;  3I9V 1;  2WXN A;  4B0E A;  4DXG A;  3KQ4 A;  1TKE A;  4RCO A;  4OZA A;  2WQY B;  4US9 A;  1L0X B;  1WRI A;  5HG2 A;  2I2Y A;  1XXG A;  5BMH A;  2W3S A;  3TEY A;  1KLU D;  4AS1 A;  1E9M A;  1JW9 D;  4LLG M;  4HJG E;  3BYT B;  1CQV A;  4OZB A;  1XLO A;  1NEK B;  2VZK D;  4TQ1 A;  2QSD A;  1SE4 A;  4RGT A;  4C80 A;  1TS5 A;  1SXT A;  3AEC B;  1TZO A;  1QF6 A;  1RWS A;  1WGK A;  5D3D A;  4OHJ A;  1SJH D;  1IBX A;  4C7Y A;  2AX5 A;  1JRP A;  1ZXI A;  1KLG D;  3AEG B;  4A9A A;  4XWW A;  3SR6 A;  4YSY B;  1D6E C;  2QIE B;  1QKZ A;  2ZW1 A;  3BVM A;  3LB8 C;  4YXD B;  1C9F A;  3P4S B;  2W55 A;  1GAQ B;  1TKY A;  1V8C A;  4HKQ A;  4DXF A;  1TKG A;  3AH7 A;  2TSS A;  2QMT A;  3Q8F A;  4HEA 1;  3BWU D;  1WSP A;  2G9H D;  1E6E B;  2MJD A;  4ARC A;  2QEJ C;  5H92 C;  4GDK B;  3NVY A;  1UWM A;  4WH4 A;  2IPK D;  2KN4 A;  3KWV A;  2KDM A;  4RGM A;  1HXY D;  2QJL A;  3W5V B;  1DOX A;  3AED B;  2LHD A;  3AM9 A;  1EWY C;  3P4R B;  1XLN A;  2IDY A;  2WU2 B;  4KKI A;  1EWC A;  1C78 A;  1V1P B;  3LXF A;  2BB6 A;  5T8I A;  4GLS C;  2LGI A;  1UUP A;  1AN8 A;  1J7A A;  1DGJ A;  2WXR A;  1LO5 D;  2YEP F;  4N6E B;  4C7Z A;  3AE2 B;  1ZDX A;  4USA A;  2IGG A;  4P6V F;  1PDX A;  2AQ1 B;  5D7G A;  5HHD G;  1K52 A;  2N0S B;  2KAJ A;  3BVZ A;  1FRR A;  4L1B A;  4HRS A;  1XCT L;  3L4P A;  4RGN A;  4KGR A;  3UI3 A;  2CJO A;  3PZ8 A;  4A8X C;  3HUI A;  1QOB A;  4MH8 A;  2WXL A;  3SFE B;  4AQ7 A;  2IGH A;  1FD6 A;  1C76 A;  2BT6 A;  3R2T A;  3E56 A;  4NAM A;  4RF1 A;  2LUM A;  1A70 A;  2FUG 1;  1MHX A;  2ONQ A;  1PGB A;  2AQ2 B;  3PZ7 A;  1HZ5 A;  4L2Y A;  1EM7 A;  2K9X A;  2BBC A;  1MPE A;  1KTK A;  5E6J A;  2EEL A;  5FK9 C;  3V3X A;  1P7E A;  1L4Z B;  4YWG G;  4LTU A;  1N5X A;  1D4B A;  2BS2 B;  3VR9 B;  1F0Z A;  1QT9 A;  5FR3 A;  1B1Z A;  4O1N A;  2PLP A;  4ARI A;  2V3P A;  4ZRP A;  1T5X D;  1F2R I;  4ZHO A;  1I4G A;  3EGR A;  1SJE D;  3GP7 A;  2N9K A;  1ESF A;  2Y3A A;  2IGD A;  3NVZ A;  1ZP0 B;  2SAK A;  1YJJ A;  2WXK A;  5JXV A;  4OW0 A;  4A6Q A;  3P4Q B;  3BII D;  2WXG A;  1NVI D;  1YQ4 B;  5AUK A;  2NTS A;  1PGX A;  2MJE A;  2WU5 B;  1IGD A;  1QQR A;  2XN9 C;  4JWU C;  5FKA C;  3AE8 B;  4TSS A;  1SBB B;  3U4E G;  2CU3 A;  1RYJ A;  1KFY B;  4XDD A;  3TSS A;  4N59 A;  2WXM A;  2XNA C;  3BK2 A;  2H89 B;  1VZ7 A;  1OQQ A;  2E6X A;  1I4H A;  2D5G A;  3ZQ4 A;  2V3N A;  3B9J A;  2J4X A;  4KKJ A;  1D5X C;  2EKI A;  2WDQ B;  1CK1 A;  2SEB D;  5H8Y E;  3T3O A;  3T3N A;  4TMA B;  4A55 A;  1T3Q A;  1PUT A;  2WLB A;  3SFD B;  2WXI A;  1FO4 A;  3DWG C;  3AE5 B;  1HQR D;  1YN5 A;  1ET6 A;  2GI9 A;  4GDL B;  5C2T B;  2I38 A;  3TEX A;  1QOG A;  3W9C B;  1XCQ L;  2ON8 A;  3Q69 A;  1V1P A;  3P1M A;  1IGC A;  1TS2 A;  4M0W A;  4MAC A;  2BW2 A;  1XEE A;  2PKO A;  4FXC A;  3VQI A;  3NS1 A;  4XDC A;  4ITK A;  2WS3 B;  1T6B X;  2JXT A;  2PW9 A;  3VRB B;  1XLP A;  4RNA A;  3IAS 1;  3ZJT A;  1STE A;  2DYM A;  3O13 A;  2LJI A;  1JWS D;  3KLS X;  5GXG B;  4WAF A;  1L6U A;  3TUO A;  1C79 A;  1BUI C;  1FXA A;  3E9S A;  1SSN A;  4WWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...