1FMAD

Molybdopterin synthase (moad/moae)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
MIKVLFFAQVRELVGTDATEVAADFPTVEALRQHMAAQSDRWALALEDGKLLAAVNQTLVSFDHPLTDGDEVAFFPPVTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MOLYBDOPTERIN CONVERTING FACTOR, SUBUNIT 1
publication title Crystal structure of molybdopterin synthase and its evolutionary relationship to ubiquitin activation.
pubmed doi rcsb
source organism Escherichia coli
total genus 22
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2000-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fmaD00
1L0VB 3LXFA 2ACZB 3PO0A 5H8YE 2BS4B 3HRDD 1KRHA 5G5HA 1ZOYB 3VRBB 2E3TA 4ZHPA 5EE1A 1WGKA 1WWTA 1E0ZA 3AEEB 2BT6A 1EWYC 2JX5A 5G5GA 3P4PB 2BS2B 4YSZB 1ZP0B 3RPFC 4KX6B 1JW9D 4LTUA 1FO4A 1NENB 1KF6B 2BS3B 2G1EA 1FM0D 1XLNA 2EKIA 2DWQA 3B2GA 1N60A 1TKEA 3AE9B 3CIRB 2PVOD 3NVYA 1TJEA 3CWIA 3NVWA 1ZXIA 5GXGB 3SFDB 1L5PA 1E10A 3AE6B 1N61A 3FAHA 1SB3C 1JRPA 2MJEA 1NYRA 3W9CB 1UWMA 2K9XA 2WU2B 2W54A 2KMMA 3WCQA 1CZPA 1QOGA 3AE3B 3W5VB 1TKYA 1T3QA 4IDIA 1QOFA 3AE7B 1JROA 1N62A 2PKOA 3BIID 3AEBB 1FRRA 3KWLA 1OQRA 1FFVA 5C2TB 2WS3B 1ROEA 3AM9A 3NRZA 4P6VF 2WLBA 2K22A 3ZYYX 3HVZA 3L4PA 4HROA 1QOBA 2Y5CA 1B9RA 3VR8B 1RYJA 1NVID 1FRDA 4YT0B 2N0SB 1JWBD 2CU3A 3P4RB 5AUIA 5AUKA 1F0ZA 4N58A 2L52A 2W3RA 1RWSA 3AE4B 3P63A 4YTNB 1RM6C 5MPOA 1JQ4A 3NVZA 4WQMA 3AEAB 4N59A 5EE3A 4YXDB 1YQ3B 3B9JA 3FC4A 3NS1A 1TYGB 3DWGC 3AMZA 4US8A 1OQQA 3ABVB 2AX5A 1CJEA 1DOIA 1WYGA 4JWSC 3ETRA 4ZHOA 2PVGC 1V97A 3AE5B 1E9MA 1N5XA 4ITKA 1DOXA 1PFDA 3AN1A 1QLBB 4USAA 4YTPB 3VR9B 2WQYB 5EE0A 1RFKA 4YSXB 2KAJA 3DWMA 1YQ4B 4A9AA 2WDVB 5C3JB 4WWMA 4FXCA 3AV8A 4N6EB 2WU5B 3VRAB 3W5UB 2MH7A 1AWDA 4JX1C 1OFFA 1NI3A 2CJNA 3AEFB 1PUTA 2QIEB 3HUIA 3P4QB 1SIJA 5H92C 1VLBA 2WP9B 1R7SA 1L6UA 3LB8C 1JALA 2W3SA 4C7ZA 1GPXA 1FXAA 2HTME 2LEKA 1QOAA 3P4SB 5EE9A 1QF6A 1VDVA 3AEDB 2L83A 1L6VA 4C80A 1KFYB 3AEGB 2Q5WD 3AB5A 2W55A 1V8CA 2K5PA 1VJKA 2DBYA 1XO3A 2H89B 3EUB2 3P1MA 1A70A 1E7PB 3AECB 4ZOHC 3AH7A 1QT9A 1YJIA 1FXIA 1NYQA 2FBWB 1IUEA 2QJLA 4JWUC 2M56B 3AE1B 3SR6A 3B2FA 1DOYA 1SF0A 3AE8B 1FFUA 2OHFA 1FMAD 2MJ3A 4US9A 1JWAD 1AYFA 1TKGA 2CJOA 2M19A 1E6EB 1J7AA 1J7BA 1N63A 1XLOA 2WDQB 4HRSA 1XLQA 2JQRB 2PIAA 2WDRB 2MJDA 1GAQB 1ZUD2 1YJJA 3AE2B 1J7CA 1XLPA 3SFEB 1WRIA 4YSYB 1DGJA 2B76B 2H88B 1PDXA 1WXQA 1I7HA 4YTMB 1NEKB 3NVVA 1FIQA 1N5WA 4C7YA
chains in the Genus database with same CATH superfamily
1WZ3A 3N1YC 2ACZB 2L0TA 1KRHA 3GZNI 3UQAA 4CQNA 1E0ZA 2KK8A 4TMAB 2VH1A 3NZSA 4WAFA 5CHWA 2G1EA 1ZW7A 3BK1A 4LLGM 2DWQA 3B2GA 2PVOD 4W9CA 3IAS1 3FAHA 3IBEA 4KZ0A 1YN4A 1PGXA 2XK5B 3HK0A 4NAWB 1T3QA 1QOFA 1P7EA 4PS7A 2LVQA 4GDKB 4GB9A 1F0ZA 2TSSA 1R4NI 3B08A 3PHWB 2QCZA 2JY6A 3EC8A 3R3MA 3AEAB 4N59A 5EDSA 2QILA 4TUUA 2FUHB 2MX2A 1WJ6A 2DNFA 2V3NA 4RM9A 1QLBB 3EA6A 2INDC 1RFKA 3TMPB 3VH3B 1YQ4B 5E6PA 5C3JB 2K39A 3QX1A 1AWDA 4NAWA 1PUTA 2WNMA 3B0AA 1EO6A 1ZKHA 4EOYA 2J0MA 1WMHB 3ZTDA 4KSLC 3H7PB 3N32A 2INCC 2L3ZA 4ZOHC 1YJIA 5D6JB 1NYQA 2J0JA 2M56B 3LJ3A 4JGHB 4L23A 2KWCA 2NPTB 3QJZA 2PIAA 1GAQB 3AE2B 3QARA 3AI5A 2B76B 5FKAC 2MBBB 2W82A 3L54A 3PLVA 2INPE 1IBXB 4W9JA 1LFDA 3DBLI 1EWYC 2K25A 4L1BA 4GU2A 4K3BA 2KMAA 2ZCCA 3PRPB 4XWTA 3PV1A 2RD0A 3IVFA 3H7PA 2IPKD 2ZNVB 3RNEC 4GDLA 3EFUA 3JYUA 3LYYA 3RT3B 4KV2A 2MRPA 4BKSA 2ZPYA 1MVKA 3WANA 2NPTA 3ZW3A 3AE7B 1BXTA 3ECIA 4M8MA 3L4PA 1QOBA 4LCDE 2ZJDA 1ENFA 1IBXA 1TS2A 3PHXB 2IO0B 3MHZA 1HXYD 2L8JA 1TGZB 3B9JA 1BMLC 2C7HA 1XQQA 2LVOA 2NMQA 2HTHA 4GLSC 4KGSA 4DQOC 3M63B 4DXFA 1B1ZA 3I3TB 5G55A 4HDOA 1WXAA 4S17A 2HD5B 2MQJA 1JALA 2N9PC 2WXNA 2GOWA 3AEDB 1KFYB 1L4DB 4W9IA 2MEKA 3E56A 1A70A 1E7PB 1MG8A 4KSKC 2JZZA 4PS8A 4EZJA 3HM3A 2KKCA 1HZ6A 1E6EB 2JWUA 2SEBD 2JUOA 4HXDA 1J7CA 4PS3A 2IO2B 5HHDG 3NVVA 4C7YA 3GS2A 3DHGC 3D32A 3L10B 4ARCA 1D5XC 1PQSA 3ENEA 4IWOA 1WGRA 3RN9C 1XLNA 1QKZA 1I4XA 1A5RA 4WAAA 4MGZE 1LM8B 2JT4B 2DZMA 2N9EB 4M02A 3KUDB 2N7JA 2KMMA 2V9HA 3UINB 2MWSB 1WR6E 5E6OA 2PMVA 4K7SA 1MI0A 2G4SA 3LDZE 3TEWA 3CF6E 2QEJC 3WAOA 1JWBD 2NS5A 4MSMB 4N58A 3WALA 2L52A 2KDBA 4E71A 5FR3A 2JYEA 5DPRA 4C00A 3RUIB 4ITKA 1LXDA 3MC9A 2D11A 2GBRA 3GE3C 1F1HA 4LJOB 1UF0A 2MBOA 4WWMA 4W9EA 2K8HA 3K9OB 3ZTCA 4BKGA 1K53A 1GPXA 4KIKB 2MLBA 4G11A 3TEXA 5J17A 1JMLA 2IZVB 1QT9A 4LNKA 4HPPA 1JWMD 1MG4A 2AQ2B 2KACA 4OVVA 2N7EA 1AARA 5IAAC 5JZEB 1STEA 3APCA 1J19A 3AXCA 2MJDA 2RDHA 2JVCA 1ZXHA 2A5UA 1DGJA 4YTMB 4MJSB 4ZRKA 3BVMA 2D10A 1SIFA 1EM7A 3PZDA 1M4VA 5IKCM 1SE4A 3UGBB 4DXGA 4KIKA 4UDUC 3APDA 4KZCA 2XBBC 2QDFA 4HCPB 2KX0A 3DHHC 4BBNC 3Q3FA 2PEAA 5IA7A 2LUMA 3ZRCA 1X1MA 2KJHB 4M00A 3RULA 2I1KA 3TIXA 1KLUD 1WR1A 4MJSA 1B9RA 4B6WA 4RGMA 4YT0B 2N0SB 5LLIA 2KFKB 1SSNA 1GB1A 2DAJA 1YX5B 2ZPNA 2AEHA 3ABVB 3DQVA 2JRHA 4WJOA 4JWSC 3W1YA 1QZEA 3AE5B 2WX1A 3P2BA 1WF9A 4I6PA 4LK0M 1OFFA 3RYTA 1D4BA 4WJQA 2K6QA 1WGYA 3Q3JA 1FNUA 4MH8A 3OJ3A 2W3SA 2HTME 2L1AA 1L6VA 2MHJA 3AB5A 5JHBA 2H89B 4RM8A 4WJPA 2ZEQA 2OJRA 2KFKA 4G50A 3AE8B 4BKTA 2K0PA 3MTNB 3DBHB 1R4MB 2HJ8A 1J7BA 3VTVA 3BYYB 3GE8C 4PK1A 4GGQA 4BAXA 2LRUA 2KVRA 2QHOA 4DHZE 1E7UA 4GSWA 1N5WA 4D2KA 1PGAA 5H8YE 2BS4B 4O1NA 2BBCA 1BT0A 4ZHPA 2LRWA 3A33B 3U8ZA 2EKEC 2BTEA 1WJUA 2FCMA 1WXMA 2BS3B 1ZPSA 1V5OA 4HPMB 1TKEA 4MGYE 3GOEA 3CWIA 2BPSA 1L5PA 4HCNB 5D3DA 4KDIC 4TV3A 2WXIA 4B95A 1YX6B 1CZPA 2DZKA 2LASA 2BYVE 2HE7A 4II3B 2N9KA 2PJHA 1C9FA 2Y5CA 1I42A 1RYJA 2MBEA 3AULA 2WXMA 3RFZB 3OG5A 3TEZA 2R2QA 2ZVNA 4RF0A 4ARIA 2KXJA 2M0AA 2A4ZA 4WWPA 2C7NB 1WM2A 3RNAC 4PYUA 1V6EA 1N5XA 2LJ5A 3DBSA 3O65B 3AU5A 3SDLC 1IGCA 2JSVX 5TR5A 3CSTA 3APFA 4Q2JA 2N9XA 2XNAC 3Q2AC 1YMHE 2MBQA 2Y5BB 4DDGD 3N30A 1VJKA 3A9JB 2KD0A 3T3OA 4NQKE 3V3XA 3AE1B 4B9KA 2BGFA 4ZRQA 1FCCC 2MW5A 2ONQA 2KWDA 2JQRB 2WDRB 1C4CA 4CYEA 4MH0E 3OAWA 2CU1A 3BINA 3PVLA 4BVUC 2I1JA 2B3AA 3VHTC 2JU6X 2BT6A 2JX5A 3NS8A 2L05A 3H7SA 2Y5PA 2EKIA 3A9JA 4BBNF 1T0QC 1XT9B 2DYMA 4TSSA 1NYRA 1UWMA 4NZLB 5CTRC 3JW0X 3PZ7A 1SE3A 1ROEA 2RPQA 3ZKJC 3A4RA 4BOSC 4FADA 2UWQA 3PGEA 1SE9A 1FRDA 3X0WA 5KHOA 1V86A 3DBHI 3WIMA 1YQ3B 4ZYSA 2KN5A 1NI2A 4BOZB 4CO7A 3JVZX 2PW9A 1E8YA 4A9AA 5DPSA 2WXHA 1JCKB 3Q14C 2GBJA 2WU5B 2L00B 4JX1C 1T0SC 4OVUA 1SIJA 2JWZA 1WY8A 1V2YA 1NDDA 2LEKA 4RNAA 4RMAA 3MFGA 1SEBD 5BMIA 5HFYA 5IP4D 2IBIB 4WQOB 1IUEA 1OQYA 5DCNA 2J53A 2KX3A 2N4FA 2OHFA 3VXWA 3N3KB 1EF1A 1WRDB 1XLQA 3M3JA 5D7GA 2ZZPB 4N9F4 2SAKA 1GC7A 1CK1A 4KX6B 1L0VB 3PO0A 2AL3A 2VH2A 2D5GA 1AW7A 1UWXA 1MJDA 2AQ1B 4GDLB 1I4GA 4XWWA 1ZP0B 3VUYA 1FO4A 1NENB 4F1SA 1GUAB 3A1QB 3CIRB 2WXKA 2XEWA 2WGSA 3SFDB 2LHDA 3DVNU 3Q3OC 2MJEA 1YOVB 2V1YA 1F9JA 2FCQA 1TKYA 1T0RC 3AEBB 1OQRA 3Q69A 2LFIA 3ZYYX 2N1VA 3I9V1 3ZDTA 2J0KA 3PRZA 1YJ1A 4ANXA 2CU3A 2DYBA 1GC6A 3R2TA 4FULA 1V80A 4JIOU 1ACCA 1Q0WB 1WIAA 1HTOA 2I2YA 2NBUA 4HLEA 2RDBC 4MM3B 3ETRA 3HHMA 4JLCA 3NY5A 3WAMA 3A1QA 3IG3A 4A55A 3AN1A 2VZKD 2IY0B 2BWFA 2WXLA 2GLSA 2D3BA 2KDFB 3VRAB 2RDGA 4J3OD 3HUIA 3LB8C 4DHZB 1YIWA 2L7RA 4MT5A 1V8CA 1XO3A 3EUB2 1KLGD 3UIPB 4FJVB 2DHZA 3OWEB 1GG3A 3A9KA 3KH0A 1JWAD 3ZNZB 2BB5A 4JE3B 1YN3A 1JWSD 3JSVA 4MM3A 1WFYA 3SFEB 1TS5A 1P9DU 2NR2A 1NEKB 2W9NA 1UZXB 4EEWA 4K7WA 3WA0A 4JPSA 2O6VD 2V3PA 3VRBB 1OEYJ 1S3SG 2JZPA 5GMVA 2ASQA 3L13A 4JQWC 3VQIA 4FBJB 1FM0D 2C60A 3PSEB 3NVYA 2X8XX 2MA9B 2CHXA 4ASWC 1TY2A 3ZJTA 4WIPA 1JRPA 5J18A 3V60A 4IG7B 4XX5A 4WJNA 1U4AA 4ANWA 5IN7A 3V62A 1LGRA 1KJTA 3KWLA 5C2TB 4OZCA 3VR8B 1HA5A 2CHWA 2KHWB 4W9HA 3P4RB 4HDQA 2ICIA 1TT5B 2W3RA 1RWSA 2FIDA 2JRIB 1OEYA 4TKNA 4US8A 4WURA 4MELA 2KANA 4LNFA 3C0RB 1SE2A 1P0RA 1UH6A 2G45B 5BMGA 2KYWA 2LHEA 2INNE 1HTQA 2D3CA 3ZGZA 1TY0A 1VRAB 1Z5SB 3QC8B 2L83A 2JXXA 4R3DA 3P1MA 2KLGA 3AECB 4AJYB 3QIJA 2QJLA 2LMCA 3SR6A 2FAZA 3ZNHB 4US9A 3ZXVA 1T6BX 1TKGA 2M19A 3L08A 1KLVA 3DBRB 2V4IB 1C1YB 2VZKB 1WRIA 4RF1A 5C1ZA 1I7HA 3L0WB 3LXFA 4K3CA 3IXSA 2JF5A 2M8SA 1FCLA 4KVGB 3ZDMC 5G5GA 4QAYA 1K52A 4YL8A 1E7VA 3VVWB 4WWNA 2KT7A 1Y56A 4MGKE 1WE6A 2C9WB 4A90A 4TQ0A 2D3AA 3NVWA 5DPWA 2KO3A 5E6NA 1F77A 1RRBA 4XC2A 2W54A 4M01A 4HK2A 2ZW1A 2GRIA 2WX0A 3Q6BA 2FNJB 2GI9A 2WXOA 3H1UA 2WS3B 3DVGY 1VZ8A 2K22A 4BZAA 1WJ4A 3HVZA 5AZHA 1Z2MA 1IGDA 2IO3B 1OGWA 4HPLB 3ZLZA 3BZDB 1GJZA 3T9LA 4OW0A 3NVZA 1SJED 3FC4A 5D94A 3RZWC 4DHJD 2PE6B 4MGIE 3TCAA 1EUVB 5TSSA 2G3QB 1DOIA 5LXHA 2PVGC 4ANUA 4HEA1 1DOXA 4NNJB 1TS3A 3ZVVA 4HKZE 2BYFA 2KQ4X 3UF8A 1SBBB 2AQ3B 1XF5L 1J0GA 4N6EB 2YLMA 2L76A 3W5UB 3AEFB 1FEHA 4IOIE 1HZ5A 3P4QB 4A20A 2O2VB 4EZLA 2IO1B 1QF6A 1VDVA 1C4PA 1XCTL 2O6VA 4WWOA 1M94A 2FIFA 3QCAA 4LNNA 4W9DA 4HJGE 4LDTD 4A8XC 1RAXA 3BWUD 2REXA 4OZAA 2VRRB 2ZCBA 3Q8FA 5BYQA 1WGGA 4NPNA 1YNTE 1KM7A 3R66C 3MJWA 3IT4B 4YSYB 1EF5A 5L83A 4PYZA 4A3OA 1TIFA 3C19A 5HG2A 1YN5A 4ZRPA 5G5HA 1ZOYB 1P98A 2BWES 2AWTA 2O2VA 4IWPA 2J42A 1Q1OA 4KGTA 3HIZA 1KF6B 2CHZA 1KTKA 3UQBA 1MHXA 1N60A 1WYWB 1FXTB 3GZNB 3KUCB 4LNIA 2JYTA 1F2RI 2WU2B 1QILA 2WWZA 4AJWA 4IWQA 4P6VF 1D5ZC 3SHQA 3GP7A 1XXGA 3VUWA 4XGAB 5JXVA 3IT6B 1I35A 4A6QA 4XE0A 2CR5A 3RNGC 1TZ1A 4YXDB 1EWCA 4AQ7A 4FN2A 1K51A 3SD5A 2DZIA 1RLFA 1V97A 5C23A 2OEDA 1E9MA 5CX3A 2D3GA 1V1OA 2QMTA 2N9LA 4E74A 1R4NB 4DBGA 3W1SC 3AV8A 2KDMA 5CHFA 5HI1A 2YVCA 4A3PA 4AWJA 4FA6A 2RGFA 5LNK1 1VZ6A 3P4SB 1Y8RC 1VCBA 3KWVA 1GNUA 1ISNA 2R61A 1IPGA 1FXIA 4HVBA 2ZW0A 4DHJB 1SF0A 3Q8AA 4B0EA 1FMAD 1N63A 1XLOA 1UGJA 3BVGA 2N7DA 1C3TA 2AYOB 2AL6A 2FE8A 5IOIA 1SGHA 1VZ7A 3TEYA 3QHTA 2Z0DB 2MCNB 2BKFA 1WGKA 1P1AA 2ZNVC 3RZFA 4RGNA 1VR9A 4OVZA 1E8ZA 3R2IA 4YSZB 3P4PB 2K8BA 4LTUA 4GN1A 4ICUA 2G4DB 1C78A 2BQQA 1P3QU 3AE6B 4KDLB 4X57B 2NBVB 1Q10A 3DBLB 1SJHD 2PTLA 1WM3A 2KFJA 2YEPF 2HDEA 2IGDA 4W9KA 1E8WA 5D2MB 2BYTA 4GIVA 4HROA 3Q8EA 4F8CB 3FKYA 2KN4A 1RFAA 3TJPA 4J6IA 4ICVA 3P63A 1JQ4A 1OQQA 2KDIA 2C7MB 2MP2B 4YSXB 2WXQA 3EECA 1UD7A 4M0WA 2WDVB 2KDEB 3SEBA 3PLUA 3QQ8B 1WJNA 3VUXA 3C8YA 1WGHA 1FXAA 1R4MI 2BYEA 1QOAA 2DZJA 2K6DB 3VDZA 5JHAA 1K50A 2Y3AA 3QK0A 2DBYA 2WHIA 3PPAA 5AEKB 2MBHA 1I4RA 2GBMA 3IHPC 3OLMD 2DENB 4IKGA 1FNWA 1T5XD 3GB1A 1J8CA 4DWFA 1ZUD2 1YJJA 2MP2A 3P42A 3PTFC 2BW2A 3NJTA 2M0XA 2C5LC 2X38A 2FUG1 2Z8LA 2NCNA 2I38A 1OTRB 3H9DA 3DOWA 3AEEB 4I6LB 1YD8U 2LJIA 2LZ6A 2Z0EB 2LUEA 1CQVA 1SXTA 4ZRIA 1KOTA 2WYQA 3Q3MC 1HQRD 1T0YA 2NTTA 3Q8BA 1F2RC 3PREA 2J52A 2PKOA 2NTSA 3S2AA 1ESFA 3U7ZA 1PYWD 1IYFA 2LGDA 3BK2A 4MDKE 2XK5A 1V5TA 3AE4B 4YTNB 2UYZB 1L4ZB 3DWGC 1UUPA 4GDKA 1CJEA 1WXSA 1WYGA 2V3SA 3MHSD 3T3NA 3MC8A 3MC0B 4USAA 4P7IA 4FLHA 1NBFC 4KGRA 4MACA 5D3IB 4P1CC 3DHIC 1C4AA 1NI3A 4ACFA 2KTRB 2MSED 3MJ5A 2IGGA 4BFRA 3QA8A 2J7QB 1FD6A 4GOCA 4HWIB 4XDCA 3A9KB 2ZVOA 2Q5WD 3KLSX 4RH6A 3BY4B 3N1ZC 3JSVB 3I63C 1UNSA 4KKJA 3HM6X 4DDID 3L16A 2KZRA 1MFWA 3B2FA 4DXAB 1WGDA 1WMHA 2MJ3A 4RFBA 3W1SA 3H6NA 2CJOA 2IDYA 2WXRA 1AN8A 2R2OA 4HRSA 1UBQA 2PLPA 1XLPA 2KWVB 1LQBA 3ZRFA 2LWPA 4NAMA 3HRDD 1KH0A 3VFKA 3URYA 2QC8A 3BVZA 4OHJA 2KTFA 2KTRA 1F52A 1H8CA 4JL9A 4EZKA 3CMMB 3I57A 2BVCA 3ML8A 1TJEA 5CHVC 3ZIMA 3E9SA 1E10A 1VD2A 4W9GA 2KC2A 2KQ7A 3RCZA 3ZXRA 2KNBA 4FJYA 1JROA 1UELA 4CHKA 2JXTA 3KUZA 4AS1A 4II2B 1P7FA 4L2YA 1XD3B 4HJKA 4ZYNA 5JH5C 2LGXA 2BB6A 2PPHA 2KVZA 2KLCA 2GMIC 3KYCD 1EU3A 5LXIB 2RR9A 3T8MA 3TSSA 2EMSA 2AX5A 3ZQ4A 4E3CA 4ZHOA 3KW5B 3N20C 2V4LA 3VR9B 2ON8A 2KAJA 2LGIA 3ZUNA 4C4VB 1D5MC 3TBLD 2CJNA 4XDDA 4ANVA 5HKHA 4C56C 1R7SA 1TBEA 2HJ1A 5IO9A 2GB1A 2KJRA 4C80A 1S1QB 2QSDA 4RGOS 4C7ZA 3ZO5B 2CKHB 2EELA 3AH7A 3ZJUA 3M62B 1DOYA 1FFUA 3U4EG 1V9JA 1Q5WB 3PT2B 1GB4A 3FILB 3IAM1 4EUTA 1DYQA 2L0FA 3V6CB 3DCGA 1L0XB 2J4XA 1V1PB 1ZGUB 2K8CA 3Q8CA 4C4VA 2XN9C 2DYOA 3O13A 5AZFA 4P16A 1WWTA 3DVGX 1WX9A 4H2AA 1I4QA 3RMKC 2KMCA 3RPFC 3U52E 1WX7A 5L95C 1ZXIA 2IY1B 1LO5D 4IUMB 4W9FA 4AOFA 3NZUA 4M8NA 1V81A 1XEEA 3EHVA 1WH3A 3RNBC 3UIOB 4TQ1A 3FILA 3KVFB 1FFVA 1WE7A 1ZE3D 3U7DA 1V1PA 1YQBA 5AUKA 3Q3NC 3DDCB 4WQMA 5I4DA 4REZA 2BF8B 3AMZA 5BMHA 2GBNA 2IYDB 1L0YB 1PFDA 3CSFA 3K9PB 3BYTB 2WQYB 4MSQB 2DX5B 2DLBA 2KWUB 3J9CA 3VAWA 4YWGG 2BKRB 2O6VB 3A4SC 2MH7A 1I4PA 1L7YA 3RD2A 1C79A 5EE9A 3I5JC 1PGBA 3NUHB 2WXJA 3AEGB 2KJ6A 3U2SC 2K5PA 3AU4A 3RNCC 2RSUA 3IFWB 1C77A 4NJ7A 2FBWB 2LD9A 2WDTB 3L17A 2WXGA 1K8RB 4WH4A 1J7AA 4PT5A 2GBKA 2H88B 1PDXA 1WXQA 1JWUD 1FIQA 4XZ4A 2OJWA 2LVPA 2LXCA 4W9LA 2M17A 2FCNA 3NZ3A 2BS2B 3WAPA 4AUQC 4LNOA 2WXFA 3ONSA 1FNVA 2LGSA 1QQRA 1UBIA 3UI3A 3EGRA 3V05A 1L2NA 4FJZA 2D07B 5GXGB 4K1RB 2RMMA 2RPVA 2LGYA 5BYRA 4B0MA 3QWZB 3W9CB 2K9XA 4IM0A 1QOGA 1H4RA 3U30A 1FRRA 2L32A 4RGTA 2WLBA 3NOBA 1TZOA 1V49A 1NVID 2OOBB 1ZDVA 1D6EC 4IM2A 4XYCA 2IGHA 5EE3A 5BO4B 2LI5A 3B1LX 3NS1A 1CMXB 1TYGB 3KQ4A 2PE9A 4NQLB 4KKIA 3PZ8A 3HVDA 2Z59B 3NHEB 3N1XC 3NG0A 4AP4C 3W2DA 1JRUA 4FXCA 1ET9A 4MEMA 1WX8A 4K7UA 3N9YC 2N1WA 2NBWB 3DBRI 4EKUA 4I6NB 5T8IA 3RNFC 3M95A 3TUOA 5DPTA 4JWUC 3OJ4B 5FK9C 1WSPA 1AYFA 1MPEA 4IW0A 2JPHA 5G2NA 1GOZA 4HKQA 3DVNV 5KHQA 1D3ZA 2KOXA 2E3TA 5EE1A 3R8BA 1ZDXA 3RI7C 1JW9D 3SU8X 4FHJA 3R7QA 5BYSA 4EE2A 3AE9B 4NY0A 3ZNGC 3PS6A 1HE8A 2G9HD 1TTNA 1N61A 1IP9A 2KQSA 1SB3C 2LXAA 4G3XB 4OZBA 3WCQA 2DAFA 3AE3B 4IDIA 3MP9A 1N62A 3BIID 1N6ZA 2FCSA 3AM9A 3NRZA 4GMVA 1I4HA 3ZNID 1ET6A 3ML9A 1WZ0A 3VH4B 5AUIA 2K3UA 4LDTB 2IJ0A 5MPOA 4ZRJA 1RM6C 3R7RA 2UU7A 2YEPB 4M0WB 4NJ6A 2K1FA 1E5WA 3ZJVA 4BKSD 1UGMA 4S0RA 4YTPB 3KYDD 5EE0A 3DWMA 4DK5A 4LJPB 1XCQL 2M4NA 5AZGA 2V0GA 2JZ3B 4G0NB 4P1BC 5FR6A 1HEZE 2E6XA 2QIEB 5H92C 1C76A 1VLBA 2WP9B 1WI0A 1L6UA 4IC7B 1BUIC 1EU4A 3VTWA 2D2QA 3TL5A 4K81A 4ZDVA 4URKA 2M1MA 3W5VB 2W55A 3QAQA 3X23A 3V6EB 1E90A 4EFOA 3V61A 5E6JA 4NJCA 1TS4A 3ALBA 2NVUI 2CS4A 1FPYA 1MHHE 4IM3A 3VTUA 2EMTA 1WXVA 4F7ZA 3EFCA 4RCOA 3DPDA 4GXBA 2WDQB 2KC1A 2WXPA 5J2RA 4FHKA 3H8HA 3PRMB 1G6JA 1E8XA
chains in the Genus database with same CATH topology
3LXFA 1PGAA 2ACZB 5H8YE 2BS4B 4NAMA 3HRDD 1KRHA 1KH0A 4O1NA 3URYA 3IXSA 3BVZA 4CQNA 4OHJA 1FCLA 2BBCA 4ZHPA 1E0ZA 4TMAB 4WAFA 5G5GA 1K52A 2BTEA 3I57A 2BS3B 2G1EA 1Y56A 1ZPSA 3BK1A 4LLGM 2DWQA 3B2GA 4A90A 1TKEA 4TQ0A 2PVOD 3IAS1 1TJEA 3CWIA 3NVWA 3E9SA 1L5PA 1E10A 1F77A 3FAHA 1YN4A 5D3DA 2WXIA 2W54A 1PGXA 2ZW1A 1CZPA 2GRIA 4NAWB 1T3QA 1QOFA 1JROA 1P7EA 2JXTA 2GI9A 2WXOA 4AS1A 2WS3B 2N9KA 1P7FA 1VZ8A 2K22A 4L2YA 1C9FA 3HVZA 2Y5CA 1RYJA 2BB6A 4GDKB 1IGDA 2WXMA 3RFZB 1F0ZA 2TSSA 1EU3A 3BZDB 3TEZA 4OW0A 4RF0A 4ARIA 3NVZA 1SJED 3AEAB 4N59A 2M0AA 3FC4A 2QILA 3TSSA 2AX5A 5TSSA 1DOIA 3ZQ4A 4ZHOA 2PVGC 4HEA1 2V3NA 1N5XA 1DOXA 1TS3A 1QLBB 3EA6A 3VR9B 1RFKA 2ON8A 2KAJA 4HKZE 1YQ4B 2KQ4X 2LGIA 1SBBB 2AQ3B 5C3JB 1IGCA 1XF5L 4N6EB 2JSVX 1D5MC 3W5UB 1AWDA 3AEFB 1FEHA 2CJNA 4IOIE 4XDDA 1PUTA 2WNMA 1HZ5A 3P4QB 4Q2JA 4C56C 1R7SA 1QF6A 2GB1A 2XNAC 1VDVA 1C4PA 1YMHE 4C80A 1XCTL 2QSDA 4RGOS 4C7ZA 1VJKA 2EELA 4ZOHC 3AH7A 3T3OA 1YJIA 3ZJUA 1NYQA 4HJGE 2M56B 4A8XC 3V3XA 3AE1B 1DOYA 3BWUD 1FFUA 3U4EG 4L23A 4ZRQA 1FCCC 4OZAA 2ONQA 2KWDA 3Q8FA 3FILB 1GB4A 5BYQA 2JQRB 2WDRB 2PIAA 3IAM1 1YNTE 1GAQB 3AE2B 1DYQA 1C4CA 3IT4B 4YSYB 5FKAC 2B76B 2W82A 1L0XB 2J4XA 5HG2A 1V1PB 1YN5A 3Q8CA 2XN9C 2INPE 4ZRPA 5G5HA 1ZOYB 2DYOA 3O13A 1IBXB 4P16A 1WWTA 4H2AA 1I4QA 2JU6X 2BT6A 1EWYC 2JX5A 4L1BA 3RPFC 2J42A 4KGTA 3U52E 1KF6B 4XWTA 2Y5PA 1KTKA 2EKIA 1MHXA 1N60A 2IPKD 1ZXIA 2DYMA 1LO5D 4TSSA 3LYYA 1XEEA 1NYRA 1UWMA 2JYTA 4NZLB 1F2RI 2WU2B 1MVKA 1QILA 4TQ1A 3FILA 3AE7B 1BXTA 3PZ7A 1FFVA 1SE3A 1ROEA 4P6VF 1ZE3D 1D5ZC 3L4PA 1QOBA 3GP7A 1XXGA 1V1PA 5JXVA 1FRDA 3IT6B 4A6QA 5AUKA 1ENFA 4XE0A 1IBXA 1TS2A 3MHZA 1HXYD 4WQMA 5I4DA 4YXDB 4REZA 1EWCA 1YQ3B 3B9JA 4AQ7A 1BMLC 1K51A 3AMZA 4ZYSA 5BMHA 2NMQA 4GLSC 2PW9A 4KGSA 4DQOC 1L0YB 1V97A 2OEDA 1E9MA 1PFDA 1V1OA 4DXFA 1B1ZA 2QMTA 3BYTB 2WQYB 2N9LA 4D2KA 2DLBA 4A9AA 2WXHA 1JCKB 3J9CA 4YWGG 3AV8A 2WU5B 2KDMA 5HI1A 2MH7A 1I4PA 4JX1C 1SIJA 1C79A 1JALA 5LNK1 1VZ6A 2LEKA 2WXNA 3P4SB 5EE9A 3AEDB 4RNAA 1PGBA 1KFYB 1L4DB 2WXJA 3AEGB 3NUHB 3MFGA 1SEBD 2MEKA 3U2SC 5BMIA 3E56A 3KWVA 2K5PA 5HFYA 1A70A 1E7PB 2R61A 1C77A 1FXIA 2FBWB 1IUEA 2ZW0A 1SF0A 2J53A 3Q8AA 4B0EA 2OHFA 1FMAD 2WXGA 1HZ6A 1E6EB 4WH4A 1J7AA 1N63A 1UGJA 1XLOA 2JWUA 2SEBD 3BVGA 1XLQA 4PT5A 5D7GA 1J7CA 5HHDG 2SAKA 2H88B 1PDXA 1WXQA 2FE8A 1JWUD 1CK1A 3NVVA 1FIQA 4KX6B 4C7YA 1L0VB 3GS2A 3PO0A 1VZ7A 3TEYA 4ARCA 2D5GA 1AW7A 1UWXA 1D5XC 1WGKA 2AQ1B 4RGNA 3NZ3A 1VR9A 4OVZA 3R2IA 4YSZB 4GDLB 3P4PB 2BS2B 1I4GA 4XWWA 1ZP0B 4LTUA 2WXFA 1FO4A 1FNVA 1NENB 1QQRA 1C78A 1XLNA 3UI3A 3EGRA 1QKZA 2WXKA 3CIRB 3V05A 1I4XA 5GXGB 3SFDB 3AE6B 2RMMA 2LHDA 2RPVA 2MJEA 5BYRA 1Q10A 4B0MA 3W9CB 2K9XA 1SJHD 2N7JA 2PTLA 2KMMA 1QOGA 2YEPF 1TKYA 2HDEA 2IGDA 3AEBB 1FRRA 2PMVA 1OQRA 3Q69A 1MI0A 2L32A 2LFIA 2BYTA 4RGTA 2WLBA 3ZYYX 1TZOA 3I9V1 4HROA 3Q8EA 2KN4A 3TEWA 1NVID 2QEJC 1JWBD 2CU3A 1ZDVA 3R2TA 4N58A 1D6EC 2L52A 3P63A 1JQ4A 2IGHA 5EE3A 1ACCA 3NS1A 1TYGB 5FR3A 1OQQA 3KQ4A 2JYEA 2I2YA 4KKIA 3PZ8A 4MM3B 3ETRA 3HVDA 4A55A 4ITKA 3AN1A 4YSXB 2WXQA 3W2DA 2VZKD 2WXLA 4M0WA 2WDVB 4WWMA 3SEBA 4FXCA 1ET9A 3VRAB 2RDGA 4J3OD 3HUIA 3C8YA 1K53A 3LB8C 1GPXA 3N9YC 1FXAA 1QOAA 1K50A 2Y3AA 5T8IA 4MT5A 1V8CA 3TEXA 2DBYA 1XO3A 3EUB2 1JMLA 1KLGD 1QT9A 3TUOA 1JWMD 4JWUC 1I4RA 2AQ2B 5FK9C 2KACA 3OWEB 4IKGA 1FNWA 1WSPA 1JWAD 1AYFA 1MPEA 1STEA 1T5XD 2BB5A 3GB1A 4JE3B 1YN3A 1JWSD 2MJDA 1ZUD2 1YJJA 2RDHA 1GOZA 3P42A 1ZXHA 4HKQA 3SFEB 2BW2A 1TS5A 1DGJA 4YTMB 1NEKB 2X38A 3BVMA 2FUG1 2Z8LA 1EM7A 1M4VA 2I38A 4JPSA 2V3PA 3VRBB 2E3TA 5EE1A 3R8BA 3AEEB 2JZPA 1SE4A 2LJIA 4DXGA 1ZDXA 1JW9D 4UDUC 3VQIA 5BYSA 4EE2A 1CQVA 1SXTA 1FM0D 3AE9B 3NVYA 2G9HD 1N61A 1HQRD 1SB3C 1TY2A 3ZJTA 4WIPA 1JRPA 2NTTA 4OZBA 3WCQA 3Q8BA 3AE3B 2LUMA 4IDIA 1F2RC 3MP9A 2J52A 1N62A 2PKOA 3BIID 2NTSA 3KWLA 5C2TB 4OZCA 1KLUD 3AM9A 3NRZA 1ESFA 3U7ZA 1I4HA 1PYWD 1ET6A 1B9RA 3VR8B 1HA5A 3BK2A 4RGMA 4YT0B 2N0SB 3P4RB 2ICIA 5AUIA 2K3UA 2W3RA 2IJ0A 1RWSA 3AE4B 1SSNA 4YTNB 1RM6C 5MPOA 1GB1A 1L4ZB 2YEPB 3DWGC 1UUPA 4US8A 3ABVB 4WURA 1CJEA 1WYGA 4JWSC 3ZJVA 3AE5B 3T3NA 1SE2A 3MC0B 4YTPB 4USAA 5EE0A 3DWMA 5BMGA 1XCQL 2V0GA 4KGRA 4MACA 5D3IB 2LHEA 4LK0M 2INNE 1C4AA 1OFFA 1NI3A 3ZGZA 1D4BA 1HEZE 2E6XA 1TY0A 2QIEB 5H92C 1C76A 1VLBA 2WP9B 1FNUA 1BUIC 1EU4A 1L6UA 1VRAB 2W3SA 3MJ5A 4MH8A 2IGGA 2HTME 2L1AA 2L83A 1L6VA 1FD6A 4XDCA 3KLSX 2Q5WD 3AB5A 2W55A 4R3DA 4RH6A 2H89B 3W5VB 3P1MA 3AECB 5E6JA 4NJCA 1TS4A 1UNSA 4KKJA 2QJLA 1MHHE 2LMCA 3SR6A 3B2FA 3AE8B 2K0PA 2MJ3A 4RFBA 4US9A 1T6BX 3W1SA 4RCOA 1TKGA 2CJOA 2IDYA 2M19A 2WXRA 1AN8A 1J7BA 2WDQB 4HRSA 3BYYB 2V4IB 2VZKB 2PLPA 2WXPA 1XLPA 1WRIA 4RF1A 3H8HA 1I7HA 1N5WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0V B;  3LXF A;  2ACZ B;  3PO0 A;  5H8Y E;  2BS4 B;  3HRD D;  1KRH A;  5G5H A;  1ZOY B;  3VRB B;  2E3T A;  4ZHP A;  5EE1 A;  1WGK A;  1WWT A;  1E0Z A;  3AEE B;  2BT6 A;  1EWY C;  2JX5 A;  5G5G A;  3P4P B;  2BS2 B;  4YSZ B;  1ZP0 B;  3RPF C;  4KX6 B;  1JW9 D;  4LTU A;  1FO4 A;  1NEN B;  1KF6 B;  2BS3 B;  2G1E A;  1FM0 D;  1XLN A;  2EKI A;  2DWQ A;  3B2G A;  1N60 A;  1TKE A;  3AE9 B;  3CIR B;  2PVO D;  3NVY A;  1TJE A;  3CWI A;  3NVW A;  1ZXI A;  5GXG B;  3SFD B;  1L5P A;  1E10 A;  3AE6 B;  1N61 A;  3FAH A;  1SB3 C;  1JRP A;  2MJE A;  1NYR A;  3W9C B;  1UWM A;  2K9X A;  2WU2 B;  2W54 A;  2KMM A;  3WCQ A;  1CZP A;  1QOG A;  3AE3 B;  3W5V B;  1TKY A;  1T3Q A;  4IDI A;  1QOF A;  3AE7 B;  1JRO A;  1N62 A;  2PKO A;  3BII D;  3AEB B;  1FRR A;  3KWL A;  1OQR A;  1FFV A;  5C2T B;  2WS3 B;  1ROE A;  3AM9 A;  3NRZ A;  4P6V F;  2WLB A;  2K22 A;  3ZYY X;  3HVZ A;  3L4P A;  4HRO A;  1QOB A;  2Y5C A;  1B9R A;  3VR8 B;  1RYJ A;  1NVI D;  1FRD A;  4YT0 B;  2N0S B;  1JWB D;  2CU3 A;  3P4R B;  5AUI A;  5AUK A;  1F0Z A;  4N58 A;  2L52 A;  2W3R A;  1RWS A;  3AE4 B;  3P63 A;  4YTN B;  1RM6 C;  5MPO A;  1JQ4 A;  3NVZ A;  4WQM A;  3AEA B;  4N59 A;  5EE3 A;  4YXD B;  1YQ3 B;  3B9J A;  3FC4 A;  3NS1 A;  1TYG B;  3DWG C;  3AMZ A;  4US8 A;  1OQQ A;  3ABV B;  2AX5 A;  1CJE A;  1DOI A;  1WYG A;  4JWS C;  3ETR A;  4ZHO A;  2PVG C;  1V97 A;  3AE5 B;  1E9M A;  1N5X A;  4ITK A;  1DOX A;  1PFD A;  3AN1 A;  1QLB B;  4USA A;  4YTP B;  3VR9 B;  2WQY B;  5EE0 A;  1RFK A;  4YSX B;  2KAJ A;  3DWM A;  1YQ4 B;  4A9A A;  2WDV B;  5C3J B;  4WWM A;  4FXC A;  3AV8 A;  4N6E B;  2WU5 B;  3VRA B;  3W5U B;  2MH7 A;  1AWD A;  4JX1 C;  1OFF A;  1NI3 A;  2CJN A;  3AEF B;  1PUT A;  2QIE B;  3HUI A;  3P4Q B;  1SIJ A;  5H92 C;  1VLB A;  2WP9 B;  1R7S A;  1L6U A;  3LB8 C;  1JAL A;  2W3S A;  4C7Z A;  1GPX A;  1FXA A;  2HTM E;  2LEK A;  1QOA A;  3P4S B;  5EE9 A;  1QF6 A;  1VDV A;  3AED B;  2L83 A;  1L6V A;  4C80 A;  1KFY B;  3AEG B;  2Q5W D;  3AB5 A;  2W55 A;  1V8C A;  2K5P A;  1VJK A;  2DBY A;  1XO3 A;  2H89 B;  3EUB 2;  3P1M A;  1A70 A;  1E7P B;  3AEC B;  4ZOH C;  3AH7 A;  1QT9 A;  1YJI A;  1FXI A;  1NYQ A;  2FBW B;  1IUE A;  2QJL A;  4JWU C;  2M56 B;  3AE1 B;  3SR6 A;  3B2F A;  1DOY A;  1SF0 A;  3AE8 B;  1FFU A;  2OHF A;  1FMA D;  2MJ3 A;  4US9 A;  1JWA D;  1AYF A;  1TKG A;  2CJO A;  2M19 A;  1E6E B;  1J7A A;  1J7B A;  1N63 A;  1XLO A;  2WDQ B;  4HRS A;  1XLQ A;  2JQR B;  2PIA A;  2WDR B;  2MJD A;  1GAQ B;  1ZUD 2;  1YJJ A;  3AE2 B;  1J7C A;  1XLP A;  3SFE B;  1WRI A;  4YSY B;  1DGJ A;  2B76 B;  2H88 B;  1PDX A;  1WXQ A;  1I7H A;  4YTM B;  1NEK B;  3NVV A;  1FIQ A;  1N5W A;  4C7Y A; 
#chains in the Genus database with same CATH topology
 1WZ3 A;  3N1Y C;  2ACZ B;  2L0T A;  1KRH A;  3GZN I;  3UQA A;  4CQN A;  1E0Z A;  2KK8 A;  4TMA B;  2VH1 A;  3NZS A;  4WAF A;  5CHW A;  2G1E A;  1ZW7 A;  3BK1 A;  4LLG M;  2DWQ A;  3B2G A;  2PVO D;  4W9C A;  3IAS 1;  3FAH A;  3IBE A;  4KZ0 A;  1YN4 A;  1PGX A;  2XK5 B;  3HK0 A;  4NAW B;  1T3Q A;  1QOF A;  1P7E A;  4PS7 A;  2LVQ A;  4GDK B;  4GB9 A;  1F0Z A;  2TSS A;  1R4N I;  3B08 A;  3PHW B;  2QCZ A;  2JY6 A;  3EC8 A;  3R3M A;  3AEA B;  4N59 A;  5EDS A;  2QIL A;  4TUU A;  2FUH B;  2MX2 A;  1WJ6 A;  2DNF A;  2V3N A;  4RM9 A;  1QLB B;  3EA6 A;  2IND C;  1RFK A;  3TMP B;  3VH3 B;  1YQ4 B;  5E6P A;  5C3J B;  2K39 A;  3QX1 A;  1AWD A;  4NAW A;  1PUT A;  2WNM A;  3B0A A;  1EO6 A;  1ZKH A;  4EOY A;  2J0M A;  1WMH B;  3ZTD A;  4KSL C;  3H7P B;  3N32 A;  2INC C;  2L3Z A;  4ZOH C;  1YJI A;  5D6J B;  1NYQ A;  2J0J A;  2M56 B;  3LJ3 A;  4JGH B;  4L23 A;  2KWC A;  2NPT B;  3QJZ A;  2PIA A;  1GAQ B;  3AE2 B;  3QAR A;  3AI5 A;  2B76 B;  5FKA C;  2MBB B;  2W82 A;  3L54 A;  3PLV A;  2INP E;  1IBX B;  4W9J A;  1LFD A;  3DBL I;  1EWY C;  2K25 A;  4L1B A;  4GU2 A;  4K3B A;  2KMA A;  2ZCC A;  3PRP B;  4XWT A;  3PV1 A;  2RD0 A;  3IVF A;  3H7P A;  2IPK D;  2ZNV B;  3RNE C;  4GDL A;  3EFU A;  3JYU A;  3LYY A;  3RT3 B;  4KV2 A;  2MRP A;  4BKS A;  2ZPY A;  1MVK A;  3WAN A;  2NPT A;  3ZW3 A;  3AE7 B;  1BXT A;  3ECI A;  4M8M A;  3L4P A;  1QOB A;  4LCD E;  2ZJD A;  1ENF A;  1IBX A;  1TS2 A;  3PHX B;  2IO0 B;  3MHZ A;  1HXY D;  2L8J A;  1TGZ B;  3B9J A;  1BML C;  2C7H A;  1XQQ A;  2LVO A;  2NMQ A;  2HTH A;  4GLS C;  4KGS A;  4DQO C;  3M63 B;  4DXF A;  1B1Z A;  3I3T B;  5G55 A;  4HDO A;  1WXA A;  4S17 A;  2HD5 B;  2MQJ A;  1JAL A;  2N9P C;  2WXN A;  2GOW A;  3AED B;  1KFY B;  1L4D B;  4W9I A;  2MEK A;  3E56 A;  1A70 A;  1E7P B;  1MG8 A;  4KSK C;  2JZZ A;  4PS8 A;  4EZJ A;  3HM3 A;  2KKC A;  1HZ6 A;  1E6E B;  2JWU A;  2SEB D;  2JUO A;  4HXD A;  1J7C A;  4PS3 A;  2IO2 B;  5HHD G;  3NVV A;  4C7Y A;  3GS2 A;  3DHG C;  3D32 A;  3L10 B;  4ARC A;  1D5X C;  1PQS A;  3ENE A;  4IWO A;  1WGR A;  3RN9 C;  1XLN A;  1QKZ A;  1I4X A;  1A5R A;  4WAA A;  4MGZ E;  1LM8 B;  2JT4 B;  2DZM A;  2N9E B;  4M02 A;  3KUD B;  2N7J A;  2KMM A;  2V9H A;  3UIN B;  2MWS B;  1WR6 E;  5E6O A;  2PMV A;  4K7S A;  1MI0 A;  2G4S A;  3LDZ E;  3TEW A;  3CF6 E;  2QEJ C;  3WAO A;  1JWB D;  2NS5 A;  4MSM B;  4N58 A;  3WAL A;  2L52 A;  2KDB A;  4E71 A;  5FR3 A;  2JYE A;  5DPR A;  4C00 A;  3RUI B;  4ITK A;  1LXD A;  3MC9 A;  2D11 A;  2GBR A;  3GE3 C;  1F1H A;  4LJO B;  1UF0 A;  2MBO A;  4WWM A;  4W9E A;  2K8H A;  3K9O B;  3ZTC A;  4BKG A;  1K53 A;  1GPX A;  4KIK B;  2MLB A;  4G11 A;  3TEX A;  5J17 A;  1JML A;  2IZV B;  1QT9 A;  4LNK A;  4HPP A;  1JWM D;  1MG4 A;  2AQ2 B;  2KAC A;  4OVV A;  2N7E A;  1AAR A;  5IAA C;  5JZE B;  1STE A;  3APC A;  1J19 A;  3AXC A;  2MJD A;  2RDH A;  2JVC A;  1ZXH A;  2A5U A;  1DGJ A;  4YTM B;  4MJS B;  4ZRK A;  3BVM A;  2D10 A;  1SIF A;  1EM7 A;  3PZD A;  1M4V A;  5IKC M;  1SE4 A;  3UGB B;  4DXG A;  4KIK A;  4UDU C;  3APD A;  4KZC A;  2XBB C;  2QDF A;  4HCP B;  2KX0 A;  3DHH C;  4BBN C;  3Q3F A;  2PEA A;  5IA7 A;  2LUM A;  3ZRC A;  1X1M A;  2KJH B;  4M00 A;  3RUL A;  2I1K A;  3TIX A;  1KLU D;  1WR1 A;  4MJS A;  1B9R A;  4B6W A;  4RGM A;  4YT0 B;  2N0S B;  5LLI A;  2KFK B;  1SSN A;  1GB1 A;  2DAJ A;  1YX5 B;  2ZPN A;  2AEH A;  3ABV B;  3DQV A;  2JRH A;  4WJO A;  4JWS C;  3W1Y A;  1QZE A;  3AE5 B;  2WX1 A;  3P2B A;  1WF9 A;  4I6P A;  4LK0 M;  1OFF A;  3RYT A;  1D4B A;  4WJQ A;  2K6Q A;  1WGY A;  3Q3J A;  1FNU A;  4MH8 A;  3OJ3 A;  2W3S A;  2HTM E;  2L1A A;  1L6V A;  2MHJ A;  3AB5 A;  5JHB A;  2H89 B;  4RM8 A;  4WJP A;  2ZEQ A;  2OJR A;  2KFK A;  4G50 A;  3AE8 B;  4BKT A;  2K0P A;  3MTN B;  3DBH B;  1R4M B;  2HJ8 A;  1J7B A;  3VTV A;  3BYY B;  3GE8 C;  4PK1 A;  4GGQ A;  4BAX A;  2LRU A;  2KVR A;  2QHO A;  4DHZ E;  1E7U A;  4GSW A;  1N5W A;  4D2K A;  1PGA A;  5H8Y E;  2BS4 B;  4O1N A;  2BBC A;  1BT0 A;  4ZHP A;  2LRW A;  3A33 B;  3U8Z A;  2EKE C;  2BTE A;  1WJU A;  2FCM A;  1WXM A;  2BS3 B;  1ZPS A;  1V5O A;  4HPM B;  1TKE A;  4MGY E;  3GOE A;  3CWI A;  2BPS A;  1L5P A;  4HCN B;  5D3D A;  4KDI C;  4TV3 A;  2WXI A;  4B95 A;  1YX6 B;  1CZP A;  2DZK A;  2LAS A;  2BYV E;  2HE7 A;  4II3 B;  2N9K A;  2PJH A;  1C9F A;  2Y5C A;  1I42 A;  1RYJ A;  2MBE A;  3AUL A;  2WXM A;  3RFZ B;  3OG5 A;  3TEZ A;  2R2Q A;  2ZVN A;  4RF0 A;  4ARI A;  2KXJ A;  2M0A A;  2A4Z A;  4WWP A;  2C7N B;  1WM2 A;  3RNA C;  4PYU A;  1V6E A;  1N5X A;  2LJ5 A;  3DBS A;  3O65 B;  3AU5 A;  3SDL C;  1IGC A;  2JSV X;  5TR5 A;  3CST A;  3APF A;  4Q2J A;  2N9X A;  2XNA C;  3Q2A C;  1YMH E;  2MBQ A;  2Y5B B;  4DDG D;  3N30 A;  1VJK A;  3A9J B;  2KD0 A;  3T3O A;  4NQK E;  3V3X A;  3AE1 B;  4B9K A;  2BGF A;  4ZRQ A;  1FCC C;  2MW5 A;  2ONQ A;  2KWD A;  2JQR B;  2WDR B;  1C4C A;  4CYE A;  4MH0 E;  3OAW A;  2CU1 A;  3BIN A;  3PVL A;  4BVU C;  2I1J A;  2B3A A;  3VHT C;  2JU6 X;  2BT6 A;  2JX5 A;  3NS8 A;  2L05 A;  3H7S A;  2Y5P A;  2EKI A;  3A9J A;  4BBN F;  1T0Q C;  1XT9 B;  2DYM A;  4TSS A;  1NYR A;  1UWM A;  4NZL B;  5CTR C;  3JW0 X;  3PZ7 A;  1SE3 A;  1ROE A;  2RPQ A;  3ZKJ C;  3A4R A;  4BOS C;  4FAD A;  2UWQ A;  3PGE A;  1SE9 A;  1FRD A;  3X0W A;  5KHO A;  1V86 A;  3DBH I;  3WIM A;  1YQ3 B;  4ZYS A;  2KN5 A;  1NI2 A;  4BOZ B;  4CO7 A;  3JVZ X;  2PW9 A;  1E8Y A;  4A9A A;  5DPS A;  2WXH A;  1JCK B;  3Q14 C;  2GBJ A;  2WU5 B;  2L00 B;  4JX1 C;  1T0S C;  4OVU A;  1SIJ A;  2JWZ A;  1WY8 A;  1V2Y A;  1NDD A;  2LEK A;  4RNA A;  4RMA A;  3MFG A;  1SEB D;  5BMI A;  5HFY A;  5IP4 D;  2IBI B;  4WQO B;  1IUE A;  1OQY A;  5DCN A;  2J53 A;  2KX3 A;  2N4F A;  2OHF A;  3VXW A;  3N3K B;  1EF1 A;  1WRD B;  1XLQ A;  3M3J A;  5D7G A;  2ZZP B;  4N9F 4;  2SAK A;  1GC7 A;  1CK1 A;  4KX6 B;  1L0V B;  3PO0 A;  2AL3 A;  2VH2 A;  2D5G A;  1AW7 A;  1UWX A;  1MJD A;  2AQ1 B;  4GDL B;  1I4G A;  4XWW A;  1ZP0 B;  3VUY A;  1FO4 A;  1NEN B;  4F1S A;  1GUA B;  3A1Q B;  3CIR B;  2WXK A;  2XEW A;  2WGS A;  3SFD B;  2LHD A;  3DVN U;  3Q3O C;  2MJE A;  1YOV B;  2V1Y A;  1F9J A;  2FCQ A;  1TKY A;  1T0R C;  3AEB B;  1OQR A;  3Q69 A;  2LFI A;  3ZYY X;  2N1V A;  3I9V 1;  3ZDT A;  2J0K A;  3PRZ A;  1YJ1 A;  4ANX A;  2CU3 A;  2DYB A;  1GC6 A;  3R2T A;  4FUL A;  1V80 A;  4JIO U;  1ACC A;  1Q0W B;  1WIA A;  1HTO A;  2I2Y A;  2NBU A;  4HLE A;  2RDB C;  4MM3 B;  3ETR A;  3HHM A;  4JLC A;  3NY5 A;  3WAM A;  3A1Q A;  3IG3 A;  4A55 A;  3AN1 A;  2VZK D;  2IY0 B;  2BWF A;  2WXL A;  2GLS A;  2D3B A;  2KDF B;  3VRA B;  2RDG A;  4J3O D;  3HUI A;  3LB8 C;  4DHZ B;  1YIW A;  2L7R A;  4MT5 A;  1V8C A;  1XO3 A;  3EUB 2;  1KLG D;  3UIP B;  4FJV B;  2DHZ A;  3OWE B;  1GG3 A;  3A9K A;  3KH0 A;  1JWA D;  3ZNZ B;  2BB5 A;  4JE3 B;  1YN3 A;  1JWS D;  3JSV A;  4MM3 A;  1WFY A;  3SFE B;  1TS5 A;  1P9D U;  2NR2 A;  1NEK B;  2W9N A;  1UZX B;  4EEW A;  4K7W A;  3WA0 A;  4JPS A;  2O6V D;  2V3P A;  3VRB B;  1OEY J;  1S3S G;  2JZP A;  5GMV A;  2ASQ A;  3L13 A;  4JQW C;  3VQI A;  4FBJ B;  1FM0 D;  2C60 A;  3PSE B;  3NVY A;  2X8X X;  2MA9 B;  2CHX A;  4ASW C;  1TY2 A;  3ZJT A;  4WIP A;  1JRP A;  5J18 A;  3V60 A;  4IG7 B;  4XX5 A;  4WJN A;  1U4A A;  4ANW A;  5IN7 A;  3V62 A;  1LGR A;  1KJT A;  3KWL A;  5C2T B;  4OZC A;  3VR8 B;  1HA5 A;  2CHW A;  2KHW B;  4W9H A;  3P4R B;  4HDQ A;  2ICI A;  1TT5 B;  2W3R A;  1RWS A;  2FID A;  2JRI B;  1OEY A;  4TKN A;  4US8 A;  4WUR A;  4MEL A;  2KAN A;  4LNF A;  3C0R B;  1SE2 A;  1P0R A;  1UH6 A;  2G45 B;  5BMG A;  2KYW A;  2LHE A;  2INN E;  1HTQ A;  2D3C A;  3ZGZ A;  1TY0 A;  1VRA B;  1Z5S B;  3QC8 B;  2L83 A;  2JXX A;  4R3D A;  3P1M A;  2KLG A;  3AEC B;  4AJY B;  3QIJ A;  2QJL A;  2LMC A;  3SR6 A;  2FAZ A;  3ZNH B;  4US9 A;  3ZXV A;  1T6B X;  1TKG A;  2M19 A;  3L08 A;  1KLV A;  3DBR B;  2V4I B;  1C1Y B;  2VZK B;  1WRI A;  4RF1 A;  5C1Z A;  1I7H A;  3L0W B;  3LXF A;  4K3C A;  3IXS A;  2JF5 A;  2M8S A;  1FCL A;  4KVG B;  3ZDM C;  5G5G A;  4QAY A;  1K52 A;  4YL8 A;  1E7V A;  3VVW B;  4WWN A;  2KT7 A;  1Y56 A;  4MGK E;  1WE6 A;  2C9W B;  4A90 A;  4TQ0 A;  2D3A A;  3NVW A;  5DPW A;  2KO3 A;  5E6N A;  1F77 A;  1RRB A;  4XC2 A;  2W54 A;  4M01 A;  4HK2 A;  2ZW1 A;  2GRI A;  2WX0 A;  3Q6B A;  2FNJ B;  2GI9 A;  2WXO A;  3H1U A;  2WS3 B;  3DVG Y;  1VZ8 A;  2K22 A;  4BZA A;  1WJ4 A;  3HVZ A;  5AZH A;  1Z2M A;  1IGD A;  2IO3 B;  1OGW A;  4HPL B;  3ZLZ A;  3BZD B;  1GJZ A;  3T9L A;  4OW0 A;  3NVZ A;  1SJE D;  3FC4 A;  5D94 A;  3RZW C;  4DHJ D;  2PE6 B;  4MGI E;  3TCA A;  1EUV B;  5TSS A;  2G3Q B;  1DOI A;  5LXH A;  2PVG C;  4ANU A;  4HEA 1;  1DOX A;  4NNJ B;  1TS3 A;  3ZVV A;  4HKZ E;  2BYF A;  2KQ4 X;  3UF8 A;  1SBB B;  2AQ3 B;  1XF5 L;  1J0G A;  4N6E B;  2YLM A;  2L76 A;  3W5U B;  3AEF B;  1FEH A;  4IOI E;  1HZ5 A;  3P4Q B;  4A20 A;  2O2V B;  4EZL A;  2IO1 B;  1QF6 A;  1VDV A;  1C4P A;  1XCT L;  2O6V A;  4WWO A;  1M94 A;  2FIF A;  3QCA A;  4LNN A;  4W9D A;  4HJG E;  4LDT D;  4A8X C;  1RAX A;  3BWU D;  2REX A;  4OZA A;  2VRR B;  2ZCB A;  3Q8F A;  5BYQ A;  1WGG A;  4NPN A;  1YNT E;  1KM7 A;  3R66 C;  3MJW A;  3IT4 B;  4YSY B;  1EF5 A;  5L83 A;  4PYZ A;  4A3O A;  1TIF A;  3C19 A;  5HG2 A;  1YN5 A;  4ZRP A;  5G5H A;  1ZOY B;  1P98 A;  2BWE S;  2AWT A;  2O2V A;  4IWP A;  2J42 A;  1Q1O A;  4KGT A;  3HIZ A;  1KF6 B;  2CHZ A;  1KTK A;  3UQB A;  1MHX A;  1N60 A;  1WYW B;  1FXT B;  3GZN B;  3KUC B;  4LNI A;  2JYT A;  1F2R I;  2WU2 B;  1QIL A;  2WWZ A;  4AJW A;  4IWQ A;  4P6V F;  1D5Z C;  3SHQ A;  3GP7 A;  1XXG A;  3VUW A;  4XGA B;  5JXV A;  3IT6 B;  1I35 A;  4A6Q A;  4XE0 A;  2CR5 A;  3RNG C;  1TZ1 A;  4YXD B;  1EWC A;  4AQ7 A;  4FN2 A;  1K51 A;  3SD5 A;  2DZI A;  1RLF A;  1V97 A;  5C23 A;  2OED A;  1E9M A;  5CX3 A;  2D3G A;  1V1O A;  2QMT A;  2N9L A;  4E74 A;  1R4N B;  4DBG A;  3W1S C;  3AV8 A;  2KDM A;  5CHF A;  5HI1 A;  2YVC A;  4A3P A;  4AWJ A;  4FA6 A;  2RGF A;  5LNK 1;  1VZ6 A;  3P4S B;  1Y8R C;  1VCB A;  3KWV A;  1GNU A;  1ISN A;  2R61 A;  1IPG A;  1FXI A;  4HVB A;  2ZW0 A;  4DHJ B;  1SF0 A;  3Q8A A;  4B0E A;  1FMA D;  1N63 A;  1XLO A;  1UGJ A;  3BVG A;  2N7D A;  1C3T A;  2AYO B;  2AL6 A;  2FE8 A;  5IOI A;  1SGH A;  1VZ7 A;  3TEY A;  3QHT A;  2Z0D B;  2MCN B;  2BKF A;  1WGK A;  1P1A A;  2ZNV C;  3RZF A;  4RGN A;  1VR9 A;  4OVZ A;  1E8Z A;  3R2I A;  4YSZ B;  3P4P B;  2K8B A;  4LTU A;  4GN1 A;  4ICU A;  2G4D B;  1C78 A;  2BQQ A;  1P3Q U;  3AE6 B;  4KDL B;  4X57 B;  2NBV B;  1Q10 A;  3DBL B;  1SJH D;  2PTL A;  1WM3 A;  2KFJ A;  2YEP F;  2HDE A;  2IGD A;  4W9K A;  1E8W A;  5D2M B;  2BYT A;  4GIV A;  4HRO A;  3Q8E A;  4F8C B;  3FKY A;  2KN4 A;  1RFA A;  3TJP A;  4J6I A;  4ICV A;  3P63 A;  1JQ4 A;  1OQQ A;  2KDI A;  2C7M B;  2MP2 B;  4YSX B;  2WXQ A;  3EEC A;  1UD7 A;  4M0W A;  2WDV B;  2KDE B;  3SEB A;  3PLU A;  3QQ8 B;  1WJN A;  3VUX A;  3C8Y A;  1WGH A;  1FXA A;  1R4M I;  2BYE A;  1QOA A;  2DZJ A;  2K6D B;  3VDZ A;  5JHA A;  1K50 A;  2Y3A A;  3QK0 A;  2DBY A;  2WHI A;  3PPA A;  5AEK B;  2MBH A;  1I4R A;  2GBM A;  3IHP C;  3OLM D;  2DEN B;  4IKG A;  1FNW A;  1T5X D;  3GB1 A;  1J8C A;  4DWF A;  1ZUD 2;  1YJJ A;  2MP2 A;  3P42 A;  3PTF C;  2BW2 A;  3NJT A;  2M0X A;  2C5L C;  2X38 A;  2FUG 1;  2Z8L A;  2NCN A;  2I38 A;  1OTR B;  3H9D A;  3DOW A;  3AEE B;  4I6L B;  1YD8 U;  2LJI A;  2LZ6 A;  2Z0E B;  2LUE A;  1CQV A;  1SXT A;  4ZRI A;  1KOT A;  2WYQ A;  3Q3M C;  1HQR D;  1T0Y A;  2NTT A;  3Q8B A;  1F2R C;  3PRE A;  2J52 A;  2PKO A;  2NTS A;  3S2A A;  1ESF A;  3U7Z A;  1PYW D;  1IYF A;  2LGD A;  3BK2 A;  4MDK E;  2XK5 A;  1V5T A;  3AE4 B;  4YTN B;  2UYZ B;  1L4Z B;  3DWG C;  1UUP A;  4GDK A;  1CJE A;  1WXS A;  1WYG A;  2V3S A;  3MHS D;  3T3N A;  3MC8 A;  3MC0 B;  4USA A;  4P7I A;  4FLH A;  1NBF C;  4KGR A;  4MAC A;  5D3I B;  4P1C C;  3DHI C;  1C4A A;  1NI3 A;  4ACF A;  2KTR B;  2MSE D;  3MJ5 A;  2IGG A;  4BFR A;  3QA8 A;  2J7Q B;  1FD6 A;  4GOC A;  4HWI B;  4XDC A;  3A9K B;  2ZVO A;  2Q5W D;  3KLS X;  4RH6 A;  3BY4 B;  3N1Z C;  3JSV B;  3I63 C;  1UNS A;  4KKJ A;  3HM6 X;  4DDI D;  3L16 A;  2KZR A;  1MFW A;  3B2F A;  4DXA B;  1WGD A;  1WMH A;  2MJ3 A;  4RFB A;  3W1S A;  3H6N A;  2CJO A;  2IDY A;  2WXR A;  1AN8 A;  2R2O A;  4HRS A;  1UBQ A;  2PLP A;  1XLP A;  2KWV B;  1LQB A;  3ZRF A;  2LWP A;  4NAM A;  3HRD D;  1KH0 A;  3VFK A;  3URY A;  2QC8 A;  3BVZ A;  4OHJ A;  2KTF A;  2KTR A;  1F52 A;  1H8C A;  4JL9 A;  4EZK A;  3CMM B;  3I57 A;  2BVC A;  3ML8 A;  1TJE A;  5CHV C;  3ZIM A;  3E9S A;  1E10 A;  1VD2 A;  4W9G A;  2KC2 A;  2KQ7 A;  3RCZ A;  3ZXR A;  2KNB A;  4FJY A;  1JRO A;  1UEL A;  4CHK A;  2JXT A;  3KUZ A;  4AS1 A;  4II2 B;  1P7F A;  4L2Y A;  1XD3 B;  4HJK A;  4ZYN A;  5JH5 C;  2LGX A;  2BB6 A;  2PPH A;  2KVZ A;  2KLC A;  2GMI C;  3KYC D;  1EU3 A;  5LXI B;  2RR9 A;  3T8M A;  3TSS A;  2EMS A;  2AX5 A;  3ZQ4 A;  4E3C A;  4ZHO A;  3KW5 B;  3N20 C;  2V4L A;  3VR9 B;  2ON8 A;  2KAJ A;  2LGI A;  3ZUN A;  4C4V B;  1D5M C;  3TBL D;  2CJN A;  4XDD A;  4ANV A;  5HKH A;  4C56 C;  1R7S A;  1TBE A;  2HJ1 A;  5IO9 A;  2GB1 A;  2KJR A;  4C80 A;  1S1Q B;  2QSD A;  4RGO S;  4C7Z A;  3ZO5 B;  2CKH B;  2EEL A;  3AH7 A;  3ZJU A;  3M62 B;  1DOY A;  1FFU A;  3U4E G;  1V9J A;  1Q5W B;  3PT2 B;  1GB4 A;  3FIL B;  3IAM 1;  4EUT A;  1DYQ A;  2L0F A;  3V6C B;  3DCG A;  1L0X B;  2J4X A;  1V1P B;  1ZGU B;  2K8C A;  3Q8C A;  4C4V A;  2XN9 C;  2DYO A;  3O13 A;  5AZF A;  4P16 A;  1WWT A;  3DVG X;  1WX9 A;  4H2A A;  1I4Q A;  3RMK C;  2KMC A;  3RPF C;  3U52 E;  1WX7 A;  5L95 C;  1ZXI A;  2IY1 B;  1LO5 D;  4IUM B;  4W9F A;  4AOF A;  3NZU A;  4M8N A;  1V81 A;  1XEE A;  3EHV A;  1WH3 A;  3RNB C;  3UIO B;  4TQ1 A;  3FIL A;  3KVF B;  1FFV A;  1WE7 A;  1ZE3 D;  3U7D A;  1V1P A;  1YQB A;  5AUK A;  3Q3N C;  3DDC B;  4WQM A;  5I4D A;  4REZ A;  2BF8 B;  3AMZ A;  5BMH A;  2GBN A;  2IYD B;  1L0Y B;  1PFD A;  3CSF A;  3K9P B;  3BYT B;  2WQY B;  4MSQ B;  2DX5 B;  2DLB A;  2KWU B;  3J9C A;  3VAW A;  4YWG G;  2BKR B;  2O6V B;  3A4S C;  2MH7 A;  1I4P A;  1L7Y A;  3RD2 A;  1C79 A;  5EE9 A;  3I5J C;  1PGB A;  3NUH B;  2WXJ A;  3AEG B;  2KJ6 A;  3U2S C;  2K5P A;  3AU4 A;  3RNC C;  2RSU A;  3IFW B;  1C77 A;  4NJ7 A;  2FBW B;  2LD9 A;  2WDT B;  3L17 A;  2WXG A;  1K8R B;  4WH4 A;  1J7A A;  4PT5 A;  2GBK A;  2H88 B;  1PDX A;  1WXQ A;  1JWU D;  1FIQ A;  4XZ4 A;  2OJW A;  2LVP A;  2LXC A;  4W9L A;  2M17 A;  2FCN A;  3NZ3 A;  2BS2 B;  3WAP A;  4AUQ C;  4LNO A;  2WXF A;  3ONS A;  1FNV A;  2LGS A;  1QQR A;  1UBI A;  3UI3 A;  3EGR A;  3V05 A;  1L2N A;  4FJZ A;  2D07 B;  5GXG B;  4K1R B;  2RMM A;  2RPV A;  2LGY A;  5BYR A;  4B0M A;  3QWZ B;  3W9C B;  2K9X A;  4IM0 A;  1QOG A;  1H4R A;  3U30 A;  1FRR A;  2L32 A;  4RGT A;  2WLB A;  3NOB A;  1TZO A;  1V49 A;  1NVI D;  2OOB B;  1ZDV A;  1D6E C;  4IM2 A;  4XYC A;  2IGH A;  5EE3 A;  5BO4 B;  2LI5 A;  3B1L X;  3NS1 A;  1CMX B;  1TYG B;  3KQ4 A;  2PE9 A;  4NQL B;  4KKI A;  3PZ8 A;  3HVD A;  2Z59 B;  3NHE B;  3N1X C;  3NG0 A;  4AP4 C;  3W2D A;  1JRU A;  4FXC A;  1ET9 A;  4MEM A;  1WX8 A;  4K7U A;  3N9Y C;  2N1W A;  2NBW B;  3DBR I;  4EKU A;  4I6N B;  5T8I A;  3RNF C;  3M95 A;  3TUO A;  5DPT A;  4JWU C;  3OJ4 B;  5FK9 C;  1WSP A;  1AYF A;  1MPE A;  4IW0 A;  2JPH A;  5G2N A;  1GOZ A;  4HKQ A;  3DVN V;  5KHQ A;  1D3Z A;  2KOX A;  2E3T A;  5EE1 A;  3R8B A;  1ZDX A;  3RI7 C;  1JW9 D;  3SU8 X;  4FHJ A;  3R7Q A;  5BYS A;  4EE2 A;  3AE9 B;  4NY0 A;  3ZNG C;  3PS6 A;  1HE8 A;  2G9H D;  1TTN A;  1N61 A;  1IP9 A;  2KQS A;  1SB3 C;  2LXA A;  4G3X B;  4OZB A;  3WCQ A;  2DAF A;  3AE3 B;  4IDI A;  3MP9 A;  1N62 A;  3BII D;  1N6Z A;  2FCS A;  3AM9 A;  3NRZ A;  4GMV A;  1I4H A;  3ZNI D;  1ET6 A;  3ML9 A;  1WZ0 A;  3VH4 B;  5AUI A;  2K3U A;  4LDT B;  2IJ0 A;  5MPO A;  4ZRJ A;  1RM6 C;  3R7R A;  2UU7 A;  2YEP B;  4M0W B;  4NJ6 A;  2K1F A;  1E5W A;  3ZJV A;  4BKS D;  1UGM A;  4S0R A;  4YTP B;  3KYD D;  5EE0 A;  3DWM A;  4DK5 A;  4LJP B;  1XCQ L;  2M4N A;  5AZG A;  2V0G A;  2JZ3 B;  4G0N B;  4P1B C;  5FR6 A;  1HEZ E;  2E6X A;  2QIE B;  5H92 C;  1C76 A;  1VLB A;  2WP9 B;  1WI0 A;  1L6U A;  4IC7 B;  1BUI C;  1EU4 A;  3VTW A;  2D2Q A;  3TL5 A;  4K81 A;  4ZDV A;  4URK A;  2M1M A;  3W5V B;  2W55 A;  3QAQ A;  3X23 A;  3V6E B;  1E90 A;  4EFO A;  3V61 A;  5E6J A;  4NJC A;  1TS4 A;  3ALB A;  2NVU I;  2CS4 A;  1FPY A;  1MHH E;  4IM3 A;  3VTU A;  2EMT A;  1WXV A;  4F7Z A;  3EFC A;  4RCO A;  3DPD A;  4GXB A;  2WDQ B;  2KC1 A;  2WXP A;  5J2R A;  4FHK A;  3H8H A;  3PRM B;  1G6J A;  1E8X A; 
#chains in the Genus database with same CATH homology
 3LXF A;  1PGA A;  2ACZ B;  5H8Y E;  2BS4 B;  4NAM A;  3HRD D;  1KRH A;  1KH0 A;  4O1N A;  3URY A;  3IXS A;  3BVZ A;  4CQN A;  4OHJ A;  1FCL A;  2BBC A;  4ZHP A;  1E0Z A;  4TMA B;  4WAF A;  5G5G A;  1K52 A;  2BTE A;  3I57 A;  2BS3 B;  2G1E A;  1Y56 A;  1ZPS A;  3BK1 A;  4LLG M;  2DWQ A;  3B2G A;  4A90 A;  1TKE A;  4TQ0 A;  2PVO D;  3IAS 1;  1TJE A;  3CWI A;  3NVW A;  3E9S A;  1L5P A;  1E10 A;  1F77 A;  3FAH A;  1YN4 A;  5D3D A;  2WXI A;  2W54 A;  1PGX A;  2ZW1 A;  1CZP A;  2GRI A;  4NAW B;  1T3Q A;  1QOF A;  1JRO A;  1P7E A;  2JXT A;  2GI9 A;  2WXO A;  4AS1 A;  2WS3 B;  2N9K A;  1P7F A;  1VZ8 A;  2K22 A;  4L2Y A;  1C9F A;  3HVZ A;  2Y5C A;  1RYJ A;  2BB6 A;  4GDK B;  1IGD A;  2WXM A;  3RFZ B;  1F0Z A;  2TSS A;  1EU3 A;  3BZD B;  3TEZ A;  4OW0 A;  4RF0 A;  4ARI A;  3NVZ A;  1SJE D;  3AEA B;  4N59 A;  2M0A A;  3FC4 A;  2QIL A;  3TSS A;  2AX5 A;  5TSS A;  1DOI A;  3ZQ4 A;  4ZHO A;  2PVG C;  4HEA 1;  2V3N A;  1N5X A;  1DOX A;  1TS3 A;  1QLB B;  3EA6 A;  3VR9 B;  1RFK A;  2ON8 A;  2KAJ A;  4HKZ E;  1YQ4 B;  2KQ4 X;  2LGI A;  1SBB B;  2AQ3 B;  5C3J B;  1IGC A;  1XF5 L;  4N6E B;  2JSV X;  1D5M C;  3W5U B;  1AWD A;  3AEF B;  1FEH A;  2CJN A;  4IOI E;  4XDD A;  1PUT A;  2WNM A;  1HZ5 A;  3P4Q B;  4Q2J A;  4C56 C;  1R7S A;  1QF6 A;  2GB1 A;  2XNA C;  1VDV A;  1C4P A;  1YMH E;  4C80 A;  1XCT L;  2QSD A;  4RGO S;  4C7Z A;  1VJK A;  2EEL A;  4ZOH C;  3AH7 A;  3T3O A;  1YJI A;  3ZJU A;  1NYQ A;  4HJG E;  2M56 B;  4A8X C;  3V3X A;  3AE1 B;  1DOY A;  3BWU D;  1FFU A;  3U4E G;  4L23 A;  4ZRQ A;  1FCC C;  4OZA A;  2ONQ A;  2KWD A;  3Q8F A;  3FIL B;  1GB4 A;  5BYQ A;  2JQR B;  2WDR B;  2PIA A;  3IAM 1;  1YNT E;  1GAQ B;  3AE2 B;  1DYQ A;  1C4C A;  3IT4 B;  4YSY B;  5FKA C;  2B76 B;  2W82 A;  1L0X B;  2J4X A;  5HG2 A;  1V1P B;  1YN5 A;  3Q8C A;  2XN9 C;  2INP E;  4ZRP A;  5G5H A;  1ZOY B;  2DYO A;  3O13 A;  1IBX B;  4P16 A;  1WWT A;  4H2A A;  1I4Q A;  2JU6 X;  2BT6 A;  1EWY C;  2JX5 A;  4L1B A;  3RPF C;  2J42 A;  4KGT A;  3U52 E;  1KF6 B;  4XWT A;  2Y5P A;  1KTK A;  2EKI A;  1MHX A;  1N60 A;  2IPK D;  1ZXI A;  2DYM A;  1LO5 D;  4TSS A;  3LYY A;  1XEE A;  1NYR A;  1UWM A;  2JYT A;  4NZL B;  1F2R I;  2WU2 B;  1MVK A;  1QIL A;  4TQ1 A;  3FIL A;  3AE7 B;  1BXT A;  3PZ7 A;  1FFV A;  1SE3 A;  1ROE A;  4P6V F;  1ZE3 D;  1D5Z C;  3L4P A;  1QOB A;  3GP7 A;  1XXG A;  1V1P A;  5JXV A;  1FRD A;  3IT6 B;  4A6Q A;  5AUK A;  1ENF A;  4XE0 A;  1IBX A;  1TS2 A;  3MHZ A;  1HXY D;  4WQM A;  5I4D A;  4YXD B;  4REZ A;  1EWC A;  1YQ3 B;  3B9J A;  4AQ7 A;  1BML C;  1K51 A;  3AMZ A;  4ZYS A;  5BMH A;  2NMQ A;  4GLS C;  2PW9 A;  4KGS A;  4DQO C;  1L0Y B;  1V97 A;  2OED A;  1E9M A;  1PFD A;  1V1O A;  4DXF A;  1B1Z A;  2QMT A;  3BYT B;  2WQY B;  2N9L A;  4D2K A;  2DLB A;  4A9A A;  2WXH A;  1JCK B;  3J9C A;  4YWG G;  3AV8 A;  2WU5 B;  2KDM A;  5HI1 A;  2MH7 A;  1I4P A;  4JX1 C;  1SIJ A;  1C79 A;  1JAL A;  5LNK 1;  1VZ6 A;  2LEK A;  2WXN A;  3P4S B;  5EE9 A;  3AED B;  4RNA A;  1PGB A;  1KFY B;  1L4D B;  2WXJ A;  3AEG B;  3NUH B;  3MFG A;  1SEB D;  2MEK A;  3U2S C;  5BMI A;  3E56 A;  3KWV A;  2K5P A;  5HFY A;  1A70 A;  1E7P B;  2R61 A;  1C77 A;  1FXI A;  2FBW B;  1IUE A;  2ZW0 A;  1SF0 A;  2J53 A;  3Q8A A;  4B0E A;  2OHF A;  1FMA D;  2WXG A;  1HZ6 A;  1E6E B;  4WH4 A;  1J7A A;  1N63 A;  1UGJ A;  1XLO A;  2JWU A;  2SEB D;  3BVG A;  1XLQ A;  4PT5 A;  5D7G A;  1J7C A;  5HHD G;  2SAK A;  2H88 B;  1PDX A;  1WXQ A;  2FE8 A;  1JWU D;  1CK1 A;  3NVV A;  1FIQ A;  4KX6 B;  4C7Y A;  1L0V B;  3GS2 A;  3PO0 A;  1VZ7 A;  3TEY A;  4ARC A;  2D5G A;  1AW7 A;  1UWX A;  1D5X C;  1WGK A;  2AQ1 B;  4RGN A;  3NZ3 A;  1VR9 A;  4OVZ A;  3R2I A;  4YSZ B;  4GDL B;  3P4P B;  2BS2 B;  1I4G A;  4XWW A;  1ZP0 B;  4LTU A;  2WXF A;  1FO4 A;  1FNV A;  1NEN B;  1QQR A;  1C78 A;  1XLN A;  3UI3 A;  3EGR A;  1QKZ A;  2WXK A;  3CIR B;  3V05 A;  1I4X A;  5GXG B;  3SFD B;  3AE6 B;  2RMM A;  2LHD A;  2RPV A;  2MJE A;  5BYR A;  1Q10 A;  4B0M A;  3W9C B;  2K9X A;  1SJH D;  2N7J A;  2PTL A;  2KMM A;  1QOG A;  2YEP F;  1TKY A;  2HDE A;  2IGD A;  3AEB B;  1FRR A;  2PMV A;  1OQR A;  3Q69 A;  1MI0 A;  2L32 A;  2LFI A;  2BYT A;  4RGT A;  2WLB A;  3ZYY X;  1TZO A;  3I9V 1;  4HRO A;  3Q8E A;  2KN4 A;  3TEW A;  1NVI D;  2QEJ C;  1JWB D;  2CU3 A;  1ZDV A;  3R2T A;  4N58 A;  1D6E C;  2L52 A;  3P63 A;  1JQ4 A;  2IGH A;  5EE3 A;  1ACC A;  3NS1 A;  1TYG B;  5FR3 A;  1OQQ A;  3KQ4 A;  2JYE A;  2I2Y A;  4KKI A;  3PZ8 A;  4MM3 B;  3ETR A;  3HVD A;  4A55 A;  4ITK A;  3AN1 A;  4YSX B;  2WXQ A;  3W2D A;  2VZK D;  2WXL A;  4M0W A;  2WDV B;  4WWM A;  3SEB A;  4FXC A;  1ET9 A;  3VRA B;  2RDG A;  4J3O D;  3HUI A;  3C8Y A;  1K53 A;  3LB8 C;  1GPX A;  3N9Y C;  1FXA A;  1QOA A;  1K50 A;  2Y3A A;  5T8I A;  4MT5 A;  1V8C A;  3TEX A;  2DBY A;  1XO3 A;  3EUB 2;  1JML A;  1KLG D;  1QT9 A;  3TUO A;  1JWM D;  4JWU C;  1I4R A;  2AQ2 B;  5FK9 C;  2KAC A;  3OWE B;  4IKG A;  1FNW A;  1WSP A;  1JWA D;  1AYF A;  1MPE A;  1STE A;  1T5X D;  2BB5 A;  3GB1 A;  4JE3 B;  1YN3 A;  1JWS D;  2MJD A;  1ZUD 2;  1YJJ A;  2RDH A;  1GOZ A;  3P42 A;  1ZXH A;  4HKQ A;  3SFE B;  2BW2 A;  1TS5 A;  1DGJ A;  4YTM B;  1NEK B;  2X38 A;  3BVM A;  2FUG 1;  2Z8L A;  1EM7 A;  1M4V A;  2I38 A;  4JPS A;  2V3P A;  3VRB B;  2E3T A;  5EE1 A;  3R8B A;  3AEE B;  2JZP A;  1SE4 A;  2LJI A;  4DXG A;  1ZDX A;  1JW9 D;  4UDU C;  3VQI A;  5BYS A;  4EE2 A;  1CQV A;  1SXT A;  1FM0 D;  3AE9 B;  3NVY A;  2G9H D;  1N61 A;  1HQR D;  1SB3 C;  1TY2 A;  3ZJT A;  4WIP A;  1JRP A;  2NTT A;  4OZB A;  3WCQ A;  3Q8B A;  3AE3 B;  2LUM A;  4IDI A;  1F2R C;  3MP9 A;  2J52 A;  1N62 A;  2PKO A;  3BII D;  2NTS A;  3KWL A;  5C2T B;  4OZC A;  1KLU D;  3AM9 A;  3NRZ A;  1ESF A;  3U7Z A;  1I4H A;  1PYW D;  1ET6 A;  1B9R A;  3VR8 B;  1HA5 A;  3BK2 A;  4RGM A;  4YT0 B;  2N0S B;  3P4R B;  2ICI A;  5AUI A;  2K3U A;  2W3R A;  2IJ0 A;  1RWS A;  3AE4 B;  1SSN A;  4YTN B;  1RM6 C;  5MPO A;  1GB1 A;  1L4Z B;  2YEP B;  3DWG C;  1UUP A;  4US8 A;  3ABV B;  4WUR A;  1CJE A;  1WYG A;  4JWS C;  3ZJV A;  3AE5 B;  3T3N A;  1SE2 A;  3MC0 B;  4YTP B;  4USA A;  5EE0 A;  3DWM A;  5BMG A;  1XCQ L;  2V0G A;  4KGR A;  4MAC A;  5D3I B;  2LHE A;  4LK0 M;  2INN E;  1C4A A;  1OFF A;  1NI3 A;  3ZGZ A;  1D4B A;  1HEZ E;  2E6X A;  1TY0 A;  2QIE B;  5H92 C;  1C76 A;  1VLB A;  2WP9 B;  1FNU A;  1BUI C;  1EU4 A;  1L6U A;  1VRA B;  2W3S A;  3MJ5 A;  4MH8 A;  2IGG A;  2HTM E;  2L1A A;  2L83 A;  1L6V A;  1FD6 A;  4XDC A;  3KLS X;  2Q5W D;  3AB5 A;  2W55 A;  4R3D A;  4RH6 A;  2H89 B;  3W5V B;  3P1M A;  3AEC B;  5E6J A;  4NJC A;  1TS4 A;  1UNS A;  4KKJ A;  2QJL A;  1MHH E;  2LMC A;  3SR6 A;  3B2F A;  3AE8 B;  2K0P A;  2MJ3 A;  4RFB A;  4US9 A;  1T6B X;  3W1S A;  4RCO A;  1TKG A;  2CJO A;  2IDY A;  2M19 A;  2WXR A;  1AN8 A;  1J7B A;  2WDQ B;  4HRS A;  3BYY B;  2V4I B;  2VZK B;  2PLP A;  2WXP A;  1XLP A;  1WRI A;  4RF1 A;  3H8H A;  1I7H A;  1N5W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...