1FMAD

Molybdopterin synthase (moad/moae)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
MIKVLFFAQVRELVGTDATEVAADFPTVEALRQHMAAQSDRWALALEDGKLLAAVNQTLVSFDHPLTDGDEVAFFPPVTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of molybdopterin synthase and its evolutionary relationship to ubiquitin activation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords MOLYBDOPTERIN CONVERTING FACTOR, SUBUNIT 1
total genus 22
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2000-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fmaD00
2JX5A 1J7CA 4C7YA 3AB5A 1FFVA 3KWLA 2CU3A 3NS1A 4LTUA 4C7ZA 4JWSC 1OQRA 1N61A 3VR9B 3AMZA 2Q5WD 1KRHA 1JRPA 1GAQB 4US8A 3AEAB 3AE9B 3LB8C 1FRRA 1YQ3B 4JX1C 1ZOYB 1N63A 2K22A 2DWQA 2QIEB 4KX6B 4P6VF 4YSYB 4YTNB 1N60A 2N0SB 3AE2B 1XLNA 1QOAA 1XLPA 2BS4B 1J7AA 2MJEA 3NVVA 2L83A 2G1EA 1SB3C 1AYFA 1V8CA 2BT6A 3P1MA 4N58A 1PFDA 4FXCA 1L6UA 1ZXIA 2KAJA 3W5UB 4ZHOA 3B2GA 5G5HA 1L0VB 2PVGC 3L4PA 2AX5A 5GXGB 2LEKA 1JALA 2PKOA 2WLBA 1XO3A 1JWBD 1YJJA 1TKYA 2K9XA 1ROEA 1B9RA 1E10A 4ZOHC 5AUIA 1TYGB 3ABVB 1FXIA 4A9AA 3VRAB 5C2TB 1A70A 3WCQA 2CJOA 4YSXB 3AEEB 3AE5B 2MJ3A 3P4SB 2EKIA 2WU2B 3AEBB 1JW9D 1SIJA 1N5XA 1RWSA 1FIQA 3NVZA 1E0ZA 1FM0D 1FMAD 1NENB 3AE4B 1PDXA 2FBWB 5EE9A 5AUKA 3P4RB 1L5PA 3SR6A 1NEKB 3CWIA 4ITKA 3W5VB 1N62A 3NVWA 4WWMA 4USAA 1OQQA 1VLBA 1WRIA 2H88B 5EE0A 1WWTA 3AE1B 3AEFB 3P4PB 3AE8B 3AEDB 3DWGC 2DBYA 4YTPB 1E6EB 1EWYC 1PUTA 1CJEA 1CZPA 3P63A 4N59A 2WQYB 2PIAA 5G5GA 4HRSA 1FXAA 3VRBB 1QOFA 1L6VA 2Y5CA 3FAHA 1QF6A 3SFDB 1XLQA 1E9MA 5EE1A 4YXDB 4YT0B 3AV8A 1TKGA 4ZHPA 1IUEA 1NYQA 1JWAD 2BS2B 1T3QA 1QLBB 1J7BA 1DGJA 1DOIA 2CJNA 2JQRB 1E7PB 2HTME 2WDQB 2KMMA 1GPXA 3AM9A 3AE3B 1JQ4A 3B9JA 3CIRB 5EE3A 3ETRA 1QOBA 1VDVA 3ZYYX 1ZP0B 3AEGB 1YJIA 4C80A 1QOGA 4YTMB 1SF0A 1N5WA 1OFFA 1QT9A 1XLOA 2PVOD 2WU5B 3DWMA 3NVYA 4WQMA 5H8YE 2W55A 1I7HA 4US9A 1FO4A 1DOYA 1NI3A 1WGKA 1YQ4B 4HROA 2WDVB 2M56B 1FRDA 1RM6C 2M19A 3LXFA 1UWMA 2MH7A 1RFKA 2WP9B 4JWUC 3SFEB 4YSZB 1VJKA 2W3SA 2B76B 3AECB 1F0ZA 3HUIA 2L52A 3VR8B 2W54A 2ACZB 4IDIA 3PO0A 1V97A 3RPFC 2BS3B 1TKEA 1ZUD2 1RYJA 4N6EB 3BIID 2W3RA 1NYRA 1FFUA 3AN1A 2QJLA 3AE6B 1KFYB 3W9CB 3NRZA 1R7SA 3EUB2 5C3JB 1TJEA 1JROA 3P4QB 2WS3B 1KF6B 2MJDA 1WYGA 2H89B 2K5PA 1AWDA 2E3TA 3FC4A 1DOXA 3AH7A 5H92C 2WDRB 3B2FA 1WXQA 2OHFA 3HRDD 5MPOA 1NVID 3AE7B 3HVZA
chains in the Genus database with same CATH superfamily
4KSLC 2ZW1A 4C7ZA 3Q3JA 4NAWA 4WURA 2KWDA 2LI5A 3OAWA 4PS3A 1QOAA 2GBMA 4N58A 3W5UB 4KGTA 1MJDA 1F9JA 3GS2A 1E8ZA 5C2TB 4AOFA 1YD8U 4II3B 3CSFA 3L17A 2L05A 4XWWA 1UF0A 2YLMA 2WU2B 1JWSD 5LLIA 4ANVA 1E7VA 4NJ6A 1L5PA 5EE0A 2KX0A 2Z0EB 2H88B 1EU3A 3AE1B 2QC8A 3X23A 3VTWA 2IJ0A 2KDIA 3NG0A 4PK1A 1LFDA 2ON8A 3QHTA 4IW0A 4IM3A 1WGYA 1NYQA 1JWAD 1L7YA 1T3QA 3CF6E 3PRZA 1DGJA 2L0TA 3PS6A 1J19A 2DLBA 4MGYE 4ZYNA 2JF5A 2JU6X 4C80A 3PZ7A 3UGBB 4M8NA 2HJ8A 4US9A 1DOYA 2M56B 1WGRA 3N32A 2WGSA 4MM3A 4JLCA 1K8RB 2MBOA 4ICVA 2W54A 3APCA 1IGDA 2GB1A 3A4SC 3H9DA 1RYJA 4XDCA 4IUMB 1ZDVA 2GI9A 2OHFA 2XEWA 5E6NA 2OEDA 2G4SA 4E74A 2XBBC 3KVFB 1CQVA 4JGHB 2WXGA 2ASQA 3U30A 3EA6A 1LXDA 1N63A 2PE9A 3WIMA 2LGYA 1J7AA 3RI7C 1ZXIA 3MFGA 4RCOA 1MG4A 5GXGB 1JALA 2M17A 1YJ1A 4FULA 1YJJA 3MTNB 3Q3NC 5AZFA 4K7UA 4XC2A 4FN2A 3TBLD 1A70A 3AULA 3U7DA 3TEZA 2WHIA 1AW7A 3DDCB 2Z8LA 1SIJA 4KSKC 2BYFA 4OVUA 1NEKB 4EKUA 2J52A 4ZRQA 1UZXB 2FNJB 1AARA 3ALBA 2Z59B 4LNFA 3JVZX 4OVZA 2BB6A 1P7FA 2L8JA 3RMKC 3PGEA 5G2NA 3R2TA 2XN9C 4FLHA 1E7PB 1VCBA 2RSUA 2WXMA 1V2YA 1HQRD 1KLGD 3AU4A 2O2VB 4W9JA 2KFKB 1WE6A 2ZPNA 4LJOB 2WX1A 3Q8CA 3ZKJC 4XGAB 1XF5L 2LVOA 3PPAA 1ET9A 4ANWA 4HVBA 3CMMB 4A6QA 4XYCA 5IO9A 1TKEA 1L2NA 2CS4A 2LGDA 2R2QA 1JRUA 2BYEA 2WNMA 4KV2A 2YEPF 2YEPB 2MP2A 5HFYA 4MH8A 3KWLA 4C4VA 4K1RB 1DYQA 1OQRA 1TS3A 4RM9A 4O1NA 3AI5A 4PS7A 1HEZE 1UBQA 4S17A 4JX1C 2G4DB 2N7EA 2MJEA 5FKAC 2INDC 2IBIB 1SJHD 4MDKE 5FR3A 1I35A 2KXJA 1MI0A 1N6ZA 2KTRB 4EEWA 1JWBD 2V4IB 3RZWC 3QA8A 2IY1B 1RAXA 4MEMA 1GG3A 2CHWA 3TSSA 1WI0A 3P4SB 2MQJA 2UU7A 1FIQA 1L0XB 5EE9A 3NUHB 4TUUA 4BAXA 4LLGM 1GPXA 3NVWA 1VLBA 3P4PB 1YN3A 1C4CA 2IGGA 1TIFA 1V80A 4JE3B 2HJ1A 5AZHA 2DZIA 1QLBB 3RD2A 2LZ6A 1UGMA 2N4FA 1RLFA 5CX3A 4YTMB 3K9PB 3VDZA 3BYYB 3VHTC 1C4AA 2N9KA 4HDOA 1I7HA 1FO4A 1FRDA 2ZW0A 2PLPA 1V5OA 1FXTB 1WSPA 2LFIA 4LJPB 2MRPA 1V97A 4G50A 4BBNC 1MPEA 2RMMA 3EECA 1KFYB 3QARA 3EUB2 3RNAC 3Q69A 2KMAA 3IHPC 1LM8B 1LGRA 3FC4A 2LD9A 3RN9C 4AUQC 3QCAA 4GDLB 3FILB 1V5TA 5LXIB 1YQBA 4GMVA 2KJRA 1YQ3B 1V49A 2DWQA 2NBVB 1N60A 1P0RA 3H7PB 5L95C 2KANA 2W9NA 1T5XD 2O6VB 2LJIA 3V3XA 3V61A 2LEKA 2PKOA 2O6VA 5DCNA 1ZKHA 3DPDA 2CJOA 2J42A 3RT3B 1K51A 2N7JA 4GLSC 2NBUA 4HJGE 4MGZE 1P7EA 1WZ0A 4JQWC 1N5XA 3A9JA 2FAZA 3V6EB 5AUKA 4HWIB 3KUZA 3SR6A 4MJSA 3H1UA 5CHFA 1WWTA 3AEFB 1ACCA 3GOEA 3L0WB 3KYCD 4AP4C 1CJEA 2K1FA 2N1WA 5HKHA 2LWPA 3A9JB 1QKZA 5TR5A 1EU4A 2GBJA 3LDZE 4URKA 4ZRPA 3MP9A 1QZEA 1YMHE 3RNGC 2CU1A 1XD3B 2V9HA 4MGIE 5D6JB 2K6QA 1EO6A 1XLOA 3NVYA 1J8CA 3GE3C 1NI3A 2NS5A 2DNFA 1WGDA 1VZ7A 4YSZB 2RDBC 1VR9A 2EMTA 3VH3B 2PPHA 1WYWB 2AQ1B 3APFA 4W9CA 2RDGA 3QIJA 1ZUD2 2J7QB 3NRZA 4PT5A 1WXVA 5DPRA 4IM2A 4RNAA 2WS3B 1KF6B 4OZBA 3VTVA 2MBEA 2WXIA 5H92C 3DVNU 3BY4B 3E56A 4HPLB 2D2QA 3I9V1 1GUAB 4I6NB 3VR9B 3TEWA 2KX3A 1OGWA 1BUIC 4D2KA 4EZLA 3V60A 4KX6B 2G45B 3H8HA 2JZPA 3N1XC 4EZJA 3KH0A 2PVGC 3U8ZA 4WJNA 5EDSA 3V6CB 1TKYA 2K9XA 1KOTA 2WXPA 3JSVB 4ICUA 2KC1A 2Z0DB 2REXA 3HM3A 5GMVA 1WJNA 4JL9A 1TTNA 5J17A 4A55A 3PT2B 3D32A 2RDHA 4C00A 2ZVNA 3L10B 2MX2A 4MT5A 4G11A 2V1YA 3DBRI 3M3JA 3PHXB 2DZKA 4HRSA 2EKEC 1KLUD 2MHJA 4YL8A 3HK0A 1CMXB 2SAKA 1WJ4A 2HE7A 3MC8A 3CIRB 2IDYA 3ZYYX 1UWXA 1WY8A 1Q5WB 3NHEB 1QT9A 1OFFA 2L7RA 2DAFA 4KDLB 3R3MA 2YVCA 1YNTE 1YN4A 2WDVB 5D94A 2AL6A 3DHIC 3WALA 4FJVB 1WE7A 4J3OD 3AECB 4E71A 4K7SA 2ICIA 4FHKA 3NY5A 3X0WA 1NYRA 3AE6B 3HVDA 4RGOS 3KLSX 2NMQA 1M4VA 3S2AA 3AH7A 3TEXA 3B2FA 2KK8A 3HRDD 2IO2B 4IKGA 2NVUI 3OWEB 1L4DB 3RNCC 4HLEA 4ZRJA 1NI2A 3RZFA 1BMLC 2JWUA 4YTNB 3ZJUA 2I1JA 3AU5A 1SB3C 2N9EB 3FILA 2GLSA 3VXWA 2KAJA 4HJKA 5TSSA 3IT4B 4W9EA 2ZCBA 1B9RA 1ZPSA 4DQOC 1WM3A 3BVMA 2KHWB 2CR5A 1GNUA 1R4NB 3AEEB 1KLVA 1UD7A 2IGHA 2LGSA 1FM0D 1FMAD 3V05A 1OEYA 2N9XA 4USAA 4OZAA 3Q2AC 2INPE 4CO7A 1E8WA 4NAMA 3L08A 1I4QA 1QF6A 2LASA 3R8BA 3SFDB 1P9DU 4LNIA 4W9KA 3IAS1 1XEEA 2IPKD 4CQNA 4B0MA 2KFJA 2VH1A 3BVGA 4KKJA 2K8HA 1EWCA 1JMLA 3WANA 2AYOB 3A9KB 2D11A 2W55A 1WGKA 2LHDA 4WJQA 2M19A 3ZNHB 3KUDB 2NTTA 2AWTA 1TZ1A 2J0KA 2EELA 2FCMA 4MSMB 2QJLA 2JXTA 3EHVA 1PGXA 5E6PA 3ZQ4A 2IO1B 4HKZE 4S0RA 1DOXA 4NZLB 2JVCA 1WXAA 2RPVA 3GZNI 1N61A 2KN4A 1C79A 1SE9A 1ZOYB 2KQ4X 2B3AA 1ZXHA 4TMAB 3WAOA 1AYFA 2BT6A 2W82A 4FBJB 1PFDA 3B2GA 3I57A 2JYEA 1IPGA 1M94A 3KWVA 3OG5A 2JPHA 4ARIA 3IXSA 4OZCA 1P3QU 3H6NA 4P7IA 3J9CA 3E9SA 4GN1A 4YSXB 3ZJTA 3C8YA 2LGIA 3NVZA 1NENB 4J6IA 4YWGG 5HHDG 1E10A 4ZRIA 3W5VB 1F0ZA 1OQQA 2FE8A 4RF1A 3N30A 4EZKA 2MW5A 1UUPA 2KTRA 2Y5CA 1IP9A 2AQ2B 4MELA 3BK2A 2KDEB 3KW5B 3NJTA 3Q8FA 5BMGA 3VH4B 3AM9A 4EOYA 3ZNZB 3B9JA 3R66C 4C56C 3VAWA 3ETRA 3AEGB 4A20A 3VVWB 1D5MC 2PVOD 3DWMA 1YX6B 4MACA 3P42A 4GOCA 1SE4A 3ZUNA 1OEYJ 3HUIA 1C9FA 5DPTA 1I4RA 4RGTA 4RGMA 1GJZA 1GC7A 1G6JA 4W9HA 1R7SA 1XCQL 1QILA 2GBNA 4GGQA 1TBEA 5FK9C 3HVZA 4MGKE 3M95A 1SBBB 3WA0A 2CU3A 1YX5B 2KFKA 4RFBA 1KRHA 3H7SA 1D3ZA 1EUVB 4GSWA 3I3TB 2N0SB 1Q10A 1WRDB 2BS4B 4BZAA 3WAPA 2LJ5A 1OTRB 1R4MI 2CKHB 3IFWB 3NZUA 1C76A 1IGCA 3JYUA 1ET6A 3DCGA 3SD5A 2MLBA 3ZRFA 4IWOA 3MHZA 2AEHA 1HZ6A 2EKIA 1P98A 3R2IA 2NCNA 3TCAA 1XCTL 4KZCA 1PDXA 5FR6A 3DWGC 2LMCA 3ZRCA 4F7ZA 1MG8A 3R7QA 1JCKB 2O2VA 1WJUA 3NZSA 1FXAA 1F2RC 1IUEA 4P1CC 4M8MA 3UINB 1JWMD 2QCZA 3O65B 5J2RA 2K0PA 4HPMB 1GOZA 1ZP0B 1ZW7A 4DDID 4OW0A 4R3DA 4F1SA 4HROA 1C1YB 1I4HA 4LNOA 5I4DA 3H7PA 4PYUA 1Z2MA 1WH3A 4FJZA 2L52A 3ZTCA 3ZLZA 4OHJA 1UH6A 3FKYA 1FFUA 1V86A 4K3BA 3PRPB 4IM0A 1HZ5A 2Y5PA 1JROA 4GDLA 2E3TA 2N9PC 2RD0A 3KYDD 1WXQA 3IG3A 2D07B 1NVID 1HE8A 3GP7A 2KN5A 4DWFA 5HI1A 3ML9A 3DBHB 4ACFA 4FHJA 1WGHA 2K25A 3CSTA 1T0QC 3EGRA 3HM6X 4KIKA 4DHZE 4LCDE 2JRHA 3AE2B 1XLNA 1XLPA 2BWFA 2IO3B 2K8CA 3Q8AA 2ZPYA 2DHZA 3Q8EA 2D3AA 1QQRA 3N20C 3TJPA 1C4PA 1C3TA 1UELA 1NDDA 2Y3AA 1BT0A 1VZ6A 2DENB 4NQLB 5HG2A 4A90A 2KWCA 2BYTA 1IYFA 1RRBA 2M0XA 4WWPA 4FA6A 3AE8B 4ANXA 1WX7A 2L1AA 3T8MA 2GBRA 3VRBB 4CYEA 4H2AA 3ZJVA 2MCNB 5EE1A 3ECIA 1FCLA 2MWSB 4LNNA 3U4EG 5C23A 4GIVA 2K3UA 1WF9A 2PMVA 2TSSA 4B0EA 4BKTA 1WFYA 1WGGA 3ZNGC 1WXMA 1KTKA 2INCC 2LGXA 2JT4B 3EC8A 1V1OA 5D3IB 2K8BA 2MP2B 3DHHC 2R2OA 4PS8A 5BYQA 1ISNA 3HHMA 5JHAA 1YN5A 4IDIA 1UBIA 1OQYA 3I63C 3BIID 2LVPA 4M0WA 1SGHA 1VD2A 2JYTA 4B95A 5JZEB 2CHZA 3JSVA 2KACA 3JW0X 2WDRB 4II2B 1H8CA 1J7CA 2GOWA 2QEJC 3DOWA 1AN8A 2KDBA 1L4ZB 2ZJDA 3DHGC 1FNWA 2BB5A 2ZZPB 2BYVE 2ZVOA 1GC6A 5JHBA 4FXCA 1L6UA 1ESFA 4I6LB 4DHZB 2L76A 4AJYB 5G5HA 1L0VB 3ZDTA 1PGAA 2JWZA 3ENEA 1U4AA 1WR1A 4ZOHC 3Q6BA 4BKGA 4A9AA 5BMIA 2C7NB 2PE6B 4WAAA 2FCNA 5C1ZA 2OOBB 2WXHA 4KGSA 1N62A 3W9CB 3VQIA 2WXLA 2VH2A 4L2YA 1V6EA 2SEBD 1D4BA 1SJED 3ZNID 4TSSA 3OJ4B 4HXDA 4W9GA 3AV8A 1TKGA 2KT7A 4ZHPA 5LNK1 4ASWC 1YIWA 2IO0B 4N9F4 2WDQB 3TEYA 3AE3B 3ZO5B 4DXGA 1F52A 1QOBA 1SF0A 3TUOA 1UGJA 2PJHA 4WQMA 1S3SG 1WMHB 4QAYA 1UWMA 3BYTB 1MFWA 3KUCB 3U2SC 1D6EC 3BWUD 2ZNVC 2V4LA 3AN1A 4ARCA 1SEBD 2IYDB 3L16A 2BKFA 4BBNF 2N9LA 2KO3A 1WYGA 2JY6A 2H89B 5DPSA 5E6JA 2RR9A 1WM2A 5MPOA 1MHHE 4E3CA 1PYWD 2G9HD 4JWSC 4NNJB 1E90A 1T0SC 1FNUA 2Q5WD 1GAQB 4US8A 2VRRB 3AEAB 3PLUA 3LB8C 4BFRA 2KLCA 2LRUA 1LQBA 3ZGZA 1TS5A 3VUWA 4BKSD 3BZDB 4M02A 3RUIB 1I4GA 1C77A 2WLBA 5D7GA 3LJ3A 2RGFA 5AUIA 1TY2A 3APDA 3WCQA 4IG7B 3LYYA 3Q3FA 3AEBB 3TL5A 1KM7A 3MHSD 4HKQA 2BBCA 2BGFA 3AE4B 2FBWB 4UDUC 1I42A 1V1PB 4WWMA 3RULA 2WXFA 3QAQA 2DBYA 2LXAA 1STEA 4YXDB 1BXTA 3Q3OC 2PTLA 2QILA 1ZDXA 3U52E 4C4VB 2CJNA 2WX0A 2C7MB 1HTOA 4A3PA 1K50A 3GZNB 3IT6B 4Q2JA 2M1MA 2IGDA 4BKSA 2JRIB 5H8YE 4AQ7A 2KYWA 3DVGX 3DVNV 3SEBA 2GMIC 3A4RA 1RM6C 3LXFA 5JH5C 2MBQA 1RFKA 2WP9B 3SFEB 4M00A 4X57B 4TKNA 4JPSA 2QDFA 2AQ3B 1VZ8A 5JXVA 2O6VD 2JUOA 4HK2A 4RM8A 2ONQA 1TJEA 2FIDA 2MJDA 2V3PA 2D3GA 2X38A 2XK5B 4L1BA 4FADA 2KQ7A 4JIOU 3V62A 4C7YA 3U7ZA 2ZCCA 4DDGD 2OJRA 1KH0A 3MC9A 4RMAA 1T0YA 2LUEA 5LXHA 3NVVA 2MBHA 3UQAA 3L13A 3B1LX 4PYZA 1WMHA 4AWJA 1XT9B 4CHKA 4P1BC 1TYGB 3MJWA 4XWTA 2D10A 2IZVB 2M0AA 1P1AA 3UQBA 4IOIE 3M63B 1JW9D 4WJPA 1ENFA 3AXCA 2BKRB 1R4NI 2KDMA 2NPTA 3CWIA 1WRIA 5D3DA 4KGRA 3AEDB 4GDKA 1E6EB 2M8SA 1PUTA 1Q0WB 4DK5A 4WIPA 3ML8A 3P63A 4XDDA 2KC2A 3FAHA 1XLQA 3P2BA 2L32A 2J4XA 2BS2B 1J7BA 1DOIA 2LUMA 2XK5A 1VDVA 4W9FA 2INNE 3GE8C 2L3ZA 4I6PA 4G3XB 2DZMA 1WZ3A 1EM7A 3ZW3A 1FCCC 2FIFA 2ACZB 3PO0A 3RPFC 2KLGA 2QMTA 3BINA 4KZ0A 2C60A 3W2DA 2PEAA 3MC0B 4DXAB 5IP4D 4LTUA 4LNKA 3PVLA 2BF8B 1X1MA 4RF0A 3AE9B 1SIFA 2EMSA 2IY0B 3UI3A 2K6DB 2KNBA 1FNVA 1VRAB 5T8IA 1PGBA 1TS4A 3L4PA 4K7WA 3IAM1 2VZKB 3DBRB 2KDFB 4TQ1A 1KJTA 2RPQA 4ZYSA 2HTHA 1WJ6A 2I38A 3AE5B 2V0GA 2V3SA 1F2RI 2I1KA 3IVFA 2FCSA 3IBEA 3N3KB 3O13A 3A33B 1FPYA 4ITKA 1J0GA 4HPPA 4ZRKA 4NQKE 1CZPA 3BVZA 2K39A 1K52A 4ZDVA 1QOFA 4EFOA 1HA5A 1WX8A 3RNBC 3RYTA 5BYSA 2HD5B 4A8XC 5IOIA 2LVQA 3GB1A 1MHXA 1YJIA 2A5UA 3UF8A 4KDIC 4NY0A 1YQ4B 2L00B 1WR6E 2BW2A 5D2MB 2JZ3B 1VJKA 1WXSA 3PREA 4OVVA 3L54A 3UIOB 4BOZB 4NAWB 3A1QA 1HTQA 1D5XC 3T3OA 4IC7B 4IWQA 1D5ZC 1FD6A 2KVRA 3SDLC 2CHXA 3NS8A 4NJCA 3B08A 1S1QB 3B0AA 3RNFC 2C9WB 4MJSB 2JX5A 1FFVA 1TS2A 1ZGUB 3AMZA 2JSVX 1JRPA 4FJYA 3Q8BA 3ZDMC 1FRRA 4KKIA 4DBGA 4NPNA 4GDKB 2G1EA 2WDTB 2KOXA 4DXFA 2KVZA 2OJWA 2AX5A 3DBSA 3PLVA 4LK0M 1ZE3D 1FEHA 1TZOA 1RFAA 4RGNA 3PRMB 3ABVB 2DX5B 5E6OA 3VRAB 4XE0A 1WIAA 3PV1A 5CHWA 1MVKA 1RWSA 4GB9A 2Y5BB 4LDTD 2FCQA 3P4RB 4BVUC 2HDEA 3SHQA 4K81A 4WWOA 4AS1A 3EFUA 3I5JC 1R4MB 1SE3A 2BWES 2UYZB 2N1VA 4N59A 1TT5B 2DYMA 2DYBA 1WX9A 3M62B 4A3OA 4YT0B 4KVGB 2WWZA 2LRWA 3DBLB 2D3CA 2KMMA 4MM3B 4WAFA 1T6BX 2UWQA 2BQQA 1YOVB 4WWNA 4HCPB 1QOGA 4P16A 3N1ZC 2KD0A 3URYA 2MH7A 1SSNA 2N7DA 2WXNA 2WYQA 3VR8B 4M0WB 2I2YA 4L23A 4LDTB 5AEKB 2D5GA 3Q14C 3VTUA 3N1YC 3N9YC 4RH6A 2D3BA 3NS1A 1IBXA 2C5LC 2BPSA 3QQ8B 1B1ZA 2KTFA 2K22A 4P6VF 2WXQA 3MJ5A 1Y56A 2MA9B 3ZXVA 3T9LA 2L83A 1V8CA 1L0YB 5AZGA 5J18A 3P1MA 5G55A 3DBLI 3ZXRA 3ZTDA 2DAJA 1Z5SB 3W1SA 2A4ZA 1FXIA 4NJ7A 1NBFC 4M01A 3ZIMA 2KWVB 1UNSA 1E0ZA 3PTFC 1F77A 3T3NA 3NZ3A 3A9KA 4W9IA 5IAAC 4K3CA 4MH0E 2ZEQA 5IKCM 5IN7A 1V1PA 4KIKB 2WQYB 2PIAA 4WJOA 3OLMD 1E7UA 5G5GA 3QX1A 1E9MA 4IWPA 5L83A 1Y8RC 5BMHA 2KJ6A 2WXJA 2HTME 3VUYA 1JQ4A 4G0NB 3W1SC 1N5WA 2WU5B 1IBXB 5BYRA 2C7HA 4WQOB 1CK1A 1XQQA 3NOBA 2GBKA 2MSED 3DBHI 1TY0A 2KMCA 2KWUB 3PHWB 4JWUC 2DYOA 4TQ0A 5CTRC 3BK1A 3KQ4A 4B6WA 3QJZA 2LHEA 2BS3B 3QC8B 3RCZA 4B9KA 2W3RA 1JWUD 3VUXA 4BOSC 2JXXA 5CHVC 2BVCA 3TIXA 3TMPB 5C3JB 1V81A 4GU2A 5DPWA 2FUHB 2K5PA 3R7RA 2NTSA 2NBWB 3C0RB 3W1YA 2M4NA 3AB5A 4ANUA 4EUTA 1I4PA 3EFCA 3VFKA 3HIZA 4GXBA 2NR2A 3A1QB 2QIEB 3ONSA 4YSYB 3WAMA 2R61A 1V9JA 1LO5D 3SU8X 4W9DA 1GB1A 3OJ3A 4TV3A 4ZHOA 1PQSA 2KZRA 2NPTB 4HDQA 1XO3A 2LXCA 2X8XX 2KQSA 1ROEA 1XXGA 2QHOA 1HXYD 5KHOA 3C19A 2MJ3A 2J53A 2KJHB 1E5WA 1TGZB 2FUG1 5KHQA 2PW9A 1I4XA 3RNEC 2E6XA 3K9OB 4W9LA 4MSQB 4YTPB 2MEKA 1H4RA 1EWYC 1EF1A 5IA7A 1K53A 3PSEB 1L6VA 2V3NA 1C78A 3QK0A 2JQRB 1SE2A 4HCNB 3Q3MC 2WXKA 2QSDA 1F1HA 5EE3A 3RFZB 2L0FA 4WH4A 2GRIA 3DVGY 1E8XA 4HEA1 3DQVA 2G3QB 1GB4A 1Q1OA 4EE2A 2DZJA 4F8CB 1E8YA 2W3SA 2B76B 3PZDA 3ZVVA 2AL3A 2WXRA 3QWZB 2KKCA 2MBBB 4N6EB 3UIPB 1EF5A 4REZA 2JZZA 2ZNVB 1T0RC 4XX5A 1A5RA 2J0MA 3P4QB 4AJWA 2J0JA 2XNAC 1AWDA 2WXOA 5BO4B 4DHJB 4DHJD 2BTEA 1SXTA 4XZ4A 2VZKD 3PZ8A 3AE7B
chains in the Genus database with same CATH topology
2ZW1A 3I9V1 4LTUA 5HI1A 4C7ZA 3VR9B 3TEWA 3EGRA 1BUIC 4WURA 4RF0A 4D2KA 3AE9B 2KWDA 4KX6B 3UI3A 3AE2B 1XLNA 1QOAA 1FNVA 1VRAB 1XLPA 2JZPA 3H8HA 5T8IA 1PGBA 3Q8AA 4N58A 1TS4A 3W5UB 4KGTA 3L4PA 2PVGC 3IAM1 3GS2A 3Q8EA 1QQRA 2VZKB 1C4PA 1TKYA 2K9XA 4TQ1A 2WXPA 5C2TB 4ZYSA 2Y3AA 1VZ6A 2I38A 5HG2A 4XWWA 3AE5B 2V0GA 4A90A 1F2RI 2WU2B 4A55A 1JWSD 2BYTA 3O13A 2RDHA 1L5PA 4ITKA 5EE0A 2H88B 1EU3A 3AE1B 4MT5A 3AE8B 2IJ0A 2L1AA 1CZPA 3BVZA 2ON8A 1K52A 3VRBB 4HRSA 1QOFA 4H2AA 1KLUD 3ZJVA 5EE1A 1FCLA 3U4EG 1HA5A 1NYQA 1JWAD 2K3UA 1T3QA 1DGJA 5BYSA 2SAKA 2PMVA 2TSSA 4B0EA 2DLBA 4A8XC 3CIRB 2IDYA 2JU6X 3ZYYX 4C80A 3GB1A 1UWXA 1MHXA 1YJIA 3PZ7A 1QT9A 1OFFA 1KTKA 4US9A 1DOYA 1V1OA 1YQ4B 1YNTE 1YN4A 2M56B 2WDVB 5D3IB 2BW2A 4J3OD 5BYQA 1VJKA 3AECB 2ICIA 1YN5A 2W54A 4IDIA 1IGDA 2GB1A 1RYJA 3BIID 4NAWB 4XDCA 1NYRA 4M0WA 3AE6B 1D5XC 2JYTA 3T3OA 3HVDA 1D5ZC 2KACA 2NMQA 1ZDVA 2GI9A 3KLSX 1M4VA 4RGOS 1FD6A 4NJCA 3AH7A 3TEXA 2WDRB 3B2FA 2OHFA 3HRDD 2JX5A 1J7CA 2OEDA 1FFVA 1TS2A 2QEJC 4IKGA 3OWEB 1CQVA 1L4DB 1AN8A 3AMZA 1L4ZB 2JSVX 1JRPA 2WXGA 3Q8BA 1FRRA 4KKIA 3EA6A 1N63A 1BMLC 1FNWA 2BB5A 2JWUA 4YTNB 3ZJUA 1J7AA 4GDKB 2G1EA 1SB3C 3FILA 4FXCA 4DXFA 1L6UA 1ESFA 1ZXIA 2KAJA 3MFGA 4RCOA 5G5HA 1L0VB 2AX5A 5GXGB 4LK0M 1JALA 1PGAA 1ZE3D 1FEHA 5TSSA 1TZOA 1YJJA 3IT4B 4RGNA 1B9RA 4ZOHC 3ABVB 1ZPSA 4A9AA 3VRAB 4XE0A 1A70A 4DQOC 3BVMA 3TEZA 5BMIA 1AW7A 3AEEB 2Z8LA 1MVKA 1SIJA 2IGHA 1RWSA 1FM0D 1FMAD 2WXHA 3V05A 3P4RB 1NEKB 4KGSA 1N62A 2HDEA 4USAA 3VQIA 3W9CB 2WXLA 4L2YA 2J52A 4ZRQA 4AS1A 4OZAA 2SEBD 1SE3A 1D4BA 2INPE 1SJED 4NAMA 4TSSA 2BB6A 1I4QA 1P7FA 4N59A 4OVZA 1QF6A 2DYMA 3R8BA 3SFDB 4YT0B 3AV8A 1TKGA 4ZHPA 5LNK1 3R2TA 2XN9C 3IAS1 1XEEA 2IPKD 4CQNA 1E7PB 2WDQB 4B0MA 2KMMA 2WXMA 4MM3B 4WAFA 1T6BX 3TEYA 3AE3B 4DXGA 1HQRD 1KLGD 3BVGA 1QOBA 4KKJA 1EWCA 1JMLA 1QOGA 1SF0A 4P16A 3TUOA 1UGJA 4WQMA 2W55A 1WGKA 2LHDA 2M19A 1UWMA 3URYA 2MH7A 1SSNA 3Q8CA 2NTTA 3BYTB 1XF5L 1ET9A 2WXNA 3VR8B 2EELA 3U2SC 1D6EC 4A6QA 2I2YA 4L23A 3BWUD 1TKEA 3AN1A 4ARCA 2QJLA 1SEBD 2JXTA 1PGXA 2N9LA 3ZQ4A 4HKZE 2WNMA 1WYGA 2H89B 1DOXA 2YEPF 2D5GA 5E6JA 2YEPB 4NZLB 5HFYA 5MPOA 1MHHE 3N9YC 2RPVA 4MH8A 4RH6A 1PYWD 3KWLA 2G9HD 3NS1A 1DYQA 4JWSC 1IBXA 1OQRA 1N61A 1TS3A 1FNUA 4O1NA 2Q5WD 1GAQB 1B1ZA 1HEZE 3AEAB 4US8A 2KN4A 1C79A 3LB8C 4JX1C 1ZOYB 2K22A 4P6VF 2KQ4X 2WXQA 3MJ5A 1ZXHA 4TMAB 1Y56A 2MJEA 2L83A 1TS5A 3ZGZA 5FKAC 1V8CA 1AYFA 2BT6A 1L0YB 2W82A 3BZDB 3P1MA 1PFDA 1SJHD 1I4GA 3B2GA 3I57A 1C77A 5FR3A 2JYEA 2WLBA 5D7GA 1MI0A 3KWVA 1JWBD 4ARIA 2V4IB 3W1SA 3IXSA 5AUIA 4OZCA 1FXIA 1TY2A 3WCQA 3J9CA 3E9SA 3TSSA 3LYYA 4YSXB 3ZJTA 3C8YA 3P4SB 1UNSA 3AEBB 2LGIA 3NVZA 4HKQA 1FIQA 2BBCA 1E0ZA 1L0XB 1NENB 3AE4B 1F77A 2FBWB 3NUHB 4UDUC 3NZ3A 4LLGM 5EE9A 4YWGG 5HHDG 3T3NA 1E10A 3W5VB 1V1PB 3NVWA 4WWMA 1F0ZA 1OQQA 1VLBA 4AQ7A 2WXFA 1YN3A 2FE8A 3P4PB 2DBYA 4RF1A 1C4CA 2IGGA 1V1PA 1IBXB 1UUPA 2PIAA 2WQYB 5G5GA 2Y5CA 1STEA 1E9MA 4YXDB 1BXTA 2AQ2B 2PTLA 4JE3B 2QILA 1ZDXA 5BMHA 3U52E 3BK2A 1QLBB 2CJNA 2WXJA 3Q8FA 2HTME 5BMGA 1GPXA 3AM9A 1JQ4A 3B9JA 1K50A 4C56C 3ETRA 4YTMB 3AEGB 3IT6B 4Q2JA 1N5WA 2WU5B 1D5MC 2IGDA 2PVOD 3BYYB 3DWMA 1C4AA 2N9KA 4MACA 5H8YE 3GP7A 1I7HA 3P42A 5BYRA 1FO4A 1CK1A 3SEBA 1FRDA 1RM6C 1SE4A 3LXFA 2ZW0A 1TY0A 1RFKA 2WP9B 4JWUC 2PLPA 3SFEB 2DYOA 4TQ0A 3BK1A 1WSPA 2LFIA 3HUIA 4JPSA 3KQ4A 1V97A 2AQ3B 1C9FA 1MPEA 1VZ8A 2LHEA 2RMMA 2BS3B 5JXVA 1I4RA 4RGTA 2W3RA 4RGMA 1JWUD 1KFYB 1R7SA 3EUB2 1XCQL 1QILA 2ONQA 1TJEA 3Q69A 5C3JB 2MJDA 2K5PA 2V3PA 3FC4A 2X38A 2NTSA 4L1BA 4GDLB 3FILB 5FK9C 3HVZA 4C7YA 1SBBB 3AB5A 3U7ZA 2CU3A 1I4PA 4RFBA 1KRHA 1KH0A 1YQ3B 2DWQA 2QIEB 4YSYB 1N60A 2N0SB 1Q10A 3NVVA 2BS4B 2R61A 1LO5D 1GB1A 4ZHOA 1T5XD 2LJIA 3V3XA 2LEKA 2PKOA 1C76A 1XO3A 1IGCA 1ET6A 1ROEA 1TYGB 1XXGA 4XWTA 1HXYD 2CJOA 2J42A 2M0AA 1K51A 3MHZA 4IOIE 2N7JA 4GLSC 2MJ3A 2J53A 1HZ6A 2EKIA 4HJGE 1P7EA 3R2IA 1JW9D 2FUG1 1XCTL 1N5XA 2PW9A 1ENFA 1I4XA 1PDXA 2KDMA 5AUKA 2E6XA 3CWIA 3SR6A 1WRIA 1WWTA 3AEFB 4KGRA 1ACCA 5D3DA 3AEDB 3DWGC 2LMCA 4YTPB 2MEKA 1JCKB 1E6EB 1EWYC 1PUTA 1CJEA 4WIPA 1K53A 3P63A 4XDDA 1FXAA 1L6VA 3FAHA 2V3NA 1XLQA 1QKZA 1F2RC 1IUEA 1EU4A 2L32A 2J4XA 2BS2B 3E56A 1C78A 4ZRPA 1J7BA 1JWMD 1DOIA 2JQRB 1SE2A 2LUMA 3MP9A 2K0PA 1YMHE 2WXKA 2QSDA 5EE3A 1GOZA 3RFZB 1VDVA 1ZP0B 2INNE 4WH4A 2GRIA 3NVYA 1XLOA 4OW0A 4R3DA 1NI3A 4HEA1 4HROA 1GB4A 1I4HA 1EM7A 4EE2A 5I4DA 1VZ7A 4YSZB 1VR9A 2W3SA 2B76B 1FCCC 2AQ1B 2L52A 2ACZB 3PO0A 3RPFC 2WXRA 2QMTA 2RDGA 4OHJA 1ZUD2 4N6EB 1FFUA 4REZA 3NRZA 1HZ5A 4PT5A 3W2DA 2Y5PA 3P4QB 1JROA 4RNAA 2WS3B 1KF6B 4OZBA 3MC0B 2XNAC 1AWDA 2E3TA 2WXOA 2BTEA 2WXIA 5H92C 1SXTA 2VZKD 1WXQA 3PZ8A 1NVID 3AE7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JX5 A;  1J7C A;  4C7Y A;  3AB5 A;  1FFV A;  3KWL A;  2CU3 A;  3NS1 A;  4LTU A;  4C7Z A;  4JWS C;  1OQR A;  1N61 A;  3VR9 B;  3AMZ A;  2Q5W D;  1KRH A;  1JRP A;  1GAQ B;  4US8 A;  3AEA B;  3AE9 B;  3LB8 C;  1FRR A;  1YQ3 B;  4JX1 C;  1ZOY B;  1N63 A;  2K22 A;  2DWQ A;  2QIE B;  4KX6 B;  4P6V F;  4YSY B;  4YTN B;  1N60 A;  2N0S B;  3AE2 B;  1XLN A;  1QOA A;  1XLP A;  2BS4 B;  1J7A A;  2MJE A;  3NVV A;  2L83 A;  2G1E A;  1SB3 C;  1AYF A;  1V8C A;  2BT6 A;  3P1M A;  4N58 A;  1PFD A;  4FXC A;  1L6U A;  1ZXI A;  2KAJ A;  3W5U B;  4ZHO A;  3B2G A;  5G5H A;  1L0V B;  2PVG C;  3L4P A;  2AX5 A;  5GXG B;  2LEK A;  1JAL A;  2PKO A;  2WLB A;  1XO3 A;  1JWB D;  1YJJ A;  1TKY A;  2K9X A;  1ROE A;  1B9R A;  1E10 A;  4ZOH C;  5AUI A;  1TYG B;  3ABV B;  1FXI A;  4A9A A;  3VRA B;  5C2T B;  1A70 A;  3WCQ A;  2CJO A;  4YSX B;  3AEE B;  3AE5 B;  2MJ3 A;  3P4S B;  2EKI A;  2WU2 B;  3AEB B;  1JW9 D;  1SIJ A;  1N5X A;  1RWS A;  1FIQ A;  3NVZ A;  1E0Z A;  1FM0 D;  1FMA D;  1NEN B;  3AE4 B;  1PDX A;  2FBW B;  5EE9 A;  5AUK A;  3P4R B;  1L5P A;  3SR6 A;  1NEK B;  3CWI A;  4ITK A;  3W5V B;  1N62 A;  3NVW A;  4WWM A;  4USA A;  1OQQ A;  1VLB A;  1WRI A;  2H88 B;  5EE0 A;  1WWT A;  3AE1 B;  3AEF B;  3P4P B;  3AE8 B;  3AED B;  3DWG C;  2DBY A;  4YTP B;  1E6E B;  1EWY C;  1PUT A;  1CJE A;  1CZP A;  3P63 A;  4N59 A;  2WQY B;  2PIA A;  5G5G A;  4HRS A;  1FXA A;  3VRB B;  1QOF A;  1L6V A;  2Y5C A;  3FAH A;  1QF6 A;  3SFD B;  1XLQ A;  1E9M A;  5EE1 A;  4YXD B;  4YT0 B;  3AV8 A;  1TKG A;  4ZHP A;  1IUE A;  1NYQ A;  1JWA D;  2BS2 B;  1T3Q A;  1QLB B;  1J7B A;  1DGJ A;  1DOI A;  2CJN A;  2JQR B;  1E7P B;  2HTM E;  2WDQ B;  2KMM A;  1GPX A;  3AM9 A;  3AE3 B;  1JQ4 A;  3B9J A;  3CIR B;  5EE3 A;  3ETR A;  1QOB A;  1VDV A;  3ZYY X;  1ZP0 B;  3AEG B;  1YJI A;  4C80 A;  1QOG A;  4YTM B;  1SF0 A;  1N5W A;  1OFF A;  1QT9 A;  1XLO A;  2PVO D;  2WU5 B;  3DWM A;  3NVY A;  4WQM A;  5H8Y E;  2W55 A;  1I7H A;  4US9 A;  1FO4 A;  1DOY A;  1NI3 A;  1WGK A;  1YQ4 B;  4HRO A;  2WDV B;  2M56 B;  1FRD A;  1RM6 C;  2M19 A;  3LXF A;  1UWM A;  2MH7 A;  1RFK A;  2WP9 B;  4JWU C;  3SFE B;  4YSZ B;  1VJK A;  2W3S A;  2B76 B;  3AEC B;  1F0Z A;  3HUI A;  2L52 A;  3VR8 B;  2W54 A;  2ACZ B;  4IDI A;  3PO0 A;  1V97 A;  3RPF C;  2BS3 B;  1TKE A;  1ZUD 2;  1RYJ A;  4N6E B;  3BII D;  2W3R A;  1NYR A;  1FFU A;  3AN1 A;  2QJL A;  3AE6 B;  1KFY B;  3W9C B;  3NRZ A;  1R7S A;  3EUB 2;  5C3J B;  1TJE A;  1JRO A;  3P4Q B;  2WS3 B;  1KF6 B;  2MJD A;  1WYG A;  2H89 B;  2K5P A;  1AWD A;  2E3T A;  3FC4 A;  1DOX A;  3AH7 A;  5H92 C;  2WDR B;  3B2F A;  1WXQ A;  2OHF A;  3HRD D;  5MPO A;  1NVI D;  3AE7 B;  3HVZ A; 
#chains in the Genus database with same CATH topology
 4KSL C;  2ZW1 A;  4C7Z A;  3Q3J A;  4NAW A;  4WUR A;  2KWD A;  2LI5 A;  3OAW A;  4PS3 A;  1QOA A;  2GBM A;  4N58 A;  3W5U B;  4KGT A;  1MJD A;  1F9J A;  3GS2 A;  1E8Z A;  5C2T B;  4AOF A;  1YD8 U;  4II3 B;  3CSF A;  3L17 A;  2L05 A;  4XWW A;  1UF0 A;  2YLM A;  2WU2 B;  1JWS D;  5LLI A;  4ANV A;  1E7V A;  4NJ6 A;  1L5P A;  5EE0 A;  2KX0 A;  2Z0E B;  2H88 B;  1EU3 A;  3AE1 B;  2QC8 A;  3X23 A;  3VTW A;  2IJ0 A;  2KDI A;  3NG0 A;  4PK1 A;  1LFD A;  2ON8 A;  3QHT A;  4IW0 A;  4IM3 A;  1WGY A;  1NYQ A;  1JWA D;  1L7Y A;  1T3Q A;  3CF6 E;  3PRZ A;  1DGJ A;  2L0T A;  3PS6 A;  1J19 A;  2DLB A;  4MGY E;  4ZYN A;  2JF5 A;  2JU6 X;  4C80 A;  3PZ7 A;  3UGB B;  4M8N A;  2HJ8 A;  4US9 A;  1DOY A;  2M56 B;  1WGR A;  3N32 A;  2WGS A;  4MM3 A;  4JLC A;  1K8R B;  2MBO A;  4ICV A;  2W54 A;  3APC A;  1IGD A;  2GB1 A;  3A4S C;  3H9D A;  1RYJ A;  4XDC A;  4IUM B;  1ZDV A;  2GI9 A;  2OHF A;  2XEW A;  5E6N A;  2OED A;  2G4S A;  4E74 A;  2XBB C;  3KVF B;  1CQV A;  4JGH B;  2WXG A;  2ASQ A;  3U30 A;  3EA6 A;  1LXD A;  1N63 A;  2PE9 A;  3WIM A;  2LGY A;  1J7A A;  3RI7 C;  1ZXI A;  3MFG A;  4RCO A;  1MG4 A;  5GXG B;  1JAL A;  2M17 A;  1YJ1 A;  4FUL A;  1YJJ A;  3MTN B;  3Q3N C;  5AZF A;  4K7U A;  4XC2 A;  4FN2 A;  3TBL D;  1A70 A;  3AUL A;  3U7D A;  3TEZ A;  2WHI A;  1AW7 A;  3DDC B;  2Z8L A;  1SIJ A;  4KSK C;  2BYF A;  4OVU A;  1NEK B;  4EKU A;  2J52 A;  4ZRQ A;  1UZX B;  2FNJ B;  1AAR A;  3ALB A;  2Z59 B;  4LNF A;  3JVZ X;  4OVZ A;  2BB6 A;  1P7F A;  2L8J A;  3RMK C;  3PGE A;  5G2N A;  3R2T A;  2XN9 C;  4FLH A;  1E7P B;  1VCB A;  2RSU A;  2WXM A;  1V2Y A;  1HQR D;  1KLG D;  3AU4 A;  2O2V B;  4W9J A;  2KFK B;  1WE6 A;  2ZPN A;  4LJO B;  2WX1 A;  3Q8C A;  3ZKJ C;  4XGA B;  1XF5 L;  2LVO A;  3PPA A;  1ET9 A;  4ANW A;  4HVB A;  3CMM B;  4A6Q A;  4XYC A;  5IO9 A;  1TKE A;  1L2N A;  2CS4 A;  2LGD A;  2R2Q A;  1JRU A;  2BYE A;  2WNM A;  4KV2 A;  2YEP F;  2YEP B;  2MP2 A;  5HFY A;  4MH8 A;  3KWL A;  4C4V A;  4K1R B;  1DYQ A;  1OQR A;  1TS3 A;  4RM9 A;  4O1N A;  3AI5 A;  4PS7 A;  1HEZ E;  1UBQ A;  4S17 A;  4JX1 C;  2G4D B;  2N7E A;  2MJE A;  5FKA C;  2IND C;  2IBI B;  1SJH D;  4MDK E;  5FR3 A;  1I35 A;  2KXJ A;  1MI0 A;  1N6Z A;  2KTR B;  4EEW A;  1JWB D;  2V4I B;  3RZW C;  3QA8 A;  2IY1 B;  1RAX A;  4MEM A;  1GG3 A;  2CHW A;  3TSS A;  1WI0 A;  3P4S B;  2MQJ A;  2UU7 A;  1FIQ A;  1L0X B;  5EE9 A;  3NUH B;  4TUU A;  4BAX A;  4LLG M;  1GPX A;  3NVW A;  1VLB A;  3P4P B;  1YN3 A;  1C4C A;  2IGG A;  1TIF A;  1V80 A;  4JE3 B;  2HJ1 A;  5AZH A;  2DZI A;  1QLB B;  3RD2 A;  2LZ6 A;  1UGM A;  2N4F A;  1RLF A;  5CX3 A;  4YTM B;  3K9P B;  3VDZ A;  3BYY B;  3VHT C;  1C4A A;  2N9K A;  4HDO A;  1I7H A;  1FO4 A;  1FRD A;  2ZW0 A;  2PLP A;  1V5O A;  1FXT B;  1WSP A;  2LFI A;  4LJP B;  2MRP A;  1V97 A;  4G50 A;  4BBN C;  1MPE A;  2RMM A;  3EEC A;  1KFY B;  3QAR A;  3EUB 2;  3RNA C;  3Q69 A;  2KMA A;  3IHP C;  1LM8 B;  1LGR A;  3FC4 A;  2LD9 A;  3RN9 C;  4AUQ C;  3QCA A;  4GDL B;  3FIL B;  1V5T A;  5LXI B;  1YQB A;  4GMV A;  2KJR A;  1YQ3 B;  1V49 A;  2DWQ A;  2NBV B;  1N60 A;  1P0R A;  3H7P B;  5L95 C;  2KAN A;  2W9N A;  1T5X D;  2O6V B;  2LJI A;  3V3X A;  3V61 A;  2LEK A;  2PKO A;  2O6V A;  5DCN A;  1ZKH A;  3DPD A;  2CJO A;  2J42 A;  3RT3 B;  1K51 A;  2N7J A;  4GLS C;  2NBU A;  4HJG E;  4MGZ E;  1P7E A;  1WZ0 A;  4JQW C;  1N5X A;  3A9J A;  2FAZ A;  3V6E B;  5AUK A;  4HWI B;  3KUZ A;  3SR6 A;  4MJS A;  3H1U A;  5CHF A;  1WWT A;  3AEF B;  1ACC A;  3GOE A;  3L0W B;  3KYC D;  4AP4 C;  1CJE A;  2K1F A;  2N1W A;  5HKH A;  2LWP A;  3A9J B;  1QKZ A;  5TR5 A;  1EU4 A;  2GBJ A;  3LDZ E;  4URK A;  4ZRP A;  3MP9 A;  1QZE A;  1YMH E;  3RNG C;  2CU1 A;  1XD3 B;  2V9H A;  4MGI E;  5D6J B;  2K6Q A;  1EO6 A;  1XLO A;  3NVY A;  1J8C A;  3GE3 C;  1NI3 A;  2NS5 A;  2DNF A;  1WGD A;  1VZ7 A;  4YSZ B;  2RDB C;  1VR9 A;  2EMT A;  3VH3 B;  2PPH A;  1WYW B;  2AQ1 B;  3APF A;  4W9C A;  2RDG A;  3QIJ A;  1ZUD 2;  2J7Q B;  3NRZ A;  4PT5 A;  1WXV A;  5DPR A;  4IM2 A;  4RNA A;  2WS3 B;  1KF6 B;  4OZB A;  3VTV A;  2MBE A;  2WXI A;  5H92 C;  3DVN U;  3BY4 B;  3E56 A;  4HPL B;  2D2Q A;  3I9V 1;  1GUA B;  4I6N B;  3VR9 B;  3TEW A;  2KX3 A;  1OGW A;  1BUI C;  4D2K A;  4EZL A;  3V60 A;  4KX6 B;  2G45 B;  3H8H A;  2JZP A;  3N1X C;  4EZJ A;  3KH0 A;  2PVG C;  3U8Z A;  4WJN A;  5EDS A;  3V6C B;  1TKY A;  2K9X A;  1KOT A;  2WXP A;  3JSV B;  4ICU A;  2KC1 A;  2Z0D B;  2REX A;  3HM3 A;  5GMV A;  1WJN A;  4JL9 A;  1TTN A;  5J17 A;  4A55 A;  3PT2 B;  3D32 A;  2RDH A;  4C00 A;  2ZVN A;  3L10 B;  2MX2 A;  4MT5 A;  4G11 A;  2V1Y A;  3DBR I;  3M3J A;  3PHX B;  2DZK A;  4HRS A;  2EKE C;  1KLU D;  2MHJ A;  4YL8 A;  3HK0 A;  1CMX B;  2SAK A;  1WJ4 A;  2HE7 A;  3MC8 A;  3CIR B;  2IDY A;  3ZYY X;  1UWX A;  1WY8 A;  1Q5W B;  3NHE B;  1QT9 A;  1OFF A;  2L7R A;  2DAF A;  4KDL B;  3R3M A;  2YVC A;  1YNT E;  1YN4 A;  2WDV B;  5D94 A;  2AL6 A;  3DHI C;  3WAL A;  4FJV B;  1WE7 A;  4J3O D;  3AEC B;  4E71 A;  4K7S A;  2ICI A;  4FHK A;  3NY5 A;  3X0W A;  1NYR A;  3AE6 B;  3HVD A;  4RGO S;  3KLS X;  2NMQ A;  1M4V A;  3S2A A;  3AH7 A;  3TEX A;  3B2F A;  2KK8 A;  3HRD D;  2IO2 B;  4IKG A;  2NVU I;  3OWE B;  1L4D B;  3RNC C;  4HLE A;  4ZRJ A;  1NI2 A;  3RZF A;  1BML C;  2JWU A;  4YTN B;  3ZJU A;  2I1J A;  3AU5 A;  1SB3 C;  2N9E B;  3FIL A;  2GLS A;  3VXW A;  2KAJ A;  4HJK A;  5TSS A;  3IT4 B;  4W9E A;  2ZCB A;  1B9R A;  1ZPS A;  4DQO C;  1WM3 A;  3BVM A;  2KHW B;  2CR5 A;  1GNU A;  1R4N B;  3AEE B;  1KLV A;  1UD7 A;  2IGH A;  2LGS A;  1FM0 D;  1FMA D;  3V05 A;  1OEY A;  2N9X A;  4USA A;  4OZA A;  3Q2A C;  2INP E;  4CO7 A;  1E8W A;  4NAM A;  3L08 A;  1I4Q A;  1QF6 A;  2LAS A;  3R8B A;  3SFD B;  1P9D U;  4LNI A;  4W9K A;  3IAS 1;  1XEE A;  2IPK D;  4CQN A;  4B0M A;  2KFJ A;  2VH1 A;  3BVG A;  4KKJ A;  2K8H A;  1EWC A;  1JML A;  3WAN A;  2AYO B;  3A9K B;  2D11 A;  2W55 A;  1WGK A;  2LHD A;  4WJQ A;  2M19 A;  3ZNH B;  3KUD B;  2NTT A;  2AWT A;  1TZ1 A;  2J0K A;  2EEL A;  2FCM A;  4MSM B;  2QJL A;  2JXT A;  3EHV A;  1PGX A;  5E6P A;  3ZQ4 A;  2IO1 B;  4HKZ E;  4S0R A;  1DOX A;  4NZL B;  2JVC A;  1WXA A;  2RPV A;  3GZN I;  1N61 A;  2KN4 A;  1C79 A;  1SE9 A;  1ZOY B;  2KQ4 X;  2B3A A;  1ZXH A;  4TMA B;  3WAO A;  1AYF A;  2BT6 A;  2W82 A;  4FBJ B;  1PFD A;  3B2G A;  3I57 A;  2JYE A;  1IPG A;  1M94 A;  3KWV A;  3OG5 A;  2JPH A;  4ARI A;  3IXS A;  4OZC A;  1P3Q U;  3H6N A;  4P7I A;  3J9C A;  3E9S A;  4GN1 A;  4YSX B;  3ZJT A;  3C8Y A;  2LGI A;  3NVZ A;  1NEN B;  4J6I A;  4YWG G;  5HHD G;  1E10 A;  4ZRI A;  3W5V B;  1F0Z A;  1OQQ A;  2FE8 A;  4RF1 A;  3N30 A;  4EZK A;  2MW5 A;  1UUP A;  2KTR A;  2Y5C A;  1IP9 A;  2AQ2 B;  4MEL A;  3BK2 A;  2KDE B;  3KW5 B;  3NJT A;  3Q8F A;  5BMG A;  3VH4 B;  3AM9 A;  4EOY A;  3ZNZ B;  3B9J A;  3R66 C;  4C56 C;  3VAW A;  3ETR A;  3AEG B;  4A20 A;  3VVW B;  1D5M C;  2PVO D;  3DWM A;  1YX6 B;  4MAC A;  3P42 A;  4GOC A;  1SE4 A;  3ZUN A;  1OEY J;  3HUI A;  1C9F A;  5DPT A;  1I4R A;  4RGT A;  4RGM A;  1GJZ A;  1GC7 A;  1G6J A;  4W9H A;  1R7S A;  1XCQ L;  1QIL A;  2GBN A;  4GGQ A;  1TBE A;  5FK9 C;  3HVZ A;  4MGK E;  3M95 A;  1SBB B;  3WA0 A;  2CU3 A;  1YX5 B;  2KFK A;  4RFB A;  1KRH A;  3H7S A;  1D3Z A;  1EUV B;  4GSW A;  3I3T B;  2N0S B;  1Q10 A;  1WRD B;  2BS4 B;  4BZA A;  3WAP A;  2LJ5 A;  1OTR B;  1R4M I;  2CKH B;  3IFW B;  3NZU A;  1C76 A;  1IGC A;  3JYU A;  1ET6 A;  3DCG A;  3SD5 A;  2MLB A;  3ZRF A;  4IWO A;  3MHZ A;  2AEH A;  1HZ6 A;  2EKI A;  1P98 A;  3R2I A;  2NCN A;  3TCA A;  1XCT L;  4KZC A;  1PDX A;  5FR6 A;  3DWG C;  2LMC A;  3ZRC A;  4F7Z A;  1MG8 A;  3R7Q A;  1JCK B;  2O2V A;  1WJU A;  3NZS A;  1FXA A;  1F2R C;  1IUE A;  4P1C C;  4M8M A;  3UIN B;  1JWM D;  2QCZ A;  3O65 B;  5J2R A;  2K0P A;  4HPM B;  1GOZ A;  1ZP0 B;  1ZW7 A;  4DDI D;  4OW0 A;  4R3D A;  4F1S A;  4HRO A;  1C1Y B;  1I4H A;  4LNO A;  5I4D A;  3H7P A;  4PYU A;  1Z2M A;  1WH3 A;  4FJZ A;  2L52 A;  3ZTC A;  3ZLZ A;  4OHJ A;  1UH6 A;  3FKY A;  1FFU A;  1V86 A;  4K3B A;  3PRP B;  4IM0 A;  1HZ5 A;  2Y5P A;  1JRO A;  4GDL A;  2E3T A;  2N9P C;  2RD0 A;  3KYD D;  1WXQ A;  3IG3 A;  2D07 B;  1NVI D;  1HE8 A;  3GP7 A;  2KN5 A;  4DWF A;  5HI1 A;  3ML9 A;  3DBH B;  4ACF A;  4FHJ A;  1WGH A;  2K25 A;  3CST A;  1T0Q C;  3EGR A;  3HM6 X;  4KIK A;  4DHZ E;  4LCD E;  2JRH A;  3AE2 B;  1XLN A;  1XLP A;  2BWF A;  2IO3 B;  2K8C A;  3Q8A A;  2ZPY A;  2DHZ A;  3Q8E A;  2D3A A;  1QQR A;  3N20 C;  3TJP A;  1C4P A;  1C3T A;  1UEL A;  1NDD A;  2Y3A A;  1BT0 A;  1VZ6 A;  2DEN B;  4NQL B;  5HG2 A;  4A90 A;  2KWC A;  2BYT A;  1IYF A;  1RRB A;  2M0X A;  4WWP A;  4FA6 A;  3AE8 B;  4ANX A;  1WX7 A;  2L1A A;  3T8M A;  2GBR A;  3VRB B;  4CYE A;  4H2A A;  3ZJV A;  2MCN B;  5EE1 A;  3ECI A;  1FCL A;  2MWS B;  4LNN A;  3U4E G;  5C23 A;  4GIV A;  2K3U A;  1WF9 A;  2PMV A;  2TSS A;  4B0E A;  4BKT A;  1WFY A;  1WGG A;  3ZNG C;  1WXM A;  1KTK A;  2INC C;  2LGX A;  2JT4 B;  3EC8 A;  1V1O A;  5D3I B;  2K8B A;  2MP2 B;  3DHH C;  2R2O A;  4PS8 A;  5BYQ A;  1ISN A;  3HHM A;  5JHA A;  1YN5 A;  4IDI A;  1UBI A;  1OQY A;  3I63 C;  3BII D;  2LVP A;  4M0W A;  1SGH A;  1VD2 A;  2JYT A;  4B95 A;  5JZE B;  2CHZ A;  3JSV A;  2KAC A;  3JW0 X;  2WDR B;  4II2 B;  1H8C A;  1J7C A;  2GOW A;  2QEJ C;  3DOW A;  1AN8 A;  2KDB A;  1L4Z B;  2ZJD A;  3DHG C;  1FNW A;  2BB5 A;  2ZZP B;  2BYV E;  2ZVO A;  1GC6 A;  5JHB A;  4FXC A;  1L6U A;  1ESF A;  4I6L B;  4DHZ B;  2L76 A;  4AJY B;  5G5H A;  1L0V B;  3ZDT A;  1PGA A;  2JWZ A;  3ENE A;  1U4A A;  1WR1 A;  4ZOH C;  3Q6B A;  4BKG A;  4A9A A;  5BMI A;  2C7N B;  2PE6 B;  4WAA A;  2FCN A;  5C1Z A;  2OOB B;  2WXH A;  4KGS A;  1N62 A;  3W9C B;  3VQI A;  2WXL A;  2VH2 A;  4L2Y A;  1V6E A;  2SEB D;  1D4B A;  1SJE D;  3ZNI D;  4TSS A;  3OJ4 B;  4HXD A;  4W9G A;  3AV8 A;  1TKG A;  2KT7 A;  4ZHP A;  5LNK 1;  4ASW C;  1YIW A;  2IO0 B;  4N9F 4;  2WDQ B;  3TEY A;  3AE3 B;  3ZO5 B;  4DXG A;  1F52 A;  1QOB A;  1SF0 A;  3TUO A;  1UGJ A;  2PJH A;  4WQM A;  1S3S G;  1WMH B;  4QAY A;  1UWM A;  3BYT B;  1MFW A;  3KUC B;  3U2S C;  1D6E C;  3BWU D;  2ZNV C;  2V4L A;  3AN1 A;  4ARC A;  1SEB D;  2IYD B;  3L16 A;  2BKF A;  4BBN F;  2N9L A;  2KO3 A;  1WYG A;  2JY6 A;  2H89 B;  5DPS A;  5E6J A;  2RR9 A;  1WM2 A;  5MPO A;  1MHH E;  4E3C A;  1PYW D;  2G9H D;  4JWS C;  4NNJ B;  1E90 A;  1T0S C;  1FNU A;  2Q5W D;  1GAQ B;  4US8 A;  2VRR B;  3AEA B;  3PLU A;  3LB8 C;  4BFR A;  2KLC A;  2LRU A;  1LQB A;  3ZGZ A;  1TS5 A;  3VUW A;  4BKS D;  3BZD B;  4M02 A;  3RUI B;  1I4G A;  1C77 A;  2WLB A;  5D7G A;  3LJ3 A;  2RGF A;  5AUI A;  1TY2 A;  3APD A;  3WCQ A;  4IG7 B;  3LYY A;  3Q3F A;  3AEB B;  3TL5 A;  1KM7 A;  3MHS D;  4HKQ A;  2BBC A;  2BGF A;  3AE4 B;  2FBW B;  4UDU C;  1I42 A;  1V1P B;  4WWM A;  3RUL A;  2WXF A;  3QAQ A;  2DBY A;  2LXA A;  1STE A;  4YXD B;  1BXT A;  3Q3O C;  2PTL A;  2QIL A;  1ZDX A;  3U52 E;  4C4V B;  2CJN A;  2WX0 A;  2C7M B;  1HTO A;  4A3P A;  1K50 A;  3GZN B;  3IT6 B;  4Q2J A;  2M1M A;  2IGD A;  4BKS A;  2JRI B;  5H8Y E;  4AQ7 A;  2KYW A;  3DVG X;  3DVN V;  3SEB A;  2GMI C;  3A4R A;  1RM6 C;  3LXF A;  5JH5 C;  2MBQ A;  1RFK A;  2WP9 B;  3SFE B;  4M00 A;  4X57 B;  4TKN A;  4JPS A;  2QDF A;  2AQ3 B;  1VZ8 A;  5JXV A;  2O6V D;  2JUO A;  4HK2 A;  4RM8 A;  2ONQ A;  1TJE A;  2FID A;  2MJD A;  2V3P A;  2D3G A;  2X38 A;  2XK5 B;  4L1B A;  4FAD A;  2KQ7 A;  4JIO U;  3V62 A;  4C7Y A;  3U7Z A;  2ZCC A;  4DDG D;  2OJR A;  1KH0 A;  3MC9 A;  4RMA A;  1T0Y A;  2LUE A;  5LXH A;  3NVV A;  2MBH A;  3UQA A;  3L13 A;  3B1L X;  4PYZ A;  1WMH A;  4AWJ A;  1XT9 B;  4CHK A;  4P1B C;  1TYG B;  3MJW A;  4XWT A;  2D10 A;  2IZV B;  2M0A A;  1P1A A;  3UQB A;  4IOI E;  3M63 B;  1JW9 D;  4WJP A;  1ENF A;  3AXC A;  2BKR B;  1R4N I;  2KDM A;  2NPT A;  3CWI A;  1WRI A;  5D3D A;  4KGR A;  3AED B;  4GDK A;  1E6E B;  2M8S A;  1PUT A;  1Q0W B;  4DK5 A;  4WIP A;  3ML8 A;  3P63 A;  4XDD A;  2KC2 A;  3FAH A;  1XLQ A;  3P2B A;  2L32 A;  2J4X A;  2BS2 B;  1J7B A;  1DOI A;  2LUM A;  2XK5 A;  1VDV A;  4W9F A;  2INN E;  3GE8 C;  2L3Z A;  4I6P A;  4G3X B;  2DZM A;  1WZ3 A;  1EM7 A;  3ZW3 A;  1FCC C;  2FIF A;  2ACZ B;  3PO0 A;  3RPF C;  2KLG A;  2QMT A;  3BIN A;  4KZ0 A;  2C60 A;  3W2D A;  2PEA A;  3MC0 B;  4DXA B;  5IP4 D;  4LTU A;  4LNK A;  3PVL A;  2BF8 B;  1X1M A;  4RF0 A;  3AE9 B;  1SIF A;  2EMS A;  2IY0 B;  3UI3 A;  2K6D B;  2KNB A;  1FNV A;  1VRA B;  5T8I A;  1PGB A;  1TS4 A;  3L4P A;  4K7W A;  3IAM 1;  2VZK B;  3DBR B;  2KDF B;  4TQ1 A;  1KJT A;  2RPQ A;  4ZYS A;  2HTH A;  1WJ6 A;  2I38 A;  3AE5 B;  2V0G A;  2V3S A;  1F2R I;  2I1K A;  3IVF A;  2FCS A;  3IBE A;  3N3K B;  3O13 A;  3A33 B;  1FPY A;  4ITK A;  1J0G A;  4HPP A;  4ZRK A;  4NQK E;  1CZP A;  3BVZ A;  2K39 A;  1K52 A;  4ZDV A;  1QOF A;  4EFO A;  1HA5 A;  1WX8 A;  3RNB C;  3RYT A;  5BYS A;  2HD5 B;  4A8X C;  5IOI A;  2LVQ A;  3GB1 A;  1MHX A;  1YJI A;  2A5U A;  3UF8 A;  4KDI C;  4NY0 A;  1YQ4 B;  2L00 B;  1WR6 E;  2BW2 A;  5D2M B;  2JZ3 B;  1VJK A;  1WXS A;  3PRE A;  4OVV A;  3L54 A;  3UIO B;  4BOZ B;  4NAW B;  3A1Q A;  1HTQ A;  1D5X C;  3T3O A;  4IC7 B;  4IWQ A;  1D5Z C;  1FD6 A;  2KVR A;  3SDL C;  2CHX A;  3NS8 A;  4NJC A;  3B08 A;  1S1Q B;  3B0A A;  3RNF C;  2C9W B;  4MJS B;  2JX5 A;  1FFV A;  1TS2 A;  1ZGU B;  3AMZ A;  2JSV X;  1JRP A;  4FJY A;  3Q8B A;  3ZDM C;  1FRR A;  4KKI A;  4DBG A;  4NPN A;  4GDK B;  2G1E A;  2WDT B;  2KOX A;  4DXF A;  2KVZ A;  2OJW A;  2AX5 A;  3DBS A;  3PLV A;  4LK0 M;  1ZE3 D;  1FEH A;  1TZO A;  1RFA A;  4RGN A;  3PRM B;  3ABV B;  2DX5 B;  5E6O A;  3VRA B;  4XE0 A;  1WIA A;  3PV1 A;  5CHW A;  1MVK A;  1RWS A;  4GB9 A;  2Y5B B;  4LDT D;  2FCQ A;  3P4R B;  4BVU C;  2HDE A;  3SHQ A;  4K81 A;  4WWO A;  4AS1 A;  3EFU A;  3I5J C;  1R4M B;  1SE3 A;  2BWE S;  2UYZ B;  2N1V A;  4N59 A;  1TT5 B;  2DYM A;  2DYB A;  1WX9 A;  3M62 B;  4A3O A;  4YT0 B;  4KVG B;  2WWZ A;  2LRW A;  3DBL B;  2D3C A;  2KMM A;  4MM3 B;  4WAF A;  1T6B X;  2UWQ A;  2BQQ A;  1YOV B;  4WWN A;  4HCP B;  1QOG A;  4P16 A;  3N1Z C;  2KD0 A;  3URY A;  2MH7 A;  1SSN A;  2N7D A;  2WXN A;  2WYQ A;  3VR8 B;  4M0W B;  2I2Y A;  4L23 A;  4LDT B;  5AEK B;  2D5G A;  3Q14 C;  3VTU A;  3N1Y C;  3N9Y C;  4RH6 A;  2D3B A;  3NS1 A;  1IBX A;  2C5L C;  2BPS A;  3QQ8 B;  1B1Z A;  2KTF A;  2K22 A;  4P6V F;  2WXQ A;  3MJ5 A;  1Y56 A;  2MA9 B;  3ZXV A;  3T9L A;  2L83 A;  1V8C A;  1L0Y B;  5AZG A;  5J18 A;  3P1M A;  5G55 A;  3DBL I;  3ZXR A;  3ZTD A;  2DAJ A;  1Z5S B;  3W1S A;  2A4Z A;  1FXI A;  4NJ7 A;  1NBF C;  4M01 A;  3ZIM A;  2KWV B;  1UNS A;  1E0Z A;  3PTF C;  1F77 A;  3T3N A;  3NZ3 A;  3A9K A;  4W9I A;  5IAA C;  4K3C A;  4MH0 E;  2ZEQ A;  5IKC M;  5IN7 A;  1V1P A;  4KIK B;  2WQY B;  2PIA A;  4WJO A;  3OLM D;  1E7U A;  5G5G A;  3QX1 A;  1E9M A;  4IWP A;  5L83 A;  1Y8R C;  5BMH A;  2KJ6 A;  2WXJ A;  2HTM E;  3VUY A;  1JQ4 A;  4G0N B;  3W1S C;  1N5W A;  2WU5 B;  1IBX B;  5BYR A;  2C7H A;  4WQO B;  1CK1 A;  1XQQ A;  3NOB A;  2GBK A;  2MSE D;  3DBH I;  1TY0 A;  2KMC A;  2KWU B;  3PHW B;  4JWU C;  2DYO A;  4TQ0 A;  5CTR C;  3BK1 A;  3KQ4 A;  4B6W A;  3QJZ A;  2LHE A;  2BS3 B;  3QC8 B;  3RCZ A;  4B9K A;  2W3R A;  1JWU D;  3VUX A;  4BOS C;  2JXX A;  5CHV C;  2BVC A;  3TIX A;  3TMP B;  5C3J B;  1V81 A;  4GU2 A;  5DPW A;  2FUH B;  2K5P A;  3R7R A;  2NTS A;  2NBW B;  3C0R B;  3W1Y A;  2M4N A;  3AB5 A;  4ANU A;  4EUT A;  1I4P A;  3EFC A;  3VFK A;  3HIZ A;  4GXB A;  2NR2 A;  3A1Q B;  2QIE B;  3ONS A;  4YSY B;  3WAM A;  2R61 A;  1V9J A;  1LO5 D;  3SU8 X;  4W9D A;  1GB1 A;  3OJ3 A;  4TV3 A;  4ZHO A;  1PQS A;  2KZR A;  2NPT B;  4HDQ A;  1XO3 A;  2LXC A;  2X8X X;  2KQS A;  1ROE A;  1XXG A;  2QHO A;  1HXY D;  5KHO A;  3C19 A;  2MJ3 A;  2J53 A;  2KJH B;  1E5W A;  1TGZ B;  2FUG 1;  5KHQ A;  2PW9 A;  1I4X A;  3RNE C;  2E6X A;  3K9O B;  4W9L A;  4MSQ B;  4YTP B;  2MEK A;  1H4R A;  1EWY C;  1EF1 A;  5IA7 A;  1K53 A;  3PSE B;  1L6V A;  2V3N A;  1C78 A;  3QK0 A;  2JQR B;  1SE2 A;  4HCN B;  3Q3M C;  2WXK A;  2QSD A;  1F1H A;  5EE3 A;  3RFZ B;  2L0F A;  4WH4 A;  2GRI A;  3DVG Y;  1E8X A;  4HEA 1;  3DQV A;  2G3Q B;  1GB4 A;  1Q1O A;  4EE2 A;  2DZJ A;  4F8C B;  1E8Y A;  2W3S A;  2B76 B;  3PZD A;  3ZVV A;  2AL3 A;  2WXR A;  3QWZ B;  2KKC A;  2MBB B;  4N6E B;  3UIP B;  1EF5 A;  4REZ A;  2JZZ A;  2ZNV B;  1T0R C;  4XX5 A;  1A5R A;  2J0M A;  3P4Q B;  4AJW A;  2J0J A;  2XNA C;  1AWD A;  2WXO A;  5BO4 B;  4DHJ B;  4DHJ D;  2BTE A;  1SXT A;  4XZ4 A;  2VZK D;  3PZ8 A;  3AE7 B; 
#chains in the Genus database with same CATH homology
 2ZW1 A;  3I9V 1;  4LTU A;  5HI1 A;  4C7Z A;  3VR9 B;  3TEW A;  3EGR A;  1BUI C;  4WUR A;  4RF0 A;  4D2K A;  3AE9 B;  2KWD A;  4KX6 B;  3UI3 A;  3AE2 B;  1XLN A;  1QOA A;  1FNV A;  1VRA B;  1XLP A;  2JZP A;  3H8H A;  5T8I A;  1PGB A;  3Q8A A;  4N58 A;  1TS4 A;  3W5U B;  4KGT A;  3L4P A;  2PVG C;  3IAM 1;  3GS2 A;  3Q8E A;  1QQR A;  2VZK B;  1C4P A;  1TKY A;  2K9X A;  4TQ1 A;  2WXP A;  5C2T B;  4ZYS A;  2Y3A A;  1VZ6 A;  2I38 A;  5HG2 A;  4XWW A;  3AE5 B;  2V0G A;  4A90 A;  1F2R I;  2WU2 B;  4A55 A;  1JWS D;  2BYT A;  3O13 A;  2RDH A;  1L5P A;  4ITK A;  5EE0 A;  2H88 B;  1EU3 A;  3AE1 B;  4MT5 A;  3AE8 B;  2IJ0 A;  2L1A A;  1CZP A;  3BVZ A;  2ON8 A;  1K52 A;  3VRB B;  4HRS A;  1QOF A;  4H2A A;  1KLU D;  3ZJV A;  5EE1 A;  1FCL A;  3U4E G;  1HA5 A;  1NYQ A;  1JWA D;  2K3U A;  1T3Q A;  1DGJ A;  5BYS A;  2SAK A;  2PMV A;  2TSS A;  4B0E A;  2DLB A;  4A8X C;  3CIR B;  2IDY A;  2JU6 X;  3ZYY X;  4C80 A;  3GB1 A;  1UWX A;  1MHX A;  1YJI A;  3PZ7 A;  1QT9 A;  1OFF A;  1KTK A;  4US9 A;  1DOY A;  1V1O A;  1YQ4 B;  1YNT E;  1YN4 A;  2M56 B;  2WDV B;  5D3I B;  2BW2 A;  4J3O D;  5BYQ A;  1VJK A;  3AEC B;  2ICI A;  1YN5 A;  2W54 A;  4IDI A;  1IGD A;  2GB1 A;  1RYJ A;  3BII D;  4NAW B;  4XDC A;  1NYR A;  4M0W A;  3AE6 B;  1D5X C;  2JYT A;  3T3O A;  3HVD A;  1D5Z C;  2KAC A;  2NMQ A;  1ZDV A;  2GI9 A;  3KLS X;  1M4V A;  4RGO S;  1FD6 A;  4NJC A;  3AH7 A;  3TEX A;  2WDR B;  3B2F A;  2OHF A;  3HRD D;  2JX5 A;  1J7C A;  2OED A;  1FFV A;  1TS2 A;  2QEJ C;  4IKG A;  3OWE B;  1CQV A;  1L4D B;  1AN8 A;  3AMZ A;  1L4Z B;  2JSV X;  1JRP A;  2WXG A;  3Q8B A;  1FRR A;  4KKI A;  3EA6 A;  1N63 A;  1BML C;  1FNW A;  2BB5 A;  2JWU A;  4YTN B;  3ZJU A;  1J7A A;  4GDK B;  2G1E A;  1SB3 C;  3FIL A;  4FXC A;  4DXF A;  1L6U A;  1ESF A;  1ZXI A;  2KAJ A;  3MFG A;  4RCO A;  5G5H A;  1L0V B;  2AX5 A;  5GXG B;  4LK0 M;  1JAL A;  1PGA A;  1ZE3 D;  1FEH A;  5TSS A;  1TZO A;  1YJJ A;  3IT4 B;  4RGN A;  1B9R A;  4ZOH C;  3ABV B;  1ZPS A;  4A9A A;  3VRA B;  4XE0 A;  1A70 A;  4DQO C;  3BVM A;  3TEZ A;  5BMI A;  1AW7 A;  3AEE B;  2Z8L A;  1MVK A;  1SIJ A;  2IGH A;  1RWS A;  1FM0 D;  1FMA D;  2WXH A;  3V05 A;  3P4R B;  1NEK B;  4KGS A;  1N62 A;  2HDE A;  4USA A;  3VQI A;  3W9C B;  2WXL A;  4L2Y A;  2J52 A;  4ZRQ A;  4AS1 A;  4OZA A;  2SEB D;  1SE3 A;  1D4B A;  2INP E;  1SJE D;  4NAM A;  4TSS A;  2BB6 A;  1I4Q A;  1P7F A;  4N59 A;  4OVZ A;  1QF6 A;  2DYM A;  3R8B A;  3SFD B;  4YT0 B;  3AV8 A;  1TKG A;  4ZHP A;  5LNK 1;  3R2T A;  2XN9 C;  3IAS 1;  1XEE A;  2IPK D;  4CQN A;  1E7P B;  2WDQ B;  4B0M A;  2KMM A;  2WXM A;  4MM3 B;  4WAF A;  1T6B X;  3TEY A;  3AE3 B;  4DXG A;  1HQR D;  1KLG D;  3BVG A;  1QOB A;  4KKJ A;  1EWC A;  1JML A;  1QOG A;  1SF0 A;  4P16 A;  3TUO A;  1UGJ A;  4WQM A;  2W55 A;  1WGK A;  2LHD A;  2M19 A;  1UWM A;  3URY A;  2MH7 A;  1SSN A;  3Q8C A;  2NTT A;  3BYT B;  1XF5 L;  1ET9 A;  2WXN A;  3VR8 B;  2EEL A;  3U2S C;  1D6E C;  4A6Q A;  2I2Y A;  4L23 A;  3BWU D;  1TKE A;  3AN1 A;  4ARC A;  2QJL A;  1SEB D;  2JXT A;  1PGX A;  2N9L A;  3ZQ4 A;  4HKZ E;  2WNM A;  1WYG A;  2H89 B;  1DOX A;  2YEP F;  2D5G A;  5E6J A;  2YEP B;  4NZL B;  5HFY A;  5MPO A;  1MHH E;  3N9Y C;  2RPV A;  4MH8 A;  4RH6 A;  1PYW D;  3KWL A;  2G9H D;  3NS1 A;  1DYQ A;  4JWS C;  1IBX A;  1OQR A;  1N61 A;  1TS3 A;  1FNU A;  4O1N A;  2Q5W D;  1GAQ B;  1B1Z A;  1HEZ E;  3AEA B;  4US8 A;  2KN4 A;  1C79 A;  3LB8 C;  4JX1 C;  1ZOY B;  2K22 A;  4P6V F;  2KQ4 X;  2WXQ A;  3MJ5 A;  1ZXH A;  4TMA B;  1Y56 A;  2MJE A;  2L83 A;  1TS5 A;  3ZGZ A;  5FKA C;  1V8C A;  1AYF A;  2BT6 A;  1L0Y B;  2W82 A;  3BZD B;  3P1M A;  1PFD A;  1SJH D;  1I4G A;  3B2G A;  3I57 A;  1C77 A;  5FR3 A;  2JYE A;  2WLB A;  5D7G A;  1MI0 A;  3KWV A;  1JWB D;  4ARI A;  2V4I B;  3W1S A;  3IXS A;  5AUI A;  4OZC A;  1FXI A;  1TY2 A;  3WCQ A;  3J9C A;  3E9S A;  3TSS A;  3LYY A;  4YSX B;  3ZJT A;  3C8Y A;  3P4S B;  1UNS A;  3AEB B;  2LGI A;  3NVZ A;  4HKQ A;  1FIQ A;  2BBC A;  1E0Z A;  1L0X B;  1NEN B;  3AE4 B;  1F77 A;  2FBW B;  3NUH B;  4UDU C;  3NZ3 A;  4LLG M;  5EE9 A;  4YWG G;  5HHD G;  3T3N A;  1E10 A;  3W5V B;  1V1P B;  3NVW A;  4WWM A;  1F0Z A;  1OQQ A;  1VLB A;  4AQ7 A;  2WXF A;  1YN3 A;  2FE8 A;  3P4P B;  2DBY A;  4RF1 A;  1C4C A;  2IGG A;  1V1P A;  1IBX B;  1UUP A;  2PIA A;  2WQY B;  5G5G A;  2Y5C A;  1STE A;  1E9M A;  4YXD B;  1BXT A;  2AQ2 B;  2PTL A;  4JE3 B;  2QIL A;  1ZDX A;  5BMH A;  3U52 E;  3BK2 A;  1QLB B;  2CJN A;  2WXJ A;  3Q8F A;  2HTM E;  5BMG A;  1GPX A;  3AM9 A;  1JQ4 A;  3B9J A;  1K50 A;  4C56 C;  3ETR A;  4YTM B;  3AEG B;  3IT6 B;  4Q2J A;  1N5W A;  2WU5 B;  1D5M C;  2IGD A;  2PVO D;  3BYY B;  3DWM A;  1C4A A;  2N9K A;  4MAC A;  5H8Y E;  3GP7 A;  1I7H A;  3P42 A;  5BYR A;  1FO4 A;  1CK1 A;  3SEB A;  1FRD A;  1RM6 C;  1SE4 A;  3LXF A;  2ZW0 A;  1TY0 A;  1RFK A;  2WP9 B;  4JWU C;  2PLP A;  3SFE B;  2DYO A;  4TQ0 A;  3BK1 A;  1WSP A;  2LFI A;  3HUI A;  4JPS A;  3KQ4 A;  1V97 A;  2AQ3 B;  1C9F A;  1MPE A;  1VZ8 A;  2LHE A;  2RMM A;  2BS3 B;  5JXV A;  1I4R A;  4RGT A;  2W3R A;  4RGM A;  1JWU D;  1KFY B;  1R7S A;  3EUB 2;  1XCQ L;  1QIL A;  2ONQ A;  1TJE A;  3Q69 A;  5C3J B;  2MJD A;  2K5P A;  2V3P A;  3FC4 A;  2X38 A;  2NTS A;  4L1B A;  4GDL B;  3FIL B;  5FK9 C;  3HVZ A;  4C7Y A;  1SBB B;  3AB5 A;  3U7Z A;  2CU3 A;  1I4P A;  4RFB A;  1KRH A;  1KH0 A;  1YQ3 B;  2DWQ A;  2QIE B;  4YSY B;  1N60 A;  2N0S B;  1Q10 A;  3NVV A;  2BS4 B;  2R61 A;  1LO5 D;  1GB1 A;  4ZHO A;  1T5X D;  2LJI A;  3V3X A;  2LEK A;  2PKO A;  1C76 A;  1XO3 A;  1IGC A;  1ET6 A;  1ROE A;  1TYG B;  1XXG A;  4XWT A;  1HXY D;  2CJO A;  2J42 A;  2M0A A;  1K51 A;  3MHZ A;  4IOI E;  2N7J A;  4GLS C;  2MJ3 A;  2J53 A;  1HZ6 A;  2EKI A;  4HJG E;  1P7E A;  3R2I A;  1JW9 D;  2FUG 1;  1XCT L;  1N5X A;  2PW9 A;  1ENF A;  1I4X A;  1PDX A;  2KDM A;  5AUK A;  2E6X A;  3CWI A;  3SR6 A;  1WRI A;  1WWT A;  3AEF B;  4KGR A;  1ACC A;  5D3D A;  3AED B;  3DWG C;  2LMC A;  4YTP B;  2MEK A;  1JCK B;  1E6E B;  1EWY C;  1PUT A;  1CJE A;  4WIP A;  1K53 A;  3P63 A;  4XDD A;  1FXA A;  1L6V A;  3FAH A;  2V3N A;  1XLQ A;  1QKZ A;  1F2R C;  1IUE A;  1EU4 A;  2L32 A;  2J4X A;  2BS2 B;  3E56 A;  1C78 A;  4ZRP A;  1J7B A;  1JWM D;  1DOI A;  2JQR B;  1SE2 A;  2LUM A;  3MP9 A;  2K0P A;  1YMH E;  2WXK A;  2QSD A;  5EE3 A;  1GOZ A;  3RFZ B;  1VDV A;  1ZP0 B;  2INN E;  4WH4 A;  2GRI A;  3NVY A;  1XLO A;  4OW0 A;  4R3D A;  1NI3 A;  4HEA 1;  4HRO A;  1GB4 A;  1I4H A;  1EM7 A;  4EE2 A;  5I4D A;  1VZ7 A;  4YSZ B;  1VR9 A;  2W3S A;  2B76 B;  1FCC C;  2AQ1 B;  2L52 A;  2ACZ B;  3PO0 A;  3RPF C;  2WXR A;  2QMT A;  2RDG A;  4OHJ A;  1ZUD 2;  4N6E B;  1FFU A;  4REZ A;  3NRZ A;  1HZ5 A;  4PT5 A;  3W2D A;  2Y5P A;  3P4Q B;  1JRO A;  4RNA A;  2WS3 B;  1KF6 B;  4OZB A;  3MC0 B;  2XNA C;  1AWD A;  2E3T A;  2WXO A;  2BTE A;  2WXI A;  5H92 C;  1SXT A;  2VZK D;  1WXQ A;  3PZ8 A;  1NVI D;  3AE7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...