1VJKA

Putative molybdopterin converting factor, subunit 1 from pyrococcus furiosus, pfu-562899-001
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
87
structure length
87
Chain Sequence
SVKVKVKYFARFRQLAGVDEEEIELPEGARVRDLIEEIKKRHEKFKEEVFGEGYDEDADVNIAVNGRYVSWDEELKDGDVVGVFPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Putative molybdopterin converting factor, subunit 1 from Pyrococcus furiosus, Pfu-562899-001 '
rcsb
source organism Pyrococcus furiosus
molecule tags Structural genomics, unknown function
molecule keywords molybdopterin converting factor, subunit 1
total genus 25
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2004-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1vjkA00
1FXIA 2CU3A 3AB5A 5G5HA 2CJNA 3P4PB 3NRZA 5G5GA 3SFDB 4US8A 1WYGA 2QIEB 1PUTA 3AE9B 2W3RA 3AH7A 1JWBD 1TKGA 2CJOA 2WDQB 3B2FA 3HUIA 4N6EB 3KWLA 3AE5B 1FFUA 2PKOA 1T3QA 1SIJA 1PDXA 1V97A 3EUB2 5H8YE 3AE6B 2LEKA 1N61A 2N0SB 2W3SA 2MJ3A 1I7HA 1E7PB 1OFFA 1RFKA 3ETRA 4HRSA 1CJEA 3ZYYX 3W5UB 3AE8B 3AECB 1TYGB 2PVOD 2WP9B 1SB3C 2H88B 2MJDA 4JX1C 4US9A 2L83A 1YJJA 2W54A 1OQQA 1NYQA 2E3TA 1E0ZA 1ZOYB 2OHFA 1FIQA 1NI3A 3AE3B 3RPFC 1ZUD2 4LTUA 1A70A 1XLNA 1OQRA 2K22A 5EE9A 1WGKA 2BT6A 1KF6B 3FAHA 1RM6C 1YQ3B 1QOGA 1N5XA 4WQMA 4C80A 1L0VB 4C7YA 2WLBA 1QOBA 1QT9A 2Q5WD 3P1MA 3VR9B 1IUEA 1VLBA 2K5PA 4YTPB 1CZPA 1NYRA 2KMMA 4HROA 1JALA 1FRDA 4N58A 1PFDA 2DBYA 4ZHOA 1FFVA 3AM9A 3AN1A 1FRRA 5C3JB 3AV8A 1J7BA 1FO4A 1EWYC 4KX6B 2JX5A 3VRAB 1FM0D 4YTNB 3HRDD 1QOAA 3P4SB 1NVID 3P63A 1JWAD 1F0ZA 1TKEA 1FMAD 2WU5B 1KRHA 3P4RB 1AYFA 2FBWB 1RYJA 4WWMA 3FC4A 3L4PA 3W5VB 2PIAA 2WU2B 2WDVB 1VJKA 5EE0A 1YJIA 3VRBB 4USAA 4ITKA 1AWDA 1V8CA 4JWSC 3B9JA 1ZP0B 1GAQB 2MH7A 2JQRB 1QLBB 2L52A 4ZHPA 2ACZB 2WQYB 1DGJA 2WS3B 2QJLA 3HVZA 1R7SA 5GXGB 3AEGB 1WXQA 4YXDB 1E9MA 3B2GA 5EE1A 1L6VA 2BS2B 2Y5CA 1DOIA 1L5PA 5H92C 1GPXA 3NVZA 2EKIA 1QOFA 2B76B 1KFYB 1XLQA 3LXFA 4YT0B 3NVWA 2M56B 1SF0A 3SFEB 4YTMB 5AUKA 4N59A 4YSXB 1JQ4A 2M19A 4JWUC 1B9RA 1N62A 1E10A 1ROEA 1J7AA 1TJEA 2K9XA 2H89B 1WRIA 1XLPA 3ABVB 3CWIA 3AE2B 1FXAA 3AEDB 1QF6A 3CIRB 2AX5A 3AE4B 2MJEA 5MPOA 1VDVA 1ZXIA 3AEBB 5EE3A 1E6EB 1NEKB 3AEEB 1YQ4B 1J7CA 3AMZA 4YSYB 2BS3B 2KAJA 3SR6A 5AUIA 3VR8B 3WCQA 4YSZB 1N63A 1NENB 2DWQA 2WDRB 3NVYA 2BS4B 1XLOA 2W55A 1UWMA 3LB8C 4P6VF 4C7ZA 1JROA 3DWMA 3DWGC 3PO0A 2HTME 1RWSA 2PVGC 2G1EA 3AEAB 1N60A 3AEFB 4ZOHC 1L6UA 3AE7B 1WWTA 3NS1A 3W9CB 3BIID 4A9AA 3P4QB 1DOXA 1N5WA 1XO3A 1TKYA 3NVVA 5C2TB 4FXCA 4IDIA 1DOYA 1JW9D 1JRPA 3AE1B
chains in the Genus database with same CATH superfamily
2RR9A 3ZNZB 2W9NA 2FNJB 2WXMA 1SJED 1JWSD 1R4NI 1I4GA 5IKCM 2FCNA 3AE8B 1ZE3D 1ACCA 1TYGB 2AL6A 1TTNA 2N9XA 5DPRA 3GE8C 1NYQA 4IWPA 3W2DA 3DBRI 3M63B 1YN4A 3ZXVA 5IN7A 1N5XA 1WSPA 3SHQA 4ZHOA 2CKHB 5E6NA 1EWYC 2C7HA 3TIXA 4W9GA 3RD2A 5T8IA 2WX0A 3P42A 2L8JA 5G55A 4EZLA 4BBNC 1LM8B 2BYEA 1D5MC 1EU3A 2NPTA 3ZRFA 4K7SA 1WXMA 4KDLB 4WQOB 1WJ6A 3M95A 1MVKA 3QIJA 1IPGA 2Y5BB 5TSSA 1C1YB 4ACFA 4NY0A 3MFGA 2NBWB 3H9DA 4ZRQA 3A33B 4FA6A 1T0RC 1IYFA 4N59A 4JWUC 1N62A 4WWOA 2AEHA 1KJTA 3Q8BA 2MBQA 4CHKA 3AE2B 3R3MA 2AX5A 2DAJA 3L16A 3ZUNA 4KSKC 1V2YA 4YSZB 2WXHA 1UUPA 2KANA 4ASWC 3ALBA 4TSSA 1N60A 4DBGA 5J2RA 2RPQA 2ZW1A 2HD5B 1RRBA 4NZLB 5G5HA 3U52E 3NRZA 3IFWB 3V6CB 2LD9A 3PLVA 2WDQB 1U4AA 2BGFA 2IO2B 2JWUA 1OGWA 2JYEA 2J0MA 4LLGM 2XK5B 4BFRA 1CJEA 2BWES 2KQ7A 4XWWA 4RFBA 5BMIA 1SE9A 2V4IB 2WXGA 1FIQA 2LGXA 1C4PA 1SBBB 1RFAA 1P1AA 2WLBA 2R61A 3WALA 4MM3B 1NBFC 2WXKA 3LYYA 2N9KA 2KHWB 5FKAC 1KH0A 2LI5A 2KT7A 3IVFA 3RN9C 5IO9A 2IYDB 1SXTA 3BINA 3UIPB 2WU2B 1HTOA 2ZCBA 4LK0M 1WM3A 2KD0A 4AJWA 1ZDVA 3ZRCA 3PHXB 1L0XB 3IT6B 2MH7A 5BYSA 1QLBB 2K8BA 5JHAA 1MFWA 3Q8FA 1GC6A 1PGAA 2G9HD 5EE1A 4DDGD 2BYFA 3ZNHB 2KLCA 3Q8AA 4L2YA 1WGRA 5DPSA 4YT0B 3NVWA 1QZEA 5IA7A 5BYQA 4GDLB 4XDDA 4BOSC 4OVVA 1B9RA 2NS5A 1SEBD 1ROEA 3UINB 2K9XA 1XLPA 5HFYA 4MT5A 2MJEA 3AEEB 2JZ3B 3VR8B 1N63A 2PW9A 2G1EA 4L1BA 2IY0B 3NS1A 1I4RA 3H1UA 4BOZB 2D3AA 3VVWB 1V6EA 3PREA 4J6IA 2N4FA 4WJPA 3ZLZA 3Q8CA 4ZYSA 2LHEA 2KJHB 2PKOA 1V97A 2KFJA 3T3NA 3DVGX 2K25A 5EE9A 4JGHB 2JWZA 1YQ3B 1UZXB 4C80A 3RYTA 2L00B 3A1QB 3UF8A 3A1QA 4DHZB 2DYMA 1YD8U 1P0RA 3TEYA 1GC7A 1XXGA 3VRBB 1CK1A 4ZHPA 1WXQA 2LRUA 3ZJVA 3APFA 4ARIA 4NNJB 1WZ3A 3UGBB 2KDEB 2G4SA 1XLQA 2D5GA 2M56B 2QDFA 4YSXB 2CR5A 2KTRB 2KDMA 1J7AA 4RF1A 1JRUA 2C9WB 1Y8RC 2LGDA 1TS4A 5MPOA 1V1OA 1YQ4B 2LMCA 4KDIC 2LGIA 4X57B 3OJ3A 3W1YA 2ON8A 4O1NA 4FN2A 4ZOHC 4BKTA 4KVGB 4DWFA 2RSUA 2RPVA 2K39A 2CJNA 5HKHA 3S2AA 2HJ8A 2GRIA 3MC0B 3B2FA 2KJ6A 3HUIA 2HTHA 1WGHA 5H92C 2MJ3A 2J0KA 1E7PB 2WWZA 4HRSA 4IM0A 3AULA 2WP9B 2H88B 1K51A 1V1PB 3QK0A 4M01A 2IPKD 3TEWA 3ZKJC 1KF6B 5L95C 1QOBA 2BYTA 1CZPA 2MHJA 3ZJUA 1E8XA 4MSQB 2MEKA 1Z5SB 4XDCA 4HXDA 1C3TA 4W9CA 1BMLC 1VZ6A 1V8CA 4OZBA 2M1MA 4XX5A 5L83A 3RI7C 4OW0A 2WXFA 1T6BX 2DENB 3UI3A 1ZPSA 5CHWA 1L5PA 1RAXA 3PV1A 1WGGA 1S3SG 1SF0A 2PLPA 1TT5B 2MBOA 2N1WA 2L76A 5E6PA 2DLBA 2MBEA 2K3UA 5J17A 2O6VA 4II3B 1G6JA 2AWTA 3I3TB 2KTFA 3L08A 2ZW0A 4OZAA 4BVUC 3NY5A 2N9EB 4RM8A 4C7YA 1KLVA 3Q69A 3FKYA 4FXCA 3DBLB 3WAMA 1JW9D 2J52A 3SFDB 3GE3C 3RNGC 4W9DA 1GG3A 1TKGA 4NJ7A 1L4ZB 2AYOB 3AE5B 3OWEB 4WJOA 2J53A 2RDBC 1UNSA 1IBXA 4HCPB 1N61A 1AN8A 1STEA 1VR9A 4NQLB 3R66C 2K6QA 3H7PB 4ICVA 2W54A 1OQQA 3GS2A 3DBHI 1E0ZA 2AQ1B 2KX0A 2D2QA 2J7QB 3VUYA 1D5ZC 3K9OB 2FCSA 1WGKA 1UF0A 2KWUB 2OJRA 2JXTA 5C23A 3I63C 1Y56A 5D2MB 3VUWA 2WGSA 5DPTA 2NTTA 2BB6A 3KW5B 4MJSB 4KX6B 3P4SB 2A5UA 1YNTE 4WJQA 1N6ZA 1AYFA 1AW7A 5FR6A 1UWXA 2KDIA 3N1YC 4EFOA 3CMMB 2VZKD 2V0GA 2KC2A 4DXFA 3VFKA 3Q3NC 3DVNU 1R7SA 1YN5A 1IGDA 2LHDA 2UU7A 3B2GA 4BKSA 4DK5A 1HTQA 3EGRA 2IGHA 2K0PA 3IHPC 5EDSA 3DCGA 4C56C 2K8CA 1VCBA 1E8WA 2WXJA 4W9EA 3L0WB 4K81A 2JSVX 4B0MA 2Z0EB 2IDYA 4IWQA 2VRRB 1UBIA 2JVCA 3AEBB 4P6VF 3PGEA 3PO0A 3IAS1 1WX7A 5JXVA 1D5XC 2PVGC 2ZCCA 1WMHA 4HVBA 5KHQA 1WYGA 1WMHB 2W3RA 3R2IA 1J0GA 4RGNA 5AZHA 2KYWA 4A55A 3PLUA 4E71A 4MGIE 1I35A 1RFKA 1WI0A 3AECB 1UH6A 2I1KA 4RNAA 1YX6B 2B3AA 2NMQA 1ZOYB 2OHFA 3N20C 3RPFC 2DAFA 2G45B 4K1RB 4TQ0A 2PPHA 3P1MA 5HHDG 2WXRA 3ZNID 3RT3B 1NYRA 1PFDA 4OZCA 5C3JB 1J7BA 3X23A 4CYEA 1P7EA 5IAAC 2MX2A 4MSMB 4ZYNA 1E8ZA 3KYCD 3TBLD 1XF5L 2WDVB 1YJIA 4ITKA 3Q14C 3B9JA 5CTRC 1TY0A 1MI0A 1ZGUB 4ANUA 2CHWA 2CS4A 2WS3B 3V61A 4GMVA 5G2NA 2ICIA 3PZDA 2INNE 1EF1A 3NG0A 2L32A 2PMVA 4JE3B 1ENFA 2C7MB 3DBSA 1L2NA 4W9KA 1TGZB 3DHGC 1KOTA 4IC7B 3UQBA 1JMLA 4C00A 1E10A 4WWPA 4LNIA 4N9F4 5LXIB 3APCA 3ZQ4A 2BB5A 3BZDB 1C78A 1OEYA 3VDZA 2ZPNA 2HJ1A 4TKNA 5D3DA 3W9CB 1YJ1A 4LNFA 1DOYA 2BVCA 1J8CA 2L7RA 2OJWA 1BT0A 4I6LB 1L7YA 2KACA 3A9KA 2BPSA 4GLSC 3M62B 2XK5A 4GDKA 3AE3B 2N0SB 4HJGE 5E6JA 1WE7A 4US9A 4MM3A 2OEDA 3R7RA 3TCAA 1WXSA 2GLSA 4DDID 3A4SC 1A70A 2O6VD 1DYQA 4WQMA 3DHIC 1QT9A 3I5JC 3PRZA 1IUEA 2WXIA 4AP4C 1MHHE 4B6WA 3AM9A 1F2RC 1WJNA 3U4EG 1WJUA 3P63A 1K52A 2MA9B 1TKEA 2WU5B 3PHWB 1RYJA 4GN1A 1K8RB 3DBLI 3PSEB 1AWDA 2GI9A 1YN3A 4JPSA 4ICUA 5CHVC 3AI5A 3WANA 4OVZA 4EZKA 3MTNB 4KGTA 2QJLA 3VXWA 3IAM1 3N1XC 3OAWA 2FAZA 3SU8X 4GXBA 2MCNB 1ISNA 2K6DB 2LXCA 4KGRA 4UDUC 4WURA 2RDGA 3EC8A 3VTWA 4ZDVA 2ZVNA 1ZXIA 3H8HA 5KHOA 4IKGA 2JPHA 2DZIA 4JQWC 1GPXA 2W55A 3EHVA 4C7ZA 2RGFA 4A9AA 2KQSA 4WWNA 2O6VB 4PYUA 4RGTA 3AE1B 2KWVB 1FXIA 2R2QA 2XNAC 1WZ0A 2CJOA 3PRPB 4AOFA 2XEWA 1T3QA 3PVLA 1PDXA 2LEKA 3ETRA 1E7UA 5BMHA 2DYOA 4AJYB 2V3PA 4M02A 1VZ7A 2V9HA 1ZUD2 1OQRA 1VZ8A 3E56A 4EEWA 2GBKA 2EELA 1VD2A 4ARCA 1I42A 2Z59B 3LDZE 4YTPB 4HEA1 2KMCA 3I57A 2CHXA 3AN1A 1FRRA 4WH4A 4YTNB 1V49A 2GBJA 3QC8B 4PYZA 4OVUA 3C0RB 3ZTDA 2KNBA 2MW5A 2I2YA 1HZ6A 1KLUD 1WIAA 1GAQB 5AZFA 1MG8A 2D3CA 4KKIA 1PGBA 2LXAA 1V86A 4M0WB 3VTUA 4L23A 5BO4B 4FLHA 2BS2B 1DOIA 2KQ4X 2EMSA 4W9IA 2A4ZA 1XQQA 3RMKC 1TS5A 3H6NA 4TQ1A 1UBQA 3AXCA 3ZDMC 1ZXHA 4YTMB 2QHOA 2QCZA 3KLSX 4NJCA 1UD7A 2LUEA 3AE4B 4M8NA 2LVOA 3VHTC 4HPLB 1SE4A 1HE8A 3T8MA 1Z2MA 3FILA 4FBJB 2UYZB 4NJ6A 1XLOA 2M8SA 2SEBD 3DWMA 1YIWA 4A8XC 2DZMA 2KJRA 4FHJA 4MGYE 3BVMA 3BK2A 2MP2A 4DXAB 2JRHA 3SDLC 2KO3A 4E3CA 1MPEA 5C1ZA 3AH7A 1JWBD 2WX1A 3CSFA 3W5UB 2MWSB 2PVOD 4ANXA 2M0AA 3U7DA 1TBEA 5I4DA 2JF5A 2ASQA 4KGSA 3ONSA 4EE2A 2KX3A 5HI1A 2JRIB 1D6EC 2N7DA 1P98A 3APDA 2NCNA 3VRAB 4LNOA 5AZGA 1FM0D 1NVID 1I4QA 4NQKE 3SEBA 3W5VB 2M17A 4FADA 4IM3A 2FE8A 3O65B 2JXXA 3UIOB 2LZ6A 2QEJC 4MH0E 4RGMA 1WRDB 2ACZB 2LASA 1LFDA 1V5TA 3TSSA 5IOIA 2D10A 4GSWA 1HEZE 5BYRA 4FJYA 3MC8A 3BY4B 4CO7A 2L1AA 3V05A 2WXOA 1JQ4A 2J0JA 1SGHA 2H89B 4WAAA 3V62A 1H8CA 2IGGA 3A9JA 2KN5A 2TSSA 1VDVA 5EE3A 4K7UA 2W82A 4WAFA 2PE6B 3AMZA 2JZPA 3EECA 4URKA 4OHJA 4RMAA 3HIZA 2BS4B 1TZOA 3M3JA 1SE3A 2IO1B 2R2OA 1QILA 2HTME 1RWSA 3AEAB 4M00A 2IBIB 1S1QB 3H7PA 1R4MB 1A5RA 2GBRA 1I4HA 1YOVB 2PTLA 1V80A 4HKZE 3ZO5B 1P3QU 4LNKA 1TS3A 3QAQA 3NZUA 4W9HA 5JHBA 2MJDA 3A9KB 4LDTD 2LRWA 2JYTA 3QQ8B 1EF5A 1C79A 3WAPA 4WJNA 2C60A 4G3XB 4NAWB 4HCNB 3H7SA 1QOGA 4A90A 3W1SA 3DVGY 1V1PA 3OJ4B 3V60A 2BF8B 2BWFA 1UELA 1WM2A 1CQVA 1EM7A 1HZ5A 3TMPB 5DPWA 1Q5WB 2KFKA 1OEYJ 4PS7A 1E5WA 2LUMA 2JY6A 2KZRA 4J3OD 1LGRA 3DBHB 2LJ5A 5HG2A 4HWIB 1WH3A 2O2VA 3PTFC 2JQRB 2CU1A 3BVGA 3R2TA 4XWTA 1P9DU 1GJZA 5GXGB 4R3DA 3ML9A 1QQRA 3VH4B 4HDOA 2L0FA 3MJWA 2L3ZA 3Q3OC 3KQ4A 2ZPYA 2LJIA 2IZVB 1E90A 4KSLC 5IP4D 3C8YA 3QARA 3ZIMA 1NEKB 3SR6A 3RNAC 2QC8A 3JSVB 2MQJA 1JROA 5D6JB 1WWTA 2QMTA 3TUOA 3N9YC 4W9LA 3BVZA 3EFCA 1SIFA 2J4XA 1JRPA 2WXNA 3VUXA 2E6XA 1EWCA 2CHZA 2Y3AA 1PUTA 4LJOB 2KXJA 2LFIA 2FUHB 4HDQA 1AARA 4W9FA 3C19A 3ZXRA 4MACA 4TUUA 2LGSA 4KIKA 3Q3JA 1M4VA 2G3QB 4XZ4A 1SJHD 1NI3A 1VRAB 1XLNA 4B0EA 1IBXB 4A3PA 3QHTA 1X1MA 3U2SC 5D7GA 2NR2A 4GU2A 4N58A 2J42A 1R4NB 3R8BA 5TR5A 3ZDTA 3Q3MC 4CQNA 3OG5A 4AUQC 3P4RB 2AQ2B 4USAA 4MJSA 3PPAA 5DCNA 1IGCA 4EKUA 2I38A 1DGJA 2KWDA 4FJZA 3X0WA 3EFUA 2YEPB 2Y5CA 2WDTB 4IW0A 3ZJTA 2VH1A 1D3ZA 3NUHB 3DBRB 1GUAB 1XCTL 2JT4B 1GB1A 1LXDA 2BTEA 1FCLA 2XBBC 2M19A 3KUZA 4B9KA 1EU4A 4BKGA 1GNUA 1QF6A 4HK2A 2LWPA 1E6EB 1J7CA 2MSED 2DWQA 3FILB 1WGYA 4C4VB 1E7VA 4P7IA 4AS1A 1NI2A 4US8A 2C7NB 3AE7B 1DOXA 4MELA 1FNWA 2CU3A 3AB5A 3Q3FA 4A20A 4GDKB 3GZNB 2QIEB 4WIPA 2VZKB 3DPDA 3KUDB 1C9FA 3N1ZC 4RH6A 1LQBA 1OTRB 2M4NA 1D4BA 2W3SA 1JWUD 3N32A 2FCMA 1MJDA 3DHHC 2DZJA 4ZRKA 2INCC 3J9CA 3B0AA 2N7JA 2WXQA 2K22A 5CX3A 3FAHA 2KFKB 1V5OA 4HROA 1FRDA 3BYYB 2L05A 3NS8A 3TJPA 4A6QA 3HRDD 1QOAA 3Q2AC 3RFZB 1F0ZA 3GZNI 2FBWB 2ONQA 4JL9A 4PK1A 3GOEA 1XT9B 3B1LX 3T9LA 4F8CB 4JWSC 4MDKE 4YL8A 3RNFC 3GP7A 2L52A 2REXA 3NOBA 4BKSD 3N3KB 3AEGB 3L54A 2X8XX 4MGZE 4DHJD 2MLBA 3PRMB 1PYWD 4IG7B 4PS3A 4ANWA 1KFYB 2WXLA 3CSTA 2Z0DB 3NHEB 3SFEB 1KM7A 1L0YB 2D07B 2DHZA 1RLFA 2FCQA 2GOWA 3CIRB 3PZ8A 2BKRB 1TZ1A 3EA6A 5CHFA 2KC1A 4YWGG 1WY8A 3QCAA 4MGKE 3HM3A 4HPPA 4HPMB 1C77A 3ML8A 4K3CA 3P4QB 5C2TB 1SSNA 1T0SC 1TS2A 2UWQA 3GB1A 3RNEC 3U30A 3ZGZA 4N6EB 1H4RA 1CMXB 1SIJA 3EUB2 3VQIA 1OFFA 2HDEA 3UQAA 4JX1C 1WX8A 3WA0A 4F7ZA 2QSDA 2BT6A 4RGOS 4GOCA 1FEHA 4XC2A 2FIFA 1ZDXA 2BBCA 2WXPA 2KMMA 2KLGA 2DBYA 1F1HA 1WR1A 2LVQA 2Z8LA 4DHJB 5JZEB 2KWCA 3RUIB 4I6PA 3WAOA 1OQYA 4KV2A 4DXGA 4P1CC 2PIAA 4NPNA 1WXAA 4G11A 4S17A 1ZKHA 4HLEA 4M0WA 3DOWA 3QWZB 2O2VB 3Q6BA 1KTKA 2NBUA 3HVZA 2ZNVB 2BQQA 2FUG1 2C5LC 2ZJDA 2YEPF 2MBBB 1QOFA 2ZNVC 1ESFA 5GMVA 3ZW3A 2ZVOA 4M8MA 1C4CA 3DQVA 5AUKA 2JZZA 4G50A 1WX9A 3CWIA 4GDLA 3ZVVA 2LVPA 4TV3A 2NTSA 2KDBA 3L17A 2K1FA 2KAJA 4IWOA 5AUIA 2MP2B 3NVYA 3KUCB 4D2KA 4DQOC 3R7QA 2NBVB 2LGYA 3JSVA 3D32A 3JYUA 2MRPA 4S0RA 1TKYA 1F2RI 3KWVA 3U7ZA 3HHMA 3P4PB 5G5GA 5AEKB 3Q8EA 4K3BA 4I6NB 4KZ0A 2NVUI 2WYQA 2V3SA 3I9V1 2AL3A 2V1YA 1HXYD 3L4PA 1I7HA 3PZ7A 1SB3C 2GBMA 2L83A 3IG3A 2E3TA 1KLGD 2AQ3B 1FNUA 2MBHA 1Q0WB 3L10B 1EUVB 1MG4A 3K9PB 1L0VB 4NAMA 4BZAA 3RNCC 2Q5WD 4XGAB 5FK9C 4HJKA 3W1SC 4LNNA 1NDDA 4W9JA 1FFVA 4KIKB 1FNVA 3A4RA 2JX5A 4XYCA 4RCOA 1JWAD 1JCKB 3MC9A 1KRHA 1K53A 2NPTB 1GB4A 3VH3B 1WR6E 2D3GA 2D3BA 4A3OA 1ZP0B 3TL5A 4FULA 3KYDD 2N9LA 1C76A 4ZRIA 1IP9A 3N30A 2WQYB 3HK0A 2OOBB 1J19A 2KVZA 4YXDB 1T0QC 2FIDA 4BAXA 2JUOA 2Y5PA 3A9JB 3LXFA 1WJ4A 4GB9A 1QKZA 1L4DB 4ZRJA 3O13A 5BMGA 1SE2A 4MEMA 4HKQA 1F52A 2GMIC 2N1VA 4P16A 3WCQA 1T0YA 2WDRB 2KK8A 2KTRA 3HVDA 3NJTA 1JWMD 1L6UA 4KZCA 3VAWA 4KKJA 4EZJA 5D3IB 1PGXA 1BXTA 2VH2A 1YQBA 2L0TA 4TMAB 3LJ3A 3KWLA 1FFUA 3RCZA 4AWJA 2RD0A 3AE6B 5EE0A 3CF6E 1UGMA 4PS8A 3HM6X 3JW0X 3ZTCA 3AU5A 4NAWA 1WF9A 3TEXA 4IM2A 4LTUA 5LXHA 1YX5B 3V3XA 1FPYA 1RM6C 1XD3B 2IO0B 4ANVA 1FCCC 4FHKA 3AU4A 3BK1A 3MJ5A 1JALA 1FD6A 2RDHA 1MHXA 1FO4A 3OLMD 3L13A 2RMMA 3NZ3A 4GIVA 4EOYA 1V9JA 1UGJA 1FMAD 1ET6A 4G0NB 3RNBC 4EUTA 3FC4A 1C4AA 1I4PA 1WYWB 3MHZA 4MH8A 3IXSA 4LCDE 2N7EA 2EKEC 2INDC 3TEZA 2KVRA 3T3OA 2IO3B 2GBNA 1E9MA 1L6VA 4PT5A 5JH5C 2BYVE 2QILA 1YMHE 4REZA 5D94A 1EO6A 1LO5D 1K50A 1P7FA 2KMAA 3KVFB 1TJEA 3ABVB 1FXAA 3AEDB 4BBNF 3QX1A 4LDTB 3BWUD 4QAYA 3URYA 3E9SA 4F1SA 4YSYB 3BYTB 4P1BC 1F77A 2V4LA 3LB8C 1BUIC 1Q10A 3DWGC 3JVZX 4XE0A 4H2AA 2X38A 4ZRPA 3AEFB 2I1JA 1N5WA 1XO3A 2YVCA 2IJ0A 2GB1A 4II2B 1TIFA 2IGDA 2KN4A 3ZNGC 3AE9B 2WNMA 4FJVB 5H8YE 1WE6A 5LNK1 2EMTA 3V6EB 3ZYYX 5J18A 2PEAA 1HQRD 4AQ7A 5FR3A 4DHZE 1M94A 1FXTB 1HA5A 1YJJA 2DYBA 1F9JA 1ZW7A 2KDFB 3ECIA 3IBEA 1B1ZA 4LJPB 4IOIE 2G4DB 3VR9B 1VLBA 2K5PA 1Q1OA 5LLIA 2IY1B 1PQSA 2WHIA 3AV8A 2ZEQA 1XCQL 1V81A 3PT2B 3RULA 5E6OA 3NZSA 2BKFA 3VTVA 3DVNV 4WWMA 2M0XA 2DNFA 1VJKA 3IT4B 1TY2A 3RZWC 1WXVA 3PS6A 2ZZPB 2D11A 2JU6X 4B95A 2BW2A 2PE9A 3KH0A 1WGDA 3DDCB 2DZKA 3MHSD 2INPE 2KOXA 2KKCA 4RF0A 4Q2JA 2N9PC 4E74A 3MP9A 2XN9C 4RM9A 3NVZA 2EKIA 2B76B 4JLCA 3QA8A 2HE7A 1T5XD 1WFYA 3U8ZA 3B08A 1I4XA 2K8HA 3WIMA 4C4VA 1WRIA 3SD5A 2YLMA 1ET9A 1R4MI 3ENEA 1XEEA 2DX5B 2SAKA 3QJZA 2BS3B 2PJHA 4K7WA 1NENB 2V3NA 4IUMB 1UWMA 4GGQA 3RZFA 3BIID 1GOZA 4JIOU 3NVVA 4IDIA 3P2BA 1E8YA
chains in the Genus database with same CATH topology
3GB1A 3BK2A 3SFDB 1MPEA 2WXMA 3AH7A 1JWBD 1TKGA 3ZGZA 1SJED 1L4ZB 3OWEB 3AE5B 4N6EB 2J53A 1JWSD 1SIJA 1UNSA 1IBXA 3EUB2 3VQIA 1N61A 1AN8A 1OFFA 1I4GA 1STEA 1VR9A 3W5UB 3AE8B 2HDEA 1ZE3D 1ACCA 1TYGB 2PVOD 4JX1C 2W54A 1OQQA 3GS2A 1NYQA 1E0ZA 2AQ1B 2M0AA 3W2DA 5I4DA 1YN4A 1D5ZC 2QSDA 4KGSA 1WGKA 2BT6A 4RGOS 1FEHA 2JXTA 1N5XA 1WSPA 1ZDXA 4EE2A 2BBCA 5HI1A 1Y56A 2WXPA 1D6EC 2KMMA 2NTTA 2DBYA 2BB6A 4ZHOA 2Z8LA 1EWYC 4KX6B 3VRAB 1FM0D 3P4SB 1NVID 1YNTE 5T8IA 3P42A 1AYFA 1I4QA 1AW7A 3SEBA 4DXGA 3W5VB 2PIAA 1D5MC 1EU3A 1UWXA 2FE8A 4M0WA 2VZKD 4RGMA 1MVKA 2QEJC 2ACZB 2V0GA 4DXFA 1KTKA 5TSSA 3TSSA 3HVZA 1R7SA 1YN5A 1IGDA 2LHDA 3B2GA 3MFGA 2FUG1 2YEPF 3EGRA 1HEZE 4ZRQA 1QOFA 2IGHA 5BYRA 1ESFA 2K0PA 1C4CA 4C56C 5AUKA 4N59A 2L1AA 3V05A 2WXOA 4JWUC 1JQ4A 1N62A 2WXJA 2JSVX 3CWIA 3Q8BA 2H89B 4B0MA 3AE2B 2IGGA 2AX5A 2IDYA 2TSSA 2NTSA 1VDVA 3AEBB 5EE3A 2W82A 4WAFA 3AMZA 2JZPA 2KAJA 4OHJA 5AUIA 4YSZB 4P6VF 2WXHA 1UUPA 2BS4B 3NVYA 1TZOA 4D2KA 4DQOC 3PO0A 3IAS1 5JXVA 1SE3A 1QILA 1D5XC 2HTME 1RWSA 2PVGC 3AEAB 4TSSA 1N60A 1TKYA 1F2RI 2ZW1A 3KWVA 3U7ZA 4NZLB 3U52E 5G5HA 3P4PB 5G5GA 3NRZA 1WYGA 3Q8EA 2W3RA 1I4HA 3R2IA 2WDQB 4RGNA 2PTLA 4HKZE 2JWUA 2JYEA 4LLGM 1TS3A 3I9V1 4A55A 1HXYD 3L4PA 1I7HA 1RFKA 1CJEA 3AECB 3PZ7A 1SB3C 2MJDA 4XWWA 4RFBA 2L83A 2JYTA 4RNAA 2E3TA 5BMIA 1C79A 2V4IB 2NMQA 2WXGA 1ZOYB 1KLGD 1FIQA 2OHFA 3RPFC 2AQ3B 1FNUA 4NAWB 1C4PA 1SBBB 1QOGA 4A90A 1L0VB 4NAMA 4TQ0A 2WLBA 2R61A 2Q5WD 3W1SA 3P1MA 5FK9C 5HHDG 2WXRA 4MM3B 1V1PA 1NYRA 2WXKA 1PFDA 1FFVA 3LYYA 4OZCA 5C3JB 2N9KA 1J7BA 1CQVA 1FNVA 2JX5A 1EM7A 5FKAC 1HZ5A 1KH0A 1P7EA 4RCOA 1JWAD 1JCKB 1KRHA 1SXTA 1K53A 1GB4A 2WU2B 1XF5L 2WDVB 2LUMA 1YJIA 4ITKA 4J3OD 4LK0M 3B9JA 1ZP0B 1TY0A 1MI0A 1ZDVA 1L0XB 3IT6B 5HG2A 2MH7A 2N9LA 2JQRB 1QLBB 5BYSA 1C76A 3BVGA 3Q8FA 2WQYB 3R2TA 1PGAA 4XWTA 2G9HD 2WS3B 5GXGB 2ICIA 4YXDB 5EE1A 4R3DA 2INNE 2L32A 1QQRA 2Y5PA 3Q8AA 4L2YA 2PMVA 3LXFA 4YT0B 3NVWA 3KQ4A 4JE3B 1ENFA 1QKZA 5BYQA 1L4DB 2LJIA 4GDLB 4XDDA 1B9RA 1SEBD 1JMLA 1ROEA 3O13A 5BMGA 2K9XA 1E10A 1XLPA 5HFYA 4MT5A 1SE2A 3C8YA 2MJEA 4HKQA 3ZQ4A 2BB5A 1NEKB 3AEEB 3SR6A 4P16A 3BZDB 1C78A 3WCQA 3VR8B 1N63A 2WDRB 3HVDA 1JROA 2PW9A 5D3DA 2G1EA 4L1BA 3W9CB 1JWMD 1L6UA 1WWTA 2QMTA 3NS1A 1I4RA 3TUOA 4KKJA 3N9YC 1DOYA 3BVZA 2J4XA 1JRPA 5D3IB 1PGXA 1BXTA 2WXNA 2E6XA 1EWCA 2Y3AA 2KACA 4GLSC 1PUTA 4TMAB 2LFIA 3Q8CA 3KWLA 1FFUA 4ZYSA 2LHEA 2PKOA 1V97A 3AE6B 3AE3B 5EE0A 2N0SB 3T3NA 4MACA 4HJGE 5E6JA 4US9A 2OEDA 3TEXA 1M4VA 1SJHD 1NI3A 1VRAB 4LTUA 1A70A 1XLNA 5EE9A 4B0EA 1IBXB 1DYQA 3V3XA 1RM6C 1YQ3B 4WQMA 4C80A 1QT9A 1FCCC 3U2SC 5D7GA 1IUEA 3BK1A 2WXIA 3MJ5A 1JALA 1FD6A 4N58A 1MHHE 2RDHA 2J42A 3AM9A 3R8BA 1MHXA 1FO4A 1F2RC 3U4EG 4CQNA 2DYMA 3P63A 2RMMA 1K52A 3NZ3A 1UGJA 1TKEA 1FMAD 1ET6A 2WU5B 3P4RB 3TEYA 1RYJA 3FC4A 2AQ2B 1C4AA 1I4PA 1XXGA 3VRBB 4USAA 1CK1A 3MHZA 4MH8A 1AWDA 3IXSA 2GI9A 1YN3A 4JPSA 3TEZA 4ZHPA 4OVZA 1IGCA 3T3OA 2I38A 1DGJA 2KWDA 4KGTA 2QJLA 3IAM1 1WXQA 3ZJVA 4ARIA 1E9MA 2YEPB 1L6VA 2Y5CA 4PT5A 3ZJTA 2QILA 1YMHE 4REZA 1XLQA 2D5GA 3NUHB 2M56B 1LO5D 1XCTL 1K50A 1GB1A 1P7FA 2BTEA 1FCLA 4YSXB 2M19A 1EU4A 2KDMA 1J7AA 1TJEA 3ABVB 4KGRA 1QF6A 1FXAA 3AEDB 4UDUC 4RF1A 3BWUD 4WURA 1TS4A 2RDGA 5MPOA 3URYA 1ZXIA 1V1OA 3E9SA 3H8HA 1E6EB 4IKGA 1YQ4B 1J7CA 3BYTB 4YSYB 2LMCA 1F77A 2DWQA 1GPXA 3LB8C 2W55A 2LGIA 1BUIC 4C7ZA 1Q10A 3FILB 3DWGC 2ON8A 4XE0A 4O1NA 4AS1A 4H2AA 2X38A 4ZRPA 4US8A 3AEFB 4ZOHC 4A9AA 3AE7B 1DOXA 1N5WA 1XO3A 2IJ0A 2GB1A 2RPVA 4RGTA 3AE1B 2IGDA 1FNWA 1FXIA 2CU3A 2KN4A 3AB5A 2CJNA 2XNAC 4GDKB 2GRIA 2QIEB 3MC0B 3AE9B 2VZKB 2WNMA 4WIPA 3B2FA 2CJOA 3HUIA 1C9FA 4RH6A 1T3QA 1PDXA 5H8YE 5LNK1 2LEKA 3ETRA 2W3SA 5H92C 2MJ3A 3ZYYX 1E7PB 1JWUD 1HQRD 4HRSA 1D4BA 4AQ7A 5FR3A 2WP9B 2H88B 5BMHA 1K51A 1HA5A 1V1PB 2DYOA 1YJJA 3BVMA 2V3PA 2IPKD 1VZ7A 3TEWA 3J9CA 1B1ZA 1ZUD2 2N7JA 2WXQA 2K22A 1OQRA 1VZ8A 3E56A 1KF6B 3FAHA 2EELA 4ARCA 4IOIE 1QOBA 2BYTA 3VR9B 1VLBA 2K5PA 4HEA1 4YTPB 1CZPA 4HROA 1FRDA 3BYYB 3I57A 3AN1A 1FRRA 3AV8A 3ZJUA 4WH4A 1XCQL 4YTNB 4A6QA 3HRDD 1QOAA 2MEKA 3RFZB 1F0ZA 4XDCA 2FBWB 2ONQA 4WWMA 1VJKA 3IT4B 1BMLC 1TY2A 1VZ6A 2I2YA 1V8CA 4JWSC 1HZ6A 1KLUD 1GAQB 4KKIA 4OZBA 3GP7A 1PGBA 2L52A 2JU6X 2BW2A 4L23A 4OW0A 2WXFA 3AEGB 1T6BX 2INPE 3UI3A 1ZPSA 2BS2B 4RF0A 1DOIA 1L5PA 1PYWD 4Q2JA 3MP9A 2XN9C 2KQ4X 3NVZA 2EKIA 2B76B 1KFYB 2WXLA 1TS5A 4TQ1A 2PLPA 1SF0A 3SFEB 1T5XD 1ZXHA 1L0YB 4YTMB 1I4XA 3KLSX 1WRIA 4NJCA 2DLBA 3CIRB 1ET9A 2K3UA 3AE4B 3PZ8A 3EA6A 1SE4A 1XEEA 2SAKA 4YWGG 3FILA 2BS3B 1NENB 2V3NA 1XLOA 1UWMA 2SEBD 2ZW0A 4OZAA 3DWMA 1C77A 4C7YA 4A8XC 3Q69A 3BIID 1GOZA 3P4QB 5C2TB 3NVVA 1SSNA 4FXCA 4IDIA 1TS2A 1JW9D 2J52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FXI A;  2CU3 A;  3AB5 A;  5G5H A;  2CJN A;  3P4P B;  3NRZ A;  5G5G A;  3SFD B;  4US8 A;  1WYG A;  2QIE B;  1PUT A;  3AE9 B;  2W3R A;  3AH7 A;  1JWB D;  1TKG A;  2CJO A;  2WDQ B;  3B2F A;  3HUI A;  4N6E B;  3KWL A;  3AE5 B;  1FFU A;  2PKO A;  1T3Q A;  1SIJ A;  1PDX A;  1V97 A;  3EUB 2;  5H8Y E;  3AE6 B;  2LEK A;  1N61 A;  2N0S B;  2W3S A;  2MJ3 A;  1I7H A;  1E7P B;  1OFF A;  1RFK A;  3ETR A;  4HRS A;  1CJE A;  3ZYY X;  3W5U B;  3AE8 B;  3AEC B;  1TYG B;  2PVO D;  2WP9 B;  1SB3 C;  2H88 B;  2MJD A;  4JX1 C;  4US9 A;  2L83 A;  1YJJ A;  2W54 A;  1OQQ A;  1NYQ A;  2E3T A;  1E0Z A;  1ZOY B;  2OHF A;  1FIQ A;  1NI3 A;  3AE3 B;  3RPF C;  1ZUD 2;  4LTU A;  1A70 A;  1XLN A;  1OQR A;  2K22 A;  5EE9 A;  1WGK A;  2BT6 A;  1KF6 B;  3FAH A;  1RM6 C;  1YQ3 B;  1QOG A;  1N5X A;  4WQM A;  4C80 A;  1L0V B;  4C7Y A;  2WLB A;  1QOB A;  1QT9 A;  2Q5W D;  3P1M A;  3VR9 B;  1IUE A;  1VLB A;  2K5P A;  4YTP B;  1CZP A;  1NYR A;  2KMM A;  4HRO A;  1JAL A;  1FRD A;  4N58 A;  1PFD A;  2DBY A;  4ZHO A;  1FFV A;  3AM9 A;  3AN1 A;  1FRR A;  5C3J B;  3AV8 A;  1J7B A;  1FO4 A;  1EWY C;  4KX6 B;  2JX5 A;  3VRA B;  1FM0 D;  4YTN B;  3HRD D;  1QOA A;  3P4S B;  1NVI D;  3P63 A;  1JWA D;  1F0Z A;  1TKE A;  1FMA D;  2WU5 B;  1KRH A;  3P4R B;  1AYF A;  2FBW B;  1RYJ A;  4WWM A;  3FC4 A;  3L4P A;  3W5V B;  2PIA A;  2WU2 B;  2WDV B;  1VJK A;  5EE0 A;  1YJI A;  3VRB B;  4USA A;  4ITK A;  1AWD A;  1V8C A;  4JWS C;  3B9J A;  1ZP0 B;  1GAQ B;  2MH7 A;  2JQR B;  1QLB B;  2L52 A;  4ZHP A;  2ACZ B;  2WQY B;  1DGJ A;  2WS3 B;  2QJL A;  3HVZ A;  1R7S A;  5GXG B;  3AEG B;  1WXQ A;  4YXD B;  1E9M A;  3B2G A;  5EE1 A;  1L6V A;  2BS2 B;  2Y5C A;  1DOI A;  1L5P A;  5H92 C;  1GPX A;  3NVZ A;  2EKI A;  1QOF A;  2B76 B;  1KFY B;  1XLQ A;  3LXF A;  4YT0 B;  3NVW A;  2M56 B;  1SF0 A;  3SFE B;  4YTM B;  5AUK A;  4N59 A;  4YSX B;  1JQ4 A;  2M19 A;  4JWU C;  1B9R A;  1N62 A;  1E10 A;  1ROE A;  1J7A A;  1TJE A;  2K9X A;  2H89 B;  1WRI A;  1XLP A;  3ABV B;  3CWI A;  3AE2 B;  1FXA A;  3AED B;  1QF6 A;  3CIR B;  2AX5 A;  3AE4 B;  2MJE A;  5MPO A;  1VDV A;  1ZXI A;  3AEB B;  5EE3 A;  1E6E B;  1NEK B;  3AEE B;  1YQ4 B;  1J7C A;  3AMZ A;  4YSY B;  2BS3 B;  2KAJ A;  3SR6 A;  5AUI A;  3VR8 B;  3WCQ A;  4YSZ B;  1N63 A;  1NEN B;  2DWQ A;  2WDR B;  3NVY A;  2BS4 B;  1XLO A;  2W55 A;  1UWM A;  3LB8 C;  4P6V F;  4C7Z A;  1JRO A;  3DWM A;  3DWG C;  3PO0 A;  2HTM E;  1RWS A;  2PVG C;  2G1E A;  3AEA B;  1N60 A;  3AEF B;  4ZOH C;  1L6U A;  3AE7 B;  1WWT A;  3NS1 A;  3W9C B;  3BII D;  4A9A A;  3P4Q B;  1DOX A;  1N5W A;  1XO3 A;  1TKY A;  3NVV A;  5C2T B;  4FXC A;  4IDI A;  1DOY A;  1JW9 D;  1JRP A;  3AE1 B; 
#chains in the Genus database with same CATH topology
 2RR9 A;  3ZNZ B;  2W9N A;  2FNJ B;  2WXM A;  1SJE D;  1JWS D;  1R4N I;  1I4G A;  5IKC M;  2FCN A;  3AE8 B;  1ZE3 D;  1ACC A;  1TYG B;  2AL6 A;  1TTN A;  2N9X A;  5DPR A;  3GE8 C;  1NYQ A;  4IWP A;  3W2D A;  3DBR I;  3M63 B;  1YN4 A;  3ZXV A;  5IN7 A;  1N5X A;  1WSP A;  3SHQ A;  4ZHO A;  2CKH B;  5E6N A;  1EWY C;  2C7H A;  3TIX A;  4W9G A;  3RD2 A;  5T8I A;  2WX0 A;  3P42 A;  2L8J A;  5G55 A;  4EZL A;  4BBN C;  1LM8 B;  2BYE A;  1D5M C;  1EU3 A;  2NPT A;  3ZRF A;  4K7S A;  1WXM A;  4KDL B;  4WQO B;  1WJ6 A;  3M95 A;  1MVK A;  3QIJ A;  1IPG A;  2Y5B B;  5TSS A;  1C1Y B;  4ACF A;  4NY0 A;  3MFG A;  2NBW B;  3H9D A;  4ZRQ A;  3A33 B;  4FA6 A;  1T0R C;  1IYF A;  4N59 A;  4JWU C;  1N62 A;  4WWO A;  2AEH A;  1KJT A;  3Q8B A;  2MBQ A;  4CHK A;  3AE2 B;  3R3M A;  2AX5 A;  2DAJ A;  3L16 A;  3ZUN A;  4KSK C;  1V2Y A;  4YSZ B;  2WXH A;  1UUP A;  2KAN A;  4ASW C;  3ALB A;  4TSS A;  1N60 A;  4DBG A;  5J2R A;  2RPQ A;  2ZW1 A;  2HD5 B;  1RRB A;  4NZL B;  5G5H A;  3U52 E;  3NRZ A;  3IFW B;  3V6C B;  2LD9 A;  3PLV A;  2WDQ B;  1U4A A;  2BGF A;  2IO2 B;  2JWU A;  1OGW A;  2JYE A;  2J0M A;  4LLG M;  2XK5 B;  4BFR A;  1CJE A;  2BWE S;  2KQ7 A;  4XWW A;  4RFB A;  5BMI A;  1SE9 A;  2V4I B;  2WXG A;  1FIQ A;  2LGX A;  1C4P A;  1SBB B;  1RFA A;  1P1A A;  2WLB A;  2R61 A;  3WAL A;  4MM3 B;  1NBF C;  2WXK A;  3LYY A;  2N9K A;  2KHW B;  5FKA C;  1KH0 A;  2LI5 A;  2KT7 A;  3IVF A;  3RN9 C;  5IO9 A;  2IYD B;  1SXT A;  3BIN A;  3UIP B;  2WU2 B;  1HTO A;  2ZCB A;  4LK0 M;  1WM3 A;  2KD0 A;  4AJW A;  1ZDV A;  3ZRC A;  3PHX B;  1L0X B;  3IT6 B;  2MH7 A;  5BYS A;  1QLB B;  2K8B A;  5JHA A;  1MFW A;  3Q8F A;  1GC6 A;  1PGA A;  2G9H D;  5EE1 A;  4DDG D;  2BYF A;  3ZNH B;  2KLC A;  3Q8A A;  4L2Y A;  1WGR A;  5DPS A;  4YT0 B;  3NVW A;  1QZE A;  5IA7 A;  5BYQ A;  4GDL B;  4XDD A;  4BOS C;  4OVV A;  1B9R A;  2NS5 A;  1SEB D;  1ROE A;  3UIN B;  2K9X A;  1XLP A;  5HFY A;  4MT5 A;  2MJE A;  3AEE B;  2JZ3 B;  3VR8 B;  1N63 A;  2PW9 A;  2G1E A;  4L1B A;  2IY0 B;  3NS1 A;  1I4R A;  3H1U A;  4BOZ B;  2D3A A;  3VVW B;  1V6E A;  3PRE A;  4J6I A;  2N4F A;  4WJP A;  3ZLZ A;  3Q8C A;  4ZYS A;  2LHE A;  2KJH B;  2PKO A;  1V97 A;  2KFJ A;  3T3N A;  3DVG X;  2K25 A;  5EE9 A;  4JGH B;  2JWZ A;  1YQ3 B;  1UZX B;  4C80 A;  3RYT A;  2L00 B;  3A1Q B;  3UF8 A;  3A1Q A;  4DHZ B;  2DYM A;  1YD8 U;  1P0R A;  3TEY A;  1GC7 A;  1XXG A;  3VRB B;  1CK1 A;  4ZHP A;  1WXQ A;  2LRU A;  3ZJV A;  3APF A;  4ARI A;  4NNJ B;  1WZ3 A;  3UGB B;  2KDE B;  2G4S A;  1XLQ A;  2D5G A;  2M56 B;  2QDF A;  4YSX B;  2CR5 A;  2KTR B;  2KDM A;  1J7A A;  4RF1 A;  1JRU A;  2C9W B;  1Y8R C;  2LGD A;  1TS4 A;  5MPO A;  1V1O A;  1YQ4 B;  2LMC A;  4KDI C;  2LGI A;  4X57 B;  3OJ3 A;  3W1Y A;  2ON8 A;  4O1N A;  4FN2 A;  4ZOH C;  4BKT A;  4KVG B;  4DWF A;  2RSU A;  2RPV A;  2K39 A;  2CJN A;  5HKH A;  3S2A A;  2HJ8 A;  2GRI A;  3MC0 B;  3B2F A;  2KJ6 A;  3HUI A;  2HTH A;  1WGH A;  5H92 C;  2MJ3 A;  2J0K A;  1E7P B;  2WWZ A;  4HRS A;  4IM0 A;  3AUL A;  2WP9 B;  2H88 B;  1K51 A;  1V1P B;  3QK0 A;  4M01 A;  2IPK D;  3TEW A;  3ZKJ C;  1KF6 B;  5L95 C;  1QOB A;  2BYT A;  1CZP A;  2MHJ A;  3ZJU A;  1E8X A;  4MSQ B;  2MEK A;  1Z5S B;  4XDC A;  4HXD A;  1C3T A;  4W9C A;  1BML C;  1VZ6 A;  1V8C A;  4OZB A;  2M1M A;  4XX5 A;  5L83 A;  3RI7 C;  4OW0 A;  2WXF A;  1T6B X;  2DEN B;  3UI3 A;  1ZPS A;  5CHW A;  1L5P A;  1RAX A;  3PV1 A;  1WGG A;  1S3S G;  1SF0 A;  2PLP A;  1TT5 B;  2MBO A;  2N1W A;  2L76 A;  5E6P A;  2DLB A;  2MBE A;  2K3U A;  5J17 A;  2O6V A;  4II3 B;  1G6J A;  2AWT A;  3I3T B;  2KTF A;  3L08 A;  2ZW0 A;  4OZA A;  4BVU C;  3NY5 A;  2N9E B;  4RM8 A;  4C7Y A;  1KLV A;  3Q69 A;  3FKY A;  4FXC A;  3DBL B;  3WAM A;  1JW9 D;  2J52 A;  3SFD B;  3GE3 C;  3RNG C;  4W9D A;  1GG3 A;  1TKG A;  4NJ7 A;  1L4Z B;  2AYO B;  3AE5 B;  3OWE B;  4WJO A;  2J53 A;  2RDB C;  1UNS A;  1IBX A;  4HCP B;  1N61 A;  1AN8 A;  1STE A;  1VR9 A;  4NQL B;  3R66 C;  2K6Q A;  3H7P B;  4ICV A;  2W54 A;  1OQQ A;  3GS2 A;  3DBH I;  1E0Z A;  2AQ1 B;  2KX0 A;  2D2Q A;  2J7Q B;  3VUY A;  1D5Z C;  3K9O B;  2FCS A;  1WGK A;  1UF0 A;  2KWU B;  2OJR A;  2JXT A;  5C23 A;  3I63 C;  1Y56 A;  5D2M B;  3VUW A;  2WGS A;  5DPT A;  2NTT A;  2BB6 A;  3KW5 B;  4MJS B;  4KX6 B;  3P4S B;  2A5U A;  1YNT E;  4WJQ A;  1N6Z A;  1AYF A;  1AW7 A;  5FR6 A;  1UWX A;  2KDI A;  3N1Y C;  4EFO A;  3CMM B;  2VZK D;  2V0G A;  2KC2 A;  4DXF A;  3VFK A;  3Q3N C;  3DVN U;  1R7S A;  1YN5 A;  1IGD A;  2LHD A;  2UU7 A;  3B2G A;  4BKS A;  4DK5 A;  1HTQ A;  3EGR A;  2IGH A;  2K0P A;  3IHP C;  5EDS A;  3DCG A;  4C56 C;  2K8C A;  1VCB A;  1E8W A;  2WXJ A;  4W9E A;  3L0W B;  4K81 A;  2JSV X;  4B0M A;  2Z0E B;  2IDY A;  4IWQ A;  2VRR B;  1UBI A;  2JVC A;  3AEB B;  4P6V F;  3PGE A;  3PO0 A;  3IAS 1;  1WX7 A;  5JXV A;  1D5X C;  2PVG C;  2ZCC A;  1WMH A;  4HVB A;  5KHQ A;  1WYG A;  1WMH B;  2W3R A;  3R2I A;  1J0G A;  4RGN A;  5AZH A;  2KYW A;  4A55 A;  3PLU A;  4E71 A;  4MGI E;  1I35 A;  1RFK A;  1WI0 A;  3AEC B;  1UH6 A;  2I1K A;  4RNA A;  1YX6 B;  2B3A A;  2NMQ A;  1ZOY B;  2OHF A;  3N20 C;  3RPF C;  2DAF A;  2G45 B;  4K1R B;  4TQ0 A;  2PPH A;  3P1M A;  5HHD G;  2WXR A;  3ZNI D;  3RT3 B;  1NYR A;  1PFD A;  4OZC A;  5C3J B;  1J7B A;  3X23 A;  4CYE A;  1P7E A;  5IAA C;  2MX2 A;  4MSM B;  4ZYN A;  1E8Z A;  3KYC D;  3TBL D;  1XF5 L;  2WDV B;  1YJI A;  4ITK A;  3Q14 C;  3B9J A;  5CTR C;  1TY0 A;  1MI0 A;  1ZGU B;  4ANU A;  2CHW A;  2CS4 A;  2WS3 B;  3V61 A;  4GMV A;  5G2N A;  2ICI A;  3PZD A;  2INN E;  1EF1 A;  3NG0 A;  2L32 A;  2PMV A;  4JE3 B;  1ENF A;  2C7M B;  3DBS A;  1L2N A;  4W9K A;  1TGZ B;  3DHG C;  1KOT A;  4IC7 B;  3UQB A;  1JML A;  4C00 A;  1E10 A;  4WWP A;  4LNI A;  4N9F 4;  5LXI B;  3APC A;  3ZQ4 A;  2BB5 A;  3BZD B;  1C78 A;  1OEY A;  3VDZ A;  2ZPN A;  2HJ1 A;  4TKN A;  5D3D A;  3W9C B;  1YJ1 A;  4LNF A;  1DOY A;  2BVC A;  1J8C A;  2L7R A;  2OJW A;  1BT0 A;  4I6L B;  1L7Y A;  2KAC A;  3A9K A;  2BPS A;  4GLS C;  3M62 B;  2XK5 A;  4GDK A;  3AE3 B;  2N0S B;  4HJG E;  5E6J A;  1WE7 A;  4US9 A;  4MM3 A;  2OED A;  3R7R A;  3TCA A;  1WXS A;  2GLS A;  4DDI D;  3A4S C;  1A70 A;  2O6V D;  1DYQ A;  4WQM A;  3DHI C;  1QT9 A;  3I5J C;  3PRZ A;  1IUE A;  2WXI A;  4AP4 C;  1MHH E;  4B6W A;  3AM9 A;  1F2R C;  1WJN A;  3U4E G;  1WJU A;  3P63 A;  1K52 A;  2MA9 B;  1TKE A;  2WU5 B;  3PHW B;  1RYJ A;  4GN1 A;  1K8R B;  3DBL I;  3PSE B;  1AWD A;  2GI9 A;  1YN3 A;  4JPS A;  4ICU A;  5CHV C;  3AI5 A;  3WAN A;  4OVZ A;  4EZK A;  3MTN B;  4KGT A;  2QJL A;  3VXW A;  3IAM 1;  3N1X C;  3OAW A;  2FAZ A;  3SU8 X;  4GXB A;  2MCN B;  1ISN A;  2K6D B;  2LXC A;  4KGR A;  4UDU C;  4WUR A;  2RDG A;  3EC8 A;  3VTW A;  4ZDV A;  2ZVN A;  1ZXI A;  3H8H A;  5KHO A;  4IKG A;  2JPH A;  2DZI A;  4JQW C;  1GPX A;  2W55 A;  3EHV A;  4C7Z A;  2RGF A;  4A9A A;  2KQS A;  4WWN A;  2O6V B;  4PYU A;  4RGT A;  3AE1 B;  2KWV B;  1FXI A;  2R2Q A;  2XNA C;  1WZ0 A;  2CJO A;  3PRP B;  4AOF A;  2XEW A;  1T3Q A;  3PVL A;  1PDX A;  2LEK A;  3ETR A;  1E7U A;  5BMH A;  2DYO A;  4AJY B;  2V3P A;  4M02 A;  1VZ7 A;  2V9H A;  1ZUD 2;  1OQR A;  1VZ8 A;  3E56 A;  4EEW A;  2GBK A;  2EEL A;  1VD2 A;  4ARC A;  1I42 A;  2Z59 B;  3LDZ E;  4YTP B;  4HEA 1;  2KMC A;  3I57 A;  2CHX A;  3AN1 A;  1FRR A;  4WH4 A;  4YTN B;  1V49 A;  2GBJ A;  3QC8 B;  4PYZ A;  4OVU A;  3C0R B;  3ZTD A;  2KNB A;  2MW5 A;  2I2Y A;  1HZ6 A;  1KLU D;  1WIA A;  1GAQ B;  5AZF A;  1MG8 A;  2D3C A;  4KKI A;  1PGB A;  2LXA A;  1V86 A;  4M0W B;  3VTU A;  4L23 A;  5BO4 B;  4FLH A;  2BS2 B;  1DOI A;  2KQ4 X;  2EMS A;  4W9I A;  2A4Z A;  1XQQ A;  3RMK C;  1TS5 A;  3H6N A;  4TQ1 A;  1UBQ A;  3AXC A;  3ZDM C;  1ZXH A;  4YTM B;  2QHO A;  2QCZ A;  3KLS X;  4NJC A;  1UD7 A;  2LUE A;  3AE4 B;  4M8N A;  2LVO A;  3VHT C;  4HPL B;  1SE4 A;  1HE8 A;  3T8M A;  1Z2M A;  3FIL A;  4FBJ B;  2UYZ B;  4NJ6 A;  1XLO A;  2M8S A;  2SEB D;  3DWM A;  1YIW A;  4A8X C;  2DZM A;  2KJR A;  4FHJ A;  4MGY E;  3BVM A;  3BK2 A;  2MP2 A;  4DXA B;  2JRH A;  3SDL C;  2KO3 A;  4E3C A;  1MPE A;  5C1Z A;  3AH7 A;  1JWB D;  2WX1 A;  3CSF A;  3W5U B;  2MWS B;  2PVO D;  4ANX A;  2M0A A;  3U7D A;  1TBE A;  5I4D A;  2JF5 A;  2ASQ A;  4KGS A;  3ONS A;  4EE2 A;  2KX3 A;  5HI1 A;  2JRI B;  1D6E C;  2N7D A;  1P98 A;  3APD A;  2NCN A;  3VRA B;  4LNO A;  5AZG A;  1FM0 D;  1NVI D;  1I4Q A;  4NQK E;  3SEB A;  3W5V B;  2M17 A;  4FAD A;  4IM3 A;  2FE8 A;  3O65 B;  2JXX A;  3UIO B;  2LZ6 A;  2QEJ C;  4MH0 E;  4RGM A;  1WRD B;  2ACZ B;  2LAS A;  1LFD A;  1V5T A;  3TSS A;  5IOI A;  2D10 A;  4GSW A;  1HEZ E;  5BYR A;  4FJY A;  3MC8 A;  3BY4 B;  4CO7 A;  2L1A A;  3V05 A;  2WXO A;  1JQ4 A;  2J0J A;  1SGH A;  2H89 B;  4WAA A;  3V62 A;  1H8C A;  2IGG A;  3A9J A;  2KN5 A;  2TSS A;  1VDV A;  5EE3 A;  4K7U A;  2W82 A;  4WAF A;  2PE6 B;  3AMZ A;  2JZP A;  3EEC A;  4URK A;  4OHJ A;  4RMA A;  3HIZ A;  2BS4 B;  1TZO A;  3M3J A;  1SE3 A;  2IO1 B;  2R2O A;  1QIL A;  2HTM E;  1RWS A;  3AEA B;  4M00 A;  2IBI B;  1S1Q B;  3H7P A;  1R4M B;  1A5R A;  2GBR A;  1I4H A;  1YOV B;  2PTL A;  1V80 A;  4HKZ E;  3ZO5 B;  1P3Q U;  4LNK A;  1TS3 A;  3QAQ A;  3NZU A;  4W9H A;  5JHB A;  2MJD A;  3A9K B;  4LDT D;  2LRW A;  2JYT A;  3QQ8 B;  1EF5 A;  1C79 A;  3WAP A;  4WJN A;  2C60 A;  4G3X B;  4NAW B;  4HCN B;  3H7S A;  1QOG A;  4A90 A;  3W1S A;  3DVG Y;  1V1P A;  3OJ4 B;  3V60 A;  2BF8 B;  2BWF A;  1UEL A;  1WM2 A;  1CQV A;  1EM7 A;  1HZ5 A;  3TMP B;  5DPW A;  1Q5W B;  2KFK A;  1OEY J;  4PS7 A;  1E5W A;  2LUM A;  2JY6 A;  2KZR A;  4J3O D;  1LGR A;  3DBH B;  2LJ5 A;  5HG2 A;  4HWI B;  1WH3 A;  2O2V A;  3PTF C;  2JQR B;  2CU1 A;  3BVG A;  3R2T A;  4XWT A;  1P9D U;  1GJZ A;  5GXG B;  4R3D A;  3ML9 A;  1QQR A;  3VH4 B;  4HDO A;  2L0F A;  3MJW A;  2L3Z A;  3Q3O C;  3KQ4 A;  2ZPY A;  2LJI A;  2IZV B;  1E90 A;  4KSL C;  5IP4 D;  3C8Y A;  3QAR A;  3ZIM A;  1NEK B;  3SR6 A;  3RNA C;  2QC8 A;  3JSV B;  2MQJ A;  1JRO A;  5D6J B;  1WWT A;  2QMT A;  3TUO A;  3N9Y C;  4W9L A;  3BVZ A;  3EFC A;  1SIF A;  2J4X A;  1JRP A;  2WXN A;  3VUX A;  2E6X A;  1EWC A;  2CHZ A;  2Y3A A;  1PUT A;  4LJO B;  2KXJ A;  2LFI A;  2FUH B;  4HDQ A;  1AAR A;  4W9F A;  3C19 A;  3ZXR A;  4MAC A;  4TUU A;  2LGS A;  4KIK A;  3Q3J A;  1M4V A;  2G3Q B;  4XZ4 A;  1SJH D;  1NI3 A;  1VRA B;  1XLN A;  4B0E A;  1IBX B;  4A3P A;  3QHT A;  1X1M A;  3U2S C;  5D7G A;  2NR2 A;  4GU2 A;  4N58 A;  2J42 A;  1R4N B;  3R8B A;  5TR5 A;  3ZDT A;  3Q3M C;  4CQN A;  3OG5 A;  4AUQ C;  3P4R B;  2AQ2 B;  4USA A;  4MJS A;  3PPA A;  5DCN A;  1IGC A;  4EKU A;  2I38 A;  1DGJ A;  2KWD A;  4FJZ A;  3X0W A;  3EFU A;  2YEP B;  2Y5C A;  2WDT B;  4IW0 A;  3ZJT A;  2VH1 A;  1D3Z A;  3NUH B;  3DBR B;  1GUA B;  1XCT L;  2JT4 B;  1GB1 A;  1LXD A;  2BTE A;  1FCL A;  2XBB C;  2M19 A;  3KUZ A;  4B9K A;  1EU4 A;  4BKG A;  1GNU A;  1QF6 A;  4HK2 A;  2LWP A;  1E6E B;  1J7C A;  2MSE D;  2DWQ A;  3FIL B;  1WGY A;  4C4V B;  1E7V A;  4P7I A;  4AS1 A;  1NI2 A;  4US8 A;  2C7N B;  3AE7 B;  1DOX A;  4MEL A;  1FNW A;  2CU3 A;  3AB5 A;  3Q3F A;  4A20 A;  4GDK B;  3GZN B;  2QIE B;  4WIP A;  2VZK B;  3DPD A;  3KUD B;  1C9F A;  3N1Z C;  4RH6 A;  1LQB A;  1OTR B;  2M4N A;  1D4B A;  2W3S A;  1JWU D;  3N32 A;  2FCM A;  1MJD A;  3DHH C;  2DZJ A;  4ZRK A;  2INC C;  3J9C A;  3B0A A;  2N7J A;  2WXQ A;  2K22 A;  5CX3 A;  3FAH A;  2KFK B;  1V5O A;  4HRO A;  1FRD A;  3BYY B;  2L05 A;  3NS8 A;  3TJP A;  4A6Q A;  3HRD D;  1QOA A;  3Q2A C;  3RFZ B;  1F0Z A;  3GZN I;  2FBW B;  2ONQ A;  4JL9 A;  4PK1 A;  3GOE A;  1XT9 B;  3B1L X;  3T9L A;  4F8C B;  4JWS C;  4MDK E;  4YL8 A;  3RNF C;  3GP7 A;  2L52 A;  2REX A;  3NOB A;  4BKS D;  3N3K B;  3AEG B;  3L54 A;  2X8X X;  4MGZ E;  4DHJ D;  2MLB A;  3PRM B;  1PYW D;  4IG7 B;  4PS3 A;  4ANW A;  1KFY B;  2WXL A;  3CST A;  2Z0D B;  3NHE B;  3SFE B;  1KM7 A;  1L0Y B;  2D07 B;  2DHZ A;  1RLF A;  2FCQ A;  2GOW A;  3CIR B;  3PZ8 A;  2BKR B;  1TZ1 A;  3EA6 A;  5CHF A;  2KC1 A;  4YWG G;  1WY8 A;  3QCA A;  4MGK E;  3HM3 A;  4HPP A;  4HPM B;  1C77 A;  3ML8 A;  4K3C A;  3P4Q B;  5C2T B;  1SSN A;  1T0S C;  1TS2 A;  2UWQ A;  3GB1 A;  3RNE C;  3U30 A;  3ZGZ A;  4N6E B;  1H4R A;  1CMX B;  1SIJ A;  3EUB 2;  3VQI A;  1OFF A;  2HDE A;  3UQA A;  4JX1 C;  1WX8 A;  3WA0 A;  4F7Z A;  2QSD A;  2BT6 A;  4RGO S;  4GOC A;  1FEH A;  4XC2 A;  2FIF A;  1ZDX A;  2BBC A;  2WXP A;  2KMM A;  2KLG A;  2DBY A;  1F1H A;  1WR1 A;  2LVQ A;  2Z8L A;  4DHJ B;  5JZE B;  2KWC A;  3RUI B;  4I6P A;  3WAO A;  1OQY A;  4KV2 A;  4DXG A;  4P1C C;  2PIA A;  4NPN A;  1WXA A;  4G11 A;  4S17 A;  1ZKH A;  4HLE A;  4M0W A;  3DOW A;  3QWZ B;  2O2V B;  3Q6B A;  1KTK A;  2NBU A;  3HVZ A;  2ZNV B;  2BQQ A;  2FUG 1;  2C5L C;  2ZJD A;  2YEP F;  2MBB B;  1QOF A;  2ZNV C;  1ESF A;  5GMV A;  3ZW3 A;  2ZVO A;  4M8M A;  1C4C A;  3DQV A;  5AUK A;  2JZZ A;  4G50 A;  1WX9 A;  3CWI A;  4GDL A;  3ZVV A;  2LVP A;  4TV3 A;  2NTS A;  2KDB A;  3L17 A;  2K1F A;  2KAJ A;  4IWO A;  5AUI A;  2MP2 B;  3NVY A;  3KUC B;  4D2K A;  4DQO C;  3R7Q A;  2NBV B;  2LGY A;  3JSV A;  3D32 A;  3JYU A;  2MRP A;  4S0R A;  1TKY A;  1F2R I;  3KWV A;  3U7Z A;  3HHM A;  3P4P B;  5G5G A;  5AEK B;  3Q8E A;  4K3B A;  4I6N B;  4KZ0 A;  2NVU I;  2WYQ A;  2V3S A;  3I9V 1;  2AL3 A;  2V1Y A;  1HXY D;  3L4P A;  1I7H A;  3PZ7 A;  1SB3 C;  2GBM A;  2L83 A;  3IG3 A;  2E3T A;  1KLG D;  2AQ3 B;  1FNU A;  2MBH A;  1Q0W B;  3L10 B;  1EUV B;  1MG4 A;  3K9P B;  1L0V B;  4NAM A;  4BZA A;  3RNC C;  2Q5W D;  4XGA B;  5FK9 C;  4HJK A;  3W1S C;  4LNN A;  1NDD A;  4W9J A;  1FFV A;  4KIK B;  1FNV A;  3A4R A;  2JX5 A;  4XYC A;  4RCO A;  1JWA D;  1JCK B;  3MC9 A;  1KRH A;  1K53 A;  2NPT B;  1GB4 A;  3VH3 B;  1WR6 E;  2D3G A;  2D3B A;  4A3O A;  1ZP0 B;  3TL5 A;  4FUL A;  3KYD D;  2N9L A;  1C76 A;  4ZRI A;  1IP9 A;  3N30 A;  2WQY B;  3HK0 A;  2OOB B;  1J19 A;  2KVZ A;  4YXD B;  1T0Q C;  2FID A;  4BAX A;  2JUO A;  2Y5P A;  3A9J B;  3LXF A;  1WJ4 A;  4GB9 A;  1QKZ A;  1L4D B;  4ZRJ A;  3O13 A;  5BMG A;  1SE2 A;  4MEM A;  4HKQ A;  1F52 A;  2GMI C;  2N1V A;  4P16 A;  3WCQ A;  1T0Y A;  2WDR B;  2KK8 A;  2KTR A;  3HVD A;  3NJT A;  1JWM D;  1L6U A;  4KZC A;  3VAW A;  4KKJ A;  4EZJ A;  5D3I B;  1PGX A;  1BXT A;  2VH2 A;  1YQB A;  2L0T A;  4TMA B;  3LJ3 A;  3KWL A;  1FFU A;  3RCZ A;  4AWJ A;  2RD0 A;  3AE6 B;  5EE0 A;  3CF6 E;  1UGM A;  4PS8 A;  3HM6 X;  3JW0 X;  3ZTC A;  3AU5 A;  4NAW A;  1WF9 A;  3TEX A;  4IM2 A;  4LTU A;  5LXH A;  1YX5 B;  3V3X A;  1FPY A;  1RM6 C;  1XD3 B;  2IO0 B;  4ANV A;  1FCC C;  4FHK A;  3AU4 A;  3BK1 A;  3MJ5 A;  1JAL A;  1FD6 A;  2RDH A;  1MHX A;  1FO4 A;  3OLM D;  3L13 A;  2RMM A;  3NZ3 A;  4GIV A;  4EOY A;  1V9J A;  1UGJ A;  1FMA D;  1ET6 A;  4G0N B;  3RNB C;  4EUT A;  3FC4 A;  1C4A A;  1I4P A;  1WYW B;  3MHZ A;  4MH8 A;  3IXS A;  4LCD E;  2N7E A;  2EKE C;  2IND C;  3TEZ A;  2KVR A;  3T3O A;  2IO3 B;  2GBN A;  1E9M A;  1L6V A;  4PT5 A;  5JH5 C;  2BYV E;  2QIL A;  1YMH E;  4REZ A;  5D94 A;  1EO6 A;  1LO5 D;  1K50 A;  1P7F A;  2KMA A;  3KVF B;  1TJE A;  3ABV B;  1FXA A;  3AED B;  4BBN F;  3QX1 A;  4LDT B;  3BWU D;  4QAY A;  3URY A;  3E9S A;  4F1S A;  4YSY B;  3BYT B;  4P1B C;  1F77 A;  2V4L A;  3LB8 C;  1BUI C;  1Q10 A;  3DWG C;  3JVZ X;  4XE0 A;  4H2A A;  2X38 A;  4ZRP A;  3AEF B;  2I1J A;  1N5W A;  1XO3 A;  2YVC A;  2IJ0 A;  2GB1 A;  4II2 B;  1TIF A;  2IGD A;  2KN4 A;  3ZNG C;  3AE9 B;  2WNM A;  4FJV B;  5H8Y E;  1WE6 A;  5LNK 1;  2EMT A;  3V6E B;  3ZYY X;  5J18 A;  2PEA A;  1HQR D;  4AQ7 A;  5FR3 A;  4DHZ E;  1M94 A;  1FXT B;  1HA5 A;  1YJJ A;  2DYB A;  1F9J A;  1ZW7 A;  2KDF B;  3ECI A;  3IBE A;  1B1Z A;  4LJP B;  4IOI E;  2G4D B;  3VR9 B;  1VLB A;  2K5P A;  1Q1O A;  5LLI A;  2IY1 B;  1PQS A;  2WHI A;  3AV8 A;  2ZEQ A;  1XCQ L;  1V81 A;  3PT2 B;  3RUL A;  5E6O A;  3NZS A;  2BKF A;  3VTV A;  3DVN V;  4WWM A;  2M0X A;  2DNF A;  1VJK A;  3IT4 B;  1TY2 A;  3RZW C;  1WXV A;  3PS6 A;  2ZZP B;  2D11 A;  2JU6 X;  4B95 A;  2BW2 A;  2PE9 A;  3KH0 A;  1WGD A;  3DDC B;  2DZK A;  3MHS D;  2INP E;  2KOX A;  2KKC A;  4RF0 A;  4Q2J A;  2N9P C;  4E74 A;  3MP9 A;  2XN9 C;  4RM9 A;  3NVZ A;  2EKI A;  2B76 B;  4JLC A;  3QA8 A;  2HE7 A;  1T5X D;  1WFY A;  3U8Z A;  3B08 A;  1I4X A;  2K8H A;  3WIM A;  4C4V A;  1WRI A;  3SD5 A;  2YLM A;  1ET9 A;  1R4M I;  3ENE A;  1XEE A;  2DX5 B;  2SAK A;  3QJZ A;  2BS3 B;  2PJH A;  4K7W A;  1NEN B;  2V3N A;  4IUM B;  1UWM A;  4GGQ A;  3RZF A;  3BII D;  1GOZ A;  4JIO U;  3NVV A;  4IDI A;  3P2B A;  1E8Y A; 
#chains in the Genus database with same CATH homology
 3GB1 A;  3BK2 A;  3SFD B;  1MPE A;  2WXM A;  3AH7 A;  1JWB D;  1TKG A;  3ZGZ A;  1SJE D;  1L4Z B;  3OWE B;  3AE5 B;  4N6E B;  2J53 A;  1JWS D;  1SIJ A;  1UNS A;  1IBX A;  3EUB 2;  3VQI A;  1N61 A;  1AN8 A;  1OFF A;  1I4G A;  1STE A;  1VR9 A;  3W5U B;  3AE8 B;  2HDE A;  1ZE3 D;  1ACC A;  1TYG B;  2PVO D;  4JX1 C;  2W54 A;  1OQQ A;  3GS2 A;  1NYQ A;  1E0Z A;  2AQ1 B;  2M0A A;  3W2D A;  5I4D A;  1YN4 A;  1D5Z C;  2QSD A;  4KGS A;  1WGK A;  2BT6 A;  4RGO S;  1FEH A;  2JXT A;  1N5X A;  1WSP A;  1ZDX A;  4EE2 A;  2BBC A;  5HI1 A;  1Y56 A;  2WXP A;  1D6E C;  2KMM A;  2NTT A;  2DBY A;  2BB6 A;  4ZHO A;  2Z8L A;  1EWY C;  4KX6 B;  3VRA B;  1FM0 D;  3P4S B;  1NVI D;  1YNT E;  5T8I A;  3P42 A;  1AYF A;  1I4Q A;  1AW7 A;  3SEB A;  4DXG A;  3W5V B;  2PIA A;  1D5M C;  1EU3 A;  1UWX A;  2FE8 A;  4M0W A;  2VZK D;  4RGM A;  1MVK A;  2QEJ C;  2ACZ B;  2V0G A;  4DXF A;  1KTK A;  5TSS A;  3TSS A;  3HVZ A;  1R7S A;  1YN5 A;  1IGD A;  2LHD A;  3B2G A;  3MFG A;  2FUG 1;  2YEP F;  3EGR A;  1HEZ E;  4ZRQ A;  1QOF A;  2IGH A;  5BYR A;  1ESF A;  2K0P A;  1C4C A;  4C56 C;  5AUK A;  4N59 A;  2L1A A;  3V05 A;  2WXO A;  4JWU C;  1JQ4 A;  1N62 A;  2WXJ A;  2JSV X;  3CWI A;  3Q8B A;  2H89 B;  4B0M A;  3AE2 B;  2IGG A;  2AX5 A;  2IDY A;  2TSS A;  2NTS A;  1VDV A;  3AEB B;  5EE3 A;  2W82 A;  4WAF A;  3AMZ A;  2JZP A;  2KAJ A;  4OHJ A;  5AUI A;  4YSZ B;  4P6V F;  2WXH A;  1UUP A;  2BS4 B;  3NVY A;  1TZO A;  4D2K A;  4DQO C;  3PO0 A;  3IAS 1;  5JXV A;  1SE3 A;  1QIL A;  1D5X C;  2HTM E;  1RWS A;  2PVG C;  3AEA B;  4TSS A;  1N60 A;  1TKY A;  1F2R I;  2ZW1 A;  3KWV A;  3U7Z A;  4NZL B;  3U52 E;  5G5H A;  3P4P B;  5G5G A;  3NRZ A;  1WYG A;  3Q8E A;  2W3R A;  1I4H A;  3R2I A;  2WDQ B;  4RGN A;  2PTL A;  4HKZ E;  2JWU A;  2JYE A;  4LLG M;  1TS3 A;  3I9V 1;  4A55 A;  1HXY D;  3L4P A;  1I7H A;  1RFK A;  1CJE A;  3AEC B;  3PZ7 A;  1SB3 C;  2MJD A;  4XWW A;  4RFB A;  2L83 A;  2JYT A;  4RNA A;  2E3T A;  5BMI A;  1C79 A;  2V4I B;  2NMQ A;  2WXG A;  1ZOY B;  1KLG D;  1FIQ A;  2OHF A;  3RPF C;  2AQ3 B;  1FNU A;  4NAW B;  1C4P A;  1SBB B;  1QOG A;  4A90 A;  1L0V B;  4NAM A;  4TQ0 A;  2WLB A;  2R61 A;  2Q5W D;  3W1S A;  3P1M A;  5FK9 C;  5HHD G;  2WXR A;  4MM3 B;  1V1P A;  1NYR A;  2WXK A;  1PFD A;  1FFV A;  3LYY A;  4OZC A;  5C3J B;  2N9K A;  1J7B A;  1CQV A;  1FNV A;  2JX5 A;  1EM7 A;  5FKA C;  1HZ5 A;  1KH0 A;  1P7E A;  4RCO A;  1JWA D;  1JCK B;  1KRH A;  1SXT A;  1K53 A;  1GB4 A;  2WU2 B;  1XF5 L;  2WDV B;  2LUM A;  1YJI A;  4ITK A;  4J3O D;  4LK0 M;  3B9J A;  1ZP0 B;  1TY0 A;  1MI0 A;  1ZDV A;  1L0X B;  3IT6 B;  5HG2 A;  2MH7 A;  2N9L A;  2JQR B;  1QLB B;  5BYS A;  1C76 A;  3BVG A;  3Q8F A;  2WQY B;  3R2T A;  1PGA A;  4XWT A;  2G9H D;  2WS3 B;  5GXG B;  2ICI A;  4YXD B;  5EE1 A;  4R3D A;  2INN E;  2L32 A;  1QQR A;  2Y5P A;  3Q8A A;  4L2Y A;  2PMV A;  3LXF A;  4YT0 B;  3NVW A;  3KQ4 A;  4JE3 B;  1ENF A;  1QKZ A;  5BYQ A;  1L4D B;  2LJI A;  4GDL B;  4XDD A;  1B9R A;  1SEB D;  1JML A;  1ROE A;  3O13 A;  5BMG A;  2K9X A;  1E10 A;  1XLP A;  5HFY A;  4MT5 A;  1SE2 A;  3C8Y A;  2MJE A;  4HKQ A;  3ZQ4 A;  2BB5 A;  1NEK B;  3AEE B;  3SR6 A;  4P16 A;  3BZD B;  1C78 A;  3WCQ A;  3VR8 B;  1N63 A;  2WDR B;  3HVD A;  1JRO A;  2PW9 A;  5D3D A;  2G1E A;  4L1B A;  3W9C B;  1JWM D;  1L6U A;  1WWT A;  2QMT A;  3NS1 A;  1I4R A;  3TUO A;  4KKJ A;  3N9Y C;  1DOY A;  3BVZ A;  2J4X A;  1JRP A;  5D3I B;  1PGX A;  1BXT A;  2WXN A;  2E6X A;  1EWC A;  2Y3A A;  2KAC A;  4GLS C;  1PUT A;  4TMA B;  2LFI A;  3Q8C A;  3KWL A;  1FFU A;  4ZYS A;  2LHE A;  2PKO A;  1V97 A;  3AE6 B;  3AE3 B;  5EE0 A;  2N0S B;  3T3N A;  4MAC A;  4HJG E;  5E6J A;  4US9 A;  2OED A;  3TEX A;  1M4V A;  1SJH D;  1NI3 A;  1VRA B;  4LTU A;  1A70 A;  1XLN A;  5EE9 A;  4B0E A;  1IBX B;  1DYQ A;  3V3X A;  1RM6 C;  1YQ3 B;  4WQM A;  4C80 A;  1QT9 A;  1FCC C;  3U2S C;  5D7G A;  1IUE A;  3BK1 A;  2WXI A;  3MJ5 A;  1JAL A;  1FD6 A;  4N58 A;  1MHH E;  2RDH A;  2J42 A;  3AM9 A;  3R8B A;  1MHX A;  1FO4 A;  1F2R C;  3U4E G;  4CQN A;  2DYM A;  3P63 A;  2RMM A;  1K52 A;  3NZ3 A;  1UGJ A;  1TKE A;  1FMA D;  1ET6 A;  2WU5 B;  3P4R B;  3TEY A;  1RYJ A;  3FC4 A;  2AQ2 B;  1C4A A;  1I4P A;  1XXG A;  3VRB B;  4USA A;  1CK1 A;  3MHZ A;  4MH8 A;  1AWD A;  3IXS A;  2GI9 A;  1YN3 A;  4JPS A;  3TEZ A;  4ZHP A;  4OVZ A;  1IGC A;  3T3O A;  2I38 A;  1DGJ A;  2KWD A;  4KGT A;  2QJL A;  3IAM 1;  1WXQ A;  3ZJV A;  4ARI A;  1E9M A;  2YEP B;  1L6V A;  2Y5C A;  4PT5 A;  3ZJT A;  2QIL A;  1YMH E;  4REZ A;  1XLQ A;  2D5G A;  3NUH B;  2M56 B;  1LO5 D;  1XCT L;  1K50 A;  1GB1 A;  1P7F A;  2BTE A;  1FCL A;  4YSX B;  2M19 A;  1EU4 A;  2KDM A;  1J7A A;  1TJE A;  3ABV B;  4KGR A;  1QF6 A;  1FXA A;  3AED B;  4UDU C;  4RF1 A;  3BWU D;  4WUR A;  1TS4 A;  2RDG A;  5MPO A;  3URY A;  1ZXI A;  1V1O A;  3E9S A;  3H8H A;  1E6E B;  4IKG A;  1YQ4 B;  1J7C A;  3BYT B;  4YSY B;  2LMC A;  1F77 A;  2DWQ A;  1GPX A;  3LB8 C;  2W55 A;  2LGI A;  1BUI C;  4C7Z A;  1Q10 A;  3FIL B;  3DWG C;  2ON8 A;  4XE0 A;  4O1N A;  4AS1 A;  4H2A A;  2X38 A;  4ZRP A;  4US8 A;  3AEF B;  4ZOH C;  4A9A A;  3AE7 B;  1DOX A;  1N5W A;  1XO3 A;  2IJ0 A;  2GB1 A;  2RPV A;  4RGT A;  3AE1 B;  2IGD A;  1FNW A;  1FXI A;  2CU3 A;  2KN4 A;  3AB5 A;  2CJN A;  2XNA C;  4GDK B;  2GRI A;  2QIE B;  3MC0 B;  3AE9 B;  2VZK B;  2WNM A;  4WIP A;  3B2F A;  2CJO A;  3HUI A;  1C9F A;  4RH6 A;  1T3Q A;  1PDX A;  5H8Y E;  5LNK 1;  2LEK A;  3ETR A;  2W3S A;  5H92 C;  2MJ3 A;  3ZYY X;  1E7P B;  1JWU D;  1HQR D;  4HRS A;  1D4B A;  4AQ7 A;  5FR3 A;  2WP9 B;  2H88 B;  5BMH A;  1K51 A;  1HA5 A;  1V1P B;  2DYO A;  1YJJ A;  3BVM A;  2V3P A;  2IPK D;  1VZ7 A;  3TEW A;  3J9C A;  1B1Z A;  1ZUD 2;  2N7J A;  2WXQ A;  2K22 A;  1OQR A;  1VZ8 A;  3E56 A;  1KF6 B;  3FAH A;  2EEL A;  4ARC A;  4IOI E;  1QOB A;  2BYT A;  3VR9 B;  1VLB A;  2K5P A;  4HEA 1;  4YTP B;  1CZP A;  4HRO A;  1FRD A;  3BYY B;  3I57 A;  3AN1 A;  1FRR A;  3AV8 A;  3ZJU A;  4WH4 A;  1XCQ L;  4YTN B;  4A6Q A;  3HRD D;  1QOA A;  2MEK A;  3RFZ B;  1F0Z A;  4XDC A;  2FBW B;  2ONQ A;  4WWM A;  1VJK A;  3IT4 B;  1BML C;  1TY2 A;  1VZ6 A;  2I2Y A;  1V8C A;  4JWS C;  1HZ6 A;  1KLU D;  1GAQ B;  4KKI A;  4OZB A;  3GP7 A;  1PGB A;  2L52 A;  2JU6 X;  2BW2 A;  4L23 A;  4OW0 A;  2WXF A;  3AEG B;  1T6B X;  2INP E;  3UI3 A;  1ZPS A;  2BS2 B;  4RF0 A;  1DOI A;  1L5P A;  1PYW D;  4Q2J A;  3MP9 A;  2XN9 C;  2KQ4 X;  3NVZ A;  2EKI A;  2B76 B;  1KFY B;  2WXL A;  1TS5 A;  4TQ1 A;  2PLP A;  1SF0 A;  3SFE B;  1T5X D;  1ZXH A;  1L0Y B;  4YTM B;  1I4X A;  3KLS X;  1WRI A;  4NJC A;  2DLB A;  3CIR B;  1ET9 A;  2K3U A;  3AE4 B;  3PZ8 A;  3EA6 A;  1SE4 A;  1XEE A;  2SAK A;  4YWG G;  3FIL A;  2BS3 B;  1NEN B;  2V3N A;  1XLO A;  1UWM A;  2SEB D;  2ZW0 A;  4OZA A;  3DWM A;  1C77 A;  4C7Y A;  4A8X C;  3Q69 A;  3BII D;  1GOZ A;  3P4Q B;  5C2T B;  3NVV A;  1SSN A;  4FXC A;  4IDI A;  1TS2 A;  1JW9 D;  2J52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...