1VJKA

Putative molybdopterin converting factor, subunit 1 from pyrococcus furiosus, pfu-562899-001
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
87
structure length
87
Chain Sequence
SVKVKVKYFARFRQLAGVDEEEIELPEGARVRDLIEEIKKRHEKFKEEVFGEGYDEDADVNIAVNGRYVSWDEELKDGDVVGVFPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Putative molybdopterin converting factor, subunit 1 from Pyrococcus furiosus, Pfu-562899-001 '
rcsb
source organism Pyrococcus furiosus
molecule tags Structural genomics, unknown function
molecule keywords molybdopterin converting factor, subunit 1
total genus 25
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2004-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1vjkA00
1FFVA 1KRHA 1TYGB 4JWUC 1N62A 2DBYA 2HTME 4C7YA 2PKOA 2MJEA 3B2FA 4WQMA 1N5WA 2BT6A 2L52A 3AE8B 1VLBA 2QIEB 2K5PA 3EUB2 4WWMA 2E3TA 1PFDA 4YSZB 2PVOD 3BIID 4FXCA 2H89B 3ETRA 1FIQA 2M19A 2CU3A 1YJIA 2WDVB 3NVZA 4C80A 4YSYB 1YJJA 3NVYA 3CIRB 5H92C 3AE6B 3AE5B 3AEGB 2OHFA 1QOFA 1AWDA 3W9CB 4ZHPA 3P4PB 1DOIA 1DGJA 1FMAD 5C3JB 4LTUA 3SFDB 3PO0A 1E10A 1J7CA 2N0SB 2WLBA 4KX6B 1QOAA 1L6UA 3SFEB 1CZPA 4ZOHC 4A9AA 2WDQB 2BS3B 2KMMA 2MJDA 2QJLA 2WDRB 1SB3C 4ZHOA 2JX5A 2PVGC 1FXAA 1QOBA 2L83A 1XLQA 2MJ3A 1N61A 1VJKA 2WP9B 4YTPB 5G5HA 3AE1B 3AMZA 5EE3A 1KF6B 1ZP0B 3AEBB 1NEKB 3W5UB 3AB5A 4US8A 2EKIA 3L4PA 2DWQA 1L5PA 1ZXIA 2KAJA 3AE2B 2Y5CA 3NVVA 1A70A 3AM9A 4YTNB 1FRDA 1YQ3B 3NRZA 5EE1A 3DWGC 1RFKA 1YQ4B 2W3SA 3HUIA 4JX1C 1WYGA 2ACZB 1WRIA 1N63A 3RPFC 3ABVB 2BS4B 3VRAB 3AECB 1E9MA 1NYRA 1J7AA 1L6VA 1ZOYB 1VDVA 2WU5B 3AN1A 2CJOA 3AE4B 1J7BA 1ZUD2 1B9RA 1EWYC 1PDXA 1WGKA 2CJNA 3AH7A 1DOYA 3P63A 4US9A 1JW9D 1TKEA 3P1MA 4N59A 5AUIA 5GXGB 1FO4A 5H8YE 3AE9B 1AYFA 2G1EA 4N58A 3SR6A 1NENB 4YTMB 1XLNA 2LEKA 1N5XA 1JRPA 2K22A 4JWSC 4C7ZA 1JWAD 2BS2B 2WS3B 2FBWB 3VR8B 3DWMA 1JQ4A 1FXIA 1QT9A 3LXFA 1JROA 2W3RA 3AE3B 3AEDB 3VRBB 1IUEA 1V97A 1E6EB 5C2TB 3CWIA 1TJEA 3P4RB 4YSXB 1RM6C 1QOGA 4YT0B 3P4QB 5EE0A 2PIAA 1OFFA 4N6EB 1PUTA 1WXQA 4HROA 1R7SA 1E0ZA 2MH7A 2WU2B 4YXDB 1SIJA 1FFUA 1JWBD 1NYQA 1KFYB 1FM0D 1TKYA 2WQYB 3B9JA 1WWTA 1T3QA 1FRRA 1CJEA 3ZYYX 1NI3A 1GAQB 2H88B 2Q5WD 1QF6A 2M56B 1RWSA 3AE7B 3HRDD 1ROEA 3KWLA 3AEEB 1QLBB 2W55A 5AUKA 3P4SB 3NVWA 3AEAB 4HRSA 4IDIA 2B76B 3LB8C 1GPXA 3AV8A 1E7PB 1UWMA 1NVID 2W54A 2AX5A 3WCQA 1JALA 3FC4A 3W5VB 5MPOA 1V8CA 1SF0A 4USAA 1DOXA 1XLOA 1N60A 4P6VF 1RYJA 1I7HA 1XO3A 3HVZA 1L0VB 2K9XA 3B2GA 3FAHA 5G5GA 5EE9A 1XLPA 1F0ZA 3AEFB 1OQRA 1OQQA 3NS1A 3VR9B 2JQRB 4ITKA 1TKGA
chains in the Genus database with same CATH superfamily
2WXRA 3ZDMC 4RFBA 3VUWA 2KWCA 4NAMA 2EELA 1UGMA 2JF5A 3A4SC 2ICIA 3VFKA 2PW9A 4HXDA 3AE5B 4K3CA 4WJOA 4FN2A 2WWZA 1QILA 2KYWA 2JYTA 3NJTA 1EM7A 4NAWB 1GB4A 3H9DA 1ZKHA 3NHEB 3LDZE 1FXAA 4JLCA 4OZBA 2O2VB 3A1QA 5G5HA 2AQ3B 1I42A 4FULA 1TTNA 3L4PA 3AE2B 3DCGA 3JYUA 3ZGZA 5HHDG 3M3JA 1FNVA 3PGEA 4BAXA 3ABVB 3L08A 1NYRA 1L6VA 2QCZA 2GBKA 2CJOA 2BTEA 1D6EC 4C4VB 1PGAA 3OJ3A 1WGDA 3PZDA 1FXIA 3BVGA 1JROA 2JWZA 1B1ZA 4Q2JA 3QQ8B 2IJ0A 2JVCA 5FR3A 4CO7A 3SU8X 2PJHA 1MVKA 3NZUA 1E90A 1PUTA 1WYWB 3PS6A 4TUUA 3HM3A 4LK0M 4A6QA 1T3QA 4X57B 1WM2A 2XK5B 3BY4B 2H88B 2LGXA 4HJGE 1SJED 1TS4A 3KWLA 2PLPA 2VRRB 2MBEA 4F1SA 2ZW0A 3GE3C 1XO3A 2DNFA 4ZYSA 2WX0A 5JH5C 2QC8A 2DZIA 2RMMA 2KMCA 4DDGD 1WE7A 2DX5B 4XGAB 4ACFA 4WWPA 2CU3A 4C80A 2OOBB 2L76A 3E56A 4ZHPA 3IG3A 1A5RA 1WSPA 2I1JA 4NY0A 4DHJD 1MFWA 1P7FA 3Q3NC 1T5XD 2WGSA 1ZDXA 4NQLB 5JXVA 2L83A 3EGRA 2D07B 5GMVA 4AP4C 2GMIC 1TZOA 1XD3B 2G4DB 3A9JA 3Q3FA 2KOXA 3RNFC 4L1BA 2KDMA 1E8YA 2ACZB 2AL6A 2L7RA 1YX6B 3NZSA 4JQWC 4XYCA 4KKIA 3ZKJC 3ZNHB 2N7EA 2RDHA 4B6WA 1NBFC 3PVLA 1Y8RC 4URKA 2J7QB 2KVRA 4HEA1 4RGTA 1X1MA 1JWAD 1TY2A 3VR8B 3DWMA 1XQQA 5DPRA 2YVCA 2BB5A 3AEDB 1ET6A 1V97A 3Q3OC 1SE4A 2LFIA 4R3DA 3DBHI 2LGDA 1NYQA 3B08A 4GMVA 4MT5A 1NI3A 1GAQB 2D11A 4DBGA 2LGSA 3W1SC 4DK5A 3AEEB 1QLBB 3PSEB 3P4SB 3C19A 3RN9C 2KZRA 4HJKA 5BMGA 2YEPF 4K7WA 2KN4A 3BVMA 5MPOA 3NG0A 1JRUA 2KWDA 1XEEA 3HVZA 1UGJA 2V3SA 4XE0A 2Z8LA 1OQQA 2LJIA 3V05A 2R2QA 2DYOA 3KUCB 1C4CA 2MX2A 4P7IA 3N20C 2G4SA 2NMQA 4K7UA 3FKYA 1I4XA 1RFAA 4LJPB 1D5ZC 4ICUA 4TKNA 4MDKE 1Q10A 2ZNVC 1UUPA 2UYZB 4EZKA 1SB3C 1JWMD 2X38A 1YN3A 1L4DB 3AMZA 1NEKB 2DWQA 1L5PA 1YX5B 4MSMB 1FRDA 2JZPA 3NRZA 3U4EG 3EHVA 1RFKA 2BYEA 5T8IA 2FNJB 2L32A 1B9RA 1YN5A 4PS3A 2I1KA 2K39A 4US9A 4WJQA 4N59A 2KDEB 5D6JB 2D3BA 3RNCC 2FE8A 2L0FA 1JRPA 4XWWA 3PRMB 1JQ4A 3APCA 3Q8EA 4ANVA 4GOCA 4AUQC 2WU2B 1WJ6A 3KH0A 2AQ2B 2Q5WD 4J6IA 4TQ1A 1UNSA 5AUKA 3TEWA 2IO3B 3MTNB 3KUDB 2AX5A 3FC4A 2IY1B 2KTRB 1SF0A 2WXGA 2YLMA 2PE9A 5G5GA 1WY8A 2HE7A 4ITKA 4JWUC 2DBYA 1YD8U 4NJCA 2JXTA 1QQRA 4MM3B 1YIWA 3BK2A 4RH6A 4WURA 4G3XB 4DXGA 3GOEA 2ASQA 4BOZB 5IA7A 2V1YA 2KDIA 1XCQL 1HA5A 2D3GA 4XDCA 1SSNA 4IG7B 1UD7A 1J7CA 1EU3A 1XXGA 3O13A 5D2MB 4A9AA 2HD5B 2Y5BB 2MJ3A 2AEHA 1VZ6A 1FNWA 1GC6A 3ML9A 2BGFA 1VRAB 2KAJA 2INNE 3PREA 1A70A 3AM9A 4YTNB 4KGRA 3PHXB 1YQ4B 3DVNU 4HPPA 2RDGA 2KDBA 4BBNF 1N63A 4EFOA 2BKFA 2NPTA 2NR2A 3RI7C 2Z59B 1ZUD2 3Q69A 2LGYA 2N9PC 3U7DA 1L0XB 2D3AA 4DWFA 5IAAC 3T3OA 2BBCA 4N58A 2SEBD 3C0RB 1OEYJ 1GJZA 4ZRPA 2L1AA 1VZ7A 1R4NB 4IM2A 2QILA 1WGHA 5CTRC 4W9IA 2R61A 4KZ0A 4P16A 1HZ5A 2AQ1B 1BT0A 4LLGM 2NS5A 4DHJB 1BUIC 3RNBC 1E0ZA 1GC7A 4ANXA 3TJPA 5L83A 3PZ8A 1IP9A 3EECA 3TBLD 2W55A 1ZE3D 5D3DA 3UF8A 3KYCD 4W9LA 3IAM1 4BVUC 2KHWB 2LI5A 2W54A 3UIOB 4GN1A 4P6VF 1T0SC 4NJ6A 2LASA 1E5WA 1TT5B 2LVQA 2LUMA 2DZMA 3UQBA 2INDC 2L8JA 1OTRB 2MJEA 3VQIA 2QIEB 1YNTE 2IO1B 2L00B 2MSED 5IOIA 1FCLA 1PFDA 4FXCA 4W9KA 2ONQA 3MC9A 3VH4B 1C4AA 2KN5A 3D32A 4KGSA 3SD5A 1QOAA 4ARCA 2KMMA 2N1VA 1MG4A 3A33B 1ZXIA 3P2BA 2XEWA 1ZW7A 3HIZA 3TSSA 1YN4A 4MGYE 4PT5A 4IUMB 2RGFA 1SIFA 3AE4B 3NY5A 3GP7A 1WXMA 1FXTB 2N1WA 5LXHA 1KM7A 2LJ5A 1L2NA 2DHZA 2CHZA 4YTMB 1JCKB 2QMTA 1V80A 2K0PA 4C7ZA 2FBWB 2JUOA 1WGRA 1J19A 2W3RA 2JY6A 3AE3B 1I4PA 3IFWB 4MEMA 4N6EB 4TQ0A 3HHMA 1V81A 4XC2A 3AXCA 1PGXA 2J52A 3TIXA 2MW5A 1D5XC 3VAWA 4BFRA 4LCDE 2CR5A 5J18A 1SJHD 3H7PA 2N9KA 1K8RB 4K3BA 4LJOB 3W5VB 4USAA 3DBHB 3N9YC 3B2GA 1UBQA 3RNGC 3A9KB 4LNOA 5LLIA 1I4HA 3Q8BA 1H8CA 1HEZE 1TYGB 2Y3AA 2C60A 2HTME 2G3QB 1N5WA 4WWMA 3H8HA 2J53A 4BKSA 1ISNA 2MBHA 2H89B 1TGZB 2C7MB 3S2AA 2WDVB 4HWIB 3WAOA 4NZLB 2GBNA 3VTWA 3QC8B 1QOFA 4FADA 5E6OA 3IXSA 5C3JB 1F77A 1L6UA 4ZOHC 2QDFA 5DCNA 1WM3A 2MJDA 2Y5PA 5JHAA 1HQRD 1VJKA 4W9HA 4KDLB 2KX3A 2MRPA 3MJ5A 1JWSD 2YEPB 3WAMA 2J0KA 1YQ3B 2IGDA 3DWGC 3IT6B 4C4VA 1WYGA 4OZCA 2FIDA 3E9SA 2VH1A 3Q14C 1J7AA 1VDVA 3AN1A 3M63B 5CHFA 4BKSD 2B3AA 4GDLA 5AUIA 2KNBA 3A9KA 2G1EA 2MWSB 4HCNB 1P9DU 3KVFB 3VVWB 3IT4B 1KJTA 1Q1OA 1IPGA 2PE6B 2KVZA 2KQ4X 2KD0A 4HROA 2LD9A 1E8WA 3ZYYX 1VR9A 4RGOS 2JYEA 2NVUI 3EA6A 3T3NA 2NTTA 2MBOA 2RDBC 4LNFA 1GPXA 4FHJA 2D10A 1JALA 3QAQA 3TMPB 5C1ZA 4KIKA 1I4GA 3U52E 3DBRI 1GB1A 2D2QA 2KQSA 3X0WA 3M62B 3VR9B 3V6CB 1IBXB 3CSFA 1BMLC 2ZZPB 1V5OA 1ZPSA 2D3CA 2VZKB 2ZW1A 2O6VD 2PVOD 3BIID 2M19A 2C9WB 4FJVB 3H7SA 3AE6B 5KHQA 3MFGA 3CMMB 4JIOU 3SFDB 4MJSA 2J0JA 4EKUA 2WDQB 2K6DB 3IAS1 4PYUA 2WP9B 2FCNA 3GZNI 1WJUA 4BBNC 2JSVX 2BF8B 4HCPB 1Q5WB 3RULA 1K50A 4RM9A 1WI0A 4KVGB 2V9HA 3T9LA 2C7NB 1FO4A 5G2NA 4LDTB 2MHJA 3I57A 1V1OA 3LXFA 3N32A 4NAWA 2KFJA 1IUEA 1MPEA 1ESFA 3P4RB 3DPDA 1QOGA 1WXQA 2BWFA 1J8CA 3N1YC 4JGHB 2JRIB 4TSSA 2Z0EB 4G50A 2K6QA 3AEAB 1TZ1A 4IWPA 2WYQA 3ZTDA 1WZ3A 3K9PB 2PPHA 3IBEA 4ARIA 1UH6A 1I7HA 4WWNA 3ZUNA 3DVGX 3FILA 3RFZB 1F0ZA 1F1HA 1V2YA 1KRHA 2OJRA 2A4ZA 3R2IA 4W9FA 5E6NA 2ZJDA 2NPTB 3RNAC 2M8SA 4GLSC 4II2B 1HTOA 4DDID 3ETRA 3QA8A 1JWUD 2UWQA 4PS7A 1I35A 2MEKA 1J0GA 4KZCA 4B0EA 3C8YA 1V9JA 2WDTB 1CMXB 3PRZA 4A3OA 2BB6A 2BPSA 1P98A 3H6NA 4W9DA 2LRWA 2JZZA 1RRBA 4MH8A 4I6PA 4RMAA 4QAYA 2W3SA 2GBRA 2UU7A 3V6EB 1WRIA 3AECB 4G0NB 5IKCM 1I4QA 1P1AA 4H2AA 4G11A 2V4IB 4JPSA 1PQSA 1C76A 1TKEA 3P1MA 4L2YA 4ZRIA 4WAAA 3V3XA 1QT9A 1Y56A 4GDLB 2M0AA 3WANA 4YT0B 4XWTA 5EE0A 3EFUA 4F7ZA 2A5UA 2MA9B 3ZNGC 4KSLC 1WWTA 1CJEA 2KC1A 1U4AA 4OVUA 4K7SA 5IO9A 3I3TB 4GDKA 3MC8A 1KOTA 2JXXA 4HRSA 4IDIA 2B76B 3LB8C 1NVID 1V1PB 2ZPYA 1YJ1A 5BMHA 2IO0B 2RR9A 5DPSA 4YWGG 2O2VA 1WXAA 3A1QB 5EE9A 2V4LA 4EEWA 3H7PB 2ON8A 1N62A 2WXMA 3IHPC 2PKOA 2KJRA 3DVNV 4D2KA 3AE8B 1LXDA 1VLBA 3VUXA 3EUB2 1T6BX 2I2YA 2KQ7A 3NVZA 3TL5A 2NBUA 2N7JA 4II3B 2W9NA 1EWCA 2DYMA 4XDDA 3H1UA 3DHIC 4LTUA 4MH0E 3GS2A 4KIKB 4WQOB 2QJLA 2PVGC 4HDQA 2J42A 1TS3A 2ZPNA 2DZKA 1ZP0B 1GG3A 1F52A 2EKIA 5DPWA 1OEYA 2Y5CA 4IM0A 5HG2A 2KWUB 4JX1C 1GOZA 4F8CB 3RPFC 1E9MA 3UGBB 3N1ZC 2JZ3B 3ECIA 2AL3A 1K52A 5AZHA 2CS4A 3RMKC 4DXFA 1UBIA 3DOWA 4M01A 1Z2MA 2R2OA 2J0MA 3ZRCA 1C9FA 1HXYD 2NTSA 4JWSC 2BS2B 2XN9C 3Q8AA 5J2RA 1STEA 3RNEC 2BVCA 3PZ7A 4RGNA 3OAWA 1S3SG 1E7VA 1KH0A 2IDYA 2PIAA 2BQQA 4CHKA 1R7SA 3DBRB 4YXDB 1SIJA 2HDEA 2IZVB 2WQYB 2KWVB 1T0YA 3I9V1 2WXHA 3QX1A 3ZDTA 3ML8A 1SGHA 3JW0X 1MI0A 3NVWA 1VD2A 4EE2A 5HKHA 2ZNVB 1UF0A 2K8HA 2WXIA 2RSUA 3ONSA 4ANUA 4LNKA 3TCAA 1KLGD 4E3CA 4RCOA 3WA0A 3B2FA 3ZNID 3Q8FA 4KKJA 1M94A 1XF5L 2PTLA 1SEBD 3WALA 1WJNA 3ZVVA 3NVYA 3PT2B 1P3QU 4WAFA 3P4PB 3OG5A 1E10A 3B1LX 2LHDA 3W1SA 4RGMA 4M0WA 2I38A 4KX6B 5HFYA 1CZPA 3PPAA 3RZFA 2BS3B 1P7EA 4ZHOA 3R66C 2RPVA 2MBBB 3TEZA 4MSQB 1TY0A 1MJDA 3N3KB 1P0RA 4TMAB 2DYBA 3L17A 3BINA 3HUIA 4WWOA 2L05A 1AW7A 1ZOYB 2WXJA 3I63C 1H4RA 1XCTL 3ENEA 4GB9A 3P42A 3QIJA 1DOYA 1UELA 5GXGB 1AYFA 3AULA 4PYZA 2CU1A 4ZRKA 1BXTA 3ZQ4A 3L54A 1QKZA 2MP2A 3APDA 3JSVA 2JU6X 5L95C 4FBJB 1TS2A 3RD2A 2KK8A 1YMHE 2MP2B 2ZCBA 4LDTD 4GGQA 2REXA 1FRRA 1ZDVA 4FJZA 4A20A 4HVBA 1YOVB 1WE6A 2ZVNA 2LVOA 2K8BA 3SHQA 3WCQA 4FHKA 3O65B 4DQOC 3QCAA 2GOWA 4GDKB 1MG8A 3ZLZA 4OVZA 2N4FA 2PEAA 4ASWC 1CK1A 2KTFA 2BT6A 2L52A 2K5PA 4HKZE 1K51A 2C5LC 4IKGA 3HK0A 4YSZB 4S0RA 5D94A 3R7QA 4NNJB 1C77A 2KKCA 4P1BC 2BW2A 4ZRQA 4IM3A 2QEJC 3BZDB 2GBMA 2OHFA 1ENFA 2HJ1A 1FPYA 3VTUA 5AZGA 2K25A 4GIVA 3ZJTA 2JX5A 1ZXHA 1N61A 1IYFA 2VZKD 2VH2A 1KF6B 2KC2A 4EOYA 1SBBB 1L0YB 4IWQA 1WX8A 3TUOA 2N9XA 1PDXA 3RT3B 1UWXA 5H8YE 2EKEC 5CHVC 3SR6A 1C78A 3NS8A 3PTFC 2WS3B 1FNUA 3ZO5B 2XBBC 2LXAA 3UINB 5LNK1 4AS1A 1F2RC 5KHOA 3QHTA 5BMIA 1QF6A 3Q8CA 3U8ZA 3JVZX 1WXVA 1EUVB 3AV8A 2GBJA 3GB1A 4TV3A 5TSSA 4REZA 3RUIB 4GU2A 1NI2A 4WIPA 1RYJA 1QZEA 1R4MB 3QK0A 2KT7A 2Z0DB 3PLUA 1WRDB 3HVDA 3DBLI 1TKGA 2G9HD 5EDSA 5C23A 1N6ZA 1TBEA 3R8BA 4M0WB 1K53A 2IO2B 1FIQA 4W9JA 3RCZA 1MHXA 1YJJA 2LGIA 4CQNA 5TR5A 1OQYA 4I6NB 4A8XC 2KJ6A 4ICVA 1FMAD 2DLBA 1PYWD 3PO0A 3LJ3A 1ZGUB 2WXOA 4IW0A 3BWUD 2WLBA 3V61A 4W9GA 3SFEB 2KTRA 4RF1A 2N9EB 2CHWA 3MHSD 3TEYA 2K3UA 1SXTA 4XX5A 3ZJVA 3AB5A 2IY0B 2KMAA 2K1FA 1WGYA 3VH3B 3ZW3A 1ET9A 4KGTA 1C4PA 3WIMA 4K1RB 3KUZA 1WXSA 2DENB 2KJHB 4RNAA 2CJNA 3AH7A 2KFKA 2KLCA 4ZYNA 1SE2A 4RM8A 2LMCA 2WNMA 3PLVA 3APFA 4HPMB 1GUAB 1E6EB 1TJEA 1RM6C 3DBLB 3Q6BA 3N30A 3DBSA 2N7DA 1UZXB 4W9EA 2LWPA 2NBVB 5JHBA 4P1CC 3AE7B 4NJ7A 2GLSA 3HRDD 2O6VB 4K81A 1WR6E 3UI3A 5IP4D 3BYYB 3PRPB 3W1YA 1IGCA 1RAXA 2KX0A 2KXJA 2EMSA 4FLHA 4DHZB 2LUEA 4HPLB 3OWEB 4KV2A 1T0RC 4MGIE 2JWUA 1L4ZB 3UIPB 3AEFB 4RF0A 5EE3A 2M17A 5HI1A 3A9JB 2RPQA 4L23A 3LYYA 2JPHA 1F2RI 4HDOA 4A90A 3ZJUA 3CIRB 5BO4B 4O1NA 3MHZA 2FIFA 4ZRJA 2M1MA 4C00A 1GNUA 2NCNA 3VXWA 2QSDA 4AJYB 3MJWA 3KWVA 2E6XA 3L0WB 3R3MA 2LRUA 3R7RA 3TEXA 2KO3A 2BYTA 1Q0WB 3NZ3A 2FCQA 3VUYA 2KFKB 3VRAB 5BYSA 1KTKA 4WH4A 1D5MC 4E74A 1PGBA 1WFYA 1V6EA 3KYDD 3I5JC 2FAZA 1DYQA 3BVZA 3GE8C 1N5XA 4E71A 4GSWA 2WXLA 3FILB 2K8CA 3QWZB 3CSTA 4MM3A 2O6VA 4KSKC 5D7GA 4KDIC 4M02A 3P4QB 1SE3A 4FA6A 3EFCA 2BYFA 1FFUA 1JWBD 1TKYA 1KFYB 4YSYB 3B9JA 4B0MA 1XT9B 1WH3A 3A4RA 2M56B 4JE3B 3MP9A 1HE8A 1AARA 1E7PB 3MC0B 2KACA 1OGWA 2BYVE 3QARA 1NDDA 3NOBA 1XLPA 4MACA 1OQRA 2JQRB 4LNIA 1FFVA 4EUTA 3WAPA 4DHZE 2GRIA 2E3TA 3KLSX 1LQBA 2GB1A 4MJSB 3EC8A 3KQ4A 1YJIA 2WX1A 1FD6A 5CHWA 3ZNZB 1LO5D 1VCBA 4W9CA 4B9KA 4AJWA 1DGJA 4M8NA 3GZNB 5G55A 2N0SB 3U30A 4B95A 2JRHA 3V62A 1R4NI 1CQVA 5AEKB 4YTPB 5FR6A 2IGHA 3Q2AC 2V3PA 3W5UB 2XK5A 1L7YA 2MLBA 3OLMD 3L13A 2V0GA 2BS4B 3OJ4B 3RZWC 2QHOA 3SDLC 1FCCC 1EWYC 2W82A 3RYTA 1WF9A 1JMLA 2L0TA 4BOSC 3AI5A 1NENB 2HTHA 2IYDB 4CYEA 1IBXA 2LEKA 1WMHA 2INCC 1LGRA 1HZ6A 1E7UA 3ZTCA 4BKGA 4OVVA 3N1XC 2OJWA 4MELA 4YSXB 3HM6X 2IBIB 2LHEA 1OFFA 3AU5A 1S1QB 4N9F4 4NQKE 1WJ4A 2WXQA 1V1PA 4PK1A 4M00A 1RWSA 3L16A 5FKAC 2KDFB 2AYOB 1M4VA 4A3PA 4BZAA 5BYRA 3VDZA 1V8CA 1EF5A 1XLOA 1HTQA 1N60A 1C1YB 1RLFA 1L0VB 1E8XA 2PMVA 3FAHA 3T8MA 3IVFA 2XNAC 3PV1A 5E6JA 1KLVA 4IC7B 2NBWB 4WQMA 4JL9A 1KLUD 3BK1A 2EMTA 5D3IB 4IOIE 1EU4A 3DDCB 1TIFA 1R4MI 3Q3JA 1C3TA 1AN8A 2FUG1 4UDUC 1AWDA 3R2TA 3W9CB 3PHWB 3ZIMA 5E6PA 1DOIA 2RD0A 3J9CA 4GXBA 1LM8B 2WDRB 1WIAA 1XLQA 2IGGA 4M8MA 2KANA 2N9LA 2TSSA 3AEBB 4EZLA 4US8A 1V86A 2FCMA 3M95A 3NVVA 2LZ6A 5EE1A 2J4XA 3AU4A 2FUHB 4ZDVA 2WU5B 1WZ0A 4A55A 1TS5A 1WGKA 3K9OB 2MQJA 5CX3A 1V5TA 1JW9D 3JSVB 2OEDA 2GI9A 3ZXVA 4HK2A 1D3ZA 1F9JA 2DAFA 4NPNA 4BKTA 4OHJA 3VRBB 2KLGA 5FK9C 5C2TB 4AWJA 1WR1A 3UQAA 3DVGY 1EF1A 4AOFA 2SAKA 2CKHB 4PS8A 1WX7A 3DHGC 4OW0A 2DZJA 3U7ZA 1UWMA 4LNNA 1FEHA 3ALBA 1DOXA 2V3NA 2AWTA 3QJZA 5I4DA 4I6LB 1SE9A 2ZVOA 2ZEQA 5BYQA 3ZRFA 4HKQA 4MGZE 4YL8A 3L10B 4C7YA 3B0AA 5AZFA 3ZXRA 2MBQA 2ZCCA 2JT4B 2DAJA 3NUHB 1E8ZA 2G45B 3V60A 3URYA 4EZJA 4C56C 4J3OD 3Q3MC 2FCSA 5H92C 3AEGB 2WHIA 2X8XX 4OZAA 2L3ZA 2M0XA 4WJNA 2MCNB 3KW5B 3CF6E 1Z5SB 1YQBA 1QOBA 4DXAB 1D4BA 2M4NA 3AE1B 2LVPA 1LFDA 1V49A 3U2SC 4S17A 3BYTB 4FJYA 2IPKD 2WXPA 4MGKE 4XZ4A 3X23A 5J17A 4HLEA 1J7BA 1WMHB 5JZEB 2D5GA 3P63A 2BWES 4AQ7A 3AE9B 4ANWA 1XLNA 3W2DA 1ACCA 2K22A 1WX9A 1C79A 2INPE 5LXIB 3CWIA 2HJ8A 2WXFA 1EO6A 3VTVA 2WXNA 2C7HA 2BKRB 2MH7A 1FM0D 5DPTA 4WJPA 3VHTC 2LXCA 1IGDA 3DHHC 1ROEA 1WGGA 1G6JA 3DQVA 2WXKA 1MHHE 1I4RA 1VZ8A 4IWOA 3SEBA 5IN7A 2K9XA 2CHXA 3NS1A 1T0QC
chains in the Genus database with same CATH topology
2ON8A 2WXRA 5HI1A 1N62A 2WXMA 2PKOA 2MJEA 4RFBA 3VQIA 4D2KA 3AE8B 1VLBA 2QIEB 3EUB2 1YNTE 4NAMA 4L23A 2EELA 3LYYA 1FCLA 1PFDA 1T6BX 2I2YA 4FXCA 1F2RI 4A90A 2ICIA 3ZJUA 3NVZA 2PW9A 2ONQA 3CIRB 3AE5B 2N7JA 1EWCA 2DYMA 4XDDA 4O1NA 3MHZA 1C4AA 4LTUA 4KGSA 1QILA 1GB4A 2JYTA 1EM7A 4NAWB 1QOAA 3GS2A 4ARCA 2KMMA 2QJLA 2QSDA 2PVGC 1FXAA 4OZBA 2J42A 1TS3A 3KWVA 5G5HA 2AQ3B 2E6XA 1ZP0B 2EKIA 3L4PA 1ZXIA 3TEXA 3AE2B 2Y5CA 2BYTA 5HG2A 3NZ3A 4JX1C 3ZGZA 5HHDG 3TSSA 1GOZA 1FNVA 1YN4A 3RPFC 3ABVB 3VRAB 5BYSA 1E9MA 4PT5A 1NYRA 1L6VA 1KTKA 2CJOA 3AE4B 3GP7A 4WH4A 2BTEA 1D5MC 1K52A 1D6EC 1PGAA 4DXFA 1PGBA 4YTMB 1DYQA 3BVZA 1JCKB 2QMTA 1C9FA 1HXYD 1N5XA 2K0PA 2NTSA 4JWSC 2WXLA 2BS2B 3FILB 4C7ZA 2FBWB 1FXIA 3BVGA 2XN9C 3Q8AA 1JROA 2W3RA 3AE3B 1STEA 1B1ZA 4Q2JA 3PZ7A 1I4PA 4RGNA 5D7GA 2IJ0A 5FR3A 1KH0A 2IDYA 1SE3A 1MVKA 2PIAA 3P4QB 4N6EB 4TQ0A 1PUTA 1R7SA 4YXDB 1SIJA 1FFUA 1JWBD 1TKYA 1KFYB 2HDEA 2WQYB 3B9JA 4LK0M 4YSYB 1T3QA 4A6QA 4B0MA 3I9V1 1PGXA 2WXHA 2H88B 2J52A 2M56B 4HJGE 4JE3B 1SJED 1TS4A 3KWLA 3MP9A 1D5XC 1MI0A 3NVWA 2PLPA 1E7PB 1SJHD 3MC0B 2KACA 2N9KA 2ZW0A 3W5VB 4EE2A 4USAA 1XO3A 2WXIA 3N9YC 3B2GA 4ZYSA 1XLPA 4MACA 1I4HA 1OQRA 2JQRB 1KLGD 3Q8BA 1FFVA 1HEZE 1TYGB 2Y3AA 2RMMA 4RCOA 2HTME 3B2FA 1N5WA 2GRIA 3Q8FA 4WWMA 3H8HA 2E3TA 3KLSX 4KKJA 2J53A 2GB1A 2H89B 1XF5L 2PTLA 3KQ4A 1SEBD 2CU3A 1YJIA 2WDVB 1FD6A 4C80A 3NVYA 4NZLB 1LO5D 1QOFA 3E56A 4ZHPA 4WAFA 3P4PB 1WSPA 1DGJA 3IXSA 5C3JB 1E10A 2LHDA 3W1SA 4RGMA 1F77A 1P7FA 4M0WA 2N0SB 1T5XD 2I38A 4KX6B 5HFYA 1L6UA 1CZPA 4ZOHC 2BS3B 1ZDXA 2MJDA 2Y5PA 1CQVA 1P7EA 4ZHOA 2RPVA 2L83A 3EGRA 1HQRD 4YTPB 1VJKA 2IGHA 5JXVA 3TEZA 3MJ5A 1TY0A 1JWSD 1TZOA 2YEPB 2V3PA 3W5UB 4TMAB 1YQ3B 2IGDA 3DWGC 3IT6B 3HUIA 1WYGA 4OZCA 4L1BA 2KDMA 2ACZB 3E9SA 2V0GA 2BS4B 1AW7A 1J7AA 1ZOYB 1VDVA 3AN1A 2WXJA 1FCCC 4KKIA 1EWYC 1XCTL 2RDHA 3P42A 2W82A 1JMLA 1DOYA 5AUIA 5GXGB 1AYFA 2G1EA 4HEA1 1NENB 4RGTA 1IBXA 2LEKA 1BXTA 3ZQ4A 1JWAD 1TY2A 3VR8B 3DWMA 3IT4B 1QKZA 2BB5A 1HZ6A 2JU6X 1ET6A 3AEDB 1V97A 1TS2A 1SE4A 2KQ4X 2LFIA 4YSXB 2LHEA 4R3DA 1YMHE 1OFFA 4HROA 2WXQA 1V1PA 1NYQA 4MT5A 3ZYYX 1FRRA 1VR9A 1ZDVA 1NI3A 2JYEA 4RGOS 1GAQB 1RWSA 3EA6A 3T3NA 2NTTA 3AEEB 1QLBB 5FKAC 3P4SB 1M4VA 1GPXA 5BMGA 2YEPF 3WCQA 2KN4A 1JALA 3BVMA 5BYRA 5MPOA 1I4GA 1V8CA 3U52E 2KWDA 1XLOA 1N60A 1XEEA 4DQOC 1GB1A 3HVZA 1L0VB 1UGJA 2PMVA 3FAHA 4XE0A 4GDKB 2XNAC 2Z8LA 1OQQA 3VR9B 2LJIA 3V05A 1IBXB 5E6JA 4OVZA 2DYOA 4WQMA 1CK1A 2BT6A 2L52A 1BMLC 1KLUD 1C4CA 1ZPSA 2K5PA 4HKZE 2VZKB 1K51A 2ZW1A 4IKGA 3BK1A 5D3IB 2NMQA 4YSZB 2PVOD 3BIID 1EU4A 4IOIE 1I4XA 2M19A 1C77A 4ZRQA 2BW2A 1AN8A 1D5ZC 2QEJC 3AE6B 2FUG1 3BZDB 2OHFA 3MFGA 4UDUC 1AWDA 3R2TA 3W9CB 1ENFA 1DOIA 1Q10A 3SFDB 3J9CA 1UUPA 3ZJTA 2WDQB 3IAS1 2WDRB 1SB3C 2JX5A 1JWMD 1ZXHA 2X38A 1XLQA 2WP9B 1N61A 2IGGA 2VZKD 1YN3A 1L4DB 2N9LA 3AMZA 2JSVX 1KF6B 2TSSA 3AEBB 1NEKB 4US8A 2DWQA 1L5PA 3NVVA 1FRDA 2JZPA 3NRZA 1SBBB 5EE1A 3U4EG 1RFKA 1L0YB 2J4XA 5T8IA 3TUOA 1K50A 2WU5B 4A55A 2L32A 1B9RA 1YN5A 1PDXA 1TS5A 1WGKA 4US9A 1FO4A 1JW9D 4N59A 1UWXA 2OEDA 5H8YE 3SR6A 1C78A 2GI9A 2FE8A 1JRPA 4XWWA 2WS3B 1FNUA 1JQ4A 3I57A 1V1OA 3Q8EA 3LXFA 5LNK1 4OHJA 3VRBB 1IUEA 5FK9C 5C2TB 1MPEA 1ESFA 3P4RB 4AS1A 1QOGA 1F2RC 1WXQA 2WU2B 2SAKA 4OW0A 2AQ2B 5BMIA 2Q5WD 1QF6A 3Q8CA 4TSSA 4TQ1A 1UNSA 5AUKA 3TEWA 3U7ZA 3AEAB 3AV8A 1UWMA 3GB1A 5TSSA 1FEHA 2AX5A 4REZA 3FC4A 1DOXA 1SF0A 2WXGA 2V3NA 4ARIA 4WIPA 1RYJA 1I7HA 5I4DA 5G5GA 3FILA 3RFZB 1F0ZA 3HVDA 4ITKA 1TKGA 5BYQA 4HKQA 2G9HD 1KRHA 4JWUC 2DBYA 3R2IA 4C7YA 4NJCA 2JXTA 3R8BA 1QQRA 4MM3B 3NUHB 3BK2A 4RH6A 3URYA 4GLSC 1K53A 4WURA 4C56C 4J3OD 3ETRA 1FIQA 4DXGA 1JWUD 1MHXA 1YJJA 2MEKA 2LGIA 5H92C 4CQNA 3AEGB 1XCQL 4B0EA 1HA5A 4OZAA 4A8XC 3C8YA 4XDCA 1FMAD 2DLBA 1PYWD 1SSNA 3PO0A 2WXOA 1J7CA 1EU3A 1XXGA 2WLBA 3BWUD 3O13A 3SFEB 4RF1A 4A9AA 2BB6A 1QOBA 2MJ3A 3TEYA 2K3UA 1SXTA 1D4BA 3AE1B 1VZ6A 3ZJVA 1FNWA 3AB5A 1VRAB 2KAJA 2INNE 3U2SC 1A70A 3AM9A 4YTNB 4MH8A 4KGRA 1YQ4B 2W3SA 3BYTB 2RDGA 1ET9A 1WRIA 2IPKD 2WXPA 1N63A 1C4PA 4KGTA 3AECB 1I4QA 1J7BA 1ZUD2 4RNAA 4H2AA 3Q69A 2V4IB 4JPSA 2CJNA 1L0XB 3AH7A 2D5GA 3P63A 1C76A 1TKEA 3P1MA 4L2YA 4AQ7A 3AE9B 3T3OA 2BBCA 4N58A 1SE2A 2SEBD 1XLNA 2LMCA 1ACCA 3W2DA 2WNMA 2K22A 4ZRPA 3V3XA 2L1AA 1VZ7A 1QT9A 1C79A 2QILA 1Y56A 2R61A 4GDLB 4P16A 2INPE 1E6EB 2M0AA 3CWIA 1HZ5A 1TJEA 2AQ1B 1RM6C 4YT0B 2WXFA 4LLGM 4XWTA 2WXNA 5EE0A 1BUIC 1E0ZA 2MH7A 1FM0D 1WWTA 1CJEA 3PZ8A 1IGDA 3AE7B 3HRDD 1ROEA 3UI3A 2W55A 1ZE3D 3BYYB 5D3DA 4HRSA 4IDIA 2WXKA 3IAM1 2B76B 1IGCA 1MHHE 3LB8C 1I4RA 1NVID 1VZ8A 2W54A 1V1PB 5BMHA 4P6VF 3SEBA 3OWEB 2K9XA 4YWGG 5EE9A 2JWUA 1L4ZB 3AEFB 3NS1A 4RF0A 2LUMA 5EE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FFV A;  1KRH A;  1TYG B;  4JWU C;  1N62 A;  2DBY A;  2HTM E;  4C7Y A;  2PKO A;  2MJE A;  3B2F A;  4WQM A;  1N5W A;  2BT6 A;  2L52 A;  3AE8 B;  1VLB A;  2QIE B;  2K5P A;  3EUB 2;  4WWM A;  2E3T A;  1PFD A;  4YSZ B;  2PVO D;  3BII D;  4FXC A;  2H89 B;  3ETR A;  1FIQ A;  2M19 A;  2CU3 A;  1YJI A;  2WDV B;  3NVZ A;  4C80 A;  4YSY B;  1YJJ A;  3NVY A;  3CIR B;  5H92 C;  3AE6 B;  3AE5 B;  3AEG B;  2OHF A;  1QOF A;  1AWD A;  3W9C B;  4ZHP A;  3P4P B;  1DOI A;  1DGJ A;  1FMA D;  5C3J B;  4LTU A;  3SFD B;  3PO0 A;  1E10 A;  1J7C A;  2N0S B;  2WLB A;  4KX6 B;  1QOA A;  1L6U A;  3SFE B;  1CZP A;  4ZOH C;  4A9A A;  2WDQ B;  2BS3 B;  2KMM A;  2MJD A;  2QJL A;  2WDR B;  1SB3 C;  4ZHO A;  2JX5 A;  2PVG C;  1FXA A;  1QOB A;  2L83 A;  1XLQ A;  2MJ3 A;  1N61 A;  1VJK A;  2WP9 B;  4YTP B;  5G5H A;  3AE1 B;  3AMZ A;  5EE3 A;  1KF6 B;  1ZP0 B;  3AEB B;  1NEK B;  3W5U B;  3AB5 A;  4US8 A;  2EKI A;  3L4P A;  2DWQ A;  1L5P A;  1ZXI A;  2KAJ A;  3AE2 B;  2Y5C A;  3NVV A;  1A70 A;  3AM9 A;  4YTN B;  1FRD A;  1YQ3 B;  3NRZ A;  5EE1 A;  3DWG C;  1RFK A;  1YQ4 B;  2W3S A;  3HUI A;  4JX1 C;  1WYG A;  2ACZ B;  1WRI A;  1N63 A;  3RPF C;  3ABV B;  2BS4 B;  3VRA B;  3AEC B;  1E9M A;  1NYR A;  1J7A A;  1L6V A;  1ZOY B;  1VDV A;  2WU5 B;  3AN1 A;  2CJO A;  3AE4 B;  1J7B A;  1ZUD 2;  1B9R A;  1EWY C;  1PDX A;  1WGK A;  2CJN A;  3AH7 A;  1DOY A;  3P63 A;  4US9 A;  1JW9 D;  1TKE A;  3P1M A;  4N59 A;  5AUI A;  5GXG B;  1FO4 A;  5H8Y E;  3AE9 B;  1AYF A;  2G1E A;  4N58 A;  3SR6 A;  1NEN B;  4YTM B;  1XLN A;  2LEK A;  1N5X A;  1JRP A;  2K22 A;  4JWS C;  4C7Z A;  1JWA D;  2BS2 B;  2WS3 B;  2FBW B;  3VR8 B;  3DWM A;  1JQ4 A;  1FXI A;  1QT9 A;  3LXF A;  1JRO A;  2W3R A;  3AE3 B;  3AED B;  3VRB B;  1IUE A;  1V97 A;  1E6E B;  5C2T B;  3CWI A;  1TJE A;  3P4R B;  4YSX B;  1RM6 C;  1QOG A;  4YT0 B;  3P4Q B;  5EE0 A;  2PIA A;  1OFF A;  4N6E B;  1PUT A;  1WXQ A;  4HRO A;  1R7S A;  1E0Z A;  2MH7 A;  2WU2 B;  4YXD B;  1SIJ A;  1FFU A;  1JWB D;  1NYQ A;  1KFY B;  1FM0 D;  1TKY A;  2WQY B;  3B9J A;  1WWT A;  1T3Q A;  1FRR A;  1CJE A;  3ZYY X;  1NI3 A;  1GAQ B;  2H88 B;  2Q5W D;  1QF6 A;  2M56 B;  1RWS A;  3AE7 B;  3HRD D;  1ROE A;  3KWL A;  3AEE B;  1QLB B;  2W55 A;  5AUK A;  3P4S B;  3NVW A;  3AEA B;  4HRS A;  4IDI A;  2B76 B;  3LB8 C;  1GPX A;  3AV8 A;  1E7P B;  1UWM A;  1NVI D;  2W54 A;  2AX5 A;  3WCQ A;  1JAL A;  3FC4 A;  3W5V B;  5MPO A;  1V8C A;  1SF0 A;  4USA A;  1DOX A;  1XLO A;  1N60 A;  4P6V F;  1RYJ A;  1I7H A;  1XO3 A;  3HVZ A;  1L0V B;  2K9X A;  3B2G A;  3FAH A;  5G5G A;  5EE9 A;  1XLP A;  1F0Z A;  3AEF B;  1OQR A;  1OQQ A;  3NS1 A;  3VR9 B;  2JQR B;  4ITK A;  1TKG A; 
#chains in the Genus database with same CATH topology
 2WXR A;  3ZDM C;  4RFB A;  3VUW A;  2KWC A;  4NAM A;  2EEL A;  1UGM A;  2JF5 A;  3A4S C;  2ICI A;  3VFK A;  2PW9 A;  4HXD A;  3AE5 B;  4K3C A;  4WJO A;  4FN2 A;  2WWZ A;  1QIL A;  2KYW A;  2JYT A;  3NJT A;  1EM7 A;  4NAW B;  1GB4 A;  3H9D A;  1ZKH A;  3NHE B;  3LDZ E;  1FXA A;  4JLC A;  4OZB A;  2O2V B;  3A1Q A;  5G5H A;  2AQ3 B;  1I42 A;  4FUL A;  1TTN A;  3L4P A;  3AE2 B;  3DCG A;  3JYU A;  3ZGZ A;  5HHD G;  3M3J A;  1FNV A;  3PGE A;  4BAX A;  3ABV B;  3L08 A;  1NYR A;  1L6V A;  2QCZ A;  2GBK A;  2CJO A;  2BTE A;  1D6E C;  4C4V B;  1PGA A;  3OJ3 A;  1WGD A;  3PZD A;  1FXI A;  3BVG A;  1JRO A;  2JWZ A;  1B1Z A;  4Q2J A;  3QQ8 B;  2IJ0 A;  2JVC A;  5FR3 A;  4CO7 A;  3SU8 X;  2PJH A;  1MVK A;  3NZU A;  1E90 A;  1PUT A;  1WYW B;  3PS6 A;  4TUU A;  3HM3 A;  4LK0 M;  4A6Q A;  1T3Q A;  4X57 B;  1WM2 A;  2XK5 B;  3BY4 B;  2H88 B;  2LGX A;  4HJG E;  1SJE D;  1TS4 A;  3KWL A;  2PLP A;  2VRR B;  2MBE A;  4F1S A;  2ZW0 A;  3GE3 C;  1XO3 A;  2DNF A;  4ZYS A;  2WX0 A;  5JH5 C;  2QC8 A;  2DZI A;  2RMM A;  2KMC A;  4DDG D;  1WE7 A;  2DX5 B;  4XGA B;  4ACF A;  4WWP A;  2CU3 A;  4C80 A;  2OOB B;  2L76 A;  3E56 A;  4ZHP A;  3IG3 A;  1A5R A;  1WSP A;  2I1J A;  4NY0 A;  4DHJ D;  1MFW A;  1P7F A;  3Q3N C;  1T5X D;  2WGS A;  1ZDX A;  4NQL B;  5JXV A;  2L83 A;  3EGR A;  2D07 B;  5GMV A;  4AP4 C;  2GMI C;  1TZO A;  1XD3 B;  2G4D B;  3A9J A;  3Q3F A;  2KOX A;  3RNF C;  4L1B A;  2KDM A;  1E8Y A;  2ACZ B;  2AL6 A;  2L7R A;  1YX6 B;  3NZS A;  4JQW C;  4XYC A;  4KKI A;  3ZKJ C;  3ZNH B;  2N7E A;  2RDH A;  4B6W A;  1NBF C;  3PVL A;  1Y8R C;  4URK A;  2J7Q B;  2KVR A;  4HEA 1;  4RGT A;  1X1M A;  1JWA D;  1TY2 A;  3VR8 B;  3DWM A;  1XQQ A;  5DPR A;  2YVC A;  2BB5 A;  3AED B;  1ET6 A;  1V97 A;  3Q3O C;  1SE4 A;  2LFI A;  4R3D A;  3DBH I;  2LGD A;  1NYQ A;  3B08 A;  4GMV A;  4MT5 A;  1NI3 A;  1GAQ B;  2D11 A;  4DBG A;  2LGS A;  3W1S C;  4DK5 A;  3AEE B;  1QLB B;  3PSE B;  3P4S B;  3C19 A;  3RN9 C;  2KZR A;  4HJK A;  5BMG A;  2YEP F;  4K7W A;  2KN4 A;  3BVM A;  5MPO A;  3NG0 A;  1JRU A;  2KWD A;  1XEE A;  3HVZ A;  1UGJ A;  2V3S A;  4XE0 A;  2Z8L A;  1OQQ A;  2LJI A;  3V05 A;  2R2Q A;  2DYO A;  3KUC B;  1C4C A;  2MX2 A;  4P7I A;  3N20 C;  2G4S A;  2NMQ A;  4K7U A;  3FKY A;  1I4X A;  1RFA A;  4LJP B;  1D5Z C;  4ICU A;  4TKN A;  4MDK E;  1Q10 A;  2ZNV C;  1UUP A;  2UYZ B;  4EZK A;  1SB3 C;  1JWM D;  2X38 A;  1YN3 A;  1L4D B;  3AMZ A;  1NEK B;  2DWQ A;  1L5P A;  1YX5 B;  4MSM B;  1FRD A;  2JZP A;  3NRZ A;  3U4E G;  3EHV A;  1RFK A;  2BYE A;  5T8I A;  2FNJ B;  2L32 A;  1B9R A;  1YN5 A;  4PS3 A;  2I1K A;  2K39 A;  4US9 A;  4WJQ A;  4N59 A;  2KDE B;  5D6J B;  2D3B A;  3RNC C;  2FE8 A;  2L0F A;  1JRP A;  4XWW A;  3PRM B;  1JQ4 A;  3APC A;  3Q8E A;  4ANV A;  4GOC A;  4AUQ C;  2WU2 B;  1WJ6 A;  3KH0 A;  2AQ2 B;  2Q5W D;  4J6I A;  4TQ1 A;  1UNS A;  5AUK A;  3TEW A;  2IO3 B;  3MTN B;  3KUD B;  2AX5 A;  3FC4 A;  2IY1 B;  2KTR B;  1SF0 A;  2WXG A;  2YLM A;  2PE9 A;  5G5G A;  1WY8 A;  2HE7 A;  4ITK A;  4JWU C;  2DBY A;  1YD8 U;  4NJC A;  2JXT A;  1QQR A;  4MM3 B;  1YIW A;  3BK2 A;  4RH6 A;  4WUR A;  4G3X B;  4DXG A;  3GOE A;  2ASQ A;  4BOZ B;  5IA7 A;  2V1Y A;  2KDI A;  1XCQ L;  1HA5 A;  2D3G A;  4XDC A;  1SSN A;  4IG7 B;  1UD7 A;  1J7C A;  1EU3 A;  1XXG A;  3O13 A;  5D2M B;  4A9A A;  2HD5 B;  2Y5B B;  2MJ3 A;  2AEH A;  1VZ6 A;  1FNW A;  1GC6 A;  3ML9 A;  2BGF A;  1VRA B;  2KAJ A;  2INN E;  3PRE A;  1A70 A;  3AM9 A;  4YTN B;  4KGR A;  3PHX B;  1YQ4 B;  3DVN U;  4HPP A;  2RDG A;  2KDB A;  4BBN F;  1N63 A;  4EFO A;  2BKF A;  2NPT A;  2NR2 A;  3RI7 C;  2Z59 B;  1ZUD 2;  3Q69 A;  2LGY A;  2N9P C;  3U7D A;  1L0X B;  2D3A A;  4DWF A;  5IAA C;  3T3O A;  2BBC A;  4N58 A;  2SEB D;  3C0R B;  1OEY J;  1GJZ A;  4ZRP A;  2L1A A;  1VZ7 A;  1R4N B;  4IM2 A;  2QIL A;  1WGH A;  5CTR C;  4W9I A;  2R61 A;  4KZ0 A;  4P16 A;  1HZ5 A;  2AQ1 B;  1BT0 A;  4LLG M;  2NS5 A;  4DHJ B;  1BUI C;  3RNB C;  1E0Z A;  1GC7 A;  4ANX A;  3TJP A;  5L83 A;  3PZ8 A;  1IP9 A;  3EEC A;  3TBL D;  2W55 A;  1ZE3 D;  5D3D A;  3UF8 A;  3KYC D;  4W9L A;  3IAM 1;  4BVU C;  2KHW B;  2LI5 A;  2W54 A;  3UIO B;  4GN1 A;  4P6V F;  1T0S C;  4NJ6 A;  2LAS A;  1E5W A;  1TT5 B;  2LVQ A;  2LUM A;  2DZM A;  3UQB A;  2IND C;  2L8J A;  1OTR B;  2MJE A;  3VQI A;  2QIE B;  1YNT E;  2IO1 B;  2L00 B;  2MSE D;  5IOI A;  1FCL A;  1PFD A;  4FXC A;  4W9K A;  2ONQ A;  3MC9 A;  3VH4 B;  1C4A A;  2KN5 A;  3D32 A;  4KGS A;  3SD5 A;  1QOA A;  4ARC A;  2KMM A;  2N1V A;  1MG4 A;  3A33 B;  1ZXI A;  3P2B A;  2XEW A;  1ZW7 A;  3HIZ A;  3TSS A;  1YN4 A;  4MGY E;  4PT5 A;  4IUM B;  2RGF A;  1SIF A;  3AE4 B;  3NY5 A;  3GP7 A;  1WXM A;  1FXT B;  2N1W A;  5LXH A;  1KM7 A;  2LJ5 A;  1L2N A;  2DHZ A;  2CHZ A;  4YTM B;  1JCK B;  2QMT A;  1V80 A;  2K0P A;  4C7Z A;  2FBW B;  2JUO A;  1WGR A;  1J19 A;  2W3R A;  2JY6 A;  3AE3 B;  1I4P A;  3IFW B;  4MEM A;  4N6E B;  4TQ0 A;  3HHM A;  1V81 A;  4XC2 A;  3AXC A;  1PGX A;  2J52 A;  3TIX A;  2MW5 A;  1D5X C;  3VAW A;  4BFR A;  4LCD E;  2CR5 A;  5J18 A;  1SJH D;  3H7P A;  2N9K A;  1K8R B;  4K3B A;  4LJO B;  3W5V B;  4USA A;  3DBH B;  3N9Y C;  3B2G A;  1UBQ A;  3RNG C;  3A9K B;  4LNO A;  5LLI A;  1I4H A;  3Q8B A;  1H8C A;  1HEZ E;  1TYG B;  2Y3A A;  2C60 A;  2HTM E;  2G3Q B;  1N5W A;  4WWM A;  3H8H A;  2J53 A;  4BKS A;  1ISN A;  2MBH A;  2H89 B;  1TGZ B;  2C7M B;  3S2A A;  2WDV B;  4HWI B;  3WAO A;  4NZL B;  2GBN A;  3VTW A;  3QC8 B;  1QOF A;  4FAD A;  5E6O A;  3IXS A;  5C3J B;  1F77 A;  1L6U A;  4ZOH C;  2QDF A;  5DCN A;  1WM3 A;  2MJD A;  2Y5P A;  5JHA A;  1HQR D;  1VJK A;  4W9H A;  4KDL B;  2KX3 A;  2MRP A;  3MJ5 A;  1JWS D;  2YEP B;  3WAM A;  2J0K A;  1YQ3 B;  2IGD A;  3DWG C;  3IT6 B;  4C4V A;  1WYG A;  4OZC A;  2FID A;  3E9S A;  2VH1 A;  3Q14 C;  1J7A A;  1VDV A;  3AN1 A;  3M63 B;  5CHF A;  4BKS D;  2B3A A;  4GDL A;  5AUI A;  2KNB A;  3A9K A;  2G1E A;  2MWS B;  4HCN B;  1P9D U;  3KVF B;  3VVW B;  3IT4 B;  1KJT A;  1Q1O A;  1IPG A;  2PE6 B;  2KVZ A;  2KQ4 X;  2KD0 A;  4HRO A;  2LD9 A;  1E8W A;  3ZYY X;  1VR9 A;  4RGO S;  2JYE A;  2NVU I;  3EA6 A;  3T3N A;  2NTT A;  2MBO A;  2RDB C;  4LNF A;  1GPX A;  4FHJ A;  2D10 A;  1JAL A;  3QAQ A;  3TMP B;  5C1Z A;  4KIK A;  1I4G A;  3U52 E;  3DBR I;  1GB1 A;  2D2Q A;  2KQS A;  3X0W A;  3M62 B;  3VR9 B;  3V6C B;  1IBX B;  3CSF A;  1BML C;  2ZZP B;  1V5O A;  1ZPS A;  2D3C A;  2VZK B;  2ZW1 A;  2O6V D;  2PVO D;  3BII D;  2M19 A;  2C9W B;  4FJV B;  3H7S A;  3AE6 B;  5KHQ A;  3MFG A;  3CMM B;  4JIO U;  3SFD B;  4MJS A;  2J0J A;  4EKU A;  2WDQ B;  2K6D B;  3IAS 1;  4PYU A;  2WP9 B;  2FCN A;  3GZN I;  1WJU A;  4BBN C;  2JSV X;  2BF8 B;  4HCP B;  1Q5W B;  3RUL A;  1K50 A;  4RM9 A;  1WI0 A;  4KVG B;  2V9H A;  3T9L A;  2C7N B;  1FO4 A;  5G2N A;  4LDT B;  2MHJ A;  3I57 A;  1V1O A;  3LXF A;  3N32 A;  4NAW A;  2KFJ A;  1IUE A;  1MPE A;  1ESF A;  3P4R B;  3DPD A;  1QOG A;  1WXQ A;  2BWF A;  1J8C A;  3N1Y C;  4JGH B;  2JRI B;  4TSS A;  2Z0E B;  4G50 A;  2K6Q A;  3AEA B;  1TZ1 A;  4IWP A;  2WYQ A;  3ZTD A;  1WZ3 A;  3K9P B;  2PPH A;  3IBE A;  4ARI A;  1UH6 A;  1I7H A;  4WWN A;  3ZUN A;  3DVG X;  3FIL A;  3RFZ B;  1F0Z A;  1F1H A;  1V2Y A;  1KRH A;  2OJR A;  2A4Z A;  3R2I A;  4W9F A;  5E6N A;  2ZJD A;  2NPT B;  3RNA C;  2M8S A;  4GLS C;  4II2 B;  1HTO A;  4DDI D;  3ETR A;  3QA8 A;  1JWU D;  2UWQ A;  4PS7 A;  1I35 A;  2MEK A;  1J0G A;  4KZC A;  4B0E A;  3C8Y A;  1V9J A;  2WDT B;  1CMX B;  3PRZ A;  4A3O A;  2BB6 A;  2BPS A;  1P98 A;  3H6N A;  4W9D A;  2LRW A;  2JZZ A;  1RRB A;  4MH8 A;  4I6P A;  4RMA A;  4QAY A;  2W3S A;  2GBR A;  2UU7 A;  3V6E B;  1WRI A;  3AEC B;  4G0N B;  5IKC M;  1I4Q A;  1P1A A;  4H2A A;  4G11 A;  2V4I B;  4JPS A;  1PQS A;  1C76 A;  1TKE A;  3P1M A;  4L2Y A;  4ZRI A;  4WAA A;  3V3X A;  1QT9 A;  1Y56 A;  4GDL B;  2M0A A;  3WAN A;  4YT0 B;  4XWT A;  5EE0 A;  3EFU A;  4F7Z A;  2A5U A;  2MA9 B;  3ZNG C;  4KSL C;  1WWT A;  1CJE A;  2KC1 A;  1U4A A;  4OVU A;  4K7S A;  5IO9 A;  3I3T B;  4GDK A;  3MC8 A;  1KOT A;  2JXX A;  4HRS A;  4IDI A;  2B76 B;  3LB8 C;  1NVI D;  1V1P B;  2ZPY A;  1YJ1 A;  5BMH A;  2IO0 B;  2RR9 A;  5DPS A;  4YWG G;  2O2V A;  1WXA A;  3A1Q B;  5EE9 A;  2V4L A;  4EEW A;  3H7P B;  2ON8 A;  1N62 A;  2WXM A;  3IHP C;  2PKO A;  2KJR A;  3DVN V;  4D2K A;  3AE8 B;  1LXD A;  1VLB A;  3VUX A;  3EUB 2;  1T6B X;  2I2Y A;  2KQ7 A;  3NVZ A;  3TL5 A;  2NBU A;  2N7J A;  4II3 B;  2W9N A;  1EWC A;  2DYM A;  4XDD A;  3H1U A;  3DHI C;  4LTU A;  4MH0 E;  3GS2 A;  4KIK B;  4WQO B;  2QJL A;  2PVG C;  4HDQ A;  2J42 A;  1TS3 A;  2ZPN A;  2DZK A;  1ZP0 B;  1GG3 A;  1F52 A;  2EKI A;  5DPW A;  1OEY A;  2Y5C A;  4IM0 A;  5HG2 A;  2KWU B;  4JX1 C;  1GOZ A;  4F8C B;  3RPF C;  1E9M A;  3UGB B;  3N1Z C;  2JZ3 B;  3ECI A;  2AL3 A;  1K52 A;  5AZH A;  2CS4 A;  3RMK C;  4DXF A;  1UBI A;  3DOW A;  4M01 A;  1Z2M A;  2R2O A;  2J0M A;  3ZRC A;  1C9F A;  1HXY D;  2NTS A;  4JWS C;  2BS2 B;  2XN9 C;  3Q8A A;  5J2R A;  1STE A;  3RNE C;  2BVC A;  3PZ7 A;  4RGN A;  3OAW A;  1S3S G;  1E7V A;  1KH0 A;  2IDY A;  2PIA A;  2BQQ A;  4CHK A;  1R7S A;  3DBR B;  4YXD B;  1SIJ A;  2HDE A;  2IZV B;  2WQY B;  2KWV B;  1T0Y A;  3I9V 1;  2WXH A;  3QX1 A;  3ZDT A;  3ML8 A;  1SGH A;  3JW0 X;  1MI0 A;  3NVW A;  1VD2 A;  4EE2 A;  5HKH A;  2ZNV B;  1UF0 A;  2K8H A;  2WXI A;  2RSU A;  3ONS A;  4ANU A;  4LNK A;  3TCA A;  1KLG D;  4E3C A;  4RCO A;  3WA0 A;  3B2F A;  3ZNI D;  3Q8F A;  4KKJ A;  1M94 A;  1XF5 L;  2PTL A;  1SEB D;  3WAL A;  1WJN A;  3ZVV A;  3NVY A;  3PT2 B;  1P3Q U;  4WAF A;  3P4P B;  3OG5 A;  1E10 A;  3B1L X;  2LHD A;  3W1S A;  4RGM A;  4M0W A;  2I38 A;  4KX6 B;  5HFY A;  1CZP A;  3PPA A;  3RZF A;  2BS3 B;  1P7E A;  4ZHO A;  3R66 C;  2RPV A;  2MBB B;  3TEZ A;  4MSQ B;  1TY0 A;  1MJD A;  3N3K B;  1P0R A;  4TMA B;  2DYB A;  3L17 A;  3BIN A;  3HUI A;  4WWO A;  2L05 A;  1AW7 A;  1ZOY B;  2WXJ A;  3I63 C;  1H4R A;  1XCT L;  3ENE A;  4GB9 A;  3P42 A;  3QIJ A;  1DOY A;  1UEL A;  5GXG B;  1AYF A;  3AUL A;  4PYZ A;  2CU1 A;  4ZRK A;  1BXT A;  3ZQ4 A;  3L54 A;  1QKZ A;  2MP2 A;  3APD A;  3JSV A;  2JU6 X;  5L95 C;  4FBJ B;  1TS2 A;  3RD2 A;  2KK8 A;  1YMH E;  2MP2 B;  2ZCB A;  4LDT D;  4GGQ A;  2REX A;  1FRR A;  1ZDV A;  4FJZ A;  4A20 A;  4HVB A;  1YOV B;  1WE6 A;  2ZVN A;  2LVO A;  2K8B A;  3SHQ A;  3WCQ A;  4FHK A;  3O65 B;  4DQO C;  3QCA A;  2GOW A;  4GDK B;  1MG8 A;  3ZLZ A;  4OVZ A;  2N4F A;  2PEA A;  4ASW C;  1CK1 A;  2KTF A;  2BT6 A;  2L52 A;  2K5P A;  4HKZ E;  1K51 A;  2C5L C;  4IKG A;  3HK0 A;  4YSZ B;  4S0R A;  5D94 A;  3R7Q A;  4NNJ B;  1C77 A;  2KKC A;  4P1B C;  2BW2 A;  4ZRQ A;  4IM3 A;  2QEJ C;  3BZD B;  2GBM A;  2OHF A;  1ENF A;  2HJ1 A;  1FPY A;  3VTU A;  5AZG A;  2K25 A;  4GIV A;  3ZJT A;  2JX5 A;  1ZXH A;  1N61 A;  1IYF A;  2VZK D;  2VH2 A;  1KF6 B;  2KC2 A;  4EOY A;  1SBB B;  1L0Y B;  4IWQ A;  1WX8 A;  3TUO A;  2N9X A;  1PDX A;  3RT3 B;  1UWX A;  5H8Y E;  2EKE C;  5CHV C;  3SR6 A;  1C78 A;  3NS8 A;  3PTF C;  2WS3 B;  1FNU A;  3ZO5 B;  2XBB C;  2LXA A;  3UIN B;  5LNK 1;  4AS1 A;  1F2R C;  5KHO A;  3QHT A;  5BMI A;  1QF6 A;  3Q8C A;  3U8Z A;  3JVZ X;  1WXV A;  1EUV B;  3AV8 A;  2GBJ A;  3GB1 A;  4TV3 A;  5TSS A;  4REZ A;  3RUI B;  4GU2 A;  1NI2 A;  4WIP A;  1RYJ A;  1QZE A;  1R4M B;  3QK0 A;  2KT7 A;  2Z0D B;  3PLU A;  1WRD B;  3HVD A;  3DBL I;  1TKG A;  2G9H D;  5EDS A;  5C23 A;  1N6Z A;  1TBE A;  3R8B A;  4M0W B;  1K53 A;  2IO2 B;  1FIQ A;  4W9J A;  3RCZ A;  1MHX A;  1YJJ A;  2LGI A;  4CQN A;  5TR5 A;  1OQY A;  4I6N B;  4A8X C;  2KJ6 A;  4ICV A;  1FMA D;  2DLB A;  1PYW D;  3PO0 A;  3LJ3 A;  1ZGU B;  2WXO A;  4IW0 A;  3BWU D;  2WLB A;  3V61 A;  4W9G A;  3SFE B;  2KTR A;  4RF1 A;  2N9E B;  2CHW A;  3MHS D;  3TEY A;  2K3U A;  1SXT A;  4XX5 A;  3ZJV A;  3AB5 A;  2IY0 B;  2KMA A;  2K1F A;  1WGY A;  3VH3 B;  3ZW3 A;  1ET9 A;  4KGT A;  1C4P A;  3WIM A;  4K1R B;  3KUZ A;  1WXS A;  2DEN B;  2KJH B;  4RNA A;  2CJN A;  3AH7 A;  2KFK A;  2KLC A;  4ZYN A;  1SE2 A;  4RM8 A;  2LMC A;  2WNM A;  3PLV A;  3APF A;  4HPM B;  1GUA B;  1E6E B;  1TJE A;  1RM6 C;  3DBL B;  3Q6B A;  3N30 A;  3DBS A;  2N7D A;  1UZX B;  4W9E A;  2LWP A;  2NBV B;  5JHB A;  4P1C C;  3AE7 B;  4NJ7 A;  2GLS A;  3HRD D;  2O6V B;  4K81 A;  1WR6 E;  3UI3 A;  5IP4 D;  3BYY B;  3PRP B;  3W1Y A;  1IGC A;  1RAX A;  2KX0 A;  2KXJ A;  2EMS A;  4FLH A;  4DHZ B;  2LUE A;  4HPL B;  3OWE B;  4KV2 A;  1T0R C;  4MGI E;  2JWU A;  1L4Z B;  3UIP B;  3AEF B;  4RF0 A;  5EE3 A;  2M17 A;  5HI1 A;  3A9J B;  2RPQ A;  4L23 A;  3LYY A;  2JPH A;  1F2R I;  4HDO A;  4A90 A;  3ZJU A;  3CIR B;  5BO4 B;  4O1N A;  3MHZ A;  2FIF A;  4ZRJ A;  2M1M A;  4C00 A;  1GNU A;  2NCN A;  3VXW A;  2QSD A;  4AJY B;  3MJW A;  3KWV A;  2E6X A;  3L0W B;  3R3M A;  2LRU A;  3R7R A;  3TEX A;  2KO3 A;  2BYT A;  1Q0W B;  3NZ3 A;  2FCQ A;  3VUY A;  2KFK B;  3VRA B;  5BYS A;  1KTK A;  4WH4 A;  1D5M C;  4E74 A;  1PGB A;  1WFY A;  1V6E A;  3KYD D;  3I5J C;  2FAZ A;  1DYQ A;  3BVZ A;  3GE8 C;  1N5X A;  4E71 A;  4GSW A;  2WXL A;  3FIL B;  2K8C A;  3QWZ B;  3CST A;  4MM3 A;  2O6V A;  4KSK C;  5D7G A;  4KDI C;  4M02 A;  3P4Q B;  1SE3 A;  4FA6 A;  3EFC A;  2BYF A;  1FFU A;  1JWB D;  1TKY A;  1KFY B;  4YSY B;  3B9J A;  4B0M A;  1XT9 B;  1WH3 A;  3A4R A;  2M56 B;  4JE3 B;  3MP9 A;  1HE8 A;  1AAR A;  1E7P B;  3MC0 B;  2KAC A;  1OGW A;  2BYV E;  3QAR A;  1NDD A;  3NOB A;  1XLP A;  4MAC A;  1OQR A;  2JQR B;  4LNI A;  1FFV A;  4EUT A;  3WAP A;  4DHZ E;  2GRI A;  2E3T A;  3KLS X;  1LQB A;  2GB1 A;  4MJS B;  3EC8 A;  3KQ4 A;  1YJI A;  2WX1 A;  1FD6 A;  5CHW A;  3ZNZ B;  1LO5 D;  1VCB A;  4W9C A;  4B9K A;  4AJW A;  1DGJ A;  4M8N A;  3GZN B;  5G55 A;  2N0S B;  3U30 A;  4B95 A;  2JRH A;  3V62 A;  1R4N I;  1CQV A;  5AEK B;  4YTP B;  5FR6 A;  2IGH A;  3Q2A C;  2V3P A;  3W5U B;  2XK5 A;  1L7Y A;  2MLB A;  3OLM D;  3L13 A;  2V0G A;  2BS4 B;  3OJ4 B;  3RZW C;  2QHO A;  3SDL C;  1FCC C;  1EWY C;  2W82 A;  3RYT A;  1WF9 A;  1JML A;  2L0T A;  4BOS C;  3AI5 A;  1NEN B;  2HTH A;  2IYD B;  4CYE A;  1IBX A;  2LEK A;  1WMH A;  2INC C;  1LGR A;  1HZ6 A;  1E7U A;  3ZTC A;  4BKG A;  4OVV A;  3N1X C;  2OJW A;  4MEL A;  4YSX B;  3HM6 X;  2IBI B;  2LHE A;  1OFF A;  3AU5 A;  1S1Q B;  4N9F 4;  4NQK E;  1WJ4 A;  2WXQ A;  1V1P A;  4PK1 A;  4M00 A;  1RWS A;  3L16 A;  5FKA C;  2KDF B;  2AYO B;  1M4V A;  4A3P A;  4BZA A;  5BYR A;  3VDZ A;  1V8C A;  1EF5 A;  1XLO A;  1HTQ A;  1N60 A;  1C1Y B;  1RLF A;  1L0V B;  1E8X A;  2PMV A;  3FAH A;  3T8M A;  3IVF A;  2XNA C;  3PV1 A;  5E6J A;  1KLV A;  4IC7 B;  2NBW B;  4WQM A;  4JL9 A;  1KLU D;  3BK1 A;  2EMT A;  5D3I B;  4IOI E;  1EU4 A;  3DDC B;  1TIF A;  1R4M I;  3Q3J A;  1C3T A;  1AN8 A;  2FUG 1;  4UDU C;  1AWD A;  3R2T A;  3W9C B;  3PHW B;  3ZIM A;  5E6P A;  1DOI A;  2RD0 A;  3J9C A;  4GXB A;  1LM8 B;  2WDR B;  1WIA A;  1XLQ A;  2IGG A;  4M8M A;  2KAN A;  2N9L A;  2TSS A;  3AEB B;  4EZL A;  4US8 A;  1V86 A;  2FCM A;  3M95 A;  3NVV A;  2LZ6 A;  5EE1 A;  2J4X A;  3AU4 A;  2FUH B;  4ZDV A;  2WU5 B;  1WZ0 A;  4A55 A;  1TS5 A;  1WGK A;  3K9O B;  2MQJ A;  5CX3 A;  1V5T A;  1JW9 D;  3JSV B;  2OED A;  2GI9 A;  3ZXV A;  4HK2 A;  1D3Z A;  1F9J A;  2DAF A;  4NPN A;  4BKT A;  4OHJ A;  3VRB B;  2KLG A;  5FK9 C;  5C2T B;  4AWJ A;  1WR1 A;  3UQA A;  3DVG Y;  1EF1 A;  4AOF A;  2SAK A;  2CKH B;  4PS8 A;  1WX7 A;  3DHG C;  4OW0 A;  2DZJ A;  3U7Z A;  1UWM A;  4LNN A;  1FEH A;  3ALB A;  1DOX A;  2V3N A;  2AWT A;  3QJZ A;  5I4D A;  4I6L B;  1SE9 A;  2ZVO A;  2ZEQ A;  5BYQ A;  3ZRF A;  4HKQ A;  4MGZ E;  4YL8 A;  3L10 B;  4C7Y A;  3B0A A;  5AZF A;  3ZXR A;  2MBQ A;  2ZCC A;  2JT4 B;  2DAJ A;  3NUH B;  1E8Z A;  2G45 B;  3V60 A;  3URY A;  4EZJ A;  4C56 C;  4J3O D;  3Q3M C;  2FCS A;  5H92 C;  3AEG B;  2WHI A;  2X8X X;  4OZA A;  2L3Z A;  2M0X A;  4WJN A;  2MCN B;  3KW5 B;  3CF6 E;  1Z5S B;  1YQB A;  1QOB A;  4DXA B;  1D4B A;  2M4N A;  3AE1 B;  2LVP A;  1LFD A;  1V49 A;  3U2S C;  4S17 A;  3BYT B;  4FJY A;  2IPK D;  2WXP A;  4MGK E;  4XZ4 A;  3X23 A;  5J17 A;  4HLE A;  1J7B A;  1WMH B;  5JZE B;  2D5G A;  3P63 A;  2BWE S;  4AQ7 A;  3AE9 B;  4ANW A;  1XLN A;  3W2D A;  1ACC A;  2K22 A;  1WX9 A;  1C79 A;  2INP E;  5LXI B;  3CWI A;  2HJ8 A;  2WXF A;  1EO6 A;  3VTV A;  2WXN A;  2C7H A;  2BKR B;  2MH7 A;  1FM0 D;  5DPT A;  4WJP A;  3VHT C;  2LXC A;  1IGD A;  3DHH C;  1ROE A;  1WGG A;  1G6J A;  3DQV A;  2WXK A;  1MHH E;  1I4R A;  1VZ8 A;  4IWO A;  3SEB A;  5IN7 A;  2K9X A;  2CHX A;  3NS1 A;  1T0Q C; 
#chains in the Genus database with same CATH homology
 2ON8 A;  2WXR A;  5HI1 A;  1N62 A;  2WXM A;  2PKO A;  2MJE A;  4RFB A;  3VQI A;  4D2K A;  3AE8 B;  1VLB A;  2QIE B;  3EUB 2;  1YNT E;  4NAM A;  4L23 A;  2EEL A;  3LYY A;  1FCL A;  1PFD A;  1T6B X;  2I2Y A;  4FXC A;  1F2R I;  4A90 A;  2ICI A;  3ZJU A;  3NVZ A;  2PW9 A;  2ONQ A;  3CIR B;  3AE5 B;  2N7J A;  1EWC A;  2DYM A;  4XDD A;  4O1N A;  3MHZ A;  1C4A A;  4LTU A;  4KGS A;  1QIL A;  1GB4 A;  2JYT A;  1EM7 A;  4NAW B;  1QOA A;  3GS2 A;  4ARC A;  2KMM A;  2QJL A;  2QSD A;  2PVG C;  1FXA A;  4OZB A;  2J42 A;  1TS3 A;  3KWV A;  5G5H A;  2AQ3 B;  2E6X A;  1ZP0 B;  2EKI A;  3L4P A;  1ZXI A;  3TEX A;  3AE2 B;  2Y5C A;  2BYT A;  5HG2 A;  3NZ3 A;  4JX1 C;  3ZGZ A;  5HHD G;  3TSS A;  1GOZ A;  1FNV A;  1YN4 A;  3RPF C;  3ABV B;  3VRA B;  5BYS A;  1E9M A;  4PT5 A;  1NYR A;  1L6V A;  1KTK A;  2CJO A;  3AE4 B;  3GP7 A;  4WH4 A;  2BTE A;  1D5M C;  1K52 A;  1D6E C;  1PGA A;  4DXF A;  1PGB A;  4YTM B;  1DYQ A;  3BVZ A;  1JCK B;  2QMT A;  1C9F A;  1HXY D;  1N5X A;  2K0P A;  2NTS A;  4JWS C;  2WXL A;  2BS2 B;  3FIL B;  4C7Z A;  2FBW B;  1FXI A;  3BVG A;  2XN9 C;  3Q8A A;  1JRO A;  2W3R A;  3AE3 B;  1STE A;  1B1Z A;  4Q2J A;  3PZ7 A;  1I4P A;  4RGN A;  5D7G A;  2IJ0 A;  5FR3 A;  1KH0 A;  2IDY A;  1SE3 A;  1MVK A;  2PIA A;  3P4Q B;  4N6E B;  4TQ0 A;  1PUT A;  1R7S A;  4YXD B;  1SIJ A;  1FFU A;  1JWB D;  1TKY A;  1KFY B;  2HDE A;  2WQY B;  3B9J A;  4LK0 M;  4YSY B;  1T3Q A;  4A6Q A;  4B0M A;  3I9V 1;  1PGX A;  2WXH A;  2H88 B;  2J52 A;  2M56 B;  4HJG E;  4JE3 B;  1SJE D;  1TS4 A;  3KWL A;  3MP9 A;  1D5X C;  1MI0 A;  3NVW A;  2PLP A;  1E7P B;  1SJH D;  3MC0 B;  2KAC A;  2N9K A;  2ZW0 A;  3W5V B;  4EE2 A;  4USA A;  1XO3 A;  2WXI A;  3N9Y C;  3B2G A;  4ZYS A;  1XLP A;  4MAC A;  1I4H A;  1OQR A;  2JQR B;  1KLG D;  3Q8B A;  1FFV A;  1HEZ E;  1TYG B;  2Y3A A;  2RMM A;  4RCO A;  2HTM E;  3B2F A;  1N5W A;  2GRI A;  3Q8F A;  4WWM A;  3H8H A;  2E3T A;  3KLS X;  4KKJ A;  2J53 A;  2GB1 A;  2H89 B;  1XF5 L;  2PTL A;  3KQ4 A;  1SEB D;  2CU3 A;  1YJI A;  2WDV B;  1FD6 A;  4C80 A;  3NVY A;  4NZL B;  1LO5 D;  1QOF A;  3E56 A;  4ZHP A;  4WAF A;  3P4P B;  1WSP A;  1DGJ A;  3IXS A;  5C3J B;  1E10 A;  2LHD A;  3W1S A;  4RGM A;  1F77 A;  1P7F A;  4M0W A;  2N0S B;  1T5X D;  2I38 A;  4KX6 B;  5HFY A;  1L6U A;  1CZP A;  4ZOH C;  2BS3 B;  1ZDX A;  2MJD A;  2Y5P A;  1CQV A;  1P7E A;  4ZHO A;  2RPV A;  2L83 A;  3EGR A;  1HQR D;  4YTP B;  1VJK A;  2IGH A;  5JXV A;  3TEZ A;  3MJ5 A;  1TY0 A;  1JWS D;  1TZO A;  2YEP B;  2V3P A;  3W5U B;  4TMA B;  1YQ3 B;  2IGD A;  3DWG C;  3IT6 B;  3HUI A;  1WYG A;  4OZC A;  4L1B A;  2KDM A;  2ACZ B;  3E9S A;  2V0G A;  2BS4 B;  1AW7 A;  1J7A A;  1ZOY B;  1VDV A;  3AN1 A;  2WXJ A;  1FCC C;  4KKI A;  1EWY C;  1XCT L;  2RDH A;  3P42 A;  2W82 A;  1JML A;  1DOY A;  5AUI A;  5GXG B;  1AYF A;  2G1E A;  4HEA 1;  1NEN B;  4RGT A;  1IBX A;  2LEK A;  1BXT A;  3ZQ4 A;  1JWA D;  1TY2 A;  3VR8 B;  3DWM A;  3IT4 B;  1QKZ A;  2BB5 A;  1HZ6 A;  2JU6 X;  1ET6 A;  3AED B;  1V97 A;  1TS2 A;  1SE4 A;  2KQ4 X;  2LFI A;  4YSX B;  2LHE A;  4R3D A;  1YMH E;  1OFF A;  4HRO A;  2WXQ A;  1V1P A;  1NYQ A;  4MT5 A;  3ZYY X;  1FRR A;  1VR9 A;  1ZDV A;  1NI3 A;  2JYE A;  4RGO S;  1GAQ B;  1RWS A;  3EA6 A;  3T3N A;  2NTT A;  3AEE B;  1QLB B;  5FKA C;  3P4S B;  1M4V A;  1GPX A;  5BMG A;  2YEP F;  3WCQ A;  2KN4 A;  1JAL A;  3BVM A;  5BYR A;  5MPO A;  1I4G A;  1V8C A;  3U52 E;  2KWD A;  1XLO A;  1N60 A;  1XEE A;  4DQO C;  1GB1 A;  3HVZ A;  1L0V B;  1UGJ A;  2PMV A;  3FAH A;  4XE0 A;  4GDK B;  2XNA C;  2Z8L A;  1OQQ A;  3VR9 B;  2LJI A;  3V05 A;  1IBX B;  5E6J A;  4OVZ A;  2DYO A;  4WQM A;  1CK1 A;  2BT6 A;  2L52 A;  1BML C;  1KLU D;  1C4C A;  1ZPS A;  2K5P A;  4HKZ E;  2VZK B;  1K51 A;  2ZW1 A;  4IKG A;  3BK1 A;  5D3I B;  2NMQ A;  4YSZ B;  2PVO D;  3BII D;  1EU4 A;  4IOI E;  1I4X A;  2M19 A;  1C77 A;  4ZRQ A;  2BW2 A;  1AN8 A;  1D5Z C;  2QEJ C;  3AE6 B;  2FUG 1;  3BZD B;  2OHF A;  3MFG A;  4UDU C;  1AWD A;  3R2T A;  3W9C B;  1ENF A;  1DOI A;  1Q10 A;  3SFD B;  3J9C A;  1UUP A;  3ZJT A;  2WDQ B;  3IAS 1;  2WDR B;  1SB3 C;  2JX5 A;  1JWM D;  1ZXH A;  2X38 A;  1XLQ A;  2WP9 B;  1N61 A;  2IGG A;  2VZK D;  1YN3 A;  1L4D B;  2N9L A;  3AMZ A;  2JSV X;  1KF6 B;  2TSS A;  3AEB B;  1NEK B;  4US8 A;  2DWQ A;  1L5P A;  3NVV A;  1FRD A;  2JZP A;  3NRZ A;  1SBB B;  5EE1 A;  3U4E G;  1RFK A;  1L0Y B;  2J4X A;  5T8I A;  3TUO A;  1K50 A;  2WU5 B;  4A55 A;  2L32 A;  1B9R A;  1YN5 A;  1PDX A;  1TS5 A;  1WGK A;  4US9 A;  1FO4 A;  1JW9 D;  4N59 A;  1UWX A;  2OED A;  5H8Y E;  3SR6 A;  1C78 A;  2GI9 A;  2FE8 A;  1JRP A;  4XWW A;  2WS3 B;  1FNU A;  1JQ4 A;  3I57 A;  1V1O A;  3Q8E A;  3LXF A;  5LNK 1;  4OHJ A;  3VRB B;  1IUE A;  5FK9 C;  5C2T B;  1MPE A;  1ESF A;  3P4R B;  4AS1 A;  1QOG A;  1F2R C;  1WXQ A;  2WU2 B;  2SAK A;  4OW0 A;  2AQ2 B;  5BMI A;  2Q5W D;  1QF6 A;  3Q8C A;  4TSS A;  4TQ1 A;  1UNS A;  5AUK A;  3TEW A;  3U7Z A;  3AEA B;  3AV8 A;  1UWM A;  3GB1 A;  5TSS A;  1FEH A;  2AX5 A;  4REZ A;  3FC4 A;  1DOX A;  1SF0 A;  2WXG A;  2V3N A;  4ARI A;  4WIP A;  1RYJ A;  1I7H A;  5I4D A;  5G5G A;  3FIL A;  3RFZ B;  1F0Z A;  3HVD A;  4ITK A;  1TKG A;  5BYQ A;  4HKQ A;  2G9H D;  1KRH A;  4JWU C;  2DBY A;  3R2I A;  4C7Y A;  4NJC A;  2JXT A;  3R8B A;  1QQR A;  4MM3 B;  3NUH B;  3BK2 A;  4RH6 A;  3URY A;  4GLS C;  1K53 A;  4WUR A;  4C56 C;  4J3O D;  3ETR A;  1FIQ A;  4DXG A;  1JWU D;  1MHX A;  1YJJ A;  2MEK A;  2LGI A;  5H92 C;  4CQN A;  3AEG B;  1XCQ L;  4B0E A;  1HA5 A;  4OZA A;  4A8X C;  3C8Y A;  4XDC A;  1FMA D;  2DLB A;  1PYW D;  1SSN A;  3PO0 A;  2WXO A;  1J7C A;  1EU3 A;  1XXG A;  2WLB A;  3BWU D;  3O13 A;  3SFE B;  4RF1 A;  4A9A A;  2BB6 A;  1QOB A;  2MJ3 A;  3TEY A;  2K3U A;  1SXT A;  1D4B A;  3AE1 B;  1VZ6 A;  3ZJV A;  1FNW A;  3AB5 A;  1VRA B;  2KAJ A;  2INN E;  3U2S C;  1A70 A;  3AM9 A;  4YTN B;  4MH8 A;  4KGR A;  1YQ4 B;  2W3S A;  3BYT B;  2RDG A;  1ET9 A;  1WRI A;  2IPK D;  2WXP A;  1N63 A;  1C4P A;  4KGT A;  3AEC B;  1I4Q A;  1J7B A;  1ZUD 2;  4RNA A;  4H2A A;  3Q69 A;  2V4I B;  4JPS A;  2CJN A;  1L0X B;  3AH7 A;  2D5G A;  3P63 A;  1C76 A;  1TKE A;  3P1M A;  4L2Y A;  4AQ7 A;  3AE9 B;  3T3O A;  2BBC A;  4N58 A;  1SE2 A;  2SEB D;  1XLN A;  2LMC A;  1ACC A;  3W2D A;  2WNM A;  2K22 A;  4ZRP A;  3V3X A;  2L1A A;  1VZ7 A;  1QT9 A;  1C79 A;  2QIL A;  1Y56 A;  2R61 A;  4GDL B;  4P16 A;  2INP E;  1E6E B;  2M0A A;  3CWI A;  1HZ5 A;  1TJE A;  2AQ1 B;  1RM6 C;  4YT0 B;  2WXF A;  4LLG M;  4XWT A;  2WXN A;  5EE0 A;  1BUI C;  1E0Z A;  2MH7 A;  1FM0 D;  1WWT A;  1CJE A;  3PZ8 A;  1IGD A;  3AE7 B;  3HRD D;  1ROE A;  3UI3 A;  2W55 A;  1ZE3 D;  3BYY B;  5D3D A;  4HRS A;  4IDI A;  2WXK A;  3IAM 1;  2B76 B;  1IGC A;  1MHH E;  3LB8 C;  1I4R A;  1NVI D;  1VZ8 A;  2W54 A;  1V1P B;  5BMH A;  4P6V F;  3SEB A;  3OWE B;  2K9X A;  4YWG G;  5EE9 A;  2JWU A;  1L4Z B;  3AEF B;  3NS1 A;  4RF0 A;  2LUM A;  5EE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...