1VJKA

Putative molybdopterin converting factor, subunit 1 from pyrococcus furiosus, pfu-562899-001
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
87
structure length
87
Chain Sequence
SVKVKVKYFARFRQLAGVDEEEIELPEGARVRDLIEEIKKRHEKFKEEVFGEGYDEDADVNIAVNGRYVSWDEELKDGDVVGVFPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords molybdopterin converting factor, subunit 1
publication title Putative molybdopterin converting factor, subunit 1 from Pyrococcus furiosus, Pfu-562899-001 '
rcsb
source organism Pyrococcus furiosus
total genus 25
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2004-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1vjkA00
1TYGB 2WDQB 3DWGC 4C7ZA 1ZUD2 1N5WA 1E0ZA 1JROA 4LTUA 3SFDB 1RM6C 5H92C 5C2TB 3CIRB 4YSZB 1FO4A 3NVVA 4C7YA 1J7CA 2MJDA 1GAQB 1XLNA 2CU3A 2H89B 2EKIA 1RYJA 5EE0A 3HUIA 3HVZA 3AE4B 3CWIA 1OQQA 3ABVB 1QOBA 4HROA 1FRDA 3FAHA 3LB8C 1XLQA 1QT9A 4N58A 4YSYB 3NRZA 1R7SA 2N0SB 2HTME 1A70A 1RWSA 2MJEA 1QLBB 2WQYB 4KX6B 1N62A 4USAA 4US9A 2WU5B 1TKEA 3W5VB 1EWYC 5C3JB 1B9RA 1TJEA 1WXQA 2PKOA 3FC4A 3KWLA 3P4QB 2PVOD 1VDVA 1NENB 3AE9B 1J7BA 3P4SB 4IDIA 4WQMA 1XLPA 4YXDB 1QOFA 1KFYB 1WYGA 1J7AA 1FMAD 2JQRB 3AE1B 3AEEB 3AEGB 3ETRA 3P4PB 3AE8B 5EE1A 1FXAA 1TKYA 2K22A 1PDXA 2E3TA 2Y5CA 1JALA 1JW9D 2WS3B 1JRPA 3AECB 1OQRA 5GXGB 1E10A 1I7HA 1JWAD 1N5XA 2H88B 3AMZA 5EE9A 1T3QA 3NVZA 1KF6B 1JQ4A 1DOIA 2L52A 1WWTA 2JX5A 3AEDB 3P63A 1ZOYB 2WP9B 1SIJA 1L0VB 4YSXB 2BS3B 1N61A 4JWUC 2QIEB 1NYQA 1ZXIA 1E7PB 3AEFB 3NVYA 3BIID 2WDRB 2K9XA 3AH7A 3WCQA 3AV8A 1DOYA 1ROEA 1GPXA 1FRRA 4ZHPA 2OHFA 1FIQA 1KRHA 1NI3A 2PVGC 1FXIA 3AE2B 1QF6A 1VJKA 4N59A 4YTNB 2W3SA 3VR9B 3B9JA 2LEKA 1V8CA 1PFDA 3AE7B 5H8YE 2BT6A 1FFVA 1SF0A 1YJIA 2W54A 1FFUA 3P1MA 4WWMA 3W5UB 1AYFA 1TKGA 1XLOA 1YQ4B 1CJEA 2M19A 1VLBA 1OFFA 3AEBB 3B2GA 1E6EB 1E9MA 2BS4B 1SB3C 3EUB2 4P6VF 3RPFC 1NVID 2BS2B 1FM0D 2ACZB 1UWMA 3DWMA 3AN1A 2W3RA 1CZPA 3P4RB 2KMMA 4C80A 2WDVB 4US8A 1IUEA 1DOXA 1AWDA 4ITKA 1F0ZA 2M56B 3VRBB 3AEAB 5AUIA 4JX1C 2L83A 3SR6A 1NYRA 1L5PA 4ZHOA 3SFEB 2K5PA 2WU2B 1WGKA 2B76B 1PUTA 2G1EA 2Q5WD 4YT0B 1YJJA 1JWBD 3AM9A 3HRDD 5G5HA 4HRSA 4YTPB 2DWQA 1ZP0B 1WRIA 2CJNA 1L6UA 2CJOA 4A9AA 2PIAA 2W55A 3W9CB 4YTMB 3NVWA 3PO0A 1NEKB 1YQ3B 5EE3A 1V97A 1DGJA 2KAJA 3B2FA 4N6EB 2AX5A 2FBWB 3L4PA 2DBYA 5AUKA 2QJLA 3AE3B 2MJ3A 3NS1A 2WLBA 1QOAA 2MH7A 3AE6B 3VRAB 3VR8B 1N60A 1L6VA 1RFKA 4FXCA 3ZYYX 4JWSC 4ZOHC 1XO3A 3AB5A 1QOGA 3LXFA 5G5GA 3AE5B 1N63A 5MPOA
chains in the Genus database with same CATH superfamily
3PZ7A 5IKCM 4W9IA 1UD7A 2KWVB 1IBXB 3L17A 4JQWC 3IHPC 4N9F4 2W82A 3RULA 3UIPB 3MC8A 5E6OA 3ZO5B 5DPWA 4XYCA 4DXGA 1TY0A 4BKSA 1TJEA 2K0PA 3V60A 3TEYA 4GXBA 2KWDA 1ESFA 1F2RI 3NZ3A 3ZTCA 1WYGA 3AEEB 2LWPA 3EA6A 2FCNA 4OVVA 3KH0A 1UWXA 1JWAD 5BO4B 3RMKC 2IY1B 1ZOYB 2WP9B 4C4VA 2NBVB 3VH4B 2YEPB 3PHXB 3N1XC 4DDGD 2GOWA 5CHVC 4ZHPA 4LNFA 2OHFA 5HI1A 1OQYA 4EZJA 2HDEA 3DDCB 1V8CA 1SF0A 2KKCA 5HKHA 2MLBA 2LZ6A 1E9MA 4BFRA 3EUB2 1YN5A 3RPFC 4RGTA 3P42A 2N1VA 1WE6A 3O13A 1K52A 3GZNI 3QC8B 4TUUA 4KSLC 2SAKA 4W9JA 5E6PA 1YJJA 4GDLA 3NJTA 1EF5A 4FJVB 1STEA 2CJOA 1WR1A 3QARA 3NVWA 3NZSA 1NEKB 2LGXA 4BKTA 1EF1A 1SSNA 1C1YB 1SE4A 1S1QB 2DNFA 4LJOB 4DXFA 3VQIA 3HK0A 1L2NA 3ENEA 3ZYYX 1G6JA 3DWGC 4GSWA 2INDC 4YSZB 1BXTA 3V3XA 1ZDVA 3ZJVA 2NBWB 1FNVA 3AE4B 1ENFA 3EFCA 4RF0A 1ACCA 2MP2A 2ZCCA 3ZKJC 1P98A 2KX3A 4P7IA 3QK0A 2PKOA 3DHHC 1ZE3D 3ZGZA 4ZYNA 1KJTA 4GGQA 3AE1B 4LK0M 1ET6A 3ETRA 1WH3A 4IM3A 3C0RB 2DHZA 1OQRA 3Q8EA 4TV3A 1E10A 2G4DB 3DVNV 2MRPA 3PZ8A 2QSDA 1WY8A 2KVZA 3AEDB 2O6VA 2BS3B 4HPLB 3PZDA 2BTEA 2K9XA 5CX3A 3I5JC 1FRRA 2WGSA 2QEJC 1HE8A 3ALBA 4A3OA 1VJKA 3VR9B 1T0SC 3AE7B 1CJEA 1M4VA 1VLBA 2ONQA 4P6VF 4PS7A 5J17A 2LJIA 1DOXA 2L76A 4A20A 3ZNZB 3VRBB 1UH6A 1SJED 2WWZA 4FADA 3H8HA 2B76B 2NPTB 2MBHA 4M8NA 1AW7A 3GOEA 2W55A 5GMVA 3R7QA 2MBBB 1FCLA 1OTRB 3APFA 3URYA 1C4AA 4ANVA 2KDMA 4FA6A 4JWSC 4KGSA 2G9HD 4EZKA 2WXKA 4HDQA 1V5TA 4OVUA 3PV1A 2MSED 2KQSA 2CU1A 2J0MA 4MJSA 1YX5B 4IWQA 1WM3A 4CQNA 1XLQA 4N58A 1UNSA 2ON8A 3A1QA 1ZGUB 2KDEB 2MJEA 1V1PB 2QDFA 4KX6B 5JZEB 4MH0E 2ZNVB 1WJNA 2M8SA 3PREA 2DX5B 3ZIMA 1TGZB 4HVBA 3A9JB 2C7MB 4LLGM 4URKA 4FHJA 3PS6A 4BKGA 4WJQA 3V6EB 4NQKE 1TKYA 3ZVVA 2ZVNA 3VTWA 1CQVA 2LXCA 1KF6B 2LHDA 2L52A 3UF8A 4DDID 1R4MB 3KUCB 2HTHA 3TCAA 2M0XA 2N9KA 2GLSA 3Q6BA 4K7UA 3N32A 1YOVB 1FIQA 2WXGA 4A6QA 2BKFA 1TKGA 1L0YB 2M19A 1SEBD 4HKQA 4DK5A 4KGRA 3W1SA 3DWMA 1WE7A 3VDZA 4C80A 2NR2A 1V5OA 2KMMA 4HEA1 1IUEA 1ZW7A 2CR5A 4KVGB 1WXAA 1I4XA 4O1NA 1I4HA 4XDCA 2J0JA 4F1SA 5G5HA 2XEWA 1WMHB 1L6UA 4BOSC 2CHZA 4Q2JA 4HJKA 3U4EG 4NPNA 3VR8B 3SHQA 1YNTE 1KH0A 1UBQA 3OJ3A 1BMLC 3NUHB 1AARA 2BGFA 1R4MI 1E0ZA 3RI7C 4HCPB 1P3QU 3T9LA 5E6JA 4HCNB 5HG2A 4IW0A 1WX9A 1FNWA 2KFKB 5HHDG 5LXIB 3BWUD 3RT3B 3KW5B 4I6NB 2REXA 3Q8AA 3P4QB 4PT5A 2EELA 4IOIE 2AL6A 2LMCA 4YXDB 2RD0A 4KSKC 3AE8B 2K22A 5GXGB 2QMTA 3VAWA 2JX5A 3BK1A 2FUG1 4XZ4A 1LGRA 5IO9A 2DYMA 4EE2A 2VZKB 3JYUA 2X38A 3RYTA 2LEKA 1OGWA 1MI0A 3BINA 1WGGA 1IPGA 3U30A 4WAFA 3W1YA 2BYEA 3X23A 4X57B 4M02A 4LNNA 3VHTC 2ZW0A 1F2RC 1PQSA 3N1ZC 3MJWA 4US8A 1CMXB 4KDLB 2D3GA 2L83A 4EKUA 1NYRA 2K5PA 1YQBA 1PUTA 3WALA 2XNAC 4YTPB 4RFBA 1IYFA 4MSQB 3V61A 2EKEC 3AU4A 3GB1A 3Q8CA 5AUKA 2I2YA 1XCTL 2WXFA 2KNBA 2IO0B 2VH2A 1I35A 2IYDB 3AB5A 1RRBA 4ZYSA 5G5GA 1V49A 5MPOA 2PE9A 1GB4A 1X1MA 3B0AA 3TMPB 3R2IA 4II3B 1GAQB 3QQ8B 1RYJA 4WWOA 2DAFA 4J6IA 5BMHA 2JSVX 3LB8C 1K53A 1WJ6A 3AI5A 3MTNB 2MBEA 4NAMA 2RR9A 5C23A 1B9RA 2V3NA 2XK5A 4L2YA 4PYZA 5L83A 1P7FA 3SDLC 1Q10A 2AL3A 4MELA 1QOFA 2J52A 3Q3NC 3S2AA 4AUQC 1WFYA 1F52A 4A55A 1I4RA 1UELA 1U4AA 1IGCA 2WYQA 3L0WB 3BYTB 5FKAC 3N9YC 1JWSD 2BVCA 4UDUC 3IFWB 2GBKA 2IJ0A 1WIAA 2PVGC 4DHZB 5J18A 4XWWA 2BF8B 2JPHA 1B1ZA 1FD6A 2BT6A 3P1MA 1AYFA 1HXYD 4KGTA 1HA5A 4LDTB 3UINB 1WJ4A 3ZNID 3UIOB 3MC9A 3ZJTA 2OJRA 2W3RA 2IDYA 2JZPA 2LGDA 2GRIA 4LNIA 2GMIC 3ZNGC 2GI9A 2KDBA 2FUHB 2DZMA 1KTKA 5G55A 3HRDD 2KXJA 3M63B 2V0GA 1GC6A 1TZ1A 2CJNA 3H7PA 3KQ4A 4BAXA 5EE3A 2N7DA 1SGHA 3M95A 4IC7B 1C4PA 1C3TA 3L4PA 2JWUA 4JE3B 4GDKA 1L4DB 3DBSA 1N60A 3DBHB 3PLVA 1FPYA 1XXGA 1PGAA 3LXFA 1D4BA 3U2SC 1ISNA 3DBLB 4GOCA 1TBEA 3T8MA 1IP9A 2EKIA 3BZDB 3HVZA 2KX0A 2D3AA 3CWIA 2MX2A 2IGDA 2L05A 4K81A 3DVNU 4WAAA 4YSYB 2IZVB 4KDIC 2JY6A 1EWYC 3B1LX 2M0AA 1IGDA 1LO5D 1SE9A 5D94A 2KTRA 3NY5A 4LTUA 2ICIA 3GZNB 2Y5CA 1PDXA 1F1HA 2BYTA 2QC8A 4AJWA 1VR9A 2V9HA 4WJOA 2ZW1A 1I7HA 1TTNA 2AWTA 2L7RA 2JYTA 3R8BA 1Z5SB 3ZDMC 1XD3B 3AEFB 2MA9B 4YWGG 1TS2A 2KACA 1ROEA 2M17A 2W3SA 4IWPA 3UGBB 2DZJA 1KM7A 4W9HA 1WZ3A 3DBHI 3BVMA 3QAQA 1FNUA 2I1KA 4BBNF 1SB3C 3ZXVA 3UQBA 3Q8FA 3CSFA 4JGHB 4MM3A 2CHWA 3DBLI 2LRUA 3P4RB 1L0XB 2QCZA 4QAYA 4GN1A 4ITKA 2M56B 4MH8A 3SR6A 4BZAA 4HLEA 3HM6X 2PJHA 4MGZE 1TT5B 1QKZA 1I4QA 4HRSA 4XWTA 3BVGA 1ZP0B 2CHXA 3H7SA 4MDKE 4PYUA 1ET9A 2LGSA 1V97A 3IBEA 1BT0A 2M1MA 3RNEC 2BB5A 2INPE 2KK8A 3HVDA 2N1WA 2BWES 3DHGC 4K3CA 3ZRCA 3I9V1 2MHJA 2N7EA 4WIPA 1VCBA 4DBGA 2CU3A 3TJPA 1MG8A 1ZPSA 5C1ZA 1GJZA 4ANUA 3RNGC 4B0MA 1OQQA 2K8BA 2KTFA 3M62B 1E8WA 2NBUA 3FILB 1A70A 4US9A 4PK1A 2ZNVC 5AZHA 1WXQA 3TEXA 4JLCA 3SU8X 4LNOA 3QJZA 2PVOD 2V1YA 4NAWA 3TSSA 2R61A 1E5WA 1J7AA 2XN9C 5EE1A 3HM3A 2KDFB 2WS3B 1KLUD 4TQ0A 2AQ1B 1KLVA 3N3KB 3MFGA 4KKIA 2H88B 2KWCA 2N7JA 3AULA 1L0VB 3Q2AC 2WXPA 3SEBA 2PLPA 2FCQA 1FEHA 3KYCD 2WXQA 3I57A 3AE2B 2LI5A 3W2DA 3E9SA 1YJ1A 1YQ4B 3PT2B 3A4SC 4FULA 4R3DA 4M0WB 2BQQA 4GMVA 1AWDA 4RF1A 2IPKD 5TR5A 4RGNA 1M94A 1D5XC 2WNMA 1MFWA 2Q5WD 4RM8A 3EECA 1Q0WB 3MHZA 2YLMA 2KMAA 1GG3A 2PIAA 3RNCC 1LM8B 1DGJA 1UBIA 2KAJA 4L1BA 4W9FA 3U52E 4F7ZA 2WLBA 2MH7A 3AE6B 4ZRQA 1RFKA 1L6VA 1P9DU 4FXCA 4RM9A 1HTOA 4NJ7A 4WWNA 3N30A 1UF0A 3M3JA 2IY0B 3CIRB 1WYWB 4HWIB 4DHJB 4ACFA 2JXXA 2ZZPB 3QIJA 4L23A 2DLBA 4MEMA 3ABVB 3ECIA 3FAHA 2A4ZA 4B6WA 2KJ6A 3AXCA 5T8IA 2WU5B 1UGMA 2MBOA 1VDVA 1NENB 1J7BA 4FBJB 3ZTDA 1KFYB 2NTTA 5FK9C 3N20C 3KLSX 2GBJA 1TS3A 3R7RA 1EU3A 2JWZA 4P1BC 5CHFA 4IG7B 4LCDE 1NI2A 4KZ0A 3ZDTA 3MC0B 4HXDA 1DOYA 4AJYB 2O2VB 4RH6A 3JSVA 1WSPA 2QHOA 5EDSA 5LLIA 2G4SA 3MJ5A 1TS5A 4OZBA 2BS4B 3RNBC 2ZCBA 1WX7A 5TSSA 4KIKA 1T6BX 1C78A 4ASWC 2GBMA 3QA8A 1J19A 3U8ZA 4FJZA 2D2QA 2J42A 2KDIA 4OVZA 3Q69A 4IM2A 1L7YA 5JHAA 1JMLA 2WXOA 4A9AA 5E6NA 4YTMB 1GB1A 1YQ3B 4B95A 1V1OA 5IAAC 2LRWA 3A9KB 4P16A 3TL5A 2KC1A 1AN8A 2JYEA 3LDZE 4AQ7A 4G50A 2OOBB 3AE5B 2QILA 1TYGB 4K1RB 1IBXA 2JU6X 3NOBA 4PS8A 3PRPB 2C5LC 3EC8A 3ZLZA 2LHEA 2WX1A 1WXSA 1R7SA 2VZKD 1BUIC 1V86A 4P1CC 4TMAB 3KWLA 1QQRA 4OHJA 4IDIA 3APDA 2CKHB 3PVLA 4M00A 3SD5A 4W9CA 3KUZA 1JALA 4NZLB 2NCNA 1N5XA 2DAJA 3A4RA 3V62A 3IXSA 1NYQA 1E7PB 1C77A 3WAOA 2C7NB 1C9FA 3T3NA 4GIVA 1Q5WB 1GPXA 3DVGY 2KMCA 1MHXA 3C19A 2L0TA 2MEKA 1PFDA 2K8CA 3PLUA 4XX5A 3DBRI 2D07B 3RZWC 2BW2A 2NVUI 2V4LA 4HJGE 3AN1A 2WXMA 3TEZA 2JRIB 1CZPA 1VZ6A 2L32A 2D11A 4WWPA 2N9PC 1NDDA 4K7SA 1KLGD 4E74A 2G1EA 2PMVA 4YT0B 1EU4A 3AM9A 1KOTA 2LD9A 1I42A 2DZIA 4HK2A 3ZQ4A 5KHOA 2N9XA 3P2BA 3LJ3A 3WAMA 4HDOA 2D5GA 4GDLB 2AQ2B 4NJ6A 2TSSA 2FBWB 2KN4A 4ZRKA 1T5XD 1MVKA 2C7HA 4W9GA 3AE3B 1SIFA 1E8YA 2Z0EB 1T0RC 2LVPA 5DPSA 2R2OA 1VD2A 1GNUA 1TIFA 3DVGX 5D2MB 4TSSA 4ARCA 2DZKA 4TKNA 4HKZE 1C76A 3ZW3A 5IA7A 3VTUA 1WX8A 2C9WB 3N1YC 1TKEA 3RCZA 2MP2B 4NJCA 4TQ1A 2KLGA 2XBBC 2JQRB 4EZLA 4LDTD 2E3TA 2J0KA 3CF6E 4IWOA 1T3QA 2RMMA 1EWCA 1WWTA 3L54A 2ZEQA 3BIID 2O6VB 4K3BA 1C79A 2JUOA 4M01A 2ZPNA 3WANA 2KZRA 1A5RA 2KN5A 4N59A 4YTNB 5BMIA 2PEAA 2PPHA 2BWFA 4FJYA 2ACZB 2FNJB 2NPTA 3ZJUA 3ONSA 3VVWB 5AUIA 1WGYA 1XF5L 1L5PA 4WJNA 2PE6B 2DWQA 1WXMA 2K8HA 3EHVA 4GU2A 4KKJA 2MQJA 4ZRJA 2LUEA 4N6EB 1WGRA 2L0FA 4LNKA 4ICUA 3UI3A 1H4RA 2KVRA 1YN3A 3H9DA 4II2B 1N5WA 2FE8A 1LXDA 1JROA 1XLNA 2PTLA 5EE0A 3GE8C 4XDDA 1V1PA 2K6DB 2YEPF 4ZDVA 4DWFA 1P0RA 2WXJA 3A9JA 3PGEA 4MJSB 5AZFA 5C3JB 2RGFA 1HEZE 3A1QB 3JW0X 4W9KA 2N4FA 5LXHA 1WXVA 2Y5BB 2W9NA 3VFKA 1JWUD 2BB6A 1RFAA 3AMZA 5EE9A 3NVZA 1DOIA 2Z59B 3P63A 4YSXB 3C8YA 4DHZE 1ZXIA 2JF5A 3AH7A 2LGYA 2ZPYA 4RGMA 1KRHA 2WX0A 4ZRPA 2KO3A 1Z2MA 3GP7A 2OJWA 5JXVA 2V4IB 2W54A 2IO1B 1TS4A 2AQ3B 3WAPA 4CHKA 4WURA 1NVID 2BS2B 2K39A 4BBNC 1UWMA 5KHQA 3PRMB 4IM0A 2D10A 2D3BA 3QX1A 1F0ZA 3AEAB 1WMHA 4ZHOA 2WHIA 1WR6E 2KC2A 1WRIA 3PTFC 3IT6B 2KQ4X 3PO0A 1QZEA 2WXIA 2J4XA 2ASQA 3ML9A 2M4NA 5IP4D 1QOAA 1I4PA 1K50A 1SBBB 1HTQA 3VUXA 3KUDB 3QHTA 1H8CA 1WRDB 3DOWA 2IGGA 2LJ5A 2SEBD 1MPEA 3NVVA 2KFKA 4H2AA 3KVFB 4KZCA 3Q3MC 3TEWA 4HROA 1FRDA 1UUPA 1QT9A 4FHKA 3HHMA 2N0SB 1OEYA 1YX6B 3Q3JA 3OWEB 1N62A 4WH4A 3ZRFA 2K6QA 3ZNHB 4D2KA 4E3CA 2RPQA 4GB9A 2HD5B 3P4SB 1YIWA 3BVZA 3APCA 1E7UA 1JRPA 2GBRA 2J53A 4EFOA 4NQLB 3NS8A 4W9DA 1JQ4A 1WJUA 3DQVA 4A90A 4YL8A 5FR6A 1GUAB 3RZFA 4XC2A 3TIXA 3IG3A 1D5MC 3A33B 5H8YE 1FFVA 1WF9A 1L4ZB 2E6XA 1OFFA 3V6CB 3Q3OC 2Z0DB 2I1JA 5DPTA 4JX1C 3L13A 1UZXB 3SFEB 5L95C 2K25A 3NG0A 4DHJD 3RNFC 3VXWA 1D5ZC 1VZ7A 1RAXA 3IT4B 1OEYJ 2LVOA 2UYZB 2WDTB 4FLHA 5D7GA 3CMMB 5JHBA 2AX5A 2KJHB 3OAWA 4EOYA 2LVQA 4ANWA 4F8CB 3U7DA 1XO3A 3OJ4B 1QOGA 3H1UA 2WDQB 1NBFC 5H92C 3KYDD 2KWUB 2H89B 2L3ZA 1ZXHA 5I4DA 2KOXA 4JIOU 2KFJA 2BKRB 4G3XB 2R2QA 1VZ8A 3R66C 1SE3A 1D6EC 4ANXA 2HTME 1RWSA 2AEHA 3B08A 3W5VB 1J0GA 2Y3AA 1YD8U 4LJPB 1WI0A 2VRRB 3AEGB 3GS2A 3P4PB 2RPVA 2XK5B 1P1AA 3OLMD 3AECB 4RCOA 5D3IB 2C60A 1WGHA 1Y8RC 3Q3FA 1R4NB 3K9PB 1SIJA 4M8MA 3L08A 3D32A 3GE3C 2A5UA 3VH3B 3KWVA 3JVZX 2MW5A 1NI3A 1FXIA 1MJDA 1XCQL 1QF6A 2X8XX 4RMAA 2MCNB 4WQOB 3TBLD 1V6EA 2NS5A 1XLOA 2J7QB 3AEBB 2WXRA 4REZA 1GC7A 3RFZB 3WIMA 4KV2A 4MACA 3K9OB 2BYVE 3ML8A 2WDVB 3RNAC 3IAS1 2KHWB 5LNK1 2IO3B 3IAM1 3I3TB 3LYYA 1CK1A 3R3MA 1V2YA 1J8CA 3H7PB 2QJLA 4I6PA 4MT5A 1PGXA 2K1FA 2ZJDA 4BKSD 4ZOHC 1P7EA 4GDKB 1N63A 1R4NI 4C7ZA 1V9JA 3UQAA 1MHHE 1YMHE 1RM6C 5FR3A 2BYFA 1MG4A 4C7YA 2MJDA 2L1AA 2RDBC 2L8JA 3TUOA 3NRZA 2NMQA 2NTSA 4USAA 2WQYB 4HPMB 3BYYB 4PS3A 1VRAB 3X0WA 2FIFA 5CTRC 4OZCA 1EUVB 1WZ0A 3DBRB 3PHWB 4AOFA 4XGAB 1F77A 4RGOS 3QCAA 2JT4B 1XT9B 4W9LA 1SJHD 2JVCA 2KTRB 3Q8BA 2ZVOA 3NHEB 3Q14C 5AZGA 3MHSD 2AYOB 2B3AA 2RSUA 4NY0A 2D3CA 2JRHA 1K51A 3AV8A 4S17A 2KJRA 4C56C 4ICVA 4FN2A 3B9JA 2V3PA 3RUIB 1QILA 2KYWA 4WWMA 1E7VA 2LFIA 1E6EB 2DENB 3VUWA 2V3SA 4GLSC 5D3DA 1FCCC 2IO2B 4MM3B 2FIDA 3RD2A 2IGHA 1K8RB 3DPDA 1JWBD 4C4VB 5AEKB 1V80A 2KANA 2N9LA 4B0EA 2WXNA 3RN9C 3WA0A 1UGJA 2VH1A 3ZXRA 1HQRD 3VRAB 4B9KA 4RNAA 2JZZA 2MWSB 3IVFA 3FKYA 4S0RA 4MGYE 4EUTA 4IKGA 2HJ1A 1J7CA 3J9CA 3BK2A 4MGIE 1Y56A 3FILA 5BYSA 2JXTA 2O6VD 2Y5PA 1E8XA 4XE0A 4AWJA 4EEWA 3FC4A 5BYRA 3L10B 1C4CA 4JPSA 4C00A 1EM7A 3AE9B 2GB1A 4WQMA 1XLPA 3W9CB 3BY4B 4DQOC 2KLCA 4OZAA 4NAWB 1LFDA 2BBCA 3QWZB 5DPRA 4CO7A 4ZRIA 2I38A 4JWUC 1SXTA 2OEDA 3NVYA 4ARIA 2GBNA 2EMSA 2RDGA 1TY2A 2MBQA 2DYBA 3PRZA 1PGBA 1V81A 4M0WA 3W5UB 1FFUA 3B2GA 5D6JB 3T3OA 3EGRA 1FM0D 2PW9A 2DYOA 1ZKHA 2KT7A 3O65B 3W1SC 1HZ5A 1PYWD 5DCNA 1T0YA 4K7WA 1JRUA 3DHIC 1S3SG 2G3QB 2UWQA 5IOIA 3VUYA 2HJ8A 1SE2A 4CYEA 1Q1OA 2MJ3A 1JWMD 3H6NA 4W9EA 5BMGA 4HPPA 1ZUD2 3DCGA 2HE7A 3SFDB 1T0QC 1FO4A 4BOZB 5CHWA 2LGIA 3HUIA 1QOBA 1EO6A 1HZ6A 2BPSA 4OW0A 4WJPA 2WXLA 3VTVA 1QLBB 2UU7A 2FCSA 2LASA 5JH5C 1WGDA 3NZUA 2INCC 1LQBA 2INNE 4AS1A 4AP4C 4I6LB 3E56A 1FMAD 1FXAA 4IUMB 5C2TB 1I4GA 1JW9D 2LXAA 3MP9A 4MGKE 2O2VA 1DYQA 1N61A 2QIEB 2EMTA 2K3UA 1WM2A 2WDRB 3WCQA 3ZUNA 1D3ZA 2Z8LA 1E8ZA 1TZOA 2L00B 1ZDXA 3R2TA 2FCMA 2YVCA 4NNJB 1YJIA 1XQQA 1E90A 2G45B 3EFUA 3AU5A 3JSVB 3L16A 1JCKB 2CS4A 3CSTA 3PSEB 4MSMB 2FAZA 2LUMA 3V05A 2N9EB 1GOZA 4G0NB 1RLFA 4KIKB 4E71A 5IN7A 2WU2B 1WGKA 5J2RA 1F9JA 1N6ZA 2KD0A 3OG5A 1XEEA 1YN4A 3A9KA 1FXTB 5G2NA 3PPAA 5BYQA 2IBIB 3B2FA 3U7ZA 2DBYA 2JZ3B 2WXHA 4G11A 4J3OD 2RDHA 4JL9A 4DXAB 3HIZA 2KQ7A 4BVUC 4A3PA 4A8XC 3NS1A 5HFYA 3I63C
chains in the Genus database with same CATH topology
1TYGB 2WDQB 3PZ7A 1IBXA 2JU6X 4ZYSA 5H92C 1GB4A 3R2IA 1GAQB 2H89B 1IBXB 1ZXHA 1RYJA 5I4DA 2W82A 5BMHA 2JSVX 2LHEA 3LB8C 1K53A 4NAMA 4DXGA 1VZ8A 1SE3A 1D6EC 1R7SA 1TY0A 1RWSA 2HTME 2VZKD 3W5VB 1B9RA 2Y3AA 1BUIC 4TMAB 1TJEA 2V3NA 3KWLA 2K0PA 4L2YA 1P7FA 3TEYA 1Q10A 1QQRA 4OHJA 4IDIA 2KWDA 1ESFA 1F2RI 1QOFA 2J52A 1WYGA 3AEEB 3AEGB 3GS2A 3NZ3A 2RPVA 3P4PB 3EA6A 3AECB 4RCOA 5D3IB 1JALA 4NZLB 4A55A 1I4RA 1JWAD 1N5XA 1IGCA 1UWXA 3BYTB 1ZOYB 2WP9B 1SIJA 3IXSA 5FKAC 1NYQA 1E7PB 1C77A 2YEPB 3N9YC 3KWVA 1C9FA 1JWSD 3T3NA 4UDUC 1GPXA 4ZHPA 2OHFA 2IJ0A 1NI3A 2PVGC 1FXIA 5HI1A 1MHXA 4XWWA 1QF6A 1XCQL 2HDEA 1B1ZA 1FD6A 2MEKA 1V8CA 1PFDA 2BT6A 1SF0A 3P1MA 1AYFA 1HXYD 1XLOA 3AEBB 4KGTA 1HA5A 2WXRA 1E9MA 4REZA 3EUB2 1YN5A 3RPFC 3RFZB 4RGTA 3P42A 2BW2A 3O13A 4MACA 1K52A 4HJGE 3AN1A 2WXMA 3TEZA 3ZJTA 2W3RA 1CZPA 1VZ6A 2L32A 2WDVB 2IDYA 2JZPA 2GRIA 2SAKA 3IAS1 2GI9A 5LNK1 1KLGD 2G1EA 1KTKA 2PMVA 1YJJA 1EU4A 3AM9A 3HRDD 4YT0B 3IAM1 2V0GA 3ZQ4A 2CJNA 1STEA 2CJOA 3LYYA 1CK1A 3KQ4A 2D5GA 3NVWA 1NEKB 5EE3A 4GDLB 2AQ2B 1C4PA 1SSNA 1SE4A 2TSSA 2FBWB 3L4PA 2KN4A 2JWUA 1T5XD 4JE3B 1MVKA 2QJLA 3AE3B 4DXFA 1L4DB 3VQIA 4MT5A 1PGXA 1N60A 3ZYYX 1XXGA 1PGAA 4ZOHC 1P7EA 4GDKB 3LXFA 1N63A 1D4BA 3DWGC 3U2SC 4C7ZA 4TSSA 1MHHE 1YMHE 1RM6C 5FR3A 4YSZB 4ARCA 1BXTA 3V3XA 1ZDVA 4HKZE 2MJDA 4C7YA 3ZJVA 2EKIA 2L1AA 3BZDB 1C76A 1FNVA 5MPOA 3HVZA 3AE4B 3CWIA 1ENFA 2IGDA 3TUOA 4YSYB 3NRZA 4RF0A 2NMQA 2NTSA 4USAA 2WQYB 1ACCA 3BYYB 1TKEA 1EWYC 1VRAB 2M0AA 2PKOA 1ZE3D 3ZGZA 4OZCA 1IGDA 1LO5D 4NJCA 4TQ1A 4LTUA 2ICIA 2JQRB 3AE1B 1F77A 4LK0M 1ET6A 3ETRA 4RGOS 2E3TA 1PDXA 2Y5CA 1OQRA 3Q8EA 1SJHD 2BYTA 3Q8BA 1E10A 1VR9A 2ZW1A 1I7HA 1T3QA 3PZ8A 2RMMA 2QSDA 1EWCA 1WWTA 3AEDB 2BS3B 2JYTA 3R8BA 3AEFB 3BIID 4YWGG 2BTEA 1TS2A 2K9XA 1K51A 3AV8A 2KACA 1ROEA 1C79A 4C56C 1FRRA 2QEJC 1VJKA 4N59A 4YTNB 2W3SA 5BMIA 3VR9B 3B9JA 2V3PA 3AE7B 1QILA 3BVMA 4WWMA 1FNUA 1CJEA 1M4VA 1VLBA 2LFIA 1E6EB 2ONQA 4P6VF 1SB3C 3Q8FA 4GLSC 2ACZB 5D3DA 1FCCC 3P4RB 2LJIA 1L0XB 1DOXA 3ZJUA 4ITKA 2M56B 3VRBB 4MH8A 5AUIA 1XF5L 4MM3B 3SR6A 1SJED 1L5PA 2IGHA 3H8HA 2B76B 1QKZA 1JWBD 1I4QA 4HRSA 4XWTA 3BVGA 2DWQA 1ZP0B 2N9LA 1AW7A 4B0EA 2W55A 1ET9A 2WXNA 4KKJA 1V97A 4N6EB 1UGJA 1FCLA 1HQRD 2BB5A 3NS1A 3URYA 1C4AA 3UI3A 3VRAB 2KDMA 1YN3A 2INPE 4JWSC 3HVDA 4KGSA 4RNAA 2G9HD 2WXKA 3I9V1 1N5WA 2FE8A 1JROA 4IKGA 4WIPA 1J7CA 2CU3A 1XLNA 3J9CA 2PTLA 1ZPSA 3BK2A 5EE0A 1Y56A 3FILA 4XDDA 1V1PA 5BYSA 4B0MA 2YEPF 1OQQA 4CQNA 1XLQA 2JXTA 2WXJA 4N58A 1UNSA 2ON8A 3FILB 1A70A 2MJEA 4XE0A 1V1PB 2Y5PA 4KX6B 4US9A 5C3JB 1WXQA 3FC4A 5BYRA 3TEXA 1C4CA 4JPSA 1HEZE 2PVOD 3TSSA 1EM7A 4LLGM 3AE9B 2GB1A 4WQMA 1XLPA 2R61A 3W9CB 1J7AA 4DQOC 2XN9C 5EE1A 1TKYA 4OZAA 4NAWB 1JWUD 2WS3B 1KLUD 2BB6A 2AQ1B 4TQ0A 3MFGA 4KKIA 3AMZA 2BBCA 2H88B 1CQVA 5EE9A 2N7JA 3NVZA 1KF6B 2LHDA 1DOIA 2L52A 3P63A 1L0VB 2I38A 3C8YA 4YSXB 2WXPA 3SEBA 2PLPA 4JWUC 1FEHA 1SXTA 1ZXIA 2OEDA 3NVYA 2N9KA 4ARIA 3AH7A 4RGMA 2RDGA 1TY2A 2WXQA 3I57A 1FIQA 1KRHA 3AE2B 4ZRPA 2WXGA 1PGBA 4M0WA 3W2DA 3GP7A 4A6QA 5JXVA 3W5UB 2V4IB 2W54A 1FFUA 3E9SA 1TKGA 1YQ4B 1L0YB 1TS4A 2AQ3B 2M19A 3B2GA 1SEBD 4R3DA 4HKQA 4WURA 1NVID 2BS2B 3T3OA 3EGRA 1FM0D 4KGRA 1UWMA 3W1SA 3DWMA 4C80A 2KMMA 4HEA1 1IUEA 1AWDA 2PW9A 1F0ZA 2DYOA 4RF1A 3AEAB 2IPKD 1HZ5A 1PYWD 1I4XA 4O1NA 4ZHOA 4RGNA 1I4HA 4XDCA 2WNMA 1D5XC 2Q5WD 5G5HA 3MHZA 1WRIA 1L6UA 3IT6B 2KQ4X 2PIAA 3PO0A 4Q2JA 1DGJA 2KAJA 2WXIA 4L1BA 2J4XA 3U4EG 1SE2A 2MJ3A 3U52E 1JWMD 2WLBA 1QOAA 2MH7A 3AE6B 4ZRQA 1I4PA 3VR8B 1RFKA 1L6VA 4FXCA 1K50A 1SBBB 1YNTE 1KH0A 5BMGA 1BMLC 3NUHB 1ZUD2 1E0ZA 2IGGA 2SEBD 3SFDB 3CIRB 1MPEA 1FO4A 3NVVA 4H2AA 5E6JA 5HG2A 2LGIA 3HUIA 4L23A 3TEWA 2DLBA 3ABVB 1QOBA 4HROA 1FRDA 1HZ6A 1FNWA 1UUPA 3FAHA 5HHDG 4OW0A 1QT9A 2WXLA 3BWUD 2N0SB 1QLBB 3OWEB 5T8IA 1N62A 2WU5B 4WH4A 3Q8AA 3P4QB 4PT5A 2EELA 4D2KA 4IOIE 1VDVA 2LMCA 1NENB 1J7BA 2INNE 3P4SB 4AS1A 4YXDB 1KFYB 3BVZA 3E56A 1FMAD 2NTTA 5FK9C 3AE8B 1FXAA 2K22A 5C2TB 1I4GA 1JW9D 5GXGB 1JRPA 2J53A 2QMTA 3KLSX 3MP9A 1TS3A 1JQ4A 1EU3A 2JX5A 3BK1A 2FUG1 1DYQA 1N61A 2QIEB 2K3UA 2WDRB 3MC0B 4A90A 3WCQA 2DYMA 4EE2A 1DOYA 2Z8LA 1TZOA 2VZKB 4RH6A 1ZDXA 2X38A 3R2TA 1WSPA 2LEKA 1D5MC 1MI0A 5H8YE 1FFVA 1YJIA 1L4ZB 2E6XA 4WAFA 3MJ5A 1TS5A 4OZBA 1OFFA 2BS4B 1JCKB 2ZW0A 5TSSA 1T6BX 1F2RC 1C78A 2LUMA 4US8A 3V05A 1GOZA 4JX1C 2L83A 1NYRA 3SFEB 2K5PA 2WU2B 1WGKA 2J42A 1PUTA 4OVZA 2XNAC 1D5ZC 1VZ7A 3Q69A 4YTPB 3IT4B 1JMLA 1XEEA 4RFBA 1YN4A 2WXOA 4A9AA 4YTMB 1GB1A 1YQ3B 5D7GA 5BYQA 3B2FA 1V1OA 2AX5A 3GB1A 3U7ZA 3Q8CA 2DBYA 5AUKA 2I2YA 1XCTL 2WXFA 2WXHA 4P16A 4J3OD 2RDHA 1AN8A 2JYEA 4AQ7A 1XO3A 3AB5A 4A8XC 1QOGA 5G5GA 5HFYA 3AE5B 2QILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TYG B;  2WDQ B;  3DWG C;  4C7Z A;  1ZUD 2;  1N5W A;  1E0Z A;  1JRO A;  4LTU A;  3SFD B;  1RM6 C;  5H92 C;  5C2T B;  3CIR B;  4YSZ B;  1FO4 A;  3NVV A;  4C7Y A;  1J7C A;  2MJD A;  1GAQ B;  1XLN A;  2CU3 A;  2H89 B;  2EKI A;  1RYJ A;  5EE0 A;  3HUI A;  3HVZ A;  3AE4 B;  3CWI A;  1OQQ A;  3ABV B;  1QOB A;  4HRO A;  1FRD A;  3FAH A;  3LB8 C;  1XLQ A;  1QT9 A;  4N58 A;  4YSY B;  3NRZ A;  1R7S A;  2N0S B;  2HTM E;  1A70 A;  1RWS A;  2MJE A;  1QLB B;  2WQY B;  4KX6 B;  1N62 A;  4USA A;  4US9 A;  2WU5 B;  1TKE A;  3W5V B;  1EWY C;  5C3J B;  1B9R A;  1TJE A;  1WXQ A;  2PKO A;  3FC4 A;  3KWL A;  3P4Q B;  2PVO D;  1VDV A;  1NEN B;  3AE9 B;  1J7B A;  3P4S B;  4IDI A;  4WQM A;  1XLP A;  4YXD B;  1QOF A;  1KFY B;  1WYG A;  1J7A A;  1FMA D;  2JQR B;  3AE1 B;  3AEE B;  3AEG B;  3ETR A;  3P4P B;  3AE8 B;  5EE1 A;  1FXA A;  1TKY A;  2K22 A;  1PDX A;  2E3T A;  2Y5C A;  1JAL A;  1JW9 D;  2WS3 B;  1JRP A;  3AEC B;  1OQR A;  5GXG B;  1E10 A;  1I7H A;  1JWA D;  1N5X A;  2H88 B;  3AMZ A;  5EE9 A;  1T3Q A;  3NVZ A;  1KF6 B;  1JQ4 A;  1DOI A;  2L52 A;  1WWT A;  2JX5 A;  3AED B;  3P63 A;  1ZOY B;  2WP9 B;  1SIJ A;  1L0V B;  4YSX B;  2BS3 B;  1N61 A;  4JWU C;  2QIE B;  1NYQ A;  1ZXI A;  1E7P B;  3AEF B;  3NVY A;  3BII D;  2WDR B;  2K9X A;  3AH7 A;  3WCQ A;  3AV8 A;  1DOY A;  1ROE A;  1GPX A;  1FRR A;  4ZHP A;  2OHF A;  1FIQ A;  1KRH A;  1NI3 A;  2PVG C;  1FXI A;  3AE2 B;  1QF6 A;  1VJK A;  4N59 A;  4YTN B;  2W3S A;  3VR9 B;  3B9J A;  2LEK A;  1V8C A;  1PFD A;  3AE7 B;  5H8Y E;  2BT6 A;  1FFV A;  1SF0 A;  1YJI A;  2W54 A;  1FFU A;  3P1M A;  4WWM A;  3W5U B;  1AYF A;  1TKG A;  1XLO A;  1YQ4 B;  1CJE A;  2M19 A;  1VLB A;  1OFF A;  3AEB B;  3B2G A;  1E6E B;  1E9M A;  2BS4 B;  1SB3 C;  3EUB 2;  4P6V F;  3RPF C;  1NVI D;  2BS2 B;  1FM0 D;  2ACZ B;  1UWM A;  3DWM A;  3AN1 A;  2W3R A;  1CZP A;  3P4R B;  2KMM A;  4C80 A;  2WDV B;  4US8 A;  1IUE A;  1DOX A;  1AWD A;  4ITK A;  1F0Z A;  2M56 B;  3VRB B;  3AEA B;  5AUI A;  4JX1 C;  2L83 A;  3SR6 A;  1NYR A;  1L5P A;  4ZHO A;  3SFE B;  2K5P A;  2WU2 B;  1WGK A;  2B76 B;  1PUT A;  2G1E A;  2Q5W D;  4YT0 B;  1YJJ A;  1JWB D;  3AM9 A;  3HRD D;  5G5H A;  4HRS A;  4YTP B;  2DWQ A;  1ZP0 B;  1WRI A;  2CJN A;  1L6U A;  2CJO A;  4A9A A;  2PIA A;  2W55 A;  3W9C B;  4YTM B;  3NVW A;  3PO0 A;  1NEK B;  1YQ3 B;  5EE3 A;  1V97 A;  1DGJ A;  2KAJ A;  3B2F A;  4N6E B;  2AX5 A;  2FBW B;  3L4P A;  2DBY A;  5AUK A;  2QJL A;  3AE3 B;  2MJ3 A;  3NS1 A;  2WLB A;  1QOA A;  2MH7 A;  3AE6 B;  3VRA B;  3VR8 B;  1N60 A;  1L6V A;  1RFK A;  4FXC A;  3ZYY X;  4JWS C;  4ZOH C;  1XO3 A;  3AB5 A;  1QOG A;  3LXF A;  5G5G A;  3AE5 B;  1N63 A;  5MPO A; 
#chains in the Genus database with same CATH topology
 3PZ7 A;  5IKC M;  4W9I A;  1UD7 A;  2KWV B;  1IBX B;  3L17 A;  4JQW C;  3IHP C;  4N9F 4;  2W82 A;  3RUL A;  3UIP B;  3MC8 A;  5E6O A;  3ZO5 B;  5DPW A;  4XYC A;  4DXG A;  1TY0 A;  4BKS A;  1TJE A;  2K0P A;  3V60 A;  3TEY A;  4GXB A;  2KWD A;  1ESF A;  1F2R I;  3NZ3 A;  3ZTC A;  1WYG A;  3AEE B;  2LWP A;  3EA6 A;  2FCN A;  4OVV A;  3KH0 A;  1UWX A;  1JWA D;  5BO4 B;  3RMK C;  2IY1 B;  1ZOY B;  2WP9 B;  4C4V A;  2NBV B;  3VH4 B;  2YEP B;  3PHX B;  3N1X C;  4DDG D;  2GOW A;  5CHV C;  4ZHP A;  4LNF A;  2OHF A;  5HI1 A;  1OQY A;  4EZJ A;  2HDE A;  3DDC B;  1V8C A;  1SF0 A;  2KKC A;  5HKH A;  2MLB A;  2LZ6 A;  1E9M A;  4BFR A;  3EUB 2;  1YN5 A;  3RPF C;  4RGT A;  3P42 A;  2N1V A;  1WE6 A;  3O13 A;  1K52 A;  3GZN I;  3QC8 B;  4TUU A;  4KSL C;  2SAK A;  4W9J A;  5E6P A;  1YJJ A;  4GDL A;  3NJT A;  1EF5 A;  4FJV B;  1STE A;  2CJO A;  1WR1 A;  3QAR A;  3NVW A;  3NZS A;  1NEK B;  2LGX A;  4BKT A;  1EF1 A;  1SSN A;  1C1Y B;  1SE4 A;  1S1Q B;  2DNF A;  4LJO B;  4DXF A;  3VQI A;  3HK0 A;  1L2N A;  3ENE A;  3ZYY X;  1G6J A;  3DWG C;  4GSW A;  2IND C;  4YSZ B;  1BXT A;  3V3X A;  1ZDV A;  3ZJV A;  2NBW B;  1FNV A;  3AE4 B;  1ENF A;  3EFC A;  4RF0 A;  1ACC A;  2MP2 A;  2ZCC A;  3ZKJ C;  1P98 A;  2KX3 A;  4P7I A;  3QK0 A;  2PKO A;  3DHH C;  1ZE3 D;  3ZGZ A;  4ZYN A;  1KJT A;  4GGQ A;  3AE1 B;  4LK0 M;  1ET6 A;  3ETR A;  1WH3 A;  4IM3 A;  3C0R B;  2DHZ A;  1OQR A;  3Q8E A;  4TV3 A;  1E10 A;  2G4D B;  3DVN V;  2MRP A;  3PZ8 A;  2QSD A;  1WY8 A;  2KVZ A;  3AED B;  2O6V A;  2BS3 B;  4HPL B;  3PZD A;  2BTE A;  2K9X A;  5CX3 A;  3I5J C;  1FRR A;  2WGS A;  2QEJ C;  1HE8 A;  3ALB A;  4A3O A;  1VJK A;  3VR9 B;  1T0S C;  3AE7 B;  1CJE A;  1M4V A;  1VLB A;  2ONQ A;  4P6V F;  4PS7 A;  5J17 A;  2LJI A;  1DOX A;  2L76 A;  4A20 A;  3ZNZ B;  3VRB B;  1UH6 A;  1SJE D;  2WWZ A;  4FAD A;  3H8H A;  2B76 B;  2NPT B;  2MBH A;  4M8N A;  1AW7 A;  3GOE A;  2W55 A;  5GMV A;  3R7Q A;  2MBB B;  1FCL A;  1OTR B;  3APF A;  3URY A;  1C4A A;  4ANV A;  2KDM A;  4FA6 A;  4JWS C;  4KGS A;  2G9H D;  4EZK A;  2WXK A;  4HDQ A;  1V5T A;  4OVU A;  3PV1 A;  2MSE D;  2KQS A;  2CU1 A;  2J0M A;  4MJS A;  1YX5 B;  4IWQ A;  1WM3 A;  4CQN A;  1XLQ A;  4N58 A;  1UNS A;  2ON8 A;  3A1Q A;  1ZGU B;  2KDE B;  2MJE A;  1V1P B;  2QDF A;  4KX6 B;  5JZE B;  4MH0 E;  2ZNV B;  1WJN A;  2M8S A;  3PRE A;  2DX5 B;  3ZIM A;  1TGZ B;  4HVB A;  3A9J B;  2C7M B;  4LLG M;  4URK A;  4FHJ A;  3PS6 A;  4BKG A;  4WJQ A;  3V6E B;  4NQK E;  1TKY A;  3ZVV A;  2ZVN A;  3VTW A;  1CQV A;  2LXC A;  1KF6 B;  2LHD A;  2L52 A;  3UF8 A;  4DDI D;  1R4M B;  3KUC B;  2HTH A;  3TCA A;  2M0X A;  2N9K A;  2GLS A;  3Q6B A;  4K7U A;  3N32 A;  1YOV B;  1FIQ A;  2WXG A;  4A6Q A;  2BKF A;  1TKG A;  1L0Y B;  2M19 A;  1SEB D;  4HKQ A;  4DK5 A;  4KGR A;  3W1S A;  3DWM A;  1WE7 A;  3VDZ A;  4C80 A;  2NR2 A;  1V5O A;  2KMM A;  4HEA 1;  1IUE A;  1ZW7 A;  2CR5 A;  4KVG B;  1WXA A;  1I4X A;  4O1N A;  1I4H A;  4XDC A;  2J0J A;  4F1S A;  5G5H A;  2XEW A;  1WMH B;  1L6U A;  4BOS C;  2CHZ A;  4Q2J A;  4HJK A;  3U4E G;  4NPN A;  3VR8 B;  3SHQ A;  1YNT E;  1KH0 A;  1UBQ A;  3OJ3 A;  1BML C;  3NUH B;  1AAR A;  2BGF A;  1R4M I;  1E0Z A;  3RI7 C;  4HCP B;  1P3Q U;  3T9L A;  5E6J A;  4HCN B;  5HG2 A;  4IW0 A;  1WX9 A;  1FNW A;  2KFK B;  5HHD G;  5LXI B;  3BWU D;  3RT3 B;  3KW5 B;  4I6N B;  2REX A;  3Q8A A;  3P4Q B;  4PT5 A;  2EEL A;  4IOI E;  2AL6 A;  2LMC A;  4YXD B;  2RD0 A;  4KSK C;  3AE8 B;  2K22 A;  5GXG B;  2QMT A;  3VAW A;  2JX5 A;  3BK1 A;  2FUG 1;  4XZ4 A;  1LGR A;  5IO9 A;  2DYM A;  4EE2 A;  2VZK B;  3JYU A;  2X38 A;  3RYT A;  2LEK A;  1OGW A;  1MI0 A;  3BIN A;  1WGG A;  1IPG A;  3U30 A;  4WAF A;  3W1Y A;  2BYE A;  3X23 A;  4X57 B;  4M02 A;  4LNN A;  3VHT C;  2ZW0 A;  1F2R C;  1PQS A;  3N1Z C;  3MJW A;  4US8 A;  1CMX B;  4KDL B;  2D3G A;  2L83 A;  4EKU A;  1NYR A;  2K5P A;  1YQB A;  1PUT A;  3WAL A;  2XNA C;  4YTP B;  4RFB A;  1IYF A;  4MSQ B;  3V61 A;  2EKE C;  3AU4 A;  3GB1 A;  3Q8C A;  5AUK A;  2I2Y A;  1XCT L;  2WXF A;  2KNB A;  2IO0 B;  2VH2 A;  1I35 A;  2IYD B;  3AB5 A;  1RRB A;  4ZYS A;  5G5G A;  1V49 A;  5MPO A;  2PE9 A;  1GB4 A;  1X1M A;  3B0A A;  3TMP B;  3R2I A;  4II3 B;  1GAQ B;  3QQ8 B;  1RYJ A;  4WWO A;  2DAF A;  4J6I A;  5BMH A;  2JSV X;  3LB8 C;  1K53 A;  1WJ6 A;  3AI5 A;  3MTN B;  2MBE A;  4NAM A;  2RR9 A;  5C23 A;  1B9R A;  2V3N A;  2XK5 A;  4L2Y A;  4PYZ A;  5L83 A;  1P7F A;  3SDL C;  1Q10 A;  2AL3 A;  4MEL A;  1QOF A;  2J52 A;  3Q3N C;  3S2A A;  4AUQ C;  1WFY A;  1F52 A;  4A55 A;  1I4R A;  1UEL A;  1U4A A;  1IGC A;  2WYQ A;  3L0W B;  3BYT B;  5FKA C;  3N9Y C;  1JWS D;  2BVC A;  4UDU C;  3IFW B;  2GBK A;  2IJ0 A;  1WIA A;  2PVG C;  4DHZ B;  5J18 A;  4XWW A;  2BF8 B;  2JPH A;  1B1Z A;  1FD6 A;  2BT6 A;  3P1M A;  1AYF A;  1HXY D;  4KGT A;  1HA5 A;  4LDT B;  3UIN B;  1WJ4 A;  3ZNI D;  3UIO B;  3MC9 A;  3ZJT A;  2OJR A;  2W3R A;  2IDY A;  2JZP A;  2LGD A;  2GRI A;  4LNI A;  2GMI C;  3ZNG C;  2GI9 A;  2KDB A;  2FUH B;  2DZM A;  1KTK A;  5G55 A;  3HRD D;  2KXJ A;  3M63 B;  2V0G A;  1GC6 A;  1TZ1 A;  2CJN A;  3H7P A;  3KQ4 A;  4BAX A;  5EE3 A;  2N7D A;  1SGH A;  3M95 A;  4IC7 B;  1C4P A;  1C3T A;  3L4P A;  2JWU A;  4JE3 B;  4GDK A;  1L4D B;  3DBS A;  1N60 A;  3DBH B;  3PLV A;  1FPY A;  1XXG A;  1PGA A;  3LXF A;  1D4B A;  3U2S C;  1ISN A;  3DBL B;  4GOC A;  1TBE A;  3T8M A;  1IP9 A;  2EKI A;  3BZD B;  3HVZ A;  2KX0 A;  2D3A A;  3CWI A;  2MX2 A;  2IGD A;  2L05 A;  4K81 A;  3DVN U;  4WAA A;  4YSY B;  2IZV B;  4KDI C;  2JY6 A;  1EWY C;  3B1L X;  2M0A A;  1IGD A;  1LO5 D;  1SE9 A;  5D94 A;  2KTR A;  3NY5 A;  4LTU A;  2ICI A;  3GZN B;  2Y5C A;  1PDX A;  1F1H A;  2BYT A;  2QC8 A;  4AJW A;  1VR9 A;  2V9H A;  4WJO A;  2ZW1 A;  1I7H A;  1TTN A;  2AWT A;  2L7R A;  2JYT A;  3R8B A;  1Z5S B;  3ZDM C;  1XD3 B;  3AEF B;  2MA9 B;  4YWG G;  1TS2 A;  2KAC A;  1ROE A;  2M17 A;  2W3S A;  4IWP A;  3UGB B;  2DZJ A;  1KM7 A;  4W9H A;  1WZ3 A;  3DBH I;  3BVM A;  3QAQ A;  1FNU A;  2I1K A;  4BBN F;  1SB3 C;  3ZXV A;  3UQB A;  3Q8F A;  3CSF A;  4JGH B;  4MM3 A;  2CHW A;  3DBL I;  2LRU A;  3P4R B;  1L0X B;  2QCZ A;  4QAY A;  4GN1 A;  4ITK A;  2M56 B;  4MH8 A;  3SR6 A;  4BZA A;  4HLE A;  3HM6 X;  2PJH A;  4MGZ E;  1TT5 B;  1QKZ A;  1I4Q A;  4HRS A;  4XWT A;  3BVG A;  1ZP0 B;  2CHX A;  3H7S A;  4MDK E;  4PYU A;  1ET9 A;  2LGS A;  1V97 A;  3IBE A;  1BT0 A;  2M1M A;  3RNE C;  2BB5 A;  2INP E;  2KK8 A;  3HVD A;  2N1W A;  2BWE S;  3DHG C;  4K3C A;  3ZRC A;  3I9V 1;  2MHJ A;  2N7E A;  4WIP A;  1VCB A;  4DBG A;  2CU3 A;  3TJP A;  1MG8 A;  1ZPS A;  5C1Z A;  1GJZ A;  4ANU A;  3RNG C;  4B0M A;  1OQQ A;  2K8B A;  2KTF A;  3M62 B;  1E8W A;  2NBU A;  3FIL B;  1A70 A;  4US9 A;  4PK1 A;  2ZNV C;  5AZH A;  1WXQ A;  3TEX A;  4JLC A;  3SU8 X;  4LNO A;  3QJZ A;  2PVO D;  2V1Y A;  4NAW A;  3TSS A;  2R61 A;  1E5W A;  1J7A A;  2XN9 C;  5EE1 A;  3HM3 A;  2KDF B;  2WS3 B;  1KLU D;  4TQ0 A;  2AQ1 B;  1KLV A;  3N3K B;  3MFG A;  4KKI A;  2H88 B;  2KWC A;  2N7J A;  3AUL A;  1L0V B;  3Q2A C;  2WXP A;  3SEB A;  2PLP A;  2FCQ A;  1FEH A;  3KYC D;  2WXQ A;  3I57 A;  3AE2 B;  2LI5 A;  3W2D A;  3E9S A;  1YJ1 A;  1YQ4 B;  3PT2 B;  3A4S C;  4FUL A;  4R3D A;  4M0W B;  2BQQ A;  4GMV A;  1AWD A;  4RF1 A;  2IPK D;  5TR5 A;  4RGN A;  1M94 A;  1D5X C;  2WNM A;  1MFW A;  2Q5W D;  4RM8 A;  3EEC A;  1Q0W B;  3MHZ A;  2YLM A;  2KMA A;  1GG3 A;  2PIA A;  3RNC C;  1LM8 B;  1DGJ A;  1UBI A;  2KAJ A;  4L1B A;  4W9F A;  3U52 E;  4F7Z A;  2WLB A;  2MH7 A;  3AE6 B;  4ZRQ A;  1RFK A;  1L6V A;  1P9D U;  4FXC A;  4RM9 A;  1HTO A;  4NJ7 A;  4WWN A;  3N30 A;  1UF0 A;  3M3J A;  2IY0 B;  3CIR B;  1WYW B;  4HWI B;  4DHJ B;  4ACF A;  2JXX A;  2ZZP B;  3QIJ A;  4L23 A;  2DLB A;  4MEM A;  3ABV B;  3ECI A;  3FAH A;  2A4Z A;  4B6W A;  2KJ6 A;  3AXC A;  5T8I A;  2WU5 B;  1UGM A;  2MBO A;  1VDV A;  1NEN B;  1J7B A;  4FBJ B;  3ZTD A;  1KFY B;  2NTT A;  5FK9 C;  3N20 C;  3KLS X;  2GBJ A;  1TS3 A;  3R7R A;  1EU3 A;  2JWZ A;  4P1B C;  5CHF A;  4IG7 B;  4LCD E;  1NI2 A;  4KZ0 A;  3ZDT A;  3MC0 B;  4HXD A;  1DOY A;  4AJY B;  2O2V B;  4RH6 A;  3JSV A;  1WSP A;  2QHO A;  5EDS A;  5LLI A;  2G4S A;  3MJ5 A;  1TS5 A;  4OZB A;  2BS4 B;  3RNB C;  2ZCB A;  1WX7 A;  5TSS A;  4KIK A;  1T6B X;  1C78 A;  4ASW C;  2GBM A;  3QA8 A;  1J19 A;  3U8Z A;  4FJZ A;  2D2Q A;  2J42 A;  2KDI A;  4OVZ A;  3Q69 A;  4IM2 A;  1L7Y A;  5JHA A;  1JML A;  2WXO A;  4A9A A;  5E6N A;  4YTM B;  1GB1 A;  1YQ3 B;  4B95 A;  1V1O A;  5IAA C;  2LRW A;  3A9K B;  4P16 A;  3TL5 A;  2KC1 A;  1AN8 A;  2JYE A;  3LDZ E;  4AQ7 A;  4G50 A;  2OOB B;  3AE5 B;  2QIL A;  1TYG B;  4K1R B;  1IBX A;  2JU6 X;  3NOB A;  4PS8 A;  3PRP B;  2C5L C;  3EC8 A;  3ZLZ A;  2LHE A;  2WX1 A;  1WXS A;  1R7S A;  2VZK D;  1BUI C;  1V86 A;  4P1C C;  4TMA B;  3KWL A;  1QQR A;  4OHJ A;  4IDI A;  3APD A;  2CKH B;  3PVL A;  4M00 A;  3SD5 A;  4W9C A;  3KUZ A;  1JAL A;  4NZL B;  2NCN A;  1N5X A;  2DAJ A;  3A4R A;  3V62 A;  3IXS A;  1NYQ A;  1E7P B;  1C77 A;  3WAO A;  2C7N B;  1C9F A;  3T3N A;  4GIV A;  1Q5W B;  1GPX A;  3DVG Y;  2KMC A;  1MHX A;  3C19 A;  2L0T A;  2MEK A;  1PFD A;  2K8C A;  3PLU A;  4XX5 A;  3DBR I;  2D07 B;  3RZW C;  2BW2 A;  2NVU I;  2V4L A;  4HJG E;  3AN1 A;  2WXM A;  3TEZ A;  2JRI B;  1CZP A;  1VZ6 A;  2L32 A;  2D11 A;  4WWP A;  2N9P C;  1NDD A;  4K7S A;  1KLG D;  4E74 A;  2G1E A;  2PMV A;  4YT0 B;  1EU4 A;  3AM9 A;  1KOT A;  2LD9 A;  1I42 A;  2DZI A;  4HK2 A;  3ZQ4 A;  5KHO A;  2N9X A;  3P2B A;  3LJ3 A;  3WAM A;  4HDO A;  2D5G A;  4GDL B;  2AQ2 B;  4NJ6 A;  2TSS A;  2FBW B;  2KN4 A;  4ZRK A;  1T5X D;  1MVK A;  2C7H A;  4W9G A;  3AE3 B;  1SIF A;  1E8Y A;  2Z0E B;  1T0R C;  2LVP A;  5DPS A;  2R2O A;  1VD2 A;  1GNU A;  1TIF A;  3DVG X;  5D2M B;  4TSS A;  4ARC A;  2DZK A;  4TKN A;  4HKZ E;  1C76 A;  3ZW3 A;  5IA7 A;  3VTU A;  1WX8 A;  2C9W B;  3N1Y C;  1TKE A;  3RCZ A;  2MP2 B;  4NJC A;  4TQ1 A;  2KLG A;  2XBB C;  2JQR B;  4EZL A;  4LDT D;  2E3T A;  2J0K A;  3CF6 E;  4IWO A;  1T3Q A;  2RMM A;  1EWC A;  1WWT A;  3L54 A;  2ZEQ A;  3BII D;  2O6V B;  4K3B A;  1C79 A;  2JUO A;  4M01 A;  2ZPN A;  3WAN A;  2KZR A;  1A5R A;  2KN5 A;  4N59 A;  4YTN B;  5BMI A;  2PEA A;  2PPH A;  2BWF A;  4FJY A;  2ACZ B;  2FNJ B;  2NPT A;  3ZJU A;  3ONS A;  3VVW B;  5AUI A;  1WGY A;  1XF5 L;  1L5P A;  4WJN A;  2PE6 B;  2DWQ A;  1WXM A;  2K8H A;  3EHV A;  4GU2 A;  4KKJ A;  2MQJ A;  4ZRJ A;  2LUE A;  4N6E B;  1WGR A;  2L0F A;  4LNK A;  4ICU A;  3UI3 A;  1H4R A;  2KVR A;  1YN3 A;  3H9D A;  4II2 B;  1N5W A;  2FE8 A;  1LXD A;  1JRO A;  1XLN A;  2PTL A;  5EE0 A;  3GE8 C;  4XDD A;  1V1P A;  2K6D B;  2YEP F;  4ZDV A;  4DWF A;  1P0R A;  2WXJ A;  3A9J A;  3PGE A;  4MJS B;  5AZF A;  5C3J B;  2RGF A;  1HEZ E;  3A1Q B;  3JW0 X;  4W9K A;  2N4F A;  5LXH A;  1WXV A;  2Y5B B;  2W9N A;  3VFK A;  1JWU D;  2BB6 A;  1RFA A;  3AMZ A;  5EE9 A;  3NVZ A;  1DOI A;  2Z59 B;  3P63 A;  4YSX B;  3C8Y A;  4DHZ E;  1ZXI A;  2JF5 A;  3AH7 A;  2LGY A;  2ZPY A;  4RGM A;  1KRH A;  2WX0 A;  4ZRP A;  2KO3 A;  1Z2M A;  3GP7 A;  2OJW A;  5JXV A;  2V4I B;  2W54 A;  2IO1 B;  1TS4 A;  2AQ3 B;  3WAP A;  4CHK A;  4WUR A;  1NVI D;  2BS2 B;  2K39 A;  4BBN C;  1UWM A;  5KHQ A;  3PRM B;  4IM0 A;  2D10 A;  2D3B A;  3QX1 A;  1F0Z A;  3AEA B;  1WMH A;  4ZHO A;  2WHI A;  1WR6 E;  2KC2 A;  1WRI A;  3PTF C;  3IT6 B;  2KQ4 X;  3PO0 A;  1QZE A;  2WXI A;  2J4X A;  2ASQ A;  3ML9 A;  2M4N A;  5IP4 D;  1QOA A;  1I4P A;  1K50 A;  1SBB B;  1HTQ A;  3VUX A;  3KUD B;  3QHT A;  1H8C A;  1WRD B;  3DOW A;  2IGG A;  2LJ5 A;  2SEB D;  1MPE A;  3NVV A;  2KFK A;  4H2A A;  3KVF B;  4KZC A;  3Q3M C;  3TEW A;  4HRO A;  1FRD A;  1UUP A;  1QT9 A;  4FHK A;  3HHM A;  2N0S B;  1OEY A;  1YX6 B;  3Q3J A;  3OWE B;  1N62 A;  4WH4 A;  3ZRF A;  2K6Q A;  3ZNH B;  4D2K A;  4E3C A;  2RPQ A;  4GB9 A;  2HD5 B;  3P4S B;  1YIW A;  3BVZ A;  3APC A;  1E7U A;  1JRP A;  2GBR A;  2J53 A;  4EFO A;  4NQL B;  3NS8 A;  4W9D A;  1JQ4 A;  1WJU A;  3DQV A;  4A90 A;  4YL8 A;  5FR6 A;  1GUA B;  3RZF A;  4XC2 A;  3TIX A;  3IG3 A;  1D5M C;  3A33 B;  5H8Y E;  1FFV A;  1WF9 A;  1L4Z B;  2E6X A;  1OFF A;  3V6C B;  3Q3O C;  2Z0D B;  2I1J A;  5DPT A;  4JX1 C;  3L13 A;  1UZX B;  3SFE B;  5L95 C;  2K25 A;  3NG0 A;  4DHJ D;  3RNF C;  3VXW A;  1D5Z C;  1VZ7 A;  1RAX A;  3IT4 B;  1OEY J;  2LVO A;  2UYZ B;  2WDT B;  4FLH A;  5D7G A;  3CMM B;  5JHB A;  2AX5 A;  2KJH B;  3OAW A;  4EOY A;  2LVQ A;  4ANW A;  4F8C B;  3U7D A;  1XO3 A;  3OJ4 B;  1QOG A;  3H1U A;  2WDQ B;  1NBF C;  5H92 C;  3KYD D;  2KWU B;  2H89 B;  2L3Z A;  1ZXH A;  5I4D A;  2KOX A;  4JIO U;  2KFJ A;  2BKR B;  4G3X B;  2R2Q A;  1VZ8 A;  3R66 C;  1SE3 A;  1D6E C;  4ANX A;  2HTM E;  1RWS A;  2AEH A;  3B08 A;  3W5V B;  1J0G A;  2Y3A A;  1YD8 U;  4LJP B;  1WI0 A;  2VRR B;  3AEG B;  3GS2 A;  3P4P B;  2RPV A;  2XK5 B;  1P1A A;  3OLM D;  3AEC B;  4RCO A;  5D3I B;  2C60 A;  1WGH A;  1Y8R C;  3Q3F A;  1R4N B;  3K9P B;  1SIJ A;  4M8M A;  3L08 A;  3D32 A;  3GE3 C;  2A5U A;  3VH3 B;  3KWV A;  3JVZ X;  2MW5 A;  1NI3 A;  1FXI A;  1MJD A;  1XCQ L;  1QF6 A;  2X8X X;  4RMA A;  2MCN B;  4WQO B;  3TBL D;  1V6E A;  2NS5 A;  1XLO A;  2J7Q B;  3AEB B;  2WXR A;  4REZ A;  1GC7 A;  3RFZ B;  3WIM A;  4KV2 A;  4MAC A;  3K9O B;  2BYV E;  3ML8 A;  2WDV B;  3RNA C;  3IAS 1;  2KHW B;  5LNK 1;  2IO3 B;  3IAM 1;  3I3T B;  3LYY A;  1CK1 A;  3R3M A;  1V2Y A;  1J8C A;  3H7P B;  2QJL A;  4I6P A;  4MT5 A;  1PGX A;  2K1F A;  2ZJD A;  4BKS D;  4ZOH C;  1P7E A;  4GDK B;  1N63 A;  1R4N I;  4C7Z A;  1V9J A;  3UQA A;  1MHH E;  1YMH E;  1RM6 C;  5FR3 A;  2BYF A;  1MG4 A;  4C7Y A;  2MJD A;  2L1A A;  2RDB C;  2L8J A;  3TUO A;  3NRZ A;  2NMQ A;  2NTS A;  4USA A;  2WQY B;  4HPM B;  3BYY B;  4PS3 A;  1VRA B;  3X0W A;  2FIF A;  5CTR C;  4OZC A;  1EUV B;  1WZ0 A;  3DBR B;  3PHW B;  4AOF A;  4XGA B;  1F77 A;  4RGO S;  3QCA A;  2JT4 B;  1XT9 B;  4W9L A;  1SJH D;  2JVC A;  2KTR B;  3Q8B A;  2ZVO A;  3NHE B;  3Q14 C;  5AZG A;  3MHS D;  2AYO B;  2B3A A;  2RSU A;  4NY0 A;  2D3C A;  2JRH A;  1K51 A;  3AV8 A;  4S17 A;  2KJR A;  4C56 C;  4ICV A;  4FN2 A;  3B9J A;  2V3P A;  3RUI B;  1QIL A;  2KYW A;  4WWM A;  1E7V A;  2LFI A;  1E6E B;  2DEN B;  3VUW A;  2V3S A;  4GLS C;  5D3D A;  1FCC C;  2IO2 B;  4MM3 B;  2FID A;  3RD2 A;  2IGH A;  1K8R B;  3DPD A;  1JWB D;  4C4V B;  5AEK B;  1V80 A;  2KAN A;  2N9L A;  4B0E A;  2WXN A;  3RN9 C;  3WA0 A;  1UGJ A;  2VH1 A;  3ZXR A;  1HQR D;  3VRA B;  4B9K A;  4RNA A;  2JZZ A;  2MWS B;  3IVF A;  3FKY A;  4S0R A;  4MGY E;  4EUT A;  4IKG A;  2HJ1 A;  1J7C A;  3J9C A;  3BK2 A;  4MGI E;  1Y56 A;  3FIL A;  5BYS A;  2JXT A;  2O6V D;  2Y5P A;  1E8X A;  4XE0 A;  4AWJ A;  4EEW A;  3FC4 A;  5BYR A;  3L10 B;  1C4C A;  4JPS A;  4C00 A;  1EM7 A;  3AE9 B;  2GB1 A;  4WQM A;  1XLP A;  3W9C B;  3BY4 B;  4DQO C;  2KLC A;  4OZA A;  4NAW B;  1LFD A;  2BBC A;  3QWZ B;  5DPR A;  4CO7 A;  4ZRI A;  2I38 A;  4JWU C;  1SXT A;  2OED A;  3NVY A;  4ARI A;  2GBN A;  2EMS A;  2RDG A;  1TY2 A;  2MBQ A;  2DYB A;  3PRZ A;  1PGB A;  1V81 A;  4M0W A;  3W5U B;  1FFU A;  3B2G A;  5D6J B;  3T3O A;  3EGR A;  1FM0 D;  2PW9 A;  2DYO A;  1ZKH A;  2KT7 A;  3O65 B;  3W1S C;  1HZ5 A;  1PYW D;  5DCN A;  1T0Y A;  4K7W A;  1JRU A;  3DHI C;  1S3S G;  2G3Q B;  2UWQ A;  5IOI A;  3VUY A;  2HJ8 A;  1SE2 A;  4CYE A;  1Q1O A;  2MJ3 A;  1JWM D;  3H6N A;  4W9E A;  5BMG A;  4HPP A;  1ZUD 2;  3DCG A;  2HE7 A;  3SFD B;  1T0Q C;  1FO4 A;  4BOZ B;  5CHW A;  2LGI A;  3HUI A;  1QOB A;  1EO6 A;  1HZ6 A;  2BPS A;  4OW0 A;  4WJP A;  2WXL A;  3VTV A;  1QLB B;  2UU7 A;  2FCS A;  2LAS A;  5JH5 C;  1WGD A;  3NZU A;  2INC C;  1LQB A;  2INN E;  4AS1 A;  4AP4 C;  4I6L B;  3E56 A;  1FMA D;  1FXA A;  4IUM B;  5C2T B;  1I4G A;  1JW9 D;  2LXA A;  3MP9 A;  4MGK E;  2O2V A;  1DYQ A;  1N61 A;  2QIE B;  2EMT A;  2K3U A;  1WM2 A;  2WDR B;  3WCQ A;  3ZUN A;  1D3Z A;  2Z8L A;  1E8Z A;  1TZO A;  2L00 B;  1ZDX A;  3R2T A;  2FCM A;  2YVC A;  4NNJ B;  1YJI A;  1XQQ A;  1E90 A;  2G45 B;  3EFU A;  3AU5 A;  3JSV B;  3L16 A;  1JCK B;  2CS4 A;  3CST A;  3PSE B;  4MSM B;  2FAZ A;  2LUM A;  3V05 A;  2N9E B;  1GOZ A;  4G0N B;  1RLF A;  4KIK B;  4E71 A;  5IN7 A;  2WU2 B;  1WGK A;  5J2R A;  1F9J A;  1N6Z A;  2KD0 A;  3OG5 A;  1XEE A;  1YN4 A;  3A9K A;  1FXT B;  5G2N A;  3PPA A;  5BYQ A;  2IBI B;  3B2F A;  3U7Z A;  2DBY A;  2JZ3 B;  2WXH A;  4G11 A;  4J3O D;  2RDH A;  4JL9 A;  4DXA B;  3HIZ A;  2KQ7 A;  4BVU C;  4A3P A;  4A8X C;  3NS1 A;  5HFY A;  3I63 C; 
#chains in the Genus database with same CATH homology
 1TYG B;  2WDQ B;  3PZ7 A;  1IBX A;  2JU6 X;  4ZYS A;  5H92 C;  1GB4 A;  3R2I A;  1GAQ B;  2H89 B;  1IBX B;  1ZXH A;  1RYJ A;  5I4D A;  2W82 A;  5BMH A;  2JSV X;  2LHE A;  3LB8 C;  1K53 A;  4NAM A;  4DXG A;  1VZ8 A;  1SE3 A;  1D6E C;  1R7S A;  1TY0 A;  1RWS A;  2HTM E;  2VZK D;  3W5V B;  1B9R A;  2Y3A A;  1BUI C;  4TMA B;  1TJE A;  2V3N A;  3KWL A;  2K0P A;  4L2Y A;  1P7F A;  3TEY A;  1Q10 A;  1QQR A;  4OHJ A;  4IDI A;  2KWD A;  1ESF A;  1F2R I;  1QOF A;  2J52 A;  1WYG A;  3AEE B;  3AEG B;  3GS2 A;  3NZ3 A;  2RPV A;  3P4P B;  3EA6 A;  3AEC B;  4RCO A;  5D3I B;  1JAL A;  4NZL B;  4A55 A;  1I4R A;  1JWA D;  1N5X A;  1IGC A;  1UWX A;  3BYT B;  1ZOY B;  2WP9 B;  1SIJ A;  3IXS A;  5FKA C;  1NYQ A;  1E7P B;  1C77 A;  2YEP B;  3N9Y C;  3KWV A;  1C9F A;  1JWS D;  3T3N A;  4UDU C;  1GPX A;  4ZHP A;  2OHF A;  2IJ0 A;  1NI3 A;  2PVG C;  1FXI A;  5HI1 A;  1MHX A;  4XWW A;  1QF6 A;  1XCQ L;  2HDE A;  1B1Z A;  1FD6 A;  2MEK A;  1V8C A;  1PFD A;  2BT6 A;  1SF0 A;  3P1M A;  1AYF A;  1HXY D;  1XLO A;  3AEB B;  4KGT A;  1HA5 A;  2WXR A;  1E9M A;  4REZ A;  3EUB 2;  1YN5 A;  3RPF C;  3RFZ B;  4RGT A;  3P42 A;  2BW2 A;  3O13 A;  4MAC A;  1K52 A;  4HJG E;  3AN1 A;  2WXM A;  3TEZ A;  3ZJT A;  2W3R A;  1CZP A;  1VZ6 A;  2L32 A;  2WDV B;  2IDY A;  2JZP A;  2GRI A;  2SAK A;  3IAS 1;  2GI9 A;  5LNK 1;  1KLG D;  2G1E A;  1KTK A;  2PMV A;  1YJJ A;  1EU4 A;  3AM9 A;  3HRD D;  4YT0 B;  3IAM 1;  2V0G A;  3ZQ4 A;  2CJN A;  1STE A;  2CJO A;  3LYY A;  1CK1 A;  3KQ4 A;  2D5G A;  3NVW A;  1NEK B;  5EE3 A;  4GDL B;  2AQ2 B;  1C4P A;  1SSN A;  1SE4 A;  2TSS A;  2FBW B;  3L4P A;  2KN4 A;  2JWU A;  1T5X D;  4JE3 B;  1MVK A;  2QJL A;  3AE3 B;  4DXF A;  1L4D B;  3VQI A;  4MT5 A;  1PGX A;  1N60 A;  3ZYY X;  1XXG A;  1PGA A;  4ZOH C;  1P7E A;  4GDK B;  3LXF A;  1N63 A;  1D4B A;  3DWG C;  3U2S C;  4C7Z A;  4TSS A;  1MHH E;  1YMH E;  1RM6 C;  5FR3 A;  4YSZ B;  4ARC A;  1BXT A;  3V3X A;  1ZDV A;  4HKZ E;  2MJD A;  4C7Y A;  3ZJV A;  2EKI A;  2L1A A;  3BZD B;  1C76 A;  1FNV A;  5MPO A;  3HVZ A;  3AE4 B;  3CWI A;  1ENF A;  2IGD A;  3TUO A;  4YSY B;  3NRZ A;  4RF0 A;  2NMQ A;  2NTS A;  4USA A;  2WQY B;  1ACC A;  3BYY B;  1TKE A;  1EWY C;  1VRA B;  2M0A A;  2PKO A;  1ZE3 D;  3ZGZ A;  4OZC A;  1IGD A;  1LO5 D;  4NJC A;  4TQ1 A;  4LTU A;  2ICI A;  2JQR B;  3AE1 B;  1F77 A;  4LK0 M;  1ET6 A;  3ETR A;  4RGO S;  2E3T A;  1PDX A;  2Y5C A;  1OQR A;  3Q8E A;  1SJH D;  2BYT A;  3Q8B A;  1E10 A;  1VR9 A;  2ZW1 A;  1I7H A;  1T3Q A;  3PZ8 A;  2RMM A;  2QSD A;  1EWC A;  1WWT A;  3AED B;  2BS3 B;  2JYT A;  3R8B A;  3AEF B;  3BII D;  4YWG G;  2BTE A;  1TS2 A;  2K9X A;  1K51 A;  3AV8 A;  2KAC A;  1ROE A;  1C79 A;  4C56 C;  1FRR A;  2QEJ C;  1VJK A;  4N59 A;  4YTN B;  2W3S A;  5BMI A;  3VR9 B;  3B9J A;  2V3P A;  3AE7 B;  1QIL A;  3BVM A;  4WWM A;  1FNU A;  1CJE A;  1M4V A;  1VLB A;  2LFI A;  1E6E B;  2ONQ A;  4P6V F;  1SB3 C;  3Q8F A;  4GLS C;  2ACZ B;  5D3D A;  1FCC C;  3P4R B;  2LJI A;  1L0X B;  1DOX A;  3ZJU A;  4ITK A;  2M56 B;  3VRB B;  4MH8 A;  5AUI A;  1XF5 L;  4MM3 B;  3SR6 A;  1SJE D;  1L5P A;  2IGH A;  3H8H A;  2B76 B;  1QKZ A;  1JWB D;  1I4Q A;  4HRS A;  4XWT A;  3BVG A;  2DWQ A;  1ZP0 B;  2N9L A;  1AW7 A;  4B0E A;  2W55 A;  1ET9 A;  2WXN A;  4KKJ A;  1V97 A;  4N6E B;  1UGJ A;  1FCL A;  1HQR D;  2BB5 A;  3NS1 A;  3URY A;  1C4A A;  3UI3 A;  3VRA B;  2KDM A;  1YN3 A;  2INP E;  4JWS C;  3HVD A;  4KGS A;  4RNA A;  2G9H D;  2WXK A;  3I9V 1;  1N5W A;  2FE8 A;  1JRO A;  4IKG A;  4WIP A;  1J7C A;  2CU3 A;  1XLN A;  3J9C A;  2PTL A;  1ZPS A;  3BK2 A;  5EE0 A;  1Y56 A;  3FIL A;  4XDD A;  1V1P A;  5BYS A;  4B0M A;  2YEP F;  1OQQ A;  4CQN A;  1XLQ A;  2JXT A;  2WXJ A;  4N58 A;  1UNS A;  2ON8 A;  3FIL B;  1A70 A;  2MJE A;  4XE0 A;  1V1P B;  2Y5P A;  4KX6 B;  4US9 A;  5C3J B;  1WXQ A;  3FC4 A;  5BYR A;  3TEX A;  1C4C A;  4JPS A;  1HEZ E;  2PVO D;  3TSS A;  1EM7 A;  4LLG M;  3AE9 B;  2GB1 A;  4WQM A;  1XLP A;  2R61 A;  3W9C B;  1J7A A;  4DQO C;  2XN9 C;  5EE1 A;  1TKY A;  4OZA A;  4NAW B;  1JWU D;  2WS3 B;  1KLU D;  2BB6 A;  2AQ1 B;  4TQ0 A;  3MFG A;  4KKI A;  3AMZ A;  2BBC A;  2H88 B;  1CQV A;  5EE9 A;  2N7J A;  3NVZ A;  1KF6 B;  2LHD A;  1DOI A;  2L52 A;  3P63 A;  1L0V B;  2I38 A;  3C8Y A;  4YSX B;  2WXP A;  3SEB A;  2PLP A;  4JWU C;  1FEH A;  1SXT A;  1ZXI A;  2OED A;  3NVY A;  2N9K A;  4ARI A;  3AH7 A;  4RGM A;  2RDG A;  1TY2 A;  2WXQ A;  3I57 A;  1FIQ A;  1KRH A;  3AE2 B;  4ZRP A;  2WXG A;  1PGB A;  4M0W A;  3W2D A;  3GP7 A;  4A6Q A;  5JXV A;  3W5U B;  2V4I B;  2W54 A;  1FFU A;  3E9S A;  1TKG A;  1YQ4 B;  1L0Y B;  1TS4 A;  2AQ3 B;  2M19 A;  3B2G A;  1SEB D;  4R3D A;  4HKQ A;  4WUR A;  1NVI D;  2BS2 B;  3T3O A;  3EGR A;  1FM0 D;  4KGR A;  1UWM A;  3W1S A;  3DWM A;  4C80 A;  2KMM A;  4HEA 1;  1IUE A;  1AWD A;  2PW9 A;  1F0Z A;  2DYO A;  4RF1 A;  3AEA B;  2IPK D;  1HZ5 A;  1PYW D;  1I4X A;  4O1N A;  4ZHO A;  4RGN A;  1I4H A;  4XDC A;  2WNM A;  1D5X C;  2Q5W D;  5G5H A;  3MHZ A;  1WRI A;  1L6U A;  3IT6 B;  2KQ4 X;  2PIA A;  3PO0 A;  4Q2J A;  1DGJ A;  2KAJ A;  2WXI A;  4L1B A;  2J4X A;  3U4E G;  1SE2 A;  2MJ3 A;  3U52 E;  1JWM D;  2WLB A;  1QOA A;  2MH7 A;  3AE6 B;  4ZRQ A;  1I4P A;  3VR8 B;  1RFK A;  1L6V A;  4FXC A;  1K50 A;  1SBB B;  1YNT E;  1KH0 A;  5BMG A;  1BML C;  3NUH B;  1ZUD 2;  1E0Z A;  2IGG A;  2SEB D;  3SFD B;  3CIR B;  1MPE A;  1FO4 A;  3NVV A;  4H2A A;  5E6J A;  5HG2 A;  2LGI A;  3HUI A;  4L23 A;  3TEW A;  2DLB A;  3ABV B;  1QOB A;  4HRO A;  1FRD A;  1HZ6 A;  1FNW A;  1UUP A;  3FAH A;  5HHD G;  4OW0 A;  1QT9 A;  2WXL A;  3BWU D;  2N0S B;  1QLB B;  3OWE B;  5T8I A;  1N62 A;  2WU5 B;  4WH4 A;  3Q8A A;  3P4Q B;  4PT5 A;  2EEL A;  4D2K A;  4IOI E;  1VDV A;  2LMC A;  1NEN B;  1J7B A;  2INN E;  3P4S B;  4AS1 A;  4YXD B;  1KFY B;  3BVZ A;  3E56 A;  1FMA D;  2NTT A;  5FK9 C;  3AE8 B;  1FXA A;  2K22 A;  5C2T B;  1I4G A;  1JW9 D;  5GXG B;  1JRP A;  2J53 A;  2QMT A;  3KLS X;  3MP9 A;  1TS3 A;  1JQ4 A;  1EU3 A;  2JX5 A;  3BK1 A;  2FUG 1;  1DYQ A;  1N61 A;  2QIE B;  2K3U A;  2WDR B;  3MC0 B;  4A90 A;  3WCQ A;  2DYM A;  4EE2 A;  1DOY A;  2Z8L A;  1TZO A;  2VZK B;  4RH6 A;  1ZDX A;  2X38 A;  3R2T A;  1WSP A;  2LEK A;  1D5M C;  1MI0 A;  5H8Y E;  1FFV A;  1YJI A;  1L4Z B;  2E6X A;  4WAF A;  3MJ5 A;  1TS5 A;  4OZB A;  1OFF A;  2BS4 B;  1JCK B;  2ZW0 A;  5TSS A;  1T6B X;  1F2R C;  1C78 A;  2LUM A;  4US8 A;  3V05 A;  1GOZ A;  4JX1 C;  2L83 A;  1NYR A;  3SFE B;  2K5P A;  2WU2 B;  1WGK A;  2J42 A;  1PUT A;  4OVZ A;  2XNA C;  1D5Z C;  1VZ7 A;  3Q69 A;  4YTP B;  3IT4 B;  1JML A;  1XEE A;  4RFB A;  1YN4 A;  2WXO A;  4A9A A;  4YTM B;  1GB1 A;  1YQ3 B;  5D7G A;  5BYQ A;  3B2F A;  1V1O A;  2AX5 A;  3GB1 A;  3U7Z A;  3Q8C A;  2DBY A;  5AUK A;  2I2Y A;  1XCT L;  2WXF A;  2WXH A;  4P16 A;  4J3O D;  2RDH A;  1AN8 A;  2JYE A;  4AQ7 A;  1XO3 A;  3AB5 A;  4A8X C;  1QOG A;  5G5G A;  5HFY A;  3AE5 B;  2QIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...