1VJKA

Putative molybdopterin converting factor, subunit 1 from pyrococcus furiosus, pfu-562899-001
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
87
structure length
87
Chain Sequence
SVKVKVKYFARFRQLAGVDEEEIELPEGARVRDLIEEIKKRHEKFKEEVFGEGYDEDADVNIAVNGRYVSWDEELKDGDVVGVFPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords molybdopterin converting factor, subunit 1
publication title Putative molybdopterin converting factor, subunit 1 from Pyrococcus furiosus, Pfu-562899-001 '
rcsb
source organism Pyrococcus furiosus
molecule tags Structural genomics, unknown function
total genus 25
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2004-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1vjkA00
3BIID 1TKEA 4ZHPA 5G5HA 4C7YA 2CJOA 3ETRA 4N59A 2MH7A 4KX6B 3W5VB 2ACZB 4FXCA 1NENB 3AE5B 1OFFA 1CJEA 5AUIA 3EUB2 2Y5CA 1QOGA 2EKIA 5EE1A 2L52A 5H92C 1QOBA 3VR8B 1ZP0B 1V8CA 2PVGC 2WP9B 2K9XA 3AB5A 3AE2B 3B9JA 4JWSC 4P6VF 1YQ3B 2W54A 1NEKB 1ZUD2 4N6EB 2WS3B 3VRAB 3VR9B 4YXDB 1TYGB 1ZXIA 2WLBA 1SF0A 1I7HA 1DOYA 3HVZA 1JWBD 4YT0B 3VRBB 1WWTA 3P4SB 3RPFC 3AMZA 1GAQB 4ZOHC 2M19A 1PFDA 1L6VA 1SIJA 4YTPB 1TJEA 3AEAB 1PUTA 1QOFA 2H89B 1XLQA 3B2GA 3AN1A 3HRDD 3NVWA 1FRRA 3AM9A 1J7BA 1FFVA 2FBWB 2BS4B 4WQMA 1NYRA 1AYFA 3LXFA 4US9A 1V97A 3AEGB 3NVVA 2PIAA 1WXQA 2KAJA 3B2FA 3PO0A 5AUKA 3AECB 1ZOYB 1N61A 2W3SA 5G5GA 1E10A 5MPOA 3AE1B 1RYJA 1EWYC 1E6EB 1FRDA 2G1EA 2K5PA 1JWAD 1YJIA 1L0VB 1UWMA 1QF6A 1WRIA 2QJLA 1DGJA 4US8A 1F0ZA 2JX5A 1DOIA 3AE8B 1WGKA 3NVZA 3P4RB 1A70A 2W3RA 5H8YE 1PDXA 2BT6A 1KFYB 3ZYYX 1RM6C 3AE7B 1VDVA 3AE9B 5EE9A 1GPXA 1OQRA 3NRZA 3AH7A 1L6UA 1FIQA 1XLPA 2DWQA 3AE4B 3P1MA 2Q5WD 2N0SB 1NI3A 4USAA 1N63A 3P4QB 5GXGB 1FO4A 3DWGC 3P63A 2PKOA 1R7SA 1N62A 2WDVB 3AV8A 3FAHA 4JX1C 4A9AA 1FM0D 3CWIA 2AX5A 3AEDB 1IUEA 3ABVB 3SR6A 4YTMB 1VLBA 3HUIA 1WYGA 1J7AA 1JW9D 2BS2B 1FXAA 1J7CA 2E3TA 1L5PA 3P4PB 2WU5B 1JRPA 1QOAA 3NS1A 3W5UB 1N5WA 1QT9A 1JROA 1DOXA 3AE6B 1KRHA 1FFUA 3CIRB 2WDQB 4YSXB 3LB8C 5C3JB 1FMAD 1FXIA 5EE3A 5C2TB 4C7ZA 3AEFB 2KMMA 3W9CB 4YSZB 4N58A 2CU3A 2QIEB 4C80A 4YSYB 4ITKA 1OQQA 1B9RA 1XLNA 1JALA 2BS3B 2DBYA 2W55A 2B76B 1QLBB 1E7PB 1NVID 1TKGA 2M56B 2K22A 3AE3B 4JWUC 1XLOA 3DWMA 3SFEB 1XO3A 2PVOD 2WQYB 4HROA 3L4PA 3NVYA 1E0ZA 2HTME 3AEEB 4LTUA 1E9MA 4WWMA 1N60A 2H88B 1YQ4B 2MJDA 1SB3C 1T3QA 3SFDB 1KF6B 3KWLA 1N5XA 1YJJA 5EE0A 4IDIA 2WU2B 1NYQA 1RFKA 1CZPA 1ROEA 2MJ3A 2CJNA 2OHFA 4YTNB 1RWSA 3WCQA 4HRSA 1VJKA 2L83A 2LEKA 2MJEA 2WDRB 3AEBB 1AWDA 4ZHOA 1JQ4A 3FC4A 1TKYA 2JQRB
chains in the Genus database with same CATH superfamily
1C4CA 4C7YA 4XC2A 4GDLB 3PPAA 1T6BX 3X23A 2BQQA 1TTNA 3SDLC 1YNTE 4WJQA 2LUEA 2L8JA 4A6QA 1JWSD 1L2NA 1ZUD2 2JSVX 5G2NA 4G11A 2L76A 1D5MC 3L08A 4C4VB 1SE4A 4XDCA 1R4NB 4ZRKA 4HEA1 3A9JA 2YVCA 1FRRA 5DPSA 2RR9A 2PIAA 2KAJA 4REZA 2EKEC 1WX8A 1EO6A 4UDUC 5L95C 1WR1A 1DGJA 2BYVE 3WANA 3AE8B 4MGYE 2LRWA 3L0WB 3GOEA 3WAPA 3M95A 2Q5WD 2N0SB 3DVNU 5GXGB 3K9PB 2C5LC 3FAHA 4DQOC 3TEZA 3SR6A 1V81A 2KACA 2YLMA 2NPTB 2BS2B 2K8CA 1T5XD 3NS1A 4LNOA 3RCZA 1MPEA 3J9CA 3R2IA 3I3TB 1MHXA 3BINA 1SSNA 3UI3A 3ZNGC 3Q8EA 4WJOA 4CHKA 1WY8A 1XO3A 2IDYA 3WALA 2MCNB 3KYDD 3BZDB 2RDBC 2QMTA 3GE8C 1R4MI 4NAWB 1Z5SB 4K7WA 1JMLA 2J0KA 1Q0WB 3L54A 1UBQA 2JQRB 4BVUC 2Y3AA 2KTRA 1NENB 2L52A 3B9JA 3AB5A 3IFWB 2LJIA 1EF5A 2KMCA 3ZXVA 4A3PA 3VRBB 2KZRA 1EM7A 3PTFC 4IWOA 1QOFA 1TS2A 3MC0B 3A4SC 3IAM1 1LXDA 1WH3A 3AECB 3HM6X 1ZOYB 2KNBA 1JCKB 1KLUD 1FRDA 1WE6A 4G0NB 1WGHA 1L0VB 1XCTL 5E6PA 4AUQC 2KX3A 2RPVA 2W3RA 1KFYB 2K6DB 1CK1A 5BYRA 4P16A 1MI0A 3VH3B 4CYEA 3DBHB 1R4NI 3FKYA 5LNK1 4MDKE 3ML8A 2MBEA 2PKOA 1N62A 1TY2A 3P4PB 2C9WB 4GDLA 3W5UB 2BKFA 2DZIA 2NS5A 1KRHA 3U7DA 1FMAD 4LNFA 3AEFB 2XBBC 2V4LA 4TQ1A 3WAMA 3LJ3A 2W55A 3AE3B 3MHZA 1SE2A 3AEEB 4JPSA 3SD5A 3PT2B 4WIPA 2GRIA 4WAAA 1IPGA 2G4SA 2CJNA 5IAAC 2BVCA 4F8CB 3UGBB 1WR6E 1V1OA 2GBMA 4BBNF 4BFRA 4KX6B 3L13A 1I4HA 2QC8A 3AE5B 3VR8B 4BAXA 1QOBA 3Q8BA 1PYWD 5JZEB 3VR9B 2VH1A 2QCZA 1OEYJ 2AEHA 1ZXIA 3PREA 2KTFA 2J0MA 1Y8RC 2HTHA 3ZDMC 3C19A 4E3CA 2NPTA 3DHGC 2D3BA 2Z0DB 3NVWA 1L4DB 1XT9B 3E56A 5AUKA 2GBJA 4EEWA 3TBLD 3M63B 3VXWA 2XK5B 1GOZA 1L0YB 4M0WA 3NUHB 3KUZA 1WMHA 3P4RB 4XGAB 1Z2MA 4BKSA 3DCGA 2RGFA 5E6JA 2N1WA 3B0AA 2PLPA 2L00B 2Z0EB 3TEYA 2J4XA 1V6EA 2BGFA 3ZDTA 2BB6A 4P1CC 3L10B 3V60A 4RFBA 1L5PA 2G45B 2KX0A 2V4IB 3KUCB 4TKNA 2NBVB 4IW0A 3ZNZB 4YSZB 3W9CB 1V5OA 3PRMB 3KQ4A 1WXSA 3O13A 2KDFB 5DCNA 1P98A 3VUWA 1QLBB 1E7PB 1XLOA 2HE7A 2IYDB 2WQYB 1MHHE 2WXIA 1VZ6A 3DBHI 2J42A 4GSWA 5IO9A 2MJDA 3IVFA 4MGZE 4HJKA 1WGDA 4ZRJA 2V3PA 2JXXA 4MGKE 4PS8A 5LLIA 4RGTA 2ZCBA 1WM2A 5D3DA 1TKYA 2I38A 2G9HD 1TS3A 4ZHPA 4H2AA 1T0RC 1LGRA 2IBIB 2UWQA 2GBKA 3PRZA 4KSLC 3ZW3A 2AL6A 3Q3JA 4WWNA 2PVGC 1WE7A 3NHEB 4NJCA 3TEXA 1I7HA 4IOIE 4ARIA 1TIFA 1PFDA 1L6VA 1TJEA 1PUTA 3QQ8B 4NQLB 4IM3A 1MFWA 1SE9A 2WHIA 1WXQA 4HK2A 1Q5WB 3OJ4B 4K3BA 2G1EA 3ML9A 4B0EA 1JWAD 2LD9A 5LXIB 3GP7A 3W1SA 2ONQA 3N1XC 3HM3A 1VDVA 4B9KA 4GGQA 2ICIA 4OVUA 1R7SA 3VVWB 3KH0A 4IM0A 1LO5D 4ZRQA 4AJWA 1JROA 4JL9A 2SAKA 3I57A 4IG7B 4B0MA 2WXFA 3VFKA 2REXA 3P42A 4YSYB 4I6LB 4BOSC 2K0PA 2DBYA 2LRUA 1P7FA 3N9YC 1WFYA 1P1AA 1E0ZA 2HTME 3ZO5B 1U4AA 2A4ZA 3DVGY 1ZDXA 4EE2A 3KWLA 5FR3A 1YJJA 1HXYD 3A9JB 3MC8A 1JRUA 1C77A 1CZPA 5BYSA 1YD8U 3PS6A 1UGJA 1VJKA 2QSDA 2M17A 5D2MB 3FC4A 4W9IA 3R2TA 1HE8A 2INPE 2JXTA 2XK5A 4HLEA 3VUXA 4BOZB 4KDLB 3W5VB 3EUB2 4LK0M 1HTOA 1WJUA 2I1JA 5T8IA 2W54A 1TGZB 4WJPA 2OOBB 1KLGD 4FADA 2D3CA 3N20C 2LZ6A 2MWSB 3MFGA 5BMIA 4BZAA 2JU6X 4KDIC 3AMZA 4FA6A 4L1BA 4AOFA 3AEAB 3B2GA 2O2VB 3Q3NC 4WQMA 2LVOA 1P3QU 1V97A 3RZFA 2NBWB 3Q14C 5CHWA 2Z59B 3H7SA 2IGHA 1WRIA 2IJ0A 2ZEQA 3I9V1 1DOIA 2XN9C 1E7VA 2BWFA 3HK0A 3TSSA 4W9KA 5EE9A 5AZGA 1GPXA 2K25A 3IBEA 3DBRB 3RNFC 2N9KA 3DWGC 5D6JB 4A9AA 3Q3MC 4DXFA 1IUEA 1WYGA 2J52A 3WAOA 4OHJA 2JRHA 1F2RI 1FFUA 1VZ8A 3QIJA 4FHJA 1C78A 4YSXB 5EE3A 4ZRIA 4C00A 1UF0A 4DXAB 2MLBA 2L7RA 2FAZA 1TT5B 1JALA 2AL3A 4M8MA 4CO7A 1XXGA 4OW0A 4EUTA 1UNSA 4PT5A 1E5WA 1RFKA 3V61A 4YTNB 2KJ6A 1XQQA 2LGIA 2L32A 1I4PA 4JWSC 4DBGA 2ZNVB 3ZKJC 4NPNA 1VZ7A 2QEJC 2JPHA 1H8CA 4M8NA 3QHTA 4W9DA 4O1NA 1GJZA 2UU7A 2WP9B 3VQIA 3CF6E 1E8XA 2D3AA 2LGSA 1SF0A 2X38A 1KTKA 2JYTA 3BWUD 4LNKA 2BYEA 2IGGA 3RZWC 3ZJUA 2RMMA 1IBXB 1UZXB 3HRDD 4IM2A 4DK5A 1FFVA 3UIPB 2LMCA 1V1PB 1KJTA 3JW0X 2WXKA 2RD0A 3ZGZA 5HKHA 1YJIA 4IUMB 1FD6A 1PDXA 4BKSD 3AE7B 3DDCB 1JWUD 1OQRA 1V86A 4HVBA 2MBBB 4J3OD 2FUG1 1YQBA 3RT3B 3RD2A 3ABVB 1K8RB 3EFCA 4NQKE 1JW9D 1ZPSA 1D5ZC 2CHWA 1K53A 2N1VA 3A33B 4MJSB 3LB8C 4TV3A 3C0RB 3SEBA 1OQQA 4RGMA 4G50A 4GMVA 3IAS1 4TQ0A 1G6JA 4XDDA 4FJYA 2J53A 1QILA 5AEKB 2PVOD 2N4FA 4HWIB 3DBRI 3L16A 3ZNID 1I35A 5BYQA 1SB3C 3PHWB 2O2VA 1QKZA 1ZXHA 5LXHA 1SGHA 4OVZA 3LDZE 3Q6BA 2PW9A 1C4PA 3PZDA 4NZLB 1WXMA 1WGRA 1C79A 2V3NA 3NY5A 1V9JA 4YL8A 3H6NA 1OFFA 4M0WB 1WMHB 1FNUA 4ACFA 4LLGM 4DHZB 2CHZA 2MHJA 2RPQA 2HJ8A 4BKTA 2LUMA 4HCPB 5J18A 4K7SA 1TS4A 3Q3FA 3Q8CA 4FLHA 4A20A 2M19A 1GC7A 2N7JA 3TUOA 3U52E 1FCCC 1M4VA 4PK1A 2W3SA 1E6EB 2WDTB 2WXJA 1ZGUB 2ZZPB 4E71A 1OEYA 1SEBD 4QAYA 1WZ0A 3U4EG 1GB1A 2YEPF 2BKRB 4W9JA 4DDID 2EELA 3M62B 3S2AA 5E6OA 4EZKA 2MBQA 2AX5A 1WF9A 3N1YC 1J7CA 2KKCA 5G55A 1N5WA 2N7DA 1WX7A 4RNAA 1K50A 3ZJVA 4DXGA 2QDFA 2N9XA 4RM9A 2MW5A 4N58A 1AW7A 4C80A 2WXRA 3JVZX 4EKUA 4AS1A 2V0GA 3MP9A 3NZSA 2BWES 2EMSA 2NTTA 4HDQA 2LWPA 4LTUA 4WWMA 2KXJA 1IBXA 2DAJA 1ACCA 3GZNB 1V1PA 1OTRB 5AZHA 1J19A 2LEKA 4RGNA 5GMVA 4ICVA 1VR9A 1QQRA 2L05A 2K39A 3U7ZA 1S1QB 3M3JA 4N59A 3BVGA 5FR6A 4P7IA 1PGAA 2LVQA 5J2RA 5HHDG 4JGHB 1WIAA 4B95A 3D32A 1XCQL 3PSEB 4W9EA 2CR5A 1GAQB 2PTLA 4F7ZA 4MJSA 2DLBA 2KK8A 1UD7A 5L83A 3EFUA 3ZNHB 1UELA 4ASWC 1E10A 1F52A 5MPOA 2KQ4X 2M8SA 2LGDA 2Y5PA 5IOIA 2WYQA 2JX5A 3SHQA 2NTSA 2JY6A 5DPRA 2GMIC 3PLUA 3QA8A 3RUIB 4ZRPA 3QWZB 3R7QA 2WDVB 2CHXA 1ISNA 1VLBA 2J0JA 1XF5L 4OZBA 2KN4A 3NOBA 1UWXA 3BYTB 2Y5BB 2NR2A 5HFYA 1Q10A 5KHQA 2QIEB 4KZCA 2KOXA 1GNUA 3GE3C 2GI9A 3CSFA 4KSKC 3SFEB 4XZ4A 4HROA 4S0RA 3IHPC 1VCBA 2GB1A 2PJHA 2FIDA 1WGGA 2KDMA 1KM7A 1CMXB 5EE0A 2ZW0A 4IDIA 2WXMA 4IWQA 2C7HA 1ROEA 2WX1A 3I5JC 5FKAC 1EF1A 1C9FA 2BBCA 3AEBB 4IWPA 2LGXA 4WQOB 1CQVA 1OGWA 1TKEA 4DHJB 4W9LA 4GOCA 1T0QC 2V3SA 2EKIA 3JSVA 1AARA 3ZTCA 2KQ7A 1ZP0B 2MP2A 2K9XA 3GS2A 1NI2A 2BYFA 1YIWA 2AWTA 2KD0A 4OVVA 1P9DU 3HVZA 2EMTA 2PEAA 4TUUA 3GZNI 4RF0A 2DYOA 2IY1B 1VD2A 4KZ0A 3X0WA 4MM3A 4LNIA 4XX5A 2B3AA 4M02A 4C56C 1RFAA 1HQRD 1PQSA 2OJWA 3HHMA 1C76A 1E8YA 2N9EB 2CU1A 5BMHA 2KMAA 2N9PC 1WGKA 2I1KA 3A4RA 1KH0A 4ZYSA 3Q8FA 2WWZA 4HPMB 1WRDB 3V6CB 2ON8A 2ZW1A 1FNVA 1FO4A 2MQJA 2I2YA 4JX1C 4L2YA 1WJ4A 2KC2A 3NJTA 3AE6B 3QX1A 3K9OB 4II2B 2XEWA 2MX2A 2CU3A 3EECA 4GDKA 3DVNV 1K51A 3TL5A 3N1ZC 4ANXA 4KGTA 4RF1A 3AULA 3TMPB 2L1AA 2LI5A 3L4PA 3UIOB 2KC1A 3NG0A 1ESFA 2D3GA 2XNAC 1AN8A 3T8MA 4A8XC 4JE3B 3C8YA 2MJ3A 1ENFA 2JYEA 2KN5A 3KUDB 1HZ6A 2FCMA 3PLVA 4P1BC 1FNWA 4MELA 5H92C 3BVZA 1LM8B 3HVDA 4P6VF 2BW2A 4PS7A 4PYUA 3HIZA 1HEZE 2JZ3B 4I6NB 3NZ3A 1ET9A 3P4SB 1MJDA 2KYWA 2JZPA 4NJ7A 2CKHB 2IO2B 1SIJA 3IG3A 3R3MA 1XLQA 1P7EA 1ZDVA 1HZ5A 2E6XA 3ZTDA 3DOWA 1UGMA 3L17A 3RYTA 1EWYC 5TSSA 2NVUI 2K5PA 1ZW7A 1F0ZA 1EU4A 4OZAA 4ANUA 3T3OA 5H8YE 2K8BA 1YMHE 3T3NA 3TJPA 3AE9B 1NBFC 3VAWA 2FCQA 3NRZA 3AE4B 4XE0A 1WI0A 2BYTA 2BB5A 3MJ5A 3N3KB 4RGOS 3AEDB 1QZEA 3HUIA 4DDGD 2MRPA 1TY0A 4MGIE 2BPSA 3VHTC 3PVLA 5C3JB 3PV1A 1D6EC 4KV2A 4MEMA 1I4RA 2FE8A 1SE3A 4AJYB 2WX0A 1B9RA 2K22A 4BBNC 2M0AA 1MVKA 4JQWC 1KF6B 2A5UA 2O6VA 4JLCA 4KGSA 2WU2B 2DENB 4A55A 3ENEA 1E8ZA 5AZFA 2KVZA 3H1UA 1L7YA 1XLNA 2JZZA 2R2OA 3DBSA 3W2DA 4M01A 2VH2A 2NMQA 4J6IA 1E7UA 1UH6A 5AUIA 2KHWB 4W9HA 3W1SC 1JWMD 4MACA 4YXDB 2WLBA 4NAMA 2LXAA 3RNEC 4OZCA 1WWTA 1D4BA 3UQAA 3ZIMA 3OJ3A 2W82A 3AM9A 3WIMA 2MBHA 2WNMA 2CS4A 2FIFA 2GLSA 3PO0A 4EFOA 4HKQA 1KLVA 3AE1B 2HDEA 3ZJTA 1QF6A 3DHHC 4W9FA 3QARA 2BT6A 3KVFB 1I42A 1F1HA 2HJ1A 2KFJA 2FCSA 1FIQA 2X8XX 3P4QB 4NNJB 3P63A 2GBNA 4S17A 3QJZA 5D94A 2DZKA 3AU4A 1XD3B 2LASA 1HA5A 3RNAC 2L3ZA 1J0GA 3OLMD 3EC8A 4JWUC 4RH6A 1IP9A 2WXOA 5CTRC 2VZKD 1YN5A 5KHOA 1D5XC 3SFDB 4K3CA 1SJHD 3UQBA 2ZPYA 4MSQB 2OHFA 3CSTA 2KWCA 3LXFA 2BTEA 3NZUA 4XWWA 3ZLZA 3LYYA 2G3QB 2OEDA 1V8CA 2LJ5A 3URYA 5HI1A 2WS3B 1TYGB 1V5TA 3R7RA 2K8HA 1A5RA 3R66C 2KO3A 1LFDA 2MEKA 4NJ6A 4AWJA 2FBWB 3APFA 2SEBD 3JYUA 2YEPB 3DVGX 2M4NA 2WXNA 3OAWA 1KOTA 4KIKB 2WXLA 1GC6A 1RYJA 2WXHA 2KFKA 2RSUA 1FCLA 4US8A 3T9LA 3QC8B 3DQVA 1Y56A 2VZKB 4LJOB 2Z8LA 3VDZA 3PZ7A 3RULA 4I6PA 2KWUB 3ZQ4A 2QHOA 3AV8A 3CWIA 2IPKD 1F2RC 4GLSC 3TIXA 3V3XA 3IT6B 2DZMA 2WU5B 5HG2A 1WX9A 3GB1A 4Q2JA 2FUHB 2INDC 5CHFA 2JUOA 1E90A 2PE6B 2KMMA 4KKIA 3V05A 2DYBA 3JSVB 4WWPA 1F9JA 2MP2B 2KDEB 3O65B 2B76B 3RNGC 3B1LX 1SXTA 3APDA 3BY4B 2KWDA 1MG8A 1YQ4B 2G4DB 1SBBB 1V49A 1WJ6A 1PGBA 1YOVB 1NYQA 4B6WA 4ANVA 1IYFA 1D3ZA 1L4ZB 1M94A 4MM3B 4AP4C 2DYMA 5IN7A 3PZ8A 1YN4A 3BIID 3PHXB 1RLFA 4N9F4 3ETRA 5I4DA 1YJ1A 3QAQA 4PYZA 5EE1A 1QOGA 3U8ZA 5EDSA 4D2KA 1MG4A 3VRAB 2WXPA 4FN2A 4EZLA 1N6ZA 3P2BA 4WH4A 3FILB 3H7PB 2TSSA 3A1QA 1WJNA 2H89B 3AN1A 2JT4B 4US9A 3RN9C 2LHEA 1AYFA 3A9KA 1UUPA 2AQ1B 1EU3A 3AEGB 4II3B 4FHKA 1PGXA 3TEWA 4WJNA 1N61A 4HJGE 2DHZA 5G5GA 4GDKB 1WZ3A 5C1ZA 3MTNB 1UWMA 5IP4D 2QJLA 2ZPNA 3ZYYX 1EUVB 2D5GA 4GN1A 2N7EA 1GG3A 4C4VA 4XYCA 3P1MA 4USAA 2LHDA 2JWUA 3BK1A 4IKGA 4DHJD 2PE9A 1WM3A 3APCA 1JRPA 4K81A 4WWOA 4EZJA 2ASQA 1IGCA 2L0TA 2OJRA 4MH0E 3VTUA 3MHSD 5CHVC 1TBEA 4RMAA 3EGRA 4TMAB 4GB9A 3QCAA 1WYWB 3DWMA 2HD5B 3NVYA 1E9MA 2AQ3B 2H88B 2V1YA 2LVPA 2WGSA 2C7NB 4HXDA 1UBIA 3KW5B 5DPTA 2O6VD 1T0YA 4CQNA 3ZXRA 2FNJB 3WCQA 1RAXA 4K7UA 1GB4A 1I4XA 2L83A 2KJRA 2WDRB 4KIKA 3CMMB 1SJED 4K1RB 4YWGG 5JHBA 3AU5A 2AQ2B 2IO0B 4EOYA 4E74A 2MH7A 4FULA 4GIVA 4MSMB 1CJEA 1C1YB 1ZE3D 3VTWA 4N6EB 2W9NA 1DOYA 3VTVA 1T0SC 4DHZE 3V6EB 4ZYNA 4ZOHC 4NAWA 2IZVB 2ZNVC 2DX5B 1EWCA 2BS4B 1NYRA 1WXVA 4HCNB 3ONSA 3KLSX 3H8HA 1STEA 3N30A 2DNFA 2IO3B 2RDGA 2IO1B 4HDOA 2ZJDA 3EHVA 1TZ1A 4FJZA 1RM6C 4MT5A 3AI5A 2FCNA 3R8BA 2O6VB 1DYQA 3ALBA 4HPLB 4ARCA 1FM0D 3DBLB 1J7AA 1QOAA 1H4RA 1DOXA 1WXAA 1FXIA 2RDHA 1YN3A 2L0FA 4ZDVA 2LXCA 1B1ZA 4ITKA 2KVRA 4HPPA 4A90A 4GXBA 1K52A 1TZOA 2V9HA 2M56B 1NVID 1TKGA 3AXCA 3FILA 3H7PA 3N32A 1NDDA 2JVCA 1T3QA 3Q69A 1FPYA 1L0XB 3IXSA 1RWSA 2VRRB 2MJEA 2ZVNA 5JXVA 1AWDA 4NY0A 4X57B 2M1MA 3TCAA 1FEHA 5G5HA 2PPHA 2CJOA 2WXGA 1SIFA 5CX3A 4L23A 1IGDA 1C3TA 4ANWA 2GOWA 1LQBA 4KKJA 5D7GA 2ZCCA 1BXTA 5FK9C 5D3IB 2D07B 3MJWA 2DZJA 1JWBD 4YT0B 4KVGB 4LNNA 4DWFA 4WAFA 1I4GA 4FBJB 2QILA 1GUAB 2M0XA 2LGYA 3NVVA 1E8WA 4KGRA 1WGYA 2AYOB 1V2YA 5BMGA 4XWTA 5E6NA 1XEEA 4MH8A 3ZVVA 4W9CA 3RMKC 3PGEA 4RCOA 1FXTB 2KDBA 3Q8AA 1YX5B 3ECIA 3NVZA 4LCDE 4RM8A 2BF8B 5J17A 1ET6A 2R61A 2K6QA 3AH7A 2INCC 4URKA 1NI3A 1N63A 3W1YA 2KT7A 2C60A 1BMLC 4YTMB 3QK0A 2JWZA 1FXAA 3BK2A 1QT9A 2KANA 1ZKHA 2WDQB 2KJHB 3RNBC 3RNCC 1TS5A 4C7ZA 3U30A 3Q2AC 2KQSA 2JF5A 2KWVB 2BS3B 4TSSA 1X1MA 4LDTD 4A3OA 1YX6B 1F77A 1N60A 3KYCD 2JRIB 3OWEB 3U2SC 4FJVB 2DAFA 3DBLI 2MA9B 1HTQA 2N9LA 4ZHOA 1JQ4A 3V62A 1J8CA 2GBRA 2KLCA 3BYYB 2KDIA 2ACZB 2KFKB 4FXCA 3VH4B 3BVMA 2Y5CA 3AE2B 3DPDA 3B08A 1YQ3B 3SU8X 1NEKB 3UINB 3OG5A 3I63C 2R2QA 2WXQA 5TR5A 2ZVOA 2LFIA 3RPFC 3ZUNA 2D11A 4YTPB 3DHIC 4HKZE 4ICUA 2K3UA 1Q1OA 1RRBA 1J7BA 4R3DA 3Q3OC 2NBUA 4G3XB 5IA7A 2C7MB 2MSED 2D10A 3B2FA 3E9SA 5JH5C 3WA0A 3MC9A 2IGDA 3PRPB 4LDTB 1A70A 2KTRB 1BT0A 5JHAA 4AQ7A 1C4AA 4PS3A 4BKGA 2KLGA 1OQYA 2UYZB 1V80A 1L6UA 1WSPA 1XLPA 2DWQA 5BO4B 2J7QB 1S3SG 1R4MB 5IKCM 2E3TA 2IY0B 4IC7B 4W9GA 4M00A 2NCNA 4WURA 1VRAB 3CIRB 5C2TB 2INNE 3UF8A 3RI7C 3ZRCA 4GU2A 3NS8A 4F1SA 2PMVA 2D2QA 3EA6A 3KWVA 1I4QA 3ZRFA 1P0RA 1N5XA 5C23A 3A1QB 2MBOA 2K1FA 1BUIC 3H9DA 3VUYA 4JIOU 4HRSA 5DPWA 3A9KB 3RFZB 3IT4B 4LJPB
chains in the Genus database with same CATH topology
1CQVA 1C4CA 1TKEA 3BIID 2INPE 2JXTA 4C7YA 3ETRA 4GDLB 5I4DA 1T6BX 3W5VB 3EUB2 4LK0M 1QOGA 2EKIA 5EE1A 1YNTE 1ZP0B 5T8IA 2K9XA 4A6QA 3GS2A 4D2KA 2W54A 1JWSD 1ZUD2 3VRAB 2WXPA 2JSVX 1KLGD 3MFGA 3HVZA 1D5MC 5BMIA 1SE4A 2JU6X 4XDCA 4WH4A 3FILB 4RF0A 3AMZA 4HEA1 2DYOA 2TSSA 4L1BA 3AEAB 2H89B 3B2GA 3AN1A 1FRRA 4US9A 4WQMA 2LHEA 1AYFA 1UUPA 2AQ1B 1EU3A 1V97A 3AEGB 2PIAA 2KAJA 1PGXA 3TEWA 4REZA 4C56C 1N61A 4HJGE 5G5GA 1HQRD 4UDUC 4GDKB 1C76A 1UWMA 2IGHA 1WRIA 2QJLA 2IJ0A 1DGJA 3I9V1 5BMHA 1DOIA 2XN9C 1WGKA 3AE8B 3ZYYX 1KH0A 4ZYSA 3Q8FA 2D5GA 3TSSA 5EE9A 1GPXA 2ON8A 2ZW1A 1FNVA 3P1MA 2Q5WD 2N0SB 2N9KA 4USAA 1FO4A 5GXGB 2LHDA 3DWGC 2I2YA 2JWUA 3BK1A 3FAHA 4A9AA 4JX1C 4DQOC 3TEZA 4DXFA 1IUEA 4IKGA 3SR6A 2KACA 4L2YA 1WYGA 2BS2B 2J52A 1T5XD 3NS1A 1JRPA 4OHJA 1MPEA 1F2RI 3AE6B 3J9CA 1FFUA 1VZ8A 3R2IA 1C78A 4YSXB 5EE3A 1MHXA 1IGCA 2CU3A 1SSNA 1K51A 3UI3A 3EGRA 1JALA 3Q8EA 4KGTA 4TMAB 4RF1A 2L1AA 3DWMA 1XO3A 2IDYA 3L4PA 3NVYA 1E9MA 2AQ3B 1XXGA 2H88B 1ESFA 3BZDB 4OW0A 1UNSA 2XNAC 2QMTA 4PT5A 4NAWB 1AN8A 4A8XC 1JMLA 1RFKA 4JE3B 3C8YA 2MJ3A 4CQNA 4YTNB 3WCQA 1GB4A 1I4XA 2L83A 1ENFA 2WDRB 2LGIA 2L32A 2JYEA 1I4PA 1SJED 4JWSC 2JQRB 1HZ6A 1VZ7A 4YWGG 2QEJC 2AQ2B 1FNWA 2MH7A 2Y3AA 1NENB 1CJEA 4O1NA 2L52A 5H92C 3BVZA 3B9JA 2WP9B 3AB5A 3HVDA 4P6VF 3VQIA 2BW2A 1ZE3D 4N6EB 1HEZE 2LJIA 1DOYA 1SF0A 2X38A 1KTKA 2JYTA 3NZ3A 3BWUD 3VRBB 1ET9A 3P4SB 2IGGA 3ZJUA 2JZPA 4ZOHC 2RMMA 1IBXB 1EM7A 1SIJA 1QOFA 1XLQA 1TS2A 3HRDD 1P7EA 1EWCA 1ZDVA 1FFVA 2BS4B 1NYRA 2LMCA 1V1PB 3MC0B 1HZ5A 3KLSX 3IAM1 2E6XA 3H8HA 1STEA 3AECB 1ZOYB 2WXKA 1JCKB 1KLUD 1EWYC 5TSSA 1FRDA 2K5PA 2RDGA 3ZGZA 1XCTL 1L0VB 1YJIA 1F0ZA 1EU4A 4OZAA 2RPVA 3T3OA 2W3RA 5H8YE 1FD6A 1PDXA 1KFYB 1YMHE 1CK1A 5BYRA 3T3NA 1RM6C 3AE7B 3AE9B 4P16A 1MI0A 4MT5A 1JWUD 1OQRA 3NRZA 3AE4B 3R8BA 5LNK1 4XE0A 2BYTA 2BB5A 3MJ5A 1DYQA 2PKOA 4J3OD 1N62A 2FUG1 4RGOS 4ARCA 1TY2A 1FM0D 3AEDB 3ABVB 3HUIA 1J7AA 1JW9D 1ZPSA 3P4PB 1TY0A 1D5ZC 1QOAA 3W5UB 1K53A 1DOXA 1KRHA 5C3JB 3LB8C 1FMAD 1FXIA 2RDHA 3AEFB 1D6EC 1YN3A 1I4RA 1B1ZA 3SEBA 4ITKA 1OQQA 4TQ1A 4RGMA 2FE8A 1SE3A 4A90A 1B9RA 1K52A 1TZOA 2W55A 3IAS1 4TQ0A 2M56B 1NVID 1TKGA 4XDDA 2J53A 2K22A 3AE3B 1QILA 2PVOD 2M0AA 3MHZA 3FILA 1MVKA 1SE2A 3AEEB 4JPSA 5BYQA 1SB3C 1T3QA 3Q69A 1KF6B 1QKZA 4WIPA 2GRIA 1L0XB 1ZXHA 4KGSA 2WU2B 4A55A 3IXSA 4OVZA 2CJNA 1RWSA 2MJEA 2PW9A 5JXVA 1AWDA 1C4PA 4NZLB 1V1OA 1XLNA 3W2DA 1C79A 1FEHA 5G5HA 2V3NA 2CJOA 2NMQA 2WXGA 4KX6B 1I4HA 4L23A 5AUIA 1IGDA 1OFFA 3AE5B 3VR8B 1QOBA 1FNUA 3Q8BA 4KKJA 4LLGM 5D7GA 1JWMD 1PYWD 4MACA 1BXTA 5FK9C 3VR9B 4YXDB 5D3IB 1ZXIA 2WLBA 4NAMA 2LUMA 1JWBD 4YT0B 1TS4A 4OZCA 1WWTA 1D4BA 3Q8CA 4WAFA 1I4GA 2M19A 2W82A 2N7JA 2QILA 3NVWA 3TUOA 3AM9A 1L4DB 3U52E 1FCCC 2WNMA 3NVVA 1M4VA 4KGRA 3PO0A 3E56A 4HKQA 5AUKA 2W3SA 5BMGA 4XWTA 3AE1B 1E6EB 2HDEA 3ZJTA 1XEEA 2WXJA 4MH8A 1QF6A 1GOZA 1L0YB 4RCOA 4M0WA 3NUHB 3Q8AA 3NVZA 3P4RB 2BT6A 1SEBD 5E6JA 3U4EG 1GB1A 2YEPF 1ET6A 2R61A 2PLPA 3AH7A 3TEYA 1FIQA 2EELA 2J4XA 1NI3A 1N63A 3P4QB 3P63A 1BMLC 2AX5A 2BB6A 4YTMB 4RFBA 1FXAA 1J7CA 1L5PA 3BK2A 2V4IB 1N5WA 1QT9A 4RNAA 1K50A 3ZJVA 4DXGA 2WDQB 1TS5A 4C7ZA 4YSZB 3W9CB 4N58A 1HA5A 3KQ4A 1AW7A 4C80A 2WXRA 3O13A 2BS3B 4AS1A 1QLBB 1E7PB 3MP9A 4JWUC 4TSSA 4RH6A 2V0GA 1XLOA 2WQYB 2WXOA 2NTTA 1MHHE 1F77A 2WXIA 1VZ6A 4LTUA 2J42A 4WWMA 1IBXA 1N60A 2MJDA 2VZKD 1YN5A 3OWEB 1D5XC 3U2SC 3SFDB 1ACCA 1SJHD 1V1PA 2V3PA 2OHFA 2N9LA 2LEKA 4RGTA 4RGNA 4ZHOA 1JQ4A 5D3DA 1TKYA 3LXFA 2I38A 1QQRA 2G9HD 1VR9A 1TS3A 4ZHPA 4H2AA 3U7ZA 4N59A 2BTEA 4XWWA 3BYYB 2ACZB 4FXCA 3LYYA 3BVMA 2Y5CA 3BVGA 2OEDA 1PGAA 1V8CA 2PVGC 3AE2B 3URYA 4NJCA 1YQ3B 5HHDG 5HI1A 1NEKB 2WS3B 1TYGB 3TEXA 1I7HA 4IOIE 2WXQA 4ARIA 1XCQL 2LFIA 3RPFC 1GAQB 2MEKA 1PFDA 1L6VA 4YTPB 2PTLA 1TJEA 4HKZE 1PUTA 2K3UA 2DLBA 1J7BA 2FBWB 4R3DA 2SEBD 2YEPB 1WXQA 2WXNA 3B2FA 2WXLA 3E9SA 1E10A 5MPOA 1RYJA 2G1EA 2WXHA 2KQ4X 2IGDA 4B0EA 1JWAD 1FCLA 2Y5PA 4US8A 2JX5A 2NTSA 3GP7A 1A70A 3W1SA 2ONQA 4AQ7A 1C4AA 1VDVA 1Y56A 2VZKB 1L6UA 1WSPA 1XLPA 2DWQA 2Z8LA 4ZRPA 2ICIA 3PZ7A 1R7SA 3ZQ4A 2WDVB 3AV8A 3CWIA 2IPKD 1F2RC 1VLBA 4GLSC 1XF5L 3V3XA 2E3TA 3IT6B 1LO5D 4OZBA 2WU5B 4ZRQA 5HG2A 3GB1A 1JROA 4Q2JA 2SAKA 4WURA 1VRAB 2KN4A 3I57A 3CIRB 4B0MA 2WXFA 1UWXA 3BYTB 5C2TB 2KMMA 5HFYA 4KKIA 3V05A 1Q10A 2INNE 2QIEB 3P42A 4YSYB 2GI9A 2K0PA 2DBYA 2B76B 1P7FA 3SFEB 3N9YC 1SXTA 4HROA 1E0ZA 2HTME 1ZDXA 2GB1A 2PMVA 2KWDA 3EA6A 1YQ4B 2KDMA 1I4QA 3KWVA 4EE2A 1SBBB 3KWLA 1N5XA 5FR3A 1YJJA 5EE0A 1HXYD 2ZW0A 1PGBA 2WXMA 4IDIA 1NYQA 1C77A 1BUIC 1CZPA 5BYSA 1ROEA 1L4ZB 4MM3B 4HRSA 1UGJA 2DYMA 1VJKA 2QSDA 5FKAC 3RFZB 1C9FA 2BBCA 3AEBB 3PZ8A 3IT4B 3FC4A 1YN4A 3R2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BII D;  1TKE A;  4ZHP A;  5G5H A;  4C7Y A;  2CJO A;  3ETR A;  4N59 A;  2MH7 A;  4KX6 B;  3W5V B;  2ACZ B;  4FXC A;  1NEN B;  3AE5 B;  1OFF A;  1CJE A;  5AUI A;  3EUB 2;  2Y5C A;  1QOG A;  2EKI A;  5EE1 A;  2L52 A;  5H92 C;  1QOB A;  3VR8 B;  1ZP0 B;  1V8C A;  2PVG C;  2WP9 B;  2K9X A;  3AB5 A;  3AE2 B;  3B9J A;  4JWS C;  4P6V F;  1YQ3 B;  2W54 A;  1NEK B;  1ZUD 2;  4N6E B;  2WS3 B;  3VRA B;  3VR9 B;  4YXD B;  1TYG B;  1ZXI A;  2WLB A;  1SF0 A;  1I7H A;  1DOY A;  3HVZ A;  1JWB D;  4YT0 B;  3VRB B;  1WWT A;  3P4S B;  3RPF C;  3AMZ A;  1GAQ B;  4ZOH C;  2M19 A;  1PFD A;  1L6V A;  1SIJ A;  4YTP B;  1TJE A;  3AEA B;  1PUT A;  1QOF A;  2H89 B;  1XLQ A;  3B2G A;  3AN1 A;  3HRD D;  3NVW A;  1FRR A;  3AM9 A;  1J7B A;  1FFV A;  2FBW B;  2BS4 B;  4WQM A;  1NYR A;  1AYF A;  3LXF A;  4US9 A;  1V97 A;  3AEG B;  3NVV A;  2PIA A;  1WXQ A;  2KAJ A;  3B2F A;  3PO0 A;  5AUK A;  3AEC B;  1ZOY B;  1N61 A;  2W3S A;  5G5G A;  1E10 A;  5MPO A;  3AE1 B;  1RYJ A;  1EWY C;  1E6E B;  1FRD A;  2G1E A;  2K5P A;  1JWA D;  1YJI A;  1L0V B;  1UWM A;  1QF6 A;  1WRI A;  2QJL A;  1DGJ A;  4US8 A;  1F0Z A;  2JX5 A;  1DOI A;  3AE8 B;  1WGK A;  3NVZ A;  3P4R B;  1A70 A;  2W3R A;  5H8Y E;  1PDX A;  2BT6 A;  1KFY B;  3ZYY X;  1RM6 C;  3AE7 B;  1VDV A;  3AE9 B;  5EE9 A;  1GPX A;  1OQR A;  3NRZ A;  3AH7 A;  1L6U A;  1FIQ A;  1XLP A;  2DWQ A;  3AE4 B;  3P1M A;  2Q5W D;  2N0S B;  1NI3 A;  4USA A;  1N63 A;  3P4Q B;  5GXG B;  1FO4 A;  3DWG C;  3P63 A;  2PKO A;  1R7S A;  1N62 A;  2WDV B;  3AV8 A;  3FAH A;  4JX1 C;  4A9A A;  1FM0 D;  3CWI A;  2AX5 A;  3AED B;  1IUE A;  3ABV B;  3SR6 A;  4YTM B;  1VLB A;  3HUI A;  1WYG A;  1J7A A;  1JW9 D;  2BS2 B;  1FXA A;  1J7C A;  2E3T A;  1L5P A;  3P4P B;  2WU5 B;  1JRP A;  1QOA A;  3NS1 A;  3W5U B;  1N5W A;  1QT9 A;  1JRO A;  1DOX A;  3AE6 B;  1KRH A;  1FFU A;  3CIR B;  2WDQ B;  4YSX B;  3LB8 C;  5C3J B;  1FMA D;  1FXI A;  5EE3 A;  5C2T B;  4C7Z A;  3AEF B;  2KMM A;  3W9C B;  4YSZ B;  4N58 A;  2CU3 A;  2QIE B;  4C80 A;  4YSY B;  4ITK A;  1OQQ A;  1B9R A;  1XLN A;  1JAL A;  2BS3 B;  2DBY A;  2W55 A;  2B76 B;  1QLB B;  1E7P B;  1NVI D;  1TKG A;  2M56 B;  2K22 A;  3AE3 B;  4JWU C;  1XLO A;  3DWM A;  3SFE B;  1XO3 A;  2PVO D;  2WQY B;  4HRO A;  3L4P A;  3NVY A;  1E0Z A;  2HTM E;  3AEE B;  4LTU A;  1E9M A;  4WWM A;  1N60 A;  2H88 B;  1YQ4 B;  2MJD A;  1SB3 C;  1T3Q A;  3SFD B;  1KF6 B;  3KWL A;  1N5X A;  1YJJ A;  5EE0 A;  4IDI A;  2WU2 B;  1NYQ A;  1RFK A;  1CZP A;  1ROE A;  2MJ3 A;  2CJN A;  2OHF A;  4YTN B;  1RWS A;  3WCQ A;  4HRS A;  1VJK A;  2L83 A;  2LEK A;  2MJE A;  2WDR B;  3AEB B;  1AWD A;  4ZHO A;  1JQ4 A;  3FC4 A;  1TKY A;  2JQR B; 
#chains in the Genus database with same CATH topology
 1C4C A;  4C7Y A;  4XC2 A;  4GDL B;  3PPA A;  1T6B X;  3X23 A;  2BQQ A;  1TTN A;  3SDL C;  1YNT E;  4WJQ A;  2LUE A;  2L8J A;  4A6Q A;  1JWS D;  1L2N A;  1ZUD 2;  2JSV X;  5G2N A;  4G11 A;  2L76 A;  1D5M C;  3L08 A;  4C4V B;  1SE4 A;  4XDC A;  1R4N B;  4ZRK A;  4HEA 1;  3A9J A;  2YVC A;  1FRR A;  5DPS A;  2RR9 A;  2PIA A;  2KAJ A;  4REZ A;  2EKE C;  1WX8 A;  1EO6 A;  4UDU C;  5L95 C;  1WR1 A;  1DGJ A;  2BYV E;  3WAN A;  3AE8 B;  4MGY E;  2LRW A;  3L0W B;  3GOE A;  3WAP A;  3M95 A;  2Q5W D;  2N0S B;  3DVN U;  5GXG B;  3K9P B;  2C5L C;  3FAH A;  4DQO C;  3TEZ A;  3SR6 A;  1V81 A;  2KAC A;  2YLM A;  2NPT B;  2BS2 B;  2K8C A;  1T5X D;  3NS1 A;  4LNO A;  3RCZ A;  1MPE A;  3J9C A;  3R2I A;  3I3T B;  1MHX A;  3BIN A;  1SSN A;  3UI3 A;  3ZNG C;  3Q8E A;  4WJO A;  4CHK A;  1WY8 A;  1XO3 A;  2IDY A;  3WAL A;  2MCN B;  3KYD D;  3BZD B;  2RDB C;  2QMT A;  3GE8 C;  1R4M I;  4NAW B;  1Z5S B;  4K7W A;  1JML A;  2J0K A;  1Q0W B;  3L54 A;  1UBQ A;  2JQR B;  4BVU C;  2Y3A A;  2KTR A;  1NEN B;  2L52 A;  3B9J A;  3AB5 A;  3IFW B;  2LJI A;  1EF5 A;  2KMC A;  3ZXV A;  4A3P A;  3VRB B;  2KZR A;  1EM7 A;  3PTF C;  4IWO A;  1QOF A;  1TS2 A;  3MC0 B;  3A4S C;  3IAM 1;  1LXD A;  1WH3 A;  3AEC B;  3HM6 X;  1ZOY B;  2KNB A;  1JCK B;  1KLU D;  1FRD A;  1WE6 A;  4G0N B;  1WGH A;  1L0V B;  1XCT L;  5E6P A;  4AUQ C;  2KX3 A;  2RPV A;  2W3R A;  1KFY B;  2K6D B;  1CK1 A;  5BYR A;  4P16 A;  1MI0 A;  3VH3 B;  4CYE A;  3DBH B;  1R4N I;  3FKY A;  5LNK 1;  4MDK E;  3ML8 A;  2MBE A;  2PKO A;  1N62 A;  1TY2 A;  3P4P B;  2C9W B;  4GDL A;  3W5U B;  2BKF A;  2DZI A;  2NS5 A;  1KRH A;  3U7D A;  1FMA D;  4LNF A;  3AEF B;  2XBB C;  2V4L A;  4TQ1 A;  3WAM A;  3LJ3 A;  2W55 A;  3AE3 B;  3MHZ A;  1SE2 A;  3AEE B;  4JPS A;  3SD5 A;  3PT2 B;  4WIP A;  2GRI A;  4WAA A;  1IPG A;  2G4S A;  2CJN A;  5IAA C;  2BVC A;  4F8C B;  3UGB B;  1WR6 E;  1V1O A;  2GBM A;  4BBN F;  4BFR A;  4KX6 B;  3L13 A;  1I4H A;  2QC8 A;  3AE5 B;  3VR8 B;  4BAX A;  1QOB A;  3Q8B A;  1PYW D;  5JZE B;  3VR9 B;  2VH1 A;  2QCZ A;  1OEY J;  2AEH A;  1ZXI A;  3PRE A;  2KTF A;  2J0M A;  1Y8R C;  2HTH A;  3ZDM C;  3C19 A;  4E3C A;  2NPT A;  3DHG C;  2D3B A;  2Z0D B;  3NVW A;  1L4D B;  1XT9 B;  3E56 A;  5AUK A;  2GBJ A;  4EEW A;  3TBL D;  3M63 B;  3VXW A;  2XK5 B;  1GOZ A;  1L0Y B;  4M0W A;  3NUH B;  3KUZ A;  1WMH A;  3P4R B;  4XGA B;  1Z2M A;  4BKS A;  3DCG A;  2RGF A;  5E6J A;  2N1W A;  3B0A A;  2PLP A;  2L00 B;  2Z0E B;  3TEY A;  2J4X A;  1V6E A;  2BGF A;  3ZDT A;  2BB6 A;  4P1C C;  3L10 B;  3V60 A;  4RFB A;  1L5P A;  2G45 B;  2KX0 A;  2V4I B;  3KUC B;  4TKN A;  2NBV B;  4IW0 A;  3ZNZ B;  4YSZ B;  3W9C B;  1V5O A;  3PRM B;  3KQ4 A;  1WXS A;  3O13 A;  2KDF B;  5DCN A;  1P98 A;  3VUW A;  1QLB B;  1E7P B;  1XLO A;  2HE7 A;  2IYD B;  2WQY B;  1MHH E;  2WXI A;  1VZ6 A;  3DBH I;  2J42 A;  4GSW A;  5IO9 A;  2MJD A;  3IVF A;  4MGZ E;  4HJK A;  1WGD A;  4ZRJ A;  2V3P A;  2JXX A;  4MGK E;  4PS8 A;  5LLI A;  4RGT A;  2ZCB A;  1WM2 A;  5D3D A;  1TKY A;  2I38 A;  2G9H D;  1TS3 A;  4ZHP A;  4H2A A;  1T0R C;  1LGR A;  2IBI B;  2UWQ A;  2GBK A;  3PRZ A;  4KSL C;  3ZW3 A;  2AL6 A;  3Q3J A;  4WWN A;  2PVG C;  1WE7 A;  3NHE B;  4NJC A;  3TEX A;  1I7H A;  4IOI E;  4ARI A;  1TIF A;  1PFD A;  1L6V A;  1TJE A;  1PUT A;  3QQ8 B;  4NQL B;  4IM3 A;  1MFW A;  1SE9 A;  2WHI A;  1WXQ A;  4HK2 A;  1Q5W B;  3OJ4 B;  4K3B A;  2G1E A;  3ML9 A;  4B0E A;  1JWA D;  2LD9 A;  5LXI B;  3GP7 A;  3W1S A;  2ONQ A;  3N1X C;  3HM3 A;  1VDV A;  4B9K A;  4GGQ A;  2ICI A;  4OVU A;  1R7S A;  3VVW B;  3KH0 A;  4IM0 A;  1LO5 D;  4ZRQ A;  4AJW A;  1JRO A;  4JL9 A;  2SAK A;  3I57 A;  4IG7 B;  4B0M A;  2WXF A;  3VFK A;  2REX A;  3P42 A;  4YSY B;  4I6L B;  4BOS C;  2K0P A;  2DBY A;  2LRU A;  1P7F A;  3N9Y C;  1WFY A;  1P1A A;  1E0Z A;  2HTM E;  3ZO5 B;  1U4A A;  2A4Z A;  3DVG Y;  1ZDX A;  4EE2 A;  3KWL A;  5FR3 A;  1YJJ A;  1HXY D;  3A9J B;  3MC8 A;  1JRU A;  1C77 A;  1CZP A;  5BYS A;  1YD8 U;  3PS6 A;  1UGJ A;  1VJK A;  2QSD A;  2M17 A;  5D2M B;  3FC4 A;  4W9I A;  3R2T A;  1HE8 A;  2INP E;  2JXT A;  2XK5 A;  4HLE A;  3VUX A;  4BOZ B;  4KDL B;  3W5V B;  3EUB 2;  4LK0 M;  1HTO A;  1WJU A;  2I1J A;  5T8I A;  2W54 A;  1TGZ B;  4WJP A;  2OOB B;  1KLG D;  4FAD A;  2D3C A;  3N20 C;  2LZ6 A;  2MWS B;  3MFG A;  5BMI A;  4BZA A;  2JU6 X;  4KDI C;  3AMZ A;  4FA6 A;  4L1B A;  4AOF A;  3AEA B;  3B2G A;  2O2V B;  3Q3N C;  4WQM A;  2LVO A;  1P3Q U;  1V97 A;  3RZF A;  2NBW B;  3Q14 C;  5CHW A;  2Z59 B;  3H7S A;  2IGH A;  1WRI A;  2IJ0 A;  2ZEQ A;  3I9V 1;  1DOI A;  2XN9 C;  1E7V A;  2BWF A;  3HK0 A;  3TSS A;  4W9K A;  5EE9 A;  5AZG A;  1GPX A;  2K25 A;  3IBE A;  3DBR B;  3RNF C;  2N9K A;  3DWG C;  5D6J B;  4A9A A;  3Q3M C;  4DXF A;  1IUE A;  1WYG A;  2J52 A;  3WAO A;  4OHJ A;  2JRH A;  1F2R I;  1FFU A;  1VZ8 A;  3QIJ A;  4FHJ A;  1C78 A;  4YSX B;  5EE3 A;  4ZRI A;  4C00 A;  1UF0 A;  4DXA B;  2MLB A;  2L7R A;  2FAZ A;  1TT5 B;  1JAL A;  2AL3 A;  4M8M A;  4CO7 A;  1XXG A;  4OW0 A;  4EUT A;  1UNS A;  4PT5 A;  1E5W A;  1RFK A;  3V61 A;  4YTN B;  2KJ6 A;  1XQQ A;  2LGI A;  2L32 A;  1I4P A;  4JWS C;  4DBG A;  2ZNV B;  3ZKJ C;  4NPN A;  1VZ7 A;  2QEJ C;  2JPH A;  1H8C A;  4M8N A;  3QHT A;  4W9D A;  4O1N A;  1GJZ A;  2UU7 A;  2WP9 B;  3VQI A;  3CF6 E;  1E8X A;  2D3A A;  2LGS A;  1SF0 A;  2X38 A;  1KTK A;  2JYT A;  3BWU D;  4LNK A;  2BYE A;  2IGG A;  3RZW C;  3ZJU A;  2RMM A;  1IBX B;  1UZX B;  3HRD D;  4IM2 A;  4DK5 A;  1FFV A;  3UIP B;  2LMC A;  1V1P B;  1KJT A;  3JW0 X;  2WXK A;  2RD0 A;  3ZGZ A;  5HKH A;  1YJI A;  4IUM B;  1FD6 A;  1PDX A;  4BKS D;  3AE7 B;  3DDC B;  1JWU D;  1OQR A;  1V86 A;  4HVB A;  2MBB B;  4J3O D;  2FUG 1;  1YQB A;  3RT3 B;  3RD2 A;  3ABV B;  1K8R B;  3EFC A;  4NQK E;  1JW9 D;  1ZPS A;  1D5Z C;  2CHW A;  1K53 A;  2N1V A;  3A33 B;  4MJS B;  3LB8 C;  4TV3 A;  3C0R B;  3SEB A;  1OQQ A;  4RGM A;  4G50 A;  4GMV A;  3IAS 1;  4TQ0 A;  1G6J A;  4XDD A;  4FJY A;  2J53 A;  1QIL A;  5AEK B;  2PVO D;  2N4F A;  4HWI B;  3DBR I;  3L16 A;  3ZNI D;  1I35 A;  5BYQ A;  1SB3 C;  3PHW B;  2O2V A;  1QKZ A;  1ZXH A;  5LXH A;  1SGH A;  4OVZ A;  3LDZ E;  3Q6B A;  2PW9 A;  1C4P A;  3PZD A;  4NZL B;  1WXM A;  1WGR A;  1C79 A;  2V3N A;  3NY5 A;  1V9J A;  4YL8 A;  3H6N A;  1OFF A;  4M0W B;  1WMH B;  1FNU A;  4ACF A;  4LLG M;  4DHZ B;  2CHZ A;  2MHJ A;  2RPQ A;  2HJ8 A;  4BKT A;  2LUM A;  4HCP B;  5J18 A;  4K7S A;  1TS4 A;  3Q3F A;  3Q8C A;  4FLH A;  4A20 A;  2M19 A;  1GC7 A;  2N7J A;  3TUO A;  3U52 E;  1FCC C;  1M4V A;  4PK1 A;  2W3S A;  1E6E B;  2WDT B;  2WXJ A;  1ZGU B;  2ZZP B;  4E71 A;  1OEY A;  1SEB D;  4QAY A;  1WZ0 A;  3U4E G;  1GB1 A;  2YEP F;  2BKR B;  4W9J A;  4DDI D;  2EEL A;  3M62 B;  3S2A A;  5E6O A;  4EZK A;  2MBQ A;  2AX5 A;  1WF9 A;  3N1Y C;  1J7C A;  2KKC A;  5G55 A;  1N5W A;  2N7D A;  1WX7 A;  4RNA A;  1K50 A;  3ZJV A;  4DXG A;  2QDF A;  2N9X A;  4RM9 A;  2MW5 A;  4N58 A;  1AW7 A;  4C80 A;  2WXR A;  3JVZ X;  4EKU A;  4AS1 A;  2V0G A;  3MP9 A;  3NZS A;  2BWE S;  2EMS A;  2NTT A;  4HDQ A;  2LWP A;  4LTU A;  4WWM A;  2KXJ A;  1IBX A;  2DAJ A;  1ACC A;  3GZN B;  1V1P A;  1OTR B;  5AZH A;  1J19 A;  2LEK A;  4RGN A;  5GMV A;  4ICV A;  1VR9 A;  1QQR A;  2L05 A;  2K39 A;  3U7Z A;  1S1Q B;  3M3J A;  4N59 A;  3BVG A;  5FR6 A;  4P7I A;  1PGA A;  2LVQ A;  5J2R A;  5HHD G;  4JGH B;  1WIA A;  4B95 A;  3D32 A;  1XCQ L;  3PSE B;  4W9E A;  2CR5 A;  1GAQ B;  2PTL A;  4F7Z A;  4MJS A;  2DLB A;  2KK8 A;  1UD7 A;  5L83 A;  3EFU A;  3ZNH B;  1UEL A;  4ASW C;  1E10 A;  1F52 A;  5MPO A;  2KQ4 X;  2M8S A;  2LGD A;  2Y5P A;  5IOI A;  2WYQ A;  2JX5 A;  3SHQ A;  2NTS A;  2JY6 A;  5DPR A;  2GMI C;  3PLU A;  3QA8 A;  3RUI B;  4ZRP A;  3QWZ B;  3R7Q A;  2WDV B;  2CHX A;  1ISN A;  1VLB A;  2J0J A;  1XF5 L;  4OZB A;  2KN4 A;  3NOB A;  1UWX A;  3BYT B;  2Y5B B;  2NR2 A;  5HFY A;  1Q10 A;  5KHQ A;  2QIE B;  4KZC A;  2KOX A;  1GNU A;  3GE3 C;  2GI9 A;  3CSF A;  4KSK C;  3SFE B;  4XZ4 A;  4HRO A;  4S0R A;  3IHP C;  1VCB A;  2GB1 A;  2PJH A;  2FID A;  1WGG A;  2KDM A;  1KM7 A;  1CMX B;  5EE0 A;  2ZW0 A;  4IDI A;  2WXM A;  4IWQ A;  2C7H A;  1ROE A;  2WX1 A;  3I5J C;  5FKA C;  1EF1 A;  1C9F A;  2BBC A;  3AEB B;  4IWP A;  2LGX A;  4WQO B;  1CQV A;  1OGW A;  1TKE A;  4DHJ B;  4W9L A;  4GOC A;  1T0Q C;  2V3S A;  2EKI A;  3JSV A;  1AAR A;  3ZTC A;  2KQ7 A;  1ZP0 B;  2MP2 A;  2K9X A;  3GS2 A;  1NI2 A;  2BYF A;  1YIW A;  2AWT A;  2KD0 A;  4OVV A;  1P9D U;  3HVZ A;  2EMT A;  2PEA A;  4TUU A;  3GZN I;  4RF0 A;  2DYO A;  2IY1 B;  1VD2 A;  4KZ0 A;  3X0W A;  4MM3 A;  4LNI A;  4XX5 A;  2B3A A;  4M02 A;  4C56 C;  1RFA A;  1HQR D;  1PQS A;  2OJW A;  3HHM A;  1C76 A;  1E8Y A;  2N9E B;  2CU1 A;  5BMH A;  2KMA A;  2N9P C;  1WGK A;  2I1K A;  3A4R A;  1KH0 A;  4ZYS A;  3Q8F A;  2WWZ A;  4HPM B;  1WRD B;  3V6C B;  2ON8 A;  2ZW1 A;  1FNV A;  1FO4 A;  2MQJ A;  2I2Y A;  4JX1 C;  4L2Y A;  1WJ4 A;  2KC2 A;  3NJT A;  3AE6 B;  3QX1 A;  3K9O B;  4II2 B;  2XEW A;  2MX2 A;  2CU3 A;  3EEC A;  4GDK A;  3DVN V;  1K51 A;  3TL5 A;  3N1Z C;  4ANX A;  4KGT A;  4RF1 A;  3AUL A;  3TMP B;  2L1A A;  2LI5 A;  3L4P A;  3UIO B;  2KC1 A;  3NG0 A;  1ESF A;  2D3G A;  2XNA C;  1AN8 A;  3T8M A;  4A8X C;  4JE3 B;  3C8Y A;  2MJ3 A;  1ENF A;  2JYE A;  2KN5 A;  3KUD B;  1HZ6 A;  2FCM A;  3PLV A;  4P1B C;  1FNW A;  4MEL A;  5H92 C;  3BVZ A;  1LM8 B;  3HVD A;  4P6V F;  2BW2 A;  4PS7 A;  4PYU A;  3HIZ A;  1HEZ E;  2JZ3 B;  4I6N B;  3NZ3 A;  1ET9 A;  3P4S B;  1MJD A;  2KYW A;  2JZP A;  4NJ7 A;  2CKH B;  2IO2 B;  1SIJ A;  3IG3 A;  3R3M A;  1XLQ A;  1P7E A;  1ZDV A;  1HZ5 A;  2E6X A;  3ZTD A;  3DOW A;  1UGM A;  3L17 A;  3RYT A;  1EWY C;  5TSS A;  2NVU I;  2K5P A;  1ZW7 A;  1F0Z A;  1EU4 A;  4OZA A;  4ANU A;  3T3O A;  5H8Y E;  2K8B A;  1YMH E;  3T3N A;  3TJP A;  3AE9 B;  1NBF C;  3VAW A;  2FCQ A;  3NRZ A;  3AE4 B;  4XE0 A;  1WI0 A;  2BYT A;  2BB5 A;  3MJ5 A;  3N3K B;  4RGO S;  3AED B;  1QZE A;  3HUI A;  4DDG D;  2MRP A;  1TY0 A;  4MGI E;  2BPS A;  3VHT C;  3PVL A;  5C3J B;  3PV1 A;  1D6E C;  4KV2 A;  4MEM A;  1I4R A;  2FE8 A;  1SE3 A;  4AJY B;  2WX0 A;  1B9R A;  2K22 A;  4BBN C;  2M0A A;  1MVK A;  4JQW C;  1KF6 B;  2A5U A;  2O6V A;  4JLC A;  4KGS A;  2WU2 B;  2DEN B;  4A55 A;  3ENE A;  1E8Z A;  5AZF A;  2KVZ A;  3H1U A;  1L7Y A;  1XLN A;  2JZZ A;  2R2O A;  3DBS A;  3W2D A;  4M01 A;  2VH2 A;  2NMQ A;  4J6I A;  1E7U A;  1UH6 A;  5AUI A;  2KHW B;  4W9H A;  3W1S C;  1JWM D;  4MAC A;  4YXD B;  2WLB A;  4NAM A;  2LXA A;  3RNE C;  4OZC A;  1WWT A;  1D4B A;  3UQA A;  3ZIM A;  3OJ3 A;  2W82 A;  3AM9 A;  3WIM A;  2MBH A;  2WNM A;  2CS4 A;  2FIF A;  2GLS A;  3PO0 A;  4EFO A;  4HKQ A;  1KLV A;  3AE1 B;  2HDE A;  3ZJT A;  1QF6 A;  3DHH C;  4W9F A;  3QAR A;  2BT6 A;  3KVF B;  1I42 A;  1F1H A;  2HJ1 A;  2KFJ A;  2FCS A;  1FIQ A;  2X8X X;  3P4Q B;  4NNJ B;  3P63 A;  2GBN A;  4S17 A;  3QJZ A;  5D94 A;  2DZK A;  3AU4 A;  1XD3 B;  2LAS A;  1HA5 A;  3RNA C;  2L3Z A;  1J0G A;  3OLM D;  3EC8 A;  4JWU C;  4RH6 A;  1IP9 A;  2WXO A;  5CTR C;  2VZK D;  1YN5 A;  5KHO A;  1D5X C;  3SFD B;  4K3C A;  1SJH D;  3UQB A;  2ZPY A;  4MSQ B;  2OHF A;  3CST A;  2KWC A;  3LXF A;  2BTE A;  3NZU A;  4XWW A;  3ZLZ A;  3LYY A;  2G3Q B;  2OED A;  1V8C A;  2LJ5 A;  3URY A;  5HI1 A;  2WS3 B;  1TYG B;  1V5T A;  3R7R A;  2K8H A;  1A5R A;  3R66 C;  2KO3 A;  1LFD A;  2MEK A;  4NJ6 A;  4AWJ A;  2FBW B;  3APF A;  2SEB D;  3JYU A;  2YEP B;  3DVG X;  2M4N A;  2WXN A;  3OAW A;  1KOT A;  4KIK B;  2WXL A;  1GC6 A;  1RYJ A;  2WXH A;  2KFK A;  2RSU A;  1FCL A;  4US8 A;  3T9L A;  3QC8 B;  3DQV A;  1Y56 A;  2VZK B;  4LJO B;  2Z8L A;  3VDZ A;  3PZ7 A;  3RUL A;  4I6P A;  2KWU B;  3ZQ4 A;  2QHO A;  3AV8 A;  3CWI A;  2IPK D;  1F2R C;  4GLS C;  3TIX A;  3V3X A;  3IT6 B;  2DZM A;  2WU5 B;  5HG2 A;  1WX9 A;  3GB1 A;  4Q2J A;  2FUH B;  2IND C;  5CHF A;  2JUO A;  1E90 A;  2PE6 B;  2KMM A;  4KKI A;  3V05 A;  2DYB A;  3JSV B;  4WWP A;  1F9J A;  2MP2 B;  2KDE B;  3O65 B;  2B76 B;  3RNG C;  3B1L X;  1SXT A;  3APD A;  3BY4 B;  2KWD A;  1MG8 A;  1YQ4 B;  2G4D B;  1SBB B;  1V49 A;  1WJ6 A;  1PGB A;  1YOV B;  1NYQ A;  4B6W A;  4ANV A;  1IYF A;  1D3Z A;  1L4Z B;  1M94 A;  4MM3 B;  4AP4 C;  2DYM A;  5IN7 A;  3PZ8 A;  1YN4 A;  3BII D;  3PHX B;  1RLF A;  4N9F 4;  3ETR A;  5I4D A;  1YJ1 A;  3QAQ A;  4PYZ A;  5EE1 A;  1QOG A;  3U8Z A;  5EDS A;  4D2K A;  1MG4 A;  3VRA B;  2WXP A;  4FN2 A;  4EZL A;  1N6Z A;  3P2B A;  4WH4 A;  3FIL B;  3H7P B;  2TSS A;  3A1Q A;  1WJN A;  2H89 B;  3AN1 A;  2JT4 B;  4US9 A;  3RN9 C;  2LHE A;  1AYF A;  3A9K A;  1UUP A;  2AQ1 B;  1EU3 A;  3AEG B;  4II3 B;  4FHK A;  1PGX A;  3TEW A;  4WJN A;  1N61 A;  4HJG E;  2DHZ A;  5G5G A;  4GDK B;  1WZ3 A;  5C1Z A;  3MTN B;  1UWM A;  5IP4 D;  2QJL A;  2ZPN A;  3ZYY X;  1EUV B;  2D5G A;  4GN1 A;  2N7E A;  1GG3 A;  4C4V A;  4XYC A;  3P1M A;  4USA A;  2LHD A;  2JWU A;  3BK1 A;  4IKG A;  4DHJ D;  2PE9 A;  1WM3 A;  3APC A;  1JRP A;  4K81 A;  4WWO A;  4EZJ A;  2ASQ A;  1IGC A;  2L0T A;  2OJR A;  4MH0 E;  3VTU A;  3MHS D;  5CHV C;  1TBE A;  4RMA A;  3EGR A;  4TMA B;  4GB9 A;  3QCA A;  1WYW B;  3DWM A;  2HD5 B;  3NVY A;  1E9M A;  2AQ3 B;  2H88 B;  2V1Y A;  2LVP A;  2WGS A;  2C7N B;  4HXD A;  1UBI A;  3KW5 B;  5DPT A;  2O6V D;  1T0Y A;  4CQN A;  3ZXR A;  2FNJ B;  3WCQ A;  1RAX A;  4K7U A;  1GB4 A;  1I4X A;  2L83 A;  2KJR A;  2WDR B;  4KIK A;  3CMM B;  1SJE D;  4K1R B;  4YWG G;  5JHB A;  3AU5 A;  2AQ2 B;  2IO0 B;  4EOY A;  4E74 A;  2MH7 A;  4FUL A;  4GIV A;  4MSM B;  1CJE A;  1C1Y B;  1ZE3 D;  3VTW A;  4N6E B;  2W9N A;  1DOY A;  3VTV A;  1T0S C;  4DHZ E;  3V6E B;  4ZYN A;  4ZOH C;  4NAW A;  2IZV B;  2ZNV C;  2DX5 B;  1EWC A;  2BS4 B;  1NYR A;  1WXV A;  4HCN B;  3ONS A;  3KLS X;  3H8H A;  1STE A;  3N30 A;  2DNF A;  2IO3 B;  2RDG A;  2IO1 B;  4HDO A;  2ZJD A;  3EHV A;  1TZ1 A;  4FJZ A;  1RM6 C;  4MT5 A;  3AI5 A;  2FCN A;  3R8B A;  2O6V B;  1DYQ A;  3ALB A;  4HPL B;  4ARC A;  1FM0 D;  3DBL B;  1J7A A;  1QOA A;  1H4R A;  1DOX A;  1WXA A;  1FXI A;  2RDH A;  1YN3 A;  2L0F A;  4ZDV A;  2LXC A;  1B1Z A;  4ITK A;  2KVR A;  4HPP A;  4A90 A;  4GXB A;  1K52 A;  1TZO A;  2V9H A;  2M56 B;  1NVI D;  1TKG A;  3AXC A;  3FIL A;  3H7P A;  3N32 A;  1NDD A;  2JVC A;  1T3Q A;  3Q69 A;  1FPY A;  1L0X B;  3IXS A;  1RWS A;  2VRR B;  2MJE A;  2ZVN A;  5JXV A;  1AWD A;  4NY0 A;  4X57 B;  2M1M A;  3TCA A;  1FEH A;  5G5H A;  2PPH A;  2CJO A;  2WXG A;  1SIF A;  5CX3 A;  4L23 A;  1IGD A;  1C3T A;  4ANW A;  2GOW A;  1LQB A;  4KKJ A;  5D7G A;  2ZCC A;  1BXT A;  5FK9 C;  5D3I B;  2D07 B;  3MJW A;  2DZJ A;  1JWB D;  4YT0 B;  4KVG B;  4LNN A;  4DWF A;  4WAF A;  1I4G A;  4FBJ B;  2QIL A;  1GUA B;  2M0X A;  2LGY A;  3NVV A;  1E8W A;  4KGR A;  1WGY A;  2AYO B;  1V2Y A;  5BMG A;  4XWT A;  5E6N A;  1XEE A;  4MH8 A;  3ZVV A;  4W9C A;  3RMK C;  3PGE A;  4RCO A;  1FXT B;  2KDB A;  3Q8A A;  1YX5 B;  3ECI A;  3NVZ A;  4LCD E;  4RM8 A;  2BF8 B;  5J17 A;  1ET6 A;  2R61 A;  2K6Q A;  3AH7 A;  2INC C;  4URK A;  1NI3 A;  1N63 A;  3W1Y A;  2KT7 A;  2C60 A;  1BML C;  4YTM B;  3QK0 A;  2JWZ A;  1FXA A;  3BK2 A;  1QT9 A;  2KAN A;  1ZKH A;  2WDQ B;  2KJH B;  3RNB C;  3RNC C;  1TS5 A;  4C7Z A;  3U30 A;  3Q2A C;  2KQS A;  2JF5 A;  2KWV B;  2BS3 B;  4TSS A;  1X1M A;  4LDT D;  4A3O A;  1YX6 B;  1F77 A;  1N60 A;  3KYC D;  2JRI B;  3OWE B;  3U2S C;  4FJV B;  2DAF A;  3DBL I;  2MA9 B;  1HTQ A;  2N9L A;  4ZHO A;  1JQ4 A;  3V62 A;  1J8C A;  2GBR A;  2KLC A;  3BYY B;  2KDI A;  2ACZ B;  2KFK B;  4FXC A;  3VH4 B;  3BVM A;  2Y5C A;  3AE2 B;  3DPD A;  3B08 A;  1YQ3 B;  3SU8 X;  1NEK B;  3UIN B;  3OG5 A;  3I63 C;  2R2Q A;  2WXQ A;  5TR5 A;  2ZVO A;  2LFI A;  3RPF C;  3ZUN A;  2D11 A;  4YTP B;  3DHI C;  4HKZ E;  4ICU A;  2K3U A;  1Q1O A;  1RRB A;  1J7B A;  4R3D A;  3Q3O C;  2NBU A;  4G3X B;  5IA7 A;  2C7M B;  2MSE D;  2D10 A;  3B2F A;  3E9S A;  5JH5 C;  3WA0 A;  3MC9 A;  2IGD A;  3PRP B;  4LDT B;  1A70 A;  2KTR B;  1BT0 A;  5JHA A;  4AQ7 A;  1C4A A;  4PS3 A;  4BKG A;  2KLG A;  1OQY A;  2UYZ B;  1V80 A;  1L6U A;  1WSP A;  1XLP A;  2DWQ A;  5BO4 B;  2J7Q B;  1S3S G;  1R4M B;  5IKC M;  2E3T A;  2IY0 B;  4IC7 B;  4W9G A;  4M00 A;  2NCN A;  4WUR A;  1VRA B;  3CIR B;  5C2T B;  2INN E;  3UF8 A;  3RI7 C;  3ZRC A;  4GU2 A;  3NS8 A;  4F1S A;  2PMV A;  2D2Q A;  3EA6 A;  3KWV A;  1I4Q A;  3ZRF A;  1P0R A;  1N5X A;  5C23 A;  3A1Q B;  2MBO A;  2K1F A;  1BUI C;  3H9D A;  3VUY A;  4JIO U;  4HRS A;  5DPW A;  3A9K B;  3RFZ B;  3IT4 B;  4LJP B; 
#chains in the Genus database with same CATH homology
 1CQV A;  1C4C A;  1TKE A;  3BII D;  2INP E;  2JXT A;  4C7Y A;  3ETR A;  4GDL B;  5I4D A;  1T6B X;  3W5V B;  3EUB 2;  4LK0 M;  1QOG A;  2EKI A;  5EE1 A;  1YNT E;  1ZP0 B;  5T8I A;  2K9X A;  4A6Q A;  3GS2 A;  4D2K A;  2W54 A;  1JWS D;  1ZUD 2;  3VRA B;  2WXP A;  2JSV X;  1KLG D;  3MFG A;  3HVZ A;  1D5M C;  5BMI A;  1SE4 A;  2JU6 X;  4XDC A;  4WH4 A;  3FIL B;  4RF0 A;  3AMZ A;  4HEA 1;  2DYO A;  2TSS A;  4L1B A;  3AEA B;  2H89 B;  3B2G A;  3AN1 A;  1FRR A;  4US9 A;  4WQM A;  2LHE A;  1AYF A;  1UUP A;  2AQ1 B;  1EU3 A;  1V97 A;  3AEG B;  2PIA A;  2KAJ A;  1PGX A;  3TEW A;  4REZ A;  4C56 C;  1N61 A;  4HJG E;  5G5G A;  1HQR D;  4UDU C;  4GDK B;  1C76 A;  1UWM A;  2IGH A;  1WRI A;  2QJL A;  2IJ0 A;  1DGJ A;  3I9V 1;  5BMH A;  1DOI A;  2XN9 C;  1WGK A;  3AE8 B;  3ZYY X;  1KH0 A;  4ZYS A;  3Q8F A;  2D5G A;  3TSS A;  5EE9 A;  1GPX A;  2ON8 A;  2ZW1 A;  1FNV A;  3P1M A;  2Q5W D;  2N0S B;  2N9K A;  4USA A;  1FO4 A;  5GXG B;  2LHD A;  3DWG C;  2I2Y A;  2JWU A;  3BK1 A;  3FAH A;  4A9A A;  4JX1 C;  4DQO C;  3TEZ A;  4DXF A;  1IUE A;  4IKG A;  3SR6 A;  2KAC A;  4L2Y A;  1WYG A;  2BS2 B;  2J52 A;  1T5X D;  3NS1 A;  1JRP A;  4OHJ A;  1MPE A;  1F2R I;  3AE6 B;  3J9C A;  1FFU A;  1VZ8 A;  3R2I A;  1C78 A;  4YSX B;  5EE3 A;  1MHX A;  1IGC A;  2CU3 A;  1SSN A;  1K51 A;  3UI3 A;  3EGR A;  1JAL A;  3Q8E A;  4KGT A;  4TMA B;  4RF1 A;  2L1A A;  3DWM A;  1XO3 A;  2IDY A;  3L4P A;  3NVY A;  1E9M A;  2AQ3 B;  1XXG A;  2H88 B;  1ESF A;  3BZD B;  4OW0 A;  1UNS A;  2XNA C;  2QMT A;  4PT5 A;  4NAW B;  1AN8 A;  4A8X C;  1JML A;  1RFK A;  4JE3 B;  3C8Y A;  2MJ3 A;  4CQN A;  4YTN B;  3WCQ A;  1GB4 A;  1I4X A;  2L83 A;  1ENF A;  2WDR B;  2LGI A;  2L32 A;  2JYE A;  1I4P A;  1SJE D;  4JWS C;  2JQR B;  1HZ6 A;  1VZ7 A;  4YWG G;  2QEJ C;  2AQ2 B;  1FNW A;  2MH7 A;  2Y3A A;  1NEN B;  1CJE A;  4O1N A;  2L52 A;  5H92 C;  3BVZ A;  3B9J A;  2WP9 B;  3AB5 A;  3HVD A;  4P6V F;  3VQI A;  2BW2 A;  1ZE3 D;  4N6E B;  1HEZ E;  2LJI A;  1DOY A;  1SF0 A;  2X38 A;  1KTK A;  2JYT A;  3NZ3 A;  3BWU D;  3VRB B;  1ET9 A;  3P4S B;  2IGG A;  3ZJU A;  2JZP A;  4ZOH C;  2RMM A;  1IBX B;  1EM7 A;  1SIJ A;  1QOF A;  1XLQ A;  1TS2 A;  3HRD D;  1P7E A;  1EWC A;  1ZDV A;  1FFV A;  2BS4 B;  1NYR A;  2LMC A;  1V1P B;  3MC0 B;  1HZ5 A;  3KLS X;  3IAM 1;  2E6X A;  3H8H A;  1STE A;  3AEC B;  1ZOY B;  2WXK A;  1JCK B;  1KLU D;  1EWY C;  5TSS A;  1FRD A;  2K5P A;  2RDG A;  3ZGZ A;  1XCT L;  1L0V B;  1YJI A;  1F0Z A;  1EU4 A;  4OZA A;  2RPV A;  3T3O A;  2W3R A;  5H8Y E;  1FD6 A;  1PDX A;  1KFY B;  1YMH E;  1CK1 A;  5BYR A;  3T3N A;  1RM6 C;  3AE7 B;  3AE9 B;  4P16 A;  1MI0 A;  4MT5 A;  1JWU D;  1OQR A;  3NRZ A;  3AE4 B;  3R8B A;  5LNK 1;  4XE0 A;  2BYT A;  2BB5 A;  3MJ5 A;  1DYQ A;  2PKO A;  4J3O D;  1N62 A;  2FUG 1;  4RGO S;  4ARC A;  1TY2 A;  1FM0 D;  3AED B;  3ABV B;  3HUI A;  1J7A A;  1JW9 D;  1ZPS A;  3P4P B;  1TY0 A;  1D5Z C;  1QOA A;  3W5U B;  1K53 A;  1DOX A;  1KRH A;  5C3J B;  3LB8 C;  1FMA D;  1FXI A;  2RDH A;  3AEF B;  1D6E C;  1YN3 A;  1I4R A;  1B1Z A;  3SEB A;  4ITK A;  1OQQ A;  4TQ1 A;  4RGM A;  2FE8 A;  1SE3 A;  4A90 A;  1B9R A;  1K52 A;  1TZO A;  2W55 A;  3IAS 1;  4TQ0 A;  2M56 B;  1NVI D;  1TKG A;  4XDD A;  2J53 A;  2K22 A;  3AE3 B;  1QIL A;  2PVO D;  2M0A A;  3MHZ A;  3FIL A;  1MVK A;  1SE2 A;  3AEE B;  4JPS A;  5BYQ A;  1SB3 C;  1T3Q A;  3Q69 A;  1KF6 B;  1QKZ A;  4WIP A;  2GRI A;  1L0X B;  1ZXH A;  4KGS A;  2WU2 B;  4A55 A;  3IXS A;  4OVZ A;  2CJN A;  1RWS A;  2MJE A;  2PW9 A;  5JXV A;  1AWD A;  1C4P A;  4NZL B;  1V1O A;  1XLN A;  3W2D A;  1C79 A;  1FEH A;  5G5H A;  2V3N A;  2CJO A;  2NMQ A;  2WXG A;  4KX6 B;  1I4H A;  4L23 A;  5AUI A;  1IGD A;  1OFF A;  3AE5 B;  3VR8 B;  1QOB A;  1FNU A;  3Q8B A;  4KKJ A;  4LLG M;  5D7G A;  1JWM D;  1PYW D;  4MAC A;  1BXT A;  5FK9 C;  3VR9 B;  4YXD B;  5D3I B;  1ZXI A;  2WLB A;  4NAM A;  2LUM A;  1JWB D;  4YT0 B;  1TS4 A;  4OZC A;  1WWT A;  1D4B A;  3Q8C A;  4WAF A;  1I4G A;  2M19 A;  2W82 A;  2N7J A;  2QIL A;  3NVW A;  3TUO A;  3AM9 A;  1L4D B;  3U52 E;  1FCC C;  2WNM A;  3NVV A;  1M4V A;  4KGR A;  3PO0 A;  3E56 A;  4HKQ A;  5AUK A;  2W3S A;  5BMG A;  4XWT A;  3AE1 B;  1E6E B;  2HDE A;  3ZJT A;  1XEE A;  2WXJ A;  4MH8 A;  1QF6 A;  1GOZ A;  1L0Y B;  4RCO A;  4M0W A;  3NUH B;  3Q8A A;  3NVZ A;  3P4R B;  2BT6 A;  1SEB D;  5E6J A;  3U4E G;  1GB1 A;  2YEP F;  1ET6 A;  2R61 A;  2PLP A;  3AH7 A;  3TEY A;  1FIQ A;  2EEL A;  2J4X A;  1NI3 A;  1N63 A;  3P4Q B;  3P63 A;  1BML C;  2AX5 A;  2BB6 A;  4YTM B;  4RFB A;  1FXA A;  1J7C A;  1L5P A;  3BK2 A;  2V4I B;  1N5W A;  1QT9 A;  4RNA A;  1K50 A;  3ZJV A;  4DXG A;  2WDQ B;  1TS5 A;  4C7Z A;  4YSZ B;  3W9C B;  4N58 A;  1HA5 A;  3KQ4 A;  1AW7 A;  4C80 A;  2WXR A;  3O13 A;  2BS3 B;  4AS1 A;  1QLB B;  1E7P B;  3MP9 A;  4JWU C;  4TSS A;  4RH6 A;  2V0G A;  1XLO A;  2WQY B;  2WXO A;  2NTT A;  1MHH E;  1F77 A;  2WXI A;  1VZ6 A;  4LTU A;  2J42 A;  4WWM A;  1IBX A;  1N60 A;  2MJD A;  2VZK D;  1YN5 A;  3OWE B;  1D5X C;  3U2S C;  3SFD B;  1ACC A;  1SJH D;  1V1P A;  2V3P A;  2OHF A;  2N9L A;  2LEK A;  4RGT A;  4RGN A;  4ZHO A;  1JQ4 A;  5D3D A;  1TKY A;  3LXF A;  2I38 A;  1QQR A;  2G9H D;  1VR9 A;  1TS3 A;  4ZHP A;  4H2A A;  3U7Z A;  4N59 A;  2BTE A;  4XWW A;  3BYY B;  2ACZ B;  4FXC A;  3LYY A;  3BVM A;  2Y5C A;  3BVG A;  2OED A;  1PGA A;  1V8C A;  2PVG C;  3AE2 B;  3URY A;  4NJC A;  1YQ3 B;  5HHD G;  5HI1 A;  1NEK B;  2WS3 B;  1TYG B;  3TEX A;  1I7H A;  4IOI E;  2WXQ A;  4ARI A;  1XCQ L;  2LFI A;  3RPF C;  1GAQ B;  2MEK A;  1PFD A;  1L6V A;  4YTP B;  2PTL A;  1TJE A;  4HKZ E;  1PUT A;  2K3U A;  2DLB A;  1J7B A;  2FBW B;  4R3D A;  2SEB D;  2YEP B;  1WXQ A;  2WXN A;  3B2F A;  2WXL A;  3E9S A;  1E10 A;  5MPO A;  1RYJ A;  2G1E A;  2WXH A;  2KQ4 X;  2IGD A;  4B0E A;  1JWA D;  1FCL A;  2Y5P A;  4US8 A;  2JX5 A;  2NTS A;  3GP7 A;  1A70 A;  3W1S A;  2ONQ A;  4AQ7 A;  1C4A A;  1VDV A;  1Y56 A;  2VZK B;  1L6U A;  1WSP A;  1XLP A;  2DWQ A;  2Z8L A;  4ZRP A;  2ICI A;  3PZ7 A;  1R7S A;  3ZQ4 A;  2WDV B;  3AV8 A;  3CWI A;  2IPK D;  1F2R C;  1VLB A;  4GLS C;  1XF5 L;  3V3X A;  2E3T A;  3IT6 B;  1LO5 D;  4OZB A;  2WU5 B;  4ZRQ A;  5HG2 A;  3GB1 A;  1JRO A;  4Q2J A;  2SAK A;  4WUR A;  1VRA B;  2KN4 A;  3I57 A;  3CIR B;  4B0M A;  2WXF A;  1UWX A;  3BYT B;  5C2T B;  2KMM A;  5HFY A;  4KKI A;  3V05 A;  1Q10 A;  2INN E;  2QIE B;  3P42 A;  4YSY B;  2GI9 A;  2K0P A;  2DBY A;  2B76 B;  1P7F A;  3SFE B;  3N9Y C;  1SXT A;  4HRO A;  1E0Z A;  2HTM E;  1ZDX A;  2GB1 A;  2PMV A;  2KWD A;  3EA6 A;  1YQ4 B;  2KDM A;  1I4Q A;  3KWV A;  4EE2 A;  1SBB B;  3KWL A;  1N5X A;  5FR3 A;  1YJJ A;  5EE0 A;  1HXY D;  2ZW0 A;  1PGB A;  2WXM A;  4IDI A;  1NYQ A;  1C77 A;  1BUI C;  1CZP A;  5BYS A;  1ROE A;  1L4Z B;  4MM3 B;  4HRS A;  1UGJ A;  2DYM A;  1VJK A;  2QSD A;  5FKA C;  3RFZ B;  1C9F A;  2BBC A;  3AEB B;  3PZ8 A;  3IT4 B;  3FC4 A;  1YN4 A;  3R2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...