5JH5C

Structural basis for the hierarchical assembly of the core of prc1.1
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
88
Chain Sequence
HSKAHYYRYDEQLNLCLERLSNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title KDM2B Recruitment of the Polycomb Group Complex, PRC1.1, Requires Cooperation between PCGF1 and BCORL1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein/transcription
molecule keywords Lysine-specific demethylase 2B
total genus 22
structure length 88
sequence length 99
ec nomenclature
pdb deposition date 2016-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF16207 RAWUL RAWUL domain RING finger- and WD40-associated ubiquitin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5jh5C00
4EFOA 3W1YA 1XT9B 2OJRA 3HM3A 4KSLC 4EZJA 5IA7A 3KUCB 2HJ8A 2MLBA 4IW0A 4FLHA 4TV3A 1WFYA 2LVOA 3KVFB 1NBFC 2LVPA 2GOWA 4EOYA 3QC8B 3QJZA 1MG8A 1WE7A 2GMIC 2RGFA 4JGHB 3DVGY 1KOTA 4KZCA 4AOFA 1Q0WB 2ZPYA 1YQBA 2IO2B 2KKCA 4E74A 1OEYJ 2KDIA 2Z0EB 4TQ0A 3JW0X 4K7WA 3TMPB 3WA0A 2DZJA 4HDQA 3AU5A 2WWZA 1GJZA 2DZIA 4WJNA 5D7GA 2CHXA 2J0MA 4ZRKA 2EKEC 1SGHA 4FN2A 5IAAC 4NAWB 3APCA 4KDIC 3R66C 4GB9A 4W9EA 4DDID 3BY4B 4W9GA 4JLCA 4DHZB 1V49A 3Q3FA 2NBWB 4B6WA 4W9DA 3IG3A 2WYQA 2LASA 2AEHA 4BVUC 2CHWA 3L17A 2KTRA 2LI5A 1P1AA 1WJ6A 1NI2A 2EMTA 1E8YA 3RZFA 2WX0A 2XEWA 2O6VD 3PREA 4WJQA 1WR6E 1WXMA 3APFA 1WH3A 2N1WA 4I6LB 1WX9A 2XK5A 1WXVA 3A33B 2QHOA 3PHWB 4B95A 4HVBA 3JYUA 3U30A 2IZVB 2KX0A 3L54A 3ZRCA 2AYOB 5LXIB 4MGKE 3IBEA 3PZDA 3DBRI 3UIOB 3PLVA 2BYVE 4RM9A 4TKNA 2MA9B 3AXCA 1E7VA 2KLCA 2L7RA 1EUVB 2CU1A 3HK0A 3K9OB 2KC1A 3S2AA 1UH6A 3VAWA 1IP9A 2MBEA 1V80A 1LQBA 2IY0B 2HTHA 4LCDE 1WIAA 4OVVA 4PS7A 3UINB 2C5LC 4FADA 2J0KA 1V5OA 3WAOA 4KV2A 3KUZA 2NPTB 4NPNA 4YL8A 3ONSA 1JRUA 4EUTA 3IVFA 3ZNID 1R4MI 3V62A 3VH3B 3VUWA 2DHZA 1YD8U 3QQ8B 3ML8A 3SHQA 1WX8A 1T0YA 3ALBA 3DBLI 3ZO5B 4AJYB 3PRPB 2KWUB 1RRBA 3B0AA 3I3TB 1VD2A 3H7PA 2V3SA 2C60A 3AI5A 2KJ6A 4IWOA 4LDTB 3VUXA 1J19A 2BKFA 3CF6E 2K8BA 4BOZB 3DOWA 5JHBA 2YLMA 2Z0DB 5CHFA 1E8WA 2MP2A 1WRDB 1QZEA 2I1KA 1KM7A 4M8MA 4WQOB 4F7ZA 1OGWA 2KTRB 2LUEA 3B08A 3DDCB 4FJYA 4P7IA 4PYUA 1WI0A 5J17A 4IC7B 4KVGB 4CYEA 3SD5A 1V9JA 1Z5SB 1XD3B 1ZW7A 3RULA 2DYOA 4ANWA 5G55A 2LGDA 3R7QA 1C3TA 1TZ1A 2W9NA 3WIMA 2REXA 1WZ3A 2WDTB 2HD5B 1WGGA 2JVCA 3PSEB 4W9JA 4CO7A 3BINA 2PEAA 3UQAA 4A3PA 5CX3A 4EZKA 4IG7B 5DPRA 2BWES 4HDOA 1YX5B 4LJOB 2CR5A 4BFRA 2UWQA 2K25A 1V86A 2KO3A 3VH4B 2GBKA 2KVRA 3A9JA 4DHZE 3TIXA 3R3MA 1WJNA 4NQLB 1WM2A 2PE9A 1EF5A 2DYMA 2L3ZA 3P2BA 1WY8A 3AU4A 4BOSC 4PS3A 2ZNVB 2ZVOA 4EEWA 1AARA 4WWNA 5E6PA 2NVUI 2JUOA 3H6NA 2LRWA 4NJ6A 5G2NA 3ZW3A 1UBQA 1WXSA 2KX3A 3KW5B 2DAFA 4I6NB 3PRZA 5BO4B 4MGYE 4FHJA 4GU2A 5C23A 3NY5A 3QK0A 3OLMD 4DXAB 3ZDTA 4GDLA 2NS5A 3ZLZA 3MHSD 2KQ7A 4I6PA 1OEYA 1YIWA 1OTRB 4DK5A 2ZCCA 1HE8A 4EZLA 4OVUA 1IYFA 1YJ1A 4BKSD 2YVCA 2GBMA 2WX1A 2M8SA 3M95A 4W9LA 3Q3JA 4HPMB 2CHZA 1E5WA 2JRHA 5DPSA 2BF8B 2V1YA 3WAMA 5J18A 3QWZB 4HWIB 1R4NI 4RMAA 4MJSB 4HK2A 3WAPA 2D10A 5AZFA 4AUQC 2KWCA 2C7HA 1WX7A 4MM3A 1X1MA 2BPSA 4MELA 3T8MA 2LVQA 4PYZA 3PVLA 4WWPA 1OQYA 2BYEA 1Q1OA 1M94A 1SE9A 4K1RB 5EDSA 1Z2MA 4E71A 2RD0A 1H4RA 2IYDB 2K6DB 2MBOA 4G50A 4HXDA 2FIFA 4M0WB 4ZYNA 2MWSB 2HE7A 3QHTA 4W9CA 1L2NA 2GBNA 2NCNA 5D94A 1P0RA 4XC2A 4EKUA 4IWPA 3PHXB 1ZGUB 2KFKA 4II3B 5JHAA 2D3GA 4X57B 3H7PB 1PQSA 1WZ0A 3ZIMA 1H8CA 2DZMA 2M1MA 2O2VA 5D6JB 3N32A 2FNJB 2JXXA 3SDLC 1J0GA 3D32A 3K9PB 1WJUA 4WJOA 4JQWC 3TBLD 4AP4C 1XQQA 2MQJA 2MCNB 3L08A 1E7UA 1WYWB 2CKHB 2ZCBA 2CS4A 2KLGA 3M63B 3X0WA 3H7SA 2ZNVC 3VDZA 2NR2A 3DVNU 1TBEA 2BKRB 3A1QA 3M62B 2IO3B 1EF1A 2KFJA 4HPLB 4FA6A 2L0FA 5FR6A 2K8CA 2C9WB 2JRIB 3RUIB 1G6JA 3JSVB 1BT0A 1TTNA 4MGZE 3LDZE 5KHQA 2KTFA 3L10B 3NHEB 2L0TA 2KZRA 2MBHA 1I35A 2G4SA 2VRRB 2LXCA 5HKHA 1WGYA 3V6CB 3W1SA 1Q5WB 4GMVA 4II2B 4W9FA 2J7QB 4DBGA 1WJ4A 1WF9A 4IWQA 4ZRIA 1U4AA 2FIDA 3VQIA 2KHWB 4K81A 1WMHA 4MDKE 4HLEA 2LRUA 2DZKA 2C7NB 3ML9A 3VTUA 3DCGA 2LWPA 2ZJDA 4AWJA 4BBNF 3DQVA 3A9JB 1WGHA 3L16A 2LXAA 3EHVA 1RFAA 5LXHA 3PS6A 1I42A 4WJPA 3A1QB 3CSFA 4RM8A 1GC7A 2PJHA 1D3ZA 5DPWA 3DPDA 3KYDD 2KNBA 3JSVA 4G3XB 4E3CA 3WALA 2G4DB 4F8CB 2JZZA 3PPAA 3TJPA 4AJWA 3A4RA 1C1YB 3ZTCA 3V60A 2C7MB 3LJ3A 1ISNA 4GGQA 5AEKB 4IM3A 4TQ1A 4NNJB 3M3JA 2KXJA 4NAWA 1VCBA 3OAWA 3PT2B 2LGXA 3PGEA 4W9IA 2M17A 2AL6A 4DHJB 2R2QA 4FHKA 2MW5A 3KUDB 2FCNA 5GMVA 3VHTC 1ZKHA 3VUYA 4ZRJA 2IO1B 3B1LX 1A5RA 4KZ0A 1UD7A 2DENB 2V4LA 3H9DA 3QIJA 4M8NA 3R7RA 2MSED 3EECA 4MJSA 4BKGA 3QARA 4FBJB 3N30A 3QX1A 2D2QA 4DWFA 1Y8RC 2ZEQA 3W1SC 4GN1A 1UZXB 2KQSA 3PLUA 4FJZA 4N9F4 2KDEB 1E90A 2O6VB 3HHMA 4XZ4A 2Z59B 4ZDVA 1WXAA 2BGFA 3A4SC 3UF8A 1EO6A 4ANXA 3RZWC 4GOCA 2KD0A 4CHKA 2L00B 1KJTA 1WR1A 4ICVA 2KANA 4WWOA 2L05A 2DX5B 2JY6A 4NJ7A 2M0XA 2JT4B 2G3QB 2KJHB 2KMCA 4DHJD 3GOEA 4JIOU 5AZGA 4MSQB 4W9KA 4XX5A 3RT3B 1UGMA 2AWTA 2MP2B 2RSUA 3C0RB 3RCZA 3RD2A 3MTNB 4A3OA 2FCMA 4GIVA 1WMHB 2FCSA 2KMAA 3UIPB 3X23A 1J8CA 3L0WB 3APDA 1WGRA 1GNUA 2A5UA 3UQBA 4MH0E 5J2RA 3VTWA 3OJ4B 3IFWB 4IUMB 3ZVVA 2LJ5A 3RYTA 1TGZB 3DVNV 2O6VA 3ZNGC 1WE6A 1F9JA 5AZHA 3TCAA 5JZEB 2K8HA 1WGDA 4HJKA 2J0JA 2LGYA 3ZTDA 2I1JA 4G0NB 5TR5A 4IM0A 2KDFB 1E8XA 4ICUA 4K7UA 3V61A 4FJVB 2D11A 2JPHA 1V6EA 5LLIA 1CMXB 2BWFA 4J6IA 4JL9A 4BKTA 1LFDA 4ANUA 5DCNA 2FCQA 3A9KB 1UELA 3HIZA 3HM6X 3U8ZA 2B3AA 2LZ6A 3EC8A 4GXBA 4KSKC 2EMSA 4A20A 2OOBB 2ZZPB 4GSWA 5E6OA 4MEMA 2ZPNA 5DPTA 3NS8A 4WAAA 4W9HA 2RR9A 3CMMB 3QA8A 2NBVB 4LJPB 1S1QB 2MX2A 2A4ZA 5CHWA 2N9EB 3AULA 4URKA 3DVGX 4NY0A 2N1VA 3ZUNA 2K1FA 3CSTA 4DDGD 5C1ZA 4G11A 3WANA 5D2MB 4KIKA 2K6QA 4F1SA 2PPHA 3PRMB 3ZKJC 2AL3A 3QCAA 2DYBA 2ZVNA 3KYCD 1LM8B 2KDBA 2LD9A 4B9KA 3H1UA 4BKSA 1LXDA 4FULA 2MRPA 2N4FA 2KN5A 2JZ3B 2IBIB 2NBUA 2UYZB 4MGIE 3ZRFA 3N3KB 4GDKA 1V81A 2ASQA 2RPQA 4PS8A 4ANVA 3ZNZB 1YX6B 1GG3A 1FXTB 3V6EB 1WM3A 3DBSA 2R2OA 1GUAB 3O65B 2N9PC 1UBIA 2K39A 2N7DA 3PV1A 1RAXA 4MSMB 2IO0B 3T9LA 4BBNC 4IM2A 4KDLB 2JF5A 3OJ3A 4KIKB 1P9DU 2N9XA 3TL5A 2KJRA 2XBBC 5CHVC 3NZSA 2KFKB 2JWZA 4GDLB 3ECIA 1IPGA 2GBJA 1SIFA 2Y5BB 3IHPC 3KH0A 3NZUA 3NOBA 2O2VB 2KC2A 5KHOA 3MJWA 1GC6A 3ZDMC 1P98A 2DAJA 4LDTD 1P3QU 3A9KA 5JH5C 3PTFC 3EFUA 4HCPB 4K7SA 4TUUA 4GDKB 5CTRC 2KK8A 3QAQA 3L13A 2PE6B 2KOXA 3ENEA 5L83A 3DBHI 3VFKA 1V5TA 3SU8X 3U7DA 3UGBB 2NPTA 2BYFA 1S3SG 1KLVA 2MBQA 2MBBB 1L7YA 2N7EA 2FUHB 1NDDA 3JVZX 2IY1B 3ZNHB 2GBRA 2L8JA 3VXWA 4HCNB 1RLFA 4NQKE 1V2YA 2XK5B 3GZNI 3VTVA 2L76A 4ASWC 2M4NA 5E6NA 1K8RB 2FAZA 1E8ZA 2D07B 5L95C 2KWVB 2G45B 3VVWB
chains in the Genus database with same CATH superfamily
3W1YA 3U4EG 2OJRA 4EZJA 2MLBA 4IW0A 4FLHA 4TV3A 4WH4A 2LVOA 3KVFB 1NBFC 3T3OA 3SR6A 1WE7A 2RGFA 3DBLB 2Y5PA 1KOTA 2JZPA 2ZPYA 1TZOA 1E7PB 2J4XA 3JW0X 4K7WA 4HDQA 1P7EA 1RFKA 3SFEB 1GJZA 2RPVA 5D7GA 2CHXA 3Q69A 4WIPA 2RDHA 3GZNB 3R66C 4DDID 2D5GA 1EU4A 1V49A 1OQQA 1SSNA 2NBWB 1P1AA 1NI2A 3APFA 2E6XA 2LGIA 3A33B 2FUG1 2QHOA 3PHWB 4B95A 3U30A 2KX0A 2AYOB 2H89B 2J42A 3IBEA 3DBRI 1BXTA 3PLVA 2BYVE 1E7VA 2KLCA 1N6ZA 3S2AA 4M01A 3VAWA 3RFZB 4LLGM 1WIAA 4FADA 2BS4B 2X38A 4XGAB 3ZNID 2JX5A 1JALA 3V62A 3VH3B 3VUWA 3BWUD 3NVWA 3AE6B 3DBLI 3FC4A 3ZO5B 2HTME 3B0AA 3H7PA 2V3SA 2KJ6A 3P4SB 4LDTB 2K8BA 1SJED 1C78A 2YLMA 5CHFA 2LJIA 5BMIA 2MP2A 3IXSA 4FJYA 5HFYA 1WI0A 1HEZE 1CJEA 1SB3C 4KVGB 3Q8CA 3SD5A 2K0PA 1ZW7A 2NTTA 2DYOA 4ANWA 5G55A 4K3CA 1C3TA 1WZ3A 4HJGE 1FNWA 5HG2A 4RGNA 1T0QC 1WGGA 2JVCA 1FNUA 1PGBA 3URYA 1RWSA 1GB4A 4A3PA 4EZKA 4IG7B 1JW9D 4ZYSA 2CR5A 2UWQA 2KO3A 3VH4B 2PE9A 3AEBB 2DYMA 2K9XA 2ZNVB 4WWNA 5E6PA 3Q8BA 2JUOA 3AEFB 2AX5A 4RF0A 1WRIA 2WP9B 4FHJA 3NY5A 4I6PA 2ZCCA 1HE8A 3RNBC 1IYFA 4BKSD 4W9LA 4HPMB 2CHZA 2OJWA 2INPE 2V1YA 2PVGC 2C7HA 2ZW0A 4K3BA 4MELA 3T8MA 2L1AA 1D4BA 1OQYA 2BYEA 1M94A 4K1RB 3MC9A 1H4RA 2PIAA 3AE7B 4M0WB 1RM6C 2FIFA 4W9CA 5D94A 1P0RA 1FCLA 3BZDB 3PHXB 2D3GA 4HKQA 1CK1A 1H8CA 2O2VA 4RNAA 3N32A 3K9PB 4HPPA 4JQWC 3TBLD 5I4DA 2CKHB 3M63B 5BYQA 3EGRA 2ZNVC 2BKRB 2WXRA 1YNTE 2L0FA 4USAA 1YN5A 2L0TA 2MBHA 5HKHA 4GMVA 1A70A 2J7QB 1WJ4A 3VQIA 1J7BA 3RNGC 2C7NB 3H8HA 1OQRA 1Q10A 3A9JB 1WGHA 3L16A 3PS6A 1VJKA 3CSFA 4RM8A 3RN9C 3JSVA 3WALA 3R2IA 3TJPA 1RYJA 4AJWA 2INDC 2D3BA 1D5XC 3ZTCA 1VCBA 1CQVA 3PZ7A 2R2QA 2MW5A 1TKGA 2MHJA 5GMVA 1ZKHA 1YN3A 3B1LX 1XCQL 4JX1C 4LNFA 4KZ0A 2KQ4X 3OWEB 3QARA 3QX1A 1Y8RC 4GN1A 4EE2A 4XZ4A 1ET9A 4ZDVA 1WXAA 1JCKB 3A4SC 1KH0A 1GPXA 4GOCA 2L00B 4WWOA 1N62A 2DX5B 3TEZA 2JT4B 4A8XC 3P4QB 2KMCA 4DHJD 4LTUA 4MSQB 2W54A 3RT3B 2MP2B 2RSUA 3RCZA 4GIVA 2FCSA 3L0WB 1GNUA 2A5UA 3UQBA 2LHDA 1EM7A 1SJHD 2O6VA 3P42A 3AB5A 4JPSA 2INCC 4HKZE 2I1JA 4G0NB 1WXQA 2FE8A 3AE9B 4ICUA 1N63A 2WXQA 5LLIA 2V9HA 1PYWD 4A6QA 3BVGA 5DCNA 2FCQA 1F52A 3N9YC 2FBWB 4GXBA 4B0EA 4A20A 2W55A 1TYGB 4MEMA 2ZPNA 4W9HA 3CMMB 2MX2A 1TY0A 3BVZA 1FO4A 2K1FA 3CSTA 4DDGD 2BB5A 4US9A 2K6QA 3ZKJC 2DYBA 2LD9A 3J9CA 1HTQA 4FULA 3HVDA 1IUEA 3Q6BA 3HRDD 3FILA 2IBIB 3MC0B 1YQ3B 3N3KB 2ASQA 2GRIA 3IAM1 2KACA 4ANVA 3ZNZB 2WXIA 1GG3A 4J3OD 3DBSA 4YWGG 3O65B 3E9SA 4MSMB 2IO0B 4BBNC 2JF5A 2N9XA 3VR9B 2KJRA 2JWZA 3ECIA 2MH7A 1IBXB 1IPGA 4NZLB 2Y5BB 3NOBA 2O2VB 4KX6B 3MJWA 3ZDMC 2DAJA 4LDTD 3A9KA 3DHGC 5JH5C 1YN4A 4C7ZA 3QAQA 2PE6B 2Y3AA 4XDCA 3VFKA 1V5TA 3U7DA 1E0ZA 4WWMA 2BYFA 4YXDB 2QJLA 2MBBB 1KFYB 1QILA 1FM0D 2FUHB 3JVZX 1JWSD 1V1PB 4NQKE 1RLFA 2L8JA 3GZNI 1L6UA 1K8RB 1E8ZA 2WDRB 2UU7A 2KWVB 4EFOA 2WXPA 1XT9B 1L0YB 2NTSA 1OFFA 4KSLC 5IA7A 3GS2A 2HJ1A 3KUCB 1TT5B 3QJZA 2N0SB 4JGHB 5BYRA 3AEAB 2QEJC 2V3NA 4TQ0A 1OEYJ 2KDIA 4P1CC 2PW9A 2DZJA 3AE8B 1VDVA 1TS4A 2EKEC 1SGHA 5IAAC 5GXGB 3PZ8A 3BYTB 4W9GA 2PMVA 4DHZB 1C77A 3Q3FA 4IKGA 2WYQA 2AEHA 2CHWA 2LI5A 3RZFA 2XEWA 4C00A 4WJQA 1XXGA 3R2TA 4YTPB 1WXMA 1WH3A 1WX9A 2XK5A 1WXVA 3HUIA 2BYTA 1VR9A 2WXJA 2WXOA 1QOGA 3UI3A 3L54A 2WXKA 2QDFA 2CU1A 4WURA 1IP9A 2JQRB 1LQBA 2IY0B 3I57A 3UINB 1V5OA 3WAOA 4KV2A 4YL8A 3ONSA 2LEKA 3AE2B 1YD8U 2W82A 1T0YA 3KQ4A 3ALBA 5D3DA 2KWUB 1ZP0B 3I3TB 2C60A 3AI5A 2RDGA 4IWOA 3CF6E 4BOZB 2N9LA 1VRAB 5EE9A 1WRDB 4B0MA 4YSZB 4R3DA 4WAFA 4CQNA 1D6EC 4M8MA 1D5ZC 3Q8AA 3Q8EA 3VRBB 4P7IA 2KTRB 1VZ6A 1JWAD 4PYUA 3NJTA 4CYEA 3RULA 5AUIA 1T0RC 1F1HA 1C4AA 2REXA 2BTEA 3LYYA 3DWGC 4A90A 4D2KA 1T0SC 2BQQA 3ZJVA 5FKAC 2V4IB 2YEPB 2L83A 3AN1A 1KF6B 1YX5B 2AQ3B 2K25A 4DHZE 3A9JA 4NQLB 1WM2A 1EF5A 3MHZA 1SE3A 3P2BA 4BOSC 3SFDB 1NVID 2WXLA 3N1XC 4NJ6A 2LRWA 1MPEA 4YTMB 1WXSA 2KX3A 3Q3NC 5C23A 3N1YC 4P6VF 4GDLA 1YQ4B 1OEYA 1YIWA 3AEGB 2KT7A 4OVUA 2YVCA 4FXCA 2BF8B 1HA5A 3WAMA 4MJSB 4AUQC 1WX7A 1X1MA 3ZJUA 1QLBB 1SE9A 4OZBA 1UWXA 2RD0A 2IYDB 2MBOA 2ON8A 4G50A 1L2NA 2NCNA 4XC2A 3NZ3A 4IWPA 1ZGUB 5JHAA 2WQYB 2PTLA 2N7JA 1DOYA 1MJDA 4MT5A 2JXXA 1ZDXA 3U52E 3D32A 3LXFA 4PK1A 3AMZA 2MCNB 2MQJA 5TSSA 1E7UA 2KLGA 2V0GA 3H7SA 1GAQB 1SE4A 1SXTA 1TBEA 1SEBD 4FA6A 2K8CA 3RUIB 2MJEA 3JSVB 1BT0A 4OW0A 4XYCA 4HEA1 1TTNA 1ACCA 3NHEB 2M0AA 1I35A 2VRRB 2LXCA 3TUOA 1Q5WB 1QT9A 1WF9A 4ZRIA 2KHWB 2GLSA 4MDKE 3ML9A 3VTUA 2ZJDA 4AWJA 4BBNF 2LXAA 2ONQA 5LXHA 1I42A 2LUMA 3C8YA 1GC7A 4GLSC 1D3ZA 3NVZA 1F2RI 4G3XB 3EA6A 1EWCA 3PO0A 2G4DB 4F8CB 1JQ4A 3R8BA 3A4RA 4M00A 4GGQA 4TQ1A 3BVMA 4KKJA 2KXJA 1TJEA 3NS1A 3P1MA 4FHKA 3FILB 2FCNA 3VHTC 3VUYA 4ZRJA 1UD7A 1UNSA 3H9DA 4FBJB 3N30A 2D2QA 2DLBA 1JROA 3AM9A 4ANXA 3EFCA 4CHKA 3ZYYX 1WR1A 4XDDA 1B1ZA 2KJHB 4JIOU 5AZGA 2I38A 1L4DB 1UGMA 1IGCA 3RD2A 2QMTA 1J0GA 2FCMA 2KMAA 3V05A 2WDQB 1PFDA 3ETRA 3TCAA 3MJ5A 4UDUC 2WHIA 1ENFA 2LGYA 3RNFC 3ZTDA 1JRPA 4IM0A 1TKEA 2BW2A 2JYTA 4K7UA 1CMXB 1QOAA 1LFDA 2RMMA 4ANUA 3HIZA 3U7ZA 3NRZA 5HI1A 3EC8A 1QKZA 4GSWA 5E6OA 2RR9A 1D5MC 3QA8A 1S1QB 1ESFA 2BS3B 2A4ZA 5CHWA 3AULA 4NY0A 3WANA 3W5VB 4LNIA 3N20C 1JWBD 2ZVNA 4QAYA 1WWTA 1IBXA 3H1UA 1T3QA 2QCZA 1ET6A 2INNE 4ZRQA 2KN5A 3OG5A 1I4RA 2NBUA 2CJNA 4MGIE 4JWSC 3P4PB 3SEBA 1TS3A 4NJCA 2RPQA 4MACA 3L4PA 3N1ZC 2Z8LA 2ACZB 2R2OA 4HRSA 3Q8FA 1GUAB 2K39A 3AE1B 1XLNA 1RAXA 1V1PA 1Y56A 3T9LA 3OJ3A 2XBBC 4YSYB 5CHVC 3NZSA 2KFKB 1VLBA 2WGSA 5EE0A 2BB6A 1SIFA 2GBJA 3KH0A 5KHOA 2NMQA 4XE0A 1AWDA 2WXFA 1FCCC 4K7SA 4TUUA 4GDKB 5CTRC 3NVVA 3L13A 2KOXA 5L83A 3B2GA 2NPTA 1MHHE 2KAJA 2IGGA 2IY1B 3ZNHB 3VXWA 4HCNB 1T5XD 4KGRA 4L1BA 5C3JB 1FRDA 2FAZA 2G45B 2K22A 3B2FA 1F2RC 4IDIA 2IGHA 4N6EB 3HM3A 3AH7A 1WFYA 1XLPA 4MH8A 1DYQA 4EOYA 2GMIC 1K53A 1YJIA 3DVGY 4XWTA 2DWQA 1YQBA 3TMPB 2DZIA 4ZRKA 2J0MA 1XLQA 1YOVB 4FN2A 4NAWB 4RFBA 4GB9A 3BY4B 2JSVX 1JWUD 3ABVB 4B6WA 4W9DA 2LASA 4BVUC 1TS5A 5MPOA 4RF1A 2WX0A 3E56A 3I9V1 3FKYA 1I4GA 3NUHB 5C2TB 3JYUA 2IZVB 3ZRCA 5LXIB 1MFWA 4MGKE 1YMHE 3UIOB 4C4VA 3AXCA 1N5XA 2L7RA 1EUVB 2KC1A 1UH6A 2MBEA 4LCDE 2HTHA 4PS7A 1UUPA 2C5LC 3KUZA 1PGXA 1C76A 2AQ1B 4LNKA 1VZ8A 1N5WA 2DHZA 3RI7C 1WX8A 4YT0B 1FRRA 1V1OA 5EE3A 3P4RB 5JHBA 1QZEA 2IJ0A 3I63C 1ROEA 2BVCA 4WQOB 4F7ZA 3B08A 2LUEA 3T3NA 4IC7B 4LNOA 4ZHPA 1V9JA 1Z5SB 1XD3B 2WXHA 4KGSA 3R7QA 1PGAA 1TZ1A 5AUKA 1DGJA 2JWUA 3PSEB 4NAMA 1WGKA 3BINA 1FEHA 4P16A 3V3XA 1QQRA 2PEAA 2K5PA 3I5JC 5CX3A 5DPRA 4HDOA 1V86A 1NYRA 2KVRA 3R3MA 1WJNA 2EKIA 3AECB 4HROA 2VZKB 2H88B 2ZVOA 2X8XX 5IOIA 4RH6A 2NVUI 1NEKB 2KWDA 3ZW3A 3H6NA 3PRZA 5BO4B 4MGYE 1KTKA 4GU2A 3ZDTA 2NS5A 1EU3A 1R7SA 1OTRB 4EZLA 1YJ1A 2GBMA 5DPSA 1E5WA 2JRHA 4LNNA 2CJOA 1TIFA 4DQOC 3QWZB 4HWIB 3RNEC 4HK2A 5AZFA 3ZQ4A 2SAKA 4MM3A 2BPSA 2LVQA 4PYZA 4WWPA 1Q1OA 4E71A 1YJJA 4ZYNA 2MWSB 2HE7A 3AE5B 1HZ6A 2GBNA 4EKUA 4RGMA 1T6BX 4X57B 5IO9A 1WZ0A 3ZIMA 4RGTA 2G9HD 1WYGA 3SDLC 2EELA 1LGRA 1FPYA 4WJOA 1XQQA 3B9JA 1WYWB 1JMLA 2ZCBA 1L0VB 1BUIC 3VDZA 1E6EB 4A9AA 1SE2A 2NR2A 5G5GA 1MG4A 3A1QA 3M62B 4HPLB 4OHJA 5FR6A 2C9WB 2JRIB 4RGOS 1G6JA 2D3AA 2GI9A 4MGZE 4C7YA 5KHQA 3L10B 1FFVA 2W3SA 4IWQA 1U4AA 2QIEB 4C56C 2L32A 4OZAA 2WU5B 2DZKA 1ZXIA 1QOFA 2KYWA 4L2YA 1K51A 3DCGA 3KWLA 2HDEA 1RFAA 4WJPA 3AEEB 2PJHA 5DPWA 3DPDA 4E3CA 1ZXHA 4N58A 4JWUC 4L23A 1TKYA 3V60A 2C7MB 3LJ3A 1ISNA 1AW7A 4C4VB 3OAWA 3PGEA 4DHJB 2J52A 1EWYC 2IO1B 1A5RA 2ICIA 2VH1A 3AV8A 4MJSA 3EECA 4LK0M 2IGDA 4BKGA 2QSDA 4O1NA 4DWFA 5EE1A 1UZXB 4H2AA 4FJZA 4N9F4 2KDEB 1E90A 3HHMA 2Z59B 2BGFA 3UF8A 3CIRB 3BK2A 3RZWC 2KD0A 1JWMD 4ICVA 1FXIA 1DOIA 2L05A 4NJ7A 4M02A 2G3QB 3GOEA 5H8YE 4W9KA 4XX5A 4P1BC 2AWTA 3GE8C 3C0RB 3AEDB 4A3OA 1WGRA 2KMMA 4MH0E 3OJ4B 1P7FA 1ZUD2 1PUTA 4TSSA 3IFWB 3ZVVA 5BMGA 2LJ5A 3RYTA 1TGZB 3DVNV 1WE6A 5AZHA 2LFIA 3BIID 3GB1A 4HJKA 2J0JA 5TR5A 3TEWA 1N61A 3V61A 4FJVB 2JPHA 4OVZA 1V6EA 2IPKD 2BWFA 2L52A 4J6IA 4XWWA 4JL9A 3A9KB 1UELA 1VZ7A 3U8ZA 2LZ6A 3Q14C 2EMSA 5DPTA 4LJPB 3FAHA 2N9EB 3AE3B 3DVGX 3ZUNA 4URKA 3ZJTA 5C1ZA 4G11A 1L5PA 4F1SA 4ZHOA 4AQ7A 3PRMB 1HXYD 4B9KA 1LM8B 2KDBA 3MP9A 1K50A 2AQ2B 1C4CA 3Q3MC 2N4FA 3LB8C 3KWVA 2JZ3B 2M19A 3ZRFA 4GDKA 4BZAA 2WNMA 1YX6B 1FXTB 3V6EB 1WM3A 2WS3B 2N9PC 1UBIA 1TS2A 1C79A 4M0WA 2WU2B 4ARCA 4IM2A 4KIKB 3KLSX 3TL5A 2LMCA 1V97A 3W5UB 1XF5L 1ZDVA 4GDLB 2I2YA 2PVOD 2KC2A 3NVYA 3C19A 5T8IA 1GC6A 1P98A 3PTFC 3EFUA 3W2DA 1QF6A 2OEDA 2VH2A 1UF0A 3ENEA 4YSXB 5IKCM 1S3SG 1FXAA 1L0XB 1V2YA 2XK5B 4ASWC 2M4NA 3DHHC 5E6NA 2WWZA 3IT4B 2HJ8A 1J7CA 2R61A 3TEXA 2LVPA 2LHEA 2GOWA 3QC8B 1MG8A 4WQMA 4KZCA 4AOFA 1Q0WB 2DBYA 1J7AA 2IO2B 2KKCA 4E74A 1DOXA 2Z0EB 2QILA 3ZXVA 3BYYB 3WA0A 5JXVA 1E10A 3DBHB 2Q5WD 3AU5A 1FIQA 4WJNA 1QOBA 3APCA 4KDIC 4W9EA 1N60A 4JLCA 4ZOHC 3IG3A 4DXGA 1CZPA 3L17A 1HTOA 2KTRA 1WJ6A 2EMTA 1E8YA 2O6VD 3PREA 1WR6E 2N1WA 4I6LB 2BBCA 3TEYA 5IP4D 4HVBA 1UGJA 3RNCC 3PZDA 4KKIA 4RM9A 4TKNA 2MA9B 1GB1A 3HK0A 4YTNB 3K9OB 1V80A 1FNVA 4OVVA 2KN4A 3DHIC 2J0KA 2NPTB 4NPNA 1JRUA 4EUTA 3IVFA 1AN8A 1R4MI 3QQ8B 3ML8A 3SHQA 4RCOA 3NG0A 4AJYB 3PRPB 1RRBA 5D3IB 1VD2A 3VUXA 1J19A 2BKFA 4A55A 2MJ3A 3DOWA 2Z0DB 1SF0A 1E8WA 3IT6B 2WXMA 2I1KA 1KM7A 1MHXA 2KDMA 1OGWA 3DDCB 5J17A 2LGDA 2W9NA 1GOZA 3WIMA 2WDTB 2HD5B 1I4HA 4W9JA 4CO7A 5LNK1 3UQAA 2WXGA 2BWES 3EUB2 4LJOB 4BFRA 4JE3B 1C4PA 2GBKA 2OHFA 3TIXA 3MFGA 1XEEA 1ZE3D 4ZRPA 2L3ZA 1IGDA 1WY8A 3AU4A 4PS3A 4EEWA 1AARA 3Q3OC 3GE3C 1FD6A 5G2NA 1UBQA 3KW5B 2DAFA 4I6NB 1K52A 4DXAB 3QK0A 3OLMD 3ZLZA 1NI3A 3MHSD 2KQ7A 4S17A 4DK5A 2Y5CA 1L4ZB 1NENB 2WX1A 2M8SA 1R4MB 3M95A 3Q3JA 2SEBD 4PT5A 3BK1A 5J18A 1R4NI 4RMAA 3WAPA 2D10A 1M4VA 2KWCA 3PVLA 1SIJA 5EDSA 1Z2MA 2K6DB 4HXDA 3QHTA 2N9KA 2LGSA 5E6JA 2KFKA 2TSSA 2XN9C 2PLPA 4II3B 3H7PB 1PQSA 2DZMA 2M1MA 4US8A 1KLUD 3DWMA 5D6JB 1XCTL 1NYQA 2FNJB 2QC8A 3VR8B 1WJUA 4AP4C 2JYEA 3L08A 2YEPF 1L6VA 1BMLC 2CS4A 3X0WA 3DVNU 3ZGZA 2JU6X 2IO3B 1EF1A 2KFJA 4KGTA 1FFUA 5BYSA 3LDZE 2KTFA 1MVKA 2KZRA 2G4SA 1WGYA 3V6CB 3W1SA 1TY2A 4II2B 4W9FA 4BAXA 4DBGA 3DBRB 1ZOYB 2FIDA 2DNFA 1XO3A 4K81A 3P63A 1WMHA 2B76B 4HLEA 2LRUA 2LWPA 3DQVA 1E9MA 1SBBB 3EHVA 1I4XA 2W3RA 3A1QB 4N59A 2J53A 3KYDD 2KNBA 2JZZA 3PPAA 3AE4B 1R4NB 4DXFA 1ZPSA 1C1YB 1WSPA 5AEKB 4IM3A 4NNJB 3M3JA 4NAWA 3PT2B 2LGXA 3RPFC 4W9IA 2M17A 2AL6A 2BS2B 1STEA 3KUDB 3GP7A 4M8NA 2DENB 2CU3A 2GB1A 2V4LA 3QIJA 3R7RA 2MSED 5H92C 5G5HA 4MM3B 2ZEQA 3W1SC 2VZKD 2KQSA 3PLUA 2O6VB 2XNAC 1EO6A 2BT6A 2PKOA 2WXNA 1KJTA 2KANA 1I7HA 2JY6A 2M0XA 1AYFA 2D3CA 3MTNB 1J8CA 2KVZA 1WMHB 3X23A 3UIPB 3APDA 1UWMA 4ARIA 5J2RA 3VTWA 4ITKA 4IUMB 3ZXRA 3ZNGC 1F9JA 5JZEB 2K8HA 2E3TA 1HZ5A 1WGDA 4AS1A 1KRHA 1FMAD 4C80A 1XLOA 2KDFB 2WLBA 4Q2JA 1E8XA 4ACFA 2D11A 3TSSA 1MI0A 4BKTA 3HM6X 4TMAB 2B3AA 4KSKC 2OOBB 2ZZPB 3Q2AC 1B9RA 2JXTA 3O13A 3NS8A 4WAAA 3W9CB 2NBVB 3IAS1 3U2SC 1LO5D 2K3UA 4IOIE 2N1VA 1I4QA 2MJDA 5D2MB 4KIKA 4S0RA 2PPHA 1HQRD 5FR3A 2RDBC 2AL3A 1C9FA 3QCAA 2IDYA 3KYCD 4BKSA 5BMHA 1LXDA 2M56B 2MRPA 3MC8A 2UYZB 4OZCA 1V81A 4PS8A 2V3PA 1F0ZA 1I4PA 2N7DA 3PV1A 3RNAC 1KLGD 2ZW1A 4KDLB 5IN7A 1P9DU 3RMKC 2WDVB 3NZUA 3IHPC 1F77A 1P3QU 3VRAB 1PDXA 4HCPB 5FK9C 2KK8A 2G1EA 3DBHI 3SU8X 3UGBB 1KLVA 2MEKA 4REZA 2MBQA 1L7YA 2N7EA 1NDDA 3WCQA 2GBRA 3CWIA 3VTVA 1V8CA 2L76A 3HVZA 2D07B 5L95C 5HHDG 3VVWB
chains in the Genus database with same CATH topology
4EFOA 3W1YA 1XT9B 2OJRA 3HM3A 4KSLC 4EZJA 5IA7A 3KUCB 2HJ8A 2MLBA 4IW0A 4FLHA 4TV3A 1WFYA 2LVOA 3KVFB 1NBFC 2LVPA 2GOWA 4EOYA 3QC8B 3QJZA 1MG8A 1WE7A 2GMIC 2RGFA 4JGHB 3DVGY 1KOTA 4KZCA 4AOFA 1Q0WB 2ZPYA 1YQBA 2IO2B 2KKCA 4E74A 1OEYJ 2KDIA 2Z0EB 4TQ0A 3JW0X 4K7WA 3TMPB 3WA0A 2DZJA 4HDQA 3AU5A 2WWZA 1GJZA 2DZIA 4WJNA 5D7GA 2CHXA 2J0MA 4ZRKA 2EKEC 1SGHA 4FN2A 5IAAC 4NAWB 3APCA 4KDIC 3R66C 4GB9A 4W9EA 4DDID 3BY4B 4W9GA 4JLCA 4DHZB 1V49A 3Q3FA 2NBWB 4B6WA 4W9DA 3IG3A 2WYQA 2LASA 2AEHA 4BVUC 2CHWA 3L17A 2KTRA 2LI5A 1P1AA 1WJ6A 1NI2A 2EMTA 1E8YA 3RZFA 2WX0A 2XEWA 2O6VD 3PREA 4WJQA 1WR6E 1WXMA 3APFA 1WH3A 2N1WA 4I6LB 1WX9A 2XK5A 1WXVA 3A33B 2QHOA 3PHWB 4B95A 4HVBA 3JYUA 3U30A 2IZVB 2KX0A 3L54A 3ZRCA 2AYOB 5LXIB 4MGKE 3IBEA 3PZDA 3DBRI 3UIOB 3PLVA 2BYVE 4RM9A 4TKNA 2MA9B 3AXCA 1E7VA 2KLCA 2L7RA 1EUVB 2CU1A 3HK0A 3K9OB 2KC1A 3S2AA 1UH6A 3VAWA 1IP9A 2MBEA 1V80A 1LQBA 2IY0B 2HTHA 4LCDE 1WIAA 4OVVA 4PS7A 3UINB 2C5LC 4FADA 2J0KA 1V5OA 3WAOA 4KV2A 3KUZA 2NPTB 4NPNA 4YL8A 3ONSA 1JRUA 4EUTA 3IVFA 3ZNID 1R4MI 3V62A 3VH3B 3VUWA 2DHZA 1YD8U 3QQ8B 3ML8A 3SHQA 1WX8A 1T0YA 3ALBA 3DBLI 3ZO5B 4AJYB 3PRPB 2KWUB 1RRBA 3B0AA 3I3TB 1VD2A 3H7PA 2V3SA 2C60A 3AI5A 2KJ6A 4IWOA 4LDTB 3VUXA 1J19A 2BKFA 3CF6E 2K8BA 4BOZB 3DOWA 5JHBA 2YLMA 2Z0DB 5CHFA 1E8WA 2MP2A 1WRDB 1QZEA 2I1KA 1KM7A 4M8MA 4WQOB 4F7ZA 1OGWA 2KTRB 2LUEA 3B08A 3DDCB 4FJYA 4P7IA 4PYUA 1WI0A 5J17A 4IC7B 4KVGB 4CYEA 3SD5A 1V9JA 1Z5SB 1XD3B 1ZW7A 3RULA 2DYOA 4ANWA 5G55A 2LGDA 3R7QA 1C3TA 1TZ1A 2W9NA 3WIMA 2REXA 1WZ3A 2WDTB 2HD5B 1WGGA 2JVCA 3PSEB 4W9JA 4CO7A 3BINA 2PEAA 3UQAA 4A3PA 5CX3A 4EZKA 4IG7B 5DPRA 2BWES 4HDOA 1YX5B 4LJOB 2CR5A 4BFRA 2UWQA 2K25A 1V86A 2KO3A 3VH4B 2GBKA 2KVRA 3A9JA 4DHZE 3TIXA 3R3MA 1WJNA 4NQLB 1WM2A 2PE9A 1EF5A 2DYMA 2L3ZA 3P2BA 1WY8A 3AU4A 4BOSC 4PS3A 2ZNVB 2ZVOA 4EEWA 1AARA 4WWNA 5E6PA 2NVUI 2JUOA 3H6NA 2LRWA 4NJ6A 5G2NA 3ZW3A 1UBQA 1WXSA 2KX3A 3KW5B 2DAFA 4I6NB 3PRZA 5BO4B 4MGYE 4FHJA 4GU2A 5C23A 3NY5A 3QK0A 3OLMD 4DXAB 3ZDTA 4GDLA 2NS5A 3ZLZA 3MHSD 2KQ7A 4I6PA 1OEYA 1YIWA 1OTRB 4DK5A 2ZCCA 1HE8A 4EZLA 4OVUA 1IYFA 1YJ1A 4BKSD 2YVCA 2GBMA 2WX1A 2M8SA 3M95A 4W9LA 3Q3JA 4HPMB 2CHZA 1E5WA 2JRHA 5DPSA 2BF8B 2V1YA 3WAMA 5J18A 3QWZB 4HWIB 1R4NI 4RMAA 4MJSB 4HK2A 3WAPA 2D10A 5AZFA 4AUQC 2KWCA 2C7HA 1WX7A 4MM3A 1X1MA 2BPSA 4MELA 3T8MA 2LVQA 4PYZA 3PVLA 4WWPA 1OQYA 2BYEA 1Q1OA 1M94A 1SE9A 4K1RB 5EDSA 1Z2MA 4E71A 2RD0A 1H4RA 2IYDB 2K6DB 2MBOA 4G50A 4HXDA 2FIFA 4M0WB 4ZYNA 2MWSB 2HE7A 3QHTA 4W9CA 1L2NA 2GBNA 2NCNA 5D94A 1P0RA 4XC2A 4EKUA 4IWPA 3PHXB 1ZGUB 2KFKA 4II3B 5JHAA 2D3GA 4X57B 3H7PB 1PQSA 1WZ0A 3ZIMA 1H8CA 2DZMA 2M1MA 2O2VA 5D6JB 3N32A 2FNJB 2JXXA 3SDLC 1J0GA 3D32A 3K9PB 1WJUA 4WJOA 4JQWC 3TBLD 4AP4C 1XQQA 2MQJA 2MCNB 3L08A 1E7UA 1WYWB 2CKHB 2ZCBA 2CS4A 2KLGA 3M63B 3X0WA 3H7SA 2ZNVC 3VDZA 2NR2A 3DVNU 1TBEA 2BKRB 3A1QA 3M62B 2IO3B 1EF1A 2KFJA 4HPLB 4FA6A 2L0FA 5FR6A 2K8CA 2C9WB 2JRIB 3RUIB 1G6JA 3JSVB 1BT0A 1TTNA 4MGZE 3LDZE 5KHQA 2KTFA 3L10B 3NHEB 2L0TA 2KZRA 2MBHA 1I35A 2G4SA 2VRRB 2LXCA 5HKHA 1WGYA 3V6CB 3W1SA 1Q5WB 4GMVA 4II2B 4W9FA 2J7QB 4DBGA 1WJ4A 1WF9A 4IWQA 4ZRIA 1U4AA 2FIDA 3VQIA 2KHWB 4K81A 1WMHA 4MDKE 4HLEA 2LRUA 2DZKA 2C7NB 3ML9A 3VTUA 3DCGA 2LWPA 2ZJDA 4AWJA 4BBNF 3DQVA 3A9JB 1WGHA 3L16A 2LXAA 3EHVA 1RFAA 5LXHA 3PS6A 1I42A 4WJPA 3A1QB 3CSFA 4RM8A 1GC7A 2PJHA 1D3ZA 5DPWA 3DPDA 3KYDD 2KNBA 3JSVA 4G3XB 4E3CA 3WALA 2G4DB 4F8CB 2JZZA 3PPAA 3TJPA 4AJWA 3A4RA 1C1YB 3ZTCA 3V60A 2C7MB 3LJ3A 1ISNA 4GGQA 5AEKB 4IM3A 4TQ1A 4NNJB 3M3JA 2KXJA 4NAWA 1VCBA 3OAWA 3PT2B 2LGXA 3PGEA 4W9IA 2M17A 2AL6A 4DHJB 2R2QA 4FHKA 2MW5A 3KUDB 2FCNA 5GMVA 3VHTC 1ZKHA 3VUYA 4ZRJA 2IO1B 3B1LX 1A5RA 4KZ0A 1UD7A 2DENB 2V4LA 3H9DA 3QIJA 4M8NA 3R7RA 2MSED 3EECA 4MJSA 4BKGA 3QARA 4FBJB 3N30A 3QX1A 2D2QA 4DWFA 1Y8RC 2ZEQA 3W1SC 4GN1A 1UZXB 2KQSA 3PLUA 4FJZA 4N9F4 2KDEB 1E90A 2O6VB 3HHMA 4XZ4A 2Z59B 4ZDVA 1WXAA 2BGFA 3A4SC 3UF8A 1EO6A 4ANXA 3RZWC 4GOCA 2KD0A 4CHKA 2L00B 1KJTA 1WR1A 4ICVA 2KANA 4WWOA 2L05A 2DX5B 2JY6A 4NJ7A 2M0XA 2JT4B 2G3QB 2KJHB 2KMCA 4DHJD 3GOEA 4JIOU 5AZGA 4MSQB 4W9KA 4XX5A 3RT3B 1UGMA 2AWTA 2MP2B 2RSUA 3C0RB 3RCZA 3RD2A 3MTNB 4A3OA 2FCMA 4GIVA 1WMHB 2FCSA 2KMAA 3UIPB 3X23A 1J8CA 3L0WB 3APDA 1WGRA 1GNUA 2A5UA 3UQBA 4MH0E 5J2RA 3VTWA 3OJ4B 3IFWB 4IUMB 3ZVVA 2LJ5A 3RYTA 1TGZB 3DVNV 2O6VA 3ZNGC 1WE6A 1F9JA 5AZHA 3TCAA 5JZEB 2K8HA 1WGDA 4HJKA 2J0JA 2LGYA 3ZTDA 2I1JA 4G0NB 5TR5A 4IM0A 2KDFB 1E8XA 4ICUA 4K7UA 3V61A 4FJVB 2D11A 2JPHA 1V6EA 5LLIA 1CMXB 2BWFA 4J6IA 4JL9A 4BKTA 1LFDA 4ANUA 5DCNA 2FCQA 3A9KB 1UELA 3HIZA 3HM6X 3U8ZA 2B3AA 2LZ6A 3EC8A 4GXBA 4KSKC 2EMSA 4A20A 2OOBB 2ZZPB 4GSWA 5E6OA 4MEMA 2ZPNA 5DPTA 3NS8A 4WAAA 4W9HA 2RR9A 3CMMB 3QA8A 2NBVB 4LJPB 1S1QB 2MX2A 2A4ZA 5CHWA 2N9EB 3AULA 4URKA 3DVGX 4NY0A 2N1VA 3ZUNA 2K1FA 3CSTA 4DDGD 5C1ZA 4G11A 3WANA 5D2MB 4KIKA 2K6QA 4F1SA 2PPHA 3PRMB 3ZKJC 2AL3A 3QCAA 2DYBA 2ZVNA 3KYCD 1LM8B 2KDBA 2LD9A 4B9KA 3H1UA 4BKSA 1LXDA 4FULA 2MRPA 2N4FA 2KN5A 2JZ3B 2IBIB 2NBUA 2UYZB 4MGIE 3ZRFA 3N3KB 4GDKA 1V81A 2ASQA 2RPQA 4PS8A 4ANVA 3ZNZB 1YX6B 1GG3A 1FXTB 3V6EB 1WM3A 3DBSA 2R2OA 1GUAB 3O65B 2N9PC 1UBIA 2K39A 2N7DA 3PV1A 1RAXA 4MSMB 2IO0B 3T9LA 4BBNC 4IM2A 4KDLB 2JF5A 3OJ3A 4KIKB 1P9DU 2N9XA 3TL5A 2KJRA 2XBBC 5CHVC 3NZSA 2KFKB 2JWZA 4GDLB 3ECIA 1IPGA 2GBJA 1SIFA 2Y5BB 3IHPC 3KH0A 3NZUA 3NOBA 2O2VB 2KC2A 5KHOA 3MJWA 1GC6A 3ZDMC 1P98A 2DAJA 4LDTD 1P3QU 3A9KA 5JH5C 3PTFC 3EFUA 4HCPB 4K7SA 4TUUA 4GDKB 5CTRC 2KK8A 3QAQA 3L13A 2PE6B 2KOXA 3ENEA 5L83A 3DBHI 3VFKA 1V5TA 3SU8X 3U7DA 3UGBB 2NPTA 2BYFA 1S3SG 1KLVA 2MBQA 2MBBB 1L7YA 2N7EA 2FUHB 1NDDA 3JVZX 2IY1B 3ZNHB 2GBRA 2L8JA 3VXWA 4HCNB 1RLFA 4NQKE 1V2YA 2XK5B 3GZNI 3VTVA 2L76A 4ASWC 2M4NA 5E6NA 1K8RB 2FAZA 1E8ZA 2D07B 5L95C 2KWVB 2G45B 3VVWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EFO A;  3W1Y A;  1XT9 B;  2OJR A;  3HM3 A;  4KSL C;  4EZJ A;  5IA7 A;  3KUC B;  2HJ8 A;  2MLB A;  4IW0 A;  4FLH A;  4TV3 A;  1WFY A;  2LVO A;  3KVF B;  1NBF C;  2LVP A;  2GOW A;  4EOY A;  3QC8 B;  3QJZ A;  1MG8 A;  1WE7 A;  2GMI C;  2RGF A;  4JGH B;  3DVG Y;  1KOT A;  4KZC A;  4AOF A;  1Q0W B;  2ZPY A;  1YQB A;  2IO2 B;  2KKC A;  4E74 A;  1OEY J;  2KDI A;  2Z0E B;  4TQ0 A;  3JW0 X;  4K7W A;  3TMP B;  3WA0 A;  2DZJ A;  4HDQ A;  3AU5 A;  2WWZ A;  1GJZ A;  2DZI A;  4WJN A;  5D7G A;  2CHX A;  2J0M A;  4ZRK A;  2EKE C;  1SGH A;  4FN2 A;  5IAA C;  4NAW B;  3APC A;  4KDI C;  3R66 C;  4GB9 A;  4W9E A;  4DDI D;  3BY4 B;  4W9G A;  4JLC A;  4DHZ B;  1V49 A;  3Q3F A;  2NBW B;  4B6W A;  4W9D A;  3IG3 A;  2WYQ A;  2LAS A;  2AEH A;  4BVU C;  2CHW A;  3L17 A;  2KTR A;  2LI5 A;  1P1A A;  1WJ6 A;  1NI2 A;  2EMT A;  1E8Y A;  3RZF A;  2WX0 A;  2XEW A;  2O6V D;  3PRE A;  4WJQ A;  1WR6 E;  1WXM A;  3APF A;  1WH3 A;  2N1W A;  4I6L B;  1WX9 A;  2XK5 A;  1WXV A;  3A33 B;  2QHO A;  3PHW B;  4B95 A;  4HVB A;  3JYU A;  3U30 A;  2IZV B;  2KX0 A;  3L54 A;  3ZRC A;  2AYO B;  5LXI B;  4MGK E;  3IBE A;  3PZD A;  3DBR I;  3UIO B;  3PLV A;  2BYV E;  4RM9 A;  4TKN A;  2MA9 B;  3AXC A;  1E7V A;  2KLC A;  2L7R A;  1EUV B;  2CU1 A;  3HK0 A;  3K9O B;  2KC1 A;  3S2A A;  1UH6 A;  3VAW A;  1IP9 A;  2MBE A;  1V80 A;  1LQB A;  2IY0 B;  2HTH A;  4LCD E;  1WIA A;  4OVV A;  4PS7 A;  3UIN B;  2C5L C;  4FAD A;  2J0K A;  1V5O A;  3WAO A;  4KV2 A;  3KUZ A;  2NPT B;  4NPN A;  4YL8 A;  3ONS A;  1JRU A;  4EUT A;  3IVF A;  3ZNI D;  1R4M I;  3V62 A;  3VH3 B;  3VUW A;  2DHZ A;  1YD8 U;  3QQ8 B;  3ML8 A;  3SHQ A;  1WX8 A;  1T0Y A;  3ALB A;  3DBL I;  3ZO5 B;  4AJY B;  3PRP B;  2KWU B;  1RRB A;  3B0A A;  3I3T B;  1VD2 A;  3H7P A;  2V3S A;  2C60 A;  3AI5 A;  2KJ6 A;  4IWO A;  4LDT B;  3VUX A;  1J19 A;  2BKF A;  3CF6 E;  2K8B A;  4BOZ B;  3DOW A;  5JHB A;  2YLM A;  2Z0D B;  5CHF A;  1E8W A;  2MP2 A;  1WRD B;  1QZE A;  2I1K A;  1KM7 A;  4M8M A;  4WQO B;  4F7Z A;  1OGW A;  2KTR B;  2LUE A;  3B08 A;  3DDC B;  4FJY A;  4P7I A;  4PYU A;  1WI0 A;  5J17 A;  4IC7 B;  4KVG B;  4CYE A;  3SD5 A;  1V9J A;  1Z5S B;  1XD3 B;  1ZW7 A;  3RUL A;  2DYO A;  4ANW A;  5G55 A;  2LGD A;  3R7Q A;  1C3T A;  1TZ1 A;  2W9N A;  3WIM A;  2REX A;  1WZ3 A;  2WDT B;  2HD5 B;  1WGG A;  2JVC A;  3PSE B;  4W9J A;  4CO7 A;  3BIN A;  2PEA A;  3UQA A;  4A3P A;  5CX3 A;  4EZK A;  4IG7 B;  5DPR A;  2BWE S;  4HDO A;  1YX5 B;  4LJO B;  2CR5 A;  4BFR A;  2UWQ A;  2K25 A;  1V86 A;  2KO3 A;  3VH4 B;  2GBK A;  2KVR A;  3A9J A;  4DHZ E;  3TIX A;  3R3M A;  1WJN A;  4NQL B;  1WM2 A;  2PE9 A;  1EF5 A;  2DYM A;  2L3Z A;  3P2B A;  1WY8 A;  3AU4 A;  4BOS C;  4PS3 A;  2ZNV B;  2ZVO A;  4EEW A;  1AAR A;  4WWN A;  5E6P A;  2NVU I;  2JUO A;  3H6N A;  2LRW A;  4NJ6 A;  5G2N A;  3ZW3 A;  1UBQ A;  1WXS A;  2KX3 A;  3KW5 B;  2DAF A;  4I6N B;  3PRZ A;  5BO4 B;  4MGY E;  4FHJ A;  4GU2 A;  5C23 A;  3NY5 A;  3QK0 A;  3OLM D;  4DXA B;  3ZDT A;  4GDL A;  2NS5 A;  3ZLZ A;  3MHS D;  2KQ7 A;  4I6P A;  1OEY A;  1YIW A;  1OTR B;  4DK5 A;  2ZCC A;  1HE8 A;  4EZL A;  4OVU A;  1IYF A;  1YJ1 A;  4BKS D;  2YVC A;  2GBM A;  2WX1 A;  2M8S A;  3M95 A;  4W9L A;  3Q3J A;  4HPM B;  2CHZ A;  1E5W A;  2JRH A;  5DPS A;  2BF8 B;  2V1Y A;  3WAM A;  5J18 A;  3QWZ B;  4HWI B;  1R4N I;  4RMA A;  4MJS B;  4HK2 A;  3WAP A;  2D10 A;  5AZF A;  4AUQ C;  2KWC A;  2C7H A;  1WX7 A;  4MM3 A;  1X1M A;  2BPS A;  4MEL A;  3T8M A;  2LVQ A;  4PYZ A;  3PVL A;  4WWP A;  1OQY A;  2BYE A;  1Q1O A;  1M94 A;  1SE9 A;  4K1R B;  5EDS A;  1Z2M A;  4E71 A;  2RD0 A;  1H4R A;  2IYD B;  2K6D B;  2MBO A;  4G50 A;  4HXD A;  2FIF A;  4M0W B;  4ZYN A;  2MWS B;  2HE7 A;  3QHT A;  4W9C A;  1L2N A;  2GBN A;  2NCN A;  5D94 A;  1P0R A;  4XC2 A;  4EKU A;  4IWP A;  3PHX B;  1ZGU B;  2KFK A;  4II3 B;  5JHA A;  2D3G A;  4X57 B;  3H7P B;  1PQS A;  1WZ0 A;  3ZIM A;  1H8C A;  2DZM A;  2M1M A;  2O2V A;  5D6J B;  3N32 A;  2FNJ B;  2JXX A;  3SDL C;  1J0G A;  3D32 A;  3K9P B;  1WJU A;  4WJO A;  4JQW C;  3TBL D;  4AP4 C;  1XQQ A;  2MQJ A;  2MCN B;  3L08 A;  1E7U A;  1WYW B;  2CKH B;  2ZCB A;  2CS4 A;  2KLG A;  3M63 B;  3X0W A;  3H7S A;  2ZNV C;  3VDZ A;  2NR2 A;  3DVN U;  1TBE A;  2BKR B;  3A1Q A;  3M62 B;  2IO3 B;  1EF1 A;  2KFJ A;  4HPL B;  4FA6 A;  2L0F A;  5FR6 A;  2K8C A;  2C9W B;  2JRI B;  3RUI B;  1G6J A;  3JSV B;  1BT0 A;  1TTN A;  4MGZ E;  3LDZ E;  5KHQ A;  2KTF A;  3L10 B;  3NHE B;  2L0T A;  2KZR A;  2MBH A;  1I35 A;  2G4S A;  2VRR B;  2LXC A;  5HKH A;  1WGY A;  3V6C B;  3W1S A;  1Q5W B;  4GMV A;  4II2 B;  4W9F A;  2J7Q B;  4DBG A;  1WJ4 A;  1WF9 A;  4IWQ A;  4ZRI A;  1U4A A;  2FID A;  3VQI A;  2KHW B;  4K81 A;  1WMH A;  4MDK E;  4HLE A;  2LRU A;  2DZK A;  2C7N B;  3ML9 A;  3VTU A;  3DCG A;  2LWP A;  2ZJD A;  4AWJ A;  4BBN F;  3DQV A;  3A9J B;  1WGH A;  3L16 A;  2LXA A;  3EHV A;  1RFA A;  5LXH A;  3PS6 A;  1I42 A;  4WJP A;  3A1Q B;  3CSF A;  4RM8 A;  1GC7 A;  2PJH A;  1D3Z A;  5DPW A;  3DPD A;  3KYD D;  2KNB A;  3JSV A;  4G3X B;  4E3C A;  3WAL A;  2G4D B;  4F8C B;  2JZZ A;  3PPA A;  3TJP A;  4AJW A;  3A4R A;  1C1Y B;  3ZTC A;  3V60 A;  2C7M B;  3LJ3 A;  1ISN A;  4GGQ A;  5AEK B;  4IM3 A;  4TQ1 A;  4NNJ B;  3M3J A;  2KXJ A;  4NAW A;  1VCB A;  3OAW A;  3PT2 B;  2LGX A;  3PGE A;  4W9I A;  2M17 A;  2AL6 A;  4DHJ B;  2R2Q A;  4FHK A;  2MW5 A;  3KUD B;  2FCN A;  5GMV A;  3VHT C;  1ZKH A;  3VUY A;  4ZRJ A;  2IO1 B;  3B1L X;  1A5R A;  4KZ0 A;  1UD7 A;  2DEN B;  2V4L A;  3H9D A;  3QIJ A;  4M8N A;  3R7R A;  2MSE D;  3EEC A;  4MJS A;  4BKG A;  3QAR A;  4FBJ B;  3N30 A;  3QX1 A;  2D2Q A;  4DWF A;  1Y8R C;  2ZEQ A;  3W1S C;  4GN1 A;  1UZX B;  2KQS A;  3PLU A;  4FJZ A;  4N9F 4;  2KDE B;  1E90 A;  2O6V B;  3HHM A;  4XZ4 A;  2Z59 B;  4ZDV A;  1WXA A;  2BGF A;  3A4S C;  3UF8 A;  1EO6 A;  4ANX A;  3RZW C;  4GOC A;  2KD0 A;  4CHK A;  2L00 B;  1KJT A;  1WR1 A;  4ICV A;  2KAN A;  4WWO A;  2L05 A;  2DX5 B;  2JY6 A;  4NJ7 A;  2M0X A;  2JT4 B;  2G3Q B;  2KJH B;  2KMC A;  4DHJ D;  3GOE A;  4JIO U;  5AZG A;  4MSQ B;  4W9K A;  4XX5 A;  3RT3 B;  1UGM A;  2AWT A;  2MP2 B;  2RSU A;  3C0R B;  3RCZ A;  3RD2 A;  3MTN B;  4A3O A;  2FCM A;  4GIV A;  1WMH B;  2FCS A;  2KMA A;  3UIP B;  3X23 A;  1J8C A;  3L0W B;  3APD A;  1WGR A;  1GNU A;  2A5U A;  3UQB A;  4MH0 E;  5J2R A;  3VTW A;  3OJ4 B;  3IFW B;  4IUM B;  3ZVV A;  2LJ5 A;  3RYT A;  1TGZ B;  3DVN V;  2O6V A;  3ZNG C;  1WE6 A;  1F9J A;  5AZH A;  3TCA A;  5JZE B;  2K8H A;  1WGD A;  4HJK A;  2J0J A;  2LGY A;  3ZTD A;  2I1J A;  4G0N B;  5TR5 A;  4IM0 A;  2KDF B;  1E8X A;  4ICU A;  4K7U A;  3V61 A;  4FJV B;  2D11 A;  2JPH A;  1V6E A;  5LLI A;  1CMX B;  2BWF A;  4J6I A;  4JL9 A;  4BKT A;  1LFD A;  4ANU A;  5DCN A;  2FCQ A;  3A9K B;  1UEL A;  3HIZ A;  3HM6 X;  3U8Z A;  2B3A A;  2LZ6 A;  3EC8 A;  4GXB A;  4KSK C;  2EMS A;  4A20 A;  2OOB B;  2ZZP B;  4GSW A;  5E6O A;  4MEM A;  2ZPN A;  5DPT A;  3NS8 A;  4WAA A;  4W9H A;  2RR9 A;  3CMM B;  3QA8 A;  2NBV B;  4LJP B;  1S1Q B;  2MX2 A;  2A4Z A;  5CHW A;  2N9E B;  3AUL A;  4URK A;  3DVG X;  4NY0 A;  2N1V A;  3ZUN A;  2K1F A;  3CST A;  4DDG D;  5C1Z A;  4G11 A;  3WAN A;  5D2M B;  4KIK A;  2K6Q A;  4F1S A;  2PPH A;  3PRM B;  3ZKJ C;  2AL3 A;  3QCA A;  2DYB A;  2ZVN A;  3KYC D;  1LM8 B;  2KDB A;  2LD9 A;  4B9K A;  3H1U A;  4BKS A;  1LXD A;  4FUL A;  2MRP A;  2N4F A;  2KN5 A;  2JZ3 B;  2IBI B;  2NBU A;  2UYZ B;  4MGI E;  3ZRF A;  3N3K B;  4GDK A;  1V81 A;  2ASQ A;  2RPQ A;  4PS8 A;  4ANV A;  3ZNZ B;  1YX6 B;  1GG3 A;  1FXT B;  3V6E B;  1WM3 A;  3DBS A;  2R2O A;  1GUA B;  3O65 B;  2N9P C;  1UBI A;  2K39 A;  2N7D A;  3PV1 A;  1RAX A;  4MSM B;  2IO0 B;  3T9L A;  4BBN C;  4IM2 A;  4KDL B;  2JF5 A;  3OJ3 A;  4KIK B;  1P9D U;  2N9X A;  3TL5 A;  2KJR A;  2XBB C;  5CHV C;  3NZS A;  2KFK B;  2JWZ A;  4GDL B;  3ECI A;  1IPG A;  2GBJ A;  1SIF A;  2Y5B B;  3IHP C;  3KH0 A;  3NZU A;  3NOB A;  2O2V B;  2KC2 A;  5KHO A;  3MJW A;  1GC6 A;  3ZDM C;  1P98 A;  2DAJ A;  4LDT D;  1P3Q U;  3A9K A;  5JH5 C;  3PTF C;  3EFU A;  4HCP B;  4K7S A;  4TUU A;  4GDK B;  5CTR C;  2KK8 A;  3QAQ A;  3L13 A;  2PE6 B;  2KOX A;  3ENE A;  5L83 A;  3DBH I;  3VFK A;  1V5T A;  3SU8 X;  3U7D A;  3UGB B;  2NPT A;  2BYF A;  1S3S G;  1KLV A;  2MBQ A;  2MBB B;  1L7Y A;  2N7E A;  2FUH B;  1NDD A;  3JVZ X;  2IY1 B;  3ZNH B;  2GBR A;  2L8J A;  3VXW A;  4HCN B;  1RLF A;  4NQK E;  1V2Y A;  2XK5 B;  3GZN I;  3VTV A;  2L76 A;  4ASW C;  2M4N A;  5E6N A;  1K8R B;  2FAZ A;  1E8Z A;  2D07 B;  5L95 C;  2KWV B;  2G45 B;  3VVW B; 
#chains in the Genus database with same CATH topology
 3W1Y A;  3U4E G;  2OJR A;  4EZJ A;  2MLB A;  4IW0 A;  4FLH A;  4TV3 A;  4WH4 A;  2LVO A;  3KVF B;  1NBF C;  3T3O A;  3SR6 A;  1WE7 A;  2RGF A;  3DBL B;  2Y5P A;  1KOT A;  2JZP A;  2ZPY A;  1TZO A;  1E7P B;  2J4X A;  3JW0 X;  4K7W A;  4HDQ A;  1P7E A;  1RFK A;  3SFE B;  1GJZ A;  2RPV A;  5D7G A;  2CHX A;  3Q69 A;  4WIP A;  2RDH A;  3GZN B;  3R66 C;  4DDI D;  2D5G A;  1EU4 A;  1V49 A;  1OQQ A;  1SSN A;  2NBW B;  1P1A A;  1NI2 A;  3APF A;  2E6X A;  2LGI A;  3A33 B;  2FUG 1;  2QHO A;  3PHW B;  4B95 A;  3U30 A;  2KX0 A;  2AYO B;  2H89 B;  2J42 A;  3IBE A;  3DBR I;  1BXT A;  3PLV A;  2BYV E;  1E7V A;  2KLC A;  1N6Z A;  3S2A A;  4M01 A;  3VAW A;  3RFZ B;  4LLG M;  1WIA A;  4FAD A;  2BS4 B;  2X38 A;  4XGA B;  3ZNI D;  2JX5 A;  1JAL A;  3V62 A;  3VH3 B;  3VUW A;  3BWU D;  3NVW A;  3AE6 B;  3DBL I;  3FC4 A;  3ZO5 B;  2HTM E;  3B0A A;  3H7P A;  2V3S A;  2KJ6 A;  3P4S B;  4LDT B;  2K8B A;  1SJE D;  1C78 A;  2YLM A;  5CHF A;  2LJI A;  5BMI A;  2MP2 A;  3IXS A;  4FJY A;  5HFY A;  1WI0 A;  1HEZ E;  1CJE A;  1SB3 C;  4KVG B;  3Q8C A;  3SD5 A;  2K0P A;  1ZW7 A;  2NTT A;  2DYO A;  4ANW A;  5G55 A;  4K3C A;  1C3T A;  1WZ3 A;  4HJG E;  1FNW A;  5HG2 A;  4RGN A;  1T0Q C;  1WGG A;  2JVC A;  1FNU A;  1PGB A;  3URY A;  1RWS A;  1GB4 A;  4A3P A;  4EZK A;  4IG7 B;  1JW9 D;  4ZYS A;  2CR5 A;  2UWQ A;  2KO3 A;  3VH4 B;  2PE9 A;  3AEB B;  2DYM A;  2K9X A;  2ZNV B;  4WWN A;  5E6P A;  3Q8B A;  2JUO A;  3AEF B;  2AX5 A;  4RF0 A;  1WRI A;  2WP9 B;  4FHJ A;  3NY5 A;  4I6P A;  2ZCC A;  1HE8 A;  3RNB C;  1IYF A;  4BKS D;  4W9L A;  4HPM B;  2CHZ A;  2OJW A;  2INP E;  2V1Y A;  2PVG C;  2C7H A;  2ZW0 A;  4K3B A;  4MEL A;  3T8M A;  2L1A A;  1D4B A;  1OQY A;  2BYE A;  1M94 A;  4K1R B;  3MC9 A;  1H4R A;  2PIA A;  3AE7 B;  4M0W B;  1RM6 C;  2FIF A;  4W9C A;  5D94 A;  1P0R A;  1FCL A;  3BZD B;  3PHX B;  2D3G A;  4HKQ A;  1CK1 A;  1H8C A;  2O2V A;  4RNA A;  3N32 A;  3K9P B;  4HPP A;  4JQW C;  3TBL D;  5I4D A;  2CKH B;  3M63 B;  5BYQ A;  3EGR A;  2ZNV C;  2BKR B;  2WXR A;  1YNT E;  2L0F A;  4USA A;  1YN5 A;  2L0T A;  2MBH A;  5HKH A;  4GMV A;  1A70 A;  2J7Q B;  1WJ4 A;  3VQI A;  1J7B A;  3RNG C;  2C7N B;  3H8H A;  1OQR A;  1Q10 A;  3A9J B;  1WGH A;  3L16 A;  3PS6 A;  1VJK A;  3CSF A;  4RM8 A;  3RN9 C;  3JSV A;  3WAL A;  3R2I A;  3TJP A;  1RYJ A;  4AJW A;  2IND C;  2D3B A;  1D5X C;  3ZTC A;  1VCB A;  1CQV A;  3PZ7 A;  2R2Q A;  2MW5 A;  1TKG A;  2MHJ A;  5GMV A;  1ZKH A;  1YN3 A;  3B1L X;  1XCQ L;  4JX1 C;  4LNF A;  4KZ0 A;  2KQ4 X;  3OWE B;  3QAR A;  3QX1 A;  1Y8R C;  4GN1 A;  4EE2 A;  4XZ4 A;  1ET9 A;  4ZDV A;  1WXA A;  1JCK B;  3A4S C;  1KH0 A;  1GPX A;  4GOC A;  2L00 B;  4WWO A;  1N62 A;  2DX5 B;  3TEZ A;  2JT4 B;  4A8X C;  3P4Q B;  2KMC A;  4DHJ D;  4LTU A;  4MSQ B;  2W54 A;  3RT3 B;  2MP2 B;  2RSU A;  3RCZ A;  4GIV A;  2FCS A;  3L0W B;  1GNU A;  2A5U A;  3UQB A;  2LHD A;  1EM7 A;  1SJH D;  2O6V A;  3P42 A;  3AB5 A;  4JPS A;  2INC C;  4HKZ E;  2I1J A;  4G0N B;  1WXQ A;  2FE8 A;  3AE9 B;  4ICU A;  1N63 A;  2WXQ A;  5LLI A;  2V9H A;  1PYW D;  4A6Q A;  3BVG A;  5DCN A;  2FCQ A;  1F52 A;  3N9Y C;  2FBW B;  4GXB A;  4B0E A;  4A20 A;  2W55 A;  1TYG B;  4MEM A;  2ZPN A;  4W9H A;  3CMM B;  2MX2 A;  1TY0 A;  3BVZ A;  1FO4 A;  2K1F A;  3CST A;  4DDG D;  2BB5 A;  4US9 A;  2K6Q A;  3ZKJ C;  2DYB A;  2LD9 A;  3J9C A;  1HTQ A;  4FUL A;  3HVD A;  1IUE A;  3Q6B A;  3HRD D;  3FIL A;  2IBI B;  3MC0 B;  1YQ3 B;  3N3K B;  2ASQ A;  2GRI A;  3IAM 1;  2KAC A;  4ANV A;  3ZNZ B;  2WXI A;  1GG3 A;  4J3O D;  3DBS A;  4YWG G;  3O65 B;  3E9S A;  4MSM B;  2IO0 B;  4BBN C;  2JF5 A;  2N9X A;  3VR9 B;  2KJR A;  2JWZ A;  3ECI A;  2MH7 A;  1IBX B;  1IPG A;  4NZL B;  2Y5B B;  3NOB A;  2O2V B;  4KX6 B;  3MJW A;  3ZDM C;  2DAJ A;  4LDT D;  3A9K A;  3DHG C;  5JH5 C;  1YN4 A;  4C7Z A;  3QAQ A;  2PE6 B;  2Y3A A;  4XDC A;  3VFK A;  1V5T A;  3U7D A;  1E0Z A;  4WWM A;  2BYF A;  4YXD B;  2QJL A;  2MBB B;  1KFY B;  1QIL A;  1FM0 D;  2FUH B;  3JVZ X;  1JWS D;  1V1P B;  4NQK E;  1RLF A;  2L8J A;  3GZN I;  1L6U A;  1K8R B;  1E8Z A;  2WDR B;  2UU7 A;  2KWV B;  4EFO A;  2WXP A;  1XT9 B;  1L0Y B;  2NTS A;  1OFF A;  4KSL C;  5IA7 A;  3GS2 A;  2HJ1 A;  3KUC B;  1TT5 B;  3QJZ A;  2N0S B;  4JGH B;  5BYR A;  3AEA B;  2QEJ C;  2V3N A;  4TQ0 A;  1OEY J;  2KDI A;  4P1C C;  2PW9 A;  2DZJ A;  3AE8 B;  1VDV A;  1TS4 A;  2EKE C;  1SGH A;  5IAA C;  5GXG B;  3PZ8 A;  3BYT B;  4W9G A;  2PMV A;  4DHZ B;  1C77 A;  3Q3F A;  4IKG A;  2WYQ A;  2AEH A;  2CHW A;  2LI5 A;  3RZF A;  2XEW A;  4C00 A;  4WJQ A;  1XXG A;  3R2T A;  4YTP B;  1WXM A;  1WH3 A;  1WX9 A;  2XK5 A;  1WXV A;  3HUI A;  2BYT A;  1VR9 A;  2WXJ A;  2WXO A;  1QOG A;  3UI3 A;  3L54 A;  2WXK A;  2QDF A;  2CU1 A;  4WUR A;  1IP9 A;  2JQR B;  1LQB A;  2IY0 B;  3I57 A;  3UIN B;  1V5O A;  3WAO A;  4KV2 A;  4YL8 A;  3ONS A;  2LEK A;  3AE2 B;  1YD8 U;  2W82 A;  1T0Y A;  3KQ4 A;  3ALB A;  5D3D A;  2KWU B;  1ZP0 B;  3I3T B;  2C60 A;  3AI5 A;  2RDG A;  4IWO A;  3CF6 E;  4BOZ B;  2N9L A;  1VRA B;  5EE9 A;  1WRD B;  4B0M A;  4YSZ B;  4R3D A;  4WAF A;  4CQN A;  1D6E C;  4M8M A;  1D5Z C;  3Q8A A;  3Q8E A;  3VRB B;  4P7I A;  2KTR B;  1VZ6 A;  1JWA D;  4PYU A;  3NJT A;  4CYE A;  3RUL A;  5AUI A;  1T0R C;  1F1H A;  1C4A A;  2REX A;  2BTE A;  3LYY A;  3DWG C;  4A90 A;  4D2K A;  1T0S C;  2BQQ A;  3ZJV A;  5FKA C;  2V4I B;  2YEP B;  2L83 A;  3AN1 A;  1KF6 B;  1YX5 B;  2AQ3 B;  2K25 A;  4DHZ E;  3A9J A;  4NQL B;  1WM2 A;  1EF5 A;  3MHZ A;  1SE3 A;  3P2B A;  4BOS C;  3SFD B;  1NVI D;  2WXL A;  3N1X C;  4NJ6 A;  2LRW A;  1MPE A;  4YTM B;  1WXS A;  2KX3 A;  3Q3N C;  5C23 A;  3N1Y C;  4P6V F;  4GDL A;  1YQ4 B;  1OEY A;  1YIW A;  3AEG B;  2KT7 A;  4OVU A;  2YVC A;  4FXC A;  2BF8 B;  1HA5 A;  3WAM A;  4MJS B;  4AUQ C;  1WX7 A;  1X1M A;  3ZJU A;  1QLB B;  1SE9 A;  4OZB A;  1UWX A;  2RD0 A;  2IYD B;  2MBO A;  2ON8 A;  4G50 A;  1L2N A;  2NCN A;  4XC2 A;  3NZ3 A;  4IWP A;  1ZGU B;  5JHA A;  2WQY B;  2PTL A;  2N7J A;  1DOY A;  1MJD A;  4MT5 A;  2JXX A;  1ZDX A;  3U52 E;  3D32 A;  3LXF A;  4PK1 A;  3AMZ A;  2MCN B;  2MQJ A;  5TSS A;  1E7U A;  2KLG A;  2V0G A;  3H7S A;  1GAQ B;  1SE4 A;  1SXT A;  1TBE A;  1SEB D;  4FA6 A;  2K8C A;  3RUI B;  2MJE A;  3JSV B;  1BT0 A;  4OW0 A;  4XYC A;  4HEA 1;  1TTN A;  1ACC A;  3NHE B;  2M0A A;  1I35 A;  2VRR B;  2LXC A;  3TUO A;  1Q5W B;  1QT9 A;  1WF9 A;  4ZRI A;  2KHW B;  2GLS A;  4MDK E;  3ML9 A;  3VTU A;  2ZJD A;  4AWJ A;  4BBN F;  2LXA A;  2ONQ A;  5LXH A;  1I42 A;  2LUM A;  3C8Y A;  1GC7 A;  4GLS C;  1D3Z A;  3NVZ A;  1F2R I;  4G3X B;  3EA6 A;  1EWC A;  3PO0 A;  2G4D B;  4F8C B;  1JQ4 A;  3R8B A;  3A4R A;  4M00 A;  4GGQ A;  4TQ1 A;  3BVM A;  4KKJ A;  2KXJ A;  1TJE A;  3NS1 A;  3P1M A;  4FHK A;  3FIL B;  2FCN A;  3VHT C;  3VUY A;  4ZRJ A;  1UD7 A;  1UNS A;  3H9D A;  4FBJ B;  3N30 A;  2D2Q A;  2DLB A;  1JRO A;  3AM9 A;  4ANX A;  3EFC A;  4CHK A;  3ZYY X;  1WR1 A;  4XDD A;  1B1Z A;  2KJH B;  4JIO U;  5AZG A;  2I38 A;  1L4D B;  1UGM A;  1IGC A;  3RD2 A;  2QMT A;  1J0G A;  2FCM A;  2KMA A;  3V05 A;  2WDQ B;  1PFD A;  3ETR A;  3TCA A;  3MJ5 A;  4UDU C;  2WHI A;  1ENF A;  2LGY A;  3RNF C;  3ZTD A;  1JRP A;  4IM0 A;  1TKE A;  2BW2 A;  2JYT A;  4K7U A;  1CMX B;  1QOA A;  1LFD A;  2RMM A;  4ANU A;  3HIZ A;  3U7Z A;  3NRZ A;  5HI1 A;  3EC8 A;  1QKZ A;  4GSW A;  5E6O A;  2RR9 A;  1D5M C;  3QA8 A;  1S1Q B;  1ESF A;  2BS3 B;  2A4Z A;  5CHW A;  3AUL A;  4NY0 A;  3WAN A;  3W5V B;  4LNI A;  3N20 C;  1JWB D;  2ZVN A;  4QAY A;  1WWT A;  1IBX A;  3H1U A;  1T3Q A;  2QCZ A;  1ET6 A;  2INN E;  4ZRQ A;  2KN5 A;  3OG5 A;  1I4R A;  2NBU A;  2CJN A;  4MGI E;  4JWS C;  3P4P B;  3SEB A;  1TS3 A;  4NJC A;  2RPQ A;  4MAC A;  3L4P A;  3N1Z C;  2Z8L A;  2ACZ B;  2R2O A;  4HRS A;  3Q8F A;  1GUA B;  2K39 A;  3AE1 B;  1XLN A;  1RAX A;  1V1P A;  1Y56 A;  3T9L A;  3OJ3 A;  2XBB C;  4YSY B;  5CHV C;  3NZS A;  2KFK B;  1VLB A;  2WGS A;  5EE0 A;  2BB6 A;  1SIF A;  2GBJ A;  3KH0 A;  5KHO A;  2NMQ A;  4XE0 A;  1AWD A;  2WXF A;  1FCC C;  4K7S A;  4TUU A;  4GDK B;  5CTR C;  3NVV A;  3L13 A;  2KOX A;  5L83 A;  3B2G A;  2NPT A;  1MHH E;  2KAJ A;  2IGG A;  2IY1 B;  3ZNH B;  3VXW A;  4HCN B;  1T5X D;  4KGR A;  4L1B A;  5C3J B;  1FRD A;  2FAZ A;  2G45 B;  2K22 A;  3B2F A;  1F2R C;  4IDI A;  2IGH A;  4N6E B;  3HM3 A;  3AH7 A;  1WFY A;  1XLP A;  4MH8 A;  1DYQ A;  4EOY A;  2GMI C;  1K53 A;  1YJI A;  3DVG Y;  4XWT A;  2DWQ A;  1YQB A;  3TMP B;  2DZI A;  4ZRK A;  2J0M A;  1XLQ A;  1YOV B;  4FN2 A;  4NAW B;  4RFB A;  4GB9 A;  3BY4 B;  2JSV X;  1JWU D;  3ABV B;  4B6W A;  4W9D A;  2LAS A;  4BVU C;  1TS5 A;  5MPO A;  4RF1 A;  2WX0 A;  3E56 A;  3I9V 1;  3FKY A;  1I4G A;  3NUH B;  5C2T B;  3JYU A;  2IZV B;  3ZRC A;  5LXI B;  1MFW A;  4MGK E;  1YMH E;  3UIO B;  4C4V A;  3AXC A;  1N5X A;  2L7R A;  1EUV B;  2KC1 A;  1UH6 A;  2MBE A;  4LCD E;  2HTH A;  4PS7 A;  1UUP A;  2C5L C;  3KUZ A;  1PGX A;  1C76 A;  2AQ1 B;  4LNK A;  1VZ8 A;  1N5W A;  2DHZ A;  3RI7 C;  1WX8 A;  4YT0 B;  1FRR A;  1V1O A;  5EE3 A;  3P4R B;  5JHB A;  1QZE A;  2IJ0 A;  3I63 C;  1ROE A;  2BVC A;  4WQO B;  4F7Z A;  3B08 A;  2LUE A;  3T3N A;  4IC7 B;  4LNO A;  4ZHP A;  1V9J A;  1Z5S B;  1XD3 B;  2WXH A;  4KGS A;  3R7Q A;  1PGA A;  1TZ1 A;  5AUK A;  1DGJ A;  2JWU A;  3PSE B;  4NAM A;  1WGK A;  3BIN A;  1FEH A;  4P16 A;  3V3X A;  1QQR A;  2PEA A;  2K5P A;  3I5J C;  5CX3 A;  5DPR A;  4HDO A;  1V86 A;  1NYR A;  2KVR A;  3R3M A;  1WJN A;  2EKI A;  3AEC B;  4HRO A;  2VZK B;  2H88 B;  2ZVO A;  2X8X X;  5IOI A;  4RH6 A;  2NVU I;  1NEK B;  2KWD A;  3ZW3 A;  3H6N A;  3PRZ A;  5BO4 B;  4MGY E;  1KTK A;  4GU2 A;  3ZDT A;  2NS5 A;  1EU3 A;  1R7S A;  1OTR B;  4EZL A;  1YJ1 A;  2GBM A;  5DPS A;  1E5W A;  2JRH A;  4LNN A;  2CJO A;  1TIF A;  4DQO C;  3QWZ B;  4HWI B;  3RNE C;  4HK2 A;  5AZF A;  3ZQ4 A;  2SAK A;  4MM3 A;  2BPS A;  2LVQ A;  4PYZ A;  4WWP A;  1Q1O A;  4E71 A;  1YJJ A;  4ZYN A;  2MWS B;  2HE7 A;  3AE5 B;  1HZ6 A;  2GBN A;  4EKU A;  4RGM A;  1T6B X;  4X57 B;  5IO9 A;  1WZ0 A;  3ZIM A;  4RGT A;  2G9H D;  1WYG A;  3SDL C;  2EEL A;  1LGR A;  1FPY A;  4WJO A;  1XQQ A;  3B9J A;  1WYW B;  1JML A;  2ZCB A;  1L0V B;  1BUI C;  3VDZ A;  1E6E B;  4A9A A;  1SE2 A;  2NR2 A;  5G5G A;  1MG4 A;  3A1Q A;  3M62 B;  4HPL B;  4OHJ A;  5FR6 A;  2C9W B;  2JRI B;  4RGO S;  1G6J A;  2D3A A;  2GI9 A;  4MGZ E;  4C7Y A;  5KHQ A;  3L10 B;  1FFV A;  2W3S A;  4IWQ A;  1U4A A;  2QIE B;  4C56 C;  2L32 A;  4OZA A;  2WU5 B;  2DZK A;  1ZXI A;  1QOF A;  2KYW A;  4L2Y A;  1K51 A;  3DCG A;  3KWL A;  2HDE A;  1RFA A;  4WJP A;  3AEE B;  2PJH A;  5DPW A;  3DPD A;  4E3C A;  1ZXH A;  4N58 A;  4JWU C;  4L23 A;  1TKY A;  3V60 A;  2C7M B;  3LJ3 A;  1ISN A;  1AW7 A;  4C4V B;  3OAW A;  3PGE A;  4DHJ B;  2J52 A;  1EWY C;  2IO1 B;  1A5R A;  2ICI A;  2VH1 A;  3AV8 A;  4MJS A;  3EEC A;  4LK0 M;  2IGD A;  4BKG A;  2QSD A;  4O1N A;  4DWF A;  5EE1 A;  1UZX B;  4H2A A;  4FJZ A;  4N9F 4;  2KDE B;  1E90 A;  3HHM A;  2Z59 B;  2BGF A;  3UF8 A;  3CIR B;  3BK2 A;  3RZW C;  2KD0 A;  1JWM D;  4ICV A;  1FXI A;  1DOI A;  2L05 A;  4NJ7 A;  4M02 A;  2G3Q B;  3GOE A;  5H8Y E;  4W9K A;  4XX5 A;  4P1B C;  2AWT A;  3GE8 C;  3C0R B;  3AED B;  4A3O A;  1WGR A;  2KMM A;  4MH0 E;  3OJ4 B;  1P7F A;  1ZUD 2;  1PUT A;  4TSS A;  3IFW B;  3ZVV A;  5BMG A;  2LJ5 A;  3RYT A;  1TGZ B;  3DVN V;  1WE6 A;  5AZH A;  2LFI A;  3BII D;  3GB1 A;  4HJK A;  2J0J A;  5TR5 A;  3TEW A;  1N61 A;  3V61 A;  4FJV B;  2JPH A;  4OVZ A;  1V6E A;  2IPK D;  2BWF A;  2L52 A;  4J6I A;  4XWW A;  4JL9 A;  3A9K B;  1UEL A;  1VZ7 A;  3U8Z A;  2LZ6 A;  3Q14 C;  2EMS A;  5DPT A;  4LJP B;  3FAH A;  2N9E B;  3AE3 B;  3DVG X;  3ZUN A;  4URK A;  3ZJT A;  5C1Z A;  4G11 A;  1L5P A;  4F1S A;  4ZHO A;  4AQ7 A;  3PRM B;  1HXY D;  4B9K A;  1LM8 B;  2KDB A;  3MP9 A;  1K50 A;  2AQ2 B;  1C4C A;  3Q3M C;  2N4F A;  3LB8 C;  3KWV A;  2JZ3 B;  2M19 A;  3ZRF A;  4GDK A;  4BZA A;  2WNM A;  1YX6 B;  1FXT B;  3V6E B;  1WM3 A;  2WS3 B;  2N9P C;  1UBI A;  1TS2 A;  1C79 A;  4M0W A;  2WU2 B;  4ARC A;  4IM2 A;  4KIK B;  3KLS X;  3TL5 A;  2LMC A;  1V97 A;  3W5U B;  1XF5 L;  1ZDV A;  4GDL B;  2I2Y A;  2PVO D;  2KC2 A;  3NVY A;  3C19 A;  5T8I A;  1GC6 A;  1P98 A;  3PTF C;  3EFU A;  3W2D A;  1QF6 A;  2OED A;  2VH2 A;  1UF0 A;  3ENE A;  4YSX B;  5IKC M;  1S3S G;  1FXA A;  1L0X B;  1V2Y A;  2XK5 B;  4ASW C;  2M4N A;  3DHH C;  5E6N A;  2WWZ A;  3IT4 B;  2HJ8 A;  1J7C A;  2R61 A;  3TEX A;  2LVP A;  2LHE A;  2GOW A;  3QC8 B;  1MG8 A;  4WQM A;  4KZC A;  4AOF A;  1Q0W B;  2DBY A;  1J7A A;  2IO2 B;  2KKC A;  4E74 A;  1DOX A;  2Z0E B;  2QIL A;  3ZXV A;  3BYY B;  3WA0 A;  5JXV A;  1E10 A;  3DBH B;  2Q5W D;  3AU5 A;  1FIQ A;  4WJN A;  1QOB A;  3APC A;  4KDI C;  4W9E A;  1N60 A;  4JLC A;  4ZOH C;  3IG3 A;  4DXG A;  1CZP A;  3L17 A;  1HTO A;  2KTR A;  1WJ6 A;  2EMT A;  1E8Y A;  2O6V D;  3PRE A;  1WR6 E;  2N1W A;  4I6L B;  2BBC A;  3TEY A;  5IP4 D;  4HVB A;  1UGJ A;  3RNC C;  3PZD A;  4KKI A;  4RM9 A;  4TKN A;  2MA9 B;  1GB1 A;  3HK0 A;  4YTN B;  3K9O B;  1V80 A;  1FNV A;  4OVV A;  2KN4 A;  3DHI C;  2J0K A;  2NPT B;  4NPN A;  1JRU A;  4EUT A;  3IVF A;  1AN8 A;  1R4M I;  3QQ8 B;  3ML8 A;  3SHQ A;  4RCO A;  3NG0 A;  4AJY B;  3PRP B;  1RRB A;  5D3I B;  1VD2 A;  3VUX A;  1J19 A;  2BKF A;  4A55 A;  2MJ3 A;  3DOW A;  2Z0D B;  1SF0 A;  1E8W A;  3IT6 B;  2WXM A;  2I1K A;  1KM7 A;  1MHX A;  2KDM A;  1OGW A;  3DDC B;  5J17 A;  2LGD A;  2W9N A;  1GOZ A;  3WIM A;  2WDT B;  2HD5 B;  1I4H A;  4W9J A;  4CO7 A;  5LNK 1;  3UQA A;  2WXG A;  2BWE S;  3EUB 2;  4LJO B;  4BFR A;  4JE3 B;  1C4P A;  2GBK A;  2OHF A;  3TIX A;  3MFG A;  1XEE A;  1ZE3 D;  4ZRP A;  2L3Z A;  1IGD A;  1WY8 A;  3AU4 A;  4PS3 A;  4EEW A;  1AAR A;  3Q3O C;  3GE3 C;  1FD6 A;  5G2N A;  1UBQ A;  3KW5 B;  2DAF A;  4I6N B;  1K52 A;  4DXA B;  3QK0 A;  3OLM D;  3ZLZ A;  1NI3 A;  3MHS D;  2KQ7 A;  4S17 A;  4DK5 A;  2Y5C A;  1L4Z B;  1NEN B;  2WX1 A;  2M8S A;  1R4M B;  3M95 A;  3Q3J A;  2SEB D;  4PT5 A;  3BK1 A;  5J18 A;  1R4N I;  4RMA A;  3WAP A;  2D10 A;  1M4V A;  2KWC A;  3PVL A;  1SIJ A;  5EDS A;  1Z2M A;  2K6D B;  4HXD A;  3QHT A;  2N9K A;  2LGS A;  5E6J A;  2KFK A;  2TSS A;  2XN9 C;  2PLP A;  4II3 B;  3H7P B;  1PQS A;  2DZM A;  2M1M A;  4US8 A;  1KLU D;  3DWM A;  5D6J B;  1XCT L;  1NYQ A;  2FNJ B;  2QC8 A;  3VR8 B;  1WJU A;  4AP4 C;  2JYE A;  3L08 A;  2YEP F;  1L6V A;  1BML C;  2CS4 A;  3X0W A;  3DVN U;  3ZGZ A;  2JU6 X;  2IO3 B;  1EF1 A;  2KFJ A;  4KGT A;  1FFU A;  5BYS A;  3LDZ E;  2KTF A;  1MVK A;  2KZR A;  2G4S A;  1WGY A;  3V6C B;  3W1S A;  1TY2 A;  4II2 B;  4W9F A;  4BAX A;  4DBG A;  3DBR B;  1ZOY B;  2FID A;  2DNF A;  1XO3 A;  4K81 A;  3P63 A;  1WMH A;  2B76 B;  4HLE A;  2LRU A;  2LWP A;  3DQV A;  1E9M A;  1SBB B;  3EHV A;  1I4X A;  2W3R A;  3A1Q B;  4N59 A;  2J53 A;  3KYD D;  2KNB A;  2JZZ A;  3PPA A;  3AE4 B;  1R4N B;  4DXF A;  1ZPS A;  1C1Y B;  1WSP A;  5AEK B;  4IM3 A;  4NNJ B;  3M3J A;  4NAW A;  3PT2 B;  2LGX A;  3RPF C;  4W9I A;  2M17 A;  2AL6 A;  2BS2 B;  1STE A;  3KUD B;  3GP7 A;  4M8N A;  2DEN B;  2CU3 A;  2GB1 A;  2V4L A;  3QIJ A;  3R7R A;  2MSE D;  5H92 C;  5G5H A;  4MM3 B;  2ZEQ A;  3W1S C;  2VZK D;  2KQS A;  3PLU A;  2O6V B;  2XNA C;  1EO6 A;  2BT6 A;  2PKO A;  2WXN A;  1KJT A;  2KAN A;  1I7H A;  2JY6 A;  2M0X A;  1AYF A;  2D3C A;  3MTN B;  1J8C A;  2KVZ A;  1WMH B;  3X23 A;  3UIP B;  3APD A;  1UWM A;  4ARI A;  5J2R A;  3VTW A;  4ITK A;  4IUM B;  3ZXR A;  3ZNG C;  1F9J A;  5JZE B;  2K8H A;  2E3T A;  1HZ5 A;  1WGD A;  4AS1 A;  1KRH A;  1FMA D;  4C80 A;  1XLO A;  2KDF B;  2WLB A;  4Q2J A;  1E8X A;  4ACF A;  2D11 A;  3TSS A;  1MI0 A;  4BKT A;  3HM6 X;  4TMA B;  2B3A A;  4KSK C;  2OOB B;  2ZZP B;  3Q2A C;  1B9R A;  2JXT A;  3O13 A;  3NS8 A;  4WAA A;  3W9C B;  2NBV B;  3IAS 1;  3U2S C;  1LO5 D;  2K3U A;  4IOI E;  2N1V A;  1I4Q A;  2MJD A;  5D2M B;  4KIK A;  4S0R A;  2PPH A;  1HQR D;  5FR3 A;  2RDB C;  2AL3 A;  1C9F A;  3QCA A;  2IDY A;  3KYC D;  4BKS A;  5BMH A;  1LXD A;  2M56 B;  2MRP A;  3MC8 A;  2UYZ B;  4OZC A;  1V81 A;  4PS8 A;  2V3P A;  1F0Z A;  1I4P A;  2N7D A;  3PV1 A;  3RNA C;  1KLG D;  2ZW1 A;  4KDL B;  5IN7 A;  1P9D U;  3RMK C;  2WDV B;  3NZU A;  3IHP C;  1F77 A;  1P3Q U;  3VRA B;  1PDX A;  4HCP B;  5FK9 C;  2KK8 A;  2G1E A;  3DBH I;  3SU8 X;  3UGB B;  1KLV A;  2MEK A;  4REZ A;  2MBQ A;  1L7Y A;  2N7E A;  1NDD A;  3WCQ A;  2GBR A;  3CWI A;  3VTV A;  1V8C A;  2L76 A;  3HVZ A;  2D07 B;  5L95 C;  5HHD G;  3VVW B; 
#chains in the Genus database with same CATH homology
 4EFO A;  3W1Y A;  1XT9 B;  2OJR A;  3HM3 A;  4KSL C;  4EZJ A;  5IA7 A;  3KUC B;  2HJ8 A;  2MLB A;  4IW0 A;  4FLH A;  4TV3 A;  1WFY A;  2LVO A;  3KVF B;  1NBF C;  2LVP A;  2GOW A;  4EOY A;  3QC8 B;  3QJZ A;  1MG8 A;  1WE7 A;  2GMI C;  2RGF A;  4JGH B;  3DVG Y;  1KOT A;  4KZC A;  4AOF A;  1Q0W B;  2ZPY A;  1YQB A;  2IO2 B;  2KKC A;  4E74 A;  1OEY J;  2KDI A;  2Z0E B;  4TQ0 A;  3JW0 X;  4K7W A;  3TMP B;  3WA0 A;  2DZJ A;  4HDQ A;  3AU5 A;  2WWZ A;  1GJZ A;  2DZI A;  4WJN A;  5D7G A;  2CHX A;  2J0M A;  4ZRK A;  2EKE C;  1SGH A;  4FN2 A;  5IAA C;  4NAW B;  3APC A;  4KDI C;  3R66 C;  4GB9 A;  4W9E A;  4DDI D;  3BY4 B;  4W9G A;  4JLC A;  4DHZ B;  1V49 A;  3Q3F A;  2NBW B;  4B6W A;  4W9D A;  3IG3 A;  2WYQ A;  2LAS A;  2AEH A;  4BVU C;  2CHW A;  3L17 A;  2KTR A;  2LI5 A;  1P1A A;  1WJ6 A;  1NI2 A;  2EMT A;  1E8Y A;  3RZF A;  2WX0 A;  2XEW A;  2O6V D;  3PRE A;  4WJQ A;  1WR6 E;  1WXM A;  3APF A;  1WH3 A;  2N1W A;  4I6L B;  1WX9 A;  2XK5 A;  1WXV A;  3A33 B;  2QHO A;  3PHW B;  4B95 A;  4HVB A;  3JYU A;  3U30 A;  2IZV B;  2KX0 A;  3L54 A;  3ZRC A;  2AYO B;  5LXI B;  4MGK E;  3IBE A;  3PZD A;  3DBR I;  3UIO B;  3PLV A;  2BYV E;  4RM9 A;  4TKN A;  2MA9 B;  3AXC A;  1E7V A;  2KLC A;  2L7R A;  1EUV B;  2CU1 A;  3HK0 A;  3K9O B;  2KC1 A;  3S2A A;  1UH6 A;  3VAW A;  1IP9 A;  2MBE A;  1V80 A;  1LQB A;  2IY0 B;  2HTH A;  4LCD E;  1WIA A;  4OVV A;  4PS7 A;  3UIN B;  2C5L C;  4FAD A;  2J0K A;  1V5O A;  3WAO A;  4KV2 A;  3KUZ A;  2NPT B;  4NPN A;  4YL8 A;  3ONS A;  1JRU A;  4EUT A;  3IVF A;  3ZNI D;  1R4M I;  3V62 A;  3VH3 B;  3VUW A;  2DHZ A;  1YD8 U;  3QQ8 B;  3ML8 A;  3SHQ A;  1WX8 A;  1T0Y A;  3ALB A;  3DBL I;  3ZO5 B;  4AJY B;  3PRP B;  2KWU B;  1RRB A;  3B0A A;  3I3T B;  1VD2 A;  3H7P A;  2V3S A;  2C60 A;  3AI5 A;  2KJ6 A;  4IWO A;  4LDT B;  3VUX A;  1J19 A;  2BKF A;  3CF6 E;  2K8B A;  4BOZ B;  3DOW A;  5JHB A;  2YLM A;  2Z0D B;  5CHF A;  1E8W A;  2MP2 A;  1WRD B;  1QZE A;  2I1K A;  1KM7 A;  4M8M A;  4WQO B;  4F7Z A;  1OGW A;  2KTR B;  2LUE A;  3B08 A;  3DDC B;  4FJY A;  4P7I A;  4PYU A;  1WI0 A;  5J17 A;  4IC7 B;  4KVG B;  4CYE A;  3SD5 A;  1V9J A;  1Z5S B;  1XD3 B;  1ZW7 A;  3RUL A;  2DYO A;  4ANW A;  5G55 A;  2LGD A;  3R7Q A;  1C3T A;  1TZ1 A;  2W9N A;  3WIM A;  2REX A;  1WZ3 A;  2WDT B;  2HD5 B;  1WGG A;  2JVC A;  3PSE B;  4W9J A;  4CO7 A;  3BIN A;  2PEA A;  3UQA A;  4A3P A;  5CX3 A;  4EZK A;  4IG7 B;  5DPR A;  2BWE S;  4HDO A;  1YX5 B;  4LJO B;  2CR5 A;  4BFR A;  2UWQ A;  2K25 A;  1V86 A;  2KO3 A;  3VH4 B;  2GBK A;  2KVR A;  3A9J A;  4DHZ E;  3TIX A;  3R3M A;  1WJN A;  4NQL B;  1WM2 A;  2PE9 A;  1EF5 A;  2DYM A;  2L3Z A;  3P2B A;  1WY8 A;  3AU4 A;  4BOS C;  4PS3 A;  2ZNV B;  2ZVO A;  4EEW A;  1AAR A;  4WWN A;  5E6P A;  2NVU I;  2JUO A;  3H6N A;  2LRW A;  4NJ6 A;  5G2N A;  3ZW3 A;  1UBQ A;  1WXS A;  2KX3 A;  3KW5 B;  2DAF A;  4I6N B;  3PRZ A;  5BO4 B;  4MGY E;  4FHJ A;  4GU2 A;  5C23 A;  3NY5 A;  3QK0 A;  3OLM D;  4DXA B;  3ZDT A;  4GDL A;  2NS5 A;  3ZLZ A;  3MHS D;  2KQ7 A;  4I6P A;  1OEY A;  1YIW A;  1OTR B;  4DK5 A;  2ZCC A;  1HE8 A;  4EZL A;  4OVU A;  1IYF A;  1YJ1 A;  4BKS D;  2YVC A;  2GBM A;  2WX1 A;  2M8S A;  3M95 A;  4W9L A;  3Q3J A;  4HPM B;  2CHZ A;  1E5W A;  2JRH A;  5DPS A;  2BF8 B;  2V1Y A;  3WAM A;  5J18 A;  3QWZ B;  4HWI B;  1R4N I;  4RMA A;  4MJS B;  4HK2 A;  3WAP A;  2D10 A;  5AZF A;  4AUQ C;  2KWC A;  2C7H A;  1WX7 A;  4MM3 A;  1X1M A;  2BPS A;  4MEL A;  3T8M A;  2LVQ A;  4PYZ A;  3PVL A;  4WWP A;  1OQY A;  2BYE A;  1Q1O A;  1M94 A;  1SE9 A;  4K1R B;  5EDS A;  1Z2M A;  4E71 A;  2RD0 A;  1H4R A;  2IYD B;  2K6D B;  2MBO A;  4G50 A;  4HXD A;  2FIF A;  4M0W B;  4ZYN A;  2MWS B;  2HE7 A;  3QHT A;  4W9C A;  1L2N A;  2GBN A;  2NCN A;  5D94 A;  1P0R A;  4XC2 A;  4EKU A;  4IWP A;  3PHX B;  1ZGU B;  2KFK A;  4II3 B;  5JHA A;  2D3G A;  4X57 B;  3H7P B;  1PQS A;  1WZ0 A;  3ZIM A;  1H8C A;  2DZM A;  2M1M A;  2O2V A;  5D6J B;  3N32 A;  2FNJ B;  2JXX A;  3SDL C;  1J0G A;  3D32 A;  3K9P B;  1WJU A;  4WJO A;  4JQW C;  3TBL D;  4AP4 C;  1XQQ A;  2MQJ A;  2MCN B;  3L08 A;  1E7U A;  1WYW B;  2CKH B;  2ZCB A;  2CS4 A;  2KLG A;  3M63 B;  3X0W A;  3H7S A;  2ZNV C;  3VDZ A;  2NR2 A;  3DVN U;  1TBE A;  2BKR B;  3A1Q A;  3M62 B;  2IO3 B;  1EF1 A;  2KFJ A;  4HPL B;  4FA6 A;  2L0F A;  5FR6 A;  2K8C A;  2C9W B;  2JRI B;  3RUI B;  1G6J A;  3JSV B;  1BT0 A;  1TTN A;  4MGZ E;  3LDZ E;  5KHQ A;  2KTF A;  3L10 B;  3NHE B;  2L0T A;  2KZR A;  2MBH A;  1I35 A;  2G4S A;  2VRR B;  2LXC A;  5HKH A;  1WGY A;  3V6C B;  3W1S A;  1Q5W B;  4GMV A;  4II2 B;  4W9F A;  2J7Q B;  4DBG A;  1WJ4 A;  1WF9 A;  4IWQ A;  4ZRI A;  1U4A A;  2FID A;  3VQI A;  2KHW B;  4K81 A;  1WMH A;  4MDK E;  4HLE A;  2LRU A;  2DZK A;  2C7N B;  3ML9 A;  3VTU A;  3DCG A;  2LWP A;  2ZJD A;  4AWJ A;  4BBN F;  3DQV A;  3A9J B;  1WGH A;  3L16 A;  2LXA A;  3EHV A;  1RFA A;  5LXH A;  3PS6 A;  1I42 A;  4WJP A;  3A1Q B;  3CSF A;  4RM8 A;  1GC7 A;  2PJH A;  1D3Z A;  5DPW A;  3DPD A;  3KYD D;  2KNB A;  3JSV A;  4G3X B;  4E3C A;  3WAL A;  2G4D B;  4F8C B;  2JZZ A;  3PPA A;  3TJP A;  4AJW A;  3A4R A;  1C1Y B;  3ZTC A;  3V60 A;  2C7M B;  3LJ3 A;  1ISN A;  4GGQ A;  5AEK B;  4IM3 A;  4TQ1 A;  4NNJ B;  3M3J A;  2KXJ A;  4NAW A;  1VCB A;  3OAW A;  3PT2 B;  2LGX A;  3PGE A;  4W9I A;  2M17 A;  2AL6 A;  4DHJ B;  2R2Q A;  4FHK A;  2MW5 A;  3KUD B;  2FCN A;  5GMV A;  3VHT C;  1ZKH A;  3VUY A;  4ZRJ A;  2IO1 B;  3B1L X;  1A5R A;  4KZ0 A;  1UD7 A;  2DEN B;  2V4L A;  3H9D A;  3QIJ A;  4M8N A;  3R7R A;  2MSE D;  3EEC A;  4MJS A;  4BKG A;  3QAR A;  4FBJ B;  3N30 A;  3QX1 A;  2D2Q A;  4DWF A;  1Y8R C;  2ZEQ A;  3W1S C;  4GN1 A;  1UZX B;  2KQS A;  3PLU A;  4FJZ A;  4N9F 4;  2KDE B;  1E90 A;  2O6V B;  3HHM A;  4XZ4 A;  2Z59 B;  4ZDV A;  1WXA A;  2BGF A;  3A4S C;  3UF8 A;  1EO6 A;  4ANX A;  3RZW C;  4GOC A;  2KD0 A;  4CHK A;  2L00 B;  1KJT A;  1WR1 A;  4ICV A;  2KAN A;  4WWO A;  2L05 A;  2DX5 B;  2JY6 A;  4NJ7 A;  2M0X A;  2JT4 B;  2G3Q B;  2KJH B;  2KMC A;  4DHJ D;  3GOE A;  4JIO U;  5AZG A;  4MSQ B;  4W9K A;  4XX5 A;  3RT3 B;  1UGM A;  2AWT A;  2MP2 B;  2RSU A;  3C0R B;  3RCZ A;  3RD2 A;  3MTN B;  4A3O A;  2FCM A;  4GIV A;  1WMH B;  2FCS A;  2KMA A;  3UIP B;  3X23 A;  1J8C A;  3L0W B;  3APD A;  1WGR A;  1GNU A;  2A5U A;  3UQB A;  4MH0 E;  5J2R A;  3VTW A;  3OJ4 B;  3IFW B;  4IUM B;  3ZVV A;  2LJ5 A;  3RYT A;  1TGZ B;  3DVN V;  2O6V A;  3ZNG C;  1WE6 A;  1F9J A;  5AZH A;  3TCA A;  5JZE B;  2K8H A;  1WGD A;  4HJK A;  2J0J A;  2LGY A;  3ZTD A;  2I1J A;  4G0N B;  5TR5 A;  4IM0 A;  2KDF B;  1E8X A;  4ICU A;  4K7U A;  3V61 A;  4FJV B;  2D11 A;  2JPH A;  1V6E A;  5LLI A;  1CMX B;  2BWF A;  4J6I A;  4JL9 A;  4BKT A;  1LFD A;  4ANU A;  5DCN A;  2FCQ A;  3A9K B;  1UEL A;  3HIZ A;  3HM6 X;  3U8Z A;  2B3A A;  2LZ6 A;  3EC8 A;  4GXB A;  4KSK C;  2EMS A;  4A20 A;  2OOB B;  2ZZP B;  4GSW A;  5E6O A;  4MEM A;  2ZPN A;  5DPT A;  3NS8 A;  4WAA A;  4W9H A;  2RR9 A;  3CMM B;  3QA8 A;  2NBV B;  4LJP B;  1S1Q B;  2MX2 A;  2A4Z A;  5CHW A;  2N9E B;  3AUL A;  4URK A;  3DVG X;  4NY0 A;  2N1V A;  3ZUN A;  2K1F A;  3CST A;  4DDG D;  5C1Z A;  4G11 A;  3WAN A;  5D2M B;  4KIK A;  2K6Q A;  4F1S A;  2PPH A;  3PRM B;  3ZKJ C;  2AL3 A;  3QCA A;  2DYB A;  2ZVN A;  3KYC D;  1LM8 B;  2KDB A;  2LD9 A;  4B9K A;  3H1U A;  4BKS A;  1LXD A;  4FUL A;  2MRP A;  2N4F A;  2KN5 A;  2JZ3 B;  2IBI B;  2NBU A;  2UYZ B;  4MGI E;  3ZRF A;  3N3K B;  4GDK A;  1V81 A;  2ASQ A;  2RPQ A;  4PS8 A;  4ANV A;  3ZNZ B;  1YX6 B;  1GG3 A;  1FXT B;  3V6E B;  1WM3 A;  3DBS A;  2R2O A;  1GUA B;  3O65 B;  2N9P C;  1UBI A;  2K39 A;  2N7D A;  3PV1 A;  1RAX A;  4MSM B;  2IO0 B;  3T9L A;  4BBN C;  4IM2 A;  4KDL B;  2JF5 A;  3OJ3 A;  4KIK B;  1P9D U;  2N9X A;  3TL5 A;  2KJR A;  2XBB C;  5CHV C;  3NZS A;  2KFK B;  2JWZ A;  4GDL B;  3ECI A;  1IPG A;  2GBJ A;  1SIF A;  2Y5B B;  3IHP C;  3KH0 A;  3NZU A;  3NOB A;  2O2V B;  2KC2 A;  5KHO A;  3MJW A;  1GC6 A;  3ZDM C;  1P98 A;  2DAJ A;  4LDT D;  1P3Q U;  3A9K A;  5JH5 C;  3PTF C;  3EFU A;  4HCP B;  4K7S A;  4TUU A;  4GDK B;  5CTR C;  2KK8 A;  3QAQ A;  3L13 A;  2PE6 B;  2KOX A;  3ENE A;  5L83 A;  3DBH I;  3VFK A;  1V5T A;  3SU8 X;  3U7D A;  3UGB B;  2NPT A;  2BYF A;  1S3S G;  1KLV A;  2MBQ A;  2MBB B;  1L7Y A;  2N7E A;  2FUH B;  1NDD A;  3JVZ X;  2IY1 B;  3ZNH B;  2GBR A;  2L8J A;  3VXW A;  4HCN B;  1RLF A;  4NQK E;  1V2Y A;  2XK5 B;  3GZN I;  3VTV A;  2L76 A;  4ASW C;  2M4N A;  5E6N A;  1K8R B;  2FAZ A;  1E8Z A;  2D07 B;  5L95 C;  2KWV B;  2G45 B;  3VVW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...