5JH5C

Structural basis for the hierarchical assembly of the core of prc1.1
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
88
Chain Sequence
HSKAHYYRYDEQLNLCLERLSNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein/transcription
molecule keywords Lysine-specific demethylase 2B
publication title KDM2B Recruitment of the Polycomb Group Complex, PRC1.1, Requires Cooperation between PCGF1 and BCORL1.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 88
sequence length 99
ec nomenclature
pdb deposition date 2016-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF16207 RAWUL RAWUL domain RING finger- and WD40-associated ubiquitin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5jh5C00
2C5LC 2M1MA 3UIPB 4HXDA 4A3OA 1J0GA 1E7UA 3R3MA 2D07B 3HM3A 4PS3A 4MJSA 1NDDA 1Q5WB 2JPHA 4XC2A 2KLGA 3N32A 2K6DB 1YIWA 4PS8A 1WM3A 1AARA 2N1VA 1TBEA 4A3PA 3ZLZA 2KOXA 5JZEB 2DYBA 2ZCCA 2N9EB 4IM2A 5C23A 4B95A 2DZKA 2CKHB 4FJYA 1OEYA 4G50A 4NAWA 3KH0A 1UZXB 2JY6A 3VHTC 1C1YB 3VTUA 4A20A 4B9KA 4DDGD 4K7WA 4HDQA 4TV3A 3RYTA 5GMVA 2K1FA 2IZVB 3V61A 1L2NA 4DDID 4II2B 3L16A 3H6NA 4DXAB 3PHXB 2KDIA 3RD2A 3KUDB 3W1YA 2JUOA 5CHVC 3CSTA 2FUHB 3B0AA 5D6JB 3VQIA 2GBMA 3RZWC 2LRWA 4TQ0A 3ECIA 3VH4B 4NJ7A 3ZDTA 2O2VA 2NS5A 1F9JA 4JLCA 1WMHA 2YVCA 3QCAA 3QWZB 4YL8A 2KTFA 2LVOA 3D32A 3PS6A 2M4NA 4W9LA 2MP2B 4GN1A 2ZPYA 2L0TA 3TCAA 3SU8X 3AU5A 4ANWA 3I3TB 3JYUA 3S2AA 3M95A 3WANA 5L83A 2FCMA 3ALBA 5IAAC 2JWZA 3AU4A 2KDBA 1BT0A 1ISNA 2KC1A 2KJRA 2KQ7A 4AJYB 1YJ1A 2FCNA 4ANVA 2MSED 3QK0A 3DPDA 2PJHA 4E74A 2NBVB 3A4RA 5JHAA 3PGEA 4BOSC 2UWQA 3P2BA 4BBNF 4IG7B 3SD5A 2O6VB 1Z5SB 2N4FA 5C1ZA 1P98A 1OTRB 1WIAA 1TZ1A 4HPMB 2K8BA 4LJPB 4NNJB 1WFYA 2D11A 2AL3A 3AULA 3ZUNA 3L17A 3ZTDA 4AJWA 4BVUC 2GBRA 3L0WB 4EKUA 3PREA 5CHWA 1WH3A 2AL6A 4IWOA 4G11A 1VD2A 2IBIB 1GNUA 2BWES 3RULA 2KVRA 3T9LA 3DBHI 3APDA 2WWZA 5J18A 1RRBA 3TMPB 1WZ0A 2PEAA 2MRPA 3KW5B 1WZ3A 5AZHA 1RAXA 4FJVB 3H7SA 3UQAA 2KN5A 3VFKA 1ZW7A 2NPTB 2I1KA 2Z0DB 4GDLA 2Y5BB 3KUZA 3JSVA 1V5OA 2MX2A 2BWFA 4FHKA 2LGYA 2G3QB 3NS8A 2KX0A 1EF5A 2L7RA 2KWCA 3A9JB 4G3XB 4E71A 4K7SA 4NY0A 1KLVA 2L00B 3RUIB 4HJKA 4DHJB 1NI2A 2KKCA 4WJNA 1V6EA 5KHQA 3VTWA 3A1QB 1SIFA 4W9DA 3PPAA 2KXJA 4GMVA 3W1SC 1ZGUB 2G45B 2DZJA 2KQSA 2ZVNA 4IWPA 2KFKB 3V6EB 1OGWA 2D3GA 4WWPA 4FHJA 3W1SA 2MBBB 3KVFB 1WYWB 4KSLC 4LCDE 1WXVA 2L05A 1WGDA 2JRIB 4AOFA 4DK5A 5DPTA 2GBJA 2IYDB 3JSVB 2LD9A 1FXTB 3DVNU 4ZRJA 3DVNV 4MSMB 2C7MB 4BKGA 2JXXA 2ZJDA 1WGHA 3PV1A 4AUQC 4MEMA 2M17A 4GXBA 5KHOA 1UBQA 2HJ8A 1RFAA 2J7QB 3RCZA 2NBWB 4TKNA 3DVGY 2DENB 3VDZA 3VAWA 4XZ4A 2LZ6A 3WAPA 3Q3FA 4I6NB 4LJOB 2BKFA 4GIVA 4KZCA 4B6WA 2D10A 2WX0A 1YX5B 3WAMA 2ZNVC 2WYQA 3DCGA 3C0RB 5LXHA 1LFDA 3PRMB 1OEYJ 2BPSA 2IO2B 1TGZB 4FN2A 4JGHB 3QARA 4WJQA 3ZO5B 4DHZB 2MLBA 2C7NB 4DHZE 5EDSA 5D7GA 1P3QU 3WA0A 1GC7A 4MSQB 4I6LB 1H8CA 2LXAA 3WAOA 1UH6A 2FIDA 4W9EA 4GSWA 4MELA 4EFOA 1KM7A 4URKA 4KDLB 3A9KB 2MP2A 3LJ3A 3PT2B 1G6JA 1R4NI 1Q0WB 3DBSA 2BF8B 3T8MA 2N7EA 4WJPA 3M62B 4EEWA 1I35A 2KTRB 2PE9A 1UGMA 3ZKJC 4BBNC 2JZZA 2XK5A 3OJ4B 2CHZA 4HCNB 3K9PB 1TTNA 4OVUA 2LGXA 3HK0A 2CHXA 2O6VD 2ZPNA 2KDFB 4LDTB 5G2NA 1LM8B 5CTRC 2I1JA 1YX6B 3EC8A 3VH3B 1P9DU 2O6VA 4E3CA 1XD3B 3DBRI 5E6OA 3V62A 3PSEB 1Y8RC 1V86A 2OOBB 2WX1A 1E8XA 2C9WB 5FR6A 1WXMA 4MGZE 1EO6A 4ICVA 4W9HA 1WGRA 1P0RA 4ZRIA 2M0XA 2XK5B 2KLCA 1D3ZA 3JW0X 2IO0B 3MTNB 2FCSA 3ML9A 2KDEB 3QAQA 4NQKE 4GB9A 3R66C 2PE6B 3VUYA 3R7QA 2NPTA 1WR1A 1X1MA 2C60A 3CMMB 4M8MA 1OQYA 3PHWB 1V5TA 1K8RB 3QHTA 1WGGA 3B1LX 1PQSA 5AEKB 4ZDVA 2GBKA 2R2QA 2IY0B 3A9JA 4N9F4 2QHOA 4WAAA 1HE8A 2BGFA 3X0WA 1WE6A 2JF5A 2DYOA 3A1QA 5JH5C 3OLMD 2RSUA 4MGKE 4WWOA 1T0YA 2YLMA 4NJ6A 1UBIA 4AWJA 2BKRB 2RR9A 1GJZA 2KFKA 5TR5A 3ZTCA 5DCNA 1E8YA 1QZEA 4K7UA 3GOEA 3X23A 4WWNA 1Z2MA 2L3ZA 2FCQA 3TL5A 2ZEQA 2XBBC 2XEWA 3R7RA 2EMTA 2ZCBA 1LXDA 1V9JA 2KWVB 1UD7A 2CR5A 3M3JA 1SE9A 5AZFA 3ZRCA 2LVQA 2V1YA 3TIXA 2MBQA 4GGQA 2N1WA 3VUWA 2RGFA 2ZZPB 1V49A 2LUEA 4AP4C 3OAWA 2KX3A 1SGHA 2GMIC 4IW0A 3SDLC 3BINA 2WDTB 1WX9A 3SHQA 4IM3A 2FAZA 2VRRB 3L10B 2HD5B 2V4LA 4MGIE 4W9IA 2REXA 5DPRA 3U30A 3ZVVA 5J17A 1EUVB 2BYFA 2J0KA 2MA9B 3MHSD 3ML8A 5D94A 3ZDMC 2G4SA 1WJ6A 3RZFA 3IG3A 2NR2A 3L08A 3NHEB 4HCPB 2DZMA 3U8ZA 3U7DA 2JZ3B 2OJRA 1A5RA 4CYEA 4MH0E 1E90A 3H1UA 4PYZA 1EF1A 2DHZA 2KO3A 2LASA 3HM6X 2EKEC 4I6PA 2MBOA 3IVFA 1XQQA 4P7IA 1WI0A 3L54A 4TUUA 3A9KA 1WRDB 2JVCA 1WXSA 2NBUA 3A4SC 3CF6E 5G55A 1VCBA 1IP9A 3UF8A 4HDOA 1P1AA 2KTRA 3ONSA 4FADA 2D2QA 2AYOB 3HIZA 3APFA 3VUXA 2J0MA 1WX8A 4ZYNA 3N3KB 5LLIA 2LVPA 4KIKB 4DWFA 1R4MI 4ASWC 1GC6A 4KVGB 4ANUA 4NQLB 3H9DA 4CHKA 3KYDD 5HKHA 4MM3A 4W9FA 4FJZA 3VTVA 1IYFA 2LRUA 3NZUA 1L7YA 4BKTA 2K8CA 2PPHA 2BYEA 5BO4B 3EECA 4KDIC 2KJHB 2KWUB 2MW5A 2LXCA 3AXCA 2IO3B 2RPQA 3PVLA 3H7PB 3Q3JA 3ZIMA 4F7ZA 1KOTA 1JRUA 2KMAA 4HWIB 4KSKC 4HK2A 4ZRKA 4GDKA 2LWPA 2EMSA 3M63B 5E6PA 3PTFC 3WIMA 1E5WA 2A4ZA 4F1SA 4GU2A 3KYCD 3ENEA 5JHBA 2C7HA 4BKSD 4G0NB 5IA7A 1XT9B 2KC2A 4BOZB 2AEHA 3O65B 3UGBB 1MG8A 3QIJA 4X57B 2HE7A 4BKSA 4FBJB 2K6QA 2J0JA 1KJTA 2GBNA 1C3TA 4MJSB 3B08A 2ZNVB 2DAFA 2IY1B 2R2OA 1GUAB 1WM2A 4M8NA 4GDKB 3OJ3A 3JVZX 2K8HA 3GZNI 4KV2A 4MDKE 3V60A 3KUCB 3QA8A 1U4AA 2FNJB 3LDZE 2KHWB 2N7DA 4ICUA 3DOWA 4GOCA 4FULA 1E8ZA 1WR6E 2HTHA 3QC8B 4EZJA 4DHJD 4II3B 3UQBA 3DQVA 3QX1A 2K25A 4NAWB 2ASQA 3K9OB 3QJZA 1I42A 3UINB 2L0FA 3IHPC 1WX7A 2L76A 2KZRA 4HPLB 4TQ1A 3ZNID 1S1QB 3PRZA 5DPWA 4EZLA 1NBFC 3PRPB 4MGYE 2LGDA 4EOYA 1H4RA 1J8CA 2DYMA 2K39A 2RD0A 1S3SG 1V81A 4W9KA 4IWQA 3PLVA 2JT4B 3DVGX 2O2VB 2MBEA 2KK8A 1WF9A 2KD0A 4W9JA 1WMHB 3PLUA 1IPGA 2M8SA 3CSFA 3ZNHB 3ZRFA 2KMCA 2NVUI 4FLHA 4WQOB 2UYZB 2CU1A 5CHFA 2V3SA 2LJ5A 2A5UA 3L13A 3VXWA 1E8WA 2AWTA 3ZNZB 4XX5A 4RM8A 2L8JA 3ZNGC 1J19A 4JL9A 1GG3A 4IM0A 2IO1B 2BYVE 3N30A 5J2RA 2MCNB 4IUMB 4IC7B 4WJOA 1WJNA 3EHVA 2DAJA 2N9PC 4K1RB 2NCNA 4RMAA 3TBLD 4EZKA 1RLFA 2KJ6A 3NY5A 2MWSB 4KIKA 4EUTA 3QQ8B 4JQWC 2B3AA 2Z0EB 4JIOU 1WY8A 1ZKHA 2MQJA 3A33B 3TJPA 1E7VA 2Z59B 4KZ0A 3NOBA 4ANXA 1LQBA 4NPNA 1UELA 1YQBA 2KANA 2KFJA 4F8CB 3BY4B 3WALA 2KNBA 2N9XA 2FIFA 4HVBA 3V6CB 3MJWA 4RM9A 4HLEA 1CMXB 3PZDA 5CX3A 1M94A 2W9NA 4BFRA 3IFWB 3H7PA 1WXAA 1V2YA 1WJUA 2G4DB 3RT3B 3VVWB 1YD8U 4LDTD 4GDLB 4FA6A 1WGYA 2GOWA 5L95C 1V80A 4K81A 1Q1OA 3HHMA 5DPSA 2MBHA 4PYUA 3NZSA 2DX5B 4DBGA 2DZIA 5LXIB 3DDCB 4J6IA 4PS7A 3APCA 4OVVA 1WJ4A 3AI5A 4W9CA 4M0WB 3ZW3A 4CO7A 2CS4A 2LI5A 5AZGA 3IBEA 4W9GA 5E6NA 3UIOB 2ZVOA 1WE7A 3DBLI 3EFUA 2JRHA 5D2MB 2CHWA
chains in the Genus database with same CATH superfamily
1FPYA 4A3OA 1DOIA 1EWYC 2L52A 3HM3A 1NDDA 3Q3NC 2JPHA 4YSYB 3N32A 2ONQA 3C8YA 3RNCC 4IM2A 2DZKA 2QIEB 4G50A 1OEYA 4A20A 2LUMA 1UZXB 1C1YB 4K7WA 4OVZA 4TV3A 2WXMA 1FFUA 1NI3A 2BVCA 4DDID 1DOXA 2QC8A 3NG0A 3W1YA 3R8BA 5CHVC 5D6JB 4XDDA 3RZWC 2LRWA 4ITKA 3Q8CA 4JLCA 3QCAA 1FD6A 2KDMA 2KTFA 3DBHB 2MP2B 2L0TA 3TCAA 3AU5A 4ANWA 3WANA 2FCMA 3AU4A 2WXLA 1C9FA 1BT0A 4ANVA 2IPKD 1RM6C 2NBVB 3A4RA 2YEPF 4IDIA 3SD5A 1V8CA 1I4HA 1XO3A 1Z5SB 3MHZA 1OTRB 1AWDA 1TZ1A 3ZUNA 1WFYA 3LYYA 4AJWA 1J7AA 2QEJC 3RNFC 1L0XB 1E10A 3PREA 1D5ZC 2AL6A 1VD2A 4ZHPA 2KVRA 3APDA 5J18A 1RRBA 3ETRA 1WZ0A 3MP9A 4MACA 3KW5B 1WZ3A 5AZHA 4FJVB 2KN5A 1ZW7A 1TY0A 3KUZA 2MX2A 4H2AA 3IT4B 1YNTE 2LGYA 2G3QB 3NS8A 1KLVA 4K7SA 2L00B 1NI2A 5KHQA 1GPXA 4XWWA 2DZJA 2KQSA 3AB5A 1AN8A 2WXQA 4IKGA 3W1SA 3KVFB 2AQ3B 4LNKA 4AOFA 1WGDA 5I4DA 2GBJA 2V3PA 3JSVB 2LD9A 3T3NA 4L2YA 3DVNV 3SFEB 4XWTA 2JXXA 1WGHA 2EKIA 1R4NB 1VZ6A 2Y5CA 4WH4A 2DENB 3BZDB 4M02A 4XZ4A 1B9RA 4B6WA 1YX5B 1V97A 2WYQA 3DCGA 2M19A 5LXHA 1LFDA 1OEYJ 3DHHC 1WXQA 2WLBA 1SEBD 1YJIA 3DBRB 1I7HA 2C7NB 4RGOS 1P3QU 4S0RA 4MSQB 3BVZA 3RPFC 4EFOA 1B1ZA 2FBWB 1G6JA 3FILB 4XGAB 2D3CA 2JZZA 2XK5A 4C56C 5BYRA 5E6JA 2LGXA 1JCKB 1C4AA 1P7EA 1LM8B 1I4PA 2G9HD 1OQQA 2WXPA 2WX1A 3U52E 1E8XA 2C9WB 3MC8A 2VZKD 1WXMA 3C19A 2WHIA 1A70A 4HKQA 1QOAA 2LEKA 3R66C 2WNMA 5EE3A 3R7QA 2NPTA 2D3AA 1V5TA 1WRIA 1SB3C 2GBKA 2R2QA 1WE6A 2AQ2B 2EELA 2JF5A 3A1QA 4S17A 3KWVA 1IBXA 3BIID 4WWOA 4JWUC 2BKRB 2RR9A 5DCNA 1E7PB 1C76A 2M56B 2ZEQA 1EU3A 2XEWA 4L23A 2E3TA 3R7RA 2EMTA 1FRDA 1LXDA 1V9JA 2KWVB 3M3JA 2CR5A 3ZRCA 2V1YA 2RGFA 2LUEA 2KT7A 3OAWA 1L0VB 2JYTA 2GMIC 2WDTB 1WX9A 4IM3A 1D5MC 4WIPA 2HD5B 2V4LA 2W3RA 4YT0B 3MHSD 4UDUC 3Q8BA 3URYA 1J7CA 1A5RA 1SE4A 3H1UA 5HG2A 4PYZA 4I6PA 2EKEC 1TS3A 4AS1A 3A9KA 4USAA 1VCBA 2R61A 1IP9A 2HTME 4ARIA 3VUXA 2KN4A 3HIZA 4ZYNA 5LLIA 5FKAC 3B9JA 3AEAB 4DWFA 4ASWC 3H9DA 3KYDD 2JQRB 3NZUA 4N59A 2BYEA 5BO4B 3EECA 1FIQA 3AXCA 3H7PB 1JRUA 1UNSA 3M63B 1XLQA 1MJDA 4N6EB 1E5WA 5H92C 3GB1A 3TEYA 4YSZB 1HTOA 3ZJTA 2J52A 1D5XC 4BOZB 3O65B 3HVZA 4X57B 5BMGA 3RNAC 1GUAB 4M8NA 4GDKB 3RN9C 1VZ8A 1YQ4B 1UUPA 3NJTA 3QA8A 1U4AA 4HRSA 3EGRA 4ICUA 3DOWA 4FULA 4EZJA 3DQVA 3QJZA 3UINB 3IHPC 4HPLB 1D4BA 1DGJA 3ZNID 3EUB2 3PRZA 1FNVA 4MGYE 4EOYA 2WS3B 2RD0A 3PLVA 2KD0A 4BZAA 2N7JA 1F2RI 3U7ZA 4KGRA 5CHFA 2L1AA 3KWLA 3BYTB 3PZ7A 2KAJA 1I4GA 1N6ZA 3ZYYX 4IUMB 3RMKC 3EHVA 2NCNA 3DBLB 5H8YE 5T8IA 3E56A 2Z0EB 4JIOU 2MQJA 3Q8EA 4P6VF 1LO5D 3NOBA 2JYEA 4NPNA 1YQBA 1CQVA 5BYSA 1EM7A 2WXRA 3WALA 2J4XA 2FIFA 4HVBA 1CMXB 1KTKA 3PZDA 2W9NA 2DNFA 4AQ7A 3VVWB 1YD8U 4FA6A 4K81A 3HHMA 4PYUA 3NZSA 4CQNA 4J6IA 3AI5A 4KGSA 1C4CA 1WE7A 2N0SB 3EFUA 2M1MA 3UIPB 2I38A 1E7UA 1P7FA 1R7SA 2D07B 3AMZA 4OZAA 3KLSX 4TMAB 3W2DA 2V4IB 1TS2A 1T0SC 2WXIA 2IGHA 5JZEB 2N9EB 2CKHB 4NAWA 2JY6A 1GAQB 4HDQA 2WXJA 3AE6B 5FK9C 1XF5L 4II2B 3HVDA 2WP9B 3ZXVA 3KUDB 2MEKA 3CSTA 3B0AA 2D3BA 3GP7A 2PVGC 4NJ7A 2O2VA 2NS5A 1WMHA 1EWCA 1SJED 2INPE 4OZBA 4GN1A 2WXKA 2WXFA 2ZPYA 3AE1B 1KLUD 5L83A 3ALBA 2JWZA 2FCNA 4P16A 3QK0A 3PGEA 4BOSC 2UWQA 4IG7B 2N4FA 3P1MA 5C1ZA 4HPMB 2K8BA 4NNJB 2AL3A 3ZTDA 2GBRA 4EKUA 1XEEA 4HKZE 5CHWA 1WH3A 4IWOA 2IBIB 1QT9A 1GNUA 3RULA 3T9LA 1JQ4A 3DBHI 2PEAA 2MRPA 1RAXA 2NPTB 2I1KA 2Z0DB 1GOZA 1T5XD 4FHKA 4E71A 2KX0A 4G3XB 4HJKA 4DHJB 4ZYSA 2KKCA 4WJNA 1C77A 2ON8A 3A1QB 3VTWA 2WXNA 1IBXB 3PPAA 2OEDA 2ZVNA 2D3GA 4FHJA 4LCDE 4KSLC 1C79A 2L05A 2JRIB 4A90A 1NENB 4C7ZA 4ZOHC 1L6UA 3P42A 4M00A 4MSMB 2C7MB 4MEMA 2M17A 4GXBA 1PYWD 3WAPA 3Q3FA 4LJOB 2BKFA 4GIVA 1XXGA 2JU6X 4YTMB 1KLGD 2ZNVC 3AE2B 5IKCM 2BPSA 2IO2B 5IO9A 4FN2A 5D3IB 1JROA 3SEBA 3ZO5B 4DHZB 4DHZE 3BVGA 3AEDB 2GLSA 2LGIA 4YTNB 4I6LB 2ICIA 1KM7A 4KDLB 3A9KB 1ACCA 3NRZA 2K3UA 1R4NI 3DBSA 3NVWA 2BF8B 3FKYA 3T8MA 1I35A 3ZKJC 4HCNB 3K9PB 4OVUA 2BB6A 2CHXA 2KDFB 5CTRC 1F0ZA 1TKYA 3VH3B 2DLBA 3RNEC 2O6VA 2CJOA 3DBRI 3V62A 1BUIC 1V86A 3TEXA 1JWUD 3R2IA 1OFFA 1WGRA 1MI0A 2M0XA 5BMIA 2KLCA 2Q5WD 3JW0X 4OW0A 2FCSA 1RYJA 3QAQA 1FFVA 1SSNA 3MJ5A 2PE6B 3VUYA 5IOIA 4QAYA 1WR1A 4M8MA 3PHWB 4P1CC 1K8RB 2NMQA 1PQSA 2UU7A 3WCQA 2QHOA 4HEA1 4MT5A 3I57A 3X0WA 5EE0A 1QOFA 2DYOA 5JH5C 3OLMD 2G1EA 1UBIA 2KFKA 1E8YA 1ET6A 4WWNA 1Q10A 1F77A 3OWEB 2XBBC 1T6BX 4XYCA 2ZCBA 2D5GA 1NYRA 2LVQA 1QOBA 2ZZPB 4WURA 2Y5PA 3NS1A 2KX3A 1QOGA 3BINA 3AEFB 2BQQA 2K22A 4M01A 5DPRA 4W9IA 3U30A 1JMLA 5J17A 1EUVB 1R4MB 3ZDMC 3RZFA 3L08A 2NR2A 4IOIE 4HCPB 3FC4A 4MH0E 1HEZE 4LNIA 4US9A 2DHZA 2KO3A 3HM6X 2MBOA 3IVFA 3L54A 4TUUA 1FNWA 1WXSA 2NBUA 4KKJA 3UF8A 3N1YC 2D2QA 2MJEA 3RNGC 1IGCA 2LHDA 1GC6A 4KVGB 2WDRB 5HKHA 1E0ZA 4MM3A 1T3QA 1IYFA 2LRUA 2K8CA 2PPHA 4KDIC 3Q3JA 3ZIMA 2IO3B 3GZNB 3EFCA 1KOTA 2KMAA 1ZPSA 4HWIB 1YN4A 4ZRKA 5E6PA 3WIMA 1HTQA 5JHBA 3IAS1 3W5UB 4NJCA 2ZW0A 5IA7A 3MC0B 1C4PA 3UGBB 4BKSA 1KJTA 2VH1A 2ZNVB 2DAFA 1V1PA 2H89B 2R2OA 3HUIA 4ACFA 1ENFA 4KV2A 2FNJB 1JW9D 2N7DA 5IN7A 1WR6E 1F52A 3UQBA 3Q6BA 4RFBA 4NAWB 2ASQA 3K9OB 2L0FA 3DWMA 2VH2A 2L76A 3CIRB 1BMLC 3IXSA 5DPWA 1SF0A 3AECB 2OJWA 1H4RA 1J8CA 2DYMA 4RGTA 2W3SA 1S3SG 4W9KA 2O2VB 1YOVB 3BK2A 1WF9A 1WMHB 3AN1A 1J7BA 2M8SA 3CSFA 1Y56A 3PO0A 2KMCA 3Q3OC 1L6VA 4WQOB 4FLHA 2V3SA 2BS4B 2A5UA 2LMCA 3L13A 4DQOC 1E6EB 2AWTA 3ZNZB 4RM8A 4K3CA 1JRPA 1GB1A 4WWMA 3DWGC 1HA5A 4RH6A 1J19A 1GG3A 1AW7A 1IUEA 5J2RA 1JWMD 2INNE 5EE9A 1WWTA 3TBLD 3ZQ4A 4KIKA 2MWSB 2B3AA 1WY8A 1F1HA 4C7YA 4KZ0A 1UELA 2KANA 1VLBA 3V6CB 5CX3A 1M94A 2KACA 1V2YA 2G4DB 1WGYA 1QILA 1Q1OA 4HPPA 2MBHA 3P63A 2DZIA 5LXIB 1N61A 3DDCB 4PS7A 3APCA 4OVVA 1KRHA 4W9CA 4W9GA 5G5HA 3UIOB 1XCQL 3DBLI 2JRHA 4YSXB 3RNBC 4HXDA 1N62A 1J0GA 3R3MA 4PS3A 1F2RC 4MJSA 2K0PA 4NAMA 3AH7A 2K6DB 1YIWA 4A8XC 1WM3A 2N1VA 3AEBB 1TBEA 4PK1A 5C23A 4B95A 4B9KA 3VHTC 3RYTA 5GMVA 2K1FA 2IZVB 3V61A 1L2NA 2PTLA 3H6NA 3L16A 3BYYB 3PHXB 2KDIA 3PZ8A 3RD2A 1QQRA 2FUHB 3VQIA 3ECIA 2IGGA 3FAHA 1F9JA 1TZOA 2YVCA 3QWZB 2LVOA 3PS6A 1FM0D 3SU8X 3I3TB 3M95A 5BYQA 1TY2A 2KDBA 2KC1A 1ISNA 2KQ7A 4AJYB 4ZHOA 2MSED 2PLPA 3AEGB 3P2BA 2O6VB 2BS2B 2KVZA 3W9CB 2HJ1A 3L17A 4RGMA 3LB8C 1KH0A 2JX5A 2WXHA 4G11A 4YWGG 2BWES 1ZOYB 2WWZA 3Q3MC 1GB4A 4NZLB 4LK0M 1PGXA 2Y5BB 3JSVA 1JWSD 1V5OA 1FXIA 1YMHE 4N58A 4B0EA 1EF5A 2INDC 2KWCA 4NY0A 4M0WA 1ET9A 3RUIB 3TUOA 1SIFA 4W9DA 4GMVA 3IAM1 1HZ6A 4PT5A 2KFKB 3O13A 3V6EB 3Q2AC 4WWPA 5JXVA 2MBBB 1WYWB 4REZA 5FR3A 2BB5A 3N1ZC 1ZDXA 4KKIA 4AUQC 1MHXA 1VJKA 3AE7B 2HJ8A 3RCZA 4TKNA 3DVGY 4R3DA 1STEA 4I6NB 1KF6B 1UWXA 3PRMB 3J9CA 1TGZB 1SE3A 1N5WA 4JGHB 2MLBA 5EDSA 1GC7A 2LXAA 1UH6A 2FIDA 4W9EA 1I4RA 4GSWA 5HI1A 3PT2B 3AV8A 2WU2B 2L83A 1UGMA 4BBNC 3OJ4B 2CHZA 4B0MA 1CK1A 3P4SB 5D3DA 2O6VD 4LDTB 1PUTA 3TEZA 5GXGB 1QKZA 3EC8A 1WYGA 4E3CA 1XD3B 3B2GA 2BW2A 1Y8RC 4MM3B 1NYQA 1EO6A 4ICVA 4W9HA 5IP4D 4TSSA 1P0RA 4ZRIA 2XK5B 1D3ZA 3ML9A 3W5VB 2KDEB 1SXTA 2GI9A 4GB9A 1YN3A 1X1MA 1OQYA 1MG4A 3B1LX 3A9JA 4WAAA 1HE8A 2BGFA 2PMVA 3AE3B 1HXYD 1RFKA 2RSUA 4MGKE 1T0YA 4NJ6A 2V3NA 3NVYA 3ZTCA 1V1PB 1QZEA 3GOEA 3X23A 2L3ZA 2FCQA 2QSDA 2J42A 5AZFA 3TIXA 1NEKB 2N1WA 1V49A 4AP4C 2WDVB 4IW0A 3SDLC 3IT6B 4XE0A 3SHQA 2FAZA 3L10B 1CZPA 2MJ3A 4MGIE 3ZVVA 2JSVX 2ZW1A 4YTPB 2BYFA 2J0KA 3ML8A 2G4SA 1WSPA 1WJ6A 3I5JC 3NHEB 2DZMA 2OJRA 3SR6A 4CYEA 4A55A 1E90A 1EF1A 1DYQA 1XQQA 1WRDB 3DHIC 4KX6B 4HDOA 2KTRA 3APFA 1D6EC 1WX8A 3Q8FA 3N3KB 1JWAD 4KIKB 2WDQB 1R4MI 2W55A 4OHJA 4ANUA 4NQLB 3L4PA 4W9FA 2CJNA 4FJZA 3VTVA 1ZXHA 4ARCA 2RDBC 2KJHB 2MW5A 2LXCA 1FEHA 2JXTA 1BXTA 4HK2A 2PIAA 2WQYB 2LWPA 4GDKA 4US8A 2EMSA 2ACZB 3PTFC 1YQ3B 2A4ZA 3ZXRA 3ENEA 4YXDB 2C7HA 4BKSD 1XT9B 1SJHD 1MG8A 3QIJA 2J0JA 3GE8C 2GBNA 1C3TA 4MJSB 2FUG1 4MH8A 2OHFA 1MVKA 4HJGE 1WM2A 1FXAA 1VZ7A 3OJ3A 2K8HA 3GZNI 3V60A 3LDZE 1QF6A 4GOCA 1E8ZA 2HTHA 3QC8B 1ESFA 2WU5B 4II3B 3R2TA 1LGRA 4DHJD 2K25A 4LNOA 2DWQA 3VRBB 1RWSA 2J53A 1L4ZB 1WX7A 3AE9B 3BVMA 1S1QB 3Q8AA 2FE8A 1TYGB 2K39A 3I9V1 1V81A 2SAKA 4IWQA 3RI7C 2JT4B 2MBEA 4W9JA 5LNK1 1IPGA 4A9AA 1ZUD2 3ZRFA 1TKEA 1XLOA 3NVZA 3TSSA 1E8WA 2L32A 4XX5A 2L8JA 2VZKB 4LTUA 4IM0A 2BYVE 3BWUD 5MPOA 3N30A 3NUHB 2MHJA 4WJOA 5HFYA 1FO4A 2W54A 1WJNA 3B2FA 3E9SA 2DAJA 2N9PC 4K1RB 4EZKA 1MPEA 2KJ6A 3AEEB 1PGAA 4JQWC 1ZDVA 3TJPA 1ZKHA 3A33B 4O1NA 2Z59B 1TKGA 3SFDB 3ABVB 2N9KA 4F8CB 2KFJA 3AE8B 2N9XA 3I63C 1FMAD 1XCTL 4HLEA 4BFRA 3IFWB 5BMHA 1WXAA 3U2SC 3RT3B 1NVID 5L95C 3P4QB 3Q69A 3ZJUA 1L5PA 1WJ4A 4M0WB 2KWDA 5AZGA 5E6NA 1SBBB 1E9MA 2MA9B 1K53A 2C5LC 1HQRD 5AUIA 1FRRA 1Q5WB 4XC2A 2KLGA 1N60A 1T0RC 1FNUA 4PS8A 1AARA 4A3PA 3ZLZA 2LHEA 2KOXA 3N9YC 2DYBA 2ZCCA 4J3OD 2BS3B 4FJYA 3VTUA 3KH0A 4DDGD 3EA6A 2RMMA 1HZ5A 2XN9C 4DXAB 2E6XA 1IGDA 2GRIA 2JUOA 2WGSA 5EE1A 1XLNA 2GBMA 1YN5A 4TQ0A 3VH4B 2QCZA 3ZDTA 4LLGM 4YL8A 4DXFA 3D32A 2RDGA 2M4NA 4W9LA 3V3XA 2H88B 3JYUA 3S2AA 4C4VA 3CWIA 5IAAC 2KJRA 1YJ1A 1PGBA 3DPDA 2PJHA 4E74A 1CJEA 5JHAA 2V9HA 4BBNF 1TIFA 1P98A 1WIAA 4RF1A 4LJPB 3AULA 2D11A 4BVUC 4BAXA 3L0WB 2IDYA 5TSSA 1PFDA 3TMPB 1MHHE 2BYTA 3UQAA 3H7SA 3VFKA 1UGJA 4GDLA 2W82A 3BK1A 2BWFA 3VRAB 2L7RA 3A9JB 2QILA 1V6EA 1C78A 1JWBD 1K50A 2KXJA 3LXFA 4JWSC 3W1SC 1ZGUB 2G45B 2I2YA 4IWPA 1OGWA 1WXVA 4DK5A 5DPTA 2IYDB 3VR8B 2IJ0A 1FXTB 2QDFA 1UF0A 2QJLA 3DVNU 4ZRJA 5C3JB 4BKGA 2ZJDA 3PV1A 1XLPA 5C2TB 1T0QC 1ZXIA 1UBQA 3HRDD 5KHOA 1RFAA 2J7QB 2NBWB 3VDZA 2PVOD 3VAWA 2LZ6A 2LGSA 4KZCA 2D10A 2WX0A 3WAMA 3C0RB 4Q2JA 1UWMA 3QARA 4WJQA 5D7GA 3WA0A 2KQ4X 1H8CA 3WAOA 3AE4B 4MELA 4URKA 1TS5A 2MP2A 3LJ3A 1SIJA 1Q0WB 2N7EA 4WJPA 3M62B 4EEWA 1ZP0B 2KTRB 2PE9A 1K52A 1TTNA 4RNAA 4DXGA 3HK0A 4C80A 2ZPNA 5G2NA 2I1JA 2WXOA 1YX6B 1P9DU 2BBCA 4JPSA 1M4VA 5E6OA 3PSEB 2DBYA 2OOBB 2TSSA 5FR6A 3V05A 4MGZE 4OZCA 2IO0B 2BTEA 3MTNB 4NQKE 1EU4A 3H8HA 1OQRA 2C60A 3CMMB 3QHTA 1WGGA 2BT6A 4FXCA 5AEKB 4ZDVA 1FCLA 4N9F4 2IY0B 3GE3C 1L4DB 2LFIA 3OG5A 4RGNA 4D2KA 2XNAC 4LNFA 3MC9A 2YLMA 4AWJA 4LNNA 1GJZA 5TR5A 3VR9B 4K7UA 2WXGA 2B76B 1Z2MA 3TL5A 1MFWA 1UD7A 1SE9A 2AQ1B 2MBQA 4GGQA 3VUWA 2Y3AA 2V0GA 2MJDA 4WQMA 1SGHA 4L1BA 2VRRB 1I4QA 2REXA 1WGKA 5D94A 3IG3A 3U8ZA 3U7DA 2JZ3B 2SEBD 2LJIA 3TEWA 2LASA 1I4XA 1ZE3D 4P7IA 1WI0A 4RF0A 2MH7A 3AE5B 2JVCA 2HDEA 3A4SC 3FILA 2NTTA 3CF6E 5G55A 1P1AA 3ONSA 4FADA 3AM9A 2AYOB 2J0MA 4ZRPA 1SE2A 2JZPA 5AUKA 2LVPA 2M0AA 1ROEA 3N20C 2PKOA 4CHKA 3P4RB 1FCCC 1TJEA 4ZRQA 1L7YA 4BKTA 4K3BA 1JALA 2KWUB 2RPQA 3PVLA 4F7ZA 2K5PA 1TT5B 1PDXA 4KSKC 4GLSC 3DHGC 4JX1C 2PW9A 4F1SA 4GU2A 3UI3A 3KYCD 2KMMA 1V1OA 2RPVA 1KFYB 4G0NB 1QLBB 2KC2A 2X38A 2AEHA 2Z8LA 2KYWA 2HE7A 4FBJB 2K6QA 1VRAB 3B08A 1VR9A 2GB1A 4P1BC 2RDHA 2IY1B 4WAFA 3JVZX 4MDKE 3KUCB 2KHWB 3U4EG 5HHDG 2JWUA 2NTSA 3T3OA 4RCOA 3QX1A 4C00A 1I42A 4XDCA 3ZGZA 2X8XX 2KZRA 2INCC 3NVVA 4TQ1A 4EZLA 1NBFC 2YEPB 3PRPB 2LGDA 1VDVA 2IGDA 5G5GA 3KQ4A 3DVGX 2KK8A 1N63A 3PLUA 3ZNHB 2NVUI 2UYZB 2CU1A 3RFZB 2LJ5A 3VXWA 4C4VB 3ZNGC 4A6QA 4JL9A 4EE2A 2IO1B 3GS2A 2MCNB 4IC7B 4HROA 4RMAA 1RLFA 3NY5A 4EUTA 3QQ8B 3ZJVA 1E7VA 1DOYA 2N9LA 4ANXA 1LQBA 4KGTA 3BY4B 1AYFA 1K51A 1L0YB 2KNBA 3Q14C 3NZ3A 3MJWA 4RM9A 1N5XA 2QMTA 1TS4A 3H7PA 1WJUA 2K9XA 4LDTD 4GDLB 2GOWA 1V80A 5DPSA 3MFGA 2DX5B 4DBGA 1YJJA 3ZW3A 4CO7A 2CS4A 2LI5A 3IBEA 3N1XC 2AX5A 2ZVOA 2CU3A 3P4PB 5D2MB 4JE3B 2CHWA
chains in the Genus database with same CATH topology
2C5LC 2M1MA 3UIPB 4HXDA 4A3OA 1J0GA 1E7UA 3R3MA 2D07B 3HM3A 4PS3A 4MJSA 1NDDA 1Q5WB 2JPHA 4XC2A 2KLGA 3N32A 2K6DB 1YIWA 4PS8A 1WM3A 1AARA 2N1VA 1TBEA 4A3PA 3ZLZA 2KOXA 5JZEB 2DYBA 2ZCCA 2N9EB 4IM2A 5C23A 4B95A 2DZKA 2CKHB 4FJYA 1OEYA 4G50A 4NAWA 3KH0A 1UZXB 2JY6A 3VHTC 1C1YB 3VTUA 4A20A 4B9KA 4DDGD 4K7WA 4HDQA 4TV3A 3RYTA 5GMVA 2K1FA 2IZVB 3V61A 1L2NA 4DDID 4II2B 3L16A 3H6NA 4DXAB 3PHXB 2KDIA 3RD2A 3KUDB 3W1YA 2JUOA 5CHVC 3CSTA 2FUHB 3B0AA 5D6JB 3VQIA 2GBMA 3RZWC 2LRWA 4TQ0A 3ECIA 3VH4B 4NJ7A 3ZDTA 2O2VA 2NS5A 1F9JA 4JLCA 1WMHA 2YVCA 3QCAA 3QWZB 4YL8A 2KTFA 2LVOA 3D32A 3PS6A 2M4NA 4W9LA 2MP2B 4GN1A 2ZPYA 2L0TA 3TCAA 3SU8X 3AU5A 4ANWA 3I3TB 3JYUA 3S2AA 3M95A 3WANA 5L83A 2FCMA 3ALBA 5IAAC 2JWZA 3AU4A 2KDBA 1BT0A 1ISNA 2KC1A 2KJRA 2KQ7A 4AJYB 1YJ1A 2FCNA 4ANVA 2MSED 3QK0A 3DPDA 2PJHA 4E74A 2NBVB 3A4RA 5JHAA 3PGEA 4BOSC 2UWQA 3P2BA 4BBNF 4IG7B 3SD5A 2O6VB 1Z5SB 2N4FA 5C1ZA 1P98A 1OTRB 1WIAA 1TZ1A 4HPMB 2K8BA 4LJPB 4NNJB 1WFYA 2D11A 2AL3A 3AULA 3ZUNA 3L17A 3ZTDA 4AJWA 4BVUC 2GBRA 3L0WB 4EKUA 3PREA 5CHWA 1WH3A 2AL6A 4IWOA 4G11A 1VD2A 2IBIB 1GNUA 2BWES 3RULA 2KVRA 3T9LA 3DBHI 3APDA 2WWZA 5J18A 1RRBA 3TMPB 1WZ0A 2PEAA 2MRPA 3KW5B 1WZ3A 5AZHA 1RAXA 4FJVB 3H7SA 3UQAA 2KN5A 3VFKA 1ZW7A 2NPTB 2I1KA 2Z0DB 4GDLA 2Y5BB 3KUZA 3JSVA 1V5OA 2MX2A 2BWFA 4FHKA 2LGYA 2G3QB 3NS8A 2KX0A 1EF5A 2L7RA 2KWCA 3A9JB 4G3XB 4E71A 4K7SA 4NY0A 1KLVA 2L00B 3RUIB 4HJKA 4DHJB 1NI2A 2KKCA 4WJNA 1V6EA 5KHQA 3VTWA 3A1QB 1SIFA 4W9DA 3PPAA 2KXJA 4GMVA 3W1SC 1ZGUB 2G45B 2DZJA 2KQSA 2ZVNA 4IWPA 2KFKB 3V6EB 1OGWA 2D3GA 4WWPA 4FHJA 3W1SA 2MBBB 3KVFB 1WYWB 4KSLC 4LCDE 1WXVA 2L05A 1WGDA 2JRIB 4AOFA 4DK5A 5DPTA 2GBJA 2IYDB 3JSVB 2LD9A 1FXTB 3DVNU 4ZRJA 3DVNV 4MSMB 2C7MB 4BKGA 2JXXA 2ZJDA 1WGHA 3PV1A 4AUQC 4MEMA 2M17A 4GXBA 5KHOA 1UBQA 2HJ8A 1RFAA 2J7QB 3RCZA 2NBWB 4TKNA 3DVGY 2DENB 3VDZA 3VAWA 4XZ4A 2LZ6A 3WAPA 3Q3FA 4I6NB 4LJOB 2BKFA 4GIVA 4KZCA 4B6WA 2D10A 2WX0A 1YX5B 3WAMA 2ZNVC 2WYQA 3DCGA 3C0RB 5LXHA 1LFDA 3PRMB 1OEYJ 2BPSA 2IO2B 1TGZB 4FN2A 4JGHB 3QARA 4WJQA 3ZO5B 4DHZB 2MLBA 2C7NB 4DHZE 5EDSA 5D7GA 1P3QU 3WA0A 1GC7A 4MSQB 4I6LB 1H8CA 2LXAA 3WAOA 1UH6A 2FIDA 4W9EA 4GSWA 4MELA 4EFOA 1KM7A 4URKA 4KDLB 3A9KB 2MP2A 3LJ3A 3PT2B 1G6JA 1R4NI 1Q0WB 3DBSA 2BF8B 3T8MA 2N7EA 4WJPA 3M62B 4EEWA 1I35A 2KTRB 2PE9A 1UGMA 3ZKJC 4BBNC 2JZZA 2XK5A 3OJ4B 2CHZA 4HCNB 3K9PB 1TTNA 4OVUA 2LGXA 3HK0A 2CHXA 2O6VD 2ZPNA 2KDFB 4LDTB 5G2NA 1LM8B 5CTRC 2I1JA 1YX6B 3EC8A 3VH3B 1P9DU 2O6VA 4E3CA 1XD3B 3DBRI 5E6OA 3V62A 3PSEB 1Y8RC 1V86A 2OOBB 2WX1A 1E8XA 2C9WB 5FR6A 1WXMA 4MGZE 1EO6A 4ICVA 4W9HA 1WGRA 1P0RA 4ZRIA 2M0XA 2XK5B 2KLCA 1D3ZA 3JW0X 2IO0B 3MTNB 2FCSA 3ML9A 2KDEB 3QAQA 4NQKE 4GB9A 3R66C 2PE6B 3VUYA 3R7QA 2NPTA 1WR1A 1X1MA 2C60A 3CMMB 4M8MA 1OQYA 3PHWB 1V5TA 1K8RB 3QHTA 1WGGA 3B1LX 1PQSA 5AEKB 4ZDVA 2GBKA 2R2QA 2IY0B 3A9JA 4N9F4 2QHOA 4WAAA 1HE8A 2BGFA 3X0WA 1WE6A 2JF5A 2DYOA 3A1QA 5JH5C 3OLMD 2RSUA 4MGKE 4WWOA 1T0YA 2YLMA 4NJ6A 1UBIA 4AWJA 2BKRB 2RR9A 1GJZA 2KFKA 5TR5A 3ZTCA 5DCNA 1E8YA 1QZEA 4K7UA 3GOEA 3X23A 4WWNA 1Z2MA 2L3ZA 2FCQA 3TL5A 2ZEQA 2XBBC 2XEWA 3R7RA 2EMTA 2ZCBA 1LXDA 1V9JA 2KWVB 1UD7A 2CR5A 3M3JA 1SE9A 5AZFA 3ZRCA 2LVQA 2V1YA 3TIXA 2MBQA 4GGQA 2N1WA 3VUWA 2RGFA 2ZZPB 1V49A 2LUEA 4AP4C 3OAWA 2KX3A 1SGHA 2GMIC 4IW0A 3SDLC 3BINA 2WDTB 1WX9A 3SHQA 4IM3A 2FAZA 2VRRB 3L10B 2HD5B 2V4LA 4MGIE 4W9IA 2REXA 5DPRA 3U30A 3ZVVA 5J17A 1EUVB 2BYFA 2J0KA 2MA9B 3MHSD 3ML8A 5D94A 3ZDMC 2G4SA 1WJ6A 3RZFA 3IG3A 2NR2A 3L08A 3NHEB 4HCPB 2DZMA 3U8ZA 3U7DA 2JZ3B 2OJRA 1A5RA 4CYEA 4MH0E 1E90A 3H1UA 4PYZA 1EF1A 2DHZA 2KO3A 2LASA 3HM6X 2EKEC 4I6PA 2MBOA 3IVFA 1XQQA 4P7IA 1WI0A 3L54A 4TUUA 3A9KA 1WRDB 2JVCA 1WXSA 2NBUA 3A4SC 3CF6E 5G55A 1VCBA 1IP9A 3UF8A 4HDOA 1P1AA 2KTRA 3ONSA 4FADA 2D2QA 2AYOB 3HIZA 3APFA 3VUXA 2J0MA 1WX8A 4ZYNA 3N3KB 5LLIA 2LVPA 4KIKB 4DWFA 1R4MI 4ASWC 1GC6A 4KVGB 4ANUA 4NQLB 3H9DA 4CHKA 3KYDD 5HKHA 4MM3A 4W9FA 4FJZA 3VTVA 1IYFA 2LRUA 3NZUA 1L7YA 4BKTA 2K8CA 2PPHA 2BYEA 5BO4B 3EECA 4KDIC 2KJHB 2KWUB 2MW5A 2LXCA 3AXCA 2IO3B 2RPQA 3PVLA 3H7PB 3Q3JA 3ZIMA 4F7ZA 1KOTA 1JRUA 2KMAA 4HWIB 4KSKC 4HK2A 4ZRKA 4GDKA 2LWPA 2EMSA 3M63B 5E6PA 3PTFC 3WIMA 1E5WA 2A4ZA 4F1SA 4GU2A 3KYCD 3ENEA 5JHBA 2C7HA 4BKSD 4G0NB 5IA7A 1XT9B 2KC2A 4BOZB 2AEHA 3O65B 3UGBB 1MG8A 3QIJA 4X57B 2HE7A 4BKSA 4FBJB 2K6QA 2J0JA 1KJTA 2GBNA 1C3TA 4MJSB 3B08A 2ZNVB 2DAFA 2IY1B 2R2OA 1GUAB 1WM2A 4M8NA 4GDKB 3OJ3A 3JVZX 2K8HA 3GZNI 4KV2A 4MDKE 3V60A 3KUCB 3QA8A 1U4AA 2FNJB 3LDZE 2KHWB 2N7DA 4ICUA 3DOWA 4GOCA 4FULA 1E8ZA 1WR6E 2HTHA 3QC8B 4EZJA 4DHJD 4II3B 3UQBA 3DQVA 3QX1A 2K25A 4NAWB 2ASQA 3K9OB 3QJZA 1I42A 3UINB 2L0FA 3IHPC 1WX7A 2L76A 2KZRA 4HPLB 4TQ1A 3ZNID 1S1QB 3PRZA 5DPWA 4EZLA 1NBFC 3PRPB 4MGYE 2LGDA 4EOYA 1H4RA 1J8CA 2DYMA 2K39A 2RD0A 1S3SG 1V81A 4W9KA 4IWQA 3PLVA 2JT4B 3DVGX 2O2VB 2MBEA 2KK8A 1WF9A 2KD0A 4W9JA 1WMHB 3PLUA 1IPGA 2M8SA 3CSFA 3ZNHB 3ZRFA 2KMCA 2NVUI 4FLHA 4WQOB 2UYZB 2CU1A 5CHFA 2V3SA 2LJ5A 2A5UA 3L13A 3VXWA 1E8WA 2AWTA 3ZNZB 4XX5A 4RM8A 2L8JA 3ZNGC 1J19A 4JL9A 1GG3A 4IM0A 2IO1B 2BYVE 3N30A 5J2RA 2MCNB 4IUMB 4IC7B 4WJOA 1WJNA 3EHVA 2DAJA 2N9PC 4K1RB 2NCNA 4RMAA 3TBLD 4EZKA 1RLFA 2KJ6A 3NY5A 2MWSB 4KIKA 4EUTA 3QQ8B 4JQWC 2B3AA 2Z0EB 4JIOU 1WY8A 1ZKHA 2MQJA 3A33B 3TJPA 1E7VA 2Z59B 4KZ0A 3NOBA 4ANXA 1LQBA 4NPNA 1UELA 1YQBA 2KANA 2KFJA 4F8CB 3BY4B 3WALA 2KNBA 2N9XA 2FIFA 4HVBA 3V6CB 3MJWA 4RM9A 4HLEA 1CMXB 3PZDA 5CX3A 1M94A 2W9NA 4BFRA 3IFWB 3H7PA 1WXAA 1V2YA 1WJUA 2G4DB 3RT3B 3VVWB 1YD8U 4LDTD 4GDLB 4FA6A 1WGYA 2GOWA 5L95C 1V80A 4K81A 1Q1OA 3HHMA 5DPSA 2MBHA 4PYUA 3NZSA 2DX5B 4DBGA 2DZIA 5LXIB 3DDCB 4J6IA 4PS7A 3APCA 4OVVA 1WJ4A 3AI5A 4W9CA 4M0WB 3ZW3A 4CO7A 2CS4A 2LI5A 5AZGA 3IBEA 4W9GA 5E6NA 3UIOB 2ZVOA 1WE7A 3DBLI 3EFUA 2JRHA 5D2MB 2CHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C5L C;  2M1M A;  3UIP B;  4HXD A;  4A3O A;  1J0G A;  1E7U A;  3R3M A;  2D07 B;  3HM3 A;  4PS3 A;  4MJS A;  1NDD A;  1Q5W B;  2JPH A;  4XC2 A;  2KLG A;  3N32 A;  2K6D B;  1YIW A;  4PS8 A;  1WM3 A;  1AAR A;  2N1V A;  1TBE A;  4A3P A;  3ZLZ A;  2KOX A;  5JZE B;  2DYB A;  2ZCC A;  2N9E B;  4IM2 A;  5C23 A;  4B95 A;  2DZK A;  2CKH B;  4FJY A;  1OEY A;  4G50 A;  4NAW A;  3KH0 A;  1UZX B;  2JY6 A;  3VHT C;  1C1Y B;  3VTU A;  4A20 A;  4B9K A;  4DDG D;  4K7W A;  4HDQ A;  4TV3 A;  3RYT A;  5GMV A;  2K1F A;  2IZV B;  3V61 A;  1L2N A;  4DDI D;  4II2 B;  3L16 A;  3H6N A;  4DXA B;  3PHX B;  2KDI A;  3RD2 A;  3KUD B;  3W1Y A;  2JUO A;  5CHV C;  3CST A;  2FUH B;  3B0A A;  5D6J B;  3VQI A;  2GBM A;  3RZW C;  2LRW A;  4TQ0 A;  3ECI A;  3VH4 B;  4NJ7 A;  3ZDT A;  2O2V A;  2NS5 A;  1F9J A;  4JLC A;  1WMH A;  2YVC A;  3QCA A;  3QWZ B;  4YL8 A;  2KTF A;  2LVO A;  3D32 A;  3PS6 A;  2M4N A;  4W9L A;  2MP2 B;  4GN1 A;  2ZPY A;  2L0T A;  3TCA A;  3SU8 X;  3AU5 A;  4ANW A;  3I3T B;  3JYU A;  3S2A A;  3M95 A;  3WAN A;  5L83 A;  2FCM A;  3ALB A;  5IAA C;  2JWZ A;  3AU4 A;  2KDB A;  1BT0 A;  1ISN A;  2KC1 A;  2KJR A;  2KQ7 A;  4AJY B;  1YJ1 A;  2FCN A;  4ANV A;  2MSE D;  3QK0 A;  3DPD A;  2PJH A;  4E74 A;  2NBV B;  3A4R A;  5JHA A;  3PGE A;  4BOS C;  2UWQ A;  3P2B A;  4BBN F;  4IG7 B;  3SD5 A;  2O6V B;  1Z5S B;  2N4F A;  5C1Z A;  1P98 A;  1OTR B;  1WIA A;  1TZ1 A;  4HPM B;  2K8B A;  4LJP B;  4NNJ B;  1WFY A;  2D11 A;  2AL3 A;  3AUL A;  3ZUN A;  3L17 A;  3ZTD A;  4AJW A;  4BVU C;  2GBR A;  3L0W B;  4EKU A;  3PRE A;  5CHW A;  1WH3 A;  2AL6 A;  4IWO A;  4G11 A;  1VD2 A;  2IBI B;  1GNU A;  2BWE S;  3RUL A;  2KVR A;  3T9L A;  3DBH I;  3APD A;  2WWZ A;  5J18 A;  1RRB A;  3TMP B;  1WZ0 A;  2PEA A;  2MRP A;  3KW5 B;  1WZ3 A;  5AZH A;  1RAX A;  4FJV B;  3H7S A;  3UQA A;  2KN5 A;  3VFK A;  1ZW7 A;  2NPT B;  2I1K A;  2Z0D B;  4GDL A;  2Y5B B;  3KUZ A;  3JSV A;  1V5O A;  2MX2 A;  2BWF A;  4FHK A;  2LGY A;  2G3Q B;  3NS8 A;  2KX0 A;  1EF5 A;  2L7R A;  2KWC A;  3A9J B;  4G3X B;  4E71 A;  4K7S A;  4NY0 A;  1KLV A;  2L00 B;  3RUI B;  4HJK A;  4DHJ B;  1NI2 A;  2KKC A;  4WJN A;  1V6E A;  5KHQ A;  3VTW A;  3A1Q B;  1SIF A;  4W9D A;  3PPA A;  2KXJ A;  4GMV A;  3W1S C;  1ZGU B;  2G45 B;  2DZJ A;  2KQS A;  2ZVN A;  4IWP A;  2KFK B;  3V6E B;  1OGW A;  2D3G A;  4WWP A;  4FHJ A;  3W1S A;  2MBB B;  3KVF B;  1WYW B;  4KSL C;  4LCD E;  1WXV A;  2L05 A;  1WGD A;  2JRI B;  4AOF A;  4DK5 A;  5DPT A;  2GBJ A;  2IYD B;  3JSV B;  2LD9 A;  1FXT B;  3DVN U;  4ZRJ A;  3DVN V;  4MSM B;  2C7M B;  4BKG A;  2JXX A;  2ZJD A;  1WGH A;  3PV1 A;  4AUQ C;  4MEM A;  2M17 A;  4GXB A;  5KHO A;  1UBQ A;  2HJ8 A;  1RFA A;  2J7Q B;  3RCZ A;  2NBW B;  4TKN A;  3DVG Y;  2DEN B;  3VDZ A;  3VAW A;  4XZ4 A;  2LZ6 A;  3WAP A;  3Q3F A;  4I6N B;  4LJO B;  2BKF A;  4GIV A;  4KZC A;  4B6W A;  2D10 A;  2WX0 A;  1YX5 B;  3WAM A;  2ZNV C;  2WYQ A;  3DCG A;  3C0R B;  5LXH A;  1LFD A;  3PRM B;  1OEY J;  2BPS A;  2IO2 B;  1TGZ B;  4FN2 A;  4JGH B;  3QAR A;  4WJQ A;  3ZO5 B;  4DHZ B;  2MLB A;  2C7N B;  4DHZ E;  5EDS A;  5D7G A;  1P3Q U;  3WA0 A;  1GC7 A;  4MSQ B;  4I6L B;  1H8C A;  2LXA A;  3WAO A;  1UH6 A;  2FID A;  4W9E A;  4GSW A;  4MEL A;  4EFO A;  1KM7 A;  4URK A;  4KDL B;  3A9K B;  2MP2 A;  3LJ3 A;  3PT2 B;  1G6J A;  1R4N I;  1Q0W B;  3DBS A;  2BF8 B;  3T8M A;  2N7E A;  4WJP A;  3M62 B;  4EEW A;  1I35 A;  2KTR B;  2PE9 A;  1UGM A;  3ZKJ C;  4BBN C;  2JZZ A;  2XK5 A;  3OJ4 B;  2CHZ A;  4HCN B;  3K9P B;  1TTN A;  4OVU A;  2LGX A;  3HK0 A;  2CHX A;  2O6V D;  2ZPN A;  2KDF B;  4LDT B;  5G2N A;  1LM8 B;  5CTR C;  2I1J A;  1YX6 B;  3EC8 A;  3VH3 B;  1P9D U;  2O6V A;  4E3C A;  1XD3 B;  3DBR I;  5E6O A;  3V62 A;  3PSE B;  1Y8R C;  1V86 A;  2OOB B;  2WX1 A;  1E8X A;  2C9W B;  5FR6 A;  1WXM A;  4MGZ E;  1EO6 A;  4ICV A;  4W9H A;  1WGR A;  1P0R A;  4ZRI A;  2M0X A;  2XK5 B;  2KLC A;  1D3Z A;  3JW0 X;  2IO0 B;  3MTN B;  2FCS A;  3ML9 A;  2KDE B;  3QAQ A;  4NQK E;  4GB9 A;  3R66 C;  2PE6 B;  3VUY A;  3R7Q A;  2NPT A;  1WR1 A;  1X1M A;  2C60 A;  3CMM B;  4M8M A;  1OQY A;  3PHW B;  1V5T A;  1K8R B;  3QHT A;  1WGG A;  3B1L X;  1PQS A;  5AEK B;  4ZDV A;  2GBK A;  2R2Q A;  2IY0 B;  3A9J A;  4N9F 4;  2QHO A;  4WAA A;  1HE8 A;  2BGF A;  3X0W A;  1WE6 A;  2JF5 A;  2DYO A;  3A1Q A;  5JH5 C;  3OLM D;  2RSU A;  4MGK E;  4WWO A;  1T0Y A;  2YLM A;  4NJ6 A;  1UBI A;  4AWJ A;  2BKR B;  2RR9 A;  1GJZ A;  2KFK A;  5TR5 A;  3ZTC A;  5DCN A;  1E8Y A;  1QZE A;  4K7U A;  3GOE A;  3X23 A;  4WWN A;  1Z2M A;  2L3Z A;  2FCQ A;  3TL5 A;  2ZEQ A;  2XBB C;  2XEW A;  3R7R A;  2EMT A;  2ZCB A;  1LXD A;  1V9J A;  2KWV B;  1UD7 A;  2CR5 A;  3M3J A;  1SE9 A;  5AZF A;  3ZRC A;  2LVQ A;  2V1Y A;  3TIX A;  2MBQ A;  4GGQ A;  2N1W A;  3VUW A;  2RGF A;  2ZZP B;  1V49 A;  2LUE A;  4AP4 C;  3OAW A;  2KX3 A;  1SGH A;  2GMI C;  4IW0 A;  3SDL C;  3BIN A;  2WDT B;  1WX9 A;  3SHQ A;  4IM3 A;  2FAZ A;  2VRR B;  3L10 B;  2HD5 B;  2V4L A;  4MGI E;  4W9I A;  2REX A;  5DPR A;  3U30 A;  3ZVV A;  5J17 A;  1EUV B;  2BYF A;  2J0K A;  2MA9 B;  3MHS D;  3ML8 A;  5D94 A;  3ZDM C;  2G4S A;  1WJ6 A;  3RZF A;  3IG3 A;  2NR2 A;  3L08 A;  3NHE B;  4HCP B;  2DZM A;  3U8Z A;  3U7D A;  2JZ3 B;  2OJR A;  1A5R A;  4CYE A;  4MH0 E;  1E90 A;  3H1U A;  4PYZ A;  1EF1 A;  2DHZ A;  2KO3 A;  2LAS A;  3HM6 X;  2EKE C;  4I6P A;  2MBO A;  3IVF A;  1XQQ A;  4P7I A;  1WI0 A;  3L54 A;  4TUU A;  3A9K A;  1WRD B;  2JVC A;  1WXS A;  2NBU A;  3A4S C;  3CF6 E;  5G55 A;  1VCB A;  1IP9 A;  3UF8 A;  4HDO A;  1P1A A;  2KTR A;  3ONS A;  4FAD A;  2D2Q A;  2AYO B;  3HIZ A;  3APF A;  3VUX A;  2J0M A;  1WX8 A;  4ZYN A;  3N3K B;  5LLI A;  2LVP A;  4KIK B;  4DWF A;  1R4M I;  4ASW C;  1GC6 A;  4KVG B;  4ANU A;  4NQL B;  3H9D A;  4CHK A;  3KYD D;  5HKH A;  4MM3 A;  4W9F A;  4FJZ A;  3VTV A;  1IYF A;  2LRU A;  3NZU A;  1L7Y A;  4BKT A;  2K8C A;  2PPH A;  2BYE A;  5BO4 B;  3EEC A;  4KDI C;  2KJH B;  2KWU B;  2MW5 A;  2LXC A;  3AXC A;  2IO3 B;  2RPQ A;  3PVL A;  3H7P B;  3Q3J A;  3ZIM A;  4F7Z A;  1KOT A;  1JRU A;  2KMA A;  4HWI B;  4KSK C;  4HK2 A;  4ZRK A;  4GDK A;  2LWP A;  2EMS A;  3M63 B;  5E6P A;  3PTF C;  3WIM A;  1E5W A;  2A4Z A;  4F1S A;  4GU2 A;  3KYC D;  3ENE A;  5JHB A;  2C7H A;  4BKS D;  4G0N B;  5IA7 A;  1XT9 B;  2KC2 A;  4BOZ B;  2AEH A;  3O65 B;  3UGB B;  1MG8 A;  3QIJ A;  4X57 B;  2HE7 A;  4BKS A;  4FBJ B;  2K6Q A;  2J0J A;  1KJT A;  2GBN A;  1C3T A;  4MJS B;  3B08 A;  2ZNV B;  2DAF A;  2IY1 B;  2R2O A;  1GUA B;  1WM2 A;  4M8N A;  4GDK B;  3OJ3 A;  3JVZ X;  2K8H A;  3GZN I;  4KV2 A;  4MDK E;  3V60 A;  3KUC B;  3QA8 A;  1U4A A;  2FNJ B;  3LDZ E;  2KHW B;  2N7D A;  4ICU A;  3DOW A;  4GOC A;  4FUL A;  1E8Z A;  1WR6 E;  2HTH A;  3QC8 B;  4EZJ A;  4DHJ D;  4II3 B;  3UQB A;  3DQV A;  3QX1 A;  2K25 A;  4NAW B;  2ASQ A;  3K9O B;  3QJZ A;  1I42 A;  3UIN B;  2L0F A;  3IHP C;  1WX7 A;  2L76 A;  2KZR A;  4HPL B;  4TQ1 A;  3ZNI D;  1S1Q B;  3PRZ A;  5DPW A;  4EZL A;  1NBF C;  3PRP B;  4MGY E;  2LGD A;  4EOY A;  1H4R A;  1J8C A;  2DYM A;  2K39 A;  2RD0 A;  1S3S G;  1V81 A;  4W9K A;  4IWQ A;  3PLV A;  2JT4 B;  3DVG X;  2O2V B;  2MBE A;  2KK8 A;  1WF9 A;  2KD0 A;  4W9J A;  1WMH B;  3PLU A;  1IPG A;  2M8S A;  3CSF A;  3ZNH B;  3ZRF A;  2KMC A;  2NVU I;  4FLH A;  4WQO B;  2UYZ B;  2CU1 A;  5CHF A;  2V3S A;  2LJ5 A;  2A5U A;  3L13 A;  3VXW A;  1E8W A;  2AWT A;  3ZNZ B;  4XX5 A;  4RM8 A;  2L8J A;  3ZNG C;  1J19 A;  4JL9 A;  1GG3 A;  4IM0 A;  2IO1 B;  2BYV E;  3N30 A;  5J2R A;  2MCN B;  4IUM B;  4IC7 B;  4WJO A;  1WJN A;  3EHV A;  2DAJ A;  2N9P C;  4K1R B;  2NCN A;  4RMA A;  3TBL D;  4EZK A;  1RLF A;  2KJ6 A;  3NY5 A;  2MWS B;  4KIK A;  4EUT A;  3QQ8 B;  4JQW C;  2B3A A;  2Z0E B;  4JIO U;  1WY8 A;  1ZKH A;  2MQJ A;  3A33 B;  3TJP A;  1E7V A;  2Z59 B;  4KZ0 A;  3NOB A;  4ANX A;  1LQB A;  4NPN A;  1UEL A;  1YQB A;  2KAN A;  2KFJ A;  4F8C B;  3BY4 B;  3WAL A;  2KNB A;  2N9X A;  2FIF A;  4HVB A;  3V6C B;  3MJW A;  4RM9 A;  4HLE A;  1CMX B;  3PZD A;  5CX3 A;  1M94 A;  2W9N A;  4BFR A;  3IFW B;  3H7P A;  1WXA A;  1V2Y A;  1WJU A;  2G4D B;  3RT3 B;  3VVW B;  1YD8 U;  4LDT D;  4GDL B;  4FA6 A;  1WGY A;  2GOW A;  5L95 C;  1V80 A;  4K81 A;  1Q1O A;  3HHM A;  5DPS A;  2MBH A;  4PYU A;  3NZS A;  2DX5 B;  4DBG A;  2DZI A;  5LXI B;  3DDC B;  4J6I A;  4PS7 A;  3APC A;  4OVV A;  1WJ4 A;  3AI5 A;  4W9C A;  4M0W B;  3ZW3 A;  4CO7 A;  2CS4 A;  2LI5 A;  5AZG A;  3IBE A;  4W9G A;  5E6N A;  3UIO B;  2ZVO A;  1WE7 A;  3DBL I;  3EFU A;  2JRH A;  5D2M B;  2CHW A; 
#chains in the Genus database with same CATH topology
 1FPY A;  4A3O A;  1DOI A;  1EWY C;  2L52 A;  3HM3 A;  1NDD A;  3Q3N C;  2JPH A;  4YSY B;  3N32 A;  2ONQ A;  3C8Y A;  3RNC C;  4IM2 A;  2DZK A;  2QIE B;  4G50 A;  1OEY A;  4A20 A;  2LUM A;  1UZX B;  1C1Y B;  4K7W A;  4OVZ A;  4TV3 A;  2WXM A;  1FFU A;  1NI3 A;  2BVC A;  4DDI D;  1DOX A;  2QC8 A;  3NG0 A;  3W1Y A;  3R8B A;  5CHV C;  5D6J B;  4XDD A;  3RZW C;  2LRW A;  4ITK A;  3Q8C A;  4JLC A;  3QCA A;  1FD6 A;  2KDM A;  2KTF A;  3DBH B;  2MP2 B;  2L0T A;  3TCA A;  3AU5 A;  4ANW A;  3WAN A;  2FCM A;  3AU4 A;  2WXL A;  1C9F A;  1BT0 A;  4ANV A;  2IPK D;  1RM6 C;  2NBV B;  3A4R A;  2YEP F;  4IDI A;  3SD5 A;  1V8C A;  1I4H A;  1XO3 A;  1Z5S B;  3MHZ A;  1OTR B;  1AWD A;  1TZ1 A;  3ZUN A;  1WFY A;  3LYY A;  4AJW A;  1J7A A;  2QEJ C;  3RNF C;  1L0X B;  1E10 A;  3PRE A;  1D5Z C;  2AL6 A;  1VD2 A;  4ZHP A;  2KVR A;  3APD A;  5J18 A;  1RRB A;  3ETR A;  1WZ0 A;  3MP9 A;  4MAC A;  3KW5 B;  1WZ3 A;  5AZH A;  4FJV B;  2KN5 A;  1ZW7 A;  1TY0 A;  3KUZ A;  2MX2 A;  4H2A A;  3IT4 B;  1YNT E;  2LGY A;  2G3Q B;  3NS8 A;  1KLV A;  4K7S A;  2L00 B;  1NI2 A;  5KHQ A;  1GPX A;  4XWW A;  2DZJ A;  2KQS A;  3AB5 A;  1AN8 A;  2WXQ A;  4IKG A;  3W1S A;  3KVF B;  2AQ3 B;  4LNK A;  4AOF A;  1WGD A;  5I4D A;  2GBJ A;  2V3P A;  3JSV B;  2LD9 A;  3T3N A;  4L2Y A;  3DVN V;  3SFE B;  4XWT A;  2JXX A;  1WGH A;  2EKI A;  1R4N B;  1VZ6 A;  2Y5C A;  4WH4 A;  2DEN B;  3BZD B;  4M02 A;  4XZ4 A;  1B9R A;  4B6W A;  1YX5 B;  1V97 A;  2WYQ A;  3DCG A;  2M19 A;  5LXH A;  1LFD A;  1OEY J;  3DHH C;  1WXQ A;  2WLB A;  1SEB D;  1YJI A;  3DBR B;  1I7H A;  2C7N B;  4RGO S;  1P3Q U;  4S0R A;  4MSQ B;  3BVZ A;  3RPF C;  4EFO A;  1B1Z A;  2FBW B;  1G6J A;  3FIL B;  4XGA B;  2D3C A;  2JZZ A;  2XK5 A;  4C56 C;  5BYR A;  5E6J A;  2LGX A;  1JCK B;  1C4A A;  1P7E A;  1LM8 B;  1I4P A;  2G9H D;  1OQQ A;  2WXP A;  2WX1 A;  3U52 E;  1E8X A;  2C9W B;  3MC8 A;  2VZK D;  1WXM A;  3C19 A;  2WHI A;  1A70 A;  4HKQ A;  1QOA A;  2LEK A;  3R66 C;  2WNM A;  5EE3 A;  3R7Q A;  2NPT A;  2D3A A;  1V5T A;  1WRI A;  1SB3 C;  2GBK A;  2R2Q A;  1WE6 A;  2AQ2 B;  2EEL A;  2JF5 A;  3A1Q A;  4S17 A;  3KWV A;  1IBX A;  3BII D;  4WWO A;  4JWU C;  2BKR B;  2RR9 A;  5DCN A;  1E7P B;  1C76 A;  2M56 B;  2ZEQ A;  1EU3 A;  2XEW A;  4L23 A;  2E3T A;  3R7R A;  2EMT A;  1FRD A;  1LXD A;  1V9J A;  2KWV B;  3M3J A;  2CR5 A;  3ZRC A;  2V1Y A;  2RGF A;  2LUE A;  2KT7 A;  3OAW A;  1L0V B;  2JYT A;  2GMI C;  2WDT B;  1WX9 A;  4IM3 A;  1D5M C;  4WIP A;  2HD5 B;  2V4L A;  2W3R A;  4YT0 B;  3MHS D;  4UDU C;  3Q8B A;  3URY A;  1J7C A;  1A5R A;  1SE4 A;  3H1U A;  5HG2 A;  4PYZ A;  4I6P A;  2EKE C;  1TS3 A;  4AS1 A;  3A9K A;  4USA A;  1VCB A;  2R61 A;  1IP9 A;  2HTM E;  4ARI A;  3VUX A;  2KN4 A;  3HIZ A;  4ZYN A;  5LLI A;  5FKA C;  3B9J A;  3AEA B;  4DWF A;  4ASW C;  3H9D A;  3KYD D;  2JQR B;  3NZU A;  4N59 A;  2BYE A;  5BO4 B;  3EEC A;  1FIQ A;  3AXC A;  3H7P B;  1JRU A;  1UNS A;  3M63 B;  1XLQ A;  1MJD A;  4N6E B;  1E5W A;  5H92 C;  3GB1 A;  3TEY A;  4YSZ B;  1HTO A;  3ZJT A;  2J52 A;  1D5X C;  4BOZ B;  3O65 B;  3HVZ A;  4X57 B;  5BMG A;  3RNA C;  1GUA B;  4M8N A;  4GDK B;  3RN9 C;  1VZ8 A;  1YQ4 B;  1UUP A;  3NJT A;  3QA8 A;  1U4A A;  4HRS A;  3EGR A;  4ICU A;  3DOW A;  4FUL A;  4EZJ A;  3DQV A;  3QJZ A;  3UIN B;  3IHP C;  4HPL B;  1D4B A;  1DGJ A;  3ZNI D;  3EUB 2;  3PRZ A;  1FNV A;  4MGY E;  4EOY A;  2WS3 B;  2RD0 A;  3PLV A;  2KD0 A;  4BZA A;  2N7J A;  1F2R I;  3U7Z A;  4KGR A;  5CHF A;  2L1A A;  3KWL A;  3BYT B;  3PZ7 A;  2KAJ A;  1I4G A;  1N6Z A;  3ZYY X;  4IUM B;  3RMK C;  3EHV A;  2NCN A;  3DBL B;  5H8Y E;  5T8I A;  3E56 A;  2Z0E B;  4JIO U;  2MQJ A;  3Q8E A;  4P6V F;  1LO5 D;  3NOB A;  2JYE A;  4NPN A;  1YQB A;  1CQV A;  5BYS A;  1EM7 A;  2WXR A;  3WAL A;  2J4X A;  2FIF A;  4HVB A;  1CMX B;  1KTK A;  3PZD A;  2W9N A;  2DNF A;  4AQ7 A;  3VVW B;  1YD8 U;  4FA6 A;  4K81 A;  3HHM A;  4PYU A;  3NZS A;  4CQN A;  4J6I A;  3AI5 A;  4KGS A;  1C4C A;  1WE7 A;  2N0S B;  3EFU A;  2M1M A;  3UIP B;  2I38 A;  1E7U A;  1P7F A;  1R7S A;  2D07 B;  3AMZ A;  4OZA A;  3KLS X;  4TMA B;  3W2D A;  2V4I B;  1TS2 A;  1T0S C;  2WXI A;  2IGH A;  5JZE B;  2N9E B;  2CKH B;  4NAW A;  2JY6 A;  1GAQ B;  4HDQ A;  2WXJ A;  3AE6 B;  5FK9 C;  1XF5 L;  4II2 B;  3HVD A;  2WP9 B;  3ZXV A;  3KUD B;  2MEK A;  3CST A;  3B0A A;  2D3B A;  3GP7 A;  2PVG C;  4NJ7 A;  2O2V A;  2NS5 A;  1WMH A;  1EWC A;  1SJE D;  2INP E;  4OZB A;  4GN1 A;  2WXK A;  2WXF A;  2ZPY A;  3AE1 B;  1KLU D;  5L83 A;  3ALB A;  2JWZ A;  2FCN A;  4P16 A;  3QK0 A;  3PGE A;  4BOS C;  2UWQ A;  4IG7 B;  2N4F A;  3P1M A;  5C1Z A;  4HPM B;  2K8B A;  4NNJ B;  2AL3 A;  3ZTD A;  2GBR A;  4EKU A;  1XEE A;  4HKZ E;  5CHW A;  1WH3 A;  4IWO A;  2IBI B;  1QT9 A;  1GNU A;  3RUL A;  3T9L A;  1JQ4 A;  3DBH I;  2PEA A;  2MRP A;  1RAX A;  2NPT B;  2I1K A;  2Z0D B;  1GOZ A;  1T5X D;  4FHK A;  4E71 A;  2KX0 A;  4G3X B;  4HJK A;  4DHJ B;  4ZYS A;  2KKC A;  4WJN A;  1C77 A;  2ON8 A;  3A1Q B;  3VTW A;  2WXN A;  1IBX B;  3PPA A;  2OED A;  2ZVN A;  2D3G A;  4FHJ A;  4LCD E;  4KSL C;  1C79 A;  2L05 A;  2JRI B;  4A90 A;  1NEN B;  4C7Z A;  4ZOH C;  1L6U A;  3P42 A;  4M00 A;  4MSM B;  2C7M B;  4MEM A;  2M17 A;  4GXB A;  1PYW D;  3WAP A;  3Q3F A;  4LJO B;  2BKF A;  4GIV A;  1XXG A;  2JU6 X;  4YTM B;  1KLG D;  2ZNV C;  3AE2 B;  5IKC M;  2BPS A;  2IO2 B;  5IO9 A;  4FN2 A;  5D3I B;  1JRO A;  3SEB A;  3ZO5 B;  4DHZ B;  4DHZ E;  3BVG A;  3AED B;  2GLS A;  2LGI A;  4YTN B;  4I6L B;  2ICI A;  1KM7 A;  4KDL B;  3A9K B;  1ACC A;  3NRZ A;  2K3U A;  1R4N I;  3DBS A;  3NVW A;  2BF8 B;  3FKY A;  3T8M A;  1I35 A;  3ZKJ C;  4HCN B;  3K9P B;  4OVU A;  2BB6 A;  2CHX A;  2KDF B;  5CTR C;  1F0Z A;  1TKY A;  3VH3 B;  2DLB A;  3RNE C;  2O6V A;  2CJO A;  3DBR I;  3V62 A;  1BUI C;  1V86 A;  3TEX A;  1JWU D;  3R2I A;  1OFF A;  1WGR A;  1MI0 A;  2M0X A;  5BMI A;  2KLC A;  2Q5W D;  3JW0 X;  4OW0 A;  2FCS A;  1RYJ A;  3QAQ A;  1FFV A;  1SSN A;  3MJ5 A;  2PE6 B;  3VUY A;  5IOI A;  4QAY A;  1WR1 A;  4M8M A;  3PHW B;  4P1C C;  1K8R B;  2NMQ A;  1PQS A;  2UU7 A;  3WCQ A;  2QHO A;  4HEA 1;  4MT5 A;  3I57 A;  3X0W A;  5EE0 A;  1QOF A;  2DYO A;  5JH5 C;  3OLM D;  2G1E A;  1UBI A;  2KFK A;  1E8Y A;  1ET6 A;  4WWN A;  1Q10 A;  1F77 A;  3OWE B;  2XBB C;  1T6B X;  4XYC A;  2ZCB A;  2D5G A;  1NYR A;  2LVQ A;  1QOB A;  2ZZP B;  4WUR A;  2Y5P A;  3NS1 A;  2KX3 A;  1QOG A;  3BIN A;  3AEF B;  2BQQ A;  2K22 A;  4M01 A;  5DPR A;  4W9I A;  3U30 A;  1JML A;  5J17 A;  1EUV B;  1R4M B;  3ZDM C;  3RZF A;  3L08 A;  2NR2 A;  4IOI E;  4HCP B;  3FC4 A;  4MH0 E;  1HEZ E;  4LNI A;  4US9 A;  2DHZ A;  2KO3 A;  3HM6 X;  2MBO A;  3IVF A;  3L54 A;  4TUU A;  1FNW A;  1WXS A;  2NBU A;  4KKJ A;  3UF8 A;  3N1Y C;  2D2Q A;  2MJE A;  3RNG C;  1IGC A;  2LHD A;  1GC6 A;  4KVG B;  2WDR B;  5HKH A;  1E0Z A;  4MM3 A;  1T3Q A;  1IYF A;  2LRU A;  2K8C A;  2PPH A;  4KDI C;  3Q3J A;  3ZIM A;  2IO3 B;  3GZN B;  3EFC A;  1KOT A;  2KMA A;  1ZPS A;  4HWI B;  1YN4 A;  4ZRK A;  5E6P A;  3WIM A;  1HTQ A;  5JHB A;  3IAS 1;  3W5U B;  4NJC A;  2ZW0 A;  5IA7 A;  3MC0 B;  1C4P A;  3UGB B;  4BKS A;  1KJT A;  2VH1 A;  2ZNV B;  2DAF A;  1V1P A;  2H89 B;  2R2O A;  3HUI A;  4ACF A;  1ENF A;  4KV2 A;  2FNJ B;  1JW9 D;  2N7D A;  5IN7 A;  1WR6 E;  1F52 A;  3UQB A;  3Q6B A;  4RFB A;  4NAW B;  2ASQ A;  3K9O B;  2L0F A;  3DWM A;  2VH2 A;  2L76 A;  3CIR B;  1BML C;  3IXS A;  5DPW A;  1SF0 A;  3AEC B;  2OJW A;  1H4R A;  1J8C A;  2DYM A;  4RGT A;  2W3S A;  1S3S G;  4W9K A;  2O2V B;  1YOV B;  3BK2 A;  1WF9 A;  1WMH B;  3AN1 A;  1J7B A;  2M8S A;  3CSF A;  1Y56 A;  3PO0 A;  2KMC A;  3Q3O C;  1L6V A;  4WQO B;  4FLH A;  2V3S A;  2BS4 B;  2A5U A;  2LMC A;  3L13 A;  4DQO C;  1E6E B;  2AWT A;  3ZNZ B;  4RM8 A;  4K3C A;  1JRP A;  1GB1 A;  4WWM A;  3DWG C;  1HA5 A;  4RH6 A;  1J19 A;  1GG3 A;  1AW7 A;  1IUE A;  5J2R A;  1JWM D;  2INN E;  5EE9 A;  1WWT A;  3TBL D;  3ZQ4 A;  4KIK A;  2MWS B;  2B3A A;  1WY8 A;  1F1H A;  4C7Y A;  4KZ0 A;  1UEL A;  2KAN A;  1VLB A;  3V6C B;  5CX3 A;  1M94 A;  2KAC A;  1V2Y A;  2G4D B;  1WGY A;  1QIL A;  1Q1O A;  4HPP A;  2MBH A;  3P63 A;  2DZI A;  5LXI B;  1N61 A;  3DDC B;  4PS7 A;  3APC A;  4OVV A;  1KRH A;  4W9C A;  4W9G A;  5G5H A;  3UIO B;  1XCQ L;  3DBL I;  2JRH A;  4YSX B;  3RNB C;  4HXD A;  1N62 A;  1J0G A;  3R3M A;  4PS3 A;  1F2R C;  4MJS A;  2K0P A;  4NAM A;  3AH7 A;  2K6D B;  1YIW A;  4A8X C;  1WM3 A;  2N1V A;  3AEB B;  1TBE A;  4PK1 A;  5C23 A;  4B95 A;  4B9K A;  3VHT C;  3RYT A;  5GMV A;  2K1F A;  2IZV B;  3V61 A;  1L2N A;  2PTL A;  3H6N A;  3L16 A;  3BYY B;  3PHX B;  2KDI A;  3PZ8 A;  3RD2 A;  1QQR A;  2FUH B;  3VQI A;  3ECI A;  2IGG A;  3FAH A;  1F9J A;  1TZO A;  2YVC A;  3QWZ B;  2LVO A;  3PS6 A;  1FM0 D;  3SU8 X;  3I3T B;  3M95 A;  5BYQ A;  1TY2 A;  2KDB A;  2KC1 A;  1ISN A;  2KQ7 A;  4AJY B;  4ZHO A;  2MSE D;  2PLP A;  3AEG B;  3P2B A;  2O6V B;  2BS2 B;  2KVZ A;  3W9C B;  2HJ1 A;  3L17 A;  4RGM A;  3LB8 C;  1KH0 A;  2JX5 A;  2WXH A;  4G11 A;  4YWG G;  2BWE S;  1ZOY B;  2WWZ A;  3Q3M C;  1GB4 A;  4NZL B;  4LK0 M;  1PGX A;  2Y5B B;  3JSV A;  1JWS D;  1V5O A;  1FXI A;  1YMH E;  4N58 A;  4B0E A;  1EF5 A;  2IND C;  2KWC A;  4NY0 A;  4M0W A;  1ET9 A;  3RUI B;  3TUO A;  1SIF A;  4W9D A;  4GMV A;  3IAM 1;  1HZ6 A;  4PT5 A;  2KFK B;  3O13 A;  3V6E B;  3Q2A C;  4WWP A;  5JXV A;  2MBB B;  1WYW B;  4REZ A;  5FR3 A;  2BB5 A;  3N1Z C;  1ZDX A;  4KKI A;  4AUQ C;  1MHX A;  1VJK A;  3AE7 B;  2HJ8 A;  3RCZ A;  4TKN A;  3DVG Y;  4R3D A;  1STE A;  4I6N B;  1KF6 B;  1UWX A;  3PRM B;  3J9C A;  1TGZ B;  1SE3 A;  1N5W A;  4JGH B;  2MLB A;  5EDS A;  1GC7 A;  2LXA A;  1UH6 A;  2FID A;  4W9E A;  1I4R A;  4GSW A;  5HI1 A;  3PT2 B;  3AV8 A;  2WU2 B;  2L83 A;  1UGM A;  4BBN C;  3OJ4 B;  2CHZ A;  4B0M A;  1CK1 A;  3P4S B;  5D3D A;  2O6V D;  4LDT B;  1PUT A;  3TEZ A;  5GXG B;  1QKZ A;  3EC8 A;  1WYG A;  4E3C A;  1XD3 B;  3B2G A;  2BW2 A;  1Y8R C;  4MM3 B;  1NYQ A;  1EO6 A;  4ICV A;  4W9H A;  5IP4 D;  4TSS A;  1P0R A;  4ZRI A;  2XK5 B;  1D3Z A;  3ML9 A;  3W5V B;  2KDE B;  1SXT A;  2GI9 A;  4GB9 A;  1YN3 A;  1X1M A;  1OQY A;  1MG4 A;  3B1L X;  3A9J A;  4WAA A;  1HE8 A;  2BGF A;  2PMV A;  3AE3 B;  1HXY D;  1RFK A;  2RSU A;  4MGK E;  1T0Y A;  4NJ6 A;  2V3N A;  3NVY A;  3ZTC A;  1V1P B;  1QZE A;  3GOE A;  3X23 A;  2L3Z A;  2FCQ A;  2QSD A;  2J42 A;  5AZF A;  3TIX A;  1NEK B;  2N1W A;  1V49 A;  4AP4 C;  2WDV B;  4IW0 A;  3SDL C;  3IT6 B;  4XE0 A;  3SHQ A;  2FAZ A;  3L10 B;  1CZP A;  2MJ3 A;  4MGI E;  3ZVV A;  2JSV X;  2ZW1 A;  4YTP B;  2BYF A;  2J0K A;  3ML8 A;  2G4S A;  1WSP A;  1WJ6 A;  3I5J C;  3NHE B;  2DZM A;  2OJR A;  3SR6 A;  4CYE A;  4A55 A;  1E90 A;  1EF1 A;  1DYQ A;  1XQQ A;  1WRD B;  3DHI C;  4KX6 B;  4HDO A;  2KTR A;  3APF A;  1D6E C;  1WX8 A;  3Q8F A;  3N3K B;  1JWA D;  4KIK B;  2WDQ B;  1R4M I;  2W55 A;  4OHJ A;  4ANU A;  4NQL B;  3L4P A;  4W9F A;  2CJN A;  4FJZ A;  3VTV A;  1ZXH A;  4ARC A;  2RDB C;  2KJH B;  2MW5 A;  2LXC A;  1FEH A;  2JXT A;  1BXT A;  4HK2 A;  2PIA A;  2WQY B;  2LWP A;  4GDK A;  4US8 A;  2EMS A;  2ACZ B;  3PTF C;  1YQ3 B;  2A4Z A;  3ZXR A;  3ENE A;  4YXD B;  2C7H A;  4BKS D;  1XT9 B;  1SJH D;  1MG8 A;  3QIJ A;  2J0J A;  3GE8 C;  2GBN A;  1C3T A;  4MJS B;  2FUG 1;  4MH8 A;  2OHF A;  1MVK A;  4HJG E;  1WM2 A;  1FXA A;  1VZ7 A;  3OJ3 A;  2K8H A;  3GZN I;  3V60 A;  3LDZ E;  1QF6 A;  4GOC A;  1E8Z A;  2HTH A;  3QC8 B;  1ESF A;  2WU5 B;  4II3 B;  3R2T A;  1LGR A;  4DHJ D;  2K25 A;  4LNO A;  2DWQ A;  3VRB B;  1RWS A;  2J53 A;  1L4Z B;  1WX7 A;  3AE9 B;  3BVM A;  1S1Q B;  3Q8A A;  2FE8 A;  1TYG B;  2K39 A;  3I9V 1;  1V81 A;  2SAK A;  4IWQ A;  3RI7 C;  2JT4 B;  2MBE A;  4W9J A;  5LNK 1;  1IPG A;  4A9A A;  1ZUD 2;  3ZRF A;  1TKE A;  1XLO A;  3NVZ A;  3TSS A;  1E8W A;  2L32 A;  4XX5 A;  2L8J A;  2VZK B;  4LTU A;  4IM0 A;  2BYV E;  3BWU D;  5MPO A;  3N30 A;  3NUH B;  2MHJ A;  4WJO A;  5HFY A;  1FO4 A;  2W54 A;  1WJN A;  3B2F A;  3E9S A;  2DAJ A;  2N9P C;  4K1R B;  4EZK A;  1MPE A;  2KJ6 A;  3AEE B;  1PGA A;  4JQW C;  1ZDV A;  3TJP A;  1ZKH A;  3A33 B;  4O1N A;  2Z59 B;  1TKG A;  3SFD B;  3ABV B;  2N9K A;  4F8C B;  2KFJ A;  3AE8 B;  2N9X A;  3I63 C;  1FMA D;  1XCT L;  4HLE A;  4BFR A;  3IFW B;  5BMH A;  1WXA A;  3U2S C;  3RT3 B;  1NVI D;  5L95 C;  3P4Q B;  3Q69 A;  3ZJU A;  1L5P A;  1WJ4 A;  4M0W B;  2KWD A;  5AZG A;  5E6N A;  1SBB B;  1E9M A;  2MA9 B;  1K53 A;  2C5L C;  1HQR D;  5AUI A;  1FRR A;  1Q5W B;  4XC2 A;  2KLG A;  1N60 A;  1T0R C;  1FNU A;  4PS8 A;  1AAR A;  4A3P A;  3ZLZ A;  2LHE A;  2KOX A;  3N9Y C;  2DYB A;  2ZCC A;  4J3O D;  2BS3 B;  4FJY A;  3VTU A;  3KH0 A;  4DDG D;  3EA6 A;  2RMM A;  1HZ5 A;  2XN9 C;  4DXA B;  2E6X A;  1IGD A;  2GRI A;  2JUO A;  2WGS A;  5EE1 A;  1XLN A;  2GBM A;  1YN5 A;  4TQ0 A;  3VH4 B;  2QCZ A;  3ZDT A;  4LLG M;  4YL8 A;  4DXF A;  3D32 A;  2RDG A;  2M4N A;  4W9L A;  3V3X A;  2H88 B;  3JYU A;  3S2A A;  4C4V A;  3CWI A;  5IAA C;  2KJR A;  1YJ1 A;  1PGB A;  3DPD A;  2PJH A;  4E74 A;  1CJE A;  5JHA A;  2V9H A;  4BBN F;  1TIF A;  1P98 A;  1WIA A;  4RF1 A;  4LJP B;  3AUL A;  2D11 A;  4BVU C;  4BAX A;  3L0W B;  2IDY A;  5TSS A;  1PFD A;  3TMP B;  1MHH E;  2BYT A;  3UQA A;  3H7S A;  3VFK A;  1UGJ A;  4GDL A;  2W82 A;  3BK1 A;  2BWF A;  3VRA B;  2L7R A;  3A9J B;  2QIL A;  1V6E A;  1C78 A;  1JWB D;  1K50 A;  2KXJ A;  3LXF A;  4JWS C;  3W1S C;  1ZGU B;  2G45 B;  2I2Y A;  4IWP A;  1OGW A;  1WXV A;  4DK5 A;  5DPT A;  2IYD B;  3VR8 B;  2IJ0 A;  1FXT B;  2QDF A;  1UF0 A;  2QJL A;  3DVN U;  4ZRJ A;  5C3J B;  4BKG A;  2ZJD A;  3PV1 A;  1XLP A;  5C2T B;  1T0Q C;  1ZXI A;  1UBQ A;  3HRD D;  5KHO A;  1RFA A;  2J7Q B;  2NBW B;  3VDZ A;  2PVO D;  3VAW A;  2LZ6 A;  2LGS A;  4KZC A;  2D10 A;  2WX0 A;  3WAM A;  3C0R B;  4Q2J A;  1UWM A;  3QAR A;  4WJQ A;  5D7G A;  3WA0 A;  2KQ4 X;  1H8C A;  3WAO A;  3AE4 B;  4MEL A;  4URK A;  1TS5 A;  2MP2 A;  3LJ3 A;  1SIJ A;  1Q0W B;  2N7E A;  4WJP A;  3M62 B;  4EEW A;  1ZP0 B;  2KTR B;  2PE9 A;  1K52 A;  1TTN A;  4RNA A;  4DXG A;  3HK0 A;  4C80 A;  2ZPN A;  5G2N A;  2I1J A;  2WXO A;  1YX6 B;  1P9D U;  2BBC A;  4JPS A;  1M4V A;  5E6O A;  3PSE B;  2DBY A;  2OOB B;  2TSS A;  5FR6 A;  3V05 A;  4MGZ E;  4OZC A;  2IO0 B;  2BTE A;  3MTN B;  4NQK E;  1EU4 A;  3H8H A;  1OQR A;  2C60 A;  3CMM B;  3QHT A;  1WGG A;  2BT6 A;  4FXC A;  5AEK B;  4ZDV A;  1FCL A;  4N9F 4;  2IY0 B;  3GE3 C;  1L4D B;  2LFI A;  3OG5 A;  4RGN A;  4D2K A;  2XNA C;  4LNF A;  3MC9 A;  2YLM A;  4AWJ A;  4LNN A;  1GJZ A;  5TR5 A;  3VR9 B;  4K7U A;  2WXG A;  2B76 B;  1Z2M A;  3TL5 A;  1MFW A;  1UD7 A;  1SE9 A;  2AQ1 B;  2MBQ A;  4GGQ A;  3VUW A;  2Y3A A;  2V0G A;  2MJD A;  4WQM A;  1SGH A;  4L1B A;  2VRR B;  1I4Q A;  2REX A;  1WGK A;  5D94 A;  3IG3 A;  3U8Z A;  3U7D A;  2JZ3 B;  2SEB D;  2LJI A;  3TEW A;  2LAS A;  1I4X A;  1ZE3 D;  4P7I A;  1WI0 A;  4RF0 A;  2MH7 A;  3AE5 B;  2JVC A;  2HDE A;  3A4S C;  3FIL A;  2NTT A;  3CF6 E;  5G55 A;  1P1A A;  3ONS A;  4FAD A;  3AM9 A;  2AYO B;  2J0M A;  4ZRP A;  1SE2 A;  2JZP A;  5AUK A;  2LVP A;  2M0A A;  1ROE A;  3N20 C;  2PKO A;  4CHK A;  3P4R B;  1FCC C;  1TJE A;  4ZRQ A;  1L7Y A;  4BKT A;  4K3B A;  1JAL A;  2KWU B;  2RPQ A;  3PVL A;  4F7Z A;  2K5P A;  1TT5 B;  1PDX A;  4KSK C;  4GLS C;  3DHG C;  4JX1 C;  2PW9 A;  4F1S A;  4GU2 A;  3UI3 A;  3KYC D;  2KMM A;  1V1O A;  2RPV A;  1KFY B;  4G0N B;  1QLB B;  2KC2 A;  2X38 A;  2AEH A;  2Z8L A;  2KYW A;  2HE7 A;  4FBJ B;  2K6Q A;  1VRA B;  3B08 A;  1VR9 A;  2GB1 A;  4P1B C;  2RDH A;  2IY1 B;  4WAF A;  3JVZ X;  4MDK E;  3KUC B;  2KHW B;  3U4E G;  5HHD G;  2JWU A;  2NTS A;  3T3O A;  4RCO A;  3QX1 A;  4C00 A;  1I42 A;  4XDC A;  3ZGZ A;  2X8X X;  2KZR A;  2INC C;  3NVV A;  4TQ1 A;  4EZL A;  1NBF C;  2YEP B;  3PRP B;  2LGD A;  1VDV A;  2IGD A;  5G5G A;  3KQ4 A;  3DVG X;  2KK8 A;  1N63 A;  3PLU A;  3ZNH B;  2NVU I;  2UYZ B;  2CU1 A;  3RFZ B;  2LJ5 A;  3VXW A;  4C4V B;  3ZNG C;  4A6Q A;  4JL9 A;  4EE2 A;  2IO1 B;  3GS2 A;  2MCN B;  4IC7 B;  4HRO A;  4RMA A;  1RLF A;  3NY5 A;  4EUT A;  3QQ8 B;  3ZJV A;  1E7V A;  1DOY A;  2N9L A;  4ANX A;  1LQB A;  4KGT A;  3BY4 B;  1AYF A;  1K51 A;  1L0Y B;  2KNB A;  3Q14 C;  3NZ3 A;  3MJW A;  4RM9 A;  1N5X A;  2QMT A;  1TS4 A;  3H7P A;  1WJU A;  2K9X A;  4LDT D;  4GDL B;  2GOW A;  1V80 A;  5DPS A;  3MFG A;  2DX5 B;  4DBG A;  1YJJ A;  3ZW3 A;  4CO7 A;  2CS4 A;  2LI5 A;  3IBE A;  3N1X C;  2AX5 A;  2ZVO A;  2CU3 A;  3P4P B;  5D2M B;  4JE3 B;  2CHW A; 
#chains in the Genus database with same CATH homology
 2C5L C;  2M1M A;  3UIP B;  4HXD A;  4A3O A;  1J0G A;  1E7U A;  3R3M A;  2D07 B;  3HM3 A;  4PS3 A;  4MJS A;  1NDD A;  1Q5W B;  2JPH A;  4XC2 A;  2KLG A;  3N32 A;  2K6D B;  1YIW A;  4PS8 A;  1WM3 A;  1AAR A;  2N1V A;  1TBE A;  4A3P A;  3ZLZ A;  2KOX A;  5JZE B;  2DYB A;  2ZCC A;  2N9E B;  4IM2 A;  5C23 A;  4B95 A;  2DZK A;  2CKH B;  4FJY A;  1OEY A;  4G50 A;  4NAW A;  3KH0 A;  1UZX B;  2JY6 A;  3VHT C;  1C1Y B;  3VTU A;  4A20 A;  4B9K A;  4DDG D;  4K7W A;  4HDQ A;  4TV3 A;  3RYT A;  5GMV A;  2K1F A;  2IZV B;  3V61 A;  1L2N A;  4DDI D;  4II2 B;  3L16 A;  3H6N A;  4DXA B;  3PHX B;  2KDI A;  3RD2 A;  3KUD B;  3W1Y A;  2JUO A;  5CHV C;  3CST A;  2FUH B;  3B0A A;  5D6J B;  3VQI A;  2GBM A;  3RZW C;  2LRW A;  4TQ0 A;  3ECI A;  3VH4 B;  4NJ7 A;  3ZDT A;  2O2V A;  2NS5 A;  1F9J A;  4JLC A;  1WMH A;  2YVC A;  3QCA A;  3QWZ B;  4YL8 A;  2KTF A;  2LVO A;  3D32 A;  3PS6 A;  2M4N A;  4W9L A;  2MP2 B;  4GN1 A;  2ZPY A;  2L0T A;  3TCA A;  3SU8 X;  3AU5 A;  4ANW A;  3I3T B;  3JYU A;  3S2A A;  3M95 A;  3WAN A;  5L83 A;  2FCM A;  3ALB A;  5IAA C;  2JWZ A;  3AU4 A;  2KDB A;  1BT0 A;  1ISN A;  2KC1 A;  2KJR A;  2KQ7 A;  4AJY B;  1YJ1 A;  2FCN A;  4ANV A;  2MSE D;  3QK0 A;  3DPD A;  2PJH A;  4E74 A;  2NBV B;  3A4R A;  5JHA A;  3PGE A;  4BOS C;  2UWQ A;  3P2B A;  4BBN F;  4IG7 B;  3SD5 A;  2O6V B;  1Z5S B;  2N4F A;  5C1Z A;  1P98 A;  1OTR B;  1WIA A;  1TZ1 A;  4HPM B;  2K8B A;  4LJP B;  4NNJ B;  1WFY A;  2D11 A;  2AL3 A;  3AUL A;  3ZUN A;  3L17 A;  3ZTD A;  4AJW A;  4BVU C;  2GBR A;  3L0W B;  4EKU A;  3PRE A;  5CHW A;  1WH3 A;  2AL6 A;  4IWO A;  4G11 A;  1VD2 A;  2IBI B;  1GNU A;  2BWE S;  3RUL A;  2KVR A;  3T9L A;  3DBH I;  3APD A;  2WWZ A;  5J18 A;  1RRB A;  3TMP B;  1WZ0 A;  2PEA A;  2MRP A;  3KW5 B;  1WZ3 A;  5AZH A;  1RAX A;  4FJV B;  3H7S A;  3UQA A;  2KN5 A;  3VFK A;  1ZW7 A;  2NPT B;  2I1K A;  2Z0D B;  4GDL A;  2Y5B B;  3KUZ A;  3JSV A;  1V5O A;  2MX2 A;  2BWF A;  4FHK A;  2LGY A;  2G3Q B;  3NS8 A;  2KX0 A;  1EF5 A;  2L7R A;  2KWC A;  3A9J B;  4G3X B;  4E71 A;  4K7S A;  4NY0 A;  1KLV A;  2L00 B;  3RUI B;  4HJK A;  4DHJ B;  1NI2 A;  2KKC A;  4WJN A;  1V6E A;  5KHQ A;  3VTW A;  3A1Q B;  1SIF A;  4W9D A;  3PPA A;  2KXJ A;  4GMV A;  3W1S C;  1ZGU B;  2G45 B;  2DZJ A;  2KQS A;  2ZVN A;  4IWP A;  2KFK B;  3V6E B;  1OGW A;  2D3G A;  4WWP A;  4FHJ A;  3W1S A;  2MBB B;  3KVF B;  1WYW B;  4KSL C;  4LCD E;  1WXV A;  2L05 A;  1WGD A;  2JRI B;  4AOF A;  4DK5 A;  5DPT A;  2GBJ A;  2IYD B;  3JSV B;  2LD9 A;  1FXT B;  3DVN U;  4ZRJ A;  3DVN V;  4MSM B;  2C7M B;  4BKG A;  2JXX A;  2ZJD A;  1WGH A;  3PV1 A;  4AUQ C;  4MEM A;  2M17 A;  4GXB A;  5KHO A;  1UBQ A;  2HJ8 A;  1RFA A;  2J7Q B;  3RCZ A;  2NBW B;  4TKN A;  3DVG Y;  2DEN B;  3VDZ A;  3VAW A;  4XZ4 A;  2LZ6 A;  3WAP A;  3Q3F A;  4I6N B;  4LJO B;  2BKF A;  4GIV A;  4KZC A;  4B6W A;  2D10 A;  2WX0 A;  1YX5 B;  3WAM A;  2ZNV C;  2WYQ A;  3DCG A;  3C0R B;  5LXH A;  1LFD A;  3PRM B;  1OEY J;  2BPS A;  2IO2 B;  1TGZ B;  4FN2 A;  4JGH B;  3QAR A;  4WJQ A;  3ZO5 B;  4DHZ B;  2MLB A;  2C7N B;  4DHZ E;  5EDS A;  5D7G A;  1P3Q U;  3WA0 A;  1GC7 A;  4MSQ B;  4I6L B;  1H8C A;  2LXA A;  3WAO A;  1UH6 A;  2FID A;  4W9E A;  4GSW A;  4MEL A;  4EFO A;  1KM7 A;  4URK A;  4KDL B;  3A9K B;  2MP2 A;  3LJ3 A;  3PT2 B;  1G6J A;  1R4N I;  1Q0W B;  3DBS A;  2BF8 B;  3T8M A;  2N7E A;  4WJP A;  3M62 B;  4EEW A;  1I35 A;  2KTR B;  2PE9 A;  1UGM A;  3ZKJ C;  4BBN C;  2JZZ A;  2XK5 A;  3OJ4 B;  2CHZ A;  4HCN B;  3K9P B;  1TTN A;  4OVU A;  2LGX A;  3HK0 A;  2CHX A;  2O6V D;  2ZPN A;  2KDF B;  4LDT B;  5G2N A;  1LM8 B;  5CTR C;  2I1J A;  1YX6 B;  3EC8 A;  3VH3 B;  1P9D U;  2O6V A;  4E3C A;  1XD3 B;  3DBR I;  5E6O A;  3V62 A;  3PSE B;  1Y8R C;  1V86 A;  2OOB B;  2WX1 A;  1E8X A;  2C9W B;  5FR6 A;  1WXM A;  4MGZ E;  1EO6 A;  4ICV A;  4W9H A;  1WGR A;  1P0R A;  4ZRI A;  2M0X A;  2XK5 B;  2KLC A;  1D3Z A;  3JW0 X;  2IO0 B;  3MTN B;  2FCS A;  3ML9 A;  2KDE B;  3QAQ A;  4NQK E;  4GB9 A;  3R66 C;  2PE6 B;  3VUY A;  3R7Q A;  2NPT A;  1WR1 A;  1X1M A;  2C60 A;  3CMM B;  4M8M A;  1OQY A;  3PHW B;  1V5T A;  1K8R B;  3QHT A;  1WGG A;  3B1L X;  1PQS A;  5AEK B;  4ZDV A;  2GBK A;  2R2Q A;  2IY0 B;  3A9J A;  4N9F 4;  2QHO A;  4WAA A;  1HE8 A;  2BGF A;  3X0W A;  1WE6 A;  2JF5 A;  2DYO A;  3A1Q A;  5JH5 C;  3OLM D;  2RSU A;  4MGK E;  4WWO A;  1T0Y A;  2YLM A;  4NJ6 A;  1UBI A;  4AWJ A;  2BKR B;  2RR9 A;  1GJZ A;  2KFK A;  5TR5 A;  3ZTC A;  5DCN A;  1E8Y A;  1QZE A;  4K7U A;  3GOE A;  3X23 A;  4WWN A;  1Z2M A;  2L3Z A;  2FCQ A;  3TL5 A;  2ZEQ A;  2XBB C;  2XEW A;  3R7R A;  2EMT A;  2ZCB A;  1LXD A;  1V9J A;  2KWV B;  1UD7 A;  2CR5 A;  3M3J A;  1SE9 A;  5AZF A;  3ZRC A;  2LVQ A;  2V1Y A;  3TIX A;  2MBQ A;  4GGQ A;  2N1W A;  3VUW A;  2RGF A;  2ZZP B;  1V49 A;  2LUE A;  4AP4 C;  3OAW A;  2KX3 A;  1SGH A;  2GMI C;  4IW0 A;  3SDL C;  3BIN A;  2WDT B;  1WX9 A;  3SHQ A;  4IM3 A;  2FAZ A;  2VRR B;  3L10 B;  2HD5 B;  2V4L A;  4MGI E;  4W9I A;  2REX A;  5DPR A;  3U30 A;  3ZVV A;  5J17 A;  1EUV B;  2BYF A;  2J0K A;  2MA9 B;  3MHS D;  3ML8 A;  5D94 A;  3ZDM C;  2G4S A;  1WJ6 A;  3RZF A;  3IG3 A;  2NR2 A;  3L08 A;  3NHE B;  4HCP B;  2DZM A;  3U8Z A;  3U7D A;  2JZ3 B;  2OJR A;  1A5R A;  4CYE A;  4MH0 E;  1E90 A;  3H1U A;  4PYZ A;  1EF1 A;  2DHZ A;  2KO3 A;  2LAS A;  3HM6 X;  2EKE C;  4I6P A;  2MBO A;  3IVF A;  1XQQ A;  4P7I A;  1WI0 A;  3L54 A;  4TUU A;  3A9K A;  1WRD B;  2JVC A;  1WXS A;  2NBU A;  3A4S C;  3CF6 E;  5G55 A;  1VCB A;  1IP9 A;  3UF8 A;  4HDO A;  1P1A A;  2KTR A;  3ONS A;  4FAD A;  2D2Q A;  2AYO B;  3HIZ A;  3APF A;  3VUX A;  2J0M A;  1WX8 A;  4ZYN A;  3N3K B;  5LLI A;  2LVP A;  4KIK B;  4DWF A;  1R4M I;  4ASW C;  1GC6 A;  4KVG B;  4ANU A;  4NQL B;  3H9D A;  4CHK A;  3KYD D;  5HKH A;  4MM3 A;  4W9F A;  4FJZ A;  3VTV A;  1IYF A;  2LRU A;  3NZU A;  1L7Y A;  4BKT A;  2K8C A;  2PPH A;  2BYE A;  5BO4 B;  3EEC A;  4KDI C;  2KJH B;  2KWU B;  2MW5 A;  2LXC A;  3AXC A;  2IO3 B;  2RPQ A;  3PVL A;  3H7P B;  3Q3J A;  3ZIM A;  4F7Z A;  1KOT A;  1JRU A;  2KMA A;  4HWI B;  4KSK C;  4HK2 A;  4ZRK A;  4GDK A;  2LWP A;  2EMS A;  3M63 B;  5E6P A;  3PTF C;  3WIM A;  1E5W A;  2A4Z A;  4F1S A;  4GU2 A;  3KYC D;  3ENE A;  5JHB A;  2C7H A;  4BKS D;  4G0N B;  5IA7 A;  1XT9 B;  2KC2 A;  4BOZ B;  2AEH A;  3O65 B;  3UGB B;  1MG8 A;  3QIJ A;  4X57 B;  2HE7 A;  4BKS A;  4FBJ B;  2K6Q A;  2J0J A;  1KJT A;  2GBN A;  1C3T A;  4MJS B;  3B08 A;  2ZNV B;  2DAF A;  2IY1 B;  2R2O A;  1GUA B;  1WM2 A;  4M8N A;  4GDK B;  3OJ3 A;  3JVZ X;  2K8H A;  3GZN I;  4KV2 A;  4MDK E;  3V60 A;  3KUC B;  3QA8 A;  1U4A A;  2FNJ B;  3LDZ E;  2KHW B;  2N7D A;  4ICU A;  3DOW A;  4GOC A;  4FUL A;  1E8Z A;  1WR6 E;  2HTH A;  3QC8 B;  4EZJ A;  4DHJ D;  4II3 B;  3UQB A;  3DQV A;  3QX1 A;  2K25 A;  4NAW B;  2ASQ A;  3K9O B;  3QJZ A;  1I42 A;  3UIN B;  2L0F A;  3IHP C;  1WX7 A;  2L76 A;  2KZR A;  4HPL B;  4TQ1 A;  3ZNI D;  1S1Q B;  3PRZ A;  5DPW A;  4EZL A;  1NBF C;  3PRP B;  4MGY E;  2LGD A;  4EOY A;  1H4R A;  1J8C A;  2DYM A;  2K39 A;  2RD0 A;  1S3S G;  1V81 A;  4W9K A;  4IWQ A;  3PLV A;  2JT4 B;  3DVG X;  2O2V B;  2MBE A;  2KK8 A;  1WF9 A;  2KD0 A;  4W9J A;  1WMH B;  3PLU A;  1IPG A;  2M8S A;  3CSF A;  3ZNH B;  3ZRF A;  2KMC A;  2NVU I;  4FLH A;  4WQO B;  2UYZ B;  2CU1 A;  5CHF A;  2V3S A;  2LJ5 A;  2A5U A;  3L13 A;  3VXW A;  1E8W A;  2AWT A;  3ZNZ B;  4XX5 A;  4RM8 A;  2L8J A;  3ZNG C;  1J19 A;  4JL9 A;  1GG3 A;  4IM0 A;  2IO1 B;  2BYV E;  3N30 A;  5J2R A;  2MCN B;  4IUM B;  4IC7 B;  4WJO A;  1WJN A;  3EHV A;  2DAJ A;  2N9P C;  4K1R B;  2NCN A;  4RMA A;  3TBL D;  4EZK A;  1RLF A;  2KJ6 A;  3NY5 A;  2MWS B;  4KIK A;  4EUT A;  3QQ8 B;  4JQW C;  2B3A A;  2Z0E B;  4JIO U;  1WY8 A;  1ZKH A;  2MQJ A;  3A33 B;  3TJP A;  1E7V A;  2Z59 B;  4KZ0 A;  3NOB A;  4ANX A;  1LQB A;  4NPN A;  1UEL A;  1YQB A;  2KAN A;  2KFJ A;  4F8C B;  3BY4 B;  3WAL A;  2KNB A;  2N9X A;  2FIF A;  4HVB A;  3V6C B;  3MJW A;  4RM9 A;  4HLE A;  1CMX B;  3PZD A;  5CX3 A;  1M94 A;  2W9N A;  4BFR A;  3IFW B;  3H7P A;  1WXA A;  1V2Y A;  1WJU A;  2G4D B;  3RT3 B;  3VVW B;  1YD8 U;  4LDT D;  4GDL B;  4FA6 A;  1WGY A;  2GOW A;  5L95 C;  1V80 A;  4K81 A;  1Q1O A;  3HHM A;  5DPS A;  2MBH A;  4PYU A;  3NZS A;  2DX5 B;  4DBG A;  2DZI A;  5LXI B;  3DDC B;  4J6I A;  4PS7 A;  3APC A;  4OVV A;  1WJ4 A;  3AI5 A;  4W9C A;  4M0W B;  3ZW3 A;  4CO7 A;  2CS4 A;  2LI5 A;  5AZG A;  3IBE A;  4W9G A;  5E6N A;  3UIO B;  2ZVO A;  1WE7 A;  3DBL I;  3EFU A;  2JRH A;  5D2M B;  2CHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...