5JH5C

Structural basis for the hierarchical assembly of the core of prc1.1
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
88
Chain Sequence
b'HSKAHYYRYDEQLNLCLERLSNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine-specific demethylase 2B
molecule tags Metal binding protein/transcription
source organism Homo sapiens
publication title KDM2B Recruitment of the Polycomb Group Complex, PRC1.1, Requires Cooperation between PCGF1 and BCORL1.
pubmed doi rcsb
total genus 22
structure length 88
sequence length 99
ec nomenclature
pdb deposition date 2016-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF16207 RAWUL RAWUL domain RING finger- and WD40-associated ubiquitin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5jh5C00
2K25A 2ZVNA 1WFYA 2J7QB 5IAAC 1Q1OA 1J19A 2LGYA 3DCGA 2PEAA 4MDKE 2RSUA 4NY0A 5L95C 2PE6B 4RMAA 2KNBA 2PPHA 4GDKA 4I6NB 2M8SA 1RAXA 2FCMA 3PTFC 4TQ1A 1WR1A 4K81A 1QZEA 3U30A 5JHBA 2FIFA 2KN5A 1A5RA 1Z5SB 1E8YA 3KH0A 1E90A 1NI2A 5J17A 4GSWA 4IW0A 2LXCA 1SGHA 2KQ7A 3IHPC 3QA8A 2KDBA 2VRRB 4BFRA 5LLIA 1WE7A 1Q5WB 2K39A 2PE9A 2WX1A 3A1QA 4ZRIA 2KWUB 1WJNA 3VXWA 2V3SA 4ANWA 2HJ8A 2Z0DB 4B9KA 4FHKA 5CHFA 3JVZX 5KHQA 2NBVB 3NY5A 2V4LA 2N9PC 4TQ0A 1RFAA 2LUEA 2KWVB 1ZGUB 1GNUA 1TBEA 1E8ZA 1XQQA 1WZ0A 4M8MA 3V6EB 3AI5A 3H9DA 5AZFA 1OGWA 1UELA 2D10A 2MBBB 4DWFA 3TBLD 5AEKB 4K1RB 3QAQA 1I42A 3ZNID 2I1JA 3PGEA 3PHWB 4GDLA 3HM6X 4HDQA 3VQIA 3M3JA 1WJUA 2KTFA 3KYDD 3SU8X 3WALA 2KOXA 4HLEA 4XX5A 3A4RA 4FLHA 4WWPA 1VD2A 2JY6A 1WGRA 3CMMB 2L8JA 2JPHA 2ZNVB 4GMVA 3OJ3A 5GMVA 5C23A 4EZLA 2WYQA 4HK2A 3WAPA 3S2AA 1G6JA 3T9LA 4GDKB 1XD3B 1WXVA 2L00B 4IWQA 3WANA 4F8CB 2FCNA 2O6VB 2EMSA 4J6IA 4A20A 2K1FA 4G50A 4NNJB 3TL5A 4JL9A 5J18A 4IM2A 2C60A 4G0NB 2LGXA 3ZTDA 4HJKA 5CX3A 2MX2A 3QIJA 2K8BA 3M63B 3VH3B 1EUVB 4HWIB 3PREA 4A3OA 2DAFA 3QJZA 4DHJD 4CYEA 2KLGA 4JIOU 1WE6A 1RRBA 4MGYE 2A4ZA 1ZKHA 4FJVB 4GDLB 2MBHA 5CHWA 3WAMA 1WGYA 2C5LC 2KFKA 3DPDA 4DK5A 2ZPNA 2UWQA 4K7SA 1KJTA 4KSLC 3APDA 4BKGA 2LGDA 2NR2A 3H6NA 4EZKA 4I6LB 1V5OA 2MRPA 3ZDMC 2FUHB 2O2VA 2LVPA 2DAJA 2Z59B 3CF6E 4MJSA 3DVGY 1KOTA 1V5TA 2LVOA 3K9PB 2D3GA 4WWNA 1NDDA 5IA7A 3OJ4B 3HIZA 4CHKA 4G11A 3SDLC 4AOFA 1C1YB 2XBBC 4AWJA 3H7SA 4RM9A 4NQLB 4NJ7A 4EEWA 2FAZA 1V81A 3PS6A 1V6EA 2CKHB 3BY4B 4KSKC 4KVGB 3ZUNA 2G4SA 2BGFA 2LRUA 1KLVA 3T8MA 2MLBA 3DBHI 3L10B 3ENEA 1UZXB 2XK5A 3DVGX 2IO2B 4I6PA 4W9CA 1V9JA 5D6JB 2M4NA 2N7EA 4MH0E 5E6PA 1X1MA 3HHMA 4PYUA 1P1AA 4FADA 3C0RB 1L2NA 1WJ4A 2N9EB 3N30A 4KZ0A 2DX5B 2RD0A 4DHJB 2NVUI 3CSFA 1E5WA 3TMPB 2RR9A 3OLMD 1EO6A 2MW5A 2LRWA 3OAWA 3KUCB 2W9NA 3A9KB 4B6WA 3KW5B 2K8CA 3QQ8B 4GB9A 3VAWA 2M17A 3ZKJC 4LDTB 1WIAA 3ZW3A 4LDTD 2GMIC 3EECA 4EZJA 2JZZA 3A4SC 1WR6E 2CHWA 1EF1A 2MBEA 3D32A 3PZDA 3QCAA 3QHTA 4HCPB 1BT0A 3VTWA 4FULA 3ZLZA 4A3PA 4M8NA 1L7YA 2HE7A 2BKFA 3DBRI 3PRZA 4W9IA 2NPTB 3KUZA 3JSVB 3DBLI 2FCQA 4HXDA 4II3B 1OTRB 4W9JA 4W9GA 2L0FA 5CTRC 2JRHA 2KTRB 1WM3A 3AU5A 4MSQB 4LJOB 2OOBB 4BOZB 2N9XA 3ALBA 3ML8A 4W9LA 4YL8A 1WX8A 4PYZA 4E74A 4W9EA 2IYDB 4M0WB 3UF8A 3QARA 4K7WA 3W1YA 2BYFA 4FN2A 2O6VA 4DDGD 4LJPB 2O2VB 3ZNHB 4DBGA 2JWZA 2N4FA 2NS5A 5KHOA 3VTUA 4B95A 2KX0A 2J0KA 1YJ1A 2BYVE 3NOBA 2C9WB 2BWES 5D2MB 1V86A 3SHQA 2KJRA 2KDEB 2LWPA 2K6DB 3PPAA 1YQBA 2IO3B 1WGGA 3KVFB 3R7RA 2LVQA 4EFOA 4ZDVA 2JT4B 2KHWB 2MBOA 3PRMB 1YX6B 2GBJA 3MTNB 3QX1A 3U8ZA 3HK0A 2KZRA 2KQSA 2NBUA 3GOEA 4MM3A 1V80A 2MA9B 3L17A 4NQKE 2C7NB 2JXXA 4XZ4A 5JZEB 4TKNA 1WM2A 2IO0B 1KM7A 3V6CB 2G4DB 4MJSB 4W9FA 2MCNB 4FBJB 2IBIB 3AULA 1D3ZA 3PRPB 1GUAB 3WAOA 4NAWA 2KMAA 4WWOA 1WY8A 1Y8RC 2UYZB 2K8HA 4HDOA 4GU2A 3LJ3A 1P3QU 1UBIA 4OVVA 4W9KA 2M1MA 3UQBA 5JH5C 2CS4A 1S3SG 4W9DA 4X57B 5DPTA 2KMCA 1P9DU 4F7ZA 2IO1B 2IY1B 1GC7A 3K9OB 4DHZE 3RZWC 3NZUA 3ZO5B 4WJNA 4WJOA 2AYOB 1E7UA 2DYMA 3M62B 3NS8A 2WX0A 4JGHB 2KDIA 3IBEA 4NJ6A 2KKCA 2ZEQA 2KLCA 5L83A 5E6OA 5G2NA 3EHVA 3ML9A 1S1QB 2RGFA 3A9JB 2MP2A 2IZVB 4BKSA 2CU1A 2K6QA 4DDID 4DXAB 4PS7A 1WI0A 4ZRJA 4HVBA 1E8XA 2ZNVC 5DPWA 1UBQA 1Q0WB 1IYFA 3SD5A 1R4MI 2DZMA 1RLFA 4E71A 4KIKA 2KFKB 3TIXA 4ANVA 2CR5A 1UGMA 3QK0A 1M94A 3ONSA 4EKUA 5JHAA 2J0JA 3PHXB 4MGIE 4MGZE 2NCNA 1WX9A 1J0GA 2L3ZA 2JZ3B 5D94A 3AU4A 1YX5B 3WIMA 4LCDE 1H8CA 4IWOA 3PLUA 2AEHA 2N1WA 3HM3A 2DHZA 3KYCD 2L7RA 3RUIB 3ZTCA 4E3CA 5LXHA 1J8CA 2AWTA 1HE8A 3A9KA 2KK8A 3VHTC 1WJ6A 2KX3A 3DQVA 2ZVOA 3RYTA 3W1SA 2LD9A 2D07B 3DOWA 4ZRKA 5DPRA 2R2QA 4NAWB 1SIFA 1GC6A 1YD8U 1GG3A 2D11A 3L0WB 2KC1A 1P0RA 2HD5B 4XC2A 4ICVA 2BYEA 3B08A 4URKA 3L13A 3RT3B 2EMTA 2KVRA 2DZIA 2BF8B 2JVCA 4FA6A 1WGHA 5EDSA 4PS3A 1TZ1A 1WX7A 3RZFA 3ZNGC 2Z0EB 4WJQA 3VDZA 4BBNC 2LASA 3UIOB 4GIVA 2MSED 3W1SC 2KO3A 2RPQA 1IP9A 5C1ZA 4AJWA 2D2QA 1WRDB 1Z2MA 1WZ3A 2ZCCA 3TJPA 1C3TA 2M0XA 2DYBA 3Q3JA 4KV2A 1WMHA 4ANXA 1UD7A 3ZIMA 3RD2A 1EF5A 2MP2B 4GGQA 2MWSB 1FXTB 1LXDA 3P2BA 2DENB 2L76A 4TUUA 2DZKA 3AXCA 3ZDTA 1T0YA 3X23A 2REXA 3L16A 3NZSA 4AJYB 3QWZB 5BO4B 2KJHB 2OJRA 3IG3A 2XEWA 4AUQC 1CMXB 3H7PA 4ICUA 2WDTB 4BOSC 1V49A 3VUWA 5HKHA 1OEYA 4GXBA 4BBNF 1ZW7A 2YLMA 1IPGA 3M95A 3R66C 4P7IA 2O6VD 3JW0X 4NPNA 4WJPA 2JF5A 1LM8B 3WA0A 3DBSA 3GZNI 4IM0A 4KZCA 2LI5A 3EC8A 5DPSA 1V2YA 3H7PB 2N1VA 4HCNB 3ZNZB 4AP4C 4MEMA 4DHZB 2KC2A 4FHJA 5TR5A 4WAAA 3EFUA 3IFWB 1WYWB 4MGKE 2A5UA 3UGBB 1WXSA 1MG8A 4MSMB 3VUXA 2L0TA 2DYOA 4JQWC 4MELA 2CHXA 2GBMA 2ZZPB 3H1UA 5AZHA 3V60A 2BPSA 2AL3A 1WF9A 1WMHB 1UH6A 2KWCA 2G3QB 1VCBA 2FIDA 3APFA 4GN1A 3VFKA 4HPLB 1I35A 4IUMB 2LJ5A 3PVLA 2V1YA 3I3TB 3UINB 4IM3A 5G55A 2JUOA 1JRUA 1P98A 2MQJA 2QHOA 2NBWB 2R2OA 3VH4B 2ASQA 5D7GA 2J0MA 5AZGA 3UQAA 3U7DA 1U4AA 4F1SA 2N7DA 1K8RB 2BKRB 1H4RA 2NPTA 2DZJA 4RM8A 3ZRFA 2BWFA 2GBRA 3R3MA 2LXAA 3LDZE 4BVUC 2I1KA 5FR6A 5DCNA 2ZPYA 2WWZA 4OVUA 2FCSA 3ECIA 2KANA 4W9HA 1WXMA 2KXJA 3UIPB 3A33B 1GJZA 1XT9B 3PLVA 2G45B 3RULA 1SE9A 5E6NA 1PQSA 1OQYA 3N32A 2PJHA 4G3XB 3APCA 3BINA 4KDLB 1F9JA 3V62A 3DVNU 3IVFA 1E8WA 2HTHA 2C7HA 3CSTA 3JYUA 3ZRCA 1LQBA 4ANUA 4II2B 1LFDA 4ASWC 3ZVVA 1WGDA 3A9JA 4EOYA 5LXIB 4IG7B 2Y5BB 1WXAA 2L05A 3JSVA 2FNJB 4ZYNA 3MHSD 2KJ6A 1OEYJ 1TGZB 2KD0A 2KFJA 2ZJDA 4K7UA 3QC8B 3DVNV 3KUDB 4FJYA 4KIKB 3NHEB 2JRIB 2IY0B 2ZCBA 3TCAA 1WH3A 3RCZA 3VTVA 2EKEC 2YVCA 2C7MB 3PV1A 4KDIC 1ISNA 3L54A 1NBFC 1R4NI 1E7VA 2GOWA 3MJWA 4WQOB 4EUTA 3V61A 3B0AA 1YIWA 4BKTA 1TTNA 2XK5B 3L08A 4TV3A 3VVWB 5J2RA 2LZ6A 4IWPA 3B1LX 3DDCB 2MBQA 3A1QB 2KTRA 3O65B 4HPMB 4CO7A 5CHVC 2CHZA 2GBKA 3Q3FA 4N9F4 4BKSD 3R7QA 1AARA 2AL6A 4IC7B 4FJZA 2B3AA 4GOCA 4PS8A 3PT2B 3PSEB 3VUYA 3N3KB 4JLCA 3X0WA 2KDFB 2GBNA
chains in the Genus database with same CATH superfamily
2K25A 5IAAC 2QJLA 2D5GA 1V1PB 2W55A 1FD6A 2RSUA 2V4IB 2M8SA 1RAXA 2FCMA 1KRHA 1GAQB 3FAHA 1QZEA 1A5RA 2KN5A 1Z5SB 4WH4A 3KH0A 1E90A 2WP9B 2QMTA 4HRSA 2KQ7A 3IHPC 2KMMA 1NVID 1GB1A 2WX1A 3Q6BA 1HTOA 4TMAB 5IP4D 4ANWA 2HJ8A 2Z0DB 1XCTL 2IGHA 4FHKA 2I38A 2ON8A 1MFWA 3GB1A 2SEBD 2BYTA 1XO3A 3V6EB 3H9DA 1DOXA 1OGWA 2D10A 3TBLD 3V3XA 1M4VA 1C79A 1UGJA 2RDHA 4LNOA 3ZNID 2I1JA 3PGEA 3PHWB 2PVOD 2RDGA 3DHHC 1WJUA 2KTFA 2YEPB 1NYRA 2K3UA 4ZYSA 4HK2A 1N61A 4GDKB 4IWQA 2FCNA 2O6VB 2XN9C 4J6IA 1LGRA 1OQQA 4NNJB 4JL9A 5J18A 5CX3A 3VH3B 2DAFA 4NAMA 4DHJD 4CYEA 2KLGA 4H2AA 2JXTA 1K50A 4MGYE 2MBHA 4K7SA 1L0YB 3V05A 3HRDD 4RGTA 3ZJTA 2MRPA 3NZ3A 2O2VA 4YSXB 2Z59B 2KYWA 1YNTE 1SF0A 3OJ4B 4G11A 3SDLC 3Q8AA 1ACCA 4YSYB 4NQLB 2FAZA 4CQNA 4RNAA 3PS6A 3ZUNA 2G4SA 2BGFA 4OHJA 3P42A 1CK1A 3DBHI 3L10B 4P1CC 2QCZA 4S17A 3DVGX 2XK5A 5D6JB 3HHMA 4PYUA 3VR8B 2WXPA 3C0RB 2N9EB 3FC4A 1QQRA 4KZ0A 4DHJB 1E5WA 2RR9A 3OLMD 3KLSX 2MW5A 1FXIA 1ZPSA 3KUCB 2W9NA 3KW5B 3PZ8A 2QSDA 2GMIC 4LDTD 1J7AA 1EF1A 3QCAA 1N6ZA 1BT0A 4OVZA 2HE7A 2BKFA 3PRZA 2BW2A 3JSVB 3DBLI 1OTRB 2L0FA 3AU5A 1WM3A 1FM0D 1B1ZA 3ALBA 4YL8A 3H8HA 3B9JA 4DBGA 2DWQA 2NS5A 3VTUA 1V1PA 3TEZA 2H89B 5D2MB 2ACZB 1V86A 1FO4A 2KJRA 1GPXA 1YQBA 2IO3B 3R7RA 5JXVA 4ZDVA 2HDEA 2KZRA 3GOEA 3ZJUA 4MM3A 3AE6B 2JXXA 3BYTB 5JZEB 1UUPA 2G4DB 4W9FA 4FBJB 5IN7A 5EE9A 4WWOA 2UYZB 1VR9A 1MI0A 3UQBA 1N62A 1EM7A 2CS4A 4W9DA 4X57B 2IO1B 1C77A 4DHZE 3RZWC 3NZUA 2Y5CA 2TSSA 3ZO5B 2AYOB 2E6XA 4ZOHC 1K52A 1E7UA 3NS8A 4A9AA 2DLBA 2LEKA 3NVZA 1IBXA 5TSSA 2IZVB 2CU1A 5FR3A 3AEDB 3Q8FA 1UBQA 4MT5A 3BVGA 3TIXA 1FNVA 1KFYB 3Q14C 4MGIE 1WSPA 3KYCD 1J8CA 2AWTA 5BYRA 3P4RB 3W1SA 3DWMA 4ARIA 3DOWA 3MHZA 4NAWB 1SIFA 1JQ4A 1GG3A 4C7ZA 1P0RA 3GE3C 4XC2A 2PW9A 2KVRA 1WGHA 4M01A 4PS3A 1TZ1A 3VDZA 2LASA 2MSED 5E6JA 2KO3A 3AE2B 3RNGC 2RMMA 3Q3NC 1F2RC 4AJWA 2MJEA 4N59A 1Z2MA 2OEDA 1WZ3A 5I4DA 4KV2A 3KQ4A 4LNKA 2SAKA 2DENB 1P7FA 5AUIA 2DZKA 3E9SA 3SEBA 2REXA 3LYYA 1JCKB 3QWZB 3O13A 2QC8A 3IG3A 2H88B 4YTNB 5HKHA 1OEYA 2Z8LA 4IM0A 3P4PB 5DPSA 1V2YA 5G5GA 3ZNZB 4MEMA 5TR5A 3EFUA 4MGKE 4YTMB 2L0TA 4C4VB 2GBMA 1WF9A 2G3QB 1VCBA 3VFKA 1I35A 2HJ1A 3MJ5A 4LLGM 1N5XA 1XLOA 4IM3A 3SR6A 2DNFA 2QHOA 1FCCC 3ZYYX 1QF6A 3U7DA 1U4AA 1T5XD 2LJIA 2IJ0A 4LTUA 3W9CB 2I1KA 4LNIA 2ZPYA 4W9HA 3UIPB 2D3AA 1UWMA 5E6NA 1ET9A 1IUEA 3N32A 1E9MA 3APCA 3P63A 3BINA 4KDLB 1F9JA 3DVNU 3CSTA 1UNSA 1D5ZC 3JYUA 4II2B 1LFDA 2KQ4X 3ZVVA 4US8A 5LXIB 2VH1A 3IXSA 2Y5BB 4DXFA 1T3QA 3MHSD 2KFJA 3QC8B 3DVNV 4FJYA 1Q10A 3NHEB 2JRIB 4M02A 2IY0B 2ZCBA 3TCAA 1T0RC 3DBHB 3RCZA 1YQ3B 4JX1C 4ZRQA 4KDIC 3C19A 1NBFC 1E7VA 4KX6B 2V9HA 3Q8CA 2BS4B 1TTNA 3L08A 1SE2A 1V97A 4IWPA 3DDCB 3A1QB 2PMVA 3MC9A 4N9F4 2AL6A 3DBRB 2J7QB 5T8IA 3VRBB 1P7EA 2LGYA 3DCGA 2PEAA 4FXCA 5L95C 2PE6B 2KNBA 2PPHA 3PTFC 3UI3A 1WR1A 3AEGB 4K81A 2FIFA 3MC0B 4GSWA 3RMKC 2ONQA 4WIPA 2Y5PA 5LLIA 1I4QA 1CQVA 1Q5WB 2PE9A 2L83A 2KWUB 1WJNA 3VXWA 2AX5A 1F0ZA 3Q2AC 4A6QA 2INPE 1WRIA 4TQ0A 1RFAA 1TIFA 3CIRB 4LK0M 2EKIA 2K22A 1E8ZA 1WZ0A 3AI5A 1EWCA 1FRRA 4DWFA 2MBBB 2BS2B 5AEKB 4C7YA 3VQIA 3NG0A 2KOXA 4HLEA 3BVZA 3A4RA 4WWPA 1HQRD 1VD2A 1XEEA 3CMMB 2JPHA 2ZNVB 3I9V1 5C23A 4EZLA 1G6JA 1JWSD 5H8YE 3WANA 4F8CB 2EMSA 4A20A 1E7PB 1F2RI 2C60A 3ZTDA 1FNWA 1SIJA 1PGAA 4HWIB 4XE0A 1FXAA 3RNEC 1ZE3D 3HUIA 1JWAD 1ZKHA 4FJVB 1I4XA 1WGYA 2J52A 5IO9A 2KFKA 2PIAA 3DPDA 4DK5A 2UWQA 1KJTA 3APDA 2NR2A 4I6LB 3ZDMC 2NTSA 2LVPA 2DAJA 1R4MB 2GB1A 3CF6E 1D5XC 3IAS1 2J4XA 2LVOA 2D3GA 2ICIA 4WWNA 1NDDA 5BMGA 3ABVB 3HIZA 4CHKA 4AQ7A 3WCQA 2M56B 1VZ7A 2CKHB 4BZAA 4XDCA 1J7CA 4KKIA 1UZXB 4W9CA 4P1BC 1NEKB 2W3SA 2K9XA 1P1AA 3RN9C 1E10A 3FILB 1WJ4A 3N30A 2NVUI 1STEA 2LRWA 3VAWA 3ZKJC 4LDTB 1WIAA 3EECA 1TS5A 1WR6E 3D32A 4BAXA 3QHTA 3ZLZA 5HFYA 4M8NA 2WS3B 3DBRI 3ZGZA 2NPTB 3Q8BA 5CTRC 4BOZB 1QOFA 1HZ6A 2KDMA 1WX8A 1FFVA 3ETRA 3UF8A 3W1YA 4FN2A 4OZAA 3I63C 2JWZA 5KHOA 4B95A 2BYVE 4NZLB 5G5HA 1I4PA 2R61A 2V3NA 2OJWA 3J9CA 2KHWB 3PRMB 1YX6B 1ZDXA 3MTNB 2BB5A 4WQMA 2WXJA 2MA9B 4NQKE 3L17A 2C7NB 4XZ4A 1MG4A 1WM2A 3SFDB 4MJSB 2IBIB 3AULA 1D3ZA 3WAOA 1GUAB 1HTQA 1Y8RC 1XF5L 1FMAD 1P3QU 2RPVA 4WWMA 4S0RA 1JROA 5DPTA 1P9DU 2IY1B 3LXFA 3K9OB 1TY0A 5D3IB 1TJEA 2YEPF 1EWYC 2DYMA 2IGGA 2WX0A 4JGHB 3B2GA 3RFZB 2MHJA 3RNCC 5G2NA 3AN1A 1S1QB 4HKZE 1HZ5A 4BKSA 2M0AA 1F1HA 2L52A 4HVBA 1E8XA 1I4RA 2WXLA 2AQ3B 2ZNVC 5DPWA 1IYFA 3SD5A 1R4MI 1RLFA 2KFKB 3KWLA 2CR5A 3ONSA 4KKJA 5JHAA 2J0JA 2JU6X 1WX9A 2HTME 3PLUA 2G1EA 2L7RA 4E3CA 5BYQA 3A9KA 3LB8C 1QILA 2ZVOA 1I4GA 1ZXHA 4ZRKA 3L0WB 1VJKA 2Y3AA 2BYEA 3AE8B 1FCLA 2JVCA 4FA6A 5EDSA 4ARCA 1B9RA 3ZNGC 2Z0EB 4WJQA 4BBNC 4GIVA 5D3DA 2RPQA 2D2QA 3VRAB 3AECB 2GLSA 2M0XA 1UD7A 1EF5A 2MP2B 2JSVX 5H92C 2J42A 1LXDA 2LGIA 4AJYB 3NZSA 3L16A 2NMQA 1ZOYB 2PTLA 2OJRA 1D5MC 2XEWA 2BTEA 3NVWA 2WXRA 4HKQA 1V49A 3U52E 1LO5D 3SFEB 3M95A 4P7IA 2O6VD 4WJPA 2L1AA 3GZNI 3EC8A 4P16A 3AEBB 2N1VA 2WQYB 2A5UA 2BS3B 3UGBB 1MG8A 1KTKA 2BBCA 3VUXA 2JQRB 4MELA 4JQWC 3H1UA 1XLQA 1SJHD 1UH6A 2KWCA 2FIDA 4GN1A 4HPLB 4IUMB 5C2TB 2V1YA 3I3TB 3UINB 5G55A 1RYJA 1JRUA 2NBWB 4K3CA 1FIQA 4OW0A 5D7GA 2J0MA 5AZGA 4DQOC 4F1SA 3R3MA 3LDZE 1F77A 2WWZA 4OVUA 2KXJA 3MC8A 1GJZA 3BWUD 2G45B 2ZW0A 1SE9A 3ZJVA 1OQYA 4G3XB 1RWSA 3NS1A 2JX5A 1KF6B 4ANUA 4EOYA 1WGDA 3RI7C 4IG7B 2FE8A 1TT5B 2KJ6A 1XLNA 1OEYJ 1L6VA 1TGZB 4K7UA 1DOIA 4QAYA 1FEHA 1HXYD 1A70A 3ZXRA 1E0ZA 4O1NA 2YVCA 1ISNA 3B2FA 3AE7B 2V0GA 3B0AA 4A8XC 5J2RA 2KTRA 4JWSC 2CJOA 2CHZA 1ROEA 4BKSD 4XWWA 1AARA 3EFCA 4RGMA 3PSEB 3VUYA 2GBNA 4HPPA 2N7JA 2QILA 1Q1OA 1ESFA 1AN8A 2IGDA 4NY0A 2K0PA 4GDKA 4P6VF 3P1MA 1PFDA 2INNE 3U30A 1AWDA 2I2YA 3TEWA 1E8YA 1NI2A 4KGTA 3QA8A 2KDBA 2VRRB 4M0WA 1N63A 3A1QA 2FBWB 1I7HA 1DOYA 4RCOA 2WXOA 4B9KA 2MJDA 5CHFA 3AEEB 1QOGA 2NBVB 1R7SA 2LUMA 2KWVB 1SB3C 4AS1A 1V1OA 3DHGC 1UELA 3MFGA 4J3OD 4K1RB 3QAQA 1I42A 4RFBA 1CZPA 4GDLA 4UDUC 2D3BA 3KYDD 2WXNA 4EE2A 2JY6A 1WGRA 2L8JA 2UU7A 3DHIC 4GMVA 3R8BA 3OJ3A 3P4QB 3WAPA 3T9LA 1XD3B 1WXVA 2L00B 2WGSA 5C3JB 5EE0A 4IM2A 4HJKA 1N5WA 2MX2A 2K8BA 3M63B 1UF0A 3W2DA 3PREA 4A3OA 1HEZE 3QJZA 1YN3A 3L4PA 1RRBA 2WXFA 3AM9A 2B76B 2C5LC 5BYSA 1SSNA 3AE9B 3H6NA 2QIEB 4EZKA 1V5OA 4XDDA 3BK1A 4RGNA 1PUTA 2FUHB 3Q69A 4JPSA 2W3RA 1C1YB 2XBBC 3H7SA 4RM9A 2QEJC 3N9YC 4NJ7A 4EEWA 3BY4B 1MJDA 2LRUA 3T8MA 1NI3A 1XCQL 1N60A 2IO2B 5E6PA 1V9JA 2JZPA 2M4NA 4MH0E 2BB6A 1X1MA 1YN4A 1L6UA 1CJEA 2DX5B 3AE3B 4C56C 1L0VB 1EO6A 3OAWA 5IOIA 1IBXB 3A9KB 2E3TA 4B6WA 3QQ8B 2K8CA 4GB9A 4RGOS 2M17A 2W54A 4M00A 5BMHA 2AQ2B 4REZA 4EZJA 2JZZA 2N9KA 2CHWA 2MBEA 4HCPB 1D6EC 1TKGA 2IPKD 4A3PA 1L7YA 3KUZA 2FCQA 4II3B 4W9GA 3VH4B 4W9JA 4D2KA 2JRHA 2KTRB 4LJOB 2NTTA 2LMCA 3AEAB 1TY2A 1BXTA 3BYYB 2WNMA 4M0WB 3QARA 4K7WA 2BYFA 2O6VA 4DDGD 4LJPB 1PDXA 2O2VB 3ZNHB 1D4BA 2J0KA 2KX0A 1JWMD 1YJ1A 3NOBA 2C9WB 3Q8EA 5EE3A 2BWES 4TSSA 2W82A 2KDEB 4HROA 2KT7A 3PPAA 2AQ1B 2G9HD 3KVFB 4EFOA 1SXTA 1SBBB 2MBOA 1ZP0B 3HK0A 2KQSA 2X38A 1QLBB 4Q2JA 4TKNA 2IO0B 1KM7A 4JWUC 3V6CB 2MCNB 4XGAB 3PRPB 4NAWA 2KMAA 2K5PA 2LHEA 2KWDA 4HDOA 2K8HA 4GU2A 3LJ3A 4A55A 2WXGA 1UBIA 2M1MA 5JH5C 1S3SG 1Y56A 1K51A 3NVYA 4F7ZA 2WDQB 4K3BA 4WJNA 4WJOA 3MP9A 3M62B 2VH2A 4NJ6A 2KKCA 2KLCA 3RPFC 5E6OA 3EHVA 3ML9A 2RGFA 2INCC 2WU2B 1VZ8A 3NRZA 2QDFA 2K6QA 4DDID 1QKZA 4DXAB 3T3NA 3IAM1 1WI0A 1C76A 4ZHOA 4E71A 4KIKA 1PYWD 1UGMA 3QK0A 1M94A 3PHXB 1J0GA 2L3ZA 2JZ3B 3AU4A 1YX5B 3WIMA 3DWGC 2AEHA 3HM3A 5FKAC 2DHZA 3RUIB 3ZTCA 1V8CA 1PGBA 2KK8A 3VHTC 1WJ6A 3DQVA 3CWIA 2LD9A 2D07B 3Q3OC 3KWVA 5DPRA 2R2QA 2D11A 1GC6A 1YD8U 1YOVB 2Q5WD 3B08A 4URKA 3L13A 3RT3B 1TS3A 4JE3B 2DZIA 1YMHE 1WX7A 1ZXIA 3AB5A 2WXMA 1R4NB 1YN5A 1MHXA 1IP9A 1RFKA 1TS4A 1WRDB 2ZCCA 3Q3JA 1WMHA 1EU4A 3ZIMA 3T3OA 4RF1A 4L2YA 1QT9A 3P2BA 4MH8A 4PT5A 4TUUA 3AXCA 5HG2A 5BMIA 3ZDTA 3X23A 4IOIE 5AUKA 3E56A 2GI9A 4AUQC 4ICUA 4BOSC 1WGKA 4GXBA 4BBNF 1ZW7A 1IPGA 3R66C 4NPNA 2JF5A 3WA0A 3DBSA 2WXQA 2JWUA 4AP4C 2KC2A 4FHJA 3IFWB 1WYWB 4DXGA 1JW9D 4XWTA 2BVCA 4MSMB 4ACFA 2DYOA 3V60A 5AZHA 2ZZPB 4LNNA 1P98A 2JYTA 1JWUD 3UQAA 2N7DA 4YT0B 2BKRB 2NPTA 2DZJA 2BWFA 2GBRA 1QOBA 3U7ZA 4BVUC 5DCNA 2INDC 2FCSA 3ECIA 3IT4B 3A33B 1XT9B 3RULA 2N9LA 1VDVA 1PQSA 1TKEA 3AE1B 3GP7A 2PJHA 4HEA1 3IVFA 1E8WA 2BT6A 2HTHA 1JWBD 3ZRCA 3RNAC 2J53A 4L1BA 3JSVA 2FNJB 4YXDB 2KD0A 2ZJDA 1C4PA 3AE4B 4MACA 1FNUA 3KUDB 4KIKB 1L4DB 2KN4A 4N6EB 1I4HA 1WH3A 3TEXA 2KAJA 3BZDB 2C7MB 3EUB2 3MJWA 3V61A 1YIWA 4BKTA 1L0XB 2VZKB 3VVWB 4TV3A 3EGRA 2LZ6A 3B1LX 3O65B 5CHVC 3Q3FA 1FFUA 3R7QA 4PK1A 2B3AA 4GOCA 3PT2B 1KLUD 3N3KB 3X0WA 2WDVB 2ZVNA 1WFYA 3PO0A 2L32A 1J19A 4MDKE 3OWEB 4RMAA 4C00A 4I6NB 3URYA 1FRDA 4TQ1A 4YTPB 1KLGD 5JHBA 1WYGA 4LNFA 5J17A 4IW0A 2LXCA 1SGHA 3PZ7A 4BFRA 4IKGA 1WE7A 2K39A 4ZRIA 2V3SA 4B0MA 4OZCA 3JVZX 5KHQA 2M19A 3NY5A 1C9FA 2V4LA 1E6EB 2N9PC 2PVGC 2LUEA 3FILA 1IGDA 1ZGUB 1GNUA 1TBEA 2WLBA 2X8XX 1XQQA 1JRPA 4M8MA 3TSSA 5AZFA 5FK9C 1KH0A 1SE4A 4HDQA 3HM6X 3M3JA 1TYGB 3WALA 3SU8X 4XYCA 4XX5A 4FLHA 4B0EA 4ZHPA 1VZ6A 4USAA 5GMVA 3HVDA 2WYQA 3S2AA 1VLBA 1NENB 2K1FA 4G50A 3TL5A 1OQRA 4G0NB 2LGXA 3QIJA 1EUVB 2WXHA 1J7BA 1XXGA 4JIOU 1WE6A 1DGJA 2ZW1A 2A4ZA 2JYEA 3GE8C 4GDLB 2MJ3A 5CHWA 3WAMA 2ZPNA 3DBLB 3GS2A 4KSLC 4BKGA 2LGDA 1C4CA 4GLSC 1OFFA 3IT6B 2LGSA 4MJSA 1F52A 3DVGY 1V5TA 1KOTA 3K9PB 5IA7A 4HJGE 1TKYA 4AOFA 4AWJA 2PKOA 1WWTA 3N20C 1V81A 4N58A 3NUHB 1V6EA 4KSKC 1SEBD 4KVGB 2V3PA 1KLVA 1XLPA 2MLBA 3ENEA 4I6PA 2N7EA 4L23A 4FADA 1JMLA 1L2NA 2RD0A 2CJNA 4YWGG 3CSFA 3TMPB 1MVKA 3RNBC 3ZW3A 4A90A 1MPEA 1T0QC 3A4SC 3AE5B 3PZDA 3VTWA 4FULA 2PLPA 4W9IA 1ET6A 4HXDA 4MSQB 1EU3A 2OOBB 1GB4A 2N9XA 3ML8A 4W9LA 4PYZA 3RNFC 1DYQA 4E74A 4W9EA 2IYDB 1JALA 2N4FA 2OHFA 2WXKA 3NVVA 3SHQA 2LWPA 2K6DB 1WGGA 2IDYA 2LVQA 2JT4B 1ZDVA 2N0SB 2KVZA 4KGSA 4KGRA 2GBJA 3QX1A 3U8ZA 1TZOA 2NBUA 1TS2A 1L4ZB 3R2IA 1RM6C 1V80A 2KACA 1L5PA 1ENFA 1BUIC 1HA5A 1WY8A 1YQ4B 4R3DA 4OVVA 4W9KA 5IKCM 2KMCA 1GC7A 3I57A 3TEYA 2WU5B 2KDIA 3IBEA 2WHIA 2ZEQA 3BVMA 5L83A 3OG5A 3A9JB 1SE3A 3W5UB 2MP2A 1T0SC 4PS7A 4IDIA 4ZRJA 3Q3MC 1Q0WB 2DZMA 4ANVA 3AEFB 4EKUA 4MGZE 4YSZB 2NCNA 1PGXA 5D94A 5HHDG 4LCDE 1H8CA 4IWOA 2N1WA 5MPOA 4NJCA 5LXHA 1HE8A 4WURA 2KX3A 3I5JC 3RYTA 4RF0A 1IGCA 2KC1A 1YJIA 2HD5B 4ICVA 2BQQA 2EMTA 3N1ZC 3N1XC 5LNK1 2BF8B 1MHHE 3RZFA 3ZXVA 4RH6A 3UIOB 2RDBC 3W1SC 1C78A 4OZBA 5C1ZA 3VR9B 1FPYA 3TJPA 4C4VA 1C3TA 2DYBA 4ANXA 3AMZA 3RD2A 4GGQA 2MWSB 3AH7A 1FXTB 3AV8A 3ZQ4A 1T6BX 2L76A 3GZNB 1T0YA 2CU3A 5BO4B 2GRIA 2KJHB 2DBYA 2MEKA 1CMXB 3H7PA 2WDTB 3VUWA 3C8YA 4MM3B 2YLMA 2EELA 3JW0X 1LM8B 4KZCA 2LI5A 2LFIA 3FKYA 3H7PB 1C4AA 4HCNB 1GOZA 2XNAC 4DHZB 1VRAB 4WAAA 1WXSA 2D3CA 3R2TA 2CHXA 2BPSA 3EA6A 2AL3A 1WMHB 3NJTA 3APFA 2LJ5A 3PVLA 1UWXA 1QOAA 2JUOA 2MQJA 5GXGB 2R2OA 3U4EG 2ASQA 3U2SC 3P4SB 3TUOA 1K8RB 1H4RA 4RM8A 3ZRFA 2LXAA 5FR6A 1ZUD2 2FUG1 2KANA 1WXMA 3PLVA 4C80A 4ITKA 2WXIA 3V62A 3W5VB 2VZKD 2C7HA 1LQBA 4ZRPA 4ASWC 3A9JA 3BK2A 1WXAA 1SJED 2L05A 1AYFA 2MH7A 4WAFA 4ZYNA 1NYQA 1WXQA 5HI1A 3HVZA 2WDRB 3VTVA 2EKEC 3PV1A 1YJJA 5EE1A 3L54A 4US9A 1R4NI 2GOWA 4WQOB 4EUTA 2LHDA 2XK5B 2MBQA 4CO7A 4HPMB 2GBKA 1AW7A 3BIID 4FJZA 4IC7B 4PS8A 1BMLC 4JLCA 1K53A 2KDFB 3N1YC
chains in the Genus database with same CATH topology
2K25A 2ZVNA 1WFYA 2J7QB 5IAAC 1Q1OA 1J19A 2LGYA 3DCGA 2PEAA 4MDKE 2RSUA 4NY0A 5L95C 2PE6B 4RMAA 2KNBA 2PPHA 4GDKA 4I6NB 2M8SA 1RAXA 2FCMA 3PTFC 4TQ1A 1WR1A 4K81A 1QZEA 3U30A 5JHBA 2FIFA 2KN5A 1A5RA 1Z5SB 1E8YA 3KH0A 1E90A 1NI2A 5J17A 4GSWA 4IW0A 2LXCA 1SGHA 2KQ7A 3IHPC 3QA8A 2KDBA 2VRRB 4BFRA 5LLIA 1WE7A 1Q5WB 2K39A 2PE9A 2WX1A 3A1QA 4ZRIA 2KWUB 1WJNA 3VXWA 2V3SA 4ANWA 2HJ8A 2Z0DB 4B9KA 4FHKA 5CHFA 3JVZX 5KHQA 2NBVB 3NY5A 2V4LA 2N9PC 4TQ0A 1RFAA 2LUEA 2KWVB 1ZGUB 1GNUA 1TBEA 1E8ZA 1XQQA 1WZ0A 4M8MA 3V6EB 3AI5A 3H9DA 5AZFA 1OGWA 1UELA 2D10A 2MBBB 4DWFA 3TBLD 5AEKB 4K1RB 3QAQA 1I42A 3ZNID 2I1JA 3PGEA 3PHWB 4GDLA 3HM6X 4HDQA 3VQIA 3M3JA 1WJUA 2KTFA 3KYDD 3SU8X 3WALA 2KOXA 4HLEA 4XX5A 3A4RA 4FLHA 4WWPA 1VD2A 2JY6A 1WGRA 3CMMB 2L8JA 2JPHA 2ZNVB 4GMVA 3OJ3A 5GMVA 5C23A 4EZLA 2WYQA 4HK2A 3WAPA 3S2AA 1G6JA 3T9LA 4GDKB 1XD3B 1WXVA 2L00B 4IWQA 3WANA 4F8CB 2FCNA 2O6VB 2EMSA 4J6IA 4A20A 2K1FA 4G50A 4NNJB 3TL5A 4JL9A 5J18A 4IM2A 2C60A 4G0NB 2LGXA 3ZTDA 4HJKA 5CX3A 2MX2A 3QIJA 2K8BA 3M63B 3VH3B 1EUVB 4HWIB 3PREA 4A3OA 2DAFA 3QJZA 4DHJD 4CYEA 2KLGA 4JIOU 1WE6A 1RRBA 4MGYE 2A4ZA 1ZKHA 4FJVB 4GDLB 2MBHA 5CHWA 3WAMA 1WGYA 2C5LC 2KFKA 3DPDA 4DK5A 2ZPNA 2UWQA 4K7SA 1KJTA 4KSLC 3APDA 4BKGA 2LGDA 2NR2A 3H6NA 4EZKA 4I6LB 1V5OA 2MRPA 3ZDMC 2FUHB 2O2VA 2LVPA 2DAJA 2Z59B 3CF6E 4MJSA 3DVGY 1KOTA 1V5TA 2LVOA 3K9PB 2D3GA 4WWNA 1NDDA 5IA7A 3OJ4B 3HIZA 4CHKA 4G11A 3SDLC 4AOFA 1C1YB 2XBBC 4AWJA 3H7SA 4RM9A 4NQLB 4NJ7A 4EEWA 2FAZA 1V81A 3PS6A 1V6EA 2CKHB 3BY4B 4KSKC 4KVGB 3ZUNA 2G4SA 2BGFA 2LRUA 1KLVA 3T8MA 2MLBA 3DBHI 3L10B 3ENEA 1UZXB 2XK5A 3DVGX 2IO2B 4I6PA 4W9CA 1V9JA 5D6JB 2M4NA 2N7EA 4MH0E 5E6PA 1X1MA 3HHMA 4PYUA 1P1AA 4FADA 3C0RB 1L2NA 1WJ4A 2N9EB 3N30A 4KZ0A 2DX5B 2RD0A 4DHJB 2NVUI 3CSFA 1E5WA 3TMPB 2RR9A 3OLMD 1EO6A 2MW5A 2LRWA 3OAWA 3KUCB 2W9NA 3A9KB 4B6WA 3KW5B 2K8CA 3QQ8B 4GB9A 3VAWA 2M17A 3ZKJC 4LDTB 1WIAA 3ZW3A 4LDTD 2GMIC 3EECA 4EZJA 2JZZA 3A4SC 1WR6E 2CHWA 1EF1A 2MBEA 3D32A 3PZDA 3QCAA 3QHTA 4HCPB 1BT0A 3VTWA 4FULA 3ZLZA 4A3PA 4M8NA 1L7YA 2HE7A 2BKFA 3DBRI 3PRZA 4W9IA 2NPTB 3KUZA 3JSVB 3DBLI 2FCQA 4HXDA 4II3B 1OTRB 4W9JA 4W9GA 2L0FA 5CTRC 2JRHA 2KTRB 1WM3A 3AU5A 4MSQB 4LJOB 2OOBB 4BOZB 2N9XA 3ALBA 3ML8A 4W9LA 4YL8A 1WX8A 4PYZA 4E74A 4W9EA 2IYDB 4M0WB 3UF8A 3QARA 4K7WA 3W1YA 2BYFA 4FN2A 2O6VA 4DDGD 4LJPB 2O2VB 3ZNHB 4DBGA 2JWZA 2N4FA 2NS5A 5KHOA 3VTUA 4B95A 2KX0A 2J0KA 1YJ1A 2BYVE 3NOBA 2C9WB 2BWES 5D2MB 1V86A 3SHQA 2KJRA 2KDEB 2LWPA 2K6DB 3PPAA 1YQBA 2IO3B 1WGGA 3KVFB 3R7RA 2LVQA 4EFOA 4ZDVA 2JT4B 2KHWB 2MBOA 3PRMB 1YX6B 2GBJA 3MTNB 3QX1A 3U8ZA 3HK0A 2KZRA 2KQSA 2NBUA 3GOEA 4MM3A 1V80A 2MA9B 3L17A 4NQKE 2C7NB 2JXXA 4XZ4A 5JZEB 4TKNA 1WM2A 2IO0B 1KM7A 3V6CB 2G4DB 4MJSB 4W9FA 2MCNB 4FBJB 2IBIB 3AULA 1D3ZA 3PRPB 1GUAB 3WAOA 4NAWA 2KMAA 4WWOA 1WY8A 1Y8RC 2UYZB 2K8HA 4HDOA 4GU2A 3LJ3A 1P3QU 1UBIA 4OVVA 4W9KA 2M1MA 3UQBA 5JH5C 2CS4A 1S3SG 4W9DA 4X57B 5DPTA 2KMCA 1P9DU 4F7ZA 2IO1B 2IY1B 1GC7A 3K9OB 4DHZE 3RZWC 3NZUA 3ZO5B 4WJNA 4WJOA 2AYOB 1E7UA 2DYMA 3M62B 3NS8A 2WX0A 4JGHB 2KDIA 3IBEA 4NJ6A 2KKCA 2ZEQA 2KLCA 5L83A 5E6OA 5G2NA 3EHVA 3ML9A 1S1QB 2RGFA 3A9JB 2MP2A 2IZVB 4BKSA 2CU1A 2K6QA 4DDID 4DXAB 4PS7A 1WI0A 4ZRJA 4HVBA 1E8XA 2ZNVC 5DPWA 1UBQA 1Q0WB 1IYFA 3SD5A 1R4MI 2DZMA 1RLFA 4E71A 4KIKA 2KFKB 3TIXA 4ANVA 2CR5A 1UGMA 3QK0A 1M94A 3ONSA 4EKUA 5JHAA 2J0JA 3PHXB 4MGIE 4MGZE 2NCNA 1WX9A 1J0GA 2L3ZA 2JZ3B 5D94A 3AU4A 1YX5B 3WIMA 4LCDE 1H8CA 4IWOA 3PLUA 2AEHA 2N1WA 3HM3A 2DHZA 3KYCD 2L7RA 3RUIB 3ZTCA 4E3CA 5LXHA 1J8CA 2AWTA 1HE8A 3A9KA 2KK8A 3VHTC 1WJ6A 2KX3A 3DQVA 2ZVOA 3RYTA 3W1SA 2LD9A 2D07B 3DOWA 4ZRKA 5DPRA 2R2QA 4NAWB 1SIFA 1GC6A 1YD8U 1GG3A 2D11A 3L0WB 2KC1A 1P0RA 2HD5B 4XC2A 4ICVA 2BYEA 3B08A 4URKA 3L13A 3RT3B 2EMTA 2KVRA 2DZIA 2BF8B 2JVCA 4FA6A 1WGHA 5EDSA 4PS3A 1TZ1A 1WX7A 3RZFA 3ZNGC 2Z0EB 4WJQA 3VDZA 4BBNC 2LASA 3UIOB 4GIVA 2MSED 3W1SC 2KO3A 2RPQA 1IP9A 5C1ZA 4AJWA 2D2QA 1WRDB 1Z2MA 1WZ3A 2ZCCA 3TJPA 1C3TA 2M0XA 2DYBA 3Q3JA 4KV2A 1WMHA 4ANXA 1UD7A 3ZIMA 3RD2A 1EF5A 2MP2B 4GGQA 2MWSB 1FXTB 1LXDA 3P2BA 2DENB 2L76A 4TUUA 2DZKA 3AXCA 3ZDTA 1T0YA 3X23A 2REXA 3L16A 3NZSA 4AJYB 3QWZB 5BO4B 2KJHB 2OJRA 3IG3A 2XEWA 4AUQC 1CMXB 3H7PA 4ICUA 2WDTB 4BOSC 1V49A 3VUWA 5HKHA 1OEYA 4GXBA 4BBNF 1ZW7A 2YLMA 1IPGA 3M95A 3R66C 4P7IA 2O6VD 3JW0X 4NPNA 4WJPA 2JF5A 1LM8B 3WA0A 3DBSA 3GZNI 4IM0A 4KZCA 2LI5A 3EC8A 5DPSA 1V2YA 3H7PB 2N1VA 4HCNB 3ZNZB 4AP4C 4MEMA 4DHZB 2KC2A 4FHJA 5TR5A 4WAAA 3EFUA 3IFWB 1WYWB 4MGKE 2A5UA 3UGBB 1WXSA 1MG8A 4MSMB 3VUXA 2L0TA 2DYOA 4JQWC 4MELA 2CHXA 2GBMA 2ZZPB 3H1UA 5AZHA 3V60A 2BPSA 2AL3A 1WF9A 1WMHB 1UH6A 2KWCA 2G3QB 1VCBA 2FIDA 3APFA 4GN1A 3VFKA 4HPLB 1I35A 4IUMB 2LJ5A 3PVLA 2V1YA 3I3TB 3UINB 4IM3A 5G55A 2JUOA 1JRUA 1P98A 2MQJA 2QHOA 2NBWB 2R2OA 3VH4B 2ASQA 5D7GA 2J0MA 5AZGA 3UQAA 3U7DA 1U4AA 4F1SA 2N7DA 1K8RB 2BKRB 1H4RA 2NPTA 2DZJA 4RM8A 3ZRFA 2BWFA 2GBRA 3R3MA 2LXAA 3LDZE 4BVUC 2I1KA 5FR6A 5DCNA 2ZPYA 2WWZA 4OVUA 2FCSA 3ECIA 2KANA 4W9HA 1WXMA 2KXJA 3UIPB 3A33B 1GJZA 1XT9B 3PLVA 2G45B 3RULA 1SE9A 5E6NA 1PQSA 1OQYA 3N32A 2PJHA 4G3XB 3APCA 3BINA 4KDLB 1F9JA 3V62A 3DVNU 3IVFA 1E8WA 2HTHA 2C7HA 3CSTA 3JYUA 3ZRCA 1LQBA 4ANUA 4II2B 1LFDA 4ASWC 3ZVVA 1WGDA 3A9JA 4EOYA 5LXIB 4IG7B 2Y5BB 1WXAA 2L05A 3JSVA 2FNJB 4ZYNA 3MHSD 2KJ6A 1OEYJ 1TGZB 2KD0A 2KFJA 2ZJDA 4K7UA 3QC8B 3DVNV 3KUDB 4FJYA 4KIKB 3NHEB 2JRIB 2IY0B 2ZCBA 3TCAA 1WH3A 3RCZA 3VTVA 2EKEC 2YVCA 2C7MB 3PV1A 4KDIC 1ISNA 3L54A 1NBFC 1R4NI 1E7VA 2GOWA 3MJWA 4WQOB 4EUTA 3V61A 3B0AA 1YIWA 4BKTA 1TTNA 2XK5B 3L08A 4TV3A 3VVWB 5J2RA 2LZ6A 4IWPA 3B1LX 3DDCB 2MBQA 3A1QB 2KTRA 3O65B 4HPMB 4CO7A 5CHVC 2CHZA 2GBKA 3Q3FA 4N9F4 4BKSD 3R7QA 1AARA 2AL6A 4IC7B 4FJZA 2B3AA 4GOCA 4PS8A 3PT2B 3PSEB 3VUYA 3N3KB 4JLCA 3X0WA 2KDFB 2GBNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K25 A;  2ZVN A;  1WFY A;  2J7Q B;  5IAA C;  1Q1O A;  1J19 A;  2LGY A;  3DCG A;  2PEA A;  4MDK E;  2RSU A;  4NY0 A;  5L95 C;  2PE6 B;  4RMA A;  2KNB A;  2PPH A;  4GDK A;  4I6N B;  2M8S A;  1RAX A;  2FCM A;  3PTF C;  4TQ1 A;  1WR1 A;  4K81 A;  1QZE A;  3U30 A;  5JHB A;  2FIF A;  2KN5 A;  1A5R A;  1Z5S B;  1E8Y A;  3KH0 A;  1E90 A;  1NI2 A;  5J17 A;  4GSW A;  4IW0 A;  2LXC A;  1SGH A;  2KQ7 A;  3IHP C;  3QA8 A;  2KDB A;  2VRR B;  4BFR A;  5LLI A;  1WE7 A;  1Q5W B;  2K39 A;  2PE9 A;  2WX1 A;  3A1Q A;  4ZRI A;  2KWU B;  1WJN A;  3VXW A;  2V3S A;  4ANW A;  2HJ8 A;  2Z0D B;  4B9K A;  4FHK A;  5CHF A;  3JVZ X;  5KHQ A;  2NBV B;  3NY5 A;  2V4L A;  2N9P C;  4TQ0 A;  1RFA A;  2LUE A;  2KWV B;  1ZGU B;  1GNU A;  1TBE A;  1E8Z A;  1XQQ A;  1WZ0 A;  4M8M A;  3V6E B;  3AI5 A;  3H9D A;  5AZF A;  1OGW A;  1UEL A;  2D10 A;  2MBB B;  4DWF A;  3TBL D;  5AEK B;  4K1R B;  3QAQ A;  1I42 A;  3ZNI D;  2I1J A;  3PGE A;  3PHW B;  4GDL A;  3HM6 X;  4HDQ A;  3VQI A;  3M3J A;  1WJU A;  2KTF A;  3KYD D;  3SU8 X;  3WAL A;  2KOX A;  4HLE A;  4XX5 A;  3A4R A;  4FLH A;  4WWP A;  1VD2 A;  2JY6 A;  1WGR A;  3CMM B;  2L8J A;  2JPH A;  2ZNV B;  4GMV A;  3OJ3 A;  5GMV A;  5C23 A;  4EZL A;  2WYQ A;  4HK2 A;  3WAP A;  3S2A A;  1G6J A;  3T9L A;  4GDK B;  1XD3 B;  1WXV A;  2L00 B;  4IWQ A;  3WAN A;  4F8C B;  2FCN A;  2O6V B;  2EMS A;  4J6I A;  4A20 A;  2K1F A;  4G50 A;  4NNJ B;  3TL5 A;  4JL9 A;  5J18 A;  4IM2 A;  2C60 A;  4G0N B;  2LGX A;  3ZTD A;  4HJK A;  5CX3 A;  2MX2 A;  3QIJ A;  2K8B A;  3M63 B;  3VH3 B;  1EUV B;  4HWI B;  3PRE A;  4A3O A;  2DAF A;  3QJZ A;  4DHJ D;  4CYE A;  2KLG A;  4JIO U;  1WE6 A;  1RRB A;  4MGY E;  2A4Z A;  1ZKH A;  4FJV B;  4GDL B;  2MBH A;  5CHW A;  3WAM A;  1WGY A;  2C5L C;  2KFK A;  3DPD A;  4DK5 A;  2ZPN A;  2UWQ A;  4K7S A;  1KJT A;  4KSL C;  3APD A;  4BKG A;  2LGD A;  2NR2 A;  3H6N A;  4EZK A;  4I6L B;  1V5O A;  2MRP A;  3ZDM C;  2FUH B;  2O2V A;  2LVP A;  2DAJ A;  2Z59 B;  3CF6 E;  4MJS A;  3DVG Y;  1KOT A;  1V5T A;  2LVO A;  3K9P B;  2D3G A;  4WWN A;  1NDD A;  5IA7 A;  3OJ4 B;  3HIZ A;  4CHK A;  4G11 A;  3SDL C;  4AOF A;  1C1Y B;  2XBB C;  4AWJ A;  3H7S A;  4RM9 A;  4NQL B;  4NJ7 A;  4EEW A;  2FAZ A;  1V81 A;  3PS6 A;  1V6E A;  2CKH B;  3BY4 B;  4KSK C;  4KVG B;  3ZUN A;  2G4S A;  2BGF A;  2LRU A;  1KLV A;  3T8M A;  2MLB A;  3DBH I;  3L10 B;  3ENE A;  1UZX B;  2XK5 A;  3DVG X;  2IO2 B;  4I6P A;  4W9C A;  1V9J A;  5D6J B;  2M4N A;  2N7E A;  4MH0 E;  5E6P A;  1X1M A;  3HHM A;  4PYU A;  1P1A A;  4FAD A;  3C0R B;  1L2N A;  1WJ4 A;  2N9E B;  3N30 A;  4KZ0 A;  2DX5 B;  2RD0 A;  4DHJ B;  2NVU I;  3CSF A;  1E5W A;  3TMP B;  2RR9 A;  3OLM D;  1EO6 A;  2MW5 A;  2LRW A;  3OAW A;  3KUC B;  2W9N A;  3A9K B;  4B6W A;  3KW5 B;  2K8C A;  3QQ8 B;  4GB9 A;  3VAW A;  2M17 A;  3ZKJ C;  4LDT B;  1WIA A;  3ZW3 A;  4LDT D;  2GMI C;  3EEC A;  4EZJ A;  2JZZ A;  3A4S C;  1WR6 E;  2CHW A;  1EF1 A;  2MBE A;  3D32 A;  3PZD A;  3QCA A;  3QHT A;  4HCP B;  1BT0 A;  3VTW A;  4FUL A;  3ZLZ A;  4A3P A;  4M8N A;  1L7Y A;  2HE7 A;  2BKF A;  3DBR I;  3PRZ A;  4W9I A;  2NPT B;  3KUZ A;  3JSV B;  3DBL I;  2FCQ A;  4HXD A;  4II3 B;  1OTR B;  4W9J A;  4W9G A;  2L0F A;  5CTR C;  2JRH A;  2KTR B;  1WM3 A;  3AU5 A;  4MSQ B;  4LJO B;  2OOB B;  4BOZ B;  2N9X A;  3ALB A;  3ML8 A;  4W9L A;  4YL8 A;  1WX8 A;  4PYZ A;  4E74 A;  4W9E A;  2IYD B;  4M0W B;  3UF8 A;  3QAR A;  4K7W A;  3W1Y A;  2BYF A;  4FN2 A;  2O6V A;  4DDG D;  4LJP B;  2O2V B;  3ZNH B;  4DBG A;  2JWZ A;  2N4F A;  2NS5 A;  5KHO A;  3VTU A;  4B95 A;  2KX0 A;  2J0K A;  1YJ1 A;  2BYV E;  3NOB A;  2C9W B;  2BWE S;  5D2M B;  1V86 A;  3SHQ A;  2KJR A;  2KDE B;  2LWP A;  2K6D B;  3PPA A;  1YQB A;  2IO3 B;  1WGG A;  3KVF B;  3R7R A;  2LVQ A;  4EFO A;  4ZDV A;  2JT4 B;  2KHW B;  2MBO A;  3PRM B;  1YX6 B;  2GBJ A;  3MTN B;  3QX1 A;  3U8Z A;  3HK0 A;  2KZR A;  2KQS A;  2NBU A;  3GOE A;  4MM3 A;  1V80 A;  2MA9 B;  3L17 A;  4NQK E;  2C7N B;  2JXX A;  4XZ4 A;  5JZE B;  4TKN A;  1WM2 A;  2IO0 B;  1KM7 A;  3V6C B;  2G4D B;  4MJS B;  4W9F A;  2MCN B;  4FBJ B;  2IBI B;  3AUL A;  1D3Z A;  3PRP B;  1GUA B;  3WAO A;  4NAW A;  2KMA A;  4WWO A;  1WY8 A;  1Y8R C;  2UYZ B;  2K8H A;  4HDO A;  4GU2 A;  3LJ3 A;  1P3Q U;  1UBI A;  4OVV A;  4W9K A;  2M1M A;  3UQB A;  5JH5 C;  2CS4 A;  1S3S G;  4W9D A;  4X57 B;  5DPT A;  2KMC A;  1P9D U;  4F7Z A;  2IO1 B;  2IY1 B;  1GC7 A;  3K9O B;  4DHZ E;  3RZW C;  3NZU A;  3ZO5 B;  4WJN A;  4WJO A;  2AYO B;  1E7U A;  2DYM A;  3M62 B;  3NS8 A;  2WX0 A;  4JGH B;  2KDI A;  3IBE A;  4NJ6 A;  2KKC A;  2ZEQ A;  2KLC A;  5L83 A;  5E6O A;  5G2N A;  3EHV A;  3ML9 A;  1S1Q B;  2RGF A;  3A9J B;  2MP2 A;  2IZV B;  4BKS A;  2CU1 A;  2K6Q A;  4DDI D;  4DXA B;  4PS7 A;  1WI0 A;  4ZRJ A;  4HVB A;  1E8X A;  2ZNV C;  5DPW A;  1UBQ A;  1Q0W B;  1IYF A;  3SD5 A;  1R4M I;  2DZM A;  1RLF A;  4E71 A;  4KIK A;  2KFK B;  3TIX A;  4ANV A;  2CR5 A;  1UGM A;  3QK0 A;  1M94 A;  3ONS A;  4EKU A;  5JHA A;  2J0J A;  3PHX B;  4MGI E;  4MGZ E;  2NCN A;  1WX9 A;  1J0G A;  2L3Z A;  2JZ3 B;  5D94 A;  3AU4 A;  1YX5 B;  3WIM A;  4LCD E;  1H8C A;  4IWO A;  3PLU A;  2AEH A;  2N1W A;  3HM3 A;  2DHZ A;  3KYC D;  2L7R A;  3RUI B;  3ZTC A;  4E3C A;  5LXH A;  1J8C A;  2AWT A;  1HE8 A;  3A9K A;  2KK8 A;  3VHT C;  1WJ6 A;  2KX3 A;  3DQV A;  2ZVO A;  3RYT A;  3W1S A;  2LD9 A;  2D07 B;  3DOW A;  4ZRK A;  5DPR A;  2R2Q A;  4NAW B;  1SIF A;  1GC6 A;  1YD8 U;  1GG3 A;  2D11 A;  3L0W B;  2KC1 A;  1P0R A;  2HD5 B;  4XC2 A;  4ICV A;  2BYE A;  3B08 A;  4URK A;  3L13 A;  3RT3 B;  2EMT A;  2KVR A;  2DZI A;  2BF8 B;  2JVC A;  4FA6 A;  1WGH A;  5EDS A;  4PS3 A;  1TZ1 A;  1WX7 A;  3RZF A;  3ZNG C;  2Z0E B;  4WJQ A;  3VDZ A;  4BBN C;  2LAS A;  3UIO B;  4GIV A;  2MSE D;  3W1S C;  2KO3 A;  2RPQ A;  1IP9 A;  5C1Z A;  4AJW A;  2D2Q A;  1WRD B;  1Z2M A;  1WZ3 A;  2ZCC A;  3TJP A;  1C3T A;  2M0X A;  2DYB A;  3Q3J A;  4KV2 A;  1WMH A;  4ANX A;  1UD7 A;  3ZIM A;  3RD2 A;  1EF5 A;  2MP2 B;  4GGQ A;  2MWS B;  1FXT B;  1LXD A;  3P2B A;  2DEN B;  2L76 A;  4TUU A;  2DZK A;  3AXC A;  3ZDT A;  1T0Y A;  3X23 A;  2REX A;  3L16 A;  3NZS A;  4AJY B;  3QWZ B;  5BO4 B;  2KJH B;  2OJR A;  3IG3 A;  2XEW A;  4AUQ C;  1CMX B;  3H7P A;  4ICU A;  2WDT B;  4BOS C;  1V49 A;  3VUW A;  5HKH A;  1OEY A;  4GXB A;  4BBN F;  1ZW7 A;  2YLM A;  1IPG A;  3M95 A;  3R66 C;  4P7I A;  2O6V D;  3JW0 X;  4NPN A;  4WJP A;  2JF5 A;  1LM8 B;  3WA0 A;  3DBS A;  3GZN I;  4IM0 A;  4KZC A;  2LI5 A;  3EC8 A;  5DPS A;  1V2Y A;  3H7P B;  2N1V A;  4HCN B;  3ZNZ B;  4AP4 C;  4MEM A;  4DHZ B;  2KC2 A;  4FHJ A;  5TR5 A;  4WAA A;  3EFU A;  3IFW B;  1WYW B;  4MGK E;  2A5U A;  3UGB B;  1WXS A;  1MG8 A;  4MSM B;  3VUX A;  2L0T A;  2DYO A;  4JQW C;  4MEL A;  2CHX A;  2GBM A;  2ZZP B;  3H1U A;  5AZH A;  3V60 A;  2BPS A;  2AL3 A;  1WF9 A;  1WMH B;  1UH6 A;  2KWC A;  2G3Q B;  1VCB A;  2FID A;  3APF A;  4GN1 A;  3VFK A;  4HPL B;  1I35 A;  4IUM B;  2LJ5 A;  3PVL A;  2V1Y A;  3I3T B;  3UIN B;  4IM3 A;  5G55 A;  2JUO A;  1JRU A;  1P98 A;  2MQJ A;  2QHO A;  2NBW B;  2R2O A;  3VH4 B;  2ASQ A;  5D7G A;  2J0M A;  5AZG A;  3UQA A;  3U7D A;  1U4A A;  4F1S A;  2N7D A;  1K8R B;  2BKR B;  1H4R A;  2NPT A;  2DZJ A;  4RM8 A;  3ZRF A;  2BWF A;  2GBR A;  3R3M A;  2LXA A;  3LDZ E;  4BVU C;  2I1K A;  5FR6 A;  5DCN A;  2ZPY A;  2WWZ A;  4OVU A;  2FCS A;  3ECI A;  2KAN A;  4W9H A;  1WXM A;  2KXJ A;  3UIP B;  3A33 B;  1GJZ A;  1XT9 B;  3PLV A;  2G45 B;  3RUL A;  1SE9 A;  5E6N A;  1PQS A;  1OQY A;  3N32 A;  2PJH A;  4G3X B;  3APC A;  3BIN A;  4KDL B;  1F9J A;  3V62 A;  3DVN U;  3IVF A;  1E8W A;  2HTH A;  2C7H A;  3CST A;  3JYU A;  3ZRC A;  1LQB A;  4ANU A;  4II2 B;  1LFD A;  4ASW C;  3ZVV A;  1WGD A;  3A9J A;  4EOY A;  5LXI B;  4IG7 B;  2Y5B B;  1WXA A;  2L05 A;  3JSV A;  2FNJ B;  4ZYN A;  3MHS D;  2KJ6 A;  1OEY J;  1TGZ B;  2KD0 A;  2KFJ A;  2ZJD A;  4K7U A;  3QC8 B;  3DVN V;  3KUD B;  4FJY A;  4KIK B;  3NHE B;  2JRI B;  2IY0 B;  2ZCB A;  3TCA A;  1WH3 A;  3RCZ A;  3VTV A;  2EKE C;  2YVC A;  2C7M B;  3PV1 A;  4KDI C;  1ISN A;  3L54 A;  1NBF C;  1R4N I;  1E7V A;  2GOW A;  3MJW A;  4WQO B;  4EUT A;  3V61 A;  3B0A A;  1YIW A;  4BKT A;  1TTN A;  2XK5 B;  3L08 A;  4TV3 A;  3VVW B;  5J2R A;  2LZ6 A;  4IWP A;  3B1L X;  3DDC B;  2MBQ A;  3A1Q B;  2KTR A;  3O65 B;  4HPM B;  4CO7 A;  5CHV C;  2CHZ A;  2GBK A;  3Q3F A;  4N9F 4;  4BKS D;  3R7Q A;  1AAR A;  2AL6 A;  4IC7 B;  4FJZ A;  2B3A A;  4GOC A;  4PS8 A;  3PT2 B;  3PSE B;  3VUY A;  3N3K B;  4JLC A;  3X0W A;  2KDF B;  2GBN A; 
#chains in the Genus database with same CATH topology
 2K25 A;  5IAA C;  2QJL A;  2D5G A;  1V1P B;  2W55 A;  1FD6 A;  2RSU A;  2V4I B;  2M8S A;  1RAX A;  2FCM A;  1KRH A;  1GAQ B;  3FAH A;  1QZE A;  1A5R A;  2KN5 A;  1Z5S B;  4WH4 A;  3KH0 A;  1E90 A;  2WP9 B;  2QMT A;  4HRS A;  2KQ7 A;  3IHP C;  2KMM A;  1NVI D;  1GB1 A;  2WX1 A;  3Q6B A;  1HTO A;  4TMA B;  5IP4 D;  4ANW A;  2HJ8 A;  2Z0D B;  1XCT L;  2IGH A;  4FHK A;  2I38 A;  2ON8 A;  1MFW A;  3GB1 A;  2SEB D;  2BYT A;  1XO3 A;  3V6E B;  3H9D A;  1DOX A;  1OGW A;  2D10 A;  3TBL D;  3V3X A;  1M4V A;  1C79 A;  1UGJ A;  2RDH A;  4LNO A;  3ZNI D;  2I1J A;  3PGE A;  3PHW B;  2PVO D;  2RDG A;  3DHH C;  1WJU A;  2KTF A;  2YEP B;  1NYR A;  2K3U A;  4ZYS A;  4HK2 A;  1N61 A;  4GDK B;  4IWQ A;  2FCN A;  2O6V B;  2XN9 C;  4J6I A;  1LGR A;  1OQQ A;  4NNJ B;  4JL9 A;  5J18 A;  5CX3 A;  3VH3 B;  2DAF A;  4NAM A;  4DHJ D;  4CYE A;  2KLG A;  4H2A A;  2JXT A;  1K50 A;  4MGY E;  2MBH A;  4K7S A;  1L0Y B;  3V05 A;  3HRD D;  4RGT A;  3ZJT A;  2MRP A;  3NZ3 A;  2O2V A;  4YSX B;  2Z59 B;  2KYW A;  1YNT E;  1SF0 A;  3OJ4 B;  4G11 A;  3SDL C;  3Q8A A;  1ACC A;  4YSY B;  4NQL B;  2FAZ A;  4CQN A;  4RNA A;  3PS6 A;  3ZUN A;  2G4S A;  2BGF A;  4OHJ A;  3P42 A;  1CK1 A;  3DBH I;  3L10 B;  4P1C C;  2QCZ A;  4S17 A;  3DVG X;  2XK5 A;  5D6J B;  3HHM A;  4PYU A;  3VR8 B;  2WXP A;  3C0R B;  2N9E B;  3FC4 A;  1QQR A;  4KZ0 A;  4DHJ B;  1E5W A;  2RR9 A;  3OLM D;  3KLS X;  2MW5 A;  1FXI A;  1ZPS A;  3KUC B;  2W9N A;  3KW5 B;  3PZ8 A;  2QSD A;  2GMI C;  4LDT D;  1J7A A;  1EF1 A;  3QCA A;  1N6Z A;  1BT0 A;  4OVZ A;  2HE7 A;  2BKF A;  3PRZ A;  2BW2 A;  3JSV B;  3DBL I;  1OTR B;  2L0F A;  3AU5 A;  1WM3 A;  1FM0 D;  1B1Z A;  3ALB A;  4YL8 A;  3H8H A;  3B9J A;  4DBG A;  2DWQ A;  2NS5 A;  3VTU A;  1V1P A;  3TEZ A;  2H89 B;  5D2M B;  2ACZ B;  1V86 A;  1FO4 A;  2KJR A;  1GPX A;  1YQB A;  2IO3 B;  3R7R A;  5JXV A;  4ZDV A;  2HDE A;  2KZR A;  3GOE A;  3ZJU A;  4MM3 A;  3AE6 B;  2JXX A;  3BYT B;  5JZE B;  1UUP A;  2G4D B;  4W9F A;  4FBJ B;  5IN7 A;  5EE9 A;  4WWO A;  2UYZ B;  1VR9 A;  1MI0 A;  3UQB A;  1N62 A;  1EM7 A;  2CS4 A;  4W9D A;  4X57 B;  2IO1 B;  1C77 A;  4DHZ E;  3RZW C;  3NZU A;  2Y5C A;  2TSS A;  3ZO5 B;  2AYO B;  2E6X A;  4ZOH C;  1K52 A;  1E7U A;  3NS8 A;  4A9A A;  2DLB A;  2LEK A;  3NVZ A;  1IBX A;  5TSS A;  2IZV B;  2CU1 A;  5FR3 A;  3AED B;  3Q8F A;  1UBQ A;  4MT5 A;  3BVG A;  3TIX A;  1FNV A;  1KFY B;  3Q14 C;  4MGI E;  1WSP A;  3KYC D;  1J8C A;  2AWT A;  5BYR A;  3P4R B;  3W1S A;  3DWM A;  4ARI A;  3DOW A;  3MHZ A;  4NAW B;  1SIF A;  1JQ4 A;  1GG3 A;  4C7Z A;  1P0R A;  3GE3 C;  4XC2 A;  2PW9 A;  2KVR A;  1WGH A;  4M01 A;  4PS3 A;  1TZ1 A;  3VDZ A;  2LAS A;  2MSE D;  5E6J A;  2KO3 A;  3AE2 B;  3RNG C;  2RMM A;  3Q3N C;  1F2R C;  4AJW A;  2MJE A;  4N59 A;  1Z2M A;  2OED A;  1WZ3 A;  5I4D A;  4KV2 A;  3KQ4 A;  4LNK A;  2SAK A;  2DEN B;  1P7F A;  5AUI A;  2DZK A;  3E9S A;  3SEB A;  2REX A;  3LYY A;  1JCK B;  3QWZ B;  3O13 A;  2QC8 A;  3IG3 A;  2H88 B;  4YTN B;  5HKH A;  1OEY A;  2Z8L A;  4IM0 A;  3P4P B;  5DPS A;  1V2Y A;  5G5G A;  3ZNZ B;  4MEM A;  5TR5 A;  3EFU A;  4MGK E;  4YTM B;  2L0T A;  4C4V B;  2GBM A;  1WF9 A;  2G3Q B;  1VCB A;  3VFK A;  1I35 A;  2HJ1 A;  3MJ5 A;  4LLG M;  1N5X A;  1XLO A;  4IM3 A;  3SR6 A;  2DNF A;  2QHO A;  1FCC C;  3ZYY X;  1QF6 A;  3U7D A;  1U4A A;  1T5X D;  2LJI A;  2IJ0 A;  4LTU A;  3W9C B;  2I1K A;  4LNI A;  2ZPY A;  4W9H A;  3UIP B;  2D3A A;  1UWM A;  5E6N A;  1ET9 A;  1IUE A;  3N32 A;  1E9M A;  3APC A;  3P63 A;  3BIN A;  4KDL B;  1F9J A;  3DVN U;  3CST A;  1UNS A;  1D5Z C;  3JYU A;  4II2 B;  1LFD A;  2KQ4 X;  3ZVV A;  4US8 A;  5LXI B;  2VH1 A;  3IXS A;  2Y5B B;  4DXF A;  1T3Q A;  3MHS D;  2KFJ A;  3QC8 B;  3DVN V;  4FJY A;  1Q10 A;  3NHE B;  2JRI B;  4M02 A;  2IY0 B;  2ZCB A;  3TCA A;  1T0R C;  3DBH B;  3RCZ A;  1YQ3 B;  4JX1 C;  4ZRQ A;  4KDI C;  3C19 A;  1NBF C;  1E7V A;  4KX6 B;  2V9H A;  3Q8C A;  2BS4 B;  1TTN A;  3L08 A;  1SE2 A;  1V97 A;  4IWP A;  3DDC B;  3A1Q B;  2PMV A;  3MC9 A;  4N9F 4;  2AL6 A;  3DBR B;  2J7Q B;  5T8I A;  3VRB B;  1P7E A;  2LGY A;  3DCG A;  2PEA A;  4FXC A;  5L95 C;  2PE6 B;  2KNB A;  2PPH A;  3PTF C;  3UI3 A;  1WR1 A;  3AEG B;  4K81 A;  2FIF A;  3MC0 B;  4GSW A;  3RMK C;  2ONQ A;  4WIP A;  2Y5P A;  5LLI A;  1I4Q A;  1CQV A;  1Q5W B;  2PE9 A;  2L83 A;  2KWU B;  1WJN A;  3VXW A;  2AX5 A;  1F0Z A;  3Q2A C;  4A6Q A;  2INP E;  1WRI A;  4TQ0 A;  1RFA A;  1TIF A;  3CIR B;  4LK0 M;  2EKI A;  2K22 A;  1E8Z A;  1WZ0 A;  3AI5 A;  1EWC A;  1FRR A;  4DWF A;  2MBB B;  2BS2 B;  5AEK B;  4C7Y A;  3VQI A;  3NG0 A;  2KOX A;  4HLE A;  3BVZ A;  3A4R A;  4WWP A;  1HQR D;  1VD2 A;  1XEE A;  3CMM B;  2JPH A;  2ZNV B;  3I9V 1;  5C23 A;  4EZL A;  1G6J A;  1JWS D;  5H8Y E;  3WAN A;  4F8C B;  2EMS A;  4A20 A;  1E7P B;  1F2R I;  2C60 A;  3ZTD A;  1FNW A;  1SIJ A;  1PGA A;  4HWI B;  4XE0 A;  1FXA A;  3RNE C;  1ZE3 D;  3HUI A;  1JWA D;  1ZKH A;  4FJV B;  1I4X A;  1WGY A;  2J52 A;  5IO9 A;  2KFK A;  2PIA A;  3DPD A;  4DK5 A;  2UWQ A;  1KJT A;  3APD A;  2NR2 A;  4I6L B;  3ZDM C;  2NTS A;  2LVP A;  2DAJ A;  1R4M B;  2GB1 A;  3CF6 E;  1D5X C;  3IAS 1;  2J4X A;  2LVO A;  2D3G A;  2ICI A;  4WWN A;  1NDD A;  5BMG A;  3ABV B;  3HIZ A;  4CHK A;  4AQ7 A;  3WCQ A;  2M56 B;  1VZ7 A;  2CKH B;  4BZA A;  4XDC A;  1J7C A;  4KKI A;  1UZX B;  4W9C A;  4P1B C;  1NEK B;  2W3S A;  2K9X A;  1P1A A;  3RN9 C;  1E10 A;  3FIL B;  1WJ4 A;  3N30 A;  2NVU I;  1STE A;  2LRW A;  3VAW A;  3ZKJ C;  4LDT B;  1WIA A;  3EEC A;  1TS5 A;  1WR6 E;  3D32 A;  4BAX A;  3QHT A;  3ZLZ A;  5HFY A;  4M8N A;  2WS3 B;  3DBR I;  3ZGZ A;  2NPT B;  3Q8B A;  5CTR C;  4BOZ B;  1QOF A;  1HZ6 A;  2KDM A;  1WX8 A;  1FFV A;  3ETR A;  3UF8 A;  3W1Y A;  4FN2 A;  4OZA A;  3I63 C;  2JWZ A;  5KHO A;  4B95 A;  2BYV E;  4NZL B;  5G5H A;  1I4P A;  2R61 A;  2V3N A;  2OJW A;  3J9C A;  2KHW B;  3PRM B;  1YX6 B;  1ZDX A;  3MTN B;  2BB5 A;  4WQM A;  2WXJ A;  2MA9 B;  4NQK E;  3L17 A;  2C7N B;  4XZ4 A;  1MG4 A;  1WM2 A;  3SFD B;  4MJS B;  2IBI B;  3AUL A;  1D3Z A;  3WAO A;  1GUA B;  1HTQ A;  1Y8R C;  1XF5 L;  1FMA D;  1P3Q U;  2RPV A;  4WWM A;  4S0R A;  1JRO A;  5DPT A;  1P9D U;  2IY1 B;  3LXF A;  3K9O B;  1TY0 A;  5D3I B;  1TJE A;  2YEP F;  1EWY C;  2DYM A;  2IGG A;  2WX0 A;  4JGH B;  3B2G A;  3RFZ B;  2MHJ A;  3RNC C;  5G2N A;  3AN1 A;  1S1Q B;  4HKZ E;  1HZ5 A;  4BKS A;  2M0A A;  1F1H A;  2L52 A;  4HVB A;  1E8X A;  1I4R A;  2WXL A;  2AQ3 B;  2ZNV C;  5DPW A;  1IYF A;  3SD5 A;  1R4M I;  1RLF A;  2KFK B;  3KWL A;  2CR5 A;  3ONS A;  4KKJ A;  5JHA A;  2J0J A;  2JU6 X;  1WX9 A;  2HTM E;  3PLU A;  2G1E A;  2L7R A;  4E3C A;  5BYQ A;  3A9K A;  3LB8 C;  1QIL A;  2ZVO A;  1I4G A;  1ZXH A;  4ZRK A;  3L0W B;  1VJK A;  2Y3A A;  2BYE A;  3AE8 B;  1FCL A;  2JVC A;  4FA6 A;  5EDS A;  4ARC A;  1B9R A;  3ZNG C;  2Z0E B;  4WJQ A;  4BBN C;  4GIV A;  5D3D A;  2RPQ A;  2D2Q A;  3VRA B;  3AEC B;  2GLS A;  2M0X A;  1UD7 A;  1EF5 A;  2MP2 B;  2JSV X;  5H92 C;  2J42 A;  1LXD A;  2LGI A;  4AJY B;  3NZS A;  3L16 A;  2NMQ A;  1ZOY B;  2PTL A;  2OJR A;  1D5M C;  2XEW A;  2BTE A;  3NVW A;  2WXR A;  4HKQ A;  1V49 A;  3U52 E;  1LO5 D;  3SFE B;  3M95 A;  4P7I A;  2O6V D;  4WJP A;  2L1A A;  3GZN I;  3EC8 A;  4P16 A;  3AEB B;  2N1V A;  2WQY B;  2A5U A;  2BS3 B;  3UGB B;  1MG8 A;  1KTK A;  2BBC A;  3VUX A;  2JQR B;  4MEL A;  4JQW C;  3H1U A;  1XLQ A;  1SJH D;  1UH6 A;  2KWC A;  2FID A;  4GN1 A;  4HPL B;  4IUM B;  5C2T B;  2V1Y A;  3I3T B;  3UIN B;  5G55 A;  1RYJ A;  1JRU A;  2NBW B;  4K3C A;  1FIQ A;  4OW0 A;  5D7G A;  2J0M A;  5AZG A;  4DQO C;  4F1S A;  3R3M A;  3LDZ E;  1F77 A;  2WWZ A;  4OVU A;  2KXJ A;  3MC8 A;  1GJZ A;  3BWU D;  2G45 B;  2ZW0 A;  1SE9 A;  3ZJV A;  1OQY A;  4G3X B;  1RWS A;  3NS1 A;  2JX5 A;  1KF6 B;  4ANU A;  4EOY A;  1WGD A;  3RI7 C;  4IG7 B;  2FE8 A;  1TT5 B;  2KJ6 A;  1XLN A;  1OEY J;  1L6V A;  1TGZ B;  4K7U A;  1DOI A;  4QAY A;  1FEH A;  1HXY D;  1A70 A;  3ZXR A;  1E0Z A;  4O1N A;  2YVC A;  1ISN A;  3B2F A;  3AE7 B;  2V0G A;  3B0A A;  4A8X C;  5J2R A;  2KTR A;  4JWS C;  2CJO A;  2CHZ A;  1ROE A;  4BKS D;  4XWW A;  1AAR A;  3EFC A;  4RGM A;  3PSE B;  3VUY A;  2GBN A;  4HPP A;  2N7J A;  2QIL A;  1Q1O A;  1ESF A;  1AN8 A;  2IGD A;  4NY0 A;  2K0P A;  4GDK A;  4P6V F;  3P1M A;  1PFD A;  2INN E;  3U30 A;  1AWD A;  2I2Y A;  3TEW A;  1E8Y A;  1NI2 A;  4KGT A;  3QA8 A;  2KDB A;  2VRR B;  4M0W A;  1N63 A;  3A1Q A;  2FBW B;  1I7H A;  1DOY A;  4RCO A;  2WXO A;  4B9K A;  2MJD A;  5CHF A;  3AEE B;  1QOG A;  2NBV B;  1R7S A;  2LUM A;  2KWV B;  1SB3 C;  4AS1 A;  1V1O A;  3DHG C;  1UEL A;  3MFG A;  4J3O D;  4K1R B;  3QAQ A;  1I42 A;  4RFB A;  1CZP A;  4GDL A;  4UDU C;  2D3B A;  3KYD D;  2WXN A;  4EE2 A;  2JY6 A;  1WGR A;  2L8J A;  2UU7 A;  3DHI C;  4GMV A;  3R8B A;  3OJ3 A;  3P4Q B;  3WAP A;  3T9L A;  1XD3 B;  1WXV A;  2L00 B;  2WGS A;  5C3J B;  5EE0 A;  4IM2 A;  4HJK A;  1N5W A;  2MX2 A;  2K8B A;  3M63 B;  1UF0 A;  3W2D A;  3PRE A;  4A3O A;  1HEZ E;  3QJZ A;  1YN3 A;  3L4P A;  1RRB A;  2WXF A;  3AM9 A;  2B76 B;  2C5L C;  5BYS A;  1SSN A;  3AE9 B;  3H6N A;  2QIE B;  4EZK A;  1V5O A;  4XDD A;  3BK1 A;  4RGN A;  1PUT A;  2FUH B;  3Q69 A;  4JPS A;  2W3R A;  1C1Y B;  2XBB C;  3H7S A;  4RM9 A;  2QEJ C;  3N9Y C;  4NJ7 A;  4EEW A;  3BY4 B;  1MJD A;  2LRU A;  3T8M A;  1NI3 A;  1XCQ L;  1N60 A;  2IO2 B;  5E6P A;  1V9J A;  2JZP A;  2M4N A;  4MH0 E;  2BB6 A;  1X1M A;  1YN4 A;  1L6U A;  1CJE A;  2DX5 B;  3AE3 B;  4C56 C;  1L0V B;  1EO6 A;  3OAW A;  5IOI A;  1IBX B;  3A9K B;  2E3T A;  4B6W A;  3QQ8 B;  2K8C A;  4GB9 A;  4RGO S;  2M17 A;  2W54 A;  4M00 A;  5BMH A;  2AQ2 B;  4REZ A;  4EZJ A;  2JZZ A;  2N9K A;  2CHW A;  2MBE A;  4HCP B;  1D6E C;  1TKG A;  2IPK D;  4A3P A;  1L7Y A;  3KUZ A;  2FCQ A;  4II3 B;  4W9G A;  3VH4 B;  4W9J A;  4D2K A;  2JRH A;  2KTR B;  4LJO B;  2NTT A;  2LMC A;  3AEA B;  1TY2 A;  1BXT A;  3BYY B;  2WNM A;  4M0W B;  3QAR A;  4K7W A;  2BYF A;  2O6V A;  4DDG D;  4LJP B;  1PDX A;  2O2V B;  3ZNH B;  1D4B A;  2J0K A;  2KX0 A;  1JWM D;  1YJ1 A;  3NOB A;  2C9W B;  3Q8E A;  5EE3 A;  2BWE S;  4TSS A;  2W82 A;  2KDE B;  4HRO A;  2KT7 A;  3PPA A;  2AQ1 B;  2G9H D;  3KVF B;  4EFO A;  1SXT A;  1SBB B;  2MBO A;  1ZP0 B;  3HK0 A;  2KQS A;  2X38 A;  1QLB B;  4Q2J A;  4TKN A;  2IO0 B;  1KM7 A;  4JWU C;  3V6C B;  2MCN B;  4XGA B;  3PRP B;  4NAW A;  2KMA A;  2K5P A;  2LHE A;  2KWD A;  4HDO A;  2K8H A;  4GU2 A;  3LJ3 A;  4A55 A;  2WXG A;  1UBI A;  2M1M A;  5JH5 C;  1S3S G;  1Y56 A;  1K51 A;  3NVY A;  4F7Z A;  2WDQ B;  4K3B A;  4WJN A;  4WJO A;  3MP9 A;  3M62 B;  2VH2 A;  4NJ6 A;  2KKC A;  2KLC A;  3RPF C;  5E6O A;  3EHV A;  3ML9 A;  2RGF A;  2INC C;  2WU2 B;  1VZ8 A;  3NRZ A;  2QDF A;  2K6Q A;  4DDI D;  1QKZ A;  4DXA B;  3T3N A;  3IAM 1;  1WI0 A;  1C76 A;  4ZHO A;  4E71 A;  4KIK A;  1PYW D;  1UGM A;  3QK0 A;  1M94 A;  3PHX B;  1J0G A;  2L3Z A;  2JZ3 B;  3AU4 A;  1YX5 B;  3WIM A;  3DWG C;  2AEH A;  3HM3 A;  5FKA C;  2DHZ A;  3RUI B;  3ZTC A;  1V8C A;  1PGB A;  2KK8 A;  3VHT C;  1WJ6 A;  3DQV A;  3CWI A;  2LD9 A;  2D07 B;  3Q3O C;  3KWV A;  5DPR A;  2R2Q A;  2D11 A;  1GC6 A;  1YD8 U;  1YOV B;  2Q5W D;  3B08 A;  4URK A;  3L13 A;  3RT3 B;  1TS3 A;  4JE3 B;  2DZI A;  1YMH E;  1WX7 A;  1ZXI A;  3AB5 A;  2WXM A;  1R4N B;  1YN5 A;  1MHX A;  1IP9 A;  1RFK A;  1TS4 A;  1WRD B;  2ZCC A;  3Q3J A;  1WMH A;  1EU4 A;  3ZIM A;  3T3O A;  4RF1 A;  4L2Y A;  1QT9 A;  3P2B A;  4MH8 A;  4PT5 A;  4TUU A;  3AXC A;  5HG2 A;  5BMI A;  3ZDT A;  3X23 A;  4IOI E;  5AUK A;  3E56 A;  2GI9 A;  4AUQ C;  4ICU A;  4BOS C;  1WGK A;  4GXB A;  4BBN F;  1ZW7 A;  1IPG A;  3R66 C;  4NPN A;  2JF5 A;  3WA0 A;  3DBS A;  2WXQ A;  2JWU A;  4AP4 C;  2KC2 A;  4FHJ A;  3IFW B;  1WYW B;  4DXG A;  1JW9 D;  4XWT A;  2BVC A;  4MSM B;  4ACF A;  2DYO A;  3V60 A;  5AZH A;  2ZZP B;  4LNN A;  1P98 A;  2JYT A;  1JWU D;  3UQA A;  2N7D A;  4YT0 B;  2BKR B;  2NPT A;  2DZJ A;  2BWF A;  2GBR A;  1QOB A;  3U7Z A;  4BVU C;  5DCN A;  2IND C;  2FCS A;  3ECI A;  3IT4 B;  3A33 B;  1XT9 B;  3RUL A;  2N9L A;  1VDV A;  1PQS A;  1TKE A;  3AE1 B;  3GP7 A;  2PJH A;  4HEA 1;  3IVF A;  1E8W A;  2BT6 A;  2HTH A;  1JWB D;  3ZRC A;  3RNA C;  2J53 A;  4L1B A;  3JSV A;  2FNJ B;  4YXD B;  2KD0 A;  2ZJD A;  1C4P A;  3AE4 B;  4MAC A;  1FNU A;  3KUD B;  4KIK B;  1L4D B;  2KN4 A;  4N6E B;  1I4H A;  1WH3 A;  3TEX A;  2KAJ A;  3BZD B;  2C7M B;  3EUB 2;  3MJW A;  3V61 A;  1YIW A;  4BKT A;  1L0X B;  2VZK B;  3VVW B;  4TV3 A;  3EGR A;  2LZ6 A;  3B1L X;  3O65 B;  5CHV C;  3Q3F A;  1FFU A;  3R7Q A;  4PK1 A;  2B3A A;  4GOC A;  3PT2 B;  1KLU D;  3N3K B;  3X0W A;  2WDV B;  2ZVN A;  1WFY A;  3PO0 A;  2L32 A;  1J19 A;  4MDK E;  3OWE B;  4RMA A;  4C00 A;  4I6N B;  3URY A;  1FRD A;  4TQ1 A;  4YTP B;  1KLG D;  5JHB A;  1WYG A;  4LNF A;  5J17 A;  4IW0 A;  2LXC A;  1SGH A;  3PZ7 A;  4BFR A;  4IKG A;  1WE7 A;  2K39 A;  4ZRI A;  2V3S A;  4B0M A;  4OZC A;  3JVZ X;  5KHQ A;  2M19 A;  3NY5 A;  1C9F A;  2V4L A;  1E6E B;  2N9P C;  2PVG C;  2LUE A;  3FIL A;  1IGD A;  1ZGU B;  1GNU A;  1TBE A;  2WLB A;  2X8X X;  1XQQ A;  1JRP A;  4M8M A;  3TSS A;  5AZF A;  5FK9 C;  1KH0 A;  1SE4 A;  4HDQ A;  3HM6 X;  3M3J A;  1TYG B;  3WAL A;  3SU8 X;  4XYC A;  4XX5 A;  4FLH A;  4B0E A;  4ZHP A;  1VZ6 A;  4USA A;  5GMV A;  3HVD A;  2WYQ A;  3S2A A;  1VLB A;  1NEN B;  2K1F A;  4G50 A;  3TL5 A;  1OQR A;  4G0N B;  2LGX A;  3QIJ A;  1EUV B;  2WXH A;  1J7B A;  1XXG A;  4JIO U;  1WE6 A;  1DGJ A;  2ZW1 A;  2A4Z A;  2JYE A;  3GE8 C;  4GDL B;  2MJ3 A;  5CHW A;  3WAM A;  2ZPN A;  3DBL B;  3GS2 A;  4KSL C;  4BKG A;  2LGD A;  1C4C A;  4GLS C;  1OFF A;  3IT6 B;  2LGS A;  4MJS A;  1F52 A;  3DVG Y;  1V5T A;  1KOT A;  3K9P B;  5IA7 A;  4HJG E;  1TKY A;  4AOF A;  4AWJ A;  2PKO A;  1WWT A;  3N20 C;  1V81 A;  4N58 A;  3NUH B;  1V6E A;  4KSK C;  1SEB D;  4KVG B;  2V3P A;  1KLV A;  1XLP A;  2MLB A;  3ENE A;  4I6P A;  2N7E A;  4L23 A;  4FAD A;  1JML A;  1L2N A;  2RD0 A;  2CJN A;  4YWG G;  3CSF A;  3TMP B;  1MVK A;  3RNB C;  3ZW3 A;  4A90 A;  1MPE A;  1T0Q C;  3A4S C;  3AE5 B;  3PZD A;  3VTW A;  4FUL A;  2PLP A;  4W9I A;  1ET6 A;  4HXD A;  4MSQ B;  1EU3 A;  2OOB B;  1GB4 A;  2N9X A;  3ML8 A;  4W9L A;  4PYZ A;  3RNF C;  1DYQ A;  4E74 A;  4W9E A;  2IYD B;  1JAL A;  2N4F A;  2OHF A;  2WXK A;  3NVV A;  3SHQ A;  2LWP A;  2K6D B;  1WGG A;  2IDY A;  2LVQ A;  2JT4 B;  1ZDV A;  2N0S B;  2KVZ A;  4KGS A;  4KGR A;  2GBJ A;  3QX1 A;  3U8Z A;  1TZO A;  2NBU A;  1TS2 A;  1L4Z B;  3R2I A;  1RM6 C;  1V80 A;  2KAC A;  1L5P A;  1ENF A;  1BUI C;  1HA5 A;  1WY8 A;  1YQ4 B;  4R3D A;  4OVV A;  4W9K A;  5IKC M;  2KMC A;  1GC7 A;  3I57 A;  3TEY A;  2WU5 B;  2KDI A;  3IBE A;  2WHI A;  2ZEQ A;  3BVM A;  5L83 A;  3OG5 A;  3A9J B;  1SE3 A;  3W5U B;  2MP2 A;  1T0S C;  4PS7 A;  4IDI A;  4ZRJ A;  3Q3M C;  1Q0W B;  2DZM A;  4ANV A;  3AEF B;  4EKU A;  4MGZ E;  4YSZ B;  2NCN A;  1PGX A;  5D94 A;  5HHD G;  4LCD E;  1H8C A;  4IWO A;  2N1W A;  5MPO A;  4NJC A;  5LXH A;  1HE8 A;  4WUR A;  2KX3 A;  3I5J C;  3RYT A;  4RF0 A;  1IGC A;  2KC1 A;  1YJI A;  2HD5 B;  4ICV A;  2BQQ A;  2EMT A;  3N1Z C;  3N1X C;  5LNK 1;  2BF8 B;  1MHH E;  3RZF A;  3ZXV A;  4RH6 A;  3UIO B;  2RDB C;  3W1S C;  1C78 A;  4OZB A;  5C1Z A;  3VR9 B;  1FPY A;  3TJP A;  4C4V A;  1C3T A;  2DYB A;  4ANX A;  3AMZ A;  3RD2 A;  4GGQ A;  2MWS B;  3AH7 A;  1FXT B;  3AV8 A;  3ZQ4 A;  1T6B X;  2L76 A;  3GZN B;  1T0Y A;  2CU3 A;  5BO4 B;  2GRI A;  2KJH B;  2DBY A;  2MEK A;  1CMX B;  3H7P A;  2WDT B;  3VUW A;  3C8Y A;  4MM3 B;  2YLM A;  2EEL A;  3JW0 X;  1LM8 B;  4KZC A;  2LI5 A;  2LFI A;  3FKY A;  3H7P B;  1C4A A;  4HCN B;  1GOZ A;  2XNA C;  4DHZ B;  1VRA B;  4WAA A;  1WXS A;  2D3C A;  3R2T A;  2CHX A;  2BPS A;  3EA6 A;  2AL3 A;  1WMH B;  3NJT A;  3APF A;  2LJ5 A;  3PVL A;  1UWX A;  1QOA A;  2JUO A;  2MQJ A;  5GXG B;  2R2O A;  3U4E G;  2ASQ A;  3U2S C;  3P4S B;  3TUO A;  1K8R B;  1H4R A;  4RM8 A;  3ZRF A;  2LXA A;  5FR6 A;  1ZUD 2;  2FUG 1;  2KAN A;  1WXM A;  3PLV A;  4C80 A;  4ITK A;  2WXI A;  3V62 A;  3W5V B;  2VZK D;  2C7H A;  1LQB A;  4ZRP A;  4ASW C;  3A9J A;  3BK2 A;  1WXA A;  1SJE D;  2L05 A;  1AYF A;  2MH7 A;  4WAF A;  4ZYN A;  1NYQ A;  1WXQ A;  5HI1 A;  3HVZ A;  2WDR B;  3VTV A;  2EKE C;  3PV1 A;  1YJJ A;  5EE1 A;  3L54 A;  4US9 A;  1R4N I;  2GOW A;  4WQO B;  4EUT A;  2LHD A;  2XK5 B;  2MBQ A;  4CO7 A;  4HPM B;  2GBK A;  1AW7 A;  3BII D;  4FJZ A;  4IC7 B;  4PS8 A;  1BML C;  4JLC A;  1K53 A;  2KDF B;  3N1Y C; 
#chains in the Genus database with same CATH homology
 2K25 A;  2ZVN A;  1WFY A;  2J7Q B;  5IAA C;  1Q1O A;  1J19 A;  2LGY A;  3DCG A;  2PEA A;  4MDK E;  2RSU A;  4NY0 A;  5L95 C;  2PE6 B;  4RMA A;  2KNB A;  2PPH A;  4GDK A;  4I6N B;  2M8S A;  1RAX A;  2FCM A;  3PTF C;  4TQ1 A;  1WR1 A;  4K81 A;  1QZE A;  3U30 A;  5JHB A;  2FIF A;  2KN5 A;  1A5R A;  1Z5S B;  1E8Y A;  3KH0 A;  1E90 A;  1NI2 A;  5J17 A;  4GSW A;  4IW0 A;  2LXC A;  1SGH A;  2KQ7 A;  3IHP C;  3QA8 A;  2KDB A;  2VRR B;  4BFR A;  5LLI A;  1WE7 A;  1Q5W B;  2K39 A;  2PE9 A;  2WX1 A;  3A1Q A;  4ZRI A;  2KWU B;  1WJN A;  3VXW A;  2V3S A;  4ANW A;  2HJ8 A;  2Z0D B;  4B9K A;  4FHK A;  5CHF A;  3JVZ X;  5KHQ A;  2NBV B;  3NY5 A;  2V4L A;  2N9P C;  4TQ0 A;  1RFA A;  2LUE A;  2KWV B;  1ZGU B;  1GNU A;  1TBE A;  1E8Z A;  1XQQ A;  1WZ0 A;  4M8M A;  3V6E B;  3AI5 A;  3H9D A;  5AZF A;  1OGW A;  1UEL A;  2D10 A;  2MBB B;  4DWF A;  3TBL D;  5AEK B;  4K1R B;  3QAQ A;  1I42 A;  3ZNI D;  2I1J A;  3PGE A;  3PHW B;  4GDL A;  3HM6 X;  4HDQ A;  3VQI A;  3M3J A;  1WJU A;  2KTF A;  3KYD D;  3SU8 X;  3WAL A;  2KOX A;  4HLE A;  4XX5 A;  3A4R A;  4FLH A;  4WWP A;  1VD2 A;  2JY6 A;  1WGR A;  3CMM B;  2L8J A;  2JPH A;  2ZNV B;  4GMV A;  3OJ3 A;  5GMV A;  5C23 A;  4EZL A;  2WYQ A;  4HK2 A;  3WAP A;  3S2A A;  1G6J A;  3T9L A;  4GDK B;  1XD3 B;  1WXV A;  2L00 B;  4IWQ A;  3WAN A;  4F8C B;  2FCN A;  2O6V B;  2EMS A;  4J6I A;  4A20 A;  2K1F A;  4G50 A;  4NNJ B;  3TL5 A;  4JL9 A;  5J18 A;  4IM2 A;  2C60 A;  4G0N B;  2LGX A;  3ZTD A;  4HJK A;  5CX3 A;  2MX2 A;  3QIJ A;  2K8B A;  3M63 B;  3VH3 B;  1EUV B;  4HWI B;  3PRE A;  4A3O A;  2DAF A;  3QJZ A;  4DHJ D;  4CYE A;  2KLG A;  4JIO U;  1WE6 A;  1RRB A;  4MGY E;  2A4Z A;  1ZKH A;  4FJV B;  4GDL B;  2MBH A;  5CHW A;  3WAM A;  1WGY A;  2C5L C;  2KFK A;  3DPD A;  4DK5 A;  2ZPN A;  2UWQ A;  4K7S A;  1KJT A;  4KSL C;  3APD A;  4BKG A;  2LGD A;  2NR2 A;  3H6N A;  4EZK A;  4I6L B;  1V5O A;  2MRP A;  3ZDM C;  2FUH B;  2O2V A;  2LVP A;  2DAJ A;  2Z59 B;  3CF6 E;  4MJS A;  3DVG Y;  1KOT A;  1V5T A;  2LVO A;  3K9P B;  2D3G A;  4WWN A;  1NDD A;  5IA7 A;  3OJ4 B;  3HIZ A;  4CHK A;  4G11 A;  3SDL C;  4AOF A;  1C1Y B;  2XBB C;  4AWJ A;  3H7S A;  4RM9 A;  4NQL B;  4NJ7 A;  4EEW A;  2FAZ A;  1V81 A;  3PS6 A;  1V6E A;  2CKH B;  3BY4 B;  4KSK C;  4KVG B;  3ZUN A;  2G4S A;  2BGF A;  2LRU A;  1KLV A;  3T8M A;  2MLB A;  3DBH I;  3L10 B;  3ENE A;  1UZX B;  2XK5 A;  3DVG X;  2IO2 B;  4I6P A;  4W9C A;  1V9J A;  5D6J B;  2M4N A;  2N7E A;  4MH0 E;  5E6P A;  1X1M A;  3HHM A;  4PYU A;  1P1A A;  4FAD A;  3C0R B;  1L2N A;  1WJ4 A;  2N9E B;  3N30 A;  4KZ0 A;  2DX5 B;  2RD0 A;  4DHJ B;  2NVU I;  3CSF A;  1E5W A;  3TMP B;  2RR9 A;  3OLM D;  1EO6 A;  2MW5 A;  2LRW A;  3OAW A;  3KUC B;  2W9N A;  3A9K B;  4B6W A;  3KW5 B;  2K8C A;  3QQ8 B;  4GB9 A;  3VAW A;  2M17 A;  3ZKJ C;  4LDT B;  1WIA A;  3ZW3 A;  4LDT D;  2GMI C;  3EEC A;  4EZJ A;  2JZZ A;  3A4S C;  1WR6 E;  2CHW A;  1EF1 A;  2MBE A;  3D32 A;  3PZD A;  3QCA A;  3QHT A;  4HCP B;  1BT0 A;  3VTW A;  4FUL A;  3ZLZ A;  4A3P A;  4M8N A;  1L7Y A;  2HE7 A;  2BKF A;  3DBR I;  3PRZ A;  4W9I A;  2NPT B;  3KUZ A;  3JSV B;  3DBL I;  2FCQ A;  4HXD A;  4II3 B;  1OTR B;  4W9J A;  4W9G A;  2L0F A;  5CTR C;  2JRH A;  2KTR B;  1WM3 A;  3AU5 A;  4MSQ B;  4LJO B;  2OOB B;  4BOZ B;  2N9X A;  3ALB A;  3ML8 A;  4W9L A;  4YL8 A;  1WX8 A;  4PYZ A;  4E74 A;  4W9E A;  2IYD B;  4M0W B;  3UF8 A;  3QAR A;  4K7W A;  3W1Y A;  2BYF A;  4FN2 A;  2O6V A;  4DDG D;  4LJP B;  2O2V B;  3ZNH B;  4DBG A;  2JWZ A;  2N4F A;  2NS5 A;  5KHO A;  3VTU A;  4B95 A;  2KX0 A;  2J0K A;  1YJ1 A;  2BYV E;  3NOB A;  2C9W B;  2BWE S;  5D2M B;  1V86 A;  3SHQ A;  2KJR A;  2KDE B;  2LWP A;  2K6D B;  3PPA A;  1YQB A;  2IO3 B;  1WGG A;  3KVF B;  3R7R A;  2LVQ A;  4EFO A;  4ZDV A;  2JT4 B;  2KHW B;  2MBO A;  3PRM B;  1YX6 B;  2GBJ A;  3MTN B;  3QX1 A;  3U8Z A;  3HK0 A;  2KZR A;  2KQS A;  2NBU A;  3GOE A;  4MM3 A;  1V80 A;  2MA9 B;  3L17 A;  4NQK E;  2C7N B;  2JXX A;  4XZ4 A;  5JZE B;  4TKN A;  1WM2 A;  2IO0 B;  1KM7 A;  3V6C B;  2G4D B;  4MJS B;  4W9F A;  2MCN B;  4FBJ B;  2IBI B;  3AUL A;  1D3Z A;  3PRP B;  1GUA B;  3WAO A;  4NAW A;  2KMA A;  4WWO A;  1WY8 A;  1Y8R C;  2UYZ B;  2K8H A;  4HDO A;  4GU2 A;  3LJ3 A;  1P3Q U;  1UBI A;  4OVV A;  4W9K A;  2M1M A;  3UQB A;  5JH5 C;  2CS4 A;  1S3S G;  4W9D A;  4X57 B;  5DPT A;  2KMC A;  1P9D U;  4F7Z A;  2IO1 B;  2IY1 B;  1GC7 A;  3K9O B;  4DHZ E;  3RZW C;  3NZU A;  3ZO5 B;  4WJN A;  4WJO A;  2AYO B;  1E7U A;  2DYM A;  3M62 B;  3NS8 A;  2WX0 A;  4JGH B;  2KDI A;  3IBE A;  4NJ6 A;  2KKC A;  2ZEQ A;  2KLC A;  5L83 A;  5E6O A;  5G2N A;  3EHV A;  3ML9 A;  1S1Q B;  2RGF A;  3A9J B;  2MP2 A;  2IZV B;  4BKS A;  2CU1 A;  2K6Q A;  4DDI D;  4DXA B;  4PS7 A;  1WI0 A;  4ZRJ A;  4HVB A;  1E8X A;  2ZNV C;  5DPW A;  1UBQ A;  1Q0W B;  1IYF A;  3SD5 A;  1R4M I;  2DZM A;  1RLF A;  4E71 A;  4KIK A;  2KFK B;  3TIX A;  4ANV A;  2CR5 A;  1UGM A;  3QK0 A;  1M94 A;  3ONS A;  4EKU A;  5JHA A;  2J0J A;  3PHX B;  4MGI E;  4MGZ E;  2NCN A;  1WX9 A;  1J0G A;  2L3Z A;  2JZ3 B;  5D94 A;  3AU4 A;  1YX5 B;  3WIM A;  4LCD E;  1H8C A;  4IWO A;  3PLU A;  2AEH A;  2N1W A;  3HM3 A;  2DHZ A;  3KYC D;  2L7R A;  3RUI B;  3ZTC A;  4E3C A;  5LXH A;  1J8C A;  2AWT A;  1HE8 A;  3A9K A;  2KK8 A;  3VHT C;  1WJ6 A;  2KX3 A;  3DQV A;  2ZVO A;  3RYT A;  3W1S A;  2LD9 A;  2D07 B;  3DOW A;  4ZRK A;  5DPR A;  2R2Q A;  4NAW B;  1SIF A;  1GC6 A;  1YD8 U;  1GG3 A;  2D11 A;  3L0W B;  2KC1 A;  1P0R A;  2HD5 B;  4XC2 A;  4ICV A;  2BYE A;  3B08 A;  4URK A;  3L13 A;  3RT3 B;  2EMT A;  2KVR A;  2DZI A;  2BF8 B;  2JVC A;  4FA6 A;  1WGH A;  5EDS A;  4PS3 A;  1TZ1 A;  1WX7 A;  3RZF A;  3ZNG C;  2Z0E B;  4WJQ A;  3VDZ A;  4BBN C;  2LAS A;  3UIO B;  4GIV A;  2MSE D;  3W1S C;  2KO3 A;  2RPQ A;  1IP9 A;  5C1Z A;  4AJW A;  2D2Q A;  1WRD B;  1Z2M A;  1WZ3 A;  2ZCC A;  3TJP A;  1C3T A;  2M0X A;  2DYB A;  3Q3J A;  4KV2 A;  1WMH A;  4ANX A;  1UD7 A;  3ZIM A;  3RD2 A;  1EF5 A;  2MP2 B;  4GGQ A;  2MWS B;  1FXT B;  1LXD A;  3P2B A;  2DEN B;  2L76 A;  4TUU A;  2DZK A;  3AXC A;  3ZDT A;  1T0Y A;  3X23 A;  2REX A;  3L16 A;  3NZS A;  4AJY B;  3QWZ B;  5BO4 B;  2KJH B;  2OJR A;  3IG3 A;  2XEW A;  4AUQ C;  1CMX B;  3H7P A;  4ICU A;  2WDT B;  4BOS C;  1V49 A;  3VUW A;  5HKH A;  1OEY A;  4GXB A;  4BBN F;  1ZW7 A;  2YLM A;  1IPG A;  3M95 A;  3R66 C;  4P7I A;  2O6V D;  3JW0 X;  4NPN A;  4WJP A;  2JF5 A;  1LM8 B;  3WA0 A;  3DBS A;  3GZN I;  4IM0 A;  4KZC A;  2LI5 A;  3EC8 A;  5DPS A;  1V2Y A;  3H7P B;  2N1V A;  4HCN B;  3ZNZ B;  4AP4 C;  4MEM A;  4DHZ B;  2KC2 A;  4FHJ A;  5TR5 A;  4WAA A;  3EFU A;  3IFW B;  1WYW B;  4MGK E;  2A5U A;  3UGB B;  1WXS A;  1MG8 A;  4MSM B;  3VUX A;  2L0T A;  2DYO A;  4JQW C;  4MEL A;  2CHX A;  2GBM A;  2ZZP B;  3H1U A;  5AZH A;  3V60 A;  2BPS A;  2AL3 A;  1WF9 A;  1WMH B;  1UH6 A;  2KWC A;  2G3Q B;  1VCB A;  2FID A;  3APF A;  4GN1 A;  3VFK A;  4HPL B;  1I35 A;  4IUM B;  2LJ5 A;  3PVL A;  2V1Y A;  3I3T B;  3UIN B;  4IM3 A;  5G55 A;  2JUO A;  1JRU A;  1P98 A;  2MQJ A;  2QHO A;  2NBW B;  2R2O A;  3VH4 B;  2ASQ A;  5D7G A;  2J0M A;  5AZG A;  3UQA A;  3U7D A;  1U4A A;  4F1S A;  2N7D A;  1K8R B;  2BKR B;  1H4R A;  2NPT A;  2DZJ A;  4RM8 A;  3ZRF A;  2BWF A;  2GBR A;  3R3M A;  2LXA A;  3LDZ E;  4BVU C;  2I1K A;  5FR6 A;  5DCN A;  2ZPY A;  2WWZ A;  4OVU A;  2FCS A;  3ECI A;  2KAN A;  4W9H A;  1WXM A;  2KXJ A;  3UIP B;  3A33 B;  1GJZ A;  1XT9 B;  3PLV A;  2G45 B;  3RUL A;  1SE9 A;  5E6N A;  1PQS A;  1OQY A;  3N32 A;  2PJH A;  4G3X B;  3APC A;  3BIN A;  4KDL B;  1F9J A;  3V62 A;  3DVN U;  3IVF A;  1E8W A;  2HTH A;  2C7H A;  3CST A;  3JYU A;  3ZRC A;  1LQB A;  4ANU A;  4II2 B;  1LFD A;  4ASW C;  3ZVV A;  1WGD A;  3A9J A;  4EOY A;  5LXI B;  4IG7 B;  2Y5B B;  1WXA A;  2L05 A;  3JSV A;  2FNJ B;  4ZYN A;  3MHS D;  2KJ6 A;  1OEY J;  1TGZ B;  2KD0 A;  2KFJ A;  2ZJD A;  4K7U A;  3QC8 B;  3DVN V;  3KUD B;  4FJY A;  4KIK B;  3NHE B;  2JRI B;  2IY0 B;  2ZCB A;  3TCA A;  1WH3 A;  3RCZ A;  3VTV A;  2EKE C;  2YVC A;  2C7M B;  3PV1 A;  4KDI C;  1ISN A;  3L54 A;  1NBF C;  1R4N I;  1E7V A;  2GOW A;  3MJW A;  4WQO B;  4EUT A;  3V61 A;  3B0A A;  1YIW A;  4BKT A;  1TTN A;  2XK5 B;  3L08 A;  4TV3 A;  3VVW B;  5J2R A;  2LZ6 A;  4IWP A;  3B1L X;  3DDC B;  2MBQ A;  3A1Q B;  2KTR A;  3O65 B;  4HPM B;  4CO7 A;  5CHV C;  2CHZ A;  2GBK A;  3Q3F A;  4N9F 4;  4BKS D;  3R7Q A;  1AAR A;  2AL6 A;  4IC7 B;  4FJZ A;  2B3A A;  4GOC A;  4PS8 A;  3PT2 B;  3PSE B;  3VUY A;  3N3K B;  4JLC A;  3X0W A;  2KDF B;  2GBN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...