5JH5C

Structural basis for the hierarchical assembly of the core of prc1.1
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
88
Chain Sequence
HSKAHYYRYDEQLNLCLERLSNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title KDM2B Recruitment of the Polycomb Group Complex, PRC1.1, Requires Cooperation between PCGF1 and BCORL1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein/transcription
molecule keywords Lysine-specific demethylase 2B
total genus 22
structure length 88
sequence length 99
ec nomenclature
pdb deposition date 2016-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF16207 RAWUL RAWUL domain RING finger- and WD40-associated ubiquitin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5jh5C00
4FN2A 4NAWB 2KVRA 4HWIB 3APCA 3H9DA 4BKSD 2V4LA 2NPTA 1MG8A 3QJZA 1GC7A 3RZWC 2GMIC 2KWUB 2ZEQA 4GSWA 3VVWB 3KYDD 2MBBB 3H7SA 5HKHA 3WAMA 3VTVA 1SGHA 2Z0EB 2MBEA 4I6NB 3RULA 2JY6A 1R4NI 4CO7A 3UGBB 5BO4B 4PS8A 1WE7A 1RAXA 4NY0A 5JZEB 3DBLI 3O65B 3EHVA 1K8RB 2N1WA 4MEMA 2MW5A 1WF9A 3A9KB 1VCBA 2KC2A 3JVZX 1E8ZA 1GNUA 3UF8A 1WE6A 1V6EA 4ASWC 4BOSC 2FCSA 3GOEA 2KLGA 3H7PB 4HK2A 2LRWA 1V2YA 2LGXA 2OJRA 3U30A 2D2QA 2KFJA 2J7QB 2KX3A 3SD5A 4F7ZA 1G6JA 3PRMB 2NVUI 2DZJA 2GBRA 2KNBA 2KD0A 1OEYJ 3U7DA 3VFKA 1J0GA 4BKTA 1TZ1A 3DPDA 3WA0A 2K8HA 4KVGB 3ZTDA 2PE9A 2MQJA 2MLBA 3NZUA 2A5UA 2M8SA 2ZCBA 1H4RA 1C3TA 3EC8A 3QARA 3CSTA 3L10B 2PJHA 4X57B 4RM9A 1WY8A 4HXDA 1GC6A 3BINA 4GU2A 2LZ6A 2KX0A 2WWZA 2L00B 2M17A 2I1JA 1SIFA 1J19A 4DHJB 2YVCA 2AL3A 2IY1B 1M94A 3GZNI 1YIWA 1UD7A 3QHTA 4GN1A 2DX5B 2L76A 3QWZB 2MX2A 5DCNA 3TJPA 3PHXB 3VAWA 2DAFA 2C9WB 1XQQA 4ANUA 4AWJA 2KANA 1P1AA 2LD9A 2C7NB 2CKHB 1NDDA 3KH0A 4G0NB 4GDKA 2N4FA 4RMAA 4W9HA 4M8MA 5D2MB 3TCAA 3VH3B 2REXA 2KDEB 4I6PA 1H8CA 5DPTA 1A5RA 3AULA 2LI5A 3IHPC 3JSVB 1EO6A 2O6VB 3VTWA 3ECIA 3L0WB 4M0WB 4ANXA 2FIDA 4FLHA 5CHFA 4A3PA 3DVGY 3KW5B 1WGYA 2L0TA 2JT4B 4W9GA 4ZRJA 4W9DA 5LXIB 4WJOA 2IYDB 2JUOA 3PT2B 3DVNV 1S1QB 1WM2A 2MBHA 2DZMA 2KZRA 2KO3A 3TMPB 1KM7A 3OLMD 1EF1A 3R7RA 4A20A 1V80A 5D6JB 4DBGA 2KN5A 1QZEA 3N30A 1GUAB 2Z0DB 4GXBA 4DDID 1UBQA 5DPRA 2V1YA 1ZGUB 2VRRB 2ZJDA 4XX5A 4WJNA 2RPQA 1WJNA 3HHMA 1PQSA 2I1KA 5E6PA 3RYTA 2R2OA 1KOTA 1UZXB 2LWPA 2FCMA 2L3ZA 2JRIB 3ZDMC 3ZIMA 4E74A 1Q5WB 3A4SC 4G11A 2OOBB 4MGZE 4LDTD 4EOYA 3AXCA 3NZSA 4MJSB 4AP4C 1YX6B 2AL6A 4BBNC 3ZW3A 1WX8A 4OVUA 4FADA 3PLVA 2KKCA 3KUZA 5KHQA 2N7DA 3APFA 5JHBA 3DOWA 3OJ3A 3KVFB 3ZNHB 4DDGD 2KFKB 2L7RA 1WXMA 2BWES 2M1MA 3M63B 2ASQA 2KDIA 3KUCB 5L83A 2WYQA 4M8NA 4AOFA 2LASA 5J2RA 2LVPA 2BPSA 5D7GA 2ZPYA 1SE9A 2ZZPB 1WXSA 4B95A 4BVUC 3UQAA 2G3QB 3L17A 3S2AA 4BBNF 3PVLA 4KSLC 3ZRCA 3T9LA 2EMTA 5GMVA 2KTRB 2Y5BB 2JWZA 2Z59B 3DDCB 5AZGA 4GDLB 2C60A 2KMAA 4URKA 3A33B 4CHKA 2FIFA 4KDIC 1D3ZA 1U4AA 3DQVA 3N3KB 2RSUA 1WGRA 3A9JB 4WWPA 3WAPA 3MTNB 4MM3A 3VUWA 1AARA 3A9KA 5IAAC 2KFKA 1Y8RC 1LXDA 1F9JA 1Z5SB 2G4SA 3H7PA 2IZVB 3MJWA 4TKNA 3WANA 3DBRI 1ZKHA 2JVCA 2D3GA 2DYMA 3AI5A 2J0JA 3DVGX 2NBWB 2BKFA 3JYUA 4NJ6A 3SHQA 3PRZA 1WIAA 1YJ1A 2WDTB 1RRBA 1V81A 2LXAA 4WWNA 3D32A 2FCNA 1WJ4A 2KLCA 2KTRA 2UWQA 4KV2A 3QIJA 2ZPNA 4JL9A 4HCNB 2J0MA 3RUIB 4JQWC 4AJYB 1V49A 2MRPA 1ISNA 2JZZA 4TQ0A 4IUMB 1HE8A 2GBNA 2C5LC 4J6IA 3UINB 1GJZA 4MGIE 1YD8U 4W9IA 1WGDA 3V61A 1WMHA 3PLUA 5D94A 4ZDVA 1LM8B 3APDA 3B0AA 4W9KA 1R4MI 2DAJA 4GDKB 2GBJA 3PGEA 3TBLD 3ZVVA 1V5TA 3W1SC 2FUHB 2D11A 3V62A 2LGYA 2CHXA 3X0WA 3QA8A 2K25A 4JIOU 4MGKE 5E6NA 4EKUA 4P7IA 2GBKA 3ZNZB 3UIOB 5FR6A 3ZDTA 1X1MA 2KDBA 4HPMB 5C23A 4EEWA 4IWQA 4GB9A 4GOCA 3HIZA 3OAWA 3VTUA 2K8BA 2LVQA 1JRUA 2CR5A 4TUUA 1V9JA 3PTFC 2AYOB 4BKGA 4DWFA 2NBUA 1V86A 4DHZE 3ZO5B 1E8XA 4OVVA 5AZHA 2JF5A 3NOBA 4I6LB 5CHWA 2KDFB 3L13A 4FHKA 4IWPA 3VXWA 2KC1A 2JPHA 3OJ4B 4G3XB 5LLIA 3I3TB 3QC8B 1RFAA 2ZNVC 2MCNB 4BFRA 4DHZB 4ICUA 2D10A 4NNJB 4WQOB 3SDLC 2BF8B 4AJWA 3PHWB 4E71A 3WALA 5CTRC 3RCZA 2MP2B 3H6NA 1P98A 2KK8A 3QK0A 1YQBA 3Q3FA 4W9JA 2KWCA 4CYEA 4PS7A 4B6WA 3N32A 1OGWA 2LVOA 4K81A 4NQLB 2UYZB 4FBJB 3EECA 1NBFC 2K6QA 3PRPB 4XZ4A 3PZDA 3VHTC 1WJUA 2BGFA 2CHZA 4HPLB 1EUVB 2NS5A 2N9PC 1FXTB 1Q1OA 4IM0A 5CX3A 4FHJA 2LXCA 3M95A 2C7MB 3MHSD 4EFOA 3ZLZA 2A4ZA 2FAZA 3DCGA 3VUYA 3QAQA 1V5OA 1OTRB 3ZNGC 1E7VA 2XBBC 2W9NA 4BKSA 1Q0WB 3ML8A 3W1SA 3P2BA 4PS3A 2FNJB 4KZCA 2O2VA 4WWOA 1P3QU 2ZCCA 1IPGA 4WAAA 2KJ6A 4ZRKA 2MP2A 1WRDB 2PE6B 2QHOA 4HJKA 4EZKA 2JRHA 3AU4A 4EUTA 5J18A 2EKEC 1WR6E 3LDZE 4NQKE 2G4DB 1WX7A 1LQBA 4ANVA 3VH4B 4XC2A 3PPAA 4NJ7A 3IBEA 4DHJD 5EDSA 4IG7B 2NR2A 3SU8X 4II2B 1YX5B 3T8MA 3V6CB 5AZFA 4W9EA 1J8CA 3CSFA 3RD2A 2B3AA 3TIXA 2KOXA 3K9OB 3RZFA 2D07B 2RR9A 1OEYA 3A4RA 1KJTA 1GG3A 2KJRA 1WGHA 3Q3JA 2DZKA 5J17A 2O2VB 4IM3A 1CMXB 3RT3B 2K6DB 3V60A 2N9EB 4IW0A 1E8YA 4KSKC 1E90A 2NCNA 2NBVB 4FJZA 3JSVA 1I42A 3R3MA 1WGGA 3K9PB 3M3JA 3QX1A 4KIKA 4HLEA 2O6VA 3ONSA 1P0RA 2IBIB 2DYOA 3PS6A 2M4NA 2YLMA 2ZVOA 3B1LX 3QQ8B 2J0KA 2BYFA 4HDQA 4NPNA 2IO3B 3C0RB 3U8ZA 3ZUNA 4RM8A 1I35A 3ALBA 1WX9A 4PYUA 1WMHB 3V6EB 2DYBA 2WX0A 2GOWA 2R2QA 3HM6X 2PEAA 4FJYA 3ML9A 3IFWB 1WR1A 5G2NA 3X23A 1UBIA 2DZIA 1WM3A 4W9FA 2C7HA 3KYCD 2XEWA 4FJVB 1KLVA 2FCQA 2DHZA 4JLCA 2MA9B 4EZJA 2IO1B 1WH3A 4BOZB 2EMSA 4IM2A 2MBQA 4JGHB 4LJOB 5TR5A 1XT9B 2JXXA 2KWVB 3VUXA 4KIKB 3WIMA 4TV3A 2N7EA 2KHWB 4KDLB 1UH6A 4GIVA 1XD3B 4DXAB 1UELA 3QCAA 3ZRFA 2BWFA 2KQ7A 2L0FA 4AUQC 3EFUA 4IC7B 2AWTA 4GDLA 2HTHA 3VDZA 2KTFA 3PSEB 4K7SA 4MSQB 4ZRIA 2KQSA 4ZYNA 2MBOA 3A9JA 1IYFA 5DPWA 2LJ5A 4K1RB 5AEKB 1S3SG 4TQ1A 1LFDA 3BY4B 2RGFA 4W9LA 3ZKJC 5DPSA 1L2NA 4K7WA 4II3B 5KHOA 1WXAA 3CMMB 4K7UA 2KMCA 4LJPB 3VQIA 4GMVA 1TTNA 1WYWB 4WJPA 4MH0E 2O6VD 1BT0A 4W9CA 4DK5A 2JZ3B 2DENB 5C1ZA 1UGMA 3DBHI 3TL5A 1WJ6A 4N9F4 1E7UA 2PPHA 2M0XA 1TBEA 3NS8A 2LGDA 2BYVE 2HE7A 4HDOA 4B9KA 5L95C 2IY0B 3IG3A 1Z2MA 4HVBA 2HD5B 2ZVNA 2WX1A 1TGZB 3A1QA 5JH5C 2MWSB 1IP9A 1WXVA 1RLFA 3NHEB 4MDKE 2L05A 2K39A 1VD2A 2CU1A 3HK0A 2HJ8A 3DBSA 2LUEA 3W1YA 1E5WA 2N9XA 4PYZA 3ZTCA 1WZ0A 5IA7A 1ZW7A 3PREA 4IWOA 4MELA 2LRUA 4YL8A 1E8WA 5LXHA 2ZNVB 2K8CA 2V3SA 4KZ0A 4ANWA 2K1FA 4NAWA 3PV1A 4GGQA 4A3OA 2IO0B 5JHAA 2GBMA 2BYEA 3L16A 2XK5A 4WJQA 2CHWA 1P9DU 2NPTB 2MSED 2CS4A 2N1VA 2RD0A 1WZ3A 1C1YB 2BKRB 5E6OA 3CF6E 3IVFA 4MGYE 5G55A 2G45B 3ZNID 3NY5A 1OQYA 3ENEA 2L8JA 4FA6A 4HCPB 2AEHA 1WFYA 3L08A 4LDTB 3UQBA 3A1QB 3DVNU 3R7QA 4MSMB 1WI0A 4E3CA 3WAOA 3JW0X 4MJSA 3L54A 5CHVC 3UIPB 4EZLA 2IO2B 3HM3A 3M62B 4LCDE 1NI2A 3LJ3A 3AU5A 1T0YA 4G50A 4ICVA 4F1SA 4FULA 3B08A 1EF5A 1L7YA 2KJHB 2KXJA 3R66C 2XK5B 3KUDB 3H1UA 4F8CB
chains in the Genus database with same CATH superfamily
1PGAA 2KVRA 4HWIB 1AN8A 3H9DA 2V4LA 2NPTA 2K0PA 1OQRA 3RZWC 2VH2A 1TJEA 4C4VA 2GMIC 1WSPA 2KWUB 3VVWB 1WYGA 4N6EB 1OQQA 4NY0A 3EHVA 1WF9A 3A9KB 3JVZX 3UF8A 1V6EA 2KLGA 1HQRD 1T0RC 3BVMA 2D2QA 2J7QB 2KX3A 4KKIA 4LTUA 4C80A 3AM9A 2KD0A 4US9A 1J0GA 1YN3A 2KDMA 4BKTA 1TZ1A 3NVZA 3AE7B 2IDYA 2SEBD 2MLBA 1V1PA 2M8SA 5E6JA 4RH6A 2M17A 2YVCA 2J52A 1JWBD 2BVCA 3QHTA 1XXGA 1SEBD 3FILA 1P1AA 1A70A 4W9HA 3Q3MC 2Y5CA 4RMAA 2N4FA 3VH3B 2KDEB 4I6PA 1H8CA 3AULA 2LI5A 4O1NA 1NI3A 1CZPA 1SSNA 4ANXA 3HVZA 1STEA 3URYA 2K3UA 2IJ0A 2JT4B 4UDUC 4W9DA 3MC8A 2WLBA 1FCCC 3PT2B 4ZHPA 3DVNV 2IGDA 1BUIC 1C77A 5D6JB 3W2DA 3N30A 2Z0DB 2RMMA 2D3AA 4HEA1 1VZ6A 3HHMA 5E6PA 5MPOA 2R2OA 2WXJA 2J53A 1KOTA 2BB6A 4E74A 1C79A 1Q5WB 3A4SC 4GLSC 4CQNA 4M0WA 1EU3A 3W5VB 1YX6B 4C7YA 2AL6A 1L0VB 1NYRA 2L7RA 4HKZE 1FMAD 2SAKA 3P4SB 2LASA 4C56C 4ZHOA 2LVPA 5J2RA 3BIID 5D7GA 1TY0A 4BVUC 2PVGC 4MT5A 1JCKB 4KSLC 3T9LA 1ESFA 3DDCB 2JWZA 5AZGA 3I9V1 4GDLB 4URKA 4CHKA 2FIFA 2BW2A 2RSUA 4ITKA 3MTNB 3T3OA 4MM3A 5IAAC 2KFKA 1LXDA 3H7PA 2IZVB 3MJWA 3DBRI 4RF1A 2JVCA 1TY2A 3AI5A 2W55A 4KGSA 1C4CA 3JYUA 3W9CB 5G5GA 1RRBA 3RNFC 2GRIA 1WJ4A 4KV2A 1SF0A 1SXTA 4JL9A 4HCNB 2L1AA 2MRPA 2J4XA 1NENB 2JZZA 4RNAA 2V9HA 3UINB 2M0AA 1OFFA 4S0RA 3V61A 3RMKC 1VDVA 3Q6BA 1JWAD 3B0AA 1HEZE 1QOFA 3W1SC 3IXSA 2D11A 3AEEB 3BVGA 2JZPA 1MPEA 4JIOU 5E6NA 3ZJTA 5D3IB 1X1MA 2KDBA 4HPMB 4GB9A 4GOCA 1ZDXA 1VLBA 2K8BA 4TUUA 1I7HA 1V9JA 3PTFC 1FO4A 4DHZE 5C3JB 4HPPA 4FHKA 2KC1A 2JPHA 1UWXA 2ZNVC 2MCNB 4NNJB 2AX5A 4YXDB 3P4QB 3Q3FA 4KGTA 2UYZB 4PT5A 2I2YA 1WJUA 1IUEA 5HHDG 1Q1OA 4IM0A 5CX3A 4YWGG 2QC8A 4A90A 2KQ4X 1GOZA 3PZ8A 4ZOHC 2D3CA 2Q5WD 3N20C 3ZGZA 3QAQA 1OTRB 2RDHA 1UNSA 2WXNA 4BKSA 1Q0WB 3ML8A 3W1SA 1F0ZA 2O2VA 1PGBA 4WWOA 1GB4A 2MP2A 3LXFA 4HJKA 1QOAA 2JRHA 2QJLA 1XLQA 4XE0A 1I4XA 3LDZE 3SFDB 4HKQA 4ANVA 3NVWA 3NS1A 2VZKD 3U4EG 1K50A 4IG7B 2ACZB 3T8MA 3V6CB 4W9EA 2KOXA 2RR9A 1YN5A 3A4RA 1KJTA 1WGHA 2JU6X 2BTEA 5J17A 4IM3A 3RT3B 2K6DB 4KSKC 2WXQA 4C7ZA 1WGGA 3K9PB 3QX1A 3PS6A 1JQ4A 2ZVOA 3RPFC 1L5PA 2BYFA 1FIQA 4RGNA 3ZUNA 3C0RB 2BT6A 1N6ZA 1I35A 3ALBA 1MHHE 3AH7A 1TS2A 2WXGA 2XN9C 4WQMA 3AEBB 3TUOA 1K51A 3UI3A 3KYCD 2XEWA 1ET6A 4EZJA 2IO1B 4ARIA 5TR5A 2KHWB 1XD3B 2BWFA 2KQ7A 4AUQC 1TKYA 4ZRIA 2QSDA 4K7SA 4OHJA 2MBOA 3A9JA 5EE1A 4K1RB 5AEKB 3AE3B 3RFZB 2JWUA 1D5MC 2JQRB 4YSZB 5C2TB 2AQ3B 1WXAA 2V4IB 2KMCA 4YTPB 3LB8C 1WYWB 2DENB 3IT6B 3DBHI 2WHIA 1E7UA 1TBEA 2WXIA 4B9KA 5L95C 1C76A 3IG3A 1Z2MA 5JH5C 1IP9A 1WXVA 3AE4B 4DQOC 1TS5A 2L05A 2PKOA 1TKEA 2W3RA 2CU1A 3B2FA 1E5WA 3PREA 4MELA 2LRUA 5LXHA 1E10A 3Q8EA 2M19A 4NAWA 2QEJC 2GBMA 5HG2A 4WJQA 3NZ3A 2CS4A 5E6OA 1JWSD 2JXTA 2G45B 2D5GA 3NY5A 1CK1A 2ICIA 4C4VB 3L08A 3A1QB 5I4DA 4MSMB 5HFYA 3JW0X 4MJSA 5FK9C 2IO2B 3HM3A 3B2GA 3B9JA 3B08A 2KJHB 3EFCA 3P1MA 3NRZA 1UF0A 1T0QC 1Y56A 1F77A 2ZEQA 4USAA 4GSWA 1N5XA 3EGRA 3H7SA 1SGHA 3RULA 2JY6A 3BYTB 1EM7A 1RAXA 3ABVB 2RDBC 3O65B 4LNFA 2N1WA 4E3CA 1GNUA 4AS1A 1WE6A 2FCSA 3GOEA 1MVKA 1TS3A 2INDC 2KFJA 3SD5A 4F7ZA 3PRMB 3ZQ4A 2NVUI 2DZJA 2GBRA 5FKAC 1OEYJ 3VR8B 1AWDA 1FNUA 3DPDA 2K8HA 2MQJA 3NZUA 2N9KA 3Q8FA 1C3TA 3EC8A 3W5UB 3CSTA 3L10B 1YMHE 2K22A 4X57B 4GU2A 4JX1C 1E0ZA 2WQYB 2K5PA 3E56A 2I1JA 5GXGB 3GP7A 2AL3A 1R7SA 5AUKA 2KYWA 1KTKA 3TSSA 3CWIA 1QQRA 2MX2A 2C9WB 1FNWA 1XQQA 3FKYA 2WXRA 2KANA 3KH0A 4G0NB 1SIJA 5D2MB 3TCAA 2O6VB 1RFKA 1V8CA 2FIDA 4FLHA 4H2AA 4LNKA 4OW0A 4QAYA 4P16A 4YTNB 1WM2A 2YEPF 2KZRA 3CIRB 1KM7A 2DWQA 3R7RA 4A20A 2L52A 2KN5A 1FRRA 1I4RA 4DDID 5T8IA 2MJ3A 1ZGUB 2ZJDA 3TEXA 2RPQA 1DYQA 3RYTA 2LWPA 2LJIA 4LNNA 2PW9A 4G11A 4MGZE 1SB3C 3NZSA 4AP4C 1HZ5A 4DXFA 1WX8A 4OVUA 3PLVA 5KHQA 3KVFB 5IP4D 4WURA 1DOYA 2KFKB 2M1MA 3GE3C 1GAQB 2LHEA 4N58A 1D4BA 2BPSA 2ZPYA 4B95A 4BBNF 3PVLA 5GMVA 3AE5B 3U52E 1E7PB 2Z59B 1N60A 1ZE3D 2NMQA 2C60A 2KMAA 3A33B 1D3ZA 4YSXB 1U4AA 3DQVA 1WGRA 3A9KA 3ZJVA 4XYCA 5H8YE 4WWMA 1Y8RC 4TKNA 1F9JA 1YOVB 1BMLC 3N9YC 2D3GA 3P4PB 2DYMA 2J0JA 1QOBA 3V3XA 2BKFA 3PRZA 1YJ1A 2WDTB 4WWNA 3AEAB 4P1CC 2KTRA 1L0YB 2J0MA 4AJYB 3RNAC 3KQ4A 2NTSA 3MJ5A 1YD8U 1NYQA 2X8XX 4OZBA 4RFBA 5D94A 4BZAA 2GBJA 3ZVVA 1V5TA 2FUHB 2INPE 2GI9A 3V62A 1R4NB 4K3CA 3Q3NC 3QA8A 2K25A 3N1YC 2IGHA 4MGKE 1B9RA 2EKIA 4P7IA 1F2RC 3ZNZB 3UIOB 3ZDTA 4WH4A 4IWQA 1YJIA 3VTUA 2OJWA 4L23A 4OVVA 2E6XA 2V3PA 1ZUD2 3AV8A 5CHWA 3L13A 1L4DB 4G3XB 1L4ZB 3I3TB 3QC8B 4ICUA 1JROA 3AE1B 1WGKA 4LNOA 1MHXA 4AJWA 3WALA 2TSSA 3RCZA 4CYEA 1ET9A 4PS7A 4FBJB 4NQLB 2LVOA 4K81A 3ZXRA 3PRPB 4A9AA 4HROA 2CHZA 2N9PC 2LXCA 5BYRA 2INNE 5EE0A 3ZLZA 2FAZA 3DCGA 3VUYA 1V5OA 2ONQA 5D3DA 3BYYB 3ZNGC 2WXPA 2W9NA 1B1ZA 4PS3A 1IPGA 2KJ6A 2BS3B 1WRDB 4ZRKA 2V0GA 2HTME 5HI1A 2M56B 2EKEC 2WU2B 2G4DB 4C00A 1YN4A 3OWEB 3VH4B 3DHHC 4DHJD 2NR2A 1YX5B 1SBBB 3RZFA 2D07B 1OEYA 1L6UA 3FAHA 1GG3A 2LMCA 1ROEA 1CMXB 1KLUD 1I42A 4RCOA 2Y5PA 1P0RA 3QQ8B 2DYOA 2YLMA 4HDQA 1FNVA 2PMVA 3V6EB 2DYBA 3ML9A 2KVZA 3IFWB 4RF0A 1WR1A 2JYEA 2DZIA 2WXOA 2NTTA 1CQVA 2FCQA 4D2KA 1WH3A 4IM2A 4JGHB 2IGGA 3VUXA 2WXMA 2N7EA 4KDLB 2ZW1A 4GIVA 2G1EA 1UELA 4J3OD 2L0FA 3EFUA 2HTHA 2N9LA 3ZYYX 4ZYNA 2LJ5A 1VRAB 3SEBA 4M01A 1DGJA 1LFDA 2RGFA 3AEFB 4ARCA 2BB5A 2JZ3B 1UGMA 3TL5A 1WJ6A 2PPHA 2M0XA 1GB1A 2BYVE 1PFDA 2BQQA 4OVZA 3RN9C 2HD5B 2MWSB 4LNIA 2WDQB 1VD2A 3HK0A 2HJ8A 1MFWA 3W1YA 5IN7A 5H92C 1ZW7A 4IWOA 3AEGB 2ZNVB 4LLGM 4ANWA 1HZ6A 4A3OA 5JHAA 2IO0B 3L16A 4XGAB 1YNTE 2WXHA 2CHWA 2NPTB 2RD0A 2N1VA 1WZ3A 3CF6E 4MGYE 3ZNID 1L6VA 1T0SC 4FA6A 3UQBA 3TEZA 3DVNU 1WI0A 3WAOA 4EZLA 1LGRA 3LJ3A 3I57A 1T0YA 4ICVA 4FULA 2LGSA 1PDXA 1FFVA 4A6QA 2KXJA 2XK5B 3KUDB 4F8CB 4FN2A 2VH1A 1XO3A 4L2YA 1HA5A 3BK1A 3P42A 1NVID 1WXQA 3KYDD 1F52A 1EU4A 5HKHA 1UWMA 1C4PA 3HUIA 3VTVA 2Z0EB 2MBEA 4WIPA 3HRDD 3UGBB 1WE7A 4B0EA 5JZEB 3DBLI 1MI0A 1K8RB 2MW5A 2DNFA 1TT5B 1FFUA 4ASWC 4BOSC 2LEKA 2LRWA 1TZOA 1V2YA 4ZRPA 3U30A 2OJRA 3I5JC 1ZOYB 3FC4A 2KNBA 3U7DA 1N5WA 3VRBB 3MHZA 3ZTDA 2PE9A 2BS4B 3PZ7A 2MH7A 2A5UA 4IOIE 3SFEB 1H4RA 1L0XB 2IPKD 2PJHA 4HXDA 2LZ6A 1SE2A 1J7CA 1FXAA 2L00B 3L4PA 2W82A 2IY1B 1UD7A 4GN1A 1IBXB 3QWZB 1EWCA 5DCNA 2DAFA 2LHDA 3RNBC 4ANUA 3C19A 3AN1A 4AWJA 4GDKA 1KF6B 3TEWA 2REXA 1UGJA 1A5RA 3IHPC 3JSVB 2WDVB 3ECIA 3L0WB 4M0WB 3T3NA 4FXCA 2CJNA 4A3PA 3DVGY 3KW5B 1WGYA 2L0TA 2QILA 3OG5A 4ZYSA 4NJCA 5LXIB 1QKZA 3U2SC 5AUIA 2DZMA 2MBHA 1EF1A 4DBGA 2WS3B 4GXBA 1GUAB 2QDFA 3SR6A 1JWMD 2VRRB 4WJNA 2WDRB 1PQSA 1P7FA 4M02A 1UZXB 2JRIB 3ZDMC 3U7ZA 2OOBB 3AXCA 1XCTL 1J7BA 4ZRQA 2MJDA 4MJSB 1E6EB 5IO9A 4BBNC 4FADA 3KUZA 1SJED 3GS2A 3OJ3A 1WXMA 4M00A 3IAM1 5IOIA 2H88B 5L83A 1WWTA 4M8NA 4AOFA 2MHJA 4MACA 2HDEA 3N1ZC 1SE9A 2OEDA 2EMTA 2KN4A 2KTRB 1VR9A 4KDIC 3N3KB 3A9JB 4WWPA 1Z5SB 3WANA 2WGSA 3DVGX 2QIEB 3RNEC 2NBWB 1XF5L 1YJJA 2FCNA 3EA6A 2KLCA 2I38A 2UWQA 3IT4B 3RUIB 2WXFA 1I4PA 2WXKA 1ZXIA 1ISNA 1I4HA 4TQ0A 4IUMB 2C5LC 4J6IA 4R3DA 1TYGB 1R4MB 2J42A 4MGIE 4W9IA 1WGDA 1XEEA 2RPVA 4MM3B 1FM0D 1WMHA 4HRSA 3PLUA 4ZDVA 1WRIA 4WAFA 1R4MI 2DAJA 4XDCA 4B0MA 4HJGE 2LGYA 1FXIA 3X0WA 3AEDB 4EKUA 3ZXVA 2KT7A 5FR6A 4EEWA 5C23A 1IGCA 2LVQA 1JRUA 2CR5A 4BKGA 4JWSC 2AYOB 4DWFA 2NBUA 5AZHA 2JF5A 3NOBA 3VXWA 2QMTA 4IWPA 4KKJA 1N62A 1RFAA 3J9CA 4BFRA 2D10A 2Y3AA 4WQOB 3SDLC 1ZDVA 4E71A 5CTRC 1VZ7A 2MP2B 3DHIC 5FR3A 1YQBA 2DLBA 3GZNB 1KLGD 1N61A 1CJEA 3ZJUA 5BYSA 1NBFC 3DHGC 2PVOD 1T5XD 3KWLA 1E9MA 2BGFA 4HPLB 4FHJA 1DOXA 3MHSD 3MC0B 2A4ZA 2WP9B 5BMGA 2HJ1A 1E7VA 2XBBC 3P2BA 4KZCA 2FBWB 3AE8B 2ZCCA 2PE6B 4EE2A 1QLBB 4EZKA 1TS4A 3AU4A 4EUTA 1WR6E 3PO0A 4NQKE 3N1XC 1WX7A 1LQBA 3PPAA 4NJ7A 3IBEA 3GE8C 3SU8X 4II2B 1J8CA 3RD2A 2B3AA 3TIXA 1FRDA 1VZ8A 2V3NA 2DZKA 3V60A 4IW0A 1E8YA 2GB1A 2L83A 2PTLA 4XWTA 3M3JA 2O6VA 3ONSA 4MSQB 2IBIB 1PYWD 2M4NA 3B1LX 2J0KA 3RNGC 3U8ZA 1HXYD 1J7AA 1WX9A 1RYJA 3RNCC 1D5XC 2GOWA 5G2NA 1UBIA 3NUHB 1WM3A 3Q8AA 4JLCA 2MA9B 2EMSA 2MBQA 4NZLB 1XT9B 2JXXA 4KIKB 3WIMA 4TV3A 3NVVA 3ZRFA 4IC7B 1V1OA 2AWTA 4GDLA 1FEHA 5DPWA 5BYQA 4TQ1A 4W9LA 1QOGA 3ZKJC 1L2NA 5KHOA 4K7UA 3CMMB 3VQIA 1Q10A 2JYTA 2O6VD 3Q8BA 2QCZA 2LGDA 2OHFA 1XLOA 2HE7A 2B76B 3IAS1 2ZVNA 3A1QA 2BS2B 1TGZB 1I4QA 1F1HA 3NHEB 4MDKE 2K39A 3AE2B 3DBRB 2LGIA 2N9XA 3ZTCA 1WZ0A 4YL8A 1E8WA 1C9FA 2K8CA 4IDIA 4P1BC 2K1FA 3PV1A 4GGQA 2KAJA 2XK5A 2MJEA 3O13A 1P9DU 1JALA 2PLPA 3IVFA 5G55A 4TMAB 1OQYA 3ENEA 4HCPB 2AEHA 2JX5A 4LDTB 4BAXA 2YEPB 1RM6C 3L54A 3UIPB 3NVYA 1N63A 1NI2A 4RGMA 3AU5A 1TKGA 4G50A 2H89B 3R66C 4JE3B 4ZRJA 4NAWB 2LFIA 2X38A 3APCA 4BKSD 1MG8A 3QJZA 1SE3A 1GC7A 4JWUC 3DBLB 2E3TA 2MBBB 2BBCA 3WAMA 1XCQL 4I6NB 1C78A 1R4NI 4CO7A 5BO4B 2CJOA 4PS8A 3Q69A 4MEMA 1VCBA 2KC2A 1E8ZA 2KACA 3H7PB 4HK2A 2LGXA 4US8A 1G6JA 2Z8LA 1F2RI 3VFKA 3WA0A 4KGRA 4KVGB 4AQ7A 3NJTA 1FD6A 2CU3A 3MC9A 4YSYB 2R61A 3EUB2 2ZCBA 3QARA 4RM9A 1WY8A 1GC6A 3BINA 2KX0A 2WWZA 1C4AA 1SIFA 1J19A 4DHJB 2MEKA 3BK2A 1M94A 3GZNI 1YIWA 1K53A 2DX5B 2L76A 3TJPA 3VAWA 3PHXB 1PGXA 2LD9A 1JMLA 2C7NB 1NDDA 2CKHB 4M8MA 3GB1A 5DPTA 1V1PB 1EO6A 1RWSA 1XLPA 3VTWA 1ACCA 5IKCM 4NAMA 5CHFA 5LNK1 3BWUD 1JWUD 2DBYA 4W9GA 4WJOA 2IYDB 2JUOA 3TMPB 1S1QB 1QF6A 2KO3A 3OLMD 1DOIA 1V80A 3FILB 1QZEA 1UBQA 5DPRA 2V1YA 4XX5A 1WJNA 2I1KA 2GLSA 2FCMA 2L3ZA 4K3BA 3ZIMA 5EE9A 4LDTD 4EOYA 2KMMA 4N59A 1ZP0B 2FUG1 4XDDA 3DWMA 3VRAB 3ZW3A 2KKCA 1EWYC 2N7DA 3APFA 5JHBA 3DOWA 3ZNHB 4DDGD 4LK0M 2BWES 3M63B 2ASQA 3KUCB 1FPYA 2KDIA 4ACFA 2WYQA 3AE9B 3AMZA 2JSVX 4RGOS 2ZZPB 3KLSX 1WXSA 3H8HA 3UQAA 2G3QB 3L17A 3S2AA 3ZRCA 2L32A 3DWGC 2Y5BB 3VR9B 1GPXA 3WAPA 2FE8A 3VUWA 1AARA 1KRHA 1KFYB 2G4SA 1ZKHA 1LO5D 3DBHB 4OZCA 4NJ6A 3SHQA 1WIAA 1V81A 3R2IA 2LXAA 1NEKB 3D32A 4KX6B 3QIJA 2ZPNA 4JQWC 1V49A 2XNAC 1HE8A 2GBNA 5JXVA 1GJZA 4P6VF 4REZA 2D3BA 3AE6B 3AECB 3Q2AC 1YQ3B 1LM8B 3C8YA 3APDA 4W9KA 2WXLA 4GDKB 1QILA 3PGEA 3TBLD 1MG4A 2CHXA 5BMIA 1JRPA 4RGTA 1TIFA 2GBKA 1MJDA 1D5ZC 2N7JA 1FCLA 3HIZA 3OAWA 3AB5A 1V86A 3ZO5B 1E8XA 4S17A 4I6LB 3P4RB 2KDFB 3OJ4B 5LLIA 1SE4A 4DHZB 1M4VA 1ZXHA 2VZKB 4Q2JA 2BF8B 2N0SB 3PHWB 2PIAA 4PK1A 3H6NA 1P98A 2KK8A 3QK0A 3Q3OC 4W9JA 2KWCA 2G9HD 4B6WA 3N32A 1OGWA 3EECA 2K6QA 4XZ4A 3PZDA 3VHTC 1EUVB 2NS5A 2AQ2B 1FXTB 1P7EA 3M95A 2C7MB 4EFOA 1T6BX 2WNMA 1K52A 3NG0A 3Q8CA 3WCQA 3RI7C 2BYTA 4L1BA 3MP9A 1IGDA 3LYYA 2FNJB 1P3QU 3R8BA 4WAAA 2QHOA 3ETRA 3R2TA 1XLNA 5J18A 4A55A 2KWDA 4XC2A 5EDSA 5AZFA 3CSFA 5BMHA 3K9OB 1IBXA 3KWVA 2KJRA 2W3SA 3Q3JA 2O2VB 2N9EB 1E90A 2NCNA 2NBVB 4FJZA 3JSVA 3HVDA 3R3MA 4KIKA 4HLEA 1VJKA 2AQ1B 1I4GA 4NPNA 2IO3B 4RM8A 4PYUA 2INCC 1WMHB 2WX0A 3HM6X 2R2QA 2PEAA 1AW7A 4FJYA 3E9SA 3X23A 1JW9D 4W9FA 2C7HA 2EELA 1YQ4B 4FJVB 1KLVA 2DHZA 4BOZB 1HTOA 4LJOB 2KWVB 3Q14C 1ENFA 1UH6A 4DXAB 3QCAA 3P63A 3VDZA 2KTFA 3PSEB 1QT9A 2KQSA 1IYFA 5G5HA 1S3SG 1SJHD 3BY4B 5DPSA 4K7WA 1ZPSA 4II3B 3BZDB 1HTQA 4LJPB 3I63C 4GMVA 1TTNA 4WJPA 4MH0E 1BT0A 1KH0A 4W9CA 4DK5A 1T3QA 4DXGA 5C1ZA 4N9F4 5EE3A 3NS8A 2ZW0A 4HDOA 1AYFA 4JPSA 2IY0B 4OZAA 3TEYA 4HVBA 2WX1A 2RDGA 2K9XA 1RLFA 3DBSA 2LUEA 4PYZA 5IA7A 4MH8A 2V3SA 4KZ0A 4YTMB 4XWWA 2BYEA 3BVZA 2UU7A 2MSED 3MFGA 1V97A 1C1YB 4IKGA 2WU5B 2BKRB 1PUTA 1UUPA 5TSSA 2ON8A 2L8JA 1D6EC 4A8XC 2W54A 1WFYA 1BXTA 3R7QA 4TSSA 5CHVC 3V05A 3M62B 4LCDE 2LUMA 4F1SA 4YT0B 1EF5A 1L7YA 3H1UA
chains in the Genus database with same CATH topology
4FN2A 4NAWB 2KVRA 4HWIB 3APCA 3H9DA 4BKSD 2V4LA 2NPTA 1MG8A 3QJZA 1GC7A 3RZWC 2GMIC 2KWUB 2ZEQA 4GSWA 3VVWB 3KYDD 2MBBB 3H7SA 5HKHA 3WAMA 3VTVA 1SGHA 2Z0EB 2MBEA 4I6NB 3RULA 2JY6A 1R4NI 4CO7A 3UGBB 5BO4B 4PS8A 1WE7A 1RAXA 4NY0A 5JZEB 3DBLI 3O65B 3EHVA 1K8RB 2N1WA 4MEMA 2MW5A 1WF9A 3A9KB 1VCBA 2KC2A 3JVZX 1E8ZA 1GNUA 3UF8A 1WE6A 1V6EA 4ASWC 4BOSC 2FCSA 3GOEA 2KLGA 3H7PB 4HK2A 2LRWA 1V2YA 2LGXA 2OJRA 3U30A 2D2QA 2KFJA 2J7QB 2KX3A 3SD5A 4F7ZA 1G6JA 3PRMB 2NVUI 2DZJA 2GBRA 2KNBA 2KD0A 1OEYJ 3U7DA 3VFKA 1J0GA 4BKTA 1TZ1A 3DPDA 3WA0A 2K8HA 4KVGB 3ZTDA 2PE9A 2MQJA 2MLBA 3NZUA 2A5UA 2M8SA 2ZCBA 1H4RA 1C3TA 3EC8A 3QARA 3CSTA 3L10B 2PJHA 4X57B 4RM9A 1WY8A 4HXDA 1GC6A 3BINA 4GU2A 2LZ6A 2KX0A 2WWZA 2L00B 2M17A 2I1JA 1SIFA 1J19A 4DHJB 2YVCA 2AL3A 2IY1B 1M94A 3GZNI 1YIWA 1UD7A 3QHTA 4GN1A 2DX5B 2L76A 3QWZB 2MX2A 5DCNA 3TJPA 3PHXB 3VAWA 2DAFA 2C9WB 1XQQA 4ANUA 4AWJA 2KANA 1P1AA 2LD9A 2C7NB 2CKHB 1NDDA 3KH0A 4G0NB 4GDKA 2N4FA 4RMAA 4W9HA 4M8MA 5D2MB 3TCAA 3VH3B 2REXA 2KDEB 4I6PA 1H8CA 5DPTA 1A5RA 3AULA 2LI5A 3IHPC 3JSVB 1EO6A 2O6VB 3VTWA 3ECIA 3L0WB 4M0WB 4ANXA 2FIDA 4FLHA 5CHFA 4A3PA 3DVGY 3KW5B 1WGYA 2L0TA 2JT4B 4W9GA 4ZRJA 4W9DA 5LXIB 4WJOA 2IYDB 2JUOA 3PT2B 3DVNV 1S1QB 1WM2A 2MBHA 2DZMA 2KZRA 2KO3A 3TMPB 1KM7A 3OLMD 1EF1A 3R7RA 4A20A 1V80A 5D6JB 4DBGA 2KN5A 1QZEA 3N30A 1GUAB 2Z0DB 4GXBA 4DDID 1UBQA 5DPRA 2V1YA 1ZGUB 2VRRB 2ZJDA 4XX5A 4WJNA 2RPQA 1WJNA 3HHMA 1PQSA 2I1KA 5E6PA 3RYTA 2R2OA 1KOTA 1UZXB 2LWPA 2FCMA 2L3ZA 2JRIB 3ZDMC 3ZIMA 4E74A 1Q5WB 3A4SC 4G11A 2OOBB 4MGZE 4LDTD 4EOYA 3AXCA 3NZSA 4MJSB 4AP4C 1YX6B 2AL6A 4BBNC 3ZW3A 1WX8A 4OVUA 4FADA 3PLVA 2KKCA 3KUZA 5KHQA 2N7DA 3APFA 5JHBA 3DOWA 3OJ3A 3KVFB 3ZNHB 4DDGD 2KFKB 2L7RA 1WXMA 2BWES 2M1MA 3M63B 2ASQA 2KDIA 3KUCB 5L83A 2WYQA 4M8NA 4AOFA 2LASA 5J2RA 2LVPA 2BPSA 5D7GA 2ZPYA 1SE9A 2ZZPB 1WXSA 4B95A 4BVUC 3UQAA 2G3QB 3L17A 3S2AA 4BBNF 3PVLA 4KSLC 3ZRCA 3T9LA 2EMTA 5GMVA 2KTRB 2Y5BB 2JWZA 2Z59B 3DDCB 5AZGA 4GDLB 2C60A 2KMAA 4URKA 3A33B 4CHKA 2FIFA 4KDIC 1D3ZA 1U4AA 3DQVA 3N3KB 2RSUA 1WGRA 3A9JB 4WWPA 3WAPA 3MTNB 4MM3A 3VUWA 1AARA 3A9KA 5IAAC 2KFKA 1Y8RC 1LXDA 1F9JA 1Z5SB 2G4SA 3H7PA 2IZVB 3MJWA 4TKNA 3WANA 3DBRI 1ZKHA 2JVCA 2D3GA 2DYMA 3AI5A 2J0JA 3DVGX 2NBWB 2BKFA 3JYUA 4NJ6A 3SHQA 3PRZA 1WIAA 1YJ1A 2WDTB 1RRBA 1V81A 2LXAA 4WWNA 3D32A 2FCNA 1WJ4A 2KLCA 2KTRA 2UWQA 4KV2A 3QIJA 2ZPNA 4JL9A 4HCNB 2J0MA 3RUIB 4JQWC 4AJYB 1V49A 2MRPA 1ISNA 2JZZA 4TQ0A 4IUMB 1HE8A 2GBNA 2C5LC 4J6IA 3UINB 1GJZA 4MGIE 1YD8U 4W9IA 1WGDA 3V61A 1WMHA 3PLUA 5D94A 4ZDVA 1LM8B 3APDA 3B0AA 4W9KA 1R4MI 2DAJA 4GDKB 2GBJA 3PGEA 3TBLD 3ZVVA 1V5TA 3W1SC 2FUHB 2D11A 3V62A 2LGYA 2CHXA 3X0WA 3QA8A 2K25A 4JIOU 4MGKE 5E6NA 4EKUA 4P7IA 2GBKA 3ZNZB 3UIOB 5FR6A 3ZDTA 1X1MA 2KDBA 4HPMB 5C23A 4EEWA 4IWQA 4GB9A 4GOCA 3HIZA 3OAWA 3VTUA 2K8BA 2LVQA 1JRUA 2CR5A 4TUUA 1V9JA 3PTFC 2AYOB 4BKGA 4DWFA 2NBUA 1V86A 4DHZE 3ZO5B 1E8XA 4OVVA 5AZHA 2JF5A 3NOBA 4I6LB 5CHWA 2KDFB 3L13A 4FHKA 4IWPA 3VXWA 2KC1A 2JPHA 3OJ4B 4G3XB 5LLIA 3I3TB 3QC8B 1RFAA 2ZNVC 2MCNB 4BFRA 4DHZB 4ICUA 2D10A 4NNJB 4WQOB 3SDLC 2BF8B 4AJWA 3PHWB 4E71A 3WALA 5CTRC 3RCZA 2MP2B 3H6NA 1P98A 2KK8A 3QK0A 1YQBA 3Q3FA 4W9JA 2KWCA 4CYEA 4PS7A 4B6WA 3N32A 1OGWA 2LVOA 4K81A 4NQLB 2UYZB 4FBJB 3EECA 1NBFC 2K6QA 3PRPB 4XZ4A 3PZDA 3VHTC 1WJUA 2BGFA 2CHZA 4HPLB 1EUVB 2NS5A 2N9PC 1FXTB 1Q1OA 4IM0A 5CX3A 4FHJA 2LXCA 3M95A 2C7MB 3MHSD 4EFOA 3ZLZA 2A4ZA 2FAZA 3DCGA 3VUYA 3QAQA 1V5OA 1OTRB 3ZNGC 1E7VA 2XBBC 2W9NA 4BKSA 1Q0WB 3ML8A 3W1SA 3P2BA 4PS3A 2FNJB 4KZCA 2O2VA 4WWOA 1P3QU 2ZCCA 1IPGA 4WAAA 2KJ6A 4ZRKA 2MP2A 1WRDB 2PE6B 2QHOA 4HJKA 4EZKA 2JRHA 3AU4A 4EUTA 5J18A 2EKEC 1WR6E 3LDZE 4NQKE 2G4DB 1WX7A 1LQBA 4ANVA 3VH4B 4XC2A 3PPAA 4NJ7A 3IBEA 4DHJD 5EDSA 4IG7B 2NR2A 3SU8X 4II2B 1YX5B 3T8MA 3V6CB 5AZFA 4W9EA 1J8CA 3CSFA 3RD2A 2B3AA 3TIXA 2KOXA 3K9OB 3RZFA 2D07B 2RR9A 1OEYA 3A4RA 1KJTA 1GG3A 2KJRA 1WGHA 3Q3JA 2DZKA 5J17A 2O2VB 4IM3A 1CMXB 3RT3B 2K6DB 3V60A 2N9EB 4IW0A 1E8YA 4KSKC 1E90A 2NCNA 2NBVB 4FJZA 3JSVA 1I42A 3R3MA 1WGGA 3K9PB 3M3JA 3QX1A 4KIKA 4HLEA 2O6VA 3ONSA 1P0RA 2IBIB 2DYOA 3PS6A 2M4NA 2YLMA 2ZVOA 3B1LX 3QQ8B 2J0KA 2BYFA 4HDQA 4NPNA 2IO3B 3C0RB 3U8ZA 3ZUNA 4RM8A 1I35A 3ALBA 1WX9A 4PYUA 1WMHB 3V6EB 2DYBA 2WX0A 2GOWA 2R2QA 3HM6X 2PEAA 4FJYA 3ML9A 3IFWB 1WR1A 5G2NA 3X23A 1UBIA 2DZIA 1WM3A 4W9FA 2C7HA 3KYCD 2XEWA 4FJVB 1KLVA 2FCQA 2DHZA 4JLCA 2MA9B 4EZJA 2IO1B 1WH3A 4BOZB 2EMSA 4IM2A 2MBQA 4JGHB 4LJOB 5TR5A 1XT9B 2JXXA 2KWVB 3VUXA 4KIKB 3WIMA 4TV3A 2N7EA 2KHWB 4KDLB 1UH6A 4GIVA 1XD3B 4DXAB 1UELA 3QCAA 3ZRFA 2BWFA 2KQ7A 2L0FA 4AUQC 3EFUA 4IC7B 2AWTA 4GDLA 2HTHA 3VDZA 2KTFA 3PSEB 4K7SA 4MSQB 4ZRIA 2KQSA 4ZYNA 2MBOA 3A9JA 1IYFA 5DPWA 2LJ5A 4K1RB 5AEKB 1S3SG 4TQ1A 1LFDA 3BY4B 2RGFA 4W9LA 3ZKJC 5DPSA 1L2NA 4K7WA 4II3B 5KHOA 1WXAA 3CMMB 4K7UA 2KMCA 4LJPB 3VQIA 4GMVA 1TTNA 1WYWB 4WJPA 4MH0E 2O6VD 1BT0A 4W9CA 4DK5A 2JZ3B 2DENB 5C1ZA 1UGMA 3DBHI 3TL5A 1WJ6A 4N9F4 1E7UA 2PPHA 2M0XA 1TBEA 3NS8A 2LGDA 2BYVE 2HE7A 4HDOA 4B9KA 5L95C 2IY0B 3IG3A 1Z2MA 4HVBA 2HD5B 2ZVNA 2WX1A 1TGZB 3A1QA 5JH5C 2MWSB 1IP9A 1WXVA 1RLFA 3NHEB 4MDKE 2L05A 2K39A 1VD2A 2CU1A 3HK0A 2HJ8A 3DBSA 2LUEA 3W1YA 1E5WA 2N9XA 4PYZA 3ZTCA 1WZ0A 5IA7A 1ZW7A 3PREA 4IWOA 4MELA 2LRUA 4YL8A 1E8WA 5LXHA 2ZNVB 2K8CA 2V3SA 4KZ0A 4ANWA 2K1FA 4NAWA 3PV1A 4GGQA 4A3OA 2IO0B 5JHAA 2GBMA 2BYEA 3L16A 2XK5A 4WJQA 2CHWA 1P9DU 2NPTB 2MSED 2CS4A 2N1VA 2RD0A 1WZ3A 1C1YB 2BKRB 5E6OA 3CF6E 3IVFA 4MGYE 5G55A 2G45B 3ZNID 3NY5A 1OQYA 3ENEA 2L8JA 4FA6A 4HCPB 2AEHA 1WFYA 3L08A 4LDTB 3UQBA 3A1QB 3DVNU 3R7QA 4MSMB 1WI0A 4E3CA 3WAOA 3JW0X 4MJSA 3L54A 5CHVC 3UIPB 4EZLA 2IO2B 3HM3A 3M62B 4LCDE 1NI2A 3LJ3A 3AU5A 1T0YA 4G50A 4ICVA 4F1SA 4FULA 3B08A 1EF5A 1L7YA 2KJHB 2KXJA 3R66C 2XK5B 3KUDB 3H1UA 4F8CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FN2 A;  4NAW B;  2KVR A;  4HWI B;  3APC A;  3H9D A;  4BKS D;  2V4L A;  2NPT A;  1MG8 A;  3QJZ A;  1GC7 A;  3RZW C;  2GMI C;  2KWU B;  2ZEQ A;  4GSW A;  3VVW B;  3KYD D;  2MBB B;  3H7S A;  5HKH A;  3WAM A;  3VTV A;  1SGH A;  2Z0E B;  2MBE A;  4I6N B;  3RUL A;  2JY6 A;  1R4N I;  4CO7 A;  3UGB B;  5BO4 B;  4PS8 A;  1WE7 A;  1RAX A;  4NY0 A;  5JZE B;  3DBL I;  3O65 B;  3EHV A;  1K8R B;  2N1W A;  4MEM A;  2MW5 A;  1WF9 A;  3A9K B;  1VCB A;  2KC2 A;  3JVZ X;  1E8Z A;  1GNU A;  3UF8 A;  1WE6 A;  1V6E A;  4ASW C;  4BOS C;  2FCS A;  3GOE A;  2KLG A;  3H7P B;  4HK2 A;  2LRW A;  1V2Y A;  2LGX A;  2OJR A;  3U30 A;  2D2Q A;  2KFJ A;  2J7Q B;  2KX3 A;  3SD5 A;  4F7Z A;  1G6J A;  3PRM B;  2NVU I;  2DZJ A;  2GBR A;  2KNB A;  2KD0 A;  1OEY J;  3U7D A;  3VFK A;  1J0G A;  4BKT A;  1TZ1 A;  3DPD A;  3WA0 A;  2K8H A;  4KVG B;  3ZTD A;  2PE9 A;  2MQJ A;  2MLB A;  3NZU A;  2A5U A;  2M8S A;  2ZCB A;  1H4R A;  1C3T A;  3EC8 A;  3QAR A;  3CST A;  3L10 B;  2PJH A;  4X57 B;  4RM9 A;  1WY8 A;  4HXD A;  1GC6 A;  3BIN A;  4GU2 A;  2LZ6 A;  2KX0 A;  2WWZ A;  2L00 B;  2M17 A;  2I1J A;  1SIF A;  1J19 A;  4DHJ B;  2YVC A;  2AL3 A;  2IY1 B;  1M94 A;  3GZN I;  1YIW A;  1UD7 A;  3QHT A;  4GN1 A;  2DX5 B;  2L76 A;  3QWZ B;  2MX2 A;  5DCN A;  3TJP A;  3PHX B;  3VAW A;  2DAF A;  2C9W B;  1XQQ A;  4ANU A;  4AWJ A;  2KAN A;  1P1A A;  2LD9 A;  2C7N B;  2CKH B;  1NDD A;  3KH0 A;  4G0N B;  4GDK A;  2N4F A;  4RMA A;  4W9H A;  4M8M A;  5D2M B;  3TCA A;  3VH3 B;  2REX A;  2KDE B;  4I6P A;  1H8C A;  5DPT A;  1A5R A;  3AUL A;  2LI5 A;  3IHP C;  3JSV B;  1EO6 A;  2O6V B;  3VTW A;  3ECI A;  3L0W B;  4M0W B;  4ANX A;  2FID A;  4FLH A;  5CHF A;  4A3P A;  3DVG Y;  3KW5 B;  1WGY A;  2L0T A;  2JT4 B;  4W9G A;  4ZRJ A;  4W9D A;  5LXI B;  4WJO A;  2IYD B;  2JUO A;  3PT2 B;  3DVN V;  1S1Q B;  1WM2 A;  2MBH A;  2DZM A;  2KZR A;  2KO3 A;  3TMP B;  1KM7 A;  3OLM D;  1EF1 A;  3R7R A;  4A20 A;  1V80 A;  5D6J B;  4DBG A;  2KN5 A;  1QZE A;  3N30 A;  1GUA B;  2Z0D B;  4GXB A;  4DDI D;  1UBQ A;  5DPR A;  2V1Y A;  1ZGU B;  2VRR B;  2ZJD A;  4XX5 A;  4WJN A;  2RPQ A;  1WJN A;  3HHM A;  1PQS A;  2I1K A;  5E6P A;  3RYT A;  2R2O A;  1KOT A;  1UZX B;  2LWP A;  2FCM A;  2L3Z A;  2JRI B;  3ZDM C;  3ZIM A;  4E74 A;  1Q5W B;  3A4S C;  4G11 A;  2OOB B;  4MGZ E;  4LDT D;  4EOY A;  3AXC A;  3NZS A;  4MJS B;  4AP4 C;  1YX6 B;  2AL6 A;  4BBN C;  3ZW3 A;  1WX8 A;  4OVU A;  4FAD A;  3PLV A;  2KKC A;  3KUZ A;  5KHQ A;  2N7D A;  3APF A;  5JHB A;  3DOW A;  3OJ3 A;  3KVF B;  3ZNH B;  4DDG D;  2KFK B;  2L7R A;  1WXM A;  2BWE S;  2M1M A;  3M63 B;  2ASQ A;  2KDI A;  3KUC B;  5L83 A;  2WYQ A;  4M8N A;  4AOF A;  2LAS A;  5J2R A;  2LVP A;  2BPS A;  5D7G A;  2ZPY A;  1SE9 A;  2ZZP B;  1WXS A;  4B95 A;  4BVU C;  3UQA A;  2G3Q B;  3L17 A;  3S2A A;  4BBN F;  3PVL A;  4KSL C;  3ZRC A;  3T9L A;  2EMT A;  5GMV A;  2KTR B;  2Y5B B;  2JWZ A;  2Z59 B;  3DDC B;  5AZG A;  4GDL B;  2C60 A;  2KMA A;  4URK A;  3A33 B;  4CHK A;  2FIF A;  4KDI C;  1D3Z A;  1U4A A;  3DQV A;  3N3K B;  2RSU A;  1WGR A;  3A9J B;  4WWP A;  3WAP A;  3MTN B;  4MM3 A;  3VUW A;  1AAR A;  3A9K A;  5IAA C;  2KFK A;  1Y8R C;  1LXD A;  1F9J A;  1Z5S B;  2G4S A;  3H7P A;  2IZV B;  3MJW A;  4TKN A;  3WAN A;  3DBR I;  1ZKH A;  2JVC A;  2D3G A;  2DYM A;  3AI5 A;  2J0J A;  3DVG X;  2NBW B;  2BKF A;  3JYU A;  4NJ6 A;  3SHQ A;  3PRZ A;  1WIA A;  1YJ1 A;  2WDT B;  1RRB A;  1V81 A;  2LXA A;  4WWN A;  3D32 A;  2FCN A;  1WJ4 A;  2KLC A;  2KTR A;  2UWQ A;  4KV2 A;  3QIJ A;  2ZPN A;  4JL9 A;  4HCN B;  2J0M A;  3RUI B;  4JQW C;  4AJY B;  1V49 A;  2MRP A;  1ISN A;  2JZZ A;  4TQ0 A;  4IUM B;  1HE8 A;  2GBN A;  2C5L C;  4J6I A;  3UIN B;  1GJZ A;  4MGI E;  1YD8 U;  4W9I A;  1WGD A;  3V61 A;  1WMH A;  3PLU A;  5D94 A;  4ZDV A;  1LM8 B;  3APD A;  3B0A A;  4W9K A;  1R4M I;  2DAJ A;  4GDK B;  2GBJ A;  3PGE A;  3TBL D;  3ZVV A;  1V5T A;  3W1S C;  2FUH B;  2D11 A;  3V62 A;  2LGY A;  2CHX A;  3X0W A;  3QA8 A;  2K25 A;  4JIO U;  4MGK E;  5E6N A;  4EKU A;  4P7I A;  2GBK A;  3ZNZ B;  3UIO B;  5FR6 A;  3ZDT A;  1X1M A;  2KDB A;  4HPM B;  5C23 A;  4EEW A;  4IWQ A;  4GB9 A;  4GOC A;  3HIZ A;  3OAW A;  3VTU A;  2K8B A;  2LVQ A;  1JRU A;  2CR5 A;  4TUU A;  1V9J A;  3PTF C;  2AYO B;  4BKG A;  4DWF A;  2NBU A;  1V86 A;  4DHZ E;  3ZO5 B;  1E8X A;  4OVV A;  5AZH A;  2JF5 A;  3NOB A;  4I6L B;  5CHW A;  2KDF B;  3L13 A;  4FHK A;  4IWP A;  3VXW A;  2KC1 A;  2JPH A;  3OJ4 B;  4G3X B;  5LLI A;  3I3T B;  3QC8 B;  1RFA A;  2ZNV C;  2MCN B;  4BFR A;  4DHZ B;  4ICU A;  2D10 A;  4NNJ B;  4WQO B;  3SDL C;  2BF8 B;  4AJW A;  3PHW B;  4E71 A;  3WAL A;  5CTR C;  3RCZ A;  2MP2 B;  3H6N A;  1P98 A;  2KK8 A;  3QK0 A;  1YQB A;  3Q3F A;  4W9J A;  2KWC A;  4CYE A;  4PS7 A;  4B6W A;  3N32 A;  1OGW A;  2LVO A;  4K81 A;  4NQL B;  2UYZ B;  4FBJ B;  3EEC A;  1NBF C;  2K6Q A;  3PRP B;  4XZ4 A;  3PZD A;  3VHT C;  1WJU A;  2BGF A;  2CHZ A;  4HPL B;  1EUV B;  2NS5 A;  2N9P C;  1FXT B;  1Q1O A;  4IM0 A;  5CX3 A;  4FHJ A;  2LXC A;  3M95 A;  2C7M B;  3MHS D;  4EFO A;  3ZLZ A;  2A4Z A;  2FAZ A;  3DCG A;  3VUY A;  3QAQ A;  1V5O A;  1OTR B;  3ZNG C;  1E7V A;  2XBB C;  2W9N A;  4BKS A;  1Q0W B;  3ML8 A;  3W1S A;  3P2B A;  4PS3 A;  2FNJ B;  4KZC A;  2O2V A;  4WWO A;  1P3Q U;  2ZCC A;  1IPG A;  4WAA A;  2KJ6 A;  4ZRK A;  2MP2 A;  1WRD B;  2PE6 B;  2QHO A;  4HJK A;  4EZK A;  2JRH A;  3AU4 A;  4EUT A;  5J18 A;  2EKE C;  1WR6 E;  3LDZ E;  4NQK E;  2G4D B;  1WX7 A;  1LQB A;  4ANV A;  3VH4 B;  4XC2 A;  3PPA A;  4NJ7 A;  3IBE A;  4DHJ D;  5EDS A;  4IG7 B;  2NR2 A;  3SU8 X;  4II2 B;  1YX5 B;  3T8M A;  3V6C B;  5AZF A;  4W9E A;  1J8C A;  3CSF A;  3RD2 A;  2B3A A;  3TIX A;  2KOX A;  3K9O B;  3RZF A;  2D07 B;  2RR9 A;  1OEY A;  3A4R A;  1KJT A;  1GG3 A;  2KJR A;  1WGH A;  3Q3J A;  2DZK A;  5J17 A;  2O2V B;  4IM3 A;  1CMX B;  3RT3 B;  2K6D B;  3V60 A;  2N9E B;  4IW0 A;  1E8Y A;  4KSK C;  1E90 A;  2NCN A;  2NBV B;  4FJZ A;  3JSV A;  1I42 A;  3R3M A;  1WGG A;  3K9P B;  3M3J A;  3QX1 A;  4KIK A;  4HLE A;  2O6V A;  3ONS A;  1P0R A;  2IBI B;  2DYO A;  3PS6 A;  2M4N A;  2YLM A;  2ZVO A;  3B1L X;  3QQ8 B;  2J0K A;  2BYF A;  4HDQ A;  4NPN A;  2IO3 B;  3C0R B;  3U8Z A;  3ZUN A;  4RM8 A;  1I35 A;  3ALB A;  1WX9 A;  4PYU A;  1WMH B;  3V6E B;  2DYB A;  2WX0 A;  2GOW A;  2R2Q A;  3HM6 X;  2PEA A;  4FJY A;  3ML9 A;  3IFW B;  1WR1 A;  5G2N A;  3X23 A;  1UBI A;  2DZI A;  1WM3 A;  4W9F A;  2C7H A;  3KYC D;  2XEW A;  4FJV B;  1KLV A;  2FCQ A;  2DHZ A;  4JLC A;  2MA9 B;  4EZJ A;  2IO1 B;  1WH3 A;  4BOZ B;  2EMS A;  4IM2 A;  2MBQ A;  4JGH B;  4LJO B;  5TR5 A;  1XT9 B;  2JXX A;  2KWV B;  3VUX A;  4KIK B;  3WIM A;  4TV3 A;  2N7E A;  2KHW B;  4KDL B;  1UH6 A;  4GIV A;  1XD3 B;  4DXA B;  1UEL A;  3QCA A;  3ZRF A;  2BWF A;  2KQ7 A;  2L0F A;  4AUQ C;  3EFU A;  4IC7 B;  2AWT A;  4GDL A;  2HTH A;  3VDZ A;  2KTF A;  3PSE B;  4K7S A;  4MSQ B;  4ZRI A;  2KQS A;  4ZYN A;  2MBO A;  3A9J A;  1IYF A;  5DPW A;  2LJ5 A;  4K1R B;  5AEK B;  1S3S G;  4TQ1 A;  1LFD A;  3BY4 B;  2RGF A;  4W9L A;  3ZKJ C;  5DPS A;  1L2N A;  4K7W A;  4II3 B;  5KHO A;  1WXA A;  3CMM B;  4K7U A;  2KMC A;  4LJP B;  3VQI A;  4GMV A;  1TTN A;  1WYW B;  4WJP A;  4MH0 E;  2O6V D;  1BT0 A;  4W9C A;  4DK5 A;  2JZ3 B;  2DEN B;  5C1Z A;  1UGM A;  3DBH I;  3TL5 A;  1WJ6 A;  4N9F 4;  1E7U A;  2PPH A;  2M0X A;  1TBE A;  3NS8 A;  2LGD A;  2BYV E;  2HE7 A;  4HDO A;  4B9K A;  5L95 C;  2IY0 B;  3IG3 A;  1Z2M A;  4HVB A;  2HD5 B;  2ZVN A;  2WX1 A;  1TGZ B;  3A1Q A;  5JH5 C;  2MWS B;  1IP9 A;  1WXV A;  1RLF A;  3NHE B;  4MDK E;  2L05 A;  2K39 A;  1VD2 A;  2CU1 A;  3HK0 A;  2HJ8 A;  3DBS A;  2LUE A;  3W1Y A;  1E5W A;  2N9X A;  4PYZ A;  3ZTC A;  1WZ0 A;  5IA7 A;  1ZW7 A;  3PRE A;  4IWO A;  4MEL A;  2LRU A;  4YL8 A;  1E8W A;  5LXH A;  2ZNV B;  2K8C A;  2V3S A;  4KZ0 A;  4ANW A;  2K1F A;  4NAW A;  3PV1 A;  4GGQ A;  4A3O A;  2IO0 B;  5JHA A;  2GBM A;  2BYE A;  3L16 A;  2XK5 A;  4WJQ A;  2CHW A;  1P9D U;  2NPT B;  2MSE D;  2CS4 A;  2N1V A;  2RD0 A;  1WZ3 A;  1C1Y B;  2BKR B;  5E6O A;  3CF6 E;  3IVF A;  4MGY E;  5G55 A;  2G45 B;  3ZNI D;  3NY5 A;  1OQY A;  3ENE A;  2L8J A;  4FA6 A;  4HCP B;  2AEH A;  1WFY A;  3L08 A;  4LDT B;  3UQB A;  3A1Q B;  3DVN U;  3R7Q A;  4MSM B;  1WI0 A;  4E3C A;  3WAO A;  3JW0 X;  4MJS A;  3L54 A;  5CHV C;  3UIP B;  4EZL A;  2IO2 B;  3HM3 A;  3M62 B;  4LCD E;  1NI2 A;  3LJ3 A;  3AU5 A;  1T0Y A;  4G50 A;  4ICV A;  4F1S A;  4FUL A;  3B08 A;  1EF5 A;  1L7Y A;  2KJH B;  2KXJ A;  3R66 C;  2XK5 B;  3KUD B;  3H1U A;  4F8C B; 
#chains in the Genus database with same CATH topology
 1PGA A;  2KVR A;  4HWI B;  1AN8 A;  3H9D A;  2V4L A;  2NPT A;  2K0P A;  1OQR A;  3RZW C;  2VH2 A;  1TJE A;  4C4V A;  2GMI C;  1WSP A;  2KWU B;  3VVW B;  1WYG A;  4N6E B;  1OQQ A;  4NY0 A;  3EHV A;  1WF9 A;  3A9K B;  3JVZ X;  3UF8 A;  1V6E A;  2KLG A;  1HQR D;  1T0R C;  3BVM A;  2D2Q A;  2J7Q B;  2KX3 A;  4KKI A;  4LTU A;  4C80 A;  3AM9 A;  2KD0 A;  4US9 A;  1J0G A;  1YN3 A;  2KDM A;  4BKT A;  1TZ1 A;  3NVZ A;  3AE7 B;  2IDY A;  2SEB D;  2MLB A;  1V1P A;  2M8S A;  5E6J A;  4RH6 A;  2M17 A;  2YVC A;  2J52 A;  1JWB D;  2BVC A;  3QHT A;  1XXG A;  1SEB D;  3FIL A;  1P1A A;  1A70 A;  4W9H A;  3Q3M C;  2Y5C A;  4RMA A;  2N4F A;  3VH3 B;  2KDE B;  4I6P A;  1H8C A;  3AUL A;  2LI5 A;  4O1N A;  1NI3 A;  1CZP A;  1SSN A;  4ANX A;  3HVZ A;  1STE A;  3URY A;  2K3U A;  2IJ0 A;  2JT4 B;  4UDU C;  4W9D A;  3MC8 A;  2WLB A;  1FCC C;  3PT2 B;  4ZHP A;  3DVN V;  2IGD A;  1BUI C;  1C77 A;  5D6J B;  3W2D A;  3N30 A;  2Z0D B;  2RMM A;  2D3A A;  4HEA 1;  1VZ6 A;  3HHM A;  5E6P A;  5MPO A;  2R2O A;  2WXJ A;  2J53 A;  1KOT A;  2BB6 A;  4E74 A;  1C79 A;  1Q5W B;  3A4S C;  4GLS C;  4CQN A;  4M0W A;  1EU3 A;  3W5V B;  1YX6 B;  4C7Y A;  2AL6 A;  1L0V B;  1NYR A;  2L7R A;  4HKZ E;  1FMA D;  2SAK A;  3P4S B;  2LAS A;  4C56 C;  4ZHO A;  2LVP A;  5J2R A;  3BII D;  5D7G A;  1TY0 A;  4BVU C;  2PVG C;  4MT5 A;  1JCK B;  4KSL C;  3T9L A;  1ESF A;  3DDC B;  2JWZ A;  5AZG A;  3I9V 1;  4GDL B;  4URK A;  4CHK A;  2FIF A;  2BW2 A;  2RSU A;  4ITK A;  3MTN B;  3T3O A;  4MM3 A;  5IAA C;  2KFK A;  1LXD A;  3H7P A;  2IZV B;  3MJW A;  3DBR I;  4RF1 A;  2JVC A;  1TY2 A;  3AI5 A;  2W55 A;  4KGS A;  1C4C A;  3JYU A;  3W9C B;  5G5G A;  1RRB A;  3RNF C;  2GRI A;  1WJ4 A;  4KV2 A;  1SF0 A;  1SXT A;  4JL9 A;  4HCN B;  2L1A A;  2MRP A;  2J4X A;  1NEN B;  2JZZ A;  4RNA A;  2V9H A;  3UIN B;  2M0A A;  1OFF A;  4S0R A;  3V61 A;  3RMK C;  1VDV A;  3Q6B A;  1JWA D;  3B0A A;  1HEZ E;  1QOF A;  3W1S C;  3IXS A;  2D11 A;  3AEE B;  3BVG A;  2JZP A;  1MPE A;  4JIO U;  5E6N A;  3ZJT A;  5D3I B;  1X1M A;  2KDB A;  4HPM B;  4GB9 A;  4GOC A;  1ZDX A;  1VLB A;  2K8B A;  4TUU A;  1I7H A;  1V9J A;  3PTF C;  1FO4 A;  4DHZ E;  5C3J B;  4HPP A;  4FHK A;  2KC1 A;  2JPH A;  1UWX A;  2ZNV C;  2MCN B;  4NNJ B;  2AX5 A;  4YXD B;  3P4Q B;  3Q3F A;  4KGT A;  2UYZ B;  4PT5 A;  2I2Y A;  1WJU A;  1IUE A;  5HHD G;  1Q1O A;  4IM0 A;  5CX3 A;  4YWG G;  2QC8 A;  4A90 A;  2KQ4 X;  1GOZ A;  3PZ8 A;  4ZOH C;  2D3C A;  2Q5W D;  3N20 C;  3ZGZ A;  3QAQ A;  1OTR B;  2RDH A;  1UNS A;  2WXN A;  4BKS A;  1Q0W B;  3ML8 A;  3W1S A;  1F0Z A;  2O2V A;  1PGB A;  4WWO A;  1GB4 A;  2MP2 A;  3LXF A;  4HJK A;  1QOA A;  2JRH A;  2QJL A;  1XLQ A;  4XE0 A;  1I4X A;  3LDZ E;  3SFD B;  4HKQ A;  4ANV A;  3NVW A;  3NS1 A;  2VZK D;  3U4E G;  1K50 A;  4IG7 B;  2ACZ B;  3T8M A;  3V6C B;  4W9E A;  2KOX A;  2RR9 A;  1YN5 A;  3A4R A;  1KJT A;  1WGH A;  2JU6 X;  2BTE A;  5J17 A;  4IM3 A;  3RT3 B;  2K6D B;  4KSK C;  2WXQ A;  4C7Z A;  1WGG A;  3K9P B;  3QX1 A;  3PS6 A;  1JQ4 A;  2ZVO A;  3RPF C;  1L5P A;  2BYF A;  1FIQ A;  4RGN A;  3ZUN A;  3C0R B;  2BT6 A;  1N6Z A;  1I35 A;  3ALB A;  1MHH E;  3AH7 A;  1TS2 A;  2WXG A;  2XN9 C;  4WQM A;  3AEB B;  3TUO A;  1K51 A;  3UI3 A;  3KYC D;  2XEW A;  1ET6 A;  4EZJ A;  2IO1 B;  4ARI A;  5TR5 A;  2KHW B;  1XD3 B;  2BWF A;  2KQ7 A;  4AUQ C;  1TKY A;  4ZRI A;  2QSD A;  4K7S A;  4OHJ A;  2MBO A;  3A9J A;  5EE1 A;  4K1R B;  5AEK B;  3AE3 B;  3RFZ B;  2JWU A;  1D5M C;  2JQR B;  4YSZ B;  5C2T B;  2AQ3 B;  1WXA A;  2V4I B;  2KMC A;  4YTP B;  3LB8 C;  1WYW B;  2DEN B;  3IT6 B;  3DBH I;  2WHI A;  1E7U A;  1TBE A;  2WXI A;  4B9K A;  5L95 C;  1C76 A;  3IG3 A;  1Z2M A;  5JH5 C;  1IP9 A;  1WXV A;  3AE4 B;  4DQO C;  1TS5 A;  2L05 A;  2PKO A;  1TKE A;  2W3R A;  2CU1 A;  3B2F A;  1E5W A;  3PRE A;  4MEL A;  2LRU A;  5LXH A;  1E10 A;  3Q8E A;  2M19 A;  4NAW A;  2QEJ C;  2GBM A;  5HG2 A;  4WJQ A;  3NZ3 A;  2CS4 A;  5E6O A;  1JWS D;  2JXT A;  2G45 B;  2D5G A;  3NY5 A;  1CK1 A;  2ICI A;  4C4V B;  3L08 A;  3A1Q B;  5I4D A;  4MSM B;  5HFY A;  3JW0 X;  4MJS A;  5FK9 C;  2IO2 B;  3HM3 A;  3B2G A;  3B9J A;  3B08 A;  2KJH B;  3EFC A;  3P1M A;  3NRZ A;  1UF0 A;  1T0Q C;  1Y56 A;  1F77 A;  2ZEQ A;  4USA A;  4GSW A;  1N5X A;  3EGR A;  3H7S A;  1SGH A;  3RUL A;  2JY6 A;  3BYT B;  1EM7 A;  1RAX A;  3ABV B;  2RDB C;  3O65 B;  4LNF A;  2N1W A;  4E3C A;  1GNU A;  4AS1 A;  1WE6 A;  2FCS A;  3GOE A;  1MVK A;  1TS3 A;  2IND C;  2KFJ A;  3SD5 A;  4F7Z A;  3PRM B;  3ZQ4 A;  2NVU I;  2DZJ A;  2GBR A;  5FKA C;  1OEY J;  3VR8 B;  1AWD A;  1FNU A;  3DPD A;  2K8H A;  2MQJ A;  3NZU A;  2N9K A;  3Q8F A;  1C3T A;  3EC8 A;  3W5U B;  3CST A;  3L10 B;  1YMH E;  2K22 A;  4X57 B;  4GU2 A;  4JX1 C;  1E0Z A;  2WQY B;  2K5P A;  3E56 A;  2I1J A;  5GXG B;  3GP7 A;  2AL3 A;  1R7S A;  5AUK A;  2KYW A;  1KTK A;  3TSS A;  3CWI A;  1QQR A;  2MX2 A;  2C9W B;  1FNW A;  1XQQ A;  3FKY A;  2WXR A;  2KAN A;  3KH0 A;  4G0N B;  1SIJ A;  5D2M B;  3TCA A;  2O6V B;  1RFK A;  1V8C A;  2FID A;  4FLH A;  4H2A A;  4LNK A;  4OW0 A;  4QAY A;  4P16 A;  4YTN B;  1WM2 A;  2YEP F;  2KZR A;  3CIR B;  1KM7 A;  2DWQ A;  3R7R A;  4A20 A;  2L52 A;  2KN5 A;  1FRR A;  1I4R A;  4DDI D;  5T8I A;  2MJ3 A;  1ZGU B;  2ZJD A;  3TEX A;  2RPQ A;  1DYQ A;  3RYT A;  2LWP A;  2LJI A;  4LNN A;  2PW9 A;  4G11 A;  4MGZ E;  1SB3 C;  3NZS A;  4AP4 C;  1HZ5 A;  4DXF A;  1WX8 A;  4OVU A;  3PLV A;  5KHQ A;  3KVF B;  5IP4 D;  4WUR A;  1DOY A;  2KFK B;  2M1M A;  3GE3 C;  1GAQ B;  2LHE A;  4N58 A;  1D4B A;  2BPS A;  2ZPY A;  4B95 A;  4BBN F;  3PVL A;  5GMV A;  3AE5 B;  3U52 E;  1E7P B;  2Z59 B;  1N60 A;  1ZE3 D;  2NMQ A;  2C60 A;  2KMA A;  3A33 B;  1D3Z A;  4YSX B;  1U4A A;  3DQV A;  1WGR A;  3A9K A;  3ZJV A;  4XYC A;  5H8Y E;  4WWM A;  1Y8R C;  4TKN A;  1F9J A;  1YOV B;  1BML C;  3N9Y C;  2D3G A;  3P4P B;  2DYM A;  2J0J A;  1QOB A;  3V3X A;  2BKF A;  3PRZ A;  1YJ1 A;  2WDT B;  4WWN A;  3AEA B;  4P1C C;  2KTR A;  1L0Y B;  2J0M A;  4AJY B;  3RNA C;  3KQ4 A;  2NTS A;  3MJ5 A;  1YD8 U;  1NYQ A;  2X8X X;  4OZB A;  4RFB A;  5D94 A;  4BZA A;  2GBJ A;  3ZVV A;  1V5T A;  2FUH B;  2INP E;  2GI9 A;  3V62 A;  1R4N B;  4K3C A;  3Q3N C;  3QA8 A;  2K25 A;  3N1Y C;  2IGH A;  4MGK E;  1B9R A;  2EKI A;  4P7I A;  1F2R C;  3ZNZ B;  3UIO B;  3ZDT A;  4WH4 A;  4IWQ A;  1YJI A;  3VTU A;  2OJW A;  4L23 A;  4OVV A;  2E6X A;  2V3P A;  1ZUD 2;  3AV8 A;  5CHW A;  3L13 A;  1L4D B;  4G3X B;  1L4Z B;  3I3T B;  3QC8 B;  4ICU A;  1JRO A;  3AE1 B;  1WGK A;  4LNO A;  1MHX A;  4AJW A;  3WAL A;  2TSS A;  3RCZ A;  4CYE A;  1ET9 A;  4PS7 A;  4FBJ B;  4NQL B;  2LVO A;  4K81 A;  3ZXR A;  3PRP B;  4A9A A;  4HRO A;  2CHZ A;  2N9P C;  2LXC A;  5BYR A;  2INN E;  5EE0 A;  3ZLZ A;  2FAZ A;  3DCG A;  3VUY A;  1V5O A;  2ONQ A;  5D3D A;  3BYY B;  3ZNG C;  2WXP A;  2W9N A;  1B1Z A;  4PS3 A;  1IPG A;  2KJ6 A;  2BS3 B;  1WRD B;  4ZRK A;  2V0G A;  2HTM E;  5HI1 A;  2M56 B;  2EKE C;  2WU2 B;  2G4D B;  4C00 A;  1YN4 A;  3OWE B;  3VH4 B;  3DHH C;  4DHJ D;  2NR2 A;  1YX5 B;  1SBB B;  3RZF A;  2D07 B;  1OEY A;  1L6U A;  3FAH A;  1GG3 A;  2LMC A;  1ROE A;  1CMX B;  1KLU D;  1I42 A;  4RCO A;  2Y5P A;  1P0R A;  3QQ8 B;  2DYO A;  2YLM A;  4HDQ A;  1FNV A;  2PMV A;  3V6E B;  2DYB A;  3ML9 A;  2KVZ A;  3IFW B;  4RF0 A;  1WR1 A;  2JYE A;  2DZI A;  2WXO A;  2NTT A;  1CQV A;  2FCQ A;  4D2K A;  1WH3 A;  4IM2 A;  4JGH B;  2IGG A;  3VUX A;  2WXM A;  2N7E A;  4KDL B;  2ZW1 A;  4GIV A;  2G1E A;  1UEL A;  4J3O D;  2L0F A;  3EFU A;  2HTH A;  2N9L A;  3ZYY X;  4ZYN A;  2LJ5 A;  1VRA B;  3SEB A;  4M01 A;  1DGJ A;  1LFD A;  2RGF A;  3AEF B;  4ARC A;  2BB5 A;  2JZ3 B;  1UGM A;  3TL5 A;  1WJ6 A;  2PPH A;  2M0X A;  1GB1 A;  2BYV E;  1PFD A;  2BQQ A;  4OVZ A;  3RN9 C;  2HD5 B;  2MWS B;  4LNI A;  2WDQ B;  1VD2 A;  3HK0 A;  2HJ8 A;  1MFW A;  3W1Y A;  5IN7 A;  5H92 C;  1ZW7 A;  4IWO A;  3AEG B;  2ZNV B;  4LLG M;  4ANW A;  1HZ6 A;  4A3O A;  5JHA A;  2IO0 B;  3L16 A;  4XGA B;  1YNT E;  2WXH A;  2CHW A;  2NPT B;  2RD0 A;  2N1V A;  1WZ3 A;  3CF6 E;  4MGY E;  3ZNI D;  1L6V A;  1T0S C;  4FA6 A;  3UQB A;  3TEZ A;  3DVN U;  1WI0 A;  3WAO A;  4EZL A;  1LGR A;  3LJ3 A;  3I57 A;  1T0Y A;  4ICV A;  4FUL A;  2LGS A;  1PDX A;  1FFV A;  4A6Q A;  2KXJ A;  2XK5 B;  3KUD B;  4F8C B;  4FN2 A;  2VH1 A;  1XO3 A;  4L2Y A;  1HA5 A;  3BK1 A;  3P42 A;  1NVI D;  1WXQ A;  3KYD D;  1F52 A;  1EU4 A;  5HKH A;  1UWM A;  1C4P A;  3HUI A;  3VTV A;  2Z0E B;  2MBE A;  4WIP A;  3HRD D;  3UGB B;  1WE7 A;  4B0E A;  5JZE B;  3DBL I;  1MI0 A;  1K8R B;  2MW5 A;  2DNF A;  1TT5 B;  1FFU A;  4ASW C;  4BOS C;  2LEK A;  2LRW A;  1TZO A;  1V2Y A;  4ZRP A;  3U30 A;  2OJR A;  3I5J C;  1ZOY B;  3FC4 A;  2KNB A;  3U7D A;  1N5W A;  3VRB B;  3MHZ A;  3ZTD A;  2PE9 A;  2BS4 B;  3PZ7 A;  2MH7 A;  2A5U A;  4IOI E;  3SFE B;  1H4R A;  1L0X B;  2IPK D;  2PJH A;  4HXD A;  2LZ6 A;  1SE2 A;  1J7C A;  1FXA A;  2L00 B;  3L4P A;  2W82 A;  2IY1 B;  1UD7 A;  4GN1 A;  1IBX B;  3QWZ B;  1EWC A;  5DCN A;  2DAF A;  2LHD A;  3RNB C;  4ANU A;  3C19 A;  3AN1 A;  4AWJ A;  4GDK A;  1KF6 B;  3TEW A;  2REX A;  1UGJ A;  1A5R A;  3IHP C;  3JSV B;  2WDV B;  3ECI A;  3L0W B;  4M0W B;  3T3N A;  4FXC A;  2CJN A;  4A3P A;  3DVG Y;  3KW5 B;  1WGY A;  2L0T A;  2QIL A;  3OG5 A;  4ZYS A;  4NJC A;  5LXI B;  1QKZ A;  3U2S C;  5AUI A;  2DZM A;  2MBH A;  1EF1 A;  4DBG A;  2WS3 B;  4GXB A;  1GUA B;  2QDF A;  3SR6 A;  1JWM D;  2VRR B;  4WJN A;  2WDR B;  1PQS A;  1P7F A;  4M02 A;  1UZX B;  2JRI B;  3ZDM C;  3U7Z A;  2OOB B;  3AXC A;  1XCT L;  1J7B A;  4ZRQ A;  2MJD A;  4MJS B;  1E6E B;  5IO9 A;  4BBN C;  4FAD A;  3KUZ A;  1SJE D;  3GS2 A;  3OJ3 A;  1WXM A;  4M00 A;  3IAM 1;  5IOI A;  2H88 B;  5L83 A;  1WWT A;  4M8N A;  4AOF A;  2MHJ A;  4MAC A;  2HDE A;  3N1Z C;  1SE9 A;  2OED A;  2EMT A;  2KN4 A;  2KTR B;  1VR9 A;  4KDI C;  3N3K B;  3A9J B;  4WWP A;  1Z5S B;  3WAN A;  2WGS A;  3DVG X;  2QIE B;  3RNE C;  2NBW B;  1XF5 L;  1YJJ A;  2FCN A;  3EA6 A;  2KLC A;  2I38 A;  2UWQ A;  3IT4 B;  3RUI B;  2WXF A;  1I4P A;  2WXK A;  1ZXI A;  1ISN A;  1I4H A;  4TQ0 A;  4IUM B;  2C5L C;  4J6I A;  4R3D A;  1TYG B;  1R4M B;  2J42 A;  4MGI E;  4W9I A;  1WGD A;  1XEE A;  2RPV A;  4MM3 B;  1FM0 D;  1WMH A;  4HRS A;  3PLU A;  4ZDV A;  1WRI A;  4WAF A;  1R4M I;  2DAJ A;  4XDC A;  4B0M A;  4HJG E;  2LGY A;  1FXI A;  3X0W A;  3AED B;  4EKU A;  3ZXV A;  2KT7 A;  5FR6 A;  4EEW A;  5C23 A;  1IGC A;  2LVQ A;  1JRU A;  2CR5 A;  4BKG A;  4JWS C;  2AYO B;  4DWF A;  2NBU A;  5AZH A;  2JF5 A;  3NOB A;  3VXW A;  2QMT A;  4IWP A;  4KKJ A;  1N62 A;  1RFA A;  3J9C A;  4BFR A;  2D10 A;  2Y3A A;  4WQO B;  3SDL C;  1ZDV A;  4E71 A;  5CTR C;  1VZ7 A;  2MP2 B;  3DHI C;  5FR3 A;  1YQB A;  2DLB A;  3GZN B;  1KLG D;  1N61 A;  1CJE A;  3ZJU A;  5BYS A;  1NBF C;  3DHG C;  2PVO D;  1T5X D;  3KWL A;  1E9M A;  2BGF A;  4HPL B;  4FHJ A;  1DOX A;  3MHS D;  3MC0 B;  2A4Z A;  2WP9 B;  5BMG A;  2HJ1 A;  1E7V A;  2XBB C;  3P2B A;  4KZC A;  2FBW B;  3AE8 B;  2ZCC A;  2PE6 B;  4EE2 A;  1QLB B;  4EZK A;  1TS4 A;  3AU4 A;  4EUT A;  1WR6 E;  3PO0 A;  4NQK E;  3N1X C;  1WX7 A;  1LQB A;  3PPA A;  4NJ7 A;  3IBE A;  3GE8 C;  3SU8 X;  4II2 B;  1J8C A;  3RD2 A;  2B3A A;  3TIX A;  1FRD A;  1VZ8 A;  2V3N A;  2DZK A;  3V60 A;  4IW0 A;  1E8Y A;  2GB1 A;  2L83 A;  2PTL A;  4XWT A;  3M3J A;  2O6V A;  3ONS A;  4MSQ B;  2IBI B;  1PYW D;  2M4N A;  3B1L X;  2J0K A;  3RNG C;  3U8Z A;  1HXY D;  1J7A A;  1WX9 A;  1RYJ A;  3RNC C;  1D5X C;  2GOW A;  5G2N A;  1UBI A;  3NUH B;  1WM3 A;  3Q8A A;  4JLC A;  2MA9 B;  2EMS A;  2MBQ A;  4NZL B;  1XT9 B;  2JXX A;  4KIK B;  3WIM A;  4TV3 A;  3NVV A;  3ZRF A;  4IC7 B;  1V1O A;  2AWT A;  4GDL A;  1FEH A;  5DPW A;  5BYQ A;  4TQ1 A;  4W9L A;  1QOG A;  3ZKJ C;  1L2N A;  5KHO A;  4K7U A;  3CMM B;  3VQI A;  1Q10 A;  2JYT A;  2O6V D;  3Q8B A;  2QCZ A;  2LGD A;  2OHF A;  1XLO A;  2HE7 A;  2B76 B;  3IAS 1;  2ZVN A;  3A1Q A;  2BS2 B;  1TGZ B;  1I4Q A;  1F1H A;  3NHE B;  4MDK E;  2K39 A;  3AE2 B;  3DBR B;  2LGI A;  2N9X A;  3ZTC A;  1WZ0 A;  4YL8 A;  1E8W A;  1C9F A;  2K8C A;  4IDI A;  4P1B C;  2K1F A;  3PV1 A;  4GGQ A;  2KAJ A;  2XK5 A;  2MJE A;  3O13 A;  1P9D U;  1JAL A;  2PLP A;  3IVF A;  5G55 A;  4TMA B;  1OQY A;  3ENE A;  4HCP B;  2AEH A;  2JX5 A;  4LDT B;  4BAX A;  2YEP B;  1RM6 C;  3L54 A;  3UIP B;  3NVY A;  1N63 A;  1NI2 A;  4RGM A;  3AU5 A;  1TKG A;  4G50 A;  2H89 B;  3R66 C;  4JE3 B;  4ZRJ A;  4NAW B;  2LFI A;  2X38 A;  3APC A;  4BKS D;  1MG8 A;  3QJZ A;  1SE3 A;  1GC7 A;  4JWU C;  3DBL B;  2E3T A;  2MBB B;  2BBC A;  3WAM A;  1XCQ L;  4I6N B;  1C78 A;  1R4N I;  4CO7 A;  5BO4 B;  2CJO A;  4PS8 A;  3Q69 A;  4MEM A;  1VCB A;  2KC2 A;  1E8Z A;  2KAC A;  3H7P B;  4HK2 A;  2LGX A;  4US8 A;  1G6J A;  2Z8L A;  1F2R I;  3VFK A;  3WA0 A;  4KGR A;  4KVG B;  4AQ7 A;  3NJT A;  1FD6 A;  2CU3 A;  3MC9 A;  4YSY B;  2R61 A;  3EUB 2;  2ZCB A;  3QAR A;  4RM9 A;  1WY8 A;  1GC6 A;  3BIN A;  2KX0 A;  2WWZ A;  1C4A A;  1SIF A;  1J19 A;  4DHJ B;  2MEK A;  3BK2 A;  1M94 A;  3GZN I;  1YIW A;  1K53 A;  2DX5 B;  2L76 A;  3TJP A;  3VAW A;  3PHX B;  1PGX A;  2LD9 A;  1JML A;  2C7N B;  1NDD A;  2CKH B;  4M8M A;  3GB1 A;  5DPT A;  1V1P B;  1EO6 A;  1RWS A;  1XLP A;  3VTW A;  1ACC A;  5IKC M;  4NAM A;  5CHF A;  5LNK 1;  3BWU D;  1JWU D;  2DBY A;  4W9G A;  4WJO A;  2IYD B;  2JUO A;  3TMP B;  1S1Q B;  1QF6 A;  2KO3 A;  3OLM D;  1DOI A;  1V80 A;  3FIL B;  1QZE A;  1UBQ A;  5DPR A;  2V1Y A;  4XX5 A;  1WJN A;  2I1K A;  2GLS A;  2FCM A;  2L3Z A;  4K3B A;  3ZIM A;  5EE9 A;  4LDT D;  4EOY A;  2KMM A;  4N59 A;  1ZP0 B;  2FUG 1;  4XDD A;  3DWM A;  3VRA B;  3ZW3 A;  2KKC A;  1EWY C;  2N7D A;  3APF A;  5JHB A;  3DOW A;  3ZNH B;  4DDG D;  4LK0 M;  2BWE S;  3M63 B;  2ASQ A;  3KUC B;  1FPY A;  2KDI A;  4ACF A;  2WYQ A;  3AE9 B;  3AMZ A;  2JSV X;  4RGO S;  2ZZP B;  3KLS X;  1WXS A;  3H8H A;  3UQA A;  2G3Q B;  3L17 A;  3S2A A;  3ZRC A;  2L32 A;  3DWG C;  2Y5B B;  3VR9 B;  1GPX A;  3WAP A;  2FE8 A;  3VUW A;  1AAR A;  1KRH A;  1KFY B;  2G4S A;  1ZKH A;  1LO5 D;  3DBH B;  4OZC A;  4NJ6 A;  3SHQ A;  1WIA A;  1V81 A;  3R2I A;  2LXA A;  1NEK B;  3D32 A;  4KX6 B;  3QIJ A;  2ZPN A;  4JQW C;  1V49 A;  2XNA C;  1HE8 A;  2GBN A;  5JXV A;  1GJZ A;  4P6V F;  4REZ A;  2D3B A;  3AE6 B;  3AEC B;  3Q2A C;  1YQ3 B;  1LM8 B;  3C8Y A;  3APD A;  4W9K A;  2WXL A;  4GDK B;  1QIL A;  3PGE A;  3TBL D;  1MG4 A;  2CHX A;  5BMI A;  1JRP A;  4RGT A;  1TIF A;  2GBK A;  1MJD A;  1D5Z C;  2N7J A;  1FCL A;  3HIZ A;  3OAW A;  3AB5 A;  1V86 A;  3ZO5 B;  1E8X A;  4S17 A;  4I6L B;  3P4R B;  2KDF B;  3OJ4 B;  5LLI A;  1SE4 A;  4DHZ B;  1M4V A;  1ZXH A;  2VZK B;  4Q2J A;  2BF8 B;  2N0S B;  3PHW B;  2PIA A;  4PK1 A;  3H6N A;  1P98 A;  2KK8 A;  3QK0 A;  3Q3O C;  4W9J A;  2KWC A;  2G9H D;  4B6W A;  3N32 A;  1OGW A;  3EEC A;  2K6Q A;  4XZ4 A;  3PZD A;  3VHT C;  1EUV B;  2NS5 A;  2AQ2 B;  1FXT B;  1P7E A;  3M95 A;  2C7M B;  4EFO A;  1T6B X;  2WNM A;  1K52 A;  3NG0 A;  3Q8C A;  3WCQ A;  3RI7 C;  2BYT A;  4L1B A;  3MP9 A;  1IGD A;  3LYY A;  2FNJ B;  1P3Q U;  3R8B A;  4WAA A;  2QHO A;  3ETR A;  3R2T A;  1XLN A;  5J18 A;  4A55 A;  2KWD A;  4XC2 A;  5EDS A;  5AZF A;  3CSF A;  5BMH A;  3K9O B;  1IBX A;  3KWV A;  2KJR A;  2W3S A;  3Q3J A;  2O2V B;  2N9E B;  1E90 A;  2NCN A;  2NBV B;  4FJZ A;  3JSV A;  3HVD A;  3R3M A;  4KIK A;  4HLE A;  1VJK A;  2AQ1 B;  1I4G A;  4NPN A;  2IO3 B;  4RM8 A;  4PYU A;  2INC C;  1WMH B;  2WX0 A;  3HM6 X;  2R2Q A;  2PEA A;  1AW7 A;  4FJY A;  3E9S A;  3X23 A;  1JW9 D;  4W9F A;  2C7H A;  2EEL A;  1YQ4 B;  4FJV B;  1KLV A;  2DHZ A;  4BOZ B;  1HTO A;  4LJO B;  2KWV B;  3Q14 C;  1ENF A;  1UH6 A;  4DXA B;  3QCA A;  3P63 A;  3VDZ A;  2KTF A;  3PSE B;  1QT9 A;  2KQS A;  1IYF A;  5G5H A;  1S3S G;  1SJH D;  3BY4 B;  5DPS A;  4K7W A;  1ZPS A;  4II3 B;  3BZD B;  1HTQ A;  4LJP B;  3I63 C;  4GMV A;  1TTN A;  4WJP A;  4MH0 E;  1BT0 A;  1KH0 A;  4W9C A;  4DK5 A;  1T3Q A;  4DXG A;  5C1Z A;  4N9F 4;  5EE3 A;  3NS8 A;  2ZW0 A;  4HDO A;  1AYF A;  4JPS A;  2IY0 B;  4OZA A;  3TEY A;  4HVB A;  2WX1 A;  2RDG A;  2K9X A;  1RLF A;  3DBS A;  2LUE A;  4PYZ A;  5IA7 A;  4MH8 A;  2V3S A;  4KZ0 A;  4YTM B;  4XWW A;  2BYE A;  3BVZ A;  2UU7 A;  2MSE D;  3MFG A;  1V97 A;  1C1Y B;  4IKG A;  2WU5 B;  2BKR B;  1PUT A;  1UUP A;  5TSS A;  2ON8 A;  2L8J A;  1D6E C;  4A8X C;  2W54 A;  1WFY A;  1BXT A;  3R7Q A;  4TSS A;  5CHV C;  3V05 A;  3M62 B;  4LCD E;  2LUM A;  4F1S A;  4YT0 B;  1EF5 A;  1L7Y A;  3H1U A; 
#chains in the Genus database with same CATH homology
 4FN2 A;  4NAW B;  2KVR A;  4HWI B;  3APC A;  3H9D A;  4BKS D;  2V4L A;  2NPT A;  1MG8 A;  3QJZ A;  1GC7 A;  3RZW C;  2GMI C;  2KWU B;  2ZEQ A;  4GSW A;  3VVW B;  3KYD D;  2MBB B;  3H7S A;  5HKH A;  3WAM A;  3VTV A;  1SGH A;  2Z0E B;  2MBE A;  4I6N B;  3RUL A;  2JY6 A;  1R4N I;  4CO7 A;  3UGB B;  5BO4 B;  4PS8 A;  1WE7 A;  1RAX A;  4NY0 A;  5JZE B;  3DBL I;  3O65 B;  3EHV A;  1K8R B;  2N1W A;  4MEM A;  2MW5 A;  1WF9 A;  3A9K B;  1VCB A;  2KC2 A;  3JVZ X;  1E8Z A;  1GNU A;  3UF8 A;  1WE6 A;  1V6E A;  4ASW C;  4BOS C;  2FCS A;  3GOE A;  2KLG A;  3H7P B;  4HK2 A;  2LRW A;  1V2Y A;  2LGX A;  2OJR A;  3U30 A;  2D2Q A;  2KFJ A;  2J7Q B;  2KX3 A;  3SD5 A;  4F7Z A;  1G6J A;  3PRM B;  2NVU I;  2DZJ A;  2GBR A;  2KNB A;  2KD0 A;  1OEY J;  3U7D A;  3VFK A;  1J0G A;  4BKT A;  1TZ1 A;  3DPD A;  3WA0 A;  2K8H A;  4KVG B;  3ZTD A;  2PE9 A;  2MQJ A;  2MLB A;  3NZU A;  2A5U A;  2M8S A;  2ZCB A;  1H4R A;  1C3T A;  3EC8 A;  3QAR A;  3CST A;  3L10 B;  2PJH A;  4X57 B;  4RM9 A;  1WY8 A;  4HXD A;  1GC6 A;  3BIN A;  4GU2 A;  2LZ6 A;  2KX0 A;  2WWZ A;  2L00 B;  2M17 A;  2I1J A;  1SIF A;  1J19 A;  4DHJ B;  2YVC A;  2AL3 A;  2IY1 B;  1M94 A;  3GZN I;  1YIW A;  1UD7 A;  3QHT A;  4GN1 A;  2DX5 B;  2L76 A;  3QWZ B;  2MX2 A;  5DCN A;  3TJP A;  3PHX B;  3VAW A;  2DAF A;  2C9W B;  1XQQ A;  4ANU A;  4AWJ A;  2KAN A;  1P1A A;  2LD9 A;  2C7N B;  2CKH B;  1NDD A;  3KH0 A;  4G0N B;  4GDK A;  2N4F A;  4RMA A;  4W9H A;  4M8M A;  5D2M B;  3TCA A;  3VH3 B;  2REX A;  2KDE B;  4I6P A;  1H8C A;  5DPT A;  1A5R A;  3AUL A;  2LI5 A;  3IHP C;  3JSV B;  1EO6 A;  2O6V B;  3VTW A;  3ECI A;  3L0W B;  4M0W B;  4ANX A;  2FID A;  4FLH A;  5CHF A;  4A3P A;  3DVG Y;  3KW5 B;  1WGY A;  2L0T A;  2JT4 B;  4W9G A;  4ZRJ A;  4W9D A;  5LXI B;  4WJO A;  2IYD B;  2JUO A;  3PT2 B;  3DVN V;  1S1Q B;  1WM2 A;  2MBH A;  2DZM A;  2KZR A;  2KO3 A;  3TMP B;  1KM7 A;  3OLM D;  1EF1 A;  3R7R A;  4A20 A;  1V80 A;  5D6J B;  4DBG A;  2KN5 A;  1QZE A;  3N30 A;  1GUA B;  2Z0D B;  4GXB A;  4DDI D;  1UBQ A;  5DPR A;  2V1Y A;  1ZGU B;  2VRR B;  2ZJD A;  4XX5 A;  4WJN A;  2RPQ A;  1WJN A;  3HHM A;  1PQS A;  2I1K A;  5E6P A;  3RYT A;  2R2O A;  1KOT A;  1UZX B;  2LWP A;  2FCM A;  2L3Z A;  2JRI B;  3ZDM C;  3ZIM A;  4E74 A;  1Q5W B;  3A4S C;  4G11 A;  2OOB B;  4MGZ E;  4LDT D;  4EOY A;  3AXC A;  3NZS A;  4MJS B;  4AP4 C;  1YX6 B;  2AL6 A;  4BBN C;  3ZW3 A;  1WX8 A;  4OVU A;  4FAD A;  3PLV A;  2KKC A;  3KUZ A;  5KHQ A;  2N7D A;  3APF A;  5JHB A;  3DOW A;  3OJ3 A;  3KVF B;  3ZNH B;  4DDG D;  2KFK B;  2L7R A;  1WXM A;  2BWE S;  2M1M A;  3M63 B;  2ASQ A;  2KDI A;  3KUC B;  5L83 A;  2WYQ A;  4M8N A;  4AOF A;  2LAS A;  5J2R A;  2LVP A;  2BPS A;  5D7G A;  2ZPY A;  1SE9 A;  2ZZP B;  1WXS A;  4B95 A;  4BVU C;  3UQA A;  2G3Q B;  3L17 A;  3S2A A;  4BBN F;  3PVL A;  4KSL C;  3ZRC A;  3T9L A;  2EMT A;  5GMV A;  2KTR B;  2Y5B B;  2JWZ A;  2Z59 B;  3DDC B;  5AZG A;  4GDL B;  2C60 A;  2KMA A;  4URK A;  3A33 B;  4CHK A;  2FIF A;  4KDI C;  1D3Z A;  1U4A A;  3DQV A;  3N3K B;  2RSU A;  1WGR A;  3A9J B;  4WWP A;  3WAP A;  3MTN B;  4MM3 A;  3VUW A;  1AAR A;  3A9K A;  5IAA C;  2KFK A;  1Y8R C;  1LXD A;  1F9J A;  1Z5S B;  2G4S A;  3H7P A;  2IZV B;  3MJW A;  4TKN A;  3WAN A;  3DBR I;  1ZKH A;  2JVC A;  2D3G A;  2DYM A;  3AI5 A;  2J0J A;  3DVG X;  2NBW B;  2BKF A;  3JYU A;  4NJ6 A;  3SHQ A;  3PRZ A;  1WIA A;  1YJ1 A;  2WDT B;  1RRB A;  1V81 A;  2LXA A;  4WWN A;  3D32 A;  2FCN A;  1WJ4 A;  2KLC A;  2KTR A;  2UWQ A;  4KV2 A;  3QIJ A;  2ZPN A;  4JL9 A;  4HCN B;  2J0M A;  3RUI B;  4JQW C;  4AJY B;  1V49 A;  2MRP A;  1ISN A;  2JZZ A;  4TQ0 A;  4IUM B;  1HE8 A;  2GBN A;  2C5L C;  4J6I A;  3UIN B;  1GJZ A;  4MGI E;  1YD8 U;  4W9I A;  1WGD A;  3V61 A;  1WMH A;  3PLU A;  5D94 A;  4ZDV A;  1LM8 B;  3APD A;  3B0A A;  4W9K A;  1R4M I;  2DAJ A;  4GDK B;  2GBJ A;  3PGE A;  3TBL D;  3ZVV A;  1V5T A;  3W1S C;  2FUH B;  2D11 A;  3V62 A;  2LGY A;  2CHX A;  3X0W A;  3QA8 A;  2K25 A;  4JIO U;  4MGK E;  5E6N A;  4EKU A;  4P7I A;  2GBK A;  3ZNZ B;  3UIO B;  5FR6 A;  3ZDT A;  1X1M A;  2KDB A;  4HPM B;  5C23 A;  4EEW A;  4IWQ A;  4GB9 A;  4GOC A;  3HIZ A;  3OAW A;  3VTU A;  2K8B A;  2LVQ A;  1JRU A;  2CR5 A;  4TUU A;  1V9J A;  3PTF C;  2AYO B;  4BKG A;  4DWF A;  2NBU A;  1V86 A;  4DHZ E;  3ZO5 B;  1E8X A;  4OVV A;  5AZH A;  2JF5 A;  3NOB A;  4I6L B;  5CHW A;  2KDF B;  3L13 A;  4FHK A;  4IWP A;  3VXW A;  2KC1 A;  2JPH A;  3OJ4 B;  4G3X B;  5LLI A;  3I3T B;  3QC8 B;  1RFA A;  2ZNV C;  2MCN B;  4BFR A;  4DHZ B;  4ICU A;  2D10 A;  4NNJ B;  4WQO B;  3SDL C;  2BF8 B;  4AJW A;  3PHW B;  4E71 A;  3WAL A;  5CTR C;  3RCZ A;  2MP2 B;  3H6N A;  1P98 A;  2KK8 A;  3QK0 A;  1YQB A;  3Q3F A;  4W9J A;  2KWC A;  4CYE A;  4PS7 A;  4B6W A;  3N32 A;  1OGW A;  2LVO A;  4K81 A;  4NQL B;  2UYZ B;  4FBJ B;  3EEC A;  1NBF C;  2K6Q A;  3PRP B;  4XZ4 A;  3PZD A;  3VHT C;  1WJU A;  2BGF A;  2CHZ A;  4HPL B;  1EUV B;  2NS5 A;  2N9P C;  1FXT B;  1Q1O A;  4IM0 A;  5CX3 A;  4FHJ A;  2LXC A;  3M95 A;  2C7M B;  3MHS D;  4EFO A;  3ZLZ A;  2A4Z A;  2FAZ A;  3DCG A;  3VUY A;  3QAQ A;  1V5O A;  1OTR B;  3ZNG C;  1E7V A;  2XBB C;  2W9N A;  4BKS A;  1Q0W B;  3ML8 A;  3W1S A;  3P2B A;  4PS3 A;  2FNJ B;  4KZC A;  2O2V A;  4WWO A;  1P3Q U;  2ZCC A;  1IPG A;  4WAA A;  2KJ6 A;  4ZRK A;  2MP2 A;  1WRD B;  2PE6 B;  2QHO A;  4HJK A;  4EZK A;  2JRH A;  3AU4 A;  4EUT A;  5J18 A;  2EKE C;  1WR6 E;  3LDZ E;  4NQK E;  2G4D B;  1WX7 A;  1LQB A;  4ANV A;  3VH4 B;  4XC2 A;  3PPA A;  4NJ7 A;  3IBE A;  4DHJ D;  5EDS A;  4IG7 B;  2NR2 A;  3SU8 X;  4II2 B;  1YX5 B;  3T8M A;  3V6C B;  5AZF A;  4W9E A;  1J8C A;  3CSF A;  3RD2 A;  2B3A A;  3TIX A;  2KOX A;  3K9O B;  3RZF A;  2D07 B;  2RR9 A;  1OEY A;  3A4R A;  1KJT A;  1GG3 A;  2KJR A;  1WGH A;  3Q3J A;  2DZK A;  5J17 A;  2O2V B;  4IM3 A;  1CMX B;  3RT3 B;  2K6D B;  3V60 A;  2N9E B;  4IW0 A;  1E8Y A;  4KSK C;  1E90 A;  2NCN A;  2NBV B;  4FJZ A;  3JSV A;  1I42 A;  3R3M A;  1WGG A;  3K9P B;  3M3J A;  3QX1 A;  4KIK A;  4HLE A;  2O6V A;  3ONS A;  1P0R A;  2IBI B;  2DYO A;  3PS6 A;  2M4N A;  2YLM A;  2ZVO A;  3B1L X;  3QQ8 B;  2J0K A;  2BYF A;  4HDQ A;  4NPN A;  2IO3 B;  3C0R B;  3U8Z A;  3ZUN A;  4RM8 A;  1I35 A;  3ALB A;  1WX9 A;  4PYU A;  1WMH B;  3V6E B;  2DYB A;  2WX0 A;  2GOW A;  2R2Q A;  3HM6 X;  2PEA A;  4FJY A;  3ML9 A;  3IFW B;  1WR1 A;  5G2N A;  3X23 A;  1UBI A;  2DZI A;  1WM3 A;  4W9F A;  2C7H A;  3KYC D;  2XEW A;  4FJV B;  1KLV A;  2FCQ A;  2DHZ A;  4JLC A;  2MA9 B;  4EZJ A;  2IO1 B;  1WH3 A;  4BOZ B;  2EMS A;  4IM2 A;  2MBQ A;  4JGH B;  4LJO B;  5TR5 A;  1XT9 B;  2JXX A;  2KWV B;  3VUX A;  4KIK B;  3WIM A;  4TV3 A;  2N7E A;  2KHW B;  4KDL B;  1UH6 A;  4GIV A;  1XD3 B;  4DXA B;  1UEL A;  3QCA A;  3ZRF A;  2BWF A;  2KQ7 A;  2L0F A;  4AUQ C;  3EFU A;  4IC7 B;  2AWT A;  4GDL A;  2HTH A;  3VDZ A;  2KTF A;  3PSE B;  4K7S A;  4MSQ B;  4ZRI A;  2KQS A;  4ZYN A;  2MBO A;  3A9J A;  1IYF A;  5DPW A;  2LJ5 A;  4K1R B;  5AEK B;  1S3S G;  4TQ1 A;  1LFD A;  3BY4 B;  2RGF A;  4W9L A;  3ZKJ C;  5DPS A;  1L2N A;  4K7W A;  4II3 B;  5KHO A;  1WXA A;  3CMM B;  4K7U A;  2KMC A;  4LJP B;  3VQI A;  4GMV A;  1TTN A;  1WYW B;  4WJP A;  4MH0 E;  2O6V D;  1BT0 A;  4W9C A;  4DK5 A;  2JZ3 B;  2DEN B;  5C1Z A;  1UGM A;  3DBH I;  3TL5 A;  1WJ6 A;  4N9F 4;  1E7U A;  2PPH A;  2M0X A;  1TBE A;  3NS8 A;  2LGD A;  2BYV E;  2HE7 A;  4HDO A;  4B9K A;  5L95 C;  2IY0 B;  3IG3 A;  1Z2M A;  4HVB A;  2HD5 B;  2ZVN A;  2WX1 A;  1TGZ B;  3A1Q A;  5JH5 C;  2MWS B;  1IP9 A;  1WXV A;  1RLF A;  3NHE B;  4MDK E;  2L05 A;  2K39 A;  1VD2 A;  2CU1 A;  3HK0 A;  2HJ8 A;  3DBS A;  2LUE A;  3W1Y A;  1E5W A;  2N9X A;  4PYZ A;  3ZTC A;  1WZ0 A;  5IA7 A;  1ZW7 A;  3PRE A;  4IWO A;  4MEL A;  2LRU A;  4YL8 A;  1E8W A;  5LXH A;  2ZNV B;  2K8C A;  2V3S A;  4KZ0 A;  4ANW A;  2K1F A;  4NAW A;  3PV1 A;  4GGQ A;  4A3O A;  2IO0 B;  5JHA A;  2GBM A;  2BYE A;  3L16 A;  2XK5 A;  4WJQ A;  2CHW A;  1P9D U;  2NPT B;  2MSE D;  2CS4 A;  2N1V A;  2RD0 A;  1WZ3 A;  1C1Y B;  2BKR B;  5E6O A;  3CF6 E;  3IVF A;  4MGY E;  5G55 A;  2G45 B;  3ZNI D;  3NY5 A;  1OQY A;  3ENE A;  2L8J A;  4FA6 A;  4HCP B;  2AEH A;  1WFY A;  3L08 A;  4LDT B;  3UQB A;  3A1Q B;  3DVN U;  3R7Q A;  4MSM B;  1WI0 A;  4E3C A;  3WAO A;  3JW0 X;  4MJS A;  3L54 A;  5CHV C;  3UIP B;  4EZL A;  2IO2 B;  3HM3 A;  3M62 B;  4LCD E;  1NI2 A;  3LJ3 A;  3AU5 A;  1T0Y A;  4G50 A;  4ICV A;  4F1S A;  4FUL A;  3B08 A;  1EF5 A;  1L7Y A;  2KJH B;  2KXJ A;  3R66 C;  2XK5 B;  3KUD B;  3H1U A;  4F8C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...