5JH5C

Structural basis for the hierarchical assembly of the core of prc1.1
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
88
Chain Sequence
HSKAHYYRYDEQLNLCLERLSNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine-specific demethylase 2B
publication title KDM2B Recruitment of the Polycomb Group Complex, PRC1.1, Requires Cooperation between PCGF1 and BCORL1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein/transcription
total genus 22
structure length 88
sequence length 99
ec nomenclature
pdb deposition date 2016-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF16207 RAWUL RAWUL domain RING finger- and WD40-associated ubiquitin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5jh5C00
4FJVB 3PRPB 1S1QB 3UF8A 1R4NI 2CKHB 4DDID 3T9LA 3JYUA 1WM2A 3AULA 2KVRA 1WGRA 4A20A 1IP9A 1GC7A 4WJNA 1E90A 1P98A 1E7UA 2DENB 3PTFC 4WJQA 1QZEA 3PLUA 4CYEA 1V49A 2KQ7A 4DK5A 1KOTA 1H8CA 2JRHA 4IWPA 4W9GA 2C60A 2HE7A 1WGHA 2CHWA 1WXVA 1YD8U 3V62A 3JW0X 3PRMB 4G3XB 2D3GA 5CTRC 2JUOA 3L0WB 4MGZE 3ZRFA 2KOXA 1GNUA 3QK0A 4MDKE 4MJSA 3A4RA 5E6PA 2L00B 2ZPNA 3DPDA 3W1SC 2MBOA 1LQBA 2KX0A 1WGGA 4KZ0A 4MM3A 4AJYB 1V2YA 4FN2A 2AEHA 3ZUNA 4BOSC 4DHZE 5L95C 1V80A 1WJUA 1UBQA 2LVPA 2MQJA 4HVBA 1SIFA 1WJ4A 5DPSA 3DVGX 2LD9A 2K8CA 4GDKA 4FLHA 3R7RA 4DHJD 4LJOB 5LLIA 1GG3A 3TL5A 4ANUA 3ZTCA 3V61A 2KNBA 2KMAA 4FHJA 2XBBC 3VTWA 4W9CA 4AOFA 4TQ0A 3RYTA 4AP4C 3A1QA 2WWZA 4IM3A 3TMPB 3WAOA 4II3B 3CMMB 4M8NA 3QARA 3L08A 1E8XA 3NOBA 5AZFA 4BFRA 2D2QA 2VRRB 4IWQA 2Y5BB 3RD2A 3APFA 2KANA 4EKUA 1Z2MA 2KZRA 4G11A 4HLEA 3ML8A 3VH4B 5IAAC 2JRIB 3ECIA 1WJNA 3DDCB 1Q1OA 2DAJA 4EZKA 5DPRA 4J6IA 4ICUA 3HIZA 4P7IA 2K39A 4A3PA 2Z0EB 2W9NA 3A9KB 3VDZA 2R2QA 1NDDA 3CSTA 1OEYA 3A4SC 3K9PB 5C1ZA 4W9HA 2L7RA 3WALA 1TTNA 4K7UA 3UIOB 3PS6A 3RT3B 2BYFA 2KTRB 3HHMA 2L8JA 3LDZE 5AEKB 4EUTA 2NR2A 2LXAA 4AJWA 1SE9A 3UQAA 4B6WA 2L0FA 3CSFA 4BOZB 4GDLB 2I1KA 1UD7A 3HM3A 5G2NA 2L76A 2Z59B 3ZRCA 1YIWA 2C9WB 1J19A 4LDTB 1WM3A 2FNJB 2GBRA 2KN5A 1K8RB 3EECA 2K6QA 2MX2A 3IBEA 4NJ7A 2MBHA 2AL6A 3W1YA 3A9KA 3QX1A 3APCA 2N9EB 2KFKB 5CX3A 2ZVNA 4W9FA 4DWFA 4IUMB 4NAWB 5C23A 4IC7B 2IO0B 1S3SG 2WX0A 2KTRA 2ZNVB 1WY8A 4OVVA 2BYVE 4FBJB 4GB9A 2N9PC 2XK5B 2ZEQA 4HCNB 2ZVOA 2JT4B 2AWTA 3QCAA 2MRPA 3L13A 4W9IA 4WWNA 4HJKA 4ZDVA 4HPMB 3P2BA 3VUWA 3R66C 2J0JA 4I6NB 4A3OA 3Q3FA 3B1LX 3MJWA 4MGKE 1WH3A 4DHJB 2KKCA 2DZMA 3PHWB 4B9KA 3VAWA 5EDSA 2PJHA 4GGQA 4HWIB 2KD0A 1G6JA 5E6NA 3VQIA 1ZGUB 3V6CB 1EF5A 3A33B 4HK2A 2C7HA 5D2MB 2D07B 3NZUA 2DYBA 1H4RA 5FR6A 2KWCA 1RRBA 2KC1A 5HKHA 1P1AA 4W9DA 3B08A 2IO2B 2JZ3B 3IG3A 2ZCCA 3JSVB 2HTHA 4PS8A 1WXSA 3QAQA 2L05A 1L7YA 4KZCA 4KVGB 4OVUA 4CHKA 3NS8A 2R2OA 1V5TA 1ZKHA 5BO4B 2IO1B 5LXIB 2IY1B 3OLMD 3LJ3A 2LJ5A 2KQSA 4XZ4A 1E8ZA 2CR5A 3VUXA 2J0KA 2IO3B 1UZXB 1P9DU 3PVLA 5CHVC 1C3TA 4I6PA 5AZHA 2YVCA 3KUZA 5GMVA 2ZZPB 3L16A 4K81A 4N9F4 1WJ6A 2ZNVC 4WJOA 1WZ0A 2IZVB 1WX9A 2NVUI 4DXAB 2N7DA 2KDEB 1R4MI 4TV3A 3MHSD 1KJTA 2KTFA 2V3SA 1A5RA 2L0TA 5L83A 5J18A 1UELA 2MBEA 3RZWC 2GBJA 5DPWA 3QC8B 1TZ1A 3EC8A 2O6VD 4PYZA 1WX7A 3B0AA 3PLVA 4JGHB 1JRUA 1WGYA 1XQQA 2PPHA 5G55A 2KC2A 3QHTA 4HXDA 3UGBB 4E3CA 1AARA 3ZDMC 3R3MA 2BYEA 3UQBA 3ZTDA 2O2VB 3NHEB 1J0GA 3CF6E 4KSLC 5E6OA 3ZNGC 3DVNU 4MGIE 2UWQA 5D6JB 3RUIB 4DBGA 2GBKA 3VTVA 2FIDA 3TJPA 2KX3A 2RR9A 4KIKB 2WYQA 3EHVA 4X57B 2M4NA 1Q0WB 2AL3A 2DZKA 2A4ZA 3H7PB 2KFJA 1LM8B 2PEAA 4GSWA 1WE7A 4F1SA 4ANVA 1EO6A 3AXCA 4GIVA 4LJPB 2N9XA 2KO3A 1P3QU 3M95A 3RCZA 3WAMA 2MP2B 4MEMA 4FHKA 4WWOA 3N32A 4RM9A 2MSED 3DOWA 3GOEA 4LCDE 2GMIC 4TUUA 1KLVA 2WX1A 2MBBB 3ZNHB 1RLFA 2BPSA 2Z0DB 3HM6X 4F7ZA 2K8BA 4KV2A 3PPAA 2NBVB 3DBHI 5KHOA 4IM0A 2HD5B 1RAXA 3C0RB 3L10B 1GUAB 1XT9B 4BVUC 3H7PA 2MCNB 3T8MA 1WGDA 5IA7A 3H1UA 4BKGA 2G4SA 3GZNI 1TBEA 4TQ1A 3Q3JA 1UH6A 4ZRJA 2WDTB 2V1YA 3NY5A 4GOCA 3OAWA 2MP2A 2ZCBA 1TGZB 4E74A 3VUYA 3PREA 3RZFA 1IPGA 4RMAA 2DAFA 4BKSA 1F9JA 1I35A 2LZ6A 4MELA 2KWUB 4FULA 2M0XA 2LVOA 1WE6A 2C5LC 4FJYA 4KDIC 5J2RA 3TIXA 1RFAA 1Q5WB 2KLCA 2CS4A 2EKEC 2G4DB 4AUQC 1NBFC 3X0WA 2IY0B 4KDLB 4FA6A 5J17A 2MW5A 2ZPYA 2DZJA 4IWOA 2GBNA 4GDLA 4AWJA 3TCAA 3SD5A 1EF1A 2MBQA 1VCBA 1WX8A 2FAZA 2G45B 2ZJDA 3KUCB 1FXTB 3QJZA 2L3ZA 1J8CA 4GMVA 1WXAA 3U30A 4MH0E 2DYOA 4JL9A 2KFKA 3QIJA 3KW5B 2DYMA 1GC6A 4WWPA 1E7VA 4NQKE 3M62B 4NAWA 4ANWA 2KJ6A 1BT0A 4ICVA 4W9KA 2IYDB 3ALBA 2CHZA 2LASA 2UYZB 2KWVB 1YX5B 2XK5A 2NBWB 1WIAA 2FCNA 2GOWA 4W9JA 1V6EA 4URKA 1YJ1A 2KDFB 2LGDA 2NCNA 1E5WA 3H7SA 2G3QB 3U7DA 3ZVVA 2LGYA 2B3AA 4GN1A 5DCNA 2RD0A 2ASQA 4GU2A 3D32A 4HDOA 3DVNV 3RULA 4RM8A 4EOYA 1IYFA 2JPHA 1D3ZA 1ZW7A 4MSMB 2QHOA 4EZLA 4ZYNA 1MG8A 4NNJB 3AU4A 1EUVB 1WMHB 2I1JA 2REXA 3QQ8B 5D94A 1M94A 2NS5A 3ML9A 3ZLZA 1V9JA 5TR5A 3VTUA 1V5OA 2FCQA 3AI5A 4IM2A 3HK0A 5AZGA 2JY6A 2KJHB 3JSVA 4WJPA 4GDKB 1WR1A 2KK8A 3A9JB 4K7WA 4LDTD 3H9DA 3ONSA 1L2NA 3QA8A 3ZO5B 1OEYJ 5CHWA 3IFWB 2K1FA 3WA0A 4G0NB 2FCMA 3SHQA 3U8ZA 2LI5A 3A1QB 3OJ3A 3DBSA 4ANXA 1WYWB 2FCSA 1WMHA 4MGYE 3AU5A 2KDIA 2JWZA 2KJRA 3BINA 3OJ4B 3EFUA 3V60A 1C1YB 1NI2A 4DDGD 2DHZA 3KUDB 4ZRKA 3L17A 2EMSA 2KLGA 3PV1A 4B95A 3L54A 5D7GA 4I6LB 3MTNB 1VD2A 4NY0A 3ZIMA 3DCGA 2K25A 3NZSA 5JZEB 3N30A 2BKFA 4HDQA 4M8MA 3A9JA 2FUHB 2N1VA 3R7QA 4MSQB 1UBIA 4PS7A 2BKRB 3ZNZB 1OGWA 1ISNA 2O2VA 1T0YA 3DQVA 4HCPB 3WAPA 3IVFA 2BF8B 2RSUA 1KM7A 1SGHA 3VVWB 5CHFA 3I3TB 4YL8A 2KHWB 3H6NA 3PZDA 3VFKA 2BWFA 3BY4B 3KVFB 3M63B 2JVCA 4KIKA 3WIMA 3ZW3A 1Z5SB 4JIOU 2C7NB 4W9EA 3UIPB 1LXDA 3VXWA 4E71A 3IHPC 2AYOB 4NJ6A 2C7MB 3DBLI 2IBIB 3M3JA 1P0RA 4FJZA 4G50A 3PT2B 2YLMA 4NQLB 1LFDA 3ZKJC 1YX6B 3KYCD 2JZZA 3VH3B 4IG7B 4TKNA 2JF5A 3KH0A 2KMCA 2LGXA 2KXJA 2XEWA 3ZDTA 5JH5C 3PSEB 1WR6E 2M1MA 4KSKC 2RGFA 3PHXB 3DVGY 2DZIA 5JHBA 1I42A 1WXMA 4BBNC 2DX5B 2LUEA 2KDBA 2PE6B 4XX5A 1Y8RC 2N7EA 2LRUA 2NPTB 4F8CB 2O6VB 4ZRIA 3PGEA 1PQSA 2JXXA 4DHZB 1GJZA 2MWSB 2BGFA 2GBMA 1WI0A 4JQWC 4II2B 4K1RB 1X1MA 2LXCA 3O65B 4BKTA 4BBNF 2K8HA 3SU8X 1XD3B 3JVZX 2J7QB 3DBRI 2OOBB 1WRDB 5DPTA 4CO7A 3N3KB 4IW0A 2D11A 1WF9A 2M8SA 4WAAA 4EEWA 2EMTA 4W9LA 2PE9A 3APDA 4PYUA 1OQYA 5JHAA 2RPQA 4K7SA 5LXHA 1UGMA 1HE8A 3UINB 2NPTA 1CMXB 3KYDD 2O6VA 4WQOB 3VHTC 2LVQA 3K9OB 2LWPA 2OJRA 4JLCA 3PRZA 4PS3A 2NBUA 2HJ8A 3S2AA 4FADA 3QWZB 1E8WA 1OTRB 1E8YA 2CU1A 2MLBA 1WZ3A 4ASWC 4BKSD 1WFYA 4M0WB 1V81A 4HPLB 1U4AA 3SDLC 2K6DB 2M17A 3ENEA 4NPNA 3V6EB 1V86A 4XC2A 1YQBA 2MA9B 2CHXA 2FIFA 2D10A 2A5UA 3TBLD 2N1WA 4MJSB 5KHQA 2J0MA 2LRWA 4EZJA 3WANA 2BWES 2N4FA 4EFOA 3W1SA 3ZNID 3X23A 4GXBA 2V4LA
chains in the Genus database with same CATH superfamily
3RNGC 3PRPB 1S1QB 4XE0A 3HUIA 3UF8A 2Z8LA 1E6EB 4OZBA 3AULA 2KVRA 1WGRA 4A20A 4RGNA 1P98A 1E7UA 4A6QA 4CYEA 1TY2A 1V49A 2KQ7A 2JRHA 4IWPA 4W9GA 2JQRB 1ROEA 4KX6B 2XN9C 3PRMB 1VZ8A 4RGTA 4P1BC 2RDGA 2JUOA 2Q5WD 1GNUA 3T3OA 4MJSA 2BS3B 1KH0A 2ZPNA 3AE5B 5H8YE 2KX0A 4LLGM 2WDQB 1UGJA 4FN2A 2AEHA 4BOSC 3MC8A 1WJUA 1WJ4A 3KLSX 4GDKA 3TL5A 2N7JA 3ZTCA 2QILA 1FNWA 1PGAA 3N1YC 3NS1A 5TSSA 4TQ0A 1C4CA 1XCQL 3A1QA 2WWZA 3TMPB 4II3B 2JYTA 3ZYYX 1E8XA 4BFRA 4RF0A 2WXPA 2Y5BB 3DHIC 3HVZA 2KANA 3TSSA 2JRIB 4JPSA 1YJIA 2Z0EB 1NDDA 1N6ZA 3UIOB 2J42A 2CJOA 2LXAA 1VZ7A 3CIRB 2I1KA 3TEXA 1YIWA 1J19A 1WM3A 2KN5A 3GP7A 3VRAB 3EFCA 1WXQA 2ZVNA 4IUMB 2KTRA 2WXLA 1BMLC 4OVVA 2BYVE 4FBJB 4GB9A 2KQ4X 4TMAB 2JT4B 4WWNA 3GS2A 3VUWA 3R66C 4I6NB 3Q3FA 3AECB 4DHJB 4B9KA 2WXRA 3MC9A 5EDSA 4HWIB 2KD0A 1G6JA 5E6NA 3FILB 3VQIA 1NVID 1EF5A 1GB1A 3A33B 4HK2A 2C7HA 2GB1A 5FR6A 5EE3A 2AQ1B 1R4MB 3B08A 2JZ3B 2HTHA 2W55A 4PS8A 4KZCA 3DHGC 4OVUA 4CHKA 3NS8A 1V5TA 2PMVA 3DWMA 5BO4B 3AB5A 4XZ4A 4A55A 2CR5A 1P9DU 1C3TA 4P6VF 1SJED 2ON8A 4BAXA 2ZZPB 1D5XC 1WJ6A 2ZNVC 1RFKA 1WZ0A 1WX9A 2NVUI 4QAYA 1KJTA 2KTFA 3SR6A 5FR3A 4WH4A 2W3SA 4C4VA 2MBEA 5DPWA 1TZ1A 1WX7A 2RPVA 1XQQA 3NVZA 1ZDXA 2O2VB 1C76A 2JSVX 2VH2A 3CF6E 3RUIB 3Q8BA 2WQYB 1SXTA 2L1AA 3N20C 2WYQA 3EHVA 4X57B 5C2TB 2WDRB 2WXGA 4GSWA 4F1SA 3U7ZA 1EO6A 1I7HA 2N9XA 2KO3A 3WAMA 1B9RA 1I4XA 2HTME 1KRHA 2ONQA 4LCDE 5BMHA 4US8A 3ZNHB 4DQOC 2YEPB 4KV2A 3PPAA 3DBHI 2HD5B 1RAXA 1N63A 4BVUC 3NJTA 3H7PA 1TZOA 3EUB2 2G4SA 3C19A 4TQ1A 3Q3JA 2WDTB 4M01A 5BYQA 3NY5A 3WCQA 2MP2A 4E74A 2DAFA 1I4RA 2LZ6A 2NMQA 3TUOA 3AEBB 1WE6A 4YXDB 5J2RA 4D2KA 2CS4A 2EKEC 5HHDG 3X0WA 2IY0B 2ZPYA 2DZJA 4GDLA 2WXNA 2LJIA 1EF1A 1JWSD 1N61A 2ZJDA 1FXTB 3QJZA 3T3NA 1FCLA 1ZUD2 4FXCA 4MH0E 3PO0A 3QIJA 2DYMA 4WWPA 1E7VA 1ZDVA 2KJ6A 1BT0A 2CHZA 1ET6A 3W5UB 2UYZB 1FRRA 4US9A 1V6EA 4J3OD 1YJ1A 2W3RA 1PGBA 3H7SA 2G3QB 2LGYA 4GN1A 5DCNA 3TEZA 3D32A 4HDOA 3DVNV 2JPHA 1F2RC 4EZLA 1FEHA 5D94A 2NS5A 3ZLZA 3SFEB 1TT5B 3HK0A 5AZGA 2KJHB 4GDKB 4A8XC 4K7WA 4LDTD 3ONSA 1JQ4A 1L2NA 1ZXHA 1SBBB 3LXFA 3QA8A 3ZO5B 1VRAB 5CHWA 4RH6A 1PFDA 3A1QB 1WYWB 1C4PA 3DWGC 3EFUA 2K3UA 3LYYA 4ZRKA 2EMSA 2KVZA 3DBHB 4I6LB 3ZIMA 3RPFC 3NZSA 3N30A 2KWDA 2RMMA 1T0YA 1N5WA 2R61A 3WAPA 4EE2A 2GLSA 1V1PA 1KM7A 4WAFA 3AEEB 3C8YA 4YL8A 1MG4A 3PZDA 5BYSA 3VFKA 3WIMA 3V05A 2AYOB 3P1MA 2IBIB 4GLSC 4G50A 4NQLB 3ZKJC 3P4PB 2JZZA 3ABVB 3VH3B 1IGDA 3KH0A 3NVYA 4RF1A 3OWEB 3MHZA 2WNMA 2XEWA 3ZDTA 1WR6E 4BBNC 2MJDA 4XX5A 4ZRPA 1Y8RC 2O6VB 5G5GA 1HQRD 4DHZB 2MWSB 5C3JB 2OEDA 3DBRI 5DPTA 3URYA 3R8BA 2D11A 3VR9B 4K7SA 5T8IA 2BS2B 1UGMA 3KYDD 4WQOB 1Y56A 4JLCA 4PS3A 2NBUA 1XEEA 2CU1A 2MLBA 3AN1A 4XYCA 4WWMA 3PZ7A 1WFYA 1YMHE 1V81A 1U4AA 3SDLC 3AE7B 5JXVA 3ENEA 1IBXB 4XC2A 2D10A 1ESFA 2PKOA 2LRWA 3ZJVA 2QIEB 4EFOA 3W1SA 3X23A 2V4LA 4FJVB 3AH7A 1R4NI 2CKHB 3JYUA 3N1ZC 1IP9A 1E90A 1QZEA 3PLUA 4DXFA 1H8CA 2WHIA 1D5ZC 3I57A 3MJ5A 1LQBA 2BQQA 1MVKA 1L6VA 4MM3A 4DHZE 4HVBA 2LVPA 1UBQA 2MQJA 5DPSA 3P63A 1ENFA 2WXFA 1VZ6A 5LLIA 1GG3A 3AE8B 3V61A 4FHJA 3AV8A 1TS3A 3RYTA 2H89B 3NG0A 3NOBA 5AZFA 1HA5A 2D2QA 2NTSA 3APFA 3Q14C 3W9CB 3NZ3A 2HDEA 3ML8A 5IAAC 3ECIA 3DDCB 4ZHOA 4EZKA 3MP9A 3Q69A 4ICUA 4P7IA 2W9NA 3A9KB 3TEYA 2L7RA 1TTNA 3AE2B 4K7UA 3PS6A 2BYFA 1L5PA 3LDZE 5AEKB 2G9HD 3KWVA 1SE9A 4OHJA 2BW2A 4LNIA 4OZCA 4GDLB 1UD7A 1NI3A 5G2NA 2L76A 2Z59B 3ZRCA 2FNJB 3I9V1 1L4DB 1K8RB 3IBEA 4NJ7A 2AL6A 3QX1A 5IP4D 3APCA 3N9YC 1YN4A 2INNE 2IO0B 2WX0A 2ZNVB 1FM0D 4HCNB 4C7ZA 2MRPA 4ZDVA 3Q8AA 4HPMB 1TS5A 4A3OA 3MJWA 3BYTB 2DZMA 3W5VB 1QF6A 1F2RI 4GGQA 1T0QC 2DYBA 2KWCA 2J53A 1JWAD 2KC1A 4W9DA 2IO2B 1SE4A 2PIAA 3PZ8A 2ZCCA 1E9MA 4KVGB 2BB5A 1HTOA 2IO3B 4RFBA 2GRIA 2ACZB 1QKZA 4I6PA 5AZHA 1E0ZA 2TSSA 3KUZA 4OZAA 3L16A 1R4MI 4TV3A 4K3CA 3MHSD 5J18A 3B0AA 3PLVA 5HG2A 2CU3A 4JGHB 4WIPA 1AN8A 1CZPA 3QHTA 3NVVA 1AARA 3ZDMC 3R3MA 3NHEB 3RMKC 2KAJA 1T6BX 5D6JB 2GBKA 1ZP0B 1TKGA 5HFYA 2AL3A 2A4ZA 2PEAA 1N62A 4AQ7A 4HJGE 4GIVA 5IOIA 1P3QU 3M95A 2L52A 2WXOA 2M0AA 2GMIC 4TUUA 2MBBB 1RLFA 3HM6X 2QJLA 4F7ZA 2V3PA 4IM0A 3C0RB 1GUAB 1FFUA 3NVWA 1WGDA 3H1UA 4YTPB 4RCOA 1TBEA 1UH6A 4M00A 2V1YA 4GOCA 3OAWA 1YN5A 3VUYA 2QEJC 1PGXA 2KWUB 4FULA 2M0XA 3RI7C 3ZXVA 2C5LC 4IKGA 4WQMA 3NRZA 2G4DB 1IUEA 2GBNA 4AWJA 1JMLA 2MBQA 5G5HA 3KUCB 2L3ZA 1J8CA 1WXAA 2DYOA 2KFKA 1F0ZA 5IN7A 3ALBA 4MH8A 2KWVB 2XK5A 5GXGB 2NBWB 4URKA 2BB6A 2OJWA 2YEPF 3IAM1 2KDFB 2LGDA 2NCNA 3U7DA 2RD0A 4GU2A 2MJEA 1PDXA 4ARCA 1FPYA 4EOYA 1IYFA 4C00A 1L6UA 1M94A 2VZKB 1V5OA 4MM3B 2DBYA 3AI5A 2LFIA 3JSVA 1C78A 4WJPA 1I4PA 1ACCA 1JALA 1NEKB 1OEYJ 3WA0A 3SHQA 1UNSA 4ANXA 3DBSA 1WMHA 2D3BA 1C1YB 1NI2A 3P4QB 2DHZA 3KUDB 5D7GA 3MTNB 3Q8CA 1VD2A 1FXIA 3GE8C 3A9JA 2FUHB 3R7QA 3ZNZB 1OGWA 1ISNA 3DQVA 2EELA 1SGHA 2JWUA 4YSYB 2JYEA 3H6NA 3CWIA 2BWFA 3M63B 3ZW3A 1LGRA 2JVCA 4JWUC 4KIKA 2C7NB 2WU2B 4E71A 3IHPC 4YSZB 1STEA 1P0RA 4FJZA 1QOFA 3PT2B 1LFDA 3KYCD 4IG7B 2JF5A 2KMCA 4N58A 2KT7A 2JXTA 2RGFA 1TYGB 4BZAA 2DZIA 1WXMA 1AW7A 1N60A 2PE6B 3TEWA 2LRUA 2NPTB 1PQSA 5IKCM 2GBMA 4KGSA 4K1RB 1X1MA 2QDFA 2V0GA 1WSPA 1HXYD 3SU8X 2J7QB 1T0SC 1K50A 5D3IB 1WF9A 4WAAA 2PE9A 2N9LA 3APDA 1HE8A 1CMXB 3VHTC 2LVQA 1L0YB 3AEAB 2OJRA 2V3NA 2IGDA 3QWZB 3FKYA 1YN3A 1E8YA 3R2IA 2K6DB 2M17A 2WP9B 3V6EB 1YQBA 2FIFA 5KHQA 2A5UA 4MJSB 2J0MA 1P7FA 4ACFA 1OFFA 5IO9A 1EWYC 4GXBA 4XWWA 1I4GA 1EM7A 4DDID 2ZW1A 4L23A 1VDVA 3T9LA 3P42A 2IPKD 1WM2A 3AM9A 2W54A 4NAMA 4WJNA 3PTFC 4WJQA 1KOTA 2KN4A 1SJHD 2C60A 2HE7A 1WGHA 2H88B 2CHWA 4M0WA 1YD8U 5HI1A 3V62A 3JW0X 5EE9A 4G3XB 2D3GA 5CTRC 3ZRFA 2KOXA 1UF0A 3E56A 3A4RA 3DPDA 3W1SC 2MBOA 4MT5A 1WGGA 2JX5A 5I4DA 5L95C 1V80A 3IT4B 3IAS1 1SIFA 2K8CA 3R7RA 4ANUA 1KF6B 4H2AA 1I4HA 2XBBC 3VTWA 4AOFA 2WXQA 4AP4C 1L4ZB 4M8NA 2Y5CA 2AX5A 2LUMA 3V3XA 3L08A 2VRRB 2GI9A 4IWQA 3RD2A 4EKUA 4PK1A 4HKQA 2K0PA 3AE4B 3BK2A 1VJKA 5DPRA 4J6IA 1HTQA 4A3PA 1MFWA 3VDZA 2R2QA 3CSTA 1OEYA 1XLNA 2WXIA 5C1ZA 4W9HA 4UDUC 2E6XA 3WALA 3RT3B 2KTRB 4K3BA 3HHMA 2WGSA 2L8JA 2NR2A 4AJWA 3UQAA 4B6WA 2L0FA 2J52A 3GE3C 1JROA 2M56B 3IXSA 2KDMA 2K6QA 5FKAC 4O1NA 2N9EB 2KFKB 4TSSA 4DWFA 5C23A 4S0RA 2UU7A 1WY8A 2IDYA 2XK5B 3QCAA 3L13A 4W9IA 4HJKA 4LNKA 2J0JA 3AE3B 1DOXA 4AS1A 1DGJA 2KKCA 2PJHA 2IJ0A 4A90A 3V6CB 3BVMA 5D2MB 3MC0B 1H4RA 3RNAC 2INCC 4C4VB 1QOAA 3IG3A 3JSVB 3QAQA 2L05A 1L7YA 2AQ3B 3Q3MC 4ZOHC 2R2OA 2IY1B 2KQSA 1E8ZA 3VUXA 1I4QA 1VR9A 1UZXB 2K5PA 3PVLA 5GMVA 3ETRA 4N9F4 4WJOA 1T5XD 2IZVB 2V9HA 2KDEB 2V3SA 1A5RA 2L0TA 5L83A 1FFVA 3UI3A 1UELA 3RZWC 2GBJA 3QC8B 4PYZA 2O6VD 1JRUA 1WGYA 1UWMA 3Q8FA 1TKYA 2KC2A 4HXDA 3UGBB 3ZTDA 1J0GA 1YOVB 4KSLC 3DVNU 4JE3B 2UWQA 4HEA1 1SE3A 1KLUD 3VTVA 3TJPA 4L1BA 2RR9A 2LHDA 4KIKB 3J9CA 1B1ZA 2DZKA 3H7PB 1YJJA 1FNUA 5LNK1 4N6EB 4ANVA 4LJPB 3GZNB 3RCZA 2QC8A 2MP2B 1VLBA 2L83A 1A70A 2MSED 4HROA 2WX1A 2BPSA 3AMZA 2K8BA 2LGSA 3AEFB 5KHOA 3AEGB 3L10B 1XT9B 2MCNB 5FK9C 3BWUD 5IA7A 1SF0A 4BKGA 1BXTA 1OQRA 4R3DA 1TGZB 3RZFA 1IPGA 1F1HA 4RMAA 4B0EA 1F9JA 5EE0A 4WURA 4MELA 2OHFA 4HRSA 1JWUD 2QCZA 2WS3B 3Q6BA 3KWLA 4AUQC 4LNNA 4KDLB 4FA6A 2I2YA 3TCAA 3IT6B 1WX8A 3ZXRA 1FNVA 1MPEA 4GMVA 4N59A 4JL9A 3KW5B 1QOGA 4ARIA 4NQKE 3M62B 4NAWA 2IYDB 4IDIA 2LASA 4W9JA 1E10A 1E5WA 4JWSC 1XO3A 2HJ1A 3BZDB 2ASQA 3AE9B 2M19A 3VR8B 1V1OA 2WDVB 1JWMD 1MG8A 2INDC 4NNJB 3AU4A 4LK0M 3P4RB 1V9JA 5TR5A 3VTUA 2LEKA 2BYTA 3ZQ4A 4IM2A 2JY6A 1V97A 2PTLA 1EU4A 2KK8A 3ZJUA 1FRDA 1EWCA 5BMGA 1T0RC 3O13A 3U8ZA 1V1PB 2LI5A 4MGYE 3AU5A 2KJRA 3OJ4B 3BINA 4XGAB 1QLBB 4DDGD 3PV1A 4B95A 3L54A 2D5GA 3GB1A 5E6JA 4C56C 2ICIA 3FAHA 2K25A 4P1CC 2BKFA 4M8MA 2RDHA 3DBLB 3ZJTA 2N1VA 4MSQB 2BKRB 1CK1A 2MJ3A 2BT6A 1D4BA 1L0VB 2BF8B 2RSUA 3VVWB 5CHFA 3I3TB 1Q10A 5H92C 3KVFB 1M4VA 2WXMA 1HZ5A 2LMCA 1RM6C 3VXWA 4NJ6A 2C7MB 4REZA 2BTEA 2YLMA 1FXAA 1YQ4B 4P16A 1ZE3D 1WYGA 4TKNA 3P4SB 5JH5C 4KSKC 3PHXB 3DVGY 1ZXIA 2DX5B 2LUEA 2KDBA 2B76B 3SFDB 5BMIA 1F52A 4ZRIA 1GJZA 2JXXA 4JQWC 2LXCA 4BBNF 2K8HA 1IGCA 3BIID 3H8HA 4LNOA 4CO7A 1SB3C 2PVOD 2K9XA 4IW0A 1GB4A 2WLBA 4EEWA 3N1XC 1ZOYB 1YNTE 2FE8A 3R2TA 4PYUA 5JHAA 3BVZA 3I63C 2O6VA 2LWPA 1UWXA 2BBCA 2LGIA 3S2AA 1UUPA 4YTNB 4FADA 1OTRB 4XDCA 2EKIA 4YWGG 4ASWC 4BKSD 1MHXA 4HPLB 3Q2AC 2MA9B 2CHXA 5AUKA 3RNEC 4EZJA 2WXKA 1J7AA 2N4FA 2SEBD 1ZPSA 2RDBC 3W2DA 2INPE 2K22A 1GC7A 3Q8EA 2DENB 4DK5A 1RYJA 1WXVA 1C9FA 1IBXA 3L0WB 4MGZE 4MDKE 3QK0A 1XXGA 5E6PA 2Y3AA 2L00B 4KKIA 1EU3A 4KZ0A 4AJYB 1V2YA 1XLOA 3ZUNA 2VH1A 3DVGX 1TS2A 2LD9A 4NJCA 4FLHA 3EA6A 4DHJD 4LJOB 2KNBA 2KMAA 4W9CA 4XWTA 1QOBA 4IM3A 3WAOA 3CMMB 3EGRA 3QARA 3SEBA 1JW9D 3I5JC 2FBWB 1ET9A 1Z2MA 2Y5PA 2KZRA 4G11A 4HLEA 3VH4B 1WGKA 1TY0A 1WJNA 1YQ3B 1Q1OA 2DAJA 2I38A 3HIZA 2K39A 2XNAC 1K53A 1KTKA 3A4SC 3K9PB 4ZYSA 2X38A 4C80A 4EUTA 2VZKD 3CSFA 4BOZB 3HM3A 4OW0A 2C9WB 4LDTB 1J7CA 3LB8C 1TKEA 2GBRA 4A9AA 3EECA 2MX2A 2MBHA 1XLPA 3W1YA 2G1EA 3A9KA 5CX3A 2KYWA 5AUIA 4W9FA 4NAWB 3HRDD 4IC7B 1S3SG 1V8CA 2N9PC 2ZEQA 4C7YA 2W82A 2ZVOA 4ITKA 2AWTA 3P2BA 2PLPA 2DLBA 4LTUA 1FCCC 3B1LX 4MGKE 2WU5B 1WH3A 2V4IB 3PHWB 4RNAA 3VAWA 4ZHPA 3B2FA 1SEBD 1NYQA 1NENB 1ZGUB 3DHHC 3ZGZA 1FIQA 2D07B 3NZUA 1BUIC 1K52A 1RRBA 5HKHA 1P1AA 2IGHA 4IOIE 3U4EG 1WXSA 4RGOS 3OG5A 1ZKHA 2MEKA 5LXIB 2IO1B 3Q3OC 3OLMD 3AE1B 2LJ5A 3LJ3A 4HPPA 3HVDA 2J0KA 2J4XA 5CHVC 2YVCA 4K81A 4MACA 1AYFA 1DOYA 1E7PB 2BS4B 4DXAB 2N7DA 1TJEA 2WXJA 3EC8A 1KFYB 1WRIA 3VRBB 2PPHA 5G55A 1K51A 4E3CA 2BYEA 3UQBA 1F77A 3ZNGC 5E6OA 1GAQB 4MGIE 2KACA 4DBGA 3E9SA 2FIDA 2KX3A 4RGMA 1C79A 2M4NA 1Q0WB 1R7SA 2KFJA 1LM8B 1FMAD 1D5MC 1WE7A 1QT9A 3AXCA 1SE2A 2N9KA 2ZW0A 4FHKA 4MEMA 4WWOA 3N32A 4RM9A 3DOWA 3GOEA 2CJNA 4KGRA 1KLVA 1GOZA 4JX1C 2Z0DB 4YT0B 2QMTA 2NBVB 4HKZE 1QQRA 1L0XB 3T8MA 3GZNI 4ZRJA 1MHHE 4PT5A 2ZCBA 3BVGA 4L2YA 3PREA 4BKSA 1I35A 2DNFA 3U2SC 2LVOA 4B0MA 4FJYA 2PVGC 4KDIC 3TIXA 2PW9A 3FC4A 1RFAA 1Q5WB 2KLCA 3B2GA 1NBFC 1NYRA 5J17A 2MW5A 4IWOA 5MPOA 3SD5A 1VCBA 2FAZA 2G45B 1HZ6A 1WWTA 4KKJA 4ZRQA 3U30A 5D3DA 1GC6A 4ANWA 4ICVA 4W9KA 1FD6A 3Q3NC 1YX5B 1WIAA 2FCNA 2GOWA 1PYWD 3BYYB 3ZVVA 1GPXA 2B3AA 2IGGA 1D6EC 2JU6X 3L4PA 3RULA 1DOIA 4RM8A 1JWBD 1D3ZA 1ZW7A 4MSMB 2QHOA 4ZYNA 3FILA 1J7BA 4S17A 4CQNA 1EUVB 1WMHB 2I1JA 2KMMA 2REXA 3QQ8B 4YTMB 3ML9A 1LO5D 3KQ4A 2FCQA 2DWQA 2L32A 1WR1A 3A9JB 2JZPA 3H9DA 3RNFC 3IFWB 2MHJA 3RFZB 2K1FA 4G0NB 2FCMA 1JCKB 4Q2JA 1C77A 1OQQA 3OJ3A 5BYRA 2FCSA 2KDIA 2JWZA 3V60A 4NZLB 2LHEA 5EE1A 3L17A 2KLGA 1XLQA 2D3CA 1MI0A 4DXGA 3AE6B 4NY0A 3DCGA 5JZEB 2QSDA 4HDQA 1HEZE 3BK1A 1XF5L 2BVCA 2AQ2B 1UBIA 4PS7A 4M02A 4HCPB 3NUHB 2O2VA 1XCTL 3IVFA 1FO4A 2N0SB 1PUTA 1TS4A 2KHWB 1P7EA 3BY4B 1Z5SB 4JIOU 1N5XA 4W9EA 3UIPB 1LXDA 1CQVA 3DBLI 3M3JA 2WXHA 4KGTA 1YX6B 1SIJA 4OVZA 3DBRB 2LGXA 2KXJA 3PSEB 2M1MA 3RN9C 5JHBA 1I42A 4YSXB 2NTTA 2N7EA 4F8CB 1C4AA 1SSNA 3PGEA 2BGFA 3RNCC 4XDDA 1WI0A 4II2B 1MJDA 3O65B 4BKTA 1JRPA 1XD3B 3JVZX 2OOBB 1KLGD 1WRDB 3N3KB 1TIFA 2E3TA 2M8SA 2EMTA 4W9LA 1OQYA 3MFGA 2RPQA 2SAKA 5LXHA 1DYQA 3UINB 2NPTA 1CJEA 1QILA 2D3AA 3K9OB 1R4NB 1AWDA 3PRZA 4LNFA 3RNBC 2HJ8A 1E8WA 3U52E 2MH7A 1WZ3A 4M0WB 3AEDB 4NPNA 1V86A 1T3QA 3TBLD 2N1WA 1RWSA 3WANA 2X8XX 2BWES 4USAA 3ZNID 3B9JA 2FUG1
chains in the Genus database with same CATH topology
4FJVB 3PRPB 1S1QB 3UF8A 1R4NI 2CKHB 4DDID 3T9LA 3JYUA 1WM2A 3AULA 2KVRA 1WGRA 4A20A 1IP9A 1GC7A 4WJNA 1E90A 1P98A 1E7UA 2DENB 3PTFC 4WJQA 1QZEA 3PLUA 4CYEA 1V49A 2KQ7A 4DK5A 1KOTA 1H8CA 2JRHA 4IWPA 4W9GA 2C60A 2HE7A 1WGHA 2CHWA 1WXVA 1YD8U 3V62A 3JW0X 3PRMB 4G3XB 2D3GA 5CTRC 2JUOA 3L0WB 4MGZE 3ZRFA 2KOXA 1GNUA 3QK0A 4MDKE 4MJSA 3A4RA 5E6PA 2L00B 2ZPNA 3DPDA 3W1SC 2MBOA 1LQBA 2KX0A 1WGGA 4KZ0A 4MM3A 4AJYB 1V2YA 4FN2A 2AEHA 3ZUNA 4BOSC 4DHZE 5L95C 1V80A 1WJUA 1UBQA 2LVPA 2MQJA 4HVBA 1SIFA 1WJ4A 5DPSA 3DVGX 2LD9A 2K8CA 4GDKA 4FLHA 3R7RA 4DHJD 4LJOB 5LLIA 1GG3A 3TL5A 4ANUA 3ZTCA 3V61A 2KNBA 2KMAA 4FHJA 2XBBC 3VTWA 4W9CA 4AOFA 4TQ0A 3RYTA 4AP4C 3A1QA 2WWZA 4IM3A 3TMPB 3WAOA 4II3B 3CMMB 4M8NA 3QARA 3L08A 1E8XA 3NOBA 5AZFA 4BFRA 2D2QA 2VRRB 4IWQA 2Y5BB 3RD2A 3APFA 2KANA 4EKUA 1Z2MA 2KZRA 4G11A 4HLEA 3ML8A 3VH4B 5IAAC 2JRIB 3ECIA 1WJNA 3DDCB 1Q1OA 2DAJA 4EZKA 5DPRA 4J6IA 4ICUA 3HIZA 4P7IA 2K39A 4A3PA 2Z0EB 2W9NA 3A9KB 3VDZA 2R2QA 1NDDA 3CSTA 1OEYA 3A4SC 3K9PB 5C1ZA 4W9HA 2L7RA 3WALA 1TTNA 4K7UA 3UIOB 3PS6A 3RT3B 2BYFA 2KTRB 3HHMA 2L8JA 3LDZE 5AEKB 4EUTA 2NR2A 2LXAA 4AJWA 1SE9A 3UQAA 4B6WA 2L0FA 3CSFA 4BOZB 4GDLB 2I1KA 1UD7A 3HM3A 5G2NA 2L76A 2Z59B 3ZRCA 1YIWA 2C9WB 1J19A 4LDTB 1WM3A 2FNJB 2GBRA 2KN5A 1K8RB 3EECA 2K6QA 2MX2A 3IBEA 4NJ7A 2MBHA 2AL6A 3W1YA 3A9KA 3QX1A 3APCA 2N9EB 2KFKB 5CX3A 2ZVNA 4W9FA 4DWFA 4IUMB 4NAWB 5C23A 4IC7B 2IO0B 1S3SG 2WX0A 2KTRA 2ZNVB 1WY8A 4OVVA 2BYVE 4FBJB 4GB9A 2N9PC 2XK5B 2ZEQA 4HCNB 2ZVOA 2JT4B 2AWTA 3QCAA 2MRPA 3L13A 4W9IA 4WWNA 4HJKA 4ZDVA 4HPMB 3P2BA 3VUWA 3R66C 2J0JA 4I6NB 4A3OA 3Q3FA 3B1LX 3MJWA 4MGKE 1WH3A 4DHJB 2KKCA 2DZMA 3PHWB 4B9KA 3VAWA 5EDSA 2PJHA 4GGQA 4HWIB 2KD0A 1G6JA 5E6NA 3VQIA 1ZGUB 3V6CB 1EF5A 3A33B 4HK2A 2C7HA 5D2MB 2D07B 3NZUA 2DYBA 1H4RA 5FR6A 2KWCA 1RRBA 2KC1A 5HKHA 1P1AA 4W9DA 3B08A 2IO2B 2JZ3B 3IG3A 2ZCCA 3JSVB 2HTHA 4PS8A 1WXSA 3QAQA 2L05A 1L7YA 4KZCA 4KVGB 4OVUA 4CHKA 3NS8A 2R2OA 1V5TA 1ZKHA 5BO4B 2IO1B 5LXIB 2IY1B 3OLMD 3LJ3A 2LJ5A 2KQSA 4XZ4A 1E8ZA 2CR5A 3VUXA 2J0KA 2IO3B 1UZXB 1P9DU 3PVLA 5CHVC 1C3TA 4I6PA 5AZHA 2YVCA 3KUZA 5GMVA 2ZZPB 3L16A 4K81A 4N9F4 1WJ6A 2ZNVC 4WJOA 1WZ0A 2IZVB 1WX9A 2NVUI 4DXAB 2N7DA 2KDEB 1R4MI 4TV3A 3MHSD 1KJTA 2KTFA 2V3SA 1A5RA 2L0TA 5L83A 5J18A 1UELA 2MBEA 3RZWC 2GBJA 5DPWA 3QC8B 1TZ1A 3EC8A 2O6VD 4PYZA 1WX7A 3B0AA 3PLVA 4JGHB 1JRUA 1WGYA 1XQQA 2PPHA 5G55A 2KC2A 3QHTA 4HXDA 3UGBB 4E3CA 1AARA 3ZDMC 3R3MA 2BYEA 3UQBA 3ZTDA 2O2VB 3NHEB 1J0GA 3CF6E 4KSLC 5E6OA 3ZNGC 3DVNU 4MGIE 2UWQA 5D6JB 3RUIB 4DBGA 2GBKA 3VTVA 2FIDA 3TJPA 2KX3A 2RR9A 4KIKB 2WYQA 3EHVA 4X57B 2M4NA 1Q0WB 2AL3A 2DZKA 2A4ZA 3H7PB 2KFJA 1LM8B 2PEAA 4GSWA 1WE7A 4F1SA 4ANVA 1EO6A 3AXCA 4GIVA 4LJPB 2N9XA 2KO3A 1P3QU 3M95A 3RCZA 3WAMA 2MP2B 4MEMA 4FHKA 4WWOA 3N32A 4RM9A 2MSED 3DOWA 3GOEA 4LCDE 2GMIC 4TUUA 1KLVA 2WX1A 2MBBB 3ZNHB 1RLFA 2BPSA 2Z0DB 3HM6X 4F7ZA 2K8BA 4KV2A 3PPAA 2NBVB 3DBHI 5KHOA 4IM0A 2HD5B 1RAXA 3C0RB 3L10B 1GUAB 1XT9B 4BVUC 3H7PA 2MCNB 3T8MA 1WGDA 5IA7A 3H1UA 4BKGA 2G4SA 3GZNI 1TBEA 4TQ1A 3Q3JA 1UH6A 4ZRJA 2WDTB 2V1YA 3NY5A 4GOCA 3OAWA 2MP2A 2ZCBA 1TGZB 4E74A 3VUYA 3PREA 3RZFA 1IPGA 4RMAA 2DAFA 4BKSA 1F9JA 1I35A 2LZ6A 4MELA 2KWUB 4FULA 2M0XA 2LVOA 1WE6A 2C5LC 4FJYA 4KDIC 5J2RA 3TIXA 1RFAA 1Q5WB 2KLCA 2CS4A 2EKEC 2G4DB 4AUQC 1NBFC 3X0WA 2IY0B 4KDLB 4FA6A 5J17A 2MW5A 2ZPYA 2DZJA 4IWOA 2GBNA 4GDLA 4AWJA 3TCAA 3SD5A 1EF1A 2MBQA 1VCBA 1WX8A 2FAZA 2G45B 2ZJDA 3KUCB 1FXTB 3QJZA 2L3ZA 1J8CA 4GMVA 1WXAA 3U30A 4MH0E 2DYOA 4JL9A 2KFKA 3QIJA 3KW5B 2DYMA 1GC6A 4WWPA 1E7VA 4NQKE 3M62B 4NAWA 4ANWA 2KJ6A 1BT0A 4ICVA 4W9KA 2IYDB 3ALBA 2CHZA 2LASA 2UYZB 2KWVB 1YX5B 2XK5A 2NBWB 1WIAA 2FCNA 2GOWA 4W9JA 1V6EA 4URKA 1YJ1A 2KDFB 2LGDA 2NCNA 1E5WA 3H7SA 2G3QB 3U7DA 3ZVVA 2LGYA 2B3AA 4GN1A 5DCNA 2RD0A 2ASQA 4GU2A 3D32A 4HDOA 3DVNV 3RULA 4RM8A 4EOYA 1IYFA 2JPHA 1D3ZA 1ZW7A 4MSMB 2QHOA 4EZLA 4ZYNA 1MG8A 4NNJB 3AU4A 1EUVB 1WMHB 2I1JA 2REXA 3QQ8B 5D94A 1M94A 2NS5A 3ML9A 3ZLZA 1V9JA 5TR5A 3VTUA 1V5OA 2FCQA 3AI5A 4IM2A 3HK0A 5AZGA 2JY6A 2KJHB 3JSVA 4WJPA 4GDKB 1WR1A 2KK8A 3A9JB 4K7WA 4LDTD 3H9DA 3ONSA 1L2NA 3QA8A 3ZO5B 1OEYJ 5CHWA 3IFWB 2K1FA 3WA0A 4G0NB 2FCMA 3SHQA 3U8ZA 2LI5A 3A1QB 3OJ3A 3DBSA 4ANXA 1WYWB 2FCSA 1WMHA 4MGYE 3AU5A 2KDIA 2JWZA 2KJRA 3BINA 3OJ4B 3EFUA 3V60A 1C1YB 1NI2A 4DDGD 2DHZA 3KUDB 4ZRKA 3L17A 2EMSA 2KLGA 3PV1A 4B95A 3L54A 5D7GA 4I6LB 3MTNB 1VD2A 4NY0A 3ZIMA 3DCGA 2K25A 3NZSA 5JZEB 3N30A 2BKFA 4HDQA 4M8MA 3A9JA 2FUHB 2N1VA 3R7QA 4MSQB 1UBIA 4PS7A 2BKRB 3ZNZB 1OGWA 1ISNA 2O2VA 1T0YA 3DQVA 4HCPB 3WAPA 3IVFA 2BF8B 2RSUA 1KM7A 1SGHA 3VVWB 5CHFA 3I3TB 4YL8A 2KHWB 3H6NA 3PZDA 3VFKA 2BWFA 3BY4B 3KVFB 3M63B 2JVCA 4KIKA 3WIMA 3ZW3A 1Z5SB 4JIOU 2C7NB 4W9EA 3UIPB 1LXDA 3VXWA 4E71A 3IHPC 2AYOB 4NJ6A 2C7MB 3DBLI 2IBIB 3M3JA 1P0RA 4FJZA 4G50A 3PT2B 2YLMA 4NQLB 1LFDA 3ZKJC 1YX6B 3KYCD 2JZZA 3VH3B 4IG7B 4TKNA 2JF5A 3KH0A 2KMCA 2LGXA 2KXJA 2XEWA 3ZDTA 5JH5C 3PSEB 1WR6E 2M1MA 4KSKC 2RGFA 3PHXB 3DVGY 2DZIA 5JHBA 1I42A 1WXMA 4BBNC 2DX5B 2LUEA 2KDBA 2PE6B 4XX5A 1Y8RC 2N7EA 2LRUA 2NPTB 4F8CB 2O6VB 4ZRIA 3PGEA 1PQSA 2JXXA 4DHZB 1GJZA 2MWSB 2BGFA 2GBMA 1WI0A 4JQWC 4II2B 4K1RB 1X1MA 2LXCA 3O65B 4BKTA 4BBNF 2K8HA 3SU8X 1XD3B 3JVZX 2J7QB 3DBRI 2OOBB 1WRDB 5DPTA 4CO7A 3N3KB 4IW0A 2D11A 1WF9A 2M8SA 4WAAA 4EEWA 2EMTA 4W9LA 2PE9A 3APDA 4PYUA 1OQYA 5JHAA 2RPQA 4K7SA 5LXHA 1UGMA 1HE8A 3UINB 2NPTA 1CMXB 3KYDD 2O6VA 4WQOB 3VHTC 2LVQA 3K9OB 2LWPA 2OJRA 4JLCA 3PRZA 4PS3A 2NBUA 2HJ8A 3S2AA 4FADA 3QWZB 1E8WA 1OTRB 1E8YA 2CU1A 2MLBA 1WZ3A 4ASWC 4BKSD 1WFYA 4M0WB 1V81A 4HPLB 1U4AA 3SDLC 2K6DB 2M17A 3ENEA 4NPNA 3V6EB 1V86A 4XC2A 1YQBA 2MA9B 2CHXA 2FIFA 2D10A 2A5UA 3TBLD 2N1WA 4MJSB 5KHQA 2J0MA 2LRWA 4EZJA 3WANA 2BWES 2N4FA 4EFOA 3W1SA 3ZNID 3X23A 4GXBA 2V4LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FJV B;  3PRP B;  1S1Q B;  3UF8 A;  1R4N I;  2CKH B;  4DDI D;  3T9L A;  3JYU A;  1WM2 A;  3AUL A;  2KVR A;  1WGR A;  4A20 A;  1IP9 A;  1GC7 A;  4WJN A;  1E90 A;  1P98 A;  1E7U A;  2DEN B;  3PTF C;  4WJQ A;  1QZE A;  3PLU A;  4CYE A;  1V49 A;  2KQ7 A;  4DK5 A;  1KOT A;  1H8C A;  2JRH A;  4IWP A;  4W9G A;  2C60 A;  2HE7 A;  1WGH A;  2CHW A;  1WXV A;  1YD8 U;  3V62 A;  3JW0 X;  3PRM B;  4G3X B;  2D3G A;  5CTR C;  2JUO A;  3L0W B;  4MGZ E;  3ZRF A;  2KOX A;  1GNU A;  3QK0 A;  4MDK E;  4MJS A;  3A4R A;  5E6P A;  2L00 B;  2ZPN A;  3DPD A;  3W1S C;  2MBO A;  1LQB A;  2KX0 A;  1WGG A;  4KZ0 A;  4MM3 A;  4AJY B;  1V2Y A;  4FN2 A;  2AEH A;  3ZUN A;  4BOS C;  4DHZ E;  5L95 C;  1V80 A;  1WJU A;  1UBQ A;  2LVP A;  2MQJ A;  4HVB A;  1SIF A;  1WJ4 A;  5DPS A;  3DVG X;  2LD9 A;  2K8C A;  4GDK A;  4FLH A;  3R7R A;  4DHJ D;  4LJO B;  5LLI A;  1GG3 A;  3TL5 A;  4ANU A;  3ZTC A;  3V61 A;  2KNB A;  2KMA A;  4FHJ A;  2XBB C;  3VTW A;  4W9C A;  4AOF A;  4TQ0 A;  3RYT A;  4AP4 C;  3A1Q A;  2WWZ A;  4IM3 A;  3TMP B;  3WAO A;  4II3 B;  3CMM B;  4M8N A;  3QAR A;  3L08 A;  1E8X A;  3NOB A;  5AZF A;  4BFR A;  2D2Q A;  2VRR B;  4IWQ A;  2Y5B B;  3RD2 A;  3APF A;  2KAN A;  4EKU A;  1Z2M A;  2KZR A;  4G11 A;  4HLE A;  3ML8 A;  3VH4 B;  5IAA C;  2JRI B;  3ECI A;  1WJN A;  3DDC B;  1Q1O A;  2DAJ A;  4EZK A;  5DPR A;  4J6I A;  4ICU A;  3HIZ A;  4P7I A;  2K39 A;  4A3P A;  2Z0E B;  2W9N A;  3A9K B;  3VDZ A;  2R2Q A;  1NDD A;  3CST A;  1OEY A;  3A4S C;  3K9P B;  5C1Z A;  4W9H A;  2L7R A;  3WAL A;  1TTN A;  4K7U A;  3UIO B;  3PS6 A;  3RT3 B;  2BYF A;  2KTR B;  3HHM A;  2L8J A;  3LDZ E;  5AEK B;  4EUT A;  2NR2 A;  2LXA A;  4AJW A;  1SE9 A;  3UQA A;  4B6W A;  2L0F A;  3CSF A;  4BOZ B;  4GDL B;  2I1K A;  1UD7 A;  3HM3 A;  5G2N A;  2L76 A;  2Z59 B;  3ZRC A;  1YIW A;  2C9W B;  1J19 A;  4LDT B;  1WM3 A;  2FNJ B;  2GBR A;  2KN5 A;  1K8R B;  3EEC A;  2K6Q A;  2MX2 A;  3IBE A;  4NJ7 A;  2MBH A;  2AL6 A;  3W1Y A;  3A9K A;  3QX1 A;  3APC A;  2N9E B;  2KFK B;  5CX3 A;  2ZVN A;  4W9F A;  4DWF A;  4IUM B;  4NAW B;  5C23 A;  4IC7 B;  2IO0 B;  1S3S G;  2WX0 A;  2KTR A;  2ZNV B;  1WY8 A;  4OVV A;  2BYV E;  4FBJ B;  4GB9 A;  2N9P C;  2XK5 B;  2ZEQ A;  4HCN B;  2ZVO A;  2JT4 B;  2AWT A;  3QCA A;  2MRP A;  3L13 A;  4W9I A;  4WWN A;  4HJK A;  4ZDV A;  4HPM B;  3P2B A;  3VUW A;  3R66 C;  2J0J A;  4I6N B;  4A3O A;  3Q3F A;  3B1L X;  3MJW A;  4MGK E;  1WH3 A;  4DHJ B;  2KKC A;  2DZM A;  3PHW B;  4B9K A;  3VAW A;  5EDS A;  2PJH A;  4GGQ A;  4HWI B;  2KD0 A;  1G6J A;  5E6N A;  3VQI A;  1ZGU B;  3V6C B;  1EF5 A;  3A33 B;  4HK2 A;  2C7H A;  5D2M B;  2D07 B;  3NZU A;  2DYB A;  1H4R A;  5FR6 A;  2KWC A;  1RRB A;  2KC1 A;  5HKH A;  1P1A A;  4W9D A;  3B08 A;  2IO2 B;  2JZ3 B;  3IG3 A;  2ZCC A;  3JSV B;  2HTH A;  4PS8 A;  1WXS A;  3QAQ A;  2L05 A;  1L7Y A;  4KZC A;  4KVG B;  4OVU A;  4CHK A;  3NS8 A;  2R2O A;  1V5T A;  1ZKH A;  5BO4 B;  2IO1 B;  5LXI B;  2IY1 B;  3OLM D;  3LJ3 A;  2LJ5 A;  2KQS A;  4XZ4 A;  1E8Z A;  2CR5 A;  3VUX A;  2J0K A;  2IO3 B;  1UZX B;  1P9D U;  3PVL A;  5CHV C;  1C3T A;  4I6P A;  5AZH A;  2YVC A;  3KUZ A;  5GMV A;  2ZZP B;  3L16 A;  4K81 A;  4N9F 4;  1WJ6 A;  2ZNV C;  4WJO A;  1WZ0 A;  2IZV B;  1WX9 A;  2NVU I;  4DXA B;  2N7D A;  2KDE B;  1R4M I;  4TV3 A;  3MHS D;  1KJT A;  2KTF A;  2V3S A;  1A5R A;  2L0T A;  5L83 A;  5J18 A;  1UEL A;  2MBE A;  3RZW C;  2GBJ A;  5DPW A;  3QC8 B;  1TZ1 A;  3EC8 A;  2O6V D;  4PYZ A;  1WX7 A;  3B0A A;  3PLV A;  4JGH B;  1JRU A;  1WGY A;  1XQQ A;  2PPH A;  5G55 A;  2KC2 A;  3QHT A;  4HXD A;  3UGB B;  4E3C A;  1AAR A;  3ZDM C;  3R3M A;  2BYE A;  3UQB A;  3ZTD A;  2O2V B;  3NHE B;  1J0G A;  3CF6 E;  4KSL C;  5E6O A;  3ZNG C;  3DVN U;  4MGI E;  2UWQ A;  5D6J B;  3RUI B;  4DBG A;  2GBK A;  3VTV A;  2FID A;  3TJP A;  2KX3 A;  2RR9 A;  4KIK B;  2WYQ A;  3EHV A;  4X57 B;  2M4N A;  1Q0W B;  2AL3 A;  2DZK A;  2A4Z A;  3H7P B;  2KFJ A;  1LM8 B;  2PEA A;  4GSW A;  1WE7 A;  4F1S A;  4ANV A;  1EO6 A;  3AXC A;  4GIV A;  4LJP B;  2N9X A;  2KO3 A;  1P3Q U;  3M95 A;  3RCZ A;  3WAM A;  2MP2 B;  4MEM A;  4FHK A;  4WWO A;  3N32 A;  4RM9 A;  2MSE D;  3DOW A;  3GOE A;  4LCD E;  2GMI C;  4TUU A;  1KLV A;  2WX1 A;  2MBB B;  3ZNH B;  1RLF A;  2BPS A;  2Z0D B;  3HM6 X;  4F7Z A;  2K8B A;  4KV2 A;  3PPA A;  2NBV B;  3DBH I;  5KHO A;  4IM0 A;  2HD5 B;  1RAX A;  3C0R B;  3L10 B;  1GUA B;  1XT9 B;  4BVU C;  3H7P A;  2MCN B;  3T8M A;  1WGD A;  5IA7 A;  3H1U A;  4BKG A;  2G4S A;  3GZN I;  1TBE A;  4TQ1 A;  3Q3J A;  1UH6 A;  4ZRJ A;  2WDT B;  2V1Y A;  3NY5 A;  4GOC A;  3OAW A;  2MP2 A;  2ZCB A;  1TGZ B;  4E74 A;  3VUY A;  3PRE A;  3RZF A;  1IPG A;  4RMA A;  2DAF A;  4BKS A;  1F9J A;  1I35 A;  2LZ6 A;  4MEL A;  2KWU B;  4FUL A;  2M0X A;  2LVO A;  1WE6 A;  2C5L C;  4FJY A;  4KDI C;  5J2R A;  3TIX A;  1RFA A;  1Q5W B;  2KLC A;  2CS4 A;  2EKE C;  2G4D B;  4AUQ C;  1NBF C;  3X0W A;  2IY0 B;  4KDL B;  4FA6 A;  5J17 A;  2MW5 A;  2ZPY A;  2DZJ A;  4IWO A;  2GBN A;  4GDL A;  4AWJ A;  3TCA A;  3SD5 A;  1EF1 A;  2MBQ A;  1VCB A;  1WX8 A;  2FAZ A;  2G45 B;  2ZJD A;  3KUC B;  1FXT B;  3QJZ A;  2L3Z A;  1J8C A;  4GMV A;  1WXA A;  3U30 A;  4MH0 E;  2DYO A;  4JL9 A;  2KFK A;  3QIJ A;  3KW5 B;  2DYM A;  1GC6 A;  4WWP A;  1E7V A;  4NQK E;  3M62 B;  4NAW A;  4ANW A;  2KJ6 A;  1BT0 A;  4ICV A;  4W9K A;  2IYD B;  3ALB A;  2CHZ A;  2LAS A;  2UYZ B;  2KWV B;  1YX5 B;  2XK5 A;  2NBW B;  1WIA A;  2FCN A;  2GOW A;  4W9J A;  1V6E A;  4URK A;  1YJ1 A;  2KDF B;  2LGD A;  2NCN A;  1E5W A;  3H7S A;  2G3Q B;  3U7D A;  3ZVV A;  2LGY A;  2B3A A;  4GN1 A;  5DCN A;  2RD0 A;  2ASQ A;  4GU2 A;  3D32 A;  4HDO A;  3DVN V;  3RUL A;  4RM8 A;  4EOY A;  1IYF A;  2JPH A;  1D3Z A;  1ZW7 A;  4MSM B;  2QHO A;  4EZL A;  4ZYN A;  1MG8 A;  4NNJ B;  3AU4 A;  1EUV B;  1WMH B;  2I1J A;  2REX A;  3QQ8 B;  5D94 A;  1M94 A;  2NS5 A;  3ML9 A;  3ZLZ A;  1V9J A;  5TR5 A;  3VTU A;  1V5O A;  2FCQ A;  3AI5 A;  4IM2 A;  3HK0 A;  5AZG A;  2JY6 A;  2KJH B;  3JSV A;  4WJP A;  4GDK B;  1WR1 A;  2KK8 A;  3A9J B;  4K7W A;  4LDT D;  3H9D A;  3ONS A;  1L2N A;  3QA8 A;  3ZO5 B;  1OEY J;  5CHW A;  3IFW B;  2K1F A;  3WA0 A;  4G0N B;  2FCM A;  3SHQ A;  3U8Z A;  2LI5 A;  3A1Q B;  3OJ3 A;  3DBS A;  4ANX A;  1WYW B;  2FCS A;  1WMH A;  4MGY E;  3AU5 A;  2KDI A;  2JWZ A;  2KJR A;  3BIN A;  3OJ4 B;  3EFU A;  3V60 A;  1C1Y B;  1NI2 A;  4DDG D;  2DHZ A;  3KUD B;  4ZRK A;  3L17 A;  2EMS A;  2KLG A;  3PV1 A;  4B95 A;  3L54 A;  5D7G A;  4I6L B;  3MTN B;  1VD2 A;  4NY0 A;  3ZIM A;  3DCG A;  2K25 A;  3NZS A;  5JZE B;  3N30 A;  2BKF A;  4HDQ A;  4M8M A;  3A9J A;  2FUH B;  2N1V A;  3R7Q A;  4MSQ B;  1UBI A;  4PS7 A;  2BKR B;  3ZNZ B;  1OGW A;  1ISN A;  2O2V A;  1T0Y A;  3DQV A;  4HCP B;  3WAP A;  3IVF A;  2BF8 B;  2RSU A;  1KM7 A;  1SGH A;  3VVW B;  5CHF A;  3I3T B;  4YL8 A;  2KHW B;  3H6N A;  3PZD A;  3VFK A;  2BWF A;  3BY4 B;  3KVF B;  3M63 B;  2JVC A;  4KIK A;  3WIM A;  3ZW3 A;  1Z5S B;  4JIO U;  2C7N B;  4W9E A;  3UIP B;  1LXD A;  3VXW A;  4E71 A;  3IHP C;  2AYO B;  4NJ6 A;  2C7M B;  3DBL I;  2IBI B;  3M3J A;  1P0R A;  4FJZ A;  4G50 A;  3PT2 B;  2YLM A;  4NQL B;  1LFD A;  3ZKJ C;  1YX6 B;  3KYC D;  2JZZ A;  3VH3 B;  4IG7 B;  4TKN A;  2JF5 A;  3KH0 A;  2KMC A;  2LGX A;  2KXJ A;  2XEW A;  3ZDT A;  5JH5 C;  3PSE B;  1WR6 E;  2M1M A;  4KSK C;  2RGF A;  3PHX B;  3DVG Y;  2DZI A;  5JHB A;  1I42 A;  1WXM A;  4BBN C;  2DX5 B;  2LUE A;  2KDB A;  2PE6 B;  4XX5 A;  1Y8R C;  2N7E A;  2LRU A;  2NPT B;  4F8C B;  2O6V B;  4ZRI A;  3PGE A;  1PQS A;  2JXX A;  4DHZ B;  1GJZ A;  2MWS B;  2BGF A;  2GBM A;  1WI0 A;  4JQW C;  4II2 B;  4K1R B;  1X1M A;  2LXC A;  3O65 B;  4BKT A;  4BBN F;  2K8H A;  3SU8 X;  1XD3 B;  3JVZ X;  2J7Q B;  3DBR I;  2OOB B;  1WRD B;  5DPT A;  4CO7 A;  3N3K B;  4IW0 A;  2D11 A;  1WF9 A;  2M8S A;  4WAA A;  4EEW A;  2EMT A;  4W9L A;  2PE9 A;  3APD A;  4PYU A;  1OQY A;  5JHA A;  2RPQ A;  4K7S A;  5LXH A;  1UGM A;  1HE8 A;  3UIN B;  2NPT A;  1CMX B;  3KYD D;  2O6V A;  4WQO B;  3VHT C;  2LVQ A;  3K9O B;  2LWP A;  2OJR A;  4JLC A;  3PRZ A;  4PS3 A;  2NBU A;  2HJ8 A;  3S2A A;  4FAD A;  3QWZ B;  1E8W A;  1OTR B;  1E8Y A;  2CU1 A;  2MLB A;  1WZ3 A;  4ASW C;  4BKS D;  1WFY A;  4M0W B;  1V81 A;  4HPL B;  1U4A A;  3SDL C;  2K6D B;  2M17 A;  3ENE A;  4NPN A;  3V6E B;  1V86 A;  4XC2 A;  1YQB A;  2MA9 B;  2CHX A;  2FIF A;  2D10 A;  2A5U A;  3TBL D;  2N1W A;  4MJS B;  5KHQ A;  2J0M A;  2LRW A;  4EZJ A;  3WAN A;  2BWE S;  2N4F A;  4EFO A;  3W1S A;  3ZNI D;  3X23 A;  4GXB A;  2V4L A; 
#chains in the Genus database with same CATH topology
 3RNG C;  3PRP B;  1S1Q B;  4XE0 A;  3HUI A;  3UF8 A;  2Z8L A;  1E6E B;  4OZB A;  3AUL A;  2KVR A;  1WGR A;  4A20 A;  4RGN A;  1P98 A;  1E7U A;  4A6Q A;  4CYE A;  1TY2 A;  1V49 A;  2KQ7 A;  2JRH A;  4IWP A;  4W9G A;  2JQR B;  1ROE A;  4KX6 B;  2XN9 C;  3PRM B;  1VZ8 A;  4RGT A;  4P1B C;  2RDG A;  2JUO A;  2Q5W D;  1GNU A;  3T3O A;  4MJS A;  2BS3 B;  1KH0 A;  2ZPN A;  3AE5 B;  5H8Y E;  2KX0 A;  4LLG M;  2WDQ B;  1UGJ A;  4FN2 A;  2AEH A;  4BOS C;  3MC8 A;  1WJU A;  1WJ4 A;  3KLS X;  4GDK A;  3TL5 A;  2N7J A;  3ZTC A;  2QIL A;  1FNW A;  1PGA A;  3N1Y C;  3NS1 A;  5TSS A;  4TQ0 A;  1C4C A;  1XCQ L;  3A1Q A;  2WWZ A;  3TMP B;  4II3 B;  2JYT A;  3ZYY X;  1E8X A;  4BFR A;  4RF0 A;  2WXP A;  2Y5B B;  3DHI C;  3HVZ A;  2KAN A;  3TSS A;  2JRI B;  4JPS A;  1YJI A;  2Z0E B;  1NDD A;  1N6Z A;  3UIO B;  2J42 A;  2CJO A;  2LXA A;  1VZ7 A;  3CIR B;  2I1K A;  3TEX A;  1YIW A;  1J19 A;  1WM3 A;  2KN5 A;  3GP7 A;  3VRA B;  3EFC A;  1WXQ A;  2ZVN A;  4IUM B;  2KTR A;  2WXL A;  1BML C;  4OVV A;  2BYV E;  4FBJ B;  4GB9 A;  2KQ4 X;  4TMA B;  2JT4 B;  4WWN A;  3GS2 A;  3VUW A;  3R66 C;  4I6N B;  3Q3F A;  3AEC B;  4DHJ B;  4B9K A;  2WXR A;  3MC9 A;  5EDS A;  4HWI B;  2KD0 A;  1G6J A;  5E6N A;  3FIL B;  3VQI A;  1NVI D;  1EF5 A;  1GB1 A;  3A33 B;  4HK2 A;  2C7H A;  2GB1 A;  5FR6 A;  5EE3 A;  2AQ1 B;  1R4M B;  3B08 A;  2JZ3 B;  2HTH A;  2W55 A;  4PS8 A;  4KZC A;  3DHG C;  4OVU A;  4CHK A;  3NS8 A;  1V5T A;  2PMV A;  3DWM A;  5BO4 B;  3AB5 A;  4XZ4 A;  4A55 A;  2CR5 A;  1P9D U;  1C3T A;  4P6V F;  1SJE D;  2ON8 A;  4BAX A;  2ZZP B;  1D5X C;  1WJ6 A;  2ZNV C;  1RFK A;  1WZ0 A;  1WX9 A;  2NVU I;  4QAY A;  1KJT A;  2KTF A;  3SR6 A;  5FR3 A;  4WH4 A;  2W3S A;  4C4V A;  2MBE A;  5DPW A;  1TZ1 A;  1WX7 A;  2RPV A;  1XQQ A;  3NVZ A;  1ZDX A;  2O2V B;  1C76 A;  2JSV X;  2VH2 A;  3CF6 E;  3RUI B;  3Q8B A;  2WQY B;  1SXT A;  2L1A A;  3N20 C;  2WYQ A;  3EHV A;  4X57 B;  5C2T B;  2WDR B;  2WXG A;  4GSW A;  4F1S A;  3U7Z A;  1EO6 A;  1I7H A;  2N9X A;  2KO3 A;  3WAM A;  1B9R A;  1I4X A;  2HTM E;  1KRH A;  2ONQ A;  4LCD E;  5BMH A;  4US8 A;  3ZNH B;  4DQO C;  2YEP B;  4KV2 A;  3PPA A;  3DBH I;  2HD5 B;  1RAX A;  1N63 A;  4BVU C;  3NJT A;  3H7P A;  1TZO A;  3EUB 2;  2G4S A;  3C19 A;  4TQ1 A;  3Q3J A;  2WDT B;  4M01 A;  5BYQ A;  3NY5 A;  3WCQ A;  2MP2 A;  4E74 A;  2DAF A;  1I4R A;  2LZ6 A;  2NMQ A;  3TUO A;  3AEB B;  1WE6 A;  4YXD B;  5J2R A;  4D2K A;  2CS4 A;  2EKE C;  5HHD G;  3X0W A;  2IY0 B;  2ZPY A;  2DZJ A;  4GDL A;  2WXN A;  2LJI A;  1EF1 A;  1JWS D;  1N61 A;  2ZJD A;  1FXT B;  3QJZ A;  3T3N A;  1FCL A;  1ZUD 2;  4FXC A;  4MH0 E;  3PO0 A;  3QIJ A;  2DYM A;  4WWP A;  1E7V A;  1ZDV A;  2KJ6 A;  1BT0 A;  2CHZ A;  1ET6 A;  3W5U B;  2UYZ B;  1FRR A;  4US9 A;  1V6E A;  4J3O D;  1YJ1 A;  2W3R A;  1PGB A;  3H7S A;  2G3Q B;  2LGY A;  4GN1 A;  5DCN A;  3TEZ A;  3D32 A;  4HDO A;  3DVN V;  2JPH A;  1F2R C;  4EZL A;  1FEH A;  5D94 A;  2NS5 A;  3ZLZ A;  3SFE B;  1TT5 B;  3HK0 A;  5AZG A;  2KJH B;  4GDK B;  4A8X C;  4K7W A;  4LDT D;  3ONS A;  1JQ4 A;  1L2N A;  1ZXH A;  1SBB B;  3LXF A;  3QA8 A;  3ZO5 B;  1VRA B;  5CHW A;  4RH6 A;  1PFD A;  3A1Q B;  1WYW B;  1C4P A;  3DWG C;  3EFU A;  2K3U A;  3LYY A;  4ZRK A;  2EMS A;  2KVZ A;  3DBH B;  4I6L B;  3ZIM A;  3RPF C;  3NZS A;  3N30 A;  2KWD A;  2RMM A;  1T0Y A;  1N5W A;  2R61 A;  3WAP A;  4EE2 A;  2GLS A;  1V1P A;  1KM7 A;  4WAF A;  3AEE B;  3C8Y A;  4YL8 A;  1MG4 A;  3PZD A;  5BYS A;  3VFK A;  3WIM A;  3V05 A;  2AYO B;  3P1M A;  2IBI B;  4GLS C;  4G50 A;  4NQL B;  3ZKJ C;  3P4P B;  2JZZ A;  3ABV B;  3VH3 B;  1IGD A;  3KH0 A;  3NVY A;  4RF1 A;  3OWE B;  3MHZ A;  2WNM A;  2XEW A;  3ZDT A;  1WR6 E;  4BBN C;  2MJD A;  4XX5 A;  4ZRP A;  1Y8R C;  2O6V B;  5G5G A;  1HQR D;  4DHZ B;  2MWS B;  5C3J B;  2OED A;  3DBR I;  5DPT A;  3URY A;  3R8B A;  2D11 A;  3VR9 B;  4K7S A;  5T8I A;  2BS2 B;  1UGM A;  3KYD D;  4WQO B;  1Y56 A;  4JLC A;  4PS3 A;  2NBU A;  1XEE A;  2CU1 A;  2MLB A;  3AN1 A;  4XYC A;  4WWM A;  3PZ7 A;  1WFY A;  1YMH E;  1V81 A;  1U4A A;  3SDL C;  3AE7 B;  5JXV A;  3ENE A;  1IBX B;  4XC2 A;  2D10 A;  1ESF A;  2PKO A;  2LRW A;  3ZJV A;  2QIE B;  4EFO A;  3W1S A;  3X23 A;  2V4L A;  4FJV B;  3AH7 A;  1R4N I;  2CKH B;  3JYU A;  3N1Z C;  1IP9 A;  1E90 A;  1QZE A;  3PLU A;  4DXF A;  1H8C A;  2WHI A;  1D5Z C;  3I57 A;  3MJ5 A;  1LQB A;  2BQQ A;  1MVK A;  1L6V A;  4MM3 A;  4DHZ E;  4HVB A;  2LVP A;  1UBQ A;  2MQJ A;  5DPS A;  3P63 A;  1ENF A;  2WXF A;  1VZ6 A;  5LLI A;  1GG3 A;  3AE8 B;  3V61 A;  4FHJ A;  3AV8 A;  1TS3 A;  3RYT A;  2H89 B;  3NG0 A;  3NOB A;  5AZF A;  1HA5 A;  2D2Q A;  2NTS A;  3APF A;  3Q14 C;  3W9C B;  3NZ3 A;  2HDE A;  3ML8 A;  5IAA C;  3ECI A;  3DDC B;  4ZHO A;  4EZK A;  3MP9 A;  3Q69 A;  4ICU A;  4P7I A;  2W9N A;  3A9K B;  3TEY A;  2L7R A;  1TTN A;  3AE2 B;  4K7U A;  3PS6 A;  2BYF A;  1L5P A;  3LDZ E;  5AEK B;  2G9H D;  3KWV A;  1SE9 A;  4OHJ A;  2BW2 A;  4LNI A;  4OZC A;  4GDL B;  1UD7 A;  1NI3 A;  5G2N A;  2L76 A;  2Z59 B;  3ZRC A;  2FNJ B;  3I9V 1;  1L4D B;  1K8R B;  3IBE A;  4NJ7 A;  2AL6 A;  3QX1 A;  5IP4 D;  3APC A;  3N9Y C;  1YN4 A;  2INN E;  2IO0 B;  2WX0 A;  2ZNV B;  1FM0 D;  4HCN B;  4C7Z A;  2MRP A;  4ZDV A;  3Q8A A;  4HPM B;  1TS5 A;  4A3O A;  3MJW A;  3BYT B;  2DZM A;  3W5V B;  1QF6 A;  1F2R I;  4GGQ A;  1T0Q C;  2DYB A;  2KWC A;  2J53 A;  1JWA D;  2KC1 A;  4W9D A;  2IO2 B;  1SE4 A;  2PIA A;  3PZ8 A;  2ZCC A;  1E9M A;  4KVG B;  2BB5 A;  1HTO A;  2IO3 B;  4RFB A;  2GRI A;  2ACZ B;  1QKZ A;  4I6P A;  5AZH A;  1E0Z A;  2TSS A;  3KUZ A;  4OZA A;  3L16 A;  1R4M I;  4TV3 A;  4K3C A;  3MHS D;  5J18 A;  3B0A A;  3PLV A;  5HG2 A;  2CU3 A;  4JGH B;  4WIP A;  1AN8 A;  1CZP A;  3QHT A;  3NVV A;  1AAR A;  3ZDM C;  3R3M A;  3NHE B;  3RMK C;  2KAJ A;  1T6B X;  5D6J B;  2GBK A;  1ZP0 B;  1TKG A;  5HFY A;  2AL3 A;  2A4Z A;  2PEA A;  1N62 A;  4AQ7 A;  4HJG E;  4GIV A;  5IOI A;  1P3Q U;  3M95 A;  2L52 A;  2WXO A;  2M0A A;  2GMI C;  4TUU A;  2MBB B;  1RLF A;  3HM6 X;  2QJL A;  4F7Z A;  2V3P A;  4IM0 A;  3C0R B;  1GUA B;  1FFU A;  3NVW A;  1WGD A;  3H1U A;  4YTP B;  4RCO A;  1TBE A;  1UH6 A;  4M00 A;  2V1Y A;  4GOC A;  3OAW A;  1YN5 A;  3VUY A;  2QEJ C;  1PGX A;  2KWU B;  4FUL A;  2M0X A;  3RI7 C;  3ZXV A;  2C5L C;  4IKG A;  4WQM A;  3NRZ A;  2G4D B;  1IUE A;  2GBN A;  4AWJ A;  1JML A;  2MBQ A;  5G5H A;  3KUC B;  2L3Z A;  1J8C A;  1WXA A;  2DYO A;  2KFK A;  1F0Z A;  5IN7 A;  3ALB A;  4MH8 A;  2KWV B;  2XK5 A;  5GXG B;  2NBW B;  4URK A;  2BB6 A;  2OJW A;  2YEP F;  3IAM 1;  2KDF B;  2LGD A;  2NCN A;  3U7D A;  2RD0 A;  4GU2 A;  2MJE A;  1PDX A;  4ARC A;  1FPY A;  4EOY A;  1IYF A;  4C00 A;  1L6U A;  1M94 A;  2VZK B;  1V5O A;  4MM3 B;  2DBY A;  3AI5 A;  2LFI A;  3JSV A;  1C78 A;  4WJP A;  1I4P A;  1ACC A;  1JAL A;  1NEK B;  1OEY J;  3WA0 A;  3SHQ A;  1UNS A;  4ANX A;  3DBS A;  1WMH A;  2D3B A;  1C1Y B;  1NI2 A;  3P4Q B;  2DHZ A;  3KUD B;  5D7G A;  3MTN B;  3Q8C A;  1VD2 A;  1FXI A;  3GE8 C;  3A9J A;  2FUH B;  3R7Q A;  3ZNZ B;  1OGW A;  1ISN A;  3DQV A;  2EEL A;  1SGH A;  2JWU A;  4YSY B;  2JYE A;  3H6N A;  3CWI A;  2BWF A;  3M63 B;  3ZW3 A;  1LGR A;  2JVC A;  4JWU C;  4KIK A;  2C7N B;  2WU2 B;  4E71 A;  3IHP C;  4YSZ B;  1STE A;  1P0R A;  4FJZ A;  1QOF A;  3PT2 B;  1LFD A;  3KYC D;  4IG7 B;  2JF5 A;  2KMC A;  4N58 A;  2KT7 A;  2JXT A;  2RGF A;  1TYG B;  4BZA A;  2DZI A;  1WXM A;  1AW7 A;  1N60 A;  2PE6 B;  3TEW A;  2LRU A;  2NPT B;  1PQS A;  5IKC M;  2GBM A;  4KGS A;  4K1R B;  1X1M A;  2QDF A;  2V0G A;  1WSP A;  1HXY D;  3SU8 X;  2J7Q B;  1T0S C;  1K50 A;  5D3I B;  1WF9 A;  4WAA A;  2PE9 A;  2N9L A;  3APD A;  1HE8 A;  1CMX B;  3VHT C;  2LVQ A;  1L0Y B;  3AEA B;  2OJR A;  2V3N A;  2IGD A;  3QWZ B;  3FKY A;  1YN3 A;  1E8Y A;  3R2I A;  2K6D B;  2M17 A;  2WP9 B;  3V6E B;  1YQB A;  2FIF A;  5KHQ A;  2A5U A;  4MJS B;  2J0M A;  1P7F A;  4ACF A;  1OFF A;  5IO9 A;  1EWY C;  4GXB A;  4XWW A;  1I4G A;  1EM7 A;  4DDI D;  2ZW1 A;  4L23 A;  1VDV A;  3T9L A;  3P42 A;  2IPK D;  1WM2 A;  3AM9 A;  2W54 A;  4NAM A;  4WJN A;  3PTF C;  4WJQ A;  1KOT A;  2KN4 A;  1SJH D;  2C60 A;  2HE7 A;  1WGH A;  2H88 B;  2CHW A;  4M0W A;  1YD8 U;  5HI1 A;  3V62 A;  3JW0 X;  5EE9 A;  4G3X B;  2D3G A;  5CTR C;  3ZRF A;  2KOX A;  1UF0 A;  3E56 A;  3A4R A;  3DPD A;  3W1S C;  2MBO A;  4MT5 A;  1WGG A;  2JX5 A;  5I4D A;  5L95 C;  1V80 A;  3IT4 B;  3IAS 1;  1SIF A;  2K8C A;  3R7R A;  4ANU A;  1KF6 B;  4H2A A;  1I4H A;  2XBB C;  3VTW A;  4AOF A;  2WXQ A;  4AP4 C;  1L4Z B;  4M8N A;  2Y5C A;  2AX5 A;  2LUM A;  3V3X A;  3L08 A;  2VRR B;  2GI9 A;  4IWQ A;  3RD2 A;  4EKU A;  4PK1 A;  4HKQ A;  2K0P A;  3AE4 B;  3BK2 A;  1VJK A;  5DPR A;  4J6I A;  1HTQ A;  4A3P A;  1MFW A;  3VDZ A;  2R2Q A;  3CST A;  1OEY A;  1XLN A;  2WXI A;  5C1Z A;  4W9H A;  4UDU C;  2E6X A;  3WAL A;  3RT3 B;  2KTR B;  4K3B A;  3HHM A;  2WGS A;  2L8J A;  2NR2 A;  4AJW A;  3UQA A;  4B6W A;  2L0F A;  2J52 A;  3GE3 C;  1JRO A;  2M56 B;  3IXS A;  2KDM A;  2K6Q A;  5FKA C;  4O1N A;  2N9E B;  2KFK B;  4TSS A;  4DWF A;  5C23 A;  4S0R A;  2UU7 A;  1WY8 A;  2IDY A;  2XK5 B;  3QCA A;  3L13 A;  4W9I A;  4HJK A;  4LNK A;  2J0J A;  3AE3 B;  1DOX A;  4AS1 A;  1DGJ A;  2KKC A;  2PJH A;  2IJ0 A;  4A90 A;  3V6C B;  3BVM A;  5D2M B;  3MC0 B;  1H4R A;  3RNA C;  2INC C;  4C4V B;  1QOA A;  3IG3 A;  3JSV B;  3QAQ A;  2L05 A;  1L7Y A;  2AQ3 B;  3Q3M C;  4ZOH C;  2R2O A;  2IY1 B;  2KQS A;  1E8Z A;  3VUX A;  1I4Q A;  1VR9 A;  1UZX B;  2K5P A;  3PVL A;  5GMV A;  3ETR A;  4N9F 4;  4WJO A;  1T5X D;  2IZV B;  2V9H A;  2KDE B;  2V3S A;  1A5R A;  2L0T A;  5L83 A;  1FFV A;  3UI3 A;  1UEL A;  3RZW C;  2GBJ A;  3QC8 B;  4PYZ A;  2O6V D;  1JRU A;  1WGY A;  1UWM A;  3Q8F A;  1TKY A;  2KC2 A;  4HXD A;  3UGB B;  3ZTD A;  1J0G A;  1YOV B;  4KSL C;  3DVN U;  4JE3 B;  2UWQ A;  4HEA 1;  1SE3 A;  1KLU D;  3VTV A;  3TJP A;  4L1B A;  2RR9 A;  2LHD A;  4KIK B;  3J9C A;  1B1Z A;  2DZK A;  3H7P B;  1YJJ A;  1FNU A;  5LNK 1;  4N6E B;  4ANV A;  4LJP B;  3GZN B;  3RCZ A;  2QC8 A;  2MP2 B;  1VLB A;  2L83 A;  1A70 A;  2MSE D;  4HRO A;  2WX1 A;  2BPS A;  3AMZ A;  2K8B A;  2LGS A;  3AEF B;  5KHO A;  3AEG B;  3L10 B;  1XT9 B;  2MCN B;  5FK9 C;  3BWU D;  5IA7 A;  1SF0 A;  4BKG A;  1BXT A;  1OQR A;  4R3D A;  1TGZ B;  3RZF A;  1IPG A;  1F1H A;  4RMA A;  4B0E A;  1F9J A;  5EE0 A;  4WUR A;  4MEL A;  2OHF A;  4HRS A;  1JWU D;  2QCZ A;  2WS3 B;  3Q6B A;  3KWL A;  4AUQ C;  4LNN A;  4KDL B;  4FA6 A;  2I2Y A;  3TCA A;  3IT6 B;  1WX8 A;  3ZXR A;  1FNV A;  1MPE A;  4GMV A;  4N59 A;  4JL9 A;  3KW5 B;  1QOG A;  4ARI A;  4NQK E;  3M62 B;  4NAW A;  2IYD B;  4IDI A;  2LAS A;  4W9J A;  1E10 A;  1E5W A;  4JWS C;  1XO3 A;  2HJ1 A;  3BZD B;  2ASQ A;  3AE9 B;  2M19 A;  3VR8 B;  1V1O A;  2WDV B;  1JWM D;  1MG8 A;  2IND C;  4NNJ B;  3AU4 A;  4LK0 M;  3P4R B;  1V9J A;  5TR5 A;  3VTU A;  2LEK A;  2BYT A;  3ZQ4 A;  4IM2 A;  2JY6 A;  1V97 A;  2PTL A;  1EU4 A;  2KK8 A;  3ZJU A;  1FRD A;  1EWC A;  5BMG A;  1T0R C;  3O13 A;  3U8Z A;  1V1P B;  2LI5 A;  4MGY E;  3AU5 A;  2KJR A;  3OJ4 B;  3BIN A;  4XGA B;  1QLB B;  4DDG D;  3PV1 A;  4B95 A;  3L54 A;  2D5G A;  3GB1 A;  5E6J A;  4C56 C;  2ICI A;  3FAH A;  2K25 A;  4P1C C;  2BKF A;  4M8M A;  2RDH A;  3DBL B;  3ZJT A;  2N1V A;  4MSQ B;  2BKR B;  1CK1 A;  2MJ3 A;  2BT6 A;  1D4B A;  1L0V B;  2BF8 B;  2RSU A;  3VVW B;  5CHF A;  3I3T B;  1Q10 A;  5H92 C;  3KVF B;  1M4V A;  2WXM A;  1HZ5 A;  2LMC A;  1RM6 C;  3VXW A;  4NJ6 A;  2C7M B;  4REZ A;  2BTE A;  2YLM A;  1FXA A;  1YQ4 B;  4P16 A;  1ZE3 D;  1WYG A;  4TKN A;  3P4S B;  5JH5 C;  4KSK C;  3PHX B;  3DVG Y;  1ZXI A;  2DX5 B;  2LUE A;  2KDB A;  2B76 B;  3SFD B;  5BMI A;  1F52 A;  4ZRI A;  1GJZ A;  2JXX A;  4JQW C;  2LXC A;  4BBN F;  2K8H A;  1IGC A;  3BII D;  3H8H A;  4LNO A;  4CO7 A;  1SB3 C;  2PVO D;  2K9X A;  4IW0 A;  1GB4 A;  2WLB A;  4EEW A;  3N1X C;  1ZOY B;  1YNT E;  2FE8 A;  3R2T A;  4PYU A;  5JHA A;  3BVZ A;  3I63 C;  2O6V A;  2LWP A;  1UWX A;  2BBC A;  2LGI A;  3S2A A;  1UUP A;  4YTN B;  4FAD A;  1OTR B;  4XDC A;  2EKI A;  4YWG G;  4ASW C;  4BKS D;  1MHX A;  4HPL B;  3Q2A C;  2MA9 B;  2CHX A;  5AUK A;  3RNE C;  4EZJ A;  2WXK A;  1J7A A;  2N4F A;  2SEB D;  1ZPS A;  2RDB C;  3W2D A;  2INP E;  2K22 A;  1GC7 A;  3Q8E A;  2DEN B;  4DK5 A;  1RYJ A;  1WXV A;  1C9F A;  1IBX A;  3L0W B;  4MGZ E;  4MDK E;  3QK0 A;  1XXG A;  5E6P A;  2Y3A A;  2L00 B;  4KKI A;  1EU3 A;  4KZ0 A;  4AJY B;  1V2Y A;  1XLO A;  3ZUN A;  2VH1 A;  3DVG X;  1TS2 A;  2LD9 A;  4NJC A;  4FLH A;  3EA6 A;  4DHJ D;  4LJO B;  2KNB A;  2KMA A;  4W9C A;  4XWT A;  1QOB A;  4IM3 A;  3WAO A;  3CMM B;  3EGR A;  3QAR A;  3SEB A;  1JW9 D;  3I5J C;  2FBW B;  1ET9 A;  1Z2M A;  2Y5P A;  2KZR A;  4G11 A;  4HLE A;  3VH4 B;  1WGK A;  1TY0 A;  1WJN A;  1YQ3 B;  1Q1O A;  2DAJ A;  2I38 A;  3HIZ A;  2K39 A;  2XNA C;  1K53 A;  1KTK A;  3A4S C;  3K9P B;  4ZYS A;  2X38 A;  4C80 A;  4EUT A;  2VZK D;  3CSF A;  4BOZ B;  3HM3 A;  4OW0 A;  2C9W B;  4LDT B;  1J7C A;  3LB8 C;  1TKE A;  2GBR A;  4A9A A;  3EEC A;  2MX2 A;  2MBH A;  1XLP A;  3W1Y A;  2G1E A;  3A9K A;  5CX3 A;  2KYW A;  5AUI A;  4W9F A;  4NAW B;  3HRD D;  4IC7 B;  1S3S G;  1V8C A;  2N9P C;  2ZEQ A;  4C7Y A;  2W82 A;  2ZVO A;  4ITK A;  2AWT A;  3P2B A;  2PLP A;  2DLB A;  4LTU A;  1FCC C;  3B1L X;  4MGK E;  2WU5 B;  1WH3 A;  2V4I B;  3PHW B;  4RNA A;  3VAW A;  4ZHP A;  3B2F A;  1SEB D;  1NYQ A;  1NEN B;  1ZGU B;  3DHH C;  3ZGZ A;  1FIQ A;  2D07 B;  3NZU A;  1BUI C;  1K52 A;  1RRB A;  5HKH A;  1P1A A;  2IGH A;  4IOI E;  3U4E G;  1WXS A;  4RGO S;  3OG5 A;  1ZKH A;  2MEK A;  5LXI B;  2IO1 B;  3Q3O C;  3OLM D;  3AE1 B;  2LJ5 A;  3LJ3 A;  4HPP A;  3HVD A;  2J0K A;  2J4X A;  5CHV C;  2YVC A;  4K81 A;  4MAC A;  1AYF A;  1DOY A;  1E7P B;  2BS4 B;  4DXA B;  2N7D A;  1TJE A;  2WXJ A;  3EC8 A;  1KFY B;  1WRI A;  3VRB B;  2PPH A;  5G55 A;  1K51 A;  4E3C A;  2BYE A;  3UQB A;  1F77 A;  3ZNG C;  5E6O A;  1GAQ B;  4MGI E;  2KAC A;  4DBG A;  3E9S A;  2FID A;  2KX3 A;  4RGM A;  1C79 A;  2M4N A;  1Q0W B;  1R7S A;  2KFJ A;  1LM8 B;  1FMA D;  1D5M C;  1WE7 A;  1QT9 A;  3AXC A;  1SE2 A;  2N9K A;  2ZW0 A;  4FHK A;  4MEM A;  4WWO A;  3N32 A;  4RM9 A;  3DOW A;  3GOE A;  2CJN A;  4KGR A;  1KLV A;  1GOZ A;  4JX1 C;  2Z0D B;  4YT0 B;  2QMT A;  2NBV B;  4HKZ E;  1QQR A;  1L0X B;  3T8M A;  3GZN I;  4ZRJ A;  1MHH E;  4PT5 A;  2ZCB A;  3BVG A;  4L2Y A;  3PRE A;  4BKS A;  1I35 A;  2DNF A;  3U2S C;  2LVO A;  4B0M A;  4FJY A;  2PVG C;  4KDI C;  3TIX A;  2PW9 A;  3FC4 A;  1RFA A;  1Q5W B;  2KLC A;  3B2G A;  1NBF C;  1NYR A;  5J17 A;  2MW5 A;  4IWO A;  5MPO A;  3SD5 A;  1VCB A;  2FAZ A;  2G45 B;  1HZ6 A;  1WWT A;  4KKJ A;  4ZRQ A;  3U30 A;  5D3D A;  1GC6 A;  4ANW A;  4ICV A;  4W9K A;  1FD6 A;  3Q3N C;  1YX5 B;  1WIA A;  2FCN A;  2GOW A;  1PYW D;  3BYY B;  3ZVV A;  1GPX A;  2B3A A;  2IGG A;  1D6E C;  2JU6 X;  3L4P A;  3RUL A;  1DOI A;  4RM8 A;  1JWB D;  1D3Z A;  1ZW7 A;  4MSM B;  2QHO A;  4ZYN A;  3FIL A;  1J7B A;  4S17 A;  4CQN A;  1EUV B;  1WMH B;  2I1J A;  2KMM A;  2REX A;  3QQ8 B;  4YTM B;  3ML9 A;  1LO5 D;  3KQ4 A;  2FCQ A;  2DWQ A;  2L32 A;  1WR1 A;  3A9J B;  2JZP A;  3H9D A;  3RNF C;  3IFW B;  2MHJ A;  3RFZ B;  2K1F A;  4G0N B;  2FCM A;  1JCK B;  4Q2J A;  1C77 A;  1OQQ A;  3OJ3 A;  5BYR A;  2FCS A;  2KDI A;  2JWZ A;  3V60 A;  4NZL B;  2LHE A;  5EE1 A;  3L17 A;  2KLG A;  1XLQ A;  2D3C A;  1MI0 A;  4DXG A;  3AE6 B;  4NY0 A;  3DCG A;  5JZE B;  2QSD A;  4HDQ A;  1HEZ E;  3BK1 A;  1XF5 L;  2BVC A;  2AQ2 B;  1UBI A;  4PS7 A;  4M02 A;  4HCP B;  3NUH B;  2O2V A;  1XCT L;  3IVF A;  1FO4 A;  2N0S B;  1PUT A;  1TS4 A;  2KHW B;  1P7E A;  3BY4 B;  1Z5S B;  4JIO U;  1N5X A;  4W9E A;  3UIP B;  1LXD A;  1CQV A;  3DBL I;  3M3J A;  2WXH A;  4KGT A;  1YX6 B;  1SIJ A;  4OVZ A;  3DBR B;  2LGX A;  2KXJ A;  3PSE B;  2M1M A;  3RN9 C;  5JHB A;  1I42 A;  4YSX B;  2NTT A;  2N7E A;  4F8C B;  1C4A A;  1SSN A;  3PGE A;  2BGF A;  3RNC C;  4XDD A;  1WI0 A;  4II2 B;  1MJD A;  3O65 B;  4BKT A;  1JRP A;  1XD3 B;  3JVZ X;  2OOB B;  1KLG D;  1WRD B;  3N3K B;  1TIF A;  2E3T A;  2M8S A;  2EMT A;  4W9L A;  1OQY A;  3MFG A;  2RPQ A;  2SAK A;  5LXH A;  1DYQ A;  3UIN B;  2NPT A;  1CJE A;  1QIL A;  2D3A A;  3K9O B;  1R4N B;  1AWD A;  3PRZ A;  4LNF A;  3RNB C;  2HJ8 A;  1E8W A;  3U52 E;  2MH7 A;  1WZ3 A;  4M0W B;  3AED B;  4NPN A;  1V86 A;  1T3Q A;  3TBL D;  2N1W A;  1RWS A;  3WAN A;  2X8X X;  2BWE S;  4USA A;  3ZNI D;  3B9J A;  2FUG 1; 
#chains in the Genus database with same CATH homology
 4FJV B;  3PRP B;  1S1Q B;  3UF8 A;  1R4N I;  2CKH B;  4DDI D;  3T9L A;  3JYU A;  1WM2 A;  3AUL A;  2KVR A;  1WGR A;  4A20 A;  1IP9 A;  1GC7 A;  4WJN A;  1E90 A;  1P98 A;  1E7U A;  2DEN B;  3PTF C;  4WJQ A;  1QZE A;  3PLU A;  4CYE A;  1V49 A;  2KQ7 A;  4DK5 A;  1KOT A;  1H8C A;  2JRH A;  4IWP A;  4W9G A;  2C60 A;  2HE7 A;  1WGH A;  2CHW A;  1WXV A;  1YD8 U;  3V62 A;  3JW0 X;  3PRM B;  4G3X B;  2D3G A;  5CTR C;  2JUO A;  3L0W B;  4MGZ E;  3ZRF A;  2KOX A;  1GNU A;  3QK0 A;  4MDK E;  4MJS A;  3A4R A;  5E6P A;  2L00 B;  2ZPN A;  3DPD A;  3W1S C;  2MBO A;  1LQB A;  2KX0 A;  1WGG A;  4KZ0 A;  4MM3 A;  4AJY B;  1V2Y A;  4FN2 A;  2AEH A;  3ZUN A;  4BOS C;  4DHZ E;  5L95 C;  1V80 A;  1WJU A;  1UBQ A;  2LVP A;  2MQJ A;  4HVB A;  1SIF A;  1WJ4 A;  5DPS A;  3DVG X;  2LD9 A;  2K8C A;  4GDK A;  4FLH A;  3R7R A;  4DHJ D;  4LJO B;  5LLI A;  1GG3 A;  3TL5 A;  4ANU A;  3ZTC A;  3V61 A;  2KNB A;  2KMA A;  4FHJ A;  2XBB C;  3VTW A;  4W9C A;  4AOF A;  4TQ0 A;  3RYT A;  4AP4 C;  3A1Q A;  2WWZ A;  4IM3 A;  3TMP B;  3WAO A;  4II3 B;  3CMM B;  4M8N A;  3QAR A;  3L08 A;  1E8X A;  3NOB A;  5AZF A;  4BFR A;  2D2Q A;  2VRR B;  4IWQ A;  2Y5B B;  3RD2 A;  3APF A;  2KAN A;  4EKU A;  1Z2M A;  2KZR A;  4G11 A;  4HLE A;  3ML8 A;  3VH4 B;  5IAA C;  2JRI B;  3ECI A;  1WJN A;  3DDC B;  1Q1O A;  2DAJ A;  4EZK A;  5DPR A;  4J6I A;  4ICU A;  3HIZ A;  4P7I A;  2K39 A;  4A3P A;  2Z0E B;  2W9N A;  3A9K B;  3VDZ A;  2R2Q A;  1NDD A;  3CST A;  1OEY A;  3A4S C;  3K9P B;  5C1Z A;  4W9H A;  2L7R A;  3WAL A;  1TTN A;  4K7U A;  3UIO B;  3PS6 A;  3RT3 B;  2BYF A;  2KTR B;  3HHM A;  2L8J A;  3LDZ E;  5AEK B;  4EUT A;  2NR2 A;  2LXA A;  4AJW A;  1SE9 A;  3UQA A;  4B6W A;  2L0F A;  3CSF A;  4BOZ B;  4GDL B;  2I1K A;  1UD7 A;  3HM3 A;  5G2N A;  2L76 A;  2Z59 B;  3ZRC A;  1YIW A;  2C9W B;  1J19 A;  4LDT B;  1WM3 A;  2FNJ B;  2GBR A;  2KN5 A;  1K8R B;  3EEC A;  2K6Q A;  2MX2 A;  3IBE A;  4NJ7 A;  2MBH A;  2AL6 A;  3W1Y A;  3A9K A;  3QX1 A;  3APC A;  2N9E B;  2KFK B;  5CX3 A;  2ZVN A;  4W9F A;  4DWF A;  4IUM B;  4NAW B;  5C23 A;  4IC7 B;  2IO0 B;  1S3S G;  2WX0 A;  2KTR A;  2ZNV B;  1WY8 A;  4OVV A;  2BYV E;  4FBJ B;  4GB9 A;  2N9P C;  2XK5 B;  2ZEQ A;  4HCN B;  2ZVO A;  2JT4 B;  2AWT A;  3QCA A;  2MRP A;  3L13 A;  4W9I A;  4WWN A;  4HJK A;  4ZDV A;  4HPM B;  3P2B A;  3VUW A;  3R66 C;  2J0J A;  4I6N B;  4A3O A;  3Q3F A;  3B1L X;  3MJW A;  4MGK E;  1WH3 A;  4DHJ B;  2KKC A;  2DZM A;  3PHW B;  4B9K A;  3VAW A;  5EDS A;  2PJH A;  4GGQ A;  4HWI B;  2KD0 A;  1G6J A;  5E6N A;  3VQI A;  1ZGU B;  3V6C B;  1EF5 A;  3A33 B;  4HK2 A;  2C7H A;  5D2M B;  2D07 B;  3NZU A;  2DYB A;  1H4R A;  5FR6 A;  2KWC A;  1RRB A;  2KC1 A;  5HKH A;  1P1A A;  4W9D A;  3B08 A;  2IO2 B;  2JZ3 B;  3IG3 A;  2ZCC A;  3JSV B;  2HTH A;  4PS8 A;  1WXS A;  3QAQ A;  2L05 A;  1L7Y A;  4KZC A;  4KVG B;  4OVU A;  4CHK A;  3NS8 A;  2R2O A;  1V5T A;  1ZKH A;  5BO4 B;  2IO1 B;  5LXI B;  2IY1 B;  3OLM D;  3LJ3 A;  2LJ5 A;  2KQS A;  4XZ4 A;  1E8Z A;  2CR5 A;  3VUX A;  2J0K A;  2IO3 B;  1UZX B;  1P9D U;  3PVL A;  5CHV C;  1C3T A;  4I6P A;  5AZH A;  2YVC A;  3KUZ A;  5GMV A;  2ZZP B;  3L16 A;  4K81 A;  4N9F 4;  1WJ6 A;  2ZNV C;  4WJO A;  1WZ0 A;  2IZV B;  1WX9 A;  2NVU I;  4DXA B;  2N7D A;  2KDE B;  1R4M I;  4TV3 A;  3MHS D;  1KJT A;  2KTF A;  2V3S A;  1A5R A;  2L0T A;  5L83 A;  5J18 A;  1UEL A;  2MBE A;  3RZW C;  2GBJ A;  5DPW A;  3QC8 B;  1TZ1 A;  3EC8 A;  2O6V D;  4PYZ A;  1WX7 A;  3B0A A;  3PLV A;  4JGH B;  1JRU A;  1WGY A;  1XQQ A;  2PPH A;  5G55 A;  2KC2 A;  3QHT A;  4HXD A;  3UGB B;  4E3C A;  1AAR A;  3ZDM C;  3R3M A;  2BYE A;  3UQB A;  3ZTD A;  2O2V B;  3NHE B;  1J0G A;  3CF6 E;  4KSL C;  5E6O A;  3ZNG C;  3DVN U;  4MGI E;  2UWQ A;  5D6J B;  3RUI B;  4DBG A;  2GBK A;  3VTV A;  2FID A;  3TJP A;  2KX3 A;  2RR9 A;  4KIK B;  2WYQ A;  3EHV A;  4X57 B;  2M4N A;  1Q0W B;  2AL3 A;  2DZK A;  2A4Z A;  3H7P B;  2KFJ A;  1LM8 B;  2PEA A;  4GSW A;  1WE7 A;  4F1S A;  4ANV A;  1EO6 A;  3AXC A;  4GIV A;  4LJP B;  2N9X A;  2KO3 A;  1P3Q U;  3M95 A;  3RCZ A;  3WAM A;  2MP2 B;  4MEM A;  4FHK A;  4WWO A;  3N32 A;  4RM9 A;  2MSE D;  3DOW A;  3GOE A;  4LCD E;  2GMI C;  4TUU A;  1KLV A;  2WX1 A;  2MBB B;  3ZNH B;  1RLF A;  2BPS A;  2Z0D B;  3HM6 X;  4F7Z A;  2K8B A;  4KV2 A;  3PPA A;  2NBV B;  3DBH I;  5KHO A;  4IM0 A;  2HD5 B;  1RAX A;  3C0R B;  3L10 B;  1GUA B;  1XT9 B;  4BVU C;  3H7P A;  2MCN B;  3T8M A;  1WGD A;  5IA7 A;  3H1U A;  4BKG A;  2G4S A;  3GZN I;  1TBE A;  4TQ1 A;  3Q3J A;  1UH6 A;  4ZRJ A;  2WDT B;  2V1Y A;  3NY5 A;  4GOC A;  3OAW A;  2MP2 A;  2ZCB A;  1TGZ B;  4E74 A;  3VUY A;  3PRE A;  3RZF A;  1IPG A;  4RMA A;  2DAF A;  4BKS A;  1F9J A;  1I35 A;  2LZ6 A;  4MEL A;  2KWU B;  4FUL A;  2M0X A;  2LVO A;  1WE6 A;  2C5L C;  4FJY A;  4KDI C;  5J2R A;  3TIX A;  1RFA A;  1Q5W B;  2KLC A;  2CS4 A;  2EKE C;  2G4D B;  4AUQ C;  1NBF C;  3X0W A;  2IY0 B;  4KDL B;  4FA6 A;  5J17 A;  2MW5 A;  2ZPY A;  2DZJ A;  4IWO A;  2GBN A;  4GDL A;  4AWJ A;  3TCA A;  3SD5 A;  1EF1 A;  2MBQ A;  1VCB A;  1WX8 A;  2FAZ A;  2G45 B;  2ZJD A;  3KUC B;  1FXT B;  3QJZ A;  2L3Z A;  1J8C A;  4GMV A;  1WXA A;  3U30 A;  4MH0 E;  2DYO A;  4JL9 A;  2KFK A;  3QIJ A;  3KW5 B;  2DYM A;  1GC6 A;  4WWP A;  1E7V A;  4NQK E;  3M62 B;  4NAW A;  4ANW A;  2KJ6 A;  1BT0 A;  4ICV A;  4W9K A;  2IYD B;  3ALB A;  2CHZ A;  2LAS A;  2UYZ B;  2KWV B;  1YX5 B;  2XK5 A;  2NBW B;  1WIA A;  2FCN A;  2GOW A;  4W9J A;  1V6E A;  4URK A;  1YJ1 A;  2KDF B;  2LGD A;  2NCN A;  1E5W A;  3H7S A;  2G3Q B;  3U7D A;  3ZVV A;  2LGY A;  2B3A A;  4GN1 A;  5DCN A;  2RD0 A;  2ASQ A;  4GU2 A;  3D32 A;  4HDO A;  3DVN V;  3RUL A;  4RM8 A;  4EOY A;  1IYF A;  2JPH A;  1D3Z A;  1ZW7 A;  4MSM B;  2QHO A;  4EZL A;  4ZYN A;  1MG8 A;  4NNJ B;  3AU4 A;  1EUV B;  1WMH B;  2I1J A;  2REX A;  3QQ8 B;  5D94 A;  1M94 A;  2NS5 A;  3ML9 A;  3ZLZ A;  1V9J A;  5TR5 A;  3VTU A;  1V5O A;  2FCQ A;  3AI5 A;  4IM2 A;  3HK0 A;  5AZG A;  2JY6 A;  2KJH B;  3JSV A;  4WJP A;  4GDK B;  1WR1 A;  2KK8 A;  3A9J B;  4K7W A;  4LDT D;  3H9D A;  3ONS A;  1L2N A;  3QA8 A;  3ZO5 B;  1OEY J;  5CHW A;  3IFW B;  2K1F A;  3WA0 A;  4G0N B;  2FCM A;  3SHQ A;  3U8Z A;  2LI5 A;  3A1Q B;  3OJ3 A;  3DBS A;  4ANX A;  1WYW B;  2FCS A;  1WMH A;  4MGY E;  3AU5 A;  2KDI A;  2JWZ A;  2KJR A;  3BIN A;  3OJ4 B;  3EFU A;  3V60 A;  1C1Y B;  1NI2 A;  4DDG D;  2DHZ A;  3KUD B;  4ZRK A;  3L17 A;  2EMS A;  2KLG A;  3PV1 A;  4B95 A;  3L54 A;  5D7G A;  4I6L B;  3MTN B;  1VD2 A;  4NY0 A;  3ZIM A;  3DCG A;  2K25 A;  3NZS A;  5JZE B;  3N30 A;  2BKF A;  4HDQ A;  4M8M A;  3A9J A;  2FUH B;  2N1V A;  3R7Q A;  4MSQ B;  1UBI A;  4PS7 A;  2BKR B;  3ZNZ B;  1OGW A;  1ISN A;  2O2V A;  1T0Y A;  3DQV A;  4HCP B;  3WAP A;  3IVF A;  2BF8 B;  2RSU A;  1KM7 A;  1SGH A;  3VVW B;  5CHF A;  3I3T B;  4YL8 A;  2KHW B;  3H6N A;  3PZD A;  3VFK A;  2BWF A;  3BY4 B;  3KVF B;  3M63 B;  2JVC A;  4KIK A;  3WIM A;  3ZW3 A;  1Z5S B;  4JIO U;  2C7N B;  4W9E A;  3UIP B;  1LXD A;  3VXW A;  4E71 A;  3IHP C;  2AYO B;  4NJ6 A;  2C7M B;  3DBL I;  2IBI B;  3M3J A;  1P0R A;  4FJZ A;  4G50 A;  3PT2 B;  2YLM A;  4NQL B;  1LFD A;  3ZKJ C;  1YX6 B;  3KYC D;  2JZZ A;  3VH3 B;  4IG7 B;  4TKN A;  2JF5 A;  3KH0 A;  2KMC A;  2LGX A;  2KXJ A;  2XEW A;  3ZDT A;  5JH5 C;  3PSE B;  1WR6 E;  2M1M A;  4KSK C;  2RGF A;  3PHX B;  3DVG Y;  2DZI A;  5JHB A;  1I42 A;  1WXM A;  4BBN C;  2DX5 B;  2LUE A;  2KDB A;  2PE6 B;  4XX5 A;  1Y8R C;  2N7E A;  2LRU A;  2NPT B;  4F8C B;  2O6V B;  4ZRI A;  3PGE A;  1PQS A;  2JXX A;  4DHZ B;  1GJZ A;  2MWS B;  2BGF A;  2GBM A;  1WI0 A;  4JQW C;  4II2 B;  4K1R B;  1X1M A;  2LXC A;  3O65 B;  4BKT A;  4BBN F;  2K8H A;  3SU8 X;  1XD3 B;  3JVZ X;  2J7Q B;  3DBR I;  2OOB B;  1WRD B;  5DPT A;  4CO7 A;  3N3K B;  4IW0 A;  2D11 A;  1WF9 A;  2M8S A;  4WAA A;  4EEW A;  2EMT A;  4W9L A;  2PE9 A;  3APD A;  4PYU A;  1OQY A;  5JHA A;  2RPQ A;  4K7S A;  5LXH A;  1UGM A;  1HE8 A;  3UIN B;  2NPT A;  1CMX B;  3KYD D;  2O6V A;  4WQO B;  3VHT C;  2LVQ A;  3K9O B;  2LWP A;  2OJR A;  4JLC A;  3PRZ A;  4PS3 A;  2NBU A;  2HJ8 A;  3S2A A;  4FAD A;  3QWZ B;  1E8W A;  1OTR B;  1E8Y A;  2CU1 A;  2MLB A;  1WZ3 A;  4ASW C;  4BKS D;  1WFY A;  4M0W B;  1V81 A;  4HPL B;  1U4A A;  3SDL C;  2K6D B;  2M17 A;  3ENE A;  4NPN A;  3V6E B;  1V86 A;  4XC2 A;  1YQB A;  2MA9 B;  2CHX A;  2FIF A;  2D10 A;  2A5U A;  3TBL D;  2N1W A;  4MJS B;  5KHQ A;  2J0M A;  2LRW A;  4EZJ A;  3WAN A;  2BWE S;  2N4F A;  4EFO A;  3W1S A;  3ZNI D;  3X23 A;  4GXB A;  2V4L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...