5JH5C

Structural basis for the hierarchical assembly of the core of prc1.1
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
88
Chain Sequence
HSKAHYYRYDEQLNLCLERLSNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine-specific demethylase 2B
publication title KDM2B Recruitment of the Polycomb Group Complex, PRC1.1, Requires Cooperation between PCGF1 and BCORL1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein/transcription
total genus 22
structure length 88
sequence length 99
ec nomenclature
pdb deposition date 2016-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF16207 RAWUL RAWUL domain RING finger- and WD40-associated ubiquitin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5jh5C00
3APFA 2RPQA 3H7PB 4HJKA 2MCNB 3RYTA 1WH3A 1Q1OA 2EMSA 5DPRA 3L08A 3WAPA 2KVRA 1LXDA 3Q3JA 4IWQA 2C5LC 5CTRC 5JHBA 1E7VA 3T8MA 4KDIC 2FIFA 2AEHA 3VFKA 4EUTA 1P0RA 3RCZA 2AWTA 2KNBA 3PV1A 4FHJA 4JL9A 4HDQA 3UQBA 3HIZA 4W9HA 4E3CA 2ZPYA 5GMVA 3R66C 3SU8X 4II2B 1X1MA 2LASA 3APCA 3BINA 1V5TA 3PSEB 3H9DA 4MSQB 4DHJD 1GG3A 2MSED 1WM3A 2MWSB 2LUEA 2N9XA 2ZNVC 3DVGX 4FHKA 3A9KA 4ZRJA 3QARA 2HJ8A 2FNJB 2LWPA 1WGDA 5TR5A 3RD2A 2NCNA 3ZTCA 1EF5A 2NS5A 2ZCBA 4KSKC 2K1FA 3JVZX 1WGYA 3WIMA 1P9DU 1YD8U 3ZUNA 3SD5A 4RMAA 2L8JA 3W1SA 3VHTC 4ASWC 4MJSA 4DXAB 2K39A 4IWOA 4RM8A 2KJHB 3X0WA 1TBEA 4LJOB 2KJRA 3LDZE 4IWPA 1GJZA 1WMHA 2QHOA 1H8CA 4ANXA 4NPNA 5G55A 2Z0EB 5DPSA 4ZYNA 3L10B 2JUOA 2JXXA 4GDKA 4MGZE 4URKA 2D11A 4KIKA 3VAWA 1CMXB 1I35A 3DBSA 2Z59B 5DPWA 3TCAA 3QA8A 1AARA 5CHWA 1IP9A 2O6VA 3ZVVA 2KQ7A 2YVCA 1WE6A 4CHKA 4TQ0A 1TGZB 2KC1A 4GDLA 2ZEQA 2DHZA 2GMIC 4EZJA 4MGIE 1V9JA 3WAMA 3QX1A 1YX5B 5AZFA 3L13A 1WR6E 3A1QB 2M0XA 1KOTA 1GC7A 3L0WB 2DYBA 1E8WA 5C23A 2D2QA 4EZKA 2L7RA 3PREA 2XBBC 4GB9A 3QCAA 1Z5SB 4PS3A 4BVUC 2V4LA 3KW5B 1P3QU 5J18A 2ZVOA 4AJWA 3WALA 3OAWA 4KV2A 2O2VB 3U8ZA 3RZWC 1WRDB 4AWJA 5IA7A 4WQOB 2AL6A 2CHWA 2M8SA 4WAAA 1E8XA 1Q5WB 2N1VA 4X57B 2C9WB 2G45B 1Z2MA 2D07B 4MELA 2M17A 4TUUA 3N32A 2I1JA 3R7RA 4PYZA 3ZNHB 2LVOA 2GBMA 1VD2A 4IM3A 1LM8B 3QIJA 3B08A 5DCNA 4G0NB 1OEYA 4FJZA 4GXBA 4MGKE 3ZIMA 2LRWA 4JLCA 2LXAA 2J0MA 2MQJA 2KC2A 3CMMB 3KYDD 4M0WB 1E8YA 4NY0A 2L76A 1WX8A 4EEWA 1R4MI 2MBQA 2BKFA 2LVPA 4BBNF 2BYFA 1IYFA 3TL5A 4LDTD 3PHXB 4NJ7A 2MP2B 1UBIA 2XK5B 4ICVA 3TJPA 2KANA 1WJ6A 4NJ6A 4MDKE 1WF9A 3CF6E 2RR9A 4FLHA 4A20A 4IG7B 2WX0A 2KQSA 1OTRB 1S1QB 5L95C 2KDBA 3IHPC 2NPTB 3ZNZB 1C1YB 2ZNVB 3DPDA 1WYWB 3WA0A 4HK2A 2BF8B 2C60A 4FADA 1TZ1A 4GN1A 2N7DA 2KTRB 4FJVB 3KYCD 4WJPA 2J0JA 3NY5A 2DZIA 1P1AA 1PQSA 3L16A 3UIPB 2DZKA 3B1LX 3JW0X 2KMAA 4ICUA 1A5RA 4HCPB 1XT9B 3X23A 4FBJB 1SE9A 2GBNA 3ZLZA 4MM3A 1WXVA 4NAWA 4ZRKA 2KMCA 4ZDVA 2FCNA 3VH4B 1WJ4A 3I3TB 4KZ0A 1GNUA 2O6VD 4W9CA 2R2QA 4MJSB 2G4DB 3CSTA 3NOBA 2MA9B 1VCBA 3ZTDA 2LRUA 3QC8B 3ZNGC 4LCDE 3RZFA 1C3TA 4F7ZA 2REXA 2MBEA 1WMHB 2EMTA 2PE6B 3U7DA 2JZZA 2DX5B 3VDZA 4GDKB 2KN5A 2NR2A 3D32A 4KIKB 4GU2A 1YIWA 2RGFA 4FULA 1WI0A 4DDID 3B0AA 3VUYA 1L7YA 1HE8A 3KUCB 2I1KA 3PVLA 4WWOA 2MW5A 3N3KB 2JY6A 5KHOA 4MSMB 3V62A 4DHJB 2LGYA 2G4SA 2MBOA 3W1SC 3ALBA 3DBHI 2FCQA 2K8CA 3NHEB 3L54A 2D10A 3PRPB 3A4SC 2KTFA 4G50A 3S2AA 4G3XB 1RRBA 2MRPA 3KVFB 5D7GA 3H1UA 5E6PA 4HLEA 3VXWA 1D3ZA 3NS8A 3V6CB 3UF8A 1UELA 3R3MA 3U30A 2C7NB 3V61A 2JRHA 3PS6A 5JH5C 1WX9A 4W9FA 4PS7A 2XEWA 4GMVA 4FJYA 3T9LA 1ISNA 1T0YA 3M63B 4J6IA 2JPHA 3VUXA 1S3SG 2NVUI 4GSWA 1EUVB 3DOWA 2FCSA 1TTNA 2CS4A 2KD0A 2CHXA 2CR5A 3ZDMC 4P7IA 3GZNI 2L05A 3EHVA 3Q3FA 3KUZA 2ASQA 1KM7A 1NDDA 1BT0A 5D94A 1WX7A 4II3B 2GOWA 2HE7A 3A9JA 3CSFA 1ZKHA 2DAFA 4CO7A 5JHAA 4KDLB 1WE7A 4HPLB 1J0GA 2ZZPB 2EKEC 1WIAA 2FUHB 2IY1B 3QK0A 3C0RB 4WJNA 1L2NA 2IO0B 2JVCA 2VRRB 2L0FA 1WXSA 2LGXA 3V60A 3PHWB 3A33B 3QQ8B 3RT3B 2PPHA 4BKSA 2KDEB 1LQBA 4PYUA 4WJQA 3OJ3A 4W9LA 5CHVC 1J19A 4MGYE 5AZHA 2K6DB 2R2OA 2MBHA 2KWCA 1XQQA 2DYMA 4KSLC 1WJNA 4B9KA 4W9EA 3M3JA 1J8CA 2JZ3B 2AL3A 3KH0A 4I6NB 3UINB 2IZVB 2WWZA 3A1QA 3K9OB 4ANVA 2LGDA 5E6NA 2LI5A 1E5WA 1XD3B 1WGGA 5CX3A 2D3GA 3DBRI 5HKHA 4MEMA 5J17A 2DAJA 2KDFB 2N9PC 2DZJA 3RUIB 2W9NA 1V86A 5CHFA 3WAOA 3PTFC 2JRIB 1ZW7A 2O2VA 4K1RB 3HM6X 4W9DA 2DENB 3OJ4B 2IO1B 3H6NA 3VQIA 2JWZA 2WX1A 3HK0A 4KZCA 3QHTA 1F9JA 5LLIA 5G2NA 4PS8A 5C1ZA 1RLFA 3GOEA 1R4NI 1KJTA 2ZJDA 2KX0A 1MG8A 1WGRA 4NAWB 2LZ6A 3PLVA 3JYUA 1WXAA 4A3OA 1RFAA 1UZXB 1WGHA 3PZDA 2ZPNA 3TIXA 3MJWA 2KWUB 5L83A 1WFYA 1E7UA 2GBJA 2FCMA 3VTVA 5D6JB 5LXHA 2FIDA 4E74A 4LDTB 2Y5BB 3A9KB 3MTNB 3PT2B 4K81A 1IPGA 2KFKA 2M1MA 2ZVNA 3VVWB 4AUQC 1EO6A 3LJ3A 4W9GA 4HCNB 2GBKA 2MBBB 4JGHB 4WJOA 2Z0DB 1G6JA 3AU5A 5J2RA 5LXIB 1WM2A 2K6QA 3EFUA 4B6WA 2BWES 4WWPA 3W1YA 2CHZA 1K8RB 2JF5A 2KLGA 2MP2A 2XK5A 3JSVA 4XC2A 4BBNC 2KWVB 4F8CB 2KLCA 4W9KA 4F1SA 4K7WA 4GIVA 1Y8RC 3PRZA 3DVNV 2KKCA 2K8HA 2IO2B 2N4FA 1ZGUB 3N30A 4RM9A 4TV3A 2BYEA 2NPTA 3AXCA 4HDOA 5JZEB 2KFJA 3ML8A 4M8MA 3HM3A 2LJ5A 1H4RA 2KOXA 2UYZB 3IVFA 3WANA 3H7PA 1V81A 1V2YA 2NBWB 2KTRA 2YLMA 4XX5A 3HHMA 4W9JA 5AEKB 3TMPB 4DK5A 1KLVA 4KVGB 2IYDB 2L3ZA 4DHZB 2CU1A 4DHZE 4HVBA 1FXTB 2C7HA 2O6VB 3DCGA 1WY8A 3PLUA 1GC6A 2K25A 2PE9A 3OLMD 4GDLB 3ZW3A 4ANUA 4BOSC 2FAZA 5AZGA 3ZDTA 3DQVA 4JQWC 2PEAA 4LJPB 1JRUA 5FR6A 4BKSD 2ZCCA 4N9F4 2K8BA 3VTWA 4ANWA 4TKNA 2DYOA 2RSUA 3SHQA 3A4RA 1V80A 2C7MB 4JIOU 1E90A 3RULA 1YJ1A 4BFRA 4NNJB 2BYVE 2DZMA 3IFWB 3EECA 2OOBB 1V6EA 1WZ3A 4EFOA 1RAXA 2BKRB 3ML9A 2KX3A 3ONSA 3A9JB 3PGEA 3H7SA 1UBQA 4GOCA 4I6LB 4BKGA 1SIFA 4HWIB 1YQBA 2IBIB 2L0TA 2RD0A 3UGBB 3KUDB 1I42A 4HPMB 2A4ZA 3PRMB 3ZO5B 1NI2A 1WXMA 3DVGY 1LFDA 1WJUA 2MX2A 5EDSA 1EF1A 1WR1A 2BGFA 2M4NA 5IAAC 2KK8A 3ZRCA 2AYOB 3AULA 4CYEA 2KO3A 3K9PB 3ZRFA 3IG3A 1V5OA 3M95A 3M62B 4IM2A 1M94A 2V1YA 3DVNU 1OQYA 3APDA 3TBLD 4BKTA 5KHQA 1WZ0A 3EC8A 4AJYB 1P98A 2V3SA 4HXDA 4DBGA 2NBUA 4EOYA 1GUAB 2N7EA 4AOFA 4IC7B 4B95A 3UIOB 4M8NA 4DDGD 3ZNID 2N1WA 4A3PA 4W9IA 2NBVB 3O65B 4OVUA 3R7QA 1YX6B 2L00B 3P2BA 2WDTB 4IUMB 4NQLB 3AU4A 4IW0A 4K7UA 1SGHA 1UD7A 3SDLC 4TQ1A 2JT4B 3IBEA 4BOZB 1OGWA 2A5UA 2PJHA 2LXCA 5D2MB 2CKHB 4G11A 2KJ6A 3V6EB 3VUWA 3DDCB 4WWNA 1QZEA 4E71A 2B3AA 4IM0A 4XZ4A 2WYQA 2LD9A 5BO4B 3NZUA 3QJZA 3VTUA 2OJRA 2UWQA 2HTHA 3AI5A 2KFKB 2HD5B 3DBLI 3ECIA 4I6PA 4DWFA 2BPSA 4EKUA 2J7QB 2IO3B 3ENEA 3L17A 4FN2A 2GBRA 4ZRIA 3QWZB 2IY0B 4MH0E 4YL8A 4EZLA 3PPAA 2LVQA 2KHWB 2N9EB 1NBFC 2KZRA 2J0KA 3MHSD 1UGMA 2KDIA 3NZSA 2KXJA 4GGQA 3JSVB 2G3QB 3QAQA 1E8ZA 4FA6A 4OVVA 4K7SA 5DPTA 1U4AA 5E6OA 2MLBA 3UQAA 3VH3B 3BY4B 4AP4C 4NQKE 1Q0WB 3ZKJC 1UH6A 1V49A 1OEYJ 2BWFA
chains in the Genus database with same CATH superfamily
5EE0A 1R4MB 1Q1OA 5DPRA 2KVRA 4IWQA 2C5LC 4P1CC 3T8MA 3AE1B 5HFYA 3VFKA 1P0RA 3RCZA 3PV1A 4FHJA 4HDQA 3AB5A 3SU8X 2LASA 3H9DA 4MSQB 2MSED 2MWSB 4A90A 3A9KA 4ZRJA 2V0GA 2MJDA 2TSSA 4K3BA 1DGJA 2NS5A 2L8JA 3TEZA 2K39A 4IWOA 4RM8A 2KJHB 1TBEA 3P63A 4LJOB 2KJRA 1H8CA 1WMHA 2QHOA 1YJIA 4A55A 4MGZE 1J7CA 2D11A 1I35A 3DBSA 2Z59B 1FFUA 3QA8A 2O6VA 3ZVVA 4TQ0A 2YVCA 2WXRA 3V3XA 1KFYB 5AZFA 1XO3A 1GC7A 4K3CA 1NENB 2W3RA 3P1MA 5C23A 4EZKA 2L7RA 2JYEA 2X8XX 4GB9A 3QCAA 4WURA 2BVCA 2ZVOA 2WXQA 3DWGC 4AJWA 3OAWA 3U8ZA 3RZWC 4AWJA 2DLBA 2K3UA 4S17A 2M8SA 1JWBD 1E8XA 2RMMA 2D5GA 1C9FA 4X57B 5C2TB 3SR6A 2PKOA 4CQNA 3T3OA 2M17A 4TUUA 1V8CA 3N32A 3R7RA 1VD2A 3AV8A 3QIJA 3B08A 4FJZA 1OQRA 1HEZE 4M00A 3CMMB 3KYDD 4NY0A 2L1AA 4US8A 1F77A 4M02A 1DOIA 2RDGA 2MP2B 4JPSA 5IN7A 1JRPA 1OTRB 1S1QB 1FPYA 1XLOA 4HK2A 2BF8B 4GN1A 2KTRB 4FJVB 3EUB2 2WXOA 1PQSA 1YJJA 3L16A 2VH1A 3I5JC 2DZKA 3W2DA 2KMAA 1MI0A 1TS4A 2GBNA 2FCNA 2JZPA 3TSSA 1GNUA 2O6VD 3RFZB 2R2QA 1MG4A 3NOBA 2MA9B 1VCBA 3TEYA 2PIAA 4LCDE 3RZFA 1HZ5A 2MBEA 1R7SA 2G1EA 3MFGA 4WQMA 2NR2A 2EELA 3D32A 4NJCA 3AM9A 2WXHA 3VUYA 3BVMA 1L7YA 2WXJA 1HE8A 1L5PA 3R2IA 2I1KA 3IT6B 5KHOA 2G4SA 1L4DB 3NHEB 3S2AA 1RRBA 2MRPA 5E6PA 4PT5A 2KMMA 4HLEA 3U30A 3RNCC 5JH5C 4W9FA 4FJYA 4LNIA 4QAYA 1ISNA 2FCSA 1YNTE 4C56C 1TKEA 2CS4A 2CHXA 2MH7A 3GZNI 3EHVA 2HE7A 1SXTA 2WXNA 3ZQ4A 2QCZA 2BW2A 1WIAA 2FUHB 2IY1B 3QK0A 3C0RB 4LNNA 3VR8B 4TMAB 1WXSA 2LGXA 4OVZA 3V60A 3QQ8B 3RT3B 4BKSA 1ZE3D 3BK2A 2YEPF 3Q8FA 1JCKB 2K6DB 1ZUD2 1XQQA 4KSLC 1WJNA 4HEA1 1J8CA 4W9EA 3M3JA 3U52E 3KH0A 2WWZA 1MHXA 5E6NA 4C4VA 1SE4A 4UDUC 2D3GA 1ET9A 3DBRI 4MEMA 3WAOA 2O2VA 4W9DA 1GB4A 3OJ4B 1JROA 3VQIA 1E0ZA 1MHHE 5LLIA 5G2NA 4PS8A 1RLFA 1R4NI 4YXDB 1HZ6A 4MM3B 2KX0A 4NAMA 3PLVA 3JYUA 1RFAA 1AW7A 1C79A 1WGHA 2ZPNA 3MJWA 1QILA 2Y5BB 3A9KB 3MTNB 2KFKA 2M1MA 4AUQC 3DHHC 1EO6A 1STEA 4RGMA 1IGCA 2GBKA 4WJOA 1NYRA 3EFUA 2BWES 3SFEB 3JSVA 2KAJA 4YTNB 4BAXA 4BBNC 2KWVB 2KLCA 5EE9A 4GIVA 2N9LA 3DVNV 1FRRA 2K8HA 3N30A 4RM9A 5HG2A 1XEEA 3AXCA 5JZEB 1XLNA 2UYZB 1V2YA 2MJEA 1XCTL 2QIEB 2IYDB 2L3ZA 5D3DA 4HVBA 2O6VB 2WP9B 1QOGA 2K25A 2PVOD 4BOSC 2OJWA 5AZGA 1FNWA 5FR6A 1TS5A 4BKSD 2QILA 2ZCCA 2K8BA 2Z8LA 3SHQA 2C7MB 4ZHOA 1E90A 5T8IA 2DZMA 2R61A 1WZ3A 3KLSX 3MC8A 4P1BC 1RAXA 3ML9A 3ONSA 4P16A 4C00A 2K0PA 2GB1A 3P4QB 3MJ5A 1YQBA 2IBIB 2L0TA 3UGBB 5IKCM 1I42A 1VZ6A 2A4ZA 1NI2A 2CU3A 1LFDA 1WJUA 3KWVA 2KQ4X 1EF1A 1SE3A 1I4HA 3ZXRA 2OHFA 4CYEA 3M62B 1VRAB 3L4PA 4USAA 2V1YA 1J7BA 1EM7A 3EC8A 1SE2A 1ZXIA 4HXDA 2I2YA 4EOYA 4GLSC 1JWUD 2LFIA 4IUMB 2WDTB 3H8HA 4NQLB 1TJEA 1FIQA 4TQ1A 1GB1A 3DDCB 4E71A 1V97A 2MEKA 4XZ4A 2LD9A 3NZUA 3QJZA 1LO5D 3AN1A 4I6PA 3VRAB 4FN2A 1N60A 2IY0B 4YL8A 4EZLA 2KHWB 1NBFC 3MHSD 2J0KA 1RYJA 1UGMA 2K5PA 4OVVA 2IGHA 3ZKJC 3R2TA 3APFA 4JX1C 4P6VF 2WXGA 4HJKA 2MCNB 3RYTA 3DBRB 5CTRC 2LGSA 5LNK1 1E7VA 1L6UA 4KDIC 3U2SC 1L0YB 4EUTA 2Y5PA 2FUG1 2HJ1A 2HDEA 2PTLA 1D5XC 3UQBA 4TSSA 4YTPB 2RDBC 2ZPYA 4II2B 1X1MA 3APCA 3BIID 3V05A 2LUEA 3QARA 2HJ8A 1T3QA 5TR5A 2ZCBA 1WWTA 3JVZX 3ZUNA 3WIMA 1YD8U 2V3NA 4ASWC 3BYYB 4DXAB 3BZDB 3LDZE 4ANXA 4NPNA 5IOIA 1XF5L 2JXXA 3KQ4A 4OHJA 1AARA 3AEGB 4CHKA 1IP9A 1C76A 3GE3C 1TY2A 2QC8A 4GDLA 3L13A 2QMTA 1KOTA 1NI3A 3L0WB 2DYBA 1E8WA 3EA6A 1PGXA 1SJED 3PREA 4KV2A 2O2VB 2XN9C 1N6ZA 3UI3A 5IA7A 2BB6A 1T6BX 2CHWA 2N1VA 2C9WB 4KGSA 4MELA 1J7AA 1RWSA 1PFDA 2GBMA 1KLUD 1YQ4B 1UF0A 1OEYA 2LRWA 2LXAA 2MQJA 4M0WB 1E8YA 2DBYA 4BBNF 2BYFA 3TL5A 4LDTD 2BTEA 3PHXB 4NJ7A 3MP9A 3TJPA 4MDKE 3CF6E 2RR9A 4A20A 2WX0A 2KQSA 3Q6BA 1UNSA 2ZNVB 3N9YC 1WYWB 2C60A 4H2AA 1IBXA 2WXLA 2J0JA 1FD6A 5FR3A 3B1LX 3JW0X 4ICUA 4HCPB 4N58A 3X23A 1FNVA 3FILA 1QKZA 4MM3A 1WXVA 1WJ4A 3I3TB 1ESFA 4MJSB 2G4DB 4NZLB 3CSTA 2INPE 3ZTDA 1EWYC 3FAHA 2X38A 1EU4A 1M4VA 3U7DA 1YQ3B 1ROEA 3J9CA 1PUTA 3BVGA 3AMZA 1YIWA 2RGFA 3B0AA 3RNEC 2MW5A 4J3OD 2WXIA 2LGYA 2MBOA 2DNFA 3W1SC 3ALBA 3DBHI 1B1ZA 2FCQA 1MJDA 2KTFA 4G50A 3P4RB 3KVFB 1FEHA 1ACCA 4MACA 3VXWA 3V6CB 5C3JB 3R3MA 4ZRPA 2UU7A 1E6EB 1QT9A 1V1PA 4GMVA 1OQQA 3T9LA 1F2RC 1T0YA 3VUXA 2JPHA 1S3SG 4GSWA 3DOWA 3RPFC 2KD0A 3ZDMC 4P7IA 1UWMA 3KUZA 1BT0A 2M0AA 2IGDA 1TS3A 1ZKHA 4KDLB 2WDRB 4YSYB 1ZPSA 3SEBA 3AEDB 1FCLA 3TEXA 2LHEA 2ONQA 2JVCA 2VRRB 4YWGG 3PHWB 3A33B 2PPHA 2I38A 5AZHA 2KWCA 4Q2JA 3R8BA 2CJOA 4B9KA 1BUIC 2AL3A 3UINB 4I6NB 4A6QA 3A1QA 5D3IB 3P42A 5HKHA 2RDHA 1I4QA 3N20C 2W9NA 4MT5A 3PTFC 1ZW7A 3HM6X 3OWEB 2KACA 2V4IB 2JWZA 4L2YA 1F9JA 1MG8A 2WU2B 1WXAA 3NRZA 3TIXA 1AYFA 1WFYA 1E7UA 2GBJA 2FCMA 2FIDA 4LDTB 5H92C 4K81A 3PT2B 1IPGA 4RFBA 3VVWB 2GLSA 4US9A 3LJ3A 4W9GA 4HCNB 2LMCA 2Z0DB 3DBLB 5LXIB 4S0RA 3W5VB 2QJLA 3W1YA 1K8RB 2XK5A 4F8CB 4F1SA 4W9KA 1VJKA 4K7WA 1I4RA 3TUOA 1ZGUB 4TV3A 1TYGB 4HROA 2BYEA 2NPTA 3HM3A 1H4RA 3RMKC 1RFKA 2KOXA 3WANA 1YMHE 1V81A 1UUPA 1AWDA 4XX5A 3HHMA 4DK5A 1KLVA 4DHZB 2CU1A 2C7HA 2LHDA 4D2KA 1UWXA 4ARCA 3OLMD 3ZW3A 2WXMA 4GDLB 2FAZA 4C7YA 4JQWC 2PEAA 3B2GA 4RF1A 1BMLC 2INDC 2BB5A 4TKNA 2DYOA 2G9HD 2RSUA 4RF0A 2JSVX 1YJ1A 3MC9A 2OOBB 4EFOA 1Q10A 3A9JB 3PGEA 1UBQA 4GOCA 2RD0A 1MPEA 1I7HA 4XYCA 5IO9A 3B2FA 3AE3B 5EDSA 2M4NA 5IAAC 3FC4A 3ZRCA 2AYOB 3M95A 4KKIA 2WDVB 4IM2A 4XDCA 2H88B 3TBLD 4BKTA 1WZ0A 3AE4B 4AS1A 1F0ZA 2DWQA 1FM0D 3I57A 1L6VA 2INNE 4IC7B 4B95A 3ZNID 4ZYSA 2ZW1A 4A3PA 4OVUA 2ICIA 3R7QA 1L0XB 2L00B 4IW0A 1TY0A 4K7UA 2SEBD 2IGGA 3IBEA 2N9KA 1A70A 1OGWA 2PJHA 2LXCA 1IBXB 1FCCC 4HKZE 4WWNA 4PK1A 4IM0A 3ZJUA 1YN4A 2HTHA 3HUIA 3FILB 4ZRIA 1K53A 1HQRD 4MH0E 2KZRA 3MC0B 4OZBA 4FA6A 1T0QC 4OZAA 2ZW0A 1NVID 1U4AA 5E6OA 2MLBA 1MVKA 4M0WA 3VH3B 1T0SC 1Q0WB 1FMAD 1V49A 2BWFA 3NZ3A 1F2RI 3H7PB 1WGKA 1IUEA 2EMSA 3L08A 3WAPA 3PZ8A 1LXDA 1ZOYB 4FXCA 2AEHA 2RPVA 1DOYA 2AWTA 4JL9A 3HIZA 1N62A 4M01A 4E3CA 5H8YE 3NS1A 1V5TA 4DHJD 1KLGD 1C77A 1WM3A 4FHKA 3DVGX 1P7FA 2LWPA 1V1PB 2NCNA 4KGTA 3RD2A 1EF5A 4KSKC 2BS3B 2K1FA 1WGYA 3SD5A 4RMAA 3VHTC 4MJSA 2BT6A 4OZCA 1HXYD 3X0WA 4WIPA 3W5UB 2BQQA 1N63A 1GJZA 3GS2A 3PO0A 2Z0EB 5DPSA 2WNMA 4ZYNA 3L10B 1E10A 1VDVA 2AX5A 4WH4A 1WE6A 3Q8CA 1TGZB 2KC1A 1SBBB 1SEBD 4EZJA 1V9JA 1YX5B 1WR6E 3A1QB 2M0XA 2FE8A 4DXGA 2D2QA 3Q2AC 1SB3C 2XBBC 3NVYA 2V4LA 3KW5B 1P3QU 3WALA 4WQOB 3P4SB 1OFFA 1P7EA 4WAAA 1TS2A 1Q5WB 2ACZB 3E56A 2D07B 3GZNB 1ENFA 2LJIA 2QEJC 4PYZA 1K51A 1LM8B 5DCNA 4GXBA 4MGKE 5JXVA 2KVZA 4JLCA 2J0MA 2KC2A 5GXGB 2L76A 3LYYA 2JX5A 1R4MI 4EEWA 2AQ3B 1FFVA 2BKFA 2MBQA 4EE2A 3WCQA 1K52A 1WRIA 2XK5B 1YN3A 2KANA 3Q8AA 4NJ6A 1WF9A 3RN9C 4IG7B 2WDQB 2J53A 5L95C 2NPTB 3ZNZB 1C1YB 4WAFA 3CIRB 4A8XC 4R3DA 2N7DA 4WJPA 2PLPA 1XCQL 3NY5A 1P1AA 5BYRA 1WYGA 3ZXVA 4ZRKA 3AEAB 3VH4B 3GB1A 1R4NB 3N1ZC 4OW0A 3DWMA 2VZKB 1C4AA 1PYWD 4JWUC 3ZNGC 1ZP0B 2REXA 2EMTA 2IDYA 3BK1A 2PE6B 4GDKB 2W55A 4KIKB 4FULA 4YSZB 1WI0A 4DDID 3PVLA 3BVZA 3U7ZA 4RNAA 2JY6A 4DHJB 2K8CA 3L54A 2D10A 3PRPB 3A4SC 2JYTA 1TT5B 3LXFA 4G3XB 5D7GA 2JRHA 3Q3MC 2JQRB 2LGIA 1JQ4A 3M63B 2NVUI 1LGRA 1D4BA 2N0SB 3HVZA 1TTNA 1N5WA 2CR5A 1DOXA 3I9V1 4LNFA 3Q14C 2L05A 2N7JA 2NTTA 1KM7A 2OEDA 3ABVB 5I4DA 1NDDA 4II3B 3A9JA 2V9HA 4HPLB 2ZZPB 2EKEC 4WJNA 2BBCA 2IO0B 2L0FA 4WJQA 4ACFA 5CHVC 1J19A 2R2OA 2MBHA 2DYMA 1Y56A 4YSXB 3O13A 2JZ3B 2PVGC 2IZVB 1XXGA 2LI5A 1BXTA 1E5WA 1HTQA 1WGGA 4HRSA 5CX3A 2DAJA 2KDFB 3AE5B 2JRIB 4K1RB 3E9SA 2DENB 2D3CA 4L23A 2J52A 4C80A 3NJTA 4RGNA 3HK0A 4KZCA 4AQ7A 1V1OA 5C1ZA 5BMIA 1KJTA 2ZJDA 4NAWB 2LZ6A 4A3OA 2Y5CA 1UZXB 2QDFA 4ZOHC 2KWUB 5L83A 4N6EB 4XDDA 4BZAA 5LXHA 4E74A 4LNOA 1ZXHA 2M56B 5TSSA 3RNGC 5EE1A 2MBBB 4JGHB 1G6JA 5J2RA 1WM2A 5MPOA 4WWPA 2CHZA 1FXAA 3ZYYX 1N61A 2W3SA 3N1YC 3PRZA 2N4FA 2IO2B 3Q8EA 3AE6B 2KFJA 2LJ5A 4LNKA 3H7PA 2YLMA 4W9JA 5AEKB 3TMPB 4KVGB 4XWTA 3DCGA 3IXSA 1JWSD 3ZDTA 3DQVA 4LJPB 1KRHA 1JRUA 4N9F4 3VTWA 1AN8A 3SFDB 1QOFA 2H89B 4XE0A 3Q8BA 4JIOU 3FKYA 5HHDG 4REZA 2BYVE 4IDIA 1CQVA 1KH0A 1TKGA 2BKRB 3PZ7A 1T0RC 2M19A 5BYSA 3H7SA 2WS3B 1SJHD 4JWSC 2QSDA 1SIFA 4HWIB 2ON8A 3KUDB 3OG5A 1QOAA 3PRMB 3ZO5B 3DVGY 2KDMA 2MX2A 2WHIA 1L4ZB 2BGFA 2KK8A 3AULA 1XLPA 3K9PB 3IG3A 2IPKD 1KTKA 2MHJA 3APDA 5KHQA 3NVVA 5BMGA 4AJYB 2NMQA 1P98A 3NVWA 2NBUA 1WXQA 2FBWB 2N7EA 4M8NA 2N1WA 2NBVB 3P2BA 3AECB 3CWIA 1SGHA 1UD7A 3SDLC 4XGAB 2CKHB 1IGDA 3DHIC 2B3AA 5BO4B 3VTUA 2UWQA 1GAQB 3ECIA 4DWFA 2BPSA 3ENEA 1T5XD 3QWZB 4DQOC 1TZOA 2B76B 3NZSA 4GGQA 2G3QB 2CJNA 1GPXA 4K7SA 5DPTA 1WSPA 3UQAA 3RNBC 4JE3B 1VZ7A 4AP4C 2BS4B 1OEYJ 3UF8A 3V61A 2K9XA 2RPQA 1WH3A 2WQYB 3Q3JA 5JHBA 3IT4B 1JWMD 1D5ZC 2FIFA 2NTSA 3C8YA 2KNBA 1I4XA 4W9HA 5GMVA 3AE9B 3R66C 3BINA 3PSEB 4ZRQA 3RNAC 1GG3A 2ZNVC 2N9XA 3I63C 1ET6A 3W9CB 1K50A 2FNJB 1WGDA 3ZTCA 2Q5WD 3AE7B 1P9DU 1MFWA 2LUMA 3W1SA 1CK1A 3NG0A 4IWPA 3LB8C 4N59A 5G55A 2EKIA 3DHGC 2JUOA 4GDKA 4URKA 3RI7C 4KIKA 1VZ8A 1CMXB 3VAWA 2SAKA 5DPWA 3TCAA 5CHWA 5AUIA 1FNUA 2KQ7A 2ZEQA 2DHZA 2GMIC 3ZJVA 4MGIE 3WAMA 3QX1A 4RGTA 3DBHB 2GRIA 1TKYA 4YT0B 2KYWA 2BS2B 2WLBA 2L32A 2W82A 4PS3A 4BVUC 5J18A 1Z5SB 3MHZA 1JALA 2KN4A 1WRDB 2JU6X 2AL6A 3EFCA 2G45B 1Z2MA 2LEKA 2I1JA 3ZNHB 2LVOA 4IM3A 1SF0A 4G0NB 3ZIMA 2BYTA 1D5MC 1PDXA 5G5GA 3ETRA 4RGOS 1WX8A 4LK0M 4HKQA 2LVPA 1IYFA 1FXIA 1JMLA 1UBIA 4ICVA 1WJ6A 3C19A 4HPPA 4FLHA 4XWWA 2KDBA 3IHPC 3DPDA 3WA0A 2VZKD 4FADA 1TZ1A 4ARIA 3KYCD 3HRDD 1JWAD 2DZIA 3VRBB 1I4GA 3KWLA 1GOZA 3UIPB 1A5RA 5BYQA 1XT9B 4FBJB 1EU3A 1SE9A 3ZLZA 1PGBA 4NAWA 4ZDVA 2KMCA 4KGRA 4KZ0A 4W9CA 5HI1A 1I4PA 3B9JA 3VR9B 3AE2B 2LRUA 1L0VB 3QC8B 1C3TA 4F7ZA 1ZDXA 2KT7A 5G5HA 1WMHB 1VLBA 3IAS1 3NVZA 2JZZA 2DX5B 3VDZA 1C4PA 2IJ0A 2KN5A 4GU2A 3TEWA 1D6EC 2KWDA 3KUCB 4WWOA 1KF6B 3N3KB 3V62A 4MSMB 1C78A 1N5XA 3NUHB 3H1UA 4IKGA 5AUKA 1D3ZA 3NS8A 4KKJA 1UELA 2C7NB 3PS6A 2D3AA 1WX9A 1QF6A 4PS7A 2XEWA 1HA5A 4J6IA 1SSNA 5E6JA 3HVDA 1EUVB 1QQRA 4ZHPA 2JXTA 3GE8C 2WXFA 3Q3FA 2ASQA 2L52A 1JW9D 5D94A 1WX7A 2GOWA 3CSFA 1FO4A 2DAFA 4CO7A 5JHAA 1WE7A 1J0GA 2YEPB 1L2NA 2PMVA 3AEBB 2KDEB 1LQBA 4PYUA 3N1XC 3OJ3A 1C4CA 4HJGE 4W9LA 1CJEA 3AEEB 4MGYE 2WXPA 2VH2A 3Q69A 1SIJA 3K9OB 4ANVA 4DXFA 2LGDA 1B9RA 1XD3B 5J17A 3ZGZA 2D3BA 2N9PC 2DZJA 1F1HA 3RUIB 1V86A 5CHFA 4WWMA 2INCC 4B0MA 4YTMB 2WU5B 2IO1B 4RH6A 3H6NA 2WX1A 3U4EG 3QHTA 3GP7A 3GOEA 3EGRA 4MH8A 1WGRA 4O1NA 3BWUD 2PW9A 1RM6C 3PZDA 2WGSA 3VTVA 5D6JB 1VR9A 2ZVNA 4RCOA 2WXKA 1PGAA 3AU5A 1YN5A 2K6QA 1E9MA 4B6WA 2JF5A 2KLGA 2MP2A 4XC2A 1QLBB 3IAM1 4KX6B 1Y8RC 2KKCA 3Q3NC 4HDOA 3ML8A 4M8MA 3IVFA 2NBWB 2KTRA 2J42A 3RNFC 5FKAC 2JWUA 5BMHA 4L1BA 4DHZE 1FXTB 3PLUA 1WY8A 4LTUA 1GC6A 2PE9A 4IOIE 4ANUA 1CZPA 5FK9C 4ANWA 2E3TA 3A4RA 1V80A 2V3PA 3RULA 4A9AA 2AQ2B 4NNJB 4BFRA 2L83A 3IFWB 3EECA 1V6EA 2AQ1B 3ZJTA 4LLGM 2KX3A 1NYQA 4BKGA 4I6LB 1XLQA 1QOBA 1NEKB 4HPMB 1WXMA 3BYTB 1WR1A 3AEFB 4B0EA 2KO3A 3ZRFA 1V5OA 1M94A 3DVNU 1OQYA 2V3SA 1F52A 1ZDVA 4C4VB 3P4PB 4DBGA 4C7ZA 1GUAB 2Y3AA 4AOFA 2K22A 3AH7A 3UIOB 4DDGD 4W9IA 3O65B 2MJ3A 1YX6B 2E6XA 3AU4A 1TIFA 3AE8B 2JT4B 4BOZB 2HTME 2A5UA 5D2MB 4G11A 2XNAC 2KJ6A 1UGJA 3V6EB 3VUWA 1HTOA 1QZEA 2GI9A 2WYQA 2OJRA 3AI5A 2KFKB 2HD5B 3DBLI 3T3NA 4EKUA 2J7QB 2IO3B 3L17A 3Q3OC 2GBRA 2J4XA 3PPAA 1E7PB 2LVQA 2N9EB 4ITKA 5IP4D 2KDIA 2KXJA 3JSVB 3QAQA 1EWCA 1E8ZA 5EE3A 1DYQA 3URYA 3BY4B 2W54A 1FRDA 4NQKE 1YOVB 1UH6A
chains in the Genus database with same CATH topology
3APFA 2RPQA 3H7PB 4HJKA 2MCNB 3RYTA 1WH3A 1Q1OA 2EMSA 5DPRA 3L08A 3WAPA 2KVRA 1LXDA 3Q3JA 4IWQA 2C5LC 5CTRC 5JHBA 1E7VA 3T8MA 4KDIC 2FIFA 2AEHA 3VFKA 4EUTA 1P0RA 3RCZA 2AWTA 2KNBA 3PV1A 4FHJA 4JL9A 4HDQA 3UQBA 3HIZA 4W9HA 4E3CA 2ZPYA 5GMVA 3R66C 3SU8X 4II2B 1X1MA 2LASA 3APCA 3BINA 1V5TA 3PSEB 3H9DA 4MSQB 4DHJD 1GG3A 2MSED 1WM3A 2MWSB 2LUEA 2N9XA 2ZNVC 3DVGX 4FHKA 3A9KA 4ZRJA 3QARA 2HJ8A 2FNJB 2LWPA 1WGDA 5TR5A 3RD2A 2NCNA 3ZTCA 1EF5A 2NS5A 2ZCBA 4KSKC 2K1FA 3JVZX 1WGYA 3WIMA 1P9DU 1YD8U 3ZUNA 3SD5A 4RMAA 2L8JA 3W1SA 3VHTC 4ASWC 4MJSA 4DXAB 2K39A 4IWOA 4RM8A 2KJHB 3X0WA 1TBEA 4LJOB 2KJRA 3LDZE 4IWPA 1GJZA 1WMHA 2QHOA 1H8CA 4ANXA 4NPNA 5G55A 2Z0EB 5DPSA 4ZYNA 3L10B 2JUOA 2JXXA 4GDKA 4MGZE 4URKA 2D11A 4KIKA 3VAWA 1CMXB 1I35A 3DBSA 2Z59B 5DPWA 3TCAA 3QA8A 1AARA 5CHWA 1IP9A 2O6VA 3ZVVA 2KQ7A 2YVCA 1WE6A 4CHKA 4TQ0A 1TGZB 2KC1A 4GDLA 2ZEQA 2DHZA 2GMIC 4EZJA 4MGIE 1V9JA 3WAMA 3QX1A 1YX5B 5AZFA 3L13A 1WR6E 3A1QB 2M0XA 1KOTA 1GC7A 3L0WB 2DYBA 1E8WA 5C23A 2D2QA 4EZKA 2L7RA 3PREA 2XBBC 4GB9A 3QCAA 1Z5SB 4PS3A 4BVUC 2V4LA 3KW5B 1P3QU 5J18A 2ZVOA 4AJWA 3WALA 3OAWA 4KV2A 2O2VB 3U8ZA 3RZWC 1WRDB 4AWJA 5IA7A 4WQOB 2AL6A 2CHWA 2M8SA 4WAAA 1E8XA 1Q5WB 2N1VA 4X57B 2C9WB 2G45B 1Z2MA 2D07B 4MELA 2M17A 4TUUA 3N32A 2I1JA 3R7RA 4PYZA 3ZNHB 2LVOA 2GBMA 1VD2A 4IM3A 1LM8B 3QIJA 3B08A 5DCNA 4G0NB 1OEYA 4FJZA 4GXBA 4MGKE 3ZIMA 2LRWA 4JLCA 2LXAA 2J0MA 2MQJA 2KC2A 3CMMB 3KYDD 4M0WB 1E8YA 4NY0A 2L76A 1WX8A 4EEWA 1R4MI 2MBQA 2BKFA 2LVPA 4BBNF 2BYFA 1IYFA 3TL5A 4LDTD 3PHXB 4NJ7A 2MP2B 1UBIA 2XK5B 4ICVA 3TJPA 2KANA 1WJ6A 4NJ6A 4MDKE 1WF9A 3CF6E 2RR9A 4FLHA 4A20A 4IG7B 2WX0A 2KQSA 1OTRB 1S1QB 5L95C 2KDBA 3IHPC 2NPTB 3ZNZB 1C1YB 2ZNVB 3DPDA 1WYWB 3WA0A 4HK2A 2BF8B 2C60A 4FADA 1TZ1A 4GN1A 2N7DA 2KTRB 4FJVB 3KYCD 4WJPA 2J0JA 3NY5A 2DZIA 1P1AA 1PQSA 3L16A 3UIPB 2DZKA 3B1LX 3JW0X 2KMAA 4ICUA 1A5RA 4HCPB 1XT9B 3X23A 4FBJB 1SE9A 2GBNA 3ZLZA 4MM3A 1WXVA 4NAWA 4ZRKA 2KMCA 4ZDVA 2FCNA 3VH4B 1WJ4A 3I3TB 4KZ0A 1GNUA 2O6VD 4W9CA 2R2QA 4MJSB 2G4DB 3CSTA 3NOBA 2MA9B 1VCBA 3ZTDA 2LRUA 3QC8B 3ZNGC 4LCDE 3RZFA 1C3TA 4F7ZA 2REXA 2MBEA 1WMHB 2EMTA 2PE6B 3U7DA 2JZZA 2DX5B 3VDZA 4GDKB 2KN5A 2NR2A 3D32A 4KIKB 4GU2A 1YIWA 2RGFA 4FULA 1WI0A 4DDID 3B0AA 3VUYA 1L7YA 1HE8A 3KUCB 2I1KA 3PVLA 4WWOA 2MW5A 3N3KB 2JY6A 5KHOA 4MSMB 3V62A 4DHJB 2LGYA 2G4SA 2MBOA 3W1SC 3ALBA 3DBHI 2FCQA 2K8CA 3NHEB 3L54A 2D10A 3PRPB 3A4SC 2KTFA 4G50A 3S2AA 4G3XB 1RRBA 2MRPA 3KVFB 5D7GA 3H1UA 5E6PA 4HLEA 3VXWA 1D3ZA 3NS8A 3V6CB 3UF8A 1UELA 3R3MA 3U30A 2C7NB 3V61A 2JRHA 3PS6A 5JH5C 1WX9A 4W9FA 4PS7A 2XEWA 4GMVA 4FJYA 3T9LA 1ISNA 1T0YA 3M63B 4J6IA 2JPHA 3VUXA 1S3SG 2NVUI 4GSWA 1EUVB 3DOWA 2FCSA 1TTNA 2CS4A 2KD0A 2CHXA 2CR5A 3ZDMC 4P7IA 3GZNI 2L05A 3EHVA 3Q3FA 3KUZA 2ASQA 1KM7A 1NDDA 1BT0A 5D94A 1WX7A 4II3B 2GOWA 2HE7A 3A9JA 3CSFA 1ZKHA 2DAFA 4CO7A 5JHAA 4KDLB 1WE7A 4HPLB 1J0GA 2ZZPB 2EKEC 1WIAA 2FUHB 2IY1B 3QK0A 3C0RB 4WJNA 1L2NA 2IO0B 2JVCA 2VRRB 2L0FA 1WXSA 2LGXA 3V60A 3PHWB 3A33B 3QQ8B 3RT3B 2PPHA 4BKSA 2KDEB 1LQBA 4PYUA 4WJQA 3OJ3A 4W9LA 5CHVC 1J19A 4MGYE 5AZHA 2K6DB 2R2OA 2MBHA 2KWCA 1XQQA 2DYMA 4KSLC 1WJNA 4B9KA 4W9EA 3M3JA 1J8CA 2JZ3B 2AL3A 3KH0A 4I6NB 3UINB 2IZVB 2WWZA 3A1QA 3K9OB 4ANVA 2LGDA 5E6NA 2LI5A 1E5WA 1XD3B 1WGGA 5CX3A 2D3GA 3DBRI 5HKHA 4MEMA 5J17A 2DAJA 2KDFB 2N9PC 2DZJA 3RUIB 2W9NA 1V86A 5CHFA 3WAOA 3PTFC 2JRIB 1ZW7A 2O2VA 4K1RB 3HM6X 4W9DA 2DENB 3OJ4B 2IO1B 3H6NA 3VQIA 2JWZA 2WX1A 3HK0A 4KZCA 3QHTA 1F9JA 5LLIA 5G2NA 4PS8A 5C1ZA 1RLFA 3GOEA 1R4NI 1KJTA 2ZJDA 2KX0A 1MG8A 1WGRA 4NAWB 2LZ6A 3PLVA 3JYUA 1WXAA 4A3OA 1RFAA 1UZXB 1WGHA 3PZDA 2ZPNA 3TIXA 3MJWA 2KWUB 5L83A 1WFYA 1E7UA 2GBJA 2FCMA 3VTVA 5D6JB 5LXHA 2FIDA 4E74A 4LDTB 2Y5BB 3A9KB 3MTNB 3PT2B 4K81A 1IPGA 2KFKA 2M1MA 2ZVNA 3VVWB 4AUQC 1EO6A 3LJ3A 4W9GA 4HCNB 2GBKA 2MBBB 4JGHB 4WJOA 2Z0DB 1G6JA 3AU5A 5J2RA 5LXIB 1WM2A 2K6QA 3EFUA 4B6WA 2BWES 4WWPA 3W1YA 2CHZA 1K8RB 2JF5A 2KLGA 2MP2A 2XK5A 3JSVA 4XC2A 4BBNC 2KWVB 4F8CB 2KLCA 4W9KA 4F1SA 4K7WA 4GIVA 1Y8RC 3PRZA 3DVNV 2KKCA 2K8HA 2IO2B 2N4FA 1ZGUB 3N30A 4RM9A 4TV3A 2BYEA 2NPTA 3AXCA 4HDOA 5JZEB 2KFJA 3ML8A 4M8MA 3HM3A 2LJ5A 1H4RA 2KOXA 2UYZB 3IVFA 3WANA 3H7PA 1V81A 1V2YA 2NBWB 2KTRA 2YLMA 4XX5A 3HHMA 4W9JA 5AEKB 3TMPB 4DK5A 1KLVA 4KVGB 2IYDB 2L3ZA 4DHZB 2CU1A 4DHZE 4HVBA 1FXTB 2C7HA 2O6VB 3DCGA 1WY8A 3PLUA 1GC6A 2K25A 2PE9A 3OLMD 4GDLB 3ZW3A 4ANUA 4BOSC 2FAZA 5AZGA 3ZDTA 3DQVA 4JQWC 2PEAA 4LJPB 1JRUA 5FR6A 4BKSD 2ZCCA 4N9F4 2K8BA 3VTWA 4ANWA 4TKNA 2DYOA 2RSUA 3SHQA 3A4RA 1V80A 2C7MB 4JIOU 1E90A 3RULA 1YJ1A 4BFRA 4NNJB 2BYVE 2DZMA 3IFWB 3EECA 2OOBB 1V6EA 1WZ3A 4EFOA 1RAXA 2BKRB 3ML9A 2KX3A 3ONSA 3A9JB 3PGEA 3H7SA 1UBQA 4GOCA 4I6LB 4BKGA 1SIFA 4HWIB 1YQBA 2IBIB 2L0TA 2RD0A 3UGBB 3KUDB 1I42A 4HPMB 2A4ZA 3PRMB 3ZO5B 1NI2A 1WXMA 3DVGY 1LFDA 1WJUA 2MX2A 5EDSA 1EF1A 1WR1A 2BGFA 2M4NA 5IAAC 2KK8A 3ZRCA 2AYOB 3AULA 4CYEA 2KO3A 3K9PB 3ZRFA 3IG3A 1V5OA 3M95A 3M62B 4IM2A 1M94A 2V1YA 3DVNU 1OQYA 3APDA 3TBLD 4BKTA 5KHQA 1WZ0A 3EC8A 4AJYB 1P98A 2V3SA 4HXDA 4DBGA 2NBUA 4EOYA 1GUAB 2N7EA 4AOFA 4IC7B 4B95A 3UIOB 4M8NA 4DDGD 3ZNID 2N1WA 4A3PA 4W9IA 2NBVB 3O65B 4OVUA 3R7QA 1YX6B 2L00B 3P2BA 2WDTB 4IUMB 4NQLB 3AU4A 4IW0A 4K7UA 1SGHA 1UD7A 3SDLC 4TQ1A 2JT4B 3IBEA 4BOZB 1OGWA 2A5UA 2PJHA 2LXCA 5D2MB 2CKHB 4G11A 2KJ6A 3V6EB 3VUWA 3DDCB 4WWNA 1QZEA 4E71A 2B3AA 4IM0A 4XZ4A 2WYQA 2LD9A 5BO4B 3NZUA 3QJZA 3VTUA 2OJRA 2UWQA 2HTHA 3AI5A 2KFKB 2HD5B 3DBLI 3ECIA 4I6PA 4DWFA 2BPSA 4EKUA 2J7QB 2IO3B 3ENEA 3L17A 4FN2A 2GBRA 4ZRIA 3QWZB 2IY0B 4MH0E 4YL8A 4EZLA 3PPAA 2LVQA 2KHWB 2N9EB 1NBFC 2KZRA 2J0KA 3MHSD 1UGMA 2KDIA 3NZSA 2KXJA 4GGQA 3JSVB 2G3QB 3QAQA 1E8ZA 4FA6A 4OVVA 4K7SA 5DPTA 1U4AA 5E6OA 2MLBA 3UQAA 3VH3B 3BY4B 4AP4C 4NQKE 1Q0WB 3ZKJC 1UH6A 1V49A 1OEYJ 2BWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3APF A;  2RPQ A;  3H7P B;  4HJK A;  2MCN B;  3RYT A;  1WH3 A;  1Q1O A;  2EMS A;  5DPR A;  3L08 A;  3WAP A;  2KVR A;  1LXD A;  3Q3J A;  4IWQ A;  2C5L C;  5CTR C;  5JHB A;  1E7V A;  3T8M A;  4KDI C;  2FIF A;  2AEH A;  3VFK A;  4EUT A;  1P0R A;  3RCZ A;  2AWT A;  2KNB A;  3PV1 A;  4FHJ A;  4JL9 A;  4HDQ A;  3UQB A;  3HIZ A;  4W9H A;  4E3C A;  2ZPY A;  5GMV A;  3R66 C;  3SU8 X;  4II2 B;  1X1M A;  2LAS A;  3APC A;  3BIN A;  1V5T A;  3PSE B;  3H9D A;  4MSQ B;  4DHJ D;  1GG3 A;  2MSE D;  1WM3 A;  2MWS B;  2LUE A;  2N9X A;  2ZNV C;  3DVG X;  4FHK A;  3A9K A;  4ZRJ A;  3QAR A;  2HJ8 A;  2FNJ B;  2LWP A;  1WGD A;  5TR5 A;  3RD2 A;  2NCN A;  3ZTC A;  1EF5 A;  2NS5 A;  2ZCB A;  4KSK C;  2K1F A;  3JVZ X;  1WGY A;  3WIM A;  1P9D U;  1YD8 U;  3ZUN A;  3SD5 A;  4RMA A;  2L8J A;  3W1S A;  3VHT C;  4ASW C;  4MJS A;  4DXA B;  2K39 A;  4IWO A;  4RM8 A;  2KJH B;  3X0W A;  1TBE A;  4LJO B;  2KJR A;  3LDZ E;  4IWP A;  1GJZ A;  1WMH A;  2QHO A;  1H8C A;  4ANX A;  4NPN A;  5G55 A;  2Z0E B;  5DPS A;  4ZYN A;  3L10 B;  2JUO A;  2JXX A;  4GDK A;  4MGZ E;  4URK A;  2D11 A;  4KIK A;  3VAW A;  1CMX B;  1I35 A;  3DBS A;  2Z59 B;  5DPW A;  3TCA A;  3QA8 A;  1AAR A;  5CHW A;  1IP9 A;  2O6V A;  3ZVV A;  2KQ7 A;  2YVC A;  1WE6 A;  4CHK A;  4TQ0 A;  1TGZ B;  2KC1 A;  4GDL A;  2ZEQ A;  2DHZ A;  2GMI C;  4EZJ A;  4MGI E;  1V9J A;  3WAM A;  3QX1 A;  1YX5 B;  5AZF A;  3L13 A;  1WR6 E;  3A1Q B;  2M0X A;  1KOT A;  1GC7 A;  3L0W B;  2DYB A;  1E8W A;  5C23 A;  2D2Q A;  4EZK A;  2L7R A;  3PRE A;  2XBB C;  4GB9 A;  3QCA A;  1Z5S B;  4PS3 A;  4BVU C;  2V4L A;  3KW5 B;  1P3Q U;  5J18 A;  2ZVO A;  4AJW A;  3WAL A;  3OAW A;  4KV2 A;  2O2V B;  3U8Z A;  3RZW C;  1WRD B;  4AWJ A;  5IA7 A;  4WQO B;  2AL6 A;  2CHW A;  2M8S A;  4WAA A;  1E8X A;  1Q5W B;  2N1V A;  4X57 B;  2C9W B;  2G45 B;  1Z2M A;  2D07 B;  4MEL A;  2M17 A;  4TUU A;  3N32 A;  2I1J A;  3R7R A;  4PYZ A;  3ZNH B;  2LVO A;  2GBM A;  1VD2 A;  4IM3 A;  1LM8 B;  3QIJ A;  3B08 A;  5DCN A;  4G0N B;  1OEY A;  4FJZ A;  4GXB A;  4MGK E;  3ZIM A;  2LRW A;  4JLC A;  2LXA A;  2J0M A;  2MQJ A;  2KC2 A;  3CMM B;  3KYD D;  4M0W B;  1E8Y A;  4NY0 A;  2L76 A;  1WX8 A;  4EEW A;  1R4M I;  2MBQ A;  2BKF A;  2LVP A;  4BBN F;  2BYF A;  1IYF A;  3TL5 A;  4LDT D;  3PHX B;  4NJ7 A;  2MP2 B;  1UBI A;  2XK5 B;  4ICV A;  3TJP A;  2KAN A;  1WJ6 A;  4NJ6 A;  4MDK E;  1WF9 A;  3CF6 E;  2RR9 A;  4FLH A;  4A20 A;  4IG7 B;  2WX0 A;  2KQS A;  1OTR B;  1S1Q B;  5L95 C;  2KDB A;  3IHP C;  2NPT B;  3ZNZ B;  1C1Y B;  2ZNV B;  3DPD A;  1WYW B;  3WA0 A;  4HK2 A;  2BF8 B;  2C60 A;  4FAD A;  1TZ1 A;  4GN1 A;  2N7D A;  2KTR B;  4FJV B;  3KYC D;  4WJP A;  2J0J A;  3NY5 A;  2DZI A;  1P1A A;  1PQS A;  3L16 A;  3UIP B;  2DZK A;  3B1L X;  3JW0 X;  2KMA A;  4ICU A;  1A5R A;  4HCP B;  1XT9 B;  3X23 A;  4FBJ B;  1SE9 A;  2GBN A;  3ZLZ A;  4MM3 A;  1WXV A;  4NAW A;  4ZRK A;  2KMC A;  4ZDV A;  2FCN A;  3VH4 B;  1WJ4 A;  3I3T B;  4KZ0 A;  1GNU A;  2O6V D;  4W9C A;  2R2Q A;  4MJS B;  2G4D B;  3CST A;  3NOB A;  2MA9 B;  1VCB A;  3ZTD A;  2LRU A;  3QC8 B;  3ZNG C;  4LCD E;  3RZF A;  1C3T A;  4F7Z A;  2REX A;  2MBE A;  1WMH B;  2EMT A;  2PE6 B;  3U7D A;  2JZZ A;  2DX5 B;  3VDZ A;  4GDK B;  2KN5 A;  2NR2 A;  3D32 A;  4KIK B;  4GU2 A;  1YIW A;  2RGF A;  4FUL A;  1WI0 A;  4DDI D;  3B0A A;  3VUY A;  1L7Y A;  1HE8 A;  3KUC B;  2I1K A;  3PVL A;  4WWO A;  2MW5 A;  3N3K B;  2JY6 A;  5KHO A;  4MSM B;  3V62 A;  4DHJ B;  2LGY A;  2G4S A;  2MBO A;  3W1S C;  3ALB A;  3DBH I;  2FCQ A;  2K8C A;  3NHE B;  3L54 A;  2D10 A;  3PRP B;  3A4S C;  2KTF A;  4G50 A;  3S2A A;  4G3X B;  1RRB A;  2MRP A;  3KVF B;  5D7G A;  3H1U A;  5E6P A;  4HLE A;  3VXW A;  1D3Z A;  3NS8 A;  3V6C B;  3UF8 A;  1UEL A;  3R3M A;  3U30 A;  2C7N B;  3V61 A;  2JRH A;  3PS6 A;  5JH5 C;  1WX9 A;  4W9F A;  4PS7 A;  2XEW A;  4GMV A;  4FJY A;  3T9L A;  1ISN A;  1T0Y A;  3M63 B;  4J6I A;  2JPH A;  3VUX A;  1S3S G;  2NVU I;  4GSW A;  1EUV B;  3DOW A;  2FCS A;  1TTN A;  2CS4 A;  2KD0 A;  2CHX A;  2CR5 A;  3ZDM C;  4P7I A;  3GZN I;  2L05 A;  3EHV A;  3Q3F A;  3KUZ A;  2ASQ A;  1KM7 A;  1NDD A;  1BT0 A;  5D94 A;  1WX7 A;  4II3 B;  2GOW A;  2HE7 A;  3A9J A;  3CSF A;  1ZKH A;  2DAF A;  4CO7 A;  5JHA A;  4KDL B;  1WE7 A;  4HPL B;  1J0G A;  2ZZP B;  2EKE C;  1WIA A;  2FUH B;  2IY1 B;  3QK0 A;  3C0R B;  4WJN A;  1L2N A;  2IO0 B;  2JVC A;  2VRR B;  2L0F A;  1WXS A;  2LGX A;  3V60 A;  3PHW B;  3A33 B;  3QQ8 B;  3RT3 B;  2PPH A;  4BKS A;  2KDE B;  1LQB A;  4PYU A;  4WJQ A;  3OJ3 A;  4W9L A;  5CHV C;  1J19 A;  4MGY E;  5AZH A;  2K6D B;  2R2O A;  2MBH A;  2KWC A;  1XQQ A;  2DYM A;  4KSL C;  1WJN A;  4B9K A;  4W9E A;  3M3J A;  1J8C A;  2JZ3 B;  2AL3 A;  3KH0 A;  4I6N B;  3UIN B;  2IZV B;  2WWZ A;  3A1Q A;  3K9O B;  4ANV A;  2LGD A;  5E6N A;  2LI5 A;  1E5W A;  1XD3 B;  1WGG A;  5CX3 A;  2D3G A;  3DBR I;  5HKH A;  4MEM A;  5J17 A;  2DAJ A;  2KDF B;  2N9P C;  2DZJ A;  3RUI B;  2W9N A;  1V86 A;  5CHF A;  3WAO A;  3PTF C;  2JRI B;  1ZW7 A;  2O2V A;  4K1R B;  3HM6 X;  4W9D A;  2DEN B;  3OJ4 B;  2IO1 B;  3H6N A;  3VQI A;  2JWZ A;  2WX1 A;  3HK0 A;  4KZC A;  3QHT A;  1F9J A;  5LLI A;  5G2N A;  4PS8 A;  5C1Z A;  1RLF A;  3GOE A;  1R4N I;  1KJT A;  2ZJD A;  2KX0 A;  1MG8 A;  1WGR A;  4NAW B;  2LZ6 A;  3PLV A;  3JYU A;  1WXA A;  4A3O A;  1RFA A;  1UZX B;  1WGH A;  3PZD A;  2ZPN A;  3TIX A;  3MJW A;  2KWU B;  5L83 A;  1WFY A;  1E7U A;  2GBJ A;  2FCM A;  3VTV A;  5D6J B;  5LXH A;  2FID A;  4E74 A;  4LDT B;  2Y5B B;  3A9K B;  3MTN B;  3PT2 B;  4K81 A;  1IPG A;  2KFK A;  2M1M A;  2ZVN A;  3VVW B;  4AUQ C;  1EO6 A;  3LJ3 A;  4W9G A;  4HCN B;  2GBK A;  2MBB B;  4JGH B;  4WJO A;  2Z0D B;  1G6J A;  3AU5 A;  5J2R A;  5LXI B;  1WM2 A;  2K6Q A;  3EFU A;  4B6W A;  2BWE S;  4WWP A;  3W1Y A;  2CHZ A;  1K8R B;  2JF5 A;  2KLG A;  2MP2 A;  2XK5 A;  3JSV A;  4XC2 A;  4BBN C;  2KWV B;  4F8C B;  2KLC A;  4W9K A;  4F1S A;  4K7W A;  4GIV A;  1Y8R C;  3PRZ A;  3DVN V;  2KKC A;  2K8H A;  2IO2 B;  2N4F A;  1ZGU B;  3N30 A;  4RM9 A;  4TV3 A;  2BYE A;  2NPT A;  3AXC A;  4HDO A;  5JZE B;  2KFJ A;  3ML8 A;  4M8M A;  3HM3 A;  2LJ5 A;  1H4R A;  2KOX A;  2UYZ B;  3IVF A;  3WAN A;  3H7P A;  1V81 A;  1V2Y A;  2NBW B;  2KTR A;  2YLM A;  4XX5 A;  3HHM A;  4W9J A;  5AEK B;  3TMP B;  4DK5 A;  1KLV A;  4KVG B;  2IYD B;  2L3Z A;  4DHZ B;  2CU1 A;  4DHZ E;  4HVB A;  1FXT B;  2C7H A;  2O6V B;  3DCG A;  1WY8 A;  3PLU A;  1GC6 A;  2K25 A;  2PE9 A;  3OLM D;  4GDL B;  3ZW3 A;  4ANU A;  4BOS C;  2FAZ A;  5AZG A;  3ZDT A;  3DQV A;  4JQW C;  2PEA A;  4LJP B;  1JRU A;  5FR6 A;  4BKS D;  2ZCC A;  4N9F 4;  2K8B A;  3VTW A;  4ANW A;  4TKN A;  2DYO A;  2RSU A;  3SHQ A;  3A4R A;  1V80 A;  2C7M B;  4JIO U;  1E90 A;  3RUL A;  1YJ1 A;  4BFR A;  4NNJ B;  2BYV E;  2DZM A;  3IFW B;  3EEC A;  2OOB B;  1V6E A;  1WZ3 A;  4EFO A;  1RAX A;  2BKR B;  3ML9 A;  2KX3 A;  3ONS A;  3A9J B;  3PGE A;  3H7S A;  1UBQ A;  4GOC A;  4I6L B;  4BKG A;  1SIF A;  4HWI B;  1YQB A;  2IBI B;  2L0T A;  2RD0 A;  3UGB B;  3KUD B;  1I42 A;  4HPM B;  2A4Z A;  3PRM B;  3ZO5 B;  1NI2 A;  1WXM A;  3DVG Y;  1LFD A;  1WJU A;  2MX2 A;  5EDS A;  1EF1 A;  1WR1 A;  2BGF A;  2M4N A;  5IAA C;  2KK8 A;  3ZRC A;  2AYO B;  3AUL A;  4CYE A;  2KO3 A;  3K9P B;  3ZRF A;  3IG3 A;  1V5O A;  3M95 A;  3M62 B;  4IM2 A;  1M94 A;  2V1Y A;  3DVN U;  1OQY A;  3APD A;  3TBL D;  4BKT A;  5KHQ A;  1WZ0 A;  3EC8 A;  4AJY B;  1P98 A;  2V3S A;  4HXD A;  4DBG A;  2NBU A;  4EOY A;  1GUA B;  2N7E A;  4AOF A;  4IC7 B;  4B95 A;  3UIO B;  4M8N A;  4DDG D;  3ZNI D;  2N1W A;  4A3P A;  4W9I A;  2NBV B;  3O65 B;  4OVU A;  3R7Q A;  1YX6 B;  2L00 B;  3P2B A;  2WDT B;  4IUM B;  4NQL B;  3AU4 A;  4IW0 A;  4K7U A;  1SGH A;  1UD7 A;  3SDL C;  4TQ1 A;  2JT4 B;  3IBE A;  4BOZ B;  1OGW A;  2A5U A;  2PJH A;  2LXC A;  5D2M B;  2CKH B;  4G11 A;  2KJ6 A;  3V6E B;  3VUW A;  3DDC B;  4WWN A;  1QZE A;  4E71 A;  2B3A A;  4IM0 A;  4XZ4 A;  2WYQ A;  2LD9 A;  5BO4 B;  3NZU A;  3QJZ A;  3VTU A;  2OJR A;  2UWQ A;  2HTH A;  3AI5 A;  2KFK B;  2HD5 B;  3DBL I;  3ECI A;  4I6P A;  4DWF A;  2BPS A;  4EKU A;  2J7Q B;  2IO3 B;  3ENE A;  3L17 A;  4FN2 A;  2GBR A;  4ZRI A;  3QWZ B;  2IY0 B;  4MH0 E;  4YL8 A;  4EZL A;  3PPA A;  2LVQ A;  2KHW B;  2N9E B;  1NBF C;  2KZR A;  2J0K A;  3MHS D;  1UGM A;  2KDI A;  3NZS A;  2KXJ A;  4GGQ A;  3JSV B;  2G3Q B;  3QAQ A;  1E8Z A;  4FA6 A;  4OVV A;  4K7S A;  5DPT A;  1U4A A;  5E6O A;  2MLB A;  3UQA A;  3VH3 B;  3BY4 B;  4AP4 C;  4NQK E;  1Q0W B;  3ZKJ C;  1UH6 A;  1V49 A;  1OEY J;  2BWF A; 
#chains in the Genus database with same CATH topology
 5EE0 A;  1R4M B;  1Q1O A;  5DPR A;  2KVR A;  4IWQ A;  2C5L C;  4P1C C;  3T8M A;  3AE1 B;  5HFY A;  3VFK A;  1P0R A;  3RCZ A;  3PV1 A;  4FHJ A;  4HDQ A;  3AB5 A;  3SU8 X;  2LAS A;  3H9D A;  4MSQ B;  2MSE D;  2MWS B;  4A90 A;  3A9K A;  4ZRJ A;  2V0G A;  2MJD A;  2TSS A;  4K3B A;  1DGJ A;  2NS5 A;  2L8J A;  3TEZ A;  2K39 A;  4IWO A;  4RM8 A;  2KJH B;  1TBE A;  3P63 A;  4LJO B;  2KJR A;  1H8C A;  1WMH A;  2QHO A;  1YJI A;  4A55 A;  4MGZ E;  1J7C A;  2D11 A;  1I35 A;  3DBS A;  2Z59 B;  1FFU A;  3QA8 A;  2O6V A;  3ZVV A;  4TQ0 A;  2YVC A;  2WXR A;  3V3X A;  1KFY B;  5AZF A;  1XO3 A;  1GC7 A;  4K3C A;  1NEN B;  2W3R A;  3P1M A;  5C23 A;  4EZK A;  2L7R A;  2JYE A;  2X8X X;  4GB9 A;  3QCA A;  4WUR A;  2BVC A;  2ZVO A;  2WXQ A;  3DWG C;  4AJW A;  3OAW A;  3U8Z A;  3RZW C;  4AWJ A;  2DLB A;  2K3U A;  4S17 A;  2M8S A;  1JWB D;  1E8X A;  2RMM A;  2D5G A;  1C9F A;  4X57 B;  5C2T B;  3SR6 A;  2PKO A;  4CQN A;  3T3O A;  2M17 A;  4TUU A;  1V8C A;  3N32 A;  3R7R A;  1VD2 A;  3AV8 A;  3QIJ A;  3B08 A;  4FJZ A;  1OQR A;  1HEZ E;  4M00 A;  3CMM B;  3KYD D;  4NY0 A;  2L1A A;  4US8 A;  1F77 A;  4M02 A;  1DOI A;  2RDG A;  2MP2 B;  4JPS A;  5IN7 A;  1JRP A;  1OTR B;  1S1Q B;  1FPY A;  1XLO A;  4HK2 A;  2BF8 B;  4GN1 A;  2KTR B;  4FJV B;  3EUB 2;  2WXO A;  1PQS A;  1YJJ A;  3L16 A;  2VH1 A;  3I5J C;  2DZK A;  3W2D A;  2KMA A;  1MI0 A;  1TS4 A;  2GBN A;  2FCN A;  2JZP A;  3TSS A;  1GNU A;  2O6V D;  3RFZ B;  2R2Q A;  1MG4 A;  3NOB A;  2MA9 B;  1VCB A;  3TEY A;  2PIA A;  4LCD E;  3RZF A;  1HZ5 A;  2MBE A;  1R7S A;  2G1E A;  3MFG A;  4WQM A;  2NR2 A;  2EEL A;  3D32 A;  4NJC A;  3AM9 A;  2WXH A;  3VUY A;  3BVM A;  1L7Y A;  2WXJ A;  1HE8 A;  1L5P A;  3R2I A;  2I1K A;  3IT6 B;  5KHO A;  2G4S A;  1L4D B;  3NHE B;  3S2A A;  1RRB A;  2MRP A;  5E6P A;  4PT5 A;  2KMM A;  4HLE A;  3U30 A;  3RNC C;  5JH5 C;  4W9F A;  4FJY A;  4LNI A;  4QAY A;  1ISN A;  2FCS A;  1YNT E;  4C56 C;  1TKE A;  2CS4 A;  2CHX A;  2MH7 A;  3GZN I;  3EHV A;  2HE7 A;  1SXT A;  2WXN A;  3ZQ4 A;  2QCZ A;  2BW2 A;  1WIA A;  2FUH B;  2IY1 B;  3QK0 A;  3C0R B;  4LNN A;  3VR8 B;  4TMA B;  1WXS A;  2LGX A;  4OVZ A;  3V60 A;  3QQ8 B;  3RT3 B;  4BKS A;  1ZE3 D;  3BK2 A;  2YEP F;  3Q8F A;  1JCK B;  2K6D B;  1ZUD 2;  1XQQ A;  4KSL C;  1WJN A;  4HEA 1;  1J8C A;  4W9E A;  3M3J A;  3U52 E;  3KH0 A;  2WWZ A;  1MHX A;  5E6N A;  4C4V A;  1SE4 A;  4UDU C;  2D3G A;  1ET9 A;  3DBR I;  4MEM A;  3WAO A;  2O2V A;  4W9D A;  1GB4 A;  3OJ4 B;  1JRO A;  3VQI A;  1E0Z A;  1MHH E;  5LLI A;  5G2N A;  4PS8 A;  1RLF A;  1R4N I;  4YXD B;  1HZ6 A;  4MM3 B;  2KX0 A;  4NAM A;  3PLV A;  3JYU A;  1RFA A;  1AW7 A;  1C79 A;  1WGH A;  2ZPN A;  3MJW A;  1QIL A;  2Y5B B;  3A9K B;  3MTN B;  2KFK A;  2M1M A;  4AUQ C;  3DHH C;  1EO6 A;  1STE A;  4RGM A;  1IGC A;  2GBK A;  4WJO A;  1NYR A;  3EFU A;  2BWE S;  3SFE B;  3JSV A;  2KAJ A;  4YTN B;  4BAX A;  4BBN C;  2KWV B;  2KLC A;  5EE9 A;  4GIV A;  2N9L A;  3DVN V;  1FRR A;  2K8H A;  3N30 A;  4RM9 A;  5HG2 A;  1XEE A;  3AXC A;  5JZE B;  1XLN A;  2UYZ B;  1V2Y A;  2MJE A;  1XCT L;  2QIE B;  2IYD B;  2L3Z A;  5D3D A;  4HVB A;  2O6V B;  2WP9 B;  1QOG A;  2K25 A;  2PVO D;  4BOS C;  2OJW A;  5AZG A;  1FNW A;  5FR6 A;  1TS5 A;  4BKS D;  2QIL A;  2ZCC A;  2K8B A;  2Z8L A;  3SHQ A;  2C7M B;  4ZHO A;  1E90 A;  5T8I A;  2DZM A;  2R61 A;  1WZ3 A;  3KLS X;  3MC8 A;  4P1B C;  1RAX A;  3ML9 A;  3ONS A;  4P16 A;  4C00 A;  2K0P A;  2GB1 A;  3P4Q B;  3MJ5 A;  1YQB A;  2IBI B;  2L0T A;  3UGB B;  5IKC M;  1I42 A;  1VZ6 A;  2A4Z A;  1NI2 A;  2CU3 A;  1LFD A;  1WJU A;  3KWV A;  2KQ4 X;  1EF1 A;  1SE3 A;  1I4H A;  3ZXR A;  2OHF A;  4CYE A;  3M62 B;  1VRA B;  3L4P A;  4USA A;  2V1Y A;  1J7B A;  1EM7 A;  3EC8 A;  1SE2 A;  1ZXI A;  4HXD A;  2I2Y A;  4EOY A;  4GLS C;  1JWU D;  2LFI A;  4IUM B;  2WDT B;  3H8H A;  4NQL B;  1TJE A;  1FIQ A;  4TQ1 A;  1GB1 A;  3DDC B;  4E71 A;  1V97 A;  2MEK A;  4XZ4 A;  2LD9 A;  3NZU A;  3QJZ A;  1LO5 D;  3AN1 A;  4I6P A;  3VRA B;  4FN2 A;  1N60 A;  2IY0 B;  4YL8 A;  4EZL A;  2KHW B;  1NBF C;  3MHS D;  2J0K A;  1RYJ A;  1UGM A;  2K5P A;  4OVV A;  2IGH A;  3ZKJ C;  3R2T A;  3APF A;  4JX1 C;  4P6V F;  2WXG A;  4HJK A;  2MCN B;  3RYT A;  3DBR B;  5CTR C;  2LGS A;  5LNK 1;  1E7V A;  1L6U A;  4KDI C;  3U2S C;  1L0Y B;  4EUT A;  2Y5P A;  2FUG 1;  2HJ1 A;  2HDE A;  2PTL A;  1D5X C;  3UQB A;  4TSS A;  4YTP B;  2RDB C;  2ZPY A;  4II2 B;  1X1M A;  3APC A;  3BII D;  3V05 A;  2LUE A;  3QAR A;  2HJ8 A;  1T3Q A;  5TR5 A;  2ZCB A;  1WWT A;  3JVZ X;  3ZUN A;  3WIM A;  1YD8 U;  2V3N A;  4ASW C;  3BYY B;  4DXA B;  3BZD B;  3LDZ E;  4ANX A;  4NPN A;  5IOI A;  1XF5 L;  2JXX A;  3KQ4 A;  4OHJ A;  1AAR A;  3AEG B;  4CHK A;  1IP9 A;  1C76 A;  3GE3 C;  1TY2 A;  2QC8 A;  4GDL A;  3L13 A;  2QMT A;  1KOT A;  1NI3 A;  3L0W B;  2DYB A;  1E8W A;  3EA6 A;  1PGX A;  1SJE D;  3PRE A;  4KV2 A;  2O2V B;  2XN9 C;  1N6Z A;  3UI3 A;  5IA7 A;  2BB6 A;  1T6B X;  2CHW A;  2N1V A;  2C9W B;  4KGS A;  4MEL A;  1J7A A;  1RWS A;  1PFD A;  2GBM A;  1KLU D;  1YQ4 B;  1UF0 A;  1OEY A;  2LRW A;  2LXA A;  2MQJ A;  4M0W B;  1E8Y A;  2DBY A;  4BBN F;  2BYF A;  3TL5 A;  4LDT D;  2BTE A;  3PHX B;  4NJ7 A;  3MP9 A;  3TJP A;  4MDK E;  3CF6 E;  2RR9 A;  4A20 A;  2WX0 A;  2KQS A;  3Q6B A;  1UNS A;  2ZNV B;  3N9Y C;  1WYW B;  2C60 A;  4H2A A;  1IBX A;  2WXL A;  2J0J A;  1FD6 A;  5FR3 A;  3B1L X;  3JW0 X;  4ICU A;  4HCP B;  4N58 A;  3X23 A;  1FNV A;  3FIL A;  1QKZ A;  4MM3 A;  1WXV A;  1WJ4 A;  3I3T B;  1ESF A;  4MJS B;  2G4D B;  4NZL B;  3CST A;  2INP E;  3ZTD A;  1EWY C;  3FAH A;  2X38 A;  1EU4 A;  1M4V A;  3U7D A;  1YQ3 B;  1ROE A;  3J9C A;  1PUT A;  3BVG A;  3AMZ A;  1YIW A;  2RGF A;  3B0A A;  3RNE C;  2MW5 A;  4J3O D;  2WXI A;  2LGY A;  2MBO A;  2DNF A;  3W1S C;  3ALB A;  3DBH I;  1B1Z A;  2FCQ A;  1MJD A;  2KTF A;  4G50 A;  3P4R B;  3KVF B;  1FEH A;  1ACC A;  4MAC A;  3VXW A;  3V6C B;  5C3J B;  3R3M A;  4ZRP A;  2UU7 A;  1E6E B;  1QT9 A;  1V1P A;  4GMV A;  1OQQ A;  3T9L A;  1F2R C;  1T0Y A;  3VUX A;  2JPH A;  1S3S G;  4GSW A;  3DOW A;  3RPF C;  2KD0 A;  3ZDM C;  4P7I A;  1UWM A;  3KUZ A;  1BT0 A;  2M0A A;  2IGD A;  1TS3 A;  1ZKH A;  4KDL B;  2WDR B;  4YSY B;  1ZPS A;  3SEB A;  3AED B;  1FCL A;  3TEX A;  2LHE A;  2ONQ A;  2JVC A;  2VRR B;  4YWG G;  3PHW B;  3A33 B;  2PPH A;  2I38 A;  5AZH A;  2KWC A;  4Q2J A;  3R8B A;  2CJO A;  4B9K A;  1BUI C;  2AL3 A;  3UIN B;  4I6N B;  4A6Q A;  3A1Q A;  5D3I B;  3P42 A;  5HKH A;  2RDH A;  1I4Q A;  3N20 C;  2W9N A;  4MT5 A;  3PTF C;  1ZW7 A;  3HM6 X;  3OWE B;  2KAC A;  2V4I B;  2JWZ A;  4L2Y A;  1F9J A;  1MG8 A;  2WU2 B;  1WXA A;  3NRZ A;  3TIX A;  1AYF A;  1WFY A;  1E7U A;  2GBJ A;  2FCM A;  2FID A;  4LDT B;  5H92 C;  4K81 A;  3PT2 B;  1IPG A;  4RFB A;  3VVW B;  2GLS A;  4US9 A;  3LJ3 A;  4W9G A;  4HCN B;  2LMC A;  2Z0D B;  3DBL B;  5LXI B;  4S0R A;  3W5V B;  2QJL A;  3W1Y A;  1K8R B;  2XK5 A;  4F8C B;  4F1S A;  4W9K A;  1VJK A;  4K7W A;  1I4R A;  3TUO A;  1ZGU B;  4TV3 A;  1TYG B;  4HRO A;  2BYE A;  2NPT A;  3HM3 A;  1H4R A;  3RMK C;  1RFK A;  2KOX A;  3WAN A;  1YMH E;  1V81 A;  1UUP A;  1AWD A;  4XX5 A;  3HHM A;  4DK5 A;  1KLV A;  4DHZ B;  2CU1 A;  2C7H A;  2LHD A;  4D2K A;  1UWX A;  4ARC A;  3OLM D;  3ZW3 A;  2WXM A;  4GDL B;  2FAZ A;  4C7Y A;  4JQW C;  2PEA A;  3B2G A;  4RF1 A;  1BML C;  2IND C;  2BB5 A;  4TKN A;  2DYO A;  2G9H D;  2RSU A;  4RF0 A;  2JSV X;  1YJ1 A;  3MC9 A;  2OOB B;  4EFO A;  1Q10 A;  3A9J B;  3PGE A;  1UBQ A;  4GOC A;  2RD0 A;  1MPE A;  1I7H A;  4XYC A;  5IO9 A;  3B2F A;  3AE3 B;  5EDS A;  2M4N A;  5IAA C;  3FC4 A;  3ZRC A;  2AYO B;  3M95 A;  4KKI A;  2WDV B;  4IM2 A;  4XDC A;  2H88 B;  3TBL D;  4BKT A;  1WZ0 A;  3AE4 B;  4AS1 A;  1F0Z A;  2DWQ A;  1FM0 D;  3I57 A;  1L6V A;  2INN E;  4IC7 B;  4B95 A;  3ZNI D;  4ZYS A;  2ZW1 A;  4A3P A;  4OVU A;  2ICI A;  3R7Q A;  1L0X B;  2L00 B;  4IW0 A;  1TY0 A;  4K7U A;  2SEB D;  2IGG A;  3IBE A;  2N9K A;  1A70 A;  1OGW A;  2PJH A;  2LXC A;  1IBX B;  1FCC C;  4HKZ E;  4WWN A;  4PK1 A;  4IM0 A;  3ZJU A;  1YN4 A;  2HTH A;  3HUI A;  3FIL B;  4ZRI A;  1K53 A;  1HQR D;  4MH0 E;  2KZR A;  3MC0 B;  4OZB A;  4FA6 A;  1T0Q C;  4OZA A;  2ZW0 A;  1NVI D;  1U4A A;  5E6O A;  2MLB A;  1MVK A;  4M0W A;  3VH3 B;  1T0S C;  1Q0W B;  1FMA D;  1V49 A;  2BWF A;  3NZ3 A;  1F2R I;  3H7P B;  1WGK A;  1IUE A;  2EMS A;  3L08 A;  3WAP A;  3PZ8 A;  1LXD A;  1ZOY B;  4FXC A;  2AEH A;  2RPV A;  1DOY A;  2AWT A;  4JL9 A;  3HIZ A;  1N62 A;  4M01 A;  4E3C A;  5H8Y E;  3NS1 A;  1V5T A;  4DHJ D;  1KLG D;  1C77 A;  1WM3 A;  4FHK A;  3DVG X;  1P7F A;  2LWP A;  1V1P B;  2NCN A;  4KGT A;  3RD2 A;  1EF5 A;  4KSK C;  2BS3 B;  2K1F A;  1WGY A;  3SD5 A;  4RMA A;  3VHT C;  4MJS A;  2BT6 A;  4OZC A;  1HXY D;  3X0W A;  4WIP A;  3W5U B;  2BQQ A;  1N63 A;  1GJZ A;  3GS2 A;  3PO0 A;  2Z0E B;  5DPS A;  2WNM A;  4ZYN A;  3L10 B;  1E10 A;  1VDV A;  2AX5 A;  4WH4 A;  1WE6 A;  3Q8C A;  1TGZ B;  2KC1 A;  1SBB B;  1SEB D;  4EZJ A;  1V9J A;  1YX5 B;  1WR6 E;  3A1Q B;  2M0X A;  2FE8 A;  4DXG A;  2D2Q A;  3Q2A C;  1SB3 C;  2XBB C;  3NVY A;  2V4L A;  3KW5 B;  1P3Q U;  3WAL A;  4WQO B;  3P4S B;  1OFF A;  1P7E A;  4WAA A;  1TS2 A;  1Q5W B;  2ACZ B;  3E56 A;  2D07 B;  3GZN B;  1ENF A;  2LJI A;  2QEJ C;  4PYZ A;  1K51 A;  1LM8 B;  5DCN A;  4GXB A;  4MGK E;  5JXV A;  2KVZ A;  4JLC A;  2J0M A;  2KC2 A;  5GXG B;  2L76 A;  3LYY A;  2JX5 A;  1R4M I;  4EEW A;  2AQ3 B;  1FFV A;  2BKF A;  2MBQ A;  4EE2 A;  3WCQ A;  1K52 A;  1WRI A;  2XK5 B;  1YN3 A;  2KAN A;  3Q8A A;  4NJ6 A;  1WF9 A;  3RN9 C;  4IG7 B;  2WDQ B;  2J53 A;  5L95 C;  2NPT B;  3ZNZ B;  1C1Y B;  4WAF A;  3CIR B;  4A8X C;  4R3D A;  2N7D A;  4WJP A;  2PLP A;  1XCQ L;  3NY5 A;  1P1A A;  5BYR A;  1WYG A;  3ZXV A;  4ZRK A;  3AEA B;  3VH4 B;  3GB1 A;  1R4N B;  3N1Z C;  4OW0 A;  3DWM A;  2VZK B;  1C4A A;  1PYW D;  4JWU C;  3ZNG C;  1ZP0 B;  2REX A;  2EMT A;  2IDY A;  3BK1 A;  2PE6 B;  4GDK B;  2W55 A;  4KIK B;  4FUL A;  4YSZ B;  1WI0 A;  4DDI D;  3PVL A;  3BVZ A;  3U7Z A;  4RNA A;  2JY6 A;  4DHJ B;  2K8C A;  3L54 A;  2D10 A;  3PRP B;  3A4S C;  2JYT A;  1TT5 B;  3LXF A;  4G3X B;  5D7G A;  2JRH A;  3Q3M C;  2JQR B;  2LGI A;  1JQ4 A;  3M63 B;  2NVU I;  1LGR A;  1D4B A;  2N0S B;  3HVZ A;  1TTN A;  1N5W A;  2CR5 A;  1DOX A;  3I9V 1;  4LNF A;  3Q14 C;  2L05 A;  2N7J A;  2NTT A;  1KM7 A;  2OED A;  3ABV B;  5I4D A;  1NDD A;  4II3 B;  3A9J A;  2V9H A;  4HPL B;  2ZZP B;  2EKE C;  4WJN A;  2BBC A;  2IO0 B;  2L0F A;  4WJQ A;  4ACF A;  5CHV C;  1J19 A;  2R2O A;  2MBH A;  2DYM A;  1Y56 A;  4YSX B;  3O13 A;  2JZ3 B;  2PVG C;  2IZV B;  1XXG A;  2LI5 A;  1BXT A;  1E5W A;  1HTQ A;  1WGG A;  4HRS A;  5CX3 A;  2DAJ A;  2KDF B;  3AE5 B;  2JRI B;  4K1R B;  3E9S A;  2DEN B;  2D3C A;  4L23 A;  2J52 A;  4C80 A;  3NJT A;  4RGN A;  3HK0 A;  4KZC A;  4AQ7 A;  1V1O A;  5C1Z A;  5BMI A;  1KJT A;  2ZJD A;  4NAW B;  2LZ6 A;  4A3O A;  2Y5C A;  1UZX B;  2QDF A;  4ZOH C;  2KWU B;  5L83 A;  4N6E B;  4XDD A;  4BZA A;  5LXH A;  4E74 A;  4LNO A;  1ZXH A;  2M56 B;  5TSS A;  3RNG C;  5EE1 A;  2MBB B;  4JGH B;  1G6J A;  5J2R A;  1WM2 A;  5MPO A;  4WWP A;  2CHZ A;  1FXA A;  3ZYY X;  1N61 A;  2W3S A;  3N1Y C;  3PRZ A;  2N4F A;  2IO2 B;  3Q8E A;  3AE6 B;  2KFJ A;  2LJ5 A;  4LNK A;  3H7P A;  2YLM A;  4W9J A;  5AEK B;  3TMP B;  4KVG B;  4XWT A;  3DCG A;  3IXS A;  1JWS D;  3ZDT A;  3DQV A;  4LJP B;  1KRH A;  1JRU A;  4N9F 4;  3VTW A;  1AN8 A;  3SFD B;  1QOF A;  2H89 B;  4XE0 A;  3Q8B A;  4JIO U;  3FKY A;  5HHD G;  4REZ A;  2BYV E;  4IDI A;  1CQV A;  1KH0 A;  1TKG A;  2BKR B;  3PZ7 A;  1T0R C;  2M19 A;  5BYS A;  3H7S A;  2WS3 B;  1SJH D;  4JWS C;  2QSD A;  1SIF A;  4HWI B;  2ON8 A;  3KUD B;  3OG5 A;  1QOA A;  3PRM B;  3ZO5 B;  3DVG Y;  2KDM A;  2MX2 A;  2WHI A;  1L4Z B;  2BGF A;  2KK8 A;  3AUL A;  1XLP A;  3K9P B;  3IG3 A;  2IPK D;  1KTK A;  2MHJ A;  3APD A;  5KHQ A;  3NVV A;  5BMG A;  4AJY B;  2NMQ A;  1P98 A;  3NVW A;  2NBU A;  1WXQ A;  2FBW B;  2N7E A;  4M8N A;  2N1W A;  2NBV B;  3P2B A;  3AEC B;  3CWI A;  1SGH A;  1UD7 A;  3SDL C;  4XGA B;  2CKH B;  1IGD A;  3DHI C;  2B3A A;  5BO4 B;  3VTU A;  2UWQ A;  1GAQ B;  3ECI A;  4DWF A;  2BPS A;  3ENE A;  1T5X D;  3QWZ B;  4DQO C;  1TZO A;  2B76 B;  3NZS A;  4GGQ A;  2G3Q B;  2CJN A;  1GPX A;  4K7S A;  5DPT A;  1WSP A;  3UQA A;  3RNB C;  4JE3 B;  1VZ7 A;  4AP4 C;  2BS4 B;  1OEY J;  3UF8 A;  3V61 A;  2K9X A;  2RPQ A;  1WH3 A;  2WQY B;  3Q3J A;  5JHB A;  3IT4 B;  1JWM D;  1D5Z C;  2FIF A;  2NTS A;  3C8Y A;  2KNB A;  1I4X A;  4W9H A;  5GMV A;  3AE9 B;  3R66 C;  3BIN A;  3PSE B;  4ZRQ A;  3RNA C;  1GG3 A;  2ZNV C;  2N9X A;  3I63 C;  1ET6 A;  3W9C B;  1K50 A;  2FNJ B;  1WGD A;  3ZTC A;  2Q5W D;  3AE7 B;  1P9D U;  1MFW A;  2LUM A;  3W1S A;  1CK1 A;  3NG0 A;  4IWP A;  3LB8 C;  4N59 A;  5G55 A;  2EKI A;  3DHG C;  2JUO A;  4GDK A;  4URK A;  3RI7 C;  4KIK A;  1VZ8 A;  1CMX B;  3VAW A;  2SAK A;  5DPW A;  3TCA A;  5CHW A;  5AUI A;  1FNU A;  2KQ7 A;  2ZEQ A;  2DHZ A;  2GMI C;  3ZJV A;  4MGI E;  3WAM A;  3QX1 A;  4RGT A;  3DBH B;  2GRI A;  1TKY A;  4YT0 B;  2KYW A;  2BS2 B;  2WLB A;  2L32 A;  2W82 A;  4PS3 A;  4BVU C;  5J18 A;  1Z5S B;  3MHZ A;  1JAL A;  2KN4 A;  1WRD B;  2JU6 X;  2AL6 A;  3EFC A;  2G45 B;  1Z2M A;  2LEK A;  2I1J A;  3ZNH B;  2LVO A;  4IM3 A;  1SF0 A;  4G0N B;  3ZIM A;  2BYT A;  1D5M C;  1PDX A;  5G5G A;  3ETR A;  4RGO S;  1WX8 A;  4LK0 M;  4HKQ A;  2LVP A;  1IYF A;  1FXI A;  1JML A;  1UBI A;  4ICV A;  1WJ6 A;  3C19 A;  4HPP A;  4FLH A;  4XWW A;  2KDB A;  3IHP C;  3DPD A;  3WA0 A;  2VZK D;  4FAD A;  1TZ1 A;  4ARI A;  3KYC D;  3HRD D;  1JWA D;  2DZI A;  3VRB B;  1I4G A;  3KWL A;  1GOZ A;  3UIP B;  1A5R A;  5BYQ A;  1XT9 B;  4FBJ B;  1EU3 A;  1SE9 A;  3ZLZ A;  1PGB A;  4NAW A;  4ZDV A;  2KMC A;  4KGR A;  4KZ0 A;  4W9C A;  5HI1 A;  1I4P A;  3B9J A;  3VR9 B;  3AE2 B;  2LRU A;  1L0V B;  3QC8 B;  1C3T A;  4F7Z A;  1ZDX A;  2KT7 A;  5G5H A;  1WMH B;  1VLB A;  3IAS 1;  3NVZ A;  2JZZ A;  2DX5 B;  3VDZ A;  1C4P A;  2IJ0 A;  2KN5 A;  4GU2 A;  3TEW A;  1D6E C;  2KWD A;  3KUC B;  4WWO A;  1KF6 B;  3N3K B;  3V62 A;  4MSM B;  1C78 A;  1N5X A;  3NUH B;  3H1U A;  4IKG A;  5AUK A;  1D3Z A;  3NS8 A;  4KKJ A;  1UEL A;  2C7N B;  3PS6 A;  2D3A A;  1WX9 A;  1QF6 A;  4PS7 A;  2XEW A;  1HA5 A;  4J6I A;  1SSN A;  5E6J A;  3HVD A;  1EUV B;  1QQR A;  4ZHP A;  2JXT A;  3GE8 C;  2WXF A;  3Q3F A;  2ASQ A;  2L52 A;  1JW9 D;  5D94 A;  1WX7 A;  2GOW A;  3CSF A;  1FO4 A;  2DAF A;  4CO7 A;  5JHA A;  1WE7 A;  1J0G A;  2YEP B;  1L2N A;  2PMV A;  3AEB B;  2KDE B;  1LQB A;  4PYU A;  3N1X C;  3OJ3 A;  1C4C A;  4HJG E;  4W9L A;  1CJE A;  3AEE B;  4MGY E;  2WXP A;  2VH2 A;  3Q69 A;  1SIJ A;  3K9O B;  4ANV A;  4DXF A;  2LGD A;  1B9R A;  1XD3 B;  5J17 A;  3ZGZ A;  2D3B A;  2N9P C;  2DZJ A;  1F1H A;  3RUI B;  1V86 A;  5CHF A;  4WWM A;  2INC C;  4B0M A;  4YTM B;  2WU5 B;  2IO1 B;  4RH6 A;  3H6N A;  2WX1 A;  3U4E G;  3QHT A;  3GP7 A;  3GOE A;  3EGR A;  4MH8 A;  1WGR A;  4O1N A;  3BWU D;  2PW9 A;  1RM6 C;  3PZD A;  2WGS A;  3VTV A;  5D6J B;  1VR9 A;  2ZVN A;  4RCO A;  2WXK A;  1PGA A;  3AU5 A;  1YN5 A;  2K6Q A;  1E9M A;  4B6W A;  2JF5 A;  2KLG A;  2MP2 A;  4XC2 A;  1QLB B;  3IAM 1;  4KX6 B;  1Y8R C;  2KKC A;  3Q3N C;  4HDO A;  3ML8 A;  4M8M A;  3IVF A;  2NBW B;  2KTR A;  2J42 A;  3RNF C;  5FKA C;  2JWU A;  5BMH A;  4L1B A;  4DHZ E;  1FXT B;  3PLU A;  1WY8 A;  4LTU A;  1GC6 A;  2PE9 A;  4IOI E;  4ANU A;  1CZP A;  5FK9 C;  4ANW A;  2E3T A;  3A4R A;  1V80 A;  2V3P A;  3RUL A;  4A9A A;  2AQ2 B;  4NNJ B;  4BFR A;  2L83 A;  3IFW B;  3EEC A;  1V6E A;  2AQ1 B;  3ZJT A;  4LLG M;  2KX3 A;  1NYQ A;  4BKG A;  4I6L B;  1XLQ A;  1QOB A;  1NEK B;  4HPM B;  1WXM A;  3BYT B;  1WR1 A;  3AEF B;  4B0E A;  2KO3 A;  3ZRF A;  1V5O A;  1M94 A;  3DVN U;  1OQY A;  2V3S A;  1F52 A;  1ZDV A;  4C4V B;  3P4P B;  4DBG A;  4C7Z A;  1GUA B;  2Y3A A;  4AOF A;  2K22 A;  3AH7 A;  3UIO B;  4DDG D;  4W9I A;  3O65 B;  2MJ3 A;  1YX6 B;  2E6X A;  3AU4 A;  1TIF A;  3AE8 B;  2JT4 B;  4BOZ B;  2HTM E;  2A5U A;  5D2M B;  4G11 A;  2XNA C;  2KJ6 A;  1UGJ A;  3V6E B;  3VUW A;  1HTO A;  1QZE A;  2GI9 A;  2WYQ A;  2OJR A;  3AI5 A;  2KFK B;  2HD5 B;  3DBL I;  3T3N A;  4EKU A;  2J7Q B;  2IO3 B;  3L17 A;  3Q3O C;  2GBR A;  2J4X A;  3PPA A;  1E7P B;  2LVQ A;  2N9E B;  4ITK A;  5IP4 D;  2KDI A;  2KXJ A;  3JSV B;  3QAQ A;  1EWC A;  1E8Z A;  5EE3 A;  1DYQ A;  3URY A;  3BY4 B;  2W54 A;  1FRD A;  4NQK E;  1YOV B;  1UH6 A; 
#chains in the Genus database with same CATH homology
 3APF A;  2RPQ A;  3H7P B;  4HJK A;  2MCN B;  3RYT A;  1WH3 A;  1Q1O A;  2EMS A;  5DPR A;  3L08 A;  3WAP A;  2KVR A;  1LXD A;  3Q3J A;  4IWQ A;  2C5L C;  5CTR C;  5JHB A;  1E7V A;  3T8M A;  4KDI C;  2FIF A;  2AEH A;  3VFK A;  4EUT A;  1P0R A;  3RCZ A;  2AWT A;  2KNB A;  3PV1 A;  4FHJ A;  4JL9 A;  4HDQ A;  3UQB A;  3HIZ A;  4W9H A;  4E3C A;  2ZPY A;  5GMV A;  3R66 C;  3SU8 X;  4II2 B;  1X1M A;  2LAS A;  3APC A;  3BIN A;  1V5T A;  3PSE B;  3H9D A;  4MSQ B;  4DHJ D;  1GG3 A;  2MSE D;  1WM3 A;  2MWS B;  2LUE A;  2N9X A;  2ZNV C;  3DVG X;  4FHK A;  3A9K A;  4ZRJ A;  3QAR A;  2HJ8 A;  2FNJ B;  2LWP A;  1WGD A;  5TR5 A;  3RD2 A;  2NCN A;  3ZTC A;  1EF5 A;  2NS5 A;  2ZCB A;  4KSK C;  2K1F A;  3JVZ X;  1WGY A;  3WIM A;  1P9D U;  1YD8 U;  3ZUN A;  3SD5 A;  4RMA A;  2L8J A;  3W1S A;  3VHT C;  4ASW C;  4MJS A;  4DXA B;  2K39 A;  4IWO A;  4RM8 A;  2KJH B;  3X0W A;  1TBE A;  4LJO B;  2KJR A;  3LDZ E;  4IWP A;  1GJZ A;  1WMH A;  2QHO A;  1H8C A;  4ANX A;  4NPN A;  5G55 A;  2Z0E B;  5DPS A;  4ZYN A;  3L10 B;  2JUO A;  2JXX A;  4GDK A;  4MGZ E;  4URK A;  2D11 A;  4KIK A;  3VAW A;  1CMX B;  1I35 A;  3DBS A;  2Z59 B;  5DPW A;  3TCA A;  3QA8 A;  1AAR A;  5CHW A;  1IP9 A;  2O6V A;  3ZVV A;  2KQ7 A;  2YVC A;  1WE6 A;  4CHK A;  4TQ0 A;  1TGZ B;  2KC1 A;  4GDL A;  2ZEQ A;  2DHZ A;  2GMI C;  4EZJ A;  4MGI E;  1V9J A;  3WAM A;  3QX1 A;  1YX5 B;  5AZF A;  3L13 A;  1WR6 E;  3A1Q B;  2M0X A;  1KOT A;  1GC7 A;  3L0W B;  2DYB A;  1E8W A;  5C23 A;  2D2Q A;  4EZK A;  2L7R A;  3PRE A;  2XBB C;  4GB9 A;  3QCA A;  1Z5S B;  4PS3 A;  4BVU C;  2V4L A;  3KW5 B;  1P3Q U;  5J18 A;  2ZVO A;  4AJW A;  3WAL A;  3OAW A;  4KV2 A;  2O2V B;  3U8Z A;  3RZW C;  1WRD B;  4AWJ A;  5IA7 A;  4WQO B;  2AL6 A;  2CHW A;  2M8S A;  4WAA A;  1E8X A;  1Q5W B;  2N1V A;  4X57 B;  2C9W B;  2G45 B;  1Z2M A;  2D07 B;  4MEL A;  2M17 A;  4TUU A;  3N32 A;  2I1J A;  3R7R A;  4PYZ A;  3ZNH B;  2LVO A;  2GBM A;  1VD2 A;  4IM3 A;  1LM8 B;  3QIJ A;  3B08 A;  5DCN A;  4G0N B;  1OEY A;  4FJZ A;  4GXB A;  4MGK E;  3ZIM A;  2LRW A;  4JLC A;  2LXA A;  2J0M A;  2MQJ A;  2KC2 A;  3CMM B;  3KYD D;  4M0W B;  1E8Y A;  4NY0 A;  2L76 A;  1WX8 A;  4EEW A;  1R4M I;  2MBQ A;  2BKF A;  2LVP A;  4BBN F;  2BYF A;  1IYF A;  3TL5 A;  4LDT D;  3PHX B;  4NJ7 A;  2MP2 B;  1UBI A;  2XK5 B;  4ICV A;  3TJP A;  2KAN A;  1WJ6 A;  4NJ6 A;  4MDK E;  1WF9 A;  3CF6 E;  2RR9 A;  4FLH A;  4A20 A;  4IG7 B;  2WX0 A;  2KQS A;  1OTR B;  1S1Q B;  5L95 C;  2KDB A;  3IHP C;  2NPT B;  3ZNZ B;  1C1Y B;  2ZNV B;  3DPD A;  1WYW B;  3WA0 A;  4HK2 A;  2BF8 B;  2C60 A;  4FAD A;  1TZ1 A;  4GN1 A;  2N7D A;  2KTR B;  4FJV B;  3KYC D;  4WJP A;  2J0J A;  3NY5 A;  2DZI A;  1P1A A;  1PQS A;  3L16 A;  3UIP B;  2DZK A;  3B1L X;  3JW0 X;  2KMA A;  4ICU A;  1A5R A;  4HCP B;  1XT9 B;  3X23 A;  4FBJ B;  1SE9 A;  2GBN A;  3ZLZ A;  4MM3 A;  1WXV A;  4NAW A;  4ZRK A;  2KMC A;  4ZDV A;  2FCN A;  3VH4 B;  1WJ4 A;  3I3T B;  4KZ0 A;  1GNU A;  2O6V D;  4W9C A;  2R2Q A;  4MJS B;  2G4D B;  3CST A;  3NOB A;  2MA9 B;  1VCB A;  3ZTD A;  2LRU A;  3QC8 B;  3ZNG C;  4LCD E;  3RZF A;  1C3T A;  4F7Z A;  2REX A;  2MBE A;  1WMH B;  2EMT A;  2PE6 B;  3U7D A;  2JZZ A;  2DX5 B;  3VDZ A;  4GDK B;  2KN5 A;  2NR2 A;  3D32 A;  4KIK B;  4GU2 A;  1YIW A;  2RGF A;  4FUL A;  1WI0 A;  4DDI D;  3B0A A;  3VUY A;  1L7Y A;  1HE8 A;  3KUC B;  2I1K A;  3PVL A;  4WWO A;  2MW5 A;  3N3K B;  2JY6 A;  5KHO A;  4MSM B;  3V62 A;  4DHJ B;  2LGY A;  2G4S A;  2MBO A;  3W1S C;  3ALB A;  3DBH I;  2FCQ A;  2K8C A;  3NHE B;  3L54 A;  2D10 A;  3PRP B;  3A4S C;  2KTF A;  4G50 A;  3S2A A;  4G3X B;  1RRB A;  2MRP A;  3KVF B;  5D7G A;  3H1U A;  5E6P A;  4HLE A;  3VXW A;  1D3Z A;  3NS8 A;  3V6C B;  3UF8 A;  1UEL A;  3R3M A;  3U30 A;  2C7N B;  3V61 A;  2JRH A;  3PS6 A;  5JH5 C;  1WX9 A;  4W9F A;  4PS7 A;  2XEW A;  4GMV A;  4FJY A;  3T9L A;  1ISN A;  1T0Y A;  3M63 B;  4J6I A;  2JPH A;  3VUX A;  1S3S G;  2NVU I;  4GSW A;  1EUV B;  3DOW A;  2FCS A;  1TTN A;  2CS4 A;  2KD0 A;  2CHX A;  2CR5 A;  3ZDM C;  4P7I A;  3GZN I;  2L05 A;  3EHV A;  3Q3F A;  3KUZ A;  2ASQ A;  1KM7 A;  1NDD A;  1BT0 A;  5D94 A;  1WX7 A;  4II3 B;  2GOW A;  2HE7 A;  3A9J A;  3CSF A;  1ZKH A;  2DAF A;  4CO7 A;  5JHA A;  4KDL B;  1WE7 A;  4HPL B;  1J0G A;  2ZZP B;  2EKE C;  1WIA A;  2FUH B;  2IY1 B;  3QK0 A;  3C0R B;  4WJN A;  1L2N A;  2IO0 B;  2JVC A;  2VRR B;  2L0F A;  1WXS A;  2LGX A;  3V60 A;  3PHW B;  3A33 B;  3QQ8 B;  3RT3 B;  2PPH A;  4BKS A;  2KDE B;  1LQB A;  4PYU A;  4WJQ A;  3OJ3 A;  4W9L A;  5CHV C;  1J19 A;  4MGY E;  5AZH A;  2K6D B;  2R2O A;  2MBH A;  2KWC A;  1XQQ A;  2DYM A;  4KSL C;  1WJN A;  4B9K A;  4W9E A;  3M3J A;  1J8C A;  2JZ3 B;  2AL3 A;  3KH0 A;  4I6N B;  3UIN B;  2IZV B;  2WWZ A;  3A1Q A;  3K9O B;  4ANV A;  2LGD A;  5E6N A;  2LI5 A;  1E5W A;  1XD3 B;  1WGG A;  5CX3 A;  2D3G A;  3DBR I;  5HKH A;  4MEM A;  5J17 A;  2DAJ A;  2KDF B;  2N9P C;  2DZJ A;  3RUI B;  2W9N A;  1V86 A;  5CHF A;  3WAO A;  3PTF C;  2JRI B;  1ZW7 A;  2O2V A;  4K1R B;  3HM6 X;  4W9D A;  2DEN B;  3OJ4 B;  2IO1 B;  3H6N A;  3VQI A;  2JWZ A;  2WX1 A;  3HK0 A;  4KZC A;  3QHT A;  1F9J A;  5LLI A;  5G2N A;  4PS8 A;  5C1Z A;  1RLF A;  3GOE A;  1R4N I;  1KJT A;  2ZJD A;  2KX0 A;  1MG8 A;  1WGR A;  4NAW B;  2LZ6 A;  3PLV A;  3JYU A;  1WXA A;  4A3O A;  1RFA A;  1UZX B;  1WGH A;  3PZD A;  2ZPN A;  3TIX A;  3MJW A;  2KWU B;  5L83 A;  1WFY A;  1E7U A;  2GBJ A;  2FCM A;  3VTV A;  5D6J B;  5LXH A;  2FID A;  4E74 A;  4LDT B;  2Y5B B;  3A9K B;  3MTN B;  3PT2 B;  4K81 A;  1IPG A;  2KFK A;  2M1M A;  2ZVN A;  3VVW B;  4AUQ C;  1EO6 A;  3LJ3 A;  4W9G A;  4HCN B;  2GBK A;  2MBB B;  4JGH B;  4WJO A;  2Z0D B;  1G6J A;  3AU5 A;  5J2R A;  5LXI B;  1WM2 A;  2K6Q A;  3EFU A;  4B6W A;  2BWE S;  4WWP A;  3W1Y A;  2CHZ A;  1K8R B;  2JF5 A;  2KLG A;  2MP2 A;  2XK5 A;  3JSV A;  4XC2 A;  4BBN C;  2KWV B;  4F8C B;  2KLC A;  4W9K A;  4F1S A;  4K7W A;  4GIV A;  1Y8R C;  3PRZ A;  3DVN V;  2KKC A;  2K8H A;  2IO2 B;  2N4F A;  1ZGU B;  3N30 A;  4RM9 A;  4TV3 A;  2BYE A;  2NPT A;  3AXC A;  4HDO A;  5JZE B;  2KFJ A;  3ML8 A;  4M8M A;  3HM3 A;  2LJ5 A;  1H4R A;  2KOX A;  2UYZ B;  3IVF A;  3WAN A;  3H7P A;  1V81 A;  1V2Y A;  2NBW B;  2KTR A;  2YLM A;  4XX5 A;  3HHM A;  4W9J A;  5AEK B;  3TMP B;  4DK5 A;  1KLV A;  4KVG B;  2IYD B;  2L3Z A;  4DHZ B;  2CU1 A;  4DHZ E;  4HVB A;  1FXT B;  2C7H A;  2O6V B;  3DCG A;  1WY8 A;  3PLU A;  1GC6 A;  2K25 A;  2PE9 A;  3OLM D;  4GDL B;  3ZW3 A;  4ANU A;  4BOS C;  2FAZ A;  5AZG A;  3ZDT A;  3DQV A;  4JQW C;  2PEA A;  4LJP B;  1JRU A;  5FR6 A;  4BKS D;  2ZCC A;  4N9F 4;  2K8B A;  3VTW A;  4ANW A;  4TKN A;  2DYO A;  2RSU A;  3SHQ A;  3A4R A;  1V80 A;  2C7M B;  4JIO U;  1E90 A;  3RUL A;  1YJ1 A;  4BFR A;  4NNJ B;  2BYV E;  2DZM A;  3IFW B;  3EEC A;  2OOB B;  1V6E A;  1WZ3 A;  4EFO A;  1RAX A;  2BKR B;  3ML9 A;  2KX3 A;  3ONS A;  3A9J B;  3PGE A;  3H7S A;  1UBQ A;  4GOC A;  4I6L B;  4BKG A;  1SIF A;  4HWI B;  1YQB A;  2IBI B;  2L0T A;  2RD0 A;  3UGB B;  3KUD B;  1I42 A;  4HPM B;  2A4Z A;  3PRM B;  3ZO5 B;  1NI2 A;  1WXM A;  3DVG Y;  1LFD A;  1WJU A;  2MX2 A;  5EDS A;  1EF1 A;  1WR1 A;  2BGF A;  2M4N A;  5IAA C;  2KK8 A;  3ZRC A;  2AYO B;  3AUL A;  4CYE A;  2KO3 A;  3K9P B;  3ZRF A;  3IG3 A;  1V5O A;  3M95 A;  3M62 B;  4IM2 A;  1M94 A;  2V1Y A;  3DVN U;  1OQY A;  3APD A;  3TBL D;  4BKT A;  5KHQ A;  1WZ0 A;  3EC8 A;  4AJY B;  1P98 A;  2V3S A;  4HXD A;  4DBG A;  2NBU A;  4EOY A;  1GUA B;  2N7E A;  4AOF A;  4IC7 B;  4B95 A;  3UIO B;  4M8N A;  4DDG D;  3ZNI D;  2N1W A;  4A3P A;  4W9I A;  2NBV B;  3O65 B;  4OVU A;  3R7Q A;  1YX6 B;  2L00 B;  3P2B A;  2WDT B;  4IUM B;  4NQL B;  3AU4 A;  4IW0 A;  4K7U A;  1SGH A;  1UD7 A;  3SDL C;  4TQ1 A;  2JT4 B;  3IBE A;  4BOZ B;  1OGW A;  2A5U A;  2PJH A;  2LXC A;  5D2M B;  2CKH B;  4G11 A;  2KJ6 A;  3V6E B;  3VUW A;  3DDC B;  4WWN A;  1QZE A;  4E71 A;  2B3A A;  4IM0 A;  4XZ4 A;  2WYQ A;  2LD9 A;  5BO4 B;  3NZU A;  3QJZ A;  3VTU A;  2OJR A;  2UWQ A;  2HTH A;  3AI5 A;  2KFK B;  2HD5 B;  3DBL I;  3ECI A;  4I6P A;  4DWF A;  2BPS A;  4EKU A;  2J7Q B;  2IO3 B;  3ENE A;  3L17 A;  4FN2 A;  2GBR A;  4ZRI A;  3QWZ B;  2IY0 B;  4MH0 E;  4YL8 A;  4EZL A;  3PPA A;  2LVQ A;  2KHW B;  2N9E B;  1NBF C;  2KZR A;  2J0K A;  3MHS D;  1UGM A;  2KDI A;  3NZS A;  2KXJ A;  4GGQ A;  3JSV B;  2G3Q B;  3QAQ A;  1E8Z A;  4FA6 A;  4OVV A;  4K7S A;  5DPT A;  1U4A A;  5E6O A;  2MLB A;  3UQA A;  3VH3 B;  3BY4 B;  4AP4 C;  4NQK E;  1Q0W B;  3ZKJ C;  1UH6 A;  1V49 A;  1OEY J;  2BWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...