2N9KA

1h, 13c, and 15n chemical shift assignments for in vitro gb1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
57
structure length
57
Chain Sequence
b'MGTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein G
molecule tags Immune system
source organism Streptococcus sp. 'group g'
publication title Improved in-cell structure determination of proteins at near-physiological concentration
pubmed doi rcsb
total genus 15
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2015-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2n9kA00
1XCTL 2JWUA 4HJGE 1PGBA 4OZBA 2JU6X 2ZW0A 4OZAA 1PGAA 2RPVA 4WH4A 2N9KA 1GB4A 2QMTA 2N9LA 2EELA 4GLSC 4IOIE 2KWDA 4KGSA 1GB1A 2LGIA 4KGTA 2LUMA 2RMMA 2J52A 2KACA 1PGXA 1K53A 1QKZA 1HZ5A 1YMHE 1MVKA 1FCCC 5BMIA 2JSVX 2ON8A 4MACA 2JZPA 2KN4A 4KGRA 1K52A 1IGCA 1MI0A 3MP9A 4OZCA 1D4BA 2NMQA 1UWXA 1P7FA 2GI9A 1C9FA 1XCQL 1MHXA 5HHDG 2ZW1A 2K0PA 2IGGA 1FCLA 2ONQA 2I2YA 2IGDA 1HEZE 1MHHE 1KH0A 4IKGA 4D2KA 1IGDA 1XF5L 2KDMA 2QSDA 1EM7A 1K50A 2OEDA 1IBXB 1FD6A 1F2RC 1ZXHA 2IGHA 5BMHA 1HZ6A 3GB1A 1P7EA 2GB1A 2J53A 3V3XA 2LHDA 2LHEA 2PTLA 5BMGA 2PW9A 1Q10A 2I38A 1F2RI 2JXTA 3UI3A 5HI1A 3FILB 5HG2A 4HKZE 5HFYA 2PLPA 5JXVA 1MPEA 1IBXA 2N7JA 3FILA 1K51A 1YNTE 2KQ4X 1JMLA
chains in the Genus database with same CATH superfamily
2DX5B 3BVGA 2K8CA 3DWGC 1FXAA 1HE8A 1D5XC 2KDFB 4KV2A 4KZ0A 1P3QU 2A5UA 2LZ6A 4GLSC 1BMLC 4P6VF 4ZRJA 5GMVA 3N32A 2GBRA 1NYRA 3IT4B 2LUMA 3ZKJC 3VHTC 1GJZA 3PRPB 3PS6A 1E8YA 1QF6A 4PYUA 2LUEA 2LJIA 1EUVB 2HD5B 3QARA 4K1RB 3ZNHB 1IGCA 4KZCA 3ZTCA 2C7MB 3BVZA 3U8ZA 2NMQA 1WXSA 4FJYA 3W5UB 2KJ6A 4XWWA 2FUHB 3BWUD 1D5MC 3VAWA 2IGDA 3AEDB 3ZNGC 2RDBC 3VR9B 4DXFA 4B95A 3AE7B 4O1NA 1EM7A 4BKSA 1DOYA 4E71A 2BGFA 1IYFA 3DBRI 3H7PA 3ZDTA 1K50A 5JHBA 4XDCA 4W9GA 3AE1B 3BY4B 4RGMA 4PT5A 2O2VA 3ZJVA 1SEBD 2LGDA 3HVDA 2JUOA 2FCSA 3A1QB 5AEKB 1HZ6A 3GB1A 1P7EA 4WJPA 4XC2A 1AYFA 2CJNA 1XQQA 4JIOU 2PTLA 3H7PB 4J3OD 2CHXA 2MJ3A 4RH6A 4ARCA 2MJDA 2K3UA 3VH3B 4K7WA 5DPWA 3ZLZA 2ZVNA 1WXQA 2WP9B 5IP4D 3SFDB 4ZDVA 1NVID 2GBMA 4PS3A 4GOCA 1GNUA 4E74A 2K1FA 3NOBA 5C23A 4OVZA 5C2TB 4RGOS 2DZJA 2Z0EB 4OZAA 3H9DA 4WH4A 1KLVA 5TR5A 3T3NA 4ANXA 4BKSD 5IN7A 2E3TA 1VZ6A 3W1SA 2QCZA 2IO1B 4N9F4 2MBOA 3B2GA 3ZJUA 5G5HA 3R2TA 2JSVX 1RFKA 4M02A 4NPNA 2WDVB 1ET6A 4FHKA 2MCNB 1FXTB 2GLSA 4TMAB 1GC7A 2MH7A 1MI0A 2TSSA 5H8YE 1RFAA 3NS1A 5L83A 2R61A 2LFIA 2DAJA 4F1SA 3HRDD 3TEYA 1CQVA 2KLCA 2PEAA 5GXGB 2MHJA 3OJ3A 3R2IA 3ZRFA 3ZW3A 2D3BA 1E8WA 2QIEB 4BBNF 2R2QA 1E0ZA 1MHHE 2KDIA 3RPFC 3ZUNA 1R4MI 2XNAC 4TKNA 3H8HA 4BBNC 2J42A 3C8YA 2L32A 3VQIA 4I6NB 3C19A 2D07B 1D3ZA 2I1KA 2AWTA 1JQ4A 2VH1A 4MGIE 3T9LA 3VTVA 1R4NB 3N1ZC 2W54A 1VZ8A 2IBIB 1TS2A 1L2NA 2GB1A 1X1MA 5DPTA 1OFFA 1UH6A 1Q10A 1WJNA 1TY0A 5D7GA 2D3CA 1NI2A 3SFEB 1KLGD 2BWES 4WWNA 5H92C 2KAJA 4ANVA 1WM3A 2N7JA 3TL5A 2KC2A 4GU2A 1D5ZC 3A9JA 3DBHB 3PZDA 1SF0A 4ASWC 3TJPA 3AU4A 4IW0A 1YD8U 3P4RB 2ZZPB 3MC0B 4EEWA 1MG4A 2WHIA 3GZNB 2FBWB 2YEPF 2JRHA 3WALA 1KM7A 3ONSA 1IPGA 2QMTA 1WJ4A 1V6EA 2EELA 1L4DB 2KWDA 4GMVA 4KGSA 1C4CA 4EKUA 4AQ7A 1B9RA 5G2NA 4B9KA 1YQBA 1TZOA 3CF6E 3L13A 1V1PA 1FCCC 4WWMA 1OEYJ 3PRZA 4MH0E 2J0MA 2V3SA 5IAAC 1UGJA 2W3RA 1WX9A 4JWSC 1K52A 4AWJA 2J0JA 2X8XX 3ZO5B 3QJZA 2ZEQA 3I3TB 3PZ8A 1TS3A 3WA0A 4MSQB 2N1VA 3QA8A 1T6BX 4II2B 4LLGM 2LXCA 5EDSA 3Q69A 3DQVA 1E8ZA 4F7ZA 2BQQA 4NY0A 2KNBA 2BYFA 2PPHA 3DVNU 3RD2A 2DZIA 4GN1A 4OVVA 1WRIA 3KYCD 2OHFA 4LNNA 2G1EA 3SHQA 3KUCB 4DHZE 3UQBA 4URKA 5DCNA 4PK1A 1WE6A 2WGSA 1SE2A 1LQBA 1TIFA 2PW9A 3PLVA 4FA6A 4A9AA 2WQYB 2XK5B 2M0XA 4W9FA 2JZ3B 4WIPA 3ZTDA 4KX6B 4ANWA 2M17A 3QWZB 4FBJB 1MJDA 1SB3C 3DHGC 2OJWA 3X0WA 1YX5B 2V9HA 3A1QA 3TEXA 1T3QA 2KN5A 1YJJA 3AULA 2WXLA 3NZ3A 3CSFA 5MPOA 3NVWA 1XEEA 3IT6B 4G0NB 2REXA 3IAM1 3ZNID 4IM3A 4ANUA 4JLCA 4MACA 4MM3A 2MJEA 3PO0A 2BF8B 5HKHA 2N4FA 1TKGA 4FJVB 2A4ZA 3MP9A 3IBEA 1VR9A 2N9EB 2K22A 1JW9D 2GI9A 3ML9A 2WDTB 2E6XA 1HA5A 4WQOB 3MHZA 2DZMA 4WWPA 4MM3B 3DOWA 4HKQA 3WAPA 1R7SA 1RAXA 4D2KA 1IGDA 3UQAA 4HXDA 1I4QA 1XO3A 5LLIA 3R66C 3ZGZA 3QHTA 4AJYB 1JWSD 1FMAD 2K5PA 3M63B 4GDKA 2IY1B 3NHEB 4LK0M 4JGHB 3AE6B 4GXBA 1ZP0B 3VUYA 1UBQA 1TY2A 2AQ3B 2INNE 2J53A 2JX5A 5C1ZA 3DVNV 3Q8BA 4WAFA 2WXRA 4UDUC 2WLBA 2PLPA 2RR9A 3MHSD 3ZRCA 4DXGA 2WXGA 2WU2B 3Q3NC 2L7RA 3UINB 3Q8CA 2KQSA 1UELA 1IP9A 2SAKA 1I4GA 3V61A 1NYQA 3Q6BA 4S17A 1A70A 2JZZA 1V8CA 2ZW0A 3HM6X 3NRZA 4FJZA 4GDLB 2WXNA 2MBBB 2WS3B 3L0WB 1QOAA 3DBLB 4G50A 1LFDA 3AXCA 2WNMA 3BZDB 1V5OA 4DHJB 1VJKA 3SEBA 2KN4A 1F1HA 3B0AA 1WZ3A 3CMMB 3TEWA 1ZDXA 1ROEA 1E10A 3RMKC 1WYGA 1V49A 1WFYA 3VUWA 3TIXA 2IJ0A 4JL9A 1KOTA 1JCKB 1FFUA 2IZVB 1TKYA 5J18A 4M0WB 1LXDA 1NENB 2KOXA 2WXKA 1OQRA 3CSTA 2KT7A 3DPDA 3PZ7A 2WDRB 2W55A 3UIOB 4B0MA 2YLMA 3L17A 1ZXHA 4ARIA 2ZPYA 3ZNZB 2AL3A 3IVFA 4L23A 3AECB 4EZJA 3QIJA 1YQ3B 2NTSA 4HCNB 4EUTA 1R4MB 5BMGA 4US9A 2JY6A 2KFKA 2JXTA 3UI3A 3GOEA 2KWCA 3HVZA 4BVUC 2CR5A 4IUMB 5JXVA 2ICIA 4EZLA 2BB6A 2WX1A 3LYYA 2V4LA 1MFWA 2KQ4X 1TJEA 2KKCA 4FLHA 1Z2MA 5KHOA 1XCTL 2H89B 1PGBA 3RUIB 3V6CB 2JU6X 5CHWA 3GP7A 2WX0A 4LNOA 3Q8FA 1J7AA 1OEYA 3JYUA 1GB4A 3QX1A 2LI5A 3ZDMC 4JQWC 2PIAA 3PVLA 2IYDB 2N1WA 1JRPA 2LGIA 4RNAA 3D32A 3AE4B 2KACA 1K53A 1DYQA 4HPPA 2N9PC 3FC4A 2WXMA 5LXIB 2KZRA 2MW5A 1I4HA 2KHWB 2N7DA 1RWSA 2JZPA 2LRWA 3FAHA 1STEA 2KJHB 4RCOA 3AE3B 4A20A 4P1BC 2GBJA 3DDCB 3A4RA 3PGEA 2MQJA 1C9FA 2L1AA 1MHXA 2EMSA 1OTRB 4NAMA 2ONQA 3A33B 1FRRA 3BK1A 1V80A 3GS2A 3M62B 2VH2A 1FNUA 2EKEC 1HTOA 1AW7A 2DYOA 2AL6A 2KX3A 2BT6A 3RYTA 4EFOA 2LHDA 3VXWA 2LASA 3DBSA 4W9IA 5HI1A 5FR3A 5LXHA 3GE8C 4WURA 1WXMA 4DHZB 1C79A 1TT5B 1WGYA 2DLBA 1KJTA 2ACZB 4CHKA 3KUDB 1T0SC 3MTNB 4HDOA 1CMXB 4HRSA 1ZGUB 1JMLA 1L7YA 3N1YC 4ZOHC 4FADA 2JQRB 1P0RA 4ZYNA 2KC1A 3QC8B 1CJEA 2N9LA 4HVBA 1JWAD 3PLUA 1VLBA 4FXCA 1EWCA 4M8NA 1JWMD 4NZLB 1XXGA 2J52A 3BYYB 1QKZA 3E9SA 3EC8A 3RFZB 4HROA 1ZE3D 4ZRKA 2CHWA 4N6EB 3R3MA 2N0SB 2NS5A 5G5GA 3IFWB 3S2AA 3AEBB 4A3OA 2ZJDA 3HK0A 4LNIA 4XDDA 4DDID 1Y56A 4NQKE 4KSLC 5JH5C 1XCQL 3N1XC 2ZVOA 3RNBC 1D6EC 1XF5L 2KDMA 2KLGA 1SGHA 1QOFA 1L5PA 2IO2B 1LGRA 1FEHA 3V6EB 1FD6A 1WWTA 5BO4B 1N5XA 4YSXB 2D10A 3LJ3A 5E6PA 2MP2A 2LXAA 1CK1A 4AJWA 3W1SC 5AZHA 2KXJA 2K6QA 3AMZA 2NTTA 2LVPA 4JPSA 1RLFA 3JSVB 3FILA 2G45B 4N58A 1WM2A 1K51A 1AARA 1T5XD 2PJHA 2QJLA 3R8BA 4ZHPA 2HE7A 3MJ5A 2PKOA 1EF5A 2UYZB 2AQ2B 3KQ4A 3TUOA 4TQ0A 1QOBA 1WY8A 5DPRA 3N9YC 2RGFA 1F0ZA 1C76A 2MX2A 4BZAA 1V1PB 3BK2A 2KANA 5KHQA 3DWMA 1WE7A 3AM9A 5BMIA 1QQRA 3ZQ4A 4GGQA 3C0RB 2RD0A 4XZ4A 4RF1A 3AH7A 4YTMB 1YN5A 3BINA 3P2BA 1JWBD 3APFA 2MA9B 4GB9A 2GMIC 2K8HA 2BKRB 3KWLA 3WCQA 4OVUA 2K0PA 1JRUA 1EWYC 1V5TA 1XLOA 4ZYSA 4ICVA 1ZXIA 3ALBA 4B6WA 4A8XC 1GC6A 2LGXA 1M94A 4LDTD 3BVMA 1KRHA 2JXXA 4W9LA 2XEWA 2Z59B 3NUHB 3EHVA 1Q5WB 4JX1C 4LJOB 2FIDA 2JRIB 1SJHD 2ZPNA 3UIPB 2FE8A 1EO6A 2DENB 3FKYA 1VCBA 1GAQB 2MSED 1V9JA 3OG5A 1BXTA 1HQRD 1WX8A 2FUG1 1E9MA 2L52A 4C4VB 2WYQA 2AEHA 1Y8RC 3VTUA 2MWSB 3VUXA 2KFJA 2J7QB 4MDKE 1OGWA 2GRIA 4YT0B 1WZ0A 3L08A 2BS2B 2B76B 1KFYB 1F77A 3AB5A 3Q3JA 4TSSA 1V86A 2RPVA 1WH3A 4DXAB 3AEFB 1GG3A 3MC8A 4A6QA 3EUB2 1UZXB 1N63A 1TS5A 4II3B 4M8MA 1YQ4B 2LGSA 5EE1A 3M3JA 3MFGA 2L05A 1YN3A 1GB1A 2RMMA 5D94A 5AZFA 4JWUC 1PGXA 2KTRB 1L0YB 1FNVA 1YMHE 2ZCBA 4HEA1 1T0QC 1C4PA 2B3AA 1L0VB 1R4NI 4ZRQA 2WXHA 3DVGX 4MH8A 2CU3A 2FCMA 1GUAB 4ITKA 1UUPA 2L00B 3VH4B 4BOZB 1WXAA 2ZW1A 5IKCM 3WANA 1YIWA 2LVQA 4R3DA 4MSMB 4WAAA 1VDVA 2XBBC 1HEZE 2WXIA 4K81A 2G4SA 2G3QB 1TGZB 3ETRA 1SJED 4KKJA 1YOVB 4JE3B 3A4SC 3GZNI 4XE0A 1P1AA 3ZVVA 5JHAA 3PHXB 2I1JA 2VZKD 4M01A 3P63A 1ESFA 2KMCA 2UU7A 4ZHOA 4EOYA 3LB8C 1I35A 5J2RA 2KQ7A 4YXDB 2LHEA 1TKEA 1YX6B 1F2RI 2NCNA 1ZW7A 4C7ZA 3DHIC 1WR6E 1C3TA 2WXPA 3DVGY 3HUIA 1VRAB 1UBIA 1WX7A 2MEKA 2EKIA 2PE6B 4C56C 1N5WA 1PGAA 2CU1A 2W82A 2V1YA 3SDLC 3EA6A 4C4VA 1S3SG 2Y5PA 2BB5A 1N60A 3V62A 1WF9A 1WGRA 3I63C 1GOZA 1EU3A 2MBEA 4DHJD 2O6VB 2DYMA 3KH0A 2D3GA 2RDHA 1GPXA 3B08A 5AZGA 1UWXA 4ZRPA 4MGYE 4B0EA 1JALA 3B9JA 2NBWB 3R7QA 4NJ7A 1WMHB 2KWVB 2WXQA 4KVGB 5FK9C 2OJRA 2Z0DB 1E7UA 5D6JB 4MT5A 2BKFA 2ZNVB 1PUTA 4XX5A 2R2OA 5BYQA 2K6DB 3L4PA 2OEDA 1IBXB 2V4IB 2LRUA 3EGRA 3EFCA 2KDBA 4NQLB 4YL8A 2C7HA 2KFKB 4M00A 1PDXA 3AEAB 1L0XB 3QCAA 5E6NA 3APDA 1N6ZA 4WJNA 2INPE 3E56A 3KVFB 2DWQA 4HKZE 2KWUB 4S0RA 3RN9C 5T8IA 2MLBA 3Q8AA 4C00A 2CJOA 2K25A 3O65B 4LCDE 1YNTE 3DHHC 3W9CB 4G3XB 2Y5BB 4PYZA 3V05A 5IO9A 4XYCA 1T0YA 1KLUD 4F8CB 3ECIA 3U7DA 1DOXA 4OW0A 2C60A 3VR8B 1NI3A 2BTEA 2WWZA 3QAQA 1TBEA 1Q1OA 4MJSA 1SXTA 5EE9A 3TCAA 1TZ1A 2IDYA 1WJ6A 2W9NA 4IWPA 4KSKC 1L6UA 5BYSA 4BOSC 4TV3A 3K9PB 3U30A 2WU5B 3TBLD 3VDZA 3L10B 4LTUA 3PV1A 2WXFA 4GDLA 4W9JA 4CO7A 4CQNA 1KH0A 3NZUA 3QQ8B 2QEJC 4GSWA 1T0RC 4YTPB 3PTFC 4WQMA 2NPTA 4EZKA 3PREA 5DPSA 4RMAA 3AE9B 2XN9C 3PHWB 4E3CA 1TYGB 4HPLB 1V97A 2SEBD 3KWVA 2X38A 1FPYA 5BYRA 3AEEB 2QDFA 3Q3OC 1XLNA 3ZIMA 3AV8A 4KDLB 3VVWB 1PQSA 2V3PA 2BPSA 1QZEA 5J17A 4KIKB 4C80A 5FKAC 3OAWA 5HFYA 1UGMA 1IBXA 4RM8A 2LWPA 1XLQA 1FIQA 2FIFA 4ZRIA 2V0GA 2GBKA 2LEKA 2AYOB 2VZKB 3L16A 4X57B 2MBQA 5TSSA 3KYDD 3URYA 2DZKA 4L2YA 1UF0A 5FR6A 2MRPA 2M4NA 2ZNVC 3ZYYX 4HCPB 3ZJTA 1Z5SB 4HJKA 1SE9A 3H6NA 3X23A 2H88B 1HZ5A 4W9EA 2NBVB 1V1OA 1XT9B 3W5VB 1A5RA 3Q3FA 3P4PB 1J7BA 3J9CA 3AN1A 4YSZB 2BS3B 1ACCA 1JROA 3P4SB 2N7EA 1ZOYB 4BKTA 4L1BA 3V60A 1QOGA 2DNFA 1ENFA 2XK5A 1P7FA 2QC8A 5HHDG 4P1CC 2OOBB 3DCGA 3VFKA 4HLEA 5G55A 1I42A 3OJ4B 3A9JB 3P1MA 4N59A 3B1LX 2QSDA 2L76A 1FNWA 1QLBB 1WIAA 1WXVA 2HDEA 1YJ1A 2KYWA 2LD9A 3W1YA 3PRMB 3V3XA 1KF6B 2KVZA 2DBYA 2O2VB 2RSUA 4DBGA 2G4DB 2I38A 2VRRB 3NY5A 3FILB 1H8CA 3ZXVA 3NVZA 2Q5WD 1P98A 4DK5A 1YN4A 2L0TA 1WR1A 1VD2A 5CTRC 4MGKE 4MELA 4YWGG 1E7PB 3R7RA 3I9V1 1F52A 1KTKA 2M0AA 4NAWA 4LJPB 3N3KB 3VRBB 5E6JA 2CS4A 4CYEA 2C5LC 4K7UA 2EMTA 2KDEB 1BT0A 4LDTB 3HM3A 2W3SA 1LM8B 3EFUA 3AE5B 4DDGD 1Q0WB 4IOIE 4RM9A 4GDKB 4MGZE 3RULA 4QAYA 2K8BA 2INDC 2JWZA 2HJ8A 2RDGA 2YVCA 4J6IA 2O6VD 3W2DA 4HDQA 3JW0X 3UGBB 3DBLI 1SIJA 4RGTA 5D3IB 2BWFA 4RFBA 2MBHA 1PFDA 2CHZA 3DBHI 3LXFA 5AUKA 3TMPB 2KTFA 4IC7B 3RCZA 4AP4C 2J4XA 2IGGA 1FCLA 2L8JA 2PMVA 2GBNA 2NR2A 4PS7A 4IKGA 3AU5A 1RRBA 4AUQC 1RM6C 3NS8A 3LDZE 3VRAB 2WXJA 4MJSB 1MG8A 4FN2A 2D11A 3APCA 1QILA 4HPMB 3L54A 4IM2A 4W9CA 4KDIC 1WGDA 1UNSA 2JT4B 5C3JB 3NZSA 1J8CA 2ZCCA 3ML8A 1NBFC 5HG2A 2L0FA 5CX3A 1C78A 2IO3B 2J0KA 3ABVB 2QILA 4NJCA 2NVUI 3JVZX 1I4RA 4ICUA 2NPTB 2C7NB 2BYTA 1WYWB 2M19A 1F9JA 3RT3B 3RNGC 4HJGE 4OZBA 3ZXRA 2FAZA 1QT9A 2KO3A 2N9KA 2MP2B 4US8A 2AX5A 3O13A 1C1YB 3IAS1 2PVOD 5L95C 4BFRA 2O6VA 4A3PA 3CIRB 1CZPA 1AWDA 1N61A 3K9OB 3SU8X 3RZWC 4OHJA 1WGGA 2DHZA 2K39A 1D4BA 2PVGC 5IA7A 2BYVE 1WGHA 3U52E 1H4RA 4YSYB 3HIZA 3MC9A 1V81A 2UWQA 1RYJA 2QHOA 4NJ6A 4REZA 4XGAB 5I4DA 2IO0B 2L3ZA 4YTNB 4TUUA 4IG7B 4TQ1A 4MEMA 1FM0D 2HJ1A 2JPHA 1WJUA 1N62A 2BYEA 1F2RC 1OQQA 5EE3A 1HXYD 1S1QB 2KMMA 3I57A 1J7CA 1E90A 1V2YA 1E7VA 2LVOA 4K7SA 3RI7C 3PPAA 1E5WA 1SE4A 2BVCA 1DGJA 2M8SA 4EE2A 1ISNA 2D5GA 4NNJB 4XWTA 5E6OA 2D2QA 4AOFA 1AN8A 5D2MB 3GE3C 2YEPB 2WDQB 3TSSA 2KMAA 2JWUA 3VTWA 4IDIA 1EF1A 2FCNA 4WJOA 4WJQA 3RZFA 3WAMA 3BYTB 3NG0A 2L83A 5CHFA 2AQ1B 1PYWD 3B2FA 4IWOA 3AEGB 1ZUD2 3PSEB 2PE9A 4LNFA 3SD5A 2Y3AA 2NBUA 4RF0A 1ZPSA 4P7IA 3U7ZA 2INCC 1WGKA 2LGYA 1SIFA 2M56B 4KGRA 2M1MA 4OZCA 2RPQA 3JSVA 2Y5CA 1SE3A 3RNAC 3P42A 1FO4A 2KK8A 5IOIA 1E8XA 1HTQA 5JZEB 1FXIA 3IXSA 2BBCA 1JWUD 3EECA 1P9DU 1K8RB 2WXOA 2DYBA 3KW5B 2I2YA 3A9KB 3IG3A 4IM0A 3RNCC 3NVYA 3HHMA 3U4EG 5EE0A 2LJ5A 2JVCA 2KTRA 3Q8EA 3QK0A 3KUZA 3RNFC 5LNK1 1FFVA 3P4QB 4KIKA 2IGHA 1L4ZB 3N30A 3A9KA 1YJIA 4DWFA 1NEKB 3MJWA 3RNEC 4RGNA 4PS8A 1XD3B 2JYTA 4DQOC 4WWOA 3I5JC 2N9XA 1B1ZA 3Q2AC 3Q3MC 1WI0A 3AE8B 4H2AA 2FCQA 1EU4A 1XLPA 4AS1A 3AI5A 1LO5D 1UD7A 1WRDB 2JYEA 1C77A 4A90A 1M4VA 2ASQA 3AE2B 4HWIB 2C9WB 3WIMA 3T3OA 3T8MA 3Q14C 4K3BA 1E6EB 3CWIA 4W9KA 2CKHB 1U4AA 3NJTA 3IHPC 2Z8LA 1ZKHA 4KGTA 4FHJA 3DBRB 3M95A 1MVKA 3OWEB 2ON8A 1SBBB 4GIVA 4USAA 1J0GA 2D3AA 3SR6A 4K3CA 1I7HA 3ENEA 4KKIA 4IWQA 2FNJB 1G6JA 5D3DA 3H1UA 3WAOA 1I4PA 2HTME 1WMHA 4A55A 4C7YA 1VZ7A 2K9XA 1J19A 4ACFA 4W9DA 3KLSX 1ZDVA 3TEZA 4HK2A 4I6LB 4BAXA 1I4XA 4G11A 4Q2JA 2V3NA 1ET9A 3BIID 4M0WA 1SSNA 4LNKA 4BKGA 3UF8A 5BMHA 2JF5A 1C4AA 1UWMA 2KJRA 2IPKD 2GOWA 4I6PA 4P16A 2KVRA 4NAWB 2G9HD 1WSPA 3N20C 1FRDA 2KD0A 5CHVC 1BUIC 2IY0B 3H7SA 1L6VA 3U2SC 1NDDA 2HTHA 4W9HA 1TS4A 1MPEA 2KX0A 1DOIA 3NVVA 2BS4B 2DAFA 3PT2B 2LMCA 2BW2A 5AUIA 3OLMD 1TTNA 4FULA 1OQYA 1IUEA
chains in the Genus database with same CATH topology
1NYQA 2GRIA 4YT0B 1A70A 2BS2B 3BVGA 2B76B 1KFYB 1F77A 1V8CA 2ZW0A 3AB5A 3DWGC 1FXAA 4TSSA 2RPVA 3NRZA 2W3SA 1D5XC 3AEFB 4GDLB 4A6QA 3AE5B 3EUB2 1N63A 1TS5A 2WXNA 1YQ4B 4GLSC 4IOIE 1BMLC 4P6VF 5EE1A 4GDKB 3MFGA 2WS3B 1YN3A 1NYRA 1GB1A 1QOAA 3IT4B 2LUMA 2RMMA 4JWUC 1PGXA 1L0YB 1FNVA 1YMHE 2RDGA 2WNMA 4HEA1 3BZDB 1C4PA 3W2DA 1QF6A 1VJKA 3SEBA 2LJIA 2KN4A 1L0VB 4ZRQA 1IGCA 1SIJA 2WXHA 3BVZA 4RGTA 3TEWA 4MH8A 5D3IB 2CU3A 2NMQA 4RFBA 1ZDXA 1PFDA 4ITKA 1ROEA 1E10A 3LXFA 1UUPA 1WYGA 5AUKA 3W5UB 2ZW1A 2IJ0A 4XWWA 4R3DA 3BWUD 1JCKB 1FFUA 2J4XA 2IGGA 1FCLA 1D5MC 2PMVA 1VDVA 2IGDA 3AEDB 1HEZE 2WXIA 3VR9B 4IKGA 1TKYA 4DXFA 3AE7B 4O1NA 1EM7A 1RM6C 1DOYA 3VRAB 1NENB 3ETRA 2WXJA 2WXKA 1SJED 1K50A 1OQRA 3PZ7A 4KKJA 2WDRB 4JE3B 1QILA 4XDCA 2W55A 4XE0A 3AE1B 4RGMA 4B0MA 4PT5A 1ZXHA 3ZJVA 1SEBD 4ARIA 2VZKD 3HVDA 3P63A 1ESFA 4L23A 3AECB 1HZ6A 1UNSA 1P7EA 3GB1A 4ZHOA 1AYFA 1YQ3B 2NTSA 2CJNA 3LB8C 5C3JB 4YXDB 2LHEA 2PTLA 5BMGA 4US9A 1TKEA 1F2RI 2JXTA 4J3OD 3UI3A 2MJ3A 4RH6A 4ARCA 2MJDA 5HG2A 2K3UA 4C7ZA 1C78A 3ABVB 3HVZA 5JXVA 2QILA 2ICIA 4NJCA 1I4RA 1WXQA 2BB6A 2WXPA 2WP9B 3HUIA 3LYYA 3SFDB 1NVID 1VRAB 2BYTA 2KQ4X 2M19A 1TJEA 4OVZA 1XCTL 2H89B 4HJGE 1PGBA 4OZBA 4RGOS 5C2TB 2MEKA 2JU6X 1QT9A 2EKIA 4OZAA 3GP7A 4C56C 1N5WA 3Q8FA 1J7AA 1PGAA 4WH4A 2N9KA 1GB4A 2W82A 3T3NA 4US8A 2AX5A 3O13A 2E3TA 3IAS1 1VZ6A 2PVOD 3EA6A 2PIAA 3W1SA 2Y5PA 1JRPA 2LGIA 4RNAA 2BB5A 3AE4B 3CIRB 2KACA 1K53A 1DYQA 1N60A 3B2GA 1CZPA 3ZJUA 3FC4A 5G5HA 2WXMA 3R2TA 2JSVX 1RFKA 1AWDA 1N61A 2WDVB 1I4HA 1ET6A 1RWSA 2JZPA 1GOZA 3FAHA 1STEA 4TMAB 2MH7A 1EU3A 1MI0A 4RCOA 4OHJA 2TSSA 5H8YE 3AE3B 2DYMA 2RDHA 1D4BA 2PVGC 3NS1A 1GPXA 1UWXA 4ZRPA 2R61A 4B0EA 2L1AA 2LFIA 1MHXA 1C9FA 3HRDD 1JALA 3B9JA 3TEYA 1CQVA 3U52E 4YSYB 5GXGB 2WXQA 3R2IA 4NAMA 5FK9C 2QIEB 2ONQA 1RYJA 1E0ZA 4MT5A 1MHHE 1FRRA 3BK1A 3RPFC 4REZA 2XNAC 1PUTA 5I4DA 4YTNB 3H8HA 3GS2A 2J42A 3C8YA 4TQ1A 5BYQA 2L32A 1FNUA 3L4PA 1FM0D 2OEDA 3VQIA 2V4IB 1IBXB 3EGRA 1AW7A 2DYOA 1N62A 1JQ4A 1F2RC 2BT6A 2W54A 1VZ8A 1OQQA 5EE3A 1HXYD 1PDXA 1TS2A 2KMMA 3AEAB 3I57A 2GB1A 1J7CA 1L0XB 2LHDA 1OFFA 1Q10A 1SE4A 1TY0A 5HI1A 1DGJA 2INPE 3E56A 5D7GA 3SFEB 5FR3A 1KLGD 4WURA 2DWQA 4HKZE 5H92C 5T8IA 1C79A 2KAJA 3Q8AA 4EE2A 2DLBA 2CJOA 2N7JA 2ACZB 2D5GA 4XWTA 1D5ZC 1SF0A 1AN8A 1YNTE 4HRSA 1JMLA 3W9CB 2YEPB 2WDQB 3TSSA 2JWUA 3P4RB 4ZOHC 4IDIA 3MC0B 3V05A 3BYTB 2L83A 2FBWB 2YEPF 2AQ1B 1PYWD 3B2FA 2JQRB 3AEGB 1ZUD2 1KLUD 2QMTA 1CJEA 2N9LA 2EELA 1JWAD 1DOXA 1L4DB 2Y3AA 2KWDA 4OW0A 1VLBA 4FXCA 4RF0A 1EWCA 1ZPSA 3VR8B 4KGSA 1C4CA 1JWMD 4AQ7A 4NZLB 1B9RA 3U7ZA 1XXGA 2J52A 1NI3A 3BYYB 1QKZA 2BTEA 1TZOA 3E9SA 3RFZB 4HROA 1V1PA 1FCCC 1SXTA 5EE9A 4WWMA 1ZE3D 1WGKA 2IDYA 1UGJA 2M56B 4N6EB 2W3RA 4KGRA 4JWSC 1K52A 2N0SB 4OZCA 5G5GA 3AEBB 2Y5CA 1SE3A 3P42A 4XDDA 1FO4A 1Y56A 3PZ8A 1TS3A 1FXIA 1L6UA 1XCQL 3IXSA 5BYSA 2BBCA 1JWUD 2WU5B 1T6BX 2WXOA 2I2YA 4LTUA 2WXFA 4LLGM 4CQNA 1D6EC 1KH0A 1XF5L 2KDMA 3Q69A 1QOFA 2QEJC 3NVYA 4YTPB 1L5PA 4WQMA 3U4EG 5EE0A 1FEHA 3AE9B 3Q8EA 2XN9C 1WRIA 1FD6A 1TYGB 1WWTA 5LNK1 1FFVA 2OHFA 1N5XA 4YSXB 3P4QB 1V97A 2SEBD 3KWVA 2X38A 2G1EA 2IGHA 1L4ZB 5BYRA 3AEEB 1YJIA 1XLNA 1CK1A 3AV8A 1NEKB 1SE2A 2PW9A 2V3PA 4RGNA 4A9AA 2JYTA 4DQOC 3AMZA 2NTTA 2WQYB 4C80A 5FKAC 4JPSA 5HFYA 1B1ZA 1IBXA 3AE8B 4H2AA 3FILA 1EU4A 4WIPA 1XLPA 4N58A 4AS1A 1K51A 1T5XD 1XLQA 4KX6B 2QJLA 1FIQA 1LO5D 3R8BA 2V0GA 4ZHPA 2LEKA 2VZKB 2JYEA 1C77A 4A90A 1SB3C 1M4VA 2PKOA 3MJ5A 2AQ2B 3KQ4A 3AE2B 5TSSA 3TUOA 4TQ0A 1QOBA 3TEXA 1T3QA 3T3OA 3N9YC 1YJJA 1E6EB 3CWIA 2WXLA 3NZ3A 3URYA 1F0ZA 1C76A 4L2YA 5MPOA 3NVWA 1V1PB 1XEEA 3BK2A 3ZYYX 3IT6B 3ZJTA 2Z8LA 4KGTA 3DWMA 3IAM1 2H88B 1HZ5A 1MVKA 3AM9A 5BMIA 1V1OA 1QQRA 2ON8A 1SBBB 3OWEB 3ZQ4A 3W5VB 4MACA 4USAA 2MJEA 3PO0A 3P4PB 1J7BA 1TKGA 3J9CA 3AN1A 4RF1A 2BS3B 3AH7A 3SR6A 4YSZB 3MP9A 1ACCA 1JROA 3P4SB 4YTMB 1I7HA 1YN5A 1ZOYB 4L1BA 1VR9A 4KKIA 1JWBD 1QOGA 2K22A 1JW9D 5D3DA 1ENFA 1P7FA 2GI9A 3KWLA 3WCQA 1I4PA 2HTME 5HHDG 2K0PA 4A55A 2E6XA 1HA5A 1EWYC 4C7YA 3MHZA 1VZ7A 2K9XA 1XLOA 4MM3B 4ZYSA 4HKQA 1R7SA 3P1MA 4D2KA 1IGDA 1ZXIA 4N59A 2QSDA 1FNWA 1I4QA 1QLBB 1ZDVA 3KLSX 1XO3A 2HDEA 3TEZA 3ZGZA 4A8XC 1JWSD 1FMAD 2K5PA 1I4XA 4Q2JA 2V3NA 3BVMA 1ET9A 4LK0M 1KRHA 3BIID 4M0WA 1SSNA 3AE6B 3NUHB 1ZP0B 4JX1C 5BMHA 1TY2A 2AQ3B 2INNE 1C4AA 1UWMA 2J53A 3V3XA 1KF6B 2IPKD 2DBYA 1SJHD 2JX5A 4P16A 4NAWB 2I38A 2G9HD 1WSPA 3Q8BA 1FRDA 2FE8A 3FILB 1BUIC 3NVZA 2Q5WD 2WXRA 1L6VA 4WAFA 4UDUC 3U2SC 2WLBA 1YN4A 1GAQB 1BXTA 1HQRD 2PLPA 1TS4A 1MPEA 2FUG1 2L52A 1DOIA 1E9MA 3NVVA 2BS4B 1E7PB 2WXGA 2WU2B 4YWGG 4DXGA 3I9V1 2LMCA 3Q8CA 2BW2A 5AUIA 1KTKA 2SAKA 2M0AA 1I4GA 1IUEA 3VRBB 5E6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XCT L;  2JWU A;  4HJG E;  1PGB A;  4OZB A;  2JU6 X;  2ZW0 A;  4OZA A;  1PGA A;  2RPV A;  4WH4 A;  2N9K A;  1GB4 A;  2QMT A;  2N9L A;  2EEL A;  4GLS C;  4IOI E;  2KWD A;  4KGS A;  1GB1 A;  2LGI A;  4KGT A;  2LUM A;  2RMM A;  2J52 A;  2KAC A;  1PGX A;  1K53 A;  1QKZ A;  1HZ5 A;  1YMH E;  1MVK A;  1FCC C;  5BMI A;  2JSV X;  2ON8 A;  4MAC A;  2JZP A;  2KN4 A;  4KGR A;  1K52 A;  1IGC A;  1MI0 A;  3MP9 A;  4OZC A;  1D4B A;  2NMQ A;  1UWX A;  1P7F A;  2GI9 A;  1C9F A;  1XCQ L;  1MHX A;  5HHD G;  2ZW1 A;  2K0P A;  2IGG A;  1FCL A;  2ONQ A;  2I2Y A;  2IGD A;  1HEZ E;  1MHH E;  1KH0 A;  4IKG A;  4D2K A;  1IGD A;  1XF5 L;  2KDM A;  2QSD A;  1EM7 A;  1K50 A;  2OED A;  1IBX B;  1FD6 A;  1F2R C;  1ZXH A;  2IGH A;  5BMH A;  1HZ6 A;  3GB1 A;  1P7E A;  2GB1 A;  2J53 A;  3V3X A;  2LHD A;  2LHE A;  2PTL A;  5BMG A;  2PW9 A;  1Q10 A;  2I38 A;  1F2R I;  2JXT A;  3UI3 A;  5HI1 A;  3FIL B;  5HG2 A;  4HKZ E;  5HFY A;  2PLP A;  5JXV A;  1MPE A;  1IBX A;  2N7J A;  3FIL A;  1K51 A;  1YNT E;  2KQ4 X;  1JML A; 
#chains in the Genus database with same CATH topology
 2DX5 B;  3BVG A;  2K8C A;  3DWG C;  1FXA A;  1HE8 A;  1D5X C;  2KDF B;  4KV2 A;  4KZ0 A;  1P3Q U;  2A5U A;  2LZ6 A;  4GLS C;  1BML C;  4P6V F;  4ZRJ A;  5GMV A;  3N32 A;  2GBR A;  1NYR A;  3IT4 B;  2LUM A;  3ZKJ C;  3VHT C;  1GJZ A;  3PRP B;  3PS6 A;  1E8Y A;  1QF6 A;  4PYU A;  2LUE A;  2LJI A;  1EUV B;  2HD5 B;  3QAR A;  4K1R B;  3ZNH B;  1IGC A;  4KZC A;  3ZTC A;  2C7M B;  3BVZ A;  3U8Z A;  2NMQ A;  1WXS A;  4FJY A;  3W5U B;  2KJ6 A;  4XWW A;  2FUH B;  3BWU D;  1D5M C;  3VAW A;  2IGD A;  3AED B;  3ZNG C;  2RDB C;  3VR9 B;  4DXF A;  4B95 A;  3AE7 B;  4O1N A;  1EM7 A;  4BKS A;  1DOY A;  4E71 A;  2BGF A;  1IYF A;  3DBR I;  3H7P A;  3ZDT A;  1K50 A;  5JHB A;  4XDC A;  4W9G A;  3AE1 B;  3BY4 B;  4RGM A;  4PT5 A;  2O2V A;  3ZJV A;  1SEB D;  2LGD A;  3HVD A;  2JUO A;  2FCS A;  3A1Q B;  5AEK B;  1HZ6 A;  3GB1 A;  1P7E A;  4WJP A;  4XC2 A;  1AYF A;  2CJN A;  1XQQ A;  4JIO U;  2PTL A;  3H7P B;  4J3O D;  2CHX A;  2MJ3 A;  4RH6 A;  4ARC A;  2MJD A;  2K3U A;  3VH3 B;  4K7W A;  5DPW A;  3ZLZ A;  2ZVN A;  1WXQ A;  2WP9 B;  5IP4 D;  3SFD B;  4ZDV A;  1NVI D;  2GBM A;  4PS3 A;  4GOC A;  1GNU A;  4E74 A;  2K1F A;  3NOB A;  5C23 A;  4OVZ A;  5C2T B;  4RGO S;  2DZJ A;  2Z0E B;  4OZA A;  3H9D A;  4WH4 A;  1KLV A;  5TR5 A;  3T3N A;  4ANX A;  4BKS D;  5IN7 A;  2E3T A;  1VZ6 A;  3W1S A;  2QCZ A;  2IO1 B;  4N9F 4;  2MBO A;  3B2G A;  3ZJU A;  5G5H A;  3R2T A;  2JSV X;  1RFK A;  4M02 A;  4NPN A;  2WDV B;  1ET6 A;  4FHK A;  2MCN B;  1FXT B;  2GLS A;  4TMA B;  1GC7 A;  2MH7 A;  1MI0 A;  2TSS A;  5H8Y E;  1RFA A;  3NS1 A;  5L83 A;  2R61 A;  2LFI A;  2DAJ A;  4F1S A;  3HRD D;  3TEY A;  1CQV A;  2KLC A;  2PEA A;  5GXG B;  2MHJ A;  3OJ3 A;  3R2I A;  3ZRF A;  3ZW3 A;  2D3B A;  1E8W A;  2QIE B;  4BBN F;  2R2Q A;  1E0Z A;  1MHH E;  2KDI A;  3RPF C;  3ZUN A;  1R4M I;  2XNA C;  4TKN A;  3H8H A;  4BBN C;  2J42 A;  3C8Y A;  2L32 A;  3VQI A;  4I6N B;  3C19 A;  2D07 B;  1D3Z A;  2I1K A;  2AWT A;  1JQ4 A;  2VH1 A;  4MGI E;  3T9L A;  3VTV A;  1R4N B;  3N1Z C;  2W54 A;  1VZ8 A;  2IBI B;  1TS2 A;  1L2N A;  2GB1 A;  1X1M A;  5DPT A;  1OFF A;  1UH6 A;  1Q10 A;  1WJN A;  1TY0 A;  5D7G A;  2D3C A;  1NI2 A;  3SFE B;  1KLG D;  2BWE S;  4WWN A;  5H92 C;  2KAJ A;  4ANV A;  1WM3 A;  2N7J A;  3TL5 A;  2KC2 A;  4GU2 A;  1D5Z C;  3A9J A;  3DBH B;  3PZD A;  1SF0 A;  4ASW C;  3TJP A;  3AU4 A;  4IW0 A;  1YD8 U;  3P4R B;  2ZZP B;  3MC0 B;  4EEW A;  1MG4 A;  2WHI A;  3GZN B;  2FBW B;  2YEP F;  2JRH A;  3WAL A;  1KM7 A;  3ONS A;  1IPG A;  2QMT A;  1WJ4 A;  1V6E A;  2EEL A;  1L4D B;  2KWD A;  4GMV A;  4KGS A;  1C4C A;  4EKU A;  4AQ7 A;  1B9R A;  5G2N A;  4B9K A;  1YQB A;  1TZO A;  3CF6 E;  3L13 A;  1V1P A;  1FCC C;  4WWM A;  1OEY J;  3PRZ A;  4MH0 E;  2J0M A;  2V3S A;  5IAA C;  1UGJ A;  2W3R A;  1WX9 A;  4JWS C;  1K52 A;  4AWJ A;  2J0J A;  2X8X X;  3ZO5 B;  3QJZ A;  2ZEQ A;  3I3T B;  3PZ8 A;  1TS3 A;  3WA0 A;  4MSQ B;  2N1V A;  3QA8 A;  1T6B X;  4II2 B;  4LLG M;  2LXC A;  5EDS A;  3Q69 A;  3DQV A;  1E8Z A;  4F7Z A;  2BQQ A;  4NY0 A;  2KNB A;  2BYF A;  2PPH A;  3DVN U;  3RD2 A;  2DZI A;  4GN1 A;  4OVV A;  1WRI A;  3KYC D;  2OHF A;  4LNN A;  2G1E A;  3SHQ A;  3KUC B;  4DHZ E;  3UQB A;  4URK A;  5DCN A;  4PK1 A;  1WE6 A;  2WGS A;  1SE2 A;  1LQB A;  1TIF A;  2PW9 A;  3PLV A;  4FA6 A;  4A9A A;  2WQY B;  2XK5 B;  2M0X A;  4W9F A;  2JZ3 B;  4WIP A;  3ZTD A;  4KX6 B;  4ANW A;  2M17 A;  3QWZ B;  4FBJ B;  1MJD A;  1SB3 C;  3DHG C;  2OJW A;  3X0W A;  1YX5 B;  2V9H A;  3A1Q A;  3TEX A;  1T3Q A;  2KN5 A;  1YJJ A;  3AUL A;  2WXL A;  3NZ3 A;  3CSF A;  5MPO A;  3NVW A;  1XEE A;  3IT6 B;  4G0N B;  2REX A;  3IAM 1;  3ZNI D;  4IM3 A;  4ANU A;  4JLC A;  4MAC A;  4MM3 A;  2MJE A;  3PO0 A;  2BF8 B;  5HKH A;  2N4F A;  1TKG A;  4FJV B;  2A4Z A;  3MP9 A;  3IBE A;  1VR9 A;  2N9E B;  2K22 A;  1JW9 D;  2GI9 A;  3ML9 A;  2WDT B;  2E6X A;  1HA5 A;  4WQO B;  3MHZ A;  2DZM A;  4WWP A;  4MM3 B;  3DOW A;  4HKQ A;  3WAP A;  1R7S A;  1RAX A;  4D2K A;  1IGD A;  3UQA A;  4HXD A;  1I4Q A;  1XO3 A;  5LLI A;  3R66 C;  3ZGZ A;  3QHT A;  4AJY B;  1JWS D;  1FMA D;  2K5P A;  3M63 B;  4GDK A;  2IY1 B;  3NHE B;  4LK0 M;  4JGH B;  3AE6 B;  4GXB A;  1ZP0 B;  3VUY A;  1UBQ A;  1TY2 A;  2AQ3 B;  2INN E;  2J53 A;  2JX5 A;  5C1Z A;  3DVN V;  3Q8B A;  4WAF A;  2WXR A;  4UDU C;  2WLB A;  2PLP A;  2RR9 A;  3MHS D;  3ZRC A;  4DXG A;  2WXG A;  2WU2 B;  3Q3N C;  2L7R A;  3UIN B;  3Q8C A;  2KQS A;  1UEL A;  1IP9 A;  2SAK A;  1I4G A;  3V61 A;  1NYQ A;  3Q6B A;  4S17 A;  1A70 A;  2JZZ A;  1V8C A;  2ZW0 A;  3HM6 X;  3NRZ A;  4FJZ A;  4GDL B;  2WXN A;  2MBB B;  2WS3 B;  3L0W B;  1QOA A;  3DBL B;  4G50 A;  1LFD A;  3AXC A;  2WNM A;  3BZD B;  1V5O A;  4DHJ B;  1VJK A;  3SEB A;  2KN4 A;  1F1H A;  3B0A A;  1WZ3 A;  3CMM B;  3TEW A;  1ZDX A;  1ROE A;  1E10 A;  3RMK C;  1WYG A;  1V49 A;  1WFY A;  3VUW A;  3TIX A;  2IJ0 A;  4JL9 A;  1KOT A;  1JCK B;  1FFU A;  2IZV B;  1TKY A;  5J18 A;  4M0W B;  1LXD A;  1NEN B;  2KOX A;  2WXK A;  1OQR A;  3CST A;  2KT7 A;  3DPD A;  3PZ7 A;  2WDR B;  2W55 A;  3UIO B;  4B0M A;  2YLM A;  3L17 A;  1ZXH A;  4ARI A;  2ZPY A;  3ZNZ B;  2AL3 A;  3IVF A;  4L23 A;  3AEC B;  4EZJ A;  3QIJ A;  1YQ3 B;  2NTS A;  4HCN B;  4EUT A;  1R4M B;  5BMG A;  4US9 A;  2JY6 A;  2KFK A;  2JXT A;  3UI3 A;  3GOE A;  2KWC A;  3HVZ A;  4BVU C;  2CR5 A;  4IUM B;  5JXV A;  2ICI A;  4EZL A;  2BB6 A;  2WX1 A;  3LYY A;  2V4L A;  1MFW A;  2KQ4 X;  1TJE A;  2KKC A;  4FLH A;  1Z2M A;  5KHO A;  1XCT L;  2H89 B;  1PGB A;  3RUI B;  3V6C B;  2JU6 X;  5CHW A;  3GP7 A;  2WX0 A;  4LNO A;  3Q8F A;  1J7A A;  1OEY A;  3JYU A;  1GB4 A;  3QX1 A;  2LI5 A;  3ZDM C;  4JQW C;  2PIA A;  3PVL A;  2IYD B;  2N1W A;  1JRP A;  2LGI A;  4RNA A;  3D32 A;  3AE4 B;  2KAC A;  1K53 A;  1DYQ A;  4HPP A;  2N9P C;  3FC4 A;  2WXM A;  5LXI B;  2KZR A;  2MW5 A;  1I4H A;  2KHW B;  2N7D A;  1RWS A;  2JZP A;  2LRW A;  3FAH A;  1STE A;  2KJH B;  4RCO A;  3AE3 B;  4A20 A;  4P1B C;  2GBJ A;  3DDC B;  3A4R A;  3PGE A;  2MQJ A;  1C9F A;  2L1A A;  1MHX A;  2EMS A;  1OTR B;  4NAM A;  2ONQ A;  3A33 B;  1FRR A;  3BK1 A;  1V80 A;  3GS2 A;  3M62 B;  2VH2 A;  1FNU A;  2EKE C;  1HTO A;  1AW7 A;  2DYO A;  2AL6 A;  2KX3 A;  2BT6 A;  3RYT A;  4EFO A;  2LHD A;  3VXW A;  2LAS A;  3DBS A;  4W9I A;  5HI1 A;  5FR3 A;  5LXH A;  3GE8 C;  4WUR A;  1WXM A;  4DHZ B;  1C79 A;  1TT5 B;  1WGY A;  2DLB A;  1KJT A;  2ACZ B;  4CHK A;  3KUD B;  1T0S C;  3MTN B;  4HDO A;  1CMX B;  4HRS A;  1ZGU B;  1JML A;  1L7Y A;  3N1Y C;  4ZOH C;  4FAD A;  2JQR B;  1P0R A;  4ZYN A;  2KC1 A;  3QC8 B;  1CJE A;  2N9L A;  4HVB A;  1JWA D;  3PLU A;  1VLB A;  4FXC A;  1EWC A;  4M8N A;  1JWM D;  4NZL B;  1XXG A;  2J52 A;  3BYY B;  1QKZ A;  3E9S A;  3EC8 A;  3RFZ B;  4HRO A;  1ZE3 D;  4ZRK A;  2CHW A;  4N6E B;  3R3M A;  2N0S B;  2NS5 A;  5G5G A;  3IFW B;  3S2A A;  3AEB B;  4A3O A;  2ZJD A;  3HK0 A;  4LNI A;  4XDD A;  4DDI D;  1Y56 A;  4NQK E;  4KSL C;  5JH5 C;  1XCQ L;  3N1X C;  2ZVO A;  3RNB C;  1D6E C;  1XF5 L;  2KDM A;  2KLG A;  1SGH A;  1QOF A;  1L5P A;  2IO2 B;  1LGR A;  1FEH A;  3V6E B;  1FD6 A;  1WWT A;  5BO4 B;  1N5X A;  4YSX B;  2D10 A;  3LJ3 A;  5E6P A;  2MP2 A;  2LXA A;  1CK1 A;  4AJW A;  3W1S C;  5AZH A;  2KXJ A;  2K6Q A;  3AMZ A;  2NTT A;  2LVP A;  4JPS A;  1RLF A;  3JSV B;  3FIL A;  2G45 B;  4N58 A;  1WM2 A;  1K51 A;  1AAR A;  1T5X D;  2PJH A;  2QJL A;  3R8B A;  4ZHP A;  2HE7 A;  3MJ5 A;  2PKO A;  1EF5 A;  2UYZ B;  2AQ2 B;  3KQ4 A;  3TUO A;  4TQ0 A;  1QOB A;  1WY8 A;  5DPR A;  3N9Y C;  2RGF A;  1F0Z A;  1C76 A;  2MX2 A;  4BZA A;  1V1P B;  3BK2 A;  2KAN A;  5KHQ A;  3DWM A;  1WE7 A;  3AM9 A;  5BMI A;  1QQR A;  3ZQ4 A;  4GGQ A;  3C0R B;  2RD0 A;  4XZ4 A;  4RF1 A;  3AH7 A;  4YTM B;  1YN5 A;  3BIN A;  3P2B A;  1JWB D;  3APF A;  2MA9 B;  4GB9 A;  2GMI C;  2K8H A;  2BKR B;  3KWL A;  3WCQ A;  4OVU A;  2K0P A;  1JRU A;  1EWY C;  1V5T A;  1XLO A;  4ZYS A;  4ICV A;  1ZXI A;  3ALB A;  4B6W A;  4A8X C;  1GC6 A;  2LGX A;  1M94 A;  4LDT D;  3BVM A;  1KRH A;  2JXX A;  4W9L A;  2XEW A;  2Z59 B;  3NUH B;  3EHV A;  1Q5W B;  4JX1 C;  4LJO B;  2FID A;  2JRI B;  1SJH D;  2ZPN A;  3UIP B;  2FE8 A;  1EO6 A;  2DEN B;  3FKY A;  1VCB A;  1GAQ B;  2MSE D;  1V9J A;  3OG5 A;  1BXT A;  1HQR D;  1WX8 A;  2FUG 1;  1E9M A;  2L52 A;  4C4V B;  2WYQ A;  2AEH A;  1Y8R C;  3VTU A;  2MWS B;  3VUX A;  2KFJ A;  2J7Q B;  4MDK E;  1OGW A;  2GRI A;  4YT0 B;  1WZ0 A;  3L08 A;  2BS2 B;  2B76 B;  1KFY B;  1F77 A;  3AB5 A;  3Q3J A;  4TSS A;  1V86 A;  2RPV A;  1WH3 A;  4DXA B;  3AEF B;  1GG3 A;  3MC8 A;  4A6Q A;  3EUB 2;  1UZX B;  1N63 A;  1TS5 A;  4II3 B;  4M8M A;  1YQ4 B;  2LGS A;  5EE1 A;  3M3J A;  3MFG A;  2L05 A;  1YN3 A;  1GB1 A;  2RMM A;  5D94 A;  5AZF A;  4JWU C;  1PGX A;  2KTR B;  1L0Y B;  1FNV A;  1YMH E;  2ZCB A;  4HEA 1;  1T0Q C;  1C4P A;  2B3A A;  1L0V B;  1R4N I;  4ZRQ A;  2WXH A;  3DVG X;  4MH8 A;  2CU3 A;  2FCM A;  1GUA B;  4ITK A;  1UUP A;  2L00 B;  3VH4 B;  4BOZ B;  1WXA A;  2ZW1 A;  5IKC M;  3WAN A;  1YIW A;  2LVQ A;  4R3D A;  4MSM B;  4WAA A;  1VDV A;  2XBB C;  1HEZ E;  2WXI A;  4K81 A;  2G4S A;  2G3Q B;  1TGZ B;  3ETR A;  1SJE D;  4KKJ A;  1YOV B;  4JE3 B;  3A4S C;  3GZN I;  4XE0 A;  1P1A A;  3ZVV A;  5JHA A;  3PHX B;  2I1J A;  2VZK D;  4M01 A;  3P63 A;  1ESF A;  2KMC A;  2UU7 A;  4ZHO A;  4EOY A;  3LB8 C;  1I35 A;  5J2R A;  2KQ7 A;  4YXD B;  2LHE A;  1TKE A;  1YX6 B;  1F2R I;  2NCN A;  1ZW7 A;  4C7Z A;  3DHI C;  1WR6 E;  1C3T A;  2WXP A;  3DVG Y;  3HUI A;  1VRA B;  1UBI A;  1WX7 A;  2MEK A;  2EKI A;  2PE6 B;  4C56 C;  1N5W A;  1PGA A;  2CU1 A;  2W82 A;  2V1Y A;  3SDL C;  3EA6 A;  4C4V A;  1S3S G;  2Y5P A;  2BB5 A;  1N60 A;  3V62 A;  1WF9 A;  1WGR A;  3I63 C;  1GOZ A;  1EU3 A;  2MBE A;  4DHJ D;  2O6V B;  2DYM A;  3KH0 A;  2D3G A;  2RDH A;  1GPX A;  3B08 A;  5AZG A;  1UWX A;  4ZRP A;  4MGY E;  4B0E A;  1JAL A;  3B9J A;  2NBW B;  3R7Q A;  4NJ7 A;  1WMH B;  2KWV B;  2WXQ A;  4KVG B;  5FK9 C;  2OJR A;  2Z0D B;  1E7U A;  5D6J B;  4MT5 A;  2BKF A;  2ZNV B;  1PUT A;  4XX5 A;  2R2O A;  5BYQ A;  2K6D B;  3L4P A;  2OED A;  1IBX B;  2V4I B;  2LRU A;  3EGR A;  3EFC A;  2KDB A;  4NQL B;  4YL8 A;  2C7H A;  2KFK B;  4M00 A;  1PDX A;  3AEA B;  1L0X B;  3QCA A;  5E6N A;  3APD A;  1N6Z A;  4WJN A;  2INP E;  3E56 A;  3KVF B;  2DWQ A;  4HKZ E;  2KWU B;  4S0R A;  3RN9 C;  5T8I A;  2MLB A;  3Q8A A;  4C00 A;  2CJO A;  2K25 A;  3O65 B;  4LCD E;  1YNT E;  3DHH C;  3W9C B;  4G3X B;  2Y5B B;  4PYZ A;  3V05 A;  5IO9 A;  4XYC A;  1T0Y A;  1KLU D;  4F8C B;  3ECI A;  3U7D A;  1DOX A;  4OW0 A;  2C60 A;  3VR8 B;  1NI3 A;  2BTE A;  2WWZ A;  3QAQ A;  1TBE A;  1Q1O A;  4MJS A;  1SXT A;  5EE9 A;  3TCA A;  1TZ1 A;  2IDY A;  1WJ6 A;  2W9N A;  4IWP A;  4KSK C;  1L6U A;  5BYS A;  4BOS C;  4TV3 A;  3K9P B;  3U30 A;  2WU5 B;  3TBL D;  3VDZ A;  3L10 B;  4LTU A;  3PV1 A;  2WXF A;  4GDL A;  4W9J A;  4CO7 A;  4CQN A;  1KH0 A;  3NZU A;  3QQ8 B;  2QEJ C;  4GSW A;  1T0R C;  4YTP B;  3PTF C;  4WQM A;  2NPT A;  4EZK A;  3PRE A;  5DPS A;  4RMA A;  3AE9 B;  2XN9 C;  3PHW B;  4E3C A;  1TYG B;  4HPL B;  1V97 A;  2SEB D;  3KWV A;  2X38 A;  1FPY A;  5BYR A;  3AEE B;  2QDF A;  3Q3O C;  1XLN A;  3ZIM A;  3AV8 A;  4KDL B;  3VVW B;  1PQS A;  2V3P A;  2BPS A;  1QZE A;  5J17 A;  4KIK B;  4C80 A;  5FKA C;  3OAW A;  5HFY A;  1UGM A;  1IBX A;  4RM8 A;  2LWP A;  1XLQ A;  1FIQ A;  2FIF A;  4ZRI A;  2V0G A;  2GBK A;  2LEK A;  2AYO B;  2VZK B;  3L16 A;  4X57 B;  2MBQ A;  5TSS A;  3KYD D;  3URY A;  2DZK A;  4L2Y A;  1UF0 A;  5FR6 A;  2MRP A;  2M4N A;  2ZNV C;  3ZYY X;  4HCP B;  3ZJT A;  1Z5S B;  4HJK A;  1SE9 A;  3H6N A;  3X23 A;  2H88 B;  1HZ5 A;  4W9E A;  2NBV B;  1V1O A;  1XT9 B;  3W5V B;  1A5R A;  3Q3F A;  3P4P B;  1J7B A;  3J9C A;  3AN1 A;  4YSZ B;  2BS3 B;  1ACC A;  1JRO A;  3P4S B;  2N7E A;  1ZOY B;  4BKT A;  4L1B A;  3V60 A;  1QOG A;  2DNF A;  1ENF A;  2XK5 A;  1P7F A;  2QC8 A;  5HHD G;  4P1C C;  2OOB B;  3DCG A;  3VFK A;  4HLE A;  5G55 A;  1I42 A;  3OJ4 B;  3A9J B;  3P1M A;  4N59 A;  3B1L X;  2QSD A;  2L76 A;  1FNW A;  1QLB B;  1WIA A;  1WXV A;  2HDE A;  1YJ1 A;  2KYW A;  2LD9 A;  3W1Y A;  3PRM B;  3V3X A;  1KF6 B;  2KVZ A;  2DBY A;  2O2V B;  2RSU A;  4DBG A;  2G4D B;  2I38 A;  2VRR B;  3NY5 A;  3FIL B;  1H8C A;  3ZXV A;  3NVZ A;  2Q5W D;  1P98 A;  4DK5 A;  1YN4 A;  2L0T A;  1WR1 A;  1VD2 A;  5CTR C;  4MGK E;  4MEL A;  4YWG G;  1E7P B;  3R7R A;  3I9V 1;  1F52 A;  1KTK A;  2M0A A;  4NAW A;  4LJP B;  3N3K B;  3VRB B;  5E6J A;  2CS4 A;  4CYE A;  2C5L C;  4K7U A;  2EMT A;  2KDE B;  1BT0 A;  4LDT B;  3HM3 A;  2W3S A;  1LM8 B;  3EFU A;  3AE5 B;  4DDG D;  1Q0W B;  4IOI E;  4RM9 A;  4GDK B;  4MGZ E;  3RUL A;  4QAY A;  2K8B A;  2IND C;  2JWZ A;  2HJ8 A;  2RDG A;  2YVC A;  4J6I A;  2O6V D;  3W2D A;  4HDQ A;  3JW0 X;  3UGB B;  3DBL I;  1SIJ A;  4RGT A;  5D3I B;  2BWF A;  4RFB A;  2MBH A;  1PFD A;  2CHZ A;  3DBH I;  3LXF A;  5AUK A;  3TMP B;  2KTF A;  4IC7 B;  3RCZ A;  4AP4 C;  2J4X A;  2IGG A;  1FCL A;  2L8J A;  2PMV A;  2GBN A;  2NR2 A;  4PS7 A;  4IKG A;  3AU5 A;  1RRB A;  4AUQ C;  1RM6 C;  3NS8 A;  3LDZ E;  3VRA B;  2WXJ A;  4MJS B;  1MG8 A;  4FN2 A;  2D11 A;  3APC A;  1QIL A;  4HPM B;  3L54 A;  4IM2 A;  4W9C A;  4KDI C;  1WGD A;  1UNS A;  2JT4 B;  5C3J B;  3NZS A;  1J8C A;  2ZCC A;  3ML8 A;  1NBF C;  5HG2 A;  2L0F A;  5CX3 A;  1C78 A;  2IO3 B;  2J0K A;  3ABV B;  2QIL A;  4NJC A;  2NVU I;  3JVZ X;  1I4R A;  4ICU A;  2NPT B;  2C7N B;  2BYT A;  1WYW B;  2M19 A;  1F9J A;  3RT3 B;  3RNG C;  4HJG E;  4OZB A;  3ZXR A;  2FAZ A;  1QT9 A;  2KO3 A;  2N9K A;  2MP2 B;  4US8 A;  2AX5 A;  3O13 A;  1C1Y B;  3IAS 1;  2PVO D;  5L95 C;  4BFR A;  2O6V A;  4A3P A;  3CIR B;  1CZP A;  1AWD A;  1N61 A;  3K9O B;  3SU8 X;  3RZW C;  4OHJ A;  1WGG A;  2DHZ A;  2K39 A;  1D4B A;  2PVG C;  5IA7 A;  2BYV E;  1WGH A;  3U52 E;  1H4R A;  4YSY B;  3HIZ A;  3MC9 A;  1V81 A;  2UWQ A;  1RYJ A;  2QHO A;  4NJ6 A;  4REZ A;  4XGA B;  5I4D A;  2IO0 B;  2L3Z A;  4YTN B;  4TUU A;  4IG7 B;  4TQ1 A;  4MEM A;  1FM0 D;  2HJ1 A;  2JPH A;  1WJU A;  1N62 A;  2BYE A;  1F2R C;  1OQQ A;  5EE3 A;  1HXY D;  1S1Q B;  2KMM A;  3I57 A;  1J7C A;  1E90 A;  1V2Y A;  1E7V A;  2LVO A;  4K7S A;  3RI7 C;  3PPA A;  1E5W A;  1SE4 A;  2BVC A;  1DGJ A;  2M8S A;  4EE2 A;  1ISN A;  2D5G A;  4NNJ B;  4XWT A;  5E6O A;  2D2Q A;  4AOF A;  1AN8 A;  5D2M B;  3GE3 C;  2YEP B;  2WDQ B;  3TSS A;  2KMA A;  2JWU A;  3VTW A;  4IDI A;  1EF1 A;  2FCN A;  4WJO A;  4WJQ A;  3RZF A;  3WAM A;  3BYT B;  3NG0 A;  2L83 A;  5CHF A;  2AQ1 B;  1PYW D;  3B2F A;  4IWO A;  3AEG B;  1ZUD 2;  3PSE B;  2PE9 A;  4LNF A;  3SD5 A;  2Y3A A;  2NBU A;  4RF0 A;  1ZPS A;  4P7I A;  3U7Z A;  2INC C;  1WGK A;  2LGY A;  1SIF A;  2M56 B;  4KGR A;  2M1M A;  4OZC A;  2RPQ A;  3JSV A;  2Y5C A;  1SE3 A;  3RNA C;  3P42 A;  1FO4 A;  2KK8 A;  5IOI A;  1E8X A;  1HTQ A;  5JZE B;  1FXI A;  3IXS A;  2BBC A;  1JWU D;  3EEC A;  1P9D U;  1K8R B;  2WXO A;  2DYB A;  3KW5 B;  2I2Y A;  3A9K B;  3IG3 A;  4IM0 A;  3RNC C;  3NVY A;  3HHM A;  3U4E G;  5EE0 A;  2LJ5 A;  2JVC A;  2KTR A;  3Q8E A;  3QK0 A;  3KUZ A;  3RNF C;  5LNK 1;  1FFV A;  3P4Q B;  4KIK A;  2IGH A;  1L4Z B;  3N30 A;  3A9K A;  1YJI A;  4DWF A;  1NEK B;  3MJW A;  3RNE C;  4RGN A;  4PS8 A;  1XD3 B;  2JYT A;  4DQO C;  4WWO A;  3I5J C;  2N9X A;  1B1Z A;  3Q2A C;  3Q3M C;  1WI0 A;  3AE8 B;  4H2A A;  2FCQ A;  1EU4 A;  1XLP A;  4AS1 A;  3AI5 A;  1LO5 D;  1UD7 A;  1WRD B;  2JYE A;  1C77 A;  4A90 A;  1M4V A;  2ASQ A;  3AE2 B;  4HWI B;  2C9W B;  3WIM A;  3T3O A;  3T8M A;  3Q14 C;  4K3B A;  1E6E B;  3CWI A;  4W9K A;  2CKH B;  1U4A A;  3NJT A;  3IHP C;  2Z8L A;  1ZKH A;  4KGT A;  4FHJ A;  3DBR B;  3M95 A;  1MVK A;  3OWE B;  2ON8 A;  1SBB B;  4GIV A;  4USA A;  1J0G A;  2D3A A;  3SR6 A;  4K3C A;  1I7H A;  3ENE A;  4KKI A;  4IWQ A;  2FNJ B;  1G6J A;  5D3D A;  3H1U A;  3WAO A;  1I4P A;  2HTM E;  1WMH A;  4A55 A;  4C7Y A;  1VZ7 A;  2K9X A;  1J19 A;  4ACF A;  4W9D A;  3KLS X;  1ZDV A;  3TEZ A;  4HK2 A;  4I6L B;  4BAX A;  1I4X A;  4G11 A;  4Q2J A;  2V3N A;  1ET9 A;  3BII D;  4M0W A;  1SSN A;  4LNK A;  4BKG A;  3UF8 A;  5BMH A;  2JF5 A;  1C4A A;  1UWM A;  2KJR A;  2IPK D;  2GOW A;  4I6P A;  4P16 A;  2KVR A;  4NAW B;  2G9H D;  1WSP A;  3N20 C;  1FRD A;  2KD0 A;  5CHV C;  1BUI C;  2IY0 B;  3H7S A;  1L6V A;  3U2S C;  1NDD A;  2HTH A;  4W9H A;  1TS4 A;  1MPE A;  2KX0 A;  1DOI A;  3NVV A;  2BS4 B;  2DAF A;  3PT2 B;  2LMC A;  2BW2 A;  5AUI A;  3OLM D;  1TTN A;  4FUL A;  1OQY A;  1IUE A; 
#chains in the Genus database with same CATH homology
 1NYQ A;  2GRI A;  4YT0 B;  1A70 A;  2BS2 B;  3BVG A;  2B76 B;  1KFY B;  1F77 A;  1V8C A;  2ZW0 A;  3AB5 A;  3DWG C;  1FXA A;  4TSS A;  2RPV A;  3NRZ A;  2W3S A;  1D5X C;  3AEF B;  4GDL B;  4A6Q A;  3AE5 B;  3EUB 2;  1N63 A;  1TS5 A;  2WXN A;  1YQ4 B;  4GLS C;  4IOI E;  1BML C;  4P6V F;  5EE1 A;  4GDK B;  3MFG A;  2WS3 B;  1YN3 A;  1NYR A;  1GB1 A;  1QOA A;  3IT4 B;  2LUM A;  2RMM A;  4JWU C;  1PGX A;  1L0Y B;  1FNV A;  1YMH E;  2RDG A;  2WNM A;  4HEA 1;  3BZD B;  1C4P A;  3W2D A;  1QF6 A;  1VJK A;  3SEB A;  2LJI A;  2KN4 A;  1L0V B;  4ZRQ A;  1IGC A;  1SIJ A;  2WXH A;  3BVZ A;  4RGT A;  3TEW A;  4MH8 A;  5D3I B;  2CU3 A;  2NMQ A;  4RFB A;  1ZDX A;  1PFD A;  4ITK A;  1ROE A;  1E10 A;  3LXF A;  1UUP A;  1WYG A;  5AUK A;  3W5U B;  2ZW1 A;  2IJ0 A;  4XWW A;  4R3D A;  3BWU D;  1JCK B;  1FFU A;  2J4X A;  2IGG A;  1FCL A;  1D5M C;  2PMV A;  1VDV A;  2IGD A;  3AED B;  1HEZ E;  2WXI A;  3VR9 B;  4IKG A;  1TKY A;  4DXF A;  3AE7 B;  4O1N A;  1EM7 A;  1RM6 C;  1DOY A;  3VRA B;  1NEN B;  3ETR A;  2WXJ A;  2WXK A;  1SJE D;  1K50 A;  1OQR A;  3PZ7 A;  4KKJ A;  2WDR B;  4JE3 B;  1QIL A;  4XDC A;  2W55 A;  4XE0 A;  3AE1 B;  4RGM A;  4B0M A;  4PT5 A;  1ZXH A;  3ZJV A;  1SEB D;  4ARI A;  2VZK D;  3HVD A;  3P63 A;  1ESF A;  4L23 A;  3AEC B;  1HZ6 A;  1UNS A;  1P7E A;  3GB1 A;  4ZHO A;  1AYF A;  1YQ3 B;  2NTS A;  2CJN A;  3LB8 C;  5C3J B;  4YXD B;  2LHE A;  2PTL A;  5BMG A;  4US9 A;  1TKE A;  1F2R I;  2JXT A;  4J3O D;  3UI3 A;  2MJ3 A;  4RH6 A;  4ARC A;  2MJD A;  5HG2 A;  2K3U A;  4C7Z A;  1C78 A;  3ABV B;  3HVZ A;  5JXV A;  2QIL A;  2ICI A;  4NJC A;  1I4R A;  1WXQ A;  2BB6 A;  2WXP A;  2WP9 B;  3HUI A;  3LYY A;  3SFD B;  1NVI D;  1VRA B;  2BYT A;  2KQ4 X;  2M19 A;  1TJE A;  4OVZ A;  1XCT L;  2H89 B;  4HJG E;  1PGB A;  4OZB A;  4RGO S;  5C2T B;  2MEK A;  2JU6 X;  1QT9 A;  2EKI A;  4OZA A;  3GP7 A;  4C56 C;  1N5W A;  3Q8F A;  1J7A A;  1PGA A;  4WH4 A;  2N9K A;  1GB4 A;  2W82 A;  3T3N A;  4US8 A;  2AX5 A;  3O13 A;  2E3T A;  3IAS 1;  1VZ6 A;  2PVO D;  3EA6 A;  2PIA A;  3W1S A;  2Y5P A;  1JRP A;  2LGI A;  4RNA A;  2BB5 A;  3AE4 B;  3CIR B;  2KAC A;  1K53 A;  1DYQ A;  1N60 A;  3B2G A;  1CZP A;  3ZJU A;  3FC4 A;  5G5H A;  2WXM A;  3R2T A;  2JSV X;  1RFK A;  1AWD A;  1N61 A;  2WDV B;  1I4H A;  1ET6 A;  1RWS A;  2JZP A;  1GOZ A;  3FAH A;  1STE A;  4TMA B;  2MH7 A;  1EU3 A;  1MI0 A;  4RCO A;  4OHJ A;  2TSS A;  5H8Y E;  3AE3 B;  2DYM A;  2RDH A;  1D4B A;  2PVG C;  3NS1 A;  1GPX A;  1UWX A;  4ZRP A;  2R61 A;  4B0E A;  2L1A A;  2LFI A;  1MHX A;  1C9F A;  3HRD D;  1JAL A;  3B9J A;  3TEY A;  1CQV A;  3U52 E;  4YSY B;  5GXG B;  2WXQ A;  3R2I A;  4NAM A;  5FK9 C;  2QIE B;  2ONQ A;  1RYJ A;  1E0Z A;  4MT5 A;  1MHH E;  1FRR A;  3BK1 A;  3RPF C;  4REZ A;  2XNA C;  1PUT A;  5I4D A;  4YTN B;  3H8H A;  3GS2 A;  2J42 A;  3C8Y A;  4TQ1 A;  5BYQ A;  2L32 A;  1FNU A;  3L4P A;  1FM0 D;  2OED A;  3VQI A;  2V4I B;  1IBX B;  3EGR A;  1AW7 A;  2DYO A;  1N62 A;  1JQ4 A;  1F2R C;  2BT6 A;  2W54 A;  1VZ8 A;  1OQQ A;  5EE3 A;  1HXY D;  1PDX A;  1TS2 A;  2KMM A;  3AEA B;  3I57 A;  2GB1 A;  1J7C A;  1L0X B;  2LHD A;  1OFF A;  1Q10 A;  1SE4 A;  1TY0 A;  5HI1 A;  1DGJ A;  2INP E;  3E56 A;  5D7G A;  3SFE B;  5FR3 A;  1KLG D;  4WUR A;  2DWQ A;  4HKZ E;  5H92 C;  5T8I A;  1C79 A;  2KAJ A;  3Q8A A;  4EE2 A;  2DLB A;  2CJO A;  2N7J A;  2ACZ B;  2D5G A;  4XWT A;  1D5Z C;  1SF0 A;  1AN8 A;  1YNT E;  4HRS A;  1JML A;  3W9C B;  2YEP B;  2WDQ B;  3TSS A;  2JWU A;  3P4R B;  4ZOH C;  4IDI A;  3MC0 B;  3V05 A;  3BYT B;  2L83 A;  2FBW B;  2YEP F;  2AQ1 B;  1PYW D;  3B2F A;  2JQR B;  3AEG B;  1ZUD 2;  1KLU D;  2QMT A;  1CJE A;  2N9L A;  2EEL A;  1JWA D;  1DOX A;  1L4D B;  2Y3A A;  2KWD A;  4OW0 A;  1VLB A;  4FXC A;  4RF0 A;  1EWC A;  1ZPS A;  3VR8 B;  4KGS A;  1C4C A;  1JWM D;  4AQ7 A;  4NZL B;  1B9R A;  3U7Z A;  1XXG A;  2J52 A;  1NI3 A;  3BYY B;  1QKZ A;  2BTE A;  1TZO A;  3E9S A;  3RFZ B;  4HRO A;  1V1P A;  1FCC C;  1SXT A;  5EE9 A;  4WWM A;  1ZE3 D;  1WGK A;  2IDY A;  1UGJ A;  2M56 B;  4N6E B;  2W3R A;  4KGR A;  4JWS C;  1K52 A;  2N0S B;  4OZC A;  5G5G A;  3AEB B;  2Y5C A;  1SE3 A;  3P42 A;  4XDD A;  1FO4 A;  1Y56 A;  3PZ8 A;  1TS3 A;  1FXI A;  1L6U A;  1XCQ L;  3IXS A;  5BYS A;  2BBC A;  1JWU D;  2WU5 B;  1T6B X;  2WXO A;  2I2Y A;  4LTU A;  2WXF A;  4LLG M;  4CQN A;  1D6E C;  1KH0 A;  1XF5 L;  2KDM A;  3Q69 A;  1QOF A;  2QEJ C;  3NVY A;  4YTP B;  1L5P A;  4WQM A;  3U4E G;  5EE0 A;  1FEH A;  3AE9 B;  3Q8E A;  2XN9 C;  1WRI A;  1FD6 A;  1TYG B;  1WWT A;  5LNK 1;  1FFV A;  2OHF A;  1N5X A;  4YSX B;  3P4Q B;  1V97 A;  2SEB D;  3KWV A;  2X38 A;  2G1E A;  2IGH A;  1L4Z B;  5BYR A;  3AEE B;  1YJI A;  1XLN A;  1CK1 A;  3AV8 A;  1NEK B;  1SE2 A;  2PW9 A;  2V3P A;  4RGN A;  4A9A A;  2JYT A;  4DQO C;  3AMZ A;  2NTT A;  2WQY B;  4C80 A;  5FKA C;  4JPS A;  5HFY A;  1B1Z A;  1IBX A;  3AE8 B;  4H2A A;  3FIL A;  1EU4 A;  4WIP A;  1XLP A;  4N58 A;  4AS1 A;  1K51 A;  1T5X D;  1XLQ A;  4KX6 B;  2QJL A;  1FIQ A;  1LO5 D;  3R8B A;  2V0G A;  4ZHP A;  2LEK A;  2VZK B;  2JYE A;  1C77 A;  4A90 A;  1SB3 C;  1M4V A;  2PKO A;  3MJ5 A;  2AQ2 B;  3KQ4 A;  3AE2 B;  5TSS A;  3TUO A;  4TQ0 A;  1QOB A;  3TEX A;  1T3Q A;  3T3O A;  3N9Y C;  1YJJ A;  1E6E B;  3CWI A;  2WXL A;  3NZ3 A;  3URY A;  1F0Z A;  1C76 A;  4L2Y A;  5MPO A;  3NVW A;  1V1P B;  1XEE A;  3BK2 A;  3ZYY X;  3IT6 B;  3ZJT A;  2Z8L A;  4KGT A;  3DWM A;  3IAM 1;  2H88 B;  1HZ5 A;  1MVK A;  3AM9 A;  5BMI A;  1V1O A;  1QQR A;  2ON8 A;  1SBB B;  3OWE B;  3ZQ4 A;  3W5V B;  4MAC A;  4USA A;  2MJE A;  3PO0 A;  3P4P B;  1J7B A;  1TKG A;  3J9C A;  3AN1 A;  4RF1 A;  2BS3 B;  3AH7 A;  3SR6 A;  4YSZ B;  3MP9 A;  1ACC A;  1JRO A;  3P4S B;  4YTM B;  1I7H A;  1YN5 A;  1ZOY B;  4L1B A;  1VR9 A;  4KKI A;  1JWB D;  1QOG A;  2K22 A;  1JW9 D;  5D3D A;  1ENF A;  1P7F A;  2GI9 A;  3KWL A;  3WCQ A;  1I4P A;  2HTM E;  5HHD G;  2K0P A;  4A55 A;  2E6X A;  1HA5 A;  1EWY C;  4C7Y A;  3MHZ A;  1VZ7 A;  2K9X A;  1XLO A;  4MM3 B;  4ZYS A;  4HKQ A;  1R7S A;  3P1M A;  4D2K A;  1IGD A;  1ZXI A;  4N59 A;  2QSD A;  1FNW A;  1I4Q A;  1QLB B;  1ZDV A;  3KLS X;  1XO3 A;  2HDE A;  3TEZ A;  3ZGZ A;  4A8X C;  1JWS D;  1FMA D;  2K5P A;  1I4X A;  4Q2J A;  2V3N A;  3BVM A;  1ET9 A;  4LK0 M;  1KRH A;  3BII D;  4M0W A;  1SSN A;  3AE6 B;  3NUH B;  1ZP0 B;  4JX1 C;  5BMH A;  1TY2 A;  2AQ3 B;  2INN E;  1C4A A;  1UWM A;  2J53 A;  3V3X A;  1KF6 B;  2IPK D;  2DBY A;  1SJH D;  2JX5 A;  4P16 A;  4NAW B;  2I38 A;  2G9H D;  1WSP A;  3Q8B A;  1FRD A;  2FE8 A;  3FIL B;  1BUI C;  3NVZ A;  2Q5W D;  2WXR A;  1L6V A;  4WAF A;  4UDU C;  3U2S C;  2WLB A;  1YN4 A;  1GAQ B;  1BXT A;  1HQR D;  2PLP A;  1TS4 A;  1MPE A;  2FUG 1;  2L52 A;  1DOI A;  1E9M A;  3NVV A;  2BS4 B;  1E7P B;  2WXG A;  2WU2 B;  4YWG G;  4DXG A;  3I9V 1;  2LMC A;  3Q8C A;  2BW2 A;  5AUI A;  1KTK A;  2SAK A;  2M0A A;  1I4G A;  1IUE A;  3VRB B;  5E6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...