2N9KA

1h, 13c, and 15n chemical shift assignments for in vitro gb1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
57
structure length
57
Chain Sequence
MGTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Improved in-cell structure determination of proteins at near-physiological concentration
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
molecule tags Immune system
molecule keywords Immunoglobulin G-binding protein G
total genus 15
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2015-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2n9kA00
1MI0A 2LUMA 5BMIA 1IGDA 4HJGE 4OZAA 1Q10A 5BMGA 5HFYA 4KGSA 1GB4A 1FCCC 2JWUA 2KDMA 1ZXHA 5JXVA 1P7EA 4HKZE 1C9FA 1HZ6A 2QMTA 1D4BA 4KGTA 1XF5L 2LGIA 2OEDA 2N9LA 2ZW1A 1QKZA 4WH4A 5BMHA 2JU6X 1IGCA 2JSVX 1K52A 1KH0A 2JZPA 1YNTE 4D2KA 1MHHE 2ZW0A 2RMMA 2GB1A 2ONQA 1JMLA 2IGGA 1IBXA 1K50A 2IGHA 1XCQL 3MP9A 2IGDA 3GB1A 4OZCA 2J53A 3FILB 4KGRA 2JXTA 1F2RI 2N9KA 1PGAA 1MPEA 2KN4A 1YMHE 5HI1A 2I38A 1FD6A 1EM7A 1MVKA 2LHDA 1PGBA 1UWXA 2ON8A 2LHEA 2NMQA 3FILA 2KQ4X 3V3XA 4IKGA 1F2RC 2I2YA 4OZBA 1FCLA 4IOIE 2PLPA 2J52A 5HG2A 2KWDA 2PW9A 1K53A 2QSDA 2EELA 1XCTL 1IBXB 1P7FA 2KACA 1MHXA 3UI3A 2GI9A 2PTLA 1HZ5A 4GLSC 1HEZE 1PGXA 2RPVA 2N7JA 5HHDG 1K51A 2K0PA 4MACA 1GB1A
chains in the Genus database with same CATH superfamily
3RNCC 2GRIA 1KOTA 5BMGA 4ZRIA 2KFJA 2IO2B 3OLMD 1R4NB 1YN4A 4K3BA 2AYOB 4EKUA 4I6NB 2KHWB 2AQ3B 1XXGA 4GDKA 3VRAB 2N9LA 1MG8A 3HVDA 4W9FA 2DYMA 2JSVX 3I9V1 1B1ZA 2CHZA 1FRRA 4IW0A 4RM9A 2WNMA 1YX5B 4HXDA 1OFFA 1RLFA 2X38A 1BXTA 1AYFA 1P1AA 2IO3B 3AE9B 3SDLC 1C4AA 2MBHA 3EFCA 1ZOYB 5BYQA 3PV1A 4BOZB 4MELA 2W9NA 3QK0A 2KXJA 1C3TA 4JGHB 2PKOA 1QOAA 1PYWD 1ENFA 5GXGB 2LHEA 4HLEA 1F2RC 4BOSC 1HQRD 3R66C 1E9MA 2J0KA 2CJNA 1SBBB 3PHXB 4FHKA 3DHGC 4IM2A 1KRHA 3SFEB 4M0WB 1ISNA 1GOZA 5FR3A 4ZYSA 3PO0A 2KACA 1YX6B 1LO5D 4LLGM 2BS2B 4B0MA 2K8BA 4JE3B 2ZVNA 3UGBB 3ZNGC 2CKHB 1WWTA 1SIFA 1MI0A 3APCA 4M01A 5BMIA 3U30A 3VVWB 4FHJA 3S2AA 1I4RA 1I4XA 1WM3A 3AULA 4LNOA 2CS4A 2N9EB 1FNWA 2PE6B 4XDCA 1JWBD 3KWVA 4XZ4A 2GMIC 3O13A 2MRPA 4JQWC 5KHQA 4M00A 1ZP0B 4DXFA 5JHAA 3P4RB 3EFUA 4HPPA 1KF6B 2BYVE 1QKZA 2PIAA 1FFVA 2LD9A 4A8XC 1TYGB 4JWSC 5IAAC 2BGFA 3FAHA 3NVVA 1UWMA 2MP2B 3A9KB 1WGKA 3SR6A 2GB1A 4LNKA 3HHMA 3VR8B 1UD7A 4MH8A 2V4LA 4OVZA 1I4GA 1L0VB 3JVZX 3QQ8B 4L2YA 4DDID 3GB1A 3FILB 5DPRA 5AZGA 1E0ZA 1WI0A 4JLCA 3IAM1 2O6VA 2N9KA 4KVGB 3Q69A 1SE4A 4ZHOA 4KZCA 1DOIA 1E8XA 3N3KB 3ZRCA 1WR1A 3NVYA 2Z59B 1JRUA 5HKHA 2N1VA 3HM6X 1D5ZC 1XT9B 2GBNA 5AEKB 1EWYC 2WXOA 3PREA 2IY1B 1TY0A 5D94A 1FNUA 1TKEA 1XEEA 3VAWA 2OJRA 3IT6B 4H2AA 1R7SA 3HM3A 3PLVA 3AE3B 4MM3B 2WXJA 3R2IA 2PTLA 4II3B 2GOWA 4GB9A 1P0RA 4KIKB 3P63A 2N7EA 4RF0A 3RMKC 2GBJA 4E71A 4MH0E 2GBMA 1UBQA 5C3JB 1Q10A 1Y56A 3N1XC 2D11A 1R4NI 2KC1A 4CO7A 1XLOA 4MEMA 2C7HA 1NVID 4HJKA 4W9KA 1SXTA 3W1YA 1YIWA 1UUPA 4DXAB 2Y3AA 2M1MA 3T3OA 4HWIB 4GXBA 4GOCA 2LJ5A 2KK8A 3ZJVA 3KLSX 4D2KA 1I4HA 3DBSA 2G1EA 4MJSA 3KVFB 1XLQA 3Q2AC 1NI3A 3H7PA 2KMAA 3V61A 4GU2A 1UNSA 4A20A 2J4XA 1H4RA 2INDC 4P6VF 3PS6A 3AEFB 3PGEA 1MPEA 3BYTB 2XEWA 1WX9A 3AV8A 2LMCA 4MT5A 1FD6A 2AL3A 4HEA1 2OOBB 2IJ0A 5CX3A 3R7QA 1RM6C 2LEKA 2LGXA 4JIOU 4XC2A 3DBRB 2WWZA 2ZNVC 4Q2JA 4RMAA 5D2MB 4KSLC 4OZBA 2NCNA 3K9OB 2LRUA 2J52A 2KJ6A 1E5WA 2YEPB 3H6NA 4HRSA 3KW5B 5FR6A 3Q8BA 3ZGZA 1J7BA 4FULA 2LGYA 4ZYNA 2RR9A 4BKSA 3VR9B 2OJWA 1HEZE 4WJQA 1VLBA 1WGDA 3AI5A 4HPLB 2WDTB 3VTUA 4DXGA 2MW5A 1Z2MA 2BYTA 3DOWA 4HDOA 1F52A 3U8ZA 2LVOA 2L32A 2LUMA 1IGDA 4LDTD 3LDZE 3V6EB 1JWSD 2DZIA 2O6VB 3DBRI 2FIFA 2JWUA 2H88B 3GE8C 3ZO5B 3Q8FA 4B95A 2WX1A 2XNAC 3BINA 3KQ4A 3V60A 4WURA 2VZKB 2WXGA 4KGTA 3Q3OC 4LTUA 1V9JA 2HD5B 2V1YA 4ZHPA 1WXSA 2IYDB 2HJ8A 4YSXB 3X0WA 1L0XB 3BWUD 2QCZA 3DQVA 3W5UB 2SAKA 2BS4B 4GMVA 2L00B 1TY2A 1SIJA 2K5PA 3Q14C 4KGRA 1BUIC 3ZXVA 1KLUD 2I1KA 4ZRJA 1YMHE 3TUOA 1E7PB 5J2RA 5EDSA 2G4SA 1C78A 5AZHA 3H7SA 3AEDB 3QA8A 1JCKB 2KJRA 1L0YB 4HKQA 1LFDA 2KX3A 1D6EC 1EUVB 1SE2A 4MJSB 1FCLA 2QHOA 1VZ6A 4I6LB 1ZKHA 2K8CA 4TKNA 3VTVA 2WLBA 3N20C 1CJEA 2ACZB 1XCTL 3PTFC 2MBQA 1WFYA 2G3QB 4WAAA 2BKFA 1AWDA 3RNEC 4M8MA 2RPVA 1UBIA 3RNBC 5HHDG 1C4PA 2SEBD 2KVZA 2KJHB 2OHFA 4WQOB 4BBNC 3V62A 5C2TB 3APFA 4ZRPA 1TBEA 1V81A 3I3TB 4WJOA 3ZIMA 4K7SA 1DOXA 4RGMA 2XK5A 4NJ7A 3R3MA 3A33B 2M56B 4IDIA 4JPSA 3KH0A 1T0YA 3NVWA 5CHWA 2KLGA 3PRMB 1EU3A 1KLGD 2LZ6A 2G45B 4G3XB 1PQSA 4E3CA 3DPDA 3V6CB 2ONQA 1HTOA 3GP7A 4OW0A 2KKCA 3ZNID 4DHJD 4AWJA 3IG3A 3AEGB 2KTRB 2WXPA 3QX1A 2CU3A 1SB3C 3AU5A 2ZCCA 3GZNI 3SEBA 1MVKA 3E56A 1FMAD 1U4AA 4HPMB 4BFRA 1RFAA 1WXQA 2L83A 2WGSA 2Z0EB 3NJTA 2BW2A 4IWPA 3JW0X 3ZXRA 4G50A 4DQOC 1WY8A 2KO3A 2KWDA 2AL6A 2MP2A 2EELA 4II2B 2NS5A 2LVQA 2LGSA 1V1PA 3WAPA 2ZZPB 2LGDA 1QZEA 3U4EG 3ZDMC 4A55A 2KD0A 4GLSC 2K25A 2V3SA 3CWIA 4WAFA 4TSSA 3M62B 2O6VD 3KUZA 1A70A 2BWES 2KDBA 4LNFA 3A1QB 1KJTA 4NAWB 1E7UA 2TSSA 1ZDXA 4NAMA 5E6JA 3VRBB 2LXAA 2INNE 4FADA 1OGWA 2O2VB 3B1LX 4YL8A 3R7RA 5JXVA 4MGZE 1J0GA 4HKZE 4FJYA 5EE0A 1LXDA 2J7QB 4P16A 1EO6A 4F7ZA 4KX6B 4W9JA 2D3BA 3DVGY 1WR6E 3AU4A 4W9CA 3TMPB 4EZKA 2OEDA 1L6VA 5BMHA 5AUIA 2MHJA 3ZUNA 5C1ZA 5T8IA 3ZTDA 1NI2A 3N1ZC 4ANVA 2ZEQA 2UYZB 3RYTA 2L0TA 2MCNB 3DBLI 3Q3JA 4WJPA 4IM3A 3AEEB 2BBCA 2CU1A 4WJNA 3L10B 2YEPF 4LK0M 1WJNA 3AE8B 3VHTC 3AE1B 4QAYA 3A1QA 4AP4C 2WHIA 3VH4B 1NEKB 4B6WA 2FIDA 3QWZB 2D2QA 4IC7B 3QCAA 2YLMA 3U52E 2KMMA 4US8A 2JT4B 2WXKA 1V1PB 2MLBA 1TIFA 3A4RA 1YJJA 1HTQA 1XO3A 2NR2A 2WXLA 2KNBA 5IO9A 5EE3A 1YQ3B 1EF5A 1TGZB 2KZRA 1XLPA 4DHZE 3MFGA 1WJ6A 1PGXA 4JWUC 3EA6A 1T6BX 1V5OA 3DBHB 2HE7A 5L95C 5G5GA 1ZPSA 2VH1A 2XBBC 3CF6E 5JH5C 3NY5A 4NNJB 1FPYA 2ICIA 2VH2A 3PLUA 1OQRA 3RZFA 4WIPA 2MJEA 4LCDE 2FBWB 3U7DA 4K81A 3BZDB 2KTRA 2M0AA 3ML9A 4N59A 2INPE 1CMXB 4LJPB 3TEXA 3LXFA 1SJED 4A3OA 1WMHB 1YD8U 5JZEB 4IM0A 3VUXA 2ZW1A 1UH6A 2NTTA 2CHXA 3ZNZB 3WANA 2IO0B 2ZW0A 2KFKB 2LVPA 3OWEB 2FE8A 1GG3A 1TT5B 1V97A 1WGGA 3QIJA 3KYDD 2J53A 4KKIA 1E6EB 2JXTA 3UINB 2FAZA 4MGKE 3OAWA 4TQ1A 3WAMA 2N0SB 2MJ3A 1E8YA 2AWTA 3W5VB 3M95A 3ZJTA 3NUHB 3PVLA 4RNAA 1WSPA 1SSNA 1ZDVA 2EKIA 4P1BC 4IOIE 4LJOB 2JYEA 4FA6A 4GSWA 1ZE3D 3L17A 3PZDA 3EHVA 5G55A 2KDFB 2KN5A 1P7FA 2JPHA 2K1FA 2BKRB 4MGIE 4G11A 1N5XA 1D3ZA 2M4NA 2NTSA 4ANXA 2JVCA 1J7CA 3NZ3A 3GE3C 2BF8B 2W3RA 3H8HA 1Q5WB 2IDYA 3EGRA 1V1OA 3BYYB 1WE6A 3EUB2 2WX0A 1GUAB 1GB4A 2KDMA 2W3SA 1F0ZA 4BKGA 2DAFA 2KQ7A 2RDHA 2BS3B 4NZLB 3N30A 3VTWA 1S3SG 1WYGA 5E6NA 3C8YA 3DCGA 1T0RC 2KTFA 1WZ0A 3C0RB 4RGTA 1I42A 2WYQA 5G2NA 2IGGA 2K8HA 2HTME 3ENEA 3N9YC 2PPHA 4DDGD 2MEKA 4J6IA 3IAS1 4NQLB 5DPSA 2INCC 3BK2A 2KC2A 1TZ1A 2N9XA 5TSSA 4K7WA 4YTNB 2LHDA 3RT3B 3KUDB 4C80A 2PJHA 3T3NA 3KUCB 4N9F4 1I4PA 1HE8A 1ZXIA 2WDQB 3BIID 5C23A 3B0AA 3PRZA 3A9JB 2R61A 4GGQA 4B0EA 3PHWB 1FRDA 1GPXA 3ETRA 2GBKA 3OG5A 1JWUD 1QOBA 1X1MA 2REXA 1NENB 4YXDB 2KYWA 2K6DB 3P4SB 4IWQA 3KWLA 2FCMA 3P2BA 1RYJA 2QEJC 3AH7A 2AEHA 2V9HA 2L76A 4E74A 1V2YA 5EE9A 4EE2A 5IOIA 4W9EA 4K3CA 1VJKA 2GLSA 3UF8A 2NPTB 1ESFA 1NBFC 2KWCA 2L1AA 2QJLA 3PPAA 2FCQA 4EZLA 1N6ZA 1HZ6A 2WU2B 2LFIA 5FK9C 5DCNA 5CHVC 2JXXA 1MFWA 3Q6BA 3ZQ4A 5D7GA 4WH4A 2KWVB 4L1BA 1IGCA 4RH6A 3ALBA 1KH0A 4GDLA 4OHJA 4TV3A 3WA0A 1MHHE 4DHZB 1K50A 1WX7A 4F1SA 4M8NA 1T0QC 2ZVOA 1UF0A 4ARCA 2KOXA 2RDBC 1PDXA 5HI1A 3N32A 2I38A 3I63C 4W9GA 4DBGA 1WRIA 4DWFA 3QC8B 2JZZA 1V8CA 2XN9C 1WGYA 2ON8A 4XX5A 1XQQA 3R8BA 4IG7B 3ZW3A 3NHEB 4JL9A 1VD2A 1FM0D 2C9WB 2DYOA 2R2QA 1E8ZA 2W82A 3DVNV 3VH3B 2NBWB 3A4SC 1WE7A 4LNNA 1VRAB 2WXNA 3UI3A 3WCQA 2WDVB 4PS3A 3L16A 4AQ7A 1IP9A 3PSEB 1F1HA 5BYRA 4EZJA 1WMHA 1FFUA 1QT9A 3PRPB 3C19A 3AECB 3QARA 2E3TA 4C7YA 1WXMA 3Q3FA 2UU7A 2PVGC 2MX2A 1N60A 1C1YB 2QC8A 4XDDA 2C7NB 1FCCC 2IBIB 2IZVB 2G4DB 3MHZA 2PE9A 3RNFC 1OEYJ 3W9CB 3ZVVA 1P3QU 5H92C 2Y5BB 1XF5L 4YTMB 3PZ8A 2KWUB 1RWSA 1FIQA 1E10A 3DVNU 4PYUA 2JZPA 2C60A 4REZA 1CK1A 1E90A 3HRDD 3A9KA 1EWCA 2FCNA 5DPTA 4A9AA 2DZKA 2JF5A 3KYCD 2IGHA 1TZOA 4NY0A 1TKGA 3WAOA 1M4VA 2JY6A 5LXIB 3IVFA 3RZWC 2Z8LA 4O1NA 2RPQA 5MPOA 2ASQA 3DDCB 3QAQA 3ZRFA 2MQJA 3UIPB 3HK0A 1STEA 2IY0B 3RCZA 1GNUA 2K39A 2KANA 4TMAB 3DBLB 3H7PB 1V86A 1KLVA 3APDA 3CSTA 2BYFA 5LXHA 2FCSA 2QSDA 3I5JC 3WIMA 3B9JA 3P42A 1UZXB 3DWMA 1DGJA 3CSFA 3H9DA 3M3JA 2L3ZA 4RGOS 3Q8EA 4AJWA 1HZ5A 4W9IA 2BVCA 3BVGA 2YVCA 2HJ1A 1YN5A 4A90A 4X57B 2ZNVB 1AW7A 3RUIB 3ZNHB 4ITKA 2K6QA 1NDDA 4MDKE 2D5GA 2M17A 2CJOA 1H8CA 2L8JA 5CTRC 3ZLZA 3R2TA 4RF1A 2JZ3B 3DVGX 4S0RA 4ASWC 3URYA 4NAWA 4MM3A 5BYSA 1FXTB 4DHJB 4HROA 1K52A 2V3NA 1C77A 3VUWA 2DZMA 4IUMB 2ZPNA 1WGRA 4BVUC 1TS5A 1ROEA 1QLBB 4XGAB 3BVZA 4OVVA 1ET9A 3TEYA 1XCQL 2IGDA 1HXYD 2D3AA 1WJ4A 1N61A 3P1MA 3N1YC 2J42A 1QILA 4ZRKA 1GJZA 4BKTA 2D3CA 4FJZA 3MC8A 3Q3MC 1A5RA 3RN9C 3VDZA 1C79A 1J19A 3AM9A 4ANUA 3FILA 3NVZA 3V3XA 3RFZB 5D3DA 2IO1B 2BPSA 5IN7A 1OEYA 2N1WA 1YJ1A 2K9XA 2JYTA 2HDEA 4OVUA 5CHFA 2GBRA 1OQYA 3NOBA 3Q8CA 3MC0B 1NYQA 3ZYYX 1MHXA 1FXIA 4KZ0A 4PK1A 1JQ4A 3L08A 4R3DA 1MG4A 2H89B 1ZUD2 1N62A 2MH7A 2UWQA 3HIZA 2BT6A 3LB8C 3RD2A 3PT2B 4ARIA 4NPNA 1WH3A 2FUG1 2WS3B 4IWOA 5G5HA 1R4MI 4KGSA 1DYQA 2WXFA 1VCBA 1ZXHA 2KLCA 3QJZA 3RULA 2NBUA 1L2NA 3TEWA 2KDIA 1ZW7A 3PZ7A 1RFKA 1WX8A 1OTRB 2EKEC 3NS1A 4F8CB 5E6OA 4RCOA 4WWNA 4AOFA 5H8YE 1L6UA 2MBBB 1D5XC 2RGFA 2JUOA 3ML8A 1D5MC 2JRIB 1JMLA 2M8SA 3P4QB 4XE0A 4C00A 3MP9A 4N6EB 2V4IB 4LNIA 1QOFA 2NVUI 4ZRQA 3AE5B 2E6XA 4PS8A 2KN4A 1Z5SB 4P1CC 2QDFA 3K9PB 5LNK1 2AQ1B 2MWSB 4KDLB 3TCAA 1S1QB 1E7VA 4KKJA 2WXQA 4USAA 3DHIC 3DBHI 1JWMD 3H1UA 3V05A 2L05A 1FEHA 2I2YA 5JHBA 4AS1A 2K3UA 2VRRB 2KX0A 1PFDA 4J3OD 4ICUA 2PEAA 4ZDVA 4C4VB 1TKYA 4EOYA 3IHPC 2JWZA 5IKCM 4HK2A 2KQSA 1DOYA 2MJDA 3L0WB 3ECIA 3B2FA 4AJYB 2G9HD 4GDKB 1GC6A 1SE3A 4C56C 4NJ6A 3GOEA 1K51A 2K0PA 4MACA 3AEBB 4W9DA 1VZ7A 4I6PA 1HA5A 3BK1A 2ZJDA 4OZAA 4YT0B 4YSYB 3W2DA 4HCPB 3NZSA 2W54A 1C9FA 5J18A 4BKSD 2X8XX 4HVBA 5DPWA 4WWMA 2DENB 1D4BA 3EC8A 1Y8RC 3L54A 3IXSA 4NJCA 4GDLB 2PMVA 1K8RB 3LYYA 1TS4A 3TL5A 4BZAA 1EF1A 4HCNB 5L83A 2D3GA 3T8MA 3L13A 3AE6B 2CR5A 1WIAA 2B3AA 2WXIA 4OZCA 1PUTA 5KHOA 1XLNA 3T9LA 2AQ2B 1LM8B 2XK5B 4PT5A 2QILA 4ICVA 1V49A 2L0FA 5J17A 1XD3B 4MSMB 2HTHA 1T0SC 4RM8A 3O65B 1LQBA 2Y5CA 2ZCBA 3AEAB 2KQ4X 2JRHA 4IKGA 3RPFC 1SJHD 5HG2A 3TSSA 1GAQB 2C5LC 2LI5A 1J7AA 2M0XA 2DHZA 4RGNA 2WP9B 3OJ3A 2C7MB 1IPGA 5D6JB 1AARA 1WYWB 2L52A 3SHQA 3AXCA 5FKAC 2N7JA 5AZFA 3UIOB 3B08A 3IFWB 2V3PA 2EMSA 3RNAC 4GIVA 2WDRB 3RNGC 1N63A 2WXMA 3GZNB 4HJGE 2WQYB 3U7ZA 2CHWA 4US9A 4EFOA 3VFKA 1EU4A 1Q1OA 1YN3A 1IUEA 1SEBD 4CYEA 3J9CA 1JALA 1UELA 2A5UA 2KVRA 4XWTA 5GMVA 5TR5A 1YJIA 2NBVB 4LDTB 3HVZA 3MJ5A 2LGIA 1AN8A 1P9DU 2BWFA 1E8WA 3X23A 3Q3NC 1N5WA 1L5PA 4BAXA 1VDVA 2EMTA 1VR9A 1VZ8A 4JX1C 1WJUA 4FBJB 3SFDB 3L4PA 3VUYA 2LRWA 4K7UA 1JW9D 1FO4A 1CQVA 1TTNA 3MTNB 2WXRA 2DAJA 1RAXA 3BY4B 1BT0A 1SE9A 2N9PC 2LXCA 3CIRB 1UWXA 1C4CA 2D07B 2MA9B 2BB5A 1IYFA 4B9KA 4RFBA 2MBOA 3OJ4B 1K53A 1B9RA 3JYUA 2I1JA 2R2OA 4KDIC 5D3IB 2LUEA 2WXHA 4MSQB 3W1SA 2BQQA 1G6JA 1I4QA 3JSVB 3ZKJC 1JWAD 2BYEA 4N58A 4FJVB 4ANWA 2DZJA 1GB1A 2NPTA 4YSZB 1P98A 2QIEB 4NQKE 1L4DB 3AE7B 4P7IA 1YOVB 3SD5A 1RRBA 3AE4B 4A3PA 2ZPYA 2DYBA 3FKYA 1JRPA 2LJIA 3JSVA 3UQAA 3HUIA 5AUKA 1WXAA 2J0MA 1LGRA 3TBLD 2KT7A 3VXWA 3WALA 4KV2A 1M94A 3A9JA 3AN1A 3AE2B 2RMMA 4CHKA 2L7RA 4W9HA 2KAJA 4YTPB 2FUHB 1V5TA 3E9SA 3MC9A 2AX5A 5E6PA 3MHSD 3TIXA 1PGAA 3RI7C 2DLBA 3P4PB 3W1SC 1JROA 3IT4B 1WF9A 2PVOD 1PGBA 1T3QA 4HDQA 3Q8AA 3BVMA 3DHHC 1YQ4B 3QHTA 4PYZA 2MBEA 1R4MB 2Z0DB 3ZDTA 2RD0A 1V6EA 5EE1A 5IA7A 1GC7A 2DNFA 4G0NB 4KIKA 4ZOHC 3ZJUA 1I7HA 2KDEB 2JX5A 5BO4B 4PS7A 4WWOA 2BTEA 2BB6A 1UGMA 3AB5A 5I4DA 1MJDA 4KSKC 2VZKD 2GI9A 2DWQA 4C4VA 4WQMA 2B76B 1L4ZB 2M19A 4URKA 3NS8A 4FXCA 1QOGA 1C76A 3NRZA 3LJ3A 2Y5PA 1QQRA 2MSED 3DWGC 4TUUA 5HFYA 1FNVA 3D32A 3CMMB 2LASA 2V0GA 3B2GA 1P7EA 3SU8X 2DBYA 1F9JA 4XYCA 3EECA 1CZPA 2N4FA 2QMTA 3ONSA 3AMZA 4BBNF 1V80A 3IBEA 4S17A 1NYRA 1ET6A 2FNJB 1OQQA 1L7YA 2JU6X 1YNTE 4CQNA 1WXVA 4AUQC 1FXAA 3U2SC 3TJPA 2W55A 1ACCA 4K1RB 1IBXA 1SF0A 4L23A 3I57A 4TQ0A 5LLIA 1QF6A 2WU5B 1F2RI 4EUTA 3NG0A 4FN2A 2O2VA 1ZGUB 1TS3A 1EM7A 3VQIA 4WWPA 4A6QA 1KM7A 1TS2A 2A4ZA 1UGJA 2RDGA 3UQBA 1Q0WB 3NZUA 2RSUA 4UDUC 2KMCA 4XWWA 1WM2A 2NMQA 2IPKD 1I35A 1F77A 5IP4D 4C7ZA 4EEWA 1T5XD 3ZTCA 2DX5B 3M63B 2PLPA 1KTKA 2JQRB 2KFKA 2PW9A 1WGHA 4YWGG 1J8CA 1SGHA 1BMLC 1WRDB 2N7DA 2Q5WD 3MJWA 1KFYB 3TEZA 1IBXB 4FLHA 4MGYE 4ACFA 1YQBA 2D10A 3GS2A 1TJEA 4M0WA 1WZ3A 3ABVB 4M02A 4GN1A 3FC4A 2J0JA 4DK5A 2K22A 4W9LA 2LWPA
chains in the Genus database with same CATH topology
1VZ7A 1HA5A 2GRIA 2OHFA 3BK1A 2SEBD 5EE9A 4EE2A 4OZAA 4YT0B 4YSYB 5BMGA 3W2DA 1VJKA 5C2TB 1ESFA 1YN4A 2L1AA 2QJLA 4ZRPA 2W54A 1C9FA 1HZ6A 2WU2B 2LFIA 4WWMA 5FK9C 1DOXA 4RGMA 2AQ3B 1D4BA 1XXGA 3VRAB 3IXSA 2M56B 4IDIA 3ZQ4A 4JPSA 2N9LA 4NJCA 5D7GA 3HVDA 4GDLB 4WH4A 3NVWA 2PMVA 4L1BA 3LYYA 1IGCA 1EU3A 1KLGD 2DYMA 2JSVX 1B1ZA 1KH0A 1TS4A 3I9V1 4RH6A 4OHJA 1FRRA 1MHHE 2ONQA 2WNMA 3GP7A 4OW0A 1K50A 1OFFA 2X38A 3AE6B 1BXTA 1AYFA 2WXIA 3AE9B 4OZCA 1PUTA 1C4AA 4ARCA 1ZOYB 3AEGB 5BYQA 1XLNA 2WXPA 2AQ2B 2CU3A 1PDXA 1SB3C 2QILA 4PT5A 5HI1A 2I38A 3SEBA 1WRIA 1MVKA 3E56A 1FMAD 1V8CA 2XN9C 2PKOA 2ON8A 2Y5CA 1QOAA 1PYWD 3AEAB 1WXQA 1ENFA 2L83A 2LHEA 5GXGB 3R8BA 2KQ4X 2BW2A 4IKGA 1F2RC 1HQRD 3RPFC 1FM0D 2DYOA 4DQOC 1E9MA 1SJHD 2CJNA 1SBBB 5HG2A 2KWDA 2W82A 3TSSA 1GAQB 2EELA 1J7AA 1KRHA 3SFEB 1GOZA 1V1PA 5FR3A 4ZYSA 4RGNA 2WP9B 3PO0A 2KACA 1VRAB 3U4EG 2WXNA 3UI3A 2L52A 4A55A 3WCQA 2WDVB 1LO5D 4GLSC 4LLGM 2BS2B 3CWIA 4B0MA 5FKAC 2N7JA 4TSSA 4WAFA 4AQ7A 4JE3B 1A70A 5BYRA 2V3PA 1WWTA 4NAWB 1FFUA 1MI0A 2TSSA 1QT9A 1ZDXA 2WDRB 1N63A 2WXMA 3AECB 4NAMA 5E6JA 3VRBB 5BMIA 2E3TA 4HJGE 2WQYB 3U7ZA 4C7YA 2INNE 4US9A 2PVGC 1I4RA 1EU4A 1I4XA 1N60A 1YN3A 4XDDA 1IUEA 1FCCC 1SEBD 3J9CA 1JALA 5JXVA 4HKZE 1FNWA 5EE0A 4P16A 4XDCA 1JWBD 3MHZA 3KWVA 4XWTA 4KX6B 3O13A 3W9CB 1YJIA 1ZP0B 4DXFA 3HVZA 3P4RB 3MJ5A 5H92C 1XF5L 4YTMB 2LGIA 1AN8A 2OEDA 3PZ8A 1KF6B 1QKZA 1L6VA 5BMHA 1RWSA 1FIQA 5AUIA 1E10A 2PIAA 1FFVA 4A8XC 1N5WA 1TYGB 1L5PA 4JWSC 2JZPA 4REZA 3FAHA 3NVVA 1CK1A 1UWMA 5T8IA 1VDVA 3HRDD 1WGKA 1VR9A 3SR6A 2GB1A 1EWCA 3VR8B 1VZ8A 4A9AA 4JX1C 4MH8A 4OVZA 2IGHA 3SFDB 1I4GA 1TZOA 1L0VB 3L4PA 4L2YA 1TKGA 1M4VA 3GB1A 1JW9D 1FO4A 3FILB 1E0ZA 1CQVA 2Z8LA 4O1NA 3IAM1 5MPOA 2N9KA 3AEEB 2BBCA 2WXRA 3Q69A 1STEA 2YEPF 1SE4A 4ZHOA 4LK0M 3AE8B 3CIRB 1UWXA 1DOIA 3AE1B 1C4CA 2BB5A 3NVYA 4TMAB 1NEKB 4RFBA 1D5ZC 1EWYC 2WXOA 3U52E 1K53A 1TY0A 2KMMA 4US8A 2QSDA 1B9RA 1FNUA 1TKEA 1XEEA 2WXKA 1V1PB 3IT6B 3B9JA 4H2AA 1R7SA 3P42A 1YJJA 5D3IB 1XO3A 2WXHA 3DWMA 2WXLA 1DGJA 3AE3B 3W1SA 4MM3B 5EE3A 1YQ3B 4RGOS 2WXJA 3R2IA 3Q8EA 1I4QA 2PTLA 1HZ5A 1XLPA 3MFGA 1JWAD 1PGXA 4JWUC 3EA6A 1T6BX 5G5GA 3P63A 4RF0A 1ZPSA 4N58A 3BVGA 1GB1A 2ICIA 1OQRA 1YN5A 4WIPA 4A90A 4YSZB 2MJEA 2QIEB 5C3JB 1AW7A 1L4DB 1Q10A 1Y56A 2FBWB 3AE7B 3BZDB 4ITKA 2M0AA 1XLOA 2D5GA 1NVID 3AE4B 1SXTA 4N59A 2CJOA 2INPE 1UUPA 3TEXA 3LXFA 1JRPA 3R2TA 2LJIA 4RF1A 2Y3AA 1SJED 3URYA 2ZW1A 3HUIA 5AUKA 2NTTA 5BYSA 3T3OA 4HROA 1K52A 2V3NA 1C77A 3ZJVA 3KLSX 4D2KA 1I4HA 3AN1A 2ZW0A 3AE2B 2RMMA 1TS5A 1ROEA 3OWEB 2FE8A 1QLBB 2KAJA 2G1EA 4YTPB 1XLQA 3BVZA 1NI3A 1ET9A 3TEYA 3E9SA 1XCQL 2IGDA 1V97A 1HXYD 1UNSA 2AX5A 2J53A 2J4XA 4KKIA 4P6VF 1E6EB 2JXTA 1N61A 3AEFB 3P1MA 1PGAA 1MPEA 2DLBA 3BYTB 2J42A 1QILA 3AV8A 2LMCA 4MT5A 1FD6A 3P4PB 1JROA 4HEA1 2IJ0A 3IT4B 1C79A 3AM9A 1RM6C 1PGBA 2LEKA 2PVOD 4TQ1A 2N0SB 2MJ3A 1T3QA 3BVMA 3Q8AA 3W5VB 1YQ4B 4Q2JA 3FILA 3NVZA 3ZJTA 3V3XA 3RFZB 5D3DA 3NUHB 4RNAA 1WSPA 1SSNA 1ZDVA 2EKIA 4OZBA 5EE1A 2K9XA 4IOIE 2JYTA 2HDEA 2J52A 2JYEA 1ZE3D 4ZOHC 3ZJUA 2YEPB 1I7HA 3Q8CA 2JX5A 3MC0B 4HRSA 1NYQA 2BTEA 3ZYYX 1P7FA 2BB6A 3Q8BA 3AB5A 3ZGZA 1J7BA 1MHXA 1FXIA 5I4DA 1JQ4A 4R3DA 2VZKD 2GI9A 2DWQA 2H89B 1ZUD2 1N62A 1N5XA 3VR9B 1HEZE 1VLBA 2MH7A 2NTSA 4WQMA 2BT6A 1J7CA 3NZ3A 2B76B 3LB8C 1L4ZB 2M19A 4DXGA 4FXCA 2BYTA 2W3RA 1QOGA 1C76A 3NRZA 2Y5PA 3H8HA 1QQRA 4ARIA 2IDYA 3EGRA 1V1OA 2L32A 2LUMA 2FUG1 1IGDA 3BYYB 2WS3B 5G5HA 3DWGC 3EUB2 5HFYA 1FNVA 1JWSD 4KGSA 2V0GA 3B2GA 1GB4A 2JWUA 1DYQA 2H88B 2WXFA 2KDMA 1ZXHA 1P7EA 2W3SA 2DBYA 1F0ZA 3Q8FA 3TEWA 1CZPA 2XNAC 2RDHA 3PZ7A 2QMTA 3KQ4A 1RFKA 4WURA 2BS3B 2VZKB 3AMZA 2WXGA 3NS1A 4KGTA 4NZLB 4LTUA 1NYRA 4RCOA 1ET6A 1WYGA 3C8YA 1OQQA 2JU6X 5H8YE 4ZHPA 4RGTA 1YNTE 4CQNA 1L6UA 4YSXB 1L0XB 1FXAA 3U2SC 1D5XC 2W55A 3BWUD 1D5MC 1ACCA 1JMLA 2IGGA 1IBXA 2HTME 1SF0A 3W5UB 4L23A 2SAKA 3P4QB 4XE0A 3I57A 2BS4B 3MP9A 3N9YC 4N6EB 2V4IB 4TQ0A 1QOFA 1QF6A 1TY2A 2MEKA 2WU5B 1SIJA 4ZRQA 3AE5B 3IAS1 2E6XA 2K5PA 4KGRA 1BUIC 1F2RI 1KLUD 2KN4A 3BK2A 1YMHE 3TUOA 1E7PB 5LNK1 1TS3A 1EM7A 2AQ1B 3VQIA 5TSSA 4YTNB 1C78A 4A6QA 2LHDA 1TS2A 3AEDB 1UGJA 2RDGA 4C80A 4KKJA 4UDUC 4XWWA 1JCKB 2WXQA 2NMQA 4USAA 2IPKD 3T3NA 1JWMD 3V05A 1F77A 1L0YB 1FEHA 2I2YA 4C7ZA 4HKQA 1T5XD 4AS1A 1D6EC 1I4PA 1SE2A 1ZXIA 2K3UA 2WDQB 1FCLA 3BIID 2PLPA 1KTKA 1PFDA 2JQRB 1VZ6A 2PW9A 4YWGG 4J3OD 2R61A 4B0EA 1BMLC 2WLBA 1TKYA 1CJEA 1FRDA 1XCTL 2ACZB 1GPXA 2Q5WD 3ETRA 1IBXB 1KFYB 3TEZA 1DOYA 2MJDA 3GS2A 1JWUD 1AWDA 3B2FA 2G9HD 4GDKB 1SE3A 1QOBA 1TJEA 4C56C 4M0WA 3ABVB 3FC4A 1NENB 2RPVA 4YXDB 5HHDG 1K51A 2K0PA 3P4SB 4MACA 3KWLA 2K22A 1C4PA 1RYJA 2QEJC 3AH7A 3AEBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MI0 A;  2LUM A;  5BMI A;  1IGD A;  4HJG E;  4OZA A;  1Q10 A;  5BMG A;  5HFY A;  4KGS A;  1GB4 A;  1FCC C;  2JWU A;  2KDM A;  1ZXH A;  5JXV A;  1P7E A;  4HKZ E;  1C9F A;  1HZ6 A;  2QMT A;  1D4B A;  4KGT A;  1XF5 L;  2LGI A;  2OED A;  2N9L A;  2ZW1 A;  1QKZ A;  4WH4 A;  5BMH A;  2JU6 X;  1IGC A;  2JSV X;  1K52 A;  1KH0 A;  2JZP A;  1YNT E;  4D2K A;  1MHH E;  2ZW0 A;  2RMM A;  2GB1 A;  2ONQ A;  1JML A;  2IGG A;  1IBX A;  1K50 A;  2IGH A;  1XCQ L;  3MP9 A;  2IGD A;  3GB1 A;  4OZC A;  2J53 A;  3FIL B;  4KGR A;  2JXT A;  1F2R I;  2N9K A;  1PGA A;  1MPE A;  2KN4 A;  1YMH E;  5HI1 A;  2I38 A;  1FD6 A;  1EM7 A;  1MVK A;  2LHD A;  1PGB A;  1UWX A;  2ON8 A;  2LHE A;  2NMQ A;  3FIL A;  2KQ4 X;  3V3X A;  4IKG A;  1F2R C;  2I2Y A;  4OZB A;  1FCL A;  4IOI E;  2PLP A;  2J52 A;  5HG2 A;  2KWD A;  2PW9 A;  1K53 A;  2QSD A;  2EEL A;  1XCT L;  1IBX B;  1P7F A;  2KAC A;  1MHX A;  3UI3 A;  2GI9 A;  2PTL A;  1HZ5 A;  4GLS C;  1HEZ E;  1PGX A;  2RPV A;  2N7J A;  5HHD G;  1K51 A;  2K0P A;  4MAC A;  1GB1 A; 
#chains in the Genus database with same CATH topology
 3RNC C;  2GRI A;  1KOT A;  5BMG A;  4ZRI A;  2KFJ A;  2IO2 B;  3OLM D;  1R4N B;  1YN4 A;  4K3B A;  2AYO B;  4EKU A;  4I6N B;  2KHW B;  2AQ3 B;  1XXG A;  4GDK A;  3VRA B;  2N9L A;  1MG8 A;  3HVD A;  4W9F A;  2DYM A;  2JSV X;  3I9V 1;  1B1Z A;  2CHZ A;  1FRR A;  4IW0 A;  4RM9 A;  2WNM A;  1YX5 B;  4HXD A;  1OFF A;  1RLF A;  2X38 A;  1BXT A;  1AYF A;  1P1A A;  2IO3 B;  3AE9 B;  3SDL C;  1C4A A;  2MBH A;  3EFC A;  1ZOY B;  5BYQ A;  3PV1 A;  4BOZ B;  4MEL A;  2W9N A;  3QK0 A;  2KXJ A;  1C3T A;  4JGH B;  2PKO A;  1QOA A;  1PYW D;  1ENF A;  5GXG B;  2LHE A;  4HLE A;  1F2R C;  4BOS C;  1HQR D;  3R66 C;  1E9M A;  2J0K A;  2CJN A;  1SBB B;  3PHX B;  4FHK A;  3DHG C;  4IM2 A;  1KRH A;  3SFE B;  4M0W B;  1ISN A;  1GOZ A;  5FR3 A;  4ZYS A;  3PO0 A;  2KAC A;  1YX6 B;  1LO5 D;  4LLG M;  2BS2 B;  4B0M A;  2K8B A;  4JE3 B;  2ZVN A;  3UGB B;  3ZNG C;  2CKH B;  1WWT A;  1SIF A;  1MI0 A;  3APC A;  4M01 A;  5BMI A;  3U30 A;  3VVW B;  4FHJ A;  3S2A A;  1I4R A;  1I4X A;  1WM3 A;  3AUL A;  4LNO A;  2CS4 A;  2N9E B;  1FNW A;  2PE6 B;  4XDC A;  1JWB D;  3KWV A;  4XZ4 A;  2GMI C;  3O13 A;  2MRP A;  4JQW C;  5KHQ A;  4M00 A;  1ZP0 B;  4DXF A;  5JHA A;  3P4R B;  3EFU A;  4HPP A;  1KF6 B;  2BYV E;  1QKZ A;  2PIA A;  1FFV A;  2LD9 A;  4A8X C;  1TYG B;  4JWS C;  5IAA C;  2BGF A;  3FAH A;  3NVV A;  1UWM A;  2MP2 B;  3A9K B;  1WGK A;  3SR6 A;  2GB1 A;  4LNK A;  3HHM A;  3VR8 B;  1UD7 A;  4MH8 A;  2V4L A;  4OVZ A;  1I4G A;  1L0V B;  3JVZ X;  3QQ8 B;  4L2Y A;  4DDI D;  3GB1 A;  3FIL B;  5DPR A;  5AZG A;  1E0Z A;  1WI0 A;  4JLC A;  3IAM 1;  2O6V A;  2N9K A;  4KVG B;  3Q69 A;  1SE4 A;  4ZHO A;  4KZC A;  1DOI A;  1E8X A;  3N3K B;  3ZRC A;  1WR1 A;  3NVY A;  2Z59 B;  1JRU A;  5HKH A;  2N1V A;  3HM6 X;  1D5Z C;  1XT9 B;  2GBN A;  5AEK B;  1EWY C;  2WXO A;  3PRE A;  2IY1 B;  1TY0 A;  5D94 A;  1FNU A;  1TKE A;  1XEE A;  3VAW A;  2OJR A;  3IT6 B;  4H2A A;  1R7S A;  3HM3 A;  3PLV A;  3AE3 B;  4MM3 B;  2WXJ A;  3R2I A;  2PTL A;  4II3 B;  2GOW A;  4GB9 A;  1P0R A;  4KIK B;  3P63 A;  2N7E A;  4RF0 A;  3RMK C;  2GBJ A;  4E71 A;  4MH0 E;  2GBM A;  1UBQ A;  5C3J B;  1Q10 A;  1Y56 A;  3N1X C;  2D11 A;  1R4N I;  2KC1 A;  4CO7 A;  1XLO A;  4MEM A;  2C7H A;  1NVI D;  4HJK A;  4W9K A;  1SXT A;  3W1Y A;  1YIW A;  1UUP A;  4DXA B;  2Y3A A;  2M1M A;  3T3O A;  4HWI B;  4GXB A;  4GOC A;  2LJ5 A;  2KK8 A;  3ZJV A;  3KLS X;  4D2K A;  1I4H A;  3DBS A;  2G1E A;  4MJS A;  3KVF B;  1XLQ A;  3Q2A C;  1NI3 A;  3H7P A;  2KMA A;  3V61 A;  4GU2 A;  1UNS A;  4A20 A;  2J4X A;  1H4R A;  2IND C;  4P6V F;  3PS6 A;  3AEF B;  3PGE A;  1MPE A;  3BYT B;  2XEW A;  1WX9 A;  3AV8 A;  2LMC A;  4MT5 A;  1FD6 A;  2AL3 A;  4HEA 1;  2OOB B;  2IJ0 A;  5CX3 A;  3R7Q A;  1RM6 C;  2LEK A;  2LGX A;  4JIO U;  4XC2 A;  3DBR B;  2WWZ A;  2ZNV C;  4Q2J A;  4RMA A;  5D2M B;  4KSL C;  4OZB A;  2NCN A;  3K9O B;  2LRU A;  2J52 A;  2KJ6 A;  1E5W A;  2YEP B;  3H6N A;  4HRS A;  3KW5 B;  5FR6 A;  3Q8B A;  3ZGZ A;  1J7B A;  4FUL A;  2LGY A;  4ZYN A;  2RR9 A;  4BKS A;  3VR9 B;  2OJW A;  1HEZ E;  4WJQ A;  1VLB A;  1WGD A;  3AI5 A;  4HPL B;  2WDT B;  3VTU A;  4DXG A;  2MW5 A;  1Z2M A;  2BYT A;  3DOW A;  4HDO A;  1F52 A;  3U8Z A;  2LVO A;  2L32 A;  2LUM A;  1IGD A;  4LDT D;  3LDZ E;  3V6E B;  1JWS D;  2DZI A;  2O6V B;  3DBR I;  2FIF A;  2JWU A;  2H88 B;  3GE8 C;  3ZO5 B;  3Q8F A;  4B95 A;  2WX1 A;  2XNA C;  3BIN A;  3KQ4 A;  3V60 A;  4WUR A;  2VZK B;  2WXG A;  4KGT A;  3Q3O C;  4LTU A;  1V9J A;  2HD5 B;  2V1Y A;  4ZHP A;  1WXS A;  2IYD B;  2HJ8 A;  4YSX B;  3X0W A;  1L0X B;  3BWU D;  2QCZ A;  3DQV A;  3W5U B;  2SAK A;  2BS4 B;  4GMV A;  2L00 B;  1TY2 A;  1SIJ A;  2K5P A;  3Q14 C;  4KGR A;  1BUI C;  3ZXV A;  1KLU D;  2I1K A;  4ZRJ A;  1YMH E;  3TUO A;  1E7P B;  5J2R A;  5EDS A;  2G4S A;  1C78 A;  5AZH A;  3H7S A;  3AED B;  3QA8 A;  1JCK B;  2KJR A;  1L0Y B;  4HKQ A;  1LFD A;  2KX3 A;  1D6E C;  1EUV B;  1SE2 A;  4MJS B;  1FCL A;  2QHO A;  1VZ6 A;  4I6L B;  1ZKH A;  2K8C A;  4TKN A;  3VTV A;  2WLB A;  3N20 C;  1CJE A;  2ACZ B;  1XCT L;  3PTF C;  2MBQ A;  1WFY A;  2G3Q B;  4WAA A;  2BKF A;  1AWD A;  3RNE C;  4M8M A;  2RPV A;  1UBI A;  3RNB C;  5HHD G;  1C4P A;  2SEB D;  2KVZ A;  2KJH B;  2OHF A;  4WQO B;  4BBN C;  3V62 A;  5C2T B;  3APF A;  4ZRP A;  1TBE A;  1V81 A;  3I3T B;  4WJO A;  3ZIM A;  4K7S A;  1DOX A;  4RGM A;  2XK5 A;  4NJ7 A;  3R3M A;  3A33 B;  2M56 B;  4IDI A;  4JPS A;  3KH0 A;  1T0Y A;  3NVW A;  5CHW A;  2KLG A;  3PRM B;  1EU3 A;  1KLG D;  2LZ6 A;  2G45 B;  4G3X B;  1PQS A;  4E3C A;  3DPD A;  3V6C B;  2ONQ A;  1HTO A;  3GP7 A;  4OW0 A;  2KKC A;  3ZNI D;  4DHJ D;  4AWJ A;  3IG3 A;  3AEG B;  2KTR B;  2WXP A;  3QX1 A;  2CU3 A;  1SB3 C;  3AU5 A;  2ZCC A;  3GZN I;  3SEB A;  1MVK A;  3E56 A;  1FMA D;  1U4A A;  4HPM B;  4BFR A;  1RFA A;  1WXQ A;  2L83 A;  2WGS A;  2Z0E B;  3NJT A;  2BW2 A;  4IWP A;  3JW0 X;  3ZXR A;  4G50 A;  4DQO C;  1WY8 A;  2KO3 A;  2KWD A;  2AL6 A;  2MP2 A;  2EEL A;  4II2 B;  2NS5 A;  2LVQ A;  2LGS A;  1V1P A;  3WAP A;  2ZZP B;  2LGD A;  1QZE A;  3U4E G;  3ZDM C;  4A55 A;  2KD0 A;  4GLS C;  2K25 A;  2V3S A;  3CWI A;  4WAF A;  4TSS A;  3M62 B;  2O6V D;  3KUZ A;  1A70 A;  2BWE S;  2KDB A;  4LNF A;  3A1Q B;  1KJT A;  4NAW B;  1E7U A;  2TSS A;  1ZDX A;  4NAM A;  5E6J A;  3VRB B;  2LXA A;  2INN E;  4FAD A;  1OGW A;  2O2V B;  3B1L X;  4YL8 A;  3R7R A;  5JXV A;  4MGZ E;  1J0G A;  4HKZ E;  4FJY A;  5EE0 A;  1LXD A;  2J7Q B;  4P16 A;  1EO6 A;  4F7Z A;  4KX6 B;  4W9J A;  2D3B A;  3DVG Y;  1WR6 E;  3AU4 A;  4W9C A;  3TMP B;  4EZK A;  2OED A;  1L6V A;  5BMH A;  5AUI A;  2MHJ A;  3ZUN A;  5C1Z A;  5T8I A;  3ZTD A;  1NI2 A;  3N1Z C;  4ANV A;  2ZEQ A;  2UYZ B;  3RYT A;  2L0T A;  2MCN B;  3DBL I;  3Q3J A;  4WJP A;  4IM3 A;  3AEE B;  2BBC A;  2CU1 A;  4WJN A;  3L10 B;  2YEP F;  4LK0 M;  1WJN A;  3AE8 B;  3VHT C;  3AE1 B;  4QAY A;  3A1Q A;  4AP4 C;  2WHI A;  3VH4 B;  1NEK B;  4B6W A;  2FID A;  3QWZ B;  2D2Q A;  4IC7 B;  3QCA A;  2YLM A;  3U52 E;  2KMM A;  4US8 A;  2JT4 B;  2WXK A;  1V1P B;  2MLB A;  1TIF A;  3A4R A;  1YJJ A;  1HTQ A;  1XO3 A;  2NR2 A;  2WXL A;  2KNB A;  5IO9 A;  5EE3 A;  1YQ3 B;  1EF5 A;  1TGZ B;  2KZR A;  1XLP A;  4DHZ E;  3MFG A;  1WJ6 A;  1PGX A;  4JWU C;  3EA6 A;  1T6B X;  1V5O A;  3DBH B;  2HE7 A;  5L95 C;  5G5G A;  1ZPS A;  2VH1 A;  2XBB C;  3CF6 E;  5JH5 C;  3NY5 A;  4NNJ B;  1FPY A;  2ICI A;  2VH2 A;  3PLU A;  1OQR A;  3RZF A;  4WIP A;  2MJE A;  4LCD E;  2FBW B;  3U7D A;  4K81 A;  3BZD B;  2KTR A;  2M0A A;  3ML9 A;  4N59 A;  2INP E;  1CMX B;  4LJP B;  3TEX A;  3LXF A;  1SJE D;  4A3O A;  1WMH B;  1YD8 U;  5JZE B;  4IM0 A;  3VUX A;  2ZW1 A;  1UH6 A;  2NTT A;  2CHX A;  3ZNZ B;  3WAN A;  2IO0 B;  2ZW0 A;  2KFK B;  2LVP A;  3OWE B;  2FE8 A;  1GG3 A;  1TT5 B;  1V97 A;  1WGG A;  3QIJ A;  3KYD D;  2J53 A;  4KKI A;  1E6E B;  2JXT A;  3UIN B;  2FAZ A;  4MGK E;  3OAW A;  4TQ1 A;  3WAM A;  2N0S B;  2MJ3 A;  1E8Y A;  2AWT A;  3W5V B;  3M95 A;  3ZJT A;  3NUH B;  3PVL A;  4RNA A;  1WSP A;  1SSN A;  1ZDV A;  2EKI A;  4P1B C;  4IOI E;  4LJO B;  2JYE A;  4FA6 A;  4GSW A;  1ZE3 D;  3L17 A;  3PZD A;  3EHV A;  5G55 A;  2KDF B;  2KN5 A;  1P7F A;  2JPH A;  2K1F A;  2BKR B;  4MGI E;  4G11 A;  1N5X A;  1D3Z A;  2M4N A;  2NTS A;  4ANX A;  2JVC A;  1J7C A;  3NZ3 A;  3GE3 C;  2BF8 B;  2W3R A;  3H8H A;  1Q5W B;  2IDY A;  3EGR A;  1V1O A;  3BYY B;  1WE6 A;  3EUB 2;  2WX0 A;  1GUA B;  1GB4 A;  2KDM A;  2W3S A;  1F0Z A;  4BKG A;  2DAF A;  2KQ7 A;  2RDH A;  2BS3 B;  4NZL B;  3N30 A;  3VTW A;  1S3S G;  1WYG A;  5E6N A;  3C8Y A;  3DCG A;  1T0R C;  2KTF A;  1WZ0 A;  3C0R B;  4RGT A;  1I42 A;  2WYQ A;  5G2N A;  2IGG A;  2K8H A;  2HTM E;  3ENE A;  3N9Y C;  2PPH A;  4DDG D;  2MEK A;  4J6I A;  3IAS 1;  4NQL B;  5DPS A;  2INC C;  3BK2 A;  2KC2 A;  1TZ1 A;  2N9X A;  5TSS A;  4K7W A;  4YTN B;  2LHD A;  3RT3 B;  3KUD B;  4C80 A;  2PJH A;  3T3N A;  3KUC B;  4N9F 4;  1I4P A;  1HE8 A;  1ZXI A;  2WDQ B;  3BII D;  5C23 A;  3B0A A;  3PRZ A;  3A9J B;  2R61 A;  4GGQ A;  4B0E A;  3PHW B;  1FRD A;  1GPX A;  3ETR A;  2GBK A;  3OG5 A;  1JWU D;  1QOB A;  1X1M A;  2REX A;  1NEN B;  4YXD B;  2KYW A;  2K6D B;  3P4S B;  4IWQ A;  3KWL A;  2FCM A;  3P2B A;  1RYJ A;  2QEJ C;  3AH7 A;  2AEH A;  2V9H A;  2L76 A;  4E74 A;  1V2Y A;  5EE9 A;  4EE2 A;  5IOI A;  4W9E A;  4K3C A;  1VJK A;  2GLS A;  3UF8 A;  2NPT B;  1ESF A;  1NBF C;  2KWC A;  2L1A A;  2QJL A;  3PPA A;  2FCQ A;  4EZL A;  1N6Z A;  1HZ6 A;  2WU2 B;  2LFI A;  5FK9 C;  5DCN A;  5CHV C;  2JXX A;  1MFW A;  3Q6B A;  3ZQ4 A;  5D7G A;  4WH4 A;  2KWV B;  4L1B A;  1IGC A;  4RH6 A;  3ALB A;  1KH0 A;  4GDL A;  4OHJ A;  4TV3 A;  3WA0 A;  1MHH E;  4DHZ B;  1K50 A;  1WX7 A;  4F1S A;  4M8N A;  1T0Q C;  2ZVO A;  1UF0 A;  4ARC A;  2KOX A;  2RDB C;  1PDX A;  5HI1 A;  3N32 A;  2I38 A;  3I63 C;  4W9G A;  4DBG A;  1WRI A;  4DWF A;  3QC8 B;  2JZZ A;  1V8C A;  2XN9 C;  1WGY A;  2ON8 A;  4XX5 A;  1XQQ A;  3R8B A;  4IG7 B;  3ZW3 A;  3NHE B;  4JL9 A;  1VD2 A;  1FM0 D;  2C9W B;  2DYO A;  2R2Q A;  1E8Z A;  2W82 A;  3DVN V;  3VH3 B;  2NBW B;  3A4S C;  1WE7 A;  4LNN A;  1VRA B;  2WXN A;  3UI3 A;  3WCQ A;  2WDV B;  4PS3 A;  3L16 A;  4AQ7 A;  1IP9 A;  3PSE B;  1F1H A;  5BYR A;  4EZJ A;  1WMH A;  1FFU A;  1QT9 A;  3PRP B;  3C19 A;  3AEC B;  3QAR A;  2E3T A;  4C7Y A;  1WXM A;  3Q3F A;  2UU7 A;  2PVG C;  2MX2 A;  1N60 A;  1C1Y B;  2QC8 A;  4XDD A;  2C7N B;  1FCC C;  2IBI B;  2IZV B;  2G4D B;  3MHZ A;  2PE9 A;  3RNF C;  1OEY J;  3W9C B;  3ZVV A;  1P3Q U;  5H92 C;  2Y5B B;  1XF5 L;  4YTM B;  3PZ8 A;  2KWU B;  1RWS A;  1FIQ A;  1E10 A;  3DVN U;  4PYU A;  2JZP A;  2C60 A;  4REZ A;  1CK1 A;  1E90 A;  3HRD D;  3A9K A;  1EWC A;  2FCN A;  5DPT A;  4A9A A;  2DZK A;  2JF5 A;  3KYC D;  2IGH A;  1TZO A;  4NY0 A;  1TKG A;  3WAO A;  1M4V A;  2JY6 A;  5LXI B;  3IVF A;  3RZW C;  2Z8L A;  4O1N A;  2RPQ A;  5MPO A;  2ASQ A;  3DDC B;  3QAQ A;  3ZRF A;  2MQJ A;  3UIP B;  3HK0 A;  1STE A;  2IY0 B;  3RCZ A;  1GNU A;  2K39 A;  2KAN A;  4TMA B;  3DBL B;  3H7P B;  1V86 A;  1KLV A;  3APD A;  3CST A;  2BYF A;  5LXH A;  2FCS A;  2QSD A;  3I5J C;  3WIM A;  3B9J A;  3P42 A;  1UZX B;  3DWM A;  1DGJ A;  3CSF A;  3H9D A;  3M3J A;  2L3Z A;  4RGO S;  3Q8E A;  4AJW A;  1HZ5 A;  4W9I A;  2BVC A;  3BVG A;  2YVC A;  2HJ1 A;  1YN5 A;  4A90 A;  4X57 B;  2ZNV B;  1AW7 A;  3RUI B;  3ZNH B;  4ITK A;  2K6Q A;  1NDD A;  4MDK E;  2D5G A;  2M17 A;  2CJO A;  1H8C A;  2L8J A;  5CTR C;  3ZLZ A;  3R2T A;  4RF1 A;  2JZ3 B;  3DVG X;  4S0R A;  4ASW C;  3URY A;  4NAW A;  4MM3 A;  5BYS A;  1FXT B;  4DHJ B;  4HRO A;  1K52 A;  2V3N A;  1C77 A;  3VUW A;  2DZM A;  4IUM B;  2ZPN A;  1WGR A;  4BVU C;  1TS5 A;  1ROE A;  1QLB B;  4XGA B;  3BVZ A;  4OVV A;  1ET9 A;  3TEY A;  1XCQ L;  2IGD A;  1HXY D;  2D3A A;  1WJ4 A;  1N61 A;  3P1M A;  3N1Y C;  2J42 A;  1QIL A;  4ZRK A;  1GJZ A;  4BKT A;  2D3C A;  4FJZ A;  3MC8 A;  3Q3M C;  1A5R A;  3RN9 C;  3VDZ A;  1C79 A;  1J19 A;  3AM9 A;  4ANU A;  3FIL A;  3NVZ A;  3V3X A;  3RFZ B;  5D3D A;  2IO1 B;  2BPS A;  5IN7 A;  1OEY A;  2N1W A;  1YJ1 A;  2K9X A;  2JYT A;  2HDE A;  4OVU A;  5CHF A;  2GBR A;  1OQY A;  3NOB A;  3Q8C A;  3MC0 B;  1NYQ A;  3ZYY X;  1MHX A;  1FXI A;  4KZ0 A;  4PK1 A;  1JQ4 A;  3L08 A;  4R3D A;  1MG4 A;  2H89 B;  1ZUD 2;  1N62 A;  2MH7 A;  2UWQ A;  3HIZ A;  2BT6 A;  3LB8 C;  3RD2 A;  3PT2 B;  4ARI A;  4NPN A;  1WH3 A;  2FUG 1;  2WS3 B;  4IWO A;  5G5H A;  1R4M I;  4KGS A;  1DYQ A;  2WXF A;  1VCB A;  1ZXH A;  2KLC A;  3QJZ A;  3RUL A;  2NBU A;  1L2N A;  3TEW A;  2KDI A;  1ZW7 A;  3PZ7 A;  1RFK A;  1WX8 A;  1OTR B;  2EKE C;  3NS1 A;  4F8C B;  5E6O A;  4RCO A;  4WWN A;  4AOF A;  5H8Y E;  1L6U A;  2MBB B;  1D5X C;  2RGF A;  2JUO A;  3ML8 A;  1D5M C;  2JRI B;  1JML A;  2M8S A;  3P4Q B;  4XE0 A;  4C00 A;  3MP9 A;  4N6E B;  2V4I B;  4LNI A;  1QOF A;  2NVU I;  4ZRQ A;  3AE5 B;  2E6X A;  4PS8 A;  2KN4 A;  1Z5S B;  4P1C C;  2QDF A;  3K9P B;  5LNK 1;  2AQ1 B;  2MWS B;  4KDL B;  3TCA A;  1S1Q B;  1E7V A;  4KKJ A;  2WXQ A;  4USA A;  3DHI C;  3DBH I;  1JWM D;  3H1U A;  3V05 A;  2L05 A;  1FEH A;  2I2Y A;  5JHB A;  4AS1 A;  2K3U A;  2VRR B;  2KX0 A;  1PFD A;  4J3O D;  4ICU A;  2PEA A;  4ZDV A;  4C4V B;  1TKY A;  4EOY A;  3IHP C;  2JWZ A;  5IKC M;  4HK2 A;  2KQS A;  1DOY A;  2MJD A;  3L0W B;  3ECI A;  3B2F A;  4AJY B;  2G9H D;  4GDK B;  1GC6 A;  1SE3 A;  4C56 C;  4NJ6 A;  3GOE A;  1K51 A;  2K0P A;  4MAC A;  3AEB B;  4W9D A;  1VZ7 A;  4I6P A;  1HA5 A;  3BK1 A;  2ZJD A;  4OZA A;  4YT0 B;  4YSY B;  3W2D A;  4HCP B;  3NZS A;  2W54 A;  1C9F A;  5J18 A;  4BKS D;  2X8X X;  4HVB A;  5DPW A;  4WWM A;  2DEN B;  1D4B A;  3EC8 A;  1Y8R C;  3L54 A;  3IXS A;  4NJC A;  4GDL B;  2PMV A;  1K8R B;  3LYY A;  1TS4 A;  3TL5 A;  4BZA A;  1EF1 A;  4HCN B;  5L83 A;  2D3G A;  3T8M A;  3L13 A;  3AE6 B;  2CR5 A;  1WIA A;  2B3A A;  2WXI A;  4OZC A;  1PUT A;  5KHO A;  1XLN A;  3T9L A;  2AQ2 B;  1LM8 B;  2XK5 B;  4PT5 A;  2QIL A;  4ICV A;  1V49 A;  2L0F A;  5J17 A;  1XD3 B;  4MSM B;  2HTH A;  1T0S C;  4RM8 A;  3O65 B;  1LQB A;  2Y5C A;  2ZCB A;  3AEA B;  2KQ4 X;  2JRH A;  4IKG A;  3RPF C;  1SJH D;  5HG2 A;  3TSS A;  1GAQ B;  2C5L C;  2LI5 A;  1J7A A;  2M0X A;  2DHZ A;  4RGN A;  2WP9 B;  3OJ3 A;  2C7M B;  1IPG A;  5D6J B;  1AAR A;  1WYW B;  2L52 A;  3SHQ A;  3AXC A;  5FKA C;  2N7J A;  5AZF A;  3UIO B;  3B08 A;  3IFW B;  2V3P A;  2EMS A;  3RNA C;  4GIV A;  2WDR B;  3RNG C;  1N63 A;  2WXM A;  3GZN B;  4HJG E;  2WQY B;  3U7Z A;  2CHW A;  4US9 A;  4EFO A;  3VFK A;  1EU4 A;  1Q1O A;  1YN3 A;  1IUE A;  1SEB D;  4CYE A;  3J9C A;  1JAL A;  1UEL A;  2A5U A;  2KVR A;  4XWT A;  5GMV A;  5TR5 A;  1YJI A;  2NBV B;  4LDT B;  3HVZ A;  3MJ5 A;  2LGI A;  1AN8 A;  1P9D U;  2BWF A;  1E8W A;  3X23 A;  3Q3N C;  1N5W A;  1L5P A;  4BAX A;  1VDV A;  2EMT A;  1VR9 A;  1VZ8 A;  4JX1 C;  1WJU A;  4FBJ B;  3SFD B;  3L4P A;  3VUY A;  2LRW A;  4K7U A;  1JW9 D;  1FO4 A;  1CQV A;  1TTN A;  3MTN B;  2WXR A;  2DAJ A;  1RAX A;  3BY4 B;  1BT0 A;  1SE9 A;  2N9P C;  2LXC A;  3CIR B;  1UWX A;  1C4C A;  2D07 B;  2MA9 B;  2BB5 A;  1IYF A;  4B9K A;  4RFB A;  2MBO A;  3OJ4 B;  1K53 A;  1B9R A;  3JYU A;  2I1J A;  2R2O A;  4KDI C;  5D3I B;  2LUE A;  2WXH A;  4MSQ B;  3W1S A;  2BQQ A;  1G6J A;  1I4Q A;  3JSV B;  3ZKJ C;  1JWA D;  2BYE A;  4N58 A;  4FJV B;  4ANW A;  2DZJ A;  1GB1 A;  2NPT A;  4YSZ B;  1P98 A;  2QIE B;  4NQK E;  1L4D B;  3AE7 B;  4P7I A;  1YOV B;  3SD5 A;  1RRB A;  3AE4 B;  4A3P A;  2ZPY A;  2DYB A;  3FKY A;  1JRP A;  2LJI A;  3JSV A;  3UQA A;  3HUI A;  5AUK A;  1WXA A;  2J0M A;  1LGR A;  3TBL D;  2KT7 A;  3VXW A;  3WAL A;  4KV2 A;  1M94 A;  3A9J A;  3AN1 A;  3AE2 B;  2RMM A;  4CHK A;  2L7R A;  4W9H A;  2KAJ A;  4YTP B;  2FUH B;  1V5T A;  3E9S A;  3MC9 A;  2AX5 A;  5E6P A;  3MHS D;  3TIX A;  1PGA A;  3RI7 C;  2DLB A;  3P4P B;  3W1S C;  1JRO A;  3IT4 B;  1WF9 A;  2PVO D;  1PGB A;  1T3Q A;  4HDQ A;  3Q8A A;  3BVM A;  3DHH C;  1YQ4 B;  3QHT A;  4PYZ A;  2MBE A;  1R4M B;  2Z0D B;  3ZDT A;  2RD0 A;  1V6E A;  5EE1 A;  5IA7 A;  1GC7 A;  2DNF A;  4G0N B;  4KIK A;  4ZOH C;  3ZJU A;  1I7H A;  2KDE B;  2JX5 A;  5BO4 B;  4PS7 A;  4WWO A;  2BTE A;  2BB6 A;  1UGM A;  3AB5 A;  5I4D A;  1MJD A;  4KSK C;  2VZK D;  2GI9 A;  2DWQ A;  4C4V A;  4WQM A;  2B76 B;  1L4Z B;  2M19 A;  4URK A;  3NS8 A;  4FXC A;  1QOG A;  1C76 A;  3NRZ A;  3LJ3 A;  2Y5P A;  1QQR A;  2MSE D;  3DWG C;  4TUU A;  5HFY A;  1FNV A;  3D32 A;  3CMM B;  2LAS A;  2V0G A;  3B2G A;  1P7E A;  3SU8 X;  2DBY A;  1F9J A;  4XYC A;  3EEC A;  1CZP A;  2N4F A;  2QMT A;  3ONS A;  3AMZ A;  4BBN F;  1V80 A;  3IBE A;  4S17 A;  1NYR A;  1ET6 A;  2FNJ B;  1OQQ A;  1L7Y A;  2JU6 X;  1YNT E;  4CQN A;  1WXV A;  4AUQ C;  1FXA A;  3U2S C;  3TJP A;  2W55 A;  1ACC A;  4K1R B;  1IBX A;  1SF0 A;  4L23 A;  3I57 A;  4TQ0 A;  5LLI A;  1QF6 A;  2WU5 B;  1F2R I;  4EUT A;  3NG0 A;  4FN2 A;  2O2V A;  1ZGU B;  1TS3 A;  1EM7 A;  3VQI A;  4WWP A;  4A6Q A;  1KM7 A;  1TS2 A;  2A4Z A;  1UGJ A;  2RDG A;  3UQB A;  1Q0W B;  3NZU A;  2RSU A;  4UDU C;  2KMC A;  4XWW A;  1WM2 A;  2NMQ A;  2IPK D;  1I35 A;  1F77 A;  5IP4 D;  4C7Z A;  4EEW A;  1T5X D;  3ZTC A;  2DX5 B;  3M63 B;  2PLP A;  1KTK A;  2JQR B;  2KFK A;  2PW9 A;  1WGH A;  4YWG G;  1J8C A;  1SGH A;  1BML C;  1WRD B;  2N7D A;  2Q5W D;  3MJW A;  1KFY B;  3TEZ A;  1IBX B;  4FLH A;  4MGY E;  4ACF A;  1YQB A;  2D10 A;  3GS2 A;  1TJE A;  4M0W A;  1WZ3 A;  3ABV B;  4M02 A;  4GN1 A;  3FC4 A;  2J0J A;  4DK5 A;  2K22 A;  4W9L A;  2LWP A; 
#chains in the Genus database with same CATH homology
 1VZ7 A;  1HA5 A;  2GRI A;  2OHF A;  3BK1 A;  2SEB D;  5EE9 A;  4EE2 A;  4OZA A;  4YT0 B;  4YSY B;  5BMG A;  3W2D A;  1VJK A;  5C2T B;  1ESF A;  1YN4 A;  2L1A A;  2QJL A;  4ZRP A;  2W54 A;  1C9F A;  1HZ6 A;  2WU2 B;  2LFI A;  4WWM A;  5FK9 C;  1DOX A;  4RGM A;  2AQ3 B;  1D4B A;  1XXG A;  3VRA B;  3IXS A;  2M56 B;  4IDI A;  3ZQ4 A;  4JPS A;  2N9L A;  4NJC A;  5D7G A;  3HVD A;  4GDL B;  4WH4 A;  3NVW A;  2PMV A;  4L1B A;  3LYY A;  1IGC A;  1EU3 A;  1KLG D;  2DYM A;  2JSV X;  1B1Z A;  1KH0 A;  1TS4 A;  3I9V 1;  4RH6 A;  4OHJ A;  1FRR A;  1MHH E;  2ONQ A;  2WNM A;  3GP7 A;  4OW0 A;  1K50 A;  1OFF A;  2X38 A;  3AE6 B;  1BXT A;  1AYF A;  2WXI A;  3AE9 B;  4OZC A;  1PUT A;  1C4A A;  4ARC A;  1ZOY B;  3AEG B;  5BYQ A;  1XLN A;  2WXP A;  2AQ2 B;  2CU3 A;  1PDX A;  1SB3 C;  2QIL A;  4PT5 A;  5HI1 A;  2I38 A;  3SEB A;  1WRI A;  1MVK A;  3E56 A;  1FMA D;  1V8C A;  2XN9 C;  2PKO A;  2ON8 A;  2Y5C A;  1QOA A;  1PYW D;  3AEA B;  1WXQ A;  1ENF A;  2L83 A;  2LHE A;  5GXG B;  3R8B A;  2KQ4 X;  2BW2 A;  4IKG A;  1F2R C;  1HQR D;  3RPF C;  1FM0 D;  2DYO A;  4DQO C;  1E9M A;  1SJH D;  2CJN A;  1SBB B;  5HG2 A;  2KWD A;  2W82 A;  3TSS A;  1GAQ B;  2EEL A;  1J7A A;  1KRH A;  3SFE B;  1GOZ A;  1V1P A;  5FR3 A;  4ZYS A;  4RGN A;  2WP9 B;  3PO0 A;  2KAC A;  1VRA B;  3U4E G;  2WXN A;  3UI3 A;  2L52 A;  4A55 A;  3WCQ A;  2WDV B;  1LO5 D;  4GLS C;  4LLG M;  2BS2 B;  3CWI A;  4B0M A;  5FKA C;  2N7J A;  4TSS A;  4WAF A;  4AQ7 A;  4JE3 B;  1A70 A;  5BYR A;  2V3P A;  1WWT A;  4NAW B;  1FFU A;  1MI0 A;  2TSS A;  1QT9 A;  1ZDX A;  2WDR B;  1N63 A;  2WXM A;  3AEC B;  4NAM A;  5E6J A;  3VRB B;  5BMI A;  2E3T A;  4HJG E;  2WQY B;  3U7Z A;  4C7Y A;  2INN E;  4US9 A;  2PVG C;  1I4R A;  1EU4 A;  1I4X A;  1N60 A;  1YN3 A;  4XDD A;  1IUE A;  1FCC C;  1SEB D;  3J9C A;  1JAL A;  5JXV A;  4HKZ E;  1FNW A;  5EE0 A;  4P16 A;  4XDC A;  1JWB D;  3MHZ A;  3KWV A;  4XWT A;  4KX6 B;  3O13 A;  3W9C B;  1YJI A;  1ZP0 B;  4DXF A;  3HVZ A;  3P4R B;  3MJ5 A;  5H92 C;  1XF5 L;  4YTM B;  2LGI A;  1AN8 A;  2OED A;  3PZ8 A;  1KF6 B;  1QKZ A;  1L6V A;  5BMH A;  1RWS A;  1FIQ A;  5AUI A;  1E10 A;  2PIA A;  1FFV A;  4A8X C;  1N5W A;  1TYG B;  1L5P A;  4JWS C;  2JZP A;  4REZ A;  3FAH A;  3NVV A;  1CK1 A;  1UWM A;  5T8I A;  1VDV A;  3HRD D;  1WGK A;  1VR9 A;  3SR6 A;  2GB1 A;  1EWC A;  3VR8 B;  1VZ8 A;  4A9A A;  4JX1 C;  4MH8 A;  4OVZ A;  2IGH A;  3SFD B;  1I4G A;  1TZO A;  1L0V B;  3L4P A;  4L2Y A;  1TKG A;  1M4V A;  3GB1 A;  1JW9 D;  1FO4 A;  3FIL B;  1E0Z A;  1CQV A;  2Z8L A;  4O1N A;  3IAM 1;  5MPO A;  2N9K A;  3AEE B;  2BBC A;  2WXR A;  3Q69 A;  1STE A;  2YEP F;  1SE4 A;  4ZHO A;  4LK0 M;  3AE8 B;  3CIR B;  1UWX A;  1DOI A;  3AE1 B;  1C4C A;  2BB5 A;  3NVY A;  4TMA B;  1NEK B;  4RFB A;  1D5Z C;  1EWY C;  2WXO A;  3U52 E;  1K53 A;  1TY0 A;  2KMM A;  4US8 A;  2QSD A;  1B9R A;  1FNU A;  1TKE A;  1XEE A;  2WXK A;  1V1P B;  3IT6 B;  3B9J A;  4H2A A;  1R7S A;  3P42 A;  1YJJ A;  5D3I B;  1XO3 A;  2WXH A;  3DWM A;  2WXL A;  1DGJ A;  3AE3 B;  3W1S A;  4MM3 B;  5EE3 A;  1YQ3 B;  4RGO S;  2WXJ A;  3R2I A;  3Q8E A;  1I4Q A;  2PTL A;  1HZ5 A;  1XLP A;  3MFG A;  1JWA D;  1PGX A;  4JWU C;  3EA6 A;  1T6B X;  5G5G A;  3P63 A;  4RF0 A;  1ZPS A;  4N58 A;  3BVG A;  1GB1 A;  2ICI A;  1OQR A;  1YN5 A;  4WIP A;  4A90 A;  4YSZ B;  2MJE A;  2QIE B;  5C3J B;  1AW7 A;  1L4D B;  1Q10 A;  1Y56 A;  2FBW B;  3AE7 B;  3BZD B;  4ITK A;  2M0A A;  1XLO A;  2D5G A;  1NVI D;  3AE4 B;  1SXT A;  4N59 A;  2CJO A;  2INP E;  1UUP A;  3TEX A;  3LXF A;  1JRP A;  3R2T A;  2LJI A;  4RF1 A;  2Y3A A;  1SJE D;  3URY A;  2ZW1 A;  3HUI A;  5AUK A;  2NTT A;  5BYS A;  3T3O A;  4HRO A;  1K52 A;  2V3N A;  1C77 A;  3ZJV A;  3KLS X;  4D2K A;  1I4H A;  3AN1 A;  2ZW0 A;  3AE2 B;  2RMM A;  1TS5 A;  1ROE A;  3OWE B;  2FE8 A;  1QLB B;  2KAJ A;  2G1E A;  4YTP B;  1XLQ A;  3BVZ A;  1NI3 A;  1ET9 A;  3TEY A;  3E9S A;  1XCQ L;  2IGD A;  1V97 A;  1HXY D;  1UNS A;  2AX5 A;  2J53 A;  2J4X A;  4KKI A;  4P6V F;  1E6E B;  2JXT A;  1N61 A;  3AEF B;  3P1M A;  1PGA A;  1MPE A;  2DLB A;  3BYT B;  2J42 A;  1QIL A;  3AV8 A;  2LMC A;  4MT5 A;  1FD6 A;  3P4P B;  1JRO A;  4HEA 1;  2IJ0 A;  3IT4 B;  1C79 A;  3AM9 A;  1RM6 C;  1PGB A;  2LEK A;  2PVO D;  4TQ1 A;  2N0S B;  2MJ3 A;  1T3Q A;  3BVM A;  3Q8A A;  3W5V B;  1YQ4 B;  4Q2J A;  3FIL A;  3NVZ A;  3ZJT A;  3V3X A;  3RFZ B;  5D3D A;  3NUH B;  4RNA A;  1WSP A;  1SSN A;  1ZDV A;  2EKI A;  4OZB A;  5EE1 A;  2K9X A;  4IOI E;  2JYT A;  2HDE A;  2J52 A;  2JYE A;  1ZE3 D;  4ZOH C;  3ZJU A;  2YEP B;  1I7H A;  3Q8C A;  2JX5 A;  3MC0 B;  4HRS A;  1NYQ A;  2BTE A;  3ZYY X;  1P7F A;  2BB6 A;  3Q8B A;  3AB5 A;  3ZGZ A;  1J7B A;  1MHX A;  1FXI A;  5I4D A;  1JQ4 A;  4R3D A;  2VZK D;  2GI9 A;  2DWQ A;  2H89 B;  1ZUD 2;  1N62 A;  1N5X A;  3VR9 B;  1HEZ E;  1VLB A;  2MH7 A;  2NTS A;  4WQM A;  2BT6 A;  1J7C A;  3NZ3 A;  2B76 B;  3LB8 C;  1L4Z B;  2M19 A;  4DXG A;  4FXC A;  2BYT A;  2W3R A;  1QOG A;  1C76 A;  3NRZ A;  2Y5P A;  3H8H A;  1QQR A;  4ARI A;  2IDY A;  3EGR A;  1V1O A;  2L32 A;  2LUM A;  2FUG 1;  1IGD A;  3BYY B;  2WS3 B;  5G5H A;  3DWG C;  3EUB 2;  5HFY A;  1FNV A;  1JWS D;  4KGS A;  2V0G A;  3B2G A;  1GB4 A;  2JWU A;  1DYQ A;  2H88 B;  2WXF A;  2KDM A;  1ZXH A;  1P7E A;  2W3S A;  2DBY A;  1F0Z A;  3Q8F A;  3TEW A;  1CZP A;  2XNA C;  2RDH A;  3PZ7 A;  2QMT A;  3KQ4 A;  1RFK A;  4WUR A;  2BS3 B;  2VZK B;  3AMZ A;  2WXG A;  3NS1 A;  4KGT A;  4NZL B;  4LTU A;  1NYR A;  4RCO A;  1ET6 A;  1WYG A;  3C8Y A;  1OQQ A;  2JU6 X;  5H8Y E;  4ZHP A;  4RGT A;  1YNT E;  4CQN A;  1L6U A;  4YSX B;  1L0X B;  1FXA A;  3U2S C;  1D5X C;  2W55 A;  3BWU D;  1D5M C;  1ACC A;  1JML A;  2IGG A;  1IBX A;  2HTM E;  1SF0 A;  3W5U B;  4L23 A;  2SAK A;  3P4Q B;  4XE0 A;  3I57 A;  2BS4 B;  3MP9 A;  3N9Y C;  4N6E B;  2V4I B;  4TQ0 A;  1QOF A;  1QF6 A;  1TY2 A;  2MEK A;  2WU5 B;  1SIJ A;  4ZRQ A;  3AE5 B;  3IAS 1;  2E6X A;  2K5P A;  4KGR A;  1BUI C;  1F2R I;  1KLU D;  2KN4 A;  3BK2 A;  1YMH E;  3TUO A;  1E7P B;  5LNK 1;  1TS3 A;  1EM7 A;  2AQ1 B;  3VQI A;  5TSS A;  4YTN B;  1C78 A;  4A6Q A;  2LHD A;  1TS2 A;  3AED B;  1UGJ A;  2RDG A;  4C80 A;  4KKJ A;  4UDU C;  4XWW A;  1JCK B;  2WXQ A;  2NMQ A;  4USA A;  2IPK D;  3T3N A;  1JWM D;  3V05 A;  1F77 A;  1L0Y B;  1FEH A;  2I2Y A;  4C7Z A;  4HKQ A;  1T5X D;  4AS1 A;  1D6E C;  1I4P A;  1SE2 A;  1ZXI A;  2K3U A;  2WDQ B;  1FCL A;  3BII D;  2PLP A;  1KTK A;  1PFD A;  2JQR B;  1VZ6 A;  2PW9 A;  4YWG G;  4J3O D;  2R61 A;  4B0E A;  1BML C;  2WLB A;  1TKY A;  1CJE A;  1FRD A;  1XCT L;  2ACZ B;  1GPX A;  2Q5W D;  3ETR A;  1IBX B;  1KFY B;  3TEZ A;  1DOY A;  2MJD A;  3GS2 A;  1JWU D;  1AWD A;  3B2F A;  2G9H D;  4GDK B;  1SE3 A;  1QOB A;  1TJE A;  4C56 C;  4M0W A;  3ABV B;  3FC4 A;  1NEN B;  2RPV A;  4YXD B;  5HHD G;  1K51 A;  2K0P A;  3P4S B;  4MAC A;  3KWL A;  2K22 A;  1C4P A;  1RYJ A;  2QEJ C;  3AH7 A;  3AEB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...