2N9KA

1h, 13c, and 15n chemical shift assignments for in vitro gb1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
57
structure length
57
Chain Sequence
b'MGTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein G
publication title Improved in-cell structure determination of proteins at near-physiological concentration
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
molecule tags Immune system
total genus 15
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2015-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2n9kA00
4HKZE 2KWDA 2PTLA 4GLSC 1K53A 3FILA 2IGDA 2JSVX 2JU6X 1MHXA 1MPEA 2J53A 1PGBA 2N7JA 2ONQA 2QSDA 2ZW0A 4OZAA 2N9KA 2KQ4X 5HI1A 2KN4A 1IBXB 2PLPA 2LGIA 1XCTL 5HG2A 2JZPA 1IBXA 2K0PA 4IKGA 4MACA 2PW9A 1XCQL 1P7FA 1IGCA 1Q10A 1QKZA 2I38A 1P7EA 1GB4A 1K51A 1PGXA 3MP9A 1EM7A 3V3XA 4KGSA 1PGAA 4KGTA 2LUMA 1MI0A 1JMLA 3UI3A 1YMHE 2NMQA 1XF5L 1MVKA 5BMGA 2GI9A 2LHEA 1HEZE 1KH0A 2QMTA 1HZ5A 2RMMA 1IGDA 4KGRA 2ON8A 4D2KA 1FCLA 2JXTA 2J52A 4IOIE 1C9FA 1K52A 5HFYA 2I2YA 1D4BA 2KDMA 1GB1A 5HHDG 1HZ6A 2N9LA 2IGGA 1MHHE 2IGHA 4OZCA 1ZXHA 2LHDA 4OZBA 2GB1A 2RPVA 2ZW1A 2EELA 1F2RI 3GB1A 1UWXA 1K50A 1FCCC 5BMHA 4HJGE 2KACA 5JXVA 4WH4A 1FD6A 1F2RC 5BMIA 2OEDA 3FILB 1YNTE 2JWUA
chains in the Genus database with same CATH superfamily
3NG0A 2PTLA 1TS2A 2DLBA 1WSPA 1V80A 3EC8A 1E6EB 1J7BA 4W9IA 1R4NI 4QAYA 1QOGA 2GBRA 2ZCBA 2I1JA 1Q1OA 2N9KA 3AU4A 2KD0A 4GB9A 2V4IB 3DBRB 1V6EA 4GN1A 2L83A 4MEMA 1NI3A 1UWMA 2D3BA 2JF5A 2KFJA 2WS3B 2BPSA 2K8CA 1P1AA 4L23A 3DBSA 2WHIA 4KDLB 5LNK1 2MLBA 5IA7A 4YXDB 3WCQA 2MBEA 4K7WA 4FBJB 3OJ4B 3VHTC 2JRIB 4JQWC 4KGSA 1MI0A 1AW7A 1SSNA 4WJOA 2OHFA 4A6QA 1L4ZB 1UGJA 2V9HA 3DBRI 3NS1A 1J7AA 3AE2B 2WDTB 3GP7A 2BYEA 2QCZA 2KVRA 4IOIE 2O6VB 2IYDB 2GRIA 4GGQA 3ZYYX 4GDLB 3TJPA 4ANWA 1PQSA 1V1PA 1HZ6A 1ZDVA 2WDQB 2EELA 5GXGB 3WAMA 2CHWA 4RF1A 3WIMA 4K7UA 2KJHB 1WH3A 2IY0B 2ICIA 3AMZA 5T8IA 2GLSA 4G11A 2OEDA 1C4AA 3NJTA 4GLSC 4F7ZA 1HQRD 2WWZA 4USAA 5MPOA 1MHXA 1FM0D 4OZAA 4IG7B 2DYBA 4DQOC 4MGIE 4F1SA 1F77A 2Z0DB 1KTKA 3AE3B 1V9JA 2HD5B 2N7EA 5E6PA 3ML9A 4BAXA 3AEAB 1DYQA 2PW9A 2M17A 4XGAB 2JYEA 3VFKA 1E90A 4LNOA 2JUOA 2KTRB 1RM6C 1XLQA 3A9JB 4GOCA 2AL6A 1SE9A 2Y5PA 1T0RC 4ANUA 5IN7A 3N20C 4ZHPA 4GDKA 4JWUC 1HE8A 3TMPB 1TS5A 3DQVA 3S2AA 2LHEA 2NS5A 1JRPA 4KIKA 4ARIA 3ZLZA 2QMTA 4WJPA 2Z0EB 3A1QB 3QX1A 2W54A 3BVZA 4W9CA 2N1WA 1CQVA 2QIEB 3C8YA 4FHJA 4FADA 5EE1A 3QC8B 3ETRA 4HJKA 3PLUA 3BWUD 1TJEA 4HRSA 3MTNB 4MSQB 1E9MA 4BOSC 3BIID 3E9SA 2Z8LA 5BMHA 1WMHA 5DPWA 2ACZB 2K5PA 1ACCA 3ZJVA 3VAWA 1J0GA 3N1YC 4E3CA 1EU3A 2IY1B 2NVUI 3I9V1 2QEJC 3W2DA 3TEYA 4W9LA 2RGFA 2JSVX 1BXTA 1XEEA 4P16A 3MFGA 5H8YE 1PGBA 2R2OA 4MDKE 3VUWA 1A70A 5EE3A 2WXOA 3A9KB 4EUTA 1ZUD2 4ZHOA 2KVZA 3H7PB 3MHSD 3H9DA 3PPAA 4MGZE 1FFUA 3TL5A 2CU3A 1E7VA 3V05A 2N9EB 3ALBA 3LDZE 3PT2B 3GOEA 2V1YA 2OOBB 3PV1A 3DPDA 1UNSA 1BT0A 2NTSA 3NS8A 1E5WA 2EKEC 5CHFA 3VUXA 1KLUD 3IFWB 2I38A 4NPNA 1JWMD 3VTVA 1E8YA 3NY5A 2KFKB 1TS3A 2MJEA 2FCNA 2RPQA 2L52A 1FO4A 2VH1A 3AEFB 4AJYB 2DZKA 3VH4B 3ZKJC 2VZKB 2KKCA 4M00A 4KZ0A 4EKUA 2J42A 4BZAA 3TCAA 5HFYA 4L2YA 3URYA 1NENB 1SJHD 1DOIA 4ZOHC 2YVCA 2RPVA 4NZLB 1FXTB 1B1ZA 3RUIB 2DZIA 1KJTA 4ARCA 3DHGC 1OQQA 3KUZA 4HJGE 2W3SA 3VR8B 2M8SA 1YOVB 1YJ1A 3QK0A 4JLCA 3ENEA 2KHWB 3TBLD 5BO4B 1GC6A 4W9JA 1C78A 1C4PA 1P0RA 3I57A 4R3DA 1LQBA 3R7QA 2N7JA 3DDCB 2QSDA 5JHBA 2KQ4X 1WGHA 5HI1A 1L0XB 3RNCC 5LXIB 1FRDA 1JWSD 5G55A 4IUMB 1SE3A 3C0RB 3L08A 2W9NA 1WM2A 1P7FA 4II3B 3W1SA 1AWDA 1ROEA 3UINB 1Q10A 4RGNA 2WGSA 2V3PA 3SFEB 4IWOA 1LGRA 3NVWA 4J3OD 4ZYSA 2XN9C 4II2B 2KO3A 1EM7A 4ANVA 3N32A 3ZRFA 1KM7A 4EZLA 5AEKB 1QZEA 3HVZA 1KH0A 5G5GA 1F0ZA 5KHOA 2K6DB 3OG5A 2LJIA 2MW5A 4HPMB 4OVZA 1TZOA 1QOBA 3DVNV 2BW2A 2G3QB 3ZDTA 5JZEB 2B3AA 2J52A 4WWNA 2LVOA 3AE7B 4LNFA 2D3CA 4FJVB 4I6LB 5AZGA 3TEZA 1Y56A 1GB1A 1HA5A 1RFAA 3PO0A 4OVUA 2JRHA 4DWFA 4DBGA 1IPGA 3DCGA 4PYUA 3M63B 4N59A 1FIQA 3QARA 1QOAA 3P4QB 5BMIA 3ZDMC 2INNE 3QAQA 2WXLA 3IAM1 3WALA 5AZHA 2FUHB 1FXAA 3UQAA 2WDVB 3R2IA 4ZRJA 1QQRA 2L76A 2MHJA 5EE0A 2WXPA 1SJED 2N9XA 4GMVA 3NVYA 4J6IA 2HE7A 1JROA 2X8XX 4PYZA 2DZMA 5D6JB 4BBNF 2LWPA 2WX1A 1WXAA 1IBXA 2Y5CA 3DOWA 1GUAB 2G9HD 2JX5A 3AV8A 4CO7A 3SFDB 4HXDA 3HM6X 1SGHA 1J19A 3ECIA 4A20A 4C4VA 3ZXVA 5JH5C 4M0WB 1F52A 2UYZB 1WJ4A 2HJ1A 3QWZB 2K3UA 3K9OB 1N5XA 1JMLA 1YQ3B 2IO2B 3CSFA 1OGWA 1V49A 3SR6A 5J2RA 1FMAD 2NBVB 3N1ZC 1WE7A 3RZFA 2JPHA 4N6EB 1L5PA 2LGYA 2BS2B 3PRMB 2KTFA 1WR6E 5C1ZA 3AI5A 1WYGA 1I35A 3FKYA 4ANXA 3R2TA 1T0QC 5IO9A 3N1XC 3X0WA 3A33B 1WGRA 1VZ7A 2N9LA 2IGGA 2IGHA 3WAPA 1QOFA 4B0MA 2K39A 3FC4A 1YQ4B 1PUTA 1E7UA 4HDQA 1I4HA 3DWGC 4KV2A 1JWAD 4K1RB 2M19A 1OFFA 4MH8A 3KUCB 2JQRB 2LRUA 1PFDA 3PZ7A 4L1BA 4W9KA 1YNTE 2GMIC 3KLSX 4KKJA 3ZNGC 2XK5B 1CJEA 3O65B 3NOBA 3FILA 3RZWC 2RD0A 2VRRB 4CYEA 4E74A 1UUPA 2D5GA 2ONQA 3ZRCA 4BFRA 1T0YA 3IT4B 3UF8A 1FRRA 2G1EA 1PYWD 4GIVA 5DPSA 2XEWA 4AJWA 4AOFA 2KC1A 1I4RA 3KYCD 4K7SA 3AE5B 3T9LA 2D10A 2KQSA 2FUG1 4YTPB 3C19A 2L05A 1V2YA 1K51A 1WI0A 5EDSA 3V3XA 4DDGD 3ZGZA 1WGYA 4K81A 4KGTA 1MG4A 3B0AA 1WX9A 4CQNA 2JYTA 1R4MI 1RFKA 4ZYNA 1M4VA 2GI9A 1HEZE 2L0FA 2L8JA 3HK0A 5DPRA 3VXWA 4KGRA 3CIRB 2OJWA 1WZ3A 4NAWB 2SAKA 1STEA 2BWES 1T5XD 4RCOA 1VZ6A 4DHJD 1MHHE 2INPE 2O6VA 3H8HA 4G50A 4S17A 1RAXA 4NJCA 4GDLA 2J7QB 2AQ2B 1ZDXA 4FJZA 3ZTDA 4I6NB 4BKSD 3ZXRA 3I3TB 3VDZA 3AEGB 3VQIA 4HVBA 2Y3AA 1AARA 1ET6A 5J18A 2MEKA 1OQRA 4WQOB 2ZJDA 2KZRA 1FEHA 1YQBA 3IBEA 1J7CA 2LZ6A 1ENFA 3R8BA 3V6EB 4RM8A 2RSUA 3RNFC 1FPYA 3WANA 1GNUA 1C77A 4M8MA 2WNMA 2GBJA 4HCNB 1VR9A 2MJ3A 1L6VA 1TYGB 2D11A 2V3SA 3DWMA 4HKQA 1XLNA 2DBYA 2A4ZA 2CJOA 3NUHB 3AE4B 2C7MB 1E7PB 5AUIA 3MC8A 4HROA 1XCQL 3V61A 2JT4B 3SEBA 4C00A 4MH0E 3Q3MC 4WJNA 4M8NA 4LNIA 3W5UB 2IJ0A 1YD8U 1N63A 5E6JA 2KTRA 1FNVA 1KFYB 5CHWA 3A9JA 1Q0WB 4FJYA 2XBBC 3T3NA 1YMHE 2NMQA 3RNEC 4RM9A 4JE3B 4WWOA 1TTNA 1IUEA 3A4RA 4NNJB 3VUYA 2PEAA 3SU8X 4WJQA 3OWEB 2ZVOA 4KDIC 4GSWA 4TQ1A 3RNGC 3A1QA 2BVCA 1UBIA 4A3PA 3DBLB 3RD2A 1CMXB 2QHOA 1MFWA 2AL3A 2BS3B 1F1HA 2FNJB 4OZBA 3VVWB 1JQ4A 2ZW1A 3GB1A 4LNKA 3HUIA 1AN8A 2FCQA 5G2NA 1WY8A 2GOWA 2MH7A 4X57B 5J17A 4C7ZA 3IAS1 3R3MA 1EWYC 2CR5A 3CMMB 5I4DA 4HKZE 2M56B 4YSYB 1IYFA 3PRPB 3LJ3A 1D6EC 2GBKA 2WYQA 1R7SA 2J0JA 4H2AA 3DBLI 1GJZA 4M02A 1NYQA 3ZO5B 1EWCA 3KUDB 3L17A 4WWPA 4K3BA 4PS8A 2K0PA 3A9KA 2KDFB 2BTEA 3VTWA 2IPKD 1L0YB 3H7PA 3B08A 1XLOA 3MHZA 2WU5B 4WAFA 3BZDB 1WYWB 4ASWC 2H89B 2DAFA 3VTUA 5HKHA 5C2TB 3SDLC 3WA0A 2G45B 3L10B 1PGAA 2LXCA 3DBHB 4WAAA 1YJIA 4LTUA 3ZJTA 2WXFA 1S3SG 5BMGA 2TSSA 1V8CA 1WRIA 2QJLA 3Q3FA 4S0RA 4AQ7A 3U4EG 2KFKA 2J0MA 3ZIMA 3DVNU 1XD3B 1YIWA 2JXTA 4ITKA 4G0NB 1EU4A 1ZE3D 5E6NA 3ABVB 1D4BA 4XWTA 2KX3A 4ZRQA 1I4QA 2MJDA 2KOXA 3N3KB 5BYSA 3DBHI 1K50A 3U7ZA 2KACA 4B6WA 2N4FA 5IP4D 2FE8A 4DDID 1UD7A 1BUIC 3NZ3A 3ZVVA 4RGOS 2DWQA 4MT5A 3Q3OC 2LJ5A 2M1MA 2IGDA 1HXYD 1MPEA 4DXGA 2D3GA 2NBWB 3JSVB 2FCSA 2MBQA 2Q5WD 1EF5A 2K8BA 1RLFA 3PRZA 1OEYA 3AXCA 2FAZA 4IKGA 1WXMA 2BF8B 3RT3B 4BKSA 3PZ8A 2Z59B 3RN9C 4BVUC 2LVPA 2KWVB 3MC0B 1WM3A 2DHZA 4CHKA 3DVGX 4LJPB 3W5VB 4ZRKA 2EKIA 2KJRA 2QC8A 4A90A 4MJSB 5JHAA 1I4XA 4EZKA 3IT6B 2IO3B 1H8CA 1X1MA 2LEKA 1JWUD 2K6QA 5TR5A 1E10A 2J4XA 1D5XC 4I6PA 1WRDB 3NVVA 2PVGC 3MJWA 1WXQA 2ON8A 4PT5A 4A55A 3B1LX 4D2KA 1WGKA 3TEXA 2O6VD 3BYYB 3KYDD 2FIDA 2O2VB 3RCZA 4OHJA 1F9JA 5DCNA 4YSZB 3PSEB 2DNFA 3KQ4A 3L0WB 4RMAA 3W1YA 3ONSA 1Y8RC 3ZTCA 3JW0X 3P2BA 1OTRB 4FXCA 2GB1A 3N30A 4XDCA 1VZ8A 1N61A 2M0AA 4XE0A 3V62A 3H1UA 1BMLC 3B2GA 3M3JA 2LI5A 5FR3A 4RFBA 2FIFA 1P98A 3QHTA 2L00B 2CHZA 2E3TA 3Q69A 3PTFC 4LK0M 4REZA 1M94A 3NZUA 4JWSC 4NAMA 4OVVA 3HHMA 4WIPA 2WXMA 4IM0A 5AZFA 2KMAA 2MBHA 2J53A 2NPTB 4B9KA 4ZRIA 2EMTA 3ML8A 2YEPF 1I7HA 2LRWA 3RMKC 2L1AA 3VRAB 2AX5A 2MCNB 1QT9A 4MACA 1T0SC 4BKGA 1WE6A 2PVOD 4FHKA 1KLVA 3K9PB 2INCC 4XWWA 3PZDA 1SXTA 3W9CB 4TQ0A 1P7EA 4ZDVA 4XDDA 4EFOA 2I1KA 2LUMA 1C4CA 2D3AA 2QDFA 3DVGY 4M0WA 3L54A 1TGZB 4MM3B 2WXKA 5IKCM 4KSKC 1GPXA 1MG8A 1HTOA 2DX5B 1FXIA 4IW0A 1ESFA 2JZ3B 2PKOA 2ZPYA 2GBNA 5FR6A 3RPFC 2PJHA 1E8ZA 2BB5A 3GE3C 1C9FA 3BY4B 3Q6BA 4TSSA 2KDMA 5HHDG 4PS3A 1KRHA 2WXJA 3QJZA 4OZCA 4IM3A 4Q2JA 1LXDA 2LHDA 3MC9A 4BBNC 2INDC 1KOTA 3B2FA 3V60A 1WGDA 1T6BX 1E8WA 2BYTA 3T3OA 4WH4A 4W9DA 3KWLA 1F2RC 4KZCA 3ZNID 4ZRPA 3U7DA 2UU7A 3U2SC 2PE6B 2JZZA 2KANA 2V4LA 3RNAC 3PHWB 2JU6X 3PREA 1JRUA 2CU1A 2M4NA 2WP9B 2XK5A 3RYTA 1VDVA 2PIAA 2C60A 1SIJA 3P63A 2ZZPB 3RI7C 3MJ5A 2FBWB 1P3QU 2JZPA 5IOIA 1TS4A 4DXAB 2PMVA 4C80A 3AEDB 1WF9A 4DXFA 3OLMD 4ACFA 2KK8A 3QCAA 1WXVA 4JIOU 1C79A 3P4PB 3AE8B 4FLHA 1WFYA 3ZW3A 1GG3A 4US8A 4HCPB 5GMVA 2BKRB 2GBMA 1XF5L 2KNBA 1WXSA 2MQJA 4LDTB 2ZEQA 2DAJA 1HZ5A 2VZKD 3EFUA 1ISNA 2ZPNA 1EF1A 3ZNHB 3Q8BA 2J0KA 5D94A 1MJDA 1T3QA 2MP2B 4EE2A 5CTRC 3X23A 2WXIA 4B0EA 3SD5A 4NAWA 2L0TA 3NZSA 1F2RI 4RF0A 4A8XC 4P6VF 1WGGA 4YWGG 3AE6B 2E6XA 5IAAC 1TZ1A 3OJ3A 5CHVC 1U4AA 1Z5SB 3QIJA 1NI2A 3UGBB 4HPPA 1LFDA 4URKA 2KWDA 2WLBA 3H7SA 2D2QA 3GE8C 4JX1C 4TUUA 2G4DB 1WJNA 4XX5A 2HTHA 2NBUA 5DPTA 5D2MB 1JWBD 3CWIA 2AYOB 3AECB 1K8RB 4GXBA 5D7GA 3FAHA 1QF6A 1D3ZA 2LGIA 2IO1B 1V1OA 1WJ6A 5LLIA 1YN5A 2ZCCA 4NQLB 3M62B 1LO5D 2V3NA 2C9WB 4AS1A 1XXGA 3WAOA 3V6CB 2PPHA 4MSMB 3NHEB 4JPSA 2JY6A 2W55A 1XLPA 4HLEA 4YTNB 3R7RA 3J9CA 1TIFA 1ZKHA 1ET9A 3TUOA 4YTMB 4NJ7A 2DYMA 3Q3NC 1IP9A 2K1FA 1N62A 2L7RA 5L95C 3UIPB 1G6JA 1V86A 2CKHB 5L83A 1V1PB 2KT7A 1XO3A 1OQYA 3L4PA 2WX0A 2DYOA 3E56A 1SE4A 2AEHA 3PLVA 4MGYE 1QILA 1WR1A 3Q14C 3NVZA 2HDEA 1VD2A 2HJ8A 4ICUA 3BK1A 4IC7B 2WXQA 2FCMA 5LXHA 3B9JA 2MBOA 3OAWA 2JVCA 3Q8CA 4RH6A 3KW5B 4LCDE 1D5ZC 1PDXA 2LGSA 1V5OA 3IVFA 4FULA 4YT0B 2BYVE 2KMCA 3ZNZB 1GAQB 1QLBB 2C7HA 2HTME 1LM8B 1S1QB 1KF6B 1XCTL 2LASA 1EO6A 3AH7A 2G4SA 5C23A 2KLCA 2W82A 3RULA 4KVGB 1YN4A 1CK1A 3BVMA 3O13A 4GDKB 3AEEB 1WWTA 4TV3A 1GOZA 3QA8A 4KIKB 1ZGUB 2AQ1B 3UI3A 4JGHB 1OEYJ 4RGMA 2BB6A 4LNNA 4P1CC 1WJUA 2RMMA 4TKNA 1UELA 1DGJA 2LMCA 1FCLA 1EUVB 2KN5A 3NRZA 2BS4B 4TMAB 4HPLB 4OW0A 1Q5WB 4XZ4A 1K52A 1SF0A 3Q2AC 4WWMA 1C3TA 1I42A 2N9PC 1V81A 2H88B 1WMHB 2KXJA 1VRAB 1YJJA 1L7YA 1SEBD 1L6UA 2RDHA 2MSED 2K9XA 4C56C 1RWSA 5JXVA 3IHPC 5D3DA 2LFIA 1TKGA 4KSLC 3TEWA 3AULA 4P1BC 4EOYA 2K25A 2RDGA 4YL8A 3KVFB 2WDRB 2C5LC 1YX6B 2QILA 4W9HA 1RYJA 4XC2A 1NDDA 4B95A 4KKIA 4XYCA 3UQBA 2MRPA 3Q8FA 1B9RA 2UWQA 1E8XA 2IO0B 1P9DU 3L13A 2N7DA 2BWFA 2LXAA 3BYTB 2C7NB 4LDTD 4LLGM 3D32A 3JSVA 5HG2A 3RNBC 2K8HA 4FN2A 2NR2A 1ZW7A 2VH2A 2RDBC 3TIXA 1JW9D 3R66C 1YX5B 1L4DB 4DK5A 2R61A 1FNWA 4PK1A 3U52E 1L0VB 1GB4A 1JALA 1PGXA 5E6OA 3BVGA 4IWQA 2KAJA 3P4RB 4GU2A 3JVZX 4AUQC 3CSTA 2AQ3B 4NY0A 1MVKA 2W3RA 1XT9B 3Q8AA 2K22A 2KWUB 1WIAA 4MJSA 4UDUC 5AUKA 1HTQA 2R2QA 3PGEA 3L16A 5FKAC 1WX7A 2ASQA 3HIZA 3DHHC 3IG3A 3KH0A 1DOYA 2PE9A 2IBIB 4C7YA 3U8ZA 2CJNA 3W1SC 3AB5A 1UZXB 3P4SB 3EUB2 1V97A 2O2VA 2OJRA 3N9YC 1ZXHA 1GC7A 4DHJB 1TY0A 3T8MA 2LGXA 2KQ7A 5H92C 4WQMA 3EGRA 1UBQA 4BKTA 4E71A 2KDBA 2L32A 1UF0A 2KX0A 2KDEB 2MA9B 4N58A 2V0GA 4G3XB 1TKYA 2N0SB 1FNUA 1I4GA 4PS7A 4RGTA 4MGKE 3AEBB 4MELA 4LJOB 3CF6E 3M95A 3GZNB 4N9F4 2ZW0A 5BYRA 1AYFA 2WXHA 4EEWA 2BKFA 4A3OA 2PLPA 2NPTA 3PS6A 2RR9A 1UH6A 2LUEA 4HK2A 3GS2A 2L3ZA 3APDA 4O1NA 1H4RA 1IGCA 1NEKB 3QQ8B 2BQQA 1QKZA 3UIOB 2BGFA 1NBFC 2WQYB 1RRBA 3MP9A 3AN1A 3BK2A 3ZQ4A 1TY2A 2MWSB 1ZXIA 3AM9A 3ZUNA 3GZNI 1WZ0A 3P1MA 2KDIA 3EHVA 3HM3A 3U30A 2WXRA 3I63C 4MM3A 2X38A 1VJKA 1J8CA 4KX6B 4A9AA 1UGMA 5FK9C 2B76B 2N1VA 4EZJA 1VLBA 4BOZB 2KJ6A 1C1YB 1C76A 3VR9B 1I4PA 2AWTA 4HEA1 1ZPSA 3AE1B 1E0ZA 2BT6A 1DOXA 2D07B 5TSSA 3PHXB 1SBBB 3LYYA 1FD6A 1SE2A 1WX8A 2ZVNA 3Q3JA 3ZJUA 5BYQA 3EECA 1D5MC 2BBCA 2JWUA 2MBBB 3LXFA 4W9EA 2A5UA 3IXSA 4HDOA 4DHZB 4M01A 2YLMA 4RNAA 1K53A 3P42A 1N5WA 3RFZB 3HVDA 1L2NA 1JCKB 4JL9A 1Z2MA 1TT5B 2WXNA 2KMMA 4NJ6A 2LVQA 2CS4A 2KN4A 1IBXB 4IDIA 3DHIC 3APCA 4DHZE 3APFA 1ZOYB 2EMSA 3BINA 4WURA 4NQKE 4W9GA 1YN3A 4C4VB 5EE9A 2YEPB 1FFVA 1VCBA 4AP4C 1TBEA 4IWPA 3A4SC 3JYUA 4YSXB 3PVLA 5KHQA 1NVID 2KC2A 2ZNVC 3KWVA 3EFCA 2KYWA 2JXXA 1N60A 2XNAC 1CZPA 2KWCA 3AE9B 1TKEA 1NYRA 1N6ZA 2BYFA 2JWZA 2WXGA 2NCNA 2REXA 1IGDA 4K3CA 2LD9A 2DZJA 3VRBB 3EA6A 1SIFA 4W9FA 3VH3B 2SEBD 3Q8EA 1R4NB 4P7IA 1XQQA 5D3IB 1SB3C 1ZP0B 2LGDA 2WU2B 3HRDD 4F8CB 2KLGA 5G5HA 1KLGD 3SHQA 2I2YA 4FA6A 4AWJA 2DENB 4IM2A 5CX3A 3LB8C 2IZVB 1V5TA 4US9A 2MP2A 1A5RA 2NTTA 4ICVA 1R4MB 1UWXA 1FCCC 3H6NA 2Y5BB 2MX2A 3AU5A 2M0XA 2ZNVB 3TSSA 5C3JB 4HWIB 3FILB 2CHXA 3I5JC 2IDYA
chains in the Genus database with same CATH topology
1BUIC 3NZ3A 3Q8CA 4RH6A 4RGOS 2PTLA 2DWQA 1FXAA 1TS2A 2WDVB 2DLBA 4MT5A 1D5ZC 1PDXA 3R2IA 2IGDA 1QQRA 1WSPA 4YT0B 5EE0A 1E6EB 1J7BA 1HXYD 1MPEA 2WXPA 4DXGA 1SJED 1QOGA 3NVYA 1GAQB 1QLBB 2HTME 2N9KA 1JROA 2V4IB 1KF6B 2Q5WD 2L83A 1NI3A 1UWMA 1XCTL 1IBXA 2WS3B 2Y5CA 3AH7A 4IKGA 4L23A 2G9HD 2JX5A 3AV8A 3SFDB 2W82A 3PZ8A 1YN4A 1CK1A 3BVMA 3O13A 4GDKB 5LNK1 3AEEB 3MC0B 1WWTA 4YXDB 3WCQA 1GOZA 2K3UA 3W5VB 2EKIA 4KGSA 4A90A 1N5XA 1MI0A 1JMLA 1AW7A 1SSNA 2AQ1B 2OHFA 3UI3A 1YQ3B 4A6QA 1L4ZB 1I4XA 1UGJA 3IT6B 3SR6A 4RGMA 1FMAD 2BB6A 2LEKA 1JWUD 1E10A 3NS1A 2J4XA 1D5XC 2RMMA 1J7AA 3AE2B 3NVVA 2PVGC 3GP7A 4N6EB 1L5PA 1WXQA 2ON8A 4PT5A 4A55A 1DGJA 2LMCA 4D2KA 1WGKA 2BS2B 1FCLA 3TEXA 3BYYB 3NRZA 2BS4B 4TMAB 1WYGA 4OW0A 4IOIE 4OHJA 1K52A 2GRIA 1SF0A 3R2TA 4YSZB 4WWMA 3ZYYX 4GDLB 3KQ4A 1V1PA 1VZ7A 1HZ6A 2N9LA 1ZDVA 2IGGA 2IGHA 2H88B 1QOFA 1VRAB 4B0MA 1YJJA 2WDQB 3FC4A 4FXCA 2GB1A 1SEBD 1YQ4B 1PUTA 2EELA 1L6UA 2RDHA 4XDCA 5GXGB 1I4HA 1VZ8A 4RF1A 1N61A 3DWGC 2M0AA 4XE0A 1JWAD 2K9XA 1BMLC 4C56C 1RWSA 3B2GA 2M19A 1OFFA 5JXVA 5FR3A 5D3DA 4MH8A 2LFIA 4RFBA 2ICIA 3AMZA 5T8IA 1TKGA 2JQRB 2E3TA 2OEDA 1PFDA 3PZ7A 3Q69A 4L1BA 3TEWA 1C4AA 1YNTE 3KLSX 4KKJA 2RDGA 4LK0M 4REZA 1CJEA 2WDRB 4GLSC 4JWSC 2QILA 4NAMA 4WIPA 3FILA 1RYJA 1HQRD 2WXMA 4USAA 5MPOA 1MHXA 2J53A 1UUPA 4KKIA 3Q8FA 2D5GA 2ONQA 1FM0D 1B9RA 4OZAA 4DQOC 3IT4B 2YEPF 1I7HA 3BYTB 1F77A 1FRRA 1KTKA 2G1EA 3AE3B 1PYWD 4LLGM 5HG2A 1I4RA 2L1AA 3AE5B 2AX5A 3VRAB 1QT9A 3AEAB 1DYQA 4MACA 2PW9A 2PVOD 2JYEA 4XWWA 1RM6C 1XLQA 1JW9D 1SXTA 2FUG1 1L4DB 4YTPB 3W9CB 2R61A 4TQ0A 1P7EA 1FNWA 3U52E 1L0VB 1GB4A 2Y5PA 1JALA 1K51A 1PGXA 4XDDA 3BVGA 3V3XA 3ZGZA 2KAJA 3P4RB 4ZHPA 4KGTA 2LUMA 1C4CA 4JWUC 4M0WA 4CQNA 2AQ3B 1MVKA 4MM3B 2JYTA 2WXKA 2W3RA 1RFKA 1GPXA 1M4VA 3Q8AA 1TS5A 1FXIA 2GI9A 2K22A 2LHEA 1JRPA 1HEZE 1ESFA 4UDUC 2PKOA 5AUKA 2QMTA 4ARIA 5FKAC 4KGRA 2W54A 3BVZA 3CIRB 3RPFC 2BB5A 1DOYA 4C7YA 1CQVA 2QIEB 1C9FA 3C8YA 4NAWB 2CJNA 2SAKA 5EE1A 3AB5A 1STEA 3ETRA 3P4SB 4TSSA 1T5XD 3EUB2 2KDMA 3BWUD 1V97A 4RCOA 5HHDG 1TJEA 1VZ6A 3N9YC 4HRSA 1KRHA 2INPE 1MHHE 2WXJA 4OZCA 1E9MA 3H8HA 4Q2JA 1ZXHA 2LHDA 3BIID 3E9SA 3B2FA 2Z8LA 4NJCA 1TY0A 2AQ2B 1ZDXA 5BMHA 1T6BX 2BYTA 3VQIA 3T3OA 3AEGB 4WH4A 2ACZB 5H92C 2K5PA 1ACCA 3KWLA 4WQMA 2Y3AA 1ET6A 1F2RC 3EGRA 3ZJVA 4ZRPA 3U2SC 2MEKA 1EU3A 2L32A 3I9V1 2QEJC 1OQRA 4N58A 3W2DA 2V0GA 1FEHA 3TEYA 1J7CA 1TKYA 1ENFA 1FNUA 2N0SB 3R8BA 1I4GA 2JSVX 1BXTA 1XEEA 2JU6X 3AEBB 4P16A 4RGTA 3MFGA 5H8YE 1PGBA 2WP9B 1C77A 2ZW0A 2WNMA 5BYRA 1AYFA 1A70A 2WXHA 5EE3A 1VDVA 2PIAA 2WXOA 1VR9A 2PLPA 2MJ3A 1SIJA 1L6VA 1ZUD2 4ZHOA 3P63A 1TYGB 3DWMA 4HKQA 1XLNA 2DBYA 3MJ5A 1FFUA 2FBWB 2CU3A 2CJOA 2JZPA 3NUHB 3V05A 3GS2A 3AE4B 1TS4A 2PMVA 4C80A 1E7PB 3AEDB 5AUIA 4DXFA 1UNSA 4O1NA 4HROA 1XCQL 2NTSA 1IGCA 3SEBA 1NEKB 1QKZA 1KLUD 2I38A 1C79A 3P4PB 3W5UB 3AE8B 2IJ0A 1N63A 5E6JA 1FNVA 2WQYB 1KFYB 3MP9A 4US8A 1JWMD 3AN1A 3BK2A 3ZQ4A 1TY2A 1ZXIA 3AM9A 3T3NA 1YMHE 2NMQA 1XF5L 3P1MA 1TS3A 2MJEA 4JE3B 1IUEA 1HZ5A 2WXRA 2VZKD 1VJKA 2X38A 2L52A 4KX6B 1FO4A 4A9AA 3AEFB 2VZKB 5FK9C 2B76B 3OWEB 2J42A 3Q8BA 4TQ1A 1VLBA 5HFYA 4L2YA 1T3QA 4EE2A 1C76A 3URYA 3VR9B 1I4PA 2WXIA 1NENB 4B0EA 1SJHD 2BS3B 1DOIA 4HEA1 4ZOHC 4OZBA 1ZPSA 2RPVA 4NZLB 1JQ4A 1B1ZA 2ZW1A 1F2RI 3AE1B 3GB1A 3HUIA 1AN8A 4RF0A 4A8XC 4ARCA 1E0ZA 1OQQA 2BT6A 4P6VF 4HJGE 4YWGG 1DOXA 3AE6B 2MH7A 2E6XA 2W3SA 5TSSA 3VR8B 1SBBB 3LYYA 1FD6A 1SE2A 4C7ZA 3IAS1 1EWYC 3ZJUA 5BYQA 1D5MC 2BBCA 2JWUA 3LXFA 4HKZE 5I4DA 2KWDA 2M56B 2WLBA 3IXSA 4YSYB 4RNAA 4JX1C 1K53A 3P42A 1N5WA 1C78A 3RFZB 1C4PA 1D6EC 3I57A 3HVDA 4R3DA 1JWBD 1JCKB 2N7JA 3CWIA 2WXNA 2KMMA 2QSDA 1R7SA 3AECB 2KQ4X 4H2AA 5HI1A 2KN4A 1IBXB 5D7GA 3FAHA 1L0XB 1QF6A 1NYQA 4IDIA 2LGIA 1FRDA 1V1OA 1JWSD 1EWCA 1YN5A 1ZOYB 4WURA 1LO5D 2K0PA 2BTEA 2V3NA 1YN3A 2IPKD 1L0YB 1SE3A 5EE9A 2YEPB 1FFVA 4AS1A 1XLOA 3MHZA 1P7FA 2WU5B 3W1SA 1AWDA 1ROEA 1XXGA 1Q10A 3BZDB 4RGNA 4WAFA 2V3PA 3SFEB 4YSXB 4JPSA 3NVWA 1NVID 4J3OD 4ZYSA 2H89B 2XN9C 2W55A 3KWVA 5C2TB 1XLPA 4YTNB 1EM7A 1PGAA 3J9CA 1N60A 1YJIA 2XNAC 4LTUA 1ET9A 3ZJTA 1CZPA 2WXFA 3TUOA 3AE9B 5BMGA 2TSSA 1TKEA 4YTMB 1NYRA 1V8CA 1WRIA 2DYMA 3HVZA 2QJLA 4AQ7A 1KH0A 5G5GA 2WXGA 3U4EG 1F0ZA 1IGDA 1N62A 2LJIA 3VRBB 3EA6A 4OVZA 1TZOA 1QOBA 2BW2A 1V1PB 2JXTA 4ITKA 1XO3A 2SEBD 2J52A 3Q8EA 1EU4A 5D3IB 1ZE3D 3AE7B 1SB3C 1ZP0B 2WU2B 3L4PA 3ABVB 3HRDD 5G5HA 2I2YA 1KLGD 3TEZA 1D4BA 4XWTA 1Y56A 1GB1A 1HA5A 2DYOA 4ZRQA 3PO0A 3E56A 1SE4A 3LB8C 1QILA 1I4QA 2MJDA 3NVZA 4US9A 2HDEA 5BYSA 2NTTA 1UWXA 1K50A 1FCCC 3U7ZA 2KACA 4N59A 1FIQA 3BK1A 1QOAA 3P4QB 3TSSA 2WXQA 5BMIA 2INNE 5C3JB 2FE8A 3FILB 3B9JA 2IDYA 2WXLA 3IAM1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HKZ E;  2KWD A;  2PTL A;  4GLS C;  1K53 A;  3FIL A;  2IGD A;  2JSV X;  2JU6 X;  1MHX A;  1MPE A;  2J53 A;  1PGB A;  2N7J A;  2ONQ A;  2QSD A;  2ZW0 A;  4OZA A;  2N9K A;  2KQ4 X;  5HI1 A;  2KN4 A;  1IBX B;  2PLP A;  2LGI A;  1XCT L;  5HG2 A;  2JZP A;  1IBX A;  2K0P A;  4IKG A;  4MAC A;  2PW9 A;  1XCQ L;  1P7F A;  1IGC A;  1Q10 A;  1QKZ A;  2I38 A;  1P7E A;  1GB4 A;  1K51 A;  1PGX A;  3MP9 A;  1EM7 A;  3V3X A;  4KGS A;  1PGA A;  4KGT A;  2LUM A;  1MI0 A;  1JML A;  3UI3 A;  1YMH E;  2NMQ A;  1XF5 L;  1MVK A;  5BMG A;  2GI9 A;  2LHE A;  1HEZ E;  1KH0 A;  2QMT A;  1HZ5 A;  2RMM A;  1IGD A;  4KGR A;  2ON8 A;  4D2K A;  1FCL A;  2JXT A;  2J52 A;  4IOI E;  1C9F A;  1K52 A;  5HFY A;  2I2Y A;  1D4B A;  2KDM A;  1GB1 A;  5HHD G;  1HZ6 A;  2N9L A;  2IGG A;  1MHH E;  2IGH A;  4OZC A;  1ZXH A;  2LHD A;  4OZB A;  2GB1 A;  2RPV A;  2ZW1 A;  2EEL A;  1F2R I;  3GB1 A;  1UWX A;  1K50 A;  1FCC C;  5BMH A;  4HJG E;  2KAC A;  5JXV A;  4WH4 A;  1FD6 A;  1F2R C;  5BMI A;  2OED A;  3FIL B;  1YNT E;  2JWU A; 
#chains in the Genus database with same CATH topology
 3NG0 A;  2PTL A;  1TS2 A;  2DLB A;  1WSP A;  1V80 A;  3EC8 A;  1E6E B;  1J7B A;  4W9I A;  1R4N I;  4QAY A;  1QOG A;  2GBR A;  2ZCB A;  2I1J A;  1Q1O A;  2N9K A;  3AU4 A;  2KD0 A;  4GB9 A;  2V4I B;  3DBR B;  1V6E A;  4GN1 A;  2L83 A;  4MEM A;  1NI3 A;  1UWM A;  2D3B A;  2JF5 A;  2KFJ A;  2WS3 B;  2BPS A;  2K8C A;  1P1A A;  4L23 A;  3DBS A;  2WHI A;  4KDL B;  5LNK 1;  2MLB A;  5IA7 A;  4YXD B;  3WCQ A;  2MBE A;  4K7W A;  4FBJ B;  3OJ4 B;  3VHT C;  2JRI B;  4JQW C;  4KGS A;  1MI0 A;  1AW7 A;  1SSN A;  4WJO A;  2OHF A;  4A6Q A;  1L4Z B;  1UGJ A;  2V9H A;  3DBR I;  3NS1 A;  1J7A A;  3AE2 B;  2WDT B;  3GP7 A;  2BYE A;  2QCZ A;  2KVR A;  4IOI E;  2O6V B;  2IYD B;  2GRI A;  4GGQ A;  3ZYY X;  4GDL B;  3TJP A;  4ANW A;  1PQS A;  1V1P A;  1HZ6 A;  1ZDV A;  2WDQ B;  2EEL A;  5GXG B;  3WAM A;  2CHW A;  4RF1 A;  3WIM A;  4K7U A;  2KJH B;  1WH3 A;  2IY0 B;  2ICI A;  3AMZ A;  5T8I A;  2GLS A;  4G11 A;  2OED A;  1C4A A;  3NJT A;  4GLS C;  4F7Z A;  1HQR D;  2WWZ A;  4USA A;  5MPO A;  1MHX A;  1FM0 D;  4OZA A;  4IG7 B;  2DYB A;  4DQO C;  4MGI E;  4F1S A;  1F77 A;  2Z0D B;  1KTK A;  3AE3 B;  1V9J A;  2HD5 B;  2N7E A;  5E6P A;  3ML9 A;  4BAX A;  3AEA B;  1DYQ A;  2PW9 A;  2M17 A;  4XGA B;  2JYE A;  3VFK A;  1E90 A;  4LNO A;  2JUO A;  2KTR B;  1RM6 C;  1XLQ A;  3A9J B;  4GOC A;  2AL6 A;  1SE9 A;  2Y5P A;  1T0R C;  4ANU A;  5IN7 A;  3N20 C;  4ZHP A;  4GDK A;  4JWU C;  1HE8 A;  3TMP B;  1TS5 A;  3DQV A;  3S2A A;  2LHE A;  2NS5 A;  1JRP A;  4KIK A;  4ARI A;  3ZLZ A;  2QMT A;  4WJP A;  2Z0E B;  3A1Q B;  3QX1 A;  2W54 A;  3BVZ A;  4W9C A;  2N1W A;  1CQV A;  2QIE B;  3C8Y A;  4FHJ A;  4FAD A;  5EE1 A;  3QC8 B;  3ETR A;  4HJK A;  3PLU A;  3BWU D;  1TJE A;  4HRS A;  3MTN B;  4MSQ B;  1E9M A;  4BOS C;  3BII D;  3E9S A;  2Z8L A;  5BMH A;  1WMH A;  5DPW A;  2ACZ B;  2K5P A;  1ACC A;  3ZJV A;  3VAW A;  1J0G A;  3N1Y C;  4E3C A;  1EU3 A;  2IY1 B;  2NVU I;  3I9V 1;  2QEJ C;  3W2D A;  3TEY A;  4W9L A;  2RGF A;  2JSV X;  1BXT A;  1XEE A;  4P16 A;  3MFG A;  5H8Y E;  1PGB A;  2R2O A;  4MDK E;  3VUW A;  1A70 A;  5EE3 A;  2WXO A;  3A9K B;  4EUT A;  1ZUD 2;  4ZHO A;  2KVZ A;  3H7P B;  3MHS D;  3H9D A;  3PPA A;  4MGZ E;  1FFU A;  3TL5 A;  2CU3 A;  1E7V A;  3V05 A;  2N9E B;  3ALB A;  3LDZ E;  3PT2 B;  3GOE A;  2V1Y A;  2OOB B;  3PV1 A;  3DPD A;  1UNS A;  1BT0 A;  2NTS A;  3NS8 A;  1E5W A;  2EKE C;  5CHF A;  3VUX A;  1KLU D;  3IFW B;  2I38 A;  4NPN A;  1JWM D;  3VTV A;  1E8Y A;  3NY5 A;  2KFK B;  1TS3 A;  2MJE A;  2FCN A;  2RPQ A;  2L52 A;  1FO4 A;  2VH1 A;  3AEF B;  4AJY B;  2DZK A;  3VH4 B;  3ZKJ C;  2VZK B;  2KKC A;  4M00 A;  4KZ0 A;  4EKU A;  2J42 A;  4BZA A;  3TCA A;  5HFY A;  4L2Y A;  3URY A;  1NEN B;  1SJH D;  1DOI A;  4ZOH C;  2YVC A;  2RPV A;  4NZL B;  1FXT B;  1B1Z A;  3RUI B;  2DZI A;  1KJT A;  4ARC A;  3DHG C;  1OQQ A;  3KUZ A;  4HJG E;  2W3S A;  3VR8 B;  2M8S A;  1YOV B;  1YJ1 A;  3QK0 A;  4JLC A;  3ENE A;  2KHW B;  3TBL D;  5BO4 B;  1GC6 A;  4W9J A;  1C78 A;  1C4P A;  1P0R A;  3I57 A;  4R3D A;  1LQB A;  3R7Q A;  2N7J A;  3DDC B;  2QSD A;  5JHB A;  2KQ4 X;  1WGH A;  5HI1 A;  1L0X B;  3RNC C;  5LXI B;  1FRD A;  1JWS D;  5G55 A;  4IUM B;  1SE3 A;  3C0R B;  3L08 A;  2W9N A;  1WM2 A;  1P7F A;  4II3 B;  3W1S A;  1AWD A;  1ROE A;  3UIN B;  1Q10 A;  4RGN A;  2WGS A;  2V3P A;  3SFE B;  4IWO A;  1LGR A;  3NVW A;  4J3O D;  4ZYS A;  2XN9 C;  4II2 B;  2KO3 A;  1EM7 A;  4ANV A;  3N32 A;  3ZRF A;  1KM7 A;  4EZL A;  5AEK B;  1QZE A;  3HVZ A;  1KH0 A;  5G5G A;  1F0Z A;  5KHO A;  2K6D B;  3OG5 A;  2LJI A;  2MW5 A;  4HPM B;  4OVZ A;  1TZO A;  1QOB A;  3DVN V;  2BW2 A;  2G3Q B;  3ZDT A;  5JZE B;  2B3A A;  2J52 A;  4WWN A;  2LVO A;  3AE7 B;  4LNF A;  2D3C A;  4FJV B;  4I6L B;  5AZG A;  3TEZ A;  1Y56 A;  1GB1 A;  1HA5 A;  1RFA A;  3PO0 A;  4OVU A;  2JRH A;  4DWF A;  4DBG A;  1IPG A;  3DCG A;  4PYU A;  3M63 B;  4N59 A;  1FIQ A;  3QAR A;  1QOA A;  3P4Q B;  5BMI A;  3ZDM C;  2INN E;  3QAQ A;  2WXL A;  3IAM 1;  3WAL A;  5AZH A;  2FUH B;  1FXA A;  3UQA A;  2WDV B;  3R2I A;  4ZRJ A;  1QQR A;  2L76 A;  2MHJ A;  5EE0 A;  2WXP A;  1SJE D;  2N9X A;  4GMV A;  3NVY A;  4J6I A;  2HE7 A;  1JRO A;  2X8X X;  4PYZ A;  2DZM A;  5D6J B;  4BBN F;  2LWP A;  2WX1 A;  1WXA A;  1IBX A;  2Y5C A;  3DOW A;  1GUA B;  2G9H D;  2JX5 A;  3AV8 A;  4CO7 A;  3SFD B;  4HXD A;  3HM6 X;  1SGH A;  1J19 A;  3ECI A;  4A20 A;  4C4V A;  3ZXV A;  5JH5 C;  4M0W B;  1F52 A;  2UYZ B;  1WJ4 A;  2HJ1 A;  3QWZ B;  2K3U A;  3K9O B;  1N5X A;  1JML A;  1YQ3 B;  2IO2 B;  3CSF A;  1OGW A;  1V49 A;  3SR6 A;  5J2R A;  1FMA D;  2NBV B;  3N1Z C;  1WE7 A;  3RZF A;  2JPH A;  4N6E B;  1L5P A;  2LGY A;  2BS2 B;  3PRM B;  2KTF A;  1WR6 E;  5C1Z A;  3AI5 A;  1WYG A;  1I35 A;  3FKY A;  4ANX A;  3R2T A;  1T0Q C;  5IO9 A;  3N1X C;  3X0W A;  3A33 B;  1WGR A;  1VZ7 A;  2N9L A;  2IGG A;  2IGH A;  3WAP A;  1QOF A;  4B0M A;  2K39 A;  3FC4 A;  1YQ4 B;  1PUT A;  1E7U A;  4HDQ A;  1I4H A;  3DWG C;  4KV2 A;  1JWA D;  4K1R B;  2M19 A;  1OFF A;  4MH8 A;  3KUC B;  2JQR B;  2LRU A;  1PFD A;  3PZ7 A;  4L1B A;  4W9K A;  1YNT E;  2GMI C;  3KLS X;  4KKJ A;  3ZNG C;  2XK5 B;  1CJE A;  3O65 B;  3NOB A;  3FIL A;  3RZW C;  2RD0 A;  2VRR B;  4CYE A;  4E74 A;  1UUP A;  2D5G A;  2ONQ A;  3ZRC A;  4BFR A;  1T0Y A;  3IT4 B;  3UF8 A;  1FRR A;  2G1E A;  1PYW D;  4GIV A;  5DPS A;  2XEW A;  4AJW A;  4AOF A;  2KC1 A;  1I4R A;  3KYC D;  4K7S A;  3AE5 B;  3T9L A;  2D10 A;  2KQS A;  2FUG 1;  4YTP B;  3C19 A;  2L05 A;  1V2Y A;  1K51 A;  1WI0 A;  5EDS A;  3V3X A;  4DDG D;  3ZGZ A;  1WGY A;  4K81 A;  4KGT A;  1MG4 A;  3B0A A;  1WX9 A;  4CQN A;  2JYT A;  1R4M I;  1RFK A;  4ZYN A;  1M4V A;  2GI9 A;  1HEZ E;  2L0F A;  2L8J A;  3HK0 A;  5DPR A;  3VXW A;  4KGR A;  3CIR B;  2OJW A;  1WZ3 A;  4NAW B;  2SAK A;  1STE A;  2BWE S;  1T5X D;  4RCO A;  1VZ6 A;  4DHJ D;  1MHH E;  2INP E;  2O6V A;  3H8H A;  4G50 A;  4S17 A;  1RAX A;  4NJC A;  4GDL A;  2J7Q B;  2AQ2 B;  1ZDX A;  4FJZ A;  3ZTD A;  4I6N B;  4BKS D;  3ZXR A;  3I3T B;  3VDZ A;  3AEG B;  3VQI A;  4HVB A;  2Y3A A;  1AAR A;  1ET6 A;  5J18 A;  2MEK A;  1OQR A;  4WQO B;  2ZJD A;  2KZR A;  1FEH A;  1YQB A;  3IBE A;  1J7C A;  2LZ6 A;  1ENF A;  3R8B A;  3V6E B;  4RM8 A;  2RSU A;  3RNF C;  1FPY A;  3WAN A;  1GNU A;  1C77 A;  4M8M A;  2WNM A;  2GBJ A;  4HCN B;  1VR9 A;  2MJ3 A;  1L6V A;  1TYG B;  2D11 A;  2V3S A;  3DWM A;  4HKQ A;  1XLN A;  2DBY A;  2A4Z A;  2CJO A;  3NUH B;  3AE4 B;  2C7M B;  1E7P B;  5AUI A;  3MC8 A;  4HRO A;  1XCQ L;  3V61 A;  2JT4 B;  3SEB A;  4C00 A;  4MH0 E;  3Q3M C;  4WJN A;  4M8N A;  4LNI A;  3W5U B;  2IJ0 A;  1YD8 U;  1N63 A;  5E6J A;  2KTR A;  1FNV A;  1KFY B;  5CHW A;  3A9J A;  1Q0W B;  4FJY A;  2XBB C;  3T3N A;  1YMH E;  2NMQ A;  3RNE C;  4RM9 A;  4JE3 B;  4WWO A;  1TTN A;  1IUE A;  3A4R A;  4NNJ B;  3VUY A;  2PEA A;  3SU8 X;  4WJQ A;  3OWE B;  2ZVO A;  4KDI C;  4GSW A;  4TQ1 A;  3RNG C;  3A1Q A;  2BVC A;  1UBI A;  4A3P A;  3DBL B;  3RD2 A;  1CMX B;  2QHO A;  1MFW A;  2AL3 A;  2BS3 B;  1F1H A;  2FNJ B;  4OZB A;  3VVW B;  1JQ4 A;  2ZW1 A;  3GB1 A;  4LNK A;  3HUI A;  1AN8 A;  2FCQ A;  5G2N A;  1WY8 A;  2GOW A;  2MH7 A;  4X57 B;  5J17 A;  4C7Z A;  3IAS 1;  3R3M A;  1EWY C;  2CR5 A;  3CMM B;  5I4D A;  4HKZ E;  2M56 B;  4YSY B;  1IYF A;  3PRP B;  3LJ3 A;  1D6E C;  2GBK A;  2WYQ A;  1R7S A;  2J0J A;  4H2A A;  3DBL I;  1GJZ A;  4M02 A;  1NYQ A;  3ZO5 B;  1EWC A;  3KUD B;  3L17 A;  4WWP A;  4K3B A;  4PS8 A;  2K0P A;  3A9K A;  2KDF B;  2BTE A;  3VTW A;  2IPK D;  1L0Y B;  3H7P A;  3B08 A;  1XLO A;  3MHZ A;  2WU5 B;  4WAF A;  3BZD B;  1WYW B;  4ASW C;  2H89 B;  2DAF A;  3VTU A;  5HKH A;  5C2T B;  3SDL C;  3WA0 A;  2G45 B;  3L10 B;  1PGA A;  2LXC A;  3DBH B;  4WAA A;  1YJI A;  4LTU A;  3ZJT A;  2WXF A;  1S3S G;  5BMG A;  2TSS A;  1V8C A;  1WRI A;  2QJL A;  3Q3F A;  4S0R A;  4AQ7 A;  3U4E G;  2KFK A;  2J0M A;  3ZIM A;  3DVN U;  1XD3 B;  1YIW A;  2JXT A;  4ITK A;  4G0N B;  1EU4 A;  1ZE3 D;  5E6N A;  3ABV B;  1D4B A;  4XWT A;  2KX3 A;  4ZRQ A;  1I4Q A;  2MJD A;  2KOX A;  3N3K B;  5BYS A;  3DBH I;  1K50 A;  3U7Z A;  2KAC A;  4B6W A;  2N4F A;  5IP4 D;  2FE8 A;  4DDI D;  1UD7 A;  1BUI C;  3NZ3 A;  3ZVV A;  4RGO S;  2DWQ A;  4MT5 A;  3Q3O C;  2LJ5 A;  2M1M A;  2IGD A;  1HXY D;  1MPE A;  4DXG A;  2D3G A;  2NBW B;  3JSV B;  2FCS A;  2MBQ A;  2Q5W D;  1EF5 A;  2K8B A;  1RLF A;  3PRZ A;  1OEY A;  3AXC A;  2FAZ A;  4IKG A;  1WXM A;  2BF8 B;  3RT3 B;  4BKS A;  3PZ8 A;  2Z59 B;  3RN9 C;  4BVU C;  2LVP A;  2KWV B;  3MC0 B;  1WM3 A;  2DHZ A;  4CHK A;  3DVG X;  4LJP B;  3W5V B;  4ZRK A;  2EKI A;  2KJR A;  2QC8 A;  4A90 A;  4MJS B;  5JHA A;  1I4X A;  4EZK A;  3IT6 B;  2IO3 B;  1H8C A;  1X1M A;  2LEK A;  1JWU D;  2K6Q A;  5TR5 A;  1E10 A;  2J4X A;  1D5X C;  4I6P A;  1WRD B;  3NVV A;  2PVG C;  3MJW A;  1WXQ A;  2ON8 A;  4PT5 A;  4A55 A;  3B1L X;  4D2K A;  1WGK A;  3TEX A;  2O6V D;  3BYY B;  3KYD D;  2FID A;  2O2V B;  3RCZ A;  4OHJ A;  1F9J A;  5DCN A;  4YSZ B;  3PSE B;  2DNF A;  3KQ4 A;  3L0W B;  4RMA A;  3W1Y A;  3ONS A;  1Y8R C;  3ZTC A;  3JW0 X;  3P2B A;  1OTR B;  4FXC A;  2GB1 A;  3N30 A;  4XDC A;  1VZ8 A;  1N61 A;  2M0A A;  4XE0 A;  3V62 A;  3H1U A;  1BML C;  3B2G A;  3M3J A;  2LI5 A;  5FR3 A;  4RFB A;  2FIF A;  1P98 A;  3QHT A;  2L00 B;  2CHZ A;  2E3T A;  3Q69 A;  3PTF C;  4LK0 M;  4REZ A;  1M94 A;  3NZU A;  4JWS C;  4NAM A;  4OVV A;  3HHM A;  4WIP A;  2WXM A;  4IM0 A;  5AZF A;  2KMA A;  2MBH A;  2J53 A;  2NPT B;  4B9K A;  4ZRI A;  2EMT A;  3ML8 A;  2YEP F;  1I7H A;  2LRW A;  3RMK C;  2L1A A;  3VRA B;  2AX5 A;  2MCN B;  1QT9 A;  4MAC A;  1T0S C;  4BKG A;  1WE6 A;  2PVO D;  4FHK A;  1KLV A;  3K9P B;  2INC C;  4XWW A;  3PZD A;  1SXT A;  3W9C B;  4TQ0 A;  1P7E A;  4ZDV A;  4XDD A;  4EFO A;  2I1K A;  2LUM A;  1C4C A;  2D3A A;  2QDF A;  3DVG Y;  4M0W A;  3L54 A;  1TGZ B;  4MM3 B;  2WXK A;  5IKC M;  4KSK C;  1GPX A;  1MG8 A;  1HTO A;  2DX5 B;  1FXI A;  4IW0 A;  1ESF A;  2JZ3 B;  2PKO A;  2ZPY A;  2GBN A;  5FR6 A;  3RPF C;  2PJH A;  1E8Z A;  2BB5 A;  3GE3 C;  1C9F A;  3BY4 B;  3Q6B A;  4TSS A;  2KDM A;  5HHD G;  4PS3 A;  1KRH A;  2WXJ A;  3QJZ A;  4OZC A;  4IM3 A;  4Q2J A;  1LXD A;  2LHD A;  3MC9 A;  4BBN C;  2IND C;  1KOT A;  3B2F A;  3V60 A;  1WGD A;  1T6B X;  1E8W A;  2BYT A;  3T3O A;  4WH4 A;  4W9D A;  3KWL A;  1F2R C;  4KZC A;  3ZNI D;  4ZRP A;  3U7D A;  2UU7 A;  3U2S C;  2PE6 B;  2JZZ A;  2KAN A;  2V4L A;  3RNA C;  3PHW B;  2JU6 X;  3PRE A;  1JRU A;  2CU1 A;  2M4N A;  2WP9 B;  2XK5 A;  3RYT A;  1VDV A;  2PIA A;  2C60 A;  1SIJ A;  3P63 A;  2ZZP B;  3RI7 C;  3MJ5 A;  2FBW B;  1P3Q U;  2JZP A;  5IOI A;  1TS4 A;  4DXA B;  2PMV A;  4C80 A;  3AED B;  1WF9 A;  4DXF A;  3OLM D;  4ACF A;  2KK8 A;  3QCA A;  1WXV A;  4JIO U;  1C79 A;  3P4P B;  3AE8 B;  4FLH A;  1WFY A;  3ZW3 A;  1GG3 A;  4US8 A;  4HCP B;  5GMV A;  2BKR B;  2GBM A;  1XF5 L;  2KNB A;  1WXS A;  2MQJ A;  4LDT B;  2ZEQ A;  2DAJ A;  1HZ5 A;  2VZK D;  3EFU A;  1ISN A;  2ZPN A;  1EF1 A;  3ZNH B;  3Q8B A;  2J0K A;  5D94 A;  1MJD A;  1T3Q A;  2MP2 B;  4EE2 A;  5CTR C;  3X23 A;  2WXI A;  4B0E A;  3SD5 A;  4NAW A;  2L0T A;  3NZS A;  1F2R I;  4RF0 A;  4A8X C;  4P6V F;  1WGG A;  4YWG G;  3AE6 B;  2E6X A;  5IAA C;  1TZ1 A;  3OJ3 A;  5CHV C;  1U4A A;  1Z5S B;  3QIJ A;  1NI2 A;  3UGB B;  4HPP A;  1LFD A;  4URK A;  2KWD A;  2WLB A;  3H7S A;  2D2Q A;  3GE8 C;  4JX1 C;  4TUU A;  2G4D B;  1WJN A;  4XX5 A;  2HTH A;  2NBU A;  5DPT A;  5D2M B;  1JWB D;  3CWI A;  2AYO B;  3AEC B;  1K8R B;  4GXB A;  5D7G A;  3FAH A;  1QF6 A;  1D3Z A;  2LGI A;  2IO1 B;  1V1O A;  1WJ6 A;  5LLI A;  1YN5 A;  2ZCC A;  4NQL B;  3M62 B;  1LO5 D;  2V3N A;  2C9W B;  4AS1 A;  1XXG A;  3WAO A;  3V6C B;  2PPH A;  4MSM B;  3NHE B;  4JPS A;  2JY6 A;  2W55 A;  1XLP A;  4HLE A;  4YTN B;  3R7R A;  3J9C A;  1TIF A;  1ZKH A;  1ET9 A;  3TUO A;  4YTM B;  4NJ7 A;  2DYM A;  3Q3N C;  1IP9 A;  2K1F A;  1N62 A;  2L7R A;  5L95 C;  3UIP B;  1G6J A;  1V86 A;  2CKH B;  5L83 A;  1V1P B;  2KT7 A;  1XO3 A;  1OQY A;  3L4P A;  2WX0 A;  2DYO A;  3E56 A;  1SE4 A;  2AEH A;  3PLV A;  4MGY E;  1QIL A;  1WR1 A;  3Q14 C;  3NVZ A;  2HDE A;  1VD2 A;  2HJ8 A;  4ICU A;  3BK1 A;  4IC7 B;  2WXQ A;  2FCM A;  5LXH A;  3B9J A;  2MBO A;  3OAW A;  2JVC A;  3Q8C A;  4RH6 A;  3KW5 B;  4LCD E;  1D5Z C;  1PDX A;  2LGS A;  1V5O A;  3IVF A;  4FUL A;  4YT0 B;  2BYV E;  2KMC A;  3ZNZ B;  1GAQ B;  1QLB B;  2C7H A;  2HTM E;  1LM8 B;  1S1Q B;  1KF6 B;  1XCT L;  2LAS A;  1EO6 A;  3AH7 A;  2G4S A;  5C23 A;  2KLC A;  2W82 A;  3RUL A;  4KVG B;  1YN4 A;  1CK1 A;  3BVM A;  3O13 A;  4GDK B;  3AEE B;  1WWT A;  4TV3 A;  1GOZ A;  3QA8 A;  4KIK B;  1ZGU B;  2AQ1 B;  3UI3 A;  4JGH B;  1OEY J;  4RGM A;  2BB6 A;  4LNN A;  4P1C C;  1WJU A;  2RMM A;  4TKN A;  1UEL A;  1DGJ A;  2LMC A;  1FCL A;  1EUV B;  2KN5 A;  3NRZ A;  2BS4 B;  4TMA B;  4HPL B;  4OW0 A;  1Q5W B;  4XZ4 A;  1K52 A;  1SF0 A;  3Q2A C;  4WWM A;  1C3T A;  1I42 A;  2N9P C;  1V81 A;  2H88 B;  1WMH B;  2KXJ A;  1VRA B;  1YJJ A;  1L7Y A;  1SEB D;  1L6U A;  2RDH A;  2MSE D;  2K9X A;  4C56 C;  1RWS A;  5JXV A;  3IHP C;  5D3D A;  2LFI A;  1TKG A;  4KSL C;  3TEW A;  3AUL A;  4P1B C;  4EOY A;  2K25 A;  2RDG A;  4YL8 A;  3KVF B;  2WDR B;  2C5L C;  1YX6 B;  2QIL A;  4W9H A;  1RYJ A;  4XC2 A;  1NDD A;  4B95 A;  4KKI A;  4XYC A;  3UQB A;  2MRP A;  3Q8F A;  1B9R A;  2UWQ A;  1E8X A;  2IO0 B;  1P9D U;  3L13 A;  2N7D A;  2BWF A;  2LXA A;  3BYT B;  2C7N B;  4LDT D;  4LLG M;  3D32 A;  3JSV A;  5HG2 A;  3RNB C;  2K8H A;  4FN2 A;  2NR2 A;  1ZW7 A;  2VH2 A;  2RDB C;  3TIX A;  1JW9 D;  3R66 C;  1YX5 B;  1L4D B;  4DK5 A;  2R61 A;  1FNW A;  4PK1 A;  3U52 E;  1L0V B;  1GB4 A;  1JAL A;  1PGX A;  5E6O A;  3BVG A;  4IWQ A;  2KAJ A;  3P4R B;  4GU2 A;  3JVZ X;  4AUQ C;  3CST A;  2AQ3 B;  4NY0 A;  1MVK A;  2W3R A;  1XT9 B;  3Q8A A;  2K22 A;  2KWU B;  1WIA A;  4MJS A;  4UDU C;  5AUK A;  1HTQ A;  2R2Q A;  3PGE A;  3L16 A;  5FKA C;  1WX7 A;  2ASQ A;  3HIZ A;  3DHH C;  3IG3 A;  3KH0 A;  1DOY A;  2PE9 A;  2IBI B;  4C7Y A;  3U8Z A;  2CJN A;  3W1S C;  3AB5 A;  1UZX B;  3P4S B;  3EUB 2;  1V97 A;  2O2V A;  2OJR A;  3N9Y C;  1ZXH A;  1GC7 A;  4DHJ B;  1TY0 A;  3T8M A;  2LGX A;  2KQ7 A;  5H92 C;  4WQM A;  3EGR A;  1UBQ A;  4BKT A;  4E71 A;  2KDB A;  2L32 A;  1UF0 A;  2KX0 A;  2KDE B;  2MA9 B;  4N58 A;  2V0G A;  4G3X B;  1TKY A;  2N0S B;  1FNU A;  1I4G A;  4PS7 A;  4RGT A;  4MGK E;  3AEB B;  4MEL A;  4LJO B;  3CF6 E;  3M95 A;  3GZN B;  4N9F 4;  2ZW0 A;  5BYR A;  1AYF A;  2WXH A;  4EEW A;  2BKF A;  4A3O A;  2PLP A;  2NPT A;  3PS6 A;  2RR9 A;  1UH6 A;  2LUE A;  4HK2 A;  3GS2 A;  2L3Z A;  3APD A;  4O1N A;  1H4R A;  1IGC A;  1NEK B;  3QQ8 B;  2BQQ A;  1QKZ A;  3UIO B;  2BGF A;  1NBF C;  2WQY B;  1RRB A;  3MP9 A;  3AN1 A;  3BK2 A;  3ZQ4 A;  1TY2 A;  2MWS B;  1ZXI A;  3AM9 A;  3ZUN A;  3GZN I;  1WZ0 A;  3P1M A;  2KDI A;  3EHV A;  3HM3 A;  3U30 A;  2WXR A;  3I63 C;  4MM3 A;  2X38 A;  1VJK A;  1J8C A;  4KX6 B;  4A9A A;  1UGM A;  5FK9 C;  2B76 B;  2N1V A;  4EZJ A;  1VLB A;  4BOZ B;  2KJ6 A;  1C1Y B;  1C76 A;  3VR9 B;  1I4P A;  2AWT A;  4HEA 1;  1ZPS A;  3AE1 B;  1E0Z A;  2BT6 A;  1DOX A;  2D07 B;  5TSS A;  3PHX B;  1SBB B;  3LYY A;  1FD6 A;  1SE2 A;  1WX8 A;  2ZVN A;  3Q3J A;  3ZJU A;  5BYQ A;  3EEC A;  1D5M C;  2BBC A;  2JWU A;  2MBB B;  3LXF A;  4W9E A;  2A5U A;  3IXS A;  4HDO A;  4DHZ B;  4M01 A;  2YLM A;  4RNA A;  1K53 A;  3P42 A;  1N5W A;  3RFZ B;  3HVD A;  1L2N A;  1JCK B;  4JL9 A;  1Z2M A;  1TT5 B;  2WXN A;  2KMM A;  4NJ6 A;  2LVQ A;  2CS4 A;  2KN4 A;  1IBX B;  4IDI A;  3DHI C;  3APC A;  4DHZ E;  3APF A;  1ZOY B;  2EMS A;  3BIN A;  4WUR A;  4NQK E;  4W9G A;  1YN3 A;  4C4V B;  5EE9 A;  2YEP B;  1FFV A;  1VCB A;  4AP4 C;  1TBE A;  4IWP A;  3A4S C;  3JYU A;  4YSX B;  3PVL A;  5KHQ A;  1NVI D;  2KC2 A;  2ZNV C;  3KWV A;  3EFC A;  2KYW A;  2JXX A;  1N60 A;  2XNA C;  1CZP A;  2KWC A;  3AE9 B;  1TKE A;  1NYR A;  1N6Z A;  2BYF A;  2JWZ A;  2WXG A;  2NCN A;  2REX A;  1IGD A;  4K3C A;  2LD9 A;  2DZJ A;  3VRB B;  3EA6 A;  1SIF A;  4W9F A;  3VH3 B;  2SEB D;  3Q8E A;  1R4N B;  4P7I A;  1XQQ A;  5D3I B;  1SB3 C;  1ZP0 B;  2LGD A;  2WU2 B;  3HRD D;  4F8C B;  2KLG A;  5G5H A;  1KLG D;  3SHQ A;  2I2Y A;  4FA6 A;  4AWJ A;  2DEN B;  4IM2 A;  5CX3 A;  3LB8 C;  2IZV B;  1V5T A;  4US9 A;  2MP2 A;  1A5R A;  2NTT A;  4ICV A;  1R4M B;  1UWX A;  1FCC C;  3H6N A;  2Y5B B;  2MX2 A;  3AU5 A;  2M0X A;  2ZNV B;  3TSS A;  5C3J B;  4HWI B;  3FIL B;  2CHX A;  3I5J C;  2IDY A; 
#chains in the Genus database with same CATH homology
 1BUI C;  3NZ3 A;  3Q8C A;  4RH6 A;  4RGO S;  2PTL A;  2DWQ A;  1FXA A;  1TS2 A;  2WDV B;  2DLB A;  4MT5 A;  1D5Z C;  1PDX A;  3R2I A;  2IGD A;  1QQR A;  1WSP A;  4YT0 B;  5EE0 A;  1E6E B;  1J7B A;  1HXY D;  1MPE A;  2WXP A;  4DXG A;  1SJE D;  1QOG A;  3NVY A;  1GAQ B;  1QLB B;  2HTM E;  2N9K A;  1JRO A;  2V4I B;  1KF6 B;  2Q5W D;  2L83 A;  1NI3 A;  1UWM A;  1XCT L;  1IBX A;  2WS3 B;  2Y5C A;  3AH7 A;  4IKG A;  4L23 A;  2G9H D;  2JX5 A;  3AV8 A;  3SFD B;  2W82 A;  3PZ8 A;  1YN4 A;  1CK1 A;  3BVM A;  3O13 A;  4GDK B;  5LNK 1;  3AEE B;  3MC0 B;  1WWT A;  4YXD B;  3WCQ A;  1GOZ A;  2K3U A;  3W5V B;  2EKI A;  4KGS A;  4A90 A;  1N5X A;  1MI0 A;  1JML A;  1AW7 A;  1SSN A;  2AQ1 B;  2OHF A;  3UI3 A;  1YQ3 B;  4A6Q A;  1L4Z B;  1I4X A;  1UGJ A;  3IT6 B;  3SR6 A;  4RGM A;  1FMA D;  2BB6 A;  2LEK A;  1JWU D;  1E10 A;  3NS1 A;  2J4X A;  1D5X C;  2RMM A;  1J7A A;  3AE2 B;  3NVV A;  2PVG C;  3GP7 A;  4N6E B;  1L5P A;  1WXQ A;  2ON8 A;  4PT5 A;  4A55 A;  1DGJ A;  2LMC A;  4D2K A;  1WGK A;  2BS2 B;  1FCL A;  3TEX A;  3BYY B;  3NRZ A;  2BS4 B;  4TMA B;  1WYG A;  4OW0 A;  4IOI E;  4OHJ A;  1K52 A;  2GRI A;  1SF0 A;  3R2T A;  4YSZ B;  4WWM A;  3ZYY X;  4GDL B;  3KQ4 A;  1V1P A;  1VZ7 A;  1HZ6 A;  2N9L A;  1ZDV A;  2IGG A;  2IGH A;  2H88 B;  1QOF A;  1VRA B;  4B0M A;  1YJJ A;  2WDQ B;  3FC4 A;  4FXC A;  2GB1 A;  1SEB D;  1YQ4 B;  1PUT A;  2EEL A;  1L6U A;  2RDH A;  4XDC A;  5GXG B;  1I4H A;  1VZ8 A;  4RF1 A;  1N61 A;  3DWG C;  2M0A A;  4XE0 A;  1JWA D;  2K9X A;  1BML C;  4C56 C;  1RWS A;  3B2G A;  2M19 A;  1OFF A;  5JXV A;  5FR3 A;  5D3D A;  4MH8 A;  2LFI A;  4RFB A;  2ICI A;  3AMZ A;  5T8I A;  1TKG A;  2JQR B;  2E3T A;  2OED A;  1PFD A;  3PZ7 A;  3Q69 A;  4L1B A;  3TEW A;  1C4A A;  1YNT E;  3KLS X;  4KKJ A;  2RDG A;  4LK0 M;  4REZ A;  1CJE A;  2WDR B;  4GLS C;  4JWS C;  2QIL A;  4NAM A;  4WIP A;  3FIL A;  1RYJ A;  1HQR D;  2WXM A;  4USA A;  5MPO A;  1MHX A;  2J53 A;  1UUP A;  4KKI A;  3Q8F A;  2D5G A;  2ONQ A;  1FM0 D;  1B9R A;  4OZA A;  4DQO C;  3IT4 B;  2YEP F;  1I7H A;  3BYT B;  1F77 A;  1FRR A;  1KTK A;  2G1E A;  3AE3 B;  1PYW D;  4LLG M;  5HG2 A;  1I4R A;  2L1A A;  3AE5 B;  2AX5 A;  3VRA B;  1QT9 A;  3AEA B;  1DYQ A;  4MAC A;  2PW9 A;  2PVO D;  2JYE A;  4XWW A;  1RM6 C;  1XLQ A;  1JW9 D;  1SXT A;  2FUG 1;  1L4D B;  4YTP B;  3W9C B;  2R61 A;  4TQ0 A;  1P7E A;  1FNW A;  3U52 E;  1L0V B;  1GB4 A;  2Y5P A;  1JAL A;  1K51 A;  1PGX A;  4XDD A;  3BVG A;  3V3X A;  3ZGZ A;  2KAJ A;  3P4R B;  4ZHP A;  4KGT A;  2LUM A;  1C4C A;  4JWU C;  4M0W A;  4CQN A;  2AQ3 B;  1MVK A;  4MM3 B;  2JYT A;  2WXK A;  2W3R A;  1RFK A;  1GPX A;  1M4V A;  3Q8A A;  1TS5 A;  1FXI A;  2GI9 A;  2K22 A;  2LHE A;  1JRP A;  1HEZ E;  1ESF A;  4UDU C;  2PKO A;  5AUK A;  2QMT A;  4ARI A;  5FKA C;  4KGR A;  2W54 A;  3BVZ A;  3CIR B;  3RPF C;  2BB5 A;  1DOY A;  4C7Y A;  1CQV A;  2QIE B;  1C9F A;  3C8Y A;  4NAW B;  2CJN A;  2SAK A;  5EE1 A;  3AB5 A;  1STE A;  3ETR A;  3P4S B;  4TSS A;  1T5X D;  3EUB 2;  2KDM A;  3BWU D;  1V97 A;  4RCO A;  5HHD G;  1TJE A;  1VZ6 A;  3N9Y C;  4HRS A;  1KRH A;  2INP E;  1MHH E;  2WXJ A;  4OZC A;  1E9M A;  3H8H A;  4Q2J A;  1ZXH A;  2LHD A;  3BII D;  3E9S A;  3B2F A;  2Z8L A;  4NJC A;  1TY0 A;  2AQ2 B;  1ZDX A;  5BMH A;  1T6B X;  2BYT A;  3VQI A;  3T3O A;  3AEG B;  4WH4 A;  2ACZ B;  5H92 C;  2K5P A;  1ACC A;  3KWL A;  4WQM A;  2Y3A A;  1ET6 A;  1F2R C;  3EGR A;  3ZJV A;  4ZRP A;  3U2S C;  2MEK A;  1EU3 A;  2L32 A;  3I9V 1;  2QEJ C;  1OQR A;  4N58 A;  3W2D A;  2V0G A;  1FEH A;  3TEY A;  1J7C A;  1TKY A;  1ENF A;  1FNU A;  2N0S B;  3R8B A;  1I4G A;  2JSV X;  1BXT A;  1XEE A;  2JU6 X;  3AEB B;  4P16 A;  4RGT A;  3MFG A;  5H8Y E;  1PGB A;  2WP9 B;  1C77 A;  2ZW0 A;  2WNM A;  5BYR A;  1AYF A;  1A70 A;  2WXH A;  5EE3 A;  1VDV A;  2PIA A;  2WXO A;  1VR9 A;  2PLP A;  2MJ3 A;  1SIJ A;  1L6V A;  1ZUD 2;  4ZHO A;  3P63 A;  1TYG B;  3DWM A;  4HKQ A;  1XLN A;  2DBY A;  3MJ5 A;  1FFU A;  2FBW B;  2CU3 A;  2CJO A;  2JZP A;  3NUH B;  3V05 A;  3GS2 A;  3AE4 B;  1TS4 A;  2PMV A;  4C80 A;  1E7P B;  3AED B;  5AUI A;  4DXF A;  1UNS A;  4O1N A;  4HRO A;  1XCQ L;  2NTS A;  1IGC A;  3SEB A;  1NEK B;  1QKZ A;  1KLU D;  2I38 A;  1C79 A;  3P4P B;  3W5U B;  3AE8 B;  2IJ0 A;  1N63 A;  5E6J A;  1FNV A;  2WQY B;  1KFY B;  3MP9 A;  4US8 A;  1JWM D;  3AN1 A;  3BK2 A;  3ZQ4 A;  1TY2 A;  1ZXI A;  3AM9 A;  3T3N A;  1YMH E;  2NMQ A;  1XF5 L;  3P1M A;  1TS3 A;  2MJE A;  4JE3 B;  1IUE A;  1HZ5 A;  2WXR A;  2VZK D;  1VJK A;  2X38 A;  2L52 A;  4KX6 B;  1FO4 A;  4A9A A;  3AEF B;  2VZK B;  5FK9 C;  2B76 B;  3OWE B;  2J42 A;  3Q8B A;  4TQ1 A;  1VLB A;  5HFY A;  4L2Y A;  1T3Q A;  4EE2 A;  1C76 A;  3URY A;  3VR9 B;  1I4P A;  2WXI A;  1NEN B;  4B0E A;  1SJH D;  2BS3 B;  1DOI A;  4HEA 1;  4ZOH C;  4OZB A;  1ZPS A;  2RPV A;  4NZL B;  1JQ4 A;  1B1Z A;  2ZW1 A;  1F2R I;  3AE1 B;  3GB1 A;  3HUI A;  1AN8 A;  4RF0 A;  4A8X C;  4ARC A;  1E0Z A;  1OQQ A;  2BT6 A;  4P6V F;  4HJG E;  4YWG G;  1DOX A;  3AE6 B;  2MH7 A;  2E6X A;  2W3S A;  5TSS A;  3VR8 B;  1SBB B;  3LYY A;  1FD6 A;  1SE2 A;  4C7Z A;  3IAS 1;  1EWY C;  3ZJU A;  5BYQ A;  1D5M C;  2BBC A;  2JWU A;  3LXF A;  4HKZ E;  5I4D A;  2KWD A;  2M56 B;  2WLB A;  3IXS A;  4YSY B;  4RNA A;  4JX1 C;  1K53 A;  3P42 A;  1N5W A;  1C78 A;  3RFZ B;  1C4P A;  1D6E C;  3I57 A;  3HVD A;  4R3D A;  1JWB D;  1JCK B;  2N7J A;  3CWI A;  2WXN A;  2KMM A;  2QSD A;  1R7S A;  3AEC B;  2KQ4 X;  4H2A A;  5HI1 A;  2KN4 A;  1IBX B;  5D7G A;  3FAH A;  1L0X B;  1QF6 A;  1NYQ A;  4IDI A;  2LGI A;  1FRD A;  1V1O A;  1JWS D;  1EWC A;  1YN5 A;  1ZOY B;  4WUR A;  1LO5 D;  2K0P A;  2BTE A;  2V3N A;  1YN3 A;  2IPK D;  1L0Y B;  1SE3 A;  5EE9 A;  2YEP B;  1FFV A;  4AS1 A;  1XLO A;  3MHZ A;  1P7F A;  2WU5 B;  3W1S A;  1AWD A;  1ROE A;  1XXG A;  1Q10 A;  3BZD B;  4RGN A;  4WAF A;  2V3P A;  3SFE B;  4YSX B;  4JPS A;  3NVW A;  1NVI D;  4J3O D;  4ZYS A;  2H89 B;  2XN9 C;  2W55 A;  3KWV A;  5C2T B;  1XLP A;  4YTN B;  1EM7 A;  1PGA A;  3J9C A;  1N60 A;  1YJI A;  2XNA C;  4LTU A;  1ET9 A;  3ZJT A;  1CZP A;  2WXF A;  3TUO A;  3AE9 B;  5BMG A;  2TSS A;  1TKE A;  4YTM B;  1NYR A;  1V8C A;  1WRI A;  2DYM A;  3HVZ A;  2QJL A;  4AQ7 A;  1KH0 A;  5G5G A;  2WXG A;  3U4E G;  1F0Z A;  1IGD A;  1N62 A;  2LJI A;  3VRB B;  3EA6 A;  4OVZ A;  1TZO A;  1QOB A;  2BW2 A;  1V1P B;  2JXT A;  4ITK A;  1XO3 A;  2SEB D;  2J52 A;  3Q8E A;  1EU4 A;  5D3I B;  1ZE3 D;  3AE7 B;  1SB3 C;  1ZP0 B;  2WU2 B;  3L4P A;  3ABV B;  3HRD D;  5G5H A;  2I2Y A;  1KLG D;  3TEZ A;  1D4B A;  4XWT A;  1Y56 A;  1GB1 A;  1HA5 A;  2DYO A;  4ZRQ A;  3PO0 A;  3E56 A;  1SE4 A;  3LB8 C;  1QIL A;  1I4Q A;  2MJD A;  3NVZ A;  4US9 A;  2HDE A;  5BYS A;  2NTT A;  1UWX A;  1K50 A;  1FCC C;  3U7Z A;  2KAC A;  4N59 A;  1FIQ A;  3BK1 A;  1QOA A;  3P4Q B;  3TSS A;  2WXQ A;  5BMI A;  2INN E;  5C3J B;  2FE8 A;  3FIL B;  3B9J A;  2IDY A;  2WXL A;  3IAM 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...