2N9KA

1h, 13c, and 15n chemical shift assignments for in vitro gb1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
57
structure length
57
Chain Sequence
MGTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Immunoglobulin G-binding protein G
publication title Improved in-cell structure determination of proteins at near-physiological concentration
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
total genus 15
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2015-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2n9kA00
2J52A 2EELA 1QKZA 1K51A 2KWDA 4HJGE 1MHHE 2LHDA 1HZ6A 1EM7A 1PGBA 1GB4A 2KDMA 2GI9A 2KQ4X 2ZW0A 2PW9A 2LGIA 4OZCA 1KH0A 2K0PA 2KACA 1JMLA 5HFYA 2KN4A 3FILA 2N9KA 1C9FA 1K53A 4IKGA 1IBXA 1FCLA 2ON8A 1MVKA 1ZXHA 2ZW1A 2ONQA 1IGDA 3MP9A 1FCCC 1XCQL 2RPVA 2J53A 1MHXA 4WH4A 4KGSA 1PGXA 1MI0A 2OEDA 4HKZE 1XF5L 2GB1A 4IOIE 5BMIA 2I38A 2IGGA 2IGDA 1XCTL 4KGRA 4OZBA 4OZAA 2RMMA 1YNTE 5BMGA 3UI3A 5BMHA 5HI1A 5HG2A 1HEZE 2QSDA 1YMHE 1K52A 1P7EA 5HHDG 2I2YA 2N7JA 5JXVA 2JU6X 1P7FA 2LUMA 3GB1A 2PTLA 1MPEA 2JZPA 2JWUA 1K50A 4GLSC 4MACA 2LHEA 1F2RI 2JXTA 2JSVX 1FD6A 2IGHA 1Q10A 1UWXA 4KGTA 1HZ5A 1IGCA 1PGAA 1D4BA 3V3XA 1GB1A 2QMTA 1F2RC 4D2KA 2PLPA 3FILB 1IBXB 2N9LA 2NMQA
chains in the Genus database with same CATH superfamily
4M01A 1P9DU 2DZKA 4JWSC 4RMAA 1YJ1A 1MG8A 1M4VA 1OTRB 2W55A 1QOGA 1HA5A 3TEYA 1LGRA 2M4NA 1SEBD 2PW9A 4PT5A 3DBSA 2WX0A 5CTRC 1KOTA 4EFOA 4H2AA 2YEPB 1DOIA 2DLBA 4OZCA 1TS5A 2KFKA 3AULA 2KACA 2N9EB 3O13A 3KYCD 1C3TA 1XEEA 3KYDD 3SFDB 2A4ZA 1T0YA 2HDEA 4AQ7A 2UYZB 4FADA 3M95A 1L4DB 1MHXA 2ZNVC 2JF5A 1WYWB 4ICVA 4W9FA 1K8RB 3GE8C 1IYFA 4MJSB 2GBNA 2PKOA 2MJ3A 4DBGA 3KWLA 5CHWA 3IAS1 1YNTE 4YSYB 1NYQA 2NTSA 3H7PA 5BMGA 4ANXA 4DHJB 3ZIMA 2IO3B 1TGZB 4TQ0A 1Q5WB 5HI1A 1OGWA 2KX3A 3OAWA 3ONSA 1FIQA 5CHVC 3TSSA 1Z5SB 3P2BA 5BYRA 4HXDA 1UGJA 1FD6A 4NPNA 1WXQA 3CMMB 2D5GA 2DBYA 3TCAA 1CZPA 2Z0EB 3V3XA 4CYEA 2HJ1A 2MBOA 4K7SA 4LLGM 1SE3A 1MJDA 3CSTA 2J52A 2JVCA 1JWUD 2RPQA 2BWFA 3OLMD 3Q8AA 4NZLB 2WXJA 2INCC 5GMVA 1FPYA 5DPRA 1E10A 3ZJUA 2L52A 2N7EA 1A70A 3SFEB 4EUTA 4K1RB 4TKNA 1B9RA 1HQRD 3N9YC 2MSED 3PS6A 1NEKB 1FFUA 2K0PA 3N1ZC 2LGXA 1B1ZA 5E6NA 1V5OA 3W1SA 3FAHA 1WE6A 2KC2A 2H88B 3VTUA 3QJZA 1V97A 2NCNA 3RZWC 2J53A 3R2IA 4MSMB 3H7SA 2G4SA 3AEDB 4XDCA 4AS1A 1N6ZA 5DPWA 2LFIA 2REXA 2W54A 3HK0A 3NJTA 3HHMA 3IBEA 3SHQA 4GIVA 3TIXA 1GC7A 2WDRB 3UIPB 3AE1B 4KX6B 4YXDB 2JYEA 1GG3A 3RNAC 1L0VB 5DPTA 4IWOA 4AJYB 2KN5A 1QZEA 2SAKA 4GDLB 2K6QA 2BPSA 4OVVA 3DBLB 2L32A 4JQWC 3KLSX 3ML9A 3AV8A 3VTVA 1BT0A 2PPHA 3L10B 1ESFA 4M0WA 2CS4A 4A6QA 1V86A 1C78A 1L6VA 1WFYA 3KUDB 4NAWA 2LHDA 1WJ4A 3BINA 4WQMA 4MGIE 4KSLC 3DDCB 2CU1A 2KQ4X 3HM6X 1V1OA 2E6XA 3OJ4B 4L2YA 3URYA 2GBKA 2WXKA 2FUG1 2AEHA 3VRAB 2CJNA 1GUAB 1MFWA 3QAQA 1MVKA 1YJJA 3DQVA 2V4LA 1QOFA 1YX5B 4GGQA 3ZRCA 1RM6C 4REZA 2ZPYA 2KJRA 1WSPA 4ARCA 4ZRIA 4WJQA 3UIOB 4MDKE 4OVZA 4BVUC 4PS8A 2IGGA 3PLUA 1BMLC 3R3MA 2M19A 3PZDA 2IY1B 1I35A 4IUMB 5LXHA 1Y56A 1TKYA 4I6LB 2BYTA 3NZUA 4XDDA 2BBCA 1WXSA 1L7YA 2KLGA 1TJEA 1D5ZC 1P7EA 4ZRQA 1JRUA 1SJHD 3VH4B 2G3QB 3T3NA 1J7CA 4IM3A 3MC8A 2JY6A 3NVVA 3ZNID 1I4HA 5LLIA 1T6BX 3NZ3A 3B0AA 4A3PA 1TS3A 3Q8BA 4YWGG 3RFZB 3R7RA 3AM9A 1P3QU 3EHVA 1XLQA 2D11A 4MJSA 4GDKB 2K6DB 4IWPA 4RFBA 3I57A 3FILB 1R4MI 2KANA 5KHQA 2KTFA 4I6NB 5I4DA 1WX9A 2KO3A 2WU5B 4JL9A 2HTME 4MT5A 4C00A 3QA8A 1EO6A 1ZDVA 2KDEB 1ET9A 2KDIA 1PYWD 2GRIA 2LRWA 1KRHA 2RGFA 2GI9A 3E9SA 4EZKA 2HD5B 4LNNA 5MPOA 2LEKA 4K3CA 2L76A 1E7VA 1ROEA 5H92C 1KLVA 2O2VB 2WWZA 2BW2A 1JMLA 2JUOA 4IG7B 3AU4A 2BB6A 2ZVOA 3R7QA 3IVFA 3JSVB 3VVWB 2XK5B 2KMAA 2B3AA 2RPVA 1NDDA 3BIID 2EKEC 5C2TB 4US9A 1PGXA 2CHXA 3EFUA 2D3AA 1E90A 3AE9B 5H8YE 3TEWA 4WJOA 2WXQA 4ZDVA 1JQ4A 5IN7A 1ZE3D 2OJWA 1XLOA 4AP4C 3RNFC 3B08A 3WAPA 4RCOA 1C4PA 2YEPF 4K3BA 2D3GA 4YSXB 4C80A 4W9LA 5L83A 2M0AA 2LASA 5JXVA 1SE2A 2R2QA 1P7FA 4K81A 3DVNV 1UD7A 2CKHB 2WXRA 2Y5CA 4F7ZA 4S17A 4YTPB 1N61A 1FM0D 1DOXA 3IAM1 4OW0A 4P6VF 1XLPA 3Q3NC 1V8CA 2D3BA 4AOFA 2Y3AA 4FJYA 2NMQA 1BUIC 1QF6A 4GSWA 2ZNVB 4LK0M 3CWIA 1E7PB 4BOZB 3PSEB 1FXTB 5C1ZA 4HPPA 2K25A 3NRZA 4JLCA 4GDLA 1EU4A 4P1BC 2O6VD 2LGIA 5BYQA 1V2YA 2UWQA 3AEAB 1EF5A 5AZGA 4DHZE 1QOBA 1TZ1A 4LJOB 3MP9A 2CHZA 3P1MA 4EKUA 4EZLA 3AEBB 1SIFA 1VD2A 1TY2A 2WDTB 4JGHB 2XN9C 3ZW3A 1TIFA 4W9IA 3TL5A 4DWFA 1WM3A 2BS4B 1NYRA 3ABVB 1TS2A 3VUXA 2L3ZA 2RD0A 4IM0A 2ACZB 3GZNB 1I4QA 2MJDA 4M02A 2WXOA 4Q2JA 2FE8A 2IZVB 3PREA 3KH0A 3Q6BA 1T0QC 1UF0A 5D7GA 3H9DA 2QC8A 2ZEQA 1JCKB 4JE3B 4R3DA 2ASQA 2D10A 3Q3OC 3JYUA 2FCQA 3GS2A 1ZDXA 4FJZA 4RH6A 3IG3A 4XC2A 1YQ4B 3APDA 4NQLB 3RT3B 4N59A 3BVGA 3RN9C 3QHTA 4B9KA 1R4NB 1WE7A 4P1CC 1I4XA 1QKZA 1NENB 2QDFA 2KAJA 1GOZA 2Y5PA 4B0EA 1UNSA 2RDBC 4HWIB 3C8YA 4OVUA 4FHKA 2V3PA 4TMAB 2AQ1B 1WR1A 1GB4A 2DWQA 2FUHB 3Q3FA 1J0GA 1J19A 2KWVB 3ZYYX 2WXNA 4JIOU 1I4RA 3FKYA 2NTTA 4BKSA 4GDKA 4WWOA 3VR8B 2M17A 2UU7A 3FILA 4IKGA 2BB5A 1FCLA 5AUIA 3R8BA 1FNWA 5JHBA 3UQAA 4GN1A 4XE0A 3NVZA 1XD3B 3QX1A 4G0NB 2KVRA 1XCQL 3J9CA 1XT9B 1KF6B 4C4VB 2N1VA 3IFWB 4K7UA 1CJEA 4L23A 2NBVB 3ZJVA 3RCZA 4USAA 1F1HA 2GBJA 3APFA 3AMZA 1WGKA 2WXFA 3ZJTA 4HK2A 2O2VA 4NNJB 1K52A 1S3SG 2IY0B 1P98A 3MC0B 4XYCA 4ZYSA 1XLNA 3JSVA 3PRMB 1UZXB 2RR9A 1LQBA 4M00A 2XK5A 4JPSA 4NJ6A 1F0ZA 2L83A 4G11A 4TUUA 1WZ0A 2G4DB 2IGHA 2LZ6A 4LNFA 3VRBB 3KUZA 1BXTA 5AEKB 4BBNC 3WCQA 1WF9A 2INDC 3P4SB 4FXCA 1C4CA 1ZW7A 1WRIA 2L05A 2KYWA 3NY5A 2AX5A 4CQNA 2KK8A 3AE6B 1WZ3A 3N32A 4LNKA 1VCBA 1PDXA 2C5LC 1HTQA 2BF8B 1HXYD 5G5HA 3Q8FA 4ICUA 1OQQA 5DPSA 1LO5D 1DYQA 3AE7B 3ML8A 1FEHA 2PE6B 3X0WA 1VZ6A 3AEGB 5IA7A 5J2RA 1RRBA 3U2SC 4M8MA 3ZTCA 4LDTD 1AYFA 3DOWA 2M56B 4W9HA 1SF0A 1JWBD 3HM3A 2VZKB 2JPHA 1MI0A 4OHJA 1C4AA 1Z2MA 2MQJA 2ZCCA 3RNBC 5BMIA 4W9CA 3P4QB 3V62A 2LMCA 1IPGA 1UWMA 2QIEB 2IO1B 2L7RA 2N4FA 4RNAA 2KWCA 3UI3A 4NJCA 3E56A 4ZOHC 3W2DA 2L0FA 1WI0A 2GOWA 1HE8A 1J7AA 1TS4A 4WURA 1KM7A 2I2YA 3A33B 2DYBA 1KFYB 3T9LA 3RNEC 2LUMA 2EMSA 2PTLA 1E9MA 1MPEA 3NUHB 2JSVX 3MHZA 3DBLI 3I5JC 1N60A 2DYOA 4YTMB 2HE7A 5E6OA 1FXIA 4HPLB 5EE3A 3BVMA 2NPTB 1RFAA 2B76B 3WA0A 3ZGZA 2WHIA 2XEWA 2JZZA 3NS1A 3BY4B 5G2NA 3SEBA 3W5VB 1L0YB 2L8JA 2OHFA 2AL6A 5EE0A 3L17A 3VQIA 1UBQA 4ZHPA 1I7HA 4MELA 1IP9A 1WJUA 1SB3C 3WAOA 4PS3A 3PZ7A 5D2MB 2KZRA 3DPDA 1V80A 3VUYA 3B2FA 1CMXB 3A9JB 2QILA 1TTNA 2N9KA 3AN1A 1Q0WB 1WH3A 3HRDD 3UGBB 3VFKA 5LNK1 3ZUNA 1F77A 4LTUA 1YIWA 4J3OD 4RGMA 5FR3A 1P0RA 4AWJA 3LYYA 2N0SB 4M8NA 2AQ3B 2L00B 3DWMA 4JX1C 2LJIA 3HVDA 1QLBB 3ECIA 1AARA 3WIMA 4WWNA 1EU3A 4PK1A 3L13A 5BO4B 4P7IA 3KQ4A 2V4IB 2MLBA 5G5GA 4ASWC 4KZCA 5HG2A 2IO0B 3BVZA 2KHWB 1FO4A 5LXIB 1TKEA 4MM3B 2NS5A 3A4SC 4DXGA 2KTRB 3VH3B 1JWAD 4MACA 3QWZB 4MGKE 2H89B 2MBQA 2FCSA 4C4VA 4KGTA 4O1NA 3ZQ4A 1IGCA 3PVLA 2C7MB 3DHIC 1T0RC 2X38A 2JT4B 2AL3A 3Q69A 2KX0A 1UUPA 2JRHA 4DK5A 5IO9A 4HCPB 1RWSA 4W9JA 3OG5A 1PGBA 2CR5A 3VTWA 4RGOS 2LD9A 3RYTA 2VH2A 1D3ZA 2MW5A 4A90A 1H4RA 3PGEA 4XWWA 5FKAC 2FBWB 4HEA1 2RSUA 2K8HA 4WWMA 3MJWA 1SE4A 4AJWA 1C76A 2WXPA 2BS3B 3GOEA 3DWGC 3PZ8A 3QCAA 1PUTA 1E8WA 1HTOA 5JHAA 3PRPB 1JROA 2MCNB 2KXJA 4WAAA 3ZDTA 1V1PB 5EDSA 2GB1A 5EE1A 1WJ6A 1XXGA 5BYSA 4OZBA 1V6EA 2MHJA 3RMKC 5BMHA 4RM9A 3RZFA 1RYJA 2R61A 2D2QA 2L0TA 3GB1A 2JWUA 1TT5B 2JZ3B 1F2RI 4HJKA 4S0RA 1FRRA 3SU8X 2GBRA 1H8CA 1FNVA 1V81A 1FMAD 2WYQA 4AUQC 3IXSA 3BWUD 1R7SA 3ZNZB 4II2B 1L6UA 3DHHC 2PLPA 3R2TA 1IBXB 2RDGA 4LCDE 1NBFC 3D32A 1NVID 3AE2B 2EELA 3P4PB 3X23A 1K51A 3ZKJC 4A8XC 3BYYB 3QARA 1VR9A 1ZUD2 2JQRB 2HJ8A 2MWSB 3KUCB 4WIPA 2J7QB 4DHJD 2KMMA 2DENB 2KQ7A 1ZKHA 2QHOA 4W9DA 1WX7A 1YQBA 3NS8A 2RDHA 3U4EG 5HKHA 3MJ5A 2NPTA 4PS7A 1ZXHA 2K39A 1EWCA 2FNJB 4DDGD 4QAYA 4KSKC 4LNOA 3A9KB 2JYTA 1I4PA 1VDVA 2MBBB 3DBRB 3NG0A 2WGSA 2A5UA 2V3NA 3N20C 3ZXRA 2WLBA 3A1QB 1MG4A 1STEA 5EE9A 1A5RA 3AXCA 4DDID 1DOYA 3W1YA 3H6NA 3I63C 1WJNA 1E5WA 4P16A 4HROA 3GZNI 2MEKA 2I1JA 1VRAB 4TV3A 2PIAA 3A9JA 3K9OB 4E71A 4GOCA 5D3DA 1TYGB 4A20A 5KHOA 3UF8A 1JALA 3DVNU 2LJ5A 3PO0A 3DCGA 3ETRA 2LXAA 1I42A 3CIRB 2KD0A 4YL8A 1PGAA 2J4XA 3SD5A 2PEAA 2ZPNA 5FK9C 3APCA 1WMHB 1AN8A 1QOAA 1YOVB 4II3B 2ICIA 3LXFA 4BAXA 1R4NI 3B9JA 2WNMA 1EWYC 2KWDA 1SIJA 2DAFA 4HJGE 1FXAA 2WS3B 1WRDB 3JVZX 4C7YA 3IT6B 2BYFA 4MM3A 3N3KB 3VUWA 2KTRA 4FLHA 3DBHB 3M62B 4HDOA 4KKJA 4N58A 2DHZA 4L1BA 3ZNGC 2K5PA 4ZRKA 4ZRJA 1YD8U 4GMVA 1YJIA 4YTNB 1N5XA 1YN4A 5GXGB 4ZYNA 3PHWB 2CU3A 3BK2A 4IW0A 3PT2B 4E74A 1GJZA 2J42A 4KGSA 3RPFC 2BT6A 3AEFB 3W9CB 3QK0A 1ZXIA 2KVZA 2IGDA 3KVFB 4MGZE 3EC8A 2RMMA 1SGHA 1L5PA 1YX6B 5CX3A 2DZJA 4N9F4 3QC8B 4FN2A 4ACFA 1RLFA 1ZGUB 4RGNA 2KJ6A 2IDYA 5IP4D 5HHDG 3V6EB 1ZP0B 4WQOB 3AI5A 2QEJC 4XX5A 4I6PA 1WR6E 1K50A 2FIDA 4FULA 2NR2A 2MP2B 1V1PA 4WJPA 3C19A 1M94A 3I9V1 4KZ0A 3DHGC 3M63B 1F2RC 2JRIB 4D2KA 1VLBA 3NZSA 2Z0DB 2YVCA 1WIAA 4LJPB 3AE4B 3U52E 2KOXA 1LM8B 4MH0E 1ZPSA 3HIZA 2BQQA 2LGDA 4B0MA 1JWMD 1OQRA 2WXLA 3AE5B 2JWZA 1VZ8A 5G55A 1ISNA 4TSSA 1QT9A 2KFJA 3VHTC 5CHFA 1F9JA 3TMPB 2D07B 3NVWA 2BS2B 5JZEB 3AE8B 3AECB 3PLVA 4IM2A 2BGFA 2KN4A 2DX5B 1IBXA 1E8YA 1C1YB 2ON8A 3VXWA 3R66C 2K8CA 4KVGB 3W1SC 4RGTA 1XO3A 2PJHA 2MRPA 4BKSD 1RFKA 1ENFA 2W9NA 3CF6E 3WAMA 4HKZE 2DZMA 2G9HD 3PTFC 4IOIE 2M0XA 2G45B 5J18A 4IC7B 1WX8A 3GE3C 3NOBA 4B95A 1WGHA 2ZJDA 2LWPA 4UDUC 2FAZA 3PHXB 1EF1A 2DYMA 4HKQA 2LRUA 2O6VB 1CQVA 1HEZE 2WP9B 2SEBD 3SR6A 4ZHOA 5AZHA 4CO7A 2ZZPB 4GB9A 4NJ7A 3AU5A 3A9KA 1FFVA 2K8BA 3P42A 3P4RB 2GLSA 3A1QA 1OFFA 3ZTDA 2BYVE 3OJ3A 2W3RA 4B6WA 4MSQB 2EKIA 2IJ0A 3AH7A 2VH1A 1QQRA 3H8HA 4US8A 2W3SA 1CK1A 4FA6A 3IT4B 2W82A 1V5TA 5J17A 1YN3A 1E7UA 2K3UA 1WXAA 3VR9B 3C0RB 2INNE 4RF0A 1E0ZA 4MH8A 1HZ6A 1L0XB 2NBUA 2KDFB 3OWEB 2KDMA 4A9AA 2CHWA 3LJ3A 1WXVA 2BWES 1Y8RC 4PYZA 3TEXA 3RUIB 4KIKB 2GMIC 3B2GA 3UINB 3ZLZA 5HFYA 4DHZB 2R2OA 1WMHA 2J0JA 3M3JA 4A3OA 1K53A 4WAFA 3TUOA 1U4AA 5T8IA 1IGDA 2Q5WD 3PPAA 2DNFA 2DZIA 4NY0A 5AZFA 4WH4A 3MFGA 1E8ZA 3RNCC 4WWPA 4X57B 4MEMA 5TSSA 5D3IB 4EE2A 2MH7A 3PRZA 3NVYA 2FCNA 1ET6A 2JXXA 3Q14C 2IBIB 3AE3B 2GBMA 3O65B 4BZAA 1JW9D 1GC6A 2PVGC 2AYOB 1KLGD 2KQSA 1ACCA 2LVPA 1GPXA 3GP7A 5C3JB 3N1YC 2E3TA 3U30A 2JU6X 4XWTA 2JZPA 2LHEA 2K9XA 4MGYE 4E3CA 3MTNB 2K1FA 2KLCA 3BYTB 3ZXVA 4FBJB 1HZ5A 2MX2A 3K9PB 3CSFA 5E6JA 3ZNHB 2L1AA 3H1UA 3L54A 1GB1A 2QMTA 4YT0B 1C77A 4BBNF 3ALBA 3FC4A 2KDBA 2WU2B 4EEWA 2WQYB 1KTKA 2KNBA 2LGSA 2M8SA 1TKGA 2AWTA 2LI5A 4EOYA 5D6JB 1WYGA 1C79A 4ANUA 1PQSA 2QJLA 4DQOC 4XGAB 2IPKD 4W9GA 4BOSC 2ZW0A 3EA6A 3SDLC 2LVQA 1GAQB 1T0SC 1TY0A 2EMTA 2MP2A 1YQ3B 3EFCA 1VJKA 2C9WB 5L95C 3ZDMC 2V1YA 1SSNA 3V60A 1C9FA 5IAAC 2WDQB 1N62A 3ENEA 1E8XA 3RULA 2ONQA 1FNUA 4KV2A 3Q3JA 4ANVA 1FCCC 1WY8A 2LUEA 1OEYA 3KW5B 4BKTA 5E6PA 1WGGA 3MHSD 1WGDA 2QCZA 3PV1A 4G3XB 1WWTA 4HPMB 1PFDA 1UBIA 1KLUD 1XF5L 2I38A 1NI2A 1SBBB 4PYUA 4KGRA 5AUKA 2OOBB 1D6EC 4C56C 2OJRA 2NVUI 4ARIA 4XZ4A 2KC1A 2BYEA 1RAXA 1KJTA 4KDLB 2INPE 3AB5A 3BZDB 4C7ZA 2WXHA 3ZVVA 4RM8A 2Z8LA 3WANA 3RI7C 2KT7A 1S1QB 3LDZE 4HDQA 4A55A 3N30A 1ZOYB 1Q10A 5DCNA 4LDTB 2V9HA 4RF1A 2KFKB 1V49A 2MBHA 3U8ZA 1R4MB 4KDIC 3Q8CA 2WX1A 4HCNB 3W5UB 3JW0X 1J8CA 2D3CA 1UGMA 5JH5C 2N7DA 1JWSD 3MC9A 4K7WA 3WALA 2TSSA 1JRPA 2O6VA 2V0GA 1MHHE 3BK1A 1YN5A 4NAMA 2WXIA 4W9EA 4TQ1A 5IKCM 3H7PB 3VAWA 1KH0A 2YLMA 3T3OA 4GXBA 4IWQA 2IO2B 2LXCA 2VRRB 2MBEA 2ZW1A 4DXAB 3EECA 2C7NB 2FCMA 1WM2A 3Q3MC 2DAJA 3DBRI 1LXDA 3IHPC 4J6IA 1AW7A 2OEDA 2WXGA 4FJVB 2PVOD 1TBEA 4ZRPA 4NQKE 4HRSA 2AQ2B 4JWUC 1GNUA 2Z59B 3V6CB 4BFRA 4W9KA 1T3QA 2KKCA 3B1LX 1L2NA 5TR5A 4ITKA 4KIKA 3QQ8B 3I3TB 1WGYA 3ZO5B 4GU2A 2QSDA 3S2AA 4FHJA 4CHKA 5D94A 3TJPA 2XBBC 2N7JA 3T8MA 2N1WA 3TEZA 1FRDA 2J0KA 4GLSC 3Q2AC 3EGRA 1IUEA 2JXTA 3LB8C 1UWXA 1TZOA 3L08A 2J0MA 2BTEA 4BKGA 4DXFA 1OQYA 3P63A 4F1SA 1DGJA 1UELA 2Y5BB 2IYDB 2MJEA 1QILA 2VZKD 2LGYA 5C23A 4EZJA 3DVGY 3ZRFA 2PMVA 1AWDA 2M1MA 1N5WA 1EM7A 3N1XC 4WJNA 2KJHB 1Q1OA 3EUB2 3NHEB 1V9JA 1LFDA 2BVCA 3DVGX 3DBHI 4LNIA 2ZVNA 3HVZA 3Q8EA 1E6EB 2BKFA 2JX5A 2HTHA 3QIJA 4URKA 2PE9A 2WDVB 3VDZA 1N63A 1EUVB 4YSZB 2G1EA 2NBWB 1NI3A 3L0WB 1F52A 1T5XD 1WGRA 5IOIA 2XNAC 3L4PA 1G6JA 2C60A 2KMCA 1UH6A 4IDIA 3KWVA 4M0WB 3U7DA 2N9XA 2N9PC 2K22A 5FR6A 1SJED 1XCTL 1SXTA 4OZAA 4F8CB 3HUIA 1D5MC 4HLEA 1X1MA 4NAWB 1L4ZB 1YMHE 3V61A 3TBLD 1WXMA 2V3SA 4G50A 3V05A 3RD2A 2BKRB 4ANWA 2KWUB 3AEEB 1OEYJ 1I4GA 2LVOA 4KKIA 3A4RA 3U7ZA 2FIFA 3L16A 4HVBA 4N6EB 3UQBA 2C7HA 1D4BA 1P1AA 2X8XX 1VZ7A 2CJOA 1D5XC 1XQQA 2ZCBA 1J7BA 2MA9B 2N9LA 2I1KA 2WXMA 1SE9A 3RNGC
chains in the Genus database with same CATH topology
2W3SA 1UUPA 1CK1A 3IT4B 2W82A 1YN3A 4JWSC 4LK0M 1M4VA 2K3UA 2W55A 1QOGA 3CWIA 3VR9B 1E7PB 2INNE 4RF0A 1RWSA 1HA5A 3TEYA 1E0ZA 4MH8A 1HZ6A 1PGBA 1L0XB 4RGOS 3OWEB 2KDMA 3NRZA 4A9AA 1SEBD 2PW9A 4PT5A 4A90A 1EU4A 2LGIA 4H2AA 5BYQA 2YEPB 5FKAC 1DOIA 2DLBA 3TEXA 4OZCA 4XWWA 1TS5A 2FBWB 4HEA1 2KACA 3B2GA 3AEAB 3O13A 5HFYA 1QOBA 4WWMA 1SE4A 1C76A 1K53A 1XEEA 2WXPA 2BS3B 3SFDB 4WAFA 3DWGC 3PZ8A 3TUOA 1PUTA 5T8IA 1IGDA 2Q5WD 3MP9A 2HDEA 3P1MA 4AQ7A 1JROA 3AEBB 1TY2A 1L4DB 1MHXA 2XN9C 4WH4A 3MFGA 1V1PB 2BS4B 2PKOA 2GB1A 1NYRA 2MJ3A 3ABVB 1TS2A 5TSSA 5EE1A 5D3IB 4EE2A 1XXGA 3KWLA 5BYSA 2MH7A 2ACZB 1I4QA 2MJDA 3NVYA 1ET6A 3IAS1 1YNTE 4OZBA 4YSYB 1NYQA 2NTSA 3AE3B 2WXOA 5BMGA 4Q2JA 2FE8A 1JW9D 4TQ0A 5BMHA 2PVGC 5HI1A 1KLGD 1RYJA 2R61A 5D7GA 1ACCA 1GPXA 3GP7A 5C3JB 1FIQA 2E3TA 3TSSA 2JU6X 3GB1A 4XWTA 2JZPA 5BYRA 2JWUA 1JCKB 2K9XA 2LHEA 4JE3B 4R3DA 1UGJA 1F2RI 1FD6A 1WXQA 1FRRA 2D5GA 3BYTB 3GS2A 1ZDXA 4RH6A 2DBYA 1HZ5A 5E6JA 1CZPA 1FNVA 2L1AA 1YQ4B 1FMAD 3IXSA 3V3XA 3BWUD 1GB1A 1R7SA 2QMTA 1L6UA 4YT0B 2PLPA 3R2TA 3BVGA 4N59A 1C77A 1IBXB 2RDGA 3FC4A 4LLGM 1SE3A 1NVID 2WU2B 3AE2B 2J52A 1I4XA 2EELA 1QKZA 1NENB 2WQYB 2KAJA 1GOZA 3P4PB 1JWUD 1K51A 1KTKA 4A8XC 3Q8AA 3BYYB 2Y5PA 1TKGA 2WXJA 4NZLB 4B0EA 1VR9A 1ZUD2 1UNSA 3C8YA 2JQRB 1E10A 3ZJUA 1WYGA 2L52A 2V3PA 4TMAB 2AQ1B 1C79A 1GB4A 2QJLA 4DQOC 4WIPA 1A70A 2DWQA 2IPKD 3SFEB 2ZW0A 3EA6A 2KMMA 1GAQB 1TY0A 1B9RA 3ZYYX 2WXNA 1HQRD 1I4RA 3N9YC 2NTTA 1YQ3B 3VR8B 1NEKB 1FFUA 1VJKA 2K0PA 1SSNA 2RDHA 3U4EG 1B1ZA 3MJ5A 3FILA 1C9FA 4IKGA 2BB5A 1FCLA 5AUIA 2WDQB 3R8BA 1FNWA 1N62A 3W1SA 3FAHA 1ZXHA 2ONQA 4XE0A 1FNUA 1EWCA 3NVZA 2H88B 1FCCC 1XCQL 1V97A 3J9CA 2JYTA 1KF6B 2J53A 3R2IA 1I4PA 1VDVA 2V3NA 1CJEA 1WWTA 1PFDA 2WLBA 3AEDB 4L23A 4XDCA 1KLUD 1XF5L 1STEA 5EE9A 4AS1A 2I38A 3ZJVA 1SBBB 1DOYA 4KGRA 2LFIA 5AUKA 1D6EC 4USAA 2W54A 4P16A 3AMZA 4HROA 4C56C 1WGKA 2WXFA 4ARIA 2MEKA 3ZJTA 1VRAB 2PIAA 2INPE 2WDRB 3AB5A 3BZDB 3AE1B 4KX6B 4C7ZA 2WXHA 5D3DA 1K52A 2Z8LA 1TYGB 4YXDB 2JYEA 1JALA 3MC0B 3PO0A 4ZYSA 1XLNA 1L0VB 3ETRA 4JPSA 2SAKA 4GDLB 4A55A 1F0ZA 2L83A 1ZOYB 2IGHA 1Q10A 2L32A 3CIRB 1PGAA 2J4XA 4RF1A 3VRBB 3KLSX 3AV8A 1BXTA 4M0WA 3Q8CA 1ESFA 5FK9C 1AN8A 3W5UB 1QOAA 3WCQA 4A6QA 1C78A 2ICIA 3LXFA 1L6VA 3P4SB 4FXCA 1C4CA 3B9JA 1JWSD 1WRIA 2WNMA 1EWYC 2AX5A 2TSSA 1JRPA 1SIJA 2KWDA 4HJGE 4CQNA 1FXAA 2WS3B 3AE6B 2V0GA 1MHHE 3BK1A 2LHDA 1YN5A 4C7YA 1PDXA 4NAMA 3IT6B 4WQMA 2WXIA 4TQ1A 1HXYD 5G5HA 3Q8FA 1OQQA 2KQ4X 1LO5D 1V1OA 2E6XA 1DYQA 3AE7B 1FEHA 4L2YA 3URYA 4KKJA 4N58A 1VZ6A 1KH0A 3AEGB 2WXKA 4L1BA 2K5PA 3T3OA 2FUG1 3VRAB 2CJNA 3U2SC 1YJIA 1MVKA 4YTNB 1YJJA 2ZW1A 1N5XA 1YN4A 5GXGB 1AYFA 2M56B 1SF0A 1QOFA 2CU3A 1JWBD 3BK2A 1RM6C 4REZA 2VZKB 2J42A 4KGSA 3RPFC 2BT6A 3AEFB 1MI0A 4OHJA 1WSPA 4ARCA 3W9CB 1AW7A 1C4AA 2OEDA 2WXGA 1ZXIA 2PVOD 4OVZA 5BMIA 4ZRPA 2IGGA 2IGDA 3P4QB 2LMCA 1UWMA 1BMLC 2QIEB 4HRSA 2AQ2B 2M19A 2RMMA 4JWUC 1Y56A 1TKYA 1L5PA 1T3QA 2BYTA 4RNAA 4ITKA 3UI3A 4XDDA 2BBCA 4NJCA 3E56A 4ZOHC 4RGNA 3W2DA 2IDYA 1TJEA 2QSDA 1D5ZC 1P7EA 1J7AA 1TS4A 4ZRQA 5HHDG 4WURA 2I2YA 1ZP0B 1SJHD 2N7JA 3T3NA 1J7CA 1KFYB 2QEJC 2LUMA 3TEZA 1FRDA 2PTLA 1E9MA 3NVVA 1MPEA 1I4HA 1K50A 3NUHB 4GLSC 3EGRA 1T6BX 1IUEA 2JXTA 3NZ3A 1TS3A 2JSVX 3Q8BA 3LB8C 1UWXA 1TZOA 4YWGG 3RFZB 3MHZA 1V1PA 3AM9A 2BTEA 1N60A 1XLQA 3I9V1 2DYOA 4GDKB 4YTMB 1F2RC 4RFBA 4D2KA 3I57A 1VLBA 4DXFA 3P63A 3FILB 1DGJA 1FXIA 5EE3A 3BVMA 2MJEA 3AE4B 2B76B 3U52E 5I4DA 2WU5B 2HTME 1QILA 2VZKD 4MT5A 3ZGZA 1ZPSA 3NS1A 1ZDVA 1ET9A 2PMVA 1PYWD 2GRIA 3SEBA 1AWDA 1N5WA 3W5VB 1L0YB 4B0MA 1JWMD 1EM7A 1OQRA 2OHFA 2WXLA 3AE5B 1VZ8A 1KRHA 3E9SA 2GI9A 5EE0A 3EUB2 4TSSA 1QT9A 3VQIA 4ZHPA 1I7HA 5MPOA 2LEKA 1SB3C 3HVZA 3Q8EA 3PZ7A 1E6EB 3B2FA 2JX5A 1ROEA 2BS2B 3NVWA 3AE8B 3AECB 5H92C 2BW2A 2QILA 1JMLA 2WDVB 2KN4A 2N9KA 1N63A 1IBXA 3AN1A 4YSZB 2ON8A 2G1EA 2BB6A 3HRDD 5LNK1 1NI3A 1T5XD 4RGTA 1XO3A 1F77A 4LTUA 4RGMA 4J3OD 5FR3A 2RPVA 3BIID 1RFKA 1ENFA 2XNAC 5C2TB 4US9A 1PGXA 3LYYA 3L4PA 2N0SB 2AQ3B 3DWMA 4JX1C 4IDIA 2LJIA 3KWVA 4HKZE 3HVDA 1QLBB 2G9HD 4IOIE 3AE9B 5H8YE 3TEWA 2WXQA 1EU3A 2K22A 1SJED 1XCTL 1JQ4A 1ZE3D 1SXTA 1XLOA 4OZAA 4RCOA 3KQ4A 2V4IB 3HUIA 1C4PA 5G5GA 4UDUC 1D5MC 2YEPF 2DYMA 4YSXB 4HKQA 5HG2A 4C80A 1CQVA 4NAWB 1HEZE 3BVZA 1L4ZB 1YMHE 2WP9B 1FO4A 2SEBD 3SR6A 4ZHOA 1TKEA 3V05A 2M0AA 4MM3B 5JXVA 1SE2A 1P7FA 3AEEB 4DXGA 1I4GA 1JWAD 2WXRA 2Y5CA 4KKIA 4MACA 4YTPB 2H89B 1FFVA 3U7ZA 1N61A 1FM0D 4N6EB 1DOXA 4KGTA 3IAM1 4O1NA 3ZQ4A 3P42A 1IGCA 1D4BA 3P4RB 4OW0A 4P6VF 1XLPA 1OFFA 1V8CA 1VZ7A 2CJOA 2X38A 1D5XC 2W3RA 3Q69A 2EKIA 2Y3AA 1J7BA 2IJ0A 3AH7A 2N9LA 2NMQA 1BUIC 1QQRA 1QF6A 2WXMA 3H8HA 4US8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J52 A;  2EEL A;  1QKZ A;  1K51 A;  2KWD A;  4HJG E;  1MHH E;  2LHD A;  1HZ6 A;  1EM7 A;  1PGB A;  1GB4 A;  2KDM A;  2GI9 A;  2KQ4 X;  2ZW0 A;  2PW9 A;  2LGI A;  4OZC A;  1KH0 A;  2K0P A;  2KAC A;  1JML A;  5HFY A;  2KN4 A;  3FIL A;  2N9K A;  1C9F A;  1K53 A;  4IKG A;  1IBX A;  1FCL A;  2ON8 A;  1MVK A;  1ZXH A;  2ZW1 A;  2ONQ A;  1IGD A;  3MP9 A;  1FCC C;  1XCQ L;  2RPV A;  2J53 A;  1MHX A;  4WH4 A;  4KGS A;  1PGX A;  1MI0 A;  2OED A;  4HKZ E;  1XF5 L;  2GB1 A;  4IOI E;  5BMI A;  2I38 A;  2IGG A;  2IGD A;  1XCT L;  4KGR A;  4OZB A;  4OZA A;  2RMM A;  1YNT E;  5BMG A;  3UI3 A;  5BMH A;  5HI1 A;  5HG2 A;  1HEZ E;  2QSD A;  1YMH E;  1K52 A;  1P7E A;  5HHD G;  2I2Y A;  2N7J A;  5JXV A;  2JU6 X;  1P7F A;  2LUM A;  3GB1 A;  2PTL A;  1MPE A;  2JZP A;  2JWU A;  1K50 A;  4GLS C;  4MAC A;  2LHE A;  1F2R I;  2JXT A;  2JSV X;  1FD6 A;  2IGH A;  1Q10 A;  1UWX A;  4KGT A;  1HZ5 A;  1IGC A;  1PGA A;  1D4B A;  3V3X A;  1GB1 A;  2QMT A;  1F2R C;  4D2K A;  2PLP A;  3FIL B;  1IBX B;  2N9L A;  2NMQ A; 
#chains in the Genus database with same CATH topology
 4M01 A;  1P9D U;  2DZK A;  4JWS C;  4RMA A;  1YJ1 A;  1MG8 A;  1M4V A;  1OTR B;  2W55 A;  1QOG A;  1HA5 A;  3TEY A;  1LGR A;  2M4N A;  1SEB D;  2PW9 A;  4PT5 A;  3DBS A;  2WX0 A;  5CTR C;  1KOT A;  4EFO A;  4H2A A;  2YEP B;  1DOI A;  2DLB A;  4OZC A;  1TS5 A;  2KFK A;  3AUL A;  2KAC A;  2N9E B;  3O13 A;  3KYC D;  1C3T A;  1XEE A;  3KYD D;  3SFD B;  2A4Z A;  1T0Y A;  2HDE A;  4AQ7 A;  2UYZ B;  4FAD A;  3M95 A;  1L4D B;  1MHX A;  2ZNV C;  2JF5 A;  1WYW B;  4ICV A;  4W9F A;  1K8R B;  3GE8 C;  1IYF A;  4MJS B;  2GBN A;  2PKO A;  2MJ3 A;  4DBG A;  3KWL A;  5CHW A;  3IAS 1;  1YNT E;  4YSY B;  1NYQ A;  2NTS A;  3H7P A;  5BMG A;  4ANX A;  4DHJ B;  3ZIM A;  2IO3 B;  1TGZ B;  4TQ0 A;  1Q5W B;  5HI1 A;  1OGW A;  2KX3 A;  3OAW A;  3ONS A;  1FIQ A;  5CHV C;  3TSS A;  1Z5S B;  3P2B A;  5BYR A;  4HXD A;  1UGJ A;  1FD6 A;  4NPN A;  1WXQ A;  3CMM B;  2D5G A;  2DBY A;  3TCA A;  1CZP A;  2Z0E B;  3V3X A;  4CYE A;  2HJ1 A;  2MBO A;  4K7S A;  4LLG M;  1SE3 A;  1MJD A;  3CST A;  2J52 A;  2JVC A;  1JWU D;  2RPQ A;  2BWF A;  3OLM D;  3Q8A A;  4NZL B;  2WXJ A;  2INC C;  5GMV A;  1FPY A;  5DPR A;  1E10 A;  3ZJU A;  2L52 A;  2N7E A;  1A70 A;  3SFE B;  4EUT A;  4K1R B;  4TKN A;  1B9R A;  1HQR D;  3N9Y C;  2MSE D;  3PS6 A;  1NEK B;  1FFU A;  2K0P A;  3N1Z C;  2LGX A;  1B1Z A;  5E6N A;  1V5O A;  3W1S A;  3FAH A;  1WE6 A;  2KC2 A;  2H88 B;  3VTU A;  3QJZ A;  1V97 A;  2NCN A;  3RZW C;  2J53 A;  3R2I A;  4MSM B;  3H7S A;  2G4S A;  3AED B;  4XDC A;  4AS1 A;  1N6Z A;  5DPW A;  2LFI A;  2REX A;  2W54 A;  3HK0 A;  3NJT A;  3HHM A;  3IBE A;  3SHQ A;  4GIV A;  3TIX A;  1GC7 A;  2WDR B;  3UIP B;  3AE1 B;  4KX6 B;  4YXD B;  2JYE A;  1GG3 A;  3RNA C;  1L0V B;  5DPT A;  4IWO A;  4AJY B;  2KN5 A;  1QZE A;  2SAK A;  4GDL B;  2K6Q A;  2BPS A;  4OVV A;  3DBL B;  2L32 A;  4JQW C;  3KLS X;  3ML9 A;  3AV8 A;  3VTV A;  1BT0 A;  2PPH A;  3L10 B;  1ESF A;  4M0W A;  2CS4 A;  4A6Q A;  1V86 A;  1C78 A;  1L6V A;  1WFY A;  3KUD B;  4NAW A;  2LHD A;  1WJ4 A;  3BIN A;  4WQM A;  4MGI E;  4KSL C;  3DDC B;  2CU1 A;  2KQ4 X;  3HM6 X;  1V1O A;  2E6X A;  3OJ4 B;  4L2Y A;  3URY A;  2GBK A;  2WXK A;  2FUG 1;  2AEH A;  3VRA B;  2CJN A;  1GUA B;  1MFW A;  3QAQ A;  1MVK A;  1YJJ A;  3DQV A;  2V4L A;  1QOF A;  1YX5 B;  4GGQ A;  3ZRC A;  1RM6 C;  4REZ A;  2ZPY A;  2KJR A;  1WSP A;  4ARC A;  4ZRI A;  4WJQ A;  3UIO B;  4MDK E;  4OVZ A;  4BVU C;  4PS8 A;  2IGG A;  3PLU A;  1BML C;  3R3M A;  2M19 A;  3PZD A;  2IY1 B;  1I35 A;  4IUM B;  5LXH A;  1Y56 A;  1TKY A;  4I6L B;  2BYT A;  3NZU A;  4XDD A;  2BBC A;  1WXS A;  1L7Y A;  2KLG A;  1TJE A;  1D5Z C;  1P7E A;  4ZRQ A;  1JRU A;  1SJH D;  3VH4 B;  2G3Q B;  3T3N A;  1J7C A;  4IM3 A;  3MC8 A;  2JY6 A;  3NVV A;  3ZNI D;  1I4H A;  5LLI A;  1T6B X;  3NZ3 A;  3B0A A;  4A3P A;  1TS3 A;  3Q8B A;  4YWG G;  3RFZ B;  3R7R A;  3AM9 A;  1P3Q U;  3EHV A;  1XLQ A;  2D11 A;  4MJS A;  4GDK B;  2K6D B;  4IWP A;  4RFB A;  3I57 A;  3FIL B;  1R4M I;  2KAN A;  5KHQ A;  2KTF A;  4I6N B;  5I4D A;  1WX9 A;  2KO3 A;  2WU5 B;  4JL9 A;  2HTM E;  4MT5 A;  4C00 A;  3QA8 A;  1EO6 A;  1ZDV A;  2KDE B;  1ET9 A;  2KDI A;  1PYW D;  2GRI A;  2LRW A;  1KRH A;  2RGF A;  2GI9 A;  3E9S A;  4EZK A;  2HD5 B;  4LNN A;  5MPO A;  2LEK A;  4K3C A;  2L76 A;  1E7V A;  1ROE A;  5H92 C;  1KLV A;  2O2V B;  2WWZ A;  2BW2 A;  1JML A;  2JUO A;  4IG7 B;  3AU4 A;  2BB6 A;  2ZVO A;  3R7Q A;  3IVF A;  3JSV B;  3VVW B;  2XK5 B;  2KMA A;  2B3A A;  2RPV A;  1NDD A;  3BII D;  2EKE C;  5C2T B;  4US9 A;  1PGX A;  2CHX A;  3EFU A;  2D3A A;  1E90 A;  3AE9 B;  5H8Y E;  3TEW A;  4WJO A;  2WXQ A;  4ZDV A;  1JQ4 A;  5IN7 A;  1ZE3 D;  2OJW A;  1XLO A;  4AP4 C;  3RNF C;  3B08 A;  3WAP A;  4RCO A;  1C4P A;  2YEP F;  4K3B A;  2D3G A;  4YSX B;  4C80 A;  4W9L A;  5L83 A;  2M0A A;  2LAS A;  5JXV A;  1SE2 A;  2R2Q A;  1P7F A;  4K81 A;  3DVN V;  1UD7 A;  2CKH B;  2WXR A;  2Y5C A;  4F7Z A;  4S17 A;  4YTP B;  1N61 A;  1FM0 D;  1DOX A;  3IAM 1;  4OW0 A;  4P6V F;  1XLP A;  3Q3N C;  1V8C A;  2D3B A;  4AOF A;  2Y3A A;  4FJY A;  2NMQ A;  1BUI C;  1QF6 A;  4GSW A;  2ZNV B;  4LK0 M;  3CWI A;  1E7P B;  4BOZ B;  3PSE B;  1FXT B;  5C1Z A;  4HPP A;  2K25 A;  3NRZ A;  4JLC A;  4GDL A;  1EU4 A;  4P1B C;  2O6V D;  2LGI A;  5BYQ A;  1V2Y A;  2UWQ A;  3AEA B;  1EF5 A;  5AZG A;  4DHZ E;  1QOB A;  1TZ1 A;  4LJO B;  3MP9 A;  2CHZ A;  3P1M A;  4EKU A;  4EZL A;  3AEB B;  1SIF A;  1VD2 A;  1TY2 A;  2WDT B;  4JGH B;  2XN9 C;  3ZW3 A;  1TIF A;  4W9I A;  3TL5 A;  4DWF A;  1WM3 A;  2BS4 B;  1NYR A;  3ABV B;  1TS2 A;  3VUX A;  2L3Z A;  2RD0 A;  4IM0 A;  2ACZ B;  3GZN B;  1I4Q A;  2MJD A;  4M02 A;  2WXO A;  4Q2J A;  2FE8 A;  2IZV B;  3PRE A;  3KH0 A;  3Q6B A;  1T0Q C;  1UF0 A;  5D7G A;  3H9D A;  2QC8 A;  2ZEQ A;  1JCK B;  4JE3 B;  4R3D A;  2ASQ A;  2D10 A;  3Q3O C;  3JYU A;  2FCQ A;  3GS2 A;  1ZDX A;  4FJZ A;  4RH6 A;  3IG3 A;  4XC2 A;  1YQ4 B;  3APD A;  4NQL B;  3RT3 B;  4N59 A;  3BVG A;  3RN9 C;  3QHT A;  4B9K A;  1R4N B;  1WE7 A;  4P1C C;  1I4X A;  1QKZ A;  1NEN B;  2QDF A;  2KAJ A;  1GOZ A;  2Y5P A;  4B0E A;  1UNS A;  2RDB C;  4HWI B;  3C8Y A;  4OVU A;  4FHK A;  2V3P A;  4TMA B;  2AQ1 B;  1WR1 A;  1GB4 A;  2DWQ A;  2FUH B;  3Q3F A;  1J0G A;  1J19 A;  2KWV B;  3ZYY X;  2WXN A;  4JIO U;  1I4R A;  3FKY A;  2NTT A;  4BKS A;  4GDK A;  4WWO A;  3VR8 B;  2M17 A;  2UU7 A;  3FIL A;  4IKG A;  2BB5 A;  1FCL A;  5AUI A;  3R8B A;  1FNW A;  5JHB A;  3UQA A;  4GN1 A;  4XE0 A;  3NVZ A;  1XD3 B;  3QX1 A;  4G0N B;  2KVR A;  1XCQ L;  3J9C A;  1XT9 B;  1KF6 B;  4C4V B;  2N1V A;  3IFW B;  4K7U A;  1CJE A;  4L23 A;  2NBV B;  3ZJV A;  3RCZ A;  4USA A;  1F1H A;  2GBJ A;  3APF A;  3AMZ A;  1WGK A;  2WXF A;  3ZJT A;  4HK2 A;  2O2V A;  4NNJ B;  1K52 A;  1S3S G;  2IY0 B;  1P98 A;  3MC0 B;  4XYC A;  4ZYS A;  1XLN A;  3JSV A;  3PRM B;  1UZX B;  2RR9 A;  1LQB A;  4M00 A;  2XK5 A;  4JPS A;  4NJ6 A;  1F0Z A;  2L83 A;  4G11 A;  4TUU A;  1WZ0 A;  2G4D B;  2IGH A;  2LZ6 A;  4LNF A;  3VRB B;  3KUZ A;  1BXT A;  5AEK B;  4BBN C;  3WCQ A;  1WF9 A;  2IND C;  3P4S B;  4FXC A;  1C4C A;  1ZW7 A;  1WRI A;  2L05 A;  2KYW A;  3NY5 A;  2AX5 A;  4CQN A;  2KK8 A;  3AE6 B;  1WZ3 A;  3N32 A;  4LNK A;  1VCB A;  1PDX A;  2C5L C;  1HTQ A;  2BF8 B;  1HXY D;  5G5H A;  3Q8F A;  4ICU A;  1OQQ A;  5DPS A;  1LO5 D;  1DYQ A;  3AE7 B;  3ML8 A;  1FEH A;  2PE6 B;  3X0W A;  1VZ6 A;  3AEG B;  5IA7 A;  5J2R A;  1RRB A;  3U2S C;  4M8M A;  3ZTC A;  4LDT D;  1AYF A;  3DOW A;  2M56 B;  4W9H A;  1SF0 A;  1JWB D;  3HM3 A;  2VZK B;  2JPH A;  1MI0 A;  4OHJ A;  1C4A A;  1Z2M A;  2MQJ A;  2ZCC A;  3RNB C;  5BMI A;  4W9C A;  3P4Q B;  3V62 A;  2LMC A;  1IPG A;  1UWM A;  2QIE B;  2IO1 B;  2L7R A;  2N4F A;  4RNA A;  2KWC A;  3UI3 A;  4NJC A;  3E56 A;  4ZOH C;  3W2D A;  2L0F A;  1WI0 A;  2GOW A;  1HE8 A;  1J7A A;  1TS4 A;  4WUR A;  1KM7 A;  2I2Y A;  3A33 B;  2DYB A;  1KFY B;  3T9L A;  3RNE C;  2LUM A;  2EMS A;  2PTL A;  1E9M A;  1MPE A;  3NUH B;  2JSV X;  3MHZ A;  3DBL I;  3I5J C;  1N60 A;  2DYO A;  4YTM B;  2HE7 A;  5E6O A;  1FXI A;  4HPL B;  5EE3 A;  3BVM A;  2NPT B;  1RFA A;  2B76 B;  3WA0 A;  3ZGZ A;  2WHI A;  2XEW A;  2JZZ A;  3NS1 A;  3BY4 B;  5G2N A;  3SEB A;  3W5V B;  1L0Y B;  2L8J A;  2OHF A;  2AL6 A;  5EE0 A;  3L17 A;  3VQI A;  1UBQ A;  4ZHP A;  1I7H A;  4MEL A;  1IP9 A;  1WJU A;  1SB3 C;  3WAO A;  4PS3 A;  3PZ7 A;  5D2M B;  2KZR A;  3DPD A;  1V80 A;  3VUY A;  3B2F A;  1CMX B;  3A9J B;  2QIL A;  1TTN A;  2N9K A;  3AN1 A;  1Q0W B;  1WH3 A;  3HRD D;  3UGB B;  3VFK A;  5LNK 1;  3ZUN A;  1F77 A;  4LTU A;  1YIW A;  4J3O D;  4RGM A;  5FR3 A;  1P0R A;  4AWJ A;  3LYY A;  2N0S B;  4M8N A;  2AQ3 B;  2L00 B;  3DWM A;  4JX1 C;  2LJI A;  3HVD A;  1QLB B;  3ECI A;  1AAR A;  3WIM A;  4WWN A;  1EU3 A;  4PK1 A;  3L13 A;  5BO4 B;  4P7I A;  3KQ4 A;  2V4I B;  2MLB A;  5G5G A;  4ASW C;  4KZC A;  5HG2 A;  2IO0 B;  3BVZ A;  2KHW B;  1FO4 A;  5LXI B;  1TKE A;  4MM3 B;  2NS5 A;  3A4S C;  4DXG A;  2KTR B;  3VH3 B;  1JWA D;  4MAC A;  3QWZ B;  4MGK E;  2H89 B;  2MBQ A;  2FCS A;  4C4V A;  4KGT A;  4O1N A;  3ZQ4 A;  1IGC A;  3PVL A;  2C7M B;  3DHI C;  1T0R C;  2X38 A;  2JT4 B;  2AL3 A;  3Q69 A;  2KX0 A;  1UUP A;  2JRH A;  4DK5 A;  5IO9 A;  4HCP B;  1RWS A;  4W9J A;  3OG5 A;  1PGB A;  2CR5 A;  3VTW A;  4RGO S;  2LD9 A;  3RYT A;  2VH2 A;  1D3Z A;  2MW5 A;  4A90 A;  1H4R A;  3PGE A;  4XWW A;  5FKA C;  2FBW B;  4HEA 1;  2RSU A;  2K8H A;  4WWM A;  3MJW A;  1SE4 A;  4AJW A;  1C76 A;  2WXP A;  2BS3 B;  3GOE A;  3DWG C;  3PZ8 A;  3QCA A;  1PUT A;  1E8W A;  1HTO A;  5JHA A;  3PRP B;  1JRO A;  2MCN B;  2KXJ A;  4WAA A;  3ZDT A;  1V1P B;  5EDS A;  2GB1 A;  5EE1 A;  1WJ6 A;  1XXG A;  5BYS A;  4OZB A;  1V6E A;  2MHJ A;  3RMK C;  5BMH A;  4RM9 A;  3RZF A;  1RYJ A;  2R61 A;  2D2Q A;  2L0T A;  3GB1 A;  2JWU A;  1TT5 B;  2JZ3 B;  1F2R I;  4HJK A;  4S0R A;  1FRR A;  3SU8 X;  2GBR A;  1H8C A;  1FNV A;  1V81 A;  1FMA D;  2WYQ A;  4AUQ C;  3IXS A;  3BWU D;  1R7S A;  3ZNZ B;  4II2 B;  1L6U A;  3DHH C;  2PLP A;  3R2T A;  1IBX B;  2RDG A;  4LCD E;  1NBF C;  3D32 A;  1NVI D;  3AE2 B;  2EEL A;  3P4P B;  3X23 A;  1K51 A;  3ZKJ C;  4A8X C;  3BYY B;  3QAR A;  1VR9 A;  1ZUD 2;  2JQR B;  2HJ8 A;  2MWS B;  3KUC B;  4WIP A;  2J7Q B;  4DHJ D;  2KMM A;  2DEN B;  2KQ7 A;  1ZKH A;  2QHO A;  4W9D A;  1WX7 A;  1YQB A;  3NS8 A;  2RDH A;  3U4E G;  5HKH A;  3MJ5 A;  2NPT A;  4PS7 A;  1ZXH A;  2K39 A;  1EWC A;  2FNJ B;  4DDG D;  4QAY A;  4KSK C;  4LNO A;  3A9K B;  2JYT A;  1I4P A;  1VDV A;  2MBB B;  3DBR B;  3NG0 A;  2WGS A;  2A5U A;  2V3N A;  3N20 C;  3ZXR A;  2WLB A;  3A1Q B;  1MG4 A;  1STE A;  5EE9 A;  1A5R A;  3AXC A;  4DDI D;  1DOY A;  3W1Y A;  3H6N A;  3I63 C;  1WJN A;  1E5W A;  4P16 A;  4HRO A;  3GZN I;  2MEK A;  2I1J A;  1VRA B;  4TV3 A;  2PIA A;  3A9J A;  3K9O B;  4E71 A;  4GOC A;  5D3D A;  1TYG B;  4A20 A;  5KHO A;  3UF8 A;  1JAL A;  3DVN U;  2LJ5 A;  3PO0 A;  3DCG A;  3ETR A;  2LXA A;  1I42 A;  3CIR B;  2KD0 A;  4YL8 A;  1PGA A;  2J4X A;  3SD5 A;  2PEA A;  2ZPN A;  5FK9 C;  3APC A;  1WMH B;  1AN8 A;  1QOA A;  1YOV B;  4II3 B;  2ICI A;  3LXF A;  4BAX A;  1R4N I;  3B9J A;  2WNM A;  1EWY C;  2KWD A;  1SIJ A;  2DAF A;  4HJG E;  1FXA A;  2WS3 B;  1WRD B;  3JVZ X;  4C7Y A;  3IT6 B;  2BYF A;  4MM3 A;  3N3K B;  3VUW A;  2KTR A;  4FLH A;  3DBH B;  3M62 B;  4HDO A;  4KKJ A;  4N58 A;  2DHZ A;  4L1B A;  3ZNG C;  2K5P A;  4ZRK A;  4ZRJ A;  1YD8 U;  4GMV A;  1YJI A;  4YTN B;  1N5X A;  1YN4 A;  5GXG B;  4ZYN A;  3PHW B;  2CU3 A;  3BK2 A;  4IW0 A;  3PT2 B;  4E74 A;  1GJZ A;  2J42 A;  4KGS A;  3RPF C;  2BT6 A;  3AEF B;  3W9C B;  3QK0 A;  1ZXI A;  2KVZ A;  2IGD A;  3KVF B;  4MGZ E;  3EC8 A;  2RMM A;  1SGH A;  1L5P A;  1YX6 B;  5CX3 A;  2DZJ A;  4N9F 4;  3QC8 B;  4FN2 A;  4ACF A;  1RLF A;  1ZGU B;  4RGN A;  2KJ6 A;  2IDY A;  5IP4 D;  5HHD G;  3V6E B;  1ZP0 B;  4WQO B;  3AI5 A;  2QEJ C;  4XX5 A;  4I6P A;  1WR6 E;  1K50 A;  2FID A;  4FUL A;  2NR2 A;  2MP2 B;  1V1P A;  4WJP A;  3C19 A;  1M94 A;  3I9V 1;  4KZ0 A;  3DHG C;  3M63 B;  1F2R C;  2JRI B;  4D2K A;  1VLB A;  3NZS A;  2Z0D B;  2YVC A;  1WIA A;  4LJP B;  3AE4 B;  3U52 E;  2KOX A;  1LM8 B;  4MH0 E;  1ZPS A;  3HIZ A;  2BQQ A;  2LGD A;  4B0M A;  1JWM D;  1OQR A;  2WXL A;  3AE5 B;  2JWZ A;  1VZ8 A;  5G55 A;  1ISN A;  4TSS A;  1QT9 A;  2KFJ A;  3VHT C;  5CHF A;  1F9J A;  3TMP B;  2D07 B;  3NVW A;  2BS2 B;  5JZE B;  3AE8 B;  3AEC B;  3PLV A;  4IM2 A;  2BGF A;  2KN4 A;  2DX5 B;  1IBX A;  1E8Y A;  1C1Y B;  2ON8 A;  3VXW A;  3R66 C;  2K8C A;  4KVG B;  3W1S C;  4RGT A;  1XO3 A;  2PJH A;  2MRP A;  4BKS D;  1RFK A;  1ENF A;  2W9N A;  3CF6 E;  3WAM A;  4HKZ E;  2DZM A;  2G9H D;  3PTF C;  4IOI E;  2M0X A;  2G45 B;  5J18 A;  4IC7 B;  1WX8 A;  3GE3 C;  3NOB A;  4B95 A;  1WGH A;  2ZJD A;  2LWP A;  4UDU C;  2FAZ A;  3PHX B;  1EF1 A;  2DYM A;  4HKQ A;  2LRU A;  2O6V B;  1CQV A;  1HEZ E;  2WP9 B;  2SEB D;  3SR6 A;  4ZHO A;  5AZH A;  4CO7 A;  2ZZP B;  4GB9 A;  4NJ7 A;  3AU5 A;  3A9K A;  1FFV A;  2K8B A;  3P42 A;  3P4R B;  2GLS A;  3A1Q A;  1OFF A;  3ZTD A;  2BYV E;  3OJ3 A;  2W3R A;  4B6W A;  4MSQ B;  2EKI A;  2IJ0 A;  3AH7 A;  2VH1 A;  1QQR A;  3H8H A;  4US8 A;  2W3S A;  1CK1 A;  4FA6 A;  3IT4 B;  2W82 A;  1V5T A;  5J17 A;  1YN3 A;  1E7U A;  2K3U A;  1WXA A;  3VR9 B;  3C0R B;  2INN E;  4RF0 A;  1E0Z A;  4MH8 A;  1HZ6 A;  1L0X B;  2NBU A;  2KDF B;  3OWE B;  2KDM A;  4A9A A;  2CHW A;  3LJ3 A;  1WXV A;  2BWE S;  1Y8R C;  4PYZ A;  3TEX A;  3RUI B;  4KIK B;  2GMI C;  3B2G A;  3UIN B;  3ZLZ A;  5HFY A;  4DHZ B;  2R2O A;  1WMH A;  2J0J A;  3M3J A;  4A3O A;  1K53 A;  4WAF A;  3TUO A;  1U4A A;  5T8I A;  1IGD A;  2Q5W D;  3PPA A;  2DNF A;  2DZI A;  4NY0 A;  5AZF A;  4WH4 A;  3MFG A;  1E8Z A;  3RNC C;  4WWP A;  4X57 B;  4MEM A;  5TSS A;  5D3I B;  4EE2 A;  2MH7 A;  3PRZ A;  3NVY A;  2FCN A;  1ET6 A;  2JXX A;  3Q14 C;  2IBI B;  3AE3 B;  2GBM A;  3O65 B;  4BZA A;  1JW9 D;  1GC6 A;  2PVG C;  2AYO B;  1KLG D;  2KQS A;  1ACC A;  2LVP A;  1GPX A;  3GP7 A;  5C3J B;  3N1Y C;  2E3T A;  3U30 A;  2JU6 X;  4XWT A;  2JZP A;  2LHE A;  2K9X A;  4MGY E;  4E3C A;  3MTN B;  2K1F A;  2KLC A;  3BYT B;  3ZXV A;  4FBJ B;  1HZ5 A;  2MX2 A;  3K9P B;  3CSF A;  5E6J A;  3ZNH B;  2L1A A;  3H1U A;  3L54 A;  1GB1 A;  2QMT A;  4YT0 B;  1C77 A;  4BBN F;  3ALB A;  3FC4 A;  2KDB A;  2WU2 B;  4EEW A;  2WQY B;  1KTK A;  2KNB A;  2LGS A;  2M8S A;  1TKG A;  2AWT A;  2LI5 A;  4EOY A;  5D6J B;  1WYG A;  1C79 A;  4ANU A;  1PQS A;  2QJL A;  4DQO C;  4XGA B;  2IPK D;  4W9G A;  4BOS C;  2ZW0 A;  3EA6 A;  3SDL C;  2LVQ A;  1GAQ B;  1T0S C;  1TY0 A;  2EMT A;  2MP2 A;  1YQ3 B;  3EFC A;  1VJK A;  2C9W B;  5L95 C;  3ZDM C;  2V1Y A;  1SSN A;  3V60 A;  1C9F A;  5IAA C;  2WDQ B;  1N62 A;  3ENE A;  1E8X A;  3RUL A;  2ONQ A;  1FNU A;  4KV2 A;  3Q3J A;  4ANV A;  1FCC C;  1WY8 A;  2LUE A;  1OEY A;  3KW5 B;  4BKT A;  5E6P A;  1WGG A;  3MHS D;  1WGD A;  2QCZ A;  3PV1 A;  4G3X B;  1WWT A;  4HPM B;  1PFD A;  1UBI A;  1KLU D;  1XF5 L;  2I38 A;  1NI2 A;  1SBB B;  4PYU A;  4KGR A;  5AUK A;  2OOB B;  1D6E C;  4C56 C;  2OJR A;  2NVU I;  4ARI A;  4XZ4 A;  2KC1 A;  2BYE A;  1RAX A;  1KJT A;  4KDL B;  2INP E;  3AB5 A;  3BZD B;  4C7Z A;  2WXH A;  3ZVV A;  4RM8 A;  2Z8L A;  3WAN A;  3RI7 C;  2KT7 A;  1S1Q B;  3LDZ E;  4HDQ A;  4A55 A;  3N30 A;  1ZOY B;  1Q10 A;  5DCN A;  4LDT B;  2V9H A;  4RF1 A;  2KFK B;  1V49 A;  2MBH A;  3U8Z A;  1R4M B;  4KDI C;  3Q8C A;  2WX1 A;  4HCN B;  3W5U B;  3JW0 X;  1J8C A;  2D3C A;  1UGM A;  5JH5 C;  2N7D A;  1JWS D;  3MC9 A;  4K7W A;  3WAL A;  2TSS A;  1JRP A;  2O6V A;  2V0G A;  1MHH E;  3BK1 A;  1YN5 A;  4NAM A;  2WXI A;  4W9E A;  4TQ1 A;  5IKC M;  3H7P B;  3VAW A;  1KH0 A;  2YLM A;  3T3O A;  4GXB A;  4IWQ A;  2IO2 B;  2LXC A;  2VRR B;  2MBE A;  2ZW1 A;  4DXA B;  3EEC A;  2C7N B;  2FCM A;  1WM2 A;  3Q3M C;  2DAJ A;  3DBR I;  1LXD A;  3IHP C;  4J6I A;  1AW7 A;  2OED A;  2WXG A;  4FJV B;  2PVO D;  1TBE A;  4ZRP A;  4NQK E;  4HRS A;  2AQ2 B;  4JWU C;  1GNU A;  2Z59 B;  3V6C B;  4BFR A;  4W9K A;  1T3Q A;  2KKC A;  3B1L X;  1L2N A;  5TR5 A;  4ITK A;  4KIK A;  3QQ8 B;  3I3T B;  1WGY A;  3ZO5 B;  4GU2 A;  2QSD A;  3S2A A;  4FHJ A;  4CHK A;  5D94 A;  3TJP A;  2XBB C;  2N7J A;  3T8M A;  2N1W A;  3TEZ A;  1FRD A;  2J0K A;  4GLS C;  3Q2A C;  3EGR A;  1IUE A;  2JXT A;  3LB8 C;  1UWX A;  1TZO A;  3L08 A;  2J0M A;  2BTE A;  4BKG A;  4DXF A;  1OQY A;  3P63 A;  4F1S A;  1DGJ A;  1UEL A;  2Y5B B;  2IYD B;  2MJE A;  1QIL A;  2VZK D;  2LGY A;  5C23 A;  4EZJ A;  3DVG Y;  3ZRF A;  2PMV A;  1AWD A;  2M1M A;  1N5W A;  1EM7 A;  3N1X C;  4WJN A;  2KJH B;  1Q1O A;  3EUB 2;  3NHE B;  1V9J A;  1LFD A;  2BVC A;  3DVG X;  3DBH I;  4LNI A;  2ZVN A;  3HVZ A;  3Q8E A;  1E6E B;  2BKF A;  2JX5 A;  2HTH A;  3QIJ A;  4URK A;  2PE9 A;  2WDV B;  3VDZ A;  1N63 A;  1EUV B;  4YSZ B;  2G1E A;  2NBW B;  1NI3 A;  3L0W B;  1F52 A;  1T5X D;  1WGR A;  5IOI A;  2XNA C;  3L4P A;  1G6J A;  2C60 A;  2KMC A;  1UH6 A;  4IDI A;  3KWV A;  4M0W B;  3U7D A;  2N9X A;  2N9P C;  2K22 A;  5FR6 A;  1SJE D;  1XCT L;  1SXT A;  4OZA A;  4F8C B;  3HUI A;  1D5M C;  4HLE A;  1X1M A;  4NAW B;  1L4Z B;  1YMH E;  3V61 A;  3TBL D;  1WXM A;  2V3S A;  4G50 A;  3V05 A;  3RD2 A;  2BKR B;  4ANW A;  2KWU B;  3AEE B;  1OEY J;  1I4G A;  2LVO A;  4KKI A;  3A4R A;  3U7Z A;  2FIF A;  3L16 A;  4HVB A;  4N6E B;  3UQB A;  2C7H A;  1D4B A;  1P1A A;  2X8X X;  1VZ7 A;  2CJO A;  1D5X C;  1XQQ A;  2ZCB A;  1J7B A;  2MA9 B;  2N9L A;  2I1K A;  2WXM A;  1SE9 A;  3RNG C; 
#chains in the Genus database with same CATH homology
 2W3S A;  1UUP A;  1CK1 A;  3IT4 B;  2W82 A;  1YN3 A;  4JWS C;  4LK0 M;  1M4V A;  2K3U A;  2W55 A;  1QOG A;  3CWI A;  3VR9 B;  1E7P B;  2INN E;  4RF0 A;  1RWS A;  1HA5 A;  3TEY A;  1E0Z A;  4MH8 A;  1HZ6 A;  1PGB A;  1L0X B;  4RGO S;  3OWE B;  2KDM A;  3NRZ A;  4A9A A;  1SEB D;  2PW9 A;  4PT5 A;  4A90 A;  1EU4 A;  2LGI A;  4H2A A;  5BYQ A;  2YEP B;  5FKA C;  1DOI A;  2DLB A;  3TEX A;  4OZC A;  4XWW A;  1TS5 A;  2FBW B;  4HEA 1;  2KAC A;  3B2G A;  3AEA B;  3O13 A;  5HFY A;  1QOB A;  4WWM A;  1SE4 A;  1C76 A;  1K53 A;  1XEE A;  2WXP A;  2BS3 B;  3SFD B;  4WAF A;  3DWG C;  3PZ8 A;  3TUO A;  1PUT A;  5T8I A;  1IGD A;  2Q5W D;  3MP9 A;  2HDE A;  3P1M A;  4AQ7 A;  1JRO A;  3AEB B;  1TY2 A;  1L4D B;  1MHX A;  2XN9 C;  4WH4 A;  3MFG A;  1V1P B;  2BS4 B;  2PKO A;  2GB1 A;  1NYR A;  2MJ3 A;  3ABV B;  1TS2 A;  5TSS A;  5EE1 A;  5D3I B;  4EE2 A;  1XXG A;  3KWL A;  5BYS A;  2MH7 A;  2ACZ B;  1I4Q A;  2MJD A;  3NVY A;  1ET6 A;  3IAS 1;  1YNT E;  4OZB A;  4YSY B;  1NYQ A;  2NTS A;  3AE3 B;  2WXO A;  5BMG A;  4Q2J A;  2FE8 A;  1JW9 D;  4TQ0 A;  5BMH A;  2PVG C;  5HI1 A;  1KLG D;  1RYJ A;  2R61 A;  5D7G A;  1ACC A;  1GPX A;  3GP7 A;  5C3J B;  1FIQ A;  2E3T A;  3TSS A;  2JU6 X;  3GB1 A;  4XWT A;  2JZP A;  5BYR A;  2JWU A;  1JCK B;  2K9X A;  2LHE A;  4JE3 B;  4R3D A;  1UGJ A;  1F2R I;  1FD6 A;  1WXQ A;  1FRR A;  2D5G A;  3BYT B;  3GS2 A;  1ZDX A;  4RH6 A;  2DBY A;  1HZ5 A;  5E6J A;  1CZP A;  1FNV A;  2L1A A;  1YQ4 B;  1FMA D;  3IXS A;  3V3X A;  3BWU D;  1GB1 A;  1R7S A;  2QMT A;  1L6U A;  4YT0 B;  2PLP A;  3R2T A;  3BVG A;  4N59 A;  1C77 A;  1IBX B;  2RDG A;  3FC4 A;  4LLG M;  1SE3 A;  1NVI D;  2WU2 B;  3AE2 B;  2J52 A;  1I4X A;  2EEL A;  1QKZ A;  1NEN B;  2WQY B;  2KAJ A;  1GOZ A;  3P4P B;  1JWU D;  1K51 A;  1KTK A;  4A8X C;  3Q8A A;  3BYY B;  2Y5P A;  1TKG A;  2WXJ A;  4NZL B;  4B0E A;  1VR9 A;  1ZUD 2;  1UNS A;  3C8Y A;  2JQR B;  1E10 A;  3ZJU A;  1WYG A;  2L52 A;  2V3P A;  4TMA B;  2AQ1 B;  1C79 A;  1GB4 A;  2QJL A;  4DQO C;  4WIP A;  1A70 A;  2DWQ A;  2IPK D;  3SFE B;  2ZW0 A;  3EA6 A;  2KMM A;  1GAQ B;  1TY0 A;  1B9R A;  3ZYY X;  2WXN A;  1HQR D;  1I4R A;  3N9Y C;  2NTT A;  1YQ3 B;  3VR8 B;  1NEK B;  1FFU A;  1VJK A;  2K0P A;  1SSN A;  2RDH A;  3U4E G;  1B1Z A;  3MJ5 A;  3FIL A;  1C9F A;  4IKG A;  2BB5 A;  1FCL A;  5AUI A;  2WDQ B;  3R8B A;  1FNW A;  1N62 A;  3W1S A;  3FAH A;  1ZXH A;  2ONQ A;  4XE0 A;  1FNU A;  1EWC A;  3NVZ A;  2H88 B;  1FCC C;  1XCQ L;  1V97 A;  3J9C A;  2JYT A;  1KF6 B;  2J53 A;  3R2I A;  1I4P A;  1VDV A;  2V3N A;  1CJE A;  1WWT A;  1PFD A;  2WLB A;  3AED B;  4L23 A;  4XDC A;  1KLU D;  1XF5 L;  1STE A;  5EE9 A;  4AS1 A;  2I38 A;  3ZJV A;  1SBB B;  1DOY A;  4KGR A;  2LFI A;  5AUK A;  1D6E C;  4USA A;  2W54 A;  4P16 A;  3AMZ A;  4HRO A;  4C56 C;  1WGK A;  2WXF A;  4ARI A;  2MEK A;  3ZJT A;  1VRA B;  2PIA A;  2INP E;  2WDR B;  3AB5 A;  3BZD B;  3AE1 B;  4KX6 B;  4C7Z A;  2WXH A;  5D3D A;  1K52 A;  2Z8L A;  1TYG B;  4YXD B;  2JYE A;  1JAL A;  3MC0 B;  3PO0 A;  4ZYS A;  1XLN A;  1L0V B;  3ETR A;  4JPS A;  2SAK A;  4GDL B;  4A55 A;  1F0Z A;  2L83 A;  1ZOY B;  2IGH A;  1Q10 A;  2L32 A;  3CIR B;  1PGA A;  2J4X A;  4RF1 A;  3VRB B;  3KLS X;  3AV8 A;  1BXT A;  4M0W A;  3Q8C A;  1ESF A;  5FK9 C;  1AN8 A;  3W5U B;  1QOA A;  3WCQ A;  4A6Q A;  1C78 A;  2ICI A;  3LXF A;  1L6V A;  3P4S B;  4FXC A;  1C4C A;  3B9J A;  1JWS D;  1WRI A;  2WNM A;  1EWY C;  2AX5 A;  2TSS A;  1JRP A;  1SIJ A;  2KWD A;  4HJG E;  4CQN A;  1FXA A;  2WS3 B;  3AE6 B;  2V0G A;  1MHH E;  3BK1 A;  2LHD A;  1YN5 A;  4C7Y A;  1PDX A;  4NAM A;  3IT6 B;  4WQM A;  2WXI A;  4TQ1 A;  1HXY D;  5G5H A;  3Q8F A;  1OQQ A;  2KQ4 X;  1LO5 D;  1V1O A;  2E6X A;  1DYQ A;  3AE7 B;  1FEH A;  4L2Y A;  3URY A;  4KKJ A;  4N58 A;  1VZ6 A;  1KH0 A;  3AEG B;  2WXK A;  4L1B A;  2K5P A;  3T3O A;  2FUG 1;  3VRA B;  2CJN A;  3U2S C;  1YJI A;  1MVK A;  4YTN B;  1YJJ A;  2ZW1 A;  1N5X A;  1YN4 A;  5GXG B;  1AYF A;  2M56 B;  1SF0 A;  1QOF A;  2CU3 A;  1JWB D;  3BK2 A;  1RM6 C;  4REZ A;  2VZK B;  2J42 A;  4KGS A;  3RPF C;  2BT6 A;  3AEF B;  1MI0 A;  4OHJ A;  1WSP A;  4ARC A;  3W9C B;  1AW7 A;  1C4A A;  2OED A;  2WXG A;  1ZXI A;  2PVO D;  4OVZ A;  5BMI A;  4ZRP A;  2IGG A;  2IGD A;  3P4Q B;  2LMC A;  1UWM A;  1BML C;  2QIE B;  4HRS A;  2AQ2 B;  2M19 A;  2RMM A;  4JWU C;  1Y56 A;  1TKY A;  1L5P A;  1T3Q A;  2BYT A;  4RNA A;  4ITK A;  3UI3 A;  4XDD A;  2BBC A;  4NJC A;  3E56 A;  4ZOH C;  4RGN A;  3W2D A;  2IDY A;  1TJE A;  2QSD A;  1D5Z C;  1P7E A;  1J7A A;  1TS4 A;  4ZRQ A;  5HHD G;  4WUR A;  2I2Y A;  1ZP0 B;  1SJH D;  2N7J A;  3T3N A;  1J7C A;  1KFY B;  2QEJ C;  2LUM A;  3TEZ A;  1FRD A;  2PTL A;  1E9M A;  3NVV A;  1MPE A;  1I4H A;  1K50 A;  3NUH B;  4GLS C;  3EGR A;  1T6B X;  1IUE A;  2JXT A;  3NZ3 A;  1TS3 A;  2JSV X;  3Q8B A;  3LB8 C;  1UWX A;  1TZO A;  4YWG G;  3RFZ B;  3MHZ A;  1V1P A;  3AM9 A;  2BTE A;  1N60 A;  1XLQ A;  3I9V 1;  2DYO A;  4GDK B;  4YTM B;  1F2R C;  4RFB A;  4D2K A;  3I57 A;  1VLB A;  4DXF A;  3P63 A;  3FIL B;  1DGJ A;  1FXI A;  5EE3 A;  3BVM A;  2MJE A;  3AE4 B;  2B76 B;  3U52 E;  5I4D A;  2WU5 B;  2HTM E;  1QIL A;  2VZK D;  4MT5 A;  3ZGZ A;  1ZPS A;  3NS1 A;  1ZDV A;  1ET9 A;  2PMV A;  1PYW D;  2GRI A;  3SEB A;  1AWD A;  1N5W A;  3W5V B;  1L0Y B;  4B0M A;  1JWM D;  1EM7 A;  1OQR A;  2OHF A;  2WXL A;  3AE5 B;  1VZ8 A;  1KRH A;  3E9S A;  2GI9 A;  5EE0 A;  3EUB 2;  4TSS A;  1QT9 A;  3VQI A;  4ZHP A;  1I7H A;  5MPO A;  2LEK A;  1SB3 C;  3HVZ A;  3Q8E A;  3PZ7 A;  1E6E B;  3B2F A;  2JX5 A;  1ROE A;  2BS2 B;  3NVW A;  3AE8 B;  3AEC B;  5H92 C;  2BW2 A;  2QIL A;  1JML A;  2WDV B;  2KN4 A;  2N9K A;  1N63 A;  1IBX A;  3AN1 A;  4YSZ B;  2ON8 A;  2G1E A;  2BB6 A;  3HRD D;  5LNK 1;  1NI3 A;  1T5X D;  4RGT A;  1XO3 A;  1F77 A;  4LTU A;  4RGM A;  4J3O D;  5FR3 A;  2RPV A;  3BII D;  1RFK A;  1ENF A;  2XNA C;  5C2T B;  4US9 A;  1PGX A;  3LYY A;  3L4P A;  2N0S B;  2AQ3 B;  3DWM A;  4JX1 C;  4IDI A;  2LJI A;  3KWV A;  4HKZ E;  3HVD A;  1QLB B;  2G9H D;  4IOI E;  3AE9 B;  5H8Y E;  3TEW A;  2WXQ A;  1EU3 A;  2K22 A;  1SJE D;  1XCT L;  1JQ4 A;  1ZE3 D;  1SXT A;  1XLO A;  4OZA A;  4RCO A;  3KQ4 A;  2V4I B;  3HUI A;  1C4P A;  5G5G A;  4UDU C;  1D5M C;  2YEP F;  2DYM A;  4YSX B;  4HKQ A;  5HG2 A;  4C80 A;  1CQV A;  4NAW B;  1HEZ E;  3BVZ A;  1L4Z B;  1YMH E;  2WP9 B;  1FO4 A;  2SEB D;  3SR6 A;  4ZHO A;  1TKE A;  3V05 A;  2M0A A;  4MM3 B;  5JXV A;  1SE2 A;  1P7F A;  3AEE B;  4DXG A;  1I4G A;  1JWA D;  2WXR A;  2Y5C A;  4KKI A;  4MAC A;  4YTP B;  2H89 B;  1FFV A;  3U7Z A;  1N61 A;  1FM0 D;  4N6E B;  1DOX A;  4KGT A;  3IAM 1;  4O1N A;  3ZQ4 A;  3P42 A;  1IGC A;  1D4B A;  3P4R B;  4OW0 A;  4P6V F;  1XLP A;  1OFF A;  1V8C A;  1VZ7 A;  2CJO A;  2X38 A;  1D5X C;  2W3R A;  3Q69 A;  2EKI A;  2Y3A A;  1J7B A;  2IJ0 A;  3AH7 A;  2N9L A;  2NMQ A;  1BUI C;  1QQR A;  1QF6 A;  2WXM A;  3H8H A;  4US8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...