2KQ7A

Solution structure of the autophagy-related protein atg8
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
119
structure length
119
Chain Sequence
GSMKSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of Atg8 reveals conformational polymorphism of the N-terminal domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords Autophagy-related protein 8
total genus 18
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kq7A01
2GMIC 2LUEA 1WM3A 2GBKA 2BYVE 4HDOA 3SD5A 2JRHA 4GN1A 2KHWB 3X0WA 4E71A 3KW5B 1C3TA 4G3XB 3H9DA 3W1SA 3PRZA 1RLFA 3B08A 1NBFC 4BKGA 2LGXA 4MH0E 1MG8A 2G4DB 3TL5A 2IO0B 3ALBA 4BOSC 5DPWA 2CR5A 2LWPA 1WGHA 3U8ZA 5CHWA 2MBBB 3VH3B 3UINB 1GC6A 3PLUA 2KFJA 4W9KA 3JW0X 1UBQA 1ZGUB 4FHKA 3RZWC 1UZXB 3VTVA 1Q5WB 1LFDA 2KJ6A 4NAWB 4ZYNA 4W9DA 2K6DB 2XK5B 2Z0EB 3QCAA 2IYDB 1RFAA 1P3QU 2K8CA 4FHJA 3DVNV 5E6OA 1K8RB 2KC1A 3NOBA 4HK2A 3RT3B 3PRMB 5DCNA 4FADA 3PLVA 2DZKA 1I35A 3A33B 4MGZE 3PSEB 2FCQA 1ISNA 4JQWC 4GDKB 4GSWA 1WIAA 2J0JA 1WY8A 4JL9A 2WX0A 4KSLC 2MSED 2L05A 3ECIA 4MM3A 4MELA 5IAAC 4WQOB 3APCA 2KDIA 2BGFA 4IG7B 1S1QB 2LI5A 1V80A 4RM9A 2XK5A 3PHWB 2QHOA 2K1FA 4GGQA 1NI2A 4BBNC 2MA9B 4W9IA 3QARA 2FUHB 2KDFB 2KJRA 3WAMA 4KZCA 4BBNF 1V5OA 2PJHA 3K9PB 3PRPB 3ML8A 3LDZE 4ASWC 1E90A 2DAFA 2LJ5A 3M62B 2AYOB 4PS7A 4RMAA 2DAJA 4FJZA 4HXDA 2OOBB 3AU4A 1P1AA 3KH0A 5G55A 2V1YA 2LASA 4A3PA 5D2MB 2L7RA 5D6JB 4EEWA 2O2VA 3SHQA 4BKSD 3DBLI 4BKTA 3KUCB 3AULA 5EDSA 3OJ4B 2BPSA 2GBNA 4FULA 4TUUA 3O65B 2RPQA 4GDLA 4ZDVA 2LRWA 4TQ1A 3ZNID 1WGGA 3ONSA 3V61A 1P0RA 3ZRCA 2ZJDA 3UF8A 2KX0A 1WX9A 1P98A 1NDDA 4W9FA 3QQ8B 3MJWA 2M8SA 2LVQA 2KO3A 2PE6B 3L0WB 3HHMA 2XEWA 2ZVNA 3A9KA 2C60A 2BKRB 2DX5B 4W9JA 5D94A 5DPTA 4EZLA 2DZMA 2KQSA 2G4SA 2JT4B 3VQIA 4RM8A 2K39A 2BWES 2LRUA 2MQJA 2LVOA 2IY1B 3NZSA 3LJ3A 2D07B 1EUVB 4W9CA 2LZ6A 1OEYJ 3N3KB 4KZ0A 2M1MA 1VD2A 3M95A 2KDEB 3WANA 5J17A 4GXBA 3MHSD 3L08A 5JH5C 2N9EB 2YLMA 2ZVOA 5G2NA 3PGEA 1V5TA 3MTNB 2IY0B 4ZRKA 4KDLB 2LXAA 4YL8A 3IBEA 2L3ZA 2R2QA 3ZVVA 2KVRA 1WRDB 2ASQA 2RR9A 3QHTA 3EC8A 4CO7A 1YD8U 1V81A 2B3AA 2CHWA 2L0FA 3RZFA 4LCDE 4AJWA 3H7PA 3H6NA 1WXMA 4FA6A 5TR5A 4GOCA 4DDGD 2PE9A 2O6VA 4F1SA 1UBIA 2ZPNA 1GUAB 4PYUA 1H4RA 1WX8A 3B0AA 4BKSA 5L83A 4EZJA 1Q0WB 4MGKE 5J2RA 4P7IA 2C7NB 2CKHB 3JYUA 2IO1B 2WDTB 2AL6A 3CSTA 3QJZA 1QZEA 1V6EA 2GBJA 3RD2A 4DK5A 4W9HA 1X1MA 1WMHB 3PV1A 3NS8A 1UH6A 4NNJB 3DBSA 4KVGB 3WAPA 3H7SA 2MBOA 1V86A 1V9JA 1ZKHA 4WAAA 1TGZB 1E5WA 3AI5A 5CHFA 2BKFA 2V4LA 3DCGA 4I6NB 3T8MA 1V49A 4XZ4A 3ZUNA 1WE7A 2GBRA 4M8NA 3ZLZA 1E8XA 3RYTA 4FJVB 3I3TB 4II2B 1OEYA 4ICVA 4W9GA 3KUZA 2A5UA 2DHZA 3DQVA 3GOEA 3WALA 2D2QA 4W9LA 1KLVA 4NJ7A 3KYCD 4XC2A 4WWNA 3BY4B 2KKCA 1LQBA 3IFWB 4IWQA 2GOWA 3QWZB 2NCNA 4IW0A 2K25A 4B9KA 1I42A 4CYEA 2WYQA 4NQLB 2HTHA 4WWPA 5KHQA 3U7DA 2KFKB 2KWUB 1FXTB 2N1VA 4ZRIA 5HKHA 4OVUA 1RRBA 3ZO5B 1J0GA 4EZKA 4PS8A 3IG3A 5AZGA 2N7DA 4E3CA 3JVZX 2LXCA 1Z2MA 2G3QB 3B1LX 2JVCA 2V3SA 3A9JB 2AL3A 4M8MA 2MBQA 4MDKE 1G6JA 2RGFA 2DENB 2Y5BB 3HIZA 3CMMB 2KFKA 1RAXA 1YIWA 2DYOA 3L17A 1WJUA 5AZFA 3JSVB 2LGDA 3RUIB 1U4AA 1WGDA 4GIVA 4MEMA 4NY0A 3A4RA 4WJQA 3DVGX 4XX5A 4BOZB 2DYBA 4JIOU 3VFKA 2KWVB 2NPTA 3UIOB 4HLEA 4IUMB 3WIMA 4HWIB 1V2YA 3D32A 2KJHB 4K1RB 1SIFA 2FCSA 4NJ6A 3VUYA 4DXAB 2FCMA 5AEKB 3PHXB 2PPHA 4HJKA 1GJZA 1WF9A 1WYWB 3DDCB 2KXJA 2M0XA 3Q3JA 3OJ3A 3OLMD 1GG3A 3TMPB 4G11A 4NAWA 3ENEA 2KD0A 2HJ8A 2MLBA 3K9OB 1ZW7A 4ICUA 1WFYA 4HPMB 3ZDMC 4W9EA 4DHZE 2ZCCA 4IWPA 5CX3A 5E6PA 1WZ0A 4G0NB 2REXA 2NBWB 2MRPA 3QAQA 4PS3A 1KJTA 4FBJB 3RCZA 2M17A 2NS5A 2M4NA 3ZW3A 3EECA 3QC8B 2JF5A 4WWOA 2KTFA 2LD9A 4TQ0A 2KMCA 2MX2A 4II3B 3NZUA 4EOYA 2YVCA 5IA7A 5CHVC 2HD5B 2KQ7A 4MSMB 1WGRA 1WXAA 2KWCA 2I1KA 4LJOB 2FAZA 3VDZA 3UQBA 2IBIB 4I6LB 4DWFA 2KTRA 1IP9A 1WX7A 2MCNB 1WXVA 2AWTA 4PYZA 2O2VB 3VVWB 2EMSA 1M94A 2R2OA 2O6VD 2N7EA 4HVBA 1EF5A 4OVVA 2CHZA 3ZDTA 5L95C 2N9XA 2JZZA 3HK0A 1YX5B 4KDIC 3DBHI 3KVFB 4K7SA 2KC2A 1L7YA 2NBUA 4ANXA 3S2AA 1T0YA 1IPGA 2CU1A 3CSFA 4GDLB 3RULA 1L2NA 1Z5SB 1A5RA 2DYMA 3WAOA 2EMTA 4EKUA 2C7HA 3N32A 3SDLC 2Z0DB 4AP4C 4BVUC 3IHPC 3APDA 3H7PB 4DDID 2KANA 2L8JA 1R4MI 2IO3B 5KHOA 1J8CA 2JXXA 3VUWA 1OTRB 1TBEA 1F9JA 2EKEC 3VHTC 4GDKA 1KOTA 2CHXA 2FCNA 1E7VA 2MBEA 4B95A 4DBGA 4IWOA 2RSUA 2G45B 3NY5A 3IVFA 1R4NI 3V60A 1TTNA 1WXSA 5LXIB 5BO4B 2PEAA 3EFUA 2UWQA 4KIKB 2NR2A 2ZEQA 1WJ6A 4FJYA 5DPSA 3UQAA 1J19A 1VCBA 2KOXA 1UGMA 4K7WA 4WJNA 5DPRA 3P2BA 3PVLA 1C1YB 1E8ZA 4G50A 1BT0A 5JHBA 3PT2B 1LXDA 2A4ZA 2Z59B 3VUXA 1HE8A 2N1WA 3ZRFA 4MSQB 4TKNA 4NQKE 2WX1A 3DOWA 2NBVB 3OAWA 1WR6E 2VRRB 2C9WB 2JWZA 2KLCA 4GU2A 4IM3A 4ANVA 2FNJB 2KNBA 1GNUA 3R3MA 1KM7A 2MW5A 1YQBA 3ML9A 5LXHA 3PZDA 2C5LC 1E8YA 2MWSB 4ANUA 4X57B 2KZRA 3AXCA 4F7ZA 1XT9B 2L00B 2BF8B 2KK8A 4AUQC 2I1JA 3M63B 3R66C 4GMVA 3WA0A 2JRIB 2W9NA 4MGIE 2JUOA 4KSKC 1PQSA 3APFA 3C0RB 2ZPYA 3EHVA 1UD7A 3L10B 4JLCA 1SGHA 3DVNU 2J0MA 3A4SC 2BYFA 3R7RA 3TJPA 4LDTB 4AOFA 4E74A 3DBRI 1WE6A 3M3JA 4A3OA 2K8BA 4NPNA 3PREA 3X23A 1WR1A 2AEHA 3QIJA 2ZNVB 3ZNZB 3VH4B 2ZZPB 4M0WB 4WJOA 2MP2A 4ZRJA 3ZNHB 2OJRA 2CS4A 3VTUA 5E6NA 3NHEB 4AWJA 1TZ1A 4DHZB 4MJSA 2LGYA 2JY6A 3V62A 3ZKJC 1WM2A 4K81A 3ZNGC 3ZTDA 3T9LA 1E7UA 2D10A 1WMHA 2XBBC 1Q1OA 4WJPA 5GMVA 3TCAA 4HCPB 2GBMA 2K8HA 3A1QA 3W1YA 3DPDA 4A20A 4EUTA 4FN2A 3PPAA 1UELA 4BFRA 1WH3A 2C7MB 2K6QA 2BYEA 2KLGA 3L13A 2J0KA 2WWZA 2JPHA 2MP2B 3N30A 4JGHB 3A9KB 2IO2B 1CMXB 5D7GA 4URKA 2O6VB 3GZNI 5FR6A 3A9JA 3U30A 1GC7A 4IM0A 5LLIA 2NPTB 2N9PC 1D3ZA 1XD3B 4J6IA 4DHJB 3DVGY 4KIKA 4LDTD 2J7QB 3A1QB 4GB9A 4HPLB 4LJPB 2FIFA 1WJNA 2RD0A 3V6CB 2IZVB 5AZHA 2KX3A 3UIPB 1EF1A 1JRUA 4HDQA 2BWFA 1SE9A 3UGBB 3BINA 2NVUI 4N9F4 3VXWA 2KDBA 5C23A 4ANWA 2LVPA 3KUDB 1P9DU 1XQQA 1E8WA 4EFOA 3QX1A 3ZIMA 4F8CB 2DZIA 5JZEB 2UYZB 4IM2A 3L16A 4B6WA 2ZNVC 3TBLD 4MJSB 1WZ3A 4MGYE 4I6PA 3HM6X 1S3SG 1YX6B 3AU5A 3PTFC 4DHJD 1WJ4A 1YJ1A 1WI0A 2DZJA 2D11A 3SU8X 2D3GA 5J18A 1EO6A 3W1SC 3JSVA 2ZCBA 4TV3A 3HM3A 3R7QA 3QK0A 3TIXA 3QA8A 1H8CA 4AJYB 3Q3FA 2L0TA 2JZ3B 5CTRC 3ZTCA 4FLHA 2MBHA 4CHKA 3L54A 3PS6A 5C1ZA 4KV2A 5JHAA 3H1UA 1IYFA 2FIDA 4HCNB 2KN5A 3VAWA 1WGYA 2N4FA 4K7UA 1AARA 3CF6E 1OQYA 2HE7A 1OGWA 1LM8B 1Y8RC 4IC7B 3V6EB 2KTRB 3VTWA 3KYDD 2L76A 2KMAA
chains in the Genus database with same CATH superfamily
1FPYA 3SD5A 1UNSA 3AEEB 3I9V1 2QMTA 1DGJA 3X0WA 4ZRQA 3B08A 1ZPSA 1MG8A 2G4DB 5FKAC 1ZDXA 2LWPA 3U8ZA 1JCKB 1QLBB 2OEDA 2KFJA 4RF1A 2VH1A 3VTVA 1QILA 1IGDA 2KJ6A 1YOVB 2D3AA 3QCAA 2M56B 1RFAA 1P3QU 4ACFA 5E6OA 3Q8BA 3PRMB 5DCNA 3PLVA 3PSEB 2JU6X 4GSWA 1WIAA 2J0JA 4KSLC 2L05A 1Y56A 1NYRA 4MELA 1ZOYB 3Q2AC 3APCA 2KDIA 1SE2A 1S1QB 2LI5A 3PHWB 2QHOA 2K1FA 2JYTA 2MA9B 2KDFB 4ASWC 4PS7A 4RMAA 2DAJA 4HXDA 2ONQA 2V1YA 2BW2A 3LB8C 5D2MB 4BKSD 3DBLI 3AULA 1M4VA 2GBNA 1TS3A 4TQ1A 4DXFA 4WH4A 2KX0A 3QQ8B 3MJWA 4N58A 2KO3A 2XEWA 2ZVNA 2JT4B 3MC8A 2Y5CA 2BWES 1V97A 2LRUA 1KH0A 5HFYA 1QF6A 1L6UA 1OEYJ 4KZ0A 2M1MA 2KDEB 2N9EB 5G2NA 1GAQB 3MTNB 4KDLB 4RGTA 4YL8A 3IBEA 2L3ZA 4KKJA 3ZVVA 1VZ6A 2AX5A 4CO7A 4XDDA 2CHWA 3RZFA 4LCDE 3VRBB 4LNNA 3R2IA 4DDGD 3AE2B 3KWLA 4HEA1 3W5VB 3B0AA 1STEA 4MGKE 4P7IA 3CSTA 4YSXB 4K3CA 2IJ0A 4KGRA 3H7SA 1V9JA 4WAAA 3AI5A 1E5WA 2V4LA 4I6NB 1V49A 2I2YA 1P7EA 1E8XA 3RYTA 4M02A 1BUIC 4XC2A 2KKCA 4GLSC 1LQBA 2GOWA 3QWZB 4CQNA 2N9LA 2WYQA 4NQLB 2HTHA 2KWUB 5IP4D 1C4PA 2WXMA 2N7DA 4E3CA 2LXCA 1Z2MA 4C4VA 3B1LX 2MBQA 2RDHA 2DENB 1RAXA 3L17A 3JSVB 1MPEA 1WGDA 4NY0A 1RFKA 3VFKA 5BMGA 2NTTA 3D32A 1SIFA 4DXAB 1I4XA 3PHXB 1GJZA 1WYWB 2KXJA 3PZ8A 3Q3JA 3TMPB 4NAWA 2MJ3A 3ENEA 2MLBA 4KX6B 1ZW7A 1HTOA 4RFBA 4W9EA 4G0NB 2MRPA 1XLOA 3NJTA 1BMLC 2M4NA 2QIEB 3ZW3A 2WXKA 4EOYA 3TEZA 1QKZA 4MSMB 2LHEA 1JWUD 2EKIA 3GS2A 3N9YC 1XO3A 1TKGA 2AWTA 2O2VB 1SBBB 4C00A 4OZBA 1M94A 5HG2A 3AE1B 1T5XD 1V1PB 2K22A 1PYWD 5C2TB 2MHJA 3VR8B 2JZZA 1YX5B 2L83A 3S2AA 1T0YA 1P7FA 1PGAA 1A5RA 1PGBA 2DYMA 3WAOA 5IN7A 2C7HA 3N32A 3SDLC 2L1AA 4C7YA 1K50A 3IHPC 2RDBC 4B0EA 3W2DA 3VUWA 2EKEC 2QC8A 2MBEA 4IWOA 2G45B 4R3DA 3IVFA 1R4NI 3ABVB 1TTNA 1ESFA 4RGMA 3EFUA 1GOZA 5DPSA 3KWVA 3UQAA 2B76B 1J19A 1VCBA 2KOXA 5DPRA 3PVLA 5EE3A 1Q10A 1HZ5A 3VUXA 1HE8A 1OQRA 3AN1A 3OAWA 2C9WB 3C19A 2KLCA 1TS5A 4ANVA 2FNJB 2KNBA 1KM7A 1E8YA 2KZRA 3AXCA 1XCTL 1XT9B 4C4VB 1N6ZA 4AUQC 2I1JA 3WA0A 4MGIE 4KSKC 3APFA 3EHVA 2ZPYA 3L10B 4XWTA 4LDTB 1C77A 4KGTA 1JALA 4IKGA 2KQ4X 4NPNA 1YNTE 4US8A 3ZNHB 2OJRA 5E6NA 3NHEB 3VRAB 1GPXA 3FAHA 2XBBC 4WJPA 5GMVA 2WDQB 2GBMA 2BYTA 1J7CA 1JMLA 3W1YA 3DPDA 2JX5A 2KACA 4BFRA 2D3BA 2K6QA 2J0KA 2WWZA 3BVGA 2MP2B 4JGHB 3I5JC 1T0RC 3DWMA 3GZNI 3A9JA 1IBXB 3U30A 1GC7A 4HRSA 5LLIA 2NPTB 2EELA 4LDTD 4GB9A 3GP7A 1FCCC 1FM0D 1WJNA 2IZVB 4OZCA 2BWFA 2NVUI 1AN8A 1A70A 3IT6B 3KUDB 1XQQA 4LNKA 4F8CB 2DZIA 5JZEB 4IM2A 4I6PA 1R4MB 3HM6X 4N59A 5G5HA 1WJ4A 1JQ4A 3HUIA 3SU8X 3DHHC 3W1SC 2WDVB 4A8XC 4TV3A 3R7QA 2BBCA 2X8XX 1JRPA 2JZ3B 3HVDA 1ROEA 2MBHA 3MFGA 3L54A 2FUG1 3ZXVA 2N4FA 1ZDVA 2HE7A 1LM8B 4IC7B 3V6EB 1V8CA 2KTRB 2L76A 2CJNA 2GMIC 2WP9B 2BYVE 4HDOA 1L0YB 2KHWB 2LEKA 1TJEA 3H9DA 3W1SA 4A90A 1NBFC 3NVVA 4MH0E 1FEHA 2WXHA 4HJGE 5DPWA 3P1MA 2KAJA 5CHWA 3U2SC 3VH3B 1FFVA 4W9KA 3JW0X 3AE9B 1UWMA 5H8YE 1UZXB 1Q5WB 4NAWB 4W9DA 2K6DB 2XK5B 4ITKA 2IYDB 1R7SA 2K8CA 4FHJA 2LGIA 4OHJA 1I35A 3A33B 1L6VA 4MGZE 4JQWC 4GDKB 1MI0A 2WXNA 1WY8A 4JL9A 2WX0A 4UDUC 3BVZA 1E7PB 4RM9A 2XK5A 1VZ8A 3NS1A 4W9IA 3RI7C 1IGCA 2KJRA 4BBNF 3K9PB 3RNAC 3ML8A 5IOIA 3ZJTA 1V1PA 1JWBD 2OOBB 5G55A 3R2TA 4RF0A 4A3PA 2O2VA 4JPSA 4BKTA 3KUCB 5EDSA 3OJ4B 2BPSA 4TUUA 1K53A 4ZDVA 3ZNID 1WGGA 3ONSA 3V61A 2ZJDA 3UF8A 2V3PA 1P98A 2LVQA 2PE6B 3AM9A 2C60A 2BKRB 5D94A 4EZLA 2KQSA 2G4SA 1R4NB 2K39A 2IY1B 3NZSA 4PK1A 3AV8A 1EUVB 4LLGM 2WS3B 2LZ6A 2W3RA 1XXGA 1MHHE 2BS4B 2HTME 3MHSD 2YLMA 2M19A 2BS2B 3Q6BA 3PGEA 1V5TA 2LXAA 1WRDB 3I57A 3QHTA 4WWMA 1VJKA 1SSNA 4OW0A 4ZYSA 1RWSA 4F1SA 2ZPNA 1GUAB 4B0MA 1WX8A 4M0WA 5L83A 2JQRB 3AE4B 2C7NB 2CKHB 3TUOA 3QJZA 1CK1A 1QZEA 1V6EA 1ZE3D 2GBJA 2W55A 4W9HA 4C56C 1SEBD 3NS8A 1UH6A 4NNJB 2LFIA 3WAPA 1V86A 2IGDA 1TYGB 1TGZB 2E6XA 1WE7A 1T0SC 2GBRA 3TSSA 3ZLZA 4WIPA 1XF5L 2LJIA 3I3TB 1OEYA 2A5UA 2DHZA 1TY0A 1ZP0B 2D2QA 2WDRB 4NJ7A 3RMKC 2NTSA 3U7ZA 2NCNA 4B9KA 2QCZA 2QILA 4IDIA 4EZKA 1JWAD 3JVZX 4YSYB 4MACA 2K9XA 2V3SA 1XCQL 3A9JB 4M8MA 4HKQA 1I4HA 5JXVA 4BAXA 2I38A 3HIZA 5MPOA 3CMMB 2KFKA 1JWMD 5AZFA 3RUIB 4A6QA 4WJQA 2ICIA 2KN4A 3A4RA 4YTNB 2DYBA 4JIOU 1HXYD 2PMVA 2NPTA 4HLEA 2KJHB 1OQQA 5AEKB 2PPHA 1WF9A 2MJEA 3RNFC 1UGJA 2V0GA 4G11A 1L4ZB 2KD0A 3K9OB 3Q3NC 2INPE 1WFYA 5AUKA 3ZDMC 1TZOA 4DHZE 4M00A 5CX3A 5E6PA 1WZ0A 4A9AA 1FMAD 1JW9D 2GRIA 2REXA 3P63A 2ZW0A 3RCZA 2JF5A 2MX2A 4REZA 4C7ZA 5CHVC 3NRZA 1WXAA 2I1KA 2FAZA 2KTRA 2VH2A 3AEAB 1OFFA 1WXVA 2X38A 3B9JA 2V9HA 2EMSA 4HKZE 3Q8EA 4HVBA 2IPKD 5L95C 2FE8A 1C78A 3AMZA 3Q8CA 3HK0A 2CJOA 3DBHI 2WQYB 3KVFB 2H88B 4K7SA 4KKIA 4ANXA 3RULA 4GDLB 2EMTA 4EKUA 1XLQA 2V4IB 3KQ4A 4BVUC 2ZW1A 3APDA 2ACZB 4DDID 2IO3B 4QAYA 4K3BA 4GDKA 1KOTA 1N63A 1YN4A 4NJCA 1T0QC 1HZ6A 2H89B 2TSSA 3Q3OC 5LXIB 2PEAA 4KIKB 2ZEQA 1WJ6A 4XWWA 3B2GA 4WJNA 4G50A 4LNIA 5JHBA 3BIID 1D5ZC 1EWCA 2A4ZA 2HJ1A 5C3JB 4MSQB 1NENB 2WX1A 3ZJUA 2MH7A 2JWZA 3SR6A 1GNUA 1L0VB 2MW5A 1YQBA 3ML9A 1TKEA 2WXRA 3PZDA 2C5LC 5IKCM 2D3CA 2MWSB 4ANUA 4X57B 3EUB2 3ZQ4A 1FD6A 2ON8A 1E9MA 2BF8B 2KK8A 2JRIB 2AQ3B 2N9KA 2J0MA 3DVNU 3R7RA 3X23A 1WR1A 2ZNVB 4RNAA 4WJOA 2MP2A 4ZRJA 4RH6A 3DHGC 3VTUA 3IXSA 3OG5A 1ET6A 4MJSA 2JY6A 2LGYA 3GE8C 1TKYA 3ZTDA 1E7UA 1SF0A 2D10A 2KDMA 4IOIE 3RNBC 2FBWB 4EUTA 4FN2A 3AE7B 1MVKA 1UELA 2C7MB 2IGGA 2KLGA 3L13A 3N30A 3BK2A 1I4GA 2G1EA 2N9PC 1B9RA 2HDEA 3URYA 3SEBA 1SJHD 3V6CB 2PVOD 1EF1A 1KLGD 2KDBA 1P9DU 1E8WA 3ZIMA 3P4PB 3IAS1 3L16A 2ZNVC 4MGYE 2BS3B 3PTFC 2D11A 2OJWA 5J18A 3JSVA 4M01A 3QK0A 1H8CA 1TS2A 3P4SB 1EU3A 4FLHA 3Q8FA 5C1ZA 3MJ5A 4KV2A 3H1UA 4AQ7A 2FIDA 1PFDA 3CF6E 3GB1A 1Y8RC 2QEJC 2KMAA 2LUEA 2RPVA 2GBKA 2JRHA 4GN1A 4LK0M 4ZOHC 1VDVA 4LNOA 2OHFA 4E71A 3KW5B 2INNE 1RLFA 3CWIA 5BMIA 3HRDD 3ALBA 4BOSC 1E0ZA 2Y5PA 4FHKA 3LYYA 2LMCA 1LFDA 4ZYNA 3TEXA 1LGRA 5HI1A 2JSVX 3DVNV 1QOGA 3Q14C 2GLSA 3RPFC 1ISNA 2WU5B 3EA6A 3P4QB 2VZKD 1CJEA 5IAAC 4WQOB 4IG7B 1V80A 3TEWA 4GGQA 1NI2A 4BBNC 2FUHB 1VLBA 5BYRA 3WAMA 4WAFA 1V5OA 2PJHA 5AUIA 3DBHB 4D2KA 2DAFA 4JX1C 2LJ5A 1HQRD 3BYYB 1FNVA 1P1AA 5EE9A 1TS4A 3NVWA 4EEWA 2L7RA 5D6JB 3NG0A 3NVZA 1ZUD2 4FULA 1NVID 4EE2A 3O65B 3NVYA 4GDLA 1P0RA 1NDDA 2M8SA 3SFEB 4A55A 2LUMA 1SE4A 2DX5B 4W9JA 3PO0A 3W5UB 4L23A 2L52A 1YJJA 2G9HD 2MQJA 3LJ3A 4W9CA 4TSSA 2LHDA 3BWUD 3WANA 1ZXHA 4XGAB 5JH5C 2ZVOA 3L4PA 3MC0B 2IY0B 2R2QA 2RR9A 2AQ1B 3EC8A 4MT5A 4YXDB 3DWGC 3N1YC 1V81A 3H7PA 2Z8LA 3H6NA 4FA6A 5TR5A 3ZXRA 3AE3B 4GOCA 3Q8AA 2J4XA 1FCLA 2WXLA 4OZAA 4N6EB 4BKSA 4EZJA 1Q0WB 5J2RA 3JYUA 2IO1B 2WDTB 2AL6A 1VZ7A 1WMHB 5H92C 3DBSA 4ZHOA 1ZKHA 1T6BX 5CHFA 4XZ4A 3ZUNA 4II2B 4ICVA 4W9GA 4US9A 3KUZA 3WALA 2WGSA 2DLBA 4W9LA 1KLVA 3KYCD 4WWNA 1KF6B 4IWQA 1MG4A 1JWSD 2Y3AA 2K25A 5TSSA 4WWPA 2KFKB 1FXTB 2N1VA 3GZNB 2YEPB 1PUTA 3ZO5B 1J0GA 3IG3A 4BZAA 3EGRA 1J7AA 2JVCA 1L4DB 1UWXA 1HTQA 1G6JA 2BB6A 1ACCA 1N5XA 4S0RA 2QJLA 2RGFA 2Y5BB 1WJUA 5EE1A 4MEMA 3DVGX 1FO4A 4IUMB 4HWIB 1V2YA 1KLUD 4K1RB 4NJ6A 2FCSA 3VUYA 1GB1A 4WQMA 1FFUA 3DDCB 1FNUA 2Q5WD 2M0XA 3OLMD 3W9CB 1GG3A 3AECB 4WURA 4HROA 2WU2B 3O13A 1QOBA 1ET9A 2NBWB 2M0AA 3QC8B 4WWOA 3NZUA 5IA7A 2HD5B 4LJOB 3VDZA 3UQBA 2IBIB 5EE0A 4I6LB 4DWFA 1WX7A 1PDXA 2R2OA 2N7EA 3BYTB 4JE3B 2N9XA 4ARCA 4KDIC 2KC2A 4XE0A 1IPGA 2K5PA 1L2NA 5I4DA 1EM7A 1XEEA 2CU3A 2Z0DB 1YMHE 3H7PB 1I7HA 2D5GA 1RYJA 5KHOA 1FNWA 2JXXA 4KGSA 3AE5B 1FXAA 4B95A 4DBGA 1JROA 2RSUA 3V60A 3BK1A 2GI9A 1WXSA 2V3NA 3TEYA 2K3UA 2XN9C 4P6VF 1UGMA 2INCC 1E8ZA 3MHZA 1BT0A 4O1NA 3PT2B 1LXDA 2Z59B 5D3DA 3AEGB 2N1WA 1KRHA 1C4CA 3ZRFA 3P4RB 4TKNA 2NMQA 2N7JA 3PZ7A 1WR6E 4GU2A 1FRDA 4IM3A 1NYQA 3R3MA 1DOIA 2PTLA 1UF0A 1SE3A 2BTEA 1SIJA 1F2RC 4F7ZA 4MM3B 3FKYA 3HVZA 2JUOA 4JLCA 1CZPA 3TJPA 2BYFA 3RN9C 1N60A 3DBRI 3M3JA 4NZLB 4A3OA 2K8BA 4ZHPA 2AEHA 2WXIA 4M0WB 1HA5A 2CS4A 3EFCA 4DHZB 3ZNGC 4K81A 3T9LA 4HCPB 3A1QA 2IDYA 2BYEA 1XLPA 3AEFB 2JPHA 2J53A 3A9KB 3J9CA 4URKA 5D7GA 5FR6A 2WXQA 4JWSC 1XD3B 1YQ4B 4DHJB 3DVGY 4KIKA 2J7QB 3A1QB 4HPLB 4LNFA 2AQ2B 1K51A 2RD0A 3RNCC 4LTUA 3UIPB 1JRUA 4HDQA 1SE9A 5C23A 4ANWA 3AB5A 4EFOA 3V3XA 2DWQA 3TBLD 4AS1A 1E6EB 2SAKA 3AU5A 1YJ1A 1WI0A 2DZJA 2QDFA 3GE3C 2DNFA 2KT7A 1SJED 3QA8A 3Q3FA 5CTRC 4ARIA 4CHKA 1I4QA 3PS6A 5JHAA 3BVMA 3ZJVA 5BYSA 4S17A 4HCNB 1MFWA 2KN5A 3VAWA 1WGYA 4K7UA 2WXGA 1AARA 1D5XC 1OQYA 3N1ZC 3VTWA 4TMAB 1WM3A 1DYQA 2WHIA 1F0ZA 1B1ZA 3ETRA 1C3TA 3AE6B 4FXCA 4G3XB 2GB1A 1D5MC 3PRZA 4BKGA 2LGXA 3WCQA 3TL5A 2IO0B 2CR5A 1WGHA 2MBBB 5FR3A 3UINB 1GC6A 3PLUA 1UBQA 1ZGUB 3RZWC 3R8BA 2IGHA 3N20C 2BVCA 2Z0EB 1MJDA 3AEDB 1C76A 1K8RB 2KC1A 3NOBA 4HK2A 3RT3B 4FADA 2PIAA 2DZKA 2FCQA 4RCOA 1J7BA 4HPPA 3NUHB 1CQVA 2MSED 3ECIA 4MM3A 4YWGG 4L1BA 2BGFA 2WLBA 1WRIA 1WGKA 1XLNA 1F1HA 3QARA 4KZCA 5E6JA 3PRPB 3RNEC 3LDZE 1AYFA 1E90A 3M62B 2AYOB 4FJZA 3AU4A 3KH0A 2LASA 3SHQA 3FILA 3P42A 2RPQA 2LRWA 3ZRCA 4USAA 1WX9A 4W9FA 3C8YA 3L0WB 1N61A 3HHMA 3MP9A 3A9KA 1YJIA 1N62A 5DPTA 2DZMA 3VQIA 3FILB 4RM8A 1DOYA 3H8HA 3T3NA 3IT4B 2LVOA 2D07B 2PLPA 1T3QA 3BZDB 5LNK1 3ZGZA 3N3KB 1VD2A 3M95A 5J17A 4GXBA 3L08A 2LGSA 3VR9B 1NEKB 3MC9A 4ZRKA 2KVRA 1QOAA 2ASQA 1WYGA 1YD8U 2B3AA 2L0FA 4C80A 4AJWA 1WXMA 1K52A 4RGNA 2R61A 3T3OA 2PE9A 2O6VA 1UBIA 5GXGB 4PYUA 1H4RA 1FXIA 2W82A 3RD2A 2WNMA 4DK5A 1X1MA 3PV1A 3AEBB 1C9FA 4KVGB 2MBOA 3DBRB 1NI3A 3T8MA 2BKFA 3DCGA 5D3IB 5HHDG 4M8NA 4FJVB 3RFZB 4RGOS 1F52A 3DQVA 3GOEA 3BY4B 1QOFA 3IFWB 5IO9A 2WXFA 1WWTA 4IW0A 1I42A 1ENFA 4CYEA 5KHQA 3U7DA 5FK9C 4ZRIA 2KYWA 5HKHA 4OVUA 1RRBA 4PS8A 5AZGA 2VZKB 4XYCA 2G3QB 2KVZA 2JWUA 2AL3A 1F2RI 4MDKE 1WSPA 4YSZB 1TIFA 2BT6A 2RDGA 1YIWA 2DYOA 1QT9A 2LGDA 1U4AA 4L2YA 4ZRPA 4GIVA 1SXTA 5BYQA 4XX5A 4BOZB 1E10A 1WXQA 2KWVB 3CIRB 3UIOB 2J42A 3WIMA 2XNAC 2FCMA 4HJKA 3OJ3A 3E56A 4OVZA 1ZXIA 4ICUA 2HJ8A 3KLSX 4HPMB 3OWEB 2ZCCA 4IWPA 2WXJA 2KMMA 1KFYB 1BXTA 3U52E 3QAQA 1N5WA 4PS3A 1KJTA 1I4PA 1AW7A 4FBJB 2M17A 2NS5A 3EECA 3AH7A 2KTFA 2LD9A 4TQ0A 2KMCA 4II3B 4JWUC 1L0XB 2YVCA 1EWYC 2KQ7A 4H2AA 1WGRA 2KWCA 1VR9A 4XDCA 2WXOA 1IP9A 2MCNB 4PYZA 3VVWB 2JZPA 2O6VD 1DOXA 4OVVA 1EF5A 2CHZA 1V1OA 3ZDTA 1TT5B 2W3SA 3Q3MC 1YQ3B 2NBUA 1L7YA 2J52A 2CU1A 3CSFA 3AE8B 2KWDA 2E3TA 1Z5SB 3DBLB 1AWDA 4NAMA 4AP4C 2PKOA 2KANA 3UI3A 2L8JA 1R4MI 1J8CA 2MEKA 5T8IA 1OTRB 1TBEA 1F9JA 3VHTC 1KTKA 2CHXA 2FCNA 1E7VA 1L5PA 3NY5A 3U4EG 5BO4B 2K0PA 2UWQA 2NR2A 4FJYA 4K7WA 3LXFA 1GB4A 3E9SA 3P2BA 1C1YB 4J3OD 4YTPB 1YN3A 2PVGC 4NQKE 3DOWA 1LO5D 2NBVB 2VRRB 2L32A 3V05A 1RM6C 4YTMB 5LXHA 1YN5A 2W54A 3B2FA 3RNGC 1D6EC 2L00B 2INDC 3M63B 3R66C 4GMVA 2W9NA 1TY2A 1PQSA 3C0RB 1UD7A 1SGHA 1D4BA 3A4SC 5BMHA 4AOFA 4E74A 5G5GA 4P16A 1WE6A 3PREA 1FRRA 3QIJA 3ZNZB 3VH4B 2ZZPB 4AWJA 2JXTA 2WXPA 1TZ1A 3ZKJC 3V62A 1WM2A 2BB5A 1WMHA 3TCAA 1Q1OA 1C4AA 2YEPF 2K8HA 2DBYA 4A20A 3PPAA 3I63C 1WH3A 1IUEA 4MH8A 2IO2B 1CMXB 2O6VB 3NZ3A 2N0SB 2JYEA 4IM0A 1I4RA 1D3ZA 4J6IA 4LJPB 2FIFA 1FIQA 1QQRA 5AZHA 2KX3A 3UGBB 3BINA 4N9F4 3VXWA 3IAM1 1HEZE 2LVPA 1IBXA 3QX1A 1VRAB 4YT0B 4P1CC 4DQOC 2UYZB 1SB3C 4B6WA 4MJSB 1WZ3A 1C79A 1S3SG 1YX6B 1F77A 4DHJD 3N1XC 3ZYYX 2D3GA 1PGXA 1EO6A 4P1BC 1UUPA 3DHIC 2ZCBA 4Q2JA 3HM3A 3TIXA 2BQQA 2MJDA 4AJYB 4PT5A 2L0TA 3ZTCA 2PW9A 3SFDB 2RMMA 2QSDA 3FC4A 2UU7A 1IYFA 3Q69A 4DXGA 2SEBD 1EU4A 1MHXA 3KYDD 1OGWA
chains in the Genus database with same CATH topology
2GMIC 2LUEA 1WM3A 2GBKA 2BYVE 4HDOA 3SD5A 2JRHA 4GN1A 2KHWB 3X0WA 4E71A 3KW5B 1C3TA 4G3XB 3H9DA 3W1SA 3PRZA 1RLFA 3B08A 1NBFC 4BKGA 2LGXA 4MH0E 1MG8A 2G4DB 3TL5A 2IO0B 3ALBA 4BOSC 5DPWA 2CR5A 2LWPA 1WGHA 3U8ZA 5CHWA 2MBBB 3VH3B 3UINB 1GC6A 3PLUA 2KFJA 4W9KA 3JW0X 1UBQA 1ZGUB 4FHKA 3RZWC 1UZXB 3VTVA 1Q5WB 1LFDA 2KJ6A 4NAWB 4ZYNA 4W9DA 2K6DB 2XK5B 2Z0EB 3QCAA 2IYDB 1RFAA 1P3QU 2K8CA 4FHJA 3DVNV 5E6OA 1K8RB 2KC1A 3NOBA 4HK2A 3RT3B 3PRMB 5DCNA 4FADA 3PLVA 2DZKA 1I35A 3A33B 4MGZE 3PSEB 2FCQA 1ISNA 4JQWC 4GDKB 4GSWA 1WIAA 2J0JA 1WY8A 4JL9A 2WX0A 4KSLC 2MSED 2L05A 3ECIA 4MM3A 4MELA 5IAAC 4WQOB 3APCA 2KDIA 2BGFA 4IG7B 1S1QB 2LI5A 1V80A 4RM9A 2XK5A 3PHWB 2QHOA 2K1FA 4GGQA 1NI2A 4BBNC 2MA9B 4W9IA 3QARA 2FUHB 2KDFB 2KJRA 3WAMA 4KZCA 4BBNF 1V5OA 2PJHA 3K9PB 3PRPB 3ML8A 3LDZE 4ASWC 1E90A 2DAFA 2LJ5A 3M62B 2AYOB 4PS7A 4RMAA 2DAJA 4FJZA 4HXDA 2OOBB 3AU4A 1P1AA 3KH0A 5G55A 2V1YA 2LASA 4A3PA 5D2MB 2L7RA 5D6JB 4EEWA 2O2VA 3SHQA 4BKSD 3DBLI 4BKTA 3KUCB 3AULA 5EDSA 3OJ4B 2BPSA 2GBNA 4FULA 4TUUA 3O65B 2RPQA 4GDLA 4ZDVA 2LRWA 4TQ1A 3ZNID 1WGGA 3ONSA 3V61A 1P0RA 3ZRCA 2ZJDA 3UF8A 2KX0A 1WX9A 1P98A 1NDDA 4W9FA 3QQ8B 3MJWA 2M8SA 2LVQA 2KO3A 2PE6B 3L0WB 3HHMA 2XEWA 2ZVNA 3A9KA 2C60A 2BKRB 2DX5B 4W9JA 5D94A 5DPTA 4EZLA 2DZMA 2KQSA 2G4SA 2JT4B 3VQIA 4RM8A 2K39A 2BWES 2LRUA 2MQJA 2LVOA 2IY1B 3NZSA 3LJ3A 2D07B 1EUVB 4W9CA 2LZ6A 1OEYJ 3N3KB 4KZ0A 2M1MA 1VD2A 3M95A 2KDEB 3WANA 5J17A 4GXBA 3MHSD 3L08A 5JH5C 2N9EB 2YLMA 2ZVOA 5G2NA 3PGEA 1V5TA 3MTNB 2IY0B 4ZRKA 4KDLB 2LXAA 4YL8A 3IBEA 2L3ZA 2R2QA 3ZVVA 2KVRA 1WRDB 2ASQA 2RR9A 3QHTA 3EC8A 4CO7A 1YD8U 1V81A 2B3AA 2CHWA 2L0FA 3RZFA 4LCDE 4AJWA 3H7PA 3H6NA 1WXMA 4FA6A 5TR5A 4GOCA 4DDGD 2PE9A 2O6VA 4F1SA 1UBIA 2ZPNA 1GUAB 4PYUA 1H4RA 1WX8A 3B0AA 4BKSA 5L83A 4EZJA 1Q0WB 4MGKE 5J2RA 4P7IA 2C7NB 2CKHB 3JYUA 2IO1B 2WDTB 2AL6A 3CSTA 3QJZA 1QZEA 1V6EA 2GBJA 3RD2A 4DK5A 4W9HA 1X1MA 1WMHB 3PV1A 3NS8A 1UH6A 4NNJB 3DBSA 4KVGB 3WAPA 3H7SA 2MBOA 1V86A 1V9JA 1ZKHA 4WAAA 1TGZB 1E5WA 3AI5A 5CHFA 2BKFA 2V4LA 3DCGA 4I6NB 3T8MA 1V49A 4XZ4A 3ZUNA 1WE7A 2GBRA 4M8NA 3ZLZA 1E8XA 3RYTA 4FJVB 3I3TB 4II2B 1OEYA 4ICVA 4W9GA 3KUZA 2A5UA 2DHZA 3DQVA 3GOEA 3WALA 2D2QA 4W9LA 1KLVA 4NJ7A 3KYCD 4XC2A 4WWNA 3BY4B 2KKCA 1LQBA 3IFWB 4IWQA 2GOWA 3QWZB 2NCNA 4IW0A 2K25A 4B9KA 1I42A 4CYEA 2WYQA 4NQLB 2HTHA 4WWPA 5KHQA 3U7DA 2KFKB 2KWUB 1FXTB 2N1VA 4ZRIA 5HKHA 4OVUA 1RRBA 3ZO5B 1J0GA 4EZKA 4PS8A 3IG3A 5AZGA 2N7DA 4E3CA 3JVZX 2LXCA 1Z2MA 2G3QB 3B1LX 2JVCA 2V3SA 3A9JB 2AL3A 4M8MA 2MBQA 4MDKE 1G6JA 2RGFA 2DENB 2Y5BB 3HIZA 3CMMB 2KFKA 1RAXA 1YIWA 2DYOA 3L17A 1WJUA 5AZFA 3JSVB 2LGDA 3RUIB 1U4AA 1WGDA 4GIVA 4MEMA 4NY0A 3A4RA 4WJQA 3DVGX 4XX5A 4BOZB 2DYBA 4JIOU 3VFKA 2KWVB 2NPTA 3UIOB 4HLEA 4IUMB 3WIMA 4HWIB 1V2YA 3D32A 2KJHB 4K1RB 1SIFA 2FCSA 4NJ6A 3VUYA 4DXAB 2FCMA 5AEKB 3PHXB 2PPHA 4HJKA 1GJZA 1WF9A 1WYWB 3DDCB 2KXJA 2M0XA 3Q3JA 3OJ3A 3OLMD 1GG3A 3TMPB 4G11A 4NAWA 3ENEA 2KD0A 2HJ8A 2MLBA 3K9OB 1ZW7A 4ICUA 1WFYA 4HPMB 3ZDMC 4W9EA 4DHZE 2ZCCA 4IWPA 5CX3A 5E6PA 1WZ0A 4G0NB 2REXA 2NBWB 2MRPA 3QAQA 4PS3A 1KJTA 4FBJB 3RCZA 2M17A 2NS5A 2M4NA 3ZW3A 3EECA 3QC8B 2JF5A 4WWOA 2KTFA 2LD9A 4TQ0A 2KMCA 2MX2A 4II3B 3NZUA 4EOYA 2YVCA 5IA7A 5CHVC 2HD5B 2KQ7A 4MSMB 1WGRA 1WXAA 2KWCA 2I1KA 4LJOB 2FAZA 3VDZA 3UQBA 2IBIB 4I6LB 4DWFA 2KTRA 1IP9A 1WX7A 2MCNB 1WXVA 2AWTA 4PYZA 2O2VB 3VVWB 2EMSA 1M94A 2R2OA 2O6VD 2N7EA 4HVBA 1EF5A 4OVVA 2CHZA 3ZDTA 5L95C 2N9XA 2JZZA 3HK0A 1YX5B 4KDIC 3DBHI 3KVFB 4K7SA 2KC2A 1L7YA 2NBUA 4ANXA 3S2AA 1T0YA 1IPGA 2CU1A 3CSFA 4GDLB 3RULA 1L2NA 1Z5SB 1A5RA 2DYMA 3WAOA 2EMTA 4EKUA 2C7HA 3N32A 3SDLC 2Z0DB 4AP4C 4BVUC 3IHPC 3APDA 3H7PB 4DDID 2KANA 2L8JA 1R4MI 2IO3B 5KHOA 1J8CA 2JXXA 3VUWA 1OTRB 1TBEA 1F9JA 2EKEC 3VHTC 4GDKA 1KOTA 2CHXA 2FCNA 1E7VA 2MBEA 4B95A 4DBGA 4IWOA 2RSUA 2G45B 3NY5A 3IVFA 1R4NI 3V60A 1TTNA 1WXSA 5LXIB 5BO4B 2PEAA 3EFUA 2UWQA 4KIKB 2NR2A 2ZEQA 1WJ6A 4FJYA 5DPSA 3UQAA 1J19A 1VCBA 2KOXA 1UGMA 4K7WA 4WJNA 5DPRA 3P2BA 3PVLA 1C1YB 1E8ZA 4G50A 1BT0A 5JHBA 3PT2B 1LXDA 2A4ZA 2Z59B 3VUXA 1HE8A 2N1WA 3ZRFA 4MSQB 4TKNA 4NQKE 2WX1A 3DOWA 2NBVB 3OAWA 1WR6E 2VRRB 2C9WB 2JWZA 2KLCA 4GU2A 4IM3A 4ANVA 2FNJB 2KNBA 1GNUA 3R3MA 1KM7A 2MW5A 1YQBA 3ML9A 5LXHA 3PZDA 2C5LC 1E8YA 2MWSB 4ANUA 4X57B 2KZRA 3AXCA 4F7ZA 1XT9B 2L00B 2BF8B 2KK8A 4AUQC 2I1JA 3M63B 3R66C 4GMVA 3WA0A 2JRIB 2W9NA 4MGIE 2JUOA 4KSKC 1PQSA 3APFA 3C0RB 2ZPYA 3EHVA 1UD7A 3L10B 4JLCA 1SGHA 3DVNU 2J0MA 3A4SC 2BYFA 3R7RA 3TJPA 4LDTB 4AOFA 4E74A 3DBRI 1WE6A 3M3JA 4A3OA 2K8BA 4NPNA 3PREA 3X23A 1WR1A 2AEHA 3QIJA 2ZNVB 3ZNZB 3VH4B 2ZZPB 4M0WB 4WJOA 2MP2A 4ZRJA 3ZNHB 2OJRA 2CS4A 3VTUA 5E6NA 3NHEB 4AWJA 1TZ1A 4DHZB 4MJSA 2LGYA 2JY6A 3V62A 3ZKJC 1WM2A 4K81A 3ZNGC 3ZTDA 3T9LA 1E7UA 2D10A 1WMHA 2XBBC 1Q1OA 4WJPA 5GMVA 3TCAA 4HCPB 2GBMA 2K8HA 3A1QA 3W1YA 3DPDA 4A20A 4EUTA 4FN2A 3PPAA 1UELA 4BFRA 1WH3A 2C7MB 2K6QA 2BYEA 2KLGA 3L13A 2J0KA 2WWZA 2JPHA 2MP2B 3N30A 4JGHB 3A9KB 2IO2B 1CMXB 5D7GA 4URKA 2O6VB 3GZNI 5FR6A 3A9JA 3U30A 1GC7A 4IM0A 5LLIA 2NPTB 2N9PC 1D3ZA 1XD3B 4J6IA 4DHJB 3DVGY 4KIKA 4LDTD 2J7QB 3A1QB 4GB9A 4HPLB 4LJPB 2FIFA 1WJNA 2RD0A 3V6CB 2IZVB 5AZHA 2KX3A 3UIPB 1EF1A 1JRUA 4HDQA 2BWFA 1SE9A 3UGBB 3BINA 2NVUI 4N9F4 3VXWA 2KDBA 5C23A 4ANWA 2LVPA 3KUDB 1P9DU 1XQQA 1E8WA 4EFOA 3QX1A 3ZIMA 4F8CB 2DZIA 5JZEB 2UYZB 4IM2A 3L16A 4B6WA 2ZNVC 3TBLD 4MJSB 1WZ3A 4MGYE 4I6PA 3HM6X 1S3SG 1YX6B 3AU5A 3PTFC 4DHJD 1WJ4A 1YJ1A 1WI0A 2DZJA 2D11A 3SU8X 2D3GA 5J18A 1EO6A 3W1SC 3JSVA 2ZCBA 4TV3A 3HM3A 3R7QA 3QK0A 3TIXA 3QA8A 1H8CA 4AJYB 3Q3FA 2L0TA 2JZ3B 5CTRC 3ZTCA 4FLHA 2MBHA 4CHKA 3L54A 3PS6A 5C1ZA 4KV2A 5JHAA 3H1UA 1IYFA 2FIDA 4HCNB 2KN5A 3VAWA 1WGYA 2N4FA 4K7UA 1AARA 3CF6E 1OQYA 2HE7A 1OGWA 1LM8B 1Y8RC 4IC7B 3V6EB 2KTRB 3VTWA 3KYDD 2L76A 2KMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GMI C;  2LUE A;  1WM3 A;  2GBK A;  2BYV E;  4HDO A;  3SD5 A;  2JRH A;  4GN1 A;  2KHW B;  3X0W A;  4E71 A;  3KW5 B;  1C3T A;  4G3X B;  3H9D A;  3W1S A;  3PRZ A;  1RLF A;  3B08 A;  1NBF C;  4BKG A;  2LGX A;  4MH0 E;  1MG8 A;  2G4D B;  3TL5 A;  2IO0 B;  3ALB A;  4BOS C;  5DPW A;  2CR5 A;  2LWP A;  1WGH A;  3U8Z A;  5CHW A;  2MBB B;  3VH3 B;  3UIN B;  1GC6 A;  3PLU A;  2KFJ A;  4W9K A;  3JW0 X;  1UBQ A;  1ZGU B;  4FHK A;  3RZW C;  1UZX B;  3VTV A;  1Q5W B;  1LFD A;  2KJ6 A;  4NAW B;  4ZYN A;  4W9D A;  2K6D B;  2XK5 B;  2Z0E B;  3QCA A;  2IYD B;  1RFA A;  1P3Q U;  2K8C A;  4FHJ A;  3DVN V;  5E6O A;  1K8R B;  2KC1 A;  3NOB A;  4HK2 A;  3RT3 B;  3PRM B;  5DCN A;  4FAD A;  3PLV A;  2DZK A;  1I35 A;  3A33 B;  4MGZ E;  3PSE B;  2FCQ A;  1ISN A;  4JQW C;  4GDK B;  4GSW A;  1WIA A;  2J0J A;  1WY8 A;  4JL9 A;  2WX0 A;  4KSL C;  2MSE D;  2L05 A;  3ECI A;  4MM3 A;  4MEL A;  5IAA C;  4WQO B;  3APC A;  2KDI A;  2BGF A;  4IG7 B;  1S1Q B;  2LI5 A;  1V80 A;  4RM9 A;  2XK5 A;  3PHW B;  2QHO A;  2K1F A;  4GGQ A;  1NI2 A;  4BBN C;  2MA9 B;  4W9I A;  3QAR A;  2FUH B;  2KDF B;  2KJR A;  3WAM A;  4KZC A;  4BBN F;  1V5O A;  2PJH A;  3K9P B;  3PRP B;  3ML8 A;  3LDZ E;  4ASW C;  1E90 A;  2DAF A;  2LJ5 A;  3M62 B;  2AYO B;  4PS7 A;  4RMA A;  2DAJ A;  4FJZ A;  4HXD A;  2OOB B;  3AU4 A;  1P1A A;  3KH0 A;  5G55 A;  2V1Y A;  2LAS A;  4A3P A;  5D2M B;  2L7R A;  5D6J B;  4EEW A;  2O2V A;  3SHQ A;  4BKS D;  3DBL I;  4BKT A;  3KUC B;  3AUL A;  5EDS A;  3OJ4 B;  2BPS A;  2GBN A;  4FUL A;  4TUU A;  3O65 B;  2RPQ A;  4GDL A;  4ZDV A;  2LRW A;  4TQ1 A;  3ZNI D;  1WGG A;  3ONS A;  3V61 A;  1P0R A;  3ZRC A;  2ZJD A;  3UF8 A;  2KX0 A;  1WX9 A;  1P98 A;  1NDD A;  4W9F A;  3QQ8 B;  3MJW A;  2M8S A;  2LVQ A;  2KO3 A;  2PE6 B;  3L0W B;  3HHM A;  2XEW A;  2ZVN A;  3A9K A;  2C60 A;  2BKR B;  2DX5 B;  4W9J A;  5D94 A;  5DPT A;  4EZL A;  2DZM A;  2KQS A;  2G4S A;  2JT4 B;  3VQI A;  4RM8 A;  2K39 A;  2BWE S;  2LRU A;  2MQJ A;  2LVO A;  2IY1 B;  3NZS A;  3LJ3 A;  2D07 B;  1EUV B;  4W9C A;  2LZ6 A;  1OEY J;  3N3K B;  4KZ0 A;  2M1M A;  1VD2 A;  3M95 A;  2KDE B;  3WAN A;  5J17 A;  4GXB A;  3MHS D;  3L08 A;  5JH5 C;  2N9E B;  2YLM A;  2ZVO A;  5G2N A;  3PGE A;  1V5T A;  3MTN B;  2IY0 B;  4ZRK A;  4KDL B;  2LXA A;  4YL8 A;  3IBE A;  2L3Z A;  2R2Q A;  3ZVV A;  2KVR A;  1WRD B;  2ASQ A;  2RR9 A;  3QHT A;  3EC8 A;  4CO7 A;  1YD8 U;  1V81 A;  2B3A A;  2CHW A;  2L0F A;  3RZF A;  4LCD E;  4AJW A;  3H7P A;  3H6N A;  1WXM A;  4FA6 A;  5TR5 A;  4GOC A;  4DDG D;  2PE9 A;  2O6V A;  4F1S A;  1UBI A;  2ZPN A;  1GUA B;  4PYU A;  1H4R A;  1WX8 A;  3B0A A;  4BKS A;  5L83 A;  4EZJ A;  1Q0W B;  4MGK E;  5J2R A;  4P7I A;  2C7N B;  2CKH B;  3JYU A;  2IO1 B;  2WDT B;  2AL6 A;  3CST A;  3QJZ A;  1QZE A;  1V6E A;  2GBJ A;  3RD2 A;  4DK5 A;  4W9H A;  1X1M A;  1WMH B;  3PV1 A;  3NS8 A;  1UH6 A;  4NNJ B;  3DBS A;  4KVG B;  3WAP A;  3H7S A;  2MBO A;  1V86 A;  1V9J A;  1ZKH A;  4WAA A;  1TGZ B;  1E5W A;  3AI5 A;  5CHF A;  2BKF A;  2V4L A;  3DCG A;  4I6N B;  3T8M A;  1V49 A;  4XZ4 A;  3ZUN A;  1WE7 A;  2GBR A;  4M8N A;  3ZLZ A;  1E8X A;  3RYT A;  4FJV B;  3I3T B;  4II2 B;  1OEY A;  4ICV A;  4W9G A;  3KUZ A;  2A5U A;  2DHZ A;  3DQV A;  3GOE A;  3WAL A;  2D2Q A;  4W9L A;  1KLV A;  4NJ7 A;  3KYC D;  4XC2 A;  4WWN A;  3BY4 B;  2KKC A;  1LQB A;  3IFW B;  4IWQ A;  2GOW A;  3QWZ B;  2NCN A;  4IW0 A;  2K25 A;  4B9K A;  1I42 A;  4CYE A;  2WYQ A;  4NQL B;  2HTH A;  4WWP A;  5KHQ A;  3U7D A;  2KFK B;  2KWU B;  1FXT B;  2N1V A;  4ZRI A;  5HKH A;  4OVU A;  1RRB A;  3ZO5 B;  1J0G A;  4EZK A;  4PS8 A;  3IG3 A;  5AZG A;  2N7D A;  4E3C A;  3JVZ X;  2LXC A;  1Z2M A;  2G3Q B;  3B1L X;  2JVC A;  2V3S A;  3A9J B;  2AL3 A;  4M8M A;  2MBQ A;  4MDK E;  1G6J A;  2RGF A;  2DEN B;  2Y5B B;  3HIZ A;  3CMM B;  2KFK A;  1RAX A;  1YIW A;  2DYO A;  3L17 A;  1WJU A;  5AZF A;  3JSV B;  2LGD A;  3RUI B;  1U4A A;  1WGD A;  4GIV A;  4MEM A;  4NY0 A;  3A4R A;  4WJQ A;  3DVG X;  4XX5 A;  4BOZ B;  2DYB A;  4JIO U;  3VFK A;  2KWV B;  2NPT A;  3UIO B;  4HLE A;  4IUM B;  3WIM A;  4HWI B;  1V2Y A;  3D32 A;  2KJH B;  4K1R B;  1SIF A;  2FCS A;  4NJ6 A;  3VUY A;  4DXA B;  2FCM A;  5AEK B;  3PHX B;  2PPH A;  4HJK A;  1GJZ A;  1WF9 A;  1WYW B;  3DDC B;  2KXJ A;  2M0X A;  3Q3J A;  3OJ3 A;  3OLM D;  1GG3 A;  3TMP B;  4G11 A;  4NAW A;  3ENE A;  2KD0 A;  2HJ8 A;  2MLB A;  3K9O B;  1ZW7 A;  4ICU A;  1WFY A;  4HPM B;  3ZDM C;  4W9E A;  4DHZ E;  2ZCC A;  4IWP A;  5CX3 A;  5E6P A;  1WZ0 A;  4G0N B;  2REX A;  2NBW B;  2MRP A;  3QAQ A;  4PS3 A;  1KJT A;  4FBJ B;  3RCZ A;  2M17 A;  2NS5 A;  2M4N A;  3ZW3 A;  3EEC A;  3QC8 B;  2JF5 A;  4WWO A;  2KTF A;  2LD9 A;  4TQ0 A;  2KMC A;  2MX2 A;  4II3 B;  3NZU A;  4EOY A;  2YVC A;  5IA7 A;  5CHV C;  2HD5 B;  2KQ7 A;  4MSM B;  1WGR A;  1WXA A;  2KWC A;  2I1K A;  4LJO B;  2FAZ A;  3VDZ A;  3UQB A;  2IBI B;  4I6L B;  4DWF A;  2KTR A;  1IP9 A;  1WX7 A;  2MCN B;  1WXV A;  2AWT A;  4PYZ A;  2O2V B;  3VVW B;  2EMS A;  1M94 A;  2R2O A;  2O6V D;  2N7E A;  4HVB A;  1EF5 A;  4OVV A;  2CHZ A;  3ZDT A;  5L95 C;  2N9X A;  2JZZ A;  3HK0 A;  1YX5 B;  4KDI C;  3DBH I;  3KVF B;  4K7S A;  2KC2 A;  1L7Y A;  2NBU A;  4ANX A;  3S2A A;  1T0Y A;  1IPG A;  2CU1 A;  3CSF A;  4GDL B;  3RUL A;  1L2N A;  1Z5S B;  1A5R A;  2DYM A;  3WAO A;  2EMT A;  4EKU A;  2C7H A;  3N32 A;  3SDL C;  2Z0D B;  4AP4 C;  4BVU C;  3IHP C;  3APD A;  3H7P B;  4DDI D;  2KAN A;  2L8J A;  1R4M I;  2IO3 B;  5KHO A;  1J8C A;  2JXX A;  3VUW A;  1OTR B;  1TBE A;  1F9J A;  2EKE C;  3VHT C;  4GDK A;  1KOT A;  2CHX A;  2FCN A;  1E7V A;  2MBE A;  4B95 A;  4DBG A;  4IWO A;  2RSU A;  2G45 B;  3NY5 A;  3IVF A;  1R4N I;  3V60 A;  1TTN A;  1WXS A;  5LXI B;  5BO4 B;  2PEA A;  3EFU A;  2UWQ A;  4KIK B;  2NR2 A;  2ZEQ A;  1WJ6 A;  4FJY A;  5DPS A;  3UQA A;  1J19 A;  1VCB A;  2KOX A;  1UGM A;  4K7W A;  4WJN A;  5DPR A;  3P2B A;  3PVL A;  1C1Y B;  1E8Z A;  4G50 A;  1BT0 A;  5JHB A;  3PT2 B;  1LXD A;  2A4Z A;  2Z59 B;  3VUX A;  1HE8 A;  2N1W A;  3ZRF A;  4MSQ B;  4TKN A;  4NQK E;  2WX1 A;  3DOW A;  2NBV B;  3OAW A;  1WR6 E;  2VRR B;  2C9W B;  2JWZ A;  2KLC A;  4GU2 A;  4IM3 A;  4ANV A;  2FNJ B;  2KNB A;  1GNU A;  3R3M A;  1KM7 A;  2MW5 A;  1YQB A;  3ML9 A;  5LXH A;  3PZD A;  2C5L C;  1E8Y A;  2MWS B;  4ANU A;  4X57 B;  2KZR A;  3AXC A;  4F7Z A;  1XT9 B;  2L00 B;  2BF8 B;  2KK8 A;  4AUQ C;  2I1J A;  3M63 B;  3R66 C;  4GMV A;  3WA0 A;  2JRI B;  2W9N A;  4MGI E;  2JUO A;  4KSK C;  1PQS A;  3APF A;  3C0R B;  2ZPY A;  3EHV A;  1UD7 A;  3L10 B;  4JLC A;  1SGH A;  3DVN U;  2J0M A;  3A4S C;  2BYF A;  3R7R A;  3TJP A;  4LDT B;  4AOF A;  4E74 A;  3DBR I;  1WE6 A;  3M3J A;  4A3O A;  2K8B A;  4NPN A;  3PRE A;  3X23 A;  1WR1 A;  2AEH A;  3QIJ A;  2ZNV B;  3ZNZ B;  3VH4 B;  2ZZP B;  4M0W B;  4WJO A;  2MP2 A;  4ZRJ A;  3ZNH B;  2OJR A;  2CS4 A;  3VTU A;  5E6N A;  3NHE B;  4AWJ A;  1TZ1 A;  4DHZ B;  4MJS A;  2LGY A;  2JY6 A;  3V62 A;  3ZKJ C;  1WM2 A;  4K81 A;  3ZNG C;  3ZTD A;  3T9L A;  1E7U A;  2D10 A;  1WMH A;  2XBB C;  1Q1O A;  4WJP A;  5GMV A;  3TCA A;  4HCP B;  2GBM A;  2K8H A;  3A1Q A;  3W1Y A;  3DPD A;  4A20 A;  4EUT A;  4FN2 A;  3PPA A;  1UEL A;  4BFR A;  1WH3 A;  2C7M B;  2K6Q A;  2BYE A;  2KLG A;  3L13 A;  2J0K A;  2WWZ A;  2JPH A;  2MP2 B;  3N30 A;  4JGH B;  3A9K B;  2IO2 B;  1CMX B;  5D7G A;  4URK A;  2O6V B;  3GZN I;  5FR6 A;  3A9J A;  3U30 A;  1GC7 A;  4IM0 A;  5LLI A;  2NPT B;  2N9P C;  1D3Z A;  1XD3 B;  4J6I A;  4DHJ B;  3DVG Y;  4KIK A;  4LDT D;  2J7Q B;  3A1Q B;  4GB9 A;  4HPL B;  4LJP B;  2FIF A;  1WJN A;  2RD0 A;  3V6C B;  2IZV B;  5AZH A;  2KX3 A;  3UIP B;  1EF1 A;  1JRU A;  4HDQ A;  2BWF A;  1SE9 A;  3UGB B;  3BIN A;  2NVU I;  4N9F 4;  3VXW A;  2KDB A;  5C23 A;  4ANW A;  2LVP A;  3KUD B;  1P9D U;  1XQQ A;  1E8W A;  4EFO A;  3QX1 A;  3ZIM A;  4F8C B;  2DZI A;  5JZE B;  2UYZ B;  4IM2 A;  3L16 A;  4B6W A;  2ZNV C;  3TBL D;  4MJS B;  1WZ3 A;  4MGY E;  4I6P A;  3HM6 X;  1S3S G;  1YX6 B;  3AU5 A;  3PTF C;  4DHJ D;  1WJ4 A;  1YJ1 A;  1WI0 A;  2DZJ A;  2D11 A;  3SU8 X;  2D3G A;  5J18 A;  1EO6 A;  3W1S C;  3JSV A;  2ZCB A;  4TV3 A;  3HM3 A;  3R7Q A;  3QK0 A;  3TIX A;  3QA8 A;  1H8C A;  4AJY B;  3Q3F A;  2L0T A;  2JZ3 B;  5CTR C;  3ZTC A;  4FLH A;  2MBH A;  4CHK A;  3L54 A;  3PS6 A;  5C1Z A;  4KV2 A;  5JHA A;  3H1U A;  1IYF A;  2FID A;  4HCN B;  2KN5 A;  3VAW A;  1WGY A;  2N4F A;  4K7U A;  1AAR A;  3CF6 E;  1OQY A;  2HE7 A;  1OGW A;  1LM8 B;  1Y8R C;  4IC7 B;  3V6E B;  2KTR B;  3VTW A;  3KYD D;  2L76 A;  2KMA A; 
#chains in the Genus database with same CATH topology
 1FPY A;  3SD5 A;  1UNS A;  3AEE B;  3I9V 1;  2QMT A;  1DGJ A;  3X0W A;  4ZRQ A;  3B08 A;  1ZPS A;  1MG8 A;  2G4D B;  5FKA C;  1ZDX A;  2LWP A;  3U8Z A;  1JCK B;  1QLB B;  2OED A;  2KFJ A;  4RF1 A;  2VH1 A;  3VTV A;  1QIL A;  1IGD A;  2KJ6 A;  1YOV B;  2D3A A;  3QCA A;  2M56 B;  1RFA A;  1P3Q U;  4ACF A;  5E6O A;  3Q8B A;  3PRM B;  5DCN A;  3PLV A;  3PSE B;  2JU6 X;  4GSW A;  1WIA A;  2J0J A;  4KSL C;  2L05 A;  1Y56 A;  1NYR A;  4MEL A;  1ZOY B;  3Q2A C;  3APC A;  2KDI A;  1SE2 A;  1S1Q B;  2LI5 A;  3PHW B;  2QHO A;  2K1F A;  2JYT A;  2MA9 B;  2KDF B;  4ASW C;  4PS7 A;  4RMA A;  2DAJ A;  4HXD A;  2ONQ A;  2V1Y A;  2BW2 A;  3LB8 C;  5D2M B;  4BKS D;  3DBL I;  3AUL A;  1M4V A;  2GBN A;  1TS3 A;  4TQ1 A;  4DXF A;  4WH4 A;  2KX0 A;  3QQ8 B;  3MJW A;  4N58 A;  2KO3 A;  2XEW A;  2ZVN A;  2JT4 B;  3MC8 A;  2Y5C A;  2BWE S;  1V97 A;  2LRU A;  1KH0 A;  5HFY A;  1QF6 A;  1L6U A;  1OEY J;  4KZ0 A;  2M1M A;  2KDE B;  2N9E B;  5G2N A;  1GAQ B;  3MTN B;  4KDL B;  4RGT A;  4YL8 A;  3IBE A;  2L3Z A;  4KKJ A;  3ZVV A;  1VZ6 A;  2AX5 A;  4CO7 A;  4XDD A;  2CHW A;  3RZF A;  4LCD E;  3VRB B;  4LNN A;  3R2I A;  4DDG D;  3AE2 B;  3KWL A;  4HEA 1;  3W5V B;  3B0A A;  1STE A;  4MGK E;  4P7I A;  3CST A;  4YSX B;  4K3C A;  2IJ0 A;  4KGR A;  3H7S A;  1V9J A;  4WAA A;  3AI5 A;  1E5W A;  2V4L A;  4I6N B;  1V49 A;  2I2Y A;  1P7E A;  1E8X A;  3RYT A;  4M02 A;  1BUI C;  4XC2 A;  2KKC A;  4GLS C;  1LQB A;  2GOW A;  3QWZ B;  4CQN A;  2N9L A;  2WYQ A;  4NQL B;  2HTH A;  2KWU B;  5IP4 D;  1C4P A;  2WXM A;  2N7D A;  4E3C A;  2LXC A;  1Z2M A;  4C4V A;  3B1L X;  2MBQ A;  2RDH A;  2DEN B;  1RAX A;  3L17 A;  3JSV B;  1MPE A;  1WGD A;  4NY0 A;  1RFK A;  3VFK A;  5BMG A;  2NTT A;  3D32 A;  1SIF A;  4DXA B;  1I4X A;  3PHX B;  1GJZ A;  1WYW B;  2KXJ A;  3PZ8 A;  3Q3J A;  3TMP B;  4NAW A;  2MJ3 A;  3ENE A;  2MLB A;  4KX6 B;  1ZW7 A;  1HTO A;  4RFB A;  4W9E A;  4G0N B;  2MRP A;  1XLO A;  3NJT A;  1BML C;  2M4N A;  2QIE B;  3ZW3 A;  2WXK A;  4EOY A;  3TEZ A;  1QKZ A;  4MSM B;  2LHE A;  1JWU D;  2EKI A;  3GS2 A;  3N9Y C;  1XO3 A;  1TKG A;  2AWT A;  2O2V B;  1SBB B;  4C00 A;  4OZB A;  1M94 A;  5HG2 A;  3AE1 B;  1T5X D;  1V1P B;  2K22 A;  1PYW D;  5C2T B;  2MHJ A;  3VR8 B;  2JZZ A;  1YX5 B;  2L83 A;  3S2A A;  1T0Y A;  1P7F A;  1PGA A;  1A5R A;  1PGB A;  2DYM A;  3WAO A;  5IN7 A;  2C7H A;  3N32 A;  3SDL C;  2L1A A;  4C7Y A;  1K50 A;  3IHP C;  2RDB C;  4B0E A;  3W2D A;  3VUW A;  2EKE C;  2QC8 A;  2MBE A;  4IWO A;  2G45 B;  4R3D A;  3IVF A;  1R4N I;  3ABV B;  1TTN A;  1ESF A;  4RGM A;  3EFU A;  1GOZ A;  5DPS A;  3KWV A;  3UQA A;  2B76 B;  1J19 A;  1VCB A;  2KOX A;  5DPR A;  3PVL A;  5EE3 A;  1Q10 A;  1HZ5 A;  3VUX A;  1HE8 A;  1OQR A;  3AN1 A;  3OAW A;  2C9W B;  3C19 A;  2KLC A;  1TS5 A;  4ANV A;  2FNJ B;  2KNB A;  1KM7 A;  1E8Y A;  2KZR A;  3AXC A;  1XCT L;  1XT9 B;  4C4V B;  1N6Z A;  4AUQ C;  2I1J A;  3WA0 A;  4MGI E;  4KSK C;  3APF A;  3EHV A;  2ZPY A;  3L10 B;  4XWT A;  4LDT B;  1C77 A;  4KGT A;  1JAL A;  4IKG A;  2KQ4 X;  4NPN A;  1YNT E;  4US8 A;  3ZNH B;  2OJR A;  5E6N A;  3NHE B;  3VRA B;  1GPX A;  3FAH A;  2XBB C;  4WJP A;  5GMV A;  2WDQ B;  2GBM A;  2BYT A;  1J7C A;  1JML A;  3W1Y A;  3DPD A;  2JX5 A;  2KAC A;  4BFR A;  2D3B A;  2K6Q A;  2J0K A;  2WWZ A;  3BVG A;  2MP2 B;  4JGH B;  3I5J C;  1T0R C;  3DWM A;  3GZN I;  3A9J A;  1IBX B;  3U30 A;  1GC7 A;  4HRS A;  5LLI A;  2NPT B;  2EEL A;  4LDT D;  4GB9 A;  3GP7 A;  1FCC C;  1FM0 D;  1WJN A;  2IZV B;  4OZC A;  2BWF A;  2NVU I;  1AN8 A;  1A70 A;  3IT6 B;  3KUD B;  1XQQ A;  4LNK A;  4F8C B;  2DZI A;  5JZE B;  4IM2 A;  4I6P A;  1R4M B;  3HM6 X;  4N59 A;  5G5H A;  1WJ4 A;  1JQ4 A;  3HUI A;  3SU8 X;  3DHH C;  3W1S C;  2WDV B;  4A8X C;  4TV3 A;  3R7Q A;  2BBC A;  2X8X X;  1JRP A;  2JZ3 B;  3HVD A;  1ROE A;  2MBH A;  3MFG A;  3L54 A;  2FUG 1;  3ZXV A;  2N4F A;  1ZDV A;  2HE7 A;  1LM8 B;  4IC7 B;  3V6E B;  1V8C A;  2KTR B;  2L76 A;  2CJN A;  2GMI C;  2WP9 B;  2BYV E;  4HDO A;  1L0Y B;  2KHW B;  2LEK A;  1TJE A;  3H9D A;  3W1S A;  4A90 A;  1NBF C;  3NVV A;  4MH0 E;  1FEH A;  2WXH A;  4HJG E;  5DPW A;  3P1M A;  2KAJ A;  5CHW A;  3U2S C;  3VH3 B;  1FFV A;  4W9K A;  3JW0 X;  3AE9 B;  1UWM A;  5H8Y E;  1UZX B;  1Q5W B;  4NAW B;  4W9D A;  2K6D B;  2XK5 B;  4ITK A;  2IYD B;  1R7S A;  2K8C A;  4FHJ A;  2LGI A;  4OHJ A;  1I35 A;  3A33 B;  1L6V A;  4MGZ E;  4JQW C;  4GDK B;  1MI0 A;  2WXN A;  1WY8 A;  4JL9 A;  2WX0 A;  4UDU C;  3BVZ A;  1E7P B;  4RM9 A;  2XK5 A;  1VZ8 A;  3NS1 A;  4W9I A;  3RI7 C;  1IGC A;  2KJR A;  4BBN F;  3K9P B;  3RNA C;  3ML8 A;  5IOI A;  3ZJT A;  1V1P A;  1JWB D;  2OOB B;  5G55 A;  3R2T A;  4RF0 A;  4A3P A;  2O2V A;  4JPS A;  4BKT A;  3KUC B;  5EDS A;  3OJ4 B;  2BPS A;  4TUU A;  1K53 A;  4ZDV A;  3ZNI D;  1WGG A;  3ONS A;  3V61 A;  2ZJD A;  3UF8 A;  2V3P A;  1P98 A;  2LVQ A;  2PE6 B;  3AM9 A;  2C60 A;  2BKR B;  5D94 A;  4EZL A;  2KQS A;  2G4S A;  1R4N B;  2K39 A;  2IY1 B;  3NZS A;  4PK1 A;  3AV8 A;  1EUV B;  4LLG M;  2WS3 B;  2LZ6 A;  2W3R A;  1XXG A;  1MHH E;  2BS4 B;  2HTM E;  3MHS D;  2YLM A;  2M19 A;  2BS2 B;  3Q6B A;  3PGE A;  1V5T A;  2LXA A;  1WRD B;  3I57 A;  3QHT A;  4WWM A;  1VJK A;  1SSN A;  4OW0 A;  4ZYS A;  1RWS A;  4F1S A;  2ZPN A;  1GUA B;  4B0M A;  1WX8 A;  4M0W A;  5L83 A;  2JQR B;  3AE4 B;  2C7N B;  2CKH B;  3TUO A;  3QJZ A;  1CK1 A;  1QZE A;  1V6E A;  1ZE3 D;  2GBJ A;  2W55 A;  4W9H A;  4C56 C;  1SEB D;  3NS8 A;  1UH6 A;  4NNJ B;  2LFI A;  3WAP A;  1V86 A;  2IGD A;  1TYG B;  1TGZ B;  2E6X A;  1WE7 A;  1T0S C;  2GBR A;  3TSS A;  3ZLZ A;  4WIP A;  1XF5 L;  2LJI A;  3I3T B;  1OEY A;  2A5U A;  2DHZ A;  1TY0 A;  1ZP0 B;  2D2Q A;  2WDR B;  4NJ7 A;  3RMK C;  2NTS A;  3U7Z A;  2NCN A;  4B9K A;  2QCZ A;  2QIL A;  4IDI A;  4EZK A;  1JWA D;  3JVZ X;  4YSY B;  4MAC A;  2K9X A;  2V3S A;  1XCQ L;  3A9J B;  4M8M A;  4HKQ A;  1I4H A;  5JXV A;  4BAX A;  2I38 A;  3HIZ A;  5MPO A;  3CMM B;  2KFK A;  1JWM D;  5AZF A;  3RUI B;  4A6Q A;  4WJQ A;  2ICI A;  2KN4 A;  3A4R A;  4YTN B;  2DYB A;  4JIO U;  1HXY D;  2PMV A;  2NPT A;  4HLE A;  2KJH B;  1OQQ A;  5AEK B;  2PPH A;  1WF9 A;  2MJE A;  3RNF C;  1UGJ A;  2V0G A;  4G11 A;  1L4Z B;  2KD0 A;  3K9O B;  3Q3N C;  2INP E;  1WFY A;  5AUK A;  3ZDM C;  1TZO A;  4DHZ E;  4M00 A;  5CX3 A;  5E6P A;  1WZ0 A;  4A9A A;  1FMA D;  1JW9 D;  2GRI A;  2REX A;  3P63 A;  2ZW0 A;  3RCZ A;  2JF5 A;  2MX2 A;  4REZ A;  4C7Z A;  5CHV C;  3NRZ A;  1WXA A;  2I1K A;  2FAZ A;  2KTR A;  2VH2 A;  3AEA B;  1OFF A;  1WXV A;  2X38 A;  3B9J A;  2V9H A;  2EMS A;  4HKZ E;  3Q8E A;  4HVB A;  2IPK D;  5L95 C;  2FE8 A;  1C78 A;  3AMZ A;  3Q8C A;  3HK0 A;  2CJO A;  3DBH I;  2WQY B;  3KVF B;  2H88 B;  4K7S A;  4KKI A;  4ANX A;  3RUL A;  4GDL B;  2EMT A;  4EKU A;  1XLQ A;  2V4I B;  3KQ4 A;  4BVU C;  2ZW1 A;  3APD A;  2ACZ B;  4DDI D;  2IO3 B;  4QAY A;  4K3B A;  4GDK A;  1KOT A;  1N63 A;  1YN4 A;  4NJC A;  1T0Q C;  1HZ6 A;  2H89 B;  2TSS A;  3Q3O C;  5LXI B;  2PEA A;  4KIK B;  2ZEQ A;  1WJ6 A;  4XWW A;  3B2G A;  4WJN A;  4G50 A;  4LNI A;  5JHB A;  3BII D;  1D5Z C;  1EWC A;  2A4Z A;  2HJ1 A;  5C3J B;  4MSQ B;  1NEN B;  2WX1 A;  3ZJU A;  2MH7 A;  2JWZ A;  3SR6 A;  1GNU A;  1L0V B;  2MW5 A;  1YQB A;  3ML9 A;  1TKE A;  2WXR A;  3PZD A;  2C5L C;  5IKC M;  2D3C A;  2MWS B;  4ANU A;  4X57 B;  3EUB 2;  3ZQ4 A;  1FD6 A;  2ON8 A;  1E9M A;  2BF8 B;  2KK8 A;  2JRI B;  2AQ3 B;  2N9K A;  2J0M A;  3DVN U;  3R7R A;  3X23 A;  1WR1 A;  2ZNV B;  4RNA A;  4WJO A;  2MP2 A;  4ZRJ A;  4RH6 A;  3DHG C;  3VTU A;  3IXS A;  3OG5 A;  1ET6 A;  4MJS A;  2JY6 A;  2LGY A;  3GE8 C;  1TKY A;  3ZTD A;  1E7U A;  1SF0 A;  2D10 A;  2KDM A;  4IOI E;  3RNB C;  2FBW B;  4EUT A;  4FN2 A;  3AE7 B;  1MVK A;  1UEL A;  2C7M B;  2IGG A;  2KLG A;  3L13 A;  3N30 A;  3BK2 A;  1I4G A;  2G1E A;  2N9P C;  1B9R A;  2HDE A;  3URY A;  3SEB A;  1SJH D;  3V6C B;  2PVO D;  1EF1 A;  1KLG D;  2KDB A;  1P9D U;  1E8W A;  3ZIM A;  3P4P B;  3IAS 1;  3L16 A;  2ZNV C;  4MGY E;  2BS3 B;  3PTF C;  2D11 A;  2OJW A;  5J18 A;  3JSV A;  4M01 A;  3QK0 A;  1H8C A;  1TS2 A;  3P4S B;  1EU3 A;  4FLH A;  3Q8F A;  5C1Z A;  3MJ5 A;  4KV2 A;  3H1U A;  4AQ7 A;  2FID A;  1PFD A;  3CF6 E;  3GB1 A;  1Y8R C;  2QEJ C;  2KMA A;  2LUE A;  2RPV A;  2GBK A;  2JRH A;  4GN1 A;  4LK0 M;  4ZOH C;  1VDV A;  4LNO A;  2OHF A;  4E71 A;  3KW5 B;  2INN E;  1RLF A;  3CWI A;  5BMI A;  3HRD D;  3ALB A;  4BOS C;  1E0Z A;  2Y5P A;  4FHK A;  3LYY A;  2LMC A;  1LFD A;  4ZYN A;  3TEX A;  1LGR A;  5HI1 A;  2JSV X;  3DVN V;  1QOG A;  3Q14 C;  2GLS A;  3RPF C;  1ISN A;  2WU5 B;  3EA6 A;  3P4Q B;  2VZK D;  1CJE A;  5IAA C;  4WQO B;  4IG7 B;  1V80 A;  3TEW A;  4GGQ A;  1NI2 A;  4BBN C;  2FUH B;  1VLB A;  5BYR A;  3WAM A;  4WAF A;  1V5O A;  2PJH A;  5AUI A;  3DBH B;  4D2K A;  2DAF A;  4JX1 C;  2LJ5 A;  1HQR D;  3BYY B;  1FNV A;  1P1A A;  5EE9 A;  1TS4 A;  3NVW A;  4EEW A;  2L7R A;  5D6J B;  3NG0 A;  3NVZ A;  1ZUD 2;  4FUL A;  1NVI D;  4EE2 A;  3O65 B;  3NVY A;  4GDL A;  1P0R A;  1NDD A;  2M8S A;  3SFE B;  4A55 A;  2LUM A;  1SE4 A;  2DX5 B;  4W9J A;  3PO0 A;  3W5U B;  4L23 A;  2L52 A;  1YJJ A;  2G9H D;  2MQJ A;  3LJ3 A;  4W9C A;  4TSS A;  2LHD A;  3BWU D;  3WAN A;  1ZXH A;  4XGA B;  5JH5 C;  2ZVO A;  3L4P A;  3MC0 B;  2IY0 B;  2R2Q A;  2RR9 A;  2AQ1 B;  3EC8 A;  4MT5 A;  4YXD B;  3DWG C;  3N1Y C;  1V81 A;  3H7P A;  2Z8L A;  3H6N A;  4FA6 A;  5TR5 A;  3ZXR A;  3AE3 B;  4GOC A;  3Q8A A;  2J4X A;  1FCL A;  2WXL A;  4OZA A;  4N6E B;  4BKS A;  4EZJ A;  1Q0W B;  5J2R A;  3JYU A;  2IO1 B;  2WDT B;  2AL6 A;  1VZ7 A;  1WMH B;  5H92 C;  3DBS A;  4ZHO A;  1ZKH A;  1T6B X;  5CHF A;  4XZ4 A;  3ZUN A;  4II2 B;  4ICV A;  4W9G A;  4US9 A;  3KUZ A;  3WAL A;  2WGS A;  2DLB A;  4W9L A;  1KLV A;  3KYC D;  4WWN A;  1KF6 B;  4IWQ A;  1MG4 A;  1JWS D;  2Y3A A;  2K25 A;  5TSS A;  4WWP A;  2KFK B;  1FXT B;  2N1V A;  3GZN B;  2YEP B;  1PUT A;  3ZO5 B;  1J0G A;  3IG3 A;  4BZA A;  3EGR A;  1J7A A;  2JVC A;  1L4D B;  1UWX A;  1HTQ A;  1G6J A;  2BB6 A;  1ACC A;  1N5X A;  4S0R A;  2QJL A;  2RGF A;  2Y5B B;  1WJU A;  5EE1 A;  4MEM A;  3DVG X;  1FO4 A;  4IUM B;  4HWI B;  1V2Y A;  1KLU D;  4K1R B;  4NJ6 A;  2FCS A;  3VUY A;  1GB1 A;  4WQM A;  1FFU A;  3DDC B;  1FNU A;  2Q5W D;  2M0X A;  3OLM D;  3W9C B;  1GG3 A;  3AEC B;  4WUR A;  4HRO A;  2WU2 B;  3O13 A;  1QOB A;  1ET9 A;  2NBW B;  2M0A A;  3QC8 B;  4WWO A;  3NZU A;  5IA7 A;  2HD5 B;  4LJO B;  3VDZ A;  3UQB A;  2IBI B;  5EE0 A;  4I6L B;  4DWF A;  1WX7 A;  1PDX A;  2R2O A;  2N7E A;  3BYT B;  4JE3 B;  2N9X A;  4ARC A;  4KDI C;  2KC2 A;  4XE0 A;  1IPG A;  2K5P A;  1L2N A;  5I4D A;  1EM7 A;  1XEE A;  2CU3 A;  2Z0D B;  1YMH E;  3H7P B;  1I7H A;  2D5G A;  1RYJ A;  5KHO A;  1FNW A;  2JXX A;  4KGS A;  3AE5 B;  1FXA A;  4B95 A;  4DBG A;  1JRO A;  2RSU A;  3V60 A;  3BK1 A;  2GI9 A;  1WXS A;  2V3N A;  3TEY A;  2K3U A;  2XN9 C;  4P6V F;  1UGM A;  2INC C;  1E8Z A;  3MHZ A;  1BT0 A;  4O1N A;  3PT2 B;  1LXD A;  2Z59 B;  5D3D A;  3AEG B;  2N1W A;  1KRH A;  1C4C A;  3ZRF A;  3P4R B;  4TKN A;  2NMQ A;  2N7J A;  3PZ7 A;  1WR6 E;  4GU2 A;  1FRD A;  4IM3 A;  1NYQ A;  3R3M A;  1DOI A;  2PTL A;  1UF0 A;  1SE3 A;  2BTE A;  1SIJ A;  1F2R C;  4F7Z A;  4MM3 B;  3FKY A;  3HVZ A;  2JUO A;  4JLC A;  1CZP A;  3TJP A;  2BYF A;  3RN9 C;  1N60 A;  3DBR I;  3M3J A;  4NZL B;  4A3O A;  2K8B A;  4ZHP A;  2AEH A;  2WXI A;  4M0W B;  1HA5 A;  2CS4 A;  3EFC A;  4DHZ B;  3ZNG C;  4K81 A;  3T9L A;  4HCP B;  3A1Q A;  2IDY A;  2BYE A;  1XLP A;  3AEF B;  2JPH A;  2J53 A;  3A9K B;  3J9C A;  4URK A;  5D7G A;  5FR6 A;  2WXQ A;  4JWS C;  1XD3 B;  1YQ4 B;  4DHJ B;  3DVG Y;  4KIK A;  2J7Q B;  3A1Q B;  4HPL B;  4LNF A;  2AQ2 B;  1K51 A;  2RD0 A;  3RNC C;  4LTU A;  3UIP B;  1JRU A;  4HDQ A;  1SE9 A;  5C23 A;  4ANW A;  3AB5 A;  4EFO A;  3V3X A;  2DWQ A;  3TBL D;  4AS1 A;  1E6E B;  2SAK A;  3AU5 A;  1YJ1 A;  1WI0 A;  2DZJ A;  2QDF A;  3GE3 C;  2DNF A;  2KT7 A;  1SJE D;  3QA8 A;  3Q3F A;  5CTR C;  4ARI A;  4CHK A;  1I4Q A;  3PS6 A;  5JHA A;  3BVM A;  3ZJV A;  5BYS A;  4S17 A;  4HCN B;  1MFW A;  2KN5 A;  3VAW A;  1WGY A;  4K7U A;  2WXG A;  1AAR A;  1D5X C;  1OQY A;  3N1Z C;  3VTW A;  4TMA B;  1WM3 A;  1DYQ A;  2WHI A;  1F0Z A;  1B1Z A;  3ETR A;  1C3T A;  3AE6 B;  4FXC A;  4G3X B;  2GB1 A;  1D5M C;  3PRZ A;  4BKG A;  2LGX A;  3WCQ A;  3TL5 A;  2IO0 B;  2CR5 A;  1WGH A;  2MBB B;  5FR3 A;  3UIN B;  1GC6 A;  3PLU A;  1UBQ A;  1ZGU B;  3RZW C;  3R8B A;  2IGH A;  3N20 C;  2BVC A;  2Z0E B;  1MJD A;  3AED B;  1C76 A;  1K8R B;  2KC1 A;  3NOB A;  4HK2 A;  3RT3 B;  4FAD A;  2PIA A;  2DZK A;  2FCQ A;  4RCO A;  1J7B A;  4HPP A;  3NUH B;  1CQV A;  2MSE D;  3ECI A;  4MM3 A;  4YWG G;  4L1B A;  2BGF A;  2WLB A;  1WRI A;  1WGK A;  1XLN A;  1F1H A;  3QAR A;  4KZC A;  5E6J A;  3PRP B;  3RNE C;  3LDZ E;  1AYF A;  1E90 A;  3M62 B;  2AYO B;  4FJZ A;  3AU4 A;  3KH0 A;  2LAS A;  3SHQ A;  3FIL A;  3P42 A;  2RPQ A;  2LRW A;  3ZRC A;  4USA A;  1WX9 A;  4W9F A;  3C8Y A;  3L0W B;  1N61 A;  3HHM A;  3MP9 A;  3A9K A;  1YJI A;  1N62 A;  5DPT A;  2DZM A;  3VQI A;  3FIL B;  4RM8 A;  1DOY A;  3H8H A;  3T3N A;  3IT4 B;  2LVO A;  2D07 B;  2PLP A;  1T3Q A;  3BZD B;  5LNK 1;  3ZGZ A;  3N3K B;  1VD2 A;  3M95 A;  5J17 A;  4GXB A;  3L08 A;  2LGS A;  3VR9 B;  1NEK B;  3MC9 A;  4ZRK A;  2KVR A;  1QOA A;  2ASQ A;  1WYG A;  1YD8 U;  2B3A A;  2L0F A;  4C80 A;  4AJW A;  1WXM A;  1K52 A;  4RGN A;  2R61 A;  3T3O A;  2PE9 A;  2O6V A;  1UBI A;  5GXG B;  4PYU A;  1H4R A;  1FXI A;  2W82 A;  3RD2 A;  2WNM A;  4DK5 A;  1X1M A;  3PV1 A;  3AEB B;  1C9F A;  4KVG B;  2MBO A;  3DBR B;  1NI3 A;  3T8M A;  2BKF A;  3DCG A;  5D3I B;  5HHD G;  4M8N A;  4FJV B;  3RFZ B;  4RGO S;  1F52 A;  3DQV A;  3GOE A;  3BY4 B;  1QOF A;  3IFW B;  5IO9 A;  2WXF A;  1WWT A;  4IW0 A;  1I42 A;  1ENF A;  4CYE A;  5KHQ A;  3U7D A;  5FK9 C;  4ZRI A;  2KYW A;  5HKH A;  4OVU A;  1RRB A;  4PS8 A;  5AZG A;  2VZK B;  4XYC A;  2G3Q B;  2KVZ A;  2JWU A;  2AL3 A;  1F2R I;  4MDK E;  1WSP A;  4YSZ B;  1TIF A;  2BT6 A;  2RDG A;  1YIW A;  2DYO A;  1QT9 A;  2LGD A;  1U4A A;  4L2Y A;  4ZRP A;  4GIV A;  1SXT A;  5BYQ A;  4XX5 A;  4BOZ B;  1E10 A;  1WXQ A;  2KWV B;  3CIR B;  3UIO B;  2J42 A;  3WIM A;  2XNA C;  2FCM A;  4HJK A;  3OJ3 A;  3E56 A;  4OVZ A;  1ZXI A;  4ICU A;  2HJ8 A;  3KLS X;  4HPM B;  3OWE B;  2ZCC A;  4IWP A;  2WXJ A;  2KMM A;  1KFY B;  1BXT A;  3U52 E;  3QAQ A;  1N5W A;  4PS3 A;  1KJT A;  1I4P A;  1AW7 A;  4FBJ B;  2M17 A;  2NS5 A;  3EEC A;  3AH7 A;  2KTF A;  2LD9 A;  4TQ0 A;  2KMC A;  4II3 B;  4JWU C;  1L0X B;  2YVC A;  1EWY C;  2KQ7 A;  4H2A A;  1WGR A;  2KWC A;  1VR9 A;  4XDC A;  2WXO A;  1IP9 A;  2MCN B;  4PYZ A;  3VVW B;  2JZP A;  2O6V D;  1DOX A;  4OVV A;  1EF5 A;  2CHZ A;  1V1O A;  3ZDT A;  1TT5 B;  2W3S A;  3Q3M C;  1YQ3 B;  2NBU A;  1L7Y A;  2J52 A;  2CU1 A;  3CSF A;  3AE8 B;  2KWD A;  2E3T A;  1Z5S B;  3DBL B;  1AWD A;  4NAM A;  4AP4 C;  2PKO A;  2KAN A;  3UI3 A;  2L8J A;  1R4M I;  1J8C A;  2MEK A;  5T8I A;  1OTR B;  1TBE A;  1F9J A;  3VHT C;  1KTK A;  2CHX A;  2FCN A;  1E7V A;  1L5P A;  3NY5 A;  3U4E G;  5BO4 B;  2K0P A;  2UWQ A;  2NR2 A;  4FJY A;  4K7W A;  3LXF A;  1GB4 A;  3E9S A;  3P2B A;  1C1Y B;  4J3O D;  4YTP B;  1YN3 A;  2PVG C;  4NQK E;  3DOW A;  1LO5 D;  2NBV B;  2VRR B;  2L32 A;  3V05 A;  1RM6 C;  4YTM B;  5LXH A;  1YN5 A;  2W54 A;  3B2F A;  3RNG C;  1D6E C;  2L00 B;  2IND C;  3M63 B;  3R66 C;  4GMV A;  2W9N A;  1TY2 A;  1PQS A;  3C0R B;  1UD7 A;  1SGH A;  1D4B A;  3A4S C;  5BMH A;  4AOF A;  4E74 A;  5G5G A;  4P16 A;  1WE6 A;  3PRE A;  1FRR A;  3QIJ A;  3ZNZ B;  3VH4 B;  2ZZP B;  4AWJ A;  2JXT A;  2WXP A;  1TZ1 A;  3ZKJ C;  3V62 A;  1WM2 A;  2BB5 A;  1WMH A;  3TCA A;  1Q1O A;  1C4A A;  2YEP F;  2K8H A;  2DBY A;  4A20 A;  3PPA A;  3I63 C;  1WH3 A;  1IUE A;  4MH8 A;  2IO2 B;  1CMX B;  2O6V B;  3NZ3 A;  2N0S B;  2JYE A;  4IM0 A;  1I4R A;  1D3Z A;  4J6I A;  4LJP B;  2FIF A;  1FIQ A;  1QQR A;  5AZH A;  2KX3 A;  3UGB B;  3BIN A;  4N9F 4;  3VXW A;  3IAM 1;  1HEZ E;  2LVP A;  1IBX A;  3QX1 A;  1VRA B;  4YT0 B;  4P1C C;  4DQO C;  2UYZ B;  1SB3 C;  4B6W A;  4MJS B;  1WZ3 A;  1C79 A;  1S3S G;  1YX6 B;  1F77 A;  4DHJ D;  3N1X C;  3ZYY X;  2D3G A;  1PGX A;  1EO6 A;  4P1B C;  1UUP A;  3DHI C;  2ZCB A;  4Q2J A;  3HM3 A;  3TIX A;  2BQQ A;  2MJD A;  4AJY B;  4PT5 A;  2L0T A;  3ZTC A;  2PW9 A;  3SFD B;  2RMM A;  2QSD A;  3FC4 A;  2UU7 A;  1IYF A;  3Q69 A;  4DXG A;  2SEB D;  1EU4 A;  1MHX A;  3KYD D;  1OGW A; 
#chains in the Genus database with same CATH homology
 2GMI C;  2LUE A;  1WM3 A;  2GBK A;  2BYV E;  4HDO A;  3SD5 A;  2JRH A;  4GN1 A;  2KHW B;  3X0W A;  4E71 A;  3KW5 B;  1C3T A;  4G3X B;  3H9D A;  3W1S A;  3PRZ A;  1RLF A;  3B08 A;  1NBF C;  4BKG A;  2LGX A;  4MH0 E;  1MG8 A;  2G4D B;  3TL5 A;  2IO0 B;  3ALB A;  4BOS C;  5DPW A;  2CR5 A;  2LWP A;  1WGH A;  3U8Z A;  5CHW A;  2MBB B;  3VH3 B;  3UIN B;  1GC6 A;  3PLU A;  2KFJ A;  4W9K A;  3JW0 X;  1UBQ A;  1ZGU B;  4FHK A;  3RZW C;  1UZX B;  3VTV A;  1Q5W B;  1LFD A;  2KJ6 A;  4NAW B;  4ZYN A;  4W9D A;  2K6D B;  2XK5 B;  2Z0E B;  3QCA A;  2IYD B;  1RFA A;  1P3Q U;  2K8C A;  4FHJ A;  3DVN V;  5E6O A;  1K8R B;  2KC1 A;  3NOB A;  4HK2 A;  3RT3 B;  3PRM B;  5DCN A;  4FAD A;  3PLV A;  2DZK A;  1I35 A;  3A33 B;  4MGZ E;  3PSE B;  2FCQ A;  1ISN A;  4JQW C;  4GDK B;  4GSW A;  1WIA A;  2J0J A;  1WY8 A;  4JL9 A;  2WX0 A;  4KSL C;  2MSE D;  2L05 A;  3ECI A;  4MM3 A;  4MEL A;  5IAA C;  4WQO B;  3APC A;  2KDI A;  2BGF A;  4IG7 B;  1S1Q B;  2LI5 A;  1V80 A;  4RM9 A;  2XK5 A;  3PHW B;  2QHO A;  2K1F A;  4GGQ A;  1NI2 A;  4BBN C;  2MA9 B;  4W9I A;  3QAR A;  2FUH B;  2KDF B;  2KJR A;  3WAM A;  4KZC A;  4BBN F;  1V5O A;  2PJH A;  3K9P B;  3PRP B;  3ML8 A;  3LDZ E;  4ASW C;  1E90 A;  2DAF A;  2LJ5 A;  3M62 B;  2AYO B;  4PS7 A;  4RMA A;  2DAJ A;  4FJZ A;  4HXD A;  2OOB B;  3AU4 A;  1P1A A;  3KH0 A;  5G55 A;  2V1Y A;  2LAS A;  4A3P A;  5D2M B;  2L7R A;  5D6J B;  4EEW A;  2O2V A;  3SHQ A;  4BKS D;  3DBL I;  4BKT A;  3KUC B;  3AUL A;  5EDS A;  3OJ4 B;  2BPS A;  2GBN A;  4FUL A;  4TUU A;  3O65 B;  2RPQ A;  4GDL A;  4ZDV A;  2LRW A;  4TQ1 A;  3ZNI D;  1WGG A;  3ONS A;  3V61 A;  1P0R A;  3ZRC A;  2ZJD A;  3UF8 A;  2KX0 A;  1WX9 A;  1P98 A;  1NDD A;  4W9F A;  3QQ8 B;  3MJW A;  2M8S A;  2LVQ A;  2KO3 A;  2PE6 B;  3L0W B;  3HHM A;  2XEW A;  2ZVN A;  3A9K A;  2C60 A;  2BKR B;  2DX5 B;  4W9J A;  5D94 A;  5DPT A;  4EZL A;  2DZM A;  2KQS A;  2G4S A;  2JT4 B;  3VQI A;  4RM8 A;  2K39 A;  2BWE S;  2LRU A;  2MQJ A;  2LVO A;  2IY1 B;  3NZS A;  3LJ3 A;  2D07 B;  1EUV B;  4W9C A;  2LZ6 A;  1OEY J;  3N3K B;  4KZ0 A;  2M1M A;  1VD2 A;  3M95 A;  2KDE B;  3WAN A;  5J17 A;  4GXB A;  3MHS D;  3L08 A;  5JH5 C;  2N9E B;  2YLM A;  2ZVO A;  5G2N A;  3PGE A;  1V5T A;  3MTN B;  2IY0 B;  4ZRK A;  4KDL B;  2LXA A;  4YL8 A;  3IBE A;  2L3Z A;  2R2Q A;  3ZVV A;  2KVR A;  1WRD B;  2ASQ A;  2RR9 A;  3QHT A;  3EC8 A;  4CO7 A;  1YD8 U;  1V81 A;  2B3A A;  2CHW A;  2L0F A;  3RZF A;  4LCD E;  4AJW A;  3H7P A;  3H6N A;  1WXM A;  4FA6 A;  5TR5 A;  4GOC A;  4DDG D;  2PE9 A;  2O6V A;  4F1S A;  1UBI A;  2ZPN A;  1GUA B;  4PYU A;  1H4R A;  1WX8 A;  3B0A A;  4BKS A;  5L83 A;  4EZJ A;  1Q0W B;  4MGK E;  5J2R A;  4P7I A;  2C7N B;  2CKH B;  3JYU A;  2IO1 B;  2WDT B;  2AL6 A;  3CST A;  3QJZ A;  1QZE A;  1V6E A;  2GBJ A;  3RD2 A;  4DK5 A;  4W9H A;  1X1M A;  1WMH B;  3PV1 A;  3NS8 A;  1UH6 A;  4NNJ B;  3DBS A;  4KVG B;  3WAP A;  3H7S A;  2MBO A;  1V86 A;  1V9J A;  1ZKH A;  4WAA A;  1TGZ B;  1E5W A;  3AI5 A;  5CHF A;  2BKF A;  2V4L A;  3DCG A;  4I6N B;  3T8M A;  1V49 A;  4XZ4 A;  3ZUN A;  1WE7 A;  2GBR A;  4M8N A;  3ZLZ A;  1E8X A;  3RYT A;  4FJV B;  3I3T B;  4II2 B;  1OEY A;  4ICV A;  4W9G A;  3KUZ A;  2A5U A;  2DHZ A;  3DQV A;  3GOE A;  3WAL A;  2D2Q A;  4W9L A;  1KLV A;  4NJ7 A;  3KYC D;  4XC2 A;  4WWN A;  3BY4 B;  2KKC A;  1LQB A;  3IFW B;  4IWQ A;  2GOW A;  3QWZ B;  2NCN A;  4IW0 A;  2K25 A;  4B9K A;  1I42 A;  4CYE A;  2WYQ A;  4NQL B;  2HTH A;  4WWP A;  5KHQ A;  3U7D A;  2KFK B;  2KWU B;  1FXT B;  2N1V A;  4ZRI A;  5HKH A;  4OVU A;  1RRB A;  3ZO5 B;  1J0G A;  4EZK A;  4PS8 A;  3IG3 A;  5AZG A;  2N7D A;  4E3C A;  3JVZ X;  2LXC A;  1Z2M A;  2G3Q B;  3B1L X;  2JVC A;  2V3S A;  3A9J B;  2AL3 A;  4M8M A;  2MBQ A;  4MDK E;  1G6J A;  2RGF A;  2DEN B;  2Y5B B;  3HIZ A;  3CMM B;  2KFK A;  1RAX A;  1YIW A;  2DYO A;  3L17 A;  1WJU A;  5AZF A;  3JSV B;  2LGD A;  3RUI B;  1U4A A;  1WGD A;  4GIV A;  4MEM A;  4NY0 A;  3A4R A;  4WJQ A;  3DVG X;  4XX5 A;  4BOZ B;  2DYB A;  4JIO U;  3VFK A;  2KWV B;  2NPT A;  3UIO B;  4HLE A;  4IUM B;  3WIM A;  4HWI B;  1V2Y A;  3D32 A;  2KJH B;  4K1R B;  1SIF A;  2FCS A;  4NJ6 A;  3VUY A;  4DXA B;  2FCM A;  5AEK B;  3PHX B;  2PPH A;  4HJK A;  1GJZ A;  1WF9 A;  1WYW B;  3DDC B;  2KXJ A;  2M0X A;  3Q3J A;  3OJ3 A;  3OLM D;  1GG3 A;  3TMP B;  4G11 A;  4NAW A;  3ENE A;  2KD0 A;  2HJ8 A;  2MLB A;  3K9O B;  1ZW7 A;  4ICU A;  1WFY A;  4HPM B;  3ZDM C;  4W9E A;  4DHZ E;  2ZCC A;  4IWP A;  5CX3 A;  5E6P A;  1WZ0 A;  4G0N B;  2REX A;  2NBW B;  2MRP A;  3QAQ A;  4PS3 A;  1KJT A;  4FBJ B;  3RCZ A;  2M17 A;  2NS5 A;  2M4N A;  3ZW3 A;  3EEC A;  3QC8 B;  2JF5 A;  4WWO A;  2KTF A;  2LD9 A;  4TQ0 A;  2KMC A;  2MX2 A;  4II3 B;  3NZU A;  4EOY A;  2YVC A;  5IA7 A;  5CHV C;  2HD5 B;  2KQ7 A;  4MSM B;  1WGR A;  1WXA A;  2KWC A;  2I1K A;  4LJO B;  2FAZ A;  3VDZ A;  3UQB A;  2IBI B;  4I6L B;  4DWF A;  2KTR A;  1IP9 A;  1WX7 A;  2MCN B;  1WXV A;  2AWT A;  4PYZ A;  2O2V B;  3VVW B;  2EMS A;  1M94 A;  2R2O A;  2O6V D;  2N7E A;  4HVB A;  1EF5 A;  4OVV A;  2CHZ A;  3ZDT A;  5L95 C;  2N9X A;  2JZZ A;  3HK0 A;  1YX5 B;  4KDI C;  3DBH I;  3KVF B;  4K7S A;  2KC2 A;  1L7Y A;  2NBU A;  4ANX A;  3S2A A;  1T0Y A;  1IPG A;  2CU1 A;  3CSF A;  4GDL B;  3RUL A;  1L2N A;  1Z5S B;  1A5R A;  2DYM A;  3WAO A;  2EMT A;  4EKU A;  2C7H A;  3N32 A;  3SDL C;  2Z0D B;  4AP4 C;  4BVU C;  3IHP C;  3APD A;  3H7P B;  4DDI D;  2KAN A;  2L8J A;  1R4M I;  2IO3 B;  5KHO A;  1J8C A;  2JXX A;  3VUW A;  1OTR B;  1TBE A;  1F9J A;  2EKE C;  3VHT C;  4GDK A;  1KOT A;  2CHX A;  2FCN A;  1E7V A;  2MBE A;  4B95 A;  4DBG A;  4IWO A;  2RSU A;  2G45 B;  3NY5 A;  3IVF A;  1R4N I;  3V60 A;  1TTN A;  1WXS A;  5LXI B;  5BO4 B;  2PEA A;  3EFU A;  2UWQ A;  4KIK B;  2NR2 A;  2ZEQ A;  1WJ6 A;  4FJY A;  5DPS A;  3UQA A;  1J19 A;  1VCB A;  2KOX A;  1UGM A;  4K7W A;  4WJN A;  5DPR A;  3P2B A;  3PVL A;  1C1Y B;  1E8Z A;  4G50 A;  1BT0 A;  5JHB A;  3PT2 B;  1LXD A;  2A4Z A;  2Z59 B;  3VUX A;  1HE8 A;  2N1W A;  3ZRF A;  4MSQ B;  4TKN A;  4NQK E;  2WX1 A;  3DOW A;  2NBV B;  3OAW A;  1WR6 E;  2VRR B;  2C9W B;  2JWZ A;  2KLC A;  4GU2 A;  4IM3 A;  4ANV A;  2FNJ B;  2KNB A;  1GNU A;  3R3M A;  1KM7 A;  2MW5 A;  1YQB A;  3ML9 A;  5LXH A;  3PZD A;  2C5L C;  1E8Y A;  2MWS B;  4ANU A;  4X57 B;  2KZR A;  3AXC A;  4F7Z A;  1XT9 B;  2L00 B;  2BF8 B;  2KK8 A;  4AUQ C;  2I1J A;  3M63 B;  3R66 C;  4GMV A;  3WA0 A;  2JRI B;  2W9N A;  4MGI E;  2JUO A;  4KSK C;  1PQS A;  3APF A;  3C0R B;  2ZPY A;  3EHV A;  1UD7 A;  3L10 B;  4JLC A;  1SGH A;  3DVN U;  2J0M A;  3A4S C;  2BYF A;  3R7R A;  3TJP A;  4LDT B;  4AOF A;  4E74 A;  3DBR I;  1WE6 A;  3M3J A;  4A3O A;  2K8B A;  4NPN A;  3PRE A;  3X23 A;  1WR1 A;  2AEH A;  3QIJ A;  2ZNV B;  3ZNZ B;  3VH4 B;  2ZZP B;  4M0W B;  4WJO A;  2MP2 A;  4ZRJ A;  3ZNH B;  2OJR A;  2CS4 A;  3VTU A;  5E6N A;  3NHE B;  4AWJ A;  1TZ1 A;  4DHZ B;  4MJS A;  2LGY A;  2JY6 A;  3V62 A;  3ZKJ C;  1WM2 A;  4K81 A;  3ZNG C;  3ZTD A;  3T9L A;  1E7U A;  2D10 A;  1WMH A;  2XBB C;  1Q1O A;  4WJP A;  5GMV A;  3TCA A;  4HCP B;  2GBM A;  2K8H A;  3A1Q A;  3W1Y A;  3DPD A;  4A20 A;  4EUT A;  4FN2 A;  3PPA A;  1UEL A;  4BFR A;  1WH3 A;  2C7M B;  2K6Q A;  2BYE A;  2KLG A;  3L13 A;  2J0K A;  2WWZ A;  2JPH A;  2MP2 B;  3N30 A;  4JGH B;  3A9K B;  2IO2 B;  1CMX B;  5D7G A;  4URK A;  2O6V B;  3GZN I;  5FR6 A;  3A9J A;  3U30 A;  1GC7 A;  4IM0 A;  5LLI A;  2NPT B;  2N9P C;  1D3Z A;  1XD3 B;  4J6I A;  4DHJ B;  3DVG Y;  4KIK A;  4LDT D;  2J7Q B;  3A1Q B;  4GB9 A;  4HPL B;  4LJP B;  2FIF A;  1WJN A;  2RD0 A;  3V6C B;  2IZV B;  5AZH A;  2KX3 A;  3UIP B;  1EF1 A;  1JRU A;  4HDQ A;  2BWF A;  1SE9 A;  3UGB B;  3BIN A;  2NVU I;  4N9F 4;  3VXW A;  2KDB A;  5C23 A;  4ANW A;  2LVP A;  3KUD B;  1P9D U;  1XQQ A;  1E8W A;  4EFO A;  3QX1 A;  3ZIM A;  4F8C B;  2DZI A;  5JZE B;  2UYZ B;  4IM2 A;  3L16 A;  4B6W A;  2ZNV C;  3TBL D;  4MJS B;  1WZ3 A;  4MGY E;  4I6P A;  3HM6 X;  1S3S G;  1YX6 B;  3AU5 A;  3PTF C;  4DHJ D;  1WJ4 A;  1YJ1 A;  1WI0 A;  2DZJ A;  2D11 A;  3SU8 X;  2D3G A;  5J18 A;  1EO6 A;  3W1S C;  3JSV A;  2ZCB A;  4TV3 A;  3HM3 A;  3R7Q A;  3QK0 A;  3TIX A;  3QA8 A;  1H8C A;  4AJY B;  3Q3F A;  2L0T A;  2JZ3 B;  5CTR C;  3ZTC A;  4FLH A;  2MBH A;  4CHK A;  3L54 A;  3PS6 A;  5C1Z A;  4KV2 A;  5JHA A;  3H1U A;  1IYF A;  2FID A;  4HCN B;  2KN5 A;  3VAW A;  1WGY A;  2N4F A;  4K7U A;  1AAR A;  3CF6 E;  1OQY A;  2HE7 A;  1OGW A;  1LM8 B;  1Y8R C;  4IC7 B;  3V6E B;  2KTR B;  3VTW A;  3KYD D;  2L76 A;  2KMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...