2KQ7A

Solution structure of the autophagy-related protein atg8
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
119
structure length
119
Chain Sequence
GSMKSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of Atg8 reveals conformational polymorphism of the N-terminal domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords Autophagy-related protein 8
total genus 18
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kq7A01
3EHVA 4W9EA 1HE8A 2ZEQA 1QZEA 4HPMB 2KXJA 5DPTA 2HJ8A 4AJYB 5HKHA 3T9LA 3ZLZA 2JT4B 4E74A 1WZ0A 3H6NA 2KFJA 2DYBA 1BT0A 2IY0B 3A1QA 2DZKA 2LWPA 2L0FA 2PPHA 1IP9A 1WJ6A 4NAWA 2FNJB 4IM3A 4DHZB 2MWSB 4WJNA 2RR9A 4ANUA 4DBGA 2BPSA 2GBNA 4CHKA 1TTNA 3A33B 3TIXA 2WX0A 2G3QB 3PRZA 3WAOA 1WX8A 4K81A 5CX3A 1Z5SB 5E6OA 2KHWB 4JIOU 3PSEB 3PGEA 4EZLA 1WXAA 1FXTB 3QARA 4FULA 3HK0A 4RMAA 3C0RB 1WXSA 4NJ7A 2LI5A 3N30A 4B9KA 2R2QA 2L05A 1ZGUB 2FIFA 2XEWA 1V86A 2N7DA 4W9JA 2ZPYA 5DCNA 1KJTA 1SIFA 3P2BA 5JH5C 3A4SC 4HK2A 5GMVA 4DK5A 3AI5A 5AZGA 4KIKA 2K39A 4DXAB 2IBIB 2NBVB 3VH3B 2LRUA 2ZPNA 3H7PA 4P7IA 3DVNV 2ASQA 1T0YA 2FAZA 2YLMA 2ZVOA 5AZFA 5L95C 2BKRB 2CU1A 2KJ6A 3NZSA 2L00B 3SHQA 2N1VA 3EECA 3OLMD 3R3MA 1RFAA 1ISNA 1MG8A 5JHAA 1XQQA 4G11A 2C7NB 3V62A 1J19A 3IBEA 1E8XA 2KWVB 3QCAA 3MTNB 4DHJB 1H4RA 2PEAA 2L3ZA 5BO4B 2N9EB 3QA8A 2IO3B 4NY0A 3B1LX 1YD8U 4MELA 1WY8A 4FJVB 4OVUA 3ZTCA 2Y5BB 2G45B 2GBKA 2NS5A 2KZRA 1A5RA 3W1YA 3HM3A 4HXDA 2O2VA 4K7UA 3VTUA 3DVNU 3H1UA 2LJ5A 4XZ4A 1P98A 4YL8A 3U7DA 4CYEA 2J0KA 2KC2A 4LJOB 1VD2A 1VCBA 2KANA 4EOYA 4GIVA 1SGHA 3CF6E 4LJPB 1J8CA 1EUVB 4HCPB 1V9JA 2IO1B 4G3XB 4BBNF 1E7UA 2D07B 2M4NA 4LDTD 1WGYA 3R7QA 3ECIA 2KFKA 2C7HA 2Z0EB 2ZJDA 2FCSA 3OJ4B 2KN5A 1H8CA 1YJ1A 2KMCA 2M8SA 3NS8A 4KV2A 2B3AA 2K8BA 3R7RA 3UINB 3UIPB 3VH4B 1WGGA 1UH6A 3QX1A 1E8ZA 2J7QB 1UGMA 2MBQA 3VVWB 3L54A 2V1YA 2K6QA 2N4FA 1WR6E 2ZNVC 4KSLC 1OGWA 1GC7A 1L7YA 4ZDVA 2D3GA 4AOFA 2KDEB 4FHJA 2HE7A 3B08A 2MP2B 3DPDA 4PS7A 3A9JB 3M63B 3DBRI 1RRBA 4I6NB 2NBUA 4GDLB 5EDSA 4MJSB 2L7RA 1NBFC 2IZVB 5AZHA 5G55A 2NCNA 3A9KA 4W9LA 1GJZA 1P3QU 3R66C 4WWOA 4KZCA 4N9F4 2BGFA 2XK5A 4HWIB 1WJNA 5KHOA 2RGFA 3L13A 3K9PB 3ALBA 1E5WA 4TQ1A 4M8NA 2YVCA 3H9DA 2KOXA 2FIDA 3WIMA 3HHMA 3QK0A 2G4SA 1TBEA 4WJOA 4BKSA 1OEYJ 1WI0A 5IA7A 2MX2A 3M95A 3NY5A 3TL5A 2AYOB 4FLHA 4NNJB 4EZKA 2J0JA 5J17A 3PRPB 3DBSA 4ICUA 3QHTA 4ANWA 3DBHI 2JZZA 2GBJA 2RPQA 2ZVNA 2KDFB 3A9JA 4AUQC 5LXHA 4NJ6A 1WMHA 1V5TA 2BYVE 3AU5A 3ZUNA 4MJSA 4FADA 3DDCB 3VQIA 3UQAA 5DPRA 1NDDA 1PQSA 2NR2A 1WM2A 2AWTA 3RD2A 4G0NB 3KYCD 2CS4A 4WJQA 3A4RA 4BVUC 1C1YB 5C23A 1WGHA 2EMSA 2EMTA 2JY6A 3ONSA 3PVLA 4KDIC 4MGIE 4W9GA 1ZKHA 3EC8A 5JHBA 2GMIC 4WJPA 2MBHA 4MH0E 3RT3B 5AEKB 3DCGA 4B95A 3H7PB 3IFWB 5E6NA 3ZTDA 1Q5WB 4TUUA 2KWCA 3VFKA 1YX6B 2ZCBA 3IG3A 4K1RB 5DPWA 2KX3A 1WXVA 2CHZA 2L8JA 3IHPC 3KVFB 3QC8B 2BF8B 3N3KB 4W9KA 4ANVA 1U4AA 2EKEC 3TCAA 2LRWA 4ASWC 2O2VB 4II2B 3W1SC 4RM9A 4E3CA 5CHVC 2MW5A 3DQVA 2KKCA 3VAWA 4IW0A 4EKUA 3ZRCA 1WJ4A 2L76A 2JF5A 4W9CA 3TMPB 3RUIB 3RZFA 2K8HA 1M94A 4K7SA 4DWFA 2N7EA 3L16A 2AL3A 3KUDB 1WGRA 4HCNB 4ZYNA 1E7VA 2IY1B 2JXXA 2KDBA 4M8MA 4WQOB 3WAPA 4EFOA 4BKGA 5C1ZA 4FJYA 2LVOA 3V60A 2GOWA 2OOBB 2CHWA 3LJ3A 1S1QB 4LCDE 3SDLC 4MGKE 2XBBC 3UGBB 1GUAB 4DDID 4HDQA 4JGHB 5FR6A 4TKNA 4FJZA 3QJZA 1KOTA 3ZNGC 1E8WA 4GXBA 1Q1OA 2N9PC 2ZNVB 2M0XA 3D32A 4MSMB 2D11A 3APCA 3ZRFA 3O65B 2GBMA 2JRIB 3PLVA 4WAAA 3APFA 1WIAA 4EZJA 4GDLA 1IYFA 1P9DU 3VHTC 3ML9A 4IWOA 5CHWA 3TJPA 1WMHB 2KJRA 3JW0X 1ZW7A 3L0WB 2WYQA 4ZRIA 4CO7A 3L08A 3PTFC 4X57B 3S2AA 3ZNID 1KM7A 2JUOA 2KJHB 4LDTB 3UF8A 3QIJA 2BWES 3VUYA 3PRMB 1X1MA 2Z59B 1WE6A 2FUHB 3APDA 4MGYE 3KYDD 4FHKA 2MCNB 5D94A 2D2QA 2WWZA 1S3SG 3M62B 1AARA 4K7WA 4PS3A 1TZ1A 1WJUA 2CHXA 4MM3A 2K8CA 4MSQB 2M1MA 4ANXA 5CTRC 1GG3A 4ZRJA 1Y8RC 4AJWA 4DHJD 2OJRA 3SU8X 5D7GA 4IWQA 1WYWB 1WFYA 1LQBA 3M3JA 1WF9A 2J0MA 1EO6A 1OQYA 3PT2B 4BKTA 3KUCB 3MHSD 3QQ8B 1LM8B 3L17A 1XT9B 2L0TA 1V81A 2C5LC 2CR5A 2O6VB 3QWZB 3RULA 3GZNI 4AP4C 2KTFA 1RLFA 4PYUA 3ZO5B 2MP2A 4KSKC 4F7ZA 1C3TA 3OAWA 4F8CB 2MRPA 3AULA 2GBRA 1P1AA 2N1WA 1LFDA 3PHXB 4AWJA 2DHZA 3NOBA 1SE9A 2O6VA 4BOSC 4B6WA 5D2MB 3RCZA 4W9DA 1OTRB 1R4MI 2JWZA 3ZIMA 2DYMA 2BKFA 2JZ3B 3V61A 3HIZA 2JPHA 4KIKB 3Q3JA 3WAMA 3ZNZB 3QAQA 2K6DB 2I1JA 2KDIA 1RAXA 4II3B 3DBLI 4W9FA 2MSED 2LVPA 3VDZA 3DOWA 4BKSD 3HM6X 4WWPA 4GGQA 1UD7A 4IM0A 5LXIB 1V6EA 3I3TB 5L83A 3PZDA 2A5UA 4A3PA 4I6LB 1V80A 5KHQA 2KTRA 2A4ZA 2KX0A 3WANA 4NAWB 3WA0A 2AEHA 4TV3A 4HPLB 4HJKA 2XK5B 4BOZB 1CMXB 3UQBA 1I35A 1LXDA 2KLGA 3ZDMC 3IVFA 1WE7A 4G50A 4GB9A 5DPSA 4KVGB 3ZVVA 2LD9A 4ICVA 2IO2B 1WGDA 4JLCA 1Q0WB 1P0RA 3ZDTA 3WALA 3CMMB 4FBJB 4J6IA 3VXWA 2DYOA 2LXCA 2DAJA 3VTVA 2KD0A 5G2NA 1J0GA 1G6JA 2FCNA 2VRRB 4DDGD 1XD3B 3ZW3A 2UYZB 3L10B 4KZ0A 3X23A 5J18A 3JYUA 3BINA 4KDLB 2KO3A 2LASA 4A3OA 2KTRB 2C7MB 3VUXA 1F9JA 2IYDB 1V5OA 2BYEA 4HDOA 3ZNHB 2KVRA 2LGDA 4FN2A 4XX5A 1WH3A 4JQWC 1WM3A 2R2OA 2DZJA 3W1SA 2DENB 2KFKB 3CSFA 3EFUA 2DZIA 2REXA 2FCQA 2LGYA 3K9OB 3V6EB 2DAFA 3U30A 2PE9A 2MBOA 2V4LA 2K25A 1NI2A 1E90A 1UELA 1V2YA 2V3SA 1WR1A 3JVZX 2NBWB 3PPAA 4M0WB 5CHFA 2BYFA 4GN1A 2MQJA 2KQ7A 2NPTB 1GNUA 4GDKB 5J2RA 4XC2A 2AL6A 2D10A 4JL9A 2DX5B 1WZ3A 4GOCA 3KH0A 1YX5B 4GSWA 4NQKE 4PYZA 3LDZE 4HVBA 4GMVA 4IUMB 2G4DB 4NQLB 3NHEB 3VUWA 2LVQA 2WDTB 4HLEA 3CSTA 5TR5A 1OEYA 1KLVA 1EF1A 3A9KB 2JRHA 1R4NI 2DZMA 3JSVB 4BFRA 3X0WA 2M17A 2KNBA 2MLBA 3PREA 2LXAA 3A1QB 1WX7A 2C60A 2KC1A 2N9XA 2O6VD 4MDKE 2KK8A 2NVUI 2I1KA 1UBIA 5E6PA 2UWQA 4A20A 2PJHA 4IM2A 1GC6A 2KLCA 1UBQA 2MBEA 2KWUB 4W9HA 2JVCA 1UZXB 3AXCA 2IO0B 1L2NA 4MGZE 1K8RB 1V49A 1EF5A 4GDKA 4IWPA 4W9IA 4EEWA 4F1SA 2K1FA 1JRUA 2LUEA 1WRDB 2HD5B 2HTHA 3KUZA 4I6PA 3PS6A 3TBLD 4GU2A 1WX9A 4IC7B 1Z2MA 1I42A 2QHOA 2NPTA 2RSUA 3PLUA 2CKHB 5LLIA 2PE6B 3VTWA 1YQBA 4TQ0A 2RD0A 4URKA 2W9NA 3SD5A 3Q3FA 1IPGA 3UIOB 3ML8A 4WWNA 4E71A 1D3ZA 1WXMA 3DVGY 3MJWA 2Z0DB 2ZCCA 4OVVA 3BY4B 3U8ZA 4BBNC 4EUTA 3RZWC 3ENEA 1YIWA 2MBBB 2KQSA 2ZZPB 3T8MA 3V6CB 2FCMA 1E8YA 2KMAA 4MEMA 4FA6A 3DVGX 3AU4A 2LGXA 3JSVA 4NPNA 3RYTA 3ZKJC 3N32A 3PHWB 2LZ6A 3GOEA 3PV1A 4IG7B 3B0AA 4ZRKA 5IAAC 2C9WB 2MA9B 3OJ3A 3KW5B 5JZEB 1TGZB 3H7SA 4PS8A 2BWFA 5D6JB 4RM8A 3NZUA 4DHZE 2WX1A
chains in the Genus database with same CATH superfamily
4W9EA 1N61A 1NI3A 3RMKC 2BTEA 2HJ8A 3I9V1 3T9LA 3ZLZA 3AMZA 1WZ0A 4JWUC 2IY0B 4JWSC 2PPHA 1L4DB 4M0WA 3KLSX 3U4EG 1T0RC 4WJNA 3ZXVA 2GBNA 1TTNA 1TKYA 2JXTA 5E6OA 2KHWB 4JIOU 3PSEB 3PGEA 3QARA 4RMAA 1WXSA 1XLOA 4KGTA 5AUKA 1RM6C 3N30A 3E56A 1C78A 1E10A 4B9KA 2R2QA 1NVID 3R8BA 4LTUA 5DCNA 3I57A 3A4SC 4DK5A 4KIKA 2K39A 5BMGA 2CU3A 2W82A 5GXGB 3VH3B 3H7PA 4P7IA 3KQ4A 4HJGE 2ASQA 1A70A 3OLMD 1MG8A 3AEBB 1J19A 1N6ZA 1E8XA 1EU4A 4DHJB 2N9EB 2QDFA 3QA8A 1FD6A 2IO3B 2XN9C 3B1LX 3ZTCA 2JWUA 2GBKA 4KKJA 2KZRA 2JYTA 4C56C 4YTNB 2O2VA 3VTUA 4XZ4A 1P98A 3BYYB 4YL8A 1SBBB 2J0KA 2KC2A 4K3BA 1TS2A 1SGHA 4YT0B 1EUVB 1QILA 4LNFA 2D07B 3OJ4B 1H8CA 1YJ1A 1ZXHA 3NS8A 3UINB 2B3AA 1B1ZA 3UIPB 1F77A 3VVWB 1WR6E 4KSLC 4XGAB 1OGWA 4WQMA 4AOFA 2HE7A 1UGJA 1JMLA 1RRBA 2IZVB 5EE0A 2W3SA 1P3QU 3R66C 5BYQA 5I4DA 2WHIA 1QLBB 2XK5A 1WJNA 1YN4A 3ALBA 4M8NA 4YTPB 3H9DA 1PGAA 1WI0A 5IA7A 4HPPA 2MX2A 2K3UA 3AH7A 4EZKA 2IGHA 3PRPB 4ANWA 3PZ8A 3MFGA 1XEEA 3VQIA 1NDDA 2AWTA 4G0NB 2NTTA 2G1EA 4WJQA 5H92C 4IOIE 4ITKA 1BMLC 1WGHA 3ONSA 4MGIE 3ZXRA 3J9CA 2GMIC 1KFYB 1FPYA 3DCGA 3H7PB 4YXDB 2ZCBA 1JWBD 1V1PB 2PLPA 2ZW1A 2FUG1 4ZHPA 4ASWC 2LRWA 2KQ4X 3Q69A 5CHVC 3DQVA 3ZRCA 1DOXA 4K7SA 2N7EA 3L16A 2KDBA 4FJYA 2LVOA 3V60A 2OOBB 4LCDE 2WDQB 2XBBC 4MGKE 4JGHB 2J42A 3NZ3A 1SE3A 1E8WA 4S17A 3APCA 2JRIB 4TMAB 4WAAA 4L1BA 1WIAA 1E0ZA 2KJRA 4FXCA 2AX5A 1ZUD2 3L0WB 4HKZE 4CO7A 3L08A 3KWLA 3ZNID 3UF8A 3VUYA 2Z59B 1WE6A 2FUHB 3FC4A 2JU6X 3KYDD 1S3SG 1V1OA 3O13A 4K7WA 1I4RA 1F2RI 1TZ1A 4MM3A 2LHDA 4MSQB 4ANXA 4OZAA 5CTRC 3HVDA 1Y8RC 4DHJD 3Q14C 3SU8X 5D7GA 1BXTA 4A8XC 1WYWB 4EE2A 5HFYA 1MJDA 2WNMA 1VZ8A 1AW7A 1LM8B 3L17A 1XT9B 2L0TA 2C5LC 3QWZB 2BQQA 3GZNI 3RN9C 1D5ZC 3OAWA 2MRPA 3AULA 2PTLA 2N1WA 4AWJA 2WS3B 3H8HA 2O6VA 2M56B 1STEA 1SSNA 1ROEA 2DYMA 2BKFA 3V61A 4KIKB 3V3XA 2KT7A 2LVPA 1XXGA 4WWPA 1UD7A 3DWGC 4IM0A 1IGCA 3GB1A 3PZDA 2A5UA 2W3RA 2VH1A 2H89B 1NYRA 3WANA 4NAWB 5EE9A 4TV3A 2XK5B 1I35A 3IVFA 1WE7A 4G50A 3ZVVA 3BVGA 3SFEB 4JLCA 1P0RA 1N5XA 1FEHA 1E9MA 2LXCA 5G2NA 1LO5D 1FFUA 4DDGD 1XD3B 1AWDA 3DHGC 1TKEA 1B9RA 1XLNA 4KZ0A 3N9YC 1FFVA 1EWCA 2KO3A 2LASA 1I4QA 2LGDA 4XX5A 1WM3A 2DENB 1T6BX 3EFUA 2DWQA 3W9CB 2WXIA 2DAFA 2V4LA 1WWTA 2RDHA 2K25A 1WR1A 5CHFA 3BZDB 1V1PA 4UDUC 2KQ7A 4S0RA 2DX5B 1ESFA 3DBHB 1FCCC 4NQKE 3LDZE 2G4DB 3NHEB 1SEBD 5TR5A 1KLVA 1LGRA 1R4NI 3NVZA 1UNSA 4BFRA 3TSSA 2KNBA 1EM7A 1WX7A 2C60A 2KC1A 2O6VD 1UBIA 2HDEA 4IDIA 2WXOA 2KLCA 4J3OD 4XWWA 1K8RB 1EF5A 1NYQA 3FAHA 1WX9A 2QHOA 3MC0B 3PLUA 2CKHB 3PZ7A 2GLSA 2RD0A 2DBYA 3Q3FA 1IPGA 1SJHD 3UIOB 3Q8AA 1D3ZA 2Z0DB 2ZCCA 4OVVA 4BBNC 2Q5WD 4N58A 4L2YA 3V6CB 1E8YA 2KMAA 3ZKJC 3P4PB 3N32A 2ZW0A 3AEAB 1FMAD 3H7SA 5D6JB 3RNFC 2BBCA 3EA6A 3R2TA 3EHVA 5DPTA 4RF0A 5HKHA 2JT4B 2W54A 5FKAC 3RPFC 4B0EA 1F2RC 1MG4A 2FNJB 2D3CA 4IM3A 4DHZB 3B9JA 4ANUA 1F52A 3TIXA 2WX0A 2G3QB 4K81A 5CX3A 4XE0A 1FXTB 1I4HA 4NJ7A 3GE8C 3SFDB 4C7ZA 4USAA 2XEWA 1V86A 4W9JA 1KJTA 1PUTA 4HK2A 4L23A 4DXAB 1DOYA 1QOGA 1HQRD 2FAZA 2YLMA 5L95C 2N1VA 1IGDA 3R3MA 1RFKA 1XQQA 4G11A 3Q8BA 3V62A 3Q8FA 3EUB2 1KLUD 1YD8U 1WY8A 1ENFA 2G45B 1XO3A 5H8YE 4RCOA 2E3TA 1FXAA 1A5RA 3W1YA 4HXDA 3DVNU 3U7DA 4LJOB 1VD2A 1VCBA 1DYQA 4EOYA 4P6VF 4LJPB 1V9JA 2B76B 4LDTD 3ECIA 4OVZA 2MJEA 3AE7B 2K22A 3QX1A 3Q2AC 2V1YA 2K6QA 1J7CA 1L7YA 4ZDVA 4FHJA 1NEKB 2MP2B 1R4MB 3DPDA 3NVWA 3DBRI 4GDLB 5EDSA 4MJSB 1NBFC 3EGRA 3A9KA 4ZRPA 4RH6A 4N9F4 2N9KA 4HWIB 5KHOA 4WURA 3L13A 3P4RB 3BVZA 2YVCA 2SAKA 2KOXA 2FIDA 3QK0A 1TBEA 4BKSA 1DOIA 1ZXIA 2UU7A 3M95A 3NY5A 4FLHA 5J17A 1C4CA 2INDC 4XYCA 3ZYYX 1ET6A 2RPQA 1GPXA 1FNUA 1ZDXA 1Q10A 4RGOS 4AUQC 5LXHA 1V5TA 1UUPA 4WWMA 3DDCB 3HVZA 3RD2A 1PYWD 1GB1A 3KYCD 2CS4A 2WP9B 4P1BC 3A4RA 1KTKA 1C1YB 1WXQA 4W9GA 3PVLA 1ZKHA 3EC8A 4D2KA 4WJPA 4MH0E 1DGJA 5AEKB 3B2GA 3ZTDA 1HZ6A 3N1ZC 2WXFA 4TUUA 1YX6B 2KX3A 1WXVA 1HZ5A 1U4AA 1JRPA 4MT5A 2EKEC 5HHDG 4II2B 1NENB 1D5XC 1YN5A 1YQ4B 1JWMD 5EE1A 2KKCA 4H2AA 4PT5A 4IW0A 3VAWA 2V9HA 2K8HA 1M94A 4CQNA 1I4GA 1AN8A 3KUDB 4EFOA 5IKCM 2GOWA 1E7PB 2CHWA 3SDLC 1S1QB 1GUAB 1I4XA 3QJZA 1KOTA 1IBXB 2N9PC 2M0XA 3D32A 4ARIA 2GBMA 3PLVA 2VZKB 3GZNB 1IYFA 1P9DU 3VHTC 1KLGD 4IWOA 1EWYC 5C2TB 4ZRIA 2QIEB 3PTFC 1C4AA 5EE3A 3AEFB 3PRMB 2BYTA 1X1MA 1BUIC 3Q3NC 3V05A 2BS4B 1AARA 1WJUA 2CHXA 4A55A 2CJOA 1GG3A 3LXFA 2OJRA 4IWQA 1WFYA 1LQBA 1WF9A 1EO6A 1OQYA 2I38A 3KUCB 3MHSD 3QQ8B 3NVVA 1C3TA 2ON8A 1V81A 2CR5A 4AP4C 3W5UB 4NJCA 4F8CB 1ZDVA 3BIID 3PHXB 2DHZA 4ZRQA 1R4NB 3U7ZA 5D2MB 3RCZA 1OTRB 1R4MI 4RGMA 2JZ3B 3ZNZB 2BT6A 3HIZA 3Q3JA 5AUIA 2I1JA 4II3B 3DBLI 1YN3A 3DOWA 4BKSD 1QF6A 1TY0A 5LNK1 3FILB 1N62A 1N5WA 4I6LB 3UI3A 1SB3C 1VJKA 2KX0A 1LXDA 2KLGA 1OFFA 4GB9A 5DPSA 3T3OA 2LD9A 3TEXA 3ZJUA 1C79A 4XDDA 1WGDA 1D4BA 3WALA 2DAJA 2L32A 4QAYA 3VTVA 1G6JA 4RFBA 2VRRB 2UYZB 1C4PA 5J18A 3BINA 4A3OA 2KTRB 3VUXA 1TS5A 2IPKD 1WH3A 4JQWC 1XLPA 2DZJA 3W1SA 3CSFA 1TS4A 3K9OB 3EFCA 2MBOA 1KRHA 1NI2A 4M0WB 1V2YA 3IT6B 3PPAA 4R3DA 2BYFA 4GN1A 2NPTB 3T3NA 2SEBD 5J2RA 4XC2A 3RNGC 2D10A 1WZ3A 1J7BA 2PVOD 2FBWB 1GB4A 4PYZA 4HVBA 1CK1A 1GAQB 3BWUD 4JE3B 1FCLA 2PIAA 4HLEA 2KVZA 2DNFA 2JRHA 1ACCA 3JSVB 3W2DA 4A9AA 3PREA 2LXAA 3A1QB 3NRZA 2KK8A 3RNCC 5E6PA 3LB8C 4A20A 4IM2A 2MBEA 2JVCA 4MGZE 4YWGG 4GDKA 4W9IA 4EEWA 2K1FA 2HTHA 3PS6A 3TBLD 3U52E 1TT5B 2Y5CA 2NPTA 3L4PA 1K51A 2GI9A 4URKA 2W9NA 3VRBB 3FILA 1M4VA 3AE2B 4C7YA 3U8ZA 3BY4B 2R61A 5C3JB 1YIWA 4IKGA 2NTSA 2RMMA 3JSVA 3VR8B 4NPNA 2LZ6A 4IG7B 3B0AA 5IAAC 3E9SA 4YSYB 2N7JA 5JZEB 2BWFA 3NZUA 2WX1A 1L6VA 3ZJVA 2G9HD 4AJYB 3H6NA 2KFJA 2DYBA 3SR6A 1BT0A 2EKIA 3W5VB 3AN1A 3A1QA 2DZKA 2LHEA 3DWMA 1F0ZA 3NG0A 1QOAA 1WJ6A 2Y3AA 2MWSB 2RR9A 4DQOC 2BPSA 3MHZA 4CHKA 3A33B 1YQ3B 4EZLA 3P1MA 3HK0A 1QQRA 5MPOA 3AEDB 2TSSA 2WXKA 1ZGUB 4BAXA 3IXSA 1SIFA 3RNEC 5GMVA 4US8A 2IBIB 2M0AA 2LRUA 2ZPNA 4KGRA 1T0YA 2ZVOA 5AZFA 1GOZA 1L4ZB 1TZOA 2CU1A 3FKYA 2KJ6A 3EECA 3Q3OC 1RFAA 1V97A 5JHAA 2C7NB 2K5PA 3MJ5A 3LYYA 3Q3MC 3QCAA 2NMQA 1H4RA 4RNAA 2L3ZA 5IN7A 2D5GA 5BO4B 4MELA 4FJVB 3HM3A 2MJDA 4K7UA 3H1UA 2AQ3B 2HTME 3P42A 2KANA 4HCPB 2IO1B 4G3XB 4BBNF 4LNKA 1P7EA 2KN5A 1ZOYB 2KMCA 3I63C 1MHHE 4KV2A 3R7RA 1WGGA 1UH6A 1UGMA 3L54A 3RNBC 5HI1A 1GC7A 4P16A 2D3GA 1P7FA 1T3QA 2KDMA 4LNIA 1L0VB 2LFIA 3B08A 2INCC 1PGXA 4KKIA 2NBUA 1VZ7A 5G55A 5AZHA 4REZA 2NCNA 4KZCA 2BGFA 4YTMB 4KX6B 3ZQ4A 1UF0A 4TQ1A 1E5WA 3WIMA 3VRAB 1SF0A 2RDGA 2KMMA 3TL5A 1JWAD 4NNJB 4ICUA 3QHTA 2JZZA 2WU2B 1MVKA 2QJLA 1QKZA 2KDFB 3URYA 2LGIA 3A9JA 1WSPA 2BYVE 3ZUNA 1C9FA 4OW0A 1CJEA 1PQSA 1F1HA 2NR2A 4ZHOA 5C23A 2EMSA 2EMTA 5IP4D 4A6QA 5JHBA 2DLBA 3AEEB 4JX1C 4B95A 3IFWB 5E6NA 3IG3A 2WXRA 5DPWA 1D5MC 1WYGA 2L8JA 3KVFB 3N3KB 4W9KA 3NS1A 3TCAA 2O2VB 2OEDA 4KGSA 4RM9A 2JZPA 4E3CA 4YSZB 3BVMA 2MW5A 1TJEA 4W9CA 3RZFA 2V0GA 2AL3A 4HCNB 1E7VA 4M8MA 3R2IA 3WAPA 5C1ZA 4BKGA 2YEPF 4DDID 2WGSA 4HDQA 5FR6A 2WXMA 4TKNA 4FJZA 2LGSA 3AE1B 1Q1OA 4GXBA 2ZNVB 2QEJC 3O65B 4EZJA 1J7AA 3AECB 3ML9A 3TJPA 5CHWA 5IOIA 3P4QB 4X57B 3S2AA 2JUOA 1TIFA 1FXIA 4DXGA 2V3PA 3APDA 4MGYE 2MCNB 2D2QA 3M62B 2PVGC 5BYSA 2Y5PA 4PS3A 2K8CA 2RPVA 1SE2A 4ZRJA 2D3AA 4OHJA 2BS2B 1V8CA 3GP7A 5G5HA 3M3JA 4ARCA 2J0MA 3DHIC 2O6VB 4AS1A 4PYUA 3ZO5B 3IAM1 4GLSC 2V3NA 3PO0A 1HXYD 2KAJA 1K53A 3NOBA 4K3CA 1JROA 4BOSC 3HUIA 3NUHB 2JPHA 1PGBA 2LJIA 1C77A 2WXJA 2MSED 3VDZA 3HM6X 4C00A 1ET9A 5LXIB 4A90A 5L83A 4A3PA 3RNAC 1I7HA 1V80A 2KTRA 5BMHA 4HPLB 1CMXB 2WDRB 2J53A 1I4PA 1XLQA 1MI0A 4DXFA 3N1YC 3DHHC 3CMMB 3AV8A 4J6IA 3VXWA 2INPE 1K50A 2JQRB 3RFZB 3ZW3A 3AM9A 4KDLB 3SEBA 4HDOA 2BYEA 4LNOA 3ZNHB 3N20C 1Y56A 1YOVB 2R2OA 1YJIA 2KFKB 1VDVA 2DZIA 1E90A 1UELA 5D3DA 2V3SA 3JVZX 5FR3A 2D3BA 1GNUA 4XDCA 1PDXA 4ZYSA 4JL9A 1MHXA 4GSWA 4HROA 1KF6B 4GMVA 4IUMB 4NQLB 3IAS1 3VUWA 2LVQA 1FRRA 3CSTA 1EF1A 3A9KB 2MH7A 2DZMA 3X0WA 5BYRA 2M17A 3I5JC 2N9XA 1VR9A 1SIJA 2I1KA 2UWQA 2PJHA 1GC6A 1UBQA 3AXCA 1L2NA 1V49A 2CJNA 1OQQA 4IWPA 1JWUD 4F1SA 3B2FA 2HD5B 4GU2A 4C4VA 4IC7B 1I42A 2RSUA 2PE6B 3VTWA 4TQ0A 3SD5A 1JCKB 4WWNA 4E71A 1MPEA 3RZWC 4MM3B 2MBBB 2PW9A 4C4VB 2FCMA 2RDBC 4FA6A 1L6UA 3DVGX 3AU4A 3RYTA 3PHWB 3PV1A 2C9WB 2ONQA 2X8XX 3OJ3A 1TGZB 2KN4A 4PS8A 1HTOA 1TY2A 3N1XC 4RM8A 3OWEB 4DHZE 4C80A 1HE8A 2ZEQA 1QZEA 4HPMB 3Q6BA 2KXJA 4E74A 3TEYA 3AE9B 2WXPA 2LWPA 2L0FA 2WLBA 1QT9A 2AQ1B 1IP9A 4NAWA 1C76A 1XCTL 3ZJTA 4DBGA 3MP9A 3PRZA 3WAOA 1YNTE 3NJTA 1WX8A 1Z5SB 2J4XA 1WXAA 4FULA 4M02A 2OHFA 3C0RB 4HEA1 2QCZA 2LI5A 3TUOA 1HA5A 2L05A 2FIFA 3RI7C 2N7DA 2ZPYA 3C8YA 3P2BA 5JH5C 3U2SC 1QOFA 3AI5A 5AZGA 2NBVB 2JSVX 2IGDA 3DVNV 2BKRB 2LMCA 1SJED 2WDVB 3KWVA 1WRIA 2L00B 1JALA 3NZSA 3SHQA 1HEZE 3OG5A 1ISNA 2GRIA 1TKGA 3IBEA 2KWVB 4N59A 3MTNB 2PEAA 2GB1A 4NY0A 2QC8A 4OVUA 2Y5BB 1ZP0B 2NS5A 4XWTA 2IGGA 2LUMA 2L1AA 2LJ5A 4CYEA 2MHJA 4GIVA 3CF6E 4Q2JA 1J8CA 1E7UA 2M4NA 1WGYA 3R7QA 2K9XA 4ZOHC 2KFKA 2C7HA 2WXQA 2Z0EB 2ZJDA 2FCSA 4WIPA 1JWSD 2AQ2B 3AEGB 2M8SA 2K8BA 1E6EB 3VH4B 1E8ZA 2J7QB 2MBQA 4US9A 2VZKD 2N4FA 2ZNVC 4PK1A 4OZCA 2KDEB 4PS7A 1QOBA 3A9JB 3M63B 3AB5A 4I6NB 1IUEA 3GE3C 2L7RA 4W9LA 1GJZA 4BZAA 4WWOA 1ZE3D 1L0YB 2L83A 3TEZA 2RGFA 3K9PB 1TS3A 2BS3B 3BK1A 3HHMA 1VZ6A 1T5XD 2G4SA 2OJWA 1CQVA 4WJOA 1OEYJ 2L52A 2AYOB 2BB6A 2J0JA 3DBSA 4OZBA 3ZGZA 3DBHI 2GBJA 2JYEA 2ZVNA 4NJ6A 1WMHA 3AU5A 1JQ4A 4MJSA 1HTQA 4FADA 3WCQA 3UQAA 1WM2A 3C19A 4BVUC 2HJ1A 4KDIC 2JY6A 2MBHA 3RT3B 4NZLB 1Q5WB 2KWCA 3VFKA 3ABVB 4K1RB 3ETRA 4ACFA 2KACA 3IHPC 2CHZA 3QC8B 5JXVA 4RF1A 2BF8B 4ANVA 5TSSA 2IJ0A 4MACA 1L0XB 3AE4B 3TEWA 1WGKA 3W1SC 1XF5L 3NVYA 4EKUA 1WJ4A 2L76A 2JF5A 3TMPB 3RUIB 4DWFA 2H88B 4ZYNA 1WGRA 4M01A 2IY1B 2JXXA 4WQOB 4P1CC 3LJ3A 3UGBB 3ZDTA 1K52A 2MJ3A 1TYGB 5BMIA 3ZNGC 4MSMB 1T0SC 1FM0D 2D11A 2FE8A 3BYTB 3CWIA 3ZRFA 3APFA 4GDLA 1WMHB 3JW0X 2X38A 1UWXA 1ZW7A 1FNVA 1YMHE 2WYQA 1IBXA 2ACZB 1SXTA 1KM7A 2MEKA 2KJHB 4LDTB 3QIJA 2BWES 4AQ7A 1PFDA 2WQYB 4FHKA 5D94A 2WWZA 2K0PA 2J52A 4MH8A 2V4IB 1D6EC 2YEPB 2M1MA 2IDYA 4AJWA 1XCQL 3PT2B 4BKTA 4WAFA 3RULA 2KTFA 3IT4B 1RLFA 1T0QC 4M00A 1RYJA 2MP2A 4KSKC 4F7ZA 2GBRA 2LEKA 1P1AA 1LFDA 1MFWA 2WU5B 3MC9A 1SE9A 5HG2A 4N6EB 2WXLA 4B6WA 4W9DA 1L5PA 2JWZA 3ZIMA 2I2YA 4NAMA 5IO9A 3WAMA 5E6JA 3AE6B 3QAQA 2K6DB 3P4SB 2EELA 2KDIA 1RAXA 4W9FA 1AYFA 4RGNA 2W55A 4GGQA 3P63A 1JW9D 2ICIA 1V6EA 3I3TB 1OQRA 5KHQA 2A4ZA 1N63A 1EU3A 3WA0A 2AEHA 4HRSA 3DBLB 4HJKA 4BOZB 3UQBA 3MC8A 3BK2A 3ZDMC 3CIRB 5D3IB 4KVGB 4ICVA 5T8IA 2IO2B 2BW2A 1UWMA 1Q0WB 2PKOA 2KYWA 4FBJB 2DYOA 2KD0A 2VH2A 3DBRB 1J0GA 2FCNA 2E6XA 1FRDA 1SE4A 1FO4A 3L10B 3X23A 3JYUA 1YJJA 3HRDD 4HKQA 2C7MB 1F9JA 1ZPSA 1V5OA 2IYDB 2JX5A 2QMTA 2KVRA 5FK9C 4FN2A 4YSXB 4RGTA 2REXA 2FCQA 2LGYA 3V6EB 3Q8EA 3U30A 2PE9A 4B0MA 1R7SA 2NBWB 2MQJA 2KWDA 4GDKB 2BVCA 2WXHA 2AL6A 2PMVA 4GOCA 3KH0A 1YX5B 2QSDA 1FIQA 4LK0M 2WDTB 2XNAC 1OEYA 3AE8B 1VLBA 1KH0A 2MLBA 4JPSA 4WH4A 4MDKE 2NVUI 2WXNA 3GS2A 1CZPA 2BB5A 2KWUB 4W9HA 1UZXB 2IO0B 4LNNA 4O1NA 2Z8LA 1FNWA 1JRUA 2LUEA 1WRDB 2WXGA 4I6PA 3KUZA 3AE5B 1Z2MA 3VR9B 5LLIA 4TSSA 1YQBA 5G5GA 3ML8A 1VRAB 1N60A 2QILA 1WXMA 3DVGY 3MJWA 2N0SB 4EUTA 3ENEA 2KQSA 2ZZPB 3T8MA 4MEMA 3AE3B 2M19A 2LGXA 2N9LA 3Q8CA 3GOEA 4ZRKA 4LLGM 2MA9B 1RWSA 3KW5B 2INNE 5DPRA
chains in the Genus database with same CATH topology
3EHVA 4W9EA 1HE8A 2ZEQA 1QZEA 4HPMB 2KXJA 5DPTA 2HJ8A 4AJYB 5HKHA 3T9LA 3ZLZA 2JT4B 4E74A 1WZ0A 3H6NA 2KFJA 2DYBA 1BT0A 2IY0B 3A1QA 2DZKA 2LWPA 2L0FA 2PPHA 1IP9A 1WJ6A 4NAWA 2FNJB 4IM3A 4DHZB 2MWSB 4WJNA 2RR9A 4ANUA 4DBGA 2BPSA 2GBNA 4CHKA 1TTNA 3A33B 3TIXA 2WX0A 2G3QB 3PRZA 3WAOA 1WX8A 4K81A 5CX3A 1Z5SB 5E6OA 2KHWB 4JIOU 3PSEB 3PGEA 4EZLA 1WXAA 1FXTB 3QARA 4FULA 3HK0A 4RMAA 3C0RB 1WXSA 4NJ7A 2LI5A 3N30A 4B9KA 2R2QA 2L05A 1ZGUB 2FIFA 2XEWA 1V86A 2N7DA 4W9JA 2ZPYA 5DCNA 1KJTA 1SIFA 3P2BA 5JH5C 3A4SC 4HK2A 5GMVA 4DK5A 3AI5A 5AZGA 4KIKA 2K39A 4DXAB 2IBIB 2NBVB 3VH3B 2LRUA 2ZPNA 3H7PA 4P7IA 3DVNV 2ASQA 1T0YA 2FAZA 2YLMA 2ZVOA 5AZFA 5L95C 2BKRB 2CU1A 2KJ6A 3NZSA 2L00B 3SHQA 2N1VA 3EECA 3OLMD 3R3MA 1RFAA 1ISNA 1MG8A 5JHAA 1XQQA 4G11A 2C7NB 3V62A 1J19A 3IBEA 1E8XA 2KWVB 3QCAA 3MTNB 4DHJB 1H4RA 2PEAA 2L3ZA 5BO4B 2N9EB 3QA8A 2IO3B 4NY0A 3B1LX 1YD8U 4MELA 1WY8A 4FJVB 4OVUA 3ZTCA 2Y5BB 2G45B 2GBKA 2NS5A 2KZRA 1A5RA 3W1YA 3HM3A 4HXDA 2O2VA 4K7UA 3VTUA 3DVNU 3H1UA 2LJ5A 4XZ4A 1P98A 4YL8A 3U7DA 4CYEA 2J0KA 2KC2A 4LJOB 1VD2A 1VCBA 2KANA 4EOYA 4GIVA 1SGHA 3CF6E 4LJPB 1J8CA 1EUVB 4HCPB 1V9JA 2IO1B 4G3XB 4BBNF 1E7UA 2D07B 2M4NA 4LDTD 1WGYA 3R7QA 3ECIA 2KFKA 2C7HA 2Z0EB 2ZJDA 2FCSA 3OJ4B 2KN5A 1H8CA 1YJ1A 2KMCA 2M8SA 3NS8A 4KV2A 2B3AA 2K8BA 3R7RA 3UINB 3UIPB 3VH4B 1WGGA 1UH6A 3QX1A 1E8ZA 2J7QB 1UGMA 2MBQA 3VVWB 3L54A 2V1YA 2K6QA 2N4FA 1WR6E 2ZNVC 4KSLC 1OGWA 1GC7A 1L7YA 4ZDVA 2D3GA 4AOFA 2KDEB 4FHJA 2HE7A 3B08A 2MP2B 3DPDA 4PS7A 3A9JB 3M63B 3DBRI 1RRBA 4I6NB 2NBUA 4GDLB 5EDSA 4MJSB 2L7RA 1NBFC 2IZVB 5AZHA 5G55A 2NCNA 3A9KA 4W9LA 1GJZA 1P3QU 3R66C 4WWOA 4KZCA 4N9F4 2BGFA 2XK5A 4HWIB 1WJNA 5KHOA 2RGFA 3L13A 3K9PB 3ALBA 1E5WA 4TQ1A 4M8NA 2YVCA 3H9DA 2KOXA 2FIDA 3WIMA 3HHMA 3QK0A 2G4SA 1TBEA 4WJOA 4BKSA 1OEYJ 1WI0A 5IA7A 2MX2A 3M95A 3NY5A 3TL5A 2AYOB 4FLHA 4NNJB 4EZKA 2J0JA 5J17A 3PRPB 3DBSA 4ICUA 3QHTA 4ANWA 3DBHI 2JZZA 2GBJA 2RPQA 2ZVNA 2KDFB 3A9JA 4AUQC 5LXHA 4NJ6A 1WMHA 1V5TA 2BYVE 3AU5A 3ZUNA 4MJSA 4FADA 3DDCB 3VQIA 3UQAA 5DPRA 1NDDA 1PQSA 2NR2A 1WM2A 2AWTA 3RD2A 4G0NB 3KYCD 2CS4A 4WJQA 3A4RA 4BVUC 1C1YB 5C23A 1WGHA 2EMSA 2EMTA 2JY6A 3ONSA 3PVLA 4KDIC 4MGIE 4W9GA 1ZKHA 3EC8A 5JHBA 2GMIC 4WJPA 2MBHA 4MH0E 3RT3B 5AEKB 3DCGA 4B95A 3H7PB 3IFWB 5E6NA 3ZTDA 1Q5WB 4TUUA 2KWCA 3VFKA 1YX6B 2ZCBA 3IG3A 4K1RB 5DPWA 2KX3A 1WXVA 2CHZA 2L8JA 3IHPC 3KVFB 3QC8B 2BF8B 3N3KB 4W9KA 4ANVA 1U4AA 2EKEC 3TCAA 2LRWA 4ASWC 2O2VB 4II2B 3W1SC 4RM9A 4E3CA 5CHVC 2MW5A 3DQVA 2KKCA 3VAWA 4IW0A 4EKUA 3ZRCA 1WJ4A 2L76A 2JF5A 4W9CA 3TMPB 3RUIB 3RZFA 2K8HA 1M94A 4K7SA 4DWFA 2N7EA 3L16A 2AL3A 3KUDB 1WGRA 4HCNB 4ZYNA 1E7VA 2IY1B 2JXXA 2KDBA 4M8MA 4WQOB 3WAPA 4EFOA 4BKGA 5C1ZA 4FJYA 2LVOA 3V60A 2GOWA 2OOBB 2CHWA 3LJ3A 1S1QB 4LCDE 3SDLC 4MGKE 2XBBC 3UGBB 1GUAB 4DDID 4HDQA 4JGHB 5FR6A 4TKNA 4FJZA 3QJZA 1KOTA 3ZNGC 1E8WA 4GXBA 1Q1OA 2N9PC 2ZNVB 2M0XA 3D32A 4MSMB 2D11A 3APCA 3ZRFA 3O65B 2GBMA 2JRIB 3PLVA 4WAAA 3APFA 1WIAA 4EZJA 4GDLA 1IYFA 1P9DU 3VHTC 3ML9A 4IWOA 5CHWA 3TJPA 1WMHB 2KJRA 3JW0X 1ZW7A 3L0WB 2WYQA 4ZRIA 4CO7A 3L08A 3PTFC 4X57B 3S2AA 3ZNID 1KM7A 2JUOA 2KJHB 4LDTB 3UF8A 3QIJA 2BWES 3VUYA 3PRMB 1X1MA 2Z59B 1WE6A 2FUHB 3APDA 4MGYE 3KYDD 4FHKA 2MCNB 5D94A 2D2QA 2WWZA 1S3SG 3M62B 1AARA 4K7WA 4PS3A 1TZ1A 1WJUA 2CHXA 4MM3A 2K8CA 4MSQB 2M1MA 4ANXA 5CTRC 1GG3A 4ZRJA 1Y8RC 4AJWA 4DHJD 2OJRA 3SU8X 5D7GA 4IWQA 1WYWB 1WFYA 1LQBA 3M3JA 1WF9A 2J0MA 1EO6A 1OQYA 3PT2B 4BKTA 3KUCB 3MHSD 3QQ8B 1LM8B 3L17A 1XT9B 2L0TA 1V81A 2C5LC 2CR5A 2O6VB 3QWZB 3RULA 3GZNI 4AP4C 2KTFA 1RLFA 4PYUA 3ZO5B 2MP2A 4KSKC 4F7ZA 1C3TA 3OAWA 4F8CB 2MRPA 3AULA 2GBRA 1P1AA 2N1WA 1LFDA 3PHXB 4AWJA 2DHZA 3NOBA 1SE9A 2O6VA 4BOSC 4B6WA 5D2MB 3RCZA 4W9DA 1OTRB 1R4MI 2JWZA 3ZIMA 2DYMA 2BKFA 2JZ3B 3V61A 3HIZA 2JPHA 4KIKB 3Q3JA 3WAMA 3ZNZB 3QAQA 2K6DB 2I1JA 2KDIA 1RAXA 4II3B 3DBLI 4W9FA 2MSED 2LVPA 3VDZA 3DOWA 4BKSD 3HM6X 4WWPA 4GGQA 1UD7A 4IM0A 5LXIB 1V6EA 3I3TB 5L83A 3PZDA 2A5UA 4A3PA 4I6LB 1V80A 5KHQA 2KTRA 2A4ZA 2KX0A 3WANA 4NAWB 3WA0A 2AEHA 4TV3A 4HPLB 4HJKA 2XK5B 4BOZB 1CMXB 3UQBA 1I35A 1LXDA 2KLGA 3ZDMC 3IVFA 1WE7A 4G50A 4GB9A 5DPSA 4KVGB 3ZVVA 2LD9A 4ICVA 2IO2B 1WGDA 4JLCA 1Q0WB 1P0RA 3ZDTA 3WALA 3CMMB 4FBJB 4J6IA 3VXWA 2DYOA 2LXCA 2DAJA 3VTVA 2KD0A 5G2NA 1J0GA 1G6JA 2FCNA 2VRRB 4DDGD 1XD3B 3ZW3A 2UYZB 3L10B 4KZ0A 3X23A 5J18A 3JYUA 3BINA 4KDLB 2KO3A 2LASA 4A3OA 2KTRB 2C7MB 3VUXA 1F9JA 2IYDB 1V5OA 2BYEA 4HDOA 3ZNHB 2KVRA 2LGDA 4FN2A 4XX5A 1WH3A 4JQWC 1WM3A 2R2OA 2DZJA 3W1SA 2DENB 2KFKB 3CSFA 3EFUA 2DZIA 2REXA 2FCQA 2LGYA 3K9OB 3V6EB 2DAFA 3U30A 2PE9A 2MBOA 2V4LA 2K25A 1NI2A 1E90A 1UELA 1V2YA 2V3SA 1WR1A 3JVZX 2NBWB 3PPAA 4M0WB 5CHFA 2BYFA 4GN1A 2MQJA 2KQ7A 2NPTB 1GNUA 4GDKB 5J2RA 4XC2A 2AL6A 2D10A 4JL9A 2DX5B 1WZ3A 4GOCA 3KH0A 1YX5B 4GSWA 4NQKE 4PYZA 3LDZE 4HVBA 4GMVA 4IUMB 2G4DB 4NQLB 3NHEB 3VUWA 2LVQA 2WDTB 4HLEA 3CSTA 5TR5A 1OEYA 1KLVA 1EF1A 3A9KB 2JRHA 1R4NI 2DZMA 3JSVB 4BFRA 3X0WA 2M17A 2KNBA 2MLBA 3PREA 2LXAA 3A1QB 1WX7A 2C60A 2KC1A 2N9XA 2O6VD 4MDKE 2KK8A 2NVUI 2I1KA 1UBIA 5E6PA 2UWQA 4A20A 2PJHA 4IM2A 1GC6A 2KLCA 1UBQA 2MBEA 2KWUB 4W9HA 2JVCA 1UZXB 3AXCA 2IO0B 1L2NA 4MGZE 1K8RB 1V49A 1EF5A 4GDKA 4IWPA 4W9IA 4EEWA 4F1SA 2K1FA 1JRUA 2LUEA 1WRDB 2HD5B 2HTHA 3KUZA 4I6PA 3PS6A 3TBLD 4GU2A 1WX9A 4IC7B 1Z2MA 1I42A 2QHOA 2NPTA 2RSUA 3PLUA 2CKHB 5LLIA 2PE6B 3VTWA 1YQBA 4TQ0A 2RD0A 4URKA 2W9NA 3SD5A 3Q3FA 1IPGA 3UIOB 3ML8A 4WWNA 4E71A 1D3ZA 1WXMA 3DVGY 3MJWA 2Z0DB 2ZCCA 4OVVA 3BY4B 3U8ZA 4BBNC 4EUTA 3RZWC 3ENEA 1YIWA 2MBBB 2KQSA 2ZZPB 3T8MA 3V6CB 2FCMA 1E8YA 2KMAA 4MEMA 4FA6A 3DVGX 3AU4A 2LGXA 3JSVA 4NPNA 3RYTA 3ZKJC 3N32A 3PHWB 2LZ6A 3GOEA 3PV1A 4IG7B 3B0AA 4ZRKA 5IAAC 2C9WB 2MA9B 3OJ3A 3KW5B 5JZEB 1TGZB 3H7SA 4PS8A 2BWFA 5D6JB 4RM8A 3NZUA 4DHZE 2WX1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EHV A;  4W9E A;  1HE8 A;  2ZEQ A;  1QZE A;  4HPM B;  2KXJ A;  5DPT A;  2HJ8 A;  4AJY B;  5HKH A;  3T9L A;  3ZLZ A;  2JT4 B;  4E74 A;  1WZ0 A;  3H6N A;  2KFJ A;  2DYB A;  1BT0 A;  2IY0 B;  3A1Q A;  2DZK A;  2LWP A;  2L0F A;  2PPH A;  1IP9 A;  1WJ6 A;  4NAW A;  2FNJ B;  4IM3 A;  4DHZ B;  2MWS B;  4WJN A;  2RR9 A;  4ANU A;  4DBG A;  2BPS A;  2GBN A;  4CHK A;  1TTN A;  3A33 B;  3TIX A;  2WX0 A;  2G3Q B;  3PRZ A;  3WAO A;  1WX8 A;  4K81 A;  5CX3 A;  1Z5S B;  5E6O A;  2KHW B;  4JIO U;  3PSE B;  3PGE A;  4EZL A;  1WXA A;  1FXT B;  3QAR A;  4FUL A;  3HK0 A;  4RMA A;  3C0R B;  1WXS A;  4NJ7 A;  2LI5 A;  3N30 A;  4B9K A;  2R2Q A;  2L05 A;  1ZGU B;  2FIF A;  2XEW A;  1V86 A;  2N7D A;  4W9J A;  2ZPY A;  5DCN A;  1KJT A;  1SIF A;  3P2B A;  5JH5 C;  3A4S C;  4HK2 A;  5GMV A;  4DK5 A;  3AI5 A;  5AZG A;  4KIK A;  2K39 A;  4DXA B;  2IBI B;  2NBV B;  3VH3 B;  2LRU A;  2ZPN A;  3H7P A;  4P7I A;  3DVN V;  2ASQ A;  1T0Y A;  2FAZ A;  2YLM A;  2ZVO A;  5AZF A;  5L95 C;  2BKR B;  2CU1 A;  2KJ6 A;  3NZS A;  2L00 B;  3SHQ A;  2N1V A;  3EEC A;  3OLM D;  3R3M A;  1RFA A;  1ISN A;  1MG8 A;  5JHA A;  1XQQ A;  4G11 A;  2C7N B;  3V62 A;  1J19 A;  3IBE A;  1E8X A;  2KWV B;  3QCA A;  3MTN B;  4DHJ B;  1H4R A;  2PEA A;  2L3Z A;  5BO4 B;  2N9E B;  3QA8 A;  2IO3 B;  4NY0 A;  3B1L X;  1YD8 U;  4MEL A;  1WY8 A;  4FJV B;  4OVU A;  3ZTC A;  2Y5B B;  2G45 B;  2GBK A;  2NS5 A;  2KZR A;  1A5R A;  3W1Y A;  3HM3 A;  4HXD A;  2O2V A;  4K7U A;  3VTU A;  3DVN U;  3H1U A;  2LJ5 A;  4XZ4 A;  1P98 A;  4YL8 A;  3U7D A;  4CYE A;  2J0K A;  2KC2 A;  4LJO B;  1VD2 A;  1VCB A;  2KAN A;  4EOY A;  4GIV A;  1SGH A;  3CF6 E;  4LJP B;  1J8C A;  1EUV B;  4HCP B;  1V9J A;  2IO1 B;  4G3X B;  4BBN F;  1E7U A;  2D07 B;  2M4N A;  4LDT D;  1WGY A;  3R7Q A;  3ECI A;  2KFK A;  2C7H A;  2Z0E B;  2ZJD A;  2FCS A;  3OJ4 B;  2KN5 A;  1H8C A;  1YJ1 A;  2KMC A;  2M8S A;  3NS8 A;  4KV2 A;  2B3A A;  2K8B A;  3R7R A;  3UIN B;  3UIP B;  3VH4 B;  1WGG A;  1UH6 A;  3QX1 A;  1E8Z A;  2J7Q B;  1UGM A;  2MBQ A;  3VVW B;  3L54 A;  2V1Y A;  2K6Q A;  2N4F A;  1WR6 E;  2ZNV C;  4KSL C;  1OGW A;  1GC7 A;  1L7Y A;  4ZDV A;  2D3G A;  4AOF A;  2KDE B;  4FHJ A;  2HE7 A;  3B08 A;  2MP2 B;  3DPD A;  4PS7 A;  3A9J B;  3M63 B;  3DBR I;  1RRB A;  4I6N B;  2NBU A;  4GDL B;  5EDS A;  4MJS B;  2L7R A;  1NBF C;  2IZV B;  5AZH A;  5G55 A;  2NCN A;  3A9K A;  4W9L A;  1GJZ A;  1P3Q U;  3R66 C;  4WWO A;  4KZC A;  4N9F 4;  2BGF A;  2XK5 A;  4HWI B;  1WJN A;  5KHO A;  2RGF A;  3L13 A;  3K9P B;  3ALB A;  1E5W A;  4TQ1 A;  4M8N A;  2YVC A;  3H9D A;  2KOX A;  2FID A;  3WIM A;  3HHM A;  3QK0 A;  2G4S A;  1TBE A;  4WJO A;  4BKS A;  1OEY J;  1WI0 A;  5IA7 A;  2MX2 A;  3M95 A;  3NY5 A;  3TL5 A;  2AYO B;  4FLH A;  4NNJ B;  4EZK A;  2J0J A;  5J17 A;  3PRP B;  3DBS A;  4ICU A;  3QHT A;  4ANW A;  3DBH I;  2JZZ A;  2GBJ A;  2RPQ A;  2ZVN A;  2KDF B;  3A9J A;  4AUQ C;  5LXH A;  4NJ6 A;  1WMH A;  1V5T A;  2BYV E;  3AU5 A;  3ZUN A;  4MJS A;  4FAD A;  3DDC B;  3VQI A;  3UQA A;  5DPR A;  1NDD A;  1PQS A;  2NR2 A;  1WM2 A;  2AWT A;  3RD2 A;  4G0N B;  3KYC D;  2CS4 A;  4WJQ A;  3A4R A;  4BVU C;  1C1Y B;  5C23 A;  1WGH A;  2EMS A;  2EMT A;  2JY6 A;  3ONS A;  3PVL A;  4KDI C;  4MGI E;  4W9G A;  1ZKH A;  3EC8 A;  5JHB A;  2GMI C;  4WJP A;  2MBH A;  4MH0 E;  3RT3 B;  5AEK B;  3DCG A;  4B95 A;  3H7P B;  3IFW B;  5E6N A;  3ZTD A;  1Q5W B;  4TUU A;  2KWC A;  3VFK A;  1YX6 B;  2ZCB A;  3IG3 A;  4K1R B;  5DPW A;  2KX3 A;  1WXV A;  2CHZ A;  2L8J A;  3IHP C;  3KVF B;  3QC8 B;  2BF8 B;  3N3K B;  4W9K A;  4ANV A;  1U4A A;  2EKE C;  3TCA A;  2LRW A;  4ASW C;  2O2V B;  4II2 B;  3W1S C;  4RM9 A;  4E3C A;  5CHV C;  2MW5 A;  3DQV A;  2KKC A;  3VAW A;  4IW0 A;  4EKU A;  3ZRC A;  1WJ4 A;  2L76 A;  2JF5 A;  4W9C A;  3TMP B;  3RUI B;  3RZF A;  2K8H A;  1M94 A;  4K7S A;  4DWF A;  2N7E A;  3L16 A;  2AL3 A;  3KUD B;  1WGR A;  4HCN B;  4ZYN A;  1E7V A;  2IY1 B;  2JXX A;  2KDB A;  4M8M A;  4WQO B;  3WAP A;  4EFO A;  4BKG A;  5C1Z A;  4FJY A;  2LVO A;  3V60 A;  2GOW A;  2OOB B;  2CHW A;  3LJ3 A;  1S1Q B;  4LCD E;  3SDL C;  4MGK E;  2XBB C;  3UGB B;  1GUA B;  4DDI D;  4HDQ A;  4JGH B;  5FR6 A;  4TKN A;  4FJZ A;  3QJZ A;  1KOT A;  3ZNG C;  1E8W A;  4GXB A;  1Q1O A;  2N9P C;  2ZNV B;  2M0X A;  3D32 A;  4MSM B;  2D11 A;  3APC A;  3ZRF A;  3O65 B;  2GBM A;  2JRI B;  3PLV A;  4WAA A;  3APF A;  1WIA A;  4EZJ A;  4GDL A;  1IYF A;  1P9D U;  3VHT C;  3ML9 A;  4IWO A;  5CHW A;  3TJP A;  1WMH B;  2KJR A;  3JW0 X;  1ZW7 A;  3L0W B;  2WYQ A;  4ZRI A;  4CO7 A;  3L08 A;  3PTF C;  4X57 B;  3S2A A;  3ZNI D;  1KM7 A;  2JUO A;  2KJH B;  4LDT B;  3UF8 A;  3QIJ A;  2BWE S;  3VUY A;  3PRM B;  1X1M A;  2Z59 B;  1WE6 A;  2FUH B;  3APD A;  4MGY E;  3KYD D;  4FHK A;  2MCN B;  5D94 A;  2D2Q A;  2WWZ A;  1S3S G;  3M62 B;  1AAR A;  4K7W A;  4PS3 A;  1TZ1 A;  1WJU A;  2CHX A;  4MM3 A;  2K8C A;  4MSQ B;  2M1M A;  4ANX A;  5CTR C;  1GG3 A;  4ZRJ A;  1Y8R C;  4AJW A;  4DHJ D;  2OJR A;  3SU8 X;  5D7G A;  4IWQ A;  1WYW B;  1WFY A;  1LQB A;  3M3J A;  1WF9 A;  2J0M A;  1EO6 A;  1OQY A;  3PT2 B;  4BKT A;  3KUC B;  3MHS D;  3QQ8 B;  1LM8 B;  3L17 A;  1XT9 B;  2L0T A;  1V81 A;  2C5L C;  2CR5 A;  2O6V B;  3QWZ B;  3RUL A;  3GZN I;  4AP4 C;  2KTF A;  1RLF A;  4PYU A;  3ZO5 B;  2MP2 A;  4KSK C;  4F7Z A;  1C3T A;  3OAW A;  4F8C B;  2MRP A;  3AUL A;  2GBR A;  1P1A A;  2N1W A;  1LFD A;  3PHX B;  4AWJ A;  2DHZ A;  3NOB A;  1SE9 A;  2O6V A;  4BOS C;  4B6W A;  5D2M B;  3RCZ A;  4W9D A;  1OTR B;  1R4M I;  2JWZ A;  3ZIM A;  2DYM A;  2BKF A;  2JZ3 B;  3V61 A;  3HIZ A;  2JPH A;  4KIK B;  3Q3J A;  3WAM A;  3ZNZ B;  3QAQ A;  2K6D B;  2I1J A;  2KDI A;  1RAX A;  4II3 B;  3DBL I;  4W9F A;  2MSE D;  2LVP A;  3VDZ A;  3DOW A;  4BKS D;  3HM6 X;  4WWP A;  4GGQ A;  1UD7 A;  4IM0 A;  5LXI B;  1V6E A;  3I3T B;  5L83 A;  3PZD A;  2A5U A;  4A3P A;  4I6L B;  1V80 A;  5KHQ A;  2KTR A;  2A4Z A;  2KX0 A;  3WAN A;  4NAW B;  3WA0 A;  2AEH A;  4TV3 A;  4HPL B;  4HJK A;  2XK5 B;  4BOZ B;  1CMX B;  3UQB A;  1I35 A;  1LXD A;  2KLG A;  3ZDM C;  3IVF A;  1WE7 A;  4G50 A;  4GB9 A;  5DPS A;  4KVG B;  3ZVV A;  2LD9 A;  4ICV A;  2IO2 B;  1WGD A;  4JLC A;  1Q0W B;  1P0R A;  3ZDT A;  3WAL A;  3CMM B;  4FBJ B;  4J6I A;  3VXW A;  2DYO A;  2LXC A;  2DAJ A;  3VTV A;  2KD0 A;  5G2N A;  1J0G A;  1G6J A;  2FCN A;  2VRR B;  4DDG D;  1XD3 B;  3ZW3 A;  2UYZ B;  3L10 B;  4KZ0 A;  3X23 A;  5J18 A;  3JYU A;  3BIN A;  4KDL B;  2KO3 A;  2LAS A;  4A3O A;  2KTR B;  2C7M B;  3VUX A;  1F9J A;  2IYD B;  1V5O A;  2BYE A;  4HDO A;  3ZNH B;  2KVR A;  2LGD A;  4FN2 A;  4XX5 A;  1WH3 A;  4JQW C;  1WM3 A;  2R2O A;  2DZJ A;  3W1S A;  2DEN B;  2KFK B;  3CSF A;  3EFU A;  2DZI A;  2REX A;  2FCQ A;  2LGY A;  3K9O B;  3V6E B;  2DAF A;  3U30 A;  2PE9 A;  2MBO A;  2V4L A;  2K25 A;  1NI2 A;  1E90 A;  1UEL A;  1V2Y A;  2V3S A;  1WR1 A;  3JVZ X;  2NBW B;  3PPA A;  4M0W B;  5CHF A;  2BYF A;  4GN1 A;  2MQJ A;  2KQ7 A;  2NPT B;  1GNU A;  4GDK B;  5J2R A;  4XC2 A;  2AL6 A;  2D10 A;  4JL9 A;  2DX5 B;  1WZ3 A;  4GOC A;  3KH0 A;  1YX5 B;  4GSW A;  4NQK E;  4PYZ A;  3LDZ E;  4HVB A;  4GMV A;  4IUM B;  2G4D B;  4NQL B;  3NHE B;  3VUW A;  2LVQ A;  2WDT B;  4HLE A;  3CST A;  5TR5 A;  1OEY A;  1KLV A;  1EF1 A;  3A9K B;  2JRH A;  1R4N I;  2DZM A;  3JSV B;  4BFR A;  3X0W A;  2M17 A;  2KNB A;  2MLB A;  3PRE A;  2LXA A;  3A1Q B;  1WX7 A;  2C60 A;  2KC1 A;  2N9X A;  2O6V D;  4MDK E;  2KK8 A;  2NVU I;  2I1K A;  1UBI A;  5E6P A;  2UWQ A;  4A20 A;  2PJH A;  4IM2 A;  1GC6 A;  2KLC A;  1UBQ A;  2MBE A;  2KWU B;  4W9H A;  2JVC A;  1UZX B;  3AXC A;  2IO0 B;  1L2N A;  4MGZ E;  1K8R B;  1V49 A;  1EF5 A;  4GDK A;  4IWP A;  4W9I A;  4EEW A;  4F1S A;  2K1F A;  1JRU A;  2LUE A;  1WRD B;  2HD5 B;  2HTH A;  3KUZ A;  4I6P A;  3PS6 A;  3TBL D;  4GU2 A;  1WX9 A;  4IC7 B;  1Z2M A;  1I42 A;  2QHO A;  2NPT A;  2RSU A;  3PLU A;  2CKH B;  5LLI A;  2PE6 B;  3VTW A;  1YQB A;  4TQ0 A;  2RD0 A;  4URK A;  2W9N A;  3SD5 A;  3Q3F A;  1IPG A;  3UIO B;  3ML8 A;  4WWN A;  4E71 A;  1D3Z A;  1WXM A;  3DVG Y;  3MJW A;  2Z0D B;  2ZCC A;  4OVV A;  3BY4 B;  3U8Z A;  4BBN C;  4EUT A;  3RZW C;  3ENE A;  1YIW A;  2MBB B;  2KQS A;  2ZZP B;  3T8M A;  3V6C B;  2FCM A;  1E8Y A;  2KMA A;  4MEM A;  4FA6 A;  3DVG X;  3AU4 A;  2LGX A;  3JSV A;  4NPN A;  3RYT A;  3ZKJ C;  3N32 A;  3PHW B;  2LZ6 A;  3GOE A;  3PV1 A;  4IG7 B;  3B0A A;  4ZRK A;  5IAA C;  2C9W B;  2MA9 B;  3OJ3 A;  3KW5 B;  5JZE B;  1TGZ B;  3H7S A;  4PS8 A;  2BWF A;  5D6J B;  4RM8 A;  3NZU A;  4DHZ E;  2WX1 A; 
#chains in the Genus database with same CATH topology
 4W9E A;  1N61 A;  1NI3 A;  3RMK C;  2BTE A;  2HJ8 A;  3I9V 1;  3T9L A;  3ZLZ A;  3AMZ A;  1WZ0 A;  4JWU C;  2IY0 B;  4JWS C;  2PPH A;  1L4D B;  4M0W A;  3KLS X;  3U4E G;  1T0R C;  4WJN A;  3ZXV A;  2GBN A;  1TTN A;  1TKY A;  2JXT A;  5E6O A;  2KHW B;  4JIO U;  3PSE B;  3PGE A;  3QAR A;  4RMA A;  1WXS A;  1XLO A;  4KGT A;  5AUK A;  1RM6 C;  3N30 A;  3E56 A;  1C78 A;  1E10 A;  4B9K A;  2R2Q A;  1NVI D;  3R8B A;  4LTU A;  5DCN A;  3I57 A;  3A4S C;  4DK5 A;  4KIK A;  2K39 A;  5BMG A;  2CU3 A;  2W82 A;  5GXG B;  3VH3 B;  3H7P A;  4P7I A;  3KQ4 A;  4HJG E;  2ASQ A;  1A70 A;  3OLM D;  1MG8 A;  3AEB B;  1J19 A;  1N6Z A;  1E8X A;  1EU4 A;  4DHJ B;  2N9E B;  2QDF A;  3QA8 A;  1FD6 A;  2IO3 B;  2XN9 C;  3B1L X;  3ZTC A;  2JWU A;  2GBK A;  4KKJ A;  2KZR A;  2JYT A;  4C56 C;  4YTN B;  2O2V A;  3VTU A;  4XZ4 A;  1P98 A;  3BYY B;  4YL8 A;  1SBB B;  2J0K A;  2KC2 A;  4K3B A;  1TS2 A;  1SGH A;  4YT0 B;  1EUV B;  1QIL A;  4LNF A;  2D07 B;  3OJ4 B;  1H8C A;  1YJ1 A;  1ZXH A;  3NS8 A;  3UIN B;  2B3A A;  1B1Z A;  3UIP B;  1F77 A;  3VVW B;  1WR6 E;  4KSL C;  4XGA B;  1OGW A;  4WQM A;  4AOF A;  2HE7 A;  1UGJ A;  1JML A;  1RRB A;  2IZV B;  5EE0 A;  2W3S A;  1P3Q U;  3R66 C;  5BYQ A;  5I4D A;  2WHI A;  1QLB B;  2XK5 A;  1WJN A;  1YN4 A;  3ALB A;  4M8N A;  4YTP B;  3H9D A;  1PGA A;  1WI0 A;  5IA7 A;  4HPP A;  2MX2 A;  2K3U A;  3AH7 A;  4EZK A;  2IGH A;  3PRP B;  4ANW A;  3PZ8 A;  3MFG A;  1XEE A;  3VQI A;  1NDD A;  2AWT A;  4G0N B;  2NTT A;  2G1E A;  4WJQ A;  5H92 C;  4IOI E;  4ITK A;  1BML C;  1WGH A;  3ONS A;  4MGI E;  3ZXR A;  3J9C A;  2GMI C;  1KFY B;  1FPY A;  3DCG A;  3H7P B;  4YXD B;  2ZCB A;  1JWB D;  1V1P B;  2PLP A;  2ZW1 A;  2FUG 1;  4ZHP A;  4ASW C;  2LRW A;  2KQ4 X;  3Q69 A;  5CHV C;  3DQV A;  3ZRC A;  1DOX A;  4K7S A;  2N7E A;  3L16 A;  2KDB A;  4FJY A;  2LVO A;  3V60 A;  2OOB B;  4LCD E;  2WDQ B;  2XBB C;  4MGK E;  4JGH B;  2J42 A;  3NZ3 A;  1SE3 A;  1E8W A;  4S17 A;  3APC A;  2JRI B;  4TMA B;  4WAA A;  4L1B A;  1WIA A;  1E0Z A;  2KJR A;  4FXC A;  2AX5 A;  1ZUD 2;  3L0W B;  4HKZ E;  4CO7 A;  3L08 A;  3KWL A;  3ZNI D;  3UF8 A;  3VUY A;  2Z59 B;  1WE6 A;  2FUH B;  3FC4 A;  2JU6 X;  3KYD D;  1S3S G;  1V1O A;  3O13 A;  4K7W A;  1I4R A;  1F2R I;  1TZ1 A;  4MM3 A;  2LHD A;  4MSQ B;  4ANX A;  4OZA A;  5CTR C;  3HVD A;  1Y8R C;  4DHJ D;  3Q14 C;  3SU8 X;  5D7G A;  1BXT A;  4A8X C;  1WYW B;  4EE2 A;  5HFY A;  1MJD A;  2WNM A;  1VZ8 A;  1AW7 A;  1LM8 B;  3L17 A;  1XT9 B;  2L0T A;  2C5L C;  3QWZ B;  2BQQ A;  3GZN I;  3RN9 C;  1D5Z C;  3OAW A;  2MRP A;  3AUL A;  2PTL A;  2N1W A;  4AWJ A;  2WS3 B;  3H8H A;  2O6V A;  2M56 B;  1STE A;  1SSN A;  1ROE A;  2DYM A;  2BKF A;  3V61 A;  4KIK B;  3V3X A;  2KT7 A;  2LVP A;  1XXG A;  4WWP A;  1UD7 A;  3DWG C;  4IM0 A;  1IGC A;  3GB1 A;  3PZD A;  2A5U A;  2W3R A;  2VH1 A;  2H89 B;  1NYR A;  3WAN A;  4NAW B;  5EE9 A;  4TV3 A;  2XK5 B;  1I35 A;  3IVF A;  1WE7 A;  4G50 A;  3ZVV A;  3BVG A;  3SFE B;  4JLC A;  1P0R A;  1N5X A;  1FEH A;  1E9M A;  2LXC A;  5G2N A;  1LO5 D;  1FFU A;  4DDG D;  1XD3 B;  1AWD A;  3DHG C;  1TKE A;  1B9R A;  1XLN A;  4KZ0 A;  3N9Y C;  1FFV A;  1EWC A;  2KO3 A;  2LAS A;  1I4Q A;  2LGD A;  4XX5 A;  1WM3 A;  2DEN B;  1T6B X;  3EFU A;  2DWQ A;  3W9C B;  2WXI A;  2DAF A;  2V4L A;  1WWT A;  2RDH A;  2K25 A;  1WR1 A;  5CHF A;  3BZD B;  1V1P A;  4UDU C;  2KQ7 A;  4S0R A;  2DX5 B;  1ESF A;  3DBH B;  1FCC C;  4NQK E;  3LDZ E;  2G4D B;  3NHE B;  1SEB D;  5TR5 A;  1KLV A;  1LGR A;  1R4N I;  3NVZ A;  1UNS A;  4BFR A;  3TSS A;  2KNB A;  1EM7 A;  1WX7 A;  2C60 A;  2KC1 A;  2O6V D;  1UBI A;  2HDE A;  4IDI A;  2WXO A;  2KLC A;  4J3O D;  4XWW A;  1K8R B;  1EF5 A;  1NYQ A;  3FAH A;  1WX9 A;  2QHO A;  3MC0 B;  3PLU A;  2CKH B;  3PZ7 A;  2GLS A;  2RD0 A;  2DBY A;  3Q3F A;  1IPG A;  1SJH D;  3UIO B;  3Q8A A;  1D3Z A;  2Z0D B;  2ZCC A;  4OVV A;  4BBN C;  2Q5W D;  4N58 A;  4L2Y A;  3V6C B;  1E8Y A;  2KMA A;  3ZKJ C;  3P4P B;  3N32 A;  2ZW0 A;  3AEA B;  1FMA D;  3H7S A;  5D6J B;  3RNF C;  2BBC A;  3EA6 A;  3R2T A;  3EHV A;  5DPT A;  4RF0 A;  5HKH A;  2JT4 B;  2W54 A;  5FKA C;  3RPF C;  4B0E A;  1F2R C;  1MG4 A;  2FNJ B;  2D3C A;  4IM3 A;  4DHZ B;  3B9J A;  4ANU A;  1F52 A;  3TIX A;  2WX0 A;  2G3Q B;  4K81 A;  5CX3 A;  4XE0 A;  1FXT B;  1I4H A;  4NJ7 A;  3GE8 C;  3SFD B;  4C7Z A;  4USA A;  2XEW A;  1V86 A;  4W9J A;  1KJT A;  1PUT A;  4HK2 A;  4L23 A;  4DXA B;  1DOY A;  1QOG A;  1HQR D;  2FAZ A;  2YLM A;  5L95 C;  2N1V A;  1IGD A;  3R3M A;  1RFK A;  1XQQ A;  4G11 A;  3Q8B A;  3V62 A;  3Q8F A;  3EUB 2;  1KLU D;  1YD8 U;  1WY8 A;  1ENF A;  2G45 B;  1XO3 A;  5H8Y E;  4RCO A;  2E3T A;  1FXA A;  1A5R A;  3W1Y A;  4HXD A;  3DVN U;  3U7D A;  4LJO B;  1VD2 A;  1VCB A;  1DYQ A;  4EOY A;  4P6V F;  4LJP B;  1V9J A;  2B76 B;  4LDT D;  3ECI A;  4OVZ A;  2MJE A;  3AE7 B;  2K22 A;  3QX1 A;  3Q2A C;  2V1Y A;  2K6Q A;  1J7C A;  1L7Y A;  4ZDV A;  4FHJ A;  1NEK B;  2MP2 B;  1R4M B;  3DPD A;  3NVW A;  3DBR I;  4GDL B;  5EDS A;  4MJS B;  1NBF C;  3EGR A;  3A9K A;  4ZRP A;  4RH6 A;  4N9F 4;  2N9K A;  4HWI B;  5KHO A;  4WUR A;  3L13 A;  3P4R B;  3BVZ A;  2YVC A;  2SAK A;  2KOX A;  2FID A;  3QK0 A;  1TBE A;  4BKS A;  1DOI A;  1ZXI A;  2UU7 A;  3M95 A;  3NY5 A;  4FLH A;  5J17 A;  1C4C A;  2IND C;  4XYC A;  3ZYY X;  1ET6 A;  2RPQ A;  1GPX A;  1FNU A;  1ZDX A;  1Q10 A;  4RGO S;  4AUQ C;  5LXH A;  1V5T A;  1UUP A;  4WWM A;  3DDC B;  3HVZ A;  3RD2 A;  1PYW D;  1GB1 A;  3KYC D;  2CS4 A;  2WP9 B;  4P1B C;  3A4R A;  1KTK A;  1C1Y B;  1WXQ A;  4W9G A;  3PVL A;  1ZKH A;  3EC8 A;  4D2K A;  4WJP A;  4MH0 E;  1DGJ A;  5AEK B;  3B2G A;  3ZTD A;  1HZ6 A;  3N1Z C;  2WXF A;  4TUU A;  1YX6 B;  2KX3 A;  1WXV A;  1HZ5 A;  1U4A A;  1JRP A;  4MT5 A;  2EKE C;  5HHD G;  4II2 B;  1NEN B;  1D5X C;  1YN5 A;  1YQ4 B;  1JWM D;  5EE1 A;  2KKC A;  4H2A A;  4PT5 A;  4IW0 A;  3VAW A;  2V9H A;  2K8H A;  1M94 A;  4CQN A;  1I4G A;  1AN8 A;  3KUD B;  4EFO A;  5IKC M;  2GOW A;  1E7P B;  2CHW A;  3SDL C;  1S1Q B;  1GUA B;  1I4X A;  3QJZ A;  1KOT A;  1IBX B;  2N9P C;  2M0X A;  3D32 A;  4ARI A;  2GBM A;  3PLV A;  2VZK B;  3GZN B;  1IYF A;  1P9D U;  3VHT C;  1KLG D;  4IWO A;  1EWY C;  5C2T B;  4ZRI A;  2QIE B;  3PTF C;  1C4A A;  5EE3 A;  3AEF B;  3PRM B;  2BYT A;  1X1M A;  1BUI C;  3Q3N C;  3V05 A;  2BS4 B;  1AAR A;  1WJU A;  2CHX A;  4A55 A;  2CJO A;  1GG3 A;  3LXF A;  2OJR A;  4IWQ A;  1WFY A;  1LQB A;  1WF9 A;  1EO6 A;  1OQY A;  2I38 A;  3KUC B;  3MHS D;  3QQ8 B;  3NVV A;  1C3T A;  2ON8 A;  1V81 A;  2CR5 A;  4AP4 C;  3W5U B;  4NJC A;  4F8C B;  1ZDV A;  3BII D;  3PHX B;  2DHZ A;  4ZRQ A;  1R4N B;  3U7Z A;  5D2M B;  3RCZ A;  1OTR B;  1R4M I;  4RGM A;  2JZ3 B;  3ZNZ B;  2BT6 A;  3HIZ A;  3Q3J A;  5AUI A;  2I1J A;  4II3 B;  3DBL I;  1YN3 A;  3DOW A;  4BKS D;  1QF6 A;  1TY0 A;  5LNK 1;  3FIL B;  1N62 A;  1N5W A;  4I6L B;  3UI3 A;  1SB3 C;  1VJK A;  2KX0 A;  1LXD A;  2KLG A;  1OFF A;  4GB9 A;  5DPS A;  3T3O A;  2LD9 A;  3TEX A;  3ZJU A;  1C79 A;  4XDD A;  1WGD A;  1D4B A;  3WAL A;  2DAJ A;  2L32 A;  4QAY A;  3VTV A;  1G6J A;  4RFB A;  2VRR B;  2UYZ B;  1C4P A;  5J18 A;  3BIN A;  4A3O A;  2KTR B;  3VUX A;  1TS5 A;  2IPK D;  1WH3 A;  4JQW C;  1XLP A;  2DZJ A;  3W1S A;  3CSF A;  1TS4 A;  3K9O B;  3EFC A;  2MBO A;  1KRH A;  1NI2 A;  4M0W B;  1V2Y A;  3IT6 B;  3PPA A;  4R3D A;  2BYF A;  4GN1 A;  2NPT B;  3T3N A;  2SEB D;  5J2R A;  4XC2 A;  3RNG C;  2D10 A;  1WZ3 A;  1J7B A;  2PVO D;  2FBW B;  1GB4 A;  4PYZ A;  4HVB A;  1CK1 A;  1GAQ B;  3BWU D;  4JE3 B;  1FCL A;  2PIA A;  4HLE A;  2KVZ A;  2DNF A;  2JRH A;  1ACC A;  3JSV B;  3W2D A;  4A9A A;  3PRE A;  2LXA A;  3A1Q B;  3NRZ A;  2KK8 A;  3RNC C;  5E6P A;  3LB8 C;  4A20 A;  4IM2 A;  2MBE A;  2JVC A;  4MGZ E;  4YWG G;  4GDK A;  4W9I A;  4EEW A;  2K1F A;  2HTH A;  3PS6 A;  3TBL D;  3U52 E;  1TT5 B;  2Y5C A;  2NPT A;  3L4P A;  1K51 A;  2GI9 A;  4URK A;  2W9N A;  3VRB B;  3FIL A;  1M4V A;  3AE2 B;  4C7Y A;  3U8Z A;  3BY4 B;  2R61 A;  5C3J B;  1YIW A;  4IKG A;  2NTS A;  2RMM A;  3JSV A;  3VR8 B;  4NPN A;  2LZ6 A;  4IG7 B;  3B0A A;  5IAA C;  3E9S A;  4YSY B;  2N7J A;  5JZE B;  2BWF A;  3NZU A;  2WX1 A;  1L6V A;  3ZJV A;  2G9H D;  4AJY B;  3H6N A;  2KFJ A;  2DYB A;  3SR6 A;  1BT0 A;  2EKI A;  3W5V B;  3AN1 A;  3A1Q A;  2DZK A;  2LHE A;  3DWM A;  1F0Z A;  3NG0 A;  1QOA A;  1WJ6 A;  2Y3A A;  2MWS B;  2RR9 A;  4DQO C;  2BPS A;  3MHZ A;  4CHK A;  3A33 B;  1YQ3 B;  4EZL A;  3P1M A;  3HK0 A;  1QQR A;  5MPO A;  3AED B;  2TSS A;  2WXK A;  1ZGU B;  4BAX A;  3IXS A;  1SIF A;  3RNE C;  5GMV A;  4US8 A;  2IBI B;  2M0A A;  2LRU A;  2ZPN A;  4KGR A;  1T0Y A;  2ZVO A;  5AZF A;  1GOZ A;  1L4Z B;  1TZO A;  2CU1 A;  3FKY A;  2KJ6 A;  3EEC A;  3Q3O C;  1RFA A;  1V97 A;  5JHA A;  2C7N B;  2K5P A;  3MJ5 A;  3LYY A;  3Q3M C;  3QCA A;  2NMQ A;  1H4R A;  4RNA A;  2L3Z A;  5IN7 A;  2D5G A;  5BO4 B;  4MEL A;  4FJV B;  3HM3 A;  2MJD A;  4K7U A;  3H1U A;  2AQ3 B;  2HTM E;  3P42 A;  2KAN A;  4HCP B;  2IO1 B;  4G3X B;  4BBN F;  4LNK A;  1P7E A;  2KN5 A;  1ZOY B;  2KMC A;  3I63 C;  1MHH E;  4KV2 A;  3R7R A;  1WGG A;  1UH6 A;  1UGM A;  3L54 A;  3RNB C;  5HI1 A;  1GC7 A;  4P16 A;  2D3G A;  1P7F A;  1T3Q A;  2KDM A;  4LNI A;  1L0V B;  2LFI A;  3B08 A;  2INC C;  1PGX A;  4KKI A;  2NBU A;  1VZ7 A;  5G55 A;  5AZH A;  4REZ A;  2NCN A;  4KZC A;  2BGF A;  4YTM B;  4KX6 B;  3ZQ4 A;  1UF0 A;  4TQ1 A;  1E5W A;  3WIM A;  3VRA B;  1SF0 A;  2RDG A;  2KMM A;  3TL5 A;  1JWA D;  4NNJ B;  4ICU A;  3QHT A;  2JZZ A;  2WU2 B;  1MVK A;  2QJL A;  1QKZ A;  2KDF B;  3URY A;  2LGI A;  3A9J A;  1WSP A;  2BYV E;  3ZUN A;  1C9F A;  4OW0 A;  1CJE A;  1PQS A;  1F1H A;  2NR2 A;  4ZHO A;  5C23 A;  2EMS A;  2EMT A;  5IP4 D;  4A6Q A;  5JHB A;  2DLB A;  3AEE B;  4JX1 C;  4B95 A;  3IFW B;  5E6N A;  3IG3 A;  2WXR A;  5DPW A;  1D5M C;  1WYG A;  2L8J A;  3KVF B;  3N3K B;  4W9K A;  3NS1 A;  3TCA A;  2O2V B;  2OED A;  4KGS A;  4RM9 A;  2JZP A;  4E3C A;  4YSZ B;  3BVM A;  2MW5 A;  1TJE A;  4W9C A;  3RZF A;  2V0G A;  2AL3 A;  4HCN B;  1E7V A;  4M8M A;  3R2I A;  3WAP A;  5C1Z A;  4BKG A;  2YEP F;  4DDI D;  2WGS A;  4HDQ A;  5FR6 A;  2WXM A;  4TKN A;  4FJZ A;  2LGS A;  3AE1 B;  1Q1O A;  4GXB A;  2ZNV B;  2QEJ C;  3O65 B;  4EZJ A;  1J7A A;  3AEC B;  3ML9 A;  3TJP A;  5CHW A;  5IOI A;  3P4Q B;  4X57 B;  3S2A A;  2JUO A;  1TIF A;  1FXI A;  4DXG A;  2V3P A;  3APD A;  4MGY E;  2MCN B;  2D2Q A;  3M62 B;  2PVG C;  5BYS A;  2Y5P A;  4PS3 A;  2K8C A;  2RPV A;  1SE2 A;  4ZRJ A;  2D3A A;  4OHJ A;  2BS2 B;  1V8C A;  3GP7 A;  5G5H A;  3M3J A;  4ARC A;  2J0M A;  3DHI C;  2O6V B;  4AS1 A;  4PYU A;  3ZO5 B;  3IAM 1;  4GLS C;  2V3N A;  3PO0 A;  1HXY D;  2KAJ A;  1K53 A;  3NOB A;  4K3C A;  1JRO A;  4BOS C;  3HUI A;  3NUH B;  2JPH A;  1PGB A;  2LJI A;  1C77 A;  2WXJ A;  2MSE D;  3VDZ A;  3HM6 X;  4C00 A;  1ET9 A;  5LXI B;  4A90 A;  5L83 A;  4A3P A;  3RNA C;  1I7H A;  1V80 A;  2KTR A;  5BMH A;  4HPL B;  1CMX B;  2WDR B;  2J53 A;  1I4P A;  1XLQ A;  1MI0 A;  4DXF A;  3N1Y C;  3DHH C;  3CMM B;  3AV8 A;  4J6I A;  3VXW A;  2INP E;  1K50 A;  2JQR B;  3RFZ B;  3ZW3 A;  3AM9 A;  4KDL B;  3SEB A;  4HDO A;  2BYE A;  4LNO A;  3ZNH B;  3N20 C;  1Y56 A;  1YOV B;  2R2O A;  1YJI A;  2KFK B;  1VDV A;  2DZI A;  1E90 A;  1UEL A;  5D3D A;  2V3S A;  3JVZ X;  5FR3 A;  2D3B A;  1GNU A;  4XDC A;  1PDX A;  4ZYS A;  4JL9 A;  1MHX A;  4GSW A;  4HRO A;  1KF6 B;  4GMV A;  4IUM B;  4NQL B;  3IAS 1;  3VUW A;  2LVQ A;  1FRR A;  3CST A;  1EF1 A;  3A9K B;  2MH7 A;  2DZM A;  3X0W A;  5BYR A;  2M17 A;  3I5J C;  2N9X A;  1VR9 A;  1SIJ A;  2I1K A;  2UWQ A;  2PJH A;  1GC6 A;  1UBQ A;  3AXC A;  1L2N A;  1V49 A;  2CJN A;  1OQQ A;  4IWP A;  1JWU D;  4F1S A;  3B2F A;  2HD5 B;  4GU2 A;  4C4V A;  4IC7 B;  1I42 A;  2RSU A;  2PE6 B;  3VTW A;  4TQ0 A;  3SD5 A;  1JCK B;  4WWN A;  4E71 A;  1MPE A;  3RZW C;  4MM3 B;  2MBB B;  2PW9 A;  4C4V B;  2FCM A;  2RDB C;  4FA6 A;  1L6U A;  3DVG X;  3AU4 A;  3RYT A;  3PHW B;  3PV1 A;  2C9W B;  2ONQ A;  2X8X X;  3OJ3 A;  1TGZ B;  2KN4 A;  4PS8 A;  1HTO A;  1TY2 A;  3N1X C;  4RM8 A;  3OWE B;  4DHZ E;  4C80 A;  1HE8 A;  2ZEQ A;  1QZE A;  4HPM B;  3Q6B A;  2KXJ A;  4E74 A;  3TEY A;  3AE9 B;  2WXP A;  2LWP A;  2L0F A;  2WLB A;  1QT9 A;  2AQ1 B;  1IP9 A;  4NAW A;  1C76 A;  1XCT L;  3ZJT A;  4DBG A;  3MP9 A;  3PRZ A;  3WAO A;  1YNT E;  3NJT A;  1WX8 A;  1Z5S B;  2J4X A;  1WXA A;  4FUL A;  4M02 A;  2OHF A;  3C0R B;  4HEA 1;  2QCZ A;  2LI5 A;  3TUO A;  1HA5 A;  2L05 A;  2FIF A;  3RI7 C;  2N7D A;  2ZPY A;  3C8Y A;  3P2B A;  5JH5 C;  3U2S C;  1QOF A;  3AI5 A;  5AZG A;  2NBV B;  2JSV X;  2IGD A;  3DVN V;  2BKR B;  2LMC A;  1SJE D;  2WDV B;  3KWV A;  1WRI A;  2L00 B;  1JAL A;  3NZS A;  3SHQ A;  1HEZ E;  3OG5 A;  1ISN A;  2GRI A;  1TKG A;  3IBE A;  2KWV B;  4N59 A;  3MTN B;  2PEA A;  2GB1 A;  4NY0 A;  2QC8 A;  4OVU A;  2Y5B B;  1ZP0 B;  2NS5 A;  4XWT A;  2IGG A;  2LUM A;  2L1A A;  2LJ5 A;  4CYE A;  2MHJ A;  4GIV A;  3CF6 E;  4Q2J A;  1J8C A;  1E7U A;  2M4N A;  1WGY A;  3R7Q A;  2K9X A;  4ZOH C;  2KFK A;  2C7H A;  2WXQ A;  2Z0E B;  2ZJD A;  2FCS A;  4WIP A;  1JWS D;  2AQ2 B;  3AEG B;  2M8S A;  2K8B A;  1E6E B;  3VH4 B;  1E8Z A;  2J7Q B;  2MBQ A;  4US9 A;  2VZK D;  2N4F A;  2ZNV C;  4PK1 A;  4OZC A;  2KDE B;  4PS7 A;  1QOB A;  3A9J B;  3M63 B;  3AB5 A;  4I6N B;  1IUE A;  3GE3 C;  2L7R A;  4W9L A;  1GJZ A;  4BZA A;  4WWO A;  1ZE3 D;  1L0Y B;  2L83 A;  3TEZ A;  2RGF A;  3K9P B;  1TS3 A;  2BS3 B;  3BK1 A;  3HHM A;  1VZ6 A;  1T5X D;  2G4S A;  2OJW A;  1CQV A;  4WJO A;  1OEY J;  2L52 A;  2AYO B;  2BB6 A;  2J0J A;  3DBS A;  4OZB A;  3ZGZ A;  3DBH I;  2GBJ A;  2JYE A;  2ZVN A;  4NJ6 A;  1WMH A;  3AU5 A;  1JQ4 A;  4MJS A;  1HTQ A;  4FAD A;  3WCQ A;  3UQA A;  1WM2 A;  3C19 A;  4BVU C;  2HJ1 A;  4KDI C;  2JY6 A;  2MBH A;  3RT3 B;  4NZL B;  1Q5W B;  2KWC A;  3VFK A;  3ABV B;  4K1R B;  3ETR A;  4ACF A;  2KAC A;  3IHP C;  2CHZ A;  3QC8 B;  5JXV A;  4RF1 A;  2BF8 B;  4ANV A;  5TSS A;  2IJ0 A;  4MAC A;  1L0X B;  3AE4 B;  3TEW A;  1WGK A;  3W1S C;  1XF5 L;  3NVY A;  4EKU A;  1WJ4 A;  2L76 A;  2JF5 A;  3TMP B;  3RUI B;  4DWF A;  2H88 B;  4ZYN A;  1WGR A;  4M01 A;  2IY1 B;  2JXX A;  4WQO B;  4P1C C;  3LJ3 A;  3UGB B;  3ZDT A;  1K52 A;  2MJ3 A;  1TYG B;  5BMI A;  3ZNG C;  4MSM B;  1T0S C;  1FM0 D;  2D11 A;  2FE8 A;  3BYT B;  3CWI A;  3ZRF A;  3APF A;  4GDL A;  1WMH B;  3JW0 X;  2X38 A;  1UWX A;  1ZW7 A;  1FNV A;  1YMH E;  2WYQ A;  1IBX A;  2ACZ B;  1SXT A;  1KM7 A;  2MEK A;  2KJH B;  4LDT B;  3QIJ A;  2BWE S;  4AQ7 A;  1PFD A;  2WQY B;  4FHK A;  5D94 A;  2WWZ A;  2K0P A;  2J52 A;  4MH8 A;  2V4I B;  1D6E C;  2YEP B;  2M1M A;  2IDY A;  4AJW A;  1XCQ L;  3PT2 B;  4BKT A;  4WAF A;  3RUL A;  2KTF A;  3IT4 B;  1RLF A;  1T0Q C;  4M00 A;  1RYJ A;  2MP2 A;  4KSK C;  4F7Z A;  2GBR A;  2LEK A;  1P1A A;  1LFD A;  1MFW A;  2WU5 B;  3MC9 A;  1SE9 A;  5HG2 A;  4N6E B;  2WXL A;  4B6W A;  4W9D A;  1L5P A;  2JWZ A;  3ZIM A;  2I2Y A;  4NAM A;  5IO9 A;  3WAM A;  5E6J A;  3AE6 B;  3QAQ A;  2K6D B;  3P4S B;  2EEL A;  2KDI A;  1RAX A;  4W9F A;  1AYF A;  4RGN A;  2W55 A;  4GGQ A;  3P63 A;  1JW9 D;  2ICI A;  1V6E A;  3I3T B;  1OQR A;  5KHQ A;  2A4Z A;  1N63 A;  1EU3 A;  3WA0 A;  2AEH A;  4HRS A;  3DBL B;  4HJK A;  4BOZ B;  3UQB A;  3MC8 A;  3BK2 A;  3ZDM C;  3CIR B;  5D3I B;  4KVG B;  4ICV A;  5T8I A;  2IO2 B;  2BW2 A;  1UWM A;  1Q0W B;  2PKO A;  2KYW A;  4FBJ B;  2DYO A;  2KD0 A;  2VH2 A;  3DBR B;  1J0G A;  2FCN A;  2E6X A;  1FRD A;  1SE4 A;  1FO4 A;  3L10 B;  3X23 A;  3JYU A;  1YJJ A;  3HRD D;  4HKQ A;  2C7M B;  1F9J A;  1ZPS A;  1V5O A;  2IYD B;  2JX5 A;  2QMT A;  2KVR A;  5FK9 C;  4FN2 A;  4YSX B;  4RGT A;  2REX A;  2FCQ A;  2LGY A;  3V6E B;  3Q8E A;  3U30 A;  2PE9 A;  4B0M A;  1R7S A;  2NBW B;  2MQJ A;  2KWD A;  4GDK B;  2BVC A;  2WXH A;  2AL6 A;  2PMV A;  4GOC A;  3KH0 A;  1YX5 B;  2QSD A;  1FIQ A;  4LK0 M;  2WDT B;  2XNA C;  1OEY A;  3AE8 B;  1VLB A;  1KH0 A;  2MLB A;  4JPS A;  4WH4 A;  4MDK E;  2NVU I;  2WXN A;  3GS2 A;  1CZP A;  2BB5 A;  2KWU B;  4W9H A;  1UZX B;  2IO0 B;  4LNN A;  4O1N A;  2Z8L A;  1FNW A;  1JRU A;  2LUE A;  1WRD B;  2WXG A;  4I6P A;  3KUZ A;  3AE5 B;  1Z2M A;  3VR9 B;  5LLI A;  4TSS A;  1YQB A;  5G5G A;  3ML8 A;  1VRA B;  1N60 A;  2QIL A;  1WXM A;  3DVG Y;  3MJW A;  2N0S B;  4EUT A;  3ENE A;  2KQS A;  2ZZP B;  3T8M A;  4MEM A;  3AE3 B;  2M19 A;  2LGX A;  2N9L A;  3Q8C A;  3GOE A;  4ZRK A;  4LLG M;  2MA9 B;  1RWS A;  3KW5 B;  2INN E;  5DPR A; 
#chains in the Genus database with same CATH homology
 3EHV A;  4W9E A;  1HE8 A;  2ZEQ A;  1QZE A;  4HPM B;  2KXJ A;  5DPT A;  2HJ8 A;  4AJY B;  5HKH A;  3T9L A;  3ZLZ A;  2JT4 B;  4E74 A;  1WZ0 A;  3H6N A;  2KFJ A;  2DYB A;  1BT0 A;  2IY0 B;  3A1Q A;  2DZK A;  2LWP A;  2L0F A;  2PPH A;  1IP9 A;  1WJ6 A;  4NAW A;  2FNJ B;  4IM3 A;  4DHZ B;  2MWS B;  4WJN A;  2RR9 A;  4ANU A;  4DBG A;  2BPS A;  2GBN A;  4CHK A;  1TTN A;  3A33 B;  3TIX A;  2WX0 A;  2G3Q B;  3PRZ A;  3WAO A;  1WX8 A;  4K81 A;  5CX3 A;  1Z5S B;  5E6O A;  2KHW B;  4JIO U;  3PSE B;  3PGE A;  4EZL A;  1WXA A;  1FXT B;  3QAR A;  4FUL A;  3HK0 A;  4RMA A;  3C0R B;  1WXS A;  4NJ7 A;  2LI5 A;  3N30 A;  4B9K A;  2R2Q A;  2L05 A;  1ZGU B;  2FIF A;  2XEW A;  1V86 A;  2N7D A;  4W9J A;  2ZPY A;  5DCN A;  1KJT A;  1SIF A;  3P2B A;  5JH5 C;  3A4S C;  4HK2 A;  5GMV A;  4DK5 A;  3AI5 A;  5AZG A;  4KIK A;  2K39 A;  4DXA B;  2IBI B;  2NBV B;  3VH3 B;  2LRU A;  2ZPN A;  3H7P A;  4P7I A;  3DVN V;  2ASQ A;  1T0Y A;  2FAZ A;  2YLM A;  2ZVO A;  5AZF A;  5L95 C;  2BKR B;  2CU1 A;  2KJ6 A;  3NZS A;  2L00 B;  3SHQ A;  2N1V A;  3EEC A;  3OLM D;  3R3M A;  1RFA A;  1ISN A;  1MG8 A;  5JHA A;  1XQQ A;  4G11 A;  2C7N B;  3V62 A;  1J19 A;  3IBE A;  1E8X A;  2KWV B;  3QCA A;  3MTN B;  4DHJ B;  1H4R A;  2PEA A;  2L3Z A;  5BO4 B;  2N9E B;  3QA8 A;  2IO3 B;  4NY0 A;  3B1L X;  1YD8 U;  4MEL A;  1WY8 A;  4FJV B;  4OVU A;  3ZTC A;  2Y5B B;  2G45 B;  2GBK A;  2NS5 A;  2KZR A;  1A5R A;  3W1Y A;  3HM3 A;  4HXD A;  2O2V A;  4K7U A;  3VTU A;  3DVN U;  3H1U A;  2LJ5 A;  4XZ4 A;  1P98 A;  4YL8 A;  3U7D A;  4CYE A;  2J0K A;  2KC2 A;  4LJO B;  1VD2 A;  1VCB A;  2KAN A;  4EOY A;  4GIV A;  1SGH A;  3CF6 E;  4LJP B;  1J8C A;  1EUV B;  4HCP B;  1V9J A;  2IO1 B;  4G3X B;  4BBN F;  1E7U A;  2D07 B;  2M4N A;  4LDT D;  1WGY A;  3R7Q A;  3ECI A;  2KFK A;  2C7H A;  2Z0E B;  2ZJD A;  2FCS A;  3OJ4 B;  2KN5 A;  1H8C A;  1YJ1 A;  2KMC A;  2M8S A;  3NS8 A;  4KV2 A;  2B3A A;  2K8B A;  3R7R A;  3UIN B;  3UIP B;  3VH4 B;  1WGG A;  1UH6 A;  3QX1 A;  1E8Z A;  2J7Q B;  1UGM A;  2MBQ A;  3VVW B;  3L54 A;  2V1Y A;  2K6Q A;  2N4F A;  1WR6 E;  2ZNV C;  4KSL C;  1OGW A;  1GC7 A;  1L7Y A;  4ZDV A;  2D3G A;  4AOF A;  2KDE B;  4FHJ A;  2HE7 A;  3B08 A;  2MP2 B;  3DPD A;  4PS7 A;  3A9J B;  3M63 B;  3DBR I;  1RRB A;  4I6N B;  2NBU A;  4GDL B;  5EDS A;  4MJS B;  2L7R A;  1NBF C;  2IZV B;  5AZH A;  5G55 A;  2NCN A;  3A9K A;  4W9L A;  1GJZ A;  1P3Q U;  3R66 C;  4WWO A;  4KZC A;  4N9F 4;  2BGF A;  2XK5 A;  4HWI B;  1WJN A;  5KHO A;  2RGF A;  3L13 A;  3K9P B;  3ALB A;  1E5W A;  4TQ1 A;  4M8N A;  2YVC A;  3H9D A;  2KOX A;  2FID A;  3WIM A;  3HHM A;  3QK0 A;  2G4S A;  1TBE A;  4WJO A;  4BKS A;  1OEY J;  1WI0 A;  5IA7 A;  2MX2 A;  3M95 A;  3NY5 A;  3TL5 A;  2AYO B;  4FLH A;  4NNJ B;  4EZK A;  2J0J A;  5J17 A;  3PRP B;  3DBS A;  4ICU A;  3QHT A;  4ANW A;  3DBH I;  2JZZ A;  2GBJ A;  2RPQ A;  2ZVN A;  2KDF B;  3A9J A;  4AUQ C;  5LXH A;  4NJ6 A;  1WMH A;  1V5T A;  2BYV E;  3AU5 A;  3ZUN A;  4MJS A;  4FAD A;  3DDC B;  3VQI A;  3UQA A;  5DPR A;  1NDD A;  1PQS A;  2NR2 A;  1WM2 A;  2AWT A;  3RD2 A;  4G0N B;  3KYC D;  2CS4 A;  4WJQ A;  3A4R A;  4BVU C;  1C1Y B;  5C23 A;  1WGH A;  2EMS A;  2EMT A;  2JY6 A;  3ONS A;  3PVL A;  4KDI C;  4MGI E;  4W9G A;  1ZKH A;  3EC8 A;  5JHB A;  2GMI C;  4WJP A;  2MBH A;  4MH0 E;  3RT3 B;  5AEK B;  3DCG A;  4B95 A;  3H7P B;  3IFW B;  5E6N A;  3ZTD A;  1Q5W B;  4TUU A;  2KWC A;  3VFK A;  1YX6 B;  2ZCB A;  3IG3 A;  4K1R B;  5DPW A;  2KX3 A;  1WXV A;  2CHZ A;  2L8J A;  3IHP C;  3KVF B;  3QC8 B;  2BF8 B;  3N3K B;  4W9K A;  4ANV A;  1U4A A;  2EKE C;  3TCA A;  2LRW A;  4ASW C;  2O2V B;  4II2 B;  3W1S C;  4RM9 A;  4E3C A;  5CHV C;  2MW5 A;  3DQV A;  2KKC A;  3VAW A;  4IW0 A;  4EKU A;  3ZRC A;  1WJ4 A;  2L76 A;  2JF5 A;  4W9C A;  3TMP B;  3RUI B;  3RZF A;  2K8H A;  1M94 A;  4K7S A;  4DWF A;  2N7E A;  3L16 A;  2AL3 A;  3KUD B;  1WGR A;  4HCN B;  4ZYN A;  1E7V A;  2IY1 B;  2JXX A;  2KDB A;  4M8M A;  4WQO B;  3WAP A;  4EFO A;  4BKG A;  5C1Z A;  4FJY A;  2LVO A;  3V60 A;  2GOW A;  2OOB B;  2CHW A;  3LJ3 A;  1S1Q B;  4LCD E;  3SDL C;  4MGK E;  2XBB C;  3UGB B;  1GUA B;  4DDI D;  4HDQ A;  4JGH B;  5FR6 A;  4TKN A;  4FJZ A;  3QJZ A;  1KOT A;  3ZNG C;  1E8W A;  4GXB A;  1Q1O A;  2N9P C;  2ZNV B;  2M0X A;  3D32 A;  4MSM B;  2D11 A;  3APC A;  3ZRF A;  3O65 B;  2GBM A;  2JRI B;  3PLV A;  4WAA A;  3APF A;  1WIA A;  4EZJ A;  4GDL A;  1IYF A;  1P9D U;  3VHT C;  3ML9 A;  4IWO A;  5CHW A;  3TJP A;  1WMH B;  2KJR A;  3JW0 X;  1ZW7 A;  3L0W B;  2WYQ A;  4ZRI A;  4CO7 A;  3L08 A;  3PTF C;  4X57 B;  3S2A A;  3ZNI D;  1KM7 A;  2JUO A;  2KJH B;  4LDT B;  3UF8 A;  3QIJ A;  2BWE S;  3VUY A;  3PRM B;  1X1M A;  2Z59 B;  1WE6 A;  2FUH B;  3APD A;  4MGY E;  3KYD D;  4FHK A;  2MCN B;  5D94 A;  2D2Q A;  2WWZ A;  1S3S G;  3M62 B;  1AAR A;  4K7W A;  4PS3 A;  1TZ1 A;  1WJU A;  2CHX A;  4MM3 A;  2K8C A;  4MSQ B;  2M1M A;  4ANX A;  5CTR C;  1GG3 A;  4ZRJ A;  1Y8R C;  4AJW A;  4DHJ D;  2OJR A;  3SU8 X;  5D7G A;  4IWQ A;  1WYW B;  1WFY A;  1LQB A;  3M3J A;  1WF9 A;  2J0M A;  1EO6 A;  1OQY A;  3PT2 B;  4BKT A;  3KUC B;  3MHS D;  3QQ8 B;  1LM8 B;  3L17 A;  1XT9 B;  2L0T A;  1V81 A;  2C5L C;  2CR5 A;  2O6V B;  3QWZ B;  3RUL A;  3GZN I;  4AP4 C;  2KTF A;  1RLF A;  4PYU A;  3ZO5 B;  2MP2 A;  4KSK C;  4F7Z A;  1C3T A;  3OAW A;  4F8C B;  2MRP A;  3AUL A;  2GBR A;  1P1A A;  2N1W A;  1LFD A;  3PHX B;  4AWJ A;  2DHZ A;  3NOB A;  1SE9 A;  2O6V A;  4BOS C;  4B6W A;  5D2M B;  3RCZ A;  4W9D A;  1OTR B;  1R4M I;  2JWZ A;  3ZIM A;  2DYM A;  2BKF A;  2JZ3 B;  3V61 A;  3HIZ A;  2JPH A;  4KIK B;  3Q3J A;  3WAM A;  3ZNZ B;  3QAQ A;  2K6D B;  2I1J A;  2KDI A;  1RAX A;  4II3 B;  3DBL I;  4W9F A;  2MSE D;  2LVP A;  3VDZ A;  3DOW A;  4BKS D;  3HM6 X;  4WWP A;  4GGQ A;  1UD7 A;  4IM0 A;  5LXI B;  1V6E A;  3I3T B;  5L83 A;  3PZD A;  2A5U A;  4A3P A;  4I6L B;  1V80 A;  5KHQ A;  2KTR A;  2A4Z A;  2KX0 A;  3WAN A;  4NAW B;  3WA0 A;  2AEH A;  4TV3 A;  4HPL B;  4HJK A;  2XK5 B;  4BOZ B;  1CMX B;  3UQB A;  1I35 A;  1LXD A;  2KLG A;  3ZDM C;  3IVF A;  1WE7 A;  4G50 A;  4GB9 A;  5DPS A;  4KVG B;  3ZVV A;  2LD9 A;  4ICV A;  2IO2 B;  1WGD A;  4JLC A;  1Q0W B;  1P0R A;  3ZDT A;  3WAL A;  3CMM B;  4FBJ B;  4J6I A;  3VXW A;  2DYO A;  2LXC A;  2DAJ A;  3VTV A;  2KD0 A;  5G2N A;  1J0G A;  1G6J A;  2FCN A;  2VRR B;  4DDG D;  1XD3 B;  3ZW3 A;  2UYZ B;  3L10 B;  4KZ0 A;  3X23 A;  5J18 A;  3JYU A;  3BIN A;  4KDL B;  2KO3 A;  2LAS A;  4A3O A;  2KTR B;  2C7M B;  3VUX A;  1F9J A;  2IYD B;  1V5O A;  2BYE A;  4HDO A;  3ZNH B;  2KVR A;  2LGD A;  4FN2 A;  4XX5 A;  1WH3 A;  4JQW C;  1WM3 A;  2R2O A;  2DZJ A;  3W1S A;  2DEN B;  2KFK B;  3CSF A;  3EFU A;  2DZI A;  2REX A;  2FCQ A;  2LGY A;  3K9O B;  3V6E B;  2DAF A;  3U30 A;  2PE9 A;  2MBO A;  2V4L A;  2K25 A;  1NI2 A;  1E90 A;  1UEL A;  1V2Y A;  2V3S A;  1WR1 A;  3JVZ X;  2NBW B;  3PPA A;  4M0W B;  5CHF A;  2BYF A;  4GN1 A;  2MQJ A;  2KQ7 A;  2NPT B;  1GNU A;  4GDK B;  5J2R A;  4XC2 A;  2AL6 A;  2D10 A;  4JL9 A;  2DX5 B;  1WZ3 A;  4GOC A;  3KH0 A;  1YX5 B;  4GSW A;  4NQK E;  4PYZ A;  3LDZ E;  4HVB A;  4GMV A;  4IUM B;  2G4D B;  4NQL B;  3NHE B;  3VUW A;  2LVQ A;  2WDT B;  4HLE A;  3CST A;  5TR5 A;  1OEY A;  1KLV A;  1EF1 A;  3A9K B;  2JRH A;  1R4N I;  2DZM A;  3JSV B;  4BFR A;  3X0W A;  2M17 A;  2KNB A;  2MLB A;  3PRE A;  2LXA A;  3A1Q B;  1WX7 A;  2C60 A;  2KC1 A;  2N9X A;  2O6V D;  4MDK E;  2KK8 A;  2NVU I;  2I1K A;  1UBI A;  5E6P A;  2UWQ A;  4A20 A;  2PJH A;  4IM2 A;  1GC6 A;  2KLC A;  1UBQ A;  2MBE A;  2KWU B;  4W9H A;  2JVC A;  1UZX B;  3AXC A;  2IO0 B;  1L2N A;  4MGZ E;  1K8R B;  1V49 A;  1EF5 A;  4GDK A;  4IWP A;  4W9I A;  4EEW A;  4F1S A;  2K1F A;  1JRU A;  2LUE A;  1WRD B;  2HD5 B;  2HTH A;  3KUZ A;  4I6P A;  3PS6 A;  3TBL D;  4GU2 A;  1WX9 A;  4IC7 B;  1Z2M A;  1I42 A;  2QHO A;  2NPT A;  2RSU A;  3PLU A;  2CKH B;  5LLI A;  2PE6 B;  3VTW A;  1YQB A;  4TQ0 A;  2RD0 A;  4URK A;  2W9N A;  3SD5 A;  3Q3F A;  1IPG A;  3UIO B;  3ML8 A;  4WWN A;  4E71 A;  1D3Z A;  1WXM A;  3DVG Y;  3MJW A;  2Z0D B;  2ZCC A;  4OVV A;  3BY4 B;  3U8Z A;  4BBN C;  4EUT A;  3RZW C;  3ENE A;  1YIW A;  2MBB B;  2KQS A;  2ZZP B;  3T8M A;  3V6C B;  2FCM A;  1E8Y A;  2KMA A;  4MEM A;  4FA6 A;  3DVG X;  3AU4 A;  2LGX A;  3JSV A;  4NPN A;  3RYT A;  3ZKJ C;  3N32 A;  3PHW B;  2LZ6 A;  3GOE A;  3PV1 A;  4IG7 B;  3B0A A;  4ZRK A;  5IAA C;  2C9W B;  2MA9 B;  3OJ3 A;  3KW5 B;  5JZE B;  1TGZ B;  3H7S A;  4PS8 A;  2BWF A;  5D6J B;  4RM8 A;  3NZU A;  4DHZ E;  2WX1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...