2KQ7A

Solution structure of the autophagy-related protein atg8
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
119
structure length
119
Chain Sequence
GSMKSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Autophagy-related protein 8
publication title Solution structure of Atg8 reveals conformational polymorphism of the N-terminal domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 18
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kq7A01
3SD5A 3W1YA 1TGZB 3VTVA 1WE6A 1WJUA 3DDCB 4W9CA 4NPNA 4EFOA 3CF6E 4K7WA 1WGYA 2KOXA 4FJVB 2KTFA 3I3TB 4TUUA 2C5LC 2L7RA 2KDBA 2J0JA 2RPQA 3HM6X 2I1KA 3IBEA 2D2QA 4KSKC 1WMHB 3A4RA 1WM3A 4KV2A 4BOZB 2V4LA 5DPSA 4F1SA 1AARA 3NS8A 4BKTA 4W9DA 2FCMA 1V5OA 4GB9A 3ZKJC 1WIAA 2GBRA 2C7MB 4XC2A 3VUYA 5IAAC 2JPHA 5CTRC 3NHEB 2RR9A 3KW5B 4BOSC 3B1LX 4WJOA 2HTHA 3TMPB 3T8MA 3ZTDA 2KK8A 5DPTA 3W1SA 4W9EA 4FULA 1WJNA 4WWPA 2MCNB 2KMAA 2RD0A 4ANWA 3VVWB 2FCNA 4AWJA 3M62B 1L2NA 3R7QA 4IM3A 3VH4B 2NPTA 1FXTB 2KD0A 2J0KA 4XZ4A 2PEAA 4NY0A 4OVVA 2JVCA 2D10A 3N3KB 2LRWA 3L0WB 5CHVC 1WH3A 3ZNGC 4NAWB 4AJYB 2KVRA 2GOWA 3APCA 3HM3A 4TQ1A 2PPHA 2MX2A 2IO3B 4ZRIA 2CHWA 1WZ0A 4HPMB 1Q1OA 1IPGA 3MJWA 2M17A 3TL5A 2L05A 2KMCA 2MP2A 3NZUA 4B6WA 4TQ0A 4MSQB 1X1MA 2BWFA 1H4RA 5TR5A 4ZYNA 3VAWA 4P7IA 4HCPB 3RYTA 3WIMA 2HJ8A 4WJQA 1SIFA 3M63B 2JWZA 1OQYA 2LGXA 3GOEA 2N9XA 2FNJB 2GBJA 2IYDB 1TTNA 4X57B 3ZLZA 3ZO5B 5L83A 5G2NA 1KOTA 5J18A 2K8HA 2MQJA 4W9FA 5E6NA 1E8XA 3T9LA 1A5RA 2DZIA 3VTUA 5C23A 3KUZA 4HPLB 4M0WB 5EDSA 1KJTA 2EMTA 4ZRJA 3X0WA 5CHWA 4RMAA 4TKNA 2MSED 3W1SC 2WX0A 1LM8B 3HHMA 3B0AA 3GZNI 3VUXA 1Q5WB 1F9JA 4KIKB 2L0TA 3ML9A 4JLCA 2XEWA 2IO0B 1GJZA 1ZKHA 4EEWA 3AULA 4NQKE 3S2AA 4ANUA 4FHKA 4I6NB 4ZRKA 3ZRFA 2A5UA 3EHVA 1YIWA 3VFKA 1EF1A 3VUWA 2BKRB 4DBGA 2NBWB 1YX6B 3QARA 2KJHB 3PREA 3ECIA 3PVLA 2K8BA 2LGDA 3DCGA 3A9KA 4LJPB 2J0MA 4E3CA 1I35A 1EF5A 2LVPA 3ONSA 3KYDD 2MBHA 2VRRB 2GBKA 4GDKA 3WAOA 4IWOA 2J7QB 2KXJA 4EKUA 4WJPA 4E74A 2V1YA 4BBNC 1J0GA 2N1WA 2D11A 3ZNHB 3SU8X 2NBUA 3UINB 3PSEB 2V3SA 2REXA 4LDTB 3RCZA 4DHZE 4GDLB 4EUTA 4WAAA 2RGFA 3VTWA 5JHAA 2UWQA 4GOCA 1E8WA 3VQIA 3V61A 3ZNID 1P0RA 2KWCA 5AZGA 1C3TA 2JF5A 3QWZB 2CKHB 5G55A 4ZDVA 3DBHI 1K8RB 3B08A 2L0FA 2O2VB 3A1QA 4A20A 3U30A 1WZ3A 1L7YA 3BY4B 2G4DB 3ZDMC 1P1AA 1M94A 3C0RB 4ICUA 4PYUA 3EECA 1UZXB 5KHQA 4WWNA 1RRBA 2AYOB 3QCAA 4PYZA 4KVGB 4II3B 4AP4C 2DYMA 1P3QU 2CR5A 2DZKA 2DAFA 3ZNZB 3M3JA 4FJYA 3APFA 1OGWA 3UQAA 2IZVB 4ANXA 2XK5B 2OOBB 3Q3JA 4KIKA 1KM7A 2KJRA 2KZRA 3V62A 3RZFA 5IA7A 3H1UA 2EMSA 4DHJB 4IM0A 4JL9A 2RSUA 1CMXB 5DCNA 2LI5A 1LFDA 2IO1B 2BYEA 4MGKE 2FUHB 3H7SA 3PHWB 4EOYA 3A4SC 1WGDA 3U8ZA 3ZRCA 3A9JA 1XQQA 4NJ7A 1NDDA 1I42A 4BBNF 1WX7A 2LWPA 3VXWA 1V86A 2BGFA 3JVZX 5CHFA 5BO4B 1WJ6A 4FLHA 4MJSB 2GMIC 2K39A 3LDZE 4RM9A 2DZMA 5J17A 3UQBA 3BINA 2O6VB 4F7ZA 2N9EB 2GBNA 1SE9A 3PRPB 2AWTA 2DZJA 1YQBA 4NJ6A 2BPSA 1EO6A 2Z59B 4GN1A 2ZZPB 1JRUA 4LCDE 2ZPNA 4BKGA 2ZNVC 1XT9B 4G50A 4AOFA 4FBJB 1C1YB 2IY0B 2KNBA 2IBIB 4G3XB 4NQLB 2L76A 2R2OA 2UYZB 2G4SA 1UGMA 3DPDA 1OEYJ 2JXXA 3IG3A 4NNJB 2PE9A 2K6QA 3V6EB 3OAWA 3QAQA 3UF8A 4IC7B 3TJPA 2KC1A 1LXDA 3JW0X 5D6JB 3PT2B 4DDGD 2KTRB 2O2VA 2KN5A 4GSWA 2KFKB 3DQVA 3A33B 1GC6A 5DPRA 4DWFA 1WR1A 4ASWC 2KHWB 2PE6B 2N7EA 2B3AA 1WMHA 1E8YA 3QA8A 2N4FA 5E6PA 2GBMA 2DYOA 2XK5A 2FCQA 3K9OB 2DHZA 3QC8B 3QIJA 1WXSA 3KUDB 1P9DU 2MBQA 3KVFB 3ZUNA 4BFRA 1KLVA 1V5TA 1YX5B 2ZJDA 1V81A 1Q0WB 5KHOA 2MA9B 2KKCA 3H9DA 4A3OA 4BKSA 2BYVE 2LASA 3IFWB 3R66C 4GGQA 4K1RB 1WM2A 3RZWC 4HVBA 2KQSA 4AJWA 4URKA 3L08A 3NOBA 4W9JA 4MJSA 5LXIB 3NY5A 4GMVA 2BF8B 2MRPA 2YLMA 1WGHA 2ZEQA 2WYQA 4PS8A 3RUIB 1SGHA 2O6VA 2JRIB 5JZEB 3AI5A 4ICVA 3K9PB 5E6OA 3V60A 4E71A 2IO2B 1NBFC 2K6DB 3QX1A 1TZ1A 4NAWA 5HKHA 3PLUA 4EZKA 3ZW3A 1BT0A 1GNUA 3L10B 1GUAB 4JQWC 3KYCD 4GIVA 4IWQA 4DXAB 1H8CA 1MG8A 4HJKA 5C1ZA 3ALBA 4JGHB 1R4MI 4DK5A 5J2RA 1E90A 2MBBB 4DDID 3IHPC 2MWSB 1OTRB 4CO7A 2K1FA 2WX1A 2PJHA 1ZGUB 1S1QB 4HDQA 4MSMB 3R3MA 1RFAA 2FCSA 1EUVB 5D2MB 4W9KA 4MELA 4MM3A 3X23A 4F8CB 2WDTB 2JZZA 3H6NA 4G0NB 4W9HA 2KTRA 1NI2A 2LXCA 3DBRI 1J8CA 2JZ3B 2K8CA 4N9F4 1Z2MA 1D3ZA 1GC7A 4HK2A 2BYFA 2ZPYA 4MGYE 3PRZA 4M8NA 1VD2A 3PPAA 3L16A 4PS3A 5JHBA 3WALA 2A4ZA 4HXDA 3DVGY 4DHZB 2Z0DB 4AUQC 3DVNU 4K7SA 3WAPA 1E8ZA 4GU2A 3N30A 1UBIA 1Z5SB 3H7PB 2LJ5A 2MW5A 1VCBA 2CU1A 3QJZA 2LD9A 3D32A 4IG7B 4IUMB 2JY6A 3UIOB 2BKFA 2L00B 3PZDA 3L13A 4WQOB 3EC8A 1YD8U 1WXMA 2KLGA 3QHTA 4MEMA 2R2QA 2KJ6A 2KLCA 1HE8A 4HWIB 1R4NI 1WGRA 2ZCBA 2JRHA 5AZHA 2JUOA 2KQ7A 4I6PA 3PGEA 3TBLD 3P2BA 2LXAA 3Q3FA 2N7DA 3LJ3A 3MTNB 4KDIC 1WXAA 4HDOA 5AEKB 3PRMB 4LDTD 4B95A 2IY1B 3VDZA 4MH0E 1WRDB 2C9WB 2LUEA 3PHXB 3ZVVA 4GDLA 4WWOA 3A9KB 3TCAA 4BVUC 3NZSA 4YL8A 3IVFA 4W9IA 1RLFA 2XBBC 5GMVA 3UGBB 1S3SG 1TBEA 3UIPB 4MDKE 1LQBA 2OJRA 3SDLC 2L3ZA 4WJNA 1UBQA 2EKEC 4GDKB 2D07B 2FIDA 4W9GA 4B9KA 2CHZA 2KDIA 1WXVA 3VH3B 2CHXA 3DBSA 3OJ3A 3PLVA 1UH6A 2HE7A 4IW0A 4FA6A 3AU5A 3KUCB 3AU4A 4HLEA 1PQSA 1IP9A 3CSTA 1WI0A 4MGZE 3DOWA 3RT3B 4EZLA 1V80A 4K7UA 4GXBA 2MBEA 4I6LB 1GG3A 2C60A 3APDA 4CHKA 1WF9A 3L17A 2LRUA 3KH0A 5FR6A 2HD5B 3JSVB 3PV1A 1WFYA 1IYFA 1ZW7A 2CS4A 3ZTCA 2DAJA 4CYEA 1Y8RC 2KX3A 3QQ8B 4FADA 2NCNA 4ANVA 2NBVB 3HK0A 3A1QB 2G3QB 1RAXA 4DHJD 2NS5A 4KZCA 3U7DA 2KANA 4KDLB 2ZNVB 2W9NA 3DVNV 5D7GA 3WAMA 3ML8A 4BKSD 2C7HA 3H7PA 2KFJA 3O65B 4JIOU 2L8JA 3DBLI 2DYBA 3JYUA 4A3PA 1U4AA 2JT4B 2MBOA 3AXCA 4LJOB 3ZDTA 2KWVB 2LVQA 2AL6A 2O6VD 2Y5BB 4II2B 1E7UA 1WGGA 1WR6E 2G45B 3MHSD 4G11A 3PS6A 2N1VA 2FAZA 3R7RA 2KX0A 2QHOA 3VHTC 5JH5C 5LXHA 2ZVNA 3CSFA 2KO3A 4HCNB 1V6EA 5AZFA 4KZ0A 1WY8A 3WANA 2I1JA 2N9PC 4FHJA 3A9JB 3OLMD 3HIZA 3ENEA 4FJZA 1J19A 1UELA 3RULA 4K81A 2BWES 2WWZA 1WX8A 2NPTB 4FN2A 2ZCCA 1OEYA 3QK0A 4IM2A 1V49A 4MGIE 2MLBA 2KWUB 1E7VA 4OVUA 1V9JA 3TIXA 1ISNA 3N32A 2KDEB 4KSLC 1P98A 4M8MA 2K25A 1WE7A 3M95A 4RM8A 2ASQA 2AL3A 4IWPA 1G6JA 2LVOA 1QZEA 2D3GA 5D94A 3WA0A 2KFKA 2LGYA 3OJ4B 1E5WA 4W9LA 4TV3A 2MP2B 1WX9A 3PTFC 5DPWA 2KDFB 5LLIA 5L95C 2NR2A 2FIFA 2YVCA 2M8SA 3CMMB 3JSVA 1T0YA 3DVGX 1V2YA 1WYWB 2C7NB 1UD7A 4J6IA 2M0XA 2DENB 2DX5B 2LZ6A 2ZVOA 3ZIMA 4XX5A 1WJ4A 1YJ1A 2M4NA 2NVUI 2M1MA 3EFUA 5CX3A 3SHQA 3V6CB 2KC2A 2AEHA 4PS7A 1XD3B 4EZJA 2Z0EB 3RD2A 3L54A
chains in the Genus database with same CATH superfamily
2PLPA 2J42A 1D5ZC 5HI1A 2D3CA 4NPNA 3MC0B 3I3TB 2WXJA 4TUUA 3IBEA 2I1KA 2D2QA 1WMHB 3A4RA 4BOZB 4A90A 4YSZB 4F1SA 4N6EB 3AE7B 1V5OA 4GB9A 4RGMA 2GBRA 2RR9A 3BK2A 2HTHA 3TMPB 3ZTDA 2QDFA 2UU7A 5DPTA 4KGSA 3W1SA 4RF0A 4KX6B 4WWPA 2MCNB 1ZE3D 2WU5B 1YQ3B 4IDIA 1FEHA 1FXTB 2J0KA 2PEAA 5CHVC 1CK1A 3EFCA 4AJYB 2KVRA 2GOWA 3APCA 3N1XC 2PPHA 3MFGA 2MX2A 4HPMB 1J7CA 2KMCA 1X1MA 3AM9A 4ZYNA 3WIMA 4LK0M 1OQYA 1FXAA 2LGXA 2N9XA 2IYDB 1Q10A 1KOTA 1OQRA 2JU6X 5E6NA 1A5RA 4USAA 2K3UA 3B9JA 2EMTA 4ZRJA 5CHWA 2WX0A 5GXGB 3GZNI 3O13A 1T5XD 4KIKB 3AE1B 3GE8C 3U4EG 4EEWA 2CU3A 2D3AA 4NQKE 1MHXA 4HJGE 3U2SC 4ANUA 2A5UA 3ETRA 3GZNB 4DBGA 2KJHB 2PVGC 3DCGA 2J0MA 1EF5A 2LVPA 1NVID 4JX1C 3ONSA 2KT7A 2MBHA 2GBKA 3BVGA 4XE0A 4P1CC 2V1YA 4BBNC 2KN4A 1J0GA 2N1WA 3SU8X 2REXA 4WURA 4ZRPA 3AECB 1SJED 2V4IB 5EE3A 5AZGA 2JF5A 3QWZB 2CKHB 3TSSA 4ZDVA 3P4SB 3U30A 5JXVA 2GRIA 1TS3A 3BY4B 1KH0A 4ICUA 2YEPF 2LUMA 4KVGB 2BT6A 4II3B 1RYJA 2CR5A 3ZNZB 4FJYA 4BZAA 3RI7C 3UQAA 1KM7A 2EMSA 1WXQA 2JYTA 4QAYA 1CMXB 1P7EA 2BYEA 3HVZA 3H7SA 3A4SC 3TUOA 1WGDA 1PFDA 3U8ZA 2M19A 4NJ7A 1F77A 1NDDA 4BBNF 2LWPA 1V86A 5BO4B 3NS1A 1SJHD 2FUG1 1WJ6A 4MJSB 3LDZE 4RM9A 2DZMA 3UQBA 3AE3B 2N9EB 5H8YE 2IGGA 3FKYA 2LGSA 1XO3A 4LCDE 2ZPNA 4YTPB 4FBJB 2IBIB 4NQLB 1WRIA 1VRAB 1T3QA 3DPDA 3IG3A 2K6QA 1PDXA 1SF0A 1WYGA 1C78A 2KTRB 2KFKB 2BBCA 3A33B 1C76A 2DWQA 1GC6A 3Q3MC 3IXSA 1E8YA 1T0SC 2GBMA 2FCQA 3QC8B 1C79A 3KLSX 2MBQA 2D5GA 2W3RA 1KLVA 2ZJDA 1V81A 2INNE 2KMMA 3H9DA 4A3OA 4BKSA 3R66C 3RZWC 1BUIC 3I9V1 5BMIA 4AJWA 4URKA 2ACZB 2ICIA 3VRAB 1KLUD 2YLMA 1SGHA 5JZEB 3PZ8A 2KDMA 1NBFC 3QX1A 1BT0A 1GNUA 1NENB 1J7BA 3E56A 2JQRB 2MBBB 4S0RA 4ZYSA 1MHHE 2PJHA 3RFZB 4MSMB 3R3MA 2WDTB 1C4CA 2LXCA 1ZXHA 2JZ3B 4N9F4 2BYFA 3N1YC 2OEDA 4M0WA 4M8NA 1UUPA 2CJOA 4PS3A 5JHBA 3WALA 4AUQC 4K7SA 1XLPA 1E8ZA 4GU2A 1RM6C 1T0QC 3H7PB 2Q5WD 2PVOD 2DNFA 1FMAD 1AW7A 4HEA1 2JY6A 2BKFA 1N60A 3EC8A 1WXMA 2IGHA 2R2QA 1N5XA 1R4NI 2ZCBA 4I6PA 2KQ7A 1EU4A 1YJJA 3Q3FA 4C7ZA 3BYYB 1JQ4A 1YJIA 2LUEA 1FFVA 1PYWD 4GDLA 1R4NB 4BVUC 1XLQA 4YL8A 4W9IA 3ZXVA 1V97A 2NTTA 2OJRA 1UBQA 4YT0B 4W9GA 4B9KA 1L6UA 2MEKA 3DBSA 3OJ3A 1E6EB 1UH6A 2HE7A 4FA6A 3MHZA 1WI0A 4MGZE 3DHIC 1GG3A 2HD5B 1YOVB 3PV1A 1WFYA 1ZW7A 4AS1A 1CJEA 2KX3A 4US9A 3W5UB 1IGCA 3U52E 2NBVB 4JPSA 1XLOA 1D5MC 2WP9B 2NS5A 1VR9A 2KANA 4KGRA 5D7GA 2TSSA 2C7HA 1L0YB 2L8JA 2DYBA 1K53A 4A3PA 1KF6B 2KWVB 4KKJA 1E7UA 3PS6A 3RMKC 2FAZA 5LXHA 3CSFA 3U7ZA 2N9LA 3ENEA 1J19A 2KAJA 3BWUD 2BWES 4FN2A 5C2TB 1OEYA 1V49A 4MGIE 2QCZA 2MLBA 1IBXB 1I4QA 1E7VA 2WXOA 4C4VA 4M8MA 3M95A 4RM8A 2ASQA 2AL3A 2OHFA 2ONQA 1QZEA 2D3GA 3N9YC 1FNWA 2XN9C 3OJ4B 4TV3A 2MP2B 1JROA 5LLIA 3JSVA 1T0YA 1V2YA 1WYWB 1VJKA 2DX5B 4YTMB 4XX5A 5CX3A 2M1MA 3EFUA 1JWMD 2KC2A 2AEHA 1XD3B 3DBRB 3NG0A 3L54A 3RCZA 3AV8A 5MPOA 3W1YA 1TGZB 1MVKA 2ZW0A 3B2GA 5TSSA 2W3SA 2JSVX 4FJVB 5BYSA 2GLSA 2RPQA 3C8YA 4KV2A 4KSKC 1HZ5A 3V3XA 1JWUD 4W9DA 2FCMA 5HFYA 1WIAA 2C7MB 5BMGA 3W2DA 3B1LX 3Q3OC 4W9EA 1YN5A 1I4HA 1UWXA 2KMAA 1MFWA 4ANWA 3VVWB 3MC9A 1V1OA 3M62B 1L2NA 1JMLA 4XZ4A 4OVVA 2JVCA 3N3KB 2LRWA 1WH3A 3ZNGC 1N6ZA 2WU2B 3HM3A 2IO3B 2QJLA 2CHWA 2WXRA 1Q1OA 3MJWA 1L4ZB 2BVCA 4TQ0A 4MSQB 1H4RA 3VAWA 4PT5A 4P7IA 1J7AA 4HCPB 3R2TA 3RYTA 1B1ZA 1TIFA 2L52A 3AE8B 2PW9A 4WJQA 2FNJB 1TTNA 1I4PA 3I63C 3VRBB 2K8HA 2MQJA 4W9FA 4DQOC 2DZIA 1ENFA 5BYRA 3KUZA 4M0WB 3X0WA 4RMAA 2MSED 1LM8B 3B0AA 1ZDVA 4NZLB 1Q5WB 3AE4B 1WWTA 4JE3B 4JLCA 1C4AA 1E10A 3LXFA 3SFDB 3LB8C 2DLBA 1YIWA 3HUIA 1EF1A 3RNCC 3AE9B 2BKRB 1YX6B 3ECIA 4LJPB 1TKEA 3AN1A 1K51A 4GDKA 4WWMA 4RF1A 4ZOHC 2J7QB 1L4DB 4WJPA 1ZP0B 2RPVA 3ZNHB 2NBUA 3UINB 5EE1A 2V3SA 4LDTB 4MACA 4GDLB 5JHAA 4GOCA 1E8WA 3VQIA 4YSXB 1YNTE 1FPYA 1KLGD 1FO4A 3DBHI 4HKQA 3P1MA 2L0FA 1FNUA 1DGJA 4A20A 2MHJA 2X8XX 1MPEA 1P1AA 1M94A 3C0RB 1UZXB 4WWNA 5E6JA 2DAFA 4UDUC 3M3JA 1OGWA 4ANXA 2XK5B 2KJRA 3RZFA 4DHJB 1LFDA 2IO1B 2IPKD 4MGKE 2FUHB 1WX7A 5CHFA 2GMIC 1JWBD 3P42A 3BINA 1JCKB 2O6VB 1K52A 1HZ6A 1QOAA 2WXHA 2DZJA 4NJ6A 2BPSA 1XEEA 1JRUA 4BKGA 4AOFA 2DBYA 3Q2AC 4G3XB 2VH2A 2KYWA 1UGMA 3RNFC 2JXXA 4NNJB 2PE9A 2W54A 2KC1A 3KQ4A 3PT2B 4CQNA 2O2VA 4GSWA 4ZRQA 3VR9B 4DWFA 1WR1A 1STEA 2PE6B 3DHGC 2B3AA 3QA8A 5E6PA 4B0EA 3K9OB 2DHZA 1FFUA 2BQQA 3KVFB 1Q0WB 5KHOA 4DXGA 2XNAC 2LASA 3IFWB 4P6VF 5LXIB 2BF8B 1WGHA 2ON8A 3K9PB 4OVZA 5IN7A 4LTUA 2WXLA 4NAWA 5HKHA 4ITKA 4JQWC 1H8CA 1QT9A 1YN3A 3CWIA 3ALBA 1R4MI 4DDID 3IHPC 1E0ZA 1QQRA 1AN8A 2WX1A 1ZGUB 1S1QB 1GAQB 3X23A 4MM3A 4F8CB 2JZZA 1HXYD 1R4MB 4R3DA 2K8CA 1D3ZA 1GC7A 1V1PA 3PPAA 2NTSA 4HXDA 2FE8A 2PKOA 3TEYA 2K5PA 2LJIA 2LJ5A 1C9FA 1NI3A 3NUHB 4L2YA 2WXFA 4IUMB 4IG7B 1JW9D 2MJDA 3PZDA 2KLCA 1WGRA 2JYEA 2W55A 5AZHA 2KVZA 2JUOA 3PGEA 3P2BA 2LXAA 3NVYA 2N7DA 1N61A 3HRDD 1EU3A 5AEKB 4B95A 2C9WB 3NRZA 1ET9A 1TS2A 2BTEA 3TCAA 2BS2B 1MJDA 3IAM1 1YQ4B 2L1AA 3LYYA 3N20C 1ZUD2 3FILB 3RNGC 4GDKB 1WXVA 3VH3B 4A6QA 3PLVA 2NMQA 3OG5A 3AU4A 1IP9A 4EZLA 1V80A 4K7UA 2R61A 3APDA 3L17A 3KH0A 4MT5A 1T0RC 3PZ7A 2WXNA 2Y5CA 3QQ8B 2NCNA 4GLSC 3HK0A 3U7DA 4KDLB 3DVNV 3WAMA 2KFJA 2WXMA 4JIOU 3GS2A 1U4AA 4A55A 1HEZE 3H8HA 1F2RC 3ZDTA 1SB3C 1UNSA 4G11A 1WGGA 3AEBB 3MHSD 3R7RA 2KX0A 1V6EA 4L23A 2I1JA 4FHJA 3RULA 1ACCA 2VZKB 4B0MA 2L32A 4XWWA 2ZCCA 1XF5L 2K0PA 3T3NA 4REZA 1IGDA 4IOIE 1V9JA 3J9CA 1UWMA 2KDEB 4KSLC 1P98A 1WE7A 1HQRD 2INCC 3E9SA 2BW2A 3Q6BA 3WA0A 1KFYB 2G1EA 1E5WA 1L0XB 1PGBA 2WXIA 3AE2B 1WX9A 2NR2A 2FIFA 5LNK1 2M8SA 3CMMB 4J6IA 2ZVOA 2IJ0A 2WGSA 3EUB2 3SHQA 1B9RA 4EZJA 5FR6A 2LMCA 3BVMA 3SD5A 4HROA 2L83A 1WJUA 3AEGB 3DDCB 4W9CA 5D3IB 4DXFA 3CF6E 4K7WA 2MH7A 2KOXA 4NAMA 1WM3A 2V4LA 5DPSA 2Y3AA 1AARA 3NS8A 2I2YA 4YWGG 1NEKB 1FRRA 4XC2A 2JPHA 1AWDA 4BOSC 4WJOA 3T8MA 1IUEA 1R7SA 3TEXA 2RD0A 2FCNA 5AUIA 4AWJA 5FR3A 3VH4B 2NPTA 4NY0A 3NVWA 2D10A 2WHIA 3IT6B 5IP4D 4NAWB 1KRHA 3SFEB 4ZRIA 1WZ0A 3AE5B 1IPGA 2M17A 3TL5A 1TKYA 3ZGZA 4RFBA 1D4BA 5TR5A 3N1ZC 1MI0A 2HJ8A 3M63B 2JWZA 4MM3B 2GBJA 3ZLZA 5G2NA 5J18A 2D3BA 1E8XA 4OHJA 3VTUA 2SAKA 4HPLB 5C3JB 1RFKA 3BK1A 3VUXA 1SEBD 1F9JA 2L0TA 3ML9A 3I57A 3AULA 1XXGA 1D5XC 1E9MA 4I6NB 5H92C 3EHVA 5IKCM 1D6EC 2NBWB 3PREA 1P7FA 2MJEA 2E3TA 3A9KA 4E3CA 5D3DA 2VRRB 3EA6A 3WAOA 4EKUA 1HTOA 2WQYB 3VTWA 2UWQA 3V61A 3ZNID 2KWCA 4OW0A 1C3TA 3BVZA 1C4PA 4LNOA 5G55A 3P4PB 1SE2A 3Q8FA 4ACFA 3A1QA 1NYRA 1L7YA 3BYTB 3EECA 2VH1A 1RRBA 3AB5A 2KACA 4PYZA 4AP4C 2EELA 2DYMA 3UI3A 3RNBC 1DOYA 1XLNA 2OOBB 3Q3JA 4KIKA 1N5WA 5T8IA 3T3OA 3EGRA 2QC8A 4XYCA 4JWUC 3PHWB 3ZRCA 1XQQA 4LNNA 3VXWA 2BGFA 3JVZX 5J17A 1CQVA 1L6VA 2N9KA 4F7ZA 2GBNA 1QOBA 5BYQA 1DYQA 1SE9A 3PRPB 2AWTA 2ZW1A 3P4QB 1EO6A 2Z59B 4GN1A 1SSNA 2ZNVC 1XT9B 4G50A 2IY0B 2KNBA 2L76A 2UYZB 2G4SA 4IC7B 3TJPA 5D6JB 4DDGD 4S17A 4C80A 3DQVA 4TSSA 2RMMA 5HG2A 1VLBA 2N7EA 2QIEB 2N4FA 1UF0A 3IAS1 3L4PA 3ZUNA 4BFRA 1V5TA 1YX5B 1QOFA 4KGTA 3GP7A 1ET6A 2E6XA 3HVDA 4GGQA 4HVBA 4K1RB 1WM2A 2KQSA 3L08A 3NOBA 4MJSA 4GMVA 1SBBB 4PS8A 2ZEQA 3RUIB 4A9AA 3URYA 3Q14C 1LO5D 3V60A 1KTKA 2IO2B 5EE9A 4E71A 1TZ1A 4EZKA 1YN4A 3ZW3A 2QILA 3AH7A 3L10B 3KYCD 4IWQA 4LLGM 4HJKA 5C1ZA 4JGHB 1TY0A 2INDC 1I4GA 4DK5A 5J2RA 2PMVA 2MWSB 1OTRB 4CO7A 4HDQA 1SE4A 4W9KA 3MC8A 4G0NB 4W9HA 3H6NA 2FBWB 2KTRA 2GI9A 1NI2A 2JXTA 4RNAA 4RH6A 1I4RA 2KQ4X 4MGYE 4RCOA 3DBHB 2A4ZA 3DVGY 4DHZB 2WXKA 1QLBB 3DVNU 2H88B 1VDVA 3I5JC 3N30A 1UBIA 4C7YA 3Q8AA 2MW5A 4M01A 1GPXA 3ZJVA 3QJZA 3D32A 3UIOB 1YD8U 4MEMA 1HE8A 4HWIB 3TEZA 2V3PA 4WH4A 3FC4A 3LJ3A 1FM0D 4KDIC 4HDOA 4LDTD 2IY1B 4MH0E 3PHXB 3NVVA 3A9KB 1RLFA 2PTLA 2XBBC 4PK1A 1S3SG 1XCTL 4MDKE 1LQBA 2WDVB 3SEBA 4WJNA 2FIDA 4C4VB 2CHZA 2CHXA 4IW0A 1HTQA 3AU5A 4Q2JA 1N62A 1PQSA 2BB6A 4ZHPA 4JWSC 3DOWA 4WAFA 2C60A 4CHKA 1WF9A 2LRUA 1QILA 3JSVB 1IYFA 3ZTCA 2DAJA 1JWSD 4CYEA 1Y8RC 2WS3B 4ANVA 3A1QB 5G5GA 3CIRB 4DHJD 3Q8CA 4KZCA 3AEDB 1DOXA 2W9NA 4OZAA 3H7PA 3DBLI 3PO0A 3JYUA 2MBOA 3AXCA 4ARIA 1GB4A 4LJOB 5BMHA 2BB5A 2O6VD 3RN9C 1OQQA 2LGIA 1WR6E 1EWCA 4C56C 3VHTC 5JH5C 3DBLB 2ZVNA 2KO3A 4HCNB 5AZFA 4KZ0A 1WY8A 2N9PC 4XGAB 3HIZA 4FJZA 3RNEC 2N7JA 1TKGA 2WWZA 1WX8A 2YEPB 5HHDG 1F0ZA 4IM2A 2KWUB 4OZBA 4OVUA 1ISNA 2JZPA 4WQMA 4N58A 3TEWA 4IWPA 3WCQA 4O1NA 1G6JA 2LVOA 3R2IA 1CZPA 2KDFB 5L95C 2C7NB 1UD7A 3ZIMA 1WJ4A 2M4NA 2NVUI 4HKZE 3V6CB 1TZOA 3RD2A 3VTVA 1WE6A 4EFOA 1WGYA 1Y56A 1F1HA 2KTFA 2C5LC 2L7RA 2KDBA 2J0JA 3HM6X 5IO9A 3ZRFA 1GOZA 4N59A 4BKTA 3ZKJC 3VUYA 5IAAC 1FXIA 5CTRC 3NHEB 2WDQB 3KW5B 3SR6A 2KK8A 4KKIA 2M0AA 4HPPA 4FULA 1WJNA 3R7QA 4IM3A 1WGKA 3W5VB 3AE6B 2KD0A 1IBXA 3BZDB 3L0WB 4P16A 3NZ3A 5FKAC 4OZCA 1HA5A 4TQ1A 1YMHE 3ABVB 1PUTA 1EM7A 2L05A 2HDEA 2MP2A 3NZUA 4B6WA 2V3NA 2BWFA 1T6BX 4L1BA 2J4XA 1SIFA 2RDGA 2MJ3A 2SEBD 3GOEA 3AMZA 4X57B 3ZO5B 5L83A 2QSDA 4US8A 3AEFB 3T9LA 1QF6A 5C23A 3V05A 5EDSA 1KJTA 1L5PA 4TKNA 3W1SC 2OJWA 3HHMA 1BXTA 1FRDA 1VZ8A 2JWUA 2XEWA 2N0SB 2IO0B 1GJZA 3BIID 1F52A 1ZKHA 2Z8LA 3S2AA 1A70A 3DWGC 1XCQL 4FHKA 4ZRKA 1AYFA 2H89B 3Q8EA 3VFKA 3VUWA 1SE3A 3KWLA 3RPFC 3ZYYX 3QARA 2BS3B 2KWDA 1I4XA 3PVLA 2K8BA 3KWVA 2LGDA 4WIPA 1F2RI 3AEAB 1I35A 3AEEB 1VZ6A 4M00A 3KYDD 1ROEA 4H2AA 4IWOA 2LEKA 2KXJA 4E74A 2D11A 3Q3NC 3GB1A 3PSEB 4DHZE 4EUTA 4WAAA 2RGFA 3VR8B 3Q8BA 1P0RA 1GB1A 1K8RB 1TS5A 3B08A 2O2VB 1V8CA 1TT5B 3P63A 1WZ3A 1JALA 3ZDMC 2G4DB 5I4DA 4PYUA 4A8XC 5KHQA 3QCAA 2AYOB 5EE0A 1FD6A 2AQ1B 1P3QU 4TMAB 4YTNB 2DZKA 4ARCA 3APFA 3NJTA 2IZVB 1SIJA 4XDDA 4EE2A 2KZRA 3V62A 5IA7A 3H1UA 3FAHA 4IM0A 4JL9A 2RSUA 5DCNA 2LI5A 2V0GA 4EOYA 2VZKD 2CJNA 3A9JA 4J3OD 1I42A 2AX5A 1I7HA 4RGTA 4FLHA 1TYGB 2K39A 2HTME 2QMTA 2K22A 1YQBA 4YSYB 2ZZPB 1FIQA 1C1YB 2R2OA 1PGAA 3OWEB 1OEYJ 3MP9A 1JWAD 4LNFA 3V6EB 3OAWA 3QAQA 3UF8A 3DWMA 1FNVA 1LXDA 3JW0X 2KN5A 1MG4A 3C19A 3B2FA 1V1PB 5DPRA 4ASWC 2KHWB 5FK9C 1SXTA 5AUKA 1WMHA 2WXQA 3ZQ4A 1JRPA 2DYOA 2XK5A 1TY2A 4RGNA 3QIJA 1WXSA 3KUDB 1P9DU 3Q69A 1DOIA 2WNMA 2MA9B 2KKCA 1RWSA 1UGJA 2BYVE 3R8BA 2IGDA 2G9HD 4W9JA 2B76B 3NY5A 2MRPA 1VZ7A 2QEJC 2WYQA 2O6VA 2JRIB 3AI5A 4ICVA 5E6OA 3W9CB 4BAXA 2K6DB 1N63A 2LHDA 3PLUA 1ESFA 2BS4B 1GUAB 4GIVA 4DXAB 3GE3C 1MG8A 1TJEA 4HRSA 1C77A 1E90A 2K1FA 2J52A 4NJCA 1RFAA 2FCSA 1EUVB 4XDCA 5D2MB 4MELA 1ZPSA 3DBRI 1J8CA 1Z2MA 4HK2A 2ZPYA 3DHHC 3PRZA 1K50A 1ZXIA 1VD2A 3L16A 1ZOYB 4K3CA 2PIAA 2Z0DB 4ZHOA 4M02A 3WAPA 3MJ5A 1Z5SB 1ZDXA 1E7PB 1TS4A 1VCBA 2CU1A 2LD9A 2GB1A 2L00B 3L13A 4WQOB 2Y5PA 3QHTA 2KLGA 2WLBA 2V9HA 2KJ6A 2X38A 1WSPA 3NVZA 2JRHA 2I38A 1OFFA 3P4RB 3TBLD 4IKGA 1PGXA 3MTNB 1QOGA 1WXAA 3PRMB 3VDZA 1WRDB 3ZVVA 4WWOA 3NZSA 2W82A 3IVFA 4YXDB 5GMVA 3UGBB 1TBEA 3UIPB 1M4VA 3SDLC 2L3ZA 2M56B 2EKEC 1QKZA 2D07B 2EKIA 2RDBC 2KDIA 2HJ1A 4HLEA 3KUCB 2JX5A 3CSTA 3RT3B 4GXBA 2MBEA 4I6LB 3ZJUA 1BMLC 2WXGA 4D2KA 4K3BA 2CS4A 2RDHA 2IDYA 4FADA 1LGRA 2G3QB 1EWYC 1RAXA 1FCLA 2AQ3B 2ZNVB 4RGOS 3ML8A 4LNKA 1L0VB 4BKSD 3IT4B 3O65B 2LHEA 4MH8A 2JT4B 3RNAC 2LVQA 2AL6A 2Y5BB 4II2B 2G45B 2N1VA 2QHOA 4XWTA 3WANA 2LFIA 3A9JB 3ZXRA 1FCCC 3OLMD 1UELA 5IOIA 4K81A 2INPE 2NPTB 2WXPA 3QK0A 2BYTA 2WDRB 3TIXA 4AQ7A 2K9XA 3N32A 3FILA 2K25A 2J53A 2AQ2B 4P1BC 5D94A 2KFKA 4FXCA 2LGYA 4W9LA 3PTFC 4LNIA 5DPWA 2YVCA 5G5HA 3ZJTA 3DVGX 2M0XA 2DENB 4C00A 2LZ6A 1YJ1A 4PS7A 1NYQA 2Z0EB
chains in the Genus database with same CATH topology
3SD5A 3W1YA 1TGZB 3VTVA 1WE6A 1WJUA 3DDCB 4W9CA 4NPNA 4EFOA 3CF6E 4K7WA 1WGYA 2KOXA 4FJVB 2KTFA 3I3TB 4TUUA 2C5LC 2L7RA 2KDBA 2J0JA 2RPQA 3HM6X 2I1KA 3IBEA 2D2QA 4KSKC 1WMHB 3A4RA 1WM3A 4KV2A 4BOZB 2V4LA 5DPSA 4F1SA 1AARA 3NS8A 4BKTA 4W9DA 2FCMA 1V5OA 4GB9A 3ZKJC 1WIAA 2GBRA 2C7MB 4XC2A 3VUYA 5IAAC 2JPHA 5CTRC 3NHEB 2RR9A 3KW5B 4BOSC 3B1LX 4WJOA 2HTHA 3TMPB 3T8MA 3ZTDA 2KK8A 5DPTA 3W1SA 4W9EA 4FULA 1WJNA 4WWPA 2MCNB 2KMAA 2RD0A 4ANWA 3VVWB 2FCNA 4AWJA 3M62B 1L2NA 3R7QA 4IM3A 3VH4B 2NPTA 1FXTB 2KD0A 2J0KA 4XZ4A 2PEAA 4NY0A 4OVVA 2JVCA 2D10A 3N3KB 2LRWA 3L0WB 5CHVC 1WH3A 3ZNGC 4NAWB 4AJYB 2KVRA 2GOWA 3APCA 3HM3A 4TQ1A 2PPHA 2MX2A 2IO3B 4ZRIA 2CHWA 1WZ0A 4HPMB 1Q1OA 1IPGA 3MJWA 2M17A 3TL5A 2L05A 2KMCA 2MP2A 3NZUA 4B6WA 4TQ0A 4MSQB 1X1MA 2BWFA 1H4RA 5TR5A 4ZYNA 3VAWA 4P7IA 4HCPB 3RYTA 3WIMA 2HJ8A 4WJQA 1SIFA 3M63B 2JWZA 1OQYA 2LGXA 3GOEA 2N9XA 2FNJB 2GBJA 2IYDB 1TTNA 4X57B 3ZLZA 3ZO5B 5L83A 5G2NA 1KOTA 5J18A 2K8HA 2MQJA 4W9FA 5E6NA 1E8XA 3T9LA 1A5RA 2DZIA 3VTUA 5C23A 3KUZA 4HPLB 4M0WB 5EDSA 1KJTA 2EMTA 4ZRJA 3X0WA 5CHWA 4RMAA 4TKNA 2MSED 3W1SC 2WX0A 1LM8B 3HHMA 3B0AA 3GZNI 3VUXA 1Q5WB 1F9JA 4KIKB 2L0TA 3ML9A 4JLCA 2XEWA 2IO0B 1GJZA 1ZKHA 4EEWA 3AULA 4NQKE 3S2AA 4ANUA 4FHKA 4I6NB 4ZRKA 3ZRFA 2A5UA 3EHVA 1YIWA 3VFKA 1EF1A 3VUWA 2BKRB 4DBGA 2NBWB 1YX6B 3QARA 2KJHB 3PREA 3ECIA 3PVLA 2K8BA 2LGDA 3DCGA 3A9KA 4LJPB 2J0MA 4E3CA 1I35A 1EF5A 2LVPA 3ONSA 3KYDD 2MBHA 2VRRB 2GBKA 4GDKA 3WAOA 4IWOA 2J7QB 2KXJA 4EKUA 4WJPA 4E74A 2V1YA 4BBNC 1J0GA 2N1WA 2D11A 3ZNHB 3SU8X 2NBUA 3UINB 3PSEB 2V3SA 2REXA 4LDTB 3RCZA 4DHZE 4GDLB 4EUTA 4WAAA 2RGFA 3VTWA 5JHAA 2UWQA 4GOCA 1E8WA 3VQIA 3V61A 3ZNID 1P0RA 2KWCA 5AZGA 1C3TA 2JF5A 3QWZB 2CKHB 5G55A 4ZDVA 3DBHI 1K8RB 3B08A 2L0FA 2O2VB 3A1QA 4A20A 3U30A 1WZ3A 1L7YA 3BY4B 2G4DB 3ZDMC 1P1AA 1M94A 3C0RB 4ICUA 4PYUA 3EECA 1UZXB 5KHQA 4WWNA 1RRBA 2AYOB 3QCAA 4PYZA 4KVGB 4II3B 4AP4C 2DYMA 1P3QU 2CR5A 2DZKA 2DAFA 3ZNZB 3M3JA 4FJYA 3APFA 1OGWA 3UQAA 2IZVB 4ANXA 2XK5B 2OOBB 3Q3JA 4KIKA 1KM7A 2KJRA 2KZRA 3V62A 3RZFA 5IA7A 3H1UA 2EMSA 4DHJB 4IM0A 4JL9A 2RSUA 1CMXB 5DCNA 2LI5A 1LFDA 2IO1B 2BYEA 4MGKE 2FUHB 3H7SA 3PHWB 4EOYA 3A4SC 1WGDA 3U8ZA 3ZRCA 3A9JA 1XQQA 4NJ7A 1NDDA 1I42A 4BBNF 1WX7A 2LWPA 3VXWA 1V86A 2BGFA 3JVZX 5CHFA 5BO4B 1WJ6A 4FLHA 4MJSB 2GMIC 2K39A 3LDZE 4RM9A 2DZMA 5J17A 3UQBA 3BINA 2O6VB 4F7ZA 2N9EB 2GBNA 1SE9A 3PRPB 2AWTA 2DZJA 1YQBA 4NJ6A 2BPSA 1EO6A 2Z59B 4GN1A 2ZZPB 1JRUA 4LCDE 2ZPNA 4BKGA 2ZNVC 1XT9B 4G50A 4AOFA 4FBJB 1C1YB 2IY0B 2KNBA 2IBIB 4G3XB 4NQLB 2L76A 2R2OA 2UYZB 2G4SA 1UGMA 3DPDA 1OEYJ 2JXXA 3IG3A 4NNJB 2PE9A 2K6QA 3V6EB 3OAWA 3QAQA 3UF8A 4IC7B 3TJPA 2KC1A 1LXDA 3JW0X 5D6JB 3PT2B 4DDGD 2KTRB 2O2VA 2KN5A 4GSWA 2KFKB 3DQVA 3A33B 1GC6A 5DPRA 4DWFA 1WR1A 4ASWC 2KHWB 2PE6B 2N7EA 2B3AA 1WMHA 1E8YA 3QA8A 2N4FA 5E6PA 2GBMA 2DYOA 2XK5A 2FCQA 3K9OB 2DHZA 3QC8B 3QIJA 1WXSA 3KUDB 1P9DU 2MBQA 3KVFB 3ZUNA 4BFRA 1KLVA 1V5TA 1YX5B 2ZJDA 1V81A 1Q0WB 5KHOA 2MA9B 2KKCA 3H9DA 4A3OA 4BKSA 2BYVE 2LASA 3IFWB 3R66C 4GGQA 4K1RB 1WM2A 3RZWC 4HVBA 2KQSA 4AJWA 4URKA 3L08A 3NOBA 4W9JA 4MJSA 5LXIB 3NY5A 4GMVA 2BF8B 2MRPA 2YLMA 1WGHA 2ZEQA 2WYQA 4PS8A 3RUIB 1SGHA 2O6VA 2JRIB 5JZEB 3AI5A 4ICVA 3K9PB 5E6OA 3V60A 4E71A 2IO2B 1NBFC 2K6DB 3QX1A 1TZ1A 4NAWA 5HKHA 3PLUA 4EZKA 3ZW3A 1BT0A 1GNUA 3L10B 1GUAB 4JQWC 3KYCD 4GIVA 4IWQA 4DXAB 1H8CA 1MG8A 4HJKA 5C1ZA 3ALBA 4JGHB 1R4MI 4DK5A 5J2RA 1E90A 2MBBB 4DDID 3IHPC 2MWSB 1OTRB 4CO7A 2K1FA 2WX1A 2PJHA 1ZGUB 1S1QB 4HDQA 4MSMB 3R3MA 1RFAA 2FCSA 1EUVB 5D2MB 4W9KA 4MELA 4MM3A 3X23A 4F8CB 2WDTB 2JZZA 3H6NA 4G0NB 4W9HA 2KTRA 1NI2A 2LXCA 3DBRI 1J8CA 2JZ3B 2K8CA 4N9F4 1Z2MA 1D3ZA 1GC7A 4HK2A 2BYFA 2ZPYA 4MGYE 3PRZA 4M8NA 1VD2A 3PPAA 3L16A 4PS3A 5JHBA 3WALA 2A4ZA 4HXDA 3DVGY 4DHZB 2Z0DB 4AUQC 3DVNU 4K7SA 3WAPA 1E8ZA 4GU2A 3N30A 1UBIA 1Z5SB 3H7PB 2LJ5A 2MW5A 1VCBA 2CU1A 3QJZA 2LD9A 3D32A 4IG7B 4IUMB 2JY6A 3UIOB 2BKFA 2L00B 3PZDA 3L13A 4WQOB 3EC8A 1YD8U 1WXMA 2KLGA 3QHTA 4MEMA 2R2QA 2KJ6A 2KLCA 1HE8A 4HWIB 1R4NI 1WGRA 2ZCBA 2JRHA 5AZHA 2JUOA 2KQ7A 4I6PA 3PGEA 3TBLD 3P2BA 2LXAA 3Q3FA 2N7DA 3LJ3A 3MTNB 4KDIC 1WXAA 4HDOA 5AEKB 3PRMB 4LDTD 4B95A 2IY1B 3VDZA 4MH0E 1WRDB 2C9WB 2LUEA 3PHXB 3ZVVA 4GDLA 4WWOA 3A9KB 3TCAA 4BVUC 3NZSA 4YL8A 3IVFA 4W9IA 1RLFA 2XBBC 5GMVA 3UGBB 1S3SG 1TBEA 3UIPB 4MDKE 1LQBA 2OJRA 3SDLC 2L3ZA 4WJNA 1UBQA 2EKEC 4GDKB 2D07B 2FIDA 4W9GA 4B9KA 2CHZA 2KDIA 1WXVA 3VH3B 2CHXA 3DBSA 3OJ3A 3PLVA 1UH6A 2HE7A 4IW0A 4FA6A 3AU5A 3KUCB 3AU4A 4HLEA 1PQSA 1IP9A 3CSTA 1WI0A 4MGZE 3DOWA 3RT3B 4EZLA 1V80A 4K7UA 4GXBA 2MBEA 4I6LB 1GG3A 2C60A 3APDA 4CHKA 1WF9A 3L17A 2LRUA 3KH0A 5FR6A 2HD5B 3JSVB 3PV1A 1WFYA 1IYFA 1ZW7A 2CS4A 3ZTCA 2DAJA 4CYEA 1Y8RC 2KX3A 3QQ8B 4FADA 2NCNA 4ANVA 2NBVB 3HK0A 3A1QB 2G3QB 1RAXA 4DHJD 2NS5A 4KZCA 3U7DA 2KANA 4KDLB 2ZNVB 2W9NA 3DVNV 5D7GA 3WAMA 3ML8A 4BKSD 2C7HA 3H7PA 2KFJA 3O65B 4JIOU 2L8JA 3DBLI 2DYBA 3JYUA 4A3PA 1U4AA 2JT4B 2MBOA 3AXCA 4LJOB 3ZDTA 2KWVB 2LVQA 2AL6A 2O6VD 2Y5BB 4II2B 1E7UA 1WGGA 1WR6E 2G45B 3MHSD 4G11A 3PS6A 2N1VA 2FAZA 3R7RA 2KX0A 2QHOA 3VHTC 5JH5C 5LXHA 2ZVNA 3CSFA 2KO3A 4HCNB 1V6EA 5AZFA 4KZ0A 1WY8A 3WANA 2I1JA 2N9PC 4FHJA 3A9JB 3OLMD 3HIZA 3ENEA 4FJZA 1J19A 1UELA 3RULA 4K81A 2BWES 2WWZA 1WX8A 2NPTB 4FN2A 2ZCCA 1OEYA 3QK0A 4IM2A 1V49A 4MGIE 2MLBA 2KWUB 1E7VA 4OVUA 1V9JA 3TIXA 1ISNA 3N32A 2KDEB 4KSLC 1P98A 4M8MA 2K25A 1WE7A 3M95A 4RM8A 2ASQA 2AL3A 4IWPA 1G6JA 2LVOA 1QZEA 2D3GA 5D94A 3WA0A 2KFKA 2LGYA 3OJ4B 1E5WA 4W9LA 4TV3A 2MP2B 1WX9A 3PTFC 5DPWA 2KDFB 5LLIA 5L95C 2NR2A 2FIFA 2YVCA 2M8SA 3CMMB 3JSVA 1T0YA 3DVGX 1V2YA 1WYWB 2C7NB 1UD7A 4J6IA 2M0XA 2DENB 2DX5B 2LZ6A 2ZVOA 3ZIMA 4XX5A 1WJ4A 1YJ1A 2M4NA 2NVUI 2M1MA 3EFUA 5CX3A 3SHQA 3V6CB 2KC2A 2AEHA 4PS7A 1XD3B 4EZJA 2Z0EB 3RD2A 3L54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SD5 A;  3W1Y A;  1TGZ B;  3VTV A;  1WE6 A;  1WJU A;  3DDC B;  4W9C A;  4NPN A;  4EFO A;  3CF6 E;  4K7W A;  1WGY A;  2KOX A;  4FJV B;  2KTF A;  3I3T B;  4TUU A;  2C5L C;  2L7R A;  2KDB A;  2J0J A;  2RPQ A;  3HM6 X;  2I1K A;  3IBE A;  2D2Q A;  4KSK C;  1WMH B;  3A4R A;  1WM3 A;  4KV2 A;  4BOZ B;  2V4L A;  5DPS A;  4F1S A;  1AAR A;  3NS8 A;  4BKT A;  4W9D A;  2FCM A;  1V5O A;  4GB9 A;  3ZKJ C;  1WIA A;  2GBR A;  2C7M B;  4XC2 A;  3VUY A;  5IAA C;  2JPH A;  5CTR C;  3NHE B;  2RR9 A;  3KW5 B;  4BOS C;  3B1L X;  4WJO A;  2HTH A;  3TMP B;  3T8M A;  3ZTD A;  2KK8 A;  5DPT A;  3W1S A;  4W9E A;  4FUL A;  1WJN A;  4WWP A;  2MCN B;  2KMA A;  2RD0 A;  4ANW A;  3VVW B;  2FCN A;  4AWJ A;  3M62 B;  1L2N A;  3R7Q A;  4IM3 A;  3VH4 B;  2NPT A;  1FXT B;  2KD0 A;  2J0K A;  4XZ4 A;  2PEA A;  4NY0 A;  4OVV A;  2JVC A;  2D10 A;  3N3K B;  2LRW A;  3L0W B;  5CHV C;  1WH3 A;  3ZNG C;  4NAW B;  4AJY B;  2KVR A;  2GOW A;  3APC A;  3HM3 A;  4TQ1 A;  2PPH A;  2MX2 A;  2IO3 B;  4ZRI A;  2CHW A;  1WZ0 A;  4HPM B;  1Q1O A;  1IPG A;  3MJW A;  2M17 A;  3TL5 A;  2L05 A;  2KMC A;  2MP2 A;  3NZU A;  4B6W A;  4TQ0 A;  4MSQ B;  1X1M A;  2BWF A;  1H4R A;  5TR5 A;  4ZYN A;  3VAW A;  4P7I A;  4HCP B;  3RYT A;  3WIM A;  2HJ8 A;  4WJQ A;  1SIF A;  3M63 B;  2JWZ A;  1OQY A;  2LGX A;  3GOE A;  2N9X A;  2FNJ B;  2GBJ A;  2IYD B;  1TTN A;  4X57 B;  3ZLZ A;  3ZO5 B;  5L83 A;  5G2N A;  1KOT A;  5J18 A;  2K8H A;  2MQJ A;  4W9F A;  5E6N A;  1E8X A;  3T9L A;  1A5R A;  2DZI A;  3VTU A;  5C23 A;  3KUZ A;  4HPL B;  4M0W B;  5EDS A;  1KJT A;  2EMT A;  4ZRJ A;  3X0W A;  5CHW A;  4RMA A;  4TKN A;  2MSE D;  3W1S C;  2WX0 A;  1LM8 B;  3HHM A;  3B0A A;  3GZN I;  3VUX A;  1Q5W B;  1F9J A;  4KIK B;  2L0T A;  3ML9 A;  4JLC A;  2XEW A;  2IO0 B;  1GJZ A;  1ZKH A;  4EEW A;  3AUL A;  4NQK E;  3S2A A;  4ANU A;  4FHK A;  4I6N B;  4ZRK A;  3ZRF A;  2A5U A;  3EHV A;  1YIW A;  3VFK A;  1EF1 A;  3VUW A;  2BKR B;  4DBG A;  2NBW B;  1YX6 B;  3QAR A;  2KJH B;  3PRE A;  3ECI A;  3PVL A;  2K8B A;  2LGD A;  3DCG A;  3A9K A;  4LJP B;  2J0M A;  4E3C A;  1I35 A;  1EF5 A;  2LVP A;  3ONS A;  3KYD D;  2MBH A;  2VRR B;  2GBK A;  4GDK A;  3WAO A;  4IWO A;  2J7Q B;  2KXJ A;  4EKU A;  4WJP A;  4E74 A;  2V1Y A;  4BBN C;  1J0G A;  2N1W A;  2D11 A;  3ZNH B;  3SU8 X;  2NBU A;  3UIN B;  3PSE B;  2V3S A;  2REX A;  4LDT B;  3RCZ A;  4DHZ E;  4GDL B;  4EUT A;  4WAA A;  2RGF A;  3VTW A;  5JHA A;  2UWQ A;  4GOC A;  1E8W A;  3VQI A;  3V61 A;  3ZNI D;  1P0R A;  2KWC A;  5AZG A;  1C3T A;  2JF5 A;  3QWZ B;  2CKH B;  5G55 A;  4ZDV A;  3DBH I;  1K8R B;  3B08 A;  2L0F A;  2O2V B;  3A1Q A;  4A20 A;  3U30 A;  1WZ3 A;  1L7Y A;  3BY4 B;  2G4D B;  3ZDM C;  1P1A A;  1M94 A;  3C0R B;  4ICU A;  4PYU A;  3EEC A;  1UZX B;  5KHQ A;  4WWN A;  1RRB A;  2AYO B;  3QCA A;  4PYZ A;  4KVG B;  4II3 B;  4AP4 C;  2DYM A;  1P3Q U;  2CR5 A;  2DZK A;  2DAF A;  3ZNZ B;  3M3J A;  4FJY A;  3APF A;  1OGW A;  3UQA A;  2IZV B;  4ANX A;  2XK5 B;  2OOB B;  3Q3J A;  4KIK A;  1KM7 A;  2KJR A;  2KZR A;  3V62 A;  3RZF A;  5IA7 A;  3H1U A;  2EMS A;  4DHJ B;  4IM0 A;  4JL9 A;  2RSU A;  1CMX B;  5DCN A;  2LI5 A;  1LFD A;  2IO1 B;  2BYE A;  4MGK E;  2FUH B;  3H7S A;  3PHW B;  4EOY A;  3A4S C;  1WGD A;  3U8Z A;  3ZRC A;  3A9J A;  1XQQ A;  4NJ7 A;  1NDD A;  1I42 A;  4BBN F;  1WX7 A;  2LWP A;  3VXW A;  1V86 A;  2BGF A;  3JVZ X;  5CHF A;  5BO4 B;  1WJ6 A;  4FLH A;  4MJS B;  2GMI C;  2K39 A;  3LDZ E;  4RM9 A;  2DZM A;  5J17 A;  3UQB A;  3BIN A;  2O6V B;  4F7Z A;  2N9E B;  2GBN A;  1SE9 A;  3PRP B;  2AWT A;  2DZJ A;  1YQB A;  4NJ6 A;  2BPS A;  1EO6 A;  2Z59 B;  4GN1 A;  2ZZP B;  1JRU A;  4LCD E;  2ZPN A;  4BKG A;  2ZNV C;  1XT9 B;  4G50 A;  4AOF A;  4FBJ B;  1C1Y B;  2IY0 B;  2KNB A;  2IBI B;  4G3X B;  4NQL B;  2L76 A;  2R2O A;  2UYZ B;  2G4S A;  1UGM A;  3DPD A;  1OEY J;  2JXX A;  3IG3 A;  4NNJ B;  2PE9 A;  2K6Q A;  3V6E B;  3OAW A;  3QAQ A;  3UF8 A;  4IC7 B;  3TJP A;  2KC1 A;  1LXD A;  3JW0 X;  5D6J B;  3PT2 B;  4DDG D;  2KTR B;  2O2V A;  2KN5 A;  4GSW A;  2KFK B;  3DQV A;  3A33 B;  1GC6 A;  5DPR A;  4DWF A;  1WR1 A;  4ASW C;  2KHW B;  2PE6 B;  2N7E A;  2B3A A;  1WMH A;  1E8Y A;  3QA8 A;  2N4F A;  5E6P A;  2GBM A;  2DYO A;  2XK5 A;  2FCQ A;  3K9O B;  2DHZ A;  3QC8 B;  3QIJ A;  1WXS A;  3KUD B;  1P9D U;  2MBQ A;  3KVF B;  3ZUN A;  4BFR A;  1KLV A;  1V5T A;  1YX5 B;  2ZJD A;  1V81 A;  1Q0W B;  5KHO A;  2MA9 B;  2KKC A;  3H9D A;  4A3O A;  4BKS A;  2BYV E;  2LAS A;  3IFW B;  3R66 C;  4GGQ A;  4K1R B;  1WM2 A;  3RZW C;  4HVB A;  2KQS A;  4AJW A;  4URK A;  3L08 A;  3NOB A;  4W9J A;  4MJS A;  5LXI B;  3NY5 A;  4GMV A;  2BF8 B;  2MRP A;  2YLM A;  1WGH A;  2ZEQ A;  2WYQ A;  4PS8 A;  3RUI B;  1SGH A;  2O6V A;  2JRI B;  5JZE B;  3AI5 A;  4ICV A;  3K9P B;  5E6O A;  3V60 A;  4E71 A;  2IO2 B;  1NBF C;  2K6D B;  3QX1 A;  1TZ1 A;  4NAW A;  5HKH A;  3PLU A;  4EZK A;  3ZW3 A;  1BT0 A;  1GNU A;  3L10 B;  1GUA B;  4JQW C;  3KYC D;  4GIV A;  4IWQ A;  4DXA B;  1H8C A;  1MG8 A;  4HJK A;  5C1Z A;  3ALB A;  4JGH B;  1R4M I;  4DK5 A;  5J2R A;  1E90 A;  2MBB B;  4DDI D;  3IHP C;  2MWS B;  1OTR B;  4CO7 A;  2K1F A;  2WX1 A;  2PJH A;  1ZGU B;  1S1Q B;  4HDQ A;  4MSM B;  3R3M A;  1RFA A;  2FCS A;  1EUV B;  5D2M B;  4W9K A;  4MEL A;  4MM3 A;  3X23 A;  4F8C B;  2WDT B;  2JZZ A;  3H6N A;  4G0N B;  4W9H A;  2KTR A;  1NI2 A;  2LXC A;  3DBR I;  1J8C A;  2JZ3 B;  2K8C A;  4N9F 4;  1Z2M A;  1D3Z A;  1GC7 A;  4HK2 A;  2BYF A;  2ZPY A;  4MGY E;  3PRZ A;  4M8N A;  1VD2 A;  3PPA A;  3L16 A;  4PS3 A;  5JHB A;  3WAL A;  2A4Z A;  4HXD A;  3DVG Y;  4DHZ B;  2Z0D B;  4AUQ C;  3DVN U;  4K7S A;  3WAP A;  1E8Z A;  4GU2 A;  3N30 A;  1UBI A;  1Z5S B;  3H7P B;  2LJ5 A;  2MW5 A;  1VCB A;  2CU1 A;  3QJZ A;  2LD9 A;  3D32 A;  4IG7 B;  4IUM B;  2JY6 A;  3UIO B;  2BKF A;  2L00 B;  3PZD A;  3L13 A;  4WQO B;  3EC8 A;  1YD8 U;  1WXM A;  2KLG A;  3QHT A;  4MEM A;  2R2Q A;  2KJ6 A;  2KLC A;  1HE8 A;  4HWI B;  1R4N I;  1WGR A;  2ZCB A;  2JRH A;  5AZH A;  2JUO A;  2KQ7 A;  4I6P A;  3PGE A;  3TBL D;  3P2B A;  2LXA A;  3Q3F A;  2N7D A;  3LJ3 A;  3MTN B;  4KDI C;  1WXA A;  4HDO A;  5AEK B;  3PRM B;  4LDT D;  4B95 A;  2IY1 B;  3VDZ A;  4MH0 E;  1WRD B;  2C9W B;  2LUE A;  3PHX B;  3ZVV A;  4GDL A;  4WWO A;  3A9K B;  3TCA A;  4BVU C;  3NZS A;  4YL8 A;  3IVF A;  4W9I A;  1RLF A;  2XBB C;  5GMV A;  3UGB B;  1S3S G;  1TBE A;  3UIP B;  4MDK E;  1LQB A;  2OJR A;  3SDL C;  2L3Z A;  4WJN A;  1UBQ A;  2EKE C;  4GDK B;  2D07 B;  2FID A;  4W9G A;  4B9K A;  2CHZ A;  2KDI A;  1WXV A;  3VH3 B;  2CHX A;  3DBS A;  3OJ3 A;  3PLV A;  1UH6 A;  2HE7 A;  4IW0 A;  4FA6 A;  3AU5 A;  3KUC B;  3AU4 A;  4HLE A;  1PQS A;  1IP9 A;  3CST A;  1WI0 A;  4MGZ E;  3DOW A;  3RT3 B;  4EZL A;  1V80 A;  4K7U A;  4GXB A;  2MBE A;  4I6L B;  1GG3 A;  2C60 A;  3APD A;  4CHK A;  1WF9 A;  3L17 A;  2LRU A;  3KH0 A;  5FR6 A;  2HD5 B;  3JSV B;  3PV1 A;  1WFY A;  1IYF A;  1ZW7 A;  2CS4 A;  3ZTC A;  2DAJ A;  4CYE A;  1Y8R C;  2KX3 A;  3QQ8 B;  4FAD A;  2NCN A;  4ANV A;  2NBV B;  3HK0 A;  3A1Q B;  2G3Q B;  1RAX A;  4DHJ D;  2NS5 A;  4KZC A;  3U7D A;  2KAN A;  4KDL B;  2ZNV B;  2W9N A;  3DVN V;  5D7G A;  3WAM A;  3ML8 A;  4BKS D;  2C7H A;  3H7P A;  2KFJ A;  3O65 B;  4JIO U;  2L8J A;  3DBL I;  2DYB A;  3JYU A;  4A3P A;  1U4A A;  2JT4 B;  2MBO A;  3AXC A;  4LJO B;  3ZDT A;  2KWV B;  2LVQ A;  2AL6 A;  2O6V D;  2Y5B B;  4II2 B;  1E7U A;  1WGG A;  1WR6 E;  2G45 B;  3MHS D;  4G11 A;  3PS6 A;  2N1V A;  2FAZ A;  3R7R A;  2KX0 A;  2QHO A;  3VHT C;  5JH5 C;  5LXH A;  2ZVN A;  3CSF A;  2KO3 A;  4HCN B;  1V6E A;  5AZF A;  4KZ0 A;  1WY8 A;  3WAN A;  2I1J A;  2N9P C;  4FHJ A;  3A9J B;  3OLM D;  3HIZ A;  3ENE A;  4FJZ A;  1J19 A;  1UEL A;  3RUL A;  4K81 A;  2BWE S;  2WWZ A;  1WX8 A;  2NPT B;  4FN2 A;  2ZCC A;  1OEY A;  3QK0 A;  4IM2 A;  1V49 A;  4MGI E;  2MLB A;  2KWU B;  1E7V A;  4OVU A;  1V9J A;  3TIX A;  1ISN A;  3N32 A;  2KDE B;  4KSL C;  1P98 A;  4M8M A;  2K25 A;  1WE7 A;  3M95 A;  4RM8 A;  2ASQ A;  2AL3 A;  4IWP A;  1G6J A;  2LVO A;  1QZE A;  2D3G A;  5D94 A;  3WA0 A;  2KFK A;  2LGY A;  3OJ4 B;  1E5W A;  4W9L A;  4TV3 A;  2MP2 B;  1WX9 A;  3PTF C;  5DPW A;  2KDF B;  5LLI A;  5L95 C;  2NR2 A;  2FIF A;  2YVC A;  2M8S A;  3CMM B;  3JSV A;  1T0Y A;  3DVG X;  1V2Y A;  1WYW B;  2C7N B;  1UD7 A;  4J6I A;  2M0X A;  2DEN B;  2DX5 B;  2LZ6 A;  2ZVO A;  3ZIM A;  4XX5 A;  1WJ4 A;  1YJ1 A;  2M4N A;  2NVU I;  2M1M A;  3EFU A;  5CX3 A;  3SHQ A;  3V6C B;  2KC2 A;  2AEH A;  4PS7 A;  1XD3 B;  4EZJ A;  2Z0E B;  3RD2 A;  3L54 A; 
#chains in the Genus database with same CATH topology
 2PLP A;  2J42 A;  1D5Z C;  5HI1 A;  2D3C A;  4NPN A;  3MC0 B;  3I3T B;  2WXJ A;  4TUU A;  3IBE A;  2I1K A;  2D2Q A;  1WMH B;  3A4R A;  4BOZ B;  4A90 A;  4YSZ B;  4F1S A;  4N6E B;  3AE7 B;  1V5O A;  4GB9 A;  4RGM A;  2GBR A;  2RR9 A;  3BK2 A;  2HTH A;  3TMP B;  3ZTD A;  2QDF A;  2UU7 A;  5DPT A;  4KGS A;  3W1S A;  4RF0 A;  4KX6 B;  4WWP A;  2MCN B;  1ZE3 D;  2WU5 B;  1YQ3 B;  4IDI A;  1FEH A;  1FXT B;  2J0K A;  2PEA A;  5CHV C;  1CK1 A;  3EFC A;  4AJY B;  2KVR A;  2GOW A;  3APC A;  3N1X C;  2PPH A;  3MFG A;  2MX2 A;  4HPM B;  1J7C A;  2KMC A;  1X1M A;  3AM9 A;  4ZYN A;  3WIM A;  4LK0 M;  1OQY A;  1FXA A;  2LGX A;  2N9X A;  2IYD B;  1Q10 A;  1KOT A;  1OQR A;  2JU6 X;  5E6N A;  1A5R A;  4USA A;  2K3U A;  3B9J A;  2EMT A;  4ZRJ A;  5CHW A;  2WX0 A;  5GXG B;  3GZN I;  3O13 A;  1T5X D;  4KIK B;  3AE1 B;  3GE8 C;  3U4E G;  4EEW A;  2CU3 A;  2D3A A;  4NQK E;  1MHX A;  4HJG E;  3U2S C;  4ANU A;  2A5U A;  3ETR A;  3GZN B;  4DBG A;  2KJH B;  2PVG C;  3DCG A;  2J0M A;  1EF5 A;  2LVP A;  1NVI D;  4JX1 C;  3ONS A;  2KT7 A;  2MBH A;  2GBK A;  3BVG A;  4XE0 A;  4P1C C;  2V1Y A;  4BBN C;  2KN4 A;  1J0G A;  2N1W A;  3SU8 X;  2REX A;  4WUR A;  4ZRP A;  3AEC B;  1SJE D;  2V4I B;  5EE3 A;  5AZG A;  2JF5 A;  3QWZ B;  2CKH B;  3TSS A;  4ZDV A;  3P4S B;  3U30 A;  5JXV A;  2GRI A;  1TS3 A;  3BY4 B;  1KH0 A;  4ICU A;  2YEP F;  2LUM A;  4KVG B;  2BT6 A;  4II3 B;  1RYJ A;  2CR5 A;  3ZNZ B;  4FJY A;  4BZA A;  3RI7 C;  3UQA A;  1KM7 A;  2EMS A;  1WXQ A;  2JYT A;  4QAY A;  1CMX B;  1P7E A;  2BYE A;  3HVZ A;  3H7S A;  3A4S C;  3TUO A;  1WGD A;  1PFD A;  3U8Z A;  2M19 A;  4NJ7 A;  1F77 A;  1NDD A;  4BBN F;  2LWP A;  1V86 A;  5BO4 B;  3NS1 A;  1SJH D;  2FUG 1;  1WJ6 A;  4MJS B;  3LDZ E;  4RM9 A;  2DZM A;  3UQB A;  3AE3 B;  2N9E B;  5H8Y E;  2IGG A;  3FKY A;  2LGS A;  1XO3 A;  4LCD E;  2ZPN A;  4YTP B;  4FBJ B;  2IBI B;  4NQL B;  1WRI A;  1VRA B;  1T3Q A;  3DPD A;  3IG3 A;  2K6Q A;  1PDX A;  1SF0 A;  1WYG A;  1C78 A;  2KTR B;  2KFK B;  2BBC A;  3A33 B;  1C76 A;  2DWQ A;  1GC6 A;  3Q3M C;  3IXS A;  1E8Y A;  1T0S C;  2GBM A;  2FCQ A;  3QC8 B;  1C79 A;  3KLS X;  2MBQ A;  2D5G A;  2W3R A;  1KLV A;  2ZJD A;  1V81 A;  2INN E;  2KMM A;  3H9D A;  4A3O A;  4BKS A;  3R66 C;  3RZW C;  1BUI C;  3I9V 1;  5BMI A;  4AJW A;  4URK A;  2ACZ B;  2ICI A;  3VRA B;  1KLU D;  2YLM A;  1SGH A;  5JZE B;  3PZ8 A;  2KDM A;  1NBF C;  3QX1 A;  1BT0 A;  1GNU A;  1NEN B;  1J7B A;  3E56 A;  2JQR B;  2MBB B;  4S0R A;  4ZYS A;  1MHH E;  2PJH A;  3RFZ B;  4MSM B;  3R3M A;  2WDT B;  1C4C A;  2LXC A;  1ZXH A;  2JZ3 B;  4N9F 4;  2BYF A;  3N1Y C;  2OED A;  4M0W A;  4M8N A;  1UUP A;  2CJO A;  4PS3 A;  5JHB A;  3WAL A;  4AUQ C;  4K7S A;  1XLP A;  1E8Z A;  4GU2 A;  1RM6 C;  1T0Q C;  3H7P B;  2Q5W D;  2PVO D;  2DNF A;  1FMA D;  1AW7 A;  4HEA 1;  2JY6 A;  2BKF A;  1N60 A;  3EC8 A;  1WXM A;  2IGH A;  2R2Q A;  1N5X A;  1R4N I;  2ZCB A;  4I6P A;  2KQ7 A;  1EU4 A;  1YJJ A;  3Q3F A;  4C7Z A;  3BYY B;  1JQ4 A;  1YJI A;  2LUE A;  1FFV A;  1PYW D;  4GDL A;  1R4N B;  4BVU C;  1XLQ A;  4YL8 A;  4W9I A;  3ZXV A;  1V97 A;  2NTT A;  2OJR A;  1UBQ A;  4YT0 B;  4W9G A;  4B9K A;  1L6U A;  2MEK A;  3DBS A;  3OJ3 A;  1E6E B;  1UH6 A;  2HE7 A;  4FA6 A;  3MHZ A;  1WI0 A;  4MGZ E;  3DHI C;  1GG3 A;  2HD5 B;  1YOV B;  3PV1 A;  1WFY A;  1ZW7 A;  4AS1 A;  1CJE A;  2KX3 A;  4US9 A;  3W5U B;  1IGC A;  3U52 E;  2NBV B;  4JPS A;  1XLO A;  1D5M C;  2WP9 B;  2NS5 A;  1VR9 A;  2KAN A;  4KGR A;  5D7G A;  2TSS A;  2C7H A;  1L0Y B;  2L8J A;  2DYB A;  1K53 A;  4A3P A;  1KF6 B;  2KWV B;  4KKJ A;  1E7U A;  3PS6 A;  3RMK C;  2FAZ A;  5LXH A;  3CSF A;  3U7Z A;  2N9L A;  3ENE A;  1J19 A;  2KAJ A;  3BWU D;  2BWE S;  4FN2 A;  5C2T B;  1OEY A;  1V49 A;  4MGI E;  2QCZ A;  2MLB A;  1IBX B;  1I4Q A;  1E7V A;  2WXO A;  4C4V A;  4M8M A;  3M95 A;  4RM8 A;  2ASQ A;  2AL3 A;  2OHF A;  2ONQ A;  1QZE A;  2D3G A;  3N9Y C;  1FNW A;  2XN9 C;  3OJ4 B;  4TV3 A;  2MP2 B;  1JRO A;  5LLI A;  3JSV A;  1T0Y A;  1V2Y A;  1WYW B;  1VJK A;  2DX5 B;  4YTM B;  4XX5 A;  5CX3 A;  2M1M A;  3EFU A;  1JWM D;  2KC2 A;  2AEH A;  1XD3 B;  3DBR B;  3NG0 A;  3L54 A;  3RCZ A;  3AV8 A;  5MPO A;  3W1Y A;  1TGZ B;  1MVK A;  2ZW0 A;  3B2G A;  5TSS A;  2W3S A;  2JSV X;  4FJV B;  5BYS A;  2GLS A;  2RPQ A;  3C8Y A;  4KV2 A;  4KSK C;  1HZ5 A;  3V3X A;  1JWU D;  4W9D A;  2FCM A;  5HFY A;  1WIA A;  2C7M B;  5BMG A;  3W2D A;  3B1L X;  3Q3O C;  4W9E A;  1YN5 A;  1I4H A;  1UWX A;  2KMA A;  1MFW A;  4ANW A;  3VVW B;  3MC9 A;  1V1O A;  3M62 B;  1L2N A;  1JML A;  4XZ4 A;  4OVV A;  2JVC A;  3N3K B;  2LRW A;  1WH3 A;  3ZNG C;  1N6Z A;  2WU2 B;  3HM3 A;  2IO3 B;  2QJL A;  2CHW A;  2WXR A;  1Q1O A;  3MJW A;  1L4Z B;  2BVC A;  4TQ0 A;  4MSQ B;  1H4R A;  3VAW A;  4PT5 A;  4P7I A;  1J7A A;  4HCP B;  3R2T A;  3RYT A;  1B1Z A;  1TIF A;  2L52 A;  3AE8 B;  2PW9 A;  4WJQ A;  2FNJ B;  1TTN A;  1I4P A;  3I63 C;  3VRB B;  2K8H A;  2MQJ A;  4W9F A;  4DQO C;  2DZI A;  1ENF A;  5BYR A;  3KUZ A;  4M0W B;  3X0W A;  4RMA A;  2MSE D;  1LM8 B;  3B0A A;  1ZDV A;  4NZL B;  1Q5W B;  3AE4 B;  1WWT A;  4JE3 B;  4JLC A;  1C4A A;  1E10 A;  3LXF A;  3SFD B;  3LB8 C;  2DLB A;  1YIW A;  3HUI A;  1EF1 A;  3RNC C;  3AE9 B;  2BKR B;  1YX6 B;  3ECI A;  4LJP B;  1TKE A;  3AN1 A;  1K51 A;  4GDK A;  4WWM A;  4RF1 A;  4ZOH C;  2J7Q B;  1L4D B;  4WJP A;  1ZP0 B;  2RPV A;  3ZNH B;  2NBU A;  3UIN B;  5EE1 A;  2V3S A;  4LDT B;  4MAC A;  4GDL B;  5JHA A;  4GOC A;  1E8W A;  3VQI A;  4YSX B;  1YNT E;  1FPY A;  1KLG D;  1FO4 A;  3DBH I;  4HKQ A;  3P1M A;  2L0F A;  1FNU A;  1DGJ A;  4A20 A;  2MHJ A;  2X8X X;  1MPE A;  1P1A A;  1M94 A;  3C0R B;  1UZX B;  4WWN A;  5E6J A;  2DAF A;  4UDU C;  3M3J A;  1OGW A;  4ANX A;  2XK5 B;  2KJR A;  3RZF A;  4DHJ B;  1LFD A;  2IO1 B;  2IPK D;  4MGK E;  2FUH B;  1WX7 A;  5CHF A;  2GMI C;  1JWB D;  3P42 A;  3BIN A;  1JCK B;  2O6V B;  1K52 A;  1HZ6 A;  1QOA A;  2WXH A;  2DZJ A;  4NJ6 A;  2BPS A;  1XEE A;  1JRU A;  4BKG A;  4AOF A;  2DBY A;  3Q2A C;  4G3X B;  2VH2 A;  2KYW A;  1UGM A;  3RNF C;  2JXX A;  4NNJ B;  2PE9 A;  2W54 A;  2KC1 A;  3KQ4 A;  3PT2 B;  4CQN A;  2O2V A;  4GSW A;  4ZRQ A;  3VR9 B;  4DWF A;  1WR1 A;  1STE A;  2PE6 B;  3DHG C;  2B3A A;  3QA8 A;  5E6P A;  4B0E A;  3K9O B;  2DHZ A;  1FFU A;  2BQQ A;  3KVF B;  1Q0W B;  5KHO A;  4DXG A;  2XNA C;  2LAS A;  3IFW B;  4P6V F;  5LXI B;  2BF8 B;  1WGH A;  2ON8 A;  3K9P B;  4OVZ A;  5IN7 A;  4LTU A;  2WXL A;  4NAW A;  5HKH A;  4ITK A;  4JQW C;  1H8C A;  1QT9 A;  1YN3 A;  3CWI A;  3ALB A;  1R4M I;  4DDI D;  3IHP C;  1E0Z A;  1QQR A;  1AN8 A;  2WX1 A;  1ZGU B;  1S1Q B;  1GAQ B;  3X23 A;  4MM3 A;  4F8C B;  2JZZ A;  1HXY D;  1R4M B;  4R3D A;  2K8C A;  1D3Z A;  1GC7 A;  1V1P A;  3PPA A;  2NTS A;  4HXD A;  2FE8 A;  2PKO A;  3TEY A;  2K5P A;  2LJI A;  2LJ5 A;  1C9F A;  1NI3 A;  3NUH B;  4L2Y A;  2WXF A;  4IUM B;  4IG7 B;  1JW9 D;  2MJD A;  3PZD A;  2KLC A;  1WGR A;  2JYE A;  2W55 A;  5AZH A;  2KVZ A;  2JUO A;  3PGE A;  3P2B A;  2LXA A;  3NVY A;  2N7D A;  1N61 A;  3HRD D;  1EU3 A;  5AEK B;  4B95 A;  2C9W B;  3NRZ A;  1ET9 A;  1TS2 A;  2BTE A;  3TCA A;  2BS2 B;  1MJD A;  3IAM 1;  1YQ4 B;  2L1A A;  3LYY A;  3N20 C;  1ZUD 2;  3FIL B;  3RNG C;  4GDK B;  1WXV A;  3VH3 B;  4A6Q A;  3PLV A;  2NMQ A;  3OG5 A;  3AU4 A;  1IP9 A;  4EZL A;  1V80 A;  4K7U A;  2R61 A;  3APD A;  3L17 A;  3KH0 A;  4MT5 A;  1T0R C;  3PZ7 A;  2WXN A;  2Y5C A;  3QQ8 B;  2NCN A;  4GLS C;  3HK0 A;  3U7D A;  4KDL B;  3DVN V;  3WAM A;  2KFJ A;  2WXM A;  4JIO U;  3GS2 A;  1U4A A;  4A55 A;  1HEZ E;  3H8H A;  1F2R C;  3ZDT A;  1SB3 C;  1UNS A;  4G11 A;  1WGG A;  3AEB B;  3MHS D;  3R7R A;  2KX0 A;  1V6E A;  4L23 A;  2I1J A;  4FHJ A;  3RUL A;  1ACC A;  2VZK B;  4B0M A;  2L32 A;  4XWW A;  2ZCC A;  1XF5 L;  2K0P A;  3T3N A;  4REZ A;  1IGD A;  4IOI E;  1V9J A;  3J9C A;  1UWM A;  2KDE B;  4KSL C;  1P98 A;  1WE7 A;  1HQR D;  2INC C;  3E9S A;  2BW2 A;  3Q6B A;  3WA0 A;  1KFY B;  2G1E A;  1E5W A;  1L0X B;  1PGB A;  2WXI A;  3AE2 B;  1WX9 A;  2NR2 A;  2FIF A;  5LNK 1;  2M8S A;  3CMM B;  4J6I A;  2ZVO A;  2IJ0 A;  2WGS A;  3EUB 2;  3SHQ A;  1B9R A;  4EZJ A;  5FR6 A;  2LMC A;  3BVM A;  3SD5 A;  4HRO A;  2L83 A;  1WJU A;  3AEG B;  3DDC B;  4W9C A;  5D3I B;  4DXF A;  3CF6 E;  4K7W A;  2MH7 A;  2KOX A;  4NAM A;  1WM3 A;  2V4L A;  5DPS A;  2Y3A A;  1AAR A;  3NS8 A;  2I2Y A;  4YWG G;  1NEK B;  1FRR A;  4XC2 A;  2JPH A;  1AWD A;  4BOS C;  4WJO A;  3T8M A;  1IUE A;  1R7S A;  3TEX A;  2RD0 A;  2FCN A;  5AUI A;  4AWJ A;  5FR3 A;  3VH4 B;  2NPT A;  4NY0 A;  3NVW A;  2D10 A;  2WHI A;  3IT6 B;  5IP4 D;  4NAW B;  1KRH A;  3SFE B;  4ZRI A;  1WZ0 A;  3AE5 B;  1IPG A;  2M17 A;  3TL5 A;  1TKY A;  3ZGZ A;  4RFB A;  1D4B A;  5TR5 A;  3N1Z C;  1MI0 A;  2HJ8 A;  3M63 B;  2JWZ A;  4MM3 B;  2GBJ A;  3ZLZ A;  5G2N A;  5J18 A;  2D3B A;  1E8X A;  4OHJ A;  3VTU A;  2SAK A;  4HPL B;  5C3J B;  1RFK A;  3BK1 A;  3VUX A;  1SEB D;  1F9J A;  2L0T A;  3ML9 A;  3I57 A;  3AUL A;  1XXG A;  1D5X C;  1E9M A;  4I6N B;  5H92 C;  3EHV A;  5IKC M;  1D6E C;  2NBW B;  3PRE A;  1P7F A;  2MJE A;  2E3T A;  3A9K A;  4E3C A;  5D3D A;  2VRR B;  3EA6 A;  3WAO A;  4EKU A;  1HTO A;  2WQY B;  3VTW A;  2UWQ A;  3V61 A;  3ZNI D;  2KWC A;  4OW0 A;  1C3T A;  3BVZ A;  1C4P A;  4LNO A;  5G55 A;  3P4P B;  1SE2 A;  3Q8F A;  4ACF A;  3A1Q A;  1NYR A;  1L7Y A;  3BYT B;  3EEC A;  2VH1 A;  1RRB A;  3AB5 A;  2KAC A;  4PYZ A;  4AP4 C;  2EEL A;  2DYM A;  3UI3 A;  3RNB C;  1DOY A;  1XLN A;  2OOB B;  3Q3J A;  4KIK A;  1N5W A;  5T8I A;  3T3O A;  3EGR A;  2QC8 A;  4XYC A;  4JWU C;  3PHW B;  3ZRC A;  1XQQ A;  4LNN A;  3VXW A;  2BGF A;  3JVZ X;  5J17 A;  1CQV A;  1L6V A;  2N9K A;  4F7Z A;  2GBN A;  1QOB A;  5BYQ A;  1DYQ A;  1SE9 A;  3PRP B;  2AWT A;  2ZW1 A;  3P4Q B;  1EO6 A;  2Z59 B;  4GN1 A;  1SSN A;  2ZNV C;  1XT9 B;  4G50 A;  2IY0 B;  2KNB A;  2L76 A;  2UYZ B;  2G4S A;  4IC7 B;  3TJP A;  5D6J B;  4DDG D;  4S17 A;  4C80 A;  3DQV A;  4TSS A;  2RMM A;  5HG2 A;  1VLB A;  2N7E A;  2QIE B;  2N4F A;  1UF0 A;  3IAS 1;  3L4P A;  3ZUN A;  4BFR A;  1V5T A;  1YX5 B;  1QOF A;  4KGT A;  3GP7 A;  1ET6 A;  2E6X A;  3HVD A;  4GGQ A;  4HVB A;  4K1R B;  1WM2 A;  2KQS A;  3L08 A;  3NOB A;  4MJS A;  4GMV A;  1SBB B;  4PS8 A;  2ZEQ A;  3RUI B;  4A9A A;  3URY A;  3Q14 C;  1LO5 D;  3V60 A;  1KTK A;  2IO2 B;  5EE9 A;  4E71 A;  1TZ1 A;  4EZK A;  1YN4 A;  3ZW3 A;  2QIL A;  3AH7 A;  3L10 B;  3KYC D;  4IWQ A;  4LLG M;  4HJK A;  5C1Z A;  4JGH B;  1TY0 A;  2IND C;  1I4G A;  4DK5 A;  5J2R A;  2PMV A;  2MWS B;  1OTR B;  4CO7 A;  4HDQ A;  1SE4 A;  4W9K A;  3MC8 A;  4G0N B;  4W9H A;  3H6N A;  2FBW B;  2KTR A;  2GI9 A;  1NI2 A;  2JXT A;  4RNA A;  4RH6 A;  1I4R A;  2KQ4 X;  4MGY E;  4RCO A;  3DBH B;  2A4Z A;  3DVG Y;  4DHZ B;  2WXK A;  1QLB B;  3DVN U;  2H88 B;  1VDV A;  3I5J C;  3N30 A;  1UBI A;  4C7Y A;  3Q8A A;  2MW5 A;  4M01 A;  1GPX A;  3ZJV A;  3QJZ A;  3D32 A;  3UIO B;  1YD8 U;  4MEM A;  1HE8 A;  4HWI B;  3TEZ A;  2V3P A;  4WH4 A;  3FC4 A;  3LJ3 A;  1FM0 D;  4KDI C;  4HDO A;  4LDT D;  2IY1 B;  4MH0 E;  3PHX B;  3NVV A;  3A9K B;  1RLF A;  2PTL A;  2XBB C;  4PK1 A;  1S3S G;  1XCT L;  4MDK E;  1LQB A;  2WDV B;  3SEB A;  4WJN A;  2FID A;  4C4V B;  2CHZ A;  2CHX A;  4IW0 A;  1HTQ A;  3AU5 A;  4Q2J A;  1N62 A;  1PQS A;  2BB6 A;  4ZHP A;  4JWS C;  3DOW A;  4WAF A;  2C60 A;  4CHK A;  1WF9 A;  2LRU A;  1QIL A;  3JSV B;  1IYF A;  3ZTC A;  2DAJ A;  1JWS D;  4CYE A;  1Y8R C;  2WS3 B;  4ANV A;  3A1Q B;  5G5G A;  3CIR B;  4DHJ D;  3Q8C A;  4KZC A;  3AED B;  1DOX A;  2W9N A;  4OZA A;  3H7P A;  3DBL I;  3PO0 A;  3JYU A;  2MBO A;  3AXC A;  4ARI A;  1GB4 A;  4LJO B;  5BMH A;  2BB5 A;  2O6V D;  3RN9 C;  1OQQ A;  2LGI A;  1WR6 E;  1EWC A;  4C56 C;  3VHT C;  5JH5 C;  3DBL B;  2ZVN A;  2KO3 A;  4HCN B;  5AZF A;  4KZ0 A;  1WY8 A;  2N9P C;  4XGA B;  3HIZ A;  4FJZ A;  3RNE C;  2N7J A;  1TKG A;  2WWZ A;  1WX8 A;  2YEP B;  5HHD G;  1F0Z A;  4IM2 A;  2KWU B;  4OZB A;  4OVU A;  1ISN A;  2JZP A;  4WQM A;  4N58 A;  3TEW A;  4IWP A;  3WCQ A;  4O1N A;  1G6J A;  2LVO A;  3R2I A;  1CZP A;  2KDF B;  5L95 C;  2C7N B;  1UD7 A;  3ZIM A;  1WJ4 A;  2M4N A;  2NVU I;  4HKZ E;  3V6C B;  1TZO A;  3RD2 A;  3VTV A;  1WE6 A;  4EFO A;  1WGY A;  1Y56 A;  1F1H A;  2KTF A;  2C5L C;  2L7R A;  2KDB A;  2J0J A;  3HM6 X;  5IO9 A;  3ZRF A;  1GOZ A;  4N59 A;  4BKT A;  3ZKJ C;  3VUY A;  5IAA C;  1FXI A;  5CTR C;  3NHE B;  2WDQ B;  3KW5 B;  3SR6 A;  2KK8 A;  4KKI A;  2M0A A;  4HPP A;  4FUL A;  1WJN A;  3R7Q A;  4IM3 A;  1WGK A;  3W5V B;  3AE6 B;  2KD0 A;  1IBX A;  3BZD B;  3L0W B;  4P16 A;  3NZ3 A;  5FKA C;  4OZC A;  1HA5 A;  4TQ1 A;  1YMH E;  3ABV B;  1PUT A;  1EM7 A;  2L05 A;  2HDE A;  2MP2 A;  3NZU A;  4B6W A;  2V3N A;  2BWF A;  1T6B X;  4L1B A;  2J4X A;  1SIF A;  2RDG A;  2MJ3 A;  2SEB D;  3GOE A;  3AMZ A;  4X57 B;  3ZO5 B;  5L83 A;  2QSD A;  4US8 A;  3AEF B;  3T9L A;  1QF6 A;  5C23 A;  3V05 A;  5EDS A;  1KJT A;  1L5P A;  4TKN A;  3W1S C;  2OJW A;  3HHM A;  1BXT A;  1FRD A;  1VZ8 A;  2JWU A;  2XEW A;  2N0S B;  2IO0 B;  1GJZ A;  3BII D;  1F52 A;  1ZKH A;  2Z8L A;  3S2A A;  1A70 A;  3DWG C;  1XCQ L;  4FHK A;  4ZRK A;  1AYF A;  2H89 B;  3Q8E A;  3VFK A;  3VUW A;  1SE3 A;  3KWL A;  3RPF C;  3ZYY X;  3QAR A;  2BS3 B;  2KWD A;  1I4X A;  3PVL A;  2K8B A;  3KWV A;  2LGD A;  4WIP A;  1F2R I;  3AEA B;  1I35 A;  3AEE B;  1VZ6 A;  4M00 A;  3KYD D;  1ROE A;  4H2A A;  4IWO A;  2LEK A;  2KXJ A;  4E74 A;  2D11 A;  3Q3N C;  3GB1 A;  3PSE B;  4DHZ E;  4EUT A;  4WAA A;  2RGF A;  3VR8 B;  3Q8B A;  1P0R A;  1GB1 A;  1K8R B;  1TS5 A;  3B08 A;  2O2V B;  1V8C A;  1TT5 B;  3P63 A;  1WZ3 A;  1JAL A;  3ZDM C;  2G4D B;  5I4D A;  4PYU A;  4A8X C;  5KHQ A;  3QCA A;  2AYO B;  5EE0 A;  1FD6 A;  2AQ1 B;  1P3Q U;  4TMA B;  4YTN B;  2DZK A;  4ARC A;  3APF A;  3NJT A;  2IZV B;  1SIJ A;  4XDD A;  4EE2 A;  2KZR A;  3V62 A;  5IA7 A;  3H1U A;  3FAH A;  4IM0 A;  4JL9 A;  2RSU A;  5DCN A;  2LI5 A;  2V0G A;  4EOY A;  2VZK D;  2CJN A;  3A9J A;  4J3O D;  1I42 A;  2AX5 A;  1I7H A;  4RGT A;  4FLH A;  1TYG B;  2K39 A;  2HTM E;  2QMT A;  2K22 A;  1YQB A;  4YSY B;  2ZZP B;  1FIQ A;  1C1Y B;  2R2O A;  1PGA A;  3OWE B;  1OEY J;  3MP9 A;  1JWA D;  4LNF A;  3V6E B;  3OAW A;  3QAQ A;  3UF8 A;  3DWM A;  1FNV A;  1LXD A;  3JW0 X;  2KN5 A;  1MG4 A;  3C19 A;  3B2F A;  1V1P B;  5DPR A;  4ASW C;  2KHW B;  5FK9 C;  1SXT A;  5AUK A;  1WMH A;  2WXQ A;  3ZQ4 A;  1JRP A;  2DYO A;  2XK5 A;  1TY2 A;  4RGN A;  3QIJ A;  1WXS A;  3KUD B;  1P9D U;  3Q69 A;  1DOI A;  2WNM A;  2MA9 B;  2KKC A;  1RWS A;  1UGJ A;  2BYV E;  3R8B A;  2IGD A;  2G9H D;  4W9J A;  2B76 B;  3NY5 A;  2MRP A;  1VZ7 A;  2QEJ C;  2WYQ A;  2O6V A;  2JRI B;  3AI5 A;  4ICV A;  5E6O A;  3W9C B;  4BAX A;  2K6D B;  1N63 A;  2LHD A;  3PLU A;  1ESF A;  2BS4 B;  1GUA B;  4GIV A;  4DXA B;  3GE3 C;  1MG8 A;  1TJE A;  4HRS A;  1C77 A;  1E90 A;  2K1F A;  2J52 A;  4NJC A;  1RFA A;  2FCS A;  1EUV B;  4XDC A;  5D2M B;  4MEL A;  1ZPS A;  3DBR I;  1J8C A;  1Z2M A;  4HK2 A;  2ZPY A;  3DHH C;  3PRZ A;  1K50 A;  1ZXI A;  1VD2 A;  3L16 A;  1ZOY B;  4K3C A;  2PIA A;  2Z0D B;  4ZHO A;  4M02 A;  3WAP A;  3MJ5 A;  1Z5S B;  1ZDX A;  1E7P B;  1TS4 A;  1VCB A;  2CU1 A;  2LD9 A;  2GB1 A;  2L00 B;  3L13 A;  4WQO B;  2Y5P A;  3QHT A;  2KLG A;  2WLB A;  2V9H A;  2KJ6 A;  2X38 A;  1WSP A;  3NVZ A;  2JRH A;  2I38 A;  1OFF A;  3P4R B;  3TBL D;  4IKG A;  1PGX A;  3MTN B;  1QOG A;  1WXA A;  3PRM B;  3VDZ A;  1WRD B;  3ZVV A;  4WWO A;  3NZS A;  2W82 A;  3IVF A;  4YXD B;  5GMV A;  3UGB B;  1TBE A;  3UIP B;  1M4V A;  3SDL C;  2L3Z A;  2M56 B;  2EKE C;  1QKZ A;  2D07 B;  2EKI A;  2RDB C;  2KDI A;  2HJ1 A;  4HLE A;  3KUC B;  2JX5 A;  3CST A;  3RT3 B;  4GXB A;  2MBE A;  4I6L B;  3ZJU A;  1BML C;  2WXG A;  4D2K A;  4K3B A;  2CS4 A;  2RDH A;  2IDY A;  4FAD A;  1LGR A;  2G3Q B;  1EWY C;  1RAX A;  1FCL A;  2AQ3 B;  2ZNV B;  4RGO S;  3ML8 A;  4LNK A;  1L0V B;  4BKS D;  3IT4 B;  3O65 B;  2LHE A;  4MH8 A;  2JT4 B;  3RNA C;  2LVQ A;  2AL6 A;  2Y5B B;  4II2 B;  2G45 B;  2N1V A;  2QHO A;  4XWT A;  3WAN A;  2LFI A;  3A9J B;  3ZXR A;  1FCC C;  3OLM D;  1UEL A;  5IOI A;  4K81 A;  2INP E;  2NPT B;  2WXP A;  3QK0 A;  2BYT A;  2WDR B;  3TIX A;  4AQ7 A;  2K9X A;  3N32 A;  3FIL A;  2K25 A;  2J53 A;  2AQ2 B;  4P1B C;  5D94 A;  2KFK A;  4FXC A;  2LGY A;  4W9L A;  3PTF C;  4LNI A;  5DPW A;  2YVC A;  5G5H A;  3ZJT A;  3DVG X;  2M0X A;  2DEN B;  4C00 A;  2LZ6 A;  1YJ1 A;  4PS7 A;  1NYQ A;  2Z0E B; 
#chains in the Genus database with same CATH homology
 3SD5 A;  3W1Y A;  1TGZ B;  3VTV A;  1WE6 A;  1WJU A;  3DDC B;  4W9C A;  4NPN A;  4EFO A;  3CF6 E;  4K7W A;  1WGY A;  2KOX A;  4FJV B;  2KTF A;  3I3T B;  4TUU A;  2C5L C;  2L7R A;  2KDB A;  2J0J A;  2RPQ A;  3HM6 X;  2I1K A;  3IBE A;  2D2Q A;  4KSK C;  1WMH B;  3A4R A;  1WM3 A;  4KV2 A;  4BOZ B;  2V4L A;  5DPS A;  4F1S A;  1AAR A;  3NS8 A;  4BKT A;  4W9D A;  2FCM A;  1V5O A;  4GB9 A;  3ZKJ C;  1WIA A;  2GBR A;  2C7M B;  4XC2 A;  3VUY A;  5IAA C;  2JPH A;  5CTR C;  3NHE B;  2RR9 A;  3KW5 B;  4BOS C;  3B1L X;  4WJO A;  2HTH A;  3TMP B;  3T8M A;  3ZTD A;  2KK8 A;  5DPT A;  3W1S A;  4W9E A;  4FUL A;  1WJN A;  4WWP A;  2MCN B;  2KMA A;  2RD0 A;  4ANW A;  3VVW B;  2FCN A;  4AWJ A;  3M62 B;  1L2N A;  3R7Q A;  4IM3 A;  3VH4 B;  2NPT A;  1FXT B;  2KD0 A;  2J0K A;  4XZ4 A;  2PEA A;  4NY0 A;  4OVV A;  2JVC A;  2D10 A;  3N3K B;  2LRW A;  3L0W B;  5CHV C;  1WH3 A;  3ZNG C;  4NAW B;  4AJY B;  2KVR A;  2GOW A;  3APC A;  3HM3 A;  4TQ1 A;  2PPH A;  2MX2 A;  2IO3 B;  4ZRI A;  2CHW A;  1WZ0 A;  4HPM B;  1Q1O A;  1IPG A;  3MJW A;  2M17 A;  3TL5 A;  2L05 A;  2KMC A;  2MP2 A;  3NZU A;  4B6W A;  4TQ0 A;  4MSQ B;  1X1M A;  2BWF A;  1H4R A;  5TR5 A;  4ZYN A;  3VAW A;  4P7I A;  4HCP B;  3RYT A;  3WIM A;  2HJ8 A;  4WJQ A;  1SIF A;  3M63 B;  2JWZ A;  1OQY A;  2LGX A;  3GOE A;  2N9X A;  2FNJ B;  2GBJ A;  2IYD B;  1TTN A;  4X57 B;  3ZLZ A;  3ZO5 B;  5L83 A;  5G2N A;  1KOT A;  5J18 A;  2K8H A;  2MQJ A;  4W9F A;  5E6N A;  1E8X A;  3T9L A;  1A5R A;  2DZI A;  3VTU A;  5C23 A;  3KUZ A;  4HPL B;  4M0W B;  5EDS A;  1KJT A;  2EMT A;  4ZRJ A;  3X0W A;  5CHW A;  4RMA A;  4TKN A;  2MSE D;  3W1S C;  2WX0 A;  1LM8 B;  3HHM A;  3B0A A;  3GZN I;  3VUX A;  1Q5W B;  1F9J A;  4KIK B;  2L0T A;  3ML9 A;  4JLC A;  2XEW A;  2IO0 B;  1GJZ A;  1ZKH A;  4EEW A;  3AUL A;  4NQK E;  3S2A A;  4ANU A;  4FHK A;  4I6N B;  4ZRK A;  3ZRF A;  2A5U A;  3EHV A;  1YIW A;  3VFK A;  1EF1 A;  3VUW A;  2BKR B;  4DBG A;  2NBW B;  1YX6 B;  3QAR A;  2KJH B;  3PRE A;  3ECI A;  3PVL A;  2K8B A;  2LGD A;  3DCG A;  3A9K A;  4LJP B;  2J0M A;  4E3C A;  1I35 A;  1EF5 A;  2LVP A;  3ONS A;  3KYD D;  2MBH A;  2VRR B;  2GBK A;  4GDK A;  3WAO A;  4IWO A;  2J7Q B;  2KXJ A;  4EKU A;  4WJP A;  4E74 A;  2V1Y A;  4BBN C;  1J0G A;  2N1W A;  2D11 A;  3ZNH B;  3SU8 X;  2NBU A;  3UIN B;  3PSE B;  2V3S A;  2REX A;  4LDT B;  3RCZ A;  4DHZ E;  4GDL B;  4EUT A;  4WAA A;  2RGF A;  3VTW A;  5JHA A;  2UWQ A;  4GOC A;  1E8W A;  3VQI A;  3V61 A;  3ZNI D;  1P0R A;  2KWC A;  5AZG A;  1C3T A;  2JF5 A;  3QWZ B;  2CKH B;  5G55 A;  4ZDV A;  3DBH I;  1K8R B;  3B08 A;  2L0F A;  2O2V B;  3A1Q A;  4A20 A;  3U30 A;  1WZ3 A;  1L7Y A;  3BY4 B;  2G4D B;  3ZDM C;  1P1A A;  1M94 A;  3C0R B;  4ICU A;  4PYU A;  3EEC A;  1UZX B;  5KHQ A;  4WWN A;  1RRB A;  2AYO B;  3QCA A;  4PYZ A;  4KVG B;  4II3 B;  4AP4 C;  2DYM A;  1P3Q U;  2CR5 A;  2DZK A;  2DAF A;  3ZNZ B;  3M3J A;  4FJY A;  3APF A;  1OGW A;  3UQA A;  2IZV B;  4ANX A;  2XK5 B;  2OOB B;  3Q3J A;  4KIK A;  1KM7 A;  2KJR A;  2KZR A;  3V62 A;  3RZF A;  5IA7 A;  3H1U A;  2EMS A;  4DHJ B;  4IM0 A;  4JL9 A;  2RSU A;  1CMX B;  5DCN A;  2LI5 A;  1LFD A;  2IO1 B;  2BYE A;  4MGK E;  2FUH B;  3H7S A;  3PHW B;  4EOY A;  3A4S C;  1WGD A;  3U8Z A;  3ZRC A;  3A9J A;  1XQQ A;  4NJ7 A;  1NDD A;  1I42 A;  4BBN F;  1WX7 A;  2LWP A;  3VXW A;  1V86 A;  2BGF A;  3JVZ X;  5CHF A;  5BO4 B;  1WJ6 A;  4FLH A;  4MJS B;  2GMI C;  2K39 A;  3LDZ E;  4RM9 A;  2DZM A;  5J17 A;  3UQB A;  3BIN A;  2O6V B;  4F7Z A;  2N9E B;  2GBN A;  1SE9 A;  3PRP B;  2AWT A;  2DZJ A;  1YQB A;  4NJ6 A;  2BPS A;  1EO6 A;  2Z59 B;  4GN1 A;  2ZZP B;  1JRU A;  4LCD E;  2ZPN A;  4BKG A;  2ZNV C;  1XT9 B;  4G50 A;  4AOF A;  4FBJ B;  1C1Y B;  2IY0 B;  2KNB A;  2IBI B;  4G3X B;  4NQL B;  2L76 A;  2R2O A;  2UYZ B;  2G4S A;  1UGM A;  3DPD A;  1OEY J;  2JXX A;  3IG3 A;  4NNJ B;  2PE9 A;  2K6Q A;  3V6E B;  3OAW A;  3QAQ A;  3UF8 A;  4IC7 B;  3TJP A;  2KC1 A;  1LXD A;  3JW0 X;  5D6J B;  3PT2 B;  4DDG D;  2KTR B;  2O2V A;  2KN5 A;  4GSW A;  2KFK B;  3DQV A;  3A33 B;  1GC6 A;  5DPR A;  4DWF A;  1WR1 A;  4ASW C;  2KHW B;  2PE6 B;  2N7E A;  2B3A A;  1WMH A;  1E8Y A;  3QA8 A;  2N4F A;  5E6P A;  2GBM A;  2DYO A;  2XK5 A;  2FCQ A;  3K9O B;  2DHZ A;  3QC8 B;  3QIJ A;  1WXS A;  3KUD B;  1P9D U;  2MBQ A;  3KVF B;  3ZUN A;  4BFR A;  1KLV A;  1V5T A;  1YX5 B;  2ZJD A;  1V81 A;  1Q0W B;  5KHO A;  2MA9 B;  2KKC A;  3H9D A;  4A3O A;  4BKS A;  2BYV E;  2LAS A;  3IFW B;  3R66 C;  4GGQ A;  4K1R B;  1WM2 A;  3RZW C;  4HVB A;  2KQS A;  4AJW A;  4URK A;  3L08 A;  3NOB A;  4W9J A;  4MJS A;  5LXI B;  3NY5 A;  4GMV A;  2BF8 B;  2MRP A;  2YLM A;  1WGH A;  2ZEQ A;  2WYQ A;  4PS8 A;  3RUI B;  1SGH A;  2O6V A;  2JRI B;  5JZE B;  3AI5 A;  4ICV A;  3K9P B;  5E6O A;  3V60 A;  4E71 A;  2IO2 B;  1NBF C;  2K6D B;  3QX1 A;  1TZ1 A;  4NAW A;  5HKH A;  3PLU A;  4EZK A;  3ZW3 A;  1BT0 A;  1GNU A;  3L10 B;  1GUA B;  4JQW C;  3KYC D;  4GIV A;  4IWQ A;  4DXA B;  1H8C A;  1MG8 A;  4HJK A;  5C1Z A;  3ALB A;  4JGH B;  1R4M I;  4DK5 A;  5J2R A;  1E90 A;  2MBB B;  4DDI D;  3IHP C;  2MWS B;  1OTR B;  4CO7 A;  2K1F A;  2WX1 A;  2PJH A;  1ZGU B;  1S1Q B;  4HDQ A;  4MSM B;  3R3M A;  1RFA A;  2FCS A;  1EUV B;  5D2M B;  4W9K A;  4MEL A;  4MM3 A;  3X23 A;  4F8C B;  2WDT B;  2JZZ A;  3H6N A;  4G0N B;  4W9H A;  2KTR A;  1NI2 A;  2LXC A;  3DBR I;  1J8C A;  2JZ3 B;  2K8C A;  4N9F 4;  1Z2M A;  1D3Z A;  1GC7 A;  4HK2 A;  2BYF A;  2ZPY A;  4MGY E;  3PRZ A;  4M8N A;  1VD2 A;  3PPA A;  3L16 A;  4PS3 A;  5JHB A;  3WAL A;  2A4Z A;  4HXD A;  3DVG Y;  4DHZ B;  2Z0D B;  4AUQ C;  3DVN U;  4K7S A;  3WAP A;  1E8Z A;  4GU2 A;  3N30 A;  1UBI A;  1Z5S B;  3H7P B;  2LJ5 A;  2MW5 A;  1VCB A;  2CU1 A;  3QJZ A;  2LD9 A;  3D32 A;  4IG7 B;  4IUM B;  2JY6 A;  3UIO B;  2BKF A;  2L00 B;  3PZD A;  3L13 A;  4WQO B;  3EC8 A;  1YD8 U;  1WXM A;  2KLG A;  3QHT A;  4MEM A;  2R2Q A;  2KJ6 A;  2KLC A;  1HE8 A;  4HWI B;  1R4N I;  1WGR A;  2ZCB A;  2JRH A;  5AZH A;  2JUO A;  2KQ7 A;  4I6P A;  3PGE A;  3TBL D;  3P2B A;  2LXA A;  3Q3F A;  2N7D A;  3LJ3 A;  3MTN B;  4KDI C;  1WXA A;  4HDO A;  5AEK B;  3PRM B;  4LDT D;  4B95 A;  2IY1 B;  3VDZ A;  4MH0 E;  1WRD B;  2C9W B;  2LUE A;  3PHX B;  3ZVV A;  4GDL A;  4WWO A;  3A9K B;  3TCA A;  4BVU C;  3NZS A;  4YL8 A;  3IVF A;  4W9I A;  1RLF A;  2XBB C;  5GMV A;  3UGB B;  1S3S G;  1TBE A;  3UIP B;  4MDK E;  1LQB A;  2OJR A;  3SDL C;  2L3Z A;  4WJN A;  1UBQ A;  2EKE C;  4GDK B;  2D07 B;  2FID A;  4W9G A;  4B9K A;  2CHZ A;  2KDI A;  1WXV A;  3VH3 B;  2CHX A;  3DBS A;  3OJ3 A;  3PLV A;  1UH6 A;  2HE7 A;  4IW0 A;  4FA6 A;  3AU5 A;  3KUC B;  3AU4 A;  4HLE A;  1PQS A;  1IP9 A;  3CST A;  1WI0 A;  4MGZ E;  3DOW A;  3RT3 B;  4EZL A;  1V80 A;  4K7U A;  4GXB A;  2MBE A;  4I6L B;  1GG3 A;  2C60 A;  3APD A;  4CHK A;  1WF9 A;  3L17 A;  2LRU A;  3KH0 A;  5FR6 A;  2HD5 B;  3JSV B;  3PV1 A;  1WFY A;  1IYF A;  1ZW7 A;  2CS4 A;  3ZTC A;  2DAJ A;  4CYE A;  1Y8R C;  2KX3 A;  3QQ8 B;  4FAD A;  2NCN A;  4ANV A;  2NBV B;  3HK0 A;  3A1Q B;  2G3Q B;  1RAX A;  4DHJ D;  2NS5 A;  4KZC A;  3U7D A;  2KAN A;  4KDL B;  2ZNV B;  2W9N A;  3DVN V;  5D7G A;  3WAM A;  3ML8 A;  4BKS D;  2C7H A;  3H7P A;  2KFJ A;  3O65 B;  4JIO U;  2L8J A;  3DBL I;  2DYB A;  3JYU A;  4A3P A;  1U4A A;  2JT4 B;  2MBO A;  3AXC A;  4LJO B;  3ZDT A;  2KWV B;  2LVQ A;  2AL6 A;  2O6V D;  2Y5B B;  4II2 B;  1E7U A;  1WGG A;  1WR6 E;  2G45 B;  3MHS D;  4G11 A;  3PS6 A;  2N1V A;  2FAZ A;  3R7R A;  2KX0 A;  2QHO A;  3VHT C;  5JH5 C;  5LXH A;  2ZVN A;  3CSF A;  2KO3 A;  4HCN B;  1V6E A;  5AZF A;  4KZ0 A;  1WY8 A;  3WAN A;  2I1J A;  2N9P C;  4FHJ A;  3A9J B;  3OLM D;  3HIZ A;  3ENE A;  4FJZ A;  1J19 A;  1UEL A;  3RUL A;  4K81 A;  2BWE S;  2WWZ A;  1WX8 A;  2NPT B;  4FN2 A;  2ZCC A;  1OEY A;  3QK0 A;  4IM2 A;  1V49 A;  4MGI E;  2MLB A;  2KWU B;  1E7V A;  4OVU A;  1V9J A;  3TIX A;  1ISN A;  3N32 A;  2KDE B;  4KSL C;  1P98 A;  4M8M A;  2K25 A;  1WE7 A;  3M95 A;  4RM8 A;  2ASQ A;  2AL3 A;  4IWP A;  1G6J A;  2LVO A;  1QZE A;  2D3G A;  5D94 A;  3WA0 A;  2KFK A;  2LGY A;  3OJ4 B;  1E5W A;  4W9L A;  4TV3 A;  2MP2 B;  1WX9 A;  3PTF C;  5DPW A;  2KDF B;  5LLI A;  5L95 C;  2NR2 A;  2FIF A;  2YVC A;  2M8S A;  3CMM B;  3JSV A;  1T0Y A;  3DVG X;  1V2Y A;  1WYW B;  2C7N B;  1UD7 A;  4J6I A;  2M0X A;  2DEN B;  2DX5 B;  2LZ6 A;  2ZVO A;  3ZIM A;  4XX5 A;  1WJ4 A;  1YJ1 A;  2M4N A;  2NVU I;  2M1M A;  3EFU A;  5CX3 A;  3SHQ A;  3V6C B;  2KC2 A;  2AEH A;  4PS7 A;  1XD3 B;  4EZJ A;  2Z0E B;  3RD2 A;  3L54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...