2HTME

Crystal structure of ttha0676 from thermus thermophilus hb8
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
64
structure length
64
Chain Sequence
MVWLNGEPRPLEGKTLKEVLEEMGVELKGVAVLLNEEAFLGLEVPDRPLRDGDVVEVVALMQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Thiazole biosynthesis protein thiG
publication title Crystal structure of TTHA0676 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 11
structure length 64
sequence length 64
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2006-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2htmE00
1TJEA 3P4QB 3AMZA 2Y5CA 3SR6A 3W5VB 1KRHA 1RYJA 1T3QA 4C80A 1L6VA 2W3SA 1B9RA 2M56B 2JX5A 1JWBD 1FRRA 2KMMA 4YTNB 2W55A 1NYQA 1SB3C 2MJ3A 2FBWB 1DOYA 1TKGA 1J7AA 1CZPA 3P4RB 3ETRA 2WU5B 1OQRA 5EE3A 1FO4A 2BS2B 1NVID 3AEAB 5GXGB 3P4SB 1FXAA 2QIEB 5G5GA 1TKEA 5EE0A 4IDIA 1N5WA 3AEFB 1FFVA 1QOFA 2H88B 4US9A 1E6EB 1YJIA 3ZYYX 2MJEA 4HROA 1KFYB 1WRIA 3ABVB 3HUIA 1CJEA 3AB5A 2WLBA 4ZOHC 1ROEA 4USAA 1VLBA 1L6UA 1FFUA 4YSYB 2ACZB 3B9JA 2DBYA 1XLQA 1SIJA 2L83A 3VRBB 1FM0D 3FC4A 1ZOYB 1PDXA 1WYGA 1VDVA 5G5HA 1DGJA 1I7HA 3AEDB 2WQYB 2AX5A 1KF6B 3AE8B 3BIID 3AE1B 2BT6A 2QJLA 4YXDB 3DWGC 3NVWA 1AYFA 3AEEB 1JQ4A 1F0ZA 3NVVA 3P63A 3CIRB 1RM6C 1N62A 2WDRB 3AE9B 1YQ3B 1J7BA 3VRAB 2E3TA 1FMAD 2CU3A 5H92C 1RFKA 4US8A 1NEKB 2BS4B 1QT9A 3AH7A 1AWDA 1E9MA 1QOBA 2MH7A 1EWYC 1SF0A 1XO3A 2HTME 5C2TB 1E7PB 2CJNA 3PO0A 1GAQB 3RPFC 3KWLA 3CWIA 3AE4B 4JX1C 5C3JB 1JW9D 1XLNA 2WDVB 3AM9A 4N6EB 4YT0B 3LB8C 2WDQB 5AUKA 3VR8B 3AE5B 1V97A 1QOGA 1IUEA 2EKIA 3NRZA 1N60A 3AE2B 4JWUC 1XLPA 1ZXIA 4N58A 3NVYA 1DOXA 1VJKA 4C7ZA 2BS3B 1OQQA 3W9CB 1DOIA 2PVOD 5MPOA 1JROA 2PVGC 2L52A 2K5PA 3P1MA 3SFDB 3DWMA 1R7SA 3W5UB 3AEBB 1WGKA 2LEKA 2CJOA 2WU2B 1ZUD2 3LXFA 2WS3B 4FXCA 4P6VF 2G1EA 2M19A 3AE3B 1FXIA 4YTPB 5EE1A 3HRDD 3AEGB 2K9XA 1YQ4B 2W54A 2H89B 1E10A 4YSZB 4ZHOA 1E0ZA 1RWSA 3FAHA 2N0SB 1WWTA 3AECB 1V8CA 4A9AA 1L5PA 5EE9A 5AUIA 3NVZA 1TYGB 4HRSA 3SFEB 3EUB2 2KAJA 1A70A 4YTMB 1QF6A 2K22A 3AE7B 1NYRA 1NENB 1L0VB 4N59A 4C7YA 1UWMA 3WCQA 4ZHPA 1NI3A 1JALA 3AV8A 1J7CA 2PKOA 2DWQA 4JWSC 3VR9B 3P4PB 1XLOA 2B76B 2PIAA 1GPXA 4LTUA 1N63A 3AE6B 4WQMA 3L4PA 4ITKA 1FIQA 1N61A 1QLBB 2Q5WD 2OHFA 1OFFA 2WP9B 1FRDA 4KX6B 1JRPA 4YSXB 5H8YE 1N5XA 3B2GA 2MJDA 1YJJA 2JQRB 3NS1A 3HVZA 1JWAD 3AN1A 1ZP0B 3B2FA 1PUTA 1WXQA 1QOAA 1PFDA 2W3RA 1TKYA 4WWMA
chains in the Genus database with same CATH superfamily
3P4QB 1WGHA 4TSSA 3W5VB 2ONQA 2KMMA 1SB3C 2MJ3A 3MP9A 1KLGD 2ZCCA 4HK2A 5CTRC 4C56C 1ZW7A 4RM8A 4LCDE 1N5WA 2ZW1A 3KQ4A 5BMIA 5DPRA 1ROEA 1TY0A 1SIJA 2CU1A 1WYGA 2KJ6A 3QK0A 1WE6A 3PLUA 2AX5A 3KYDD 4BKTA 3OJ4B 3FILA 4GN1A 3EFCA 2JZ3B 1T5XD 2DLBA 3CIRB 1TS3A 1FMAD 3X23A 2N9XA 3AH7A 1QT9A 2LGXA 1AWDA 3FILB 1C3TA 2OOBB 3M62B 4WWPA 1A5RA 2LJIA 4BKSA 1JW9D 1GC6A 1K8RB 2WDQB 4ZRKA 5J2RA 3MTNB 2RDGA 2LVOA 4IWQA 1UH6A 1YQBA 5E6PA 1DOXA 2FNJB 3A4SC 1WGYA 3IT4B 4GOCA 5BYRA 1HEZE 1HQRD 1T0QC 2AL3A 2IY1B 1MI0A 2KD0A 3BK1A 4NJ6A 1JWSD 1EU4A 1JWUD 3LXFA 5FK9C 4EEWA 1WSPA 1FXIA 2RGFA 3RI7C 4IM2A 2KHWB 2UWQA 2KACA 1ZE3D 1ZDVA 1V8CA 2HE7A 5E6OA 3LYYA 3EUB2 2KAJA 2MRPA 5CHVC 4LLGM 2V9HA 3Q8BA 3AV8A 1K51A 2XNAC 3Q14C 5DPSA 1QLBB 2L1AA 2WXHA 3HVZA 4EFOA 2KWCA 1CK1A 2K3UA 1TJEA 2W82A 4KGTA 3SR6A 1YNTE 4DDGD 2JX5A 2J0KA 3Q69A 2FBWB 2WNMA 4W9DA 2BB5A 1NVID 4S0RA 4OVUA 4E74A 4JQWC 4AP4C 3ZJUA 2MJEA 1E5WA 1WX9A 1FFUA 3NJTA 2JF5A 3H9DA 4TKNA 2QC8A 3W1SC 4F1SA 3DWGC 3AEEB 1IGDA 4YL8A 4KKIA 3GP7A 4ARCA 1KJTA 3QX1A 3U2SC 1NEKB 4M02A 3PRZA 1SBBB 3APDA 1M94A 2NBWB 4DXGA 3ZLZA 2L0TA 3MC9A 1V9JA 2BS3B 2KQ7A 4XZ4A 3EC8A 1R7SA 2I2YA 4WIPA 4EE2A 3TUOA 3H7PA 1S3SG 4BZAA 3BYYB 2C60A 3VTWA 1YQ4B 4I6LB 3U8ZA 1BT0A 1EF5A 2KTRB 2FIDA 2KDEB 1UWMA 4HJKA 1TTNA 2M4NA 4WAAA 5AZGA 5JHBA 2ZPNA 3GE8C 2KWDA 5C23A 2MQJA 3VTUA 2M8SA 1D5MC 3WAPA 4O1NA 2L3ZA 3H1UA 3C19A 4FHJA 1YJJA 1P3QU 1C79A 1M4VA 5BMGA 1PFDA 2W3RA 5D3IB 3DQVA 4N9F4 1LO5D 3BY4B 1MJDA 2FUG1 1FRRA 4YTNB 2FAZA 1SSNA 3NZSA 3I57A 2INDC 5GXGB 4LNKA 2QIEB 4IDIA 1UD7A 2WXFA 1BXTA 3DBLB 4HROA 4GDLB 1FNWA 3QA8A 5L83A 3VRBB 1WZ3A 3TEXA 4HDOA 4ZRQA 3NZUA 4B0EA 3A9KA 3AE1B 4GIVA 2V0GA 3V05A 3NVVA 1RM6C 1QKZA 1N62A 1I4XA 1YQ3B 3N20C 3T9LA 3A9KB 1BUIC 2J52A 1Q5WB 1YD8U 2WXNA 2Z0EB 1RRBA 2WX1A 1V97A 2EKIA 3NRZA 2OEDA 4W9HA 3WALA 4GXBA 3BYTB 3IXSA 1UGMA 1ZXIA 2YLMA 1F9JA 2ZNVC 3RZFA 2N9EB 3KUZA 2GRIA 2YEPB 1DOIA 2KQSA 4LNIA 5IAAC 3W5UB 4HXDA 1SE9A 4OHJA 2JXXA 4K7UA 1LM8B 3HRDD 3AU5A 2EMSA 2D10A 4BKSD 1YN3A 3T3OA 3RNAC 2HDEA 4HRSA 2PE6B 1Q10A 1E8ZA 2G4DB 2ASQA 3PVLA 3SD5A 2JT4B 3VH3B 1D3ZA 4KGSA 2V1YA 2YVCA 2RDBC 2K6DB 4ITKA 3IBEA 3TEWA 1JRPA 4YSXB 1R4NB 2XEWA 2FCQA 3DCGA 4A90A 1WXQA 1Y8RC 1C76A 2KLGA 3ZNGC 2WXPA 1OQRA 1VZ8A 1YOVB 5AZHA 5LXHA 1IGCA 3ZUNA 2LVQA 2K6QA 1VRAB 4ZOHC 3PREA 5IO9A 4EZLA 3EFUA 4WJPA 3DVGX 1OEYJ 3ZTCA 4YXDB 2ICIA 3ZW3A 3ALBA 1V2YA 3L17A 2FCMA 3NG0A 4WAFA 2W9NA 2G4SA 1J7BA 1T0SC 2CU3A 2O2VA 2DYOA 1WRDB 4HLEA 4KVGB 2FE8A 2N9LA 1E7PB 4JX1C 3VR8B 2IYDB 2PE9A 3LDZE 2O2VB 2KJHB 2LWPA 2WXLA 1JCKB 1KM7A 4II3B 4NJ7A 1P1AA 2HTHA 2IO3B 2K0PA 2PVOD 1T6BX 4OW0A 2V4IB 2DZMA 3AEBB 3PS6A 1WGKA 2LEKA 2Y3AA 1ZUD2 4FXCA 3L08A 3QC8B 4YTPB 2NBVB 5KHQA 4PT5A 5JZEB 4HDQA 1P7EA 3EA6A 1TYGB 4OZCA 1YX6B 4ZRPA 2BVCA 3W2DA 2JY6A 3U30A 3BVGA 3Q3OC 1L0VB 4N59A 3RT3B 1EM7A 4OVVA 2J4XA 2V3SA 1L0XB 2LUEA 3P4PB 1WJUA 2MBOA 4LTUA 1UUPA 4MGKE 4KKJA 2BKRB 1I35A 3VFKA 4IWOA 5CX3A 2EMTA 4BAXA 2D07B 1TS2A 1SJHD 3W1SA 1FD6A 2FIFA 1L6VA 2W3SA 2WYQA 3DHHC 3E9SA 2OJWA 3KW5B 4CO7A 1FO4A 3VAWA 1DOYA 3URYA 5L95C 3ZYYX 3IG3A 3P2BA 2DZJA 4GMVA 2LHDA 4ARIA 2XBBC 3ZRFA 5CHWA 2GBMA 3BIID 1F2RI 3ZVVA 2D2QA 2J0JA 1WX7A 1WH3A 2ZVNA 1RAXA 4E71A 2BS4B 5CHFA 1XXGA 1IBXA 4ICUA 4WQOB 3U52E 4HEA1 1OTRB 4QAYA 2RSUA 2MP2A 1J19A 4FULA 3RNFC 4LJPB 2MP2B 2KMAA 4ZDVA 1TGZB 1GB1A 3SDLC 3DBHI 3AEGB 3WA0A 2WGSA 2IO0B 2G3QB 1L5PA 2MA9B 1SEBD 2M0XA 1I4PA 1ZGUB 1NENB 2GI9A 4XDCA 3DPDA 1MVKA 1UF0A 3WCQA 3JYUA 3AI5A 1JALA 3N32A 1J8CA 2J7QB 4G11A 1V86A 3RN9C 2PMVA 1ENFA 1FIQA 4CQNA 1CQVA 2JQRB 2JWZA 1C4PA 3C0RB 2PLPA 5HI1A 2WXMA 2VZKB 2SEBD 1GOZA 2MBBB 3IVFA 1EF1A 2EKEC 2R2QA 1KRHA 1RYJA 1T3QA 2BF8B 3HVDA 4MGYE 4C80A 4PYZA 1J7AA 2GBKA 1XCQL 1FXAA 2AL6A 3TBLD 5EE0A 1QOFA 3UINB 2KXJA 3BK2A 4W9FA 4HWIB 4US9A 3ZNZB 4B6WA 2WXGA 2ACZB 1LGRA 4G0NB 1WJ6A 3L10B 1FM0D 3FC4A 5C1ZA 3WAOA 3AEDB 1L0YB 4WJOA 1HA5A 2LUMA 2WXRA 1I4RA 1JQ4A 3JW0X 1D5XC 2ZNVB 3VRAB 4GLSC 1RFKA 2WXQA 2LZ6A 4AS1A 2ZPYA 4N6EB 1XEEA 1GB4A 2L32A 2QSDA 3M95A 1IYFA 3DBRI 4LJOB 2JUOA 1WIAA 2K8CA 3GE3C 3VUWA 1YMHE 2AQ1B 3W9CB 2GB1A 1V49A 3M63B 2PVGC 4REZA 1WX8A 3PZ8A 2ZEQA 4ZRIA 3ZNHB 3NY5A 1E10A 2N0SB 2DYBA 1V1PA 3VDZA 3SFEB 4F7ZA 3AE7B 5BMHA 2MBEA 3ZJVA 2IZVB 2MWSB 4C7YA 1NI3A 4XE0A 1RFAA 3S2AA 2B76B 2ZW0A 2IY0B 2K39A 4XWTA 3UF8A 3X0WA 2K8BA 2Q5WD 5IOIA 2MJDA 2KKCA 1JWAD 4RMAA 2LVPA 3PV1A 4XDDA 4PYUA 3V6CB 2CHWA 3BZDB 3NZ3A 3RNGC 1JWBD 3R3MA 2KT7A 3W1YA 3NHEB 1CZPA 1OEYA 1ISNA 2DAJA 1QQRA 1STEA 4MM3A 4FHKA 1D6EC 1MFWA 1XCTL 4MACA 4MM3B 2Z59B 3RD2A 3PRMB 1TY2A 4WURA 2N7DA 1MG4A 2ON8A 2WX0A 3I3TB 4NPNA 2KDBA 4JPSA 2TSSA 2KYWA 3CWIA 3AE4B 1XLNA 1XF5L 2KO3A 2NTSA 1V5TA 4L23A 1WXVA 2AWTA 2M0AA 2QILA 3RNBC 3ZO5B 1YX5B 3O65B 4MH8A 4GDKA 1I4QA 2BQQA 2KK8A 3ECIA 1GNUA 1GC7A 2IPKD 1G6JA 4GDKB 4RFBA 4KV2A 2KZRA 1U4AA 1AW7A 4ZRJA 4AQ7A 3Q6BA 3ZXVA 2M17A 4YSZB 3KUCB 1WWTA 3VTVA 1H4RA 5IA7A 2DNFA 3M3JA 1C9FA 3GS2A 1OQYA 2BGFA 1WM3A 3ONSA 4EZJA 4FBJB 1N5XA 2IGDA 3O13A 4ANXA 1I4GA 4DHZB 2NR2A 3ZQ4A 4NQLB 4HVBA 2QEJC 2BW2A 3ENEA 3H7PB 2FCNA 2CR5A 1TS4A 5HG2A 4IOIE 3PZ7A 2KJRA 3RUIB 4OZBA 2R61A 4AOFA 4OVZA 2JZPA 5EE3A 4MJSA 2J53A 5IN7A 3N1ZC 2VZKD 1FFVA 2H88B 1KFYB 5EDSA 3KLSX 1L6UA 4MJSB 3P42A 1I7HA 2R2OA 4MEMA 2GMIC 1LFDA 1FNUA 4L2YA 1H8CA 4K81A 5BYQA 2JYTA 5D6JB 3P63A 3EGRA 3ZJTA 1WE7A 1BMLC 4KDIC 1JRUA 2A4ZA 2HTME 3Q3MC 3B1LX 1WFYA 2WDVB 3A4RA 4MELA 3J9CA 1N60A 4FLHA 4A20A 2K25A 3P1MA 3ZTDA 3WANA 5DPWA 3MHZA 2WHIA 2K9XA 4PS3A 3APCA 3IAS1 2V4LA 2JRHA 2AQ2B 3ZNID 2PTLA 4W9LA 3QIJA 5LLIA 2DWQA 2WWZA 4YWGG 2REXA 3VR9B 2L0FA 5BYSA 5LNK1 4IKGA 3L4PA 4XX5A 3CF6E 2GBJA 1ZKHA 3TIXA 2KFKA 3PGEA 1SE2A 3U7ZA 2INNE 4RCOA 4WWMA 4HKZE 1VZ7A 1X1MA 1ET9A 1NYQA 3A9JA 3ETRA 5G5GA 2N1VA 3GZNB 3ZRCA 5D7GA 1E6EB 1YJIA 1FPYA 4HCPB 2XN9C 1SE4A 4XWWA 1FCLA 2KVRA 2LGIA 3MC0B 2L00B 1NBFC 1XLQA 2L83A 2C7NB 5D3DA 2DYMA 2KDMA 4MSMB 1KF6B 2BT6A 1HTQA 4RGTA 3PHWB 2CS4A 4KIKA 4AJWA 1UELA 5DPTA 4ZYSA 4JLCA 2B3AA 2Z0DB 2EELA 1EWYC 4M01A 3KWLA 2IGGA 2PPHA 2D3BA 3BVZA 3AE5B 1IUEA 4G50A 1ACCA 2KDIA 4PS8A 2V3PA 3DBLI 3NS8A 1XLPA 4J6IA 4RGNA 3V6EB 4P1BC 2NBUA 4MGZE 1N6ZA 3QWZB 2BB6A 2KDFB 3R66C 4PK1A 2RDHA 3AECB 2MHJA 4AWJA 5AUIA 2WXOA 1PGBA 4W9KA 4RM9A 2KN5A 1SJED 1J7CA 3VHTC 4DBGA 5JXVA 4RNAA 4Q2JA 2MW5A 2OHFA 1OFFA 2VH2A 4M8NA 1K52A 2BKFA 2JU6X 3GOEA 1GUAB 4HCNB 3AMZA 1T0RC 1WJ4A 2N9KA 2M56B 2LHEA 1ET6A 4K7SA 1AARA 2DX5B 4MT5A 2NCNA 4DDID 3CSFA 2RR9A 3Q8CA 4M00A 3AEFB 3TMPB 1B1ZA 4WH4A 1WJNA 4LNOA 3DOWA 3L16A 3QAQA 1VLBA 1RLFA 4RGMA 4IM0A 2MEKA 4FA6A 5G5HA 3JSVA 1WMHA 4HKQA 1GJZA 2JYEA 3OG5A 2I1JA 1L7YA 5FR3A 3NVWA 2FCSA 1AYFA 1R4NI 4DK5A 4RF0A 2OJRA 3VXWA 3JSVB 4LNFA 1WMHB 2QHOA 5H92C 4BKGA 2HJ1A 3PPAA 4NZLB 2DZKA 2MH7A 4MSQB 3VH4B 4ICVA 3AM9A 4GGQA 2SAKA 5AEKB 2KQ4X 2FUHB 4R3DA 3PLVA 4DXAB 2D11A 4ANUA 5MPOA 3N3KB 1R4MB 4KSLC 3SFDB 3IFWB 4ZYNA 2IO1B 1E7VA 3IHPC 2BYVE 2BTEA 5TR5A 2ZVOA 2A5UA 1J0GA 3B0AA 1A70A 5DCNA 3KYCD 1IBXB 1JWMD 3VUXA 3R2IA 2C7HA 3T3NA 1MHXA 5HKHA 4FADA 3RNEC 3A1QA 2RPQA 3PRPB 2WP9B 3ZDMC 2I38A 2NPTA 4TUUA 2BBCA 3MC8A 4WJQA 3A1QB 4WJNA 3DHIC 4NAMA 5D94A 3KUDB 4W9JA 2WU5B 4GU2A 1E8YA 5JHAA 4FJZA 3APFA 4LDTB 1D4BA 1HTOA 2DBYA 3K9PB 1ZOYB 1PGAA 3TSSA 5BO4B 4S17A 2QJLA 3Q3NC 3K9OB 4PS7A 2MX2A 2BWES 1V6EA 1Q0WB 3PHXB 1EU3A 2QDFA 2N4FA 2D3AA 4L1BA 1QOBA 3Q3JA 1SF0A 2CJNA 1ESFA 3DDCB 4W9EA 2ZJDA 3RFZB 3AE2B 1V5OA 3ML8A 5I4DA 1XT9B 1P9DU 2G45B 2L52A 3DWMA 1WI0A 3D32A 3T8MA 3WIMA 2AQ3B 1EO6A 2WS3B 2G1EA 4NQKE 2JXTA 2W54A 3TEZA 2H89B 1R4MI 3V61A 1UZXB 2WXKA 2IGHA 4P7IA 4BBNF 4KDLB 4WWNA 3RYTA 1E8WA 2PJHA 1HZ5A 4JWSC 3UQBA 1N61A 1I4HA 3TL5A 3AULA 3L0WB 4AJYB 5AZFA 1P7FA 4I6NB 3R7RA 1E7UA 1K50A 2WXJA 4ACFA 4LNNA 1F2RC 1V1PB 3P4RB 3BVMA 2PW9A 3OWEB 3AEAB 1WR6E 3Q8EA 4NY0A 2WLBA 2N7EA 2JRIB 4HJGE 1PGXA 1PDXA 1VDVA 4ANVA 1DGJA 2KLCA 2KC1A 5J17A 4MDKE 1UNSA 2LD9A 3PSEB 1F0ZA 3QARA 5FKAC 3L54A 2WDRB 1F52A 3U4EG 1MHHE 4TV3A 1TBEA 1XO3A 1XQQA 3KH0A 4B0MA 5C3JB 4YT0B 5AUKA 2GLSA 1FNVA 1OGWA 4EUTA 4K3BA 3MJWA 4N58A 2C9WB 4W9GA 4BOSC 2N1WA 3OAWA 3MHSD 2L7RA 2RPVA 1UGJA 4A55A 4D2KA 2CJOA 2WU2B 4A3PA 2M19A 5EE1A 1ZXHA 1Z5SB 1RWSA 3PZDA 3CSTA 2D3CA 3C8YA 4H2AA 2CHXA 3WAMA 4CYEA 4KGRA 4NAWA 1XLOA 4P16A 3PT2B 2N7JA 1SGHA 3DVGY 1Z2MA 4W9IA 4I6PA 2VH1A 4ASWC 3BINA 5IKCM 4NAWB 3ZDTA 2V3NA 1ZP0B 2BYEA 5FR6A 2WDTB 2BYTA 3OJ3A 3Q2AC 1P98A 2O6VA 4HPPA 2K1FA 3IAM1 4FJYA 5T8IA 2DZIA 2BS2B 4BOZB 3R7QA 4W9CA 2O6VB 1TKEA 1UBQA 1TZOA 2K8HA 4RGOS 3H8HA 2Y5PA 3B9JA 3LJ3A 2N9PC 2RD0A 3AE8B 3I9V1 1UBIA 4TMAB 2NMQA 3I63C 1V1OA 1VZ6A 2UU7A 4J3OD 2MLBA 4LDTD 2G9HD 4XC2A 1GG3A 1FEHA 3R8BA 2KTRA 3MFGA 2GOWA 1E9MA 3ZGZA 3AU4A 3PTFC 1JMLA 4F8CB 4HPLB 1K53A 1VJKA 4JGHB 1OQQA 1E90A 4GSWA 1JROA 2K5PA 2Y5BB 4DQOC 2YEPF 3V3XA 2AYOB 1Y56A 2NS5A 2KWVB 5D2MB 3UIOB 3FAHA 2IO2B 1KTKA 2QMTA 1WXSA 4K7WA 1IPGA 4B95A 4GDLA 2PKOA 2D5GA 3RMKC 1WZ0A 1L4ZB 4KZ0A 2KTFA 1FRDA 2C7MB 3A33B 4KX6B 3DVNU 3B2GA 1S1QB 1MG8A 3NS1A 2L76A 4UDUC 2JSVX 3AE9B 3RNCC 2Y5CA 1C4CA 3U7DA 2KX3A 4DHJB 1YN4A 4EZKA 2LRUA 3UGBB 3SEBA 1WXAA 2KFJA 1PQSA 1C78A 1WF9A 3RZWC 2C5LC 1EWCA 4X57B 1WGRA 4IWPA 3VQIA 4A8XC 4YSYB 2L05A 2RMMA 2WQYB 3N9YC 1HXYD 3E56A 2KFKB 4K1RB 3ZXRA 3ZKJC 2VRRB 1HZ6A 3SHQA 5C2TB 3A9JB 4EOYA 1PYWD 3PO0A 1GAQB 3KWVA 4IUMB 2I1KA 3Q8FA 3BWUD 1TS5A 4FN2A 2MSED 4A3OA 4JWUC 2HJ8A 1FCCC 3HHMA 4MH0E 3I5JC 4C00A 4HPMB 2UYZB 2X8XX 4JL9A 2HD5B 4M0WA 2BYFA 2KWUB 4KZCA 2KN4A 4DHZE 4P6VF 3SU8X 3AE3B 3B08A 4KIKB 3N30A 2WXIA 1HE8A 2XK5A 4JIOU 4M0WB 2INPE 5HHDG 4B9KA 4IG7B 1NI2A 2LRWA 3QHTA 2XK5B 3UIPB 4G3XB 3NOBA 1SXTA 2KNBA 2DHZA 3EHVA 1GPXA 1KOTA 3AE6B 4WQMA 2LGDA 3Q3FA 4BBNC 5GMVA 4FJVB 1KH0A 3DHGC 3H7SA 4KSKC 2D3GA 3UQAA 1QOAA 1TKYA 1V81A 3FKYA 2GBRA 3QJZA 2QCZA 4ANWA 2W55A 1TKGA 1WYWB 1L2NA 3HM6X 2DAFA 4LK0M 4GB9A 1T0YA 3V60A 1WRIA 3HUIA 2J42A 1CJEA 3N1YC 4E3CA 4USAA 4TQ1A 5TSSA 3ML9A 1F1HA 2LJ5A 5J18A 3L13A 2JVCA 2O6VD 3JVZX 1E8XA 3NUHB 3DBHB 1WGDA 3KVFB 1QZEA 2L8JA 2E3TA 3QQ8B 1UWXA 2KVZA 4RH6A 1VD2A 4URKA 1YJ1A 4II2B 4EKUA 3IT6B 2LFIA 4CHKA 1IP9A 2AEHA 4A6QA 3GB1A 3GZNI 2JZZA 3VUYA 3VVWB 4DXFA 2JWUA 5E6JA 1SIFA 3RCZA 1CMXB 1P0RA 3R2TA 4WWOA 5EE9A 1ZDXA 3QCAA 2KOXA 1L4DB 1C1YB 1ZPSA 4A9AA 3DVNV 1YN5A 3AXCA 4NJCA 2LGYA 4ZHPA 1KLUD 2LXAA 4RF1A 1WXMA 3TEYA 2PIAA 2GBNA 4BVUC 1DYQA 2CKHB 3TJPA 5H8YE 1C4AA 2INCC 1PUTA 2CHZA 2BPSA 3ZIMA 1MPEA 2LGSA 4C4VA 1B9RA 5IP4D 1D5ZC 2KANA 1TT5B 3OLMD 1LQBA 3P4SB 4IC7B 2LI5A 4C4VB 3DBRB 3MJ5A 1TIFA 2MBQA 3ABVB 3AB5A 4XYCA 5LXIB 1NDDA 1VCBA 5G55A 5E6NA 4DHJD 2Z8LA 2LMCA 1F77A 3DBSA 2IJ0A 2IBIB 2NVUI 1QILA 4IW0A 4M8MA 4AUQC 1WY8A 2NPTB 4K3CA 5JH5C 2M1MA 4P1CC 2ZZPB 3CMMB 3HIZA 4JE3B 4US8A 1WM2A 4BFRA 1Q1OA 1SE3A 1LXDA 2ZCBA 3RPFC 2JPHA 3LB8C 4OZAA 1VR9A 4IM3A 1QOGA 3HM3A 5HFYA 2NTTA 2J0MA 2LASA 2LXCA 3NVYA 4C7ZA 4TQ0A 3H6NA 2E6XA 1V80A 3RULA 2KX0A 3EECA 4NNJB 2PEAA 2KMCA 4DWFA 4ZHOA 1E0ZA 1C77A 3NVZA 2IDYA 5KHOA 4YTMB 1QF6A 2K22A 1NYRA 3HK0A 1I42A 2MCNB 1KLVA 2DENB 1FXTB 3N1XC 1TZ1A 1WGGA 2X38A 5G2NA 1N63A 2KC2A 1XD3B 3Q8AA 1EUVB 3TCAA 1AN8A 3UI3A 3AN1A 1WR1A 3B2FA 2BWFA 4XGAB 4MGIE 3V62A 2MBHA 1YIWA
chains in the Genus database with same CATH topology
4HKZE 3P4QB 1VZ7A 1TS2A 1SJHD 4TSSA 3W1SA 3W5VB 1FD6A 2ONQA 1L6VA 2W3SA 3E9SA 1ET9A 2KMMA 1NYQA 1SB3C 3IAM1 2MJ3A 3MP9A 1KLGD 1FO4A 4C56C 3ETRA 5T8IA 1DOYA 2BS2B 3URYA 5G5GA 1TKEA 1N5WA 1TZOA 3ZYYX 5D7GA 1E6EB 1YJIA 2ZW1A 3KQ4A 5BMIA 4RGOS 2XN9C 3H8HA 1SE4A 2Y5PA 1ROEA 4XWWA 2LHDA 1FCLA 2LGIA 1TY0A 3MC0B 3B9JA 2L83A 1XLQA 1SIJA 4ARIA 1WYGA 5D3DA 2DYMA 2KDMA 2AX5A 1KF6B 3AE8B 3I9V1 3BIID 1F2RI 4TMAB 2BT6A 4RGTA 2NMQA 3FILA 1V1OA 1VZ6A 4J3OD 1T5XD 2DLBA 3CIRB 4ZYSA 2G9HD 1TS3A 1FMAD 1FEHA 2BS4B 1QT9A 3AH7A 1AWDA 3FILB 2EELA 3MFGA 1E9MA 3R8BA 3ZGZA 1EWYC 1XXGA 1IBXA 3KWLA 2IGGA 2LJIA 1JW9D 3U52E 2WDQB 1JMLA 3BVZA 4HEA1 3AE5B 1IUEA 1ACCA 2V3PA 2RDGA 1XLPA 1K53A 4RGNA 1DOXA 1VJKA 3IT4B 5BYRA 1HEZE 1OQQA 1HQRD 1JROA 1MI0A 2K5PA 3BK1A 4DQOC 2YEPF 3V3XA 1JWSD 2BB6A 1EU4A 1JWUD 3LXFA 1Y56A 1GB1A 5FK9C 1WSPA 1FXIA 3AEGB 2KACA 3FAHA 1ZE3D 1ZDVA 2RDHA 3AECB 1V8CA 1L5PA 3LYYA 1SEBD 5AUIA 1KTKA 3EUB2 1I4PA 2KAJA 2QMTA 1NENB 2WXOA 2GI9A 4XDCA 1PGBA 1MVKA 4LLGM 3WCQA 1SJED 3Q8BA 1JALA 3AV8A 1J7CA 2PKOA 1K51A 2D5GA 2XNAC 5JXVA 4RNAA 1L4ZB 4Q2JA 2PMVA 1ENFA 1FIQA 1QLBB 2OHFA 1OFFA 4CQNA 1FRDA 2L1AA 4KX6B 1K52A 3B2GA 1CQVA 2JU6X 2JQRB 2WXHA 3NS1A 3HVZA 1C4PA 2PLPA 5HI1A 2WXMA 4UDUC 2JSVX 2VZKB 3AE9B 2K3UA 1CK1A 1TJEA 2SEBD 2W82A 3AMZA 1GOZA 2Y5CA 4KGTA 3SR6A 2N9KA 1C4CA 1YNTE 1KRHA 1RYJA 1T3QA 3HVDA 4C80A 2M56B 2JX5A 2LHEA 1ET6A 1YN4A 3Q69A 4MT5A 2FBWB 2WNMA 1J7AA 3SEBA 2BB5A 1NVID 1XCQL 1FXAA 1C78A 3Q8CA 5EE0A 3AEFB 1QOFA 3BK2A 1B1ZA 4WH4A 4US9A 3ZJUA 2MJEA 1EWCA 3VQIA 1VLBA 4A8XC 2WXGA 1FFUA 4YSYB 2ACZB 4RGMA 2MEKA 1FM0D 3FC4A 5G5HA 2RMMA 3AEDB 2WQYB 1L0YB 4HKQA 3N9YC 1HXYD 1HA5A 2JYEA 2LUMA 5FR3A 3DWGC 3NVWA 3E56A 1AYFA 2WXRA 3AEEB 1I4RA 4RF0A 1IGDA 1JQ4A 4KKIA 3GP7A 4ARCA 1D5XC 3VRAB 4GLSC 5H92C 1RFKA 1HZ6A 3U2SC 1NEKB 2WXQA 4NZLB 5C2TB 2MH7A 1PYWD 4AS1A 1SBBB 3PO0A 1GAQB 3KWVA 3AM9A 4N6EB 1XEEA 1GB4A 2SAKA 3Q8FA 3BWUD 1TS5A 4DXGA 2KQ4X 2L32A 2QSDA 4JWUC 1FCCC 4R3DA 2BS3B 1YMHE 2AQ1B 3W9CB 2GB1A 5MPOA 4REZA 2PVGC 3PZ8A 3SFDB 4M0WA 1R7SA 2I2YA 4WIPA 4EE2A 3TUOA 2KN4A 4P6VF 2BTEA 3AE3B 3BYYB 1YQ4B 2WXIA 1E10A 2N0SB 1V1PA 2INPE 5HHDG 3SFEB 1A70A 3AE7B 5BMHA 3ZJVA 4C7YA 1UWMA 1IBXB 1NI3A 4XE0A 1JWMD 1SXTA 3R2IA 2B76B 1GPXA 3T3NA 2ZW0A 1MHXA 2KWDA 3AE6B 4WQMA 4XWTA 2Q5WD 1D5MC 2WP9B 1KH0A 2I38A 4O1NA 2MJDA 1YJJA 1JWAD 1C79A 1M4VA 2BBCA 5BMGA 4XDDA 1QOAA 1PFDA 2W3RA 1TKYA 5D3IB 1LO5D 3BZDB 3NZ3A 2FUG1 4NAMA 1JWBD 1FRRA 4YTNB 2W55A 1SSNA 1TKGA 1CZPA 2WU5B 3I57A 5GXGB 4LK0M 2QIEB 4IDIA 1QQRA 1STEA 2WXFA 1BXTA 4HROA 1WRIA 3HUIA 2J42A 1CJEA 1FNWA 4GDLB 4USAA 4TQ1A 1D6EC 1D4BA 5TSSA 2DBYA 3VRBB 3TEXA 1ZOYB 1XCTL 1PGAA 4MACA 4MM3B 4ZRQA 3TSSA 4B0EA 3AE1B 2QJLA 1TY2A 4WURA 3NUHB 2V0GA 3V05A 3NVVA 2ON8A 1RM6C 1QKZA 1N62A 1I4XA 1YQ3B 1EU3A 2E3TA 1BUIC 2J52A 1UWXA 4JPSA 4L1BA 2TSSA 4RH6A 1QOBA 1SF0A 2CJNA 1ESFA 2WXNA 3CWIA 3AE4B 1XLNA 1XF5L 2NTSA 3IT6B 2LFIA 4L23A 1V97A 2EKIA 2M0AA 2QILA 3NRZA 2OEDA 3RFZB 3AE2B 4MH8A 3GB1A 3BYTB 4A6QA 3IXSA 1ZXIA 5I4DA 1I4QA 4DXFA 2JWUA 2GRIA 5E6JA 2YEPB 1DOIA 2L52A 3R2TA 2IPKD 3W5UB 3DWMA 4OHJA 4GDKB 2AQ3B 4RFBA 5EE9A 1AW7A 2WS3B 2G1EA 1ZDXA 3HRDD 4AQ7A 2JXTA 1L4DB 2W54A 3TEZA 2H89B 4YSZB 1ZPSA 1WWTA 1YN3A 3T3OA 4A9AA 2WXKA 2HDEA 4HRSA 2IGHA 1Q10A 1YN5A 4NJCA 4ZHPA 1KLUD 4RF1A 1HZ5A 4JWSC 3TEYA 2PIAA 4KGSA 1C9FA 3GS2A 4ITKA 1DYQA 1N61A 1I4HA 3TEWA 1JRPA 4YSXB 5H8YE 1N5XA 2IGDA 1C4AA 3O13A 4A90A 1I4GA 3ZQ4A 1P7FA 1PUTA 1WXQA 1C76A 2QEJC 1MPEA 2BW2A 1K50A 1TS4A 5HG2A 4IOIE 1B9RA 2WXJA 1D5ZC 3PZ7A 1F2RC 4OZBA 2R61A 2WXPA 1V1PB 3P4RB 4OVZA 1OQRA 2JZPA 2PW9A 1VZ8A 3BVMA 3AEAB 3OWEB 3P4SB 5EE3A 2J53A 1IGCA 2VZKD 1FFVA 2H88B 3Q8EA 3MJ5A 1KFYB 3ABVB 1VRAB 3AB5A 2WLBA 4ZOHC 3KLSX 1L6UA 2Z8LA 2LMCA 1F77A 4HJGE 2IJ0A 1PGXA 1PDXA 1VDVA 3P42A 1DGJA 1I7HA 1QILA 1FNUA 1UNSA 4L2YA 4YXDB 5BYQA 2ICIA 2JYTA 1F0ZA 3P63A 5FKAC 3EGRA 2WDRB 4WAFA 3ZJTA 1BMLC 1J7BA 4JE3B 3U4EG 2CU3A 1MHHE 4US8A 2DYOA 1SE3A 2HTME 1XO3A 2FE8A 2N9LA 1E7PB 3RPFC 4B0MA 4JX1C 5C3JB 3VR8B 2WDVB 4YT0B 5AUKA 3LB8C 4OZAA 1VR9A 1FNVA 1QOGA 5HFYA 3J9CA 1N60A 2WXLA 1JCKB 2NTTA 4N58A 3NVYA 4C7ZA 2K0PA 4TQ0A 2PVOD 2RPVA 1T6BX 3P1MA 1UGJA 4OW0A 2E6XA 2V4IB 4A55A 3AEBB 4D2KA 1WGKA 2LEKA 2CJOA 2WU2B 1ZUD2 2Y3AA 4FXCA 4YTPB 2M19A 5EE1A 3MHZA 2K9XA 4PT5A 1ZXHA 4ZHOA 1E0ZA 1RWSA 3IAS1 1C77A 1P7EA 3EA6A 1TYGB 2IDYA 3NVZA 4OZCA 4ZRPA 2AQ2B 4YTMB 1QF6A 2K22A 1NYRA 3W2DA 3C8YA 2PTLA 3BVGA 4H2AA 1L0VB 4N59A 1EM7A 2J4XA 1L0XB 2DWQA 4KGRA 4YWGG 3VR9B 3P4PB 1XLOA 4P16A 5BYSA 4LTUA 2X38A 5LNK1 1N63A 2N7JA 4IKGA 3L4PA 1UUPA 3Q8AA 4KKJA 1AN8A 4NAWB 3UI3A 2V3NA 3AN1A 1ZP0B 3B2FA 1SE2A 3U7ZA 2BYTA 2INNE 4RCOA 4WWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TJE A;  3P4Q B;  3AMZ A;  2Y5C A;  3SR6 A;  3W5V B;  1KRH A;  1RYJ A;  1T3Q A;  4C80 A;  1L6V A;  2W3S A;  1B9R A;  2M56 B;  2JX5 A;  1JWB D;  1FRR A;  2KMM A;  4YTN B;  2W55 A;  1NYQ A;  1SB3 C;  2MJ3 A;  2FBW B;  1DOY A;  1TKG A;  1J7A A;  1CZP A;  3P4R B;  3ETR A;  2WU5 B;  1OQR A;  5EE3 A;  1FO4 A;  2BS2 B;  1NVI D;  3AEA B;  5GXG B;  3P4S B;  1FXA A;  2QIE B;  5G5G A;  1TKE A;  5EE0 A;  4IDI A;  1N5W A;  3AEF B;  1FFV A;  1QOF A;  2H88 B;  4US9 A;  1E6E B;  1YJI A;  3ZYY X;  2MJE A;  4HRO A;  1KFY B;  1WRI A;  3ABV B;  3HUI A;  1CJE A;  3AB5 A;  2WLB A;  4ZOH C;  1ROE A;  4USA A;  1VLB A;  1L6U A;  1FFU A;  4YSY B;  2ACZ B;  3B9J A;  2DBY A;  1XLQ A;  1SIJ A;  2L83 A;  3VRB B;  1FM0 D;  3FC4 A;  1ZOY B;  1PDX A;  1WYG A;  1VDV A;  5G5H A;  1DGJ A;  1I7H A;  3AED B;  2WQY B;  2AX5 A;  1KF6 B;  3AE8 B;  3BII D;  3AE1 B;  2BT6 A;  2QJL A;  4YXD B;  3DWG C;  3NVW A;  1AYF A;  3AEE B;  1JQ4 A;  1F0Z A;  3NVV A;  3P63 A;  3CIR B;  1RM6 C;  1N62 A;  2WDR B;  3AE9 B;  1YQ3 B;  1J7B A;  3VRA B;  2E3T A;  1FMA D;  2CU3 A;  5H92 C;  1RFK A;  4US8 A;  1NEK B;  2BS4 B;  1QT9 A;  3AH7 A;  1AWD A;  1E9M A;  1QOB A;  2MH7 A;  1EWY C;  1SF0 A;  1XO3 A;  2HTM E;  5C2T B;  1E7P B;  2CJN A;  3PO0 A;  1GAQ B;  3RPF C;  3KWL A;  3CWI A;  3AE4 B;  4JX1 C;  5C3J B;  1JW9 D;  1XLN A;  2WDV B;  3AM9 A;  4N6E B;  4YT0 B;  3LB8 C;  2WDQ B;  5AUK A;  3VR8 B;  3AE5 B;  1V97 A;  1QOG A;  1IUE A;  2EKI A;  3NRZ A;  1N60 A;  3AE2 B;  4JWU C;  1XLP A;  1ZXI A;  4N58 A;  3NVY A;  1DOX A;  1VJK A;  4C7Z A;  2BS3 B;  1OQQ A;  3W9C B;  1DOI A;  2PVO D;  5MPO A;  1JRO A;  2PVG C;  2L52 A;  2K5P A;  3P1M A;  3SFD B;  3DWM A;  1R7S A;  3W5U B;  3AEB B;  1WGK A;  2LEK A;  2CJO A;  2WU2 B;  1ZUD 2;  3LXF A;  2WS3 B;  4FXC A;  4P6V F;  2G1E A;  2M19 A;  3AE3 B;  1FXI A;  4YTP B;  5EE1 A;  3HRD D;  3AEG B;  2K9X A;  1YQ4 B;  2W54 A;  2H89 B;  1E10 A;  4YSZ B;  4ZHO A;  1E0Z A;  1RWS A;  3FAH A;  2N0S B;  1WWT A;  3AEC B;  1V8C A;  4A9A A;  1L5P A;  5EE9 A;  5AUI A;  3NVZ A;  1TYG B;  4HRS A;  3SFE B;  3EUB 2;  2KAJ A;  1A70 A;  4YTM B;  1QF6 A;  2K22 A;  3AE7 B;  1NYR A;  1NEN B;  1L0V B;  4N59 A;  4C7Y A;  1UWM A;  3WCQ A;  4ZHP A;  1NI3 A;  1JAL A;  3AV8 A;  1J7C A;  2PKO A;  2DWQ A;  4JWS C;  3VR9 B;  3P4P B;  1XLO A;  2B76 B;  2PIA A;  1GPX A;  4LTU A;  1N63 A;  3AE6 B;  4WQM A;  3L4P A;  4ITK A;  1FIQ A;  1N61 A;  1QLB B;  2Q5W D;  2OHF A;  1OFF A;  2WP9 B;  1FRD A;  4KX6 B;  1JRP A;  4YSX B;  5H8Y E;  1N5X A;  3B2G A;  2MJD A;  1YJJ A;  2JQR B;  3NS1 A;  3HVZ A;  1JWA D;  3AN1 A;  1ZP0 B;  3B2F A;  1PUT A;  1WXQ A;  1QOA A;  1PFD A;  2W3R A;  1TKY A;  4WWM A; 
#chains in the Genus database with same CATH topology
 3P4Q B;  1WGH A;  4TSS A;  3W5V B;  2ONQ A;  2KMM A;  1SB3 C;  2MJ3 A;  3MP9 A;  1KLG D;  2ZCC A;  4HK2 A;  5CTR C;  4C56 C;  1ZW7 A;  4RM8 A;  4LCD E;  1N5W A;  2ZW1 A;  3KQ4 A;  5BMI A;  5DPR A;  1ROE A;  1TY0 A;  1SIJ A;  2CU1 A;  1WYG A;  2KJ6 A;  3QK0 A;  1WE6 A;  3PLU A;  2AX5 A;  3KYD D;  4BKT A;  3OJ4 B;  3FIL A;  4GN1 A;  3EFC A;  2JZ3 B;  1T5X D;  2DLB A;  3CIR B;  1TS3 A;  1FMA D;  3X23 A;  2N9X A;  3AH7 A;  1QT9 A;  2LGX A;  1AWD A;  3FIL B;  1C3T A;  2OOB B;  3M62 B;  4WWP A;  1A5R A;  2LJI A;  4BKS A;  1JW9 D;  1GC6 A;  1K8R B;  2WDQ B;  4ZRK A;  5J2R A;  3MTN B;  2RDG A;  2LVO A;  4IWQ A;  1UH6 A;  1YQB A;  5E6P A;  1DOX A;  2FNJ B;  3A4S C;  1WGY A;  3IT4 B;  4GOC A;  5BYR A;  1HEZ E;  1HQR D;  1T0Q C;  2AL3 A;  2IY1 B;  1MI0 A;  2KD0 A;  3BK1 A;  4NJ6 A;  1JWS D;  1EU4 A;  1JWU D;  3LXF A;  5FK9 C;  4EEW A;  1WSP A;  1FXI A;  2RGF A;  3RI7 C;  4IM2 A;  2KHW B;  2UWQ A;  2KAC A;  1ZE3 D;  1ZDV A;  1V8C A;  2HE7 A;  5E6O A;  3LYY A;  3EUB 2;  2KAJ A;  2MRP A;  5CHV C;  4LLG M;  2V9H A;  3Q8B A;  3AV8 A;  1K51 A;  2XNA C;  3Q14 C;  5DPS A;  1QLB B;  2L1A A;  2WXH A;  3HVZ A;  4EFO A;  2KWC A;  1CK1 A;  2K3U A;  1TJE A;  2W82 A;  4KGT A;  3SR6 A;  1YNT E;  4DDG D;  2JX5 A;  2J0K A;  3Q69 A;  2FBW B;  2WNM A;  4W9D A;  2BB5 A;  1NVI D;  4S0R A;  4OVU A;  4E74 A;  4JQW C;  4AP4 C;  3ZJU A;  2MJE A;  1E5W A;  1WX9 A;  1FFU A;  3NJT A;  2JF5 A;  3H9D A;  4TKN A;  2QC8 A;  3W1S C;  4F1S A;  3DWG C;  3AEE B;  1IGD A;  4YL8 A;  4KKI A;  3GP7 A;  4ARC A;  1KJT A;  3QX1 A;  3U2S C;  1NEK B;  4M02 A;  3PRZ A;  1SBB B;  3APD A;  1M94 A;  2NBW B;  4DXG A;  3ZLZ A;  2L0T A;  3MC9 A;  1V9J A;  2BS3 B;  2KQ7 A;  4XZ4 A;  3EC8 A;  1R7S A;  2I2Y A;  4WIP A;  4EE2 A;  3TUO A;  3H7P A;  1S3S G;  4BZA A;  3BYY B;  2C60 A;  3VTW A;  1YQ4 B;  4I6L B;  3U8Z A;  1BT0 A;  1EF5 A;  2KTR B;  2FID A;  2KDE B;  1UWM A;  4HJK A;  1TTN A;  2M4N A;  4WAA A;  5AZG A;  5JHB A;  2ZPN A;  3GE8 C;  2KWD A;  5C23 A;  2MQJ A;  3VTU A;  2M8S A;  1D5M C;  3WAP A;  4O1N A;  2L3Z A;  3H1U A;  3C19 A;  4FHJ A;  1YJJ A;  1P3Q U;  1C79 A;  1M4V A;  5BMG A;  1PFD A;  2W3R A;  5D3I B;  3DQV A;  4N9F 4;  1LO5 D;  3BY4 B;  1MJD A;  2FUG 1;  1FRR A;  4YTN B;  2FAZ A;  1SSN A;  3NZS A;  3I57 A;  2IND C;  5GXG B;  4LNK A;  2QIE B;  4IDI A;  1UD7 A;  2WXF A;  1BXT A;  3DBL B;  4HRO A;  4GDL B;  1FNW A;  3QA8 A;  5L83 A;  3VRB B;  1WZ3 A;  3TEX A;  4HDO A;  4ZRQ A;  3NZU A;  4B0E A;  3A9K A;  3AE1 B;  4GIV A;  2V0G A;  3V05 A;  3NVV A;  1RM6 C;  1QKZ A;  1N62 A;  1I4X A;  1YQ3 B;  3N20 C;  3T9L A;  3A9K B;  1BUI C;  2J52 A;  1Q5W B;  1YD8 U;  2WXN A;  2Z0E B;  1RRB A;  2WX1 A;  1V97 A;  2EKI A;  3NRZ A;  2OED A;  4W9H A;  3WAL A;  4GXB A;  3BYT B;  3IXS A;  1UGM A;  1ZXI A;  2YLM A;  1F9J A;  2ZNV C;  3RZF A;  2N9E B;  3KUZ A;  2GRI A;  2YEP B;  1DOI A;  2KQS A;  4LNI A;  5IAA C;  3W5U B;  4HXD A;  1SE9 A;  4OHJ A;  2JXX A;  4K7U A;  1LM8 B;  3HRD D;  3AU5 A;  2EMS A;  2D10 A;  4BKS D;  1YN3 A;  3T3O A;  3RNA C;  2HDE A;  4HRS A;  2PE6 B;  1Q10 A;  1E8Z A;  2G4D B;  2ASQ A;  3PVL A;  3SD5 A;  2JT4 B;  3VH3 B;  1D3Z A;  4KGS A;  2V1Y A;  2YVC A;  2RDB C;  2K6D B;  4ITK A;  3IBE A;  3TEW A;  1JRP A;  4YSX B;  1R4N B;  2XEW A;  2FCQ A;  3DCG A;  4A90 A;  1WXQ A;  1Y8R C;  1C76 A;  2KLG A;  3ZNG C;  2WXP A;  1OQR A;  1VZ8 A;  1YOV B;  5AZH A;  5LXH A;  1IGC A;  3ZUN A;  2LVQ A;  2K6Q A;  1VRA B;  4ZOH C;  3PRE A;  5IO9 A;  4EZL A;  3EFU A;  4WJP A;  3DVG X;  1OEY J;  3ZTC A;  4YXD B;  2ICI A;  3ZW3 A;  3ALB A;  1V2Y A;  3L17 A;  2FCM A;  3NG0 A;  4WAF A;  2W9N A;  2G4S A;  1J7B A;  1T0S C;  2CU3 A;  2O2V A;  2DYO A;  1WRD B;  4HLE A;  4KVG B;  2FE8 A;  2N9L A;  1E7P B;  4JX1 C;  3VR8 B;  2IYD B;  2PE9 A;  3LDZ E;  2O2V B;  2KJH B;  2LWP A;  2WXL A;  1JCK B;  1KM7 A;  4II3 B;  4NJ7 A;  1P1A A;  2HTH A;  2IO3 B;  2K0P A;  2PVO D;  1T6B X;  4OW0 A;  2V4I B;  2DZM A;  3AEB B;  3PS6 A;  1WGK A;  2LEK A;  2Y3A A;  1ZUD 2;  4FXC A;  3L08 A;  3QC8 B;  4YTP B;  2NBV B;  5KHQ A;  4PT5 A;  5JZE B;  4HDQ A;  1P7E A;  3EA6 A;  1TYG B;  4OZC A;  1YX6 B;  4ZRP A;  2BVC A;  3W2D A;  2JY6 A;  3U30 A;  3BVG A;  3Q3O C;  1L0V B;  4N59 A;  3RT3 B;  1EM7 A;  4OVV A;  2J4X A;  2V3S A;  1L0X B;  2LUE A;  3P4P B;  1WJU A;  2MBO A;  4LTU A;  1UUP A;  4MGK E;  4KKJ A;  2BKR B;  1I35 A;  3VFK A;  4IWO A;  5CX3 A;  2EMT A;  4BAX A;  2D07 B;  1TS2 A;  1SJH D;  3W1S A;  1FD6 A;  2FIF A;  1L6V A;  2W3S A;  2WYQ A;  3DHH C;  3E9S A;  2OJW A;  3KW5 B;  4CO7 A;  1FO4 A;  3VAW A;  1DOY A;  3URY A;  5L95 C;  3ZYY X;  3IG3 A;  3P2B A;  2DZJ A;  4GMV A;  2LHD A;  4ARI A;  2XBB C;  3ZRF A;  5CHW A;  2GBM A;  3BII D;  1F2R I;  3ZVV A;  2D2Q A;  2J0J A;  1WX7 A;  1WH3 A;  2ZVN A;  1RAX A;  4E71 A;  2BS4 B;  5CHF A;  1XXG A;  1IBX A;  4ICU A;  4WQO B;  3U52 E;  4HEA 1;  1OTR B;  4QAY A;  2RSU A;  2MP2 A;  1J19 A;  4FUL A;  3RNF C;  4LJP B;  2MP2 B;  2KMA A;  4ZDV A;  1TGZ B;  1GB1 A;  3SDL C;  3DBH I;  3AEG B;  3WA0 A;  2WGS A;  2IO0 B;  2G3Q B;  1L5P A;  2MA9 B;  1SEB D;  2M0X A;  1I4P A;  1ZGU B;  1NEN B;  2GI9 A;  4XDC A;  3DPD A;  1MVK A;  1UF0 A;  3WCQ A;  3JYU A;  3AI5 A;  1JAL A;  3N32 A;  1J8C A;  2J7Q B;  4G11 A;  1V86 A;  3RN9 C;  2PMV A;  1ENF A;  1FIQ A;  4CQN A;  1CQV A;  2JQR B;  2JWZ A;  1C4P A;  3C0R B;  2PLP A;  5HI1 A;  2WXM A;  2VZK B;  2SEB D;  1GOZ A;  2MBB B;  3IVF A;  1EF1 A;  2EKE C;  2R2Q A;  1KRH A;  1RYJ A;  1T3Q A;  2BF8 B;  3HVD A;  4MGY E;  4C80 A;  4PYZ A;  1J7A A;  2GBK A;  1XCQ L;  1FXA A;  2AL6 A;  3TBL D;  5EE0 A;  1QOF A;  3UIN B;  2KXJ A;  3BK2 A;  4W9F A;  4HWI B;  4US9 A;  3ZNZ B;  4B6W A;  2WXG A;  2ACZ B;  1LGR A;  4G0N B;  1WJ6 A;  3L10 B;  1FM0 D;  3FC4 A;  5C1Z A;  3WAO A;  3AED B;  1L0Y B;  4WJO A;  1HA5 A;  2LUM A;  2WXR A;  1I4R A;  1JQ4 A;  3JW0 X;  1D5X C;  2ZNV B;  3VRA B;  4GLS C;  1RFK A;  2WXQ A;  2LZ6 A;  4AS1 A;  2ZPY A;  4N6E B;  1XEE A;  1GB4 A;  2L32 A;  2QSD A;  3M95 A;  1IYF A;  3DBR I;  4LJO B;  2JUO A;  1WIA A;  2K8C A;  3GE3 C;  3VUW A;  1YMH E;  2AQ1 B;  3W9C B;  2GB1 A;  1V49 A;  3M63 B;  2PVG C;  4REZ A;  1WX8 A;  3PZ8 A;  2ZEQ A;  4ZRI A;  3ZNH B;  3NY5 A;  1E10 A;  2N0S B;  2DYB A;  1V1P A;  3VDZ A;  3SFE B;  4F7Z A;  3AE7 B;  5BMH A;  2MBE A;  3ZJV A;  2IZV B;  2MWS B;  4C7Y A;  1NI3 A;  4XE0 A;  1RFA A;  3S2A A;  2B76 B;  2ZW0 A;  2IY0 B;  2K39 A;  4XWT A;  3UF8 A;  3X0W A;  2K8B A;  2Q5W D;  5IOI A;  2MJD A;  2KKC A;  1JWA D;  4RMA A;  2LVP A;  3PV1 A;  4XDD A;  4PYU A;  3V6C B;  2CHW A;  3BZD B;  3NZ3 A;  3RNG C;  1JWB D;  3R3M A;  2KT7 A;  3W1Y A;  3NHE B;  1CZP A;  1OEY A;  1ISN A;  2DAJ A;  1QQR A;  1STE A;  4MM3 A;  4FHK A;  1D6E C;  1MFW A;  1XCT L;  4MAC A;  4MM3 B;  2Z59 B;  3RD2 A;  3PRM B;  1TY2 A;  4WUR A;  2N7D A;  1MG4 A;  2ON8 A;  2WX0 A;  3I3T B;  4NPN A;  2KDB A;  4JPS A;  2TSS A;  2KYW A;  3CWI A;  3AE4 B;  1XLN A;  1XF5 L;  2KO3 A;  2NTS A;  1V5T A;  4L23 A;  1WXV A;  2AWT A;  2M0A A;  2QIL A;  3RNB C;  3ZO5 B;  1YX5 B;  3O65 B;  4MH8 A;  4GDK A;  1I4Q A;  2BQQ A;  2KK8 A;  3ECI A;  1GNU A;  1GC7 A;  2IPK D;  1G6J A;  4GDK B;  4RFB A;  4KV2 A;  2KZR A;  1U4A A;  1AW7 A;  4ZRJ A;  4AQ7 A;  3Q6B A;  3ZXV A;  2M17 A;  4YSZ B;  3KUC B;  1WWT A;  3VTV A;  1H4R A;  5IA7 A;  2DNF A;  3M3J A;  1C9F A;  3GS2 A;  1OQY A;  2BGF A;  1WM3 A;  3ONS A;  4EZJ A;  4FBJ B;  1N5X A;  2IGD A;  3O13 A;  4ANX A;  1I4G A;  4DHZ B;  2NR2 A;  3ZQ4 A;  4NQL B;  4HVB A;  2QEJ C;  2BW2 A;  3ENE A;  3H7P B;  2FCN A;  2CR5 A;  1TS4 A;  5HG2 A;  4IOI E;  3PZ7 A;  2KJR A;  3RUI B;  4OZB A;  2R61 A;  4AOF A;  4OVZ A;  2JZP A;  5EE3 A;  4MJS A;  2J53 A;  5IN7 A;  3N1Z C;  2VZK D;  1FFV A;  2H88 B;  1KFY B;  5EDS A;  3KLS X;  1L6U A;  4MJS B;  3P42 A;  1I7H A;  2R2O A;  4MEM A;  2GMI C;  1LFD A;  1FNU A;  4L2Y A;  1H8C A;  4K81 A;  5BYQ A;  2JYT A;  5D6J B;  3P63 A;  3EGR A;  3ZJT A;  1WE7 A;  1BML C;  4KDI C;  1JRU A;  2A4Z A;  2HTM E;  3Q3M C;  3B1L X;  1WFY A;  2WDV B;  3A4R A;  4MEL A;  3J9C A;  1N60 A;  4FLH A;  4A20 A;  2K25 A;  3P1M A;  3ZTD A;  3WAN A;  5DPW A;  3MHZ A;  2WHI A;  2K9X A;  4PS3 A;  3APC A;  3IAS 1;  2V4L A;  2JRH A;  2AQ2 B;  3ZNI D;  2PTL A;  4W9L A;  3QIJ A;  5LLI A;  2DWQ A;  2WWZ A;  4YWG G;  2REX A;  3VR9 B;  2L0F A;  5BYS A;  5LNK 1;  4IKG A;  3L4P A;  4XX5 A;  3CF6 E;  2GBJ A;  1ZKH A;  3TIX A;  2KFK A;  3PGE A;  1SE2 A;  3U7Z A;  2INN E;  4RCO A;  4WWM A;  4HKZ E;  1VZ7 A;  1X1M A;  1ET9 A;  1NYQ A;  3A9J A;  3ETR A;  5G5G A;  2N1V A;  3GZN B;  3ZRC A;  5D7G A;  1E6E B;  1YJI A;  1FPY A;  4HCP B;  2XN9 C;  1SE4 A;  4XWW A;  1FCL A;  2KVR A;  2LGI A;  3MC0 B;  2L00 B;  1NBF C;  1XLQ A;  2L83 A;  2C7N B;  5D3D A;  2DYM A;  2KDM A;  4MSM B;  1KF6 B;  2BT6 A;  1HTQ A;  4RGT A;  3PHW B;  2CS4 A;  4KIK A;  4AJW A;  1UEL A;  5DPT A;  4ZYS A;  4JLC A;  2B3A A;  2Z0D B;  2EEL A;  1EWY C;  4M01 A;  3KWL A;  2IGG A;  2PPH A;  2D3B A;  3BVZ A;  3AE5 B;  1IUE A;  4G50 A;  1ACC A;  2KDI A;  4PS8 A;  2V3P A;  3DBL I;  3NS8 A;  1XLP A;  4J6I A;  4RGN A;  3V6E B;  4P1B C;  2NBU A;  4MGZ E;  1N6Z A;  3QWZ B;  2BB6 A;  2KDF B;  3R66 C;  4PK1 A;  2RDH A;  3AEC B;  2MHJ A;  4AWJ A;  5AUI A;  2WXO A;  1PGB A;  4W9K A;  4RM9 A;  2KN5 A;  1SJE D;  1J7C A;  3VHT C;  4DBG A;  5JXV A;  4RNA A;  4Q2J A;  2MW5 A;  2OHF A;  1OFF A;  2VH2 A;  4M8N A;  1K52 A;  2BKF A;  2JU6 X;  3GOE A;  1GUA B;  4HCN B;  3AMZ A;  1T0R C;  1WJ4 A;  2N9K A;  2M56 B;  2LHE A;  1ET6 A;  4K7S A;  1AAR A;  2DX5 B;  4MT5 A;  2NCN A;  4DDI D;  3CSF A;  2RR9 A;  3Q8C A;  4M00 A;  3AEF B;  3TMP B;  1B1Z A;  4WH4 A;  1WJN A;  4LNO A;  3DOW A;  3L16 A;  3QAQ A;  1VLB A;  1RLF A;  4RGM A;  4IM0 A;  2MEK A;  4FA6 A;  5G5H A;  3JSV A;  1WMH A;  4HKQ A;  1GJZ A;  2JYE A;  3OG5 A;  2I1J A;  1L7Y A;  5FR3 A;  3NVW A;  2FCS A;  1AYF A;  1R4N I;  4DK5 A;  4RF0 A;  2OJR A;  3VXW A;  3JSV B;  4LNF A;  1WMH B;  2QHO A;  5H92 C;  4BKG A;  2HJ1 A;  3PPA A;  4NZL B;  2DZK A;  2MH7 A;  4MSQ B;  3VH4 B;  4ICV A;  3AM9 A;  4GGQ A;  2SAK A;  5AEK B;  2KQ4 X;  2FUH B;  4R3D A;  3PLV A;  4DXA B;  2D11 A;  4ANU A;  5MPO A;  3N3K B;  1R4M B;  4KSL C;  3SFD B;  3IFW B;  4ZYN A;  2IO1 B;  1E7V A;  3IHP C;  2BYV E;  2BTE A;  5TR5 A;  2ZVO A;  2A5U A;  1J0G A;  3B0A A;  1A70 A;  5DCN A;  3KYC D;  1IBX B;  1JWM D;  3VUX A;  3R2I A;  2C7H A;  3T3N A;  1MHX A;  5HKH A;  4FAD A;  3RNE C;  3A1Q A;  2RPQ A;  3PRP B;  2WP9 B;  3ZDM C;  2I38 A;  2NPT A;  4TUU A;  2BBC A;  3MC8 A;  4WJQ A;  3A1Q B;  4WJN A;  3DHI C;  4NAM A;  5D94 A;  3KUD B;  4W9J A;  2WU5 B;  4GU2 A;  1E8Y A;  5JHA A;  4FJZ A;  3APF A;  4LDT B;  1D4B A;  1HTO A;  2DBY A;  3K9P B;  1ZOY B;  1PGA A;  3TSS A;  5BO4 B;  4S17 A;  2QJL A;  3Q3N C;  3K9O B;  4PS7 A;  2MX2 A;  2BWE S;  1V6E A;  1Q0W B;  3PHX B;  1EU3 A;  2QDF A;  2N4F A;  2D3A A;  4L1B A;  1QOB A;  3Q3J A;  1SF0 A;  2CJN A;  1ESF A;  3DDC B;  4W9E A;  2ZJD A;  3RFZ B;  3AE2 B;  1V5O A;  3ML8 A;  5I4D A;  1XT9 B;  1P9D U;  2G45 B;  2L52 A;  3DWM A;  1WI0 A;  3D32 A;  3T8M A;  3WIM A;  2AQ3 B;  1EO6 A;  2WS3 B;  2G1E A;  4NQK E;  2JXT A;  2W54 A;  3TEZ A;  2H89 B;  1R4M I;  3V61 A;  1UZX B;  2WXK A;  2IGH A;  4P7I A;  4BBN F;  4KDL B;  4WWN A;  3RYT A;  1E8W A;  2PJH A;  1HZ5 A;  4JWS C;  3UQB A;  1N61 A;  1I4H A;  3TL5 A;  3AUL A;  3L0W B;  4AJY B;  5AZF A;  1P7F A;  4I6N B;  3R7R A;  1E7U A;  1K50 A;  2WXJ A;  4ACF A;  4LNN A;  1F2R C;  1V1P B;  3P4R B;  3BVM A;  2PW9 A;  3OWE B;  3AEA B;  1WR6 E;  3Q8E A;  4NY0 A;  2WLB A;  2N7E A;  2JRI B;  4HJG E;  1PGX A;  1PDX A;  1VDV A;  4ANV A;  1DGJ A;  2KLC A;  2KC1 A;  5J17 A;  4MDK E;  1UNS A;  2LD9 A;  3PSE B;  1F0Z A;  3QAR A;  5FKA C;  3L54 A;  2WDR B;  1F52 A;  3U4E G;  1MHH E;  4TV3 A;  1TBE A;  1XO3 A;  1XQQ A;  3KH0 A;  4B0M A;  5C3J B;  4YT0 B;  5AUK A;  2GLS A;  1FNV A;  1OGW A;  4EUT A;  4K3B A;  3MJW A;  4N58 A;  2C9W B;  4W9G A;  4BOS C;  2N1W A;  3OAW A;  3MHS D;  2L7R A;  2RPV A;  1UGJ A;  4A55 A;  4D2K A;  2CJO A;  2WU2 B;  4A3P A;  2M19 A;  5EE1 A;  1ZXH A;  1Z5S B;  1RWS A;  3PZD A;  3CST A;  2D3C A;  3C8Y A;  4H2A A;  2CHX A;  3WAM A;  4CYE A;  4KGR A;  4NAW A;  1XLO A;  4P16 A;  3PT2 B;  2N7J A;  1SGH A;  3DVG Y;  1Z2M A;  4W9I A;  4I6P A;  2VH1 A;  4ASW C;  3BIN A;  5IKC M;  4NAW B;  3ZDT A;  2V3N A;  1ZP0 B;  2BYE A;  5FR6 A;  2WDT B;  2BYT A;  3OJ3 A;  3Q2A C;  1P98 A;  2O6V A;  4HPP A;  2K1F A;  3IAM 1;  4FJY A;  5T8I A;  2DZI A;  2BS2 B;  4BOZ B;  3R7Q A;  4W9C A;  2O6V B;  1TKE A;  1UBQ A;  1TZO A;  2K8H A;  4RGO S;  3H8H A;  2Y5P A;  3B9J A;  3LJ3 A;  2N9P C;  2RD0 A;  3AE8 B;  3I9V 1;  1UBI A;  4TMA B;  2NMQ A;  3I63 C;  1V1O A;  1VZ6 A;  2UU7 A;  4J3O D;  2MLB A;  4LDT D;  2G9H D;  4XC2 A;  1GG3 A;  1FEH A;  3R8B A;  2KTR A;  3MFG A;  2GOW A;  1E9M A;  3ZGZ A;  3AU4 A;  3PTF C;  1JML A;  4F8C B;  4HPL B;  1K53 A;  1VJK A;  4JGH B;  1OQQ A;  1E90 A;  4GSW A;  1JRO A;  2K5P A;  2Y5B B;  4DQO C;  2YEP F;  3V3X A;  2AYO B;  1Y56 A;  2NS5 A;  2KWV B;  5D2M B;  3UIO B;  3FAH A;  2IO2 B;  1KTK A;  2QMT A;  1WXS A;  4K7W A;  1IPG A;  4B95 A;  4GDL A;  2PKO A;  2D5G A;  3RMK C;  1WZ0 A;  1L4Z B;  4KZ0 A;  2KTF A;  1FRD A;  2C7M B;  3A33 B;  4KX6 B;  3DVN U;  3B2G A;  1S1Q B;  1MG8 A;  3NS1 A;  2L76 A;  4UDU C;  2JSV X;  3AE9 B;  3RNC C;  2Y5C A;  1C4C A;  3U7D A;  2KX3 A;  4DHJ B;  1YN4 A;  4EZK A;  2LRU A;  3UGB B;  3SEB A;  1WXA A;  2KFJ A;  1PQS A;  1C78 A;  1WF9 A;  3RZW C;  2C5L C;  1EWC A;  4X57 B;  1WGR A;  4IWP A;  3VQI A;  4A8X C;  4YSY B;  2L05 A;  2RMM A;  2WQY B;  3N9Y C;  1HXY D;  3E56 A;  2KFK B;  4K1R B;  3ZXR A;  3ZKJ C;  2VRR B;  1HZ6 A;  3SHQ A;  5C2T B;  3A9J B;  4EOY A;  1PYW D;  3PO0 A;  1GAQ B;  3KWV A;  4IUM B;  2I1K A;  3Q8F A;  3BWU D;  1TS5 A;  4FN2 A;  2MSE D;  4A3O A;  4JWU C;  2HJ8 A;  1FCC C;  3HHM A;  4MH0 E;  3I5J C;  4C00 A;  4HPM B;  2UYZ B;  2X8X X;  4JL9 A;  2HD5 B;  4M0W A;  2BYF A;  2KWU B;  4KZC A;  2KN4 A;  4DHZ E;  4P6V F;  3SU8 X;  3AE3 B;  3B08 A;  4KIK B;  3N30 A;  2WXI A;  1HE8 A;  2XK5 A;  4JIO U;  4M0W B;  2INP E;  5HHD G;  4B9K A;  4IG7 B;  1NI2 A;  2LRW A;  3QHT A;  2XK5 B;  3UIP B;  4G3X B;  3NOB A;  1SXT A;  2KNB A;  2DHZ A;  3EHV A;  1GPX A;  1KOT A;  3AE6 B;  4WQM A;  2LGD A;  3Q3F A;  4BBN C;  5GMV A;  4FJV B;  1KH0 A;  3DHG C;  3H7S A;  4KSK C;  2D3G A;  3UQA A;  1QOA A;  1TKY A;  1V81 A;  3FKY A;  2GBR A;  3QJZ A;  2QCZ A;  4ANW A;  2W55 A;  1TKG A;  1WYW B;  1L2N A;  3HM6 X;  2DAF A;  4LK0 M;  4GB9 A;  1T0Y A;  3V60 A;  1WRI A;  3HUI A;  2J42 A;  1CJE A;  3N1Y C;  4E3C A;  4USA A;  4TQ1 A;  5TSS A;  3ML9 A;  1F1H A;  2LJ5 A;  5J18 A;  3L13 A;  2JVC A;  2O6V D;  3JVZ X;  1E8X A;  3NUH B;  3DBH B;  1WGD A;  3KVF B;  1QZE A;  2L8J A;  2E3T A;  3QQ8 B;  1UWX A;  2KVZ A;  4RH6 A;  1VD2 A;  4URK A;  1YJ1 A;  4II2 B;  4EKU A;  3IT6 B;  2LFI A;  4CHK A;  1IP9 A;  2AEH A;  4A6Q A;  3GB1 A;  3GZN I;  2JZZ A;  3VUY A;  3VVW B;  4DXF A;  2JWU A;  5E6J A;  1SIF A;  3RCZ A;  1CMX B;  1P0R A;  3R2T A;  4WWO A;  5EE9 A;  1ZDX A;  3QCA A;  2KOX A;  1L4D B;  1C1Y B;  1ZPS A;  4A9A A;  3DVN V;  1YN5 A;  3AXC A;  4NJC A;  2LGY A;  4ZHP A;  1KLU D;  2LXA A;  4RF1 A;  1WXM A;  3TEY A;  2PIA A;  2GBN A;  4BVU C;  1DYQ A;  2CKH B;  3TJP A;  5H8Y E;  1C4A A;  2INC C;  1PUT A;  2CHZ A;  2BPS A;  3ZIM A;  1MPE A;  2LGS A;  4C4V A;  1B9R A;  5IP4 D;  1D5Z C;  2KAN A;  1TT5 B;  3OLM D;  1LQB A;  3P4S B;  4IC7 B;  2LI5 A;  4C4V B;  3DBR B;  3MJ5 A;  1TIF A;  2MBQ A;  3ABV B;  3AB5 A;  4XYC A;  5LXI B;  1NDD A;  1VCB A;  5G55 A;  5E6N A;  4DHJ D;  2Z8L A;  2LMC A;  1F77 A;  3DBS A;  2IJ0 A;  2IBI B;  2NVU I;  1QIL A;  4IW0 A;  4M8M A;  4AUQ C;  1WY8 A;  2NPT B;  4K3C A;  5JH5 C;  2M1M A;  4P1C C;  2ZZP B;  3CMM B;  3HIZ A;  4JE3 B;  4US8 A;  1WM2 A;  4BFR A;  1Q1O A;  1SE3 A;  1LXD A;  2ZCB A;  3RPF C;  2JPH A;  3LB8 C;  4OZA A;  1VR9 A;  4IM3 A;  1QOG A;  3HM3 A;  5HFY A;  2NTT A;  2J0M A;  2LAS A;  2LXC A;  3NVY A;  4C7Z A;  4TQ0 A;  3H6N A;  2E6X A;  1V80 A;  3RUL A;  2KX0 A;  3EEC A;  4NNJ B;  2PEA A;  2KMC A;  4DWF A;  4ZHO A;  1E0Z A;  1C77 A;  3NVZ A;  2IDY A;  5KHO A;  4YTM B;  1QF6 A;  2K22 A;  1NYR A;  3HK0 A;  1I42 A;  2MCN B;  1KLV A;  2DEN B;  1FXT B;  3N1X C;  1TZ1 A;  1WGG A;  2X38 A;  5G2N A;  1N63 A;  2KC2 A;  1XD3 B;  3Q8A A;  1EUV B;  3TCA A;  1AN8 A;  3UI3 A;  3AN1 A;  1WR1 A;  3B2F A;  2BWF A;  4XGA B;  4MGI E;  3V62 A;  2MBH A;  1YIW A; 
#chains in the Genus database with same CATH homology
 4HKZ E;  3P4Q B;  1VZ7 A;  1TS2 A;  1SJH D;  4TSS A;  3W1S A;  3W5V B;  1FD6 A;  2ONQ A;  1L6V A;  2W3S A;  3E9S A;  1ET9 A;  2KMM A;  1NYQ A;  1SB3 C;  3IAM 1;  2MJ3 A;  3MP9 A;  1KLG D;  1FO4 A;  4C56 C;  3ETR A;  5T8I A;  1DOY A;  2BS2 B;  3URY A;  5G5G A;  1TKE A;  1N5W A;  1TZO A;  3ZYY X;  5D7G A;  1E6E B;  1YJI A;  2ZW1 A;  3KQ4 A;  5BMI A;  4RGO S;  2XN9 C;  3H8H A;  1SE4 A;  2Y5P A;  1ROE A;  4XWW A;  2LHD A;  1FCL A;  2LGI A;  1TY0 A;  3MC0 B;  3B9J A;  2L83 A;  1XLQ A;  1SIJ A;  4ARI A;  1WYG A;  5D3D A;  2DYM A;  2KDM A;  2AX5 A;  1KF6 B;  3AE8 B;  3I9V 1;  3BII D;  1F2R I;  4TMA B;  2BT6 A;  4RGT A;  2NMQ A;  3FIL A;  1V1O A;  1VZ6 A;  4J3O D;  1T5X D;  2DLB A;  3CIR B;  4ZYS A;  2G9H D;  1TS3 A;  1FMA D;  1FEH A;  2BS4 B;  1QT9 A;  3AH7 A;  1AWD A;  3FIL B;  2EEL A;  3MFG A;  1E9M A;  3R8B A;  3ZGZ A;  1EWY C;  1XXG A;  1IBX A;  3KWL A;  2IGG A;  2LJI A;  1JW9 D;  3U52 E;  2WDQ B;  1JML A;  3BVZ A;  4HEA 1;  3AE5 B;  1IUE A;  1ACC A;  2V3P A;  2RDG A;  1XLP A;  1K53 A;  4RGN A;  1DOX A;  1VJK A;  3IT4 B;  5BYR A;  1HEZ E;  1OQQ A;  1HQR D;  1JRO A;  1MI0 A;  2K5P A;  3BK1 A;  4DQO C;  2YEP F;  3V3X A;  1JWS D;  2BB6 A;  1EU4 A;  1JWU D;  3LXF A;  1Y56 A;  1GB1 A;  5FK9 C;  1WSP A;  1FXI A;  3AEG B;  2KAC A;  3FAH A;  1ZE3 D;  1ZDV A;  2RDH A;  3AEC B;  1V8C A;  1L5P A;  3LYY A;  1SEB D;  5AUI A;  1KTK A;  3EUB 2;  1I4P A;  2KAJ A;  2QMT A;  1NEN B;  2WXO A;  2GI9 A;  4XDC A;  1PGB A;  1MVK A;  4LLG M;  3WCQ A;  1SJE D;  3Q8B A;  1JAL A;  3AV8 A;  1J7C A;  2PKO A;  1K51 A;  2D5G A;  2XNA C;  5JXV A;  4RNA A;  1L4Z B;  4Q2J A;  2PMV A;  1ENF A;  1FIQ A;  1QLB B;  2OHF A;  1OFF A;  4CQN A;  1FRD A;  2L1A A;  4KX6 B;  1K52 A;  3B2G A;  1CQV A;  2JU6 X;  2JQR B;  2WXH A;  3NS1 A;  3HVZ A;  1C4P A;  2PLP A;  5HI1 A;  2WXM A;  4UDU C;  2JSV X;  2VZK B;  3AE9 B;  2K3U A;  1CK1 A;  1TJE A;  2SEB D;  2W82 A;  3AMZ A;  1GOZ A;  2Y5C A;  4KGT A;  3SR6 A;  2N9K A;  1C4C A;  1YNT E;  1KRH A;  1RYJ A;  1T3Q A;  3HVD A;  4C80 A;  2M56 B;  2JX5 A;  2LHE A;  1ET6 A;  1YN4 A;  3Q69 A;  4MT5 A;  2FBW B;  2WNM A;  1J7A A;  3SEB A;  2BB5 A;  1NVI D;  1XCQ L;  1FXA A;  1C78 A;  3Q8C A;  5EE0 A;  3AEF B;  1QOF A;  3BK2 A;  1B1Z A;  4WH4 A;  4US9 A;  3ZJU A;  2MJE A;  1EWC A;  3VQI A;  1VLB A;  4A8X C;  2WXG A;  1FFU A;  4YSY B;  2ACZ B;  4RGM A;  2MEK A;  1FM0 D;  3FC4 A;  5G5H A;  2RMM A;  3AED B;  2WQY B;  1L0Y B;  4HKQ A;  3N9Y C;  1HXY D;  1HA5 A;  2JYE A;  2LUM A;  5FR3 A;  3DWG C;  3NVW A;  3E56 A;  1AYF A;  2WXR A;  3AEE B;  1I4R A;  4RF0 A;  1IGD A;  1JQ4 A;  4KKI A;  3GP7 A;  4ARC A;  1D5X C;  3VRA B;  4GLS C;  5H92 C;  1RFK A;  1HZ6 A;  3U2S C;  1NEK B;  2WXQ A;  4NZL B;  5C2T B;  2MH7 A;  1PYW D;  4AS1 A;  1SBB B;  3PO0 A;  1GAQ B;  3KWV A;  3AM9 A;  4N6E B;  1XEE A;  1GB4 A;  2SAK A;  3Q8F A;  3BWU D;  1TS5 A;  4DXG A;  2KQ4 X;  2L32 A;  2QSD A;  4JWU C;  1FCC C;  4R3D A;  2BS3 B;  1YMH E;  2AQ1 B;  3W9C B;  2GB1 A;  5MPO A;  4REZ A;  2PVG C;  3PZ8 A;  3SFD B;  4M0W A;  1R7S A;  2I2Y A;  4WIP A;  4EE2 A;  3TUO A;  2KN4 A;  4P6V F;  2BTE A;  3AE3 B;  3BYY B;  1YQ4 B;  2WXI A;  1E10 A;  2N0S B;  1V1P A;  2INP E;  5HHD G;  3SFE B;  1A70 A;  3AE7 B;  5BMH A;  3ZJV A;  4C7Y A;  1UWM A;  1IBX B;  1NI3 A;  4XE0 A;  1JWM D;  1SXT A;  3R2I A;  2B76 B;  1GPX A;  3T3N A;  2ZW0 A;  1MHX A;  2KWD A;  3AE6 B;  4WQM A;  4XWT A;  2Q5W D;  1D5M C;  2WP9 B;  1KH0 A;  2I38 A;  4O1N A;  2MJD A;  1YJJ A;  1JWA D;  1C79 A;  1M4V A;  2BBC A;  5BMG A;  4XDD A;  1QOA A;  1PFD A;  2W3R A;  1TKY A;  5D3I B;  1LO5 D;  3BZD B;  3NZ3 A;  2FUG 1;  4NAM A;  1JWB D;  1FRR A;  4YTN B;  2W55 A;  1SSN A;  1TKG A;  1CZP A;  2WU5 B;  3I57 A;  5GXG B;  4LK0 M;  2QIE B;  4IDI A;  1QQR A;  1STE A;  2WXF A;  1BXT A;  4HRO A;  1WRI A;  3HUI A;  2J42 A;  1CJE A;  1FNW A;  4GDL B;  4USA A;  4TQ1 A;  1D6E C;  1D4B A;  5TSS A;  2DBY A;  3VRB B;  3TEX A;  1ZOY B;  1XCT L;  1PGA A;  4MAC A;  4MM3 B;  4ZRQ A;  3TSS A;  4B0E A;  3AE1 B;  2QJL A;  1TY2 A;  4WUR A;  3NUH B;  2V0G A;  3V05 A;  3NVV A;  2ON8 A;  1RM6 C;  1QKZ A;  1N62 A;  1I4X A;  1YQ3 B;  1EU3 A;  2E3T A;  1BUI C;  2J52 A;  1UWX A;  4JPS A;  4L1B A;  2TSS A;  4RH6 A;  1QOB A;  1SF0 A;  2CJN A;  1ESF A;  2WXN A;  3CWI A;  3AE4 B;  1XLN A;  1XF5 L;  2NTS A;  3IT6 B;  2LFI A;  4L23 A;  1V97 A;  2EKI A;  2M0A A;  2QIL A;  3NRZ A;  2OED A;  3RFZ B;  3AE2 B;  4MH8 A;  3GB1 A;  3BYT B;  4A6Q A;  3IXS A;  1ZXI A;  5I4D A;  1I4Q A;  4DXF A;  2JWU A;  2GRI A;  5E6J A;  2YEP B;  1DOI A;  2L52 A;  3R2T A;  2IPK D;  3W5U B;  3DWM A;  4OHJ A;  4GDK B;  2AQ3 B;  4RFB A;  5EE9 A;  1AW7 A;  2WS3 B;  2G1E A;  1ZDX A;  3HRD D;  4AQ7 A;  2JXT A;  1L4D B;  2W54 A;  3TEZ A;  2H89 B;  4YSZ B;  1ZPS A;  1WWT A;  1YN3 A;  3T3O A;  4A9A A;  2WXK A;  2HDE A;  4HRS A;  2IGH A;  1Q10 A;  1YN5 A;  4NJC A;  4ZHP A;  1KLU D;  4RF1 A;  1HZ5 A;  4JWS C;  3TEY A;  2PIA A;  4KGS A;  1C9F A;  3GS2 A;  4ITK A;  1DYQ A;  1N61 A;  1I4H A;  3TEW A;  1JRP A;  4YSX B;  5H8Y E;  1N5X A;  2IGD A;  1C4A A;  3O13 A;  4A90 A;  1I4G A;  3ZQ4 A;  1P7F A;  1PUT A;  1WXQ A;  1C76 A;  2QEJ C;  1MPE A;  2BW2 A;  1K50 A;  1TS4 A;  5HG2 A;  4IOI E;  1B9R A;  2WXJ A;  1D5Z C;  3PZ7 A;  1F2R C;  4OZB A;  2R61 A;  2WXP A;  1V1P B;  3P4R B;  4OVZ A;  1OQR A;  2JZP A;  2PW9 A;  1VZ8 A;  3BVM A;  3AEA B;  3OWE B;  3P4S B;  5EE3 A;  2J53 A;  1IGC A;  2VZK D;  1FFV A;  2H88 B;  3Q8E A;  3MJ5 A;  1KFY B;  3ABV B;  1VRA B;  3AB5 A;  2WLB A;  4ZOH C;  3KLS X;  1L6U A;  2Z8L A;  2LMC A;  1F77 A;  4HJG E;  2IJ0 A;  1PGX A;  1PDX A;  1VDV A;  3P42 A;  1DGJ A;  1I7H A;  1QIL A;  1FNU A;  1UNS A;  4L2Y A;  4YXD B;  5BYQ A;  2ICI A;  2JYT A;  1F0Z A;  3P63 A;  5FKA C;  3EGR A;  2WDR B;  4WAF A;  3ZJT A;  1BML C;  1J7B A;  4JE3 B;  3U4E G;  2CU3 A;  1MHH E;  4US8 A;  2DYO A;  1SE3 A;  2HTM E;  1XO3 A;  2FE8 A;  2N9L A;  1E7P B;  3RPF C;  4B0M A;  4JX1 C;  5C3J B;  3VR8 B;  2WDV B;  4YT0 B;  5AUK A;  3LB8 C;  4OZA A;  1VR9 A;  1FNV A;  1QOG A;  5HFY A;  3J9C A;  1N60 A;  2WXL A;  1JCK B;  2NTT A;  4N58 A;  3NVY A;  4C7Z A;  2K0P A;  4TQ0 A;  2PVO D;  2RPV A;  1T6B X;  3P1M A;  1UGJ A;  4OW0 A;  2E6X A;  2V4I B;  4A55 A;  3AEB B;  4D2K A;  1WGK A;  2LEK A;  2CJO A;  2WU2 B;  1ZUD 2;  2Y3A A;  4FXC A;  4YTP B;  2M19 A;  5EE1 A;  3MHZ A;  2K9X A;  4PT5 A;  1ZXH A;  4ZHO A;  1E0Z A;  1RWS A;  3IAS 1;  1C77 A;  1P7E A;  3EA6 A;  1TYG B;  2IDY A;  3NVZ A;  4OZC A;  4ZRP A;  2AQ2 B;  4YTM B;  1QF6 A;  2K22 A;  1NYR A;  3W2D A;  3C8Y A;  2PTL A;  3BVG A;  4H2A A;  1L0V B;  4N59 A;  1EM7 A;  2J4X A;  1L0X B;  2DWQ A;  4KGR A;  4YWG G;  3VR9 B;  3P4P B;  1XLO A;  4P16 A;  5BYS A;  4LTU A;  2X38 A;  5LNK 1;  1N63 A;  2N7J A;  4IKG A;  3L4P A;  1UUP A;  3Q8A A;  4KKJ A;  1AN8 A;  4NAW B;  3UI3 A;  2V3N A;  3AN1 A;  1ZP0 B;  3B2F A;  1SE2 A;  3U7Z A;  2BYT A;  2INN E;  4RCO A;  4WWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...