2HTME

Crystal structure of ttha0676 from thermus thermophilus hb8
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
64
structure length
64
Chain Sequence
MVWLNGEPRPLEGKTLKEVLEEMGVELKGVAVLLNEEAFLGLEVPDRPLRDGDVVEVVALMQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiazole biosynthesis protein thiG
publication title Crystal structure of TTHA0676 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Biosynthetic protein
total genus 11
structure length 64
sequence length 64
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2006-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2htmE00
1GPXA 1UWMA 3L4PA 3SFEB 1TJEA 1JALA 3AE1B 1N61A 1YQ3B 3AE9B 2K5PA 3HVZA 3P1MA 2PIAA 1PUTA 3AN1A 1OQQA 5AUKA 3LB8C 5EE9A 1ZXIA 1FRDA 1KF6B 2MJ3A 4US8A 1GAQB 5G5HA 4ZHPA 1DGJA 3AECB 2WDRB 4KX6B 1QF6A 2L83A 1FMAD 1ZUD2 3B2FA 3W5VB 1SIJA 1AYFA 1OQRA 2PKOA 1A70A 1JWAD 3CIRB 5C2TB 2E3TA 4YSXB 5MPOA 4USAA 3NVVA 3AE4B 1E9MA 1PFDA 3NRZA 1L0VB 4ZHOA 1RYJA 1QOFA 4WWMA 1ROEA 2KAJA 2LEKA 4C80A 1N63A 1XLNA 3SR6A 2ACZB 5G5GA 1KFYB 1KRHA 2WS3B 3AEDB 4N58A 1FM0D 1QT9A 1TYGB 1WXQA 3DWMA 4C7ZA 2DWQA 1WYGA 3SFDB 2W55A 1J7CA 2WP9B 3AV8A 3FC4A 1XLQA 1CZPA 1N5WA 1YJJA 1YQ4B 3AE3B 3NVWA 4YSYB 2MH7A 3ETRA 5EE0A 2BT6A 3WCQA 4YTMB 1DOXA 2CJNA 1V8CA 3NVYA 1J7BA 4ZOHC 3RPFC 2WU2B 4A9AA 2FBWB 1NI3A 3AE7B 1E0ZA 1I7HA 1E7PB 1TKGA 1FFVA 1QOAA 2WDVB 5EE1A 4N59A 2DBYA 5GXGB 4YSZB 1NEKB 3PO0A 1WGKA 3AE2B 1PDXA 3BIID 3AE5B 2OHFA 4YT0B 3CWIA 3AM9A 4ITKA 1VDVA 2QIEB 1SB3C 3AE8B 2KMMA 2K22A 2W3RA 3P4QB 1B9RA 1OFFA 1XO3A 1IUEA 1RM6C 3KWLA 2M19A 1DOYA 3ABVB 3VRAB 2CU3A 3P4SB 1AWDA 4FXCA 4P6VF 1QOGA 1L5PA 1N5XA 2W3SA 3AEGB 2H88B 3EUB2 3DWGC 5C3JB 2QJLA 4WQMA 1TKYA 3HRDD 4C7YA 4YXDB 1RFKA 4IDIA 2K9XA 2PVOD 1JW9D 3NVZA 1L6UA 2N0SB 1NYQA 4YTNB 1FXAA 2CJOA 1N62A 2WLBA 1F0ZA 2BS4B 1DOIA 3NS1A 2WU5B 1E6EB 1N60A 3AEFB 3AEEB 1ZOYB 3B9JA 4HROA 2HTME 1FO4A 4N6EB 1WRIA 2BS2B 1JRPA 3AEBB 3P63A 1FIQA 2H89B 3AH7A 3FAHA 1FXIA 1NENB 1QOBA 1EWYC 2PVGC 2EKIA 4US9A 3AMZA 1L6VA 1ZP0B 1FRRA 2M56B 2Y5CA 3P4PB 1WWTA 2W54A 3AB5A 3HUIA 4HRSA 3VRBB 5H8YE 2MJEA 3B2GA 2WDQB 1JROA 1TKEA 1V97A 3AE6B 5H92C 4JX1C 1CJEA 2JX5A 1J7AA 1QLBB 4JWUC 2MJDA 1JWBD 5AUIA 3ZYYX 2Q5WD 5EE3A 2G1EA 3P4RB 1RWSA 1VLBA 1XLOA 2AX5A 2WQYB 1NVID 1YJIA 3AEAB 1JQ4A 1R7SA 1T3QA 4YTPB 3VR9B 4JWSC 3VR8B 1SF0A 3W9CB 2JQRB 3LXFA 4LTUA 1FFUA 3W5UB 1XLPA 2L52A 1E10A 2BS3B 1NYRA 1VJKA 2B76B
chains in the Genus database with same CATH superfamily
4TSSA 3AE9B 2N9XA 5J18A 2M1MA 1J0GA 4BOZB 4NAWA 4A3OA 2L05A 3R2TA 3H8HA 3JSVB 1A70A 4ZRJA 1FNVA 2KTRA 3TCAA 2AEHA 3TBLD 5GMVA 1K50A 4IG7B 3DBRB 2VZKD 2KANA 2ZNVB 1K8RB 2WXGA 1EM7A 4M01A 1KLVA 4EKUA 1J7CA 2KN4A 3JW0X 2R61A 3QHTA 2ZVOA 4GDKB 3V6CB 4R3DA 5G55A 4C4VA 1TKGA 3WAMA 1WM2A 1EO6A 4WWPA 4LCDE 1PDXA 3Q8BA 4KKIA 2ZW0A 3AM9A 1RLFA 3OLMD 2KK8A 4BBNC 3KWLA 1EU4A 2AQ3B 1PYWD 4AQ7A 1UGMA 3H7PA 1QOGA 1WGDA 4YL8A 2M0XA 4CQNA 2BYVE 2KTFA 2WX0A 4OVZA 2NBWB 1C4CA 2CJOA 2KQ4X 1VZ6A 1TBEA 2KJHB 3CSFA 3OJ4B 2KDFB 5JHAA 2LGYA 3EA6A 2W54A 5IKCM 3A1QA 2Z59B 2WDQB 2I1KA 2QC8A 5D3DA 5CHVC 3RD2A 1ZPSA 2Z0EB 1TS2A 2V3PA 2AX5A 2D3BA 2IO1B 3UF8A 3W5UB 2LUMA 1TIFA 2KVZA 4NY0A 2LVQA 2CU1A 3OG5A 5IA7A 1K52A 3NHEB 4RGNA 3R2IA 4NJCA 3IAS1 3L13A 4DHJD 2HE7A 2MBBB 3Q3JA 4GU2A 3W5VB 2WXJA 4TKNA 3PZ7A 2YEPB 3ZO5B 2LGXA 1BUIC 1EUVB 4MSMB 2KAJA 1Q5WB 1N63A 1FM0D 3KYDD 5IO9A 3X0WA 2KDMA 1VD2A 4C7ZA 1IPGA 4W9GA 3NVWA 4YTMB 4W9HA 1WZ3A 1J7BA 3I9V1 1NI3A 3RI7C 3MC0B 4MH0E 1F1HA 1MJDA 2CS4A 3UIPB 1P3QU 1S3SG 1AN8A 3BINA 2W3RA 4ANXA 2W82A 2BPSA 2PJHA 3GE3C 3P4SB 3PZ8A 3PZDA 2QJLA 4GGQA 1EF5A 1SJHD 5E6NA 2XN9C 2GB1A 1N62A 2EMSA 4B0MA 1GOZA 1YJ1A 1F2RI 2K25A 2L76A 3P63A 2DAJA 3AH7A 4GSWA 4C00A 3FAHA 3N9YC 2I2YA 3PRMB 1FRRA 3HVDA 3PHWB 1JMLA 5AUIA 3ZYYX 3Q2AC 4BZAA 3P4RB 3VTUA 3QARA 1WF9A 3RULA 3ZTCA 3UINB 4KSKC 1WR6E 1KLGD 2K8HA 3BVGA 3BVMA 2L8JA 1J8CA 1JALA 3FILB 1IGCA 3I57A 3ZRFA 1NI2A 4KGSA 3MFGA 4WJQA 4DQOC 2KWUB 2ZJDA 3BK2A 1F9JA 2XBBC 1HZ5A 1YN5A 2UYZB 4LNOA 2Y5BB 1KRHA 2YEPF 1WXQA 2NCNA 3VH4B 2ZPNA 2KQ7A 1E10A 5BMIA 3EC8A 4EFOA 2FBWB 3Q3FA 4MT5A 1V1OA 1I7HA 2RPQA 2B3AA 3ML9A 4WWNA 1U4AA 4M8NA 1JWMD 2V3NA 3K9OB 5JZEB 4IW0A 4DK5A 3MHZA 3Q69A 3AE5B 2WXIA 1UZXB 3RN9C 2BWES 3P4QB 1LQBA 2L7RA 3SD5A 2CKHB 2ICIA 2LXCA 3HM3A 1SSNA 3B08A 5E6PA 5C23A 4OZBA 4EZLA 1FO4A 2MBOA 1KM7A 1UELA 2BW2A 2N9PC 2WHIA 2PLPA 1ISNA 2WXQA 4K3CA 2LXAA 2N9EB 4US9A 2Y5CA 2M56B 1E7VA 2MJEA 3ALBA 2IZVB 3B2GA 4ZRQA 1Z2MA 4B0EA 5CX3A 4HK2A 4HJKA 4CO7A 2QHOA 1YJIA 1WXSA 3QAQA 2N9KA 3MC8A 2NPTA 2K6QA 5BYQA 3DBLI 2QILA 4K81A 2IO0B 1A5RA 2B76B 2LI5A 4A20A 1I4PA 1WX7A 3CMMB 4IOIE 2BQQA 4W9IA 1R4NB 1SE2A 2KJRA 1FRDA 1MVKA 4REZA 3E56A 5CTRC 4K7WA 1TZOA 3CF6E 3AU5A 3IT4B 3B0AA 3A4SC 4OVUA 4ANWA 4IM0A 5LXHA 3JSVA 4KSLC 4IM2A 3GP7A 4A6QA 1NBFC 2GBKA 4MELA 1WE6A 4DWFA 3NVYA 3ZNZB 3NG0A 1PGXA 4ZDVA 4YWGG 3B1LX 4FHJA 2RDBC 3S2AA 2O6VB 2KNBA 4FHKA 4GDKA 1OGWA 2OHFA 2JYTA 2FCSA 1T6BX 3BK1A 1LM8B 3VRAB 2LWPA 4HJGE 3O65B 1JW9D 4JE3B 3SEBA 1FXAA 2LASA 1PGAA 4S0RA 2V1YA 3NJTA 1V81A 3N32A 3AEFB 2DZKA 3ZXRA 4HROA 2LMCA 5IP4D 3H1UA 2LZ6A 2DYMA 3ZW3A 3BWUD 4C56C 1ZP0B 2D3AA 2WXFA 1JROA 1C79A 1GB1A 2PE6B 3VHTC 2G1EA 3DBSA 3TJPA 3TSSA 4JWSC 1FD6A 4BVUC 3QJZA 1TZ1A 1L0YB 1KTKA 1KF6B 2MJ3A 3ZKJC 1WMHB 2L32A 1WRDB 3VTWA 3JYUA 1WGYA 4M0WA 2MEKA 4M8MA 4QAYA 1X1MA 4UDUC 3RNAC 3NVVA 2IBIB 2L00B 4W9EA 3EHVA 2G4SA 4WWMA 4RF1A 3PS6A 2R2OA 3IAM1 5C1ZA 2DLBA 2IY0B 3RMKC 2MH7A 2UU7A 2WX1A 2CJNA 4A9AA 1E7PB 3U2SC 4II2B 1GC7A 1QILA 4L2YA 3APFA 4HPLB 5GXGB 3WAOA 3AE2B 4G50A 4NQKE 4YT0B 3AE8B 1IBXA 1OFFA 2KC1A 1IUEA 1P1AA 4RM9A 2M19A 1KOTA 2LJ5A 5D3IB 5IOIA 2BBCA 5J17A 4HKQA 2PVOD 4KV2A 2IGDA 1L0XB 5KHQA 2ZVNA 1E6EB 2LJIA 2O6VD 1EWCA 4L23A 3T9LA 3Q3NC 4B6WA 2FIDA 3ZNHB 4D2KA 4RGOS 1FXIA 1C77A 3AMZA 3NZUA 2GI9A 4HRSA 3AB5A 4WJPA 4RCOA 2GBMA 1K53A 5L83A 3VQIA 3ZXVA 2C60A 1HTOA 2J52A 4KGRA 2R2QA 2MHJA 1I4RA 4EEWA 2BB5A 4MDKE 4TV3A 2RDHA 3Q14C 4XGAB 1GPXA 1WGRA 1HE8A 4WWOA 3R7QA 2GBRA 2WXRA 2K3UA 4MJSA 4OW0A 4Q2JA 3U52E 3EFCA 3IXSA 2Y5PA 3WA0A 4XDDA 3FILA 5MPOA 3AE4B 2KN5A 3NRZA 2IO2B 1QOFA 2LVPA 2ACZB 1SE3A 2HJ8A 3BZDB 1P9DU 3CSTA 3NY5A 3ONSA 4HDOA 4YSXB 1ESFA 2FE8A 3C8YA 2ZCBA 4M00A 2DHZA 4GXBA 3H6NA 1MG4A 2MWSB 4FBJB 1T0YA 1WFYA 4ZRIA 2KX3A 3KVFB 3HK0A 5EE1A 4EZKA 3U7ZA 4N9F4 5CHWA 1RM6C 2KDBA 4IWPA 2YLMA 4P1CC 4RF0A 3DWGC 2C9WB 4WQOB 3A9KB 1UBIA 3VUYA 1ZKHA 2IGHA 2MRPA 2G3QB 4LNFA 4A3PA 1WGHA 2RSUA 3QQ8B 2QCZA 2PVGC 1L4DB 1IGDA 4A90A 3P4PB 2K1FA 1FCLA 1J19A 3GB1A 1V97A 4OVVA 4P1BC 1RAXA 2JX5A 1VCBA 2N1WA 3M63B 1HZ6A 2DYOA 1SIFA 1V80A 3KYCD 2L52A 2BS3B 2D11A 2K39A 4OZAA 3RCZA 2AQ1B 4HEA1 5J2RA 2KMCA 4ANVA 3DHIC 2JT4B 4ZRPA 1D5MC 5JHBA 2KLGA 1ZUD2 2MBEA 1YMHE 1OQRA 4USAA 4LNKA 1B1ZA 2ZZPB 3LDZE 1XCQL 4BFRA 1WX9A 1G6JA 1WH3A 4XWTA 2FCMA 3QK0A 3E9SA 4M02A 3W1SA 1V8CA 1ZW7A 4BKSA 4W9CA 2KACA 1E8WA 2Y3AA 3DVGY 1MHHE 1WGKA 3BIID 4HPPA 2D3CA 3DOWA 4DXAB 2GBNA 2J7QB 2NR2A 1V6EA 3Q8EA 4FXCA 4KKJA 2DZMA 4A8XC 2O6VA 2I1JA 2BYEA 3X23A 1VZ8A 1LXDA 1YX5B 2QEJC 3IT6B 4WIPA 3DQVA 3DBHI 3PREA 3N3KB 1WY8A 4N6EB 1WRIA 4DHZB 1QZEA 4W9DA 1PQSA 4FN2A 1YOVB 3ZJVA 5L95C 4F1SA 2MQJA 3KWVA 3AU4A 4ICUA 2BKFA 4GB9A 1WJUA 1C9FA 2K8CA 1V86A 1UGJA 3DVNV 4JWUC 1WYWB 4KDLB 4DHZE 2KX0A 1V49A 3Q8AA 3VR8B 1SE4A 4LTUA 2JYEA 2D2QA 1NYRA 1V5OA 2JUOA 3K9PB 4PYUA 4MGZE 3QIJA 3P1MA 1SXTA 1PUTA 2ZCCA 3AN1A 2EKEC 5EE9A 2LFIA 4GDLB 4GOCA 5AEKB 4CYEA 1SIJA 3V62A 3VTVA 3I3TB 2FNJB 1TS5A 1WGGA 2KWCA 2J53A 1YN3A 2WGSA 2BYTA 3SR6A 1WMHA 4N58A 5AZFA 2IGGA 1FNUA 3PSEB 3AV8A 4LLGM 1CZPA 2MCNB 1P0RA 1XF5L 3R8BA 5LXIB 4JPSA 1GJZA 3I63C 4F8CB 3M3JA 4BKGA 1XXGA 4N59A 1OTRB 3BVZA 1NEKB 3M62B 3CWIA 2MBHA 2A4ZA 2NVUI 3MTNB 1VDVA 2QIEB 5DPRA 3WANA 4KVGB 4O1NA 1KLUD 1E8ZA 1HQRD 1LFDA 2K6DB 3EUB2 5C3JB 2BB6A 2O2VA 1RFKA 4PT5A 3RZFA 1GG3A 1JRUA 4HCPB 4RM8A 4XYCA 3P2BA 4B9KA 3Q3OC 5G2NA 3NOBA 1FIQA 2JPHA 3OJ3A 3QA8A 3HIZA 2AQ2B 2FUHB 3N1XC 1CQVA 4ARCA 3VXWA 3M95A 2EMTA 1Q1OA 1VLBA 3UQAA 3Q8FA 4C4VB 5BMGA 4I6PA 2WNMA 2NS5A 4HKZE 1BMLC 1OQYA 3PVLA 2Z0DB 2VH2A 2KWVB 4US8A 2JWZA 2DNFA 1GAQB 4WURA 3EGRA 1D5ZC 1DGJA 4KX6B 1EU3A 2QMTA 3MC9A 5AZHA 5HFYA 2J4XA 1Y56A 1C4PA 3HHMA 4JQWC 4LJOB 2XK5A 1S1QB 1KFYB 1D4BA 2JY6A 2WS3B 1K51A 2IY1B 2KWDA 5TR5A 1GNUA 4J3OD 2KVRA 3SDLC 3PTFC 1H4RA 2WU2B 1LO5D 4IWOA 2MP2B 2WXPA 2KD0A 2X38A 2L0FA 3AULA 2MW5A 1R4MI 2VRRB 2DENB 1AWDA 2KOXA 1MFWA 3KUZA 3DHGC 4XC2A 2M8SA 1L6UA 2ZNVC 5HI1A 1YQBA 4AWJA 2MLBA 3NS1A 3QC8B 4MM3B 3B9JA 3GS2A 1Q10A 3IG3A 3BY4B 2VH1A 3A33B 3AEBB 4AJYB 3P42A 1WJNA 1XD3B 4LDTB 4PS3A 3UGBB 3QWZB 3UI3A 5JH5C 1GB4A 2J0MA 3L0WB 2FCQA 2V0GA 1C1YB 4GMVA 4JLCA 2KO3A 4I6LB 3A9JB 2GMIC 1JCKB 4XDCA 3O13A 5BMHA 4KZCA 3R66C 1M94A 3ZGZA 3PLVA 1FXTB 4BOSC 2AL3A 1RRBA 1ZE3D 2FAZA 5BYSA 2KZRA 2PIAA 2X8XX 3LB8C 1ZXIA 4KZ0A 3L08A 1UBQA 4W9KA 1SE9A 1V1PB 1QF6A 2WXOA 2NBVB 5DPWA 1JWAD 3PHXB 2KFKB 4MH8A 1E9MA 1V9JA 4BBNF 2J0JA 2OJWA 4X57B 4P7IA 3KQ4A 3AEDB 1I4GA 3SFDB 3GZNI 4ZOHC 2XNAC 3APCA 2WXNA 1E90A 1P98A 4DDGD 1FFVA 2BGFA 2PW9A 3ENEA 5T8IA 1D3ZA 2DBYA 3N1ZC 3ZDMC 3BYTB 4FJZA 4IWQA 1ZXHA 2HDEA 2K22A 3W1YA 2M17A 1B9RA 3HM6X 2BF8B 1N5XA 4NPNA 1PGBA 2K9XA 3PRZA 1ZDVA 1F52A 4NAMA 2BTEA 2WDTB 1C4AA 2KDIA 2SAKA 4DDID 4IKGA 2WU5B 4RH6A 1P7EA 1UNSA 1I35A 2IO3B 2JF5A 2VZKB 1KJTA 1E8YA 4BKSD 4WJOA 1NENB 1EWYC 1TGZB 3VRBB 2OJRA 3AE6B 2N7DA 2JXXA 1SBBB 2OOBB 1QLBB 1JWBD 2WXKA 4J6IA 1M4VA 4W9JA 2V4LA 1I42A 4KDIC 2K8BA 3W9CB 2M4NA 1FFUA 3VVWB 2MX2A 2REXA 4S17A 2L1AA 2INCC 3L4PA 4ICVA 2BKRB 1YQ3B 5IN7A 2KDEB 3TEZA 4TQ1A 4ZHPA 2KFJA 2CHZA 2WDRB 3R3MA 3B2FA 2N7EA 3OAWA 1OEYA 2ZW1A 2PKOA 3CIRB 2BVCA 4FLHA 1P7FA 4GDLA 4TMAB 3WALA 3QX1A 3LYYA 5G5GA 1E8XA 1TTNA 3DBLB 1BXTA 4KIKB 3NUHB 1YJJA 3DHHC 1NDDA 3ETRA 1DOXA 2GLSA 3N30A 3RPFC 3PT2B 4II3B 3N1YC 3AE7B 5D7GA 4HDQA 2LVOA 4HXDA 2LRUA 1UH6A 2L3ZA 3ZQ4A 2WXLA 3VUWA 3RFZB 3R7RA 2KQSA 3ABVB 2CU3A 1R4MB 3IVFA 3TMPB 3AEGB 3L54A 2NPTB 4DHJB 4RMAA 2NTSA 4YXDB 2PEAA 4C7YA 3TEWA 1UWXA 3NVZA 4YTNB 2GBJA 2IYDB 2BWFA 1I4QA 2DYBA 2IJ0A 2KC2A 4RNAA 2DZJA 3AEEB 1ZOYB 2D07B 3IBEA 1XEEA 2L0TA 4NNJB 3RYTA 4XWWA 4I6NB 3VAWA 1YNTE 2KT7A 1JWSD 1WE7A 5EE3A 3T8MA 1XLOA 4K7SA 3AEAB 1SF0A 4ANUA 1VJKA 3ZJTA 4WAFA 3HVZA 1GUAB 4OZCA 2E6XA 3WIMA 1TS3A 2NMQA 2JU6X 3T3OA 1TY0A 1WM3A 1ENFA 4H2AA 2YVCA 4C80A 2JZPA 3ZIMA 1IP9A 4HWIB 3DPDA 2DWQA 2WXMA 2KXJA 4E3CA 3FC4A 5H8YE 1SEBD 3FKYA 2D3GA 3URYA 4GLSC 3GZNB 1AW7A 4FULA 5D2MB 1XT9B 4OHJA 2V4IB 4RFBA 1E5WA 2ON8A 4ITKA 2I38A 2J42A 1HEZE 1WZ0A 2MP2A 3VUXA 1L5PA 3U4EG 3V61A 3W1SC 4WJNA 4WQMA 3Q8CA 3ZRCA 4EUTA 2N7JA 3N20C 1SGHA 5DPSA 2IDYA 2WLBA 3V6EB 1F0ZA 2BS4B 4WAAA 1DOIA 2HTHA 5FK9C 1UD7A 4IC7B 4M0WB 1UF0A 1R4NI 5EE0A 1VRAB 4MM3A 4XX5A 3APDA 4EOYA 1Q0WB 5H92C 1CMXB 1CJEA 4AOFA 5FR3A 3PGEA 2M0AA 1R7SA 2JZ3B 4FJYA 3ZNID 3LXFA 4K7UA 1XLPA 5E6JA 2RMMA 5LNK1 1F77A 3TEXA 1ACCA 1TJEA 3ZUNA 4E71A 3A9JA 2JXTA 2JVCA 4CHKA 4MACA 1IBXB 2RDGA 1BT0A 1C76A 2L83A 3KH0A 1F2RC 3JVZX 2OEDA 3RUIB 2G4DB 4PS7A 5C2TB 4ZYSA 4XZ4A 1C3TA 1L0VB 3KW5B 2DX5B 4G11A 2LUEA 4F7ZA 2MSED 1V1PA 5BYRA 1QT9A 2N1VA 3PLUA 2PMVA 2W55A 2WP9B 2FCNA 1YQ4B 2KFKA 3AE3B 3WCQA 1WXAA 4FJVB 1XCTL 4DXFA 3AI5A 1FNWA 3V60A 2MA9B 4W9LA 2HJ1A 2CHWA 2ZPYA 3ZTDA 1I4XA 4GN1A 4K3BA 4AJWA 3MHSD 3Q6BA 3U30A 2HD5B 1MHXA 4AS1A 3A4RA 1QKZA 3W2DA 2LGDA 1XO3A 3KUCB 4MGIE 2NTTA 4URKA 3UIOB 3UQBA 1WSPA 2W9NA 2JSVX 4ACFA 3L17A 1ZGUB 3ZLZA 4NQLB 4BAXA 3RNFC 4MJSB 3ML8A 2EELA 2QSDA 2H89B 2RPVA 5E6OA 2LGIA 1MG8A 2WXHA 4JIOU 2V3SA 1L6VA 3SHQA 3HUIA 3LJ3A 5AZGA 1HTQA 5BO4B 1L2NA 4ARIA 1LGRA 3VFKA 4HLEA 1C78A 3L16A 4NAWB 2JQRB 1L4ZB 1FEHA 1UWMA 3OWEB 2KTRB 3MJWA 5LLIA 2AWTA 5G5HA 2IPKD 3ECIA 4NJ7A 1CK1A 3KUDB 3VDZA 1AYFA 1H8CA 2JWUA 4NZLB 3SU8X 1PFDA 3MJ5A 4LK0M 4ZHOA 2GOWA 1ROEA 2LEKA 1XQQA 4TQ0A 1XLNA 1QQRA 1TYGB 1WYGA 4AUQC 1XLQA 1N5WA 1AARA 1RFAA 2BT6A 3IFWB 4ASWC 2BYFA 2C7MB 3KLSX 2QDFA 5HHDG 4JL9A 3RNGC 2MBQA 3H7PB 4KIKA 2JRHA 4PK1A 4YSZB 2C7NB 1FCCC 2KHWB 1VZ7A 1SB3C 2FUG1 1L7YA 3ZJUA 1DOYA 3I5JC 3IHPC 4FADA 1MI0A 1UUPA 4KGTA 2KKCA 3RNBC 3DVNU 2W3SA 3WAPA 4A55A 4IDIA 4HCNB 1JWUD 4P16A 5IAAC 2N0SB 4E74A 1EF1A 4FA6A 1WR1A 4NJ6A 2PTLA 1KH0A 1WJ6A 3A1QB 2BS2B 1STEA 1T5XD 2SEBD 2XEWA 5D94A 2DAFA 1E0ZA 1WXVA 4HPMB 1TT5B 2ONQA 5D6JB 5EDSA 2MJDA 1T0QC 2Q5WD 5CHFA 2C7HA 2WQYB 1NVID 3DDCB 3DVGX 1TS4A 2ZEQA 3DBHB 1GC6A 1IYFA 2C5LC 2V9HA 5JXVA 3SFEB 3A9KA 1V2YA 2RGFA 4MGYE 4RGTA 1OQQA 3TUOA 5DPTA 3AECB 2INNE 4DBGA 1FMAD 1V5TA 5KHOA 1RYJA 3DBRI 4MSQB 4EZJA 1YN4A 4EE2A 3DWMA 3AXCA 3RZWC 5HG2A 2AYOB 3D32A 2TSSA 3V3XA 4G3XB 1QOAA 5I4DA 2FIFA 2K0PA 4WH4A 3C19A 1YX6B 2KMMA 4BKTA 3RNCC 2KMAA 4AP4C 3ZDTA 3U8ZA 1MPEA 4P6VF 4B95A 1HA5A 2PE9A 1WI0A 1TKYA 1YD8U 1OEYJ 2ASQA 5FKAC 4LNIA 4W9FA 1D5XC 1FPYA 2HTME 3H7SA 3GOEA 1JRPA 2N4FA 2INPE 2EKIA 5HKHA 4LNNA 1WWTA 1I4HA 4L1BA 3PV1A 1TKEA 2LHDA 4JX1C 3TIXA 1J7AA 4K1RB 1D6EC 4XE0A 5DCNA 4PS8A 4YTPB 1Z5SB 3BYYB 1ET6A 1YIWA 3VH3B 3RT3B 3TL5A 3PPAA 2GRIA 1HXYD 2JRIB 1WX8A 3AE1B 4MEMA 1N61A 2K5PA 1T0RC 2D10A 5AUKA 2LGSA 2LD9A 3EECA 4ZRKA 2D5GA 2LRWA 2E3TA 2WWZA 2O2VB 3H9DA 4GIVA 3U7DA 2UWQA 3DCGA 2INDC 5TSSA 4G0NB 2RR9A 2JZZA 4YSYB 1E7UA 4LDTD 2N9LA 2DZIA 2WYQA 3ZVVA 2WDVB 2Z8LA 2KJ6A 3PO0A 2AL6A 3J9CA 2NBUA 4IUMB 4IM3A 3QCAA 3NZSA 3ZNGC 4LJPB 5FR6A 2H88B 4PYZA 3HRDD 1DYQA 3C0RB 3V05A 2PPHA 3PRPB 3Q3MC 1NYQA 1Y8RC 2CR5A 1TY2A 1ET9A 2CHXA 4ZYNA 1N6ZA 1N60A 1VR9A 3NZ3A 3TEYA 3GE8C 3T3NA 1QOBA 3EFUA 1WXMA 2KYWA 4TUUA 3L10B 4DXGA 2XK5B 2G45B 3RNEC 4RGMA 1T0SC 2A5UA 4HVBA 1RWSA 1JQ4A 3VR9B 1T3QA 1ZDXA 2RD0A 1WJ4A 3NS8A 1WIAA 2G9HD 1SJED 2KLCA 4JGHB 4MGKE 2J0KA 2LHEA 3MP9A
chains in the Genus database with same CATH topology
2WNMA 1ACCA 4TSSA 4HKZE 1BMLC 1TJEA 3AE9B 1L0YB 1KTKA 2JXTA 4US8A 1KF6B 2MJ3A 4MACA 1GAQB 4WURA 3EGRA 1D5ZC 1DGJA 1IBXB 2RDGA 4KX6B 1EU3A 2QMTA 1C76A 2L32A 2L83A 1F2RC 3R2TA 3H8HA 4M0WA 2MEKA 2OEDA 1A70A 5C2TB 5HFYA 1FNVA 4UDUC 2J4XA 1Y56A 3NVVA 4ZYSA 1L0VB 1C4PA 4WWMA 1K50A 1V1PA 5BYRA 2VZKD 1KFYB 1D4BA 2WS3B 4RF1A 1QT9A 1K51A 2WXGA 2KWDA 3IAM1 1EM7A 2DLBA 2PMVA 2W55A 1J7CA 2WP9B 2KN4A 1YQ4B 2R61A 3AE3B 3WCQA 2MH7A 4GDKB 2CJNA 4J3OD 4R3DA 1XCTL 4DXFA 1FNWA 2WU2B 4A9AA 1LO5D 1E7PB 1TKGA 3U2SC 1QILA 4L2YA 1I4XA 5GXGB 2WXPA 3AE2B 1PDXA 3Q8BA 1MHXA 4AS1A 4KKIA 4YT0B 2X38A 2ZW0A 3AM9A 3AE8B 1QKZA 3W2DA 1IBXA 1OFFA 1XO3A 1IUEA 3KWLA 2M19A 2NTTA 1EU4A 2AQ3B 1PYWD 4AQ7A 5D3IB 1AWDA 1QOGA 1WSPA 2BBCA 2JSVX 4CQNA 4HKQA 2PVOD 2IGDA 4OVZA 1L6UA 1C4CA 1L0XB 5HI1A 2CJOA 3NS1A 1E6EB 2LJIA 1EWCA 4L23A 4MM3B 3B9JA 3GS2A 1Q10A 2KQ4X 1VZ6A 3AEBB 2EELA 2QSDA 2H89B 2RPVA 4D2KA 4RGOS 1FXIA 2LGIA 3P42A 2WXHA 1C77A 3AMZA 3EA6A 1L6VA 2GI9A 4HRSA 2W54A 3AB5A 3HUIA 4RCOA 3UI3A 1K53A 2WDQB 1GB4A 3VQIA 2J52A 5D3DA 4KGRA 2V0GA 1ZPSA 1TS2A 4ARIA 2V3PA 2AX5A 1I4RA 1JCKB 4XDCA 3O13A 1C78A 2BB5A 4NAWB 5BMHA 2JQRB 1L4ZB 3W5UB 2LUMA 2RDHA 3ZGZA 1GPXA 1K52A 1FEHA 1UWMA 4RGNA 1ZE3D 5BYSA 3R2IA 4NJCA 3IAS1 3OWEB 2PIAA 3LB8C 1ZXIA 5G5HA 2WXRA 2K3UA 2IPKD 4OW0A 4Q2JA 1V1PB 3U52E 1QF6A 2WXOA 3IXSA 1CK1A 3W5VB 2Y5PA 4XDDA 1AYFA 2WXJA 3FILA 3PZ7A 5MPOA 1JWAD 2YEPB 4MH8A 2JWUA 4NZLB 3AE4B 1E9MA 1PFDA 3NRZA 3MJ5A 1BUIC 4LK0M 4ZHOA 1QOFA 1ROEA 2KAJA 2LEKA 4TQ0A 1N63A 1XLNA 1QQRA 2ACZB 3KQ4A 3AEDB 1FM0D 1I4GA 1TYGB 1SE3A 3BZDB 2KDMA 4C7ZA 1WYGA 3SFDB 3NVWA 1XLQA 1N5WA 4YSXB 1ESFA 4YTMB 2FE8A 2BT6A 3C8YA 1J7BA 4ZOHC 3TEXA 3I9V1 2XNAC 3KLSX 1NI3A 2WXNA 5HHDG 3MC0B 1FFVA 2PW9A 5EE1A 5T8IA 2DBYA 4YSZB 3BYTB 3U7ZA 1FCCC 1ZXHA 1VZ7A 2HDEA 1SB3C 1AN8A 2FUG1 2K22A 2W3RA 1B9RA 3ZJUA 2W82A 1DOYA 1RM6C 1MI0A 1UUPA 4KGTA 3P4SB 3PZ8A 1N5XA 2W3SA 4RF0A 3DWGC 2QJLA 1PGBA 4A55A 4IDIA 2K9XA 1ZDVA 4NAMA 1JWUD 4P16A 2N0SB 1SJHD 2XN9C 2BTEA 2GB1A 1C4AA 1N62A 2PTLA 2SAKA 4IKGA 2WU5B 4RH6A 1P7EA 4B0MA 1KH0A 1GOZA 2IGHA 1UNSA 2BS2B 1F2RI 2VZKB 3P63A 3AH7A 1STEA 1T5XD 3FAHA 3N9YC 2SEBD 1NENB 2PVGC 1EWYC 1L4DB 1IGDA 4A90A 2I2YA 1E0ZA 1FRRA 3HVDA 3P4PB 3VRBB 1FCLA 3GB1A 1V97A 3AE6B 1JMLA 2ONQA 2JX5A 1SBBB 1QLBB 2MJDA 1JWBD 2WXKA 5AUIA 2Q5WD 3ZYYX 3P4RB 1HZ6A 1M4VA 2WQYB 1NVID 2DYOA 1TS4A 3W9CB 1KLGD 1FFUA 2L52A 2BS3B 3BVGA 4OZAA 3BVMA 5JXVA 2L1AA 3L4PA 3SFEB 2AQ1B 1JALA 3FILB 1YQ3B 4HEA1 1IGCA 3I57A 4RGTA 3TEZA 4KGSA 1OQQA 1D5MC 3MFGA 4TQ1A 4ZRPA 4ZHPA 3TUOA 3AECB 2WDRB 2INNE 3B2FA 1FMAD 1ZUD2 4DQOC 1YMHE 1OQRA 2ZW1A 3BK2A 2PKOA 3CIRB 4USAA 1P7FA 1RYJA 1B1ZA 4TMAB 1XCQL 1HZ5A 1YN5A 1YN4A 3LYYA 5G5GA 4EE2A 1KRHA 2YEPF 4XWTA 1WXQA 3DWMA 3E9SA 1BXTA 1E10A 3NUHB 5BMIA 1YJJA 3W1SA 3ETRA 1DOXA 1V8CA 5HG2A 3RPFC 2TSSA 3V3XA 2KACA 2FBWB 3AE7B 4MT5A 1V1OA 5D7GA 1I7HA 2Y3AA 1QOAA 5I4DA 1JWMD 2V3NA 1MHHE 2K0PA 1WGKA 4WH4A 3BIID 3MHZA 3Q69A 3AE5B 2WXIA 3ZQ4A 2WXLA 2KMMA 3RFZB 3P4QB 3Q8EA 3ABVB 2CU3A 1MPEA 2ICIA 4FXCA 4KKJA 4P6VF 4A8XC 3AEGB 1HA5A 2NTSA 1TKYA 4C7YA 4YXDB 1SSNA 3TEWA 1UWXA 1VZ8A 3NVZA 4WIPA 2QEJC 3IT6B 4YTNB 5FKAC 4OZBA 1I4QA 2IJ0A 1D5XC 4RNAA 3AEEB 1ZOYB 2HTME 1FO4A 4N6EB 1WRIA 1JRPA 2BW2A 1XEEA 2PLPA 2WXQA 2INPE 2EKIA 3ZJVA 4XWWA 4US9A 2Y5CA 2M56B 1WWTA 1I4HA 2MJEA 3KWVA 3B2GA 4L1BA 4ZRQA 1TKEA 1YNTE 1C9FA 2LHDA 4JX1C 4B0EA 1UGJA 1J7AA 1JWSD 4JWUC 1D6EC 4XE0A 5EE3A 1XLOA 1YJIA 3AEAB 4YTPB 2N9KA 3Q8AA 1SF0A 3BYYB 1SE4A 4LTUA 5BYQA 3VR8B 2JYEA 1ET6A 2QILA 2GRIA 1VJKA 1NYRA 1HXYD 2B76B 3ZJTA 1I4PA 3AE1B 1N61A 4WAFA 2K5PA 3HVZA 4IOIE 3P1MA 1SXTA 4OZCA 1PUTA 2E6XA 3AN1A 1SE2A 5AUKA 1TS3A 5EE9A 2NMQA 1FRDA 1MVKA 2JU6X 2LFIA 4GDLB 4REZA 3E56A 3T3OA 1TY0A 1TZOA 1ENFA 1SIJA 2D5GA 2E3TA 1TS5A 4H2AA 2J53A 3IT4B 1YN3A 2BYTA 4C80A 3SR6A 2JZPA 4N58A 5TSSA 2IGGA 2DWQA 2WXMA 1FNUA 3FC4A 3AV8A 4LLGM 4YSYB 1CZPA 1SEBD 5H8YE 3GP7A 4A6QA 2N9LA 3URYA 1XF5L 3NVYA 3R8BA 4JPSA 4GLSC 1AW7A 1PGXA 4YWGG 2WDVB 2Z8LA 1XXGA 4N59A 4OHJA 2V4IB 3BVZA 1NEKB 3PO0A 3J9CA 4RFBA 2ON8A 2OHFA 2JYTA 3CWIA 4ITKA 1VDVA 2QIEB 2I38A 4O1NA 2J42A 1KLUD 1HEZE 1T6BX 3BK1A 1HQRD 3VRAB 1L5PA 3U4EG 2H88B 3EUB2 5C3JB 4WQMA 3Q8CA 2BB6A 2N7JA 3HRDD 1RFKA 1DYQA 4HJGE 3V05A 1JW9D 4PT5A 4JE3B 1NYQA 3SEBA 1FXAA 1PGAA 2IDYA 1TY2A 1ET9A 2WLBA 1F0ZA 2BS4B 1DOIA 1N60A 3AEFB 1VR9A 3NZ3A 4HROA 3TEYA 2LMCA 5FK9C 1FIQA 3T3NA 2DYMA 1QOBA 3BWUD 4C56C 1ZP0B 5EE0A 1VRAB 2AQ2B 2WXFA 4DXGA 1JROA 1C79A 1CQVA 4RGMA 5H92C 4ARCA 1GB1A 1CJEA 5FR3A 2G1EA 2M0AA 1RWSA 1VLBA 1JQ4A 1R7SA 1T3QA 1ZDXA 3VR9B 3TSSA 4JWSC 1FD6A 3Q8FA 2G9HD 3LXFA 1SJED 5BMGA 1XLPA 5E6JA 2RMMA 5LNK1 1F77A 2LHEA 3MP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GPX A;  1UWM A;  3L4P A;  3SFE B;  1TJE A;  1JAL A;  3AE1 B;  1N61 A;  1YQ3 B;  3AE9 B;  2K5P A;  3HVZ A;  3P1M A;  2PIA A;  1PUT A;  3AN1 A;  1OQQ A;  5AUK A;  3LB8 C;  5EE9 A;  1ZXI A;  1FRD A;  1KF6 B;  2MJ3 A;  4US8 A;  1GAQ B;  5G5H A;  4ZHP A;  1DGJ A;  3AEC B;  2WDR B;  4KX6 B;  1QF6 A;  2L83 A;  1FMA D;  1ZUD 2;  3B2F A;  3W5V B;  1SIJ A;  1AYF A;  1OQR A;  2PKO A;  1A70 A;  1JWA D;  3CIR B;  5C2T B;  2E3T A;  4YSX B;  5MPO A;  4USA A;  3NVV A;  3AE4 B;  1E9M A;  1PFD A;  3NRZ A;  1L0V B;  4ZHO A;  1RYJ A;  1QOF A;  4WWM A;  1ROE A;  2KAJ A;  2LEK A;  4C80 A;  1N63 A;  1XLN A;  3SR6 A;  2ACZ B;  5G5G A;  1KFY B;  1KRH A;  2WS3 B;  3AED B;  4N58 A;  1FM0 D;  1QT9 A;  1TYG B;  1WXQ A;  3DWM A;  4C7Z A;  2DWQ A;  1WYG A;  3SFD B;  2W55 A;  1J7C A;  2WP9 B;  3AV8 A;  3FC4 A;  1XLQ A;  1CZP A;  1N5W A;  1YJJ A;  1YQ4 B;  3AE3 B;  3NVW A;  4YSY B;  2MH7 A;  3ETR A;  5EE0 A;  2BT6 A;  3WCQ A;  4YTM B;  1DOX A;  2CJN A;  1V8C A;  3NVY A;  1J7B A;  4ZOH C;  3RPF C;  2WU2 B;  4A9A A;  2FBW B;  1NI3 A;  3AE7 B;  1E0Z A;  1I7H A;  1E7P B;  1TKG A;  1FFV A;  1QOA A;  2WDV B;  5EE1 A;  4N59 A;  2DBY A;  5GXG B;  4YSZ B;  1NEK B;  3PO0 A;  1WGK A;  3AE2 B;  1PDX A;  3BII D;  3AE5 B;  2OHF A;  4YT0 B;  3CWI A;  3AM9 A;  4ITK A;  1VDV A;  2QIE B;  1SB3 C;  3AE8 B;  2KMM A;  2K22 A;  2W3R A;  3P4Q B;  1B9R A;  1OFF A;  1XO3 A;  1IUE A;  1RM6 C;  3KWL A;  2M19 A;  1DOY A;  3ABV B;  3VRA B;  2CU3 A;  3P4S B;  1AWD A;  4FXC A;  4P6V F;  1QOG A;  1L5P A;  1N5X A;  2W3S A;  3AEG B;  2H88 B;  3EUB 2;  3DWG C;  5C3J B;  2QJL A;  4WQM A;  1TKY A;  3HRD D;  4C7Y A;  4YXD B;  1RFK A;  4IDI A;  2K9X A;  2PVO D;  1JW9 D;  3NVZ A;  1L6U A;  2N0S B;  1NYQ A;  4YTN B;  1FXA A;  2CJO A;  1N62 A;  2WLB A;  1F0Z A;  2BS4 B;  1DOI A;  3NS1 A;  2WU5 B;  1E6E B;  1N60 A;  3AEF B;  3AEE B;  1ZOY B;  3B9J A;  4HRO A;  2HTM E;  1FO4 A;  4N6E B;  1WRI A;  2BS2 B;  1JRP A;  3AEB B;  3P63 A;  1FIQ A;  2H89 B;  3AH7 A;  3FAH A;  1FXI A;  1NEN B;  1QOB A;  1EWY C;  2PVG C;  2EKI A;  4US9 A;  3AMZ A;  1L6V A;  1ZP0 B;  1FRR A;  2M56 B;  2Y5C A;  3P4P B;  1WWT A;  2W54 A;  3AB5 A;  3HUI A;  4HRS A;  3VRB B;  5H8Y E;  2MJE A;  3B2G A;  2WDQ B;  1JRO A;  1TKE A;  1V97 A;  3AE6 B;  5H92 C;  4JX1 C;  1CJE A;  2JX5 A;  1J7A A;  1QLB B;  4JWU C;  2MJD A;  1JWB D;  5AUI A;  3ZYY X;  2Q5W D;  5EE3 A;  2G1E A;  3P4R B;  1RWS A;  1VLB A;  1XLO A;  2AX5 A;  2WQY B;  1NVI D;  1YJI A;  3AEA B;  1JQ4 A;  1R7S A;  1T3Q A;  4YTP B;  3VR9 B;  4JWS C;  3VR8 B;  1SF0 A;  3W9C B;  2JQR B;  3LXF A;  4LTU A;  1FFU A;  3W5U B;  1XLP A;  2L52 A;  1E10 A;  2BS3 B;  1NYR A;  1VJK A;  2B76 B; 
#chains in the Genus database with same CATH topology
 4TSS A;  3AE9 B;  2N9X A;  5J18 A;  2M1M A;  1J0G A;  4BOZ B;  4NAW A;  4A3O A;  2L05 A;  3R2T A;  3H8H A;  3JSV B;  1A70 A;  4ZRJ A;  1FNV A;  2KTR A;  3TCA A;  2AEH A;  3TBL D;  5GMV A;  1K50 A;  4IG7 B;  3DBR B;  2VZK D;  2KAN A;  2ZNV B;  1K8R B;  2WXG A;  1EM7 A;  4M01 A;  1KLV A;  4EKU A;  1J7C A;  2KN4 A;  3JW0 X;  2R61 A;  3QHT A;  2ZVO A;  4GDK B;  3V6C B;  4R3D A;  5G55 A;  4C4V A;  1TKG A;  3WAM A;  1WM2 A;  1EO6 A;  4WWP A;  4LCD E;  1PDX A;  3Q8B A;  4KKI A;  2ZW0 A;  3AM9 A;  1RLF A;  3OLM D;  2KK8 A;  4BBN C;  3KWL A;  1EU4 A;  2AQ3 B;  1PYW D;  4AQ7 A;  1UGM A;  3H7P A;  1QOG A;  1WGD A;  4YL8 A;  2M0X A;  4CQN A;  2BYV E;  2KTF A;  2WX0 A;  4OVZ A;  2NBW B;  1C4C A;  2CJO A;  2KQ4 X;  1VZ6 A;  1TBE A;  2KJH B;  3CSF A;  3OJ4 B;  2KDF B;  5JHA A;  2LGY A;  3EA6 A;  2W54 A;  5IKC M;  3A1Q A;  2Z59 B;  2WDQ B;  2I1K A;  2QC8 A;  5D3D A;  5CHV C;  3RD2 A;  1ZPS A;  2Z0E B;  1TS2 A;  2V3P A;  2AX5 A;  2D3B A;  2IO1 B;  3UF8 A;  3W5U B;  2LUM A;  1TIF A;  2KVZ A;  4NY0 A;  2LVQ A;  2CU1 A;  3OG5 A;  5IA7 A;  1K52 A;  3NHE B;  4RGN A;  3R2I A;  4NJC A;  3IAS 1;  3L13 A;  4DHJ D;  2HE7 A;  2MBB B;  3Q3J A;  4GU2 A;  3W5V B;  2WXJ A;  4TKN A;  3PZ7 A;  2YEP B;  3ZO5 B;  2LGX A;  1BUI C;  1EUV B;  4MSM B;  2KAJ A;  1Q5W B;  1N63 A;  1FM0 D;  3KYD D;  5IO9 A;  3X0W A;  2KDM A;  1VD2 A;  4C7Z A;  1IPG A;  4W9G A;  3NVW A;  4YTM B;  4W9H A;  1WZ3 A;  1J7B A;  3I9V 1;  1NI3 A;  3RI7 C;  3MC0 B;  4MH0 E;  1F1H A;  1MJD A;  2CS4 A;  3UIP B;  1P3Q U;  1S3S G;  1AN8 A;  3BIN A;  2W3R A;  4ANX A;  2W82 A;  2BPS A;  2PJH A;  3GE3 C;  3P4S B;  3PZ8 A;  3PZD A;  2QJL A;  4GGQ A;  1EF5 A;  1SJH D;  5E6N A;  2XN9 C;  2GB1 A;  1N62 A;  2EMS A;  4B0M A;  1GOZ A;  1YJ1 A;  1F2R I;  2K25 A;  2L76 A;  3P63 A;  2DAJ A;  3AH7 A;  4GSW A;  4C00 A;  3FAH A;  3N9Y C;  2I2Y A;  3PRM B;  1FRR A;  3HVD A;  3PHW B;  1JML A;  5AUI A;  3ZYY X;  3Q2A C;  4BZA A;  3P4R B;  3VTU A;  3QAR A;  1WF9 A;  3RUL A;  3ZTC A;  3UIN B;  4KSK C;  1WR6 E;  1KLG D;  2K8H A;  3BVG A;  3BVM A;  2L8J A;  1J8C A;  1JAL A;  3FIL B;  1IGC A;  3I57 A;  3ZRF A;  1NI2 A;  4KGS A;  3MFG A;  4WJQ A;  4DQO C;  2KWU B;  2ZJD A;  3BK2 A;  1F9J A;  2XBB C;  1HZ5 A;  1YN5 A;  2UYZ B;  4LNO A;  2Y5B B;  1KRH A;  2YEP F;  1WXQ A;  2NCN A;  3VH4 B;  2ZPN A;  2KQ7 A;  1E10 A;  5BMI A;  3EC8 A;  4EFO A;  2FBW B;  3Q3F A;  4MT5 A;  1V1O A;  1I7H A;  2RPQ A;  2B3A A;  3ML9 A;  4WWN A;  1U4A A;  4M8N A;  1JWM D;  2V3N A;  3K9O B;  5JZE B;  4IW0 A;  4DK5 A;  3MHZ A;  3Q69 A;  3AE5 B;  2WXI A;  1UZX B;  3RN9 C;  2BWE S;  3P4Q B;  1LQB A;  2L7R A;  3SD5 A;  2CKH B;  2ICI A;  2LXC A;  3HM3 A;  1SSN A;  3B08 A;  5E6P A;  5C23 A;  4OZB A;  4EZL A;  1FO4 A;  2MBO A;  1KM7 A;  1UEL A;  2BW2 A;  2N9P C;  2WHI A;  2PLP A;  1ISN A;  2WXQ A;  4K3C A;  2LXA A;  2N9E B;  4US9 A;  2Y5C A;  2M56 B;  1E7V A;  2MJE A;  3ALB A;  2IZV B;  3B2G A;  4ZRQ A;  1Z2M A;  4B0E A;  5CX3 A;  4HK2 A;  4HJK A;  4CO7 A;  2QHO A;  1YJI A;  1WXS A;  3QAQ A;  2N9K A;  3MC8 A;  2NPT A;  2K6Q A;  5BYQ A;  3DBL I;  2QIL A;  4K81 A;  2IO0 B;  1A5R A;  2B76 B;  2LI5 A;  4A20 A;  1I4P A;  1WX7 A;  3CMM B;  4IOI E;  2BQQ A;  4W9I A;  1R4N B;  1SE2 A;  2KJR A;  1FRD A;  1MVK A;  4REZ A;  3E56 A;  5CTR C;  4K7W A;  1TZO A;  3CF6 E;  3AU5 A;  3IT4 B;  3B0A A;  3A4S C;  4OVU A;  4ANW A;  4IM0 A;  5LXH A;  3JSV A;  4KSL C;  4IM2 A;  3GP7 A;  4A6Q A;  1NBF C;  2GBK A;  4MEL A;  1WE6 A;  4DWF A;  3NVY A;  3ZNZ B;  3NG0 A;  1PGX A;  4ZDV A;  4YWG G;  3B1L X;  4FHJ A;  2RDB C;  3S2A A;  2O6V B;  2KNB A;  4FHK A;  4GDK A;  1OGW A;  2OHF A;  2JYT A;  2FCS A;  1T6B X;  3BK1 A;  1LM8 B;  3VRA B;  2LWP A;  4HJG E;  3O65 B;  1JW9 D;  4JE3 B;  3SEB A;  1FXA A;  2LAS A;  1PGA A;  4S0R A;  2V1Y A;  3NJT A;  1V81 A;  3N32 A;  3AEF B;  2DZK A;  3ZXR A;  4HRO A;  2LMC A;  5IP4 D;  3H1U A;  2LZ6 A;  2DYM A;  3ZW3 A;  3BWU D;  4C56 C;  1ZP0 B;  2D3A A;  2WXF A;  1JRO A;  1C79 A;  1GB1 A;  2PE6 B;  3VHT C;  2G1E A;  3DBS A;  3TJP A;  3TSS A;  4JWS C;  1FD6 A;  4BVU C;  3QJZ A;  1TZ1 A;  1L0Y B;  1KTK A;  1KF6 B;  2MJ3 A;  3ZKJ C;  1WMH B;  2L32 A;  1WRD B;  3VTW A;  3JYU A;  1WGY A;  4M0W A;  2MEK A;  4M8M A;  4QAY A;  1X1M A;  4UDU C;  3RNA C;  3NVV A;  2IBI B;  2L00 B;  4W9E A;  3EHV A;  2G4S A;  4WWM A;  4RF1 A;  3PS6 A;  2R2O A;  3IAM 1;  5C1Z A;  2DLB A;  2IY0 B;  3RMK C;  2MH7 A;  2UU7 A;  2WX1 A;  2CJN A;  4A9A A;  1E7P B;  3U2S C;  4II2 B;  1GC7 A;  1QIL A;  4L2Y A;  3APF A;  4HPL B;  5GXG B;  3WAO A;  3AE2 B;  4G50 A;  4NQK E;  4YT0 B;  3AE8 B;  1IBX A;  1OFF A;  2KC1 A;  1IUE A;  1P1A A;  4RM9 A;  2M19 A;  1KOT A;  2LJ5 A;  5D3I B;  5IOI A;  2BBC A;  5J17 A;  4HKQ A;  2PVO D;  4KV2 A;  2IGD A;  1L0X B;  5KHQ A;  2ZVN A;  1E6E B;  2LJI A;  2O6V D;  1EWC A;  4L23 A;  3T9L A;  3Q3N C;  4B6W A;  2FID A;  3ZNH B;  4D2K A;  4RGO S;  1FXI A;  1C77 A;  3AMZ A;  3NZU A;  2GI9 A;  4HRS A;  3AB5 A;  4WJP A;  4RCO A;  2GBM A;  1K53 A;  5L83 A;  3VQI A;  3ZXV A;  2C60 A;  1HTO A;  2J52 A;  4KGR A;  2R2Q A;  2MHJ A;  1I4R A;  4EEW A;  2BB5 A;  4MDK E;  4TV3 A;  2RDH A;  3Q14 C;  4XGA B;  1GPX A;  1WGR A;  1HE8 A;  4WWO A;  3R7Q A;  2GBR A;  2WXR A;  2K3U A;  4MJS A;  4OW0 A;  4Q2J A;  3U52 E;  3EFC A;  3IXS A;  2Y5P A;  3WA0 A;  4XDD A;  3FIL A;  5MPO A;  3AE4 B;  2KN5 A;  3NRZ A;  2IO2 B;  1QOF A;  2LVP A;  2ACZ B;  1SE3 A;  2HJ8 A;  3BZD B;  1P9D U;  3CST A;  3NY5 A;  3ONS A;  4HDO A;  4YSX B;  1ESF A;  2FE8 A;  3C8Y A;  2ZCB A;  4M00 A;  2DHZ A;  4GXB A;  3H6N A;  1MG4 A;  2MWS B;  4FBJ B;  1T0Y A;  1WFY A;  4ZRI A;  2KX3 A;  3KVF B;  3HK0 A;  5EE1 A;  4EZK A;  3U7Z A;  4N9F 4;  5CHW A;  1RM6 C;  2KDB A;  4IWP A;  2YLM A;  4P1C C;  4RF0 A;  3DWG C;  2C9W B;  4WQO B;  3A9K B;  1UBI A;  3VUY A;  1ZKH A;  2IGH A;  2MRP A;  2G3Q B;  4LNF A;  4A3P A;  1WGH A;  2RSU A;  3QQ8 B;  2QCZ A;  2PVG C;  1L4D B;  1IGD A;  4A90 A;  3P4P B;  2K1F A;  1FCL A;  1J19 A;  3GB1 A;  1V97 A;  4OVV A;  4P1B C;  1RAX A;  2JX5 A;  1VCB A;  2N1W A;  3M63 B;  1HZ6 A;  2DYO A;  1SIF A;  1V80 A;  3KYC D;  2L52 A;  2BS3 B;  2D11 A;  2K39 A;  4OZA A;  3RCZ A;  2AQ1 B;  4HEA 1;  5J2R A;  2KMC A;  4ANV A;  3DHI C;  2JT4 B;  4ZRP A;  1D5M C;  5JHB A;  2KLG A;  1ZUD 2;  2MBE A;  1YMH E;  1OQR A;  4USA A;  4LNK A;  1B1Z A;  2ZZP B;  3LDZ E;  1XCQ L;  4BFR A;  1WX9 A;  1G6J A;  1WH3 A;  4XWT A;  2FCM A;  3QK0 A;  3E9S A;  4M02 A;  3W1S A;  1V8C A;  1ZW7 A;  4BKS A;  4W9C A;  2KAC A;  1E8W A;  2Y3A A;  3DVG Y;  1MHH E;  1WGK A;  3BII D;  4HPP A;  2D3C A;  3DOW A;  4DXA B;  2GBN A;  2J7Q B;  2NR2 A;  1V6E A;  3Q8E A;  4FXC A;  4KKJ A;  2DZM A;  4A8X C;  2O6V A;  2I1J A;  2BYE A;  3X23 A;  1VZ8 A;  1LXD A;  1YX5 B;  2QEJ C;  3IT6 B;  4WIP A;  3DQV A;  3DBH I;  3PRE A;  3N3K B;  1WY8 A;  4N6E B;  1WRI A;  4DHZ B;  1QZE A;  4W9D A;  1PQS A;  4FN2 A;  1YOV B;  3ZJV A;  5L95 C;  4F1S A;  2MQJ A;  3KWV A;  3AU4 A;  4ICU A;  2BKF A;  4GB9 A;  1WJU A;  1C9F A;  2K8C A;  1V86 A;  1UGJ A;  3DVN V;  4JWU C;  1WYW B;  4KDL B;  4DHZ E;  2KX0 A;  1V49 A;  3Q8A A;  3VR8 B;  1SE4 A;  4LTU A;  2JYE A;  2D2Q A;  1NYR A;  1V5O A;  2JUO A;  3K9P B;  4PYU A;  4MGZ E;  3QIJ A;  3P1M A;  1SXT A;  1PUT A;  2ZCC A;  3AN1 A;  2EKE C;  5EE9 A;  2LFI A;  4GDL B;  4GOC A;  5AEK B;  4CYE A;  1SIJ A;  3V62 A;  3VTV A;  3I3T B;  2FNJ B;  1TS5 A;  1WGG A;  2KWC A;  2J53 A;  1YN3 A;  2WGS A;  2BYT A;  3SR6 A;  1WMH A;  4N58 A;  5AZF A;  2IGG A;  1FNU A;  3PSE B;  3AV8 A;  4LLG M;  1CZP A;  2MCN B;  1P0R A;  1XF5 L;  3R8B A;  5LXI B;  4JPS A;  1GJZ A;  3I63 C;  4F8C B;  3M3J A;  4BKG A;  1XXG A;  4N59 A;  1OTR B;  3BVZ A;  1NEK B;  3M62 B;  3CWI A;  2MBH A;  2A4Z A;  2NVU I;  3MTN B;  1VDV A;  2QIE B;  5DPR A;  3WAN A;  4KVG B;  4O1N A;  1KLU D;  1E8Z A;  1HQR D;  1LFD A;  2K6D B;  3EUB 2;  5C3J B;  2BB6 A;  2O2V A;  1RFK A;  4PT5 A;  3RZF A;  1GG3 A;  1JRU A;  4HCP B;  4RM8 A;  4XYC A;  3P2B A;  4B9K A;  3Q3O C;  5G2N A;  3NOB A;  1FIQ A;  2JPH A;  3OJ3 A;  3QA8 A;  3HIZ A;  2AQ2 B;  2FUH B;  3N1X C;  1CQV A;  4ARC A;  3VXW A;  3M95 A;  2EMT A;  1Q1O A;  1VLB A;  3UQA A;  3Q8F A;  4C4V B;  5BMG A;  4I6P A;  2WNM A;  2NS5 A;  4HKZ E;  1BML C;  1OQY A;  3PVL A;  2Z0D B;  2VH2 A;  2KWV B;  4US8 A;  2JWZ A;  2DNF A;  1GAQ B;  4WUR A;  3EGR A;  1D5Z C;  1DGJ A;  4KX6 B;  1EU3 A;  2QMT A;  3MC9 A;  5AZH A;  5HFY A;  2J4X A;  1Y56 A;  1C4P A;  3HHM A;  4JQW C;  4LJO B;  2XK5 A;  1S1Q B;  1KFY B;  1D4B A;  2JY6 A;  2WS3 B;  1K51 A;  2IY1 B;  2KWD A;  5TR5 A;  1GNU A;  4J3O D;  2KVR A;  3SDL C;  3PTF C;  1H4R A;  2WU2 B;  1LO5 D;  4IWO A;  2MP2 B;  2WXP A;  2KD0 A;  2X38 A;  2L0F A;  3AUL A;  2MW5 A;  1R4M I;  2VRR B;  2DEN B;  1AWD A;  2KOX A;  1MFW A;  3KUZ A;  3DHG C;  4XC2 A;  2M8S A;  1L6U A;  2ZNV C;  5HI1 A;  1YQB A;  4AWJ A;  2MLB A;  3NS1 A;  3QC8 B;  4MM3 B;  3B9J A;  3GS2 A;  1Q10 A;  3IG3 A;  3BY4 B;  2VH1 A;  3A33 B;  3AEB B;  4AJY B;  3P42 A;  1WJN A;  1XD3 B;  4LDT B;  4PS3 A;  3UGB B;  3QWZ B;  3UI3 A;  5JH5 C;  1GB4 A;  2J0M A;  3L0W B;  2FCQ A;  2V0G A;  1C1Y B;  4GMV A;  4JLC A;  2KO3 A;  4I6L B;  3A9J B;  2GMI C;  1JCK B;  4XDC A;  3O13 A;  5BMH A;  4KZC A;  3R66 C;  1M94 A;  3ZGZ A;  3PLV A;  1FXT B;  4BOS C;  2AL3 A;  1RRB A;  1ZE3 D;  2FAZ A;  5BYS A;  2KZR A;  2PIA A;  2X8X X;  3LB8 C;  1ZXI A;  4KZ0 A;  3L08 A;  1UBQ A;  4W9K A;  1SE9 A;  1V1P B;  1QF6 A;  2WXO A;  2NBV B;  5DPW A;  1JWA D;  3PHX B;  2KFK B;  4MH8 A;  1E9M A;  1V9J A;  4BBN F;  2J0J A;  2OJW A;  4X57 B;  4P7I A;  3KQ4 A;  3AED B;  1I4G A;  3SFD B;  3GZN I;  4ZOH C;  2XNA C;  3APC A;  2WXN A;  1E90 A;  1P98 A;  4DDG D;  1FFV A;  2BGF A;  2PW9 A;  3ENE A;  5T8I A;  1D3Z A;  2DBY A;  3N1Z C;  3ZDM C;  3BYT B;  4FJZ A;  4IWQ A;  1ZXH A;  2HDE A;  2K22 A;  3W1Y A;  2M17 A;  1B9R A;  3HM6 X;  2BF8 B;  1N5X A;  4NPN A;  1PGB A;  2K9X A;  3PRZ A;  1ZDV A;  1F52 A;  4NAM A;  2BTE A;  2WDT B;  1C4A A;  2KDI A;  2SAK A;  4DDI D;  4IKG A;  2WU5 B;  4RH6 A;  1P7E A;  1UNS A;  1I35 A;  2IO3 B;  2JF5 A;  2VZK B;  1KJT A;  1E8Y A;  4BKS D;  4WJO A;  1NEN B;  1EWY C;  1TGZ B;  3VRB B;  2OJR A;  3AE6 B;  2N7D A;  2JXX A;  1SBB B;  2OOB B;  1QLB B;  1JWB D;  2WXK A;  4J6I A;  1M4V A;  4W9J A;  2V4L A;  1I42 A;  4KDI C;  2K8B A;  3W9C B;  2M4N A;  1FFU A;  3VVW B;  2MX2 A;  2REX A;  4S17 A;  2L1A A;  2INC C;  3L4P A;  4ICV A;  2BKR B;  1YQ3 B;  5IN7 A;  2KDE B;  3TEZ A;  4TQ1 A;  4ZHP A;  2KFJ A;  2CHZ A;  2WDR B;  3R3M A;  3B2F A;  2N7E A;  3OAW A;  1OEY A;  2ZW1 A;  2PKO A;  3CIR B;  2BVC A;  4FLH A;  1P7F A;  4GDL A;  4TMA B;  3WAL A;  3QX1 A;  3LYY A;  5G5G A;  1E8X A;  1TTN A;  3DBL B;  1BXT A;  4KIK B;  3NUH B;  1YJJ A;  3DHH C;  1NDD A;  3ETR A;  1DOX A;  2GLS A;  3N30 A;  3RPF C;  3PT2 B;  4II3 B;  3N1Y C;  3AE7 B;  5D7G A;  4HDQ A;  2LVO A;  4HXD A;  2LRU A;  1UH6 A;  2L3Z A;  3ZQ4 A;  2WXL A;  3VUW A;  3RFZ B;  3R7R A;  2KQS A;  3ABV B;  2CU3 A;  1R4M B;  3IVF A;  3TMP B;  3AEG B;  3L54 A;  2NPT B;  4DHJ B;  4RMA A;  2NTS A;  4YXD B;  2PEA A;  4C7Y A;  3TEW A;  1UWX A;  3NVZ A;  4YTN B;  2GBJ A;  2IYD B;  2BWF A;  1I4Q A;  2DYB A;  2IJ0 A;  2KC2 A;  4RNA A;  2DZJ A;  3AEE B;  1ZOY B;  2D07 B;  3IBE A;  1XEE A;  2L0T A;  4NNJ B;  3RYT A;  4XWW A;  4I6N B;  3VAW A;  1YNT E;  2KT7 A;  1JWS D;  1WE7 A;  5EE3 A;  3T8M A;  1XLO A;  4K7S A;  3AEA B;  1SF0 A;  4ANU A;  1VJK A;  3ZJT A;  4WAF A;  3HVZ A;  1GUA B;  4OZC A;  2E6X A;  3WIM A;  1TS3 A;  2NMQ A;  2JU6 X;  3T3O A;  1TY0 A;  1WM3 A;  1ENF A;  4H2A A;  2YVC A;  4C80 A;  2JZP A;  3ZIM A;  1IP9 A;  4HWI B;  3DPD A;  2DWQ A;  2WXM A;  2KXJ A;  4E3C A;  3FC4 A;  5H8Y E;  1SEB D;  3FKY A;  2D3G A;  3URY A;  4GLS C;  3GZN B;  1AW7 A;  4FUL A;  5D2M B;  1XT9 B;  4OHJ A;  2V4I B;  4RFB A;  1E5W A;  2ON8 A;  4ITK A;  2I38 A;  2J42 A;  1HEZ E;  1WZ0 A;  2MP2 A;  3VUX A;  1L5P A;  3U4E G;  3V61 A;  3W1S C;  4WJN A;  4WQM A;  3Q8C A;  3ZRC A;  4EUT A;  2N7J A;  3N20 C;  1SGH A;  5DPS A;  2IDY A;  2WLB A;  3V6E B;  1F0Z A;  2BS4 B;  4WAA A;  1DOI A;  2HTH A;  5FK9 C;  1UD7 A;  4IC7 B;  4M0W B;  1UF0 A;  1R4N I;  5EE0 A;  1VRA B;  4MM3 A;  4XX5 A;  3APD A;  4EOY A;  1Q0W B;  5H92 C;  1CMX B;  1CJE A;  4AOF A;  5FR3 A;  3PGE A;  2M0A A;  1R7S A;  2JZ3 B;  4FJY A;  3ZNI D;  3LXF A;  4K7U A;  1XLP A;  5E6J A;  2RMM A;  5LNK 1;  1F77 A;  3TEX A;  1ACC A;  1TJE A;  3ZUN A;  4E71 A;  3A9J A;  2JXT A;  2JVC A;  4CHK A;  4MAC A;  1IBX B;  2RDG A;  1BT0 A;  1C76 A;  2L83 A;  3KH0 A;  1F2R C;  3JVZ X;  2OED A;  3RUI B;  2G4D B;  4PS7 A;  5C2T B;  4ZYS A;  4XZ4 A;  1C3T A;  1L0V B;  3KW5 B;  2DX5 B;  4G11 A;  2LUE A;  4F7Z A;  2MSE D;  1V1P A;  5BYR A;  1QT9 A;  2N1V A;  3PLU A;  2PMV A;  2W55 A;  2WP9 B;  2FCN A;  1YQ4 B;  2KFK A;  3AE3 B;  3WCQ A;  1WXA A;  4FJV B;  1XCT L;  4DXF A;  3AI5 A;  1FNW A;  3V60 A;  2MA9 B;  4W9L A;  2HJ1 A;  2CHW A;  2ZPY A;  3ZTD A;  1I4X A;  4GN1 A;  4K3B A;  4AJW A;  3MHS D;  3Q6B A;  3U30 A;  2HD5 B;  1MHX A;  4AS1 A;  3A4R A;  1QKZ A;  3W2D A;  2LGD A;  1XO3 A;  3KUC B;  4MGI E;  2NTT A;  4URK A;  3UIO B;  3UQB A;  1WSP A;  2W9N A;  2JSV X;  4ACF A;  3L17 A;  1ZGU B;  3ZLZ A;  4NQL B;  4BAX A;  3RNF C;  4MJS B;  3ML8 A;  2EEL A;  2QSD A;  2H89 B;  2RPV A;  5E6O A;  2LGI A;  1MG8 A;  2WXH A;  4JIO U;  2V3S A;  1L6V A;  3SHQ A;  3HUI A;  3LJ3 A;  5AZG A;  1HTQ A;  5BO4 B;  1L2N A;  4ARI A;  1LGR A;  3VFK A;  4HLE A;  1C78 A;  3L16 A;  4NAW B;  2JQR B;  1L4Z B;  1FEH A;  1UWM A;  3OWE B;  2KTR B;  3MJW A;  5LLI A;  2AWT A;  5G5H A;  2IPK D;  3ECI A;  4NJ7 A;  1CK1 A;  3KUD B;  3VDZ A;  1AYF A;  1H8C A;  2JWU A;  4NZL B;  3SU8 X;  1PFD A;  3MJ5 A;  4LK0 M;  4ZHO A;  2GOW A;  1ROE A;  2LEK A;  1XQQ A;  4TQ0 A;  1XLN A;  1QQR A;  1TYG B;  1WYG A;  4AUQ C;  1XLQ A;  1N5W A;  1AAR A;  1RFA A;  2BT6 A;  3IFW B;  4ASW C;  2BYF A;  2C7M B;  3KLS X;  2QDF A;  5HHD G;  4JL9 A;  3RNG C;  2MBQ A;  3H7P B;  4KIK A;  2JRH A;  4PK1 A;  4YSZ B;  2C7N B;  1FCC C;  2KHW B;  1VZ7 A;  1SB3 C;  2FUG 1;  1L7Y A;  3ZJU A;  1DOY A;  3I5J C;  3IHP C;  4FAD A;  1MI0 A;  1UUP A;  4KGT A;  2KKC A;  3RNB C;  3DVN U;  2W3S A;  3WAP A;  4A55 A;  4IDI A;  4HCN B;  1JWU D;  4P16 A;  5IAA C;  2N0S B;  4E74 A;  1EF1 A;  4FA6 A;  1WR1 A;  4NJ6 A;  2PTL A;  1KH0 A;  1WJ6 A;  3A1Q B;  2BS2 B;  1STE A;  1T5X D;  2SEB D;  2XEW A;  5D94 A;  2DAF A;  1E0Z A;  1WXV A;  4HPM B;  1TT5 B;  2ONQ A;  5D6J B;  5EDS A;  2MJD A;  1T0Q C;  2Q5W D;  5CHF A;  2C7H A;  2WQY B;  1NVI D;  3DDC B;  3DVG X;  1TS4 A;  2ZEQ A;  3DBH B;  1GC6 A;  1IYF A;  2C5L C;  2V9H A;  5JXV A;  3SFE B;  3A9K A;  1V2Y A;  2RGF A;  4MGY E;  4RGT A;  1OQQ A;  3TUO A;  5DPT A;  3AEC B;  2INN E;  4DBG A;  1FMA D;  1V5T A;  5KHO A;  1RYJ A;  3DBR I;  4MSQ B;  4EZJ A;  1YN4 A;  4EE2 A;  3DWM A;  3AXC A;  3RZW C;  5HG2 A;  2AYO B;  3D32 A;  2TSS A;  3V3X A;  4G3X B;  1QOA A;  5I4D A;  2FIF A;  2K0P A;  4WH4 A;  3C19 A;  1YX6 B;  2KMM A;  4BKT A;  3RNC C;  2KMA A;  4AP4 C;  3ZDT A;  3U8Z A;  1MPE A;  4P6V F;  4B95 A;  1HA5 A;  2PE9 A;  1WI0 A;  1TKY A;  1YD8 U;  1OEY J;  2ASQ A;  5FKA C;  4LNI A;  4W9F A;  1D5X C;  1FPY A;  2HTM E;  3H7S A;  3GOE A;  1JRP A;  2N4F A;  2INP E;  2EKI A;  5HKH A;  4LNN A;  1WWT A;  1I4H A;  4L1B A;  3PV1 A;  1TKE A;  2LHD A;  4JX1 C;  3TIX A;  1J7A A;  4K1R B;  1D6E C;  4XE0 A;  5DCN A;  4PS8 A;  4YTP B;  1Z5S B;  3BYY B;  1ET6 A;  1YIW A;  3VH3 B;  3RT3 B;  3TL5 A;  3PPA A;  2GRI A;  1HXY D;  2JRI B;  1WX8 A;  3AE1 B;  4MEM A;  1N61 A;  2K5P A;  1T0R C;  2D10 A;  5AUK A;  2LGS A;  2LD9 A;  3EEC A;  4ZRK A;  2D5G A;  2LRW A;  2E3T A;  2WWZ A;  2O2V B;  3H9D A;  4GIV A;  3U7D A;  2UWQ A;  3DCG A;  2IND C;  5TSS A;  4G0N B;  2RR9 A;  2JZZ A;  4YSY B;  1E7U A;  4LDT D;  2N9L A;  2DZI A;  2WYQ A;  3ZVV A;  2WDV B;  2Z8L A;  2KJ6 A;  3PO0 A;  2AL6 A;  3J9C A;  2NBU A;  4IUM B;  4IM3 A;  3QCA A;  3NZS A;  3ZNG C;  4LJP B;  5FR6 A;  2H88 B;  4PYZ A;  3HRD D;  1DYQ A;  3C0R B;  3V05 A;  2PPH A;  3PRP B;  3Q3M C;  1NYQ A;  1Y8R C;  2CR5 A;  1TY2 A;  1ET9 A;  2CHX A;  4ZYN A;  1N6Z A;  1N60 A;  1VR9 A;  3NZ3 A;  3TEY A;  3GE8 C;  3T3N A;  1QOB A;  3EFU A;  1WXM A;  2KYW A;  4TUU A;  3L10 B;  4DXG A;  2XK5 B;  2G45 B;  3RNE C;  4RGM A;  1T0S C;  2A5U A;  4HVB A;  1RWS A;  1JQ4 A;  3VR9 B;  1T3Q A;  1ZDX A;  2RD0 A;  1WJ4 A;  3NS8 A;  1WIA A;  2G9H D;  1SJE D;  2KLC A;  4JGH B;  4MGK E;  2J0K A;  2LHE A;  3MP9 A; 
#chains in the Genus database with same CATH homology
 2WNM A;  1ACC A;  4TSS A;  4HKZ E;  1BML C;  1TJE A;  3AE9 B;  1L0Y B;  1KTK A;  2JXT A;  4US8 A;  1KF6 B;  2MJ3 A;  4MAC A;  1GAQ B;  4WUR A;  3EGR A;  1D5Z C;  1DGJ A;  1IBX B;  2RDG A;  4KX6 B;  1EU3 A;  2QMT A;  1C76 A;  2L32 A;  2L83 A;  1F2R C;  3R2T A;  3H8H A;  4M0W A;  2MEK A;  2OED A;  1A70 A;  5C2T B;  5HFY A;  1FNV A;  4UDU C;  2J4X A;  1Y56 A;  3NVV A;  4ZYS A;  1L0V B;  1C4P A;  4WWM A;  1K50 A;  1V1P A;  5BYR A;  2VZK D;  1KFY B;  1D4B A;  2WS3 B;  4RF1 A;  1QT9 A;  1K51 A;  2WXG A;  2KWD A;  3IAM 1;  1EM7 A;  2DLB A;  2PMV A;  2W55 A;  1J7C A;  2WP9 B;  2KN4 A;  1YQ4 B;  2R61 A;  3AE3 B;  3WCQ A;  2MH7 A;  4GDK B;  2CJN A;  4J3O D;  4R3D A;  1XCT L;  4DXF A;  1FNW A;  2WU2 B;  4A9A A;  1LO5 D;  1E7P B;  1TKG A;  3U2S C;  1QIL A;  4L2Y A;  1I4X A;  5GXG B;  2WXP A;  3AE2 B;  1PDX A;  3Q8B A;  1MHX A;  4AS1 A;  4KKI A;  4YT0 B;  2X38 A;  2ZW0 A;  3AM9 A;  3AE8 B;  1QKZ A;  3W2D A;  1IBX A;  1OFF A;  1XO3 A;  1IUE A;  3KWL A;  2M19 A;  2NTT A;  1EU4 A;  2AQ3 B;  1PYW D;  4AQ7 A;  5D3I B;  1AWD A;  1QOG A;  1WSP A;  2BBC A;  2JSV X;  4CQN A;  4HKQ A;  2PVO D;  2IGD A;  4OVZ A;  1L6U A;  1C4C A;  1L0X B;  5HI1 A;  2CJO A;  3NS1 A;  1E6E B;  2LJI A;  1EWC A;  4L23 A;  4MM3 B;  3B9J A;  3GS2 A;  1Q10 A;  2KQ4 X;  1VZ6 A;  3AEB B;  2EEL A;  2QSD A;  2H89 B;  2RPV A;  4D2K A;  4RGO S;  1FXI A;  2LGI A;  3P42 A;  2WXH A;  1C77 A;  3AMZ A;  3EA6 A;  1L6V A;  2GI9 A;  4HRS A;  2W54 A;  3AB5 A;  3HUI A;  4RCO A;  3UI3 A;  1K53 A;  2WDQ B;  1GB4 A;  3VQI A;  2J52 A;  5D3D A;  4KGR A;  2V0G A;  1ZPS A;  1TS2 A;  4ARI A;  2V3P A;  2AX5 A;  1I4R A;  1JCK B;  4XDC A;  3O13 A;  1C78 A;  2BB5 A;  4NAW B;  5BMH A;  2JQR B;  1L4Z B;  3W5U B;  2LUM A;  2RDH A;  3ZGZ A;  1GPX A;  1K52 A;  1FEH A;  1UWM A;  4RGN A;  1ZE3 D;  5BYS A;  3R2I A;  4NJC A;  3IAS 1;  3OWE B;  2PIA A;  3LB8 C;  1ZXI A;  5G5H A;  2WXR A;  2K3U A;  2IPK D;  4OW0 A;  4Q2J A;  1V1P B;  3U52 E;  1QF6 A;  2WXO A;  3IXS A;  1CK1 A;  3W5V B;  2Y5P A;  4XDD A;  1AYF A;  2WXJ A;  3FIL A;  3PZ7 A;  5MPO A;  1JWA D;  2YEP B;  4MH8 A;  2JWU A;  4NZL B;  3AE4 B;  1E9M A;  1PFD A;  3NRZ A;  3MJ5 A;  1BUI C;  4LK0 M;  4ZHO A;  1QOF A;  1ROE A;  2KAJ A;  2LEK A;  4TQ0 A;  1N63 A;  1XLN A;  1QQR A;  2ACZ B;  3KQ4 A;  3AED B;  1FM0 D;  1I4G A;  1TYG B;  1SE3 A;  3BZD B;  2KDM A;  4C7Z A;  1WYG A;  3SFD B;  3NVW A;  1XLQ A;  1N5W A;  4YSX B;  1ESF A;  4YTM B;  2FE8 A;  2BT6 A;  3C8Y A;  1J7B A;  4ZOH C;  3TEX A;  3I9V 1;  2XNA C;  3KLS X;  1NI3 A;  2WXN A;  5HHD G;  3MC0 B;  1FFV A;  2PW9 A;  5EE1 A;  5T8I A;  2DBY A;  4YSZ B;  3BYT B;  3U7Z A;  1FCC C;  1ZXH A;  1VZ7 A;  2HDE A;  1SB3 C;  1AN8 A;  2FUG 1;  2K22 A;  2W3R A;  1B9R A;  3ZJU A;  2W82 A;  1DOY A;  1RM6 C;  1MI0 A;  1UUP A;  4KGT A;  3P4S B;  3PZ8 A;  1N5X A;  2W3S A;  4RF0 A;  3DWG C;  2QJL A;  1PGB A;  4A55 A;  4IDI A;  2K9X A;  1ZDV A;  4NAM A;  1JWU D;  4P16 A;  2N0S B;  1SJH D;  2XN9 C;  2BTE A;  2GB1 A;  1C4A A;  1N62 A;  2PTL A;  2SAK A;  4IKG A;  2WU5 B;  4RH6 A;  1P7E A;  4B0M A;  1KH0 A;  1GOZ A;  2IGH A;  1UNS A;  2BS2 B;  1F2R I;  2VZK B;  3P63 A;  3AH7 A;  1STE A;  1T5X D;  3FAH A;  3N9Y C;  2SEB D;  1NEN B;  2PVG C;  1EWY C;  1L4D B;  1IGD A;  4A90 A;  2I2Y A;  1E0Z A;  1FRR A;  3HVD A;  3P4P B;  3VRB B;  1FCL A;  3GB1 A;  1V97 A;  3AE6 B;  1JML A;  2ONQ A;  2JX5 A;  1SBB B;  1QLB B;  2MJD A;  1JWB D;  2WXK A;  5AUI A;  2Q5W D;  3ZYY X;  3P4R B;  1HZ6 A;  1M4V A;  2WQY B;  1NVI D;  2DYO A;  1TS4 A;  3W9C B;  1KLG D;  1FFU A;  2L52 A;  2BS3 B;  3BVG A;  4OZA A;  3BVM A;  5JXV A;  2L1A A;  3L4P A;  3SFE B;  2AQ1 B;  1JAL A;  3FIL B;  1YQ3 B;  4HEA 1;  1IGC A;  3I57 A;  4RGT A;  3TEZ A;  4KGS A;  1OQQ A;  1D5M C;  3MFG A;  4TQ1 A;  4ZRP A;  4ZHP A;  3TUO A;  3AEC B;  2WDR B;  2INN E;  3B2F A;  1FMA D;  1ZUD 2;  4DQO C;  1YMH E;  1OQR A;  2ZW1 A;  3BK2 A;  2PKO A;  3CIR B;  4USA A;  1P7F A;  1RYJ A;  1B1Z A;  4TMA B;  1XCQ L;  1HZ5 A;  1YN5 A;  1YN4 A;  3LYY A;  5G5G A;  4EE2 A;  1KRH A;  2YEP F;  4XWT A;  1WXQ A;  3DWM A;  3E9S A;  1BXT A;  1E10 A;  3NUH B;  5BMI A;  1YJJ A;  3W1S A;  3ETR A;  1DOX A;  1V8C A;  5HG2 A;  3RPF C;  2TSS A;  3V3X A;  2KAC A;  2FBW B;  3AE7 B;  4MT5 A;  1V1O A;  5D7G A;  1I7H A;  2Y3A A;  1QOA A;  5I4D A;  1JWM D;  2V3N A;  1MHH E;  2K0P A;  1WGK A;  4WH4 A;  3BII D;  3MHZ A;  3Q69 A;  3AE5 B;  2WXI A;  3ZQ4 A;  2WXL A;  2KMM A;  3RFZ B;  3P4Q B;  3Q8E A;  3ABV B;  2CU3 A;  1MPE A;  2ICI A;  4FXC A;  4KKJ A;  4P6V F;  4A8X C;  3AEG B;  1HA5 A;  2NTS A;  1TKY A;  4C7Y A;  4YXD B;  1SSN A;  3TEW A;  1UWX A;  1VZ8 A;  3NVZ A;  4WIP A;  2QEJ C;  3IT6 B;  4YTN B;  5FKA C;  4OZB A;  1I4Q A;  2IJ0 A;  1D5X C;  4RNA A;  3AEE B;  1ZOY B;  2HTM E;  1FO4 A;  4N6E B;  1WRI A;  1JRP A;  2BW2 A;  1XEE A;  2PLP A;  2WXQ A;  2INP E;  2EKI A;  3ZJV A;  4XWW A;  4US9 A;  2Y5C A;  2M56 B;  1WWT A;  1I4H A;  2MJE A;  3KWV A;  3B2G A;  4L1B A;  4ZRQ A;  1TKE A;  1YNT E;  1C9F A;  2LHD A;  4JX1 C;  4B0E A;  1UGJ A;  1J7A A;  1JWS D;  4JWU C;  1D6E C;  4XE0 A;  5EE3 A;  1XLO A;  1YJI A;  3AEA B;  4YTP B;  2N9K A;  3Q8A A;  1SF0 A;  3BYY B;  1SE4 A;  4LTU A;  5BYQ A;  3VR8 B;  2JYE A;  1ET6 A;  2QIL A;  2GRI A;  1VJK A;  1NYR A;  1HXY D;  2B76 B;  3ZJT A;  1I4P A;  3AE1 B;  1N61 A;  4WAF A;  2K5P A;  3HVZ A;  4IOI E;  3P1M A;  1SXT A;  4OZC A;  1PUT A;  2E6X A;  3AN1 A;  1SE2 A;  5AUK A;  1TS3 A;  5EE9 A;  2NMQ A;  1FRD A;  1MVK A;  2JU6 X;  2LFI A;  4GDL B;  4REZ A;  3E56 A;  3T3O A;  1TY0 A;  1TZO A;  1ENF A;  1SIJ A;  2D5G A;  2E3T A;  1TS5 A;  4H2A A;  2J53 A;  3IT4 B;  1YN3 A;  2BYT A;  4C80 A;  3SR6 A;  2JZP A;  4N58 A;  5TSS A;  2IGG A;  2DWQ A;  2WXM A;  1FNU A;  3FC4 A;  3AV8 A;  4LLG M;  4YSY B;  1CZP A;  1SEB D;  5H8Y E;  3GP7 A;  4A6Q A;  2N9L A;  3URY A;  1XF5 L;  3NVY A;  3R8B A;  4JPS A;  4GLS C;  1AW7 A;  1PGX A;  4YWG G;  2WDV B;  2Z8L A;  1XXG A;  4N59 A;  4OHJ A;  2V4I B;  3BVZ A;  1NEK B;  3PO0 A;  3J9C A;  4RFB A;  2ON8 A;  2OHF A;  2JYT A;  3CWI A;  4ITK A;  1VDV A;  2QIE B;  2I38 A;  4O1N A;  2J42 A;  1KLU D;  1HEZ E;  1T6B X;  3BK1 A;  1HQR D;  3VRA B;  1L5P A;  3U4E G;  2H88 B;  3EUB 2;  5C3J B;  4WQM A;  3Q8C A;  2BB6 A;  2N7J A;  3HRD D;  1RFK A;  1DYQ A;  4HJG E;  3V05 A;  1JW9 D;  4PT5 A;  4JE3 B;  1NYQ A;  3SEB A;  1FXA A;  1PGA A;  2IDY A;  1TY2 A;  1ET9 A;  2WLB A;  1F0Z A;  2BS4 B;  1DOI A;  1N60 A;  3AEF B;  1VR9 A;  3NZ3 A;  4HRO A;  3TEY A;  2LMC A;  5FK9 C;  1FIQ A;  3T3N A;  2DYM A;  1QOB A;  3BWU D;  4C56 C;  1ZP0 B;  5EE0 A;  1VRA B;  2AQ2 B;  2WXF A;  4DXG A;  1JRO A;  1C79 A;  1CQV A;  4RGM A;  5H92 C;  4ARC A;  1GB1 A;  1CJE A;  5FR3 A;  2G1E A;  2M0A A;  1RWS A;  1VLB A;  1JQ4 A;  1R7S A;  1T3Q A;  1ZDX A;  3VR9 B;  3TSS A;  4JWS C;  1FD6 A;  3Q8F A;  2G9H D;  3LXF A;  1SJE D;  5BMG A;  1XLP A;  5E6J A;  2RMM A;  5LNK 1;  1F77 A;  2LHE A;  3MP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...