2HTME

Crystal structure of ttha0676 from thermus thermophilus hb8
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
64
structure length
64
Chain Sequence
b'MVWLNGEPRPLEGKTLKEVLEEMGVELKGVAVLLNEEAFLGLEVPDRPLRDGDVVEVVALMQGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiazole biosynthesis protein thiG
publication title Crystal structure of TTHA0676 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Biosynthetic protein
total genus 11
structure length 64
sequence length 64
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2006-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2htmE00
2K9XA 3AH7A 5G5GA 4WWMA 3HRDD 1J7BA 1RM6C 1WXQA 1XLOA 2E3TA 2K22A 1J7AA 1FXAA 4HROA 3AEFB 1GAQB 2Q5WD 1QT9A 2PVOD 3AEDB 2MJEA 2WU2B 1NI3A 1WYGA 3KWLA 3B2FA 1T3QA 1VJKA 1N5WA 1PUTA 1GPXA 1AWDA 1UWMA 3LB8C 3HVZA 5H8YE 3CWIA 3SFEB 1JRPA 1PDXA 1FIQA 2EKIA 3VR9B 2QIEB 2Y5CA 1TKYA 1EWYC 1JWBD 3AEAB 1DOXA 2PKOA 1JWAD 1NVID 1KRHA 1TJEA 2CJOA 2WP9B 2K5PA 3AE5B 3NVYA 4JX1C 1FFVA 2WU5B 3DWMA 2G1EA 1L6UA 2PIAA 3ETRA 3FC4A 3NVZA 2MH7A 2WS3B 3ABVB 4A9AA 1JW9D 1QF6A 4HRSA 2WDVB 3W9CB 1V97A 2BT6A 3VR8B 1E9MA 5EE9A 1OQRA 1V8CA 5EE3A 2PVGC 1JQ4A 4KX6B 2WQYB 3AEGB 3AV8A 2HTME 5G5HA 1NEKB 2BS3B 1VDVA 1QOAA 2JX5A 2W54A 4USAA 3NVVA 3BIID 1NYRA 1AYFA 1CZPA 2H88B 3EUB2 3AE9B 3B2GA 3AN1A 3PO0A 3CIRB 4LTUA 1E0ZA 3SR6A 2CJNA 4ITKA 1E10A 5C2TB 2W3SA 1KF6B 1TKEA 5MPOA 2W55A 1XLQA 3AE7B 1FFUA 2N0SB 5AUKA 1ROEA 4WQMA 1SF0A 4YT0B 3W5VB 1FRRA 2DWQA 4ZHPA 3LXFA 1YJJA 2AX5A 1N63A 4US9A 1WRIA 4ZHOA 1TKGA 3P4SB 3AE1B 3NS1A 4YTPB 5EE0A 1YJIA 2W3RA 3WCQA 1DGJA 1ZXIA 1FM0D 1N5XA 3RPFC 3AE8B 1FMAD 2M19A 3AMZA 3P4RB 1OQQA 5C3JB 1SB3C 1DOIA 1CJEA 2B76B 3HUIA 3AEEB 3DWGC 1YQ3B 2MJ3A 4JWUC 2CU3A 1L0VB 1ZP0B 1RWSA 2M56B 1XO3A 2WLBA 5EE1A 5H92C 4YTMB 1I7HA 1QLBB 1RYJA 4US8A 1E6EB 3ZYYX 3B9JA 1N62A 5GXGB 1FO4A 1ZUD2 2BS2B 2L83A 4JWSC 4C80A 1A70A 3SFDB 3NVWA 4N59A 1N61A 2BS4B 3AEBB 3FAHA 3P1MA 4YSYB 1SIJA 1FXIA 1KFYB 5AUIA 1OFFA 3AB5A 3P4PB 2DBYA 2MJDA 3AE2B 2JQRB 4P6VF 1QOBA 1XLNA 2H89B 1E7PB 3VRBB 1XLPA 1FRDA 4C7ZA 1RFKA 1JALA 1VLBA 2L52A 1QOFA 2QJLA 3AE3B 1WWTA 1YQ4B 3L4PA 1L5PA 3P63A 4IDIA 4N58A 4YXDB 1L6VA 1B9RA 2KAJA 2WDRB 1IUEA 2FBWB 3P4QB 1JROA 1NENB 1J7CA 3AE4B 3W5UB 4YSZB 4YSXB 4ZOHC 1WGKA 3VRAB 1R7SA 2KMMA 3NRZA 2ACZB 2WDQB 4YTNB 1N60A 1TYGB 3AECB 4N6EB 4FXCA 4C7YA 1DOYA 1F0ZA 3AM9A 1NYQA 3AE6B 2OHFA 1ZOYB 1QOGA 1PFDA 2LEKA
chains in the Genus database with same CATH superfamily
2EMSA 4LNNA 2K0PA 1WJ4A 3M63B 3AULA 4KZ0A 1R4MB 1WMHB 1P0RA 5T8IA 3VVWB 3I63C 1L7YA 5TSSA 2KDEB 3JW0X 4KDLB 5J17A 1KRHA 3AE5B 3DPDA 2DNFA 3I57A 3KUDB 2NTTA 4FJVB 1P9DU 1JW9D 1MI0A 2KYWA 3K9PB 2MBBB 1UGMA 4G3XB 3EUB2 4RNAA 4EE2A 1SEBD 3SR6A 2W82A 1WGDA 1UBQA 1I4HA 1L4DB 2EMTA 2IZVB 1Z5SB 3TEZA 3L08A 2LJIA 5I4DA 3Q2AC 1V1OA 3BY4B 3NHEB 1YN4A 2V3PA 3RD2A 2G9HD 2DYOA 4XWWA 1TBEA 2KFJA 2UYZB 1ZW7A 2KK8A 3DWGC 3EGRA 2G4DB 4MH0E 4XE0A 4EFOA 3ZNZB 3HM3A 5IAAC 2CKHB 2DAFA 3FAHA 3P1MA 3V62A 1K51A 1VZ8A 1MJDA 3CSTA 4A3PA 2N7JA 2FUHB 3VRBB 4MEMA 1I35A 1V9JA 3IAM1 2FCQA 3NY5A 2E6XA 3RI7C 3DHGC 1YX6B 3Q8AA 2KC2A 3GP7A 2OHFA 3PSEB 3ZDTA 2JF5A 3NZUA 5G5GA 4DHZB 1WXQA 1IGCA 5DPWA 5C23A 4NAWB 4HDQA 4ANUA 1T3QA 1N5WA 1AWDA 2GBMA 3FKYA 3AEAB 4IM2A 1Y8RC 3JVZX 2K5PA 4JQWC 4JIOU 1E8WA 5G55A 2GRIA 2N7DA 1I42A 3U2SC 1V5TA 1EU3A 1HZ6A 2L3ZA 3BK1A 3IG3A 3OAWA 2AYOB 1FNVA 1VCBA 2GMIC 5C2TB 2ZEQA 3AE7B 3E56A 2BVCA 3H9DA 2LRWA 3KUZA 1I4PA 3RNGC 1YJJA 4RFBA 1N63A 1T0QC 4ASWC 2ZPNA 1TY0A 2W3RA 1XD3B 1ET6A 2N4FA 3DVNV 4FBJB 2Z59B 4BBNF 2RGFA 5DCNA 1J8CA 5D3DA 3WAPA 2WLBA 2M56B 3Q3MC 1DYQA 3DCGA 2KNBA 3PZ8A 2CHXA 1M94A 1AW7A 2MJDA 2KT7A 2BGFA 4A20A 4B9KA 2NPTA 4N58A 2N9LA 1WH3A 3SEBA 1ET9A 2D11A 4X57B 4A8XC 4P16A 3VRAB 3WAOA 1EF1A 3UI3A 5KHQA 1F0ZA 4ZRJA 5D2MB 1V80A 1PFDA 4TQ1A 2K39A 3DQVA 2PVOD 1CK1A 3DHHC 2DYMA 2BW2A 3QA8A 3VR9B 3OLMD 2BBCA 2SAKA 4LDTD 2UU7A 2CJOA 2BTEA 2G1EA 4F8CB 2WS3B 4EZLA 3MC8A 3LDZE 1QF6A 4IM3A 4XC2A 1HXYD 2IO1B 1E9MA 1WXVA 2TSSA 1AN8A 5EE3A 4WWNA 2JYEA 1GB4A 5CTRC 2NVUI 4XZ4A 1CZPA 4IC7B 3MFGA 5JHBA 2CHZA 1XLQA 4KIKA 3H7SA 1L4ZB 2KJHB 1C77A 2KDFB 1TZOA 2KLGA 3LJ3A 4AP4C 2KLCA 1S3SG 1FMAD 2ASQA 1SE3A 2IGGA 4MM3A 1YQ3B 1E8XA 3PHWB 2ICIA 1HZ5A 4MT5A 1ESFA 1VR9A 1FEHA 3R3MA 2OJRA 2WXFA 5E6JA 4C7ZA 2QJLA 3P63A 3JYUA 4ZYSA 1TGZB 2L8JA 1LFDA 4UDUC 1V1PB 1WGYA 4BOSC 4YSZB 1Q1OA 3T8MA 1E7VA 1EWCA 3NRZA 1MVKA 2PE6B 2AQ1B 1PGAA 3H7PB 1J7AA 2WXRA 2KWUB 2PMVA 3B08A 1MHXA 3NS8A 1KLVA 2KWDA 1UWMA 3HM6X 1GC6A 1JRPA 4A55A 3I9V1 1C9FA 1L0XB 3IAS1 2NMQA 2WXPA 5D94A 1WMHA 3ETRA 2PIAA 2UWQA 4WH4A 4FADA 2I2YA 3EECA 5EE9A 2ZW1A 2ZCCA 1IPGA 2YEPB 1QOAA 1UZXB 1AYFA 3B2GA 2M1MA 3QK0A 4DHZE 4P7IA 5MPOA 4A6QA 4RCOA 2LGXA 1YMHE 2K25A 1UELA 1E5WA 2C5LC 4KGTA 4YTPB 2MW5A 2K1FA 1YJIA 3OG5A 3WCQA 1ZXIA 1N5XA 3RZFA 1GG3A 4GIVA 3QQ8B 1OQQA 1WZ0A 2WXKA 1D5XC 2AWTA 2LXCA 1CJEA 1FNWA 4YTMB 2MWSB 3NG0A 4JL9A 5GXGB 3EA6A 1RAXA 2BS2B 4ZRQA 4KSLC 3ZNID 3ZJTA 2DZIA 3TEXA 1N61A 3AEBB 4EZKA 2LHDA 3A1QB 4WAAA 2IJ0A 4GDKB 1V2YA 3AB5A 1RFKA 1JALA 1VLBA 2L05A 3ML8A 3AU4A 4F7ZA 5HG2A 2FCMA 2JT4B 1F77A 2LFIA 1NENB 4S17A 5BO4B 4K3CA 1BUIC 3VUXA 4E71A 3RMKC 3RPFC 4HLEA 3GOEA 3TIXA 4ACFA 1TS5A 3HVDA 2LXAA 2QHOA 4AQ7A 3UIOB 3A9JB 3LB8C 2KVZA 1D3ZA 1EF5A 2V3NA 3N9YC 1HQRD 1U4AA 1ZPSA 4RM9A 2KDBA 2JZPA 3HIZA 1FXTB 3V6CB 4D2KA 1P7FA 2PPHA 5D6JB 3PRZA 2PVGC 2LGDA 1UWXA 1HE8A 3TCAA 1NEKB 2JX5A 3QHTA 1B1ZA 2GBKA 1Q0WB 4W9CA 2IY0B 2D3BA 2RDHA 4RF1A 2KC1A 4OVZA 2AX5A 4EOYA 4TV3A 3ZNHB 3AE1B 5IOIA 4WIPA 4IWPA 1DGJA 3UQAA 4FLHA 1WJNA 1IYFA 4KIKB 1C78A 2BPSA 2FAZA 2V0GA 1DOIA 4BZAA 3NOBA 2KMCA 2NTSA 1I7HA 1E6EB 4M8MA 1N62A 4NPNA 4AWJA 2LD9A 2BYFA 3N20C 4HCNB 3AI5A 2GB1A 1VZ7A 2X8XX 2H89B 2VZKD 4BKSD 3DBLI 2INNE 5JXVA 3N30A 2WWZA 3W5UB 4WJPA 3A9KB 2JZ3B 1ZDVA 3E9SA 3RZWC 2BQQA 1J0GA 3DBHI 4NJCA 3VUWA 4CYEA 3AEFB 2WXNA 2N9PC 1KLUD 1VJKA 2MA9B 5FK9C 1HTQA 2EKIA 3VXWA 4MGIE 2PEAA 1EWYC 2KWCA 4QAYA 1F2RC 3Q3OC 4XGAB 3UF8A 2GLSA 1FFVA 4OZCA 3OJ4B 1V97A 3V6EB 3CF6E 2MBOA 2N9XA 3VTUA 3UQBA 1FD6A 1Z2MA 5TR5A 2N1WA 4A3OA 2EELA 1FCCC 3ZJVA 5BMGA 2KDIA 3DBRB 2KDMA 1ROEA 3QIJA 1SJED 3Q8CA 4KGRA 1WRIA 3GE3C 5CX3A 4BFRA 2M19A 3AMZA 5C1ZA 3Q8FA 1SB3C 2CU1A 2JZZA 1JWUD 5AEKB 2Y3AA 1TZ1A 2Z8LA 3R7QA 5DPTA 3NVWA 4IWQA 3QWZB 1C4CA 3JSVB 5AUIA 2G4SA 1T0RC 2JQRB 3SU8X 1MFWA 2KOXA 4Q2JA 4GLSC 1WWTA 3BVZA 3CSFA 2KAJA 1B9RA 1D5ZC 4YSXB 1WIAA 4KSKC 2J42A 1WJUA 2ZCBA 2WDQB 1WE6A 1GC7A 5BYRA 3AM9A 4HWIB 1QILA 3VDZA 4NJ7A 1V1PA 1WGGA 3L10B 5HHDG 4HPMB 5IKCM 1KH0A 1YN5A 3QARA 2PJHA 3B2FA 3L17A 1EM7A 1GPXA 3H7PA 3V05A 3U8ZA 2KVRA 4HPLB 1D4BA 2BWFA 4GSWA 2IGDA 2INDC 2QMTA 3KVFB 4LNFA 3DOWA 3ZW3A 3Q3JA 4CO7A 1WF9A 4LDTB 2INPE 4ZDVA 1WYWB 4G0NB 1SGHA 2B3AA 2HTME 5FR3A 3BIID 3VH3B 2FCSA 2J7QB 3AE9B 3AN1A 1J19A 3PO0A 4LTUA 1F52A 2JRHA 4ITKA 4TUUA 3KQ4A 4PYUA 3ZNGC 2YEPF 2GBJA 4YT0B 1QZEA 2RD0A 4II2B 1SIFA 1MG8A 5BYSA 4IM0A 5IA7A 3PVLA 2O6VD 2WYQA 2V9HA 2K3UA 2SEBD 3H1UA 3FILA 1RWSA 3BZDB 4DQOC 4US8A 4I6NB 1JWMD 3PZ7A 1A5RA 1FCLA 4C80A 1OFFA 3P4PB 2LJ5A 4HCPB 3W9CB 4RGMA 3RFZB 3A1QA 4GDKA 2MRPA 1C1YB 3QC8B 3P4QB 4DBGA 3AE4B 3N3KB 3X23A 3HK0A 4LCDE 2RDGA 2KWVB 1R7SA 4YTNB 2HE7A 3ZXVA 3ZGZA 5JZEB 3ZQ4A 2IO3B 1ZOYB 2IPKD 5D3IB 1P1AA 5LNK1 3N1ZC 3L16A 2ZZPB 2XK5B 3Q3FA 1NI3A 1YNTE 3RT3B 3RUIB 5CHVC 2LMCA 4W9IA 4RGNA 4HEA1 4HKZE 2M4NA 4DDID 4JPSA 2IDYA 2MSED 4HPPA 2XBBC 2WU5B 3A4RA 3KYDD 4FULA 1GB1A 1ACCA 3A9JA 2K8CA 3ZUNA 2KZRA 4R3DA 2NBVB 2WQYB 3AEGB 2L0FA 2D3GA 2MX2A 2C7MB 4GXBA 2KQ7A 4HXDA 3CIRB 4K1RB 2DHZA 2KXJA 4K7UA 5D7GA 5AUKA 4E74A 1TKGA 5IN7A 3ZTDA 3NS1A 1T6BX 3PLVA 4GDLB 3DDCB 2I1JA 3R2TA 1Q5WB 3P42A 2O2VA 2REXA 3R7RA 2CU3A 3C19A 3IXSA 5E6OA 2BYVE 1I4QA 3BINA 1YIWA 3U7ZA 1ZUD2 2L83A 1FPYA 4N59A 1SIJA 2YLMA 1WGHA 4P6VF 4WWPA 2DX5B 2RMMA 4IKGA 4MH8A 3AE3B 2GBNA 4YXDB 3MJWA 4NAMA 4LLGM 1KM7A 2LZ6A 4K7SA 3T9LA 2RR9A 1DOYA 1WXAA 3D32A 4IW0A 4RH6A 3VHTC 3M95A 1J7BA 3U30A 2K22A 4HROA 3A9KA 4XDDA 1WXMA 2A5UA 2L76A 4W9GA 2C60A 2J52A 4ANWA 1ZE3D 4PS8A 1LXDA 2QIEB 2Y5CA 3ONSA 5CHFA 3NUHB 1FNUA 1OGWA 3DWMA 4N9F4 3R2IA 3ZJUA 3RN9C 3PS6A 3AXCA 2LGYA 2WNMA 4LJPB 2RPQA 1JQ4A 2KX0A 2D07B 5JHAA 3W5VB 2HTHA 4KKIA 2ZVNA 1E8YA 2BKFA 3VTWA 1PYWD 1EO6A 2IYDB 4M00A 1TIFA 2I38A 5EDSA 1SE4A 3DVNU 4FHKA 3P2BA 3BVGA 2JU6X 1H4RA 2JWUA 2KJRA 1FM0D 4AOFA 3AE8B 2NR2A 2C7HA 2KACA 1E10A 4MSMB 1XO3A 4TQ0A 1QKZA 4W9EA 2K8BA 4LNKA 1WRDB 3FILB 1JMLA 3GZNI 2NS5A 1QOFA 4IDIA 2X38A 3SHQA 3JSVA 2MP2A 1XXGA 4O1NA 4K3BA 3VQIA 2D10A 2IGHA 2DENB 1R4MI 2J4XA 1GUAB 4M01A 3VH4B 3ZLZA 3KW5B 2QCZA 2D3CA 2RDBC 2J53A 2DAJA 3AH7A 3EC8A 1UF0A 1NI2A 1FXAA 2PE9A 4MGKE 4DHJD 3KWLA 4GOCA 1PUTA 3NJTA 1V5OA 2LUEA 1PDXA 1I4GA 3APCA 3O13A 3RNBC 2WP9B 3BWUD 1L6UA 2A4ZA 3C0RB 4BKGA 4HKQA 1YD8U 4KGSA 3V60A 4MJSB 1IGDA 2M0XA 4EEWA 4REZA 2JRIB 2BS3B 2W54A 3SD5A 1NYRA 4S0RA 2Y5BB 1ZKHA 3WA0A 2NCNA 1UH6A 4G50A 1IP9A 3AU5A 2LI5A 2FIDA 2N0SB 4B6WA 2NBWB 1N6ZA 3LXFA 4BAXA 1SBBB 3KUCB 5AZGA 2WXIA 1C79A 1UGJA 2L32A 3O65B 1ZP0B 2LGSA 2HJ8A 1NBFC 2LGIA 1A70A 1V6EA 2BS4B 2ZPYA 2QEJC 2ZW0A 2KMAA 3U7DA 2O2VB 3AE2B 1WR1A 4BVUC 2JPHA 1XCTL 2KFKB 4XX5A 2NBUA 1E90A 1M4VA 3VAWA 3ZRCA 1SSNA 4GB9A 3N32A 1ZDXA 2JWZA 1WY8A 2LVQA 1BMLC 3CMMB 3RULA 1E8ZA 4WJOA 1QOGA 4E3CA 4G11A 4DXGA 3APFA 1XLOA 2G45B 2D5GA 2MJEA 1I4XA 1OEYJ 2XNAC 1WSPA 3EFCA 4EZJA 3UGBB 5H8YE 2FCNA 1KLGD 1TKYA 3GB1A 4I6PA 3PHXB 1NVID 1L2NA 4W9HA 2XK5A 1XEEA 1ZGUB 3W2DA 2J0MA 4MGYE 1NDDA 3PTFC 2KTFA 1V81A 4XWTA 1K50A 1YQBA 3ML9A 3L0WB 1YX5B 3KLSX 3MC0B 5JH5C 2XEWA 3ZVVA 2CJNA 2L00B 1K52A 3EHVA 3NZ3A 3ZTCA 4K7WA 3NZSA 4GN1A 4OHJA 3R66C 1CQVA 2DWQA 2KN4A 1SXTA 2AL3A 4ARCA 4PT5A 3P4SB 4BBNC 2MBEA 2FNJB 2YVCA 2M17A 2LVPA 1KOTA 4WAFA 3WALA 5KHOA 4W9FA 5GMVA 3AEEB 2QC8A 2HJ1A 2I1KA 4DXFA 3GZNB 4GDLA 4NQLB 2MBQA 3SFDB 1FXIA 1YOVB 3U52E 2M8SA 4W9JA 1XLNA 3TEYA 1BXTA 3WANA 2WXHA 1L5PA 1E7UA 2DLBA 3WIMA 3PZDA 1JROA 3TMPB 4J6IA 2KN5A 3T3NA 1GNUA 1ENFA 3Q3NC 4KV2A 4TSSA 4N6EB 4FXCA 2BYEA 2IO0B 2MP2B 5IP4D 3ZKJC 3KH0A 1UBIA 1TY2A 4DDGD 4TMAB 3CWIA 3SFEB 5L95C 2K6QA 4LNIA 1JWBD 4JX1C 5LXHA 4HJGE 4ANVA 2QILA 4CQNA 3FC4A 1TT5B 1TS3A 4HRSA 2WDVB 1IBXB 4J3OD 4IWOA 4M8NA 4KX6B 3W1SC 4MELA 1D5MC 1D6EC 4USAA 2H88B 1XF5L 2BB6A 4DWFA 2R2QA 3ZDMC 1TS2A 2W3SA 1TKEA 2ON8A 2JSVX 4AS1A 2FE8A 3Q14C 1R4NI 2KQ4X 1RLFA 2HD5B 2L7RA 1JRUA 1OEYA 2AQ3B 3P4RB 5AZFA 2J0JA 2W9NA 2KO3A 2MJ3A 4L23A 4ZHPA 1WM3A 2ZNVB 4KDIC 3RNEC 1FO4A 3IFWB 4HK2A 4JWSC 4HDOA 4YSYB 1VD2A 4C56C 1BT0A 1E7PB 3IT4B 2KTRB 1RRBA 1WE7A 3TUOA 4FHJA 2V4LA 3MHSD 1AARA 4RMAA 3TBLD 2WDRB 2IO2B 3Q6BA 4ZRPA 4C00A 1J7CA 4GGQA 1C3TA 3RCZA 1WGKA 2RPVA 3N1XC 1SE9A 4PS3A 3I3TB 4C7YA 3DBLB 1LGRA 3L13A 1NYQA 2M0AA 1G6JA 4ZRIA 3QCAA 2LEKA 1WX7A 1HA5A 1V49A 2LASA 3Q69A 1RM6C 3Q8EA 4BKSA 2AEHA 2CS4A 2LWPA 1F9JA 1K8RB 2JXTA 2CHWA 3PRMB 1WYGA 2GBRA 3DBHB 1FIQA 3I5JC 1HEZE 1JWAD 1WZ3A 5LLIA 2PTLA 3NVZA 1P98A 4OZBA 4NQKE 4FJYA 2JYTA 4P1BC 2FUG1 4HJKA 2PLPA 3QJZA 2IBIB 1CMXB 3AV8A 1KTKA 1YN3A 4H2AA 5BMIA 3ENEA 2WXQA 4DK5A 3NVVA 1E0ZA 3OWEB 2CR5A 4MJSA 3A4SC 3MC9A 4OVUA 4KVGB 2DZJA 4FN2A 3IT6B 1FRRA 2MCNB 4BOZB 4K81A 4C4VA 3MP9A 1C4PA 2LUMA 4NY0A 4KZCA 2QSDA 2K8HA 3PREA 1QLBB 1RYJA 3OJ3A 1X1MA 1C4AA 5BMHA 2R61A 4WJQA 4B0EA 1F2RI 2AL6A 4DXAB 3IVFA 2WGSA 1QOBA 1VRAB 3TSSA 1L0YB 4M02A 3KYCD 1K53A 3L4PA 3K9OB 4YL8A 1UUPA 1V86A 1IUEA 3RNAC 1XT9B 4M0WA 2XN9C 3ZIMA 3TEWA 2OOBB 2KFKA 2MBHA 2ZNVC 3PLUA 2EKEC 2WDTB 2N9EB 4L1BA 4WWMA 1GAQB 1QT9A 4NNJB 1SE2A 5DPRA 2PW9A 3L54A 1EU4A 1SJHD 4OZAA 3W1SA 4WWOA 4LK0M 4DHJB 3NVYA 3IHPC 2ZJDA 2WXOA 2R2OA 3BVMA 2MH7A 2OEDA 1WGRA 3RNFC 3ZXRA 1OQRA 4XYCA 5FKAC 4LNOA 2Z0EB 3DHIC 3H6NA 2KJ6A 5G5HA 5LXIB 3ALBA 2ZVOA 1R4NB 3MTNB 1TTNA 1PGXA 2WXMA 2W55A 1FFUA 3V3XA 1WJ6A 3B0AA 4MACA 2L1AA 1UNSA 3R8BA 2GI9A 4ZHOA 5EE0A 1T0YA 5G2NA 2LHEA 3DVGY 2GOWA 2V1YA 1TS4A 4ICUA 4ZRKA 2J0KA 4ANXA 3TL5A 2B76B 2K6DB 5HI1A 5H92C 1T5XD 3DBSA 3PT2B 3B9JA 2N9KA 4PK1A 4L2YA 2FIFA 1ZXHA 5L83A 1JCKB 4W9LA 3TJPA 2Z0DB 5J18A 2O6VA 1FRDA 4WQMA 4ICVA 4TKNA 4YWGG 4RGOS 3PRPB 2MLBA 4I6LB 2C9WB 5FR6A 1HTOA 2BYTA 1WM2A 1F1HA 2KX3A 2KMMA 1MPEA 2Y5PA 1TYGB 3AECB 2JVCA 3AE6B 1LM8B 2WXGA 2AQ2B 2K9XA 4A90A 2E3TA 3GE8C 2Q5WD 1OTRB 4MGZE 1P7EA 4WJNA 4IUMB 3ZO5B 1YJ1A 2LRUA 3W1YA 3EFUA 1UD7A 2JUOA 1C76A 4MDKE 1GOZA 2V4IB 2PKOA 2VZKB 1LO5D 1H8CA 2DZKA 1JWSD 1S1QB 1MHHE 3VUYA 3V61A 4A9AA 1P3QU 2WX0A 2OJWA 3DVGX 3DBRI 4NJ6A 5J2RA 3QAQA 3UIPB 4NZLB 2KKCA 3QX1A 3M62B 1IBXA 2LVOA 1KF6B 3BYYB 5E6PA 2L0TA 1RFAA 2BKRB 4US9A 5E6NA 4AJWA 4FJZA 2DYBA 4AUQC 3VFKA 1WX8A 2VRRB 1WFYA 3PGEA 2BWES 4B0MA 1LQBA 2KANA 4WQOB 4GU2A 1L0VB 1XQQA 1MG4A 3ZYYX 3ECIA 4C4VB 3IBEA 3RNCC 2NPTB 1WX9A 2ONQA 3GS2A 4IG7B 4JLCA 1KJTA 2L52A 3MJ5A 3M3JA 2JXXA 1L6VA 1XCQL 1STEA 3X0WA 4PS7A 4ZOHC 2KTRA 2MEKA 5DPSA 1Y56A 4EUTA 4F1SA 4FA6A 5BYQA 4NAWA 2WXJA 3UINB 3H8HA 4ARIA 4OVVA 3Q8BA 4JE3B 3HRDD 3U4EG 3SDLC 4AJYB 4M0WB 3AEDB 2WU2B 4BKTA 1ISNA 3LYYA 4ZYNA 3HVZA 3RYTA 3T3OA 3HHMA 4JGHB 1DOXA 5HFYA 2MHJA 1TJEA 4PYZA 5HKHA 4B95A 4RF0A 3VTVA 2JY6A 3ABVB 1QQRA 3WAMA 2BT6A 3VR8B 2G3QB 3PPAA 4W9KA 1V8CA 2KHWB 4RM8A 3KWVA 2WX1A 4IOIE 2KQSA 1VDVA 4II3B 2INCC 4HVBA 1WXSA 2KD0A 2VH1A 3BYTB 4URKA 1VZ6A 2BB5A 2D3AA 2C7NB 1SF0A 2QDFA 3A33B 1PGBA 2DZMA 4EKUA 2N1VA 4MM3B 5IO9A 3URYA 1OQYA 4LJOB 1PQSA 5C3JB 3HUIA 4JWUC 1WR6E 5EE1A 3APDA 2WXLA 3C8YA 5CHWA 4CHKA 3S2AA 4KKJA 4MSQB 3ZRFA 3N1YC 3B1LX 4OW0A 1KFYB 3J9CA 2D2QA 2DBYA 5AZHA 3PV1A 4XDCA 2VH2A 4RGTA 2V3SA 1XLPA 2IY1B 1YQ4B 3BK2A 1T0SC 1WI0A 2N7EA 3MHZA 4W9DA 2FBWB 1GJZA 1EUVB 1I4RA 2MQJA 2BF8B 2O6VB 4P1CC 2ACZB 1N60A 4WURA 2HDEA 1Q10A 4GMVA 2RSUA 2WHIA
chains in the Genus database with same CATH topology
3Q69A 1J7BA 1RM6C 1TS5A 3Q8EA 2K0PA 2K22A 3HVDA 4HROA 4XDDA 2JXTA 1WYGA 2J52A 4AQ7A 5T8IA 1ZE3D 3LB8C 2V3NA 1FIQA 3N9YC 2QIEB 2Y5CA 1HQRD 5TSSA 1ZPSA 1HEZE 2JZPA 1JWAD 1KRHA 3NUHB 3AE5B 1FNUA 3I57A 2PTLA 3DWMA 3NVZA 3R2IA 2NTTA 3ZJUA 4D2KA 1JW9D 1MI0A 4OZBA 1P7FA 2JYTA 2FUG1 2WNMA 2PVGC 1JQ4A 2PLPA 1UWXA 3AV8A 5BMIA 1KTKA 1YN3A 4H2AA 1NEKB 2JX5A 2WXQA 3NVVA 3EUB2 3W5VB 4RNAA 4EE2A 1E0ZA 1SEBD 3OWEB 4KKIA 3SR6A 1B1ZA 2W82A 1I4HA 1L4DB 1PYWD 2RDHA 3TEZA 3IT6B 4RF1A 2LJIA 5I4DA 1FRRA 2I38A 4OVZA 1SE4A 1V1OA 2AX5A 1YN4A 2V3PA 3BVGA 3AE1B 2JU6X 4WIPA 1DGJA 2JWUA 1FM0D 3MP9A 2G9HD 1C4PA 3AE8B 2DYOA 1C78A 4XWWA 2LUMA 2V0GA 1DOIA 2KACA 3DWGC 3EGRA 2QSDA 1E10A 2NTSA 1XO3A 1I7HA 1QLBB 4TQ0A 1RYJA 4XE0A 1E6EB 1C4AA 1QKZA 5BMHA 1N62A 2R61A 4B0EA 3FAHA 3P1MA 1F2RI 1K51A 1VZ8A 2GB1A 1VZ7A 3FILB 1JMLA 1QOBA 1VRAB 2H89B 2N7JA 1L0YB 3TSSA 3VRBB 1K53A 3L4PA 1QOFA 4IDIA 2VZKD 2INNE 2X38A 5JXVA 1UUPA 3IAM1 1IUEA 1XXGA 4O1NA 3W5UB 4M0WA 3VQIA 2E6XA 2XN9C 3TEWA 2IGHA 3Q8AA 2J4XA 1ZDVA 3E9SA 3GP7A 2OHFA 2J53A 4NJCA 3AH7A 5G5GA 4L1BA 4WWMA 1WXQA 1FXAA 3AEFB 1GAQB 1IGCA 1QT9A 2WXNA 1SE2A 2PW9A 3KWLA 1EU4A 4NAWB 1KLUD 1SJHD 1T3QA 1VJKA 1N5WA 1PUTA 4OZAA 1AWDA 3W1SA 5FK9C 4LK0M 1PDXA 2EKIA 1I4GA 1EWYC 3O13A 3AEAB 1F2RC 3NVYA 2WP9B 2K5PA 2WXOA 3BWUD 1FFVA 4OZCA 1L6UA 3BVMA 2MH7A 4HKQA 4KGSA 2GRIA 2OEDA 1V97A 1OQRA 3U2SC 5FKAC 1EU3A 1IGDA 1HZ6A 4REZA 5G5HA 3BK1A 1FD6A 2BS3B 2W54A 1NYRA 1FNVA 2EELA 1FCCC 3ZJVA 1PGXA 2WXMA 5BMGA 5C2TB 2W55A 3AE7B 1FFUA 3E56A 3V3XA 2KDMA 2N0SB 1ROEA 4MACA 1SJED 2L1AA 1UNSA 1I4PA 3R8BA 3LXFA 1YJJA 4RFBA 1N63A 2GI9A 3Q8CA 1WRIA 4KGRA 4ZHOA 1TY0A 5EE0A 2W3RA 1SBBB 1ET6A 2LHEA 1TS4A 2M19A 3AMZA 2WXIA 3Q8FA 1SB3C 1C79A 2B76B 1UGJA 5D3DA 2L32A 1JWUD 2WLBA 1ZP0B 2M56B 5H92C 5HI1A 2Y3AA 1T5XD 2Z8LA 3B9JA 2N9KA 1DYQA 2LGIA 4L2YA 1A70A 3NVWA 1ZXHA 3PZ8A 2BS4B 1C4CA 1JCKB 2QEJC 2ZW0A 5AUIA 1AW7A 2MJDA 3AE2B 2JQRB 1XCTL 1FRDA 4Q2JA 4WQMA 4GLSC 4YWGG 1WWTA 4RGOS 1M4VA 4N58A 1SSNA 2N9LA 3BVZA 1B9RA 2KAJA 2BYTA 1D5ZC 3SEBA 4YSXB 1ET9A 4A8XC 1ZDXA 2J42A 4P16A 3VRAB 2KMMA 1MPEA 2WDQB 2Y5PA 3UI3A 1BMLC 1TYGB 3AECB 5BYRA 1F0ZA 3AM9A 1QILA 3AE6B 2WXGA 1QOGA 1V1PA 1PFDA 2AQ2B 4DXGA 2K9XA 4TQ1A 4A90A 5HHDG 1XLOA 2E3TA 2D5GA 2Q5WD 2PVOD 1CK1A 1KH0A 1YN5A 1I4XA 2MJEA 2DYMA 3B2FA 2XNAC 1WSPA 1EM7A 1P7EA 2BW2A 1GPXA 5H8YE 3VR9B 1C76A 2BBCA 1KLGD 1TKYA 1GOZA 3GB1A 2V4IB 2SAKA 3V05A 2PKOA 2VZKB 1LO5D 1NVID 2CJOA 2BTEA 1D4BA 1JWSD 1XEEA 2G1EA 2IGDA 1MHHE 2QMTA 2WS3B 3W2DA 4A9AA 1QF6A 1HXYD 1E9MA 2INPE 2TSSA 1AN8A 5EE3A 2JYEA 1GB4A 4XWTA 1K50A 2HTME 5FR3A 4NZLB 3BIID 1CZPA 3AE9B 3AN1A 3KLSX 3MC0B 3PO0A 4LTUA 2CJNA 1IBXA 1K52A 4ITKA 3NZ3A 3MFGA 1KF6B 3BYYB 3KQ4A 1XLQA 4OHJA 2YEPF 1CQVA 4YT0B 1L4ZB 1C77A 2DWQA 2KN4A 1SXTA 4US9A 1TZOA 4ARCA 4PT5A 3P4SB 5BYSA 1FMAD 1SE3A 4WAFA 2IGGA 4B0MA 3AEEB 2K3UA 1YQ3B 2SEBD 3FILA 1L0VB 1RWSA 3BZDB 4DQOC 2ICIA 4US8A 3ZYYX 4DXFA 1JWMD 3PZ7A 1FCLA 1HZ5A 4C80A 3SFDB 4MT5A 1ESFA 1FXIA 3U52E 1OFFA 1VR9A 3P4PB 2ONQA 3GS2A 1FEHA 2WXFA 1XLNA 3TEYA 1BXTA 5E6JA 4C7ZA 2WXHA 2L52A 3W9CB 2QJLA 3P63A 1L5PA 3MJ5A 4RGMA 3RFZB 4ZYSA 1L6VA 1XCQL 2DLBA 1STEA 4UDUC 1V1PB 3P4QB 1JROA 3AE4B 4YSZB 4ZOHC 3T3NA 2MEKA 2RDGA 1Y56A 1ENFA 5BYQA 1EWCA 1R7SA 2WXJA 4TSSA 3NRZA 4YTNB 1MVKA 4N6EB 4FXCA 3H8HA 4ARIA 3ZGZA 2AQ1B 1PGAA 3ZQ4A 1ZOYB 2IPKD 3Q8BA 4JE3B 5D3IB 3HRDD 5LNK1 3U4EG 1J7AA 3AEDB 2WXRA 2WU2B 2PMVA 1NI3A 1MHXA 1YNTE 2KWDA 1TY2A 4TMAB 2LMCA 1UWMA 3LYYA 3HVZA 3CWIA 3SFEB 1JRPA 4HEA1 3I9V1 4RGNA 4A55A 4HKZE 1C9FA 1JWBD 3T3OA 4JPSA 1L0XB 3IAS1 1DOXA 2NMQA 5HFYA 2IDYA 1TJEA 2WXPA 4JX1C 4RF0A 4HJGE 2WU5B 2QILA 3ETRA 2PIAA 3FC4A 4WH4A 4CQNA 1TS3A 3ABVB 1GB1A 2I2YA 1QQRA 4HRSA 1ACCA 2WDVB 2BT6A 3VR8B 5EE9A 1IBXB 4J3OD 2ZW1A 1V8CA 4R3DA 4KX6B 2WQYB 3AEGB 1D5MC 3KWVA 4IOIE 2YEPB 1D6EC 1VDVA 1QOAA 4USAA 2H88B 1AYFA 1XF5L 2BB6A 3B2GA 3CIRB 1TS2A 3BYTB 2W3SA 1TKEA 1VZ6A 5MPOA 2ON8A 2BB5A 2JSVX 4A6QA 4AS1A 5D7GA 5AUKA 1SF0A 4RCOA 2FE8A 1PGBA 1YMHE 4MM3B 2KQ4X 1TKGA 4KGTA 3NS1A 3URYA 1T6BX 4YTPB 1YJIA 3WCQA 1ZXIA 1N5XA 4GDLB 3R2TA 2AQ3B 3P4RB 3P42A 1OQQA 5C3JB 2WXKA 1D5XC 1CJEA 3HUIA 1FNWA 4JWUC 2MJ3A 4L23A 2CU3A 3IXSA 4ZHPA 5EE1A 4YTMB 1I4QA 2WXLA 3C8YA 3U7ZA 1FO4A 5GXGB 1ZUD2 2BS2B 3EA6A 2L83A 4JWSC 4KKJA 4ZRQA 3ZJTA 4N59A 3TEXA 1N61A 3AEBB 2LHDA 2IJ0A 4GDKB 4YSYB 1SIJA 4OW0A 1KFYB 3J9CA 4C56C 3AB5A 2DBYA 4P6VF 4XDCA 4RGTA 1E7PB 2RMMA 1XLPA 3IT4B 4IKGA 4MH8A 1RFKA 1JALA 1VLBA 3AE3B 3TUOA 1YQ4B 3BK2A 4YXDB 5HG2A 4NAMA 3MHZA 4LLGM 2WDRB 1F77A 2LFIA 2FBWB 4ZRPA 1NENB 1J7CA 1I4RA 1WGKA 2RPVA 1BUIC 2ACZB 1N60A 1DOYA 4C7YA 4WURA 1NYQA 2M0AA 2HDEA 1Q10A 3RPFC 2LEKA 4RH6A 1HA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9X A;  3AH7 A;  5G5G A;  4WWM A;  3HRD D;  1J7B A;  1RM6 C;  1WXQ A;  1XLO A;  2E3T A;  2K22 A;  1J7A A;  1FXA A;  4HRO A;  3AEF B;  1GAQ B;  2Q5W D;  1QT9 A;  2PVO D;  3AED B;  2MJE A;  2WU2 B;  1NI3 A;  1WYG A;  3KWL A;  3B2F A;  1T3Q A;  1VJK A;  1N5W A;  1PUT A;  1GPX A;  1AWD A;  1UWM A;  3LB8 C;  3HVZ A;  5H8Y E;  3CWI A;  3SFE B;  1JRP A;  1PDX A;  1FIQ A;  2EKI A;  3VR9 B;  2QIE B;  2Y5C A;  1TKY A;  1EWY C;  1JWB D;  3AEA B;  1DOX A;  2PKO A;  1JWA D;  1NVI D;  1KRH A;  1TJE A;  2CJO A;  2WP9 B;  2K5P A;  3AE5 B;  3NVY A;  4JX1 C;  1FFV A;  2WU5 B;  3DWM A;  2G1E A;  1L6U A;  2PIA A;  3ETR A;  3FC4 A;  3NVZ A;  2MH7 A;  2WS3 B;  3ABV B;  4A9A A;  1JW9 D;  1QF6 A;  4HRS A;  2WDV B;  3W9C B;  1V97 A;  2BT6 A;  3VR8 B;  1E9M A;  5EE9 A;  1OQR A;  1V8C A;  5EE3 A;  2PVG C;  1JQ4 A;  4KX6 B;  2WQY B;  3AEG B;  3AV8 A;  2HTM E;  5G5H A;  1NEK B;  2BS3 B;  1VDV A;  1QOA A;  2JX5 A;  2W54 A;  4USA A;  3NVV A;  3BII D;  1NYR A;  1AYF A;  1CZP A;  2H88 B;  3EUB 2;  3AE9 B;  3B2G A;  3AN1 A;  3PO0 A;  3CIR B;  4LTU A;  1E0Z A;  3SR6 A;  2CJN A;  4ITK A;  1E10 A;  5C2T B;  2W3S A;  1KF6 B;  1TKE A;  5MPO A;  2W55 A;  1XLQ A;  3AE7 B;  1FFU A;  2N0S B;  5AUK A;  1ROE A;  4WQM A;  1SF0 A;  4YT0 B;  3W5V B;  1FRR A;  2DWQ A;  4ZHP A;  3LXF A;  1YJJ A;  2AX5 A;  1N63 A;  4US9 A;  1WRI A;  4ZHO A;  1TKG A;  3P4S B;  3AE1 B;  3NS1 A;  4YTP B;  5EE0 A;  1YJI A;  2W3R A;  3WCQ A;  1DGJ A;  1ZXI A;  1FM0 D;  1N5X A;  3RPF C;  3AE8 B;  1FMA D;  2M19 A;  3AMZ A;  3P4R B;  1OQQ A;  5C3J B;  1SB3 C;  1DOI A;  1CJE A;  2B76 B;  3HUI A;  3AEE B;  3DWG C;  1YQ3 B;  2MJ3 A;  4JWU C;  2CU3 A;  1L0V B;  1ZP0 B;  1RWS A;  2M56 B;  1XO3 A;  2WLB A;  5EE1 A;  5H92 C;  4YTM B;  1I7H A;  1QLB B;  1RYJ A;  4US8 A;  1E6E B;  3ZYY X;  3B9J A;  1N62 A;  5GXG B;  1FO4 A;  1ZUD 2;  2BS2 B;  2L83 A;  4JWS C;  4C80 A;  1A70 A;  3SFD B;  3NVW A;  4N59 A;  1N61 A;  2BS4 B;  3AEB B;  3FAH A;  3P1M A;  4YSY B;  1SIJ A;  1FXI A;  1KFY B;  5AUI A;  1OFF A;  3AB5 A;  3P4P B;  2DBY A;  2MJD A;  3AE2 B;  2JQR B;  4P6V F;  1QOB A;  1XLN A;  2H89 B;  1E7P B;  3VRB B;  1XLP A;  1FRD A;  4C7Z A;  1RFK A;  1JAL A;  1VLB A;  2L52 A;  1QOF A;  2QJL A;  3AE3 B;  1WWT A;  1YQ4 B;  3L4P A;  1L5P A;  3P63 A;  4IDI A;  4N58 A;  4YXD B;  1L6V A;  1B9R A;  2KAJ A;  2WDR B;  1IUE A;  2FBW B;  3P4Q B;  1JRO A;  1NEN B;  1J7C A;  3AE4 B;  3W5U B;  4YSZ B;  4YSX B;  4ZOH C;  1WGK A;  3VRA B;  1R7S A;  2KMM A;  3NRZ A;  2ACZ B;  2WDQ B;  4YTN B;  1N60 A;  1TYG B;  3AEC B;  4N6E B;  4FXC A;  4C7Y A;  1DOY A;  1F0Z A;  3AM9 A;  1NYQ A;  3AE6 B;  2OHF A;  1ZOY B;  1QOG A;  1PFD A;  2LEK A; 
#chains in the Genus database with same CATH topology
 2EMS A;  4LNN A;  2K0P A;  1WJ4 A;  3M63 B;  3AUL A;  4KZ0 A;  1R4M B;  1WMH B;  1P0R A;  5T8I A;  3VVW B;  3I63 C;  1L7Y A;  5TSS A;  2KDE B;  3JW0 X;  4KDL B;  5J17 A;  1KRH A;  3AE5 B;  3DPD A;  2DNF A;  3I57 A;  3KUD B;  2NTT A;  4FJV B;  1P9D U;  1JW9 D;  1MI0 A;  2KYW A;  3K9P B;  2MBB B;  1UGM A;  4G3X B;  3EUB 2;  4RNA A;  4EE2 A;  1SEB D;  3SR6 A;  2W82 A;  1WGD A;  1UBQ A;  1I4H A;  1L4D B;  2EMT A;  2IZV B;  1Z5S B;  3TEZ A;  3L08 A;  2LJI A;  5I4D A;  3Q2A C;  1V1O A;  3BY4 B;  3NHE B;  1YN4 A;  2V3P A;  3RD2 A;  2G9H D;  2DYO A;  4XWW A;  1TBE A;  2KFJ A;  2UYZ B;  1ZW7 A;  2KK8 A;  3DWG C;  3EGR A;  2G4D B;  4MH0 E;  4XE0 A;  4EFO A;  3ZNZ B;  3HM3 A;  5IAA C;  2CKH B;  2DAF A;  3FAH A;  3P1M A;  3V62 A;  1K51 A;  1VZ8 A;  1MJD A;  3CST A;  4A3P A;  2N7J A;  2FUH B;  3VRB B;  4MEM A;  1I35 A;  1V9J A;  3IAM 1;  2FCQ A;  3NY5 A;  2E6X A;  3RI7 C;  3DHG C;  1YX6 B;  3Q8A A;  2KC2 A;  3GP7 A;  2OHF A;  3PSE B;  3ZDT A;  2JF5 A;  3NZU A;  5G5G A;  4DHZ B;  1WXQ A;  1IGC A;  5DPW A;  5C23 A;  4NAW B;  4HDQ A;  4ANU A;  1T3Q A;  1N5W A;  1AWD A;  2GBM A;  3FKY A;  3AEA B;  4IM2 A;  1Y8R C;  3JVZ X;  2K5P A;  4JQW C;  4JIO U;  1E8W A;  5G55 A;  2GRI A;  2N7D A;  1I42 A;  3U2S C;  1V5T A;  1EU3 A;  1HZ6 A;  2L3Z A;  3BK1 A;  3IG3 A;  3OAW A;  2AYO B;  1FNV A;  1VCB A;  2GMI C;  5C2T B;  2ZEQ A;  3AE7 B;  3E56 A;  2BVC A;  3H9D A;  2LRW A;  3KUZ A;  1I4P A;  3RNG C;  1YJJ A;  4RFB A;  1N63 A;  1T0Q C;  4ASW C;  2ZPN A;  1TY0 A;  2W3R A;  1XD3 B;  1ET6 A;  2N4F A;  3DVN V;  4FBJ B;  2Z59 B;  4BBN F;  2RGF A;  5DCN A;  1J8C A;  5D3D A;  3WAP A;  2WLB A;  2M56 B;  3Q3M C;  1DYQ A;  3DCG A;  2KNB A;  3PZ8 A;  2CHX A;  1M94 A;  1AW7 A;  2MJD A;  2KT7 A;  2BGF A;  4A20 A;  4B9K A;  2NPT A;  4N58 A;  2N9L A;  1WH3 A;  3SEB A;  1ET9 A;  2D11 A;  4X57 B;  4A8X C;  4P16 A;  3VRA B;  3WAO A;  1EF1 A;  3UI3 A;  5KHQ A;  1F0Z A;  4ZRJ A;  5D2M B;  1V80 A;  1PFD A;  4TQ1 A;  2K39 A;  3DQV A;  2PVO D;  1CK1 A;  3DHH C;  2DYM A;  2BW2 A;  3QA8 A;  3VR9 B;  3OLM D;  2BBC A;  2SAK A;  4LDT D;  2UU7 A;  2CJO A;  2BTE A;  2G1E A;  4F8C B;  2WS3 B;  4EZL A;  3MC8 A;  3LDZ E;  1QF6 A;  4IM3 A;  4XC2 A;  1HXY D;  2IO1 B;  1E9M A;  1WXV A;  2TSS A;  1AN8 A;  5EE3 A;  4WWN A;  2JYE A;  1GB4 A;  5CTR C;  2NVU I;  4XZ4 A;  1CZP A;  4IC7 B;  3MFG A;  5JHB A;  2CHZ A;  1XLQ A;  4KIK A;  3H7S A;  1L4Z B;  2KJH B;  1C77 A;  2KDF B;  1TZO A;  2KLG A;  3LJ3 A;  4AP4 C;  2KLC A;  1S3S G;  1FMA D;  2ASQ A;  1SE3 A;  2IGG A;  4MM3 A;  1YQ3 B;  1E8X A;  3PHW B;  2ICI A;  1HZ5 A;  4MT5 A;  1ESF A;  1VR9 A;  1FEH A;  3R3M A;  2OJR A;  2WXF A;  5E6J A;  4C7Z A;  2QJL A;  3P63 A;  3JYU A;  4ZYS A;  1TGZ B;  2L8J A;  1LFD A;  4UDU C;  1V1P B;  1WGY A;  4BOS C;  4YSZ B;  1Q1O A;  3T8M A;  1E7V A;  1EWC A;  3NRZ A;  1MVK A;  2PE6 B;  2AQ1 B;  1PGA A;  3H7P B;  1J7A A;  2WXR A;  2KWU B;  2PMV A;  3B08 A;  1MHX A;  3NS8 A;  1KLV A;  2KWD A;  1UWM A;  3HM6 X;  1GC6 A;  1JRP A;  4A55 A;  3I9V 1;  1C9F A;  1L0X B;  3IAS 1;  2NMQ A;  2WXP A;  5D94 A;  1WMH A;  3ETR A;  2PIA A;  2UWQ A;  4WH4 A;  4FAD A;  2I2Y A;  3EEC A;  5EE9 A;  2ZW1 A;  2ZCC A;  1IPG A;  2YEP B;  1QOA A;  1UZX B;  1AYF A;  3B2G A;  2M1M A;  3QK0 A;  4DHZ E;  4P7I A;  5MPO A;  4A6Q A;  4RCO A;  2LGX A;  1YMH E;  2K25 A;  1UEL A;  1E5W A;  2C5L C;  4KGT A;  4YTP B;  2MW5 A;  2K1F A;  1YJI A;  3OG5 A;  3WCQ A;  1ZXI A;  1N5X A;  3RZF A;  1GG3 A;  4GIV A;  3QQ8 B;  1OQQ A;  1WZ0 A;  2WXK A;  1D5X C;  2AWT A;  2LXC A;  1CJE A;  1FNW A;  4YTM B;  2MWS B;  3NG0 A;  4JL9 A;  5GXG B;  3EA6 A;  1RAX A;  2BS2 B;  4ZRQ A;  4KSL C;  3ZNI D;  3ZJT A;  2DZI A;  3TEX A;  1N61 A;  3AEB B;  4EZK A;  2LHD A;  3A1Q B;  4WAA A;  2IJ0 A;  4GDK B;  1V2Y A;  3AB5 A;  1RFK A;  1JAL A;  1VLB A;  2L05 A;  3ML8 A;  3AU4 A;  4F7Z A;  5HG2 A;  2FCM A;  2JT4 B;  1F77 A;  2LFI A;  1NEN B;  4S17 A;  5BO4 B;  4K3C A;  1BUI C;  3VUX A;  4E71 A;  3RMK C;  3RPF C;  4HLE A;  3GOE A;  3TIX A;  4ACF A;  1TS5 A;  3HVD A;  2LXA A;  2QHO A;  4AQ7 A;  3UIO B;  3A9J B;  3LB8 C;  2KVZ A;  1D3Z A;  1EF5 A;  2V3N A;  3N9Y C;  1HQR D;  1U4A A;  1ZPS A;  4RM9 A;  2KDB A;  2JZP A;  3HIZ A;  1FXT B;  3V6C B;  4D2K A;  1P7F A;  2PPH A;  5D6J B;  3PRZ A;  2PVG C;  2LGD A;  1UWX A;  1HE8 A;  3TCA A;  1NEK B;  2JX5 A;  3QHT A;  1B1Z A;  2GBK A;  1Q0W B;  4W9C A;  2IY0 B;  2D3B A;  2RDH A;  4RF1 A;  2KC1 A;  4OVZ A;  2AX5 A;  4EOY A;  4TV3 A;  3ZNH B;  3AE1 B;  5IOI A;  4WIP A;  4IWP A;  1DGJ A;  3UQA A;  4FLH A;  1WJN A;  1IYF A;  4KIK B;  1C78 A;  2BPS A;  2FAZ A;  2V0G A;  1DOI A;  4BZA A;  3NOB A;  2KMC A;  2NTS A;  1I7H A;  1E6E B;  4M8M A;  1N62 A;  4NPN A;  4AWJ A;  2LD9 A;  2BYF A;  3N20 C;  4HCN B;  3AI5 A;  2GB1 A;  1VZ7 A;  2X8X X;  2H89 B;  2VZK D;  4BKS D;  3DBL I;  2INN E;  5JXV A;  3N30 A;  2WWZ A;  3W5U B;  4WJP A;  3A9K B;  2JZ3 B;  1ZDV A;  3E9S A;  3RZW C;  2BQQ A;  1J0G A;  3DBH I;  4NJC A;  3VUW A;  4CYE A;  3AEF B;  2WXN A;  2N9P C;  1KLU D;  1VJK A;  2MA9 B;  5FK9 C;  1HTQ A;  2EKI A;  3VXW A;  4MGI E;  2PEA A;  1EWY C;  2KWC A;  4QAY A;  1F2R C;  3Q3O C;  4XGA B;  3UF8 A;  2GLS A;  1FFV A;  4OZC A;  3OJ4 B;  1V97 A;  3V6E B;  3CF6 E;  2MBO A;  2N9X A;  3VTU A;  3UQB A;  1FD6 A;  1Z2M A;  5TR5 A;  2N1W A;  4A3O A;  2EEL A;  1FCC C;  3ZJV A;  5BMG A;  2KDI A;  3DBR B;  2KDM A;  1ROE A;  3QIJ A;  1SJE D;  3Q8C A;  4KGR A;  1WRI A;  3GE3 C;  5CX3 A;  4BFR A;  2M19 A;  3AMZ A;  5C1Z A;  3Q8F A;  1SB3 C;  2CU1 A;  2JZZ A;  1JWU D;  5AEK B;  2Y3A A;  1TZ1 A;  2Z8L A;  3R7Q A;  5DPT A;  3NVW A;  4IWQ A;  3QWZ B;  1C4C A;  3JSV B;  5AUI A;  2G4S A;  1T0R C;  2JQR B;  3SU8 X;  1MFW A;  2KOX A;  4Q2J A;  4GLS C;  1WWT A;  3BVZ A;  3CSF A;  2KAJ A;  1B9R A;  1D5Z C;  4YSX B;  1WIA A;  4KSK C;  2J42 A;  1WJU A;  2ZCB A;  2WDQ B;  1WE6 A;  1GC7 A;  5BYR A;  3AM9 A;  4HWI B;  1QIL A;  3VDZ A;  4NJ7 A;  1V1P A;  1WGG A;  3L10 B;  5HHD G;  4HPM B;  5IKC M;  1KH0 A;  1YN5 A;  3QAR A;  2PJH A;  3B2F A;  3L17 A;  1EM7 A;  1GPX A;  3H7P A;  3V05 A;  3U8Z A;  2KVR A;  4HPL B;  1D4B A;  2BWF A;  4GSW A;  2IGD A;  2IND C;  2QMT A;  3KVF B;  4LNF A;  3DOW A;  3ZW3 A;  3Q3J A;  4CO7 A;  1WF9 A;  4LDT B;  2INP E;  4ZDV A;  1WYW B;  4G0N B;  1SGH A;  2B3A A;  2HTM E;  5FR3 A;  3BII D;  3VH3 B;  2FCS A;  2J7Q B;  3AE9 B;  3AN1 A;  1J19 A;  3PO0 A;  4LTU A;  1F52 A;  2JRH A;  4ITK A;  4TUU A;  3KQ4 A;  4PYU A;  3ZNG C;  2YEP F;  2GBJ A;  4YT0 B;  1QZE A;  2RD0 A;  4II2 B;  1SIF A;  1MG8 A;  5BYS A;  4IM0 A;  5IA7 A;  3PVL A;  2O6V D;  2WYQ A;  2V9H A;  2K3U A;  2SEB D;  3H1U A;  3FIL A;  1RWS A;  3BZD B;  4DQO C;  4US8 A;  4I6N B;  1JWM D;  3PZ7 A;  1A5R A;  1FCL A;  4C80 A;  1OFF A;  3P4P B;  2LJ5 A;  4HCP B;  3W9C B;  4RGM A;  3RFZ B;  3A1Q A;  4GDK A;  2MRP A;  1C1Y B;  3QC8 B;  3P4Q B;  4DBG A;  3AE4 B;  3N3K B;  3X23 A;  3HK0 A;  4LCD E;  2RDG A;  2KWV B;  1R7S A;  4YTN B;  2HE7 A;  3ZXV A;  3ZGZ A;  5JZE B;  3ZQ4 A;  2IO3 B;  1ZOY B;  2IPK D;  5D3I B;  1P1A A;  5LNK 1;  3N1Z C;  3L16 A;  2ZZP B;  2XK5 B;  3Q3F A;  1NI3 A;  1YNT E;  3RT3 B;  3RUI B;  5CHV C;  2LMC A;  4W9I A;  4RGN A;  4HEA 1;  4HKZ E;  2M4N A;  4DDI D;  4JPS A;  2IDY A;  2MSE D;  4HPP A;  2XBB C;  2WU5 B;  3A4R A;  3KYD D;  4FUL A;  1GB1 A;  1ACC A;  3A9J A;  2K8C A;  3ZUN A;  2KZR A;  4R3D A;  2NBV B;  2WQY B;  3AEG B;  2L0F A;  2D3G A;  2MX2 A;  2C7M B;  4GXB A;  2KQ7 A;  4HXD A;  3CIR B;  4K1R B;  2DHZ A;  2KXJ A;  4K7U A;  5D7G A;  5AUK A;  4E74 A;  1TKG A;  5IN7 A;  3ZTD A;  3NS1 A;  1T6B X;  3PLV A;  4GDL B;  3DDC B;  2I1J A;  3R2T A;  1Q5W B;  3P42 A;  2O2V A;  2REX A;  3R7R A;  2CU3 A;  3C19 A;  3IXS A;  5E6O A;  2BYV E;  1I4Q A;  3BIN A;  1YIW A;  3U7Z A;  1ZUD 2;  2L83 A;  1FPY A;  4N59 A;  1SIJ A;  2YLM A;  1WGH A;  4P6V F;  4WWP A;  2DX5 B;  2RMM A;  4IKG A;  4MH8 A;  3AE3 B;  2GBN A;  4YXD B;  3MJW A;  4NAM A;  4LLG M;  1KM7 A;  2LZ6 A;  4K7S A;  3T9L A;  2RR9 A;  1DOY A;  1WXA A;  3D32 A;  4IW0 A;  4RH6 A;  3VHT C;  3M95 A;  1J7B A;  3U30 A;  2K22 A;  4HRO A;  3A9K A;  4XDD A;  1WXM A;  2A5U A;  2L76 A;  4W9G A;  2C60 A;  2J52 A;  4ANW A;  1ZE3 D;  4PS8 A;  1LXD A;  2QIE B;  2Y5C A;  3ONS A;  5CHF A;  3NUH B;  1FNU A;  1OGW A;  3DWM A;  4N9F 4;  3R2I A;  3ZJU A;  3RN9 C;  3PS6 A;  3AXC A;  2LGY A;  2WNM A;  4LJP B;  2RPQ A;  1JQ4 A;  2KX0 A;  2D07 B;  5JHA A;  3W5V B;  2HTH A;  4KKI A;  2ZVN A;  1E8Y A;  2BKF A;  3VTW A;  1PYW D;  1EO6 A;  2IYD B;  4M00 A;  1TIF A;  2I38 A;  5EDS A;  1SE4 A;  3DVN U;  4FHK A;  3P2B A;  3BVG A;  2JU6 X;  1H4R A;  2JWU A;  2KJR A;  1FM0 D;  4AOF A;  3AE8 B;  2NR2 A;  2C7H A;  2KAC A;  1E10 A;  4MSM B;  1XO3 A;  4TQ0 A;  1QKZ A;  4W9E A;  2K8B A;  4LNK A;  1WRD B;  3FIL B;  1JML A;  3GZN I;  2NS5 A;  1QOF A;  4IDI A;  2X38 A;  3SHQ A;  3JSV A;  2MP2 A;  1XXG A;  4O1N A;  4K3B A;  3VQI A;  2D10 A;  2IGH A;  2DEN B;  1R4M I;  2J4X A;  1GUA B;  4M01 A;  3VH4 B;  3ZLZ A;  3KW5 B;  2QCZ A;  2D3C A;  2RDB C;  2J53 A;  2DAJ A;  3AH7 A;  3EC8 A;  1UF0 A;  1NI2 A;  1FXA A;  2PE9 A;  4MGK E;  4DHJ D;  3KWL A;  4GOC A;  1PUT A;  3NJT A;  1V5O A;  2LUE A;  1PDX A;  1I4G A;  3APC A;  3O13 A;  3RNB C;  2WP9 B;  3BWU D;  1L6U A;  2A4Z A;  3C0R B;  4BKG A;  4HKQ A;  1YD8 U;  4KGS A;  3V60 A;  4MJS B;  1IGD A;  2M0X A;  4EEW A;  4REZ A;  2JRI B;  2BS3 B;  2W54 A;  3SD5 A;  1NYR A;  4S0R A;  2Y5B B;  1ZKH A;  3WA0 A;  2NCN A;  1UH6 A;  4G50 A;  1IP9 A;  3AU5 A;  2LI5 A;  2FID A;  2N0S B;  4B6W A;  2NBW B;  1N6Z A;  3LXF A;  4BAX A;  1SBB B;  3KUC B;  5AZG A;  2WXI A;  1C79 A;  1UGJ A;  2L32 A;  3O65 B;  1ZP0 B;  2LGS A;  2HJ8 A;  1NBF C;  2LGI A;  1A70 A;  1V6E A;  2BS4 B;  2ZPY A;  2QEJ C;  2ZW0 A;  2KMA A;  3U7D A;  2O2V B;  3AE2 B;  1WR1 A;  4BVU C;  2JPH A;  1XCT L;  2KFK B;  4XX5 A;  2NBU A;  1E90 A;  1M4V A;  3VAW A;  3ZRC A;  1SSN A;  4GB9 A;  3N32 A;  1ZDX A;  2JWZ A;  1WY8 A;  2LVQ A;  1BML C;  3CMM B;  3RUL A;  1E8Z A;  4WJO A;  1QOG A;  4E3C A;  4G11 A;  4DXG A;  3APF A;  1XLO A;  2G45 B;  2D5G A;  2MJE A;  1I4X A;  1OEY J;  2XNA C;  1WSP A;  3EFC A;  4EZJ A;  3UGB B;  5H8Y E;  2FCN A;  1KLG D;  1TKY A;  3GB1 A;  4I6P A;  3PHX B;  1NVI D;  1L2N A;  4W9H A;  2XK5 A;  1XEE A;  1ZGU B;  3W2D A;  2J0M A;  4MGY E;  1NDD A;  3PTF C;  2KTF A;  1V81 A;  4XWT A;  1K50 A;  1YQB A;  3ML9 A;  3L0W B;  1YX5 B;  3KLS X;  3MC0 B;  5JH5 C;  2XEW A;  3ZVV A;  2CJN A;  2L00 B;  1K52 A;  3EHV A;  3NZ3 A;  3ZTC A;  4K7W A;  3NZS A;  4GN1 A;  4OHJ A;  3R66 C;  1CQV A;  2DWQ A;  2KN4 A;  1SXT A;  2AL3 A;  4ARC A;  4PT5 A;  3P4S B;  4BBN C;  2MBE A;  2FNJ B;  2YVC A;  2M17 A;  2LVP A;  1KOT A;  4WAF A;  3WAL A;  5KHO A;  4W9F A;  5GMV A;  3AEE B;  2QC8 A;  2HJ1 A;  2I1K A;  4DXF A;  3GZN B;  4GDL A;  4NQL B;  2MBQ A;  3SFD B;  1FXI A;  1YOV B;  3U52 E;  2M8S A;  4W9J A;  1XLN A;  3TEY A;  1BXT A;  3WAN A;  2WXH A;  1L5P A;  1E7U A;  2DLB A;  3WIM A;  3PZD A;  1JRO A;  3TMP B;  4J6I A;  2KN5 A;  3T3N A;  1GNU A;  1ENF A;  3Q3N C;  4KV2 A;  4TSS A;  4N6E B;  4FXC A;  2BYE A;  2IO0 B;  2MP2 B;  5IP4 D;  3ZKJ C;  3KH0 A;  1UBI A;  1TY2 A;  4DDG D;  4TMA B;  3CWI A;  3SFE B;  5L95 C;  2K6Q A;  4LNI A;  1JWB D;  4JX1 C;  5LXH A;  4HJG E;  4ANV A;  2QIL A;  4CQN A;  3FC4 A;  1TT5 B;  1TS3 A;  4HRS A;  2WDV B;  1IBX B;  4J3O D;  4IWO A;  4M8N A;  4KX6 B;  3W1S C;  4MEL A;  1D5M C;  1D6E C;  4USA A;  2H88 B;  1XF5 L;  2BB6 A;  4DWF A;  2R2Q A;  3ZDM C;  1TS2 A;  2W3S A;  1TKE A;  2ON8 A;  2JSV X;  4AS1 A;  2FE8 A;  3Q14 C;  1R4N I;  2KQ4 X;  1RLF A;  2HD5 B;  2L7R A;  1JRU A;  1OEY A;  2AQ3 B;  3P4R B;  5AZF A;  2J0J A;  2W9N A;  2KO3 A;  2MJ3 A;  4L23 A;  4ZHP A;  1WM3 A;  2ZNV B;  4KDI C;  3RNE C;  1FO4 A;  3IFW B;  4HK2 A;  4JWS C;  4HDO A;  4YSY B;  1VD2 A;  4C56 C;  1BT0 A;  1E7P B;  3IT4 B;  2KTR B;  1RRB A;  1WE7 A;  3TUO A;  4FHJ A;  2V4L A;  3MHS D;  1AAR A;  4RMA A;  3TBL D;  2WDR B;  2IO2 B;  3Q6B A;  4ZRP A;  4C00 A;  1J7C A;  4GGQ A;  1C3T A;  3RCZ A;  1WGK A;  2RPV A;  3N1X C;  1SE9 A;  4PS3 A;  3I3T B;  4C7Y A;  3DBL B;  1LGR A;  3L13 A;  1NYQ A;  2M0A A;  1G6J A;  4ZRI A;  3QCA A;  2LEK A;  1WX7 A;  1HA5 A;  1V49 A;  2LAS A;  3Q69 A;  1RM6 C;  3Q8E A;  4BKS A;  2AEH A;  2CS4 A;  2LWP A;  1F9J A;  1K8R B;  2JXT A;  2CHW A;  3PRM B;  1WYG A;  2GBR A;  3DBH B;  1FIQ A;  3I5J C;  1HEZ E;  1JWA D;  1WZ3 A;  5LLI A;  2PTL A;  3NVZ A;  1P98 A;  4OZB A;  4NQK E;  4FJY A;  2JYT A;  4P1B C;  2FUG 1;  4HJK A;  2PLP A;  3QJZ A;  2IBI B;  1CMX B;  3AV8 A;  1KTK A;  1YN3 A;  4H2A A;  5BMI A;  3ENE A;  2WXQ A;  4DK5 A;  3NVV A;  1E0Z A;  3OWE B;  2CR5 A;  4MJS A;  3A4S C;  3MC9 A;  4OVU A;  4KVG B;  2DZJ A;  4FN2 A;  3IT6 B;  1FRR A;  2MCN B;  4BOZ B;  4K81 A;  4C4V A;  3MP9 A;  1C4P A;  2LUM A;  4NY0 A;  4KZC A;  2QSD A;  2K8H A;  3PRE A;  1QLB B;  1RYJ A;  3OJ3 A;  1X1M A;  1C4A A;  5BMH A;  2R61 A;  4WJQ A;  4B0E A;  1F2R I;  2AL6 A;  4DXA B;  3IVF A;  2WGS A;  1QOB A;  1VRA B;  3TSS A;  1L0Y B;  4M02 A;  3KYC D;  1K53 A;  3L4P A;  3K9O B;  4YL8 A;  1UUP A;  1V86 A;  1IUE A;  3RNA C;  1XT9 B;  4M0W A;  2XN9 C;  3ZIM A;  3TEW A;  2OOB B;  2KFK A;  2MBH A;  2ZNV C;  3PLU A;  2EKE C;  2WDT B;  2N9E B;  4L1B A;  4WWM A;  1GAQ B;  1QT9 A;  4NNJ B;  1SE2 A;  5DPR A;  2PW9 A;  3L54 A;  1EU4 A;  1SJH D;  4OZA A;  3W1S A;  4WWO A;  4LK0 M;  4DHJ B;  3NVY A;  3IHP C;  2ZJD A;  2WXO A;  2R2O A;  3BVM A;  2MH7 A;  2OED A;  1WGR A;  3RNF C;  3ZXR A;  1OQR A;  4XYC A;  5FKA C;  4LNO A;  2Z0E B;  3DHI C;  3H6N A;  2KJ6 A;  5G5H A;  5LXI B;  3ALB A;  2ZVO A;  1R4N B;  3MTN B;  1TTN A;  1PGX A;  2WXM A;  2W55 A;  1FFU A;  3V3X A;  1WJ6 A;  3B0A A;  4MAC A;  2L1A A;  1UNS A;  3R8B A;  2GI9 A;  4ZHO A;  5EE0 A;  1T0Y A;  5G2N A;  2LHE A;  3DVG Y;  2GOW A;  2V1Y A;  1TS4 A;  4ICU A;  4ZRK A;  2J0K A;  4ANX A;  3TL5 A;  2B76 B;  2K6D B;  5HI1 A;  5H92 C;  1T5X D;  3DBS A;  3PT2 B;  3B9J A;  2N9K A;  4PK1 A;  4L2Y A;  2FIF A;  1ZXH A;  5L83 A;  1JCK B;  4W9L A;  3TJP A;  2Z0D B;  5J18 A;  2O6V A;  1FRD A;  4WQM A;  4ICV A;  4TKN A;  4YWG G;  4RGO S;  3PRP B;  2MLB A;  4I6L B;  2C9W B;  5FR6 A;  1HTO A;  2BYT A;  1WM2 A;  1F1H A;  2KX3 A;  2KMM A;  1MPE A;  2Y5P A;  1TYG B;  3AEC B;  2JVC A;  3AE6 B;  1LM8 B;  2WXG A;  2AQ2 B;  2K9X A;  4A90 A;  2E3T A;  3GE8 C;  2Q5W D;  1OTR B;  4MGZ E;  1P7E A;  4WJN A;  4IUM B;  3ZO5 B;  1YJ1 A;  2LRU A;  3W1Y A;  3EFU A;  1UD7 A;  2JUO A;  1C76 A;  4MDK E;  1GOZ A;  2V4I B;  2PKO A;  2VZK B;  1LO5 D;  1H8C A;  2DZK A;  1JWS D;  1S1Q B;  1MHH E;  3VUY A;  3V61 A;  4A9A A;  1P3Q U;  2WX0 A;  2OJW A;  3DVG X;  3DBR I;  4NJ6 A;  5J2R A;  3QAQ A;  3UIP B;  4NZL B;  2KKC A;  3QX1 A;  3M62 B;  1IBX A;  2LVO A;  1KF6 B;  3BYY B;  5E6P A;  2L0T A;  1RFA A;  2BKR B;  4US9 A;  5E6N A;  4AJW A;  4FJZ A;  2DYB A;  4AUQ C;  3VFK A;  1WX8 A;  2VRR B;  1WFY A;  3PGE A;  2BWE S;  4B0M A;  1LQB A;  2KAN A;  4WQO B;  4GU2 A;  1L0V B;  1XQQ A;  1MG4 A;  3ZYY X;  3ECI A;  4C4V B;  3IBE A;  3RNC C;  2NPT B;  1WX9 A;  2ONQ A;  3GS2 A;  4IG7 B;  4JLC A;  1KJT A;  2L52 A;  3MJ5 A;  3M3J A;  2JXX A;  1L6V A;  1XCQ L;  1STE A;  3X0W A;  4PS7 A;  4ZOH C;  2KTR A;  2MEK A;  5DPS A;  1Y56 A;  4EUT A;  4F1S A;  4FA6 A;  5BYQ A;  4NAW A;  2WXJ A;  3UIN B;  3H8H A;  4ARI A;  4OVV A;  3Q8B A;  4JE3 B;  3HRD D;  3U4E G;  3SDL C;  4AJY B;  4M0W B;  3AED B;  2WU2 B;  4BKT A;  1ISN A;  3LYY A;  4ZYN A;  3HVZ A;  3RYT A;  3T3O A;  3HHM A;  4JGH B;  1DOX A;  5HFY A;  2MHJ A;  1TJE A;  4PYZ A;  5HKH A;  4B95 A;  4RF0 A;  3VTV A;  2JY6 A;  3ABV B;  1QQR A;  3WAM A;  2BT6 A;  3VR8 B;  2G3Q B;  3PPA A;  4W9K A;  1V8C A;  2KHW B;  4RM8 A;  3KWV A;  2WX1 A;  4IOI E;  2KQS A;  1VDV A;  4II3 B;  2INC C;  4HVB A;  1WXS A;  2KD0 A;  2VH1 A;  3BYT B;  4URK A;  1VZ6 A;  2BB5 A;  2D3A A;  2C7N B;  1SF0 A;  2QDF A;  3A33 B;  1PGB A;  2DZM A;  4EKU A;  2N1V A;  4MM3 B;  5IO9 A;  3URY A;  1OQY A;  4LJO B;  1PQS A;  5C3J B;  3HUI A;  4JWU C;  1WR6 E;  5EE1 A;  3APD A;  2WXL A;  3C8Y A;  5CHW A;  4CHK A;  3S2A A;  4KKJ A;  4MSQ B;  3ZRF A;  3N1Y C;  3B1L X;  4OW0 A;  1KFY B;  3J9C A;  2D2Q A;  2DBY A;  5AZH A;  3PV1 A;  4XDC A;  2VH2 A;  4RGT A;  2V3S A;  1XLP A;  2IY1 B;  1YQ4 B;  3BK2 A;  1T0S C;  1WI0 A;  2N7E A;  3MHZ A;  4W9D A;  2FBW B;  1GJZ A;  1EUV B;  1I4R A;  2MQJ A;  2BF8 B;  2O6V B;  4P1C C;  2ACZ B;  1N60 A;  4WUR A;  2HDE A;  1Q10 A;  4GMV A;  2RSU A;  2WHI A; 
#chains in the Genus database with same CATH homology
 3Q69 A;  1J7B A;  1RM6 C;  1TS5 A;  3Q8E A;  2K0P A;  2K22 A;  3HVD A;  4HRO A;  4XDD A;  2JXT A;  1WYG A;  2J52 A;  4AQ7 A;  5T8I A;  1ZE3 D;  3LB8 C;  2V3N A;  1FIQ A;  3N9Y C;  2QIE B;  2Y5C A;  1HQR D;  5TSS A;  1ZPS A;  1HEZ E;  2JZP A;  1JWA D;  1KRH A;  3NUH B;  3AE5 B;  1FNU A;  3I57 A;  2PTL A;  3DWM A;  3NVZ A;  3R2I A;  2NTT A;  3ZJU A;  4D2K A;  1JW9 D;  1MI0 A;  4OZB A;  1P7F A;  2JYT A;  2FUG 1;  2WNM A;  2PVG C;  1JQ4 A;  2PLP A;  1UWX A;  3AV8 A;  5BMI A;  1KTK A;  1YN3 A;  4H2A A;  1NEK B;  2JX5 A;  2WXQ A;  3NVV A;  3EUB 2;  3W5V B;  4RNA A;  4EE2 A;  1E0Z A;  1SEB D;  3OWE B;  4KKI A;  3SR6 A;  1B1Z A;  2W82 A;  1I4H A;  1L4D B;  1PYW D;  2RDH A;  3TEZ A;  3IT6 B;  4RF1 A;  2LJI A;  5I4D A;  1FRR A;  2I38 A;  4OVZ A;  1SE4 A;  1V1O A;  2AX5 A;  1YN4 A;  2V3P A;  3BVG A;  3AE1 B;  2JU6 X;  4WIP A;  1DGJ A;  2JWU A;  1FM0 D;  3MP9 A;  2G9H D;  1C4P A;  3AE8 B;  2DYO A;  1C78 A;  4XWW A;  2LUM A;  2V0G A;  1DOI A;  2KAC A;  3DWG C;  3EGR A;  2QSD A;  1E10 A;  2NTS A;  1XO3 A;  1I7H A;  1QLB B;  4TQ0 A;  1RYJ A;  4XE0 A;  1E6E B;  1C4A A;  1QKZ A;  5BMH A;  1N62 A;  2R61 A;  4B0E A;  3FAH A;  3P1M A;  1F2R I;  1K51 A;  1VZ8 A;  2GB1 A;  1VZ7 A;  3FIL B;  1JML A;  1QOB A;  1VRA B;  2H89 B;  2N7J A;  1L0Y B;  3TSS A;  3VRB B;  1K53 A;  3L4P A;  1QOF A;  4IDI A;  2VZK D;  2INN E;  2X38 A;  5JXV A;  1UUP A;  3IAM 1;  1IUE A;  1XXG A;  4O1N A;  3W5U B;  4M0W A;  3VQI A;  2E6X A;  2XN9 C;  3TEW A;  2IGH A;  3Q8A A;  2J4X A;  1ZDV A;  3E9S A;  3GP7 A;  2OHF A;  2J53 A;  4NJC A;  3AH7 A;  5G5G A;  4L1B A;  4WWM A;  1WXQ A;  1FXA A;  3AEF B;  1GAQ B;  1IGC A;  1QT9 A;  2WXN A;  1SE2 A;  2PW9 A;  3KWL A;  1EU4 A;  4NAW B;  1KLU D;  1SJH D;  1T3Q A;  1VJK A;  1N5W A;  1PUT A;  4OZA A;  1AWD A;  3W1S A;  5FK9 C;  4LK0 M;  1PDX A;  2EKI A;  1I4G A;  1EWY C;  3O13 A;  3AEA B;  1F2R C;  3NVY A;  2WP9 B;  2K5P A;  2WXO A;  3BWU D;  1FFV A;  4OZC A;  1L6U A;  3BVM A;  2MH7 A;  4HKQ A;  4KGS A;  2GRI A;  2OED A;  1V97 A;  1OQR A;  3U2S C;  5FKA C;  1EU3 A;  1IGD A;  1HZ6 A;  4REZ A;  5G5H A;  3BK1 A;  1FD6 A;  2BS3 B;  2W54 A;  1NYR A;  1FNV A;  2EEL A;  1FCC C;  3ZJV A;  1PGX A;  2WXM A;  5BMG A;  5C2T B;  2W55 A;  3AE7 B;  1FFU A;  3E56 A;  3V3X A;  2KDM A;  2N0S B;  1ROE A;  4MAC A;  1SJE D;  2L1A A;  1UNS A;  1I4P A;  3R8B A;  3LXF A;  1YJJ A;  4RFB A;  1N63 A;  2GI9 A;  3Q8C A;  1WRI A;  4KGR A;  4ZHO A;  1TY0 A;  5EE0 A;  2W3R A;  1SBB B;  1ET6 A;  2LHE A;  1TS4 A;  2M19 A;  3AMZ A;  2WXI A;  3Q8F A;  1SB3 C;  1C79 A;  2B76 B;  1UGJ A;  5D3D A;  2L32 A;  1JWU D;  2WLB A;  1ZP0 B;  2M56 B;  5H92 C;  5HI1 A;  2Y3A A;  1T5X D;  2Z8L A;  3B9J A;  2N9K A;  1DYQ A;  2LGI A;  4L2Y A;  1A70 A;  3NVW A;  1ZXH A;  3PZ8 A;  2BS4 B;  1C4C A;  1JCK B;  2QEJ C;  2ZW0 A;  5AUI A;  1AW7 A;  2MJD A;  3AE2 B;  2JQR B;  1XCT L;  1FRD A;  4Q2J A;  4WQM A;  4GLS C;  4YWG G;  1WWT A;  4RGO S;  1M4V A;  4N58 A;  1SSN A;  2N9L A;  3BVZ A;  1B9R A;  2KAJ A;  2BYT A;  1D5Z C;  3SEB A;  4YSX B;  1ET9 A;  4A8X C;  1ZDX A;  2J42 A;  4P16 A;  3VRA B;  2KMM A;  1MPE A;  2WDQ B;  2Y5P A;  3UI3 A;  1BML C;  1TYG B;  3AEC B;  5BYR A;  1F0Z A;  3AM9 A;  1QIL A;  3AE6 B;  2WXG A;  1QOG A;  1V1P A;  1PFD A;  2AQ2 B;  4DXG A;  2K9X A;  4TQ1 A;  4A90 A;  5HHD G;  1XLO A;  2E3T A;  2D5G A;  2Q5W D;  2PVO D;  1CK1 A;  1KH0 A;  1YN5 A;  1I4X A;  2MJE A;  2DYM A;  3B2F A;  2XNA C;  1WSP A;  1EM7 A;  1P7E A;  2BW2 A;  1GPX A;  5H8Y E;  3VR9 B;  1C76 A;  2BBC A;  1KLG D;  1TKY A;  1GOZ A;  3GB1 A;  2V4I B;  2SAK A;  3V05 A;  2PKO A;  2VZK B;  1LO5 D;  1NVI D;  2CJO A;  2BTE A;  1D4B A;  1JWS D;  1XEE A;  2G1E A;  2IGD A;  1MHH E;  2QMT A;  2WS3 B;  3W2D A;  4A9A A;  1QF6 A;  1HXY D;  1E9M A;  2INP E;  2TSS A;  1AN8 A;  5EE3 A;  2JYE A;  1GB4 A;  4XWT A;  1K50 A;  2HTM E;  5FR3 A;  4NZL B;  3BII D;  1CZP A;  3AE9 B;  3AN1 A;  3KLS X;  3MC0 B;  3PO0 A;  4LTU A;  2CJN A;  1IBX A;  1K52 A;  4ITK A;  3NZ3 A;  3MFG A;  1KF6 B;  3BYY B;  3KQ4 A;  1XLQ A;  4OHJ A;  2YEP F;  1CQV A;  4YT0 B;  1L4Z B;  1C77 A;  2DWQ A;  2KN4 A;  1SXT A;  4US9 A;  1TZO A;  4ARC A;  4PT5 A;  3P4S B;  5BYS A;  1FMA D;  1SE3 A;  4WAF A;  2IGG A;  4B0M A;  3AEE B;  2K3U A;  1YQ3 B;  2SEB D;  3FIL A;  1L0V B;  1RWS A;  3BZD B;  4DQO C;  2ICI A;  4US8 A;  3ZYY X;  4DXF A;  1JWM D;  3PZ7 A;  1FCL A;  1HZ5 A;  4C80 A;  3SFD B;  4MT5 A;  1ESF A;  1FXI A;  3U52 E;  1OFF A;  1VR9 A;  3P4P B;  2ONQ A;  3GS2 A;  1FEH A;  2WXF A;  1XLN A;  3TEY A;  1BXT A;  5E6J A;  4C7Z A;  2WXH A;  2L52 A;  3W9C B;  2QJL A;  3P63 A;  1L5P A;  3MJ5 A;  4RGM A;  3RFZ B;  4ZYS A;  1L6V A;  1XCQ L;  2DLB A;  1STE A;  4UDU C;  1V1P B;  3P4Q B;  1JRO A;  3AE4 B;  4YSZ B;  4ZOH C;  3T3N A;  2MEK A;  2RDG A;  1Y56 A;  1ENF A;  5BYQ A;  1EWC A;  1R7S A;  2WXJ A;  4TSS A;  3NRZ A;  4YTN B;  1MVK A;  4N6E B;  4FXC A;  3H8H A;  4ARI A;  3ZGZ A;  2AQ1 B;  1PGA A;  3ZQ4 A;  1ZOY B;  2IPK D;  3Q8B A;  4JE3 B;  5D3I B;  3HRD D;  5LNK 1;  3U4E G;  1J7A A;  3AED B;  2WXR A;  2WU2 B;  2PMV A;  1NI3 A;  1MHX A;  1YNT E;  2KWD A;  1TY2 A;  4TMA B;  2LMC A;  1UWM A;  3LYY A;  3HVZ A;  3CWI A;  3SFE B;  1JRP A;  4HEA 1;  3I9V 1;  4RGN A;  4A55 A;  4HKZ E;  1C9F A;  1JWB D;  3T3O A;  4JPS A;  1L0X B;  3IAS 1;  1DOX A;  2NMQ A;  5HFY A;  2IDY A;  1TJE A;  2WXP A;  4JX1 C;  4RF0 A;  4HJG E;  2WU5 B;  2QIL A;  3ETR A;  2PIA A;  3FC4 A;  4WH4 A;  4CQN A;  1TS3 A;  3ABV B;  1GB1 A;  2I2Y A;  1QQR A;  4HRS A;  1ACC A;  2WDV B;  2BT6 A;  3VR8 B;  5EE9 A;  1IBX B;  4J3O D;  2ZW1 A;  1V8C A;  4R3D A;  4KX6 B;  2WQY B;  3AEG B;  1D5M C;  3KWV A;  4IOI E;  2YEP B;  1D6E C;  1VDV A;  1QOA A;  4USA A;  2H88 B;  1AYF A;  1XF5 L;  2BB6 A;  3B2G A;  3CIR B;  1TS2 A;  3BYT B;  2W3S A;  1TKE A;  1VZ6 A;  5MPO A;  2ON8 A;  2BB5 A;  2JSV X;  4A6Q A;  4AS1 A;  5D7G A;  5AUK A;  1SF0 A;  4RCO A;  2FE8 A;  1PGB A;  1YMH E;  4MM3 B;  2KQ4 X;  1TKG A;  4KGT A;  3NS1 A;  3URY A;  1T6B X;  4YTP B;  1YJI A;  3WCQ A;  1ZXI A;  1N5X A;  4GDL B;  3R2T A;  2AQ3 B;  3P4R B;  3P42 A;  1OQQ A;  5C3J B;  2WXK A;  1D5X C;  1CJE A;  3HUI A;  1FNW A;  4JWU C;  2MJ3 A;  4L23 A;  2CU3 A;  3IXS A;  4ZHP A;  5EE1 A;  4YTM B;  1I4Q A;  2WXL A;  3C8Y A;  3U7Z A;  1FO4 A;  5GXG B;  1ZUD 2;  2BS2 B;  3EA6 A;  2L83 A;  4JWS C;  4KKJ A;  4ZRQ A;  3ZJT A;  4N59 A;  3TEX A;  1N61 A;  3AEB B;  2LHD A;  2IJ0 A;  4GDK B;  4YSY B;  1SIJ A;  4OW0 A;  1KFY B;  3J9C A;  4C56 C;  3AB5 A;  2DBY A;  4P6V F;  4XDC A;  4RGT A;  1E7P B;  2RMM A;  1XLP A;  3IT4 B;  4IKG A;  4MH8 A;  1RFK A;  1JAL A;  1VLB A;  3AE3 B;  3TUO A;  1YQ4 B;  3BK2 A;  4YXD B;  5HG2 A;  4NAM A;  3MHZ A;  4LLG M;  2WDR B;  1F77 A;  2LFI A;  2FBW B;  4ZRP A;  1NEN B;  1J7C A;  1I4R A;  1WGK A;  2RPV A;  1BUI C;  2ACZ B;  1N60 A;  1DOY A;  4C7Y A;  4WUR A;  1NYQ A;  2M0A A;  2HDE A;  1Q10 A;  3RPF C;  2LEK A;  4RH6 A;  1HA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...