2MEKA

N-terminal domain of bilbo1 from trypanosoma brucei
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
110
structure length
110
Chain Sequence
MAFLVQVAADIFNNKVNFELSFPSRPSISELTRSAETAFSNEISLRRPDNVPSHKFHSSKIKMYDEELNKWVDLIREDQLTDYCQLYVFQPPNEWHKESQKEIPPAMKPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and assembly mechanism of TbBILBO1, an essential flagellar pocket collar protein
rcsb
source organism Trypanosoma brucei brucei
molecule tags Metal binding protein
molecule keywords N-TERMINAL DOMAIN OF BILBO1
total genus 11
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2013-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18281 BILBO1_N BILBO1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.650 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2mekA00
2MEKA
chains in the Genus database with same CATH superfamily
2W9NA 4MJSB 4YT0B 3S2AA 1ZPSA 4HKQA 4N6EB 3L13A 1JMLA 2ZVOA 2V0GA 4ANVA 1MI0A 4ZRQA 3Q14C 4GMVA 3KYCD 4C7YA 2NCNA 1SIJA 3ZVVA 2BWFA 3DVGY 1CK1A 3Q3OC 1YX6B 4F8CB 1I42A 3AE8B 3JYUA 1ZW7A 2CU1A 1BXTA 3PVLA 2N1WA 2WDRB 5AUKA 5E6PA 3LDZE 4PS8A 2EMSA 1XO3A 1UH6A 2LD9A 1RWSA 3IAS1 1VRAB 4KGRA 2QHOA 2X8XX 4YSXB 4K7SA 3H9DA 3NJTA 1UELA 3UIOB 2N4FA 3RD2A 4LNOA 3X0WA 2EELA 1EF5A 2ZNVC 1QOFA 2QCZA 4B6WA 2L76A 1JW9D 2BQQA 2L0FA 4IM3A 1WRIA 4MGIE 1QLBB 1OGWA 4OVZA 2KACA 1B1ZA 2CHWA 1P3QU 3RNCC 4AUQC 1L0VB 2BS2B 3ZTDA 4A6QA 1V86A 2BKFA 2GBRA 1XLOA 2GRIA 5BMGA 4FJZA 3HRDD 3QHTA 3IT4B 1DOIA 4C4VA 3MHZA 1V2YA 1ZXIA 2KWCA 2KNBA 2WU2B 1WGDA 4YSYB 3EHVA 1Q1OA 4JIOU 3C19A 4AOFA 2D3AA 4DHZB 5IOIA 5G5GA 2IO0B 1XQQA 3Q8CA 2JYTA 1TGZB 2MSED 2KJ6A 3PZ8A 2JXXA 1K52A 4HPPA 2N7EA 1UBQA 3AE3B 1J0GA 3KYDD 3PT2B 5EE1A 4DDID 1J7BA 3W5VB 4B95A 4IOIE 2QDFA 4HK2A 2WNMA 1FPYA 3M95A 3SU8X 1XLQA 1NI2A 2KHWB 1WGRA 3A9JB 2FCQA 2MP2A 4RNAA 5L95C 2M1MA 1TS5A 3QCAA 2WXPA 2GOWA 4P7IA 4HLEA 2KDFB 2JQRB 2ZEQA 1N60A 1OTRB 4WH4A 1FO4A 1WSPA 2BF8B 3DBSA 3DBLB 3PTFC 5CX3A 2YVCA 3BIID 3EECA 1K8RB 2V3SA 3DHIC 4ITKA 2JZ3B 4KDLB 3U2SC 2L52A 3N32A 5C2TB 2G9HD 2MJ3A 3P42A 3O13A 3FKYA 1YJJA 2FCSA 1QOAA 3AEAB 2JPHA 1I4RA 4GDKB 1WJ4A 3HVZA 3ZNZB 1H4RA 3AEBB 3DQVA 5EE9A 4FADA 1TY2A 3HM6X 4LNKA 1NYQA 3KW5B 3IBEA 1S1QB 1J8CA 2M8SA 3RI7C 3A1QA 3E56A 3BWUD 2KXJA 1GNUA 2ZPNA 2W82A 2KQ7A 1T6BX 1YQ3B 1VDVA 1FNUA 5HKHA 1SEBD 1KH0A 3UQBA 1GOZA 3IG3A 3A9KA 3OLMD 1F1HA 2FIDA 3HVDA 2GMIC 3W1YA 3SFEB 4K1RB 5LXHA 2FIFA 2BS3B 2E6XA 3QC8B 2KVZA 2RDBC 2B76B 2K8CA 1RLFA 5GXGB 2KX0A 4L23A 1K50A 2WXOA 1XD3B 2N9XA 2PVOD 4FXCA 2BTEA 1ACCA 3AU5A 4N9F4 1VCBA 4KDIC 1WR6E 2D2QA 4ZDVA 2ZCBA 3ZUNA 1KM7A 2E3TA 5D2MB 4CHKA 1VZ7A 2INCC 4MEMA 3L4PA 1F52A 1RM6C 3SFDB 1WGGA 4YXDB 3APDA 4LLGM 1FFVA 4I6PA 4B9KA 1YNTE 1OQQA 3M62B 4WQOB 3CWIA 3H7PB 3AU4A 1ZOYB 4XC2A 4GDKA 4HDQA 1MG8A 2L00B 4KSKC 1PGXA 4H2AA 2JUOA 2KC2A 1MJDA 1SB3C 4NPNA 2KDIA 2WDVB 2WLBA 2OJWA 1NEKB 3UGBB 2J0KA 2MBOA 4G0NB 4FHKA 1G6JA 2I1KA 2KC1A 5IAAC 1D5MC 1DOYA 1LXDA 3W1SA 3UINB 2LHDA 4N59A 2HTME 4A3PA 3APCA 3RFZB 2PEAA 2LEKA 2LRUA 4XX5A 1NI3A 2WXHA 3DBRI 3OJ4B 1C77A 3DWMA 4K7WA 1PUTA 3NG0A 3VH3B 3A9JA 3QWZB 1KLGD 4BBNC 3NVWA 4IUMB 1LFDA 4W9HA 4X57B 5JZEB 3QQ8B 1OQRA 3VXWA 1ET6A 1M4VA 1YMHE 2DZIA 2H89B 3DOWA 3TBLD 5J2RA 3MFGA 1R4MB 3IAM1 2KQ4X 4RMAA 3ZO5B 2LGYA 4MH0E 1U4AA 4DXGA 1TZOA 2GLSA 3KUCB 1TYGB 3JSVB 4AJWA 3AI5A 1YX5B 3QA8A 2KYWA 1SE2A 3WAOA 2K5PA 1FM0D 1JWSD 2K9XA 4IC7B 2MJDA 1T0YA 2H88B 4CYEA 1C4CA 3Q3JA 2LZ6A 1N5WA 4JL9A 2WXQA 2Z0EB 3CMMB 4ZYNA 1L4DB 5IN7A 5E6NA 2ZVNA 1F77A 2DHZA 2KMAA 3NY5A 2JRIB 2DAFA 1V5TA 4ZHOA 1V81A 3B1LX 1XEEA 2QMTA 4MGZE 1V8CA 3TSSA 3PLVA 3L17A 4ZRJA 2AQ3B 1SF0A 3WIMA 1KTKA 5BYQA 4MSMB 2NMQA 3VTUA 4RM8A 1E0ZA 2FBWB 5FKAC 1IBXB 4BOSC 2KMMA 1V1PA 2Y3AA 1KLVA 2J52A 1FRRA 2CJNA 2WDQB 4LK0M 2J0MA 3LB8C 5TR5A 1FD6A 4WJOA 2NPTA 3VHTC 4YL8A 3QIJA 1RRBA 2YEPF 1R4NI 2R2OA 3AE9B 5IKCM 2BYTA 4A90A 2JX5A 1I4XA 4BKSA 3TEXA 3GZNI 2KFKB 4AS1A 2L3ZA 4M0WA 4IWPA 1VZ6A 3N1XC 2HJ8A 4XGAB 2GI9A 2WYQA 1KJTA 3RCZA 3GE8C 1N5XA 4PYUA 3PRMB 1HQRD 3Q8EA 4URKA 2GBJA 2B3AA 4ANUA 3PHWB 4GGQA 3RUIB 1E9MA 2QIEB 2XNAC 2ASQA 1ZGUB 4C4VB 2D3CA 1WR1A 1FXAA 5HG2A 3DVNU 1E5WA 3TL5A 4HROA 1C4PA 3VDZA 1HA5A 4F1SA 4WURA 1LO5D 2KFJA 4C00A 2MBBB 1HZ6A 3VRBB 1WM3A 4EUTA 3M3JA 4TSSA 4K3CA 5JH5C 3ZNGC 1Y8RC 3I5JC 1YQ4B 2LGIA 2BGFA 2M0AA 2AYOB 4DBGA 3ENEA 3R2TA 2WQYB 3SDLC 4KZCA 1F2RI 1EU3A 4Q2JA 4F7ZA 1SE9A 1BUIC 1TJEA 3L0WB 4HPMB 1UWXA 1HE8A 3KWLA 3IFWB 2IDYA 2KKCA 4OZAA 1E8YA 1LM8B 2MWSB 1N6ZA 2D3BA 2KO3A 4KGSA 3TEZA 1STEA 3W2DA 1SE4A 4RM9A 3ZYYX 4FN2A 3RNGC 3JW0X 5GMVA 4AP4C 3ZGZA 2KAJA 2EKIA 2JT4B 1DYQA 1L7YA 1E7UA 4LNIA 4LJOB 3RT3B 3V62A 2LVQA 5D6JB 4P1CC 2FUG1 3Q8FA 4OW0A 3SHQA 2KDMA 3ABVB 2AQ1B 5DPSA 1WGKA 1TKGA 2J53A 3B08A 1EM7A 5JHAA 3Q3NC 2KK8A 2A4ZA 5D7GA 1MFWA 2D07B 3IXSA 3AH7A 3EC8A 3RZFA 3APFA 1GAQB 4LNFA 1HXYD 5C3JB 1OEYA 5LXIB 2ZNVB 2J4XA 2IO2B 3EA6A 4WAAA 5D3DA 2VRRB 3ML8A 1MG4A 2R2QA 2O6VA 1XT9B 4BVUC 2KLCA 3T3NA 2VH2A 3PRPB 4FA6A 4GSWA 1YOVB 1ROEA 2XK5B 4ANWA 2DBYA 3UF8A 2R61A 3ZW3A 3FILA 1JRPA 3D32A 3A9KB 2RSUA 4XDCA 2NVUI 2VZKB 3R2IA 1ZDVA 3AEDB 1WMHB 1QF6A 3BINA 4HKZE 4MH8A 3EUB2 1E8ZA 1WXMA 2PLPA 2MLBA 2SAKA 3AE5B 4K7UA 3Q3MC 2GBKA 3NVZA 1C1YB 4BBNF 2G4SA 1L6VA 2WGSA 3AE2B 2Z59B 2ZPYA 5DPRA 1AARA 2ONQA 4HVBA 2J42A 3NHEB 3L08A 2NPTB 3ECIA 3KH0A 1UUPA 2JSVX 4OVVA 3J9CA 4M8NA 4KIKB 2JVCA 2ON8A 3PLUA 1SSNA 2DENB 1GPXA 1TT5B 1RAXA 3GOEA 4DHJD 4RF1A 3Q8BA 2OJRA 4MJSA 1YJIA 3U4EG 1PFDA 2FUHB 1GG3A 3A4RA 4P16A 2MCNB 3AEFB 2KQSA 1P9DU 1LGRA 5CHFA 4IKGA 4EKUA 3CSTA 1J7AA 1E7VA 3ZDTA 2ZCCA 1QILA 2W3SA 4KKIA 1WX9A 1ZKHA 3RZWC 2WXLA 3MTNB 2QSDA 3AM9A 4WJPA 3W5UB 1TS4A 4TV3A 1N63A 4ICVA 3C0RB 2KTRB 1BMLC 2PJHA 1WGYA 2JYEA 2UYZB 3T8MA 2PMVA 2V9HA 4LDTD 1GJZA 1YN4A 2PTLA 1IBXA 1EWCA 1N61A 2LHEA 2WS3B 3ONSA 4OHJA 3U7ZA 4NAMA 2KTFA 1EO6A 3VAWA 1E8WA 4W9LA 1UD7A 2LUEA 3A1QB 1WY8A 2LI5A 4XDDA 5EE3A 2MHJA 4USAA 3H8HA 1QOGA 4RGNA 1QT9A 3MC0B 3FC4A 1HZ5A 2DWQA 2I2YA 4BKGA 1UBIA 3M63B 4MGKE 4XWTA 1MPEA 1WF9A 2KLGA 3VUXA 1AW7A 2WXRA 3RULA 2K22A 3MHSD 2AX5A 3RPFC 2QJLA 3GB1A 4GIVA 3NUHB 4WAFA 2C7HA 1WX7A 3DHHC 4GU2A 3FAHA 2UU7A 4ANXA 2L32A 2KANA 2HJ1A 2PE9A 3U30A 2L1AA 1WM2A 3TMPB 3DBRB 2RDGA 4BKTA 5FR6A 1JROA 1GC7A 4OZCA 4EOYA 4W9IA 1WXAA 2LRWA 2XEWA 3N9YC 1A70A 4W9GA 3P1MA 1WIAA 3B2FA 4MT5A 2IBIB 3DVNV 2OEDA 3V05A 1WXVA 3DPDA 4ARIA 1FNWA 1LQBA 1H8CA 1P98A 1IUEA 3I9V1 3H7PA 2BB5A 4XZ4A 3DBLI 2M4NA 2RPQA 3X23A 1P7EA 4WQMA 2J7QB 4XWWA 3EFUA 2IPKD 1KFYB 2JZPA 1WJUA 2N0SB 4A3OA 1SE3A 3WAMA 2WXFA 5LLIA 2CHZA 1J7CA 2IY1B 4M0WB 2K8BA 3V60A 1CQVA 3A4SC 4RF0A 1KRHA 4FJYA 5J17A 2RPVA 1M94A 1EF1A 4US9A 1WZ3A 2KJRA 2N9PC 1JWAD 5G55A 3O65B 1T3QA 2WXKA 4NQLB 4HJKA 2ICIA 5EDSA 2N7DA 4AJYB 1L0YB 1WWTA 2A5UA 1VD2A 1OQYA 1UWMA 3DBHB 2HDEA 2IGHA 3AE1B 3P4RB 3QAQA 3SD5A 2G45B 3H7SA 3LXFA 1FCLA 2BS4B 1F2RC 2K6QA 4GXBA 4II2B 1UNSA 3WANA 2RD0A 4YSZB 5E6OA 4G11A 1YN3A 4MDKE 1K51A 2MH7A 2O6VB 4NJ7A 1J19A 3UI3A 1YN5A 2RMMA 3RMKC 4LTUA 4NJCA 1T5XD 4W9JA 2GB1A 2WHIA 4M02A 5AEKB 3ZTCA 2LGXA 4L1BA 2CS4A 5AZFA 2I1JA 4UDUC 2BKRB 2IJ0A 3JSVA 3Q8AA 2O2VB 2KWVB 3B0AA 4G3XB 4HRSA 4GOCA 2LFIA 3RNBC 3KUDB 1K53A 3URYA 3PGEA 2G1EA 3PV1A 4DWFA 1NVID 2EKEC 2IGGA 2K6DB 2UWQA 2KTRA 2C5LC 3Q2AC 3NOBA 5DPWA 4JWUC 1SJED 3AULA 3GP7A 3OG5A 1MVKA 4HEA1 2LXAA 1VLBA 5BO4B 1YJ1A 1XXGA 4B0MA 4YTPB 1HTOA 2NS5A 3ML9A 4FJVB 3CSFA 1R7SA 4WWMA 2J0JA 3KLSX 3OWEB 2GBMA 1CMXB 1PYWD 2WXMA 2V1YA 1WYWB 4L2YA 2WXGA 3U7DA 1E90A 2WU5B 4M00A 1TZ1A 4CQNA 1PGAA 3ZNID 5AZGA 4CO7A 1GB4A 3BVZA 2MBEA 1I4HA 4AQ7A 4KVGB 2DYMA 4OZBA 2M56B 5BYRA 2BBCA 1SXTA 4DXFA 1A5RA 1TS2A 3VTVA 5TSSA 5H92C 1WGHA 1SBBB 5IA7A 2FAZA 4II3B 2VH1A 3N1YC 2AQ2B 1FFUA 4W9FA 1R4MI 1T0RC 3AV8A 4WJQA 2DZJA 2L7RA 2AL3A 4NNJB 3AN1A 1C9FA 1FMAD 2PKOA 2BT6A 4YWGG 2FCMA 2NR2A 4ICUA 1WYGA 3BK2A 1RFAA 5AZHA 1TTNA 1YQBA 3ZLZA 2IO1B 4HPLB 3ZQ4A 4S0RA 4PK1A 1JCKB 4E3CA 1IGDA 2KD0A 5H8YE 2W55A 5D94A 3V6EB 1KLUD 2DNFA 2V4LA 3R66C 4D2KA 1WI0A 2LXCA 1Z2MA 5LNK1 2LVOA 5BMHA 4GDLB 3ZNHB 4A8XC 1AN8A 2CKHB 2N9LA 1KF6B 5JHBA 4LCDE 2Z8LA 3DDCB 4IM0A 1QOBA 2QC8A 3PZDA 2INPE 2KWUB 3BZDB 2KDEB 4KV2A 1F9JA 1WH3A 5CTRC 3R3MA 5EE0A 1EUVB 4EE2A 4TQ0A 1L2NA 4ZRIA 4O1NA 1L0XB 2MEKA 2LJ5A 2ZW1A 4MM3B 1C79A 2WXIA 1VZ8A 1TKEA 3R7QA 1IGCA 1V1OA 2OHFA 1V1PB 2BPSA 4KIKA 3RNAC 4A55A 1ENFA 4KZ0A 1JWUD 1ZUD2 4J3OD 4P6VF 1X1MA 2HTHA 4TQ1A 4BOZB 2CHXA 5BMIA 1QZEA 2TSSA 3H6NA 3CIRB 4IM2A 1RFKA 3AEGB 3VUYA 3VFKA 3PPAA 4ZYSA 2K25A 4C7ZA 1FRDA 2N9KA 3WA0A 4HJGE 2JWZA 3HK0A 4PYZA 1D5ZC 4NAWB 5J18A 2N1VA 4EEWA 1B9RA 3AECB 4RFBA 1XCTL 2NTTA 2IZVB 2MQJA 2AL6A 2DYBA 2MX2A 1P7FA 4HDOA 4N58A 3TJPA 2DYOA 1VR9A 2NBVB 3AE6B 4YTNB 4A9AA 2DLBA 2KVRA 2KN5A 1YD8U 1D3ZA 4E74A 3PS6A 2NBUA 1I4GA 2MJEA 3OAWA 1FEHA 3QK0A 2JWUA 4JX1C 4MELA 3A33B 4NQKE 2BWES 2Y5BB 3BK1A 5KHOA 4KSLC 3L16A 3SR6A 4FHJA 3KQ4A 5MPOA 2N9EB 1WXQA 1WFYA 1UGJA 3ZIMA 1OFFA 3I63C 3KWVA 1NENB 2NTSA 1XCQL 2D10A 3UIPB 1XF5L 4BZAA 3V3XA 3V6CB 4RH6A 3U8ZA 4ZRPA 5IP4D 1WJ6A 4RCOA 2IGDA 4FBJB 5HFYA 4JLCA 1IYFA 3IVFA 3ZRFA 3NVYA 2MRPA 1V5OA 3TEWA 3DVGX 1IPGA 2Q5WD 3BYYB 1E8XA 3T3OA 1PDXA 2D11A 4C56C 2PPHA 3R8BA 3NVVA 2L0TA 3BYTB 3ZKJC 1DGJA 4LJPB 3CF6E 4I6LB 2IY0B 2G3QB 1N62A 2BW2A 2PVGC 3IHPC 3P63A 3AE4B 2LASA 2AEHA 4W9CA 4DHZE 3PRZA 2JU6X 1SIFA 1JQ4A 2FNJB 3RYTA 1TBEA 4RGMA 1Z5SB 4MM3A 5HHDG 2OOBB 4BKSD 3AEEB 4FULA 1TKYA 5CHVC 3RN9C 1EWYC 2KX3A 5DCNA 3IT6B 3VVWB 3P4PB 4ZHPA 4DQOC 1WXSA 1MHXA 3AXCA 2INNE 2RR9A 2ACZB 4JE3B 1PGBA 2C7NB 2LGDA 3K9OB 1PQSA 3PHXB 3DHGC 2FE8A 2KWDA 3I3TB 1D6EC 1AWDA 1UGMA 4EZJA 3NZ3A 5FR3A 3WCQA 1QQRA 1JALA 4US8A 4DDGD 1L6UA 1T0QC 1FNVA 2PIAA 3P4QB 1XLPA 3FILB 4GB9A 1UZXB 4ARCA 3VRAB 1ISNA 4HXDA 5E6JA 4EZKA 1F0ZA 1DOXA 5G2NA 1R4NB 3WALA 3B2GA 5G5HA 4GDLA 2C60A 4M01A 3KUZA 4TMAB 2JXTA 1I4QA 4JGHB 2JZZA 2WP9B 2KFKA 2DX5B 3PSEB 3V61A 4MSQB 2O6VD 2REXA 2PE6B 1JWBD 2L8JA 1IP9A 3VQIA 3MP9A 2MA9B 4YTMB 1OEYJ 1GB1A 1WMHA 4IWQA 1JWMD 3QX1A 4FLHA 3TCAA 2INDC 1KOTA 2WDTB 1Q10A 2LVPA 1C4AA 4OVUA 3VR8B 4ASWC 4E71A 3B9JA 3NS1A 3GE3C 3PREA 3TIXA 3LJ3A 1V49A 3DWGC 5AUIA 3ETRA 2WX1A 3N30A 1WE7A 4QAYA 3L10B 2JY6A 4PS3A 3TUOA 2BYVE 4P1BC 5D3IB 4B0EA 2V4IB 1ET9A 1CZPA 1S3SG 2ZW0A 2LJIA 1JRUA 1WX8A 2XBBC 3SEBA 1TY0A 2BYFA 1SGHA 1V9JA 2JRHA 4DHJB 1ESFA 3ZJVA 4IWOA 4HWIB 2BB6A 3EFCA 1V80A 2V3PA 3NS8A 2Y5PA 3LYYA 2D5GA 4NZLB 1TIFA 4AWJA 3OJ3A 3E9SA 1P1AA 2K3UA 4ZOHC 4NY0A 4IDIA 3T9LA 4JQWC 1D5XC 3H1UA 4J6IA 3HM3A 2YLMA 2GBNA 2RDHA 1YIWA 3Q3FA 2JF5A 2C7MB 4IG7B 1GC6A 3BVGA 3AE7B 4TUUA 2G4DB 2Z0DB 4KGTA 1Q5WB 4JPSA 2DZKA 2N7JA 2M19A 3N3KB 2BYEA 1CJEA 1FIQA 2QILA 2VZKD 4LDTB 4PT5A 1L5PA 1SJHD 3Q6BA 3ZXRA 2O2VA 2SEBD 3GZNB 2D3GA 3MJ5A 4A20A 3NRZA 3ZJUA 4K81A 1D4BA 3I57A 1ZDXA 1P0RA 3C8YA 2YEPB 5T8IA 2WXJA 2WX0A 1WE6A 3U52E 1ZP0B 3MJWA 1NBFC 1E6EB 4JWSC 2M17A 1C76A 1FXIA 4ACFA 1L4ZB 3VR9B 3VUWA 5HI1A 1HTQA 3W9CB 3N20C 1E10A 2ZZPB 3WAPA 2BVCA 2Y5CA 1MHHE 4DXAB 4WWOA 4HCPB 3ZJTA 2KJHB 1QKZA 1HEZE 1C78A 2K0PA 4WIPA 1VJKA 3GS2A 3KVFB 5IO9A 3P2BA 3NZUA 2K39A 1AYFA 3UQAA 5I4DA 3VTWA 1BT0A 5FK9C 4WJNA 4R3DA 3VH4B 2DZMA 2V3NA 3P4SB 2LWPA 1E7PB 3QARA 4LNNA 2WWZA 3ALBA 4GN1A 4M8MA 2K1FA 4C80A 4GLSC 2ZJDA 4EFOA 4WWPA 4K3BA 2AWTA 3RNEC 2PW9A 3L54A 3BVMA 4BFRA 2KMCA 4RGTA 4G50A 4XYCA 1WJNA 1T0SC 2DAJA 2LMCA 3DBHI 2LUMA 3HUIA 3ZRCA 2MBQA 1I4PA 4W9DA 4S17A 4BAXA 2L05A 3W1SC 2W54A 4IW0A 5KHQA 4I6NB 1C3TA 4W9EA 2WXNA 2HE7A 2RGFA 1Q0WB 1V6EA 3RNFC 4HCNB 3ZXVA 3PO0A 2KDBA 1ZE3D 2CJOA 2KN4A 2MBHA 2IYDB 1GUAB 2CR5A 3K9PB 1TS3A 4KX6B 4MGYE 2K8HA 2QEJC 1ZXHA 3N1ZC 1XLNA 4NJ6A 2NBWB 4XE0A 3EGRA 1I35A 3Q69A 4REZA 1EU4A 1RYJA 5BYSA 5JXVA 4MACA 3ZDMC 3NZSA 3AMZA 2XK5A 3JVZX 5CHWA 4ZRKA 1V97A 2XN9C 2KZRA 1WRDB 3QJZA 2I38A 1FCCC 4KKJA 5DPTA 2X38A 4NAWA 4PS7A 1NYRA 4DK5A 3TEYA 1NDDA 4EZLA 2W3RA 2MP2B 2FCNA 3R7RA 2LGSA 2L83A 3AB5A 3BY4B 1Y56A 3MC8A 3HHMA 4TKNA 4WWNA 5L83A 3MC9A 2KT7A 3DCGA 2EMTA 3PZ7A 5C23A 2KOXA 3HIZA 2MW5A 4RGOS 1WZ0A 2IO3B 1FXTB 2M0XA 2HD5B 2C9WB 4W9KA 5C1ZA 1I7HA 2CU3A 1UF0A
chains in the Genus database with same CATH topology
2N0SB 2J52A 1SE3A 2JU6X 4YT0B 1FRRA 1JQ4A 2CJNA 1ZPSA 4HKQA 2WDQB 4RGMA 4LK0M 5HHDG 4N6EB 2WXFA 1JMLA 2V0GA 3LB8C 1MI0A 1J7CA 3AEEB 4ZRQA 1TKYA 1FD6A 1EWYC 1CQVA 4RF0A 3IT6B 4C7YA 3P4PB 1SIJA 2YEPF 1KRHA 3AE9B 4ZHPA 4DQOC 2RPVA 2BYTA 1CK1A 1MHXA 4A90A 4US9A 2INNE 2JX5A 2ACZB 1I4XA 3AE8B 1JWAD 1PGBA 1BXTA 4JE3B 3TEXA 1T3QA 2FE8A 2WDRB 2KWDA 2WXKA 5AUKA 4AS1A 4M0WA 2ICIA 1L0YB 1D6EC 1VZ6A 1XO3A 1AWDA 1WWTA 1RWSA 1UWMA 3IAS1 1VRAB 2GI9A 4KGRA 2HDEA 2IGHA 3NZ3A 4YSXB 1N5XA 3AE1B 3P4RB 5FR3A 3WCQA 1QQRA 1JALA 2EELA 1QOFA 4US8A 1L6UA 1HQRD 3Q8EA 1JW9D 1FNVA 2PIAA 3P4QB 1XLPA 3FILB 4ARCA 1WRIA 1E9MA 3VRAB 2QIEB 2XNAC 3LXFA 1QLBB 5E6JA 1FCLA 2BS4B 1F0ZA 1V1PA 1F2RC 1DOXA 4OVZA 2KACA 1B1ZA 1UNSA 3B2GA 5G5HA 1FXAA 4TMAB 4YSZB 2JXTA 1YN3A 1I4QA 5HG2A 1L0VB 1K51A 2WP9B 2MH7A 4HROA 1C4PA 2BS2B 1HA5A 3UI3A 4A6QA 4WURA 1LO5D 1XLOA 1YN5A 2GRIA 5BMGA 2RMMA 3HRDD 1HZ6A 3IT4B 3VRBB 1DOIA 4LTUA 3MHZA 4NJCA 1T5XD 1JWBD 4TSSA 3VQIA 1ZXIA 3MP9A 2GB1A 2WU2B 4YTMB 1GB1A 1YQ4B 2LGIA 4YSYB 1JWMD 2M0AA 4L1BA 3R2TA 4UDUC 2IJ0A 2WQYB 1Q10A 3Q8AA 1F2RI 5G5GA 1EU3A 4Q2JA 3Q8CA 1C4AA 2JYTA 3PZ8A 4HRSA 3VR8B 2LFIA 1K53A 3B9JA 1BUIC 3NS1A 1TJEA 3URYA 2G1EA 1K52A 1UWXA 3AE3B 3KWLA 1NVID 5EE1A 2IDYA 3DWGC 5AUIA 4OZAA 2IGGA 3ETRA 1J7BA 4KGSA 3W5VB 4IOIE 3TEZA 1STEA 3W2DA 1SE4A 3ZYYX 2WNMA 3TUOA 1XLQA 4JWUC 1SJED 3ZGZA 2KAJA 2EKIA 3GP7A 1DYQA 1MVKA 5D3IB 4B0EA 4HEA1 1VLBA 2V4IB 1ET9A 1XXGA 4B0MA 4YTPB 1CZPA 4RNAA 2ZW0A 2LJIA 3SEBA 1TY0A 1TS5A 1R7SA 4WWMA 2WXPA 2FUG1 3KLSX 3OWEB 2JQRB 3Q8FA 4OW0A 1PYWD 1ESFA 2KDMA 1N60A 3ZJVA 2WXMA 3ABVB 2BB6A 4L2YA 2WXGA 2WU5B 2AQ1B 4WH4A 1FO4A 1WSPA 2V3PA 2Y5PA 3LYYA 1WGKA 3BIID 2D5GA 1TKGA 2J53A 1EM7A 4NZLB 4CQNA 1PGAA 1GB4A 3BVZA 3E9SA 1I4HA 4AQ7A 2K3UA 4ZOHC 4IDIA 2DYMA 4ITKA 1D5XC 4OZBA 2M56B 5BYRA 3U2SC 2BBCA 1SXTA 5D7GA 4DXFA 1TS2A 2RDHA 2L52A 5TSSA 3IXSA 5C2TB 2G9HD 2MJ3A 3P42A 5H92C 3AH7A 1SBBB 3O13A 1YJJA 1GAQB 2AQ2B 3BVGA 1HXYD 1QOAA 3AEAB 5C3JB 3AE7B 1I4RA 4GDKB 1FFUA 3HVZA 4KGTA 3AEBB 3AV8A 4JPSA 2J4XA 5EE9A 2N7JA 3EA6A 1TY2A 2M19A 5D3DA 3AN1A 1C9FA 1FMAD 1NYQA 2PKOA 1CJEA 1FIQA 2QILA 2VZKD 4PT5A 2BT6A 3T3NA 1L5PA 1SJHD 4YWGG 3E56A 2SEBD 3BWUD 1WYGA 3BK2A 3MJ5A 1ROEA 3NRZA 3ZJUA 2DBYA 1D4BA 2R61A 2W82A 1ZDXA 3I57A 3C8YA 1T6BX 3FILA 1JRPA 1YQ3B 1VDVA 1FNUA 2YEPB 5T8IA 2WXJA 3ZQ4A 4XDCA 1SEBD 1JCKB 1KH0A 1GOZA 1IGDA 2VZKB 3R2IA 1ZDVA 3AEDB 1ZP0B 5H8YE 3U52E 1QF6A 2W55A 1E6EB 4HKZE 4JWSC 3HVDA 1C76A 4MH8A 3EUB2 1FXIA 1KLUD 3SFEB 1L4ZB 3VR9B 2PLPA 2SAKA 3AE5B 5HI1A 3NVZA 3W9CB 2BS3B 2E6XA 1L6VA 4D2KA 1E10A 3AE2B 5LNK1 2B76B 5GXGB 2Y5CA 1MHHE 5BMHA 4GDLB 4L23A 1K50A 2ONQA 2WXOA 2PVOD 4FXCA 2BTEA 4A8XC 1AN8A 3ZJTA 1ACCA 2N9LA 1KF6B 1QKZA 2J42A 2Z8LA 1HEZE 1QOBA 2INPE 1C78A 2K0PA 3BZDB 2E3TA 5EE0A 4EE2A 1UUPA 2JSVX 3J9CA 4TQ0A 4WIPA 1VZ7A 2ON8A 4O1NA 1SSNA 1VJKA 1L0XB 2MEKA 1GPXA 3GS2A 3L4PA 2ZW1A 4MM3B 1RM6C 3Q8BA 4RF1A 1C79A 3SFDB 1AYFA 2WXIA 1VZ8A 1YJIA 1TKEA 4YXDB 4LLGM 5I4DA 1IGCA 1V1OA 2OHFA 1FFVA 1PFDA 3U4EG 5FK9C 1V1PB 1YNTE 4R3DA 2V3NA 3P4SB 4P16A 1OQQA 1E7PB 3AEFB 4A55A 3CWIA 1ENFA 1ZOYB 4IKGA 1JWUD 1ZUD2 4C80A 4J3OD 4GLSC 1J7AA 4P6VF 1QILA 2PW9A 2W3SA 4KKIA 1PGXA 4TQ1A 4H2AA 2WXLA 1SB3C 2QSDA 5BMIA 3BVMA 3AM9A 3W5UB 2TSSA 4RGTA 2WDVB 2WLBA 1NEKB 1TS4A 3CIRB 1N63A 1RFKA 3AEGB 2LMCA 1BMLC 4ZYSA 4C7ZA 2JYEA 1FRDA 2N9KA 2LUMA 3HUIA 4HJGE 1D5MC 1DOYA 1I4PA 2PMVA 3W1SA 2W54A 1D5ZC 4NAWB 1YN4A 2LHDA 2PTLA 1IBXA 1B9RA 3AECB 4N59A 2HTME 4RFBA 1XCTL 2NTTA 1EWCA 1N61A 3RFZB 2WXNA 2LEKA 2LHEA 2WS3B 4OHJA 3U7ZA 4NAMA 1NI3A 1P7FA 4N58A 2WXHA 1C77A 3DWMA 3PO0A 2DYOA 1VR9A 1ZE3D 3AE6B 4YTNB 4A9AA 2CJOA 2DLBA 2KN4A 1PUTA 4XDDA 5EE3A 1KLGD 4USAA 3H8HA 1QOGA 3NVWA 1QT9A 4RGNA 3MC0B 1I4GA 2MJEA 3FC4A 1OQRA 1HZ5A 2DWQA 2I2YA 1TS3A 1FEHA 4KX6B 1ET6A 1M4VA 1YMHE 2H89B 2QEJC 3MFGA 4XWTA 2JWUA 4JX1C 1MPEA 3IAM1 1ZXHA 2KQ4X 1AW7A 1XLNA 2WXRA 2K22A 4XE0A 3EGRA 3BK1A 3Q69A 4REZA 1EU4A 2AX5A 3RPFC 1RYJA 5BYSA 5JXVA 4MACA 3SR6A 2QJLA 3GB1A 3KQ4A 3NUHB 5MPOA 4DXGA 1WXQA 4WAFA 1UGJA 3AMZA 1OFFA 1TZOA 3KWVA 1NENB 1TYGB 3FAHA 2L32A 2NTSA 1XCQL 1V97A 2XN9C 1SE2A 1XF5L 2L1AA 3V3XA 2K5PA 4RH6A 1FM0D 1JWSD 1FCCC 2I38A 2K9XA 2RDGA 2X38A 4KKJA 2MJDA 1JROA 4ZRPA 2H88B 1C4CA 4OZCA 1NYRA 4RCOA 1N5WA 2IGDA 2WXQA 3TEYA 5HFYA 1L4DB 3N9YC 1A70A 2W3RA 1F77A 3P1MA 3B2FA 4MT5A 3NVYA 4ZHOA 2L83A 3TEWA 3AB5A 2OEDA 3V05A 1XEEA 2QMTA 1Y56A 2Q5WD 3BYYB 1V8CA 1PDXA 3TSSA 3T3OA 4ARIA 4C56C 3PZ7A 2AQ3B 1FNWA 1SF0A 3R8BA 3NVVA 3BYTB 1DGJA 1IUEA 3I9V1 4RGOS 1KTKA 2BB5A 5BYQA 1I7HA 2NMQA 1N62A 2BW2A 2CU3A 2PVGC 1P7EA 3P63A 1E0ZA 4WQMA 2FBWB 5FKAC 1IBXB 3AE4B 4XWWA 2KMMA 2IPKD 1KFYB 2JZPA 2Y3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MEK A; 
#chains in the Genus database with same CATH topology
 2W9N A;  4MJS B;  4YT0 B;  3S2A A;  1ZPS A;  4HKQ A;  4N6E B;  3L13 A;  1JML A;  2ZVO A;  2V0G A;  4ANV A;  1MI0 A;  4ZRQ A;  3Q14 C;  4GMV A;  3KYC D;  4C7Y A;  2NCN A;  1SIJ A;  3ZVV A;  2BWF A;  3DVG Y;  1CK1 A;  3Q3O C;  1YX6 B;  4F8C B;  1I42 A;  3AE8 B;  3JYU A;  1ZW7 A;  2CU1 A;  1BXT A;  3PVL A;  2N1W A;  2WDR B;  5AUK A;  5E6P A;  3LDZ E;  4PS8 A;  2EMS A;  1XO3 A;  1UH6 A;  2LD9 A;  1RWS A;  3IAS 1;  1VRA B;  4KGR A;  2QHO A;  2X8X X;  4YSX B;  4K7S A;  3H9D A;  3NJT A;  1UEL A;  3UIO B;  2N4F A;  3RD2 A;  4LNO A;  3X0W A;  2EEL A;  1EF5 A;  2ZNV C;  1QOF A;  2QCZ A;  4B6W A;  2L76 A;  1JW9 D;  2BQQ A;  2L0F A;  4IM3 A;  1WRI A;  4MGI E;  1QLB B;  1OGW A;  4OVZ A;  2KAC A;  1B1Z A;  2CHW A;  1P3Q U;  3RNC C;  4AUQ C;  1L0V B;  2BS2 B;  3ZTD A;  4A6Q A;  1V86 A;  2BKF A;  2GBR A;  1XLO A;  2GRI A;  5BMG A;  4FJZ A;  3HRD D;  3QHT A;  3IT4 B;  1DOI A;  4C4V A;  3MHZ A;  1V2Y A;  1ZXI A;  2KWC A;  2KNB A;  2WU2 B;  1WGD A;  4YSY B;  3EHV A;  1Q1O A;  4JIO U;  3C19 A;  4AOF A;  2D3A A;  4DHZ B;  5IOI A;  5G5G A;  2IO0 B;  1XQQ A;  3Q8C A;  2JYT A;  1TGZ B;  2MSE D;  2KJ6 A;  3PZ8 A;  2JXX A;  1K52 A;  4HPP A;  2N7E A;  1UBQ A;  3AE3 B;  1J0G A;  3KYD D;  3PT2 B;  5EE1 A;  4DDI D;  1J7B A;  3W5V B;  4B95 A;  4IOI E;  2QDF A;  4HK2 A;  2WNM A;  1FPY A;  3M95 A;  3SU8 X;  1XLQ A;  1NI2 A;  2KHW B;  1WGR A;  3A9J B;  2FCQ A;  2MP2 A;  4RNA A;  5L95 C;  2M1M A;  1TS5 A;  3QCA A;  2WXP A;  2GOW A;  4P7I A;  4HLE A;  2KDF B;  2JQR B;  2ZEQ A;  1N60 A;  1OTR B;  4WH4 A;  1FO4 A;  1WSP A;  2BF8 B;  3DBS A;  3DBL B;  3PTF C;  5CX3 A;  2YVC A;  3BII D;  3EEC A;  1K8R B;  2V3S A;  3DHI C;  4ITK A;  2JZ3 B;  4KDL B;  3U2S C;  2L52 A;  3N32 A;  5C2T B;  2G9H D;  2MJ3 A;  3P42 A;  3O13 A;  3FKY A;  1YJJ A;  2FCS A;  1QOA A;  3AEA B;  2JPH A;  1I4R A;  4GDK B;  1WJ4 A;  3HVZ A;  3ZNZ B;  1H4R A;  3AEB B;  3DQV A;  5EE9 A;  4FAD A;  1TY2 A;  3HM6 X;  4LNK A;  1NYQ A;  3KW5 B;  3IBE A;  1S1Q B;  1J8C A;  2M8S A;  3RI7 C;  3A1Q A;  3E56 A;  3BWU D;  2KXJ A;  1GNU A;  2ZPN A;  2W82 A;  2KQ7 A;  1T6B X;  1YQ3 B;  1VDV A;  1FNU A;  5HKH A;  1SEB D;  1KH0 A;  3UQB A;  1GOZ A;  3IG3 A;  3A9K A;  3OLM D;  1F1H A;  2FID A;  3HVD A;  2GMI C;  3W1Y A;  3SFE B;  4K1R B;  5LXH A;  2FIF A;  2BS3 B;  2E6X A;  3QC8 B;  2KVZ A;  2RDB C;  2B76 B;  2K8C A;  1RLF A;  5GXG B;  2KX0 A;  4L23 A;  1K50 A;  2WXO A;  1XD3 B;  2N9X A;  2PVO D;  4FXC A;  2BTE A;  1ACC A;  3AU5 A;  4N9F 4;  1VCB A;  4KDI C;  1WR6 E;  2D2Q A;  4ZDV A;  2ZCB A;  3ZUN A;  1KM7 A;  2E3T A;  5D2M B;  4CHK A;  1VZ7 A;  2INC C;  4MEM A;  3L4P A;  1F52 A;  1RM6 C;  3SFD B;  1WGG A;  4YXD B;  3APD A;  4LLG M;  1FFV A;  4I6P A;  4B9K A;  1YNT E;  1OQQ A;  3M62 B;  4WQO B;  3CWI A;  3H7P B;  3AU4 A;  1ZOY B;  4XC2 A;  4GDK A;  4HDQ A;  1MG8 A;  2L00 B;  4KSK C;  1PGX A;  4H2A A;  2JUO A;  2KC2 A;  1MJD A;  1SB3 C;  4NPN A;  2KDI A;  2WDV B;  2WLB A;  2OJW A;  1NEK B;  3UGB B;  2J0K A;  2MBO A;  4G0N B;  4FHK A;  1G6J A;  2I1K A;  2KC1 A;  5IAA C;  1D5M C;  1DOY A;  1LXD A;  3W1S A;  3UIN B;  2LHD A;  4N59 A;  2HTM E;  4A3P A;  3APC A;  3RFZ B;  2PEA A;  2LEK A;  2LRU A;  4XX5 A;  1NI3 A;  2WXH A;  3DBR I;  3OJ4 B;  1C77 A;  3DWM A;  4K7W A;  1PUT A;  3NG0 A;  3VH3 B;  3A9J A;  3QWZ B;  1KLG D;  4BBN C;  3NVW A;  4IUM B;  1LFD A;  4W9H A;  4X57 B;  5JZE B;  3QQ8 B;  1OQR A;  3VXW A;  1ET6 A;  1M4V A;  1YMH E;  2DZI A;  2H89 B;  3DOW A;  3TBL D;  5J2R A;  3MFG A;  1R4M B;  3IAM 1;  2KQ4 X;  4RMA A;  3ZO5 B;  2LGY A;  4MH0 E;  1U4A A;  4DXG A;  1TZO A;  2GLS A;  3KUC B;  1TYG B;  3JSV B;  4AJW A;  3AI5 A;  1YX5 B;  3QA8 A;  2KYW A;  1SE2 A;  3WAO A;  2K5P A;  1FM0 D;  1JWS D;  2K9X A;  4IC7 B;  2MJD A;  1T0Y A;  2H88 B;  4CYE A;  1C4C A;  3Q3J A;  2LZ6 A;  1N5W A;  4JL9 A;  2WXQ A;  2Z0E B;  3CMM B;  4ZYN A;  1L4D B;  5IN7 A;  5E6N A;  2ZVN A;  1F77 A;  2DHZ A;  2KMA A;  3NY5 A;  2JRI B;  2DAF A;  1V5T A;  4ZHO A;  1V81 A;  3B1L X;  1XEE A;  2QMT A;  4MGZ E;  1V8C A;  3TSS A;  3PLV A;  3L17 A;  4ZRJ A;  2AQ3 B;  1SF0 A;  3WIM A;  1KTK A;  5BYQ A;  4MSM B;  2NMQ A;  3VTU A;  4RM8 A;  1E0Z A;  2FBW B;  5FKA C;  1IBX B;  4BOS C;  2KMM A;  1V1P A;  2Y3A A;  1KLV A;  2J52 A;  1FRR A;  2CJN A;  2WDQ B;  4LK0 M;  2J0M A;  3LB8 C;  5TR5 A;  1FD6 A;  4WJO A;  2NPT A;  3VHT C;  4YL8 A;  3QIJ A;  1RRB A;  2YEP F;  1R4N I;  2R2O A;  3AE9 B;  5IKC M;  2BYT A;  4A90 A;  2JX5 A;  1I4X A;  4BKS A;  3TEX A;  3GZN I;  2KFK B;  4AS1 A;  2L3Z A;  4M0W A;  4IWP A;  1VZ6 A;  3N1X C;  2HJ8 A;  4XGA B;  2GI9 A;  2WYQ A;  1KJT A;  3RCZ A;  3GE8 C;  1N5X A;  4PYU A;  3PRM B;  1HQR D;  3Q8E A;  4URK A;  2GBJ A;  2B3A A;  4ANU A;  3PHW B;  4GGQ A;  3RUI B;  1E9M A;  2QIE B;  2XNA C;  2ASQ A;  1ZGU B;  4C4V B;  2D3C A;  1WR1 A;  1FXA A;  5HG2 A;  3DVN U;  1E5W A;  3TL5 A;  4HRO A;  1C4P A;  3VDZ A;  1HA5 A;  4F1S A;  4WUR A;  1LO5 D;  2KFJ A;  4C00 A;  2MBB B;  1HZ6 A;  3VRB B;  1WM3 A;  4EUT A;  3M3J A;  4TSS A;  4K3C A;  5JH5 C;  3ZNG C;  1Y8R C;  3I5J C;  1YQ4 B;  2LGI A;  2BGF A;  2M0A A;  2AYO B;  4DBG A;  3ENE A;  3R2T A;  2WQY B;  3SDL C;  4KZC A;  1F2R I;  1EU3 A;  4Q2J A;  4F7Z A;  1SE9 A;  1BUI C;  1TJE A;  3L0W B;  4HPM B;  1UWX A;  1HE8 A;  3KWL A;  3IFW B;  2IDY A;  2KKC A;  4OZA A;  1E8Y A;  1LM8 B;  2MWS B;  1N6Z A;  2D3B A;  2KO3 A;  4KGS A;  3TEZ A;  1STE A;  3W2D A;  1SE4 A;  4RM9 A;  3ZYY X;  4FN2 A;  3RNG C;  3JW0 X;  5GMV A;  4AP4 C;  3ZGZ A;  2KAJ A;  2EKI A;  2JT4 B;  1DYQ A;  1L7Y A;  1E7U A;  4LNI A;  4LJO B;  3RT3 B;  3V62 A;  2LVQ A;  5D6J B;  4P1C C;  2FUG 1;  3Q8F A;  4OW0 A;  3SHQ A;  2KDM A;  3ABV B;  2AQ1 B;  5DPS A;  1WGK A;  1TKG A;  2J53 A;  3B08 A;  1EM7 A;  5JHA A;  3Q3N C;  2KK8 A;  2A4Z A;  5D7G A;  1MFW A;  2D07 B;  3IXS A;  3AH7 A;  3EC8 A;  3RZF A;  3APF A;  1GAQ B;  4LNF A;  1HXY D;  5C3J B;  1OEY A;  5LXI B;  2ZNV B;  2J4X A;  2IO2 B;  3EA6 A;  4WAA A;  5D3D A;  2VRR B;  3ML8 A;  1MG4 A;  2R2Q A;  2O6V A;  1XT9 B;  4BVU C;  2KLC A;  3T3N A;  2VH2 A;  3PRP B;  4FA6 A;  4GSW A;  1YOV B;  1ROE A;  2XK5 B;  4ANW A;  2DBY A;  3UF8 A;  2R61 A;  3ZW3 A;  3FIL A;  1JRP A;  3D32 A;  3A9K B;  2RSU A;  4XDC A;  2NVU I;  2VZK B;  3R2I A;  1ZDV A;  3AED B;  1WMH B;  1QF6 A;  3BIN A;  4HKZ E;  4MH8 A;  3EUB 2;  1E8Z A;  1WXM A;  2PLP A;  2MLB A;  2SAK A;  3AE5 B;  4K7U A;  3Q3M C;  2GBK A;  3NVZ A;  1C1Y B;  4BBN F;  2G4S A;  1L6V A;  2WGS A;  3AE2 B;  2Z59 B;  2ZPY A;  5DPR A;  1AAR A;  2ONQ A;  4HVB A;  2J42 A;  3NHE B;  3L08 A;  2NPT B;  3ECI A;  3KH0 A;  1UUP A;  2JSV X;  4OVV A;  3J9C A;  4M8N A;  4KIK B;  2JVC A;  2ON8 A;  3PLU A;  1SSN A;  2DEN B;  1GPX A;  1TT5 B;  1RAX A;  3GOE A;  4DHJ D;  4RF1 A;  3Q8B A;  2OJR A;  4MJS A;  1YJI A;  3U4E G;  1PFD A;  2FUH B;  1GG3 A;  3A4R A;  4P16 A;  2MCN B;  3AEF B;  2KQS A;  1P9D U;  1LGR A;  5CHF A;  4IKG A;  4EKU A;  3CST A;  1J7A A;  1E7V A;  3ZDT A;  2ZCC A;  1QIL A;  2W3S A;  4KKI A;  1WX9 A;  1ZKH A;  3RZW C;  2WXL A;  3MTN B;  2QSD A;  3AM9 A;  4WJP A;  3W5U B;  1TS4 A;  4TV3 A;  1N63 A;  4ICV A;  3C0R B;  2KTR B;  1BML C;  2PJH A;  1WGY A;  2JYE A;  2UYZ B;  3T8M A;  2PMV A;  2V9H A;  4LDT D;  1GJZ A;  1YN4 A;  2PTL A;  1IBX A;  1EWC A;  1N61 A;  2LHE A;  2WS3 B;  3ONS A;  4OHJ A;  3U7Z A;  4NAM A;  2KTF A;  1EO6 A;  3VAW A;  1E8W A;  4W9L A;  1UD7 A;  2LUE A;  3A1Q B;  1WY8 A;  2LI5 A;  4XDD A;  5EE3 A;  2MHJ A;  4USA A;  3H8H A;  1QOG A;  4RGN A;  1QT9 A;  3MC0 B;  3FC4 A;  1HZ5 A;  2DWQ A;  2I2Y A;  4BKG A;  1UBI A;  3M63 B;  4MGK E;  4XWT A;  1MPE A;  1WF9 A;  2KLG A;  3VUX A;  1AW7 A;  2WXR A;  3RUL A;  2K22 A;  3MHS D;  2AX5 A;  3RPF C;  2QJL A;  3GB1 A;  4GIV A;  3NUH B;  4WAF A;  2C7H A;  1WX7 A;  3DHH C;  4GU2 A;  3FAH A;  2UU7 A;  4ANX A;  2L32 A;  2KAN A;  2HJ1 A;  2PE9 A;  3U30 A;  2L1A A;  1WM2 A;  3TMP B;  3DBR B;  2RDG A;  4BKT A;  5FR6 A;  1JRO A;  1GC7 A;  4OZC A;  4EOY A;  4W9I A;  1WXA A;  2LRW A;  2XEW A;  3N9Y C;  1A70 A;  4W9G A;  3P1M A;  1WIA A;  3B2F A;  4MT5 A;  2IBI B;  3DVN V;  2OED A;  3V05 A;  1WXV A;  3DPD A;  4ARI A;  1FNW A;  1LQB A;  1H8C A;  1P98 A;  1IUE A;  3I9V 1;  3H7P A;  2BB5 A;  4XZ4 A;  3DBL I;  2M4N A;  2RPQ A;  3X23 A;  1P7E A;  4WQM A;  2J7Q B;  4XWW A;  3EFU A;  2IPK D;  1KFY B;  2JZP A;  1WJU A;  2N0S B;  4A3O A;  1SE3 A;  3WAM A;  2WXF A;  5LLI A;  2CHZ A;  1J7C A;  2IY1 B;  4M0W B;  2K8B A;  3V60 A;  1CQV A;  3A4S C;  4RF0 A;  1KRH A;  4FJY A;  5J17 A;  2RPV A;  1M94 A;  1EF1 A;  4US9 A;  1WZ3 A;  2KJR A;  2N9P C;  1JWA D;  5G55 A;  3O65 B;  1T3Q A;  2WXK A;  4NQL B;  4HJK A;  2ICI A;  5EDS A;  2N7D A;  4AJY B;  1L0Y B;  1WWT A;  2A5U A;  1VD2 A;  1OQY A;  1UWM A;  3DBH B;  2HDE A;  2IGH A;  3AE1 B;  3P4R B;  3QAQ A;  3SD5 A;  2G45 B;  3H7S A;  3LXF A;  1FCL A;  2BS4 B;  1F2R C;  2K6Q A;  4GXB A;  4II2 B;  1UNS A;  3WAN A;  2RD0 A;  4YSZ B;  5E6O A;  4G11 A;  1YN3 A;  4MDK E;  1K51 A;  2MH7 A;  2O6V B;  4NJ7 A;  1J19 A;  3UI3 A;  1YN5 A;  2RMM A;  3RMK C;  4LTU A;  4NJC A;  1T5X D;  4W9J A;  2GB1 A;  2WHI A;  4M02 A;  5AEK B;  3ZTC A;  2LGX A;  4L1B A;  2CS4 A;  5AZF A;  2I1J A;  4UDU C;  2BKR B;  2IJ0 A;  3JSV A;  3Q8A A;  2O2V B;  2KWV B;  3B0A A;  4G3X B;  4HRS A;  4GOC A;  2LFI A;  3RNB C;  3KUD B;  1K53 A;  3URY A;  3PGE A;  2G1E A;  3PV1 A;  4DWF A;  1NVI D;  2EKE C;  2IGG A;  2K6D B;  2UWQ A;  2KTR A;  2C5L C;  3Q2A C;  3NOB A;  5DPW A;  4JWU C;  1SJE D;  3AUL A;  3GP7 A;  3OG5 A;  1MVK A;  4HEA 1;  2LXA A;  1VLB A;  5BO4 B;  1YJ1 A;  1XXG A;  4B0M A;  4YTP B;  1HTO A;  2NS5 A;  3ML9 A;  4FJV B;  3CSF A;  1R7S A;  4WWM A;  2J0J A;  3KLS X;  3OWE B;  2GBM A;  1CMX B;  1PYW D;  2WXM A;  2V1Y A;  1WYW B;  4L2Y A;  2WXG A;  3U7D A;  1E90 A;  2WU5 B;  4M00 A;  1TZ1 A;  4CQN A;  1PGA A;  3ZNI D;  5AZG A;  4CO7 A;  1GB4 A;  3BVZ A;  2MBE A;  1I4H A;  4AQ7 A;  4KVG B;  2DYM A;  4OZB A;  2M56 B;  5BYR A;  2BBC A;  1SXT A;  4DXF A;  1A5R A;  1TS2 A;  3VTV A;  5TSS A;  5H92 C;  1WGH A;  1SBB B;  5IA7 A;  2FAZ A;  4II3 B;  2VH1 A;  3N1Y C;  2AQ2 B;  1FFU A;  4W9F A;  1R4M I;  1T0R C;  3AV8 A;  4WJQ A;  2DZJ A;  2L7R A;  2AL3 A;  4NNJ B;  3AN1 A;  1C9F A;  1FMA D;  2PKO A;  2BT6 A;  4YWG G;  2FCM A;  2NR2 A;  4ICU A;  1WYG A;  3BK2 A;  1RFA A;  5AZH A;  1TTN A;  1YQB A;  3ZLZ A;  2IO1 B;  4HPL B;  3ZQ4 A;  4S0R A;  4PK1 A;  1JCK B;  4E3C A;  1IGD A;  2KD0 A;  5H8Y E;  2W55 A;  5D94 A;  3V6E B;  1KLU D;  2DNF A;  2V4L A;  3R66 C;  4D2K A;  1WI0 A;  2LXC A;  1Z2M A;  5LNK 1;  2LVO A;  5BMH A;  4GDL B;  3ZNH B;  4A8X C;  1AN8 A;  2CKH B;  2N9L A;  1KF6 B;  5JHB A;  4LCD E;  2Z8L A;  3DDC B;  4IM0 A;  1QOB A;  2QC8 A;  3PZD A;  2INP E;  2KWU B;  3BZD B;  2KDE B;  4KV2 A;  1F9J A;  1WH3 A;  5CTR C;  3R3M A;  5EE0 A;  1EUV B;  4EE2 A;  4TQ0 A;  1L2N A;  4ZRI A;  4O1N A;  1L0X B;  2MEK A;  2LJ5 A;  2ZW1 A;  4MM3 B;  1C79 A;  2WXI A;  1VZ8 A;  1TKE A;  3R7Q A;  1IGC A;  1V1O A;  2OHF A;  1V1P B;  2BPS A;  4KIK A;  3RNA C;  4A55 A;  1ENF A;  4KZ0 A;  1JWU D;  1ZUD 2;  4J3O D;  4P6V F;  1X1M A;  2HTH A;  4TQ1 A;  4BOZ B;  2CHX A;  5BMI A;  1QZE A;  2TSS A;  3H6N A;  3CIR B;  4IM2 A;  1RFK A;  3AEG B;  3VUY A;  3VFK A;  3PPA A;  4ZYS A;  2K25 A;  4C7Z A;  1FRD A;  2N9K A;  3WA0 A;  4HJG E;  2JWZ A;  3HK0 A;  4PYZ A;  1D5Z C;  4NAW B;  5J18 A;  2N1V A;  4EEW A;  1B9R A;  3AEC B;  4RFB A;  1XCT L;  2NTT A;  2IZV B;  2MQJ A;  2AL6 A;  2DYB A;  2MX2 A;  1P7F A;  4HDO A;  4N58 A;  3TJP A;  2DYO A;  1VR9 A;  2NBV B;  3AE6 B;  4YTN B;  4A9A A;  2DLB A;  2KVR A;  2KN5 A;  1YD8 U;  1D3Z A;  4E74 A;  3PS6 A;  2NBU A;  1I4G A;  2MJE A;  3OAW A;  1FEH A;  3QK0 A;  2JWU A;  4JX1 C;  4MEL A;  3A33 B;  4NQK E;  2BWE S;  2Y5B B;  3BK1 A;  5KHO A;  4KSL C;  3L16 A;  3SR6 A;  4FHJ A;  3KQ4 A;  5MPO A;  2N9E B;  1WXQ A;  1WFY A;  1UGJ A;  3ZIM A;  1OFF A;  3I63 C;  3KWV A;  1NEN B;  2NTS A;  1XCQ L;  2D10 A;  3UIP B;  1XF5 L;  4BZA A;  3V3X A;  3V6C B;  4RH6 A;  3U8Z A;  4ZRP A;  5IP4 D;  1WJ6 A;  4RCO A;  2IGD A;  4FBJ B;  5HFY A;  4JLC A;  1IYF A;  3IVF A;  3ZRF A;  3NVY A;  2MRP A;  1V5O A;  3TEW A;  3DVG X;  1IPG A;  2Q5W D;  3BYY B;  1E8X A;  3T3O A;  1PDX A;  2D11 A;  4C56 C;  2PPH A;  3R8B A;  3NVV A;  2L0T A;  3BYT B;  3ZKJ C;  1DGJ A;  4LJP B;  3CF6 E;  4I6L B;  2IY0 B;  2G3Q B;  1N62 A;  2BW2 A;  2PVG C;  3IHP C;  3P63 A;  3AE4 B;  2LAS A;  2AEH A;  4W9C A;  4DHZ E;  3PRZ A;  2JU6 X;  1SIF A;  1JQ4 A;  2FNJ B;  3RYT A;  1TBE A;  4RGM A;  1Z5S B;  4MM3 A;  5HHD G;  2OOB B;  4BKS D;  3AEE B;  4FUL A;  1TKY A;  5CHV C;  3RN9 C;  1EWY C;  2KX3 A;  5DCN A;  3IT6 B;  3VVW B;  3P4P B;  4ZHP A;  4DQO C;  1WXS A;  1MHX A;  3AXC A;  2INN E;  2RR9 A;  2ACZ B;  4JE3 B;  1PGB A;  2C7N B;  2LGD A;  3K9O B;  1PQS A;  3PHX B;  3DHG C;  2FE8 A;  2KWD A;  3I3T B;  1D6E C;  1AWD A;  1UGM A;  4EZJ A;  3NZ3 A;  5FR3 A;  3WCQ A;  1QQR A;  1JAL A;  4US8 A;  4DDG D;  1L6U A;  1T0Q C;  1FNV A;  2PIA A;  3P4Q B;  1XLP A;  3FIL B;  4GB9 A;  1UZX B;  4ARC A;  3VRA B;  1ISN A;  4HXD A;  5E6J A;  4EZK A;  1F0Z A;  1DOX A;  5G2N A;  1R4N B;  3WAL A;  3B2G A;  5G5H A;  4GDL A;  2C60 A;  4M01 A;  3KUZ A;  4TMA B;  2JXT A;  1I4Q A;  4JGH B;  2JZZ A;  2WP9 B;  2KFK A;  2DX5 B;  3PSE B;  3V61 A;  4MSQ B;  2O6V D;  2REX A;  2PE6 B;  1JWB D;  2L8J A;  1IP9 A;  3VQI A;  3MP9 A;  2MA9 B;  4YTM B;  1OEY J;  1GB1 A;  1WMH A;  4IWQ A;  1JWM D;  3QX1 A;  4FLH A;  3TCA A;  2IND C;  1KOT A;  2WDT B;  1Q10 A;  2LVP A;  1C4A A;  4OVU A;  3VR8 B;  4ASW C;  4E71 A;  3B9J A;  3NS1 A;  3GE3 C;  3PRE A;  3TIX A;  3LJ3 A;  1V49 A;  3DWG C;  5AUI A;  3ETR A;  2WX1 A;  3N30 A;  1WE7 A;  4QAY A;  3L10 B;  2JY6 A;  4PS3 A;  3TUO A;  2BYV E;  4P1B C;  5D3I B;  4B0E A;  2V4I B;  1ET9 A;  1CZP A;  1S3S G;  2ZW0 A;  2LJI A;  1JRU A;  1WX8 A;  2XBB C;  3SEB A;  1TY0 A;  2BYF A;  1SGH A;  1V9J A;  2JRH A;  4DHJ B;  1ESF A;  3ZJV A;  4IWO A;  4HWI B;  2BB6 A;  3EFC A;  1V80 A;  2V3P A;  3NS8 A;  2Y5P A;  3LYY A;  2D5G A;  4NZL B;  1TIF A;  4AWJ A;  3OJ3 A;  3E9S A;  1P1A A;  2K3U A;  4ZOH C;  4NY0 A;  4IDI A;  3T9L A;  4JQW C;  1D5X C;  3H1U A;  4J6I A;  3HM3 A;  2YLM A;  2GBN A;  2RDH A;  1YIW A;  3Q3F A;  2JF5 A;  2C7M B;  4IG7 B;  1GC6 A;  3BVG A;  3AE7 B;  4TUU A;  2G4D B;  2Z0D B;  4KGT A;  1Q5W B;  4JPS A;  2DZK A;  2N7J A;  2M19 A;  3N3K B;  2BYE A;  1CJE A;  1FIQ A;  2QIL A;  2VZK D;  4LDT B;  4PT5 A;  1L5P A;  1SJH D;  3Q6B A;  3ZXR A;  2O2V A;  2SEB D;  3GZN B;  2D3G A;  3MJ5 A;  4A20 A;  3NRZ A;  3ZJU A;  4K81 A;  1D4B A;  3I57 A;  1ZDX A;  1P0R A;  3C8Y A;  2YEP B;  5T8I A;  2WXJ A;  2WX0 A;  1WE6 A;  3U52 E;  1ZP0 B;  3MJW A;  1NBF C;  1E6E B;  4JWS C;  2M17 A;  1C76 A;  1FXI A;  4ACF A;  1L4Z B;  3VR9 B;  3VUW A;  5HI1 A;  1HTQ A;  3W9C B;  3N20 C;  1E10 A;  2ZZP B;  3WAP A;  2BVC A;  2Y5C A;  1MHH E;  4DXA B;  4WWO A;  4HCP B;  3ZJT A;  2KJH B;  1QKZ A;  1HEZ E;  1C78 A;  2K0P A;  4WIP A;  1VJK A;  3GS2 A;  3KVF B;  5IO9 A;  3P2B A;  3NZU A;  2K39 A;  1AYF A;  3UQA A;  5I4D A;  3VTW A;  1BT0 A;  5FK9 C;  4WJN A;  4R3D A;  3VH4 B;  2DZM A;  2V3N A;  3P4S B;  2LWP A;  1E7P B;  3QAR A;  4LNN A;  2WWZ A;  3ALB A;  4GN1 A;  4M8M A;  2K1F A;  4C80 A;  4GLS C;  2ZJD A;  4EFO A;  4WWP A;  4K3B A;  2AWT A;  3RNE C;  2PW9 A;  3L54 A;  3BVM A;  4BFR A;  2KMC A;  4RGT A;  4G50 A;  4XYC A;  1WJN A;  1T0S C;  2DAJ A;  2LMC A;  3DBH I;  2LUM A;  3HUI A;  3ZRC A;  2MBQ A;  1I4P A;  4W9D A;  4S17 A;  4BAX A;  2L05 A;  3W1S C;  2W54 A;  4IW0 A;  5KHQ A;  4I6N B;  1C3T A;  4W9E A;  2WXN A;  2HE7 A;  2RGF A;  1Q0W B;  1V6E A;  3RNF C;  4HCN B;  3ZXV A;  3PO0 A;  2KDB A;  1ZE3 D;  2CJO A;  2KN4 A;  2MBH A;  2IYD B;  1GUA B;  2CR5 A;  3K9P B;  1TS3 A;  4KX6 B;  4MGY E;  2K8H A;  2QEJ C;  1ZXH A;  3N1Z C;  1XLN A;  4NJ6 A;  2NBW B;  4XE0 A;  3EGR A;  1I35 A;  3Q69 A;  4REZ A;  1EU4 A;  1RYJ A;  5BYS A;  5JXV A;  4MAC A;  3ZDM C;  3NZS A;  3AMZ A;  2XK5 A;  3JVZ X;  5CHW A;  4ZRK A;  1V97 A;  2XN9 C;  2KZR A;  1WRD B;  3QJZ A;  2I38 A;  1FCC C;  4KKJ A;  5DPT A;  2X38 A;  4NAW A;  4PS7 A;  1NYR A;  4DK5 A;  3TEY A;  1NDD A;  4EZL A;  2W3R A;  2MP2 B;  2FCN A;  3R7R A;  2LGS A;  2L83 A;  3AB5 A;  3BY4 B;  1Y56 A;  3MC8 A;  3HHM A;  4TKN A;  4WWN A;  5L83 A;  3MC9 A;  2KT7 A;  3DCG A;  2EMT A;  3PZ7 A;  5C23 A;  2KOX A;  3HIZ A;  2MW5 A;  4RGO S;  1WZ0 A;  2IO3 B;  1FXT B;  2M0X A;  2HD5 B;  2C9W B;  4W9K A;  5C1Z A;  1I7H A;  2CU3 A;  1UF0 A; 
#chains in the Genus database with same CATH homology
 2N0S B;  2J52 A;  1SE3 A;  2JU6 X;  4YT0 B;  1FRR A;  1JQ4 A;  2CJN A;  1ZPS A;  4HKQ A;  2WDQ B;  4RGM A;  4LK0 M;  5HHD G;  4N6E B;  2WXF A;  1JML A;  2V0G A;  3LB8 C;  1MI0 A;  1J7C A;  3AEE B;  4ZRQ A;  1TKY A;  1FD6 A;  1EWY C;  1CQV A;  4RF0 A;  3IT6 B;  4C7Y A;  3P4P B;  1SIJ A;  2YEP F;  1KRH A;  3AE9 B;  4ZHP A;  4DQO C;  2RPV A;  2BYT A;  1CK1 A;  1MHX A;  4A90 A;  4US9 A;  2INN E;  2JX5 A;  2ACZ B;  1I4X A;  3AE8 B;  1JWA D;  1PGB A;  1BXT A;  4JE3 B;  3TEX A;  1T3Q A;  2FE8 A;  2WDR B;  2KWD A;  2WXK A;  5AUK A;  4AS1 A;  4M0W A;  2ICI A;  1L0Y B;  1D6E C;  1VZ6 A;  1XO3 A;  1AWD A;  1WWT A;  1RWS A;  1UWM A;  3IAS 1;  1VRA B;  2GI9 A;  4KGR A;  2HDE A;  2IGH A;  3NZ3 A;  4YSX B;  1N5X A;  3AE1 B;  3P4R B;  5FR3 A;  3WCQ A;  1QQR A;  1JAL A;  2EEL A;  1QOF A;  4US8 A;  1L6U A;  1HQR D;  3Q8E A;  1JW9 D;  1FNV A;  2PIA A;  3P4Q B;  1XLP A;  3FIL B;  4ARC A;  1WRI A;  1E9M A;  3VRA B;  2QIE B;  2XNA C;  3LXF A;  1QLB B;  5E6J A;  1FCL A;  2BS4 B;  1F0Z A;  1V1P A;  1F2R C;  1DOX A;  4OVZ A;  2KAC A;  1B1Z A;  1UNS A;  3B2G A;  5G5H A;  1FXA A;  4TMA B;  4YSZ B;  2JXT A;  1YN3 A;  1I4Q A;  5HG2 A;  1L0V B;  1K51 A;  2WP9 B;  2MH7 A;  4HRO A;  1C4P A;  2BS2 B;  1HA5 A;  3UI3 A;  4A6Q A;  4WUR A;  1LO5 D;  1XLO A;  1YN5 A;  2GRI A;  5BMG A;  2RMM A;  3HRD D;  1HZ6 A;  3IT4 B;  3VRB B;  1DOI A;  4LTU A;  3MHZ A;  4NJC A;  1T5X D;  1JWB D;  4TSS A;  3VQI A;  1ZXI A;  3MP9 A;  2GB1 A;  2WU2 B;  4YTM B;  1GB1 A;  1YQ4 B;  2LGI A;  4YSY B;  1JWM D;  2M0A A;  4L1B A;  3R2T A;  4UDU C;  2IJ0 A;  2WQY B;  1Q10 A;  3Q8A A;  1F2R I;  5G5G A;  1EU3 A;  4Q2J A;  3Q8C A;  1C4A A;  2JYT A;  3PZ8 A;  4HRS A;  3VR8 B;  2LFI A;  1K53 A;  3B9J A;  1BUI C;  3NS1 A;  1TJE A;  3URY A;  2G1E A;  1K52 A;  1UWX A;  3AE3 B;  3KWL A;  1NVI D;  5EE1 A;  2IDY A;  3DWG C;  5AUI A;  4OZA A;  2IGG A;  3ETR A;  1J7B A;  4KGS A;  3W5V B;  4IOI E;  3TEZ A;  1STE A;  3W2D A;  1SE4 A;  3ZYY X;  2WNM A;  3TUO A;  1XLQ A;  4JWU C;  1SJE D;  3ZGZ A;  2KAJ A;  2EKI A;  3GP7 A;  1DYQ A;  1MVK A;  5D3I B;  4B0E A;  4HEA 1;  1VLB A;  2V4I B;  1ET9 A;  1XXG A;  4B0M A;  4YTP B;  1CZP A;  4RNA A;  2ZW0 A;  2LJI A;  3SEB A;  1TY0 A;  1TS5 A;  1R7S A;  4WWM A;  2WXP A;  2FUG 1;  3KLS X;  3OWE B;  2JQR B;  3Q8F A;  4OW0 A;  1PYW D;  1ESF A;  2KDM A;  1N60 A;  3ZJV A;  2WXM A;  3ABV B;  2BB6 A;  4L2Y A;  2WXG A;  2WU5 B;  2AQ1 B;  4WH4 A;  1FO4 A;  1WSP A;  2V3P A;  2Y5P A;  3LYY A;  1WGK A;  3BII D;  2D5G A;  1TKG A;  2J53 A;  1EM7 A;  4NZL B;  4CQN A;  1PGA A;  1GB4 A;  3BVZ A;  3E9S A;  1I4H A;  4AQ7 A;  2K3U A;  4ZOH C;  4IDI A;  2DYM A;  4ITK A;  1D5X C;  4OZB A;  2M56 B;  5BYR A;  3U2S C;  2BBC A;  1SXT A;  5D7G A;  4DXF A;  1TS2 A;  2RDH A;  2L52 A;  5TSS A;  3IXS A;  5C2T B;  2G9H D;  2MJ3 A;  3P42 A;  5H92 C;  3AH7 A;  1SBB B;  3O13 A;  1YJJ A;  1GAQ B;  2AQ2 B;  3BVG A;  1HXY D;  1QOA A;  3AEA B;  5C3J B;  3AE7 B;  1I4R A;  4GDK B;  1FFU A;  3HVZ A;  4KGT A;  3AEB B;  3AV8 A;  4JPS A;  2J4X A;  5EE9 A;  2N7J A;  3EA6 A;  1TY2 A;  2M19 A;  5D3D A;  3AN1 A;  1C9F A;  1FMA D;  1NYQ A;  2PKO A;  1CJE A;  1FIQ A;  2QIL A;  2VZK D;  4PT5 A;  2BT6 A;  3T3N A;  1L5P A;  1SJH D;  4YWG G;  3E56 A;  2SEB D;  3BWU D;  1WYG A;  3BK2 A;  3MJ5 A;  1ROE A;  3NRZ A;  3ZJU A;  2DBY A;  1D4B A;  2R61 A;  2W82 A;  1ZDX A;  3I57 A;  3C8Y A;  1T6B X;  3FIL A;  1JRP A;  1YQ3 B;  1VDV A;  1FNU A;  2YEP B;  5T8I A;  2WXJ A;  3ZQ4 A;  4XDC A;  1SEB D;  1JCK B;  1KH0 A;  1GOZ A;  1IGD A;  2VZK B;  3R2I A;  1ZDV A;  3AED B;  1ZP0 B;  5H8Y E;  3U52 E;  1QF6 A;  2W55 A;  1E6E B;  4HKZ E;  4JWS C;  3HVD A;  1C76 A;  4MH8 A;  3EUB 2;  1FXI A;  1KLU D;  3SFE B;  1L4Z B;  3VR9 B;  2PLP A;  2SAK A;  3AE5 B;  5HI1 A;  3NVZ A;  3W9C B;  2BS3 B;  2E6X A;  1L6V A;  4D2K A;  1E10 A;  3AE2 B;  5LNK 1;  2B76 B;  5GXG B;  2Y5C A;  1MHH E;  5BMH A;  4GDL B;  4L23 A;  1K50 A;  2ONQ A;  2WXO A;  2PVO D;  4FXC A;  2BTE A;  4A8X C;  1AN8 A;  3ZJT A;  1ACC A;  2N9L A;  1KF6 B;  1QKZ A;  2J42 A;  2Z8L A;  1HEZ E;  1QOB A;  2INP E;  1C78 A;  2K0P A;  3BZD B;  2E3T A;  5EE0 A;  4EE2 A;  1UUP A;  2JSV X;  3J9C A;  4TQ0 A;  4WIP A;  1VZ7 A;  2ON8 A;  4O1N A;  1SSN A;  1VJK A;  1L0X B;  2MEK A;  1GPX A;  3GS2 A;  3L4P A;  2ZW1 A;  4MM3 B;  1RM6 C;  3Q8B A;  4RF1 A;  1C79 A;  3SFD B;  1AYF A;  2WXI A;  1VZ8 A;  1YJI A;  1TKE A;  4YXD B;  4LLG M;  5I4D A;  1IGC A;  1V1O A;  2OHF A;  1FFV A;  1PFD A;  3U4E G;  5FK9 C;  1V1P B;  1YNT E;  4R3D A;  2V3N A;  3P4S B;  4P16 A;  1OQQ A;  1E7P B;  3AEF B;  4A55 A;  3CWI A;  1ENF A;  1ZOY B;  4IKG A;  1JWU D;  1ZUD 2;  4C80 A;  4J3O D;  4GLS C;  1J7A A;  4P6V F;  1QIL A;  2PW9 A;  2W3S A;  4KKI A;  1PGX A;  4TQ1 A;  4H2A A;  2WXL A;  1SB3 C;  2QSD A;  5BMI A;  3BVM A;  3AM9 A;  3W5U B;  2TSS A;  4RGT A;  2WDV B;  2WLB A;  1NEK B;  1TS4 A;  3CIR B;  1N63 A;  1RFK A;  3AEG B;  2LMC A;  1BML C;  4ZYS A;  4C7Z A;  2JYE A;  1FRD A;  2N9K A;  2LUM A;  3HUI A;  4HJG E;  1D5M C;  1DOY A;  1I4P A;  2PMV A;  3W1S A;  2W54 A;  1D5Z C;  4NAW B;  1YN4 A;  2LHD A;  2PTL A;  1IBX A;  1B9R A;  3AEC B;  4N59 A;  2HTM E;  4RFB A;  1XCT L;  2NTT A;  1EWC A;  1N61 A;  3RFZ B;  2WXN A;  2LEK A;  2LHE A;  2WS3 B;  4OHJ A;  3U7Z A;  4NAM A;  1NI3 A;  1P7F A;  4N58 A;  2WXH A;  1C77 A;  3DWM A;  3PO0 A;  2DYO A;  1VR9 A;  1ZE3 D;  3AE6 B;  4YTN B;  4A9A A;  2CJO A;  2DLB A;  2KN4 A;  1PUT A;  4XDD A;  5EE3 A;  1KLG D;  4USA A;  3H8H A;  1QOG A;  3NVW A;  1QT9 A;  4RGN A;  3MC0 B;  1I4G A;  2MJE A;  3FC4 A;  1OQR A;  1HZ5 A;  2DWQ A;  2I2Y A;  1TS3 A;  1FEH A;  4KX6 B;  1ET6 A;  1M4V A;  1YMH E;  2H89 B;  2QEJ C;  3MFG A;  4XWT A;  2JWU A;  4JX1 C;  1MPE A;  3IAM 1;  1ZXH A;  2KQ4 X;  1AW7 A;  1XLN A;  2WXR A;  2K22 A;  4XE0 A;  3EGR A;  3BK1 A;  3Q69 A;  4REZ A;  1EU4 A;  2AX5 A;  3RPF C;  1RYJ A;  5BYS A;  5JXV A;  4MAC A;  3SR6 A;  2QJL A;  3GB1 A;  3KQ4 A;  3NUH B;  5MPO A;  4DXG A;  1WXQ A;  4WAF A;  1UGJ A;  3AMZ A;  1OFF A;  1TZO A;  3KWV A;  1NEN B;  1TYG B;  3FAH A;  2L32 A;  2NTS A;  1XCQ L;  1V97 A;  2XN9 C;  1SE2 A;  1XF5 L;  2L1A A;  3V3X A;  2K5P A;  4RH6 A;  1FM0 D;  1JWS D;  1FCC C;  2I38 A;  2K9X A;  2RDG A;  2X38 A;  4KKJ A;  2MJD A;  1JRO A;  4ZRP A;  2H88 B;  1C4C A;  4OZC A;  1NYR A;  4RCO A;  1N5W A;  2IGD A;  2WXQ A;  3TEY A;  5HFY A;  1L4D B;  3N9Y C;  1A70 A;  2W3R A;  1F77 A;  3P1M A;  3B2F A;  4MT5 A;  3NVY A;  4ZHO A;  2L83 A;  3TEW A;  3AB5 A;  2OED A;  3V05 A;  1XEE A;  2QMT A;  1Y56 A;  2Q5W D;  3BYY B;  1V8C A;  1PDX A;  3TSS A;  3T3O A;  4ARI A;  4C56 C;  3PZ7 A;  2AQ3 B;  1FNW A;  1SF0 A;  3R8B A;  3NVV A;  3BYT B;  1DGJ A;  1IUE A;  3I9V 1;  4RGO S;  1KTK A;  2BB5 A;  5BYQ A;  1I7H A;  2NMQ A;  1N62 A;  2BW2 A;  2CU3 A;  2PVG C;  1P7E A;  3P63 A;  1E0Z A;  4WQM A;  2FBW B;  5FKA C;  1IBX B;  3AE4 B;  4XWW A;  2KMM A;  2IPK D;  1KFY B;  2JZP A;  2Y3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...