2MEKA

N-terminal domain of bilbo1 from trypanosoma brucei
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
110
structure length
110
Chain Sequence
MAFLVQVAADIFNNKVNFELSFPSRPSISELTRSAETAFSNEISLRRPDNVPSHKFHSSKIKMYDEELNKWVDLIREDQLTDYCQLYVFQPPNEWHKESQKEIPPAMKPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and assembly mechanism of TbBILBO1, an essential flagellar pocket collar protein
rcsb
source organism Trypanosoma brucei brucei
molecule tags Metal binding protein
molecule keywords N-TERMINAL DOMAIN OF BILBO1
total genus 11
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2013-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18281 BILBO1_N BILBO1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.650 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2mekA00
2MEKA
chains in the Genus database with same CATH superfamily
4HDOA 1XCQL 3B0AA 4D2KA 2MWSB 2LFIA 1RLFA 1WXSA 1TBEA 2JXXA 1QOGA 2IGHA 4C00A 4DDGD 4KGRA 4MSMB 4CO7A 4W9GA 5HHDG 4DHZB 3GZNI 1XLOA 4W9DA 2M19A 3AE3B 2KC1A 5G5GA 3M3JA 1OTRB 4L1BA 4IC7B 1WGHA 1V49A 4WWOA 2MBEA 1MJDA 3UI3A 2M0XA 2NS5A 3N32A 1EF1A 1TS2A 2KDFB 1C9FA 3MFGA 1J7AA 2WP9B 5AZHA 2VZKB 2BB6A 3N3KB 2V3PA 2KMMA 4W9HA 2LGIA 5IAAC 4II2B 2L00B 2EMTA 1IGDA 2WDTB 2KWCA 2YVCA 3I3TB 3ZNGC 4HPLB 4IM3A 5JZEB 1K53A 3L4PA 2LMCA 2D10A 2ZW0A 4LJPB 3VFKA 1JMLA 1VLBA 3V05A 4IWPA 2N7EA 1BXTA 2CU3A 4AS1A 1VJKA 2M0AA 4ZYSA 1E7PB 2NTTA 4LNNA 3GS2A 3L16A 1TKYA 4URKA 3IT4B 4F1SA 1WM3A 3OWEB 3SHQA 2AL3A 1QLBB 3UINB 2LGYA 1L7YA 1SJHD 1Q10A 2XK5B 1GG3A 1KOTA 4RF1A 2W3SA 2WXFA 3Q8CA 3RT3B 3H8HA 2XN9C 1F9JA 1C4PA 2HDEA 3PZ7A 2LJ5A 1YQBA 3SD5A 3ALBA 2GI9A 3CSTA 3VRBB 4ICUA 1I4PA 3R7QA 1SSNA 2K8BA 1QILA 3NVWA 3SFDB 1D3ZA 1J7CA 1FNUA 1E6EB 1PDXA 1Q0WB 1IBXB 1LFDA 4AP4C 2JWUA 1D5XC 1PUTA 5CX3A 1GPXA 1VZ6A 3HHMA 3AULA 2QIEB 4GN1A 2XBBC 1TKGA 1ZOYB 4KIKB 4JPSA 4IWQA 3M62B 4EZLA 4OZAA 1CMXB 5HG2A 1GUAB 2DHZA 1ROEA 4K3BA 2PE6B 1SJED 2C7HA 1JW9D 2J53A 3MHSD 2LGSA 2IDYA 3AB5A 4TV3A 3BVZA 1UNSA 4AUQC 3K9PB 1AYFA 2MHJA 2KT7A 1HA5A 3N20C 4TUUA 5IA7A 3Q3JA 3SEBA 5IKCM 3P4SB 1L5PA 2BT6A 3WAOA 2RDBC 3BVMA 3RUIB 4WH4A 2KC2A 1WX9A 2WXRA 3WCQA 1FXIA 1K50A 3N9YC 1M94A 1YN3A 3TEXA 3OJ3A 3QC8B 3T9LA 5E6JA 3PGEA 3AH7A 1E7VA 3H7SA 5J18A 3WA0A 3ZVVA 5HKHA 3R2TA 5JHAA 1I4QA 2J0KA 3NHEB 1IUEA 2K6DB 1KRHA 2IBIB 3PLUA 3TBLD 3BZDB 2QJLA 3V6CB 2WNMA 2GBKA 5C2TB 3ZUNA 1T0RC 2CHWA 3OG5A 1HE8A 4ARIA 2CJOA 3C0RB 5FKAC 1JWBD 3U7ZA 3NOBA 4LNOA 1P7EA 3KYDD 3U52E 1RWSA 1GJZA 1KLVA 2DYBA 3Q69A 2BS3B 1Z5SB 1YJJA 2FNJB 4C7YA 3MC0B 3WAMA 2GBMA 3ML9A 4HRSA 3EFCA 4XWWA 2IO0B 4HKQA 4XWTA 3RMKC 2WLBA 2WXGA 4ZDVA 2KWVB 3NY5A 4JLCA 2IGDA 3V60A 2K22A 1PFDA 1GB4A 2MX2A 2FCMA 3P4QB 1EF5A 3DQVA 2KTRB 3VH4B 1NENB 3JVZX 2JRHA 2ICIA 2QHOA 4G3XB 3LB8C 2FAZA 3APFA 4IKGA 4C7ZA 3FKYA 2KMAA 1WGDA 4JX1C 1F0ZA 3PO0A 4KDIC 4HDQA 5T8IA 1E90A 2GBRA 3ZDTA 4WWPA 4GXBA 2N9KA 2KACA 3Q8BA 5EE0A 2D11A 1L4ZB 2Z0EB 1DOYA 1SE9A 1XLNA 3AEDB 3HRDD 2FIDA 1FEHA 1NYQA 3KH0A 4AJYB 2LWPA 2AQ2B 3AMZA 3ZKJC 2D3AA 4WAFA 4ZRKA 3IHPC 1OEYA 3TEZA 2G9HD 3PSEB 1FPYA 1WXAA 3T8MA 3CWIA 5E6OA 2KTFA 1C77A 2WQYB 1T0YA 3RPFC 1WGYA 4C4VA 1XF5L 1V5OA 2DBYA 2ZNVB 4MGKE 1VRAB 5D2MB 2KX3A 2IY0B 1IPGA 1DYQA 2BQQA 4OVUA 1ET9A 1WSPA 1ENFA 4K3CA 2VH1A 5IOIA 1OGWA 3DDCB 3HVDA 3NS8A 2NBUA 3LJ3A 2BYTA 2VH2A 5IO9A 3M95A 2LI5A 2JWZA 4EKUA 1FXTB 4IG7B 3C8YA 4XZ4A 1YD8U 4JQWC 1VCBA 1JROA 3AEFB 2CKHB 4GDLB 1YNTE 1YX5B 3NVYA 4IOIE 4LCDE 4DXGA 2WDRB 1TZOA 1JCKB 4GU2A 4K1RB 1WX7A 2N9LA 4YXDB 1KTKA 2DENB 1J7BA 4OVZA 3ZQ4A 4L2YA 3OJ4B 1DGJA 1I42A 4BKSA 4NZLB 5LXIB 2WXOA 4M8NA 1J0GA 4NAWB 1EUVB 2GBNA 2JZPA 5AEKB 1JALA 5DPTA 3TEYA 3KQ4A 3ZRCA 1MFWA 4NJCA 3NZUA 2MJDA 1MVKA 3A1QA 3QARA 4EFOA 1E9MA 2KFKA 1NYRA 4IDIA 1BMLC 4IW0A 1AN8A 2IYDB 5DPWA 5H8YE 1WRIA 5DCNA 5TR5A 2JZ3B 1X1MA 3LDZE 2JT4B 2RPQA 2D5GA 4BKTA 4DHJD 2DAFA 4RM9A 1SB3C 3KWVA 4G11A 5CHWA 1TS3A 2M8SA 3C19A 1UGJA 1IP9A 4WWNA 3R7RA 2ZW1A 2Y3AA 3W1SC 2INNE 2L05A 2BWFA 4YTPB 2BB5A 4KVGB 4FN2A 1V1PA 4MEMA 2PW9A 4K81A 4YSXB 2J0MA 5I4DA 3X23A 3A4RA 1YN5A 2OHFA 3ZW3A 2L52A 1SE2A 3AXCA 1MG4A 4PYZA 2ZCCA 2DAJA 2KFJA 3P2BA 4BBNF 3RNBC 1WR6E 3U2SC 3ZGZA 2FCSA 2LHEA 3P4PB 4FJYA 2KZRA 3UIPB 1YOVB 4W9LA 3P4RB 3Q6BA 3ZYYX 3IG3A 2MCNB 2HD5B 4EZJA 2KDMA 4MGIE 5AZFA 1I4HA 2INCC 4ITKA 3UF8A 2LRUA 2O6VB 2L8JA 4XGAB 4EUTA 2IO1B 2FCNA 3WALA 2KJHB 5GXGB 2A4ZA 2JSVX 2PE9A 1BT0A 3MJWA 1UBQA 3AEBB 3I5JC 1NI3A 4HJGE 2M56B 2V1YA 1QZEA 2MBQA 1UH6A 1I7HA 1ACCA 3J9CA 3DWMA 1PGXA 4HROA 1F2RC 1V2YA 2MW5A 4AQ7A 1L6VA 4BKSD 1YX6B 2C5LC 3AV8A 2Q5WD 1LQBA 3Q3OC 2PJHA 4N58A 3RZWC 3PVLA 3N1ZC 2ZNVC 2AL6A 3IBEA 3W1YA 1S3SG 2KQSA 1JWAD 3AE9B 3WAPA 4BKGA 3RN9C 1JWMD 2KYWA 3L10B 4JL9A 3VUWA 5D7GA 3PHXB 4M8MA 2G3QB 3R8BA 1UWXA 5KHQA 2G4SA 1NDDA 2QCZA 4WWMA 4MSQB 4NPNA 1FCLA 2K39A 4O1NA 4WJQA 5KHOA 3P63A 2V9HA 3RCZA 3ZLZA 1L2NA 1S1QB 1ISNA 2WXHA 4RMAA 2AWTA 4LLGM 3U30A 2CS4A 2Z8LA 1VR9A 2KD0A 2L83A 2HJ1A 2B3AA 1E5WA 2DX5B 5G55A 3FAHA 3A9KA 3T3OA 3V61A 4RGNA 3TL5A 1N63A 1FNWA 1N6ZA 1FRDA 3B1LX 1YIWA 1L6UA 1LXDA 1P1AA 3W9CB 1HEZE 2FUG1 4P1CC 3DVGY 3HVZA 4BZAA 4HCNB 3QK0A 5LXHA 2LHDA 2HTHA 1RFKA 3AEEB 3O13A 1GB1A 3AU4A 2RDHA 2AYOB 3DHIC 3Q3MC 1TY2A 4JWUC 4P6VF 4ANUA 1WX8A 1HXYD 1UGMA 5BYSA 3IT6B 2C7NB 2RSUA 3NVVA 1WRDB 1EU3A 1WJUA 2DNFA 3A9JB 3IVFA 4A20A 3RD2A 4HK2A 4K7SA 2C9WB 3VDZA 2V3SA 2KN5A 4EE2A 2K9XA 4FULA 3BVGA 1P3QU 4GOCA 2L1AA 3WANA 1JWSD 3ABVB 1TT5B 2C60A 4FHJA 5CHVC 4HCPB 2AQ3B 3ZXVA 3DVGX 4IM0A 4MGYE 2JZZA 3ZDMC 3B2GA 4YT0B 1PGBA 2Y5PA 3NUHB 2WU5B 5J17A 2LGDA 1LM8B 1XT9B 2RDGA 4DXFA 3B08A 2BPSA 4MACA 1ZDVA 4YSYB 1R4NB 2Z59B 4BAXA 1SE4A 5JH5C 4ZRJA 3DHGC 4EZKA 4J3OD 3AM9A 2MLBA 2KDBA 4DDID 3QWZB 4OW0A 1ZKHA 1CJEA 3ZIMA 2OOBB 3KVFB 2A5UA 1ZP0B 2QILA 1F77A 3PS6A 4LDTD 4MGZE 2KQ7A 2QSDA 4M02A 3RNAC 2O2VB 4PYUA 2LGXA 5G2NA 2JX5A 4DK5A 1J19A 3A9KB 2NCNA 2MQJA 2ZEQA 3ZO5B 2R61A 3GB1A 3LXFA 4ZHPA 3PRPB 2WXJA 1XD3B 1R7SA 2I38A 1WY8A 2MJ3A 3VTWA 1RAXA 2XK5A 4OVVA 1C78A 3VTUA 1V97A 1QF6A 1MG8A 1WGKA 3EECA 4KGTA 4S17A 1EWCA 1PGAA 2VRRB 4ZRIA 1DOIA 4RCOA 1HZ5A 2J4XA 1OFFA 3O65B 2BBCA 2BTEA 3RNFC 3KUDB 3T3NA 3AE5B 3DBHI 1KLUD 1K8RB 1OQRA 2LUEA 3U8ZA 4M0WB 2WDQB 5E6NA 1N5WA 2HE7A 3A1QB 1LGRA 2JUOA 2X38A 3AEAB 2JY6A 4A3OA 2REXA 3JSVB 2BF8B 3NZSA 3W5VB 3R3MA 2N1VA 1N5XA 1YN4A 2ZVNA 2J52A 1XQQA 5EE3A 3HIZA 2H89B 1OEYJ 1A70A 1R4MI 3MHZA 4TQ1A 2LJIA 3V62A 4FLHA 1YQ3B 1PQSA 5D3IB 2DYMA 4K7UA 5C23A 4JWSC 2MBHA 3K9OB 3RNCC 1ZW7A 3GP7A 3UQAA 2K6QA 1TTNA 1KLGD 2KWDA 2UU7A 4KSLC 4HXDA 2I1JA 2C7MB 4FHKA 4REZA 4A90A 1NVID 4JE3B 3ZTCA 4XX5A 1AWDA 1VZ8A 1KF6B 2BYEA 1V6EA 2KVZA 1WI0A 2BVCA 2L3ZA 3W2DA 2L0TA 2SAKA 2D3GA 1FXAA 3NVZA 1J8CA 3APCA 3BK1A 3E56A 4FXCA 4IM2A 3TEWA 1UF0A 3QQ8B 1KJTA 2MJEA 3V6EB 3VXWA 3PREA 1YJ1A 4HVBA 4HJKA 4MH0E 3TJPA 2KQ4X 2EKEC 4G50A 1I4XA 2LXCA 2NPTA 2PMVA 1E8ZA 5HFYA 3BIID 3KUZA 2LVPA 4YTMB 3V3XA 1EM7A 2RPVA 3CIRB 4E71A 2W82A 2XNAC 2GRIA 1WJ4A 5D6JB 2JU6X 1D5MC 3ZJVA 4XYCA 1TKEA 1V9JA 4B0MA 5BMIA 1FIQA 4OZCA 4ZYNA 3DBSA 2ZCBA 4FADA 3QHTA 4GMVA 1SE3A 2L7RA 5FR6A 1MI0A 4GGQA 4I6NB 1E7UA 1TGZB 3CMMB 1C1YB 1K51A 4MJSA 4B95A 3I9V1 2N1WA 1GOZA 2TSSA 4L23A 1I4RA 3AE1B 2W54A 4BVUC 4DHZE 3I63C 3ZNZB 3UIOB 3LYYA 4A6QA 2QEJC 4LNIA 4NAWA 5BMGA 2INDC 4KX6B 3EA6A 1V80A 3SDLC 3NJTA 1QT9A 1SIFA 2Z0DB 5DPSA 4CHKA 5IN7A 1WWTA 2I1KA 3PRMB 3RNGC 4HPMB 4M0WA 1ET6A 4N6EB 2BWES 3BY4B 1WE7A 3GZNB 4OZBA 1GAQB 4M00A 3AE2B 4BOSC 2PIAA 1TS5A 4UDUC 2I2YA 1XO3A 3MP9A 2FBWB 1VDVA 2WHIA 3PRZA 1T0SC 1STEA 5MPOA 3FILA 1XLQA 1Z2MA 2LXAA 2M4NA 2KO3A 1QOBA 1FRRA 1NEKB 3VUXA 2LZ6A 5EE1A 3NG0A 2KHWB 2IY1B 2HJ8A 4RGMA 3QCAA 2EKIA 3VVWB 1WF9A 4H2AA 4RM8A 1EWYC 4WURA 4W9KA 3A4SC 5TSSA 2KLCA 2J0JA 4MELA 1OQQA 1WE6A 2R2QA 4KKIA 3ECIA 1E10A 1YMHE 3DCGA 2JPHA 1ZE3D 4BOZB 1IGCA 5EDSA 3DVNV 2VZKD 2M17A 4USAA 5H92C 3IFWB 5LNK1 3Q3FA 4YL8A 1F2RI 4KDLB 4PK1A 2WXNA 3TIXA 2MP2A 1WR1A 1R4MB 2IPKD 1G6JA 3SR6A 2J42A 1QKZA 4HKZE 4NQKE 4GDLA 3Q8FA 3Q8EA 4A8XC 4RFBA 1HZ6A 2WXKA 2G45B 4KGSA 1XEEA 3EHVA 2BW2A 3NZ3A 4II3B 3VR8B 2N7JA 5D94A 4RH6A 2L76A 1FFVA 4NAMA 1IBXA 1E8XA 1TS4A 3H6NA 4R3DA 1L0VB 4N9F4 2ASQA 4ANWA 2IGGA 2V3NA 4K7WA 3EUB2 3RI7C 2RGFA 2AQ1B 2KKCA 2DZMA 1WFYA 2K25A 2N4FA 2KXJA 5BMHA 2INPE 2MEKA 2NMQA 2WYQA 4AJWA 1D6EC 1WZ3A 1JRUA 4CYEA 3X0WA 1T0QC 4YTNB 1FD6A 3IAM1 1TZ1A 2MSED 3GOEA 3EC8A 4GDKA 2Y5BB 1HTOA 4MH8A 1V1OA 2W55A 3BWUD 4LDTB 1RM6C 2ZPYA 1V8CA 3R66C 3H1UA 1P0RA 4W9FA 5FR3A 5BYRA 2WGSA 2RR9A 2WWZA 3TSSA 1WJNA 3PLVA 4YSZB 2NPTB 2MRPA 3PZ8A 2N0SB 2O6VD 4PS8A 2LD9A 4IWOA 3PV1A 3Q14C 2LASA 2OJWA 2O2VA 5GMVA 2DZIA 2DZKA 3PPAA 2WXLA 4WJNA 3W1SA 3DVNU 2JRIB 3CSFA 4KZCA 3BK2A 4XDCA 3KYCD 1HTQA 3AE4B 1CK1A 4P1BC 4E3CA 4WQOB 3VTVA 4KZ0A 1E8WA 2QMTA 3MJ5A 1P7FA 4GIVA 5AUKA 2V4LA 3QAQA 5AZGA 4P7IA 3Q8AA 4NJ6A 3QIJA 1VD2A 3DBRB 4W9IA 1RYJA 4FBJB 2CU1A 3ZNHB 2E3TA 3IXSA 1NI2A 3ZJTA 1IYFA 2J7QB 3VQIA 3JSVA 5D3DA 1LO5D 1SEBD 2IO2B 2GOWA 2YEPB 1MHXA 4TKNA 4WQMA 2M1MA 1WM2A 3N1YC 3DBHB 4X57B 2K3UA 2ONQA 1WZ0A 1Y8RC 3AECB 2WXQA 1B1ZA 4ANVA 5EE9A 4KV2A 4DQOC 4G0NB 1V1PB 1HQRD 2PPHA 2L0FA 1WGGA 4ZRPA 2N9XA 2KJ6A 4P16A 1KFYB 4W9EA 4I6LB 2KFKB 1GC6A 4HPPA 3QA8A 4KIKA 4MT5A 4WJPA 3UGBB 1CZPA 4M01A 4PT5A 2KANA 3HM3A 4GLSC 1FMAD 2KOXA 1UD7A 4ANXA 2BS2B 4MM3B 2GLSA 1L4DB 4MDKE 2JQRB 2PVGC 4A55A 2CJNA 3OLMD 1C76A 2XEWA 1K52A 4MM3A 2K8HA 3CF6E 1T6BX 4DBGA 4GDKB 3SU8X 2JYTA 3MC9A 2D07B 4ASWC 3PTFC 3RYTA 4EEWA 1FM0D 1XXGA 3OAWA 4HWIB 5C1ZA 1EO6A 4NQLB 4WAAA 2FE8A 3VR9B 1WJ6A 1YJIA 1TY0A 2WXMA 3UQBA 4NJ7A 2FIFA 1WMHA 1R4NI 3N30A 3U4EG 3AE8B 3U7DA 4XDDA 2G4DB 1I4GA 2N9PC 4BBNC 4BFRA 3BINA 1UBIA 5BO4B 2E6XA 2K0PA 1F1HA 2GMIC 3KW5B 1H4RA 5BYQA 3DBLB 3FC4A 1C4CA 2UYZB 3RFZB 1FNVA 2JVCA 2ZPNA 2PKOA 1L0YB 3VUYA 4S0RA 3H7PA 3VRAB 4ACFA 2N7DA 1ESFA 4LK0M 2KN4A 3RZFA 4CQNA 4B0EA 4FJVB 2MBBB 1E0ZA 2DLBA 1F52A 3HM6X 2CHZA 4E74A 2RMMA 3RULA 4FJZA 1SF0A 1ZGUB 2JYEA 1WMHB 4MJSB 1YQ4B 2PVOD 3A33B 1WXQA 2N9EB 2MA9B 3KWLA 1SGHA 4QAYA 4YWGG 2KX0A 4JGHB 2YEPF 3PT2B 3MTNB 1Q1OA 1V81A 1JQ4A 1T5XD 2K5PA 3L17A 1T3QA 2MP2B 3SFEB 3B9JA 2NVUI 2IJ0A 2K1FA 1N62A 1ZDXA 3H7PB 5LLIA 1A5RA 3URYA 3B2FA 1CQVA 4F8CB 2KDEB 2AX5A 1Y56A 2KVRA 2CHXA 1MHHE 1NBFC 3DHHC 2YLMA 2DWQA 3M63B 4TSSA 1ZXIA 3ONSA 3AU5A 4ZOHC 4RGOS 2Y5CA 3DBRI 4XE0A 4EOYA 3ML8A 2FCQA 4ZHOA 1P98A 2OJRA 1SBBB 2KLGA 3GE8C 1N60A 2BYFA 4Q2JA 2EMSA 5FK9C 3D32A 5L95C 4C56C 1AARA 2KDIA 5JXVA 3VAWA 2G1EA 2LVQA 3ZTDA 2BGFA 2NTSA 2DZJA 2BS4B 2D3CA 3KLSX 1XCTL 2JXTA 1WXMA 1WYWB 4DWFA 1KH0A 2SEBD 4IUMB 1GNUA 1ZXHA 4NNJB 1TYGB 1V86A 3R2IA 1L0XB 2FUHB 4OHJA 5L83A 2BYVE 4US9A 5G5HA 2UWQA 1D5ZC 3BYYB 4RNAA 1DOXA 2L32A 2KAJA 4W9CA 1C4AA 1TIFA 1QQRA 2D2QA 2NR2A 3APDA 2AEHA 2PLPA 5CTRC 2LVOA 2K8CA 3PZDA 3L54A 4I6PA 4ZRQA 1GC7A 3NRZA 2MBOA 2ACZB 1QOFA 4J6IA 3E9SA 4KSKC 4FA6A 2KTRA 2QC8A 4JIOU 2CR5A 3S2AA 1FFUA 3A9JA 3DWGC 1UELA 4LNFA 4AOFA 2WU2B 2WDVB 5CHFA 2OEDA 1H8CA 2KMCA 1Q5WB 1D4BA 3HK0A 3QX1A 4XC2A 1I35A 3TUOA 2DYOA 1M4VA 1PYWD 2EELA 4PS3A 1WIAA 2BKRB 4DXAB 3H9DA 2W9NA 3N1XC 5E6PA 2V0GA 4C4VB 3IAS1 3P42A 3ZXRA 1JRPA 1C79A 4B9KA 5AUIA 3AN1A 1WXVA 4GB9A 3L13A 3TCAA 2NBVB 1AW7A 3L08A 3JYUA 4C80A 3QJZA 3ZRFA 1VZ7A 3EGRA 4RF0A 4HEA1 1KM7A 3FILB 5IP4D 3WIMA 1OQYA 2BKFA 3ZNID 3NS1A 1WYGA 1C3TA 3VH3B 1P9DU 4PS7A 2LEKA 2WS3B 2WXIA 4A9AA 4ARCA 2KNBA 4HLEA 3DPDA 1FCCC 5C3JB 4NY0A 2NBWB 1V5TA 2V4IB 4WJOA 3KUCB 3PHWB 2GB1A 3VHTC 2D3BA 4LNKA 3W5UB 4GSWA 3Q2AC 4US8A 3GE3C 2WX1A 1UZXB 2LUMA 5JHBA 1U4AA 2ZJDA 2O6VA 5HI1A 3DOWA 3I57A 1B9RA 4LTUA 3BYTB 1BUIC 3ENEA 1ZPSA 3HUIA 2ON8A 2KWUB 3L0WB 2LRWA 1UUPA 4W9JA 3ZJUA 1SXTA 2PEAA 1E8YA 1SIJA 1XLPA 2WXPA 3EFUA 4B6WA 1TJEA 2R2OA 2ZVOA 2W3RA 4TQ0A 1N61A 3MC8A 2IO3B 4LJOB 3P1MA 2MH7A 1RRBA 3AE7B 3AI5A 4A3PA 4TMAB 2H88B 2B76B 2RD0A 2PTLA 1ZUD2 2QDFA 4ICVA 1FO4A 2HTME 1JWUD 2KK8A 2X8XX 3DBLI 3ETRA 5J2RA 1WH3A 2WX0A 4N59A 3TMPB 1WGRA 3AEGB 3AE6B 2KJRA 3JW0X 3Q3NC 3RNEC 2IZVB 4AWJA 1MPEA 2JF5A 1QOAA 1RFAA 4F7ZA 2GBJA 1UWMA 4WIPA 5DPRA 2ZZPB 4KKJA 4RGTA 4DHJB 1EU4A
chains in the Genus database with same CATH topology
1KLGD 4GLSC 1SB3C 2KWDA 1XCQL 4A90A 4REZA 1FMAD 3KWVA 1NVID 4D2KA 4JE3B 2BS2B 2LFIA 4MM3B 1TS3A 1AWDA 1QOGA 1VZ8A 1KF6B 1L4DB 2IGHA 2JQRB 2PVGC 4KGRA 1UGJA 4A55A 2CJNA 2ZW1A 5HHDG 2Y3AA 1C76A 2INNE 3W2DA 1K52A 2SAKA 1XLOA 2M19A 4YTPB 3AE3B 1FXAA 5G5GA 3NVZA 1T6BX 2BB5A 4GDKB 4L1BA 3BK1A 2JYTA 3E56A 4FXCA 3TEWA 1V1PA 2PW9A 2MJEA 4YSXB 5I4DA 1FM0D 1XXGA 1YN5A 3UI3A 2OHFA 2KQ4X 2L52A 1SE2A 1TS2A 1C9FA 1I4XA 2FE8A 3MFGA 3VR9B 1J7AA 2WP9B 1YJIA 2PMVA 1TY0A 2VZKB 2WXMA 3U2SC 2BB6A 3ZGZA 2LHEA 3P4PB 5HFYA 3U4EG 3AE8B 3BIID 2V3PA 2KMMA 4XDDA 4YTMB 1I4GA 1EM7A 2LGIA 3V3XA 3P4RB 2RPVA 3CIRB 2W82A 2XNAC 3ZYYX 1IGDA 2GRIA 2E6XA 2KDMA 2JU6X 1D5MC 2K0PA 3ZJVA 1I4HA 1TKEA 4ITKA 4B0MA 1K53A 5BMIA 5GXGB 5BYQA 3L4PA 2LMCA 2ZW0A 1FIQA 3FC4A 2JSVX 1C4CA 4OZCA 3RFZB 1FNVA 1JMLA 1VLBA 3V05A 1BXTA 3AEBB 2CU3A 4AS1A 1SE3A 1NI3A 1VJKA 2PKOA 1L0YB 4HJGE 1MI0A 2M0AA 4ZYSA 3VRAB 1E7PB 2M56B 2NTTA 3GS2A 1TKYA 3IT4B 1ESFA 3OWEB 4LK0M 2KN4A 1K51A 4CQNA 4B0EA 1I7HA 1ACCA 1QLBB 3DWMA 1PGXA 3J9CA 1F2RC 4HROA 1E0ZA 1SJHD 2DLBA 1Q10A 3I9V1 4AQ7A 1GOZA 2TSSA 1L6VA 4L23A 4RF1A 2RMMA 1I4RA 2W3SA 2WXFA 3Q8CA 3AE1B 2W54A 3AV8A 3H8HA 2Q5WD 1SF0A 2JYEA 2XN9C 1C4PA 1YQ4B 2HDEA 3LYYA 4N58A 4A6QA 2QEJC 3PZ7A 5BMGA 2PVOD 4KX6B 2GI9A 3EA6A 1WXQA 3VRBB 1I4PA 1QT9A 3KWLA 1SSNA 1QILA 3NVWA 3SFDB 4YWGG 1JWAD 1WWTA 1J7CA 1FNUA 1E6EB 3AE9B 2YEPF 1PDXA 1JWMD 1IBXB 4M0WA 1ET6A 1JQ4A 1T5XD 2K5PA 4N6EB 2JWUA 1D5XC 1T3QA 4OZBA 3SFEB 1PUTA 5D7GA 3B9JA 2IJ0A 1GAQB 1N62A 1ZDXA 1GPXA 3AE2B 1UWXA 1VZ6A 3R8BA 2PIAA 2QIEB 3URYA 1TKGA 3B2FA 1ZOYB 1CQVA 1TS5A 4UDUC 4JPSA 2I2YA 1XO3A 2AX5A 1Y56A 2FBWB 3MP9A 4OZAA 4WWMA 1VDVA 1MHHE 5HG2A 1FCLA 1STEA 1ROEA 5MPOA 4O1NA 2DWQA 3FILA 3P63A 1SJED 1XLQA 4TSSA 1ZXIA 1JW9D 2J53A 2WXHA 1QOBA 2IDYA 3AB5A 1FRRA 4ZOHC 4RGOS 1NEKB 2Y5CA 3BVZA 4LLGM 1UNSA 4XE0A 5EE1A 1AYFA 2Z8LA 1VR9A 1HA5A 4RGMA 4ZHOA 2L83A 3SEBA 1SBBB 2EKIA 1N60A 3P4SB 1L5PA 4Q2JA 2BT6A 3FAHA 3T3OA 5FK9C 3BVMA 4RGNA 4WH4A 1N63A 1FNWA 4H2AA 1FRDA 2WXRA 4C56C 3WCQA 1EWYC 1FXIA 1K50A 3N9YC 5JXVA 4WURA 1L6UA 1YN3A 2G1EA 3TEXA 5TSSA 2NTSA 1OQQA 2BS4B 3W9CB 3KLSX 1XCTL 1HEZE 2JXTA 5E6JA 2FUG1 4KKIA 3AH7A 3HVZA 1KH0A 2SEBD 2LHDA 1ZXHA 1RFKA 3AEEB 3O13A 1YMHE 1E10A 1TYGB 3R2TA 1GB1A 2RDHA 3R2IA 1I4QA 1L0XB 1TY2A 4JWUC 1IUEA 4OHJA 4US9A 1ZE3D 1KRHA 5G5HA 1D5ZC 4P6VF 3BYYB 4RNAA 1IGCA 1HXYD 3BZDB 2QJLA 1DOXA 2L32A 2WNMA 2KAJA 2VZKD 5C2TB 5BYSA 1C4AA 3IT6B 4USAA 1QQRA 5H92C 4ARIA 5LNK1 2PLPA 2CJOA 3NVVA 5FKAC 1EU3A 1JWBD 1F2RI 3U7ZA 1P7EA 4ZRQA 3NRZA 3U52E 1RWSA 3Q69A 2WXNA 2BS3B 2ACZB 1QOFA 3E9SA 1YJJA 4C7YA 3MC0B 4HRSA 4XWWA 4HKQA 4EE2A 4XWTA 2K9XA 2WLBA 2WXGA 1FFUA 3BVGA 3DWGC 2IPKD 2L1AA 2WU2B 1JWSD 2WDVB 3ABVB 2J42A 2IGDA 3SR6A 1QKZA 4HKZE 2K22A 2OEDA 1PFDA 2AQ3B 3Q8FA 3Q8EA 4A8XC 1GB4A 1HZ6A 4RFBA 1D4BA 2WXKA 3P4QB 4KGSA 1NENB 3TUOA 1XEEA 3NZ3A 2BW2A 3VR8B 2N7JA 3B2GA 2DYOA 2ICIA 4RH6A 1M4VA 4YT0B 1PYWD 2EELA 1PGBA 2Y5PA 3LB8C 4IKGA 1FFVA 4NAMA 1IBXA 1TS4A 3NUHB 4C7ZA 2WU5B 4R3DA 2V0GA 3IAS1 1L0VB 3P42A 1JRPA 4JX1C 1C79A 1F0ZA 3PO0A 2IGGA 2V3NA 3EUB2 2RDGA 5T8IA 4DXFA 5AUIA 2AQ1B 3AN1A 4MACA 5BMHA 1ZDVA 2N9KA 4YSYB 2KACA 3Q8BA 5EE0A 1SE4A 2INPE 1AW7A 2MEKA 1L4ZB 2NMQA 4J3OD 1D6EC 1DOYA 1XLNA 4C80A 3AM9A 3AEDB 3HRDD 1VZ7A 1FEHA 1NYQA 4YTNB 3EGRA 4RF0A 2AQ2B 4HEA1 3AMZA 4OW0A 3FILB 1FD6A 3IAM1 1CJEA 4WAFA 4MH8A 1V1OA 2W55A 3NS1A 3BWUD 1WYGA 1RM6C 1ZP0B 2QILA 1V8CA 1F77A 2LEKA 2WS3B 2WXIA 4A9AA 4ARCA 2QSDA 3TEZA 5FR3A 2G9HD 5BYRA 1FCCC 5C3JB 3CWIA 3TSSA 2JX5A 2V4IB 4YSZB 1C77A 2WQYB 2R61A 2GB1A 3PZ8A 2N0SB 3RPFC 3GB1A 3LXFA 3W5UB 4ZHPA 1XF5L 2DBYA 2WXJA 1VRAB 4US8A 2WXLA 1R7SA 2I38A 2LUMA 1DYQA 2MJ3A 3W1SA 1ET9A 1WSPA 1ENFA 3BK2A 1C78A 3HVDA 4XDCA 3AE4B 1CK1A 2BYTA 1V97A 1QF6A 3MJ5A 2QMTA 5HI1A 1WGKA 3I57A 1B9RA 1P7FA 5AUKA 4KGTA 4LTUA 3BYTB 1EWCA 1PGAA 1BUIC 1DOIA 4RCOA 1HZ5A 2J4XA 3Q8AA 1OFFA 1ZPSA 3HUIA 2ON8A 2BBCA 1UUPA 3C8YA 2BTEA 3T3NA 3AE5B 1JROA 3AEFB 4GDLB 1YNTE 1RYJA 3ZJUA 1SXTA 1SIJA 1KLUD 1XLPA 2WXPA 3NVYA 4IOIE 1TJEA 1OQRA 4DXGA 2E3TA 2WDRB 3IXSA 3ZJTA 2WDQB 2W3RA 1TZOA 1JCKB 1N5WA 3VQIA 4TQ0A 4YXDB 2N9LA 2X38A 1KTKA 1N61A 1J7BA 4OVZA 5D3DA 3ZQ4A 4L2YA 1LO5D 1SEBD 1DGJA 3P1MA 4NZLB 2MH7A 3AE7B 2WXOA 3AEAB 4NAWB 2JZPA 2YEPB 1MHXA 4TMAB 1JALA 3TEYA 4WQMA 3KQ4A 2H88B 2B76B 2PTLA 4NJCA 1ZUD2 2MJDA 1FO4A 2HTME 1JWUD 1MVKA 3ETRA 1E9MA 2K3UA 2ONQA 3AECB 1NYRA 4IDIA 1BMLC 4N59A 2WXQA 1B1ZA 3W5VB 5EE9A 1AN8A 3AEGB 1N5XA 1YN4A 3AE6B 4DQOC 2J52A 5H8YE 1WRIA 1V1PB 5EE3A 2H89B 1HQRD 1A70A 3MHZA 4ZRPA 4TQ1A 2LJIA 1KFYB 4P16A 1YQ3B 5D3IB 1MPEA 1QOAA 2DYMA 4JWSC 4MT5A 1UWMA 2D5GA 4WIPA 1CZPA 3GP7A 4KKJA 4PT5A 4RGTA 1EU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MEK A; 
#chains in the Genus database with same CATH topology
 4HDO A;  1XCQ L;  3B0A A;  4D2K A;  2MWS B;  2LFI A;  1RLF A;  1WXS A;  1TBE A;  2JXX A;  1QOG A;  2IGH A;  4C00 A;  4DDG D;  4KGR A;  4MSM B;  4CO7 A;  4W9G A;  5HHD G;  4DHZ B;  3GZN I;  1XLO A;  4W9D A;  2M19 A;  3AE3 B;  2KC1 A;  5G5G A;  3M3J A;  1OTR B;  4L1B A;  4IC7 B;  1WGH A;  1V49 A;  4WWO A;  2MBE A;  1MJD A;  3UI3 A;  2M0X A;  2NS5 A;  3N32 A;  1EF1 A;  1TS2 A;  2KDF B;  1C9F A;  3MFG A;  1J7A A;  2WP9 B;  5AZH A;  2VZK B;  2BB6 A;  3N3K B;  2V3P A;  2KMM A;  4W9H A;  2LGI A;  5IAA C;  4II2 B;  2L00 B;  2EMT A;  1IGD A;  2WDT B;  2KWC A;  2YVC A;  3I3T B;  3ZNG C;  4HPL B;  4IM3 A;  5JZE B;  1K53 A;  3L4P A;  2LMC A;  2D10 A;  2ZW0 A;  4LJP B;  3VFK A;  1JML A;  1VLB A;  3V05 A;  4IWP A;  2N7E A;  1BXT A;  2CU3 A;  4AS1 A;  1VJK A;  2M0A A;  4ZYS A;  1E7P B;  2NTT A;  4LNN A;  3GS2 A;  3L16 A;  1TKY A;  4URK A;  3IT4 B;  4F1S A;  1WM3 A;  3OWE B;  3SHQ A;  2AL3 A;  1QLB B;  3UIN B;  2LGY A;  1L7Y A;  1SJH D;  1Q10 A;  2XK5 B;  1GG3 A;  1KOT A;  4RF1 A;  2W3S A;  2WXF A;  3Q8C A;  3RT3 B;  3H8H A;  2XN9 C;  1F9J A;  1C4P A;  2HDE A;  3PZ7 A;  2LJ5 A;  1YQB A;  3SD5 A;  3ALB A;  2GI9 A;  3CST A;  3VRB B;  4ICU A;  1I4P A;  3R7Q A;  1SSN A;  2K8B A;  1QIL A;  3NVW A;  3SFD B;  1D3Z A;  1J7C A;  1FNU A;  1E6E B;  1PDX A;  1Q0W B;  1IBX B;  1LFD A;  4AP4 C;  2JWU A;  1D5X C;  1PUT A;  5CX3 A;  1GPX A;  1VZ6 A;  3HHM A;  3AUL A;  2QIE B;  4GN1 A;  2XBB C;  1TKG A;  1ZOY B;  4KIK B;  4JPS A;  4IWQ A;  3M62 B;  4EZL A;  4OZA A;  1CMX B;  5HG2 A;  1GUA B;  2DHZ A;  1ROE A;  4K3B A;  2PE6 B;  1SJE D;  2C7H A;  1JW9 D;  2J53 A;  3MHS D;  2LGS A;  2IDY A;  3AB5 A;  4TV3 A;  3BVZ A;  1UNS A;  4AUQ C;  3K9P B;  1AYF A;  2MHJ A;  2KT7 A;  1HA5 A;  3N20 C;  4TUU A;  5IA7 A;  3Q3J A;  3SEB A;  5IKC M;  3P4S B;  1L5P A;  2BT6 A;  3WAO A;  2RDB C;  3BVM A;  3RUI B;  4WH4 A;  2KC2 A;  1WX9 A;  2WXR A;  3WCQ A;  1FXI A;  1K50 A;  3N9Y C;  1M94 A;  1YN3 A;  3TEX A;  3OJ3 A;  3QC8 B;  3T9L A;  5E6J A;  3PGE A;  3AH7 A;  1E7V A;  3H7S A;  5J18 A;  3WA0 A;  3ZVV A;  5HKH A;  3R2T A;  5JHA A;  1I4Q A;  2J0K A;  3NHE B;  1IUE A;  2K6D B;  1KRH A;  2IBI B;  3PLU A;  3TBL D;  3BZD B;  2QJL A;  3V6C B;  2WNM A;  2GBK A;  5C2T B;  3ZUN A;  1T0R C;  2CHW A;  3OG5 A;  1HE8 A;  4ARI A;  2CJO A;  3C0R B;  5FKA C;  1JWB D;  3U7Z A;  3NOB A;  4LNO A;  1P7E A;  3KYD D;  3U52 E;  1RWS A;  1GJZ A;  1KLV A;  2DYB A;  3Q69 A;  2BS3 B;  1Z5S B;  1YJJ A;  2FNJ B;  4C7Y A;  3MC0 B;  3WAM A;  2GBM A;  3ML9 A;  4HRS A;  3EFC A;  4XWW A;  2IO0 B;  4HKQ A;  4XWT A;  3RMK C;  2WLB A;  2WXG A;  4ZDV A;  2KWV B;  3NY5 A;  4JLC A;  2IGD A;  3V60 A;  2K22 A;  1PFD A;  1GB4 A;  2MX2 A;  2FCM A;  3P4Q B;  1EF5 A;  3DQV A;  2KTR B;  3VH4 B;  1NEN B;  3JVZ X;  2JRH A;  2ICI A;  2QHO A;  4G3X B;  3LB8 C;  2FAZ A;  3APF A;  4IKG A;  4C7Z A;  3FKY A;  2KMA A;  1WGD A;  4JX1 C;  1F0Z A;  3PO0 A;  4KDI C;  4HDQ A;  5T8I A;  1E90 A;  2GBR A;  3ZDT A;  4WWP A;  4GXB A;  2N9K A;  2KAC A;  3Q8B A;  5EE0 A;  2D11 A;  1L4Z B;  2Z0E B;  1DOY A;  1SE9 A;  1XLN A;  3AED B;  3HRD D;  2FID A;  1FEH A;  1NYQ A;  3KH0 A;  4AJY B;  2LWP A;  2AQ2 B;  3AMZ A;  3ZKJ C;  2D3A A;  4WAF A;  4ZRK A;  3IHP C;  1OEY A;  3TEZ A;  2G9H D;  3PSE B;  1FPY A;  1WXA A;  3T8M A;  3CWI A;  5E6O A;  2KTF A;  1C77 A;  2WQY B;  1T0Y A;  3RPF C;  1WGY A;  4C4V A;  1XF5 L;  1V5O A;  2DBY A;  2ZNV B;  4MGK E;  1VRA B;  5D2M B;  2KX3 A;  2IY0 B;  1IPG A;  1DYQ A;  2BQQ A;  4OVU A;  1ET9 A;  1WSP A;  1ENF A;  4K3C A;  2VH1 A;  5IOI A;  1OGW A;  3DDC B;  3HVD A;  3NS8 A;  2NBU A;  3LJ3 A;  2BYT A;  2VH2 A;  5IO9 A;  3M95 A;  2LI5 A;  2JWZ A;  4EKU A;  1FXT B;  4IG7 B;  3C8Y A;  4XZ4 A;  1YD8 U;  4JQW C;  1VCB A;  1JRO A;  3AEF B;  2CKH B;  4GDL B;  1YNT E;  1YX5 B;  3NVY A;  4IOI E;  4LCD E;  4DXG A;  2WDR B;  1TZO A;  1JCK B;  4GU2 A;  4K1R B;  1WX7 A;  2N9L A;  4YXD B;  1KTK A;  2DEN B;  1J7B A;  4OVZ A;  3ZQ4 A;  4L2Y A;  3OJ4 B;  1DGJ A;  1I42 A;  4BKS A;  4NZL B;  5LXI B;  2WXO A;  4M8N A;  1J0G A;  4NAW B;  1EUV B;  2GBN A;  2JZP A;  5AEK B;  1JAL A;  5DPT A;  3TEY A;  3KQ4 A;  3ZRC A;  1MFW A;  4NJC A;  3NZU A;  2MJD A;  1MVK A;  3A1Q A;  3QAR A;  4EFO A;  1E9M A;  2KFK A;  1NYR A;  4IDI A;  1BML C;  4IW0 A;  1AN8 A;  2IYD B;  5DPW A;  5H8Y E;  1WRI A;  5DCN A;  5TR5 A;  2JZ3 B;  1X1M A;  3LDZ E;  2JT4 B;  2RPQ A;  2D5G A;  4BKT A;  4DHJ D;  2DAF A;  4RM9 A;  1SB3 C;  3KWV A;  4G11 A;  5CHW A;  1TS3 A;  2M8S A;  3C19 A;  1UGJ A;  1IP9 A;  4WWN A;  3R7R A;  2ZW1 A;  2Y3A A;  3W1S C;  2INN E;  2L05 A;  2BWF A;  4YTP B;  2BB5 A;  4KVG B;  4FN2 A;  1V1P A;  4MEM A;  2PW9 A;  4K81 A;  4YSX B;  2J0M A;  5I4D A;  3X23 A;  3A4R A;  1YN5 A;  2OHF A;  3ZW3 A;  2L52 A;  1SE2 A;  3AXC A;  1MG4 A;  4PYZ A;  2ZCC A;  2DAJ A;  2KFJ A;  3P2B A;  4BBN F;  3RNB C;  1WR6 E;  3U2S C;  3ZGZ A;  2FCS A;  2LHE A;  3P4P B;  4FJY A;  2KZR A;  3UIP B;  1YOV B;  4W9L A;  3P4R B;  3Q6B A;  3ZYY X;  3IG3 A;  2MCN B;  2HD5 B;  4EZJ A;  2KDM A;  4MGI E;  5AZF A;  1I4H A;  2INC C;  4ITK A;  3UF8 A;  2LRU A;  2O6V B;  2L8J A;  4XGA B;  4EUT A;  2IO1 B;  2FCN A;  3WAL A;  2KJH B;  5GXG B;  2A4Z A;  2JSV X;  2PE9 A;  1BT0 A;  3MJW A;  1UBQ A;  3AEB B;  3I5J C;  1NI3 A;  4HJG E;  2M56 B;  2V1Y A;  1QZE A;  2MBQ A;  1UH6 A;  1I7H A;  1ACC A;  3J9C A;  3DWM A;  1PGX A;  4HRO A;  1F2R C;  1V2Y A;  2MW5 A;  4AQ7 A;  1L6V A;  4BKS D;  1YX6 B;  2C5L C;  3AV8 A;  2Q5W D;  1LQB A;  3Q3O C;  2PJH A;  4N58 A;  3RZW C;  3PVL A;  3N1Z C;  2ZNV C;  2AL6 A;  3IBE A;  3W1Y A;  1S3S G;  2KQS A;  1JWA D;  3AE9 B;  3WAP A;  4BKG A;  3RN9 C;  1JWM D;  2KYW A;  3L10 B;  4JL9 A;  3VUW A;  5D7G A;  3PHX B;  4M8M A;  2G3Q B;  3R8B A;  1UWX A;  5KHQ A;  2G4S A;  1NDD A;  2QCZ A;  4WWM A;  4MSQ B;  4NPN A;  1FCL A;  2K39 A;  4O1N A;  4WJQ A;  5KHO A;  3P63 A;  2V9H A;  3RCZ A;  3ZLZ A;  1L2N A;  1S1Q B;  1ISN A;  2WXH A;  4RMA A;  2AWT A;  4LLG M;  3U30 A;  2CS4 A;  2Z8L A;  1VR9 A;  2KD0 A;  2L83 A;  2HJ1 A;  2B3A A;  1E5W A;  2DX5 B;  5G55 A;  3FAH A;  3A9K A;  3T3O A;  3V61 A;  4RGN A;  3TL5 A;  1N63 A;  1FNW A;  1N6Z A;  1FRD A;  3B1L X;  1YIW A;  1L6U A;  1LXD A;  1P1A A;  3W9C B;  1HEZ E;  2FUG 1;  4P1C C;  3DVG Y;  3HVZ A;  4BZA A;  4HCN B;  3QK0 A;  5LXH A;  2LHD A;  2HTH A;  1RFK A;  3AEE B;  3O13 A;  1GB1 A;  3AU4 A;  2RDH A;  2AYO B;  3DHI C;  3Q3M C;  1TY2 A;  4JWU C;  4P6V F;  4ANU A;  1WX8 A;  1HXY D;  1UGM A;  5BYS A;  3IT6 B;  2C7N B;  2RSU A;  3NVV A;  1WRD B;  1EU3 A;  1WJU A;  2DNF A;  3A9J B;  3IVF A;  4A20 A;  3RD2 A;  4HK2 A;  4K7S A;  2C9W B;  3VDZ A;  2V3S A;  2KN5 A;  4EE2 A;  2K9X A;  4FUL A;  3BVG A;  1P3Q U;  4GOC A;  2L1A A;  3WAN A;  1JWS D;  3ABV B;  1TT5 B;  2C60 A;  4FHJ A;  5CHV C;  4HCP B;  2AQ3 B;  3ZXV A;  3DVG X;  4IM0 A;  4MGY E;  2JZZ A;  3ZDM C;  3B2G A;  4YT0 B;  1PGB A;  2Y5P A;  3NUH B;  2WU5 B;  5J17 A;  2LGD A;  1LM8 B;  1XT9 B;  2RDG A;  4DXF A;  3B08 A;  2BPS A;  4MAC A;  1ZDV A;  4YSY B;  1R4N B;  2Z59 B;  4BAX A;  1SE4 A;  5JH5 C;  4ZRJ A;  3DHG C;  4EZK A;  4J3O D;  3AM9 A;  2MLB A;  2KDB A;  4DDI D;  3QWZ B;  4OW0 A;  1ZKH A;  1CJE A;  3ZIM A;  2OOB B;  3KVF B;  2A5U A;  1ZP0 B;  2QIL A;  1F77 A;  3PS6 A;  4LDT D;  4MGZ E;  2KQ7 A;  2QSD A;  4M02 A;  3RNA C;  2O2V B;  4PYU A;  2LGX A;  5G2N A;  2JX5 A;  4DK5 A;  1J19 A;  3A9K B;  2NCN A;  2MQJ A;  2ZEQ A;  3ZO5 B;  2R61 A;  3GB1 A;  3LXF A;  4ZHP A;  3PRP B;  2WXJ A;  1XD3 B;  1R7S A;  2I38 A;  1WY8 A;  2MJ3 A;  3VTW A;  1RAX A;  2XK5 A;  4OVV A;  1C78 A;  3VTU A;  1V97 A;  1QF6 A;  1MG8 A;  1WGK A;  3EEC A;  4KGT A;  4S17 A;  1EWC A;  1PGA A;  2VRR B;  4ZRI A;  1DOI A;  4RCO A;  1HZ5 A;  2J4X A;  1OFF A;  3O65 B;  2BBC A;  2BTE A;  3RNF C;  3KUD B;  3T3N A;  3AE5 B;  3DBH I;  1KLU D;  1K8R B;  1OQR A;  2LUE A;  3U8Z A;  4M0W B;  2WDQ B;  5E6N A;  1N5W A;  2HE7 A;  3A1Q B;  1LGR A;  2JUO A;  2X38 A;  3AEA B;  2JY6 A;  4A3O A;  2REX A;  3JSV B;  2BF8 B;  3NZS A;  3W5V B;  3R3M A;  2N1V A;  1N5X A;  1YN4 A;  2ZVN A;  2J52 A;  1XQQ A;  5EE3 A;  3HIZ A;  2H89 B;  1OEY J;  1A70 A;  1R4M I;  3MHZ A;  4TQ1 A;  2LJI A;  3V62 A;  4FLH A;  1YQ3 B;  1PQS A;  5D3I B;  2DYM A;  4K7U A;  5C23 A;  4JWS C;  2MBH A;  3K9O B;  3RNC C;  1ZW7 A;  3GP7 A;  3UQA A;  2K6Q A;  1TTN A;  1KLG D;  2KWD A;  2UU7 A;  4KSL C;  4HXD A;  2I1J A;  2C7M B;  4FHK A;  4REZ A;  4A90 A;  1NVI D;  4JE3 B;  3ZTC A;  4XX5 A;  1AWD A;  1VZ8 A;  1KF6 B;  2BYE A;  1V6E A;  2KVZ A;  1WI0 A;  2BVC A;  2L3Z A;  3W2D A;  2L0T A;  2SAK A;  2D3G A;  1FXA A;  3NVZ A;  1J8C A;  3APC A;  3BK1 A;  3E56 A;  4FXC A;  4IM2 A;  3TEW A;  1UF0 A;  3QQ8 B;  1KJT A;  2MJE A;  3V6E B;  3VXW A;  3PRE A;  1YJ1 A;  4HVB A;  4HJK A;  4MH0 E;  3TJP A;  2KQ4 X;  2EKE C;  4G50 A;  1I4X A;  2LXC A;  2NPT A;  2PMV A;  1E8Z A;  5HFY A;  3BII D;  3KUZ A;  2LVP A;  4YTM B;  3V3X A;  1EM7 A;  2RPV A;  3CIR B;  4E71 A;  2W82 A;  2XNA C;  2GRI A;  1WJ4 A;  5D6J B;  2JU6 X;  1D5M C;  3ZJV A;  4XYC A;  1TKE A;  1V9J A;  4B0M A;  5BMI A;  1FIQ A;  4OZC A;  4ZYN A;  3DBS A;  2ZCB A;  4FAD A;  3QHT A;  4GMV A;  1SE3 A;  2L7R A;  5FR6 A;  1MI0 A;  4GGQ A;  4I6N B;  1E7U A;  1TGZ B;  3CMM B;  1C1Y B;  1K51 A;  4MJS A;  4B95 A;  3I9V 1;  2N1W A;  1GOZ A;  2TSS A;  4L23 A;  1I4R A;  3AE1 B;  2W54 A;  4BVU C;  4DHZ E;  3I63 C;  3ZNZ B;  3UIO B;  3LYY A;  4A6Q A;  2QEJ C;  4LNI A;  4NAW A;  5BMG A;  2IND C;  4KX6 B;  3EA6 A;  1V80 A;  3SDL C;  3NJT A;  1QT9 A;  1SIF A;  2Z0D B;  5DPS A;  4CHK A;  5IN7 A;  1WWT A;  2I1K A;  3PRM B;  3RNG C;  4HPM B;  4M0W A;  1ET6 A;  4N6E B;  2BWE S;  3BY4 B;  1WE7 A;  3GZN B;  4OZB A;  1GAQ B;  4M00 A;  3AE2 B;  4BOS C;  2PIA A;  1TS5 A;  4UDU C;  2I2Y A;  1XO3 A;  3MP9 A;  2FBW B;  1VDV A;  2WHI A;  3PRZ A;  1T0S C;  1STE A;  5MPO A;  3FIL A;  1XLQ A;  1Z2M A;  2LXA A;  2M4N A;  2KO3 A;  1QOB A;  1FRR A;  1NEK B;  3VUX A;  2LZ6 A;  5EE1 A;  3NG0 A;  2KHW B;  2IY1 B;  2HJ8 A;  4RGM A;  3QCA A;  2EKI A;  3VVW B;  1WF9 A;  4H2A A;  4RM8 A;  1EWY C;  4WUR A;  4W9K A;  3A4S C;  5TSS A;  2KLC A;  2J0J A;  4MEL A;  1OQQ A;  1WE6 A;  2R2Q A;  4KKI A;  3ECI A;  1E10 A;  1YMH E;  3DCG A;  2JPH A;  1ZE3 D;  4BOZ B;  1IGC A;  5EDS A;  3DVN V;  2VZK D;  2M17 A;  4USA A;  5H92 C;  3IFW B;  5LNK 1;  3Q3F A;  4YL8 A;  1F2R I;  4KDL B;  4PK1 A;  2WXN A;  3TIX A;  2MP2 A;  1WR1 A;  1R4M B;  2IPK D;  1G6J A;  3SR6 A;  2J42 A;  1QKZ A;  4HKZ E;  4NQK E;  4GDL A;  3Q8F A;  3Q8E A;  4A8X C;  4RFB A;  1HZ6 A;  2WXK A;  2G45 B;  4KGS A;  1XEE A;  3EHV A;  2BW2 A;  3NZ3 A;  4II3 B;  3VR8 B;  2N7J A;  5D94 A;  4RH6 A;  2L76 A;  1FFV A;  4NAM A;  1IBX A;  1E8X A;  1TS4 A;  3H6N A;  4R3D A;  1L0V B;  4N9F 4;  2ASQ A;  4ANW A;  2IGG A;  2V3N A;  4K7W A;  3EUB 2;  3RI7 C;  2RGF A;  2AQ1 B;  2KKC A;  2DZM A;  1WFY A;  2K25 A;  2N4F A;  2KXJ A;  5BMH A;  2INP E;  2MEK A;  2NMQ A;  2WYQ A;  4AJW A;  1D6E C;  1WZ3 A;  1JRU A;  4CYE A;  3X0W A;  1T0Q C;  4YTN B;  1FD6 A;  3IAM 1;  1TZ1 A;  2MSE D;  3GOE A;  3EC8 A;  4GDK A;  2Y5B B;  1HTO A;  4MH8 A;  1V1O A;  2W55 A;  3BWU D;  4LDT B;  1RM6 C;  2ZPY A;  1V8C A;  3R66 C;  3H1U A;  1P0R A;  4W9F A;  5FR3 A;  5BYR A;  2WGS A;  2RR9 A;  2WWZ A;  3TSS A;  1WJN A;  3PLV A;  4YSZ B;  2NPT B;  2MRP A;  3PZ8 A;  2N0S B;  2O6V D;  4PS8 A;  2LD9 A;  4IWO A;  3PV1 A;  3Q14 C;  2LAS A;  2OJW A;  2O2V A;  5GMV A;  2DZI A;  2DZK A;  3PPA A;  2WXL A;  4WJN A;  3W1S A;  3DVN U;  2JRI B;  3CSF A;  4KZC A;  3BK2 A;  4XDC A;  3KYC D;  1HTQ A;  3AE4 B;  1CK1 A;  4P1B C;  4E3C A;  4WQO B;  3VTV A;  4KZ0 A;  1E8W A;  2QMT A;  3MJ5 A;  1P7F A;  4GIV A;  5AUK A;  2V4L A;  3QAQ A;  5AZG A;  4P7I A;  3Q8A A;  4NJ6 A;  3QIJ A;  1VD2 A;  3DBR B;  4W9I A;  1RYJ A;  4FBJ B;  2CU1 A;  3ZNH B;  2E3T A;  3IXS A;  1NI2 A;  3ZJT A;  1IYF A;  2J7Q B;  3VQI A;  3JSV A;  5D3D A;  1LO5 D;  1SEB D;  2IO2 B;  2GOW A;  2YEP B;  1MHX A;  4TKN A;  4WQM A;  2M1M A;  1WM2 A;  3N1Y C;  3DBH B;  4X57 B;  2K3U A;  2ONQ A;  1WZ0 A;  1Y8R C;  3AEC B;  2WXQ A;  1B1Z A;  4ANV A;  5EE9 A;  4KV2 A;  4DQO C;  4G0N B;  1V1P B;  1HQR D;  2PPH A;  2L0F A;  1WGG A;  4ZRP A;  2N9X A;  2KJ6 A;  4P16 A;  1KFY B;  4W9E A;  4I6L B;  2KFK B;  1GC6 A;  4HPP A;  3QA8 A;  4KIK A;  4MT5 A;  4WJP A;  3UGB B;  1CZP A;  4M01 A;  4PT5 A;  2KAN A;  3HM3 A;  4GLS C;  1FMA D;  2KOX A;  1UD7 A;  4ANX A;  2BS2 B;  4MM3 B;  2GLS A;  1L4D B;  4MDK E;  2JQR B;  2PVG C;  4A55 A;  2CJN A;  3OLM D;  1C76 A;  2XEW A;  1K52 A;  4MM3 A;  2K8H A;  3CF6 E;  1T6B X;  4DBG A;  4GDK B;  3SU8 X;  2JYT A;  3MC9 A;  2D07 B;  4ASW C;  3PTF C;  3RYT A;  4EEW A;  1FM0 D;  1XXG A;  3OAW A;  4HWI B;  5C1Z A;  1EO6 A;  4NQL B;  4WAA A;  2FE8 A;  3VR9 B;  1WJ6 A;  1YJI A;  1TY0 A;  2WXM A;  3UQB A;  4NJ7 A;  2FIF A;  1WMH A;  1R4N I;  3N30 A;  3U4E G;  3AE8 B;  3U7D A;  4XDD A;  2G4D B;  1I4G A;  2N9P C;  4BBN C;  4BFR A;  3BIN A;  1UBI A;  5BO4 B;  2E6X A;  2K0P A;  1F1H A;  2GMI C;  3KW5 B;  1H4R A;  5BYQ A;  3DBL B;  3FC4 A;  1C4C A;  2UYZ B;  3RFZ B;  1FNV A;  2JVC A;  2ZPN A;  2PKO A;  1L0Y B;  3VUY A;  4S0R A;  3H7P A;  3VRA B;  4ACF A;  2N7D A;  1ESF A;  4LK0 M;  2KN4 A;  3RZF A;  4CQN A;  4B0E A;  4FJV B;  2MBB B;  1E0Z A;  2DLB A;  1F52 A;  3HM6 X;  2CHZ A;  4E74 A;  2RMM A;  3RUL A;  4FJZ A;  1SF0 A;  1ZGU B;  2JYE A;  1WMH B;  4MJS B;  1YQ4 B;  2PVO D;  3A33 B;  1WXQ A;  2N9E B;  2MA9 B;  3KWL A;  1SGH A;  4QAY A;  4YWG G;  2KX0 A;  4JGH B;  2YEP F;  3PT2 B;  3MTN B;  1Q1O A;  1V81 A;  1JQ4 A;  1T5X D;  2K5P A;  3L17 A;  1T3Q A;  2MP2 B;  3SFE B;  3B9J A;  2NVU I;  2IJ0 A;  2K1F A;  1N62 A;  1ZDX A;  3H7P B;  5LLI A;  1A5R A;  3URY A;  3B2F A;  1CQV A;  4F8C B;  2KDE B;  2AX5 A;  1Y56 A;  2KVR A;  2CHX A;  1MHH E;  1NBF C;  3DHH C;  2YLM A;  2DWQ A;  3M63 B;  4TSS A;  1ZXI A;  3ONS A;  3AU5 A;  4ZOH C;  4RGO S;  2Y5C A;  3DBR I;  4XE0 A;  4EOY A;  3ML8 A;  2FCQ A;  4ZHO A;  1P98 A;  2OJR A;  1SBB B;  2KLG A;  3GE8 C;  1N60 A;  2BYF A;  4Q2J A;  2EMS A;  5FK9 C;  3D32 A;  5L95 C;  4C56 C;  1AAR A;  2KDI A;  5JXV A;  3VAW A;  2G1E A;  2LVQ A;  3ZTD A;  2BGF A;  2NTS A;  2DZJ A;  2BS4 B;  2D3C A;  3KLS X;  1XCT L;  2JXT A;  1WXM A;  1WYW B;  4DWF A;  1KH0 A;  2SEB D;  4IUM B;  1GNU A;  1ZXH A;  4NNJ B;  1TYG B;  1V86 A;  3R2I A;  1L0X B;  2FUH B;  4OHJ A;  5L83 A;  2BYV E;  4US9 A;  5G5H A;  2UWQ A;  1D5Z C;  3BYY B;  4RNA A;  1DOX A;  2L32 A;  2KAJ A;  4W9C A;  1C4A A;  1TIF A;  1QQR A;  2D2Q A;  2NR2 A;  3APD A;  2AEH A;  2PLP A;  5CTR C;  2LVO A;  2K8C A;  3PZD A;  3L54 A;  4I6P A;  4ZRQ A;  1GC7 A;  3NRZ A;  2MBO A;  2ACZ B;  1QOF A;  4J6I A;  3E9S A;  4KSK C;  4FA6 A;  2KTR A;  2QC8 A;  4JIO U;  2CR5 A;  3S2A A;  1FFU A;  3A9J A;  3DWG C;  1UEL A;  4LNF A;  4AOF A;  2WU2 B;  2WDV B;  5CHF A;  2OED A;  1H8C A;  2KMC A;  1Q5W B;  1D4B A;  3HK0 A;  3QX1 A;  4XC2 A;  1I35 A;  3TUO A;  2DYO A;  1M4V A;  1PYW D;  2EEL A;  4PS3 A;  1WIA A;  2BKR B;  4DXA B;  3H9D A;  2W9N A;  3N1X C;  5E6P A;  2V0G A;  4C4V B;  3IAS 1;  3P42 A;  3ZXR A;  1JRP A;  1C79 A;  4B9K A;  5AUI A;  3AN1 A;  1WXV A;  4GB9 A;  3L13 A;  3TCA A;  2NBV B;  1AW7 A;  3L08 A;  3JYU A;  4C80 A;  3QJZ A;  3ZRF A;  1VZ7 A;  3EGR A;  4RF0 A;  4HEA 1;  1KM7 A;  3FIL B;  5IP4 D;  3WIM A;  1OQY A;  2BKF A;  3ZNI D;  3NS1 A;  1WYG A;  1C3T A;  3VH3 B;  1P9D U;  4PS7 A;  2LEK A;  2WS3 B;  2WXI A;  4A9A A;  4ARC A;  2KNB A;  4HLE A;  3DPD A;  1FCC C;  5C3J B;  4NY0 A;  2NBW B;  1V5T A;  2V4I B;  4WJO A;  3KUC B;  3PHW B;  2GB1 A;  3VHT C;  2D3B A;  4LNK A;  3W5U B;  4GSW A;  3Q2A C;  4US8 A;  3GE3 C;  2WX1 A;  1UZX B;  2LUM A;  5JHB A;  1U4A A;  2ZJD A;  2O6V A;  5HI1 A;  3DOW A;  3I57 A;  1B9R A;  4LTU A;  3BYT B;  1BUI C;  3ENE A;  1ZPS A;  3HUI A;  2ON8 A;  2KWU B;  3L0W B;  2LRW A;  1UUP A;  4W9J A;  3ZJU A;  1SXT A;  2PEA A;  1E8Y A;  1SIJ A;  1XLP A;  2WXP A;  3EFU A;  4B6W A;  1TJE A;  2R2O A;  2ZVO A;  2W3R A;  4TQ0 A;  1N61 A;  3MC8 A;  2IO3 B;  4LJO B;  3P1M A;  2MH7 A;  1RRB A;  3AE7 B;  3AI5 A;  4A3P A;  4TMA B;  2H88 B;  2B76 B;  2RD0 A;  2PTL A;  1ZUD 2;  2QDF A;  4ICV A;  1FO4 A;  2HTM E;  1JWU D;  2KK8 A;  2X8X X;  3DBL I;  3ETR A;  5J2R A;  1WH3 A;  2WX0 A;  4N59 A;  3TMP B;  1WGR A;  3AEG B;  3AE6 B;  2KJR A;  3JW0 X;  3Q3N C;  3RNE C;  2IZV B;  4AWJ A;  1MPE A;  2JF5 A;  1QOA A;  1RFA A;  4F7Z A;  2GBJ A;  1UWM A;  4WIP A;  5DPR A;  2ZZP B;  4KKJ A;  4RGT A;  4DHJ B;  1EU4 A; 
#chains in the Genus database with same CATH homology
 1KLG D;  4GLS C;  1SB3 C;  2KWD A;  1XCQ L;  4A90 A;  4REZ A;  1FMA D;  3KWV A;  1NVI D;  4D2K A;  4JE3 B;  2BS2 B;  2LFI A;  4MM3 B;  1TS3 A;  1AWD A;  1QOG A;  1VZ8 A;  1KF6 B;  1L4D B;  2IGH A;  2JQR B;  2PVG C;  4KGR A;  1UGJ A;  4A55 A;  2CJN A;  2ZW1 A;  5HHD G;  2Y3A A;  1C76 A;  2INN E;  3W2D A;  1K52 A;  2SAK A;  1XLO A;  2M19 A;  4YTP B;  3AE3 B;  1FXA A;  5G5G A;  3NVZ A;  1T6B X;  2BB5 A;  4GDK B;  4L1B A;  3BK1 A;  2JYT A;  3E56 A;  4FXC A;  3TEW A;  1V1P A;  2PW9 A;  2MJE A;  4YSX B;  5I4D A;  1FM0 D;  1XXG A;  1YN5 A;  3UI3 A;  2OHF A;  2KQ4 X;  2L52 A;  1SE2 A;  1TS2 A;  1C9F A;  1I4X A;  2FE8 A;  3MFG A;  3VR9 B;  1J7A A;  2WP9 B;  1YJI A;  2PMV A;  1TY0 A;  2VZK B;  2WXM A;  3U2S C;  2BB6 A;  3ZGZ A;  2LHE A;  3P4P B;  5HFY A;  3U4E G;  3AE8 B;  3BII D;  2V3P A;  2KMM A;  4XDD A;  4YTM B;  1I4G A;  1EM7 A;  2LGI A;  3V3X A;  3P4R B;  2RPV A;  3CIR B;  2W82 A;  2XNA C;  3ZYY X;  1IGD A;  2GRI A;  2E6X A;  2KDM A;  2JU6 X;  1D5M C;  2K0P A;  3ZJV A;  1I4H A;  1TKE A;  4ITK A;  4B0M A;  1K53 A;  5BMI A;  5GXG B;  5BYQ A;  3L4P A;  2LMC A;  2ZW0 A;  1FIQ A;  3FC4 A;  2JSV X;  1C4C A;  4OZC A;  3RFZ B;  1FNV A;  1JML A;  1VLB A;  3V05 A;  1BXT A;  3AEB B;  2CU3 A;  4AS1 A;  1SE3 A;  1NI3 A;  1VJK A;  2PKO A;  1L0Y B;  4HJG E;  1MI0 A;  2M0A A;  4ZYS A;  3VRA B;  1E7P B;  2M56 B;  2NTT A;  3GS2 A;  1TKY A;  3IT4 B;  1ESF A;  3OWE B;  4LK0 M;  2KN4 A;  1K51 A;  4CQN A;  4B0E A;  1I7H A;  1ACC A;  1QLB B;  3DWM A;  1PGX A;  3J9C A;  1F2R C;  4HRO A;  1E0Z A;  1SJH D;  2DLB A;  1Q10 A;  3I9V 1;  4AQ7 A;  1GOZ A;  2TSS A;  1L6V A;  4L23 A;  4RF1 A;  2RMM A;  1I4R A;  2W3S A;  2WXF A;  3Q8C A;  3AE1 B;  2W54 A;  3AV8 A;  3H8H A;  2Q5W D;  1SF0 A;  2JYE A;  2XN9 C;  1C4P A;  1YQ4 B;  2HDE A;  3LYY A;  4N58 A;  4A6Q A;  2QEJ C;  3PZ7 A;  5BMG A;  2PVO D;  4KX6 B;  2GI9 A;  3EA6 A;  1WXQ A;  3VRB B;  1I4P A;  1QT9 A;  3KWL A;  1SSN A;  1QIL A;  3NVW A;  3SFD B;  4YWG G;  1JWA D;  1WWT A;  1J7C A;  1FNU A;  1E6E B;  3AE9 B;  2YEP F;  1PDX A;  1JWM D;  1IBX B;  4M0W A;  1ET6 A;  1JQ4 A;  1T5X D;  2K5P A;  4N6E B;  2JWU A;  1D5X C;  1T3Q A;  4OZB A;  3SFE B;  1PUT A;  5D7G A;  3B9J A;  2IJ0 A;  1GAQ B;  1N62 A;  1ZDX A;  1GPX A;  3AE2 B;  1UWX A;  1VZ6 A;  3R8B A;  2PIA A;  2QIE B;  3URY A;  1TKG A;  3B2F A;  1ZOY B;  1CQV A;  1TS5 A;  4UDU C;  4JPS A;  2I2Y A;  1XO3 A;  2AX5 A;  1Y56 A;  2FBW B;  3MP9 A;  4OZA A;  4WWM A;  1VDV A;  1MHH E;  5HG2 A;  1FCL A;  1STE A;  1ROE A;  5MPO A;  4O1N A;  2DWQ A;  3FIL A;  3P63 A;  1SJE D;  1XLQ A;  4TSS A;  1ZXI A;  1JW9 D;  2J53 A;  2WXH A;  1QOB A;  2IDY A;  3AB5 A;  1FRR A;  4ZOH C;  4RGO S;  1NEK B;  2Y5C A;  3BVZ A;  4LLG M;  1UNS A;  4XE0 A;  5EE1 A;  1AYF A;  2Z8L A;  1VR9 A;  1HA5 A;  4RGM A;  4ZHO A;  2L83 A;  3SEB A;  1SBB B;  2EKI A;  1N60 A;  3P4S B;  1L5P A;  4Q2J A;  2BT6 A;  3FAH A;  3T3O A;  5FK9 C;  3BVM A;  4RGN A;  4WH4 A;  1N63 A;  1FNW A;  4H2A A;  1FRD A;  2WXR A;  4C56 C;  3WCQ A;  1EWY C;  1FXI A;  1K50 A;  3N9Y C;  5JXV A;  4WUR A;  1L6U A;  1YN3 A;  2G1E A;  3TEX A;  5TSS A;  2NTS A;  1OQQ A;  2BS4 B;  3W9C B;  3KLS X;  1XCT L;  1HEZ E;  2JXT A;  5E6J A;  2FUG 1;  4KKI A;  3AH7 A;  3HVZ A;  1KH0 A;  2SEB D;  2LHD A;  1ZXH A;  1RFK A;  3AEE B;  3O13 A;  1YMH E;  1E10 A;  1TYG B;  3R2T A;  1GB1 A;  2RDH A;  3R2I A;  1I4Q A;  1L0X B;  1TY2 A;  4JWU C;  1IUE A;  4OHJ A;  4US9 A;  1ZE3 D;  1KRH A;  5G5H A;  1D5Z C;  4P6V F;  3BYY B;  4RNA A;  1IGC A;  1HXY D;  3BZD B;  2QJL A;  1DOX A;  2L32 A;  2WNM A;  2KAJ A;  2VZK D;  5C2T B;  5BYS A;  1C4A A;  3IT6 B;  4USA A;  1QQR A;  5H92 C;  4ARI A;  5LNK 1;  2PLP A;  2CJO A;  3NVV A;  5FKA C;  1EU3 A;  1JWB D;  1F2R I;  3U7Z A;  1P7E A;  4ZRQ A;  3NRZ A;  3U52 E;  1RWS A;  3Q69 A;  2WXN A;  2BS3 B;  2ACZ B;  1QOF A;  3E9S A;  1YJJ A;  4C7Y A;  3MC0 B;  4HRS A;  4XWW A;  4HKQ A;  4EE2 A;  4XWT A;  2K9X A;  2WLB A;  2WXG A;  1FFU A;  3BVG A;  3DWG C;  2IPK D;  2L1A A;  2WU2 B;  1JWS D;  2WDV B;  3ABV B;  2J42 A;  2IGD A;  3SR6 A;  1QKZ A;  4HKZ E;  2K22 A;  2OED A;  1PFD A;  2AQ3 B;  3Q8F A;  3Q8E A;  4A8X C;  1GB4 A;  1HZ6 A;  4RFB A;  1D4B A;  2WXK A;  3P4Q B;  4KGS A;  1NEN B;  3TUO A;  1XEE A;  3NZ3 A;  2BW2 A;  3VR8 B;  2N7J A;  3B2G A;  2DYO A;  2ICI A;  4RH6 A;  1M4V A;  4YT0 B;  1PYW D;  2EEL A;  1PGB A;  2Y5P A;  3LB8 C;  4IKG A;  1FFV A;  4NAM A;  1IBX A;  1TS4 A;  3NUH B;  4C7Z A;  2WU5 B;  4R3D A;  2V0G A;  3IAS 1;  1L0V B;  3P42 A;  1JRP A;  4JX1 C;  1C79 A;  1F0Z A;  3PO0 A;  2IGG A;  2V3N A;  3EUB 2;  2RDG A;  5T8I A;  4DXF A;  5AUI A;  2AQ1 B;  3AN1 A;  4MAC A;  5BMH A;  1ZDV A;  2N9K A;  4YSY B;  2KAC A;  3Q8B A;  5EE0 A;  1SE4 A;  2INP E;  1AW7 A;  2MEK A;  1L4Z B;  2NMQ A;  4J3O D;  1D6E C;  1DOY A;  1XLN A;  4C80 A;  3AM9 A;  3AED B;  3HRD D;  1VZ7 A;  1FEH A;  1NYQ A;  4YTN B;  3EGR A;  4RF0 A;  2AQ2 B;  4HEA 1;  3AMZ A;  4OW0 A;  3FIL B;  1FD6 A;  3IAM 1;  1CJE A;  4WAF A;  4MH8 A;  1V1O A;  2W55 A;  3NS1 A;  3BWU D;  1WYG A;  1RM6 C;  1ZP0 B;  2QIL A;  1V8C A;  1F77 A;  2LEK A;  2WS3 B;  2WXI A;  4A9A A;  4ARC A;  2QSD A;  3TEZ A;  5FR3 A;  2G9H D;  5BYR A;  1FCC C;  5C3J B;  3CWI A;  3TSS A;  2JX5 A;  2V4I B;  4YSZ B;  1C77 A;  2WQY B;  2R61 A;  2GB1 A;  3PZ8 A;  2N0S B;  3RPF C;  3GB1 A;  3LXF A;  3W5U B;  4ZHP A;  1XF5 L;  2DBY A;  2WXJ A;  1VRA B;  4US8 A;  2WXL A;  1R7S A;  2I38 A;  2LUM A;  1DYQ A;  2MJ3 A;  3W1S A;  1ET9 A;  1WSP A;  1ENF A;  3BK2 A;  1C78 A;  3HVD A;  4XDC A;  3AE4 B;  1CK1 A;  2BYT A;  1V97 A;  1QF6 A;  3MJ5 A;  2QMT A;  5HI1 A;  1WGK A;  3I57 A;  1B9R A;  1P7F A;  5AUK A;  4KGT A;  4LTU A;  3BYT B;  1EWC A;  1PGA A;  1BUI C;  1DOI A;  4RCO A;  1HZ5 A;  2J4X A;  3Q8A A;  1OFF A;  1ZPS A;  3HUI A;  2ON8 A;  2BBC A;  1UUP A;  3C8Y A;  2BTE A;  3T3N A;  3AE5 B;  1JRO A;  3AEF B;  4GDL B;  1YNT E;  1RYJ A;  3ZJU A;  1SXT A;  1SIJ A;  1KLU D;  1XLP A;  2WXP A;  3NVY A;  4IOI E;  1TJE A;  1OQR A;  4DXG A;  2E3T A;  2WDR B;  3IXS A;  3ZJT A;  2WDQ B;  2W3R A;  1TZO A;  1JCK B;  1N5W A;  3VQI A;  4TQ0 A;  4YXD B;  2N9L A;  2X38 A;  1KTK A;  1N61 A;  1J7B A;  4OVZ A;  5D3D A;  3ZQ4 A;  4L2Y A;  1LO5 D;  1SEB D;  1DGJ A;  3P1M A;  4NZL B;  2MH7 A;  3AE7 B;  2WXO A;  3AEA B;  4NAW B;  2JZP A;  2YEP B;  1MHX A;  4TMA B;  1JAL A;  3TEY A;  4WQM A;  3KQ4 A;  2H88 B;  2B76 B;  2PTL A;  4NJC A;  1ZUD 2;  2MJD A;  1FO4 A;  2HTM E;  1JWU D;  1MVK A;  3ETR A;  1E9M A;  2K3U A;  2ONQ A;  3AEC B;  1NYR A;  4IDI A;  1BML C;  4N59 A;  2WXQ A;  1B1Z A;  3W5V B;  5EE9 A;  1AN8 A;  3AEG B;  1N5X A;  1YN4 A;  3AE6 B;  4DQO C;  2J52 A;  5H8Y E;  1WRI A;  1V1P B;  5EE3 A;  2H89 B;  1HQR D;  1A70 A;  3MHZ A;  4ZRP A;  4TQ1 A;  2LJI A;  1KFY B;  4P16 A;  1YQ3 B;  5D3I B;  1MPE A;  1QOA A;  2DYM A;  4JWS C;  4MT5 A;  1UWM A;  2D5G A;  4WIP A;  1CZP A;  3GP7 A;  4KKJ A;  4PT5 A;  4RGT A;  1EU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...