2MEKA

N-terminal domain of bilbo1 from trypanosoma brucei
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
110
structure length
110
Chain Sequence
MAFLVQVAADIFNNKVNFELSFPSRPSISELTRSAETAFSNEISLRRPDNVPSHKFHSSKIKMYDEELNKWVDLIREDQLTDYCQLYVFQPPNEWHKESQKEIPPAMKPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-TERMINAL DOMAIN OF BILBO1
publication title Structure and assembly mechanism of TbBILBO1, an essential flagellar pocket collar protein
rcsb
source organism Trypanosoma brucei brucei
molecule tags Metal binding protein
total genus 11
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2013-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18281 BILBO1_N BILBO1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.650 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2mekA00
2MEKA
chains in the Genus database with same CATH superfamily
3KUZA 5E6OA 4MGKE 1BUIC 2CJOA 3FAHA 2LUEA 2KTRA 1WJ4A 3C8YA 4II2B 2FAZA 2LVOA 3ZNZB 3ZNGC 3EC8A 1IBXB 2JUOA 2BTEA 3LYYA 2QIEB 2NR2A 4WIPA 4MEMA 3UIPB 5BMGA 5E6PA 2MCNB 3LXFA 3VAWA 3KQ4A 4II3B 1Y56A 5FR6A 5IN7A 3H1UA 3AEFB 1V5TA 3NVWA 4HCNB 1KRHA 4ZOHC 4HRSA 3RCZA 4NAMA 2K8BA 3DOWA 2MLBA 2ON8A 3M62B 1WJ6A 2WU5B 2RDGA 3N20C 3DBRB 1F9JA 1NEKB 2ZZPB 1TGZB 3VUXA 3NUHB 2IJ0A 2LJ5A 3A9KB 1WJNA 3W2DA 3NVVA 4RCOA 2E6XA 3IHPC 1D6EC 4XDDA 1P3QU 2GMIC 4XE0A 3Q8FA 1PUTA 1ZDVA 1YOVB 1EF1A 3VH4B 4A90A 2KFJA 3QQ8B 4AP4C 2PTLA 2QILA 2X8XX 3VVWB 5EE3A 1UNSA 3BY4B 1K8RB 1I4HA 2D5GA 4MDKE 4EZLA 3PREA 3ZDMC 4RGMA 3VR8B 3TL5A 2NS5A 1EO6A 3Q3FA 3AE6B 4C7ZA 1RFAA 4FA6A 2KKCA 4LJOB 3BYYB 2WX0A 2SAKA 2PPHA 1WIAA 3PZ7A 2MQJA 1EWYC 3A9JA 4YSXB 2CR5A 3Q3NC 1F2RC 1NENB 1V1OA 3TBLD 2FNJB 1KM7A 3AMZA 1UBIA 2AL6A 4HWIB 3BVMA 4TV3A 3GZNB 3PRPB 4HPMB 4WWPA 1B1ZA 3VQIA 2LEKA 3AULA 4NQKE 3H6NA 3ZVVA 1LM8B 3NVYA 4HDQA 2KQSA 1ZGUB 1A70A 4OW0A 4BVUC 1YN3A 3AEDB 3P4QB 2KDBA 1CJEA 1WXMA 1I4QA 3CSTA 3TMPB 5GXGB 5J17A 4MH0E 2ZPNA 4ANWA 2LXCA 3U30A 1NI3A 1VZ8A 1OGWA 4J3OD 1WGHA 5D7GA 4I6LB 3BINA 4L23A 4RMAA 1MVKA 4I6PA 4KGSA 1WMHA 4EZJA 3AE1B 1FRRA 1WR6E 2FUG1 1JROA 1E8YA 4K7UA 1EWCA 1E7UA 2K25A 1EUVB 4X57B 3ZDTA 2K6QA 1WE6A 4WJOA 3APDA 2N4FA 4OHJA 4Q2JA 4TSSA 3NOBA 3PTFC 3WALA 2MJEA 1KTKA 2FIDA 2O2VA 4E74A 4W9EA 4C4VB 1WGRA 5J18A 4ZRPA 1P98A 3BVGA 2MWSB 2AQ1B 2N9LA 2LWPA 5IAAC 4KZCA 2BW2A 3ZJUA 1YMHE 3DVNU 4A3PA 4CHKA 3ML8A 3V6EB 4LCDE 2FCNA 1GNUA 3VUWA 1OQRA 3SHQA 1PDXA 2BVCA 1WX8A 3Q3JA 3W5VB 5DPWA 4KSKC 4K7WA 2NMQA 1OQQA 1C76A 2PJHA 2MW5A 4P6VF 4RF0A 4XWTA 1I42A 2IGHA 5C2TB 1WXQA 1R4MB 1D3ZA 4IC7B 2NBUA 3P4RB 3AE9B 1NBFC 2IBIB 3GZNI 1N63A 5LNK1 3QARA 2Z0EB 1V1PA 3O13A 3DVGY 5GMVA 2M4NA 1KF6B 3T8MA 4BKGA 2D3CA 3FC4A 1TKGA 1TTNA 4BOZB 2NCNA 2WDQB 4LK0M 1RM6C 1WH3A 2I2YA 3MJWA 1ACCA 4C80A 4FHKA 4NAWA 2LGDA 3KW5B 3RNFC 3P1MA 4W9GA 2BWFA 2JXXA 2Y3AA 2Z8LA 1C4AA 3V3XA 4URKA 1OEYJ 1WY8A 4DHJB 2RDHA 1H4RA 3DBHI 1WZ3A 5CHFA 1PGXA 3Q8AA 3SU8X 4H2AA 1Q1OA 2Z59B 2K22A 4YTMB 2LGYA 4RGNA 1TBEA 4PYUA 3MJ5A 4DHJD 2ZPYA 2O6VA 4CQNA 1L0XB 3EUB2 1F1HA 2DZKA 3EGRA 5BO4B 4RNAA 4NJCA 4N58A 1XQQA 2XEWA 4XZ4A 1SJHD 1FFUA 4US9A 3Q6BA 3RYTA 1P7EA 4S17A 2A4ZA 2CHZA 2CHWA 2INDC 3M95A 2Z0DB 1D5XC 3RNGC 3KYDD 3SD5A 1WR1A 4JL9A 3P63A 3KUDB 3MC9A 3AEGB 2IY1B 5IA7A 3ZYYX 4N59A 3VTVA 4RM9A 2JRHA 4WJNA 4IW0A 3RZWC 1WXAA 1XT9B 3ZIMA 2IY0B 4N6EB 3AEBB 1V81A 1Z2MA 1R4MI 2M1MA 2G3QB 2MRPA 1ZPSA 3NVZA 3PV1A 1FNUA 3R66C 2MEKA 3RPFC 4WWMA 2ZCCA 5HG2A 2FE8A 2SEBD 1GC6A 5JHAA 3MHZA 3B08A 5AZGA 1HA5A 3VDZA 4LLGM 1RRBA 2WXFA 1F0ZA 2L3ZA 3FILB 4FN2A 4KVGB 1YQ3B 4WWNA 4K3BA 1GUAB 2JRIB 1VCBA 1SSNA 4DXGA 5FK9C 2LHEA 4DDID 4TQ0A 4BAXA 3QK0A 2V9HA 4EKUA 4EEWA 2MP2B 4PS3A 2MX2A 3IFWB 4JPSA 3AE8B 2N7EA 2KWUB 2J52A 4PYZA 1C4PA 4MSMB 2R61A 3PVLA 4MGIE 3AE5B 3VRBB 2HD5B 2OJRA 3QAQA 1WFYA 2WXGA 3B9JA 2PW9A 1K53A 4N9F4 3ZLZA 1S1QB 2BYFA 1S3SG 3RZFA 3C19A 1VZ6A 4JX1C 1GB4A 3N3KB 1BMLC 4KIKA 2JZPA 2LJIA 2WXJA 4A9AA 1FO4A 3R2IA 3MC8A 2AYOB 2BS3B 1TKYA 1Z5SB 4RGOS 2EELA 2L1AA 1EF5A 1IGCA 2BB6A 2ZCBA 4W9FA 1XF5L 3ZXRA 1UD7A 1LFDA 3K9PB 1I35A 2KVZA 4A55A 2K9XA 2M19A 3OJ3A 2E3TA 3N9YC 2TSSA 1WGYA 5LXIB 2LHDA 3IAS1 1V49A 5FKAC 5D94A 4LNIA 3KLSX 4IUMB 3B1LX 1WWTA 4W9HA 3B2GA 2LGXA 1TZOA 2N1VA 1N6ZA 3L13A 3AH7A 5HHDG 4KKIA 3L10B 1BXTA 2V3PA 4P1CC 4WH4A 3VRAB 4FADA 1HTQA 3NS8A 2NBVB 2JY6A 1XLPA 2YEPF 4AS1A 1I7HA 4AOFA 2ZEQA 2BS2B 3WCQA 2N9KA 2ZW0A 3N1YC 3ZKJC 2J0JA 2LVPA 4MH8A 4BBNC 2ICIA 2LXAA 2JQRB 1K51A 1VZ7A 2C5LC 1TT5B 4MGYE 4IOIE 2L32A 1RAXA 3S2AA 3A4SC 4RM8A 4HJGE 2KDFB 2QEJC 3AI5A 2R2OA 3DVNV 4HVBA 3N30A 3AE3B 2KWVB 4KV2A 3GP7A 2IGGA 5AEKB 4GGQA 4LNNA 2GRIA 1YIWA 2AL3A 5H8YE 4RGTA 2GBRA 3U8ZA 2JZ3B 2IGDA 4ZRJA 4ZDVA 4KX6B 2LASA 3M3JA 1FRDA 2HTME 3WAOA 2NBWB 3PLUA 2MSED 4DBGA 2D2QA 3H7PA 2W55A 1N5XA 2M8SA 3NRZA 4GDKB 1T3QA 1J7AA 4EUTA 1T0SC 1GJZA 5HI1A 1XLNA 2XK5B 2UYZB 2OOBB 1HXYD 2HJ1A 3CSFA 4W9DA 3HRDD 4IM2A 5HKHA 1YNTE 4BOSC 1ZW7A 3GE8C 4K1RB 4AJWA 5DPSA 4NJ7A 3RT3B 4B0MA 4B95A 3ZGZA 2N9PC 4IWQA 4DWFA 2N9EB 5DPTA 5T8IA 2J0MA 3PPAA 1FNWA 3NZUA 1Q0WB 5JXVA 2ZW1A 4ICUA 2V1YA 3M63B 2JSVX 3MC0B 4C4VA 5L83A 1HEZE 4TQ1A 4FLHA 2KJ6A 3WAPA 4ICVA 3PZDA 2IYDB 3ETRA 4ZYSA 3AXCA 4L2YA 1MI0A 2Y5BB 2KHWB 3W1SA 2JXTA 2L00B 1JWBD 2NPTA 4FJYA 4HPPA 3T3NA 3WIMA 1OTRB 4A3OA 4KGTA 3L54A 2BB5A 4KDIC 1UH6A 3PGEA 3W9CB 1GC7A 4KZ0A 3APCA 2DLBA 5G5GA 2K5PA 3ZRCA 4MM3A 2KYWA 1FXAA 2ZVNA 3AE2B 3DHGC 2PVGC 1LXDA 3BYTB 4F7ZA 2JZZA 2MJDA 1WGGA 2L76A 1WX7A 4BKSD 2AX5A 3Q8EA 1TY0A 4ACFA 3UGBB 1PQSA 3SEBA 5AUIA 3IBEA 3QCAA 1KJTA 3WAMA 3TUOA 1WF9A 3ZW3A 3BVZA 1TS2A 2WXNA 3HM3A 1SXTA 4F8CB 2GBMA 3OAWA 5D3DA 1WRDB 4HDOA 2NVUI 2KTFA 3OG5A 1KOTA 4AJYB 1V97A 2DHZA 2LRUA 3L17A 1YX6B 2EMSA 3ZNID 4MACA 1DOIA 2RPQA 3B0AA 2JPHA 4YTPB 4DXFA 2VZKB 4LTUA 1P0RA 3AU4A 5DPRA 1SE4A 2WP9B 3WANA 1F77A 4GDLA 2RDBC 4F1SA 1C3TA 4EOYA 4REZA 4OVZA 4NY0A 2HJ8A 4A8XC 3DBHB 4K81A 1WYGA 2YVCA 4ANUA 2QMTA 3TEXA 4WAFA 2LI5A 4OZAA 5TR5A 3A1QA 5C23A 3PRMB 3ZUNA 1SIFA 4DDGD 2CS4A 3QJZA 1D5MC 4B9KA 4KKJA 3ZJVA 3Q3OC 4HXDA 1T0YA 2RSUA 2LMCA 1E9MA 2ACZB 2VZKD 4M0WA 2FIFA 3JSVA 1QKZA 5CHVC 3I3TB 3HHMA 3VFKA 3PHWB 3RULA 2WXPA 2FUHB 1AW7A 3DQVA 4KDLB 4ZYNA 1TY2A 3HUIA 4MT5A 4YTNB 3EFCA 1N61A 1IPGA 4J6IA 5G55A 1V2YA 1DYQA 4IM0A 3TIXA 3U4EG 3VUYA 2FCMA 3ZXVA 1OFFA 3EFUA 4USAA 2AWTA 3CMMB 3QWZB 1E8WA 2AQ3B 3QHTA 2C7NB 2WXQA 2L7RA 3VHTC 3DVGX 1DGJA 3DBLI 4ASWC 2M0XA 3ABVB 3KUCB 1WE7A 5AUKA 4JLCA 3DHHC 1X1MA 3H7SA 3VR9B 3X0WA 4OVVA 5LXHA 1WX9A 4L1BA 2WXLA 1E8XA 1TIFA 1UGJA 1HQRD 2PVOD 1SE2A 1G6JA 4S0RA 1FM0D 1FCCC 1L6VA 1QT9A 4IWOA 2J53A 5JH5C 2G4DB 2BYTA 2IO2B 2D11A 3RD2A 4E3CA 2IDYA 3OLMD 4WAAA 5AZHA 1L2NA 2J7QB 4YWGG 2UWQA 2CKHB 4GIVA 3ZRFA 3AEAB 2BF8B 3AB5A 4NZLB 2REXA 2WQYB 3H9DA 1PGBA 3PO0A 1ZXHA 5BYSA 1QILA 4HJKA 2N7DA 2KJRA 4HK2A 3ENEA 4ZRQA 3JVZX 3PRZA 1L4ZB 5KHQA 1ZKHA 1T5XD 1Q5WB 1SIJA 1AYFA 4M8MA 3OWEB 4LNOA 3IT4B 2DAJA 1QF6A 2B76B 4FJVB 3UQBA 1Y8RC 1TKEA 3NS1A 5HFYA 3L08A 3WA0A 3RI7C 1L5PA 2MBBB 2JYTA 1N5WA 3R7RA 3NJTA 3IXSA 2VH2A 1R4NI 1CQVA 3L4PA 1TS4A 1XCTL 2KVRA 2LRWA 1RFKA 1WI0A 3IT6B 1MG4A 3KYCD 1SBBB 5CX3A 1P7FA 5D3IB 5BMHA 2N7JA 2BBCA 2JX5A 4XGAB 2KT7A 1A5RA 4C00A 4MJSA 3VXWA 2L0TA 1L4DB 1VRAB 4YL8A 3ZQ4A 3CF6E 1ET6A 3ZO5B 1C79A 1OQYA 4HLEA 4G3XB 1C77A 4G50A 1R7SA 3QC8B 3DWMA 3KVFB 1B9RA 3J9CA 2ZNVC 3GB1A 1PGAA 1DOYA 2WXHA 1I4XA 2KMAA 2L05A 2KN4A 4WWOA 2DX5B 4ANVA 1XXGA 1UUPA 3W5UB 1WM3A 1JWSD 2EMTA 2MBQA 4PK1A 2A5UA 3KH0A 5BYQA 5G5HA 1KLGD 2ZNVB 1YQBA 2W82A 1GOZA 3BZDB 2JT4B 3GE3C 5IO9A 1IBXA 4XYCA 5H92C 2BQQA 3N1ZC 3ZNHB 4JWUC 3ML9A 4JE3B 2XK5A 1U4AA 3L0WB 2DBYA 3U52E 5C1ZA 2WNMA 2BS4B 1NYQA 4ZRKA 4HKQA 3I57A 2GBNA 2B3AA 2JF5A 4GN1A 3TEWA 2JWZA 2WXOA 1SB3C 2MH7A 2RD0A 2INNE 2K0PA 2KDMA 3DHIC 3JW0X 3R3MA 3Q14C 1YN4A 4XC2A 1WSPA 3DPDA 2DYOA 2GBKA 2YEPB 1TYGB 3MFGA 1IP9A 3H8HA 4A6QA 3NG0A 2L83A 3A9KA 3ECIA 1KLUD 1AARA 2WHIA 1FIQA 3HIZA 4OZBA 4RH6A 3UQAA 4WURA 1E0ZA 2WDTB 4BKTA 1OEYA 1FMAD 3URYA 1WRIA 2G1EA 5E6JA 3ZJTA 3KWLA 4P7IA 1ZDXA 3RNCC 2KWCA 2MBEA 1ISNA 4M00A 1E8ZA 1T6BX 3MP9A 3V60A 2LZ6A 1QOFA 1VD2A 4DXAB 2YLMA 2FBWB 4KSLC 1JWAD 1WGDA 1IYFA 1I4PA 2QSDA 4IWPA 1FPYA 4OZCA 4JWSC 1E7PB 2WYQA 3V62A 5CHWA 3AM9A 1SE3A 3RNBC 4GOCA 2M56B 4WQMA 3R7QA 3CIRB 4OVUA 1N60A 3EHVA 5EE9A 2GOWA 2KC1A 2KJHB 2N0SB 1AWDA 2RPVA 2MJ3A 1Q10A 3GOEA 2MA9B 3RUIB 3V6CB 2DZJA 2PKOA 1TS3A 4B6WA 1HTOA 2KLGA 1ZP0B 1J8CA 4MGZE 2CU3A 2K39A 2V4IB 1CK1A 5L95C 1J0GA 3SR6A 2RGFA 2H89B 4D2KA 1TJEA 2AQ2B 2Y5PA 4W9LA 3RN9C 4ZHOA 1SE9A 3Q69A 2KNBA 5BYRA 3HM6X 3DWGC 4NNJB 1NDDA 4LNKA 1JRUA 2IO0B 1WM2A 1NI2A 4IM3A 2LGSA 1PYWD 2MBOA 1HZ6A 2WX1A 4MSQB 1RWSA 1K50A 4O1NA 2BKRB 4W9CA 1QQRA 3APFA 1WYWB 2DYBA 2DWQA 2K3UA 1FFVA 1MJDA 4TUUA 1C1YB 3V05A 1L7YA 3BWUD 4KIKB 4E71A 2KAJA 2JVCA 2CHXA 2MHJA 3LB8C 4PS7A 4BBNF 3K9OB 1SEBD 3HVZA 2KMMA 2QC8A 2KDIA 1WXSA 2H88B 1CZPA 1JWUD 3ZTDA 2V0GA 2RMMA 1P9DU 4W9IA 2KX0A 1UF0A 3GS2A 3KWVA 2R2QA 4W9JA 3NZ3A 4RF1A 3Q2AC 1WZ0A 2V4LA 1MHXA 2WDVB 4M8NA 1SGHA 4PT5A 3DBLB 3ONSA 4G11A 1J7BA 1FD6A 3T9LA 1T0QC 2V3NA 5KHOA 1L0VB 4JGHB 3E9SA 3SFEB 2G9HD 5FR3A 1YJ1A 2I1JA 3JYUA 4PS8A 2BWES 1D4BA 2WLBA 1GAQB 4ZRIA 1YX5B 4IDIA 4WJPA 3RNEC 2BGFA 2VRRB 3LJ3A 4HKZE 3Q8BA 4C56C 5E6NA 3Q8CA 4FJZA 1J7CA 1ZXIA 4M02A 2I38A 4KGRA 3RNAC 5IOIA 3DCGA 4US8A 2KFKB 2J0KA 3RFZB 3PT2B 4M01A 1ET9A 3P42A 2ONQA 3PHXB 3C0RB 2PLPA 2BT6A 3TJPA 4CYEA 2JU6X 2PMVA 3LDZE 5JZEB 1IUEA 4IKGA 3AV8A 2LUMA 1EU3A 2KTRB 4LJPB 2OEDA 4HCPB 3VTWA 3QX1A 1FNVA 2I1KA 2JYEA 1XLQA 3AN1A 1DOXA 3H7PB 3QA8A 2W3SA 2OJWA 4K3CA 3R8BA 1QZEA 4TMAB 2RR9A 2KDEB 1ROEA 4GU2A 5CTRC 2W3RA 4DQOC 1XD3B 1JCKB 3DBRI 4JIOU 3PSEB 1JWMD 4A20A 4YXDB 1ZOYB 4FXCA 4GMVA 1YD8U 1R4NB 1UWMA 4DHZE 1MG8A 1D5ZC 1MFWA 2XN9C 2CJNA 2D3GA 3W1SC 3U2SC 1JW9D 3CWIA 3P4SB 4YT0B 1V9JA 1K52A 1VR9A 3ZTCA 3EA6A 1E7VA 4HROA 5J2RA 5BMIA 2IZVB 2INPE 2NPTB 2IO1B 3D32A 2BPSA 5TSSA 4FULA 1QOAA 3I5JC 4YSYB 4G0NB 2PEAA 1GG3A 5IKCM 2WS3B 2WU2B 2NTTA 2WXMA 4EFOA 2QCZA 2KOXA 1STEA 1WJUA 2BYEA 2KX3A 2OHFA 3FILA 3PZ8A 4MM3B 1EM7A 1TS5A 2K8CA 2L52A 4P1BC 4XX5A 2HDEA 3HK0A 3NZSA 4K7SA 3BIID 1V80A 3X23A 3TSSA 3A4RA 3MHSD 2PIAA 4DHZB 2MP2A 2N9XA 1L6UA 2W54A 1SF0A 3BK1A 1UBQA 3B2FA 1F52A 3SDLC 2XNAC 3A9JB 1XEEA 2V3SA 3FKYA 1GPXA 4IG7B 2C7HA 3T3OA 1VLBA 3N1XC 1XO3A 2KQ4X 3Q3MC 2WXRA 3IAM1 5MPOA 4LDTB 3P4PB 1V5OA 2KC2A 1JRPA 1QOBA 1F2RI 2KACA 3UF8A 3U7DA 2WDRB 4NJ6A 2QJLA 4AQ7A 2G45B 2D10A 1NYRA 1BT0A 1KH0A 1RYJA 1V6EA 2KANA 2KN5A 1QOGA 1YJJA 4ITKA 3TEYA 4TKNA 1KLVA 2MBHA 3QIJA 2LD9A 3RMKC 2GLSA 2ZJDA 4LDTD 3NHEB 4R3DA 2WGSA 4GDLB 2INCC 3IG3A 3SFDB 2HTHA 2PE6B 1VDVA 3A1QB 3DBSA 1L0YB 2N1WA 3I9V1 1VJKA 1HE8A 2DZIA 1JMLA 2DYMA 2FCSA 4M0WB 2EKEC 1WMHB 3JSVB 2KQ7A 2L0FA 3TEZA 1UZXB 4NQLB 2K8HA 3P2BA 1UWXA 5C3JB 1E6EB 2KXJA 2D07B 3DDCB 1YN5A 4NPNA 1YQ4B 4BFRA 4XDCA 2Y5CA 4C7YA 5I4DA 2BKFA 4YSZB 2O2VB 1N62A 2DAFA 2LGIA 4BZAA 1PFDA 1YJIA 2GI9A 3EECA 2M0AA 1P1AA 1SJED 3N32A 2W9NA 2WXIA 1ENFA 4RFBA 1KFYB 5IP4D 2ZVOA 1NVID 2HE7A 3U7ZA 1CMXB 4W9KA 1M94A 3AE7B 1C4CA 1C9FA 2GB1A 4XWWA 3E56A 2X38A 2EKIA 4MELA 3PLVA 3V61A 1E10A 2KLCA 4GSWA 2J4XA 2D3BA 2K1FA 2WXKA 3W1YA 1I4RA 4ANXA 5EE1A 1T0RC 1TZ1A 2WWZA 5EDSA 4I6NB 2C7MB 1C78A 4EE2A 1V86A 1MHHE 1ZE3D 1LO5D 3MTNB 4GDKA 2D3AA 2DNFA 4UDUC 1JALA 1V1PB 1FCLA 1FXIA 2L8JA 3R2TA 2LFIA 3AU5A 1IGDA 3UIOB 1M4VA 2QDFA 2ASQA 2UU7A 4CO7A 2C60A 3A33B 4NAWB 1FEHA 2KK8A 1ZUD2 1AN8A 3IVFA 4ZHPA 2IPKD 4AUQC 1H8CA 2KO3A 2NTSA 3VH3B 1E90A 3VTUA 3NY5A 4FHJA 3ALBA 1XLOA 5DCNA 1HZ5A 3L16A 5G2NA 2Q5WD 2C9WB 1FXTB 4DK5A 4GB9A 1QLBB 4GLSC 2XBBC 3UINB 3OJ4B 2BYVE 3BK2A 3PS6A 5JHBA 1LQBA 2FCQA 4AWJA 4HPLB 2O6VB 4GXBA 1XCQL 1E5WA 4LNFA 1RLFA 4BKSA 1V8CA 1UELA 1WGKA 2DZMA 1LGRA 2JWUA 2QHOA 4WJQA 4WQOB 2KMCA 2J42A 4QAYA 2G4SA 4P16A 5EE0A 1UGMA 1ESFA 2VH1A 3O65B 2KZRA 2O6VD 4ARIA 5AZFA 1J19A 2KWDA 2AEHA 5LLIA 3AEEB 4FBJB 4B0EA 4HEA1 5D6JB 2KD0A 4EZKA 4MJSB 2LVQA 1JQ4A 1WXVA 3AECB 1MPEA 3UI3A 2CU1A 4ARCA 3TCAA 2K6DB 1GB1A 3I63C 3HVDA 4JQWC 2KFKA 2M17A 1EU4A 1I4GA 3AE4B 2GBJA 5D2MB 2DENB 2PE9A 2IO3B
chains in the Genus database with same CATH topology
2ONQA 5FK9C 2LHEA 3AEAB 4TQ0A 1BUIC 2PLPA 3AB5A 2BT6A 4NZLB 2CJOA 3FAHA 2WQYB 2JU6X 2PMVA 3C8YA 1PGBA 3PO0A 4JPSA 1IUEA 1ZXHA 4IKGA 3AE8B 5BYSA 3AV8A 2LUMA 1QILA 2J52A 1IBXB 1EU3A 2BTEA 1C4PA 2R61A 4ZRQA 2OEDA 3LYYA 3AE5B 3VRBB 1L4ZB 2QIEB 2WXGA 4WIPA 3B9JA 1FNVA 2PW9A 2JYEA 1XLQA 1K53A 5BMGA 1T5XD 1SIJA 1AYFA 3AN1A 3LXFA 1VZ6A 3KQ4A 4JX1C 3OWEB 1GB4A 3IT4B 1QF6A 1DOXA 1BMLC 2B76B 1Y56A 2JZPA 2LJIA 2W3SA 2WXJA 1TKEA 3NS1A 3R8BA 4A9AA 1FO4A 5HFYA 3AEFB 3R2IA 4TMAB 2BS3B 3NVWA 1TKYA 1KRHA 1L5PA 1ROEA 4HRSA 4ZOHC 4NAMA 2JYTA 1N5WA 2ON8A 4RGOS 2EELA 2W3RA 4DQOC 1JCKB 2WU5B 3IXSA 2L1AA 1IGCA 2BB6A 2RDGA 1JWMD 4YXDB 1XF5L 1ZOYB 1CQVA 3L4PA 1TS4A 4FXCA 1XCTL 1UWMA 4A55A 1NEKB 1D5ZC 2K9XA 1RFKA 2M19A 2E3TA 2XN9C 2CJNA 3NUHB 3IT6B 2IJ0A 3N9YC 2TSSA 1SBBB 3U2SC 1JW9D 3CWIA 3P4SB 1P7FA 2LHDA 3IAS1 5FKAC 3W2DA 4YT0B 3NVVA 4RCOA 5D3IB 5BMHA 2N7JA 2E6XA 3KLSX 1K52A 1D6EC 2BBCA 1VR9A 2JX5A 4XDDA 1WWTA 4XE0A 3Q8FA 3B2GA 3EA6A 1PUTA 1ZDVA 1TZOA 4HROA 1L4DB 1VRAB 3AH7A 5HHDG 4KKIA 5BMIA 1BXTA 3ZQ4A 2V3PA 4WH4A 4A90A 3VRAB 2INPE 1ET6A 1C79A 2PTLA 2QILA 5TSSA 5EE3A 1C77A 1QOAA 1XLPA 1R7SA 1UNSA 2YEPF 4YSYB 1I4HA 3DWMA 4AS1A 2D5GA 1I7HA 2WS3B 2WU2B 1B9RA 3J9CA 2NTTA 2BS2B 2WXMA 3WCQA 4RGMA 3VR8B 2N9KA 1STEA 3GB1A 2ZW0A 1PGAA 1DOYA 2WXHA 1I4XA 4MH8A 2OHFA 2ICIA 3FILA 2JQRB 3PZ8A 4MM3B 1EM7A 1K51A 1TS5A 2L52A 1VZ7A 2KN4A 3AE6B 2HDEA 4C7ZA 1XXGA 1UUPA 3BIID 4IOIE 3W5UB 2L32A 3BYYB 2SAKA 1JWSD 4HJGE 3PZ7A 1EWYC 5BYQA 3TSSA 2QEJC 4YSXB 5G5HA 1KLGD 2PIAA 1F2RC 1NENB 1V1OA 2W82A 3AE3B 2W54A 1L6UA 3BK1A 1SF0A 1GOZA 3BZDB 3B2FA 2IGGA 3GP7A 2GRIA 2XNAC 3AMZA 1XEEA 1IBXA 1GPXA 3BVMA 3T3OA 5H8YE 1VLBA 1XO3A 4RGTA 5H92C 2KQ4X 2WXRA 3IAM1 1B1ZA 5MPOA 3VQIA 2LEKA 3P4PB 2IGDA 4KX6B 3NVYA 4JWUC 1FRDA 1JRPA 1F2RI 1QOBA 2KACA 2HTME 1A70A 4JE3B 4OW0A 2WDRB 2W55A 2DBYA 2QJLA 3U52E 2WNMA 4AQ7A 1N5XA 3NRZA 1YN3A 1NYRA 3AEDB 1T3QA 1KH0A 1RYJA 2BS4B 4GDKB 1J7AA 3P4QB 1CJEA 1QOGA 1NYQA 1YJJA 5HI1A 4ITKA 3TEYA 4HKQA 1XLNA 3I57A 1I4QA 1HXYD 3TEWA 2WXOA 5GXGB 1SB3C 2MH7A 2INNE 3HRDD 2K0PA 2KDMA 4R3DA 4GDLB 1NI3A 1YNTE 1VZ8A 1YN4A 3SFDB 4J3OD 5D7GA 1VDVA 1WSPA 4B0MA 2DYOA 3ZGZA 4L23A 2YEPB 1TYGB 3MFGA 1MVKA 3H8HA 4A6QA 4KGSA 5T8IA 2L83A 1L0YB 1KLUD 3I9V1 3AE1B 1VJKA 1FRRA 1FNWA 2FUG1 1JROA 1EWCA 1FIQA 1JMLA 2DYMA 5JXVA 2ZW1A 4OZBA 4RH6A 4WURA 1E0ZA 2JSVX 3MC0B 3TEZA 1HEZE 4OHJA 4TQ1A 1FMAD 3URYA 4Q2JA 4TSSA 1WRIA 2G1EA 1UWXA 2MJEA 5E6JA 3ZJTA 3ETRA 3KWLA 4ZYSA 1KTKA 4L2YA 5C3JB 1MI0A 1E6EB 1ZDXA 1YN5A 3W1SA 1YQ4B 2JXTA 1JWBD 3T3NA 4XDCA 2Y5CA 4ZRPA 4C7YA 3BVGA 2AQ1B 1T6BX 2N9LA 4KGTA 5I4DA 3MP9A 4YSZB 2BB5A 1N62A 1QOFA 2BW2A 2LGIA 3W9CB 3ZJUA 1PFDA 1YJIA 1YMHE 2GI9A 2M0AA 2FBWB 1JWAD 1SJED 2DLBA 5G5GA 1I4PA 2QSDA 2K5PA 4OZCA 4JWSC 2WXIA 1FXAA 1ENFA 3AE2B 4RFBA 1KFYB 1E7PB 1NVID 1OQRA 3U7ZA 1PDXA 2PVGC 3BYTB 3AM9A 1SE3A 2MJDA 3AE7B 3W5VB 1C4CA 2AX5A 3Q8EA 1C9FA 1TY0A 2GB1A 2M56B 1OQQA 2NMQA 4WQMA 4XWWA 1C76A 4RF0A 3CIRB 3E56A 4P6VF 2X38A 4XWTA 1N60A 2IGHA 5EE9A 5AUIA 5C2TB 3SEBA 1WXQA 2EKIA 1E10A 2N0SB 3TUOA 1AWDA 2RPVA 2MJ3A 3P4RB 1Q10A 2J4XA 3AE9B 3BVZA 1TS2A 2WXNA 2WXKA 1I4RA 5EE1A 1SXTA 2PKOA 1N63A 5D3DA 1TS3A 1C78A 4EE2A 5LNK1 1V1PA 1MHHE 1ZE3D 1ZP0B 3O13A 1V97A 1LO5D 1KF6B 3FC4A 1TKGA 2CU3A 2V4IB 2WDQB 4LK0M 4UDUC 1JALA 4MACA 1RM6C 1DOIA 1V1PB 2I2YA 1FCLA 1FXIA 1CK1A 3R2TA 1ACCA 4YTPB 4C80A 2LFIA 3P1MA 3SR6A 2VZKB 4DXFA 4LTUA 2H89B 1IGDA 1SE4A 2Y3AA 2Z8LA 1C4AA 1M4VA 1F77A 1TJEA 2AQ2B 2WP9B 2Y5PA 3V3XA 4D2KA 4ZHOA 3Q69A 2RDHA 5BYRA 4REZA 1PGXA 4OVZA 4NAWB 4A8XC 3DWGC 3Q8AA 1FEHA 1WYGA 2QMTA 3TEXA 4WAFA 4H2AA 1ZUD2 1AN8A 4OZAA 4ZHPA 2IPKD 2K22A 2NTSA 1PYWD 1D5MC 4KKJA 1XLOA 3ZJVA 1HZ6A 4YTMB 1HZ5A 2LMCA 1E9MA 2ACZB 2Q5WD 4RGNA 2VZKD 1RWSA 4M0WA 3MJ5A 1K50A 4O1NA 1QQRA 1QKZA 1QLBB 4CQNA 2WXPA 1L0XB 3EUB2 4GLSC 2DWQA 2K3UA 1FFVA 3BK2A 3EGRA 3V05A 4RNAA 3BWUD 4NJCA 4N58A 1AW7A 2KAJA 1XCQL 3LB8C 1TY2A 3HUIA 4MT5A 4YTNB 1SEBD 3HVZA 2KMMA 1V8CA 1N61A 1WGKA 2H88B 1CZPA 1JWUD 1SJHD 2V0GA 1FFUA 2JWUA 1DYQA 2RMMA 4US9A 3U4EG 2J42A 1P7EA 4P16A 1OFFA 5EE0A 1ESFA 4USAA 3GS2A 1D5XC 3KWVA 4ARIA 2AQ3B 2KWDA 3P63A 2WXQA 3NZ3A 4RF1A 3AEEB 1DGJA 1MHXA 4B0EA 2WDVB 3AEGB 4PT5A 3ABVB 4HEA1 4N59A 3ZYYX 1J7BA 1FD6A 2V3NA 5AUKA 1L0VB 3E9SA 3SFEB 2G9HD 5FR3A 4N6EB 3VR9B 3AEBB 4L1BA 2WXLA 1ZPSA 3NVZA 1UGJA 1FNUA 1HQRD 2PVOD 2MEKA 1SE2A 1JQ4A 3RPFC 3AECB 4WWMA 1D4BA 2WLBA 1GAQB 1MPEA 1FM0D 5HG2A 3UI3A 1FCCC 2FE8A 1L6VA 1QT9A 2SEBD 4IDIA 4ARCA 2J53A 1GB1A 3MHZA 2BYTA 3HVDA 4HKZE 3Q8BA 4C56C 2IDYA 1HA5A 3Q8CA 4LLGM 2WXFA 1EU4A 1F0ZA 1J7CA 1I4GA 1ZXIA 3AE4B 3FILB 2I38A 4KGRA 4YWGG 1YQ3B 4US8A 3RFZB 1SSNA 4DXGA 1ET9A 3P42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MEK A; 
#chains in the Genus database with same CATH topology
 3KUZ A;  5E6O A;  4MGK E;  1BUI C;  2CJO A;  3FAH A;  2LUE A;  2KTR A;  1WJ4 A;  3C8Y A;  4II2 B;  2FAZ A;  2LVO A;  3ZNZ B;  3ZNG C;  3EC8 A;  1IBX B;  2JUO A;  2BTE A;  3LYY A;  2QIE B;  2NR2 A;  4WIP A;  4MEM A;  3UIP B;  5BMG A;  5E6P A;  2MCN B;  3LXF A;  3VAW A;  3KQ4 A;  4II3 B;  1Y56 A;  5FR6 A;  5IN7 A;  3H1U A;  3AEF B;  1V5T A;  3NVW A;  4HCN B;  1KRH A;  4ZOH C;  4HRS A;  3RCZ A;  4NAM A;  2K8B A;  3DOW A;  2MLB A;  2ON8 A;  3M62 B;  1WJ6 A;  2WU5 B;  2RDG A;  3N20 C;  3DBR B;  1F9J A;  1NEK B;  2ZZP B;  1TGZ B;  3VUX A;  3NUH B;  2IJ0 A;  2LJ5 A;  3A9K B;  1WJN A;  3W2D A;  3NVV A;  4RCO A;  2E6X A;  3IHP C;  1D6E C;  4XDD A;  1P3Q U;  2GMI C;  4XE0 A;  3Q8F A;  1PUT A;  1ZDV A;  1YOV B;  1EF1 A;  3VH4 B;  4A90 A;  2KFJ A;  3QQ8 B;  4AP4 C;  2PTL A;  2QIL A;  2X8X X;  3VVW B;  5EE3 A;  1UNS A;  3BY4 B;  1K8R B;  1I4H A;  2D5G A;  4MDK E;  4EZL A;  3PRE A;  3ZDM C;  4RGM A;  3VR8 B;  3TL5 A;  2NS5 A;  1EO6 A;  3Q3F A;  3AE6 B;  4C7Z A;  1RFA A;  4FA6 A;  2KKC A;  4LJO B;  3BYY B;  2WX0 A;  2SAK A;  2PPH A;  1WIA A;  3PZ7 A;  2MQJ A;  1EWY C;  3A9J A;  4YSX B;  2CR5 A;  3Q3N C;  1F2R C;  1NEN B;  1V1O A;  3TBL D;  2FNJ B;  1KM7 A;  3AMZ A;  1UBI A;  2AL6 A;  4HWI B;  3BVM A;  4TV3 A;  3GZN B;  3PRP B;  4HPM B;  4WWP A;  1B1Z A;  3VQI A;  2LEK A;  3AUL A;  4NQK E;  3H6N A;  3ZVV A;  1LM8 B;  3NVY A;  4HDQ A;  2KQS A;  1ZGU B;  1A70 A;  4OW0 A;  4BVU C;  1YN3 A;  3AED B;  3P4Q B;  2KDB A;  1CJE A;  1WXM A;  1I4Q A;  3CST A;  3TMP B;  5GXG B;  5J17 A;  4MH0 E;  2ZPN A;  4ANW A;  2LXC A;  3U30 A;  1NI3 A;  1VZ8 A;  1OGW A;  4J3O D;  1WGH A;  5D7G A;  4I6L B;  3BIN A;  4L23 A;  4RMA A;  1MVK A;  4I6P A;  4KGS A;  1WMH A;  4EZJ A;  3AE1 B;  1FRR A;  1WR6 E;  2FUG 1;  1JRO A;  1E8Y A;  4K7U A;  1EWC A;  1E7U A;  2K25 A;  1EUV B;  4X57 B;  3ZDT A;  2K6Q A;  1WE6 A;  4WJO A;  3APD A;  2N4F A;  4OHJ A;  4Q2J A;  4TSS A;  3NOB A;  3PTF C;  3WAL A;  2MJE A;  1KTK A;  2FID A;  2O2V A;  4E74 A;  4W9E A;  4C4V B;  1WGR A;  5J18 A;  4ZRP A;  1P98 A;  3BVG A;  2MWS B;  2AQ1 B;  2N9L A;  2LWP A;  5IAA C;  4KZC A;  2BW2 A;  3ZJU A;  1YMH E;  3DVN U;  4A3P A;  4CHK A;  3ML8 A;  3V6E B;  4LCD E;  2FCN A;  1GNU A;  3VUW A;  1OQR A;  3SHQ A;  1PDX A;  2BVC A;  1WX8 A;  3Q3J A;  3W5V B;  5DPW A;  4KSK C;  4K7W A;  2NMQ A;  1OQQ A;  1C76 A;  2PJH A;  2MW5 A;  4P6V F;  4RF0 A;  4XWT A;  1I42 A;  2IGH A;  5C2T B;  1WXQ A;  1R4M B;  1D3Z A;  4IC7 B;  2NBU A;  3P4R B;  3AE9 B;  1NBF C;  2IBI B;  3GZN I;  1N63 A;  5LNK 1;  3QAR A;  2Z0E B;  1V1P A;  3O13 A;  3DVG Y;  5GMV A;  2M4N A;  1KF6 B;  3T8M A;  4BKG A;  2D3C A;  3FC4 A;  1TKG A;  1TTN A;  4BOZ B;  2NCN A;  2WDQ B;  4LK0 M;  1RM6 C;  1WH3 A;  2I2Y A;  3MJW A;  1ACC A;  4C80 A;  4FHK A;  4NAW A;  2LGD A;  3KW5 B;  3RNF C;  3P1M A;  4W9G A;  2BWF A;  2JXX A;  2Y3A A;  2Z8L A;  1C4A A;  3V3X A;  4URK A;  1OEY J;  1WY8 A;  4DHJ B;  2RDH A;  1H4R A;  3DBH I;  1WZ3 A;  5CHF A;  1PGX A;  3Q8A A;  3SU8 X;  4H2A A;  1Q1O A;  2Z59 B;  2K22 A;  4YTM B;  2LGY A;  4RGN A;  1TBE A;  4PYU A;  3MJ5 A;  4DHJ D;  2ZPY A;  2O6V A;  4CQN A;  1L0X B;  3EUB 2;  1F1H A;  2DZK A;  3EGR A;  5BO4 B;  4RNA A;  4NJC A;  4N58 A;  1XQQ A;  2XEW A;  4XZ4 A;  1SJH D;  1FFU A;  4US9 A;  3Q6B A;  3RYT A;  1P7E A;  4S17 A;  2A4Z A;  2CHZ A;  2CHW A;  2IND C;  3M95 A;  2Z0D B;  1D5X C;  3RNG C;  3KYD D;  3SD5 A;  1WR1 A;  4JL9 A;  3P63 A;  3KUD B;  3MC9 A;  3AEG B;  2IY1 B;  5IA7 A;  3ZYY X;  4N59 A;  3VTV A;  4RM9 A;  2JRH A;  4WJN A;  4IW0 A;  3RZW C;  1WXA A;  1XT9 B;  3ZIM A;  2IY0 B;  4N6E B;  3AEB B;  1V81 A;  1Z2M A;  1R4M I;  2M1M A;  2G3Q B;  2MRP A;  1ZPS A;  3NVZ A;  3PV1 A;  1FNU A;  3R66 C;  2MEK A;  3RPF C;  4WWM A;  2ZCC A;  5HG2 A;  2FE8 A;  2SEB D;  1GC6 A;  5JHA A;  3MHZ A;  3B08 A;  5AZG A;  1HA5 A;  3VDZ A;  4LLG M;  1RRB A;  2WXF A;  1F0Z A;  2L3Z A;  3FIL B;  4FN2 A;  4KVG B;  1YQ3 B;  4WWN A;  4K3B A;  1GUA B;  2JRI B;  1VCB A;  1SSN A;  4DXG A;  5FK9 C;  2LHE A;  4DDI D;  4TQ0 A;  4BAX A;  3QK0 A;  2V9H A;  4EKU A;  4EEW A;  2MP2 B;  4PS3 A;  2MX2 A;  3IFW B;  4JPS A;  3AE8 B;  2N7E A;  2KWU B;  2J52 A;  4PYZ A;  1C4P A;  4MSM B;  2R61 A;  3PVL A;  4MGI E;  3AE5 B;  3VRB B;  2HD5 B;  2OJR A;  3QAQ A;  1WFY A;  2WXG A;  3B9J A;  2PW9 A;  1K53 A;  4N9F 4;  3ZLZ A;  1S1Q B;  2BYF A;  1S3S G;  3RZF A;  3C19 A;  1VZ6 A;  4JX1 C;  1GB4 A;  3N3K B;  1BML C;  4KIK A;  2JZP A;  2LJI A;  2WXJ A;  4A9A A;  1FO4 A;  3R2I A;  3MC8 A;  2AYO B;  2BS3 B;  1TKY A;  1Z5S B;  4RGO S;  2EEL A;  2L1A A;  1EF5 A;  1IGC A;  2BB6 A;  2ZCB A;  4W9F A;  1XF5 L;  3ZXR A;  1UD7 A;  1LFD A;  3K9P B;  1I35 A;  2KVZ A;  4A55 A;  2K9X A;  2M19 A;  3OJ3 A;  2E3T A;  3N9Y C;  2TSS A;  1WGY A;  5LXI B;  2LHD A;  3IAS 1;  1V49 A;  5FKA C;  5D94 A;  4LNI A;  3KLS X;  4IUM B;  3B1L X;  1WWT A;  4W9H A;  3B2G A;  2LGX A;  1TZO A;  2N1V A;  1N6Z A;  3L13 A;  3AH7 A;  5HHD G;  4KKI A;  3L10 B;  1BXT A;  2V3P A;  4P1C C;  4WH4 A;  3VRA B;  4FAD A;  1HTQ A;  3NS8 A;  2NBV B;  2JY6 A;  1XLP A;  2YEP F;  4AS1 A;  1I7H A;  4AOF A;  2ZEQ A;  2BS2 B;  3WCQ A;  2N9K A;  2ZW0 A;  3N1Y C;  3ZKJ C;  2J0J A;  2LVP A;  4MH8 A;  4BBN C;  2ICI A;  2LXA A;  2JQR B;  1K51 A;  1VZ7 A;  2C5L C;  1TT5 B;  4MGY E;  4IOI E;  2L32 A;  1RAX A;  3S2A A;  3A4S C;  4RM8 A;  4HJG E;  2KDF B;  2QEJ C;  3AI5 A;  2R2O A;  3DVN V;  4HVB A;  3N30 A;  3AE3 B;  2KWV B;  4KV2 A;  3GP7 A;  2IGG A;  5AEK B;  4GGQ A;  4LNN A;  2GRI A;  1YIW A;  2AL3 A;  5H8Y E;  4RGT A;  2GBR A;  3U8Z A;  2JZ3 B;  2IGD A;  4ZRJ A;  4ZDV A;  4KX6 B;  2LAS A;  3M3J A;  1FRD A;  2HTM E;  3WAO A;  2NBW B;  3PLU A;  2MSE D;  4DBG A;  2D2Q A;  3H7P A;  2W55 A;  1N5X A;  2M8S A;  3NRZ A;  4GDK B;  1T3Q A;  1J7A A;  4EUT A;  1T0S C;  1GJZ A;  5HI1 A;  1XLN A;  2XK5 B;  2UYZ B;  2OOB B;  1HXY D;  2HJ1 A;  3CSF A;  4W9D A;  3HRD D;  4IM2 A;  5HKH A;  1YNT E;  4BOS C;  1ZW7 A;  3GE8 C;  4K1R B;  4AJW A;  5DPS A;  4NJ7 A;  3RT3 B;  4B0M A;  4B95 A;  3ZGZ A;  2N9P C;  4IWQ A;  4DWF A;  2N9E B;  5DPT A;  5T8I A;  2J0M A;  3PPA A;  1FNW A;  3NZU A;  1Q0W B;  5JXV A;  2ZW1 A;  4ICU A;  2V1Y A;  3M63 B;  2JSV X;  3MC0 B;  4C4V A;  5L83 A;  1HEZ E;  4TQ1 A;  4FLH A;  2KJ6 A;  3WAP A;  4ICV A;  3PZD A;  2IYD B;  3ETR A;  4ZYS A;  3AXC A;  4L2Y A;  1MI0 A;  2Y5B B;  2KHW B;  3W1S A;  2JXT A;  2L00 B;  1JWB D;  2NPT A;  4FJY A;  4HPP A;  3T3N A;  3WIM A;  1OTR B;  4A3O A;  4KGT A;  3L54 A;  2BB5 A;  4KDI C;  1UH6 A;  3PGE A;  3W9C B;  1GC7 A;  4KZ0 A;  3APC A;  2DLB A;  5G5G A;  2K5P A;  3ZRC A;  4MM3 A;  2KYW A;  1FXA A;  2ZVN A;  3AE2 B;  3DHG C;  2PVG C;  1LXD A;  3BYT B;  4F7Z A;  2JZZ A;  2MJD A;  1WGG A;  2L76 A;  1WX7 A;  4BKS D;  2AX5 A;  3Q8E A;  1TY0 A;  4ACF A;  3UGB B;  1PQS A;  3SEB A;  5AUI A;  3IBE A;  3QCA A;  1KJT A;  3WAM A;  3TUO A;  1WF9 A;  3ZW3 A;  3BVZ A;  1TS2 A;  2WXN A;  3HM3 A;  1SXT A;  4F8C B;  2GBM A;  3OAW A;  5D3D A;  1WRD B;  4HDO A;  2NVU I;  2KTF A;  3OG5 A;  1KOT A;  4AJY B;  1V97 A;  2DHZ A;  2LRU A;  3L17 A;  1YX6 B;  2EMS A;  3ZNI D;  4MAC A;  1DOI A;  2RPQ A;  3B0A A;  2JPH A;  4YTP B;  4DXF A;  2VZK B;  4LTU A;  1P0R A;  3AU4 A;  5DPR A;  1SE4 A;  2WP9 B;  3WAN A;  1F77 A;  4GDL A;  2RDB C;  4F1S A;  1C3T A;  4EOY A;  4REZ A;  4OVZ A;  4NY0 A;  2HJ8 A;  4A8X C;  3DBH B;  4K81 A;  1WYG A;  2YVC A;  4ANU A;  2QMT A;  3TEX A;  4WAF A;  2LI5 A;  4OZA A;  5TR5 A;  3A1Q A;  5C23 A;  3PRM B;  3ZUN A;  1SIF A;  4DDG D;  2CS4 A;  3QJZ A;  1D5M C;  4B9K A;  4KKJ A;  3ZJV A;  3Q3O C;  4HXD A;  1T0Y A;  2RSU A;  2LMC A;  1E9M A;  2ACZ B;  2VZK D;  4M0W A;  2FIF A;  3JSV A;  1QKZ A;  5CHV C;  3I3T B;  3HHM A;  3VFK A;  3PHW B;  3RUL A;  2WXP A;  2FUH B;  1AW7 A;  3DQV A;  4KDL B;  4ZYN A;  1TY2 A;  3HUI A;  4MT5 A;  4YTN B;  3EFC A;  1N61 A;  1IPG A;  4J6I A;  5G55 A;  1V2Y A;  1DYQ A;  4IM0 A;  3TIX A;  3U4E G;  3VUY A;  2FCM A;  3ZXV A;  1OFF A;  3EFU A;  4USA A;  2AWT A;  3CMM B;  3QWZ B;  1E8W A;  2AQ3 B;  3QHT A;  2C7N B;  2WXQ A;  2L7R A;  3VHT C;  3DVG X;  1DGJ A;  3DBL I;  4ASW C;  2M0X A;  3ABV B;  3KUC B;  1WE7 A;  5AUK A;  4JLC A;  3DHH C;  1X1M A;  3H7S A;  3VR9 B;  3X0W A;  4OVV A;  5LXH A;  1WX9 A;  4L1B A;  2WXL A;  1E8X A;  1TIF A;  1UGJ A;  1HQR D;  2PVO D;  1SE2 A;  1G6J A;  4S0R A;  1FM0 D;  1FCC C;  1L6V A;  1QT9 A;  4IWO A;  2J53 A;  5JH5 C;  2G4D B;  2BYT A;  2IO2 B;  2D11 A;  3RD2 A;  4E3C A;  2IDY A;  3OLM D;  4WAA A;  5AZH A;  1L2N A;  2J7Q B;  4YWG G;  2UWQ A;  2CKH B;  4GIV A;  3ZRF A;  3AEA B;  2BF8 B;  3AB5 A;  4NZL B;  2REX A;  2WQY B;  3H9D A;  1PGB A;  3PO0 A;  1ZXH A;  5BYS A;  1QIL A;  4HJK A;  2N7D A;  2KJR A;  4HK2 A;  3ENE A;  4ZRQ A;  3JVZ X;  3PRZ A;  1L4Z B;  5KHQ A;  1ZKH A;  1T5X D;  1Q5W B;  1SIJ A;  1AYF A;  4M8M A;  3OWE B;  4LNO A;  3IT4 B;  2DAJ A;  1QF6 A;  2B76 B;  4FJV B;  3UQB A;  1Y8R C;  1TKE A;  3NS1 A;  5HFY A;  3L08 A;  3WA0 A;  3RI7 C;  1L5P A;  2MBB B;  2JYT A;  1N5W A;  3R7R A;  3NJT A;  3IXS A;  2VH2 A;  1R4N I;  1CQV A;  3L4P A;  1TS4 A;  1XCT L;  2KVR A;  2LRW A;  1RFK A;  1WI0 A;  3IT6 B;  1MG4 A;  3KYC D;  1SBB B;  5CX3 A;  1P7F A;  5D3I B;  5BMH A;  2N7J A;  2BBC A;  2JX5 A;  4XGA B;  2KT7 A;  1A5R A;  4C00 A;  4MJS A;  3VXW A;  2L0T A;  1L4D B;  1VRA B;  4YL8 A;  3ZQ4 A;  3CF6 E;  1ET6 A;  3ZO5 B;  1C79 A;  1OQY A;  4HLE A;  4G3X B;  1C77 A;  4G50 A;  1R7S A;  3QC8 B;  3DWM A;  3KVF B;  1B9R A;  3J9C A;  2ZNV C;  3GB1 A;  1PGA A;  1DOY A;  2WXH A;  1I4X A;  2KMA A;  2L05 A;  2KN4 A;  4WWO A;  2DX5 B;  4ANV A;  1XXG A;  1UUP A;  3W5U B;  1WM3 A;  1JWS D;  2EMT A;  2MBQ A;  4PK1 A;  2A5U A;  3KH0 A;  5BYQ A;  5G5H A;  1KLG D;  2ZNV B;  1YQB A;  2W82 A;  1GOZ A;  3BZD B;  2JT4 B;  3GE3 C;  5IO9 A;  1IBX A;  4XYC A;  5H92 C;  2BQQ A;  3N1Z C;  3ZNH B;  4JWU C;  3ML9 A;  4JE3 B;  2XK5 A;  1U4A A;  3L0W B;  2DBY A;  3U52 E;  5C1Z A;  2WNM A;  2BS4 B;  1NYQ A;  4ZRK A;  4HKQ A;  3I57 A;  2GBN A;  2B3A A;  2JF5 A;  4GN1 A;  3TEW A;  2JWZ A;  2WXO A;  1SB3 C;  2MH7 A;  2RD0 A;  2INN E;  2K0P A;  2KDM A;  3DHI C;  3JW0 X;  3R3M A;  3Q14 C;  1YN4 A;  4XC2 A;  1WSP A;  3DPD A;  2DYO A;  2GBK A;  2YEP B;  1TYG B;  3MFG A;  1IP9 A;  3H8H A;  4A6Q A;  3NG0 A;  2L83 A;  3A9K A;  3ECI A;  1KLU D;  1AAR A;  2WHI A;  1FIQ A;  3HIZ A;  4OZB A;  4RH6 A;  3UQA A;  4WUR A;  1E0Z A;  2WDT B;  4BKT A;  1OEY A;  1FMA D;  3URY A;  1WRI A;  2G1E A;  5E6J A;  3ZJT A;  3KWL A;  4P7I A;  1ZDX A;  3RNC C;  2KWC A;  2MBE A;  1ISN A;  4M00 A;  1E8Z A;  1T6B X;  3MP9 A;  3V60 A;  2LZ6 A;  1QOF A;  1VD2 A;  4DXA B;  2YLM A;  2FBW B;  4KSL C;  1JWA D;  1WGD A;  1IYF A;  1I4P A;  2QSD A;  4IWP A;  1FPY A;  4OZC A;  4JWS C;  1E7P B;  2WYQ A;  3V62 A;  5CHW A;  3AM9 A;  1SE3 A;  3RNB C;  4GOC A;  2M56 B;  4WQM A;  3R7Q A;  3CIR B;  4OVU A;  1N60 A;  3EHV A;  5EE9 A;  2GOW A;  2KC1 A;  2KJH B;  2N0S B;  1AWD A;  2RPV A;  2MJ3 A;  1Q10 A;  3GOE A;  2MA9 B;  3RUI B;  3V6C B;  2DZJ A;  2PKO A;  1TS3 A;  4B6W A;  1HTO A;  2KLG A;  1ZP0 B;  1J8C A;  4MGZ E;  2CU3 A;  2K39 A;  2V4I B;  1CK1 A;  5L95 C;  1J0G A;  3SR6 A;  2RGF A;  2H89 B;  4D2K A;  1TJE A;  2AQ2 B;  2Y5P A;  4W9L A;  3RN9 C;  4ZHO A;  1SE9 A;  3Q69 A;  2KNB A;  5BYR A;  3HM6 X;  3DWG C;  4NNJ B;  1NDD A;  4LNK A;  1JRU A;  2IO0 B;  1WM2 A;  1NI2 A;  4IM3 A;  2LGS A;  1PYW D;  2MBO A;  1HZ6 A;  2WX1 A;  4MSQ B;  1RWS A;  1K50 A;  4O1N A;  2BKR B;  4W9C A;  1QQR A;  3APF A;  1WYW B;  2DYB A;  2DWQ A;  2K3U A;  1FFV A;  1MJD A;  4TUU A;  1C1Y B;  3V05 A;  1L7Y A;  3BWU D;  4KIK B;  4E71 A;  2KAJ A;  2JVC A;  2CHX A;  2MHJ A;  3LB8 C;  4PS7 A;  4BBN F;  3K9O B;  1SEB D;  3HVZ A;  2KMM A;  2QC8 A;  2KDI A;  1WXS A;  2H88 B;  1CZP A;  1JWU D;  3ZTD A;  2V0G A;  2RMM A;  1P9D U;  4W9I A;  2KX0 A;  1UF0 A;  3GS2 A;  3KWV A;  2R2Q A;  4W9J A;  3NZ3 A;  4RF1 A;  3Q2A C;  1WZ0 A;  2V4L A;  1MHX A;  2WDV B;  4M8N A;  1SGH A;  4PT5 A;  3DBL B;  3ONS A;  4G11 A;  1J7B A;  1FD6 A;  3T9L A;  1T0Q C;  2V3N A;  5KHO A;  1L0V B;  4JGH B;  3E9S A;  3SFE B;  2G9H D;  5FR3 A;  1YJ1 A;  2I1J A;  3JYU A;  4PS8 A;  2BWE S;  1D4B A;  2WLB A;  1GAQ B;  4ZRI A;  1YX5 B;  4IDI A;  4WJP A;  3RNE C;  2BGF A;  2VRR B;  3LJ3 A;  4HKZ E;  3Q8B A;  4C56 C;  5E6N A;  3Q8C A;  4FJZ A;  1J7C A;  1ZXI A;  4M02 A;  2I38 A;  4KGR A;  3RNA C;  5IOI A;  3DCG A;  4US8 A;  2KFK B;  2J0K A;  3RFZ B;  3PT2 B;  4M01 A;  1ET9 A;  3P42 A;  2ONQ A;  3PHX B;  3C0R B;  2PLP A;  2BT6 A;  3TJP A;  4CYE A;  2JU6 X;  2PMV A;  3LDZ E;  5JZE B;  1IUE A;  4IKG A;  3AV8 A;  2LUM A;  1EU3 A;  2KTR B;  4LJP B;  2OED A;  4HCP B;  3VTW A;  3QX1 A;  1FNV A;  2I1K A;  2JYE A;  1XLQ A;  3AN1 A;  1DOX A;  3H7P B;  3QA8 A;  2W3S A;  2OJW A;  4K3C A;  3R8B A;  1QZE A;  4TMA B;  2RR9 A;  2KDE B;  1ROE A;  4GU2 A;  5CTR C;  2W3R A;  4DQO C;  1XD3 B;  1JCK B;  3DBR I;  4JIO U;  3PSE B;  1JWM D;  4A20 A;  4YXD B;  1ZOY B;  4FXC A;  4GMV A;  1YD8 U;  1R4N B;  1UWM A;  4DHZ E;  1MG8 A;  1D5Z C;  1MFW A;  2XN9 C;  2CJN A;  2D3G A;  3W1S C;  3U2S C;  1JW9 D;  3CWI A;  3P4S B;  4YT0 B;  1V9J A;  1K52 A;  1VR9 A;  3ZTC A;  3EA6 A;  1E7V A;  4HRO A;  5J2R A;  5BMI A;  2IZV B;  2INP E;  2NPT B;  2IO1 B;  3D32 A;  2BPS A;  5TSS A;  4FUL A;  1QOA A;  3I5J C;  4YSY B;  4G0N B;  2PEA A;  1GG3 A;  5IKC M;  2WS3 B;  2WU2 B;  2NTT A;  2WXM A;  4EFO A;  2QCZ A;  2KOX A;  1STE A;  1WJU A;  2BYE A;  2KX3 A;  2OHF A;  3FIL A;  3PZ8 A;  4MM3 B;  1EM7 A;  1TS5 A;  2K8C A;  2L52 A;  4P1B C;  4XX5 A;  2HDE A;  3HK0 A;  3NZS A;  4K7S A;  3BII D;  1V80 A;  3X23 A;  3TSS A;  3A4R A;  3MHS D;  2PIA A;  4DHZ B;  2MP2 A;  2N9X A;  1L6U A;  2W54 A;  1SF0 A;  3BK1 A;  1UBQ A;  3B2F A;  1F52 A;  3SDL C;  2XNA C;  3A9J B;  1XEE A;  2V3S A;  3FKY A;  1GPX A;  4IG7 B;  2C7H A;  3T3O A;  1VLB A;  3N1X C;  1XO3 A;  2KQ4 X;  3Q3M C;  2WXR A;  3IAM 1;  5MPO A;  4LDT B;  3P4P B;  1V5O A;  2KC2 A;  1JRP A;  1QOB A;  1F2R I;  2KAC A;  3UF8 A;  3U7D A;  2WDR B;  4NJ6 A;  2QJL A;  4AQ7 A;  2G45 B;  2D10 A;  1NYR A;  1BT0 A;  1KH0 A;  1RYJ A;  1V6E A;  2KAN A;  2KN5 A;  1QOG A;  1YJJ A;  4ITK A;  3TEY A;  4TKN A;  1KLV A;  2MBH A;  3QIJ A;  2LD9 A;  3RMK C;  2GLS A;  2ZJD A;  4LDT D;  3NHE B;  4R3D A;  2WGS A;  4GDL B;  2INC C;  3IG3 A;  3SFD B;  2HTH A;  2PE6 B;  1VDV A;  3A1Q B;  3DBS A;  1L0Y B;  2N1W A;  3I9V 1;  1VJK A;  1HE8 A;  2DZI A;  1JML A;  2DYM A;  2FCS A;  4M0W B;  2EKE C;  1WMH B;  3JSV B;  2KQ7 A;  2L0F A;  3TEZ A;  1UZX B;  4NQL B;  2K8H A;  3P2B A;  1UWX A;  5C3J B;  1E6E B;  2KXJ A;  2D07 B;  3DDC B;  1YN5 A;  4NPN A;  1YQ4 B;  4BFR A;  4XDC A;  2Y5C A;  4C7Y A;  5I4D A;  2BKF A;  4YSZ B;  2O2V B;  1N62 A;  2DAF A;  2LGI A;  4BZA A;  1PFD A;  1YJI A;  2GI9 A;  3EEC A;  2M0A A;  1P1A A;  1SJE D;  3N32 A;  2W9N A;  2WXI A;  1ENF A;  4RFB A;  1KFY B;  5IP4 D;  2ZVO A;  1NVI D;  2HE7 A;  3U7Z A;  1CMX B;  4W9K A;  1M94 A;  3AE7 B;  1C4C A;  1C9F A;  2GB1 A;  4XWW A;  3E56 A;  2X38 A;  2EKI A;  4MEL A;  3PLV A;  3V61 A;  1E10 A;  2KLC A;  4GSW A;  2J4X A;  2D3B A;  2K1F A;  2WXK A;  3W1Y A;  1I4R A;  4ANX A;  5EE1 A;  1T0R C;  1TZ1 A;  2WWZ A;  5EDS A;  4I6N B;  2C7M B;  1C78 A;  4EE2 A;  1V86 A;  1MHH E;  1ZE3 D;  1LO5 D;  3MTN B;  4GDK A;  2D3A A;  2DNF A;  4UDU C;  1JAL A;  1V1P B;  1FCL A;  1FXI A;  2L8J A;  3R2T A;  2LFI A;  3AU5 A;  1IGD A;  3UIO B;  1M4V A;  2QDF A;  2ASQ A;  2UU7 A;  4CO7 A;  2C60 A;  3A33 B;  4NAW B;  1FEH A;  2KK8 A;  1ZUD 2;  1AN8 A;  3IVF A;  4ZHP A;  2IPK D;  4AUQ C;  1H8C A;  2KO3 A;  2NTS A;  3VH3 B;  1E90 A;  3VTU A;  3NY5 A;  4FHJ A;  3ALB A;  1XLO A;  5DCN A;  1HZ5 A;  3L16 A;  5G2N A;  2Q5W D;  2C9W B;  1FXT B;  4DK5 A;  4GB9 A;  1QLB B;  4GLS C;  2XBB C;  3UIN B;  3OJ4 B;  2BYV E;  3BK2 A;  3PS6 A;  5JHB A;  1LQB A;  2FCQ A;  4AWJ A;  4HPL B;  2O6V B;  4GXB A;  1XCQ L;  1E5W A;  4LNF A;  1RLF A;  4BKS A;  1V8C A;  1UEL A;  1WGK A;  2DZM A;  1LGR A;  2JWU A;  2QHO A;  4WJQ A;  4WQO B;  2KMC A;  2J42 A;  4QAY A;  2G4S A;  4P16 A;  5EE0 A;  1UGM A;  1ESF A;  2VH1 A;  3O65 B;  2KZR A;  2O6V D;  4ARI A;  5AZF A;  1J19 A;  2KWD A;  2AEH A;  5LLI A;  3AEE B;  4FBJ B;  4B0E A;  4HEA 1;  5D6J B;  2KD0 A;  4EZK A;  4MJS B;  2LVQ A;  1JQ4 A;  1WXV A;  3AEC B;  1MPE A;  3UI3 A;  2CU1 A;  4ARC A;  3TCA A;  2K6D B;  1GB1 A;  3I63 C;  3HVD A;  4JQW C;  2KFK A;  2M17 A;  1EU4 A;  1I4G A;  3AE4 B;  2GBJ A;  5D2M B;  2DEN B;  2PE9 A;  2IO3 B; 
#chains in the Genus database with same CATH homology
 2ONQ A;  5FK9 C;  2LHE A;  3AEA B;  4TQ0 A;  1BUI C;  2PLP A;  3AB5 A;  2BT6 A;  4NZL B;  2CJO A;  3FAH A;  2WQY B;  2JU6 X;  2PMV A;  3C8Y A;  1PGB A;  3PO0 A;  4JPS A;  1IUE A;  1ZXH A;  4IKG A;  3AE8 B;  5BYS A;  3AV8 A;  2LUM A;  1QIL A;  2J52 A;  1IBX B;  1EU3 A;  2BTE A;  1C4P A;  2R61 A;  4ZRQ A;  2OED A;  3LYY A;  3AE5 B;  3VRB B;  1L4Z B;  2QIE B;  2WXG A;  4WIP A;  3B9J A;  1FNV A;  2PW9 A;  2JYE A;  1XLQ A;  1K53 A;  5BMG A;  1T5X D;  1SIJ A;  1AYF A;  3AN1 A;  3LXF A;  1VZ6 A;  3KQ4 A;  4JX1 C;  3OWE B;  1GB4 A;  3IT4 B;  1QF6 A;  1DOX A;  1BML C;  2B76 B;  1Y56 A;  2JZP A;  2LJI A;  2W3S A;  2WXJ A;  1TKE A;  3NS1 A;  3R8B A;  4A9A A;  1FO4 A;  5HFY A;  3AEF B;  3R2I A;  4TMA B;  2BS3 B;  3NVW A;  1TKY A;  1KRH A;  1L5P A;  1ROE A;  4HRS A;  4ZOH C;  4NAM A;  2JYT A;  1N5W A;  2ON8 A;  4RGO S;  2EEL A;  2W3R A;  4DQO C;  1JCK B;  2WU5 B;  3IXS A;  2L1A A;  1IGC A;  2BB6 A;  2RDG A;  1JWM D;  4YXD B;  1XF5 L;  1ZOY B;  1CQV A;  3L4P A;  1TS4 A;  4FXC A;  1XCT L;  1UWM A;  4A55 A;  1NEK B;  1D5Z C;  2K9X A;  1RFK A;  2M19 A;  2E3T A;  2XN9 C;  2CJN A;  3NUH B;  3IT6 B;  2IJ0 A;  3N9Y C;  2TSS A;  1SBB B;  3U2S C;  1JW9 D;  3CWI A;  3P4S B;  1P7F A;  2LHD A;  3IAS 1;  5FKA C;  3W2D A;  4YT0 B;  3NVV A;  4RCO A;  5D3I B;  5BMH A;  2N7J A;  2E6X A;  3KLS X;  1K52 A;  1D6E C;  2BBC A;  1VR9 A;  2JX5 A;  4XDD A;  1WWT A;  4XE0 A;  3Q8F A;  3B2G A;  3EA6 A;  1PUT A;  1ZDV A;  1TZO A;  4HRO A;  1L4D B;  1VRA B;  3AH7 A;  5HHD G;  4KKI A;  5BMI A;  1BXT A;  3ZQ4 A;  2V3P A;  4WH4 A;  4A90 A;  3VRA B;  2INP E;  1ET6 A;  1C79 A;  2PTL A;  2QIL A;  5TSS A;  5EE3 A;  1C77 A;  1QOA A;  1XLP A;  1R7S A;  1UNS A;  2YEP F;  4YSY B;  1I4H A;  3DWM A;  4AS1 A;  2D5G A;  1I7H A;  2WS3 B;  2WU2 B;  1B9R A;  3J9C A;  2NTT A;  2BS2 B;  2WXM A;  3WCQ A;  4RGM A;  3VR8 B;  2N9K A;  1STE A;  3GB1 A;  2ZW0 A;  1PGA A;  1DOY A;  2WXH A;  1I4X A;  4MH8 A;  2OHF A;  2ICI A;  3FIL A;  2JQR B;  3PZ8 A;  4MM3 B;  1EM7 A;  1K51 A;  1TS5 A;  2L52 A;  1VZ7 A;  2KN4 A;  3AE6 B;  2HDE A;  4C7Z A;  1XXG A;  1UUP A;  3BII D;  4IOI E;  3W5U B;  2L32 A;  3BYY B;  2SAK A;  1JWS D;  4HJG E;  3PZ7 A;  1EWY C;  5BYQ A;  3TSS A;  2QEJ C;  4YSX B;  5G5H A;  1KLG D;  2PIA A;  1F2R C;  1NEN B;  1V1O A;  2W82 A;  3AE3 B;  2W54 A;  1L6U A;  3BK1 A;  1SF0 A;  1GOZ A;  3BZD B;  3B2F A;  2IGG A;  3GP7 A;  2GRI A;  2XNA C;  3AMZ A;  1XEE A;  1IBX A;  1GPX A;  3BVM A;  3T3O A;  5H8Y E;  1VLB A;  1XO3 A;  4RGT A;  5H92 C;  2KQ4 X;  2WXR A;  3IAM 1;  1B1Z A;  5MPO A;  3VQI A;  2LEK A;  3P4P B;  2IGD A;  4KX6 B;  3NVY A;  4JWU C;  1FRD A;  1JRP A;  1F2R I;  1QOB A;  2KAC A;  2HTM E;  1A70 A;  4JE3 B;  4OW0 A;  2WDR B;  2W55 A;  2DBY A;  2QJL A;  3U52 E;  2WNM A;  4AQ7 A;  1N5X A;  3NRZ A;  1YN3 A;  1NYR A;  3AED B;  1T3Q A;  1KH0 A;  1RYJ A;  2BS4 B;  4GDK B;  1J7A A;  3P4Q B;  1CJE A;  1QOG A;  1NYQ A;  1YJJ A;  5HI1 A;  4ITK A;  3TEY A;  4HKQ A;  1XLN A;  3I57 A;  1I4Q A;  1HXY D;  3TEW A;  2WXO A;  5GXG B;  1SB3 C;  2MH7 A;  2INN E;  3HRD D;  2K0P A;  2KDM A;  4R3D A;  4GDL B;  1NI3 A;  1YNT E;  1VZ8 A;  1YN4 A;  3SFD B;  4J3O D;  5D7G A;  1VDV A;  1WSP A;  4B0M A;  2DYO A;  3ZGZ A;  4L23 A;  2YEP B;  1TYG B;  3MFG A;  1MVK A;  3H8H A;  4A6Q A;  4KGS A;  5T8I A;  2L83 A;  1L0Y B;  1KLU D;  3I9V 1;  3AE1 B;  1VJK A;  1FRR A;  1FNW A;  2FUG 1;  1JRO A;  1EWC A;  1FIQ A;  1JML A;  2DYM A;  5JXV A;  2ZW1 A;  4OZB A;  4RH6 A;  4WUR A;  1E0Z A;  2JSV X;  3MC0 B;  3TEZ A;  1HEZ E;  4OHJ A;  4TQ1 A;  1FMA D;  3URY A;  4Q2J A;  4TSS A;  1WRI A;  2G1E A;  1UWX A;  2MJE A;  5E6J A;  3ZJT A;  3ETR A;  3KWL A;  4ZYS A;  1KTK A;  4L2Y A;  5C3J B;  1MI0 A;  1E6E B;  1ZDX A;  1YN5 A;  3W1S A;  1YQ4 B;  2JXT A;  1JWB D;  3T3N A;  4XDC A;  2Y5C A;  4ZRP A;  4C7Y A;  3BVG A;  2AQ1 B;  1T6B X;  2N9L A;  4KGT A;  5I4D A;  3MP9 A;  4YSZ B;  2BB5 A;  1N62 A;  1QOF A;  2BW2 A;  2LGI A;  3W9C B;  3ZJU A;  1PFD A;  1YJI A;  1YMH E;  2GI9 A;  2M0A A;  2FBW B;  1JWA D;  1SJE D;  2DLB A;  5G5G A;  1I4P A;  2QSD A;  2K5P A;  4OZC A;  4JWS C;  2WXI A;  1FXA A;  1ENF A;  3AE2 B;  4RFB A;  1KFY B;  1E7P B;  1NVI D;  1OQR A;  3U7Z A;  1PDX A;  2PVG C;  3BYT B;  3AM9 A;  1SE3 A;  2MJD A;  3AE7 B;  3W5V B;  1C4C A;  2AX5 A;  3Q8E A;  1C9F A;  1TY0 A;  2GB1 A;  2M56 B;  1OQQ A;  2NMQ A;  4WQM A;  4XWW A;  1C76 A;  4RF0 A;  3CIR B;  3E56 A;  4P6V F;  2X38 A;  4XWT A;  1N60 A;  2IGH A;  5EE9 A;  5AUI A;  5C2T B;  3SEB A;  1WXQ A;  2EKI A;  1E10 A;  2N0S B;  3TUO A;  1AWD A;  2RPV A;  2MJ3 A;  3P4R B;  1Q10 A;  2J4X A;  3AE9 B;  3BVZ A;  1TS2 A;  2WXN A;  2WXK A;  1I4R A;  5EE1 A;  1SXT A;  2PKO A;  1N63 A;  5D3D A;  1TS3 A;  1C78 A;  4EE2 A;  5LNK 1;  1V1P A;  1MHH E;  1ZE3 D;  1ZP0 B;  3O13 A;  1V97 A;  1LO5 D;  1KF6 B;  3FC4 A;  1TKG A;  2CU3 A;  2V4I B;  2WDQ B;  4LK0 M;  4UDU C;  1JAL A;  4MAC A;  1RM6 C;  1DOI A;  1V1P B;  2I2Y A;  1FCL A;  1FXI A;  1CK1 A;  3R2T A;  1ACC A;  4YTP B;  4C80 A;  2LFI A;  3P1M A;  3SR6 A;  2VZK B;  4DXF A;  4LTU A;  2H89 B;  1IGD A;  1SE4 A;  2Y3A A;  2Z8L A;  1C4A A;  1M4V A;  1F77 A;  1TJE A;  2AQ2 B;  2WP9 B;  2Y5P A;  3V3X A;  4D2K A;  4ZHO A;  3Q69 A;  2RDH A;  5BYR A;  4REZ A;  1PGX A;  4OVZ A;  4NAW B;  4A8X C;  3DWG C;  3Q8A A;  1FEH A;  1WYG A;  2QMT A;  3TEX A;  4WAF A;  4H2A A;  1ZUD 2;  1AN8 A;  4OZA A;  4ZHP A;  2IPK D;  2K22 A;  2NTS A;  1PYW D;  1D5M C;  4KKJ A;  1XLO A;  3ZJV A;  1HZ6 A;  4YTM B;  1HZ5 A;  2LMC A;  1E9M A;  2ACZ B;  2Q5W D;  4RGN A;  2VZK D;  1RWS A;  4M0W A;  3MJ5 A;  1K50 A;  4O1N A;  1QQR A;  1QKZ A;  1QLB B;  4CQN A;  2WXP A;  1L0X B;  3EUB 2;  4GLS C;  2DWQ A;  2K3U A;  1FFV A;  3BK2 A;  3EGR A;  3V05 A;  4RNA A;  3BWU D;  4NJC A;  4N58 A;  1AW7 A;  2KAJ A;  1XCQ L;  3LB8 C;  1TY2 A;  3HUI A;  4MT5 A;  4YTN B;  1SEB D;  3HVZ A;  2KMM A;  1V8C A;  1N61 A;  1WGK A;  2H88 B;  1CZP A;  1JWU D;  1SJH D;  2V0G A;  1FFU A;  2JWU A;  1DYQ A;  2RMM A;  4US9 A;  3U4E G;  2J42 A;  1P7E A;  4P16 A;  1OFF A;  5EE0 A;  1ESF A;  4USA A;  3GS2 A;  1D5X C;  3KWV A;  4ARI A;  2AQ3 B;  2KWD A;  3P63 A;  2WXQ A;  3NZ3 A;  4RF1 A;  3AEE B;  1DGJ A;  1MHX A;  4B0E A;  2WDV B;  3AEG B;  4PT5 A;  3ABV B;  4HEA 1;  4N59 A;  3ZYY X;  1J7B A;  1FD6 A;  2V3N A;  5AUK A;  1L0V B;  3E9S A;  3SFE B;  2G9H D;  5FR3 A;  4N6E B;  3VR9 B;  3AEB B;  4L1B A;  2WXL A;  1ZPS A;  3NVZ A;  1UGJ A;  1FNU A;  1HQR D;  2PVO D;  2MEK A;  1SE2 A;  1JQ4 A;  3RPF C;  3AEC B;  4WWM A;  1D4B A;  2WLB A;  1GAQ B;  1MPE A;  1FM0 D;  5HG2 A;  3UI3 A;  1FCC C;  2FE8 A;  1L6V A;  1QT9 A;  2SEB D;  4IDI A;  4ARC A;  2J53 A;  1GB1 A;  3MHZ A;  2BYT A;  3HVD A;  4HKZ E;  3Q8B A;  4C56 C;  2IDY A;  1HA5 A;  3Q8C A;  4LLG M;  2WXF A;  1EU4 A;  1F0Z A;  1J7C A;  1I4G A;  1ZXI A;  3AE4 B;  3FIL B;  2I38 A;  4KGR A;  4YWG G;  1YQ3 B;  4US8 A;  3RFZ B;  1SSN A;  4DXG A;  1ET9 A;  3P42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...