2MEKA

N-terminal domain of bilbo1 from trypanosoma brucei
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
110
structure length
110
Chain Sequence
b'MAFLVQVAADIFNNKVNFELSFPSRPSISELTRSAETAFSNEISLRRPDNVPSHKFHSSKIKMYDEELNKWVDLIREDQLTDYCQLYVFQPPNEWHKESQKEIPPAMKPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-TERMINAL DOMAIN OF BILBO1
publication title Structure and assembly mechanism of TbBILBO1, an essential flagellar pocket collar protein
rcsb
source organism Trypanosoma brucei brucei
molecule tags Metal binding protein
total genus 11
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2013-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18281 BILBO1_N BILBO1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.650 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2mekA00
2MEKA
chains in the Genus database with same CATH superfamily
2D07B 1C4CA 2C9WB 3RT3B 1GJZA 1KLVA 3A9KB 3PRPB 1LXDA 2JRIB 3H1UA 1I42A 2O6VB 1KRHA 3V3XA 3QJZA 5IOIA 3LJ3A 2JVCA 1IPGA 3VXWA 4DDGD 1MG4A 2C5LC 4YTNB 2LGXA 2KT7A 1V5TA 4KSKC 3R3MA 2N7DA 1MPEA 1WGRA 2I38A 1C1YB 2IGHA 1C78A 4C7YA 5E6OA 4A9AA 2DWQA 1JWSD 1TJEA 2C7NB 4M01A 4MSQB 4FA6A 2L7RA 1XO3A 4K1RB 2CU3A 3N20C 3SHQA 1YMHE 2DAFA 3EGRA 5EDSA 3UIPB 3PT2B 4GDKB 4HDQA 2ZVOA 4HKQA 3H6NA 2M8SA 2BQQA 3BVMA 2LHEA 3HM6X 2LI5A 3ZYYX 1RLFA 1AYFA 3ZIMA 2D5GA 1VZ7A 5L83A 4MGIE 3NZUA 4LTUA 1GOZA 1L6UA 1UGJA 2J42A 2PPHA 4W9CA 5BYQA 2AX5A 4WJPA 3DOWA 2LRWA 1T0RC 3ZNZB 2GBKA 1TZOA 1WYWB 4W9DA 1RFKA 4ZDVA 3PHXB 2WXLA 3VR8B 2PE9A 2KN4A 3IAS1 3O65B 1FRRA 5AUKA 3C19A 5BMGA 4UDUC 5E6NA 3E9SA 3L54A 1WGGA 5JZEB 4MJSB 5IKCM 3RULA 3OG5A 2GMIC 2Y5BB 4L23A 3U7DA 1SEBD 5D94A 5J18A 3NVZA 1N63A 3SD5A 1STEA 3SR6A 1GPXA 3Q14C 4AWJA 3P2BA 3U8ZA 3M95A 1P9DU 3Q3FA 2NMQA 2WXIA 1TKGA 1UZXB 3FC4A 2QIEB 2N9LA 3H7SA 5BYRA 2KC1A 2D2QA 1QZEA 3HHMA 4E71A 1WRDB 3AU4A 3OJ4B 4AJWA 1TYGB 1TS2A 1YD8U 1KLUD 2X38A 3I9V1 2KLGA 1L4ZB 4QAYA 2ACZB 4PYUA 1WWTA 3H9DA 1OTRB 3RUIB 4NAWA 3NS1A 1SGHA 2INNE 2NPTA 5HKHA 2FCNA 2XEWA 2IYDB 2KFJA 1K53A 2AQ3B 2OOBB 3HVZA 4OHJA 1IBXB 2KX3A 2RD0A 3RZFA 2UYZB 2KAJA 3ZO5B 2KJRA 2N9PC 1A5RA 2E6XA 1H4RA 4GIVA 4CHKA 1XLOA 4WJOA 2HTHA 4EZJA 1P0RA 1JCKB 2WXOA 4RGNA 1WR6E 4YL8A 3VHTC 1C4AA 1YQ3B 1YX5B 4B0EA 4FN2A 2VZKD 5H92C 4A3PA 2WX0A 2KWUB 3UQBA 1XF5L 4WJNA 3ZTCA 3PPAA 2O2VA 5TR5A 2IGDA 3NVYA 1S1QB 3TCAA 1BUIC 3AE5B 3A4RA 5JH5C 3KWVA 2L00B 4MH8A 2V3SA 1F1HA 2QC8A 5BYSA 2WX1A 1NENB 2RPVA 1JW9D 1AARA 5FR3A 2DYMA 5CHVC 3AN1A 2WXRA 3TIXA 3W1SC 3E56A 1B9RA 1FXAA 4RF1A 3RYTA 2K22A 2LGIA 4PT5A 3RNGC 1E7VA 1FO4A 1ZDXA 5I4DA 4KZCA 4FHJA 1ZE3D 3AEDB 4AQ7A 2AYOB 1ENFA 3PS6A 2KX0A 2WS3B 4AP4C 4GSWA 2ZW1A 3OLMD 3AEFB 1UF0A 4IM3A 3DVNU 1E7UA 3QX1A 2KDFB 1P7FA 2J0KA 3L13A 4L2YA 2M0AA 1WX7A 3A33B 4TKNA 2Y5PA 3IT4B 4TMAB 1FNVA 4WIPA 4JQWC 1F9JA 1JWMD 1FNUA 2LASA 2W55A 3KUCB 1D5XC 2VRRB 4I6NB 5IAAC 4LNFA 4W9HA 2BB6A 5EE1A 4M8NA 2MEKA 2LJIA 2L52A 3UGBB 1WJ6A 2REXA 2LXAA 3VVWB 4Q2JA 1JRPA 4PS3A 1SSNA 1WF9A 3U2SC 3EFCA 2FIFA 1V97A 5HFYA 4MGKE 3W2DA 1KM7A 4IM2A 2KMAA 4DHJB 4TQ0A 3TEXA 2LUMA 2BPSA 2HJ1A 3VAWA 3A9JA 3ZGZA 1A70A 1NI3A 3MC0B 3AE9B 1P7EA 3PSEB 3LYYA 3CSFA 3PREA 5AZHA 3PLUA 3W1SA 4XWTA 3RN9C 3RI7C 1TS5A 2IJ0A 4TV3A 3MC8A 2KANA 4A90A 4WAAA 1G6JA 3R7RA 3PHWB 2JQRB 2K0PA 2YEPF 1K8RB 1T5XD 2K6QA 4RGMA 4FJVB 2GLSA 4NJCA 4ANUA 3AE8B 3QA8A 3R7QA 2IY0B 4GGQA 3UQAA 3IBEA 3ZJTA 4JIOU 3DVNV 2ZPYA 3M62B 5J17A 1J0GA 1KOTA 4RCOA 3NRZA 3QK0A 1Q0WB 1N5WA 5AZFA 4ACFA 2WXQA 1BMLC 2PEAA 3T3NA 4MACA 3NZ3A 2CHZA 4M0WA 2A5UA 2PMVA 4F7ZA 2JY6A 1P3QU 1OGWA 4NAWB 1E8YA 4KGSA 2KO3A 2NPTB 4C4VA 1WY8A 3KUZA 3WAPA 3KQ4A 2JU6X 2IO0B 2SEBD 4XWWA 4JGHB 2C7HA 5EE3A 3BINA 2KHWB 2WGSA 1UD7A 4OVUA 5JHAA 3VRAB 2N9EB 1JALA 1ZUD2 2L76A 4MEMA 4ZHPA 4HXDA 4DXGA 4B9KA 4URKA 1I4QA 2KWCA 2JXTA 1V49A 4NQKE 4WWNA 5C2TB 2BKFA 2K8BA 1IUEA 1TBEA 2DBYA 1D5ZC 1ESFA 1FFUA 1J7BA 3GE8C 3P4RB 3DPDA 4WAFA 4JE3B 2QILA 3JSVA 1VZ8A 1VDVA 2K1FA 2AL3A 1D5MC 1FRDA 5EE0A 2Q5WD 1YNTE 2KZRA 3HUIA 4LNNA 3ZNGC 4DQOC 5IP4D 2LRUA 3RD2A 2O2VB 3ZNHB 2LUEA 3P4PB 5CHWA 4W9IA 2KVRA 3SU8X 1P98A 3KLSX 3WAMA 1SIJA 3DWMA 3MP9A 4PK1A 3KW5B 1AWDA 1Z2MA 4DXFA 4HVBA 4LNKA 1PFDA 2K3UA 2FUG1 2GRIA 3MTNB 3ZXRA 1M94A 1WXSA 1CQVA 2KDIA 3EC8A 1WXAA 1HXYD 4K3CA 4BAXA 4OVVA 3KWLA 2C7MB 3RNFC 1WX8A 2JT4B 3SFDB 2M17A 2ZCBA 1HE8A 2JZ3B 4G50A 2PLPA 3NS8A 1WXMA 2LGSA 2V4IB 1DOIA 1CZPA 1V2YA 4MDKE 2LGDA 3GZNB 3QWZB 2MP2A 3PLVA 2HD5B 4DK5A 2LZ6A 1JWBD 3APFA 1K50A 4RM9A 3N30A 3Q8FA 4HCPB 3N1YC 2GBNA 5IN7A 4XGAB 2D3GA 1QQRA 2RDHA 5JHBA 1V5OA 2AEHA 1MVKA 2QHOA 5CHFA 1CK1A 1FIQA 4P1CC 4GXBA 1WGKA 2KC2A 1WX9A 1XCTL 3AEEB 1F2RI 1XQQA 3RNEC 4EUTA 3R66C 5AZGA 3MJWA 4DHZB 3BIID 4R3DA 1MFWA 3PO0A 4JWSC 4YWGG 1KTKA 1K51A 1WE7A 4M00A 4AS1A 3ZJUA 1RM6C 2LGYA 5BMHA 1E8ZA 4C00A 3IVFA 4YT0B 1C79A 2QMTA 3KVFB 4K7SA 3T9LA 1HEZE 2WDTB 3A9JB 4BKTA 3Q3NC 2L32A 4CYEA 2N9KA 2ZNVB 3U30A 1L0VB 4RH6A 1QOFA 3WANA 3ZVVA 3AE1B 2JWZA 2XK5A 1D3ZA 1HZ5A 3Q3MC 2B76B 2ZW0A 3IT6B 1EO6A 1J7AA 1SF0A 1N6ZA 2KVZA 5LLIA 3B0AA 2L0FA 5D3IB 3VUYA 3EFUA 5C23A 1ROEA 2LJ5A 3GS2A 3UI3A 3PVLA 2PW9A 4G11A 3MHZA 1T6BX 2D3BA 2CU1A 2W3RA 2LD9A 2QEJC 2M0XA 2V3PA 3PRMB 4ZOHC 1E5WA 3DCGA 2WP9B 3W9CB 1OFFA 1V6EA 4P16A 4IC7B 2KDMA 4MM3A 2LVPA 1AW7A 2XBBC 2L1AA 1PGAA 2LVQA 4KV2A 1KLGD 1J7CA 4LDTD 3DVGY 4M0WB 2INPE 1T3QA 1UUPA 1FNWA 3NJTA 4W9EA 5D6JB 3AH7A 3C0RB 1T0QC 1ZXIA 3MC9A 4C4VB 4HPMB 1E90A 1SE3A 3D32A 3K9OB 3HRDD 3KYCD 3WAOA 2W9NA 3ONSA 4PYZA 4RMAA 3M63B 2KJ6A 4XYCA 2MBOA 4BVUC 5E6PA 4TUUA 1PYWD 2VH1A 4P7IA 3I63C 3KH0A 3ZW3A 3T8MA 2I2YA 1IGDA 2DYBA 1BXTA 3ZRCA 4FULA 3A4SC 1VCBA 4W9FA 1FPYA 3VRBB 4NY0A 4IWQA 1I4PA 1RYJA 2RMMA 3N32A 2PJHA 4KIKB 1WXVA 2ON8A 2K25A 4IM0A 2KMMA 4GMVA 3JSVB 4KDIC 2INCC 4AJYB 3DBHB 4NZLB 4IDIA 4O1NA 1GB1A 4G0NB 1OEYJ 4L1BA 4F8CB 1MI0A 3DVGX 2Z59B 1UNSA 3BVGA 5C3JB 3R2IA 2ZZPB 1GB4A 1LFDA 3DWGC 1ET6A 2KOXA 2QDFA 3BZDB 3TUOA 1EUVB 3X0WA 4KGRA 2JZPA 1DOYA 1GAQB 3L17A 1F52A 2LMCA 3H7PA 2JYTA 4A6QA 3Q69A 2XN9C 1XD3B 1JMLA 2ONQA 4W9JA 1Y8RC 2G3QB 4N9F4 4WURA 1WI0A 1FM0D 4N59A 2IBIB 1SBBB 1E0ZA 1YIWA 1YJIA 2KQ7A 1NI2A 3AE6B 1IP9A 3ZXVA 5L95C 4M02A 3K9PB 1YJ1A 1J8CA 4A8XC 5FKAC 1FEHA 1VR9A 4KX6B 4F1SA 2N1WA 3Q2AC 4PS8A 1HTOA 2MP2B 2MBHA 1OQYA 4LNOA 2BS2B 3O13A 4LLGM 1FCLA 1K52A 4HK2A 3ECIA 3BYTB 4YSYB 4S0RA 1V80A 3TBLD 1EF5A 1OQQA 1DGJA 4IOIE 4MSMB 3RNBC 4NAMA 5MPOA 3LDZE 5HG2A 3AE2B 1OEYA 1PGXA 2MBQA 3DBSA 2INDC 3SDLC 1I4RA 4GLSC 3H8HA 3AI5A 4KKIA 2EKEC 4EZKA 4ZRIA 2JWUA 2DZMA 2WXJA 2VH2A 3J9CA 2O6VD 2N9XA 2M4NA 4AOFA 1SJED 4JWUC 2DNFA 4OW0A 2BVCA 1L6VA 2PKOA 3R8BA 1L0YB 3W5UB 4G3XB 2NCNA 1C3TA 2XK5B 2RSUA 1WGDA 3SFEB 3B08A 2A4ZA 3VH3B 3AEAB 4WQMA 4LJOB 3DBLB 1BT0A 2BYEA 4RGTA 2CKHB 1D4BA 1VJKA 4EE2A 3IG3A 2RGFA 4HJKA 2JF5A 4HJGE 4HKZE 3BVZA 2LVOA 3RPFC 3ZJVA 1VZ6A 1XCQL 3APDA 1ZP0B 1XXGA 3ZRFA 3TEWA 1WMHA 3NVWA 3AM9A 3I5JC 1UBIA 5DPWA 4LK0M 4MM3B 3W1YA 1YQBA 5KHQA 4RM8A 5LXHA 2QSDA 4GDLB 2IDYA 2GI9A 4NPNA 3MHSD 1NYRA 2L83A 3AECB 5IA7A 1XEEA 2RPQA 2RDBC 1UBQA 3ZDTA 1L5PA 2MHJA 4KKJA 1EU4A 2BF8B 4HPPA 2BGFA 3L4PA 3Q8BA 4M8MA 2WXFA 3PTFC 4C80A 1TY0A 2G4DB 2J52A 1YX6B 2DZJA 5BMIA 1IYFA 4XE0A 1C9FA 1WIAA 4TQ1A 2PVOD 4MH0E 5CTRC 2D11A 3VDZA 1Q5WB 1PQSA 1NEKB 4ICUA 2BYTA 2LEKA 3CF6E 3URYA 2KTFA 4W9LA 2G1EA 3B9JA 1V1PB 1WRIA 3WIMA 1NYQA 1TTNA 1L2NA 4TSSA 1T0YA 2OJRA 3VUWA 1NDDA 4US8A 4X57B 1E9MA 2OJWA 3SEBA 2R61A 4IKGA 1SE4A 1EWCA 4BKSD 2AWTA 1VD2A 3QHTA 2NR2A 2UU7A 2D3CA 1ZDVA 4XX5A 1TS3A 3N1XC 5G5GA 2R2QA 2CHWA 1C4PA 2TSSA 2BS3B 4K3BA 2WDQB 2OHFA 2CJNA 2Y5CA 4KSLC 1S3SG 1C76A 3M3JA 1OQRA 1RFAA 4DHZE 1E8XA 2WLBA 3GZNI 3V60A 2BS4B 2MQJA 3CIRB 2IO3B 5DPRA 4ANWA 1NBFC 3LB8C 2CR5A 5T8IA 2BTEA 3H7PB 4KIKA 2MH7A 2D10A 3U52E 2AL6A 2X8XX 2LXCA 1WJ4A 1WZ3A 4OZCA 2L05A 2DZKA 1AN8A 2H89B 4NJ6A 3NVVA 4IWOA 2K8CA 3L16A 3EECA 2JRHA 4HDOA 3ML9A 1YJJA 1RAXA 2IPKD 2MLBA 2NS5A 1Q10A 1UWXA 2ZJDA 2VZKB 5IO9A 1YN4A 5BO4B 2IY1B 3B1LX 3BWUD 2Z0EB 2KYWA 2EKIA 1VRAB 3ZTDA 1WR1A 2WXKA 1PDXA 2KK8A 3U4EG 4USAA 3UIOB 2LWPA 4C7ZA 1J19A 2JPHA 1SJHD 2EELA 4HROA 2KQSA 2PTLA 1CJEA 2MSED 4XC2A 3IXSA 3ML8A 4WQOB 3V62A 3GB1A 4E3CA 2NBUA 5TSSA 2HE7A 3Q6BA 4WJQA 1XLQA 1TKYA 4J6IA 4WWOA 2AQ2B 3TSSA 1U4AA 4IWPA 4FADA 1E7PB 4HWIB 1LO5D 4WWMA 3PZ8A 2PVGC 4NQLB 1FD6A 2C60A 1QOGA 3PV1A 2N4FA 2M19A 2N1VA 3DBRB 1ZOYB 2DENB 4HRSA 3VQIA 4OVZA 3ZLZA 2M1MA 3DHHC 3BY4B 4DDID 4YSXB 3AU5A 2M56B 4NJ7A 2N7EA 3TMPB 2JZZA 1ZW7A 1WGYA 5GXGB 2IO1B 2ICIA 1FFVA 3RNCC 1H8CA 1HZ6A 2V0GA 3ALBA 4HEA1 3DDCB 4PS7A 3ZQ4A 4ZRPA 3JVZX 4BZAA 3V6EB 3JYUA 5JXVA 1E8WA 2EMTA 3C8YA 4GB9A 3RFZB 1CMXB 1WMHB 2JX5A 3HVDA 3QC8B 1JRUA 1N61A 2D3AA 4EFOA 5HI1A 3GOEA 2J7QB 2RR9A 2J4XA 4E74A 3GP7A 2GBMA 3P1MA 3HK0A 4RGOS 3X23A 3MJ5A 4YXDB 2K8HA 1WSPA 4JLCA 2DYOA 2YLMA 1UWMA 2K9XA 2CS4A 1WYGA 1JWUD 2YVCA 3Q3OC 3WCQA 1ISNA 4K81A 3NG0A 2FIDA 1JROA 2ZVNA 3TEYA 2KWDA 1QOAA 3DBHI 1UELA 4DHJD 1NVID 4ZHOA 2DX5B 2FBWB 2MCNB 4ICVA 2V1YA 4BBNF 3CSTA 2KNBA 3EUB2 3ENEA 3NY5A 4GDLA 3FAHA 4B95A 2I1JA 4ANVA 1I4GA 5AUIA 1WXQA 3N9YC 4JX1C 4B0MA 3DQVA 2WWZA 2MJEA 1SIFA 4IUMB 1F77A 2HJ8A 5FK9C 2DAJA 3P63A 3KUDB 3TJPA 1N5XA 2FAZA 3L0WB 3RCZA 2L8JA 3N3KB 4LJPB 3PGEA 1QLBB 2WXMA 1LGRA 1DYQA 1JQ4A 4EKUA 2L0TA 2GBRA 2ASQA 1C77A 3DHIC 1P1AA 1TS4A 1KFYB 5CX3A 1DOXA 3QCAA 2LHDA 1M4VA 1QILA 4CQNA 5H8YE 2LFIA 2KFKA 2HDEA 2G4SA 1R4MI 3AEBB 2V9HA 1V1PA 3VUXA 2MW5A 3A1QA 3UINB 4KZ0A 5DPSA 4ZRQA 4ARIA 3RZWC 4YSZB 1ACCA 4RFBA 4BKGA 3AMZA 4A20A 4BOSC 2BWFA 1ZXHA 3IHPC 3ZUNA 5LXIB 1XT9B 2ZPNA 3W5VB 1MHHE 2ZEQA 2IZVB 1L0XB 3NHEB 4ITKA 1YOVB 2GOWA 3S2AA 2PIAA 4MGZE 2E3TA 2KXJA 2KTRB 1Q1OA 1EWYC 2IGGA 1E6EB 2MWSB 4B6WA 2MX2A 2J0MA 4HPLB 1SE9A 2KWVB 1R7SA 4S17A 2HTME 2BBCA 1WJNA 5AEKB 4YTPB 2JUOA 3V6CB 1ET9A 3P4SB 3B2GA 3PZDA 1XLNA 1GNUA 1VLBA 4OZBA 3FILA 4MELA 2CHXA 3DBLI 4C56C 2ZCCA 4CO7A 4ZRJA 1HTQA 3B2FA 2NVUI 4US9A 2QCZA 2B3AA 2J0JA 2KMCA 4I6PA 4H2AA 4IG7B 5D2MB 1R4MB 2DLBA 2DHZA 1PUTA 4JPSA 1I35A 4N6EB 4FJZA 3CWIA 4LCDE 4N58A 4JL9A 4ASWC 1LQBA 3AV8A 4K7WA 4YTMB 3QARA 1JWAD 1QOBA 1WJUA 1GG3A 3RMKC 1TZ1A 2Y3AA 2DZIA 2ZNVC 4FBJB 2BYFA 2KLCA 4GOCA 2KDEB 2W3SA 2NBVB 3PZ7A 3OJ3A 1F0ZA 1TKEA 3EHVA 2WQYB 2FUHB 1WM3A 3RNAC 3I3TB 2KDBA 1UH6A 4LNIA 4A55A 4D2KA 1IGCA 3L08A 3VR9B 2MBBB 3N1ZC 3A9KA 2WNMA 3ZKJC 1EF1A 4J3OD 4DXAB 2NTSA 2O6VA 4P6VF 1I4XA 2GB1A 4WH4A 1V1OA 3U7ZA 2L3ZA 4EZLA 4GN1A 3VH4B 4ARCA 1V86A 1RRBA 1R4NI 4FXCA 1FXTB 3KYDD 1HA5A 3IFWB 2KACA 5G5HA 1F2RC 2Z8LA 4ZRKA 4XDCA 1TGZB 5G55A 2MRPA 5DCNA 2WDVB 3VTUA 3NOBA 4W9GA 1ZKHA 4II3B 2BW2A 1MJDA 2XNAC 4RF0A 2FE8A 2EMSA 1FMAD 3P4QB 2WHIA 4BFRA 5GMVA 4GU2A 4XZ4A 2JSVX 4BBNC 3BK2A 3LXFA 3CMMB 5EE9A 2Z0DB 1QT9A 3JW0X 5E6JA 1WM2A 3VTVA 1V81A 3R2TA 4KGTA 3AEGB 1T0SC 5KHOA 4GDKA 2BKRB 1I7HA 3QQ8B 4NNJB 2WXNA 2W54A 3MFGA 1QF6A 3NZSA 4P1BC 1PGBA 3TEZA 4LDTB 2MJDA 2JXXA 1FXIA 4RNAA 3AULA 4DBGA 3UF8A 3HM3A 2K6DB 3Q8CA 4MT5A 3AE4B 1KJTA 2FCSA 4ANXA 2J53A 2SAKA 4OZAA 3AE7B 1YN3A 4BOZB 1ZPSA 2KFKB 4HCNB 2BT6A 1E10A 1SE2A 4FJYA 1V9JA 3DHGC 1SXTA 4KDLB 2GBJA 1R4NB 3A1QB 1N60A 3NUHB 2KKCA 2KQ4X 2MJ3A 1KH0A 4I6LB 4MGYE 2N0SB 1L7YA 1Y56A 5J2RA 1TT5B 3HIZA 2FNJB 3OAWA 2WXGA 3VFKA 4MJSA 4EOYA 1X1MA 1WFYA 4REZA 2PE6B 3ZDMC 3T3OA 2AQ1B 2G9HD 4FHKA 1HQRD 2IO2B 5DPTA 2KD0A 4II2B 4K7UA 4EEWA 3Q8AA 2BB5A 2NTTA 4BKSA 3ETRA 3V61A 2YEPB 5D7GA 2FCMA 2K5PA 2WDRB 4XDDA 4FLHA 1YN5A 2RDGA 1L4DB 1MHXA 5HHDG 5D3DA 4A3OA 5G2NA 3TL5A 4DWFA 3DBRI 3OWEB 1TY2A 1WZ0A 3BK1A 3QIJA 3ABVB 3QAQA 1RWSA 4ZYSA 3FILB 2WU5B 1WH3A 2V3NA 2QJLA 1SB3C 3AB5A 1LM8B 3WA0A 2MBEA 1EM7A 1V8CA 2KTRA 3VTWA 1TIFA 1B1ZA 3V05A 1QKZA 3IAM1 4KVGB 1UGMA 2R2OA 1EU3A 5FR6A 2BYVE 1GC7A 4HLEA 1I4HA 3EA6A 2WU2B 4AUQC 1YQ4B 2NBWB 1WGHA 1IBXA 2WXPA 3APCA 2G45B 2UWQA 3BYYB 2K39A 2MA9B 1Z5SB 3L10B 3WALA 3I57A 3PRZA 2KJHB 3Q3JA 1GUAB 5LNK1 2N7JA 4ZYNA 1N62A 2FCQA 2CJOA 1D6EC 3GE3C 3P42A 2V4LA 2WYQA 2WXHA 1GC6A 4IW0A 5C1ZA 2W82A 2JYEA 4WWPA 1ZGUB 2OEDA 3AE3B 2BWES 3ZNID 2H88B 1KF6B 3AXCA 1FCCC 4W9KA 1MG8A 2I1KA 3FKYA 1XLPA 1WE6A 3Q8EA 2KN5A
chains in the Genus database with same CATH topology
2WXMA 1OQQA 1C4CA 3ZJTA 1DGJA 4IOIE 1DYQA 1JQ4A 4NAMA 5MPOA 5HG2A 1C77A 3AE2B 1PGXA 4RCOA 3NRZA 1N5WA 1TS4A 1KFYB 2WXQA 1DOXA 2LHDA 1BMLC 1I4RA 1M4VA 1QILA 1KRHA 4GLSC 3V3XA 3T3NA 4MACA 3NZ3A 3H8HA 4CQNA 5H8YE 2LFIA 4M0WA 4KKIA 2HDEA 2PMVA 3AEBB 2JWUA 4NAWB 2WXJA 1V1PA 3J9CA 4KGSA 4YTNB 1SJED 4JWUC 4ZRQA 4ARIA 4OW0A 4YSZB 3KQ4A 1ACCA 4RFBA 2JU6X 2SEBD 4XWWA 3AMZA 1L6VA 2PKOA 5EE3A 3R8BA 1L0YB 1ZXHA 1MPEA 3W5UB 3W5VB 1MHHE 3VRAB 1L0XB 4ITKA 1JALA 2I38A 3SFEB 2IGHA 1C78A 4C7YA 1ZUD2 2PIAA 4ZHPA 3AEAB 4DXGA 4WQMA 4A9AA 2E3TA 2DWQA 4RGTA 1JWSD 1I4QA 1TJEA 2JXTA 1D4BA 1VJKA 5C2TB 4EE2A 1XO3A 1IUEA 1EWYC 2CU3A 2IGGA 1E6EB 2DBYA 1D5ZC 1ESFA 1FFUA 1J7BA 1YMHE 4HJGE 4HKZE 3BVZA 3EGRA 3P4RB 4WAFA 3RPFC 4GDKB 3ZJVA 1R7SA 4JE3B 1VZ6A 2HTME 2BBCA 1XCQL 2QILA 4HKQA 1VZ8A 1VDVA 1ZP0B 1XXGA 3TEWA 3BVMA 1D5MC 1FRDA 4YTPB 3NVWA 2LHEA 5EE0A 2Q5WD 1ET9A 3AM9A 3P4SB 1YNTE 3HUIA 3B2GA 3ZYYX 4LK0M 4MM3B 1AYFA 1XLNA 4DQOC 1VLBA 4OZBA 2D5GA 1VZ7A 2QSDA 4GDLB 3FILA 2IDYA 2GI9A 4LTUA 3P4PB 4C56C 1GOZA 1NYRA 2L83A 1L6UA 1UGJA 2J42A 3AECB 3KLSX 5BYQA 2AX5A 1SIJA 3DWMA 1XEEA 3B2FA 3MP9A 4US9A 1AWDA 1L5PA 1TZOA 4KKJA 4DXFA 4H2AA 1RFKA 1EU4A 2DLBA 1PFDA 1PUTA 2WXLA 3VR8B 4JPSA 3L4PA 2K3UA 2KN4A 2FUG1 2GRIA 4N6EB 3CWIA 3IAS1 3Q8BA 2WXFA 1CQVA 4C80A 4N58A 1TY0A 1FRRA 2J52A 5AUKA 3AV8A 1HXYD 5BMIA 5BMGA 4YTMB 4UDUC 4XE0A 1C9FA 4TQ1A 2PVOD 3E9SA 3KWLA 3SFDB 1JWAD 1QOBA 1NEKB 2BYTA 2Y3AA 2LEKA 3URYA 4L23A 1SEBD 3NVZA 2PLPA 1N63A 1STEA 2G1EA 3B9JA 1V1PB 2V4IB 2W3SA 1DOIA 1WRIA 1CZPA 3PZ7A 3SR6A 1NYQA 1GPXA 1F0ZA 4TSSA 1TKEA 2WQYB 1JWBD 4US8A 1K50A 3Q8FA 2NMQA 2WXIA 1TKGA 3FC4A 1E9MA 3SEBA 2R61A 4A55A 4IKGA 1SE4A 4D2KA 1EWCA 1IGCA 2QIEB 2N9LA 3VR9B 2RDHA 1QQRA 1MVKA 1CK1A 5BYRA 1FIQA 2WNMA 1ZDVA 1WGKA 1TS3A 1XCTL 3AEEB 1TYGB 1TS2A 5G5GA 1F2RI 4J3OD 2NTSA 1C4PA 2TSSA 2BS3B 4P6VF 1KLUD 2X38A 1I4XA 2GB1A 2OHFA 1V1OA 2CJNA 2WDQB 2Y5CA 3I9V1 4WH4A 3U7ZA 1L4ZB 2ACZB 1C76A 3BIID 4R3DA 4ARCA 3PO0A 4JWSC 1WWTA 4FXCA 1OQRA 4YWGG 1KTKA 1K51A 1HA5A 3NS1A 2KACA 2WLBA 5G5HA 1F2RC 4AS1A 2BS4B 2INNE 3ZJUA 3CIRB 1RM6C 5BMHA 2Z8LA 4YT0B 3LB8C 1C79A 2QMTA 1HEZE 5T8IA 2BTEA 1K53A 2AQ3B 4XDCA 2MH7A 3HVZA 3U52E 2L32A 4OHJA 2N9KA 1L0VB 4RH6A 1IBXB 1QOFA 2WDVB 2BW2A 3AE1B 4OZCA 2H89B 1AN8A 2KAJA 1HZ5A 2XNAC 4RF0A 2FE8A 3NVVA 1FMAD 2B76B 2E6XA 2ZW0A 3P4QB 3IT6B 2JSVX 1XLOA 1J7AA 1SF0A 3BK2A 1YJJA 3LXFA 2IPKD 5EE9A 5D3IB 1Q10A 1JCKB 1UWXA 2VZKB 1QT9A 2WXOA 1YN4A 5E6JA 4RGNA 1ROEA 3BWUD 3GS2A 3UI3A 3R2TA 1C4AA 4KGTA 2PW9A 1YQ3B 3AEGB 3MHZA 1T6BX 2EKIA 4B0EA 2W3RA 1VRAB 1I7HA 2WXNA 2QEJC 2W54A 3MFGA 1QF6A 2VZKD 2WXKA 2V3PA 1PDXA 4ZOHC 1PGBA 3U4EG 3TEZA 2MJDA 2WP9B 4USAA 4C7ZA 3W9CB 1FXIA 4RNAA 1OFFA 5H92C 4P16A 3Q8CA 2KDMA 4MT5A 3AE4B 1SJHD 1XF5L 2EELA 1AW7A 4HROA 2PTLA 1CJEA 2L1AA 2J53A 1PGAA 2IGDA 2SAKA 3IXSA 1KLGD 1J7CA 3NVYA 4OZAA 3AE7B 1YN3A 1BUIC 3AE5B 3GB1A 1ZPSA 3KWVA 4MH8A 1E10A 2BT6A 2INPE 1SE2A 1T3QA 1UUPA 5BYSA 1NENB 2RPVA 1FNWA 5TSSA 1SXTA 1JW9D 5FR3A 2DYMA 3AH7A 1XLQA 1TKYA 3AN1A 2WXRA 2AQ2B 1ZXIA 3TSSA 3E56A 1N60A 3NUHB 1B9RA 1FXAA 1SE3A 2KQ4X 4RF1A 1E7PB 1LO5D 3HRDD 4WWMA 2MJ3A 2PVGC 1KH0A 3PZ8A 2K22A 2LGIA 1FD6A 4PT5A 1QOGA 2N0SB 1Y56A 1FO4A 1ZDXA 2M19A 5I4DA 2WXGA 1ZE3D 3AEDB 1ZOYB 4HRSA 3VQIA 1PYWD 4AQ7A 4OVZA 1ENFA 4REZA 4YSXB 2WS3B 3T3OA 2M56B 2ZW1A 3AEFB 2I2YA 1IGDA 1BXTA 5GXGB 2AQ1B 2G9HD 1HQRD 2ICIA 3Q8AA 2BB5A 2NTTA 1FFVA 3VRBB 1P7FA 3ETRA 1I4PA 1HZ6A 2YEPB 1RYJA 2V0GA 5D7GA 2RMMA 2M0AA 2K5PA 4L2YA 2WDRB 4HEA1 4XDDA 2Y5PA 3IT4B 2ON8A 4TMAB 1YN5A 3ZQ4A 4ZRPA 1FNVA 2KMMA 4WIPA 1JWMD 1FNUA 2RDGA 5JXVA 2W55A 3C8YA 1D5XC 1L4DB 1MHXA 5D3DA 5HHDG 3RFZB 4NZLB 4IDIA 2JX5A 2BB6A 5EE1A 3HVDA 4O1NA 1GB1A 3OWEB 1TY2A 1N61A 3BK1A 4L1BA 1MI0A 2MEKA 3ABVB 2LJIA 1RWSA 1UNSA 2L52A 3BVGA 4ZYSA 5C3JB 5HI1A 3FILB 2WU5B 3R2IA 2V3NA 2QJLA 1GB4A 1SB3C 2J4XA 3GP7A 4Q2JA 1JRPA 3AB5A 3P1MA 4RGOS 1SSNA 3MJ5A 4YXDB 3U2SC 1EM7A 1WSPA 3DWGC 1V8CA 1V97A 5HFYA 1ET6A 3W2DA 1B1ZA 2DYOA 1UWMA 3V05A 1QKZA 3IAM1 2K9XA 4TQ0A 3BZDB 3TUOA 3TEXA 1WYGA 1JWUD 2LUMA 3WCQA 4KGRA 2JZPA 1DOYA 1EU3A 1GAQB 2LMCA 1JROA 3ZGZA 1A70A 1I4HA 1NI3A 2JYTA 2WU2B 3EA6A 3MC0B 3Q69A 2KWDA 4A6QA 2XN9C 3AE9B 3TEYA 1QOAA 1JMLA 1YQ4B 2ONQA 1P7EA 1IBXA 2WXPA 1NVID 4ZHOA 3BYYB 3LYYA 2FBWB 4WURA 1FM0D 4N59A 3I57A 1SBBB 3W1SA 4XWTA 1E0ZA 1YJIA 5LNK1 2N7JA 3EUB2 1TS5A 1N62A 3AE6B 2CJOA 3FAHA 1D6EC 2IJ0A 1I4GA 3P42A 5AUIA 4A90A 4A8XC 1WXQA 5FKAC 3N9YC 1FEHA 4JX1C 2WXHA 4B0MA 1VR9A 2W82A 4KX6B 2JYEA 2OEDA 3AE3B 2JQRB 2K0PA 2YEPF 2MJEA 2H88B 1T5XD 1KF6B 1F77A 1FCCC 2BS2B 4RGMA 5FK9C 3O13A 1XLPA 4LLGM 4NJCA 3P63A 1FCLA 1K52A 3AE8B 1N5XA 3BYTB 4YSYB 3Q8EA 1QLBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MEK A; 
#chains in the Genus database with same CATH topology
 2D07 B;  1C4C A;  2C9W B;  3RT3 B;  1GJZ A;  1KLV A;  3A9K B;  3PRP B;  1LXD A;  2JRI B;  3H1U A;  1I42 A;  2O6V B;  1KRH A;  3V3X A;  3QJZ A;  5IOI A;  3LJ3 A;  2JVC A;  1IPG A;  3VXW A;  4DDG D;  1MG4 A;  2C5L C;  4YTN B;  2LGX A;  2KT7 A;  1V5T A;  4KSK C;  3R3M A;  2N7D A;  1MPE A;  1WGR A;  2I38 A;  1C1Y B;  2IGH A;  1C78 A;  4C7Y A;  5E6O A;  4A9A A;  2DWQ A;  1JWS D;  1TJE A;  2C7N B;  4M01 A;  4MSQ B;  4FA6 A;  2L7R A;  1XO3 A;  4K1R B;  2CU3 A;  3N20 C;  3SHQ A;  1YMH E;  2DAF A;  3EGR A;  5EDS A;  3UIP B;  3PT2 B;  4GDK B;  4HDQ A;  2ZVO A;  4HKQ A;  3H6N A;  2M8S A;  2BQQ A;  3BVM A;  2LHE A;  3HM6 X;  2LI5 A;  3ZYY X;  1RLF A;  1AYF A;  3ZIM A;  2D5G A;  1VZ7 A;  5L83 A;  4MGI E;  3NZU A;  4LTU A;  1GOZ A;  1L6U A;  1UGJ A;  2J42 A;  2PPH A;  4W9C A;  5BYQ A;  2AX5 A;  4WJP A;  3DOW A;  2LRW A;  1T0R C;  3ZNZ B;  2GBK A;  1TZO A;  1WYW B;  4W9D A;  1RFK A;  4ZDV A;  3PHX B;  2WXL A;  3VR8 B;  2PE9 A;  2KN4 A;  3IAS 1;  3O65 B;  1FRR A;  5AUK A;  3C19 A;  5BMG A;  4UDU C;  5E6N A;  3E9S A;  3L54 A;  1WGG A;  5JZE B;  4MJS B;  5IKC M;  3RUL A;  3OG5 A;  2GMI C;  2Y5B B;  4L23 A;  3U7D A;  1SEB D;  5D94 A;  5J18 A;  3NVZ A;  1N63 A;  3SD5 A;  1STE A;  3SR6 A;  1GPX A;  3Q14 C;  4AWJ A;  3P2B A;  3U8Z A;  3M95 A;  1P9D U;  3Q3F A;  2NMQ A;  2WXI A;  1TKG A;  1UZX B;  3FC4 A;  2QIE B;  2N9L A;  3H7S A;  5BYR A;  2KC1 A;  2D2Q A;  1QZE A;  3HHM A;  4E71 A;  1WRD B;  3AU4 A;  3OJ4 B;  4AJW A;  1TYG B;  1TS2 A;  1YD8 U;  1KLU D;  2X38 A;  3I9V 1;  2KLG A;  1L4Z B;  4QAY A;  2ACZ B;  4PYU A;  1WWT A;  3H9D A;  1OTR B;  3RUI B;  4NAW A;  3NS1 A;  1SGH A;  2INN E;  2NPT A;  5HKH A;  2FCN A;  2XEW A;  2IYD B;  2KFJ A;  1K53 A;  2AQ3 B;  2OOB B;  3HVZ A;  4OHJ A;  1IBX B;  2KX3 A;  2RD0 A;  3RZF A;  2UYZ B;  2KAJ A;  3ZO5 B;  2KJR A;  2N9P C;  1A5R A;  2E6X A;  1H4R A;  4GIV A;  4CHK A;  1XLO A;  4WJO A;  2HTH A;  4EZJ A;  1P0R A;  1JCK B;  2WXO A;  4RGN A;  1WR6 E;  4YL8 A;  3VHT C;  1C4A A;  1YQ3 B;  1YX5 B;  4B0E A;  4FN2 A;  2VZK D;  5H92 C;  4A3P A;  2WX0 A;  2KWU B;  3UQB A;  1XF5 L;  4WJN A;  3ZTC A;  3PPA A;  2O2V A;  5TR5 A;  2IGD A;  3NVY A;  1S1Q B;  3TCA A;  1BUI C;  3AE5 B;  3A4R A;  5JH5 C;  3KWV A;  2L00 B;  4MH8 A;  2V3S A;  1F1H A;  2QC8 A;  5BYS A;  2WX1 A;  1NEN B;  2RPV A;  1JW9 D;  1AAR A;  5FR3 A;  2DYM A;  5CHV C;  3AN1 A;  2WXR A;  3TIX A;  3W1S C;  3E56 A;  1B9R A;  1FXA A;  4RF1 A;  3RYT A;  2K22 A;  2LGI A;  4PT5 A;  3RNG C;  1E7V A;  1FO4 A;  1ZDX A;  5I4D A;  4KZC A;  4FHJ A;  1ZE3 D;  3AED B;  4AQ7 A;  2AYO B;  1ENF A;  3PS6 A;  2KX0 A;  2WS3 B;  4AP4 C;  4GSW A;  2ZW1 A;  3OLM D;  3AEF B;  1UF0 A;  4IM3 A;  3DVN U;  1E7U A;  3QX1 A;  2KDF B;  1P7F A;  2J0K A;  3L13 A;  4L2Y A;  2M0A A;  1WX7 A;  3A33 B;  4TKN A;  2Y5P A;  3IT4 B;  4TMA B;  1FNV A;  4WIP A;  4JQW C;  1F9J A;  1JWM D;  1FNU A;  2LAS A;  2W55 A;  3KUC B;  1D5X C;  2VRR B;  4I6N B;  5IAA C;  4LNF A;  4W9H A;  2BB6 A;  5EE1 A;  4M8N A;  2MEK A;  2LJI A;  2L52 A;  3UGB B;  1WJ6 A;  2REX A;  2LXA A;  3VVW B;  4Q2J A;  1JRP A;  4PS3 A;  1SSN A;  1WF9 A;  3U2S C;  3EFC A;  2FIF A;  1V97 A;  5HFY A;  4MGK E;  3W2D A;  1KM7 A;  4IM2 A;  2KMA A;  4DHJ B;  4TQ0 A;  3TEX A;  2LUM A;  2BPS A;  2HJ1 A;  3VAW A;  3A9J A;  3ZGZ A;  1A70 A;  1NI3 A;  3MC0 B;  3AE9 B;  1P7E A;  3PSE B;  3LYY A;  3CSF A;  3PRE A;  5AZH A;  3PLU A;  3W1S A;  4XWT A;  3RN9 C;  3RI7 C;  1TS5 A;  2IJ0 A;  4TV3 A;  3MC8 A;  2KAN A;  4A90 A;  4WAA A;  1G6J A;  3R7R A;  3PHW B;  2JQR B;  2K0P A;  2YEP F;  1K8R B;  1T5X D;  2K6Q A;  4RGM A;  4FJV B;  2GLS A;  4NJC A;  4ANU A;  3AE8 B;  3QA8 A;  3R7Q A;  2IY0 B;  4GGQ A;  3UQA A;  3IBE A;  3ZJT A;  4JIO U;  3DVN V;  2ZPY A;  3M62 B;  5J17 A;  1J0G A;  1KOT A;  4RCO A;  3NRZ A;  3QK0 A;  1Q0W B;  1N5W A;  5AZF A;  4ACF A;  2WXQ A;  1BML C;  2PEA A;  3T3N A;  4MAC A;  3NZ3 A;  2CHZ A;  4M0W A;  2A5U A;  2PMV A;  4F7Z A;  2JY6 A;  1P3Q U;  1OGW A;  4NAW B;  1E8Y A;  4KGS A;  2KO3 A;  2NPT B;  4C4V A;  1WY8 A;  3KUZ A;  3WAP A;  3KQ4 A;  2JU6 X;  2IO0 B;  2SEB D;  4XWW A;  4JGH B;  2C7H A;  5EE3 A;  3BIN A;  2KHW B;  2WGS A;  1UD7 A;  4OVU A;  5JHA A;  3VRA B;  2N9E B;  1JAL A;  1ZUD 2;  2L76 A;  4MEM A;  4ZHP A;  4HXD A;  4DXG A;  4B9K A;  4URK A;  1I4Q A;  2KWC A;  2JXT A;  1V49 A;  4NQK E;  4WWN A;  5C2T B;  2BKF A;  2K8B A;  1IUE A;  1TBE A;  2DBY A;  1D5Z C;  1ESF A;  1FFU A;  1J7B A;  3GE8 C;  3P4R B;  3DPD A;  4WAF A;  4JE3 B;  2QIL A;  3JSV A;  1VZ8 A;  1VDV A;  2K1F A;  2AL3 A;  1D5M C;  1FRD A;  5EE0 A;  2Q5W D;  1YNT E;  2KZR A;  3HUI A;  4LNN A;  3ZNG C;  4DQO C;  5IP4 D;  2LRU A;  3RD2 A;  2O2V B;  3ZNH B;  2LUE A;  3P4P B;  5CHW A;  4W9I A;  2KVR A;  3SU8 X;  1P98 A;  3KLS X;  3WAM A;  1SIJ A;  3DWM A;  3MP9 A;  4PK1 A;  3KW5 B;  1AWD A;  1Z2M A;  4DXF A;  4HVB A;  4LNK A;  1PFD A;  2K3U A;  2FUG 1;  2GRI A;  3MTN B;  3ZXR A;  1M94 A;  1WXS A;  1CQV A;  2KDI A;  3EC8 A;  1WXA A;  1HXY D;  4K3C A;  4BAX A;  4OVV A;  3KWL A;  2C7M B;  3RNF C;  1WX8 A;  2JT4 B;  3SFD B;  2M17 A;  2ZCB A;  1HE8 A;  2JZ3 B;  4G50 A;  2PLP A;  3NS8 A;  1WXM A;  2LGS A;  2V4I B;  1DOI A;  1CZP A;  1V2Y A;  4MDK E;  2LGD A;  3GZN B;  3QWZ B;  2MP2 A;  3PLV A;  2HD5 B;  4DK5 A;  2LZ6 A;  1JWB D;  3APF A;  1K50 A;  4RM9 A;  3N30 A;  3Q8F A;  4HCP B;  3N1Y C;  2GBN A;  5IN7 A;  4XGA B;  2D3G A;  1QQR A;  2RDH A;  5JHB A;  1V5O A;  2AEH A;  1MVK A;  2QHO A;  5CHF A;  1CK1 A;  1FIQ A;  4P1C C;  4GXB A;  1WGK A;  2KC2 A;  1WX9 A;  1XCT L;  3AEE B;  1F2R I;  1XQQ A;  3RNE C;  4EUT A;  3R66 C;  5AZG A;  3MJW A;  4DHZ B;  3BII D;  4R3D A;  1MFW A;  3PO0 A;  4JWS C;  4YWG G;  1KTK A;  1K51 A;  1WE7 A;  4M00 A;  4AS1 A;  3ZJU A;  1RM6 C;  2LGY A;  5BMH A;  1E8Z A;  4C00 A;  3IVF A;  4YT0 B;  1C79 A;  2QMT A;  3KVF B;  4K7S A;  3T9L A;  1HEZ E;  2WDT B;  3A9J B;  4BKT A;  3Q3N C;  2L32 A;  4CYE A;  2N9K A;  2ZNV B;  3U30 A;  1L0V B;  4RH6 A;  1QOF A;  3WAN A;  3ZVV A;  3AE1 B;  2JWZ A;  2XK5 A;  1D3Z A;  1HZ5 A;  3Q3M C;  2B76 B;  2ZW0 A;  3IT6 B;  1EO6 A;  1J7A A;  1SF0 A;  1N6Z A;  2KVZ A;  5LLI A;  3B0A A;  2L0F A;  5D3I B;  3VUY A;  3EFU A;  5C23 A;  1ROE A;  2LJ5 A;  3GS2 A;  3UI3 A;  3PVL A;  2PW9 A;  4G11 A;  3MHZ A;  1T6B X;  2D3B A;  2CU1 A;  2W3R A;  2LD9 A;  2QEJ C;  2M0X A;  2V3P A;  3PRM B;  4ZOH C;  1E5W A;  3DCG A;  2WP9 B;  3W9C B;  1OFF A;  1V6E A;  4P16 A;  4IC7 B;  2KDM A;  4MM3 A;  2LVP A;  1AW7 A;  2XBB C;  2L1A A;  1PGA A;  2LVQ A;  4KV2 A;  1KLG D;  1J7C A;  4LDT D;  3DVG Y;  4M0W B;  2INP E;  1T3Q A;  1UUP A;  1FNW A;  3NJT A;  4W9E A;  5D6J B;  3AH7 A;  3C0R B;  1T0Q C;  1ZXI A;  3MC9 A;  4C4V B;  4HPM B;  1E90 A;  1SE3 A;  3D32 A;  3K9O B;  3HRD D;  3KYC D;  3WAO A;  2W9N A;  3ONS A;  4PYZ A;  4RMA A;  3M63 B;  2KJ6 A;  4XYC A;  2MBO A;  4BVU C;  5E6P A;  4TUU A;  1PYW D;  2VH1 A;  4P7I A;  3I63 C;  3KH0 A;  3ZW3 A;  3T8M A;  2I2Y A;  1IGD A;  2DYB A;  1BXT A;  3ZRC A;  4FUL A;  3A4S C;  1VCB A;  4W9F A;  1FPY A;  3VRB B;  4NY0 A;  4IWQ A;  1I4P A;  1RYJ A;  2RMM A;  3N32 A;  2PJH A;  4KIK B;  1WXV A;  2ON8 A;  2K25 A;  4IM0 A;  2KMM A;  4GMV A;  3JSV B;  4KDI C;  2INC C;  4AJY B;  3DBH B;  4NZL B;  4IDI A;  4O1N A;  1GB1 A;  4G0N B;  1OEY J;  4L1B A;  4F8C B;  1MI0 A;  3DVG X;  2Z59 B;  1UNS A;  3BVG A;  5C3J B;  3R2I A;  2ZZP B;  1GB4 A;  1LFD A;  3DWG C;  1ET6 A;  2KOX A;  2QDF A;  3BZD B;  3TUO A;  1EUV B;  3X0W A;  4KGR A;  2JZP A;  1DOY A;  1GAQ B;  3L17 A;  1F52 A;  2LMC A;  3H7P A;  2JYT A;  4A6Q A;  3Q69 A;  2XN9 C;  1XD3 B;  1JML A;  2ONQ A;  4W9J A;  1Y8R C;  2G3Q B;  4N9F 4;  4WUR A;  1WI0 A;  1FM0 D;  4N59 A;  2IBI B;  1SBB B;  1E0Z A;  1YIW A;  1YJI A;  2KQ7 A;  1NI2 A;  3AE6 B;  1IP9 A;  3ZXV A;  5L95 C;  4M02 A;  3K9P B;  1YJ1 A;  1J8C A;  4A8X C;  5FKA C;  1FEH A;  1VR9 A;  4KX6 B;  4F1S A;  2N1W A;  3Q2A C;  4PS8 A;  1HTO A;  2MP2 B;  2MBH A;  1OQY A;  4LNO A;  2BS2 B;  3O13 A;  4LLG M;  1FCL A;  1K52 A;  4HK2 A;  3ECI A;  3BYT B;  4YSY B;  4S0R A;  1V80 A;  3TBL D;  1EF5 A;  1OQQ A;  1DGJ A;  4IOI E;  4MSM B;  3RNB C;  4NAM A;  5MPO A;  3LDZ E;  5HG2 A;  3AE2 B;  1OEY A;  1PGX A;  2MBQ A;  3DBS A;  2IND C;  3SDL C;  1I4R A;  4GLS C;  3H8H A;  3AI5 A;  4KKI A;  2EKE C;  4EZK A;  4ZRI A;  2JWU A;  2DZM A;  2WXJ A;  2VH2 A;  3J9C A;  2O6V D;  2N9X A;  2M4N A;  4AOF A;  1SJE D;  4JWU C;  2DNF A;  4OW0 A;  2BVC A;  1L6V A;  2PKO A;  3R8B A;  1L0Y B;  3W5U B;  4G3X B;  2NCN A;  1C3T A;  2XK5 B;  2RSU A;  1WGD A;  3SFE B;  3B08 A;  2A4Z A;  3VH3 B;  3AEA B;  4WQM A;  4LJO B;  3DBL B;  1BT0 A;  2BYE A;  4RGT A;  2CKH B;  1D4B A;  1VJK A;  4EE2 A;  3IG3 A;  2RGF A;  4HJK A;  2JF5 A;  4HJG E;  4HKZ E;  3BVZ A;  2LVO A;  3RPF C;  3ZJV A;  1VZ6 A;  1XCQ L;  3APD A;  1ZP0 B;  1XXG A;  3ZRF A;  3TEW A;  1WMH A;  3NVW A;  3AM9 A;  3I5J C;  1UBI A;  5DPW A;  4LK0 M;  4MM3 B;  3W1Y A;  1YQB A;  5KHQ A;  4RM8 A;  5LXH A;  2QSD A;  4GDL B;  2IDY A;  2GI9 A;  4NPN A;  3MHS D;  1NYR A;  2L83 A;  3AEC B;  5IA7 A;  1XEE A;  2RPQ A;  2RDB C;  1UBQ A;  3ZDT A;  1L5P A;  2MHJ A;  4KKJ A;  1EU4 A;  2BF8 B;  4HPP A;  2BGF A;  3L4P A;  3Q8B A;  4M8M A;  2WXF A;  3PTF C;  4C80 A;  1TY0 A;  2G4D B;  2J52 A;  1YX6 B;  2DZJ A;  5BMI A;  1IYF A;  4XE0 A;  1C9F A;  1WIA A;  4TQ1 A;  2PVO D;  4MH0 E;  5CTR C;  2D11 A;  3VDZ A;  1Q5W B;  1PQS A;  1NEK B;  4ICU A;  2BYT A;  2LEK A;  3CF6 E;  3URY A;  2KTF A;  4W9L A;  2G1E A;  3B9J A;  1V1P B;  1WRI A;  3WIM A;  1NYQ A;  1TTN A;  1L2N A;  4TSS A;  1T0Y A;  2OJR A;  3VUW A;  1NDD A;  4US8 A;  4X57 B;  1E9M A;  2OJW A;  3SEB A;  2R61 A;  4IKG A;  1SE4 A;  1EWC A;  4BKS D;  2AWT A;  1VD2 A;  3QHT A;  2NR2 A;  2UU7 A;  2D3C A;  1ZDV A;  4XX5 A;  1TS3 A;  3N1X C;  5G5G A;  2R2Q A;  2CHW A;  1C4P A;  2TSS A;  2BS3 B;  4K3B A;  2WDQ B;  2OHF A;  2CJN A;  2Y5C A;  4KSL C;  1S3S G;  1C76 A;  3M3J A;  1OQR A;  1RFA A;  4DHZ E;  1E8X A;  2WLB A;  3GZN I;  3V60 A;  2BS4 B;  2MQJ A;  3CIR B;  2IO3 B;  5DPR A;  4ANW A;  1NBF C;  3LB8 C;  2CR5 A;  5T8I A;  2BTE A;  3H7P B;  4KIK A;  2MH7 A;  2D10 A;  3U52 E;  2AL6 A;  2X8X X;  2LXC A;  1WJ4 A;  1WZ3 A;  4OZC A;  2L05 A;  2DZK A;  1AN8 A;  2H89 B;  4NJ6 A;  3NVV A;  4IWO A;  2K8C A;  3L16 A;  3EEC A;  2JRH A;  4HDO A;  3ML9 A;  1YJJ A;  1RAX A;  2IPK D;  2MLB A;  2NS5 A;  1Q10 A;  1UWX A;  2ZJD A;  2VZK B;  5IO9 A;  1YN4 A;  5BO4 B;  2IY1 B;  3B1L X;  3BWU D;  2Z0E B;  2KYW A;  2EKI A;  1VRA B;  3ZTD A;  1WR1 A;  2WXK A;  1PDX A;  2KK8 A;  3U4E G;  4USA A;  3UIO B;  2LWP A;  4C7Z A;  1J19 A;  2JPH A;  1SJH D;  2EEL A;  4HRO A;  2KQS A;  2PTL A;  1CJE A;  2MSE D;  4XC2 A;  3IXS A;  3ML8 A;  4WQO B;  3V62 A;  3GB1 A;  4E3C A;  2NBU A;  5TSS A;  2HE7 A;  3Q6B A;  4WJQ A;  1XLQ A;  1TKY A;  4J6I A;  4WWO A;  2AQ2 B;  3TSS A;  1U4A A;  4IWP A;  4FAD A;  1E7P B;  4HWI B;  1LO5 D;  4WWM A;  3PZ8 A;  2PVG C;  4NQL B;  1FD6 A;  2C60 A;  1QOG A;  3PV1 A;  2N4F A;  2M19 A;  2N1V A;  3DBR B;  1ZOY B;  2DEN B;  4HRS A;  3VQI A;  4OVZ A;  3ZLZ A;  2M1M A;  3DHH C;  3BY4 B;  4DDI D;  4YSX B;  3AU5 A;  2M56 B;  4NJ7 A;  2N7E A;  3TMP B;  2JZZ A;  1ZW7 A;  1WGY A;  5GXG B;  2IO1 B;  2ICI A;  1FFV A;  3RNC C;  1H8C A;  1HZ6 A;  2V0G A;  3ALB A;  4HEA 1;  3DDC B;  4PS7 A;  3ZQ4 A;  4ZRP A;  3JVZ X;  4BZA A;  3V6E B;  3JYU A;  5JXV A;  1E8W A;  2EMT A;  3C8Y A;  4GB9 A;  3RFZ B;  1CMX B;  1WMH B;  2JX5 A;  3HVD A;  3QC8 B;  1JRU A;  1N61 A;  2D3A A;  4EFO A;  5HI1 A;  3GOE A;  2J7Q B;  2RR9 A;  2J4X A;  4E74 A;  3GP7 A;  2GBM A;  3P1M A;  3HK0 A;  4RGO S;  3X23 A;  3MJ5 A;  4YXD B;  2K8H A;  1WSP A;  4JLC A;  2DYO A;  2YLM A;  1UWM A;  2K9X A;  2CS4 A;  1WYG A;  1JWU D;  2YVC A;  3Q3O C;  3WCQ A;  1ISN A;  4K81 A;  3NG0 A;  2FID A;  1JRO A;  2ZVN A;  3TEY A;  2KWD A;  1QOA A;  3DBH I;  1UEL A;  4DHJ D;  1NVI D;  4ZHO A;  2DX5 B;  2FBW B;  2MCN B;  4ICV A;  2V1Y A;  4BBN F;  3CST A;  2KNB A;  3EUB 2;  3ENE A;  3NY5 A;  4GDL A;  3FAH A;  4B95 A;  2I1J A;  4ANV A;  1I4G A;  5AUI A;  1WXQ A;  3N9Y C;  4JX1 C;  4B0M A;  3DQV A;  2WWZ A;  2MJE A;  1SIF A;  4IUM B;  1F77 A;  2HJ8 A;  5FK9 C;  2DAJ A;  3P63 A;  3KUD B;  3TJP A;  1N5X A;  2FAZ A;  3L0W B;  3RCZ A;  2L8J A;  3N3K B;  4LJP B;  3PGE A;  1QLB B;  2WXM A;  1LGR A;  1DYQ A;  1JQ4 A;  4EKU A;  2L0T A;  2GBR A;  2ASQ A;  1C77 A;  3DHI C;  1P1A A;  1TS4 A;  1KFY B;  5CX3 A;  1DOX A;  3QCA A;  2LHD A;  1M4V A;  1QIL A;  4CQN A;  5H8Y E;  2LFI A;  2KFK A;  2HDE A;  2G4S A;  1R4M I;  3AEB B;  2V9H A;  1V1P A;  3VUX A;  2MW5 A;  3A1Q A;  3UIN B;  4KZ0 A;  5DPS A;  4ZRQ A;  4ARI A;  3RZW C;  4YSZ B;  1ACC A;  4RFB A;  4BKG A;  3AMZ A;  4A20 A;  4BOS C;  2BWF A;  1ZXH A;  3IHP C;  3ZUN A;  5LXI B;  1XT9 B;  2ZPN A;  3W5V B;  1MHH E;  2ZEQ A;  2IZV B;  1L0X B;  3NHE B;  4ITK A;  1YOV B;  2GOW A;  3S2A A;  2PIA A;  4MGZ E;  2E3T A;  2KXJ A;  2KTR B;  1Q1O A;  1EWY C;  2IGG A;  1E6E B;  2MWS B;  4B6W A;  2MX2 A;  2J0M A;  4HPL B;  1SE9 A;  2KWV B;  1R7S A;  4S17 A;  2HTM E;  2BBC A;  1WJN A;  5AEK B;  4YTP B;  2JUO A;  3V6C B;  1ET9 A;  3P4S B;  3B2G A;  3PZD A;  1XLN A;  1GNU A;  1VLB A;  4OZB A;  3FIL A;  4MEL A;  2CHX A;  3DBL I;  4C56 C;  2ZCC A;  4CO7 A;  4ZRJ A;  1HTQ A;  3B2F A;  2NVU I;  4US9 A;  2QCZ A;  2B3A A;  2J0J A;  2KMC A;  4I6P A;  4H2A A;  4IG7 B;  5D2M B;  1R4M B;  2DLB A;  2DHZ A;  1PUT A;  4JPS A;  1I35 A;  4N6E B;  4FJZ A;  3CWI A;  4LCD E;  4N58 A;  4JL9 A;  4ASW C;  1LQB A;  3AV8 A;  4K7W A;  4YTM B;  3QAR A;  1JWA D;  1QOB A;  1WJU A;  1GG3 A;  3RMK C;  1TZ1 A;  2Y3A A;  2DZI A;  2ZNV C;  4FBJ B;  2BYF A;  2KLC A;  4GOC A;  2KDE B;  2W3S A;  2NBV B;  3PZ7 A;  3OJ3 A;  1F0Z A;  1TKE A;  3EHV A;  2WQY B;  2FUH B;  1WM3 A;  3RNA C;  3I3T B;  2KDB A;  1UH6 A;  4LNI A;  4A55 A;  4D2K A;  1IGC A;  3L08 A;  3VR9 B;  2MBB B;  3N1Z C;  3A9K A;  2WNM A;  3ZKJ C;  1EF1 A;  4J3O D;  4DXA B;  2NTS A;  2O6V A;  4P6V F;  1I4X A;  2GB1 A;  4WH4 A;  1V1O A;  3U7Z A;  2L3Z A;  4EZL A;  4GN1 A;  3VH4 B;  4ARC A;  1V86 A;  1RRB A;  1R4N I;  4FXC A;  1FXT B;  3KYD D;  1HA5 A;  3IFW B;  2KAC A;  5G5H A;  1F2R C;  2Z8L A;  4ZRK A;  4XDC A;  1TGZ B;  5G55 A;  2MRP A;  5DCN A;  2WDV B;  3VTU A;  3NOB A;  4W9G A;  1ZKH A;  4II3 B;  2BW2 A;  1MJD A;  2XNA C;  4RF0 A;  2FE8 A;  2EMS A;  1FMA D;  3P4Q B;  2WHI A;  4BFR A;  5GMV A;  4GU2 A;  4XZ4 A;  2JSV X;  4BBN C;  3BK2 A;  3LXF A;  3CMM B;  5EE9 A;  2Z0D B;  1QT9 A;  3JW0 X;  5E6J A;  1WM2 A;  3VTV A;  1V81 A;  3R2T A;  4KGT A;  3AEG B;  1T0S C;  5KHO A;  4GDK A;  2BKR B;  1I7H A;  3QQ8 B;  4NNJ B;  2WXN A;  2W54 A;  3MFG A;  1QF6 A;  3NZS A;  4P1B C;  1PGB A;  3TEZ A;  4LDT B;  2MJD A;  2JXX A;  1FXI A;  4RNA A;  3AUL A;  4DBG A;  3UF8 A;  3HM3 A;  2K6D B;  3Q8C A;  4MT5 A;  3AE4 B;  1KJT A;  2FCS A;  4ANX A;  2J53 A;  2SAK A;  4OZA A;  3AE7 B;  1YN3 A;  4BOZ B;  1ZPS A;  2KFK B;  4HCN B;  2BT6 A;  1E10 A;  1SE2 A;  4FJY A;  1V9J A;  3DHG C;  1SXT A;  4KDL B;  2GBJ A;  1R4N B;  3A1Q B;  1N60 A;  3NUH B;  2KKC A;  2KQ4 X;  2MJ3 A;  1KH0 A;  4I6L B;  4MGY E;  2N0S B;  1L7Y A;  1Y56 A;  5J2R A;  1TT5 B;  3HIZ A;  2FNJ B;  3OAW A;  2WXG A;  3VFK A;  4MJS A;  4EOY A;  1X1M A;  1WFY A;  4REZ A;  2PE6 B;  3ZDM C;  3T3O A;  2AQ1 B;  2G9H D;  4FHK A;  1HQR D;  2IO2 B;  5DPT A;  2KD0 A;  4II2 B;  4K7U A;  4EEW A;  3Q8A A;  2BB5 A;  2NTT A;  4BKS A;  3ETR A;  3V61 A;  2YEP B;  5D7G A;  2FCM A;  2K5P A;  2WDR B;  4XDD A;  4FLH A;  1YN5 A;  2RDG A;  1L4D B;  1MHX A;  5HHD G;  5D3D A;  4A3O A;  5G2N A;  3TL5 A;  4DWF A;  3DBR I;  3OWE B;  1TY2 A;  1WZ0 A;  3BK1 A;  3QIJ A;  3ABV B;  3QAQ A;  1RWS A;  4ZYS A;  3FIL B;  2WU5 B;  1WH3 A;  2V3N A;  2QJL A;  1SB3 C;  3AB5 A;  1LM8 B;  3WA0 A;  2MBE A;  1EM7 A;  1V8C A;  2KTR A;  3VTW A;  1TIF A;  1B1Z A;  3V05 A;  1QKZ A;  3IAM 1;  4KVG B;  1UGM A;  2R2O A;  1EU3 A;  5FR6 A;  2BYV E;  1GC7 A;  4HLE A;  1I4H A;  3EA6 A;  2WU2 B;  4AUQ C;  1YQ4 B;  2NBW B;  1WGH A;  1IBX A;  2WXP A;  3APC A;  2G45 B;  2UWQ A;  3BYY B;  2K39 A;  2MA9 B;  1Z5S B;  3L10 B;  3WAL A;  3I57 A;  3PRZ A;  2KJH B;  3Q3J A;  1GUA B;  5LNK 1;  2N7J A;  4ZYN A;  1N62 A;  2FCQ A;  2CJO A;  1D6E C;  3GE3 C;  3P42 A;  2V4L A;  2WYQ A;  2WXH A;  1GC6 A;  4IW0 A;  5C1Z A;  2W82 A;  2JYE A;  4WWP A;  1ZGU B;  2OED A;  3AE3 B;  2BWE S;  3ZNI D;  2H88 B;  1KF6 B;  3AXC A;  1FCC C;  4W9K A;  1MG8 A;  2I1K A;  3FKY A;  1XLP A;  1WE6 A;  3Q8E A;  2KN5 A; 
#chains in the Genus database with same CATH homology
 2WXM A;  1OQQ A;  1C4C A;  3ZJT A;  1DGJ A;  4IOI E;  1DYQ A;  1JQ4 A;  4NAM A;  5MPO A;  5HG2 A;  1C77 A;  3AE2 B;  1PGX A;  4RCO A;  3NRZ A;  1N5W A;  1TS4 A;  1KFY B;  2WXQ A;  1DOX A;  2LHD A;  1BML C;  1I4R A;  1M4V A;  1QIL A;  1KRH A;  4GLS C;  3V3X A;  3T3N A;  4MAC A;  3NZ3 A;  3H8H A;  4CQN A;  5H8Y E;  2LFI A;  4M0W A;  4KKI A;  2HDE A;  2PMV A;  3AEB B;  2JWU A;  4NAW B;  2WXJ A;  1V1P A;  3J9C A;  4KGS A;  4YTN B;  1SJE D;  4JWU C;  4ZRQ A;  4ARI A;  4OW0 A;  4YSZ B;  3KQ4 A;  1ACC A;  4RFB A;  2JU6 X;  2SEB D;  4XWW A;  3AMZ A;  1L6V A;  2PKO A;  5EE3 A;  3R8B A;  1L0Y B;  1ZXH A;  1MPE A;  3W5U B;  3W5V B;  1MHH E;  3VRA B;  1L0X B;  4ITK A;  1JAL A;  2I38 A;  3SFE B;  2IGH A;  1C78 A;  4C7Y A;  1ZUD 2;  2PIA A;  4ZHP A;  3AEA B;  4DXG A;  4WQM A;  4A9A A;  2E3T A;  2DWQ A;  4RGT A;  1JWS D;  1I4Q A;  1TJE A;  2JXT A;  1D4B A;  1VJK A;  5C2T B;  4EE2 A;  1XO3 A;  1IUE A;  1EWY C;  2CU3 A;  2IGG A;  1E6E B;  2DBY A;  1D5Z C;  1ESF A;  1FFU A;  1J7B A;  1YMH E;  4HJG E;  4HKZ E;  3BVZ A;  3EGR A;  3P4R B;  4WAF A;  3RPF C;  4GDK B;  3ZJV A;  1R7S A;  4JE3 B;  1VZ6 A;  2HTM E;  2BBC A;  1XCQ L;  2QIL A;  4HKQ A;  1VZ8 A;  1VDV A;  1ZP0 B;  1XXG A;  3TEW A;  3BVM A;  1D5M C;  1FRD A;  4YTP B;  3NVW A;  2LHE A;  5EE0 A;  2Q5W D;  1ET9 A;  3AM9 A;  3P4S B;  1YNT E;  3HUI A;  3B2G A;  3ZYY X;  4LK0 M;  4MM3 B;  1AYF A;  1XLN A;  4DQO C;  1VLB A;  4OZB A;  2D5G A;  1VZ7 A;  2QSD A;  4GDL B;  3FIL A;  2IDY A;  2GI9 A;  4LTU A;  3P4P B;  4C56 C;  1GOZ A;  1NYR A;  2L83 A;  1L6U A;  1UGJ A;  2J42 A;  3AEC B;  3KLS X;  5BYQ A;  2AX5 A;  1SIJ A;  3DWM A;  1XEE A;  3B2F A;  3MP9 A;  4US9 A;  1AWD A;  1L5P A;  1TZO A;  4KKJ A;  4DXF A;  4H2A A;  1RFK A;  1EU4 A;  2DLB A;  1PFD A;  1PUT A;  2WXL A;  3VR8 B;  4JPS A;  3L4P A;  2K3U A;  2KN4 A;  2FUG 1;  2GRI A;  4N6E B;  3CWI A;  3IAS 1;  3Q8B A;  2WXF A;  1CQV A;  4C80 A;  4N58 A;  1TY0 A;  1FRR A;  2J52 A;  5AUK A;  3AV8 A;  1HXY D;  5BMI A;  5BMG A;  4YTM B;  4UDU C;  4XE0 A;  1C9F A;  4TQ1 A;  2PVO D;  3E9S A;  3KWL A;  3SFD B;  1JWA D;  1QOB A;  1NEK B;  2BYT A;  2Y3A A;  2LEK A;  3URY A;  4L23 A;  1SEB D;  3NVZ A;  2PLP A;  1N63 A;  1STE A;  2G1E A;  3B9J A;  1V1P B;  2V4I B;  2W3S A;  1DOI A;  1WRI A;  1CZP A;  3PZ7 A;  3SR6 A;  1NYQ A;  1GPX A;  1F0Z A;  4TSS A;  1TKE A;  2WQY B;  1JWB D;  4US8 A;  1K50 A;  3Q8F A;  2NMQ A;  2WXI A;  1TKG A;  3FC4 A;  1E9M A;  3SEB A;  2R61 A;  4A55 A;  4IKG A;  1SE4 A;  4D2K A;  1EWC A;  1IGC A;  2QIE B;  2N9L A;  3VR9 B;  2RDH A;  1QQR A;  1MVK A;  1CK1 A;  5BYR A;  1FIQ A;  2WNM A;  1ZDV A;  1WGK A;  1TS3 A;  1XCT L;  3AEE B;  1TYG B;  1TS2 A;  5G5G A;  1F2R I;  4J3O D;  2NTS A;  1C4P A;  2TSS A;  2BS3 B;  4P6V F;  1KLU D;  2X38 A;  1I4X A;  2GB1 A;  2OHF A;  1V1O A;  2CJN A;  2WDQ B;  2Y5C A;  3I9V 1;  4WH4 A;  3U7Z A;  1L4Z B;  2ACZ B;  1C76 A;  3BII D;  4R3D A;  4ARC A;  3PO0 A;  4JWS C;  1WWT A;  4FXC A;  1OQR A;  4YWG G;  1KTK A;  1K51 A;  1HA5 A;  3NS1 A;  2KAC A;  2WLB A;  5G5H A;  1F2R C;  4AS1 A;  2BS4 B;  2INN E;  3ZJU A;  3CIR B;  1RM6 C;  5BMH A;  2Z8L A;  4YT0 B;  3LB8 C;  1C79 A;  2QMT A;  1HEZ E;  5T8I A;  2BTE A;  1K53 A;  2AQ3 B;  4XDC A;  2MH7 A;  3HVZ A;  3U52 E;  2L32 A;  4OHJ A;  2N9K A;  1L0V B;  4RH6 A;  1IBX B;  1QOF A;  2WDV B;  2BW2 A;  3AE1 B;  4OZC A;  2H89 B;  1AN8 A;  2KAJ A;  1HZ5 A;  2XNA C;  4RF0 A;  2FE8 A;  3NVV A;  1FMA D;  2B76 B;  2E6X A;  2ZW0 A;  3P4Q B;  3IT6 B;  2JSV X;  1XLO A;  1J7A A;  1SF0 A;  3BK2 A;  1YJJ A;  3LXF A;  2IPK D;  5EE9 A;  5D3I B;  1Q10 A;  1JCK B;  1UWX A;  2VZK B;  1QT9 A;  2WXO A;  1YN4 A;  5E6J A;  4RGN A;  1ROE A;  3BWU D;  3GS2 A;  3UI3 A;  3R2T A;  1C4A A;  4KGT A;  2PW9 A;  1YQ3 B;  3AEG B;  3MHZ A;  1T6B X;  2EKI A;  4B0E A;  2W3R A;  1VRA B;  1I7H A;  2WXN A;  2QEJ C;  2W54 A;  3MFG A;  1QF6 A;  2VZK D;  2WXK A;  2V3P A;  1PDX A;  4ZOH C;  1PGB A;  3U4E G;  3TEZ A;  2MJD A;  2WP9 B;  4USA A;  4C7Z A;  3W9C B;  1FXI A;  4RNA A;  1OFF A;  5H92 C;  4P16 A;  3Q8C A;  2KDM A;  4MT5 A;  3AE4 B;  1SJH D;  1XF5 L;  2EEL A;  1AW7 A;  4HRO A;  2PTL A;  1CJE A;  2L1A A;  2J53 A;  1PGA A;  2IGD A;  2SAK A;  3IXS A;  1KLG D;  1J7C A;  3NVY A;  4OZA A;  3AE7 B;  1YN3 A;  1BUI C;  3AE5 B;  3GB1 A;  1ZPS A;  3KWV A;  4MH8 A;  1E10 A;  2BT6 A;  2INP E;  1SE2 A;  1T3Q A;  1UUP A;  5BYS A;  1NEN B;  2RPV A;  1FNW A;  5TSS A;  1SXT A;  1JW9 D;  5FR3 A;  2DYM A;  3AH7 A;  1XLQ A;  1TKY A;  3AN1 A;  2WXR A;  2AQ2 B;  1ZXI A;  3TSS A;  3E56 A;  1N60 A;  3NUH B;  1B9R A;  1FXA A;  1SE3 A;  2KQ4 X;  4RF1 A;  1E7P B;  1LO5 D;  3HRD D;  4WWM A;  2MJ3 A;  2PVG C;  1KH0 A;  3PZ8 A;  2K22 A;  2LGI A;  1FD6 A;  4PT5 A;  1QOG A;  2N0S B;  1Y56 A;  1FO4 A;  1ZDX A;  2M19 A;  5I4D A;  2WXG A;  1ZE3 D;  3AED B;  1ZOY B;  4HRS A;  3VQI A;  1PYW D;  4AQ7 A;  4OVZ A;  1ENF A;  4REZ A;  4YSX B;  2WS3 B;  3T3O A;  2M56 B;  2ZW1 A;  3AEF B;  2I2Y A;  1IGD A;  1BXT A;  5GXG B;  2AQ1 B;  2G9H D;  1HQR D;  2ICI A;  3Q8A A;  2BB5 A;  2NTT A;  1FFV A;  3VRB B;  1P7F A;  3ETR A;  1I4P A;  1HZ6 A;  2YEP B;  1RYJ A;  2V0G A;  5D7G A;  2RMM A;  2M0A A;  2K5P A;  4L2Y A;  2WDR B;  4HEA 1;  4XDD A;  2Y5P A;  3IT4 B;  2ON8 A;  4TMA B;  1YN5 A;  3ZQ4 A;  4ZRP A;  1FNV A;  2KMM A;  4WIP A;  1JWM D;  1FNU A;  2RDG A;  5JXV A;  2W55 A;  3C8Y A;  1D5X C;  1L4D B;  1MHX A;  5D3D A;  5HHD G;  3RFZ B;  4NZL B;  4IDI A;  2JX5 A;  2BB6 A;  5EE1 A;  3HVD A;  4O1N A;  1GB1 A;  3OWE B;  1TY2 A;  1N61 A;  3BK1 A;  4L1B A;  1MI0 A;  2MEK A;  3ABV B;  2LJI A;  1RWS A;  1UNS A;  2L52 A;  3BVG A;  4ZYS A;  5C3J B;  5HI1 A;  3FIL B;  2WU5 B;  3R2I A;  2V3N A;  2QJL A;  1GB4 A;  1SB3 C;  2J4X A;  3GP7 A;  4Q2J A;  1JRP A;  3AB5 A;  3P1M A;  4RGO S;  1SSN A;  3MJ5 A;  4YXD B;  3U2S C;  1EM7 A;  1WSP A;  3DWG C;  1V8C A;  1V97 A;  5HFY A;  1ET6 A;  3W2D A;  1B1Z A;  2DYO A;  1UWM A;  3V05 A;  1QKZ A;  3IAM 1;  2K9X A;  4TQ0 A;  3BZD B;  3TUO A;  3TEX A;  1WYG A;  1JWU D;  2LUM A;  3WCQ A;  4KGR A;  2JZP A;  1DOY A;  1EU3 A;  1GAQ B;  2LMC A;  1JRO A;  3ZGZ A;  1A70 A;  1I4H A;  1NI3 A;  2JYT A;  2WU2 B;  3EA6 A;  3MC0 B;  3Q69 A;  2KWD A;  4A6Q A;  2XN9 C;  3AE9 B;  3TEY A;  1QOA A;  1JML A;  1YQ4 B;  2ONQ A;  1P7E A;  1IBX A;  2WXP A;  1NVI D;  4ZHO A;  3BYY B;  3LYY A;  2FBW B;  4WUR A;  1FM0 D;  4N59 A;  3I57 A;  1SBB B;  3W1S A;  4XWT A;  1E0Z A;  1YJI A;  5LNK 1;  2N7J A;  3EUB 2;  1TS5 A;  1N62 A;  3AE6 B;  2CJO A;  3FAH A;  1D6E C;  2IJ0 A;  1I4G A;  3P42 A;  5AUI A;  4A90 A;  4A8X C;  1WXQ A;  5FKA C;  3N9Y C;  1FEH A;  4JX1 C;  2WXH A;  4B0M A;  1VR9 A;  2W82 A;  4KX6 B;  2JYE A;  2OED A;  3AE3 B;  2JQR B;  2K0P A;  2YEP F;  2MJE A;  2H88 B;  1T5X D;  1KF6 B;  1F77 A;  1FCC C;  2BS2 B;  4RGM A;  5FK9 C;  3O13 A;  1XLP A;  4LLG M;  4NJC A;  3P63 A;  1FCL A;  1K52 A;  3AE8 B;  1N5X A;  3BYT B;  4YSY B;  3Q8E A;  1QLB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...