2MEKA

N-terminal domain of bilbo1 from trypanosoma brucei
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
110
structure length
110
Chain Sequence
MAFLVQVAADIFNNKVNFELSFPSRPSISELTRSAETAFSNEISLRRPDNVPSHKFHSSKIKMYDEELNKWVDLIREDQLTDYCQLYVFQPPNEWHKESQKEIPPAMKPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords N-TERMINAL DOMAIN OF BILBO1
publication title Structure and assembly mechanism of TbBILBO1, an essential flagellar pocket collar protein
rcsb
source organism Trypanosoma brucei brucei
total genus 11
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2013-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18281 BILBO1_N BILBO1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.650 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2mekA00
2MEKA
chains in the Genus database with same CATH superfamily
4C7ZA 2LJ5A 3QJZA 1AW7A 2WDTB 4P7IA 2GOWA 3Q8EA 3UGBB 5JZEB 1XLNA 5IA7A 1GAQB 3B0AA 2QDFA 4XDDA 3UI3A 4HLEA 3VUYA 1WIAA 5CHVC 1MG4A 2IO0B 2O6VD 2INPE 1ZKHA 1Q5WB 2GB1A 1D5XC 2N4FA 1U4AA 3BVZA 3ZUNA 1Q0WB 1DOYA 4NJ6A 4K7WA 4EZKA 2LGIA 1MHHE 4LLGM 3PT2B 4YTMB 1MFWA 1TIFA 1SIJA 2K8BA 4W9KA 3VTVA 1C9FA 1TY0A 1RAXA 3KWLA 1E8ZA 3P4QB 2BT6A 2BYFA 3P4SB 2NMQA 2TSSA 2G45B 3L16A 2C7HA 3ZNGC 3DBRB 2KWDA 3M62B 5IP4D 2PEAA 2L8JA 3FC4A 3V62A 3ZTCA 1N62A 2LFIA 2LI5A 5CX3A 5D3DA 2WXRA 2PKOA 2CJNA 1NYQA 1RFAA 2QCZA 3DVGY 2KACA 4RMAA 3EC8A 1HA5A 2Z0EB 2IDYA 4KDIC 3T3OA 2CKHB 1JWSD 5HG2A 1MJDA 1AYFA 1J7CA 4HXDA 2KXJA 3PGEA 4R3DA 3ZGZA 1SB3C 1ISNA 1WMHA 2WP9B 4RGOS 1ZDXA 3RPFC 1YJJA 1WJNA 3LXFA 4B6WA 4ANUA 2CR5A 2WXIA 2M8SA 3L13A 4IWPA 2JWUA 2BWFA 2W82A 5AEKB 4M02A 1GG3A 1K51A 4XE0A 4HK2A 1JRUA 4IWQA 4HKQA 1ZXHA 4IOIE 1FM0D 1TBEA 3R8BA 4C56C 4IUMB 2NR2A 2YLMA 2K22A 2WWZA 4DXFA 3N1ZC 3B1LX 2L52A 2KVZA 1L5PA 4JIOU 4NPNA 4MEMA 4P1BC 2JF5A 3VDZA 2W9NA 3QARA 1STEA 1WGDA 2KMCA 3PS6A 4DXGA 2NBUA 4ZHPA 1ZE3D 2BYTA 1T6BX 3IAS1 3NZ3A 1I4QA 1VDVA 1UWXA 3EGRA 5D6JB 1EF5A 1WZ0A 1M4VA 3AE3B 4USAA 1JWBD 3DHGC 4FHJA 1V5OA 4IM0A 4S17A 3ZJTA 3L0WB 4TSSA 3PO0A 2IPKD 1CQVA 2XNAC 2LUEA 4P6VF 1SBBB 5GMVA 1WXVA 1FMAD 5FK9C 2RPQA 4KGRA 1F2RI 4MGIE 2HDEA 2WDQB 5AZHA 1TS4A 2KJRA 2WX1A 4RGMA 4GDLB 2MBHA 2HD5B 3PREA 3WANA 4JGHB 3C8YA 5BO4B 1C76A 3QQ8B 2MBEA 1MHXA 3APDA 2MQJA 2ZPYA 1VZ6A 2MCNB 2G1EA 1TS5A 1E0ZA 4A8XC 3RNCC 1OQQA 2UYZB 5D94A 3K9PB 4XWWA 1I4RA 4RF0A 3QWZB 1UGMA 5JH5C 4ANXA 3PPAA 4OHJA 3NVZA 5D2MB 3PTFC 1GC7A 2BPSA 3PRZA 4W9EA 4KSKC 5LXIB 1VJKA 2K9XA 1WJ4A 4RF1A 3RN9C 1V97A 2PTLA 3DBLB 3L17A 1WRDB 4LJPB 3I5JC 4DK5A 2WS3B 4DHJB 1NI3A 3Q8AA 2AQ2B 2KWCA 5IO9A 5LLIA 4GSWA 1JQ4A 3BZDB 4N9F4 2L00B 2D5GA 1XCQL 3TUOA 1UBIA 4ARCA 1UH6A 2JZZA 2KQSA 3B2FA 4TUUA 1WR1A 2B76B 3RNAC 1H8CA 1WM2A 3QA8A 3AE2B 2I2YA 1ZOYB 2JU6X 3TEZA 4HRSA 1TZOA 1V1OA 2FBWB 1KRHA 3DBHI 3JVZX 1SE9A 4WWPA 4US8A 2AYOB 1SEBD 4A20A 1WM3A 2VH1A 4OVVA 2N1VA 4N59A 1Y56A 5HKHA 2GLSA 4WH4A 3Q2AC 4D2KA 3ZIMA 1EU3A 3VHTC 2MP2B 5MPOA 1XCTL 1MI0A 2JRHA 1L0VB 3HM6X 1DGJA 3N3KB 2XBBC 1QILA 3VVWB 3P42A 1N5XA 2KLCA 2FNJB 2MW5A 3OJ3A 3QHTA 4GDKB 2C9WB 4BKSD 1YN3A 1YQ4B 2OJWA 4GDLA 1UNSA 2KDBA 1WYWB 2N9EB 1F2RC 4NNJB 2K3UA 3IAM1 2BF8B 3PLVA 4PT5A 2J0MA 2NTSA 2PLPA 1YQ3B 3L4PA 1QT9A 1J8CA 3SDLC 4IG7B 1UGJA 1JALA 4L1BA 3AECB 1UUPA 5LNK1 1WF9A 1SJHD 2PVOD 2L0TA 4US9A 1WGHA 4YTNB 1WGGA 2VZKB 2QEJC 2ASQA 1OEYA 1Z5SB 4E74A 1D4BA 2KJHB 5KHQA 3Q14C 3R66C 4RGTA 3U4EG 4B95A 2JRIB 4MGZE 1WRIA 4FJZA 2NPTA 2B3AA 3B2GA 2DYBA 2DZIA 3I63C 3LYYA 1T3QA 1AARA 2KN5A 4AS1A 3FILA 4ACFA 2JXXA 3DVNU 2IJ0A 2ZJDA 4EE2A 3A4SC 1H4RA 3GE3C 5IOIA 4C00A 1HEZE 3A9JB 4WWOA 3NZUA 3N30A 4HKZE 4EKUA 1KLVA 4J6IA 2OJRA 4YT0B 3Q3OC 2CHWA 3RMKC 2GBJA 3W1SA 3RZWC 3NVWA 3ML8A 3DVNV 5E6JA 2LJIA 2FCNA 2KJ6A 2HJ1A 4JQWC 3MC0B 2MP2A 3CMMB 3TSSA 4ZRPA 3Q8FA 4JX1C 2AWTA 4G50A 1FEHA 1XO3A 3N32A 3AM9A 2OOBB 2DX5B 3KQ4A 4GDKA 4KIKB 3AE5B 1L7YA 3SR6A 2XEWA 2V1YA 3R2IA 5AZGA 3EUB2 2G9HD 3BYTB 4W9JA 3Q8BA 3LB8C 1VLBA 2N7DA 2BW2A 5EE3A 1DYQA 3MTNB 2BTEA 2K8CA 1V6EA 1E10A 3V61A 2DWQA 1GB4A 2MHJA 3AE7B 4WQMA 4AJYB 4ZYSA 2JWZA 2KD0A 3RFZB 1GC6A 1YX6B 2PW9A 3M3JA 3DWMA 3NHEB 3HRDD 3ZO5B 2A5UA 4DXAB 4L23A 1UELA 3VUWA 3ZXVA 4K7SA 1KF6B 4XZ4A 4MM3B 2HTHA 2IO3B 2W3RA 3URYA 3W2DA 3VAWA 1E5WA 1WX8A 1D5ZC 4LDTB 1D5MC 2DAJA 3ZNHB 4DDGD 4KX6B 1P1AA 3BK2A 2ZCBA 1KTKA 3HK0A 3I57A 1V9JA 4P16A 1LO5D 1OGWA 1ENFA 3IT6B 4YSYB 1BXTA 5HI1A 3OG5A 3CSTA 1R4MB 2FE8A 1N63A 1DOIA 1ZXIA 1PGBA 3DOWA 3A9JA 3AEFB 1OQYA 3ABVB 1EUVB 1ZUD2 2V9HA 3VFKA 2WGSA 4ZYNA 2CS4A 2LZ6A 3L08A 2WLBA 1C4PA 2KDEB 3A9KB 3EFUA 3FAHA 2M0AA 1L4ZB 4AJWA 2K8HA 2UU7A 1HE8A 2ZVOA 3WCQA 2N0SB 4ZRKA 1T0RC 2V3NA 4OVZA 2LWPA 2ZNVB 1VRAB 2WX0A 2YEPB 2JXTA 4GN1A 3SFEB 2NS5A 1F9JA 2IGDA 1YN4A 4HPMB 4IKGA 4JLCA 4KDLB 1G6JA 3ALBA 1WXAA 4KIKA 2BB6A 2LRWA 4XYCA 2HTME 2BYVE 4CO7A 3H9DA 1KH0A 4RGNA 2N1WA 1YJIA 1JW9D 1N61A 4BVUC 5C3JB 3L10B 1XLOA 2GBNA 4BOSC 5C1ZA 3W5VB 4FA6A 2AX5A 3M95A 3N1XC 4BKGA 3VH3B 1WX9A 3BINA 3E9SA 2WNMA 4GLSC 2ZEQA 2WYQA 2KMMA 3TL5A 1EF1A 2CHXA 5FR3A 3DBSA 1F0ZA 5G5GA 4MJSB 4ZRQA 2J42A 3UQBA 1YQBA 1BUIC 3AU4A 2D3AA 3R2TA 3UIPB 5CHWA 1VD2A 3AN1A 4ZHOA 4MM3A 4DBGA 1BMLC 1K50A 4FHKA 1XT9B 1PGAA 4MDKE 2W3SA 3K9OB 4ICUA 1YMHE 5G5HA 4AP4C 3PRMB 2KTFA 3T3NA 1SE3A 3AB5A 2Y5BB 3IFWB 1Y8RC 1IP9A 3DBLI 4AWJA 1WFYA 4TV3A 4WJPA 4ZDVA 2N9KA 2INDC 4RNAA 4I6LB 1C4AA 3A4RA 3ZNID 3V05A 4C7YA 4LNNA 3ZYYX 3UIOB 3QAQA 3MP9A 1RWSA 1V81A 4WJOA 3ZNZB 1MPEA 5BMIA 4XX5A 1ZP0B 2PJHA 2C7MB 1FXIA 1SGHA 3GB1A 3GS2A 2LGXA 2WXKA 4TQ1A 3U7ZA 1GNUA 1ESFA 4HJGE 3A9KA 5EE0A 2K1FA 3P4RB 3U7DA 4G11A 1PQSA 2L05A 2LGSA 3KW5B 1EU4A 2J7QB 3KVFB 1K52A 5CHFA 1QOBA 2D3CA 3DWGC 4KGSA 3KYDD 2BS3B 1HZ6A 1XEEA 1HXYD 1WH3A 4RM8A 2WXQA 3IXSA 3R7RA 1V86A 4OZCA 4XC2A 4O1NA 4TKNA 4PS7A 3W9CB 4URKA 2DZKA 3SFDB 3RUIB 5KHOA 2G3QB 1J7AA 3A1QB 1MG8A 1SIFA 2AQ3B 4W9IA 1UF0A 2YEPF 2H88B 2MX2A 1T0QC 1WGKA 3B9JA 3U2SC 2ZPNA 1FCCC 2L32A 1E8XA 3ZQ4A 3KLSX 4HVBA 2BWES 2ZW0A 1WX7A 3AV8A 1FD6A 2R61A 4MH0E 2IY0B 2JVCA 1K53A 4BBNF 3N20C 1LQBA 3EECA 1CZPA 2MBQA 3MHSD 4PYUA 3CIRB 4CYEA 4OZAA 3L54A 2RPVA 2QJLA 2DZJA 3BVMA 1XXGA 2BGFA 3AEGB 2DYOA 3DPDA 1V5TA 1J7BA 2PMVA 4A90A 3Q3MC 3N1YC 2QMTA 2V4IB 2J0JA 3R7QA 4II2B 5J18A 5LXHA 1L6UA 4FJYA 3MC9A 4A3OA 1XD3B 3H6NA 4Q2JA 1UD7A 2VH2A 4X57B 4A9AA 2XN9C 3KUZA 3WIMA 2BB5A 4OVUA 2M56B 2VRRB 2JYTA 1KJTA 3NVYA 3PHWB 1PDXA 3Q6BA 3PVLA 1NEKB 4G3XB 3ZJUA 4PS3A 4ANVA 1P9DU 2K39A 2O6VB 1ZPSA 2MJEA 1N5WA 2JUOA 1SJED 2NTTA 1RFKA 1VCBA 1TS3A 3O65B 4NQKE 5AZFA 4N6EB 1V2YA 4W9FA 1HZ5A 4GMVA 4I6NB 1WE6A 2EELA 2V0GA 5BYSA 1P3QU 2M17A 3RULA 5BMHA 1ACCA 3WAOA 2AL3A 3E56A 3D32A 2FCSA 2Y5CA 4AOFA 2ZCCA 3UINB 2SAKA 2WXLA 1JROA 2C60A 2G4DB 2E6XA 3AEEB 2CU3A 2YVCA 3ZDMC 3UF8A 2IO2B 3CF6E 4JL9A 2FCQA 3W1SC 1TY2A 4W9LA 2LRUA 2KMAA 2A4ZA 4WAAA 3WALA 3GZNB 1K8RB 2KN4A 4RM9A 3ENEA 1VZ7A 1YX5B 1NYRA 4GU2A 5JHAA 3A1QA 1GUAB 2INNE 3PLUA 4W9DA 2MA9B 3DDCB 2LVQA 3HVDA 4BFRA 3R3MA 4NZLB 1E90A 4PYZA 1M94A 4ANWA 3Q3FA 1D3ZA 2IZVB 1OTRB 3H7SA 4MSMB 3AE9B 2DYMA 4ZRJA 3AE8B 3GE8C 4G0NB 3SU8X 2XK5B 2N7JA 1RM6C 1E6EB 2WU5B 5C23A 1NDDA 1IYFA 2H89B 1HQRD 1CK1A 5T8IA 3VRBB 2ACZB 2AQ1B 4BKTA 1L2NA 2MJDA 2BKFA 4KVGB 2FCMA 2G4SA 2QHOA 4WJNA 5TSSA 2Z59B 3N9YC 2KKCA 4OZBA 1ZDVA 1FXAA 4F7ZA 3VTWA 3QIJA 4K7UA 1WZ3A 1WGRA 4I6PA 2WXFA 4B9KA 2WXNA 4RCOA 2BQQA 1R7SA 4NJ7A 3Q3JA 1QF6A 1V8CA 2IGHA 5J17A 1E7VA 3BY4B 3QX1A 2L83A 4FXCA 1WE7A 1AWDA 4HDOA 1OEYJ 3RT3B 3Q3NC 1QLBB 4GIVA 4WURA 2O6VA 2GBMA 3H8HA 4EFOA 4KZCA 2KLGA 1P98A 1KOTA 3TEXA 2QSDA 1SSNA 1I4GA 1UWMA 3ZVVA 1MVKA 2WDRB 2FAZA 3AU5A 2CU1A 3X23A 5G2NA 1V1PB 4LCDE 3NJTA 4NAMA 3I9V1 2DHZA 2RDBC 3AI5A 2M0XA 1CMXB 2RMMA 3V6EB 5HFYA 3PZ7A 1WGYA 4KGTA 2K25A 1WWTA 4GGQA 3NZSA 4YWGG 1CJEA 3EFCA 3HUIA 3ZW3A 3OWEB 3M63B 3P1MA 4WJQA 2D07B 2MBBB 3KYCD 3TJPA 2OHFA 4FBJB 3T8MA 2BS4B 4HJKA 1EWCA 1WI0A 1C79A 4YSZB 3RNEC 2KX0A 1IGCA 3RNGC 3DBRI 5L83A 2GRIA 2QC8A 2JQRB 1YIWA 4HEA1 3DQVA 2QIEB 4HCPB 1FO4A 2C5LC 4WAFA 2MLBA 2XK5A 5E6NA 4LK0M 1YOVB 2I38A 3J9CA 2KK8A 2M19A 4HDQA 4IW0A 4E71A 1SXTA 3ZTDA 5DPTA 1EO6A 3Q69A 3AE1B 2EKEC 2OEDA 3CSFA 2D3GA 3NVVA 4MT5A 3NS1A 2LUMA 5GXGB 1IBXB 1V49A 2Q5WD 3V60A 1A70A 2DAFA 4P1CC 1B1ZA 2KANA 2E3TA 2RSUA 1TS2A 3KH0A 2WXMA 2D2QA 1WY8A 2L3ZA 2MH7A 4B0EA 1RYJA 4S0RA 1A5RA 5IAAC 5EDSA 4M00A 1FFUA 4TMAB 1T5XD 3SD5A 1E9MA 3RCZA 4DHJD 2D3BA 2K5PA 3V6CB 1C77A 4H2AA 3WAMA 4XWTA 4EZJA 1NBFC 3C0RB 1QOFA 3BK1A 4GOCA 4N58A 1B9RA 1JRPA 3NUHB 2AL6A 3AEDB 1FNWA 2JT4B 1LFDA 1V1PA 2DZMA 4FN2A 2W55A 2Y3AA 2KHWB 3W5UB 4MH8A 5L95C 3VUXA 5BYRA 4PS8A 3VTUA 4K1RB 2KDIA 2MBOA 5DCNA 1WXQA 1I4XA 2X38A 3EA6A 2IYDB 2JZPA 3T9LA 3PZ8A 2D11A 3MJ5A 4W9HA 1YD8U 1S1QB 4F1SA 2KQ7A 1WXSA 2W54A 3B08A 4NAWB 4DHZB 4DWFA 3ONSA 2RR9A 4M8NA 1R4NB 2MSED 2ON8A 4HCNB 1KLGD 3LDZE 2ZNVC 1J0GA 1TGZB 1XLQA 3ZKJC 1PGXA 2R2OA 4J3OD 2KT7A 2LASA 1AN8A 2WDVB 4HROA 5JXVA 4BBNC 1S3SG 3BWUD 1JWMD 2GMIC 1F1HA 1C3TA 1JWAD 1WYGA 4MELA 4JWSC 3CWIA 5HHDG 3IG3A 3WAPA 1EWYC 3WA0A 3TCAA 1Q10A 3NOBA 4ASWC 3VXWA 4K81A 3NRZA 4IDIA 1PYWD 1IBXA 4B0MA 1ZW7A 2GI9A 2Y5PA 2KTRB 3PHXB 1UZXB 1IGDA 1WJUA 2VZKD 3MJWA 4REZA 4RFBA 1T0YA 3JYUA 5AUKA 3H1UA 3BVGA 2KYWA 2KFKB 2PE6B 2L7RA 3NS8A 4II3B 3OLMD 4XDCA 2ZW1A 2WXGA 3AE4B 3U8ZA 1X1MA 4BOZB 4DHZE 2BKRB 4ARIA 3AXCA 4C4VB 2J4XA 2C7NB 1E8WA 1XF5L 4YSXB 4UDUC 2O2VB 4AUQC 2R2QA 4LNIA 3VQIA 1FRRA 4BKSA 2BBCA 5DPSA 2ONQA 3VR9B 2JY6A 3NG0A 2GBRA 2WXJA 2DENB 1QOAA 2INCC 2N9XA 4LJOB 1QKZA 5EE9A 3VH4B 4GB9A 4YL8A 1PUTA 2D10A 4NQLB 2K6DB 2N7EA 1FCLA 4LTUA 3PRPB 5H92C 3KUDB 3ZLZA 2V3SA 2LHEA 3QK0A 1Z2MA 5FKAC 2RDHA 1RLFA 2I1JA 4W9GA 1ET9A 1TZ1A 4FULA 2SEBD 2L0FA 3RD2A 1I4HA 2KX3A 3BIID 4NAWA 4A55A 1I4PA 2HE7A 1QZEA 3APFA 3AEBB 2L1AA 4BAXA 3PZDA 4W9CA 1TKYA 3GZNI 2NBVB 1TJEA 3S2AA 1YN5A 3P63A 1FFVA 2REXA 4JE3B 2FIDA 2N9PC 2EMSA 5D7GA 3U30A 1FIQA 1TKEA 4MJSA 3RNBC 3HIZA 2WHIA 4A3PA 3OAWA 1FXTB 1KFYB 2KDFB 2KDMA 3UQAA 1VR9A 4AQ7A 1E8YA 2EKIA 3IBEA 1NVID 5BMGA 3TMPB 4LNOA 2NVUI 2V3PA 4KKIA 2LD9A 2WQYB 4DQOC 2KAJA 1N60A 1E7PB 1OFFA 1L4DB 1P0RA 2FUG1 3AE6B 4A6QA 3H7PB 2NBWB 3P4PB 3A33B 2WXHA 2NPTB 4WWNA 1D6EC 2KTRA 4KSLC 4HWIB 3ZRFA 3C19A 3ML9A 1E7UA 4QAYA 4IWOA 1UBQA 1HTOA 4IC7B 3FILB 2WXPA 3DCGA 4LDTD 2KFKA 2GBKA 1JCKB 4RH6A 1ROEA 4KV2A 1QQRA 3VRAB 1WSPA 5FR6A 3JW0X 4E3CA 3ECIA 4C4VA 2KNBA 4IM3A 2O2VA 3ZXRA 1NENB 2JSVX 3FKYA 2LVOA 4JPSA 1I7HA 3HM3A 4MACA 5JHBA 5E6OA 1PFDA 4NJCA 4KKJA 1WR6E 4MSQB 2ICIA 2WU2B 2FIFA 2BYEA 1JWUD 1L0XB 4M0WB 4EUTA 1GJZA 1I35A 2QILA 2I1KA 2DNFA 1GPXA 2Z0DB 1YNTE 3AMZA 4IM2A 3ZRCA 1DOXA 4LNKA 3MC8A 1FNUA 2KFJA 4KZ0A 3TIXA 2M1MA 1LGRA 1L0YB 3GP7A 3PSEB 2KZRA 1QOGA 4YTPB 4EEWA 3Q8CA 4CHKA 3AULA 1XQQA 2CJOA 1P7EA 2PPHA 2IGGA 4HPPA 5EE1A 3APCA 1GB1A 2KQ4X 2WXOA 1TKGA 2J53A 4GXBA 4F8CB 5E6PA 5D3IB 1I42A 2LXAA 2V4LA 1KM7A 2RDGA 2KO3A 1XLPA 2KVRA 1EM7A 5IN7A 3TEWA 2J52A 4BZAA 2K6QA 1TYGB 2FUHB 2MEKA 2JPHA 2IY1B 1OQRA 1RRBA 4CQNA 5AUIA 1TTNA 2M4NA 4EZLA 1F52A 1ZGUB 2LGDA 3IHPC 3H7PA 2X8XX 3JSVB 2BS2B 3ZDTA 3OJ4B 1VZ8A 1N6ZA 2RD0A 4OW0A 1JMLA 3AEAB 1YJ1A 1ET6A 2LEKA 2JYEA 5BYQA 2AEHA 1GOZA 4ITKA 2KOXA 4MGKE 5TR5A 4M01A 2J0KA 1C78A 3QCAA 5C2TB 5H8YE 3DBHB 1R4MI 3X0WA 2HJ8A 3TEYA 4FLHA 4TQ0A 3I3TB 2KC2A 4ZRIA 5IKCM 2DLBA 3GOEA 3VR8B 1F77A 1LM8B 2LHDA 1C4CA 2EMTA 2LGYA 1BT0A 2MJ3A 2KWUB 2KC1A 2K0PA 4XGAB 2IO1B 1J19A 2L76A 5I4DA 5DPRA 3RYTA 4ICVA 3MHZA 4M0WA 3EHVA 2UWQA 1P7FA 2DBYA 2MRPA 3ZJVA 3DHIC 1C1YB 4PK1A 2ZVNA 3RNFC 2MWSB 4DDID 1TT5B 1SE4A 2LVPA 2BVCA 5G55A 4FADA 3SEBA 3ETRA 1V80A 4MGYE 3HVZA 3V3XA 1SE2A 3DHHC 4L2YA 3HHMA 2PVGC 3LJ3A 3TBLD 1HTQA 2ZZPB 1NI2A 2JX5A 2LMCA 4WQOB 4ZOHC 4NY0A 4EOYA 2N9LA 3P2BA 1R4NI 1IPGA 3DVGX 1FNVA 3PV1A 3KWVA 4LNFA 4K3CA 2CHZA 1L6VA 3KUCB 2RGFA 2IBIB 4C80A 1WMHB 2KWVB 2PE9A 1FPYA 4WWMA 3RI7C 1SF0A 1KLUD 4FJVB 1LXDA 3BYYB 2PIAA 3MFGA 2LXCA 4JWUC 3AH7A 4WIPA 5DPWA 3NY5A 1WJ6A 3JSVA 3O13A 4K3BA 3RZFA 5J2RA 2JZ3B 2NCNA 3W1YA 1WXMA 1T0SC 1FRDA 3IVFA 2Z8LA 3SHQA 1IUEA 3IT4B 3QC8B 3U52E 1Q1OA 4YXDB 5CTRC 4HPLB 4M8MA
chains in the Genus database with same CATH topology
4C7ZA 1ZPSA 2MJEA 1N5WA 1SJED 2NTTA 1RFKA 4HKZE 1AW7A 1TS3A 4ARIA 4N6EB 2J4XA 3Q8EA 1XF5L 1HZ5A 4YSXB 1XLNA 4UDUC 4YT0B 2EELA 1GAQB 2V0GA 3W1SA 5BYSA 3VQIA 1FRRA 3NVWA 4XDDA 2BBCA 3UI3A 2ONQA 5BMHA 3VR9B 1ACCA 2WXJA 5E6JA 2LJIA 3E56A 1QOAA 1QKZA 5EE9A 2Y5CA 1PUTA 3MC0B 1FCLA 4LTUA 2INPE 2SAKA 3TSSA 2WXLA 4ZRPA 1JROA 2GB1A 5H92C 1D5XC 3Q8FA 4JX1C 2E6XA 3BVZA 2LHEA 3AEEB 2CU3A 1DOYA 1FEHA 5FKAC 1XO3A 2RDHA 2LGIA 3AM9A 3KQ4A 1MHHE 1ET9A 1TY2A 4LLGM 2SEBD 3AE5B 4YTMB 3SR6A 2KN4A 1SIJA 3R2IA 1C9FA 1TY0A 1VZ7A 1I4HA 3KWLA 3EUB2 2G9HD 3BIID 3P4QB 2BT6A 3BYTB 4A55A 1I4PA 3P4SB 1NYRA 3Q8BA 2NMQA 3LB8C 2TSSA 1VLBA 3AEBB 2INNE 2L1AA 2BW2A 5EE3A 1TKYA 2KWDA 1DYQA 3HVDA 2BTEA 1TJEA 1YN5A 3FC4A 3P63A 4NZLB 1N62A 2LFIA 1FFVA 4JE3B 5D7GA 5D3DA 1E10A 2WXRA 2PKOA 2DWQA 2CJNA 1FIQA 1NYQA 2DYMA 3AE9B 1TKEA 1GB4A 2KACA 3AE8B 4WQMA 3AE7B 4ZYSA 2N7JA 1HA5A 1E6EB 1RM6C 2WU5B 3RFZB 2IDYA 3T3OA 1JWSD 2H89B 2PW9A 3DWMA 5HG2A 1AYFA 1KFYB 2KDMA 3HRDD 1J7CA 1HQRD 4L23A 1VR9A 4AQ7A 4R3DA 1CK1A 5T8IA 3VRBB 3ZGZA 1KF6B 1SB3C 2ACZB 2EKIA 4MM3B 2AQ1B 2W3RA 3URYA 2WP9B 2MJDA 3W2DA 4RGOS 1ZDXA 3RPFC 1YJJA 1NVID 5BMGA 1D5ZC 1D5MC 5TSSA 3LXFA 2V3PA 4KKIA 2WQYB 4DQOC 2KAJA 2WXIA 1N60A 3N9YC 1E7PB 4KX6B 3BK2A 1OFFA 4OZBA 1L4DB 1FXAA 1ZDVA 2JWUA 1KTKA 2W82A 2FUG1 3AE6B 4A6QA 3P4PB 3I57A 4P16A 2WXFA 1LO5D 1K51A 2WXHA 4XE0A 1D6EC 2WXNA 4RCOA 1ENFA 3IT6B 4HKQA 1ZXHA 4IOIE 1FM0D 1R7SA 4YSYB 4C56C 1BXTA 3R8BA 1QF6A 1V8CA 2IGHA 5HI1A 2K22A 4DXFA 2FE8A 3FILB 2WXPA 2L52A 2L83A 1N63A 1L5PA 1DOIA 4FXCA 1AWDA 1ZXIA 1PGBA 1JCKB 4RH6A 1ROEA 1QLBB 1QQRA 3AEFB 4WURA 3VRAB 3ABVB 1ZUD2 1WSPA 3H8HA 1STEA 3TEXA 4DXGA 4ZHPA 1ZE3D 2QSDA 2WLBA 2BYTA 1SSNA 1T6BX 3IAS1 3NZ3A 2JSVX 1VDVA 1NENB 1I4QA 1I4GA 1UWXA 1C4PA 1UWMA 3EGRA 4JPSA 1I7HA 1MVKA 2WDRB 3FAHA 2M0AA 1M4VA 3AE3B 4USAA 1JWBD 4MACA 1PFDA 4NJCA 4KKJA 1L4ZB 1V1PB 2ICIA 2WU2B 3ZJTA 1JWUD 1L0XB 4NAMA 2QILA 3I9V1 3PO0A 4TSSA 3WCQA 2N0SB 1GPXA 2IPKD 1CQVA 2XNAC 2V3NA 4P6VF 1SBBB 4OVZA 1YNTE 3AMZA 1FMAD 5FK9C 1VRAB 2YEPB 2JXTA 3SFEB 1DOXA 2RMMA 2IGDA 1YN4A 1FNUA 4KGRA 1F2RI 4IKGA 1L0YB 5HFYA 3GP7A 3PZ7A 2HDEA 4KGTA 2WDQB 1QOGA 1TS4A 2BB6A 4RGMA 1WWTA 4GDLB 4YTPB 2HTME 4YWGG 1CJEA 3Q8CA 3HUIA 1KH0A 3OWEB 3P1MA 4RGNA 3C8YA 1YJIA 1JW9D 1N61A 2CJOA 1P7EA 2OHFA 2IGGA 5EE1A 1C76A 5C3JB 2BS4B 1MHXA 1VZ6A 1XLOA 1EWCA 1GB1A 2KQ4X 2G1EA 1C79A 2WXOA 3W5VB 4YSZB 1IGCA 1TKGA 2GRIA 2AX5A 1TS5A 2J53A 2JQRB 1E0ZA 4A8XC 3E9SA 2WNMA 4HEA1 1OQQA 4GLSC 5D3IB 2QIEB 2KMMA 1FO4A 4XWWA 4WAFA 5FR3A 1I4RA 4RF0A 4LK0M 1F0ZA 5G5GA 4ZRQA 2J42A 2I38A 3J9CA 4OHJA 3NVZA 2RDGA 1XLPA 1BUIC 2M19A 3R2TA 1EM7A 3TEWA 2J52A 3AN1A 1SXTA 4ZHOA 1TYGB 1VJKA 2MEKA 3Q69A 2K9XA 1BMLC 1K50A 3AE1B 1OQRA 4RF1A 2OEDA 1V97A 4CQNA 2PTLA 5AUIA 1PGAA 3NVVA 4MT5A 2W3SA 1YMHE 5G5HA 2WS3B 3NS1A 2LUMA 5GXGB 1IBXB 1NI3A 3Q8AA 3T3NA 1SE3A 2Q5WD 3AB5A 2AQ2B 1A70A 1JQ4A 3BZDB 1B1ZA 2BS2B 2E3TA 2D5GA 1TS2A 1XCQL 2WXMA 1VZ8A 3TUOA 2I2YA 2N9KA 2MH7A 4OW0A 4ARCA 1JMLA 3AEAB 1ET6A 2LEKA 2JYEA 5BYQA 4RNAA 4B0EA 1GOZA 4ITKA 1C4AA 1RYJA 3B2FA 3V05A 2B76B 1C78A 5C2TB 4C7YA 5H8YE 3ZYYX 1FFUA 4TMAB 1T5XD 3MP9A 1E9MA 1RWSA 2K5PA 3AE2B 1ZOYB 4TQ0A 3TEYA 2JU6X 1MPEA 1C77A 4HRSA 4H2AA 5BMIA 3TEZA 1TZOA 1V1OA 1ZP0B 2DLBA 1F77A 4XWTA 3VR8B 1FXIA 2LHDA 1QOFA 1C4CA 2FBWB 3BK1A 3GB1A 3GS2A 4N58A 2WXKA 1KRHA 4US8A 1B9RA 4TQ1A 3U7ZA 1SEBD 1JRPA 2MJ3A 3NUHB 1ESFA 4HJGE 3AEDB 2K0PA 5EE0A 1FNWA 4N59A 3P4RB 1Y56A 5I4DA 4WH4A 1V1PA 4D2KA 1EU4A 1K52A 2W55A 2Y3AA 3MHZA 4M0WA 1P7FA 1EU3A 1QOBA 5MPOA 3DWGC 3W5UB 1XCTL 1MI0A 2DBYA 1L0VB 4MH8A 4KGSA 1DGJA 3ZJVA 5BYRA 2BS3B 1HZ6A 1XEEA 1HXYD 1WXQA 1I4XA 1QILA 2X38A 3P42A 3EA6A 1N5XA 2JZPA 1SE4A 2WXQA 3IXSA 3PZ8A 4GDKB 4OZCA 3MJ5A 4O1NA 3SEBA 3ETRA 1YN3A 1YQ4B 3W9CB 2W54A 3HVZA 1UNSA 3V3XA 1SE2A 4NAWB 3SFDB 4L2YA 1J7AA 1F2RC 2PVGC 2AQ3B 2K3UA 2ON8A 1KLGD 3IAM1 2JX5A 4PT5A 2NTSA 2YEPF 2PLPA 2H88B 2LMCA 4ZOHC 1XLQA 1YQ3B 1WGKA 1PGXA 3B9JA 3U2SC 1FCCC 2L32A 3L4PA 2N9LA 4J3OD 3ZQ4A 1QT9A 3KLSX 2ZW0A 3AV8A 1FD6A 2R61A 1UGJA 1AN8A 2WDVB 4HROA 1JALA 1FNVA 1K53A 3KWVA 4L1BA 5JXVA 3AECB 1UUPA 5LNK1 1CZPA 3BWUD 1JWMD 3CIRB 1L6VA 1SJHD 2PVOD 1JWAD 1WYGA 4OZAA 4JWSC 4US9A 4YTNB 3CWIA 5HHDG 2VZKB 4C80A 2QEJC 1EWYC 2RPVA 2QJLA 3BVMA 1XXGA 1Q10A 1D4BA 3AEGB 2DYOA 4RGTA 3U4EG 4WWMA 1J7BA 1SF0A 2PMVA 1KLUD 4A90A 3NRZA 4IDIA 1WRIA 2QMTA 1PYWD 2V4IB 3BYYB 2PIAA 3MFGA 1L6UA 1IBXA 4JWUC 3B2GA 4B0MA 3AH7A 4WIPA 4Q2JA 2GI9A 3O13A 2Y5PA 3LYYA 1T3QA 1IGDA 4A9AA 2VZKD 2XN9C 4REZA 2BB5A 4RFBA 2M56B 4AS1A 2JYTA 3FILA 3NVYA 5AUKA 1FRDA 1PDXA 2IJ0A 2Z8LA 3BVGA 4EE2A 1NEKB 1IUEA 3IT4B 3U52E 4XDCA 3ZJUA 4YXDB 2ZW1A 2WXGA 3AE4B 1HEZE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MEK A; 
#chains in the Genus database with same CATH topology
 4C7Z A;  2LJ5 A;  3QJZ A;  1AW7 A;  2WDT B;  4P7I A;  2GOW A;  3Q8E A;  3UGB B;  5JZE B;  1XLN A;  5IA7 A;  1GAQ B;  3B0A A;  2QDF A;  4XDD A;  3UI3 A;  4HLE A;  3VUY A;  1WIA A;  5CHV C;  1MG4 A;  2IO0 B;  2O6V D;  2INP E;  1ZKH A;  1Q5W B;  2GB1 A;  1D5X C;  2N4F A;  1U4A A;  3BVZ A;  3ZUN A;  1Q0W B;  1DOY A;  4NJ6 A;  4K7W A;  4EZK A;  2LGI A;  1MHH E;  4LLG M;  3PT2 B;  4YTM B;  1MFW A;  1TIF A;  1SIJ A;  2K8B A;  4W9K A;  3VTV A;  1C9F A;  1TY0 A;  1RAX A;  3KWL A;  1E8Z A;  3P4Q B;  2BT6 A;  2BYF A;  3P4S B;  2NMQ A;  2TSS A;  2G45 B;  3L16 A;  2C7H A;  3ZNG C;  3DBR B;  2KWD A;  3M62 B;  5IP4 D;  2PEA A;  2L8J A;  3FC4 A;  3V62 A;  3ZTC A;  1N62 A;  2LFI A;  2LI5 A;  5CX3 A;  5D3D A;  2WXR A;  2PKO A;  2CJN A;  1NYQ A;  1RFA A;  2QCZ A;  3DVG Y;  2KAC A;  4RMA A;  3EC8 A;  1HA5 A;  2Z0E B;  2IDY A;  4KDI C;  3T3O A;  2CKH B;  1JWS D;  5HG2 A;  1MJD A;  1AYF A;  1J7C A;  4HXD A;  2KXJ A;  3PGE A;  4R3D A;  3ZGZ A;  1SB3 C;  1ISN A;  1WMH A;  2WP9 B;  4RGO S;  1ZDX A;  3RPF C;  1YJJ A;  1WJN A;  3LXF A;  4B6W A;  4ANU A;  2CR5 A;  2WXI A;  2M8S A;  3L13 A;  4IWP A;  2JWU A;  2BWF A;  2W82 A;  5AEK B;  4M02 A;  1GG3 A;  1K51 A;  4XE0 A;  4HK2 A;  1JRU A;  4IWQ A;  4HKQ A;  1ZXH A;  4IOI E;  1FM0 D;  1TBE A;  3R8B A;  4C56 C;  4IUM B;  2NR2 A;  2YLM A;  2K22 A;  2WWZ A;  4DXF A;  3N1Z C;  3B1L X;  2L52 A;  2KVZ A;  1L5P A;  4JIO U;  4NPN A;  4MEM A;  4P1B C;  2JF5 A;  3VDZ A;  2W9N A;  3QAR A;  1STE A;  1WGD A;  2KMC A;  3PS6 A;  4DXG A;  2NBU A;  4ZHP A;  1ZE3 D;  2BYT A;  1T6B X;  3IAS 1;  3NZ3 A;  1I4Q A;  1VDV A;  1UWX A;  3EGR A;  5D6J B;  1EF5 A;  1WZ0 A;  1M4V A;  3AE3 B;  4USA A;  1JWB D;  3DHG C;  4FHJ A;  1V5O A;  4IM0 A;  4S17 A;  3ZJT A;  3L0W B;  4TSS A;  3PO0 A;  2IPK D;  1CQV A;  2XNA C;  2LUE A;  4P6V F;  1SBB B;  5GMV A;  1WXV A;  1FMA D;  5FK9 C;  2RPQ A;  4KGR A;  1F2R I;  4MGI E;  2HDE A;  2WDQ B;  5AZH A;  1TS4 A;  2KJR A;  2WX1 A;  4RGM A;  4GDL B;  2MBH A;  2HD5 B;  3PRE A;  3WAN A;  4JGH B;  3C8Y A;  5BO4 B;  1C76 A;  3QQ8 B;  2MBE A;  1MHX A;  3APD A;  2MQJ A;  2ZPY A;  1VZ6 A;  2MCN B;  2G1E A;  1TS5 A;  1E0Z A;  4A8X C;  3RNC C;  1OQQ A;  2UYZ B;  5D94 A;  3K9P B;  4XWW A;  1I4R A;  4RF0 A;  3QWZ B;  1UGM A;  5JH5 C;  4ANX A;  3PPA A;  4OHJ A;  3NVZ A;  5D2M B;  3PTF C;  1GC7 A;  2BPS A;  3PRZ A;  4W9E A;  4KSK C;  5LXI B;  1VJK A;  2K9X A;  1WJ4 A;  4RF1 A;  3RN9 C;  1V97 A;  2PTL A;  3DBL B;  3L17 A;  1WRD B;  4LJP B;  3I5J C;  4DK5 A;  2WS3 B;  4DHJ B;  1NI3 A;  3Q8A A;  2AQ2 B;  2KWC A;  5IO9 A;  5LLI A;  4GSW A;  1JQ4 A;  3BZD B;  4N9F 4;  2L00 B;  2D5G A;  1XCQ L;  3TUO A;  1UBI A;  4ARC A;  1UH6 A;  2JZZ A;  2KQS A;  3B2F A;  4TUU A;  1WR1 A;  2B76 B;  3RNA C;  1H8C A;  1WM2 A;  3QA8 A;  3AE2 B;  2I2Y A;  1ZOY B;  2JU6 X;  3TEZ A;  4HRS A;  1TZO A;  1V1O A;  2FBW B;  1KRH A;  3DBH I;  3JVZ X;  1SE9 A;  4WWP A;  4US8 A;  2AYO B;  1SEB D;  4A20 A;  1WM3 A;  2VH1 A;  4OVV A;  2N1V A;  4N59 A;  1Y56 A;  5HKH A;  2GLS A;  4WH4 A;  3Q2A C;  4D2K A;  3ZIM A;  1EU3 A;  3VHT C;  2MP2 B;  5MPO A;  1XCT L;  1MI0 A;  2JRH A;  1L0V B;  3HM6 X;  1DGJ A;  3N3K B;  2XBB C;  1QIL A;  3VVW B;  3P42 A;  1N5X A;  2KLC A;  2FNJ B;  2MW5 A;  3OJ3 A;  3QHT A;  4GDK B;  2C9W B;  4BKS D;  1YN3 A;  1YQ4 B;  2OJW A;  4GDL A;  1UNS A;  2KDB A;  1WYW B;  2N9E B;  1F2R C;  4NNJ B;  2K3U A;  3IAM 1;  2BF8 B;  3PLV A;  4PT5 A;  2J0M A;  2NTS A;  2PLP A;  1YQ3 B;  3L4P A;  1QT9 A;  1J8C A;  3SDL C;  4IG7 B;  1UGJ A;  1JAL A;  4L1B A;  3AEC B;  1UUP A;  5LNK 1;  1WF9 A;  1SJH D;  2PVO D;  2L0T A;  4US9 A;  1WGH A;  4YTN B;  1WGG A;  2VZK B;  2QEJ C;  2ASQ A;  1OEY A;  1Z5S B;  4E74 A;  1D4B A;  2KJH B;  5KHQ A;  3Q14 C;  3R66 C;  4RGT A;  3U4E G;  4B95 A;  2JRI B;  4MGZ E;  1WRI A;  4FJZ A;  2NPT A;  2B3A A;  3B2G A;  2DYB A;  2DZI A;  3I63 C;  3LYY A;  1T3Q A;  1AAR A;  2KN5 A;  4AS1 A;  3FIL A;  4ACF A;  2JXX A;  3DVN U;  2IJ0 A;  2ZJD A;  4EE2 A;  3A4S C;  1H4R A;  3GE3 C;  5IOI A;  4C00 A;  1HEZ E;  3A9J B;  4WWO A;  3NZU A;  3N30 A;  4HKZ E;  4EKU A;  1KLV A;  4J6I A;  2OJR A;  4YT0 B;  3Q3O C;  2CHW A;  3RMK C;  2GBJ A;  3W1S A;  3RZW C;  3NVW A;  3ML8 A;  3DVN V;  5E6J A;  2LJI A;  2FCN A;  2KJ6 A;  2HJ1 A;  4JQW C;  3MC0 B;  2MP2 A;  3CMM B;  3TSS A;  4ZRP A;  3Q8F A;  4JX1 C;  2AWT A;  4G50 A;  1FEH A;  1XO3 A;  3N32 A;  3AM9 A;  2OOB B;  2DX5 B;  3KQ4 A;  4GDK A;  4KIK B;  3AE5 B;  1L7Y A;  3SR6 A;  2XEW A;  2V1Y A;  3R2I A;  5AZG A;  3EUB 2;  2G9H D;  3BYT B;  4W9J A;  3Q8B A;  3LB8 C;  1VLB A;  2N7D A;  2BW2 A;  5EE3 A;  1DYQ A;  3MTN B;  2BTE A;  2K8C A;  1V6E A;  1E10 A;  3V61 A;  2DWQ A;  1GB4 A;  2MHJ A;  3AE7 B;  4WQM A;  4AJY B;  4ZYS A;  2JWZ A;  2KD0 A;  3RFZ B;  1GC6 A;  1YX6 B;  2PW9 A;  3M3J A;  3DWM A;  3NHE B;  3HRD D;  3ZO5 B;  2A5U A;  4DXA B;  4L23 A;  1UEL A;  3VUW A;  3ZXV A;  4K7S A;  1KF6 B;  4XZ4 A;  4MM3 B;  2HTH A;  2IO3 B;  2W3R A;  3URY A;  3W2D A;  3VAW A;  1E5W A;  1WX8 A;  1D5Z C;  4LDT B;  1D5M C;  2DAJ A;  3ZNH B;  4DDG D;  4KX6 B;  1P1A A;  3BK2 A;  2ZCB A;  1KTK A;  3HK0 A;  3I57 A;  1V9J A;  4P16 A;  1LO5 D;  1OGW A;  1ENF A;  3IT6 B;  4YSY B;  1BXT A;  5HI1 A;  3OG5 A;  3CST A;  1R4M B;  2FE8 A;  1N63 A;  1DOI A;  1ZXI A;  1PGB A;  3DOW A;  3A9J A;  3AEF B;  1OQY A;  3ABV B;  1EUV B;  1ZUD 2;  2V9H A;  3VFK A;  2WGS A;  4ZYN A;  2CS4 A;  2LZ6 A;  3L08 A;  2WLB A;  1C4P A;  2KDE B;  3A9K B;  3EFU A;  3FAH A;  2M0A A;  1L4Z B;  4AJW A;  2K8H A;  2UU7 A;  1HE8 A;  2ZVO A;  3WCQ A;  2N0S B;  4ZRK A;  1T0R C;  2V3N A;  4OVZ A;  2LWP A;  2ZNV B;  1VRA B;  2WX0 A;  2YEP B;  2JXT A;  4GN1 A;  3SFE B;  2NS5 A;  1F9J A;  2IGD A;  1YN4 A;  4HPM B;  4IKG A;  4JLC A;  4KDL B;  1G6J A;  3ALB A;  1WXA A;  4KIK A;  2BB6 A;  2LRW A;  4XYC A;  2HTM E;  2BYV E;  4CO7 A;  3H9D A;  1KH0 A;  4RGN A;  2N1W A;  1YJI A;  1JW9 D;  1N61 A;  4BVU C;  5C3J B;  3L10 B;  1XLO A;  2GBN A;  4BOS C;  5C1Z A;  3W5V B;  4FA6 A;  2AX5 A;  3M95 A;  3N1X C;  4BKG A;  3VH3 B;  1WX9 A;  3BIN A;  3E9S A;  2WNM A;  4GLS C;  2ZEQ A;  2WYQ A;  2KMM A;  3TL5 A;  1EF1 A;  2CHX A;  5FR3 A;  3DBS A;  1F0Z A;  5G5G A;  4MJS B;  4ZRQ A;  2J42 A;  3UQB A;  1YQB A;  1BUI C;  3AU4 A;  2D3A A;  3R2T A;  3UIP B;  5CHW A;  1VD2 A;  3AN1 A;  4ZHO A;  4MM3 A;  4DBG A;  1BML C;  1K50 A;  4FHK A;  1XT9 B;  1PGA A;  4MDK E;  2W3S A;  3K9O B;  4ICU A;  1YMH E;  5G5H A;  4AP4 C;  3PRM B;  2KTF A;  3T3N A;  1SE3 A;  3AB5 A;  2Y5B B;  3IFW B;  1Y8R C;  1IP9 A;  3DBL I;  4AWJ A;  1WFY A;  4TV3 A;  4WJP A;  4ZDV A;  2N9K A;  2IND C;  4RNA A;  4I6L B;  1C4A A;  3A4R A;  3ZNI D;  3V05 A;  4C7Y A;  4LNN A;  3ZYY X;  3UIO B;  3QAQ A;  3MP9 A;  1RWS A;  1V81 A;  4WJO A;  3ZNZ B;  1MPE A;  5BMI A;  4XX5 A;  1ZP0 B;  2PJH A;  2C7M B;  1FXI A;  1SGH A;  3GB1 A;  3GS2 A;  2LGX A;  2WXK A;  4TQ1 A;  3U7Z A;  1GNU A;  1ESF A;  4HJG E;  3A9K A;  5EE0 A;  2K1F A;  3P4R B;  3U7D A;  4G11 A;  1PQS A;  2L05 A;  2LGS A;  3KW5 B;  1EU4 A;  2J7Q B;  3KVF B;  1K52 A;  5CHF A;  1QOB A;  2D3C A;  3DWG C;  4KGS A;  3KYD D;  2BS3 B;  1HZ6 A;  1XEE A;  1HXY D;  1WH3 A;  4RM8 A;  2WXQ A;  3IXS A;  3R7R A;  1V86 A;  4OZC A;  4XC2 A;  4O1N A;  4TKN A;  4PS7 A;  3W9C B;  4URK A;  2DZK A;  3SFD B;  3RUI B;  5KHO A;  2G3Q B;  1J7A A;  3A1Q B;  1MG8 A;  1SIF A;  2AQ3 B;  4W9I A;  1UF0 A;  2YEP F;  2H88 B;  2MX2 A;  1T0Q C;  1WGK A;  3B9J A;  3U2S C;  2ZPN A;  1FCC C;  2L32 A;  1E8X A;  3ZQ4 A;  3KLS X;  4HVB A;  2BWE S;  2ZW0 A;  1WX7 A;  3AV8 A;  1FD6 A;  2R61 A;  4MH0 E;  2IY0 B;  2JVC A;  1K53 A;  4BBN F;  3N20 C;  1LQB A;  3EEC A;  1CZP A;  2MBQ A;  3MHS D;  4PYU A;  3CIR B;  4CYE A;  4OZA A;  3L54 A;  2RPV A;  2QJL A;  2DZJ A;  3BVM A;  1XXG A;  2BGF A;  3AEG B;  2DYO A;  3DPD A;  1V5T A;  1J7B A;  2PMV A;  4A90 A;  3Q3M C;  3N1Y C;  2QMT A;  2V4I B;  2J0J A;  3R7Q A;  4II2 B;  5J18 A;  5LXH A;  1L6U A;  4FJY A;  3MC9 A;  4A3O A;  1XD3 B;  3H6N A;  4Q2J A;  1UD7 A;  2VH2 A;  4X57 B;  4A9A A;  2XN9 C;  3KUZ A;  3WIM A;  2BB5 A;  4OVU A;  2M56 B;  2VRR B;  2JYT A;  1KJT A;  3NVY A;  3PHW B;  1PDX A;  3Q6B A;  3PVL A;  1NEK B;  4G3X B;  3ZJU A;  4PS3 A;  4ANV A;  1P9D U;  2K39 A;  2O6V B;  1ZPS A;  2MJE A;  1N5W A;  2JUO A;  1SJE D;  2NTT A;  1RFK A;  1VCB A;  1TS3 A;  3O65 B;  4NQK E;  5AZF A;  4N6E B;  1V2Y A;  4W9F A;  1HZ5 A;  4GMV A;  4I6N B;  1WE6 A;  2EEL A;  2V0G A;  5BYS A;  1P3Q U;  2M17 A;  3RUL A;  5BMH A;  1ACC A;  3WAO A;  2AL3 A;  3E56 A;  3D32 A;  2FCS A;  2Y5C A;  4AOF A;  2ZCC A;  3UIN B;  2SAK A;  2WXL A;  1JRO A;  2C60 A;  2G4D B;  2E6X A;  3AEE B;  2CU3 A;  2YVC A;  3ZDM C;  3UF8 A;  2IO2 B;  3CF6 E;  4JL9 A;  2FCQ A;  3W1S C;  1TY2 A;  4W9L A;  2LRU A;  2KMA A;  2A4Z A;  4WAA A;  3WAL A;  3GZN B;  1K8R B;  2KN4 A;  4RM9 A;  3ENE A;  1VZ7 A;  1YX5 B;  1NYR A;  4GU2 A;  5JHA A;  3A1Q A;  1GUA B;  2INN E;  3PLU A;  4W9D A;  2MA9 B;  3DDC B;  2LVQ A;  3HVD A;  4BFR A;  3R3M A;  4NZL B;  1E90 A;  4PYZ A;  1M94 A;  4ANW A;  3Q3F A;  1D3Z A;  2IZV B;  1OTR B;  3H7S A;  4MSM B;  3AE9 B;  2DYM A;  4ZRJ A;  3AE8 B;  3GE8 C;  4G0N B;  3SU8 X;  2XK5 B;  2N7J A;  1RM6 C;  1E6E B;  2WU5 B;  5C23 A;  1NDD A;  1IYF A;  2H89 B;  1HQR D;  1CK1 A;  5T8I A;  3VRB B;  2ACZ B;  2AQ1 B;  4BKT A;  1L2N A;  2MJD A;  2BKF A;  4KVG B;  2FCM A;  2G4S A;  2QHO A;  4WJN A;  5TSS A;  2Z59 B;  3N9Y C;  2KKC A;  4OZB A;  1ZDV A;  1FXA A;  4F7Z A;  3VTW A;  3QIJ A;  4K7U A;  1WZ3 A;  1WGR A;  4I6P A;  2WXF A;  4B9K A;  2WXN A;  4RCO A;  2BQQ A;  1R7S A;  4NJ7 A;  3Q3J A;  1QF6 A;  1V8C A;  2IGH A;  5J17 A;  1E7V A;  3BY4 B;  3QX1 A;  2L83 A;  4FXC A;  1WE7 A;  1AWD A;  4HDO A;  1OEY J;  3RT3 B;  3Q3N C;  1QLB B;  4GIV A;  4WUR A;  2O6V A;  2GBM A;  3H8H A;  4EFO A;  4KZC A;  2KLG A;  1P98 A;  1KOT A;  3TEX A;  2QSD A;  1SSN A;  1I4G A;  1UWM A;  3ZVV A;  1MVK A;  2WDR B;  2FAZ A;  3AU5 A;  2CU1 A;  3X23 A;  5G2N A;  1V1P B;  4LCD E;  3NJT A;  4NAM A;  3I9V 1;  2DHZ A;  2RDB C;  3AI5 A;  2M0X A;  1CMX B;  2RMM A;  3V6E B;  5HFY A;  3PZ7 A;  1WGY A;  4KGT A;  2K25 A;  1WWT A;  4GGQ A;  3NZS A;  4YWG G;  1CJE A;  3EFC A;  3HUI A;  3ZW3 A;  3OWE B;  3M63 B;  3P1M A;  4WJQ A;  2D07 B;  2MBB B;  3KYC D;  3TJP A;  2OHF A;  4FBJ B;  3T8M A;  2BS4 B;  4HJK A;  1EWC A;  1WI0 A;  1C79 A;  4YSZ B;  3RNE C;  2KX0 A;  1IGC A;  3RNG C;  3DBR I;  5L83 A;  2GRI A;  2QC8 A;  2JQR B;  1YIW A;  4HEA 1;  3DQV A;  2QIE B;  4HCP B;  1FO4 A;  2C5L C;  4WAF A;  2MLB A;  2XK5 A;  5E6N A;  4LK0 M;  1YOV B;  2I38 A;  3J9C A;  2KK8 A;  2M19 A;  4HDQ A;  4IW0 A;  4E71 A;  1SXT A;  3ZTD A;  5DPT A;  1EO6 A;  3Q69 A;  3AE1 B;  2EKE C;  2OED A;  3CSF A;  2D3G A;  3NVV A;  4MT5 A;  3NS1 A;  2LUM A;  5GXG B;  1IBX B;  1V49 A;  2Q5W D;  3V60 A;  1A70 A;  2DAF A;  4P1C C;  1B1Z A;  2KAN A;  2E3T A;  2RSU A;  1TS2 A;  3KH0 A;  2WXM A;  2D2Q A;  1WY8 A;  2L3Z A;  2MH7 A;  4B0E A;  1RYJ A;  4S0R A;  1A5R A;  5IAA C;  5EDS A;  4M00 A;  1FFU A;  4TMA B;  1T5X D;  3SD5 A;  1E9M A;  3RCZ A;  4DHJ D;  2D3B A;  2K5P A;  3V6C B;  1C77 A;  4H2A A;  3WAM A;  4XWT A;  4EZJ A;  1NBF C;  3C0R B;  1QOF A;  3BK1 A;  4GOC A;  4N58 A;  1B9R A;  1JRP A;  3NUH B;  2AL6 A;  3AED B;  1FNW A;  2JT4 B;  1LFD A;  1V1P A;  2DZM A;  4FN2 A;  2W55 A;  2Y3A A;  2KHW B;  3W5U B;  4MH8 A;  5L95 C;  3VUX A;  5BYR A;  4PS8 A;  3VTU A;  4K1R B;  2KDI A;  2MBO A;  5DCN A;  1WXQ A;  1I4X A;  2X38 A;  3EA6 A;  2IYD B;  2JZP A;  3T9L A;  3PZ8 A;  2D11 A;  3MJ5 A;  4W9H A;  1YD8 U;  1S1Q B;  4F1S A;  2KQ7 A;  1WXS A;  2W54 A;  3B08 A;  4NAW B;  4DHZ B;  4DWF A;  3ONS A;  2RR9 A;  4M8N A;  1R4N B;  2MSE D;  2ON8 A;  4HCN B;  1KLG D;  3LDZ E;  2ZNV C;  1J0G A;  1TGZ B;  1XLQ A;  3ZKJ C;  1PGX A;  2R2O A;  4J3O D;  2KT7 A;  2LAS A;  1AN8 A;  2WDV B;  4HRO A;  5JXV A;  4BBN C;  1S3S G;  3BWU D;  1JWM D;  2GMI C;  1F1H A;  1C3T A;  1JWA D;  1WYG A;  4MEL A;  4JWS C;  3CWI A;  5HHD G;  3IG3 A;  3WAP A;  1EWY C;  3WA0 A;  3TCA A;  1Q10 A;  3NOB A;  4ASW C;  3VXW A;  4K81 A;  3NRZ A;  4IDI A;  1PYW D;  1IBX A;  4B0M A;  1ZW7 A;  2GI9 A;  2Y5P A;  2KTR B;  3PHX B;  1UZX B;  1IGD A;  1WJU A;  2VZK D;  3MJW A;  4REZ A;  4RFB A;  1T0Y A;  3JYU A;  5AUK A;  3H1U A;  3BVG A;  2KYW A;  2KFK B;  2PE6 B;  2L7R A;  3NS8 A;  4II3 B;  3OLM D;  4XDC A;  2ZW1 A;  2WXG A;  3AE4 B;  3U8Z A;  1X1M A;  4BOZ B;  4DHZ E;  2BKR B;  4ARI A;  3AXC A;  4C4V B;  2J4X A;  2C7N B;  1E8W A;  1XF5 L;  4YSX B;  4UDU C;  2O2V B;  4AUQ C;  2R2Q A;  4LNI A;  3VQI A;  1FRR A;  4BKS A;  2BBC A;  5DPS A;  2ONQ A;  3VR9 B;  2JY6 A;  3NG0 A;  2GBR A;  2WXJ A;  2DEN B;  1QOA A;  2INC C;  2N9X A;  4LJO B;  1QKZ A;  5EE9 A;  3VH4 B;  4GB9 A;  4YL8 A;  1PUT A;  2D10 A;  4NQL B;  2K6D B;  2N7E A;  1FCL A;  4LTU A;  3PRP B;  5H92 C;  3KUD B;  3ZLZ A;  2V3S A;  2LHE A;  3QK0 A;  1Z2M A;  5FKA C;  2RDH A;  1RLF A;  2I1J A;  4W9G A;  1ET9 A;  1TZ1 A;  4FUL A;  2SEB D;  2L0F A;  3RD2 A;  1I4H A;  2KX3 A;  3BII D;  4NAW A;  4A55 A;  1I4P A;  2HE7 A;  1QZE A;  3APF A;  3AEB B;  2L1A A;  4BAX A;  3PZD A;  4W9C A;  1TKY A;  3GZN I;  2NBV B;  1TJE A;  3S2A A;  1YN5 A;  3P63 A;  1FFV A;  2REX A;  4JE3 B;  2FID A;  2N9P C;  2EMS A;  5D7G A;  3U30 A;  1FIQ A;  1TKE A;  4MJS A;  3RNB C;  3HIZ A;  2WHI A;  4A3P A;  3OAW A;  1FXT B;  1KFY B;  2KDF B;  2KDM A;  3UQA A;  1VR9 A;  4AQ7 A;  1E8Y A;  2EKI A;  3IBE A;  1NVI D;  5BMG A;  3TMP B;  4LNO A;  2NVU I;  2V3P A;  4KKI A;  2LD9 A;  2WQY B;  4DQO C;  2KAJ A;  1N60 A;  1E7P B;  1OFF A;  1L4D B;  1P0R A;  2FUG 1;  3AE6 B;  4A6Q A;  3H7P B;  2NBW B;  3P4P B;  3A33 B;  2WXH A;  2NPT B;  4WWN A;  1D6E C;  2KTR A;  4KSL C;  4HWI B;  3ZRF A;  3C19 A;  3ML9 A;  1E7U A;  4QAY A;  4IWO A;  1UBQ A;  1HTO A;  4IC7 B;  3FIL B;  2WXP A;  3DCG A;  4LDT D;  2KFK A;  2GBK A;  1JCK B;  4RH6 A;  1ROE A;  4KV2 A;  1QQR A;  3VRA B;  1WSP A;  5FR6 A;  3JW0 X;  4E3C A;  3ECI A;  4C4V A;  2KNB A;  4IM3 A;  2O2V A;  3ZXR A;  1NEN B;  2JSV X;  3FKY A;  2LVO A;  4JPS A;  1I7H A;  3HM3 A;  4MAC A;  5JHB A;  5E6O A;  1PFD A;  4NJC A;  4KKJ A;  1WR6 E;  4MSQ B;  2ICI A;  2WU2 B;  2FIF A;  2BYE A;  1JWU D;  1L0X B;  4M0W B;  4EUT A;  1GJZ A;  1I35 A;  2QIL A;  2I1K A;  2DNF A;  1GPX A;  2Z0D B;  1YNT E;  3AMZ A;  4IM2 A;  3ZRC A;  1DOX A;  4LNK A;  3MC8 A;  1FNU A;  2KFJ A;  4KZ0 A;  3TIX A;  2M1M A;  1LGR A;  1L0Y B;  3GP7 A;  3PSE B;  2KZR A;  1QOG A;  4YTP B;  4EEW A;  3Q8C A;  4CHK A;  3AUL A;  1XQQ A;  2CJO A;  1P7E A;  2PPH A;  2IGG A;  4HPP A;  5EE1 A;  3APC A;  1GB1 A;  2KQ4 X;  2WXO A;  1TKG A;  2J53 A;  4GXB A;  4F8C B;  5E6P A;  5D3I B;  1I42 A;  2LXA A;  2V4L A;  1KM7 A;  2RDG A;  2KO3 A;  1XLP A;  2KVR A;  1EM7 A;  5IN7 A;  3TEW A;  2J52 A;  4BZA A;  2K6Q A;  1TYG B;  2FUH B;  2MEK A;  2JPH A;  2IY1 B;  1OQR A;  1RRB A;  4CQN A;  5AUI A;  1TTN A;  2M4N A;  4EZL A;  1F52 A;  1ZGU B;  2LGD A;  3IHP C;  3H7P A;  2X8X X;  3JSV B;  2BS2 B;  3ZDT A;  3OJ4 B;  1VZ8 A;  1N6Z A;  2RD0 A;  4OW0 A;  1JML A;  3AEA B;  1YJ1 A;  1ET6 A;  2LEK A;  2JYE A;  5BYQ A;  2AEH A;  1GOZ A;  4ITK A;  2KOX A;  4MGK E;  5TR5 A;  4M01 A;  2J0K A;  1C78 A;  3QCA A;  5C2T B;  5H8Y E;  3DBH B;  1R4M I;  3X0W A;  2HJ8 A;  3TEY A;  4FLH A;  4TQ0 A;  3I3T B;  2KC2 A;  4ZRI A;  5IKC M;  2DLB A;  3GOE A;  3VR8 B;  1F77 A;  1LM8 B;  2LHD A;  1C4C A;  2EMT A;  2LGY A;  1BT0 A;  2MJ3 A;  2KWU B;  2KC1 A;  2K0P A;  4XGA B;  2IO1 B;  1J19 A;  2L76 A;  5I4D A;  5DPR A;  3RYT A;  4ICV A;  3MHZ A;  4M0W A;  3EHV A;  2UWQ A;  1P7F A;  2DBY A;  2MRP A;  3ZJV A;  3DHI C;  1C1Y B;  4PK1 A;  2ZVN A;  3RNF C;  2MWS B;  4DDI D;  1TT5 B;  1SE4 A;  2LVP A;  2BVC A;  5G55 A;  4FAD A;  3SEB A;  3ETR A;  1V80 A;  4MGY E;  3HVZ A;  3V3X A;  1SE2 A;  3DHH C;  4L2Y A;  3HHM A;  2PVG C;  3LJ3 A;  3TBL D;  1HTQ A;  2ZZP B;  1NI2 A;  2JX5 A;  2LMC A;  4WQO B;  4ZOH C;  4NY0 A;  4EOY A;  2N9L A;  3P2B A;  1R4N I;  1IPG A;  3DVG X;  1FNV A;  3PV1 A;  3KWV A;  4LNF A;  4K3C A;  2CHZ A;  1L6V A;  3KUC B;  2RGF A;  2IBI B;  4C80 A;  1WMH B;  2KWV B;  2PE9 A;  1FPY A;  4WWM A;  3RI7 C;  1SF0 A;  1KLU D;  4FJV B;  1LXD A;  3BYY B;  2PIA A;  3MFG A;  2LXC A;  4JWU C;  3AH7 A;  4WIP A;  5DPW A;  3NY5 A;  1WJ6 A;  3JSV A;  3O13 A;  4K3B A;  3RZF A;  5J2R A;  2JZ3 B;  2NCN A;  3W1Y A;  1WXM A;  1T0S C;  1FRD A;  3IVF A;  2Z8L A;  3SHQ A;  1IUE A;  3IT4 B;  3QC8 B;  3U52 E;  1Q1O A;  4YXD B;  5CTR C;  4HPL B;  4M8M A; 
#chains in the Genus database with same CATH homology
 4C7Z A;  1ZPS A;  2MJE A;  1N5W A;  1SJE D;  2NTT A;  1RFK A;  4HKZ E;  1AW7 A;  1TS3 A;  4ARI A;  4N6E B;  2J4X A;  3Q8E A;  1XF5 L;  1HZ5 A;  4YSX B;  1XLN A;  4UDU C;  4YT0 B;  2EEL A;  1GAQ B;  2V0G A;  3W1S A;  5BYS A;  3VQI A;  1FRR A;  3NVW A;  4XDD A;  2BBC A;  3UI3 A;  2ONQ A;  5BMH A;  3VR9 B;  1ACC A;  2WXJ A;  5E6J A;  2LJI A;  3E56 A;  1QOA A;  1QKZ A;  5EE9 A;  2Y5C A;  1PUT A;  3MC0 B;  1FCL A;  4LTU A;  2INP E;  2SAK A;  3TSS A;  2WXL A;  4ZRP A;  1JRO A;  2GB1 A;  5H92 C;  1D5X C;  3Q8F A;  4JX1 C;  2E6X A;  3BVZ A;  2LHE A;  3AEE B;  2CU3 A;  1DOY A;  1FEH A;  5FKA C;  1XO3 A;  2RDH A;  2LGI A;  3AM9 A;  3KQ4 A;  1MHH E;  1ET9 A;  1TY2 A;  4LLG M;  2SEB D;  3AE5 B;  4YTM B;  3SR6 A;  2KN4 A;  1SIJ A;  3R2I A;  1C9F A;  1TY0 A;  1VZ7 A;  1I4H A;  3KWL A;  3EUB 2;  2G9H D;  3BII D;  3P4Q B;  2BT6 A;  3BYT B;  4A55 A;  1I4P A;  3P4S B;  1NYR A;  3Q8B A;  2NMQ A;  3LB8 C;  2TSS A;  1VLB A;  3AEB B;  2INN E;  2L1A A;  2BW2 A;  5EE3 A;  1TKY A;  2KWD A;  1DYQ A;  3HVD A;  2BTE A;  1TJE A;  1YN5 A;  3FC4 A;  3P63 A;  4NZL B;  1N62 A;  2LFI A;  1FFV A;  4JE3 B;  5D7G A;  5D3D A;  1E10 A;  2WXR A;  2PKO A;  2DWQ A;  2CJN A;  1FIQ A;  1NYQ A;  2DYM A;  3AE9 B;  1TKE A;  1GB4 A;  2KAC A;  3AE8 B;  4WQM A;  3AE7 B;  4ZYS A;  2N7J A;  1HA5 A;  1E6E B;  1RM6 C;  2WU5 B;  3RFZ B;  2IDY A;  3T3O A;  1JWS D;  2H89 B;  2PW9 A;  3DWM A;  5HG2 A;  1AYF A;  1KFY B;  2KDM A;  3HRD D;  1J7C A;  1HQR D;  4L23 A;  1VR9 A;  4AQ7 A;  4R3D A;  1CK1 A;  5T8I A;  3VRB B;  3ZGZ A;  1KF6 B;  1SB3 C;  2ACZ B;  2EKI A;  4MM3 B;  2AQ1 B;  2W3R A;  3URY A;  2WP9 B;  2MJD A;  3W2D A;  4RGO S;  1ZDX A;  3RPF C;  1YJJ A;  1NVI D;  5BMG A;  1D5Z C;  1D5M C;  5TSS A;  3LXF A;  2V3P A;  4KKI A;  2WQY B;  4DQO C;  2KAJ A;  2WXI A;  1N60 A;  3N9Y C;  1E7P B;  4KX6 B;  3BK2 A;  1OFF A;  4OZB A;  1L4D B;  1FXA A;  1ZDV A;  2JWU A;  1KTK A;  2W82 A;  2FUG 1;  3AE6 B;  4A6Q A;  3P4P B;  3I57 A;  4P16 A;  2WXF A;  1LO5 D;  1K51 A;  2WXH A;  4XE0 A;  1D6E C;  2WXN A;  4RCO A;  1ENF A;  3IT6 B;  4HKQ A;  1ZXH A;  4IOI E;  1FM0 D;  1R7S A;  4YSY B;  4C56 C;  1BXT A;  3R8B A;  1QF6 A;  1V8C A;  2IGH A;  5HI1 A;  2K22 A;  4DXF A;  2FE8 A;  3FIL B;  2WXP A;  2L52 A;  2L83 A;  1N63 A;  1L5P A;  1DOI A;  4FXC A;  1AWD A;  1ZXI A;  1PGB A;  1JCK B;  4RH6 A;  1ROE A;  1QLB B;  1QQR A;  3AEF B;  4WUR A;  3VRA B;  3ABV B;  1ZUD 2;  1WSP A;  3H8H A;  1STE A;  3TEX A;  4DXG A;  4ZHP A;  1ZE3 D;  2QSD A;  2WLB A;  2BYT A;  1SSN A;  1T6B X;  3IAS 1;  3NZ3 A;  2JSV X;  1VDV A;  1NEN B;  1I4Q A;  1I4G A;  1UWX A;  1C4P A;  1UWM A;  3EGR A;  4JPS A;  1I7H A;  1MVK A;  2WDR B;  3FAH A;  2M0A A;  1M4V A;  3AE3 B;  4USA A;  1JWB D;  4MAC A;  1PFD A;  4NJC A;  4KKJ A;  1L4Z B;  1V1P B;  2ICI A;  2WU2 B;  3ZJT A;  1JWU D;  1L0X B;  4NAM A;  2QIL A;  3I9V 1;  3PO0 A;  4TSS A;  3WCQ A;  2N0S B;  1GPX A;  2IPK D;  1CQV A;  2XNA C;  2V3N A;  4P6V F;  1SBB B;  4OVZ A;  1YNT E;  3AMZ A;  1FMA D;  5FK9 C;  1VRA B;  2YEP B;  2JXT A;  3SFE B;  1DOX A;  2RMM A;  2IGD A;  1YN4 A;  1FNU A;  4KGR A;  1F2R I;  4IKG A;  1L0Y B;  5HFY A;  3GP7 A;  3PZ7 A;  2HDE A;  4KGT A;  2WDQ B;  1QOG A;  1TS4 A;  2BB6 A;  4RGM A;  1WWT A;  4GDL B;  4YTP B;  2HTM E;  4YWG G;  1CJE A;  3Q8C A;  3HUI A;  1KH0 A;  3OWE B;  3P1M A;  4RGN A;  3C8Y A;  1YJI A;  1JW9 D;  1N61 A;  2CJO A;  1P7E A;  2OHF A;  2IGG A;  5EE1 A;  1C76 A;  5C3J B;  2BS4 B;  1MHX A;  1VZ6 A;  1XLO A;  1EWC A;  1GB1 A;  2KQ4 X;  2G1E A;  1C79 A;  2WXO A;  3W5V B;  4YSZ B;  1IGC A;  1TKG A;  2GRI A;  2AX5 A;  1TS5 A;  2J53 A;  2JQR B;  1E0Z A;  4A8X C;  3E9S A;  2WNM A;  4HEA 1;  1OQQ A;  4GLS C;  5D3I B;  2QIE B;  2KMM A;  1FO4 A;  4XWW A;  4WAF A;  5FR3 A;  1I4R A;  4RF0 A;  4LK0 M;  1F0Z A;  5G5G A;  4ZRQ A;  2J42 A;  2I38 A;  3J9C A;  4OHJ A;  3NVZ A;  2RDG A;  1XLP A;  1BUI C;  2M19 A;  3R2T A;  1EM7 A;  3TEW A;  2J52 A;  3AN1 A;  1SXT A;  4ZHO A;  1TYG B;  1VJK A;  2MEK A;  3Q69 A;  2K9X A;  1BML C;  1K50 A;  3AE1 B;  1OQR A;  4RF1 A;  2OED A;  1V97 A;  4CQN A;  2PTL A;  5AUI A;  1PGA A;  3NVV A;  4MT5 A;  2W3S A;  1YMH E;  5G5H A;  2WS3 B;  3NS1 A;  2LUM A;  5GXG B;  1IBX B;  1NI3 A;  3Q8A A;  3T3N A;  1SE3 A;  2Q5W D;  3AB5 A;  2AQ2 B;  1A70 A;  1JQ4 A;  3BZD B;  1B1Z A;  2BS2 B;  2E3T A;  2D5G A;  1TS2 A;  1XCQ L;  2WXM A;  1VZ8 A;  3TUO A;  2I2Y A;  2N9K A;  2MH7 A;  4OW0 A;  4ARC A;  1JML A;  3AEA B;  1ET6 A;  2LEK A;  2JYE A;  5BYQ A;  4RNA A;  4B0E A;  1GOZ A;  4ITK A;  1C4A A;  1RYJ A;  3B2F A;  3V05 A;  2B76 B;  1C78 A;  5C2T B;  4C7Y A;  5H8Y E;  3ZYY X;  1FFU A;  4TMA B;  1T5X D;  3MP9 A;  1E9M A;  1RWS A;  2K5P A;  3AE2 B;  1ZOY B;  4TQ0 A;  3TEY A;  2JU6 X;  1MPE A;  1C77 A;  4HRS A;  4H2A A;  5BMI A;  3TEZ A;  1TZO A;  1V1O A;  1ZP0 B;  2DLB A;  1F77 A;  4XWT A;  3VR8 B;  1FXI A;  2LHD A;  1QOF A;  1C4C A;  2FBW B;  3BK1 A;  3GB1 A;  3GS2 A;  4N58 A;  2WXK A;  1KRH A;  4US8 A;  1B9R A;  4TQ1 A;  3U7Z A;  1SEB D;  1JRP A;  2MJ3 A;  3NUH B;  1ESF A;  4HJG E;  3AED B;  2K0P A;  5EE0 A;  1FNW A;  4N59 A;  3P4R B;  1Y56 A;  5I4D A;  4WH4 A;  1V1P A;  4D2K A;  1EU4 A;  1K52 A;  2W55 A;  2Y3A A;  3MHZ A;  4M0W A;  1P7F A;  1EU3 A;  1QOB A;  5MPO A;  3DWG C;  3W5U B;  1XCT L;  1MI0 A;  2DBY A;  1L0V B;  4MH8 A;  4KGS A;  1DGJ A;  3ZJV A;  5BYR A;  2BS3 B;  1HZ6 A;  1XEE A;  1HXY D;  1WXQ A;  1I4X A;  1QIL A;  2X38 A;  3P42 A;  3EA6 A;  1N5X A;  2JZP A;  1SE4 A;  2WXQ A;  3IXS A;  3PZ8 A;  4GDK B;  4OZC A;  3MJ5 A;  4O1N A;  3SEB A;  3ETR A;  1YN3 A;  1YQ4 B;  3W9C B;  2W54 A;  3HVZ A;  1UNS A;  3V3X A;  1SE2 A;  4NAW B;  3SFD B;  4L2Y A;  1J7A A;  1F2R C;  2PVG C;  2AQ3 B;  2K3U A;  2ON8 A;  1KLG D;  3IAM 1;  2JX5 A;  4PT5 A;  2NTS A;  2YEP F;  2PLP A;  2H88 B;  2LMC A;  4ZOH C;  1XLQ A;  1YQ3 B;  1WGK A;  1PGX A;  3B9J A;  3U2S C;  1FCC C;  2L32 A;  3L4P A;  2N9L A;  4J3O D;  3ZQ4 A;  1QT9 A;  3KLS X;  2ZW0 A;  3AV8 A;  1FD6 A;  2R61 A;  1UGJ A;  1AN8 A;  2WDV B;  4HRO A;  1JAL A;  1FNV A;  1K53 A;  3KWV A;  4L1B A;  5JXV A;  3AEC B;  1UUP A;  5LNK 1;  1CZP A;  3BWU D;  1JWM D;  3CIR B;  1L6V A;  1SJH D;  2PVO D;  1JWA D;  1WYG A;  4OZA A;  4JWS C;  4US9 A;  4YTN B;  3CWI A;  5HHD G;  2VZK B;  4C80 A;  2QEJ C;  1EWY C;  2RPV A;  2QJL A;  3BVM A;  1XXG A;  1Q10 A;  1D4B A;  3AEG B;  2DYO A;  4RGT A;  3U4E G;  4WWM A;  1J7B A;  1SF0 A;  2PMV A;  1KLU D;  4A90 A;  3NRZ A;  4IDI A;  1WRI A;  2QMT A;  1PYW D;  2V4I B;  3BYY B;  2PIA A;  3MFG A;  1L6U A;  1IBX A;  4JWU C;  3B2G A;  4B0M A;  3AH7 A;  4WIP A;  4Q2J A;  2GI9 A;  3O13 A;  2Y5P A;  3LYY A;  1T3Q A;  1IGD A;  4A9A A;  2VZK D;  2XN9 C;  4REZ A;  2BB5 A;  4RFB A;  2M56 B;  4AS1 A;  2JYT A;  3FIL A;  3NVY A;  5AUK A;  1FRD A;  1PDX A;  2IJ0 A;  2Z8L A;  3BVG A;  4EE2 A;  1NEK B;  1IUE A;  3IT4 B;  3U52 E;  4XDC A;  3ZJU A;  4YXD B;  2ZW1 A;  2WXG A;  3AE4 B;  1HEZ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...