2MEKA

N-terminal domain of bilbo1 from trypanosoma brucei
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
110
structure length
110
Chain Sequence
MAFLVQVAADIFNNKVNFELSFPSRPSISELTRSAETAFSNEISLRRPDNVPSHKFHSSKIKMYDEELNKWVDLIREDQLTDYCQLYVFQPPNEWHKESQKEIPPAMKPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and assembly mechanism of TbBILBO1, an essential flagellar pocket collar protein
rcsb
source organism Trypanosoma brucei brucei
molecule tags Metal binding protein
molecule keywords N-TERMINAL DOMAIN OF BILBO1
total genus 11
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2013-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18281 BILBO1_N BILBO1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.650 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2mekA00
2MEKA
chains in the Genus database with same CATH superfamily
4OW0A 2K6DB 2IO2B 4NY0A 2KFJA 1J7BA 3A9JB 3SFDB 3O65B 3WIMA 2D5GA 1WGHA 4ARIA 3MC9A 3AEAB 1ZXIA 2LFIA 2RD0A 4HPLB 4CYEA 1YJ1A 1A70A 2DWQA 4MSMB 4A20A 1L6UA 1J7AA 3L0WB 1E7UA 4GSWA 1TIFA 2UWQA 4DDGD 4ICVA 1WMHA 1WX7A 5GXGB 1WXAA 2R2OA 3ZXVA 2KWVB 2KDMA 2JXTA 4BOZB 4M0WA 1FM0D 2IJ0A 3KLSX 3JVZX 2FCSA 3CWIA 5AZHA 1XXGA 3H7SA 2AX5A 1GJZA 1D6EC 2LUMA 3GE3C 4TKNA 3AE2B 3PRPB 3TBLD 2RPVA 1EO6A 1TS4A 2RDBC 2WYQA 3C0RB 1NYQA 4MGZE 2NVUI 2ZPNA 4IUMB 4WAAA 4HPPA 3ZIMA 2LVPA 4MEMA 4M02A 1WGDA 3M95A 5JHAA 3QHTA 3I63C 5CHWA 3NZSA 4GGQA 3A9JA 4ANVA 1V2YA 4E74A 2V1YA 1WRDB 2TSSA 3ML9A 4S0RA 4WH4A 4WWMA 4HPMB 3BY4B 1LM8B 3BZDB 3ETRA 2KZRA 1SE3A 3B2FA 1RRBA 4NNJB 3DOWA 2ZZPB 3AECB 4A55A 2Z8LA 4LLGM 2CR5A 3PO0A 3ZTDA 3SU8X 4YXDB 3KVFB 1WE7A 3RNCC 1WGKA 5I4DA 1I4PA 2BYVE 1WR6E 3GE8C 1KOTA 3WA0A 3WAMA 3PSEB 3GOEA 2LGDA 2D10A 3Q3MC 2WXPA 3E9SA 2WDVB 5KHQA 3RI7C 3VH3B 1XLPA 3R7RA 4HEA1 4ZRJA 1QOFA 3HRDD 5BYSA 1FIQA 2IDYA 3IAM1 4M01A 3KWVA 5E6JA 3AU5A 1YX5B 5BMHA 1WYWB 1VLBA 3OJ3A 3PRMB 4MH8A 3VUYA 2K6QA 2BT6A 2RMMA 3KUCB 2WXKA 4WWNA 3NG0A 4XC2A 3APDA 4NJ6A 4FHJA 4B0EA 1PGXA 1IGDA 3JSVB 3PRZA 4OHJA 3Q2AC 2D11A 2XK5A 3VVWB 2BKFA 4GU2A 2J42A 1OGWA 4AP4C 2GBJA 3DBRI 2KNBA 2LWPA 2ASQA 1SE9A 3U7ZA 3KUDB 1TKGA 4LDTD 1F52A 5D7GA 3KH0A 1WXQA 3S2AA 2IPKD 2MEKA 4FJVB 3RNEC 2OJRA 4W9EA 3FKYA 2LGXA 1FMAD 1RFAA 2J52A 3KW5B 4ZYNA 3RNBC 5DPRA 2V0GA 4ARCA 3MC0B 4X57B 3WAPA 2KLGA 1GC6A 4C80A 4NAWA 1UZXB 2K22A 3ABVB 5D3IB 2KN4A 1KF6B 5CX3A 1T5XD 1SIFA 3CMMB 1MHHE 1SF0A 1KLUD 1JWBD 4MELA 4YSXB 2N4FA 4I6LB 2KWDA 1Y56A 3RULA 2D3GA 2PE6B 1IBXA 1P98A 3NVWA 3RD2A 3R2IA 2DZMA 4W9LA 2X38A 1Z2MA 4ANWA 2OEDA 2JWUA 1UBIA 2MP2B 4TQ1A 1XCTL 4HCNB 3H9DA 2H89B 2NR2A 2LHEA 4JLCA 4DDID 2G9HD 2JZ3B 4JPSA 2OJWA 4A6QA 1XF5L 4NZLB 5JHBA 2KVZA 1TS5A 1C77A 1V5OA 2I38A 2XEWA 4RNAA 1GNUA 3OLMD 3HK0A 3SEBA 1NYRA 2JUOA 1IP9A 3BVZA 2I2YA 2NPTB 3CSFA 4II2B 5LXHA 4WIPA 1AW7A 2LJIA 1N60A 2WXIA 1M4VA 1NEKB 1V5TA 4YTPB 5HG2A 3VR9B 2IZVB 3TL5A 4MGIE 1VRAB 2L0FA 3DWMA 3DVNV 1QOAA 2ONQA 4II3B 1C9FA 2ON8A 3BVMA 2UU7A 3PHWB 2FIDA 4LNFA 4GB9A 1VZ7A 3DVNU 1MFWA 2LUEA 1IPGA 3A1QB 2KDBA 3HHMA 1N5WA 2N9PC 4JWSC 5EE3A 3W1SC 2KJ6A 4PK1A 1YIWA 2M0AA 3V60A 2W82A 2AWTA 4TUUA 4ASWC 1WGRA 3A4SC 2PVGC 3U4EG 2V3NA 3VRAB 3APFA 1PDXA 1FFVA 1FNVA 1E8ZA 3RMKC 1H8CA 5H92C 4YSYB 3DBHI 3H7PA 4JE3B 3ZNID 2BS2B 3PV1A 4LCDE 5TR5A 2ZNVB 1YN4A 4AUQC 5LXIB 4US9A 5BO4B 3ZJUA 1I4XA 4WURA 4WJNA 4L23A 3V62A 4NJ7A 4YT0B 1PGAA 3K9PB 1WXSA 5BMGA 1QLBB 4S17A 2E6XA 3QIJA 1S3SG 2FUHB 1FXIA 1J8CA 3APCA 3V05A 2GBRA 2LGYA 3HVZA 4I6NB 5AUKA 1TKEA 3IT4B 5BYRA 1WM3A 4XZ4A 2J7QB 1E10A 5AZGA 4JL9A 3RNGC 2Z0DB 1X1MA 2MBQA 1VCBA 4NPNA 1FEHA 1Q0WB 3BK1A 1I4GA 3W2DA 3ZRFA 2DZJA 2M1MA 3NUHB 4DHJD 4D2KA 3PZ8A 4BKTA 2G1EA 1DYQA 3TEXA 1UGMA 3RYTA 3Q3JA 1F2RC 1Q10A 2N0SB 5IKCM 2JU6X 2ZW0A 4GLSC 1AWDA 4M8MA 4TMAB 4W9DA 3W1SA 4YTNB 3GP7A 3ZXRA 3ZUNA 2N9XA 4Q2JA 4AQ7A 2M56B 3HVDA 1TT5B 1L6VA 1I42A 2JSVX 3QWZB 3OAWA 3RUIB 1UF0A 3UINB 3VUWA 1XCQL 3EECA 1L2NA 1L4ZB 1V1PA 2V3PA 4ITKA 1C4PA 3IFWB 1YN3A 5D94A 3URYA 4B9KA 2CHXA 3DBLB 3D32A 2VZKB 4BOSC 2R61A 2WGSA 1C3TA 3AI5A 4KGTA 2FE8A 2KXJA 2JF5A 2MRPA 4G11A 4KSLC 2FAZA 1G6JA 3IXSA 4JGHB 1EU4A 3DHIC 1V6EA 4W9IA 1V49A 3N1ZC 4DXFA 5DPTA 1JCKB 4J6IA 1RM6C 1D4BA 1MI0A 4W9HA 1KLVA 4NQKE 2WXJA 1ZDVA 4G3XB 1R4MI 3Q3FA 3VR8B 1H4RA 2BF8B 2KAJA 3ZNHB 3DWGC 2NTTA 1FD6A 4ANUA 2BVCA 3A9KB 1WFYA 4HJGE 2WWZA 4KKJA 1ACCA 1GAQB 1R4NI 3TIXA 5IP4D 3JW0X 1SBBB 3QQ8B 5E6OA 4K81A 2LEKA 1WZ3A 4USAA 2WX1A 2QILA 3WCQA 1WMHB 2MJ3A 3AULA 1WZ0A 1P0RA 1EWYC 3U8ZA 3EC8A 3TSSA 3P1MA 3SDLC 1QILA 2Z0EB 2W54A 2JZZA 2GI9A 3I5JC 2HDEA 4KIKB 1D5ZC 1ESFA 1I4HA 1QF6A 1NVID 3M63B 1PYWD 2X8XX 4WJPA 1TS3A 2WNMA 1FCLA 3GB1A 1WJUA 2HJ1A 3GS2A 2G4DB 2BPSA 2V4LA 2JVCA 5KHOA 2C7HA 1HZ6A 3M3JA 3NHEB 1HE8A 2WDTB 4GDLA 4FBJB 1QOGA 4C7ZA 3MHZA 3DQVA 5L83A 2IGHA 3DHGC 3H1UA 5H8YE 1RYJA 1WWTA 4LDTB 2KC1A 2G45B 2ZVNA 4HJKA 2EMSA 3ZW3A 3PZ7A 3PT2B 2D07B 5C23A 1E0ZA 1SJED 3B2GA 1L0VB 2MQJA 4CHKA 2G3QB 3V3XA 4BBNF 5TSSA 1SJHD 2NBUA 4E3CA 4J3OD 2BGFA 2KQ4X 1JALA 3RT3B 4PT5A 2K8HA 1J0GA 1EF1A 3JYUA 3N1XC 3DHHC 4R3DA 3DBHB 2MH7A 3AV8A 3OJ4B 4DXGA 1F1HA 2M19A 4F1SA 1U4AA 3ZQ4A 2UYZB 1R7SA 4GN1A 2K3UA 2RPQA 1BT0A 2GLSA 2YVCA 1ZGUB 2FCMA 1J7CA 3L4PA 5LNK1 4IW0A 5J18A 1AYFA 1EF5A 2KK8A 4TQ0A 4N6EB 2EMTA 4YWGG 4C4VA 4OVZA 4MGYE 3HM3A 2LGSA 3PPAA 3M62B 2K0PA 1OEYA 2PKOA 1YQ3B 1YJJA 1P3QU 2KFKB 3QJZA 4XDCA 2DENB 4XE0A 1P9DU 2Y5CA 3RFZB 4EZLA 2NCNA 2INCC 4CO7A 1WF9A 2W3SA 2J4XA 1LFDA 1YQBA 2I1KA 2WDQB 1P1AA 1N61A 2YEPB 4HVBA 4C00A 3E56A 1P7FA 3FC4A 2BBCA 3FAHA 2XK5B 3EHVA 1L5PA 2N1VA 3T9LA 4GXBA 2RGFA 3RNFC 1MPEA 4XX5A 2RR9A 1FCCC 1PFDA 5D2MB 2MBBB 3P4SB 1L4DB 1E5WA 2LRUA 2W3RA 1KRHA 3GZNI 2DNFA 4REZA 4OZCA 2L8JA 3HUIA 2LXCA 2ZNVC 4M8NA 3RZFA 4BZAA 4ZRPA 3MC8A 3AMZA 1WE6A 3AXCA 2OOBB 2O6VD 4XWWA 3RN9C 1TJEA 2VRRB 4K7WA 3RCZA 4UDUC 2IO0B 1ENFA 2G4SA 1C79A 3IHPC 3LXFA 3C19A 2K5PA 2KX3A 1L0YB 3UQAA 3SR6A 3DVGY 2K8CA 1UH6A 2GRIA 1I35A 4LNKA 1B9RA 3DBRB 2WXOA 4WWPA 2ZVOA 5BYQA 2C7NB 1K52A 2KJRA 1ISNA 1D5XC 2JXXA 1GB4A 4HDQA 1CQVA 3QK0A 4N9F4 4ZDVA 3DBLI 1MJDA 4EZJA 4RCOA 4B0MA 3I9V1 2EKEC 3VTUA 1EM7A 3ZO5B 3KUZA 4RMAA 2L05A 1OQYA 2AEHA 2I1JA 3ZDMC 2MBEA 4EOYA 1C78A 3AE3B 5FK9C 2WLBA 1UNSA 3A33B 1NENB 3I3TB 5E6PA 4BBNC 2DYMA 3ONSA 2Y5PA 4N58A 3J9CA 3IAS1 2BB6A 2M4NA 1TZOA 4AS1A 1ZOYB 1F9JA 4KVGB 1TBEA 2HE7A 3BYTB 3R7QA 2NTSA 3VH4B 2L1AA 1ZW7A 4OVVA 3RNAC 2C7MB 2XNAC 1V1OA 2D3CA 3R66C 2YLMA 1K51A 1GG3A 3ENEA 1JWUD 4ANXA 3NVZA 2LASA 1VR9A 4W9JA 4MJSA 3QA8A 2BQQA 3H8HA 3AB5A 2KX0A 1EUVB 1GB1A 2KMAA 2JRHA 3Q3OC 2IO3B 2WXGA 3IG3A 1I4QA 2CHZA 1T0RC 1F2RI 3AE9B 2ICIA 1N6ZA 1Q1OA 1IUEA 2N7EA 2KWUB 3NY5A 4EUTA 2IY0B 1TGZB 3AEDB 4PYUA 3AU4A 5BMIA 2VZKD 1NI3A 1LGRA 3TJPA 2KOXA 3ZRCA 4XYCA 1P7EA 1SIJA 1JW9D 1VZ6A 1SE4A 4IDIA 1UWMA 1Y8RC 1EU3A 4B6WA 2QHOA 3ALBA 2DYBA 1MVKA 1HTQA 1OQQA 2L3ZA 2L0TA 4A8XC 2NS5A 1ZUD2 1BUIC 3L10B 2O2VA 3MHSD 4P1BC 4ZYSA 2PTLA 5J17A 4P1CC 2N7JA 3PREA 3TEZA 2J53A 3PZDA 2OHFA 3HIZA 3Q69A 3Q3NC 4MM3A 2KDFB 2W55A 4FN2A 3L16A 4MJSB 3Q8BA 5IA7A 3AE7B 2LZ6A 3ML8A 4HRSA 3VFKA 2KKCA 3UIOB 3TCAA 4HK2A 4BKSD 5CHFA 3T3NA 4LJOB 5FKAC 3ZNGC 4RH6A 4YL8A 5EE0A 5DCNA 1R4NB 1VD2A 1TTNA 1WYGA 1WGYA 2A4ZA 4P6VF 3V61A 2KLCA 2JPHA 2FCNA 2M17A 4KZCA 1RFKA 4ZRKA 5G55A 2IGGA 1FXAA 4LJPB 3P42A 1V97A 4I6PA 1F77A 2WXMA 2BYEA 3RPFC 4EEWA 4LNOA 2MSED 2IYDB 3N30A 1TY0A 1OTRB 1WM2A 2KACA 2ZCCA 3L13A 1PUTA 4RGNA 2NBWB 3ZYYX 2LRWA 1T3QA 3VTVA 4BAXA 3BINA 1V1PB 1XLOA 2MWSB 3L54A 4JQWC 3H6NA 3VUXA 3VHTC 4K1RB 3AEBB 4H2AA 2CKHB 1T6BX 4IWQA 1E7PB 1V81A 2C60A 2MHJA 1WX8A 4GDLB 3KYDD 3ZTCA 1QQRA 1UD7A 3PTFC 1Z5SB 4EKUA 2QCZA 3N3KB 3VXWA 1T0QC 2V4IB 2W9NA 1QKZA 3W9CB 2DZIA 3DBSA 3ZJVA 2QEJC 3KYCD 2A5UA 4C56C 2L7RA 3VTWA 3AE5B 5GMVA 4NJCA 2NMQA 2IO1B 4C7YA 3WANA 1E8YA 1ET6A 1MG8A 2FCQA 2JX5A 3Q8AA 3AE4B 3ZLZA 1YQ4B 1PQSA 4WQMA 4IWOA 4RF0A 3SFEB 1KTKA 2NBVB 1XLNA 4RM8A 4RGOS 4AWJA 3DVGX 4FXCA 2KTRA 4GDKB 4BKGA 1C4CA 4EE2A 3W5VB 1C4AA 5L95C 2HJ8A 2LVQA 3WALA 4A90A 1TYGB 2VH1A 4IM2A 4KSKC 2KJHB 2IGDA 3W1YA 2BTEA 3O13A 4KKIA 3AEGB 1N63A 1WJ6A 1I7HA 2J0MA 2D3AA 1K50A 3QARA 2BW2A 3FILA 3I57A 4FLHA 5G5GA 2WXLA 1KJTA 3QCAA 5EDSA 1WJ4A 4P7IA 3EUB2 5HHDG 3Q14C 3L08A 2Z59B 2ZW1A 4HCPB 3R2TA 2DAJA 3TUOA 2JT4B 3EFUA 2MCNB 3BK2A 2ZJDA 4AOFA 1CZPA 4L2YA 4PS8A 4DBGA 4A3PA 2L00B 2C9WB 1WJNA 3TEWA 3AE6B 2KT7A 3U30A 2O2VB 1R4MB 2MP2A 2Q5WD 3IT6B 2KDIA 1ZE3D 2KVRA 2CU1A 3U2SC 2KANA 1FRDA 3B0AA 3UGBB 2N9LA 2PJHA 2QDFA 1JRPA 2AYOB 3N20C 1YN5A 1PGBA 1LXDA 2JWZA 2AQ1B 1WIAA 1JWSD 2N7DA 2WXRA 2L32A 2WU2B 2LXAA 2GOWA 3R8BA 1UGJA 2EELA 5C3JB 2LHDA 3PS6A 2K25A 2DBYA 2N9EB 2INPE 4KV2A 2LVOA 3ZNZB 2N9KA 1VDVA 2JQRB 3Q8CA 4TV3A 4KGSA 4HXDA 4RFBA 2MW5A 3VDZA 5AEKB 2QMTA 2CJOA 1WSPA 4DK5A 5IN7A 3AN1A 4NAWB 1L7YA 1IYFA 1OEYJ 1YD8U 1SGHA 4FULA 1NDDA 4M00A 2RDGA 3HM6X 4XGAB 3B1LX 1C1YB 3LJ3A 2WXQA 4DHJB 1V9JA 3VAWA 1TKYA 4AJWA 1RLFA 2RDHA 1FO4A 4IM0A 4RM9A 3WAOA 4W9CA 3PLUA 1OQRA 2DZKA 2PEAA 3AEEB 3NVVA 1YMHE 3SHQA 2L83A 1E8XA 3AM9A 2N1WA 2QC8A 3BVGA 2BYTA 1D3ZA 4L1BA 4HDOA 4W9FA 2CHWA 2IY1B 3B9JA 1E9MA 2WHIA 3V6CB 4GOCA 2GBMA 2DX5B 5D3DA 1UELA 2ZCBA 3OWEB 4MT5A 4MGKE 1E90A 1E6EB 1V8CA 2MA9B 4W9GA 2WQYB 1V86A 3FILB 2MBOA 4PS7A 5HI1A 2LGIA 1LQBA 2R2QA 2DHZA 2KMMA 3AH7A 5E6NA 1TS2A 1T0YA 1KFYB 3N1YC 2C5LC 2K39A 2QJLA 1DOIA 5HKHA 2M0XA 1XO3A 2K1FA 3AE8B 2O6VA 1QOBA 2L52A 3ECIA 2L76A 1FRRA 5EE9A 3DPDA 1QT9A 1NI2A 4IC7B 4FJZA 4LK0M 3VRBB 2CJNA 2KTFA 4K3BA 2K9XA 2J0KA 3W5UB 1CMXB 4FADA 3A9KA 5T8IA 3U7DA 2AQ2B 3BWUD 3EFCA 5JH5C 4ZRIA 4B95A 4PS3A 3UQBA 1T0SC 5D6JB 2KQSA 3NOBA 2BYFA 3IVFA 3UI3A 1CJEA 2FNJB 5JZEB 1SXTA 2B3AA 3NJTA 3A1QA 1STEA 4MSQB 2JYEA 2KMCA 3ZJTA 3MTNB 2GMIC 2FBWB 1N5XA 4KIKA 1UBQA 5G5HA 3JSVA 1WR1A 3GZNB 3U52E 3CIRB 4NAMA 2LI5A 1HA5A 1HEZE 1ZKHA 1KH0A 2B76B 2PVOD 4LNIA 4K7SA 4DHZE 1GUAB 4YSZB 4ZHPA 2BWES 2GB1A 2PE9A 2J0JA 1F0ZA 2KTRB 1AARA 2GBNA 1E8WA 2O6VB 3V6EB 2V3SA 3BYYB 3L17A 3PVLA 4WAFA 4TSSA 1JMLA 1Q5WB 4W9KA 4RGMA 1RAXA 1ZXHA 4JX1C 3NS1A 4DWFA 1K53A 5C1ZA 4ICUA 3X23A 2DLBA 2INNE 3OG5A 4FHKA 3N9YC 2REXA 1AN8A 3P4QB 2LMCA 5DPSA 4OZBA 1FFUA 1QZEA 1I4RA 1XLQA 3P63A 1ZP0B 4JIOU 1MHXA 3TEYA 4OVUA 4A9AA 2KFKA 2PLPA 4DXAB 2JYTA 4URKA 3BIID 1KLGD 4K3CA 4GMVA 4RGTA 4XWTA 4BKSA 3K9OB 1L0XB 3CSTA 1BMLC 1SEBD 1YOVB 3LYYA 2FUG1 1LO5D 4EFOA 1JWMD 1YNTE 3EGRA 2MX2A 1V80A 4LNNA 4HROA 1HQRD 1GPXA 1D5MC 2BS4B 2DAFA 1SSNA 2JZPA 3X0WA 3KWLA 4IWPA 5LLIA 4US8A 1A5RA 1UWXA 5CTRC 1DGJA 5C2TB 5CHVC 3ZVVA 1ZPSA 2HTME 2VH2A 5G2NA 3T8MA 2AQ3B 4ZHOA 2KO3A 2RSUA 2KDEB 1YX6B 3RZWC 1WXMA 3DCGA 1WGGA 1GC7A 3QX1A 4NQLB 4BVUC 2ZPYA 3P4PB 2IBIB 3MJWA 4HKQA 4G50A 4GDKA 5FR3A 1TZ1A 4QAYA 3Q8FA 4ZRQA 3PLVA 2BWFA 2INDC 4F7ZA 5IOIA 2KD0A 3P4RB 1WH3A 1GOZA 2EKIA 4MM3B 3P2BA 5FR6A 4FJYA 1JQ4A 2QSDA 2WXNA 1SE2A 1WY8A 3MP9A 4KX6B 3LDZE 2Y3AA 3ZGZA 3T3OA 4P16A 5DPWA 2V9HA 1WI0A 1WX9A 3NRZA 1VJKA 1NBFC 4IKGA 2PPHA 1J19A 2KHWB 2AL6A 1JWAD 4ACFA 3PHXB 2WXFA 1HXYD 3B08A 4HWIB 3N32A 1XEEA 1ET9A 1S1QB 2KQ7A 5J2RA 3TMPB 2WXHA 1XD3B 3PGEA 4M0WB 1SB3C 4IG7B 4RF1A 4IOIE 3LB8C 3QC8B 2WP9B 2KYWA 4EZKA 2AL3A 4MACA 4E71A 2ACZB 1HTOA 4KDLB 4WJQA 4WJOA 3SD5A 3NVYA 2LD9A 3CF6E 5EE1A 1JROA 3H7PB 5JXVA 2FIFA 5IO9A 2MLBA 2LJ5A 1BXTA 2KN5A 1HZ5A 1FNWA 4IM3A 2WS3B 1B1ZA 2XBBC 4BFRA 3ZDTA 3KQ4A 2JRIB 2PIAA 4MDKE 5AUIA 3VQIA 1FXTB 2HD5B 4DQOC 1M94A 3C8YA 4KZ0A 3ZKJC 4YTMB 5IAAC 1IBXB 3MFGA 2GBKA 1KM7A 2MJDA 2CU3A 2E3TA 3Q8EA 3IBEA 3A4RA 4MH0E 4GIVA 4ZOHC 1ZDXA 2WX0A 4JWUC 2HTHA 1TY2A 4G0NB 4AJYB 3DDCB 2M8SA 2PW9A 1RWSA 2SEBD 5AZFA 3NZUA 3NZ3A 4KDIC 4DHZB 2SAKA 2H88B 4K7UA 3AE1B 2K8BA 2MJEA 1XQQA 1C76A 2Y5BB 2DYOA 1FNUA 2NPTA 2BKRB 4KGRA 4LTUA 2BB5A 1CK1A 4A3OA 2D3BA 5HFYA 1E7VA 2ZEQA 1DOYA 4XDDA 3AEFB 1XT9B 3R3MA 1ROEA 2D2QA 2XN9C 1MG4A 1YJIA 2WDRB 2YEPF 1JRUA 4OZAA 1VZ8A 2BS3B 1WXVA 4HKZE 4WQOB 5MPOA 4HLEA 2QIEB 2KWCA 3UIPB 2PMVA 3EA6A 1DOXA 1UUPA 1IGCA 4WWOA 2MBHA 1OFFA 3QAQA 1K8RB 4FA6A 1FPYA 4C4VB 2KC2A 4PYZA 4CQNA 1N62A 1WRIA 4N59A 4O1NA 4F8CB 2CS4A 1EWCA 3UF8A 3NS8A 2WU5B 2JY6A 3MJ5A 3Q6BA
chains in the Genus database with same CATH topology
1E6EB 2JU6X 2ZW0A 4GLSC 1AWDA 4OW0A 1V8CA 3AB5A 4TMAB 2WQYB 1GB1A 3FILB 1J7BA 3W1SA 3SFDB 4YTNB 3GP7A 4AQ7A 2WXGA 4Q2JA 5HI1A 1I4QA 2D5GA 2LGIA 2M56B 3HVDA 4ARIA 2KMMA 3AH7A 3AEAB 1TS2A 1F2RI 3AE9B 1L6VA 1KFYB 1ZXIA 2ICIA 2LFIA 2QJLA 1A70A 1IUEA 2JSVX 2DWQA 1DOIA 1L6UA 1J7AA 1XCQL 1XO3A 3AE8B 1L4ZB 1V1PA 2V3PA 4ITKA 5GXGB 1QOBA 1C4PA 3AEDB 5BMIA 2L52A 2VZKD 1NI3A 1YN3A 2JXTA 2KDMA 3URYA 1FRRA 5EE9A 1QT9A 2VZKB 4M0WA 1P7EA 1FM0D 1SIJA 2IJ0A 2R61A 3KLSX 4LK0M 1JW9D 2CJNA 3CWIA 3VRBB 4KGTA 2FE8A 1VZ6A 1SE4A 4IDIA 1UWMA 2K9XA 1EU3A 3W5UB 1MVKA 5T8IA 1OQQA 1XXGA 3IXSA 2AQ2B 4A8XC 1EU4A 2AX5A 3BWUD 1ZUD2 1BUIC 1D6EC 2LUMA 4DXFA 3AE2B 1JCKB 1RM6C 4ZYSA 2RPVA 2PTLA 3UI3A 1CJEA 1D4BA 1MI0A 1TS4A 2N7JA 2WXJA 1ZDVA 3TEZA 2J53A 1SXTA 1NYQA 1STEA 2JYEA 2OHFA 3ZJTA 3VR8B 3Q69A 2FBWB 2W55A 1N5XA 2KAJA 3Q8BA 3DWGC 3AE7B 5G5HA 4HRSA 3U52E 3CIRB 2NTTA 1FD6A 4NAMA 1HA5A 4HJGE 1HEZE 4KKJA 1ACCA 1GAQB 1KH0A 2B76B 2TSSA 3T3NA 2PVOD 1SBBB 5FKAC 4RH6A 4WH4A 4WWMA 2LEKA 4YSZB 3BZDB 3ETRA 4ZHPA 4USAA 5EE0A 2QILA 1SE3A 3B2FA 3WCQA 2GB1A 1F0ZA 1WYGA 2MJ3A 3AECB 4A55A 1EWYC 2Z8LA 4P6VF 4LLGM 3BYYB 3PO0A 3TSSA 3P1MA 4WAFA 1QILA 4YXDB 4TSSA 1JMLA 1WGKA 2W54A 4RGMA 1RFKA 1ZXHA 5I4DA 1I4PA 4JX1C 2IGGA 1FXAA 2GI9A 2HDEA 1V97A 3P42A 1F77A 2WXMA 1K53A 3NS1A 1D5ZC 3RPFC 2DLBA 3H8HA 2INNE 2WXPA 3E9SA 1TY0A 1ESFA 1I4HA 2KACA 1QF6A 1NVID 1PUTA 4RGNA 3N9YC 2WDVB 3ZYYX 1AN8A 1PYWD 1XLPA 4HEA1 3P4QB 1QOFA 2LMCA 3HRDD 4OZBA 5BYSA 1FFUA 1FIQA 1TS3A 1I4RA 2WNMA 1FCLA 1T3QA 1XLQA 2IDYA 3IAM1 3P63A 1ZP0B 1MHXA 3KWVA 1V1PB 3GB1A 5E6JA 3TEYA 1XLOA 5BMHA 3GS2A 4A9AA 1VLBA 4MH8A 2PLPA 3AEBB 4H2AA 2JYTA 1T6BX 3BIID 2BT6A 1KLGD 4RGTA 1E7PB 4XWTA 2RMMA 2WXKA 4GDLB 1L0XB 1BMLC 1SEBD 4B0EA 1HZ6A 1PGXA 1IGDA 1QQRA 4OHJA 3LYYA 2FUG1 1LO5D 1JWMD 1QOGA 4C7ZA 3MHZA 1YNTE 3EGRA 2IGHA 2V4IB 4HROA 2J42A 1QKZA 5H8YE 3W9CB 1RYJA 1WWTA 1HQRD 1GPXA 3ZJVA 1D5MC 2QEJC 3U7ZA 2BS4B 1SSNA 2JZPA 3KWLA 1TKGA 4US8A 3PZ7A 5D7GA 1UWXA 1WXQA 4C56C 1E0ZA 2IPKD 1DGJA 1SJED 3B2GA 2MEKA 5C2TB 1ZPSA 2HTME 3AE5B 1L0VB 1FMAD 2AQ3B 4ZHOA 2J52A 4NJCA 2NMQA 3V3XA 5TSSA 2V0GA 1SJHD 4C7YA 4ARCA 3MC0B 4J3OD 4C80A 1ET6A 2JX5A 2K22A 3ABVB 2KQ4X 3Q8AA 3AE4B 1JALA 3P4PB 1YQ4B 4WQMA 5D3IB 4RF0A 3SFEB 4PT5A 2KN4A 1KTKA 4HKQA 1XLNA 1KF6B 5FR3A 3Q8FA 4RGOS 4R3DA 1T5XD 4ZRQA 4FXCA 2MH7A 1MHHE 3P4RB 4GDKB 3AV8A 1C4CA 1SF0A 4DXGA 1KLUD 3W5VB 1C4AA 4EE2A 1GOZA 2EKIA 4MM3B 1JWBD 4YSXB 2M19A 1TYGB 4A90A 2KWDA 3ZQ4A 1Y56A 2IGDA 1R7SA 1JQ4A 2BTEA 2QSDA 2WXNA 1SE2A 2K3UA 3O13A 4KKIA 1IBXA 3MP9A 3AEGB 1N63A 3NVWA 4KX6B 2Y3AA 3R2IA 1J7CA 1I7HA 3ZGZA 2X38A 1K50A 3L4PA 5LNK1 3T3OA 4P16A 1AYFA 2BW2A 2OEDA 3FILA 2JWUA 3I57A 4TQ0A 4N6EB 3NRZA 5G5GA 2WXLA 1VJKA 4TQ1A 4YWGG 4IKGA 4OVZA 1XCTL 3EUB2 5HHDG 2H89B 1JWAD 2LHEA 2ZW1A 2G9HD 3R2TA 4JPSA 4A6QA 2WXFA 1HXYD 2K0PA 1XF5L 3TUOA 4NZLB 2PKOA 3BK2A 1TS5A 1C77A 1YQ3B 1XEEA 1ET9A 1YJJA 2I38A 2WXHA 1CZPA 4L2YA 4XDCA 4XE0A 4RNAA 1SB3C 4RF1A 2Y5CA 4IOIE 3SEBA 3RFZB 3LB8C 1NYRA 2WP9B 2W3SA 3BVZA 2J4XA 2I2YA 2WDQB 4MACA 4WIPA 1N61A 2YEPB 3TEWA 3E56A 1AW7A 3AE6B 2ACZB 2LJIA 1P7FA 3FC4A 2BBCA 1N60A 2WXIA 3FAHA 1M4VA 1NEKB 3NVYA 4YTPB 5HG2A 1L5PA 3VR9B 5EE1A 1JROA 2Q5WD 1VRAB 5JXVA 3DWMA 1MPEA 1QOAA 2ONQA 1C9FA 2ON8A 3BVMA 3IT6B 1FCCC 1BXTA 1PFDA 1ZE3D 1HZ5A 1FNWA 1VZ7A 3P4SB 1L4DB 3U2SC 1FRDA 2WS3B 2W3RA 2N9LA 1KRHA 1B1ZA 1JRPA 3KQ4A 1N5WA 1YN5A 1PGBA 2PIAA 4REZA 2AQ1B 4JWSC 5EE3A 4OZCA 5AUIA 2M0AA 3VQIA 3HUIA 2W82A 4DQOC 1JWSD 3C8YA 4ZRPA 4YTMB 2WXRA 3AMZA 2L32A 2WU2B 1IBXB 2PVGC 3MFGA 3R8BA 1UGJA 2MJDA 3U4EG 2V3NA 4XWWA 3VRAB 2EELA 2CU3A 5C3JB 2E3TA 1TJEA 2LHDA 3Q8EA 4ZOHC 2DBYA 4UDUC 1ZDXA 1ENFA 4JWUC 1C79A 2INPE 3LXFA 1TY2A 1PDXA 1FFVA 2K5PA 1FNVA 1L0YB 2PW9A 5H92C 4YSYB 2N9KA 1RWSA 2SEBD 1VDVA 4JE3B 2JQRB 3Q8CA 3SR6A 2BS2B 3NZ3A 4KGSA 4RFBA 2SAKA 2H88B 1YN4A 2QMTA 4US9A 2GRIA 2CJOA 3AE1B 1WSPA 3ZJUA 1I4XA 1B9RA 4WURA 3AN1A 4NAWB 2MJEA 4L23A 2WXOA 5BYQA 1C76A 2DYOA 1K52A 4YT0B 1PGAA 1D5XC 1GB4A 1FNUA 5BMGA 4KGRA 1CQVA 2RDGA 4LTUA 2BB5A 1QLBB 1CK1A 2E6XA 2WXQA 4RCOA 4B0MA 5HFYA 1TKYA 3I9V1 1DOYA 1FXIA 4XDDA 3AEFB 1EM7A 2RDHA 1ROEA 1FO4A 2XN9C 1YJIA 2WDRB 2YEPF 4OZAA 1VZ8A 1C78A 3V05A 3AE3B 1OQRA 5FK9C 2WLBA 2BS3B 1UNSA 3AEEB 4HKZE 5MPOA 1NENB 2QIEB 3HVZA 5AUKA 2PMVA 1TKEA 3IT4B 3NVVA 2DYMA 5BYRA 3EA6A 1DOXA 1E10A 1UUPA 1IGCA 2Y5PA 4N58A 1YMHE 3J9CA 3IAS1 2L83A 1OFFA 2BB6A 1TZOA 4AS1A 1ZOYB 3AM9A 1FEHA 3BVGA 2BYTA 3BK1A 3BYTB 4L1BA 2NTSA 1I4GA 4CQNA 1N62A 2L1AA 1WRIA 3W2DA 4N59A 4O1NA 2XNAC 3B9JA 1E9MA 1EWCA 3NUHB 1V1OA 1K51A 2WU5B 4D2KA 3PZ8A 5D3DA 2G1EA 1JWUD 1DYQA 3MJ5A 3TEXA 3NVZA 1F2RC 1VR9A 3OWEB 4MT5A 1Q10A 2N0SB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MEK A; 
#chains in the Genus database with same CATH topology
 4OW0 A;  2K6D B;  2IO2 B;  4NY0 A;  2KFJ A;  1J7B A;  3A9J B;  3SFD B;  3O65 B;  3WIM A;  2D5G A;  1WGH A;  4ARI A;  3MC9 A;  3AEA B;  1ZXI A;  2LFI A;  2RD0 A;  4HPL B;  4CYE A;  1YJ1 A;  1A70 A;  2DWQ A;  4MSM B;  4A20 A;  1L6U A;  1J7A A;  3L0W B;  1E7U A;  4GSW A;  1TIF A;  2UWQ A;  4DDG D;  4ICV A;  1WMH A;  1WX7 A;  5GXG B;  1WXA A;  2R2O A;  3ZXV A;  2KWV B;  2KDM A;  2JXT A;  4BOZ B;  4M0W A;  1FM0 D;  2IJ0 A;  3KLS X;  3JVZ X;  2FCS A;  3CWI A;  5AZH A;  1XXG A;  3H7S A;  2AX5 A;  1GJZ A;  1D6E C;  2LUM A;  3GE3 C;  4TKN A;  3AE2 B;  3PRP B;  3TBL D;  2RPV A;  1EO6 A;  1TS4 A;  2RDB C;  2WYQ A;  3C0R B;  1NYQ A;  4MGZ E;  2NVU I;  2ZPN A;  4IUM B;  4WAA A;  4HPP A;  3ZIM A;  2LVP A;  4MEM A;  4M02 A;  1WGD A;  3M95 A;  5JHA A;  3QHT A;  3I63 C;  5CHW A;  3NZS A;  4GGQ A;  3A9J A;  4ANV A;  1V2Y A;  4E74 A;  2V1Y A;  1WRD B;  2TSS A;  3ML9 A;  4S0R A;  4WH4 A;  4WWM A;  4HPM B;  3BY4 B;  1LM8 B;  3BZD B;  3ETR A;  2KZR A;  1SE3 A;  3B2F A;  1RRB A;  4NNJ B;  3DOW A;  2ZZP B;  3AEC B;  4A55 A;  2Z8L A;  4LLG M;  2CR5 A;  3PO0 A;  3ZTD A;  3SU8 X;  4YXD B;  3KVF B;  1WE7 A;  3RNC C;  1WGK A;  5I4D A;  1I4P A;  2BYV E;  1WR6 E;  3GE8 C;  1KOT A;  3WA0 A;  3WAM A;  3PSE B;  3GOE A;  2LGD A;  2D10 A;  3Q3M C;  2WXP A;  3E9S A;  2WDV B;  5KHQ A;  3RI7 C;  3VH3 B;  1XLP A;  3R7R A;  4HEA 1;  4ZRJ A;  1QOF A;  3HRD D;  5BYS A;  1FIQ A;  2IDY A;  3IAM 1;  4M01 A;  3KWV A;  5E6J A;  3AU5 A;  1YX5 B;  5BMH A;  1WYW B;  1VLB A;  3OJ3 A;  3PRM B;  4MH8 A;  3VUY A;  2K6Q A;  2BT6 A;  2RMM A;  3KUC B;  2WXK A;  4WWN A;  3NG0 A;  4XC2 A;  3APD A;  4NJ6 A;  4FHJ A;  4B0E A;  1PGX A;  1IGD A;  3JSV B;  3PRZ A;  4OHJ A;  3Q2A C;  2D11 A;  2XK5 A;  3VVW B;  2BKF A;  4GU2 A;  2J42 A;  1OGW A;  4AP4 C;  2GBJ A;  3DBR I;  2KNB A;  2LWP A;  2ASQ A;  1SE9 A;  3U7Z A;  3KUD B;  1TKG A;  4LDT D;  1F52 A;  5D7G A;  3KH0 A;  1WXQ A;  3S2A A;  2IPK D;  2MEK A;  4FJV B;  3RNE C;  2OJR A;  4W9E A;  3FKY A;  2LGX A;  1FMA D;  1RFA A;  2J52 A;  3KW5 B;  4ZYN A;  3RNB C;  5DPR A;  2V0G A;  4ARC A;  3MC0 B;  4X57 B;  3WAP A;  2KLG A;  1GC6 A;  4C80 A;  4NAW A;  1UZX B;  2K22 A;  3ABV B;  5D3I B;  2KN4 A;  1KF6 B;  5CX3 A;  1T5X D;  1SIF A;  3CMM B;  1MHH E;  1SF0 A;  1KLU D;  1JWB D;  4MEL A;  4YSX B;  2N4F A;  4I6L B;  2KWD A;  1Y56 A;  3RUL A;  2D3G A;  2PE6 B;  1IBX A;  1P98 A;  3NVW A;  3RD2 A;  3R2I A;  2DZM A;  4W9L A;  2X38 A;  1Z2M A;  4ANW A;  2OED A;  2JWU A;  1UBI A;  2MP2 B;  4TQ1 A;  1XCT L;  4HCN B;  3H9D A;  2H89 B;  2NR2 A;  2LHE A;  4JLC A;  4DDI D;  2G9H D;  2JZ3 B;  4JPS A;  2OJW A;  4A6Q A;  1XF5 L;  4NZL B;  5JHB A;  2KVZ A;  1TS5 A;  1C77 A;  1V5O A;  2I38 A;  2XEW A;  4RNA A;  1GNU A;  3OLM D;  3HK0 A;  3SEB A;  1NYR A;  2JUO A;  1IP9 A;  3BVZ A;  2I2Y A;  2NPT B;  3CSF A;  4II2 B;  5LXH A;  4WIP A;  1AW7 A;  2LJI A;  1N60 A;  2WXI A;  1M4V A;  1NEK B;  1V5T A;  4YTP B;  5HG2 A;  3VR9 B;  2IZV B;  3TL5 A;  4MGI E;  1VRA B;  2L0F A;  3DWM A;  3DVN V;  1QOA A;  2ONQ A;  4II3 B;  1C9F A;  2ON8 A;  3BVM A;  2UU7 A;  3PHW B;  2FID A;  4LNF A;  4GB9 A;  1VZ7 A;  3DVN U;  1MFW A;  2LUE A;  1IPG A;  3A1Q B;  2KDB A;  3HHM A;  1N5W A;  2N9P C;  4JWS C;  5EE3 A;  3W1S C;  2KJ6 A;  4PK1 A;  1YIW A;  2M0A A;  3V60 A;  2W82 A;  2AWT A;  4TUU A;  4ASW C;  1WGR A;  3A4S C;  2PVG C;  3U4E G;  2V3N A;  3VRA B;  3APF A;  1PDX A;  1FFV A;  1FNV A;  1E8Z A;  3RMK C;  1H8C A;  5H92 C;  4YSY B;  3DBH I;  3H7P A;  4JE3 B;  3ZNI D;  2BS2 B;  3PV1 A;  4LCD E;  5TR5 A;  2ZNV B;  1YN4 A;  4AUQ C;  5LXI B;  4US9 A;  5BO4 B;  3ZJU A;  1I4X A;  4WUR A;  4WJN A;  4L23 A;  3V62 A;  4NJ7 A;  4YT0 B;  1PGA A;  3K9P B;  1WXS A;  5BMG A;  1QLB B;  4S17 A;  2E6X A;  3QIJ A;  1S3S G;  2FUH B;  1FXI A;  1J8C A;  3APC A;  3V05 A;  2GBR A;  2LGY A;  3HVZ A;  4I6N B;  5AUK A;  1TKE A;  3IT4 B;  5BYR A;  1WM3 A;  4XZ4 A;  2J7Q B;  1E10 A;  5AZG A;  4JL9 A;  3RNG C;  2Z0D B;  1X1M A;  2MBQ A;  1VCB A;  4NPN A;  1FEH A;  1Q0W B;  3BK1 A;  1I4G A;  3W2D A;  3ZRF A;  2DZJ A;  2M1M A;  3NUH B;  4DHJ D;  4D2K A;  3PZ8 A;  4BKT A;  2G1E A;  1DYQ A;  3TEX A;  1UGM A;  3RYT A;  3Q3J A;  1F2R C;  1Q10 A;  2N0S B;  5IKC M;  2JU6 X;  2ZW0 A;  4GLS C;  1AWD A;  4M8M A;  4TMA B;  4W9D A;  3W1S A;  4YTN B;  3GP7 A;  3ZXR A;  3ZUN A;  2N9X A;  4Q2J A;  4AQ7 A;  2M56 B;  3HVD A;  1TT5 B;  1L6V A;  1I42 A;  2JSV X;  3QWZ B;  3OAW A;  3RUI B;  1UF0 A;  3UIN B;  3VUW A;  1XCQ L;  3EEC A;  1L2N A;  1L4Z B;  1V1P A;  2V3P A;  4ITK A;  1C4P A;  3IFW B;  1YN3 A;  5D94 A;  3URY A;  4B9K A;  2CHX A;  3DBL B;  3D32 A;  2VZK B;  4BOS C;  2R61 A;  2WGS A;  1C3T A;  3AI5 A;  4KGT A;  2FE8 A;  2KXJ A;  2JF5 A;  2MRP A;  4G11 A;  4KSL C;  2FAZ A;  1G6J A;  3IXS A;  4JGH B;  1EU4 A;  3DHI C;  1V6E A;  4W9I A;  1V49 A;  3N1Z C;  4DXF A;  5DPT A;  1JCK B;  4J6I A;  1RM6 C;  1D4B A;  1MI0 A;  4W9H A;  1KLV A;  4NQK E;  2WXJ A;  1ZDV A;  4G3X B;  1R4M I;  3Q3F A;  3VR8 B;  1H4R A;  2BF8 B;  2KAJ A;  3ZNH B;  3DWG C;  2NTT A;  1FD6 A;  4ANU A;  2BVC A;  3A9K B;  1WFY A;  4HJG E;  2WWZ A;  4KKJ A;  1ACC A;  1GAQ B;  1R4N I;  3TIX A;  5IP4 D;  3JW0 X;  1SBB B;  3QQ8 B;  5E6O A;  4K81 A;  2LEK A;  1WZ3 A;  4USA A;  2WX1 A;  2QIL A;  3WCQ A;  1WMH B;  2MJ3 A;  3AUL A;  1WZ0 A;  1P0R A;  1EWY C;  3U8Z A;  3EC8 A;  3TSS A;  3P1M A;  3SDL C;  1QIL A;  2Z0E B;  2W54 A;  2JZZ A;  2GI9 A;  3I5J C;  2HDE A;  4KIK B;  1D5Z C;  1ESF A;  1I4H A;  1QF6 A;  1NVI D;  3M63 B;  1PYW D;  2X8X X;  4WJP A;  1TS3 A;  2WNM A;  1FCL A;  3GB1 A;  1WJU A;  2HJ1 A;  3GS2 A;  2G4D B;  2BPS A;  2V4L A;  2JVC A;  5KHO A;  2C7H A;  1HZ6 A;  3M3J A;  3NHE B;  1HE8 A;  2WDT B;  4GDL A;  4FBJ B;  1QOG A;  4C7Z A;  3MHZ A;  3DQV A;  5L83 A;  2IGH A;  3DHG C;  3H1U A;  5H8Y E;  1RYJ A;  1WWT A;  4LDT B;  2KC1 A;  2G45 B;  2ZVN A;  4HJK A;  2EMS A;  3ZW3 A;  3PZ7 A;  3PT2 B;  2D07 B;  5C23 A;  1E0Z A;  1SJE D;  3B2G A;  1L0V B;  2MQJ A;  4CHK A;  2G3Q B;  3V3X A;  4BBN F;  5TSS A;  1SJH D;  2NBU A;  4E3C A;  4J3O D;  2BGF A;  2KQ4 X;  1JAL A;  3RT3 B;  4PT5 A;  2K8H A;  1J0G A;  1EF1 A;  3JYU A;  3N1X C;  3DHH C;  4R3D A;  3DBH B;  2MH7 A;  3AV8 A;  3OJ4 B;  4DXG A;  1F1H A;  2M19 A;  4F1S A;  1U4A A;  3ZQ4 A;  2UYZ B;  1R7S A;  4GN1 A;  2K3U A;  2RPQ A;  1BT0 A;  2GLS A;  2YVC A;  1ZGU B;  2FCM A;  1J7C A;  3L4P A;  5LNK 1;  4IW0 A;  5J18 A;  1AYF A;  1EF5 A;  2KK8 A;  4TQ0 A;  4N6E B;  2EMT A;  4YWG G;  4C4V A;  4OVZ A;  4MGY E;  3HM3 A;  2LGS A;  3PPA A;  3M62 B;  2K0P A;  1OEY A;  2PKO A;  1YQ3 B;  1YJJ A;  1P3Q U;  2KFK B;  3QJZ A;  4XDC A;  2DEN B;  4XE0 A;  1P9D U;  2Y5C A;  3RFZ B;  4EZL A;  2NCN A;  2INC C;  4CO7 A;  1WF9 A;  2W3S A;  2J4X A;  1LFD A;  1YQB A;  2I1K A;  2WDQ B;  1P1A A;  1N61 A;  2YEP B;  4HVB A;  4C00 A;  3E56 A;  1P7F A;  3FC4 A;  2BBC A;  3FAH A;  2XK5 B;  3EHV A;  1L5P A;  2N1V A;  3T9L A;  4GXB A;  2RGF A;  3RNF C;  1MPE A;  4XX5 A;  2RR9 A;  1FCC C;  1PFD A;  5D2M B;  2MBB B;  3P4S B;  1L4D B;  1E5W A;  2LRU A;  2W3R A;  1KRH A;  3GZN I;  2DNF A;  4REZ A;  4OZC A;  2L8J A;  3HUI A;  2LXC A;  2ZNV C;  4M8N A;  3RZF A;  4BZA A;  4ZRP A;  3MC8 A;  3AMZ A;  1WE6 A;  3AXC A;  2OOB B;  2O6V D;  4XWW A;  3RN9 C;  1TJE A;  2VRR B;  4K7W A;  3RCZ A;  4UDU C;  2IO0 B;  1ENF A;  2G4S A;  1C79 A;  3IHP C;  3LXF A;  3C19 A;  2K5P A;  2KX3 A;  1L0Y B;  3UQA A;  3SR6 A;  3DVG Y;  2K8C A;  1UH6 A;  2GRI A;  1I35 A;  4LNK A;  1B9R A;  3DBR B;  2WXO A;  4WWP A;  2ZVO A;  5BYQ A;  2C7N B;  1K52 A;  2KJR A;  1ISN A;  1D5X C;  2JXX A;  1GB4 A;  4HDQ A;  1CQV A;  3QK0 A;  4N9F 4;  4ZDV A;  3DBL I;  1MJD A;  4EZJ A;  4RCO A;  4B0M A;  3I9V 1;  2EKE C;  3VTU A;  1EM7 A;  3ZO5 B;  3KUZ A;  4RMA A;  2L05 A;  1OQY A;  2AEH A;  2I1J A;  3ZDM C;  2MBE A;  4EOY A;  1C78 A;  3AE3 B;  5FK9 C;  2WLB A;  1UNS A;  3A33 B;  1NEN B;  3I3T B;  5E6P A;  4BBN C;  2DYM A;  3ONS A;  2Y5P A;  4N58 A;  3J9C A;  3IAS 1;  2BB6 A;  2M4N A;  1TZO A;  4AS1 A;  1ZOY B;  1F9J A;  4KVG B;  1TBE A;  2HE7 A;  3BYT B;  3R7Q A;  2NTS A;  3VH4 B;  2L1A A;  1ZW7 A;  4OVV A;  3RNA C;  2C7M B;  2XNA C;  1V1O A;  2D3C A;  3R66 C;  2YLM A;  1K51 A;  1GG3 A;  3ENE A;  1JWU D;  4ANX A;  3NVZ A;  2LAS A;  1VR9 A;  4W9J A;  4MJS A;  3QA8 A;  2BQQ A;  3H8H A;  3AB5 A;  2KX0 A;  1EUV B;  1GB1 A;  2KMA A;  2JRH A;  3Q3O C;  2IO3 B;  2WXG A;  3IG3 A;  1I4Q A;  2CHZ A;  1T0R C;  1F2R I;  3AE9 B;  2ICI A;  1N6Z A;  1Q1O A;  1IUE A;  2N7E A;  2KWU B;  3NY5 A;  4EUT A;  2IY0 B;  1TGZ B;  3AED B;  4PYU A;  3AU4 A;  5BMI A;  2VZK D;  1NI3 A;  1LGR A;  3TJP A;  2KOX A;  3ZRC A;  4XYC A;  1P7E A;  1SIJ A;  1JW9 D;  1VZ6 A;  1SE4 A;  4IDI A;  1UWM A;  1Y8R C;  1EU3 A;  4B6W A;  2QHO A;  3ALB A;  2DYB A;  1MVK A;  1HTQ A;  1OQQ A;  2L3Z A;  2L0T A;  4A8X C;  2NS5 A;  1ZUD 2;  1BUI C;  3L10 B;  2O2V A;  3MHS D;  4P1B C;  4ZYS A;  2PTL A;  5J17 A;  4P1C C;  2N7J A;  3PRE A;  3TEZ A;  2J53 A;  3PZD A;  2OHF A;  3HIZ A;  3Q69 A;  3Q3N C;  4MM3 A;  2KDF B;  2W55 A;  4FN2 A;  3L16 A;  4MJS B;  3Q8B A;  5IA7 A;  3AE7 B;  2LZ6 A;  3ML8 A;  4HRS A;  3VFK A;  2KKC A;  3UIO B;  3TCA A;  4HK2 A;  4BKS D;  5CHF A;  3T3N A;  4LJO B;  5FKA C;  3ZNG C;  4RH6 A;  4YL8 A;  5EE0 A;  5DCN A;  1R4N B;  1VD2 A;  1TTN A;  1WYG A;  1WGY A;  2A4Z A;  4P6V F;  3V61 A;  2KLC A;  2JPH A;  2FCN A;  2M17 A;  4KZC A;  1RFK A;  4ZRK A;  5G55 A;  2IGG A;  1FXA A;  4LJP B;  3P42 A;  1V97 A;  4I6P A;  1F77 A;  2WXM A;  2BYE A;  3RPF C;  4EEW A;  4LNO A;  2MSE D;  2IYD B;  3N30 A;  1TY0 A;  1OTR B;  1WM2 A;  2KAC A;  2ZCC A;  3L13 A;  1PUT A;  4RGN A;  2NBW B;  3ZYY X;  2LRW A;  1T3Q A;  3VTV A;  4BAX A;  3BIN A;  1V1P B;  1XLO A;  2MWS B;  3L54 A;  4JQW C;  3H6N A;  3VUX A;  3VHT C;  4K1R B;  3AEB B;  4H2A A;  2CKH B;  1T6B X;  4IWQ A;  1E7P B;  1V81 A;  2C60 A;  2MHJ A;  1WX8 A;  4GDL B;  3KYD D;  3ZTC A;  1QQR A;  1UD7 A;  3PTF C;  1Z5S B;  4EKU A;  2QCZ A;  3N3K B;  3VXW A;  1T0Q C;  2V4I B;  2W9N A;  1QKZ A;  3W9C B;  2DZI A;  3DBS A;  3ZJV A;  2QEJ C;  3KYC D;  2A5U A;  4C56 C;  2L7R A;  3VTW A;  3AE5 B;  5GMV A;  4NJC A;  2NMQ A;  2IO1 B;  4C7Y A;  3WAN A;  1E8Y A;  1ET6 A;  1MG8 A;  2FCQ A;  2JX5 A;  3Q8A A;  3AE4 B;  3ZLZ A;  1YQ4 B;  1PQS A;  4WQM A;  4IWO A;  4RF0 A;  3SFE B;  1KTK A;  2NBV B;  1XLN A;  4RM8 A;  4RGO S;  4AWJ A;  3DVG X;  4FXC A;  2KTR A;  4GDK B;  4BKG A;  1C4C A;  4EE2 A;  3W5V B;  1C4A A;  5L95 C;  2HJ8 A;  2LVQ A;  3WAL A;  4A90 A;  1TYG B;  2VH1 A;  4IM2 A;  4KSK C;  2KJH B;  2IGD A;  3W1Y A;  2BTE A;  3O13 A;  4KKI A;  3AEG B;  1N63 A;  1WJ6 A;  1I7H A;  2J0M A;  2D3A A;  1K50 A;  3QAR A;  2BW2 A;  3FIL A;  3I57 A;  4FLH A;  5G5G A;  2WXL A;  1KJT A;  3QCA A;  5EDS A;  1WJ4 A;  4P7I A;  3EUB 2;  5HHD G;  3Q14 C;  3L08 A;  2Z59 B;  2ZW1 A;  4HCP B;  3R2T A;  2DAJ A;  3TUO A;  2JT4 B;  3EFU A;  2MCN B;  3BK2 A;  2ZJD A;  4AOF A;  1CZP A;  4L2Y A;  4PS8 A;  4DBG A;  4A3P A;  2L00 B;  2C9W B;  1WJN A;  3TEW A;  3AE6 B;  2KT7 A;  3U30 A;  2O2V B;  1R4M B;  2MP2 A;  2Q5W D;  3IT6 B;  2KDI A;  1ZE3 D;  2KVR A;  2CU1 A;  3U2S C;  2KAN A;  1FRD A;  3B0A A;  3UGB B;  2N9L A;  2PJH A;  2QDF A;  1JRP A;  2AYO B;  3N20 C;  1YN5 A;  1PGB A;  1LXD A;  2JWZ A;  2AQ1 B;  1WIA A;  1JWS D;  2N7D A;  2WXR A;  2L32 A;  2WU2 B;  2LXA A;  2GOW A;  3R8B A;  1UGJ A;  2EEL A;  5C3J B;  2LHD A;  3PS6 A;  2K25 A;  2DBY A;  2N9E B;  2INP E;  4KV2 A;  2LVO A;  3ZNZ B;  2N9K A;  1VDV A;  2JQR B;  3Q8C A;  4TV3 A;  4KGS A;  4HXD A;  4RFB A;  2MW5 A;  3VDZ A;  5AEK B;  2QMT A;  2CJO A;  1WSP A;  4DK5 A;  5IN7 A;  3AN1 A;  4NAW B;  1L7Y A;  1IYF A;  1OEY J;  1YD8 U;  1SGH A;  4FUL A;  1NDD A;  4M00 A;  2RDG A;  3HM6 X;  4XGA B;  3B1L X;  1C1Y B;  3LJ3 A;  2WXQ A;  4DHJ B;  1V9J A;  3VAW A;  1TKY A;  4AJW A;  1RLF A;  2RDH A;  1FO4 A;  4IM0 A;  4RM9 A;  3WAO A;  4W9C A;  3PLU A;  1OQR A;  2DZK A;  2PEA A;  3AEE B;  3NVV A;  1YMH E;  3SHQ A;  2L83 A;  1E8X A;  3AM9 A;  2N1W A;  2QC8 A;  3BVG A;  2BYT A;  1D3Z A;  4L1B A;  4HDO A;  4W9F A;  2CHW A;  2IY1 B;  3B9J A;  1E9M A;  2WHI A;  3V6C B;  4GOC A;  2GBM A;  2DX5 B;  5D3D A;  1UEL A;  2ZCB A;  3OWE B;  4MT5 A;  4MGK E;  1E90 A;  1E6E B;  1V8C A;  2MA9 B;  4W9G A;  2WQY B;  1V86 A;  3FIL B;  2MBO A;  4PS7 A;  5HI1 A;  2LGI A;  1LQB A;  2R2Q A;  2DHZ A;  2KMM A;  3AH7 A;  5E6N A;  1TS2 A;  1T0Y A;  1KFY B;  3N1Y C;  2C5L C;  2K39 A;  2QJL A;  1DOI A;  5HKH A;  2M0X A;  1XO3 A;  2K1F A;  3AE8 B;  2O6V A;  1QOB A;  2L52 A;  3ECI A;  2L76 A;  1FRR A;  5EE9 A;  3DPD A;  1QT9 A;  1NI2 A;  4IC7 B;  4FJZ A;  4LK0 M;  3VRB B;  2CJN A;  2KTF A;  4K3B A;  2K9X A;  2J0K A;  3W5U B;  1CMX B;  4FAD A;  3A9K A;  5T8I A;  3U7D A;  2AQ2 B;  3BWU D;  3EFC A;  5JH5 C;  4ZRI A;  4B95 A;  4PS3 A;  3UQB A;  1T0S C;  5D6J B;  2KQS A;  3NOB A;  2BYF A;  3IVF A;  3UI3 A;  1CJE A;  2FNJ B;  5JZE B;  1SXT A;  2B3A A;  3NJT A;  3A1Q A;  1STE A;  4MSQ B;  2JYE A;  2KMC A;  3ZJT A;  3MTN B;  2GMI C;  2FBW B;  1N5X A;  4KIK A;  1UBQ A;  5G5H A;  3JSV A;  1WR1 A;  3GZN B;  3U52 E;  3CIR B;  4NAM A;  2LI5 A;  1HA5 A;  1HEZ E;  1ZKH A;  1KH0 A;  2B76 B;  2PVO D;  4LNI A;  4K7S A;  4DHZ E;  1GUA B;  4YSZ B;  4ZHP A;  2BWE S;  2GB1 A;  2PE9 A;  2J0J A;  1F0Z A;  2KTR B;  1AAR A;  2GBN A;  1E8W A;  2O6V B;  3V6E B;  2V3S A;  3BYY B;  3L17 A;  3PVL A;  4WAF A;  4TSS A;  1JML A;  1Q5W B;  4W9K A;  4RGM A;  1RAX A;  1ZXH A;  4JX1 C;  3NS1 A;  4DWF A;  1K53 A;  5C1Z A;  4ICU A;  3X23 A;  2DLB A;  2INN E;  3OG5 A;  4FHK A;  3N9Y C;  2REX A;  1AN8 A;  3P4Q B;  2LMC A;  5DPS A;  4OZB A;  1FFU A;  1QZE A;  1I4R A;  1XLQ A;  3P63 A;  1ZP0 B;  4JIO U;  1MHX A;  3TEY A;  4OVU A;  4A9A A;  2KFK A;  2PLP A;  4DXA B;  2JYT A;  4URK A;  3BII D;  1KLG D;  4K3C A;  4GMV A;  4RGT A;  4XWT A;  4BKS A;  3K9O B;  1L0X B;  3CST A;  1BML C;  1SEB D;  1YOV B;  3LYY A;  2FUG 1;  1LO5 D;  4EFO A;  1JWM D;  1YNT E;  3EGR A;  2MX2 A;  1V80 A;  4LNN A;  4HRO A;  1HQR D;  1GPX A;  1D5M C;  2BS4 B;  2DAF A;  1SSN A;  2JZP A;  3X0W A;  3KWL A;  4IWP A;  5LLI A;  4US8 A;  1A5R A;  1UWX A;  5CTR C;  1DGJ A;  5C2T B;  5CHV C;  3ZVV A;  1ZPS A;  2HTM E;  2VH2 A;  5G2N A;  3T8M A;  2AQ3 B;  4ZHO A;  2KO3 A;  2RSU A;  2KDE B;  1YX6 B;  3RZW C;  1WXM A;  3DCG A;  1WGG A;  1GC7 A;  3QX1 A;  4NQL B;  4BVU C;  2ZPY A;  3P4P B;  2IBI B;  3MJW A;  4HKQ A;  4G50 A;  4GDK A;  5FR3 A;  1TZ1 A;  4QAY A;  3Q8F A;  4ZRQ A;  3PLV A;  2BWF A;  2IND C;  4F7Z A;  5IOI A;  2KD0 A;  3P4R B;  1WH3 A;  1GOZ A;  2EKI A;  4MM3 B;  3P2B A;  5FR6 A;  4FJY A;  1JQ4 A;  2QSD A;  2WXN A;  1SE2 A;  1WY8 A;  3MP9 A;  4KX6 B;  3LDZ E;  2Y3A A;  3ZGZ A;  3T3O A;  4P16 A;  5DPW A;  2V9H A;  1WI0 A;  1WX9 A;  3NRZ A;  1VJK A;  1NBF C;  4IKG A;  2PPH A;  1J19 A;  2KHW B;  2AL6 A;  1JWA D;  4ACF A;  3PHX B;  2WXF A;  1HXY D;  3B08 A;  4HWI B;  3N32 A;  1XEE A;  1ET9 A;  1S1Q B;  2KQ7 A;  5J2R A;  3TMP B;  2WXH A;  1XD3 B;  3PGE A;  4M0W B;  1SB3 C;  4IG7 B;  4RF1 A;  4IOI E;  3LB8 C;  3QC8 B;  2WP9 B;  2KYW A;  4EZK A;  2AL3 A;  4MAC A;  4E71 A;  2ACZ B;  1HTO A;  4KDL B;  4WJQ A;  4WJO A;  3SD5 A;  3NVY A;  2LD9 A;  3CF6 E;  5EE1 A;  1JRO A;  3H7P B;  5JXV A;  2FIF A;  5IO9 A;  2MLB A;  2LJ5 A;  1BXT A;  2KN5 A;  1HZ5 A;  1FNW A;  4IM3 A;  2WS3 B;  1B1Z A;  2XBB C;  4BFR A;  3ZDT A;  3KQ4 A;  2JRI B;  2PIA A;  4MDK E;  5AUI A;  3VQI A;  1FXT B;  2HD5 B;  4DQO C;  1M94 A;  3C8Y A;  4KZ0 A;  3ZKJ C;  4YTM B;  5IAA C;  1IBX B;  3MFG A;  2GBK A;  1KM7 A;  2MJD A;  2CU3 A;  2E3T A;  3Q8E A;  3IBE A;  3A4R A;  4MH0 E;  4GIV A;  4ZOH C;  1ZDX A;  2WX0 A;  4JWU C;  2HTH A;  1TY2 A;  4G0N B;  4AJY B;  3DDC B;  2M8S A;  2PW9 A;  1RWS A;  2SEB D;  5AZF A;  3NZU A;  3NZ3 A;  4KDI C;  4DHZ B;  2SAK A;  2H88 B;  4K7U A;  3AE1 B;  2K8B A;  2MJE A;  1XQQ A;  1C76 A;  2Y5B B;  2DYO A;  1FNU A;  2NPT A;  2BKR B;  4KGR A;  4LTU A;  2BB5 A;  1CK1 A;  4A3O A;  2D3B A;  5HFY A;  1E7V A;  2ZEQ A;  1DOY A;  4XDD A;  3AEF B;  1XT9 B;  3R3M A;  1ROE A;  2D2Q A;  2XN9 C;  1MG4 A;  1YJI A;  2WDR B;  2YEP F;  1JRU A;  4OZA A;  1VZ8 A;  2BS3 B;  1WXV A;  4HKZ E;  4WQO B;  5MPO A;  4HLE A;  2QIE B;  2KWC A;  3UIP B;  2PMV A;  3EA6 A;  1DOX A;  1UUP A;  1IGC A;  4WWO A;  2MBH A;  1OFF A;  3QAQ A;  1K8R B;  4FA6 A;  1FPY A;  4C4V B;  2KC2 A;  4PYZ A;  4CQN A;  1N62 A;  1WRI A;  4N59 A;  4O1N A;  4F8C B;  2CS4 A;  1EWC A;  3UF8 A;  3NS8 A;  2WU5 B;  2JY6 A;  3MJ5 A;  3Q6B A; 
#chains in the Genus database with same CATH homology
 1E6E B;  2JU6 X;  2ZW0 A;  4GLS C;  1AWD A;  4OW0 A;  1V8C A;  3AB5 A;  4TMA B;  2WQY B;  1GB1 A;  3FIL B;  1J7B A;  3W1S A;  3SFD B;  4YTN B;  3GP7 A;  4AQ7 A;  2WXG A;  4Q2J A;  5HI1 A;  1I4Q A;  2D5G A;  2LGI A;  2M56 B;  3HVD A;  4ARI A;  2KMM A;  3AH7 A;  3AEA B;  1TS2 A;  1F2R I;  3AE9 B;  1L6V A;  1KFY B;  1ZXI A;  2ICI A;  2LFI A;  2QJL A;  1A70 A;  1IUE A;  2JSV X;  2DWQ A;  1DOI A;  1L6U A;  1J7A A;  1XCQ L;  1XO3 A;  3AE8 B;  1L4Z B;  1V1P A;  2V3P A;  4ITK A;  5GXG B;  1QOB A;  1C4P A;  3AED B;  5BMI A;  2L52 A;  2VZK D;  1NI3 A;  1YN3 A;  2JXT A;  2KDM A;  3URY A;  1FRR A;  5EE9 A;  1QT9 A;  2VZK B;  4M0W A;  1P7E A;  1FM0 D;  1SIJ A;  2IJ0 A;  2R61 A;  3KLS X;  4LK0 M;  1JW9 D;  2CJN A;  3CWI A;  3VRB B;  4KGT A;  2FE8 A;  1VZ6 A;  1SE4 A;  4IDI A;  1UWM A;  2K9X A;  1EU3 A;  3W5U B;  1MVK A;  5T8I A;  1OQQ A;  1XXG A;  3IXS A;  2AQ2 B;  4A8X C;  1EU4 A;  2AX5 A;  3BWU D;  1ZUD 2;  1BUI C;  1D6E C;  2LUM A;  4DXF A;  3AE2 B;  1JCK B;  1RM6 C;  4ZYS A;  2RPV A;  2PTL A;  3UI3 A;  1CJE A;  1D4B A;  1MI0 A;  1TS4 A;  2N7J A;  2WXJ A;  1ZDV A;  3TEZ A;  2J53 A;  1SXT A;  1NYQ A;  1STE A;  2JYE A;  2OHF A;  3ZJT A;  3VR8 B;  3Q69 A;  2FBW B;  2W55 A;  1N5X A;  2KAJ A;  3Q8B A;  3DWG C;  3AE7 B;  5G5H A;  4HRS A;  3U52 E;  3CIR B;  2NTT A;  1FD6 A;  4NAM A;  1HA5 A;  4HJG E;  1HEZ E;  4KKJ A;  1ACC A;  1GAQ B;  1KH0 A;  2B76 B;  2TSS A;  3T3N A;  2PVO D;  1SBB B;  5FKA C;  4RH6 A;  4WH4 A;  4WWM A;  2LEK A;  4YSZ B;  3BZD B;  3ETR A;  4ZHP A;  4USA A;  5EE0 A;  2QIL A;  1SE3 A;  3B2F A;  3WCQ A;  2GB1 A;  1F0Z A;  1WYG A;  2MJ3 A;  3AEC B;  4A55 A;  1EWY C;  2Z8L A;  4P6V F;  4LLG M;  3BYY B;  3PO0 A;  3TSS A;  3P1M A;  4WAF A;  1QIL A;  4YXD B;  4TSS A;  1JML A;  1WGK A;  2W54 A;  4RGM A;  1RFK A;  1ZXH A;  5I4D A;  1I4P A;  4JX1 C;  2IGG A;  1FXA A;  2GI9 A;  2HDE A;  1V97 A;  3P42 A;  1F77 A;  2WXM A;  1K53 A;  3NS1 A;  1D5Z C;  3RPF C;  2DLB A;  3H8H A;  2INN E;  2WXP A;  3E9S A;  1TY0 A;  1ESF A;  1I4H A;  2KAC A;  1QF6 A;  1NVI D;  1PUT A;  4RGN A;  3N9Y C;  2WDV B;  3ZYY X;  1AN8 A;  1PYW D;  1XLP A;  4HEA 1;  3P4Q B;  1QOF A;  2LMC A;  3HRD D;  4OZB A;  5BYS A;  1FFU A;  1FIQ A;  1TS3 A;  1I4R A;  2WNM A;  1FCL A;  1T3Q A;  1XLQ A;  2IDY A;  3IAM 1;  3P63 A;  1ZP0 B;  1MHX A;  3KWV A;  1V1P B;  3GB1 A;  5E6J A;  3TEY A;  1XLO A;  5BMH A;  3GS2 A;  4A9A A;  1VLB A;  4MH8 A;  2PLP A;  3AEB B;  4H2A A;  2JYT A;  1T6B X;  3BII D;  2BT6 A;  1KLG D;  4RGT A;  1E7P B;  4XWT A;  2RMM A;  2WXK A;  4GDL B;  1L0X B;  1BML C;  1SEB D;  4B0E A;  1HZ6 A;  1PGX A;  1IGD A;  1QQR A;  4OHJ A;  3LYY A;  2FUG 1;  1LO5 D;  1JWM D;  1QOG A;  4C7Z A;  3MHZ A;  1YNT E;  3EGR A;  2IGH A;  2V4I B;  4HRO A;  2J42 A;  1QKZ A;  5H8Y E;  3W9C B;  1RYJ A;  1WWT A;  1HQR D;  1GPX A;  3ZJV A;  1D5M C;  2QEJ C;  3U7Z A;  2BS4 B;  1SSN A;  2JZP A;  3KWL A;  1TKG A;  4US8 A;  3PZ7 A;  5D7G A;  1UWX A;  1WXQ A;  4C56 C;  1E0Z A;  2IPK D;  1DGJ A;  1SJE D;  3B2G A;  2MEK A;  5C2T B;  1ZPS A;  2HTM E;  3AE5 B;  1L0V B;  1FMA D;  2AQ3 B;  4ZHO A;  2J52 A;  4NJC A;  2NMQ A;  3V3X A;  5TSS A;  2V0G A;  1SJH D;  4C7Y A;  4ARC A;  3MC0 B;  4J3O D;  4C80 A;  1ET6 A;  2JX5 A;  2K22 A;  3ABV B;  2KQ4 X;  3Q8A A;  3AE4 B;  1JAL A;  3P4P B;  1YQ4 B;  4WQM A;  5D3I B;  4RF0 A;  3SFE B;  4PT5 A;  2KN4 A;  1KTK A;  4HKQ A;  1XLN A;  1KF6 B;  5FR3 A;  3Q8F A;  4RGO S;  4R3D A;  1T5X D;  4ZRQ A;  4FXC A;  2MH7 A;  1MHH E;  3P4R B;  4GDK B;  3AV8 A;  1C4C A;  1SF0 A;  4DXG A;  1KLU D;  3W5V B;  1C4A A;  4EE2 A;  1GOZ A;  2EKI A;  4MM3 B;  1JWB D;  4YSX B;  2M19 A;  1TYG B;  4A90 A;  2KWD A;  3ZQ4 A;  1Y56 A;  2IGD A;  1R7S A;  1JQ4 A;  2BTE A;  2QSD A;  2WXN A;  1SE2 A;  2K3U A;  3O13 A;  4KKI A;  1IBX A;  3MP9 A;  3AEG B;  1N63 A;  3NVW A;  4KX6 B;  2Y3A A;  3R2I A;  1J7C A;  1I7H A;  3ZGZ A;  2X38 A;  1K50 A;  3L4P A;  5LNK 1;  3T3O A;  4P16 A;  1AYF A;  2BW2 A;  2OED A;  3FIL A;  2JWU A;  3I57 A;  4TQ0 A;  4N6E B;  3NRZ A;  5G5G A;  2WXL A;  1VJK A;  4TQ1 A;  4YWG G;  4IKG A;  4OVZ A;  1XCT L;  3EUB 2;  5HHD G;  2H89 B;  1JWA D;  2LHE A;  2ZW1 A;  2G9H D;  3R2T A;  4JPS A;  4A6Q A;  2WXF A;  1HXY D;  2K0P A;  1XF5 L;  3TUO A;  4NZL B;  2PKO A;  3BK2 A;  1TS5 A;  1C77 A;  1YQ3 B;  1XEE A;  1ET9 A;  1YJJ A;  2I38 A;  2WXH A;  1CZP A;  4L2Y A;  4XDC A;  4XE0 A;  4RNA A;  1SB3 C;  4RF1 A;  2Y5C A;  4IOI E;  3SEB A;  3RFZ B;  3LB8 C;  1NYR A;  2WP9 B;  2W3S A;  3BVZ A;  2J4X A;  2I2Y A;  2WDQ B;  4MAC A;  4WIP A;  1N61 A;  2YEP B;  3TEW A;  3E56 A;  1AW7 A;  3AE6 B;  2ACZ B;  2LJI A;  1P7F A;  3FC4 A;  2BBC A;  1N60 A;  2WXI A;  3FAH A;  1M4V A;  1NEK B;  3NVY A;  4YTP B;  5HG2 A;  1L5P A;  3VR9 B;  5EE1 A;  1JRO A;  2Q5W D;  1VRA B;  5JXV A;  3DWM A;  1MPE A;  1QOA A;  2ONQ A;  1C9F A;  2ON8 A;  3BVM A;  3IT6 B;  1FCC C;  1BXT A;  1PFD A;  1ZE3 D;  1HZ5 A;  1FNW A;  1VZ7 A;  3P4S B;  1L4D B;  3U2S C;  1FRD A;  2WS3 B;  2W3R A;  2N9L A;  1KRH A;  1B1Z A;  1JRP A;  3KQ4 A;  1N5W A;  1YN5 A;  1PGB A;  2PIA A;  4REZ A;  2AQ1 B;  4JWS C;  5EE3 A;  4OZC A;  5AUI A;  2M0A A;  3VQI A;  3HUI A;  2W82 A;  4DQO C;  1JWS D;  3C8Y A;  4ZRP A;  4YTM B;  2WXR A;  3AMZ A;  2L32 A;  2WU2 B;  1IBX B;  2PVG C;  3MFG A;  3R8B A;  1UGJ A;  2MJD A;  3U4E G;  2V3N A;  4XWW A;  3VRA B;  2EEL A;  2CU3 A;  5C3J B;  2E3T A;  1TJE A;  2LHD A;  3Q8E A;  4ZOH C;  2DBY A;  4UDU C;  1ZDX A;  1ENF A;  4JWU C;  1C79 A;  2INP E;  3LXF A;  1TY2 A;  1PDX A;  1FFV A;  2K5P A;  1FNV A;  1L0Y B;  2PW9 A;  5H92 C;  4YSY B;  2N9K A;  1RWS A;  2SEB D;  1VDV A;  4JE3 B;  2JQR B;  3Q8C A;  3SR6 A;  2BS2 B;  3NZ3 A;  4KGS A;  4RFB A;  2SAK A;  2H88 B;  1YN4 A;  2QMT A;  4US9 A;  2GRI A;  2CJO A;  3AE1 B;  1WSP A;  3ZJU A;  1I4X A;  1B9R A;  4WUR A;  3AN1 A;  4NAW B;  2MJE A;  4L23 A;  2WXO A;  5BYQ A;  1C76 A;  2DYO A;  1K52 A;  4YT0 B;  1PGA A;  1D5X C;  1GB4 A;  1FNU A;  5BMG A;  4KGR A;  1CQV A;  2RDG A;  4LTU A;  2BB5 A;  1QLB B;  1CK1 A;  2E6X A;  2WXQ A;  4RCO A;  4B0M A;  5HFY A;  1TKY A;  3I9V 1;  1DOY A;  1FXI A;  4XDD A;  3AEF B;  1EM7 A;  2RDH A;  1ROE A;  1FO4 A;  2XN9 C;  1YJI A;  2WDR B;  2YEP F;  4OZA A;  1VZ8 A;  1C78 A;  3V05 A;  3AE3 B;  1OQR A;  5FK9 C;  2WLB A;  2BS3 B;  1UNS A;  3AEE B;  4HKZ E;  5MPO A;  1NEN B;  2QIE B;  3HVZ A;  5AUK A;  2PMV A;  1TKE A;  3IT4 B;  3NVV A;  2DYM A;  5BYR A;  3EA6 A;  1DOX A;  1E10 A;  1UUP A;  1IGC A;  2Y5P A;  4N58 A;  1YMH E;  3J9C A;  3IAS 1;  2L83 A;  1OFF A;  2BB6 A;  1TZO A;  4AS1 A;  1ZOY B;  3AM9 A;  1FEH A;  3BVG A;  2BYT A;  3BK1 A;  3BYT B;  4L1B A;  2NTS A;  1I4G A;  4CQN A;  1N62 A;  2L1A A;  1WRI A;  3W2D A;  4N59 A;  4O1N A;  2XNA C;  3B9J A;  1E9M A;  1EWC A;  3NUH B;  1V1O A;  1K51 A;  2WU5 B;  4D2K A;  3PZ8 A;  5D3D A;  2G1E A;  1JWU D;  1DYQ A;  3MJ5 A;  3TEX A;  3NVZ A;  1F2R C;  1VR9 A;  3OWE B;  4MT5 A;  1Q10 A;  2N0S B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...