5DCNA

Crystal structure of lc3 in complex with tecpr2 lir
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
126
structure length
126
Chain Sequence
b'DEWEVIGGPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Microtubule-associated proteins 1A/1B light chain 3B
publication title TECPR2 Cooperates with LC3C to Regulate COPII-Dependent ER Export.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 34
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2015-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5dcnA00
2L00B 3VTVA 1GC7A 1WF9A 3R7RA 3KYCD 2FCMA 1UGMA 2JF5A 2RD0A 2C60A 3D32A 4II3B 4W9GA 5CTRC 3TJPA 3VFKA 4OVUA 3JW0X 4WJOA 4A3OA 4IWOA 2AL3A 1WJNA 3PPAA 3QWZB 4IM2A 3ZDMC 5LXIB 2KJ6A 4KV2A 5KHQA 2LASA 3W1YA 4FBJB 2KDIA 4GDKB 4II2B 2L0TA 3NY5A 4PS3A 4FLHA 3ZTCA 4CYEA 3ZNHB 4MH0E 3BINA 5CHWA 5KHOA 5AZGA 2M8SA 1KOTA 3MJWA 1WX7A 5L83A 2KQ7A 3QCAA 3M95A 3QX1A 1EO6A 1CMXB 2CU1A 3K9OB 4JLCA 3U7DA 5D7GA 4HXDA 1J8CA 1P3QU 4XX5A 2Y5BB 3OJ3A 4ANWA 2EMSA 2G4SA 2KJHB 1AARA 2LGDA 2L7RA 3QHTA 3CMMB 1E8ZA 1WYWB 2JWZA 4WJPA 4BKTA 2MQJA 2IO0B 2V4LA 2BWES 3L16A 3L17A 4LDTB 2NVUI 1YX6B 1WM3A 3ZNGC 4K7SA 4GGQA 4KSKC 5G55A 1RRBA 1WIAA 2J0KA 2N7DA 2BKRB 2M4NA 1WE7A 5AZFA 3VTUA 2REXA 4IUMB 4DBGA 3UGBB 2WX1A 1GC6A 2LRWA 4EZLA 2HJ8A 2L0FA 3QK0A 4JGHB 4DHZE 1NI2A 1WY8A 2CR5A 5HKHA 1V80A 3HIZA 3AULA 3GOEA 5GMVA 2FAZA 4GIVA 2K8BA 1S3SG 4G11A 1UELA 4WQOB 3C0RB 4NQLB 2MRPA 3DPDA 3APDA 3PS6A 3PSEB 4GU2A 2NBWB 3S2AA 3RZWC 1C1YB 2FUHB 4AWJA 3AU5A 4BOZB 4EKUA 2IY0B 1XD3B 4LDTD 1GUAB 3LDZE 2PPHA 2GBMA 2BYVE 2D10A 4BBNF 3UINB 4GB9A 1G6JA 1LM8B 3M3JA 3N32A 4IW0A 3RT3B 2JZ3B 2N1WA 3H6NA 1OGWA 2IY1B 2IBIB 3V6CB 2GBNA 4TKNA 2WX0A 4IWPA 1F9JA 1VD2A 3ZNID 1ZKHA 2M0XA 4KZ0A 2MLBA 3ECIA 2KMAA 4X57B 4EUTA 3V62A 4G50A 4AOFA 2JPHA 3WA0A 1J0GA 3VHTC 2GBKA 2JZZA 1GJZA 4EEWA 1WJ6A 1Y8RC 2ASQA 4F7ZA 5EDSA 2ZZPB 2LUEA 2A4ZA 1H8CA 1E8WA 2L3ZA 4BKGA 1S1QB 2J7QB 2LRUA 3HHMA 1V81A 2CHXA 4DXAB 1XT9B 4IM0A 4JL9A 5LLIA 2BGFA 4HPMB 2PJHA 5JH5C 4BFRA 1V86A 4GOCA 1WM2A 2MCNB 4MGKE 5DCNA 3QARA 3CSTA 3APFA 4ZRKA 3L08A 2I1KA 4AJWA 3IFWB 2KLCA 2N9EB 3V6EB 2G4DB 3PREA 2WYQA 1J19A 4DWFA 4B6WA 1WJUA 4FJYA 2K39A 3A9KA 2CS4A 2DX5B 3MTNB 3ZVVA 2KHWB 3PHXB 4ANVA 2N1VA 3LJ3A 2KKCA 4LCDE 2KX3A 3KVFB 4DDGD 2JY6A 1H4RA 2ZPNA 3WAOA 2RR9A 3ZIMA 1Z5SB 2DZKA 1WGHA 1WZ3A 3SDLC 3V60A 1C3TA 3K9PB 4EZKA 2EMTA 2XBBC 1TBEA 3N3KB 5C1ZA 3AI5A 1OEYJ 2J0JA 1TGZB 2MBQA 2RPQA 3B0AA 2A5UA 2KD0A 1LXDA 3N30A 3RYTA 3IG3A 2KWVB 2NBVB 2L05A 2C7HA 1WX9A 2BPSA 4W9KA 5D94A 1VCBA 4FHJA 4NNJB 4PYUA 4EZJA 4IM3A 3PRPB 4KDIC 2KNBA 5D2MB 1IYFA 2K8HA 4ZDVA 1RAXA 3ONSA 4MSQB 5TR5A 3W1SC 1WH3A 2KDFB 1R4NI 2LD9A 2MWSB 3KUZA 3VH4B 4MJSA 1OEYA 3TL5A 1JRUA 4HPLB 3A4RA 2MP2A 4FN2A 2MW5A 2O6VA 2K25A 4G0NB 2CHZA 3PLVA 4NY0A 3VH3B 4A3PA 1E90A 4GDLA 2KQSA 4W9LA 3QAQA 3UIPB 3A9KB 4DHJD 5LXHA 3P2BA 3VXWA 2M1MA 3ZLZA 2IZVB 4AUQC 4N9F4 3ZNZB 2I1JA 1WXSA 2OOBB 5DPSA 1IP9A 3A1QA 1KM7A 1TTNA 4W9CA 4E74A 3RULA 4FADA 4NQKE 2C9WB 2BYFA 4G3XB 2DAFA 4ICUA 4RM9A 3PZDA 2MSED 3CSFA 2IO1B 2FIFA 4BOSC 2LGXA 2LGYA 2V3SA 2KDBA 4MM3A 4BKSA 1K8RB 2DYMA 3DQVA 1P0RA 2G3QB 4KIKA 4ANUA 1WXMA 1ZGUB 1WRDB 2HD5B 3QC8B 5J18A 5IA7A 1KLVA 4B95A 2C7NB 3DCGA 3ZUNA 3EECA 5IAAC 4E3CA 2GOWA 3APCA 3JYUA 4W9DA 1UBIA 3VTWA 2BF8B 1WE6A 3B08A 5DPTA 2FNJB 4MJSB 3DOWA 2HTHA 4DHZB 4FJVB 1KJTA 1TZ1A 5CX3A 5E6PA 2ZVOA 2MP2B 4NAWA 3UIOB 5JHAA 4MELA 2O6VB 2BWFA 1D3ZA 1I35A 1OTRB 2KLGA 3IVFA 3U8ZA 5JHBA 3UQBA 2LVPA 4GDLB 1WJ4A 2LVQA 4KVGB 4WAAA 3O65B 1UZXB 2UWQA 3H9DA 4J6IA 3CF6E 4F1SA 2PE6B 3HM6X 1V5OA 2DYBA 3VVWB 4GSWA 4OVVA 4TUUA 1EF5A 2GMIC 2ZNVC 3A1QB 1NBFC 4M8NA 3DDCB 3AXCA 3X23A 4XC2A 1A5RA 3WIMA 3RUIB 3T8MA 1V2YA 3QQ8B 3JSVA 4TV3A 4A20A 3ZTDA 3X0WA 3L0WB 3DBHI 2KFKA 4WJQA 3VUYA 3ZKJC 3WAMA 3KW5B 4IC7B 4PS7A 3TCAA 3L54A 3A9JA 4CHKA 4KSLC 2O6VD 4ZRJA 3W1SA 1MG8A 1WZ0A 4KIKB 2W9NA 1ZW7A 3ZRCA 2KTRA 2K1FA 2YLMA 2MBHA 2KX0A 3KH0A 1UH6A 4KDLB 4EOYA 2J0MA 2ZEQA 3VUXA 2JVCA 4M0WB 3A4SC 3DVNV 4JIOU 4MDKE 1NDDA 3VAWA 2DHZA 4PS8A 4TQ0A 4IG7B 3NHEB 2AL6A 2YVCA 4GN1A 1GNUA 1YQBA 2N7EA 1RFAA 2C5LC 4MGIE 5D6JB 4I6LB 2EKEC 4NAWB 5E6NA 2MX2A 4W9IA 4HDOA 3SU8X 2JUOA 3A33B 2HE7A 1E7UA 3PLUA 3WANA 2WWZA 3TMPB 1E8XA 3NOBA 4K1RB 4PYZA 4DHJB 4BKSD 2NS5A 2ZPYA 1YX5B 3H1UA 1XQQA 1LQBA 5FR6A 1WR1A 2LXAA 2M17A 3EC8A 4AJYB 1V9JA 2FIDA 3H7SA 5DPRA 5DPWA 2C7MB 4P7IA 4GMVA 3JSVB 1PQSA 2XK5A 3SHQA 4F8CB 2L76A 1V49A 3VUWA 2KFKB 5L95C 1Z2MA 2JRIB 2DZIA 4RMAA 3R7QA 4W9JA 2DAJA 3RZFA 4W9FA 1P9DU 3A9JB 3PVLA 4K7WA 5C23A 2PE9A 3R66C 3UQAA 2FCQA 2KWCA 3M62B 1WMHA 2KTRB 3OAWA 4M8MA 4HJKA 1WGRA 2N4FA 2KANA 2LJ5A 3DVGY 4I6NB 3ALBA 3QA8A 2BKFA 3V61A 1P1AA 3PHWB 2D07B 2KXJA 3ML9A 3RCZA 1FXTB 3HM3A 1I42A 2KO3A 2D2QA 2R2QA 3OLMD 3ZRFA 1WGDA 2NR2A 2LWPA 4I6PA 3DBRI 4ASWC 3MHSD 1GG3A 1T0YA 2D11A 2KMCA 3DBLI 2XEWA 2JXXA 3DBSA 3QJZA 1Q1OA 2AEHA 3DVGX 2RGFA 3RD2A 3IHPC 1Q5WB 4HLEA 1QZEA 3PTFC 4HCNB 1R4MI 2UYZB 4FULA 5JZEB 2N9XA 1SGHA 1M94A 2Z0EB 5CHFA 4E71A 3OJ4B 3PGEA 2LZ6A 3NZSA 4HDQA 4DK5A 2KJRA 1UD7A 1OQYA 2MBOA 4NPNA 1LFDA 1L2NA 1EF1A 2LXCA 4CO7A 1WR6E 2K6QA 4RM8A 2O2VA 4MSMB 3HK0A 4DDID 3ZDTA 2BYEA 3ZW3A 1X1MA 4WWNA 4K7UA 4ANXA 1YIWA 1E5WA 1WI0A 4HCPB 2XK5B 1BT0A 2RSUA 2NPTA 3NS8A 2WDTB 1YJ1A 3PRMB 4JQWC 3TBLD 4NJ7A 2MA9B 1WFYA 3H7PA 2LI5A 4B9KA 2G45B 3UF8A 1UBQA 2L8JA 2FCSA 3DVNU 4GXBA 3VDZA 4URKA 1SE9A 3T9LA 1V5TA 3WALA 1WMHB 1WGYA 1WXAA 5AZHA 5BO4B 2KOXA 2JT4B 3PRZA 1EUVB 5E6OA 2GBJA 2D3GA 2NCNA 1WGGA 2Z0DB 4IWQA 4MEMA 4ZYNA 4AP4C 4LJPB 1Q0WB 4HWIB 3AU4A 2KFJA 4MGYE 2IO2B 1WX8A 3WAPA 3ML8A 3SD5A 2KVRA 3B1LX 2ZCBA 4WWPA 4FA6A 2V1YA 4WJNA 2JRHA 2PEAA 4FJZA 2ZCCA 4LJOB 4ICVA 2KK8A 3R3MA 1WXVA 2ZJDA 4ZRIA 2AYOB 2FCNA 1V6EA 2ZNVB 4TQ1A 3EHVA 2QHOA 3VQIA 1U4AA 1HE8A 2K8CA 2VRRB 2R2OA 3BY4B 4NJ6A 4BVUC 2DZMA 2MBBB 3JVZX 2O2VB 3TIXA 4GDKA 4HVBA 5J17A 2IO3B 3EFUA 2DYOA 3GZNI 3NZUA 2KZRA 2LVOA 1ISNA 2KTFA 3PT2B 2AWTA 4MGZE 4WWOA 1YD8U 3Q3JA 2DZJA 3QIJA 5AEKB 4FHKA 4YL8A 3KYDD 2NPTB 4BBNC 3KUCB 2CKHB 4XZ4A 2ZVNA 3H7PB 4W9EA 2OJRA 3M63B 3IBEA 2KC2A 5G2NA 2KDEB 2IYDB 2K6DB 1E7VA 1P98A 3L10B 3PV1A 4EFOA 1L7YA 2MBEA 3ZO5B 3U30A 2Z59B 4W9HA 1IPGA 1RLFA 3Q3FA 2KWUB 4KZCA 1SIFA 2CHWA 3ENEA 3KUDB 3L13A 4K81A 5J2RA 2KC1A 2KN5A 2DENB 5CHVC 2NBUA 4HK2A 2B3AA 2N9PC 3I3TB 2GBRA 1E8YA
chains in the Genus database with same CATH superfamily
2L00B 5HHDG 3KYCD 1QKZA 4W9GA 1T6BX 4IWOA 2AL3A 3VRBB 5LXIB 3ZDMC 3RMKC 4AS1A 1BMLC 2CU3A 2LASA 2KDIA 2L0TA 3NY5A 3AEFB 4FLHA 3ZTCA 3BINA 5CHWA 5KHOA 4OW0A 2V4IB 1LGRA 2KQ7A 2L83A 1SBBB 1CMXB 2CU1A 1J8CA 1P3QU 1GB4A 3ZJVA 2SEBD 2KJHB 1AARA 1JWBD 2L7RA 2LGDA 2DWQA 4WJPA 2IO0B 1L0VB 3HVDA 1GAQB 2HJ1A 1RRBA 1WE7A 5AZFA 2REXA 2HJ8A 2ICIA 3MP9A 3QK0A 4JGHB 1NI2A 1V80A 1E10A 1JW9D 3FILA 5AUIA 2JZPA 1N63A 3C0RB 2MRPA 2WXQA 2QC8A 1N60A 3APDA 3DPDA 3PSEB 4GU2A 5LNK1 1ZDVA 2Y3AA 3RZWC 3TSSA 2GLSA 4EKUA 1XD3B 1XEEA 2GBMA 2D10A 4FXCA 1FMAD 1LM8B 3M3JA 3U4EG 3AV8A 2IY1B 3O13A 3V6CB 1QOGA 2KN4A 2WDVB 2M0XA 1T5XD 4LNKA 3DWMA 3V62A 4NAMA 2JZZA 3ZXVA 1GJZA 2IJ0A 2ZZPB 4WH4A 4BKGA 2J7QB 1V81A 1XT9B 4HPMB 2PJHA 1PGAA 4BZAA 3TUOA 3T3OA 3QARA 3CSTA 3APFA 3V3XA 4AJWA 3V6EB 1J19A 5BYRA 4FJYA 2K39A 1HTQA 2CS4A 1Y56A 3ZVVA 3PHXB 2EKIA 5IKCM 3AE5B 5GXGB 1HTOA 1H4RA 3WAOA 1TYGB 1WGHA 3ZJUA 1VZ6A 3V60A 1TBEA 5C1ZA 1OFFA 3AI5A 4EE2A 1TGZB 2A5UA 2KD0A 3TEXA 1LXDA 1WWTA 2GRIA 3IAM1 3P4RB 2NBVB 2BPSA 4FHJA 3PRPB 1SJHD 4KDIC 1VR9A 2K8HA 1RAXA 1YN3A 3NJTA 2WDRB 5TSSA 2WU5B 2VZKB 3KUZA 2MWSB 3VH4B 4YSXB 2IGGA 4MJSA 1FCLA 3TL5A 2ZW0A 4REZA 3U52E 1I4PA 4MACA 2MP2A 2MW5A 2O6VA 2KWDA 3ZGZA 4G0NB 1C9FA 3VH3B 1FXIA 4W9LA 4GDLA 2AQ3B 5LXHA 3P2BA 4AUQC 1J7CA 2I1JA 1MPEA 4W9CA 3RULA 2C9WB 4ICUA 2DAFA 2K22A 3RFZB 3LXFA 3Q8EA 1RM6C 2X8XX 1FNWA 1J7AA 1YJIA 4KIKA 4ANUA 4HRSA 3TEZA 3QC8B 5J18A 1C79A 3DCGA 1PDXA 1UBIA 2KDMA 2MJDA 1TS3A 1TJEA 3UIOB 2BWFA 1D3ZA 3U7ZA 1OTRB 2LUMA 4WAAA 2UWQA 3CF6E 1EF5A 2GMIC 3A1QB 1NBFC 3DDCB 4M02A 3AMZA 1V2YA 4TV3A 4A20A 5HI1A 2KFKA 2RMMA 3KW5B 1SB3C 3L54A 3A9JA 4CHKA 4ZRJA 3W1SA 1SE4A 2KTRA 1T0QC 1XO3A 1QQRA 4MDKE 4ZHOA 4GN1A 3FKYA 4HDOA 3AEBB 3AE3B 4O1NA 3WANA 3SFEB 2WWZA 5E6JA 3TMPB 2XN9C 4K1RB 2Z8LA 5AUKA 2NS5A 3Q8BA 1M4VA 2LGIA 1JQ4A 5DPRA 5DPWA 2NMQA 2BVCA 4HKZE 3VUWA 1V1PB 3RZFA 4C4VA 1F77A 2DAJA 2JSVX 3VRAB 4YTMB 1L4ZB 4K7WA 2UU7A 3UQAA 4M8MA 1WMHA 4ZRQA 3ZQ4A 1WGRA 1D5XC 2D07B 1TZOA 3HM3A 4K3CA 1I42A 4Q2JA 3ZRFA 3DBRI 1YJJA 1GG3A 1T0YA 3DBLI 2ONQA 3QJZA 2RGFA 1ZOYB 1FNVA 3P4QB 1R4MI 4E71A 2AX5A 3PGEA 4NPNA 2K9XA 1L2NA 1EF1A 2LXCA 1WR6E 4RM8A 4MSMB 4RFBA 2BYEA 1X1MA 1E5WA 1R7SA 4MT5A 2QMTA 4HCPB 5H92C 1BT0A 2J53A 2WDTB 4NJ7A 4B9KA 3UF8A 2L8JA 3DVNU 2FCSA 2INNE 3WALA 1I4XA 5AZHA 1WXAA 5BMIA 1EU4A 3T3NA 3NVWA 4N6EB 2JT4B 5E6OA 1JROA 4A8XC 3SFDB 4HWIB 2KVZA 2H88B 1KFYB 1TKEA 3ZJTA 2PEAA 4FJZA 2WHIA 2KK8A 4OVZA 3VR9B 1BXTA 2DZMA 4HVBA 3EFUA 2DYOA 2KZRA 2LVOA 1OQRA 3P4SB 2KTFA 4L23A 5AEKB 1ZE3D 4YL8A 3KUCB 1L6VA 2CKHB 2ZVNA 4WAFA 3MFGA 1N62A 5G2NA 3RNGC 3AE6B 1E7VA 3B2FA 2MBEA 3ZO5B 4W9HA 1IPGA 1RLFA 2CHWA 2KN5A 3EA6A 4LNOA 2B3AA 1YOVB 2BQQA 2XNAC 3R7RA 4P1BC 2FCMA 3MC0B 1E6EB 1UGMA 2RD0A 4A9AA 5G5GA 4M00A 2D3AA 1GPXA 2M19A 1WJNA 3PPAA 2WXPA 3RNFC 3MC8A 2Q5WD 1T3QA 3DHIC 5KHQA 3Q2AC 3ETRA 5MPOA 3W1YA 4OZCA 4FBJB 4II2B 4P1CC 4XE0A 1TKYA 2N9LA 2M8SA 3FAHA 3DHHC 5C3JB 5L83A 2BTEA 3QCAA 1UGJA 1D6EC 3U7DA 5D7GA 3Q14C 4XX5A 4ANWA 2CJNA 2FBWB 2TSSA 2QIEB 1E8ZA 2JWZA 4BKTA 2MQJA 2WDQB 3L17A 4LDTB 2NVUI 3ZNGC 5G55A 1WIAA 1L5PA 2J0KA 2N7DA 2BKRB 3Q3NC 3VTUA 2MHJA 2WP9B 1QOFA 2WX1A 4EZLA 4DHZE 2CR5A 2LFIA 2FAZA 2G1EA 1KLUD 2K8BA 1UWXA 2FUG1 1ET9A 3PS6A 4ARIA 3S2AA 1C1YB 1SIJA 4AWJA 3J9CA 4ITKA 3PZ8A 2BBCA 3EGRA 4BBNF 2NTSA 4JWUC 3RT3B 2JZ3B 2N1WA 3H6NA 1OGWA 1YQ4B 4IWPA 1XLQA 1MG4A 1F9JA 3NVYA 3H8HA 2MLBA 2KMAA 4X57B 2JPHA 2GBKA 4EEWA 1Y8RC 5EDSA 3BK1A 2LUEA 2A4ZA 1H8CA 2J4XA 2L3ZA 1HQRD 3BYYB 3HHMA 2CHXA 4IM0A 4JL9A 1N61A 2BGFA 4XDCA 3U2SC 1SXTA 3R8BA 1JWSD 4BFRA 2MCNB 2D5GA 4MGKE 1TIFA 1ZUD2 2N9EB 3PREA 2WYQA 4DWFA 1WJUA 2DX5B 3MTNB 2KHWB 1ENFA 2KKCA 4LCDE 1VLBA 4DDGD 2JY6A 2QSDA 1P7EA 3ZIMA 2DZKA 1NENB 2EMTA 4AQ7A 3NZ3A 2RPQA 3IG3A 2KWVB 1WX9A 3N9YC 2LMCA 3IT6B 5D94A 1VCBA 4EZJA 1AW7A 1SE2A 5D2MB 3DBHB 3ONSA 3W1SC 2JXTA 1WH3A 2KDFB 3TEYA 3Q6BA 3AEEB 3P1MA 3A4RA 1QLBB 3KWVA 2CHZA 3HRDD 3PLVA 2KQSA 3A9KB 4S0RA 2V3PA 3ZLZA 1PGBA 3A1QA 1FRRA 2IDYA 4FADA 4NQKE 4G3XB 4RM9A 1C78A 1D4BA 2FIFA 2FE8A 4ZOHC 2LGXA 2LGYA 1C4CA 2W3RA 1WSPA 1HA5A 4BKSA 1NEKB 2M56B 2G3QB 3NRZA 4HROA 2BS2B 3AN1A 2HD5B 1R4NB 1FRDA 3DHGC 3BVZA 3APCA 1V1OA 3JYUA 3N20C 4OZBA 1WE6A 2HTHA 3Q8FA 1KJTA 5CX3A 4YXDB 4C80A 4USAA 3IVFA 3AEAB 5JHBA 3UQBA 4KVGB 3MHZA 4F1SA 2PE6B 1LO5D 3VVWB 3I5JC 4OVVA 4M8NA 3AXCA 4YT0B 4RNAA 1A5RA 4WIPA 3WIMA 3T8MA 4KGSA 3QQ8B 1ACCA 1YQ3B 3X0WA 1V1PA 1FFUA 3VUYA 3WAMA 1FCCC 4MM3B 2O6VD 3KQ4A 1WZ0A 2W9NA 1MVKA 1J7BA 3BYTB 3VUXA 4M0WB 1NDDA 4TQ0A 2YVCA 5D6JB 4NAWB 4QAYA 2M0AA 1TY0A 1JWUD 2JUOA 3A33B 3NS1A 4DHJB 1N6ZA 2ZPYA 2WXLA 4L1BA 1JWAD 1YN4A 3EC8A 3H7SA 4F8CB 4A90A 3NG0A 1QOBA 3R7QA 4RMAA 4W9JA 4W9FA 1C77A 4MH8A 3BVGA 2WXOA 3P63A 3OAWA 2W82A 3C8YA 2KANA 1I7HA 1P1AA 4RGMA 2KXJA 4US8A 2BS4B 3I9V1 1WGDA 4NJCA 2LWPA 4RCOA 1E7PB 2XEWA 2OHFA 3RD2A 3IHPC 1Q5WB 4HLEA 1QZEA 2WXJA 4HCNB 1FNUA 4ZYSA 2UYZB 4FULA 5JZEB 2Z0EB 1M94A 4HDQA 3NZSA 1UD7A 1OQYA 2MBOA 2PVGC 1LFDA 1IGCA 1HEZE 3HK0A 4DDID 4RF0A 1K50A 2XK5B 1MI0A 3AE8B 4BAXA 3TBLD 2DNFA 1WFYA 2LI5A 1L0XB 2MEKA 3P4PB 1I4RA 1UBQA 4URKA 3VDZA 2RDBC 1V5TA 1T0SC 2RDGA 1EUVB 1P7FA 2GBJA 2W55A 2NCNA 1WGGA 4AP4C 4MEMA 2R61A 3AU4A 3FC4A 2IO2B 3SD5A 2N9KA 2RPVA 3RN9C 2KVRA 4WJNA 4LJOB 1IGDA 4ICVA 3R3MA 2JYEA 2ZJDA 4ZRIA 2LHEA 4JE3B 2AYOB 1BUIC 2ZNVB 4TQ1A 1UWMA 1SF0A 2VRRB 2K8CA 3BY4B 2R2OA 4BVUC 3NVVA 1ZDXA 2LGSA 3HUIA 3RNAC 2AQ1B 3TIXA 2JQRB 2JX5A 4NZLB 1F0ZA 5EE1A 3ZXRA 4MGZE 3KYDD 1N5WA 2MH7A 5HG2A 3R2TA 5IP4D 3N1ZC 2NTTA 2OJRA 3IBEA 3B9JA 3L10B 1L7YA 4KGRA 1ESFA 1RYJA 1QILA 3I63C 1MJDA 3Q3FA 1SIFA 3ENEA 3KUDB 2KC1A 3R2IA 1EWYC 3I3TB 1NVID 2GBRA 4CYEA 4L2YA 2ACZB 1WF9A 1PUTA 2CJOA 2Y5CA 2IGHA 5CTRC 4J3OD 4OVUA 1SE3A 3NVZA 4WJOA 4A3OA 5BYSA 4KV2A 1IBXB 3KLSX 4HPPA 4PS3A 5FR3A 3ZNHB 4MH0E 5AZGA 3CWIA 1WX7A 1WYGA 3NUHB 3M95A 3BZDB 4JLCA 3K9OB 4HXDA 2Y5BB 1VRAB 2EMSA 2G4SA 2DLBA 3CMMB 4LNFA 2V4LA 2BWES 1YX6B 1WM3A 2RDHA 4K7SA 4IUMB 3GS2A 3UGBB 1GC6A 1DYQA 4PK1A 5HKHA 3VR8B 1JMLA 1Q10A 5GMVA 4XWTA 1DOXA 1V97A 2BB5A 4GIVA 1S3SG 4G11A 1QOAA 2JYTA 4NQLB 1K52A 2NBWB 1FPYA 2FUHB 4BOZB 3N1XC 1GUAB 3LDZE 1OQQA 2PPHA 3AE1B 3UINB 1FXAA 2AQ2B 3N32A 4IW0A 2IBIB 2WX0A 2WXFA 4KZ0A 2K0PA 1EM7A 4RGOS 1J0GA 3VHTC 4RF1A 2ASQA 3B2GA 1VZ8A 1E8WA 1S1QB 2LRUA 5EE0A 2WGSA 1JCKB 5LLIA 1B1ZA 3PZ7A 5DCNA 2G9HD 3IFWB 2KLCA 4IDIA 3A9KA 1C76A 2J52A 2N1VA 1JWMD 4LNIA 2KX3A 2ZPNA 5I4DA 2YEPF 1C3TA 3AM9A 4C00A 4GLSC 3B0AA 2KYWA 3BIID 3RYTA 2WQYB 4W9KA 2WNMA 2ON8A 4IM3A 3OG5A 1VJKA 2KNBA 1C4PA 4MSQB 2WLBA 1R4NI 3E9SA 2LD9A 1JALA 1JRUA 4HPLB 1E0ZA 1D5MC 3C19A 4HKQA 2K25A 5EE9A 2BT6A 4NY0A 4WQMA 4A3PA 1E90A 1YNTE 3UIPB 4C56C 1IUEA 4DHJD 4YSZB 2M1MA 2W3SA 1ROEA 4N9F4 3ZNZB 1WXSA 5DPSA 1IP9A 4KX6B 4JX1C 5JXVA 2WXGA 1TTNA 3E56A 1PFDA 2V9HA 2LJIA 2BYFA 2VZKD 1SSNA 2IO1B 2K3UA 2V3SA 2KDBA 4MM3A 1K8RB 2DYMA 4YWGG 1P0RA 2PMVA 1ZGUB 1WRDB 3LB8C 5IOIA 1KLVA 5IN7A 1CJEA 5IAAC 1HZ5A 4M0WA 2BF8B 2MJEA 3B08A 3KWLA 5HFYA 5DPTA 2FNJB 3DOWA 4DHZB 2B76B 4FJVB 2HTME 2ZVOA 1WGKA 4NAWA 2JWUA 2EELA 4MELA 5G5HA 2WXHA 4LNNA 2WXNA 1KLGD 1UZXB 3IAS1 3DBRB 3HM6X 1V5OA 2DYBA 2PLPA 3DBLB 4GSWA 1I4HA 3X23A 5BMGA 1F52A 1STEA 3RUIB 1R4MB 2QCZA 1UUPA 4C7ZA 3BVMA 3L0WB 4WJQA 1C4AA 3URYA 4IC7B 4PS7A 4N59A 2PTLA 4KSLC 1MG8A 1VDVA 1UNSA 1ZW7A 3ZRCA 2K1FA 2YLMA 2PVOD 2MBHA 2KX0A 3KH0A 1UH6A 4KDLB 2J0MA 1K51A 2JVCA 3A4SC 3DVNV 2DHZA 5IO9A 4PS8A 4IG7B 1RWSA 1D5ZC 1GNUA 2N7EA 4M01A 2E3TA 2C5LC 1XLNA 2EKEC 4WURA 2MX2A 1E9MA 3UI3A 2HE7A 3AECB 1E8XA 1GOZA 3NOBA 1N5XA 4PYZA 4BKSD 3IXSA 2L32A 1YX5B 2SAKA 3H1UA 5FR6A 1WR1A 2LXAA 4RH6A 4AJYB 4KKJA 1V9JA 2FIDA 1YMHE 2C7MB 4P7IA 4GMVA 2DBYA 3JSVB 1CK1A 2XK5A 3SHQA 1FIQA 2L76A 1V49A 2INPE 3I57A 4KGTA 2JRIB 2DZIA 2QEJC 3PVLA 1SJED 3M62B 2N4FA 3ALBA 3QA8A 2I38A 3RCZA 1FXTB 1EU3A 2KO3A 2K5PA 2R2QA 2X38A 2NR2A 1MHXA 4I6PA 4ASWC 2D11A 2AEHA 3DVGX 3PTFC 1F2RC 2VH2A 2N9XA 1SGHA 3OJ4B 4DK5A 1KTKA 2PIAA 1QF6A 1YIWA 4S17A 5BYQA 1V8CA 1WI0A 3L4PA 1EWCA 3NS8A 4A55A 4JQWC 1L0YB 3N1YC 4GXBA 1I4GA 3T9LA 2WXRA 1K53A 4IOIE 1ZXIA 4YTNB 2MJ3A 2Z0DB 4ZYNA 2OEDA 1UF0A 2KACA 3ML8A 3RNEC 2ZCBA 4WWPA 3W5VB 2V1YA 1HXYD 3CIRB 5BMHA 2HDEA 2W54A 1WXVA 2BB6A 1AYFA 4XWWA 2FCNA 3EHVA 2QHOA 1HE8A 4NJ6A 2QDFA 2MBBB 3JVZX 2O2VB 1IBXA 2IO3B 3NZUA 3V05A 4PT5A 1GB1A 1B9RA 2AWTA 3Q3JA 3QIJA 2DZJA 3P42A 4FHKA 2NPTB 4XZ4A 3H7PB 4W9EA 3M63B 2LHDA 1WRIA 2WU2B 2WXMA 2INCC 1P98A 3PV1A 3Q69A 4EFOA 1ET6A 4US9A 5J2RA 3L13A 4K81A 2DENB 5CHVC 2NBUA 4HK2A 4N58A 2N9PC 1E8YA 3VTVA 1GC7A 2PKOA 4RGNA 3W5UB 2JF5A 3D32A 2C60A 4II3B 3TJPA 3VFKA 3JW0X 3GP7A 1XLOA 3QWZB 4IM2A 2KJ6A 3GZNB 1DOIA 4GDKB 2VH1A 2L1AA 1KOTA 2LEKA 3MJWA 3RNBC 3MJ5A 3QX1A 1EO6A 4DXFA 1VZ7A 3GE8C 3OJ3A 4K3BA 3QHTA 1XCQL 1WYWB 2IPKD 1A70A 3AE9B 3AB5A 3L16A 4P16A 4GGQA 4KSKC 5H8YE 2M4NA 1RFKA 2V0GA 1FO4A 4DBGA 1ZXHA 2LRWA 2L0FA 4XGAB 1WY8A 3HIZA 3AULA 3GOEA 2QILA 1UELA 4WQOB 5EE3A 4RGTA 3AU5A 2IY0B 4LDTD 2BYVE 4GB9A 1G6JA 1JRPA 1ZP0B 4R3DA 1NI3A 2GBNA 4TKNA 1VD2A 3ZNID 1ZKHA 4B0EA 4B0MA 3ECIA 4EUTA 2BYTA 4G50A 4H2AA 2N7JA 4AOFA 3WA0A 1SEBD 3W2DA 1WJ6A 1WXQA 4F7ZA 3TEWA 4DXAB 5JH5C 2WXKA 1V86A 3Q3MC 4GOCA 1PYWD 1WM2A 3FILB 1I4QA 4P6VF 4ZRKA 3L08A 2I1KA 2G4DB 4B6WA 3PO0A 2KQ4X 4ANVA 3LJ3A 3KVFB 3AE7B 2RR9A 1Z5SB 4LLGM 1WZ3A 3SDLC 3K9PB 2KMMA 2XBBC 4ACFA 4EZKA 3N3KB 1T0RC 1OEYJ 2J0JA 2MBQA 1F2RI 1FM0D 3N30A 2D3BA 2L05A 2C7HA 4NNJB 4PYUA 3AEGB 1IYFA 4ZDVA 5TR5A 1CZPA 3IT4B 1OEYA 2QJLA 4FN2A 2WXIA 4XDDA 3HVZA 3QAQA 2D3CA 4XYCA 3VXWA 2IZVB 2YEPB 2OOBB 4ZRPA 1YN5A 1KM7A 4KKIA 4UDUC 4E74A 3BK2A 3PZDA 2MSED 3CSFA 3EUB2 2Y5PA 3ZYYX 4BOSC 3DQVA 1WXMA 1TS5A 5IA7A 4B95A 2C7NB 1QT9A 3ZUNA 3EECA 3SR6A 1ZPSA 4HEA1 1TS2A 4E3CA 2GOWA 4JPSA 4W9DA 3VTWA 3AE2B 3RPFC 1NYRA 4ARCA 4MJSB 2N0SB 5E6PA 1TZ1A 2MP2B 5JHAA 2O6VB 1I35A 2KLGA 3U8ZA 1FFVA 2LVPA 4GDLB 1WJ4A 2LVQA 3O65B 2H89B 4J6IA 3H9DA 4A6QA 4TUUA 4HJGE 2ZNVC 2WS3B 4YTPB 4XC2A 1XCTL 1HZ6A 3JSVA 3ZTDA 3DBHI 3WCQA 3ZKJC 2INDC 3TCAA 4TSSA 3GB1A 4KIKB 2J42A 1DGJA 2E6XA 2I2YA 4EOYA 2ZEQA 4IKGA 4CQNA 4JIOU 3VAWA 2L52A 3ABVB 4WWMA 3NHEB 2AL6A 3EFCA 3GE3C 1YQBA 3OWEB 4LK0M 1RFAA 4MGIE 4I6LB 5E6NA 4W9IA 3SU8X 3RNCC 1E7UA 3PLUA 1XLPA 5C2TB 2KT7A 1XQQA 1LQBA 2M17A 1CQVA 1AWDA 1PQSA 2BW2A 2KFKB 5L95C 1Z2MA 4JWSC 1P9DU 3A9JB 5C23A 2PE9A 3R66C 2FCQA 1L6UA 2KWCA 2KTRB 4HJKA 5D3DA 2LJ5A 3DVGY 4I6NB 3V61A 2BKFA 3PHWB 3ML9A 3RI7C 2D2QA 1FEHA 3OLMD 5FKAC 2OJWA 3MHSD 2KMCA 2JXXA 3DWGC 3DBSA 3LYYA 1Q1OA 4YSYB 1PGXA 1FD6A 2PW9A 5CHFA 4C7YA 2LZ6A 2KJRA 1MHHE 4CO7A 2K6QA 2O2VA 3ZDTA 3ZW3A 4WWNA 4K7UA 4ANXA 1AN8A 1NYQA 4OZAA 2V3NA 1MFWA 2RSUA 2NPTA 1YJ1A 1TS4A 3PRMB 1L4DB 2MA9B 3H7PA 3AEDB 4C4VB 2G45B 5T8IA 1SE9A 2GB1A 1TT5B 1WMHB 1WGYA 5BO4B 2KOXA 3Q8CA 4ZHPA 3PRZA 2D3GA 2KAJA 3Q3OC 4IWQA 3AE4B 4LJPB 1Q0WB 2KFJA 4MGYE 1WX8A 3WAPA 1XF5L 2BS3B 2ZW1A 3B1LX 2JU6X 4FA6A 1TY2A 2JRHA 2ZCCA 3W9CB 1XXGA 3MC9A 1V6EA 3AH7A 3VQIA 1U4AA 1F1HA 4LTUA 4GDKA 5J17A 3Q8AA 3GZNI 1DOYA 1ISNA 4D2KA 3PT2B 4WWOA 5FK9C 1YD8U 4BBNC 2IGDA 3BWUD 2KC2A 2KDEB 2IYDB 2K6DB 1KF6B 4TMAB 4DQOC 3U30A 5D3IB 1TKGA 2Z59B 4DXGA 4KZCA 2KWUB 2GI9A 1KRHA 4OHJA 1KH0A 3SEBA
chains in the Genus database with same CATH topology
2L00B 3VTVA 1GC7A 1WF9A 3R7RA 3KYCD 2FCMA 1UGMA 2JF5A 2RD0A 2C60A 3D32A 4II3B 4W9GA 5CTRC 3TJPA 3VFKA 4OVUA 3JW0X 4WJOA 4A3OA 4IWOA 2AL3A 1WJNA 3PPAA 3QWZB 4IM2A 3ZDMC 5LXIB 2KJ6A 4KV2A 5KHQA 2LASA 3W1YA 4FBJB 2KDIA 4GDKB 4II2B 2L0TA 3NY5A 4PS3A 4FLHA 3ZTCA 4CYEA 3ZNHB 4MH0E 3BINA 5CHWA 5KHOA 5AZGA 2M8SA 1KOTA 3MJWA 1WX7A 5L83A 2KQ7A 3QCAA 3M95A 3QX1A 1EO6A 1CMXB 2CU1A 3K9OB 4JLCA 3U7DA 5D7GA 4HXDA 1J8CA 1P3QU 4XX5A 2Y5BB 3OJ3A 4ANWA 2EMSA 2G4SA 2KJHB 1AARA 2LGDA 2L7RA 3QHTA 3CMMB 1E8ZA 1WYWB 2JWZA 4WJPA 4BKTA 2MQJA 2IO0B 2V4LA 2BWES 3L16A 3L17A 4LDTB 2NVUI 1YX6B 1WM3A 3ZNGC 4K7SA 4GGQA 4KSKC 5G55A 1RRBA 1WIAA 2J0KA 2N7DA 2BKRB 2M4NA 1WE7A 5AZFA 3VTUA 2REXA 4IUMB 4DBGA 3UGBB 2WX1A 1GC6A 2LRWA 4EZLA 2HJ8A 2L0FA 3QK0A 4JGHB 4DHZE 1NI2A 1WY8A 2CR5A 5HKHA 1V80A 3HIZA 3AULA 3GOEA 5GMVA 2FAZA 4GIVA 2K8BA 1S3SG 4G11A 1UELA 4WQOB 3C0RB 4NQLB 2MRPA 3DPDA 3APDA 3PS6A 3PSEB 4GU2A 2NBWB 3S2AA 3RZWC 1C1YB 2FUHB 4AWJA 3AU5A 4BOZB 4EKUA 2IY0B 1XD3B 4LDTD 1GUAB 3LDZE 2PPHA 2GBMA 2BYVE 2D10A 4BBNF 3UINB 4GB9A 1G6JA 1LM8B 3M3JA 3N32A 4IW0A 3RT3B 2JZ3B 2N1WA 3H6NA 1OGWA 2IY1B 2IBIB 3V6CB 2GBNA 4TKNA 2WX0A 4IWPA 1F9JA 1VD2A 3ZNID 1ZKHA 2M0XA 4KZ0A 2MLBA 3ECIA 2KMAA 4X57B 4EUTA 3V62A 4G50A 4AOFA 2JPHA 3WA0A 1J0GA 3VHTC 2GBKA 2JZZA 1GJZA 4EEWA 1WJ6A 1Y8RC 2ASQA 4F7ZA 5EDSA 2ZZPB 2LUEA 2A4ZA 1H8CA 1E8WA 2L3ZA 4BKGA 1S1QB 2J7QB 2LRUA 3HHMA 1V81A 2CHXA 4DXAB 1XT9B 4IM0A 4JL9A 5LLIA 2BGFA 4HPMB 2PJHA 5JH5C 4BFRA 1V86A 4GOCA 1WM2A 2MCNB 4MGKE 5DCNA 3QARA 3CSTA 3APFA 4ZRKA 3L08A 2I1KA 4AJWA 3IFWB 2KLCA 2N9EB 3V6EB 2G4DB 3PREA 2WYQA 1J19A 4DWFA 4B6WA 1WJUA 4FJYA 2K39A 3A9KA 2CS4A 2DX5B 3MTNB 3ZVVA 2KHWB 3PHXB 4ANVA 2N1VA 3LJ3A 2KKCA 4LCDE 2KX3A 3KVFB 4DDGD 2JY6A 1H4RA 2ZPNA 3WAOA 2RR9A 3ZIMA 1Z5SB 2DZKA 1WGHA 1WZ3A 3SDLC 3V60A 1C3TA 3K9PB 4EZKA 2EMTA 2XBBC 1TBEA 3N3KB 5C1ZA 3AI5A 1OEYJ 2J0JA 1TGZB 2MBQA 2RPQA 3B0AA 2A5UA 2KD0A 1LXDA 3N30A 3RYTA 3IG3A 2KWVB 2NBVB 2L05A 2C7HA 1WX9A 2BPSA 4W9KA 5D94A 1VCBA 4FHJA 4NNJB 4PYUA 4EZJA 4IM3A 3PRPB 4KDIC 2KNBA 5D2MB 1IYFA 2K8HA 4ZDVA 1RAXA 3ONSA 4MSQB 5TR5A 3W1SC 1WH3A 2KDFB 1R4NI 2LD9A 2MWSB 3KUZA 3VH4B 4MJSA 1OEYA 3TL5A 1JRUA 4HPLB 3A4RA 2MP2A 4FN2A 2MW5A 2O6VA 2K25A 4G0NB 2CHZA 3PLVA 4NY0A 3VH3B 4A3PA 1E90A 4GDLA 2KQSA 4W9LA 3QAQA 3UIPB 3A9KB 4DHJD 5LXHA 3P2BA 3VXWA 2M1MA 3ZLZA 2IZVB 4AUQC 4N9F4 3ZNZB 2I1JA 1WXSA 2OOBB 5DPSA 1IP9A 3A1QA 1KM7A 1TTNA 4W9CA 4E74A 3RULA 4FADA 4NQKE 2C9WB 2BYFA 4G3XB 2DAFA 4ICUA 4RM9A 3PZDA 2MSED 3CSFA 2IO1B 2FIFA 4BOSC 2LGXA 2LGYA 2V3SA 2KDBA 4MM3A 4BKSA 1K8RB 2DYMA 3DQVA 1P0RA 2G3QB 4KIKA 4ANUA 1WXMA 1ZGUB 1WRDB 2HD5B 3QC8B 5J18A 5IA7A 1KLVA 4B95A 2C7NB 3DCGA 3ZUNA 3EECA 5IAAC 4E3CA 2GOWA 3APCA 3JYUA 4W9DA 1UBIA 3VTWA 2BF8B 1WE6A 3B08A 5DPTA 2FNJB 4MJSB 3DOWA 2HTHA 4DHZB 4FJVB 1KJTA 1TZ1A 5CX3A 5E6PA 2ZVOA 2MP2B 4NAWA 3UIOB 5JHAA 4MELA 2O6VB 2BWFA 1D3ZA 1I35A 1OTRB 2KLGA 3IVFA 3U8ZA 5JHBA 3UQBA 2LVPA 4GDLB 1WJ4A 2LVQA 4KVGB 4WAAA 3O65B 1UZXB 2UWQA 3H9DA 4J6IA 3CF6E 4F1SA 2PE6B 3HM6X 1V5OA 2DYBA 3VVWB 4GSWA 4OVVA 4TUUA 1EF5A 2GMIC 2ZNVC 3A1QB 1NBFC 4M8NA 3DDCB 3AXCA 3X23A 4XC2A 1A5RA 3WIMA 3RUIB 3T8MA 1V2YA 3QQ8B 3JSVA 4TV3A 4A20A 3ZTDA 3X0WA 3L0WB 3DBHI 2KFKA 4WJQA 3VUYA 3ZKJC 3WAMA 3KW5B 4IC7B 4PS7A 3TCAA 3L54A 3A9JA 4CHKA 4KSLC 2O6VD 4ZRJA 3W1SA 1MG8A 1WZ0A 4KIKB 2W9NA 1ZW7A 3ZRCA 2KTRA 2K1FA 2YLMA 2MBHA 2KX0A 3KH0A 1UH6A 4KDLB 4EOYA 2J0MA 2ZEQA 3VUXA 2JVCA 4M0WB 3A4SC 3DVNV 4JIOU 4MDKE 1NDDA 3VAWA 2DHZA 4PS8A 4TQ0A 4IG7B 3NHEB 2AL6A 2YVCA 4GN1A 1GNUA 1YQBA 2N7EA 1RFAA 2C5LC 4MGIE 5D6JB 4I6LB 2EKEC 4NAWB 5E6NA 2MX2A 4W9IA 4HDOA 3SU8X 2JUOA 3A33B 2HE7A 1E7UA 3PLUA 3WANA 2WWZA 3TMPB 1E8XA 3NOBA 4K1RB 4PYZA 4DHJB 4BKSD 2NS5A 2ZPYA 1YX5B 3H1UA 1XQQA 1LQBA 5FR6A 1WR1A 2LXAA 2M17A 3EC8A 4AJYB 1V9JA 2FIDA 3H7SA 5DPRA 5DPWA 2C7MB 4P7IA 4GMVA 3JSVB 1PQSA 2XK5A 3SHQA 4F8CB 2L76A 1V49A 3VUWA 2KFKB 5L95C 1Z2MA 2JRIB 2DZIA 4RMAA 3R7QA 4W9JA 2DAJA 3RZFA 4W9FA 1P9DU 3A9JB 3PVLA 4K7WA 5C23A 2PE9A 3R66C 3UQAA 2FCQA 2KWCA 3M62B 1WMHA 2KTRB 3OAWA 4M8MA 4HJKA 1WGRA 2N4FA 2KANA 2LJ5A 3DVGY 4I6NB 3ALBA 3QA8A 2BKFA 3V61A 1P1AA 3PHWB 2D07B 2KXJA 3ML9A 3RCZA 1FXTB 3HM3A 1I42A 2KO3A 2D2QA 2R2QA 3OLMD 3ZRFA 1WGDA 2NR2A 2LWPA 4I6PA 3DBRI 4ASWC 3MHSD 1GG3A 1T0YA 2D11A 2KMCA 3DBLI 2XEWA 2JXXA 3DBSA 3QJZA 1Q1OA 2AEHA 3DVGX 2RGFA 3RD2A 3IHPC 1Q5WB 4HLEA 1QZEA 3PTFC 4HCNB 1R4MI 2UYZB 4FULA 5JZEB 2N9XA 1SGHA 1M94A 2Z0EB 5CHFA 4E71A 3OJ4B 3PGEA 2LZ6A 3NZSA 4HDQA 4DK5A 2KJRA 1UD7A 1OQYA 2MBOA 4NPNA 1LFDA 1L2NA 1EF1A 2LXCA 4CO7A 1WR6E 2K6QA 4RM8A 2O2VA 4MSMB 3HK0A 4DDID 3ZDTA 2BYEA 3ZW3A 1X1MA 4WWNA 4K7UA 4ANXA 1YIWA 1E5WA 1WI0A 4HCPB 2XK5B 1BT0A 2RSUA 2NPTA 3NS8A 2WDTB 1YJ1A 3PRMB 4JQWC 3TBLD 4NJ7A 2MA9B 1WFYA 3H7PA 2LI5A 4B9KA 2G45B 3UF8A 1UBQA 2L8JA 2FCSA 3DVNU 4GXBA 3VDZA 4URKA 1SE9A 3T9LA 1V5TA 3WALA 1WMHB 1WGYA 1WXAA 5AZHA 5BO4B 2KOXA 2JT4B 3PRZA 1EUVB 5E6OA 2GBJA 2D3GA 2NCNA 1WGGA 2Z0DB 4IWQA 4MEMA 4ZYNA 4AP4C 4LJPB 1Q0WB 4HWIB 3AU4A 2KFJA 4MGYE 2IO2B 1WX8A 3WAPA 3ML8A 3SD5A 2KVRA 3B1LX 2ZCBA 4WWPA 4FA6A 2V1YA 4WJNA 2JRHA 2PEAA 4FJZA 2ZCCA 4LJOB 4ICVA 2KK8A 3R3MA 1WXVA 2ZJDA 4ZRIA 2AYOB 2FCNA 1V6EA 2ZNVB 4TQ1A 3EHVA 2QHOA 3VQIA 1U4AA 1HE8A 2K8CA 2VRRB 2R2OA 3BY4B 4NJ6A 4BVUC 2DZMA 2MBBB 3JVZX 2O2VB 3TIXA 4GDKA 4HVBA 5J17A 2IO3B 3EFUA 2DYOA 3GZNI 3NZUA 2KZRA 2LVOA 1ISNA 2KTFA 3PT2B 2AWTA 4MGZE 4WWOA 1YD8U 3Q3JA 2DZJA 3QIJA 5AEKB 4FHKA 4YL8A 3KYDD 2NPTB 4BBNC 3KUCB 2CKHB 4XZ4A 2ZVNA 3H7PB 4W9EA 2OJRA 3M63B 3IBEA 2KC2A 5G2NA 2KDEB 2IYDB 2K6DB 1E7VA 1P98A 3L10B 3PV1A 4EFOA 1L7YA 2MBEA 3ZO5B 3U30A 2Z59B 4W9HA 1IPGA 1RLFA 3Q3FA 2KWUB 4KZCA 1SIFA 2CHWA 3ENEA 3KUDB 3L13A 4K81A 5J2RA 2KC1A 2KN5A 2DENB 5CHVC 2NBUA 4HK2A 2B3AA 2N9PC 3I3TB 2GBRA 1E8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L00 B;  3VTV A;  1GC7 A;  1WF9 A;  3R7R A;  3KYC D;  2FCM A;  1UGM A;  2JF5 A;  2RD0 A;  2C60 A;  3D32 A;  4II3 B;  4W9G A;  5CTR C;  3TJP A;  3VFK A;  4OVU A;  3JW0 X;  4WJO A;  4A3O A;  4IWO A;  2AL3 A;  1WJN A;  3PPA A;  3QWZ B;  4IM2 A;  3ZDM C;  5LXI B;  2KJ6 A;  4KV2 A;  5KHQ A;  2LAS A;  3W1Y A;  4FBJ B;  2KDI A;  4GDK B;  4II2 B;  2L0T A;  3NY5 A;  4PS3 A;  4FLH A;  3ZTC A;  4CYE A;  3ZNH B;  4MH0 E;  3BIN A;  5CHW A;  5KHO A;  5AZG A;  2M8S A;  1KOT A;  3MJW A;  1WX7 A;  5L83 A;  2KQ7 A;  3QCA A;  3M95 A;  3QX1 A;  1EO6 A;  1CMX B;  2CU1 A;  3K9O B;  4JLC A;  3U7D A;  5D7G A;  4HXD A;  1J8C A;  1P3Q U;  4XX5 A;  2Y5B B;  3OJ3 A;  4ANW A;  2EMS A;  2G4S A;  2KJH B;  1AAR A;  2LGD A;  2L7R A;  3QHT A;  3CMM B;  1E8Z A;  1WYW B;  2JWZ A;  4WJP A;  4BKT A;  2MQJ A;  2IO0 B;  2V4L A;  2BWE S;  3L16 A;  3L17 A;  4LDT B;  2NVU I;  1YX6 B;  1WM3 A;  3ZNG C;  4K7S A;  4GGQ A;  4KSK C;  5G55 A;  1RRB A;  1WIA A;  2J0K A;  2N7D A;  2BKR B;  2M4N A;  1WE7 A;  5AZF A;  3VTU A;  2REX A;  4IUM B;  4DBG A;  3UGB B;  2WX1 A;  1GC6 A;  2LRW A;  4EZL A;  2HJ8 A;  2L0F A;  3QK0 A;  4JGH B;  4DHZ E;  1NI2 A;  1WY8 A;  2CR5 A;  5HKH A;  1V80 A;  3HIZ A;  3AUL A;  3GOE A;  5GMV A;  2FAZ A;  4GIV A;  2K8B A;  1S3S G;  4G11 A;  1UEL A;  4WQO B;  3C0R B;  4NQL B;  2MRP A;  3DPD A;  3APD A;  3PS6 A;  3PSE B;  4GU2 A;  2NBW B;  3S2A A;  3RZW C;  1C1Y B;  2FUH B;  4AWJ A;  3AU5 A;  4BOZ B;  4EKU A;  2IY0 B;  1XD3 B;  4LDT D;  1GUA B;  3LDZ E;  2PPH A;  2GBM A;  2BYV E;  2D10 A;  4BBN F;  3UIN B;  4GB9 A;  1G6J A;  1LM8 B;  3M3J A;  3N32 A;  4IW0 A;  3RT3 B;  2JZ3 B;  2N1W A;  3H6N A;  1OGW A;  2IY1 B;  2IBI B;  3V6C B;  2GBN A;  4TKN A;  2WX0 A;  4IWP A;  1F9J A;  1VD2 A;  3ZNI D;  1ZKH A;  2M0X A;  4KZ0 A;  2MLB A;  3ECI A;  2KMA A;  4X57 B;  4EUT A;  3V62 A;  4G50 A;  4AOF A;  2JPH A;  3WA0 A;  1J0G A;  3VHT C;  2GBK A;  2JZZ A;  1GJZ A;  4EEW A;  1WJ6 A;  1Y8R C;  2ASQ A;  4F7Z A;  5EDS A;  2ZZP B;  2LUE A;  2A4Z A;  1H8C A;  1E8W A;  2L3Z A;  4BKG A;  1S1Q B;  2J7Q B;  2LRU A;  3HHM A;  1V81 A;  2CHX A;  4DXA B;  1XT9 B;  4IM0 A;  4JL9 A;  5LLI A;  2BGF A;  4HPM B;  2PJH A;  5JH5 C;  4BFR A;  1V86 A;  4GOC A;  1WM2 A;  2MCN B;  4MGK E;  5DCN A;  3QAR A;  3CST A;  3APF A;  4ZRK A;  3L08 A;  2I1K A;  4AJW A;  3IFW B;  2KLC A;  2N9E B;  3V6E B;  2G4D B;  3PRE A;  2WYQ A;  1J19 A;  4DWF A;  4B6W A;  1WJU A;  4FJY A;  2K39 A;  3A9K A;  2CS4 A;  2DX5 B;  3MTN B;  3ZVV A;  2KHW B;  3PHX B;  4ANV A;  2N1V A;  3LJ3 A;  2KKC A;  4LCD E;  2KX3 A;  3KVF B;  4DDG D;  2JY6 A;  1H4R A;  2ZPN A;  3WAO A;  2RR9 A;  3ZIM A;  1Z5S B;  2DZK A;  1WGH A;  1WZ3 A;  3SDL C;  3V60 A;  1C3T A;  3K9P B;  4EZK A;  2EMT A;  2XBB C;  1TBE A;  3N3K B;  5C1Z A;  3AI5 A;  1OEY J;  2J0J A;  1TGZ B;  2MBQ A;  2RPQ A;  3B0A A;  2A5U A;  2KD0 A;  1LXD A;  3N30 A;  3RYT A;  3IG3 A;  2KWV B;  2NBV B;  2L05 A;  2C7H A;  1WX9 A;  2BPS A;  4W9K A;  5D94 A;  1VCB A;  4FHJ A;  4NNJ B;  4PYU A;  4EZJ A;  4IM3 A;  3PRP B;  4KDI C;  2KNB A;  5D2M B;  1IYF A;  2K8H A;  4ZDV A;  1RAX A;  3ONS A;  4MSQ B;  5TR5 A;  3W1S C;  1WH3 A;  2KDF B;  1R4N I;  2LD9 A;  2MWS B;  3KUZ A;  3VH4 B;  4MJS A;  1OEY A;  3TL5 A;  1JRU A;  4HPL B;  3A4R A;  2MP2 A;  4FN2 A;  2MW5 A;  2O6V A;  2K25 A;  4G0N B;  2CHZ A;  3PLV A;  4NY0 A;  3VH3 B;  4A3P A;  1E90 A;  4GDL A;  2KQS A;  4W9L A;  3QAQ A;  3UIP B;  3A9K B;  4DHJ D;  5LXH A;  3P2B A;  3VXW A;  2M1M A;  3ZLZ A;  2IZV B;  4AUQ C;  4N9F 4;  3ZNZ B;  2I1J A;  1WXS A;  2OOB B;  5DPS A;  1IP9 A;  3A1Q A;  1KM7 A;  1TTN A;  4W9C A;  4E74 A;  3RUL A;  4FAD A;  4NQK E;  2C9W B;  2BYF A;  4G3X B;  2DAF A;  4ICU A;  4RM9 A;  3PZD A;  2MSE D;  3CSF A;  2IO1 B;  2FIF A;  4BOS C;  2LGX A;  2LGY A;  2V3S A;  2KDB A;  4MM3 A;  4BKS A;  1K8R B;  2DYM A;  3DQV A;  1P0R A;  2G3Q B;  4KIK A;  4ANU A;  1WXM A;  1ZGU B;  1WRD B;  2HD5 B;  3QC8 B;  5J18 A;  5IA7 A;  1KLV A;  4B95 A;  2C7N B;  3DCG A;  3ZUN A;  3EEC A;  5IAA C;  4E3C A;  2GOW A;  3APC A;  3JYU A;  4W9D A;  1UBI A;  3VTW A;  2BF8 B;  1WE6 A;  3B08 A;  5DPT A;  2FNJ B;  4MJS B;  3DOW A;  2HTH A;  4DHZ B;  4FJV B;  1KJT A;  1TZ1 A;  5CX3 A;  5E6P A;  2ZVO A;  2MP2 B;  4NAW A;  3UIO B;  5JHA A;  4MEL A;  2O6V B;  2BWF A;  1D3Z A;  1I35 A;  1OTR B;  2KLG A;  3IVF A;  3U8Z A;  5JHB A;  3UQB A;  2LVP A;  4GDL B;  1WJ4 A;  2LVQ A;  4KVG B;  4WAA A;  3O65 B;  1UZX B;  2UWQ A;  3H9D A;  4J6I A;  3CF6 E;  4F1S A;  2PE6 B;  3HM6 X;  1V5O A;  2DYB A;  3VVW B;  4GSW A;  4OVV A;  4TUU A;  1EF5 A;  2GMI C;  2ZNV C;  3A1Q B;  1NBF C;  4M8N A;  3DDC B;  3AXC A;  3X23 A;  4XC2 A;  1A5R A;  3WIM A;  3RUI B;  3T8M A;  1V2Y A;  3QQ8 B;  3JSV A;  4TV3 A;  4A20 A;  3ZTD A;  3X0W A;  3L0W B;  3DBH I;  2KFK A;  4WJQ A;  3VUY A;  3ZKJ C;  3WAM A;  3KW5 B;  4IC7 B;  4PS7 A;  3TCA A;  3L54 A;  3A9J A;  4CHK A;  4KSL C;  2O6V D;  4ZRJ A;  3W1S A;  1MG8 A;  1WZ0 A;  4KIK B;  2W9N A;  1ZW7 A;  3ZRC A;  2KTR A;  2K1F A;  2YLM A;  2MBH A;  2KX0 A;  3KH0 A;  1UH6 A;  4KDL B;  4EOY A;  2J0M A;  2ZEQ A;  3VUX A;  2JVC A;  4M0W B;  3A4S C;  3DVN V;  4JIO U;  4MDK E;  1NDD A;  3VAW A;  2DHZ A;  4PS8 A;  4TQ0 A;  4IG7 B;  3NHE B;  2AL6 A;  2YVC A;  4GN1 A;  1GNU A;  1YQB A;  2N7E A;  1RFA A;  2C5L C;  4MGI E;  5D6J B;  4I6L B;  2EKE C;  4NAW B;  5E6N A;  2MX2 A;  4W9I A;  4HDO A;  3SU8 X;  2JUO A;  3A33 B;  2HE7 A;  1E7U A;  3PLU A;  3WAN A;  2WWZ A;  3TMP B;  1E8X A;  3NOB A;  4K1R B;  4PYZ A;  4DHJ B;  4BKS D;  2NS5 A;  2ZPY A;  1YX5 B;  3H1U A;  1XQQ A;  1LQB A;  5FR6 A;  1WR1 A;  2LXA A;  2M17 A;  3EC8 A;  4AJY B;  1V9J A;  2FID A;  3H7S A;  5DPR A;  5DPW A;  2C7M B;  4P7I A;  4GMV A;  3JSV B;  1PQS A;  2XK5 A;  3SHQ A;  4F8C B;  2L76 A;  1V49 A;  3VUW A;  2KFK B;  5L95 C;  1Z2M A;  2JRI B;  2DZI A;  4RMA A;  3R7Q A;  4W9J A;  2DAJ A;  3RZF A;  4W9F A;  1P9D U;  3A9J B;  3PVL A;  4K7W A;  5C23 A;  2PE9 A;  3R66 C;  3UQA A;  2FCQ A;  2KWC A;  3M62 B;  1WMH A;  2KTR B;  3OAW A;  4M8M A;  4HJK A;  1WGR A;  2N4F A;  2KAN A;  2LJ5 A;  3DVG Y;  4I6N B;  3ALB A;  3QA8 A;  2BKF A;  3V61 A;  1P1A A;  3PHW B;  2D07 B;  2KXJ A;  3ML9 A;  3RCZ A;  1FXT B;  3HM3 A;  1I42 A;  2KO3 A;  2D2Q A;  2R2Q A;  3OLM D;  3ZRF A;  1WGD A;  2NR2 A;  2LWP A;  4I6P A;  3DBR I;  4ASW C;  3MHS D;  1GG3 A;  1T0Y A;  2D11 A;  2KMC A;  3DBL I;  2XEW A;  2JXX A;  3DBS A;  3QJZ A;  1Q1O A;  2AEH A;  3DVG X;  2RGF A;  3RD2 A;  3IHP C;  1Q5W B;  4HLE A;  1QZE A;  3PTF C;  4HCN B;  1R4M I;  2UYZ B;  4FUL A;  5JZE B;  2N9X A;  1SGH A;  1M94 A;  2Z0E B;  5CHF A;  4E71 A;  3OJ4 B;  3PGE A;  2LZ6 A;  3NZS A;  4HDQ A;  4DK5 A;  2KJR A;  1UD7 A;  1OQY A;  2MBO A;  4NPN A;  1LFD A;  1L2N A;  1EF1 A;  2LXC A;  4CO7 A;  1WR6 E;  2K6Q A;  4RM8 A;  2O2V A;  4MSM B;  3HK0 A;  4DDI D;  3ZDT A;  2BYE A;  3ZW3 A;  1X1M A;  4WWN A;  4K7U A;  4ANX A;  1YIW A;  1E5W A;  1WI0 A;  4HCP B;  2XK5 B;  1BT0 A;  2RSU A;  2NPT A;  3NS8 A;  2WDT B;  1YJ1 A;  3PRM B;  4JQW C;  3TBL D;  4NJ7 A;  2MA9 B;  1WFY A;  3H7P A;  2LI5 A;  4B9K A;  2G45 B;  3UF8 A;  1UBQ A;  2L8J A;  2FCS A;  3DVN U;  4GXB A;  3VDZ A;  4URK A;  1SE9 A;  3T9L A;  1V5T A;  3WAL A;  1WMH B;  1WGY A;  1WXA A;  5AZH A;  5BO4 B;  2KOX A;  2JT4 B;  3PRZ A;  1EUV B;  5E6O A;  2GBJ A;  2D3G A;  2NCN A;  1WGG A;  2Z0D B;  4IWQ A;  4MEM A;  4ZYN A;  4AP4 C;  4LJP B;  1Q0W B;  4HWI B;  3AU4 A;  2KFJ A;  4MGY E;  2IO2 B;  1WX8 A;  3WAP A;  3ML8 A;  3SD5 A;  2KVR A;  3B1L X;  2ZCB A;  4WWP A;  4FA6 A;  2V1Y A;  4WJN A;  2JRH A;  2PEA A;  4FJZ A;  2ZCC A;  4LJO B;  4ICV A;  2KK8 A;  3R3M A;  1WXV A;  2ZJD A;  4ZRI A;  2AYO B;  2FCN A;  1V6E A;  2ZNV B;  4TQ1 A;  3EHV A;  2QHO A;  3VQI A;  1U4A A;  1HE8 A;  2K8C A;  2VRR B;  2R2O A;  3BY4 B;  4NJ6 A;  4BVU C;  2DZM A;  2MBB B;  3JVZ X;  2O2V B;  3TIX A;  4GDK A;  4HVB A;  5J17 A;  2IO3 B;  3EFU A;  2DYO A;  3GZN I;  3NZU A;  2KZR A;  2LVO A;  1ISN A;  2KTF A;  3PT2 B;  2AWT A;  4MGZ E;  4WWO A;  1YD8 U;  3Q3J A;  2DZJ A;  3QIJ A;  5AEK B;  4FHK A;  4YL8 A;  3KYD D;  2NPT B;  4BBN C;  3KUC B;  2CKH B;  4XZ4 A;  2ZVN A;  3H7P B;  4W9E A;  2OJR A;  3M63 B;  3IBE A;  2KC2 A;  5G2N A;  2KDE B;  2IYD B;  2K6D B;  1E7V A;  1P98 A;  3L10 B;  3PV1 A;  4EFO A;  1L7Y A;  2MBE A;  3ZO5 B;  3U30 A;  2Z59 B;  4W9H A;  1IPG A;  1RLF A;  3Q3F A;  2KWU B;  4KZC A;  1SIF A;  2CHW A;  3ENE A;  3KUD B;  3L13 A;  4K81 A;  5J2R A;  2KC1 A;  2KN5 A;  2DEN B;  5CHV C;  2NBU A;  4HK2 A;  2B3A A;  2N9P C;  3I3T B;  2GBR A;  1E8Y A; 
#chains in the Genus database with same CATH topology
 2L00 B;  5HHD G;  3KYC D;  1QKZ A;  4W9G A;  1T6B X;  4IWO A;  2AL3 A;  3VRB B;  5LXI B;  3ZDM C;  3RMK C;  4AS1 A;  1BML C;  2CU3 A;  2LAS A;  2KDI A;  2L0T A;  3NY5 A;  3AEF B;  4FLH A;  3ZTC A;  3BIN A;  5CHW A;  5KHO A;  4OW0 A;  2V4I B;  1LGR A;  2KQ7 A;  2L83 A;  1SBB B;  1CMX B;  2CU1 A;  1J8C A;  1P3Q U;  1GB4 A;  3ZJV A;  2SEB D;  2KJH B;  1AAR A;  1JWB D;  2L7R A;  2LGD A;  2DWQ A;  4WJP A;  2IO0 B;  1L0V B;  3HVD A;  1GAQ B;  2HJ1 A;  1RRB A;  1WE7 A;  5AZF A;  2REX A;  2HJ8 A;  2ICI A;  3MP9 A;  3QK0 A;  4JGH B;  1NI2 A;  1V80 A;  1E10 A;  1JW9 D;  3FIL A;  5AUI A;  2JZP A;  1N63 A;  3C0R B;  2MRP A;  2WXQ A;  2QC8 A;  1N60 A;  3APD A;  3DPD A;  3PSE B;  4GU2 A;  5LNK 1;  1ZDV A;  2Y3A A;  3RZW C;  3TSS A;  2GLS A;  4EKU A;  1XD3 B;  1XEE A;  2GBM A;  2D10 A;  4FXC A;  1FMA D;  1LM8 B;  3M3J A;  3U4E G;  3AV8 A;  2IY1 B;  3O13 A;  3V6C B;  1QOG A;  2KN4 A;  2WDV B;  2M0X A;  1T5X D;  4LNK A;  3DWM A;  3V62 A;  4NAM A;  2JZZ A;  3ZXV A;  1GJZ A;  2IJ0 A;  2ZZP B;  4WH4 A;  4BKG A;  2J7Q B;  1V81 A;  1XT9 B;  4HPM B;  2PJH A;  1PGA A;  4BZA A;  3TUO A;  3T3O A;  3QAR A;  3CST A;  3APF A;  3V3X A;  4AJW A;  3V6E B;  1J19 A;  5BYR A;  4FJY A;  2K39 A;  1HTQ A;  2CS4 A;  1Y56 A;  3ZVV A;  3PHX B;  2EKI A;  5IKC M;  3AE5 B;  5GXG B;  1HTO A;  1H4R A;  3WAO A;  1TYG B;  1WGH A;  3ZJU A;  1VZ6 A;  3V60 A;  1TBE A;  5C1Z A;  1OFF A;  3AI5 A;  4EE2 A;  1TGZ B;  2A5U A;  2KD0 A;  3TEX A;  1LXD A;  1WWT A;  2GRI A;  3IAM 1;  3P4R B;  2NBV B;  2BPS A;  4FHJ A;  3PRP B;  1SJH D;  4KDI C;  1VR9 A;  2K8H A;  1RAX A;  1YN3 A;  3NJT A;  2WDR B;  5TSS A;  2WU5 B;  2VZK B;  3KUZ A;  2MWS B;  3VH4 B;  4YSX B;  2IGG A;  4MJS A;  1FCL A;  3TL5 A;  2ZW0 A;  4REZ A;  3U52 E;  1I4P A;  4MAC A;  2MP2 A;  2MW5 A;  2O6V A;  2KWD A;  3ZGZ A;  4G0N B;  1C9F A;  3VH3 B;  1FXI A;  4W9L A;  4GDL A;  2AQ3 B;  5LXH A;  3P2B A;  4AUQ C;  1J7C A;  2I1J A;  1MPE A;  4W9C A;  3RUL A;  2C9W B;  4ICU A;  2DAF A;  2K22 A;  3RFZ B;  3LXF A;  3Q8E A;  1RM6 C;  2X8X X;  1FNW A;  1J7A A;  1YJI A;  4KIK A;  4ANU A;  4HRS A;  3TEZ A;  3QC8 B;  5J18 A;  1C79 A;  3DCG A;  1PDX A;  1UBI A;  2KDM A;  2MJD A;  1TS3 A;  1TJE A;  3UIO B;  2BWF A;  1D3Z A;  3U7Z A;  1OTR B;  2LUM A;  4WAA A;  2UWQ A;  3CF6 E;  1EF5 A;  2GMI C;  3A1Q B;  1NBF C;  3DDC B;  4M02 A;  3AMZ A;  1V2Y A;  4TV3 A;  4A20 A;  5HI1 A;  2KFK A;  2RMM A;  3KW5 B;  1SB3 C;  3L54 A;  3A9J A;  4CHK A;  4ZRJ A;  3W1S A;  1SE4 A;  2KTR A;  1T0Q C;  1XO3 A;  1QQR A;  4MDK E;  4ZHO A;  4GN1 A;  3FKY A;  4HDO A;  3AEB B;  3AE3 B;  4O1N A;  3WAN A;  3SFE B;  2WWZ A;  5E6J A;  3TMP B;  2XN9 C;  4K1R B;  2Z8L A;  5AUK A;  2NS5 A;  3Q8B A;  1M4V A;  2LGI A;  1JQ4 A;  5DPR A;  5DPW A;  2NMQ A;  2BVC A;  4HKZ E;  3VUW A;  1V1P B;  3RZF A;  4C4V A;  1F77 A;  2DAJ A;  2JSV X;  3VRA B;  4YTM B;  1L4Z B;  4K7W A;  2UU7 A;  3UQA A;  4M8M A;  1WMH A;  4ZRQ A;  3ZQ4 A;  1WGR A;  1D5X C;  2D07 B;  1TZO A;  3HM3 A;  4K3C A;  1I42 A;  4Q2J A;  3ZRF A;  3DBR I;  1YJJ A;  1GG3 A;  1T0Y A;  3DBL I;  2ONQ A;  3QJZ A;  2RGF A;  1ZOY B;  1FNV A;  3P4Q B;  1R4M I;  4E71 A;  2AX5 A;  3PGE A;  4NPN A;  2K9X A;  1L2N A;  1EF1 A;  2LXC A;  1WR6 E;  4RM8 A;  4MSM B;  4RFB A;  2BYE A;  1X1M A;  1E5W A;  1R7S A;  4MT5 A;  2QMT A;  4HCP B;  5H92 C;  1BT0 A;  2J53 A;  2WDT B;  4NJ7 A;  4B9K A;  3UF8 A;  2L8J A;  3DVN U;  2FCS A;  2INN E;  3WAL A;  1I4X A;  5AZH A;  1WXA A;  5BMI A;  1EU4 A;  3T3N A;  3NVW A;  4N6E B;  2JT4 B;  5E6O A;  1JRO A;  4A8X C;  3SFD B;  4HWI B;  2KVZ A;  2H88 B;  1KFY B;  1TKE A;  3ZJT A;  2PEA A;  4FJZ A;  2WHI A;  2KK8 A;  4OVZ A;  3VR9 B;  1BXT A;  2DZM A;  4HVB A;  3EFU A;  2DYO A;  2KZR A;  2LVO A;  1OQR A;  3P4S B;  2KTF A;  4L23 A;  5AEK B;  1ZE3 D;  4YL8 A;  3KUC B;  1L6V A;  2CKH B;  2ZVN A;  4WAF A;  3MFG A;  1N62 A;  5G2N A;  3RNG C;  3AE6 B;  1E7V A;  3B2F A;  2MBE A;  3ZO5 B;  4W9H A;  1IPG A;  1RLF A;  2CHW A;  2KN5 A;  3EA6 A;  4LNO A;  2B3A A;  1YOV B;  2BQQ A;  2XNA C;  3R7R A;  4P1B C;  2FCM A;  3MC0 B;  1E6E B;  1UGM A;  2RD0 A;  4A9A A;  5G5G A;  4M00 A;  2D3A A;  1GPX A;  2M19 A;  1WJN A;  3PPA A;  2WXP A;  3RNF C;  3MC8 A;  2Q5W D;  1T3Q A;  3DHI C;  5KHQ A;  3Q2A C;  3ETR A;  5MPO A;  3W1Y A;  4OZC A;  4FBJ B;  4II2 B;  4P1C C;  4XE0 A;  1TKY A;  2N9L A;  2M8S A;  3FAH A;  3DHH C;  5C3J B;  5L83 A;  2BTE A;  3QCA A;  1UGJ A;  1D6E C;  3U7D A;  5D7G A;  3Q14 C;  4XX5 A;  4ANW A;  2CJN A;  2FBW B;  2TSS A;  2QIE B;  1E8Z A;  2JWZ A;  4BKT A;  2MQJ A;  2WDQ B;  3L17 A;  4LDT B;  2NVU I;  3ZNG C;  5G55 A;  1WIA A;  1L5P A;  2J0K A;  2N7D A;  2BKR B;  3Q3N C;  3VTU A;  2MHJ A;  2WP9 B;  1QOF A;  2WX1 A;  4EZL A;  4DHZ E;  2CR5 A;  2LFI A;  2FAZ A;  2G1E A;  1KLU D;  2K8B A;  1UWX A;  2FUG 1;  1ET9 A;  3PS6 A;  4ARI A;  3S2A A;  1C1Y B;  1SIJ A;  4AWJ A;  3J9C A;  4ITK A;  3PZ8 A;  2BBC A;  3EGR A;  4BBN F;  2NTS A;  4JWU C;  3RT3 B;  2JZ3 B;  2N1W A;  3H6N A;  1OGW A;  1YQ4 B;  4IWP A;  1XLQ A;  1MG4 A;  1F9J A;  3NVY A;  3H8H A;  2MLB A;  2KMA A;  4X57 B;  2JPH A;  2GBK A;  4EEW A;  1Y8R C;  5EDS A;  3BK1 A;  2LUE A;  2A4Z A;  1H8C A;  2J4X A;  2L3Z A;  1HQR D;  3BYY B;  3HHM A;  2CHX A;  4IM0 A;  4JL9 A;  1N61 A;  2BGF A;  4XDC A;  3U2S C;  1SXT A;  3R8B A;  1JWS D;  4BFR A;  2MCN B;  2D5G A;  4MGK E;  1TIF A;  1ZUD 2;  2N9E B;  3PRE A;  2WYQ A;  4DWF A;  1WJU A;  2DX5 B;  3MTN B;  2KHW B;  1ENF A;  2KKC A;  4LCD E;  1VLB A;  4DDG D;  2JY6 A;  2QSD A;  1P7E A;  3ZIM A;  2DZK A;  1NEN B;  2EMT A;  4AQ7 A;  3NZ3 A;  2RPQ A;  3IG3 A;  2KWV B;  1WX9 A;  3N9Y C;  2LMC A;  3IT6 B;  5D94 A;  1VCB A;  4EZJ A;  1AW7 A;  1SE2 A;  5D2M B;  3DBH B;  3ONS A;  3W1S C;  2JXT A;  1WH3 A;  2KDF B;  3TEY A;  3Q6B A;  3AEE B;  3P1M A;  3A4R A;  1QLB B;  3KWV A;  2CHZ A;  3HRD D;  3PLV A;  2KQS A;  3A9K B;  4S0R A;  2V3P A;  3ZLZ A;  1PGB A;  3A1Q A;  1FRR A;  2IDY A;  4FAD A;  4NQK E;  4G3X B;  4RM9 A;  1C78 A;  1D4B A;  2FIF A;  2FE8 A;  4ZOH C;  2LGX A;  2LGY A;  1C4C A;  2W3R A;  1WSP A;  1HA5 A;  4BKS A;  1NEK B;  2M56 B;  2G3Q B;  3NRZ A;  4HRO A;  2BS2 B;  3AN1 A;  2HD5 B;  1R4N B;  1FRD A;  3DHG C;  3BVZ A;  3APC A;  1V1O A;  3JYU A;  3N20 C;  4OZB A;  1WE6 A;  2HTH A;  3Q8F A;  1KJT A;  5CX3 A;  4YXD B;  4C80 A;  4USA A;  3IVF A;  3AEA B;  5JHB A;  3UQB A;  4KVG B;  3MHZ A;  4F1S A;  2PE6 B;  1LO5 D;  3VVW B;  3I5J C;  4OVV A;  4M8N A;  3AXC A;  4YT0 B;  4RNA A;  1A5R A;  4WIP A;  3WIM A;  3T8M A;  4KGS A;  3QQ8 B;  1ACC A;  1YQ3 B;  3X0W A;  1V1P A;  1FFU A;  3VUY A;  3WAM A;  1FCC C;  4MM3 B;  2O6V D;  3KQ4 A;  1WZ0 A;  2W9N A;  1MVK A;  1J7B A;  3BYT B;  3VUX A;  4M0W B;  1NDD A;  4TQ0 A;  2YVC A;  5D6J B;  4NAW B;  4QAY A;  2M0A A;  1TY0 A;  1JWU D;  2JUO A;  3A33 B;  3NS1 A;  4DHJ B;  1N6Z A;  2ZPY A;  2WXL A;  4L1B A;  1JWA D;  1YN4 A;  3EC8 A;  3H7S A;  4F8C B;  4A90 A;  3NG0 A;  1QOB A;  3R7Q A;  4RMA A;  4W9J A;  4W9F A;  1C77 A;  4MH8 A;  3BVG A;  2WXO A;  3P63 A;  3OAW A;  2W82 A;  3C8Y A;  2KAN A;  1I7H A;  1P1A A;  4RGM A;  2KXJ A;  4US8 A;  2BS4 B;  3I9V 1;  1WGD A;  4NJC A;  2LWP A;  4RCO A;  1E7P B;  2XEW A;  2OHF A;  3RD2 A;  3IHP C;  1Q5W B;  4HLE A;  1QZE A;  2WXJ A;  4HCN B;  1FNU A;  4ZYS A;  2UYZ B;  4FUL A;  5JZE B;  2Z0E B;  1M94 A;  4HDQ A;  3NZS A;  1UD7 A;  1OQY A;  2MBO A;  2PVG C;  1LFD A;  1IGC A;  1HEZ E;  3HK0 A;  4DDI D;  4RF0 A;  1K50 A;  2XK5 B;  1MI0 A;  3AE8 B;  4BAX A;  3TBL D;  2DNF A;  1WFY A;  2LI5 A;  1L0X B;  2MEK A;  3P4P B;  1I4R A;  1UBQ A;  4URK A;  3VDZ A;  2RDB C;  1V5T A;  1T0S C;  2RDG A;  1EUV B;  1P7F A;  2GBJ A;  2W55 A;  2NCN A;  1WGG A;  4AP4 C;  4MEM A;  2R61 A;  3AU4 A;  3FC4 A;  2IO2 B;  3SD5 A;  2N9K A;  2RPV A;  3RN9 C;  2KVR A;  4WJN A;  4LJO B;  1IGD A;  4ICV A;  3R3M A;  2JYE A;  2ZJD A;  4ZRI A;  2LHE A;  4JE3 B;  2AYO B;  1BUI C;  2ZNV B;  4TQ1 A;  1UWM A;  1SF0 A;  2VRR B;  2K8C A;  3BY4 B;  2R2O A;  4BVU C;  3NVV A;  1ZDX A;  2LGS A;  3HUI A;  3RNA C;  2AQ1 B;  3TIX A;  2JQR B;  2JX5 A;  4NZL B;  1F0Z A;  5EE1 A;  3ZXR A;  4MGZ E;  3KYD D;  1N5W A;  2MH7 A;  5HG2 A;  3R2T A;  5IP4 D;  3N1Z C;  2NTT A;  2OJR A;  3IBE A;  3B9J A;  3L10 B;  1L7Y A;  4KGR A;  1ESF A;  1RYJ A;  1QIL A;  3I63 C;  1MJD A;  3Q3F A;  1SIF A;  3ENE A;  3KUD B;  2KC1 A;  3R2I A;  1EWY C;  3I3T B;  1NVI D;  2GBR A;  4CYE A;  4L2Y A;  2ACZ B;  1WF9 A;  1PUT A;  2CJO A;  2Y5C A;  2IGH A;  5CTR C;  4J3O D;  4OVU A;  1SE3 A;  3NVZ A;  4WJO A;  4A3O A;  5BYS A;  4KV2 A;  1IBX B;  3KLS X;  4HPP A;  4PS3 A;  5FR3 A;  3ZNH B;  4MH0 E;  5AZG A;  3CWI A;  1WX7 A;  1WYG A;  3NUH B;  3M95 A;  3BZD B;  4JLC A;  3K9O B;  4HXD A;  2Y5B B;  1VRA B;  2EMS A;  2G4S A;  2DLB A;  3CMM B;  4LNF A;  2V4L A;  2BWE S;  1YX6 B;  1WM3 A;  2RDH A;  4K7S A;  4IUM B;  3GS2 A;  3UGB B;  1GC6 A;  1DYQ A;  4PK1 A;  5HKH A;  3VR8 B;  1JML A;  1Q10 A;  5GMV A;  4XWT A;  1DOX A;  1V97 A;  2BB5 A;  4GIV A;  1S3S G;  4G11 A;  1QOA A;  2JYT A;  4NQL B;  1K52 A;  2NBW B;  1FPY A;  2FUH B;  4BOZ B;  3N1X C;  1GUA B;  3LDZ E;  1OQQ A;  2PPH A;  3AE1 B;  3UIN B;  1FXA A;  2AQ2 B;  3N32 A;  4IW0 A;  2IBI B;  2WX0 A;  2WXF A;  4KZ0 A;  2K0P A;  1EM7 A;  4RGO S;  1J0G A;  3VHT C;  4RF1 A;  2ASQ A;  3B2G A;  1VZ8 A;  1E8W A;  1S1Q B;  2LRU A;  5EE0 A;  2WGS A;  1JCK B;  5LLI A;  1B1Z A;  3PZ7 A;  5DCN A;  2G9H D;  3IFW B;  2KLC A;  4IDI A;  3A9K A;  1C76 A;  2J52 A;  2N1V A;  1JWM D;  4LNI A;  2KX3 A;  2ZPN A;  5I4D A;  2YEP F;  1C3T A;  3AM9 A;  4C00 A;  4GLS C;  3B0A A;  2KYW A;  3BII D;  3RYT A;  2WQY B;  4W9K A;  2WNM A;  2ON8 A;  4IM3 A;  3OG5 A;  1VJK A;  2KNB A;  1C4P A;  4MSQ B;  2WLB A;  1R4N I;  3E9S A;  2LD9 A;  1JAL A;  1JRU A;  4HPL B;  1E0Z A;  1D5M C;  3C19 A;  4HKQ A;  2K25 A;  5EE9 A;  2BT6 A;  4NY0 A;  4WQM A;  4A3P A;  1E90 A;  1YNT E;  3UIP B;  4C56 C;  1IUE A;  4DHJ D;  4YSZ B;  2M1M A;  2W3S A;  1ROE A;  4N9F 4;  3ZNZ B;  1WXS A;  5DPS A;  1IP9 A;  4KX6 B;  4JX1 C;  5JXV A;  2WXG A;  1TTN A;  3E56 A;  1PFD A;  2V9H A;  2LJI A;  2BYF A;  2VZK D;  1SSN A;  2IO1 B;  2K3U A;  2V3S A;  2KDB A;  4MM3 A;  1K8R B;  2DYM A;  4YWG G;  1P0R A;  2PMV A;  1ZGU B;  1WRD B;  3LB8 C;  5IOI A;  1KLV A;  5IN7 A;  1CJE A;  5IAA C;  1HZ5 A;  4M0W A;  2BF8 B;  2MJE A;  3B08 A;  3KWL A;  5HFY A;  5DPT A;  2FNJ B;  3DOW A;  4DHZ B;  2B76 B;  4FJV B;  2HTM E;  2ZVO A;  1WGK A;  4NAW A;  2JWU A;  2EEL A;  4MEL A;  5G5H A;  2WXH A;  4LNN A;  2WXN A;  1KLG D;  1UZX B;  3IAS 1;  3DBR B;  3HM6 X;  1V5O A;  2DYB A;  2PLP A;  3DBL B;  4GSW A;  1I4H A;  3X23 A;  5BMG A;  1F52 A;  1STE A;  3RUI B;  1R4M B;  2QCZ A;  1UUP A;  4C7Z A;  3BVM A;  3L0W B;  4WJQ A;  1C4A A;  3URY A;  4IC7 B;  4PS7 A;  4N59 A;  2PTL A;  4KSL C;  1MG8 A;  1VDV A;  1UNS A;  1ZW7 A;  3ZRC A;  2K1F A;  2YLM A;  2PVO D;  2MBH A;  2KX0 A;  3KH0 A;  1UH6 A;  4KDL B;  2J0M A;  1K51 A;  2JVC A;  3A4S C;  3DVN V;  2DHZ A;  5IO9 A;  4PS8 A;  4IG7 B;  1RWS A;  1D5Z C;  1GNU A;  2N7E A;  4M01 A;  2E3T A;  2C5L C;  1XLN A;  2EKE C;  4WUR A;  2MX2 A;  1E9M A;  3UI3 A;  2HE7 A;  3AEC B;  1E8X A;  1GOZ A;  3NOB A;  1N5X A;  4PYZ A;  4BKS D;  3IXS A;  2L32 A;  1YX5 B;  2SAK A;  3H1U A;  5FR6 A;  1WR1 A;  2LXA A;  4RH6 A;  4AJY B;  4KKJ A;  1V9J A;  2FID A;  1YMH E;  2C7M B;  4P7I A;  4GMV A;  2DBY A;  3JSV B;  1CK1 A;  2XK5 A;  3SHQ A;  1FIQ A;  2L76 A;  1V49 A;  2INP E;  3I57 A;  4KGT A;  2JRI B;  2DZI A;  2QEJ C;  3PVL A;  1SJE D;  3M62 B;  2N4F A;  3ALB A;  3QA8 A;  2I38 A;  3RCZ A;  1FXT B;  1EU3 A;  2KO3 A;  2K5P A;  2R2Q A;  2X38 A;  2NR2 A;  1MHX A;  4I6P A;  4ASW C;  2D11 A;  2AEH A;  3DVG X;  3PTF C;  1F2R C;  2VH2 A;  2N9X A;  1SGH A;  3OJ4 B;  4DK5 A;  1KTK A;  2PIA A;  1QF6 A;  1YIW A;  4S17 A;  5BYQ A;  1V8C A;  1WI0 A;  3L4P A;  1EWC A;  3NS8 A;  4A55 A;  4JQW C;  1L0Y B;  3N1Y C;  4GXB A;  1I4G A;  3T9L A;  2WXR A;  1K53 A;  4IOI E;  1ZXI A;  4YTN B;  2MJ3 A;  2Z0D B;  4ZYN A;  2OED A;  1UF0 A;  2KAC A;  3ML8 A;  3RNE C;  2ZCB A;  4WWP A;  3W5V B;  2V1Y A;  1HXY D;  3CIR B;  5BMH A;  2HDE A;  2W54 A;  1WXV A;  2BB6 A;  1AYF A;  4XWW A;  2FCN A;  3EHV A;  2QHO A;  1HE8 A;  4NJ6 A;  2QDF A;  2MBB B;  3JVZ X;  2O2V B;  1IBX A;  2IO3 B;  3NZU A;  3V05 A;  4PT5 A;  1GB1 A;  1B9R A;  2AWT A;  3Q3J A;  3QIJ A;  2DZJ A;  3P42 A;  4FHK A;  2NPT B;  4XZ4 A;  3H7P B;  4W9E A;  3M63 B;  2LHD A;  1WRI A;  2WU2 B;  2WXM A;  2INC C;  1P98 A;  3PV1 A;  3Q69 A;  4EFO A;  1ET6 A;  4US9 A;  5J2R A;  3L13 A;  4K81 A;  2DEN B;  5CHV C;  2NBU A;  4HK2 A;  4N58 A;  2N9P C;  1E8Y A;  3VTV A;  1GC7 A;  2PKO A;  4RGN A;  3W5U B;  2JF5 A;  3D32 A;  2C60 A;  4II3 B;  3TJP A;  3VFK A;  3JW0 X;  3GP7 A;  1XLO A;  3QWZ B;  4IM2 A;  2KJ6 A;  3GZN B;  1DOI A;  4GDK B;  2VH1 A;  2L1A A;  1KOT A;  2LEK A;  3MJW A;  3RNB C;  3MJ5 A;  3QX1 A;  1EO6 A;  4DXF A;  1VZ7 A;  3GE8 C;  3OJ3 A;  4K3B A;  3QHT A;  1XCQ L;  1WYW B;  2IPK D;  1A70 A;  3AE9 B;  3AB5 A;  3L16 A;  4P16 A;  4GGQ A;  4KSK C;  5H8Y E;  2M4N A;  1RFK A;  2V0G A;  1FO4 A;  4DBG A;  1ZXH A;  2LRW A;  2L0F A;  4XGA B;  1WY8 A;  3HIZ A;  3AUL A;  3GOE A;  2QIL A;  1UEL A;  4WQO B;  5EE3 A;  4RGT A;  3AU5 A;  2IY0 B;  4LDT D;  2BYV E;  4GB9 A;  1G6J A;  1JRP A;  1ZP0 B;  4R3D A;  1NI3 A;  2GBN A;  4TKN A;  1VD2 A;  3ZNI D;  1ZKH A;  4B0E A;  4B0M A;  3ECI A;  4EUT A;  2BYT A;  4G50 A;  4H2A A;  2N7J A;  4AOF A;  3WA0 A;  1SEB D;  3W2D A;  1WJ6 A;  1WXQ A;  4F7Z A;  3TEW A;  4DXA B;  5JH5 C;  2WXK A;  1V86 A;  3Q3M C;  4GOC A;  1PYW D;  1WM2 A;  3FIL B;  1I4Q A;  4P6V F;  4ZRK A;  3L08 A;  2I1K A;  2G4D B;  4B6W A;  3PO0 A;  2KQ4 X;  4ANV A;  3LJ3 A;  3KVF B;  3AE7 B;  2RR9 A;  1Z5S B;  4LLG M;  1WZ3 A;  3SDL C;  3K9P B;  2KMM A;  2XBB C;  4ACF A;  4EZK A;  3N3K B;  1T0R C;  1OEY J;  2J0J A;  2MBQ A;  1F2R I;  1FM0 D;  3N30 A;  2D3B A;  2L05 A;  2C7H A;  4NNJ B;  4PYU A;  3AEG B;  1IYF A;  4ZDV A;  5TR5 A;  1CZP A;  3IT4 B;  1OEY A;  2QJL A;  4FN2 A;  2WXI A;  4XDD A;  3HVZ A;  3QAQ A;  2D3C A;  4XYC A;  3VXW A;  2IZV B;  2YEP B;  2OOB B;  4ZRP A;  1YN5 A;  1KM7 A;  4KKI A;  4UDU C;  4E74 A;  3BK2 A;  3PZD A;  2MSE D;  3CSF A;  3EUB 2;  2Y5P A;  3ZYY X;  4BOS C;  3DQV A;  1WXM A;  1TS5 A;  5IA7 A;  4B95 A;  2C7N B;  1QT9 A;  3ZUN A;  3EEC A;  3SR6 A;  1ZPS A;  4HEA 1;  1TS2 A;  4E3C A;  2GOW A;  4JPS A;  4W9D A;  3VTW A;  3AE2 B;  3RPF C;  1NYR A;  4ARC A;  4MJS B;  2N0S B;  5E6P A;  1TZ1 A;  2MP2 B;  5JHA A;  2O6V B;  1I35 A;  2KLG A;  3U8Z A;  1FFV A;  2LVP A;  4GDL B;  1WJ4 A;  2LVQ A;  3O65 B;  2H89 B;  4J6I A;  3H9D A;  4A6Q A;  4TUU A;  4HJG E;  2ZNV C;  2WS3 B;  4YTP B;  4XC2 A;  1XCT L;  1HZ6 A;  3JSV A;  3ZTD A;  3DBH I;  3WCQ A;  3ZKJ C;  2IND C;  3TCA A;  4TSS A;  3GB1 A;  4KIK B;  2J42 A;  1DGJ A;  2E6X A;  2I2Y A;  4EOY A;  2ZEQ A;  4IKG A;  4CQN A;  4JIO U;  3VAW A;  2L52 A;  3ABV B;  4WWM A;  3NHE B;  2AL6 A;  3EFC A;  3GE3 C;  1YQB A;  3OWE B;  4LK0 M;  1RFA A;  4MGI E;  4I6L B;  5E6N A;  4W9I A;  3SU8 X;  3RNC C;  1E7U A;  3PLU A;  1XLP A;  5C2T B;  2KT7 A;  1XQQ A;  1LQB A;  2M17 A;  1CQV A;  1AWD A;  1PQS A;  2BW2 A;  2KFK B;  5L95 C;  1Z2M A;  4JWS C;  1P9D U;  3A9J B;  5C23 A;  2PE9 A;  3R66 C;  2FCQ A;  1L6U A;  2KWC A;  2KTR B;  4HJK A;  5D3D A;  2LJ5 A;  3DVG Y;  4I6N B;  3V61 A;  2BKF A;  3PHW B;  3ML9 A;  3RI7 C;  2D2Q A;  1FEH A;  3OLM D;  5FKA C;  2OJW A;  3MHS D;  2KMC A;  2JXX A;  3DWG C;  3DBS A;  3LYY A;  1Q1O A;  4YSY B;  1PGX A;  1FD6 A;  2PW9 A;  5CHF A;  4C7Y A;  2LZ6 A;  2KJR A;  1MHH E;  4CO7 A;  2K6Q A;  2O2V A;  3ZDT A;  3ZW3 A;  4WWN A;  4K7U A;  4ANX A;  1AN8 A;  1NYQ A;  4OZA A;  2V3N A;  1MFW A;  2RSU A;  2NPT A;  1YJ1 A;  1TS4 A;  3PRM B;  1L4D B;  2MA9 B;  3H7P A;  3AED B;  4C4V B;  2G45 B;  5T8I A;  1SE9 A;  2GB1 A;  1TT5 B;  1WMH B;  1WGY A;  5BO4 B;  2KOX A;  3Q8C A;  4ZHP A;  3PRZ A;  2D3G A;  2KAJ A;  3Q3O C;  4IWQ A;  3AE4 B;  4LJP B;  1Q0W B;  2KFJ A;  4MGY E;  1WX8 A;  3WAP A;  1XF5 L;  2BS3 B;  2ZW1 A;  3B1L X;  2JU6 X;  4FA6 A;  1TY2 A;  2JRH A;  2ZCC A;  3W9C B;  1XXG A;  3MC9 A;  1V6E A;  3AH7 A;  3VQI A;  1U4A A;  1F1H A;  4LTU A;  4GDK A;  5J17 A;  3Q8A A;  3GZN I;  1DOY A;  1ISN A;  4D2K A;  3PT2 B;  4WWO A;  5FK9 C;  1YD8 U;  4BBN C;  2IGD A;  3BWU D;  2KC2 A;  2KDE B;  2IYD B;  2K6D B;  1KF6 B;  4TMA B;  4DQO C;  3U30 A;  5D3I B;  1TKG A;  2Z59 B;  4DXG A;  4KZC A;  2KWU B;  2GI9 A;  1KRH A;  4OHJ A;  1KH0 A;  3SEB A; 
#chains in the Genus database with same CATH homology
 2L00 B;  3VTV A;  1GC7 A;  1WF9 A;  3R7R A;  3KYC D;  2FCM A;  1UGM A;  2JF5 A;  2RD0 A;  2C60 A;  3D32 A;  4II3 B;  4W9G A;  5CTR C;  3TJP A;  3VFK A;  4OVU A;  3JW0 X;  4WJO A;  4A3O A;  4IWO A;  2AL3 A;  1WJN A;  3PPA A;  3QWZ B;  4IM2 A;  3ZDM C;  5LXI B;  2KJ6 A;  4KV2 A;  5KHQ A;  2LAS A;  3W1Y A;  4FBJ B;  2KDI A;  4GDK B;  4II2 B;  2L0T A;  3NY5 A;  4PS3 A;  4FLH A;  3ZTC A;  4CYE A;  3ZNH B;  4MH0 E;  3BIN A;  5CHW A;  5KHO A;  5AZG A;  2M8S A;  1KOT A;  3MJW A;  1WX7 A;  5L83 A;  2KQ7 A;  3QCA A;  3M95 A;  3QX1 A;  1EO6 A;  1CMX B;  2CU1 A;  3K9O B;  4JLC A;  3U7D A;  5D7G A;  4HXD A;  1J8C A;  1P3Q U;  4XX5 A;  2Y5B B;  3OJ3 A;  4ANW A;  2EMS A;  2G4S A;  2KJH B;  1AAR A;  2LGD A;  2L7R A;  3QHT A;  3CMM B;  1E8Z A;  1WYW B;  2JWZ A;  4WJP A;  4BKT A;  2MQJ A;  2IO0 B;  2V4L A;  2BWE S;  3L16 A;  3L17 A;  4LDT B;  2NVU I;  1YX6 B;  1WM3 A;  3ZNG C;  4K7S A;  4GGQ A;  4KSK C;  5G55 A;  1RRB A;  1WIA A;  2J0K A;  2N7D A;  2BKR B;  2M4N A;  1WE7 A;  5AZF A;  3VTU A;  2REX A;  4IUM B;  4DBG A;  3UGB B;  2WX1 A;  1GC6 A;  2LRW A;  4EZL A;  2HJ8 A;  2L0F A;  3QK0 A;  4JGH B;  4DHZ E;  1NI2 A;  1WY8 A;  2CR5 A;  5HKH A;  1V80 A;  3HIZ A;  3AUL A;  3GOE A;  5GMV A;  2FAZ A;  4GIV A;  2K8B A;  1S3S G;  4G11 A;  1UEL A;  4WQO B;  3C0R B;  4NQL B;  2MRP A;  3DPD A;  3APD A;  3PS6 A;  3PSE B;  4GU2 A;  2NBW B;  3S2A A;  3RZW C;  1C1Y B;  2FUH B;  4AWJ A;  3AU5 A;  4BOZ B;  4EKU A;  2IY0 B;  1XD3 B;  4LDT D;  1GUA B;  3LDZ E;  2PPH A;  2GBM A;  2BYV E;  2D10 A;  4BBN F;  3UIN B;  4GB9 A;  1G6J A;  1LM8 B;  3M3J A;  3N32 A;  4IW0 A;  3RT3 B;  2JZ3 B;  2N1W A;  3H6N A;  1OGW A;  2IY1 B;  2IBI B;  3V6C B;  2GBN A;  4TKN A;  2WX0 A;  4IWP A;  1F9J A;  1VD2 A;  3ZNI D;  1ZKH A;  2M0X A;  4KZ0 A;  2MLB A;  3ECI A;  2KMA A;  4X57 B;  4EUT A;  3V62 A;  4G50 A;  4AOF A;  2JPH A;  3WA0 A;  1J0G A;  3VHT C;  2GBK A;  2JZZ A;  1GJZ A;  4EEW A;  1WJ6 A;  1Y8R C;  2ASQ A;  4F7Z A;  5EDS A;  2ZZP B;  2LUE A;  2A4Z A;  1H8C A;  1E8W A;  2L3Z A;  4BKG A;  1S1Q B;  2J7Q B;  2LRU A;  3HHM A;  1V81 A;  2CHX A;  4DXA B;  1XT9 B;  4IM0 A;  4JL9 A;  5LLI A;  2BGF A;  4HPM B;  2PJH A;  5JH5 C;  4BFR A;  1V86 A;  4GOC A;  1WM2 A;  2MCN B;  4MGK E;  5DCN A;  3QAR A;  3CST A;  3APF A;  4ZRK A;  3L08 A;  2I1K A;  4AJW A;  3IFW B;  2KLC A;  2N9E B;  3V6E B;  2G4D B;  3PRE A;  2WYQ A;  1J19 A;  4DWF A;  4B6W A;  1WJU A;  4FJY A;  2K39 A;  3A9K A;  2CS4 A;  2DX5 B;  3MTN B;  3ZVV A;  2KHW B;  3PHX B;  4ANV A;  2N1V A;  3LJ3 A;  2KKC A;  4LCD E;  2KX3 A;  3KVF B;  4DDG D;  2JY6 A;  1H4R A;  2ZPN A;  3WAO A;  2RR9 A;  3ZIM A;  1Z5S B;  2DZK A;  1WGH A;  1WZ3 A;  3SDL C;  3V60 A;  1C3T A;  3K9P B;  4EZK A;  2EMT A;  2XBB C;  1TBE A;  3N3K B;  5C1Z A;  3AI5 A;  1OEY J;  2J0J A;  1TGZ B;  2MBQ A;  2RPQ A;  3B0A A;  2A5U A;  2KD0 A;  1LXD A;  3N30 A;  3RYT A;  3IG3 A;  2KWV B;  2NBV B;  2L05 A;  2C7H A;  1WX9 A;  2BPS A;  4W9K A;  5D94 A;  1VCB A;  4FHJ A;  4NNJ B;  4PYU A;  4EZJ A;  4IM3 A;  3PRP B;  4KDI C;  2KNB A;  5D2M B;  1IYF A;  2K8H A;  4ZDV A;  1RAX A;  3ONS A;  4MSQ B;  5TR5 A;  3W1S C;  1WH3 A;  2KDF B;  1R4N I;  2LD9 A;  2MWS B;  3KUZ A;  3VH4 B;  4MJS A;  1OEY A;  3TL5 A;  1JRU A;  4HPL B;  3A4R A;  2MP2 A;  4FN2 A;  2MW5 A;  2O6V A;  2K25 A;  4G0N B;  2CHZ A;  3PLV A;  4NY0 A;  3VH3 B;  4A3P A;  1E90 A;  4GDL A;  2KQS A;  4W9L A;  3QAQ A;  3UIP B;  3A9K B;  4DHJ D;  5LXH A;  3P2B A;  3VXW A;  2M1M A;  3ZLZ A;  2IZV B;  4AUQ C;  4N9F 4;  3ZNZ B;  2I1J A;  1WXS A;  2OOB B;  5DPS A;  1IP9 A;  3A1Q A;  1KM7 A;  1TTN A;  4W9C A;  4E74 A;  3RUL A;  4FAD A;  4NQK E;  2C9W B;  2BYF A;  4G3X B;  2DAF A;  4ICU A;  4RM9 A;  3PZD A;  2MSE D;  3CSF A;  2IO1 B;  2FIF A;  4BOS C;  2LGX A;  2LGY A;  2V3S A;  2KDB A;  4MM3 A;  4BKS A;  1K8R B;  2DYM A;  3DQV A;  1P0R A;  2G3Q B;  4KIK A;  4ANU A;  1WXM A;  1ZGU B;  1WRD B;  2HD5 B;  3QC8 B;  5J18 A;  5IA7 A;  1KLV A;  4B95 A;  2C7N B;  3DCG A;  3ZUN A;  3EEC A;  5IAA C;  4E3C A;  2GOW A;  3APC A;  3JYU A;  4W9D A;  1UBI A;  3VTW A;  2BF8 B;  1WE6 A;  3B08 A;  5DPT A;  2FNJ B;  4MJS B;  3DOW A;  2HTH A;  4DHZ B;  4FJV B;  1KJT A;  1TZ1 A;  5CX3 A;  5E6P A;  2ZVO A;  2MP2 B;  4NAW A;  3UIO B;  5JHA A;  4MEL A;  2O6V B;  2BWF A;  1D3Z A;  1I35 A;  1OTR B;  2KLG A;  3IVF A;  3U8Z A;  5JHB A;  3UQB A;  2LVP A;  4GDL B;  1WJ4 A;  2LVQ A;  4KVG B;  4WAA A;  3O65 B;  1UZX B;  2UWQ A;  3H9D A;  4J6I A;  3CF6 E;  4F1S A;  2PE6 B;  3HM6 X;  1V5O A;  2DYB A;  3VVW B;  4GSW A;  4OVV A;  4TUU A;  1EF5 A;  2GMI C;  2ZNV C;  3A1Q B;  1NBF C;  4M8N A;  3DDC B;  3AXC A;  3X23 A;  4XC2 A;  1A5R A;  3WIM A;  3RUI B;  3T8M A;  1V2Y A;  3QQ8 B;  3JSV A;  4TV3 A;  4A20 A;  3ZTD A;  3X0W A;  3L0W B;  3DBH I;  2KFK A;  4WJQ A;  3VUY A;  3ZKJ C;  3WAM A;  3KW5 B;  4IC7 B;  4PS7 A;  3TCA A;  3L54 A;  3A9J A;  4CHK A;  4KSL C;  2O6V D;  4ZRJ A;  3W1S A;  1MG8 A;  1WZ0 A;  4KIK B;  2W9N A;  1ZW7 A;  3ZRC A;  2KTR A;  2K1F A;  2YLM A;  2MBH A;  2KX0 A;  3KH0 A;  1UH6 A;  4KDL B;  4EOY A;  2J0M A;  2ZEQ A;  3VUX A;  2JVC A;  4M0W B;  3A4S C;  3DVN V;  4JIO U;  4MDK E;  1NDD A;  3VAW A;  2DHZ A;  4PS8 A;  4TQ0 A;  4IG7 B;  3NHE B;  2AL6 A;  2YVC A;  4GN1 A;  1GNU A;  1YQB A;  2N7E A;  1RFA A;  2C5L C;  4MGI E;  5D6J B;  4I6L B;  2EKE C;  4NAW B;  5E6N A;  2MX2 A;  4W9I A;  4HDO A;  3SU8 X;  2JUO A;  3A33 B;  2HE7 A;  1E7U A;  3PLU A;  3WAN A;  2WWZ A;  3TMP B;  1E8X A;  3NOB A;  4K1R B;  4PYZ A;  4DHJ B;  4BKS D;  2NS5 A;  2ZPY A;  1YX5 B;  3H1U A;  1XQQ A;  1LQB A;  5FR6 A;  1WR1 A;  2LXA A;  2M17 A;  3EC8 A;  4AJY B;  1V9J A;  2FID A;  3H7S A;  5DPR A;  5DPW A;  2C7M B;  4P7I A;  4GMV A;  3JSV B;  1PQS A;  2XK5 A;  3SHQ A;  4F8C B;  2L76 A;  1V49 A;  3VUW A;  2KFK B;  5L95 C;  1Z2M A;  2JRI B;  2DZI A;  4RMA A;  3R7Q A;  4W9J A;  2DAJ A;  3RZF A;  4W9F A;  1P9D U;  3A9J B;  3PVL A;  4K7W A;  5C23 A;  2PE9 A;  3R66 C;  3UQA A;  2FCQ A;  2KWC A;  3M62 B;  1WMH A;  2KTR B;  3OAW A;  4M8M A;  4HJK A;  1WGR A;  2N4F A;  2KAN A;  2LJ5 A;  3DVG Y;  4I6N B;  3ALB A;  3QA8 A;  2BKF A;  3V61 A;  1P1A A;  3PHW B;  2D07 B;  2KXJ A;  3ML9 A;  3RCZ A;  1FXT B;  3HM3 A;  1I42 A;  2KO3 A;  2D2Q A;  2R2Q A;  3OLM D;  3ZRF A;  1WGD A;  2NR2 A;  2LWP A;  4I6P A;  3DBR I;  4ASW C;  3MHS D;  1GG3 A;  1T0Y A;  2D11 A;  2KMC A;  3DBL I;  2XEW A;  2JXX A;  3DBS A;  3QJZ A;  1Q1O A;  2AEH A;  3DVG X;  2RGF A;  3RD2 A;  3IHP C;  1Q5W B;  4HLE A;  1QZE A;  3PTF C;  4HCN B;  1R4M I;  2UYZ B;  4FUL A;  5JZE B;  2N9X A;  1SGH A;  1M94 A;  2Z0E B;  5CHF A;  4E71 A;  3OJ4 B;  3PGE A;  2LZ6 A;  3NZS A;  4HDQ A;  4DK5 A;  2KJR A;  1UD7 A;  1OQY A;  2MBO A;  4NPN A;  1LFD A;  1L2N A;  1EF1 A;  2LXC A;  4CO7 A;  1WR6 E;  2K6Q A;  4RM8 A;  2O2V A;  4MSM B;  3HK0 A;  4DDI D;  3ZDT A;  2BYE A;  3ZW3 A;  1X1M A;  4WWN A;  4K7U A;  4ANX A;  1YIW A;  1E5W A;  1WI0 A;  4HCP B;  2XK5 B;  1BT0 A;  2RSU A;  2NPT A;  3NS8 A;  2WDT B;  1YJ1 A;  3PRM B;  4JQW C;  3TBL D;  4NJ7 A;  2MA9 B;  1WFY A;  3H7P A;  2LI5 A;  4B9K A;  2G45 B;  3UF8 A;  1UBQ A;  2L8J A;  2FCS A;  3DVN U;  4GXB A;  3VDZ A;  4URK A;  1SE9 A;  3T9L A;  1V5T A;  3WAL A;  1WMH B;  1WGY A;  1WXA A;  5AZH A;  5BO4 B;  2KOX A;  2JT4 B;  3PRZ A;  1EUV B;  5E6O A;  2GBJ A;  2D3G A;  2NCN A;  1WGG A;  2Z0D B;  4IWQ A;  4MEM A;  4ZYN A;  4AP4 C;  4LJP B;  1Q0W B;  4HWI B;  3AU4 A;  2KFJ A;  4MGY E;  2IO2 B;  1WX8 A;  3WAP A;  3ML8 A;  3SD5 A;  2KVR A;  3B1L X;  2ZCB A;  4WWP A;  4FA6 A;  2V1Y A;  4WJN A;  2JRH A;  2PEA A;  4FJZ A;  2ZCC A;  4LJO B;  4ICV A;  2KK8 A;  3R3M A;  1WXV A;  2ZJD A;  4ZRI A;  2AYO B;  2FCN A;  1V6E A;  2ZNV B;  4TQ1 A;  3EHV A;  2QHO A;  3VQI A;  1U4A A;  1HE8 A;  2K8C A;  2VRR B;  2R2O A;  3BY4 B;  4NJ6 A;  4BVU C;  2DZM A;  2MBB B;  3JVZ X;  2O2V B;  3TIX A;  4GDK A;  4HVB A;  5J17 A;  2IO3 B;  3EFU A;  2DYO A;  3GZN I;  3NZU A;  2KZR A;  2LVO A;  1ISN A;  2KTF A;  3PT2 B;  2AWT A;  4MGZ E;  4WWO A;  1YD8 U;  3Q3J A;  2DZJ A;  3QIJ A;  5AEK B;  4FHK A;  4YL8 A;  3KYD D;  2NPT B;  4BBN C;  3KUC B;  2CKH B;  4XZ4 A;  2ZVN A;  3H7P B;  4W9E A;  2OJR A;  3M63 B;  3IBE A;  2KC2 A;  5G2N A;  2KDE B;  2IYD B;  2K6D B;  1E7V A;  1P98 A;  3L10 B;  3PV1 A;  4EFO A;  1L7Y A;  2MBE A;  3ZO5 B;  3U30 A;  2Z59 B;  4W9H A;  1IPG A;  1RLF A;  3Q3F A;  2KWU B;  4KZC A;  1SIF A;  2CHW A;  3ENE A;  3KUD B;  3L13 A;  4K81 A;  5J2R A;  2KC1 A;  2KN5 A;  2DEN B;  5CHV C;  2NBU A;  4HK2 A;  2B3A A;  2N9P C;  3I3T B;  2GBR A;  1E8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...