5DCNA

Crystal structure of lc3 in complex with tecpr2 lir
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
126
structure length
126
Chain Sequence
DEWEVIGGPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Microtubule-associated proteins 1A/1B light chain 3B
publication title TECPR2 Cooperates with LC3C to Regulate COPII-Dependent ER Export.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2015-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5dcnA00
4XZ4A 1LQBA 3U8ZA 2DHZA 4IWPA 3APFA 3QQ8B 2C7MB 4WWPA 1RAXA 1I35A 4K7UA 4KSKC 1PQSA 2MP2B 5KHOA 1EF1A 4ICUA 2KX0A 3RZWC 2L3ZA 2CKHB 2L05A 1IP9A 2D10A 2KFKA 3DVNU 3KYCD 3B1LX 1IYFA 5JHBA 4ZDVA 1WXVA 3A9KA 2HJ8A 3ZRFA 2V3SA 4GDLB 5C23A 4ANXA 3KUDB 1UBQA 2N9PC 4K81A 3RUIB 4W9GA 2LI5A 2ZCBA 4IC7B 4MH0E 2M8SA 3UGBB 3D32A 4BKGA 3KYDD 4NAWA 3R66C 5G2NA 2KMCA 2KFJA 4CO7A 1P3QU 2XBBC 2M17A 1V5OA 2KFKB 3A4RA 2DENB 3CMMB 2PE9A 4W9EA 4BFRA 4EZJA 3ALBA 2DAJA 3M63B 3A9KB 3JYUA 4B95A 4MSQB 4DHJD 2LVOA 2LGYA 1OGWA 3H9DA 3AU4A 4KZ0A 4GMVA 2MRPA 3QCAA 4HPLB 3U30A 1V49A 4DXAB 2JF5A 3QIJA 4FBJB 4KIKB 2G45B 1Q1OA 5IAAC 3TIXA 3AULA 1D3ZA 4NAWB 5DPRA 3DDCB 4DHJB 2OJRA 5D2MB 2WX0A 2BYVE 3OJ4B 1E7UA 4BKSD 2PJHA 3ZNZB 1YIWA 2ZPNA 1EF5A 1Q5WB 2K8CA 3MTNB 3ZNID 3HM6X 2K39A 2K8BA 2KC1A 1NI2A 4IWQA 3VTWA 1YQBA 2I1JA 5JHAA 3V6CB 2CS4A 4WWOA 3ENEA 1SE9A 3UIPB 2NBWB 1WY8A 2RSUA 3QC8B 4BVUC 2EMTA 4RM8A 3ZRCA 2GBMA 4FJZA 4M8MA 2I1KA 2AWTA 1A5RA 4KDLB 4HCNB 3QAQA 2N1VA 1GNUA 2C9WB 4J6IA 4AP4C 4A3OA 4IG7B 1E8ZA 2JRIB 4HK2A 4WJOA 2KTRB 1P0RA 1WGHA 3L10B 2KQSA 4W9FA 2IO3B 5CX3A 3IBEA 3L54A 2MBOA 4TQ1A 4MEMA 2LGXA 1KJTA 1WXSA 4EOYA 2IO0B 1KM7A 4WAAA 4HVBA 1ZW7A 1JRUA 4WWNA 4K1RB 1OEYA 3A9JA 5L95C 1WM2A 2MSED 2Z59B 4NJ7A 1WXMA 4P7IA 5HKHA 2PE6B 2DAFA 3PS6A 3SDLC 5D7GA 1GC6A 2NCNA 3AU5A 3MHSD 1RLFA 3VH3B 2JPHA 1UH6A 3V61A 1YD8U 4PYZA 3V6EB 2N9XA 4OVUA 3BY4B 4JIOU 1L7YA 1UGMA 3ZDTA 1S3SG 2MW5A 1WE7A 3LDZE 4TQ0A 3VH4B 3CSTA 2DZIA 4FULA 4GU2A 3WAPA 2GBJA 2J0MA 2CU1A 2D07B 2GBNA 4DWFA 2C7NB 4EZLA 3ZTDA 4CHKA 2MA9B 3BINA 2B3AA 3WALA 1SGHA 4GXBA 2KJHB 4FA6A 2KLGA 2RPQA 2O2VA 1ISNA 4W9LA 3WAOA 1R4MI 1OQYA 4IUMB 3H7PA 3QHTA 2REXA 3R7QA 5C1ZA 4PS7A 4M8NA 2LASA 3ZNGC 4EZKA 3H6NA 3QARA 2R2QA 1LM8B 4GB9A 1TGZB 2BKFA 3K9OB 3VAWA 4HPMB 1L2NA 1T0YA 3EC8A 2MCNB 1TTNA 3QX1A 2M4NA 1M94A 4FJVB 4KVGB 2BKRB 4FADA 2FCMA 4HLEA 4G0NB 2ZVNA 3VFKA 1WRDB 3KH0A 3TCAA 1XT9B 3B08A 3ZLZA 1WXAA 2BPSA 3ZVVA 2WX1A 2N7DA 4YL8A 2MLBA 2UYZB 2LXCA 4AOFA 2O2VB 3V62A 1WF9A 4MGZE 5CHVC 2KC2A 3NY5A 3H7PB 3QA8A 4PYUA 2KTFA 2D2QA 2IZVB 4NY0A 2PPHA 4HCPB 2KDIA 4PS3A 4BKTA 4AJYB 4DK5A 5E6OA 1V86A 2KO3A 2NBUA 2BGFA 2ZZPB 1J0GA 2KLCA 1YX6B 3QWZB 3VTUA 2AEHA 2FUHB 1UELA 3N32A 2DYBA 1OEYJ 2KD0A 4HDOA 3DBRI 3OJ3A 3QK0A 4MGYE 3IVFA 4XC2A 1I42A 4DDID 3APCA 2RGFA 3VDZA 2L7RA 2VRRB 2LVPA 1WGGA 4I6NB 1G6JA 3AXCA 3A1QA 2C60A 1YJ1A 3IFWB 3O65B 4A3PA 1WZ3A 4MSMB 1F9JA 3JSVA 1WMHA 1WX7A 2YVCA 3P2BA 2KJ6A 1H8CA 2D11A 4URKA 5LXHA 3L17A 4ZRJA 4W9JA 4EUTA 1WR6E 4RMAA 2CHWA 1GUAB 4ANVA 1MG8A 2GBKA 2FIDA 5CHFA 1UZXB 1Z5SB 4DDGD 2KJRA 3PRPB 1LXDA 2KNBA 3NHEB 1C1YB 4AWJA 3A1QB 4ZYNA 3DPDA 1WH3A 5DPWA 3T8MA 3GZNI 4WJQA 4F7ZA 4W9KA 1WJ4A 3N30A 3RULA 4IW0A 2JY6A 3JSVB 4E71A 3X23A 1WGRA 4BOSC 2R2OA 3IHPC 4GDKA 3ECIA 2L76A 4MGIE 4KZCA 3NOBA 5AZHA 1WR1A 3LJ3A 4KDIC 3VUXA 3RD2A 5EDSA 1KOTA 5D94A 2KDBA 1WYWB 3C0RB 3IG3A 4W9IA 3TMPB 2KKCA 1R4NI 3A4SC 2NPTA 4LDTD 4LCDE 2JZ3B 5TR5A 3W1SC 3PLVA 3PZDA 2KWUB 2CR5A 1GG3A 2AL6A 4GDKB 1ZKHA 5FR6A 1WFYA 2L8JA 3RYTA 3U7DA 4ZRIA 2XEWA 3NZUA 3W1SA 3PVLA 2EMSA 1V9JA 2IYDB 2J0JA 2DZKA 4NPNA 4TUUA 4MGKE 3GOEA 3WANA 1P9DU 4I6LB 2FCQA 3Q3FA 1WJNA 2NPTB 2K6QA 2QHOA 5J17A 4EKUA 3PT2B 4MELA 2KHWB 2N1WA 1E5WA 2ZNVC 2NR2A 2K6DB 5CTRC 2LVQA 4BBNF 3HM3A 2HE7A 4TV3A 2BWES 1TZ1A 4WJPA 3ZTCA 2XK5A 2ZPYA 2IY1B 3PRZA 4BBNC 3VUYA 3A9JB 2JUOA 3R7RA 4B9KA 3L16A 2N7EA 4FLHA 4F1SA 5BO4B 3L0WB 2K25A 3A33B 2KDFB 5KHQA 3B0AA 1LFDA 4NNJB 2UWQA 2V1YA 1Z2MA 4AJWA 4WQOB 1NDDA 1V6EA 4ANUA 2KQ7A 3JVZX 3ZUNA 3M3JA 3VHTC 2RD0A 3APDA 1V5TA 4IM2A 3AI5A 2ZVOA 2MWSB 2WWZA 5AZFA 2ZNVB 1WX9A 1S1QB 2KX3A 1WM3A 3PHXB 2FNJB 2ZJDA 3PTFC 4W9HA 2MBBB 4KSLC 1WJ6A 1X1MA 2RR9A 2DYOA 3EECA 3ML8A 2ZCCA 3PHWB 2Y5BB 3PSEB 3SHQA 2KVRA 1EUVB 3WA0A 1WX8A 2IY0B 5GMVA 3ZDMC 2FAZA 4AUQC 4IM3A 4NQLB 5L83A 2KN5A 1QZEA 4HXDA 1GJZA 4K7WA 4MJSA 3UIOB 3DVGX 3PV1A 3DCGA 4WJNA 4M0WB 1V80A 4B6WA 2JWZA 4F8CB 1OTRB 2WYQA 2IO1B 4OVVA 3I3TB 2JVCA 3L13A 1VCBA 4XX5A 3ZIMA 1Q0WB 3SU8X 1V2YA 4GGQA 3DQVA 2LZ6A 2W9NA 3DBHI 4KV2A 2N9EB 1XQQA 4IM0A 2M0XA 5AZGA 2NBVB 4MM3A 5DPTA 1J8CA 4G50A 2FCSA 4BOZB 4MJSB 3NZSA 4E74A 1E90A 4CYEA 3VUWA 2IBIB 2MBEA 3RT3B 1WJUA 3HHMA 3VXWA 3WAMA 2K1FA 2G4SA 1ZGUB 2CHZA 1IPGA 2M1MA 4II3B 3K9PB 5DPSA 4KIKA 2KOXA 4HJKA 4DBGA 2LWPA 4GN1A 2AYOB 3HIZA 3T9LA 3X0WA 2LRUA 2LD9A 3HK0A 5CHWA 3DVGY 5D6JB 2MX2A 2DZJA 2KANA 2GOWA 2BYEA 3PPAA 1UD7A 1AARA 3KUCB 3M62B 3ZNHB 4JLCA 1NBFC 3WIMA 3DVNV 3PLUA 4W9CA 4ZRKA 1WE6A 2LJ5A 1WMHB 1UBIA 1HE8A 4TKNA 5E6PA 4BKSA 4HDQA 1RFAA 3M95A 4G11A 3VQIA 3NS8A 3TL5A 3H7SA 2FCNA 3ML9A 2Z0EB 3MJWA 2LUEA 2AL3A 4IWOA 4EEWA 1XD3B 4FJYA 4RM9A 1J19A 2KTRA 2WDTB 4ICVA 2O6VA 3JW0X 4FHKA 2MBQA 1U4AA 1TBEA 5DCNA 4LJOB 4FHJA 2BF8B 4I6PA 4N9F4 1E8WA 2O6VD 2BWFA 4E3CA 2KZRA 1WIAA 4LDTB 1KLVA 4K7SA 3OLMD 3VVWB 5J18A 2HD5B 2ZEQA 1SIFA 2KMAA 4PS8A 5LLIA 2LXAA 3UINB 3ONSA 4A20A 1E8XA 5AEKB 1WI0A 3QJZA 2NS5A 1C3TA 3ZW3A 3CF6E 3UQAA 2O6VB 1BT0A 1CMXB 4MDKE 5E6NA 3SD5A 2JT4B 4II2B 4ANWA 3KUZA 3Q3JA 2KK8A 2A4ZA 3V60A 1GC7A 2L00B 5JH5C 2IO2B 3VTVA 3W1YA 4DHZE 2PEAA 2LRWA 4JQWC 3RCZA 1WGDA 3DOWA 4W9DA 3RZFA 3UF8A 2V4LA 2CHXA 4FN2A 2A5UA 3EHVA 2MQJA 4GSWA 4X57B 2KWVB 2EKEC 3PREA 1FXTB 3CSFA 2N4FA 3KVFB 4GIVA 3H1UA 5G55A 2FIFA 3TBLD 2JZZA 2J7QB 5IA7A 3R3MA 3DBLI 3OAWA 2DZMA 2KDEB 1WZ0A 3N3KB 1YX5B 2GBRA 1WGYA 2HTHA 2KXJA 4G3XB 4JGHB 2XK5B 2LGDA 3ZO5B 5JZEB 4LJPB 1P98A 2KWCA 3PGEA 2D3GA 1VD2A 1Y8RC 1K8RB 1E7VA 2DYMA 2BYFA 1RRBA 3PRMB 3TJPA 2C5LC 2L0FA 5LXIB 1P1AA 2ASQA 5J2RA 3KW5B 4NJ6A 4DHZB 1E8YA 3DBSA 3L08A 2J0KA 2MP2A 2GMIC 2Z0DB 2OOBB 2G4DB 2MBHA 1V81A 3EFUA 2K8HA 2JRHA 2NVUI 4HWIB 4NQKE 4ASWC 2YLMA 3S2AA 1EO6A 1H4RA 2DX5B 4GOCA 4JL9A 3ZKJC 2G3QB 2JXXA 4GDLA 3UQBA 2C7HA 4EFOA 2L0TA
chains in the Genus database with same CATH superfamily
3PO0A 1LQBA 3APFA 4WWPA 4ZHPA 3URYA 1EF1A 3RZWC 3ABVB 2SAKA 4USAA 3KYCD 3B1LX 1IYFA 5JHBA 3ZRFA 1UBQA 4K81A 2BS2B 2LI5A 1NI3A 4IC7B 2DLBA 2QSDA 3BK1A 2J53A 1F52A 4HJGE 4NAWA 3R66C 3Q3MC 2NTTA 1L4DB 2KMCA 2KFJA 5G2NA 1V5OA 4W9EA 3CMMB 2PE9A 3Q69A 1SIJA 3A9KB 5HI1A 4B95A 3IAS1 2LVOA 3H9DA 4KZ0A 2W3RA 1L4ZB 3AULA 1JWAD 2W3SA 4ZHOA 4BKSD 1E7PB 3AM9A 1Q5WB 2K8CA 3ZNID 2L83A 2IJ0A 5JHAA 4WWOA 3ZJTA 3WCQA 4JWUC 2PLPA 2WU5B 4TMAB 1D5MC 3ZRCA 3RN9C 1EWYC 2I1KA 4J6IA 4RFBA 2AQ3B 4WH4A 4A3OA 5IKCM 4M01A 1E8ZA 2BB6A 5C3JB 3FC4A 4A55A 3L10B 2KQSA 3LB8C 2IO3B 3L54A 1KJTA 1WXSA 1XXGA 4WAAA 4C80A 4K1RB 1OEYA 1FRDA 3A9JA 1WM2A 3AE8B 4NJ7A 1WXMA 2PE6B 2DAFA 3AEGB 3PS6A 5D7GA 4P16A 1GC6A 3AU5A 1UH6A 1YD8U 3AE7B 2G9HD 4JIOU 1S3SG 1YNTE 2WXHA 1WE7A 3H8HA 1MPEA 1K50A 3TEYA 4FULA 4D2KA 4GU2A 3WAPA 2GBJA 2GBNA 4HROA 1UF0A 3BINA 4YWGG 2B3AA 4YXDB 1ISNA 1YN5A 1D4BA 3H7PA 3R7QA 2IDYA 2IGDA 3H6NA 3QARA 4K3BA 4GB9A 1TGZB 3K9OB 4NAMA 1L2NA 2MCNB 1TTNA 2LJIA 3SR6A 4KVGB 2BKRB 4FADA 1ZDVA 4N59A 3VFKA 3KH0A 3TCAA 2BPSA 3ZVVA 4YL8A 2UYZB 1PUTA 5D3DA 3ZJUA 4PYUA 4L23A 4NY0A 2Y3AA 1TKYA 3QWZB 3VTUA 2D3BA 4BAXA 2DYBA 1OEYJ 2BS4B 3LXFA 2ZW1A 4MGYE 4XC2A 1I42A 4DDID 2BT6A 2RGFA 1QF6A 2LVPA 1AWDA 2K3UA 3JSVA 5LXHA 5H8YE 4ZRJA 2LHDA 3RNCC 2GBKA 5T8IA 1YN4A 3NHEB 4KGRA 1PDXA 2DNFA 1RM6C 4AWJA 4N58A 2Y5CA 2JY6A 1JWSD 1SE4A 2ON8A 1WGRA 4GDKA 2K9XA 2PMVA 4KZCA 2J42A 5AZHA 1WR1A 4KGTA 3VUXA 1KOTA 5LNK1 1WYWB 4Q2JA 1EWCA 2NPTA 2PTLA 2RMMA 3AE1B 2IGGA 3PZDA 2MJDA 3AN1A 3DWGC 1ZKHA 3U7DA 1DOIA 2J0JA 4NPNA 3I57A 1T3QA 1J7CA 3DBRB 4I6LB 3Q3FA 4NZLB 4AS1A 1E5WA 5CTRC 1JRPA 5D3IB 2LVQA 4BBNF 2KDMA 1TZ1A 1FO4A 1XO3A 1PYWD 2ZPYA 3PRZA 3ZXVA 4BBNC 3L0WB 4TSSA 1ZXIA 4NNJB 2UWQA 1T5XD 1XCQL 4AJWA 2KQ7A 3NRZA 3VHTC 1V5TA 1AN8A 3FILB 1N5WA 5AZFA 3NVVA 4B0MA 3R2IA 2FNJB 4W9HA 2MBBB 4KSLC 3C19A 2Y5BB 1WGKA 2NTSA 1R4NB 2L52A 4LNFA 2CU3A 4IM3A 4NQLB 4N6EB 4K7WA 4MJSA 1XLOA 1GB1A 3NVZA 4WJNA 5BYRA 2BS3B 3L13A 1VCBA 4XX5A 2LZ6A 4IM0A 3AE6B 1J8CA 2KT7A 4E74A 4CYEA 3VUWA 1C4AA 4RGMA 3IT4B 4RF0A 3ETRA 2VZKD 4II3B 2LWPA 4GN1A 1TS2A 3T9LA 2LD9A 5D6JB 2VZKB 3PPAA 1UD7A 3KUCB 1WE6A 2LJ5A 1HE8A 5E6PA 3TL5A 2Z0EB 1SJHD 4DXGA 4EEWA 1AYFA 4RM9A 1J19A 2KTRA 2WXKA 4MACA 2WDTB 4ICVA 1F2RC 1V1OA 2JSVX 1T0QC 4E3CA 3I63C 2KZRA 4XDCA 4LDTB 3U52E 1N60A 4K7SA 5J18A 1IGDA 1SIFA 3ONSA 1E8XA 1WI0A 1SJED 3CF6E 1CMXB 4MDKE 5E6NA 3SD5A 4LNIA 3B2FA 4II2B 5H92C 5JH5C 1V1PB 4A9AA 1L6UA 4JQWC 1WGDA 3UF8A 2CHXA 2L1AA 1MFWA 2KN4A 4KKJA 5EE9A 2EKEC 1BUIC 3KVFB 5HHDG 2J7QB 1SE3A 2BTEA 2KDEB 1XLQA 2GBRA 2XK5B 5JZEB 1P98A 1SE2A 1VD2A 2BYFA 1YJJA 1CQVA 5LXIB 1P1AA 5J2RA 4C7YA 3L08A 2MP2A 4JPSA 2VH2A 2G4DB 2MBHA 4HWIB 2K8HA 4ASWC 3S2AA 1D5XC 4EFOA 1F0ZA 4XZ4A 3P4QB 3U8ZA 2DHZA 3QQ8B 1OQQA 1RAXA 1I35A 4K7UA 3R2TA 4CQNA 1PQSA 4ICUA 2L3ZA 2CKHB 2D10A 1QKZA 1FXAA 5C23A 1VZ7A 2N9PC 3Q6BA 3RUIB 4W9GA 2M8SA 3UGBB 1GOZA 4YSYB 1P3QU 2WXQA 2QJLA 2XBBC 2M17A 3DBLB 2DENB 2WXLA 2DAJA 3M63B 2WS3B 4DHJD 4GMVA 4DXAB 3QIJA 4KIKB 2G45B 1Q1OA 2DWQA 4NAWB 5DPRA 4DHJB 5D2MB 2WX0A 2M0AA 2QMTA 2ZPNA 3AE9B 3HM6X 2K39A 1NI2A 3HUIA 4IWQA 2I1JA 1Y56A 3V6CB 2CS4A 3MHZA 1SE9A 3UIPB 4C00A 2RSUA 2EMTA 3RI7C 2GBMA 4FJZA 1A5RA 4KDLB 1JALA 3CIRB 4AP4C 3I5JC 4HK2A 2KVZA 1I4GA 3ZXRA 5CX3A 4TQ1A 5BMGA 2INDC 1E10A 2WU2B 1JWUD 2IO0B 4LNKA 1JRUA 2QIEB 3GE8C 5L95C 2MSED 2Z59B 5HKHA 3SDLC 1TIFA 1RLFA 3W9CB 2JZPA 2BQQA 2N9XA 1BXTA 2WNMA 1L7YA 1UGMA 3LDZE 2DZIA 1NEKB 3EUB2 2J0MA 3AECB 1P7FA 2C7NB 5FKAC 1KTKA 1HXYD 1SGHA 2WXJA 4FA6A 4W9LA 2O2VA 4IUMB 3QHTA 2REXA 5C1ZA 4PS7A 2LASA 4EZKA 1E0ZA 1LM8B 5FK9C 2LGIA 4DQOC 3DHIC 4FJVB 4HLEA 2FCMA 3BVGA 2ZVNA 1VJKA 1WRDB 2N7DA 3BIID 1ZUD2 2LXCA 1DOYA 1KFYB 3H7PB 3Q8EA 1QT9A 4ZRQA 2IZVB 2PPHA 4PS3A 4AJYB 4DK5A 2KO3A 2NBUA 2ZZPB 2KLCA 3AE5B 4RGNA 2AEHA 2TSSA 1UELA 1WSPA 2KD0A 1FM0D 3EFCA 3QK0A 3IVFA 3APCA 3VDZA 2L7RA 2VRRB 4I6NB 1L6VA 3A1QA 2C60A 4B0EA 4MT5A 2D3CA 4A3PA 3FKYA 1WZ3A 1F9JA 1H8CA 2JU6X 3L17A 4RMAA 2CHWA 4RH6A 1GUAB 1MG8A 1Z5SB 1R4MB 2KJRA 1LXDA 2KNBA 5TSSA 1C1YB 2ZW0A 4ZYNA 1WH3A 3T8MA 4RCOA 2EKIA 4IW0A 4E71A 3JSVB 3IHPC 4WIPA 2L76A 4KKIA 2WXGA 3NOBA 3IXSA 5G5GA 4WQMA 5D94A 3DHGC 3C0RB 2AX5A 1FNWA 2KKCA 4LCDE 5TR5A 1YOVB 3NJTA 3PLVA 2QDFA 2OJWA 2CR5A 1GG3A 2AL6A 4GDKB 2L8JA 4ZRIA 3W1SA 3PVLA 3GB1A 3TEXA 4TUUA 3GOEA 3NUHB 3IT6B 1FFUA 2N7JA 2FCQA 1WJNA 3MC8A 2NPTB 4EKUA 3KWVA 2B76B 3P4RB 5G5HA 1QOAA 2HE7A 4TV3A 4WJPA 3ZTCA 3VUYA 3R7RA 2JUOA 2JQRB 1WXQA 4JWSC 1L0VB 2M19A 4WQOB 1V6EA 3ZUNA 3M3JA 2N9KA 2RD0A 1JWBD 4OZCA 2ZVOA 2HDEA 2WXMA 2JWUA 3AE4B 1WM3A 1X1MA 3PSEB 3EECA 3VTWA 2KVRA 3WA0A 1DOXA 1TS4A 4AUQC 5L83A 2KN5A 4HXDA 1GJZA 3UIOB 1F77A 3AE2B 4B6WA 2AQ2B 2JWZA 1IGCA 1CK1A 1OTRB 2INCC 5E6JA 2WYQA 4OVVA 3I3TB 3W5UB 4YT0B 4A90A 1FRRA 4GGQA 2W9NA 2LUMA 2LFIA 2M0XA 4G50A 2FCSA 4MJSB 1E90A 3B2GA 3RT3B 1PGBA 3VXWA 3WAMA 1FNUA 4FXCA 1ZGUB 2CHZA 1D6EC 1IPGA 1TKGA 2YEPF 4IKGA 2KOXA 4HJKA 4DBGA 5BYQA 3HRDD 3X0WA 2LRUA 4BZAA 1NYRA 2MH7A 4S17A 2DZJA 2GOWA 3RNGC 1AARA 3M62B 3P42A 4JLCA 1NBFC 2JYEA 3DVNV 1WMHB 3VRBB 4NJCA 1XCTL 1TY2A 2BBCA 4BKSA 3M95A 4G11A 1FD6A 4ARCA 2ICIA 3NS8A 3H7SA 3P1MA 4RGTA 2LUEA 2AL3A 4IWOA 1KF6B 4C4VA 2L32A 3Q2AC 3Q3NC 2K22A 3NG0A 4FHKA 4PK1A 1U4AA 2HTME 1TBEA 4YSXB 4N9F4 4I6PA 2WXPA 2Z8LA 3N1YC 1WIAA 3AEDB 3OLMD 3VVWB 2WLBA 2HD5B 2ZEQA 4PS8A 5LLIA 1V8CA 5AEKB 4A20A 1SXTA 1MVKA 2GB1A 1C3TA 1C79A 1FCLA 2RDHA 3AEEB 3VTVA 3OWEB 3E56A 3RCZA 3RZFA 1K53A 2MQJA 4GSWA 4X57B 1L0XB 1L0YB 2KWVB 3RNEC 2OEDA 4REZA 3PREA 5G55A 3H1UA 2LMCA 2JZZA 3R3MA 4XDDA 1KH0A 2DZMA 1YX5B 2W54A 1VZ6A 3ZO5B 4ACFA 3PGEA 1Y8RC 1E7VA 1K52A 2ASQA 2H88B 1HZ5A 2J0KA 1FFVA 2PVGC 3EFUA 2NVUI 4NQKE 2YLMA 1EO6A 1H4RA 3ZKJC 4GDLA 2QEJC 2C7HA 4W9JA 3Q3OC 3P4PB 1KLGD 2MP2B 5KHOA 4XGAB 2KX0A 4ARIA 2L05A 1IP9A 2KFKA 3DVNU 3NVWA 2QCZA 3FAHA 1WXVA 5IO9A 1FIQA 4ZDVA 5I4DA 2HJ8A 3AEBB 2V3SA 4ANXA 3KUDB 4P1BC 2ZCBA 2WXIA 1FXIA 4BKGA 3KYDD 1OQRA 1HA5A 3ALBA 1TJEA 2JXTA 2X38A 3DWMA 3JYUA 4MSQB 1ZE3D 3AU4A 2MRPA 3QCAA 4HPPA 2JF5A 4L1BA 4KX6B 2RDBC 2OJRA 2BVCA 2BYVE 3OJ4B 2Q5WD 2YEPB 2PJHA 1EF5A 2IGHA 2KC1A 2J4XA 3ENEA 4GLSC 1JMLA 1WY8A 3RNFC 4RM8A 4M8MA 2I38A 2N1VA 4ZYSA 1JCKB 1GNUA 2C9WB 4IG7B 1P0RA 3MFGA 4W9FA 3IBEA 4MEMA 4EOYA 1ZW7A 2XN9C 4WWNA 3MC0B 2JX5A 3IAM1 2WDVB 2D5GA 2MEKA 2JPHA 4PYZA 3BY4B 3ZDTA 4WWMA 1IBXB 3FILA 2MW5A 4UDUC 4TQ0A 3CSTA 1STEA 3P63A 1NVID 1TY0A 2FBWB 1IUEA 4A6QA 4EZLA 4CHKA 2LEKA 2MA9B 1WRIA 3NZ3A 3WALA 4GXBA 2KJHB 1TS5A 1WWTA 2KLGA 2ONQA 1N5XA 1OQYA 3ZNGC 1XEEA 2R2QA 2BKFA 4HPMB 2M4NA 3EA6A 1EM7A 1JWMD 2KYWA 1N63A 3ZLZA 3B08A 1RYJA 1SF0A 1WXAA 2WX1A 2MLBA 2KQ4X 2O2VB 3QA8A 2WXRA 5HFYA 2D2QA 3J9CA 4HCPB 4XE0A 4WURA 4BKTA 4DXFA 5E6OA 1J0GA 1UUPA 2V4IB 3DBRI 4RNAA 3OJ3A 3MJ5A 1WGGA 1GAQB 2GI9A 1ZDXA 3IFWB 3O65B 2J52A 1YQ4B 4MSMB 2YVCA 2KJ6A 2MJEA 1D5ZC 4J3OD 2GLSA 4EUTA 1WR6E 3ZGZA 1C77A 1RWSA 3A1QB 3DPDA 3GZNI 4W9KA 1WJ4A 3N30A 1ZXHA 3X23A 4BOSC 2V0GA 2MHJA 3BK2A 4JE3B 3Q8FA 3ECIA 4MGIE 2KMMA 2V9HA 3T3NA 1HTOA 1ZPSA 4LTUA 3IG3A 2WXFA 3U2SC 1R4NI 3A4SC 3DHHC 2JZ3B 2IPKD 2KWUB 5FR6A 3RYTA 2EMSA 1V1PA 1V9JA 3W2DA 2DZKA 4MGKE 3BWUD 1P9DU 3B9JA 1I4HA 4MH8A 4MELA 2KHWB 2XK5A 1JW9D 5IOIA 3A9JB 3L16A 2N7EA 4FLHA 3A33B 2KDFB 5KHQA 1LFDA 1TT5B 5HG2A 1I4PA 2V1YA 1Z2MA 4YTPB 4ANUA 3JVZX 3APDA 4IM2A 3AI5A 2WWZA 3VR9B 2ZNVB 1WX9A 1S1QB 2KX3A 4M0WA 2EELA 2V3NA 2ZJDA 3PTFC 1J7AA 3ML8A 3PHWB 2DYOA 2DBYA 2ZCCA 2BYTA 1WX8A 5EE0A 1N62A 5GMVA 3ZDMC 2R61A 4HRSA 1KRHA 3W5VB 3DVGX 3PV1A 3DCGA 1V80A 1I4QA 1ZOYB 4F8CB 3RPFC 2GRIA 4O1NA 2IO1B 3P4SB 1VZ8A 3ZIMA 1Q0WB 3DBHI 4KV2A 2PW9A 2N9EB 3BVMA 3AEAB 4MM3A 3NZSA 4JX1C 2IBIB 3HHMA 2K1FA 3RNAC 3RMKC 2M1MA 4KIKA 3CWIA 2AYOB 2PVOD 1FMAD 1JROA 3HK0A 5CHWA 5IN7A 1NYQA 2E3TA 2MX2A 3AV8A 2NMQA 2WDQB 1ET9A 3ZNHB 3PLUA 1PFDA 3N20C 3N1ZC 1UBIA 2FUG1 4TKNA 3PZ7A 4YTNB 3VQIA 2VH1A 1SBBB 1SB3C 2O6VA 2UU7A 3JW0X 1CJEA 3KWLA 3AB5A 2MBQA 1YQ3B 5DCNA 4LJOB 4FHJA 3GP7A 4EE2A 1KLVA 1ACCA 1J7BA 4OZAA 1YN3A 2KMAA 2LXAA 4C4VB 3QJZA 3ZW3A 3UQAA 1BT0A 2KACA 4US8A 4ANWA 3Q3JA 3V60A 2L00B 2IO2B 1NENB 2QILA 4US9A 1AW7A 2PEAA 2LRWA 3DOWA 4AQ7A 4IOIE 3VRAB 3EHVA 1FPYA 2MJ3A 5BMHA 1K51A 3R8BA 4ZOHC 1FXTB 4GIVA 1SEBD 3TBLD 3U4EG 3DBLI 2FE8A 3N3KB 2HTHA 4G3XB 4JGHB 5EE3A 2LGDA 3HVDA 4LJPB 4C7ZA 1Q10A 1K8RB 2DYMA 1RRBA 3PRMB 3TJPA 2L0FA 2D3AA 3KW5B 3DBSA 4H2AA 2Z0DB 1FCCC 2OOBB 1V81A 1N61A 4JL9A 1TS3A 2JXXA 1UZXB 2LGSA 5EE1A 3UQBA 4IWPA 2C7MB 3TUOA 4S0RA 2WGSA 1VRAB 3N1XC 4KSKC 4OZBA 3SFDB 3MC9A 1XF5L 4L2YA 3A9KA 4GDLB 3OG5A 1L5PA 2WXNA 1HTQA 4MH0E 1F2RI 1DYQA 3D32A 1GPXA 4CO7A 1C4PA 3A4RA 2KFKB 4EZJA 4BFRA 3N9YC 3BYYB 1CZPA 2LGYA 1OGWA 1UWMA 3U30A 4HPLB 1V49A 2QC8A 4HKZE 2RPVA 1XLNA 4FBJB 2CJOA 5IAAC 3TIXA 1D3ZA 1C78A 1EU4A 3DDCB 1BMLC 3UI3A 1E7UA 3ZNZB 1YIWA 1QQRA 3MTNB 1MI0A 2K8BA 1YQBA 1V97A 1M4VA 2NBWB 3QC8B 4BVUC 3HVZA 2AWTA 4HCNB 3QAQA 2BB5A 4OVZA 2JRIB 4WJOA 2KTRB 1FEHA 1WGHA 2N0SB 2MBOA 2LGXA 3Q14C 1T0RC 1KM7A 3T3OA 4HVBA 4HEA1 2WDRB 4C56C 4PT5A 1UNSA 1ROEA 2NCNA 3MHSD 2PKOA 3VH3B 3V61A 3V6EB 4OVUA 2JYTA 1QLBB 2BW2A 4K3CA 3VH4B 2W55A 3Q8BA 3SEBA 2CU1A 2D07B 2XNAC 4DWFA 3ZTDA 3C8YA 3WAOA 2RPQA 3Q8CA 3GZNB 4P1CC 1R4MI 4M8NA 1MHXA 3BZDB 3VAWA 1T0YA 3EC8A 3NVYA 5BYSA 3QX1A 5IP4D 1M94A 1QILA 1DGJA 4G0NB 1XT9B 3MP9A 1KLUD 4AOFA 3V62A 1WF9A 4MGZE 5CHVC 2KC2A 3NY5A 5JXVA 2WXOA 2KTFA 5AUIA 2KDIA 1V86A 4M00A 2BGFA 5MPOA 1YX6B 2FUHB 3N32A 4HDOA 3KLSX 1QOGA 3V05A 2CJNA 1LO5D 1I4RA 1QOBA 2M56B 1G6JA 3AXCA 3ZQ4A 1YJ1A 1WMHA 1WX7A 3P2BA 2D11A 4URKA 1ZP0B 4YTMB 4OW0A 4ANVA 2I2YA 3LYYA 5CHFA 2FIDA 1MJDA 4DDGD 3PRPB 1TZOA 3V3XA 4RF1A 5DPWA 4WJQA 4F7ZA 3RULA 1B1ZA 4XYCA 3L4PA 2R2OA 3E9SA 4LNOA 3LJ3A 4KDIC 1C4CA 3RD2A 5EDSA 2KDBA 4W9IA 3TMPB 4IDIA 4LDTD 3W1SC 1I4XA 1T0SC 1WFYA 4LK0M 2XEWA 3NZUA 3VR8B 2IYDB 4A8XC 3AE3B 2Y5PA 3U7ZA 3DBHB 3WANA 3ZYYX 2LHEA 2QHOA 1TYGB 2K6QA 5J17A 3PT2B 1T6BX 2N1WA 2ZNVC 2NR2A 1QOFA 2K6DB 3KQ4A 3HM3A 2BWES 2E6XA 2IY1B 4B9KA 4RGOS 4F1SA 5BO4B 2K25A 4OHJA 2HJ1A 1VDVA 3B0AA 1NDDA 1FNVA 5BMIA 5GXGB 2MWSB 1SSNA 3BYTB 2KWDA 3PHXB 3GE3C 1WJ6A 2RR9A 3SHQA 1P7EA 4LLGM 4XWTA 4WAFA 1EUVB 1YJIA 2IY0B 2FAZA 3I9V1 1QZEA 3Q8AA 4LNNA 4M0WB 4HKQA 2SEBD 5AUKA 1XLPA 4YSZB 4P6VF 2JVCA 3RFZB 4M02A 1GB4A 3SU8X 1V2YA 2OHFA 3DQVA 1ENFA 5AZGA 1XQQA 1VLBA 1RFKA 2NBVB 5DPTA 4BOZB 4QAYA 2MBEA 1WJUA 2G4SA 3AMZA 5DPSA 3K9PB 1OFFA 1HQRD 3BVZA 3HIZA 1I7HA 3AEFB 3DVGY 1HZ6A 2G1EA 3PZ8A 4MM3B 2KAJA 2KANA 1B9RA 4ITKA 1VR9A 2BYEA 3WIMA 4ZRKA 4W9CA 2ACZB 3EGRA 3AH7A 2AQ1B 3NS1A 4XWWA 1PGAA 4HDQA 2K0PA 1RFAA 2WHIA 1C9FA 2FCNA 3ML9A 3MJWA 1LGRA 1YMHE 1XD3B 4FJYA 2WQYB 2N9LA 1F1HA 3TSSA 1R7SA 2WP9B 2BF8B 1ET6A 1MHHE 1E8WA 2O6VD 2BWFA 1A70A 1E9MA 4R3DA 1N6ZA 2X8XX 3UINB 2INPE 2PIAA 2NS5A 1HEZE 2O6VB 1UGJA 2JT4B 3KUZA 2KK8A 2A4ZA 1ESFA 2K5PA 1GC7A 3O13A 1PGXA 5FR3A 1E6EB 3W1YA 4DHZE 1IBXA 2W82A 3TEWA 4W9DA 2V4LA 1EU3A 4FN2A 2A5UA 5C2TB 3TEZA 1MG4A 2V3PA 1UWXA 3SFEB 3CSFA 2N4FA 2RDGA 2FIFA 5IA7A 1WYGA 3OAWA 1WZ0A 1WGYA 2KXJA 3RNBC 3GS2A 2KWCA 4ZRPA 2D3GA 1C76A 1TKEA 2C5LC 2H89B 4KGSA 4DHZB 4NJ6A 1E8YA 2INNE 1JQ4A 2GMIC 2JRHA 3ZJVA 2DX5B 4GOCA 2G3QB 4P7IA 2L0TA
chains in the Genus database with same CATH topology
4XZ4A 1LQBA 3U8ZA 2DHZA 4IWPA 3APFA 3QQ8B 2C7MB 4WWPA 1RAXA 1I35A 4K7UA 4KSKC 1PQSA 2MP2B 5KHOA 1EF1A 4ICUA 2KX0A 3RZWC 2L3ZA 2CKHB 2L05A 1IP9A 2D10A 2KFKA 3DVNU 3KYCD 3B1LX 1IYFA 5JHBA 4ZDVA 1WXVA 3A9KA 2HJ8A 3ZRFA 2V3SA 4GDLB 5C23A 4ANXA 3KUDB 1UBQA 2N9PC 4K81A 3RUIB 4W9GA 2LI5A 2ZCBA 4IC7B 4MH0E 2M8SA 3UGBB 3D32A 4BKGA 3KYDD 4NAWA 3R66C 5G2NA 2KMCA 2KFJA 4CO7A 1P3QU 2XBBC 2M17A 1V5OA 2KFKB 3A4RA 2DENB 3CMMB 2PE9A 4W9EA 4BFRA 4EZJA 3ALBA 2DAJA 3M63B 3A9KB 3JYUA 4B95A 4MSQB 4DHJD 2LVOA 2LGYA 1OGWA 3H9DA 3AU4A 4KZ0A 4GMVA 2MRPA 3QCAA 4HPLB 3U30A 1V49A 4DXAB 2JF5A 3QIJA 4FBJB 4KIKB 2G45B 1Q1OA 5IAAC 3TIXA 3AULA 1D3ZA 4NAWB 5DPRA 3DDCB 4DHJB 2OJRA 5D2MB 2WX0A 2BYVE 3OJ4B 1E7UA 4BKSD 2PJHA 3ZNZB 1YIWA 2ZPNA 1EF5A 1Q5WB 2K8CA 3MTNB 3ZNID 3HM6X 2K39A 2K8BA 2KC1A 1NI2A 4IWQA 3VTWA 1YQBA 2I1JA 5JHAA 3V6CB 2CS4A 4WWOA 3ENEA 1SE9A 3UIPB 2NBWB 1WY8A 2RSUA 3QC8B 4BVUC 2EMTA 4RM8A 3ZRCA 2GBMA 4FJZA 4M8MA 2I1KA 2AWTA 1A5RA 4KDLB 4HCNB 3QAQA 2N1VA 1GNUA 2C9WB 4J6IA 4AP4C 4A3OA 4IG7B 1E8ZA 2JRIB 4HK2A 4WJOA 2KTRB 1P0RA 1WGHA 3L10B 2KQSA 4W9FA 2IO3B 5CX3A 3IBEA 3L54A 2MBOA 4TQ1A 4MEMA 2LGXA 1KJTA 1WXSA 4EOYA 2IO0B 1KM7A 4WAAA 4HVBA 1ZW7A 1JRUA 4WWNA 4K1RB 1OEYA 3A9JA 5L95C 1WM2A 2MSED 2Z59B 4NJ7A 1WXMA 4P7IA 5HKHA 2PE6B 2DAFA 3PS6A 3SDLC 5D7GA 1GC6A 2NCNA 3AU5A 3MHSD 1RLFA 3VH3B 2JPHA 1UH6A 3V61A 1YD8U 4PYZA 3V6EB 2N9XA 4OVUA 3BY4B 4JIOU 1L7YA 1UGMA 3ZDTA 1S3SG 2MW5A 1WE7A 3LDZE 4TQ0A 3VH4B 3CSTA 2DZIA 4FULA 4GU2A 3WAPA 2GBJA 2J0MA 2CU1A 2D07B 2GBNA 4DWFA 2C7NB 4EZLA 3ZTDA 4CHKA 2MA9B 3BINA 2B3AA 3WALA 1SGHA 4GXBA 2KJHB 4FA6A 2KLGA 2RPQA 2O2VA 1ISNA 4W9LA 3WAOA 1R4MI 1OQYA 4IUMB 3H7PA 3QHTA 2REXA 3R7QA 5C1ZA 4PS7A 4M8NA 2LASA 3ZNGC 4EZKA 3H6NA 3QARA 2R2QA 1LM8B 4GB9A 1TGZB 2BKFA 3K9OB 3VAWA 4HPMB 1L2NA 1T0YA 3EC8A 2MCNB 1TTNA 3QX1A 2M4NA 1M94A 4FJVB 4KVGB 2BKRB 4FADA 2FCMA 4HLEA 4G0NB 2ZVNA 3VFKA 1WRDB 3KH0A 3TCAA 1XT9B 3B08A 3ZLZA 1WXAA 2BPSA 3ZVVA 2WX1A 2N7DA 4YL8A 2MLBA 2UYZB 2LXCA 4AOFA 2O2VB 3V62A 1WF9A 4MGZE 5CHVC 2KC2A 3NY5A 3H7PB 3QA8A 4PYUA 2KTFA 2D2QA 2IZVB 4NY0A 2PPHA 4HCPB 2KDIA 4PS3A 4BKTA 4AJYB 4DK5A 5E6OA 1V86A 2KO3A 2NBUA 2BGFA 2ZZPB 1J0GA 2KLCA 1YX6B 3QWZB 3VTUA 2AEHA 2FUHB 1UELA 3N32A 2DYBA 1OEYJ 2KD0A 4HDOA 3DBRI 3OJ3A 3QK0A 4MGYE 3IVFA 4XC2A 1I42A 4DDID 3APCA 2RGFA 3VDZA 2L7RA 2VRRB 2LVPA 1WGGA 4I6NB 1G6JA 3AXCA 3A1QA 2C60A 1YJ1A 3IFWB 3O65B 4A3PA 1WZ3A 4MSMB 1F9JA 3JSVA 1WMHA 1WX7A 2YVCA 3P2BA 2KJ6A 1H8CA 2D11A 4URKA 5LXHA 3L17A 4ZRJA 4W9JA 4EUTA 1WR6E 4RMAA 2CHWA 1GUAB 4ANVA 1MG8A 2GBKA 2FIDA 5CHFA 1UZXB 1Z5SB 4DDGD 2KJRA 3PRPB 1LXDA 2KNBA 3NHEB 1C1YB 4AWJA 3A1QB 4ZYNA 3DPDA 1WH3A 5DPWA 3T8MA 3GZNI 4WJQA 4F7ZA 4W9KA 1WJ4A 3N30A 3RULA 4IW0A 2JY6A 3JSVB 4E71A 3X23A 1WGRA 4BOSC 2R2OA 3IHPC 4GDKA 3ECIA 2L76A 4MGIE 4KZCA 3NOBA 5AZHA 1WR1A 3LJ3A 4KDIC 3VUXA 3RD2A 5EDSA 1KOTA 5D94A 2KDBA 1WYWB 3C0RB 3IG3A 4W9IA 3TMPB 2KKCA 1R4NI 3A4SC 2NPTA 4LDTD 4LCDE 2JZ3B 5TR5A 3W1SC 3PLVA 3PZDA 2KWUB 2CR5A 1GG3A 2AL6A 4GDKB 1ZKHA 5FR6A 1WFYA 2L8JA 3RYTA 3U7DA 4ZRIA 2XEWA 3NZUA 3W1SA 3PVLA 2EMSA 1V9JA 2IYDB 2J0JA 2DZKA 4NPNA 4TUUA 4MGKE 3GOEA 3WANA 1P9DU 4I6LB 2FCQA 3Q3FA 1WJNA 2NPTB 2K6QA 2QHOA 5J17A 4EKUA 3PT2B 4MELA 2KHWB 2N1WA 1E5WA 2ZNVC 2NR2A 2K6DB 5CTRC 2LVQA 4BBNF 3HM3A 2HE7A 4TV3A 2BWES 1TZ1A 4WJPA 3ZTCA 2XK5A 2ZPYA 2IY1B 3PRZA 4BBNC 3VUYA 3A9JB 2JUOA 3R7RA 4B9KA 3L16A 2N7EA 4FLHA 4F1SA 5BO4B 3L0WB 2K25A 3A33B 2KDFB 5KHQA 3B0AA 1LFDA 4NNJB 2UWQA 2V1YA 1Z2MA 4AJWA 4WQOB 1NDDA 1V6EA 4ANUA 2KQ7A 3JVZX 3ZUNA 3M3JA 3VHTC 2RD0A 3APDA 1V5TA 4IM2A 3AI5A 2ZVOA 2MWSB 2WWZA 5AZFA 2ZNVB 1WX9A 1S1QB 2KX3A 1WM3A 3PHXB 2FNJB 2ZJDA 3PTFC 4W9HA 2MBBB 4KSLC 1WJ6A 1X1MA 2RR9A 2DYOA 3EECA 3ML8A 2ZCCA 3PHWB 2Y5BB 3PSEB 3SHQA 2KVRA 1EUVB 3WA0A 1WX8A 2IY0B 5GMVA 3ZDMC 2FAZA 4AUQC 4IM3A 4NQLB 5L83A 2KN5A 1QZEA 4HXDA 1GJZA 4K7WA 4MJSA 3UIOB 3DVGX 3PV1A 3DCGA 4WJNA 4M0WB 1V80A 4B6WA 2JWZA 4F8CB 1OTRB 2WYQA 2IO1B 4OVVA 3I3TB 2JVCA 3L13A 1VCBA 4XX5A 3ZIMA 1Q0WB 3SU8X 1V2YA 4GGQA 3DQVA 2LZ6A 2W9NA 3DBHI 4KV2A 2N9EB 1XQQA 4IM0A 2M0XA 5AZGA 2NBVB 4MM3A 5DPTA 1J8CA 4G50A 2FCSA 4BOZB 4MJSB 3NZSA 4E74A 1E90A 4CYEA 3VUWA 2IBIB 2MBEA 3RT3B 1WJUA 3HHMA 3VXWA 3WAMA 2K1FA 2G4SA 1ZGUB 2CHZA 1IPGA 2M1MA 4II3B 3K9PB 5DPSA 4KIKA 2KOXA 4HJKA 4DBGA 2LWPA 4GN1A 2AYOB 3HIZA 3T9LA 3X0WA 2LRUA 2LD9A 3HK0A 5CHWA 3DVGY 5D6JB 2MX2A 2DZJA 2KANA 2GOWA 2BYEA 3PPAA 1UD7A 1AARA 3KUCB 3M62B 3ZNHB 4JLCA 1NBFC 3WIMA 3DVNV 3PLUA 4W9CA 4ZRKA 1WE6A 2LJ5A 1WMHB 1UBIA 1HE8A 4TKNA 5E6PA 4BKSA 4HDQA 1RFAA 3M95A 4G11A 3VQIA 3NS8A 3TL5A 3H7SA 2FCNA 3ML9A 2Z0EB 3MJWA 2LUEA 2AL3A 4IWOA 4EEWA 1XD3B 4FJYA 4RM9A 1J19A 2KTRA 2WDTB 4ICVA 2O6VA 3JW0X 4FHKA 2MBQA 1U4AA 1TBEA 5DCNA 4LJOB 4FHJA 2BF8B 4I6PA 4N9F4 1E8WA 2O6VD 2BWFA 4E3CA 2KZRA 1WIAA 4LDTB 1KLVA 4K7SA 3OLMD 3VVWB 5J18A 2HD5B 2ZEQA 1SIFA 2KMAA 4PS8A 5LLIA 2LXAA 3UINB 3ONSA 4A20A 1E8XA 5AEKB 1WI0A 3QJZA 2NS5A 1C3TA 3ZW3A 3CF6E 3UQAA 2O6VB 1BT0A 1CMXB 4MDKE 5E6NA 3SD5A 2JT4B 4II2B 4ANWA 3KUZA 3Q3JA 2KK8A 2A4ZA 3V60A 1GC7A 2L00B 5JH5C 2IO2B 3VTVA 3W1YA 4DHZE 2PEAA 2LRWA 4JQWC 3RCZA 1WGDA 3DOWA 4W9DA 3RZFA 3UF8A 2V4LA 2CHXA 4FN2A 2A5UA 3EHVA 2MQJA 4GSWA 4X57B 2KWVB 2EKEC 3PREA 1FXTB 3CSFA 2N4FA 3KVFB 4GIVA 3H1UA 5G55A 2FIFA 3TBLD 2JZZA 2J7QB 5IA7A 3R3MA 3DBLI 3OAWA 2DZMA 2KDEB 1WZ0A 3N3KB 1YX5B 2GBRA 1WGYA 2HTHA 2KXJA 4G3XB 4JGHB 2XK5B 2LGDA 3ZO5B 5JZEB 4LJPB 1P98A 2KWCA 3PGEA 2D3GA 1VD2A 1Y8RC 1K8RB 1E7VA 2DYMA 2BYFA 1RRBA 3PRMB 3TJPA 2C5LC 2L0FA 5LXIB 1P1AA 2ASQA 5J2RA 3KW5B 4NJ6A 4DHZB 1E8YA 3DBSA 3L08A 2J0KA 2MP2A 2GMIC 2Z0DB 2OOBB 2G4DB 2MBHA 1V81A 3EFUA 2K8HA 2JRHA 2NVUI 4HWIB 4NQKE 4ASWC 2YLMA 3S2AA 1EO6A 1H4RA 2DX5B 4GOCA 4JL9A 3ZKJC 2G3QB 2JXXA 4GDLA 3UQBA 2C7HA 4EFOA 2L0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XZ4 A;  1LQB A;  3U8Z A;  2DHZ A;  4IWP A;  3APF A;  3QQ8 B;  2C7M B;  4WWP A;  1RAX A;  1I35 A;  4K7U A;  4KSK C;  1PQS A;  2MP2 B;  5KHO A;  1EF1 A;  4ICU A;  2KX0 A;  3RZW C;  2L3Z A;  2CKH B;  2L05 A;  1IP9 A;  2D10 A;  2KFK A;  3DVN U;  3KYC D;  3B1L X;  1IYF A;  5JHB A;  4ZDV A;  1WXV A;  3A9K A;  2HJ8 A;  3ZRF A;  2V3S A;  4GDL B;  5C23 A;  4ANX A;  3KUD B;  1UBQ A;  2N9P C;  4K81 A;  3RUI B;  4W9G A;  2LI5 A;  2ZCB A;  4IC7 B;  4MH0 E;  2M8S A;  3UGB B;  3D32 A;  4BKG A;  3KYD D;  4NAW A;  3R66 C;  5G2N A;  2KMC A;  2KFJ A;  4CO7 A;  1P3Q U;  2XBB C;  2M17 A;  1V5O A;  2KFK B;  3A4R A;  2DEN B;  3CMM B;  2PE9 A;  4W9E A;  4BFR A;  4EZJ A;  3ALB A;  2DAJ A;  3M63 B;  3A9K B;  3JYU A;  4B95 A;  4MSQ B;  4DHJ D;  2LVO A;  2LGY A;  1OGW A;  3H9D A;  3AU4 A;  4KZ0 A;  4GMV A;  2MRP A;  3QCA A;  4HPL B;  3U30 A;  1V49 A;  4DXA B;  2JF5 A;  3QIJ A;  4FBJ B;  4KIK B;  2G45 B;  1Q1O A;  5IAA C;  3TIX A;  3AUL A;  1D3Z A;  4NAW B;  5DPR A;  3DDC B;  4DHJ B;  2OJR A;  5D2M B;  2WX0 A;  2BYV E;  3OJ4 B;  1E7U A;  4BKS D;  2PJH A;  3ZNZ B;  1YIW A;  2ZPN A;  1EF5 A;  1Q5W B;  2K8C A;  3MTN B;  3ZNI D;  3HM6 X;  2K39 A;  2K8B A;  2KC1 A;  1NI2 A;  4IWQ A;  3VTW A;  1YQB A;  2I1J A;  5JHA A;  3V6C B;  2CS4 A;  4WWO A;  3ENE A;  1SE9 A;  3UIP B;  2NBW B;  1WY8 A;  2RSU A;  3QC8 B;  4BVU C;  2EMT A;  4RM8 A;  3ZRC A;  2GBM A;  4FJZ A;  4M8M A;  2I1K A;  2AWT A;  1A5R A;  4KDL B;  4HCN B;  3QAQ A;  2N1V A;  1GNU A;  2C9W B;  4J6I A;  4AP4 C;  4A3O A;  4IG7 B;  1E8Z A;  2JRI B;  4HK2 A;  4WJO A;  2KTR B;  1P0R A;  1WGH A;  3L10 B;  2KQS A;  4W9F A;  2IO3 B;  5CX3 A;  3IBE A;  3L54 A;  2MBO A;  4TQ1 A;  4MEM A;  2LGX A;  1KJT A;  1WXS A;  4EOY A;  2IO0 B;  1KM7 A;  4WAA A;  4HVB A;  1ZW7 A;  1JRU A;  4WWN A;  4K1R B;  1OEY A;  3A9J A;  5L95 C;  1WM2 A;  2MSE D;  2Z59 B;  4NJ7 A;  1WXM A;  4P7I A;  5HKH A;  2PE6 B;  2DAF A;  3PS6 A;  3SDL C;  5D7G A;  1GC6 A;  2NCN A;  3AU5 A;  3MHS D;  1RLF A;  3VH3 B;  2JPH A;  1UH6 A;  3V61 A;  1YD8 U;  4PYZ A;  3V6E B;  2N9X A;  4OVU A;  3BY4 B;  4JIO U;  1L7Y A;  1UGM A;  3ZDT A;  1S3S G;  2MW5 A;  1WE7 A;  3LDZ E;  4TQ0 A;  3VH4 B;  3CST A;  2DZI A;  4FUL A;  4GU2 A;  3WAP A;  2GBJ A;  2J0M A;  2CU1 A;  2D07 B;  2GBN A;  4DWF A;  2C7N B;  4EZL A;  3ZTD A;  4CHK A;  2MA9 B;  3BIN A;  2B3A A;  3WAL A;  1SGH A;  4GXB A;  2KJH B;  4FA6 A;  2KLG A;  2RPQ A;  2O2V A;  1ISN A;  4W9L A;  3WAO A;  1R4M I;  1OQY A;  4IUM B;  3H7P A;  3QHT A;  2REX A;  3R7Q A;  5C1Z A;  4PS7 A;  4M8N A;  2LAS A;  3ZNG C;  4EZK A;  3H6N A;  3QAR A;  2R2Q A;  1LM8 B;  4GB9 A;  1TGZ B;  2BKF A;  3K9O B;  3VAW A;  4HPM B;  1L2N A;  1T0Y A;  3EC8 A;  2MCN B;  1TTN A;  3QX1 A;  2M4N A;  1M94 A;  4FJV B;  4KVG B;  2BKR B;  4FAD A;  2FCM A;  4HLE A;  4G0N B;  2ZVN A;  3VFK A;  1WRD B;  3KH0 A;  3TCA A;  1XT9 B;  3B08 A;  3ZLZ A;  1WXA A;  2BPS A;  3ZVV A;  2WX1 A;  2N7D A;  4YL8 A;  2MLB A;  2UYZ B;  2LXC A;  4AOF A;  2O2V B;  3V62 A;  1WF9 A;  4MGZ E;  5CHV C;  2KC2 A;  3NY5 A;  3H7P B;  3QA8 A;  4PYU A;  2KTF A;  2D2Q A;  2IZV B;  4NY0 A;  2PPH A;  4HCP B;  2KDI A;  4PS3 A;  4BKT A;  4AJY B;  4DK5 A;  5E6O A;  1V86 A;  2KO3 A;  2NBU A;  2BGF A;  2ZZP B;  1J0G A;  2KLC A;  1YX6 B;  3QWZ B;  3VTU A;  2AEH A;  2FUH B;  1UEL A;  3N32 A;  2DYB A;  1OEY J;  2KD0 A;  4HDO A;  3DBR I;  3OJ3 A;  3QK0 A;  4MGY E;  3IVF A;  4XC2 A;  1I42 A;  4DDI D;  3APC A;  2RGF A;  3VDZ A;  2L7R A;  2VRR B;  2LVP A;  1WGG A;  4I6N B;  1G6J A;  3AXC A;  3A1Q A;  2C60 A;  1YJ1 A;  3IFW B;  3O65 B;  4A3P A;  1WZ3 A;  4MSM B;  1F9J A;  3JSV A;  1WMH A;  1WX7 A;  2YVC A;  3P2B A;  2KJ6 A;  1H8C A;  2D11 A;  4URK A;  5LXH A;  3L17 A;  4ZRJ A;  4W9J A;  4EUT A;  1WR6 E;  4RMA A;  2CHW A;  1GUA B;  4ANV A;  1MG8 A;  2GBK A;  2FID A;  5CHF A;  1UZX B;  1Z5S B;  4DDG D;  2KJR A;  3PRP B;  1LXD A;  2KNB A;  3NHE B;  1C1Y B;  4AWJ A;  3A1Q B;  4ZYN A;  3DPD A;  1WH3 A;  5DPW A;  3T8M A;  3GZN I;  4WJQ A;  4F7Z A;  4W9K A;  1WJ4 A;  3N30 A;  3RUL A;  4IW0 A;  2JY6 A;  3JSV B;  4E71 A;  3X23 A;  1WGR A;  4BOS C;  2R2O A;  3IHP C;  4GDK A;  3ECI A;  2L76 A;  4MGI E;  4KZC A;  3NOB A;  5AZH A;  1WR1 A;  3LJ3 A;  4KDI C;  3VUX A;  3RD2 A;  5EDS A;  1KOT A;  5D94 A;  2KDB A;  1WYW B;  3C0R B;  3IG3 A;  4W9I A;  3TMP B;  2KKC A;  1R4N I;  3A4S C;  2NPT A;  4LDT D;  4LCD E;  2JZ3 B;  5TR5 A;  3W1S C;  3PLV A;  3PZD A;  2KWU B;  2CR5 A;  1GG3 A;  2AL6 A;  4GDK B;  1ZKH A;  5FR6 A;  1WFY A;  2L8J A;  3RYT A;  3U7D A;  4ZRI A;  2XEW A;  3NZU A;  3W1S A;  3PVL A;  2EMS A;  1V9J A;  2IYD B;  2J0J A;  2DZK A;  4NPN A;  4TUU A;  4MGK E;  3GOE A;  3WAN A;  1P9D U;  4I6L B;  2FCQ A;  3Q3F A;  1WJN A;  2NPT B;  2K6Q A;  2QHO A;  5J17 A;  4EKU A;  3PT2 B;  4MEL A;  2KHW B;  2N1W A;  1E5W A;  2ZNV C;  2NR2 A;  2K6D B;  5CTR C;  2LVQ A;  4BBN F;  3HM3 A;  2HE7 A;  4TV3 A;  2BWE S;  1TZ1 A;  4WJP A;  3ZTC A;  2XK5 A;  2ZPY A;  2IY1 B;  3PRZ A;  4BBN C;  3VUY A;  3A9J B;  2JUO A;  3R7R A;  4B9K A;  3L16 A;  2N7E A;  4FLH A;  4F1S A;  5BO4 B;  3L0W B;  2K25 A;  3A33 B;  2KDF B;  5KHQ A;  3B0A A;  1LFD A;  4NNJ B;  2UWQ A;  2V1Y A;  1Z2M A;  4AJW A;  4WQO B;  1NDD A;  1V6E A;  4ANU A;  2KQ7 A;  3JVZ X;  3ZUN A;  3M3J A;  3VHT C;  2RD0 A;  3APD A;  1V5T A;  4IM2 A;  3AI5 A;  2ZVO A;  2MWS B;  2WWZ A;  5AZF A;  2ZNV B;  1WX9 A;  1S1Q B;  2KX3 A;  1WM3 A;  3PHX B;  2FNJ B;  2ZJD A;  3PTF C;  4W9H A;  2MBB B;  4KSL C;  1WJ6 A;  1X1M A;  2RR9 A;  2DYO A;  3EEC A;  3ML8 A;  2ZCC A;  3PHW B;  2Y5B B;  3PSE B;  3SHQ A;  2KVR A;  1EUV B;  3WA0 A;  1WX8 A;  2IY0 B;  5GMV A;  3ZDM C;  2FAZ A;  4AUQ C;  4IM3 A;  4NQL B;  5L83 A;  2KN5 A;  1QZE A;  4HXD A;  1GJZ A;  4K7W A;  4MJS A;  3UIO B;  3DVG X;  3PV1 A;  3DCG A;  4WJN A;  4M0W B;  1V80 A;  4B6W A;  2JWZ A;  4F8C B;  1OTR B;  2WYQ A;  2IO1 B;  4OVV A;  3I3T B;  2JVC A;  3L13 A;  1VCB A;  4XX5 A;  3ZIM A;  1Q0W B;  3SU8 X;  1V2Y A;  4GGQ A;  3DQV A;  2LZ6 A;  2W9N A;  3DBH I;  4KV2 A;  2N9E B;  1XQQ A;  4IM0 A;  2M0X A;  5AZG A;  2NBV B;  4MM3 A;  5DPT A;  1J8C A;  4G50 A;  2FCS A;  4BOZ B;  4MJS B;  3NZS A;  4E74 A;  1E90 A;  4CYE A;  3VUW A;  2IBI B;  2MBE A;  3RT3 B;  1WJU A;  3HHM A;  3VXW A;  3WAM A;  2K1F A;  2G4S A;  1ZGU B;  2CHZ A;  1IPG A;  2M1M A;  4II3 B;  3K9P B;  5DPS A;  4KIK A;  2KOX A;  4HJK A;  4DBG A;  2LWP A;  4GN1 A;  2AYO B;  3HIZ A;  3T9L A;  3X0W A;  2LRU A;  2LD9 A;  3HK0 A;  5CHW A;  3DVG Y;  5D6J B;  2MX2 A;  2DZJ A;  2KAN A;  2GOW A;  2BYE A;  3PPA A;  1UD7 A;  1AAR A;  3KUC B;  3M62 B;  3ZNH B;  4JLC A;  1NBF C;  3WIM A;  3DVN V;  3PLU A;  4W9C A;  4ZRK A;  1WE6 A;  2LJ5 A;  1WMH B;  1UBI A;  1HE8 A;  4TKN A;  5E6P A;  4BKS A;  4HDQ A;  1RFA A;  3M95 A;  4G11 A;  3VQI A;  3NS8 A;  3TL5 A;  3H7S A;  2FCN A;  3ML9 A;  2Z0E B;  3MJW A;  2LUE A;  2AL3 A;  4IWO A;  4EEW A;  1XD3 B;  4FJY A;  4RM9 A;  1J19 A;  2KTR A;  2WDT B;  4ICV A;  2O6V A;  3JW0 X;  4FHK A;  2MBQ A;  1U4A A;  1TBE A;  5DCN A;  4LJO B;  4FHJ A;  2BF8 B;  4I6P A;  4N9F 4;  1E8W A;  2O6V D;  2BWF A;  4E3C A;  2KZR A;  1WIA A;  4LDT B;  1KLV A;  4K7S A;  3OLM D;  3VVW B;  5J18 A;  2HD5 B;  2ZEQ A;  1SIF A;  2KMA A;  4PS8 A;  5LLI A;  2LXA A;  3UIN B;  3ONS A;  4A20 A;  1E8X A;  5AEK B;  1WI0 A;  3QJZ A;  2NS5 A;  1C3T A;  3ZW3 A;  3CF6 E;  3UQA A;  2O6V B;  1BT0 A;  1CMX B;  4MDK E;  5E6N A;  3SD5 A;  2JT4 B;  4II2 B;  4ANW A;  3KUZ A;  3Q3J A;  2KK8 A;  2A4Z A;  3V60 A;  1GC7 A;  2L00 B;  5JH5 C;  2IO2 B;  3VTV A;  3W1Y A;  4DHZ E;  2PEA A;  2LRW A;  4JQW C;  3RCZ A;  1WGD A;  3DOW A;  4W9D A;  3RZF A;  3UF8 A;  2V4L A;  2CHX A;  4FN2 A;  2A5U A;  3EHV A;  2MQJ A;  4GSW A;  4X57 B;  2KWV B;  2EKE C;  3PRE A;  1FXT B;  3CSF A;  2N4F A;  3KVF B;  4GIV A;  3H1U A;  5G55 A;  2FIF A;  3TBL D;  2JZZ A;  2J7Q B;  5IA7 A;  3R3M A;  3DBL I;  3OAW A;  2DZM A;  2KDE B;  1WZ0 A;  3N3K B;  1YX5 B;  2GBR A;  1WGY A;  2HTH A;  2KXJ A;  4G3X B;  4JGH B;  2XK5 B;  2LGD A;  3ZO5 B;  5JZE B;  4LJP B;  1P98 A;  2KWC A;  3PGE A;  2D3G A;  1VD2 A;  1Y8R C;  1K8R B;  1E7V A;  2DYM A;  2BYF A;  1RRB A;  3PRM B;  3TJP A;  2C5L C;  2L0F A;  5LXI B;  1P1A A;  2ASQ A;  5J2R A;  3KW5 B;  4NJ6 A;  4DHZ B;  1E8Y A;  3DBS A;  3L08 A;  2J0K A;  2MP2 A;  2GMI C;  2Z0D B;  2OOB B;  2G4D B;  2MBH A;  1V81 A;  3EFU A;  2K8H A;  2JRH A;  2NVU I;  4HWI B;  4NQK E;  4ASW C;  2YLM A;  3S2A A;  1EO6 A;  1H4R A;  2DX5 B;  4GOC A;  4JL9 A;  3ZKJ C;  2G3Q B;  2JXX A;  4GDL A;  3UQB A;  2C7H A;  4EFO A;  2L0T A; 
#chains in the Genus database with same CATH topology
 3PO0 A;  1LQB A;  3APF A;  4WWP A;  4ZHP A;  3URY A;  1EF1 A;  3RZW C;  3ABV B;  2SAK A;  4USA A;  3KYC D;  3B1L X;  1IYF A;  5JHB A;  3ZRF A;  1UBQ A;  4K81 A;  2BS2 B;  2LI5 A;  1NI3 A;  4IC7 B;  2DLB A;  2QSD A;  3BK1 A;  2J53 A;  1F52 A;  4HJG E;  4NAW A;  3R66 C;  3Q3M C;  2NTT A;  1L4D B;  2KMC A;  2KFJ A;  5G2N A;  1V5O A;  4W9E A;  3CMM B;  2PE9 A;  3Q69 A;  1SIJ A;  3A9K B;  5HI1 A;  4B95 A;  3IAS 1;  2LVO A;  3H9D A;  4KZ0 A;  2W3R A;  1L4Z B;  3AUL A;  1JWA D;  2W3S A;  4ZHO A;  4BKS D;  1E7P B;  3AM9 A;  1Q5W B;  2K8C A;  3ZNI D;  2L83 A;  2IJ0 A;  5JHA A;  4WWO A;  3ZJT A;  3WCQ A;  4JWU C;  2PLP A;  2WU5 B;  4TMA B;  1D5M C;  3ZRC A;  3RN9 C;  1EWY C;  2I1K A;  4J6I A;  4RFB A;  2AQ3 B;  4WH4 A;  4A3O A;  5IKC M;  4M01 A;  1E8Z A;  2BB6 A;  5C3J B;  3FC4 A;  4A55 A;  3L10 B;  2KQS A;  3LB8 C;  2IO3 B;  3L54 A;  1KJT A;  1WXS A;  1XXG A;  4WAA A;  4C80 A;  4K1R B;  1OEY A;  1FRD A;  3A9J A;  1WM2 A;  3AE8 B;  4NJ7 A;  1WXM A;  2PE6 B;  2DAF A;  3AEG B;  3PS6 A;  5D7G A;  4P16 A;  1GC6 A;  3AU5 A;  1UH6 A;  1YD8 U;  3AE7 B;  2G9H D;  4JIO U;  1S3S G;  1YNT E;  2WXH A;  1WE7 A;  3H8H A;  1MPE A;  1K50 A;  3TEY A;  4FUL A;  4D2K A;  4GU2 A;  3WAP A;  2GBJ A;  2GBN A;  4HRO A;  1UF0 A;  3BIN A;  4YWG G;  2B3A A;  4YXD B;  1ISN A;  1YN5 A;  1D4B A;  3H7P A;  3R7Q A;  2IDY A;  2IGD A;  3H6N A;  3QAR A;  4K3B A;  4GB9 A;  1TGZ B;  3K9O B;  4NAM A;  1L2N A;  2MCN B;  1TTN A;  2LJI A;  3SR6 A;  4KVG B;  2BKR B;  4FAD A;  1ZDV A;  4N59 A;  3VFK A;  3KH0 A;  3TCA A;  2BPS A;  3ZVV A;  4YL8 A;  2UYZ B;  1PUT A;  5D3D A;  3ZJU A;  4PYU A;  4L23 A;  4NY0 A;  2Y3A A;  1TKY A;  3QWZ B;  3VTU A;  2D3B A;  4BAX A;  2DYB A;  1OEY J;  2BS4 B;  3LXF A;  2ZW1 A;  4MGY E;  4XC2 A;  1I42 A;  4DDI D;  2BT6 A;  2RGF A;  1QF6 A;  2LVP A;  1AWD A;  2K3U A;  3JSV A;  5LXH A;  5H8Y E;  4ZRJ A;  2LHD A;  3RNC C;  2GBK A;  5T8I A;  1YN4 A;  3NHE B;  4KGR A;  1PDX A;  2DNF A;  1RM6 C;  4AWJ A;  4N58 A;  2Y5C A;  2JY6 A;  1JWS D;  1SE4 A;  2ON8 A;  1WGR A;  4GDK A;  2K9X A;  2PMV A;  4KZC A;  2J42 A;  5AZH A;  1WR1 A;  4KGT A;  3VUX A;  1KOT A;  5LNK 1;  1WYW B;  4Q2J A;  1EWC A;  2NPT A;  2PTL A;  2RMM A;  3AE1 B;  2IGG A;  3PZD A;  2MJD A;  3AN1 A;  3DWG C;  1ZKH A;  3U7D A;  1DOI A;  2J0J A;  4NPN A;  3I57 A;  1T3Q A;  1J7C A;  3DBR B;  4I6L B;  3Q3F A;  4NZL B;  4AS1 A;  1E5W A;  5CTR C;  1JRP A;  5D3I B;  2LVQ A;  4BBN F;  2KDM A;  1TZ1 A;  1FO4 A;  1XO3 A;  1PYW D;  2ZPY A;  3PRZ A;  3ZXV A;  4BBN C;  3L0W B;  4TSS A;  1ZXI A;  4NNJ B;  2UWQ A;  1T5X D;  1XCQ L;  4AJW A;  2KQ7 A;  3NRZ A;  3VHT C;  1V5T A;  1AN8 A;  3FIL B;  1N5W A;  5AZF A;  3NVV A;  4B0M A;  3R2I A;  2FNJ B;  4W9H A;  2MBB B;  4KSL C;  3C19 A;  2Y5B B;  1WGK A;  2NTS A;  1R4N B;  2L52 A;  4LNF A;  2CU3 A;  4IM3 A;  4NQL B;  4N6E B;  4K7W A;  4MJS A;  1XLO A;  1GB1 A;  3NVZ A;  4WJN A;  5BYR A;  2BS3 B;  3L13 A;  1VCB A;  4XX5 A;  2LZ6 A;  4IM0 A;  3AE6 B;  1J8C A;  2KT7 A;  4E74 A;  4CYE A;  3VUW A;  1C4A A;  4RGM A;  3IT4 B;  4RF0 A;  3ETR A;  2VZK D;  4II3 B;  2LWP A;  4GN1 A;  1TS2 A;  3T9L A;  2LD9 A;  5D6J B;  2VZK B;  3PPA A;  1UD7 A;  3KUC B;  1WE6 A;  2LJ5 A;  1HE8 A;  5E6P A;  3TL5 A;  2Z0E B;  1SJH D;  4DXG A;  4EEW A;  1AYF A;  4RM9 A;  1J19 A;  2KTR A;  2WXK A;  4MAC A;  2WDT B;  4ICV A;  1F2R C;  1V1O A;  2JSV X;  1T0Q C;  4E3C A;  3I63 C;  2KZR A;  4XDC A;  4LDT B;  3U52 E;  1N60 A;  4K7S A;  5J18 A;  1IGD A;  1SIF A;  3ONS A;  1E8X A;  1WI0 A;  1SJE D;  3CF6 E;  1CMX B;  4MDK E;  5E6N A;  3SD5 A;  4LNI A;  3B2F A;  4II2 B;  5H92 C;  5JH5 C;  1V1P B;  4A9A A;  1L6U A;  4JQW C;  1WGD A;  3UF8 A;  2CHX A;  2L1A A;  1MFW A;  2KN4 A;  4KKJ A;  5EE9 A;  2EKE C;  1BUI C;  3KVF B;  5HHD G;  2J7Q B;  1SE3 A;  2BTE A;  2KDE B;  1XLQ A;  2GBR A;  2XK5 B;  5JZE B;  1P98 A;  1SE2 A;  1VD2 A;  2BYF A;  1YJJ A;  1CQV A;  5LXI B;  1P1A A;  5J2R A;  4C7Y A;  3L08 A;  2MP2 A;  4JPS A;  2VH2 A;  2G4D B;  2MBH A;  4HWI B;  2K8H A;  4ASW C;  3S2A A;  1D5X C;  4EFO A;  1F0Z A;  4XZ4 A;  3P4Q B;  3U8Z A;  2DHZ A;  3QQ8 B;  1OQQ A;  1RAX A;  1I35 A;  4K7U A;  3R2T A;  4CQN A;  1PQS A;  4ICU A;  2L3Z A;  2CKH B;  2D10 A;  1QKZ A;  1FXA A;  5C23 A;  1VZ7 A;  2N9P C;  3Q6B A;  3RUI B;  4W9G A;  2M8S A;  3UGB B;  1GOZ A;  4YSY B;  1P3Q U;  2WXQ A;  2QJL A;  2XBB C;  2M17 A;  3DBL B;  2DEN B;  2WXL A;  2DAJ A;  3M63 B;  2WS3 B;  4DHJ D;  4GMV A;  4DXA B;  3QIJ A;  4KIK B;  2G45 B;  1Q1O A;  2DWQ A;  4NAW B;  5DPR A;  4DHJ B;  5D2M B;  2WX0 A;  2M0A A;  2QMT A;  2ZPN A;  3AE9 B;  3HM6 X;  2K39 A;  1NI2 A;  3HUI A;  4IWQ A;  2I1J A;  1Y56 A;  3V6C B;  2CS4 A;  3MHZ A;  1SE9 A;  3UIP B;  4C00 A;  2RSU A;  2EMT A;  3RI7 C;  2GBM A;  4FJZ A;  1A5R A;  4KDL B;  1JAL A;  3CIR B;  4AP4 C;  3I5J C;  4HK2 A;  2KVZ A;  1I4G A;  3ZXR A;  5CX3 A;  4TQ1 A;  5BMG A;  2IND C;  1E10 A;  2WU2 B;  1JWU D;  2IO0 B;  4LNK A;  1JRU A;  2QIE B;  3GE8 C;  5L95 C;  2MSE D;  2Z59 B;  5HKH A;  3SDL C;  1TIF A;  1RLF A;  3W9C B;  2JZP A;  2BQQ A;  2N9X A;  1BXT A;  2WNM A;  1L7Y A;  1UGM A;  3LDZ E;  2DZI A;  1NEK B;  3EUB 2;  2J0M A;  3AEC B;  1P7F A;  2C7N B;  5FKA C;  1KTK A;  1HXY D;  1SGH A;  2WXJ A;  4FA6 A;  4W9L A;  2O2V A;  4IUM B;  3QHT A;  2REX A;  5C1Z A;  4PS7 A;  2LAS A;  4EZK A;  1E0Z A;  1LM8 B;  5FK9 C;  2LGI A;  4DQO C;  3DHI C;  4FJV B;  4HLE A;  2FCM A;  3BVG A;  2ZVN A;  1VJK A;  1WRD B;  2N7D A;  3BII D;  1ZUD 2;  2LXC A;  1DOY A;  1KFY B;  3H7P B;  3Q8E A;  1QT9 A;  4ZRQ A;  2IZV B;  2PPH A;  4PS3 A;  4AJY B;  4DK5 A;  2KO3 A;  2NBU A;  2ZZP B;  2KLC A;  3AE5 B;  4RGN A;  2AEH A;  2TSS A;  1UEL A;  1WSP A;  2KD0 A;  1FM0 D;  3EFC A;  3QK0 A;  3IVF A;  3APC A;  3VDZ A;  2L7R A;  2VRR B;  4I6N B;  1L6V A;  3A1Q A;  2C60 A;  4B0E A;  4MT5 A;  2D3C A;  4A3P A;  3FKY A;  1WZ3 A;  1F9J A;  1H8C A;  2JU6 X;  3L17 A;  4RMA A;  2CHW A;  4RH6 A;  1GUA B;  1MG8 A;  1Z5S B;  1R4M B;  2KJR A;  1LXD A;  2KNB A;  5TSS A;  1C1Y B;  2ZW0 A;  4ZYN A;  1WH3 A;  3T8M A;  4RCO A;  2EKI A;  4IW0 A;  4E71 A;  3JSV B;  3IHP C;  4WIP A;  2L76 A;  4KKI A;  2WXG A;  3NOB A;  3IXS A;  5G5G A;  4WQM A;  5D94 A;  3DHG C;  3C0R B;  2AX5 A;  1FNW A;  2KKC A;  4LCD E;  5TR5 A;  1YOV B;  3NJT A;  3PLV A;  2QDF A;  2OJW A;  2CR5 A;  1GG3 A;  2AL6 A;  4GDK B;  2L8J A;  4ZRI A;  3W1S A;  3PVL A;  3GB1 A;  3TEX A;  4TUU A;  3GOE A;  3NUH B;  3IT6 B;  1FFU A;  2N7J A;  2FCQ A;  1WJN A;  3MC8 A;  2NPT B;  4EKU A;  3KWV A;  2B76 B;  3P4R B;  5G5H A;  1QOA A;  2HE7 A;  4TV3 A;  4WJP A;  3ZTC A;  3VUY A;  3R7R A;  2JUO A;  2JQR B;  1WXQ A;  4JWS C;  1L0V B;  2M19 A;  4WQO B;  1V6E A;  3ZUN A;  3M3J A;  2N9K A;  2RD0 A;  1JWB D;  4OZC A;  2ZVO A;  2HDE A;  2WXM A;  2JWU A;  3AE4 B;  1WM3 A;  1X1M A;  3PSE B;  3EEC A;  3VTW A;  2KVR A;  3WA0 A;  1DOX A;  1TS4 A;  4AUQ C;  5L83 A;  2KN5 A;  4HXD A;  1GJZ A;  3UIO B;  1F77 A;  3AE2 B;  4B6W A;  2AQ2 B;  2JWZ A;  1IGC A;  1CK1 A;  1OTR B;  2INC C;  5E6J A;  2WYQ A;  4OVV A;  3I3T B;  3W5U B;  4YT0 B;  4A90 A;  1FRR A;  4GGQ A;  2W9N A;  2LUM A;  2LFI A;  2M0X A;  4G50 A;  2FCS A;  4MJS B;  1E90 A;  3B2G A;  3RT3 B;  1PGB A;  3VXW A;  3WAM A;  1FNU A;  4FXC A;  1ZGU B;  2CHZ A;  1D6E C;  1IPG A;  1TKG A;  2YEP F;  4IKG A;  2KOX A;  4HJK A;  4DBG A;  5BYQ A;  3HRD D;  3X0W A;  2LRU A;  4BZA A;  1NYR A;  2MH7 A;  4S17 A;  2DZJ A;  2GOW A;  3RNG C;  1AAR A;  3M62 B;  3P42 A;  4JLC A;  1NBF C;  2JYE A;  3DVN V;  1WMH B;  3VRB B;  4NJC A;  1XCT L;  1TY2 A;  2BBC A;  4BKS A;  3M95 A;  4G11 A;  1FD6 A;  4ARC A;  2ICI A;  3NS8 A;  3H7S A;  3P1M A;  4RGT A;  2LUE A;  2AL3 A;  4IWO A;  1KF6 B;  4C4V A;  2L32 A;  3Q2A C;  3Q3N C;  2K22 A;  3NG0 A;  4FHK A;  4PK1 A;  1U4A A;  2HTM E;  1TBE A;  4YSX B;  4N9F 4;  4I6P A;  2WXP A;  2Z8L A;  3N1Y C;  1WIA A;  3AED B;  3OLM D;  3VVW B;  2WLB A;  2HD5 B;  2ZEQ A;  4PS8 A;  5LLI A;  1V8C A;  5AEK B;  4A20 A;  1SXT A;  1MVK A;  2GB1 A;  1C3T A;  1C79 A;  1FCL A;  2RDH A;  3AEE B;  3VTV A;  3OWE B;  3E56 A;  3RCZ A;  3RZF A;  1K53 A;  2MQJ A;  4GSW A;  4X57 B;  1L0X B;  1L0Y B;  2KWV B;  3RNE C;  2OED A;  4REZ A;  3PRE A;  5G55 A;  3H1U A;  2LMC A;  2JZZ A;  3R3M A;  4XDD A;  1KH0 A;  2DZM A;  1YX5 B;  2W54 A;  1VZ6 A;  3ZO5 B;  4ACF A;  3PGE A;  1Y8R C;  1E7V A;  1K52 A;  2ASQ A;  2H88 B;  1HZ5 A;  2J0K A;  1FFV A;  2PVG C;  3EFU A;  2NVU I;  4NQK E;  2YLM A;  1EO6 A;  1H4R A;  3ZKJ C;  4GDL A;  2QEJ C;  2C7H A;  4W9J A;  3Q3O C;  3P4P B;  1KLG D;  2MP2 B;  5KHO A;  4XGA B;  2KX0 A;  4ARI A;  2L05 A;  1IP9 A;  2KFK A;  3DVN U;  3NVW A;  2QCZ A;  3FAH A;  1WXV A;  5IO9 A;  1FIQ A;  4ZDV A;  5I4D A;  2HJ8 A;  3AEB B;  2V3S A;  4ANX A;  3KUD B;  4P1B C;  2ZCB A;  2WXI A;  1FXI A;  4BKG A;  3KYD D;  1OQR A;  1HA5 A;  3ALB A;  1TJE A;  2JXT A;  2X38 A;  3DWM A;  3JYU A;  4MSQ B;  1ZE3 D;  3AU4 A;  2MRP A;  3QCA A;  4HPP A;  2JF5 A;  4L1B A;  4KX6 B;  2RDB C;  2OJR A;  2BVC A;  2BYV E;  3OJ4 B;  2Q5W D;  2YEP B;  2PJH A;  1EF5 A;  2IGH A;  2KC1 A;  2J4X A;  3ENE A;  4GLS C;  1JML A;  1WY8 A;  3RNF C;  4RM8 A;  4M8M A;  2I38 A;  2N1V A;  4ZYS A;  1JCK B;  1GNU A;  2C9W B;  4IG7 B;  1P0R A;  3MFG A;  4W9F A;  3IBE A;  4MEM A;  4EOY A;  1ZW7 A;  2XN9 C;  4WWN A;  3MC0 B;  2JX5 A;  3IAM 1;  2WDV B;  2D5G A;  2MEK A;  2JPH A;  4PYZ A;  3BY4 B;  3ZDT A;  4WWM A;  1IBX B;  3FIL A;  2MW5 A;  4UDU C;  4TQ0 A;  3CST A;  1STE A;  3P63 A;  1NVI D;  1TY0 A;  2FBW B;  1IUE A;  4A6Q A;  4EZL A;  4CHK A;  2LEK A;  2MA9 B;  1WRI A;  3NZ3 A;  3WAL A;  4GXB A;  2KJH B;  1TS5 A;  1WWT A;  2KLG A;  2ONQ A;  1N5X A;  1OQY A;  3ZNG C;  1XEE A;  2R2Q A;  2BKF A;  4HPM B;  2M4N A;  3EA6 A;  1EM7 A;  1JWM D;  2KYW A;  1N63 A;  3ZLZ A;  3B08 A;  1RYJ A;  1SF0 A;  1WXA A;  2WX1 A;  2MLB A;  2KQ4 X;  2O2V B;  3QA8 A;  2WXR A;  5HFY A;  2D2Q A;  3J9C A;  4HCP B;  4XE0 A;  4WUR A;  4BKT A;  4DXF A;  5E6O A;  1J0G A;  1UUP A;  2V4I B;  3DBR I;  4RNA A;  3OJ3 A;  3MJ5 A;  1WGG A;  1GAQ B;  2GI9 A;  1ZDX A;  3IFW B;  3O65 B;  2J52 A;  1YQ4 B;  4MSM B;  2YVC A;  2KJ6 A;  2MJE A;  1D5Z C;  4J3O D;  2GLS A;  4EUT A;  1WR6 E;  3ZGZ A;  1C77 A;  1RWS A;  3A1Q B;  3DPD A;  3GZN I;  4W9K A;  1WJ4 A;  3N30 A;  1ZXH A;  3X23 A;  4BOS C;  2V0G A;  2MHJ A;  3BK2 A;  4JE3 B;  3Q8F A;  3ECI A;  4MGI E;  2KMM A;  2V9H A;  3T3N A;  1HTO A;  1ZPS A;  4LTU A;  3IG3 A;  2WXF A;  3U2S C;  1R4N I;  3A4S C;  3DHH C;  2JZ3 B;  2IPK D;  2KWU B;  5FR6 A;  3RYT A;  2EMS A;  1V1P A;  1V9J A;  3W2D A;  2DZK A;  4MGK E;  3BWU D;  1P9D U;  3B9J A;  1I4H A;  4MH8 A;  4MEL A;  2KHW B;  2XK5 A;  1JW9 D;  5IOI A;  3A9J B;  3L16 A;  2N7E A;  4FLH A;  3A33 B;  2KDF B;  5KHQ A;  1LFD A;  1TT5 B;  5HG2 A;  1I4P A;  2V1Y A;  1Z2M A;  4YTP B;  4ANU A;  3JVZ X;  3APD A;  4IM2 A;  3AI5 A;  2WWZ A;  3VR9 B;  2ZNV B;  1WX9 A;  1S1Q B;  2KX3 A;  4M0W A;  2EEL A;  2V3N A;  2ZJD A;  3PTF C;  1J7A A;  3ML8 A;  3PHW B;  2DYO A;  2DBY A;  2ZCC A;  2BYT A;  1WX8 A;  5EE0 A;  1N62 A;  5GMV A;  3ZDM C;  2R61 A;  4HRS A;  1KRH A;  3W5V B;  3DVG X;  3PV1 A;  3DCG A;  1V80 A;  1I4Q A;  1ZOY B;  4F8C B;  3RPF C;  2GRI A;  4O1N A;  2IO1 B;  3P4S B;  1VZ8 A;  3ZIM A;  1Q0W B;  3DBH I;  4KV2 A;  2PW9 A;  2N9E B;  3BVM A;  3AEA B;  4MM3 A;  3NZS A;  4JX1 C;  2IBI B;  3HHM A;  2K1F A;  3RNA C;  3RMK C;  2M1M A;  4KIK A;  3CWI A;  2AYO B;  2PVO D;  1FMA D;  1JRO A;  3HK0 A;  5CHW A;  5IN7 A;  1NYQ A;  2E3T A;  2MX2 A;  3AV8 A;  2NMQ A;  2WDQ B;  1ET9 A;  3ZNH B;  3PLU A;  1PFD A;  3N20 C;  3N1Z C;  1UBI A;  2FUG 1;  4TKN A;  3PZ7 A;  4YTN B;  3VQI A;  2VH1 A;  1SBB B;  1SB3 C;  2O6V A;  2UU7 A;  3JW0 X;  1CJE A;  3KWL A;  3AB5 A;  2MBQ A;  1YQ3 B;  5DCN A;  4LJO B;  4FHJ A;  3GP7 A;  4EE2 A;  1KLV A;  1ACC A;  1J7B A;  4OZA A;  1YN3 A;  2KMA A;  2LXA A;  4C4V B;  3QJZ A;  3ZW3 A;  3UQA A;  1BT0 A;  2KAC A;  4US8 A;  4ANW A;  3Q3J A;  3V60 A;  2L00 B;  2IO2 B;  1NEN B;  2QIL A;  4US9 A;  1AW7 A;  2PEA A;  2LRW A;  3DOW A;  4AQ7 A;  4IOI E;  3VRA B;  3EHV A;  1FPY A;  2MJ3 A;  5BMH A;  1K51 A;  3R8B A;  4ZOH C;  1FXT B;  4GIV A;  1SEB D;  3TBL D;  3U4E G;  3DBL I;  2FE8 A;  3N3K B;  2HTH A;  4G3X B;  4JGH B;  5EE3 A;  2LGD A;  3HVD A;  4LJP B;  4C7Z A;  1Q10 A;  1K8R B;  2DYM A;  1RRB A;  3PRM B;  3TJP A;  2L0F A;  2D3A A;  3KW5 B;  3DBS A;  4H2A A;  2Z0D B;  1FCC C;  2OOB B;  1V81 A;  1N61 A;  4JL9 A;  1TS3 A;  2JXX A;  1UZX B;  2LGS A;  5EE1 A;  3UQB A;  4IWP A;  2C7M B;  3TUO A;  4S0R A;  2WGS A;  1VRA B;  3N1X C;  4KSK C;  4OZB A;  3SFD B;  3MC9 A;  1XF5 L;  4L2Y A;  3A9K A;  4GDL B;  3OG5 A;  1L5P A;  2WXN A;  1HTQ A;  4MH0 E;  1F2R I;  1DYQ A;  3D32 A;  1GPX A;  4CO7 A;  1C4P A;  3A4R A;  2KFK B;  4EZJ A;  4BFR A;  3N9Y C;  3BYY B;  1CZP A;  2LGY A;  1OGW A;  1UWM A;  3U30 A;  4HPL B;  1V49 A;  2QC8 A;  4HKZ E;  2RPV A;  1XLN A;  4FBJ B;  2CJO A;  5IAA C;  3TIX A;  1D3Z A;  1C78 A;  1EU4 A;  3DDC B;  1BML C;  3UI3 A;  1E7U A;  3ZNZ B;  1YIW A;  1QQR A;  3MTN B;  1MI0 A;  2K8B A;  1YQB A;  1V97 A;  1M4V A;  2NBW B;  3QC8 B;  4BVU C;  3HVZ A;  2AWT A;  4HCN B;  3QAQ A;  2BB5 A;  4OVZ A;  2JRI B;  4WJO A;  2KTR B;  1FEH A;  1WGH A;  2N0S B;  2MBO A;  2LGX A;  3Q14 C;  1T0R C;  1KM7 A;  3T3O A;  4HVB A;  4HEA 1;  2WDR B;  4C56 C;  4PT5 A;  1UNS A;  1ROE A;  2NCN A;  3MHS D;  2PKO A;  3VH3 B;  3V61 A;  3V6E B;  4OVU A;  2JYT A;  1QLB B;  2BW2 A;  4K3C A;  3VH4 B;  2W55 A;  3Q8B A;  3SEB A;  2CU1 A;  2D07 B;  2XNA C;  4DWF A;  3ZTD A;  3C8Y A;  3WAO A;  2RPQ A;  3Q8C A;  3GZN B;  4P1C C;  1R4M I;  4M8N A;  1MHX A;  3BZD B;  3VAW A;  1T0Y A;  3EC8 A;  3NVY A;  5BYS A;  3QX1 A;  5IP4 D;  1M94 A;  1QIL A;  1DGJ A;  4G0N B;  1XT9 B;  3MP9 A;  1KLU D;  4AOF A;  3V62 A;  1WF9 A;  4MGZ E;  5CHV C;  2KC2 A;  3NY5 A;  5JXV A;  2WXO A;  2KTF A;  5AUI A;  2KDI A;  1V86 A;  4M00 A;  2BGF A;  5MPO A;  1YX6 B;  2FUH B;  3N32 A;  4HDO A;  3KLS X;  1QOG A;  3V05 A;  2CJN A;  1LO5 D;  1I4R A;  1QOB A;  2M56 B;  1G6J A;  3AXC A;  3ZQ4 A;  1YJ1 A;  1WMH A;  1WX7 A;  3P2B A;  2D11 A;  4URK A;  1ZP0 B;  4YTM B;  4OW0 A;  4ANV A;  2I2Y A;  3LYY A;  5CHF A;  2FID A;  1MJD A;  4DDG D;  3PRP B;  1TZO A;  3V3X A;  4RF1 A;  5DPW A;  4WJQ A;  4F7Z A;  3RUL A;  1B1Z A;  4XYC A;  3L4P A;  2R2O A;  3E9S A;  4LNO A;  3LJ3 A;  4KDI C;  1C4C A;  3RD2 A;  5EDS A;  2KDB A;  4W9I A;  3TMP B;  4IDI A;  4LDT D;  3W1S C;  1I4X A;  1T0S C;  1WFY A;  4LK0 M;  2XEW A;  3NZU A;  3VR8 B;  2IYD B;  4A8X C;  3AE3 B;  2Y5P A;  3U7Z A;  3DBH B;  3WAN A;  3ZYY X;  2LHE A;  2QHO A;  1TYG B;  2K6Q A;  5J17 A;  3PT2 B;  1T6B X;  2N1W A;  2ZNV C;  2NR2 A;  1QOF A;  2K6D B;  3KQ4 A;  3HM3 A;  2BWE S;  2E6X A;  2IY1 B;  4B9K A;  4RGO S;  4F1S A;  5BO4 B;  2K25 A;  4OHJ A;  2HJ1 A;  1VDV A;  3B0A A;  1NDD A;  1FNV A;  5BMI A;  5GXG B;  2MWS B;  1SSN A;  3BYT B;  2KWD A;  3PHX B;  3GE3 C;  1WJ6 A;  2RR9 A;  3SHQ A;  1P7E A;  4LLG M;  4XWT A;  4WAF A;  1EUV B;  1YJI A;  2IY0 B;  2FAZ A;  3I9V 1;  1QZE A;  3Q8A A;  4LNN A;  4M0W B;  4HKQ A;  2SEB D;  5AUK A;  1XLP A;  4YSZ B;  4P6V F;  2JVC A;  3RFZ B;  4M02 A;  1GB4 A;  3SU8 X;  1V2Y A;  2OHF A;  3DQV A;  1ENF A;  5AZG A;  1XQQ A;  1VLB A;  1RFK A;  2NBV B;  5DPT A;  4BOZ B;  4QAY A;  2MBE A;  1WJU A;  2G4S A;  3AMZ A;  5DPS A;  3K9P B;  1OFF A;  1HQR D;  3BVZ A;  3HIZ A;  1I7H A;  3AEF B;  3DVG Y;  1HZ6 A;  2G1E A;  3PZ8 A;  4MM3 B;  2KAJ A;  2KAN A;  1B9R A;  4ITK A;  1VR9 A;  2BYE A;  3WIM A;  4ZRK A;  4W9C A;  2ACZ B;  3EGR A;  3AH7 A;  2AQ1 B;  3NS1 A;  4XWW A;  1PGA A;  4HDQ A;  2K0P A;  1RFA A;  2WHI A;  1C9F A;  2FCN A;  3ML9 A;  3MJW A;  1LGR A;  1YMH E;  1XD3 B;  4FJY A;  2WQY B;  2N9L A;  1F1H A;  3TSS A;  1R7S A;  2WP9 B;  2BF8 B;  1ET6 A;  1MHH E;  1E8W A;  2O6V D;  2BWF A;  1A70 A;  1E9M A;  4R3D A;  1N6Z A;  2X8X X;  3UIN B;  2INP E;  2PIA A;  2NS5 A;  1HEZ E;  2O6V B;  1UGJ A;  2JT4 B;  3KUZ A;  2KK8 A;  2A4Z A;  1ESF A;  2K5P A;  1GC7 A;  3O13 A;  1PGX A;  5FR3 A;  1E6E B;  3W1Y A;  4DHZ E;  1IBX A;  2W82 A;  3TEW A;  4W9D A;  2V4L A;  1EU3 A;  4FN2 A;  2A5U A;  5C2T B;  3TEZ A;  1MG4 A;  2V3P A;  1UWX A;  3SFE B;  3CSF A;  2N4F A;  2RDG A;  2FIF A;  5IA7 A;  1WYG A;  3OAW A;  1WZ0 A;  1WGY A;  2KXJ A;  3RNB C;  3GS2 A;  2KWC A;  4ZRP A;  2D3G A;  1C76 A;  1TKE A;  2C5L C;  2H89 B;  4KGS A;  4DHZ B;  4NJ6 A;  1E8Y A;  2INN E;  1JQ4 A;  2GMI C;  2JRH A;  3ZJV A;  2DX5 B;  4GOC A;  2G3Q B;  4P7I A;  2L0T A; 
#chains in the Genus database with same CATH homology
 4XZ4 A;  1LQB A;  3U8Z A;  2DHZ A;  4IWP A;  3APF A;  3QQ8 B;  2C7M B;  4WWP A;  1RAX A;  1I35 A;  4K7U A;  4KSK C;  1PQS A;  2MP2 B;  5KHO A;  1EF1 A;  4ICU A;  2KX0 A;  3RZW C;  2L3Z A;  2CKH B;  2L05 A;  1IP9 A;  2D10 A;  2KFK A;  3DVN U;  3KYC D;  3B1L X;  1IYF A;  5JHB A;  4ZDV A;  1WXV A;  3A9K A;  2HJ8 A;  3ZRF A;  2V3S A;  4GDL B;  5C23 A;  4ANX A;  3KUD B;  1UBQ A;  2N9P C;  4K81 A;  3RUI B;  4W9G A;  2LI5 A;  2ZCB A;  4IC7 B;  4MH0 E;  2M8S A;  3UGB B;  3D32 A;  4BKG A;  3KYD D;  4NAW A;  3R66 C;  5G2N A;  2KMC A;  2KFJ A;  4CO7 A;  1P3Q U;  2XBB C;  2M17 A;  1V5O A;  2KFK B;  3A4R A;  2DEN B;  3CMM B;  2PE9 A;  4W9E A;  4BFR A;  4EZJ A;  3ALB A;  2DAJ A;  3M63 B;  3A9K B;  3JYU A;  4B95 A;  4MSQ B;  4DHJ D;  2LVO A;  2LGY A;  1OGW A;  3H9D A;  3AU4 A;  4KZ0 A;  4GMV A;  2MRP A;  3QCA A;  4HPL B;  3U30 A;  1V49 A;  4DXA B;  2JF5 A;  3QIJ A;  4FBJ B;  4KIK B;  2G45 B;  1Q1O A;  5IAA C;  3TIX A;  3AUL A;  1D3Z A;  4NAW B;  5DPR A;  3DDC B;  4DHJ B;  2OJR A;  5D2M B;  2WX0 A;  2BYV E;  3OJ4 B;  1E7U A;  4BKS D;  2PJH A;  3ZNZ B;  1YIW A;  2ZPN A;  1EF5 A;  1Q5W B;  2K8C A;  3MTN B;  3ZNI D;  3HM6 X;  2K39 A;  2K8B A;  2KC1 A;  1NI2 A;  4IWQ A;  3VTW A;  1YQB A;  2I1J A;  5JHA A;  3V6C B;  2CS4 A;  4WWO A;  3ENE A;  1SE9 A;  3UIP B;  2NBW B;  1WY8 A;  2RSU A;  3QC8 B;  4BVU C;  2EMT A;  4RM8 A;  3ZRC A;  2GBM A;  4FJZ A;  4M8M A;  2I1K A;  2AWT A;  1A5R A;  4KDL B;  4HCN B;  3QAQ A;  2N1V A;  1GNU A;  2C9W B;  4J6I A;  4AP4 C;  4A3O A;  4IG7 B;  1E8Z A;  2JRI B;  4HK2 A;  4WJO A;  2KTR B;  1P0R A;  1WGH A;  3L10 B;  2KQS A;  4W9F A;  2IO3 B;  5CX3 A;  3IBE A;  3L54 A;  2MBO A;  4TQ1 A;  4MEM A;  2LGX A;  1KJT A;  1WXS A;  4EOY A;  2IO0 B;  1KM7 A;  4WAA A;  4HVB A;  1ZW7 A;  1JRU A;  4WWN A;  4K1R B;  1OEY A;  3A9J A;  5L95 C;  1WM2 A;  2MSE D;  2Z59 B;  4NJ7 A;  1WXM A;  4P7I A;  5HKH A;  2PE6 B;  2DAF A;  3PS6 A;  3SDL C;  5D7G A;  1GC6 A;  2NCN A;  3AU5 A;  3MHS D;  1RLF A;  3VH3 B;  2JPH A;  1UH6 A;  3V61 A;  1YD8 U;  4PYZ A;  3V6E B;  2N9X A;  4OVU A;  3BY4 B;  4JIO U;  1L7Y A;  1UGM A;  3ZDT A;  1S3S G;  2MW5 A;  1WE7 A;  3LDZ E;  4TQ0 A;  3VH4 B;  3CST A;  2DZI A;  4FUL A;  4GU2 A;  3WAP A;  2GBJ A;  2J0M A;  2CU1 A;  2D07 B;  2GBN A;  4DWF A;  2C7N B;  4EZL A;  3ZTD A;  4CHK A;  2MA9 B;  3BIN A;  2B3A A;  3WAL A;  1SGH A;  4GXB A;  2KJH B;  4FA6 A;  2KLG A;  2RPQ A;  2O2V A;  1ISN A;  4W9L A;  3WAO A;  1R4M I;  1OQY A;  4IUM B;  3H7P A;  3QHT A;  2REX A;  3R7Q A;  5C1Z A;  4PS7 A;  4M8N A;  2LAS A;  3ZNG C;  4EZK A;  3H6N A;  3QAR A;  2R2Q A;  1LM8 B;  4GB9 A;  1TGZ B;  2BKF A;  3K9O B;  3VAW A;  4HPM B;  1L2N A;  1T0Y A;  3EC8 A;  2MCN B;  1TTN A;  3QX1 A;  2M4N A;  1M94 A;  4FJV B;  4KVG B;  2BKR B;  4FAD A;  2FCM A;  4HLE A;  4G0N B;  2ZVN A;  3VFK A;  1WRD B;  3KH0 A;  3TCA A;  1XT9 B;  3B08 A;  3ZLZ A;  1WXA A;  2BPS A;  3ZVV A;  2WX1 A;  2N7D A;  4YL8 A;  2MLB A;  2UYZ B;  2LXC A;  4AOF A;  2O2V B;  3V62 A;  1WF9 A;  4MGZ E;  5CHV C;  2KC2 A;  3NY5 A;  3H7P B;  3QA8 A;  4PYU A;  2KTF A;  2D2Q A;  2IZV B;  4NY0 A;  2PPH A;  4HCP B;  2KDI A;  4PS3 A;  4BKT A;  4AJY B;  4DK5 A;  5E6O A;  1V86 A;  2KO3 A;  2NBU A;  2BGF A;  2ZZP B;  1J0G A;  2KLC A;  1YX6 B;  3QWZ B;  3VTU A;  2AEH A;  2FUH B;  1UEL A;  3N32 A;  2DYB A;  1OEY J;  2KD0 A;  4HDO A;  3DBR I;  3OJ3 A;  3QK0 A;  4MGY E;  3IVF A;  4XC2 A;  1I42 A;  4DDI D;  3APC A;  2RGF A;  3VDZ A;  2L7R A;  2VRR B;  2LVP A;  1WGG A;  4I6N B;  1G6J A;  3AXC A;  3A1Q A;  2C60 A;  1YJ1 A;  3IFW B;  3O65 B;  4A3P A;  1WZ3 A;  4MSM B;  1F9J A;  3JSV A;  1WMH A;  1WX7 A;  2YVC A;  3P2B A;  2KJ6 A;  1H8C A;  2D11 A;  4URK A;  5LXH A;  3L17 A;  4ZRJ A;  4W9J A;  4EUT A;  1WR6 E;  4RMA A;  2CHW A;  1GUA B;  4ANV A;  1MG8 A;  2GBK A;  2FID A;  5CHF A;  1UZX B;  1Z5S B;  4DDG D;  2KJR A;  3PRP B;  1LXD A;  2KNB A;  3NHE B;  1C1Y B;  4AWJ A;  3A1Q B;  4ZYN A;  3DPD A;  1WH3 A;  5DPW A;  3T8M A;  3GZN I;  4WJQ A;  4F7Z A;  4W9K A;  1WJ4 A;  3N30 A;  3RUL A;  4IW0 A;  2JY6 A;  3JSV B;  4E71 A;  3X23 A;  1WGR A;  4BOS C;  2R2O A;  3IHP C;  4GDK A;  3ECI A;  2L76 A;  4MGI E;  4KZC A;  3NOB A;  5AZH A;  1WR1 A;  3LJ3 A;  4KDI C;  3VUX A;  3RD2 A;  5EDS A;  1KOT A;  5D94 A;  2KDB A;  1WYW B;  3C0R B;  3IG3 A;  4W9I A;  3TMP B;  2KKC A;  1R4N I;  3A4S C;  2NPT A;  4LDT D;  4LCD E;  2JZ3 B;  5TR5 A;  3W1S C;  3PLV A;  3PZD A;  2KWU B;  2CR5 A;  1GG3 A;  2AL6 A;  4GDK B;  1ZKH A;  5FR6 A;  1WFY A;  2L8J A;  3RYT A;  3U7D A;  4ZRI A;  2XEW A;  3NZU A;  3W1S A;  3PVL A;  2EMS A;  1V9J A;  2IYD B;  2J0J A;  2DZK A;  4NPN A;  4TUU A;  4MGK E;  3GOE A;  3WAN A;  1P9D U;  4I6L B;  2FCQ A;  3Q3F A;  1WJN A;  2NPT B;  2K6Q A;  2QHO A;  5J17 A;  4EKU A;  3PT2 B;  4MEL A;  2KHW B;  2N1W A;  1E5W A;  2ZNV C;  2NR2 A;  2K6D B;  5CTR C;  2LVQ A;  4BBN F;  3HM3 A;  2HE7 A;  4TV3 A;  2BWE S;  1TZ1 A;  4WJP A;  3ZTC A;  2XK5 A;  2ZPY A;  2IY1 B;  3PRZ A;  4BBN C;  3VUY A;  3A9J B;  2JUO A;  3R7R A;  4B9K A;  3L16 A;  2N7E A;  4FLH A;  4F1S A;  5BO4 B;  3L0W B;  2K25 A;  3A33 B;  2KDF B;  5KHQ A;  3B0A A;  1LFD A;  4NNJ B;  2UWQ A;  2V1Y A;  1Z2M A;  4AJW A;  4WQO B;  1NDD A;  1V6E A;  4ANU A;  2KQ7 A;  3JVZ X;  3ZUN A;  3M3J A;  3VHT C;  2RD0 A;  3APD A;  1V5T A;  4IM2 A;  3AI5 A;  2ZVO A;  2MWS B;  2WWZ A;  5AZF A;  2ZNV B;  1WX9 A;  1S1Q B;  2KX3 A;  1WM3 A;  3PHX B;  2FNJ B;  2ZJD A;  3PTF C;  4W9H A;  2MBB B;  4KSL C;  1WJ6 A;  1X1M A;  2RR9 A;  2DYO A;  3EEC A;  3ML8 A;  2ZCC A;  3PHW B;  2Y5B B;  3PSE B;  3SHQ A;  2KVR A;  1EUV B;  3WA0 A;  1WX8 A;  2IY0 B;  5GMV A;  3ZDM C;  2FAZ A;  4AUQ C;  4IM3 A;  4NQL B;  5L83 A;  2KN5 A;  1QZE A;  4HXD A;  1GJZ A;  4K7W A;  4MJS A;  3UIO B;  3DVG X;  3PV1 A;  3DCG A;  4WJN A;  4M0W B;  1V80 A;  4B6W A;  2JWZ A;  4F8C B;  1OTR B;  2WYQ A;  2IO1 B;  4OVV A;  3I3T B;  2JVC A;  3L13 A;  1VCB A;  4XX5 A;  3ZIM A;  1Q0W B;  3SU8 X;  1V2Y A;  4GGQ A;  3DQV A;  2LZ6 A;  2W9N A;  3DBH I;  4KV2 A;  2N9E B;  1XQQ A;  4IM0 A;  2M0X A;  5AZG A;  2NBV B;  4MM3 A;  5DPT A;  1J8C A;  4G50 A;  2FCS A;  4BOZ B;  4MJS B;  3NZS A;  4E74 A;  1E90 A;  4CYE A;  3VUW A;  2IBI B;  2MBE A;  3RT3 B;  1WJU A;  3HHM A;  3VXW A;  3WAM A;  2K1F A;  2G4S A;  1ZGU B;  2CHZ A;  1IPG A;  2M1M A;  4II3 B;  3K9P B;  5DPS A;  4KIK A;  2KOX A;  4HJK A;  4DBG A;  2LWP A;  4GN1 A;  2AYO B;  3HIZ A;  3T9L A;  3X0W A;  2LRU A;  2LD9 A;  3HK0 A;  5CHW A;  3DVG Y;  5D6J B;  2MX2 A;  2DZJ A;  2KAN A;  2GOW A;  2BYE A;  3PPA A;  1UD7 A;  1AAR A;  3KUC B;  3M62 B;  3ZNH B;  4JLC A;  1NBF C;  3WIM A;  3DVN V;  3PLU A;  4W9C A;  4ZRK A;  1WE6 A;  2LJ5 A;  1WMH B;  1UBI A;  1HE8 A;  4TKN A;  5E6P A;  4BKS A;  4HDQ A;  1RFA A;  3M95 A;  4G11 A;  3VQI A;  3NS8 A;  3TL5 A;  3H7S A;  2FCN A;  3ML9 A;  2Z0E B;  3MJW A;  2LUE A;  2AL3 A;  4IWO A;  4EEW A;  1XD3 B;  4FJY A;  4RM9 A;  1J19 A;  2KTR A;  2WDT B;  4ICV A;  2O6V A;  3JW0 X;  4FHK A;  2MBQ A;  1U4A A;  1TBE A;  5DCN A;  4LJO B;  4FHJ A;  2BF8 B;  4I6P A;  4N9F 4;  1E8W A;  2O6V D;  2BWF A;  4E3C A;  2KZR A;  1WIA A;  4LDT B;  1KLV A;  4K7S A;  3OLM D;  3VVW B;  5J18 A;  2HD5 B;  2ZEQ A;  1SIF A;  2KMA A;  4PS8 A;  5LLI A;  2LXA A;  3UIN B;  3ONS A;  4A20 A;  1E8X A;  5AEK B;  1WI0 A;  3QJZ A;  2NS5 A;  1C3T A;  3ZW3 A;  3CF6 E;  3UQA A;  2O6V B;  1BT0 A;  1CMX B;  4MDK E;  5E6N A;  3SD5 A;  2JT4 B;  4II2 B;  4ANW A;  3KUZ A;  3Q3J A;  2KK8 A;  2A4Z A;  3V60 A;  1GC7 A;  2L00 B;  5JH5 C;  2IO2 B;  3VTV A;  3W1Y A;  4DHZ E;  2PEA A;  2LRW A;  4JQW C;  3RCZ A;  1WGD A;  3DOW A;  4W9D A;  3RZF A;  3UF8 A;  2V4L A;  2CHX A;  4FN2 A;  2A5U A;  3EHV A;  2MQJ A;  4GSW A;  4X57 B;  2KWV B;  2EKE C;  3PRE A;  1FXT B;  3CSF A;  2N4F A;  3KVF B;  4GIV A;  3H1U A;  5G55 A;  2FIF A;  3TBL D;  2JZZ A;  2J7Q B;  5IA7 A;  3R3M A;  3DBL I;  3OAW A;  2DZM A;  2KDE B;  1WZ0 A;  3N3K B;  1YX5 B;  2GBR A;  1WGY A;  2HTH A;  2KXJ A;  4G3X B;  4JGH B;  2XK5 B;  2LGD A;  3ZO5 B;  5JZE B;  4LJP B;  1P98 A;  2KWC A;  3PGE A;  2D3G A;  1VD2 A;  1Y8R C;  1K8R B;  1E7V A;  2DYM A;  2BYF A;  1RRB A;  3PRM B;  3TJP A;  2C5L C;  2L0F A;  5LXI B;  1P1A A;  2ASQ A;  5J2R A;  3KW5 B;  4NJ6 A;  4DHZ B;  1E8Y A;  3DBS A;  3L08 A;  2J0K A;  2MP2 A;  2GMI C;  2Z0D B;  2OOB B;  2G4D B;  2MBH A;  1V81 A;  3EFU A;  2K8H A;  2JRH A;  2NVU I;  4HWI B;  4NQK E;  4ASW C;  2YLM A;  3S2A A;  1EO6 A;  1H4R A;  2DX5 B;  4GOC A;  4JL9 A;  3ZKJ C;  2G3Q B;  2JXX A;  4GDL A;  3UQB A;  2C7H A;  4EFO A;  2L0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...