5DCNA

Crystal structure of lc3 in complex with tecpr2 lir
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
126
structure length
126
Chain Sequence
DEWEVIGGPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title TECPR2 Cooperates with LC3C to Regulate COPII-Dependent ER Export.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Microtubule-associated proteins 1A/1B light chain 3B
total genus 34
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2015-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5dcnA00
1OEYJ 3ZDMC 2LWPA 4IG7B 2L05A 1AARA 2MWSB 3DVGX 3VH4B 3A1QB 2KKCA 1L2NA 2KWUB 2IO2B 2LZ6A 2PEAA 1E8ZA 3NZSA 2R2OA 3PRPB 4GN1A 5J18A 2D2QA 3PPAA 4M8MA 4DDID 5JH5C 5KHQA 3V60A 4K7WA 3ZIMA 3WALA 3CSTA 3RUIB 1YX5B 3UINB 3VQIA 4WJPA 3K9PB 3EHVA 2KQ7A 4BBNC 2KLGA 2RPQA 3WAOA 3EC8A 4FN2A 4ZDVA 4NQKE 5L95C 2O6VB 4MEMA 3KW5B 4KIKB 4CYEA 2KO3A 4WJQA 4BOSC 3RD2A 2BF8B 2CS4A 4IM0A 2AYOB 1UH6A 2KDIA 1P98A 1WR1A 4B6WA 3W1SA 3C0RB 1KJTA 2IO1B 2MCNB 3R7QA 5C23A 3VAWA 4MGZE 2KDFB 1E90A 3AULA 2DYOA 3PLVA 4W9JA 4DHJB 5JHAA 2UYZB 4GIVA 2LGYA 2LVPA 4PS8A 2KLCA 2AL6A 4FJYA 4B9KA 5GMVA 4HCPB 4IW0A 3UIPB 4K81A 1WH3A 4EUTA 4W9HA 4EKUA 4B95A 3V61A 3HM6X 2LI5A 4ICUA 4J6IA 4DHZB 1KOTA 4NPNA 1UBIA 2IBIB 1WXAA 3T9LA 3JVZX 2J0KA 2ZVNA 3DBHI 4FULA 4JL9A 1ZGUB 2ZPNA 4GMVA 4HJKA 3NHEB 4PS7A 1C1YB 4W9EA 1XD3B 2JZ3B 2BWES 1E7VA 3QX1A 4WAAA 4DHZE 4DDGD 4PYUA 4EOYA 1WMHA 1TZ1A 3H9DA 3PHWB 2GMIC 3JSVB 1G6JA 3UQBA 3A9KB 1WZ3A 3L08A 2LRUA 1QZEA 3ML9A 4HPMB 1RLFA 5CTRC 3U8ZA 1WGYA 3VVWB 2IY0B 2JVCA 1J19A 2GBRA 2V4LA 3EECA 4P7IA 4GXBA 1WX7A 3ZKJC 4ASWC 4KDLB 3ZW3A 2N4FA 3A4SC 2KC1A 1P9DU 4MGKE 4RM8A 1V9JA 3ZO5B 2KFJA 2N1WA 2O2VB 4K1RB 1V5OA 2MQJA 2BYVE 3A4RA 1FXTB 2DX5B 3ECIA 3ZNID 2MLBA 4LDTD 1EO6A 3T8MA 2L3ZA 1E5WA 2WX1A 4IWQA 2ZVOA 4AJYB 3PREA 4WWPA 3TBLD 1IPGA 2G3QB 2KXJA 4GSWA 2BWFA 1JRUA 3ZVVA 2MRPA 2D07B 2KDEB 4NJ7A 3VXWA 2KX0A 1SGHA 5D7GA 4LJOB 3UGBB 3GOEA 2MP2B 5AZHA 2JZZA 5CX3A 5DPRA 2IY1B 3VDZA 1E8WA 2MBOA 1P3QU 1UBQA 5J2RA 4PS3A 3V6CB 1HE8A 2RGFA 3P2BA 3KUDB 1P1AA 2K8BA 3DBSA 5AZFA 1Q5WB 1LFDA 2WYQA 3B08A 4PYZA 3N3KB 3ZTDA 2KDBA 2JXXA 4TV3A 4HCNB 2ZZPB 4M8NA 3TMPB 2L0TA 1WZ0A 1Z2MA 2O2VA 2ZCCA 5DPSA 2Y5BB 3GZNI 4GDKA 5E6PA 1XQQA 2BYFA 1WI0A 2DENB 2JUOA 2LUEA 2M1MA 1T0YA 5JZEB 3HHMA 3IVFA 2OOBB 1E7UA 1WE6A 3SU8X 4W9IA 2N9PC 3L10B 3OJ4B 1V49A 4F7ZA 4FA6A 4HDQA 2LVQA 2NPTA 4MH0E 2D10A 4IWOA 2FCQA 4HXDA 2NS5A 1Z5SB 5DPWA 4AOFA 2D11A 3DCGA 4JQWC 1WY8A 3JW0X 4WWNA 2MBQA 2Z0EB 2V3SA 3DVNV 3ZDTA 3A9KA 1RRBA 3WAMA 4BVUC 2R2QA 3PGEA 3VUYA 2KVRA 2L8JA 4DWFA 2GBKA 3L13A 3L54A 2KMCA 5E6OA 2L00B 4BKTA 4AJWA 2L7RA 2K8CA 2C9WB 3BY4B 1IP9A 2DHZA 4MGIE 2K8HA 3Q3JA 4XZ4A 5LXIB 1V80A 4KZ0A 2C60A 2G4SA 5D2MB 3N30A 4MELA 1EF5A 4XC2A 4M0WB 2KMAA 4GOCA 1NBFC 2VRRB 2MA9B 2KK8A 3ZNHB 4A20A 3UQAA 3KH0A 4GDLA 3NZUA 2REXA 1WXMA 4W9LA 1RAXA 1YIWA 2FUHB 2XEWA 4FLHA 3WA0A 1D3ZA 2J7QB 3DOWA 3PSEB 4GGQA 1E8XA 5BO4B 2UWQA 4AP4C 2CR5A 3ENEA 1NDDA 4DBGA 2KOXA 4W9CA 3U7DA 2ZJDA 4BOZB 2N1VA 4OVUA 3VHTC 2CHXA 2OJRA 3APDA 4F1SA 4TQ0A 3RCZA 1Y8RC 4G11A 2MP2A 1S3SG 1UELA 3PS6A 1TGZB 2O6VD 2EMSA 4W9FA 4RM9A 4BKGA 1OEYA 4KSKC 2QHOA 3UF8A 5G55A 2LASA 3MTNB 2MBEA 1GG3A 3K9OB 2NR2A 4WQOB 2CKHB 3JYUA 4JLCA 2K39A 3PT2B 2CHWA 2G45B 2LGXA 5L83A 2A5UA 2KTRA 1H4RA 3APFA 3PHXB 3RULA 4FBJB 2PPHA 3VFKA 3IBEA 1WJUA 1WM3A 2JRIB 3QAQA 3ZRCA 2N9XA 3HK0A 4GDLB 1V6EA 4AWJA 4IUMB 2YLMA 2Z0DB 4FHKA 3DVNU 1M94A 3TCAA 3X23A 1SIFA 4ANWA 4FJVB 1OTRB 4IC7B 2NBVB 4LJPB 4XX5A 2K6QA 1WGGA 3DPDA 4I6LB 4EZKA 1WX9A 2DZIA 3DVGY 3EFUA 2M0XA 2Z59B 4IM2A 4DK5A 1I42A 2KWVB 3B0AA 1LM8B 1LXDA 2N9EB 2AWTA 2ZEQA 4MM3A 1WE7A 4CO7A 3V62A 1Q0WB 3KUZA 2FCSA 3M62B 3QC8B 4K7UA 4JIOU 5G2NA 1WXSA 1WYWB 1R4MI 4DXAB 2CU1A 2DZKA 1WJ4A 3KVFB 2IYDB 2MBBB 2ZCBA 4E74A 5DCNA 5AEKB 1K8RB 1WF9A 2C7HA 2BKFA 1PQSA 4KDIC 1S1QB 5IAAC 1XT9B 4MSQB 2JY6A 3PRZA 3MJWA 3NOBA 2LJ5A 3H7PA 2HJ8A 2EKEC 3OLMD 4W9KA 3QWZB 4FHJA 4WJOA 2MW5A 1LQBA 1GNUA 2GBJA 3IFWB 4GB9A 5EDSA 3AI5A 4A3OA 3ONSA 3CF6E 3ZRFA 2NCNA 1IYFA 1CMXB 1C3TA 1GC6A 3NS8A 1YD8U 4BBNF 1Q1OA 4KSLC 3S2AA 4NAWA 3ZUNA 4MJSA 3RT3B 1WIAA 4X57B 4EZJA 2DYMA 2EMTA 4WWOA 3AU4A 4NNJB 5FR6A 3SD5A 2WX0A 1WXVA 2N7EA 2K6DB 1WX8A 2NBUA 1J0GA 4CHKA 2DAJA 3ZNGC 3N32A 3L17A 2ASQA 2LD9A 1EUVB 5KHOA 1YX6B 3D32A 4IWPA 3AXCA 1WFYA 1V81A 2WDTB 3KYCD 4LDTB 3VTVA 3O65B 2BKRB 2GBNA 2BPSA 1WM2A 3R3MA 4II2B 3PRMB 3DBLI 3V6EB 4EFOA 3QCAA 2PE9A 3QA8A 1A5RA 2IO0B 3A9JB 5DPTA 3WANA 2NBWB 4IM3A 3B1LX 2IO3B 3OJ3A 4HK2A 2W9NA 2DYBA 4G50A 4RMAA 2XK5B 2KJHB 3A33B 5J17A 2KFKA 1I35A 2FNJB 2KZRA 2MBHA 4FADA 4ANVA 4OVVA 3R7RA 2NVUI 2JWZA 1R4NI 3KUCB 2KHWB 5JHBA 2LXCA 3CSFA 4LCDE 2AL3A 4TUUA 3M3JA 4ZYNA 2K25A 4II3B 3NY5A 2JPHA 1WJNA 2KWCA 1SE9A 3RYTA 3PTFC 4ZRKA 4HLEA 3VTUA 5D94A 5LLIA 4MSMB 4EZLA 2M4NA 2LXAA 3DDCB 4N9F4 3SHQA 1H8CA 2JT4B 2J0MA 1KM7A 4KIKA 1U4AA 2KD0A 2O6VA 3HIZA 4F8CB 2B3AA 2MSED 2C7MB 4ICVA 1EF1A 4BKSD 2K1FA 2LGDA 5IA7A 2JRHA 4FJZA 1WMHB 2I1JA 2KQSA 2RD0A 3VH3B 4AUQC 4WJNA 4ZRJA 2V1YA 2XBBC 1RFAA 2BYEA 4ANXA 3LJ3A 2KX3A 3SDLC 1WGHA 1VD2A 1YQBA 2GOWA 2FAZA 2LVOA 2DZMA 1GC7A 4TKNA 4HVBA 1WJ6A 3A1QA 4DHJD 5E6NA 4URKA 1V2YA 2CHZA 4KZCA 2HD5B 1ISNA 4NAWB 1NI2A 2KNBA 3IG3A 1UD7A 4GDKB 4HWIB 3I3TB 5HKHA 1J8CA 3RZFA 3QQ8B 1OGWA 1WGRA 3QHTA 3W1SC 1F9JA 3PVLA 1UZXB 1WR6E 3H7PB 3LDZE 4BFRA 1GUAB 4JGHB 3HM3A 4W9DA 2HE7A 3VUXA 3ZNZB 3M95A 3MHSD 2WWZA 3H1UA 2LRWA 3R66C 2C7NB 2FCNA 3QK0A 2XK5A 2KTFA 2D3GA 1KLVA 2J0JA 3TJPA 3KYDD 4MDKE 2ZPYA 4YL8A 3WIMA 4I6NB 2PJHA 4E71A 2AEHA 1TBEA 3TIXA 4W9GA 4G0NB 3A9JA 2ZNVB 3W1YA 1V5TA 3X0WA 4NJ6A 3PLUA 3L16A 4HPLB 3RZWC 2FIFA 3ZLZA 3ML8A 1MG8A 4NQLB 3UIOB 5C1ZA 3CMMB 3AU5A 2DAFA 1OQYA 2M17A 2NPTB 1WGDA 5CHVC 2A4ZA 1TTNA 3WAPA 3L0WB 5CHFA 3ZTCA 2PE6B 2YVCA 1X1MA 2GBMA 4A3PA 4MJSB 2KN5A 5LXHA 2KTRB 2G4DB 2KFKB 4BKSA 2KANA 3DBRI 2RSUA 2MX2A 1BT0A 3JSVA 2HTHA 4ANUA 5TR5A 1GJZA 1UGMA 4K7SA 3BINA 4MGYE 2IZVB 4HDOA 1VCBA 2L76A 3QJZA 3ALBA 2RR9A 1WRDB 1V86A 1ZKHA 2KJ6A 4KVGB 2N7DA 3PV1A 3QARA 3DQVA 1P0RA 3TL5A 2I1KA 3IHPC 3H6NA 4G3XB 3Q3FA 4ZRIA 2ZNVC 4I6PA 4TQ1A 3U30A 3VTWA 1L7YA 3QIJA 4NY0A 2M8SA 2C5LC 3APCA 5CHWA 3VUWA 3PZDA 3OAWA 4GU2A 2BGFA 2FCMA 3H7SA 4EEWA 2DZJA 3M63B 5AZGA 5D6JB 2FIDA 4E3CA 2KJRA 2JF5A 4KV2A 2KC2A 1E8YA 1YJ1A 2L0FA 1ZW7A
chains in the Genus database with same CATH superfamily
4J3OD 2BB5A 2L05A 3DVGX 3VH4B 1C9FA 2KKCA 4GN1A 2PEAA 2L32A 5J18A 1L0XB 3BK1A 3Q6BA 1IGDA 4K7WA 3CSTA 2BVCA 2OHFA 3K9PB 1C4AA 4H2AA 2RPQA 4ZDVA 1D5XC 2FUG1 4MEMA 4KIKB 3ZJVA 2RPVA 4LTUA 4B6WA 3C0RB 3TEXA 1KJTA 4MGZE 1UWXA 2KDFB 3AULA 4US9A 4W9JA 4HCPB 1FEHA 3GZNB 4K81A 3MJ5A 4W9HA 4JPSA 2LI5A 4ICUA 3DBHI 2ZPNA 4HJKA 1XD3B 2JZ3B 3QX1A 4DHZE 4DDGD 3H9DA 2B76B 4ITKA 3JSVB 1TKEA 2LRUA 3ML9A 4HPMB 1RLFA 3Q8BA 2IY0B 2GBRA 2CJOA 3EECA 4P7IA 1TKGA 2WHIA 4ASWC 2LUMA 2KC1A 1V9JA 3ZO5B 2ACZB 2DLBA 5BMGA 1B9RA 3ZNID 2BYVE 5HI1A 1FXTB 1QOBA 3ECIA 3T8MA 2L3ZA 1E5WA 2WX1A 4AJYB 2Y3AA 3AM9A 1JRUA 1AYFA 2D07B 2KDEB 4NJ7A 5HHDG 3VDZA 4P1CC 1P3QU 5J2RA 4N59A 3V6CB 1HE8A 3TEZA 1SE2A 3ZTDA 3SFDB 1YNTE 2QCZA 2JXXA 4TV3A 5HG2A 2V4IB 4HCNB 4M8NA 2LGSA 5JZEB 2DENB 2W3RA 2M1MA 1N63A 4UDUC 4GLSC 1DGJA 3OJ4B 1V49A 3GB1A 2N0SB 2D10A 2FCQA 3SFEB 2NS5A 1JWSD 3MP9A 4JQWC 3JW0X 2V3SA 1QILA 1RRBA 3OWEB 1V1PB 2R2QA 3AEFB 3VUYA 4DWFA 2YEPB 3B9JA 1KFYB 1JQ4A 2VZKB 3WCQA 4EE2A 4WWMA 1V80A 4KZ0A 3N30A 2KAJA 1NBFC 1SE4A 4GDLA 1WXMA 3OG5A 2BQQA 1L6UA 1RAXA 1YIWA 2GLSA 3DOWA 4L23A 4C80A 2CR5A 1VZ8A 4MACA 1QOGA 3U7DA 2N1VA 2M19A 2CHXA 4F1SA 1SEBD 3RCZA 4A8XC 1S3SG 2LASA 3BK2A 5G5GA 2NR2A 4WQOB 1E9MA 3NS1A 2KTRA 1H4RA 4FBJB 3VFKA 1XEEA 2N9XA 3GE3C 4AWJA 4YWGG 3DVNU 3TCAA 4XX5A 2K6QA 3DPDA 2D3BA 2M0XA 2KDMA 2Z59B 3Q69A 1I42A 2KWVB 1LM8B 2AWTA 1L4DB 3KWLA 5G2NA 4JIOU 3RMKC 1WJ4A 3KVFB 2MBBB 1DYQA 4E74A 1K8RB 4LNOA 2AQ1B 3PRZA 5BYRA 3OLMD 3Q2AC 4FHJA 3AN1A 1GB1A 3FAHA 1ZXHA 2GBJA 3CF6E 3KLSX 3PZ7A 4RGNA 3NS8A 4BBNF 4NNJB 2WX0A 1WXVA 4KX6B 2G9HD 2DAJA 3L17A 1EUVB 1V81A 2WDTB 3KYCD 4OZBA 3BVZA 4P6VF 3DBLI 3Q8FA 3QA8A 1A5RA 1YN4A 1HQRD 3OJ3A 2W9NA 2JYEA 2DYBA 1F77A 3NVYA 2KJHB 3A33B 4NJCA 3CIRB 2CJNA 4ANVA 1R4NI 1XLQA 1NYQA 1T0RC 2K25A 2JPHA 2KWCA 1SE9A 3RYTA 2D3CA 2WXMA 3PTFC 1K51A 1GOZA 1H8CA 1U4AA 3MC0B 2B3AA 1J7CA 2C7MB 4ICVA 4BKSD 2K1FA 5IA7A 2I1JA 4OZAA 2KQSA 4K3BA 2PTLA 1PGXA 1C79A 2XBBC 4S17A 2BYEA 4P1BC 3P4RB 1WXQA 1MHHE 3SDLC 1YQBA 2LVOA 3N1YC 4HVBA 1I4PA 3A1QA 4DHJD 5E6NA 1T0SC 3T3OA 4KZCA 1ISNA 3IG3A 1XLPA 3I3TB 3RZFA 3QQ8B 3B2FA 1OGWA 3R2IA 3PVLA 3H7PB 2AQ3B 1I4QA 3VUXA 2WWZA 2C7NB 2HJ1A 2XK5A 1VJKA 3KYDD 2AEHA 1MJDA 4HPLB 3RZWC 3DHHC 1QOFA 4BZAA 4NQLB 2QIEB 1OQYA 2M17A 5CHVC 2IGGA 1TTNA 2L83A 5HFYA 1SE3A 1EU4A 1F2RC 4MJSB 4YT0B 3DBRI 3V05A 4JWSC 1BT0A 4ANUA 4K7SA 3BINA 1FXIA 2IZVB 3BWUD 2PKOA 1WRDB 1ZKHA 3AEDB 3SEBA 3QARA 3DQVA 3TL5A 2WXJA 3Q3FA 4ZRIA 2ZNVC 3VTWA 1K52A 1XO3A 2AX5A 2W82A 4NY0A 2IDYA 3VUWA 2BGFA 2FCMA 1R4MB 1GPXA 2E6XA 1E8YA 2QEJC 4YSYB 1OEYJ 2LWPA 1ZE3D 4IG7B 4NZLB 1E8ZA 1PYWD 3Q8CA 3ZIMA 3WALA 3RUIB 2D3AA 3ZJUA 1P7FA 3EHVA 3HVDA 3IXSA 3RNAC 2BT6A 5L95C 2O6VB 1KLUD 3KW5B 4CYEA 2BS2B 2KO3A 2VZKD 1PUTA 1PGAA 2BF8B 1WR1A 1N5XA 3SR6A 3W1SA 1R4NB 5C23A 2L1AA 4DHJB 5JHAA 2UYZB 1TJEA 2YEPF 4KKIA 4IKGA 4B9KA 5GMVA 1OQQA 4IW0A 1UGJA 1T5XD 1K53A 4EKUA 3HM6X 4DHZB 4J6IA 4NPNA 1UBIA 4D2KA 2IBIB 1FCLA 3TSSA 2WXOA 4YSXB 1JROA 1BUIC 2ZVNA 1ZGUB 1SXTA 1E10A 1FXAA 4WAAA 2QMTA 1V97A 4EOYA 1I4GA 1WMHA 1TZ1A 3PO0A 1G6JA 3UQBA 3A9KB 3KQ4A 3RPFC 3GS2A 4TSSA 3BVGA 2JVCA 2V4LA 3ZW3A 2N4FA 1P9DU 4RM8A 1DOXA 4OHJA 2N1WA 4C7YA 4ZOHC 4K1RB 3A4RA 2JSVX 1AW7A 2ZVOA 3PREA 4WWPA 4WH4A 3TBLD 2BWFA 2BB6A 3ZVVA 2MRPA 5D7GA 2JZZA 2IY1B 3GP7A 1UBQA 1M4VA 2K8BA 2RMMA 3DBSA 4C4VB 2WYQA 2V3NA 4PYZA 3N3KB 1HTQA 3AB5A 1YOVB 5TSSA 1HEZE 5LNK1 5DPSA 4GDKA 3GZNI 5E6PA 1XQQA 1TT5B 3HHMA 1AWDA 3IVFA 1ZP0B 5BYSA 1STEA 2AQ2B 3I57A 4L1BA 4HDQA 2Z8LA 2KACA 1WYGA 1N62A 2D11A 1SJED 4WWNA 1EU3A 3A9KA 3Q3OC 1RM6C 3EUB2 1D5MC 3L54A 4BKTA 2I2YA 4AJWA 2L7RA 2W54A 3Q14C 1IP9A 3Q3MC 1GB4A 4DXGA 2JQRB 5D2MB 1EF5A 4ARIA 4M0WB 2W55A 5BMIA 1D5ZC 4GOCA 2VRRB 1ET6A 2MA9B 4A9AA 1I7HA 3IAS1 3RN9C 3ZNHB 4A20A 3NZUA 4W9LA 2XEWA 2WXLA 3N1XC 4GGQA 2WNMA 1SF0A 4M01A 1N61A 1NDDA 4DBGA 1KF6B 2G1EA 3VHTC 4AQ7A 4TQ0A 4G11A 2MP2A 3AEGB 4BKGA 1OEYA 4KSKC 4PK1A 2QHOA 2MBEA 1GG3A 3DWMA 3N1ZC 2EKIA 2JU6X 3PT2B 2CHWA 2G45B 2LGXA 1PDXA 5L83A 2A5UA 3AV8A 3RULA 2PMVA 3IBEA 2J53A 3BZDB 1VDVA 3QAQA 3ZRCA 1XXGA 3NVVA 4FHKA 1OTRB 4LJPB 4I6LB 1WGGA 3BYTB 4DQOC 2LHEA 4EZKA 1WX9A 2DZIA 3B0AA 4MM3A 1LXDA 2ZEQA 4CO7A 1WE7A 1CQVA 3QC8B 2QDFA 1WXSA 1NI3A 1J7BA 1FIQA 4DXAB 2DZKA 3FKYA 5DCNA 5AEKB 2HTME 2C7HA 1S1QB 1JALA 5IAAC 1XT9B 2JY6A 1E7PB 2JYTA 4HEA1 4LK0M 2LGIA 3IFWB 1GNUA 4NAMA 3RNCC 4BAXA 2NCNA 3MFGA 1C3TA 1GC6A 1Q1OA 4NAWA 4MJSA 3RT3B 3AE3B 3AU4A 5FR6A 2N7EA 2K6DB 2NBUA 4REZA 1LGRA 4MH8A 2RDGA 3D32A 3AXCA 2BKRB 4II2B 3AH7A 3PRMB 3V6EB 5C3JB 4EFOA 2PE9A 2NBWB 4ZYSA 2PLPA 2ZW0A 4IM3A 2IO3B 4HK2A 4RF0A 2JZPA 3P1MA 2WU5B 4RMAA 2XK5B 4Q2JA 2KFKA 2WP9B 2KZRA 3NUHB 5C2TB 4FADA 3I9V1 4OVVA 2KHWB 5JHBA 4LCDE 3CSFA 2AL3A 2WXKA 3M3JA 1WJNA 4ZRKA 4HLEA 3VTUA 4MSMB 3AE6B 3DDCB 4JWUC 3CWIA 4KIKA 3HIZA 3DWGC 4LLGM 3FILB 3VRBB 2WXRA 1WMHB 4AUQC 4WJNA 3BYYB 3E56A 1RFAA 4ANXA 1KRHA 5EE9A 3V3XA 3U52E 1HA5A 1VD2A 2GOWA 2WDQB 4YXDB 3ZXRA 1GC7A 4TKNA 1WJ6A 3NVWA 2NTSA 1V2YA 1EWCA 2N9KA 2RDHA 4C7ZA 1KTKA 4HWIB 1J8CA 3MC9A 4US8A 1WR6E 3FC4A 4BFRA 3HM3A 4LNFA 3ZNZB 1I4HA 3MHSD 5FR3A 2LRWA 2FCNA 2J0JA 4ZRPA 3TJPA 4MDKE 3WIMA 4I6NB 4E71A 4G0NB 3A9JA 2ZNVB 1V5TA 3FILA 3J9CA 3VRAB 4LNNA 2H89B 1MG8A 3KWVA 1NEKB 3P63A 2KTRB 2G4DB 4BKSA 2KANA 2RSUA 3JSVA 4DXFA 1GJZA 1OQRA 1VLBA 4L2YA 4MGYE 5BYQA 2L76A 1HZ6A 2HDEA 3AE9B 2M56B 3ALBA 3N9YC 3QIJA 2C5LC 1D6EC 3APCA 5CHWA 3OAWA 2Y5CA 1DOYA 2DZJA 3M63B 5D6JB 1MHXA 4E3CA 2JF5A 2KJRA 4KV2A 3W2DA 1YJ1A 5DPTA 1ZW7A 2BS4B 3ZDMC 4USAA 1AARA 1VZ7A 3EFCA 3A1QB 1L2NA 2KWUB 2LZ6A 3PRPB 3NZSA 4P16A 1UWMA 1A70A 2D2QA 5KHQA 3VR8B 1YX5B 3UINB 3VQIA 4BBNC 1L6VA 3WAOA 3RFZB 3EC8A 3P4QB 3EGRA 3P4SB 4WJQA 3RD2A 2CS4A 2AYOB 2KDIA 3R7QA 3RNEC 3VAWA 2PIAA 1E90A 2DYOA 2LGYA 1XCQL 2WXQA 1PGBA 4PS8A 2AL6A 3U4EG 4OVZA 1ZXIA 3UIPB 1CK1A 4AS1A 1BMLC 3HVZA 4B95A 3V61A 5IKCM 1KOTA 4WURA 2N7JA 4WAFA 1WXAA 3T9LA 3JVZX 2L52A 5JXVA 1QF6A 2OEDA 4FULA 2KVZA 4GMVA 1HZ5A 2IGHA 2SEBD 5FK9C 3NHEB 4PS7A 5IO9A 4A6QA 2BWES 3U2SC 1E7VA 1ACCA 4RGTA 1PFDA 1K50A 2JX5A 3B2GA 2GMIC 2WXPA 1WZ3A 1ZOYB 5CTRC 3W5UB 3U8ZA 1WGYA 3VVWB 4R3DA 1XF5L 1WX7A 2PW9A 3Q3NC 2IJ0A 1RWSA 1V8CA 4B0EA 3A4SC 4MT5A 1KH0A 2PVOD 2KFJA 1N60A 1HXYD 1V5OA 2MQJA 2DX5B 1SB3C 2MLBA 1EO6A 4LDTD 1ZUD2 3ZQ4A 1IPGA 2IGDA 2KXJA 4C4VA 3VXWA 2KX0A 1SGHA 2W3SA 3UGBB 5DPRA 3LYYA 2KYWA 4PS3A 2RGFA 3P2BA 3KUDB 1P1AA 1JWUD 1Q5WB 2Y5PA 1TKYA 3TEYA 2KDBA 1E6EB 1Q10A 2ZZPB 3TMPB 3ZJTA 1WZ0A 1Z2MA 2WXFA 1JMLA 1RFKA 2Y5BB 2BYFA 1WI0A 4RGOS 1T0YA 4YSZB 1E7UA 1WE6A 3SU8X 2N9PC 3L10B 2K9XA 2LVQA 2NPTA 2BYTA 1V1OA 2RDBC 2MJ3A 4C56C 4AOFA 4XGAB 3DCGA 1WY8A 1IGCA 2MBQA 2Z0EB 3W5VB 3DVNV 3ZDTA 2OJWA 4BVUC 3PGEA 2KVRA 2L8JA 2GBKA 4JX1C 3L13A 2KMCA 2MH7A 5E6OA 2L00B 3ABVB 2K8CA 2C9WB 2KN4A 3BY4B 2X38A 4MGIE 2K8HA 2C60A 1EM7A 2G4SA 2M0AA 3DHIC 2KT7A 4O1NA 4MELA 4XC2A 4XE0A 2KMAA 1FD6A 2KK8A 2MJDA 5IN7A 3UQAA 3KH0A 3NVZA 2REXA 1VRAB 2J42A 1D3ZA 5BO4B 2QC8A 4ARCA 2KOXA 3BIID 2DWQA 2V0GA 1JW9D 2WDVB 4OVUA 4ZHPA 2OJRA 3APDA 1TY0A 1Y8RC 1UELA 2H88B 3L4PA 3DBRB 2EMSA 5G55A 3MTNB 3K9OB 3JYUA 2BS3B 4N6EB 3PHXB 2X8XX 1F0ZA 4LNIA 1WJUA 2KWDA 3HK0A 4IUMB 2NTTA 3X23A 1SIFA 4ANWA 4FJVB 4XDCA 2NBVB 3DVGY 3EFUA 2N9EB 3C8YA 4XWTA 3KUZA 1L0YB 1FRRA 1WYWB 1R4MI 3AE1B 2CU1A 4MM3B 2ZCBA 3Q8AA 2BTEA 1FNUA 3TEWA 1WF9A 5I4DA 1PQSA 3MJWA 3NOBA 5AUKA 2LJ5A 3H7PA 2HJ8A 2EKEC 3QWZB 1Y56A 4WJOA 2MW5A 1LQBA 4A90A 2CU3A 4GB9A 3AI5A 1C78A 1D4BA 1IYFA 1QLBB 1AN8A 1YD8U 4DDID 4KSLC 3S2AA 4X57B 2DYMA 1WX8A 1WGKA 1J0GA 4CHKA 1YX6B 3AE5B 4IWPA 2J52A 1YN3A 2BPSA 1WM2A 2WXNA 1VR9A 3URYA 3MHZA 1C77A 1YN5A 4KKJA 3B1LX 4G50A 2TSSA 4RNAA 3R7RA 4WIPA 2IPKD 3R2TA 1FCCC 2LXCA 3I5JC 4ZYNA 3NY5A 4M0WA 1NYRA 4EZLA 5LLIA 2M4NA 4N9F4 1JWBD 2JT4B 3IT6B 2J0MA 1KM7A 2KD0A 4F8CB 2MSED 2QILA 3VH3B 5FKAC 3GE8C 2LFIA 3AE8B 4QAYA 1R7SA 2DZMA 1UUPA 1TS4A 2CHZA 2HD5B 3AEAB 1FNVA 2KNBA 1YQ4B 1UD7A 2E3TA 5D3IB 5HKHA 1L0VB 1WRIA 3W1SC 1F9JA 1UZXB 3LDZE 4JGHB 4W9DA 2HE7A 3M95A 3LB8C 4OZCA 3ZXVA 3R66C 4CQNA 2KTFA 2UU7A 1F1HA 1KLVA 2BBCA 3O13A 4YL8A 2PJHA 1TBEA 1ROEA 1UNSA 3N20C 1YJIA 1I4XA 2FBWB 3AEEB 3X0WA 1FPYA 3L16A 1SSNA 5G5HA 4XDDA 4JE3B 1IUEA 3UIOB 5C1ZA 1FNWA 3AU5A 2DAFA 4OW0A 2NPTB 1SIJA 2A4ZA 3L0WB 5CHFA 2PE6B 2YVCA 2GBMA 3Q8EA 2MX2A 3AECB 4XWWA 5TR5A 2FE8A 3QJZA 1ENFA 2RR9A 1ZPSA 1TS3A 2KJ6A 1CZPA 5H8YE 3IHPC 3H6NA 1L7YA 4RFBA 2LMCA 2M8SA 3H7SA 2MEKA 4EEWA 2WQYB 5AZGA 2LHDA 4A55A 4TQ1A 1E0ZA 2MWSB 2IO2B 2R2OA 3PPAA 4M8MA 5JH5C 3ETRA 4IOIE 2VH1A 3DHGC 3V60A 1IBXB 1FRDA 1YMHE 4YTNB 2WDRB 2D5GA 4WJPA 3U7ZA 1FO4A 2KQ7A 2KLGA 4FN2A 3ZYYX 2J4XA 1V1PA 1WWTA 2INNE 4NQKE 5BMHA 2NMQA 2K5PA 4BOSC 4IM0A 1ESFA 1UH6A 1P98A 2IO1B 2MCNB 3PLVA 4GIVA 1JWAD 1OFFA 2LVPA 2KLCA 4FJYA 1LO5D 1C4PA 1WH3A 4EUTA 3AE7B 1FFVA 2J0KA 5IP4D 4JL9A 4IDIA 2JXTA 1L5PA 1FM0D 1XLNA 1C1YB 4W9EA 4HRSA 4KGRA 2I38A 4PYUA 3PHWB 3L08A 3MC8A 1QZEA 4ZRQA 1SJHD 1FMAD 1J19A 1P7EA 4GXBA 3ZKJC 4KDLB 2LEKA 4MGKE 2QSDA 2O2VB 3T3NA 2WGSA 4IWQA 2G3QB 4GSWA 3DBHB 4LJOB 3GOEA 2MP2B 5AZHA 5CX3A 1E8WA 2MBOA 5H92C 2K22A 3AE2B 5AZFA 1LFDA 3B08A 3AE4B 3AMZA 2ICIA 1DOIA 2L0TA 2O2VA 2ZCCA 4TMAB 2JUOA 2LUEA 2K0PA 2INDC 2OOBB 1TZOA 4W9IA 4F7ZA 4FA6A 1F52A 5AUIA 4KGSA 1QKZA 4MH0E 1MI0A 4IWOA 4HXDA 5DPWA 1Z5SB 3BVMA 3P4PB 4K3CA 2WS3B 4WQMA 2WXHA 5IOIA 1I4RA 3WAMA 3HRDD 5EE0A 1XLOA 2BW2A 1TS5A 1T0QC 2DHZA 5T8IA 2GI9A 3E9SA 4ZHOA 3Q3JA 4XZ4A 5LXIB 2INPE 2DBYA 1MPEA 1ZDXA 1UF0A 4C00A 1WSPA 1ET9A 2FUHB 5MPOA 4FLHA 1NVID 3UI3A 3WA0A 2J7QB 4HROA 3PSEB 1E8XA 2UWQA 4AP4C 4M02A 2PVGC 2XN9C 3ENEA 4W9CA 2ZJDA 4BOZB 4XYCA 1FFUA 3NG0A 5EE3A 3PS6A 1TGZB 2O6VD 4W9FA 2ZW1A 4RM9A 2R61A 4M00A 4KGTA 3UF8A 4RCOA 1JRPA 2CKHB 4JLCA 1CJEA 1QOAA 2K39A 3APFA 2QJLA 1SBBB 2PPHA 4PT5A 2JRIB 1WM3A 2V9HA 4GDLB 1V6EA 2YLMA 2Z0DB 1EWYC 1M94A 3C19A 3H8HA 4HPPA 4IC7B 1L4ZB 5E6JA 4IM2A 4DK5A 4YTMB 1T6BX 3V62A 1Q0WB 4ACFA 2Q5WD 2FCSA 3M62B 4K7UA 1HTOA 1QT9A 2ON8A 2IYDB 4RH6A 2BKFA 4FXCA 4KDIC 4MSQB 3VR9B 4W9KA 1KLGD 5EDSA 4A3OA 3ONSA 3ZRFA 1TYGB 1CMXB 2V3PA 2GB1A 3NRZA 3TUOA 1JCKB 3AEBB 4EZJA 3ZUNA 1WIAA 5GXGB 2EMTA 4WWOA 3SD5A 2MJEA 1C76A 3ZNGC 3N32A 1N5WA 2ASQA 2LD9A 5KHOA 1MVKA 2EELA 1WFYA 4LDTB 3VTVA 1RYJA 3O65B 2GBNA 3R3MA 1VZ6A 1J7AA 3RNBC 3QCAA 2WU2B 1TIFA 2IO0B 3A9JB 3WANA 4LNKA 2LJIA 4RF1A 4RGMA 3NZ3A 5J17A 1I35A 2FNJB 2MBHA 2DNFA 2NVUI 2JWZA 4HKQA 3KUCB 4TUUA 3IT4B 4II3B 3I63C 4YTPB 5D94A 2LXAA 1MFWA 2VH2A 2GRIA 3SHQA 5EE1A 3RNFC 4HKZE 2O6VA 3IAM1 1EF1A 2LGDA 2JRHA 4FJZA 2RD0A 4ZRJA 2V1YA 3W9CB 3LJ3A 2KX3A 1WGHA 2FAZA 1B1ZA 3PZ8A 2K3UA 1QQRA 4N58A 4S0RA 4HJGE 4URKA 2KMMA 1JWMD 2WLBA 4NAWB 1NI2A 4GDKB 1WGRA 3QHTA 2JWUA 1GUAB 1ZDVA 3EA6A 1TY2A 2XNAC 3H1UA 1T3QA 2WXGA 3QK0A 2D3GA 2ZPYA 2WXIA 3TIXA 1GAQB 1XCTL 2INCC 4W9GA 3W1YA 5D3DA 4NJ6A 3PLUA 2FIFA 2KQ4X 2ONQA 3ZLZA 3ML8A 1IBXA 1MG4A 2SAKA 3P42A 3ZGZA 3CMMB 1YQ3B 1WGDA 2N9LA 3WAPA 1BXTA 3ZTCA 1X1MA 3R8BA 3RNGC 1C4CA 4A3PA 2KN5A 5LXHA 2KFKB 2HTHA 1UGMA 1NENB 4HDOA 1VCBA 2MHJA 1YJJA 4KVGB 1TS2A 1V86A 3HUIA 3NJTA 2N7DA 3PV1A 1P0RA 3RI7C 2I1KA 3DBLB 4G3XB 3U30A 4I6PA 4B0MA 1F2RI 3PZDA 4GU2A 1N6ZA 3LXFA 2FIDA 2KC2A 2L0FA
chains in the Genus database with same CATH topology
1OEYJ 3ZDMC 2LWPA 4IG7B 2L05A 1AARA 2MWSB 3DVGX 3VH4B 3A1QB 2KKCA 1L2NA 2KWUB 2IO2B 2LZ6A 2PEAA 1E8ZA 3NZSA 2R2OA 3PRPB 4GN1A 5J18A 2D2QA 3PPAA 4M8MA 4DDID 5JH5C 5KHQA 3V60A 4K7WA 3ZIMA 3WALA 3CSTA 3RUIB 1YX5B 3UINB 3VQIA 4WJPA 3K9PB 3EHVA 2KQ7A 4BBNC 2KLGA 2RPQA 3WAOA 3EC8A 4FN2A 4ZDVA 4NQKE 5L95C 2O6VB 4MEMA 3KW5B 4KIKB 4CYEA 2KO3A 4WJQA 4BOSC 3RD2A 2BF8B 2CS4A 4IM0A 2AYOB 1UH6A 2KDIA 1P98A 1WR1A 4B6WA 3W1SA 3C0RB 1KJTA 2IO1B 2MCNB 3R7QA 5C23A 3VAWA 4MGZE 2KDFB 1E90A 3AULA 2DYOA 3PLVA 4W9JA 4DHJB 5JHAA 2UYZB 4GIVA 2LGYA 2LVPA 4PS8A 2KLCA 2AL6A 4FJYA 4B9KA 5GMVA 4HCPB 4IW0A 3UIPB 4K81A 1WH3A 4EUTA 4W9HA 4EKUA 4B95A 3V61A 3HM6X 2LI5A 4ICUA 4J6IA 4DHZB 1KOTA 4NPNA 1UBIA 2IBIB 1WXAA 3T9LA 3JVZX 2J0KA 2ZVNA 3DBHI 4FULA 4JL9A 1ZGUB 2ZPNA 4GMVA 4HJKA 3NHEB 4PS7A 1C1YB 4W9EA 1XD3B 2JZ3B 2BWES 1E7VA 3QX1A 4WAAA 4DHZE 4DDGD 4PYUA 4EOYA 1WMHA 1TZ1A 3H9DA 3PHWB 2GMIC 3JSVB 1G6JA 3UQBA 3A9KB 1WZ3A 3L08A 2LRUA 1QZEA 3ML9A 4HPMB 1RLFA 5CTRC 3U8ZA 1WGYA 3VVWB 2IY0B 2JVCA 1J19A 2GBRA 2V4LA 3EECA 4P7IA 4GXBA 1WX7A 3ZKJC 4ASWC 4KDLB 3ZW3A 2N4FA 3A4SC 2KC1A 1P9DU 4MGKE 4RM8A 1V9JA 3ZO5B 2KFJA 2N1WA 2O2VB 4K1RB 1V5OA 2MQJA 2BYVE 3A4RA 1FXTB 2DX5B 3ECIA 3ZNID 2MLBA 4LDTD 1EO6A 3T8MA 2L3ZA 1E5WA 2WX1A 4IWQA 2ZVOA 4AJYB 3PREA 4WWPA 3TBLD 1IPGA 2G3QB 2KXJA 4GSWA 2BWFA 1JRUA 3ZVVA 2MRPA 2D07B 2KDEB 4NJ7A 3VXWA 2KX0A 1SGHA 5D7GA 4LJOB 3UGBB 3GOEA 2MP2B 5AZHA 2JZZA 5CX3A 5DPRA 2IY1B 3VDZA 1E8WA 2MBOA 1P3QU 1UBQA 5J2RA 4PS3A 3V6CB 1HE8A 2RGFA 3P2BA 3KUDB 1P1AA 2K8BA 3DBSA 5AZFA 1Q5WB 1LFDA 2WYQA 3B08A 4PYZA 3N3KB 3ZTDA 2KDBA 2JXXA 4TV3A 4HCNB 2ZZPB 4M8NA 3TMPB 2L0TA 1WZ0A 1Z2MA 2O2VA 2ZCCA 5DPSA 2Y5BB 3GZNI 4GDKA 5E6PA 1XQQA 2BYFA 1WI0A 2DENB 2JUOA 2LUEA 2M1MA 1T0YA 5JZEB 3HHMA 3IVFA 2OOBB 1E7UA 1WE6A 3SU8X 4W9IA 2N9PC 3L10B 3OJ4B 1V49A 4F7ZA 4FA6A 4HDQA 2LVQA 2NPTA 4MH0E 2D10A 4IWOA 2FCQA 4HXDA 2NS5A 1Z5SB 5DPWA 4AOFA 2D11A 3DCGA 4JQWC 1WY8A 3JW0X 4WWNA 2MBQA 2Z0EB 2V3SA 3DVNV 3ZDTA 3A9KA 1RRBA 3WAMA 4BVUC 2R2QA 3PGEA 3VUYA 2KVRA 2L8JA 4DWFA 2GBKA 3L13A 3L54A 2KMCA 5E6OA 2L00B 4BKTA 4AJWA 2L7RA 2K8CA 2C9WB 3BY4B 1IP9A 2DHZA 4MGIE 2K8HA 3Q3JA 4XZ4A 5LXIB 1V80A 4KZ0A 2C60A 2G4SA 5D2MB 3N30A 4MELA 1EF5A 4XC2A 4M0WB 2KMAA 4GOCA 1NBFC 2VRRB 2MA9B 2KK8A 3ZNHB 4A20A 3UQAA 3KH0A 4GDLA 3NZUA 2REXA 1WXMA 4W9LA 1RAXA 1YIWA 2FUHB 2XEWA 4FLHA 3WA0A 1D3ZA 2J7QB 3DOWA 3PSEB 4GGQA 1E8XA 5BO4B 2UWQA 4AP4C 2CR5A 3ENEA 1NDDA 4DBGA 2KOXA 4W9CA 3U7DA 2ZJDA 4BOZB 2N1VA 4OVUA 3VHTC 2CHXA 2OJRA 3APDA 4F1SA 4TQ0A 3RCZA 1Y8RC 4G11A 2MP2A 1S3SG 1UELA 3PS6A 1TGZB 2O6VD 2EMSA 4W9FA 4RM9A 4BKGA 1OEYA 4KSKC 2QHOA 3UF8A 5G55A 2LASA 3MTNB 2MBEA 1GG3A 3K9OB 2NR2A 4WQOB 2CKHB 3JYUA 4JLCA 2K39A 3PT2B 2CHWA 2G45B 2LGXA 5L83A 2A5UA 2KTRA 1H4RA 3APFA 3PHXB 3RULA 4FBJB 2PPHA 3VFKA 3IBEA 1WJUA 1WM3A 2JRIB 3QAQA 3ZRCA 2N9XA 3HK0A 4GDLB 1V6EA 4AWJA 4IUMB 2YLMA 2Z0DB 4FHKA 3DVNU 1M94A 3TCAA 3X23A 1SIFA 4ANWA 4FJVB 1OTRB 4IC7B 2NBVB 4LJPB 4XX5A 2K6QA 1WGGA 3DPDA 4I6LB 4EZKA 1WX9A 2DZIA 3DVGY 3EFUA 2M0XA 2Z59B 4IM2A 4DK5A 1I42A 2KWVB 3B0AA 1LM8B 1LXDA 2N9EB 2AWTA 2ZEQA 4MM3A 1WE7A 4CO7A 3V62A 1Q0WB 3KUZA 2FCSA 3M62B 3QC8B 4K7UA 4JIOU 5G2NA 1WXSA 1WYWB 1R4MI 4DXAB 2CU1A 2DZKA 1WJ4A 3KVFB 2IYDB 2MBBB 2ZCBA 4E74A 5DCNA 5AEKB 1K8RB 1WF9A 2C7HA 2BKFA 1PQSA 4KDIC 1S1QB 5IAAC 1XT9B 4MSQB 2JY6A 3PRZA 3MJWA 3NOBA 2LJ5A 3H7PA 2HJ8A 2EKEC 3OLMD 4W9KA 3QWZB 4FHJA 4WJOA 2MW5A 1LQBA 1GNUA 2GBJA 3IFWB 4GB9A 5EDSA 3AI5A 4A3OA 3ONSA 3CF6E 3ZRFA 2NCNA 1IYFA 1CMXB 1C3TA 1GC6A 3NS8A 1YD8U 4BBNF 1Q1OA 4KSLC 3S2AA 4NAWA 3ZUNA 4MJSA 3RT3B 1WIAA 4X57B 4EZJA 2DYMA 2EMTA 4WWOA 3AU4A 4NNJB 5FR6A 3SD5A 2WX0A 1WXVA 2N7EA 2K6DB 1WX8A 2NBUA 1J0GA 4CHKA 2DAJA 3ZNGC 3N32A 3L17A 2ASQA 2LD9A 1EUVB 5KHOA 1YX6B 3D32A 4IWPA 3AXCA 1WFYA 1V81A 2WDTB 3KYCD 4LDTB 3VTVA 3O65B 2BKRB 2GBNA 2BPSA 1WM2A 3R3MA 4II2B 3PRMB 3DBLI 3V6EB 4EFOA 3QCAA 2PE9A 3QA8A 1A5RA 2IO0B 3A9JB 5DPTA 3WANA 2NBWB 4IM3A 3B1LX 2IO3B 3OJ3A 4HK2A 2W9NA 2DYBA 4G50A 4RMAA 2XK5B 2KJHB 3A33B 5J17A 2KFKA 1I35A 2FNJB 2KZRA 2MBHA 4FADA 4ANVA 4OVVA 3R7RA 2NVUI 2JWZA 1R4NI 3KUCB 2KHWB 5JHBA 2LXCA 3CSFA 4LCDE 2AL3A 4TUUA 3M3JA 4ZYNA 2K25A 4II3B 3NY5A 2JPHA 1WJNA 2KWCA 1SE9A 3RYTA 3PTFC 4ZRKA 4HLEA 3VTUA 5D94A 5LLIA 4MSMB 4EZLA 2M4NA 2LXAA 3DDCB 4N9F4 3SHQA 1H8CA 2JT4B 2J0MA 1KM7A 4KIKA 1U4AA 2KD0A 2O6VA 3HIZA 4F8CB 2B3AA 2MSED 2C7MB 4ICVA 1EF1A 4BKSD 2K1FA 2LGDA 5IA7A 2JRHA 4FJZA 1WMHB 2I1JA 2KQSA 2RD0A 3VH3B 4AUQC 4WJNA 4ZRJA 2V1YA 2XBBC 1RFAA 2BYEA 4ANXA 3LJ3A 2KX3A 3SDLC 1WGHA 1VD2A 1YQBA 2GOWA 2FAZA 2LVOA 2DZMA 1GC7A 4TKNA 4HVBA 1WJ6A 3A1QA 4DHJD 5E6NA 4URKA 1V2YA 2CHZA 4KZCA 2HD5B 1ISNA 4NAWB 1NI2A 2KNBA 3IG3A 1UD7A 4GDKB 4HWIB 3I3TB 5HKHA 1J8CA 3RZFA 3QQ8B 1OGWA 1WGRA 3QHTA 3W1SC 1F9JA 3PVLA 1UZXB 1WR6E 3H7PB 3LDZE 4BFRA 1GUAB 4JGHB 3HM3A 4W9DA 2HE7A 3VUXA 3ZNZB 3M95A 3MHSD 2WWZA 3H1UA 2LRWA 3R66C 2C7NB 2FCNA 3QK0A 2XK5A 2KTFA 2D3GA 1KLVA 2J0JA 3TJPA 3KYDD 4MDKE 2ZPYA 4YL8A 3WIMA 4I6NB 2PJHA 4E71A 2AEHA 1TBEA 3TIXA 4W9GA 4G0NB 3A9JA 2ZNVB 3W1YA 1V5TA 3X0WA 4NJ6A 3PLUA 3L16A 4HPLB 3RZWC 2FIFA 3ZLZA 3ML8A 1MG8A 4NQLB 3UIOB 5C1ZA 3CMMB 3AU5A 2DAFA 1OQYA 2M17A 2NPTB 1WGDA 5CHVC 2A4ZA 1TTNA 3WAPA 3L0WB 5CHFA 3ZTCA 2PE6B 2YVCA 1X1MA 2GBMA 4A3PA 4MJSB 2KN5A 5LXHA 2KTRB 2G4DB 2KFKB 4BKSA 2KANA 3DBRI 2RSUA 2MX2A 1BT0A 3JSVA 2HTHA 4ANUA 5TR5A 1GJZA 1UGMA 4K7SA 3BINA 4MGYE 2IZVB 4HDOA 1VCBA 2L76A 3QJZA 3ALBA 2RR9A 1WRDB 1V86A 1ZKHA 2KJ6A 4KVGB 2N7DA 3PV1A 3QARA 3DQVA 1P0RA 3TL5A 2I1KA 3IHPC 3H6NA 4G3XB 3Q3FA 4ZRIA 2ZNVC 4I6PA 4TQ1A 3U30A 3VTWA 1L7YA 3QIJA 4NY0A 2M8SA 2C5LC 3APCA 5CHWA 3VUWA 3PZDA 3OAWA 4GU2A 2BGFA 2FCMA 3H7SA 4EEWA 2DZJA 3M63B 5AZGA 5D6JB 2FIDA 4E3CA 2KJRA 2JF5A 4KV2A 2KC2A 1E8YA 1YJ1A 2L0FA 1ZW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OEY J;  3ZDM C;  2LWP A;  4IG7 B;  2L05 A;  1AAR A;  2MWS B;  3DVG X;  3VH4 B;  3A1Q B;  2KKC A;  1L2N A;  2KWU B;  2IO2 B;  2LZ6 A;  2PEA A;  1E8Z A;  3NZS A;  2R2O A;  3PRP B;  4GN1 A;  5J18 A;  2D2Q A;  3PPA A;  4M8M A;  4DDI D;  5JH5 C;  5KHQ A;  3V60 A;  4K7W A;  3ZIM A;  3WAL A;  3CST A;  3RUI B;  1YX5 B;  3UIN B;  3VQI A;  4WJP A;  3K9P B;  3EHV A;  2KQ7 A;  4BBN C;  2KLG A;  2RPQ A;  3WAO A;  3EC8 A;  4FN2 A;  4ZDV A;  4NQK E;  5L95 C;  2O6V B;  4MEM A;  3KW5 B;  4KIK B;  4CYE A;  2KO3 A;  4WJQ A;  4BOS C;  3RD2 A;  2BF8 B;  2CS4 A;  4IM0 A;  2AYO B;  1UH6 A;  2KDI A;  1P98 A;  1WR1 A;  4B6W A;  3W1S A;  3C0R B;  1KJT A;  2IO1 B;  2MCN B;  3R7Q A;  5C23 A;  3VAW A;  4MGZ E;  2KDF B;  1E90 A;  3AUL A;  2DYO A;  3PLV A;  4W9J A;  4DHJ B;  5JHA A;  2UYZ B;  4GIV A;  2LGY A;  2LVP A;  4PS8 A;  2KLC A;  2AL6 A;  4FJY A;  4B9K A;  5GMV A;  4HCP B;  4IW0 A;  3UIP B;  4K81 A;  1WH3 A;  4EUT A;  4W9H A;  4EKU A;  4B95 A;  3V61 A;  3HM6 X;  2LI5 A;  4ICU A;  4J6I A;  4DHZ B;  1KOT A;  4NPN A;  1UBI A;  2IBI B;  1WXA A;  3T9L A;  3JVZ X;  2J0K A;  2ZVN A;  3DBH I;  4FUL A;  4JL9 A;  1ZGU B;  2ZPN A;  4GMV A;  4HJK A;  3NHE B;  4PS7 A;  1C1Y B;  4W9E A;  1XD3 B;  2JZ3 B;  2BWE S;  1E7V A;  3QX1 A;  4WAA A;  4DHZ E;  4DDG D;  4PYU A;  4EOY A;  1WMH A;  1TZ1 A;  3H9D A;  3PHW B;  2GMI C;  3JSV B;  1G6J A;  3UQB A;  3A9K B;  1WZ3 A;  3L08 A;  2LRU A;  1QZE A;  3ML9 A;  4HPM B;  1RLF A;  5CTR C;  3U8Z A;  1WGY A;  3VVW B;  2IY0 B;  2JVC A;  1J19 A;  2GBR A;  2V4L A;  3EEC A;  4P7I A;  4GXB A;  1WX7 A;  3ZKJ C;  4ASW C;  4KDL B;  3ZW3 A;  2N4F A;  3A4S C;  2KC1 A;  1P9D U;  4MGK E;  4RM8 A;  1V9J A;  3ZO5 B;  2KFJ A;  2N1W A;  2O2V B;  4K1R B;  1V5O A;  2MQJ A;  2BYV E;  3A4R A;  1FXT B;  2DX5 B;  3ECI A;  3ZNI D;  2MLB A;  4LDT D;  1EO6 A;  3T8M A;  2L3Z A;  1E5W A;  2WX1 A;  4IWQ A;  2ZVO A;  4AJY B;  3PRE A;  4WWP A;  3TBL D;  1IPG A;  2G3Q B;  2KXJ A;  4GSW A;  2BWF A;  1JRU A;  3ZVV A;  2MRP A;  2D07 B;  2KDE B;  4NJ7 A;  3VXW A;  2KX0 A;  1SGH A;  5D7G A;  4LJO B;  3UGB B;  3GOE A;  2MP2 B;  5AZH A;  2JZZ A;  5CX3 A;  5DPR A;  2IY1 B;  3VDZ A;  1E8W A;  2MBO A;  1P3Q U;  1UBQ A;  5J2R A;  4PS3 A;  3V6C B;  1HE8 A;  2RGF A;  3P2B A;  3KUD B;  1P1A A;  2K8B A;  3DBS A;  5AZF A;  1Q5W B;  1LFD A;  2WYQ A;  3B08 A;  4PYZ A;  3N3K B;  3ZTD A;  2KDB A;  2JXX A;  4TV3 A;  4HCN B;  2ZZP B;  4M8N A;  3TMP B;  2L0T A;  1WZ0 A;  1Z2M A;  2O2V A;  2ZCC A;  5DPS A;  2Y5B B;  3GZN I;  4GDK A;  5E6P A;  1XQQ A;  2BYF A;  1WI0 A;  2DEN B;  2JUO A;  2LUE A;  2M1M A;  1T0Y A;  5JZE B;  3HHM A;  3IVF A;  2OOB B;  1E7U A;  1WE6 A;  3SU8 X;  4W9I A;  2N9P C;  3L10 B;  3OJ4 B;  1V49 A;  4F7Z A;  4FA6 A;  4HDQ A;  2LVQ A;  2NPT A;  4MH0 E;  2D10 A;  4IWO A;  2FCQ A;  4HXD A;  2NS5 A;  1Z5S B;  5DPW A;  4AOF A;  2D11 A;  3DCG A;  4JQW C;  1WY8 A;  3JW0 X;  4WWN A;  2MBQ A;  2Z0E B;  2V3S A;  3DVN V;  3ZDT A;  3A9K A;  1RRB A;  3WAM A;  4BVU C;  2R2Q A;  3PGE A;  3VUY A;  2KVR A;  2L8J A;  4DWF A;  2GBK A;  3L13 A;  3L54 A;  2KMC A;  5E6O A;  2L00 B;  4BKT A;  4AJW A;  2L7R A;  2K8C A;  2C9W B;  3BY4 B;  1IP9 A;  2DHZ A;  4MGI E;  2K8H A;  3Q3J A;  4XZ4 A;  5LXI B;  1V80 A;  4KZ0 A;  2C60 A;  2G4S A;  5D2M B;  3N30 A;  4MEL A;  1EF5 A;  4XC2 A;  4M0W B;  2KMA A;  4GOC A;  1NBF C;  2VRR B;  2MA9 B;  2KK8 A;  3ZNH B;  4A20 A;  3UQA A;  3KH0 A;  4GDL A;  3NZU A;  2REX A;  1WXM A;  4W9L A;  1RAX A;  1YIW A;  2FUH B;  2XEW A;  4FLH A;  3WA0 A;  1D3Z A;  2J7Q B;  3DOW A;  3PSE B;  4GGQ A;  1E8X A;  5BO4 B;  2UWQ A;  4AP4 C;  2CR5 A;  3ENE A;  1NDD A;  4DBG A;  2KOX A;  4W9C A;  3U7D A;  2ZJD A;  4BOZ B;  2N1V A;  4OVU A;  3VHT C;  2CHX A;  2OJR A;  3APD A;  4F1S A;  4TQ0 A;  3RCZ A;  1Y8R C;  4G11 A;  2MP2 A;  1S3S G;  1UEL A;  3PS6 A;  1TGZ B;  2O6V D;  2EMS A;  4W9F A;  4RM9 A;  4BKG A;  1OEY A;  4KSK C;  2QHO A;  3UF8 A;  5G55 A;  2LAS A;  3MTN B;  2MBE A;  1GG3 A;  3K9O B;  2NR2 A;  4WQO B;  2CKH B;  3JYU A;  4JLC A;  2K39 A;  3PT2 B;  2CHW A;  2G45 B;  2LGX A;  5L83 A;  2A5U A;  2KTR A;  1H4R A;  3APF A;  3PHX B;  3RUL A;  4FBJ B;  2PPH A;  3VFK A;  3IBE A;  1WJU A;  1WM3 A;  2JRI B;  3QAQ A;  3ZRC A;  2N9X A;  3HK0 A;  4GDL B;  1V6E A;  4AWJ A;  4IUM B;  2YLM A;  2Z0D B;  4FHK A;  3DVN U;  1M94 A;  3TCA A;  3X23 A;  1SIF A;  4ANW A;  4FJV B;  1OTR B;  4IC7 B;  2NBV B;  4LJP B;  4XX5 A;  2K6Q A;  1WGG A;  3DPD A;  4I6L B;  4EZK A;  1WX9 A;  2DZI A;  3DVG Y;  3EFU A;  2M0X A;  2Z59 B;  4IM2 A;  4DK5 A;  1I42 A;  2KWV B;  3B0A A;  1LM8 B;  1LXD A;  2N9E B;  2AWT A;  2ZEQ A;  4MM3 A;  1WE7 A;  4CO7 A;  3V62 A;  1Q0W B;  3KUZ A;  2FCS A;  3M62 B;  3QC8 B;  4K7U A;  4JIO U;  5G2N A;  1WXS A;  1WYW B;  1R4M I;  4DXA B;  2CU1 A;  2DZK A;  1WJ4 A;  3KVF B;  2IYD B;  2MBB B;  2ZCB A;  4E74 A;  5DCN A;  5AEK B;  1K8R B;  1WF9 A;  2C7H A;  2BKF A;  1PQS A;  4KDI C;  1S1Q B;  5IAA C;  1XT9 B;  4MSQ B;  2JY6 A;  3PRZ A;  3MJW A;  3NOB A;  2LJ5 A;  3H7P A;  2HJ8 A;  2EKE C;  3OLM D;  4W9K A;  3QWZ B;  4FHJ A;  4WJO A;  2MW5 A;  1LQB A;  1GNU A;  2GBJ A;  3IFW B;  4GB9 A;  5EDS A;  3AI5 A;  4A3O A;  3ONS A;  3CF6 E;  3ZRF A;  2NCN A;  1IYF A;  1CMX B;  1C3T A;  1GC6 A;  3NS8 A;  1YD8 U;  4BBN F;  1Q1O A;  4KSL C;  3S2A A;  4NAW A;  3ZUN A;  4MJS A;  3RT3 B;  1WIA A;  4X57 B;  4EZJ A;  2DYM A;  2EMT A;  4WWO A;  3AU4 A;  4NNJ B;  5FR6 A;  3SD5 A;  2WX0 A;  1WXV A;  2N7E A;  2K6D B;  1WX8 A;  2NBU A;  1J0G A;  4CHK A;  2DAJ A;  3ZNG C;  3N32 A;  3L17 A;  2ASQ A;  2LD9 A;  1EUV B;  5KHO A;  1YX6 B;  3D32 A;  4IWP A;  3AXC A;  1WFY A;  1V81 A;  2WDT B;  3KYC D;  4LDT B;  3VTV A;  3O65 B;  2BKR B;  2GBN A;  2BPS A;  1WM2 A;  3R3M A;  4II2 B;  3PRM B;  3DBL I;  3V6E B;  4EFO A;  3QCA A;  2PE9 A;  3QA8 A;  1A5R A;  2IO0 B;  3A9J B;  5DPT A;  3WAN A;  2NBW B;  4IM3 A;  3B1L X;  2IO3 B;  3OJ3 A;  4HK2 A;  2W9N A;  2DYB A;  4G50 A;  4RMA A;  2XK5 B;  2KJH B;  3A33 B;  5J17 A;  2KFK A;  1I35 A;  2FNJ B;  2KZR A;  2MBH A;  4FAD A;  4ANV A;  4OVV A;  3R7R A;  2NVU I;  2JWZ A;  1R4N I;  3KUC B;  2KHW B;  5JHB A;  2LXC A;  3CSF A;  4LCD E;  2AL3 A;  4TUU A;  3M3J A;  4ZYN A;  2K25 A;  4II3 B;  3NY5 A;  2JPH A;  1WJN A;  2KWC A;  1SE9 A;  3RYT A;  3PTF C;  4ZRK A;  4HLE A;  3VTU A;  5D94 A;  5LLI A;  4MSM B;  4EZL A;  2M4N A;  2LXA A;  3DDC B;  4N9F 4;  3SHQ A;  1H8C A;  2JT4 B;  2J0M A;  1KM7 A;  4KIK A;  1U4A A;  2KD0 A;  2O6V A;  3HIZ A;  4F8C B;  2B3A A;  2MSE D;  2C7M B;  4ICV A;  1EF1 A;  4BKS D;  2K1F A;  2LGD A;  5IA7 A;  2JRH A;  4FJZ A;  1WMH B;  2I1J A;  2KQS A;  2RD0 A;  3VH3 B;  4AUQ C;  4WJN A;  4ZRJ A;  2V1Y A;  2XBB C;  1RFA A;  2BYE A;  4ANX A;  3LJ3 A;  2KX3 A;  3SDL C;  1WGH A;  1VD2 A;  1YQB A;  2GOW A;  2FAZ A;  2LVO A;  2DZM A;  1GC7 A;  4TKN A;  4HVB A;  1WJ6 A;  3A1Q A;  4DHJ D;  5E6N A;  4URK A;  1V2Y A;  2CHZ A;  4KZC A;  2HD5 B;  1ISN A;  4NAW B;  1NI2 A;  2KNB A;  3IG3 A;  1UD7 A;  4GDK B;  4HWI B;  3I3T B;  5HKH A;  1J8C A;  3RZF A;  3QQ8 B;  1OGW A;  1WGR A;  3QHT A;  3W1S C;  1F9J A;  3PVL A;  1UZX B;  1WR6 E;  3H7P B;  3LDZ E;  4BFR A;  1GUA B;  4JGH B;  3HM3 A;  4W9D A;  2HE7 A;  3VUX A;  3ZNZ B;  3M95 A;  3MHS D;  2WWZ A;  3H1U A;  2LRW A;  3R66 C;  2C7N B;  2FCN A;  3QK0 A;  2XK5 A;  2KTF A;  2D3G A;  1KLV A;  2J0J A;  3TJP A;  3KYD D;  4MDK E;  2ZPY A;  4YL8 A;  3WIM A;  4I6N B;  2PJH A;  4E71 A;  2AEH A;  1TBE A;  3TIX A;  4W9G A;  4G0N B;  3A9J A;  2ZNV B;  3W1Y A;  1V5T A;  3X0W A;  4NJ6 A;  3PLU A;  3L16 A;  4HPL B;  3RZW C;  2FIF A;  3ZLZ A;  3ML8 A;  1MG8 A;  4NQL B;  3UIO B;  5C1Z A;  3CMM B;  3AU5 A;  2DAF A;  1OQY A;  2M17 A;  2NPT B;  1WGD A;  5CHV C;  2A4Z A;  1TTN A;  3WAP A;  3L0W B;  5CHF A;  3ZTC A;  2PE6 B;  2YVC A;  1X1M A;  2GBM A;  4A3P A;  4MJS B;  2KN5 A;  5LXH A;  2KTR B;  2G4D B;  2KFK B;  4BKS A;  2KAN A;  3DBR I;  2RSU A;  2MX2 A;  1BT0 A;  3JSV A;  2HTH A;  4ANU A;  5TR5 A;  1GJZ A;  1UGM A;  4K7S A;  3BIN A;  4MGY E;  2IZV B;  4HDO A;  1VCB A;  2L76 A;  3QJZ A;  3ALB A;  2RR9 A;  1WRD B;  1V86 A;  1ZKH A;  2KJ6 A;  4KVG B;  2N7D A;  3PV1 A;  3QAR A;  3DQV A;  1P0R A;  3TL5 A;  2I1K A;  3IHP C;  3H6N A;  4G3X B;  3Q3F A;  4ZRI A;  2ZNV C;  4I6P A;  4TQ1 A;  3U30 A;  3VTW A;  1L7Y A;  3QIJ A;  4NY0 A;  2M8S A;  2C5L C;  3APC A;  5CHW A;  3VUW A;  3PZD A;  3OAW A;  4GU2 A;  2BGF A;  2FCM A;  3H7S A;  4EEW A;  2DZJ A;  3M63 B;  5AZG A;  5D6J B;  2FID A;  4E3C A;  2KJR A;  2JF5 A;  4KV2 A;  2KC2 A;  1E8Y A;  1YJ1 A;  2L0F A;  1ZW7 A; 
#chains in the Genus database with same CATH topology
 4J3O D;  2BB5 A;  2L05 A;  3DVG X;  3VH4 B;  1C9F A;  2KKC A;  4GN1 A;  2PEA A;  2L32 A;  5J18 A;  1L0X B;  3BK1 A;  3Q6B A;  1IGD A;  4K7W A;  3CST A;  2BVC A;  2OHF A;  3K9P B;  1C4A A;  4H2A A;  2RPQ A;  4ZDV A;  1D5X C;  2FUG 1;  4MEM A;  4KIK B;  3ZJV A;  2RPV A;  4LTU A;  4B6W A;  3C0R B;  3TEX A;  1KJT A;  4MGZ E;  1UWX A;  2KDF B;  3AUL A;  4US9 A;  4W9J A;  4HCP B;  1FEH A;  3GZN B;  4K81 A;  3MJ5 A;  4W9H A;  4JPS A;  2LI5 A;  4ICU A;  3DBH I;  2ZPN A;  4HJK A;  1XD3 B;  2JZ3 B;  3QX1 A;  4DHZ E;  4DDG D;  3H9D A;  2B76 B;  4ITK A;  3JSV B;  1TKE A;  2LRU A;  3ML9 A;  4HPM B;  1RLF A;  3Q8B A;  2IY0 B;  2GBR A;  2CJO A;  3EEC A;  4P7I A;  1TKG A;  2WHI A;  4ASW C;  2LUM A;  2KC1 A;  1V9J A;  3ZO5 B;  2ACZ B;  2DLB A;  5BMG A;  1B9R A;  3ZNI D;  2BYV E;  5HI1 A;  1FXT B;  1QOB A;  3ECI A;  3T8M A;  2L3Z A;  1E5W A;  2WX1 A;  4AJY B;  2Y3A A;  3AM9 A;  1JRU A;  1AYF A;  2D07 B;  2KDE B;  4NJ7 A;  5HHD G;  3VDZ A;  4P1C C;  1P3Q U;  5J2R A;  4N59 A;  3V6C B;  1HE8 A;  3TEZ A;  1SE2 A;  3ZTD A;  3SFD B;  1YNT E;  2QCZ A;  2JXX A;  4TV3 A;  5HG2 A;  2V4I B;  4HCN B;  4M8N A;  2LGS A;  5JZE B;  2DEN B;  2W3R A;  2M1M A;  1N63 A;  4UDU C;  4GLS C;  1DGJ A;  3OJ4 B;  1V49 A;  3GB1 A;  2N0S B;  2D10 A;  2FCQ A;  3SFE B;  2NS5 A;  1JWS D;  3MP9 A;  4JQW C;  3JW0 X;  2V3S A;  1QIL A;  1RRB A;  3OWE B;  1V1P B;  2R2Q A;  3AEF B;  3VUY A;  4DWF A;  2YEP B;  3B9J A;  1KFY B;  1JQ4 A;  2VZK B;  3WCQ A;  4EE2 A;  4WWM A;  1V80 A;  4KZ0 A;  3N30 A;  2KAJ A;  1NBF C;  1SE4 A;  4GDL A;  1WXM A;  3OG5 A;  2BQQ A;  1L6U A;  1RAX A;  1YIW A;  2GLS A;  3DOW A;  4L23 A;  4C80 A;  2CR5 A;  1VZ8 A;  4MAC A;  1QOG A;  3U7D A;  2N1V A;  2M19 A;  2CHX A;  4F1S A;  1SEB D;  3RCZ A;  4A8X C;  1S3S G;  2LAS A;  3BK2 A;  5G5G A;  2NR2 A;  4WQO B;  1E9M A;  3NS1 A;  2KTR A;  1H4R A;  4FBJ B;  3VFK A;  1XEE A;  2N9X A;  3GE3 C;  4AWJ A;  4YWG G;  3DVN U;  3TCA A;  4XX5 A;  2K6Q A;  3DPD A;  2D3B A;  2M0X A;  2KDM A;  2Z59 B;  3Q69 A;  1I42 A;  2KWV B;  1LM8 B;  2AWT A;  1L4D B;  3KWL A;  5G2N A;  4JIO U;  3RMK C;  1WJ4 A;  3KVF B;  2MBB B;  1DYQ A;  4E74 A;  1K8R B;  4LNO A;  2AQ1 B;  3PRZ A;  5BYR A;  3OLM D;  3Q2A C;  4FHJ A;  3AN1 A;  1GB1 A;  3FAH A;  1ZXH A;  2GBJ A;  3CF6 E;  3KLS X;  3PZ7 A;  4RGN A;  3NS8 A;  4BBN F;  4NNJ B;  2WX0 A;  1WXV A;  4KX6 B;  2G9H D;  2DAJ A;  3L17 A;  1EUV B;  1V81 A;  2WDT B;  3KYC D;  4OZB A;  3BVZ A;  4P6V F;  3DBL I;  3Q8F A;  3QA8 A;  1A5R A;  1YN4 A;  1HQR D;  3OJ3 A;  2W9N A;  2JYE A;  2DYB A;  1F77 A;  3NVY A;  2KJH B;  3A33 B;  4NJC A;  3CIR B;  2CJN A;  4ANV A;  1R4N I;  1XLQ A;  1NYQ A;  1T0R C;  2K25 A;  2JPH A;  2KWC A;  1SE9 A;  3RYT A;  2D3C A;  2WXM A;  3PTF C;  1K51 A;  1GOZ A;  1H8C A;  1U4A A;  3MC0 B;  2B3A A;  1J7C A;  2C7M B;  4ICV A;  4BKS D;  2K1F A;  5IA7 A;  2I1J A;  4OZA A;  2KQS A;  4K3B A;  2PTL A;  1PGX A;  1C79 A;  2XBB C;  4S17 A;  2BYE A;  4P1B C;  3P4R B;  1WXQ A;  1MHH E;  3SDL C;  1YQB A;  2LVO A;  3N1Y C;  4HVB A;  1I4P A;  3A1Q A;  4DHJ D;  5E6N A;  1T0S C;  3T3O A;  4KZC A;  1ISN A;  3IG3 A;  1XLP A;  3I3T B;  3RZF A;  3QQ8 B;  3B2F A;  1OGW A;  3R2I A;  3PVL A;  3H7P B;  2AQ3 B;  1I4Q A;  3VUX A;  2WWZ A;  2C7N B;  2HJ1 A;  2XK5 A;  1VJK A;  3KYD D;  2AEH A;  1MJD A;  4HPL B;  3RZW C;  3DHH C;  1QOF A;  4BZA A;  4NQL B;  2QIE B;  1OQY A;  2M17 A;  5CHV C;  2IGG A;  1TTN A;  2L83 A;  5HFY A;  1SE3 A;  1EU4 A;  1F2R C;  4MJS B;  4YT0 B;  3DBR I;  3V05 A;  4JWS C;  1BT0 A;  4ANU A;  4K7S A;  3BIN A;  1FXI A;  2IZV B;  3BWU D;  2PKO A;  1WRD B;  1ZKH A;  3AED B;  3SEB A;  3QAR A;  3DQV A;  3TL5 A;  2WXJ A;  3Q3F A;  4ZRI A;  2ZNV C;  3VTW A;  1K52 A;  1XO3 A;  2AX5 A;  2W82 A;  4NY0 A;  2IDY A;  3VUW A;  2BGF A;  2FCM A;  1R4M B;  1GPX A;  2E6X A;  1E8Y A;  2QEJ C;  4YSY B;  1OEY J;  2LWP A;  1ZE3 D;  4IG7 B;  4NZL B;  1E8Z A;  1PYW D;  3Q8C A;  3ZIM A;  3WAL A;  3RUI B;  2D3A A;  3ZJU A;  1P7F A;  3EHV A;  3HVD A;  3IXS A;  3RNA C;  2BT6 A;  5L95 C;  2O6V B;  1KLU D;  3KW5 B;  4CYE A;  2BS2 B;  2KO3 A;  2VZK D;  1PUT A;  1PGA A;  2BF8 B;  1WR1 A;  1N5X A;  3SR6 A;  3W1S A;  1R4N B;  5C23 A;  2L1A A;  4DHJ B;  5JHA A;  2UYZ B;  1TJE A;  2YEP F;  4KKI A;  4IKG A;  4B9K A;  5GMV A;  1OQQ A;  4IW0 A;  1UGJ A;  1T5X D;  1K53 A;  4EKU A;  3HM6 X;  4DHZ B;  4J6I A;  4NPN A;  1UBI A;  4D2K A;  2IBI B;  1FCL A;  3TSS A;  2WXO A;  4YSX B;  1JRO A;  1BUI C;  2ZVN A;  1ZGU B;  1SXT A;  1E10 A;  1FXA A;  4WAA A;  2QMT A;  1V97 A;  4EOY A;  1I4G A;  1WMH A;  1TZ1 A;  3PO0 A;  1G6J A;  3UQB A;  3A9K B;  3KQ4 A;  3RPF C;  3GS2 A;  4TSS A;  3BVG A;  2JVC A;  2V4L A;  3ZW3 A;  2N4F A;  1P9D U;  4RM8 A;  1DOX A;  4OHJ A;  2N1W A;  4C7Y A;  4ZOH C;  4K1R B;  3A4R A;  2JSV X;  1AW7 A;  2ZVO A;  3PRE A;  4WWP A;  4WH4 A;  3TBL D;  2BWF A;  2BB6 A;  3ZVV A;  2MRP A;  5D7G A;  2JZZ A;  2IY1 B;  3GP7 A;  1UBQ A;  1M4V A;  2K8B A;  2RMM A;  3DBS A;  4C4V B;  2WYQ A;  2V3N A;  4PYZ A;  3N3K B;  1HTQ A;  3AB5 A;  1YOV B;  5TSS A;  1HEZ E;  5LNK 1;  5DPS A;  4GDK A;  3GZN I;  5E6P A;  1XQQ A;  1TT5 B;  3HHM A;  1AWD A;  3IVF A;  1ZP0 B;  5BYS A;  1STE A;  2AQ2 B;  3I57 A;  4L1B A;  4HDQ A;  2Z8L A;  2KAC A;  1WYG A;  1N62 A;  2D11 A;  1SJE D;  4WWN A;  1EU3 A;  3A9K A;  3Q3O C;  1RM6 C;  3EUB 2;  1D5M C;  3L54 A;  4BKT A;  2I2Y A;  4AJW A;  2L7R A;  2W54 A;  3Q14 C;  1IP9 A;  3Q3M C;  1GB4 A;  4DXG A;  2JQR B;  5D2M B;  1EF5 A;  4ARI A;  4M0W B;  2W55 A;  5BMI A;  1D5Z C;  4GOC A;  2VRR B;  1ET6 A;  2MA9 B;  4A9A A;  1I7H A;  3IAS 1;  3RN9 C;  3ZNH B;  4A20 A;  3NZU A;  4W9L A;  2XEW A;  2WXL A;  3N1X C;  4GGQ A;  2WNM A;  1SF0 A;  4M01 A;  1N61 A;  1NDD A;  4DBG A;  1KF6 B;  2G1E A;  3VHT C;  4AQ7 A;  4TQ0 A;  4G11 A;  2MP2 A;  3AEG B;  4BKG A;  1OEY A;  4KSK C;  4PK1 A;  2QHO A;  2MBE A;  1GG3 A;  3DWM A;  3N1Z C;  2EKI A;  2JU6 X;  3PT2 B;  2CHW A;  2G45 B;  2LGX A;  1PDX A;  5L83 A;  2A5U A;  3AV8 A;  3RUL A;  2PMV A;  3IBE A;  2J53 A;  3BZD B;  1VDV A;  3QAQ A;  3ZRC A;  1XXG A;  3NVV A;  4FHK A;  1OTR B;  4LJP B;  4I6L B;  1WGG A;  3BYT B;  4DQO C;  2LHE A;  4EZK A;  1WX9 A;  2DZI A;  3B0A A;  4MM3 A;  1LXD A;  2ZEQ A;  4CO7 A;  1WE7 A;  1CQV A;  3QC8 B;  2QDF A;  1WXS A;  1NI3 A;  1J7B A;  1FIQ A;  4DXA B;  2DZK A;  3FKY A;  5DCN A;  5AEK B;  2HTM E;  2C7H A;  1S1Q B;  1JAL A;  5IAA C;  1XT9 B;  2JY6 A;  1E7P B;  2JYT A;  4HEA 1;  4LK0 M;  2LGI A;  3IFW B;  1GNU A;  4NAM A;  3RNC C;  4BAX A;  2NCN A;  3MFG A;  1C3T A;  1GC6 A;  1Q1O A;  4NAW A;  4MJS A;  3RT3 B;  3AE3 B;  3AU4 A;  5FR6 A;  2N7E A;  2K6D B;  2NBU A;  4REZ A;  1LGR A;  4MH8 A;  2RDG A;  3D32 A;  3AXC A;  2BKR B;  4II2 B;  3AH7 A;  3PRM B;  3V6E B;  5C3J B;  4EFO A;  2PE9 A;  2NBW B;  4ZYS A;  2PLP A;  2ZW0 A;  4IM3 A;  2IO3 B;  4HK2 A;  4RF0 A;  2JZP A;  3P1M A;  2WU5 B;  4RMA A;  2XK5 B;  4Q2J A;  2KFK A;  2WP9 B;  2KZR A;  3NUH B;  5C2T B;  4FAD A;  3I9V 1;  4OVV A;  2KHW B;  5JHB A;  4LCD E;  3CSF A;  2AL3 A;  2WXK A;  3M3J A;  1WJN A;  4ZRK A;  4HLE A;  3VTU A;  4MSM B;  3AE6 B;  3DDC B;  4JWU C;  3CWI A;  4KIK A;  3HIZ A;  3DWG C;  4LLG M;  3FIL B;  3VRB B;  2WXR A;  1WMH B;  4AUQ C;  4WJN A;  3BYY B;  3E56 A;  1RFA A;  4ANX A;  1KRH A;  5EE9 A;  3V3X A;  3U52 E;  1HA5 A;  1VD2 A;  2GOW A;  2WDQ B;  4YXD B;  3ZXR A;  1GC7 A;  4TKN A;  1WJ6 A;  3NVW A;  2NTS A;  1V2Y A;  1EWC A;  2N9K A;  2RDH A;  4C7Z A;  1KTK A;  4HWI B;  1J8C A;  3MC9 A;  4US8 A;  1WR6 E;  3FC4 A;  4BFR A;  3HM3 A;  4LNF A;  3ZNZ B;  1I4H A;  3MHS D;  5FR3 A;  2LRW A;  2FCN A;  2J0J A;  4ZRP A;  3TJP A;  4MDK E;  3WIM A;  4I6N B;  4E71 A;  4G0N B;  3A9J A;  2ZNV B;  1V5T A;  3FIL A;  3J9C A;  3VRA B;  4LNN A;  2H89 B;  1MG8 A;  3KWV A;  1NEK B;  3P63 A;  2KTR B;  2G4D B;  4BKS A;  2KAN A;  2RSU A;  3JSV A;  4DXF A;  1GJZ A;  1OQR A;  1VLB A;  4L2Y A;  4MGY E;  5BYQ A;  2L76 A;  1HZ6 A;  2HDE A;  3AE9 B;  2M56 B;  3ALB A;  3N9Y C;  3QIJ A;  2C5L C;  1D6E C;  3APC A;  5CHW A;  3OAW A;  2Y5C A;  1DOY A;  2DZJ A;  3M63 B;  5D6J B;  1MHX A;  4E3C A;  2JF5 A;  2KJR A;  4KV2 A;  3W2D A;  1YJ1 A;  5DPT A;  1ZW7 A;  2BS4 B;  3ZDM C;  4USA A;  1AAR A;  1VZ7 A;  3EFC A;  3A1Q B;  1L2N A;  2KWU B;  2LZ6 A;  3PRP B;  3NZS A;  4P16 A;  1UWM A;  1A70 A;  2D2Q A;  5KHQ A;  3VR8 B;  1YX5 B;  3UIN B;  3VQI A;  4BBN C;  1L6V A;  3WAO A;  3RFZ B;  3EC8 A;  3P4Q B;  3EGR A;  3P4S B;  4WJQ A;  3RD2 A;  2CS4 A;  2AYO B;  2KDI A;  3R7Q A;  3RNE C;  3VAW A;  2PIA A;  1E90 A;  2DYO A;  2LGY A;  1XCQ L;  2WXQ A;  1PGB A;  4PS8 A;  2AL6 A;  3U4E G;  4OVZ A;  1ZXI A;  3UIP B;  1CK1 A;  4AS1 A;  1BML C;  3HVZ A;  4B95 A;  3V61 A;  5IKC M;  1KOT A;  4WUR A;  2N7J A;  4WAF A;  1WXA A;  3T9L A;  3JVZ X;  2L52 A;  5JXV A;  1QF6 A;  2OED A;  4FUL A;  2KVZ A;  4GMV A;  1HZ5 A;  2IGH A;  2SEB D;  5FK9 C;  3NHE B;  4PS7 A;  5IO9 A;  4A6Q A;  2BWE S;  3U2S C;  1E7V A;  1ACC A;  4RGT A;  1PFD A;  1K50 A;  2JX5 A;  3B2G A;  2GMI C;  2WXP A;  1WZ3 A;  1ZOY B;  5CTR C;  3W5U B;  3U8Z A;  1WGY A;  3VVW B;  4R3D A;  1XF5 L;  1WX7 A;  2PW9 A;  3Q3N C;  2IJ0 A;  1RWS A;  1V8C A;  4B0E A;  3A4S C;  4MT5 A;  1KH0 A;  2PVO D;  2KFJ A;  1N60 A;  1HXY D;  1V5O A;  2MQJ A;  2DX5 B;  1SB3 C;  2MLB A;  1EO6 A;  4LDT D;  1ZUD 2;  3ZQ4 A;  1IPG A;  2IGD A;  2KXJ A;  4C4V A;  3VXW A;  2KX0 A;  1SGH A;  2W3S A;  3UGB B;  5DPR A;  3LYY A;  2KYW A;  4PS3 A;  2RGF A;  3P2B A;  3KUD B;  1P1A A;  1JWU D;  1Q5W B;  2Y5P A;  1TKY A;  3TEY A;  2KDB A;  1E6E B;  1Q10 A;  2ZZP B;  3TMP B;  3ZJT A;  1WZ0 A;  1Z2M A;  2WXF A;  1JML A;  1RFK A;  2Y5B B;  2BYF A;  1WI0 A;  4RGO S;  1T0Y A;  4YSZ B;  1E7U A;  1WE6 A;  3SU8 X;  2N9P C;  3L10 B;  2K9X A;  2LVQ A;  2NPT A;  2BYT A;  1V1O A;  2RDB C;  2MJ3 A;  4C56 C;  4AOF A;  4XGA B;  3DCG A;  1WY8 A;  1IGC A;  2MBQ A;  2Z0E B;  3W5V B;  3DVN V;  3ZDT A;  2OJW A;  4BVU C;  3PGE A;  2KVR A;  2L8J A;  2GBK A;  4JX1 C;  3L13 A;  2KMC A;  2MH7 A;  5E6O A;  2L00 B;  3ABV B;  2K8C A;  2C9W B;  2KN4 A;  3BY4 B;  2X38 A;  4MGI E;  2K8H A;  2C60 A;  1EM7 A;  2G4S A;  2M0A A;  3DHI C;  2KT7 A;  4O1N A;  4MEL A;  4XC2 A;  4XE0 A;  2KMA A;  1FD6 A;  2KK8 A;  2MJD A;  5IN7 A;  3UQA A;  3KH0 A;  3NVZ A;  2REX A;  1VRA B;  2J42 A;  1D3Z A;  5BO4 B;  2QC8 A;  4ARC A;  2KOX A;  3BII D;  2DWQ A;  2V0G A;  1JW9 D;  2WDV B;  4OVU A;  4ZHP A;  2OJR A;  3APD A;  1TY0 A;  1Y8R C;  1UEL A;  2H88 B;  3L4P A;  3DBR B;  2EMS A;  5G55 A;  3MTN B;  3K9O B;  3JYU A;  2BS3 B;  4N6E B;  3PHX B;  2X8X X;  1F0Z A;  4LNI A;  1WJU A;  2KWD A;  3HK0 A;  4IUM B;  2NTT A;  3X23 A;  1SIF A;  4ANW A;  4FJV B;  4XDC A;  2NBV B;  3DVG Y;  3EFU A;  2N9E B;  3C8Y A;  4XWT A;  3KUZ A;  1L0Y B;  1FRR A;  1WYW B;  1R4M I;  3AE1 B;  2CU1 A;  4MM3 B;  2ZCB A;  3Q8A A;  2BTE A;  1FNU A;  3TEW A;  1WF9 A;  5I4D A;  1PQS A;  3MJW A;  3NOB A;  5AUK A;  2LJ5 A;  3H7P A;  2HJ8 A;  2EKE C;  3QWZ B;  1Y56 A;  4WJO A;  2MW5 A;  1LQB A;  4A90 A;  2CU3 A;  4GB9 A;  3AI5 A;  1C78 A;  1D4B A;  1IYF A;  1QLB B;  1AN8 A;  1YD8 U;  4DDI D;  4KSL C;  3S2A A;  4X57 B;  2DYM A;  1WX8 A;  1WGK A;  1J0G A;  4CHK A;  1YX6 B;  3AE5 B;  4IWP A;  2J52 A;  1YN3 A;  2BPS A;  1WM2 A;  2WXN A;  1VR9 A;  3URY A;  3MHZ A;  1C77 A;  1YN5 A;  4KKJ A;  3B1L X;  4G50 A;  2TSS A;  4RNA A;  3R7R A;  4WIP A;  2IPK D;  3R2T A;  1FCC C;  2LXC A;  3I5J C;  4ZYN A;  3NY5 A;  4M0W A;  1NYR A;  4EZL A;  5LLI A;  2M4N A;  4N9F 4;  1JWB D;  2JT4 B;  3IT6 B;  2J0M A;  1KM7 A;  2KD0 A;  4F8C B;  2MSE D;  2QIL A;  3VH3 B;  5FKA C;  3GE8 C;  2LFI A;  3AE8 B;  4QAY A;  1R7S A;  2DZM A;  1UUP A;  1TS4 A;  2CHZ A;  2HD5 B;  3AEA B;  1FNV A;  2KNB A;  1YQ4 B;  1UD7 A;  2E3T A;  5D3I B;  5HKH A;  1L0V B;  1WRI A;  3W1S C;  1F9J A;  1UZX B;  3LDZ E;  4JGH B;  4W9D A;  2HE7 A;  3M95 A;  3LB8 C;  4OZC A;  3ZXV A;  3R66 C;  4CQN A;  2KTF A;  2UU7 A;  1F1H A;  1KLV A;  2BBC A;  3O13 A;  4YL8 A;  2PJH A;  1TBE A;  1ROE A;  1UNS A;  3N20 C;  1YJI A;  1I4X A;  2FBW B;  3AEE B;  3X0W A;  1FPY A;  3L16 A;  1SSN A;  5G5H A;  4XDD A;  4JE3 B;  1IUE A;  3UIO B;  5C1Z A;  1FNW A;  3AU5 A;  2DAF A;  4OW0 A;  2NPT B;  1SIJ A;  2A4Z A;  3L0W B;  5CHF A;  2PE6 B;  2YVC A;  2GBM A;  3Q8E A;  2MX2 A;  3AEC B;  4XWW A;  5TR5 A;  2FE8 A;  3QJZ A;  1ENF A;  2RR9 A;  1ZPS A;  1TS3 A;  2KJ6 A;  1CZP A;  5H8Y E;  3IHP C;  3H6N A;  1L7Y A;  4RFB A;  2LMC A;  2M8S A;  3H7S A;  2MEK A;  4EEW A;  2WQY B;  5AZG A;  2LHD A;  4A55 A;  4TQ1 A;  1E0Z A;  2MWS B;  2IO2 B;  2R2O A;  3PPA A;  4M8M A;  5JH5 C;  3ETR A;  4IOI E;  2VH1 A;  3DHG C;  3V60 A;  1IBX B;  1FRD A;  1YMH E;  4YTN B;  2WDR B;  2D5G A;  4WJP A;  3U7Z A;  1FO4 A;  2KQ7 A;  2KLG A;  4FN2 A;  3ZYY X;  2J4X A;  1V1P A;  1WWT A;  2INN E;  4NQK E;  5BMH A;  2NMQ A;  2K5P A;  4BOS C;  4IM0 A;  1ESF A;  1UH6 A;  1P98 A;  2IO1 B;  2MCN B;  3PLV A;  4GIV A;  1JWA D;  1OFF A;  2LVP A;  2KLC A;  4FJY A;  1LO5 D;  1C4P A;  1WH3 A;  4EUT A;  3AE7 B;  1FFV A;  2J0K A;  5IP4 D;  4JL9 A;  4IDI A;  2JXT A;  1L5P A;  1FM0 D;  1XLN A;  1C1Y B;  4W9E A;  4HRS A;  4KGR A;  2I38 A;  4PYU A;  3PHW B;  3L08 A;  3MC8 A;  1QZE A;  4ZRQ A;  1SJH D;  1FMA D;  1J19 A;  1P7E A;  4GXB A;  3ZKJ C;  4KDL B;  2LEK A;  4MGK E;  2QSD A;  2O2V B;  3T3N A;  2WGS A;  4IWQ A;  2G3Q B;  4GSW A;  3DBH B;  4LJO B;  3GOE A;  2MP2 B;  5AZH A;  5CX3 A;  1E8W A;  2MBO A;  5H92 C;  2K22 A;  3AE2 B;  5AZF A;  1LFD A;  3B08 A;  3AE4 B;  3AMZ A;  2ICI A;  1DOI A;  2L0T A;  2O2V A;  2ZCC A;  4TMA B;  2JUO A;  2LUE A;  2K0P A;  2IND C;  2OOB B;  1TZO A;  4W9I A;  4F7Z A;  4FA6 A;  1F52 A;  5AUI A;  4KGS A;  1QKZ A;  4MH0 E;  1MI0 A;  4IWO A;  4HXD A;  5DPW A;  1Z5S B;  3BVM A;  3P4P B;  4K3C A;  2WS3 B;  4WQM A;  2WXH A;  5IOI A;  1I4R A;  3WAM A;  3HRD D;  5EE0 A;  1XLO A;  2BW2 A;  1TS5 A;  1T0Q C;  2DHZ A;  5T8I A;  2GI9 A;  3E9S A;  4ZHO A;  3Q3J A;  4XZ4 A;  5LXI B;  2INP E;  2DBY A;  1MPE A;  1ZDX A;  1UF0 A;  4C00 A;  1WSP A;  1ET9 A;  2FUH B;  5MPO A;  4FLH A;  1NVI D;  3UI3 A;  3WA0 A;  2J7Q B;  4HRO A;  3PSE B;  1E8X A;  2UWQ A;  4AP4 C;  4M02 A;  2PVG C;  2XN9 C;  3ENE A;  4W9C A;  2ZJD A;  4BOZ B;  4XYC A;  1FFU A;  3NG0 A;  5EE3 A;  3PS6 A;  1TGZ B;  2O6V D;  4W9F A;  2ZW1 A;  4RM9 A;  2R61 A;  4M00 A;  4KGT A;  3UF8 A;  4RCO A;  1JRP A;  2CKH B;  4JLC A;  1CJE A;  1QOA A;  2K39 A;  3APF A;  2QJL A;  1SBB B;  2PPH A;  4PT5 A;  2JRI B;  1WM3 A;  2V9H A;  4GDL B;  1V6E A;  2YLM A;  2Z0D B;  1EWY C;  1M94 A;  3C19 A;  3H8H A;  4HPP A;  4IC7 B;  1L4Z B;  5E6J A;  4IM2 A;  4DK5 A;  4YTM B;  1T6B X;  3V62 A;  1Q0W B;  4ACF A;  2Q5W D;  2FCS A;  3M62 B;  4K7U A;  1HTO A;  1QT9 A;  2ON8 A;  2IYD B;  4RH6 A;  2BKF A;  4FXC A;  4KDI C;  4MSQ B;  3VR9 B;  4W9K A;  1KLG D;  5EDS A;  4A3O A;  3ONS A;  3ZRF A;  1TYG B;  1CMX B;  2V3P A;  2GB1 A;  3NRZ A;  3TUO A;  1JCK B;  3AEB B;  4EZJ A;  3ZUN A;  1WIA A;  5GXG B;  2EMT A;  4WWO A;  3SD5 A;  2MJE A;  1C76 A;  3ZNG C;  3N32 A;  1N5W A;  2ASQ A;  2LD9 A;  5KHO A;  1MVK A;  2EEL A;  1WFY A;  4LDT B;  3VTV A;  1RYJ A;  3O65 B;  2GBN A;  3R3M A;  1VZ6 A;  1J7A A;  3RNB C;  3QCA A;  2WU2 B;  1TIF A;  2IO0 B;  3A9J B;  3WAN A;  4LNK A;  2LJI A;  4RF1 A;  4RGM A;  3NZ3 A;  5J17 A;  1I35 A;  2FNJ B;  2MBH A;  2DNF A;  2NVU I;  2JWZ A;  4HKQ A;  3KUC B;  4TUU A;  3IT4 B;  4II3 B;  3I63 C;  4YTP B;  5D94 A;  2LXA A;  1MFW A;  2VH2 A;  2GRI A;  3SHQ A;  5EE1 A;  3RNF C;  4HKZ E;  2O6V A;  3IAM 1;  1EF1 A;  2LGD A;  2JRH A;  4FJZ A;  2RD0 A;  4ZRJ A;  2V1Y A;  3W9C B;  3LJ3 A;  2KX3 A;  1WGH A;  2FAZ A;  1B1Z A;  3PZ8 A;  2K3U A;  1QQR A;  4N58 A;  4S0R A;  4HJG E;  4URK A;  2KMM A;  1JWM D;  2WLB A;  4NAW B;  1NI2 A;  4GDK B;  1WGR A;  3QHT A;  2JWU A;  1GUA B;  1ZDV A;  3EA6 A;  1TY2 A;  2XNA C;  3H1U A;  1T3Q A;  2WXG A;  3QK0 A;  2D3G A;  2ZPY A;  2WXI A;  3TIX A;  1GAQ B;  1XCT L;  2INC C;  4W9G A;  3W1Y A;  5D3D A;  4NJ6 A;  3PLU A;  2FIF A;  2KQ4 X;  2ONQ A;  3ZLZ A;  3ML8 A;  1IBX A;  1MG4 A;  2SAK A;  3P42 A;  3ZGZ A;  3CMM B;  1YQ3 B;  1WGD A;  2N9L A;  3WAP A;  1BXT A;  3ZTC A;  1X1M A;  3R8B A;  3RNG C;  1C4C A;  4A3P A;  2KN5 A;  5LXH A;  2KFK B;  2HTH A;  1UGM A;  1NEN B;  4HDO A;  1VCB A;  2MHJ A;  1YJJ A;  4KVG B;  1TS2 A;  1V86 A;  3HUI A;  3NJT A;  2N7D A;  3PV1 A;  1P0R A;  3RI7 C;  2I1K A;  3DBL B;  4G3X B;  3U30 A;  4I6P A;  4B0M A;  1F2R I;  3PZD A;  4GU2 A;  1N6Z A;  3LXF A;  2FID A;  2KC2 A;  2L0F A; 
#chains in the Genus database with same CATH homology
 1OEY J;  3ZDM C;  2LWP A;  4IG7 B;  2L05 A;  1AAR A;  2MWS B;  3DVG X;  3VH4 B;  3A1Q B;  2KKC A;  1L2N A;  2KWU B;  2IO2 B;  2LZ6 A;  2PEA A;  1E8Z A;  3NZS A;  2R2O A;  3PRP B;  4GN1 A;  5J18 A;  2D2Q A;  3PPA A;  4M8M A;  4DDI D;  5JH5 C;  5KHQ A;  3V60 A;  4K7W A;  3ZIM A;  3WAL A;  3CST A;  3RUI B;  1YX5 B;  3UIN B;  3VQI A;  4WJP A;  3K9P B;  3EHV A;  2KQ7 A;  4BBN C;  2KLG A;  2RPQ A;  3WAO A;  3EC8 A;  4FN2 A;  4ZDV A;  4NQK E;  5L95 C;  2O6V B;  4MEM A;  3KW5 B;  4KIK B;  4CYE A;  2KO3 A;  4WJQ A;  4BOS C;  3RD2 A;  2BF8 B;  2CS4 A;  4IM0 A;  2AYO B;  1UH6 A;  2KDI A;  1P98 A;  1WR1 A;  4B6W A;  3W1S A;  3C0R B;  1KJT A;  2IO1 B;  2MCN B;  3R7Q A;  5C23 A;  3VAW A;  4MGZ E;  2KDF B;  1E90 A;  3AUL A;  2DYO A;  3PLV A;  4W9J A;  4DHJ B;  5JHA A;  2UYZ B;  4GIV A;  2LGY A;  2LVP A;  4PS8 A;  2KLC A;  2AL6 A;  4FJY A;  4B9K A;  5GMV A;  4HCP B;  4IW0 A;  3UIP B;  4K81 A;  1WH3 A;  4EUT A;  4W9H A;  4EKU A;  4B95 A;  3V61 A;  3HM6 X;  2LI5 A;  4ICU A;  4J6I A;  4DHZ B;  1KOT A;  4NPN A;  1UBI A;  2IBI B;  1WXA A;  3T9L A;  3JVZ X;  2J0K A;  2ZVN A;  3DBH I;  4FUL A;  4JL9 A;  1ZGU B;  2ZPN A;  4GMV A;  4HJK A;  3NHE B;  4PS7 A;  1C1Y B;  4W9E A;  1XD3 B;  2JZ3 B;  2BWE S;  1E7V A;  3QX1 A;  4WAA A;  4DHZ E;  4DDG D;  4PYU A;  4EOY A;  1WMH A;  1TZ1 A;  3H9D A;  3PHW B;  2GMI C;  3JSV B;  1G6J A;  3UQB A;  3A9K B;  1WZ3 A;  3L08 A;  2LRU A;  1QZE A;  3ML9 A;  4HPM B;  1RLF A;  5CTR C;  3U8Z A;  1WGY A;  3VVW B;  2IY0 B;  2JVC A;  1J19 A;  2GBR A;  2V4L A;  3EEC A;  4P7I A;  4GXB A;  1WX7 A;  3ZKJ C;  4ASW C;  4KDL B;  3ZW3 A;  2N4F A;  3A4S C;  2KC1 A;  1P9D U;  4MGK E;  4RM8 A;  1V9J A;  3ZO5 B;  2KFJ A;  2N1W A;  2O2V B;  4K1R B;  1V5O A;  2MQJ A;  2BYV E;  3A4R A;  1FXT B;  2DX5 B;  3ECI A;  3ZNI D;  2MLB A;  4LDT D;  1EO6 A;  3T8M A;  2L3Z A;  1E5W A;  2WX1 A;  4IWQ A;  2ZVO A;  4AJY B;  3PRE A;  4WWP A;  3TBL D;  1IPG A;  2G3Q B;  2KXJ A;  4GSW A;  2BWF A;  1JRU A;  3ZVV A;  2MRP A;  2D07 B;  2KDE B;  4NJ7 A;  3VXW A;  2KX0 A;  1SGH A;  5D7G A;  4LJO B;  3UGB B;  3GOE A;  2MP2 B;  5AZH A;  2JZZ A;  5CX3 A;  5DPR A;  2IY1 B;  3VDZ A;  1E8W A;  2MBO A;  1P3Q U;  1UBQ A;  5J2R A;  4PS3 A;  3V6C B;  1HE8 A;  2RGF A;  3P2B A;  3KUD B;  1P1A A;  2K8B A;  3DBS A;  5AZF A;  1Q5W B;  1LFD A;  2WYQ A;  3B08 A;  4PYZ A;  3N3K B;  3ZTD A;  2KDB A;  2JXX A;  4TV3 A;  4HCN B;  2ZZP B;  4M8N A;  3TMP B;  2L0T A;  1WZ0 A;  1Z2M A;  2O2V A;  2ZCC A;  5DPS A;  2Y5B B;  3GZN I;  4GDK A;  5E6P A;  1XQQ A;  2BYF A;  1WI0 A;  2DEN B;  2JUO A;  2LUE A;  2M1M A;  1T0Y A;  5JZE B;  3HHM A;  3IVF A;  2OOB B;  1E7U A;  1WE6 A;  3SU8 X;  4W9I A;  2N9P C;  3L10 B;  3OJ4 B;  1V49 A;  4F7Z A;  4FA6 A;  4HDQ A;  2LVQ A;  2NPT A;  4MH0 E;  2D10 A;  4IWO A;  2FCQ A;  4HXD A;  2NS5 A;  1Z5S B;  5DPW A;  4AOF A;  2D11 A;  3DCG A;  4JQW C;  1WY8 A;  3JW0 X;  4WWN A;  2MBQ A;  2Z0E B;  2V3S A;  3DVN V;  3ZDT A;  3A9K A;  1RRB A;  3WAM A;  4BVU C;  2R2Q A;  3PGE A;  3VUY A;  2KVR A;  2L8J A;  4DWF A;  2GBK A;  3L13 A;  3L54 A;  2KMC A;  5E6O A;  2L00 B;  4BKT A;  4AJW A;  2L7R A;  2K8C A;  2C9W B;  3BY4 B;  1IP9 A;  2DHZ A;  4MGI E;  2K8H A;  3Q3J A;  4XZ4 A;  5LXI B;  1V80 A;  4KZ0 A;  2C60 A;  2G4S A;  5D2M B;  3N30 A;  4MEL A;  1EF5 A;  4XC2 A;  4M0W B;  2KMA A;  4GOC A;  1NBF C;  2VRR B;  2MA9 B;  2KK8 A;  3ZNH B;  4A20 A;  3UQA A;  3KH0 A;  4GDL A;  3NZU A;  2REX A;  1WXM A;  4W9L A;  1RAX A;  1YIW A;  2FUH B;  2XEW A;  4FLH A;  3WA0 A;  1D3Z A;  2J7Q B;  3DOW A;  3PSE B;  4GGQ A;  1E8X A;  5BO4 B;  2UWQ A;  4AP4 C;  2CR5 A;  3ENE A;  1NDD A;  4DBG A;  2KOX A;  4W9C A;  3U7D A;  2ZJD A;  4BOZ B;  2N1V A;  4OVU A;  3VHT C;  2CHX A;  2OJR A;  3APD A;  4F1S A;  4TQ0 A;  3RCZ A;  1Y8R C;  4G11 A;  2MP2 A;  1S3S G;  1UEL A;  3PS6 A;  1TGZ B;  2O6V D;  2EMS A;  4W9F A;  4RM9 A;  4BKG A;  1OEY A;  4KSK C;  2QHO A;  3UF8 A;  5G55 A;  2LAS A;  3MTN B;  2MBE A;  1GG3 A;  3K9O B;  2NR2 A;  4WQO B;  2CKH B;  3JYU A;  4JLC A;  2K39 A;  3PT2 B;  2CHW A;  2G45 B;  2LGX A;  5L83 A;  2A5U A;  2KTR A;  1H4R A;  3APF A;  3PHX B;  3RUL A;  4FBJ B;  2PPH A;  3VFK A;  3IBE A;  1WJU A;  1WM3 A;  2JRI B;  3QAQ A;  3ZRC A;  2N9X A;  3HK0 A;  4GDL B;  1V6E A;  4AWJ A;  4IUM B;  2YLM A;  2Z0D B;  4FHK A;  3DVN U;  1M94 A;  3TCA A;  3X23 A;  1SIF A;  4ANW A;  4FJV B;  1OTR B;  4IC7 B;  2NBV B;  4LJP B;  4XX5 A;  2K6Q A;  1WGG A;  3DPD A;  4I6L B;  4EZK A;  1WX9 A;  2DZI A;  3DVG Y;  3EFU A;  2M0X A;  2Z59 B;  4IM2 A;  4DK5 A;  1I42 A;  2KWV B;  3B0A A;  1LM8 B;  1LXD A;  2N9E B;  2AWT A;  2ZEQ A;  4MM3 A;  1WE7 A;  4CO7 A;  3V62 A;  1Q0W B;  3KUZ A;  2FCS A;  3M62 B;  3QC8 B;  4K7U A;  4JIO U;  5G2N A;  1WXS A;  1WYW B;  1R4M I;  4DXA B;  2CU1 A;  2DZK A;  1WJ4 A;  3KVF B;  2IYD B;  2MBB B;  2ZCB A;  4E74 A;  5DCN A;  5AEK B;  1K8R B;  1WF9 A;  2C7H A;  2BKF A;  1PQS A;  4KDI C;  1S1Q B;  5IAA C;  1XT9 B;  4MSQ B;  2JY6 A;  3PRZ A;  3MJW A;  3NOB A;  2LJ5 A;  3H7P A;  2HJ8 A;  2EKE C;  3OLM D;  4W9K A;  3QWZ B;  4FHJ A;  4WJO A;  2MW5 A;  1LQB A;  1GNU A;  2GBJ A;  3IFW B;  4GB9 A;  5EDS A;  3AI5 A;  4A3O A;  3ONS A;  3CF6 E;  3ZRF A;  2NCN A;  1IYF A;  1CMX B;  1C3T A;  1GC6 A;  3NS8 A;  1YD8 U;  4BBN F;  1Q1O A;  4KSL C;  3S2A A;  4NAW A;  3ZUN A;  4MJS A;  3RT3 B;  1WIA A;  4X57 B;  4EZJ A;  2DYM A;  2EMT A;  4WWO A;  3AU4 A;  4NNJ B;  5FR6 A;  3SD5 A;  2WX0 A;  1WXV A;  2N7E A;  2K6D B;  1WX8 A;  2NBU A;  1J0G A;  4CHK A;  2DAJ A;  3ZNG C;  3N32 A;  3L17 A;  2ASQ A;  2LD9 A;  1EUV B;  5KHO A;  1YX6 B;  3D32 A;  4IWP A;  3AXC A;  1WFY A;  1V81 A;  2WDT B;  3KYC D;  4LDT B;  3VTV A;  3O65 B;  2BKR B;  2GBN A;  2BPS A;  1WM2 A;  3R3M A;  4II2 B;  3PRM B;  3DBL I;  3V6E B;  4EFO A;  3QCA A;  2PE9 A;  3QA8 A;  1A5R A;  2IO0 B;  3A9J B;  5DPT A;  3WAN A;  2NBW B;  4IM3 A;  3B1L X;  2IO3 B;  3OJ3 A;  4HK2 A;  2W9N A;  2DYB A;  4G50 A;  4RMA A;  2XK5 B;  2KJH B;  3A33 B;  5J17 A;  2KFK A;  1I35 A;  2FNJ B;  2KZR A;  2MBH A;  4FAD A;  4ANV A;  4OVV A;  3R7R A;  2NVU I;  2JWZ A;  1R4N I;  3KUC B;  2KHW B;  5JHB A;  2LXC A;  3CSF A;  4LCD E;  2AL3 A;  4TUU A;  3M3J A;  4ZYN A;  2K25 A;  4II3 B;  3NY5 A;  2JPH A;  1WJN A;  2KWC A;  1SE9 A;  3RYT A;  3PTF C;  4ZRK A;  4HLE A;  3VTU A;  5D94 A;  5LLI A;  4MSM B;  4EZL A;  2M4N A;  2LXA A;  3DDC B;  4N9F 4;  3SHQ A;  1H8C A;  2JT4 B;  2J0M A;  1KM7 A;  4KIK A;  1U4A A;  2KD0 A;  2O6V A;  3HIZ A;  4F8C B;  2B3A A;  2MSE D;  2C7M B;  4ICV A;  1EF1 A;  4BKS D;  2K1F A;  2LGD A;  5IA7 A;  2JRH A;  4FJZ A;  1WMH B;  2I1J A;  2KQS A;  2RD0 A;  3VH3 B;  4AUQ C;  4WJN A;  4ZRJ A;  2V1Y A;  2XBB C;  1RFA A;  2BYE A;  4ANX A;  3LJ3 A;  2KX3 A;  3SDL C;  1WGH A;  1VD2 A;  1YQB A;  2GOW A;  2FAZ A;  2LVO A;  2DZM A;  1GC7 A;  4TKN A;  4HVB A;  1WJ6 A;  3A1Q A;  4DHJ D;  5E6N A;  4URK A;  1V2Y A;  2CHZ A;  4KZC A;  2HD5 B;  1ISN A;  4NAW B;  1NI2 A;  2KNB A;  3IG3 A;  1UD7 A;  4GDK B;  4HWI B;  3I3T B;  5HKH A;  1J8C A;  3RZF A;  3QQ8 B;  1OGW A;  1WGR A;  3QHT A;  3W1S C;  1F9J A;  3PVL A;  1UZX B;  1WR6 E;  3H7P B;  3LDZ E;  4BFR A;  1GUA B;  4JGH B;  3HM3 A;  4W9D A;  2HE7 A;  3VUX A;  3ZNZ B;  3M95 A;  3MHS D;  2WWZ A;  3H1U A;  2LRW A;  3R66 C;  2C7N B;  2FCN A;  3QK0 A;  2XK5 A;  2KTF A;  2D3G A;  1KLV A;  2J0J A;  3TJP A;  3KYD D;  4MDK E;  2ZPY A;  4YL8 A;  3WIM A;  4I6N B;  2PJH A;  4E71 A;  2AEH A;  1TBE A;  3TIX A;  4W9G A;  4G0N B;  3A9J A;  2ZNV B;  3W1Y A;  1V5T A;  3X0W A;  4NJ6 A;  3PLU A;  3L16 A;  4HPL B;  3RZW C;  2FIF A;  3ZLZ A;  3ML8 A;  1MG8 A;  4NQL B;  3UIO B;  5C1Z A;  3CMM B;  3AU5 A;  2DAF A;  1OQY A;  2M17 A;  2NPT B;  1WGD A;  5CHV C;  2A4Z A;  1TTN A;  3WAP A;  3L0W B;  5CHF A;  3ZTC A;  2PE6 B;  2YVC A;  1X1M A;  2GBM A;  4A3P A;  4MJS B;  2KN5 A;  5LXH A;  2KTR B;  2G4D B;  2KFK B;  4BKS A;  2KAN A;  3DBR I;  2RSU A;  2MX2 A;  1BT0 A;  3JSV A;  2HTH A;  4ANU A;  5TR5 A;  1GJZ A;  1UGM A;  4K7S A;  3BIN A;  4MGY E;  2IZV B;  4HDO A;  1VCB A;  2L76 A;  3QJZ A;  3ALB A;  2RR9 A;  1WRD B;  1V86 A;  1ZKH A;  2KJ6 A;  4KVG B;  2N7D A;  3PV1 A;  3QAR A;  3DQV A;  1P0R A;  3TL5 A;  2I1K A;  3IHP C;  3H6N A;  4G3X B;  3Q3F A;  4ZRI A;  2ZNV C;  4I6P A;  4TQ1 A;  3U30 A;  3VTW A;  1L7Y A;  3QIJ A;  4NY0 A;  2M8S A;  2C5L C;  3APC A;  5CHW A;  3VUW A;  3PZD A;  3OAW A;  4GU2 A;  2BGF A;  2FCM A;  3H7S A;  4EEW A;  2DZJ A;  3M63 B;  5AZG A;  5D6J B;  2FID A;  4E3C A;  2KJR A;  2JF5 A;  4KV2 A;  2KC2 A;  1E8Y A;  1YJ1 A;  2L0F A;  1ZW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...