5DCNA

Crystal structure of lc3 in complex with tecpr2 lir
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
126
structure length
126
Chain Sequence
DEWEVIGGPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Microtubule-associated proteins 1A/1B light chain 3B
publication title TECPR2 Cooperates with LC3C to Regulate COPII-Dependent ER Export.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 34
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2015-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5dcnA00
1E7VA 3EFUA 2RPQA 2KANA 3R7RA 3QAQA 3MJWA 4TQ1A 5J2RA 1EF5A 1GJZA 3SHQA 2NS5A 3U7DA 3W1YA 4BOZB 4KZ0A 3WALA 1V5TA 1QZEA 3PHWB 2HE7A 4K1RB 1WI0A 2KOXA 3DVGY 4GXBA 2B3AA 1WGRA 3L54A 4NPNA 2YLMA 5AZGA 4WAAA 2N4FA 3VHTC 3ZO5B 2AYOB 2LASA 2M0XA 3NOBA 2KD0A 2AWTA 4GDKA 2JPHA 3TBLD 3ZVVA 2L00B 4F8CB 2IYDB 3MTNB 5DPTA 3HM3A 3V61A 5D6JB 4HLEA 2PEAA 1E7UA 1X1MA 2JZZA 3ZRCA 1OGWA 3OAWA 1WZ3A 1KLVA 2ZVOA 4IWPA 2C7NB 1ISNA 2DENB 4JLCA 3N32A 2MX2A 2OOBB 2MBQA 2K6QA 1WH3A 4K7UA 2XBBC 1P9DU 1IYFA 4ICVA 3DQVA 2WYQA 4TQ0A 3HK0A 3TCAA 2KKCA 3IBEA 1EO6A 3PRMB 5KHOA 5KHQA 1V80A 2A4ZA 3L10B 1JRUA 3RZWC 4J6IA 3T8MA 4DHZE 4KV2A 2LXAA 1WX7A 3AXCA 3D32A 2LVQA 5LLIA 1Q1OA 2EMSA 2K25A 4K7WA 2FUHB 3VTVA 4HPLB 5E6OA 3PTFC 3A4RA 1UD7A 2IO0B 2FNJB 3N30A 1GUAB 1EUVB 3NS8A 2KDEB 4IC7B 2KJHB 3JYUA 3APDA 3N3KB 2MBEA 4BBNC 4EFOA 2GBKA 4TKNA 1WM3A 2BWES 4DXAB 2L7RA 4IWQA 1SE9A 2AEHA 2LGXA 1PQSA 2C7HA 4W9DA 3VUWA 1WX8A 3QQ8B 1XQQA 2IO2B 5J17A 2RGFA 2OJRA 4GDLB 2BKRB 1TGZB 2MP2B 3DBLI 3PS6A 4IWOA 1MG8A 4E3CA 1L7YA 2KMCA 4YL8A 3DPDA 2LVOA 3WA0A 3ECIA 1V86A 2BWFA 4OVUA 3UIPB 2NPTA 4WJQA 2CKHB 1WRDB 4ZRIA 1WYWB 3R66C 4GGQA 4IM0A 1P1AA 3QX1A 1BT0A 2J0JA 1WR6E 2K39A 1GC7A 2LRUA 2DZJA 2MBBB 3CSTA 4W9IA 1FXTB 1WGYA 1LM8B 3A33B 2BGFA 3JW0X 4MSMB 1S1QB 4CO7A 2L76A 4E71A 3UGBB 3H1UA 2ZCBA 1J8CA 2MA9B 3ZLZA 4IUMB 4W9JA 2KFKA 2KJRA 4NAWB 2JRHA 3PZDA 4DDID 3CSFA 3KYDD 2I1JA 4NQKE 3DBHI 4I6PA 1UH6A 3GZNI 4LCDE 4K7SA 4W9HA 1Q0WB 3QIJA 3VAWA 1WFYA 3VUYA 3VH3B 4CYEA 4DBGA 3W1SC 2KQ7A 5DPWA 4MSQB 2CR5A 2JVCA 2JT4B 5CHFA 4RM8A 3X23A 2UWQA 4IM2A 4B6WA 3ZNID 3TIXA 3IG3A 1F9JA 5TR5A 4PYZA 5EDSA 2CHZA 4JQWC 2FAZA 3SDLC 4NNJB 3OJ3A 4G50A 4W9EA 2N9PC 2NCNA 4KVGB 4AWJA 3ML9A 2J7QB 4MGKE 1E5WA 4FBJB 3DOWA 2KN5A 3Q3JA 2GBRA 3H9DA 5JHBA 1A5RA 4TUUA 4FADA 3GOEA 2KXJA 3VXWA 1I35A 2KWUB 4HDOA 3PV1A 3TMPB 1YD8U 4FHKA 3DVGX 2LVPA 4N9F4 3U30A 4II2B 2DX5B 2K8BA 1C3TA 2BKFA 1U4AA 2Z59B 2REXA 3QC8B 1WGGA 5G55A 3ZW3A 1P3QU 2XEWA 4F7ZA 2FCQA 4XZ4A 2QHOA 4MH0E 3ZRFA 2XK5B 1V2YA 4P7IA 5JZEB 5GMVA 4WQOB 3B1LX 2EMTA 3T9LA 3A9KB 4GSWA 3VVWB 2BF8B 2ZCCA 3ML8A 4FJVB 4K81A 3A4SC 5E6PA 1I42A 1GNUA 4MGIE 2FIFA 4HVBA 1WJ4A 2PE6B 4ANVA 1AARA 1WGDA 3A1QB 4EZLA 5JHAA 2WDTB 3VDZA 3EECA 4KIKB 3NHEB 3L17A 4HCPB 3RD2A 1G6JA 4TV3A 3RT3B 3KH0A 4PS3A 4URKA 4AOFA 3KUDB 5D2MB 3QWZB 3KUZA 4NJ6A 2FCNA 2C5LC 2C60A 4FA6A 4G11A 3P2BA 2KWCA 3KYCD 3VUXA 3UF8A 2R2OA 4DHJD 2G4SA 4GMVA 1V6EA 3UIOB 1J0GA 3R3MA 4GOCA 4CHKA 1Y8RC 4RM9A 2IBIB 2PPHA 2A5UA 3M63B 2KZRA 5G2NA 4BBNF 2IY1B 2KMAA 2UYZB 3APCA 4A3PA 5E6NA 1P98A 2RD0A 3RUIB 3V6CB 3NY5A 3QA8A 1WMHA 4DWFA 2KJ6A 2V3SA 4XC2A 2LZ6A 2BYEA 1H4RA 4G0NB 3L0WB 2K6DB 1WZ0A 2MLBA 2LGDA 2L05A 4ZYNA 3SU8X 5DPSA 2KLGA 2NBVB 2M4NA 2KX0A 3QJZA 3APFA 4FJZA 3VTWA 1WE6A 2MQJA 2MSED 1S3SG 1OEYA 1YJ1A 4EZJA 2O6VD 5IAAC 2M8SA 2BYFA 2KTRB 4DDGD 3I3TB 2NPTB 3CMMB 3JSVB 3UQBA 2KWVB 4KZCA 3AI5A 1WXSA 4RMAA 3ZDMC 3PLVA 2V1YA 3PT2B 4GDLA 4OVVA 1TZ1A 1RAXA 3NZUA 3VQIA 2MW5A 2L0FA 4EUTA 4E74A 3ZKJC 5CHVC 2ZVNA 1EF1A 2CHWA 2JZ3B 4JL9A 2M17A 4MJSB 4AJWA 2Y5BB 5AZFA 2EKEC 2K8HA 2D2QA 2MBHA 2NVUI 3OLMD 2DYMA 3TL5A 4I6LB 2CU1A 2KNBA 3ZUNA 3IFWB 1V5OA 5LXIB 2O2VA 2O6VB 3X0WA 2M1MA 1Z5SB 3B08A 2JRIB 2KDIA 2AL3A 1HE8A 3PRZA 4KSLC 1LXDA 3H7PB 4M8NA 3HIZA 3WAPA 2ZNVB 2IY0B 4HK2A 3UINB 3ZNHB 5IA7A 1T0YA 4PS7A 2ZNVC 5D7GA 4A3OA 2KK8A 1LFDA 1KJTA 2J0KA 4PYUA 2IO3B 1UBQA 5CX3A 4BKGA 2ASQA 2JWZA 2HJ8A 3ZNGC 2GOWA 1WXAA 5C1ZA 1WR1A 3HM6X 4HXDA 2N1VA 4NAWA 1XD3B 4W9FA 4KSKC 4B9KA 1YX6B 2Z0DB 2W9NA 3A9JB 1J19A 1WE7A 5BO4B 1WF9A 2MBOA 1P0RA 3PSEB 1Z2MA 1VD2A 2C9WB 2KFJA 3QHTA 3ONSA 2MCNB 2ZPNA 3JVZX 4JIOU 2D10A 2L3ZA 3MHSD 2VRRB 5HKHA 1UGMA 5CHWA 1IPGA 5D94A 3RYTA 4ANXA 2RSUA 1WX9A 2N9EB 2L8JA 3AU4A 4FULA 2N7EA 3H6NA 4WWNA 3DVNU 3PREA 2DYBA 2K8CA 3PHXB 4WJNA 3PVLA 3UQAA 1CMXB 3L08A 1D3ZA 1NI2A 3L16A 2V4LA 3DBRI 4FHJA 4BKSA 2Z0EB 3S2AA 4DHZB 4KDIC 4LJOB 1RRBA 2KO3A 3ALBA 4W9KA 2L0TA 2ZJDA 2ZZPB 4GDKB 4ASWC 1E8ZA 4W9CA 4NY0A 3ZDTA 3M62B 4GU2A 3AU5A 5FR6A 1V81A 4DK5A 2N7DA 2XK5A 3ENEA 4IW0A 4HDQA 2GBJA 2JY6A 4EKUA 1Q5WB 1SGHA 3WIMA 1E8XA 1WJNA 2FCSA 3A9KA 1SIFA 1XT9B 1KOTA 3WANA 2WX0A 3PPAA 4I6NB 5LXHA 1ZGUB 1OEYJ 1ZKHA 4FJYA 3DBSA 2WWZA 1NDDA 2YVCA 1E90A 4NJ7A 3A1QA 3VFKA 2LGYA 2ZPYA 4A20A 2G3QB 3QK0A 1UZXB 3VH4B 3K9OB 2C7MB 4KIKA 3IVFA 4NQLB 2LWPA 5AZHA 2PJHA 4FLHA 4MGYE 3PRPB 5L95C 4B95A 2K1FA 2NBUA 4AP4C 3PLUA 2NR2A 4FN2A 4EZKA 3M95A 4PS8A 3M3JA 2MWSB 4WWPA 2HTHA 3AULA 1UBIA 4JGHB 3V62A 3VTUA 4HJKA 1YQBA 2CHXA 2KC2A 1WMHB 3KW5B 1GC6A 2J0MA 3EHVA 1R4NI 4DHJB 2KDFB 4HWIB 2IZVB 3WAMA 3Q3FA 4IM3A 4IG7B 4BKTA 4EOYA 2GBMA 1TTNA 4X57B 5C23A 3QARA 4ZRJA 1WJ6A 4ANUA 2G4DB 1TBEA 5L83A 2DAFA 4M0WB 1UELA 1ZW7A 2AL6A 1WIAA 3L13A 2MRPA 4BVUC 2HD5B 2D3GA 4M8MA 2KVRA 5AEKB 2R2QA 4LDTD 5JH5C 2KQSA 1NBFC 4F1SA 3DCGA 3V60A 1R4MI 2DZIA 2LUEA 3ZNZB 3H7SA 3IHPC 2FIDA 2JF5A 4BOSC 1YIWA 2MP2A 1WJUA 3NZSA 4MGZE 2D07B 3BY4B 4GN1A 4ICUA 4ZRKA 3LJ3A 3QCAA 1WXMA 4KDLB 2WX1A 4WJOA 1E8WA 1OQYA 4W9GA 1E8YA 4HCNB 1M94A 2DZMA 2D11A 3R7QA 4ANWA 2JXXA 2N1WA 1GG3A 2KTRA 2KFKB 1RLFA 2BYVE 3JSVA 3ZTDA 4LDTB 2O2VB 1KM7A 1V9JA 3RZFA 4G3XB 1V49A 3B0AA 1RFAA 2KTFA 1VCBA 4EEWA 2KX3A 3EC8A 5CTRC 2KC1A 4II3B 4HPMB 4BFRA 3KUCB 1K8RB 4MJSA 1OTRB 2DHZA 5J18A 3WAOA 3SD5A 2G45B 4MM3A 2GMIC 4GIVA 3CF6E 2O6VA 4WWOA 2DZKA 3DDCB 1WY8A 3LDZE 4ZDVA 3H7PA 3BINA 3RULA 2LXCA 3W1SA 2BPSA 4WJPA 3ZIMA 1WM2A 1YX5B 4BKSD 1WXVA 3K9PB 4AJYB 2KDBA 4W9LA 2GBNA 3ZTCA 2RR9A 3RCZA 1LQBA 2CS4A 3OJ4B 2FCMA 2NBWB 2N9XA 1H8CA 3V6EB 2KHWB 2JUOA 2LI5A 4XX5A 1IP9A 1C1YB 2I1KA 5DCNA 3DVNV 4MDKE 1WGHA 3A9JA 3O65B 2ZEQA 3PGEA 4AUQC 2LRWA 3KVFB 4LJPB 4MELA 3TJPA 3U8ZA 1L2NA 2KLCA 4GB9A 2LD9A 3C0RB 4MEMA 2DAJA 2DYOA 2PE9A 3HHMA 5DPRA 2IO1B 2LJ5A
chains in the Genus database with same CATH superfamily
1E7VA 3EFUA 4DXFA 3GS2A 1D5XC 3MJWA 5J2RA 1EF5A 4OZAA 3IXSA 3RNEC 3W1YA 4K1RB 1QZEA 3PHWB 5BYSA 1WI0A 4GXBA 3DVGY 1WGRA 2YLMA 5FKAC 2INDC 3NOBA 4GDKA 3TBLD 1YMHE 1CJEA 3MTNB 1ET6A 1QOBA 1XXGA 1X1MA 1QLBB 3KQ4A 3I63C 1WZ3A 1KLVA 4IWPA 4ZRQA 1ISNA 3T3NA 2XBBC 1IYFA 2WYQA 3HVZA 3HK0A 4TQ0A 3TCAA 3BWUD 2KKCA 4RCOA 4ACFA 2JYTA 3PRMB 5KHQA 1MFWA 1JRUA 3RZWC 4JWUC 2LVQA 2EMSA 2GB1A 1SE4A 5EE9A 4IC7B 1A70A 2GBKA 1WM3A 3I9V1 3KWLA 4TKNA 3RNAC 2L7RA 2AEHA 1PQSA 2IO2B 5J17A 1YN4A 1C78A 4MH8A 2KMCA 4YL8A 3ECIA 1ZXIA 4OVUA 2NPTA 1WRDB 2Y5CA 4GGQA 1BT0A 1WR6E 2WXRA 1TKYA 1GC7A 2DZJA 3N1YC 2PTLA 1UUPA 2LEKA 2MA9B 2ONQA 4IUMB 2M56B 2KJRA 4JE3B 3CSFA 1MJDA 4I6PA 2WLBA 4W9HA 1Q0WB 1FMAD 1WFYA 1SE2A 4MSQB 3I57A 4UDUC 3AE8B 4RM8A 1IUEA 4PYZA 3U7ZA 3DHGC 1L0VB 4JQWC 1CK1A 1R7SA 3DBLB 4G50A 3Q69A 4FBJB 3ML9A 4MGKE 3Q3JA 1E6EB 4B0MA 4A9AA 1A5RA 4TUUA 1HA5A 1I35A 2KWUB 1TT5B 4HDOA 3PV1A 3DVGX 3U30A 1SJHD 1C3TA 4KKJA 1WGKA 2BKFA 1ROEA 1P3QU 4C56C 1V8CA 2ICIA 4MH0E 4P7IA 2LFIA 3RN9C 5GMVA 3B1LX 3T9LA 2IGHA 3AE2B 4XDCA 4MGIE 4HVBA 2PE6B 2WDTB 3GZNB 2FUG1 2KN4A 2YEPF 3IT6B 2FCNA 2KWCA 4GMVA 1J0GA 2QILA 2IBIB 2PPHA 4RH6A 2WXFA 4GLSC 1SEBD 3APCA 3RNGC 5E6NA 3QA8A 4D2KA 1ZPSA 2KJ6A 2PW9A 4G0NB 1WZ0A 1DGJA 4ZYNA 2NTSA 2DNFA 2LHEA 4N59A 2NBVB 1VDVA 2OHFA 2KX0A 1WE6A 3FC4A 2WU5B 4FXCA 3UQBA 2DLBA 4KZCA 1WXSA 3PT2B 1TZ1A 3FKYA 1EF1A 4JL9A 4AJWA 2GRIA 2D2QA 2NVUI 3OLMD 2LGIA 3ZUNA 2CU1A 3B08A 4ZRPA 2JRIB 2WDVB 1HE8A 3PRZA 4KSLC 4C7YA 3HIZA 1M4VA 5IA7A 1RYJA 4PS7A 2KK8A 1KJTA 2J0KA 4PYUA 2IO3B 2VH1A 2HJ8A 1WXAA 5C1ZA 4NAWA 4HXDA 2N1VA 2V0GA 1C4PA 2PKOA 1SB3C 1YX6B 4XWWA 4A90A 4M00A 1WF9A 2MCNB 4JIOU 2LHDA 3JVZX 2D10A 1FCCC 3ZJVA 2AQ3B 1UGMA 5CHWA 3AEEB 2NTTA 2RSUA 3SFDB 2N9EB 3AEDB 1PGBA 4WWNA 3PREA 4WJNA 2JSVX 3L16A 5IP4D 4FHJA 1XF5L 2J52A 3S2AA 4DHZB 5E6JA 2CU3A 4B0EA 1DOXA 2AQ1B 4P16A 1XO3A 2ZZPB 3L4PA 3GE3C 1AW7A 1ESFA 5FR6A 2WXMA 2N7DA 2WS3B 3ENEA 4IW0A 2INPE 2JY6A 4N6EB 1N6ZA 1FNWA 5C2TB 4EKUA 1JWBD 1TIFA 5LXHA 1OEYJ 1E0ZA 4XE0A 2LGYA 2ZPYA 4P6VF 3QK0A 1NYQA 1UZXB 4NZLB 2BVCA 1AYFA 4OVZA 3PRPB 3HVDA 2K1FA 2NBUA 4PS8A 3AULA 3VTUA 4JGHB 3V62A 4HJKA 2SEBD 1T0QC 2J0MA 4DHJB 3N20C 3WAMA 4JX1C 1TS5A 4IM3A 3AE9B 3DBRB 3U2SC 1FCLA 2GBMA 2JWUA 2W3RA 4ZHPA 1DOYA 5H8YE 4ANUA 2G4DB 5L83A 1I4RA 2DAFA 4M0WB 4BVUC 2MRPA 1HQRD 4XDDA 1C9FA 2FE8A 3IHPC 1ZOYB 1YIWA 3NZSA 2MP2A 4ZRKA 1L4DB 3TSSA 3LJ3A 3BYTB 2Z8LA 4WJOA 1C77A 2DZMA 1RWSA 2D11A 4S17A 1RM6C 2JXXA 1RLFA 2BYVE 3JSVA 3ZTDA 4C00A 2O2VB 2K0PA 3W5UB 1KM7A 4WQMA 3TEWA 4LTUA 4G3XB 1V49A 2GLSA 1C76A 3P4QB 2KTFA 4EEWA 4II3B 3VRBB 1K8RB 1MHHE 5FK9C 4O1NA 1YN3A 3SD5A 1E7PB 2N9LA 4GIVA 2LJIA 5C3JB 4WWOA 2Q5WD 1J7AA 4ZDVA 3RULA 4WJPA 3ZIMA 1WYGA 4AJYB 2KDBA 1DOIA 1E9MA 3E56A 4W9LA 1NVID 1R4MB 4RF1A 2CS4A 1FXAA 2JUOA 1IP9A 4HEA1 5DCNA 1FFVA 3PGEA 2LRWA 1L2NA 5BMIA 4GB9A 2W82A 2DAJA 2BT6A 2LUMA 5DPRA 2LJ5A 3IAM1 3N1XC 2KANA 3QAQA 2VH2A 4TQ1A 3MC0B 1KF6B 3SHQA 3HUIA 4KZ0A 3WALA 3J9CA 2B3AA 3L54A 5EE0A 4WAAA 2AYOB 2LASA 2M0XA 2KD0A 3ZVVA 5D6JB 2WXOA 2C7NB 2IDYA 1WXQA 3ZJUA 2OOBB 5I4DA 1DYQA 4K7UA 4ICVA 1JROA 5KHOA 5D3IB 2WXHA 1TS3A 3T8MA 1ZDXA 4DHZE 2LXAA 3AXCA 5LLIA 1Q1OA 4K7WA 1JCKB 1TJEA 3SFEB 1ACCA 3A4RA 1UD7A 3Q8BA 2IO0B 1F0ZA 1GUAB 3C8YA 3RI7C 3NS8A 2KDEB 3JYUA 4P1BC 4XWTA 3AH7A 1C4CA 1T0RC 2I38A 1PGXA 1B1ZA 4LNNA 2OJRA 2BKRB 1TGZB 3PS6A 4IWOA 3ZYYX 1T0SC 2IGGA 3WA0A 1JQ4A 5AUIA 2BWFA 3VRAB 1YQ4B 3RNFC 4IM0A 1P1AA 3QX1A 1I4HA 3NVYA 2D3CA 4OZCA 4W9IA 4CO7A 2BGFA 3Q8EA 4MSMB 4E71A 1TKGA 2ZCBA 1P7FA 2KFKA 2JRHA 3PZDA 4DDID 4HRSA 2RDGA 4LCDE 1PFDA 3E9SA 3VH3B 3W1SC 1I4PA 2JT4B 3GE8C 4KX6B 2UWQA 3X23A 2BS2B 4B6WA 2KQ4X 3IG3A 1F9JA 3MC8A 3URYA 5EDSA 4RGOS 3SDLC 3OJ3A 2NCNA 2R61A 2WXQA 3DOWA 2RDHA 4HKQA 2GBRA 4FADA 2KXJA 2MJ3A 2MH7A 1YD8U 4FHKA 4N9F4 3FILA 2K8BA 2PMVA 1U4AA 2REXA 3QC8B 4KGTA 1WGGA 1UF0A 2FCQA 4C4VB 4XZ4A 2QHOA 4ZOHC 2XK5B 5JZEB 2M19A 4WQOB 4WWMA 4NAMA 2EMTA 3A9KB 4GSWA 3VVWB 1XCTL 4K81A 4HPPA 2PIAA 1GNUA 2FIFA 4A55A 2N7JA 1WGDA 2QDFA 4EZLA 4HJGE 2INNE 3EECA 3ZXVA 4KIKB 1QQRA 3RD2A 2IGDA 5G5HA 5D2MB 3QWZB 1JW9D 1SF0A 2C5LC 4FA6A 4G11A 3P2BA 2R2OA 2JU6X 2G4SA 3R3MA 1FFUA 4CHKA 1Y8RC 2A5UA 3M63B 4YSYB 3Q3NC 1C4AA 2UYZB 3MP9A 1TY2A 2WQYB 4DWFA 4XC2A 2BYEA 1H4RA 3L0WB 1OFFA 2WXKA 4TSSA 2WU2B 1D6EC 1CQVA 2BW2A 3SU8X 4BAXA 1F1HA 3N1ZC 2M4NA 5HFYA 1YNTE 4FJZA 2MQJA 2MSED 1S3SG 2I2YA 2O6VD 5IAAC 5EE1A 2BYFA 3I3TB 2NPTB 1JWSD 3ZDMC 3AI5A 3PLVA 2V1YA 3TUOA 4OVVA 4HKZE 3MJ5A 3VQIA 3ZQ4A 4E74A 4MJSB 3OG5A 2K8HA 5AZFA 2M0AA 3TL5A 3IFWB 1V5OA 2WXJA 4MM3B 4RF0A 2O6VB 2M1MA 2AL3A 1LXDA 3H7PB 2V3PA 4HK2A 2KT7A 1EWCA 5D7GA 2BTEA 3SEBA 2ASQA 2JWZA 2LMCA 1QT9A 2GOWA 4US9A 3HM6X 4RGTA 3R2IA 1XD3B 2W55A 1WE7A 5BO4B 3SR6A 3ZJTA 2KFJA 3N9YC 3ONSA 2VRRB 5HKHA 2L8JA 3AU4A 3DVNU 4YSZB 2W3SA 3PVLA 1HEZE 1D3ZA 4LK0M 2Z0EB 5BMGA 1VLBA 5G5GA 2Y3AA 4W9CA 4NY0A 3ZDTA 3M62B 4GU2A 4PT5A 1V81A 3AE6B 4N58A 2GBJA 1Q5WB 3WIMA 4AQ7A 4XGAB 1VZ7A 3Q14C 1I4XA 1SIFA 3TEXA 3PPAA 2CJNA 1ZGUB 4FJYA 3VFKA 1KLUD 1L0YB 3VH4B 2BYTA 3K9OB 1VZ6A 1L6VA 3R2TA 4FLHA 4MGYE 3P4SB 4B95A 3RNCC 4EZKA 4RGNA 1C79A 3EFCA 3Q3MC 2BB5A 4K3BA 1VJKA 3AE3B 3EHVA 1R4NI 2WXLA 2IZVB 4US8A 3Q3FA 4R3DA 1MVKA 2JZPA 4IG7B 4EOYA 3W5VB 3RFZB 1TTNA 4X57B 3QARA 1UGJA 1WJ6A 3U52E 1T6BX 1BMLC 1MPEA 1WIAA 2D3GA 4M8MA 2R2QA 4LDTD 1YN5A 5JH5C 4F1SA 3NG0A 3V60A 5D3DA 1JALA 4OZBA 2LUEA 2WXGA 5EE3A 1T3QA 3T3OA 4MGZE 2V9HA 2QEJC 1E8WA 1OQYA 3KLSX 2QSDA 2AQ2B 4A6QA 1GG3A 2KVZA 1XLQA 1XLPA 4RNAA 4KGSA 4LDTB 1GB4A 3EA6A 3B0AA 1VCBA 2KX3A 2KC1A 3KUCB 3MHZA 1OTRB 4LNFA 3WAOA 1WWTA 3C19A 2XNAC 3DDCB 1SXTA 2BPSA 1YX5B 3K9PB 3Q8AA 1QOAA 1IBXB 3HRDD 1LQBA 1FNVA 2KHWB 1ENFA 3NJTA 4MDKE 1WGHA 3H8HA 3KVFB 2KLCA 1PYWD 3C0RB 2PE9A 3HHMA 1VRAB 2RPQA 1MI0A 1TS4A 3R7RA 3U7DA 1I7HA 1YOVB 2KOXA 3V05A 3AN1A 3VHTC 1GPXA 2N4FA 2AWTA 2JPHA 2L00B 2SAKA 3V61A 3DBHB 1GOZA 3EUB2 2JZZA 3ZRCA 1OGWA 3OAWA 1SSNA 2LGSA 2DENB 1N60A 3N32A 2MX2A 2K6QA 1EO6A 1V80A 3BVMA 4IOIE 2WNMA 3D32A 1V1PB 3VTVA 1VZ8A 1F2RI 3PTFC 1Y56A 1F52A 2H88B 4ITKA 3N30A 3AE7B 1EUVB 2WGSA 3LXFA 3APDA 3Q2AC 4BBNC 2ZW1A 1NEKB 4DXAB 1GB1A 2LGXA 1MHXA 1ZP0B 4W9DA 1FXIA 1WX8A 3PO0A 3QQ8B 1XQQA 3O13A 2RGFA 4GDLB 2MP2B 1MG8A 1L7YA 1XEEA 4M0WA 2CJOA 3DPDA 2LVOA 4REZA 2J4XA 1V86A 3UIPB 4WJQA 2WXNA 2CKHB 3AMZA 1WYWB 2NMQA 4CQNA 1HZ6A 2N0SB 2LRUA 2MBBB 1WRIA 1WGYA 1LM8B 1V1OA 2L76A 1YJIA 3H1UA 1J8CA 1YJJA 1J7CA 4W9JA 4OHJA 4EE2A 2ON8A 1BXTA 3KYDD 2I1JA 4MT5A 3DBHI 3CWIA 1D5MC 3UI3A 3VAWA 3PZ8A 3AE4B 3VUYA 4DBGA 2Y5PA 2IJ0A 2KQ7A 3AEFB 5DPWA 2CR5A 5CHFA 1UWXA 2EELA 3TIXA 2K22A 5TR5A 2CHZA 2FAZA 2N9PC 2J7QB 4TMAB 2MEKA 3H9DA 3VXWA 5T8IA 2LVPA 4II2B 1FRDA 3ZW3A 2XEWA 4F7ZA 4K3CA 3AEAB 5HI1A 3ZRFA 3NRZA 1IGDA 1TKEA 3NVVA 4YTPB 2ZCCA 4FJVB 5HG2A 3A4SC 2K9XA 1I42A 4ANVA 1AARA 3A1QB 5JHAA 3VDZA 4KKIA 2OJWA 3NHEB 1G6JA 4TV3A 4PS3A 4WAFA 5IN7A 3KUDB 4DXGA 3KUZA 4NJ6A 2C60A 3KYCD 3VUXA 4WH4A 3UF8A 1L6UA 1V6EA 1JWAD 4BZAA 2VZKD 1QOFA 3AM9A 3GB1A 3NY5A 1UWMA 1WMHA 2V3SA 1N5XA 1FNUA 1QKZA 3BVGA 2MLBA 1YQ3B 4ARCA 2LGDA 2L05A 5DPSA 1MG4A 2KLGA 2VZKB 3QJZA 5BMHA 2KYWA 3APFA 2BBCA 3P63A 4IDIA 1YJ1A 2WDRB 4S0RA 4DDGD 2KTRB 1K52A 3CMMB 4RMAA 1KLGD 3KWVA 1CZPA 2MW5A 4YXDB 1KRHA 2DBYA 4EUTA 3ZKJC 2OEDA 5CHVC 2BB6A 1HZ5A 2ZVNA 1TS2A 2M17A 2QMTA 2MBHA 2RPVA 4I6LB 3ZXRA 2KDMA 4M8NA 3Q8CA 3P42A 2ZNVB 5IO9A 1T0YA 2ZNVC 4A3OA 3DHIC 1LFDA 3LB8C 4L1BA 5CX3A 2KACA 5IKCM 2KWDA 4KSKC 4B9KA 2Z0DB 3A9JB 1Q10A 3PSEB 1VD2A 3X0WA 2L3ZA 1WSPA 5H92C 1FEHA 3FILB 1IPGA 5D94A 3RYTA 3RPFC 1JRPA 4FULA 2RMMA 2N7EA 3H6NA 2DYBA 3PHXB 2JQRB 3UQAA 3L08A 3AEGB 4BKSA 4LJOB 4W9KA 2ZJDA 4GDKB 3AU5A 4C4VA 4DK5A 3NVWA 2XK5A 3P4PB 1SGHA 1WJNA 2FCSA 2E6XA 1JWUD 3A9KA 1KOTA 2WX0A 1ZKHA 2QCZA 2WWZA 4NJ7A 5BYQA 4A20A 2K5PA 3Q3OC 2QC8A 4KIKA 2V3NA 4NQLB 5AZHA 2PJHA 3PLUA 2NR2A 4FN2A 3M3JA 1KFYB 2J42A 2MWSB 4WWPA 2HTHA 1L4ZB 3BYYB 2CHXA 2KC2A 3KW5B 1OQRA 2E3TA 4HWIB 2MJEA 1N63A 4BKTA 2INCC 2HTME 5C23A 4WIPA 4ZHOA 1TBEA 3BIID 2AL6A 3NS1A 3VR8B 1NENB 1P7EA 2KQSA 3DCGA 2DZIA 3ZNZB 4BOSC 2WP9B 2QJLA 1FM0D 2D07B 3BY4B 1HTQA 3QCAA 1WXMA 2WX1A 4YT0B 3P1MA 1QF6A 1M94A 1STEA 4ANWA 1EWYC 5JXVA 2AX5A 2WXIA 1V9JA 1D5ZC 2B76B 4HPMB 2K3UA 2KAJA 4BFRA 4MJSA 2DHZA 5J18A 4YTNB 1R4NB 4MM3A 2GMIC 2O6VA 1WY8A 3R8BA 1K53A 3LDZE 3H7PA 3BINA 2TSSA 2LXCA 1WM2A 1WXVA 2DWQA 4YWGG 3RCZA 3OJ4B 1F77A 1C1YB 3MFGA 2PLPA 4LJPB 3U8ZA 2D3AA 4LNIA 2UU7A 4MEMA 3MC9A 1OQQA 2IO1B 1AN8A 4L2YA 1SE3A 2BS3B 1GJZA 2NS5A 4BOZB 3BVZA 4DQOC 1V5TA 2HE7A 1EU4A 4NPNA 1XLOA 5AZGA 3ZO5B 2WHIA 4F8CB 2IYDB 5DPTA 3HM3A 4HLEA 2PEAA 1E7UA 1QILA 4WURA 1KTKA 2X38A 2ZVOA 3LYYA 4JLCA 2MBQA 4Q2JA 1WH3A 1P9DU 3DQVA 3BK2A 2YEPB 4ZYSA 3IBEA 1NI3A 2A4ZA 3L10B 4J6IA 4KV2A 1WX7A 1PGAA 2XN9C 2K25A 2FUHB 4HPLB 5E6OA 1ZDVA 2FNJB 3AV8A 1FIQA 2KJHB 3N3KB 2MBEA 4EFOA 2BWES 4IWQA 1SE9A 1RFKA 2C7HA 2D5GA 3VUWA 2V4IB 1UNSA 2L32A 2X8XX 3DBLI 4E3CA 3OWEB 2BQQA 4ZRIA 3R66C 2J0JA 1SIJA 3PZ7A 2K39A 3IT4B 3CSTA 2PVGC 1FXTB 3JW0X 3A33B 1S1QB 3UGBB 3ZLZA 4YSXB 3W2DA 4NAWB 2WDQB 4NQKE 4M01A 1UH6A 3GZNI 1F2RC 4K7SA 3QIJA 2L83A 2BS4B 3AEBB 2ACZB 4CYEA 1EU3A 2JVCA 2WXPA 4IM2A 3ZNID 3BZDB 4NNJB 4W9EA 4AWJA 4KVGB 1E5WA 2KN5A 2G1EA 3TEZA 5JHBA 3GOEA 3TMPB 1IBXA 1KH0A 2DX5B 1FD6A 3DWGC 2Z59B 3U4EG 5G55A 4OW0A 4P1CC 1SJED 4A8XC 1V2YA 1TZOA 3AE1B 2BF8B 3ML8A 2G9HD 4LNKA 5E6PA 1WJ4A 3RNBC 3Q8FA 1K51A 3L17A 4HCPB 3CIRB 3NVZA 3RT3B 3KH0A 5TSSA 2ZW0A 4URKA 4AOFA 1AWDA 1QOGA 3AE5B 1N61A 1ZXHA 1LO5D 1T5XD 1B9RA 4DHJD 3UIOB 4GOCA 4RM9A 2KZRA 5G2NA 4IKGA 4BBNF 2IY1B 2KMAA 2HJ1A 4A3PA 1P98A 2RD0A 3RUIB 3V6CB 5AUKA 2LZ6A 2K6DB 5MPOA 1XLNA 4H2AA 1V1PA 2MJDA 1SBBB 1FO4A 4JWSC 3WCQA 1ET9A 1N62A 5FR3A 1N5WA 5HHDG 3VTWA 3NUHB 1K50A 4RFBA 1OEYA 4EZJA 2M8SA 3JSVB 1LGRA 2KWVB 4GDLA 1RAXA 3NZUA 1L5PA 1PDXA 3Q6BA 2L0FA 2CHWA 2JZ3B 2MHJA 2Y5BB 1IGCA 3B9JA 2EKEC 2DYMA 2KNBA 4QAYA 1V97A 5LXIB 2O2VA 1JWMD 1Z5SB 3DHHC 1E10A 2KDIA 5GXGB 1HXYD 3WAPA 2IY0B 1ZE3D 2KMMA 3UINB 3ZNHB 3AECB 3BK1A 3FAHA 5LNK1 4L23A 1UBQA 4BKGA 1FRRA 3ZNGC 1WR1A 4W9FA 1I4GA 2W9NA 3I5JC 1J19A 1TY0A 2MBOA 4C7ZA 1P0RA 1Z2MA 2C9WB 3QHTA 2ZPNA 5BYRA 3EGRA 2L52A 2GI9A 3MHSD 2QIEB 4ANXA 1WX9A 1ZUD2 2K8CA 4YTMB 1CMXB 1NI2A 2V4LA 3DBRI 4KDIC 2D3BA 1RRBA 2KO3A 3ZGZA 3ALBA 3AB5A 2L0TA 4ASWC 1E8ZA 3VR9B 2EKIA 4XYCA 2J53A 2W54A 4HDQA 4LNOA 1E8XA 4RGMA 1D4BA 3ABVB 2PVOD 1XT9B 3WANA 4I6NB 2H89B 3DBSA 2YVCA 1NDDA 1E90A 3A1QA 4MACA 2JX5A 2G3QB 3B2GA 2C7MB 3IVFA 2LWPA 3TEYA 5L95C 4C80A 4AP4C 3M95A 3P4RB 1UBIA 2IPKD 1YQBA 4M02A 1WMHB 1GC6A 3B2FA 2KDFB 1I4QA 4NJCA 4ZRJA 1GAQB 1BUIC 2FBWB 1UELA 1ZW7A 3L13A 2HD5B 2KVRA 5AEKB 3RMKC 2L1AA 1NBFC 1R4MI 3NZ3A 3H7SA 2FIDA 2JF5A 4J3OD 1WJUA 4GN1A 4ICUA 1VR9A 4KDLB 2N9KA 4W9GA 1E8YA 4HCNB 3DWMA 3W9CB 3R7QA 2N1WA 2KTRA 2KFKB 1XCQL 3RZFA 2JYEA 1J7BA 1JMLA 1EM7A 1RFAA 4USAA 3EC8A 1L0XB 5CTRC 2G45B 3CF6E 5IOIA 4ARIA 1NYRA 2DZKA 3W1SA 1PUTA 4KGRA 4BKSD 4LLGM 2GBNA 3ZTCA 2JXTA 2RR9A 1TYGB 4HROA 1H8CA 2FCMA 2NBWB 2N9XA 2HDEA 1HTOA 3V6EB 2LI5A 4XX5A 3IAS1 2I1KA 3DVNV 4JPSA 4AS1A 3A9JA 3O65B 2ZEQA 4AUQC 3V3XA 2RDBC 4MELA 3TJPA 3GP7A 2LD9A 3ETRA 2DYOA 1FPYA 4PK1A
chains in the Genus database with same CATH topology
1E7VA 3EFUA 2RPQA 2KANA 3R7RA 3QAQA 3MJWA 4TQ1A 5J2RA 1EF5A 1GJZA 3SHQA 2NS5A 3U7DA 3W1YA 4BOZB 4KZ0A 3WALA 1V5TA 1QZEA 3PHWB 2HE7A 4K1RB 1WI0A 2KOXA 3DVGY 4GXBA 2B3AA 1WGRA 3L54A 4NPNA 2YLMA 5AZGA 4WAAA 2N4FA 3VHTC 3ZO5B 2AYOB 2LASA 2M0XA 3NOBA 2KD0A 2AWTA 4GDKA 2JPHA 3TBLD 3ZVVA 2L00B 4F8CB 2IYDB 3MTNB 5DPTA 3HM3A 3V61A 5D6JB 4HLEA 2PEAA 1E7UA 1X1MA 2JZZA 3ZRCA 1OGWA 3OAWA 1WZ3A 1KLVA 2ZVOA 4IWPA 2C7NB 1ISNA 2DENB 4JLCA 3N32A 2MX2A 2OOBB 2MBQA 2K6QA 1WH3A 4K7UA 2XBBC 1P9DU 1IYFA 4ICVA 3DQVA 2WYQA 4TQ0A 3HK0A 3TCAA 2KKCA 3IBEA 1EO6A 3PRMB 5KHOA 5KHQA 1V80A 2A4ZA 3L10B 1JRUA 3RZWC 4J6IA 3T8MA 4DHZE 4KV2A 2LXAA 1WX7A 3AXCA 3D32A 2LVQA 5LLIA 1Q1OA 2EMSA 2K25A 4K7WA 2FUHB 3VTVA 4HPLB 5E6OA 3PTFC 3A4RA 1UD7A 2IO0B 2FNJB 3N30A 1GUAB 1EUVB 3NS8A 2KDEB 4IC7B 2KJHB 3JYUA 3APDA 3N3KB 2MBEA 4BBNC 4EFOA 2GBKA 4TKNA 1WM3A 2BWES 4DXAB 2L7RA 4IWQA 1SE9A 2AEHA 2LGXA 1PQSA 2C7HA 4W9DA 3VUWA 1WX8A 3QQ8B 1XQQA 2IO2B 5J17A 2RGFA 2OJRA 4GDLB 2BKRB 1TGZB 2MP2B 3DBLI 3PS6A 4IWOA 1MG8A 4E3CA 1L7YA 2KMCA 4YL8A 3DPDA 2LVOA 3WA0A 3ECIA 1V86A 2BWFA 4OVUA 3UIPB 2NPTA 4WJQA 2CKHB 1WRDB 4ZRIA 1WYWB 3R66C 4GGQA 4IM0A 1P1AA 3QX1A 1BT0A 2J0JA 1WR6E 2K39A 1GC7A 2LRUA 2DZJA 2MBBB 3CSTA 4W9IA 1FXTB 1WGYA 1LM8B 3A33B 2BGFA 3JW0X 4MSMB 1S1QB 4CO7A 2L76A 4E71A 3UGBB 3H1UA 2ZCBA 1J8CA 2MA9B 3ZLZA 4IUMB 4W9JA 2KFKA 2KJRA 4NAWB 2JRHA 3PZDA 4DDID 3CSFA 3KYDD 2I1JA 4NQKE 3DBHI 4I6PA 1UH6A 3GZNI 4LCDE 4K7SA 4W9HA 1Q0WB 3QIJA 3VAWA 1WFYA 3VUYA 3VH3B 4CYEA 4DBGA 3W1SC 2KQ7A 5DPWA 4MSQB 2CR5A 2JVCA 2JT4B 5CHFA 4RM8A 3X23A 2UWQA 4IM2A 4B6WA 3ZNID 3TIXA 3IG3A 1F9JA 5TR5A 4PYZA 5EDSA 2CHZA 4JQWC 2FAZA 3SDLC 4NNJB 3OJ3A 4G50A 4W9EA 2N9PC 2NCNA 4KVGB 4AWJA 3ML9A 2J7QB 4MGKE 1E5WA 4FBJB 3DOWA 2KN5A 3Q3JA 2GBRA 3H9DA 5JHBA 1A5RA 4TUUA 4FADA 3GOEA 2KXJA 3VXWA 1I35A 2KWUB 4HDOA 3PV1A 3TMPB 1YD8U 4FHKA 3DVGX 2LVPA 4N9F4 3U30A 4II2B 2DX5B 2K8BA 1C3TA 2BKFA 1U4AA 2Z59B 2REXA 3QC8B 1WGGA 5G55A 3ZW3A 1P3QU 2XEWA 4F7ZA 2FCQA 4XZ4A 2QHOA 4MH0E 3ZRFA 2XK5B 1V2YA 4P7IA 5JZEB 5GMVA 4WQOB 3B1LX 2EMTA 3T9LA 3A9KB 4GSWA 3VVWB 2BF8B 2ZCCA 3ML8A 4FJVB 4K81A 3A4SC 5E6PA 1I42A 1GNUA 4MGIE 2FIFA 4HVBA 1WJ4A 2PE6B 4ANVA 1AARA 1WGDA 3A1QB 4EZLA 5JHAA 2WDTB 3VDZA 3EECA 4KIKB 3NHEB 3L17A 4HCPB 3RD2A 1G6JA 4TV3A 3RT3B 3KH0A 4PS3A 4URKA 4AOFA 3KUDB 5D2MB 3QWZB 3KUZA 4NJ6A 2FCNA 2C5LC 2C60A 4FA6A 4G11A 3P2BA 2KWCA 3KYCD 3VUXA 3UF8A 2R2OA 4DHJD 2G4SA 4GMVA 1V6EA 3UIOB 1J0GA 3R3MA 4GOCA 4CHKA 1Y8RC 4RM9A 2IBIB 2PPHA 2A5UA 3M63B 2KZRA 5G2NA 4BBNF 2IY1B 2KMAA 2UYZB 3APCA 4A3PA 5E6NA 1P98A 2RD0A 3RUIB 3V6CB 3NY5A 3QA8A 1WMHA 4DWFA 2KJ6A 2V3SA 4XC2A 2LZ6A 2BYEA 1H4RA 4G0NB 3L0WB 2K6DB 1WZ0A 2MLBA 2LGDA 2L05A 4ZYNA 3SU8X 5DPSA 2KLGA 2NBVB 2M4NA 2KX0A 3QJZA 3APFA 4FJZA 3VTWA 1WE6A 2MQJA 2MSED 1S3SG 1OEYA 1YJ1A 4EZJA 2O6VD 5IAAC 2M8SA 2BYFA 2KTRB 4DDGD 3I3TB 2NPTB 3CMMB 3JSVB 3UQBA 2KWVB 4KZCA 3AI5A 1WXSA 4RMAA 3ZDMC 3PLVA 2V1YA 3PT2B 4GDLA 4OVVA 1TZ1A 1RAXA 3NZUA 3VQIA 2MW5A 2L0FA 4EUTA 4E74A 3ZKJC 5CHVC 2ZVNA 1EF1A 2CHWA 2JZ3B 4JL9A 2M17A 4MJSB 4AJWA 2Y5BB 5AZFA 2EKEC 2K8HA 2D2QA 2MBHA 2NVUI 3OLMD 2DYMA 3TL5A 4I6LB 2CU1A 2KNBA 3ZUNA 3IFWB 1V5OA 5LXIB 2O2VA 2O6VB 3X0WA 2M1MA 1Z5SB 3B08A 2JRIB 2KDIA 2AL3A 1HE8A 3PRZA 4KSLC 1LXDA 3H7PB 4M8NA 3HIZA 3WAPA 2ZNVB 2IY0B 4HK2A 3UINB 3ZNHB 5IA7A 1T0YA 4PS7A 2ZNVC 5D7GA 4A3OA 2KK8A 1LFDA 1KJTA 2J0KA 4PYUA 2IO3B 1UBQA 5CX3A 4BKGA 2ASQA 2JWZA 2HJ8A 3ZNGC 2GOWA 1WXAA 5C1ZA 1WR1A 3HM6X 4HXDA 2N1VA 4NAWA 1XD3B 4W9FA 4KSKC 4B9KA 1YX6B 2Z0DB 2W9NA 3A9JB 1J19A 1WE7A 5BO4B 1WF9A 2MBOA 1P0RA 3PSEB 1Z2MA 1VD2A 2C9WB 2KFJA 3QHTA 3ONSA 2MCNB 2ZPNA 3JVZX 4JIOU 2D10A 2L3ZA 3MHSD 2VRRB 5HKHA 1UGMA 5CHWA 1IPGA 5D94A 3RYTA 4ANXA 2RSUA 1WX9A 2N9EB 2L8JA 3AU4A 4FULA 2N7EA 3H6NA 4WWNA 3DVNU 3PREA 2DYBA 2K8CA 3PHXB 4WJNA 3PVLA 3UQAA 1CMXB 3L08A 1D3ZA 1NI2A 3L16A 2V4LA 3DBRI 4FHJA 4BKSA 2Z0EB 3S2AA 4DHZB 4KDIC 4LJOB 1RRBA 2KO3A 3ALBA 4W9KA 2L0TA 2ZJDA 2ZZPB 4GDKB 4ASWC 1E8ZA 4W9CA 4NY0A 3ZDTA 3M62B 4GU2A 3AU5A 5FR6A 1V81A 4DK5A 2N7DA 2XK5A 3ENEA 4IW0A 4HDQA 2GBJA 2JY6A 4EKUA 1Q5WB 1SGHA 3WIMA 1E8XA 1WJNA 2FCSA 3A9KA 1SIFA 1XT9B 1KOTA 3WANA 2WX0A 3PPAA 4I6NB 5LXHA 1ZGUB 1OEYJ 1ZKHA 4FJYA 3DBSA 2WWZA 1NDDA 2YVCA 1E90A 4NJ7A 3A1QA 3VFKA 2LGYA 2ZPYA 4A20A 2G3QB 3QK0A 1UZXB 3VH4B 3K9OB 2C7MB 4KIKA 3IVFA 4NQLB 2LWPA 5AZHA 2PJHA 4FLHA 4MGYE 3PRPB 5L95C 4B95A 2K1FA 2NBUA 4AP4C 3PLUA 2NR2A 4FN2A 4EZKA 3M95A 4PS8A 3M3JA 2MWSB 4WWPA 2HTHA 3AULA 1UBIA 4JGHB 3V62A 3VTUA 4HJKA 1YQBA 2CHXA 2KC2A 1WMHB 3KW5B 1GC6A 2J0MA 3EHVA 1R4NI 4DHJB 2KDFB 4HWIB 2IZVB 3WAMA 3Q3FA 4IM3A 4IG7B 4BKTA 4EOYA 2GBMA 1TTNA 4X57B 5C23A 3QARA 4ZRJA 1WJ6A 4ANUA 2G4DB 1TBEA 5L83A 2DAFA 4M0WB 1UELA 1ZW7A 2AL6A 1WIAA 3L13A 2MRPA 4BVUC 2HD5B 2D3GA 4M8MA 2KVRA 5AEKB 2R2QA 4LDTD 5JH5C 2KQSA 1NBFC 4F1SA 3DCGA 3V60A 1R4MI 2DZIA 2LUEA 3ZNZB 3H7SA 3IHPC 2FIDA 2JF5A 4BOSC 1YIWA 2MP2A 1WJUA 3NZSA 4MGZE 2D07B 3BY4B 4GN1A 4ICUA 4ZRKA 3LJ3A 3QCAA 1WXMA 4KDLB 2WX1A 4WJOA 1E8WA 1OQYA 4W9GA 1E8YA 4HCNB 1M94A 2DZMA 2D11A 3R7QA 4ANWA 2JXXA 2N1WA 1GG3A 2KTRA 2KFKB 1RLFA 2BYVE 3JSVA 3ZTDA 4LDTB 2O2VB 1KM7A 1V9JA 3RZFA 4G3XB 1V49A 3B0AA 1RFAA 2KTFA 1VCBA 4EEWA 2KX3A 3EC8A 5CTRC 2KC1A 4II3B 4HPMB 4BFRA 3KUCB 1K8RB 4MJSA 1OTRB 2DHZA 5J18A 3WAOA 3SD5A 2G45B 4MM3A 2GMIC 4GIVA 3CF6E 2O6VA 4WWOA 2DZKA 3DDCB 1WY8A 3LDZE 4ZDVA 3H7PA 3BINA 3RULA 2LXCA 3W1SA 2BPSA 4WJPA 3ZIMA 1WM2A 1YX5B 4BKSD 1WXVA 3K9PB 4AJYB 2KDBA 4W9LA 2GBNA 3ZTCA 2RR9A 3RCZA 1LQBA 2CS4A 3OJ4B 2FCMA 2NBWB 2N9XA 1H8CA 3V6EB 2KHWB 2JUOA 2LI5A 4XX5A 1IP9A 1C1YB 2I1KA 5DCNA 3DVNV 4MDKE 1WGHA 3A9JA 3O65B 2ZEQA 3PGEA 4AUQC 2LRWA 3KVFB 4LJPB 4MELA 3TJPA 3U8ZA 1L2NA 2KLCA 4GB9A 2LD9A 3C0RB 4MEMA 2DAJA 2DYOA 2PE9A 3HHMA 5DPRA 2IO1B 2LJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E7V A;  3EFU A;  2RPQ A;  2KAN A;  3R7R A;  3QAQ A;  3MJW A;  4TQ1 A;  5J2R A;  1EF5 A;  1GJZ A;  3SHQ A;  2NS5 A;  3U7D A;  3W1Y A;  4BOZ B;  4KZ0 A;  3WAL A;  1V5T A;  1QZE A;  3PHW B;  2HE7 A;  4K1R B;  1WI0 A;  2KOX A;  3DVG Y;  4GXB A;  2B3A A;  1WGR A;  3L54 A;  4NPN A;  2YLM A;  5AZG A;  4WAA A;  2N4F A;  3VHT C;  3ZO5 B;  2AYO B;  2LAS A;  2M0X A;  3NOB A;  2KD0 A;  2AWT A;  4GDK A;  2JPH A;  3TBL D;  3ZVV A;  2L00 B;  4F8C B;  2IYD B;  3MTN B;  5DPT A;  3HM3 A;  3V61 A;  5D6J B;  4HLE A;  2PEA A;  1E7U A;  1X1M A;  2JZZ A;  3ZRC A;  1OGW A;  3OAW A;  1WZ3 A;  1KLV A;  2ZVO A;  4IWP A;  2C7N B;  1ISN A;  2DEN B;  4JLC A;  3N32 A;  2MX2 A;  2OOB B;  2MBQ A;  2K6Q A;  1WH3 A;  4K7U A;  2XBB C;  1P9D U;  1IYF A;  4ICV A;  3DQV A;  2WYQ A;  4TQ0 A;  3HK0 A;  3TCA A;  2KKC A;  3IBE A;  1EO6 A;  3PRM B;  5KHO A;  5KHQ A;  1V80 A;  2A4Z A;  3L10 B;  1JRU A;  3RZW C;  4J6I A;  3T8M A;  4DHZ E;  4KV2 A;  2LXA A;  1WX7 A;  3AXC A;  3D32 A;  2LVQ A;  5LLI A;  1Q1O A;  2EMS A;  2K25 A;  4K7W A;  2FUH B;  3VTV A;  4HPL B;  5E6O A;  3PTF C;  3A4R A;  1UD7 A;  2IO0 B;  2FNJ B;  3N30 A;  1GUA B;  1EUV B;  3NS8 A;  2KDE B;  4IC7 B;  2KJH B;  3JYU A;  3APD A;  3N3K B;  2MBE A;  4BBN C;  4EFO A;  2GBK A;  4TKN A;  1WM3 A;  2BWE S;  4DXA B;  2L7R A;  4IWQ A;  1SE9 A;  2AEH A;  2LGX A;  1PQS A;  2C7H A;  4W9D A;  3VUW A;  1WX8 A;  3QQ8 B;  1XQQ A;  2IO2 B;  5J17 A;  2RGF A;  2OJR A;  4GDL B;  2BKR B;  1TGZ B;  2MP2 B;  3DBL I;  3PS6 A;  4IWO A;  1MG8 A;  4E3C A;  1L7Y A;  2KMC A;  4YL8 A;  3DPD A;  2LVO A;  3WA0 A;  3ECI A;  1V86 A;  2BWF A;  4OVU A;  3UIP B;  2NPT A;  4WJQ A;  2CKH B;  1WRD B;  4ZRI A;  1WYW B;  3R66 C;  4GGQ A;  4IM0 A;  1P1A A;  3QX1 A;  1BT0 A;  2J0J A;  1WR6 E;  2K39 A;  1GC7 A;  2LRU A;  2DZJ A;  2MBB B;  3CST A;  4W9I A;  1FXT B;  1WGY A;  1LM8 B;  3A33 B;  2BGF A;  3JW0 X;  4MSM B;  1S1Q B;  4CO7 A;  2L76 A;  4E71 A;  3UGB B;  3H1U A;  2ZCB A;  1J8C A;  2MA9 B;  3ZLZ A;  4IUM B;  4W9J A;  2KFK A;  2KJR A;  4NAW B;  2JRH A;  3PZD A;  4DDI D;  3CSF A;  3KYD D;  2I1J A;  4NQK E;  3DBH I;  4I6P A;  1UH6 A;  3GZN I;  4LCD E;  4K7S A;  4W9H A;  1Q0W B;  3QIJ A;  3VAW A;  1WFY A;  3VUY A;  3VH3 B;  4CYE A;  4DBG A;  3W1S C;  2KQ7 A;  5DPW A;  4MSQ B;  2CR5 A;  2JVC A;  2JT4 B;  5CHF A;  4RM8 A;  3X23 A;  2UWQ A;  4IM2 A;  4B6W A;  3ZNI D;  3TIX A;  3IG3 A;  1F9J A;  5TR5 A;  4PYZ A;  5EDS A;  2CHZ A;  4JQW C;  2FAZ A;  3SDL C;  4NNJ B;  3OJ3 A;  4G50 A;  4W9E A;  2N9P C;  2NCN A;  4KVG B;  4AWJ A;  3ML9 A;  2J7Q B;  4MGK E;  1E5W A;  4FBJ B;  3DOW A;  2KN5 A;  3Q3J A;  2GBR A;  3H9D A;  5JHB A;  1A5R A;  4TUU A;  4FAD A;  3GOE A;  2KXJ A;  3VXW A;  1I35 A;  2KWU B;  4HDO A;  3PV1 A;  3TMP B;  1YD8 U;  4FHK A;  3DVG X;  2LVP A;  4N9F 4;  3U30 A;  4II2 B;  2DX5 B;  2K8B A;  1C3T A;  2BKF A;  1U4A A;  2Z59 B;  2REX A;  3QC8 B;  1WGG A;  5G55 A;  3ZW3 A;  1P3Q U;  2XEW A;  4F7Z A;  2FCQ A;  4XZ4 A;  2QHO A;  4MH0 E;  3ZRF A;  2XK5 B;  1V2Y A;  4P7I A;  5JZE B;  5GMV A;  4WQO B;  3B1L X;  2EMT A;  3T9L A;  3A9K B;  4GSW A;  3VVW B;  2BF8 B;  2ZCC A;  3ML8 A;  4FJV B;  4K81 A;  3A4S C;  5E6P A;  1I42 A;  1GNU A;  4MGI E;  2FIF A;  4HVB A;  1WJ4 A;  2PE6 B;  4ANV A;  1AAR A;  1WGD A;  3A1Q B;  4EZL A;  5JHA A;  2WDT B;  3VDZ A;  3EEC A;  4KIK B;  3NHE B;  3L17 A;  4HCP B;  3RD2 A;  1G6J A;  4TV3 A;  3RT3 B;  3KH0 A;  4PS3 A;  4URK A;  4AOF A;  3KUD B;  5D2M B;  3QWZ B;  3KUZ A;  4NJ6 A;  2FCN A;  2C5L C;  2C60 A;  4FA6 A;  4G11 A;  3P2B A;  2KWC A;  3KYC D;  3VUX A;  3UF8 A;  2R2O A;  4DHJ D;  2G4S A;  4GMV A;  1V6E A;  3UIO B;  1J0G A;  3R3M A;  4GOC A;  4CHK A;  1Y8R C;  4RM9 A;  2IBI B;  2PPH A;  2A5U A;  3M63 B;  2KZR A;  5G2N A;  4BBN F;  2IY1 B;  2KMA A;  2UYZ B;  3APC A;  4A3P A;  5E6N A;  1P98 A;  2RD0 A;  3RUI B;  3V6C B;  3NY5 A;  3QA8 A;  1WMH A;  4DWF A;  2KJ6 A;  2V3S A;  4XC2 A;  2LZ6 A;  2BYE A;  1H4R A;  4G0N B;  3L0W B;  2K6D B;  1WZ0 A;  2MLB A;  2LGD A;  2L05 A;  4ZYN A;  3SU8 X;  5DPS A;  2KLG A;  2NBV B;  2M4N A;  2KX0 A;  3QJZ A;  3APF A;  4FJZ A;  3VTW A;  1WE6 A;  2MQJ A;  2MSE D;  1S3S G;  1OEY A;  1YJ1 A;  4EZJ A;  2O6V D;  5IAA C;  2M8S A;  2BYF A;  2KTR B;  4DDG D;  3I3T B;  2NPT B;  3CMM B;  3JSV B;  3UQB A;  2KWV B;  4KZC A;  3AI5 A;  1WXS A;  4RMA A;  3ZDM C;  3PLV A;  2V1Y A;  3PT2 B;  4GDL A;  4OVV A;  1TZ1 A;  1RAX A;  3NZU A;  3VQI A;  2MW5 A;  2L0F A;  4EUT A;  4E74 A;  3ZKJ C;  5CHV C;  2ZVN A;  1EF1 A;  2CHW A;  2JZ3 B;  4JL9 A;  2M17 A;  4MJS B;  4AJW A;  2Y5B B;  5AZF A;  2EKE C;  2K8H A;  2D2Q A;  2MBH A;  2NVU I;  3OLM D;  2DYM A;  3TL5 A;  4I6L B;  2CU1 A;  2KNB A;  3ZUN A;  3IFW B;  1V5O A;  5LXI B;  2O2V A;  2O6V B;  3X0W A;  2M1M A;  1Z5S B;  3B08 A;  2JRI B;  2KDI A;  2AL3 A;  1HE8 A;  3PRZ A;  4KSL C;  1LXD A;  3H7P B;  4M8N A;  3HIZ A;  3WAP A;  2ZNV B;  2IY0 B;  4HK2 A;  3UIN B;  3ZNH B;  5IA7 A;  1T0Y A;  4PS7 A;  2ZNV C;  5D7G A;  4A3O A;  2KK8 A;  1LFD A;  1KJT A;  2J0K A;  4PYU A;  2IO3 B;  1UBQ A;  5CX3 A;  4BKG A;  2ASQ A;  2JWZ A;  2HJ8 A;  3ZNG C;  2GOW A;  1WXA A;  5C1Z A;  1WR1 A;  3HM6 X;  4HXD A;  2N1V A;  4NAW A;  1XD3 B;  4W9F A;  4KSK C;  4B9K A;  1YX6 B;  2Z0D B;  2W9N A;  3A9J B;  1J19 A;  1WE7 A;  5BO4 B;  1WF9 A;  2MBO A;  1P0R A;  3PSE B;  1Z2M A;  1VD2 A;  2C9W B;  2KFJ A;  3QHT A;  3ONS A;  2MCN B;  2ZPN A;  3JVZ X;  4JIO U;  2D10 A;  2L3Z A;  3MHS D;  2VRR B;  5HKH A;  1UGM A;  5CHW A;  1IPG A;  5D94 A;  3RYT A;  4ANX A;  2RSU A;  1WX9 A;  2N9E B;  2L8J A;  3AU4 A;  4FUL A;  2N7E A;  3H6N A;  4WWN A;  3DVN U;  3PRE A;  2DYB A;  2K8C A;  3PHX B;  4WJN A;  3PVL A;  3UQA A;  1CMX B;  3L08 A;  1D3Z A;  1NI2 A;  3L16 A;  2V4L A;  3DBR I;  4FHJ A;  4BKS A;  2Z0E B;  3S2A A;  4DHZ B;  4KDI C;  4LJO B;  1RRB A;  2KO3 A;  3ALB A;  4W9K A;  2L0T A;  2ZJD A;  2ZZP B;  4GDK B;  4ASW C;  1E8Z A;  4W9C A;  4NY0 A;  3ZDT A;  3M62 B;  4GU2 A;  3AU5 A;  5FR6 A;  1V81 A;  4DK5 A;  2N7D A;  2XK5 A;  3ENE A;  4IW0 A;  4HDQ A;  2GBJ A;  2JY6 A;  4EKU A;  1Q5W B;  1SGH A;  3WIM A;  1E8X A;  1WJN A;  2FCS A;  3A9K A;  1SIF A;  1XT9 B;  1KOT A;  3WAN A;  2WX0 A;  3PPA A;  4I6N B;  5LXH A;  1ZGU B;  1OEY J;  1ZKH A;  4FJY A;  3DBS A;  2WWZ A;  1NDD A;  2YVC A;  1E90 A;  4NJ7 A;  3A1Q A;  3VFK A;  2LGY A;  2ZPY A;  4A20 A;  2G3Q B;  3QK0 A;  1UZX B;  3VH4 B;  3K9O B;  2C7M B;  4KIK A;  3IVF A;  4NQL B;  2LWP A;  5AZH A;  2PJH A;  4FLH A;  4MGY E;  3PRP B;  5L95 C;  4B95 A;  2K1F A;  2NBU A;  4AP4 C;  3PLU A;  2NR2 A;  4FN2 A;  4EZK A;  3M95 A;  4PS8 A;  3M3J A;  2MWS B;  4WWP A;  2HTH A;  3AUL A;  1UBI A;  4JGH B;  3V62 A;  3VTU A;  4HJK A;  1YQB A;  2CHX A;  2KC2 A;  1WMH B;  3KW5 B;  1GC6 A;  2J0M A;  3EHV A;  1R4N I;  4DHJ B;  2KDF B;  4HWI B;  2IZV B;  3WAM A;  3Q3F A;  4IM3 A;  4IG7 B;  4BKT A;  4EOY A;  2GBM A;  1TTN A;  4X57 B;  5C23 A;  3QAR A;  4ZRJ A;  1WJ6 A;  4ANU A;  2G4D B;  1TBE A;  5L83 A;  2DAF A;  4M0W B;  1UEL A;  1ZW7 A;  2AL6 A;  1WIA A;  3L13 A;  2MRP A;  4BVU C;  2HD5 B;  2D3G A;  4M8M A;  2KVR A;  5AEK B;  2R2Q A;  4LDT D;  5JH5 C;  2KQS A;  1NBF C;  4F1S A;  3DCG A;  3V60 A;  1R4M I;  2DZI A;  2LUE A;  3ZNZ B;  3H7S A;  3IHP C;  2FID A;  2JF5 A;  4BOS C;  1YIW A;  2MP2 A;  1WJU A;  3NZS A;  4MGZ E;  2D07 B;  3BY4 B;  4GN1 A;  4ICU A;  4ZRK A;  3LJ3 A;  3QCA A;  1WXM A;  4KDL B;  2WX1 A;  4WJO A;  1E8W A;  1OQY A;  4W9G A;  1E8Y A;  4HCN B;  1M94 A;  2DZM A;  2D11 A;  3R7Q A;  4ANW A;  2JXX A;  2N1W A;  1GG3 A;  2KTR A;  2KFK B;  1RLF A;  2BYV E;  3JSV A;  3ZTD A;  4LDT B;  2O2V B;  1KM7 A;  1V9J A;  3RZF A;  4G3X B;  1V49 A;  3B0A A;  1RFA A;  2KTF A;  1VCB A;  4EEW A;  2KX3 A;  3EC8 A;  5CTR C;  2KC1 A;  4II3 B;  4HPM B;  4BFR A;  3KUC B;  1K8R B;  4MJS A;  1OTR B;  2DHZ A;  5J18 A;  3WAO A;  3SD5 A;  2G45 B;  4MM3 A;  2GMI C;  4GIV A;  3CF6 E;  2O6V A;  4WWO A;  2DZK A;  3DDC B;  1WY8 A;  3LDZ E;  4ZDV A;  3H7P A;  3BIN A;  3RUL A;  2LXC A;  3W1S A;  2BPS A;  4WJP A;  3ZIM A;  1WM2 A;  1YX5 B;  4BKS D;  1WXV A;  3K9P B;  4AJY B;  2KDB A;  4W9L A;  2GBN A;  3ZTC A;  2RR9 A;  3RCZ A;  1LQB A;  2CS4 A;  3OJ4 B;  2FCM A;  2NBW B;  2N9X A;  1H8C A;  3V6E B;  2KHW B;  2JUO A;  2LI5 A;  4XX5 A;  1IP9 A;  1C1Y B;  2I1K A;  5DCN A;  3DVN V;  4MDK E;  1WGH A;  3A9J A;  3O65 B;  2ZEQ A;  3PGE A;  4AUQ C;  2LRW A;  3KVF B;  4LJP B;  4MEL A;  3TJP A;  3U8Z A;  1L2N A;  2KLC A;  4GB9 A;  2LD9 A;  3C0R B;  4MEM A;  2DAJ A;  2DYO A;  2PE9 A;  3HHM A;  5DPR A;  2IO1 B;  2LJ5 A; 
#chains in the Genus database with same CATH topology
 1E7V A;  3EFU A;  4DXF A;  3GS2 A;  1D5X C;  3MJW A;  5J2R A;  1EF5 A;  4OZA A;  3IXS A;  3RNE C;  3W1Y A;  4K1R B;  1QZE A;  3PHW B;  5BYS A;  1WI0 A;  4GXB A;  3DVG Y;  1WGR A;  2YLM A;  5FKA C;  2IND C;  3NOB A;  4GDK A;  3TBL D;  1YMH E;  1CJE A;  3MTN B;  1ET6 A;  1QOB A;  1XXG A;  1X1M A;  1QLB B;  3KQ4 A;  3I63 C;  1WZ3 A;  1KLV A;  4IWP A;  4ZRQ A;  1ISN A;  3T3N A;  2XBB C;  1IYF A;  2WYQ A;  3HVZ A;  3HK0 A;  4TQ0 A;  3TCA A;  3BWU D;  2KKC A;  4RCO A;  4ACF A;  2JYT A;  3PRM B;  5KHQ A;  1MFW A;  1JRU A;  3RZW C;  4JWU C;  2LVQ A;  2EMS A;  2GB1 A;  1SE4 A;  5EE9 A;  4IC7 B;  1A70 A;  2GBK A;  1WM3 A;  3I9V 1;  3KWL A;  4TKN A;  3RNA C;  2L7R A;  2AEH A;  1PQS A;  2IO2 B;  5J17 A;  1YN4 A;  1C78 A;  4MH8 A;  2KMC A;  4YL8 A;  3ECI A;  1ZXI A;  4OVU A;  2NPT A;  1WRD B;  2Y5C A;  4GGQ A;  1BT0 A;  1WR6 E;  2WXR A;  1TKY A;  1GC7 A;  2DZJ A;  3N1Y C;  2PTL A;  1UUP A;  2LEK A;  2MA9 B;  2ONQ A;  4IUM B;  2M56 B;  2KJR A;  4JE3 B;  3CSF A;  1MJD A;  4I6P A;  2WLB A;  4W9H A;  1Q0W B;  1FMA D;  1WFY A;  1SE2 A;  4MSQ B;  3I57 A;  4UDU C;  3AE8 B;  4RM8 A;  1IUE A;  4PYZ A;  3U7Z A;  3DHG C;  1L0V B;  4JQW C;  1CK1 A;  1R7S A;  3DBL B;  4G50 A;  3Q69 A;  4FBJ B;  3ML9 A;  4MGK E;  3Q3J A;  1E6E B;  4B0M A;  4A9A A;  1A5R A;  4TUU A;  1HA5 A;  1I35 A;  2KWU B;  1TT5 B;  4HDO A;  3PV1 A;  3DVG X;  3U30 A;  1SJH D;  1C3T A;  4KKJ A;  1WGK A;  2BKF A;  1ROE A;  1P3Q U;  4C56 C;  1V8C A;  2ICI A;  4MH0 E;  4P7I A;  2LFI A;  3RN9 C;  5GMV A;  3B1L X;  3T9L A;  2IGH A;  3AE2 B;  4XDC A;  4MGI E;  4HVB A;  2PE6 B;  2WDT B;  3GZN B;  2FUG 1;  2KN4 A;  2YEP F;  3IT6 B;  2FCN A;  2KWC A;  4GMV A;  1J0G A;  2QIL A;  2IBI B;  2PPH A;  4RH6 A;  2WXF A;  4GLS C;  1SEB D;  3APC A;  3RNG C;  5E6N A;  3QA8 A;  4D2K A;  1ZPS A;  2KJ6 A;  2PW9 A;  4G0N B;  1WZ0 A;  1DGJ A;  4ZYN A;  2NTS A;  2DNF A;  2LHE A;  4N59 A;  2NBV B;  1VDV A;  2OHF A;  2KX0 A;  1WE6 A;  3FC4 A;  2WU5 B;  4FXC A;  3UQB A;  2DLB A;  4KZC A;  1WXS A;  3PT2 B;  1TZ1 A;  3FKY A;  1EF1 A;  4JL9 A;  4AJW A;  2GRI A;  2D2Q A;  2NVU I;  3OLM D;  2LGI A;  3ZUN A;  2CU1 A;  3B08 A;  4ZRP A;  2JRI B;  2WDV B;  1HE8 A;  3PRZ A;  4KSL C;  4C7Y A;  3HIZ A;  1M4V A;  5IA7 A;  1RYJ A;  4PS7 A;  2KK8 A;  1KJT A;  2J0K A;  4PYU A;  2IO3 B;  2VH1 A;  2HJ8 A;  1WXA A;  5C1Z A;  4NAW A;  4HXD A;  2N1V A;  2V0G A;  1C4P A;  2PKO A;  1SB3 C;  1YX6 B;  4XWW A;  4A90 A;  4M00 A;  1WF9 A;  2MCN B;  4JIO U;  2LHD A;  3JVZ X;  2D10 A;  1FCC C;  3ZJV A;  2AQ3 B;  1UGM A;  5CHW A;  3AEE B;  2NTT A;  2RSU A;  3SFD B;  2N9E B;  3AED B;  1PGB A;  4WWN A;  3PRE A;  4WJN A;  2JSV X;  3L16 A;  5IP4 D;  4FHJ A;  1XF5 L;  2J52 A;  3S2A A;  4DHZ B;  5E6J A;  2CU3 A;  4B0E A;  1DOX A;  2AQ1 B;  4P16 A;  1XO3 A;  2ZZP B;  3L4P A;  3GE3 C;  1AW7 A;  1ESF A;  5FR6 A;  2WXM A;  2N7D A;  2WS3 B;  3ENE A;  4IW0 A;  2INP E;  2JY6 A;  4N6E B;  1N6Z A;  1FNW A;  5C2T B;  4EKU A;  1JWB D;  1TIF A;  5LXH A;  1OEY J;  1E0Z A;  4XE0 A;  2LGY A;  2ZPY A;  4P6V F;  3QK0 A;  1NYQ A;  1UZX B;  4NZL B;  2BVC A;  1AYF A;  4OVZ A;  3PRP B;  3HVD A;  2K1F A;  2NBU A;  4PS8 A;  3AUL A;  3VTU A;  4JGH B;  3V62 A;  4HJK A;  2SEB D;  1T0Q C;  2J0M A;  4DHJ B;  3N20 C;  3WAM A;  4JX1 C;  1TS5 A;  4IM3 A;  3AE9 B;  3DBR B;  3U2S C;  1FCL A;  2GBM A;  2JWU A;  2W3R A;  4ZHP A;  1DOY A;  5H8Y E;  4ANU A;  2G4D B;  5L83 A;  1I4R A;  2DAF A;  4M0W B;  4BVU C;  2MRP A;  1HQR D;  4XDD A;  1C9F A;  2FE8 A;  3IHP C;  1ZOY B;  1YIW A;  3NZS A;  2MP2 A;  4ZRK A;  1L4D B;  3TSS A;  3LJ3 A;  3BYT B;  2Z8L A;  4WJO A;  1C77 A;  2DZM A;  1RWS A;  2D11 A;  4S17 A;  1RM6 C;  2JXX A;  1RLF A;  2BYV E;  3JSV A;  3ZTD A;  4C00 A;  2O2V B;  2K0P A;  3W5U B;  1KM7 A;  4WQM A;  3TEW A;  4LTU A;  4G3X B;  1V49 A;  2GLS A;  1C76 A;  3P4Q B;  2KTF A;  4EEW A;  4II3 B;  3VRB B;  1K8R B;  1MHH E;  5FK9 C;  4O1N A;  1YN3 A;  3SD5 A;  1E7P B;  2N9L A;  4GIV A;  2LJI A;  5C3J B;  4WWO A;  2Q5W D;  1J7A A;  4ZDV A;  3RUL A;  4WJP A;  3ZIM A;  1WYG A;  4AJY B;  2KDB A;  1DOI A;  1E9M A;  3E56 A;  4W9L A;  1NVI D;  1R4M B;  4RF1 A;  2CS4 A;  1FXA A;  2JUO A;  1IP9 A;  4HEA 1;  5DCN A;  1FFV A;  3PGE A;  2LRW A;  1L2N A;  5BMI A;  4GB9 A;  2W82 A;  2DAJ A;  2BT6 A;  2LUM A;  5DPR A;  2LJ5 A;  3IAM 1;  3N1X C;  2KAN A;  3QAQ A;  2VH2 A;  4TQ1 A;  3MC0 B;  1KF6 B;  3SHQ A;  3HUI A;  4KZ0 A;  3WAL A;  3J9C A;  2B3A A;  3L54 A;  5EE0 A;  4WAA A;  2AYO B;  2LAS A;  2M0X A;  2KD0 A;  3ZVV A;  5D6J B;  2WXO A;  2C7N B;  2IDY A;  1WXQ A;  3ZJU A;  2OOB B;  5I4D A;  1DYQ A;  4K7U A;  4ICV A;  1JRO A;  5KHO A;  5D3I B;  2WXH A;  1TS3 A;  3T8M A;  1ZDX A;  4DHZ E;  2LXA A;  3AXC A;  5LLI A;  1Q1O A;  4K7W A;  1JCK B;  1TJE A;  3SFE B;  1ACC A;  3A4R A;  1UD7 A;  3Q8B A;  2IO0 B;  1F0Z A;  1GUA B;  3C8Y A;  3RI7 C;  3NS8 A;  2KDE B;  3JYU A;  4P1B C;  4XWT A;  3AH7 A;  1C4C A;  1T0R C;  2I38 A;  1PGX A;  1B1Z A;  4LNN A;  2OJR A;  2BKR B;  1TGZ B;  3PS6 A;  4IWO A;  3ZYY X;  1T0S C;  2IGG A;  3WA0 A;  1JQ4 A;  5AUI A;  2BWF A;  3VRA B;  1YQ4 B;  3RNF C;  4IM0 A;  1P1A A;  3QX1 A;  1I4H A;  3NVY A;  2D3C A;  4OZC A;  4W9I A;  4CO7 A;  2BGF A;  3Q8E A;  4MSM B;  4E71 A;  1TKG A;  2ZCB A;  1P7F A;  2KFK A;  2JRH A;  3PZD A;  4DDI D;  4HRS A;  2RDG A;  4LCD E;  1PFD A;  3E9S A;  3VH3 B;  3W1S C;  1I4P A;  2JT4 B;  3GE8 C;  4KX6 B;  2UWQ A;  3X23 A;  2BS2 B;  4B6W A;  2KQ4 X;  3IG3 A;  1F9J A;  3MC8 A;  3URY A;  5EDS A;  4RGO S;  3SDL C;  3OJ3 A;  2NCN A;  2R61 A;  2WXQ A;  3DOW A;  2RDH A;  4HKQ A;  2GBR A;  4FAD A;  2KXJ A;  2MJ3 A;  2MH7 A;  1YD8 U;  4FHK A;  4N9F 4;  3FIL A;  2K8B A;  2PMV A;  1U4A A;  2REX A;  3QC8 B;  4KGT A;  1WGG A;  1UF0 A;  2FCQ A;  4C4V B;  4XZ4 A;  2QHO A;  4ZOH C;  2XK5 B;  5JZE B;  2M19 A;  4WQO B;  4WWM A;  4NAM A;  2EMT A;  3A9K B;  4GSW A;  3VVW B;  1XCT L;  4K81 A;  4HPP A;  2PIA A;  1GNU A;  2FIF A;  4A55 A;  2N7J A;  1WGD A;  2QDF A;  4EZL A;  4HJG E;  2INN E;  3EEC A;  3ZXV A;  4KIK B;  1QQR A;  3RD2 A;  2IGD A;  5G5H A;  5D2M B;  3QWZ B;  1JW9 D;  1SF0 A;  2C5L C;  4FA6 A;  4G11 A;  3P2B A;  2R2O A;  2JU6 X;  2G4S A;  3R3M A;  1FFU A;  4CHK A;  1Y8R C;  2A5U A;  3M63 B;  4YSY B;  3Q3N C;  1C4A A;  2UYZ B;  3MP9 A;  1TY2 A;  2WQY B;  4DWF A;  4XC2 A;  2BYE A;  1H4R A;  3L0W B;  1OFF A;  2WXK A;  4TSS A;  2WU2 B;  1D6E C;  1CQV A;  2BW2 A;  3SU8 X;  4BAX A;  1F1H A;  3N1Z C;  2M4N A;  5HFY A;  1YNT E;  4FJZ A;  2MQJ A;  2MSE D;  1S3S G;  2I2Y A;  2O6V D;  5IAA C;  5EE1 A;  2BYF A;  3I3T B;  2NPT B;  1JWS D;  3ZDM C;  3AI5 A;  3PLV A;  2V1Y A;  3TUO A;  4OVV A;  4HKZ E;  3MJ5 A;  3VQI A;  3ZQ4 A;  4E74 A;  4MJS B;  3OG5 A;  2K8H A;  5AZF A;  2M0A A;  3TL5 A;  3IFW B;  1V5O A;  2WXJ A;  4MM3 B;  4RF0 A;  2O6V B;  2M1M A;  2AL3 A;  1LXD A;  3H7P B;  2V3P A;  4HK2 A;  2KT7 A;  1EWC A;  5D7G A;  2BTE A;  3SEB A;  2ASQ A;  2JWZ A;  2LMC A;  1QT9 A;  2GOW A;  4US9 A;  3HM6 X;  4RGT A;  3R2I A;  1XD3 B;  2W55 A;  1WE7 A;  5BO4 B;  3SR6 A;  3ZJT A;  2KFJ A;  3N9Y C;  3ONS A;  2VRR B;  5HKH A;  2L8J A;  3AU4 A;  3DVN U;  4YSZ B;  2W3S A;  3PVL A;  1HEZ E;  1D3Z A;  4LK0 M;  2Z0E B;  5BMG A;  1VLB A;  5G5G A;  2Y3A A;  4W9C A;  4NY0 A;  3ZDT A;  3M62 B;  4GU2 A;  4PT5 A;  1V81 A;  3AE6 B;  4N58 A;  2GBJ A;  1Q5W B;  3WIM A;  4AQ7 A;  4XGA B;  1VZ7 A;  3Q14 C;  1I4X A;  1SIF A;  3TEX A;  3PPA A;  2CJN A;  1ZGU B;  4FJY A;  3VFK A;  1KLU D;  1L0Y B;  3VH4 B;  2BYT A;  3K9O B;  1VZ6 A;  1L6V A;  3R2T A;  4FLH A;  4MGY E;  3P4S B;  4B95 A;  3RNC C;  4EZK A;  4RGN A;  1C79 A;  3EFC A;  3Q3M C;  2BB5 A;  4K3B A;  1VJK A;  3AE3 B;  3EHV A;  1R4N I;  2WXL A;  2IZV B;  4US8 A;  3Q3F A;  4R3D A;  1MVK A;  2JZP A;  4IG7 B;  4EOY A;  3W5V B;  3RFZ B;  1TTN A;  4X57 B;  3QAR A;  1UGJ A;  1WJ6 A;  3U52 E;  1T6B X;  1BML C;  1MPE A;  1WIA A;  2D3G A;  4M8M A;  2R2Q A;  4LDT D;  1YN5 A;  5JH5 C;  4F1S A;  3NG0 A;  3V60 A;  5D3D A;  1JAL A;  4OZB A;  2LUE A;  2WXG A;  5EE3 A;  1T3Q A;  3T3O A;  4MGZ E;  2V9H A;  2QEJ C;  1E8W A;  1OQY A;  3KLS X;  2QSD A;  2AQ2 B;  4A6Q A;  1GG3 A;  2KVZ A;  1XLQ A;  1XLP A;  4RNA A;  4KGS A;  4LDT B;  1GB4 A;  3EA6 A;  3B0A A;  1VCB A;  2KX3 A;  2KC1 A;  3KUC B;  3MHZ A;  1OTR B;  4LNF A;  3WAO A;  1WWT A;  3C19 A;  2XNA C;  3DDC B;  1SXT A;  2BPS A;  1YX5 B;  3K9P B;  3Q8A A;  1QOA A;  1IBX B;  3HRD D;  1LQB A;  1FNV A;  2KHW B;  1ENF A;  3NJT A;  4MDK E;  1WGH A;  3H8H A;  3KVF B;  2KLC A;  1PYW D;  3C0R B;  2PE9 A;  3HHM A;  1VRA B;  2RPQ A;  1MI0 A;  1TS4 A;  3R7R A;  3U7D A;  1I7H A;  1YOV B;  2KOX A;  3V05 A;  3AN1 A;  3VHT C;  1GPX A;  2N4F A;  2AWT A;  2JPH A;  2L00 B;  2SAK A;  3V61 A;  3DBH B;  1GOZ A;  3EUB 2;  2JZZ A;  3ZRC A;  1OGW A;  3OAW A;  1SSN A;  2LGS A;  2DEN B;  1N60 A;  3N32 A;  2MX2 A;  2K6Q A;  1EO6 A;  1V80 A;  3BVM A;  4IOI E;  2WNM A;  3D32 A;  1V1P B;  3VTV A;  1VZ8 A;  1F2R I;  3PTF C;  1Y56 A;  1F52 A;  2H88 B;  4ITK A;  3N30 A;  3AE7 B;  1EUV B;  2WGS A;  3LXF A;  3APD A;  3Q2A C;  4BBN C;  2ZW1 A;  1NEK B;  4DXA B;  1GB1 A;  2LGX A;  1MHX A;  1ZP0 B;  4W9D A;  1FXI A;  1WX8 A;  3PO0 A;  3QQ8 B;  1XQQ A;  3O13 A;  2RGF A;  4GDL B;  2MP2 B;  1MG8 A;  1L7Y A;  1XEE A;  4M0W A;  2CJO A;  3DPD A;  2LVO A;  4REZ A;  2J4X A;  1V86 A;  3UIP B;  4WJQ A;  2WXN A;  2CKH B;  3AMZ A;  1WYW B;  2NMQ A;  4CQN A;  1HZ6 A;  2N0S B;  2LRU A;  2MBB B;  1WRI A;  1WGY A;  1LM8 B;  1V1O A;  2L76 A;  1YJI A;  3H1U A;  1J8C A;  1YJJ A;  1J7C A;  4W9J A;  4OHJ A;  4EE2 A;  2ON8 A;  1BXT A;  3KYD D;  2I1J A;  4MT5 A;  3DBH I;  3CWI A;  1D5M C;  3UI3 A;  3VAW A;  3PZ8 A;  3AE4 B;  3VUY A;  4DBG A;  2Y5P A;  2IJ0 A;  2KQ7 A;  3AEF B;  5DPW A;  2CR5 A;  5CHF A;  1UWX A;  2EEL A;  3TIX A;  2K22 A;  5TR5 A;  2CHZ A;  2FAZ A;  2N9P C;  2J7Q B;  4TMA B;  2MEK A;  3H9D A;  3VXW A;  5T8I A;  2LVP A;  4II2 B;  1FRD A;  3ZW3 A;  2XEW A;  4F7Z A;  4K3C A;  3AEA B;  5HI1 A;  3ZRF A;  3NRZ A;  1IGD A;  1TKE A;  3NVV A;  4YTP B;  2ZCC A;  4FJV B;  5HG2 A;  3A4S C;  2K9X A;  1I42 A;  4ANV A;  1AAR A;  3A1Q B;  5JHA A;  3VDZ A;  4KKI A;  2OJW A;  3NHE B;  1G6J A;  4TV3 A;  4PS3 A;  4WAF A;  5IN7 A;  3KUD B;  4DXG A;  3KUZ A;  4NJ6 A;  2C60 A;  3KYC D;  3VUX A;  4WH4 A;  3UF8 A;  1L6U A;  1V6E A;  1JWA D;  4BZA A;  2VZK D;  1QOF A;  3AM9 A;  3GB1 A;  3NY5 A;  1UWM A;  1WMH A;  2V3S A;  1N5X A;  1FNU A;  1QKZ A;  3BVG A;  2MLB A;  1YQ3 B;  4ARC A;  2LGD A;  2L05 A;  5DPS A;  1MG4 A;  2KLG A;  2VZK B;  3QJZ A;  5BMH A;  2KYW A;  3APF A;  2BBC A;  3P63 A;  4IDI A;  1YJ1 A;  2WDR B;  4S0R A;  4DDG D;  2KTR B;  1K52 A;  3CMM B;  4RMA A;  1KLG D;  3KWV A;  1CZP A;  2MW5 A;  4YXD B;  1KRH A;  2DBY A;  4EUT A;  3ZKJ C;  2OED A;  5CHV C;  2BB6 A;  1HZ5 A;  2ZVN A;  1TS2 A;  2M17 A;  2QMT A;  2MBH A;  2RPV A;  4I6L B;  3ZXR A;  2KDM A;  4M8N A;  3Q8C A;  3P42 A;  2ZNV B;  5IO9 A;  1T0Y A;  2ZNV C;  4A3O A;  3DHI C;  1LFD A;  3LB8 C;  4L1B A;  5CX3 A;  2KAC A;  5IKC M;  2KWD A;  4KSK C;  4B9K A;  2Z0D B;  3A9J B;  1Q10 A;  3PSE B;  1VD2 A;  3X0W A;  2L3Z A;  1WSP A;  5H92 C;  1FEH A;  3FIL B;  1IPG A;  5D94 A;  3RYT A;  3RPF C;  1JRP A;  4FUL A;  2RMM A;  2N7E A;  3H6N A;  2DYB A;  3PHX B;  2JQR B;  3UQA A;  3L08 A;  3AEG B;  4BKS A;  4LJO B;  4W9K A;  2ZJD A;  4GDK B;  3AU5 A;  4C4V A;  4DK5 A;  3NVW A;  2XK5 A;  3P4P B;  1SGH A;  1WJN A;  2FCS A;  2E6X A;  1JWU D;  3A9K A;  1KOT A;  2WX0 A;  1ZKH A;  2QCZ A;  2WWZ A;  4NJ7 A;  5BYQ A;  4A20 A;  2K5P A;  3Q3O C;  2QC8 A;  4KIK A;  2V3N A;  4NQL B;  5AZH A;  2PJH A;  3PLU A;  2NR2 A;  4FN2 A;  3M3J A;  1KFY B;  2J42 A;  2MWS B;  4WWP A;  2HTH A;  1L4Z B;  3BYY B;  2CHX A;  2KC2 A;  3KW5 B;  1OQR A;  2E3T A;  4HWI B;  2MJE A;  1N63 A;  4BKT A;  2INC C;  2HTM E;  5C23 A;  4WIP A;  4ZHO A;  1TBE A;  3BII D;  2AL6 A;  3NS1 A;  3VR8 B;  1NEN B;  1P7E A;  2KQS A;  3DCG A;  2DZI A;  3ZNZ B;  4BOS C;  2WP9 B;  2QJL A;  1FM0 D;  2D07 B;  3BY4 B;  1HTQ A;  3QCA A;  1WXM A;  2WX1 A;  4YT0 B;  3P1M A;  1QF6 A;  1M94 A;  1STE A;  4ANW A;  1EWY C;  5JXV A;  2AX5 A;  2WXI A;  1V9J A;  1D5Z C;  2B76 B;  4HPM B;  2K3U A;  2KAJ A;  4BFR A;  4MJS A;  2DHZ A;  5J18 A;  4YTN B;  1R4N B;  4MM3 A;  2GMI C;  2O6V A;  1WY8 A;  3R8B A;  1K53 A;  3LDZ E;  3H7P A;  3BIN A;  2TSS A;  2LXC A;  1WM2 A;  1WXV A;  2DWQ A;  4YWG G;  3RCZ A;  3OJ4 B;  1F77 A;  1C1Y B;  3MFG A;  2PLP A;  4LJP B;  3U8Z A;  2D3A A;  4LNI A;  2UU7 A;  4MEM A;  3MC9 A;  1OQQ A;  2IO1 B;  1AN8 A;  4L2Y A;  1SE3 A;  2BS3 B;  1GJZ A;  2NS5 A;  4BOZ B;  3BVZ A;  4DQO C;  1V5T A;  2HE7 A;  1EU4 A;  4NPN A;  1XLO A;  5AZG A;  3ZO5 B;  2WHI A;  4F8C B;  2IYD B;  5DPT A;  3HM3 A;  4HLE A;  2PEA A;  1E7U A;  1QIL A;  4WUR A;  1KTK A;  2X38 A;  2ZVO A;  3LYY A;  4JLC A;  2MBQ A;  4Q2J A;  1WH3 A;  1P9D U;  3DQV A;  3BK2 A;  2YEP B;  4ZYS A;  3IBE A;  1NI3 A;  2A4Z A;  3L10 B;  4J6I A;  4KV2 A;  1WX7 A;  1PGA A;  2XN9 C;  2K25 A;  2FUH B;  4HPL B;  5E6O A;  1ZDV A;  2FNJ B;  3AV8 A;  1FIQ A;  2KJH B;  3N3K B;  2MBE A;  4EFO A;  2BWE S;  4IWQ A;  1SE9 A;  1RFK A;  2C7H A;  2D5G A;  3VUW A;  2V4I B;  1UNS A;  2L32 A;  2X8X X;  3DBL I;  4E3C A;  3OWE B;  2BQQ A;  4ZRI A;  3R66 C;  2J0J A;  1SIJ A;  3PZ7 A;  2K39 A;  3IT4 B;  3CST A;  2PVG C;  1FXT B;  3JW0 X;  3A33 B;  1S1Q B;  3UGB B;  3ZLZ A;  4YSX B;  3W2D A;  4NAW B;  2WDQ B;  4NQK E;  4M01 A;  1UH6 A;  3GZN I;  1F2R C;  4K7S A;  3QIJ A;  2L83 A;  2BS4 B;  3AEB B;  2ACZ B;  4CYE A;  1EU3 A;  2JVC A;  2WXP A;  4IM2 A;  3ZNI D;  3BZD B;  4NNJ B;  4W9E A;  4AWJ A;  4KVG B;  1E5W A;  2KN5 A;  2G1E A;  3TEZ A;  5JHB A;  3GOE A;  3TMP B;  1IBX A;  1KH0 A;  2DX5 B;  1FD6 A;  3DWG C;  2Z59 B;  3U4E G;  5G55 A;  4OW0 A;  4P1C C;  1SJE D;  4A8X C;  1V2Y A;  1TZO A;  3AE1 B;  2BF8 B;  3ML8 A;  2G9H D;  4LNK A;  5E6P A;  1WJ4 A;  3RNB C;  3Q8F A;  1K51 A;  3L17 A;  4HCP B;  3CIR B;  3NVZ A;  3RT3 B;  3KH0 A;  5TSS A;  2ZW0 A;  4URK A;  4AOF A;  1AWD A;  1QOG A;  3AE5 B;  1N61 A;  1ZXH A;  1LO5 D;  1T5X D;  1B9R A;  4DHJ D;  3UIO B;  4GOC A;  4RM9 A;  2KZR A;  5G2N A;  4IKG A;  4BBN F;  2IY1 B;  2KMA A;  2HJ1 A;  4A3P A;  1P98 A;  2RD0 A;  3RUI B;  3V6C B;  5AUK A;  2LZ6 A;  2K6D B;  5MPO A;  1XLN A;  4H2A A;  1V1P A;  2MJD A;  1SBB B;  1FO4 A;  4JWS C;  3WCQ A;  1ET9 A;  1N62 A;  5FR3 A;  1N5W A;  5HHD G;  3VTW A;  3NUH B;  1K50 A;  4RFB A;  1OEY A;  4EZJ A;  2M8S A;  3JSV B;  1LGR A;  2KWV B;  4GDL A;  1RAX A;  3NZU A;  1L5P A;  1PDX A;  3Q6B A;  2L0F A;  2CHW A;  2JZ3 B;  2MHJ A;  2Y5B B;  1IGC A;  3B9J A;  2EKE C;  2DYM A;  2KNB A;  4QAY A;  1V97 A;  5LXI B;  2O2V A;  1JWM D;  1Z5S B;  3DHH C;  1E10 A;  2KDI A;  5GXG B;  1HXY D;  3WAP A;  2IY0 B;  1ZE3 D;  2KMM A;  3UIN B;  3ZNH B;  3AEC B;  3BK1 A;  3FAH A;  5LNK 1;  4L23 A;  1UBQ A;  4BKG A;  1FRR A;  3ZNG C;  1WR1 A;  4W9F A;  1I4G A;  2W9N A;  3I5J C;  1J19 A;  1TY0 A;  2MBO A;  4C7Z A;  1P0R A;  1Z2M A;  2C9W B;  3QHT A;  2ZPN A;  5BYR A;  3EGR A;  2L52 A;  2GI9 A;  3MHS D;  2QIE B;  4ANX A;  1WX9 A;  1ZUD 2;  2K8C A;  4YTM B;  1CMX B;  1NI2 A;  2V4L A;  3DBR I;  4KDI C;  2D3B A;  1RRB A;  2KO3 A;  3ZGZ A;  3ALB A;  3AB5 A;  2L0T A;  4ASW C;  1E8Z A;  3VR9 B;  2EKI A;  4XYC A;  2J53 A;  2W54 A;  4HDQ A;  4LNO A;  1E8X A;  4RGM A;  1D4B A;  3ABV B;  2PVO D;  1XT9 B;  3WAN A;  4I6N B;  2H89 B;  3DBS A;  2YVC A;  1NDD A;  1E90 A;  3A1Q A;  4MAC A;  2JX5 A;  2G3Q B;  3B2G A;  2C7M B;  3IVF A;  2LWP A;  3TEY A;  5L95 C;  4C80 A;  4AP4 C;  3M95 A;  3P4R B;  1UBI A;  2IPK D;  1YQB A;  4M02 A;  1WMH B;  1GC6 A;  3B2F A;  2KDF B;  1I4Q A;  4NJC A;  4ZRJ A;  1GAQ B;  1BUI C;  2FBW B;  1UEL A;  1ZW7 A;  3L13 A;  2HD5 B;  2KVR A;  5AEK B;  3RMK C;  2L1A A;  1NBF C;  1R4M I;  3NZ3 A;  3H7S A;  2FID A;  2JF5 A;  4J3O D;  1WJU A;  4GN1 A;  4ICU A;  1VR9 A;  4KDL B;  2N9K A;  4W9G A;  1E8Y A;  4HCN B;  3DWM A;  3W9C B;  3R7Q A;  2N1W A;  2KTR A;  2KFK B;  1XCQ L;  3RZF A;  2JYE A;  1J7B A;  1JML A;  1EM7 A;  1RFA A;  4USA A;  3EC8 A;  1L0X B;  5CTR C;  2G45 B;  3CF6 E;  5IOI A;  4ARI A;  1NYR A;  2DZK A;  3W1S A;  1PUT A;  4KGR A;  4BKS D;  4LLG M;  2GBN A;  3ZTC A;  2JXT A;  2RR9 A;  1TYG B;  4HRO A;  1H8C A;  2FCM A;  2NBW B;  2N9X A;  2HDE A;  1HTO A;  3V6E B;  2LI5 A;  4XX5 A;  3IAS 1;  2I1K A;  3DVN V;  4JPS A;  4AS1 A;  3A9J A;  3O65 B;  2ZEQ A;  4AUQ C;  3V3X A;  2RDB C;  4MEL A;  3TJP A;  3GP7 A;  2LD9 A;  3ETR A;  2DYO A;  1FPY A;  4PK1 A; 
#chains in the Genus database with same CATH homology
 1E7V A;  3EFU A;  2RPQ A;  2KAN A;  3R7R A;  3QAQ A;  3MJW A;  4TQ1 A;  5J2R A;  1EF5 A;  1GJZ A;  3SHQ A;  2NS5 A;  3U7D A;  3W1Y A;  4BOZ B;  4KZ0 A;  3WAL A;  1V5T A;  1QZE A;  3PHW B;  2HE7 A;  4K1R B;  1WI0 A;  2KOX A;  3DVG Y;  4GXB A;  2B3A A;  1WGR A;  3L54 A;  4NPN A;  2YLM A;  5AZG A;  4WAA A;  2N4F A;  3VHT C;  3ZO5 B;  2AYO B;  2LAS A;  2M0X A;  3NOB A;  2KD0 A;  2AWT A;  4GDK A;  2JPH A;  3TBL D;  3ZVV A;  2L00 B;  4F8C B;  2IYD B;  3MTN B;  5DPT A;  3HM3 A;  3V61 A;  5D6J B;  4HLE A;  2PEA A;  1E7U A;  1X1M A;  2JZZ A;  3ZRC A;  1OGW A;  3OAW A;  1WZ3 A;  1KLV A;  2ZVO A;  4IWP A;  2C7N B;  1ISN A;  2DEN B;  4JLC A;  3N32 A;  2MX2 A;  2OOB B;  2MBQ A;  2K6Q A;  1WH3 A;  4K7U A;  2XBB C;  1P9D U;  1IYF A;  4ICV A;  3DQV A;  2WYQ A;  4TQ0 A;  3HK0 A;  3TCA A;  2KKC A;  3IBE A;  1EO6 A;  3PRM B;  5KHO A;  5KHQ A;  1V80 A;  2A4Z A;  3L10 B;  1JRU A;  3RZW C;  4J6I A;  3T8M A;  4DHZ E;  4KV2 A;  2LXA A;  1WX7 A;  3AXC A;  3D32 A;  2LVQ A;  5LLI A;  1Q1O A;  2EMS A;  2K25 A;  4K7W A;  2FUH B;  3VTV A;  4HPL B;  5E6O A;  3PTF C;  3A4R A;  1UD7 A;  2IO0 B;  2FNJ B;  3N30 A;  1GUA B;  1EUV B;  3NS8 A;  2KDE B;  4IC7 B;  2KJH B;  3JYU A;  3APD A;  3N3K B;  2MBE A;  4BBN C;  4EFO A;  2GBK A;  4TKN A;  1WM3 A;  2BWE S;  4DXA B;  2L7R A;  4IWQ A;  1SE9 A;  2AEH A;  2LGX A;  1PQS A;  2C7H A;  4W9D A;  3VUW A;  1WX8 A;  3QQ8 B;  1XQQ A;  2IO2 B;  5J17 A;  2RGF A;  2OJR A;  4GDL B;  2BKR B;  1TGZ B;  2MP2 B;  3DBL I;  3PS6 A;  4IWO A;  1MG8 A;  4E3C A;  1L7Y A;  2KMC A;  4YL8 A;  3DPD A;  2LVO A;  3WA0 A;  3ECI A;  1V86 A;  2BWF A;  4OVU A;  3UIP B;  2NPT A;  4WJQ A;  2CKH B;  1WRD B;  4ZRI A;  1WYW B;  3R66 C;  4GGQ A;  4IM0 A;  1P1A A;  3QX1 A;  1BT0 A;  2J0J A;  1WR6 E;  2K39 A;  1GC7 A;  2LRU A;  2DZJ A;  2MBB B;  3CST A;  4W9I A;  1FXT B;  1WGY A;  1LM8 B;  3A33 B;  2BGF A;  3JW0 X;  4MSM B;  1S1Q B;  4CO7 A;  2L76 A;  4E71 A;  3UGB B;  3H1U A;  2ZCB A;  1J8C A;  2MA9 B;  3ZLZ A;  4IUM B;  4W9J A;  2KFK A;  2KJR A;  4NAW B;  2JRH A;  3PZD A;  4DDI D;  3CSF A;  3KYD D;  2I1J A;  4NQK E;  3DBH I;  4I6P A;  1UH6 A;  3GZN I;  4LCD E;  4K7S A;  4W9H A;  1Q0W B;  3QIJ A;  3VAW A;  1WFY A;  3VUY A;  3VH3 B;  4CYE A;  4DBG A;  3W1S C;  2KQ7 A;  5DPW A;  4MSQ B;  2CR5 A;  2JVC A;  2JT4 B;  5CHF A;  4RM8 A;  3X23 A;  2UWQ A;  4IM2 A;  4B6W A;  3ZNI D;  3TIX A;  3IG3 A;  1F9J A;  5TR5 A;  4PYZ A;  5EDS A;  2CHZ A;  4JQW C;  2FAZ A;  3SDL C;  4NNJ B;  3OJ3 A;  4G50 A;  4W9E A;  2N9P C;  2NCN A;  4KVG B;  4AWJ A;  3ML9 A;  2J7Q B;  4MGK E;  1E5W A;  4FBJ B;  3DOW A;  2KN5 A;  3Q3J A;  2GBR A;  3H9D A;  5JHB A;  1A5R A;  4TUU A;  4FAD A;  3GOE A;  2KXJ A;  3VXW A;  1I35 A;  2KWU B;  4HDO A;  3PV1 A;  3TMP B;  1YD8 U;  4FHK A;  3DVG X;  2LVP A;  4N9F 4;  3U30 A;  4II2 B;  2DX5 B;  2K8B A;  1C3T A;  2BKF A;  1U4A A;  2Z59 B;  2REX A;  3QC8 B;  1WGG A;  5G55 A;  3ZW3 A;  1P3Q U;  2XEW A;  4F7Z A;  2FCQ A;  4XZ4 A;  2QHO A;  4MH0 E;  3ZRF A;  2XK5 B;  1V2Y A;  4P7I A;  5JZE B;  5GMV A;  4WQO B;  3B1L X;  2EMT A;  3T9L A;  3A9K B;  4GSW A;  3VVW B;  2BF8 B;  2ZCC A;  3ML8 A;  4FJV B;  4K81 A;  3A4S C;  5E6P A;  1I42 A;  1GNU A;  4MGI E;  2FIF A;  4HVB A;  1WJ4 A;  2PE6 B;  4ANV A;  1AAR A;  1WGD A;  3A1Q B;  4EZL A;  5JHA A;  2WDT B;  3VDZ A;  3EEC A;  4KIK B;  3NHE B;  3L17 A;  4HCP B;  3RD2 A;  1G6J A;  4TV3 A;  3RT3 B;  3KH0 A;  4PS3 A;  4URK A;  4AOF A;  3KUD B;  5D2M B;  3QWZ B;  3KUZ A;  4NJ6 A;  2FCN A;  2C5L C;  2C60 A;  4FA6 A;  4G11 A;  3P2B A;  2KWC A;  3KYC D;  3VUX A;  3UF8 A;  2R2O A;  4DHJ D;  2G4S A;  4GMV A;  1V6E A;  3UIO B;  1J0G A;  3R3M A;  4GOC A;  4CHK A;  1Y8R C;  4RM9 A;  2IBI B;  2PPH A;  2A5U A;  3M63 B;  2KZR A;  5G2N A;  4BBN F;  2IY1 B;  2KMA A;  2UYZ B;  3APC A;  4A3P A;  5E6N A;  1P98 A;  2RD0 A;  3RUI B;  3V6C B;  3NY5 A;  3QA8 A;  1WMH A;  4DWF A;  2KJ6 A;  2V3S A;  4XC2 A;  2LZ6 A;  2BYE A;  1H4R A;  4G0N B;  3L0W B;  2K6D B;  1WZ0 A;  2MLB A;  2LGD A;  2L05 A;  4ZYN A;  3SU8 X;  5DPS A;  2KLG A;  2NBV B;  2M4N A;  2KX0 A;  3QJZ A;  3APF A;  4FJZ A;  3VTW A;  1WE6 A;  2MQJ A;  2MSE D;  1S3S G;  1OEY A;  1YJ1 A;  4EZJ A;  2O6V D;  5IAA C;  2M8S A;  2BYF A;  2KTR B;  4DDG D;  3I3T B;  2NPT B;  3CMM B;  3JSV B;  3UQB A;  2KWV B;  4KZC A;  3AI5 A;  1WXS A;  4RMA A;  3ZDM C;  3PLV A;  2V1Y A;  3PT2 B;  4GDL A;  4OVV A;  1TZ1 A;  1RAX A;  3NZU A;  3VQI A;  2MW5 A;  2L0F A;  4EUT A;  4E74 A;  3ZKJ C;  5CHV C;  2ZVN A;  1EF1 A;  2CHW A;  2JZ3 B;  4JL9 A;  2M17 A;  4MJS B;  4AJW A;  2Y5B B;  5AZF A;  2EKE C;  2K8H A;  2D2Q A;  2MBH A;  2NVU I;  3OLM D;  2DYM A;  3TL5 A;  4I6L B;  2CU1 A;  2KNB A;  3ZUN A;  3IFW B;  1V5O A;  5LXI B;  2O2V A;  2O6V B;  3X0W A;  2M1M A;  1Z5S B;  3B08 A;  2JRI B;  2KDI A;  2AL3 A;  1HE8 A;  3PRZ A;  4KSL C;  1LXD A;  3H7P B;  4M8N A;  3HIZ A;  3WAP A;  2ZNV B;  2IY0 B;  4HK2 A;  3UIN B;  3ZNH B;  5IA7 A;  1T0Y A;  4PS7 A;  2ZNV C;  5D7G A;  4A3O A;  2KK8 A;  1LFD A;  1KJT A;  2J0K A;  4PYU A;  2IO3 B;  1UBQ A;  5CX3 A;  4BKG A;  2ASQ A;  2JWZ A;  2HJ8 A;  3ZNG C;  2GOW A;  1WXA A;  5C1Z A;  1WR1 A;  3HM6 X;  4HXD A;  2N1V A;  4NAW A;  1XD3 B;  4W9F A;  4KSK C;  4B9K A;  1YX6 B;  2Z0D B;  2W9N A;  3A9J B;  1J19 A;  1WE7 A;  5BO4 B;  1WF9 A;  2MBO A;  1P0R A;  3PSE B;  1Z2M A;  1VD2 A;  2C9W B;  2KFJ A;  3QHT A;  3ONS A;  2MCN B;  2ZPN A;  3JVZ X;  4JIO U;  2D10 A;  2L3Z A;  3MHS D;  2VRR B;  5HKH A;  1UGM A;  5CHW A;  1IPG A;  5D94 A;  3RYT A;  4ANX A;  2RSU A;  1WX9 A;  2N9E B;  2L8J A;  3AU4 A;  4FUL A;  2N7E A;  3H6N A;  4WWN A;  3DVN U;  3PRE A;  2DYB A;  2K8C A;  3PHX B;  4WJN A;  3PVL A;  3UQA A;  1CMX B;  3L08 A;  1D3Z A;  1NI2 A;  3L16 A;  2V4L A;  3DBR I;  4FHJ A;  4BKS A;  2Z0E B;  3S2A A;  4DHZ B;  4KDI C;  4LJO B;  1RRB A;  2KO3 A;  3ALB A;  4W9K A;  2L0T A;  2ZJD A;  2ZZP B;  4GDK B;  4ASW C;  1E8Z A;  4W9C A;  4NY0 A;  3ZDT A;  3M62 B;  4GU2 A;  3AU5 A;  5FR6 A;  1V81 A;  4DK5 A;  2N7D A;  2XK5 A;  3ENE A;  4IW0 A;  4HDQ A;  2GBJ A;  2JY6 A;  4EKU A;  1Q5W B;  1SGH A;  3WIM A;  1E8X A;  1WJN A;  2FCS A;  3A9K A;  1SIF A;  1XT9 B;  1KOT A;  3WAN A;  2WX0 A;  3PPA A;  4I6N B;  5LXH A;  1ZGU B;  1OEY J;  1ZKH A;  4FJY A;  3DBS A;  2WWZ A;  1NDD A;  2YVC A;  1E90 A;  4NJ7 A;  3A1Q A;  3VFK A;  2LGY A;  2ZPY A;  4A20 A;  2G3Q B;  3QK0 A;  1UZX B;  3VH4 B;  3K9O B;  2C7M B;  4KIK A;  3IVF A;  4NQL B;  2LWP A;  5AZH A;  2PJH A;  4FLH A;  4MGY E;  3PRP B;  5L95 C;  4B95 A;  2K1F A;  2NBU A;  4AP4 C;  3PLU A;  2NR2 A;  4FN2 A;  4EZK A;  3M95 A;  4PS8 A;  3M3J A;  2MWS B;  4WWP A;  2HTH A;  3AUL A;  1UBI A;  4JGH B;  3V62 A;  3VTU A;  4HJK A;  1YQB A;  2CHX A;  2KC2 A;  1WMH B;  3KW5 B;  1GC6 A;  2J0M A;  3EHV A;  1R4N I;  4DHJ B;  2KDF B;  4HWI B;  2IZV B;  3WAM A;  3Q3F A;  4IM3 A;  4IG7 B;  4BKT A;  4EOY A;  2GBM A;  1TTN A;  4X57 B;  5C23 A;  3QAR A;  4ZRJ A;  1WJ6 A;  4ANU A;  2G4D B;  1TBE A;  5L83 A;  2DAF A;  4M0W B;  1UEL A;  1ZW7 A;  2AL6 A;  1WIA A;  3L13 A;  2MRP A;  4BVU C;  2HD5 B;  2D3G A;  4M8M A;  2KVR A;  5AEK B;  2R2Q A;  4LDT D;  5JH5 C;  2KQS A;  1NBF C;  4F1S A;  3DCG A;  3V60 A;  1R4M I;  2DZI A;  2LUE A;  3ZNZ B;  3H7S A;  3IHP C;  2FID A;  2JF5 A;  4BOS C;  1YIW A;  2MP2 A;  1WJU A;  3NZS A;  4MGZ E;  2D07 B;  3BY4 B;  4GN1 A;  4ICU A;  4ZRK A;  3LJ3 A;  3QCA A;  1WXM A;  4KDL B;  2WX1 A;  4WJO A;  1E8W A;  1OQY A;  4W9G A;  1E8Y A;  4HCN B;  1M94 A;  2DZM A;  2D11 A;  3R7Q A;  4ANW A;  2JXX A;  2N1W A;  1GG3 A;  2KTR A;  2KFK B;  1RLF A;  2BYV E;  3JSV A;  3ZTD A;  4LDT B;  2O2V B;  1KM7 A;  1V9J A;  3RZF A;  4G3X B;  1V49 A;  3B0A A;  1RFA A;  2KTF A;  1VCB A;  4EEW A;  2KX3 A;  3EC8 A;  5CTR C;  2KC1 A;  4II3 B;  4HPM B;  4BFR A;  3KUC B;  1K8R B;  4MJS A;  1OTR B;  2DHZ A;  5J18 A;  3WAO A;  3SD5 A;  2G45 B;  4MM3 A;  2GMI C;  4GIV A;  3CF6 E;  2O6V A;  4WWO A;  2DZK A;  3DDC B;  1WY8 A;  3LDZ E;  4ZDV A;  3H7P A;  3BIN A;  3RUL A;  2LXC A;  3W1S A;  2BPS A;  4WJP A;  3ZIM A;  1WM2 A;  1YX5 B;  4BKS D;  1WXV A;  3K9P B;  4AJY B;  2KDB A;  4W9L A;  2GBN A;  3ZTC A;  2RR9 A;  3RCZ A;  1LQB A;  2CS4 A;  3OJ4 B;  2FCM A;  2NBW B;  2N9X A;  1H8C A;  3V6E B;  2KHW B;  2JUO A;  2LI5 A;  4XX5 A;  1IP9 A;  1C1Y B;  2I1K A;  5DCN A;  3DVN V;  4MDK E;  1WGH A;  3A9J A;  3O65 B;  2ZEQ A;  3PGE A;  4AUQ C;  2LRW A;  3KVF B;  4LJP B;  4MEL A;  3TJP A;  3U8Z A;  1L2N A;  2KLC A;  4GB9 A;  2LD9 A;  3C0R B;  4MEM A;  2DAJ A;  2DYO A;  2PE9 A;  3HHM A;  5DPR A;  2IO1 B;  2LJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...