4JWSC

Crystal structure of cytochrome p450cam-putidaredoxin complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLECVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for effector control and redox partner recognition in cytochrome P450.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase/electron transport
molecule keywords Camphor 5-monooxygenase
total genus 30
structure length 106
sequence length 106
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4jwsC00
3P4QB 3AE1B 2CJOA 1PUTA 2M19A 1OFFA 2MJEA 4YTNB 1V97A 1VJKA 3L4PA 1NYRA 1N5WA 3AE6B 3AEBB 3NVWA 1QLBB 3NVVA 3P4RB 4JX1C 4YT0B 4N58A 1QOBA 2BT6A 3NVZA 2BS3B 4YXDB 1B9RA 5H92C 2W3SA 1L5PA 1TKEA 1WGKA 1ZOYB 3AE3B 3VR8B 2BS4B 4HRSA 2MJ3A 2LEKA 3VRBB 1J7BA 1V8CA 4YSXB 1WWTA 1N61A 2FBWB 1RWSA 2WDQB 1TJEA 2E3TA 2H89B 1DGJA 1OQRA 2WU5B 3HVZA 1SB3C 2K22A 4C7ZA 1JROA 1XO3A 2OHFA 1KF6B 4N59A 5AUKA 5C3JB 4ZOHC 3W9CB 4A9AA 2AX5A 1N60A 1L0VB 1FMAD 3AV8A 4C80A 3AEAB 2M56B 1FXIA 2MH7A 3P1MA 5EE1A 3ZYYX 1A70A 1NENB 1PFDA 2Y5CA 4YTMB 1FM0D 1J7AA 1FRDA 2PVGC 2JQRB 4YSZB 2WS3B 3DWMA 1FFUA 3P4PB 1ZXIA 3RPFC 3DWGC 1AWDA 2N0SB 1UWMA 5AUIA 3AN1A 3AECB 1EWYC 4JWSC 1XLQA 3BIID 1L6VA 3CIRB 4P6VF 3AEDB 1IUEA 2MJDA 3VR9B 1NEKB 2W3RA 1NVID 2WQYB 2WU2B 3AE2B 2WDRB 3LB8C 4US8A 1PDXA 1XLNA 3HRDD 1QOGA 3AH7A 1ZUD2 1TKGA 1VDVA 2QJLA 4YSYB 3AE4B 3PO0A 2Q5WD 4FXCA 1CZPA 1FFVA 5EE0A 3AE7B 3W5UB 1J7CA 3LXFA 1FIQA 5G5HA 1YJJA 3HUIA 4ZHOA 1CJEA 1TYGB 2KMMA 2CU3A 3AMZA 2W54A 1ROEA 1F0ZA 1E6EB 2PKOA 5C2TB 3WCQA 2K5PA 1QOFA 3B2FA 3FAHA 3W5VB 1E7PB 1JRPA 4ZHPA 1R7SA 1DOXA 2L83A 1KFYB 3NRZA 2L52A 2B76B 5G5GA 1FRRA 3SR6A 1AYFA 3B2GA 1JWBD 1ZP0B 1OQQA 1N63A 1YJIA 1JALA 2WP9B 3AEFB 4JWUC 3NVYA 1L6UA 3EUB2 4KX6B 2BS2B 3FC4A 2W55A 3AE5B 3KWLA 4ITKA 2PIAA 1KRHA 4YTPB 3AE9B 1SF0A 3ETRA 1I7HA 1JW9D 1WXQA 1WYGA 4C7YA 3B9JA 3P63A 4N6EB 4WQMA 3NS1A 4LTUA 1FXAA 1N62A 1JQ4A 4US9A 3SFDB 3AM9A 1GPXA 4IDIA 2WLBA 3AB5A 1RYJA 1E9MA 1NYQA 5EE3A 1GAQB 2H88B 4HROA 2DWQA 2JX5A 5GXGB 4WWMA 3ABVB 1DOYA 1YQ3B 2QIEB 2EKIA 5H8YE 1DOIA 3VRAB 2K9XA 2HTME 1VLBA 1RFKA 5EE9A 3SFEB 1E0ZA 3CWIA 1T3QA 1N5XA 1TKYA 1JWAD 2ACZB 2DBYA 2WDVB 1QF6A 1QT9A 1E10A 3P4SB 1SIJA 5MPOA 3AE8B 1XLOA 3AEEB 2PVOD 1YQ4B 1XLPA 2G1EA 1QOAA 2CJNA 1WRIA 1NI3A 1FO4A 2KAJA 4USAA 1RM6C 3AEGB
chains in the Genus database with same CATH superfamily
1OGWA 1BUIC 1NYRA 4EKUA 2KVRA 1F9JA 4M00A 1FNUA 2C5LC 1D4BA 2IZVB 1B9RA 4PS7A 3TCAA 5DPRA 2IY0B 2KO3A 2QHOA 5BMGA 4JIOU 5GMVA 1UZXB 4RH6A 1ZKHA 3N32A 2UYZB 1D6EC 2O2VA 1TS2A 5LXIB 2J0MA 1FXIA 1PFDA 2G4DB 4NY0A 2PLPA 3B0AA 2KTFA 2L1AA 1WRDB 2N7EA 3EA6A 2MLBA 1FPYA 2D2QA 2BGFA 3AEDB 2K6DB 1WSPA 3ECIA 4TV3A 2WNMA 1XLNA 4HK2A 4A3OA 1LGRA 4LDTD 4KIKB 4NQLB 4W9HA 1MJDA 1J7CA 4CQNA 1K50A 2KC2A 5HI1A 1E7PB 2L83A 3I3TB 5JXVA 3DBRB 3IBEA 3I57A 1AN8A 1VZ8A 2BW2A 1SF0A 3ZVVA 2WDTB 1T0YA 2O6VA 2TSSA 5FR3A 2LMCA 4G3XB 3AM9A 1UGJA 4JGHB 2JWZA 1VRAB 3B08A 3ZJTA 1YQ3B 2EKIA 2V3SA 3E56A 1DOIA 3ZNID 2K9XA 4WWOA 5J17A 1JWAD 4IW0A 1YJ1A 4GDKA 3AEEB 3ZNGC 2KXJA 1UBIA 4GN1A 4KKJA 5AZHA 1TIFA 1TS4A 1V97A 3Q14C 2BBCA 3NVZA 3AXCA 4RF1A 4E71A 1L5PA 3GS2A 3VR8B 3AE3B 2MBOA 3I63C 3LYYA 3ONSA 1NI2A 3BZDB 1RWSA 2QCZA 2WDQB 3BVMA 3TMPB 5AEKB 2WU5B 4JQWC 4C7ZA 2ZCCA 1BT0A 1N60A 2CS4A 2RD0A 4UDUC 5EE1A 4KVGB 2Z59B 3R2TA 3PV1A 4NJ7A 2IGDA 4FLHA 4YSZB 1ZE3D 1ZXIA 4XDCA 1S1QB 1L6VA 3CIRB 2BQQA 4MT5A 4LCDE 2LXAA 4OZAA 3ZRFA 2JZPA 1TYGB 1F0ZA 1WMHA 2LRUA 1EF5A 4ZHPA 4RNAA 3SR6A 4E3CA 1AYFA 1N63A 3PTFC 2QMTA 1UNSA 3VDZA 1KRHA 3JVZX 1WYGA 3KWVA 3I5JC 1C76A 2QEJC 2FCNA 1WXMA 1QQRA 1GPXA 1SGHA 5GXGB 4LDTB 3H7SA 2PW9A 3VRAB 3OG5A 1WY8A 1VLBA 3R8BA 3VH3B 1XT9B 4BKSD 1AARA 1WZ0A 2NVUI 1F2RC 2ICIA 3KVFB 2LI5A 5L95C 3DOWA 3APCA 2WXNA 2EMSA 3AE1B 4IC7B 1YQBA 1QLBB 2KX0A 3QARA 2Y5PA 4PK1A 2RDGA 2KQSA 2W3SA 4O1NA 3VRBB 3ZUNA 2YLMA 1WMHB 3Q3MC 2LZ6A 4HKQA 1WE6A 3O13A 4N59A 4C80A 4YTMB 1FM0D 4KKIA 4XZ4A 4PYUA 4KIKA 3SU8X 1EWYC 2LFIA 2ZW0A 2WXLA 5JZEB 2KT7A 4RF0A 1I4RA 1E8YA 1OQYA 4LNOA 2JWUA 3HHMA 4ZYSA 5EE0A 4DHJD 2V3PA 4TKNA 5C2TB 4RGNA 1JRPA 3BVGA 3A4RA 3ZGZA 1ZP0B 1E5WA 4IM0A 3OWEB 3FKYA 3Q8EA 2KQ4X 2KACA 4W9FA 4M0WA 3P63A 2BYVE 3ML9A 4G0NB 4EUTA 4RM9A 4MEMA 2LUEA 4I6NB 2KDMA 2JX5A 3ZJVA 3AULA 3ZO5B 2JY6A 2PTLA 1SIJA 2Z8LA 3AE8B 1XXGA 3UGBB 1Z5SB 3C19A 1Y56A 4FJZA 1QOAA 1EU4A 1UELA 3U30A 2QILA 4HLEA 1XCQL 4L2YA 1EU3A 3AE6B 2BT6A 2BS3B 1Q10A 4KDIC 2RGFA 2JPHA 4EOYA 2D10A 1J19A 4DWFA 2YVCA 1WJ6A 2MEKA 2J0KA 2L76A 3PPAA 1K52A 2BB6A 3AEAB 2M56B 2K0PA 4DDID 3KUZA 2Y5CA 1FRDA 2DAFA 1P7EA 3DWGC 2XBBC 3AECB 1ENFA 1GOZA 4P7IA 1M94A 4A3PA 2BTEA 1NEKB 2RDHA 4QAYA 4OZCA 1P0RA 1KOTA 3HRDD 3R2IA 2KZRA 5TSSA 2WXRA 1TKGA 3S2AA 2ZNVB 1V49A 1V5OA 4GSWA 2C9WB 3L10B 2DHZA 1FIQA 5TR5A 2N7DA 3U4EG 2V3NA 2BYTA 5DPWA 1WYWB 2KTRA 4YL8A 4YTPB 1UD7A 2BS2B 1UH6A 3ETRA 2KLGA 3GZNB 2AQ1B 1JW9D 3P2BA 2LGXA 2BYFA 3DDCB 1UUPA 1JQ4A 3VQIA 4G11A 4FHKA 4EZJA 4HROA 2MBEA 3BINA 4MH0E 4HWIB 4IM2A 1TKYA 2ACZB 3CF6E 4WWNA 3A33B 5D3IB 2MW5A 2FCMA 2MP2B 1KLUD 1UF0A 5LNK1 1IYFA 1E8XA 1YOVB 3ENEA 3MP9A 3EHVA 5IO9A 3WAOA 4WJQA 3AEBB 1FXTB 2L05A 1E8ZA 5JHBA 3OAWA 1ZW7A 4I6LB 2SAKA 1OEYJ 1WZ3A 4K81A 3NOBA 1TY0A 2INPE 2IY1B 3H8HA 3U2SC 1L0VB 3UINB 3ZYYX 2LJ5A 3MJWA 2D11A 3NZSA 1WGDA 3V62A 2MBQA 4JWSC 2JXTA 2WU2B 3RNBC 1I42A 4K3BA 1M4VA 3GZNI 3APDA 3AE4B 4ANWA 3U7ZA 1CZPA 4DHZE 3AE7B 1V2YA 3QHTA 3HUIA 3ML8A 1QOFA 2LXCA 4NAWA 2IPKD 1R7SA 2KMAA 2M0AA 2QC8A 2B76B 1K8RB 2OEDA 3VTVA 1JWBD 2KFKA 3R66C 3W1SC 3APFA 2LWPA 1WM2A 3MFGA 2ASQA 4LLGM 2LGDA 1VD2A 3L0WB 3FILB 5AZFA 4US9A 4N9F4 1RFAA 3KH0A 3ZTCA 1GAQB 3TEXA 5H8YE 2WXMA 2HTME 2WDVB 2MRPA 2RPQA 4YWGG 4W9GA 2RMMA 2LGIA 2J0JA 2EELA 2KJHB 3KUDB 1XCTL 1Y8RC 1ZXHA 4GDLA 2KLCA 3L54A 3L4PA 2KN5A 4FULA 3W2DA 2KFJA 4OHJA 5H92C 3V61A 1WGKA 3NG0A 3PREA 4H2AA 3ZRCA 2EMTA 2QSDA 3QA8A 2INNE 2LUMA 3VUWA 3MTNB 1X1MA 4W9LA 3R3MA 1NENB 3ZIMA 1JCKB 1K51A 3BVZA 4Q2JA 5AZGA 2ZJDA 4DK5A 4OVZA 3Q2AC 5G2NA 1V1PA 1ZUD2 2LVOA 4AJYB 3VHTC 5IA7A 1STEA 5E6OA 2KDFB 2LJIA 3LXFA 1SXTA 2WWZA 2W54A 3IT6B 3VTUA 3W5VB 2GOWA 2MWSB 3RCZA 1E7UA 4DBGA 3QX1A 1XD3B 2JYEA 3M63B 3ZNZB 4KGSA 4GIVA 1WM3A 1WXQA 4ICVA 1I4QA 1I4HA 2GMIC 2WLBA 4XWWA 2YEPF 1E9MA 3MHSD 4ANUA 1L2NA 1G6JA 2C7HA 3WAMA 1DOYA 4ZRKA 3N30A 2KHWB 1GC7A 2GBRA 2L32A 2R2QA 2ZVOA 4MGZE 2IJ0A 1I4GA 2KDIA 2KJ6A 5HHDG 1QF6A 3UIOB 2BB5A 1R4MI 3V3XA 2PVOD 5I4DA 3HM6X 4R3DA 2RDBC 2LGSA 2CJNA 1TT5B 1LO5D 2PEAA 5IP4D 2RSUA 1MVKA 4BAXA 4URKA 3EFUA 1PUTA 3IAS1 4XX5A 2DYMA 2NBVB 3VUXA 4IWQA 2MCNB 3N1YC 3A4SC 1QKZA 1A5RA 2HE7A 3L17A 4ANXA 3TIXA 3JSVB 2BPSA 2GBNA 4B95A 2N9EB 2KC1A 2NS5A 1YX5B 2INDC 1FNWA 4ZOHC 2I38A 2XK5B 2PE9A 3QCAA 3IFWB 2ZVNA 1H8CA 5D3DA 3NUHB 2CU1A 1I4XA 1YD8U 3AN1A 1LXDA 1GG3A 2AYOB 3QIJA 5FKAC 1MG4A 1WX8A 1MG8A 4LNNA 3ZXRA 1GJZA 3PO0A 1H4RA 4NJ6A 3A9JA 4HCPB 5BYSA 1C1YB 3PZ8A 2KMMA 2N4FA 1WJNA 1EUVB 2WX0A 3N3KB 1JWMD 4K3CA 1DOXA 1KFYB 2MBBB 3RD2A 3DQVA 3K9OB 3B2GA 3QC8B 2NTTA 3RNGC 3B1LX 3EUB2 3NY5A 2PIAA 1P7FA 4RFBA 1P98A 4FADA 2IBIB 4FA6A 1T0QC 2KWUB 1N62A 3JSVA 3TEZA 4GU2A 3T8MA 1Z2MA 4M02A 1ZGUB 3BWUD 1IP9A 1WJUA 1TY2A 4MGIE 1DYQA 2AQ2B 3DHGC 1E10A 3P4SB 4DHJB 2C60A 4J6IA 4E74A 3UF8A 2DLBA 1OEYA 4HPLB 4TQ1A 1JWUD 1RM6C 4K1RB 4NAMA 2CJOA 3O65B 4BOSC 4C00A 4L23A 1N5WA 2WXIA 3NVWA 2JZZA 4JX1C 1V86A 5IAAC 3ZDTA 1C3TA 4LJOB 2PMVA 2LRWA 1TKEA 4AWJA 1B1ZA 4IKGA 2DENB 3H1UA 5T8IA 1UGMA 1WWTA 2FBWB 3Q8FA 1WXAA 1ACCA 2K3UA 3R7RA 3WIMA 2JT4B 2DX5B 3GB1A 2AX5A 3PHXB 2G45B 5C1ZA 3PRPB 4WWPA 3GP7A 1V1PB 3A1QA 2NBUA 1IPGA 4IWOA 3GE8C 5J2RA 2JU6X 2BKRB 4LNFA 2AL6A 2VH2A 4EEWA 3DBHB 4NJCA 3BYYB 2AEHA 3DHHC 2I2YA 2FIDA 2G4SA 3AH7A 1YIWA 2KVZA 3KUCB 2FIFA 2QJLA 1F2RI 4W9DA 2Q5WD 3W1SA 1OTRB 2NPTA 2DZJA 2OJWA 3DBRI 1ZDXA 4IWPA 3Q6BA 4REZA 3Q8CA 4ARIA 3CSFA 3RFZB 2FNJB 2DAJA 1PQSA 2Y3AA 4FHJA 1EM7A 4HPPA 3X0WA 2LVQA 2OJRA 3KWLA 2KWVB 4JL9A 5G55A 1L0XB 2FUHB 4HCNB 4WH4A 2K8HA 2CHZA 2IGHA 2D07B 5EE3A 2ZEQA 2L7RA 4ACFA 4G50A 1E0ZA 1T3QA 3MC0B 1WX9A 3A9KB 4XDDA 4P1CC 1YN5A 1XLPA 4GOCA 1IBXA 4DXGA 1SJHD 2KAJA 2J53A 2ZPYA 3GOEA 4MELA 4WAFA 2M19A 4YTNB 4JLCA 2N7JA 5BYRA 3OJ4B 3NVVA 3H9DA 3RNEC 4WJOA 1TGZB 2JSVX 1FNVA 4A6QA 2AWTA 2KK8A 1L4ZB 2BKFA 3DPDA 1J7BA 4EZLA 4XE0A 2V4LA 3TBLD 2IO2B 2E3TA 1SJED 4MGYE 1XO3A 4S17A 3HIZA 1KF6B 4I6PA 4PT5A 3AU5A 2REXA 2MH7A 3NS8A 3NJTA 1HXYD 3BK2A 1HE8A 4B9KA 4WURA 1GNUA 4ASWC 3DWMA 4BFRA 2JRIB 3A9JB 3D32A 2O2VB 2D5GA 4XC2A 2MJDA 4ZRJA 3ZTDA 3RZFA 4CHKA 4W9JA 3CMMB 2JUOA 4MDKE 2X38A 2KKCA 2A4ZA 1WX7A 3RNAC 2M8SA 1OQQA 1Q0WB 3ZJUA 1MFWA 1KJTA 3RULA 3OJ3A 3EECA 1FEHA 3BK1A 3TJPA 4GDKB 3DBHI 3DVNU 2PPHA 3SFDB 1UWXA 4NPNA 3EFCA 3DBSA 3ZKJC 3Q3NC 5HKHA 5LXHA 2UWQA 1N5XA 2J42A 2O6VB 4K7UA 2AQ3B 3PSEB 3VXWA 4WIPA 1WGGA 1WRIA 4PYZA 2NCNA 3P4QB 4LK0M 2KTRB 4HJGE 1VZ7A 2WXQA 1C9FA 3N1ZC 4YT0B 1QOBA 2WXKA 3RMKC 4YXDB 4F7ZA 1YN4A 3OLMD 3U52E 2LVPA 3IG3A 5DCNA 3UIPB 1DGJA 2QDFA 2M4NA 3C8YA 3PRMB 3PT2B 3PRZA 1L7YA 2KQ7A 4J3OD 2Z0DB 1D5MC 4B0EA 3ZQ4A 4BVUC 4NQKE 1WGHA 2VZKB 4B6WA 1SEBD 1A70A 1ET6A 4IG7B 1KTKA 2KN4A 1C4PA 4RM8A 1XLQA 2Y5BB 3RT3B 1T0RC 1D5XC 2K39A 3ZLZA 1JWSD 2J52A 1CJEA 2CU3A 4DDGD 5C23A 4K7SA 1WIAA 2L52A 1FRRA 4MH8A 2CHWA 2YEPB 1VZ6A 4W9IA 1RAXA 4C7YA 2JVCA 4RGOS 3Q8BA 3A9KA 4MGKE 1P1AA 2H88B 3BYTB 4WWMA 3VTWA 3ABVB 2A5UA 4K7WA 2FCQA 5D7GA 4WQOB 2GRIA 5EE9A 2GB1A 3Q3OC 1SIFA 4HXDA 3RNCC 1UBQA 1TZOA 2BF8B 4M01A 4FBJB 3Q3FA 1BXTA 2N9PC 1SE4A 3N20C 1NI3A 4NAWB 3NHEB 3SHQA 2MJEA 4XWTA 4OVUA 4HDOA 3X23A 3IVFA 3QK0A 4F1SA 1EO6A 2MBHA 2NTSA 2JXXA 1ZDVA 1SBBB 1C77A 1N61A 1JMLA 1TJEA 1SB3C 4BOZB 5HFYA 1RLFA 2N9XA 1R4MB 3PVLA 2WX1A 2EKEC 4ZYNA 4S0RA 3T9LA 3KW5B 2JQRB 1QZEA 2N0SB 1WXVA 3MJ5A 1HQRD 3NZ3A 1IUEA 2D3BA 3E9SA 3AE2B 1HTOA 2JF5A 4ANVA 3P42A 5E6JA 1HZ5A 2ZW1A 1CK1A 4DXAB 2MQJA 4FN2A 4LJPB 3WCQA 2NBWB 2V1YA 4M0WB 2I1KA 2Z0EB 4C4VA 2SEBD 2WP9B 1HZ6A 2MA9B 1N6ZA 4EE2A 3U7DA 4RMAA 3V05A 1ISNA 1TZ1A 2D3GA 2JRHA 3TSSA 2OOBB 2VRRB 1E8WA 1MHXA 2K8BA 3DVNV 3H7PA 2IO1B 2DWQA 1EWCA 5IN7A 1AW7A 3PS6A 1VR9A 4HJKA 1K53A 4GGQA 3KYCD 1TS5A 4USAA 3BY4B 3VUYA 4HVBA 3WAPA 1YN3A 2RR9A 4BKSA 3P4RB 3V60A 1TBEA 4MSMB 4MACA 1EF1A 1T0SC 5D2MB 1WI0A 1WR6E 3RN9C 3L16A 1NDDA 3VVWB 1OQRA 4MSQB 3DBLB 4KV2A 2DYBA 5HG2A 3W9CB 5CX3A 3WA0A 4HDQA 3DVGY 2C7MB 2WS3B 2N1WA 4ZRQA 2XEWA 3TEYA 3DHIC 3KYDD 1TTNA 4P6VF 2RPVA 1V6EA 4MJSA 2W3RA 1L4DB 4L1BA 4ZRPA 1NVID 3K9PB 1QOGA 3PLVA 4XYCA 2M17A 1VDVA 3RZWC 1QILA 1SE3A 2V9HA 4AJWA 2XNAC 1YJJA 1RRBA 2ONQA 3B2FA 2K25A 4WAAA 5DPSA 2WXPA 3AEFB 3QJZA 4M8MA 2IO0B 1WF9A 1E90A 2N1VA 1PGBA 1GUAB 2W9NA 2D3AA 5KHOA 3TUOA 2MP2A 1C4CA 5CHFA 3C0RB 2QIEB 3RYTA 3SFEB 2LD9A 1WR1A 3IT4B 2R2OA 4W9CA 4PS8A 4D2KA 2GI9A 1YQ4B 2G1EA 2KWCA 3MHZA 2PE6B 4MJSB 4FJYA 1BMLC 3EGRA 5BO4B 2GBMA 1XF5L 3L08A 2WXJA 2V4IB 4A20A 2BS4B 4HRSA 3EC8A 3TL5A 1HTQA 1V8CA 3NZUA 4W9EA 4AS1A 3LDZE 2LHEA 2H89B 5KHQA 3ALBA 1I4PA 1V9JA 1IGDA 2NR2A 4NZLB 5AUKA 1C79A 3AV8A 1V5TA 1I35A 4NNJB 1FCLA 1J7AA 2XN9C 3MC9A 3UQAA 4OVVA 1YMHE 5JHAA 4OW0A 3SEBA 2IDYA 1WH3A 2HD5B 2LGYA 2BVCA 4C4VB 2L3ZA 1SE9A 4KGTA 2ZPNA 2PJHA 3VAWA 4BKTA 1XQQA 4X57B 1ROEA 2WXFA 3FILA 1LM8B 1XEEA 2K5PA 2WXOA 1D3ZA 2DZKA 1KH0A 5BMHA 3H7PB 1JALA 4JWUC 1TS3A 4KX6B 1PGAA 3AE5B 3Q3JA 2ZNVC 3A1QB 3B9JA 4N6EB 2V0GA 1HEZE 3CSTA 1Q5WB 4LNIA 4XGAB 4C56C 2ZZPB 3URYA 4OZBA 4KGRA 4GXBA 1VCBA 3AI5A 4WJNA 3CWIA 4DXFA 4GB9A 2HDEA 2KJRA 5BMIA 5MPOA 4AQ7A 4CYEA 1Q1OA 3DBLI 2J4XA 1YNTE 1MHHE 2INCC 1FO4A 3AEGB 2FE8A 1MI0A 4P16A 1VJKA 2M0XA 4WJPA 2BWES 3PGEA 3RI7C 1GB1A 2L8JA 2MJ3A 2KX3A 1FCCC 1YX6B 1KLVA 3HVDA 4AOFA 3SD5A 2FUG1 3JW0X 4GLSC 2K22A 4HPMB 1JROA 5J18A 3P1MA 3TEWA 1JRUA 5FK9C 1CQVA 3RPFC 1AWDA 4ZDVA 1V80A 4MM3B 3BIID 4IUMB 2ZCBA 4DQOC 3M62B 4RGTA 3VR9B 2WQYB 3M95A 4II3B 3LB8C 2DYOA 2KANA 4RGMA 4EFOA 3N9YC 3HM3A 2N9LA 2AL3A 4KSKC 2FAZA 3W5UB 4BKGA 1KLGD 3Q8AA 1F77A 2CKHB 2G3QB 1CMXB 3NRZA 5G5GA 2W82A 1YJIA 1IGCA 2BWFA 3R7QA 4KDLB 3AU4A 3RUIB 4ZRIA 3V6EB 3ZNHB 1S3SG 3PHWB 3NS1A 1FXAA 4AP4C 2LASA 2GBJA 4A8XC 4KSLC 3QAQA 2LHDA 1RFKA 1ET9A 2CR5A 4FJVB 5FR6A 2KOXA 2VH1A 3DVGX 2WXHA 1GC6A 2WXGA 2DNFA 3IAM1 2IO3B 2NMQA 4BBNC 1OFFA 2JYTA 3SDLC 2IYDB 4N58A 1R4NB 1ZOYB 2LEKA 1SE2A 1P3QU 1FD6A 2KYWA 2VZKD 2FCSA 4BBNF 3HVZA 4TQ0A 1LQBA 5CHWA 2OHFA 4A9AA 1J0GA 2UU7A 1FMAD 3Q69A 2M1MA 4PS3A 2DZMA 3W1YA 4HEA1 2KNBA 1PGXA 5CTRC 3QQ8B 2XK5A 3IHPC 2WDRB 1WE7A 5BYQA 1LFDA 2D3CA 2WHIA 4YSYB 3PZ7A 2JZ3B 3GE3C 1FFVA 2ON8A 4IM3A 4JE3B 4IOIE 3I9V1 4A55A 4ICUA 1C78A 1L0YB 4GMVA 4JPSA 3FAHA 2I1JA 4KZCA 2WGSA 2K8CA 3J9CA 3WALA 3NVYA 5D94A 2N9KA 1NBFC 1I7HA 4TMAB 2IGGA 2L0FA 1ZPSA 1KM7A 1P9DU 1HA5A 2KMCA 2C7NB 3M3JA 4IDIA 3T3OA 4TUUA 3UI3A 2MHJA 2KD0A 1WGYA 4BZAA 2R61A 2L00B 1QT9A 2K1FA 2CHXA 4RCOA 2DZIA 5L83A 1F1HA 1WJ4A 1V1OA 2WYQA 3LJ3A 3ZXVA 4US8A 2BYEA 4W9KA 2J7QB 2MX2A 3ZDMC 1R4NI 1PYWD 5CHVC 2HJ1A 5DPTA 1ESFA 1WFYA 2E6XA 3VFKA 3PLUA 3MC8A 4YSXB 1GB4A 1SSNA 3UQBA 4LNKA 3WANA 3KLSX 1T5XD 5D6JB 1J8CA 2KFKB 3N1XC 4MM3A 1T6BX 5C3JB 2HJ8A 3RNFC 5E6NA 1U4AA 2PVGC 3IXSA 4DHZB 3T3NA 5JH5C 3P4PB 1FFUA 5LLIA 5AUIA 1UWMA 1C4AA 2GLSA 4KZ0A 1WXSA 1F52A 2X8XX 2MSED 3DCGA 3ZW3A 1PDXA 4B0MA 3L13A 4EZKA 3HK0A 4HKZE 2G9HD 4FXCA 3U8ZA 5G5HA 4P1BC 4ZHOA 3AMZA 1E6EB 2PKOA 3H6NA 2O6VD 4A90A 5IKCM 2B3AA 4GDLB 3KQ4A 4M8NA 2KDBA 1L6UA 2L0TA 3FC4A 2NPTB 2W55A 4ITKA 3AE9B 2KWDA 5EDSA 4WQMA 4LTUA 4II2B 5E6PA 3QWZB 4CO7A 2GBKA 4ARCA 3AB5A 1RYJA 2K6QA 1NYQA 1IBXB 1E7VA 3JYUA 4TSSA 4AUQC 3PZDA 1WGRA 3V6CB 1MPEA 2DBYA 3VH4B 1V81A 5IOIA 1XLOA 4F8CB 1D5ZC 2HTHA 2KDEB
chains in the Genus database with same CATH topology
3MP9A 1BMLC 4WAFA 1BUIC 2M19A 3EGRA 4YTNB 2N7JA 5BYRA 1NYRA 3AEBB 3NVVA 1FNUA 1D4BA 2JSVX 1FNVA 1XF5L 1B9RA 4A6QA 2WXJA 2V4IB 2BS4B 2SAKA 4HRSA 1L4ZB 1J7BA 1V8CA 5BMGA 4XE0A 4AS1A 1TY0A 2E3TA 2LHEA 2INPE 2H89B 4RH6A 1SJED 1I4PA 3H8HA 1D6EC 1IGDA 1XO3A 4NZLB 3U2SC 1KF6B 5AUKA 1TS2A 1C79A 1L0VB 3AV8A 4PT5A 3ZYYX 1FXIA 2MH7A 1PFDA 1FCLA 1J7AA 1HXYD 3BK2A 2XN9C 2PLPA 4WURA 2L1AA 3DWMA 3EA6A 4JWSC 1YMHE 2D5GA 3AEDB 2MJDA 2JXTA 4OW0A 3SEBA 2WU2B 2IDYA 1WSPA 2WNMA 1XLNA 4KGTA 1M4VA 3AE4B 3U7ZA 1CZPA 3AE7B 1J7CA 3HUIA 4CQNA 1K50A 5HI1A 2X38A 1ROEA 2WXFA 3FILA 1XEEA 2K5PA 1QOFA 2WXOA 1E7PB 2IPKD 1R7SA 2L83A 2M0AA 2B76B 2OEDA 1KH0A 5BMHA 1JWBD 5JXVA 1OQQA 4JWUC 1JALA 1TS3A 4KX6B 3ZJUA 1PGAA 1AN8A 3I57A 3AE5B 3MFGA 1VZ8A 2BW2A 4LLGM 1SF0A 3FILB 3B9JA 4N6EB 1FEHA 2TSSA 5FR3A 2LMCA 2V0GA 1HEZE 4US9A 3BK1A 4GDKB 3SFDB 3AM9A 1UWXA 1UGJA 4C56C 1GAQB 3TEXA 3URYA 1VRAB 4OZBA 3ZJTA 1YQ3B 2EKIA 3E56A 5H8YE 1DOIA 2K9XA 2WXMA 2HTME 4KGRA 3CWIA 2J42A 1N5XA 4DXFA 1JWAD 2WDVB 2HDEA 2AQ3B 4YWGG 5BMIA 5MPOA 4WIPA 4AQ7A 3AEEB 2RMMA 2LGIA 4KKJA 2J4XA 1YNTE 1WRIA 1MHHE 1FO4A 2EELA 3AEGB 3P4QB 4LK0M 2FE8A 1XCTL 1TS4A 1MI0A 1ZXHA 4HJGE 1VZ7A 1V97A 4P16A 1VJKA 3L4PA 3W2DA 2WXQA 1C9FA 2BBCA 4YT0B 1QOBA 2WXKA 3NVZA 4YXDB 4OHJA 4RF1A 1YN4A 5H92C 1L5PA 1WGKA 3GS2A 3VR8B 3AE3B 3LYYA 1GB1A 2MJ3A 3U52E 1FCCC 4H2AA 3BZDB 1RWSA 2QSDA 2WDQB 3BVMA 2INNE 3HVDA 1DGJA 2FUG1 2LUMA 2WU5B 4GLSC 2K22A 3C8YA 4C7ZA 1JROA 4B0EA 4J3OD 1D5MC 3ZQ4A 1N60A 2VZKB 1SEBD 3P1MA 4UDUC 5EE1A 1A70A 1ET6A 1NENB 3R2TA 1KTKA 3TEWA 2KN4A 2IGDA 5FK9C 1C4PA 1CQVA 1JCKB 1ZE3D 3RPFC 4YSZB 1ZXIA 1AWDA 4XDCA 1K51A 1XLQA 3BIID 1L6VA 3CIRB 3BVZA 4MM3B 4Q2JA 4DQOC 4RGTA 4MT5A 3VR9B 2WQYB 4OVZA 3LB8C 2DYOA 4RGMA 1V1PA 1ZUD2 3N9YC 1D5XC 2N9LA 4OZAA 1STEA 3W5UB 2LJIA 1JWSD 3LXFA 2J52A 1KLGD 1SXTA 2JZPA 1CJEA 1TYGB 2CU3A 3IT6B 2W54A 1F0ZA 3Q8AA 1F77A 3W5VB 4ZHPA 4RNAA 3NRZA 5G5GA 2L52A 3SR6A 1FRRA 1AYFA 1N63A 1YJIA 1IGCA 2W82A 4MH8A 2JYEA 2YEPB 2QMTA 1VZ6A 1UNSA 1KRHA 4KGSA 1WXQA 1WYGA 4C7YA 3KWVA 1C76A 3NS1A 1I4QA 1FXAA 2QEJC 4RGOS 3Q8BA 1QQRA 1I4HA 1GPXA 2WLBA 4XWWA 2YEPF 1E9MA 2H88B 3BYTB 5GXGB 4WWMA 3ABVB 4A8XC 1DOYA 2PW9A 3VRAB 2LHDA 1VLBA 2L32A 5D7GA 2GRIA 1RFKA 2GB1A 1ET9A 2IJ0A 5EE9A 1I4GA 5HHDG 3R8BA 1QF6A 2BB5A 1TZOA 3V3XA 1F2RC 2PVOD 5I4DA 4R3DA 2ICIA 1BXTA 2CJNA 1LO5D 1SE4A 1NI3A 2WXHA 4NAWB 2WXGA 1MVKA 2WXNA 3IAM1 3AE1B 1PUTA 2NMQA 3IAS1 1OFFA 2MJEA 2DYMA 2JYTA 4XWTA 1QLBB 4N58A 2Y5PA 2RDGA 2W3SA 4O1NA 1QKZA 1ZOYB 3VRBB 2NTSA 2LEKA 1SE2A 1ZDVA 1FD6A 1SBBB 2VZKD 1C77A 1N61A 1JMLA 1TJEA 4HKQA 3HVZA 4TQ0A 1SB3C 2OHFA 3O13A 5HFYA 4N59A 1FNWA 4ZOHC 4A9AA 2I38A 1FMAD 3Q69A 4C80A 4YTMB 1FM0D 5D3DA 2JQRB 3NUHB 4HEA1 4KKIA 2N0SB 1PGXA 3MJ5A 1I4XA 3AN1A 1EWYC 2LFIA 2ZW0A 1HQRD 2WXLA 3NZ3A 1IUEA 4RF0A 3E9SA 3AE2B 5FKAC 2WDRB 1I4RA 3P42A 5E6JA 5BYQA 1HZ5A 4YSYB 3PZ7A 2ZW1A 2JWUA 3PO0A 1CK1A 4ZYSA 1FFVA 2ON8A 5EE0A 5BYSA 3PZ8A 2V3PA 4JE3B 2KMMA 4IOIE 3I9V1 4A55A 3WCQA 1C78A 1L0YB 5C2TB 4JPSA 1JWMD 3FAHA 4RGNA 1JRPA 3BVGA 1DOXA 1KFYB 2SEBD 3ZGZA 3B2GA 1ZP0B 2WP9B 1HZ6A 3J9CA 2NTTA 3NVYA 4EE2A 3EUB2 3OWEB 3V05A 2N9KA 2PIAA 1P7FA 3Q8EA 2KQ4X 1I7HA 4TMAB 2KACA 4RFBA 2IGGA 4M0WA 3P63A 3TSSA 1ZPSA 1MHXA 1N62A 3TEZA 1HA5A 4IDIA 3T3OA 3UI3A 2KDMA 2DWQA 2JX5A 3BWUD 1EWCA 1AW7A 3ZJVA 1TY2A 1DYQA 1VR9A 2AQ2B 2R61A 2PTLA 1QT9A 1E10A 3P4SB 1SIJA 2Z8LA 3AE8B 1XXGA 1K53A 1Y56A 4RCOA 1QOAA 1EU4A 2DLBA 1V1OA 1TS5A 4TQ1A 1JWUD 4USAA 1RM6C 4US8A 2QILA 1XCQL 4NAMA 2CJOA 4L2YA 1YN3A 4L23A 1EU3A 1N5WA 2WXIA 3AE6B 3NVWA 3P4RB 4JX1C 2BT6A 1PYWD 1Q10A 2BS3B 2PMVA 4MACA 1ESFA 1TKEA 1B1ZA 4IKGA 5T8IA 2E6XA 4YSXB 1WWTA 1GB4A 1SSNA 2FBWB 3KLSX 2K3UA 3Q8FA 1ACCA 1T5XD 1OQRA 2MEKA 1T6BX 5C3JB 1K52A 3GB1A 5HG2A 3W9CB 2AX5A 2BB6A 3AEAB 2M56B 2K0PA 2Y5CA 3GP7A 1V1PB 1FRDA 2PVGC 3IXSA 3T3NA 2WS3B 3P4PB 1FFUA 1P7EA 2JU6X 3DWGC 4ZRQA 5AUIA 3TEYA 1UWMA 1C4AA 3AECB 1ENFA 1GOZA 4P6VF 2RPVA 2BTEA 1NEKB 2W3RA 1L4DB 4L1BA 4NJCA 4ZRPA 1NVID 3BYYB 2RDHA 4OZCA 1PDXA 2I2YA 3HRDD 1QOGA 4B0MA 3AH7A 3R2IA 5TSSA 2WXRA 1TKGA 1VDVA 2G9HD 4HKZE 2QJLA 1QILA 1SE3A 1F2RI 2Q5WD 3W1SA 2XNAC 4FXCA 5G5HA 1FIQA 1YJJA 4ZHOA 3AMZA 1ZDXA 1E6EB 2ONQA 2PKOA 3B2FA 4REZA 3Q8CA 3U4EG 2V3NA 2BYTA 4A90A 4ARIA 3RFZB 4YTPB 2WXPA 3AEFB 4GDLB 3KQ4A 2Y3AA 1EM7A 1L6UA 2BS2B 3FC4A 2W55A 3KWLA 4ITKA 3AE9B 3ETRA 2KWDA 2AQ1B 1JW9D 1L0XB 1PGBA 4WQMA 4LTUA 4WH4A 1UUPA 1JQ4A 3TUOA 4ARCA 3AB5A 3VQIA 1RYJA 2IGHA 1C4CA 1NYQA 5EE3A 4HROA 1IBXB 4TSSA 2QIEB 3SFEB 1E0ZA 1MPEA 1T3QA 1TKYA 2ACZB 2DBYA 5D3IB 3MC0B 3IT4B 1XLOA 4D2KA 1KLUD 2GI9A 4XDDA 1YN5A 1XLPA 1YQ4B 2G1EA 5LNK1 1IBXA 4DXGA 1SJHD 3MHZA 2KAJA 1D5ZC 2J53A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P4Q B;  3AE1 B;  2CJO A;  1PUT A;  2M19 A;  1OFF A;  2MJE A;  4YTN B;  1V97 A;  1VJK A;  3L4P A;  1NYR A;  1N5W A;  3AE6 B;  3AEB B;  3NVW A;  1QLB B;  3NVV A;  3P4R B;  4JX1 C;  4YT0 B;  4N58 A;  1QOB A;  2BT6 A;  3NVZ A;  2BS3 B;  4YXD B;  1B9R A;  5H92 C;  2W3S A;  1L5P A;  1TKE A;  1WGK A;  1ZOY B;  3AE3 B;  3VR8 B;  2BS4 B;  4HRS A;  2MJ3 A;  2LEK A;  3VRB B;  1J7B A;  1V8C A;  4YSX B;  1WWT A;  1N61 A;  2FBW B;  1RWS A;  2WDQ B;  1TJE A;  2E3T A;  2H89 B;  1DGJ A;  1OQR A;  2WU5 B;  3HVZ A;  1SB3 C;  2K22 A;  4C7Z A;  1JRO A;  1XO3 A;  2OHF A;  1KF6 B;  4N59 A;  5AUK A;  5C3J B;  4ZOH C;  3W9C B;  4A9A A;  2AX5 A;  1N60 A;  1L0V B;  1FMA D;  3AV8 A;  4C80 A;  3AEA B;  2M56 B;  1FXI A;  2MH7 A;  3P1M A;  5EE1 A;  3ZYY X;  1A70 A;  1NEN B;  1PFD A;  2Y5C A;  4YTM B;  1FM0 D;  1J7A A;  1FRD A;  2PVG C;  2JQR B;  4YSZ B;  2WS3 B;  3DWM A;  1FFU A;  3P4P B;  1ZXI A;  3RPF C;  3DWG C;  1AWD A;  2N0S B;  1UWM A;  5AUI A;  3AN1 A;  3AEC B;  1EWY C;  4JWS C;  1XLQ A;  3BII D;  1L6V A;  3CIR B;  4P6V F;  3AED B;  1IUE A;  2MJD A;  3VR9 B;  1NEK B;  2W3R A;  1NVI D;  2WQY B;  2WU2 B;  3AE2 B;  2WDR B;  3LB8 C;  4US8 A;  1PDX A;  1XLN A;  3HRD D;  1QOG A;  3AH7 A;  1ZUD 2;  1TKG A;  1VDV A;  2QJL A;  4YSY B;  3AE4 B;  3PO0 A;  2Q5W D;  4FXC A;  1CZP A;  1FFV A;  5EE0 A;  3AE7 B;  3W5U B;  1J7C A;  3LXF A;  1FIQ A;  5G5H A;  1YJJ A;  3HUI A;  4ZHO A;  1CJE A;  1TYG B;  2KMM A;  2CU3 A;  3AMZ A;  2W54 A;  1ROE A;  1F0Z A;  1E6E B;  2PKO A;  5C2T B;  3WCQ A;  2K5P A;  1QOF A;  3B2F A;  3FAH A;  3W5V B;  1E7P B;  1JRP A;  4ZHP A;  1R7S A;  1DOX A;  2L83 A;  1KFY B;  3NRZ A;  2L52 A;  2B76 B;  5G5G A;  1FRR A;  3SR6 A;  1AYF A;  3B2G A;  1JWB D;  1ZP0 B;  1OQQ A;  1N63 A;  1YJI A;  1JAL A;  2WP9 B;  3AEF B;  4JWU C;  3NVY A;  1L6U A;  3EUB 2;  4KX6 B;  2BS2 B;  3FC4 A;  2W55 A;  3AE5 B;  3KWL A;  4ITK A;  2PIA A;  1KRH A;  4YTP B;  3AE9 B;  1SF0 A;  3ETR A;  1I7H A;  1JW9 D;  1WXQ A;  1WYG A;  4C7Y A;  3B9J A;  3P63 A;  4N6E B;  4WQM A;  3NS1 A;  4LTU A;  1FXA A;  1N62 A;  1JQ4 A;  4US9 A;  3SFD B;  3AM9 A;  1GPX A;  4IDI A;  2WLB A;  3AB5 A;  1RYJ A;  1E9M A;  1NYQ A;  5EE3 A;  1GAQ B;  2H88 B;  4HRO A;  2DWQ A;  2JX5 A;  5GXG B;  4WWM A;  3ABV B;  1DOY A;  1YQ3 B;  2QIE B;  2EKI A;  5H8Y E;  1DOI A;  3VRA B;  2K9X A;  2HTM E;  1VLB A;  1RFK A;  5EE9 A;  3SFE B;  1E0Z A;  3CWI A;  1T3Q A;  1N5X A;  1TKY A;  1JWA D;  2ACZ B;  2DBY A;  2WDV B;  1QF6 A;  1QT9 A;  1E10 A;  3P4S B;  1SIJ A;  5MPO A;  3AE8 B;  1XLO A;  3AEE B;  2PVO D;  1YQ4 B;  1XLP A;  2G1E A;  1QOA A;  2CJN A;  1WRI A;  1NI3 A;  1FO4 A;  2KAJ A;  4USA A;  1RM6 C;  3AEG B; 
#chains in the Genus database with same CATH topology
 1OGW A;  1BUI C;  1NYR A;  4EKU A;  2KVR A;  1F9J A;  4M00 A;  1FNU A;  2C5L C;  1D4B A;  2IZV B;  1B9R A;  4PS7 A;  3TCA A;  5DPR A;  2IY0 B;  2KO3 A;  2QHO A;  5BMG A;  4JIO U;  5GMV A;  1UZX B;  4RH6 A;  1ZKH A;  3N32 A;  2UYZ B;  1D6E C;  2O2V A;  1TS2 A;  5LXI B;  2J0M A;  1FXI A;  1PFD A;  2G4D B;  4NY0 A;  2PLP A;  3B0A A;  2KTF A;  2L1A A;  1WRD B;  2N7E A;  3EA6 A;  2MLB A;  1FPY A;  2D2Q A;  2BGF A;  3AED B;  2K6D B;  1WSP A;  3ECI A;  4TV3 A;  2WNM A;  1XLN A;  4HK2 A;  4A3O A;  1LGR A;  4LDT D;  4KIK B;  4NQL B;  4W9H A;  1MJD A;  1J7C A;  4CQN A;  1K50 A;  2KC2 A;  5HI1 A;  1E7P B;  2L83 A;  3I3T B;  5JXV A;  3DBR B;  3IBE A;  3I57 A;  1AN8 A;  1VZ8 A;  2BW2 A;  1SF0 A;  3ZVV A;  2WDT B;  1T0Y A;  2O6V A;  2TSS A;  5FR3 A;  2LMC A;  4G3X B;  3AM9 A;  1UGJ A;  4JGH B;  2JWZ A;  1VRA B;  3B08 A;  3ZJT A;  1YQ3 B;  2EKI A;  2V3S A;  3E56 A;  1DOI A;  3ZNI D;  2K9X A;  4WWO A;  5J17 A;  1JWA D;  4IW0 A;  1YJ1 A;  4GDK A;  3AEE B;  3ZNG C;  2KXJ A;  1UBI A;  4GN1 A;  4KKJ A;  5AZH A;  1TIF A;  1TS4 A;  1V97 A;  3Q14 C;  2BBC A;  3NVZ A;  3AXC A;  4RF1 A;  4E71 A;  1L5P A;  3GS2 A;  3VR8 B;  3AE3 B;  2MBO A;  3I63 C;  3LYY A;  3ONS A;  1NI2 A;  3BZD B;  1RWS A;  2QCZ A;  2WDQ B;  3BVM A;  3TMP B;  5AEK B;  2WU5 B;  4JQW C;  4C7Z A;  2ZCC A;  1BT0 A;  1N60 A;  2CS4 A;  2RD0 A;  4UDU C;  5EE1 A;  4KVG B;  2Z59 B;  3R2T A;  3PV1 A;  4NJ7 A;  2IGD A;  4FLH A;  4YSZ B;  1ZE3 D;  1ZXI A;  4XDC A;  1S1Q B;  1L6V A;  3CIR B;  2BQQ A;  4MT5 A;  4LCD E;  2LXA A;  4OZA A;  3ZRF A;  2JZP A;  1TYG B;  1F0Z A;  1WMH A;  2LRU A;  1EF5 A;  4ZHP A;  4RNA A;  3SR6 A;  4E3C A;  1AYF A;  1N63 A;  3PTF C;  2QMT A;  1UNS A;  3VDZ A;  1KRH A;  3JVZ X;  1WYG A;  3KWV A;  3I5J C;  1C76 A;  2QEJ C;  2FCN A;  1WXM A;  1QQR A;  1GPX A;  1SGH A;  5GXG B;  4LDT B;  3H7S A;  2PW9 A;  3VRA B;  3OG5 A;  1WY8 A;  1VLB A;  3R8B A;  3VH3 B;  1XT9 B;  4BKS D;  1AAR A;  1WZ0 A;  2NVU I;  1F2R C;  2ICI A;  3KVF B;  2LI5 A;  5L95 C;  3DOW A;  3APC A;  2WXN A;  2EMS A;  3AE1 B;  4IC7 B;  1YQB A;  1QLB B;  2KX0 A;  3QAR A;  2Y5P A;  4PK1 A;  2RDG A;  2KQS A;  2W3S A;  4O1N A;  3VRB B;  3ZUN A;  2YLM A;  1WMH B;  3Q3M C;  2LZ6 A;  4HKQ A;  1WE6 A;  3O13 A;  4N59 A;  4C80 A;  4YTM B;  1FM0 D;  4KKI A;  4XZ4 A;  4PYU A;  4KIK A;  3SU8 X;  1EWY C;  2LFI A;  2ZW0 A;  2WXL A;  5JZE B;  2KT7 A;  4RF0 A;  1I4R A;  1E8Y A;  1OQY A;  4LNO A;  2JWU A;  3HHM A;  4ZYS A;  5EE0 A;  4DHJ D;  2V3P A;  4TKN A;  5C2T B;  4RGN A;  1JRP A;  3BVG A;  3A4R A;  3ZGZ A;  1ZP0 B;  1E5W A;  4IM0 A;  3OWE B;  3FKY A;  3Q8E A;  2KQ4 X;  2KAC A;  4W9F A;  4M0W A;  3P63 A;  2BYV E;  3ML9 A;  4G0N B;  4EUT A;  4RM9 A;  4MEM A;  2LUE A;  4I6N B;  2KDM A;  2JX5 A;  3ZJV A;  3AUL A;  3ZO5 B;  2JY6 A;  2PTL A;  1SIJ A;  2Z8L A;  3AE8 B;  1XXG A;  3UGB B;  1Z5S B;  3C19 A;  1Y56 A;  4FJZ A;  1QOA A;  1EU4 A;  1UEL A;  3U30 A;  2QIL A;  4HLE A;  1XCQ L;  4L2Y A;  1EU3 A;  3AE6 B;  2BT6 A;  2BS3 B;  1Q10 A;  4KDI C;  2RGF A;  2JPH A;  4EOY A;  2D10 A;  1J19 A;  4DWF A;  2YVC A;  1WJ6 A;  2MEK A;  2J0K A;  2L76 A;  3PPA A;  1K52 A;  2BB6 A;  3AEA B;  2M56 B;  2K0P A;  4DDI D;  3KUZ A;  2Y5C A;  1FRD A;  2DAF A;  1P7E A;  3DWG C;  2XBB C;  3AEC B;  1ENF A;  1GOZ A;  4P7I A;  1M94 A;  4A3P A;  2BTE A;  1NEK B;  2RDH A;  4QAY A;  4OZC A;  1P0R A;  1KOT A;  3HRD D;  3R2I A;  2KZR A;  5TSS A;  2WXR A;  1TKG A;  3S2A A;  2ZNV B;  1V49 A;  1V5O A;  4GSW A;  2C9W B;  3L10 B;  2DHZ A;  1FIQ A;  5TR5 A;  2N7D A;  3U4E G;  2V3N A;  2BYT A;  5DPW A;  1WYW B;  2KTR A;  4YL8 A;  4YTP B;  1UD7 A;  2BS2 B;  1UH6 A;  3ETR A;  2KLG A;  3GZN B;  2AQ1 B;  1JW9 D;  3P2B A;  2LGX A;  2BYF A;  3DDC B;  1UUP A;  1JQ4 A;  3VQI A;  4G11 A;  4FHK A;  4EZJ A;  4HRO A;  2MBE A;  3BIN A;  4MH0 E;  4HWI B;  4IM2 A;  1TKY A;  2ACZ B;  3CF6 E;  4WWN A;  3A33 B;  5D3I B;  2MW5 A;  2FCM A;  2MP2 B;  1KLU D;  1UF0 A;  5LNK 1;  1IYF A;  1E8X A;  1YOV B;  3ENE A;  3MP9 A;  3EHV A;  5IO9 A;  3WAO A;  4WJQ A;  3AEB B;  1FXT B;  2L05 A;  1E8Z A;  5JHB A;  3OAW A;  1ZW7 A;  4I6L B;  2SAK A;  1OEY J;  1WZ3 A;  4K81 A;  3NOB A;  1TY0 A;  2INP E;  2IY1 B;  3H8H A;  3U2S C;  1L0V B;  3UIN B;  3ZYY X;  2LJ5 A;  3MJW A;  2D11 A;  3NZS A;  1WGD A;  3V62 A;  2MBQ A;  4JWS C;  2JXT A;  2WU2 B;  3RNB C;  1I42 A;  4K3B A;  1M4V A;  3GZN I;  3APD A;  3AE4 B;  4ANW A;  3U7Z A;  1CZP A;  4DHZ E;  3AE7 B;  1V2Y A;  3QHT A;  3HUI A;  3ML8 A;  1QOF A;  2LXC A;  4NAW A;  2IPK D;  1R7S A;  2KMA A;  2M0A A;  2QC8 A;  2B76 B;  1K8R B;  2OED A;  3VTV A;  1JWB D;  2KFK A;  3R66 C;  3W1S C;  3APF A;  2LWP A;  1WM2 A;  3MFG A;  2ASQ A;  4LLG M;  2LGD A;  1VD2 A;  3L0W B;  3FIL B;  5AZF A;  4US9 A;  4N9F 4;  1RFA A;  3KH0 A;  3ZTC A;  1GAQ B;  3TEX A;  5H8Y E;  2WXM A;  2HTM E;  2WDV B;  2MRP A;  2RPQ A;  4YWG G;  4W9G A;  2RMM A;  2LGI A;  2J0J A;  2EEL A;  2KJH B;  3KUD B;  1XCT L;  1Y8R C;  1ZXH A;  4GDL A;  2KLC A;  3L54 A;  3L4P A;  2KN5 A;  4FUL A;  3W2D A;  2KFJ A;  4OHJ A;  5H92 C;  3V61 A;  1WGK A;  3NG0 A;  3PRE A;  4H2A A;  3ZRC A;  2EMT A;  2QSD A;  3QA8 A;  2INN E;  2LUM A;  3VUW A;  3MTN B;  1X1M A;  4W9L A;  3R3M A;  1NEN B;  3ZIM A;  1JCK B;  1K51 A;  3BVZ A;  4Q2J A;  5AZG A;  2ZJD A;  4DK5 A;  4OVZ A;  3Q2A C;  5G2N A;  1V1P A;  1ZUD 2;  2LVO A;  4AJY B;  3VHT C;  5IA7 A;  1STE A;  5E6O A;  2KDF B;  2LJI A;  3LXF A;  1SXT A;  2WWZ A;  2W54 A;  3IT6 B;  3VTU A;  3W5V B;  2GOW A;  2MWS B;  3RCZ A;  1E7U A;  4DBG A;  3QX1 A;  1XD3 B;  2JYE A;  3M63 B;  3ZNZ B;  4KGS A;  4GIV A;  1WM3 A;  1WXQ A;  4ICV A;  1I4Q A;  1I4H A;  2GMI C;  2WLB A;  4XWW A;  2YEP F;  1E9M A;  3MHS D;  4ANU A;  1L2N A;  1G6J A;  2C7H A;  3WAM A;  1DOY A;  4ZRK A;  3N30 A;  2KHW B;  1GC7 A;  2GBR A;  2L32 A;  2R2Q A;  2ZVO A;  4MGZ E;  2IJ0 A;  1I4G A;  2KDI A;  2KJ6 A;  5HHD G;  1QF6 A;  3UIO B;  2BB5 A;  1R4M I;  3V3X A;  2PVO D;  5I4D A;  3HM6 X;  4R3D A;  2RDB C;  2LGS A;  2CJN A;  1TT5 B;  1LO5 D;  2PEA A;  5IP4 D;  2RSU A;  1MVK A;  4BAX A;  4URK A;  3EFU A;  1PUT A;  3IAS 1;  4XX5 A;  2DYM A;  2NBV B;  3VUX A;  4IWQ A;  2MCN B;  3N1Y C;  3A4S C;  1QKZ A;  1A5R A;  2HE7 A;  3L17 A;  4ANX A;  3TIX A;  3JSV B;  2BPS A;  2GBN A;  4B95 A;  2N9E B;  2KC1 A;  2NS5 A;  1YX5 B;  2IND C;  1FNW A;  4ZOH C;  2I38 A;  2XK5 B;  2PE9 A;  3QCA A;  3IFW B;  2ZVN A;  1H8C A;  5D3D A;  3NUH B;  2CU1 A;  1I4X A;  1YD8 U;  3AN1 A;  1LXD A;  1GG3 A;  2AYO B;  3QIJ A;  5FKA C;  1MG4 A;  1WX8 A;  1MG8 A;  4LNN A;  3ZXR A;  1GJZ A;  3PO0 A;  1H4R A;  4NJ6 A;  3A9J A;  4HCP B;  5BYS A;  1C1Y B;  3PZ8 A;  2KMM A;  2N4F A;  1WJN A;  1EUV B;  2WX0 A;  3N3K B;  1JWM D;  4K3C A;  1DOX A;  1KFY B;  2MBB B;  3RD2 A;  3DQV A;  3K9O B;  3B2G A;  3QC8 B;  2NTT A;  3RNG C;  3B1L X;  3EUB 2;  3NY5 A;  2PIA A;  1P7F A;  4RFB A;  1P98 A;  4FAD A;  2IBI B;  4FA6 A;  1T0Q C;  2KWU B;  1N62 A;  3JSV A;  3TEZ A;  4GU2 A;  3T8M A;  1Z2M A;  4M02 A;  1ZGU B;  3BWU D;  1IP9 A;  1WJU A;  1TY2 A;  4MGI E;  1DYQ A;  2AQ2 B;  3DHG C;  1E10 A;  3P4S B;  4DHJ B;  2C60 A;  4J6I A;  4E74 A;  3UF8 A;  2DLB A;  1OEY A;  4HPL B;  4TQ1 A;  1JWU D;  1RM6 C;  4K1R B;  4NAM A;  2CJO A;  3O65 B;  4BOS C;  4C00 A;  4L23 A;  1N5W A;  2WXI A;  3NVW A;  2JZZ A;  4JX1 C;  1V86 A;  5IAA C;  3ZDT A;  1C3T A;  4LJO B;  2PMV A;  2LRW A;  1TKE A;  4AWJ A;  1B1Z A;  4IKG A;  2DEN B;  3H1U A;  5T8I A;  1UGM A;  1WWT A;  2FBW B;  3Q8F A;  1WXA A;  1ACC A;  2K3U A;  3R7R A;  3WIM A;  2JT4 B;  2DX5 B;  3GB1 A;  2AX5 A;  3PHX B;  2G45 B;  5C1Z A;  3PRP B;  4WWP A;  3GP7 A;  1V1P B;  3A1Q A;  2NBU A;  1IPG A;  4IWO A;  3GE8 C;  5J2R A;  2JU6 X;  2BKR B;  4LNF A;  2AL6 A;  2VH2 A;  4EEW A;  3DBH B;  4NJC A;  3BYY B;  2AEH A;  3DHH C;  2I2Y A;  2FID A;  2G4S A;  3AH7 A;  1YIW A;  2KVZ A;  3KUC B;  2FIF A;  2QJL A;  1F2R I;  4W9D A;  2Q5W D;  3W1S A;  1OTR B;  2NPT A;  2DZJ A;  2OJW A;  3DBR I;  1ZDX A;  4IWP A;  3Q6B A;  4REZ A;  3Q8C A;  4ARI A;  3CSF A;  3RFZ B;  2FNJ B;  2DAJ A;  1PQS A;  2Y3A A;  4FHJ A;  1EM7 A;  4HPP A;  3X0W A;  2LVQ A;  2OJR A;  3KWL A;  2KWV B;  4JL9 A;  5G55 A;  1L0X B;  2FUH B;  4HCN B;  4WH4 A;  2K8H A;  2CHZ A;  2IGH A;  2D07 B;  5EE3 A;  2ZEQ A;  2L7R A;  4ACF A;  4G50 A;  1E0Z A;  1T3Q A;  3MC0 B;  1WX9 A;  3A9K B;  4XDD A;  4P1C C;  1YN5 A;  1XLP A;  4GOC A;  1IBX A;  4DXG A;  1SJH D;  2KAJ A;  2J53 A;  2ZPY A;  3GOE A;  4MEL A;  4WAF A;  2M19 A;  4YTN B;  4JLC A;  2N7J A;  5BYR A;  3OJ4 B;  3NVV A;  3H9D A;  3RNE C;  4WJO A;  1TGZ B;  2JSV X;  1FNV A;  4A6Q A;  2AWT A;  2KK8 A;  1L4Z B;  2BKF A;  3DPD A;  1J7B A;  4EZL A;  4XE0 A;  2V4L A;  3TBL D;  2IO2 B;  2E3T A;  1SJE D;  4MGY E;  1XO3 A;  4S17 A;  3HIZ A;  1KF6 B;  4I6P A;  4PT5 A;  3AU5 A;  2REX A;  2MH7 A;  3NS8 A;  3NJT A;  1HXY D;  3BK2 A;  1HE8 A;  4B9K A;  4WUR A;  1GNU A;  4ASW C;  3DWM A;  4BFR A;  2JRI B;  3A9J B;  3D32 A;  2O2V B;  2D5G A;  4XC2 A;  2MJD A;  4ZRJ A;  3ZTD A;  3RZF A;  4CHK A;  4W9J A;  3CMM B;  2JUO A;  4MDK E;  2X38 A;  2KKC A;  2A4Z A;  1WX7 A;  3RNA C;  2M8S A;  1OQQ A;  1Q0W B;  3ZJU A;  1MFW A;  1KJT A;  3RUL A;  3OJ3 A;  3EEC A;  1FEH A;  3BK1 A;  3TJP A;  4GDK B;  3DBH I;  3DVN U;  2PPH A;  3SFD B;  1UWX A;  4NPN A;  3EFC A;  3DBS A;  3ZKJ C;  3Q3N C;  5HKH A;  5LXH A;  2UWQ A;  1N5X A;  2J42 A;  2O6V B;  4K7U A;  2AQ3 B;  3PSE B;  3VXW A;  4WIP A;  1WGG A;  1WRI A;  4PYZ A;  2NCN A;  3P4Q B;  4LK0 M;  2KTR B;  4HJG E;  1VZ7 A;  2WXQ A;  1C9F A;  3N1Z C;  4YT0 B;  1QOB A;  2WXK A;  3RMK C;  4YXD B;  4F7Z A;  1YN4 A;  3OLM D;  3U52 E;  2LVP A;  3IG3 A;  5DCN A;  3UIP B;  1DGJ A;  2QDF A;  2M4N A;  3C8Y A;  3PRM B;  3PT2 B;  3PRZ A;  1L7Y A;  2KQ7 A;  4J3O D;  2Z0D B;  1D5M C;  4B0E A;  3ZQ4 A;  4BVU C;  4NQK E;  1WGH A;  2VZK B;  4B6W A;  1SEB D;  1A70 A;  1ET6 A;  4IG7 B;  1KTK A;  2KN4 A;  1C4P A;  4RM8 A;  1XLQ A;  2Y5B B;  3RT3 B;  1T0R C;  1D5X C;  2K39 A;  3ZLZ A;  1JWS D;  2J52 A;  1CJE A;  2CU3 A;  4DDG D;  5C23 A;  4K7S A;  1WIA A;  2L52 A;  1FRR A;  4MH8 A;  2CHW A;  2YEP B;  1VZ6 A;  4W9I A;  1RAX A;  4C7Y A;  2JVC A;  4RGO S;  3Q8B A;  3A9K A;  4MGK E;  1P1A A;  2H88 B;  3BYT B;  4WWM A;  3VTW A;  3ABV B;  2A5U A;  4K7W A;  2FCQ A;  5D7G A;  4WQO B;  2GRI A;  5EE9 A;  2GB1 A;  3Q3O C;  1SIF A;  4HXD A;  3RNC C;  1UBQ A;  1TZO A;  2BF8 B;  4M01 A;  4FBJ B;  3Q3F A;  1BXT A;  2N9P C;  1SE4 A;  3N20 C;  1NI3 A;  4NAW B;  3NHE B;  3SHQ A;  2MJE A;  4XWT A;  4OVU A;  4HDO A;  3X23 A;  3IVF A;  3QK0 A;  4F1S A;  1EO6 A;  2MBH A;  2NTS A;  2JXX A;  1ZDV A;  1SBB B;  1C77 A;  1N61 A;  1JML A;  1TJE A;  1SB3 C;  4BOZ B;  5HFY A;  1RLF A;  2N9X A;  1R4M B;  3PVL A;  2WX1 A;  2EKE C;  4ZYN A;  4S0R A;  3T9L A;  3KW5 B;  2JQR B;  1QZE A;  2N0S B;  1WXV A;  3MJ5 A;  1HQR D;  3NZ3 A;  1IUE A;  2D3B A;  3E9S A;  3AE2 B;  1HTO A;  2JF5 A;  4ANV A;  3P42 A;  5E6J A;  1HZ5 A;  2ZW1 A;  1CK1 A;  4DXA B;  2MQJ A;  4FN2 A;  4LJP B;  3WCQ A;  2NBW B;  2V1Y A;  4M0W B;  2I1K A;  2Z0E B;  4C4V A;  2SEB D;  2WP9 B;  1HZ6 A;  2MA9 B;  1N6Z A;  4EE2 A;  3U7D A;  4RMA A;  3V05 A;  1ISN A;  1TZ1 A;  2D3G A;  2JRH A;  3TSS A;  2OOB B;  2VRR B;  1E8W A;  1MHX A;  2K8B A;  3DVN V;  3H7P A;  2IO1 B;  2DWQ A;  1EWC A;  5IN7 A;  1AW7 A;  3PS6 A;  1VR9 A;  4HJK A;  1K53 A;  4GGQ A;  3KYC D;  1TS5 A;  4USA A;  3BY4 B;  3VUY A;  4HVB A;  3WAP A;  1YN3 A;  2RR9 A;  4BKS A;  3P4R B;  3V60 A;  1TBE A;  4MSM B;  4MAC A;  1EF1 A;  1T0S C;  5D2M B;  1WI0 A;  1WR6 E;  3RN9 C;  3L16 A;  1NDD A;  3VVW B;  1OQR A;  4MSQ B;  3DBL B;  4KV2 A;  2DYB A;  5HG2 A;  3W9C B;  5CX3 A;  3WA0 A;  4HDQ A;  3DVG Y;  2C7M B;  2WS3 B;  2N1W A;  4ZRQ A;  2XEW A;  3TEY A;  3DHI C;  3KYD D;  1TTN A;  4P6V F;  2RPV A;  1V6E A;  4MJS A;  2W3R A;  1L4D B;  4L1B A;  4ZRP A;  1NVI D;  3K9P B;  1QOG A;  3PLV A;  4XYC A;  2M17 A;  1VDV A;  3RZW C;  1QIL A;  1SE3 A;  2V9H A;  4AJW A;  2XNA C;  1YJJ A;  1RRB A;  2ONQ A;  3B2F A;  2K25 A;  4WAA A;  5DPS A;  2WXP A;  3AEF B;  3QJZ A;  4M8M A;  2IO0 B;  1WF9 A;  1E90 A;  2N1V A;  1PGB A;  1GUA B;  2W9N A;  2D3A A;  5KHO A;  3TUO A;  2MP2 A;  1C4C A;  5CHF A;  3C0R B;  2QIE B;  3RYT A;  3SFE B;  2LD9 A;  1WR1 A;  3IT4 B;  2R2O A;  4W9C A;  4PS8 A;  4D2K A;  2GI9 A;  1YQ4 B;  2G1E A;  2KWC A;  3MHZ A;  2PE6 B;  4MJS B;  4FJY A;  1BML C;  3EGR A;  5BO4 B;  2GBM A;  1XF5 L;  3L08 A;  2WXJ A;  2V4I B;  4A20 A;  2BS4 B;  4HRS A;  3EC8 A;  3TL5 A;  1HTQ A;  1V8C A;  3NZU A;  4W9E A;  4AS1 A;  3LDZ E;  2LHE A;  2H89 B;  5KHQ A;  3ALB A;  1I4P A;  1V9J A;  1IGD A;  2NR2 A;  4NZL B;  5AUK A;  1C79 A;  3AV8 A;  1V5T A;  1I35 A;  4NNJ B;  1FCL A;  1J7A A;  2XN9 C;  3MC9 A;  3UQA A;  4OVV A;  1YMH E;  5JHA A;  4OW0 A;  3SEB A;  2IDY A;  1WH3 A;  2HD5 B;  2LGY A;  2BVC A;  4C4V B;  2L3Z A;  1SE9 A;  4KGT A;  2ZPN A;  2PJH A;  3VAW A;  4BKT A;  1XQQ A;  4X57 B;  1ROE A;  2WXF A;  3FIL A;  1LM8 B;  1XEE A;  2K5P A;  2WXO A;  1D3Z A;  2DZK A;  1KH0 A;  5BMH A;  3H7P B;  1JAL A;  4JWU C;  1TS3 A;  4KX6 B;  1PGA A;  3AE5 B;  3Q3J A;  2ZNV C;  3A1Q B;  3B9J A;  4N6E B;  2V0G A;  1HEZ E;  3CST A;  1Q5W B;  4LNI A;  4XGA B;  4C56 C;  2ZZP B;  3URY A;  4OZB A;  4KGR A;  4GXB A;  1VCB A;  3AI5 A;  4WJN A;  3CWI A;  4DXF A;  4GB9 A;  2HDE A;  2KJR A;  5BMI A;  5MPO A;  4AQ7 A;  4CYE A;  1Q1O A;  3DBL I;  2J4X A;  1YNT E;  1MHH E;  2INC C;  1FO4 A;  3AEG B;  2FE8 A;  1MI0 A;  4P16 A;  1VJK A;  2M0X A;  4WJP A;  2BWE S;  3PGE A;  3RI7 C;  1GB1 A;  2L8J A;  2MJ3 A;  2KX3 A;  1FCC C;  1YX6 B;  1KLV A;  3HVD A;  4AOF A;  3SD5 A;  2FUG 1;  3JW0 X;  4GLS C;  2K22 A;  4HPM B;  1JRO A;  5J18 A;  3P1M A;  3TEW A;  1JRU A;  5FK9 C;  1CQV A;  3RPF C;  1AWD A;  4ZDV A;  1V80 A;  4MM3 B;  3BII D;  4IUM B;  2ZCB A;  4DQO C;  3M62 B;  4RGT A;  3VR9 B;  2WQY B;  3M95 A;  4II3 B;  3LB8 C;  2DYO A;  2KAN A;  4RGM A;  4EFO A;  3N9Y C;  3HM3 A;  2N9L A;  2AL3 A;  4KSK C;  2FAZ A;  3W5U B;  4BKG A;  1KLG D;  3Q8A A;  1F77 A;  2CKH B;  2G3Q B;  1CMX B;  3NRZ A;  5G5G A;  2W82 A;  1YJI A;  1IGC A;  2BWF A;  3R7Q A;  4KDL B;  3AU4 A;  3RUI B;  4ZRI A;  3V6E B;  3ZNH B;  1S3S G;  3PHW B;  3NS1 A;  1FXA A;  4AP4 C;  2LAS A;  2GBJ A;  4A8X C;  4KSL C;  3QAQ A;  2LHD A;  1RFK A;  1ET9 A;  2CR5 A;  4FJV B;  5FR6 A;  2KOX A;  2VH1 A;  3DVG X;  2WXH A;  1GC6 A;  2WXG A;  2DNF A;  3IAM 1;  2IO3 B;  2NMQ A;  4BBN C;  1OFF A;  2JYT A;  3SDL C;  2IYD B;  4N58 A;  1R4N B;  1ZOY B;  2LEK A;  1SE2 A;  1P3Q U;  1FD6 A;  2KYW A;  2VZK D;  2FCS A;  4BBN F;  3HVZ A;  4TQ0 A;  1LQB A;  5CHW A;  2OHF A;  4A9A A;  1J0G A;  2UU7 A;  1FMA D;  3Q69 A;  2M1M A;  4PS3 A;  2DZM A;  3W1Y A;  4HEA 1;  2KNB A;  1PGX A;  5CTR C;  3QQ8 B;  2XK5 A;  3IHP C;  2WDR B;  1WE7 A;  5BYQ A;  1LFD A;  2D3C A;  2WHI A;  4YSY B;  3PZ7 A;  2JZ3 B;  3GE3 C;  1FFV A;  2ON8 A;  4IM3 A;  4JE3 B;  4IOI E;  3I9V 1;  4A55 A;  4ICU A;  1C78 A;  1L0Y B;  4GMV A;  4JPS A;  3FAH A;  2I1J A;  4KZC A;  2WGS A;  2K8C A;  3J9C A;  3WAL A;  3NVY A;  5D94 A;  2N9K A;  1NBF C;  1I7H A;  4TMA B;  2IGG A;  2L0F A;  1ZPS A;  1KM7 A;  1P9D U;  1HA5 A;  2KMC A;  2C7N B;  3M3J A;  4IDI A;  3T3O A;  4TUU A;  3UI3 A;  2MHJ A;  2KD0 A;  1WGY A;  4BZA A;  2R61 A;  2L00 B;  1QT9 A;  2K1F A;  2CHX A;  4RCO A;  2DZI A;  5L83 A;  1F1H A;  1WJ4 A;  1V1O A;  2WYQ A;  3LJ3 A;  3ZXV A;  4US8 A;  2BYE A;  4W9K A;  2J7Q B;  2MX2 A;  3ZDM C;  1R4N I;  1PYW D;  5CHV C;  2HJ1 A;  5DPT A;  1ESF A;  1WFY A;  2E6X A;  3VFK A;  3PLU A;  3MC8 A;  4YSX B;  1GB4 A;  1SSN A;  3UQB A;  4LNK A;  3WAN A;  3KLS X;  1T5X D;  5D6J B;  1J8C A;  2KFK B;  3N1X C;  4MM3 A;  1T6B X;  5C3J B;  2HJ8 A;  3RNF C;  5E6N A;  1U4A A;  2PVG C;  3IXS A;  4DHZ B;  3T3N A;  5JH5 C;  3P4P B;  1FFU A;  5LLI A;  5AUI A;  1UWM A;  1C4A A;  2GLS A;  4KZ0 A;  1WXS A;  1F52 A;  2X8X X;  2MSE D;  3DCG A;  3ZW3 A;  1PDX A;  4B0M A;  3L13 A;  4EZK A;  3HK0 A;  4HKZ E;  2G9H D;  4FXC A;  3U8Z A;  5G5H A;  4P1B C;  4ZHO A;  3AMZ A;  1E6E B;  2PKO A;  3H6N A;  2O6V D;  4A90 A;  5IKC M;  2B3A A;  4GDL B;  3KQ4 A;  4M8N A;  2KDB A;  1L6U A;  2L0T A;  3FC4 A;  2NPT B;  2W55 A;  4ITK A;  3AE9 B;  2KWD A;  5EDS A;  4WQM A;  4LTU A;  4II2 B;  5E6P A;  3QWZ B;  4CO7 A;  2GBK A;  4ARC A;  3AB5 A;  1RYJ A;  2K6Q A;  1NYQ A;  1IBX B;  1E7V A;  3JYU A;  4TSS A;  4AUQ C;  3PZD A;  1WGR A;  3V6C B;  1MPE A;  2DBY A;  3VH4 B;  1V81 A;  5IOI A;  1XLO A;  4F8C B;  1D5Z C;  2HTH A;  2KDE B; 
#chains in the Genus database with same CATH homology
 3MP9 A;  1BML C;  4WAF A;  1BUI C;  2M19 A;  3EGR A;  4YTN B;  2N7J A;  5BYR A;  1NYR A;  3AEB B;  3NVV A;  1FNU A;  1D4B A;  2JSV X;  1FNV A;  1XF5 L;  1B9R A;  4A6Q A;  2WXJ A;  2V4I B;  2BS4 B;  2SAK A;  4HRS A;  1L4Z B;  1J7B A;  1V8C A;  5BMG A;  4XE0 A;  4AS1 A;  1TY0 A;  2E3T A;  2LHE A;  2INP E;  2H89 B;  4RH6 A;  1SJE D;  1I4P A;  3H8H A;  1D6E C;  1IGD A;  1XO3 A;  4NZL B;  3U2S C;  1KF6 B;  5AUK A;  1TS2 A;  1C79 A;  1L0V B;  3AV8 A;  4PT5 A;  3ZYY X;  1FXI A;  2MH7 A;  1PFD A;  1FCL A;  1J7A A;  1HXY D;  3BK2 A;  2XN9 C;  2PLP A;  4WUR A;  2L1A A;  3DWM A;  3EA6 A;  4JWS C;  1YMH E;  2D5G A;  3AED B;  2MJD A;  2JXT A;  4OW0 A;  3SEB A;  2WU2 B;  2IDY A;  1WSP A;  2WNM A;  1XLN A;  4KGT A;  1M4V A;  3AE4 B;  3U7Z A;  1CZP A;  3AE7 B;  1J7C A;  3HUI A;  4CQN A;  1K50 A;  5HI1 A;  2X38 A;  1ROE A;  2WXF A;  3FIL A;  1XEE A;  2K5P A;  1QOF A;  2WXO A;  1E7P B;  2IPK D;  1R7S A;  2L83 A;  2M0A A;  2B76 B;  2OED A;  1KH0 A;  5BMH A;  1JWB D;  5JXV A;  1OQQ A;  4JWU C;  1JAL A;  1TS3 A;  4KX6 B;  3ZJU A;  1PGA A;  1AN8 A;  3I57 A;  3AE5 B;  3MFG A;  1VZ8 A;  2BW2 A;  4LLG M;  1SF0 A;  3FIL B;  3B9J A;  4N6E B;  1FEH A;  2TSS A;  5FR3 A;  2LMC A;  2V0G A;  1HEZ E;  4US9 A;  3BK1 A;  4GDK B;  3SFD B;  3AM9 A;  1UWX A;  1UGJ A;  4C56 C;  1GAQ B;  3TEX A;  3URY A;  1VRA B;  4OZB A;  3ZJT A;  1YQ3 B;  2EKI A;  3E56 A;  5H8Y E;  1DOI A;  2K9X A;  2WXM A;  2HTM E;  4KGR A;  3CWI A;  2J42 A;  1N5X A;  4DXF A;  1JWA D;  2WDV B;  2HDE A;  2AQ3 B;  4YWG G;  5BMI A;  5MPO A;  4WIP A;  4AQ7 A;  3AEE B;  2RMM A;  2LGI A;  4KKJ A;  2J4X A;  1YNT E;  1WRI A;  1MHH E;  1FO4 A;  2EEL A;  3AEG B;  3P4Q B;  4LK0 M;  2FE8 A;  1XCT L;  1TS4 A;  1MI0 A;  1ZXH A;  4HJG E;  1VZ7 A;  1V97 A;  4P16 A;  1VJK A;  3L4P A;  3W2D A;  2WXQ A;  1C9F A;  2BBC A;  4YT0 B;  1QOB A;  2WXK A;  3NVZ A;  4YXD B;  4OHJ A;  4RF1 A;  1YN4 A;  5H92 C;  1L5P A;  1WGK A;  3GS2 A;  3VR8 B;  3AE3 B;  3LYY A;  1GB1 A;  2MJ3 A;  3U52 E;  1FCC C;  4H2A A;  3BZD B;  1RWS A;  2QSD A;  2WDQ B;  3BVM A;  2INN E;  3HVD A;  1DGJ A;  2FUG 1;  2LUM A;  2WU5 B;  4GLS C;  2K22 A;  3C8Y A;  4C7Z A;  1JRO A;  4B0E A;  4J3O D;  1D5M C;  3ZQ4 A;  1N60 A;  2VZK B;  1SEB D;  3P1M A;  4UDU C;  5EE1 A;  1A70 A;  1ET6 A;  1NEN B;  3R2T A;  1KTK A;  3TEW A;  2KN4 A;  2IGD A;  5FK9 C;  1C4P A;  1CQV A;  1JCK B;  1ZE3 D;  3RPF C;  4YSZ B;  1ZXI A;  1AWD A;  4XDC A;  1K51 A;  1XLQ A;  3BII D;  1L6V A;  3CIR B;  3BVZ A;  4MM3 B;  4Q2J A;  4DQO C;  4RGT A;  4MT5 A;  3VR9 B;  2WQY B;  4OVZ A;  3LB8 C;  2DYO A;  4RGM A;  1V1P A;  1ZUD 2;  3N9Y C;  1D5X C;  2N9L A;  4OZA A;  1STE A;  3W5U B;  2LJI A;  1JWS D;  3LXF A;  2J52 A;  1KLG D;  1SXT A;  2JZP A;  1CJE A;  1TYG B;  2CU3 A;  3IT6 B;  2W54 A;  1F0Z A;  3Q8A A;  1F77 A;  3W5V B;  4ZHP A;  4RNA A;  3NRZ A;  5G5G A;  2L52 A;  3SR6 A;  1FRR A;  1AYF A;  1N63 A;  1YJI A;  1IGC A;  2W82 A;  4MH8 A;  2JYE A;  2YEP B;  2QMT A;  1VZ6 A;  1UNS A;  1KRH A;  4KGS A;  1WXQ A;  1WYG A;  4C7Y A;  3KWV A;  1C76 A;  3NS1 A;  1I4Q A;  1FXA A;  2QEJ C;  4RGO S;  3Q8B A;  1QQR A;  1I4H A;  1GPX A;  2WLB A;  4XWW A;  2YEP F;  1E9M A;  2H88 B;  3BYT B;  5GXG B;  4WWM A;  3ABV B;  4A8X C;  1DOY A;  2PW9 A;  3VRA B;  2LHD A;  1VLB A;  2L32 A;  5D7G A;  2GRI A;  1RFK A;  2GB1 A;  1ET9 A;  2IJ0 A;  5EE9 A;  1I4G A;  5HHD G;  3R8B A;  1QF6 A;  2BB5 A;  1TZO A;  3V3X A;  1F2R C;  2PVO D;  5I4D A;  4R3D A;  2ICI A;  1BXT A;  2CJN A;  1LO5 D;  1SE4 A;  1NI3 A;  2WXH A;  4NAW B;  2WXG A;  1MVK A;  2WXN A;  3IAM 1;  3AE1 B;  1PUT A;  2NMQ A;  3IAS 1;  1OFF A;  2MJE A;  2DYM A;  2JYT A;  4XWT A;  1QLB B;  4N58 A;  2Y5P A;  2RDG A;  2W3S A;  4O1N A;  1QKZ A;  1ZOY B;  3VRB B;  2NTS A;  2LEK A;  1SE2 A;  1ZDV A;  1FD6 A;  1SBB B;  2VZK D;  1C77 A;  1N61 A;  1JML A;  1TJE A;  4HKQ A;  3HVZ A;  4TQ0 A;  1SB3 C;  2OHF A;  3O13 A;  5HFY A;  4N59 A;  1FNW A;  4ZOH C;  4A9A A;  2I38 A;  1FMA D;  3Q69 A;  4C80 A;  4YTM B;  1FM0 D;  5D3D A;  2JQR B;  3NUH B;  4HEA 1;  4KKI A;  2N0S B;  1PGX A;  3MJ5 A;  1I4X A;  3AN1 A;  1EWY C;  2LFI A;  2ZW0 A;  1HQR D;  2WXL A;  3NZ3 A;  1IUE A;  4RF0 A;  3E9S A;  3AE2 B;  5FKA C;  2WDR B;  1I4R A;  3P42 A;  5E6J A;  5BYQ A;  1HZ5 A;  4YSY B;  3PZ7 A;  2ZW1 A;  2JWU A;  3PO0 A;  1CK1 A;  4ZYS A;  1FFV A;  2ON8 A;  5EE0 A;  5BYS A;  3PZ8 A;  2V3P A;  4JE3 B;  2KMM A;  4IOI E;  3I9V 1;  4A55 A;  3WCQ A;  1C78 A;  1L0Y B;  5C2T B;  4JPS A;  1JWM D;  3FAH A;  4RGN A;  1JRP A;  3BVG A;  1DOX A;  1KFY B;  2SEB D;  3ZGZ A;  3B2G A;  1ZP0 B;  2WP9 B;  1HZ6 A;  3J9C A;  2NTT A;  3NVY A;  4EE2 A;  3EUB 2;  3OWE B;  3V05 A;  2N9K A;  2PIA A;  1P7F A;  3Q8E A;  2KQ4 X;  1I7H A;  4TMA B;  2KAC A;  4RFB A;  2IGG A;  4M0W A;  3P63 A;  3TSS A;  1ZPS A;  1MHX A;  1N62 A;  3TEZ A;  1HA5 A;  4IDI A;  3T3O A;  3UI3 A;  2KDM A;  2DWQ A;  2JX5 A;  3BWU D;  1EWC A;  1AW7 A;  3ZJV A;  1TY2 A;  1DYQ A;  1VR9 A;  2AQ2 B;  2R61 A;  2PTL A;  1QT9 A;  1E10 A;  3P4S B;  1SIJ A;  2Z8L A;  3AE8 B;  1XXG A;  1K53 A;  1Y56 A;  4RCO A;  1QOA A;  1EU4 A;  2DLB A;  1V1O A;  1TS5 A;  4TQ1 A;  1JWU D;  4USA A;  1RM6 C;  4US8 A;  2QIL A;  1XCQ L;  4NAM A;  2CJO A;  4L2Y A;  1YN3 A;  4L23 A;  1EU3 A;  1N5W A;  2WXI A;  3AE6 B;  3NVW A;  3P4R B;  4JX1 C;  2BT6 A;  1PYW D;  1Q10 A;  2BS3 B;  2PMV A;  4MAC A;  1ESF A;  1TKE A;  1B1Z A;  4IKG A;  5T8I A;  2E6X A;  4YSX B;  1WWT A;  1GB4 A;  1SSN A;  2FBW B;  3KLS X;  2K3U A;  3Q8F A;  1ACC A;  1T5X D;  1OQR A;  2MEK A;  1T6B X;  5C3J B;  1K52 A;  3GB1 A;  5HG2 A;  3W9C B;  2AX5 A;  2BB6 A;  3AEA B;  2M56 B;  2K0P A;  2Y5C A;  3GP7 A;  1V1P B;  1FRD A;  2PVG C;  3IXS A;  3T3N A;  2WS3 B;  3P4P B;  1FFU A;  1P7E A;  2JU6 X;  3DWG C;  4ZRQ A;  5AUI A;  3TEY A;  1UWM A;  1C4A A;  3AEC B;  1ENF A;  1GOZ A;  4P6V F;  2RPV A;  2BTE A;  1NEK B;  2W3R A;  1L4D B;  4L1B A;  4NJC A;  4ZRP A;  1NVI D;  3BYY B;  2RDH A;  4OZC A;  1PDX A;  2I2Y A;  3HRD D;  1QOG A;  4B0M A;  3AH7 A;  3R2I A;  5TSS A;  2WXR A;  1TKG A;  1VDV A;  2G9H D;  4HKZ E;  2QJL A;  1QIL A;  1SE3 A;  1F2R I;  2Q5W D;  3W1S A;  2XNA C;  4FXC A;  5G5H A;  1FIQ A;  1YJJ A;  4ZHO A;  3AMZ A;  1ZDX A;  1E6E B;  2ONQ A;  2PKO A;  3B2F A;  4REZ A;  3Q8C A;  3U4E G;  2V3N A;  2BYT A;  4A90 A;  4ARI A;  3RFZ B;  4YTP B;  2WXP A;  3AEF B;  4GDL B;  3KQ4 A;  2Y3A A;  1EM7 A;  1L6U A;  2BS2 B;  3FC4 A;  2W55 A;  3KWL A;  4ITK A;  3AE9 B;  3ETR A;  2KWD A;  2AQ1 B;  1JW9 D;  1L0X B;  1PGB A;  4WQM A;  4LTU A;  4WH4 A;  1UUP A;  1JQ4 A;  3TUO A;  4ARC A;  3AB5 A;  3VQI A;  1RYJ A;  2IGH A;  1C4C A;  1NYQ A;  5EE3 A;  4HRO A;  1IBX B;  4TSS A;  2QIE B;  3SFE B;  1E0Z A;  1MPE A;  1T3Q A;  1TKY A;  2ACZ B;  2DBY A;  5D3I B;  3MC0 B;  3IT4 B;  1XLO A;  4D2K A;  1KLU D;  2GI9 A;  4XDD A;  1YN5 A;  1XLP A;  1YQ4 B;  2G1E A;  5LNK 1;  1IBX A;  4DXG A;  1SJH D;  3MHZ A;  2KAJ A;  1D5Z C;  2J53 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...