4JWSC

Crystal structure of cytochrome p450cam-putidaredoxin complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
b'SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLECVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Camphor 5-monooxygenase
molecule tags Oxidoreductase/electron transport
source organism Pseudomonas putida
publication title Structural basis for effector control and redox partner recognition in cytochrome P450.
pubmed doi rcsb
total genus 30
structure length 106
sequence length 106
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4jwsC00
1FFUA 1TKGA 3B9JA 4YTMB 1JALA 2E3TA 5G5HA 1FRRA 3BIID 2WDVB 1GAQB 2M56B 2QIEB 2PVOD 3W5VB 4FXCA 4YSXB 3AV8A 5G5GA 3AE2B 2Y5CA 3NVYA 2HTME 2MJEA 1E9MA 1NYQA 5EE9A 2PIAA 2Q5WD 3EUB2 4USAA 2M19A 3AM9A 1ZP0B 1E6EB 1L0VB 2BS3B 4ZOHC 3AE9B 2N0SB 3AEEB 4C7ZA 2LEKA 4YT0B 1A70A 1RFKA 3VRAB 1CJEA 3VR9B 4JWSC 5EE0A 5C2TB 1YQ4B 4YTNB 1XLPA 2K22A 1TKYA 1RYJA 1DOXA 2K9XA 3CIRB 1NVID 1YJIA 3AE7B 3AEGB 3HVZA 3NVWA 3SFEB 1DOIA 1UWMA 4KX6B 1QT9A 3FC4A 4YTPB 4C7YA 3P4PB 2FBWB 2ACZB 1V97A 3AN1A 1N5WA 1L5PA 1KF6B 2WP9B 3AE8B 2PVGC 4US8A 3AE3B 3B2FA 1DOYA 1N61A 1TKEA 2W54A 3AE5B 1QOBA 5AUIA 2MJ3A 2JX5A 3ABVB 3P1MA 3P4SB 4HRSA 3AEAB 3W5UB 4JWUC 1YQ3B 2K5PA 2H89B 3NS1A 2W3SA 1E0ZA 1PDXA 1KFYB 1XLOA 1ZOYB 4WWMA 2DBYA 5H8YE 1DGJA 2MH7A 2L52A 4JX1C 1T3QA 4IDIA 3VR8B 4HROA 4P6VF 1SB3C 2L83A 1XO3A 1JQ4A 1QOGA 4N59A 4ZHPA 5H92C 1L6UA 3CWIA 5EE1A 1J7AA 1JWAD 1FMAD 3AEDB 5EE3A 1TYGB 4ITKA 5C3JB 1VDVA 1N63A 2WS3B 5MPOA 1OQQA 1B9RA 1R7SA 1OFFA 2G1EA 2DWQA 1ZXIA 3HUIA 1GPXA 3P63A 4YSZB 1N5XA 1FXIA 1L6VA 3DWGC 2QJLA 1FM0D 2BS2B 1IUEA 2H88B 3HRDD 1WRIA 4US9A 1ZUD2 1E10A 1XLNA 1RM6C 2WDRB 3AMZA 1NENB 3AECB 3FAHA 3PO0A 4N6EB 2B76B 4N58A 2W3RA 5GXGB 2AX5A 1NI3A 1FFVA 1PUTA 3P4RB 3LXFA 1TJEA 1JRPA 2WU2B 2WLBA 4YXDB 3AH7A 1FRDA 1WWTA 1V8CA 1QOFA 3AEBB 3SFDB 4ZHOA 1QF6A 3NVZA 1WYGA 2PKOA 1EWYC 1AYFA 3AE6B 1QOAA 1SIJA 1F0ZA 3LB8C 1J7CA 3NVVA 1JROA 2BS4B 1OQRA 2CJOA 3AE4B 1ROEA 2JQRB 1I7HA 3ETRA 1XLQA 2KMMA 3P4QB 3NRZA 1RWSA 3VRBB 1VJKA 3WCQA 1PFDA 1WGKA 1WXQA 1KRHA 3AE1B 4A9AA 3ZYYX 1FIQA 3L4PA 4WQMA 2MJDA 2W55A 1N62A 3SR6A 2KAJA 2EKIA 4LTUA 1J7BA 2WQYB 1YJJA 4YSYB 3AB5A 1E7PB 1JW9D 1CZPA 2BT6A 2OHFA 3AEFB 2CJNA 1VLBA 1N60A 4C80A 1FO4A 3DWMA 3KWLA 1QLBB 2WDQB 2WU5B 3RPFC 2CU3A 1NEKB 3W9CB 5AUKA 1SF0A 1JWBD 3B2GA 1FXAA 1AWDA 1NYRA
chains in the Genus database with same CATH superfamily
3HIZA 1WFYA 2IO0B 5G5GA 3ZIMA 3PRZA 2MWSB 4GDLB 4RMAA 1EU4A 2DYBA 4A20A 4ZOHC 3RD2A 1VZ7A 5EE0A 2GRIA 4CO7A 5AEKB 2KHWB 1J0GA 2KVRA 1DOIA 1YX5B 4KX6B 1WXAA 2NCNA 4AQ7A 4RH6A 1KF6B 1P98A 5BO4B 3R7QA 2BYTA 1GUAB 5HI1A 2MX2A 2UU7A 5FKAC 4G11A 1D5XC 3Q8CA 3B1LX 2AL3A 3CSFA 4KDIC 1ACCA 1E5WA 4LLGM 4E71A 3V3XA 1XO3A 2YEPB 4KVGB 3NJTA 3PV1A 3DBLI 4LJOB 2L32A 3ZO5B 5MPOA 1N63A 1OGWA 1Z2MA 2BF8B 3NZ3A 2D07B 2BVCA 3EC8A 2K8HA 1F0ZA 1LFDA 3PO0A 3V05A 2JT4B 5BYRA 4KGRA 1FFVA 2XEWA 3TEXA 4M01A 1R4NI 2D2QA 3AEBB 3R2IA 3DBLB 4RCOA 2PKOA 4RGOS 2VRRB 2BS4B 3ETRA 3NRZA 1HZ5A 3N1XC 2BYVE 3VRBB 1FNUA 4ZYNA 4NNJB 4XYCA 3UGBB 2IO3B 2JXXA 2RPVA 4MH8A 4W9DA 1J7BA 2CJNA 4ZRJA 2AQ3B 3EHVA 4M0WA 1JWUD 2JXTA 1RRBA 1T0QC 1SF0A 4KSKC 2ON8A 4YTMB 3TEWA 2PVOD 4BFRA 4L1BA 4W9LA 1WJ6A 4IWOA 2TSSA 2WXMA 2JF5A 3TUOA 3E56A 1L0VB 2J52A 4HDQA 2M0XA 3A9JA 3A33B 3Q8EA 3ZDTA 4MGIE 2K6QA 3UI3A 1SXTA 1Q5WB 1PGBA 3GZNB 2FCMA 3Q3NC 3ZNID 1UNSA 2L7RA 1I4QA 1V5OA 4DXAB 5J2RA 1V1PB 4HJKA 4M0WB 3K9OB 1V6EA 3I5JC 1ISNA 1P7EA 4P6VF 3VTUA 3ZW3A 3NUHB 5HKHA 4WH4A 4WJPA 1WYWB 1ZDXA 3CMMB 4ZHPA 3H7SA 5JH5C 3DVNV 2K1FA 2KJ6A 1FXIA 4GN1A 3A9KA 4FHJA 4KGTA 2JZZA 3ZXRA 1MG8A 5GXGB 4N58A 3SU8X 2B76B 2W3RA 4M8NA 2ZW1A 1ZXHA 4HVBA 2DZJA 4MM3A 1HXYD 2DAJA 4WQOB 2KYWA 2KLGA 2IY1B 1VCBA 1ROEA 3RCZA 1C4CA 3AULA 3IXSA 3JVZX 3PS6A 5IO9A 2FIDA 3L4PA 3SHQA 3L16A 2KDMA 2DYMA 4PT5A 1T6BX 3DWMA 3KWLA 4WAAA 2ZW0A 4HJGE 3TEYA 3B2GA 1FXAA 4DHJD 1AWDA 4KIKB 2K6DB 4KDLB 1XD3B 2RDHA 1H8CA 3RULA 4J6IA 2IBIB 3GE3C 2KLCA 3VRAB 4JWSC 5CX3A 4WJOA 2WYQA 1STEA 2EKEC 2JU6X 3NVWA 3TSSA 1P3QU 3TJPA 2LJ5A 2MEKA 4C7YA 1V86A 5BYQA 1OEYJ 2LZ6A 4W9IA 1ZDVA 2PVGC 2JUOA 5D3DA 2EELA 2VH1A 2MJ3A 1V9JA 2J0JA 4BOSC 3ZNHB 2QCZA 2NMQA 1SSNA 2AQ2B 1RAXA 4LCDE 2KFKA 4P1CC 1SB3C 1EU3A 5LNK1 3OG5A 2LVOA 3UQAA 3N1YC 5CHFA 2V4IB 1EF1A 3Q3OC 2L8JA 4JIOU 1D6EC 3BZDB 3TCAA 2KD0A 3QX1A 2H88B 1FXTB 1E10A 1YJ1A 1RM6C 1JWSD 3WAOA 4TQ0A 4HCPB 4NAWB 2G3QB 4BKSA 2CHWA 2N1VA 3AE4B 2IZVB 2KDFB 3O65B 3P4QB 1WM2A 4LNFA 3DDCB 3I63C 1E8XA 2LGXA 4WAFA 4YSYB 2PEAA 3DBRI 2WDTB 1XCQL 1SE3A 2KQSA 3VQIA 2XN9C 1WGRA 5LXHA 2GLSA 3EFUA 1TKGA 2N9PC 5G5HA 4XX5A 5CTRC 2WXPA 3HHMA 1E9MA 2N7JA 3DVGX 2NPTA 3L0WB 4AWJA 4NQKE 3KYDD 2MP2A 2HTHA 5BYSA 3AEEB 3ENEA 4NPNA 5CHWA 1TZ1A 4GU2A 1EUVB 1V97A 2WXOA 3VTWA 1QQRA 1I4PA 1F2RI 2KMAA 3ABVB 2L1AA 3RMKC 1P7FA 1C79A 2FUHB 4ANUA 3W5UB 2H89B 2J0MA 1VRAB 1E7UA 3VVWB 3KQ4A 1M4VA 2ZPYA 4K81A 2KDEB 2CR5A 4MELA 2JPHA 1F9JA 4E74A 3JW0X 1XXGA 1WR1A 3BVGA 3DCGA 4F7ZA 4NAMA 2IYDB 1V2YA 1ZXIA 2KACA 4DWFA 3KH0A 2KT7A 2MBOA 2KOXA 2J0KA 4RNAA 1IYFA 2DX5B 2N9KA 3V62A 2AX5A 3PPAA 4XWWA 3VH3B 2LGIA 3P42A 3LDZE 1WWTA 2NVUI 2G45B 2GB1A 3AE6B 3QK0A 1JROA 5TSSA 3V61A 2O2VB 1XLQA 2KJHB 3WAPA 2NTTA 1L0YB 3AE1B 2C7MB 2X38A 1WY8A 1WM3A 4GXBA 2MBHA 1FPYA 2LXAA 3OJ3A 1UBQA 2LMCA 3P2BA 4LDTB 4J3OD 4FN2A 2O6VD 2KZRA 2I1JA 2WDVB 4W9KA 3U2SC 1UF0A 1CMXB 1E6EB 3ZUNA 4CYEA 4C7ZA 2C9WB 3WANA 3MP9A 3B08A 2C7NB 1QT9A 4IWPA 3U8ZA 2BYEA 4KV2A 4GDKA 1RFAA 2V4LA 4HRSA 3AEAB 5JXVA 1WI0A 4EZJA 5FR6A 1YIWA 1NDDA 1C77A 3KLSX 3VAWA 2REXA 4ZYSA 4MGZE 2BWES 1C76A 2LVQA 4LNOA 3H1UA 1OFFA 4DBGA 3Q8BA 3JYUA 2MBQA 1XEEA 3U4EG 4HLEA 4MSMB 1WGHA 2N7EA 4UDUC 1WH3A 4A6QA 5C23A 3LXFA 1ZKHA 1AN8A 3QIJA 4OVUA 2L3ZA 2W82A 1I7HA 1LXDA 2WXQA 2FCQA 2LASA 5IKCM 2FNJB 4LK0M 3AI5A 4NJCA 4H2AA 4XGAB 2LD9A 2C60A 4HWIB 4MH0E 1ZPSA 4YL8A 5L95C 4IG7B 2WXGA 3IAS1 1BUIC 4HXDA 5E6JA 4YT0B 1V5TA 3CF6E 3TBLD 3W2DA 2LGDA 1XLPA 3CIRB 3SFEB 2MRPA 2BTEA 3P4PB 2WP9B 1HZ6A 3R66C 2D3GA 1N61A 1XCTL 2MQJA 4GMVA 2OJRA 2XBBC 5J17A 1WRDB 3NOBA 3V6EB 2DENB 4DHZB 2AEHA 1XQQA 4W9CA 3ZKJC 2ZPNA 3W1SA 4K3BA 1YN5A 1X1MA 3ZDMC 4F8CB 1GPXA 1U4AA 1SGHA 2LJIA 1QILA 4XDDA 2SEBD 2KNBA 2LUMA 2NBWB 4TMAB 3A4SC 3AH7A 3EGRA 3NVZA 1EWYC 2QILA 3BY4B 1SIJA 1D3ZA 3OJ4B 4P16A 3QQ8B 2WXLA 2A4ZA 4EZLA 2KMMA 3PRPB 1I35A 3NZUA 2ZNVB 1MHHE 2W9NA 4B6WA 2GBKA 1KRHA 2MLBA 4ICUA 4A9AA 4FJVB 2FIFA 3DBHB 3SD5A 4YWGG 2QHOA 4I6LB 4GSWA 5DPSA 2JZ3B 4C80A 1KLGD 1FCLA 3W9CB 3QJZA 5I4DA 3Q2AC 3TMPB 2M56B 4FXCA 2ASQA 4JPSA 2GOWA 2M0AA 2KQ4X 1TS4A 4EE2A 2CHXA 2PMVA 3VXWA 4PK1A 1HTQA 1WZ3A 4C56C 1I4RA 4M02A 4DHZE 4QAYA 4REZA 5BMGA 3AE7B 1WJNA 3FKYA 2J53A 1Q10A 2KTRA 4TUUA 4NY0A 4BKTA 1L5PA 2O6VA 1QKZA 1QOBA 2KTFA 1KLVA 2R2QA 3UINB 3VFKA 5HFYA 1YQBA 3JSVA 3APCA 2C7HA 2W3SA 3QAQA 1SEBD 2FCSA 4OZBA 1XLOA 4CQNA 4XDCA 1WMHB 2MSED 3PRMB 3EFCA 1XT9B 1KOTA 2KANA 2L83A 1WXMA 1KTKA 2KXJA 1OQQA 2V1YA 3HUIA 3OLMD 4W9HA 2HDEA 5AZFA 1WJ4A 1G6JA 1TZOA 3U7DA 3N20C 4G3XB 3AMZA 1ET9A 2N9EB 3P4RB 4FBJB 3HVDA 2ZCCA 1QOFA 2A5UA 5D7GA 1EM7A 1WE7A 2QMTA 3NG0A 2V3NA 1J7CA 3RI7C 1OQRA 1GJZA 2CHZA 5IN7A 2HE7A 1WGKA 3ZYYX 4LNKA 1VR9A 2W55A 3WIMA 4BOZB 2JWUA 4LTUA 3UQBA 2OEDA 1ZE3D 5IOIA 3H6NA 1HQRD 4R3DA 1EO6A 3RYTA 3KYCD 1SIFA 2XK5A 1Y56A 5JHBA 4MGYE 2N9LA 5LXIB 4P1BC 2BGFA 3QARA 2D5GA 3AE2B 2Y5CA 2HTME 4L2YA 4XWTA 3EUB2 4AOFA 2LEKA 4RGMA 3U30A 1F77A 3J9CA 3KUDB 2ZVOA 2BB6A 5C1ZA 4ANXA 4M8MA 1UGJA 2PE6B 3DBHI 3S2AA 2DAFA 4PS7A 2J4XA 4WWMA 1Y8RC 1DGJA 4JX1C 4IDIA 4HROA 4ANWA 2IGGA 3MHSD 4G0NB 3BWUD 3ECIA 1Z5SB 3M62B 2WXKA 1C4PA 3PSEB 4N9F4 1L6VA 3DWGC 2UWQA 2J7QB 1OTRB 4N6EB 1NENB 2M8SA 4FLHA 1P9DU 3UIOB 1D5MC 4MSQB 3W1YA 4RGNA 1AYFA 5T8IA 1WX7A 3T8MA 2ZZPB 1OEYA 4HPMB 5KHQA 2DZIA 1WXQA 4WQMA 3R2TA 1SJHD 4FA6A 4TQ1A 3L08A 1E7PB 4GDKB 2WU5B 2ZEQA 2ICIA 2K8CA 4P7IA 1WGYA 2EMTA 1TS3A 3DHHC 3WAMA 4HCNB 2PIAA 1I4XA 1ET6A 1Q1OA 2Q5WD 2Z59B 1ZP0B 4W9FA 2NBVB 2N0SB 4II2B 3ZJTA 2PW9A 3PREA 1AW7A 1DOXA 1F2RC 2IPKD 4LDTD 1HA5A 3ML9A 3RUIB 3RNFC 4ASWC 5JZEB 4RF0A 3RNEC 4II3B 4URKA 2MBBB 1DOYA 1WX9A 1R4MI 1K8RB 4EZKA 3V6CB 1WMHA 1I4GA 4MGKE 4EFOA 4GGQA 2IO1B 4A3PA 4IKGA 3FILA 3JSVB 4K7UA 5IP4D 4FJZA 5GMVA 2IY0B 3URYA 4KKJA 2R61A 4ICVA 5H92C 3RNCC 2D3CA 2KTRB 4BZAA 4BVUC 4Q2JA 2JRIB 3KVFB 1WR6E 1VD2A 1HTOA 2QJLA 2G4SA 4TKNA 2BS2B 1H4RA 1WRIA 1FD6A 1PGXA 3AECB 2RDBC 4JQWC 2DZMA 3APFA 3MHZA 3ZXVA 1V8CA 2JRHA 1SE4A 3VUYA 3DVGY 4KZ0A 2LVPA 4WJNA 2PPHA 2GBJA 2G4DB 1RWSA 2MJDA 3L10B 3BK1A 1N60A 3VUXA 1FO4A 3RPFC 4WWOA 2KC1A 1LM8B 2LGSA 2FCNA 1C4AA 1L0XB 2M1MA 4I6NB 2E6XA 2INPE 2K3UA 2KFJA 1TGZB 2M19A 3HK0A 3X23A 2GBNA 2SAKA 1UBIA 3K9PB 4IW0A 1RFKA 3VUWA 3VR9B 4AJYB 3PHWB 5LLIA 3T3OA 1RYJA 3AEGB 1YNTE 1UWXA 4A8XC 2FUG1 4C00A 4BKGA 2VH2A 3AE3B 3B2FA 3GP7A 3NY5A 4DQOC 2WX0A 3AU4A 1E0ZA 1KFYB 1ZOYB 3WA0A 4HEA1 2KMCA 1F1HA 3MFGA 2WXRA 3A1QB 4N59A 4M00A 1BMLC 2PTLA 2JZPA 4X57B 2LHDA 2KWUB 3PVLA 4NAWA 2MHJA 3R3MA 1N5XA 2KWVB 3QC8B 2LFIA 4GLSC 2MBEA 3IHPC 4DXGA 3KW5B 1D5ZC 1MPEA 1TJEA 3VDZA 1L7YA 2LRWA 3SFDB 1K50A 3N32A 1QOAA 1MI0A 5D94A 4RGTA 1HEZE 3PLUA 2WXIA 2Y5BB 3RN9C 4OVZA 4AUQC 4PYZA 2OHFA 3APDA 2I38A 2BT6A 4PS8A 2GBMA 5D2MB 4HKQA 3U52E 5DCNA 5AUKA 1FNWA 2KC2A 1FFUA 5E6PA 4RM9A 1C1YB 1GAQB 3VTVA 2Z8LA 1TS2A 2JY6A 2BB5A 3AM9A 4AS1A 4A55A 3VHTC 2KKCA 1L2NA 2K0PA 2K22A 2CKHB 1NVID 2AL6A 3R8BA 2WNMA 3M3JA 2KQ7A 4OZCA 3ZVVA 2IGDA 2RR9A 1IBXA 2RD0A 2RMMA 5AUIA 2L0FA 4IUMB 2GMIC 2KK8A 2KWDA 1TBEA 3SEBA 2AQ1B 1V80A 5DPRA 1TY0A 3KUZA 3DQVA 2KWCA 1OQYA 3UF8A 3ONSA 2EMSA 4OVVA 1SE9A 3DBSA 2MA9B 1FMAD 4FADA 1WE6A 3RZWC 2KN4A 1JCKB 3DHIC 3MJWA 1PGAA 2WHIA 2OOBB 3DOWA 2YEPF 3GE8C 3GS2A 4S0RA 2N1WA 4E3CA 1IUEA 1LO5D 1ZW7A 1ZUD2 3A9KB 2BBCA 4S17A 1JRPA 1WYGA 1LQBA 3TIXA 4HPLB 2WGSA 2JQRB 3NS8A 4EKUA 4IOIE 2V3PA 2PLPA 1FIQA 4BBNC 1N62A 2BQQA 3EA6A 1V1PA 1XF5L 2OJWA 1CZPA 4OHJA 5D3IB 1VLBA 4KSLC 3I57A 3RZFA 2HJ8A 3BK2A 1RLFA 2N7DA 3DVNU 2E3TA 4DDID 1P0RA 3E9SA 4GIVA 1UD7A 2MJEA 2XNAC 4WWNA 4A90A 5DPTA 3ZRFA 4W9GA 1YN4A 3PZDA 1A70A 4L23A 4B0MA 1YX6B 1WZ0A 3DBRB 4W9EA 4DK5A 3HVZA 1WX8A 4YTPB 1NBFC 2K25A 3AE5B 3P1MA 2I2YA 1EWCA 4JWUC 2K5PA 2NBUA 2XK5B 4GOCA 1V49A 5DPWA 1J19A 4I6PA 2WXNA 3B0AA 5H8YE 3VH4B 1UUPA 2L52A 1S1QB 1QOGA 3PZ8A 3CWIA 1J7AA 5EE3A 2L05A 1P1AA 2QEJC 5KHOA 2YLMA 4ITKA 1VDVA 1B9RA 3NHEB 1IGCA 2MCNB 3C8YA 1FCCC 4YSZB 3UIPB 1KJTA 3IBEA 2Z0DB 3QHTA 3Q3FA 4C4VA 1M94A 3IT4B 3HRDD 4K3CA 1ESFA 4KZCA 2L00B 3Q3MC 1MHXA 1V1OA 1QF6A 1WGDA 3BINA 1KM7A 3LB8C 2PJHA 1PYWD 3RNAC 2VZKB 4XE0A 3M95A 4JE3B 1LGRA 4ANVA 1R4MB 1PFDA 2KX3A 1MVKA 3GB1A 2HJ1A 2EKIA 4NJ6A 1WSPA 2INDC 1IP9A 1YJJA 3DPDA 1JW9D 3IT6B 3HM6X 3MC0B 2QSDA 3IAM1 1NEKB 3ZQ4A 3IVFA 4MJSB 3Q8AA 2BKFA 3B9JA 3A1QA 4ZRQA 3BIID 1T5XD 4DDGD 3W5VB 1YMHE 4YSXB 4KGSA 2O2VA 2DLBA 2K8BA 4IM2A 2V3SA 1BT0A 4B95A 1TS5A 4YTNB 2K9XA 3ALBA 3MC8A 1YJIA 2DHZA 2IGHA 2LGYA 4HKZE 1N5WA 2R2OA 4W9JA 4ACFA 2YVCA 3BYYB 3Q14C 1QZEA 1SE2A 2KJRA 4B9KA 2IDYA 1VZ8A 1WF9A 1IBXB 3SDLC 1YOVB 4NQLB 1K53A 2KVZA 3L54A 2ZJDA 4RF1A 2UYZB 1A5RA 4LNIA 1L6UA 3AEDB 2PE9A 1WGGA 2BKRB 2D10A 3L13A 2G1EA 2CS4A 5HG2A 5FK9C 2N9XA 2WLBA 3ZJUA 4YXDB 2GBRA 3H9DA 3PHXB 5D6JB 2AYOB 4JL9A 2G9HD 3N30A 2O6VB 2MP2B 2K39A 2AWTA 2NPTB 3AXCA 3ZTCA 2NTSA 3GZNI 5AZHA 3WCQA 3PLVA 4OW0A 2M17A 2L76A 3RFZB 3SR6A 2Y3AA 4TV3A 1J8CA 3BVMA 3LYYA 5IAAC 1UGMA 4JGHB 5AZGA 1GB1A 1BXTA 3H7PB 4ARCA 2ZNVC 2WXHA 3T9LA 2QIEB 4ARIA 4PYUA 3NVYA 3BVZA 1GOZA 2V0GA 4USAA 3FILB 2BS3B 3AE9B 4MJSA 4F1SA 1UH6A 1MJDA 1CK1A 5C2TB 1GB4A 1YQ4B 4BAXA 2DZKA 2GI9A 1TT5B 1E8ZA 4ZRKA 2ACZB 3AN1A 2JWZA 1E90A 3RT3B 3AE8B 2DNFA 1L4ZB 2W54A 2JYTA 3N9YC 3P4SB 2JX5A 1C3TA 3NS1A 1PDXA 4LNNA 2WXJA 1C9FA 1R4NB 2KFKB 3KWVA 1E8YA 4MEMA 4C4VB 4ZDVA 2WS3B 1SJED 3HM3A 1R7SA 3Q69A 5JHAA 2DWQA 1WXSA 2BYFA 2WWZA 1GG3A 1Q0WB 3Q6BA 1ZGUB 3TL5A 4RFBA 2WDRB 1PQSA 2KDIA 4IC7B 2LI5A 1WJUA 3O13A 2LXCA 1T0RC 2KO3A 4EUTA 4ZHOA 5L83A 3ML8A 1IGDA 4XC2A 4EEWA 3PGEA 2BW2A 2D3BA 2V9HA 2ZVNA 3L17A 2WXFA 3MTNB 1KH0A 1GC7A 2B3AA 1TTNA 2J42A 4KIKA 3C0RB 4WURA 1L4DB 4NZLB 2WQYB 4FJYA 5CHVC 3Q3JA 3AEFB 4RM8A 4A3OA 4HDOA 1TY2A 4NJ7A 2WDQB 2CU3A 1V81A 4AP4C 1NYRA 5G2NA 1JQ4A 1JALA 1KLUD 4ZRPA 1EF5A 3AV8A 3M63B 1WXVA 1YD8U 3ZGZA 1B1ZA 3U7ZA 2DYOA 4MDKE 1MG4A 3GOEA 5FR3A 2ONQA 2LHEA 4MM3B 5TR5A 2QC8A 3FC4A 1C78A 4OZAA 2FBWB 1JRUA 2INNE 3A4RA 3MJ5A 4O1NA 2LWPA 2L0TA 1F52A 3IFWB 2BWFA 4XZ4A 2JYEA 1K51A 2I1KA 3ZLZA 1CQVA 4K7WA 4EOYA 5E6OA 3AU5A 3MC9A 4LJPB 3W1SC 3QWZB 3I9V1 1T3QA 3V60A 2FE8A 1SBBB 2BPSA 3CSTA 3BYTB 1JWAD 4DHJB 3T3NA 1GNUA 1TYGB 3IG3A 5C3JB 3Q8FA 3RNBC 5E6NA 1NI2A 2IO2B 3TEZA 2LRUA 3DHGC 3D32A 4WIPA 4DXFA 1E7VA 3PZ7A 3N1ZC 4TSSA 3WALA 1FEHA 4AJWA 3R7RA 1PUTA 5HHDG 2INCC 1FRDA 3A9JB 4IM0A 3NZSA 1DYQA 3NVVA 3ZTDA 3ZNGC 2VZKD 3EECA 4MACA 2D3AA 1VJKA 2MW5A 2KAJA 1GC6A 3PT2B 3OAWA 5IA7A 4CHKA 3ZJVA 2IJ0A 4K1RB 4G50A 1JWBD 2KDBA 1FRRA 2FAZA 2RGFA 4D2KA 1JWMD 1K52A 2N4FA 3KUCB 1UZXB 1NYQA 2Y5PA 5EE9A 4JLCA 1MFWA 5BMHA 1ENFA 4HPPA 1YN3A 1CJEA 4WWPA 1TKYA 3QA8A 3ZRCA 3RNGC 1FNVA 4FHKA 1UWMA 4B0EA 2KN5A 3ZNZB 3LJ3A 3H7PA 4US8A 1TKEA 4KKIA 1JMLA 1S3SG 2JVCA 4MT5A 1YQ3B 4WJQA 2Z0EB 2QDFA 4BBNF 1E8WA 3QCAA 3X0WA 2DBYA 4BKSD 2RSUA 2MH7A 3VR8B 2X8XX 1IPGA 4FULA 2LUEA 4ZRIA 5G55A 5J18A 5EE1A 1VZ6A 2JSVX 2C5LC 1WIAA 2RDGA 3PTFC 1I42A 5BMIA 4GB9A 3P63A 3N3KB 2RPQA 1FM0D 1T0SC 1UELA 4US9A 2ZCBA 1XLNA 3FAHA 4HK2A 3I3TB 2M4NA 3C19A 1NI3A 2WU2B 5EDSA 1D4BA 2CU1A 2HD5B 1HE8A 1N6ZA 2CJOA 4IM3A 1AARA 4GDLA 4K7SA 2NR2A 1T0YA 2D11A 2WX1A 2KX0A 3OWEB 3AB5A 1TIFA 4PS3A 1I4HA 4IWQA 1QLBB 2NS5A 3H8HA
chains in the Genus database with same CATH topology
3B9JA 4ZRQA 3BIID 1T5XD 2WDVB 1TS3A 3W5VB 1YMHE 4YSXB 5G5GA 4KGSA 3U2SC 4GDLB 1EU4A 2PIAA 1I4XA 1ET6A 2Q5WD 1ZP0B 1E6EB 2DLBA 4ZOHC 2N0SB 1VZ7A 4C7ZA 3MP9A 5EE0A 2GRIA 3ZJTA 2PW9A 1TS5A 4YTNB 1AW7A 1DOXA 2K9XA 1F2RC 1YJIA 2IPKD 2IGHA 1DOIA 1HA5A 4KX6B 1QT9A 4RF0A 4HKZE 4AQ7A 4RH6A 1N5WA 1KF6B 2BYTA 1DOYA 5HI1A 3BYYB 5FKAC 1D5XC 1I4GA 1SE2A 4HRSA 3AEAB 3Q8CA 5JXVA 2IDYA 4IKGA 3FILA 1C77A 1VZ8A 1IBXB 3KLSX 1ACCA 1K53A 4LLGM 4ZYSA 4RF1A 3URYA 3V3XA 1XO3A 2YEPB 2R61A 4KKJA 1C76A 5H92C 1L6UA 3AEDB 2L32A 4Q2JA 5MPOA 1N63A 1OFFA 2G1EA 3Q8BA 3NZ3A 1XEEA 2QJLA 3U4EG 5HG2A 2BS2B 4UDUC 1WRIA 1FD6A 1PGXA 1F0ZA 3PO0A 3AECB 3V05A 5FK9C 4A6QA 5BYRA 4KGRA 1FFVA 3LXFA 1AN8A 2WLBA 3MHZA 3ZJUA 4YXDB 3TEXA 1V8CA 3AEBB 3R2IA 1SE4A 4RCOA 2PKOA 4RGOS 2G9HD 2W82A 2BS4B 1I7HA 3ETRA 2WXQA 3NRZA 1RWSA 1HZ5A 2NTSA 3VRBB 1FNUA 3WCQA 4OW0A 4LK0M 3RFZB 2MJDA 2RPVA 4MH8A 3SR6A 2Y3AA 4NJCA 1J7BA 3BVMA 4H2AA 2CJNA 2AQ3B 3BK1A 1N60A 3LYYA 1FO4A 4M0WA 1JWUD 3RPFC 2JXTA 1SF0A 1GB1A 1BXTA 4ARCA 2ON8A 1C4AA 4YTMB 3TEWA 1L0XB 2WXHA 1ZPSA 2QIEB 2E6XA 2INPE 2PVOD 4L1BA 2K3UA 4ARIA 2WXGA 3IAS1 3NVYA 3BVZA 2TSSA 1BUIC 1GOZA 2WXMA 5E6JA 2V0GA 4USAA 3TUOA 2M19A 3FILB 3E56A 1L0VB 2BS3B 3AE9B 2J52A 2SAKA 4YT0B 1RFKA 3VR9B 1CK1A 5C2TB 3W2DA 1YQ4B 1GB4A 1XLPA 3T3OA 1RYJA 3CIRB 3AEGB 2GI9A 1YNTE 3SFEB 3Q8EA 1UWXA 4A8XC 2BTEA 3P4PB 2FUG1 2ACZB 3AN1A 3UI3A 2WP9B 1HZ6A 1SXTA 3AE8B 3AE3B 3B2FA 3GP7A 1L4ZB 1N61A 1PGBA 2W54A 2JYTA 1XCTL 3N9YC 3P4SB 2JX5A 4DQOC 1UNSA 1I4QA 3NS1A 1V1PB 1E0ZA 1PDXA 1KFYB 2WXJA 1ZOYB 1C9FA 4HEA1 3W1SA 1P7EA 4P6VF 3MFGA 2WXRA 3NUHB 3KWVA 4WH4A 1ZDXA 4N59A 1YN5A 4ZHPA 1BMLC 2PTLA 2JZPA 2LHDA 2WS3B 1SJED 3Q69A 1R7SA 2DWQA 1GPXA 1N5XA 1FXIA 2LFIA 4GLSC 4KGTA 4DXGA 2LJIA 1QILA 1D5ZC 4RFBA 2WDRB 4XDDA 4N58A 1MPEA 5GXGB 2B76B 2SEBD 2W3RA 2LUMA 2ZW1A 1ZXHA 1TJEA 4TMAB 3AH7A 3O13A 3EGRA 1HXYD 3SFDB 4ZHOA 1K50A 3NVZA 1EWYC 1IGDA 2QILA 1QOAA 1SIJA 1MI0A 4RGTA 2BW2A 1ROEA 4P16A 2WXLA 1C4CA 2KMMA 2WXFA 1KH0A 1HEZE 1MHHE 3IXSA 2J42A 1KRHA 2WXIA 4WURA 4A9AA 1L4DB 3L4PA 4YWGG 4NZLB 2WQYB 4OVZA 2OHFA 2I38A 2BT6A 2KDMA 2DYMA 3AEFB 4PT5A 3U52E 4C80A 1T6BX 1KLGD 1TY2A 4HKQA 3DWMA 3KWLA 2WDQB 2ZW0A 1FCLA 4HJGE 2CU3A 3W9CB 5AUKA 3TEYA 3B2GA 1FNWA 1FXAA 1AWDA 1NYRA 5I4DA 1FFUA 1JQ4A 1JALA 1KLUD 4ZRPA 1GAQB 2M56B 4FXCA 2Z8LA 1TS2A 3AV8A 4JPSA 2M0AA 3ZGZA 2RDHA 2BB5A 1B1ZA 2KQ4X 3AM9A 3U7ZA 1TS4A 2DYOA 4EE2A 2PMVA 5FR3A 3VRAB 2ONQA 4AS1A 4A55A 4JWSC 2LHEA 4C56C 1I4RA 4MM3B 2K0PA 2K22A 4REZA 5BMGA 1STEA 2JU6X 1NVID 3AE7B 3NVWA 3TSSA 3R8BA 2WNMA 2MEKA 2J53A 3FC4A 1Q10A 4C7YA 1C78A 4OZCA 5BYQA 4OZAA 2FBWB 2INNE 2IGDA 1L5PA 1IBXA 1ZDVA 2PVGC 3MJ5A 5D3DA 2EELA 2RMMA 4O1NA 5AUIA 1QKZA 1QOBA 2MJ3A 5HFYA 2JYEA 1K51A 2W3SA 1CQVA 2KWDA 1SEBD 4OZBA 3SEBA 1XLOA 4CQNA 4XDCA 2AQ1B 2NMQA 1TY0A 1SSNA 2AQ2B 3I9V1 1T3QA 2FE8A 1SB3C 1EU3A 1SBBB 2L83A 5LNK1 3BYTB 1KTKA 1JWAD 1FMAD 3T3NA 1TYGB 5C3JB 1OQQA 3Q8FA 2KN4A 1JCKB 2V4IB 3TEZA 1PGAA 3HUIA 2HDEA 2YEPF 3GS2A 1D6EC 3BZDB 4WIPA 4DXFA 1IUEA 1TZOA 2H88B 1LO5D 3PZ7A 1ZUD2 1E10A 1RM6C 4TSSA 3AMZA 1FEHA 1JWSD 1ET9A 2BBCA 1PUTA 3P4RB 5HHDG 4TQ0A 1JRPA 3HVDA 4NAWB 1FRDA 1QOFA 5D7GA 1EM7A 1WYGA 2QMTA 2V3NA 1J7CA 1DYQA 3NVVA 3AE4B 1OQRA 2JQRB 2VZKD 3P4QB 4MACA 4IOIE 2V3PA 1VJKA 1WGKA 2PLPA 3ZYYX 1FIQA 1VR9A 1N62A 2W55A 2KAJA 2JWUA 3EA6A 4LTUA 1V1PA 4WAFA 1XF5L 4YSYB 2OEDA 1CZPA 1ZE3D 4OHJA 3ZJVA 5D3IB 1VLBA 2IJ0A 1HQRD 3I57A 4R3DA 1XCQL 1SE3A 3BK2A 3VQIA 2XN9C 1JWBD 1Y56A 1TKGA 2N9LA 2E3TA 1FRRA 5G5HA 4D2KA 1JWMD 1K52A 2D5GA 2WXPA 3E9SA 3AE2B 2Y5CA 2HTME 2MJEA 1E9MA 2N7JA 1NYQA 2XNAC 2Y5PA 4L2YA 5EE9A 4A90A 4XWTA 3EUB2 5BMHA 1ENFA 5BYSA 1YN4A 3AEEB 2LEKA 1A70A 4RGMA 1YN3A 4L23A 1CJEA 4B0MA 1TKYA 3HVZA 1FNVA 1UWMA 4B0EA 4YTPB 1F77A 3J9CA 1V97A 2WXOA 2BB6A 1QQRA 1I4PA 4US8A 1TKEA 3AE5B 1F2RI 4KKIA 3ABVB 2L1AA 3P1MA 1UGJA 2I2YA 1JMLA 1C79A 1P7FA 1EWCA 4MT5A 3W5UB 4JWUC 1YQ3B 2K5PA 2H89B 1VRAB 2J4XA 3KQ4A 2DBYA 1M4VA 4WWMA 2WXNA 5H8YE 1DGJA 1UUPA 2L52A 2MH7A 4JX1C 4IDIA 3VR8B 4HROA 1QOGA 2IGGA 3PZ8A 3CWIA 1VZ6A 2JSVX 1J7AA 5EE1A 5EE3A 2RDGA 3BWUD 2QEJC 1XXGA 4ITKA 3BVGA 1VDVA 2WXKA 1B9RA 1C4PA 1IGCA 4NAMA 5BMIA 1ZXIA 2KACA 3C8YA 1FCCC 3P63A 4YSZB 1L6VA 3DWGC 1FM0D 4RNAA 3IT4B 3HRDD 1ESFA 4US9A 1XLNA 4N6EB 1NENB 3FAHA 1MHXA 2N9KA 2AX5A 1NI3A 1V1OA 4XWWA 2WU2B 2LGIA 1D5MC 3P42A 1D4BA 1WWTA 1QF6A 4RGNA 2GB1A 1AYFA 3AE6B 5T8IA 3LB8C 1PYWD 1JROA 2CJOA 2VZKB 4XE0A 5TSSA 4JE3B 1XLQA 2NTTA 1L0YB 1PFDA 1WXQA 3AE1B 1MVKA 2X38A 3GB1A 4WQMA 3R2TA 2EKIA 1SJHD 1WSPA 4TQ1A 1YJJA 3OWEB 3AB5A 1E7PB 1JW9D 3IT6B 3MC0B 2QSDA 3IAM1 2LMCA 4GDKB 1I4HA 1QLBB 2WU5B 1NEKB 3ZQ4A 3H8HA 4J3OD 3Q8AA 2ICIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FFU A;  1TKG A;  3B9J A;  4YTM B;  1JAL A;  2E3T A;  5G5H A;  1FRR A;  3BII D;  2WDV B;  1GAQ B;  2M56 B;  2QIE B;  2PVO D;  3W5V B;  4FXC A;  4YSX B;  3AV8 A;  5G5G A;  3AE2 B;  2Y5C A;  3NVY A;  2HTM E;  2MJE A;  1E9M A;  1NYQ A;  5EE9 A;  2PIA A;  2Q5W D;  3EUB 2;  4USA A;  2M19 A;  3AM9 A;  1ZP0 B;  1E6E B;  1L0V B;  2BS3 B;  4ZOH C;  3AE9 B;  2N0S B;  3AEE B;  4C7Z A;  2LEK A;  4YT0 B;  1A70 A;  1RFK A;  3VRA B;  1CJE A;  3VR9 B;  4JWS C;  5EE0 A;  5C2T B;  1YQ4 B;  4YTN B;  1XLP A;  2K22 A;  1TKY A;  1RYJ A;  1DOX A;  2K9X A;  3CIR B;  1NVI D;  1YJI A;  3AE7 B;  3AEG B;  3HVZ A;  3NVW A;  3SFE B;  1DOI A;  1UWM A;  4KX6 B;  1QT9 A;  3FC4 A;  4YTP B;  4C7Y A;  3P4P B;  2FBW B;  2ACZ B;  1V97 A;  3AN1 A;  1N5W A;  1L5P A;  1KF6 B;  2WP9 B;  3AE8 B;  2PVG C;  4US8 A;  3AE3 B;  3B2F A;  1DOY A;  1N61 A;  1TKE A;  2W54 A;  3AE5 B;  1QOB A;  5AUI A;  2MJ3 A;  2JX5 A;  3ABV B;  3P1M A;  3P4S B;  4HRS A;  3AEA B;  3W5U B;  4JWU C;  1YQ3 B;  2K5P A;  2H89 B;  3NS1 A;  2W3S A;  1E0Z A;  1PDX A;  1KFY B;  1XLO A;  1ZOY B;  4WWM A;  2DBY A;  5H8Y E;  1DGJ A;  2MH7 A;  2L52 A;  4JX1 C;  1T3Q A;  4IDI A;  3VR8 B;  4HRO A;  4P6V F;  1SB3 C;  2L83 A;  1XO3 A;  1JQ4 A;  1QOG A;  4N59 A;  4ZHP A;  5H92 C;  1L6U A;  3CWI A;  5EE1 A;  1J7A A;  1JWA D;  1FMA D;  3AED B;  5EE3 A;  1TYG B;  4ITK A;  5C3J B;  1VDV A;  1N63 A;  2WS3 B;  5MPO A;  1OQQ A;  1B9R A;  1R7S A;  1OFF A;  2G1E A;  2DWQ A;  1ZXI A;  3HUI A;  1GPX A;  3P63 A;  4YSZ B;  1N5X A;  1FXI A;  1L6V A;  3DWG C;  2QJL A;  1FM0 D;  2BS2 B;  1IUE A;  2H88 B;  3HRD D;  1WRI A;  4US9 A;  1ZUD 2;  1E10 A;  1XLN A;  1RM6 C;  2WDR B;  3AMZ A;  1NEN B;  3AEC B;  3FAH A;  3PO0 A;  4N6E B;  2B76 B;  4N58 A;  2W3R A;  5GXG B;  2AX5 A;  1NI3 A;  1FFV A;  1PUT A;  3P4R B;  3LXF A;  1TJE A;  1JRP A;  2WU2 B;  2WLB A;  4YXD B;  3AH7 A;  1FRD A;  1WWT A;  1V8C A;  1QOF A;  3AEB B;  3SFD B;  4ZHO A;  1QF6 A;  3NVZ A;  1WYG A;  2PKO A;  1EWY C;  1AYF A;  3AE6 B;  1QOA A;  1SIJ A;  1F0Z A;  3LB8 C;  1J7C A;  3NVV A;  1JRO A;  2BS4 B;  1OQR A;  2CJO A;  3AE4 B;  1ROE A;  2JQR B;  1I7H A;  3ETR A;  1XLQ A;  2KMM A;  3P4Q B;  3NRZ A;  1RWS A;  3VRB B;  1VJK A;  3WCQ A;  1PFD A;  1WGK A;  1WXQ A;  1KRH A;  3AE1 B;  4A9A A;  3ZYY X;  1FIQ A;  3L4P A;  4WQM A;  2MJD A;  2W55 A;  1N62 A;  3SR6 A;  2KAJ A;  2EKI A;  4LTU A;  1J7B A;  2WQY B;  1YJJ A;  4YSY B;  3AB5 A;  1E7P B;  1JW9 D;  1CZP A;  2BT6 A;  2OHF A;  3AEF B;  2CJN A;  1VLB A;  1N60 A;  4C80 A;  1FO4 A;  3DWM A;  3KWL A;  1QLB B;  2WDQ B;  2WU5 B;  3RPF C;  2CU3 A;  1NEK B;  3W9C B;  5AUK A;  1SF0 A;  1JWB D;  3B2G A;  1FXA A;  1AWD A;  1NYR A; 
#chains in the Genus database with same CATH topology
 3HIZ A;  1WFY A;  2IO0 B;  5G5G A;  3ZIM A;  3PRZ A;  2MWS B;  4GDL B;  4RMA A;  1EU4 A;  2DYB A;  4A20 A;  4ZOH C;  3RD2 A;  1VZ7 A;  5EE0 A;  2GRI A;  4CO7 A;  5AEK B;  2KHW B;  1J0G A;  2KVR A;  1DOI A;  1YX5 B;  4KX6 B;  1WXA A;  2NCN A;  4AQ7 A;  4RH6 A;  1KF6 B;  1P98 A;  5BO4 B;  3R7Q A;  2BYT A;  1GUA B;  5HI1 A;  2MX2 A;  2UU7 A;  5FKA C;  4G11 A;  1D5X C;  3Q8C A;  3B1L X;  2AL3 A;  3CSF A;  4KDI C;  1ACC A;  1E5W A;  4LLG M;  4E71 A;  3V3X A;  1XO3 A;  2YEP B;  4KVG B;  3NJT A;  3PV1 A;  3DBL I;  4LJO B;  2L32 A;  3ZO5 B;  5MPO A;  1N63 A;  1OGW A;  1Z2M A;  2BF8 B;  3NZ3 A;  2D07 B;  2BVC A;  3EC8 A;  2K8H A;  1F0Z A;  1LFD A;  3PO0 A;  3V05 A;  2JT4 B;  5BYR A;  4KGR A;  1FFV A;  2XEW A;  3TEX A;  4M01 A;  1R4N I;  2D2Q A;  3AEB B;  3R2I A;  3DBL B;  4RCO A;  2PKO A;  4RGO S;  2VRR B;  2BS4 B;  3ETR A;  3NRZ A;  1HZ5 A;  3N1X C;  2BYV E;  3VRB B;  1FNU A;  4ZYN A;  4NNJ B;  4XYC A;  3UGB B;  2IO3 B;  2JXX A;  2RPV A;  4MH8 A;  4W9D A;  1J7B A;  2CJN A;  4ZRJ A;  2AQ3 B;  3EHV A;  4M0W A;  1JWU D;  2JXT A;  1RRB A;  1T0Q C;  1SF0 A;  4KSK C;  2ON8 A;  4YTM B;  3TEW A;  2PVO D;  4BFR A;  4L1B A;  4W9L A;  1WJ6 A;  4IWO A;  2TSS A;  2WXM A;  2JF5 A;  3TUO A;  3E56 A;  1L0V B;  2J52 A;  4HDQ A;  2M0X A;  3A9J A;  3A33 B;  3Q8E A;  3ZDT A;  4MGI E;  2K6Q A;  3UI3 A;  1SXT A;  1Q5W B;  1PGB A;  3GZN B;  2FCM A;  3Q3N C;  3ZNI D;  1UNS A;  2L7R A;  1I4Q A;  1V5O A;  4DXA B;  5J2R A;  1V1P B;  4HJK A;  4M0W B;  3K9O B;  1V6E A;  3I5J C;  1ISN A;  1P7E A;  4P6V F;  3VTU A;  3ZW3 A;  3NUH B;  5HKH A;  4WH4 A;  4WJP A;  1WYW B;  1ZDX A;  3CMM B;  4ZHP A;  3H7S A;  5JH5 C;  3DVN V;  2K1F A;  2KJ6 A;  1FXI A;  4GN1 A;  3A9K A;  4FHJ A;  4KGT A;  2JZZ A;  3ZXR A;  1MG8 A;  5GXG B;  4N58 A;  3SU8 X;  2B76 B;  2W3R A;  4M8N A;  2ZW1 A;  1ZXH A;  4HVB A;  2DZJ A;  4MM3 A;  1HXY D;  2DAJ A;  4WQO B;  2KYW A;  2KLG A;  2IY1 B;  1VCB A;  1ROE A;  3RCZ A;  1C4C A;  3AUL A;  3IXS A;  3JVZ X;  3PS6 A;  5IO9 A;  2FID A;  3L4P A;  3SHQ A;  3L16 A;  2KDM A;  2DYM A;  4PT5 A;  1T6B X;  3DWM A;  3KWL A;  4WAA A;  2ZW0 A;  4HJG E;  3TEY A;  3B2G A;  1FXA A;  4DHJ D;  1AWD A;  4KIK B;  2K6D B;  4KDL B;  1XD3 B;  2RDH A;  1H8C A;  3RUL A;  4J6I A;  2IBI B;  3GE3 C;  2KLC A;  3VRA B;  4JWS C;  5CX3 A;  4WJO A;  2WYQ A;  1STE A;  2EKE C;  2JU6 X;  3NVW A;  3TSS A;  1P3Q U;  3TJP A;  2LJ5 A;  2MEK A;  4C7Y A;  1V86 A;  5BYQ A;  1OEY J;  2LZ6 A;  4W9I A;  1ZDV A;  2PVG C;  2JUO A;  5D3D A;  2EEL A;  2VH1 A;  2MJ3 A;  1V9J A;  2J0J A;  4BOS C;  3ZNH B;  2QCZ A;  2NMQ A;  1SSN A;  2AQ2 B;  1RAX A;  4LCD E;  2KFK A;  4P1C C;  1SB3 C;  1EU3 A;  5LNK 1;  3OG5 A;  2LVO A;  3UQA A;  3N1Y C;  5CHF A;  2V4I B;  1EF1 A;  3Q3O C;  2L8J A;  4JIO U;  1D6E C;  3BZD B;  3TCA A;  2KD0 A;  3QX1 A;  2H88 B;  1FXT B;  1E10 A;  1YJ1 A;  1RM6 C;  1JWS D;  3WAO A;  4TQ0 A;  4HCP B;  4NAW B;  2G3Q B;  4BKS A;  2CHW A;  2N1V A;  3AE4 B;  2IZV B;  2KDF B;  3O65 B;  3P4Q B;  1WM2 A;  4LNF A;  3DDC B;  3I63 C;  1E8X A;  2LGX A;  4WAF A;  4YSY B;  2PEA A;  3DBR I;  2WDT B;  1XCQ L;  1SE3 A;  2KQS A;  3VQI A;  2XN9 C;  1WGR A;  5LXH A;  2GLS A;  3EFU A;  1TKG A;  2N9P C;  5G5H A;  4XX5 A;  5CTR C;  2WXP A;  3HHM A;  1E9M A;  2N7J A;  3DVG X;  2NPT A;  3L0W B;  4AWJ A;  4NQK E;  3KYD D;  2MP2 A;  2HTH A;  5BYS A;  3AEE B;  3ENE A;  4NPN A;  5CHW A;  1TZ1 A;  4GU2 A;  1EUV B;  1V97 A;  2WXO A;  3VTW A;  1QQR A;  1I4P A;  1F2R I;  2KMA A;  3ABV B;  2L1A A;  3RMK C;  1P7F A;  1C79 A;  2FUH B;  4ANU A;  3W5U B;  2H89 B;  2J0M A;  1VRA B;  1E7U A;  3VVW B;  3KQ4 A;  1M4V A;  2ZPY A;  4K81 A;  2KDE B;  2CR5 A;  4MEL A;  2JPH A;  1F9J A;  4E74 A;  3JW0 X;  1XXG A;  1WR1 A;  3BVG A;  3DCG A;  4F7Z A;  4NAM A;  2IYD B;  1V2Y A;  1ZXI A;  2KAC A;  4DWF A;  3KH0 A;  2KT7 A;  2MBO A;  2KOX A;  2J0K A;  4RNA A;  1IYF A;  2DX5 B;  2N9K A;  3V62 A;  2AX5 A;  3PPA A;  4XWW A;  3VH3 B;  2LGI A;  3P42 A;  3LDZ E;  1WWT A;  2NVU I;  2G45 B;  2GB1 A;  3AE6 B;  3QK0 A;  1JRO A;  5TSS A;  3V61 A;  2O2V B;  1XLQ A;  2KJH B;  3WAP A;  2NTT A;  1L0Y B;  3AE1 B;  2C7M B;  2X38 A;  1WY8 A;  1WM3 A;  4GXB A;  2MBH A;  1FPY A;  2LXA A;  3OJ3 A;  1UBQ A;  2LMC A;  3P2B A;  4LDT B;  4J3O D;  4FN2 A;  2O6V D;  2KZR A;  2I1J A;  2WDV B;  4W9K A;  3U2S C;  1UF0 A;  1CMX B;  1E6E B;  3ZUN A;  4CYE A;  4C7Z A;  2C9W B;  3WAN A;  3MP9 A;  3B08 A;  2C7N B;  1QT9 A;  4IWP A;  3U8Z A;  2BYE A;  4KV2 A;  4GDK A;  1RFA A;  2V4L A;  4HRS A;  3AEA B;  5JXV A;  1WI0 A;  4EZJ A;  5FR6 A;  1YIW A;  1NDD A;  1C77 A;  3KLS X;  3VAW A;  2REX A;  4ZYS A;  4MGZ E;  2BWE S;  1C76 A;  2LVQ A;  4LNO A;  3H1U A;  1OFF A;  4DBG A;  3Q8B A;  3JYU A;  2MBQ A;  1XEE A;  3U4E G;  4HLE A;  4MSM B;  1WGH A;  2N7E A;  4UDU C;  1WH3 A;  4A6Q A;  5C23 A;  3LXF A;  1ZKH A;  1AN8 A;  3QIJ A;  4OVU A;  2L3Z A;  2W82 A;  1I7H A;  1LXD A;  2WXQ A;  2FCQ A;  2LAS A;  5IKC M;  2FNJ B;  4LK0 M;  3AI5 A;  4NJC A;  4H2A A;  4XGA B;  2LD9 A;  2C60 A;  4HWI B;  4MH0 E;  1ZPS A;  4YL8 A;  5L95 C;  4IG7 B;  2WXG A;  3IAS 1;  1BUI C;  4HXD A;  5E6J A;  4YT0 B;  1V5T A;  3CF6 E;  3TBL D;  3W2D A;  2LGD A;  1XLP A;  3CIR B;  3SFE B;  2MRP A;  2BTE A;  3P4P B;  2WP9 B;  1HZ6 A;  3R66 C;  2D3G A;  1N61 A;  1XCT L;  2MQJ A;  4GMV A;  2OJR A;  2XBB C;  5J17 A;  1WRD B;  3NOB A;  3V6E B;  2DEN B;  4DHZ B;  2AEH A;  1XQQ A;  4W9C A;  3ZKJ C;  2ZPN A;  3W1S A;  4K3B A;  1YN5 A;  1X1M A;  3ZDM C;  4F8C B;  1GPX A;  1U4A A;  1SGH A;  2LJI A;  1QIL A;  4XDD A;  2SEB D;  2KNB A;  2LUM A;  2NBW B;  4TMA B;  3A4S C;  3AH7 A;  3EGR A;  3NVZ A;  1EWY C;  2QIL A;  3BY4 B;  1SIJ A;  1D3Z A;  3OJ4 B;  4P16 A;  3QQ8 B;  2WXL A;  2A4Z A;  4EZL A;  2KMM A;  3PRP B;  1I35 A;  3NZU A;  2ZNV B;  1MHH E;  2W9N A;  4B6W A;  2GBK A;  1KRH A;  2MLB A;  4ICU A;  4A9A A;  4FJV B;  2FIF A;  3DBH B;  3SD5 A;  4YWG G;  2QHO A;  4I6L B;  4GSW A;  5DPS A;  2JZ3 B;  4C80 A;  1KLG D;  1FCL A;  3W9C B;  3QJZ A;  5I4D A;  3Q2A C;  3TMP B;  2M56 B;  4FXC A;  2ASQ A;  4JPS A;  2GOW A;  2M0A A;  2KQ4 X;  1TS4 A;  4EE2 A;  2CHX A;  2PMV A;  3VXW A;  4PK1 A;  1HTQ A;  1WZ3 A;  4C56 C;  1I4R A;  4M02 A;  4DHZ E;  4QAY A;  4REZ A;  5BMG A;  3AE7 B;  1WJN A;  3FKY A;  2J53 A;  1Q10 A;  2KTR A;  4TUU A;  4NY0 A;  4BKT A;  1L5P A;  2O6V A;  1QKZ A;  1QOB A;  2KTF A;  1KLV A;  2R2Q A;  3UIN B;  3VFK A;  5HFY A;  1YQB A;  3JSV A;  3APC A;  2C7H A;  2W3S A;  3QAQ A;  1SEB D;  2FCS A;  4OZB A;  1XLO A;  4CQN A;  4XDC A;  1WMH B;  2MSE D;  3PRM B;  3EFC A;  1XT9 B;  1KOT A;  2KAN A;  2L83 A;  1WXM A;  1KTK A;  2KXJ A;  1OQQ A;  2V1Y A;  3HUI A;  3OLM D;  4W9H A;  2HDE A;  5AZF A;  1WJ4 A;  1G6J A;  1TZO A;  3U7D A;  3N20 C;  4G3X B;  3AMZ A;  1ET9 A;  2N9E B;  3P4R B;  4FBJ B;  3HVD A;  2ZCC A;  1QOF A;  2A5U A;  5D7G A;  1EM7 A;  1WE7 A;  2QMT A;  3NG0 A;  2V3N A;  1J7C A;  3RI7 C;  1OQR A;  1GJZ A;  2CHZ A;  5IN7 A;  2HE7 A;  1WGK A;  3ZYY X;  4LNK A;  1VR9 A;  2W55 A;  3WIM A;  4BOZ B;  2JWU A;  4LTU A;  3UQB A;  2OED A;  1ZE3 D;  5IOI A;  3H6N A;  1HQR D;  4R3D A;  1EO6 A;  3RYT A;  3KYC D;  1SIF A;  2XK5 A;  1Y56 A;  5JHB A;  4MGY E;  2N9L A;  5LXI B;  4P1B C;  2BGF A;  3QAR A;  2D5G A;  3AE2 B;  2Y5C A;  2HTM E;  4L2Y A;  4XWT A;  3EUB 2;  4AOF A;  2LEK A;  4RGM A;  3U30 A;  1F77 A;  3J9C A;  3KUD B;  2ZVO A;  2BB6 A;  5C1Z A;  4ANX A;  4M8M A;  1UGJ A;  2PE6 B;  3DBH I;  3S2A A;  2DAF A;  4PS7 A;  2J4X A;  4WWM A;  1Y8R C;  1DGJ A;  4JX1 C;  4IDI A;  4HRO A;  4ANW A;  2IGG A;  3MHS D;  4G0N B;  3BWU D;  3ECI A;  1Z5S B;  3M62 B;  2WXK A;  1C4P A;  3PSE B;  4N9F 4;  1L6V A;  3DWG C;  2UWQ A;  2J7Q B;  1OTR B;  4N6E B;  1NEN B;  2M8S A;  4FLH A;  1P9D U;  3UIO B;  1D5M C;  4MSQ B;  3W1Y A;  4RGN A;  1AYF A;  5T8I A;  1WX7 A;  3T8M A;  2ZZP B;  1OEY A;  4HPM B;  5KHQ A;  2DZI A;  1WXQ A;  4WQM A;  3R2T A;  1SJH D;  4FA6 A;  4TQ1 A;  3L08 A;  1E7P B;  4GDK B;  2WU5 B;  2ZEQ A;  2ICI A;  2K8C A;  4P7I A;  1WGY A;  2EMT A;  1TS3 A;  3DHH C;  3WAM A;  4HCN B;  2PIA A;  1I4X A;  1ET6 A;  1Q1O A;  2Q5W D;  2Z59 B;  1ZP0 B;  4W9F A;  2NBV B;  2N0S B;  4II2 B;  3ZJT A;  2PW9 A;  3PRE A;  1AW7 A;  1DOX A;  1F2R C;  2IPK D;  4LDT D;  1HA5 A;  3ML9 A;  3RUI B;  3RNF C;  4ASW C;  5JZE B;  4RF0 A;  3RNE C;  4II3 B;  4URK A;  2MBB B;  1DOY A;  1WX9 A;  1R4M I;  1K8R B;  4EZK A;  3V6C B;  1WMH A;  1I4G A;  4MGK E;  4EFO A;  4GGQ A;  2IO1 B;  4A3P A;  4IKG A;  3FIL A;  3JSV B;  4K7U A;  5IP4 D;  4FJZ A;  5GMV A;  2IY0 B;  3URY A;  4KKJ A;  2R61 A;  4ICV A;  5H92 C;  3RNC C;  2D3C A;  2KTR B;  4BZA A;  4BVU C;  4Q2J A;  2JRI B;  3KVF B;  1WR6 E;  1VD2 A;  1HTO A;  2QJL A;  2G4S A;  4TKN A;  2BS2 B;  1H4R A;  1WRI A;  1FD6 A;  1PGX A;  3AEC B;  2RDB C;  4JQW C;  2DZM A;  3APF A;  3MHZ A;  3ZXV A;  1V8C A;  2JRH A;  1SE4 A;  3VUY A;  3DVG Y;  4KZ0 A;  2LVP A;  4WJN A;  2PPH A;  2GBJ A;  2G4D B;  1RWS A;  2MJD A;  3L10 B;  3BK1 A;  1N60 A;  3VUX A;  1FO4 A;  3RPF C;  4WWO A;  2KC1 A;  1LM8 B;  2LGS A;  2FCN A;  1C4A A;  1L0X B;  2M1M A;  4I6N B;  2E6X A;  2INP E;  2K3U A;  2KFJ A;  1TGZ B;  2M19 A;  3HK0 A;  3X23 A;  2GBN A;  2SAK A;  1UBI A;  3K9P B;  4IW0 A;  1RFK A;  3VUW A;  3VR9 B;  4AJY B;  3PHW B;  5LLI A;  3T3O A;  1RYJ A;  3AEG B;  1YNT E;  1UWX A;  4A8X C;  2FUG 1;  4C00 A;  4BKG A;  2VH2 A;  3AE3 B;  3B2F A;  3GP7 A;  3NY5 A;  4DQO C;  2WX0 A;  3AU4 A;  1E0Z A;  1KFY B;  1ZOY B;  3WA0 A;  4HEA 1;  2KMC A;  1F1H A;  3MFG A;  2WXR A;  3A1Q B;  4N59 A;  4M00 A;  1BML C;  2PTL A;  2JZP A;  4X57 B;  2LHD A;  2KWU B;  3PVL A;  4NAW A;  2MHJ A;  3R3M A;  1N5X A;  2KWV B;  3QC8 B;  2LFI A;  4GLS C;  2MBE A;  3IHP C;  4DXG A;  3KW5 B;  1D5Z C;  1MPE A;  1TJE A;  3VDZ A;  1L7Y A;  2LRW A;  3SFD B;  1K50 A;  3N32 A;  1QOA A;  1MI0 A;  5D94 A;  4RGT A;  1HEZ E;  3PLU A;  2WXI A;  2Y5B B;  3RN9 C;  4OVZ A;  4AUQ C;  4PYZ A;  2OHF A;  3APD A;  2I38 A;  2BT6 A;  4PS8 A;  2GBM A;  5D2M B;  4HKQ A;  3U52 E;  5DCN A;  5AUK A;  1FNW A;  2KC2 A;  1FFU A;  5E6P A;  4RM9 A;  1C1Y B;  1GAQ B;  3VTV A;  2Z8L A;  1TS2 A;  2JY6 A;  2BB5 A;  3AM9 A;  4AS1 A;  4A55 A;  3VHT C;  2KKC A;  1L2N A;  2K0P A;  2K22 A;  2CKH B;  1NVI D;  2AL6 A;  3R8B A;  2WNM A;  3M3J A;  2KQ7 A;  4OZC A;  3ZVV A;  2IGD A;  2RR9 A;  1IBX A;  2RD0 A;  2RMM A;  5AUI A;  2L0F A;  4IUM B;  2GMI C;  2KK8 A;  2KWD A;  1TBE A;  3SEB A;  2AQ1 B;  1V80 A;  5DPR A;  1TY0 A;  3KUZ A;  3DQV A;  2KWC A;  1OQY A;  3UF8 A;  3ONS A;  2EMS A;  4OVV A;  1SE9 A;  3DBS A;  2MA9 B;  1FMA D;  4FAD A;  1WE6 A;  3RZW C;  2KN4 A;  1JCK B;  3DHI C;  3MJW A;  1PGA A;  2WHI A;  2OOB B;  3DOW A;  2YEP F;  3GE8 C;  3GS2 A;  4S0R A;  2N1W A;  4E3C A;  1IUE A;  1LO5 D;  1ZW7 A;  1ZUD 2;  3A9K B;  2BBC A;  4S17 A;  1JRP A;  1WYG A;  1LQB A;  3TIX A;  4HPL B;  2WGS A;  2JQR B;  3NS8 A;  4EKU A;  4IOI E;  2V3P A;  2PLP A;  1FIQ A;  4BBN C;  1N62 A;  2BQQ A;  3EA6 A;  1V1P A;  1XF5 L;  2OJW A;  1CZP A;  4OHJ A;  5D3I B;  1VLB A;  4KSL C;  3I57 A;  3RZF A;  2HJ8 A;  3BK2 A;  1RLF A;  2N7D A;  3DVN U;  2E3T A;  4DDI D;  1P0R A;  3E9S A;  4GIV A;  1UD7 A;  2MJE A;  2XNA C;  4WWN A;  4A90 A;  5DPT A;  3ZRF A;  4W9G A;  1YN4 A;  3PZD A;  1A70 A;  4L23 A;  4B0M A;  1YX6 B;  1WZ0 A;  3DBR B;  4W9E A;  4DK5 A;  3HVZ A;  1WX8 A;  4YTP B;  1NBF C;  2K25 A;  3AE5 B;  3P1M A;  2I2Y A;  1EWC A;  4JWU C;  2K5P A;  2NBU A;  2XK5 B;  4GOC A;  1V49 A;  5DPW A;  1J19 A;  4I6P A;  2WXN A;  3B0A A;  5H8Y E;  3VH4 B;  1UUP A;  2L52 A;  1S1Q B;  1QOG A;  3PZ8 A;  3CWI A;  1J7A A;  5EE3 A;  2L05 A;  1P1A A;  2QEJ C;  5KHO A;  2YLM A;  4ITK A;  1VDV A;  1B9R A;  3NHE B;  1IGC A;  2MCN B;  3C8Y A;  1FCC C;  4YSZ B;  3UIP B;  1KJT A;  3IBE A;  2Z0D B;  3QHT A;  3Q3F A;  4C4V A;  1M94 A;  3IT4 B;  3HRD D;  4K3C A;  1ESF A;  4KZC A;  2L00 B;  3Q3M C;  1MHX A;  1V1O A;  1QF6 A;  1WGD A;  3BIN A;  1KM7 A;  3LB8 C;  2PJH A;  1PYW D;  3RNA C;  2VZK B;  4XE0 A;  3M95 A;  4JE3 B;  1LGR A;  4ANV A;  1R4M B;  1PFD A;  2KX3 A;  1MVK A;  3GB1 A;  2HJ1 A;  2EKI A;  4NJ6 A;  1WSP A;  2IND C;  1IP9 A;  1YJJ A;  3DPD A;  1JW9 D;  3IT6 B;  3HM6 X;  3MC0 B;  2QSD A;  3IAM 1;  1NEK B;  3ZQ4 A;  3IVF A;  4MJS B;  3Q8A A;  2BKF A;  3B9J A;  3A1Q A;  4ZRQ A;  3BII D;  1T5X D;  4DDG D;  3W5V B;  1YMH E;  4YSX B;  4KGS A;  2O2V A;  2DLB A;  2K8B A;  4IM2 A;  2V3S A;  1BT0 A;  4B95 A;  1TS5 A;  4YTN B;  2K9X A;  3ALB A;  3MC8 A;  1YJI A;  2DHZ A;  2IGH A;  2LGY A;  4HKZ E;  1N5W A;  2R2O A;  4W9J A;  4ACF A;  2YVC A;  3BYY B;  3Q14 C;  1QZE A;  1SE2 A;  2KJR A;  4B9K A;  2IDY A;  1VZ8 A;  1WF9 A;  1IBX B;  3SDL C;  1YOV B;  4NQL B;  1K53 A;  2KVZ A;  3L54 A;  2ZJD A;  4RF1 A;  2UYZ B;  1A5R A;  4LNI A;  1L6U A;  3AED B;  2PE9 A;  1WGG A;  2BKR B;  2D10 A;  3L13 A;  2G1E A;  2CS4 A;  5HG2 A;  5FK9 C;  2N9X A;  2WLB A;  3ZJU A;  4YXD B;  2GBR A;  3H9D A;  3PHX B;  5D6J B;  2AYO B;  4JL9 A;  2G9H D;  3N30 A;  2O6V B;  2MP2 B;  2K39 A;  2AWT A;  2NPT B;  3AXC A;  3ZTC A;  2NTS A;  3GZN I;  5AZH A;  3WCQ A;  3PLV A;  4OW0 A;  2M17 A;  2L76 A;  3RFZ B;  3SR6 A;  2Y3A A;  4TV3 A;  1J8C A;  3BVM A;  3LYY A;  5IAA C;  1UGM A;  4JGH B;  5AZG A;  1GB1 A;  1BXT A;  3H7P B;  4ARC A;  2ZNV C;  2WXH A;  3T9L A;  2QIE B;  4ARI A;  4PYU A;  3NVY A;  3BVZ A;  1GOZ A;  2V0G A;  4USA A;  3FIL B;  2BS3 B;  3AE9 B;  4MJS A;  4F1S A;  1UH6 A;  1MJD A;  1CK1 A;  5C2T B;  1GB4 A;  1YQ4 B;  4BAX A;  2DZK A;  2GI9 A;  1TT5 B;  1E8Z A;  4ZRK A;  2ACZ B;  3AN1 A;  2JWZ A;  1E90 A;  3RT3 B;  3AE8 B;  2DNF A;  1L4Z B;  2W54 A;  2JYT A;  3N9Y C;  3P4S B;  2JX5 A;  1C3T A;  3NS1 A;  1PDX A;  4LNN A;  2WXJ A;  1C9F A;  1R4N B;  2KFK B;  3KWV A;  1E8Y A;  4MEM A;  4C4V B;  4ZDV A;  2WS3 B;  1SJE D;  3HM3 A;  1R7S A;  3Q69 A;  5JHA A;  2DWQ A;  1WXS A;  2BYF A;  2WWZ A;  1GG3 A;  1Q0W B;  3Q6B A;  1ZGU B;  3TL5 A;  4RFB A;  2WDR B;  1PQS A;  2KDI A;  4IC7 B;  2LI5 A;  1WJU A;  3O13 A;  2LXC A;  1T0R C;  2KO3 A;  4EUT A;  4ZHO A;  5L83 A;  3ML8 A;  1IGD A;  4XC2 A;  4EEW A;  3PGE A;  2BW2 A;  2D3B A;  2V9H A;  2ZVN A;  3L17 A;  2WXF A;  3MTN B;  1KH0 A;  1GC7 A;  2B3A A;  1TTN A;  2J42 A;  4KIK A;  3C0R B;  4WUR A;  1L4D B;  4NZL B;  2WQY B;  4FJY A;  5CHV C;  3Q3J A;  3AEF B;  4RM8 A;  4A3O A;  4HDO A;  1TY2 A;  4NJ7 A;  2WDQ B;  2CU3 A;  1V81 A;  4AP4 C;  1NYR A;  5G2N A;  1JQ4 A;  1JAL A;  1KLU D;  4ZRP A;  1EF5 A;  3AV8 A;  3M63 B;  1WXV A;  1YD8 U;  3ZGZ A;  1B1Z A;  3U7Z A;  2DYO A;  4MDK E;  1MG4 A;  3GOE A;  5FR3 A;  2ONQ A;  2LHE A;  4MM3 B;  5TR5 A;  2QC8 A;  3FC4 A;  1C78 A;  4OZA A;  2FBW B;  1JRU A;  2INN E;  3A4R A;  3MJ5 A;  4O1N A;  2LWP A;  2L0T A;  1F52 A;  3IFW B;  2BWF A;  4XZ4 A;  2JYE A;  1K51 A;  2I1K A;  3ZLZ A;  1CQV A;  4K7W A;  4EOY A;  5E6O A;  3AU5 A;  3MC9 A;  4LJP B;  3W1S C;  3QWZ B;  3I9V 1;  1T3Q A;  3V60 A;  2FE8 A;  1SBB B;  2BPS A;  3CST A;  3BYT B;  1JWA D;  4DHJ B;  3T3N A;  1GNU A;  1TYG B;  3IG3 A;  5C3J B;  3Q8F A;  3RNB C;  5E6N A;  1NI2 A;  2IO2 B;  3TEZ A;  2LRU A;  3DHG C;  3D32 A;  4WIP A;  4DXF A;  1E7V A;  3PZ7 A;  3N1Z C;  4TSS A;  3WAL A;  1FEH A;  4AJW A;  3R7R A;  1PUT A;  5HHD G;  2INC C;  1FRD A;  3A9J B;  4IM0 A;  3NZS A;  1DYQ A;  3NVV A;  3ZTD A;  3ZNG C;  2VZK D;  3EEC A;  4MAC A;  2D3A A;  1VJK A;  2MW5 A;  2KAJ A;  1GC6 A;  3PT2 B;  3OAW A;  5IA7 A;  4CHK A;  3ZJV A;  2IJ0 A;  4K1R B;  4G50 A;  1JWB D;  2KDB A;  1FRR A;  2FAZ A;  2RGF A;  4D2K A;  1JWM D;  1K52 A;  2N4F A;  3KUC B;  1UZX B;  1NYQ A;  2Y5P A;  5EE9 A;  4JLC A;  1MFW A;  5BMH A;  1ENF A;  4HPP A;  1YN3 A;  1CJE A;  4WWP A;  1TKY A;  3QA8 A;  3ZRC A;  3RNG C;  1FNV A;  4FHK A;  1UWM A;  4B0E A;  2KN5 A;  3ZNZ B;  3LJ3 A;  3H7P A;  4US8 A;  1TKE A;  4KKI A;  1JML A;  1S3S G;  2JVC A;  4MT5 A;  1YQ3 B;  4WJQ A;  2Z0E B;  2QDF A;  4BBN F;  1E8W A;  3QCA A;  3X0W A;  2DBY A;  4BKS D;  2RSU A;  2MH7 A;  3VR8 B;  2X8X X;  1IPG A;  4FUL A;  2LUE A;  4ZRI A;  5G55 A;  5J18 A;  5EE1 A;  1VZ6 A;  2JSV X;  2C5L C;  1WIA A;  2RDG A;  3PTF C;  1I42 A;  5BMI A;  4GB9 A;  3P63 A;  3N3K B;  2RPQ A;  1FM0 D;  1T0S C;  1UEL A;  4US9 A;  2ZCB A;  1XLN A;  3FAH A;  4HK2 A;  3I3T B;  2M4N A;  3C19 A;  1NI3 A;  2WU2 B;  5EDS A;  1D4B A;  2CU1 A;  2HD5 B;  1HE8 A;  1N6Z A;  2CJO A;  4IM3 A;  1AAR A;  4GDL A;  4K7S A;  2NR2 A;  1T0Y A;  2D11 A;  2WX1 A;  2KX0 A;  3OWE B;  3AB5 A;  1TIF A;  4PS3 A;  1I4H A;  4IWQ A;  1QLB B;  2NS5 A;  3H8H A; 
#chains in the Genus database with same CATH homology
 3B9J A;  4ZRQ A;  3BII D;  1T5X D;  2WDV B;  1TS3 A;  3W5V B;  1YMH E;  4YSX B;  5G5G A;  4KGS A;  3U2S C;  4GDL B;  1EU4 A;  2PIA A;  1I4X A;  1ET6 A;  2Q5W D;  1ZP0 B;  1E6E B;  2DLB A;  4ZOH C;  2N0S B;  1VZ7 A;  4C7Z A;  3MP9 A;  5EE0 A;  2GRI A;  3ZJT A;  2PW9 A;  1TS5 A;  4YTN B;  1AW7 A;  1DOX A;  2K9X A;  1F2R C;  1YJI A;  2IPK D;  2IGH A;  1DOI A;  1HA5 A;  4KX6 B;  1QT9 A;  4RF0 A;  4HKZ E;  4AQ7 A;  4RH6 A;  1N5W A;  1KF6 B;  2BYT A;  1DOY A;  5HI1 A;  3BYY B;  5FKA C;  1D5X C;  1I4G A;  1SE2 A;  4HRS A;  3AEA B;  3Q8C A;  5JXV A;  2IDY A;  4IKG A;  3FIL A;  1C77 A;  1VZ8 A;  1IBX B;  3KLS X;  1ACC A;  1K53 A;  4LLG M;  4ZYS A;  4RF1 A;  3URY A;  3V3X A;  1XO3 A;  2YEP B;  2R61 A;  4KKJ A;  1C76 A;  5H92 C;  1L6U A;  3AED B;  2L32 A;  4Q2J A;  5MPO A;  1N63 A;  1OFF A;  2G1E A;  3Q8B A;  3NZ3 A;  1XEE A;  2QJL A;  3U4E G;  5HG2 A;  2BS2 B;  4UDU C;  1WRI A;  1FD6 A;  1PGX A;  1F0Z A;  3PO0 A;  3AEC B;  3V05 A;  5FK9 C;  4A6Q A;  5BYR A;  4KGR A;  1FFV A;  3LXF A;  1AN8 A;  2WLB A;  3MHZ A;  3ZJU A;  4YXD B;  3TEX A;  1V8C A;  3AEB B;  3R2I A;  1SE4 A;  4RCO A;  2PKO A;  4RGO S;  2G9H D;  2W82 A;  2BS4 B;  1I7H A;  3ETR A;  2WXQ A;  3NRZ A;  1RWS A;  1HZ5 A;  2NTS A;  3VRB B;  1FNU A;  3WCQ A;  4OW0 A;  4LK0 M;  3RFZ B;  2MJD A;  2RPV A;  4MH8 A;  3SR6 A;  2Y3A A;  4NJC A;  1J7B A;  3BVM A;  4H2A A;  2CJN A;  2AQ3 B;  3BK1 A;  1N60 A;  3LYY A;  1FO4 A;  4M0W A;  1JWU D;  3RPF C;  2JXT A;  1SF0 A;  1GB1 A;  1BXT A;  4ARC A;  2ON8 A;  1C4A A;  4YTM B;  3TEW A;  1L0X B;  2WXH A;  1ZPS A;  2QIE B;  2E6X A;  2INP E;  2PVO D;  4L1B A;  2K3U A;  4ARI A;  2WXG A;  3IAS 1;  3NVY A;  3BVZ A;  2TSS A;  1BUI C;  1GOZ A;  2WXM A;  5E6J A;  2V0G A;  4USA A;  3TUO A;  2M19 A;  3FIL B;  3E56 A;  1L0V B;  2BS3 B;  3AE9 B;  2J52 A;  2SAK A;  4YT0 B;  1RFK A;  3VR9 B;  1CK1 A;  5C2T B;  3W2D A;  1YQ4 B;  1GB4 A;  1XLP A;  3T3O A;  1RYJ A;  3CIR B;  3AEG B;  2GI9 A;  1YNT E;  3SFE B;  3Q8E A;  1UWX A;  4A8X C;  2BTE A;  3P4P B;  2FUG 1;  2ACZ B;  3AN1 A;  3UI3 A;  2WP9 B;  1HZ6 A;  1SXT A;  3AE8 B;  3AE3 B;  3B2F A;  3GP7 A;  1L4Z B;  1N61 A;  1PGB A;  2W54 A;  2JYT A;  1XCT L;  3N9Y C;  3P4S B;  2JX5 A;  4DQO C;  1UNS A;  1I4Q A;  3NS1 A;  1V1P B;  1E0Z A;  1PDX A;  1KFY B;  2WXJ A;  1ZOY B;  1C9F A;  4HEA 1;  3W1S A;  1P7E A;  4P6V F;  3MFG A;  2WXR A;  3NUH B;  3KWV A;  4WH4 A;  1ZDX A;  4N59 A;  1YN5 A;  4ZHP A;  1BML C;  2PTL A;  2JZP A;  2LHD A;  2WS3 B;  1SJE D;  3Q69 A;  1R7S A;  2DWQ A;  1GPX A;  1N5X A;  1FXI A;  2LFI A;  4GLS C;  4KGT A;  4DXG A;  2LJI A;  1QIL A;  1D5Z C;  4RFB A;  2WDR B;  4XDD A;  4N58 A;  1MPE A;  5GXG B;  2B76 B;  2SEB D;  2W3R A;  2LUM A;  2ZW1 A;  1ZXH A;  1TJE A;  4TMA B;  3AH7 A;  3O13 A;  3EGR A;  1HXY D;  3SFD B;  4ZHO A;  1K50 A;  3NVZ A;  1EWY C;  1IGD A;  2QIL A;  1QOA A;  1SIJ A;  1MI0 A;  4RGT A;  2BW2 A;  1ROE A;  4P16 A;  2WXL A;  1C4C A;  2KMM A;  2WXF A;  1KH0 A;  1HEZ E;  1MHH E;  3IXS A;  2J42 A;  1KRH A;  2WXI A;  4WUR A;  4A9A A;  1L4D B;  3L4P A;  4YWG G;  4NZL B;  2WQY B;  4OVZ A;  2OHF A;  2I38 A;  2BT6 A;  2KDM A;  2DYM A;  3AEF B;  4PT5 A;  3U52 E;  4C80 A;  1T6B X;  1KLG D;  1TY2 A;  4HKQ A;  3DWM A;  3KWL A;  2WDQ B;  2ZW0 A;  1FCL A;  4HJG E;  2CU3 A;  3W9C B;  5AUK A;  3TEY A;  3B2G A;  1FNW A;  1FXA A;  1AWD A;  1NYR A;  5I4D A;  1FFU A;  1JQ4 A;  1JAL A;  1KLU D;  4ZRP A;  1GAQ B;  2M56 B;  4FXC A;  2Z8L A;  1TS2 A;  3AV8 A;  4JPS A;  2M0A A;  3ZGZ A;  2RDH A;  2BB5 A;  1B1Z A;  2KQ4 X;  3AM9 A;  3U7Z A;  1TS4 A;  2DYO A;  4EE2 A;  2PMV A;  5FR3 A;  3VRA B;  2ONQ A;  4AS1 A;  4A55 A;  4JWS C;  2LHE A;  4C56 C;  1I4R A;  4MM3 B;  2K0P A;  2K22 A;  4REZ A;  5BMG A;  1STE A;  2JU6 X;  1NVI D;  3AE7 B;  3NVW A;  3TSS A;  3R8B A;  2WNM A;  2MEK A;  2J53 A;  3FC4 A;  1Q10 A;  4C7Y A;  1C78 A;  4OZC A;  5BYQ A;  4OZA A;  2FBW B;  2INN E;  2IGD A;  1L5P A;  1IBX A;  1ZDV A;  2PVG C;  3MJ5 A;  5D3D A;  2EEL A;  2RMM A;  4O1N A;  5AUI A;  1QKZ A;  1QOB A;  2MJ3 A;  5HFY A;  2JYE A;  1K51 A;  2W3S A;  1CQV A;  2KWD A;  1SEB D;  4OZB A;  3SEB A;  1XLO A;  4CQN A;  4XDC A;  2AQ1 B;  2NMQ A;  1TY0 A;  1SSN A;  2AQ2 B;  3I9V 1;  1T3Q A;  2FE8 A;  1SB3 C;  1EU3 A;  1SBB B;  2L83 A;  5LNK 1;  3BYT B;  1KTK A;  1JWA D;  1FMA D;  3T3N A;  1TYG B;  5C3J B;  1OQQ A;  3Q8F A;  2KN4 A;  1JCK B;  2V4I B;  3TEZ A;  1PGA A;  3HUI A;  2HDE A;  2YEP F;  3GS2 A;  1D6E C;  3BZD B;  4WIP A;  4DXF A;  1IUE A;  1TZO A;  2H88 B;  1LO5 D;  3PZ7 A;  1ZUD 2;  1E10 A;  1RM6 C;  4TSS A;  3AMZ A;  1FEH A;  1JWS D;  1ET9 A;  2BBC A;  1PUT A;  3P4R B;  5HHD G;  4TQ0 A;  1JRP A;  3HVD A;  4NAW B;  1FRD A;  1QOF A;  5D7G A;  1EM7 A;  1WYG A;  2QMT A;  2V3N A;  1J7C A;  1DYQ A;  3NVV A;  3AE4 B;  1OQR A;  2JQR B;  2VZK D;  3P4Q B;  4MAC A;  4IOI E;  2V3P A;  1VJK A;  1WGK A;  2PLP A;  3ZYY X;  1FIQ A;  1VR9 A;  1N62 A;  2W55 A;  2KAJ A;  2JWU A;  3EA6 A;  4LTU A;  1V1P A;  4WAF A;  1XF5 L;  4YSY B;  2OED A;  1CZP A;  1ZE3 D;  4OHJ A;  3ZJV A;  5D3I B;  1VLB A;  2IJ0 A;  1HQR D;  3I57 A;  4R3D A;  1XCQ L;  1SE3 A;  3BK2 A;  3VQI A;  2XN9 C;  1JWB D;  1Y56 A;  1TKG A;  2N9L A;  2E3T A;  1FRR A;  5G5H A;  4D2K A;  1JWM D;  1K52 A;  2D5G A;  2WXP A;  3E9S A;  3AE2 B;  2Y5C A;  2HTM E;  2MJE A;  1E9M A;  2N7J A;  1NYQ A;  2XNA C;  2Y5P A;  4L2Y A;  5EE9 A;  4A90 A;  4XWT A;  3EUB 2;  5BMH A;  1ENF A;  5BYS A;  1YN4 A;  3AEE B;  2LEK A;  1A70 A;  4RGM A;  1YN3 A;  4L23 A;  1CJE A;  4B0M A;  1TKY A;  3HVZ A;  1FNV A;  1UWM A;  4B0E A;  4YTP B;  1F77 A;  3J9C A;  1V97 A;  2WXO A;  2BB6 A;  1QQR A;  1I4P A;  4US8 A;  1TKE A;  3AE5 B;  1F2R I;  4KKI A;  3ABV B;  2L1A A;  3P1M A;  1UGJ A;  2I2Y A;  1JML A;  1C79 A;  1P7F A;  1EWC A;  4MT5 A;  3W5U B;  4JWU C;  1YQ3 B;  2K5P A;  2H89 B;  1VRA B;  2J4X A;  3KQ4 A;  2DBY A;  1M4V A;  4WWM A;  2WXN A;  5H8Y E;  1DGJ A;  1UUP A;  2L52 A;  2MH7 A;  4JX1 C;  4IDI A;  3VR8 B;  4HRO A;  1QOG A;  2IGG A;  3PZ8 A;  3CWI A;  1VZ6 A;  2JSV X;  1J7A A;  5EE1 A;  5EE3 A;  2RDG A;  3BWU D;  2QEJ C;  1XXG A;  4ITK A;  3BVG A;  1VDV A;  2WXK A;  1B9R A;  1C4P A;  1IGC A;  4NAM A;  5BMI A;  1ZXI A;  2KAC A;  3C8Y A;  1FCC C;  3P63 A;  4YSZ B;  1L6V A;  3DWG C;  1FM0 D;  4RNA A;  3IT4 B;  3HRD D;  1ESF A;  4US9 A;  1XLN A;  4N6E B;  1NEN B;  3FAH A;  1MHX A;  2N9K A;  2AX5 A;  1NI3 A;  1V1O A;  4XWW A;  2WU2 B;  2LGI A;  1D5M C;  3P42 A;  1D4B A;  1WWT A;  1QF6 A;  4RGN A;  2GB1 A;  1AYF A;  3AE6 B;  5T8I A;  3LB8 C;  1PYW D;  1JRO A;  2CJO A;  2VZK B;  4XE0 A;  5TSS A;  4JE3 B;  1XLQ A;  2NTT A;  1L0Y B;  1PFD A;  1WXQ A;  3AE1 B;  1MVK A;  2X38 A;  3GB1 A;  4WQM A;  3R2T A;  2EKI A;  1SJH D;  1WSP A;  4TQ1 A;  1YJJ A;  3OWE B;  3AB5 A;  1E7P B;  1JW9 D;  3IT6 B;  3MC0 B;  2QSD A;  3IAM 1;  2LMC A;  4GDK B;  1I4H A;  1QLB B;  2WU5 B;  1NEK B;  3ZQ4 A;  3H8H A;  4J3O D;  3Q8A A;  2ICI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...