4JWSC

Crystal structure of cytochrome p450cam-putidaredoxin complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLECVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Camphor 5-monooxygenase
publication title Structural basis for effector control and redox partner recognition in cytochrome P450.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase/electron transport
total genus 30
structure length 106
sequence length 106
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4jwsC00
1QT9A 3AEBB 1YJJA 3W5UB 2ACZB 3CWIA 3RPFC 1PDXA 2B76B 1VDVA 4ZHPA 1AYFA 3P4QB 1NENB 1F0ZA 1QF6A 1QOGA 3AE5B 1ZXIA 1XLNA 1EWYC 2JX5A 3AEFB 3DWGC 2WDRB 2G1EA 4N58A 5H92C 3P4SB 2W55A 1J7CA 3PO0A 3AE8B 1YJIA 3P4PB 3HVZA 1QOFA 2EKIA 1FO4A 1JRPA 2K22A 4YSYB 1E0ZA 3DWMA 4USAA 1FRRA 1XLOA 3AEAB 2BT6A 1TKYA 1E6EB 1TKEA 3NS1A 2WDVB 2JQRB 1L0VB 2L83A 2Q5WD 3AE3B 1E10A 1R7SA 1E7PB 1UWMA 2KAJA 3AN1A 1QLBB 1XLQA 3B9JA 4YSZB 1RYJA 1FFVA 1YQ3B 2CJNA 3B2GA 3B2FA 1A70A 1OFFA 2WU2B 5AUIA 1CJEA 2WP9B 4YTNB 4YTPB 3EUB2 1B9RA 2AX5A 2BS4B 5EE0A 5EE3A 5G5HA 3L4PA 5GXGB 1TJEA 1DGJA 1WRIA 1JW9D 2MJEA 2K5PA 4IDIA 3AEDB 3AE9B 1WYGA 4YT0B 1FXAA 4N59A 3AB5A 2MH7A 1DOIA 5AUKA 1IUEA 1TKGA 1WXQA 2OHFA 2W54A 2H89B 2WLBA 2K9XA 3ETRA 3WCQA 5EE9A 5C2TB 3ABVB 1XO3A 1KFYB 2Y5CA 5C3JB 3AE4B 5EE1A 1FFUA 1JROA 3HRDD 1I7HA 1ZP0B 3VR9B 1L5PA 2M56B 3AM9A 3AH7A 1N60A 1NVID 3LXFA 3NVWA 3AECB 3NVZA 4JX1C 4P6VF 3LB8C 3AE2B 2HTME 4LTUA 4YTMB 1N62A 1AWDA 1N5XA 1OQRA 2MJ3A 2N0SB 1V8CA 1ROEA 1RFKA 1KRHA 1L6VA 4WWMA 2FBWB 4ZOHC 4N6EB 3AE7B 3HUIA 1N63A 2MJDA 3AV8A 3KWLA 1NYRA 2L52A 4WQMA 1GAQB 1RWSA 4ZHOA 2CJOA 2WDQB 2M19A 3CIRB 3NVVA 4US9A 5H8YE 3P1MA 4KX6B 4YXDB 2CU3A 2E3TA 1ZUD2 1NEKB 1T3QA 4FXCA 1GPXA 3NVYA 1FMAD 1SB3C 1DOXA 2PVGC 1RM6C 3W5VB 4A9AA 4JWSC 2DWQA 3VR8B 2PKOA 3W9CB 1JWAD 1FRDA 1SF0A 2QJLA 3AEEB 1CZPA 1FM0D 1SIJA 3FC4A 3SFDB 3SFEB 2W3RA 1L6UA 1KF6B 1JALA 1FIQA 2BS3B 1VLBA 1OQQA 1JQ4A 3AEGB 1TYGB 3P4RB 1VJKA 3P63A 1NI3A 1V97A 2BS2B 2H88B 3NRZA 3VRBB 1NYQA 4C7ZA 3AE1B 2LEKA 4HRSA 2KMMA 3BIID 4YSXB 1JWBD 1N61A 3AMZA 1QOAA 2PVOD 4C7YA 1PFDA 1PUTA 2WU5B 1WWTA 1E9MA 3VRAB 1FXIA 1WGKA 3SR6A 2PIAA 3AE6B 2QIEB 1J7BA 3FAHA 4JWUC 1N5WA 1YQ4B 2W3SA 5MPOA 2WQYB 3ZYYX 5G5GA 4HROA 4US8A 4C80A 4ITKA 1DOYA 1J7AA 1XLPA 1ZOYB 1QOBA 2DBYA 2WS3B
chains in the Genus database with same CATH superfamily
2JRHA 4XDDA 2B76B 1NENB 3EECA 2L00B 1R4NI 3L13A 3PO0A 4MGZE 1YJIA 3HVZA 2DNFA 1ISNA 2KDEB 4HCPB 4USAA 3RZFA 2PW9A 2OJRA 1E6EB 2M17A 4GLSC 4WIPA 3AN1A 1WM2A 2IY0B 3U7DA 3ZGZA 4HDQA 2KC1A 4RGNA 2RPVA 2QSDA 4KGRA 3TSSA 2AQ3B 4RM9A 3RNFC 4N59A 4W9FA 1ZPSA 5AUKA 1FEHA 1UD7A 1D5MC 3Q8BA 4NPNA 2D3CA 3RUIB 3ALBA 1KOTA 2JWZA 1CK1A 3Q14C 1K52A 2B3AA 2K1FA 3LB8C 1UGMA 2FCQA 4RM8A 3DVNV 2OJWA 3H1UA 3APCA 4WWMA 4N6EB 2BYEA 1E8ZA 3V62A 3ZJTA 1RLFA 2ZW0A 2AEHA 4KVGB 3GE3C 2BB6A 2PE9A 4BKGA 3NZUA 4YXDB 4KSKC 3W1YA 1TS4A 1FRDA 1S3SG 3T3NA 2NPTB 2XN9C 2PMVA 1WJ4A 5DCNA 2BPSA 1JWBD 4REZA 2TSSA 4W9JA 1OQYA 2NTTA 4B95A 2C7NB 1F1HA 1GUAB 1IGDA 1N5WA 2W3SA 1KH0A 1VD2A 3OLMD 2DBYA 1QT9A 1ET9A 3LYYA 1H8CA 4HCNB 2WX0A 4BAXA 3PGEA 3APFA 1QOGA 5HHDG 2REXA 5J17A 1CQVA 1FO4A 1JRPA 3Q6BA 4OZBA 4KDIC 3A1QB 3V61A 4BBNC 2V3NA 1SGHA 4W9KA 2GBNA 5KHQA 3AI5A 2GBRA 2W9NA 3M63B 1TTNA 2QMTA 1QLBB 2NR2A 2PTLA 1C4PA 1H4RA 2N9LA 4GB9A 1YMHE 3QWZB 1IPGA 3R66C 3EUB2 2MBEA 4LNIA 4ZYNA 4J3OD 4K7WA 2LVQA 3O65B 1SE9A 4A20A 3R8BA 3DBLB 2K9XA 5C2TB 4P7IA 2JRIB 4J6IA 1FFUA 4FULA 3VH3B 1GB1A 3NVZA 2VH1A 2NCNA 5EDSA 2L0TA 1L6VA 4PS3A 1WGYA 4HPPA 4K7SA 1EF1A 3RCZA 3NVVA 2CHZA 4XWWA 1T3QA 3ZTDA 3R7RA 3DBRB 4L23A 2DWQA 4HK2A 3NOBA 3PHXB 4O1NA 1P0RA 1FNWA 2IO0B 3DBHB 1MHHE 3BVZA 2H88B 4R3DA 1IBXA 2VRRB 3VRBB 1EU4A 4M02A 1JCKB 3B08A 1WGKA 3HM6X 1K8RB 5JHBA 2I1KA 4GDLB 2IY1B 4RF0A 3A9JB 4ITKA 1FXTB 4DBGA 4K3BA 3CWIA 2J53A 4WJQA 1V1PA 1ZXIA 2KFKA 2G3QB 3DHIC 2K6QA 3RNCC 3GOEA 4W9EA 2KWVB 1GNUA 2GLSA 4MELA 1EU3A 3BZDB 3VVWB 2MBHA 5TSSA 2KHWB 2CJNA 2FCNA 3B2FA 3N30A 3ML9A 3ZUNA 2GBKA 2RDBC 2BS4B 5HI1A 1HZ6A 3SHQA 4FA6A 3AE9B 1UZXB 3PV1A 4PK1A 1ZXHA 4OVUA 1JROA 3HRDD 3DPDA 3EFUA 2L8JA 2RDHA 3ZVVA 2MA9B 3AXCA 2BYVE 3VAWA 1UF0A 3RD2A 2BYFA 1TY2A 3WANA 2K3UA 3IT4B 3MC9A 2IZVB 3R3MA 1TS5A 2QILA 4X57B 4ZRJA 4W9CA 1SB3C 4BKSD 3K9PB 2PLPA 4XZ4A 2INPE 2A5UA 2RSUA 3V05A 3PTFC 3CSFA 3UIPB 1LFDA 2QCZA 3U8ZA 3NS8A 4AOFA 4C7ZA 2JZZA 1N61A 3BWUD 2WXQA 4Q2JA 2NPTA 1AN8A 4ZYSA 4P1CC 3EA6A 4IW0A 2KX3A 2M0AA 2LASA 3SDLC 1HTQA 3BYYB 2ACZB 3RPFC 2YLMA 2ZPNA 1F0ZA 4FLHA 4TQ1A 2ZCCA 1J7CA 4BKSA 1QOFA 2EKIA 4II3B 3ECIA 2IO1B 2R2QA 3ZNGC 1V2YA 2L83A 3CMMB 1XLQA 4FHKA 3DVNU 4ACFA 4KSLC 3U52E 2WU2B 1I35A 5IN7A 3A1QA 2IJ0A 2KLCA 1MPEA 1WXMA 4E71A 3KUCB 1TJEA 1DGJA 3H6NA 2RR9A 1Y8RC 1C76A 3IHPC 2WXMA 2YVCA 3ZDMC 4DXFA 1Q1OA 2KD0A 2KWUB 2L05A 4MH8A 3UGBB 3UI3A 1WGGA 2D2QA 3AM9A 3RNBC 1LO5D 2KK8A 4EUTA 1BT0A 4RH6A 1E8WA 2LRWA 3KWVA 3IT6B 1NYRA 5J2RA 3FILB 2WXGA 4MM3A 4GDKB 1D4BA 4LK0M 4ZRQA 1YN4A 4PT5A 1J8CA 4HPLB 4NY0A 2KQSA 3W9CB 5JH5C 4D2KA 4TQ0A 4NJ7A 4WURA 4EEWA 4GOCA 2LHDA 4KIKB 4GU2A 3BK1A 5DPTA 3MFGA 1IP9A 2V3PA 4C7YA 3MHSD 2INDC 4IWPA 4K81A 2ZEQA 1WE6A 4RFBA 2SEBD 2V4LA 1UGJA 2AL3A 2N1WA 3CSTA 1GOZA 2QEJC 4KDLB 3WA0A 1UBIA 1ENFA 3PZDA 4IUMB 3WAMA 1PDXA 2V0GA 1WRDB 2RPQA 2OOBB 2K25A 3AULA 1Y56A 4GDLA 1I4HA 3A9JA 3RT3B 2M4NA 3ZQ4A 2L1AA 2NMQA 4BKTA 3V6CB 4LNNA 4II2B 4FBJB 2WXRA 4A3OA 4PYZA 1A5RA 1VCBA 4H2AA 1TIFA 2IYDB 1KM7A 1J0GA 2LXCA 1B9RA 1E5WA 4TUUA 3TEZA 4HEA1 1WRIA 2JXTA 3UQBA 4EE2A 2WLBA 3L08A 1KJTA 2ZZPB 3AU4A 2Y5CA 2WX1A 4DWFA 5JHAA 1L4DB 5KHOA 5C1ZA 1NVID 2ZVOA 4HKQA 1AWDA 4W9HA 3R7QA 4FJVB 4DDID 3T9LA 4ZOHC 1S1QB 3A33B 1YN3A 1MG8A 3PT2B 5LXHA 2ZJDA 2K8HA 3KLSX 3P1MA 2MBOA 3Q8FA 4C4VB 1NEKB 4FXCA 2FCMA 4RGTA 3PPAA 4WAAA 1SE3A 4JL9A 4M0WB 2G45B 2JWUA 2KACA 2ZPYA 1JWSD 2CHWA 1MFWA 2FE8A 2MEKA 4DXGA 2X38A 3BIID 1Q10A 1WJNA 4AJYB 5L95C 4NJCA 1PFDA 3E9SA 2N9XA 1F77A 4MJSB 2QIEB 2JZ3B 2L3ZA 3WAOA 1WXAA 2HTHA 1LGRA 2VZKB 2N9PC 1FD6A 2J7QB 3K9OB 4XDCA 3PRPB 4XWTA 3RN9C 3JSVB 2G1EA 3N3KB 2O6VB 3RMKC 4CQNA 4QAYA 3P4QB 3A4RA 3D32A 1MHXA 2HDEA 1R4NB 4G0NB 5H92C 3TIXA 3MHZA 1JRUA 2D3GA 2KDMA 3RNAC 2J0MA 2BKRB 3VDZA 3C8YA 1P7EA 3Q3NC 1TKEA 1V1PB 2WDVB 4MH0E 5HKHA 1C9FA 2I38A 3KW5B 1PGBA 4GIVA 3MTNB 2I2YA 1YQ3B 2C7HA 3UINB 5IP4D 1YN5A 2N9EB 4MGYE 2JUOA 3L17A 3L4PA 4XE0A 2BWES 3MC0B 1D5ZC 2GRIA 4MT5A 3DQVA 3M95A 4WWPA 4AQ7A 4XYCA 3LXFA 4KZCA 3NVWA 4IM0A 1YNTE 2ZCBA 1C1YB 2DHZA 2GBMA 1Z2MA 4IOIE 1GJZA 3M3JA 1SBBB 2MJDA 1RAXA 1SJED 5E6JA 4GGQA 1KLUD 1FNUA 5AZGA 3Q3JA 3OJ4B 1P9DU 3B0AA 1G6JA 4JE3B 2EMSA 1WX9A 4NAWB 3FILA 2FIDA 4GDKA 1OGWA 2KTFA 1EM7A 2BS2B 1KLGD 2CR5A 4AS1A 4DHZE 5J18A 2Y3AA 2KTRA 4TSSA 3RULA 3VTUA 4CYEA 2FCSA 3PZ7A 2WDTB 2WXJA 2XBBC 4B0MA 4ARIA 2CU1A 1WJ6A 4KIKA 2WWZA 2K8BA 3GP7A 1XF5L 1YJJA 3W5UB 3W1SA 3KQ4A 2DZIA 2J0KA 2LRUA 4F8CB 5BYRA 1I4QA 3UQAA 1WMHA 3NUHB 3AE8B 5D7GA 2G4SA 4LNKA 5BMIA 1E0ZA 1TBEA 1FPYA 2NBWB 3NHEB 3X0WA 2J52A 2LXAA 3NS1A 2JQRB 3RNGC 5E6OA 2NVUI 4IKGA 1ZDVA 5AZFA 4A6QA 1A70A 2MSED 1QILA 2JXXA 2K8CA 1N6ZA 2MWSB 3DOWA 1TT5B 1TKGA 2MW5A 4WJPA 1J19A 3U7ZA 2EKEC 3I9V1 2DENB 3N1XC 4EKUA 1L5PA 2R61A 3Q8CA 3T8MA 1AW7A 2UU7A 3JVZX 4YTMB 2FUG1 3V60A 3ZW3A 2LJ5A 4ICVA 2KDBA 3KYDD 3R2IA 1N63A 3KWLA 1IYFA 1YJ1A 1GAQB 2DLBA 2DYBA 2PEAA 2JY6A 3ZKJC 4JGHB 2E3TA 1FMAD 1WZ0A 1EO6A 2KVRA 4BVUC 1PYWD 2PKOA 1SF0A 3SFEB 1T0YA 4MM3B 1KF6B 3S2AA 4YWGG 3P4RB 3PRZA 3M62B 3V3XA 4C4VA 2WYQA 3AE1B 4EFOA 2LEKA 2V3SA 3AMZA 4WH4A 2HE7A 1L7YA 4M0WA 4ARCA 2WU5B 2MRPA 5HFYA 1E9MA 2MP2A 2GI9A 2LMCA 3AE6B 5LLIA 4MEMA 1WR6E 1HXYD 3OWEB 4C80A 4HJGE 1DOYA 2RMMA 4NNJB 1XLPA 2AQ2B 3JW0X 4AJWA 1VDVA 2KJ6A 4MJSA 2DAFA 5LXIB 3TJPA 3PSEB 4GMVA 2MLBA 3MP9A 2JYTA 3DBLI 3JSVA 2K22A 3BK2A 3PS6A 2O6VA 3ZXRA 3PLUA 2HJ8A 4FJYA 4EZLA 1MG4A 2KQ4X 1X1MA 2XK5B 2MBBB 1XCTL 4LNFA 3I63C 5AZHA 4YTPB 2AX5A 4WJNA 5GXGB 1WYGA 5IOIA 3DVGY 4A3PA 2OHFA 2KJRA 3BVGA 3RNEC 2ASQA 2KVZA 4TKNA 1I4RA 3TEWA 1STEA 4LLGM 3I5JC 1N5XA 1ROEA 2CKHB 2O2VA 3X23A 1WY8A 1BMLC 2M19A 4WWOA 2L76A 4DHZB 1WF9A 2D3AA 1TS3A 1V5OA 2IBIB 3H7SA 3DBSA 1C4CA 2LUMA 1PGXA 2GB1A 2BS3B 1VLBA 1OQQA 5IAAC 5E6NA 4M01A 1SE2A 3H7PB 4G11A 3U4EG 3DDCB 4HDOA 3KUDB 2PVOD 4NAWA 1LQBA 3N32A 5FR3A 1WWTA 3OG5A 5BMHA 4IC7B 4PYUA 2PIAA 3VHTC 5DPSA 4MDKE 2BF8B 1WH3A 5FR6A 3BY4B 5MPOA 3ZYYX 5G5GA 4CO7A 3IG3A 3MJWA 3IAM1 4E74A 4ZHPA 1V1OA 1QF6A 1P98A 3AE5B 2WDRB 3ZNID 4DXAB 3QAQA 2ON8A 1JWUD 5T8IA 3UIOB 2M8SA 1VZ8A 2BT6A 4WWNA 2IDYA 1ZE3D 3KYCD 2D10A 3W2DA 4XC2A 1WGRA 1C78A 4NQLB 4TMAB 3W1SC 3E56A 3NJTA 2YEPB 5D2MB 3P42A 4ZRIA 3QHTA 2WP9B 1E8YA 5G5HA 1WFYA 1JW9D 2NBVB 1XD3B 5JZEB 2OEDA 1V81A 4YT0B 1C77A 1DOIA 1PQSA 2BTEA 2J0JA 2FAZA 3U2SC 5G55A 2M0XA 3VR9B 3ZJVA 2HTME 2PE6B 4DHJB 2MJ3A 3A9KB 3VUWA 3C0RB 1DYQA 4A55A 3VFKA 1PGAA 4LJPB 2L52A 4I6PA 1P3QU 2ICIA 5JXVA 1ZUD2 3LDZE 1T0QC 1GPXA 3NVYA 3HM3A 2RDGA 2N9KA 1NBFC 1JWAD 3URYA 4HXDA 3TEYA 4HPMB 4OZCA 2KOXA 4W9IA 2AWTA 1TYGB 2BBCA 2CHXA 1YX6B 1NI3A 2R2OA 2E6XA 4NAMA 2BKFA 4TV3A 1V86A 2KFJA 4JLCA 5AEKB 4ZRPA 2KTRB 2GBJA 2KMAA 1FCLA 3ZJUA 5LNK1 2WS3B 1L0YB 3KUZA 3GZNB 3Q3MC 3AEFB 3TUOA 5E6PA 1V49A 3ZLZA 3P4PB 4YSYB 2INCC 1F52A 3ENEA 1TKYA 1R7SA 1E7PB 2ZNVB 4RGOS 1WMHB 2WXFA 1FCCC 3QCAA 3ZIMA 1CJEA 1FXAA 1Q5WB 4FJZA 2XK5A 5DPWA 4KGTA 4F1SA 1I7HA 1XXGA 5CX3A 3PLVA 3U30A 1N60A 3GB1A 2KANA 1D5XC 2GOWA 1EUVB 2RGFA 1HE8A 2PJHA 4KV2A 4WQMA 4M8MA 2LGDA 3IXSA 1UWXA 2PPHA 3VXWA 3N20C 2V1YA 2CU3A 3APDA 3I3TB 3AU5A 2QJLA 3DVGX 3IVFA 3LJ3A 1F9JA 1VJKA 4FHJA 3TL5A 4L1BA 2J4XA 4HRSA 2WXKA 4YSXB 1E7UA 1T0RC 4I6NB 3FKYA 2WXLA 5L83A 2CS4A 4XGAB 3HHMA 5HG2A 4W9GA 3BVMA 3ONSA 3H7PA 4HKZE 1EF5A 1WI0A 1I42A 1YOVB 2BYTA 2MP2B 3IBEA 2IGDA 3DCGA 4AUQC 3Q8AA 4G50A 4B9KA 3DWGC 2BB5A 4ANVA 4BBNF 2LI5A 2IO3B 3A4SC 3DHHC 4FN2A 2Q5WD 4DHJD 3B9JA 4IM2A 1RYJA 1SIFA 1OFFA 3GE8C 1FNVA 2C9WB 2V4IB 2IGHA 4LDTB 1R4MI 2I1JA 1ZKHA 1T5XD 2H89B 1XO3A 4HVBA 5IKCM 1OEYA 1ZP0B 4MGIE 2BVCA 3VTWA 2G9HD 4ANWA 3R2TA 2WXPA 3TCAA 2DX5B 4LTUA 1I4XA 3HK0A 1RFKA 2FBWB 2IO2B 1K50A 4A90A 4RGMA 1YX5B 3WIMA 4ZHOA 3CIRB 3C19A 4KX6B 2C5LC 1XCQL 3A9KA 3Q3FA 1DOXA 2O2VB 3W5VB 1VRAB 1K51A 3ZNZB 4B0EA 5CHVC 3VUXA 5D94A 1L6UA 1HTOA 1OTRB 5D3IB 1WGDA 4EOYA 1HA5A 2YEPF 3P63A 2WXNA 1E90A 1GG3A 2LGSA 3PREA 1NI2A 1QOAA 2KJHB 2D11A 3RYTA 1KLVA 1TS2A 4ASWC 1J7BA 1TZ1A 2G4DB 4N9F4 5BYSA 4NZLB 4YL8A 2LD9A 4KZ0A 4AWJA 3TEXA 1QOBA 5G2NA 2N7DA 1VZ7A 1EWYC 3TMPB 2MX2A 4S17A 1HEZE 4ZRKA 1E8XA 2FUHB 1UWMA 1Z5SB 1FFVA 2WXHA 4EZKA 3KH0A 3B2GA 3GS2A 2A4ZA 1WZ3A 2KKCA 2K0PA 2EELA 5EE0A 5EE3A 1Q0WB 2LUEA 2EMTA 2MHJA 3AEDB 4HLEA 4URKA 3ETRA 5C23A 1QZEA 5C3JB 2QHOA 2D07B 3IAS1 3AECB 4P6VF 4CHKA 4WQOB 2UYZB 4M8NA 1V8CA 3H9DA 1UUPA 3VTVA 1E7VA 2NBUA 3I57A 1M4VA 2FNJB 2Z0EB 1ZW7A 2HJ1A 1FM0D 1SIJA 2KDFB 4IWOA 2KWDA 3QIJA 3L54A 1YQBA 4K3CA 4ZDVA 3EGRA 3ML8A 1KTKA 2VH2A 3QC8B 5IA7A 2VZKD 3VUYA 2GMIC 1BUIC 2O6VD 4HROA 5FKAC 1J7AA 1OEYJ 5DPRA 4LDTD 4L2YA 2WXOA 2BW2A 2JF5A 2JX5A 3T3OA 3JYUA 3QJZA 2AYOB 1WSPA 1F2RC 1FRRA 1ZDXA 4RMAA 3NZ3A 4MGKE 1UELA 3ZRFA 4YSZB 1WX8A 2K39A 2KMCA 1TGZB 1LM8B 5AUIA 2JYEA 5BO4B 2BWFA 3Q3OC 4IDIA 3AB5A 2W54A 1WXSA 4S0RA 4C56C 5EE9A 1XEEA 3ABVB 3L0WB 2N7EA 1WM3A 5BYQA 3VQIA 2M56B 2JVCA 4F7ZA 2LGYA 1ET6A 4NQKE 1N62A 1JWMD 2N0SB 2MCNB 3BYTB 3ZNHB 4EZJA 1KRHA 4BOZB 3AE7B 2KZRA 3ZRCA 1RWSA 4K7UA 1ESFA 2CJOA 1SE4A 2BQQA 2MBQA 3P2BA 3DBRI 1L0XB 4JWSC 1C4AA 1WE7A 1P1AA 3SFDB 2Y5BB 2W3RA 2LVOA 1JALA 3DBHI 1JQ4A 4BFRA 3CF6E 3RZWC 3NRZA 1NYQA 2N7JA 1C3TA 1V9JA 4C00A 1I4GA 3Q8EA 3VH4B 3IFWB 3VRAB 1SJHD 2SAKA 4ANUA 3EHVA 2KYWA 4GSWA 4OHJA 3NY5A 3H8HA 2WHIA 5D6JB 3B1LX 4JPSA 2Z59B 3AEBB 5IO9A 2LJIA 2C60A 3P4SB 1MJDA 2AL6A 4K1RB 2JZPA 4RCOA 3SEBA 1U4AA 2C7MB 4HJKA 2MQJA 3PRMB 1TY0A 4DK5A 2KDIA 4ICUA 1SXTA 2MJEA 2KX0A 2KWCA 4DQOC 1VZ6A 2MH7A 1WXQA 3MJ5A 5BMGA 2KLGA 1VR9A 3WCQA 1EWCA 1ZGUB 1L2NA 1KFYB 3AE4B 1P7FA 3ZTCA 5EE1A 2JSVX 1BXTA 3AH7A 4HWIB 4JX1C 4AP4C 2JT4B 3ZO5B 3RI7C 3QA8A 2INNE 4GN1A 1F2RI 4MSQB 2ZNVC 2DZJA 4ANXA 2RD0A 3QARA 1D6EC 2Y5PA 5TR5A 1GC7A 2WDQB 3WALA 4US9A 3HIZA 2DAJA 3EC8A 4A8XC 3TBLD 4LCDE 1YD8U 2L7RA 3L16A 1RM6C 4JQWC 2Z0DB 4OVZA 1L4ZB 3AEEB 1QKZA 1UBQA 3N1ZC 1GB4A 4LNOA 4WAFA 2K6DB 3PZ8A 2DZKA 2JU6X 2KN4A 3Q2AC 1PUTA 4BOSC 3PVLA 1HZ5A 1MI0A 1FXIA 4KKJA 3Q69A 2LGXA 3FAHA 1RFAA 2AQ1B 2WQYB 5CTRC 4US8A 3WAPA 3V6EB 4WJOA 1UH6A 2QC8A 1SSNA 2NS5A 2QDFA 3ZXVA 3OAWA 1AYFA 1WXVA 1WJUA 2WGSA 4P16A 4KGSA 1CMXB 5CHFA 1XLOA 3AEAB 4IG7B 1RRBA 2BGFA 1L0VB 1TZOA 4B6WA 1T0SC 5GMVA 1YIWA 1GC6A 3SU8X 4NJ6A 4G3XB 4DDGD 4P1BC 2K5PA 4I6LB 2W82A 2L32A 2XNAC 3QK0A 4IM3A 3VR8B 1JMLA 1IUEA 3MC8A 1WIAA 3DHGC 4A9AA 2L0FA 1HQRD 2LHEA 3QX1A 3L10B 4OW0A 2JPHA 3N9YC 4LJOB 2KC2A 3HUIA 2NTSA 2V9HA 3AV8A 1XQQA 1WX7A 1UNSA 4E3CA 5H8YE 4JIOU 5FK9C 4MACA 1CZPA 2UWQA 2D5GA 2FIFA 2LFIA 3RFZB 1K53A 1I4PA 1V97A 1V5TA 3GZNI 2DYOA 3SD5A 3UF8A 2KXJA 4XX5A 2Z8LA 3NZSA 1XT9B 3N1YC 2X8XX 2N4FA 3SR6A 3NG0A 2LZ6A 3BINA 1YQ4B 4PS7A 3ZDTA 1C79A 4RNAA 3QQ8B 4PS8A 1NDDA 1XLNA 2LVPA 4N58A 2W55A 2ZVNA 1WGHA 1ACCA 3DWMA 3OJ3A 4MSMB 2KNBA 3AE3B 1E10A 2KAJA 3J9CA 4UDUC 1LXDA 4OZAA 2KN5A 2KT7A 2LWPA 4YTNB 1B1ZA 2KQ7A 1R4MB 2KO3A 1MVKA 2ZW1A 5I4DA 1AARA 1WYWB 2IGGA 2WXIA 2ONQA 1SEBD 4BZAA 3AE2B 4FADA 2J42A 1D3ZA 2HD5B 1OQRA 3PHWB 2LGIA 1T6BX 2DYMA 2DZMA 2M1MA 1IBXB 2IPKD 4IWQA 2PVGC 4W9LA 1V6EA 2N1VA 1M94A 3FC4A 3KVFB 5CHWA 1FIQA 1WR1A 4M00A 3AEGB 2XEWA 1IGCA 3EFCA 3HVDA 4GXBA 2D3BA 4KKIA 2KMMA 1QQRA 3O13A 4W9DA 4RF1A 1V80A 2KFKB 4JWUC 4OVVA 2WNMA 5D3DA 1ZOYB
chains in the Genus database with same CATH topology
4XDDA 3IAM1 1PDXA 4L2YA 2B76B 4ZHPA 2V0GA 2WXOA 1V1OA 1NENB 2BW2A 1QF6A 3AE5B 2JX5A 2WDRB 3T3OA 1Y56A 2ON8A 3PO0A 1YJIA 3HVZA 1I4HA 1JWUD 5T8IA 1WSPA 1F2RC 4USAA 1FRRA 2PW9A 1ZDXA 1VZ8A 3ZQ4A 2BT6A 2L1AA 2IDYA 1ZE3D 1E6EB 2NMQA 4GLSC 3NZ3A 3W2DA 4WIPA 2WXRA 3AN1A 3ZGZA 4YSZB 1C78A 4TMAB 3E56A 2YEPB 4RGNA 4H2AA 2RPVA 5AUIA 2JYEA 3P42A 2WP9B 1B9RA 2QSDA 4KGRA 3TSSA 5G5HA 3TEZA 4HEA1 2AQ3B 1WRIA 2JXTA 1JW9D 4IDIA 4EE2A 2OEDA 4YT0B 1C77A 3AB5A 1ZPSA 1DOIA 1FEHA 2W54A 4N59A 1D5MC 2WLBA 5AUKA 2BTEA 4C56C 3Q8BA 5EE9A 1XEEA 3ABVB 3U2SC 2Y5CA 5BYQA 1L4DB 3VQIA 3VR9B 1CK1A 2M56B 1NVID 1K52A 3ZJVA 3LB8C 2HTME 1ET6A 4HKQA 1N62A 1AWDA 1JWMD 2MJ3A 2N0SB 3BYTB 1KRHA 1DYQA 4WWMA 4ZOHC 4A55A 4N6EB 1PGAA 3AE7B 1YN3A 2L52A 3ZJTA 1RWSA 2ZW0A 1ESFA 2CJOA 1SE4A 2BB6A 2ICIA 3KLSX 3P1MA 4YXDB 3Q8FA 5JXVA 1ZUD2 1NEKB 4FXCA 1GPXA 3NVYA 1TS4A 2RDGA 1L0XB 4RGTA 4JWSC 2N9KA 1C4AA 1JWAD 1FRDA 3URYA 3TEYA 1SE3A 3T3NA 3SFDB 2JWUA 2KACA 2W3RA 4OZCA 1JALA 2XN9C 1JQ4A 2PMVA 1TYGB 1JWSD 2BBCA 1NI3A 2FE8A 2E6XA 2MEKA 3NRZA 1NYQA 4DXGA 4NAMA 2N7JA 2X38A 3BIID 1JWBD 4REZA 1Q10A 4NJCA 1I4GA 1PFDA 3E9SA 3Q8EA 2TSSA 1F77A 3VRAB 1SJHD 2SAKA 2NTTA 2QIEB 4OHJA 4ZRPA 2VZKB 1IGDA 1N5WA 2W3SA 3H8HA 1FD6A 4XDCA 1FCLA 4XWTA 3ZJUA 4JPSA 1KH0A 5LNK1 2G1EA 2DBYA 2WS3B 1QT9A 1ET9A 3AEBB 1L0YB 3LYYA 4CQNA 3P4QB 1MHXA 1QOGA 2HDEA 2LJIA 3AEFB 5HHDG 3TUOA 5H92C 1CQVA 3P4SB 3MHZA 2KDMA 3P4PB 1FO4A 1JRPA 4OZBA 4YSYB 2JZPA 4RCOA 3SEBA 3C8YA 1P7EA 2V3NA 1TKYA 1TKEA 1V1PB 2WDVB 1C9FA 2I38A 1R7SA 1E7PB 1PGBA 2QMTA 4RGOS 1QLBB 2WXFA 2PTLA 2I2YA 1YQ3B 1C4PA 2N9LA 1YMHE 1YN5A 1FCCC 1TY0A 1CJEA 3EUB2 3L4PA 4XE0A 1SXTA 2MJEA 4J3OD 1FXAA 4DQOC 1VZ6A 2MH7A 3MC0B 1D5ZC 1WXQA 3MJ5A 5BMGA 3R8BA 2K9XA 1VR9A 3WCQA 2GRIA 4MT5A 1EWCA 5C2TB 1KFYB 3AE4B 1P7FA 4KGTA 5EE1A 4AQ7A 2JSVX 1FFUA 1I7HA 1GB1A 1XXGA 3LXFA 3NVZA 1BXTA 3AH7A 1N60A 3GB1A 3NVWA 4JX1C 1D5XC 1YNTE 2INNE 4IOIE 1F2RI 1L6VA 1SBBB 2MJDA 1D6EC 1SJED 2Y5PA 4WQMA 5E6JA 2WDQB 3IXSA 1UWXA 3NVVA 4US9A 1KLUD 1FNUA 2CU3A 4A8XC 4XWWA 1T3QA 4L23A 1RM6C 2DWQA 4JE3B 4O1NA 4OVZA 1L4ZB 2QJLA 3AEEB 4NAWB 1QKZA 1FNWA 3FILA 1MHHE 3BVZA 1GB4A 1EM7A 1VJKA 4WAFA 2BS2B 2H88B 4R3DA 1IBXA 1KLGD 4AS1A 3VRBB 3PZ8A 2JU6X 2KN4A 2Y3AA 4L1BA 2J4XA 4HRSA 2WXKA 1EU4A 4TSSA 4YSXB 3PZ7A 2WXJA 1PUTA 2WXLA 4B0MA 1JCKB 1HZ5A 1MI0A 4ARIA 1FXIA 4KKJA 5HG2A 1WGKA 3BVMA 3Q69A 3FAHA 2AQ1B 4HKZE 4GDLB 2WQYB 4US8A 4RF0A 4ITKA 3GP7A 1SSNA 2BYTA 1XF5L 1YJJA 3W5UB 3W1SA 3KQ4A 2IGDA 3CWIA 3Q8AA 2J53A 1AYFA 1V1PA 5BYRA 1ZXIA 3DWGC 2BB5A 1I4QA 4P16A 3NUHB 3AE8B 5D7GA 4KGSA 5BMIA 1E0ZA 1XLOA 3AEAB 2J52A 3NS1A 1EU3A 2JQRB 3BZDB 1L0VB 1TZOA 2Q5WD 4IKGA 1ZDVA 5TSSA 3B9JA 1RYJA 4A6QA 2CJNA 3B2FA 1A70A 1OFFA 1QILA 1FNVA 2BS4B 5HI1A 2V4IB 2IGHA 1HZ6A 2K5PA 3AE9B 2W82A 2L32A 2XNAC 1T5XD 3VR8B 1JMLA 1IUEA 1TKGA 2H89B 1ZXHA 3U7ZA 1XO3A 3I9V1 1JROA 3HRDD 1ZP0B 1L5PA 4A9AA 2G9HD 2RDHA 2R61A 3Q8CA 1AW7A 1HQRD 3R2TA 2LHEA 2WXPA 4LTUA 4YTMB 2FUG1 4OW0A 1I4XA 1RFKA 3N9YC 2FBWB 1K50A 3R2IA 3HUIA 1N63A 2NTSA 3AV8A 3KWLA 1TY2A 4A90A 1UNSA 1GAQB 2DLBA 2K3UA 3IT4B 4RGMA 4ZHOA 3CIRB 5H8YE 4KX6B 2E3TA 1TS5A 2QILA 1XCQL 5FK9C 1FMAD 1SB3C 1DOXA 2PLPA 1PYWD 1VRAB 1K51A 2INPE 3W5VB 2PKOA 4B0EA 1SF0A 3SFEB 4MACA 1CZPA 3V05A 1L6UA 4MM3B 1KF6B 2D5GA 2LFIA 5D3IB 4YWGG 3RFZB 3P4RB 1K53A 3V3XA 1HA5A 1I4PA 2YEPF 3P63A 1V97A 2DYOA 4C7ZA 3AE1B 2WXNA 2LEKA 2Z8LA 1N61A 3BWUD 3AMZA 2WXQA 4WH4A 4M0WA 1QOAA 4Q2JA 4ARCA 2WU5B 1TS2A 5HFYA 1E9MA 2GI9A 1AN8A 3SR6A 2LMCA 3AE6B 1J7BA 4ZYSA 1YQ4B 1HXYD 5BYSA 3OWEB 3EA6A 4NZLB 4C80A 2M0AA 4HJGE 1DOYA 1C79A 2RMMA 3TEXA 1XLPA 1QOBA 2AQ2B 4RNAA 3BYYB 2ACZB 3RPFC 1VDVA 1F0ZA 1VZ7A 1XLNA 1EWYC 4N58A 4TQ1A 2W55A 1J7CA 1QOFA 3MP9A 2EKIA 2JYTA 2K22A 3BK2A 1ACCA 1HEZE 3DWMA 2L83A 1E10A 3AE3B 1UWMA 2KAJA 3J9CA 4UDUC 1XLQA 1FFVA 2KQ4X 2WXHA 4OZAA 1XCTL 3B2GA 3GS2A 3U52E 2WU2B 2IJ0A 2K0PA 2EELA 4YTNB 1MPEA 4YTPB 2AX5A 5EE0A 5EE3A 1B1ZA 5GXGB 1TJEA 1DGJA 3AEDB 1WYGA 1MVKA 2ZW1A 1C76A 5I4DA 2WXMA 3ETRA 2OHFA 4DXFA 2IGGA 3BVGA 4MH8A 5C3JB 3UI3A 3IAS1 2WXIA 2ONQA 3AM9A 1I4RA 1SEBD 3AECB 4P6VF 1STEA 3TEWA 4LLGM 3AE2B 2J42A 1LO5D 1N5XA 1OQRA 1V8CA 1ROEA 4RH6A 2LGIA 1T6BX 1UUPA 2DYMA 3KWVA 1BMLC 3IT6B 1NYRA 3FILB 2WXGA 2M19A 3I57A 1M4VA 4GDKB 1D4BA 4LK0M 4ZRQA 1YN4A 1IBXB 1TS3A 4PT5A 2IPKD 2PVGC 3W9CB 1C4CA 3FC4A 1FM0D 1SIJA 4D2KA 4TQ0A 2LUMA 1PGXA 4WURA 2GB1A 2KWDA 1FIQA 2BS3B 1VLBA 1OQQA 3AEGB 2LHDA 1IGCA 1SE2A 3HVDA 3BK1A 3MFGA 4KKIA 3U4EG 2KMMA 3EGRA 1QQRA 3O13A 2PVOD 2V3PA 4C7YA 1KTKA 5FR3A 1WWTA 5BMHA 4RF1A 2PIAA 2VZKD 4RFBA 2SEBD 1UGJA 4JWUC 5MPOA 1BUIC 1GOZA 2QEJC 2WNMA 4HROA 5G5GA 3ZYYX 5FKAC 1ENFA 1J7AA 5D3DA 1ZOYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QT9 A;  3AEB B;  1YJJ A;  3W5U B;  2ACZ B;  3CWI A;  3RPF C;  1PDX A;  2B76 B;  1VDV A;  4ZHP A;  1AYF A;  3P4Q B;  1NEN B;  1F0Z A;  1QF6 A;  1QOG A;  3AE5 B;  1ZXI A;  1XLN A;  1EWY C;  2JX5 A;  3AEF B;  3DWG C;  2WDR B;  2G1E A;  4N58 A;  5H92 C;  3P4S B;  2W55 A;  1J7C A;  3PO0 A;  3AE8 B;  1YJI A;  3P4P B;  3HVZ A;  1QOF A;  2EKI A;  1FO4 A;  1JRP A;  2K22 A;  4YSY B;  1E0Z A;  3DWM A;  4USA A;  1FRR A;  1XLO A;  3AEA B;  2BT6 A;  1TKY A;  1E6E B;  1TKE A;  3NS1 A;  2WDV B;  2JQR B;  1L0V B;  2L83 A;  2Q5W D;  3AE3 B;  1E10 A;  1R7S A;  1E7P B;  1UWM A;  2KAJ A;  3AN1 A;  1QLB B;  1XLQ A;  3B9J A;  4YSZ B;  1RYJ A;  1FFV A;  1YQ3 B;  2CJN A;  3B2G A;  3B2F A;  1A70 A;  1OFF A;  2WU2 B;  5AUI A;  1CJE A;  2WP9 B;  4YTN B;  4YTP B;  3EUB 2;  1B9R A;  2AX5 A;  2BS4 B;  5EE0 A;  5EE3 A;  5G5H A;  3L4P A;  5GXG B;  1TJE A;  1DGJ A;  1WRI A;  1JW9 D;  2MJE A;  2K5P A;  4IDI A;  3AED B;  3AE9 B;  1WYG A;  4YT0 B;  1FXA A;  4N59 A;  3AB5 A;  2MH7 A;  1DOI A;  5AUK A;  1IUE A;  1TKG A;  1WXQ A;  2OHF A;  2W54 A;  2H89 B;  2WLB A;  2K9X A;  3ETR A;  3WCQ A;  5EE9 A;  5C2T B;  3ABV B;  1XO3 A;  1KFY B;  2Y5C A;  5C3J B;  3AE4 B;  5EE1 A;  1FFU A;  1JRO A;  3HRD D;  1I7H A;  1ZP0 B;  3VR9 B;  1L5P A;  2M56 B;  3AM9 A;  3AH7 A;  1N60 A;  1NVI D;  3LXF A;  3NVW A;  3AEC B;  3NVZ A;  4JX1 C;  4P6V F;  3LB8 C;  3AE2 B;  2HTM E;  4LTU A;  4YTM B;  1N62 A;  1AWD A;  1N5X A;  1OQR A;  2MJ3 A;  2N0S B;  1V8C A;  1ROE A;  1RFK A;  1KRH A;  1L6V A;  4WWM A;  2FBW B;  4ZOH C;  4N6E B;  3AE7 B;  3HUI A;  1N63 A;  2MJD A;  3AV8 A;  3KWL A;  1NYR A;  2L52 A;  4WQM A;  1GAQ B;  1RWS A;  4ZHO A;  2CJO A;  2WDQ B;  2M19 A;  3CIR B;  3NVV A;  4US9 A;  5H8Y E;  3P1M A;  4KX6 B;  4YXD B;  2CU3 A;  2E3T A;  1ZUD 2;  1NEK B;  1T3Q A;  4FXC A;  1GPX A;  3NVY A;  1FMA D;  1SB3 C;  1DOX A;  2PVG C;  1RM6 C;  3W5V B;  4A9A A;  4JWS C;  2DWQ A;  3VR8 B;  2PKO A;  3W9C B;  1JWA D;  1FRD A;  1SF0 A;  2QJL A;  3AEE B;  1CZP A;  1FM0 D;  1SIJ A;  3FC4 A;  3SFD B;  3SFE B;  2W3R A;  1L6U A;  1KF6 B;  1JAL A;  1FIQ A;  2BS3 B;  1VLB A;  1OQQ A;  1JQ4 A;  3AEG B;  1TYG B;  3P4R B;  1VJK A;  3P63 A;  1NI3 A;  1V97 A;  2BS2 B;  2H88 B;  3NRZ A;  3VRB B;  1NYQ A;  4C7Z A;  3AE1 B;  2LEK A;  4HRS A;  2KMM A;  3BII D;  4YSX B;  1JWB D;  1N61 A;  3AMZ A;  1QOA A;  2PVO D;  4C7Y A;  1PFD A;  1PUT A;  2WU5 B;  1WWT A;  1E9M A;  3VRA B;  1FXI A;  1WGK A;  3SR6 A;  2PIA A;  3AE6 B;  2QIE B;  1J7B A;  3FAH A;  4JWU C;  1N5W A;  1YQ4 B;  2W3S A;  5MPO A;  2WQY B;  3ZYY X;  5G5G A;  4HRO A;  4US8 A;  4C80 A;  4ITK A;  1DOY A;  1J7A A;  1XLP A;  1ZOY B;  1QOB A;  2DBY A;  2WS3 B; 
#chains in the Genus database with same CATH topology
 2JRH A;  4XDD A;  2B76 B;  1NEN B;  3EEC A;  2L00 B;  1R4N I;  3L13 A;  3PO0 A;  4MGZ E;  1YJI A;  3HVZ A;  2DNF A;  1ISN A;  2KDE B;  4HCP B;  4USA A;  3RZF A;  2PW9 A;  2OJR A;  1E6E B;  2M17 A;  4GLS C;  4WIP A;  3AN1 A;  1WM2 A;  2IY0 B;  3U7D A;  3ZGZ A;  4HDQ A;  2KC1 A;  4RGN A;  2RPV A;  2QSD A;  4KGR A;  3TSS A;  2AQ3 B;  4RM9 A;  3RNF C;  4N59 A;  4W9F A;  1ZPS A;  5AUK A;  1FEH A;  1UD7 A;  1D5M C;  3Q8B A;  4NPN A;  2D3C A;  3RUI B;  3ALB A;  1KOT A;  2JWZ A;  1CK1 A;  3Q14 C;  1K52 A;  2B3A A;  2K1F A;  3LB8 C;  1UGM A;  2FCQ A;  4RM8 A;  3DVN V;  2OJW A;  3H1U A;  3APC A;  4WWM A;  4N6E B;  2BYE A;  1E8Z A;  3V62 A;  3ZJT A;  1RLF A;  2ZW0 A;  2AEH A;  4KVG B;  3GE3 C;  2BB6 A;  2PE9 A;  4BKG A;  3NZU A;  4YXD B;  4KSK C;  3W1Y A;  1TS4 A;  1FRD A;  1S3S G;  3T3N A;  2NPT B;  2XN9 C;  2PMV A;  1WJ4 A;  5DCN A;  2BPS A;  1JWB D;  4REZ A;  2TSS A;  4W9J A;  1OQY A;  2NTT A;  4B95 A;  2C7N B;  1F1H A;  1GUA B;  1IGD A;  1N5W A;  2W3S A;  1KH0 A;  1VD2 A;  3OLM D;  2DBY A;  1QT9 A;  1ET9 A;  3LYY A;  1H8C A;  4HCN B;  2WX0 A;  4BAX A;  3PGE A;  3APF A;  1QOG A;  5HHD G;  2REX A;  5J17 A;  1CQV A;  1FO4 A;  1JRP A;  3Q6B A;  4OZB A;  4KDI C;  3A1Q B;  3V61 A;  4BBN C;  2V3N A;  1SGH A;  4W9K A;  2GBN A;  5KHQ A;  3AI5 A;  2GBR A;  2W9N A;  3M63 B;  1TTN A;  2QMT A;  1QLB B;  2NR2 A;  2PTL A;  1C4P A;  1H4R A;  2N9L A;  4GB9 A;  1YMH E;  3QWZ B;  1IPG A;  3R66 C;  3EUB 2;  2MBE A;  4LNI A;  4ZYN A;  4J3O D;  4K7W A;  2LVQ A;  3O65 B;  1SE9 A;  4A20 A;  3R8B A;  3DBL B;  2K9X A;  5C2T B;  4P7I A;  2JRI B;  4J6I A;  1FFU A;  4FUL A;  3VH3 B;  1GB1 A;  3NVZ A;  2VH1 A;  2NCN A;  5EDS A;  2L0T A;  1L6V A;  4PS3 A;  1WGY A;  4HPP A;  4K7S A;  1EF1 A;  3RCZ A;  3NVV A;  2CHZ A;  4XWW A;  1T3Q A;  3ZTD A;  3R7R A;  3DBR B;  4L23 A;  2DWQ A;  4HK2 A;  3NOB A;  3PHX B;  4O1N A;  1P0R A;  1FNW A;  2IO0 B;  3DBH B;  1MHH E;  3BVZ A;  2H88 B;  4R3D A;  1IBX A;  2VRR B;  3VRB B;  1EU4 A;  4M02 A;  1JCK B;  3B08 A;  1WGK A;  3HM6 X;  1K8R B;  5JHB A;  2I1K A;  4GDL B;  2IY1 B;  4RF0 A;  3A9J B;  4ITK A;  1FXT B;  4DBG A;  4K3B A;  3CWI A;  2J53 A;  4WJQ A;  1V1P A;  1ZXI A;  2KFK A;  2G3Q B;  3DHI C;  2K6Q A;  3RNC C;  3GOE A;  4W9E A;  2KWV B;  1GNU A;  2GLS A;  4MEL A;  1EU3 A;  3BZD B;  3VVW B;  2MBH A;  5TSS A;  2KHW B;  2CJN A;  2FCN A;  3B2F A;  3N30 A;  3ML9 A;  3ZUN A;  2GBK A;  2RDB C;  2BS4 B;  5HI1 A;  1HZ6 A;  3SHQ A;  4FA6 A;  3AE9 B;  1UZX B;  3PV1 A;  4PK1 A;  1ZXH A;  4OVU A;  1JRO A;  3HRD D;  3DPD A;  3EFU A;  2L8J A;  2RDH A;  3ZVV A;  2MA9 B;  3AXC A;  2BYV E;  3VAW A;  1UF0 A;  3RD2 A;  2BYF A;  1TY2 A;  3WAN A;  2K3U A;  3IT4 B;  3MC9 A;  2IZV B;  3R3M A;  1TS5 A;  2QIL A;  4X57 B;  4ZRJ A;  4W9C A;  1SB3 C;  4BKS D;  3K9P B;  2PLP A;  4XZ4 A;  2INP E;  2A5U A;  2RSU A;  3V05 A;  3PTF C;  3CSF A;  3UIP B;  1LFD A;  2QCZ A;  3U8Z A;  3NS8 A;  4AOF A;  4C7Z A;  2JZZ A;  1N61 A;  3BWU D;  2WXQ A;  4Q2J A;  2NPT A;  1AN8 A;  4ZYS A;  4P1C C;  3EA6 A;  4IW0 A;  2KX3 A;  2M0A A;  2LAS A;  3SDL C;  1HTQ A;  3BYY B;  2ACZ B;  3RPF C;  2YLM A;  2ZPN A;  1F0Z A;  4FLH A;  4TQ1 A;  2ZCC A;  1J7C A;  4BKS A;  1QOF A;  2EKI A;  4II3 B;  3ECI A;  2IO1 B;  2R2Q A;  3ZNG C;  1V2Y A;  2L83 A;  3CMM B;  1XLQ A;  4FHK A;  3DVN U;  4ACF A;  4KSL C;  3U52 E;  2WU2 B;  1I35 A;  5IN7 A;  3A1Q A;  2IJ0 A;  2KLC A;  1MPE A;  1WXM A;  4E71 A;  3KUC B;  1TJE A;  1DGJ A;  3H6N A;  2RR9 A;  1Y8R C;  1C76 A;  3IHP C;  2WXM A;  2YVC A;  3ZDM C;  4DXF A;  1Q1O A;  2KD0 A;  2KWU B;  2L05 A;  4MH8 A;  3UGB B;  3UI3 A;  1WGG A;  2D2Q A;  3AM9 A;  3RNB C;  1LO5 D;  2KK8 A;  4EUT A;  1BT0 A;  4RH6 A;  1E8W A;  2LRW A;  3KWV A;  3IT6 B;  1NYR A;  5J2R A;  3FIL B;  2WXG A;  4MM3 A;  4GDK B;  1D4B A;  4LK0 M;  4ZRQ A;  1YN4 A;  4PT5 A;  1J8C A;  4HPL B;  4NY0 A;  2KQS A;  3W9C B;  5JH5 C;  4D2K A;  4TQ0 A;  4NJ7 A;  4WUR A;  4EEW A;  4GOC A;  2LHD A;  4KIK B;  4GU2 A;  3BK1 A;  5DPT A;  3MFG A;  1IP9 A;  2V3P A;  4C7Y A;  3MHS D;  2IND C;  4IWP A;  4K81 A;  2ZEQ A;  1WE6 A;  4RFB A;  2SEB D;  2V4L A;  1UGJ A;  2AL3 A;  2N1W A;  3CST A;  1GOZ A;  2QEJ C;  4KDL B;  3WA0 A;  1UBI A;  1ENF A;  3PZD A;  4IUM B;  3WAM A;  1PDX A;  2V0G A;  1WRD B;  2RPQ A;  2OOB B;  2K25 A;  3AUL A;  1Y56 A;  4GDL A;  1I4H A;  3A9J A;  3RT3 B;  2M4N A;  3ZQ4 A;  2L1A A;  2NMQ A;  4BKT A;  3V6C B;  4LNN A;  4II2 B;  4FBJ B;  2WXR A;  4A3O A;  4PYZ A;  1A5R A;  1VCB A;  4H2A A;  1TIF A;  2IYD B;  1KM7 A;  1J0G A;  2LXC A;  1B9R A;  1E5W A;  4TUU A;  3TEZ A;  4HEA 1;  1WRI A;  2JXT A;  3UQB A;  4EE2 A;  2WLB A;  3L08 A;  1KJT A;  2ZZP B;  3AU4 A;  2Y5C A;  2WX1 A;  4DWF A;  5JHA A;  1L4D B;  5KHO A;  5C1Z A;  1NVI D;  2ZVO A;  4HKQ A;  1AWD A;  4W9H A;  3R7Q A;  4FJV B;  4DDI D;  3T9L A;  4ZOH C;  1S1Q B;  3A33 B;  1YN3 A;  1MG8 A;  3PT2 B;  5LXH A;  2ZJD A;  2K8H A;  3KLS X;  3P1M A;  2MBO A;  3Q8F A;  4C4V B;  1NEK B;  4FXC A;  2FCM A;  4RGT A;  3PPA A;  4WAA A;  1SE3 A;  4JL9 A;  4M0W B;  2G45 B;  2JWU A;  2KAC A;  2ZPY A;  1JWS D;  2CHW A;  1MFW A;  2FE8 A;  2MEK A;  4DXG A;  2X38 A;  3BII D;  1Q10 A;  1WJN A;  4AJY B;  5L95 C;  4NJC A;  1PFD A;  3E9S A;  2N9X A;  1F77 A;  4MJS B;  2QIE B;  2JZ3 B;  2L3Z A;  3WAO A;  1WXA A;  2HTH A;  1LGR A;  2VZK B;  2N9P C;  1FD6 A;  2J7Q B;  3K9O B;  4XDC A;  3PRP B;  4XWT A;  3RN9 C;  3JSV B;  2G1E A;  3N3K B;  2O6V B;  3RMK C;  4CQN A;  4QAY A;  3P4Q B;  3A4R A;  3D32 A;  1MHX A;  2HDE A;  1R4N B;  4G0N B;  5H92 C;  3TIX A;  3MHZ A;  1JRU A;  2D3G A;  2KDM A;  3RNA C;  2J0M A;  2BKR B;  3VDZ A;  3C8Y A;  1P7E A;  3Q3N C;  1TKE A;  1V1P B;  2WDV B;  4MH0 E;  5HKH A;  1C9F A;  2I38 A;  3KW5 B;  1PGB A;  4GIV A;  3MTN B;  2I2Y A;  1YQ3 B;  2C7H A;  3UIN B;  5IP4 D;  1YN5 A;  2N9E B;  4MGY E;  2JUO A;  3L17 A;  3L4P A;  4XE0 A;  2BWE S;  3MC0 B;  1D5Z C;  2GRI A;  4MT5 A;  3DQV A;  3M95 A;  4WWP A;  4AQ7 A;  4XYC A;  3LXF A;  4KZC A;  3NVW A;  4IM0 A;  1YNT E;  2ZCB A;  1C1Y B;  2DHZ A;  2GBM A;  1Z2M A;  4IOI E;  1GJZ A;  3M3J A;  1SBB B;  2MJD A;  1RAX A;  1SJE D;  5E6J A;  4GGQ A;  1KLU D;  1FNU A;  5AZG A;  3Q3J A;  3OJ4 B;  1P9D U;  3B0A A;  1G6J A;  4JE3 B;  2EMS A;  1WX9 A;  4NAW B;  3FIL A;  2FID A;  4GDK A;  1OGW A;  2KTF A;  1EM7 A;  2BS2 B;  1KLG D;  2CR5 A;  4AS1 A;  4DHZ E;  5J18 A;  2Y3A A;  2KTR A;  4TSS A;  3RUL A;  3VTU A;  4CYE A;  2FCS A;  3PZ7 A;  2WDT B;  2WXJ A;  2XBB C;  4B0M A;  4ARI A;  2CU1 A;  1WJ6 A;  4KIK A;  2WWZ A;  2K8B A;  3GP7 A;  1XF5 L;  1YJJ A;  3W5U B;  3W1S A;  3KQ4 A;  2DZI A;  2J0K A;  2LRU A;  4F8C B;  5BYR A;  1I4Q A;  3UQA A;  1WMH A;  3NUH B;  3AE8 B;  5D7G A;  2G4S A;  4LNK A;  5BMI A;  1E0Z A;  1TBE A;  1FPY A;  2NBW B;  3NHE B;  3X0W A;  2J52 A;  2LXA A;  3NS1 A;  2JQR B;  3RNG C;  5E6O A;  2NVU I;  4IKG A;  1ZDV A;  5AZF A;  4A6Q A;  1A70 A;  2MSE D;  1QIL A;  2JXX A;  2K8C A;  1N6Z A;  2MWS B;  3DOW A;  1TT5 B;  1TKG A;  2MW5 A;  4WJP A;  1J19 A;  3U7Z A;  2EKE C;  3I9V 1;  2DEN B;  3N1X C;  4EKU A;  1L5P A;  2R61 A;  3Q8C A;  3T8M A;  1AW7 A;  2UU7 A;  3JVZ X;  4YTM B;  2FUG 1;  3V60 A;  3ZW3 A;  2LJ5 A;  4ICV A;  2KDB A;  3KYD D;  3R2I A;  1N63 A;  3KWL A;  1IYF A;  1YJ1 A;  1GAQ B;  2DLB A;  2DYB A;  2PEA A;  2JY6 A;  3ZKJ C;  4JGH B;  2E3T A;  1FMA D;  1WZ0 A;  1EO6 A;  2KVR A;  4BVU C;  1PYW D;  2PKO A;  1SF0 A;  3SFE B;  1T0Y A;  4MM3 B;  1KF6 B;  3S2A A;  4YWG G;  3P4R B;  3PRZ A;  3M62 B;  3V3X A;  4C4V A;  2WYQ A;  3AE1 B;  4EFO A;  2LEK A;  2V3S A;  3AMZ A;  4WH4 A;  2HE7 A;  1L7Y A;  4M0W A;  4ARC A;  2WU5 B;  2MRP A;  5HFY A;  1E9M A;  2MP2 A;  2GI9 A;  2LMC A;  3AE6 B;  5LLI A;  4MEM A;  1WR6 E;  1HXY D;  3OWE B;  4C80 A;  4HJG E;  1DOY A;  2RMM A;  4NNJ B;  1XLP A;  2AQ2 B;  3JW0 X;  4AJW A;  1VDV A;  2KJ6 A;  4MJS A;  2DAF A;  5LXI B;  3TJP A;  3PSE B;  4GMV A;  2MLB A;  3MP9 A;  2JYT A;  3DBL I;  3JSV A;  2K22 A;  3BK2 A;  3PS6 A;  2O6V A;  3ZXR A;  3PLU A;  2HJ8 A;  4FJY A;  4EZL A;  1MG4 A;  2KQ4 X;  1X1M A;  2XK5 B;  2MBB B;  1XCT L;  4LNF A;  3I63 C;  5AZH A;  4YTP B;  2AX5 A;  4WJN A;  5GXG B;  1WYG A;  5IOI A;  3DVG Y;  4A3P A;  2OHF A;  2KJR A;  3BVG A;  3RNE C;  2ASQ A;  2KVZ A;  4TKN A;  1I4R A;  3TEW A;  1STE A;  4LLG M;  3I5J C;  1N5X A;  1ROE A;  2CKH B;  2O2V A;  3X23 A;  1WY8 A;  1BML C;  2M19 A;  4WWO A;  2L76 A;  4DHZ B;  1WF9 A;  2D3A A;  1TS3 A;  1V5O A;  2IBI B;  3H7S A;  3DBS A;  1C4C A;  2LUM A;  1PGX A;  2GB1 A;  2BS3 B;  1VLB A;  1OQQ A;  5IAA C;  5E6N A;  4M01 A;  1SE2 A;  3H7P B;  4G11 A;  3U4E G;  3DDC B;  4HDO A;  3KUD B;  2PVO D;  4NAW A;  1LQB A;  3N32 A;  5FR3 A;  1WWT A;  3OG5 A;  5BMH A;  4IC7 B;  4PYU A;  2PIA A;  3VHT C;  5DPS A;  4MDK E;  2BF8 B;  1WH3 A;  5FR6 A;  3BY4 B;  5MPO A;  3ZYY X;  5G5G A;  4CO7 A;  3IG3 A;  3MJW A;  3IAM 1;  4E74 A;  4ZHP A;  1V1O A;  1QF6 A;  1P98 A;  3AE5 B;  2WDR B;  3ZNI D;  4DXA B;  3QAQ A;  2ON8 A;  1JWU D;  5T8I A;  3UIO B;  2M8S A;  1VZ8 A;  2BT6 A;  4WWN A;  2IDY A;  1ZE3 D;  3KYC D;  2D10 A;  3W2D A;  4XC2 A;  1WGR A;  1C78 A;  4NQL B;  4TMA B;  3W1S C;  3E56 A;  3NJT A;  2YEP B;  5D2M B;  3P42 A;  4ZRI A;  3QHT A;  2WP9 B;  1E8Y A;  5G5H A;  1WFY A;  1JW9 D;  2NBV B;  1XD3 B;  5JZE B;  2OED A;  1V81 A;  4YT0 B;  1C77 A;  1DOI A;  1PQS A;  2BTE A;  2J0J A;  2FAZ A;  3U2S C;  5G55 A;  2M0X A;  3VR9 B;  3ZJV A;  2HTM E;  2PE6 B;  4DHJ B;  2MJ3 A;  3A9K B;  3VUW A;  3C0R B;  1DYQ A;  4A55 A;  3VFK A;  1PGA A;  4LJP B;  2L52 A;  4I6P A;  1P3Q U;  2ICI A;  5JXV A;  1ZUD 2;  3LDZ E;  1T0Q C;  1GPX A;  3NVY A;  3HM3 A;  2RDG A;  2N9K A;  1NBF C;  1JWA D;  3URY A;  4HXD A;  3TEY A;  4HPM B;  4OZC A;  2KOX A;  4W9I A;  2AWT A;  1TYG B;  2BBC A;  2CHX A;  1YX6 B;  1NI3 A;  2R2O A;  2E6X A;  4NAM A;  2BKF A;  4TV3 A;  1V86 A;  2KFJ A;  4JLC A;  5AEK B;  4ZRP A;  2KTR B;  2GBJ A;  2KMA A;  1FCL A;  3ZJU A;  5LNK 1;  2WS3 B;  1L0Y B;  3KUZ A;  3GZN B;  3Q3M C;  3AEF B;  3TUO A;  5E6P A;  1V49 A;  3ZLZ A;  3P4P B;  4YSY B;  2INC C;  1F52 A;  3ENE A;  1TKY A;  1R7S A;  1E7P B;  2ZNV B;  4RGO S;  1WMH B;  2WXF A;  1FCC C;  3QCA A;  3ZIM A;  1CJE A;  1FXA A;  1Q5W B;  4FJZ A;  2XK5 A;  5DPW A;  4KGT A;  4F1S A;  1I7H A;  1XXG A;  5CX3 A;  3PLV A;  3U30 A;  1N60 A;  3GB1 A;  2KAN A;  1D5X C;  2GOW A;  1EUV B;  2RGF A;  1HE8 A;  2PJH A;  4KV2 A;  4WQM A;  4M8M A;  2LGD A;  3IXS A;  1UWX A;  2PPH A;  3VXW A;  3N20 C;  2V1Y A;  2CU3 A;  3APD A;  3I3T B;  3AU5 A;  2QJL A;  3DVG X;  3IVF A;  3LJ3 A;  1F9J A;  1VJK A;  4FHJ A;  3TL5 A;  4L1B A;  2J4X A;  4HRS A;  2WXK A;  4YSX B;  1E7U A;  1T0R C;  4I6N B;  3FKY A;  2WXL A;  5L83 A;  2CS4 A;  4XGA B;  3HHM A;  5HG2 A;  4W9G A;  3BVM A;  3ONS A;  3H7P A;  4HKZ E;  1EF5 A;  1WI0 A;  1I42 A;  1YOV B;  2BYT A;  2MP2 B;  3IBE A;  2IGD A;  3DCG A;  4AUQ C;  3Q8A A;  4G50 A;  4B9K A;  3DWG C;  2BB5 A;  4ANV A;  4BBN F;  2LI5 A;  2IO3 B;  3A4S C;  3DHH C;  4FN2 A;  2Q5W D;  4DHJ D;  3B9J A;  4IM2 A;  1RYJ A;  1SIF A;  1OFF A;  3GE8 C;  1FNV A;  2C9W B;  2V4I B;  2IGH A;  4LDT B;  1R4M I;  2I1J A;  1ZKH A;  1T5X D;  2H89 B;  1XO3 A;  4HVB A;  5IKC M;  1OEY A;  1ZP0 B;  4MGI E;  2BVC A;  3VTW A;  2G9H D;  4ANW A;  3R2T A;  2WXP A;  3TCA A;  2DX5 B;  4LTU A;  1I4X A;  3HK0 A;  1RFK A;  2FBW B;  2IO2 B;  1K50 A;  4A90 A;  4RGM A;  1YX5 B;  3WIM A;  4ZHO A;  3CIR B;  3C19 A;  4KX6 B;  2C5L C;  1XCQ L;  3A9K A;  3Q3F A;  1DOX A;  2O2V B;  3W5V B;  1VRA B;  1K51 A;  3ZNZ B;  4B0E A;  5CHV C;  3VUX A;  5D94 A;  1L6U A;  1HTO A;  1OTR B;  5D3I B;  1WGD A;  4EOY A;  1HA5 A;  2YEP F;  3P63 A;  2WXN A;  1E90 A;  1GG3 A;  2LGS A;  3PRE A;  1NI2 A;  1QOA A;  2KJH B;  2D11 A;  3RYT A;  1KLV A;  1TS2 A;  4ASW C;  1J7B A;  1TZ1 A;  2G4D B;  4N9F 4;  5BYS A;  4NZL B;  4YL8 A;  2LD9 A;  4KZ0 A;  4AWJ A;  3TEX A;  1QOB A;  5G2N A;  2N7D A;  1VZ7 A;  1EWY C;  3TMP B;  2MX2 A;  4S17 A;  1HEZ E;  4ZRK A;  1E8X A;  2FUH B;  1UWM A;  1Z5S B;  1FFV A;  2WXH A;  4EZK A;  3KH0 A;  3B2G A;  3GS2 A;  2A4Z A;  1WZ3 A;  2KKC A;  2K0P A;  2EEL A;  5EE0 A;  5EE3 A;  1Q0W B;  2LUE A;  2EMT A;  2MHJ A;  3AED B;  4HLE A;  4URK A;  3ETR A;  5C23 A;  1QZE A;  5C3J B;  2QHO A;  2D07 B;  3IAS 1;  3AEC B;  4P6V F;  4CHK A;  4WQO B;  2UYZ B;  4M8N A;  1V8C A;  3H9D A;  1UUP A;  3VTV A;  1E7V A;  2NBU A;  3I57 A;  1M4V A;  2FNJ B;  2Z0E B;  1ZW7 A;  2HJ1 A;  1FM0 D;  1SIJ A;  2KDF B;  4IWO A;  2KWD A;  3QIJ A;  3L54 A;  1YQB A;  4K3C A;  4ZDV A;  3EGR A;  3ML8 A;  1KTK A;  2VH2 A;  3QC8 B;  5IA7 A;  2VZK D;  3VUY A;  2GMI C;  1BUI C;  2O6V D;  4HRO A;  5FKA C;  1J7A A;  1OEY J;  5DPR A;  4LDT D;  4L2Y A;  2WXO A;  2BW2 A;  2JF5 A;  2JX5 A;  3T3O A;  3JYU A;  3QJZ A;  2AYO B;  1WSP A;  1F2R C;  1FRR A;  1ZDX A;  4RMA A;  3NZ3 A;  4MGK E;  1UEL A;  3ZRF A;  4YSZ B;  1WX8 A;  2K39 A;  2KMC A;  1TGZ B;  1LM8 B;  5AUI A;  2JYE A;  5BO4 B;  2BWF A;  3Q3O C;  4IDI A;  3AB5 A;  2W54 A;  1WXS A;  4S0R A;  4C56 C;  5EE9 A;  1XEE A;  3ABV B;  3L0W B;  2N7E A;  1WM3 A;  5BYQ A;  3VQI A;  2M56 B;  2JVC A;  4F7Z A;  2LGY A;  1ET6 A;  4NQK E;  1N62 A;  1JWM D;  2N0S B;  2MCN B;  3BYT B;  3ZNH B;  4EZJ A;  1KRH A;  4BOZ B;  3AE7 B;  2KZR A;  3ZRC A;  1RWS A;  4K7U A;  1ESF A;  2CJO A;  1SE4 A;  2BQQ A;  2MBQ A;  3P2B A;  3DBR I;  1L0X B;  4JWS C;  1C4A A;  1WE7 A;  1P1A A;  3SFD B;  2Y5B B;  2W3R A;  2LVO A;  1JAL A;  3DBH I;  1JQ4 A;  4BFR A;  3CF6 E;  3RZW C;  3NRZ A;  1NYQ A;  2N7J A;  1C3T A;  1V9J A;  4C00 A;  1I4G A;  3Q8E A;  3VH4 B;  3IFW B;  3VRA B;  1SJH D;  2SAK A;  4ANU A;  3EHV A;  2KYW A;  4GSW A;  4OHJ A;  3NY5 A;  3H8H A;  2WHI A;  5D6J B;  3B1L X;  4JPS A;  2Z59 B;  3AEB B;  5IO9 A;  2LJI A;  2C60 A;  3P4S B;  1MJD A;  2AL6 A;  4K1R B;  2JZP A;  4RCO A;  3SEB A;  1U4A A;  2C7M B;  4HJK A;  2MQJ A;  3PRM B;  1TY0 A;  4DK5 A;  2KDI A;  4ICU A;  1SXT A;  2MJE A;  2KX0 A;  2KWC A;  4DQO C;  1VZ6 A;  2MH7 A;  1WXQ A;  3MJ5 A;  5BMG A;  2KLG A;  1VR9 A;  3WCQ A;  1EWC A;  1ZGU B;  1L2N A;  1KFY B;  3AE4 B;  1P7F A;  3ZTC A;  5EE1 A;  2JSV X;  1BXT A;  3AH7 A;  4HWI B;  4JX1 C;  4AP4 C;  2JT4 B;  3ZO5 B;  3RI7 C;  3QA8 A;  2INN E;  4GN1 A;  1F2R I;  4MSQ B;  2ZNV C;  2DZJ A;  4ANX A;  2RD0 A;  3QAR A;  1D6E C;  2Y5P A;  5TR5 A;  1GC7 A;  2WDQ B;  3WAL A;  4US9 A;  3HIZ A;  2DAJ A;  3EC8 A;  4A8X C;  3TBL D;  4LCD E;  1YD8 U;  2L7R A;  3L16 A;  1RM6 C;  4JQW C;  2Z0D B;  4OVZ A;  1L4Z B;  3AEE B;  1QKZ A;  1UBQ A;  3N1Z C;  1GB4 A;  4LNO A;  4WAF A;  2K6D B;  3PZ8 A;  2DZK A;  2JU6 X;  2KN4 A;  3Q2A C;  1PUT A;  4BOS C;  3PVL A;  1HZ5 A;  1MI0 A;  1FXI A;  4KKJ A;  3Q69 A;  2LGX A;  3FAH A;  1RFA A;  2AQ1 B;  2WQY B;  5CTR C;  4US8 A;  3WAP A;  3V6E B;  4WJO A;  1UH6 A;  2QC8 A;  1SSN A;  2NS5 A;  2QDF A;  3ZXV A;  3OAW A;  1AYF A;  1WXV A;  1WJU A;  2WGS A;  4P16 A;  4KGS A;  1CMX B;  5CHF A;  1XLO A;  3AEA B;  4IG7 B;  1RRB A;  2BGF A;  1L0V B;  1TZO A;  4B6W A;  1T0S C;  5GMV A;  1YIW A;  1GC6 A;  3SU8 X;  4NJ6 A;  4G3X B;  4DDG D;  4P1B C;  2K5P A;  4I6L B;  2W82 A;  2L32 A;  2XNA C;  3QK0 A;  4IM3 A;  3VR8 B;  1JML A;  1IUE A;  3MC8 A;  1WIA A;  3DHG C;  4A9A A;  2L0F A;  1HQR D;  2LHE A;  3QX1 A;  3L10 B;  4OW0 A;  2JPH A;  3N9Y C;  4LJO B;  2KC2 A;  3HUI A;  2NTS A;  2V9H A;  3AV8 A;  1XQQ A;  1WX7 A;  1UNS A;  4E3C A;  5H8Y E;  4JIO U;  5FK9 C;  4MAC A;  1CZP A;  2UWQ A;  2D5G A;  2FIF A;  2LFI A;  3RFZ B;  1K53 A;  1I4P A;  1V97 A;  1V5T A;  3GZN I;  2DYO A;  3SD5 A;  3UF8 A;  2KXJ A;  4XX5 A;  2Z8L A;  3NZS A;  1XT9 B;  3N1Y C;  2X8X X;  2N4F A;  3SR6 A;  3NG0 A;  2LZ6 A;  3BIN A;  1YQ4 B;  4PS7 A;  3ZDT A;  1C79 A;  4RNA A;  3QQ8 B;  4PS8 A;  1NDD A;  1XLN A;  2LVP A;  4N58 A;  2W55 A;  2ZVN A;  1WGH A;  1ACC A;  3DWM A;  3OJ3 A;  4MSM B;  2KNB A;  3AE3 B;  1E10 A;  2KAJ A;  3J9C A;  4UDU C;  1LXD A;  4OZA A;  2KN5 A;  2KT7 A;  2LWP A;  4YTN B;  1B1Z A;  2KQ7 A;  1R4M B;  2KO3 A;  1MVK A;  2ZW1 A;  5I4D A;  1AAR A;  1WYW B;  2IGG A;  2WXI A;  2ONQ A;  1SEB D;  4BZA A;  3AE2 B;  4FAD A;  2J42 A;  1D3Z A;  2HD5 B;  1OQR A;  3PHW B;  2LGI A;  1T6B X;  2DYM A;  2DZM A;  2M1M A;  1IBX B;  2IPK D;  4IWQ A;  2PVG C;  4W9L A;  1V6E A;  2N1V A;  1M94 A;  3FC4 A;  3KVF B;  5CHW A;  1FIQ A;  1WR1 A;  4M00 A;  3AEG B;  2XEW A;  1IGC A;  3EFC A;  3HVD A;  4GXB A;  2D3B A;  4KKI A;  2KMM A;  1QQR A;  3O13 A;  4W9D A;  4RF1 A;  1V80 A;  2KFK B;  4JWU C;  4OVV A;  2WNM A;  5D3D A;  1ZOY B; 
#chains in the Genus database with same CATH homology
 4XDD A;  3IAM 1;  1PDX A;  4L2Y A;  2B76 B;  4ZHP A;  2V0G A;  2WXO A;  1V1O A;  1NEN B;  2BW2 A;  1QF6 A;  3AE5 B;  2JX5 A;  2WDR B;  3T3O A;  1Y56 A;  2ON8 A;  3PO0 A;  1YJI A;  3HVZ A;  1I4H A;  1JWU D;  5T8I A;  1WSP A;  1F2R C;  4USA A;  1FRR A;  2PW9 A;  1ZDX A;  1VZ8 A;  3ZQ4 A;  2BT6 A;  2L1A A;  2IDY A;  1ZE3 D;  1E6E B;  2NMQ A;  4GLS C;  3NZ3 A;  3W2D A;  4WIP A;  2WXR A;  3AN1 A;  3ZGZ A;  4YSZ B;  1C78 A;  4TMA B;  3E56 A;  2YEP B;  4RGN A;  4H2A A;  2RPV A;  5AUI A;  2JYE A;  3P42 A;  2WP9 B;  1B9R A;  2QSD A;  4KGR A;  3TSS A;  5G5H A;  3TEZ A;  4HEA 1;  2AQ3 B;  1WRI A;  2JXT A;  1JW9 D;  4IDI A;  4EE2 A;  2OED A;  4YT0 B;  1C77 A;  3AB5 A;  1ZPS A;  1DOI A;  1FEH A;  2W54 A;  4N59 A;  1D5M C;  2WLB A;  5AUK A;  2BTE A;  4C56 C;  3Q8B A;  5EE9 A;  1XEE A;  3ABV B;  3U2S C;  2Y5C A;  5BYQ A;  1L4D B;  3VQI A;  3VR9 B;  1CK1 A;  2M56 B;  1NVI D;  1K52 A;  3ZJV A;  3LB8 C;  2HTM E;  1ET6 A;  4HKQ A;  1N62 A;  1AWD A;  1JWM D;  2MJ3 A;  2N0S B;  3BYT B;  1KRH A;  1DYQ A;  4WWM A;  4ZOH C;  4A55 A;  4N6E B;  1PGA A;  3AE7 B;  1YN3 A;  2L52 A;  3ZJT A;  1RWS A;  2ZW0 A;  1ESF A;  2CJO A;  1SE4 A;  2BB6 A;  2ICI A;  3KLS X;  3P1M A;  4YXD B;  3Q8F A;  5JXV A;  1ZUD 2;  1NEK B;  4FXC A;  1GPX A;  3NVY A;  1TS4 A;  2RDG A;  1L0X B;  4RGT A;  4JWS C;  2N9K A;  1C4A A;  1JWA D;  1FRD A;  3URY A;  3TEY A;  1SE3 A;  3T3N A;  3SFD B;  2JWU A;  2KAC A;  2W3R A;  4OZC A;  1JAL A;  2XN9 C;  1JQ4 A;  2PMV A;  1TYG B;  1JWS D;  2BBC A;  1NI3 A;  2FE8 A;  2E6X A;  2MEK A;  3NRZ A;  1NYQ A;  4DXG A;  4NAM A;  2N7J A;  2X38 A;  3BII D;  1JWB D;  4REZ A;  1Q10 A;  4NJC A;  1I4G A;  1PFD A;  3E9S A;  3Q8E A;  2TSS A;  1F77 A;  3VRA B;  1SJH D;  2SAK A;  2NTT A;  2QIE B;  4OHJ A;  4ZRP A;  2VZK B;  1IGD A;  1N5W A;  2W3S A;  3H8H A;  1FD6 A;  4XDC A;  1FCL A;  4XWT A;  3ZJU A;  4JPS A;  1KH0 A;  5LNK 1;  2G1E A;  2DBY A;  2WS3 B;  1QT9 A;  1ET9 A;  3AEB B;  1L0Y B;  3LYY A;  4CQN A;  3P4Q B;  1MHX A;  1QOG A;  2HDE A;  2LJI A;  3AEF B;  5HHD G;  3TUO A;  5H92 C;  1CQV A;  3P4S B;  3MHZ A;  2KDM A;  3P4P B;  1FO4 A;  1JRP A;  4OZB A;  4YSY B;  2JZP A;  4RCO A;  3SEB A;  3C8Y A;  1P7E A;  2V3N A;  1TKY A;  1TKE A;  1V1P B;  2WDV B;  1C9F A;  2I38 A;  1R7S A;  1E7P B;  1PGB A;  2QMT A;  4RGO S;  1QLB B;  2WXF A;  2PTL A;  2I2Y A;  1YQ3 B;  1C4P A;  2N9L A;  1YMH E;  1YN5 A;  1FCC C;  1TY0 A;  1CJE A;  3EUB 2;  3L4P A;  4XE0 A;  1SXT A;  2MJE A;  4J3O D;  1FXA A;  4DQO C;  1VZ6 A;  2MH7 A;  3MC0 B;  1D5Z C;  1WXQ A;  3MJ5 A;  5BMG A;  3R8B A;  2K9X A;  1VR9 A;  3WCQ A;  2GRI A;  4MT5 A;  1EWC A;  5C2T B;  1KFY B;  3AE4 B;  1P7F A;  4KGT A;  5EE1 A;  4AQ7 A;  2JSV X;  1FFU A;  1I7H A;  1GB1 A;  1XXG A;  3LXF A;  3NVZ A;  1BXT A;  3AH7 A;  1N60 A;  3GB1 A;  3NVW A;  4JX1 C;  1D5X C;  1YNT E;  2INN E;  4IOI E;  1F2R I;  1L6V A;  1SBB B;  2MJD A;  1D6E C;  1SJE D;  2Y5P A;  4WQM A;  5E6J A;  2WDQ B;  3IXS A;  1UWX A;  3NVV A;  4US9 A;  1KLU D;  1FNU A;  2CU3 A;  4A8X C;  4XWW A;  1T3Q A;  4L23 A;  1RM6 C;  2DWQ A;  4JE3 B;  4O1N A;  4OVZ A;  1L4Z B;  2QJL A;  3AEE B;  4NAW B;  1QKZ A;  1FNW A;  3FIL A;  1MHH E;  3BVZ A;  1GB4 A;  1EM7 A;  1VJK A;  4WAF A;  2BS2 B;  2H88 B;  4R3D A;  1IBX A;  1KLG D;  4AS1 A;  3VRB B;  3PZ8 A;  2JU6 X;  2KN4 A;  2Y3A A;  4L1B A;  2J4X A;  4HRS A;  2WXK A;  1EU4 A;  4TSS A;  4YSX B;  3PZ7 A;  2WXJ A;  1PUT A;  2WXL A;  4B0M A;  1JCK B;  1HZ5 A;  1MI0 A;  4ARI A;  1FXI A;  4KKJ A;  5HG2 A;  1WGK A;  3BVM A;  3Q69 A;  3FAH A;  2AQ1 B;  4HKZ E;  4GDL B;  2WQY B;  4US8 A;  4RF0 A;  4ITK A;  3GP7 A;  1SSN A;  2BYT A;  1XF5 L;  1YJJ A;  3W5U B;  3W1S A;  3KQ4 A;  2IGD A;  3CWI A;  3Q8A A;  2J53 A;  1AYF A;  1V1P A;  5BYR A;  1ZXI A;  3DWG C;  2BB5 A;  1I4Q A;  4P16 A;  3NUH B;  3AE8 B;  5D7G A;  4KGS A;  5BMI A;  1E0Z A;  1XLO A;  3AEA B;  2J52 A;  3NS1 A;  1EU3 A;  2JQR B;  3BZD B;  1L0V B;  1TZO A;  2Q5W D;  4IKG A;  1ZDV A;  5TSS A;  3B9J A;  1RYJ A;  4A6Q A;  2CJN A;  3B2F A;  1A70 A;  1OFF A;  1QIL A;  1FNV A;  2BS4 B;  5HI1 A;  2V4I B;  2IGH A;  1HZ6 A;  2K5P A;  3AE9 B;  2W82 A;  2L32 A;  2XNA C;  1T5X D;  3VR8 B;  1JML A;  1IUE A;  1TKG A;  2H89 B;  1ZXH A;  3U7Z A;  1XO3 A;  3I9V 1;  1JRO A;  3HRD D;  1ZP0 B;  1L5P A;  4A9A A;  2G9H D;  2RDH A;  2R61 A;  3Q8C A;  1AW7 A;  1HQR D;  3R2T A;  2LHE A;  2WXP A;  4LTU A;  4YTM B;  2FUG 1;  4OW0 A;  1I4X A;  1RFK A;  3N9Y C;  2FBW B;  1K50 A;  3R2I A;  3HUI A;  1N63 A;  2NTS A;  3AV8 A;  3KWL A;  1TY2 A;  4A90 A;  1UNS A;  1GAQ B;  2DLB A;  2K3U A;  3IT4 B;  4RGM A;  4ZHO A;  3CIR B;  5H8Y E;  4KX6 B;  2E3T A;  1TS5 A;  2QIL A;  1XCQ L;  5FK9 C;  1FMA D;  1SB3 C;  1DOX A;  2PLP A;  1PYW D;  1VRA B;  1K51 A;  2INP E;  3W5V B;  2PKO A;  4B0E A;  1SF0 A;  3SFE B;  4MAC A;  1CZP A;  3V05 A;  1L6U A;  4MM3 B;  1KF6 B;  2D5G A;  2LFI A;  5D3I B;  4YWG G;  3RFZ B;  3P4R B;  1K53 A;  3V3X A;  1HA5 A;  1I4P A;  2YEP F;  3P63 A;  1V97 A;  2DYO A;  4C7Z A;  3AE1 B;  2WXN A;  2LEK A;  2Z8L A;  1N61 A;  3BWU D;  3AMZ A;  2WXQ A;  4WH4 A;  4M0W A;  1QOA A;  4Q2J A;  4ARC A;  2WU5 B;  1TS2 A;  5HFY A;  1E9M A;  2GI9 A;  1AN8 A;  3SR6 A;  2LMC A;  3AE6 B;  1J7B A;  4ZYS A;  1YQ4 B;  1HXY D;  5BYS A;  3OWE B;  3EA6 A;  4NZL B;  4C80 A;  2M0A A;  4HJG E;  1DOY A;  1C79 A;  2RMM A;  3TEX A;  1XLP A;  1QOB A;  2AQ2 B;  4RNA A;  3BYY B;  2ACZ B;  3RPF C;  1VDV A;  1F0Z A;  1VZ7 A;  1XLN A;  1EWY C;  4N58 A;  4TQ1 A;  2W55 A;  1J7C A;  1QOF A;  3MP9 A;  2EKI A;  2JYT A;  2K22 A;  3BK2 A;  1ACC A;  1HEZ E;  3DWM A;  2L83 A;  1E10 A;  3AE3 B;  1UWM A;  2KAJ A;  3J9C A;  4UDU C;  1XLQ A;  1FFV A;  2KQ4 X;  2WXH A;  4OZA A;  1XCT L;  3B2G A;  3GS2 A;  3U52 E;  2WU2 B;  2IJ0 A;  2K0P A;  2EEL A;  4YTN B;  1MPE A;  4YTP B;  2AX5 A;  5EE0 A;  5EE3 A;  1B1Z A;  5GXG B;  1TJE A;  1DGJ A;  3AED B;  1WYG A;  1MVK A;  2ZW1 A;  1C76 A;  5I4D A;  2WXM A;  3ETR A;  2OHF A;  4DXF A;  2IGG A;  3BVG A;  4MH8 A;  5C3J B;  3UI3 A;  3IAS 1;  2WXI A;  2ONQ A;  3AM9 A;  1I4R A;  1SEB D;  3AEC B;  4P6V F;  1STE A;  3TEW A;  4LLG M;  3AE2 B;  2J42 A;  1LO5 D;  1N5X A;  1OQR A;  1V8C A;  1ROE A;  4RH6 A;  2LGI A;  1T6B X;  1UUP A;  2DYM A;  3KWV A;  1BML C;  3IT6 B;  1NYR A;  3FIL B;  2WXG A;  2M19 A;  3I57 A;  1M4V A;  4GDK B;  1D4B A;  4LK0 M;  4ZRQ A;  1YN4 A;  1IBX B;  1TS3 A;  4PT5 A;  2IPK D;  2PVG C;  3W9C B;  1C4C A;  3FC4 A;  1FM0 D;  1SIJ A;  4D2K A;  4TQ0 A;  2LUM A;  1PGX A;  4WUR A;  2GB1 A;  2KWD A;  1FIQ A;  2BS3 B;  1VLB A;  1OQQ A;  3AEG B;  2LHD A;  1IGC A;  1SE2 A;  3HVD A;  3BK1 A;  3MFG A;  4KKI A;  3U4E G;  2KMM A;  3EGR A;  1QQR A;  3O13 A;  2PVO D;  2V3P A;  4C7Y A;  1KTK A;  5FR3 A;  1WWT A;  5BMH A;  4RF1 A;  2PIA A;  2VZK D;  4RFB A;  2SEB D;  1UGJ A;  4JWU C;  5MPO A;  1BUI C;  1GOZ A;  2QEJ C;  2WNM A;  4HRO A;  5G5G A;  3ZYY X;  5FKA C;  1ENF A;  1J7A A;  5D3D A;  1ZOY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...