4JWSC

Crystal structure of cytochrome p450cam-putidaredoxin complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLECVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Camphor 5-monooxygenase
publication title Structural basis for effector control and redox partner recognition in cytochrome P450.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 30
structure length 106
sequence length 106
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4jwsC00
1NYQA 1GPXA 2PKOA 3AE5B 1YJJA 2KAJA 4ZHOA 4USAA 3RPFC 3W5UB 3NVWA 1QOBA 2HTME 1TKGA 2MJDA 2WU5B 1CZPA 2K5PA 4P6VF 4C7ZA 3W5VB 1E0ZA 1XLQA 1E7PB 4HRSA 1FIQA 2AX5A 1V97A 2OHFA 3VRBB 1B9RA 1FXAA 3P4QB 1RFKA 3AMZA 4JX1C 2BS2B 2W3SA 4LTUA 1TYGB 5AUIA 3PO0A 1WXQA 1JW9D 1RWSA 3FC4A 3AEEB 4JWSC 1L0VB 1AWDA 4JWUC 3VR8B 2BS3B 4WWMA 3ABVB 1ZP0B 2BT6A 1EWYC 1WRIA 2M56B 1OQQA 2K22A 2WS3B 4N6EB 3P63A 1L6VA 2L83A 1ZUD2 3AE9B 4FXCA 1QOAA 1SF0A 2QJLA 3AB5A 1YJIA 3SFDB 2FBWB 1QT9A 4KX6B 3FAHA 5EE1A 4ITKA 2N0SB 1J7BA 2B76B 1KFYB 1FXIA 1J7AA 2DWQA 1FRRA 2H88B 2PVOD 2W3RA 1WGKA 3AE6B 3LXFA 1PDXA 2L52A 3NS1A 1XLOA 3HRDD 1PUTA 1KRHA 1FM0D 1A70A 3ETRA 2QIEB 1WYGA 1OFFA 1TJEA 3AEFB 2PVGC 2W55A 1N5WA 2WDQB 1AYFA 1SB3C 3AM9A 1RYJA 2WQYB 4YSYB 5MPOA 4ZOHC 2M19A 2E3TA 1YQ3B 3AE3B 3AE4B 1NI3A 3P4PB 2CJOA 1QF6A 1NYRA 1TKYA 1UWMA 1QOGA 2Q5WD 4ZHPA 2Y5CA 1JALA 1DOYA 2JX5A 1J7CA 2CU3A 5AUKA 1JWBD 3BIID 1XLNA 3B2GA 5H92C 3CIRB 3AE8B 1N61A 4YTNB 2EKIA 1IUEA 1DGJA 5G5GA 1T3QA 2ACZB 2WLBA 3AN1A 5EE9A 4YXDB 3AE7B 2WDVB 2W54A 3AEBB 4HROA 1JWAD 3NVYA 1ZOYB 3AEGB 3HUIA 1E6EB 4C80A 1NENB 4N58A 4YTMB 1DOXA 2WP9B 1PFDA 5GXGB 3ZYYX 2PIAA 3NRZA 4US9A 1I7HA 1N5XA 1JROA 2WU2B 5EE0A 3SFEB 1JRPA 1FFVA 1XO3A 2KMMA 3P4SB 1FRDA 1TKEA 4WQMA 1QLBB 2K9XA 2WDRB 4IDIA 4YSXB 1N62A 3P4RB 3LB8C 1DOIA 1YQ4B 3AEDB 3P1MA 2BS4B 1JQ4A 2H89B 5EE3A 1FO4A 2LEKA 2MH7A 5C2TB 3AE1B 1SIJA 1FMAD 4C7YA 2G1EA 2MJ3A 1L5PA 1ROEA 1RM6C 1WWTA 3CWIA 3DWGC 1ZXIA 1F0ZA 1KF6B 1L6UA 3AE2B 2CJNA 1GAQB 3SR6A 1VJKA 3AH7A 1FFUA 1VLBA 3AV8A 3NVZA 1XLPA 2MJEA 4YSZB 1OQRA 2DBYA 2JQRB 4YTPB 3KWLA 3EUB2 3W9CB 3L4PA 1NVID 3B9JA 1N60A 4YT0B 3AEAB 1CJEA 3HVZA 3DWMA 5G5HA 4US8A 1E9MA 1R7SA 1V8CA 4N59A 3VR9B 5C3JB 3NVVA 1N63A 5H8YE 4A9AA 3AECB 1QOFA 1VDVA 3B2FA 3WCQA 1NEKB 1E10A 3VRAB
chains in the Genus database with same CATH superfamily
5D2MB 1NI2A 3QA8A 3X23A 2MJDA 1XCQL 1UH6A 3AMZA 3BY4B 5AUIA 2NR2A 1WGGA 2LFIA 1OTRB 1V1PB 2ZNVC 3L16A 2K22A 2L0TA 3NOBA 4XDDA 2RPQA 3UGBB 2LGDA 3ZTDA 4M8NA 3WA0A 2BPSA 2G45B 4GU2A 4CQNA 3KVFB 1J8CA 2QILA 4BKTA 1E8XA 2I1JA 5MPOA 3AE3B 2NBUA 3ZXVA 1VRAB 1PGXA 3ZRFA 1T0QC 3IBEA 2XN9C 3LDZE 3WIMA 3H9DA 4OVZA 4CHKA 2ZNVB 1N61A 2LUMA 4YXDB 3A4SC 3PZ8A 1HTOA 3DVNU 3GZNI 4RM8A 2YEPB 5IP4D 4ANVA 5HI1A 2J52A 2D10A 4HKZE 4K3BA 3N1YC 5JHBA 2NS5A 3QARA 2GBJA 2WDRB 1WE6A 2N4FA 1WJ4A 4AOFA 4C4VB 2D5GA 4GLSC 1V1PA 4NY0A 2V3PA 3FKYA 2J53A 1KM7A 2KX3A 3HHMA 2BTEA 2G1EA 5CHWA 4I6PA 1E8WA 3K9OB 1K50A 4NAWA 1MFWA 2HJ1A 1D4BA 4RMAA 1TGZB 3MJWA 3DCGA 1V9JA 4A9AA 5H8YE 5DPWA 3AECB 4HLEA 3W5UB 1GOZA 5IOIA 4S17A 1C77A 3VAWA 4W9EA 2ZEQA 1WXMA 1HEZE 1IBXB 2V9HA 2IO1B 2N1WA 3ZLZA 4DQOC 2KYWA 1ZP0B 2BBCA 1OQQA 3R3MA 3A1QA 1HA5A 1QOAA 2R2OA 2IPKD 5E6PA 1SJHD 1HXYD 5T8IA 1KFYB 1FXIA 3NZSA 4E74A 2JZPA 1XLOA 2XBBC 2KQ4X 5AEKB 2IGGA 3AM9A 2J0KA 2WWZA 2VH2A 1RFAA 1Q5WB 2WQYB 4GB9A 3QJZA 2YVCA 4IUMB 3QX1A 4RFBA 2AL3A 5HHDG 1HQRD 4FADA 5BMIA 1IUEA 4KKJA 5EE9A 4GMVA 1CQVA 2FNJB 1WGHA 1UBQA 3RFZB 1IYFA 1GB1A 3RNGC 5LXIB 2N7JA 2MX2A 3BYYB 3VQIA 1JROA 2REXA 3IAS1 1TS4A 4RF1A 1IBXA 1C4CA 1V80A 3B08A 3AEDB 1JQ4A 1UWXA 2N9XA 2R2QA 4NJ7A 1ZXHA 2LI5A 1P1AA 1YN5A 2L0FA 2LMCA 2WXGA 3R7QA 2I38A 3W2DA 3BK2A 3V61A 5EDSA 4K81A 3GOEA 2C9WB 2KVZA 3WCQA 3ALBA 1YMHE 3PRMB 2CR5A 2KAJA 3ML9A 1MHHE 3QIJA 1VZ8A 4A8XC 4RCOA 4IWQA 1SE9A 4IOIE 1L4ZB 3VVWB 4P7IA 4MGZE 1WX7A 2X38A 3Q3MC 1AWDA 2LHEA 4KSKC 2MQJA 2ASQA 2KC1A 4RGNA 3MTNB 4OVUA 3TEWA 3AI5A 2WXQA 2K0PA 2XNAC 1MG8A 2FCQA 2MLBA 4XDCA 3N3KB 4S0RA 2V4IB 2KLGA 3NY5A 1FM0D 2V1YA 2WDQB 4YSYB 1R4NB 1MVKA 3I9V1 4XWTA 4FBJB 3AE4B 1NI3A 2MHJA 4LLGM 3ZDTA 1WGRA 4W9GA 5L83A 1JALA 1DOYA 4LCDE 3PV1A 3RNEC 3TJPA 2WXLA 5AUKA 2D07B 2Z59B 2LGSA 2CU1A 2RMMA 4G0NB 2JXTA 3ECIA 1Q1OA 4YTMB 4A55A 2ZVNA 1WR6E 2J4XA 1NBFC 4C56C 2PIAA 4WAFA 2ZZPB 2ZPYA 4EZKA 4GGQA 4IDIA 3VH3B 2L05A 2INNE 2E6XA 2H89B 4W9CA 3TEYA 5C2TB 2IZVB 2IGHA 2CKHB 1IGDA 1YQBA 2WHIA 3ZGZA 3JYUA 2CJNA 3OG5A 1WY8A 3GP7A 2MJEA 4ANWA 2ZW0A 3VTVA 3HVZA 2MBQA 4BOZB 3S2AA 3KYDD 3TEXA 3VRAB 4W9DA 4HEA1 5FKAC 3KH0A 3H6NA 3P2BA 4HRSA 2BKRB 2BS2B 4FA6A 3Q69A 1ZPSA 3JSVB 2PEAA 1XXGA 1E7UA 2PJHA 4KGRA 4KV2A 4DXGA 1V5TA 2WXKA 4ZRPA 2FBWB 3U8ZA 1OQYA 4Q2JA 1R4NI 2BYTA 3GE3C 2W3RA 1F52A 2GBNA 3AE6B 4YL8A 4WJQA 2GI9A 1LO5D 5IN7A 4OW0A 3H7PB 2FAZA 2PTLA 1TS2A 2LJ5A 3N1XC 1T0SC 1L2NA 3U7DA 3P42A 2MWSB 3RD2A 1VR9A 2AQ2B 4OZAA 2LD9A 5JH5C 2WDVB 4BZAA 2D3BA 4MM3B 4N58A 2KN4A 1DOXA 3R66C 4EEWA 3IAM1 1UNSA 2LJIA 1I7HA 1BUIC 5FR6A 1H8CA 4A3PA 2WDTB 3CF6E 1WSPA 2KK8A 4BBNC 1I4RA 2DLBA 4YSZB 3EHVA 2WXHA 3TUOA 4EFOA 1D5MC 1F2RC 4YT0B 3AEAB 2INCC 1U4AA 1TS3A 4GOCA 2K1FA 1E10A 3AE5B 4MELA 3NS8A 2K8CA 1CZPA 3PPAA 5BMGA 1FIQA 4AUQC 2RPVA 2KFJA 3KLSX 2NPTB 4DHZB 5FR3A 3UIOB 5CHVC 1WJ6A 3V62A 4XGAB 2DYMA 2KNBA 1WRIA 2I1KA 3Q8EA 4MT5A 2JYTA 4GDLB 3RUIB 2KJ6A 3NZUA 4HJGE 3IG3A 1SE2A 5D3DA 1Y8RC 2QIEB 3IHPC 2W55A 3DQVA 3TMPB 1V5OA 2Y5BB 4ASWC 1CMXB 4HK2A 2PE9A 4K7SA 2I2YA 1NYRA 2BWES 2WXPA 2M4NA 4XYCA 4IKGA 3DVGY 1C4AA 1KTKA 4DHZE 4F8CB 1FNUA 2Z8LA 2CHWA 1KLGD 2JYEA 2FCMA 4TQ0A 1LXDA 3QQ8B 1EUVB 1HZ6A 3VH4B 1FFVA 1XD3B 1XO3A 3ZW3A 3KUZA 2WYQA 2IO3B 3Q6BA 3QK0A 4P1CC 4NJCA 2MH7A 3EFCA 2MJ3A 4GDLA 2AQ1B 4IG7B 4ZRKA 3VUYA 1T0YA 1Q10A 2J0MA 1T6BX 2L76A 3APFA 2DZMA 1MG4A 1N60A 1CJEA 5DPSA 1XEEA 2INPE 4WIPA 3A33B 3RNCC 4KSLC 1UGJA 4B95A 2W3SA 2KC2A 4IC7B 3VTUA 4EZLA 3U52E 1QKZA 4MGYE 3OWEB 1TKGA 5E6NA 3EA6A 1GG3A 4ICVA 1D6EC 4DXAB 3PO0A 1WXQA 1JW9D 4A3OA 2BS3B 1KH0A 2O6VB 1CK1A 1E8YA 1EWYC 2CS4A 2KDMA 1HZ5A 2PW9A 4BOSC 3H1UA 2B76B 3EFUA 3LXFA 1PDXA 2L52A 5C23A 1KRHA 2JY6A 1XQQA 3DHHC 3V6CB 1I4GA 4LJPB 4CO7A 3RZWC 1J0GA 3DBHB 1E5WA 3RI7C 3U2SC 1OEYJ 4ZHPA 4MH0E 2IJ0A 1J7CA 4NAMA 2A5UA 2SEBD 3Q2AC 2BGFA 3H7SA 2OJRA 3MHSD 4HROA 1RLFA 2LVPA 4M8MA 1WZ3A 2O2VA 1N5XA 1RAXA 4LNFA 5AZFA 3E56A 4YSXB 1DOIA 1XF5L 3DOWA 2O6VA 1F77A 1WM2A 3C19A 3Q8FA 2NTSA 5IAAC 2V4LA 1WWTA 4MDKE 1F0ZA 2L7RA 1K52A 1FFUA 1E7VA 2EMTA 5IA7A 1FNWA 3IVFA 4FULA 4PS8A 5D94A 3L08A 2KN5A 1ENFA 5JHAA 3NVVA 4DDID 2ZPNA 1VDVA 2OEDA 5CX3A 2FIDA 1UF0A 4D2KA 1GPXA 2G3QB 4ZHOA 3C0RB 1E0ZA 1P98A 4KZCA 4G3XB 3P4QB 1WXVA 2N7EA 1TS5A 1C9FA 2J42A 1YIWA 4OHJA 3PS6A 2BWFA 3ML8A 3PREA 4WWPA 1ET9A 1ZUD2 3DBSA 2SAKA 3AB5A 2QJLA 2IBIB 5E6JA 3L13A 5DCNA 1J19A 1FRRA 1X1MA 3DBHI 4DWFA 3DVGX 2LGIA 2AEHA 1D3ZA 2DNFA 1L4DB 1WIAA 1QF6A 1T0RC 1AYFA 1SSNA 2TSSA 4WJPA 4BAXA 1UWMA 1UZXB 2Q5WD 3ZJUA 3BIID 5BYSA 2AYOB 3BVZA 1WXAA 2YEPF 3AEBB 4C4VA 3RMKC 4HDQA 4MEMA 3ZNHB 2LGXA 3OJ4B 5GXGB 4KGSA 2KQSA 1WMHB 3RCZA 2BB5A 2KJRA 3D32A 1GJZA 4BKGA 2MEKA 2KANA 2KXJA 2KDEB 1JWUD 5D3IB 3VTWA 1FXTB 3DWGC 3Q8CA 3AE2B 2V3NA 3AH7A 3ZTCA 3AV8A 1OEYA 2DAFA 4WWNA 3L0WB 3ZXRA 3JW0X 2IYDB 1FCLA 3SEBA 4W9IA 2PKOA 1SIFA 3SU8X 4WH4A 1QOBA 2IY1B 2V3SA 3VRBB 2OHFA 2WX1A 2BF8B 3FC4A 4FLHA 2JWZA 3T9LA 4DBGA 3BWUD 2M56B 3U30A 2NBWB 2FCSA 1YJIA 2KWCA 4HCPB 1PQSA 1SGHA 4JLCA 3VUWA 1P9DU 4FHKA 1PUTA 2IO0B 1EWCA 4ARCA 1SB3C 1RYJA 3H8HA 3SD5A 2O6VD 1YN3A 3QC8B 2OJWA 1TIFA 3VUXA 1TKYA 1QOGA 4KIKB 1VZ7A 4PK1A 4ZDVA 4A90A 1YX6B 3AU4A 5H92C 2W9NA 2MW5A 1GUAB 2W54A 5BO4B 4GIVA 5JZEB 3VXWA 2DAJA 5GMVA 2KMCA 2MA9B 3A9KB 3BK1A 2WXMA 1JRPA 4PYZA 2VZKB 2ZJDA 1EU3A 1FMAD 4KZ0A 3QCAA 3CWIA 1D5ZC 2FCNA 4AJYB 1LQBA 2D2QA 4LK0M 5J18A 2QEJC 1DYQA 1E9MA 1ZE3D 4HJKA 1ZKHA 2RDGA 2G4SA 5D7GA 4K7UA 4C00A 2ZVOA 4P6VF 2D3CA 3TSSA 2KTRB 1R4MB 3PHXB 3EGRA 4WWOA 1V81A 1MHXA 2LRUA 1L6VA 4RF0A 2KWUB 4HKQA 4LDTB 2DWQA 4RGTA 3W1SC 1SXTA 2X8XX 2L1AA 3C8YA 3ZDMC 4JIOU 1Q0WB 5IKCM 4KVGB 2V0GA 1PGAA 4JL9A 2JX5A 2CU3A 3RNFC 3KYCD 3AE8B 1WYWB 3NUHB 3T3OA 2UYZB 1K8RB 3L17A 3KQ4A 5CHFA 1ZOYB 3FILB 2FIFA 1G6JA 3ZYYX 2KO3A 3E9SA 4XZ4A 5EE0A 2KTRA 1WI0A 3GS2A 3B0AA 2BKFA 3PHWB 1GB4A 2M1MA 1ZDXA 4EKUA 1JCKB 3DHIC 1WM3A 2ONQA 3ENEA 1ROEA 3Q3OC 3SR6A 2K6DB 1OQRA 4JQWC 4YTPB 2MSED 1PGBA 1TY0A 4RNAA 3UIPB 2LASA 1QOFA 3GE8C 2JXXA 3DBRB 2R61A 3JSVA 1P3QU 1R4MI 2WU5B 3DPDA 1XLQA 1JMLA 2KVRA 4OZCA 3I3TB 1P7FA 4JE3B 3FILA 2JU6X 1SBBB 3H7PA 4K1RB 1MPEA 3T3NA 2DHZA 1QT9A 1WGYA 4ITKA 1C76A 2HDEA 2PVOD 2LGYA 3NS1A 4DHJB 5KHOA 3I63C 1A70A 2JSVX 4IWOA 3IFWB 1UD7A 2KFKB 4MM3A 3Q3JA 3WAMA 4HPMB 3LYYA 3V60A 4DDGD 3ZNID 2XK5B 4L23A 4M01A 4W9FA 1TZ1A 3CIRB 5LNK1 2MBBB 1Z5SB 2EKIA 1DGJA 2KKCA 3ZIMA 3AN1A 2GBMA 3AE7B 2QSDA 3NVYA 3EECA 4I6NB 2IO2B 1PFDA 3AXCA 2WU2B 4WURA 4HWIB 2MP2B 4BKSD 2N7DA 4ZYSA 3I5JC 1GNUA 4HDOA 4FN2A 2BVCA 2AL6A 1WJNA 5LLIA 4A6QA 1EO6A 3N32A 2AQ3B 3RYTA 4XC2A 3DDCB 3L10B 1ZXIA 2VRRB 2QHOA 4YWGG 1AN8A 1NDDA 3L4PA 3DBRI 3O13A 4LNOA 3OAWA 4NJ6A 2VZKD 1R7SA 4R3DA 4XX5A 2JZ3B 2NPTA 4OZBA 2N1VA 3RULA 1FO4A 3OJ3A 2BB6A 4GN1A 3PT2B 2W82A 3W5VB 4E3CA 2BYVE 4TQ1A 1LFDA 1RFKA 4IM0A 1F1HA 1WGDA 4J3OD 1EF1A 1M4VA 1L0VB 2MBHA 1I4QA 3M63B 4MSQB 1ESFA 4IM2A 4LJOB 4EOYA 4RH6A 5EE1A 3UQBA 2N0SB 2JF5A 4EUTA 4F7ZA 3HIZA 2GMIC 4MGKE 4E71A 2YLMA 2E3TA 1F2RI 3P4PB 2WXOA 3N20C 1HTQA 2K39A 1YJ1A 4CYEA 4ARIA 2D3GA 2PLPA 3DHGC 3MJ5A 2RDBC 4W9HA 5AZGA 3B2GA 2LWPA 2WLBA 3MP9A 4FJZA 3AU5A 3VHTC 1A5RA 3HUIA 4L2YA 4PYUA 4XE0A 3X0WA 1MI0A 2NMQA 2BW2A 3SFEB 1T5XD 2KZRA 1EM7A 2KMMA 3NJTA 4TSSA 3P4RB 3LB8C 3V6EB 2KMAA 3BINA 1IP9A 5EE3A 3MC0B 4M00A 2WNMA 3AE1B 1SIJA 2UU7A 1L5PA 1RM6C 3R8BA 5DPTA 4IWPA 4O1NA 5DPRA 2ZCCA 2MBEA 2WXRA 2JRHA 2K25A 3R7RA 2JQRB 1FEHA 4ZYNA 5I4DA 3K9PB 1WX8A 4US8A 3PSEB 2GBRA 4N59A 1FPYA 3A4RA 5C3JB 3PLVA 3R2IA 3WANA 1H4RA 3IT6B 3RPFC 4ANXA 4NAWB 2QMTA 1UBIA 2GBKA 1C3TA 3O65B 4LTUA 1RWSA 4ZRQA 3I57A 1E8ZA 4DK5A 1UUPA 1WJUA 1WR1A 2L83A 3AE9B 3RZFA 1KLVA 2C7MB 4KX6B 4EZJA 2G4DB 3PTFC 3QHTA 2H88B 1ZGUB 2RSUA 1JWMD 3ETRA 1EF5A 1N5WA 3A1QB 2KOXA 4MSMB 2N9PC 1XCTL 2JUOA 2MBOA 2KWVB 2GLSA 5G5GA 4DHJD 2VH1A 2ACZB 1VCBA 2KDBA 2MRPA 1JWAD 3Q8AA 3PZ7A 2XEWA 2IDYA 1EU4A 3NHEB 3ZRCA 3IT4B 4US9A 5G55A 1JWSD 1JRUA 4J6IA 3P4SB 4WQMA 1QLBB 2LHDA 4KKIA 5BYRA 1I4PA 2GRIA 4M0WB 2DYBA 2JWUA 2LVOA 3APCA 2G9HD 4URKA 2J7QB 1GAQB 2UWQA 3NVZA 3BYTB 3Q14C 3UF8A 3B9JA 1KJTA 3MC8A 2A4ZA 3DBLB 3A9JB 3SHQA 1GC7A 3PVLA 3MC9A 2DZKA 3B2FA 1SEBD 3V3XA 1BXTA 4F1SA 3T8MA 1KLUD 1E7PB 1V97A 4N9F4 2DX5B 4TUUA 5AZHA 3HM6X 4JWUC 3URYA 2QC8A 3Q8BA 3P63A 1V2YA 3VFKA 4FXCA 3W1YA 4HCNB 1L0XB 2KACA 2C7HA 2ZW1A 2KX0A 3KWVA 2CHZA 5J17A 3BVMA 4M0WA 4H2AA 2GOWA 2ON8A 2KLCA 4LNNA 1WYGA 4PS7A 2PVGC 4ZOHC 3Q3NC 2DENB 5J2RA 1YOVB 4B0EA 1D5XC 1FD6A 2PMVA 2Y5CA 1WMHA 3PZDA 2JVCA 3CSFA 1BMLC 2C60A 3A9JA 4YTNB 2GB1A 1QQRA 4B6WA 1UGMA 2EMSA 2DZJA 3HM3A 4AWJA 4ANUA 1WXSA 2PPHA 3U7ZA 1WZ0A 1L7YA 3N30A 2KT7A 1FRDA 2LRWA 2K9XA 3PRZA 1ZW7A 1YQ4B 2JRIB 1Y56A 1OGWA 3P1MA 1KOTA 5G2NA 2KJHB 1P7EA 2LEKA 5TSSA 4AP4C 2EKEC 2NVUI 4MACA 1KF6B 3DBLI 3R2TA 3AULA 1VJKA 5BYQA 4K7WA 3PLUA 3EUB2 2KWDA 4FHJA 1IGCA 3ZUNA 5HFYA 5C1ZA 3APDA 3VR9B 1WRDB 2ICIA 5BMHA 1S3SG 5TR5A 4USAA 4K3CA 3NVWA 2HTME 5CTRC 1ZDVA 2RGFA 1RRBA 1FXAA 3UQAA 1TYGB 1I4XA 3AEEB 3VDZA 1YN4A 3LJ3A 3M95A 1YNTE 3ABVB 2DYOA 2BT6A 2WS3B 4MH8A 4N6EB 2HJ8A 1SE3A 3FAHA 4KIKA 4WAAA 2BYFA 4NQLB 2INDC 2NCNA 4NQKE 3TEZA 1WX9A 1QZEA 4NZLB 4BKSA 1TJEA 2JZZA 2JPHA 2C5LC 2Y5PA 1ET6A 3NG0A 2L32A 4GXBA 3A9KA 1ACCA 3V05A 1XLNA 4W9LA 4MJSB 3N9YC 3CSTA 4FJYA 2EELA 2PE6B 1UELA 1I4HA 4XWWA 4IW0A 1B1ZA 2KTFA 4C80A 1NENB 4KGTA 5HKHA 2WP9B 4GSWA 3NRZA 5JXVA 3N1ZC 3DVNV 4BVUC 3HK0A 3JVZX 4HVBA 2BS4B 1P0RA 1V1OA 3ZNZB 2BQQA 1I35A 1C1YB 1K51A 1L6UA 1XLPA 2DBYA 1GC6A 1NVID 1LM8B 1WH3A 5KHQA 4QAYA 4I6LB 4W9KA 1N63A 4W9JA 4NNJB 2DZIA 1YQ3B 4P1BC 5FK9C 1YJJA 3OLMD 1IPGA 2C7NB 1TBEA 3ZQ4A 1B9RA 3QWZB 4MJSA 4JX1C 3B1LX 3EC8A 4WJNA 4TMAB 1I42A 4AJWA 5L95C 3J9CA 2IY0B 3VR8B 2L8JA 4WWMA 1V49A 4P16A 2WXJA 2LVQA 2LUEA 1M94A 1E90A 2HE7A 2N9KA 3UI3A 2D3AA 2KDFB 2Z0DB 3WAOA 2WX0A 3MHZA 4PS3A 1WGKA 3TIXA 3HRDD 1PYWD 3L54A 4AQ7A 1YX5B 2M19A 4PT5A 1VZ6A 4UDUC 2FE8A 2CJOA 1V86A 4JPSA 2QDFA 1N6ZA 3RT3B 4AS1A 1LGRA 4GDKB 1JWBD 3W1SA 1WE7A 1SJED 2N9EB 4M02A 1TY2A 3HVDA 2RD0A 3TBLD 1E6EB 3CMMB 4II3B 3QAQA 4RM9A 2M0XA 4WJOA 2KQ7A 5HG2A 1N62A 4ACFA 1V6EA 2B3AA 2WXNA 5LXHA 3ZJTA 3MFGA 4X57B 2ZCBA 1TZOA 3KUCB 1VD2A 2HTHA 3KW5B 4IM3A 2K8HA 1BT0A 3UINB 1TT5B 1VLBA 1STEA 1WFYA 2CHXA 4DXFA 4LNIA 3W9CB 4WQOB 2FUHB 3TL5A 1V8CA 5IO9A 4REZA 3WAPA 1FNVA 3RNAC 1F9JA 1NEKB 3BVGA 1NYQA 4HXDA 3WALA 2LZ6A 4GDKA 1XT9B 3IXSA 4C7ZA 2K5PA 2KD0A 2AX5A 4G50A 3ZNGC 4JWSC 1HE8A 3BZDB 1MJDA 4BFRA 2M0AA 2M8SA 2IGDA 1ISNA 2WXFA 1TTNA 3GB1A 1SF0A 3SFDB 1C78A 1SE4A 2KFKA 2RDHA 1J7BA 2L00B 1J7AA 4RGMA 2BYEA 2XK5A 2WXIA 1OFFA 3AEFB 4KDIC 4BBNF 1YD8U 2K6QA 5E6OA 1AW7A 2N9LA 4II2B 4KDLB 4ZRIA 2Z0EB 2HD5B 4ZRJA 2MP2A 3KUDB 4TV3A 1T3QA 3PGEA 4HPPA 3RNBC 4FJVB 2K8BA 4B9KA 1FCCC 2J0JA 3RN9C 3TCAA 3AEGB 2M17A 2NTTA 4MGIE 2JT4B 4ICUA 1C79A 2L3ZA 1S1QB 2LXCA 1L0YB 3SDLC 1C4PA 4RGOS 3GZNB 4G11A 4A20A 2KDIA 1Z2MA 4JGHB 1TKEA 3NZ3A 2WGSA 4B0MA 2Y3AA 2AWTA 3ZVVA 3ZKJC 2D11A 3PRPB 4LDTD 2O2VB 2LXAA 3Q3FA 4C7YA 4EE2A 2K3UA 2QCZA 3M3JA 3ZO5B 1AARA 4L1BA 4OVVA 1K53A 2FUG1 3U4EG 5D6JB 4LNKA 3KWLA 3M62B 4TKNA 2KHWB 3ZJVA 3DWMA 3ONSA 5G5HA 1WF9A 2RR9A 4NPNA 1QILA 2MCNB 4HPLB 2OOBB 2NBVB
chains in the Genus database with same CATH topology
5D7GA 3AE5B 1KLUD 2MJDA 1XCQL 1CZPA 4P6VF 1E7PB 5BMGA 1FIQA 1V97A 3TSSA 2RPVA 3AMZA 5AUIA 3KLSX 5FR3A 2LFIA 3EGRA 4JWUC 1V1PB 3URYA 2DYMA 1WRIA 1MHXA 2K22A 3Q8EA 3Q8BA 3P63A 1L6VA 4FXCA 4MT5A 4RF0A 4HKQA 4XDDA 1L0XB 2JYTA 4GDLB 2KACA 4HJGE 2ZW1A 3KWVA 2DWQA 3BVMA 4M0WA 4H2AA 1SE2A 4RGTA 5D3DA 4CQNA 2ON8A 2QIEB 1WYGA 2QILA 2PVGC 1SXTA 2W55A 2L1AA 3C8YA 5MPOA 4ZOHC 3AE3B 2I2YA 1NYRA 1VRAB 1PGXA 4B0EA 1D5XC 1FD6A 2PMVA 2XN9C 2Y5CA 2WXPA 2V0GA 1PGAA 2JX5A 2CU3A 4IKGA 4OVZA 1C4AA 1BMLC 1KTKA 3AE8B 1N61A 4YTNB 3NUHB 3T3OA 2GB1A 1FNUA 1QQRA 2LUMA 2Z8LA 4YXDB 3KQ4A 3PZ8A 1ZOYB 3FILB 1KLGD 2JYEA 2YEPB 4TQ0A 3U7ZA 1E10A 5HI1A 3ZYYX 2J52A 4HKZE 3E9SA 5EE0A 1HZ6A 1FFVA 1XO3A 1FRDA 3GS2A 2K9XA 2WDRB 1GB4A 1YQ4B 1Y56A 2D5GA 1ZDXA 4GLSC 1V1PA 3P1MA 2V3PA 1JCKB 4NJCA 1P7EA 2J53A 2LEKA 2MH7A 5TSSA 2ONQA 2BTEA 2G1EA 2MJ3A 1ROEA 4MACA 2AQ1B 1KF6B 3R2TA 3SR6A 1VJKA 5BYQA 1K50A 1Q10A 1OQRA 4YTPB 1T6BX 3EUB2 2KWDA 1D4BA 1IGCA 1N60A 1PGBA 1CJEA 1TY0A 5HFYA 4RNAA 1XEEA 2INPE 4WIPA 3VR9B 4A9AA 5H8YE 1UGJA 3AECB 2ICIA 1QOFA 5BMHA 2W3SA 2R61A 3U52E 1QKZA 4USAA 3W5UB 3NVWA 1GOZA 2HTME 1TKGA 2WU5B 3OWEB 1C77A 1ZDVA 3EA6A 1XLQA 1JMLA 1FXAA 1D6EC 1I4XA 1HEZE 1TYGB 1JW9D 1WXQA 3PO0A 3AEEB 4OZCA 1IBXB 1P7FA 4JE3B 1YN4A 3FILA 2JU6X 1YNTE 4DQOC 2BS3B 1KH0A 1CK1A 2DYOA 1SBBB 1ZP0B 1EWYC 2BBCA 2BT6A 1OQQA 1HZ5A 2KDMA 2WS3B 1MPEA 4MH8A 4N6EB 2PW9A 3T3NA 1HA5A 1QOAA 1SE3A 2IPKD 1QT9A 1SJHD 1HXYD 3FAHA 4ITKA 5T8IA 1C76A 1KFYB 1FXIA 2B76B 2HDEA 2PVOD 3LXFA 3TEZA 1PDXA 2JZPA 2L52A 3NS1A 1XLOA 4NZLB 1KRHA 1A70A 2KQ4X 1TJEA 1I4GA 2IGGA 3AM9A 2WQYB 2JSVX 3U2SC 3LYYA 4ZHPA 4RFBA 2Y5PA 1ET6A 2L32A 5HHDG 1ACCA 1HQRD 1J7CA 2IJ0A 4NAMA 3V05A 1XLNA 2SEBD 4L23A 5BMIA 5LNK1 3CIRB 2EKIA 1IUEA 1DGJA 3N9YC 4KKJA 3AN1A 5EE9A 3AE7B 2EELA 1CQVA 2QSDA 4HROA 1I4HA 3NVYA 4XWWA 1B1ZA 4C80A 3RFZB 1NENB 4KGTA 1GB1A 2N7JA 2WP9B 1PFDA 3NRZA 5JXVA 3BYYB 1N5XA 1JROA 2WU2B 4WURA 3VQIA 3IAS1 3E56A 1TS4A 4RF1A 1IBXA 1C4CA 4YSXB 4ZYSA 1DOIA 1XF5L 3AEDB 1JQ4A 2BS4B 1UWXA 1F77A 4A6QA 3Q8FA 2NTSA 1V1OA 1ZXHA 2AQ3B 1YN5A 2LMCA 1WWTA 2WXGA 1ZXIA 1K51A 1F0ZA 1L6UA 2I38A 3W2DA 1K52A 3BK2A 4YWGG 1FFUA 1XLPA 1AN8A 2DBYA 3L4PA 1NVID 3O13A 1FNWA 2VZKD 1R7SA 4R3DA 1ENFA 3NVVA 1N63A 1VDVA 2OEDA 4OZBA 3WCQA 1YQ3B 1FO4A 5FK9C 1YMHE 2BB6A 4D2KA 1YJJA 2KAJA 4ZHOA 1GPXA 1MHHE 1VZ8A 4A8XC 2W82A 1E0ZA 3W5VB 4RCOA 3ZQ4A 4IOIE 1B9RA 1L4ZB 4TQ1A 3P4QB 1RFKA 4JX1C 2X38A 4J3OD 4TMAB 1M4VA 1L0VB 1TS5A 1C9FA 1AWDA 2LHEA 3J9CA 2J42A 4OHJA 1I4QA 3VR8B 4WWMA 4RGNA 4P16A 2WXJA 3TEWA 1ESFA 1ET9A 1ZUD2 2SAKA 2WXQA 3AB5A 2N9KA 2K0PA 2QJLA 2XNAC 3UI3A 4RH6A 5E6JA 5EE1A 2N0SB 4XDCA 3MHZA 1FRRA 1WGKA 2V4IB 2LGIA 3HRDD 1FM0D 1L4DB 1PYWD 1QF6A 4AQ7A 2WDQB 1AYFA 1SSNA 2TSSA 4YSYB 2M19A 3I9V1 1MVKA 2E3TA 4PT5A 4XWTA 1F2RI 1VZ6A 4UDUC 3AE4B 1NI3A 2FE8A 2CJOA 3P4PB 4LLGM 4JPSA 1UWMA 2WXOA 4AS1A 2Q5WD 1JALA 1DOYA 4GDKB 4ARIA 2WXLA 2PLPA 3MJ5A 5AUKA 3ZJUA 1JWBD 3BIID 3W1SA 3B2GA 1SJED 5BYSA 1TY2A 3BVZA 2WLBA 3MP9A 2RMMA 2YEPF 3HVDA 3AEBB 2JXTA 4YTMB 3HUIA 1E6EB 4A55A 2J4XA 4L2YA 5GXGB 4XE0A 4C56C 2PIAA 4KGSA 1MI0A 4WAFA 2NMQA 2BB5A 2BW2A 3SFEB 1T5XD 1EM7A 2KMMA 2MEKA 4IDIA 4TSSA 1N62A 3P4RB 5HG2A 3LB8C 2INNE 2WXNA 2E6XA 3ZJTA 2H89B 5EE3A 3MFGA 1JWUD 5D3IB 3TEYA 3MC0B 3ABVB 2WNMA 3AE1B 5C2TB 1SIJA 2IGHA 1TZOA 1IGDA 1L5PA 1RM6C 3R8BA 3DWGC 3Q8CA 4O1NA 3AE2B 2V3NA 2CJNA 3ZGZA 3GP7A 3AH7A 2WXRA 1VLBA 1STEA 3AV8A 2MJEA 4DXFA 2JQRB 2ZW0A 1FEHA 3W9CB 5I4DA 3HVZA 4US8A 4N59A 1V8CA 5C3JB 4REZA 1FNVA 3R2IA 1FCLA 3SEBA 1NEKB 3TEXA 3VRAB 3BVGA 1NYQA 2PKOA 3IT6B 4HEA1 4WH4A 3RPFC 4NAWB 1QOBA 2QMTA 3IXSA 5FKAC 4C7ZA 2K5PA 4HRSA 3VRBB 2AX5A 2OHFA 4LTUA 2BS2B 1RWSA 3FC4A 4ZRQA 4JWSC 3I57A 3BZDB 3Q69A 1ZPSA 1XXGA 1UUPA 2M0AA 3BWUD 2M56B 2IGDA 4KGRA 2WXFA 4DXGA 3GB1A 2L83A 3AE9B 2WXKA 1SF0A 3SFDB 1C78A 1YJIA 1SE4A 4ZRPA 2FBWB 4KX6B 2RDHA 4Q2JA 1J7BA 2BYTA 1J7AA 4RGMA 2H88B 2W3RA 1JWMD 3AE6B 2GI9A 1LO5D 1PUTA 3ETRA 2WXIA 4OW0A 1OFFA 1EWCA 3AEFB 4ARCA 1N5WA 1SB3C 1RYJA 3H8HA 2PTLA 1TS2A 1YN3A 1TKYA 1QOGA 1VZ7A 1AW7A 2N9LA 1XCTL 4A90A 3P42A 5H92C 5G5GA 1VR9A 2AQ2B 4OZAA 1T3QA 2ACZB 2WDVB 2W54A 1JWAD 1FCCC 3Q8AA 3AEGB 4MM3B 4N58A 2KN4A 2NTTA 3PZ7A 1DOXA 2IDYA 1EU4A 3IAM1 1UNSA 3IT4B 1C79A 2LJIA 4US9A 1I7HA 1BUIC 1L0YB 1JWSD 1C4PA 3BK1A 2WXMA 1JRPA 4RGOS 3P4SB 1TKEA 3NZ3A 4WQMA 1QLBB 2LHDA 2Y3AA 4B0MA 4KKIA 5BYRA 1I4PA 2GRIA 2VZKB 1EU3A 2JWUA 2G9HD 1FMAD 4C7YA 4EE2A 2K3UA 3CWIA 1WSPA 4L1BA 3V3XA 1GAQB 1I4RA 2DLBA 1K53A 1D5ZC 3NVZA 2FUG1 4YSZB 3BYTB 4LK0M 3U4EG 2WXHA 3KWLA 3TUOA 1D5MC 1F2RC 3B9JA 4YT0B 3AEAB 3ZJVA 3DWMA 2QEJC 5G5HA 1DYQA 1E9MA 1TS3A 1ZE3D 1QILA 2RDGA 3B2FA 1SEBD 1BXTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NYQ A;  1GPX A;  2PKO A;  3AE5 B;  1YJJ A;  2KAJ A;  4ZHO A;  4USA A;  3RPF C;  3W5U B;  3NVW A;  1QOB A;  2HTM E;  1TKG A;  2MJD A;  2WU5 B;  1CZP A;  2K5P A;  4P6V F;  4C7Z A;  3W5V B;  1E0Z A;  1XLQ A;  1E7P B;  4HRS A;  1FIQ A;  2AX5 A;  1V97 A;  2OHF A;  3VRB B;  1B9R A;  1FXA A;  3P4Q B;  1RFK A;  3AMZ A;  4JX1 C;  2BS2 B;  2W3S A;  4LTU A;  1TYG B;  5AUI A;  3PO0 A;  1WXQ A;  1JW9 D;  1RWS A;  3FC4 A;  3AEE B;  4JWS C;  1L0V B;  1AWD A;  4JWU C;  3VR8 B;  2BS3 B;  4WWM A;  3ABV B;  1ZP0 B;  2BT6 A;  1EWY C;  1WRI A;  2M56 B;  1OQQ A;  2K22 A;  2WS3 B;  4N6E B;  3P63 A;  1L6V A;  2L83 A;  1ZUD 2;  3AE9 B;  4FXC A;  1QOA A;  1SF0 A;  2QJL A;  3AB5 A;  1YJI A;  3SFD B;  2FBW B;  1QT9 A;  4KX6 B;  3FAH A;  5EE1 A;  4ITK A;  2N0S B;  1J7B A;  2B76 B;  1KFY B;  1FXI A;  1J7A A;  2DWQ A;  1FRR A;  2H88 B;  2PVO D;  2W3R A;  1WGK A;  3AE6 B;  3LXF A;  1PDX A;  2L52 A;  3NS1 A;  1XLO A;  3HRD D;  1PUT A;  1KRH A;  1FM0 D;  1A70 A;  3ETR A;  2QIE B;  1WYG A;  1OFF A;  1TJE A;  3AEF B;  2PVG C;  2W55 A;  1N5W A;  2WDQ B;  1AYF A;  1SB3 C;  3AM9 A;  1RYJ A;  2WQY B;  4YSY B;  5MPO A;  4ZOH C;  2M19 A;  2E3T A;  1YQ3 B;  3AE3 B;  3AE4 B;  1NI3 A;  3P4P B;  2CJO A;  1QF6 A;  1NYR A;  1TKY A;  1UWM A;  1QOG A;  2Q5W D;  4ZHP A;  2Y5C A;  1JAL A;  1DOY A;  2JX5 A;  1J7C A;  2CU3 A;  5AUK A;  1JWB D;  3BII D;  1XLN A;  3B2G A;  5H92 C;  3CIR B;  3AE8 B;  1N61 A;  4YTN B;  2EKI A;  1IUE A;  1DGJ A;  5G5G A;  1T3Q A;  2ACZ B;  2WLB A;  3AN1 A;  5EE9 A;  4YXD B;  3AE7 B;  2WDV B;  2W54 A;  3AEB B;  4HRO A;  1JWA D;  3NVY A;  1ZOY B;  3AEG B;  3HUI A;  1E6E B;  4C80 A;  1NEN B;  4N58 A;  4YTM B;  1DOX A;  2WP9 B;  1PFD A;  5GXG B;  3ZYY X;  2PIA A;  3NRZ A;  4US9 A;  1I7H A;  1N5X A;  1JRO A;  2WU2 B;  5EE0 A;  3SFE B;  1JRP A;  1FFV A;  1XO3 A;  2KMM A;  3P4S B;  1FRD A;  1TKE A;  4WQM A;  1QLB B;  2K9X A;  2WDR B;  4IDI A;  4YSX B;  1N62 A;  3P4R B;  3LB8 C;  1DOI A;  1YQ4 B;  3AED B;  3P1M A;  2BS4 B;  1JQ4 A;  2H89 B;  5EE3 A;  1FO4 A;  2LEK A;  2MH7 A;  5C2T B;  3AE1 B;  1SIJ A;  1FMA D;  4C7Y A;  2G1E A;  2MJ3 A;  1L5P A;  1ROE A;  1RM6 C;  1WWT A;  3CWI A;  3DWG C;  1ZXI A;  1F0Z A;  1KF6 B;  1L6U A;  3AE2 B;  2CJN A;  1GAQ B;  3SR6 A;  1VJK A;  3AH7 A;  1FFU A;  1VLB A;  3AV8 A;  3NVZ A;  1XLP A;  2MJE A;  4YSZ B;  1OQR A;  2DBY A;  2JQR B;  4YTP B;  3KWL A;  3EUB 2;  3W9C B;  3L4P A;  1NVI D;  3B9J A;  1N60 A;  4YT0 B;  3AEA B;  1CJE A;  3HVZ A;  3DWM A;  5G5H A;  4US8 A;  1E9M A;  1R7S A;  1V8C A;  4N59 A;  3VR9 B;  5C3J B;  3NVV A;  1N63 A;  5H8Y E;  4A9A A;  3AEC B;  1QOF A;  1VDV A;  3B2F A;  3WCQ A;  1NEK B;  1E10 A;  3VRA B; 
#chains in the Genus database with same CATH topology
 5D2M B;  1NI2 A;  3QA8 A;  3X23 A;  2MJD A;  1XCQ L;  1UH6 A;  3AMZ A;  3BY4 B;  5AUI A;  2NR2 A;  1WGG A;  2LFI A;  1OTR B;  1V1P B;  2ZNV C;  3L16 A;  2K22 A;  2L0T A;  3NOB A;  4XDD A;  2RPQ A;  3UGB B;  2LGD A;  3ZTD A;  4M8N A;  3WA0 A;  2BPS A;  2G45 B;  4GU2 A;  4CQN A;  3KVF B;  1J8C A;  2QIL A;  4BKT A;  1E8X A;  2I1J A;  5MPO A;  3AE3 B;  2NBU A;  3ZXV A;  1VRA B;  1PGX A;  3ZRF A;  1T0Q C;  3IBE A;  2XN9 C;  3LDZ E;  3WIM A;  3H9D A;  4OVZ A;  4CHK A;  2ZNV B;  1N61 A;  2LUM A;  4YXD B;  3A4S C;  3PZ8 A;  1HTO A;  3DVN U;  3GZN I;  4RM8 A;  2YEP B;  5IP4 D;  4ANV A;  5HI1 A;  2J52 A;  2D10 A;  4HKZ E;  4K3B A;  3N1Y C;  5JHB A;  2NS5 A;  3QAR A;  2GBJ A;  2WDR B;  1WE6 A;  2N4F A;  1WJ4 A;  4AOF A;  4C4V B;  2D5G A;  4GLS C;  1V1P A;  4NY0 A;  2V3P A;  3FKY A;  2J53 A;  1KM7 A;  2KX3 A;  3HHM A;  2BTE A;  2G1E A;  5CHW A;  4I6P A;  1E8W A;  3K9O B;  1K50 A;  4NAW A;  1MFW A;  2HJ1 A;  1D4B A;  4RMA A;  1TGZ B;  3MJW A;  3DCG A;  1V9J A;  4A9A A;  5H8Y E;  5DPW A;  3AEC B;  4HLE A;  3W5U B;  1GOZ A;  5IOI A;  4S17 A;  1C77 A;  3VAW A;  4W9E A;  2ZEQ A;  1WXM A;  1HEZ E;  1IBX B;  2V9H A;  2IO1 B;  2N1W A;  3ZLZ A;  4DQO C;  2KYW A;  1ZP0 B;  2BBC A;  1OQQ A;  3R3M A;  3A1Q A;  1HA5 A;  1QOA A;  2R2O A;  2IPK D;  5E6P A;  1SJH D;  1HXY D;  5T8I A;  1KFY B;  1FXI A;  3NZS A;  4E74 A;  2JZP A;  1XLO A;  2XBB C;  2KQ4 X;  5AEK B;  2IGG A;  3AM9 A;  2J0K A;  2WWZ A;  2VH2 A;  1RFA A;  1Q5W B;  2WQY B;  4GB9 A;  3QJZ A;  2YVC A;  4IUM B;  3QX1 A;  4RFB A;  2AL3 A;  5HHD G;  1HQR D;  4FAD A;  5BMI A;  1IUE A;  4KKJ A;  5EE9 A;  4GMV A;  1CQV A;  2FNJ B;  1WGH A;  1UBQ A;  3RFZ B;  1IYF A;  1GB1 A;  3RNG C;  5LXI B;  2N7J A;  2MX2 A;  3BYY B;  3VQI A;  1JRO A;  2REX A;  3IAS 1;  1TS4 A;  4RF1 A;  1IBX A;  1C4C A;  1V80 A;  3B08 A;  3AED B;  1JQ4 A;  1UWX A;  2N9X A;  2R2Q A;  4NJ7 A;  1ZXH A;  2LI5 A;  1P1A A;  1YN5 A;  2L0F A;  2LMC A;  2WXG A;  3R7Q A;  2I38 A;  3W2D A;  3BK2 A;  3V61 A;  5EDS A;  4K81 A;  3GOE A;  2C9W B;  2KVZ A;  3WCQ A;  3ALB A;  1YMH E;  3PRM B;  2CR5 A;  2KAJ A;  3ML9 A;  1MHH E;  3QIJ A;  1VZ8 A;  4A8X C;  4RCO A;  4IWQ A;  1SE9 A;  4IOI E;  1L4Z B;  3VVW B;  4P7I A;  4MGZ E;  1WX7 A;  2X38 A;  3Q3M C;  1AWD A;  2LHE A;  4KSK C;  2MQJ A;  2ASQ A;  2KC1 A;  4RGN A;  3MTN B;  4OVU A;  3TEW A;  3AI5 A;  2WXQ A;  2K0P A;  2XNA C;  1MG8 A;  2FCQ A;  2MLB A;  4XDC A;  3N3K B;  4S0R A;  2V4I B;  2KLG A;  3NY5 A;  1FM0 D;  2V1Y A;  2WDQ B;  4YSY B;  1R4N B;  1MVK A;  3I9V 1;  4XWT A;  4FBJ B;  3AE4 B;  1NI3 A;  2MHJ A;  4LLG M;  3ZDT A;  1WGR A;  4W9G A;  5L83 A;  1JAL A;  1DOY A;  4LCD E;  3PV1 A;  3RNE C;  3TJP A;  2WXL A;  5AUK A;  2D07 B;  2Z59 B;  2LGS A;  2CU1 A;  2RMM A;  4G0N B;  2JXT A;  3ECI A;  1Q1O A;  4YTM B;  4A55 A;  2ZVN A;  1WR6 E;  2J4X A;  1NBF C;  4C56 C;  2PIA A;  4WAF A;  2ZZP B;  2ZPY A;  4EZK A;  4GGQ A;  4IDI A;  3VH3 B;  2L05 A;  2INN E;  2E6X A;  2H89 B;  4W9C A;  3TEY A;  5C2T B;  2IZV B;  2IGH A;  2CKH B;  1IGD A;  1YQB A;  2WHI A;  3ZGZ A;  3JYU A;  2CJN A;  3OG5 A;  1WY8 A;  3GP7 A;  2MJE A;  4ANW A;  2ZW0 A;  3VTV A;  3HVZ A;  2MBQ A;  4BOZ B;  3S2A A;  3KYD D;  3TEX A;  3VRA B;  4W9D A;  4HEA 1;  5FKA C;  3KH0 A;  3H6N A;  3P2B A;  4HRS A;  2BKR B;  2BS2 B;  4FA6 A;  3Q69 A;  1ZPS A;  3JSV B;  2PEA A;  1XXG A;  1E7U A;  2PJH A;  4KGR A;  4KV2 A;  4DXG A;  1V5T A;  2WXK A;  4ZRP A;  2FBW B;  3U8Z A;  1OQY A;  4Q2J A;  1R4N I;  2BYT A;  3GE3 C;  2W3R A;  1F52 A;  2GBN A;  3AE6 B;  4YL8 A;  4WJQ A;  2GI9 A;  1LO5 D;  5IN7 A;  4OW0 A;  3H7P B;  2FAZ A;  2PTL A;  1TS2 A;  2LJ5 A;  3N1X C;  1T0S C;  1L2N A;  3U7D A;  3P42 A;  2MWS B;  3RD2 A;  1VR9 A;  2AQ2 B;  4OZA A;  2LD9 A;  5JH5 C;  2WDV B;  4BZA A;  2D3B A;  4MM3 B;  4N58 A;  2KN4 A;  1DOX A;  3R66 C;  4EEW A;  3IAM 1;  1UNS A;  2LJI A;  1I7H A;  1BUI C;  5FR6 A;  1H8C A;  4A3P A;  2WDT B;  3CF6 E;  1WSP A;  2KK8 A;  4BBN C;  1I4R A;  2DLB A;  4YSZ B;  3EHV A;  2WXH A;  3TUO A;  4EFO A;  1D5M C;  1F2R C;  4YT0 B;  3AEA B;  2INC C;  1U4A A;  1TS3 A;  4GOC A;  2K1F A;  1E10 A;  3AE5 B;  4MEL A;  3NS8 A;  2K8C A;  1CZP A;  3PPA A;  5BMG A;  1FIQ A;  4AUQ C;  2RPV A;  2KFJ A;  3KLS X;  2NPT B;  4DHZ B;  5FR3 A;  3UIO B;  5CHV C;  1WJ6 A;  3V62 A;  4XGA B;  2DYM A;  2KNB A;  1WRI A;  2I1K A;  3Q8E A;  4MT5 A;  2JYT A;  4GDL B;  3RUI B;  2KJ6 A;  3NZU A;  4HJG E;  3IG3 A;  1SE2 A;  5D3D A;  1Y8R C;  2QIE B;  3IHP C;  2W55 A;  3DQV A;  3TMP B;  1V5O A;  2Y5B B;  4ASW C;  1CMX B;  4HK2 A;  2PE9 A;  4K7S A;  2I2Y A;  1NYR A;  2BWE S;  2WXP A;  2M4N A;  4XYC A;  4IKG A;  3DVG Y;  1C4A A;  1KTK A;  4DHZ E;  4F8C B;  1FNU A;  2Z8L A;  2CHW A;  1KLG D;  2JYE A;  2FCM A;  4TQ0 A;  1LXD A;  3QQ8 B;  1EUV B;  1HZ6 A;  3VH4 B;  1FFV A;  1XD3 B;  1XO3 A;  3ZW3 A;  3KUZ A;  2WYQ A;  2IO3 B;  3Q6B A;  3QK0 A;  4P1C C;  4NJC A;  2MH7 A;  3EFC A;  2MJ3 A;  4GDL A;  2AQ1 B;  4IG7 B;  4ZRK A;  3VUY A;  1T0Y A;  1Q10 A;  2J0M A;  1T6B X;  2L76 A;  3APF A;  2DZM A;  1MG4 A;  1N60 A;  1CJE A;  5DPS A;  1XEE A;  2INP E;  4WIP A;  3A33 B;  3RNC C;  4KSL C;  1UGJ A;  4B95 A;  2W3S A;  2KC2 A;  4IC7 B;  3VTU A;  4EZL A;  3U52 E;  1QKZ A;  4MGY E;  3OWE B;  1TKG A;  5E6N A;  3EA6 A;  1GG3 A;  4ICV A;  1D6E C;  4DXA B;  3PO0 A;  1WXQ A;  1JW9 D;  4A3O A;  2BS3 B;  1KH0 A;  2O6V B;  1CK1 A;  1E8Y A;  1EWY C;  2CS4 A;  2KDM A;  1HZ5 A;  2PW9 A;  4BOS C;  3H1U A;  2B76 B;  3EFU A;  3LXF A;  1PDX A;  2L52 A;  5C23 A;  1KRH A;  2JY6 A;  1XQQ A;  3DHH C;  3V6C B;  1I4G A;  4LJP B;  4CO7 A;  3RZW C;  1J0G A;  3DBH B;  1E5W A;  3RI7 C;  3U2S C;  1OEY J;  4ZHP A;  4MH0 E;  2IJ0 A;  1J7C A;  4NAM A;  2A5U A;  2SEB D;  3Q2A C;  2BGF A;  3H7S A;  2OJR A;  3MHS D;  4HRO A;  1RLF A;  2LVP A;  4M8M A;  1WZ3 A;  2O2V A;  1N5X A;  1RAX A;  4LNF A;  5AZF A;  3E56 A;  4YSX B;  1DOI A;  1XF5 L;  3DOW A;  2O6V A;  1F77 A;  1WM2 A;  3C19 A;  3Q8F A;  2NTS A;  5IAA C;  2V4L A;  1WWT A;  4MDK E;  1F0Z A;  2L7R A;  1K52 A;  1FFU A;  1E7V A;  2EMT A;  5IA7 A;  1FNW A;  3IVF A;  4FUL A;  4PS8 A;  5D94 A;  3L08 A;  2KN5 A;  1ENF A;  5JHA A;  3NVV A;  4DDI D;  2ZPN A;  1VDV A;  2OED A;  5CX3 A;  2FID A;  1UF0 A;  4D2K A;  1GPX A;  2G3Q B;  4ZHO A;  3C0R B;  1E0Z A;  1P98 A;  4KZC A;  4G3X B;  3P4Q B;  1WXV A;  2N7E A;  1TS5 A;  1C9F A;  2J42 A;  1YIW A;  4OHJ A;  3PS6 A;  2BWF A;  3ML8 A;  3PRE A;  4WWP A;  1ET9 A;  1ZUD 2;  3DBS A;  2SAK A;  3AB5 A;  2QJL A;  2IBI B;  5E6J A;  3L13 A;  5DCN A;  1J19 A;  1FRR A;  1X1M A;  3DBH I;  4DWF A;  3DVG X;  2LGI A;  2AEH A;  1D3Z A;  2DNF A;  1L4D B;  1WIA A;  1QF6 A;  1T0R C;  1AYF A;  1SSN A;  2TSS A;  4WJP A;  4BAX A;  1UWM A;  1UZX B;  2Q5W D;  3ZJU A;  3BII D;  5BYS A;  2AYO B;  3BVZ A;  1WXA A;  2YEP F;  3AEB B;  4C4V A;  3RMK C;  4HDQ A;  4MEM A;  3ZNH B;  2LGX A;  3OJ4 B;  5GXG B;  4KGS A;  2KQS A;  1WMH B;  3RCZ A;  2BB5 A;  2KJR A;  3D32 A;  1GJZ A;  4BKG A;  2MEK A;  2KAN A;  2KXJ A;  2KDE B;  1JWU D;  5D3I B;  3VTW A;  1FXT B;  3DWG C;  3Q8C A;  3AE2 B;  2V3N A;  3AH7 A;  3ZTC A;  3AV8 A;  1OEY A;  2DAF A;  4WWN A;  3L0W B;  3ZXR A;  3JW0 X;  2IYD B;  1FCL A;  3SEB A;  4W9I A;  2PKO A;  1SIF A;  3SU8 X;  4WH4 A;  1QOB A;  2IY1 B;  2V3S A;  3VRB B;  2OHF A;  2WX1 A;  2BF8 B;  3FC4 A;  4FLH A;  2JWZ A;  3T9L A;  4DBG A;  3BWU D;  2M56 B;  3U30 A;  2NBW B;  2FCS A;  1YJI A;  2KWC A;  4HCP B;  1PQS A;  1SGH A;  4JLC A;  3VUW A;  1P9D U;  4FHK A;  1PUT A;  2IO0 B;  1EWC A;  4ARC A;  1SB3 C;  1RYJ A;  3H8H A;  3SD5 A;  2O6V D;  1YN3 A;  3QC8 B;  2OJW A;  1TIF A;  3VUX A;  1TKY A;  1QOG A;  4KIK B;  1VZ7 A;  4PK1 A;  4ZDV A;  4A90 A;  1YX6 B;  3AU4 A;  5H92 C;  2W9N A;  2MW5 A;  1GUA B;  2W54 A;  5BO4 B;  4GIV A;  5JZE B;  3VXW A;  2DAJ A;  5GMV A;  2KMC A;  2MA9 B;  3A9K B;  3BK1 A;  2WXM A;  1JRP A;  4PYZ A;  2VZK B;  2ZJD A;  1EU3 A;  1FMA D;  4KZ0 A;  3QCA A;  3CWI A;  1D5Z C;  2FCN A;  4AJY B;  1LQB A;  2D2Q A;  4LK0 M;  5J18 A;  2QEJ C;  1DYQ A;  1E9M A;  1ZE3 D;  4HJK A;  1ZKH A;  2RDG A;  2G4S A;  5D7G A;  4K7U A;  4C00 A;  2ZVO A;  4P6V F;  2D3C A;  3TSS A;  2KTR B;  1R4M B;  3PHX B;  3EGR A;  4WWO A;  1V81 A;  1MHX A;  2LRU A;  1L6V A;  4RF0 A;  2KWU B;  4HKQ A;  4LDT B;  2DWQ A;  4RGT A;  3W1S C;  1SXT A;  2X8X X;  2L1A A;  3C8Y A;  3ZDM C;  4JIO U;  1Q0W B;  5IKC M;  4KVG B;  2V0G A;  1PGA A;  4JL9 A;  2JX5 A;  2CU3 A;  3RNF C;  3KYC D;  3AE8 B;  1WYW B;  3NUH B;  3T3O A;  2UYZ B;  1K8R B;  3L17 A;  3KQ4 A;  5CHF A;  1ZOY B;  3FIL B;  2FIF A;  1G6J A;  3ZYY X;  2KO3 A;  3E9S A;  4XZ4 A;  5EE0 A;  2KTR A;  1WI0 A;  3GS2 A;  3B0A A;  2BKF A;  3PHW B;  1GB4 A;  2M1M A;  1ZDX A;  4EKU A;  1JCK B;  3DHI C;  1WM3 A;  2ONQ A;  3ENE A;  1ROE A;  3Q3O C;  3SR6 A;  2K6D B;  1OQR A;  4JQW C;  4YTP B;  2MSE D;  1PGB A;  1TY0 A;  4RNA A;  3UIP B;  2LAS A;  1QOF A;  3GE8 C;  2JXX A;  3DBR B;  2R61 A;  3JSV A;  1P3Q U;  1R4M I;  2WU5 B;  3DPD A;  1XLQ A;  1JML A;  2KVR A;  4OZC A;  3I3T B;  1P7F A;  4JE3 B;  3FIL A;  2JU6 X;  1SBB B;  3H7P A;  4K1R B;  1MPE A;  3T3N A;  2DHZ A;  1QT9 A;  1WGY A;  4ITK A;  1C76 A;  2HDE A;  2PVO D;  2LGY A;  3NS1 A;  4DHJ B;  5KHO A;  3I63 C;  1A70 A;  2JSV X;  4IWO A;  3IFW B;  1UD7 A;  2KFK B;  4MM3 A;  3Q3J A;  3WAM A;  4HPM B;  3LYY A;  3V60 A;  4DDG D;  3ZNI D;  2XK5 B;  4L23 A;  4M01 A;  4W9F A;  1TZ1 A;  3CIR B;  5LNK 1;  2MBB B;  1Z5S B;  2EKI A;  1DGJ A;  2KKC A;  3ZIM A;  3AN1 A;  2GBM A;  3AE7 B;  2QSD A;  3NVY A;  3EEC A;  4I6N B;  2IO2 B;  1PFD A;  3AXC A;  2WU2 B;  4WUR A;  4HWI B;  2MP2 B;  4BKS D;  2N7D A;  4ZYS A;  3I5J C;  1GNU A;  4HDO A;  4FN2 A;  2BVC A;  2AL6 A;  1WJN A;  5LLI A;  4A6Q A;  1EO6 A;  3N32 A;  2AQ3 B;  3RYT A;  4XC2 A;  3DDC B;  3L10 B;  1ZXI A;  2VRR B;  2QHO A;  4YWG G;  1AN8 A;  1NDD A;  3L4P A;  3DBR I;  3O13 A;  4LNO A;  3OAW A;  4NJ6 A;  2VZK D;  1R7S A;  4R3D A;  4XX5 A;  2JZ3 B;  2NPT A;  4OZB A;  2N1V A;  3RUL A;  1FO4 A;  3OJ3 A;  2BB6 A;  4GN1 A;  3PT2 B;  2W82 A;  3W5V B;  4E3C A;  2BYV E;  4TQ1 A;  1LFD A;  1RFK A;  4IM0 A;  1F1H A;  1WGD A;  4J3O D;  1EF1 A;  1M4V A;  1L0V B;  2MBH A;  1I4Q A;  3M63 B;  4MSQ B;  1ESF A;  4IM2 A;  4LJO B;  4EOY A;  4RH6 A;  5EE1 A;  3UQB A;  2N0S B;  2JF5 A;  4EUT A;  4F7Z A;  3HIZ A;  2GMI C;  4MGK E;  4E71 A;  2YLM A;  2E3T A;  1F2R I;  3P4P B;  2WXO A;  3N20 C;  1HTQ A;  2K39 A;  1YJ1 A;  4CYE A;  4ARI A;  2D3G A;  2PLP A;  3DHG C;  3MJ5 A;  2RDB C;  4W9H A;  5AZG A;  3B2G A;  2LWP A;  2WLB A;  3MP9 A;  4FJZ A;  3AU5 A;  3VHT C;  1A5R A;  3HUI A;  4L2Y A;  4PYU A;  4XE0 A;  3X0W A;  1MI0 A;  2NMQ A;  2BW2 A;  3SFE B;  1T5X D;  2KZR A;  1EM7 A;  2KMM A;  3NJT A;  4TSS A;  3P4R B;  3LB8 C;  3V6E B;  2KMA A;  3BIN A;  1IP9 A;  5EE3 A;  3MC0 B;  4M00 A;  2WNM A;  3AE1 B;  1SIJ A;  2UU7 A;  1L5P A;  1RM6 C;  3R8B A;  5DPT A;  4IWP A;  4O1N A;  5DPR A;  2ZCC A;  2MBE A;  2WXR A;  2JRH A;  2K25 A;  3R7R A;  2JQR B;  1FEH A;  4ZYN A;  5I4D A;  3K9P B;  1WX8 A;  4US8 A;  3PSE B;  2GBR A;  4N59 A;  1FPY A;  3A4R A;  5C3J B;  3PLV A;  3R2I A;  3WAN A;  1H4R A;  3IT6 B;  3RPF C;  4ANX A;  4NAW B;  2QMT A;  1UBI A;  2GBK A;  1C3T A;  3O65 B;  4LTU A;  1RWS A;  4ZRQ A;  3I57 A;  1E8Z A;  4DK5 A;  1UUP A;  1WJU A;  1WR1 A;  2L83 A;  3AE9 B;  3RZF A;  1KLV A;  2C7M B;  4KX6 B;  4EZJ A;  2G4D B;  3PTF C;  3QHT A;  2H88 B;  1ZGU B;  2RSU A;  1JWM D;  3ETR A;  1EF5 A;  1N5W A;  3A1Q B;  2KOX A;  4MSM B;  2N9P C;  1XCT L;  2JUO A;  2MBO A;  2KWV B;  2GLS A;  5G5G A;  4DHJ D;  2VH1 A;  2ACZ B;  1VCB A;  2KDB A;  2MRP A;  1JWA D;  3Q8A A;  3PZ7 A;  2XEW A;  2IDY A;  1EU4 A;  3NHE B;  3ZRC A;  3IT4 B;  4US9 A;  5G55 A;  1JWS D;  1JRU A;  4J6I A;  3P4S B;  4WQM A;  1QLB B;  2LHD A;  4KKI A;  5BYR A;  1I4P A;  2GRI A;  4M0W B;  2DYB A;  2JWU A;  2LVO A;  3APC A;  2G9H D;  4URK A;  2J7Q B;  1GAQ B;  2UWQ A;  3NVZ A;  3BYT B;  3Q14 C;  3UF8 A;  3B9J A;  1KJT A;  3MC8 A;  2A4Z A;  3DBL B;  3A9J B;  3SHQ A;  1GC7 A;  3PVL A;  3MC9 A;  2DZK A;  3B2F A;  1SEB D;  3V3X A;  1BXT A;  4F1S A;  3T8M A;  1KLU D;  1E7P B;  1V97 A;  4N9F 4;  2DX5 B;  4TUU A;  5AZH A;  3HM6 X;  4JWU C;  3URY A;  2QC8 A;  3Q8B A;  3P63 A;  1V2Y A;  3VFK A;  4FXC A;  3W1Y A;  4HCN B;  1L0X B;  2KAC A;  2C7H A;  2ZW1 A;  2KX0 A;  3KWV A;  2CHZ A;  5J17 A;  3BVM A;  4M0W A;  4H2A A;  2GOW A;  2ON8 A;  2KLC A;  4LNN A;  1WYG A;  4PS7 A;  2PVG C;  4ZOH C;  3Q3N C;  2DEN B;  5J2R A;  1YOV B;  4B0E A;  1D5X C;  1FD6 A;  2PMV A;  2Y5C A;  1WMH A;  3PZD A;  2JVC A;  3CSF A;  1BML C;  2C60 A;  3A9J A;  4YTN B;  2GB1 A;  1QQR A;  4B6W A;  1UGM A;  2EMS A;  2DZJ A;  3HM3 A;  4AWJ A;  4ANU A;  1WXS A;  2PPH A;  3U7Z A;  1WZ0 A;  1L7Y A;  3N30 A;  2KT7 A;  1FRD A;  2LRW A;  2K9X A;  3PRZ A;  1ZW7 A;  1YQ4 B;  2JRI B;  1Y56 A;  1OGW A;  3P1M A;  1KOT A;  5G2N A;  2KJH B;  1P7E A;  2LEK A;  5TSS A;  4AP4 C;  2EKE C;  2NVU I;  4MAC A;  1KF6 B;  3DBL I;  3R2T A;  3AUL A;  1VJK A;  5BYQ A;  4K7W A;  3PLU A;  3EUB 2;  2KWD A;  4FHJ A;  1IGC A;  3ZUN A;  5HFY A;  5C1Z A;  3APD A;  3VR9 B;  1WRD B;  2ICI A;  5BMH A;  1S3S G;  5TR5 A;  4USA A;  4K3C A;  3NVW A;  2HTM E;  5CTR C;  1ZDV A;  2RGF A;  1RRB A;  1FXA A;  3UQA A;  1TYG B;  1I4X A;  3AEE B;  3VDZ A;  1YN4 A;  3LJ3 A;  3M95 A;  1YNT E;  3ABV B;  2DYO A;  2BT6 A;  2WS3 B;  4MH8 A;  4N6E B;  2HJ8 A;  1SE3 A;  3FAH A;  4KIK A;  4WAA A;  2BYF A;  4NQL B;  2IND C;  2NCN A;  4NQK E;  3TEZ A;  1WX9 A;  1QZE A;  4NZL B;  4BKS A;  1TJE A;  2JZZ A;  2JPH A;  2C5L C;  2Y5P A;  1ET6 A;  3NG0 A;  2L32 A;  4GXB A;  3A9K A;  1ACC A;  3V05 A;  1XLN A;  4W9L A;  4MJS B;  3N9Y C;  3CST A;  4FJY A;  2EEL A;  2PE6 B;  1UEL A;  1I4H A;  4XWW A;  4IW0 A;  1B1Z A;  2KTF A;  4C80 A;  1NEN B;  4KGT A;  5HKH A;  2WP9 B;  4GSW A;  3NRZ A;  5JXV A;  3N1Z C;  3DVN V;  4BVU C;  3HK0 A;  3JVZ X;  4HVB A;  2BS4 B;  1P0R A;  1V1O A;  3ZNZ B;  2BQQ A;  1I35 A;  1C1Y B;  1K51 A;  1L6U A;  1XLP A;  2DBY A;  1GC6 A;  1NVI D;  1LM8 B;  1WH3 A;  5KHQ A;  4QAY A;  4I6L B;  4W9K A;  1N63 A;  4W9J A;  4NNJ B;  2DZI A;  1YQ3 B;  4P1B C;  5FK9 C;  1YJJ A;  3OLM D;  1IPG A;  2C7N B;  1TBE A;  3ZQ4 A;  1B9R A;  3QWZ B;  4MJS A;  4JX1 C;  3B1L X;  3EC8 A;  4WJN A;  4TMA B;  1I42 A;  4AJW A;  5L95 C;  3J9C A;  2IY0 B;  3VR8 B;  2L8J A;  4WWM A;  1V49 A;  4P16 A;  2WXJ A;  2LVQ A;  2LUE A;  1M94 A;  1E90 A;  2HE7 A;  2N9K A;  3UI3 A;  2D3A A;  2KDF B;  2Z0D B;  3WAO A;  2WX0 A;  3MHZ A;  4PS3 A;  1WGK A;  3TIX A;  3HRD D;  1PYW D;  3L54 A;  4AQ7 A;  1YX5 B;  2M19 A;  4PT5 A;  1VZ6 A;  4UDU C;  2FE8 A;  2CJO A;  1V86 A;  4JPS A;  2QDF A;  1N6Z A;  3RT3 B;  4AS1 A;  1LGR A;  4GDK B;  1JWB D;  3W1S A;  1WE7 A;  1SJE D;  2N9E B;  4M02 A;  1TY2 A;  3HVD A;  2RD0 A;  3TBL D;  1E6E B;  3CMM B;  4II3 B;  3QAQ A;  4RM9 A;  2M0X A;  4WJO A;  2KQ7 A;  5HG2 A;  1N62 A;  4ACF A;  1V6E A;  2B3A A;  2WXN A;  5LXH A;  3ZJT A;  3MFG A;  4X57 B;  2ZCB A;  1TZO A;  3KUC B;  1VD2 A;  2HTH A;  3KW5 B;  4IM3 A;  2K8H A;  1BT0 A;  3UIN B;  1TT5 B;  1VLB A;  1STE A;  1WFY A;  2CHX A;  4DXF A;  4LNI A;  3W9C B;  4WQO B;  2FUH B;  3TL5 A;  1V8C A;  5IO9 A;  4REZ A;  3WAP A;  1FNV A;  3RNA C;  1F9J A;  1NEK B;  3BVG A;  1NYQ A;  4HXD A;  3WAL A;  2LZ6 A;  4GDK A;  1XT9 B;  3IXS A;  4C7Z A;  2K5P A;  2KD0 A;  2AX5 A;  4G50 A;  3ZNG C;  4JWS C;  1HE8 A;  3BZD B;  1MJD A;  4BFR A;  2M0A A;  2M8S A;  2IGD A;  1ISN A;  2WXF A;  1TTN A;  3GB1 A;  1SF0 A;  3SFD B;  1C78 A;  1SE4 A;  2KFK A;  2RDH A;  1J7B A;  2L00 B;  1J7A A;  4RGM A;  2BYE A;  2XK5 A;  2WXI A;  1OFF A;  3AEF B;  4KDI C;  4BBN F;  1YD8 U;  2K6Q A;  5E6O A;  1AW7 A;  2N9L A;  4II2 B;  4KDL B;  4ZRI A;  2Z0E B;  2HD5 B;  4ZRJ A;  2MP2 A;  3KUD B;  4TV3 A;  1T3Q A;  3PGE A;  4HPP A;  3RNB C;  4FJV B;  2K8B A;  4B9K A;  1FCC C;  2J0J A;  3RN9 C;  3TCA A;  3AEG B;  2M17 A;  2NTT A;  4MGI E;  2JT4 B;  4ICU A;  1C79 A;  2L3Z A;  1S1Q B;  2LXC A;  1L0Y B;  3SDL C;  1C4P A;  4RGO S;  3GZN B;  4G11 A;  4A20 A;  2KDI A;  1Z2M A;  4JGH B;  1TKE A;  3NZ3 A;  2WGS A;  4B0M A;  2Y3A A;  2AWT A;  3ZVV A;  3ZKJ C;  2D11 A;  3PRP B;  4LDT D;  2O2V B;  2LXA A;  3Q3F A;  4C7Y A;  4EE2 A;  2K3U A;  2QCZ A;  3M3J A;  3ZO5 B;  1AAR A;  4L1B A;  4OVV A;  1K53 A;  2FUG 1;  3U4E G;  5D6J B;  4LNK A;  3KWL A;  3M62 B;  4TKN A;  2KHW B;  3ZJV A;  3DWM A;  3ONS A;  5G5H A;  1WF9 A;  2RR9 A;  4NPN A;  1QIL A;  2MCN B;  4HPL B;  2OOB B;  2NBV B; 
#chains in the Genus database with same CATH homology
 5D7G A;  3AE5 B;  1KLU D;  2MJD A;  1XCQ L;  1CZP A;  4P6V F;  1E7P B;  5BMG A;  1FIQ A;  1V97 A;  3TSS A;  2RPV A;  3AMZ A;  5AUI A;  3KLS X;  5FR3 A;  2LFI A;  3EGR A;  4JWU C;  1V1P B;  3URY A;  2DYM A;  1WRI A;  1MHX A;  2K22 A;  3Q8E A;  3Q8B A;  3P63 A;  1L6V A;  4FXC A;  4MT5 A;  4RF0 A;  4HKQ A;  4XDD A;  1L0X B;  2JYT A;  4GDL B;  2KAC A;  4HJG E;  2ZW1 A;  3KWV A;  2DWQ A;  3BVM A;  4M0W A;  4H2A A;  1SE2 A;  4RGT A;  5D3D A;  4CQN A;  2ON8 A;  2QIE B;  1WYG A;  2QIL A;  2PVG C;  1SXT A;  2W55 A;  2L1A A;  3C8Y A;  5MPO A;  4ZOH C;  3AE3 B;  2I2Y A;  1NYR A;  1VRA B;  1PGX A;  4B0E A;  1D5X C;  1FD6 A;  2PMV A;  2XN9 C;  2Y5C A;  2WXP A;  2V0G A;  1PGA A;  2JX5 A;  2CU3 A;  4IKG A;  4OVZ A;  1C4A A;  1BML C;  1KTK A;  3AE8 B;  1N61 A;  4YTN B;  3NUH B;  3T3O A;  2GB1 A;  1FNU A;  1QQR A;  2LUM A;  2Z8L A;  4YXD B;  3KQ4 A;  3PZ8 A;  1ZOY B;  3FIL B;  1KLG D;  2JYE A;  2YEP B;  4TQ0 A;  3U7Z A;  1E10 A;  5HI1 A;  3ZYY X;  2J52 A;  4HKZ E;  3E9S A;  5EE0 A;  1HZ6 A;  1FFV A;  1XO3 A;  1FRD A;  3GS2 A;  2K9X A;  2WDR B;  1GB4 A;  1YQ4 B;  1Y56 A;  2D5G A;  1ZDX A;  4GLS C;  1V1P A;  3P1M A;  2V3P A;  1JCK B;  4NJC A;  1P7E A;  2J53 A;  2LEK A;  2MH7 A;  5TSS A;  2ONQ A;  2BTE A;  2G1E A;  2MJ3 A;  1ROE A;  4MAC A;  2AQ1 B;  1KF6 B;  3R2T A;  3SR6 A;  1VJK A;  5BYQ A;  1K50 A;  1Q10 A;  1OQR A;  4YTP B;  1T6B X;  3EUB 2;  2KWD A;  1D4B A;  1IGC A;  1N60 A;  1PGB A;  1CJE A;  1TY0 A;  5HFY A;  4RNA A;  1XEE A;  2INP E;  4WIP A;  3VR9 B;  4A9A A;  5H8Y E;  1UGJ A;  3AEC B;  2ICI A;  1QOF A;  5BMH A;  2W3S A;  2R61 A;  3U52 E;  1QKZ A;  4USA A;  3W5U B;  3NVW A;  1GOZ A;  2HTM E;  1TKG A;  2WU5 B;  3OWE B;  1C77 A;  1ZDV A;  3EA6 A;  1XLQ A;  1JML A;  1FXA A;  1D6E C;  1I4X A;  1HEZ E;  1TYG B;  1JW9 D;  1WXQ A;  3PO0 A;  3AEE B;  4OZC A;  1IBX B;  1P7F A;  4JE3 B;  1YN4 A;  3FIL A;  2JU6 X;  1YNT E;  4DQO C;  2BS3 B;  1KH0 A;  1CK1 A;  2DYO A;  1SBB B;  1ZP0 B;  1EWY C;  2BBC A;  2BT6 A;  1OQQ A;  1HZ5 A;  2KDM A;  2WS3 B;  1MPE A;  4MH8 A;  4N6E B;  2PW9 A;  3T3N A;  1HA5 A;  1QOA A;  1SE3 A;  2IPK D;  1QT9 A;  1SJH D;  1HXY D;  3FAH A;  4ITK A;  5T8I A;  1C76 A;  1KFY B;  1FXI A;  2B76 B;  2HDE A;  2PVO D;  3LXF A;  3TEZ A;  1PDX A;  2JZP A;  2L52 A;  3NS1 A;  1XLO A;  4NZL B;  1KRH A;  1A70 A;  2KQ4 X;  1TJE A;  1I4G A;  2IGG A;  3AM9 A;  2WQY B;  2JSV X;  3U2S C;  3LYY A;  4ZHP A;  4RFB A;  2Y5P A;  1ET6 A;  2L32 A;  5HHD G;  1ACC A;  1HQR D;  1J7C A;  2IJ0 A;  4NAM A;  3V05 A;  1XLN A;  2SEB D;  4L23 A;  5BMI A;  5LNK 1;  3CIR B;  2EKI A;  1IUE A;  1DGJ A;  3N9Y C;  4KKJ A;  3AN1 A;  5EE9 A;  3AE7 B;  2EEL A;  1CQV A;  2QSD A;  4HRO A;  1I4H A;  3NVY A;  4XWW A;  1B1Z A;  4C80 A;  3RFZ B;  1NEN B;  4KGT A;  1GB1 A;  2N7J A;  2WP9 B;  1PFD A;  3NRZ A;  5JXV A;  3BYY B;  1N5X A;  1JRO A;  2WU2 B;  4WUR A;  3VQI A;  3IAS 1;  3E56 A;  1TS4 A;  4RF1 A;  1IBX A;  1C4C A;  4YSX B;  4ZYS A;  1DOI A;  1XF5 L;  3AED B;  1JQ4 A;  2BS4 B;  1UWX A;  1F77 A;  4A6Q A;  3Q8F A;  2NTS A;  1V1O A;  1ZXH A;  2AQ3 B;  1YN5 A;  2LMC A;  1WWT A;  2WXG A;  1ZXI A;  1K51 A;  1F0Z A;  1L6U A;  2I38 A;  3W2D A;  1K52 A;  3BK2 A;  4YWG G;  1FFU A;  1XLP A;  1AN8 A;  2DBY A;  3L4P A;  1NVI D;  3O13 A;  1FNW A;  2VZK D;  1R7S A;  4R3D A;  1ENF A;  3NVV A;  1N63 A;  1VDV A;  2OED A;  4OZB A;  3WCQ A;  1YQ3 B;  1FO4 A;  5FK9 C;  1YMH E;  2BB6 A;  4D2K A;  1YJJ A;  2KAJ A;  4ZHO A;  1GPX A;  1MHH E;  1VZ8 A;  4A8X C;  2W82 A;  1E0Z A;  3W5V B;  4RCO A;  3ZQ4 A;  4IOI E;  1B9R A;  1L4Z B;  4TQ1 A;  3P4Q B;  1RFK A;  4JX1 C;  2X38 A;  4J3O D;  4TMA B;  1M4V A;  1L0V B;  1TS5 A;  1C9F A;  1AWD A;  2LHE A;  3J9C A;  2J42 A;  4OHJ A;  1I4Q A;  3VR8 B;  4WWM A;  4RGN A;  4P16 A;  2WXJ A;  3TEW A;  1ESF A;  1ET9 A;  1ZUD 2;  2SAK A;  2WXQ A;  3AB5 A;  2N9K A;  2K0P A;  2QJL A;  2XNA C;  3UI3 A;  4RH6 A;  5E6J A;  5EE1 A;  2N0S B;  4XDC A;  3MHZ A;  1FRR A;  1WGK A;  2V4I B;  2LGI A;  3HRD D;  1FM0 D;  1L4D B;  1PYW D;  1QF6 A;  4AQ7 A;  2WDQ B;  1AYF A;  1SSN A;  2TSS A;  4YSY B;  2M19 A;  3I9V 1;  1MVK A;  2E3T A;  4PT5 A;  4XWT A;  1F2R I;  1VZ6 A;  4UDU C;  3AE4 B;  1NI3 A;  2FE8 A;  2CJO A;  3P4P B;  4LLG M;  4JPS A;  1UWM A;  2WXO A;  4AS1 A;  2Q5W D;  1JAL A;  1DOY A;  4GDK B;  4ARI A;  2WXL A;  2PLP A;  3MJ5 A;  5AUK A;  3ZJU A;  1JWB D;  3BII D;  3W1S A;  3B2G A;  1SJE D;  5BYS A;  1TY2 A;  3BVZ A;  2WLB A;  3MP9 A;  2RMM A;  2YEP F;  3HVD A;  3AEB B;  2JXT A;  4YTM B;  3HUI A;  1E6E B;  4A55 A;  2J4X A;  4L2Y A;  5GXG B;  4XE0 A;  4C56 C;  2PIA A;  4KGS A;  1MI0 A;  4WAF A;  2NMQ A;  2BB5 A;  2BW2 A;  3SFE B;  1T5X D;  1EM7 A;  2KMM A;  2MEK A;  4IDI A;  4TSS A;  1N62 A;  3P4R B;  5HG2 A;  3LB8 C;  2INN E;  2WXN A;  2E6X A;  3ZJT A;  2H89 B;  5EE3 A;  3MFG A;  1JWU D;  5D3I B;  3TEY A;  3MC0 B;  3ABV B;  2WNM A;  3AE1 B;  5C2T B;  1SIJ A;  2IGH A;  1TZO A;  1IGD A;  1L5P A;  1RM6 C;  3R8B A;  3DWG C;  3Q8C A;  4O1N A;  3AE2 B;  2V3N A;  2CJN A;  3ZGZ A;  3GP7 A;  3AH7 A;  2WXR A;  1VLB A;  1STE A;  3AV8 A;  2MJE A;  4DXF A;  2JQR B;  2ZW0 A;  1FEH A;  3W9C B;  5I4D A;  3HVZ A;  4US8 A;  4N59 A;  1V8C A;  5C3J B;  4REZ A;  1FNV A;  3R2I A;  1FCL A;  3SEB A;  1NEK B;  3TEX A;  3VRA B;  3BVG A;  1NYQ A;  2PKO A;  3IT6 B;  4HEA 1;  4WH4 A;  3RPF C;  4NAW B;  1QOB A;  2QMT A;  3IXS A;  5FKA C;  4C7Z A;  2K5P A;  4HRS A;  3VRB B;  2AX5 A;  2OHF A;  4LTU A;  2BS2 B;  1RWS A;  3FC4 A;  4ZRQ A;  4JWS C;  3I57 A;  3BZD B;  3Q69 A;  1ZPS A;  1XXG A;  1UUP A;  2M0A A;  3BWU D;  2M56 B;  2IGD A;  4KGR A;  2WXF A;  4DXG A;  3GB1 A;  2L83 A;  3AE9 B;  2WXK A;  1SF0 A;  3SFD B;  1C78 A;  1YJI A;  1SE4 A;  4ZRP A;  2FBW B;  4KX6 B;  2RDH A;  4Q2J A;  1J7B A;  2BYT A;  1J7A A;  4RGM A;  2H88 B;  2W3R A;  1JWM D;  3AE6 B;  2GI9 A;  1LO5 D;  1PUT A;  3ETR A;  2WXI A;  4OW0 A;  1OFF A;  1EWC A;  3AEF B;  4ARC A;  1N5W A;  1SB3 C;  1RYJ A;  3H8H A;  2PTL A;  1TS2 A;  1YN3 A;  1TKY A;  1QOG A;  1VZ7 A;  1AW7 A;  2N9L A;  1XCT L;  4A90 A;  3P42 A;  5H92 C;  5G5G A;  1VR9 A;  2AQ2 B;  4OZA A;  1T3Q A;  2ACZ B;  2WDV B;  2W54 A;  1JWA D;  1FCC C;  3Q8A A;  3AEG B;  4MM3 B;  4N58 A;  2KN4 A;  2NTT A;  3PZ7 A;  1DOX A;  2IDY A;  1EU4 A;  3IAM 1;  1UNS A;  3IT4 B;  1C79 A;  2LJI A;  4US9 A;  1I7H A;  1BUI C;  1L0Y B;  1JWS D;  1C4P A;  3BK1 A;  2WXM A;  1JRP A;  4RGO S;  3P4S B;  1TKE A;  3NZ3 A;  4WQM A;  1QLB B;  2LHD A;  2Y3A A;  4B0M A;  4KKI A;  5BYR A;  1I4P A;  2GRI A;  2VZK B;  1EU3 A;  2JWU A;  2G9H D;  1FMA D;  4C7Y A;  4EE2 A;  2K3U A;  3CWI A;  1WSP A;  4L1B A;  3V3X A;  1GAQ B;  1I4R A;  2DLB A;  1K53 A;  1D5Z C;  3NVZ A;  2FUG 1;  4YSZ B;  3BYT B;  4LK0 M;  3U4E G;  2WXH A;  3KWL A;  3TUO A;  1D5M C;  1F2R C;  3B9J A;  4YT0 B;  3AEA B;  3ZJV A;  3DWM A;  2QEJ C;  5G5H A;  1DYQ A;  1E9M A;  1TS3 A;  1ZE3 D;  1QIL A;  2RDG A;  3B2F A;  1SEB D;  1BXT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...