4JWSC

Crystal structure of cytochrome p450cam-putidaredoxin complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
b'SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLECVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Camphor 5-monooxygenase
publication title Structural basis for effector control and redox partner recognition in cytochrome P450.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase/electron transport
total genus 30
structure length 106
sequence length 106
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4jwsC00
1XO3A 3P4QB 1QF6A 1V97A 1J7CA 1AYFA 1XLQA 3NVZA 4C7YA 1IUEA 1T3QA 2K22A 1N5XA 1FMAD 2WS3B 4JX1C 3HUIA 4KX6B 5C3JB 2PIAA 1J7AA 1L6UA 2E3TA 4IDIA 3W5VB 1DOIA 3AN1A 1NVID 4P6VF 5G5HA 3VR9B 1JQ4A 1ZUD2 1RM6C 2MJEA 1JWBD 1ZXIA 3B9JA 2BS2B 3AE3B 1RYJA 3DWMA 3AE8B 1JW9D 3AECB 2W54A 2H88B 1QOBA 2ACZB 3AE7B 1N60A 1TKGA 2H89B 3AB5A 1FO4A 1ZOYB 3B2FA 3P1MA 2L52A 1FXIA 1YJJA 3VR8B 3NVVA 1YQ3B 3DWGC 1L0VB 1WXQA 4ZHPA 1E10A 1N62A 4YTNB 4HRSA 1R7SA 1JWAD 5H8YE 1EWYC 1GPXA 3AEFB 4YTPB 1J7BA 2EKIA 3NS1A 1OQRA 1XLNA 2MJDA 3NVWA 3W9CB 1WYGA 5EE9A 4A9AA 2KMMA 5G5GA 5C2TB 1FM0D 2W55A 3P4SB 3AE1B 2QJLA 4N59A 4YSYB 4YT0B 4YSZB 4US8A 3AE2B 2Y5CA 1KRHA 2K5PA 3PO0A 5EE1A 3L4PA 2WQYB 1PDXA 3AE4B 1NEKB 1GAQB 4YXDB 4USAA 1E9MA 3P4RB 3BIID 3W5UB 5EE0A 1TKEA 2N0SB 2M56B 3ZYYX 3AE5B 2B76B 2M19A 2WU5B 2QIEB 3ETRA 4YSXB 2CJNA 2PKOA 1ZP0B 2BS3B 2FBWB 3AM9A 3EUB2 4US9A 2HTME 3CIRB 4ZOHC 3VRBB 1NI3A 3NRZA 1FRDA 2WDQB 2WLBA 4FXCA 1QOFA 1L6VA 1E0ZA 3SFEB 2KAJA 1SIJA 1QLBB 2LEKA 4C80A 1QOAA 3HVZA 4N6EB 2AX5A 2W3SA 3B2GA 3AEEB 1ROEA 1JALA 2PVGC 2PVOD 1I7HA 3KWLA 1B9RA 1DOYA 1OFFA 1NYQA 1QT9A 1OQQA 1WWTA 1FIQA 1PFDA 3P63A 2CJOA 1WGKA 2WP9B 3AV8A 2K9XA 1CZPA 3FC4A 2WDRB 2WDVB 2BS4B 2MH7A 2DWQA 2CU3A 3ABVB 1SB3C 1SF0A 1AWDA 3P4PB 4WQMA 2JQRB 3AE6B 1N5WA 1XLOA 4LTUA 5MPOA 3RPFC 4ZHOA 1CJEA 1TKYA 4JWUC 1VJKA 3AMZA 3HRDD 2Q5WD 4N58A 5GXGB 1VLBA 1V8CA 1TJEA 3AEDB 1QOGA 5H92C 2WU2B 1N61A 1WRIA 4WWMA 5AUKA 3SFDB 4HROA 1JROA 5EE3A 1DOXA 1NENB 1L5PA 1PUTA 3AEGB 2BT6A 1KF6B 5AUIA 1JRPA 1N63A 1NYRA 3CWIA 1DGJA 3WCQA 2DBYA 1E7PB 1A70A 2G1EA 3FAHA 1FXAA 1FRRA 1UWMA 4ITKA 1TYGB 1E6EB 3AE9B 3VRAB 1FFUA 2L83A 1YJIA 3AEAB 3LXFA 3NVYA 1KFYB 2JX5A 2MJ3A 1VDVA 2W3RA 2OHFA 4C7ZA 1XLPA 4YTMB 1RWSA 1RFKA 3AH7A 3LB8C 1YQ4B 4JWSC 1F0ZA 3AEBB 1FFVA 3SR6A
chains in the Genus database with same CATH superfamily
1V97A 2JRHA 2IY0B 2K22A 4L1BA 1WJNA 1J7AA 4C56C 3ZNGC 1FCLA 1HZ5A 1L0YB 1GJZA 2N9LA 2Y5BB 3B1LX 2K8BA 3B9JA 3QHTA 4WWNA 4BKTA 1IBXA 1XD3B 3AECB 1TY0A 5CHWA 3AB5A 2MSED 2WX0A 2J0KA 1WXQA 3MC0B 1D3ZA 2XEWA 2HTHA 1YMHE 1GG3A 4LNOA 2MBHA 2KMMA 4YT0B 3AE1B 3VQIA 3AE2B 1MG8A 1SJHD 1UBQA 3KWVA 3QAQA 4HPMB 4JL9A 1NEKB 1WGYA 3NUHB 3WANA 4KGRA 5DPTA 2FIDA 4WWOA 1YN5A 3NRZA 2WLBA 3UF8A 3PREA 2VH2A 2W3SA 2GBMA 2AEHA 3L10B 2MRPA 2TSSA 2K6QA 4J6IA 3FC4A 2PJHA 4FJYA 3TUOA 4NAWA 2OEDA 1PGAA 2Q5WD 4GSWA 1FCCC 1AARA 2INDC 2Y3AA 4RM8A 1WM2A 4GU2A 1YQBA 1A70A 2XBBC 4FHKA 3Q8BA 3AE9B 4JGHB 2ZZPB 2MJ3A 3EFCA 2OHFA 2V3NA 1XLPA 3M63B 1TGZB 2KMAA 2WXQA 1RLFA 2C60A 3LB8C 1SE2A 1XO3A 2DAFA 4B0EA 2WS3B 2OOBB 4KX6B 1ZXHA 2ZPYA 3JVZX 1RRBA 4PS3A 1E7UA 3AE8B 4A55A 1KH0A 2W82A 1WXVA 3R66C 1P7EA 4MM3A 2BB5A 2PMVA 3ZXVA 2KANA 1AW7A 1BT0A 3J9CA 2MHJA 2CHWA 2RPVA 2HJ8A 3A33B 3P2BA 4D2KA 2LGSA 2XK5A 3QK0A 1V2YA 1J19A 3IAM1 1KRHA 2J4XA 2NPTA 2BWES 2I1JA 2X8XX 1E7VA 4W9HA 4KDIC 1SBBB 5EDSA 3X0WA 2LEKA 2L00B 3RNAC 4E74A 4CHKA 1FPYA 2GB1A 1V1PB 4ZRPA 2FNJB 2PVOD 1I7HA 4G50A 1FIQA 1WXSA 3AV8A 2LJIA 4LJOB 4AP4C 1E8XA 3DDCB 2J42A 1U4AA 3FILA 3AMZA 4XX5A 4P1BC 3UQAA 1TT5B 4MJSB 4XGAB 2IBIB 3EA6A 3OAWA 3CMMB 1JROA 1I4PA 4OZAA 2EKEC 3AEGB 1TS5A 2KJRA 4HK2A 2KLGA 2RMMA 4HCPB 3ZDMC 1YJIA 1C9FA 3LXFA 4WIPA 4ZYNA 5HG2A 3AEBB 3P4QB 1QF6A 1FNVA 3AN1A 2L32A 2MLBA 4W9EA 2M0AA 3WAMA 3TEZA 3NHEB 1JW9D 2AQ2B 5AZHA 2W54A 2BKRB 1C4AA 1FO4A 3ZLZA 4TV3A 1OTRB 1L4ZB 4AQ7A 3QX1A 1WSPA 1L2NA 1LQBA 4AJYB 3Q8EA 4LNKA 2RSUA 1IGDA 2N7EA 4UDUC 3E56A 4MSMB 4WJQA 1C3TA 3K9OB 4FULA 1LO5D 2FAZA 3B0AA 2KN4A 3L13A 2G9HD 3U2SC 4HPLB 3UIOB 2QIEB 3VAWA 4KKIA 1UELA 1EF1A 2ASQA 4JIOU 2WXLA 1KLVA 3MTNB 1P9DU 1IBXB 2YEPF 3PVLA 1KLUD 4WH4A 2KDIA 1OQQA 3P63A 3UQBA 1MVKA 1EO6A 4ANXA 3DQVA 3KW5B 2BKFA 2G3QB 5HKHA 2JF5A 2IZVB 3ZNID 1NENB 1G6JA 1JRPA 1NYRA 2LVQA 5IP4D 2JXTA 1E7PB 1SE4A 4NPNA 4C00A 4HKQA 2G45B 2V1YA 3W1YA 2RDGA 2LWPA 3VTVA 1KFYB 2JX5A 4GDKA 4K7SA 4KVGB 2C5LC 4NNJB 3C19A 1WH3A 2KT7A 2HJ1A 2DENB 2GMIC 3W5VB 4AOFA 2NTSA 1MI0A 1C4CA 2K3UA 1Y56A 3VR9B 1T6BX 2D3AA 2BS2B 3KLSX 3RI7C 5E6NA 2ACZB 3NZ3A 1FXIA 2MBQA 4ZYSA 4TKNA 4ZRIA 2KJHB 3DBLB 5TR5A 3Q3OC 2GBKA 2WXIA 2BQQA 5J17A 1WYGA 5EE9A 2E6XA 4KDLB 1F1HA 4I6NB 2PPHA 3BYYB 2MX2A 3BIID 4RMAA 1WI0A 1Q0WB 1T0RC 3SD5A 2CJNA 2BS3B 3EUB2 1NI3A 3PHWB 4M00A 1ZE3D 3IAS1 3C8YA 3E9SA 2NS5A 3Q8CA 4OZCA 4PS8A 1DOYA 1AN8A 3KH0A 1UGMA 5BMHA 2RDHA 1CZPA 4EZKA 3PS6A 3T9LA 3KYCD 3MC8A 4ARCA 2JQRB 1ET6A 3BWUD 1E5WA 5LNK1 2JXXA 3KUDB 2CS4A 2X38A 2XK5B 2DZMA 1D5MC 4Q2JA 4C4VA 1EWCA 1L5PA 2B3AA 1N63A 1P0RA 1Q10A 1WX9A 2IO1B 2NPTB 2L83A 1D4BA 1ZPSA 1MJDA 2L1AA 2DHZA 2K1FA 2KDFB 3QARA 2LVPA 3L0WB 3ZW3A 2NVUI 5FK9C 1Q5WB 1VRAB 1L6UA 2AWTA 1GB4A 2QMTA 3ALBA 2G4DB 4M8MA 3VDZA 2KQ7A 3PLUA 2KN5A 3PZ8A 3ZNZB 1VZ6A 2MBBB 4GDLA 4W9CA 4F8CB 5HI1A 1SE3A 3FILB 3ZJTA 4BKSD 3QIJA 2JZZA 2AQ3B 2KACA 5AZGA 3ZUNA 2EKIA 4IWPA 4MH8A 4CQNA 3QWZB 2W55A 5CX3A 2KVRA 5D3DA 2M1MA 1RFAA 2M19A 2O6VD 1JWSD 4ICVA 4ZOHC 1KLGD 5LXIB 2L0TA 3VH4B 1M94A 1L6VA 1WZ0A 4FHJA 5BYSA 1V6EA 3Q8AA 5JH5C 4NJ6A 1WFYA 1JALA 5CHVC 4A90A 2PE9A 1OFFA 2L3ZA 1T0SC 2KOXA 3P4PB 2LI5A 2DWQA 3ABVB 3L08A 1AWDA 2QDFA 3A4RA 1CJEA 2KTFA 1WE7A 3ML8A 4RF1A 4WWMA 1N6ZA 1VZ7A 4LDTD 4NJ7A 2Z8LA 2AL6A 2BB6A 1R4MB 1HQRD 1E6EB 2MW5A 4LNIA 1I42A 4A3PA 1E8WA 1EM7A 4PK1A 4MELA 2WGSA 2MEKA 1J8CA 3SR6A 3NVZA 3APFA 4JX1C 2PIAA 3HVDA 4XWTA 1DOIA 3R8BA 2LASA 3U4EG 3N1XC 3NG0A 2H89B 4H2AA 3B2FA 2C9WB 4DHJB 2JWZA 3MHZA 1UF0A 4ZHPA 2MCNB 2ZW0A 2N9PC 3WAPA 1R7SA 4IUMB 3IT6B 1WF9A 1XLNA 5D3IB 3ZTCA 3TEYA 3ENEA 5FR6A 1WR6E 3BVGA 1FNUA 3NJTA 3P4SB 2QJLA 3PLVA 4YSZB 4US8A 3PRPB 2WQYB 1TTNA 3AE4B 1HZ6A 3R3MA 4PYUA 5E6JA 4GDKB 3NS8A 3W5UB 3VUYA 2N0SB 2I1KA 2L05A 1E8ZA 3C0RB 4ICUA 4DHZB 4B6WA 4OHJA 1UH6A 3H8HA 4TQ0A 4DWFA 2D07B 3APCA 1CMXB 2M8SA 3HK0A 1TZ1A 2BYTA 2XN9C 2G4SA 2BPSA 2JT4B 2WP9B 2I2YA 2MP2A 3AE6B 4E71A 3GS2A 4KKJA 4M0WA 4BKGA 2HE7A 1KF6B 4XWWA 1J0GA 3UINB 2LXCA 1SEBD 3Q8FA 2WWZA 2GLSA 2EMSA 4G3XB 4OVUA 3A1QA 3U8ZA 2K8CA 1IP9A 3AU5A 5JHBA 1LFDA 2DZJA 5G5HA 1JQ4A 1ZUD2 1MHHE 1R4MI 1WJ6A 3N9YC 4DQOC 1HTQA 1QOBA 2QEJC 4R3DA 2IGGA 5D6JB 2BW2A 4EEWA 1YQ3B 1LGRA 3IT4B 1K51A 3FKYA 3ZNHB 3AEFB 1TZOA 1VCBA 2MBOA 4KZ0A 4N59A 2V3SA 4NQKE 2KD0A 2JYTA 3URYA 5EE1A 5BO4B 4WURA 3P4RB 5DCNA 2KVZA 3TIXA 1D5ZC 3H7SA 1F9JA 2YVCA 3ECIA 4ARIA 2I38A 5GMVA 4FXCA 1FRDA 1SXTA 4AJWA 2DYMA 2IPKD 3H7PB 5IKCM 1FXTB 2KZRA 3HVZA 2FE8A 3H1UA 2BVCA 3H6NA 4MGYE 2CKHB 4B0MA 4DBGA 2KWCA 4P1CC 1I4HA 3OJ4B 4JE3B 3PT2B 3RULA 2GBJA 2LD9A 1Y8RC 2KWVB 3DBSA 4XDCA 1TJEA 5JZEB 5H92C 2K39A 2MA9B 3GOEA 4MEMA 2LGDA 4IM2A 4S0RA 3CWIA 2KTRA 3BYTB 1OEYJ 5E6PA 1I4GA 4DXAB 4DXFA 4RGNA 3Q3JA 1XXGA 2AYOB 4JPSA 4ANVA 3AH7A 3H9DA 1F2RC 4HVBA 1XQQA 1FMAD 3HUIA 4HPPA 3ZJVA 4BFRA 4FLHA 1EUVB 2NR2A 3VTUA 1V1OA 2HDEA 2L8JA 2EELA 3TBLD 2WYQA 3EECA 1JRUA 2IY1B 4RF0A 2ZVOA 3U7ZA 3CSTA 1P7FA 5IAAC 4KGSA 2NBVB 2BGFA 2JZPA 4QAYA 4W9IA 1V49A 4CO7A 1TKEA 1SIFA 3ZYYX 1YN3A 3TEWA 1TY2A 2WU5B 3N1YC 1T0YA 2FBWB 3VRBB 3KVFB 1QOFA 1JWMD 3ZDTA 1GOZA 3ONSA 1E0ZA 5LLIA 3ZRCA 3K9PB 3AEEB 2N1WA 1STEA 1S3SG 2DZIA 2RPQA 3PPAA 1V80A 3RUIB 2WDRB 3I63C 5LXHA 1XLOA 3RCZA 2BYFA 2UWQA 5TSSA 5IO9A 4KIKA 2O2VA 5DPRA 1D6EC 4EZLA 4RGTA 2CU1A 1WJ4A 1WRIA 3GE8C 4TSSA 3APDA 5EE3A 1ZDXA 1C76A 1YJ1A 1WMHA 3QJZA 2J7QB 2M0XA 4XC2A 3TCAA 3T3OA 2D2QA 3KQ4A 2RDBC 1NDDA 1C77A 1VDVA 3MJWA 1YNTE 1GUAB 1S1QB 3GB1A 3IBEA 3MJ5A 4C7YA 1IUEA 3Q3MC 1K53A 1H8CA 1L7YA 3UIPB 3EGRA 4K81A 1L0XB 2MJEA 3A9KA 3BVMA 1YN4A 2JU6X 1JCKB 2GBNA 1WGGA 1XEEA 1N60A 2MP2B 2QC8A 4PT5A 1ZOYB 4TUUA 2V4IB 4OZBA 2M17A 3N32A 4HJGE 1WX7A 3A4SC 2KDMA 1IGCA 1JWAD 2VZKB 2D3CA 3Q69A 3V62A 1ET9A 3BY4B 4XZ4A 2EMTA 5C2TB 4KV2A 1EU3A 3EHVA 2PW9A 2K5PA 5JHAA 2ZEQA 4ANWA 1NBFC 3DVNV 4NAWB 3LYYA 3A1QB 5T8IA 4P16A 3WAOA 2R2QA 3SDLC 2WDQB 2ONQA 2R61A 4LCDE 1R4NI 2DZKA 2V3PA 1MG4A 4DK5A 3NZUA 1PQSA 1HA5A 1PFDA 3R2TA 3U30A 2K9XA 2KFJA 4RM9A 1I35A 2ZVNA 2Z59B 2WNMA 4JWUC 1VJKA 4G0NB 4LK0M 4J3OD 1VLBA 2PE6B 4MACA 4A8XC 1PUTA 1C4PA 2KC2A 1PYWD 2JVCA 3FAHA 2A5UA 4MM3B 3HM6X 1SGHA 1BMLC 4MSQB 4A6QA 4BZAA 1CQVA 4HJKA 4HWIB 1RWSA 2KYWA 3JSVA 4BOZB 1XLQA 2W9NA 3DVGX 2ZNVB 2E3TA 4A3OA 4N9F4 1T5XD 4BKSA 4L23A 1EU4A 2QSDA 4M01A 4FN2A 3R7RA 2L52A 4W9GA 4W9FA 2D11A 2SEBD 3EFUA 4XE0A 1EWYC 4M02A 1J7BA 4YTPB 2LGIA 5FKAC 2KTRB 1FM0D 3O13A 2JSVX 2Y5CA 2M4NA 2O6VA 2QILA 2INPE 4USAA 2DNFA 4NY0A 3GP7A 4EE2A 3AM9A 4MDKE 2HTME 4HEA1 3V6CB 1WRDB 3ZGZA 4N6EB 3N30A 3A9JA 5D94A 1E8YA 1L4DB 2DYOA 2NCNA 3MC9A 3NY5A 3RNGC 3HM3A 4EFOA 2MBEA 1UD7A 4WQOB 3ZO5B 4FA6A 1BUIC 2MH7A 3DBRB 4EOYA 1SB3C 3JW0X 4ZRJA 1VZ8A 2IJ0A 2LHEA 1QOGA 4A20A 2KK8A 2KMCA 4RGOS 2UU7A 3D32A 3WCQA 1V1PA 1SE9A 4RH6A 2DYBA 1FRRA 2IO2B 4FJZA 3RZFA 1SJED 1KJTA 2CR5A 5JXVA 3Q6BA 1XF5L 2D10A 2D5GA 1AYFA 1V5OA 1YX5B 3L17A 1N5XA 5J2RA 2N7DA 3BK1A 4W9DA 1WIAA 1B1ZA 5J18A 1ZKHA 4LJPB 2BTEA 2H88B 1UBIA 2LJ5A 1I4XA 4KIKB 1XCTL 2O2VB 3RNBC 3DWGC 2WXGA 3M3JA 4W9KA 4P7IA 3MHSD 5H8YE 4O1NA 5IOIA 3TL5A 3NS1A 1OQRA 2KWUB 1WMHB 4WAAA 2NMQA 1IPGA 2LFIA 1MHXA 2C7NB 3DHIC 3L4PA 4GMVA 3W1SC 2WXNA 2Z0DB 4ASWC 3SEBA 2L0FA 2Z0EB 1NI2A 1FD6A 1LXDA 2WXKA 1TS3A 3T3NA 4YSXB 2ZCBA 5L83A 2CHZA 2LRUA 2FCSA 1OGWA 5C1ZA 3RFZB 2MQJA 1P1AA 2K6DB 3L54A 4EKUA 2LGXA 2FIFA 1KOTA 4AWJA 5HFYA 4IM0A 1WGKA 1TS4A 3B08A 3SU8X 4GIVA 4WQMA 3VUXA 4G11A 5L95C 2JUOA 3I9V1 1TKYA 3HRDD 3U7DA 2NBWB 3I3TB 1TS2A 4HROA 1WY8A 2KKCA 1FEHA 3WIMA 4LLGM 5IA7A 3WALA 2G1EA 2ICIA 1PGXA 4MH0E 2JZ3B 4XYCA 5AZFA 4BAXA 1P3QU 3NVYA 2LXAA 3DBRI 4HDOA 4IOIE 2BYEA 1PGBA 4BOSC 3NOBA 1TBEA 2WXMA 3AULA 1QKZA 4KZCA 1T3QA 2LZ6A 2IDYA 1MFWA 5G55A 1JWBD 1ZXIA 2R2OA 3BZDB 3DWMA 2WXRA 1C1YB 4KSKC 1QQRA 1WR1A 3MP9A 2NBUA 1YJJA 3ZQ4A 4B95A 1WZ3A 2J0JA 5AEKB 4GOCA 4HRSA 3IFWB 1D5XC 2WHIA 1YD8U 2HD5B 2INCC 3GZNB 3VUWA 4K3CA 3BVZA 2KJ6A 2K8HA 4S17A 4B9KA 3JSVB 4IKGA 1X1MA 4TMAB 3P42A 2DX5B 3CIRB 3IG3A 3QQ8B 2V4LA 4FADA 1UNSA 4C80A 1QOAA 4K7UA 4C4VB 4ZDVA 3IHPC 1ROEA 3I5JC 3DPDA 4DXGA 2PVGC 4HCNB 2DAJA 2VZKD 1ESFA 3VTWA 2BYVE 2WDVB 2OJWA 3KYDD 3QC8B 1SF0A 5MPOA 2QCZA 2C7HA 2C7MB 3AU4A 1F52A 3AEDB 3SHQA 3UI3A 1C79A 2LUMA 3V61A 1H4RA 2VH1A 3Q3NC 4IWQA 2IGDA 4IM3A 1VD2A 4MGZE 2O6VB 2WXOA 1V86A 4GDLB 3PSEB 2KO3A 2MWSB 2N9XA 4RFBA 3V3XA 4C7ZA 1YQ4B 5D2MB 2IYDB 1RAXA 2K25A 1KM7A 3A9JB 1I4RA 4BVUC 2JRIB 4IWOA 1RM6C 2KXJA 2A4ZA 1UWXA 1TKGA 1Q1OA 1CK1A 3VR8B 4LDTB 2KHWB 3RYTA 1E10A 2QHOA 3RN9C 3TEXA 1BXTA 3WA0A 1ISNA 2L76A 3NVWA 3W9CB 5I4DA 2LRWA 5G5GA 2ON8A 2KX3A 2RD0A 3ZJUA 1GC6A 3ML9A 2M56B 3AE5B 2RGFA 4K1RB 4US9A 3Q3FA 2KAJA 1SSNA 3L16A 1R4NB 3GZNI 4RNAA 1ZDVA 3KWLA 2J53A 5D7GA 2LGYA 2LVOA 3ZRFA 1NYQA 3N20C 1QT9A 2N7JA 3VVWB 2CJOA 4HXDA 3TJPA 1WGDA 4WAFA 3CF6E 5BMIA 1MPEA 4LNNA 1V8CA 1WJUA 1K50A 4WJOA 2PTLA 3Q2AC 3VXWA 2PEAA 4HDQA 3TMPB 1DOXA 2FUHB 4GGQA 4OVZA 5G2NA 1I4QA 2WXFA 1FXAA 3IVFA 4ITKA 3RT3B 3N3KB 3VRAB 3OWEB 3AEAB 5DPWA 3O65B 2JWUA 5FR3A 3R7QA 3QA8A 2WXHA 4K7WA 3RNEC 4DHZE 5BMGA 3RMKC 1UZXB 1J7CA 3EC8A 4WJPA 2KX0A 5E6OA 5C3JB 3LDZE 3DBHB 4IDIA 2N9EB 3X23A 4P6VF 2AQ1B 2Y5PA 3ZKJC 4JQWC 2N9KA 4REZA 1F77A 1Z2MA 1FNWA 1Z5SB 3AE7B 2YEPB 1JWUD 1YX6B 1QILA 2LUEA 2LHDA 2RR9A 1WGRA 4YTNB 5CHFA 3PZ7A 4KSLC 4NAMA 4CYEA 3W1SA 3KUZA 4II3B 1WXMA 2AL3A 3ZIMA 5IN7A 3PO0A 1IYFA 1V9JA 1PDXA 4YXDB 3LJ3A 1WGHA 4W9JA 4ZRQA 3PRMB 2B76B 1YIWA 4F1SA 1UUPA 3ETRA 1GC7A 2YLMA 2KFKA 2ZJDA 3VH3B 1SIJA 3V6EB 4M0WB 4FJVB 2FCNA 3B2GA 2GRIA 4ANUA 4IW0A 1F2RI 4RCOA 1DYQA 4ZRKA 3HHMA 4NZLB 3PV1A 2JYEA 4AS1A 4GXBA 2BS4B 4MGIE 4M8NA 4II2B 1A5RA 3QCAA 4URKA 4IG7B 5GXGB 2D3GA 1VR9A 2GBRA 3Q14C 1LM8B 1WXAA 2WU2B 2IGHA 2J52A 3SFDB 4DHJD 5C23A 2BT6A 1DGJA 3S2AA 2DBYA 1OQYA 2GI9A 2KQSA 2FUG1 1TYGB 3PRZA 5BYQA 2W3RA 2PLPA 1GB1A 1V81A 2V0GA 2NTTA 5KHQA 1FFVA 2V9HA 1K8RB 4MGKE 2FCQA 3TSSA 3AXCA 1HEZE 4FBJB 3AE3B 1JMLA 2LMCA 4GB9A 4EZJA 2KC1A 2BF8B 1HXYD 3HIZA 3NVVA 1TIFA 1V5TA 4NQLB 1GPXA 3OLMD 1ENFA 3DBHI 4BBNC 4A9AA 2KQ4X 4LNFA 2UYZB 2IO3B 2REXA 4BBNF 3M62B 4W9LA 1GAQB 1WE6A 2ZNVC 3RNCC 5EE0A 1E90A 3DHGC 1WYWB 1XT9B 4K3BA 1ZW7A 2K0PA 3I57A 3ZTDA 3BK2A 2KNBA 1QLBB 2AX5A 4PYZA 2N4FA 3GE3C 4WJNA 1KTKA 5DPSA 2WX1A 2KWDA 4DDID 4F7ZA 5KHOA 4I6LB 2VRRB 2CU3A 3UGBB 3BINA 2KDEB 4TQ1A 4LTUA 1M4VA 3RPFC 4PS7A 2BWFA 2KDBA 1N61A 5AUKA 3VFKA 3H7PA 4HLEA 3AI5A 1WM3A 5AUIA 3RZWC 2BBCA 2DLBA 1K52A 3JYUA 2D3BA 2L7RA 3CSFA 1OEYA 4ACFA 2WXPA 4YTMB 4IC7B 1RFKA 2WXJA 1F0ZA 3PHXB 4OVVA 2FCMA 4NJCA 3ZXRA 1NVID 5HHDG 3PTFC 4KGTA 1RYJA 4RGMA 1ACCA 4JLCA 4YWGG 3P1MA 3DVGY 4EUTA 2GOWA 4XDDA 1L0VB 4GLSC 3DBLI 1N62A 5BYRA 2J0MA 2INNE 1GNUA 4E3CA 2MJDA 4MJSA 3V05A 3DHHC 1ZGUB 4YSYB 3IXSA 3RNFC 2OJRA 3PGEA 3M95A 3OJ3A 5CTRC 1E9MA 2JY6A 4AUQC 2ZW1A 3W2DA 1QZEA 4OW0A 2PKOA 1ZP0B 4WWPA 2CHXA 4HKZE 4I6PA 2IO0B 4MT5A 3SFEB 3U52E 3T8MA 2KLCA 1WX8A 1EF5A 1B9RA 2ZCCA 3RD2A 1WWTA 4DDGD 4L2YA 2SAKA 1N5WA 4ZHOA 3OG5A 3DCGA 2JPHA 3NZSA 4N58A 1HTOA 1HE8A 1T0QC 3V60A 3KUCB 3N1ZC 3DVNU 3DOWA 3A9KB 2XNAC 3ZVVA 2ZPNA 1XCQL 1UWMA 1C78A 2N1VA 1FFUA 3PZDA 3MFGA 4X57B 1UGJA 3VHTC 4YL8A 1YOVB 2WDTB 2KFKB 4JWSC 1P98A 4GN1A 3R2IA
chains in the Genus database with same CATH topology
3MJ5A 1V97A 5FK9C 4C7YA 1IUEA 2K22A 1VRAB 4L1BA 1K53A 1J7AA 1L6UA 1I4RA 4C56C 1GB4A 2QMTA 1FCLA 3EGRA 1HZ5A 1L0XB 1L0YB 1RM6C 2MJEA 2N9LA 3B9JA 1YN4A 2JU6X 1JCKB 3BVMA 3PZ8A 1IBXA 3AECB 1VZ6A 1XEEA 1TY0A 1UWXA 1N60A 1TKGA 3AB5A 4PT5A 1ZOYB 1SE3A 5HI1A 1CK1A 3FILB 3VR8B 2V4IB 4OZBA 3ZJTA 1WXQA 3MC0B 4HJGE 1E10A 2AQ3B 2KDMA 1IGCA 1JWAD 1BXTA 2KACA 3TEXA 2VZKB 2EKIA 1YMHE 3NVWA 3Q69A 1ET9A 3W9CB 5I4DA 4MH8A 2KMMA 4CQNA 5G5GA 5C2TB 2W55A 4YT0B 3AE1B 1EU3A 3VQIA 2ON8A 2PW9A 3AE2B 3ZJUA 1SJHD 2K5PA 3KWVA 1NEKB 5D3DA 3NUHB 4NAWB 4KGRA 3LYYA 2M56B 3AE5B 5T8IA 2M19A 1YN5A 1JWSD 4P16A 4US9A 4ZOHC 3NRZA 1KLGD 2WDQB 2WLBA 2ONQA 1L6VA 2R61A 2KAJA 1SSNA 2V3PA 5BYSA 3Q8AA 2W3SA 4A90A 1JALA 4RNAA 1ZDVA 3KWLA 2J53A 5D7GA 1OFFA 1NYQA 1QT9A 2N7JA 1HA5A 1PFDA 3R2TA 2CJOA 2TSSA 2K9XA 3FC4A 3TUOA 3P4PB 3ABVB 2DWQA 2OEDA 1AWDA 1PGAA 4WAFA 5BMIA 1MPEA 2WNMA 1CJEA 4JWUC 1VJKA 4LK0M 2Q5WD 4J3OD 1VLBA 1FCCC 1V8CA 1K50A 4RF1A 4WWMA 2PTLA 2Y3AA 4MACA 4A8XC 1VZ7A 1DOXA 1PUTA 1C4PA 2Z8LA 4OVZA 1PYWD 2BB6A 1HQRD 1A70A 3FAHA 1I4QA 2WXFA 1FXAA 4MM3B 4ITKA 1E6EB 3AE9B 3Q8BA 3VRAB 3OWEB 1BMLC 3AEAB 2JWUA 4A6QA 1CQVA 1EM7A 2MJ3A 5FR3A 2OHFA 2V3NA 1XLPA 2MEKA 1RWSA 2WXQA 2WXHA 3LB8C 5BMGA 3SR6A 1SE2A 1XO3A 1J7CA 3NVZA 1XLQA 4B0EA 4JX1C 2WS3B 5C3JB 4KX6B 2PIAA 1ZXHA 2E3TA 3HVDA 4IDIA 1DOIA 4XWTA 3R8BA 4P6VF 2AQ1B 1T5XD 3U4EG 2Y5PA 4L23A 1EU4A 2N9KA 4REZA 3AE8B 1F77A 4A55A 1KH0A 1FNWA 2QSDA 2W82A 1P7EA 3AE7B 2BB5A 2H89B 2PMVA 2YEPB 1JWUD 4H2AA 3B2FA 2L52A 1AW7A 1QILA 2LHDA 3MHZA 3J9CA 4ZHPA 2SEBD 2ZW0A 2RPVA 4XE0A 4YTNB 1R7SA 1EWYC 3PZ7A 3IT6B 1J7BA 4NAMA 4YTPB 1XLNA 2LGIA 5D3IB 3TEYA 5FKAC 3W1SA 3BVGA 4D2KA 1FM0D 1FNUA 3P4SB 2QJLA 4YSZB 3O13A 2JSVX 4US8A 2Y5CA 3IAM1 1KRHA 3PO0A 2QILA 2WQYB 1PDXA 2J4XA 3AE4B 1HZ6A 4YXDB 2INPE 4USAA 5E6JA 4GDKB 3W5UB 2N0SB 4ZRQA 3GP7A 2B76B 4EE2A 1UUPA 3ETRA 3AM9A 2HTME 4OHJA 4HEA1 1SBBB 1SIJA 2LEKA 3H8HA 3ZGZA 4TQ0A 4N6EB 3B2GA 2GB1A 2GRIA 1V1PB 4ZRPA 2PVOD 1L4DB 2DYOA 1I7HA 1F2RI 4RCOA 2XN9C 2BYTA 1DYQA 1FIQA 4NZLB 2WP9B 3AV8A 2JYEA 2LJIA 2I2YA 4AS1A 2BS4B 1BUIC 2MH7A 1SB3C 3AE6B 2J42A 3FILA 3AMZA 5GXGB 1VZ8A 1VR9A 2IJ0A 2LHEA 1QOGA 2WU2B 2IGHA 2J52A 3SFDB 3EA6A 3GS2A 4KKJA 1JROA 4M0WA 4RGOS 1I4PA 4OZAA 3AEGB 2BT6A 1KF6B 1TS5A 4XWWA 1DGJA 3WCQA 1V1PA 2DBYA 2GI9A 2FUG1 4RH6A 1FRRA 1TYGB 1SEBD 2RMMA 3Q8FA 1YJIA 1C9FA 3LXFA 4WIPA 5BYQA 1SJED 2W3RA 5HG2A 2PLPA 5JXVA 1GB1A 2V0GA 1XF5L 2NTTA 3AEBB 1FFVA 2D5GA 3P4QB 1QF6A 1AYFA 1N5XA 3BK1A 3TSSA 1FNVA 3AN1A 2L32A 1B1ZA 5G5HA 1JQ4A 1ZUD2 1HEZE 2M0AA 1MHHE 3AE3B 2BTEA 3TEZA 3N9YC 4DQOC 1JW9D 2AQ2B 2W54A 2H88B 1QOBA 2QEJC 1JMLA 1C4AA 4R3DA 2IGGA 2LMCA 1FO4A 1HXYD 1I4XA 2BW2A 1XCTL 3NVVA 1YQ3B 1L4ZB 2WXGA 3DWGC 4AQ7A 3IT4B 1K51A 1WSPA 5H8YE 1GPXA 3AEFB 1TZOA 4O1NA 3Q8EA 1ENFA 3NS1A 1OQRA 1IGDA 4A9AA 2KQ4X 2NMQA 2LFIA 4UDUC 4N59A 3E56A 2JYTA 1MHXA 3URYA 5EE1A 3L4PA 4WURA 1GAQB 2WXNA 1LO5D 3P4RB 2KN4A 2G9HD 3SEBA 5EE0A 1D5ZC 1FD6A 2WXKA 1TS3A 3U2SC 3T3NA 4ARIA 2QIEB 4YSXB 4KKIA 2I38A 4FXCA 1FRDA 1SXTA 2K0PA 3I57A 2WXLA 3BK2A 2DYMA 2IPKD 1QLBB 3RFZB 3HVZA 2AX5A 2FE8A 1IBXB 1KTKA 2YEPF 4B0MA 1KLUD 4WH4A 5HFYA 1OQQA 2KWDA 1I4HA 3P63A 4JE3B 1MVKA 1WGKA 1TS4A 4WQMA 2CU3A 4TQ1A 4LTUA 1M4VA 3RPFC 3I9V1 1TKYA 3HRDD 4XDCA 1TJEA 1TS2A 5H92C 1N61A 5AUKA 4HROA 1FEHA 1NENB 4LLGM 5AUIA 1JRPA 1NYRA 3CWIA 2JXTA 1E7PB 3BYTB 2BBCA 2DLBA 1SE4A 2G1EA 2ICIA 1I4GA 1K52A 1PGXA 4HKQA 4DXFA 4RGNA 1XXGA 3NVYA 2RDGA 1KFYB 2JX5A 4JPSA 4IOIE 2WXPA 4YTMB 1PGBA 1RFKA 2WXJA 3AH7A 1F0ZA 1F2RC 2WXMA 4NJCA 1QKZA 1T3QA 1FMAD 3HUIA 3W5VB 2NTSA 1MI0A 1C4CA 1NVID 5HHDG 2K3UA 1Y56A 2IDYA 3VR9B 1T6BX 3ZJVA 4KGTA 1JWBD 1ZXIA 2BS2B 3BZDB 1RYJA 3DWMA 4RGMA 2WXRA 1ACCA 3KLSX 1V1OA 4YWGG 1QQRA 2ACZB 2HDEA 3MP9A 3P1MA 3NZ3A 1FXIA 1YJJA 2EELA 3ZQ4A 4ZYSA 4XDDA 1L0VB 4GLSC 1N62A 5BYRA 2INNE 4HRSA 4RF0A 1D5XC 3U7ZA 2WXIA 2MJDA 1P7FA 1WYGA 4KGSA 5EE9A 3V05A 2E6XA 4YSYB 3IXSA 3BYYB 3BVZA 2JZPA 1E9MA 3BIID 1TKEA 2ZW1A 3W2DA 4IKGA 1YN3A 3ZYYX 3TEWA 1TY2A 2WU5B 4OW0A 4TMAB 2CJNA 2PKOA 1ZP0B 2BS3B 2FBWB 3P42A 3EUB2 3VRBB 3CIRB 1NI3A 1QOFA 1JWMD 4HKZE 1GOZA 4MT5A 1E0ZA 3SFEB 1UNSA 4C80A 3U52E 1ZE3D 1QOAA 3IAS1 3C8YA 3E9SA 3AEEB 1ROEA 1STEA 3Q8CA 4DXGA 2PVGC 4OZCA 1B9RA 1DOYA 1AN8A 1WWTA 2VZKD 1ESFA 2RDHA 5BMHA 1CZPA 2WDRB 2WDVB 4L2YA 1SF0A 2SAKA 2JQRB 5MPOA 1N5WA 1XLOA 4ARCA 5TSSA 4ZHOA 1ET6A 3BWUD 4N58A 5LNK1 1D6EC 3AEDB 4RGTA 3UI3A 1WRIA 1C79A 2LUMA 2X38A 4TSSA 2IGDA 1ZDXA 5EE3A 1D5MC 4Q2JA 1EWCA 1L5PA 1C76A 1N63A 2XNAC 2WXOA 1Q10A 4GDLB 1XCQL 1UWMA 1C78A 4RFBA 1FFUA 2L83A 3T3OA 3V3XA 1ZPSA 3KQ4A 1D4BA 3MFGA 1C77A 1UGJA 1VDVA 4C7ZA 2L1AA 1YNTE 3GB1A 1YQ4B 4JWSC 3R2IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XO3 A;  3P4Q B;  1QF6 A;  1V97 A;  1J7C A;  1AYF A;  1XLQ A;  3NVZ A;  4C7Y A;  1IUE A;  1T3Q A;  2K22 A;  1N5X A;  1FMA D;  2WS3 B;  4JX1 C;  3HUI A;  4KX6 B;  5C3J B;  2PIA A;  1J7A A;  1L6U A;  2E3T A;  4IDI A;  3W5V B;  1DOI A;  3AN1 A;  1NVI D;  4P6V F;  5G5H A;  3VR9 B;  1JQ4 A;  1ZUD 2;  1RM6 C;  2MJE A;  1JWB D;  1ZXI A;  3B9J A;  2BS2 B;  3AE3 B;  1RYJ A;  3DWM A;  3AE8 B;  1JW9 D;  3AEC B;  2W54 A;  2H88 B;  1QOB A;  2ACZ B;  3AE7 B;  1N60 A;  1TKG A;  2H89 B;  3AB5 A;  1FO4 A;  1ZOY B;  3B2F A;  3P1M A;  2L52 A;  1FXI A;  1YJJ A;  3VR8 B;  3NVV A;  1YQ3 B;  3DWG C;  1L0V B;  1WXQ A;  4ZHP A;  1E10 A;  1N62 A;  4YTN B;  4HRS A;  1R7S A;  1JWA D;  5H8Y E;  1EWY C;  1GPX A;  3AEF B;  4YTP B;  1J7B A;  2EKI A;  3NS1 A;  1OQR A;  1XLN A;  2MJD A;  3NVW A;  3W9C B;  1WYG A;  5EE9 A;  4A9A A;  2KMM A;  5G5G A;  5C2T B;  1FM0 D;  2W55 A;  3P4S B;  3AE1 B;  2QJL A;  4N59 A;  4YSY B;  4YT0 B;  4YSZ B;  4US8 A;  3AE2 B;  2Y5C A;  1KRH A;  2K5P A;  3PO0 A;  5EE1 A;  3L4P A;  2WQY B;  1PDX A;  3AE4 B;  1NEK B;  1GAQ B;  4YXD B;  4USA A;  1E9M A;  3P4R B;  3BII D;  3W5U B;  5EE0 A;  1TKE A;  2N0S B;  2M56 B;  3ZYY X;  3AE5 B;  2B76 B;  2M19 A;  2WU5 B;  2QIE B;  3ETR A;  4YSX B;  2CJN A;  2PKO A;  1ZP0 B;  2BS3 B;  2FBW B;  3AM9 A;  3EUB 2;  4US9 A;  2HTM E;  3CIR B;  4ZOH C;  3VRB B;  1NI3 A;  3NRZ A;  1FRD A;  2WDQ B;  2WLB A;  4FXC A;  1QOF A;  1L6V A;  1E0Z A;  3SFE B;  2KAJ A;  1SIJ A;  1QLB B;  2LEK A;  4C80 A;  1QOA A;  3HVZ A;  4N6E B;  2AX5 A;  2W3S A;  3B2G A;  3AEE B;  1ROE A;  1JAL A;  2PVG C;  2PVO D;  1I7H A;  3KWL A;  1B9R A;  1DOY A;  1OFF A;  1NYQ A;  1QT9 A;  1OQQ A;  1WWT A;  1FIQ A;  1PFD A;  3P63 A;  2CJO A;  1WGK A;  2WP9 B;  3AV8 A;  2K9X A;  1CZP A;  3FC4 A;  2WDR B;  2WDV B;  2BS4 B;  2MH7 A;  2DWQ A;  2CU3 A;  3ABV B;  1SB3 C;  1SF0 A;  1AWD A;  3P4P B;  4WQM A;  2JQR B;  3AE6 B;  1N5W A;  1XLO A;  4LTU A;  5MPO A;  3RPF C;  4ZHO A;  1CJE A;  1TKY A;  4JWU C;  1VJK A;  3AMZ A;  3HRD D;  2Q5W D;  4N58 A;  5GXG B;  1VLB A;  1V8C A;  1TJE A;  3AED B;  1QOG A;  5H92 C;  2WU2 B;  1N61 A;  1WRI A;  4WWM A;  5AUK A;  3SFD B;  4HRO A;  1JRO A;  5EE3 A;  1DOX A;  1NEN B;  1L5P A;  1PUT A;  3AEG B;  2BT6 A;  1KF6 B;  5AUI A;  1JRP A;  1N63 A;  1NYR A;  3CWI A;  1DGJ A;  3WCQ A;  2DBY A;  1E7P B;  1A70 A;  2G1E A;  3FAH A;  1FXA A;  1FRR A;  1UWM A;  4ITK A;  1TYG B;  1E6E B;  3AE9 B;  3VRA B;  1FFU A;  2L83 A;  1YJI A;  3AEA B;  3LXF A;  3NVY A;  1KFY B;  2JX5 A;  2MJ3 A;  1VDV A;  2W3R A;  2OHF A;  4C7Z A;  1XLP A;  4YTM B;  1RWS A;  1RFK A;  3AH7 A;  3LB8 C;  1YQ4 B;  4JWS C;  1F0Z A;  3AEB B;  1FFV A;  3SR6 A; 
#chains in the Genus database with same CATH topology
 1V97 A;  2JRH A;  2IY0 B;  2K22 A;  4L1B A;  1WJN A;  1J7A A;  4C56 C;  3ZNG C;  1FCL A;  1HZ5 A;  1L0Y B;  1GJZ A;  2N9L A;  2Y5B B;  3B1L X;  2K8B A;  3B9J A;  3QHT A;  4WWN A;  4BKT A;  1IBX A;  1XD3 B;  3AEC B;  1TY0 A;  5CHW A;  3AB5 A;  2MSE D;  2WX0 A;  2J0K A;  1WXQ A;  3MC0 B;  1D3Z A;  2XEW A;  2HTH A;  1YMH E;  1GG3 A;  4LNO A;  2MBH A;  2KMM A;  4YT0 B;  3AE1 B;  3VQI A;  3AE2 B;  1MG8 A;  1SJH D;  1UBQ A;  3KWV A;  3QAQ A;  4HPM B;  4JL9 A;  1NEK B;  1WGY A;  3NUH B;  3WAN A;  4KGR A;  5DPT A;  2FID A;  4WWO A;  1YN5 A;  3NRZ A;  2WLB A;  3UF8 A;  3PRE A;  2VH2 A;  2W3S A;  2GBM A;  2AEH A;  3L10 B;  2MRP A;  2TSS A;  2K6Q A;  4J6I A;  3FC4 A;  2PJH A;  4FJY A;  3TUO A;  4NAW A;  2OED A;  1PGA A;  2Q5W D;  4GSW A;  1FCC C;  1AAR A;  2IND C;  2Y3A A;  4RM8 A;  1WM2 A;  4GU2 A;  1YQB A;  1A70 A;  2XBB C;  4FHK A;  3Q8B A;  3AE9 B;  4JGH B;  2ZZP B;  2MJ3 A;  3EFC A;  2OHF A;  2V3N A;  1XLP A;  3M63 B;  1TGZ B;  2KMA A;  2WXQ A;  1RLF A;  2C60 A;  3LB8 C;  1SE2 A;  1XO3 A;  2DAF A;  4B0E A;  2WS3 B;  2OOB B;  4KX6 B;  1ZXH A;  2ZPY A;  3JVZ X;  1RRB A;  4PS3 A;  1E7U A;  3AE8 B;  4A55 A;  1KH0 A;  2W82 A;  1WXV A;  3R66 C;  1P7E A;  4MM3 A;  2BB5 A;  2PMV A;  3ZXV A;  2KAN A;  1AW7 A;  1BT0 A;  3J9C A;  2MHJ A;  2CHW A;  2RPV A;  2HJ8 A;  3A33 B;  3P2B A;  4D2K A;  2LGS A;  2XK5 A;  3QK0 A;  1V2Y A;  1J19 A;  3IAM 1;  1KRH A;  2J4X A;  2NPT A;  2BWE S;  2I1J A;  2X8X X;  1E7V A;  4W9H A;  4KDI C;  1SBB B;  5EDS A;  3X0W A;  2LEK A;  2L00 B;  3RNA C;  4E74 A;  4CHK A;  1FPY A;  2GB1 A;  1V1P B;  4ZRP A;  2FNJ B;  2PVO D;  1I7H A;  4G50 A;  1FIQ A;  1WXS A;  3AV8 A;  2LJI A;  4LJO B;  4AP4 C;  1E8X A;  3DDC B;  2J42 A;  1U4A A;  3FIL A;  3AMZ A;  4XX5 A;  4P1B C;  3UQA A;  1TT5 B;  4MJS B;  4XGA B;  2IBI B;  3EA6 A;  3OAW A;  3CMM B;  1JRO A;  1I4P A;  4OZA A;  2EKE C;  3AEG B;  1TS5 A;  2KJR A;  4HK2 A;  2KLG A;  2RMM A;  4HCP B;  3ZDM C;  1YJI A;  1C9F A;  3LXF A;  4WIP A;  4ZYN A;  5HG2 A;  3AEB B;  3P4Q B;  1QF6 A;  1FNV A;  3AN1 A;  2L32 A;  2MLB A;  4W9E A;  2M0A A;  3WAM A;  3TEZ A;  3NHE B;  1JW9 D;  2AQ2 B;  5AZH A;  2W54 A;  2BKR B;  1C4A A;  1FO4 A;  3ZLZ A;  4TV3 A;  1OTR B;  1L4Z B;  4AQ7 A;  3QX1 A;  1WSP A;  1L2N A;  1LQB A;  4AJY B;  3Q8E A;  4LNK A;  2RSU A;  1IGD A;  2N7E A;  4UDU C;  3E56 A;  4MSM B;  4WJQ A;  1C3T A;  3K9O B;  4FUL A;  1LO5 D;  2FAZ A;  3B0A A;  2KN4 A;  3L13 A;  2G9H D;  3U2S C;  4HPL B;  3UIO B;  2QIE B;  3VAW A;  4KKI A;  1UEL A;  1EF1 A;  2ASQ A;  4JIO U;  2WXL A;  1KLV A;  3MTN B;  1P9D U;  1IBX B;  2YEP F;  3PVL A;  1KLU D;  4WH4 A;  2KDI A;  1OQQ A;  3P63 A;  3UQB A;  1MVK A;  1EO6 A;  4ANX A;  3DQV A;  3KW5 B;  2BKF A;  2G3Q B;  5HKH A;  2JF5 A;  2IZV B;  3ZNI D;  1NEN B;  1G6J A;  1JRP A;  1NYR A;  2LVQ A;  5IP4 D;  2JXT A;  1E7P B;  1SE4 A;  4NPN A;  4C00 A;  4HKQ A;  2G45 B;  2V1Y A;  3W1Y A;  2RDG A;  2LWP A;  3VTV A;  1KFY B;  2JX5 A;  4GDK A;  4K7S A;  4KVG B;  2C5L C;  4NNJ B;  3C19 A;  1WH3 A;  2KT7 A;  2HJ1 A;  2DEN B;  2GMI C;  3W5V B;  4AOF A;  2NTS A;  1MI0 A;  1C4C A;  2K3U A;  1Y56 A;  3VR9 B;  1T6B X;  2D3A A;  2BS2 B;  3KLS X;  3RI7 C;  5E6N A;  2ACZ B;  3NZ3 A;  1FXI A;  2MBQ A;  4ZYS A;  4TKN A;  4ZRI A;  2KJH B;  3DBL B;  5TR5 A;  3Q3O C;  2GBK A;  2WXI A;  2BQQ A;  5J17 A;  1WYG A;  5EE9 A;  2E6X A;  4KDL B;  1F1H A;  4I6N B;  2PPH A;  3BYY B;  2MX2 A;  3BII D;  4RMA A;  1WI0 A;  1Q0W B;  1T0R C;  3SD5 A;  2CJN A;  2BS3 B;  3EUB 2;  1NI3 A;  3PHW B;  4M00 A;  1ZE3 D;  3IAS 1;  3C8Y A;  3E9S A;  2NS5 A;  3Q8C A;  4OZC A;  4PS8 A;  1DOY A;  1AN8 A;  3KH0 A;  1UGM A;  5BMH A;  2RDH A;  1CZP A;  4EZK A;  3PS6 A;  3T9L A;  3KYC D;  3MC8 A;  4ARC A;  2JQR B;  1ET6 A;  3BWU D;  1E5W A;  5LNK 1;  2JXX A;  3KUD B;  2CS4 A;  2X38 A;  2XK5 B;  2DZM A;  1D5M C;  4Q2J A;  4C4V A;  1EWC A;  1L5P A;  2B3A A;  1N63 A;  1P0R A;  1Q10 A;  1WX9 A;  2IO1 B;  2NPT B;  2L83 A;  1D4B A;  1ZPS A;  1MJD A;  2L1A A;  2DHZ A;  2K1F A;  2KDF B;  3QAR A;  2LVP A;  3L0W B;  3ZW3 A;  2NVU I;  5FK9 C;  1Q5W B;  1VRA B;  1L6U A;  2AWT A;  1GB4 A;  2QMT A;  3ALB A;  2G4D B;  4M8M A;  3VDZ A;  2KQ7 A;  3PLU A;  2KN5 A;  3PZ8 A;  3ZNZ B;  1VZ6 A;  2MBB B;  4GDL A;  4W9C A;  4F8C B;  5HI1 A;  1SE3 A;  3FIL B;  3ZJT A;  4BKS D;  3QIJ A;  2JZZ A;  2AQ3 B;  2KAC A;  5AZG A;  3ZUN A;  2EKI A;  4IWP A;  4MH8 A;  4CQN A;  3QWZ B;  2W55 A;  5CX3 A;  2KVR A;  5D3D A;  2M1M A;  1RFA A;  2M19 A;  2O6V D;  1JWS D;  4ICV A;  4ZOH C;  1KLG D;  5LXI B;  2L0T A;  3VH4 B;  1M94 A;  1L6V A;  1WZ0 A;  4FHJ A;  5BYS A;  1V6E A;  3Q8A A;  5JH5 C;  4NJ6 A;  1WFY A;  1JAL A;  5CHV C;  4A90 A;  2PE9 A;  1OFF A;  2L3Z A;  1T0S C;  2KOX A;  3P4P B;  2LI5 A;  2DWQ A;  3ABV B;  3L08 A;  1AWD A;  2QDF A;  3A4R A;  1CJE A;  2KTF A;  1WE7 A;  3ML8 A;  4RF1 A;  4WWM A;  1N6Z A;  1VZ7 A;  4LDT D;  4NJ7 A;  2Z8L A;  2AL6 A;  2BB6 A;  1R4M B;  1HQR D;  1E6E B;  2MW5 A;  4LNI A;  1I42 A;  4A3P A;  1E8W A;  1EM7 A;  4PK1 A;  4MEL A;  2WGS A;  2MEK A;  1J8C A;  3SR6 A;  3NVZ A;  3APF A;  4JX1 C;  2PIA A;  3HVD A;  4XWT A;  1DOI A;  3R8B A;  2LAS A;  3U4E G;  3N1X C;  3NG0 A;  2H89 B;  4H2A A;  3B2F A;  2C9W B;  4DHJ B;  2JWZ A;  3MHZ A;  1UF0 A;  4ZHP A;  2MCN B;  2ZW0 A;  2N9P C;  3WAP A;  1R7S A;  4IUM B;  3IT6 B;  1WF9 A;  1XLN A;  5D3I B;  3ZTC A;  3TEY A;  3ENE A;  5FR6 A;  1WR6 E;  3BVG A;  1FNU A;  3NJT A;  3P4S B;  2QJL A;  3PLV A;  4YSZ B;  4US8 A;  3PRP B;  2WQY B;  1TTN A;  3AE4 B;  1HZ6 A;  3R3M A;  4PYU A;  5E6J A;  4GDK B;  3NS8 A;  3W5U B;  3VUY A;  2N0S B;  2I1K A;  2L05 A;  1E8Z A;  3C0R B;  4ICU A;  4DHZ B;  4B6W A;  4OHJ A;  1UH6 A;  3H8H A;  4TQ0 A;  4DWF A;  2D07 B;  3APC A;  1CMX B;  2M8S A;  3HK0 A;  1TZ1 A;  2BYT A;  2XN9 C;  2G4S A;  2BPS A;  2JT4 B;  2WP9 B;  2I2Y A;  2MP2 A;  3AE6 B;  4E71 A;  3GS2 A;  4KKJ A;  4M0W A;  4BKG A;  2HE7 A;  1KF6 B;  4XWW A;  1J0G A;  3UIN B;  2LXC A;  1SEB D;  3Q8F A;  2WWZ A;  2GLS A;  2EMS A;  4G3X B;  4OVU A;  3A1Q A;  3U8Z A;  2K8C A;  1IP9 A;  3AU5 A;  5JHB A;  1LFD A;  2DZJ A;  5G5H A;  1JQ4 A;  1ZUD 2;  1MHH E;  1R4M I;  1WJ6 A;  3N9Y C;  4DQO C;  1HTQ A;  1QOB A;  2QEJ C;  4R3D A;  2IGG A;  5D6J B;  2BW2 A;  4EEW A;  1YQ3 B;  1LGR A;  3IT4 B;  1K51 A;  3FKY A;  3ZNH B;  3AEF B;  1TZO A;  1VCB A;  2MBO A;  4KZ0 A;  4N59 A;  2V3S A;  4NQK E;  2KD0 A;  2JYT A;  3URY A;  5EE1 A;  5BO4 B;  4WUR A;  3P4R B;  5DCN A;  2KVZ A;  3TIX A;  1D5Z C;  3H7S A;  1F9J A;  2YVC A;  3ECI A;  4ARI A;  2I38 A;  5GMV A;  4FXC A;  1FRD A;  1SXT A;  4AJW A;  2DYM A;  2IPK D;  3H7P B;  5IKC M;  1FXT B;  2KZR A;  3HVZ A;  2FE8 A;  3H1U A;  2BVC A;  3H6N A;  4MGY E;  2CKH B;  4B0M A;  4DBG A;  2KWC A;  4P1C C;  1I4H A;  3OJ4 B;  4JE3 B;  3PT2 B;  3RUL A;  2GBJ A;  2LD9 A;  1Y8R C;  2KWV B;  3DBS A;  4XDC A;  1TJE A;  5JZE B;  5H92 C;  2K39 A;  2MA9 B;  3GOE A;  4MEM A;  2LGD A;  4IM2 A;  4S0R A;  3CWI A;  2KTR A;  3BYT B;  1OEY J;  5E6P A;  1I4G A;  4DXA B;  4DXF A;  4RGN A;  3Q3J A;  1XXG A;  2AYO B;  4JPS A;  4ANV A;  3AH7 A;  3H9D A;  1F2R C;  4HVB A;  1XQQ A;  1FMA D;  3HUI A;  4HPP A;  3ZJV A;  4BFR A;  4FLH A;  1EUV B;  2NR2 A;  3VTU A;  1V1O A;  2HDE A;  2L8J A;  2EEL A;  3TBL D;  2WYQ A;  3EEC A;  1JRU A;  2IY1 B;  4RF0 A;  2ZVO A;  3U7Z A;  3CST A;  1P7F A;  5IAA C;  4KGS A;  2NBV B;  2BGF A;  2JZP A;  4QAY A;  4W9I A;  1V49 A;  4CO7 A;  1TKE A;  1SIF A;  3ZYY X;  1YN3 A;  3TEW A;  1TY2 A;  2WU5 B;  3N1Y C;  1T0Y A;  2FBW B;  3VRB B;  3KVF B;  1QOF A;  1JWM D;  3ZDT A;  1GOZ A;  3ONS A;  1E0Z A;  5LLI A;  3ZRC A;  3K9P B;  3AEE B;  2N1W A;  1STE A;  1S3S G;  2DZI A;  2RPQ A;  3PPA A;  1V80 A;  3RUI B;  2WDR B;  3I63 C;  5LXH A;  1XLO A;  3RCZ A;  2BYF A;  2UWQ A;  5TSS A;  5IO9 A;  4KIK A;  2O2V A;  5DPR A;  1D6E C;  4EZL A;  4RGT A;  2CU1 A;  1WJ4 A;  1WRI A;  3GE8 C;  4TSS A;  3APD A;  5EE3 A;  1ZDX A;  1C76 A;  1YJ1 A;  1WMH A;  3QJZ A;  2J7Q B;  2M0X A;  4XC2 A;  3TCA A;  3T3O A;  2D2Q A;  3KQ4 A;  2RDB C;  1NDD A;  1C77 A;  1VDV A;  3MJW A;  1YNT E;  1GUA B;  1S1Q B;  3GB1 A;  3IBE A;  3MJ5 A;  4C7Y A;  1IUE A;  3Q3M C;  1K53 A;  1H8C A;  1L7Y A;  3UIP B;  3EGR A;  4K81 A;  1L0X B;  2MJE A;  3A9K A;  3BVM A;  1YN4 A;  2JU6 X;  1JCK B;  2GBN A;  1WGG A;  1XEE A;  1N60 A;  2MP2 B;  2QC8 A;  4PT5 A;  1ZOY B;  4TUU A;  2V4I B;  4OZB A;  2M17 A;  3N32 A;  4HJG E;  1WX7 A;  3A4S C;  2KDM A;  1IGC A;  1JWA D;  2VZK B;  2D3C A;  3Q69 A;  3V62 A;  1ET9 A;  3BY4 B;  4XZ4 A;  2EMT A;  5C2T B;  4KV2 A;  1EU3 A;  3EHV A;  2PW9 A;  2K5P A;  5JHA A;  2ZEQ A;  4ANW A;  1NBF C;  3DVN V;  4NAW B;  3LYY A;  3A1Q B;  5T8I A;  4P16 A;  3WAO A;  2R2Q A;  3SDL C;  2WDQ B;  2ONQ A;  2R61 A;  4LCD E;  1R4N I;  2DZK A;  2V3P A;  1MG4 A;  4DK5 A;  3NZU A;  1PQS A;  1HA5 A;  1PFD A;  3R2T A;  3U30 A;  2K9X A;  2KFJ A;  4RM9 A;  1I35 A;  2ZVN A;  2Z59 B;  2WNM A;  4JWU C;  1VJK A;  4G0N B;  4LK0 M;  4J3O D;  1VLB A;  2PE6 B;  4MAC A;  4A8X C;  1PUT A;  1C4P A;  2KC2 A;  1PYW D;  2JVC A;  3FAH A;  2A5U A;  4MM3 B;  3HM6 X;  1SGH A;  1BML C;  4MSQ B;  4A6Q A;  4BZA A;  1CQV A;  4HJK A;  4HWI B;  1RWS A;  2KYW A;  3JSV A;  4BOZ B;  1XLQ A;  2W9N A;  3DVG X;  2ZNV B;  2E3T A;  4A3O A;  4N9F 4;  1T5X D;  4BKS A;  4L23 A;  1EU4 A;  2QSD A;  4M01 A;  4FN2 A;  3R7R A;  2L52 A;  4W9G A;  4W9F A;  2D11 A;  2SEB D;  3EFU A;  4XE0 A;  1EWY C;  4M02 A;  1J7B A;  4YTP B;  2LGI A;  5FKA C;  2KTR B;  1FM0 D;  3O13 A;  2JSV X;  2Y5C A;  2M4N A;  2O6V A;  2QIL A;  2INP E;  4USA A;  2DNF A;  4NY0 A;  3GP7 A;  4EE2 A;  3AM9 A;  4MDK E;  2HTM E;  4HEA 1;  3V6C B;  1WRD B;  3ZGZ A;  4N6E B;  3N30 A;  3A9J A;  5D94 A;  1E8Y A;  1L4D B;  2DYO A;  2NCN A;  3MC9 A;  3NY5 A;  3RNG C;  3HM3 A;  4EFO A;  2MBE A;  1UD7 A;  4WQO B;  3ZO5 B;  4FA6 A;  1BUI C;  2MH7 A;  3DBR B;  4EOY A;  1SB3 C;  3JW0 X;  4ZRJ A;  1VZ8 A;  2IJ0 A;  2LHE A;  1QOG A;  4A20 A;  2KK8 A;  2KMC A;  4RGO S;  2UU7 A;  3D32 A;  3WCQ A;  1V1P A;  1SE9 A;  4RH6 A;  2DYB A;  1FRR A;  2IO2 B;  4FJZ A;  3RZF A;  1SJE D;  1KJT A;  2CR5 A;  5JXV A;  3Q6B A;  1XF5 L;  2D10 A;  2D5G A;  1AYF A;  1V5O A;  1YX5 B;  3L17 A;  1N5X A;  5J2R A;  2N7D A;  3BK1 A;  4W9D A;  1WIA A;  1B1Z A;  5J18 A;  1ZKH A;  4LJP B;  2BTE A;  2H88 B;  1UBI A;  2LJ5 A;  1I4X A;  4KIK B;  1XCT L;  2O2V B;  3RNB C;  3DWG C;  2WXG A;  3M3J A;  4W9K A;  4P7I A;  3MHS D;  5H8Y E;  4O1N A;  5IOI A;  3TL5 A;  3NS1 A;  1OQR A;  2KWU B;  1WMH B;  4WAA A;  2NMQ A;  1IPG A;  2LFI A;  1MHX A;  2C7N B;  3DHI C;  3L4P A;  4GMV A;  3W1S C;  2WXN A;  2Z0D B;  4ASW C;  3SEB A;  2L0F A;  2Z0E B;  1NI2 A;  1FD6 A;  1LXD A;  2WXK A;  1TS3 A;  3T3N A;  4YSX B;  2ZCB A;  5L83 A;  2CHZ A;  2LRU A;  2FCS A;  1OGW A;  5C1Z A;  3RFZ B;  2MQJ A;  1P1A A;  2K6D B;  3L54 A;  4EKU A;  2LGX A;  2FIF A;  1KOT A;  4AWJ A;  5HFY A;  4IM0 A;  1WGK A;  1TS4 A;  3B08 A;  3SU8 X;  4GIV A;  4WQM A;  3VUX A;  4G11 A;  5L95 C;  2JUO A;  3I9V 1;  1TKY A;  3HRD D;  3U7D A;  2NBW B;  3I3T B;  1TS2 A;  4HRO A;  1WY8 A;  2KKC A;  1FEH A;  3WIM A;  4LLG M;  5IA7 A;  3WAL A;  2G1E A;  2ICI A;  1PGX A;  4MH0 E;  2JZ3 B;  4XYC A;  5AZF A;  4BAX A;  1P3Q U;  3NVY A;  2LXA A;  3DBR I;  4HDO A;  4IOI E;  2BYE A;  1PGB A;  4BOS C;  3NOB A;  1TBE A;  2WXM A;  3AUL A;  1QKZ A;  4KZC A;  1T3Q A;  2LZ6 A;  2IDY A;  1MFW A;  5G55 A;  1JWB D;  1ZXI A;  2R2O A;  3BZD B;  3DWM A;  2WXR A;  1C1Y B;  4KSK C;  1QQR A;  1WR1 A;  3MP9 A;  2NBU A;  1YJJ A;  3ZQ4 A;  4B95 A;  1WZ3 A;  2J0J A;  5AEK B;  4GOC A;  4HRS A;  3IFW B;  1D5X C;  2WHI A;  1YD8 U;  2HD5 B;  2INC C;  3GZN B;  3VUW A;  4K3C A;  3BVZ A;  2KJ6 A;  2K8H A;  4S17 A;  4B9K A;  3JSV B;  4IKG A;  1X1M A;  4TMA B;  3P42 A;  2DX5 B;  3CIR B;  3IG3 A;  3QQ8 B;  2V4L A;  4FAD A;  1UNS A;  4C80 A;  1QOA A;  4K7U A;  4C4V B;  4ZDV A;  3IHP C;  1ROE A;  3I5J C;  3DPD A;  4DXG A;  2PVG C;  4HCN B;  2DAJ A;  2VZK D;  1ESF A;  3VTW A;  2BYV E;  2WDV B;  2OJW A;  3KYD D;  3QC8 B;  1SF0 A;  5MPO A;  2QCZ A;  2C7H A;  2C7M B;  3AU4 A;  1F52 A;  3AED B;  3SHQ A;  3UI3 A;  1C79 A;  2LUM A;  3V61 A;  1H4R A;  2VH1 A;  3Q3N C;  4IWQ A;  2IGD A;  4IM3 A;  1VD2 A;  4MGZ E;  2O6V B;  2WXO A;  1V86 A;  4GDL B;  3PSE B;  2KO3 A;  2MWS B;  2N9X A;  4RFB A;  3V3X A;  4C7Z A;  1YQ4 B;  5D2M B;  2IYD B;  1RAX A;  2K25 A;  1KM7 A;  3A9J B;  1I4R A;  4BVU C;  2JRI B;  4IWO A;  1RM6 C;  2KXJ A;  2A4Z A;  1UWX A;  1TKG A;  1Q1O A;  1CK1 A;  3VR8 B;  4LDT B;  2KHW B;  3RYT A;  1E10 A;  2QHO A;  3RN9 C;  3TEX A;  1BXT A;  3WA0 A;  1ISN A;  2L76 A;  3NVW A;  3W9C B;  5I4D A;  2LRW A;  5G5G A;  2ON8 A;  2KX3 A;  2RD0 A;  3ZJU A;  1GC6 A;  3ML9 A;  2M56 B;  3AE5 B;  2RGF A;  4K1R B;  4US9 A;  3Q3F A;  2KAJ A;  1SSN A;  3L16 A;  1R4N B;  3GZN I;  4RNA A;  1ZDV A;  3KWL A;  2J53 A;  5D7G A;  2LGY A;  2LVO A;  3ZRF A;  1NYQ A;  3N20 C;  1QT9 A;  2N7J A;  3VVW B;  2CJO A;  4HXD A;  3TJP A;  1WGD A;  4WAF A;  3CF6 E;  5BMI A;  1MPE A;  4LNN A;  1V8C A;  1WJU A;  1K50 A;  4WJO A;  2PTL A;  3Q2A C;  3VXW A;  2PEA A;  4HDQ A;  3TMP B;  1DOX A;  2FUH B;  4GGQ A;  4OVZ A;  5G2N A;  1I4Q A;  2WXF A;  1FXA A;  3IVF A;  4ITK A;  3RT3 B;  3N3K B;  3VRA B;  3OWE B;  3AEA B;  5DPW A;  3O65 B;  2JWU A;  5FR3 A;  3R7Q A;  3QA8 A;  2WXH A;  4K7W A;  3RNE C;  4DHZ E;  5BMG A;  3RMK C;  1UZX B;  1J7C A;  3EC8 A;  4WJP A;  2KX0 A;  5E6O A;  5C3J B;  3LDZ E;  3DBH B;  4IDI A;  2N9E B;  3X23 A;  4P6V F;  2AQ1 B;  2Y5P A;  3ZKJ C;  4JQW C;  2N9K A;  4REZ A;  1F77 A;  1Z2M A;  1FNW A;  1Z5S B;  3AE7 B;  2YEP B;  1JWU D;  1YX6 B;  1QIL A;  2LUE A;  2LHD A;  2RR9 A;  1WGR A;  4YTN B;  5CHF A;  3PZ7 A;  4KSL C;  4NAM A;  4CYE A;  3W1S A;  3KUZ A;  4II3 B;  1WXM A;  2AL3 A;  3ZIM A;  5IN7 A;  3PO0 A;  1IYF A;  1V9J A;  1PDX A;  4YXD B;  3LJ3 A;  1WGH A;  4W9J A;  4ZRQ A;  3PRM B;  2B76 B;  1YIW A;  4F1S A;  1UUP A;  3ETR A;  1GC7 A;  2YLM A;  2KFK A;  2ZJD A;  3VH3 B;  1SIJ A;  3V6E B;  4M0W B;  4FJV B;  2FCN A;  3B2G A;  2GRI A;  4ANU A;  4IW0 A;  1F2R I;  4RCO A;  1DYQ A;  4ZRK A;  3HHM A;  4NZL B;  3PV1 A;  2JYE A;  4AS1 A;  4GXB A;  2BS4 B;  4MGI E;  4M8N A;  4II2 B;  1A5R A;  3QCA A;  4URK A;  4IG7 B;  5GXG B;  2D3G A;  1VR9 A;  2GBR A;  3Q14 C;  1LM8 B;  1WXA A;  2WU2 B;  2IGH A;  2J52 A;  3SFD B;  4DHJ D;  5C23 A;  2BT6 A;  1DGJ A;  3S2A A;  2DBY A;  1OQY A;  2GI9 A;  2KQS A;  2FUG 1;  1TYG B;  3PRZ A;  5BYQ A;  2W3R A;  2PLP A;  1GB1 A;  1V81 A;  2V0G A;  2NTT A;  5KHQ A;  1FFV A;  2V9H A;  1K8R B;  4MGK E;  2FCQ A;  3TSS A;  3AXC A;  1HEZ E;  4FBJ B;  3AE3 B;  1JML A;  2LMC A;  4GB9 A;  4EZJ A;  2KC1 A;  2BF8 B;  1HXY D;  3HIZ A;  3NVV A;  1TIF A;  1V5T A;  4NQL B;  1GPX A;  3OLM D;  1ENF A;  3DBH I;  4BBN C;  4A9A A;  2KQ4 X;  4LNF A;  2UYZ B;  2IO3 B;  2REX A;  4BBN F;  3M62 B;  4W9L A;  1GAQ B;  1WE6 A;  2ZNV C;  3RNC C;  5EE0 A;  1E90 A;  3DHG C;  1WYW B;  1XT9 B;  4K3B A;  1ZW7 A;  2K0P A;  3I57 A;  3ZTD A;  3BK2 A;  2KNB A;  1QLB B;  2AX5 A;  4PYZ A;  2N4F A;  3GE3 C;  4WJN A;  1KTK A;  5DPS A;  2WX1 A;  2KWD A;  4DDI D;  4F7Z A;  5KHO A;  4I6L B;  2VRR B;  2CU3 A;  3UGB B;  3BIN A;  2KDE B;  4TQ1 A;  4LTU A;  1M4V A;  3RPF C;  4PS7 A;  2BWF A;  2KDB A;  1N61 A;  5AUK A;  3VFK A;  3H7P A;  4HLE A;  3AI5 A;  1WM3 A;  5AUI A;  3RZW C;  2BBC A;  2DLB A;  1K52 A;  3JYU A;  2D3B A;  2L7R A;  3CSF A;  1OEY A;  4ACF A;  2WXP A;  4YTM B;  4IC7 B;  1RFK A;  2WXJ A;  1F0Z A;  3PHX B;  4OVV A;  2FCM A;  4NJC A;  3ZXR A;  1NVI D;  5HHD G;  3PTF C;  4KGT A;  1RYJ A;  4RGM A;  1ACC A;  4JLC A;  4YWG G;  3P1M A;  3DVG Y;  4EUT A;  2GOW A;  4XDD A;  1L0V B;  4GLS C;  3DBL I;  1N62 A;  5BYR A;  2J0M A;  2INN E;  1GNU A;  4E3C A;  2MJD A;  4MJS A;  3V05 A;  3DHH C;  1ZGU B;  4YSY B;  3IXS A;  3RNF C;  2OJR A;  3PGE A;  3M95 A;  3OJ3 A;  5CTR C;  1E9M A;  2JY6 A;  4AUQ C;  2ZW1 A;  3W2D A;  1QZE A;  4OW0 A;  2PKO A;  1ZP0 B;  4WWP A;  2CHX A;  4HKZ E;  4I6P A;  2IO0 B;  4MT5 A;  3SFE B;  3U52 E;  3T8M A;  2KLC A;  1WX8 A;  1EF5 A;  1B9R A;  2ZCC A;  3RD2 A;  1WWT A;  4DDG D;  4L2Y A;  2SAK A;  1N5W A;  4ZHO A;  3OG5 A;  3DCG A;  2JPH A;  3NZS A;  4N58 A;  1HTO A;  1HE8 A;  1T0Q C;  3V60 A;  3KUC B;  3N1Z C;  3DVN U;  3DOW A;  3A9K B;  2XNA C;  3ZVV A;  2ZPN A;  1XCQ L;  1UWM A;  1C78 A;  2N1V A;  1FFU A;  3PZD A;  3MFG A;  4X57 B;  1UGJ A;  3VHT C;  4YL8 A;  1YOV B;  2WDT B;  2KFK B;  4JWS C;  1P98 A;  4GN1 A;  3R2I A; 
#chains in the Genus database with same CATH homology
 3MJ5 A;  1V97 A;  5FK9 C;  4C7Y A;  1IUE A;  2K22 A;  1VRA B;  4L1B A;  1K53 A;  1J7A A;  1L6U A;  1I4R A;  4C56 C;  1GB4 A;  2QMT A;  1FCL A;  3EGR A;  1HZ5 A;  1L0X B;  1L0Y B;  1RM6 C;  2MJE A;  2N9L A;  3B9J A;  1YN4 A;  2JU6 X;  1JCK B;  3BVM A;  3PZ8 A;  1IBX A;  3AEC B;  1VZ6 A;  1XEE A;  1TY0 A;  1UWX A;  1N60 A;  1TKG A;  3AB5 A;  4PT5 A;  1ZOY B;  1SE3 A;  5HI1 A;  1CK1 A;  3FIL B;  3VR8 B;  2V4I B;  4OZB A;  3ZJT A;  1WXQ A;  3MC0 B;  4HJG E;  1E10 A;  2AQ3 B;  2KDM A;  1IGC A;  1JWA D;  1BXT A;  2KAC A;  3TEX A;  2VZK B;  2EKI A;  1YMH E;  3NVW A;  3Q69 A;  1ET9 A;  3W9C B;  5I4D A;  4MH8 A;  2KMM A;  4CQN A;  5G5G A;  5C2T B;  2W55 A;  4YT0 B;  3AE1 B;  1EU3 A;  3VQI A;  2ON8 A;  2PW9 A;  3AE2 B;  3ZJU A;  1SJH D;  2K5P A;  3KWV A;  1NEK B;  5D3D A;  3NUH B;  4NAW B;  4KGR A;  3LYY A;  2M56 B;  3AE5 B;  5T8I A;  2M19 A;  1YN5 A;  1JWS D;  4P16 A;  4US9 A;  4ZOH C;  3NRZ A;  1KLG D;  2WDQ B;  2WLB A;  2ONQ A;  1L6V A;  2R61 A;  2KAJ A;  1SSN A;  2V3P A;  5BYS A;  3Q8A A;  2W3S A;  4A90 A;  1JAL A;  4RNA A;  1ZDV A;  3KWL A;  2J53 A;  5D7G A;  1OFF A;  1NYQ A;  1QT9 A;  2N7J A;  1HA5 A;  1PFD A;  3R2T A;  2CJO A;  2TSS A;  2K9X A;  3FC4 A;  3TUO A;  3P4P B;  3ABV B;  2DWQ A;  2OED A;  1AWD A;  1PGA A;  4WAF A;  5BMI A;  1MPE A;  2WNM A;  1CJE A;  4JWU C;  1VJK A;  4LK0 M;  2Q5W D;  4J3O D;  1VLB A;  1FCC C;  1V8C A;  1K50 A;  4RF1 A;  4WWM A;  2PTL A;  2Y3A A;  4MAC A;  4A8X C;  1VZ7 A;  1DOX A;  1PUT A;  1C4P A;  2Z8L A;  4OVZ A;  1PYW D;  2BB6 A;  1HQR D;  1A70 A;  3FAH A;  1I4Q A;  2WXF A;  1FXA A;  4MM3 B;  4ITK A;  1E6E B;  3AE9 B;  3Q8B A;  3VRA B;  3OWE B;  1BML C;  3AEA B;  2JWU A;  4A6Q A;  1CQV A;  1EM7 A;  2MJ3 A;  5FR3 A;  2OHF A;  2V3N A;  1XLP A;  2MEK A;  1RWS A;  2WXQ A;  2WXH A;  3LB8 C;  5BMG A;  3SR6 A;  1SE2 A;  1XO3 A;  1J7C A;  3NVZ A;  1XLQ A;  4B0E A;  4JX1 C;  2WS3 B;  5C3J B;  4KX6 B;  2PIA A;  1ZXH A;  2E3T A;  3HVD A;  4IDI A;  1DOI A;  4XWT A;  3R8B A;  4P6V F;  2AQ1 B;  1T5X D;  3U4E G;  2Y5P A;  4L23 A;  1EU4 A;  2N9K A;  4REZ A;  3AE8 B;  1F77 A;  4A55 A;  1KH0 A;  1FNW A;  2QSD A;  2W82 A;  1P7E A;  3AE7 B;  2BB5 A;  2H89 B;  2PMV A;  2YEP B;  1JWU D;  4H2A A;  3B2F A;  2L52 A;  1AW7 A;  1QIL A;  2LHD A;  3MHZ A;  3J9C A;  4ZHP A;  2SEB D;  2ZW0 A;  2RPV A;  4XE0 A;  4YTN B;  1R7S A;  1EWY C;  3PZ7 A;  3IT6 B;  1J7B A;  4NAM A;  4YTP B;  1XLN A;  2LGI A;  5D3I B;  3TEY A;  5FKA C;  3W1S A;  3BVG A;  4D2K A;  1FM0 D;  1FNU A;  3P4S B;  2QJL A;  4YSZ B;  3O13 A;  2JSV X;  4US8 A;  2Y5C A;  3IAM 1;  1KRH A;  3PO0 A;  2QIL A;  2WQY B;  1PDX A;  2J4X A;  3AE4 B;  1HZ6 A;  4YXD B;  2INP E;  4USA A;  5E6J A;  4GDK B;  3W5U B;  2N0S B;  4ZRQ A;  3GP7 A;  2B76 B;  4EE2 A;  1UUP A;  3ETR A;  3AM9 A;  2HTM E;  4OHJ A;  4HEA 1;  1SBB B;  1SIJ A;  2LEK A;  3H8H A;  3ZGZ A;  4TQ0 A;  4N6E B;  3B2G A;  2GB1 A;  2GRI A;  1V1P B;  4ZRP A;  2PVO D;  1L4D B;  2DYO A;  1I7H A;  1F2R I;  4RCO A;  2XN9 C;  2BYT A;  1DYQ A;  1FIQ A;  4NZL B;  2WP9 B;  3AV8 A;  2JYE A;  2LJI A;  2I2Y A;  4AS1 A;  2BS4 B;  1BUI C;  2MH7 A;  1SB3 C;  3AE6 B;  2J42 A;  3FIL A;  3AMZ A;  5GXG B;  1VZ8 A;  1VR9 A;  2IJ0 A;  2LHE A;  1QOG A;  2WU2 B;  2IGH A;  2J52 A;  3SFD B;  3EA6 A;  3GS2 A;  4KKJ A;  1JRO A;  4M0W A;  4RGO S;  1I4P A;  4OZA A;  3AEG B;  2BT6 A;  1KF6 B;  1TS5 A;  4XWW A;  1DGJ A;  3WCQ A;  1V1P A;  2DBY A;  2GI9 A;  2FUG 1;  4RH6 A;  1FRR A;  1TYG B;  1SEB D;  2RMM A;  3Q8F A;  1YJI A;  1C9F A;  3LXF A;  4WIP A;  5BYQ A;  1SJE D;  2W3R A;  5HG2 A;  2PLP A;  5JXV A;  1GB1 A;  2V0G A;  1XF5 L;  2NTT A;  3AEB B;  1FFV A;  2D5G A;  3P4Q B;  1QF6 A;  1AYF A;  1N5X A;  3BK1 A;  3TSS A;  1FNV A;  3AN1 A;  2L32 A;  1B1Z A;  5G5H A;  1JQ4 A;  1ZUD 2;  1HEZ E;  2M0A A;  1MHH E;  3AE3 B;  2BTE A;  3TEZ A;  3N9Y C;  4DQO C;  1JW9 D;  2AQ2 B;  2W54 A;  2H88 B;  1QOB A;  2QEJ C;  1JML A;  1C4A A;  4R3D A;  2IGG A;  2LMC A;  1FO4 A;  1HXY D;  1I4X A;  2BW2 A;  1XCT L;  3NVV A;  1YQ3 B;  1L4Z B;  2WXG A;  3DWG C;  4AQ7 A;  3IT4 B;  1K51 A;  1WSP A;  5H8Y E;  1GPX A;  3AEF B;  1TZO A;  4O1N A;  3Q8E A;  1ENF A;  3NS1 A;  1OQR A;  1IGD A;  4A9A A;  2KQ4 X;  2NMQ A;  2LFI A;  4UDU C;  4N59 A;  3E56 A;  2JYT A;  1MHX A;  3URY A;  5EE1 A;  3L4P A;  4WUR A;  1GAQ B;  2WXN A;  1LO5 D;  3P4R B;  2KN4 A;  2G9H D;  3SEB A;  5EE0 A;  1D5Z C;  1FD6 A;  2WXK A;  1TS3 A;  3U2S C;  3T3N A;  4ARI A;  2QIE B;  4YSX B;  4KKI A;  2I38 A;  4FXC A;  1FRD A;  1SXT A;  2K0P A;  3I57 A;  2WXL A;  3BK2 A;  2DYM A;  2IPK D;  1QLB B;  3RFZ B;  3HVZ A;  2AX5 A;  2FE8 A;  1IBX B;  1KTK A;  2YEP F;  4B0M A;  1KLU D;  4WH4 A;  5HFY A;  1OQQ A;  2KWD A;  1I4H A;  3P63 A;  4JE3 B;  1MVK A;  1WGK A;  1TS4 A;  4WQM A;  2CU3 A;  4TQ1 A;  4LTU A;  1M4V A;  3RPF C;  3I9V 1;  1TKY A;  3HRD D;  4XDC A;  1TJE A;  1TS2 A;  5H92 C;  1N61 A;  5AUK A;  4HRO A;  1FEH A;  1NEN B;  4LLG M;  5AUI A;  1JRP A;  1NYR A;  3CWI A;  2JXT A;  1E7P B;  3BYT B;  2BBC A;  2DLB A;  1SE4 A;  2G1E A;  2ICI A;  1I4G A;  1K52 A;  1PGX A;  4HKQ A;  4DXF A;  4RGN A;  1XXG A;  3NVY A;  2RDG A;  1KFY B;  2JX5 A;  4JPS A;  4IOI E;  2WXP A;  4YTM B;  1PGB A;  1RFK A;  2WXJ A;  3AH7 A;  1F0Z A;  1F2R C;  2WXM A;  4NJC A;  1QKZ A;  1T3Q A;  1FMA D;  3HUI A;  3W5V B;  2NTS A;  1MI0 A;  1C4C A;  1NVI D;  5HHD G;  2K3U A;  1Y56 A;  2IDY A;  3VR9 B;  1T6B X;  3ZJV A;  4KGT A;  1JWB D;  1ZXI A;  2BS2 B;  3BZD B;  1RYJ A;  3DWM A;  4RGM A;  2WXR A;  1ACC A;  3KLS X;  1V1O A;  4YWG G;  1QQR A;  2ACZ B;  2HDE A;  3MP9 A;  3P1M A;  3NZ3 A;  1FXI A;  1YJJ A;  2EEL A;  3ZQ4 A;  4ZYS A;  4XDD A;  1L0V B;  4GLS C;  1N62 A;  5BYR A;  2INN E;  4HRS A;  4RF0 A;  1D5X C;  3U7Z A;  2WXI A;  2MJD A;  1P7F A;  1WYG A;  4KGS A;  5EE9 A;  3V05 A;  2E6X A;  4YSY B;  3IXS A;  3BYY B;  3BVZ A;  2JZP A;  1E9M A;  3BII D;  1TKE A;  2ZW1 A;  3W2D A;  4IKG A;  1YN3 A;  3ZYY X;  3TEW A;  1TY2 A;  2WU5 B;  4OW0 A;  4TMA B;  2CJN A;  2PKO A;  1ZP0 B;  2BS3 B;  2FBW B;  3P42 A;  3EUB 2;  3VRB B;  3CIR B;  1NI3 A;  1QOF A;  1JWM D;  4HKZ E;  1GOZ A;  4MT5 A;  1E0Z A;  3SFE B;  1UNS A;  4C80 A;  3U52 E;  1ZE3 D;  1QOA A;  3IAS 1;  3C8Y A;  3E9S A;  3AEE B;  1ROE A;  1STE A;  3Q8C A;  4DXG A;  2PVG C;  4OZC A;  1B9R A;  1DOY A;  1AN8 A;  1WWT A;  2VZK D;  1ESF A;  2RDH A;  5BMH A;  1CZP A;  2WDR B;  2WDV B;  4L2Y A;  1SF0 A;  2SAK A;  2JQR B;  5MPO A;  1N5W A;  1XLO A;  4ARC A;  5TSS A;  4ZHO A;  1ET6 A;  3BWU D;  4N58 A;  5LNK 1;  1D6E C;  3AED B;  4RGT A;  3UI3 A;  1WRI A;  1C79 A;  2LUM A;  2X38 A;  4TSS A;  2IGD A;  1ZDX A;  5EE3 A;  1D5M C;  4Q2J A;  1EWC A;  1L5P A;  1C76 A;  1N63 A;  2XNA C;  2WXO A;  1Q10 A;  4GDL B;  1XCQ L;  1UWM A;  1C78 A;  4RFB A;  1FFU A;  2L83 A;  3T3O A;  3V3X A;  1ZPS A;  3KQ4 A;  1D4B A;  3MFG A;  1C77 A;  1UGJ A;  1VDV A;  4C7Z A;  2L1A A;  1YNT E;  3GB1 A;  1YQ4 B;  4JWS C;  3R2I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...