5IAAC

Crystal structure of human uba5 in complex with ufm1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
80
structure length
80
Chain Sequence
b'VSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like modifier-activating enzyme 5
publication title Trans-Binding Mechanism of Ubiquitin-like Protein Activation Revealed by a UBA5-UFM1 Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 17
structure length 80
sequence length 80
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03671 Ufm1 Ubiquitin fold modifier 1 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5iaaC00
3A9JB 1YD8U 2Z0EB 2IBIB 3SHQA 4ZRKA 4CYEA 2B3AA 1GNUA 2IYDB 2JXXA 4I6NB 4K7UA 5DPTA 5IAAC 3VH4B 1SGHA 1GUAB 5D94A 3AU4A 2OOBB 3PREA 1M94A 2RGFA 5DPSA 1WR6E 2HJ8A 3I3TB 3UF8A 5J18A 4CHKA 2L00B 2JPHA 3OJ3A 2NCNA 4IWOA 3QA8A 1XQQA 3ZNID 4BKSA 1EUVB 2XBBC 4X57B 3DBLI 4EKUA 3ZNGC 2BYEA 4GU2A 4FADA 2MBBB 2FUHB 5CTRC 3M95A 2L3ZA 2WYQA 2G45B 2DAFA 2ZPYA 4ZDVA 3IFWB 3PTFC 2M1MA 1LXDA 1KJTA 1WM2A 2IO0B 1E8ZA 4NAWA 2KD0A 3VDZA 3NZSA 2NBVB 3V61A 5DPWA 4MM3A 3KH0A 1UELA 1XT9B 2CKHB 2FCNA 2ZZPB 3PV1A 4IC7B 3DBHI 1I42A 2ZEQA 5GMVA 4AJYB 2K39A 2MBEA 3V62A 1WMHB 3OLMD 2YVCA 3RZWC 3WALA 3VTVA 3PVLA 4MJSA 3PHXB 1H8CA 2KKCA 2R2OA 2JVCA 2Y5BB 3L08A 1WFYA 2M8SA 1E7UA 5C1ZA 3Q3FA 3KYDD 1WJNA 3DVNV 3M3JA 4WJNA 4W9HA 3B1LX 4WJOA 3PRPB 2ZJDA 2XK5A 3KW5B 4FA6A 1P3QU 4NJ7A 4DHJB 4KSLC 5HKHA 3UQBA 4BBNF 3DVGY 3QCAA 3VVWB 3PSEB 2DZMA 4W9IA 5BO4B 5EDSA 1OQYA 2ZPNA 2REXA 2KHWB 2RR9A 1U4AA 2LVPA 4MGIE 4F8CB 4W9CA 4G3XB 2GBNA 1V81A 3HK0A 4HPMB 1UZXB 3QK0A 2KX3A 4HWIB 4W9JA 5KHOA 2KWVB 4HVBA 1R4MI 1X1MA 2YLMA 4XZ4A 4KZCA 1E90A 2K6QA 4J6IA 4PS8A 1EF1A 5JHAA 2C7HA 1WZ0A 1PQSA 4B9KA 4EZLA 2BWFA 1V80A 4K81A 3V6EB 5AZFA 2JZZA 3NOBA 1WE7A 3WIMA 1HE8A 2DYBA 2JT4B 4A3OA 2KFKB 4EZKA 3QC8B 2GBRA 3A33B 2KJHB 1V86A 2FAZA 4II3B 3ZKJC 2LVOA 2LD9A 4JIOU 4EEWA 1V2YA 2KFJA 2JY6A 2D11A 2L0FA 4K1RB 3W1YA 5D7GA 3L54A 3RZFA 3W1SC 2A5UA 3B08A 3HHMA 3VXWA 2KWCA 4EFOA 4KDLB 1IYFA 3ENEA 3WAPA 2J0JA 4LJOB 3RULA 3DQVA 3K9OB 3NHEB 4JLCA 1S3SG 2A4ZA 5CX3A 2HE7A 4WAAA 2D10A 2BYFA 5JHBA 1WX9A 3TL5A 2DHZA 1WY8A 4AUQC 3N30A 4GB9A 2PEAA 1NI2A 4TQ1A 3VH3B 4BBNC 2ASQA 1L2NA 4OVUA 2DYMA 4GGQA 4PS3A 2N1VA 4DDID 3L0WB 4AP4C 3TIXA 3NY5A 2ZVNA 4ASWC 4M8MA 5DCNA 4MGZE 3UGBB 3VHTC 1WGHA 3JYUA 3ML8A 5IA7A 4NY0A 4BOSC 1P1AA 3VUYA 2NVUI 3ZDMC 2EMSA 4GIVA 1SIFA 2BWES 2NS5A 4TQ0A 4BKGA 5TR5A 4NNJB 3AI5A 1GC7A 1GC6A 4OVVA 2MA9B 3VAWA 2RPQA 2PE9A 3UIOB 3KVFB 2KQSA 2I1KA 1VD2A 2FIDA 3H1UA 3R66C 1CMXB 4G50A 4ANUA 3ALBA 1KOTA 2KWUB 4XX5A 4W9GA 1Q0WB 5LXHA 4IW0A 4P7IA 3RD2A 1YX5B 2AL6A 3DVGX 4MDKE 2MRPA 5J17A 2DZJA 4WWOA 2J7QB 2CR5A 4NJ6A 3A9JA 4TV3A 1YIWA 1Z2MA 1E5WA 1C1YB 1H4RA 1ZGUB 3P2BA 1V9JA 4E74A 3TMPB 1TZ1A 2FNJB 4DHJD 3JVZX 3L17A 4IM0A 3KUCB 4F1SA 1WXAA 1TBEA 4G0NB 3VFKA 1WJUA 2CHXA 2LGYA 3ZTDA 4DWFA 1TGZB 1ISNA 3CF6E 1WXVA 3SU8X 3V60A 3WA0A 4BFRA 2O6VB 3ZNZB 4JL9A 2KQ7A 2KC2A 4W9LA 4W9KA 3SD5A 3X0WA 2LRUA 2DAJA 1E8XA 3K9PB 2QHOA 4GDLB 2ZCBA 4MELA 5DPRA 2FCSA 4FJZA 1YQBA 4MH0E 3KYCD 4DK5A 3RCZA 5D6JB 2WWZA 2JUOA 1F9JA 5KHQA 4AOFA 2BGFA 2RD0A 4I6LB 3ECIA 3ML9A 4G11A 2MX2A 3CSTA 2AL3A 3EFUA 2KZRA 2W9NA 3PGEA 2KMCA 1WGGA 1E8WA 1LQBA 5CHFA 2VRRB 4FN2A 2EKEC 1WMHA 3H7PB 4HDOA 5E6OA 2MP2B 1LM8B 4PYUA 4LJPB 2AEHA 3H7SA 2RSUA 3PRMB 4LDTB 3A9KB 1S1QB 4IM2A 3VUXA 4HPLB 4HXDA 1V5OA 2PJHA 1KM7A 1MG8A 2GBKA 3VUWA 3ZUNA 4JGHB 2DZKA 2LASA 2LI5A 4KSKC 3KUZA 2Z0DB 3T8MA 4FJVB 4AWJA 1EO6A 2GBJA 2KDIA 3OJ4B 4BVUC 4IWPA 2JZ3B 1SE9A 2KVRA 2IY1B 4GMVA 3SDLC 4B95A 4WWNA 1WIAA 4KVGB 5JH5C 2D07B 3RT3B 1WE6A 1TTNA 4A20A 3PHWB 2ZNVC 2FCMA 3QQ8B 4BKTA 2L05A 3QJZA 1AARA 2J0KA 4IWQA 3PRZA 2O2VB 2FIFA 1WGRA 2ZNVB 3L16A 1WZ3A 2ZVOA 1NBFC 4GDKB 2PE6B 3PZDA 3R3MA 4DXAB 2KLCA 2C5LC 4M0WB 2FCQA 1BT0A 2AWTA 2KNBA 4DHZB 4HK2A 4KV2A 4ICVA 2N9PC 4N9F4 2KFKA 2BYVE 4WQOB 1OEYJ 3A4RA 2M4NA 5JZEB 4GSWA 1A5RA 2MQJA 1RLFA 4KIKB 3R7QA 2MLBA 5L83A 1V49A 1KLVA 4WJQA 5AZHA 3PLVA 3AXCA 4NQKE 4PYZA 2CU1A 2IO1B 2KDBA 3S2AA 3JSVB 1WXMA 5D2MB 1UH6A 1LFDA 2N7DA 3CMMB 2JRHA 4XC2A 2ZCCA 3A1QB 2NBUA 4URKA 2LXCA 3APCA 4ZRIA 3DDCB 5G2NA 2BF8B 2K8BA 2LZ6A 2WX0A 2DX5B 4A3PA 1FXTB 1YJ1A 4MGKE 2L0TA 3U7DA 2LGXA 2LUEA 1J19A 1WF9A 3AU5A 1RAXA 2N4FA 2O6VD 2KK8A 2KTRA 1OEYA 2NPTB 1OTRB 4EOYA 4KZ0A 2L8JA 4HJKA 2JF5A 2L7RA 2D2QA 5G55A 1EF5A 3TJPA 4JQWC 1WJ6A 1UD7A 2V3SA 1WRDB 4W9FA 1WM3A 1OGWA 3MHSD 2MW5A 3WAMA 3QARA 3DBRI 4FLHA 4II2B 4I6PA 3RYTA 1J0GA 3ZO5B 3JW0X 2C7MB 2C9WB 3ZTCA 4KDIC 4RM8A 2KJ6A 3IBEA 4DBGA 2MCNB 3DOWA 4LDTD 2I1JA 2D3GA 2KDFB 5AZGA 3RUIB 2KDEB 4ANXA 1V6EA 2NR2A 2IO3B 3B0AA 3NS8A 4CO7A 2WDTB 3CSFA 5LLIA 5C23A 3L13A 4YL8A 1RRBA 4PS7A 1Y8RC 4MSQB 4IUMB 4E71A 2IZVB 3EC8A 5LXIB 2N9EB 2KN5A 4NAWB 2OJRA 1I35A 1WYWB 3MTNB 1R4NI 2DZIA 2G4DB 3ZW3A 4FHJA 2DENB 1E7VA 3O65B 2KTFA 4M8NA 2O6VA 1WH3A 3TCAA 4B6WA 4HLEA 1WR1A 5E6NA 1ZKHA 4MJSB 2K8CA 4GDLA 2KOXA 3ZVVA 1WI0A 4GN1A 3PPAA 4RMAA 2PPHA 2GMIC 2CHZA 3LDZE 3UIPB 1UGMA 1K8RB 2R2QA 4WJPA 4W9EA 3N32A 3ZRFA 2HD5B 3WAOA 2LJ5A 2XK5B 2MWSB 1Q1OA 1WXSA 1WX7A 2G4SA 2LVQA 3X23A 2N1WA 5CHVC 4FHKA 3LJ3A 3D32A 3H7PA 4NQLB 3ZNHB 3IG3A 2XEWA 2MP2A 3MJWA 2JRIB 2UWQA 3DVNU 4ZRJA 4E3CA 3EECA 2GBMA 3A9KA 5J2RA 1Z5SB 1JRUA 2IO2B 4HCPB 3VTUA 2KXJA 2G3QB 3DPDA 4ZYNA 3GOEA 1VCBA 1L7YA 4TUUA 2K6DB 2KC1A 1J8CA 1E8YA 3M62B 4TKNA 3WANA 3UQAA 1YX6B 2GOWA 2KX0A 3PLUA 3ZRCA 2CS4A 4ANWA 5E6PA 3ZDTA 2LWPA 4GOCA 2MBOA 2C7NB 2KJRA 4K7SA 1UBIA 5FR6A 3IHPC 3M63B 1G6JA 3KUDB 2HTHA 2O2VA 2K25A 3APDA 4GDKA 2M17A 3QX1A 2BKFA 3BY4B 4BOZB 4FBJB 1XD3B 3A4SC 3ZIMA 2MBQA 4LCDE 2V1YA 4ICUA 2JWZA 1P9DU 3U8ZA 1QZEA 1NDDA 2UYZB 3R7RA 3Q3JA 2BKRB 2K8HA 3L10B 2MBHA 2BPSA 3EHVA 2LGDA 3UINB 3HIZA 3OAWA 3W1SA 4W9DA 3BINA 4EUTA 4F7ZA 2LXAA 1IP9A 1GG3A 4HCNB 5CHWA 3AULA 4DDGD 1GJZA 3VQIA 1V5TA 4KIKA 4NPNA 3HM6X 3APFA 3U30A 3QHTA 3T9LA 3QAQA 1WX8A 3H6NA 3VTWA 1ZW7A 2KO3A 4WWPA 4RM9A 2J0MA 3HM3A 4DHZE 1D3ZA 2N9XA 2KLGA 3JSVA 4BKSD 2NBWB 2KANA 2AYOB 1IPGA 5L95C 2IY0B 2M0XA 3DCGA 1RFAA 4GXBA 3QWZB 3A1QA 4IG7B 4MGYE 3QIJA 2L76A 4ANVA 2Z59B 4FULA 1P0RA 4K7WA 2WX1A 2EMTA 2MSED 4MSMB 3GZNI 3V6CB 3ONSA 3NZUA 1UBQA 1Q5WB 2KTRB 2KMAA 4EZJA 3N3KB 3PT2B 2C60A 2V4LA 3DBSA 1WJ4A 2DYOA 2LRWA 2K1FA 1WGDA 3PS6A 2CHWA 2NPTA 4IM3A 3C0RB 3IVFA 5AEKB 4AJWA 3H9DA 1T0YA 4FJYA 4HDQA 1P98A 1WGYA 3TBLD 4MEMA 1C3TA 2N7EA 3ZLZA
chains in the Genus database with same CATH superfamily
4YWGG 4HROA 4WH4A 3VH4B 3BIID 5D94A 2RDBC 3GS2A 1KRHA 3TEXA 1WR6E 2HJ8A 3I3TB 4AS1A 2L00B 3BWUD 3ZNID 4CQNA 1HQRD 1RYJA 1TS4A 2FUHB 3M95A 3V3XA 4ZDVA 4UDUC 1WYGA 4XDCA 2QCZA 3NZSA 3V61A 3KH0A 2FCNA 1FIQA 3DBHI 4YXDB 2JX5A 2ZEQA 3SR6A 2YEPF 2BQQA 4C7ZA 2KMMA 2PW9A 4C7YA 3L08A 1WFYA 2LHEA 2WDRB 1STEA 1WJNA 3B1LX 4FA6A 2XK5A 3UQBA 4BBNF 2WXIA 1FXAA 1N60A 1KH0A 2REXA 2RR9A 2LVPA 4MGIE 5FKAC 4W9CA 4HWIB 3HK0A 1UZXB 4HVBA 1E90A 3B2GA 1EF1A 1KTKA 1WZ0A 4EZLA 4B9KA 3AE5B 2EKIA 3NOBA 4US9A 3WIMA 1HE8A 2JT4B 2PVGC 4M0WA 4ARCA 4JIOU 4EEWA 4Q2JA 2L0FA 4K1RB 2HJ1A 3W1SC 3Q8CA 4A90A 3VXWA 2KWCA 3DWGC 3K9OB 3NHEB 1SF0A 1WY8A 2ZW1A 3VH3B 2ASQA 4HJGE 1L2NA 2DYMA 1EM7A 4DDID 4IKGA 4BZAA 4M8MA 3EGRA 3VHTC 1WGHA 1QOGA 3ML8A 4LK0M 3VUYA 1KF6B 1ZUD2 2EMSA 1SIFA 1A70A 3RNBC 4O1NA 1GPXA 3I5JC 2MA9B 3HUIA 4RF1A 4TSSA 2PE9A 4M02A 4HKZE 4ANUA 3ALBA 1Q0WB 5LXHA 4IW0A 3GZNB 4P7IA 3RD2A 2D3BA 2AL6A 1FCCC 2MRPA 2M19A 2J7QB 1Z2MA 3P2BA 3TMPB 4JX1C 3CIRB 2FNJB 4IM0A 4F1SA 5G5HA 1WXAA 3ZJUA 1QOAA 3W9CB 1WJUA 1CZPA 3DHGC 1EWCA 3CF6E 1WXVA 4BFRA 1LO5D 4W9LA 4W9KA 3SD5A 3AECB 4KX6B 4MELA 2FCSA 4FJZA 4IDIA 1PGBA 1L0VB 2WXKA 2WWZA 3AE6B 1FCLA 4OHJA 3ML9A 1N6ZA 3EUB2 4YSXB 1E8WA 1QILA 2EKEC 1WMHA 2WDQB 2MP2B 4PYUA 2RSUA 2WXNA 3DBHB 2GBKA 3ZUNA 1F1HA 2VZKB 3BK1A 3OJ4B 1TS2A 4IWPA 2JZ3B 1HTOA 3DHIC 4B95A 5JH5C 2J42A 5FK9C 1JWAD 4A20A 1YMHE 2ZNVC 2LGSA 1AARA 2L83A 4IWQA 1WRIA 1WGRA 1VLBA 2GRIA 4QAYA 5G5GA 1NBFC 4GDKB 2PE6B 4DXAB 2KLCA 2FCQA 1BT0A 2AWTA 4DHZB 1AW7A 4ICVA 1KFYB 5IN7A 2KFKA 2MQJA 4KIKB 3R7QA 2MLBA 1M4VA 3Q6BA 1KLVA 4WJQA 1DOXA 3AXCA 3N1YC 2IO1B 1WXMA 5D2MB 5BYSA 2N7JA 3P42A 4URKA 1IGDA 4ZRIA 2K9XA 2K8BA 2WX0A 1YJ1A 2NMQA 2KACA 3R2IA 2L0TA 2WGSA 3HVDA 3U7DA 1J19A 1WF9A 1RAXA 1OTRB 2L32A 2WU5B 1EU3A 3GE8C 5G55A 1MFWA 1FPYA 2D3AA 1WM3A 3WAMA 3QARA 4RH6A 4II2B 3DBRI 3AH7A 3ZQ4A 1SE2A 3FAHA 4RM8A 4DBGA 3P63A 1ZE3D 1C79A 4CO7A 3NS8A 2INDC 3KQ4A 1TY2A 2VZKD 3L13A 4YL8A 1EWYC 4JWUC 1Q10A 4YTNB 1Y8RC 4IUMB 4E71A 2IZVB 2FBWB 1D5XC 5LXIB 2KN5A 2OJRA 1WYWB 1B1ZA 1R4NI 4M00A 3ZW3A 4FHJA 4MH8A 4M8NA 2KTFA 2O6VA 3TCAA 5E6NA 4P1BC 1ZKHA 4WURA 2K8CA 4A6QA 4RMAA 5I4DA 4K3BA 4WJPA 4W9EA 3N32A 3ZRFA 2HD5B 2XK5B 2MWSB 1TZOA 1Q1OA 1WXSA 2G4SA 4ACFA 1FFUA 3J9CA 3H7PA 1K53A 1Z5SB 4N58A 4L2YA 1T5XD 1QOFA 2G3QB 2JSVX 1FMAD 1MVKA 4NJCA 3UQAA 1YN5A 1JMLA 2GOWA 3N1ZC 3PLUA 3ZRCA 2EELA 2KWDA 4XWTA 4GOCA 2C7NB 2PIAA 1UBIA 3RMKC 1RFKA 1B9RA 1TKGA 1ZP0B 2HTHA 2O2VA 4S0RA 4FBJB 2BKFA 3MC9A 2WXHA 2JWZA 1NDDA 2LJIA 3R7RA 2BKRB 1QKZA 2MBHA 3EHVA 4W9DA 1IP9A 5HHDG 1FXIA 1FRRA 3APFA 1WX8A 3VTWA 1ZW7A 3IT6B 4RCOA 2WXJA 3RNEC 3JSVA 1FFVA 1AYFA 3FILA 3EA6A 3QIJA 2Z59B 1I4HA 2Z8LA 4ZHOA 4MSMB 3V6CB 3NZUA 1UBQA 1Q5WB 2KTRB 2WHIA 3N3KB 2I38A 1WJ4A 2WXQA 2MEKA 1VDVA 2LRWA 3NS1A 2V0GA 3PS6A 2NPTA 5JXVA 1P98A 2N7EA 2IBIB 3SHQA 1ZPSA 2OOBB 5DPSA 3AE2B 1JRPA 4CHKA 3OJ3A 2NCNA 1XQQA 3DBRB 4IOIE 4BKSA 4LNNA 3DBLI 4EKUA 2BYEA 1SE4A 1VR9A 3NVZA 5BMIA 2DAFA 4N6EB 3IFWB 1LXDA 1OQQA 1E8ZA 3MC8A 3HRDD 4JE3B 1N5WA 3PV1A 4IC7B 5GMVA 1I7HA 2K39A 3IAM1 1WMHB 1HA5A 3WALA 1YN4A 1MI0A 3PHXB 2R2OA 2JVCA 2Y5BB 1R4NB 3RN9C 2M8SA 3Q3FA 3KYDD 3KW5B 3AE9B 4DHJB 2FE8A 4KSLC 5HKHA 3DVGY 3QCAA 5EDSA 1OQYA 2ZPNA 4F8CB 2JWUA 4USAA 4G3XB 2MH7A 2KX3A 5KHOA 2KWVB 1R4MI 1X1MA 4XZ4A 4EE2A 2C7HA 3B9JA 3T3NA 2KYWA 1PQSA 1V80A 4K81A 2XNAC 1AN8A 2DYBA 2KFKB 3QC8B 3SFDB 2KJHB 1V86A 3ZKJC 3W1YA 2JY6A 2D11A 3ETRA 4RFBA 2A5UA 3B08A 2BBCA 3ENEA 4LJOB 2LHDA 4JLCA 5CX3A 1S3SG 3OG5A 1NVID 4WAAA 5JHBA 2DHZA 4P1CC 4ITKA 1NI2A 2MJEA 4TQ1A 1J7BA 4XWWA 1NYQA 3Q3OC 4OVUA 4PS3A 1MHXA 2N1VA 3L0WB 3TIXA 4ASWC 4RGMA 2BWES 1IUEA 1L4DB 1YQ4B 4HKQA 3TUOA 1T0QC 4NNJB 1GC6A 3H8HA 4B0EA 1ROEA 3VAWA 2VH1A 2KQSA 1VD2A 3H1UA 2KWUB 4XX5A 4W9GA 1I4RA 1E10A 4P6VF 1UNSA 1YX5B 3DVGX 1WSPA 1VZ6A 2DZJA 2BVCA 1I4PA 3A9JA 2JQRB 1YIWA 1E5WA 1FNWA 3ZYYX 2DLBA 3R8BA 1TZ1A 4DHJD 3JVZX 3L17A 5LNK1 4DQOC 3VFKA 2LGYA 1QOBA 1R7SA 2LFIA 3SU8X 3WA0A 2O6VB 3ZNZB 4JL9A 5IOIA 3AEFB 3AE7B 4M01A 1TS5A 1YQBA 2KN4A 3IAS1 4AOFA 3DBLB 4I6LB 2KQ4X 1IBXA 4G11A 3CSTA 3EFUA 2W9NA 4OZAA 5CHFA 3H7PB 4LTUA 4HDOA 5E6OA 4FXCA 1LM8B 4LJPB 2AEHA 3H7SA 2WXFA 2XN9C 1MHHE 1N61A 1XCQL 2PJHA 1KM7A 3VUWA 4JGHB 3TSSA 1C9FA 2LASA 4AWJA 2W55A 2KVRA 2IY1B 4GMVA 4WWNA 4KVGB 3RT3B 3NUHB 1TTNA 2RMMA 3PHWB 4BKTA 2WXRA 1UWMA 3QJZA 1SB3C 3I57A 2Y5CA 2O2VB 1FO4A 3L16A 2ZVOA 2C5LC 2KNBA 1ESFA 1ET6A 2N9PC 1R4MB 1SJED 2BYVE 3P4QB 1D5ZC 2CJNA 3AM9A 1A5RA 5EE1A 5L83A 2HTME 2OJWA 5T8IA 1V49A 5AZHA 2CU1A 1PGXA 3JSVB 3FILB 2N7DA 4KKJA 2NBUA 4OW0A 3APCA 1E0ZA 1OQRA 2IJ0A 3DDCB 4OZCA 2BB5A 2DX5B 2NTTA 4A3PA 3E9SA 4XGAB 2LUEA 2N4FA 2O6VD 3KWLA 2KK8A 3AEEB 3U4EG 2KTRA 2NPTB 5C3JB 4KZ0A 1FNUA 1ZOYB 5BYQA 1HEZE 1EF5A 1RWSA 2JXTA 1WJ6A 2BS3B 1WRDB 1OGWA 1F0ZA 1WWTA 4JPSA 4FLHA 3N20C 1V1OA 2C9WB 4RGTA 5GXGB 3IBEA 4AQ7A 2D3GA 2D5GA 5TSSA 3Q2AC 3RUIB 2KDEB 1V6EA 1TKYA 2NR2A 1JQ4A 2N9EB 1I35A 3C19A 1SIJA 3MTNB 2G4DB 1VJKA 2QILA 3R2TA 1E7VA 3P4SB 4D2KA 4HLEA 4ARIA 1J7CA 2DNFA 2KOXA 5BMGA 2GMIC 4HRSA 4S17A 2LJ5A 2GI9A 1L5PA 1TT5B 2WXPA 3AEGB 3X23A 1WGKA 4FHKA 4NQLB 1TY0A 3IG3A 2JRIB 2UWQA 3DVNU 4XYCA 3EECA 2GBMA 4C4VA 5J2RA 4DXGA 2KXJA 4HPPA 3ZXVA 4ZYNA 3AE4B 3MHZA 4N59A 3M62B 3WANA 3DHHC 1PGAA 3DWMA 1YX6B 1AWDA 4L23A 3ZDTA 4K7SA 4ZRPA 5E6JA 5FR6A 3LYYA 4YSZB 3EFCA 2K25A 3APDA 3BY4B 4LCDE 2X8XX 3I9V1 2BPSA 3UINB 3OAWA 4ZRQA 4DDGD 1GJZA 3VQIA 1V5TA 4PK1A 3U30A 3C8YA 3T9LA 3QAQA 4A9AA 1F52A 1D3ZA 4BKSD 2WDVB 2SEBD 2HDEA 2M0XA 1HZ5A 1FRDA 3A1QA 1D6EC 4IG7B 4MGYE 3AEAB 2WX1A 2EMTA 1T6BX 3ONSA 4OZBA 1FD6A 2AQ1B 2KMAA 1XLOA 3DBSA 1F77A 2K1FA 4KGTA 3IVFA 2K5PA 2KAJA 1WGYA 4XE0A 3P4RB 1C3TA 3ZLZA 1UGJA 3A9JB 1E6EB 3AEDB 2Z0EB 1L6VA 4ZRKA 4CYEA 4J3OD 2IYDB 4I6NB 4K7UA 5DPTA 3AU4A 3PREA 3CWIA 1M94A 2RGFA 4ZYSA 5HFYA 1SBBB 3UF8A 5J18A 2RDGA 3GB1A 1T3QA 4X57B 4GU2A 1NENB 5AUIA 1V97A 4FADA 2Q5WD 2CU3A 2DWQA 2WYQA 2ZPYA 1WM2A 1YQ3B 4NAWA 2KD0A 3VDZA 4NAMA 5AUKA 1GOZA 5DPWA 1IBXB 5H8YE 2CKHB 2ZZPB 1LGRA 5BMHA 2D3CA 2YVCA 5D3DA 4L1BA 4PT5A 1E7UA 5C1ZA 3DVNV 4W9HA 3PRPB 2ZJDA 1V1PB 4WQMA 5IO9A 4W9IA 3BVGA 2KHWB 1U4AA 1JWUD 2QIEB 1V81A 3QK0A 4W9JA 4K3CA 4KZCA 4J6IA 4PS8A 5JHAA 1UF0A 2BWFA 3V6EB 3RI7C 1I4XA 1ACCA 2JZZA 4A3OA 1WE7A 4RNAA 3A33B 2KVZA 1V2YA 3RZFA 3L54A 3HHMA 1IYFA 4KDLB 2J0JA 2GLSA 4DXFA 3RULA 3DQVA 2A4ZA 3VR8B 2L1AA 2BYFA 3TL5A 2E3TA 1F2RI 1VZ8A 4GB9A 2PEAA 4BBNC 4AP4C 3NY5A 2ZVNA 4MGZE 3UGBB 2FUG1 1YOVB 4LNOA 1TYGB 3JYUA 5FR3A 5IA7A 4NY0A 4BOSC 1P1AA 3ZDMC 1F2RC 4YSYB 4GIVA 1TJEA 3ZXRA 3W5UB 3AE8B 1YJIA 4BKGA 5TR5A 3AI5A 1GC7A 4OVVA 2WNMA 5EE3A 2N0SB 3UIOB 3KVFB 1KOTA 1C4CA 4GLSC 4MDKE 2N9LA 4WWOA 1JWMD 2CR5A 2K0PA 3O13A 1H4RA 1ZGUB 1HTQA 2WXLA 2KT7A 3KUCB 3Q14C 1TBEA 1D5MC 4G0NB 2JZPA 3ZTDA 1ISNA 2BS2B 3V60A 4P16A 3Q8BA 2KC2A 1TS3A 3X0WA 2DAJA 1E8XA 2I2YA 3BYYB 3T3OA 1C77A 4MH0E 3KYCD 3RCZA 5D6JB 2WXOA 2JYEA 2JUOA 5HG2A 2MX2A 3FC4A 1UUPA 3TEYA 2KZRA 3PGEA 1WGGA 2KMCA 2VRRB 4FN2A 4WWMA 3P1MA 3U52E 2IPKD 2INPE 3PRMB 4C4VB 4IM2A 1SJHD 3VUXA 1V5OA 1MG8A 2DZKA 2L52A 2LI5A 4KSKC 3KUZA 2Z0DB 3T8MA 2GBJA 2KDIA 2VH2A 1SE9A 1WE6A 2ON8A 2W82A 2FCMA 2PKOA 3QQ8B 2J0KA 2IGDA 2OEDA 3VRBB 3PRZA 2MJDA 1WZ3A 3PZDA 3R3MA 3U2SC 4HK2A 4KV2A 2YEPB 2GB1A 4WQOB 1OEYJ 2LGIA 5JZEB 2K3UA 4GSWA 3GP7A 3AEBB 1GB4A 4KGSA 3MJ5A 1XO3A 4PYZA 1YJJA 3S2AA 3NZ3A 1D4BA 5EE9A 1LFDA 1L0XB 3CMMB 1Y56A 3A1QB 4B0MA 2WU2B 1PFDA 5G2NA 2BB6A 3P4PB 4MGKE 2MHJA 2ONQA 1ENFA 1SSNA 2LGXA 2WXGA 4RF0A 2QJLA 1E7PB 4EOYA 1CK1A 2JF5A 1XLQA 1BXTA 2V3SA 4W9FA 3MHSD 3AE3B 2KDMA 4MACA 2W3SA 3ZO5B 2C7MB 3ZTCA 3WCQA 4KDIC 2PTLA 2MCNB 2I1JA 2DBYA 4TMAB 5LLIA 5C23A 1RRBA 4H2AA 3TEZA 2QEJC 4NAWB 2AQ3B 1KLUD 2DZIA 4BAXA 2DENB 3I63C 4ZOHC 4RGNA 4NZLB 2Y3AA 4GDLA 5HI1A 1WI0A 3PPAA 2PPHA 2CHZA 3LDZE 3UIPB 1MG4A 1K8RB 1UGMA 2R2QA 2J4XA 1FEHA 1K52A 4LNIA 5CHVC 3D32A 2XEWA 4ZRJA 4E3CA 1V1PA 3V05A 1QQRA 3A9KA 4HCPB 3VTUA 2IO2B 3LXFA 3ZJTA 3GOEA 4TUUA 1L7YA 1SXTA 1JWBD 1J8CA 1N62A 3MFGA 4LNKA 2WQYB 4XDDA 2KX0A 2QSDA 5EE0A 2QC8A 1DOYA 2MBOA 3AN1A 3IHPC 1WXQA 3QX1A 2MBQA 2J53A 2TSSA 2V1YA 2CJOA 3KLSX 1TIFA 4EUTA 2OHFA 2LXAA 5H92C 4HCNB 2X38A 3AULA 3HM6X 3QHTA 2H88B 5C2TB 2AX5A 2V3PA 1XCTL 2AQ2B 1QF6A 4RM9A 1N63A 4DHZE 4JWSC 2NBWB 2AYOB 1IPGA 5L95C 2IY0B 3DCGA 3QWZB 3NVVA 2L76A 3L4PA 4ANVA 2IGHA 4FULA 1P0RA 4WAFA 4A8XC 1I4GA 3GE3C 3OWEB 4EZJA 3PT2B 3Q3MC 2V4LA 3AMZA 2DYOA 3Q8EA 3RNFC 4IM3A 4AJWA 3H9DA 1T0YA 4FJYA 4HDQA 3TBLD 2K22A 1YD8U 2B3AA 1J7AA 1GNUA 2JXXA 5IAAC 1SGHA 1GUAB 3Q3NC 1OFFA 3RNAC 2JPHA 4IWOA 3QA8A 1EUVB 2XBBC 3ZGZA 1JW9D 3ZNGC 2MBBB 5CTRC 3W5VB 2L3ZA 2G45B 3PTFC 2M1MA 1KJTA 2IO0B 4WIPA 2NBVB 4MM3A 3MP9A 1UELA 1XT9B 3Q8AA 3URYA 1I42A 4AJYB 2MBEA 3V62A 3RZWC 3OLMD 3VTVA 3PVLA 3Q8FA 4MJSA 5BYRA 1H8CA 2KKCA 1DOIA 1YNTE 3M3JA 4WJNA 1CJEA 4WJOA 1P3QU 1PUTA 2R61A 1PYWD 4NJ7A 5D3IB 3PO0A 3RFZB 3VVWB 1VRAB 2DZMA 3PSEB 5BO4B 1K50A 1MPEA 2GBNA 4HPMB 5IP4D 4C80A 2YLMA 2K6QA 4C00A 2BT6A 5AZFA 4EZKA 2GBRA 2V4IB 1XXGA 2FAZA 1RM6C 4II3B 3RNGC 2LVOA 1BMLC 2LD9A 2KFJA 5D7GA 3B2FA 2RDHA 4EFOA 3WAPA 2HE7A 3E56A 1BUIC 2D10A 4A55A 1CQVA 1WX9A 3BVZA 4AUQC 3N30A 4GGQA 1KLGD 3NVYA 5DCNA 2PMVA 2BYTA 1YN3A 3U7ZA 1PDXA 2NVUI 2RPVA 3SFEB 2WXMA 2LEKA 2NS5A 4TQ0A 1GB1A 1XLPA 3IXSA 1FM0D 2V3NA 2RPQA 3VR9B 2I1KA 2INNE 2FIDA 3R66C 1CMXB 4G50A 3NRZA 1ZXHA 3HVZA 5J17A 1V8CA 1TKEA 3FKYA 4NJ6A 4TV3A 1C1YB 4KKIA 1C4PA 1V9JA 4E74A 1C4AA 1QT9A 3NG0A 4DWFA 1JROA 2CHXA 4LNFA 1TGZB 4HEA1 2B76B 3NVWA 2KQ7A 2LRUA 1QLBB 4US8A 3K9PB 4GDLB 1DGJA 2QHOA 2W54A 2ZCBA 5DPRA 4DK5A 1F9JA 5KHQA 3PZ8A 2BGFA 2RD0A 3ECIA 2AL3A 3BZDB 1LQBA 2IGGA 1N5XA 2IDYA 3BK2A 4LDTB 3A9KB 1S1QB 2SAKA 4HPLB 4HXDA 3PZ7A 1JALA 2QMTA 2J52A 4FJVB 4BVUC 1EO6A 2M0AA 1IGCA 3SDLC 1WIAA 1XEEA 2D07B 3N1XC 2BW2A 1L4ZB 2L05A 4YT0B 3Q69A 2FIFA 2E6XA 2ZNVB 2W3RA 4M0WB 1UWXA 4REZA 4N9F4 3A4RA 2M4NA 3AV8A 1RLFA 1NEKB 3PLVA 4NQKE 2KDBA 2H89B 1UH6A 2ZW0A 2BS4B 1EU4A 2JRHA 2WS3B 2ZCCA 2M56B 4XC2A 3UI3A 2LXCA 2BF8B 2LZ6A 1ZDXA 1FXTB 3RNCC 3AU5A 1VZ7A 1XF5L 2ACZB 3ABVB 1OEYA 2L8JA 4HJKA 4MT5A 2L7RA 2D2QA 3TJPA 2PLPA 4JQWC 2BTEA 2N9KA 1UD7A 1NI3A 2MW5A 3RYTA 4I6PA 2UU7A 1J0GA 2MJ3A 3JW0X 3AE1B 4YTMB 1I4QA 1T0SC 2KJ6A 3MC0B 1P7FA 3DOWA 4LDTD 1SE3A 2KDFB 3N9YC 5AZGA 4ANXA 1DYQA 1E9MA 2IO3B 3B0AA 2WDTB 3CSFA 3BVMA 4PS7A 1L6UA 4MSQB 3EC8A 1K51A 4MM3B 3O65B 1WH3A 2G9HD 4B6WA 1WR1A 4MJSB 2Y5PA 3ZVVA 4GN1A 2WP9B 3W2DA 4R3DA 3WAOA 4C56C 5IKCM 1WX7A 2LVQA 3IT4B 3AB5A 2N1WA 3LJ3A 3ZNHB 2MP2A 3MJWA 2JYTA 3NJTA 4LLGM 1C76A 1JRUA 2ICIA 3DPDA 2QDFA 1VCBA 1MJDA 1SEBD 2K6DB 2KC1A 1ZDVA 1HXYD 1E8YA 4TKNA 2INCC 1GAQB 2CS4A 4ANWA 2NTSA 5E6PA 2LWPA 1HZ6A 2KJRA 1L0YB 2WLBA 3M63B 1G6JA 3KUDB 1NYRA 3SEBA 1FNVA 2V9HA 4GDKA 2M17A 4BOZB 1XD3B 3A4SC 4YTPB 3ZIMA 1XLNA 4ICUA 1P9DU 1JWSD 4OVZA 3U8ZA 1QZEA 2UYZB 3Q3JA 2K8HA 3L10B 2LUMA 2PVOD 3RPFC 2LGDA 4ZHPA 3HIZA 3W1SA 3BINA 4F7ZA 1JCKB 2JU6X 1GG3A 5CHWA 3TEWA 3ZJVA 4KIKA 4NPNA 2G1EA 1T0RC 3H6NA 3VRAB 2KO3A 4WWPA 2J0MA 3HM3A 2N9XA 2KLGA 2KANA 1RFAA 4GXBA 4K7WA 4KGRA 1C78A 2MSED 3KWVA 3GZNI 1ZXIA 2LMCA 2C60A 1P7EA 3LB8C 1ET9A 5MPOA 1WGDA 2CHWA 3C0RB 3BYTB 5AEKB 4RGOS 4MEMA
chains in the Genus database with same CATH topology
3A9JB 1YD8U 2Z0EB 2IBIB 3SHQA 4ZRKA 4CYEA 2B3AA 1GNUA 2IYDB 2JXXA 4I6NB 4K7UA 5DPTA 5IAAC 3VH4B 1SGHA 1GUAB 5D94A 3AU4A 2OOBB 3PREA 1M94A 2RGFA 5DPSA 1WR6E 2HJ8A 3I3TB 3UF8A 5J18A 4CHKA 2L00B 2JPHA 3OJ3A 2NCNA 4IWOA 3QA8A 1XQQA 3ZNID 4BKSA 1EUVB 2XBBC 4X57B 3DBLI 4EKUA 3ZNGC 2BYEA 4GU2A 4FADA 2MBBB 2FUHB 5CTRC 3M95A 2L3ZA 2WYQA 2G45B 2DAFA 2ZPYA 4ZDVA 3IFWB 3PTFC 2M1MA 1LXDA 1KJTA 1WM2A 2IO0B 1E8ZA 4NAWA 2KD0A 3VDZA 3NZSA 2NBVB 3V61A 5DPWA 4MM3A 3KH0A 1UELA 1XT9B 2CKHB 2FCNA 2ZZPB 3PV1A 4IC7B 3DBHI 1I42A 2ZEQA 5GMVA 4AJYB 2K39A 2MBEA 3V62A 1WMHB 3OLMD 2YVCA 3RZWC 3WALA 3VTVA 3PVLA 4MJSA 3PHXB 1H8CA 2KKCA 2R2OA 2JVCA 2Y5BB 3L08A 1WFYA 2M8SA 1E7UA 5C1ZA 3Q3FA 3KYDD 1WJNA 3DVNV 3M3JA 4WJNA 4W9HA 3B1LX 4WJOA 3PRPB 2ZJDA 2XK5A 3KW5B 4FA6A 1P3QU 4NJ7A 4DHJB 4KSLC 5HKHA 3UQBA 4BBNF 3DVGY 3QCAA 3VVWB 3PSEB 2DZMA 4W9IA 5BO4B 5EDSA 1OQYA 2ZPNA 2REXA 2KHWB 2RR9A 1U4AA 2LVPA 4MGIE 4F8CB 4W9CA 4G3XB 2GBNA 1V81A 3HK0A 4HPMB 1UZXB 3QK0A 2KX3A 4HWIB 4W9JA 5KHOA 2KWVB 4HVBA 1R4MI 1X1MA 2YLMA 4XZ4A 4KZCA 1E90A 2K6QA 4J6IA 4PS8A 1EF1A 5JHAA 2C7HA 1WZ0A 1PQSA 4B9KA 4EZLA 2BWFA 1V80A 4K81A 3V6EB 5AZFA 2JZZA 3NOBA 1WE7A 3WIMA 1HE8A 2DYBA 2JT4B 4A3OA 2KFKB 4EZKA 3QC8B 2GBRA 3A33B 2KJHB 1V86A 2FAZA 4II3B 3ZKJC 2LVOA 2LD9A 4JIOU 4EEWA 1V2YA 2KFJA 2JY6A 2D11A 2L0FA 4K1RB 3W1YA 5D7GA 3L54A 3RZFA 3W1SC 2A5UA 3B08A 3HHMA 3VXWA 2KWCA 4EFOA 4KDLB 1IYFA 3ENEA 3WAPA 2J0JA 4LJOB 3RULA 3DQVA 3K9OB 3NHEB 4JLCA 1S3SG 2A4ZA 5CX3A 2HE7A 4WAAA 2D10A 2BYFA 5JHBA 1WX9A 3TL5A 2DHZA 1WY8A 4AUQC 3N30A 4GB9A 2PEAA 1NI2A 4TQ1A 3VH3B 4BBNC 2ASQA 1L2NA 4OVUA 2DYMA 4GGQA 4PS3A 2N1VA 4DDID 3L0WB 4AP4C 3TIXA 3NY5A 2ZVNA 4ASWC 4M8MA 5DCNA 4MGZE 3UGBB 3VHTC 1WGHA 3JYUA 3ML8A 5IA7A 4NY0A 4BOSC 1P1AA 3VUYA 2NVUI 3ZDMC 2EMSA 4GIVA 1SIFA 2BWES 2NS5A 4TQ0A 4BKGA 5TR5A 4NNJB 3AI5A 1GC7A 1GC6A 4OVVA 2MA9B 3VAWA 2RPQA 2PE9A 3UIOB 3KVFB 2KQSA 2I1KA 1VD2A 2FIDA 3H1UA 3R66C 1CMXB 4G50A 4ANUA 3ALBA 1KOTA 2KWUB 4XX5A 4W9GA 1Q0WB 5LXHA 4IW0A 4P7IA 3RD2A 1YX5B 2AL6A 3DVGX 4MDKE 2MRPA 5J17A 2DZJA 4WWOA 2J7QB 2CR5A 4NJ6A 3A9JA 4TV3A 1YIWA 1Z2MA 1E5WA 1C1YB 1H4RA 1ZGUB 3P2BA 1V9JA 4E74A 3TMPB 1TZ1A 2FNJB 4DHJD 3JVZX 3L17A 4IM0A 3KUCB 4F1SA 1WXAA 1TBEA 4G0NB 3VFKA 1WJUA 2CHXA 2LGYA 3ZTDA 4DWFA 1TGZB 1ISNA 3CF6E 1WXVA 3SU8X 3V60A 3WA0A 4BFRA 2O6VB 3ZNZB 4JL9A 2KQ7A 2KC2A 4W9LA 4W9KA 3SD5A 3X0WA 2LRUA 2DAJA 1E8XA 3K9PB 2QHOA 4GDLB 2ZCBA 4MELA 5DPRA 2FCSA 4FJZA 1YQBA 4MH0E 3KYCD 4DK5A 3RCZA 5D6JB 2WWZA 2JUOA 1F9JA 5KHQA 4AOFA 2BGFA 2RD0A 4I6LB 3ECIA 3ML9A 4G11A 2MX2A 3CSTA 2AL3A 3EFUA 2KZRA 2W9NA 3PGEA 2KMCA 1WGGA 1E8WA 1LQBA 5CHFA 2VRRB 4FN2A 2EKEC 1WMHA 3H7PB 4HDOA 5E6OA 2MP2B 1LM8B 4PYUA 4LJPB 2AEHA 3H7SA 2RSUA 3PRMB 4LDTB 3A9KB 1S1QB 4IM2A 3VUXA 4HPLB 4HXDA 1V5OA 2PJHA 1KM7A 1MG8A 2GBKA 3VUWA 3ZUNA 4JGHB 2DZKA 2LASA 2LI5A 4KSKC 3KUZA 2Z0DB 3T8MA 4FJVB 4AWJA 1EO6A 2GBJA 2KDIA 3OJ4B 4BVUC 4IWPA 2JZ3B 1SE9A 2KVRA 2IY1B 4GMVA 3SDLC 4B95A 4WWNA 1WIAA 4KVGB 5JH5C 2D07B 3RT3B 1WE6A 1TTNA 4A20A 3PHWB 2ZNVC 2FCMA 3QQ8B 4BKTA 2L05A 3QJZA 1AARA 2J0KA 4IWQA 3PRZA 2O2VB 2FIFA 1WGRA 2ZNVB 3L16A 1WZ3A 2ZVOA 1NBFC 4GDKB 2PE6B 3PZDA 3R3MA 4DXAB 2KLCA 2C5LC 4M0WB 2FCQA 1BT0A 2AWTA 2KNBA 4DHZB 4HK2A 4KV2A 4ICVA 2N9PC 4N9F4 2KFKA 2BYVE 4WQOB 1OEYJ 3A4RA 2M4NA 5JZEB 4GSWA 1A5RA 2MQJA 1RLFA 4KIKB 3R7QA 2MLBA 5L83A 1V49A 1KLVA 4WJQA 5AZHA 3PLVA 3AXCA 4NQKE 4PYZA 2CU1A 2IO1B 2KDBA 3S2AA 3JSVB 1WXMA 5D2MB 1UH6A 1LFDA 2N7DA 3CMMB 2JRHA 4XC2A 2ZCCA 3A1QB 2NBUA 4URKA 2LXCA 3APCA 4ZRIA 3DDCB 5G2NA 2BF8B 2K8BA 2LZ6A 2WX0A 2DX5B 4A3PA 1FXTB 1YJ1A 4MGKE 2L0TA 3U7DA 2LGXA 2LUEA 1J19A 1WF9A 3AU5A 1RAXA 2N4FA 2O6VD 2KK8A 2KTRA 1OEYA 2NPTB 1OTRB 4EOYA 4KZ0A 2L8JA 4HJKA 2JF5A 2L7RA 2D2QA 5G55A 1EF5A 3TJPA 4JQWC 1WJ6A 1UD7A 2V3SA 1WRDB 4W9FA 1WM3A 1OGWA 3MHSD 2MW5A 3WAMA 3QARA 3DBRI 4FLHA 4II2B 4I6PA 3RYTA 1J0GA 3ZO5B 3JW0X 2C7MB 2C9WB 3ZTCA 4KDIC 4RM8A 2KJ6A 3IBEA 4DBGA 2MCNB 3DOWA 4LDTD 2I1JA 2D3GA 2KDFB 5AZGA 3RUIB 2KDEB 4ANXA 1V6EA 2NR2A 2IO3B 3B0AA 3NS8A 4CO7A 2WDTB 3CSFA 5LLIA 5C23A 3L13A 4YL8A 1RRBA 4PS7A 1Y8RC 4MSQB 4IUMB 4E71A 2IZVB 3EC8A 5LXIB 2N9EB 2KN5A 4NAWB 2OJRA 1I35A 1WYWB 3MTNB 1R4NI 2DZIA 2G4DB 3ZW3A 4FHJA 2DENB 1E7VA 3O65B 2KTFA 4M8NA 2O6VA 1WH3A 3TCAA 4B6WA 4HLEA 1WR1A 5E6NA 1ZKHA 4MJSB 2K8CA 4GDLA 2KOXA 3ZVVA 1WI0A 4GN1A 3PPAA 4RMAA 2PPHA 2GMIC 2CHZA 3LDZE 3UIPB 1UGMA 1K8RB 2R2QA 4WJPA 4W9EA 3N32A 3ZRFA 2HD5B 3WAOA 2LJ5A 2XK5B 2MWSB 1Q1OA 1WXSA 1WX7A 2G4SA 2LVQA 3X23A 2N1WA 5CHVC 4FHKA 3LJ3A 3D32A 3H7PA 4NQLB 3ZNHB 3IG3A 2XEWA 2MP2A 3MJWA 2JRIB 2UWQA 3DVNU 4ZRJA 4E3CA 3EECA 2GBMA 3A9KA 5J2RA 1Z5SB 1JRUA 2IO2B 4HCPB 3VTUA 2KXJA 2G3QB 3DPDA 4ZYNA 3GOEA 1VCBA 1L7YA 4TUUA 2K6DB 2KC1A 1J8CA 1E8YA 3M62B 4TKNA 3WANA 3UQAA 1YX6B 2GOWA 2KX0A 3PLUA 3ZRCA 2CS4A 4ANWA 5E6PA 3ZDTA 2LWPA 4GOCA 2MBOA 2C7NB 2KJRA 4K7SA 1UBIA 5FR6A 3IHPC 3M63B 1G6JA 3KUDB 2HTHA 2O2VA 2K25A 3APDA 4GDKA 2M17A 3QX1A 2BKFA 3BY4B 4BOZB 4FBJB 1XD3B 3A4SC 3ZIMA 2MBQA 4LCDE 2V1YA 4ICUA 2JWZA 1P9DU 3U8ZA 1QZEA 1NDDA 2UYZB 3R7RA 3Q3JA 2BKRB 2K8HA 3L10B 2MBHA 2BPSA 3EHVA 2LGDA 3UINB 3HIZA 3OAWA 3W1SA 4W9DA 3BINA 4EUTA 4F7ZA 2LXAA 1IP9A 1GG3A 4HCNB 5CHWA 3AULA 4DDGD 1GJZA 3VQIA 1V5TA 4KIKA 4NPNA 3HM6X 3APFA 3U30A 3QHTA 3T9LA 3QAQA 1WX8A 3H6NA 3VTWA 1ZW7A 2KO3A 4WWPA 4RM9A 2J0MA 3HM3A 4DHZE 1D3ZA 2N9XA 2KLGA 3JSVA 4BKSD 2NBWB 2KANA 2AYOB 1IPGA 5L95C 2IY0B 2M0XA 3DCGA 1RFAA 4GXBA 3QWZB 3A1QA 4IG7B 4MGYE 3QIJA 2L76A 4ANVA 2Z59B 4FULA 1P0RA 4K7WA 2WX1A 2EMTA 2MSED 4MSMB 3GZNI 3V6CB 3ONSA 3NZUA 1UBQA 1Q5WB 2KTRB 2KMAA 4EZJA 3N3KB 3PT2B 2C60A 2V4LA 3DBSA 1WJ4A 2DYOA 2LRWA 2K1FA 1WGDA 3PS6A 2CHWA 2NPTA 4IM3A 3C0RB 3IVFA 5AEKB 4AJWA 3H9DA 1T0YA 4FJYA 4HDQA 1P98A 1WGYA 3TBLD 4MEMA 1C3TA 2N7EA 3ZLZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A9J B;  1YD8 U;  2Z0E B;  2IBI B;  3SHQ A;  4ZRK A;  4CYE A;  2B3A A;  1GNU A;  2IYD B;  2JXX A;  4I6N B;  4K7U A;  5DPT A;  5IAA C;  3VH4 B;  1SGH A;  1GUA B;  5D94 A;  3AU4 A;  2OOB B;  3PRE A;  1M94 A;  2RGF A;  5DPS A;  1WR6 E;  2HJ8 A;  3I3T B;  3UF8 A;  5J18 A;  4CHK A;  2L00 B;  2JPH A;  3OJ3 A;  2NCN A;  4IWO A;  3QA8 A;  1XQQ A;  3ZNI D;  4BKS A;  1EUV B;  2XBB C;  4X57 B;  3DBL I;  4EKU A;  3ZNG C;  2BYE A;  4GU2 A;  4FAD A;  2MBB B;  2FUH B;  5CTR C;  3M95 A;  2L3Z A;  2WYQ A;  2G45 B;  2DAF A;  2ZPY A;  4ZDV A;  3IFW B;  3PTF C;  2M1M A;  1LXD A;  1KJT A;  1WM2 A;  2IO0 B;  1E8Z A;  4NAW A;  2KD0 A;  3VDZ A;  3NZS A;  2NBV B;  3V61 A;  5DPW A;  4MM3 A;  3KH0 A;  1UEL A;  1XT9 B;  2CKH B;  2FCN A;  2ZZP B;  3PV1 A;  4IC7 B;  3DBH I;  1I42 A;  2ZEQ A;  5GMV A;  4AJY B;  2K39 A;  2MBE A;  3V62 A;  1WMH B;  3OLM D;  2YVC A;  3RZW C;  3WAL A;  3VTV A;  3PVL A;  4MJS A;  3PHX B;  1H8C A;  2KKC A;  2R2O A;  2JVC A;  2Y5B B;  3L08 A;  1WFY A;  2M8S A;  1E7U A;  5C1Z A;  3Q3F A;  3KYD D;  1WJN A;  3DVN V;  3M3J A;  4WJN A;  4W9H A;  3B1L X;  4WJO A;  3PRP B;  2ZJD A;  2XK5 A;  3KW5 B;  4FA6 A;  1P3Q U;  4NJ7 A;  4DHJ B;  4KSL C;  5HKH A;  3UQB A;  4BBN F;  3DVG Y;  3QCA A;  3VVW B;  3PSE B;  2DZM A;  4W9I A;  5BO4 B;  5EDS A;  1OQY A;  2ZPN A;  2REX A;  2KHW B;  2RR9 A;  1U4A A;  2LVP A;  4MGI E;  4F8C B;  4W9C A;  4G3X B;  2GBN A;  1V81 A;  3HK0 A;  4HPM B;  1UZX B;  3QK0 A;  2KX3 A;  4HWI B;  4W9J A;  5KHO A;  2KWV B;  4HVB A;  1R4M I;  1X1M A;  2YLM A;  4XZ4 A;  4KZC A;  1E90 A;  2K6Q A;  4J6I A;  4PS8 A;  1EF1 A;  5JHA A;  2C7H A;  1WZ0 A;  1PQS A;  4B9K A;  4EZL A;  2BWF A;  1V80 A;  4K81 A;  3V6E B;  5AZF A;  2JZZ A;  3NOB A;  1WE7 A;  3WIM A;  1HE8 A;  2DYB A;  2JT4 B;  4A3O A;  2KFK B;  4EZK A;  3QC8 B;  2GBR A;  3A33 B;  2KJH B;  1V86 A;  2FAZ A;  4II3 B;  3ZKJ C;  2LVO A;  2LD9 A;  4JIO U;  4EEW A;  1V2Y A;  2KFJ A;  2JY6 A;  2D11 A;  2L0F A;  4K1R B;  3W1Y A;  5D7G A;  3L54 A;  3RZF A;  3W1S C;  2A5U A;  3B08 A;  3HHM A;  3VXW A;  2KWC A;  4EFO A;  4KDL B;  1IYF A;  3ENE A;  3WAP A;  2J0J A;  4LJO B;  3RUL A;  3DQV A;  3K9O B;  3NHE B;  4JLC A;  1S3S G;  2A4Z A;  5CX3 A;  2HE7 A;  4WAA A;  2D10 A;  2BYF A;  5JHB A;  1WX9 A;  3TL5 A;  2DHZ A;  1WY8 A;  4AUQ C;  3N30 A;  4GB9 A;  2PEA A;  1NI2 A;  4TQ1 A;  3VH3 B;  4BBN C;  2ASQ A;  1L2N A;  4OVU A;  2DYM A;  4GGQ A;  4PS3 A;  2N1V A;  4DDI D;  3L0W B;  4AP4 C;  3TIX A;  3NY5 A;  2ZVN A;  4ASW C;  4M8M A;  5DCN A;  4MGZ E;  3UGB B;  3VHT C;  1WGH A;  3JYU A;  3ML8 A;  5IA7 A;  4NY0 A;  4BOS C;  1P1A A;  3VUY A;  2NVU I;  3ZDM C;  2EMS A;  4GIV A;  1SIF A;  2BWE S;  2NS5 A;  4TQ0 A;  4BKG A;  5TR5 A;  4NNJ B;  3AI5 A;  1GC7 A;  1GC6 A;  4OVV A;  2MA9 B;  3VAW A;  2RPQ A;  2PE9 A;  3UIO B;  3KVF B;  2KQS A;  2I1K A;  1VD2 A;  2FID A;  3H1U A;  3R66 C;  1CMX B;  4G50 A;  4ANU A;  3ALB A;  1KOT A;  2KWU B;  4XX5 A;  4W9G A;  1Q0W B;  5LXH A;  4IW0 A;  4P7I A;  3RD2 A;  1YX5 B;  2AL6 A;  3DVG X;  4MDK E;  2MRP A;  5J17 A;  2DZJ A;  4WWO A;  2J7Q B;  2CR5 A;  4NJ6 A;  3A9J A;  4TV3 A;  1YIW A;  1Z2M A;  1E5W A;  1C1Y B;  1H4R A;  1ZGU B;  3P2B A;  1V9J A;  4E74 A;  3TMP B;  1TZ1 A;  2FNJ B;  4DHJ D;  3JVZ X;  3L17 A;  4IM0 A;  3KUC B;  4F1S A;  1WXA A;  1TBE A;  4G0N B;  3VFK A;  1WJU A;  2CHX A;  2LGY A;  3ZTD A;  4DWF A;  1TGZ B;  1ISN A;  3CF6 E;  1WXV A;  3SU8 X;  3V60 A;  3WA0 A;  4BFR A;  2O6V B;  3ZNZ B;  4JL9 A;  2KQ7 A;  2KC2 A;  4W9L A;  4W9K A;  3SD5 A;  3X0W A;  2LRU A;  2DAJ A;  1E8X A;  3K9P B;  2QHO A;  4GDL B;  2ZCB A;  4MEL A;  5DPR A;  2FCS A;  4FJZ A;  1YQB A;  4MH0 E;  3KYC D;  4DK5 A;  3RCZ A;  5D6J B;  2WWZ A;  2JUO A;  1F9J A;  5KHQ A;  4AOF A;  2BGF A;  2RD0 A;  4I6L B;  3ECI A;  3ML9 A;  4G11 A;  2MX2 A;  3CST A;  2AL3 A;  3EFU A;  2KZR A;  2W9N A;  3PGE A;  2KMC A;  1WGG A;  1E8W A;  1LQB A;  5CHF A;  2VRR B;  4FN2 A;  2EKE C;  1WMH A;  3H7P B;  4HDO A;  5E6O A;  2MP2 B;  1LM8 B;  4PYU A;  4LJP B;  2AEH A;  3H7S A;  2RSU A;  3PRM B;  4LDT B;  3A9K B;  1S1Q B;  4IM2 A;  3VUX A;  4HPL B;  4HXD A;  1V5O A;  2PJH A;  1KM7 A;  1MG8 A;  2GBK A;  3VUW A;  3ZUN A;  4JGH B;  2DZK A;  2LAS A;  2LI5 A;  4KSK C;  3KUZ A;  2Z0D B;  3T8M A;  4FJV B;  4AWJ A;  1EO6 A;  2GBJ A;  2KDI A;  3OJ4 B;  4BVU C;  4IWP A;  2JZ3 B;  1SE9 A;  2KVR A;  2IY1 B;  4GMV A;  3SDL C;  4B95 A;  4WWN A;  1WIA A;  4KVG B;  5JH5 C;  2D07 B;  3RT3 B;  1WE6 A;  1TTN A;  4A20 A;  3PHW B;  2ZNV C;  2FCM A;  3QQ8 B;  4BKT A;  2L05 A;  3QJZ A;  1AAR A;  2J0K A;  4IWQ A;  3PRZ A;  2O2V B;  2FIF A;  1WGR A;  2ZNV B;  3L16 A;  1WZ3 A;  2ZVO A;  1NBF C;  4GDK B;  2PE6 B;  3PZD A;  3R3M A;  4DXA B;  2KLC A;  2C5L C;  4M0W B;  2FCQ A;  1BT0 A;  2AWT A;  2KNB A;  4DHZ B;  4HK2 A;  4KV2 A;  4ICV A;  2N9P C;  4N9F 4;  2KFK A;  2BYV E;  4WQO B;  1OEY J;  3A4R A;  2M4N A;  5JZE B;  4GSW A;  1A5R A;  2MQJ A;  1RLF A;  4KIK B;  3R7Q A;  2MLB A;  5L83 A;  1V49 A;  1KLV A;  4WJQ A;  5AZH A;  3PLV A;  3AXC A;  4NQK E;  4PYZ A;  2CU1 A;  2IO1 B;  2KDB A;  3S2A A;  3JSV B;  1WXM A;  5D2M B;  1UH6 A;  1LFD A;  2N7D A;  3CMM B;  2JRH A;  4XC2 A;  2ZCC A;  3A1Q B;  2NBU A;  4URK A;  2LXC A;  3APC A;  4ZRI A;  3DDC B;  5G2N A;  2BF8 B;  2K8B A;  2LZ6 A;  2WX0 A;  2DX5 B;  4A3P A;  1FXT B;  1YJ1 A;  4MGK E;  2L0T A;  3U7D A;  2LGX A;  2LUE A;  1J19 A;  1WF9 A;  3AU5 A;  1RAX A;  2N4F A;  2O6V D;  2KK8 A;  2KTR A;  1OEY A;  2NPT B;  1OTR B;  4EOY A;  4KZ0 A;  2L8J A;  4HJK A;  2JF5 A;  2L7R A;  2D2Q A;  5G55 A;  1EF5 A;  3TJP A;  4JQW C;  1WJ6 A;  1UD7 A;  2V3S A;  1WRD B;  4W9F A;  1WM3 A;  1OGW A;  3MHS D;  2MW5 A;  3WAM A;  3QAR A;  3DBR I;  4FLH A;  4II2 B;  4I6P A;  3RYT A;  1J0G A;  3ZO5 B;  3JW0 X;  2C7M B;  2C9W B;  3ZTC A;  4KDI C;  4RM8 A;  2KJ6 A;  3IBE A;  4DBG A;  2MCN B;  3DOW A;  4LDT D;  2I1J A;  2D3G A;  2KDF B;  5AZG A;  3RUI B;  2KDE B;  4ANX A;  1V6E A;  2NR2 A;  2IO3 B;  3B0A A;  3NS8 A;  4CO7 A;  2WDT B;  3CSF A;  5LLI A;  5C23 A;  3L13 A;  4YL8 A;  1RRB A;  4PS7 A;  1Y8R C;  4MSQ B;  4IUM B;  4E71 A;  2IZV B;  3EC8 A;  5LXI B;  2N9E B;  2KN5 A;  4NAW B;  2OJR A;  1I35 A;  1WYW B;  3MTN B;  1R4N I;  2DZI A;  2G4D B;  3ZW3 A;  4FHJ A;  2DEN B;  1E7V A;  3O65 B;  2KTF A;  4M8N A;  2O6V A;  1WH3 A;  3TCA A;  4B6W A;  4HLE A;  1WR1 A;  5E6N A;  1ZKH A;  4MJS B;  2K8C A;  4GDL A;  2KOX A;  3ZVV A;  1WI0 A;  4GN1 A;  3PPA A;  4RMA A;  2PPH A;  2GMI C;  2CHZ A;  3LDZ E;  3UIP B;  1UGM A;  1K8R B;  2R2Q A;  4WJP A;  4W9E A;  3N32 A;  3ZRF A;  2HD5 B;  3WAO A;  2LJ5 A;  2XK5 B;  2MWS B;  1Q1O A;  1WXS A;  1WX7 A;  2G4S A;  2LVQ A;  3X23 A;  2N1W A;  5CHV C;  4FHK A;  3LJ3 A;  3D32 A;  3H7P A;  4NQL B;  3ZNH B;  3IG3 A;  2XEW A;  2MP2 A;  3MJW A;  2JRI B;  2UWQ A;  3DVN U;  4ZRJ A;  4E3C A;  3EEC A;  2GBM A;  3A9K A;  5J2R A;  1Z5S B;  1JRU A;  2IO2 B;  4HCP B;  3VTU A;  2KXJ A;  2G3Q B;  3DPD A;  4ZYN A;  3GOE A;  1VCB A;  1L7Y A;  4TUU A;  2K6D B;  2KC1 A;  1J8C A;  1E8Y A;  3M62 B;  4TKN A;  3WAN A;  3UQA A;  1YX6 B;  2GOW A;  2KX0 A;  3PLU A;  3ZRC A;  2CS4 A;  4ANW A;  5E6P A;  3ZDT A;  2LWP A;  4GOC A;  2MBO A;  2C7N B;  2KJR A;  4K7S A;  1UBI A;  5FR6 A;  3IHP C;  3M63 B;  1G6J A;  3KUD B;  2HTH A;  2O2V A;  2K25 A;  3APD A;  4GDK A;  2M17 A;  3QX1 A;  2BKF A;  3BY4 B;  4BOZ B;  4FBJ B;  1XD3 B;  3A4S C;  3ZIM A;  2MBQ A;  4LCD E;  2V1Y A;  4ICU A;  2JWZ A;  1P9D U;  3U8Z A;  1QZE A;  1NDD A;  2UYZ B;  3R7R A;  3Q3J A;  2BKR B;  2K8H A;  3L10 B;  2MBH A;  2BPS A;  3EHV A;  2LGD A;  3UIN B;  3HIZ A;  3OAW A;  3W1S A;  4W9D A;  3BIN A;  4EUT A;  4F7Z A;  2LXA A;  1IP9 A;  1GG3 A;  4HCN B;  5CHW A;  3AUL A;  4DDG D;  1GJZ A;  3VQI A;  1V5T A;  4KIK A;  4NPN A;  3HM6 X;  3APF A;  3U30 A;  3QHT A;  3T9L A;  3QAQ A;  1WX8 A;  3H6N A;  3VTW A;  1ZW7 A;  2KO3 A;  4WWP A;  4RM9 A;  2J0M A;  3HM3 A;  4DHZ E;  1D3Z A;  2N9X A;  2KLG A;  3JSV A;  4BKS D;  2NBW B;  2KAN A;  2AYO B;  1IPG A;  5L95 C;  2IY0 B;  2M0X A;  3DCG A;  1RFA A;  4GXB A;  3QWZ B;  3A1Q A;  4IG7 B;  4MGY E;  3QIJ A;  2L76 A;  4ANV A;  2Z59 B;  4FUL A;  1P0R A;  4K7W A;  2WX1 A;  2EMT A;  2MSE D;  4MSM B;  3GZN I;  3V6C B;  3ONS A;  3NZU A;  1UBQ A;  1Q5W B;  2KTR B;  2KMA A;  4EZJ A;  3N3K B;  3PT2 B;  2C60 A;  2V4L A;  3DBS A;  1WJ4 A;  2DYO A;  2LRW A;  2K1F A;  1WGD A;  3PS6 A;  2CHW A;  2NPT A;  4IM3 A;  3C0R B;  3IVF A;  5AEK B;  4AJW A;  3H9D A;  1T0Y A;  4FJY A;  4HDQ A;  1P98 A;  1WGY A;  3TBL D;  4MEM A;  1C3T A;  2N7E A;  3ZLZ A; 
#chains in the Genus database with same CATH topology
 4YWG G;  4HRO A;  4WH4 A;  3VH4 B;  3BII D;  5D94 A;  2RDB C;  3GS2 A;  1KRH A;  3TEX A;  1WR6 E;  2HJ8 A;  3I3T B;  4AS1 A;  2L00 B;  3BWU D;  3ZNI D;  4CQN A;  1HQR D;  1RYJ A;  1TS4 A;  2FUH B;  3M95 A;  3V3X A;  4ZDV A;  4UDU C;  1WYG A;  4XDC A;  2QCZ A;  3NZS A;  3V61 A;  3KH0 A;  2FCN A;  1FIQ A;  3DBH I;  4YXD B;  2JX5 A;  2ZEQ A;  3SR6 A;  2YEP F;  2BQQ A;  4C7Z A;  2KMM A;  2PW9 A;  4C7Y A;  3L08 A;  1WFY A;  2LHE A;  2WDR B;  1STE A;  1WJN A;  3B1L X;  4FA6 A;  2XK5 A;  3UQB A;  4BBN F;  2WXI A;  1FXA A;  1N60 A;  1KH0 A;  2REX A;  2RR9 A;  2LVP A;  4MGI E;  5FKA C;  4W9C A;  4HWI B;  3HK0 A;  1UZX B;  4HVB A;  1E90 A;  3B2G A;  1EF1 A;  1KTK A;  1WZ0 A;  4EZL A;  4B9K A;  3AE5 B;  2EKI A;  3NOB A;  4US9 A;  3WIM A;  1HE8 A;  2JT4 B;  2PVG C;  4M0W A;  4ARC A;  4JIO U;  4EEW A;  4Q2J A;  2L0F A;  4K1R B;  2HJ1 A;  3W1S C;  3Q8C A;  4A90 A;  3VXW A;  2KWC A;  3DWG C;  3K9O B;  3NHE B;  1SF0 A;  1WY8 A;  2ZW1 A;  3VH3 B;  2ASQ A;  4HJG E;  1L2N A;  2DYM A;  1EM7 A;  4DDI D;  4IKG A;  4BZA A;  4M8M A;  3EGR A;  3VHT C;  1WGH A;  1QOG A;  3ML8 A;  4LK0 M;  3VUY A;  1KF6 B;  1ZUD 2;  2EMS A;  1SIF A;  1A70 A;  3RNB C;  4O1N A;  1GPX A;  3I5J C;  2MA9 B;  3HUI A;  4RF1 A;  4TSS A;  2PE9 A;  4M02 A;  4HKZ E;  4ANU A;  3ALB A;  1Q0W B;  5LXH A;  4IW0 A;  3GZN B;  4P7I A;  3RD2 A;  2D3B A;  2AL6 A;  1FCC C;  2MRP A;  2M19 A;  2J7Q B;  1Z2M A;  3P2B A;  3TMP B;  4JX1 C;  3CIR B;  2FNJ B;  4IM0 A;  4F1S A;  5G5H A;  1WXA A;  3ZJU A;  1QOA A;  3W9C B;  1WJU A;  1CZP A;  3DHG C;  1EWC A;  3CF6 E;  1WXV A;  4BFR A;  1LO5 D;  4W9L A;  4W9K A;  3SD5 A;  3AEC B;  4KX6 B;  4MEL A;  2FCS A;  4FJZ A;  4IDI A;  1PGB A;  1L0V B;  2WXK A;  2WWZ A;  3AE6 B;  1FCL A;  4OHJ A;  3ML9 A;  1N6Z A;  3EUB 2;  4YSX B;  1E8W A;  1QIL A;  2EKE C;  1WMH A;  2WDQ B;  2MP2 B;  4PYU A;  2RSU A;  2WXN A;  3DBH B;  2GBK A;  3ZUN A;  1F1H A;  2VZK B;  3BK1 A;  3OJ4 B;  1TS2 A;  4IWP A;  2JZ3 B;  1HTO A;  3DHI C;  4B95 A;  5JH5 C;  2J42 A;  5FK9 C;  1JWA D;  4A20 A;  1YMH E;  2ZNV C;  2LGS A;  1AAR A;  2L83 A;  4IWQ A;  1WRI A;  1WGR A;  1VLB A;  2GRI A;  4QAY A;  5G5G A;  1NBF C;  4GDK B;  2PE6 B;  4DXA B;  2KLC A;  2FCQ A;  1BT0 A;  2AWT A;  4DHZ B;  1AW7 A;  4ICV A;  1KFY B;  5IN7 A;  2KFK A;  2MQJ A;  4KIK B;  3R7Q A;  2MLB A;  1M4V A;  3Q6B A;  1KLV A;  4WJQ A;  1DOX A;  3AXC A;  3N1Y C;  2IO1 B;  1WXM A;  5D2M B;  5BYS A;  2N7J A;  3P42 A;  4URK A;  1IGD A;  4ZRI A;  2K9X A;  2K8B A;  2WX0 A;  1YJ1 A;  2NMQ A;  2KAC A;  3R2I A;  2L0T A;  2WGS A;  3HVD A;  3U7D A;  1J19 A;  1WF9 A;  1RAX A;  1OTR B;  2L32 A;  2WU5 B;  1EU3 A;  3GE8 C;  5G55 A;  1MFW A;  1FPY A;  2D3A A;  1WM3 A;  3WAM A;  3QAR A;  4RH6 A;  4II2 B;  3DBR I;  3AH7 A;  3ZQ4 A;  1SE2 A;  3FAH A;  4RM8 A;  4DBG A;  3P63 A;  1ZE3 D;  1C79 A;  4CO7 A;  3NS8 A;  2IND C;  3KQ4 A;  1TY2 A;  2VZK D;  3L13 A;  4YL8 A;  1EWY C;  4JWU C;  1Q10 A;  4YTN B;  1Y8R C;  4IUM B;  4E71 A;  2IZV B;  2FBW B;  1D5X C;  5LXI B;  2KN5 A;  2OJR A;  1WYW B;  1B1Z A;  1R4N I;  4M00 A;  3ZW3 A;  4FHJ A;  4MH8 A;  4M8N A;  2KTF A;  2O6V A;  3TCA A;  5E6N A;  4P1B C;  1ZKH A;  4WUR A;  2K8C A;  4A6Q A;  4RMA A;  5I4D A;  4K3B A;  4WJP A;  4W9E A;  3N32 A;  3ZRF A;  2HD5 B;  2XK5 B;  2MWS B;  1TZO A;  1Q1O A;  1WXS A;  2G4S A;  4ACF A;  1FFU A;  3J9C A;  3H7P A;  1K53 A;  1Z5S B;  4N58 A;  4L2Y A;  1T5X D;  1QOF A;  2G3Q B;  2JSV X;  1FMA D;  1MVK A;  4NJC A;  3UQA A;  1YN5 A;  1JML A;  2GOW A;  3N1Z C;  3PLU A;  3ZRC A;  2EEL A;  2KWD A;  4XWT A;  4GOC A;  2C7N B;  2PIA A;  1UBI A;  3RMK C;  1RFK A;  1B9R A;  1TKG A;  1ZP0 B;  2HTH A;  2O2V A;  4S0R A;  4FBJ B;  2BKF A;  3MC9 A;  2WXH A;  2JWZ A;  1NDD A;  2LJI A;  3R7R A;  2BKR B;  1QKZ A;  2MBH A;  3EHV A;  4W9D A;  1IP9 A;  5HHD G;  1FXI A;  1FRR A;  3APF A;  1WX8 A;  3VTW A;  1ZW7 A;  3IT6 B;  4RCO A;  2WXJ A;  3RNE C;  3JSV A;  1FFV A;  1AYF A;  3FIL A;  3EA6 A;  3QIJ A;  2Z59 B;  1I4H A;  2Z8L A;  4ZHO A;  4MSM B;  3V6C B;  3NZU A;  1UBQ A;  1Q5W B;  2KTR B;  2WHI A;  3N3K B;  2I38 A;  1WJ4 A;  2WXQ A;  2MEK A;  1VDV A;  2LRW A;  3NS1 A;  2V0G A;  3PS6 A;  2NPT A;  5JXV A;  1P98 A;  2N7E A;  2IBI B;  3SHQ A;  1ZPS A;  2OOB B;  5DPS A;  3AE2 B;  1JRP A;  4CHK A;  3OJ3 A;  2NCN A;  1XQQ A;  3DBR B;  4IOI E;  4BKS A;  4LNN A;  3DBL I;  4EKU A;  2BYE A;  1SE4 A;  1VR9 A;  3NVZ A;  5BMI A;  2DAF A;  4N6E B;  3IFW B;  1LXD A;  1OQQ A;  1E8Z A;  3MC8 A;  3HRD D;  4JE3 B;  1N5W A;  3PV1 A;  4IC7 B;  5GMV A;  1I7H A;  2K39 A;  3IAM 1;  1WMH B;  1HA5 A;  3WAL A;  1YN4 A;  1MI0 A;  3PHX B;  2R2O A;  2JVC A;  2Y5B B;  1R4N B;  3RN9 C;  2M8S A;  3Q3F A;  3KYD D;  3KW5 B;  3AE9 B;  4DHJ B;  2FE8 A;  4KSL C;  5HKH A;  3DVG Y;  3QCA A;  5EDS A;  1OQY A;  2ZPN A;  4F8C B;  2JWU A;  4USA A;  4G3X B;  2MH7 A;  2KX3 A;  5KHO A;  2KWV B;  1R4M I;  1X1M A;  4XZ4 A;  4EE2 A;  2C7H A;  3B9J A;  3T3N A;  2KYW A;  1PQS A;  1V80 A;  4K81 A;  2XNA C;  1AN8 A;  2DYB A;  2KFK B;  3QC8 B;  3SFD B;  2KJH B;  1V86 A;  3ZKJ C;  3W1Y A;  2JY6 A;  2D11 A;  3ETR A;  4RFB A;  2A5U A;  3B08 A;  2BBC A;  3ENE A;  4LJO B;  2LHD A;  4JLC A;  5CX3 A;  1S3S G;  3OG5 A;  1NVI D;  4WAA A;  5JHB A;  2DHZ A;  4P1C C;  4ITK A;  1NI2 A;  2MJE A;  4TQ1 A;  1J7B A;  4XWW A;  1NYQ A;  3Q3O C;  4OVU A;  4PS3 A;  1MHX A;  2N1V A;  3L0W B;  3TIX A;  4ASW C;  4RGM A;  2BWE S;  1IUE A;  1L4D B;  1YQ4 B;  4HKQ A;  3TUO A;  1T0Q C;  4NNJ B;  1GC6 A;  3H8H A;  4B0E A;  1ROE A;  3VAW A;  2VH1 A;  2KQS A;  1VD2 A;  3H1U A;  2KWU B;  4XX5 A;  4W9G A;  1I4R A;  1E10 A;  4P6V F;  1UNS A;  1YX5 B;  3DVG X;  1WSP A;  1VZ6 A;  2DZJ A;  2BVC A;  1I4P A;  3A9J A;  2JQR B;  1YIW A;  1E5W A;  1FNW A;  3ZYY X;  2DLB A;  3R8B A;  1TZ1 A;  4DHJ D;  3JVZ X;  3L17 A;  5LNK 1;  4DQO C;  3VFK A;  2LGY A;  1QOB A;  1R7S A;  2LFI A;  3SU8 X;  3WA0 A;  2O6V B;  3ZNZ B;  4JL9 A;  5IOI A;  3AEF B;  3AE7 B;  4M01 A;  1TS5 A;  1YQB A;  2KN4 A;  3IAS 1;  4AOF A;  3DBL B;  4I6L B;  2KQ4 X;  1IBX A;  4G11 A;  3CST A;  3EFU A;  2W9N A;  4OZA A;  5CHF A;  3H7P B;  4LTU A;  4HDO A;  5E6O A;  4FXC A;  1LM8 B;  4LJP B;  2AEH A;  3H7S A;  2WXF A;  2XN9 C;  1MHH E;  1N61 A;  1XCQ L;  2PJH A;  1KM7 A;  3VUW A;  4JGH B;  3TSS A;  1C9F A;  2LAS A;  4AWJ A;  2W55 A;  2KVR A;  2IY1 B;  4GMV A;  4WWN A;  4KVG B;  3RT3 B;  3NUH B;  1TTN A;  2RMM A;  3PHW B;  4BKT A;  2WXR A;  1UWM A;  3QJZ A;  1SB3 C;  3I57 A;  2Y5C A;  2O2V B;  1FO4 A;  3L16 A;  2ZVO A;  2C5L C;  2KNB A;  1ESF A;  1ET6 A;  2N9P C;  1R4M B;  1SJE D;  2BYV E;  3P4Q B;  1D5Z C;  2CJN A;  3AM9 A;  1A5R A;  5EE1 A;  5L83 A;  2HTM E;  2OJW A;  5T8I A;  1V49 A;  5AZH A;  2CU1 A;  1PGX A;  3JSV B;  3FIL B;  2N7D A;  4KKJ A;  2NBU A;  4OW0 A;  3APC A;  1E0Z A;  1OQR A;  2IJ0 A;  3DDC B;  4OZC A;  2BB5 A;  2DX5 B;  2NTT A;  4A3P A;  3E9S A;  4XGA B;  2LUE A;  2N4F A;  2O6V D;  3KWL A;  2KK8 A;  3AEE B;  3U4E G;  2KTR A;  2NPT B;  5C3J B;  4KZ0 A;  1FNU A;  1ZOY B;  5BYQ A;  1HEZ E;  1EF5 A;  1RWS A;  2JXT A;  1WJ6 A;  2BS3 B;  1WRD B;  1OGW A;  1F0Z A;  1WWT A;  4JPS A;  4FLH A;  3N20 C;  1V1O A;  2C9W B;  4RGT A;  5GXG B;  3IBE A;  4AQ7 A;  2D3G A;  2D5G A;  5TSS A;  3Q2A C;  3RUI B;  2KDE B;  1V6E A;  1TKY A;  2NR2 A;  1JQ4 A;  2N9E B;  1I35 A;  3C19 A;  1SIJ A;  3MTN B;  2G4D B;  1VJK A;  2QIL A;  3R2T A;  1E7V A;  3P4S B;  4D2K A;  4HLE A;  4ARI A;  1J7C A;  2DNF A;  2KOX A;  5BMG A;  2GMI C;  4HRS A;  4S17 A;  2LJ5 A;  2GI9 A;  1L5P A;  1TT5 B;  2WXP A;  3AEG B;  3X23 A;  1WGK A;  4FHK A;  4NQL B;  1TY0 A;  3IG3 A;  2JRI B;  2UWQ A;  3DVN U;  4XYC A;  3EEC A;  2GBM A;  4C4V A;  5J2R A;  4DXG A;  2KXJ A;  4HPP A;  3ZXV A;  4ZYN A;  3AE4 B;  3MHZ A;  4N59 A;  3M62 B;  3WAN A;  3DHH C;  1PGA A;  3DWM A;  1YX6 B;  1AWD A;  4L23 A;  3ZDT A;  4K7S A;  4ZRP A;  5E6J A;  5FR6 A;  3LYY A;  4YSZ B;  3EFC A;  2K25 A;  3APD A;  3BY4 B;  4LCD E;  2X8X X;  3I9V 1;  2BPS A;  3UIN B;  3OAW A;  4ZRQ A;  4DDG D;  1GJZ A;  3VQI A;  1V5T A;  4PK1 A;  3U30 A;  3C8Y A;  3T9L A;  3QAQ A;  4A9A A;  1F52 A;  1D3Z A;  4BKS D;  2WDV B;  2SEB D;  2HDE A;  2M0X A;  1HZ5 A;  1FRD A;  3A1Q A;  1D6E C;  4IG7 B;  4MGY E;  3AEA B;  2WX1 A;  2EMT A;  1T6B X;  3ONS A;  4OZB A;  1FD6 A;  2AQ1 B;  2KMA A;  1XLO A;  3DBS A;  1F77 A;  2K1F A;  4KGT A;  3IVF A;  2K5P A;  2KAJ A;  1WGY A;  4XE0 A;  3P4R B;  1C3T A;  3ZLZ A;  1UGJ A;  3A9J B;  1E6E B;  3AED B;  2Z0E B;  1L6V A;  4ZRK A;  4CYE A;  4J3O D;  2IYD B;  4I6N B;  4K7U A;  5DPT A;  3AU4 A;  3PRE A;  3CWI A;  1M94 A;  2RGF A;  4ZYS A;  5HFY A;  1SBB B;  3UF8 A;  5J18 A;  2RDG A;  3GB1 A;  1T3Q A;  4X57 B;  4GU2 A;  1NEN B;  5AUI A;  1V97 A;  4FAD A;  2Q5W D;  2CU3 A;  2DWQ A;  2WYQ A;  2ZPY A;  1WM2 A;  1YQ3 B;  4NAW A;  2KD0 A;  3VDZ A;  4NAM A;  5AUK A;  1GOZ A;  5DPW A;  1IBX B;  5H8Y E;  2CKH B;  2ZZP B;  1LGR A;  5BMH A;  2D3C A;  2YVC A;  5D3D A;  4L1B A;  4PT5 A;  1E7U A;  5C1Z A;  3DVN V;  4W9H A;  3PRP B;  2ZJD A;  1V1P B;  4WQM A;  5IO9 A;  4W9I A;  3BVG A;  2KHW B;  1U4A A;  1JWU D;  2QIE B;  1V81 A;  3QK0 A;  4W9J A;  4K3C A;  4KZC A;  4J6I A;  4PS8 A;  5JHA A;  1UF0 A;  2BWF A;  3V6E B;  3RI7 C;  1I4X A;  1ACC A;  2JZZ A;  4A3O A;  1WE7 A;  4RNA A;  3A33 B;  2KVZ A;  1V2Y A;  3RZF A;  3L54 A;  3HHM A;  1IYF A;  4KDL B;  2J0J A;  2GLS A;  4DXF A;  3RUL A;  3DQV A;  2A4Z A;  3VR8 B;  2L1A A;  2BYF A;  3TL5 A;  2E3T A;  1F2R I;  1VZ8 A;  4GB9 A;  2PEA A;  4BBN C;  4AP4 C;  3NY5 A;  2ZVN A;  4MGZ E;  3UGB B;  2FUG 1;  1YOV B;  4LNO A;  1TYG B;  3JYU A;  5FR3 A;  5IA7 A;  4NY0 A;  4BOS C;  1P1A A;  3ZDM C;  1F2R C;  4YSY B;  4GIV A;  1TJE A;  3ZXR A;  3W5U B;  3AE8 B;  1YJI A;  4BKG A;  5TR5 A;  3AI5 A;  1GC7 A;  4OVV A;  2WNM A;  5EE3 A;  2N0S B;  3UIO B;  3KVF B;  1KOT A;  1C4C A;  4GLS C;  4MDK E;  2N9L A;  4WWO A;  1JWM D;  2CR5 A;  2K0P A;  3O13 A;  1H4R A;  1ZGU B;  1HTQ A;  2WXL A;  2KT7 A;  3KUC B;  3Q14 C;  1TBE A;  1D5M C;  4G0N B;  2JZP A;  3ZTD A;  1ISN A;  2BS2 B;  3V60 A;  4P16 A;  3Q8B A;  2KC2 A;  1TS3 A;  3X0W A;  2DAJ A;  1E8X A;  2I2Y A;  3BYY B;  3T3O A;  1C77 A;  4MH0 E;  3KYC D;  3RCZ A;  5D6J B;  2WXO A;  2JYE A;  2JUO A;  5HG2 A;  2MX2 A;  3FC4 A;  1UUP A;  3TEY A;  2KZR A;  3PGE A;  1WGG A;  2KMC A;  2VRR B;  4FN2 A;  4WWM A;  3P1M A;  3U52 E;  2IPK D;  2INP E;  3PRM B;  4C4V B;  4IM2 A;  1SJH D;  3VUX A;  1V5O A;  1MG8 A;  2DZK A;  2L52 A;  2LI5 A;  4KSK C;  3KUZ A;  2Z0D B;  3T8M A;  2GBJ A;  2KDI A;  2VH2 A;  1SE9 A;  1WE6 A;  2ON8 A;  2W82 A;  2FCM A;  2PKO A;  3QQ8 B;  2J0K A;  2IGD A;  2OED A;  3VRB B;  3PRZ A;  2MJD A;  1WZ3 A;  3PZD A;  3R3M A;  3U2S C;  4HK2 A;  4KV2 A;  2YEP B;  2GB1 A;  4WQO B;  1OEY J;  2LGI A;  5JZE B;  2K3U A;  4GSW A;  3GP7 A;  3AEB B;  1GB4 A;  4KGS A;  3MJ5 A;  1XO3 A;  4PYZ A;  1YJJ A;  3S2A A;  3NZ3 A;  1D4B A;  5EE9 A;  1LFD A;  1L0X B;  3CMM B;  1Y56 A;  3A1Q B;  4B0M A;  2WU2 B;  1PFD A;  5G2N A;  2BB6 A;  3P4P B;  4MGK E;  2MHJ A;  2ONQ A;  1ENF A;  1SSN A;  2LGX A;  2WXG A;  4RF0 A;  2QJL A;  1E7P B;  4EOY A;  1CK1 A;  2JF5 A;  1XLQ A;  1BXT A;  2V3S A;  4W9F A;  3MHS D;  3AE3 B;  2KDM A;  4MAC A;  2W3S A;  3ZO5 B;  2C7M B;  3ZTC A;  3WCQ A;  4KDI C;  2PTL A;  2MCN B;  2I1J A;  2DBY A;  4TMA B;  5LLI A;  5C23 A;  1RRB A;  4H2A A;  3TEZ A;  2QEJ C;  4NAW B;  2AQ3 B;  1KLU D;  2DZI A;  4BAX A;  2DEN B;  3I63 C;  4ZOH C;  4RGN A;  4NZL B;  2Y3A A;  4GDL A;  5HI1 A;  1WI0 A;  3PPA A;  2PPH A;  2CHZ A;  3LDZ E;  3UIP B;  1MG4 A;  1K8R B;  1UGM A;  2R2Q A;  2J4X A;  1FEH A;  1K52 A;  4LNI A;  5CHV C;  3D32 A;  2XEW A;  4ZRJ A;  4E3C A;  1V1P A;  3V05 A;  1QQR A;  3A9K A;  4HCP B;  3VTU A;  2IO2 B;  3LXF A;  3ZJT A;  3GOE A;  4TUU A;  1L7Y A;  1SXT A;  1JWB D;  1J8C A;  1N62 A;  3MFG A;  4LNK A;  2WQY B;  4XDD A;  2KX0 A;  2QSD A;  5EE0 A;  2QC8 A;  1DOY A;  2MBO A;  3AN1 A;  3IHP C;  1WXQ A;  3QX1 A;  2MBQ A;  2J53 A;  2TSS A;  2V1Y A;  2CJO A;  3KLS X;  1TIF A;  4EUT A;  2OHF A;  2LXA A;  5H92 C;  4HCN B;  2X38 A;  3AUL A;  3HM6 X;  3QHT A;  2H88 B;  5C2T B;  2AX5 A;  2V3P A;  1XCT L;  2AQ2 B;  1QF6 A;  4RM9 A;  1N63 A;  4DHZ E;  4JWS C;  2NBW B;  2AYO B;  1IPG A;  5L95 C;  2IY0 B;  3DCG A;  3QWZ B;  3NVV A;  2L76 A;  3L4P A;  4ANV A;  2IGH A;  4FUL A;  1P0R A;  4WAF A;  4A8X C;  1I4G A;  3GE3 C;  3OWE B;  4EZJ A;  3PT2 B;  3Q3M C;  2V4L A;  3AMZ A;  2DYO A;  3Q8E A;  3RNF C;  4IM3 A;  4AJW A;  3H9D A;  1T0Y A;  4FJY A;  4HDQ A;  3TBL D;  2K22 A;  1YD8 U;  2B3A A;  1J7A A;  1GNU A;  2JXX A;  5IAA C;  1SGH A;  1GUA B;  3Q3N C;  1OFF A;  3RNA C;  2JPH A;  4IWO A;  3QA8 A;  1EUV B;  2XBB C;  3ZGZ A;  1JW9 D;  3ZNG C;  2MBB B;  5CTR C;  3W5V B;  2L3Z A;  2G45 B;  3PTF C;  2M1M A;  1KJT A;  2IO0 B;  4WIP A;  2NBV B;  4MM3 A;  3MP9 A;  1UEL A;  1XT9 B;  3Q8A A;  3URY A;  1I42 A;  4AJY B;  2MBE A;  3V62 A;  3RZW C;  3OLM D;  3VTV A;  3PVL A;  3Q8F A;  4MJS A;  5BYR A;  1H8C A;  2KKC A;  1DOI A;  1YNT E;  3M3J A;  4WJN A;  1CJE A;  4WJO A;  1P3Q U;  1PUT A;  2R61 A;  1PYW D;  4NJ7 A;  5D3I B;  3PO0 A;  3RFZ B;  3VVW B;  1VRA B;  2DZM A;  3PSE B;  5BO4 B;  1K50 A;  1MPE A;  2GBN A;  4HPM B;  5IP4 D;  4C80 A;  2YLM A;  2K6Q A;  4C00 A;  2BT6 A;  5AZF A;  4EZK A;  2GBR A;  2V4I B;  1XXG A;  2FAZ A;  1RM6 C;  4II3 B;  3RNG C;  2LVO A;  1BML C;  2LD9 A;  2KFJ A;  5D7G A;  3B2F A;  2RDH A;  4EFO A;  3WAP A;  2HE7 A;  3E56 A;  1BUI C;  2D10 A;  4A55 A;  1CQV A;  1WX9 A;  3BVZ A;  4AUQ C;  3N30 A;  4GGQ A;  1KLG D;  3NVY A;  5DCN A;  2PMV A;  2BYT A;  1YN3 A;  3U7Z A;  1PDX A;  2NVU I;  2RPV A;  3SFE B;  2WXM A;  2LEK A;  2NS5 A;  4TQ0 A;  1GB1 A;  1XLP A;  3IXS A;  1FM0 D;  2V3N A;  2RPQ A;  3VR9 B;  2I1K A;  2INN E;  2FID A;  3R66 C;  1CMX B;  4G50 A;  3NRZ A;  1ZXH A;  3HVZ A;  5J17 A;  1V8C A;  1TKE A;  3FKY A;  4NJ6 A;  4TV3 A;  1C1Y B;  4KKI A;  1C4P A;  1V9J A;  4E74 A;  1C4A A;  1QT9 A;  3NG0 A;  4DWF A;  1JRO A;  2CHX A;  4LNF A;  1TGZ B;  4HEA 1;  2B76 B;  3NVW A;  2KQ7 A;  2LRU A;  1QLB B;  4US8 A;  3K9P B;  4GDL B;  1DGJ A;  2QHO A;  2W54 A;  2ZCB A;  5DPR A;  4DK5 A;  1F9J A;  5KHQ A;  3PZ8 A;  2BGF A;  2RD0 A;  3ECI A;  2AL3 A;  3BZD B;  1LQB A;  2IGG A;  1N5X A;  2IDY A;  3BK2 A;  4LDT B;  3A9K B;  1S1Q B;  2SAK A;  4HPL B;  4HXD A;  3PZ7 A;  1JAL A;  2QMT A;  2J52 A;  4FJV B;  4BVU C;  1EO6 A;  2M0A A;  1IGC A;  3SDL C;  1WIA A;  1XEE A;  2D07 B;  3N1X C;  2BW2 A;  1L4Z B;  2L05 A;  4YT0 B;  3Q69 A;  2FIF A;  2E6X A;  2ZNV B;  2W3R A;  4M0W B;  1UWX A;  4REZ A;  4N9F 4;  3A4R A;  2M4N A;  3AV8 A;  1RLF A;  1NEK B;  3PLV A;  4NQK E;  2KDB A;  2H89 B;  1UH6 A;  2ZW0 A;  2BS4 B;  1EU4 A;  2JRH A;  2WS3 B;  2ZCC A;  2M56 B;  4XC2 A;  3UI3 A;  2LXC A;  2BF8 B;  2LZ6 A;  1ZDX A;  1FXT B;  3RNC C;  3AU5 A;  1VZ7 A;  1XF5 L;  2ACZ B;  3ABV B;  1OEY A;  2L8J A;  4HJK A;  4MT5 A;  2L7R A;  2D2Q A;  3TJP A;  2PLP A;  4JQW C;  2BTE A;  2N9K A;  1UD7 A;  1NI3 A;  2MW5 A;  3RYT A;  4I6P A;  2UU7 A;  1J0G A;  2MJ3 A;  3JW0 X;  3AE1 B;  4YTM B;  1I4Q A;  1T0S C;  2KJ6 A;  3MC0 B;  1P7F A;  3DOW A;  4LDT D;  1SE3 A;  2KDF B;  3N9Y C;  5AZG A;  4ANX A;  1DYQ A;  1E9M A;  2IO3 B;  3B0A A;  2WDT B;  3CSF A;  3BVM A;  4PS7 A;  1L6U A;  4MSQ B;  3EC8 A;  1K51 A;  4MM3 B;  3O65 B;  1WH3 A;  2G9H D;  4B6W A;  1WR1 A;  4MJS B;  2Y5P A;  3ZVV A;  4GN1 A;  2WP9 B;  3W2D A;  4R3D A;  3WAO A;  4C56 C;  5IKC M;  1WX7 A;  2LVQ A;  3IT4 B;  3AB5 A;  2N1W A;  3LJ3 A;  3ZNH B;  2MP2 A;  3MJW A;  2JYT A;  3NJT A;  4LLG M;  1C76 A;  1JRU A;  2ICI A;  3DPD A;  2QDF A;  1VCB A;  1MJD A;  1SEB D;  2K6D B;  2KC1 A;  1ZDV A;  1HXY D;  1E8Y A;  4TKN A;  2INC C;  1GAQ B;  2CS4 A;  4ANW A;  2NTS A;  5E6P A;  2LWP A;  1HZ6 A;  2KJR A;  1L0Y B;  2WLB A;  3M63 B;  1G6J A;  3KUD B;  1NYR A;  3SEB A;  1FNV A;  2V9H A;  4GDK A;  2M17 A;  4BOZ B;  1XD3 B;  3A4S C;  4YTP B;  3ZIM A;  1XLN A;  4ICU A;  1P9D U;  1JWS D;  4OVZ A;  3U8Z A;  1QZE A;  2UYZ B;  3Q3J A;  2K8H A;  3L10 B;  2LUM A;  2PVO D;  3RPF C;  2LGD A;  4ZHP A;  3HIZ A;  3W1S A;  3BIN A;  4F7Z A;  1JCK B;  2JU6 X;  1GG3 A;  5CHW A;  3TEW A;  3ZJV A;  4KIK A;  4NPN A;  2G1E A;  1T0R C;  3H6N A;  3VRA B;  2KO3 A;  4WWP A;  2J0M A;  3HM3 A;  2N9X A;  2KLG A;  2KAN A;  1RFA A;  4GXB A;  4K7W A;  4KGR A;  1C78 A;  2MSE D;  3KWV A;  3GZN I;  1ZXI A;  2LMC A;  2C60 A;  1P7E A;  3LB8 C;  1ET9 A;  5MPO A;  1WGD A;  2CHW A;  3C0R B;  3BYT B;  5AEK B;  4RGO S;  4MEM A; 
#chains in the Genus database with same CATH homology
 3A9J B;  1YD8 U;  2Z0E B;  2IBI B;  3SHQ A;  4ZRK A;  4CYE A;  2B3A A;  1GNU A;  2IYD B;  2JXX A;  4I6N B;  4K7U A;  5DPT A;  5IAA C;  3VH4 B;  1SGH A;  1GUA B;  5D94 A;  3AU4 A;  2OOB B;  3PRE A;  1M94 A;  2RGF A;  5DPS A;  1WR6 E;  2HJ8 A;  3I3T B;  3UF8 A;  5J18 A;  4CHK A;  2L00 B;  2JPH A;  3OJ3 A;  2NCN A;  4IWO A;  3QA8 A;  1XQQ A;  3ZNI D;  4BKS A;  1EUV B;  2XBB C;  4X57 B;  3DBL I;  4EKU A;  3ZNG C;  2BYE A;  4GU2 A;  4FAD A;  2MBB B;  2FUH B;  5CTR C;  3M95 A;  2L3Z A;  2WYQ A;  2G45 B;  2DAF A;  2ZPY A;  4ZDV A;  3IFW B;  3PTF C;  2M1M A;  1LXD A;  1KJT A;  1WM2 A;  2IO0 B;  1E8Z A;  4NAW A;  2KD0 A;  3VDZ A;  3NZS A;  2NBV B;  3V61 A;  5DPW A;  4MM3 A;  3KH0 A;  1UEL A;  1XT9 B;  2CKH B;  2FCN A;  2ZZP B;  3PV1 A;  4IC7 B;  3DBH I;  1I42 A;  2ZEQ A;  5GMV A;  4AJY B;  2K39 A;  2MBE A;  3V62 A;  1WMH B;  3OLM D;  2YVC A;  3RZW C;  3WAL A;  3VTV A;  3PVL A;  4MJS A;  3PHX B;  1H8C A;  2KKC A;  2R2O A;  2JVC A;  2Y5B B;  3L08 A;  1WFY A;  2M8S A;  1E7U A;  5C1Z A;  3Q3F A;  3KYD D;  1WJN A;  3DVN V;  3M3J A;  4WJN A;  4W9H A;  3B1L X;  4WJO A;  3PRP B;  2ZJD A;  2XK5 A;  3KW5 B;  4FA6 A;  1P3Q U;  4NJ7 A;  4DHJ B;  4KSL C;  5HKH A;  3UQB A;  4BBN F;  3DVG Y;  3QCA A;  3VVW B;  3PSE B;  2DZM A;  4W9I A;  5BO4 B;  5EDS A;  1OQY A;  2ZPN A;  2REX A;  2KHW B;  2RR9 A;  1U4A A;  2LVP A;  4MGI E;  4F8C B;  4W9C A;  4G3X B;  2GBN A;  1V81 A;  3HK0 A;  4HPM B;  1UZX B;  3QK0 A;  2KX3 A;  4HWI B;  4W9J A;  5KHO A;  2KWV B;  4HVB A;  1R4M I;  1X1M A;  2YLM A;  4XZ4 A;  4KZC A;  1E90 A;  2K6Q A;  4J6I A;  4PS8 A;  1EF1 A;  5JHA A;  2C7H A;  1WZ0 A;  1PQS A;  4B9K A;  4EZL A;  2BWF A;  1V80 A;  4K81 A;  3V6E B;  5AZF A;  2JZZ A;  3NOB A;  1WE7 A;  3WIM A;  1HE8 A;  2DYB A;  2JT4 B;  4A3O A;  2KFK B;  4EZK A;  3QC8 B;  2GBR A;  3A33 B;  2KJH B;  1V86 A;  2FAZ A;  4II3 B;  3ZKJ C;  2LVO A;  2LD9 A;  4JIO U;  4EEW A;  1V2Y A;  2KFJ A;  2JY6 A;  2D11 A;  2L0F A;  4K1R B;  3W1Y A;  5D7G A;  3L54 A;  3RZF A;  3W1S C;  2A5U A;  3B08 A;  3HHM A;  3VXW A;  2KWC A;  4EFO A;  4KDL B;  1IYF A;  3ENE A;  3WAP A;  2J0J A;  4LJO B;  3RUL A;  3DQV A;  3K9O B;  3NHE B;  4JLC A;  1S3S G;  2A4Z A;  5CX3 A;  2HE7 A;  4WAA A;  2D10 A;  2BYF A;  5JHB A;  1WX9 A;  3TL5 A;  2DHZ A;  1WY8 A;  4AUQ C;  3N30 A;  4GB9 A;  2PEA A;  1NI2 A;  4TQ1 A;  3VH3 B;  4BBN C;  2ASQ A;  1L2N A;  4OVU A;  2DYM A;  4GGQ A;  4PS3 A;  2N1V A;  4DDI D;  3L0W B;  4AP4 C;  3TIX A;  3NY5 A;  2ZVN A;  4ASW C;  4M8M A;  5DCN A;  4MGZ E;  3UGB B;  3VHT C;  1WGH A;  3JYU A;  3ML8 A;  5IA7 A;  4NY0 A;  4BOS C;  1P1A A;  3VUY A;  2NVU I;  3ZDM C;  2EMS A;  4GIV A;  1SIF A;  2BWE S;  2NS5 A;  4TQ0 A;  4BKG A;  5TR5 A;  4NNJ B;  3AI5 A;  1GC7 A;  1GC6 A;  4OVV A;  2MA9 B;  3VAW A;  2RPQ A;  2PE9 A;  3UIO B;  3KVF B;  2KQS A;  2I1K A;  1VD2 A;  2FID A;  3H1U A;  3R66 C;  1CMX B;  4G50 A;  4ANU A;  3ALB A;  1KOT A;  2KWU B;  4XX5 A;  4W9G A;  1Q0W B;  5LXH A;  4IW0 A;  4P7I A;  3RD2 A;  1YX5 B;  2AL6 A;  3DVG X;  4MDK E;  2MRP A;  5J17 A;  2DZJ A;  4WWO A;  2J7Q B;  2CR5 A;  4NJ6 A;  3A9J A;  4TV3 A;  1YIW A;  1Z2M A;  1E5W A;  1C1Y B;  1H4R A;  1ZGU B;  3P2B A;  1V9J A;  4E74 A;  3TMP B;  1TZ1 A;  2FNJ B;  4DHJ D;  3JVZ X;  3L17 A;  4IM0 A;  3KUC B;  4F1S A;  1WXA A;  1TBE A;  4G0N B;  3VFK A;  1WJU A;  2CHX A;  2LGY A;  3ZTD A;  4DWF A;  1TGZ B;  1ISN A;  3CF6 E;  1WXV A;  3SU8 X;  3V60 A;  3WA0 A;  4BFR A;  2O6V B;  3ZNZ B;  4JL9 A;  2KQ7 A;  2KC2 A;  4W9L A;  4W9K A;  3SD5 A;  3X0W A;  2LRU A;  2DAJ A;  1E8X A;  3K9P B;  2QHO A;  4GDL B;  2ZCB A;  4MEL A;  5DPR A;  2FCS A;  4FJZ A;  1YQB A;  4MH0 E;  3KYC D;  4DK5 A;  3RCZ A;  5D6J B;  2WWZ A;  2JUO A;  1F9J A;  5KHQ A;  4AOF A;  2BGF A;  2RD0 A;  4I6L B;  3ECI A;  3ML9 A;  4G11 A;  2MX2 A;  3CST A;  2AL3 A;  3EFU A;  2KZR A;  2W9N A;  3PGE A;  2KMC A;  1WGG A;  1E8W A;  1LQB A;  5CHF A;  2VRR B;  4FN2 A;  2EKE C;  1WMH A;  3H7P B;  4HDO A;  5E6O A;  2MP2 B;  1LM8 B;  4PYU A;  4LJP B;  2AEH A;  3H7S A;  2RSU A;  3PRM B;  4LDT B;  3A9K B;  1S1Q B;  4IM2 A;  3VUX A;  4HPL B;  4HXD A;  1V5O A;  2PJH A;  1KM7 A;  1MG8 A;  2GBK A;  3VUW A;  3ZUN A;  4JGH B;  2DZK A;  2LAS A;  2LI5 A;  4KSK C;  3KUZ A;  2Z0D B;  3T8M A;  4FJV B;  4AWJ A;  1EO6 A;  2GBJ A;  2KDI A;  3OJ4 B;  4BVU C;  4IWP A;  2JZ3 B;  1SE9 A;  2KVR A;  2IY1 B;  4GMV A;  3SDL C;  4B95 A;  4WWN A;  1WIA A;  4KVG B;  5JH5 C;  2D07 B;  3RT3 B;  1WE6 A;  1TTN A;  4A20 A;  3PHW B;  2ZNV C;  2FCM A;  3QQ8 B;  4BKT A;  2L05 A;  3QJZ A;  1AAR A;  2J0K A;  4IWQ A;  3PRZ A;  2O2V B;  2FIF A;  1WGR A;  2ZNV B;  3L16 A;  1WZ3 A;  2ZVO A;  1NBF C;  4GDK B;  2PE6 B;  3PZD A;  3R3M A;  4DXA B;  2KLC A;  2C5L C;  4M0W B;  2FCQ A;  1BT0 A;  2AWT A;  2KNB A;  4DHZ B;  4HK2 A;  4KV2 A;  4ICV A;  2N9P C;  4N9F 4;  2KFK A;  2BYV E;  4WQO B;  1OEY J;  3A4R A;  2M4N A;  5JZE B;  4GSW A;  1A5R A;  2MQJ A;  1RLF A;  4KIK B;  3R7Q A;  2MLB A;  5L83 A;  1V49 A;  1KLV A;  4WJQ A;  5AZH A;  3PLV A;  3AXC A;  4NQK E;  4PYZ A;  2CU1 A;  2IO1 B;  2KDB A;  3S2A A;  3JSV B;  1WXM A;  5D2M B;  1UH6 A;  1LFD A;  2N7D A;  3CMM B;  2JRH A;  4XC2 A;  2ZCC A;  3A1Q B;  2NBU A;  4URK A;  2LXC A;  3APC A;  4ZRI A;  3DDC B;  5G2N A;  2BF8 B;  2K8B A;  2LZ6 A;  2WX0 A;  2DX5 B;  4A3P A;  1FXT B;  1YJ1 A;  4MGK E;  2L0T A;  3U7D A;  2LGX A;  2LUE A;  1J19 A;  1WF9 A;  3AU5 A;  1RAX A;  2N4F A;  2O6V D;  2KK8 A;  2KTR A;  1OEY A;  2NPT B;  1OTR B;  4EOY A;  4KZ0 A;  2L8J A;  4HJK A;  2JF5 A;  2L7R A;  2D2Q A;  5G55 A;  1EF5 A;  3TJP A;  4JQW C;  1WJ6 A;  1UD7 A;  2V3S A;  1WRD B;  4W9F A;  1WM3 A;  1OGW A;  3MHS D;  2MW5 A;  3WAM A;  3QAR A;  3DBR I;  4FLH A;  4II2 B;  4I6P A;  3RYT A;  1J0G A;  3ZO5 B;  3JW0 X;  2C7M B;  2C9W B;  3ZTC A;  4KDI C;  4RM8 A;  2KJ6 A;  3IBE A;  4DBG A;  2MCN B;  3DOW A;  4LDT D;  2I1J A;  2D3G A;  2KDF B;  5AZG A;  3RUI B;  2KDE B;  4ANX A;  1V6E A;  2NR2 A;  2IO3 B;  3B0A A;  3NS8 A;  4CO7 A;  2WDT B;  3CSF A;  5LLI A;  5C23 A;  3L13 A;  4YL8 A;  1RRB A;  4PS7 A;  1Y8R C;  4MSQ B;  4IUM B;  4E71 A;  2IZV B;  3EC8 A;  5LXI B;  2N9E B;  2KN5 A;  4NAW B;  2OJR A;  1I35 A;  1WYW B;  3MTN B;  1R4N I;  2DZI A;  2G4D B;  3ZW3 A;  4FHJ A;  2DEN B;  1E7V A;  3O65 B;  2KTF A;  4M8N A;  2O6V A;  1WH3 A;  3TCA A;  4B6W A;  4HLE A;  1WR1 A;  5E6N A;  1ZKH A;  4MJS B;  2K8C A;  4GDL A;  2KOX A;  3ZVV A;  1WI0 A;  4GN1 A;  3PPA A;  4RMA A;  2PPH A;  2GMI C;  2CHZ A;  3LDZ E;  3UIP B;  1UGM A;  1K8R B;  2R2Q A;  4WJP A;  4W9E A;  3N32 A;  3ZRF A;  2HD5 B;  3WAO A;  2LJ5 A;  2XK5 B;  2MWS B;  1Q1O A;  1WXS A;  1WX7 A;  2G4S A;  2LVQ A;  3X23 A;  2N1W A;  5CHV C;  4FHK A;  3LJ3 A;  3D32 A;  3H7P A;  4NQL B;  3ZNH B;  3IG3 A;  2XEW A;  2MP2 A;  3MJW A;  2JRI B;  2UWQ A;  3DVN U;  4ZRJ A;  4E3C A;  3EEC A;  2GBM A;  3A9K A;  5J2R A;  1Z5S B;  1JRU A;  2IO2 B;  4HCP B;  3VTU A;  2KXJ A;  2G3Q B;  3DPD A;  4ZYN A;  3GOE A;  1VCB A;  1L7Y A;  4TUU A;  2K6D B;  2KC1 A;  1J8C A;  1E8Y A;  3M62 B;  4TKN A;  3WAN A;  3UQA A;  1YX6 B;  2GOW A;  2KX0 A;  3PLU A;  3ZRC A;  2CS4 A;  4ANW A;  5E6P A;  3ZDT A;  2LWP A;  4GOC A;  2MBO A;  2C7N B;  2KJR A;  4K7S A;  1UBI A;  5FR6 A;  3IHP C;  3M63 B;  1G6J A;  3KUD B;  2HTH A;  2O2V A;  2K25 A;  3APD A;  4GDK A;  2M17 A;  3QX1 A;  2BKF A;  3BY4 B;  4BOZ B;  4FBJ B;  1XD3 B;  3A4S C;  3ZIM A;  2MBQ A;  4LCD E;  2V1Y A;  4ICU A;  2JWZ A;  1P9D U;  3U8Z A;  1QZE A;  1NDD A;  2UYZ B;  3R7R A;  3Q3J A;  2BKR B;  2K8H A;  3L10 B;  2MBH A;  2BPS A;  3EHV A;  2LGD A;  3UIN B;  3HIZ A;  3OAW A;  3W1S A;  4W9D A;  3BIN A;  4EUT A;  4F7Z A;  2LXA A;  1IP9 A;  1GG3 A;  4HCN B;  5CHW A;  3AUL A;  4DDG D;  1GJZ A;  3VQI A;  1V5T A;  4KIK A;  4NPN A;  3HM6 X;  3APF A;  3U30 A;  3QHT A;  3T9L A;  3QAQ A;  1WX8 A;  3H6N A;  3VTW A;  1ZW7 A;  2KO3 A;  4WWP A;  4RM9 A;  2J0M A;  3HM3 A;  4DHZ E;  1D3Z A;  2N9X A;  2KLG A;  3JSV A;  4BKS D;  2NBW B;  2KAN A;  2AYO B;  1IPG A;  5L95 C;  2IY0 B;  2M0X A;  3DCG A;  1RFA A;  4GXB A;  3QWZ B;  3A1Q A;  4IG7 B;  4MGY E;  3QIJ A;  2L76 A;  4ANV A;  2Z59 B;  4FUL A;  1P0R A;  4K7W A;  2WX1 A;  2EMT A;  2MSE D;  4MSM B;  3GZN I;  3V6C B;  3ONS A;  3NZU A;  1UBQ A;  1Q5W B;  2KTR B;  2KMA A;  4EZJ A;  3N3K B;  3PT2 B;  2C60 A;  2V4L A;  3DBS A;  1WJ4 A;  2DYO A;  2LRW A;  2K1F A;  1WGD A;  3PS6 A;  2CHW A;  2NPT A;  4IM3 A;  3C0R B;  3IVF A;  5AEK B;  4AJW A;  3H9D A;  1T0Y A;  4FJY A;  4HDQ A;  1P98 A;  1WGY A;  3TBL D;  4MEM A;  1C3T A;  2N7E A;  3ZLZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...