5IAAC

Crystal structure of human uba5 in complex with ufm1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
80
structure length
80
Chain Sequence
VSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Ubiquitin-like modifier-activating enzyme 5
publication title Trans-Binding Mechanism of Ubiquitin-like Protein Activation Revealed by a UBA5-UFM1 Complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 80
sequence length 80
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03671 Ufm1 Ubiquitin fold modifier 1 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5iaaC00
3DVGX 2J0JA 4GDLA 4GU2A 5AZHA 3EFUA 2KFJA 2M4NA 5D2MB 3TBLD 5HKHA 2K1FA 2W9NA 2D11A 2YLMA 1RFAA 2N9XA 2HJ8A 2N9EB 3H9DA 4DXAB 4M8NA 2C5LC 4TKNA 5C1ZA 2IYDB 3V62A 1WY8A 1OGWA 3QJZA 4P7IA 4G11A 1V80A 5DPRA 2NR2A 2K8BA 5C23A 4K1RB 1WE6A 3GOEA 1E8ZA 1IP9A 3K9PB 2MP2A 4CHKA 4JGHB 4NPNA 3CF6E 3I3TB 4DDID 3L54A 1LM8B 4FJZA 4HK2A 4M0WB 1WH3A 2KK8A 2KJRA 2KLGA 3VH3B 5J18A 2K6DB 3D32A 5GMVA 2KX0A 1OQYA 4BBNC 4HXDA 2EMSA 2HTHA 4PS8A 4WAAA 4ZYNA 1Q1OA 1GNUA 3KYDD 1S3SG 2KANA 3ZDMC 3SU8X 4EZLA 1J0GA 1XT9B 2MWSB 1E8XA 1WX8A 3PVLA 2WX0A 4PYZA 2XBBC 2LVOA 3IBEA 4HCPB 3KW5B 4KIKA 5IAAC 4XZ4A 2ZPNA 5E6OA 2ZNVC 4BOSC 3HK0A 2RD0A 3A1QA 4EEWA 3ZIMA 4B6WA 3HHMA 4K7UA 2MSED 3NOBA 4F1SA 3ZRFA 2IY0B 5LXHA 4KV2A 2Z0EB 3S2AA 2L0TA 2G4SA 2JUOA 3N30A 5AEKB 1KOTA 1WI0A 2WYQA 3R7QA 4HPLB 2LI5A 4DWFA 1YD8U 2MBBB 2RGFA 4MEMA 1T0YA 2KD0A 4DHZB 1WM2A 2V4LA 4BKTA 2ZJDA 1P98A 1YJ1A 1YX5B 3HM6X 1I35A 4FJVB 2KN5A 2WDTB 3SHQA 1VD2A 2RR9A 2PE6B 3M95A 3UGBB 2PJHA 4AJWA 2XK5B 2BGFA 1WM3A 3PHXB 1LXDA 2BYVE 2NBUA 4JL9A 4WJQA 4KSKC 4ZRIA 2UWQA 3M62B 2MW5A 2IBIB 3QHTA 3DOWA 3ZLZA 1WF9A 1QZEA 4CO7A 5L95C 2CR5A 2V3SA 2NBWB 3CMMB 3ENEA 2O2VB 1LQBA 1UGMA 4FBJB 5DCNA 4JLCA 2KTRA 2KX3A 2RPQA 4JQWC 2WX1A 2KC2A 4MSQB 3WAOA 3VTWA 1L2NA 4URKA 4MGYE 4BBNF 3RZFA 2KMCA 4GDLB 3QAQA 2IO1B 2LXCA 4ZRKA 2CHXA 3CSFA 2LUEA 4XC2A 1ZW7A 2NPTA 1UZXB 1WXSA 2KXJA 2B3AA 3VFKA 2DHZA 3H7PA 4FULA 1V81A 3L0WB 1L7YA 4A20A 2IO3B 4EKUA 2KZRA 4I6NB 1WX9A 4G0NB 3RD2A 4W9EA 2LASA 3A9KA 3L16A 1V6EA 2LXAA 4A3OA 1V86A 2XEWA 2NCNA 4HPMB 3A4SC 4IUMB 4XX5A 4W9CA 2L3ZA 1V5TA 2DENB 5LLIA 2DYMA 4GDKA 1RLFA 4IM0A 4TUUA 2EKEC 4WWOA 1G6JA 1OEYJ 4GN1A 5IA7A 2A4ZA 4WWNA 3NZSA 4JIOU 2ZVNA 1WYWB 3ZDTA 4AWJA 2IO0B 3N3KB 1ZGUB 4KIKB 4KDIC 4FLHA 2JPHA 2JXXA 3A1QB 3NHEB 1TTNA 1WJ6A 2M0XA 4KDLB 5CHVC 1MG8A 2JY6A 3ZW3A 4DBGA 4NQKE 1E5WA 2D10A 3OJ4B 3ZNZB 4HDOA 3VUWA 2AWTA 4FADA 3NS8A 3JVZX 1D3ZA 2KWUB 2D3GA 1F9JA 2KJ6A 2Y5BB 1P1AA 2M1MA 3DQVA 2IZVB 4W9DA 3TCAA 3VUYA 1GG3A 2GOWA 3MJWA 4I6PA 3ZTCA 5KHQA 2OJRA 4AP4C 4KZCA 4MGZE 4EUTA 2EMTA 2AL3A 1RAXA 1WGHA 2FIDA 1TZ1A 2M17A 3UINB 2MX2A 2ZNVB 4A3PA 3WALA 4IM2A 3L10B 2DZIA 3PTFC 3KUDB 3PPAA 2O6VA 1NI2A 1V9JA 3QA8A 1VCBA 1WGDA 3QWZB 5E6PA 2JWZA 4NJ7A 3MHSD 3PT2B 3W1YA 5DPWA 3JSVA 3L17A 2CHWA 4EFOA 2K8CA 2CKHB 2QHOA 4MH0E 4RMAA 2KWCA 4ANVA 5AZGA 3APDA 3QARA 2KTRB 1GUAB 4K7SA 1WZ3A 3EECA 4DHJB 1OTRB 3KUCB 3RT3B 4MJSA 4GIVA 3QIJA 2N7DA 2KC1A 3EHVA 2PEAA 2LGDA 1K8RB 3AU4A 2NPTB 4BFRA 2MA9B 2DAJA 1UH6A 2DZMA 3H7PB 4WQOB 4ANUA 1WRDB 2C7MB 1M94A 3VHTC 3Q3JA 3NY5A 4II2B 1E7UA 3U8ZA 3DVNV 4IW0A 3KH0A 2OOBB 3V6EB 4PS7A 3M63B 1NBFC 3A9KB 1UD7A 3DVNU 2C7NB 2DAFA 3TIXA 5CHWA 2BYFA 1Z5SB 3DBRI 2G3QB 3VTVA 2JZ3B 3OAWA 1PQSA 2FCQA 2K6QA 2KO3A 3L13A 2PE9A 3PHWB 4GDKB 1V5OA 1WGYA 2NS5A 2JZZA 2D07B 1V49A 2ZCBA 2GBKA 1C1YB 4J6IA 4TQ1A 1XQQA 3ML8A 3AXCA 1UELA 3QC8B 3QX1A 5CHFA 1GC7A 2GBRA 2ZEQA 3TJPA 3RYTA 3A33B 3QK0A 3PLUA 2MBHA 2LJ5A 1UBIA 1WXMA 2DZJA 3P2BA 2N1WA 1WFYA 2CHZA 5DPSA 1ISNA 3M3JA 4WJOA 2C60A 1WR6E 4DHJD 3SDLC 2FCMA 3DBLI 2MCNB 4CYEA 3PSEB 2KHWB 4LCDE 2MQJA 3TMPB 3VUXA 4F7ZA 2LGYA 3B08A 2JVCA 2LVQA 3K9OB 3VAWA 2N7EA 5D7GA 2Z0DB 5JH5C 1WGRA 3LJ3A 3V60A 3R7RA 4KSLC 4BVUC 2O6VB 1WXVA 4MELA 4G50A 2FIFA 2VRRB 4ICVA 1EO6A 4ANXA 4WJPA 3JSVB 3T8MA 3W1SC 4NAWA 2J0KA 3GZNI 2AYOB 1RRBA 3OJ3A 4E3CA 1WZ0A 3KYCD 3U7DA 1WJ4A 1CMXB 3U30A 1EF5A 3V6CB 2MBEA 4MJSB 3WAMA 2L00B 3APCA 1Z2MA 2KFKA 2L05A 3PLVA 4M8MA 4TQ0A 3T9LA 2BWFA 5JZEB 1C3TA 3ZNID 3ALBA 1E8YA 2LD9A 3DVGY 4IC7B 3VXWA 1GJZA 2LVPA 2DX5B 4AJYB 2R2OA 3W1SA 2Z59B 3ZVVA 4B95A 5D6JB 1YX6B 3UF8A 3B0AA 2DZKA 3ZRCA 1WE7A 3IHPC 3WIMA 3KVFB 1WX7A 3ZNGC 1IYFA 3N32A 2KDEB 3TL5A 5FR6A 2KKCA 4FJYA 5TR5A 4HLEA 5J2RA 2ZPYA 3ZUNA 4BOZB 2BPSA 4E74A 2BKRB 2DYOA 4NQLB 2IO2B 4NNJB 1KM7A 4GXBA 2LRUA 2L0FA 4WJNA 2A5UA 1WMHA 2WWZA 5KHOA 3R3MA 4HWIB 4AUQC 3CSTA 1Q0WB 3HM3A 1E7VA 2O6VD 4FHKA 1WJUA 4IWQA 4GOCA 4MDKE 4W9FA 3WA0A 4BKSA 4KVGB 4BKSD 2LGXA 4OVUA 5LXIB 2KOXA 3PRZA 3PRMB 2KVRA 3C0RB 3UQAA 4EZJA 3VTUA 2BF8B 1X1MA 4ASWC 4WWPA 3IG3A 4B9KA 2R2QA 2FNJB 1P0RA 3BINA 3RZWC 1V2YA 3OLMD 2FAZA 1KJTA 3PGEA 2L76A 2KMAA 3EC8A 2I1KA 2I1JA 3A9JA 5J17A 4W9HA 4HVBA 4X57B 2N1VA 5DPTA 4EZKA 3AU5A 4G3XB 1XD3B 1EF1A 4GSWA 2GBJA 4GB9A 3PZDA 3H6NA 2JF5A 1E90A 2KDIA 5L83A 3RUIB 2PPHA 1GC6A 3O65B 2YVCA 4FHJA 4I6LB 3VH4B 3LDZE 1Q5WB 1NDDA 3ECIA 4NAWB 1I42A 5G2NA 4LDTB 3RCZA 3RULA 2DYBA 3DDCB 1U4AA 4K7WA 4II3B 2ZVOA 5JHAA 1P3QU 2MBOA 5E6NA 2KFKB 2AL6A 3DBHI 3ML9A 3JW0X 2MBQA 3IFWB 4W9KA 3IVFA 5BO4B 3VVWB 4MSMB 3X0WA 4OVVA 4LJOB 4ANWA 2M8SA 2N9PC 4IM3A 3QQ8B 2FCNA 1E8WA 4N9F4 4AOFA 2C9WB 4ZDVA 4PS3A 2BWES 1WIAA 1ZKHA 2KJHB 4GMVA 2KQ7A 4W9LA 4NY0A 3B1LX 2IY1B 1SIFA 2LRWA 2MLBA 3SD5A 4PYUA 4DDGD 2NBVB 3ZO5B 3KUZA 2KDFB 2J0MA 4NJ6A 3UIPB 2HE7A 4EOYA 2RSUA 3MTNB 1JRUA 1UBQA 2V1YA 4HDQA 3DBSA 5D94A 2ZZPB 3WANA 4ICUA 4RM8A 2C7HA 1J19A 2FUHB 3PV1A 2ASQA 4FA6A 4W9JA 3DCGA 2KLCA 1WMHB 1TBEA 2G4DB 2K39A 3UQBA 4HCNB 4F8CB 2D2QA 2ZCCA 5CX3A 2CU1A 4MGKE 2KTFA 3L08A 1IPGA 3PREA 1WGGA 2L8JA 3BY4B 4KZ0A 4YL8A 1H8CA 2K25A 2LZ6A 3APFA 3PRPB 4IWOA 2JT4B 4DK5A 2GBMA 1YQBA 2FCSA 4LDTD 1EUVB 4E71A 2KWVB 2JRHA 3A4RA 3PS6A 1BT0A 3HIZA 3AI5A 3ZNHB 2J7QB 4K81A 1AARA 3Q3FA 4ZRJA 5AZFA 2KNBA 1R4NI 1WR1A 3ZTDA 3H1UA 4LJPB 3A9JB 3QCAA 2UYZB 2G45B 1Y8RC 2MP2B 2MRPA 2HD5B 3X23A 5G55A 4MGIE 3ONSA 4BKGA 1SGHA 2GBNA 1YIWA 4FN2A 3R66C 1R4MI 3JYUA 2AEHA 1WJNA 1KLVA 1H4RA 4GGQA 3ZKJC 5JHBA 1A5RA 2XK5A 2CS4A 1TGZB 4W9GA 1HE8A 2LWPA 2BKFA 4W9IA 2L7RA 2KDBA 1SE9A 2KQSA 2BYEA 3VDZA 1FXTB 4RM9A 3DPDA 1LFDA 1OEYA 2O2VA 3H7SA 3AULA 4TV3A 5EDSA 5CTRC 3UIOB 3V61A 2REXA 3WAPA 1J8CA 2K8HA 4DHZE 3NZUA 2JRIB 1WXAA 4IG7B 4IWPA 3VQIA 1S1QB 4HJKA 2GMIC 4MM3A 1P9DU 2NVUI 2N4FA
chains in the Genus database with same CATH superfamily
1C77A 2FE8A 2N9LA 1QILA 5D2MB 3TBLD 5HKHA 2D11A 2YLMA 2XNAC 3AV8A 4M8NA 3Q3OC 4TKNA 3SEBA 3Q2AC 1HXYD 5AUIA 3V62A 1WY8A 1V80A 1EWYC 4K1RB 4RH6A 1WE6A 4CHKA 4NPNA 2LEKA 3CF6E 2KMMA 2KJRA 2K6DB 1GAQB 4AS1A 5GMVA 4BBNC 2EMSA 2EELA 1Q1OA 1J0GA 1XT9B 1E8XA 2XBBC 5TSSA 4KIKA 3KW5B 4EEWA 1PYWD 1DOIA 1MVKA 3RNCC 3HHMA 1SF0A 3NOBA 3ZRFA 2LHDA 1GPXA 4NJCA 2WYQA 3R7QA 2WDVB 3LYYA 4H2AA 3RNEC 1T0YA 2KD0A 1C76A 2V4LA 1YJ1A 3HM6X 1HTQA 3SHQA 3UGBB 1WM3A 1L4ZB 2BYVE 2WLBA 3M62B 2MW5A 2IBIB 3DOWA 1QZEA 4CO7A 3CMMB 1YN5A 4B0EA 4YXDB 4CQNA 2PVOD 2KX3A 4MSQB 1E0ZA 3E9SA 2KMCA 1PFDA 3QAQA 2LXCA 1PDXA 2CHXA 4XC2A 2B3AA 3BZDB 4FULA 2X8XX 1N6ZA 4N58A 1WX9A 4G0NB 1LGRA 3A9KA 2INCC 3L16A 1DYQA 2LXAA 1SSNA 4A3OA 3B9JA 3NJTA 4IUMB 4W9CA 2L3ZA 5FK9C 2DENB 2DYMA 4IM0A 4GN1A 1KLGD 2A4ZA 4JIOU 3GE3C 1WYWB 3ZDTA 1JWAD 2LGIA 3U4EG 1IGDA 2JXXA 4NQKE 1E5WA 2D10A 1ZXIA 1FNWA 4FADA 3JVZX 2D3GA 4A90A 3TCAA 2Y5BB 1P1AA 2GOWA 4MGZE 4EUTA 2EMTA 3Q8FA 3MFGA 3UINB 1V1PA 2FBWB 5T8IA 4RNAA 1N60A 2O6VA 1NI2A 2WDRB 1V9JA 1VCBA 2JWZA 4R3DA 3MHSD 1UGJA 3L17A 2QHOA 1SBBB 2KTRB 1GUAB 2V3NA 2PIAA 4DHJB 3RT3B 4USAA 3N1ZC 1UNSA 3EHVA 3CIRB 2XN9C 2LGDA 3AU4A 3VRBB 2NPTB 4BFRA 1AYFA 2D3AA 3H7PB 1M94A 3N1XC 4IW0A 4MT5A 4XDDA 3RI7C 1NBFC 1JW9D 2C7NB 3DVNU 2H89B 2BYFA 1I4RA 3AB5A 4HEA1 1NI3A 2BS2B 2ZCBA 2GBKA 1XQQA 2QJLA 3QX1A 5CHFA 3GB1A 1XLNA 1OQQA 3A33B 1QOGA 3FC4A 2SAKA 3H8HA 4WAFA 1HEZE 1ISNA 2NTTA 2C60A 3Q8CA 1WR6E 2V9HA 5MPOA 1TY0A 3VUXA 2JVCA 2N7EA 2BTEA 1F52A 3R7RA 2V0GA 2WXHA 3JSVB 3T8MA 1OQRA 3BYYB 1RRBA 3CWIA 1WZ0A 3U7DA 1V97A 2WP9B 4MJSB 2L00B 3AEBB 1FXIA 1HZ5A 4M8MA 1JWUD 2J42A 2WQYB 3ZNID 1GJZA 1TZOA 3ZVVA 3LB8C 1YX6B 3B0AA 2DZKA 2CJOA 3KWLA 2KKCA 5TR5A 1RM6C 4HLEA 5J2RA 2BPSA 4D2KA 2IO2B 4KX6B 2RMMA 3OG5A 4HKZE 1E7VA 4FHKA 4J3OD 3WA0A 4GOCA 1MHHE 2HJ1A 4BKSD 1P7EA 1SE2A 3UQAA 3SR6A 4ASWC 4B9KA 4P1CC 3EC8A 1K50A 2WXRA 1YQ4B 2VH2A 1C4AA 1FNUA 3AECB 2W3SA 3PZDA 1TS4A 4A9AA 1Q10A 1R7SA 3LDZE 1Q5WB 2WXPA 1L6VA 1AW7A 4XDCA 5G2NA 3RCZA 4K7WA 1L5PA 3OWEB 3NVYA 2MJ3A 3DBHI 3ML9A 3IVFA 5BO4B 3VVWB 4RCOA 4LJOB 4ANWA 1N5WA 2DNFA 2IGDA 1E8WA 4N9F4 3VR8B 2QC8A 2BWES 4MACA 1YJIA 4W9LA 4NY0A 1SIFA 2LRWA 3SD5A 2DBYA 3URYA 4DDGD 2WXJA 2WNMA 4YSZB 3MTNB 5D94A 1UBQA 3AE5B 3DBSA 4RM8A 2FUHB 3HRDD 4W9JA 2RPVA 1QLBB 2KLCA 3UQBA 2D2QA 1WXQA 2ZCCA 4OZAA 5CX3A 2CU1A 2IDYA 1IPGA 4NZLB 2ONQA 3APFA 1YJJA 3TSSA 1HZ6A 4LDTD 4RGNA 1EUVB 1FRDA 3I63C 2KWVB 1JRPA 2Z8LA 1BT0A 3C8YA 4C7YA 1V8CA 5AZFA 1FFVA 2UYZB 3EGRA 1F2RC 2MP2B 3X23A 4MGIE 1YIWA 4FN2A 1B9RA 1WJNA 1TGZB 2LWPA 4RF1A 1C4CA 1SE9A 2BYEA 1NYRA 1LFDA 2MJDA 1EU3A 2REXA 1FXAA 3VR9B 4DHZE 4C4VB 1KRHA 5BYRA 2N4FA 3DVGX 2J0JA 3Q8AA 2M4NA 2N9XA 2HJ8A 3B2GA 2BS4B 2IYDB 1OGWA 3QJZA 3GS2A 1D5XC 5C23A 3NVVA 3GOEA 4US8A 3BVZA 3K9PB 1UWXA 3I3TB 4LK0M 4HK2A 4M0WB 1RYJA 3VH3B 2KLGA 3TEYA 4PS8A 4ZYNA 3KYDD 3ZDMC 3SU8X 4O1NA 1ESFA 2MWSB 2LVOA 3B2FA 4B6WA 1F0ZA 2K5PA 2CJNA 2Z0EB 1F2RI 2LHEA 4HPLB 4DWFA 1YD8U 4P1BC 2MBBB 2RGFA 1WM2A 2ZJDA 1P98A 1YX5B 1I35A 2Y3AA 4FJVB 1FFUA 1VD2A 2PE6B 3M95A 2TSSA 2PJHA 4AJWA 5EE3A 2NBUA 1I4XA 4JL9A 2W54A 5L95C 4TMAB 2V3SA 3SFDB 1UGMA 5DCNA 4JLCA 2KTRA 2RPQA 3WAOA 3VTWA 5IP4D 1L2NA 4BBNF 3RZFA 1BXTA 1J7AA 3BVMA 3DHHC 1C9FA 2NPTA 3H7PA 3L0WB 4RGOS 2KZRA 4I6NB 1ZDVA 3AE9B 4REZA 4M00A 4TUUA 1K52A 2EKEC 4WWOA 1OEYJ 5IA7A 4QAYA 1N62A 2ZVNA 4AWJA 4WQMA 5EE1A 5DPWA 3NHEB 1TTNA 1MG8A 3J9CA 2KWUB 1TY2A 2KJ6A 2ON8A 3ZTCA 1GG3A 3MJWA 4PT5A 3FILA 4KZCA 2AL3A 1RAXA 4DXGA 1TZ1A 3ZQ4A 3U7ZA 2MX2A 4N59A 3WALA 3E56A 2DZIA 2N7JA 4ZHOA 3PPAA 3QWZB 2M56B 2YEPF 4NJ7A 1FO4A 3JSVA 4EFOA 2CHWA 2K8CA 3NUHB 4MH0E 2KWCA 3Q14C 4ANVA 5AZGA 3QARA 5BYQA 3W5UB 2H88B 1WZ3A 3EECA 4HJGE 5D3IB 4MJSA 3QIJA 4OW0A 2QSDA 2PEAA 4L1BA 1K8RB 2MA9B 2DAJA 1UH6A 4WQOB 4ANUA 3BWUD 5BMGA 3Q3JA 3NY5A 3TIXA 5CHWA 3AH7A 1GB1A 3OAWA 2KO3A 2K6QA 3PHWB 4RFBA 1V5OA 1WGYA 2JZZA 4YSYB 4ARCA 1J7CA 1C1YB 4J6IA 4TQ1A 1L0YB 1GC7A 2QILA 1P7FA 4C00A 1WFYA 2LFIA 4CYEA 3W9CB 4LCDE 5IN7A 3TMPB 2LGYA 3B08A 1XCTL 2R61A 2LVQA 3K9OB 2Z0DB 3V60A 4KSLC 4G50A 5E6JA 1YN3A 2VRRB 4WJPA 2WHIA 4KGTA 4EE2A 4L23A 3KYCD 1UWMA 3V6CB 3DBLB 2MBEA 4TQ0A 2MHJA 2INPE 3T9LA 2BB6A 2LD9A 2LVPA 2DX5B 1YNTE 1QOFA 2R2OA 2LGSA 3Q69A 4IDIA 3UF8A 1FIQA 1D5MC 1WE7A 1WX7A 2M19A 3N32A 2Y5PA 4KKIA 1ZXHA 5G5GA 3R2TA 5BMHA 2ZPYA 3ZUNA 4BOZB 4E74A 4BAXA 3O13A 2L0FA 1D6EC 3R3MA 3CSTA 2BYTA 4IWQA 4MDKE 4W9FA 1WJUA 3AE8B 4KVGB 2LGXA 4OVUA 3PZ8A 1YQ3B 3C0RB 3RN9C 3VTUA 1TS2A 4WWPA 3IG3A 2FNJB 3BINA 2K3UA 1KJTA 2Q5WD 2I1JA 4HVBA 5HFYA 4EZKA 4G3XB 1XD3B 1YN4A 2PTLA 3IAM1 3HUIA 4GB9A 3H6NA 3MJ5A 4I6LB 3O65B 4FHJA 2ACZB 3ECIA 4LDTB 4ZRPA 3RULA 2DYBA 5JHAA 2QCZA 5E6NA 3JW0X 2MBQA 3TEWA 4C4VA 3X0WA 4OVVA 1K51A 4IM3A 2N9PC 2IPKD 2C9WB 4ZDVA 4PS3A 1WIAA 1ZKHA 2KJHB 4GMVA 2MLBA 3ZYYX 2JYTA 4A6QA 2NBVB 2V4IB 3KUZA 2KDFB 4LNIA 2J0MA 4NJ6A 2KACA 2M0AA 2BQQA 1JRUA 2W55A 1XEEA 1WRIA 2K0PA 4ICUA 2C7HA 2ASQA 3TEZA 1TBEA 3AE1B 2K9XA 1NENB 1QF6A 3PREA 4HRSA 1WGGA 2L8JA 4KZ0A 1H8CA 3U2SC 4IWOA 2JYEA 2GBMA 1QT9A 4AQ7A 2HDEA 1YQBA 1MG4A 2JRHA 3PS6A 3A4RA 1AARA 1SJED 3Q3FA 3ZTDA 3TEXA 4LJPB 3A9JB 3QCAA 1IBXA 3EFCA 3PO0A 1Y8RC 4LNNA 5G55A 2GBNA 1R4MI 2AEHA 1T0SC 5FR3A 1NVID 1WYGA 4OZBA 2KDBA 5HHDG 4B0MA 1Y56A 1E7PB 1K53A 4BZAA 1WXAA 2UU7A 2NVUI 1I4GA 4GU2A 5AZHA 3EFUA 2KFJA 2MJEA 2N9EB 3H9DA 3BK1A 4DXAB 4YSXB 4P7IA 2NR2A 2K8BA 2KVZA 2BW2A 4WWMA 2QIEB 3L54A 1LM8B 2KK8A 5J18A 4HXDA 4L2YA 1VLBA 1GNUA 2KANA 4N6EB 2KWDA 4EZLA 1SJHD 4PYZA 3IBEA 5IAAC 4XZ4A 2ZPNA 3AE2B 4S0RA 2J53A 2BBCA 1VR9A 5E6OA 2JQRB 4K7UA 2MSED 4F1SA 5LXHA 2L0TA 2G4SA 3N30A 4ZOHC 2KDMA 2LI5A 2AQ2B 2WU5B 1VRAB 1T5XD 4DHZB 3HVZA 4HPPA 2IJ0A 4BKTA 1UUPA 2JX5A 4XWTA 5JXVA 2SEBD 2KN5A 3P4SB 4C7ZA 3BVGA 2J4XA 1LXDA 2BT6A 4WJQA 2YEPB 5GXGB 2N9KA 4XE0A 1T3QA 1WF9A 1CQVA 2CR5A 3N9YC 1LQBA 3ZJVA 3NG0A 4JQWC 1VZ6A 2KC2A 1BUIC 4S17A 2MH7A 2OJWA 4URKA 3KLSX 2KYWA 4GDLB 4KGRA 4ZRKA 3NRZA 2KXJA 2DHZA 4YT0B 1V81A 1L7YA 2IO3B 3NVZA 4EKUA 1CZPA 3EUB2 3RD2A 4FXCA 2LASA 4W9EA 1V6EA 1V86A 2XEWA 1RWSA 4HPMB 3P1MA 3I9V1 1RLFA 2PW9A 1G6JA 4WWNA 3NZSA 4LTUA 2IO0B 2Y5CA 4KDIC 4HKQA 1SIJA 3A1QB 1WJ6A 2JY6A 3ZW3A 3ZGZA 5AUKA 1HTOA 3OJ4B 3ZNZB 4HDOA 1ZE3D 1SE3A 2AWTA 3VUWA 4ARIA 1JWMD 3NS8A 1D3ZA 2L1AA 3P4PB 1F9JA 1M4VA 3DQVA 2M1MA 4W9DA 5KHQA 4I6PA 3DWGC 3ZJTA 1QOBA 2ZNVB 4NAMA 4OVZA 3V3XA 3U52E 1TKEA 4A55A 2L32A 2LUMA 4IM2A 3AEDB 3KUDB 4RGMA 1FEHA 1WGDA 4HROA 3W1YA 1MPEA 1F77A 3RNBC 2PVGC 2RDGA 4GIVA 2BB5A 5H92C 1TT5B 3W5VB 5HG2A 2DZMA 4II2B 1E7UA 2WXFA 3DVNV 3KH0A 4PS7A 3M63B 1PGXA 1UD7A 1FMAD 1KFYB 3V05A 2DAFA 2GRIA 3VRAB 3VTVA 2JZ3B 1C4PA 2FCQA 1XO3A 4GDKB 2VZKD 3ML8A 1UELA 2JZPA 3QC8B 3KQ4A 2GBRA 2ZEQA 3TJPA 3QK0A 2LJ5A 1YOVB 2DZJA 4WH4A 3P2BA 4JPSA 2G9HD 4KGSA 3DBRB 1EU4A 3ZXRA 4YTMB 1TS3A 1N61A 1J7BA 2KN4A 3PZ7A 1OFFA 3DBLI 2RDHA 1L0XB 2KHWB 2W82A 2KT7A 1TKYA 4DQOC 2OEDA 3DBHB 2AQ1B 1WGRA 4BVUC 3KWVA 1DOXA 4MELA 4ICVA 4ANXA 3W1SC 3AE4B 2IGGA 2AYOB 3OJ3A 1JROA 2WS3B 1EF5A 3WAMA 3APCA 1Z2MA 2L05A 2BWFA 5JZEB 3ALBA 1E8YA 2JU6X 3DVGY 4IC7B 3VXWA 4Q2JA 3W1SA 4B95A 5D6JB 3ZJUA 3HVDA 3IHPC 3ZNGC 1IYFA 3SFEB 1I4PA 1I7HA 2KDEB 3GZNB 3AN1A 5FR6A 4FJYA 2W3RA 1MHXA 1NYQA 2ZW1A 3P42A 4NQLB 4WJNA 2A5UA 5KHOA 1VZ7A 3BYTB 4HWIB 4AUQC 1JALA 2WXNA 5IKCM 3HM3A 2O6VD 4ACFA 1N5XA 1IGCA 2KOXA 3PRZA 4K3BA 3RNGC 2IGHA 3EA6A 2AQ3B 1ZDXA 1VDVA 1V2YA 3OLMD 4DXFA 2FAZA 1L0VB 2EKIA 2KMAA 2I1KA 3A9JA 5J17A 4X57B 2N1VA 1F1HA 5DPTA 3AU5A 2BVCA 3LXFA 2JF5A 1E90A 2KDIA 4YTNB 3RUIB 1GC6A 2YVCA 3IAS1 4NAWB 1I42A 1C79A 3DDCB 3R2IA 2NTSA 2KFKB 4XWWA 1T0QC 4MSMB 5LNK1 3QQ8B 1FCLA 1XCQL 5HI1A 4AOFA 1ZUD2 2QEJC 2WXKA 3UIPB 4HDQA 3WANA 4FA6A 1J19A 4JE3B 2J52A 2V3PA 3DCGA 1KH0A 3GE8C 1WMHB 5D3DA 4HCNB 4F8CB 1NEKB 3P4QB 4MGKE 1SB3C 3IT6B 3L08A 2GB1A 1JCKB 2INNE 2K25A 2LZ6A 1JWBD 1QOAA 4DK5A 2PLPA 4E71A 3T3NA 3ZNHB 4K81A 4ZRJA 2KNBA 3H1UA 4JWUC 2HD5B 1FNVA 4BKGA 1KLVA 1H4RA 4GGQA 5C2TB 3ZKJC 1FCCC 5JHBA 1A5RA 2CS4A 4W9GA 1HE8A 2BKFA 2L7RA 1GB4A 2KQSA 4WURA 3VDZA 1OEYA 2KQ4X 3AE3B 3H7SA 1R4NB 3AE7B 3AULA 1KLUD 5EDSA 4OHJA 2JRIB 1STEA 3RNAC 1C78A 1ACCA 4GDLA 3AEFB 2K1FA 2W9NA 1RFAA 2INDC 1EWCA 4ZHPA 2C5LC 2L52A 5IO9A 5C1ZA 2MEKA 3R8BA 4G11A 5DPRA 5G5HA 3I5JC 1E8ZA 1IP9A 2MP2A 2D5GA 4JGHB 4DDID 4FJZA 1WH3A 1KTKA 5BYSA 3D32A 1ZPSA 2KX0A 1OQYA 2HTHA 4WAAA 3MP9A 1S3SG 3MHZA 4M01A 3PVLA 1WX8A 2WX0A 1D4BA 4HCPB 2ZNVC 4BOSC 3HK0A 2RD0A 3A1QA 2N0SB 1MFWA 3ZIMA 1A70A 2IY0B 4KV2A 1KOTA 3S2AA 2JUOA 5AEKB 1WI0A 4RGTA 1KF6B 1VZ8A 2D3BA 4MEMA 2WDQB 4LNKA 1CJEA 5H8YE 3RNFC 1EM7A 4WIPA 2WDTB 4GLSC 2ZW0A 2RR9A 1PUTA 1B1ZA 1JWSD 2XK5B 2BGFA 3PHXB 2VH1A 3T3OA 4KSKC 4ZRIA 2UWQA 3QHTA 3ZLZA 2NBWB 3ENEA 2O2VB 1I4QA 2OHFA 4M0WA 4JWSC 4FBJB 2QDFA 4XGAB 2WX1A 4MGYE 4MM3B 2BS3B 2IO1B 3FILB 3CSFA 2LUEA 1ZW7A 1UZXB 3RMKC 1WXSA 3VFKA 1AWDA 1PGBA 4A20A 2WXIA 3C19A 2WXMA 2NCNA 3A4SC 4XX5A 1V5TA 1ZOYB 1N63A 2KAJA 5LLIA 4GDKA 1E6EB 3TUOA 1TYGB 4YWGG 2WXOA 1FM0D 3N3KB 1ZGUB 4KIKB 5FKAC 3Q6BA 4FLHA 2JPHA 5CHVC 2M0XA 4KDLB 4US9A 1SEBD 4A8XC 4DBGA 2JWUA 1ZP0B 2IZVB 3VUYA 2OJRA 5EE9A 4AP4C 3P4RB 1I4HA 1JMLA 1WGHA 2FIDA 2M17A 2HTME 2RDBC 4A3PA 4JX1C 2E3TA 2VZKB 3L10B 3RFZB 3PTFC 4XYCA 3AEGB 3QA8A 3P63A 2G1EA 5E6PA 3Q8EA 1WWTA 4P16A 3PT2B 1XLOA 1L4DB 1WSPA 2CKHB 1PGAA 3NS1A 4M02A 4RMAA 3APDA 3NZ3A 4K7SA 3WCQA 1OTRB 3KUCB 1IUEA 4MH8A 2N7DA 2KC1A 2DLBA 2K22A 3RPFC 2ICIA 1UF0A 4PK1A 1WRDB 2C7MB 3VHTC 3NVWA 1FD6A 1TS5A 3U8ZA 2OOBB 3V6EB 3DHIC 3W2DA 3A9KB 3DWMA 2I2YA 1Z5SB 3DBRI 2G3QB 1ROEA 2WXGA 3MC8A 1PQSA 3N1YC 3L13A 2PE9A 1HQRD 2NS5A 2D07B 1V49A 1XXGA 1LO5D 3AXCA 1XLQA 3RYTA 3PLUA 2MBHA 1UBIA 1WXMA 2N1WA 2QMTA 3MC9A 2CHZA 5DPSA 3M3JA 4WJOA 4DHJD 3SDLC 2FCMA 2MCNB 1TKGA 4LNFA 1T6BX 3FAHA 3PSEB 4ZRQA 2MQJA 2WGSA 3AE6B 4F7ZA 1V1PB 4ITKA 1L6UA 3VAWA 5D7GA 5JH5C 3LJ3A 3Q3MC 4LNOA 4UDUC 2O6VB 5I4DA 1ET9A 2LJIA 1WXVA 3BK2A 2FIFA 4TSSA 2AX5A 1GOZA 1EO6A 1E9MA 4NAWA 2J0KA 2X38A 1VJKA 3GZNI 4E3CA 1WJ4A 1CMXB 3U30A 2GI9A 4KKJA 3I57A 2KFKA 1D5ZC 3PLVA 1YMHE 4P6VF 1C3TA 5BMIA 4AJYB 2WXLA 2D3CA 1ENFA 2Z59B 3AEEB 3Q3NC 1TJEA 4IOIE 1CK1A 3ZRCA 3WIMA 3KVFB 1HA5A 3TL5A 2GLSA 2L83A 2E6XA 2DWQA 3AMZA 2BKRB 2DYOA 4NNJB 1KM7A 4GXBA 2LRUA 2WWZA 1BMLC 1WMHA 1XLPA 2CU3A 1Q0WB 4BKSA 2FUG1 1R4MB 2WU2B 5LXIB 3PRMB 2KVRA 1V1OA 4EZJA 2BF8B 1X1MA 3L4PA 2R2QA 4YTPB 1P0RA 3AM9A 3RZWC 2JSVX 3PGEA 2L76A 4C80A 4IKGA 4C56C 4W9HA 1T0RC 1EF1A 4GSWA 2GBJA 3AEAB 5L83A 3ZXVA 2PPHA 4RF0A 3VH4B 1NDDA 4OZCA 1SXTA 1U4AA 4II3B 2PKOA 2ZVOA 1P3QU 2MBOA 4K3CA 1QKZA 2AL6A 5IOIA 3ABVB 2B76B 3IFWB 4W9KA 2M8SA 1IBXB 2FCNA 1ET6A 1XF5L 2WXQA 3N20C 2KQ7A 5EE0A 3B1LX 2IY1B 4PYUA 1QQRA 3ZO5B 2HE7A 4EOYA 2RSUA 3DHGC 2V1YA 2ZZPB 3PV1A 3ETRA 2G4DB 2K39A 2JXTA 2PMVA 3BIID 2KTFA 4LLGM 4YL8A 3BY4B 4ZYSA 3PRPB 2JT4B 1FRRA 3IT4B 2LMCA 2FCSA 1JQ4A 2I38A 1MJDA 3HIZA 2NMQA 1AN8A 2J7QB 3AI5A 1R4NI 1WR1A 3IXSA 5C3JB 2G45B 2MRPA 3Q8BA 3MC0B 3UI3A 1SE4A 3ONSA 3GP7A 1SGHA 1DOYA 1MI0A 3R66C 1WGKA 3JYUA 2XK5A 4W9IA 3FKYA 1DGJA 1FXTB 4RM9A 3DPDA 1FPYA 2O2VA 4TV3A 5CTRC 3UIOB 3V61A 3WAPA 1E10A 1J8CA 2K8HA 3NZUA 1TIFA 4IG7B 1RFKA 4IWPA 3VQIA 1S1QB 4HJKA 2GMIC 4MM3A 1P9DU
chains in the Genus database with same CATH topology
3DVGX 2J0JA 4GDLA 4GU2A 5AZHA 3EFUA 2KFJA 2M4NA 5D2MB 3TBLD 5HKHA 2K1FA 2W9NA 2D11A 2YLMA 1RFAA 2N9XA 2HJ8A 2N9EB 3H9DA 4DXAB 4M8NA 2C5LC 4TKNA 5C1ZA 2IYDB 3V62A 1WY8A 1OGWA 3QJZA 4P7IA 4G11A 1V80A 5DPRA 2NR2A 2K8BA 5C23A 4K1RB 1WE6A 3GOEA 1E8ZA 1IP9A 3K9PB 2MP2A 4CHKA 4JGHB 4NPNA 3CF6E 3I3TB 4DDID 3L54A 1LM8B 4FJZA 4HK2A 4M0WB 1WH3A 2KK8A 2KJRA 2KLGA 3VH3B 5J18A 2K6DB 3D32A 5GMVA 2KX0A 1OQYA 4BBNC 4HXDA 2EMSA 2HTHA 4PS8A 4WAAA 4ZYNA 1Q1OA 1GNUA 3KYDD 1S3SG 2KANA 3ZDMC 3SU8X 4EZLA 1J0GA 1XT9B 2MWSB 1E8XA 1WX8A 3PVLA 2WX0A 4PYZA 2XBBC 2LVOA 3IBEA 4HCPB 3KW5B 4KIKA 5IAAC 4XZ4A 2ZPNA 5E6OA 2ZNVC 4BOSC 3HK0A 2RD0A 3A1QA 4EEWA 3ZIMA 4B6WA 3HHMA 4K7UA 2MSED 3NOBA 4F1SA 3ZRFA 2IY0B 5LXHA 4KV2A 2Z0EB 3S2AA 2L0TA 2G4SA 2JUOA 3N30A 5AEKB 1KOTA 1WI0A 2WYQA 3R7QA 4HPLB 2LI5A 4DWFA 1YD8U 2MBBB 2RGFA 4MEMA 1T0YA 2KD0A 4DHZB 1WM2A 2V4LA 4BKTA 2ZJDA 1P98A 1YJ1A 1YX5B 3HM6X 1I35A 4FJVB 2KN5A 2WDTB 3SHQA 1VD2A 2RR9A 2PE6B 3M95A 3UGBB 2PJHA 4AJWA 2XK5B 2BGFA 1WM3A 3PHXB 1LXDA 2BYVE 2NBUA 4JL9A 4WJQA 4KSKC 4ZRIA 2UWQA 3M62B 2MW5A 2IBIB 3QHTA 3DOWA 3ZLZA 1WF9A 1QZEA 4CO7A 5L95C 2CR5A 2V3SA 2NBWB 3CMMB 3ENEA 2O2VB 1LQBA 1UGMA 4FBJB 5DCNA 4JLCA 2KTRA 2KX3A 2RPQA 4JQWC 2WX1A 2KC2A 4MSQB 3WAOA 3VTWA 1L2NA 4URKA 4MGYE 4BBNF 3RZFA 2KMCA 4GDLB 3QAQA 2IO1B 2LXCA 4ZRKA 2CHXA 3CSFA 2LUEA 4XC2A 1ZW7A 2NPTA 1UZXB 1WXSA 2KXJA 2B3AA 3VFKA 2DHZA 3H7PA 4FULA 1V81A 3L0WB 1L7YA 4A20A 2IO3B 4EKUA 2KZRA 4I6NB 1WX9A 4G0NB 3RD2A 4W9EA 2LASA 3A9KA 3L16A 1V6EA 2LXAA 4A3OA 1V86A 2XEWA 2NCNA 4HPMB 3A4SC 4IUMB 4XX5A 4W9CA 2L3ZA 1V5TA 2DENB 5LLIA 2DYMA 4GDKA 1RLFA 4IM0A 4TUUA 2EKEC 4WWOA 1G6JA 1OEYJ 4GN1A 5IA7A 2A4ZA 4WWNA 3NZSA 4JIOU 2ZVNA 1WYWB 3ZDTA 4AWJA 2IO0B 3N3KB 1ZGUB 4KIKB 4KDIC 4FLHA 2JPHA 2JXXA 3A1QB 3NHEB 1TTNA 1WJ6A 2M0XA 4KDLB 5CHVC 1MG8A 2JY6A 3ZW3A 4DBGA 4NQKE 1E5WA 2D10A 3OJ4B 3ZNZB 4HDOA 3VUWA 2AWTA 4FADA 3NS8A 3JVZX 1D3ZA 2KWUB 2D3GA 1F9JA 2KJ6A 2Y5BB 1P1AA 2M1MA 3DQVA 2IZVB 4W9DA 3TCAA 3VUYA 1GG3A 2GOWA 3MJWA 4I6PA 3ZTCA 5KHQA 2OJRA 4AP4C 4KZCA 4MGZE 4EUTA 2EMTA 2AL3A 1RAXA 1WGHA 2FIDA 1TZ1A 2M17A 3UINB 2MX2A 2ZNVB 4A3PA 3WALA 4IM2A 3L10B 2DZIA 3PTFC 3KUDB 3PPAA 2O6VA 1NI2A 1V9JA 3QA8A 1VCBA 1WGDA 3QWZB 5E6PA 2JWZA 4NJ7A 3MHSD 3PT2B 3W1YA 5DPWA 3JSVA 3L17A 2CHWA 4EFOA 2K8CA 2CKHB 2QHOA 4MH0E 4RMAA 2KWCA 4ANVA 5AZGA 3APDA 3QARA 2KTRB 1GUAB 4K7SA 1WZ3A 3EECA 4DHJB 1OTRB 3KUCB 3RT3B 4MJSA 4GIVA 3QIJA 2N7DA 2KC1A 3EHVA 2PEAA 2LGDA 1K8RB 3AU4A 2NPTB 4BFRA 2MA9B 2DAJA 1UH6A 2DZMA 3H7PB 4WQOB 4ANUA 1WRDB 2C7MB 1M94A 3VHTC 3Q3JA 3NY5A 4II2B 1E7UA 3U8ZA 3DVNV 4IW0A 3KH0A 2OOBB 3V6EB 4PS7A 3M63B 1NBFC 3A9KB 1UD7A 3DVNU 2C7NB 2DAFA 3TIXA 5CHWA 2BYFA 1Z5SB 3DBRI 2G3QB 3VTVA 2JZ3B 3OAWA 1PQSA 2FCQA 2K6QA 2KO3A 3L13A 2PE9A 3PHWB 4GDKB 1V5OA 1WGYA 2NS5A 2JZZA 2D07B 1V49A 2ZCBA 2GBKA 1C1YB 4J6IA 4TQ1A 1XQQA 3ML8A 3AXCA 1UELA 3QC8B 3QX1A 5CHFA 1GC7A 2GBRA 2ZEQA 3TJPA 3RYTA 3A33B 3QK0A 3PLUA 2MBHA 2LJ5A 1UBIA 1WXMA 2DZJA 3P2BA 2N1WA 1WFYA 2CHZA 5DPSA 1ISNA 3M3JA 4WJOA 2C60A 1WR6E 4DHJD 3SDLC 2FCMA 3DBLI 2MCNB 4CYEA 3PSEB 2KHWB 4LCDE 2MQJA 3TMPB 3VUXA 4F7ZA 2LGYA 3B08A 2JVCA 2LVQA 3K9OB 3VAWA 2N7EA 5D7GA 2Z0DB 5JH5C 1WGRA 3LJ3A 3V60A 3R7RA 4KSLC 4BVUC 2O6VB 1WXVA 4MELA 4G50A 2FIFA 2VRRB 4ICVA 1EO6A 4ANXA 4WJPA 3JSVB 3T8MA 3W1SC 4NAWA 2J0KA 3GZNI 2AYOB 1RRBA 3OJ3A 4E3CA 1WZ0A 3KYCD 3U7DA 1WJ4A 1CMXB 3U30A 1EF5A 3V6CB 2MBEA 4MJSB 3WAMA 2L00B 3APCA 1Z2MA 2KFKA 2L05A 3PLVA 4M8MA 4TQ0A 3T9LA 2BWFA 5JZEB 1C3TA 3ZNID 3ALBA 1E8YA 2LD9A 3DVGY 4IC7B 3VXWA 1GJZA 2LVPA 2DX5B 4AJYB 2R2OA 3W1SA 2Z59B 3ZVVA 4B95A 5D6JB 1YX6B 3UF8A 3B0AA 2DZKA 3ZRCA 1WE7A 3IHPC 3WIMA 3KVFB 1WX7A 3ZNGC 1IYFA 3N32A 2KDEB 3TL5A 5FR6A 2KKCA 4FJYA 5TR5A 4HLEA 5J2RA 2ZPYA 3ZUNA 4BOZB 2BPSA 4E74A 2BKRB 2DYOA 4NQLB 2IO2B 4NNJB 1KM7A 4GXBA 2LRUA 2L0FA 4WJNA 2A5UA 1WMHA 2WWZA 5KHOA 3R3MA 4HWIB 4AUQC 3CSTA 1Q0WB 3HM3A 1E7VA 2O6VD 4FHKA 1WJUA 4IWQA 4GOCA 4MDKE 4W9FA 3WA0A 4BKSA 4KVGB 4BKSD 2LGXA 4OVUA 5LXIB 2KOXA 3PRZA 3PRMB 2KVRA 3C0RB 3UQAA 4EZJA 3VTUA 2BF8B 1X1MA 4ASWC 4WWPA 3IG3A 4B9KA 2R2QA 2FNJB 1P0RA 3BINA 3RZWC 1V2YA 3OLMD 2FAZA 1KJTA 3PGEA 2L76A 2KMAA 3EC8A 2I1KA 2I1JA 3A9JA 5J17A 4W9HA 4HVBA 4X57B 2N1VA 5DPTA 4EZKA 3AU5A 4G3XB 1XD3B 1EF1A 4GSWA 2GBJA 4GB9A 3PZDA 3H6NA 2JF5A 1E90A 2KDIA 5L83A 3RUIB 2PPHA 1GC6A 3O65B 2YVCA 4FHJA 4I6LB 3VH4B 3LDZE 1Q5WB 1NDDA 3ECIA 4NAWB 1I42A 5G2NA 4LDTB 3RCZA 3RULA 2DYBA 3DDCB 1U4AA 4K7WA 4II3B 2ZVOA 5JHAA 1P3QU 2MBOA 5E6NA 2KFKB 2AL6A 3DBHI 3ML9A 3JW0X 2MBQA 3IFWB 4W9KA 3IVFA 5BO4B 3VVWB 4MSMB 3X0WA 4OVVA 4LJOB 4ANWA 2M8SA 2N9PC 4IM3A 3QQ8B 2FCNA 1E8WA 4N9F4 4AOFA 2C9WB 4ZDVA 4PS3A 2BWES 1WIAA 1ZKHA 2KJHB 4GMVA 2KQ7A 4W9LA 4NY0A 3B1LX 2IY1B 1SIFA 2LRWA 2MLBA 3SD5A 4PYUA 4DDGD 2NBVB 3ZO5B 3KUZA 2KDFB 2J0MA 4NJ6A 3UIPB 2HE7A 4EOYA 2RSUA 3MTNB 1JRUA 1UBQA 2V1YA 4HDQA 3DBSA 5D94A 2ZZPB 3WANA 4ICUA 4RM8A 2C7HA 1J19A 2FUHB 3PV1A 2ASQA 4FA6A 4W9JA 3DCGA 2KLCA 1WMHB 1TBEA 2G4DB 2K39A 3UQBA 4HCNB 4F8CB 2D2QA 2ZCCA 5CX3A 2CU1A 4MGKE 2KTFA 3L08A 1IPGA 3PREA 1WGGA 2L8JA 3BY4B 4KZ0A 4YL8A 1H8CA 2K25A 2LZ6A 3APFA 3PRPB 4IWOA 2JT4B 4DK5A 2GBMA 1YQBA 2FCSA 4LDTD 1EUVB 4E71A 2KWVB 2JRHA 3A4RA 3PS6A 1BT0A 3HIZA 3AI5A 3ZNHB 2J7QB 4K81A 1AARA 3Q3FA 4ZRJA 5AZFA 2KNBA 1R4NI 1WR1A 3ZTDA 3H1UA 4LJPB 3A9JB 3QCAA 2UYZB 2G45B 1Y8RC 2MP2B 2MRPA 2HD5B 3X23A 5G55A 4MGIE 3ONSA 4BKGA 1SGHA 2GBNA 1YIWA 4FN2A 3R66C 1R4MI 3JYUA 2AEHA 1WJNA 1KLVA 1H4RA 4GGQA 3ZKJC 5JHBA 1A5RA 2XK5A 2CS4A 1TGZB 4W9GA 1HE8A 2LWPA 2BKFA 4W9IA 2L7RA 2KDBA 1SE9A 2KQSA 2BYEA 3VDZA 1FXTB 4RM9A 3DPDA 1LFDA 1OEYA 2O2VA 3H7SA 3AULA 4TV3A 5EDSA 5CTRC 3UIOB 3V61A 2REXA 3WAPA 1J8CA 2K8HA 4DHZE 3NZUA 2JRIB 1WXAA 4IG7B 4IWPA 3VQIA 1S1QB 4HJKA 2GMIC 4MM3A 1P9DU 2NVUI 2N4FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DVG X;  2J0J A;  4GDL A;  4GU2 A;  5AZH A;  3EFU A;  2KFJ A;  2M4N A;  5D2M B;  3TBL D;  5HKH A;  2K1F A;  2W9N A;  2D11 A;  2YLM A;  1RFA A;  2N9X A;  2HJ8 A;  2N9E B;  3H9D A;  4DXA B;  4M8N A;  2C5L C;  4TKN A;  5C1Z A;  2IYD B;  3V62 A;  1WY8 A;  1OGW A;  3QJZ A;  4P7I A;  4G11 A;  1V80 A;  5DPR A;  2NR2 A;  2K8B A;  5C23 A;  4K1R B;  1WE6 A;  3GOE A;  1E8Z A;  1IP9 A;  3K9P B;  2MP2 A;  4CHK A;  4JGH B;  4NPN A;  3CF6 E;  3I3T B;  4DDI D;  3L54 A;  1LM8 B;  4FJZ A;  4HK2 A;  4M0W B;  1WH3 A;  2KK8 A;  2KJR A;  2KLG A;  3VH3 B;  5J18 A;  2K6D B;  3D32 A;  5GMV A;  2KX0 A;  1OQY A;  4BBN C;  4HXD A;  2EMS A;  2HTH A;  4PS8 A;  4WAA A;  4ZYN A;  1Q1O A;  1GNU A;  3KYD D;  1S3S G;  2KAN A;  3ZDM C;  3SU8 X;  4EZL A;  1J0G A;  1XT9 B;  2MWS B;  1E8X A;  1WX8 A;  3PVL A;  2WX0 A;  4PYZ A;  2XBB C;  2LVO A;  3IBE A;  4HCP B;  3KW5 B;  4KIK A;  5IAA C;  4XZ4 A;  2ZPN A;  5E6O A;  2ZNV C;  4BOS C;  3HK0 A;  2RD0 A;  3A1Q A;  4EEW A;  3ZIM A;  4B6W A;  3HHM A;  4K7U A;  2MSE D;  3NOB A;  4F1S A;  3ZRF A;  2IY0 B;  5LXH A;  4KV2 A;  2Z0E B;  3S2A A;  2L0T A;  2G4S A;  2JUO A;  3N30 A;  5AEK B;  1KOT A;  1WI0 A;  2WYQ A;  3R7Q A;  4HPL B;  2LI5 A;  4DWF A;  1YD8 U;  2MBB B;  2RGF A;  4MEM A;  1T0Y A;  2KD0 A;  4DHZ B;  1WM2 A;  2V4L A;  4BKT A;  2ZJD A;  1P98 A;  1YJ1 A;  1YX5 B;  3HM6 X;  1I35 A;  4FJV B;  2KN5 A;  2WDT B;  3SHQ A;  1VD2 A;  2RR9 A;  2PE6 B;  3M95 A;  3UGB B;  2PJH A;  4AJW A;  2XK5 B;  2BGF A;  1WM3 A;  3PHX B;  1LXD A;  2BYV E;  2NBU A;  4JL9 A;  4WJQ A;  4KSK C;  4ZRI A;  2UWQ A;  3M62 B;  2MW5 A;  2IBI B;  3QHT A;  3DOW A;  3ZLZ A;  1WF9 A;  1QZE A;  4CO7 A;  5L95 C;  2CR5 A;  2V3S A;  2NBW B;  3CMM B;  3ENE A;  2O2V B;  1LQB A;  1UGM A;  4FBJ B;  5DCN A;  4JLC A;  2KTR A;  2KX3 A;  2RPQ A;  4JQW C;  2WX1 A;  2KC2 A;  4MSQ B;  3WAO A;  3VTW A;  1L2N A;  4URK A;  4MGY E;  4BBN F;  3RZF A;  2KMC A;  4GDL B;  3QAQ A;  2IO1 B;  2LXC A;  4ZRK A;  2CHX A;  3CSF A;  2LUE A;  4XC2 A;  1ZW7 A;  2NPT A;  1UZX B;  1WXS A;  2KXJ A;  2B3A A;  3VFK A;  2DHZ A;  3H7P A;  4FUL A;  1V81 A;  3L0W B;  1L7Y A;  4A20 A;  2IO3 B;  4EKU A;  2KZR A;  4I6N B;  1WX9 A;  4G0N B;  3RD2 A;  4W9E A;  2LAS A;  3A9K A;  3L16 A;  1V6E A;  2LXA A;  4A3O A;  1V86 A;  2XEW A;  2NCN A;  4HPM B;  3A4S C;  4IUM B;  4XX5 A;  4W9C A;  2L3Z A;  1V5T A;  2DEN B;  5LLI A;  2DYM A;  4GDK A;  1RLF A;  4IM0 A;  4TUU A;  2EKE C;  4WWO A;  1G6J A;  1OEY J;  4GN1 A;  5IA7 A;  2A4Z A;  4WWN A;  3NZS A;  4JIO U;  2ZVN A;  1WYW B;  3ZDT A;  4AWJ A;  2IO0 B;  3N3K B;  1ZGU B;  4KIK B;  4KDI C;  4FLH A;  2JPH A;  2JXX A;  3A1Q B;  3NHE B;  1TTN A;  1WJ6 A;  2M0X A;  4KDL B;  5CHV C;  1MG8 A;  2JY6 A;  3ZW3 A;  4DBG A;  4NQK E;  1E5W A;  2D10 A;  3OJ4 B;  3ZNZ B;  4HDO A;  3VUW A;  2AWT A;  4FAD A;  3NS8 A;  3JVZ X;  1D3Z A;  2KWU B;  2D3G A;  1F9J A;  2KJ6 A;  2Y5B B;  1P1A A;  2M1M A;  3DQV A;  2IZV B;  4W9D A;  3TCA A;  3VUY A;  1GG3 A;  2GOW A;  3MJW A;  4I6P A;  3ZTC A;  5KHQ A;  2OJR A;  4AP4 C;  4KZC A;  4MGZ E;  4EUT A;  2EMT A;  2AL3 A;  1RAX A;  1WGH A;  2FID A;  1TZ1 A;  2M17 A;  3UIN B;  2MX2 A;  2ZNV B;  4A3P A;  3WAL A;  4IM2 A;  3L10 B;  2DZI A;  3PTF C;  3KUD B;  3PPA A;  2O6V A;  1NI2 A;  1V9J A;  3QA8 A;  1VCB A;  1WGD A;  3QWZ B;  5E6P A;  2JWZ A;  4NJ7 A;  3MHS D;  3PT2 B;  3W1Y A;  5DPW A;  3JSV A;  3L17 A;  2CHW A;  4EFO A;  2K8C A;  2CKH B;  2QHO A;  4MH0 E;  4RMA A;  2KWC A;  4ANV A;  5AZG A;  3APD A;  3QAR A;  2KTR B;  1GUA B;  4K7S A;  1WZ3 A;  3EEC A;  4DHJ B;  1OTR B;  3KUC B;  3RT3 B;  4MJS A;  4GIV A;  3QIJ A;  2N7D A;  2KC1 A;  3EHV A;  2PEA A;  2LGD A;  1K8R B;  3AU4 A;  2NPT B;  4BFR A;  2MA9 B;  2DAJ A;  1UH6 A;  2DZM A;  3H7P B;  4WQO B;  4ANU A;  1WRD B;  2C7M B;  1M94 A;  3VHT C;  3Q3J A;  3NY5 A;  4II2 B;  1E7U A;  3U8Z A;  3DVN V;  4IW0 A;  3KH0 A;  2OOB B;  3V6E B;  4PS7 A;  3M63 B;  1NBF C;  3A9K B;  1UD7 A;  3DVN U;  2C7N B;  2DAF A;  3TIX A;  5CHW A;  2BYF A;  1Z5S B;  3DBR I;  2G3Q B;  3VTV A;  2JZ3 B;  3OAW A;  1PQS A;  2FCQ A;  2K6Q A;  2KO3 A;  3L13 A;  2PE9 A;  3PHW B;  4GDK B;  1V5O A;  1WGY A;  2NS5 A;  2JZZ A;  2D07 B;  1V49 A;  2ZCB A;  2GBK A;  1C1Y B;  4J6I A;  4TQ1 A;  1XQQ A;  3ML8 A;  3AXC A;  1UEL A;  3QC8 B;  3QX1 A;  5CHF A;  1GC7 A;  2GBR A;  2ZEQ A;  3TJP A;  3RYT A;  3A33 B;  3QK0 A;  3PLU A;  2MBH A;  2LJ5 A;  1UBI A;  1WXM A;  2DZJ A;  3P2B A;  2N1W A;  1WFY A;  2CHZ A;  5DPS A;  1ISN A;  3M3J A;  4WJO A;  2C60 A;  1WR6 E;  4DHJ D;  3SDL C;  2FCM A;  3DBL I;  2MCN B;  4CYE A;  3PSE B;  2KHW B;  4LCD E;  2MQJ A;  3TMP B;  3VUX A;  4F7Z A;  2LGY A;  3B08 A;  2JVC A;  2LVQ A;  3K9O B;  3VAW A;  2N7E A;  5D7G A;  2Z0D B;  5JH5 C;  1WGR A;  3LJ3 A;  3V60 A;  3R7R A;  4KSL C;  4BVU C;  2O6V B;  1WXV A;  4MEL A;  4G50 A;  2FIF A;  2VRR B;  4ICV A;  1EO6 A;  4ANX A;  4WJP A;  3JSV B;  3T8M A;  3W1S C;  4NAW A;  2J0K A;  3GZN I;  2AYO B;  1RRB A;  3OJ3 A;  4E3C A;  1WZ0 A;  3KYC D;  3U7D A;  1WJ4 A;  1CMX B;  3U30 A;  1EF5 A;  3V6C B;  2MBE A;  4MJS B;  3WAM A;  2L00 B;  3APC A;  1Z2M A;  2KFK A;  2L05 A;  3PLV A;  4M8M A;  4TQ0 A;  3T9L A;  2BWF A;  5JZE B;  1C3T A;  3ZNI D;  3ALB A;  1E8Y A;  2LD9 A;  3DVG Y;  4IC7 B;  3VXW A;  1GJZ A;  2LVP A;  2DX5 B;  4AJY B;  2R2O A;  3W1S A;  2Z59 B;  3ZVV A;  4B95 A;  5D6J B;  1YX6 B;  3UF8 A;  3B0A A;  2DZK A;  3ZRC A;  1WE7 A;  3IHP C;  3WIM A;  3KVF B;  1WX7 A;  3ZNG C;  1IYF A;  3N32 A;  2KDE B;  3TL5 A;  5FR6 A;  2KKC A;  4FJY A;  5TR5 A;  4HLE A;  5J2R A;  2ZPY A;  3ZUN A;  4BOZ B;  2BPS A;  4E74 A;  2BKR B;  2DYO A;  4NQL B;  2IO2 B;  4NNJ B;  1KM7 A;  4GXB A;  2LRU A;  2L0F A;  4WJN A;  2A5U A;  1WMH A;  2WWZ A;  5KHO A;  3R3M A;  4HWI B;  4AUQ C;  3CST A;  1Q0W B;  3HM3 A;  1E7V A;  2O6V D;  4FHK A;  1WJU A;  4IWQ A;  4GOC A;  4MDK E;  4W9F A;  3WA0 A;  4BKS A;  4KVG B;  4BKS D;  2LGX A;  4OVU A;  5LXI B;  2KOX A;  3PRZ A;  3PRM B;  2KVR A;  3C0R B;  3UQA A;  4EZJ A;  3VTU A;  2BF8 B;  1X1M A;  4ASW C;  4WWP A;  3IG3 A;  4B9K A;  2R2Q A;  2FNJ B;  1P0R A;  3BIN A;  3RZW C;  1V2Y A;  3OLM D;  2FAZ A;  1KJT A;  3PGE A;  2L76 A;  2KMA A;  3EC8 A;  2I1K A;  2I1J A;  3A9J A;  5J17 A;  4W9H A;  4HVB A;  4X57 B;  2N1V A;  5DPT A;  4EZK A;  3AU5 A;  4G3X B;  1XD3 B;  1EF1 A;  4GSW A;  2GBJ A;  4GB9 A;  3PZD A;  3H6N A;  2JF5 A;  1E90 A;  2KDI A;  5L83 A;  3RUI B;  2PPH A;  1GC6 A;  3O65 B;  2YVC A;  4FHJ A;  4I6L B;  3VH4 B;  3LDZ E;  1Q5W B;  1NDD A;  3ECI A;  4NAW B;  1I42 A;  5G2N A;  4LDT B;  3RCZ A;  3RUL A;  2DYB A;  3DDC B;  1U4A A;  4K7W A;  4II3 B;  2ZVO A;  5JHA A;  1P3Q U;  2MBO A;  5E6N A;  2KFK B;  2AL6 A;  3DBH I;  3ML9 A;  3JW0 X;  2MBQ A;  3IFW B;  4W9K A;  3IVF A;  5BO4 B;  3VVW B;  4MSM B;  3X0W A;  4OVV A;  4LJO B;  4ANW A;  2M8S A;  2N9P C;  4IM3 A;  3QQ8 B;  2FCN A;  1E8W A;  4N9F 4;  4AOF A;  2C9W B;  4ZDV A;  4PS3 A;  2BWE S;  1WIA A;  1ZKH A;  2KJH B;  4GMV A;  2KQ7 A;  4W9L A;  4NY0 A;  3B1L X;  2IY1 B;  1SIF A;  2LRW A;  2MLB A;  3SD5 A;  4PYU A;  4DDG D;  2NBV B;  3ZO5 B;  3KUZ A;  2KDF B;  2J0M A;  4NJ6 A;  3UIP B;  2HE7 A;  4EOY A;  2RSU A;  3MTN B;  1JRU A;  1UBQ A;  2V1Y A;  4HDQ A;  3DBS A;  5D94 A;  2ZZP B;  3WAN A;  4ICU A;  4RM8 A;  2C7H A;  1J19 A;  2FUH B;  3PV1 A;  2ASQ A;  4FA6 A;  4W9J A;  3DCG A;  2KLC A;  1WMH B;  1TBE A;  2G4D B;  2K39 A;  3UQB A;  4HCN B;  4F8C B;  2D2Q A;  2ZCC A;  5CX3 A;  2CU1 A;  4MGK E;  2KTF A;  3L08 A;  1IPG A;  3PRE A;  1WGG A;  2L8J A;  3BY4 B;  4KZ0 A;  4YL8 A;  1H8C A;  2K25 A;  2LZ6 A;  3APF A;  3PRP B;  4IWO A;  2JT4 B;  4DK5 A;  2GBM A;  1YQB A;  2FCS A;  4LDT D;  1EUV B;  4E71 A;  2KWV B;  2JRH A;  3A4R A;  3PS6 A;  1BT0 A;  3HIZ A;  3AI5 A;  3ZNH B;  2J7Q B;  4K81 A;  1AAR A;  3Q3F A;  4ZRJ A;  5AZF A;  2KNB A;  1R4N I;  1WR1 A;  3ZTD A;  3H1U A;  4LJP B;  3A9J B;  3QCA A;  2UYZ B;  2G45 B;  1Y8R C;  2MP2 B;  2MRP A;  2HD5 B;  3X23 A;  5G55 A;  4MGI E;  3ONS A;  4BKG A;  1SGH A;  2GBN A;  1YIW A;  4FN2 A;  3R66 C;  1R4M I;  3JYU A;  2AEH A;  1WJN A;  1KLV A;  1H4R A;  4GGQ A;  3ZKJ C;  5JHB A;  1A5R A;  2XK5 A;  2CS4 A;  1TGZ B;  4W9G A;  1HE8 A;  2LWP A;  2BKF A;  4W9I A;  2L7R A;  2KDB A;  1SE9 A;  2KQS A;  2BYE A;  3VDZ A;  1FXT B;  4RM9 A;  3DPD A;  1LFD A;  1OEY A;  2O2V A;  3H7S A;  3AUL A;  4TV3 A;  5EDS A;  5CTR C;  3UIO B;  3V61 A;  2REX A;  3WAP A;  1J8C A;  2K8H A;  4DHZ E;  3NZU A;  2JRI B;  1WXA A;  4IG7 B;  4IWP A;  3VQI A;  1S1Q B;  4HJK A;  2GMI C;  4MM3 A;  1P9D U;  2NVU I;  2N4F A; 
#chains in the Genus database with same CATH topology
 1C77 A;  2FE8 A;  2N9L A;  1QIL A;  5D2M B;  3TBL D;  5HKH A;  2D11 A;  2YLM A;  2XNA C;  3AV8 A;  4M8N A;  3Q3O C;  4TKN A;  3SEB A;  3Q2A C;  1HXY D;  5AUI A;  3V62 A;  1WY8 A;  1V80 A;  1EWY C;  4K1R B;  4RH6 A;  1WE6 A;  4CHK A;  4NPN A;  2LEK A;  3CF6 E;  2KMM A;  2KJR A;  2K6D B;  1GAQ B;  4AS1 A;  5GMV A;  4BBN C;  2EMS A;  2EEL A;  1Q1O A;  1J0G A;  1XT9 B;  1E8X A;  2XBB C;  5TSS A;  4KIK A;  3KW5 B;  4EEW A;  1PYW D;  1DOI A;  1MVK A;  3RNC C;  3HHM A;  1SF0 A;  3NOB A;  3ZRF A;  2LHD A;  1GPX A;  4NJC A;  2WYQ A;  3R7Q A;  2WDV B;  3LYY A;  4H2A A;  3RNE C;  1T0Y A;  2KD0 A;  1C76 A;  2V4L A;  1YJ1 A;  3HM6 X;  1HTQ A;  3SHQ A;  3UGB B;  1WM3 A;  1L4Z B;  2BYV E;  2WLB A;  3M62 B;  2MW5 A;  2IBI B;  3DOW A;  1QZE A;  4CO7 A;  3CMM B;  1YN5 A;  4B0E A;  4YXD B;  4CQN A;  2PVO D;  2KX3 A;  4MSQ B;  1E0Z A;  3E9S A;  2KMC A;  1PFD A;  3QAQ A;  2LXC A;  1PDX A;  2CHX A;  4XC2 A;  2B3A A;  3BZD B;  4FUL A;  2X8X X;  1N6Z A;  4N58 A;  1WX9 A;  4G0N B;  1LGR A;  3A9K A;  2INC C;  3L16 A;  1DYQ A;  2LXA A;  1SSN A;  4A3O A;  3B9J A;  3NJT A;  4IUM B;  4W9C A;  2L3Z A;  5FK9 C;  2DEN B;  2DYM A;  4IM0 A;  4GN1 A;  1KLG D;  2A4Z A;  4JIO U;  3GE3 C;  1WYW B;  3ZDT A;  1JWA D;  2LGI A;  3U4E G;  1IGD A;  2JXX A;  4NQK E;  1E5W A;  2D10 A;  1ZXI A;  1FNW A;  4FAD A;  3JVZ X;  2D3G A;  4A90 A;  3TCA A;  2Y5B B;  1P1A A;  2GOW A;  4MGZ E;  4EUT A;  2EMT A;  3Q8F A;  3MFG A;  3UIN B;  1V1P A;  2FBW B;  5T8I A;  4RNA A;  1N60 A;  2O6V A;  1NI2 A;  2WDR B;  1V9J A;  1VCB A;  2JWZ A;  4R3D A;  3MHS D;  1UGJ A;  3L17 A;  2QHO A;  1SBB B;  2KTR B;  1GUA B;  2V3N A;  2PIA A;  4DHJ B;  3RT3 B;  4USA A;  3N1Z C;  1UNS A;  3EHV A;  3CIR B;  2XN9 C;  2LGD A;  3AU4 A;  3VRB B;  2NPT B;  4BFR A;  1AYF A;  2D3A A;  3H7P B;  1M94 A;  3N1X C;  4IW0 A;  4MT5 A;  4XDD A;  3RI7 C;  1NBF C;  1JW9 D;  2C7N B;  3DVN U;  2H89 B;  2BYF A;  1I4R A;  3AB5 A;  4HEA 1;  1NI3 A;  2BS2 B;  2ZCB A;  2GBK A;  1XQQ A;  2QJL A;  3QX1 A;  5CHF A;  3GB1 A;  1XLN A;  1OQQ A;  3A33 B;  1QOG A;  3FC4 A;  2SAK A;  3H8H A;  4WAF A;  1HEZ E;  1ISN A;  2NTT A;  2C60 A;  3Q8C A;  1WR6 E;  2V9H A;  5MPO A;  1TY0 A;  3VUX A;  2JVC A;  2N7E A;  2BTE A;  1F52 A;  3R7R A;  2V0G A;  2WXH A;  3JSV B;  3T8M A;  1OQR A;  3BYY B;  1RRB A;  3CWI A;  1WZ0 A;  3U7D A;  1V97 A;  2WP9 B;  4MJS B;  2L00 B;  3AEB B;  1FXI A;  1HZ5 A;  4M8M A;  1JWU D;  2J42 A;  2WQY B;  3ZNI D;  1GJZ A;  1TZO A;  3ZVV A;  3LB8 C;  1YX6 B;  3B0A A;  2DZK A;  2CJO A;  3KWL A;  2KKC A;  5TR5 A;  1RM6 C;  4HLE A;  5J2R A;  2BPS A;  4D2K A;  2IO2 B;  4KX6 B;  2RMM A;  3OG5 A;  4HKZ E;  1E7V A;  4FHK A;  4J3O D;  3WA0 A;  4GOC A;  1MHH E;  2HJ1 A;  4BKS D;  1P7E A;  1SE2 A;  3UQA A;  3SR6 A;  4ASW C;  4B9K A;  4P1C C;  3EC8 A;  1K50 A;  2WXR A;  1YQ4 B;  2VH2 A;  1C4A A;  1FNU A;  3AEC B;  2W3S A;  3PZD A;  1TS4 A;  4A9A A;  1Q10 A;  1R7S A;  3LDZ E;  1Q5W B;  2WXP A;  1L6V A;  1AW7 A;  4XDC A;  5G2N A;  3RCZ A;  4K7W A;  1L5P A;  3OWE B;  3NVY A;  2MJ3 A;  3DBH I;  3ML9 A;  3IVF A;  5BO4 B;  3VVW B;  4RCO A;  4LJO B;  4ANW A;  1N5W A;  2DNF A;  2IGD A;  1E8W A;  4N9F 4;  3VR8 B;  2QC8 A;  2BWE S;  4MAC A;  1YJI A;  4W9L A;  4NY0 A;  1SIF A;  2LRW A;  3SD5 A;  2DBY A;  3URY A;  4DDG D;  2WXJ A;  2WNM A;  4YSZ B;  3MTN B;  5D94 A;  1UBQ A;  3AE5 B;  3DBS A;  4RM8 A;  2FUH B;  3HRD D;  4W9J A;  2RPV A;  1QLB B;  2KLC A;  3UQB A;  2D2Q A;  1WXQ A;  2ZCC A;  4OZA A;  5CX3 A;  2CU1 A;  2IDY A;  1IPG A;  4NZL B;  2ONQ A;  3APF A;  1YJJ A;  3TSS A;  1HZ6 A;  4LDT D;  4RGN A;  1EUV B;  1FRD A;  3I63 C;  2KWV B;  1JRP A;  2Z8L A;  1BT0 A;  3C8Y A;  4C7Y A;  1V8C A;  5AZF A;  1FFV A;  2UYZ B;  3EGR A;  1F2R C;  2MP2 B;  3X23 A;  4MGI E;  1YIW A;  4FN2 A;  1B9R A;  1WJN A;  1TGZ B;  2LWP A;  4RF1 A;  1C4C A;  1SE9 A;  2BYE A;  1NYR A;  1LFD A;  2MJD A;  1EU3 A;  2REX A;  1FXA A;  3VR9 B;  4DHZ E;  4C4V B;  1KRH A;  5BYR A;  2N4F A;  3DVG X;  2J0J A;  3Q8A A;  2M4N A;  2N9X A;  2HJ8 A;  3B2G A;  2BS4 B;  2IYD B;  1OGW A;  3QJZ A;  3GS2 A;  1D5X C;  5C23 A;  3NVV A;  3GOE A;  4US8 A;  3BVZ A;  3K9P B;  1UWX A;  3I3T B;  4LK0 M;  4HK2 A;  4M0W B;  1RYJ A;  3VH3 B;  2KLG A;  3TEY A;  4PS8 A;  4ZYN A;  3KYD D;  3ZDM C;  3SU8 X;  4O1N A;  1ESF A;  2MWS B;  2LVO A;  3B2F A;  4B6W A;  1F0Z A;  2K5P A;  2CJN A;  2Z0E B;  1F2R I;  2LHE A;  4HPL B;  4DWF A;  1YD8 U;  4P1B C;  2MBB B;  2RGF A;  1WM2 A;  2ZJD A;  1P98 A;  1YX5 B;  1I35 A;  2Y3A A;  4FJV B;  1FFU A;  1VD2 A;  2PE6 B;  3M95 A;  2TSS A;  2PJH A;  4AJW A;  5EE3 A;  2NBU A;  1I4X A;  4JL9 A;  2W54 A;  5L95 C;  4TMA B;  2V3S A;  3SFD B;  1UGM A;  5DCN A;  4JLC A;  2KTR A;  2RPQ A;  3WAO A;  3VTW A;  5IP4 D;  1L2N A;  4BBN F;  3RZF A;  1BXT A;  1J7A A;  3BVM A;  3DHH C;  1C9F A;  2NPT A;  3H7P A;  3L0W B;  4RGO S;  2KZR A;  4I6N B;  1ZDV A;  3AE9 B;  4REZ A;  4M00 A;  4TUU A;  1K52 A;  2EKE C;  4WWO A;  1OEY J;  5IA7 A;  4QAY A;  1N62 A;  2ZVN A;  4AWJ A;  4WQM A;  5EE1 A;  5DPW A;  3NHE B;  1TTN A;  1MG8 A;  3J9C A;  2KWU B;  1TY2 A;  2KJ6 A;  2ON8 A;  3ZTC A;  1GG3 A;  3MJW A;  4PT5 A;  3FIL A;  4KZC A;  2AL3 A;  1RAX A;  4DXG A;  1TZ1 A;  3ZQ4 A;  3U7Z A;  2MX2 A;  4N59 A;  3WAL A;  3E56 A;  2DZI A;  2N7J A;  4ZHO A;  3PPA A;  3QWZ B;  2M56 B;  2YEP F;  4NJ7 A;  1FO4 A;  3JSV A;  4EFO A;  2CHW A;  2K8C A;  3NUH B;  4MH0 E;  2KWC A;  3Q14 C;  4ANV A;  5AZG A;  3QAR A;  5BYQ A;  3W5U B;  2H88 B;  1WZ3 A;  3EEC A;  4HJG E;  5D3I B;  4MJS A;  3QIJ A;  4OW0 A;  2QSD A;  2PEA A;  4L1B A;  1K8R B;  2MA9 B;  2DAJ A;  1UH6 A;  4WQO B;  4ANU A;  3BWU D;  5BMG A;  3Q3J A;  3NY5 A;  3TIX A;  5CHW A;  3AH7 A;  1GB1 A;  3OAW A;  2KO3 A;  2K6Q A;  3PHW B;  4RFB A;  1V5O A;  1WGY A;  2JZZ A;  4YSY B;  4ARC A;  1J7C A;  1C1Y B;  4J6I A;  4TQ1 A;  1L0Y B;  1GC7 A;  2QIL A;  1P7F A;  4C00 A;  1WFY A;  2LFI A;  4CYE A;  3W9C B;  4LCD E;  5IN7 A;  3TMP B;  2LGY A;  3B08 A;  1XCT L;  2R61 A;  2LVQ A;  3K9O B;  2Z0D B;  3V60 A;  4KSL C;  4G50 A;  5E6J A;  1YN3 A;  2VRR B;  4WJP A;  2WHI A;  4KGT A;  4EE2 A;  4L23 A;  3KYC D;  1UWM A;  3V6C B;  3DBL B;  2MBE A;  4TQ0 A;  2MHJ A;  2INP E;  3T9L A;  2BB6 A;  2LD9 A;  2LVP A;  2DX5 B;  1YNT E;  1QOF A;  2R2O A;  2LGS A;  3Q69 A;  4IDI A;  3UF8 A;  1FIQ A;  1D5M C;  1WE7 A;  1WX7 A;  2M19 A;  3N32 A;  2Y5P A;  4KKI A;  1ZXH A;  5G5G A;  3R2T A;  5BMH A;  2ZPY A;  3ZUN A;  4BOZ B;  4E74 A;  4BAX A;  3O13 A;  2L0F A;  1D6E C;  3R3M A;  3CST A;  2BYT A;  4IWQ A;  4MDK E;  4W9F A;  1WJU A;  3AE8 B;  4KVG B;  2LGX A;  4OVU A;  3PZ8 A;  1YQ3 B;  3C0R B;  3RN9 C;  3VTU A;  1TS2 A;  4WWP A;  3IG3 A;  2FNJ B;  3BIN A;  2K3U A;  1KJT A;  2Q5W D;  2I1J A;  4HVB A;  5HFY A;  4EZK A;  4G3X B;  1XD3 B;  1YN4 A;  2PTL A;  3IAM 1;  3HUI A;  4GB9 A;  3H6N A;  3MJ5 A;  4I6L B;  3O65 B;  4FHJ A;  2ACZ B;  3ECI A;  4LDT B;  4ZRP A;  3RUL A;  2DYB A;  5JHA A;  2QCZ A;  5E6N A;  3JW0 X;  2MBQ A;  3TEW A;  4C4V A;  3X0W A;  4OVV A;  1K51 A;  4IM3 A;  2N9P C;  2IPK D;  2C9W B;  4ZDV A;  4PS3 A;  1WIA A;  1ZKH A;  2KJH B;  4GMV A;  2MLB A;  3ZYY X;  2JYT A;  4A6Q A;  2NBV B;  2V4I B;  3KUZ A;  2KDF B;  4LNI A;  2J0M A;  4NJ6 A;  2KAC A;  2M0A A;  2BQQ A;  1JRU A;  2W55 A;  1XEE A;  1WRI A;  2K0P A;  4ICU A;  2C7H A;  2ASQ A;  3TEZ A;  1TBE A;  3AE1 B;  2K9X A;  1NEN B;  1QF6 A;  3PRE A;  4HRS A;  1WGG A;  2L8J A;  4KZ0 A;  1H8C A;  3U2S C;  4IWO A;  2JYE A;  2GBM A;  1QT9 A;  4AQ7 A;  2HDE A;  1YQB A;  1MG4 A;  2JRH A;  3PS6 A;  3A4R A;  1AAR A;  1SJE D;  3Q3F A;  3ZTD A;  3TEX A;  4LJP B;  3A9J B;  3QCA A;  1IBX A;  3EFC A;  3PO0 A;  1Y8R C;  4LNN A;  5G55 A;  2GBN A;  1R4M I;  2AEH A;  1T0S C;  5FR3 A;  1NVI D;  1WYG A;  4OZB A;  2KDB A;  5HHD G;  4B0M A;  1Y56 A;  1E7P B;  1K53 A;  4BZA A;  1WXA A;  2UU7 A;  2NVU I;  1I4G A;  4GU2 A;  5AZH A;  3EFU A;  2KFJ A;  2MJE A;  2N9E B;  3H9D A;  3BK1 A;  4DXA B;  4YSX B;  4P7I A;  2NR2 A;  2K8B A;  2KVZ A;  2BW2 A;  4WWM A;  2QIE B;  3L54 A;  1LM8 B;  2KK8 A;  5J18 A;  4HXD A;  4L2Y A;  1VLB A;  1GNU A;  2KAN A;  4N6E B;  2KWD A;  4EZL A;  1SJH D;  4PYZ A;  3IBE A;  5IAA C;  4XZ4 A;  2ZPN A;  3AE2 B;  4S0R A;  2J53 A;  2BBC A;  1VR9 A;  5E6O A;  2JQR B;  4K7U A;  2MSE D;  4F1S A;  5LXH A;  2L0T A;  2G4S A;  3N30 A;  4ZOH C;  2KDM A;  2LI5 A;  2AQ2 B;  2WU5 B;  1VRA B;  1T5X D;  4DHZ B;  3HVZ A;  4HPP A;  2IJ0 A;  4BKT A;  1UUP A;  2JX5 A;  4XWT A;  5JXV A;  2SEB D;  2KN5 A;  3P4S B;  4C7Z A;  3BVG A;  2J4X A;  1LXD A;  2BT6 A;  4WJQ A;  2YEP B;  5GXG B;  2N9K A;  4XE0 A;  1T3Q A;  1WF9 A;  1CQV A;  2CR5 A;  3N9Y C;  1LQB A;  3ZJV A;  3NG0 A;  4JQW C;  1VZ6 A;  2KC2 A;  1BUI C;  4S17 A;  2MH7 A;  2OJW A;  4URK A;  3KLS X;  2KYW A;  4GDL B;  4KGR A;  4ZRK A;  3NRZ A;  2KXJ A;  2DHZ A;  4YT0 B;  1V81 A;  1L7Y A;  2IO3 B;  3NVZ A;  4EKU A;  1CZP A;  3EUB 2;  3RD2 A;  4FXC A;  2LAS A;  4W9E A;  1V6E A;  1V86 A;  2XEW A;  1RWS A;  4HPM B;  3P1M A;  3I9V 1;  1RLF A;  2PW9 A;  1G6J A;  4WWN A;  3NZS A;  4LTU A;  2IO0 B;  2Y5C A;  4KDI C;  4HKQ A;  1SIJ A;  3A1Q B;  1WJ6 A;  2JY6 A;  3ZW3 A;  3ZGZ A;  5AUK A;  1HTO A;  3OJ4 B;  3ZNZ B;  4HDO A;  1ZE3 D;  1SE3 A;  2AWT A;  3VUW A;  4ARI A;  1JWM D;  3NS8 A;  1D3Z A;  2L1A A;  3P4P B;  1F9J A;  1M4V A;  3DQV A;  2M1M A;  4W9D A;  5KHQ A;  4I6P A;  3DWG C;  3ZJT A;  1QOB A;  2ZNV B;  4NAM A;  4OVZ A;  3V3X A;  3U52 E;  1TKE A;  4A55 A;  2L32 A;  2LUM A;  4IM2 A;  3AED B;  3KUD B;  4RGM A;  1FEH A;  1WGD A;  4HRO A;  3W1Y A;  1MPE A;  1F77 A;  3RNB C;  2PVG C;  2RDG A;  4GIV A;  2BB5 A;  5H92 C;  1TT5 B;  3W5V B;  5HG2 A;  2DZM A;  4II2 B;  1E7U A;  2WXF A;  3DVN V;  3KH0 A;  4PS7 A;  3M63 B;  1PGX A;  1UD7 A;  1FMA D;  1KFY B;  3V05 A;  2DAF A;  2GRI A;  3VRA B;  3VTV A;  2JZ3 B;  1C4P A;  2FCQ A;  1XO3 A;  4GDK B;  2VZK D;  3ML8 A;  1UEL A;  2JZP A;  3QC8 B;  3KQ4 A;  2GBR A;  2ZEQ A;  3TJP A;  3QK0 A;  2LJ5 A;  1YOV B;  2DZJ A;  4WH4 A;  3P2B A;  4JPS A;  2G9H D;  4KGS A;  3DBR B;  1EU4 A;  3ZXR A;  4YTM B;  1TS3 A;  1N61 A;  1J7B A;  2KN4 A;  3PZ7 A;  1OFF A;  3DBL I;  2RDH A;  1L0X B;  2KHW B;  2W82 A;  2KT7 A;  1TKY A;  4DQO C;  2OED A;  3DBH B;  2AQ1 B;  1WGR A;  4BVU C;  3KWV A;  1DOX A;  4MEL A;  4ICV A;  4ANX A;  3W1S C;  3AE4 B;  2IGG A;  2AYO B;  3OJ3 A;  1JRO A;  2WS3 B;  1EF5 A;  3WAM A;  3APC A;  1Z2M A;  2L05 A;  2BWF A;  5JZE B;  3ALB A;  1E8Y A;  2JU6 X;  3DVG Y;  4IC7 B;  3VXW A;  4Q2J A;  3W1S A;  4B95 A;  5D6J B;  3ZJU A;  3HVD A;  3IHP C;  3ZNG C;  1IYF A;  3SFE B;  1I4P A;  1I7H A;  2KDE B;  3GZN B;  3AN1 A;  5FR6 A;  4FJY A;  2W3R A;  1MHX A;  1NYQ A;  2ZW1 A;  3P42 A;  4NQL B;  4WJN A;  2A5U A;  5KHO A;  1VZ7 A;  3BYT B;  4HWI B;  4AUQ C;  1JAL A;  2WXN A;  5IKC M;  3HM3 A;  2O6V D;  4ACF A;  1N5X A;  1IGC A;  2KOX A;  3PRZ A;  4K3B A;  3RNG C;  2IGH A;  3EA6 A;  2AQ3 B;  1ZDX A;  1VDV A;  1V2Y A;  3OLM D;  4DXF A;  2FAZ A;  1L0V B;  2EKI A;  2KMA A;  2I1K A;  3A9J A;  5J17 A;  4X57 B;  2N1V A;  1F1H A;  5DPT A;  3AU5 A;  2BVC A;  3LXF A;  2JF5 A;  1E90 A;  2KDI A;  4YTN B;  3RUI B;  1GC6 A;  2YVC A;  3IAS 1;  4NAW B;  1I42 A;  1C79 A;  3DDC B;  3R2I A;  2NTS A;  2KFK B;  4XWW A;  1T0Q C;  4MSM B;  5LNK 1;  3QQ8 B;  1FCL A;  1XCQ L;  5HI1 A;  4AOF A;  1ZUD 2;  2QEJ C;  2WXK A;  3UIP B;  4HDQ A;  3WAN A;  4FA6 A;  1J19 A;  4JE3 B;  2J52 A;  2V3P A;  3DCG A;  1KH0 A;  3GE8 C;  1WMH B;  5D3D A;  4HCN B;  4F8C B;  1NEK B;  3P4Q B;  4MGK E;  1SB3 C;  3IT6 B;  3L08 A;  2GB1 A;  1JCK B;  2INN E;  2K25 A;  2LZ6 A;  1JWB D;  1QOA A;  4DK5 A;  2PLP A;  4E71 A;  3T3N A;  3ZNH B;  4K81 A;  4ZRJ A;  2KNB A;  3H1U A;  4JWU C;  2HD5 B;  1FNV A;  4BKG A;  1KLV A;  1H4R A;  4GGQ A;  5C2T B;  3ZKJ C;  1FCC C;  5JHB A;  1A5R A;  2CS4 A;  4W9G A;  1HE8 A;  2BKF A;  2L7R A;  1GB4 A;  2KQS A;  4WUR A;  3VDZ A;  1OEY A;  2KQ4 X;  3AE3 B;  3H7S A;  1R4N B;  3AE7 B;  3AUL A;  1KLU D;  5EDS A;  4OHJ A;  2JRI B;  1STE A;  3RNA C;  1C78 A;  1ACC A;  4GDL A;  3AEF B;  2K1F A;  2W9N A;  1RFA A;  2IND C;  1EWC A;  4ZHP A;  2C5L C;  2L52 A;  5IO9 A;  5C1Z A;  2MEK A;  3R8B A;  4G11 A;  5DPR A;  5G5H A;  3I5J C;  1E8Z A;  1IP9 A;  2MP2 A;  2D5G A;  4JGH B;  4DDI D;  4FJZ A;  1WH3 A;  1KTK A;  5BYS A;  3D32 A;  1ZPS A;  2KX0 A;  1OQY A;  2HTH A;  4WAA A;  3MP9 A;  1S3S G;  3MHZ A;  4M01 A;  3PVL A;  1WX8 A;  2WX0 A;  1D4B A;  4HCP B;  2ZNV C;  4BOS C;  3HK0 A;  2RD0 A;  3A1Q A;  2N0S B;  1MFW A;  3ZIM A;  1A70 A;  2IY0 B;  4KV2 A;  1KOT A;  3S2A A;  2JUO A;  5AEK B;  1WI0 A;  4RGT A;  1KF6 B;  1VZ8 A;  2D3B A;  4MEM A;  2WDQ B;  4LNK A;  1CJE A;  5H8Y E;  3RNF C;  1EM7 A;  4WIP A;  2WDT B;  4GLS C;  2ZW0 A;  2RR9 A;  1PUT A;  1B1Z A;  1JWS D;  2XK5 B;  2BGF A;  3PHX B;  2VH1 A;  3T3O A;  4KSK C;  4ZRI A;  2UWQ A;  3QHT A;  3ZLZ A;  2NBW B;  3ENE A;  2O2V B;  1I4Q A;  2OHF A;  4M0W A;  4JWS C;  4FBJ B;  2QDF A;  4XGA B;  2WX1 A;  4MGY E;  4MM3 B;  2BS3 B;  2IO1 B;  3FIL B;  3CSF A;  2LUE A;  1ZW7 A;  1UZX B;  3RMK C;  1WXS A;  3VFK A;  1AWD A;  1PGB A;  4A20 A;  2WXI A;  3C19 A;  2WXM A;  2NCN A;  3A4S C;  4XX5 A;  1V5T A;  1ZOY B;  1N63 A;  2KAJ A;  5LLI A;  4GDK A;  1E6E B;  3TUO A;  1TYG B;  4YWG G;  2WXO A;  1FM0 D;  3N3K B;  1ZGU B;  4KIK B;  5FKA C;  3Q6B A;  4FLH A;  2JPH A;  5CHV C;  2M0X A;  4KDL B;  4US9 A;  1SEB D;  4A8X C;  4DBG A;  2JWU A;  1ZP0 B;  2IZV B;  3VUY A;  2OJR A;  5EE9 A;  4AP4 C;  3P4R B;  1I4H A;  1JML A;  1WGH A;  2FID A;  2M17 A;  2HTM E;  2RDB C;  4A3P A;  4JX1 C;  2E3T A;  2VZK B;  3L10 B;  3RFZ B;  3PTF C;  4XYC A;  3AEG B;  3QA8 A;  3P63 A;  2G1E A;  5E6P A;  3Q8E A;  1WWT A;  4P16 A;  3PT2 B;  1XLO A;  1L4D B;  1WSP A;  2CKH B;  1PGA A;  3NS1 A;  4M02 A;  4RMA A;  3APD A;  3NZ3 A;  4K7S A;  3WCQ A;  1OTR B;  3KUC B;  1IUE A;  4MH8 A;  2N7D A;  2KC1 A;  2DLB A;  2K22 A;  3RPF C;  2ICI A;  1UF0 A;  4PK1 A;  1WRD B;  2C7M B;  3VHT C;  3NVW A;  1FD6 A;  1TS5 A;  3U8Z A;  2OOB B;  3V6E B;  3DHI C;  3W2D A;  3A9K B;  3DWM A;  2I2Y A;  1Z5S B;  3DBR I;  2G3Q B;  1ROE A;  2WXG A;  3MC8 A;  1PQS A;  3N1Y C;  3L13 A;  2PE9 A;  1HQR D;  2NS5 A;  2D07 B;  1V49 A;  1XXG A;  1LO5 D;  3AXC A;  1XLQ A;  3RYT A;  3PLU A;  2MBH A;  1UBI A;  1WXM A;  2N1W A;  2QMT A;  3MC9 A;  2CHZ A;  5DPS A;  3M3J A;  4WJO A;  4DHJ D;  3SDL C;  2FCM A;  2MCN B;  1TKG A;  4LNF A;  1T6B X;  3FAH A;  3PSE B;  4ZRQ A;  2MQJ A;  2WGS A;  3AE6 B;  4F7Z A;  1V1P B;  4ITK A;  1L6U A;  3VAW A;  5D7G A;  5JH5 C;  3LJ3 A;  3Q3M C;  4LNO A;  4UDU C;  2O6V B;  5I4D A;  1ET9 A;  2LJI A;  1WXV A;  3BK2 A;  2FIF A;  4TSS A;  2AX5 A;  1GOZ A;  1EO6 A;  1E9M A;  4NAW A;  2J0K A;  2X38 A;  1VJK A;  3GZN I;  4E3C A;  1WJ4 A;  1CMX B;  3U30 A;  2GI9 A;  4KKJ A;  3I57 A;  2KFK A;  1D5Z C;  3PLV A;  1YMH E;  4P6V F;  1C3T A;  5BMI A;  4AJY B;  2WXL A;  2D3C A;  1ENF A;  2Z59 B;  3AEE B;  3Q3N C;  1TJE A;  4IOI E;  1CK1 A;  3ZRC A;  3WIM A;  3KVF B;  1HA5 A;  3TL5 A;  2GLS A;  2L83 A;  2E6X A;  2DWQ A;  3AMZ A;  2BKR B;  2DYO A;  4NNJ B;  1KM7 A;  4GXB A;  2LRU A;  2WWZ A;  1BML C;  1WMH A;  1XLP A;  2CU3 A;  1Q0W B;  4BKS A;  2FUG 1;  1R4M B;  2WU2 B;  5LXI B;  3PRM B;  2KVR A;  1V1O A;  4EZJ A;  2BF8 B;  1X1M A;  3L4P A;  2R2Q A;  4YTP B;  1P0R A;  3AM9 A;  3RZW C;  2JSV X;  3PGE A;  2L76 A;  4C80 A;  4IKG A;  4C56 C;  4W9H A;  1T0R C;  1EF1 A;  4GSW A;  2GBJ A;  3AEA B;  5L83 A;  3ZXV A;  2PPH A;  4RF0 A;  3VH4 B;  1NDD A;  4OZC A;  1SXT A;  1U4A A;  4II3 B;  2PKO A;  2ZVO A;  1P3Q U;  2MBO A;  4K3C A;  1QKZ A;  2AL6 A;  5IOI A;  3ABV B;  2B76 B;  3IFW B;  4W9K A;  2M8S A;  1IBX B;  2FCN A;  1ET6 A;  1XF5 L;  2WXQ A;  3N20 C;  2KQ7 A;  5EE0 A;  3B1L X;  2IY1 B;  4PYU A;  1QQR A;  3ZO5 B;  2HE7 A;  4EOY A;  2RSU A;  3DHG C;  2V1Y A;  2ZZP B;  3PV1 A;  3ETR A;  2G4D B;  2K39 A;  2JXT A;  2PMV A;  3BII D;  2KTF A;  4LLG M;  4YL8 A;  3BY4 B;  4ZYS A;  3PRP B;  2JT4 B;  1FRR A;  3IT4 B;  2LMC A;  2FCS A;  1JQ4 A;  2I38 A;  1MJD A;  3HIZ A;  2NMQ A;  1AN8 A;  2J7Q B;  3AI5 A;  1R4N I;  1WR1 A;  3IXS A;  5C3J B;  2G45 B;  2MRP A;  3Q8B A;  3MC0 B;  3UI3 A;  1SE4 A;  3ONS A;  3GP7 A;  1SGH A;  1DOY A;  1MI0 A;  3R66 C;  1WGK A;  3JYU A;  2XK5 A;  4W9I A;  3FKY A;  1DGJ A;  1FXT B;  4RM9 A;  3DPD A;  1FPY A;  2O2V A;  4TV3 A;  5CTR C;  3UIO B;  3V61 A;  3WAP A;  1E10 A;  1J8C A;  2K8H A;  3NZU A;  1TIF A;  4IG7 B;  1RFK A;  4IWP A;  3VQI A;  1S1Q B;  4HJK A;  2GMI C;  4MM3 A;  1P9D U; 
#chains in the Genus database with same CATH homology
 3DVG X;  2J0J A;  4GDL A;  4GU2 A;  5AZH A;  3EFU A;  2KFJ A;  2M4N A;  5D2M B;  3TBL D;  5HKH A;  2K1F A;  2W9N A;  2D11 A;  2YLM A;  1RFA A;  2N9X A;  2HJ8 A;  2N9E B;  3H9D A;  4DXA B;  4M8N A;  2C5L C;  4TKN A;  5C1Z A;  2IYD B;  3V62 A;  1WY8 A;  1OGW A;  3QJZ A;  4P7I A;  4G11 A;  1V80 A;  5DPR A;  2NR2 A;  2K8B A;  5C23 A;  4K1R B;  1WE6 A;  3GOE A;  1E8Z A;  1IP9 A;  3K9P B;  2MP2 A;  4CHK A;  4JGH B;  4NPN A;  3CF6 E;  3I3T B;  4DDI D;  3L54 A;  1LM8 B;  4FJZ A;  4HK2 A;  4M0W B;  1WH3 A;  2KK8 A;  2KJR A;  2KLG A;  3VH3 B;  5J18 A;  2K6D B;  3D32 A;  5GMV A;  2KX0 A;  1OQY A;  4BBN C;  4HXD A;  2EMS A;  2HTH A;  4PS8 A;  4WAA A;  4ZYN A;  1Q1O A;  1GNU A;  3KYD D;  1S3S G;  2KAN A;  3ZDM C;  3SU8 X;  4EZL A;  1J0G A;  1XT9 B;  2MWS B;  1E8X A;  1WX8 A;  3PVL A;  2WX0 A;  4PYZ A;  2XBB C;  2LVO A;  3IBE A;  4HCP B;  3KW5 B;  4KIK A;  5IAA C;  4XZ4 A;  2ZPN A;  5E6O A;  2ZNV C;  4BOS C;  3HK0 A;  2RD0 A;  3A1Q A;  4EEW A;  3ZIM A;  4B6W A;  3HHM A;  4K7U A;  2MSE D;  3NOB A;  4F1S A;  3ZRF A;  2IY0 B;  5LXH A;  4KV2 A;  2Z0E B;  3S2A A;  2L0T A;  2G4S A;  2JUO A;  3N30 A;  5AEK B;  1KOT A;  1WI0 A;  2WYQ A;  3R7Q A;  4HPL B;  2LI5 A;  4DWF A;  1YD8 U;  2MBB B;  2RGF A;  4MEM A;  1T0Y A;  2KD0 A;  4DHZ B;  1WM2 A;  2V4L A;  4BKT A;  2ZJD A;  1P98 A;  1YJ1 A;  1YX5 B;  3HM6 X;  1I35 A;  4FJV B;  2KN5 A;  2WDT B;  3SHQ A;  1VD2 A;  2RR9 A;  2PE6 B;  3M95 A;  3UGB B;  2PJH A;  4AJW A;  2XK5 B;  2BGF A;  1WM3 A;  3PHX B;  1LXD A;  2BYV E;  2NBU A;  4JL9 A;  4WJQ A;  4KSK C;  4ZRI A;  2UWQ A;  3M62 B;  2MW5 A;  2IBI B;  3QHT A;  3DOW A;  3ZLZ A;  1WF9 A;  1QZE A;  4CO7 A;  5L95 C;  2CR5 A;  2V3S A;  2NBW B;  3CMM B;  3ENE A;  2O2V B;  1LQB A;  1UGM A;  4FBJ B;  5DCN A;  4JLC A;  2KTR A;  2KX3 A;  2RPQ A;  4JQW C;  2WX1 A;  2KC2 A;  4MSQ B;  3WAO A;  3VTW A;  1L2N A;  4URK A;  4MGY E;  4BBN F;  3RZF A;  2KMC A;  4GDL B;  3QAQ A;  2IO1 B;  2LXC A;  4ZRK A;  2CHX A;  3CSF A;  2LUE A;  4XC2 A;  1ZW7 A;  2NPT A;  1UZX B;  1WXS A;  2KXJ A;  2B3A A;  3VFK A;  2DHZ A;  3H7P A;  4FUL A;  1V81 A;  3L0W B;  1L7Y A;  4A20 A;  2IO3 B;  4EKU A;  2KZR A;  4I6N B;  1WX9 A;  4G0N B;  3RD2 A;  4W9E A;  2LAS A;  3A9K A;  3L16 A;  1V6E A;  2LXA A;  4A3O A;  1V86 A;  2XEW A;  2NCN A;  4HPM B;  3A4S C;  4IUM B;  4XX5 A;  4W9C A;  2L3Z A;  1V5T A;  2DEN B;  5LLI A;  2DYM A;  4GDK A;  1RLF A;  4IM0 A;  4TUU A;  2EKE C;  4WWO A;  1G6J A;  1OEY J;  4GN1 A;  5IA7 A;  2A4Z A;  4WWN A;  3NZS A;  4JIO U;  2ZVN A;  1WYW B;  3ZDT A;  4AWJ A;  2IO0 B;  3N3K B;  1ZGU B;  4KIK B;  4KDI C;  4FLH A;  2JPH A;  2JXX A;  3A1Q B;  3NHE B;  1TTN A;  1WJ6 A;  2M0X A;  4KDL B;  5CHV C;  1MG8 A;  2JY6 A;  3ZW3 A;  4DBG A;  4NQK E;  1E5W A;  2D10 A;  3OJ4 B;  3ZNZ B;  4HDO A;  3VUW A;  2AWT A;  4FAD A;  3NS8 A;  3JVZ X;  1D3Z A;  2KWU B;  2D3G A;  1F9J A;  2KJ6 A;  2Y5B B;  1P1A A;  2M1M A;  3DQV A;  2IZV B;  4W9D A;  3TCA A;  3VUY A;  1GG3 A;  2GOW A;  3MJW A;  4I6P A;  3ZTC A;  5KHQ A;  2OJR A;  4AP4 C;  4KZC A;  4MGZ E;  4EUT A;  2EMT A;  2AL3 A;  1RAX A;  1WGH A;  2FID A;  1TZ1 A;  2M17 A;  3UIN B;  2MX2 A;  2ZNV B;  4A3P A;  3WAL A;  4IM2 A;  3L10 B;  2DZI A;  3PTF C;  3KUD B;  3PPA A;  2O6V A;  1NI2 A;  1V9J A;  3QA8 A;  1VCB A;  1WGD A;  3QWZ B;  5E6P A;  2JWZ A;  4NJ7 A;  3MHS D;  3PT2 B;  3W1Y A;  5DPW A;  3JSV A;  3L17 A;  2CHW A;  4EFO A;  2K8C A;  2CKH B;  2QHO A;  4MH0 E;  4RMA A;  2KWC A;  4ANV A;  5AZG A;  3APD A;  3QAR A;  2KTR B;  1GUA B;  4K7S A;  1WZ3 A;  3EEC A;  4DHJ B;  1OTR B;  3KUC B;  3RT3 B;  4MJS A;  4GIV A;  3QIJ A;  2N7D A;  2KC1 A;  3EHV A;  2PEA A;  2LGD A;  1K8R B;  3AU4 A;  2NPT B;  4BFR A;  2MA9 B;  2DAJ A;  1UH6 A;  2DZM A;  3H7P B;  4WQO B;  4ANU A;  1WRD B;  2C7M B;  1M94 A;  3VHT C;  3Q3J A;  3NY5 A;  4II2 B;  1E7U A;  3U8Z A;  3DVN V;  4IW0 A;  3KH0 A;  2OOB B;  3V6E B;  4PS7 A;  3M63 B;  1NBF C;  3A9K B;  1UD7 A;  3DVN U;  2C7N B;  2DAF A;  3TIX A;  5CHW A;  2BYF A;  1Z5S B;  3DBR I;  2G3Q B;  3VTV A;  2JZ3 B;  3OAW A;  1PQS A;  2FCQ A;  2K6Q A;  2KO3 A;  3L13 A;  2PE9 A;  3PHW B;  4GDK B;  1V5O A;  1WGY A;  2NS5 A;  2JZZ A;  2D07 B;  1V49 A;  2ZCB A;  2GBK A;  1C1Y B;  4J6I A;  4TQ1 A;  1XQQ A;  3ML8 A;  3AXC A;  1UEL A;  3QC8 B;  3QX1 A;  5CHF A;  1GC7 A;  2GBR A;  2ZEQ A;  3TJP A;  3RYT A;  3A33 B;  3QK0 A;  3PLU A;  2MBH A;  2LJ5 A;  1UBI A;  1WXM A;  2DZJ A;  3P2B A;  2N1W A;  1WFY A;  2CHZ A;  5DPS A;  1ISN A;  3M3J A;  4WJO A;  2C60 A;  1WR6 E;  4DHJ D;  3SDL C;  2FCM A;  3DBL I;  2MCN B;  4CYE A;  3PSE B;  2KHW B;  4LCD E;  2MQJ A;  3TMP B;  3VUX A;  4F7Z A;  2LGY A;  3B08 A;  2JVC A;  2LVQ A;  3K9O B;  3VAW A;  2N7E A;  5D7G A;  2Z0D B;  5JH5 C;  1WGR A;  3LJ3 A;  3V60 A;  3R7R A;  4KSL C;  4BVU C;  2O6V B;  1WXV A;  4MEL A;  4G50 A;  2FIF A;  2VRR B;  4ICV A;  1EO6 A;  4ANX A;  4WJP A;  3JSV B;  3T8M A;  3W1S C;  4NAW A;  2J0K A;  3GZN I;  2AYO B;  1RRB A;  3OJ3 A;  4E3C A;  1WZ0 A;  3KYC D;  3U7D A;  1WJ4 A;  1CMX B;  3U30 A;  1EF5 A;  3V6C B;  2MBE A;  4MJS B;  3WAM A;  2L00 B;  3APC A;  1Z2M A;  2KFK A;  2L05 A;  3PLV A;  4M8M A;  4TQ0 A;  3T9L A;  2BWF A;  5JZE B;  1C3T A;  3ZNI D;  3ALB A;  1E8Y A;  2LD9 A;  3DVG Y;  4IC7 B;  3VXW A;  1GJZ A;  2LVP A;  2DX5 B;  4AJY B;  2R2O A;  3W1S A;  2Z59 B;  3ZVV A;  4B95 A;  5D6J B;  1YX6 B;  3UF8 A;  3B0A A;  2DZK A;  3ZRC A;  1WE7 A;  3IHP C;  3WIM A;  3KVF B;  1WX7 A;  3ZNG C;  1IYF A;  3N32 A;  2KDE B;  3TL5 A;  5FR6 A;  2KKC A;  4FJY A;  5TR5 A;  4HLE A;  5J2R A;  2ZPY A;  3ZUN A;  4BOZ B;  2BPS A;  4E74 A;  2BKR B;  2DYO A;  4NQL B;  2IO2 B;  4NNJ B;  1KM7 A;  4GXB A;  2LRU A;  2L0F A;  4WJN A;  2A5U A;  1WMH A;  2WWZ A;  5KHO A;  3R3M A;  4HWI B;  4AUQ C;  3CST A;  1Q0W B;  3HM3 A;  1E7V A;  2O6V D;  4FHK A;  1WJU A;  4IWQ A;  4GOC A;  4MDK E;  4W9F A;  3WA0 A;  4BKS A;  4KVG B;  4BKS D;  2LGX A;  4OVU A;  5LXI B;  2KOX A;  3PRZ A;  3PRM B;  2KVR A;  3C0R B;  3UQA A;  4EZJ A;  3VTU A;  2BF8 B;  1X1M A;  4ASW C;  4WWP A;  3IG3 A;  4B9K A;  2R2Q A;  2FNJ B;  1P0R A;  3BIN A;  3RZW C;  1V2Y A;  3OLM D;  2FAZ A;  1KJT A;  3PGE A;  2L76 A;  2KMA A;  3EC8 A;  2I1K A;  2I1J A;  3A9J A;  5J17 A;  4W9H A;  4HVB A;  4X57 B;  2N1V A;  5DPT A;  4EZK A;  3AU5 A;  4G3X B;  1XD3 B;  1EF1 A;  4GSW A;  2GBJ A;  4GB9 A;  3PZD A;  3H6N A;  2JF5 A;  1E90 A;  2KDI A;  5L83 A;  3RUI B;  2PPH A;  1GC6 A;  3O65 B;  2YVC A;  4FHJ A;  4I6L B;  3VH4 B;  3LDZ E;  1Q5W B;  1NDD A;  3ECI A;  4NAW B;  1I42 A;  5G2N A;  4LDT B;  3RCZ A;  3RUL A;  2DYB A;  3DDC B;  1U4A A;  4K7W A;  4II3 B;  2ZVO A;  5JHA A;  1P3Q U;  2MBO A;  5E6N A;  2KFK B;  2AL6 A;  3DBH I;  3ML9 A;  3JW0 X;  2MBQ A;  3IFW B;  4W9K A;  3IVF A;  5BO4 B;  3VVW B;  4MSM B;  3X0W A;  4OVV A;  4LJO B;  4ANW A;  2M8S A;  2N9P C;  4IM3 A;  3QQ8 B;  2FCN A;  1E8W A;  4N9F 4;  4AOF A;  2C9W B;  4ZDV A;  4PS3 A;  2BWE S;  1WIA A;  1ZKH A;  2KJH B;  4GMV A;  2KQ7 A;  4W9L A;  4NY0 A;  3B1L X;  2IY1 B;  1SIF A;  2LRW A;  2MLB A;  3SD5 A;  4PYU A;  4DDG D;  2NBV B;  3ZO5 B;  3KUZ A;  2KDF B;  2J0M A;  4NJ6 A;  3UIP B;  2HE7 A;  4EOY A;  2RSU A;  3MTN B;  1JRU A;  1UBQ A;  2V1Y A;  4HDQ A;  3DBS A;  5D94 A;  2ZZP B;  3WAN A;  4ICU A;  4RM8 A;  2C7H A;  1J19 A;  2FUH B;  3PV1 A;  2ASQ A;  4FA6 A;  4W9J A;  3DCG A;  2KLC A;  1WMH B;  1TBE A;  2G4D B;  2K39 A;  3UQB A;  4HCN B;  4F8C B;  2D2Q A;  2ZCC A;  5CX3 A;  2CU1 A;  4MGK E;  2KTF A;  3L08 A;  1IPG A;  3PRE A;  1WGG A;  2L8J A;  3BY4 B;  4KZ0 A;  4YL8 A;  1H8C A;  2K25 A;  2LZ6 A;  3APF A;  3PRP B;  4IWO A;  2JT4 B;  4DK5 A;  2GBM A;  1YQB A;  2FCS A;  4LDT D;  1EUV B;  4E71 A;  2KWV B;  2JRH A;  3A4R A;  3PS6 A;  1BT0 A;  3HIZ A;  3AI5 A;  3ZNH B;  2J7Q B;  4K81 A;  1AAR A;  3Q3F A;  4ZRJ A;  5AZF A;  2KNB A;  1R4N I;  1WR1 A;  3ZTD A;  3H1U A;  4LJP B;  3A9J B;  3QCA A;  2UYZ B;  2G45 B;  1Y8R C;  2MP2 B;  2MRP A;  2HD5 B;  3X23 A;  5G55 A;  4MGI E;  3ONS A;  4BKG A;  1SGH A;  2GBN A;  1YIW A;  4FN2 A;  3R66 C;  1R4M I;  3JYU A;  2AEH A;  1WJN A;  1KLV A;  1H4R A;  4GGQ A;  3ZKJ C;  5JHB A;  1A5R A;  2XK5 A;  2CS4 A;  1TGZ B;  4W9G A;  1HE8 A;  2LWP A;  2BKF A;  4W9I A;  2L7R A;  2KDB A;  1SE9 A;  2KQS A;  2BYE A;  3VDZ A;  1FXT B;  4RM9 A;  3DPD A;  1LFD A;  1OEY A;  2O2V A;  3H7S A;  3AUL A;  4TV3 A;  5EDS A;  5CTR C;  3UIO B;  3V61 A;  2REX A;  3WAP A;  1J8C A;  2K8H A;  4DHZ E;  3NZU A;  2JRI B;  1WXA A;  4IG7 B;  4IWP A;  3VQI A;  1S1Q B;  4HJK A;  2GMI C;  4MM3 A;  1P9D U;  2NVU I;  2N4F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...