5IAAC

Crystal structure of human uba5 in complex with ufm1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
80
structure length
80
Chain Sequence
VSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like modifier-activating enzyme 5
publication title Trans-Binding Mechanism of Ubiquitin-like Protein Activation Revealed by a UBA5-UFM1 Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 17
structure length 80
sequence length 80
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03671 Ufm1 Ubiquitin fold modifier 1 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5iaaC00
4GDKA 4NY0A 3AU5A 1WGGA 5DPRA 4BOSC 2IZVB 3PRPB 2LUEA 4WWOA 2BYVE 2EMTA 2FUHB 3OJ3A 1R4NI 4GU2A 3ZRCA 1WXSA 2KMAA 4OVUA 5KHOA 2PPHA 2KX3A 3A9JA 4KVGB 4ZRIA 4TQ0A 2O2VA 3A4SC 5AEKB 2JRHA 3ML8A 3V6EB 1C1YB 1WGYA 2KC2A 1KM7A 2KJHB 2NPTA 4GB9A 5LXIB 4AUQC 1FXTB 2KXJA 2L8JA 1U4AA 2AL3A 3JYUA 2EKEC 5G2NA 2FCMA 1RFAA 3PSEB 4NPNA 4B9KA 2ZVOA 4I6PA 2BYEA 3ZDMC 1Y8RC 2KZRA 3QA8A 2CKHB 3UGBB 2EMSA 1WGDA 2PE6B 3KUZA 2DAJA 4IWPA 3H7SA 4ZRJA 1ZKHA 3DPDA 2ZPNA 3U30A 2LD9A 3VTWA 2C7HA 2CHZA 2C9WB 3CF6E 1YX5B 3R3MA 5D7GA 1IYFA 1J8CA 3SHQA 3NY5A 1WJUA 3PT2B 3VUXA 3JSVB 2OJRA 2XBBC 2MA9B 4NQLB 1HE8A 3LDZE 3B08A 3X23A 1K8RB 1UH6A 1WM2A 4IWOA 3H9DA 2Z0EB 2IO1B 4MGKE 2KO3A 2C7MB 2KVRA 4NNJB 4DXAB 2CR5A 2JZZA 2N9PC 5CX3A 2J0MA 1WXAA 3SD5A 2UWQA 2D11A 4G0NB 1XQQA 4GN1A 3SU8X 4A3PA 2UYZB 4WJPA 4MH0E 3PPAA 4BVUC 4FA6A 5EDSA 1M94A 3WAPA 1E5WA 3P2BA 2RPQA 3PTFC 2M1MA 1WR1A 2HJ8A 3VVWB 1A5RA 1OQYA 2KLGA 2CHXA 2IY1B 2ZZPB 1WX8A 2AYOB 1P3QU 3A1QA 2V1YA 4AP4C 4TQ1A 2NBVB 1WMHA 4FLHA 2L0TA 4EOYA 2GBNA 3MHSD 1V5TA 2JZ3B 1WJ6A 2L76A 2NVUI 1CMXB 3DVNV 4FJVB 4W9FA 2A5UA 1Z2MA 4AJYB 2D3GA 3N30A 2N9XA 3DBHI 4GDLA 2KMCA 4PS8A 1WR6E 2LVOA 3W1SA 1L7YA 1OGWA 2DYBA 2HE7A 3GOEA 4JLCA 3O65B 4TV3A 3VH4B 3VQIA 4K7SA 2D10A 3ZDTA 2LRUA 2CU1A 1UELA 2BKRB 4G11A 4JQWC 3H7PA 1OEYJ 2N1WA 4HK2A 4MM3A 3QWZB 1X1MA 3CMMB 3QAQA 2KOXA 5CHFA 2MBBB 4MSQB 2Z59B 4N9F4 3QARA 4BOZB 4MELA 2RD0A 4HDOA 1J19A 4HJKA 2N4FA 4JL9A 4KZCA 1YQBA 3A9KA 3K9PB 4DHJB 3TBLD 3A33B 3DVGY 3HK0A 3R66C 3ZO5B 3M63B 5CTRC 2O6VB 4II2B 2MSED 4IM2A 5C23A 4EFOA 1AARA 1EF5A 2WYQA 2KWVB 3WALA 3QK0A 3T8MA 3IFWB 4J6IA 2DHZA 2FCQA 2KKCA 4BBNF 4E71A 1WRDB 4KV2A 1IP9A 4K1RB 4IM3A 2HD5B 3QC8B 4CO7A 1WFYA 3ZLZA 2KC1A 1QZEA 1YIWA 2LWPA 4GMVA 1E90A 1V81A 3U8ZA 1BT0A 1NDDA 3APCA 2DENB 2RR9A 3ENEA 1RRBA 2L3ZA 1Q0WB 2LVPA 2L05A 3L13A 2FCNA 4KSKC 3ZRFA 1V49A 2ZNVB 2GMIC 4PYUA 4ZYNA 1Z5SB 4WWPA 3RD2A 3KH0A 3HM3A 4NAWA 2DZMA 2DZJA 2KHWB 1GC6A 4XC2A 3WIMA 3ECIA 1I35A 1LM8B 2M0XA 2MWSB 2GBKA 4EZKA 4B6WA 5G55A 3VTUA 3NZSA 5IAAC 1E8ZA 1YJ1A 3CSFA 4M0WB 3DBSA 1P0RA 1UBQA 2IO2B 1WZ0A 1WGHA 4MGZE 4W9DA 4WAAA 4GDKB 3U7DA 4LDTB 4EUTA 1L2NA 4W9IA 2FIFA 2BF8B 4HPLB 1E8XA 3VHTC 2NBWB 3DVNU 3RT3B 2JT4B 5E6NA 4GOCA 4PS7A 2ZJDA 4DBGA 1WE7A 1WE6A 4W9GA 2D07B 2XK5B 1WF9A 3A9JB 4IM0A 3W1SC 4FHJA 2K8BA 3HHMA 3N3KB 3N32A 2A4ZA 2DZKA 5J18A 4CHKA 2DYMA 3DDCB 2NCNA 2Y5BB 4W9KA 2MLBA 1ZGUB 1V6EA 2LJ5A 1IPGA 4K81A 4RM8A 2G4SA 2AWTA 4WJNA 1WXVA 3VUYA 2K6QA 3TCAA 2KDEB 2C60A 2BWES 2ZVNA 2JVCA 1EO6A 5DPTA 3BINA 4EEWA 3L0WB 3VDZA 4HPMB 1LFDA 2AL6A 1R4MI 3QCAA 4ZDVA 3UQBA 4DDID 1GUAB 3UIOB 3NOBA 2K8CA 2J0KA 2KTFA 3RCZA 2IYDB 1T0YA 5LXHA 3A4RA 3ZW3A 4IWQA 3R7RA 2ZEQA 4K7UA 5JH5C 2JRIB 3B0AA 2IBIB 4P7IA 4WJQA 4JIOU 2O6VD 1E8YA 2IO0B 3AXCA 2MBHA 2KWUB 2XEWA 3IVFA 2LASA 5JHBA 1P9DU 3R7QA 3QQ8B 3WAOA 1I42A 4HCPB 3DOWA 2KFJA 1V5OA 4HWIB 2GBRA 2JXXA 2J7QB 2YLMA 1Q5WB 4FADA 5LLIA 4HLEA 4MJSA 4HCNB 4LJOB 2G4DB 3A1QB 4IUMB 4KDLB 5DCNA 4B95A 4DHZB 1OEYA 4GXBA 3UINB 1J0GA 4TKNA 1WMHB 4E3CA 4G3XB 3RZFA 3PS6A 1S3SG 2NR2A 2MRPA 4M8NA 2LGDA 2KLCA 5HKHA 5J17A 4NJ7A 1WX9A 1H4RA 4BKTA 3T9LA 3PRZA 3W1YA 3ONSA 1XT9B 4KIKA 2IY0B 4X57B 3H1UA 2L7RA 3IBEA 2BKFA 3B1LX 4GDLB 5CHVC 2LGXA 3EC8A 4IW0A 3RZWC 3EECA 1PQSA 3PV1A 2KJRA 2O6VA 2K8HA 2KFKA 5IA7A 3NHEB 3OJ4B 5GMVA 4EZLA 2PJHA 1VCBA 2VRRB 3D32A 3H6NA 4I6LB 2B3AA 4ANUA 4W9HA 3H7PB 3ZNHB 2K6DB 2BGFA 2LRWA 1VD2A 4MDKE 4DWFA 4W9LA 2RSUA 4FBJB 4EZJA 4JGHB 3VAWA 2MCNB 4ANXA 3EFUA 5KHQA 2JF5A 1YX6B 2KTRA 1UZXB 1NBFC 2KJ6A 1V9JA 4AWJA 2NBUA 2PEAA 2WDTB 3ZTDA 2L00B 2WWZA 4YL8A 1EUVB 1UD7A 3A9KB 3PVLA 4FHKA 3ALBA 5JZEB 2KDFB 4KSLC 3S2AA 2M17A 4KDIC 2JPHA 3WAMA 3Q3FA 2MBQA 3TL5A 2FIDA 3ZIMA 3VXWA 3DBRI 1KOTA 4KZ0A 4XZ4A 2BYFA 4OVVA 4EKUA 1TGZB 4M8MA 2KD0A 2PE9A 2LGYA 3KUDB 2M4NA 3DVGX 1UGMA 1F9JA 2JWZA 3ZUNA 4ZRKA 4A20A 3M3JA 3CSTA 1TBEA 3LJ3A 3PGEA 5D94A 1WGRA 2DZIA 5E6PA 2KNBA 2MP2B 4MGIE 2M8SA 2GOWA 3X0WA 3MTNB 2GBMA 2HTHA 1LXDA 2WX0A 3HM6X 4URKA 3WA0A 4DK5A 3ZNZB 4A3OA 3AI5A 2N1VA 2D2QA 2R2QA 3PHWB 4W9CA 1WH3A 1WX7A 4NQKE 4FJYA 5J2RA 4II3B 1WXMA 1P1AA 5TR5A 2XK5A 3KYCD 1WM3A 4NAWB 4BFRA 2O2VB 1D3ZA 3JSVA 4K7WA 1SIFA 5CHWA 2GBJA 2NPTB 4ICVA 5FR6A 2ZCBA 2AEHA 4BKSD 3NS8A 3VH3B 1G6JA 1RAXA 2QHOA 3OAWA 1ZW7A 2LXAA 1V2YA 3I3TB 4BKGA 2KN5A 3EHVA 4ASWC 4LCDE 1S1QB 1WY8A 4TUUA 1P98A 4FN2A 5L95C 1WYWB 3MJWA 1V86A 4BBNC 5AZGA 2G3QB 2DAFA 4GGQA 4ANVA 5DPWA 3UQAA 1JRUA 4W9EA 2REXA 3KUCB 3NZUA 4ICUA 4ANWA 5L83A 3V60A 4I6NB 2LVQA 3GZNI 2LI5A 2V4LA 4F7ZA 3PLVA 5AZFA 4HDQA 3PHXB 4DHJD 1SE9A 5JHAA 2CS4A 2FAZA 3ZTCA 1LQBA 1MG8A 3RULA 3ML9A 2LXCA 5D6JB 3M95A 2ASQA 3KYDD 3V62A 2C7NB 4DDGD 4F1SA 4CYEA 1KJTA 1WI0A 4F8CB 5E6OA 3RUIB 2KANA 2N9EB 4GIVA 1WZ3A 2R2OA 2KDBA 1UBIA 5AZHA 2MW5A 3L16A 2MBOA 3L17A 1ISNA 4IG7B 4BKSA 3QX1A 1C3TA 1YD8U 3ZKJC 2RGFA 2ZNVC 4RM9A 3KVFB 4WWNA 2C5LC 3RYTA 1XD3B 1WIAA 2IO3B 4MGYE 3SDLC 1WJNA 1E7VA 3KW5B 1GNUA 3PZDA 2K1FA 3BY4B 4HXDA 1E8WA 4MEMA 4LJPB 4E74A 2N7DA 1Q1OA 3QIJA 3HIZA 3AU4A 3Q3JA 2MQJA 3JW0X 3JVZX 3TIXA 1OTRB 3VUWA 3UIPB 2V3SA 1SGHA 2N7EA 3APDA 3TMPB 2K25A 2K39A 1WJ4A 3WANA 2DYOA 2FCSA 2I1JA 3IG3A 3PLUA 1H8CA 1RLFA 4MJSB 2ZPYA 3APFA 2CHWA 5BO4B 1GJZA 4LDTD 1KLVA 4HVBA 4IC7B 2J0JA 1V80A 2LZ6A 3ZVVA 2NS5A 3DCGA 3PREA 1GG3A 2W9NA 2Z0DB 5D2MB 4KIKB 3ZNID 1EF1A 1E7UA 2KK8A 4G50A 1NI2A 3ZNGC 2DX5B 2MX2A 2I1KA 3L08A 2WX1A 3TJPA 1GC7A 2L0FA 3IHPC 4AJWA 2FNJB 3PRMB 4GSWA 3V61A 2MBEA 4FJZA 5C1ZA 3AULA 4W9JA 3K9OB 3OLMD 3M62B 1TZ1A 3C0RB 2KFKB 2KDIA 3DBLI 2YVCA 2ZCCA 1TTNA 3DQVA 3V6CB 2JY6A 4FULA 3QHTA 2KQ7A 2KWCA 2OOBB 3L54A 4NJ6A 3VTVA 4PYZA 4DHZE 2BPSA 4PS3A 4RMAA 3QJZA 4MSMB 5DPSA 3UF8A 2KTRB 2KQSA 4XX5A 3VFKA 2BWFA 4AOFA 4WQOB 3L10B 2MP2A 4WJOA 2JUOA 2G45B 2KX0A
chains in the Genus database with same CATH superfamily
3AU5A 1WRIA 2JYTA 3TSSA 1BUIC 1T0SC 2V0GA 4GU2A 1R4NI 2KX3A 4ZRIA 3A4SC 2JRHA 3ML8A 1C1YB 2M19A 1RFAA 4AS1A 4B9KA 2BYEA 3QA8A 1DOXA 2PE6B 3FAHA 4IWPA 2LD9A 3P42A 2PMVA 2CHZA 3BVMA 1HZ6A 2GB1A 1WJUA 4RFBA 4DQOC 1IUEA 3SFDB 3JSVB 2OJRA 4DXGA 3BIID 2H88B 1AWDA 3DWGC 3B08A 3R8BA 1K8RB 4DXAB 2PTLA 2CR5A 4KGTA 2LFIA 3SD5A 4G0NB 3SU8X 2ONQA 3RNFC 2J4XA 3VRBB 4FA6A 5EDSA 1M94A 3P2BA 2XNAC 3RNBC 1FNUA 2FBWB 2BVCA 1OQYA 2AQ1B 5HHDG 1WX8A 3BK2A 3Q8AA 2FUG1 2J53A 2CJNA 1V5TA 2E3TA 1WJ6A 1Z2MA 3EFCA 2J42A 4PS8A 1YQ3B 1L7YA 1OGWA 1T0QC 3B2FA 2K5PA 4P16A 2LRUA 2QILA 1PGXA 3Q8EA 4UDUC 3PZ7A 3P4QB 1J7AA 4MM3A 1RYJA 2V9HA 3ZGZA 2IGGA 3CMMB 2KOXA 5CHFA 4ZOHC 1C4PA 2RD0A 2BTEA 4JL9A 1YQBA 3A33B 3HK0A 2SEBD 3M63B 4XGAB 5C23A 4EFOA 2WXGA 2JZPA 2UU7A 1GAQB 3WALA 4YSYB 3IFWB 1JCKB 4J6IA 2FCQA 4E71A 4YTNB 2VZKD 1IP9A 2IPKD 4IM3A 1TKYA 3QC8B 3U4EG 4RGMA 3DHIC 3ZLZA 3B2GA 1MHHE 4GMVA 4LNKA 1E90A 1BT0A 4KSKC 1I4QA 2FCNA 1V49A 3MHZA 1TT5B 4MACA 2N9KA 4NAWA 3HM3A 3WIMA 1I35A 1D5ZC 3ECIA 1LM8B 2M0XA 3T3OA 4XDCA 5G55A 5IAAC 2IO2B 4MGZE 4N6EB 1FRDA 2WGSA 1VR9A 2OJWA 2WP9B 4HPLB 1SB3C 3NVWA 1YJJA 2TSSA 5G5HA 4W9GA 2LEKA 1WF9A 3A9JB 4IM0A 3W1SC 2K8BA 2W82A 3HHMA 2DZKA 4KGRA 2DYMA 2Y5BB 2WXMA 4ZHPA 2LJ5A 4RM8A 1XXGA 3VUYA 2KDEB 3L0WB 1YN3A 3RMKC 1E7PB 1L4ZB 2PVOD 1ZUD2 1T0YA 2JQRB 3DHHC 3EGRA 2NTTA 4IWQA 4K7UA 2JRIB 3B0AA 1TY0A 3Q8BA 4JIOU 3AEEB 2IO0B 5G5GA 1V8CA 3IVFA 1YN5A 5JHBA 2WDVB 4HWIB 2KQ4X 2YLMA 4C7YA 3NS1A 4FADA 5DCNA 2G4DB 3URYA 3MJ5A 3C8YA 4ZRQA 5HKHA 5J17A 1WX9A 1JWMD 3AEGB 3PRZA 3H1UA 2L7RA 3B1LX 3PV1A 1C9FA 1GOZA 4EE2A 5GMVA 4EZLA 1FM0D 3AH7A 1QT9A 3H6NA 4I6LB 2B3AA 2BS3B 2CJOA 1CJEA 2K6DB 2LRWA 1VD2A 3OWEB 5EE0A 2RSUA 4FBJB 3VAWA 2V3NA 3I5JC 2QCZA 2JF5A 3Q6BA 1UZXB 3NVYA 2KJ6A 3W5UB 1EUVB 1UD7A 1QOBA 4FHKA 1K50A 1NENB 2KDFB 3S2AA 2M17A 2RDBC 4KDIC 2PKOA 2WXQA 3Q3FA 2QIEB 3NVVA 2IGDA 3BVGA 4M8MA 2KD0A 3NJTA 2M4NA 2RDGA 3DVGX 1TS4A 1J7CA 3PGEA 5D94A 3DHGC 2KNBA 4H2AA 3MC0B 2WHIA 3BK1A 2WX0A 4DK5A 4GLSC 2R2QA 1WH3A 1WX7A 4NJCA 1HTQA 4II3B 1P1AA 4D2KA 5TR5A 2XK5A 1C78A 4K7WA 2BQQA 2AEHA 4BKSD 3VH3B 1ZOYB 2LXAA 4KX6B 4LCDE 1S1QB 1WY8A 4C4VB 2J52A 1P98A 1CK1A 1WYWB 1RM6C 4LNOA 1V86A 5AZGA 4ANVA 4OZAA 2V4IB 3KUCB 1FCCC 3V60A 1K51A 3GZNI 2HJ1A 3PLVA 4KKIA 2MJEA 1J7BA 2KN4A 2CS4A 2FAZA 3AMZA 3RULA 1T5XD 4CYEA 3ZXVA 1WI0A 5E6OA 3RUIB 4XDDA 2KANA 3GB1A 1C3TA 4BKSA 3QX1A 1YD8U 1HEZE 1F2RI 1WGKA 3SDLC 1E7VA 1GNUA 2K1FA 5I4DA 1PFDA 2MEKA 4LJPB 3N20C 3TIXA 3VUWA 3UIPB 1XLPA 1FXAA 3TMPB 2K39A 2LJIA 2I1JA 3IG3A 4MJSB 4LDTD 1OFFA 1WSPA 2LZ6A 4M00A 3PREA 4HROA 4LK0M 1GG3A 2W9NA 4KIKB 4G50A 4ZYSA 3Q3OC 2DX5B 2MHJA 3IHPC 4AJWA 4GSWA 3OLMD 3M62B 2BS4B 5T8IA 2YVCA 2ZCCA 2WXIA 2WU2B 3V6CB 4NJ6A 2KQ7A 2OOBB 1EU4A 4YT0B 3QJZA 2DLBA 4AOFA 2BS2B 3FC4A 4GDKA 5DPRA 4BOSC 1UUPA 2LUEA 1TKEA 2RMMA 2EMTA 2KMAA 1NI3A 2LMCA 4WQMA 3I9V1 2JX5A 1TZOA 1N63A 2O2VA 3V6EB 2KC2A 2KJHB 1KM7A 4GB9A 5LXIB 4IOIE 2WXJA 2QMTA 1U4AA 3JYUA 1KRHA 1MVKA 1SBBB 4I6PA 1Y8RC 2KZRA 2CKHB 2EMSA 1PUTA 1WGDA 3U30A 1ZKHA 3DPDA 3PO0A 3BYTB 1IYFA 4TMAB 2JYEA 1JWSD 2BYTA 1ESFA 2HTME 4ARIA 2JZZA 1WXAA 2UWQA 2UYZB 1D4BA 3PPAA 4BVUC 4OZCA 1IGCA 2KWDA 3WAPA 3PTFC 2HJ8A 1HZ5A 1A5RA 2LHEA 2IY1B 2AYOB 4AP4C 5FR3A 4TQ1A 2L0TA 2INDC 2JZ3B 2NVUI 1CMXB 3T3NA 2EKIA 4W9FA 3DBLB 5HFYA 4HKZE 2N9XA 1YN4A 3B9JA 2WDRB 4B0MA 1D5MC 3DBHI 5IOIA 1L0VB 1WR6E 2LVOA 2DYBA 3GOEA 4JLCA 3O65B 4K7SA 3BVZA 2H89B 3UI3A 3W5VB 3HVZA 5E6JA 1IGDA 1QQRA 4G11A 2Y5PA 4LTUA 3TEWA 2L83A 4HK2A 2CU3A 2MBBB 3QARA 4XWTA 1J19A 1F77A 4HJKA 1KH0A 4KZCA 3A9KA 1MG4A 3Q69A 5CTRC 2O6VB 1AARA 2DNFA 4L1BA 3R2TA 4KGSA 2KKCA 2JWUA 3MC9A 3RNAC 3O13A 3ZYYX 1FNVA 4KV2A 4P1CC 4CO7A 1DOIA 4L2YA 2FE8A 2DENB 1RRBA 2L3ZA 1Q0WB 3KLSX 4J3OD 2DZMA 2KHWB 1GC6A 4A55A 3RNCC 2GBKA 4EZKA 1IBXA 2WNMA 3NZSA 2WXNA 4M0WB 3DBSA 4W9DA 1WZ0A 1WGHA 4EUTA 5JXVA 3ZJUA 2BF8B 2NBWB 3MFGA 5E6NA 4PS7A 1VZ8A 3AEAB 1QKZA 2D3BA 2JXTA 2A4ZA 3N32A 3RFZB 2K22A 4CHKA 3DDCB 2W3SA 1V6EA 4L23A 1IPGA 4K81A 3GE3C 3SEBA 1JWAD 4WJNA 1ZE3D 2WXKA 2C60A 5DPTA 3BINA 4MH8A 4HPMB 3GE8C 1JW9D 1LFDA 2AL6A 1R4MI 2X38A 3QCAA 3UQBA 3BZDB 1YNTE 3NOBA 2KTFA 2Y5CA 3RCZA 3TEYA 3R7RA 1C4AA 2ZEQA 1R7SA 1VZ7A 2IBIB 1FPYA 1ACCA 1GB1A 1JALA 1STEA 2XEWA 1OQRA 5FKAC 4RF1A 1FIQA 3AE1B 4HCPB 3DOWA 1V5OA 2GBRA 1EM7A 4C80A 1FO4A 4HCNB 5LNK1 4LJOB 4KDLB 4IUMB 4GXBA 1J0GA 5HI1A 4E3CA 1N5WA 4G3XB 2JSVX 2WXRA 2LGDA 2KLCA 3CIRB 4BKTA 3W1YA 1HA5A 3VR8B 4X57B 1MI0A 3DBRB 1EU3A 4JX1C 1DYQA 5CHVC 1F2RC 3RZWC 1PQSA 1SJED 3AEBB 1KTKA 3OJ4B 2PJHA 4DWFA 4MDKE 4MM3B 1EWYC 4RNAA 2MCNB 2AX5A 1YX6B 1NBFC 4AWJA 2WDTB 2INCC 4R3DA 3PVLA 1TKGA 2YEPF 3V05A 2WQYB 1RWSA 2LUMA 3ZIMA 1CQVA 3DBRI 1N60A 4KZ0A 1ZXHA 2LGYA 5AUIA 1UGMA 1F9JA 2JWZA 3ZUNA 4A20A 1RFKA 1TBEA 2DZIA 2MP2B 2M8SA 2HTHA 1LXDA 1NYQA 3IT4B 4P6VF 1TS3A 4RCOA 1AN8A 3AI5A 4A3OA 4FJYA 4NAWB 4BFRA 3HUIA 1D3ZA 1SIFA 5CHWA 2GBJA 2NPTB 4ICVA 3IAM1 5C2TB 2N7JA 3NS8A 1G6JA 1V2YA 4BKGA 3KWVA 1YJIA 3N1YC 4BZAA 4TUUA 5L95C 4M02A 2GI9A 3MJWA 4BBNC 2G3QB 4W9EA 1KF6B 2REXA 3NZUA 5L83A 4I6NB 2LVQA 2V4LA 1ZP0B 2D5GA 4WURA 3PHXB 4DHJD 1SE9A 2W54A 2IDYA 2IGHA 1Y56A 3LB8C 5D6JB 1B1ZA 2ASQA 3KYDD 4A90A 4OHJA 4WWMA 1WZ3A 2R2OA 2KDBA 1FCLA 2ZNVC 1VZ6A 3AE6B 2C5LC 3IAS1 1PYWD 5BYRA 4OW0A 3BY4B 2K9XA 4C00A 3DWMA 3JW0X 3JVZX 1OTRB 5AUKA 4CQNA 3N9YC 2K25A 1WJ4A 3PLUA 4NZLB 1KLVA 4IC7B 1VRAB 4RGNA 2LGSA 4HJGE 1UWMA 1UNSA 3ZXRA 2Z0DB 5D2MB 3AE5B 3ZNID 2R61A 2KK8A 1MPEA 1GC7A 2L0FA 3V61A 2MBEA 4FJZA 3AULA 2M0AA 3C0RB 2KYWA 2JY6A 3U2SC 2KWCA 3L54A 4DHZE 2XN9C 2BPSA 4PS3A 4WJOA 1FNWA 4LNIA 4NY0A 1WGGA 3RNEC 1FFVA 2IZVB 3GZNB 3PRPB 2BYVE 2FUHB 3ZRCA 1WXSA 1DGJA 4OVUA 5KHOA 4KVGB 4TQ0A 3W9CB 4Q2JA 1N61A 1FXTB 2KXJA 4M01A 2AL3A 1E6EB 2EKEC 5G2NA 3PSEB 1L6VA 3ZDMC 1NVID 1D5XC 3NZ3A 2INNE 2DAJA 2PVGC 3V3XA 3VTWA 2C9WB 2V3PA 3FKYA 5D7GA 3SHQA 3U7ZA 3PT2B 3VUXA 2XBBC 2MA9B 1TS2A 3P4RB 5FK9C 1HE8A 3LDZE 3P1MA 3X23A 1WM2A 1XCTL 4IWOA 2Z0EB 4MGKE 2KO3A 2C7MB 2KVRA 3VR9B 2N9PC 1OQQA 2J0MA 2D11A 4WJPA 5IN7A 1JWUD 2RPQA 2M1MA 1XF5L 3MP9A 3Q8CA 1LGRA 3A1QA 2V1YA 1WMHA 4FLHA 2GBNA 3MHSD 1I4GA 4YTMB 1QOFA 3DVNV 2A5UA 4N58A 4AJYB 2D3GA 4GDLA 3W1SA 4HEA1 4WH4A 3NG0A 1LO5D 4TV3A 4IDIA 3VH4B 2D10A 3ZDTA 1ROEA 1MHXA 2L1AA 2DBYA 3H7PA 2Z59B 1T0RC 3CWIA 2BT6A 1B9RA 4USAA 1C77A 1C76A 1I7HA 2ICIA 2N4FA 1XLNA 3K9PB 2INPE 4XYCA 3DVGY 3R66C 1DOYA 4II2B 2MSED 2WYQA 1V1PA 1SF0A 3EUB2 3J9CA 2EELA 3BWUD 1WRDB 3N1XC 1PGBA 4K1RB 4PK1A 1WFYA 4O1NA 1V81A 3U8ZA 1NDDA 2RR9A 3L13A 3ZRFA 2ZNVB 4PYUA 4WWPA 3RD2A 3KH0A 3AEFB 1QOAA 2KDMA 3Q3NC 1KFYB 3VTUA 1E8ZA 3IXSA 1P0RA 1UBQA 4YTPB 1WXQA 4GDKB 4LDTB 3U7DA 5EE1A 2Q5WD 1TIFA 1E8XA 3VHTC 1GB4A 4GOCA 2ZJDA 4DBGA 3P63A 1WE6A 3SR6A 1TYGB 1P7FA 5J18A 1T3QA 4KKJA 1HXYD 3DBHB 2NMQA 2G4SA 1WXVA 1XEEA 1E0ZA 1QLBB 2ZVNA 1EO6A 1TJEA 4ZDVA 1GUAB 5D3IB 3UIOB 4RH6A 2K8CA 2J0KA 2IYDB 3A4RA 3I57A 4US8A 4WJQA 2WXPA 2O6VD 3AXCA 2MBHA 2KWUB 1N6ZA 1P9DU 5BMHA 3WAOA 1F52A 2JXXA 1Q5WB 4HLEA 2L52A 1SE4A 4DHZB 3UINB 1PGAA 1XO3A 3L4PA 1QILA 3RZFA 1S3SG 2NR2A 2MRPA 4M8NA 3OG5A 4NJ7A 4JWUC 2K0PA 2G9HD 1H4RA 3T9LA 4JE3B 3ONSA 2IY0B 2BKFA 3EC8A 1ET6A 3KQ4A 3EECA 4YSZB 4AQ7A 2KJRA 4HKQA 2O6VA 2KFKA 3NHEB 2LHDA 4REZA 1VCBA 4ANUA 1MJDA 1FEHA 3FILA 1WYGA 3EFUA 4ANXA 5KHQA 2KTRA 2G1EA 1ET9A 1V9JA 1SXTA 2L00B 2KMMA 1UF0A 3Q14C 4YL8A 3A9KB 4KSLC 3TL5A 2FIDA 3VXWA 1KOTA 4XZ4A 2LGIA 1TGZB 3LXFA 3M3JA 3CSTA 1R4MB 1WGRA 3X0WA 3MTNB 1AW7A 2GBMA 4URKA 1VDVA 3E9SA 2N1VA 2D2QA 3PHWB 4W9CA 5J2RA 2QC8A 1WXMA 2RDHA 1WM3A 3KYCD 2AQ3B 3JSVA 1SE3A 4C56C 1SEBD 3AE8B 1IBXB 5FR6A 4LLGM 1RAXA 2QHOA 3OAWA 1ZW7A 2OEDA 3EHVA 2MJ3A 4FN2A 3EA6A 3TEZA 3AB5A 2Z8LA 3WCQA 4GGQA 4RGOS 1N5XA 3UQAA 4ARCA 1JRUA 2WLBA 5GXGB 2LI5A 4F7ZA 1TS5A 4N59A 4OVZA 1N62A 1SSNA 5AZFA 4HDQA 1TY2A 3ZTCA 2LXCA 3M95A 3V62A 2C7NB 2WXHA 1ZPSA 3AN1A 3KWLA 3R2IA 2N9EB 4GIVA 5BYQA 1UBIA 3L16A 4IG7B 2RGFA 5TSSA 4RM9A 4WWNA 1FMAD 1WIAA 2IO3B 4MGYE 1WJNA 4HXDA 3QIJA 3AU4A 4PT5A 3Q3JA 4RF0A 1JRPA 2V3SA 1SGHA 2N7EA 2W55A 3WANA 2DYOA 3VRAB 1RLFA 3APFA 1UGJA 2CHWA 5BO4B 1GJZA 1M4VA 4HVBA 1VJKA 2J0JA 3GS2A 1V80A 3DCGA 2D3AA 2E6XA 1YOVB 1YQ4B 2AQ2B 4WIPA 1NI2A 4HRSA 3ZNGC 2MX2A 3L08A 2W3RA 2WX1A 3TJPA 3ZQ4A 2SAKA 2QSDA 5C1ZA 4W9JA 3K9OB 1I4HA 1CZPA 1QOGA 3VTVA 4PYZA 5IKCM 3UF8A 1PDXA 2GRIA 4XX5A 3VFKA 4WQOB 3L10B 2MP2A 4IKGA 4OZBA 3NUHB 5IP4D 3P4SB 2BBCA 3ZJTA 4WWOA 4YXDB 5BMGA 3OJ3A 2PPHA 3A9JA 1I4XA 2K3UA 1D6EC 5AEKB 1ENFA 1WGYA 2NPTA 5EE9A 5D3DA 1QF6A 1I4RA 4AUQC 1F1HA 2L8JA 1L0XB 5IO9A 2FCMA 4NPNA 5H92C 2ZVOA 1FFUA 3UGBB 3KUZA 4K3BA 3H7SA 4ZRJA 2ZPNA 2C7HA 3CF6E 1YX5B 3R3MA 2QEJC 1J8CA 1SJHD 2VZKB 1JMLA 3NY5A 2PW9A 4A8XC 1A70A 4NQLB 2KAJA 2M56B 1MFWA 1I4PA 2ACZB 1UH6A 3H9DA 2IO1B 4NNJB 1FRRA 1KLUD 5CX3A 1XQQA 2DWQA 4GN1A 4K3CA 4A3PA 4HPPA 2B76B 4MH0E 1JROA 1E5WA 1V1OA 3H8HA 1WR1A 3VVWB 4LNNA 2KLGA 2CHXA 1SE2A 4TSSA 2ZZPB 1P3QU 2RPVA 2NBVB 4EOYA 1FXIA 2L76A 2PIAA 1ZXIA 4FJVB 3N30A 2KMCA 3RPFC 2HE7A 3NVZA 2N9LA 3VQIA 2CU1A 1UELA 2BKRB 4JQWC 2WDQB 1OEYJ 2N1WA 3QWZB 1X1MA 1GPXA 3QAQA 4P1BC 4MSQB 4N9F4 4BOZB 4MELA 4HDOA 4US9A 2X8XX 4DHJB 3TBLD 2WXOA 3ZO5B 2VH1A 4IM2A 3ETRA 1EF5A 2KWVB 2YEPB 3QK0A 3T8MA 1XLQA 2DHZA 4S0RA 3HVDA 4BBNF 2GLSA 1JWBD 1JQ4A 1YMHE 3TUOA 3AECB 4A9AA 4DXFA 4LNFA 2HD5B 4ZRPA 2KC1A 3PZ8A 1QZEA 1YIWA 2LWPA 3APCA 3ENEA 2LVPA 2L05A 5BMIA 2HDEA 4ZYNA 2GMIC 1Z5SB 2DZJA 4XC2A 1BXTA 2MWSB 3HRDD 1E10A 4B6WA 1YJ1A 5C3JB 3CSFA 4JWSC 4WAAA 1L2NA 4W9IA 1BMLC 2FIFA 1L5PA 1K52A 3AEDB 3DVNU 3RT3B 4YWGG 4C4VA 2JT4B 1WE7A 2D07B 2XK5B 4FHJA 3N3KB 5HG2A 1HQRD 3Q3MC 2NCNA 4W9KA 2MLBA 1ZGUB 1EWCA 2ZW1A 2VH2A 1NYRA 3RN9C 2AWTA 2K6QA 3TCAA 3ZJVA 2BWES 4XWWA 2JVCA 4EEWA 3VDZA 3AE9B 1K53A 4WAFA 5MPOA 4DDID 1FD6A 4C7ZA 5LXHA 3ZW3A 4ZHOA 5JH5C 3ABVB 4P7IA 3TEXA 1E8YA 2KVZA 2LASA 3R7QA 3QQ8B 1I42A 5BYSA 2KFJA 2J7QB 5LLIA 4MJSA 3U52E 3A1QB 4FXCA 4B95A 1OEYA 4TKNA 2IJ0A 1WMHB 2I2YA 1UWXA 3AV8A 3PS6A 1C4CA 1Q10A 1KLGD 1XT9B 1L0YB 4KIKA 3IBEA 2PLPA 4GDLB 2LGXA 3RNGC 4IW0A 3NRZA 4B0EA 2K8HA 5IA7A 3P4PB 2VRRB 2WXFA 3D32A 3BYYB 4W9HA 3H7PB 3ZNHB 2Y3AA 2BGFA 3Q8FA 4W9LA 4EZJA 3AE7B 4JGHB 1HTOA 3GP7A 4RGTA 3E56A 2NBUA 2PEAA 3ZTDA 2WWZA 3C19A 2BB6A 2JU6X 4MT5A 3ALBA 5JZEB 1V97A 4ITKA 2JPHA 3WAMA 2MBQA 1V1PB 3AE4B 3W2DA 2BYFA 4OVVA 4EKUA 2KACA 2PE9A 3KUDB 5H8YE 3AE3B 4ZRKA 3LJ3A 1ZDXA 3AM9A 5E6PA 4A6QA 4MGIE 2GOWA 3HM6X 3WA0A 1P7EA 3SFEB 3ZNZB 4NAMA 4NQKE 2BB5A 2N0SB 2O2VB 2ZCBA 4ACFA 3I3TB 2KN5A 1C79A 4ASWC 3LYYA 2BW2A 1WWTA 1NEKB 2DAFA 5DPWA 4ICUA 4ANWA 3IT6B 2QJLA 1T6BX 4QAYA 1E9MA 2WXLA 2MH7A 5JHAA 3Q2AC 1LQBA 1MG8A 3ML9A 4F1SA 4DDGD 1KJTA 4F8CB 5AZHA 2I38A 2MW5A 2MBOA 3L17A 1ISNA 3ZKJC 3KVFB 3RYTA 1XD3B 2OHFA 3KW5B 3PZDA 2ZW0A 1ZDVA 1E8WA 4MEMA 1F0ZA 2L32A 4E74A 2N7DA 1AYFA 1Q1OA 3HIZA 4YSXB 2MQJA 1L4DB 2WU5B 2MJDA 1XLOA 3APDA 2FCSA 1H8CA 2ZPYA 4BAXA 3MC8A 1SIJA 2ON8A 3ZVVA 2NS5A 2WS3B 2NTSA 2QDFA 1R4NB 1EF1A 1E7UA 3N1ZC 2I1KA 4JPSA 2FNJB 3PRMB 2D3CA 1TZ1A 2KFKB 2KDIA 4XE0A 1VLBA 3DBLI 1TTNA 3DQVA 4FULA 3QHTA 2KT7A 3AE2B 4RMAA 3I63C 4MSMB 3FILB 5DPSA 3RI7C 2KTRB 2KQSA 4S17A 1XCQL 2BWFA 4M0WA 2JUOA 2G45B 1L6UA 5EE3A 2KX0A
chains in the Genus database with same CATH topology
4GDKA 4NY0A 3AU5A 1WGGA 5DPRA 4BOSC 2IZVB 3PRPB 2LUEA 4WWOA 2BYVE 2EMTA 2FUHB 3OJ3A 1R4NI 4GU2A 3ZRCA 1WXSA 2KMAA 4OVUA 5KHOA 2PPHA 2KX3A 3A9JA 4KVGB 4ZRIA 4TQ0A 2O2VA 3A4SC 5AEKB 2JRHA 3ML8A 3V6EB 1C1YB 1WGYA 2KC2A 1KM7A 2KJHB 2NPTA 4GB9A 5LXIB 4AUQC 1FXTB 2KXJA 2L8JA 1U4AA 2AL3A 3JYUA 2EKEC 5G2NA 2FCMA 1RFAA 3PSEB 4NPNA 4B9KA 2ZVOA 4I6PA 2BYEA 3ZDMC 1Y8RC 2KZRA 3QA8A 2CKHB 3UGBB 2EMSA 1WGDA 2PE6B 3KUZA 2DAJA 4IWPA 3H7SA 4ZRJA 1ZKHA 3DPDA 2ZPNA 3U30A 2LD9A 3VTWA 2C7HA 2CHZA 2C9WB 3CF6E 1YX5B 3R3MA 5D7GA 1IYFA 1J8CA 3SHQA 3NY5A 1WJUA 3PT2B 3VUXA 3JSVB 2OJRA 2XBBC 2MA9B 4NQLB 1HE8A 3LDZE 3B08A 3X23A 1K8RB 1UH6A 1WM2A 4IWOA 3H9DA 2Z0EB 2IO1B 4MGKE 2KO3A 2C7MB 2KVRA 4NNJB 4DXAB 2CR5A 2JZZA 2N9PC 5CX3A 2J0MA 1WXAA 3SD5A 2UWQA 2D11A 4G0NB 1XQQA 4GN1A 3SU8X 4A3PA 2UYZB 4WJPA 4MH0E 3PPAA 4BVUC 4FA6A 5EDSA 1M94A 3WAPA 1E5WA 3P2BA 2RPQA 3PTFC 2M1MA 1WR1A 2HJ8A 3VVWB 1A5RA 1OQYA 2KLGA 2CHXA 2IY1B 2ZZPB 1WX8A 2AYOB 1P3QU 3A1QA 2V1YA 4AP4C 4TQ1A 2NBVB 1WMHA 4FLHA 2L0TA 4EOYA 2GBNA 3MHSD 1V5TA 2JZ3B 1WJ6A 2L76A 2NVUI 1CMXB 3DVNV 4FJVB 4W9FA 2A5UA 1Z2MA 4AJYB 2D3GA 3N30A 2N9XA 3DBHI 4GDLA 2KMCA 4PS8A 1WR6E 2LVOA 3W1SA 1L7YA 1OGWA 2DYBA 2HE7A 3GOEA 4JLCA 3O65B 4TV3A 3VH4B 3VQIA 4K7SA 2D10A 3ZDTA 2LRUA 2CU1A 1UELA 2BKRB 4G11A 4JQWC 3H7PA 1OEYJ 2N1WA 4HK2A 4MM3A 3QWZB 1X1MA 3CMMB 3QAQA 2KOXA 5CHFA 2MBBB 4MSQB 2Z59B 4N9F4 3QARA 4BOZB 4MELA 2RD0A 4HDOA 1J19A 4HJKA 2N4FA 4JL9A 4KZCA 1YQBA 3A9KA 3K9PB 4DHJB 3TBLD 3A33B 3DVGY 3HK0A 3R66C 3ZO5B 3M63B 5CTRC 2O6VB 4II2B 2MSED 4IM2A 5C23A 4EFOA 1AARA 1EF5A 2WYQA 2KWVB 3WALA 3QK0A 3T8MA 3IFWB 4J6IA 2DHZA 2FCQA 2KKCA 4BBNF 4E71A 1WRDB 4KV2A 1IP9A 4K1RB 4IM3A 2HD5B 3QC8B 4CO7A 1WFYA 3ZLZA 2KC1A 1QZEA 1YIWA 2LWPA 4GMVA 1E90A 1V81A 3U8ZA 1BT0A 1NDDA 3APCA 2DENB 2RR9A 3ENEA 1RRBA 2L3ZA 1Q0WB 2LVPA 2L05A 3L13A 2FCNA 4KSKC 3ZRFA 1V49A 2ZNVB 2GMIC 4PYUA 4ZYNA 1Z5SB 4WWPA 3RD2A 3KH0A 3HM3A 4NAWA 2DZMA 2DZJA 2KHWB 1GC6A 4XC2A 3WIMA 3ECIA 1I35A 1LM8B 2M0XA 2MWSB 2GBKA 4EZKA 4B6WA 5G55A 3VTUA 3NZSA 5IAAC 1E8ZA 1YJ1A 3CSFA 4M0WB 3DBSA 1P0RA 1UBQA 2IO2B 1WZ0A 1WGHA 4MGZE 4W9DA 4WAAA 4GDKB 3U7DA 4LDTB 4EUTA 1L2NA 4W9IA 2FIFA 2BF8B 4HPLB 1E8XA 3VHTC 2NBWB 3DVNU 3RT3B 2JT4B 5E6NA 4GOCA 4PS7A 2ZJDA 4DBGA 1WE7A 1WE6A 4W9GA 2D07B 2XK5B 1WF9A 3A9JB 4IM0A 3W1SC 4FHJA 2K8BA 3HHMA 3N3KB 3N32A 2A4ZA 2DZKA 5J18A 4CHKA 2DYMA 3DDCB 2NCNA 2Y5BB 4W9KA 2MLBA 1ZGUB 1V6EA 2LJ5A 1IPGA 4K81A 4RM8A 2G4SA 2AWTA 4WJNA 1WXVA 3VUYA 2K6QA 3TCAA 2KDEB 2C60A 2BWES 2ZVNA 2JVCA 1EO6A 5DPTA 3BINA 4EEWA 3L0WB 3VDZA 4HPMB 1LFDA 2AL6A 1R4MI 3QCAA 4ZDVA 3UQBA 4DDID 1GUAB 3UIOB 3NOBA 2K8CA 2J0KA 2KTFA 3RCZA 2IYDB 1T0YA 5LXHA 3A4RA 3ZW3A 4IWQA 3R7RA 2ZEQA 4K7UA 5JH5C 2JRIB 3B0AA 2IBIB 4P7IA 4WJQA 4JIOU 2O6VD 1E8YA 2IO0B 3AXCA 2MBHA 2KWUB 2XEWA 3IVFA 2LASA 5JHBA 1P9DU 3R7QA 3QQ8B 3WAOA 1I42A 4HCPB 3DOWA 2KFJA 1V5OA 4HWIB 2GBRA 2JXXA 2J7QB 2YLMA 1Q5WB 4FADA 5LLIA 4HLEA 4MJSA 4HCNB 4LJOB 2G4DB 3A1QB 4IUMB 4KDLB 5DCNA 4B95A 4DHZB 1OEYA 4GXBA 3UINB 1J0GA 4TKNA 1WMHB 4E3CA 4G3XB 3RZFA 3PS6A 1S3SG 2NR2A 2MRPA 4M8NA 2LGDA 2KLCA 5HKHA 5J17A 4NJ7A 1WX9A 1H4RA 4BKTA 3T9LA 3PRZA 3W1YA 3ONSA 1XT9B 4KIKA 2IY0B 4X57B 3H1UA 2L7RA 3IBEA 2BKFA 3B1LX 4GDLB 5CHVC 2LGXA 3EC8A 4IW0A 3RZWC 3EECA 1PQSA 3PV1A 2KJRA 2O6VA 2K8HA 2KFKA 5IA7A 3NHEB 3OJ4B 5GMVA 4EZLA 2PJHA 1VCBA 2VRRB 3D32A 3H6NA 4I6LB 2B3AA 4ANUA 4W9HA 3H7PB 3ZNHB 2K6DB 2BGFA 2LRWA 1VD2A 4MDKE 4DWFA 4W9LA 2RSUA 4FBJB 4EZJA 4JGHB 3VAWA 2MCNB 4ANXA 3EFUA 5KHQA 2JF5A 1YX6B 2KTRA 1UZXB 1NBFC 2KJ6A 1V9JA 4AWJA 2NBUA 2PEAA 2WDTB 3ZTDA 2L00B 2WWZA 4YL8A 1EUVB 1UD7A 3A9KB 3PVLA 4FHKA 3ALBA 5JZEB 2KDFB 4KSLC 3S2AA 2M17A 4KDIC 2JPHA 3WAMA 3Q3FA 2MBQA 3TL5A 2FIDA 3ZIMA 3VXWA 3DBRI 1KOTA 4KZ0A 4XZ4A 2BYFA 4OVVA 4EKUA 1TGZB 4M8MA 2KD0A 2PE9A 2LGYA 3KUDB 2M4NA 3DVGX 1UGMA 1F9JA 2JWZA 3ZUNA 4ZRKA 4A20A 3M3JA 3CSTA 1TBEA 3LJ3A 3PGEA 5D94A 1WGRA 2DZIA 5E6PA 2KNBA 2MP2B 4MGIE 2M8SA 2GOWA 3X0WA 3MTNB 2GBMA 2HTHA 1LXDA 2WX0A 3HM6X 4URKA 3WA0A 4DK5A 3ZNZB 4A3OA 3AI5A 2N1VA 2D2QA 2R2QA 3PHWB 4W9CA 1WH3A 1WX7A 4NQKE 4FJYA 5J2RA 4II3B 1WXMA 1P1AA 5TR5A 2XK5A 3KYCD 1WM3A 4NAWB 4BFRA 2O2VB 1D3ZA 3JSVA 4K7WA 1SIFA 5CHWA 2GBJA 2NPTB 4ICVA 5FR6A 2ZCBA 2AEHA 4BKSD 3NS8A 3VH3B 1G6JA 1RAXA 2QHOA 3OAWA 1ZW7A 2LXAA 1V2YA 3I3TB 4BKGA 2KN5A 3EHVA 4ASWC 4LCDE 1S1QB 1WY8A 4TUUA 1P98A 4FN2A 5L95C 1WYWB 3MJWA 1V86A 4BBNC 5AZGA 2G3QB 2DAFA 4GGQA 4ANVA 5DPWA 3UQAA 1JRUA 4W9EA 2REXA 3KUCB 3NZUA 4ICUA 4ANWA 5L83A 3V60A 4I6NB 2LVQA 3GZNI 2LI5A 2V4LA 4F7ZA 3PLVA 5AZFA 4HDQA 3PHXB 4DHJD 1SE9A 5JHAA 2CS4A 2FAZA 3ZTCA 1LQBA 1MG8A 3RULA 3ML9A 2LXCA 5D6JB 3M95A 2ASQA 3KYDD 3V62A 2C7NB 4DDGD 4F1SA 4CYEA 1KJTA 1WI0A 4F8CB 5E6OA 3RUIB 2KANA 2N9EB 4GIVA 1WZ3A 2R2OA 2KDBA 1UBIA 5AZHA 2MW5A 3L16A 2MBOA 3L17A 1ISNA 4IG7B 4BKSA 3QX1A 1C3TA 1YD8U 3ZKJC 2RGFA 2ZNVC 4RM9A 3KVFB 4WWNA 2C5LC 3RYTA 1XD3B 1WIAA 2IO3B 4MGYE 3SDLC 1WJNA 1E7VA 3KW5B 1GNUA 3PZDA 2K1FA 3BY4B 4HXDA 1E8WA 4MEMA 4LJPB 4E74A 2N7DA 1Q1OA 3QIJA 3HIZA 3AU4A 3Q3JA 2MQJA 3JW0X 3JVZX 3TIXA 1OTRB 3VUWA 3UIPB 2V3SA 1SGHA 2N7EA 3APDA 3TMPB 2K25A 2K39A 1WJ4A 3WANA 2DYOA 2FCSA 2I1JA 3IG3A 3PLUA 1H8CA 1RLFA 4MJSB 2ZPYA 3APFA 2CHWA 5BO4B 1GJZA 4LDTD 1KLVA 4HVBA 4IC7B 2J0JA 1V80A 2LZ6A 3ZVVA 2NS5A 3DCGA 3PREA 1GG3A 2W9NA 2Z0DB 5D2MB 4KIKB 3ZNID 1EF1A 1E7UA 2KK8A 4G50A 1NI2A 3ZNGC 2DX5B 2MX2A 2I1KA 3L08A 2WX1A 3TJPA 1GC7A 2L0FA 3IHPC 4AJWA 2FNJB 3PRMB 4GSWA 3V61A 2MBEA 4FJZA 5C1ZA 3AULA 4W9JA 3K9OB 3OLMD 3M62B 1TZ1A 3C0RB 2KFKB 2KDIA 3DBLI 2YVCA 2ZCCA 1TTNA 3DQVA 3V6CB 2JY6A 4FULA 3QHTA 2KQ7A 2KWCA 2OOBB 3L54A 4NJ6A 3VTVA 4PYZA 4DHZE 2BPSA 4PS3A 4RMAA 3QJZA 4MSMB 5DPSA 3UF8A 2KTRB 2KQSA 4XX5A 3VFKA 2BWFA 4AOFA 4WQOB 3L10B 2MP2A 4WJOA 2JUOA 2G45B 2KX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GDK A;  4NY0 A;  3AU5 A;  1WGG A;  5DPR A;  4BOS C;  2IZV B;  3PRP B;  2LUE A;  4WWO A;  2BYV E;  2EMT A;  2FUH B;  3OJ3 A;  1R4N I;  4GU2 A;  3ZRC A;  1WXS A;  2KMA A;  4OVU A;  5KHO A;  2PPH A;  2KX3 A;  3A9J A;  4KVG B;  4ZRI A;  4TQ0 A;  2O2V A;  3A4S C;  5AEK B;  2JRH A;  3ML8 A;  3V6E B;  1C1Y B;  1WGY A;  2KC2 A;  1KM7 A;  2KJH B;  2NPT A;  4GB9 A;  5LXI B;  4AUQ C;  1FXT B;  2KXJ A;  2L8J A;  1U4A A;  2AL3 A;  3JYU A;  2EKE C;  5G2N A;  2FCM A;  1RFA A;  3PSE B;  4NPN A;  4B9K A;  2ZVO A;  4I6P A;  2BYE A;  3ZDM C;  1Y8R C;  2KZR A;  3QA8 A;  2CKH B;  3UGB B;  2EMS A;  1WGD A;  2PE6 B;  3KUZ A;  2DAJ A;  4IWP A;  3H7S A;  4ZRJ A;  1ZKH A;  3DPD A;  2ZPN A;  3U30 A;  2LD9 A;  3VTW A;  2C7H A;  2CHZ A;  2C9W B;  3CF6 E;  1YX5 B;  3R3M A;  5D7G A;  1IYF A;  1J8C A;  3SHQ A;  3NY5 A;  1WJU A;  3PT2 B;  3VUX A;  3JSV B;  2OJR A;  2XBB C;  2MA9 B;  4NQL B;  1HE8 A;  3LDZ E;  3B08 A;  3X23 A;  1K8R B;  1UH6 A;  1WM2 A;  4IWO A;  3H9D A;  2Z0E B;  2IO1 B;  4MGK E;  2KO3 A;  2C7M B;  2KVR A;  4NNJ B;  4DXA B;  2CR5 A;  2JZZ A;  2N9P C;  5CX3 A;  2J0M A;  1WXA A;  3SD5 A;  2UWQ A;  2D11 A;  4G0N B;  1XQQ A;  4GN1 A;  3SU8 X;  4A3P A;  2UYZ B;  4WJP A;  4MH0 E;  3PPA A;  4BVU C;  4FA6 A;  5EDS A;  1M94 A;  3WAP A;  1E5W A;  3P2B A;  2RPQ A;  3PTF C;  2M1M A;  1WR1 A;  2HJ8 A;  3VVW B;  1A5R A;  1OQY A;  2KLG A;  2CHX A;  2IY1 B;  2ZZP B;  1WX8 A;  2AYO B;  1P3Q U;  3A1Q A;  2V1Y A;  4AP4 C;  4TQ1 A;  2NBV B;  1WMH A;  4FLH A;  2L0T A;  4EOY A;  2GBN A;  3MHS D;  1V5T A;  2JZ3 B;  1WJ6 A;  2L76 A;  2NVU I;  1CMX B;  3DVN V;  4FJV B;  4W9F A;  2A5U A;  1Z2M A;  4AJY B;  2D3G A;  3N30 A;  2N9X A;  3DBH I;  4GDL A;  2KMC A;  4PS8 A;  1WR6 E;  2LVO A;  3W1S A;  1L7Y A;  1OGW A;  2DYB A;  2HE7 A;  3GOE A;  4JLC A;  3O65 B;  4TV3 A;  3VH4 B;  3VQI A;  4K7S A;  2D10 A;  3ZDT A;  2LRU A;  2CU1 A;  1UEL A;  2BKR B;  4G11 A;  4JQW C;  3H7P A;  1OEY J;  2N1W A;  4HK2 A;  4MM3 A;  3QWZ B;  1X1M A;  3CMM B;  3QAQ A;  2KOX A;  5CHF A;  2MBB B;  4MSQ B;  2Z59 B;  4N9F 4;  3QAR A;  4BOZ B;  4MEL A;  2RD0 A;  4HDO A;  1J19 A;  4HJK A;  2N4F A;  4JL9 A;  4KZC A;  1YQB A;  3A9K A;  3K9P B;  4DHJ B;  3TBL D;  3A33 B;  3DVG Y;  3HK0 A;  3R66 C;  3ZO5 B;  3M63 B;  5CTR C;  2O6V B;  4II2 B;  2MSE D;  4IM2 A;  5C23 A;  4EFO A;  1AAR A;  1EF5 A;  2WYQ A;  2KWV B;  3WAL A;  3QK0 A;  3T8M A;  3IFW B;  4J6I A;  2DHZ A;  2FCQ A;  2KKC A;  4BBN F;  4E71 A;  1WRD B;  4KV2 A;  1IP9 A;  4K1R B;  4IM3 A;  2HD5 B;  3QC8 B;  4CO7 A;  1WFY A;  3ZLZ A;  2KC1 A;  1QZE A;  1YIW A;  2LWP A;  4GMV A;  1E90 A;  1V81 A;  3U8Z A;  1BT0 A;  1NDD A;  3APC A;  2DEN B;  2RR9 A;  3ENE A;  1RRB A;  2L3Z A;  1Q0W B;  2LVP A;  2L05 A;  3L13 A;  2FCN A;  4KSK C;  3ZRF A;  1V49 A;  2ZNV B;  2GMI C;  4PYU A;  4ZYN A;  1Z5S B;  4WWP A;  3RD2 A;  3KH0 A;  3HM3 A;  4NAW A;  2DZM A;  2DZJ A;  2KHW B;  1GC6 A;  4XC2 A;  3WIM A;  3ECI A;  1I35 A;  1LM8 B;  2M0X A;  2MWS B;  2GBK A;  4EZK A;  4B6W A;  5G55 A;  3VTU A;  3NZS A;  5IAA C;  1E8Z A;  1YJ1 A;  3CSF A;  4M0W B;  3DBS A;  1P0R A;  1UBQ A;  2IO2 B;  1WZ0 A;  1WGH A;  4MGZ E;  4W9D A;  4WAA A;  4GDK B;  3U7D A;  4LDT B;  4EUT A;  1L2N A;  4W9I A;  2FIF A;  2BF8 B;  4HPL B;  1E8X A;  3VHT C;  2NBW B;  3DVN U;  3RT3 B;  2JT4 B;  5E6N A;  4GOC A;  4PS7 A;  2ZJD A;  4DBG A;  1WE7 A;  1WE6 A;  4W9G A;  2D07 B;  2XK5 B;  1WF9 A;  3A9J B;  4IM0 A;  3W1S C;  4FHJ A;  2K8B A;  3HHM A;  3N3K B;  3N32 A;  2A4Z A;  2DZK A;  5J18 A;  4CHK A;  2DYM A;  3DDC B;  2NCN A;  2Y5B B;  4W9K A;  2MLB A;  1ZGU B;  1V6E A;  2LJ5 A;  1IPG A;  4K81 A;  4RM8 A;  2G4S A;  2AWT A;  4WJN A;  1WXV A;  3VUY A;  2K6Q A;  3TCA A;  2KDE B;  2C60 A;  2BWE S;  2ZVN A;  2JVC A;  1EO6 A;  5DPT A;  3BIN A;  4EEW A;  3L0W B;  3VDZ A;  4HPM B;  1LFD A;  2AL6 A;  1R4M I;  3QCA A;  4ZDV A;  3UQB A;  4DDI D;  1GUA B;  3UIO B;  3NOB A;  2K8C A;  2J0K A;  2KTF A;  3RCZ A;  2IYD B;  1T0Y A;  5LXH A;  3A4R A;  3ZW3 A;  4IWQ A;  3R7R A;  2ZEQ A;  4K7U A;  5JH5 C;  2JRI B;  3B0A A;  2IBI B;  4P7I A;  4WJQ A;  4JIO U;  2O6V D;  1E8Y A;  2IO0 B;  3AXC A;  2MBH A;  2KWU B;  2XEW A;  3IVF A;  2LAS A;  5JHB A;  1P9D U;  3R7Q A;  3QQ8 B;  3WAO A;  1I42 A;  4HCP B;  3DOW A;  2KFJ A;  1V5O A;  4HWI B;  2GBR A;  2JXX A;  2J7Q B;  2YLM A;  1Q5W B;  4FAD A;  5LLI A;  4HLE A;  4MJS A;  4HCN B;  4LJO B;  2G4D B;  3A1Q B;  4IUM B;  4KDL B;  5DCN A;  4B95 A;  4DHZ B;  1OEY A;  4GXB A;  3UIN B;  1J0G A;  4TKN A;  1WMH B;  4E3C A;  4G3X B;  3RZF A;  3PS6 A;  1S3S G;  2NR2 A;  2MRP A;  4M8N A;  2LGD A;  2KLC A;  5HKH A;  5J17 A;  4NJ7 A;  1WX9 A;  1H4R A;  4BKT A;  3T9L A;  3PRZ A;  3W1Y A;  3ONS A;  1XT9 B;  4KIK A;  2IY0 B;  4X57 B;  3H1U A;  2L7R A;  3IBE A;  2BKF A;  3B1L X;  4GDL B;  5CHV C;  2LGX A;  3EC8 A;  4IW0 A;  3RZW C;  3EEC A;  1PQS A;  3PV1 A;  2KJR A;  2O6V A;  2K8H A;  2KFK A;  5IA7 A;  3NHE B;  3OJ4 B;  5GMV A;  4EZL A;  2PJH A;  1VCB A;  2VRR B;  3D32 A;  3H6N A;  4I6L B;  2B3A A;  4ANU A;  4W9H A;  3H7P B;  3ZNH B;  2K6D B;  2BGF A;  2LRW A;  1VD2 A;  4MDK E;  4DWF A;  4W9L A;  2RSU A;  4FBJ B;  4EZJ A;  4JGH B;  3VAW A;  2MCN B;  4ANX A;  3EFU A;  5KHQ A;  2JF5 A;  1YX6 B;  2KTR A;  1UZX B;  1NBF C;  2KJ6 A;  1V9J A;  4AWJ A;  2NBU A;  2PEA A;  2WDT B;  3ZTD A;  2L00 B;  2WWZ A;  4YL8 A;  1EUV B;  1UD7 A;  3A9K B;  3PVL A;  4FHK A;  3ALB A;  5JZE B;  2KDF B;  4KSL C;  3S2A A;  2M17 A;  4KDI C;  2JPH A;  3WAM A;  3Q3F A;  2MBQ A;  3TL5 A;  2FID A;  3ZIM A;  3VXW A;  3DBR I;  1KOT A;  4KZ0 A;  4XZ4 A;  2BYF A;  4OVV A;  4EKU A;  1TGZ B;  4M8M A;  2KD0 A;  2PE9 A;  2LGY A;  3KUD B;  2M4N A;  3DVG X;  1UGM A;  1F9J A;  2JWZ A;  3ZUN A;  4ZRK A;  4A20 A;  3M3J A;  3CST A;  1TBE A;  3LJ3 A;  3PGE A;  5D94 A;  1WGR A;  2DZI A;  5E6P A;  2KNB A;  2MP2 B;  4MGI E;  2M8S A;  2GOW A;  3X0W A;  3MTN B;  2GBM A;  2HTH A;  1LXD A;  2WX0 A;  3HM6 X;  4URK A;  3WA0 A;  4DK5 A;  3ZNZ B;  4A3O A;  3AI5 A;  2N1V A;  2D2Q A;  2R2Q A;  3PHW B;  4W9C A;  1WH3 A;  1WX7 A;  4NQK E;  4FJY A;  5J2R A;  4II3 B;  1WXM A;  1P1A A;  5TR5 A;  2XK5 A;  3KYC D;  1WM3 A;  4NAW B;  4BFR A;  2O2V B;  1D3Z A;  3JSV A;  4K7W A;  1SIF A;  5CHW A;  2GBJ A;  2NPT B;  4ICV A;  5FR6 A;  2ZCB A;  2AEH A;  4BKS D;  3NS8 A;  3VH3 B;  1G6J A;  1RAX A;  2QHO A;  3OAW A;  1ZW7 A;  2LXA A;  1V2Y A;  3I3T B;  4BKG A;  2KN5 A;  3EHV A;  4ASW C;  4LCD E;  1S1Q B;  1WY8 A;  4TUU A;  1P98 A;  4FN2 A;  5L95 C;  1WYW B;  3MJW A;  1V86 A;  4BBN C;  5AZG A;  2G3Q B;  2DAF A;  4GGQ A;  4ANV A;  5DPW A;  3UQA A;  1JRU A;  4W9E A;  2REX A;  3KUC B;  3NZU A;  4ICU A;  4ANW A;  5L83 A;  3V60 A;  4I6N B;  2LVQ A;  3GZN I;  2LI5 A;  2V4L A;  4F7Z A;  3PLV A;  5AZF A;  4HDQ A;  3PHX B;  4DHJ D;  1SE9 A;  5JHA A;  2CS4 A;  2FAZ A;  3ZTC A;  1LQB A;  1MG8 A;  3RUL A;  3ML9 A;  2LXC A;  5D6J B;  3M95 A;  2ASQ A;  3KYD D;  3V62 A;  2C7N B;  4DDG D;  4F1S A;  4CYE A;  1KJT A;  1WI0 A;  4F8C B;  5E6O A;  3RUI B;  2KAN A;  2N9E B;  4GIV A;  1WZ3 A;  2R2O A;  2KDB A;  1UBI A;  5AZH A;  2MW5 A;  3L16 A;  2MBO A;  3L17 A;  1ISN A;  4IG7 B;  4BKS A;  3QX1 A;  1C3T A;  1YD8 U;  3ZKJ C;  2RGF A;  2ZNV C;  4RM9 A;  3KVF B;  4WWN A;  2C5L C;  3RYT A;  1XD3 B;  1WIA A;  2IO3 B;  4MGY E;  3SDL C;  1WJN A;  1E7V A;  3KW5 B;  1GNU A;  3PZD A;  2K1F A;  3BY4 B;  4HXD A;  1E8W A;  4MEM A;  4LJP B;  4E74 A;  2N7D A;  1Q1O A;  3QIJ A;  3HIZ A;  3AU4 A;  3Q3J A;  2MQJ A;  3JW0 X;  3JVZ X;  3TIX A;  1OTR B;  3VUW A;  3UIP B;  2V3S A;  1SGH A;  2N7E A;  3APD A;  3TMP B;  2K25 A;  2K39 A;  1WJ4 A;  3WAN A;  2DYO A;  2FCS A;  2I1J A;  3IG3 A;  3PLU A;  1H8C A;  1RLF A;  4MJS B;  2ZPY A;  3APF A;  2CHW A;  5BO4 B;  1GJZ A;  4LDT D;  1KLV A;  4HVB A;  4IC7 B;  2J0J A;  1V80 A;  2LZ6 A;  3ZVV A;  2NS5 A;  3DCG A;  3PRE A;  1GG3 A;  2W9N A;  2Z0D B;  5D2M B;  4KIK B;  3ZNI D;  1EF1 A;  1E7U A;  2KK8 A;  4G50 A;  1NI2 A;  3ZNG C;  2DX5 B;  2MX2 A;  2I1K A;  3L08 A;  2WX1 A;  3TJP A;  1GC7 A;  2L0F A;  3IHP C;  4AJW A;  2FNJ B;  3PRM B;  4GSW A;  3V61 A;  2MBE A;  4FJZ A;  5C1Z A;  3AUL A;  4W9J A;  3K9O B;  3OLM D;  3M62 B;  1TZ1 A;  3C0R B;  2KFK B;  2KDI A;  3DBL I;  2YVC A;  2ZCC A;  1TTN A;  3DQV A;  3V6C B;  2JY6 A;  4FUL A;  3QHT A;  2KQ7 A;  2KWC A;  2OOB B;  3L54 A;  4NJ6 A;  3VTV A;  4PYZ A;  4DHZ E;  2BPS A;  4PS3 A;  4RMA A;  3QJZ A;  4MSM B;  5DPS A;  3UF8 A;  2KTR B;  2KQS A;  4XX5 A;  3VFK A;  2BWF A;  4AOF A;  4WQO B;  3L10 B;  2MP2 A;  4WJO A;  2JUO A;  2G45 B;  2KX0 A; 
#chains in the Genus database with same CATH topology
 3AU5 A;  1WRI A;  2JYT A;  3TSS A;  1BUI C;  1T0S C;  2V0G A;  4GU2 A;  1R4N I;  2KX3 A;  4ZRI A;  3A4S C;  2JRH A;  3ML8 A;  1C1Y B;  2M19 A;  1RFA A;  4AS1 A;  4B9K A;  2BYE A;  3QA8 A;  1DOX A;  2PE6 B;  3FAH A;  4IWP A;  2LD9 A;  3P42 A;  2PMV A;  2CHZ A;  3BVM A;  1HZ6 A;  2GB1 A;  1WJU A;  4RFB A;  4DQO C;  1IUE A;  3SFD B;  3JSV B;  2OJR A;  4DXG A;  3BII D;  2H88 B;  1AWD A;  3DWG C;  3B08 A;  3R8B A;  1K8R B;  4DXA B;  2PTL A;  2CR5 A;  4KGT A;  2LFI A;  3SD5 A;  4G0N B;  3SU8 X;  2ONQ A;  3RNF C;  2J4X A;  3VRB B;  4FA6 A;  5EDS A;  1M94 A;  3P2B A;  2XNA C;  3RNB C;  1FNU A;  2FBW B;  2BVC A;  1OQY A;  2AQ1 B;  5HHD G;  1WX8 A;  3BK2 A;  3Q8A A;  2FUG 1;  2J53 A;  2CJN A;  1V5T A;  2E3T A;  1WJ6 A;  1Z2M A;  3EFC A;  2J42 A;  4PS8 A;  1YQ3 B;  1L7Y A;  1OGW A;  1T0Q C;  3B2F A;  2K5P A;  4P16 A;  2LRU A;  2QIL A;  1PGX A;  3Q8E A;  4UDU C;  3PZ7 A;  3P4Q B;  1J7A A;  4MM3 A;  1RYJ A;  2V9H A;  3ZGZ A;  2IGG A;  3CMM B;  2KOX A;  5CHF A;  4ZOH C;  1C4P A;  2RD0 A;  2BTE A;  4JL9 A;  1YQB A;  3A33 B;  3HK0 A;  2SEB D;  3M63 B;  4XGA B;  5C23 A;  4EFO A;  2WXG A;  2JZP A;  2UU7 A;  1GAQ B;  3WAL A;  4YSY B;  3IFW B;  1JCK B;  4J6I A;  2FCQ A;  4E71 A;  4YTN B;  2VZK D;  1IP9 A;  2IPK D;  4IM3 A;  1TKY A;  3QC8 B;  3U4E G;  4RGM A;  3DHI C;  3ZLZ A;  3B2G A;  1MHH E;  4GMV A;  4LNK A;  1E90 A;  1BT0 A;  4KSK C;  1I4Q A;  2FCN A;  1V49 A;  3MHZ A;  1TT5 B;  4MAC A;  2N9K A;  4NAW A;  3HM3 A;  3WIM A;  1I35 A;  1D5Z C;  3ECI A;  1LM8 B;  2M0X A;  3T3O A;  4XDC A;  5G55 A;  5IAA C;  2IO2 B;  4MGZ E;  4N6E B;  1FRD A;  2WGS A;  1VR9 A;  2OJW A;  2WP9 B;  4HPL B;  1SB3 C;  3NVW A;  1YJJ A;  2TSS A;  5G5H A;  4W9G A;  2LEK A;  1WF9 A;  3A9J B;  4IM0 A;  3W1S C;  2K8B A;  2W82 A;  3HHM A;  2DZK A;  4KGR A;  2DYM A;  2Y5B B;  2WXM A;  4ZHP A;  2LJ5 A;  4RM8 A;  1XXG A;  3VUY A;  2KDE B;  3L0W B;  1YN3 A;  3RMK C;  1E7P B;  1L4Z B;  2PVO D;  1ZUD 2;  1T0Y A;  2JQR B;  3DHH C;  3EGR A;  2NTT A;  4IWQ A;  4K7U A;  2JRI B;  3B0A A;  1TY0 A;  3Q8B A;  4JIO U;  3AEE B;  2IO0 B;  5G5G A;  1V8C A;  3IVF A;  1YN5 A;  5JHB A;  2WDV B;  4HWI B;  2KQ4 X;  2YLM A;  4C7Y A;  3NS1 A;  4FAD A;  5DCN A;  2G4D B;  3URY A;  3MJ5 A;  3C8Y A;  4ZRQ A;  5HKH A;  5J17 A;  1WX9 A;  1JWM D;  3AEG B;  3PRZ A;  3H1U A;  2L7R A;  3B1L X;  3PV1 A;  1C9F A;  1GOZ A;  4EE2 A;  5GMV A;  4EZL A;  1FM0 D;  3AH7 A;  1QT9 A;  3H6N A;  4I6L B;  2B3A A;  2BS3 B;  2CJO A;  1CJE A;  2K6D B;  2LRW A;  1VD2 A;  3OWE B;  5EE0 A;  2RSU A;  4FBJ B;  3VAW A;  2V3N A;  3I5J C;  2QCZ A;  2JF5 A;  3Q6B A;  1UZX B;  3NVY A;  2KJ6 A;  3W5U B;  1EUV B;  1UD7 A;  1QOB A;  4FHK A;  1K50 A;  1NEN B;  2KDF B;  3S2A A;  2M17 A;  2RDB C;  4KDI C;  2PKO A;  2WXQ A;  3Q3F A;  2QIE B;  3NVV A;  2IGD A;  3BVG A;  4M8M A;  2KD0 A;  3NJT A;  2M4N A;  2RDG A;  3DVG X;  1TS4 A;  1J7C A;  3PGE A;  5D94 A;  3DHG C;  2KNB A;  4H2A A;  3MC0 B;  2WHI A;  3BK1 A;  2WX0 A;  4DK5 A;  4GLS C;  2R2Q A;  1WH3 A;  1WX7 A;  4NJC A;  1HTQ A;  4II3 B;  1P1A A;  4D2K A;  5TR5 A;  2XK5 A;  1C78 A;  4K7W A;  2BQQ A;  2AEH A;  4BKS D;  3VH3 B;  1ZOY B;  2LXA A;  4KX6 B;  4LCD E;  1S1Q B;  1WY8 A;  4C4V B;  2J52 A;  1P98 A;  1CK1 A;  1WYW B;  1RM6 C;  4LNO A;  1V86 A;  5AZG A;  4ANV A;  4OZA A;  2V4I B;  3KUC B;  1FCC C;  3V60 A;  1K51 A;  3GZN I;  2HJ1 A;  3PLV A;  4KKI A;  2MJE A;  1J7B A;  2KN4 A;  2CS4 A;  2FAZ A;  3AMZ A;  3RUL A;  1T5X D;  4CYE A;  3ZXV A;  1WI0 A;  5E6O A;  3RUI B;  4XDD A;  2KAN A;  3GB1 A;  1C3T A;  4BKS A;  3QX1 A;  1YD8 U;  1HEZ E;  1F2R I;  1WGK A;  3SDL C;  1E7V A;  1GNU A;  2K1F A;  5I4D A;  1PFD A;  2MEK A;  4LJP B;  3N20 C;  3TIX A;  3VUW A;  3UIP B;  1XLP A;  1FXA A;  3TMP B;  2K39 A;  2LJI A;  2I1J A;  3IG3 A;  4MJS B;  4LDT D;  1OFF A;  1WSP A;  2LZ6 A;  4M00 A;  3PRE A;  4HRO A;  4LK0 M;  1GG3 A;  2W9N A;  4KIK B;  4G50 A;  4ZYS A;  3Q3O C;  2DX5 B;  2MHJ A;  3IHP C;  4AJW A;  4GSW A;  3OLM D;  3M62 B;  2BS4 B;  5T8I A;  2YVC A;  2ZCC A;  2WXI A;  2WU2 B;  3V6C B;  4NJ6 A;  2KQ7 A;  2OOB B;  1EU4 A;  4YT0 B;  3QJZ A;  2DLB A;  4AOF A;  2BS2 B;  3FC4 A;  4GDK A;  5DPR A;  4BOS C;  1UUP A;  2LUE A;  1TKE A;  2RMM A;  2EMT A;  2KMA A;  1NI3 A;  2LMC A;  4WQM A;  3I9V 1;  2JX5 A;  1TZO A;  1N63 A;  2O2V A;  3V6E B;  2KC2 A;  2KJH B;  1KM7 A;  4GB9 A;  5LXI B;  4IOI E;  2WXJ A;  2QMT A;  1U4A A;  3JYU A;  1KRH A;  1MVK A;  1SBB B;  4I6P A;  1Y8R C;  2KZR A;  2CKH B;  2EMS A;  1PUT A;  1WGD A;  3U30 A;  1ZKH A;  3DPD A;  3PO0 A;  3BYT B;  1IYF A;  4TMA B;  2JYE A;  1JWS D;  2BYT A;  1ESF A;  2HTM E;  4ARI A;  2JZZ A;  1WXA A;  2UWQ A;  2UYZ B;  1D4B A;  3PPA A;  4BVU C;  4OZC A;  1IGC A;  2KWD A;  3WAP A;  3PTF C;  2HJ8 A;  1HZ5 A;  1A5R A;  2LHE A;  2IY1 B;  2AYO B;  4AP4 C;  5FR3 A;  4TQ1 A;  2L0T A;  2IND C;  2JZ3 B;  2NVU I;  1CMX B;  3T3N A;  2EKI A;  4W9F A;  3DBL B;  5HFY A;  4HKZ E;  2N9X A;  1YN4 A;  3B9J A;  2WDR B;  4B0M A;  1D5M C;  3DBH I;  5IOI A;  1L0V B;  1WR6 E;  2LVO A;  2DYB A;  3GOE A;  4JLC A;  3O65 B;  4K7S A;  3BVZ A;  2H89 B;  3UI3 A;  3W5V B;  3HVZ A;  5E6J A;  1IGD A;  1QQR A;  4G11 A;  2Y5P A;  4LTU A;  3TEW A;  2L83 A;  4HK2 A;  2CU3 A;  2MBB B;  3QAR A;  4XWT A;  1J19 A;  1F77 A;  4HJK A;  1KH0 A;  4KZC A;  3A9K A;  1MG4 A;  3Q69 A;  5CTR C;  2O6V B;  1AAR A;  2DNF A;  4L1B A;  3R2T A;  4KGS A;  2KKC A;  2JWU A;  3MC9 A;  3RNA C;  3O13 A;  3ZYY X;  1FNV A;  4KV2 A;  4P1C C;  4CO7 A;  1DOI A;  4L2Y A;  2FE8 A;  2DEN B;  1RRB A;  2L3Z A;  1Q0W B;  3KLS X;  4J3O D;  2DZM A;  2KHW B;  1GC6 A;  4A55 A;  3RNC C;  2GBK A;  4EZK A;  1IBX A;  2WNM A;  3NZS A;  2WXN A;  4M0W B;  3DBS A;  4W9D A;  1WZ0 A;  1WGH A;  4EUT A;  5JXV A;  3ZJU A;  2BF8 B;  2NBW B;  3MFG A;  5E6N A;  4PS7 A;  1VZ8 A;  3AEA B;  1QKZ A;  2D3B A;  2JXT A;  2A4Z A;  3N32 A;  3RFZ B;  2K22 A;  4CHK A;  3DDC B;  2W3S A;  1V6E A;  4L23 A;  1IPG A;  4K81 A;  3GE3 C;  3SEB A;  1JWA D;  4WJN A;  1ZE3 D;  2WXK A;  2C60 A;  5DPT A;  3BIN A;  4MH8 A;  4HPM B;  3GE8 C;  1JW9 D;  1LFD A;  2AL6 A;  1R4M I;  2X38 A;  3QCA A;  3UQB A;  3BZD B;  1YNT E;  3NOB A;  2KTF A;  2Y5C A;  3RCZ A;  3TEY A;  3R7R A;  1C4A A;  2ZEQ A;  1R7S A;  1VZ7 A;  2IBI B;  1FPY A;  1ACC A;  1GB1 A;  1JAL A;  1STE A;  2XEW A;  1OQR A;  5FKA C;  4RF1 A;  1FIQ A;  3AE1 B;  4HCP B;  3DOW A;  1V5O A;  2GBR A;  1EM7 A;  4C80 A;  1FO4 A;  4HCN B;  5LNK 1;  4LJO B;  4KDL B;  4IUM B;  4GXB A;  1J0G A;  5HI1 A;  4E3C A;  1N5W A;  4G3X B;  2JSV X;  2WXR A;  2LGD A;  2KLC A;  3CIR B;  4BKT A;  3W1Y A;  1HA5 A;  3VR8 B;  4X57 B;  1MI0 A;  3DBR B;  1EU3 A;  4JX1 C;  1DYQ A;  5CHV C;  1F2R C;  3RZW C;  1PQS A;  1SJE D;  3AEB B;  1KTK A;  3OJ4 B;  2PJH A;  4DWF A;  4MDK E;  4MM3 B;  1EWY C;  4RNA A;  2MCN B;  2AX5 A;  1YX6 B;  1NBF C;  4AWJ A;  2WDT B;  2INC C;  4R3D A;  3PVL A;  1TKG A;  2YEP F;  3V05 A;  2WQY B;  1RWS A;  2LUM A;  3ZIM A;  1CQV A;  3DBR I;  1N60 A;  4KZ0 A;  1ZXH A;  2LGY A;  5AUI A;  1UGM A;  1F9J A;  2JWZ A;  3ZUN A;  4A20 A;  1RFK A;  1TBE A;  2DZI A;  2MP2 B;  2M8S A;  2HTH A;  1LXD A;  1NYQ A;  3IT4 B;  4P6V F;  1TS3 A;  4RCO A;  1AN8 A;  3AI5 A;  4A3O A;  4FJY A;  4NAW B;  4BFR A;  3HUI A;  1D3Z A;  1SIF A;  5CHW A;  2GBJ A;  2NPT B;  4ICV A;  3IAM 1;  5C2T B;  2N7J A;  3NS8 A;  1G6J A;  1V2Y A;  4BKG A;  3KWV A;  1YJI A;  3N1Y C;  4BZA A;  4TUU A;  5L95 C;  4M02 A;  2GI9 A;  3MJW A;  4BBN C;  2G3Q B;  4W9E A;  1KF6 B;  2REX A;  3NZU A;  5L83 A;  4I6N B;  2LVQ A;  2V4L A;  1ZP0 B;  2D5G A;  4WUR A;  3PHX B;  4DHJ D;  1SE9 A;  2W54 A;  2IDY A;  2IGH A;  1Y56 A;  3LB8 C;  5D6J B;  1B1Z A;  2ASQ A;  3KYD D;  4A90 A;  4OHJ A;  4WWM A;  1WZ3 A;  2R2O A;  2KDB A;  1FCL A;  2ZNV C;  1VZ6 A;  3AE6 B;  2C5L C;  3IAS 1;  1PYW D;  5BYR A;  4OW0 A;  3BY4 B;  2K9X A;  4C00 A;  3DWM A;  3JW0 X;  3JVZ X;  1OTR B;  5AUK A;  4CQN A;  3N9Y C;  2K25 A;  1WJ4 A;  3PLU A;  4NZL B;  1KLV A;  4IC7 B;  1VRA B;  4RGN A;  2LGS A;  4HJG E;  1UWM A;  1UNS A;  3ZXR A;  2Z0D B;  5D2M B;  3AE5 B;  3ZNI D;  2R61 A;  2KK8 A;  1MPE A;  1GC7 A;  2L0F A;  3V61 A;  2MBE A;  4FJZ A;  3AUL A;  2M0A A;  3C0R B;  2KYW A;  2JY6 A;  3U2S C;  2KWC A;  3L54 A;  4DHZ E;  2XN9 C;  2BPS A;  4PS3 A;  4WJO A;  1FNW A;  4LNI A;  4NY0 A;  1WGG A;  3RNE C;  1FFV A;  2IZV B;  3GZN B;  3PRP B;  2BYV E;  2FUH B;  3ZRC A;  1WXS A;  1DGJ A;  4OVU A;  5KHO A;  4KVG B;  4TQ0 A;  3W9C B;  4Q2J A;  1N61 A;  1FXT B;  2KXJ A;  4M01 A;  2AL3 A;  1E6E B;  2EKE C;  5G2N A;  3PSE B;  1L6V A;  3ZDM C;  1NVI D;  1D5X C;  3NZ3 A;  2INN E;  2DAJ A;  2PVG C;  3V3X A;  3VTW A;  2C9W B;  2V3P A;  3FKY A;  5D7G A;  3SHQ A;  3U7Z A;  3PT2 B;  3VUX A;  2XBB C;  2MA9 B;  1TS2 A;  3P4R B;  5FK9 C;  1HE8 A;  3LDZ E;  3P1M A;  3X23 A;  1WM2 A;  1XCT L;  4IWO A;  2Z0E B;  4MGK E;  2KO3 A;  2C7M B;  2KVR A;  3VR9 B;  2N9P C;  1OQQ A;  2J0M A;  2D11 A;  4WJP A;  5IN7 A;  1JWU D;  2RPQ A;  2M1M A;  1XF5 L;  3MP9 A;  3Q8C A;  1LGR A;  3A1Q A;  2V1Y A;  1WMH A;  4FLH A;  2GBN A;  3MHS D;  1I4G A;  4YTM B;  1QOF A;  3DVN V;  2A5U A;  4N58 A;  4AJY B;  2D3G A;  4GDL A;  3W1S A;  4HEA 1;  4WH4 A;  3NG0 A;  1LO5 D;  4TV3 A;  4IDI A;  3VH4 B;  2D10 A;  3ZDT A;  1ROE A;  1MHX A;  2L1A A;  2DBY A;  3H7P A;  2Z59 B;  1T0R C;  3CWI A;  2BT6 A;  1B9R A;  4USA A;  1C77 A;  1C76 A;  1I7H A;  2ICI A;  2N4F A;  1XLN A;  3K9P B;  2INP E;  4XYC A;  3DVG Y;  3R66 C;  1DOY A;  4II2 B;  2MSE D;  2WYQ A;  1V1P A;  1SF0 A;  3EUB 2;  3J9C A;  2EEL A;  3BWU D;  1WRD B;  3N1X C;  1PGB A;  4K1R B;  4PK1 A;  1WFY A;  4O1N A;  1V81 A;  3U8Z A;  1NDD A;  2RR9 A;  3L13 A;  3ZRF A;  2ZNV B;  4PYU A;  4WWP A;  3RD2 A;  3KH0 A;  3AEF B;  1QOA A;  2KDM A;  3Q3N C;  1KFY B;  3VTU A;  1E8Z A;  3IXS A;  1P0R A;  1UBQ A;  4YTP B;  1WXQ A;  4GDK B;  4LDT B;  3U7D A;  5EE1 A;  2Q5W D;  1TIF A;  1E8X A;  3VHT C;  1GB4 A;  4GOC A;  2ZJD A;  4DBG A;  3P63 A;  1WE6 A;  3SR6 A;  1TYG B;  1P7F A;  5J18 A;  1T3Q A;  4KKJ A;  1HXY D;  3DBH B;  2NMQ A;  2G4S A;  1WXV A;  1XEE A;  1E0Z A;  1QLB B;  2ZVN A;  1EO6 A;  1TJE A;  4ZDV A;  1GUA B;  5D3I B;  3UIO B;  4RH6 A;  2K8C A;  2J0K A;  2IYD B;  3A4R A;  3I57 A;  4US8 A;  4WJQ A;  2WXP A;  2O6V D;  3AXC A;  2MBH A;  2KWU B;  1N6Z A;  1P9D U;  5BMH A;  3WAO A;  1F52 A;  2JXX A;  1Q5W B;  4HLE A;  2L52 A;  1SE4 A;  4DHZ B;  3UIN B;  1PGA A;  1XO3 A;  3L4P A;  1QIL A;  3RZF A;  1S3S G;  2NR2 A;  2MRP A;  4M8N A;  3OG5 A;  4NJ7 A;  4JWU C;  2K0P A;  2G9H D;  1H4R A;  3T9L A;  4JE3 B;  3ONS A;  2IY0 B;  2BKF A;  3EC8 A;  1ET6 A;  3KQ4 A;  3EEC A;  4YSZ B;  4AQ7 A;  2KJR A;  4HKQ A;  2O6V A;  2KFK A;  3NHE B;  2LHD A;  4REZ A;  1VCB A;  4ANU A;  1MJD A;  1FEH A;  3FIL A;  1WYG A;  3EFU A;  4ANX A;  5KHQ A;  2KTR A;  2G1E A;  1ET9 A;  1V9J A;  1SXT A;  2L00 B;  2KMM A;  1UF0 A;  3Q14 C;  4YL8 A;  3A9K B;  4KSL C;  3TL5 A;  2FID A;  3VXW A;  1KOT A;  4XZ4 A;  2LGI A;  1TGZ B;  3LXF A;  3M3J A;  3CST A;  1R4M B;  1WGR A;  3X0W A;  3MTN B;  1AW7 A;  2GBM A;  4URK A;  1VDV A;  3E9S A;  2N1V A;  2D2Q A;  3PHW B;  4W9C A;  5J2R A;  2QC8 A;  1WXM A;  2RDH A;  1WM3 A;  3KYC D;  2AQ3 B;  3JSV A;  1SE3 A;  4C56 C;  1SEB D;  3AE8 B;  1IBX B;  5FR6 A;  4LLG M;  1RAX A;  2QHO A;  3OAW A;  1ZW7 A;  2OED A;  3EHV A;  2MJ3 A;  4FN2 A;  3EA6 A;  3TEZ A;  3AB5 A;  2Z8L A;  3WCQ A;  4GGQ A;  4RGO S;  1N5X A;  3UQA A;  4ARC A;  1JRU A;  2WLB A;  5GXG B;  2LI5 A;  4F7Z A;  1TS5 A;  4N59 A;  4OVZ A;  1N62 A;  1SSN A;  5AZF A;  4HDQ A;  1TY2 A;  3ZTC A;  2LXC A;  3M95 A;  3V62 A;  2C7N B;  2WXH A;  1ZPS A;  3AN1 A;  3KWL A;  3R2I A;  2N9E B;  4GIV A;  5BYQ A;  1UBI A;  3L16 A;  4IG7 B;  2RGF A;  5TSS A;  4RM9 A;  4WWN A;  1FMA D;  1WIA A;  2IO3 B;  4MGY E;  1WJN A;  4HXD A;  3QIJ A;  3AU4 A;  4PT5 A;  3Q3J A;  4RF0 A;  1JRP A;  2V3S A;  1SGH A;  2N7E A;  2W55 A;  3WAN A;  2DYO A;  3VRA B;  1RLF A;  3APF A;  1UGJ A;  2CHW A;  5BO4 B;  1GJZ A;  1M4V A;  4HVB A;  1VJK A;  2J0J A;  3GS2 A;  1V80 A;  3DCG A;  2D3A A;  2E6X A;  1YOV B;  1YQ4 B;  2AQ2 B;  4WIP A;  1NI2 A;  4HRS A;  3ZNG C;  2MX2 A;  3L08 A;  2W3R A;  2WX1 A;  3TJP A;  3ZQ4 A;  2SAK A;  2QSD A;  5C1Z A;  4W9J A;  3K9O B;  1I4H A;  1CZP A;  1QOG A;  3VTV A;  4PYZ A;  5IKC M;  3UF8 A;  1PDX A;  2GRI A;  4XX5 A;  3VFK A;  4WQO B;  3L10 B;  2MP2 A;  4IKG A;  4OZB A;  3NUH B;  5IP4 D;  3P4S B;  2BBC A;  3ZJT A;  4WWO A;  4YXD B;  5BMG A;  3OJ3 A;  2PPH A;  3A9J A;  1I4X A;  2K3U A;  1D6E C;  5AEK B;  1ENF A;  1WGY A;  2NPT A;  5EE9 A;  5D3D A;  1QF6 A;  1I4R A;  4AUQ C;  1F1H A;  2L8J A;  1L0X B;  5IO9 A;  2FCM A;  4NPN A;  5H92 C;  2ZVO A;  1FFU A;  3UGB B;  3KUZ A;  4K3B A;  3H7S A;  4ZRJ A;  2ZPN A;  2C7H A;  3CF6 E;  1YX5 B;  3R3M A;  2QEJ C;  1J8C A;  1SJH D;  2VZK B;  1JML A;  3NY5 A;  2PW9 A;  4A8X C;  1A70 A;  4NQL B;  2KAJ A;  2M56 B;  1MFW A;  1I4P A;  2ACZ B;  1UH6 A;  3H9D A;  2IO1 B;  4NNJ B;  1FRR A;  1KLU D;  5CX3 A;  1XQQ A;  2DWQ A;  4GN1 A;  4K3C A;  4A3P A;  4HPP A;  2B76 B;  4MH0 E;  1JRO A;  1E5W A;  1V1O A;  3H8H A;  1WR1 A;  3VVW B;  4LNN A;  2KLG A;  2CHX A;  1SE2 A;  4TSS A;  2ZZP B;  1P3Q U;  2RPV A;  2NBV B;  4EOY A;  1FXI A;  2L76 A;  2PIA A;  1ZXI A;  4FJV B;  3N30 A;  2KMC A;  3RPF C;  2HE7 A;  3NVZ A;  2N9L A;  3VQI A;  2CU1 A;  1UEL A;  2BKR B;  4JQW C;  2WDQ B;  1OEY J;  2N1W A;  3QWZ B;  1X1M A;  1GPX A;  3QAQ A;  4P1B C;  4MSQ B;  4N9F 4;  4BOZ B;  4MEL A;  4HDO A;  4US9 A;  2X8X X;  4DHJ B;  3TBL D;  2WXO A;  3ZO5 B;  2VH1 A;  4IM2 A;  3ETR A;  1EF5 A;  2KWV B;  2YEP B;  3QK0 A;  3T8M A;  1XLQ A;  2DHZ A;  4S0R A;  3HVD A;  4BBN F;  2GLS A;  1JWB D;  1JQ4 A;  1YMH E;  3TUO A;  3AEC B;  4A9A A;  4DXF A;  4LNF A;  2HD5 B;  4ZRP A;  2KC1 A;  3PZ8 A;  1QZE A;  1YIW A;  2LWP A;  3APC A;  3ENE A;  2LVP A;  2L05 A;  5BMI A;  2HDE A;  4ZYN A;  2GMI C;  1Z5S B;  2DZJ A;  4XC2 A;  1BXT A;  2MWS B;  3HRD D;  1E10 A;  4B6W A;  1YJ1 A;  5C3J B;  3CSF A;  4JWS C;  4WAA A;  1L2N A;  4W9I A;  1BML C;  2FIF A;  1L5P A;  1K52 A;  3AED B;  3DVN U;  3RT3 B;  4YWG G;  4C4V A;  2JT4 B;  1WE7 A;  2D07 B;  2XK5 B;  4FHJ A;  3N3K B;  5HG2 A;  1HQR D;  3Q3M C;  2NCN A;  4W9K A;  2MLB A;  1ZGU B;  1EWC A;  2ZW1 A;  2VH2 A;  1NYR A;  3RN9 C;  2AWT A;  2K6Q A;  3TCA A;  3ZJV A;  2BWE S;  4XWW A;  2JVC A;  4EEW A;  3VDZ A;  3AE9 B;  1K53 A;  4WAF A;  5MPO A;  4DDI D;  1FD6 A;  4C7Z A;  5LXH A;  3ZW3 A;  4ZHO A;  5JH5 C;  3ABV B;  4P7I A;  3TEX A;  1E8Y A;  2KVZ A;  2LAS A;  3R7Q A;  3QQ8 B;  1I42 A;  5BYS A;  2KFJ A;  2J7Q B;  5LLI A;  4MJS A;  3U52 E;  3A1Q B;  4FXC A;  4B95 A;  1OEY A;  4TKN A;  2IJ0 A;  1WMH B;  2I2Y A;  1UWX A;  3AV8 A;  3PS6 A;  1C4C A;  1Q10 A;  1KLG D;  1XT9 B;  1L0Y B;  4KIK A;  3IBE A;  2PLP A;  4GDL B;  2LGX A;  3RNG C;  4IW0 A;  3NRZ A;  4B0E A;  2K8H A;  5IA7 A;  3P4P B;  2VRR B;  2WXF A;  3D32 A;  3BYY B;  4W9H A;  3H7P B;  3ZNH B;  2Y3A A;  2BGF A;  3Q8F A;  4W9L A;  4EZJ A;  3AE7 B;  4JGH B;  1HTO A;  3GP7 A;  4RGT A;  3E56 A;  2NBU A;  2PEA A;  3ZTD A;  2WWZ A;  3C19 A;  2BB6 A;  2JU6 X;  4MT5 A;  3ALB A;  5JZE B;  1V97 A;  4ITK A;  2JPH A;  3WAM A;  2MBQ A;  1V1P B;  3AE4 B;  3W2D A;  2BYF A;  4OVV A;  4EKU A;  2KAC A;  2PE9 A;  3KUD B;  5H8Y E;  3AE3 B;  4ZRK A;  3LJ3 A;  1ZDX A;  3AM9 A;  5E6P A;  4A6Q A;  4MGI E;  2GOW A;  3HM6 X;  3WA0 A;  1P7E A;  3SFE B;  3ZNZ B;  4NAM A;  4NQK E;  2BB5 A;  2N0S B;  2O2V B;  2ZCB A;  4ACF A;  3I3T B;  2KN5 A;  1C79 A;  4ASW C;  3LYY A;  2BW2 A;  1WWT A;  1NEK B;  2DAF A;  5DPW A;  4ICU A;  4ANW A;  3IT6 B;  2QJL A;  1T6B X;  4QAY A;  1E9M A;  2WXL A;  2MH7 A;  5JHA A;  3Q2A C;  1LQB A;  1MG8 A;  3ML9 A;  4F1S A;  4DDG D;  1KJT A;  4F8C B;  5AZH A;  2I38 A;  2MW5 A;  2MBO A;  3L17 A;  1ISN A;  3ZKJ C;  3KVF B;  3RYT A;  1XD3 B;  2OHF A;  3KW5 B;  3PZD A;  2ZW0 A;  1ZDV A;  1E8W A;  4MEM A;  1F0Z A;  2L32 A;  4E74 A;  2N7D A;  1AYF A;  1Q1O A;  3HIZ A;  4YSX B;  2MQJ A;  1L4D B;  2WU5 B;  2MJD A;  1XLO A;  3APD A;  2FCS A;  1H8C A;  2ZPY A;  4BAX A;  3MC8 A;  1SIJ A;  2ON8 A;  3ZVV A;  2NS5 A;  2WS3 B;  2NTS A;  2QDF A;  1R4N B;  1EF1 A;  1E7U A;  3N1Z C;  2I1K A;  4JPS A;  2FNJ B;  3PRM B;  2D3C A;  1TZ1 A;  2KFK B;  2KDI A;  4XE0 A;  1VLB A;  3DBL I;  1TTN A;  3DQV A;  4FUL A;  3QHT A;  2KT7 A;  3AE2 B;  4RMA A;  3I63 C;  4MSM B;  3FIL B;  5DPS A;  3RI7 C;  2KTR B;  2KQS A;  4S17 A;  1XCQ L;  2BWF A;  4M0W A;  2JUO A;  2G45 B;  1L6U A;  5EE3 A;  2KX0 A; 
#chains in the Genus database with same CATH homology
 4GDK A;  4NY0 A;  3AU5 A;  1WGG A;  5DPR A;  4BOS C;  2IZV B;  3PRP B;  2LUE A;  4WWO A;  2BYV E;  2EMT A;  2FUH B;  3OJ3 A;  1R4N I;  4GU2 A;  3ZRC A;  1WXS A;  2KMA A;  4OVU A;  5KHO A;  2PPH A;  2KX3 A;  3A9J A;  4KVG B;  4ZRI A;  4TQ0 A;  2O2V A;  3A4S C;  5AEK B;  2JRH A;  3ML8 A;  3V6E B;  1C1Y B;  1WGY A;  2KC2 A;  1KM7 A;  2KJH B;  2NPT A;  4GB9 A;  5LXI B;  4AUQ C;  1FXT B;  2KXJ A;  2L8J A;  1U4A A;  2AL3 A;  3JYU A;  2EKE C;  5G2N A;  2FCM A;  1RFA A;  3PSE B;  4NPN A;  4B9K A;  2ZVO A;  4I6P A;  2BYE A;  3ZDM C;  1Y8R C;  2KZR A;  3QA8 A;  2CKH B;  3UGB B;  2EMS A;  1WGD A;  2PE6 B;  3KUZ A;  2DAJ A;  4IWP A;  3H7S A;  4ZRJ A;  1ZKH A;  3DPD A;  2ZPN A;  3U30 A;  2LD9 A;  3VTW A;  2C7H A;  2CHZ A;  2C9W B;  3CF6 E;  1YX5 B;  3R3M A;  5D7G A;  1IYF A;  1J8C A;  3SHQ A;  3NY5 A;  1WJU A;  3PT2 B;  3VUX A;  3JSV B;  2OJR A;  2XBB C;  2MA9 B;  4NQL B;  1HE8 A;  3LDZ E;  3B08 A;  3X23 A;  1K8R B;  1UH6 A;  1WM2 A;  4IWO A;  3H9D A;  2Z0E B;  2IO1 B;  4MGK E;  2KO3 A;  2C7M B;  2KVR A;  4NNJ B;  4DXA B;  2CR5 A;  2JZZ A;  2N9P C;  5CX3 A;  2J0M A;  1WXA A;  3SD5 A;  2UWQ A;  2D11 A;  4G0N B;  1XQQ A;  4GN1 A;  3SU8 X;  4A3P A;  2UYZ B;  4WJP A;  4MH0 E;  3PPA A;  4BVU C;  4FA6 A;  5EDS A;  1M94 A;  3WAP A;  1E5W A;  3P2B A;  2RPQ A;  3PTF C;  2M1M A;  1WR1 A;  2HJ8 A;  3VVW B;  1A5R A;  1OQY A;  2KLG A;  2CHX A;  2IY1 B;  2ZZP B;  1WX8 A;  2AYO B;  1P3Q U;  3A1Q A;  2V1Y A;  4AP4 C;  4TQ1 A;  2NBV B;  1WMH A;  4FLH A;  2L0T A;  4EOY A;  2GBN A;  3MHS D;  1V5T A;  2JZ3 B;  1WJ6 A;  2L76 A;  2NVU I;  1CMX B;  3DVN V;  4FJV B;  4W9F A;  2A5U A;  1Z2M A;  4AJY B;  2D3G A;  3N30 A;  2N9X A;  3DBH I;  4GDL A;  2KMC A;  4PS8 A;  1WR6 E;  2LVO A;  3W1S A;  1L7Y A;  1OGW A;  2DYB A;  2HE7 A;  3GOE A;  4JLC A;  3O65 B;  4TV3 A;  3VH4 B;  3VQI A;  4K7S A;  2D10 A;  3ZDT A;  2LRU A;  2CU1 A;  1UEL A;  2BKR B;  4G11 A;  4JQW C;  3H7P A;  1OEY J;  2N1W A;  4HK2 A;  4MM3 A;  3QWZ B;  1X1M A;  3CMM B;  3QAQ A;  2KOX A;  5CHF A;  2MBB B;  4MSQ B;  2Z59 B;  4N9F 4;  3QAR A;  4BOZ B;  4MEL A;  2RD0 A;  4HDO A;  1J19 A;  4HJK A;  2N4F A;  4JL9 A;  4KZC A;  1YQB A;  3A9K A;  3K9P B;  4DHJ B;  3TBL D;  3A33 B;  3DVG Y;  3HK0 A;  3R66 C;  3ZO5 B;  3M63 B;  5CTR C;  2O6V B;  4II2 B;  2MSE D;  4IM2 A;  5C23 A;  4EFO A;  1AAR A;  1EF5 A;  2WYQ A;  2KWV B;  3WAL A;  3QK0 A;  3T8M A;  3IFW B;  4J6I A;  2DHZ A;  2FCQ A;  2KKC A;  4BBN F;  4E71 A;  1WRD B;  4KV2 A;  1IP9 A;  4K1R B;  4IM3 A;  2HD5 B;  3QC8 B;  4CO7 A;  1WFY A;  3ZLZ A;  2KC1 A;  1QZE A;  1YIW A;  2LWP A;  4GMV A;  1E90 A;  1V81 A;  3U8Z A;  1BT0 A;  1NDD A;  3APC A;  2DEN B;  2RR9 A;  3ENE A;  1RRB A;  2L3Z A;  1Q0W B;  2LVP A;  2L05 A;  3L13 A;  2FCN A;  4KSK C;  3ZRF A;  1V49 A;  2ZNV B;  2GMI C;  4PYU A;  4ZYN A;  1Z5S B;  4WWP A;  3RD2 A;  3KH0 A;  3HM3 A;  4NAW A;  2DZM A;  2DZJ A;  2KHW B;  1GC6 A;  4XC2 A;  3WIM A;  3ECI A;  1I35 A;  1LM8 B;  2M0X A;  2MWS B;  2GBK A;  4EZK A;  4B6W A;  5G55 A;  3VTU A;  3NZS A;  5IAA C;  1E8Z A;  1YJ1 A;  3CSF A;  4M0W B;  3DBS A;  1P0R A;  1UBQ A;  2IO2 B;  1WZ0 A;  1WGH A;  4MGZ E;  4W9D A;  4WAA A;  4GDK B;  3U7D A;  4LDT B;  4EUT A;  1L2N A;  4W9I A;  2FIF A;  2BF8 B;  4HPL B;  1E8X A;  3VHT C;  2NBW B;  3DVN U;  3RT3 B;  2JT4 B;  5E6N A;  4GOC A;  4PS7 A;  2ZJD A;  4DBG A;  1WE7 A;  1WE6 A;  4W9G A;  2D07 B;  2XK5 B;  1WF9 A;  3A9J B;  4IM0 A;  3W1S C;  4FHJ A;  2K8B A;  3HHM A;  3N3K B;  3N32 A;  2A4Z A;  2DZK A;  5J18 A;  4CHK A;  2DYM A;  3DDC B;  2NCN A;  2Y5B B;  4W9K A;  2MLB A;  1ZGU B;  1V6E A;  2LJ5 A;  1IPG A;  4K81 A;  4RM8 A;  2G4S A;  2AWT A;  4WJN A;  1WXV A;  3VUY A;  2K6Q A;  3TCA A;  2KDE B;  2C60 A;  2BWE S;  2ZVN A;  2JVC A;  1EO6 A;  5DPT A;  3BIN A;  4EEW A;  3L0W B;  3VDZ A;  4HPM B;  1LFD A;  2AL6 A;  1R4M I;  3QCA A;  4ZDV A;  3UQB A;  4DDI D;  1GUA B;  3UIO B;  3NOB A;  2K8C A;  2J0K A;  2KTF A;  3RCZ A;  2IYD B;  1T0Y A;  5LXH A;  3A4R A;  3ZW3 A;  4IWQ A;  3R7R A;  2ZEQ A;  4K7U A;  5JH5 C;  2JRI B;  3B0A A;  2IBI B;  4P7I A;  4WJQ A;  4JIO U;  2O6V D;  1E8Y A;  2IO0 B;  3AXC A;  2MBH A;  2KWU B;  2XEW A;  3IVF A;  2LAS A;  5JHB A;  1P9D U;  3R7Q A;  3QQ8 B;  3WAO A;  1I42 A;  4HCP B;  3DOW A;  2KFJ A;  1V5O A;  4HWI B;  2GBR A;  2JXX A;  2J7Q B;  2YLM A;  1Q5W B;  4FAD A;  5LLI A;  4HLE A;  4MJS A;  4HCN B;  4LJO B;  2G4D B;  3A1Q B;  4IUM B;  4KDL B;  5DCN A;  4B95 A;  4DHZ B;  1OEY A;  4GXB A;  3UIN B;  1J0G A;  4TKN A;  1WMH B;  4E3C A;  4G3X B;  3RZF A;  3PS6 A;  1S3S G;  2NR2 A;  2MRP A;  4M8N A;  2LGD A;  2KLC A;  5HKH A;  5J17 A;  4NJ7 A;  1WX9 A;  1H4R A;  4BKT A;  3T9L A;  3PRZ A;  3W1Y A;  3ONS A;  1XT9 B;  4KIK A;  2IY0 B;  4X57 B;  3H1U A;  2L7R A;  3IBE A;  2BKF A;  3B1L X;  4GDL B;  5CHV C;  2LGX A;  3EC8 A;  4IW0 A;  3RZW C;  3EEC A;  1PQS A;  3PV1 A;  2KJR A;  2O6V A;  2K8H A;  2KFK A;  5IA7 A;  3NHE B;  3OJ4 B;  5GMV A;  4EZL A;  2PJH A;  1VCB A;  2VRR B;  3D32 A;  3H6N A;  4I6L B;  2B3A A;  4ANU A;  4W9H A;  3H7P B;  3ZNH B;  2K6D B;  2BGF A;  2LRW A;  1VD2 A;  4MDK E;  4DWF A;  4W9L A;  2RSU A;  4FBJ B;  4EZJ A;  4JGH B;  3VAW A;  2MCN B;  4ANX A;  3EFU A;  5KHQ A;  2JF5 A;  1YX6 B;  2KTR A;  1UZX B;  1NBF C;  2KJ6 A;  1V9J A;  4AWJ A;  2NBU A;  2PEA A;  2WDT B;  3ZTD A;  2L00 B;  2WWZ A;  4YL8 A;  1EUV B;  1UD7 A;  3A9K B;  3PVL A;  4FHK A;  3ALB A;  5JZE B;  2KDF B;  4KSL C;  3S2A A;  2M17 A;  4KDI C;  2JPH A;  3WAM A;  3Q3F A;  2MBQ A;  3TL5 A;  2FID A;  3ZIM A;  3VXW A;  3DBR I;  1KOT A;  4KZ0 A;  4XZ4 A;  2BYF A;  4OVV A;  4EKU A;  1TGZ B;  4M8M A;  2KD0 A;  2PE9 A;  2LGY A;  3KUD B;  2M4N A;  3DVG X;  1UGM A;  1F9J A;  2JWZ A;  3ZUN A;  4ZRK A;  4A20 A;  3M3J A;  3CST A;  1TBE A;  3LJ3 A;  3PGE A;  5D94 A;  1WGR A;  2DZI A;  5E6P A;  2KNB A;  2MP2 B;  4MGI E;  2M8S A;  2GOW A;  3X0W A;  3MTN B;  2GBM A;  2HTH A;  1LXD A;  2WX0 A;  3HM6 X;  4URK A;  3WA0 A;  4DK5 A;  3ZNZ B;  4A3O A;  3AI5 A;  2N1V A;  2D2Q A;  2R2Q A;  3PHW B;  4W9C A;  1WH3 A;  1WX7 A;  4NQK E;  4FJY A;  5J2R A;  4II3 B;  1WXM A;  1P1A A;  5TR5 A;  2XK5 A;  3KYC D;  1WM3 A;  4NAW B;  4BFR A;  2O2V B;  1D3Z A;  3JSV A;  4K7W A;  1SIF A;  5CHW A;  2GBJ A;  2NPT B;  4ICV A;  5FR6 A;  2ZCB A;  2AEH A;  4BKS D;  3NS8 A;  3VH3 B;  1G6J A;  1RAX A;  2QHO A;  3OAW A;  1ZW7 A;  2LXA A;  1V2Y A;  3I3T B;  4BKG A;  2KN5 A;  3EHV A;  4ASW C;  4LCD E;  1S1Q B;  1WY8 A;  4TUU A;  1P98 A;  4FN2 A;  5L95 C;  1WYW B;  3MJW A;  1V86 A;  4BBN C;  5AZG A;  2G3Q B;  2DAF A;  4GGQ A;  4ANV A;  5DPW A;  3UQA A;  1JRU A;  4W9E A;  2REX A;  3KUC B;  3NZU A;  4ICU A;  4ANW A;  5L83 A;  3V60 A;  4I6N B;  2LVQ A;  3GZN I;  2LI5 A;  2V4L A;  4F7Z A;  3PLV A;  5AZF A;  4HDQ A;  3PHX B;  4DHJ D;  1SE9 A;  5JHA A;  2CS4 A;  2FAZ A;  3ZTC A;  1LQB A;  1MG8 A;  3RUL A;  3ML9 A;  2LXC A;  5D6J B;  3M95 A;  2ASQ A;  3KYD D;  3V62 A;  2C7N B;  4DDG D;  4F1S A;  4CYE A;  1KJT A;  1WI0 A;  4F8C B;  5E6O A;  3RUI B;  2KAN A;  2N9E B;  4GIV A;  1WZ3 A;  2R2O A;  2KDB A;  1UBI A;  5AZH A;  2MW5 A;  3L16 A;  2MBO A;  3L17 A;  1ISN A;  4IG7 B;  4BKS A;  3QX1 A;  1C3T A;  1YD8 U;  3ZKJ C;  2RGF A;  2ZNV C;  4RM9 A;  3KVF B;  4WWN A;  2C5L C;  3RYT A;  1XD3 B;  1WIA A;  2IO3 B;  4MGY E;  3SDL C;  1WJN A;  1E7V A;  3KW5 B;  1GNU A;  3PZD A;  2K1F A;  3BY4 B;  4HXD A;  1E8W A;  4MEM A;  4LJP B;  4E74 A;  2N7D A;  1Q1O A;  3QIJ A;  3HIZ A;  3AU4 A;  3Q3J A;  2MQJ A;  3JW0 X;  3JVZ X;  3TIX A;  1OTR B;  3VUW A;  3UIP B;  2V3S A;  1SGH A;  2N7E A;  3APD A;  3TMP B;  2K25 A;  2K39 A;  1WJ4 A;  3WAN A;  2DYO A;  2FCS A;  2I1J A;  3IG3 A;  3PLU A;  1H8C A;  1RLF A;  4MJS B;  2ZPY A;  3APF A;  2CHW A;  5BO4 B;  1GJZ A;  4LDT D;  1KLV A;  4HVB A;  4IC7 B;  2J0J A;  1V80 A;  2LZ6 A;  3ZVV A;  2NS5 A;  3DCG A;  3PRE A;  1GG3 A;  2W9N A;  2Z0D B;  5D2M B;  4KIK B;  3ZNI D;  1EF1 A;  1E7U A;  2KK8 A;  4G50 A;  1NI2 A;  3ZNG C;  2DX5 B;  2MX2 A;  2I1K A;  3L08 A;  2WX1 A;  3TJP A;  1GC7 A;  2L0F A;  3IHP C;  4AJW A;  2FNJ B;  3PRM B;  4GSW A;  3V61 A;  2MBE A;  4FJZ A;  5C1Z A;  3AUL A;  4W9J A;  3K9O B;  3OLM D;  3M62 B;  1TZ1 A;  3C0R B;  2KFK B;  2KDI A;  3DBL I;  2YVC A;  2ZCC A;  1TTN A;  3DQV A;  3V6C B;  2JY6 A;  4FUL A;  3QHT A;  2KQ7 A;  2KWC A;  2OOB B;  3L54 A;  4NJ6 A;  3VTV A;  4PYZ A;  4DHZ E;  2BPS A;  4PS3 A;  4RMA A;  3QJZ A;  4MSM B;  5DPS A;  3UF8 A;  2KTR B;  2KQS A;  4XX5 A;  3VFK A;  2BWF A;  4AOF A;  4WQO B;  3L10 B;  2MP2 A;  4WJO A;  2JUO A;  2G45 B;  2KX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...