1XCTL

Complex hcv core-fab 19d9d6-protein l mutant (d55a, l57h, y64w) in space group p21212
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
70
structure length
70
Chain Sequence
TPEEPKEEVTIKVNLIFADGKIQTAEFKGTFEEATAEAYRYAALHAKVNGEWTADLEDGGNHMNIKFAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Capsid protein C
publication title Different crystal packing in Fab-protein L semi-disordered peptide complex.
pubmed doi rcsb
source organism Finegoldia magna
total genus 15
structure length 70
sequence length 70
chains with identical sequence M
ec nomenclature
pdb deposition date 2004-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1xctL00
1GB4A 4WH4A 4D2KA 1K53A 2QMTA 1XCTL 2JU6X 2I2YA 2PTLA 4KGTA 5JXVA 1MHHE 1F2RC 1P7EA 1JMLA 4OZBA 1IGDA 2IGHA 2N9LA 5HHDG 1FCCC 2JZPA 4KGRA 1K50A 3FILA 4GLSC 2KDMA 1KH0A 2J53A 5BMIA 2JXTA 2J52A 2RPVA 4MACA 1GB1A 2OEDA 1HEZE 1P7FA 1FD6A 4IKGA 1K52A 2KACA 2KN4A 4KGSA 1MHXA 1QKZA 2KQ4X 1YMHE 2PLPA 1MVKA 1XCQL 4OZCA 2LUMA 1K51A 2ZW1A 2EELA 3UI3A 1HZ5A 1IBXA 1IBXB 3MP9A 1IGCA 1PGBA 1C9FA 2GB1A 4HKZE 1PGXA 2N7JA 1ZXHA 2N9KA 5BMHA 2NMQA 2KWDA 1D4BA 2JSVX 1MPEA 1YNTE 2LGIA 2K0PA 3V3XA 2JWUA 4HJGE 1MI0A 1Q10A 2I38A 4IOIE 1EM7A 5HG2A 5HFYA 2QSDA 5BMGA 2ONQA 2RMMA 5HI1A 1PGAA 2ZW0A 1HZ6A 3FILB 2IGDA 2PW9A 1FCLA 1F2RI 2IGGA 2LHDA 4OZAA 1XF5L 2ON8A 2GI9A 2LHEA 1UWXA 3GB1A
chains in the Genus database with same CATH superfamily
2FIDA 4KZ0A 1KF6B 2WXJA 2O2VB 1P7EA 4N58A 3SDLC 3AE1B 2SAKA 2L3ZA 2MLBA 2R2QA 1NYRA 5CHVC 1OEYA 1WX8A 4ZHOA 5J18A 4GGQA 2AL3A 2IY0B 3HM6X 1JW9D 2MHJA 1D3ZA 2W3RA 5D7GA 3DBHI 4HXDA 3VRAB 4IG7B 1BUIC 1NEKB 2KNBA 2V4LA 1AWDA 2KX0A 3CWIA 1F1HA 2SEBD 1EWYC 5JH5C 3NUHB 2BKRB 3RNBC 2KYWA 1IGCA 4EZKA 1I4RA 1WXAA 4M8NA 1E9MA 3ZJTA 2AWTA 4WWNA 1SBBB 3Q8FA 1AARA 4ITKA 5G55A 1ZGUB 3T3OA 2KFKB 2I38A 4S0RA 3RD2A 2KN5A 3H1UA 2WXLA 2ZJDA 1WJ6A 2K39A 3BVGA 1UUPA 2RMMA 1UZXB 1NYQA 1WXQA 4GSWA 2G4SA 2RR9A 2KC2A 1RAXA 4REZA 4HVBA 2RD0A 1SB3C 2L52A 2NBVB 3R2IA 3R2TA 1OGWA 4HPMB 2KANA 1XLNA 3HVDA 1WE7A 3W1SA 1MG8A 4RGOS 3DBLB 4C00A 4IM0A 3NS8A 3RZWC 1K50A 4XE0A 1C78A 3BY4B 1E0ZA 3EECA 5EDSA 1QILA 1STEA 3X23A 2FNJB 4GDKB 2MP2A 1GB1A 4ICVA 3H9DA 4B0MA 1QKZA 2M0AA 4JIOU 1C4PA 2RSUA 3TEXA 2HJ1A 2N7DA 2JY6A 2LUMA 2KFJA 5KHQA 3A9KA 4BKGA 2ZW1A 2OJWA 1WM2A 4PK1A 3JW0X 2Y3AA 2LGDA 4MGYE 1XD3B 2L00B 2MBBB 4C4VB 2HJ8A 1P98A 2WS3B 1J7BA 1DYQA 1V1PA 4HEA1 3K9OB 1RFKA 1HTOA 3Q8CA 1MPEA 4JX1C 1MJDA 3PGEA 3R7RA 2GBKA 2YEPF 4N6EB 2FCSA 1N62A 2KD0A 2W54A 4G3XB 1TKGA 1WH3A 3AE3B 5DPTA 2LRWA 4K3CA 2KJ6A 4LJPB 4PT5A 4IW0A 3APDA 3IFWB 3VTVA 4M02A 1B9RA 1JWBD 1XLPA 2GBJA 4B6WA 2M17A 4A55A 2NPTB 1E6EB 1T0SC 2NR2A 3AE8B 3J9CA 3IG3A 4JLCA 1ZDVA 3ZRFA 4WJPA 2LMCA 3RCZA 4KSKC 4WQOB 4EZJA 2FCQA 1E5WA 1V81A 1J0GA 4YT0B 4HROA 1KLUD 4GMVA 1T3QA 1V2YA 4W9EA 2L0TA 2OOBB 2BPSA 4NAWA 5EE0A 4ANXA 1JQ4A 4GLSC 1WXSA 4RGMA 4DHZB 1OFFA 2NVUI 3N9YC 3HVZA 1WX7A 2KDMA 4NJ7A 1YJ1A 1EO6A 2MJ3A 2OEDA 3NOBA 2BKFA 1K52A 4JWUC 2INNE 1RYJA 3W9CB 3WAMA 5E6NA 3MHZA 4ZOHC 3SD5A 4RGTA 3IT4B 1YN5A 2O6VB 4NQKE 1IBXA 4URKA 3RNEC 3Q8EA 2REXA 1KTKA 3BYYB 3HUIA 4FJZA 1OTRB 3EC8A 2K6QA 1BMLC 4WWOA 2LD9A 1CZPA 4RM8A 4JL9A 2MBQA 5H92C 4NJCA 4PS3A 5D94A 5EE1A 2DHZA 1SE3A 2IZVB 3BYTB 2L32A 3RN9C 4JQWC 2G9HD 2LRUA 1D5MC 2K6DB 1N60A 2IBIB 3TEZA 2W55A 1E8XA 4CYEA 3PLUA 4XDDA 4IWPA 4HK2A 2VZKD 3SEBA 5DPSA 3APCA 3QWZB 3ZW3A 2KK8A 3RNCC 3EFUA 4W9KA 1QZEA 3NY5A 1K53A 2C9WB 3QK0A 2JU6X 3TEYA 2IY1B 1YQ3B 4ZRIA 2VH1A 3FILA 3PT2B 1N5XA 3B0AA 2PJHA 3QA8A 4HCPB 3DBRB 2J53A 2AEHA 3M62B 1DOXA 2J52A 2JXTA 3TBLD 2LWPA 2JYTA 1T0RC 2WDQB 1WZ0A 3LB8C 3P42A 2CJOA 3HK0A 2QILA 2DWQA 1H8CA 4LJOB 2G3QB 1VCBA 1L6VA 1PUTA 3I63C 1TGZB 2B3AA 2L76A 2ACZB 2KTRB 1GC7A 1EUVB 4LCDE 4IWOA 1VZ6A 2JRHA 2BVCA 2Y5CA 5AZFA 1EF1A 4IWQA 1R4NI 2ZCCA 1YN3A 1QOBA 2RDHA 2IDYA 4IUMB 1ZXHA 2LVQA 2N1WA 4WJOA 4ZRQA 1V8CA 4DWFA 3Q3FA 1ZDXA 2ZZPB 1L7YA 2WXPA 3AV8A 2KVZA 2JWUA 1TZ1A 2JWZA 3IT6B 3PS6A 4AJYB 1JWUD 4LDTD 1HA5A 4E74A 2PVOD 2H89B 4GOCA 3MHSD 1C79A 4TKNA 2CHXA 2V3NA 3BK1A 3EGRA 3C19A 1FCLA 1AYFA 3KQ4A 1CJEA 4M0WA 1CK1A 2TSSA 4ZYSA 2INPE 4E71A 1GAQB 2LHEA 2EKEC 4I6PA 2XBBC 4LTUA 2C7MB 4GIVA 3KW5B 1ZKHA 2QMTA 3V05A 1WMHA 1WXVA 4OZBA 3X0WA 2IGHA 3W1SC 5FR3A 3DVNV 4I6NB 3IVFA 2WYQA 1F0ZA 2GOWA 1ISNA 3DBSA 1C76A 2M4NA 1GG3A 2KHWB 4FHJA 2INDC 4C80A 2GRIA 1I4GA 2KOXA 1P0RA 1QOGA 1SJED 1YX6B 3NG0A 4PS7A 1ZP0B 1F52A 4ZRPA 5FKAC 4OZCA 2G1EA 4BBNC 3GZNI 1HZ5A 3B2GA 3N1YC 2KWUB 1SIJA 1C4CA 5AZGA 3AU5A 2WXGA 1C3TA 2KTFA 5D6JB 1EWCA 4FLHA 3BZDB 2WQYB 2KVRA 5IKCM 2L1AA 3DVNU 2C60A 3GE8C 3QIJA 1R4MB 1ROEA 2Y5PA 3N3KB 3APFA 3AE2B 1UGJA 2J0MA 1C4AA 1L4ZB 4MGZE 5DCNA 3AH7A 2WP9B 1F77A 4BOSC 1WJ4A 1XQQA 1LQBA 1NDDA 2KAJA 2L0FA 5CHWA 1KFYB 4WAFA 3S2AA 3UGBB 4HKQA 2BS3B 1V9JA 3ZVVA 3GP7A 5KHOA 3UF8A 1I4PA 3GB1A 4WH4A 3BVMA 1NVID 3L13A 5G2NA 2I2YA 3ZDTA 3U7DA 2H88B 1F2RC 4P1BC 3B1LX 2HD5B 2N0SB 2ASQA 1PQSA 2JUOA 2MH7A 2IO1B 4I6LB 4OHJA 2DENB 3AEAB 3BVZA 4HRSA 4B95A 3GOEA 4HDQA 5EE3A 3AXCA 3JSVB 4AUQC 3PRZA 4MJSA 2LJIA 1TS5A 2MJEA 1PFDA 3AE9B 1UD7A 3SU8X 1WGDA 1N61A 3NVVA 5D3IB 4TSSA 1XCQL 3VQIA 2RGFA 5L83A 2MBOA 1N5WA 4HDOA 1ZXIA 1Q5WB 2WX0A 3KWVA 5D3DA 2KQ7A 2LVPA 1OQQA 1C9FA 3QHTA 1RFAA 1FIQA 4K7WA 1LM8B 3HRDD 2N7JA 3PZ7A 1YQ4B 3KWLA 1TT5B 1E8ZA 2D07B 1E10A 4WJNA 4FADA 1TS2A 2CHWA 3V3XA 3IAS1 4XGAB 2INCC 2K3UA 3DCGA 3ONSA 4EKUA 3IHPC 3MTNB 5JZEB 5J2RA 2ZVOA 4GU2A 2E6XA 4HLEA 2WXRA 3QAQA 1TZOA 4W9JA 5BMGA 2ONQA 4EE2A 4RNAA 1D5ZC 4MH0E 4JWSC 3KUZA 3JYUA 5D2MB 5FR6A 2OHFA 1M4VA 1V1OA 1WYWB 4DHZE 1Z2MA 4W9GA 4MM3B 4KDLB 2WDVB 1EU3A 2PPHA 3Q3OC 2MRPA 1MHHE 3WAPA 3ZDMC 2YVCA 3PHWB 4RM9A 2BYVE 3D32A 3PVLA 3U30A 2D3CA 4DBGA 4XWTA 3URYA 1YN4A 1TS3A 3A1QB 3RNAC 1TKEA 2KMAA 1JWSD 3LYYA 1WSPA 2WDRB 2WXIA 4J3OD 5G5GA 2MSED 4DXFA 4ARIA 4YWGG 2QDFA 4FBJB 1TY0A 5CX3A 2MW5A 2KO3A 3U4EG 1MFWA 2BQQA 1GNUA 2LGSA 4AS1A 2AQ3B 1L4DB 4TQ1A 3TUOA 1L2NA 2N9PC 3TSSA 4BBNF 4IDIA 4C4VA 1I4XA 4NY0A 2N9EB 3A33B 1QQRA 1KOTA 3DQVA 4M8MA 1YNTE 3ML9A 1V6EA 4JGHB 5C23A 3KYDD 1QF6A 2N4FA 4W9LA 2MCNB 5AZHA 3V6EB 4OVVA 4IOIE 2WNMA 3ZTCA 3KVFB 4KIKA 3NS1A 1DOYA 3T3NA 4C7ZA 4NNJB 2L05A 1CQVA 1FXAA 2IGGA 2M0XA 4WWMA 1FNUA 2LI5A 1VR9A 2MP2B 1UWXA 1VRAB 4TMAB 1UELA 1XCTL 4MDKE 4RH6A 1QOAA 2LGXA 4MGKE 1HE8A 4K7SA 3SHQA 2IO2B 2JZPA 3A4RA 2UU7A 2WX1A 3PZDA 2IPKD 3A9KB 2CU3A 1XLOA 1KM7A 1KH0A 3DBLI 5BMIA 5E6PA 2FUG1 5E6OA 2CJNA 1P9DU 2KMMA 1I4QA 1T5XD 1TJEA 3BINA 2KJRA 3BK2A 2HE7A 4YSZB 4DHJD 1V1PB 1MHXA 3P63A 4IC7B 2PLPA 4L23A 3DHGC 3PZ8A 5LNK1 2DZMA 1HTQA 2AYOB 3ZJVA 2KDBA 2JQRB 2V1YA 4W9DA 4A8XC 1TIFA 1E8WA 2EELA 1IPGA 4GN1A 1TBEA 2WXMA 2NBWB 4BOZB 3H7PA 2BWES 2YEPB 1Q0WB 2L7RA 1WIAA 2K25A 3ZTDA 1JCKB 1NENB 1EU4A 2D10A 2JSVX 2ZPYA 4ZRJA 4ICUA 2KQSA 4GXBA 4IM2A 2K0PA 3W5UB 3T8MA 3H8HA 1WJNA 2AX5A 1RRBA 1Q10A 1KLGD 1L0XB 1WFYA 4H2AA 4K3BA 4FHKA 1UNSA 3SR6A 1WR6E 1SSNA 4AP4C 4NAWB 2MA9B 5JHAA 1UH6A 1JALA 1JWAD 2JX5A 4OZAA 1DOIA 1P3QU 2ZNVC 3VDZA 4AJWA 5DPRA 2QC8A 4DK5A 5C1ZA 4HJKA 5BO4B 1ET9A 3Q3JA 1YX5B 1NBFC 3ZNZB 5IN7A 3ZLZA 2EKIA 3PHXB 3AE4B 3FKYA 4KGRA 3VTWA 4B9KA 1YD8U 3L10B 2K22A 3PREA 5AUIA 3Q69A 3HIZA 2Z0DB 1VD2A 1L6UA 1SE9A 3NZUA 2A4ZA 1FM0D 1UBIA 1GUAB 1FRRA 2KN4A 2RPQA 3V62A 2LFIA 3WALA 3PO0A 3NRZA 4R3DA 3VR8B 1SF0A 2J0JA 2KT7A 4AQ7A 4RCOA 1SIFA 4PYUA 1K8RB 3QCAA 5H8YE 3DWMA 1FFVA 3MP9A 2N1VA 2WDTB 3R66C 1L0VB 4P7IA 1XEEA 1DGJA 4RMAA 4P6VF 1WJUA 1U4AA 2IO0B 3KUDB 4ANWA 4XX5A 4RF0A 5GMVA 4EFOA 3H6NA 2KDFB 2EMTA 4L2YA 4LNOA 4G0NB 3P1MA 1V97A 2WXOA 2PE9A 1NI3A 3UINB 2LXCA 2MQJA 1SEBD 3ETRA 5C2TB 1UBQA 2CU1A 1IYFA 1XO3A 4MSQB 5EE9A 1PGAA 1LGRA 3AB5A 3EUB2 3FILB 3AEGB 2PW9A 4RF1A 4W9IA 4BZAA 2BBCA 4TV3A 3EHVA 1JROA 2J42A 3TEWA 4MEMA 2ZEQA 2WXKA 4G50A 4ZYNA 4Q2JA 2DZJA 3CIRB 2XK5A 4DHJB 4ANVA 2XNAC 4KV2A 2K8BA 3JVZX 3VFKA 3U7ZA 2PIAA 2FUHB 1A70A 3RPFC 3AEBB 4DDGD 4QAYA 4W9HA 2D3BA 1T0QC 1R7SA 3ZYYX 3N1XC 4KGSA 3V60A 3OWEB 3DBRI 3UQBA 1WM3A 2CS4A 1MVKA 2LGYA 4II3B 2WXNA 4A3PA 1UGMA 1WYGA 4DDID 1TTNA 1MG4A 3ZGZA 1WGRA 3O13A 1YQBA 3A9JA 1J7AA 1ESFA 2ZVNA 1XT9B 2A5UA 2WXHA 5G5HA 1CMXB 4NQLB 4WJQA 3Q6BA 1C77A 1LFDA 3M3JA 4M0WB 4O1NA 2CKHB 3BIID 2X38A 3VR9B 4YL8A 4HCNB 1FNVA 1J7CA 3ZKJC 1EM7A 1RLFA 2ZCBA 2QSDA 3A4SC 2MWSB 1RM6C 1J19A 2BW2A 3VAWA 4YTPB 2ZW0A 3AE5B 2G4DB 4OW0A 4DXGA 5FK9C 4KSLC 2ICIA 2L8JA 1SE2A 2VZKB 3Q8AA 4MGIE 3U2SC 2JYEA 2N7EA 1YIWA 1FXIA 1WY8A 3CSTA 3WAOA 4KDIC 2PTLA 2WWZA 4GDLA 1D6EC 4EOYA 1WWTA 2NS5A 5HHDG 3Q8BA 2DBYA 2K8HA 3ZO5B 3R8BA 2KKCA 3RMKC 3P4RB 2JRIB 3DBHB 4L1BA 1V86A 4MACA 3TJPA 3R3MA 5MPOA 2O2VA 1OEYJ 1S1QB 3ENEA 3NVZA 4US9A 2KQ4X 2M56B 3RULA 1YMHE 2HDEA 2QEJC 2BF8B 1FPYA 1N63A 1K51A 1YOVB 1GPXA 2FBWB 3FAHA 4NZLB 3V61A 1AN8A 4KVGB 3HHMA 3Q14C 4BAXA 3GS2A 3L4PA 4K81A 1JWMD 1VLBA 4AWJA 3RZFA 2MJDA 4NJ6A 2GLSA 3QC8B 3DHIC 1WRDB 1FO4A 3T9LA 4OVUA 1Y8RC 1WGHA 4II2B 5AEKB 3ZJUA 4LDTB 1ZW7A 4USAA 2KJHB 1R4MI 5HI1A 5IO9A 3NVYA 2N9XA 2V9HA 3DOWA 5LLIA 3P2BA 4DXAB 2ZPNA 3DVGX 2IJ0A 2K9XA 4YSYB 4MM3A 3C8YA 2KFKA 4MJSB 3TIXA 2MBHA 1LXDA 1WX9A 2Z0EB 2QJLA 2NTSA 4LNKA 5JHBA 4LNFA 2NBUA 2DZIA 4S17A 4TUUA 4A90A 3RYTA 3A1QA 2QIEB 4CQNA 2MEKA 2FAZA 4UDUC 2RPVA 2VRRB 2DAJA 2UWQA 4C56C 3ZNHB 4IKGA 2GBRA 3VH3B 1QLBB 1ZUD2 2PE6B 3FC4A 1G6JA 1VJKA 2O6VD 1TKYA 2MBEA 3RNFC 3AE6B 1UWMA 2DYMA 5TSSA 4F7ZA 1PGBA 4GDKA 4XDCA 5DPWA 3EA6A 2J7QB 3O65B 3L17A 4XYCA 3DVGY 3NHEB 2C5LC 3SFEB 4HKZE 1PGXA 1VZ7A 4BKSD 2FCMA 3MC0B 4FJYA 3L0WB 2N9KA 3TL5A 1L0YB 3HM3A 4ZHPA 3KYCD 1KLVA 4B0EA 3AN1A 1FXTB 2M19A 3NZSA 1M94A 4CHKA 4G11A 1ACCA 2JF5A 2AQ2B 2EMSA 2I1JA 4XWWA 4IM3A 4LK0M 1V5TA 4C7YA 2I1KA 3QX1A 1IP9A 5C3JB 4YXDB 2FE8A 2W82A 4K1RB 4D2KA 2LASA 4KZCA 2HTHA 3N30A 5IA7A 3LJ3A 1JMLA 2Z59B 5LXHA 4HPLB 2N9LA 2JZ3B 3KUCB 1IUEA 2NPTA 3ECIA 2HTME 1FMAD 3Q3MC 1E90A 3RNGC 4A3OA 2KLCA 2NTTA 4ANUA 4WAAA 3LDZE 1HEZE 4EUTA 1T6BX 1RWSA 3IAM1 3I9V1 4GB9A 4BFRA 2GBMA 2OJRA 3DWGC 3ZIMA 3ZQ4A 4F1SA 2DYOA 2KWCA 3DPDA 5BYSA 3OLMD 2RDBC 1E7PB 4FN2A 3WANA 4NPNA 3VH4B 3RI7C 3OG5A 5BYQA 1J8CA 1YJIA 1PYWD 2BGFA 3I5JC 1WGGA 2KDEB 4KIKB 4N59A 2DYBA 4J6IA 3L16A 4A9AA 4F8CB 2K8CA 2NMQA 1V5OA 2PMVA 2O6VA 2Q5WD 2LGIA 2V3PA 2D2QA 1Q1OA 2M8SA 3OJ3A 2E3TA 1MI0A 2Z8LA 3ZNID 2MX2A 2QCZA 3KH0A 4FULA 2DZKA 1KJTA 2W3SA 4OVZA 1A5RA 4ZRKA 4KKIA 4HPPA 4YTNB 3NZ3A 1SGHA 2BT6A 3ALBA 4BKSA 2V3SA 2BB5A 1GOZA 4YSXB 1T0YA 2AL6A 4N9F4 2JZZA 1XF5L 4JPSA 1WGKA 1FEHA 2GI9A 4M01A 3I57A 2X8XX 5GXGB 1GB4A 3W5VB 1QT9A 4BVUC 3NJTA 3EFCA 4ACFA 1I4HA 2M1MA 2PKOA 2LUEA 3MJ5A 1FCCC 1JRPA 3Q3NC 3PLVA 3AMZA 3H7SA 1I7HA 2AQ1B 3K9PB 2G45B 4A6QA 3BWUD 2V4IB 3OJ4B 3H7PB 1UF0A 2YLMA 2WGSA 4XZ4A 3Q2AC 2LVOA 1TS4A 4KX6B 4JE3B 1FFUA 1R4NB 2CR5A 3CF6E 3B08A 3PRPB 4ASWC 3PSEB 3N1ZC 2KZRA 3I3TB 2WLBA 2UYZB 4FJVB 1IBXB 5IAAC 1D5XC 3MFGA 3VTUA 2WHIA 5LXIB 2D5GA 4ZDVA 3N20C 3DHHC 3CSFA 2GB1A 1WE6A 1N6ZA 4WWPA 3VVWB 3VUYA 4WIPA 1HQRD 3U8ZA 5BMHA 3ZUNA 2GBNA 3ZRCA 1D4BA 2LJ5A 1F9JA 5L95C 3ZXVA 1ENFA 2KTRA 3DDCB 3UQAA 2KC1A 1GJZA 2GMIC 3PPAA 4HJGE 3ZNGC 2DX5B 2BS2B 4MT5A 2D3GA 1NI2A 2WU5B 3QJZA 4MSMB 5HG2A 2DLBA 2PEAA 5T8IA 1WXMA 4EZLA 3V6CB 2WXQA 4US8A 2KLGA 3VUXA 1PDXA 1FRDA 4EEWA 4WURA 1F2RI 3SFDB 1Y56A 1VDVA 2ON8A 5CTRC 1B1ZA 3OAWA 4MELA 4MH8A 1TYGB 2KMCA 4RFBA 2K5PA 3RUIB 1YJJA 1KRHA 5JXVA 1VZ8A 3QQ8B 3VXWA 2DNFA 4W9FA 4TQ0A 3VRBB 3RT3B 3LXFA 2R61A 2BWFA 3P4PB 2V0GA 2C7HA 2WXFA 2LZ6A 4WQMA 2BYFA 3CMMB 3IBEA 1P7FA 1FD6A 3KLSX 4K7UA 2KACA 4HWIB 3UIOB 1FNWA 3GZNB 2NCNA 3ZXRA 1WRIA 3AE7B 3ABVB 3PV1A 1X1MA 3MC8A 3IXSA 2FIFA 1BXTA 3RFZB 3UI3A 2JXXA 2KDIA 5IOIA 5TR5A 2WU2B 2R2OA 2BYEA 2J4XA 2XEWA 3E9SA 3MC9A 5CHFA 1BT0A 1E7VA 3TMPB 3L54A 3M95A 2KXJA 2KWDA 3AEEB 4P1CC 2C7NB 4W9CA 1ET6A 2L83A 2LEKA 4X57B 2KWVB 5J17A 1S3SG 4PS8A 1C1YB 3AULA 2D3AA 5HFYA 2XK5B 5HKHA 3ML8A 1EF5A 3U52E 3W2DA 1JRUA 1HZ6A 1TY2A 1H4RA 2IGDA 1QOFA 2JVCA 1WF9A 2LHDA 1WGYA 3E56A 2FCNA 1WI0A 2RDGA 4LNNA 4P16A 1WMHB 1V80A 2IYDB 4KGTA 2DAFA 2LXAA 5I4DA 2BB6A 1IGDA 3B9JA 4BKTA 3AEDB 4FA6A 3A9JB 2Y5BB 2JPHA 3GE3C 3WA0A 3AU4A 1E8YA 2BTEA 3AM9A 4YTMB 4M00A 1L5PA 1SXTA 1ZOYB 1Z5SB 1SE4A 4E3CA 4DQOC 3MJWA 3AEFB 3QARA 4ARCA 2PVGC 1XXGA 3VHTC 3TCAA 3C0RB 1AW7A 4KKJA 4PYZA 2JT4B 5BYRA 3VUWA 2W9NA 2BS4B 4AOFA 5AUKA 1GC6A 4XC2A 1WR1A 3PRMB 3AI5A 3JSVA 3NVWA 2IO3B 2BYTA 1LO5D 1I35A 3P4SB 5IP4D 1P1AA 3N32A 2J0KA 4LLGM 4NAMA 4LNIA 2B76B 1OQYA 3M63B 1V49A 2QHOA 1ZPSA 5E6JA 1ZE3D 3R7QA 1I42A 1OQRA 3WIMA 4RGNA 2D11A 3W1YA 3PTFC 3L08A 2XN9C 2KX3A 4FXCA 4GDLB 2K1FA 2CHZA 3B2FA 1HXYD 1WZ3A 1XLQA 2VH2A 4A20A 3UIPB 1SJHD 3WCQA 2ZNVB 3AECB 1E7UA 3P4QB 4CO7A
chains in the Genus database with same CATH topology
2W82A 4D2KA 1KF6B 2QMTA 2WXJA 3V05A 1ET9A 4OZBA 1P7EA 1JMLA 4N58A 2IGHA 3AE1B 2SAKA 2EKIA 2N9LA 3AE4B 1NYRA 5FR3A 4KGRA 1IUEA 2K22A 2HTME 5AUIA 1FMAD 3Q69A 1F0ZA 2NTTA 4ZHOA 1L6UA 1C76A 1HEZE 1JW9D 1T6BX 1FM0D 1RWSA 3IAM1 3I9V1 1FRRA 4C80A 2GRIA 2KN4A 1I4GA 2W3RA 2LFIA 3DWGC 5D7GA 3ZQ4A 2DYOA 3PO0A 3NRZA 5BYSA 4R3DA 3VRAB 3VR8B 1SF0A 1QOGA 4AQ7A 1SJED 1E7PB 1BUIC 1NEKB 1ZP0B 4RCOA 4ZRPA 5FKAC 4OZCA 1AWDA 2G1EA 3CWIA 2SEBD 1EWYC 5H8YE 3DWMA 3NUHB 1FFVA 1HZ5A 3MP9A 1IGCA 3B2GA 1L0VB 5BYQA 1I4RA 1YJIA 1PYWD 1SIJA 1C4CA 1XEEA 1E9MA 1DGJA 3ZJTA 4N59A 4P6VF 2WXGA 4A9AA 1SBBB 4RF0A 2NMQA 3Q8FA 1EWCA 3BZDB 2WQYB 4ITKA 4L2YA 2PMVA 2L1AA 3P1MA 2Q5WD 1V97A 2LGIA 2V3PA 2WXOA 3T3OA 2E3TA 2Z8LA 1MI0A 1ROEA 1NI3A 2Y5PA 2I38A 3AE2B 2W3SA 1SEBD 1UGJA 4OVZA 3ETRA 2WXLA 5C2TB 3BVGA 1XO3A 1UUPA 5EE9A 1C4AA 4KKIA 1L4ZB 4YTNB 2RMMA 3NZ3A 3AH7A 1PGAA 2WP9B 2BT6A 1F77A 3AB5A 3EUB2 3FILB 3AEGB 1NYQA 1WXQA 2PW9A 4RF1A 2KAJA 2BB5A 1GOZA 4YSXB 2BBCA 1KFYB 4WAFA 1JROA 2J42A 4REZA 3TEWA 1XF5L 4JPSA 1WGKA 4HKQA 2BS3B 1FEHA 2GI9A 3GP7A 1SB3C 1I4PA 3I57A 3GB1A 5GXGB 2WXKA 2L52A 1GB4A 4WH4A 3R2IA 3W5VB 3BVMA 3R2TA 1QT9A 4Q2JA 1NVID 3CIRB 2I2YA 1XLNA 2H88B 3HVDA 3W1SA 1F2RC 2XNAC 4RGOS 1I4HA 2PKOA 2N0SB 3MJ5A 1FCCC 1JRPA 2MH7A 4OHJA 1K50A 4XE0A 3U7ZA 1C78A 2PIAA 3AEAB 3BVZA 3AMZA 1A70A 1I7HA 3RPFC 4HRSA 2AQ1B 1E0ZA 3AEBB 1QILA 5EE3A 1STEA 4A6QA 3BWUD 4GDKB 1GB1A 2V4IB 1R7SA 3ZYYX 2LJIA 1TS5A 2MJEA 4KGSA 1PFDA 3AE9B 4B0MA 3OWEB 1QKZA 1TS4A 4KX6B 2M0AA 1C4PA 4JE3B 1FFUA 1N61A 3NVVA 5D3IB 1MVKA 4TSSA 3TEXA 1XCQL 3VQIA 2WXNA 1N5WA 2LUMA 1WYGA 1ZXIA 2ZW1A 3ZGZA 3O13A 2WLBA 1IBXB 1D5XC 3KWVA 2Y3AA 3MFGA 5D3DA 1J7AA 1ESFA 1OQQA 1C9FA 2D5GA 1FIQA 2GB1A 2WS3B 2WXHA 3HRDD 5G5HA 2N7JA 3PZ7A 1J7BA 1DYQA 1V1PA 1YQ4B 3KWLA 4HEA1 4WIPA 1HQRD 5BMHA 1E10A 1TS2A 1RFKA 1D4BA 1C77A 3Q8CA 1ENFA 1MPEA 4JX1C 4O1NA 3V3XA 3IAS1 3BIID 2YEPF 2K3UA 4HJGE 4N6EB 2X38A 3VR9B 1N62A 1FNVA 2BS2B 1J7CA 4MT5A 2W54A 1TKGA 2WU5B 1EM7A 2E6XA 2WXRA 3AE3B 5HG2A 2DLBA 4PT5A 1TZOA 2QSDA 5BMGA 2ONQA 1RM6C 4EE2A 2BW2A 5T8IA 4RNAA 1D5ZC 1JWBD 1B9RA 1XLPA 4YTPB 4JWSC 2WXQA 2ZW0A 4US8A 3AE5B 1PDXA 1FRDA 4OW0A 4A55A 1E6EB 2OHFA 4DXGA 5FK9C 1M4VA 4WURA 3AE8B 1F2RI 3SFDB 1V1OA 2ICIA 3J9CA 1Y56A 1ZDVA 1SE2A 1VDVA 2ON8A 2VZKB 4MM3B 2LMCA 3Q8AA 1B1ZA 2WDVB 4MH8A 3U2SC 1TYGB 2JYEA 4RFBA 1EU3A 2K5PA 1FXIA 1YJJA 4YT0B 4HROA 1KLUD 2PTLA 1KRHA 5JXVA 1MHHE 1T3QA 1VZ8A 1D6EC 1WWTA 4TQ0A 5HHDG 3VRBB 3Q8BA 2DBYA 5EE0A 1JQ4A 4GLSC 4RGMA 3LXFA 1OFFA 3R8BA 3N9YC 4XWTA 3HVZA 3URYA 1YN4A 1TS3A 2KDMA 2R61A 3P4RB 3P4PB 1TKEA 4L1BA 2V0GA 2WXFA 4WQMA 2MJ3A 4MACA 2OEDA 1P7FA 1JWSD 1FD6A 5MPOA 3LYYA 1K52A 1WSPA 3KLSX 2INNE 1RYJA 4JWUC 3W9CB 2WDRB 2KACA 2WXIA 1FNWA 4J3OD 5G5GA 3NVZA 4DXFA 1WRIA 4US9A 2KQ4X 3MHZA 4ARIA 4YWGG 2M56B 1YMHE 3AE7B 2HDEA 3ABVB 1TY0A 2QEJC 4ZOHC 4RGTA 3IXSA 3IT4B 1YN5A 1N63A 1BXTA 3RFZB 1K51A 3U4EG 3UI3A 1GPXA 2FBWB 3FAHA 1IBXA 4NZLB 4AS1A 2AQ3B 1L4DB 4TQ1A 3TUOA 3Q8EA 1AN8A 1KTKA 2WU2B 3BYYB 3HUIA 3TSSA 2J4XA 4IDIA 3E9SA 3GS2A 1I4XA 1BMLC 1CZPA 3L4PA 5H92C 4NJCA 1JWMD 1VLBA 2KWDA 5EE1A 3AEEB 1QQRA 2MJDA 1SE3A 1YNTE 3BYTB 1ET6A 2L83A 2L32A 2LEKA 1QF6A 1FO4A 2G9HD 4IOIE 2WNMA 3ZJUA 5HFYA 1D5MC 1N60A 4USAA 3TEZA 2W55A 3NS1A 1DOYA 3T3NA 3U52E 4C7ZA 5HI1A 3W2DA 4XDDA 3NVYA 1HZ6A 1TY2A 2IGDA 1CQVA 1FXAA 1QOFA 2IGGA 2IJ0A 2LHDA 2VZKD 4WWMA 3SEBA 2K9XA 4YSYB 1FNUA 3C8YA 1VR9A 3E56A 1UWXA 1VRAB 2RDGA 4TMAB 1K53A 4P16A 1XCTL 4RH6A 2JU6X 3TEYA 4KGTA 1QOAA 2QJLA 5I4DA 2BB6A 2NTSA 1IGDA 3B9JA 1YQ3B 3AEDB 2JZPA 3FILA 2IPKD 1N5XA 2CU3A 4A90A 1XLOA 1KH0A 2J53A 2QIEB 5BMIA 4CQNA 2MEKA 4UDUC 2FUG1 2J52A 2JXTA 2RPVA 2BTEA 2CJNA 1DOXA 2KMMA 1I4QA 1T5XD 3AM9A 1TJEA 4C56C 4YTMB 1L5PA 2JYTA 3BK2A 1SXTA 1ZOYB 4IKGA 2WDQB 1SE4A 4YSZB 1QLBB 3LB8C 4DQOC 3AEFB 2CJOA 3P42A 4ARCA 1V1PB 1MHXA 2DWQA 2QILA 2PVGC 3P63A 1ZUD2 1XXGA 1AW7A 4KKJA 3FC4A 1L6VA 1PUTA 2PLPA 4L23A 1VJKA 2ACZB 3PZ8A 5LNK1 3ZJVA 5BYRA 1TKYA 2JQRB 4A8XC 1VZ6A 2BS4B 1UWMA 3AE6B 2EELA 5AUKA 2Y5CA 2DYMA 5TSSA 1PGBA 4XDCA 3EA6A 2WXMA 3NVWA 3SFEB 4HKZE 1YN3A 2BYTA 1PGXA 1QOBA 2RDHA 2YEPB 1LO5D 1VZ7A 2IDYA 3MC0B 1ZXHA 3P4SB 4ZRQA 2N9KA 1V8CA 1L0YB 4LLGM 1JCKB 1NENB 4NAMA 2B76B 1EU4A 2JSVX 4ZHPA 1ZDXA 4B0EA 1ZPSA 5E6JA 2WXPA 3AV8A 1ZE3D 2K0PA 3W5UB 2JWUA 3H8HA 3AN1A 1OQRA 2AX5A 3IT6B 4RGNA 1Q10A 2M19A 1KLGD 1L0XB 4H2AA 1JWUD 1HA5A 2PVOD 2H89B 1ACCA 1C79A 2XN9C 4FXCA 4GDLB 2V3NA 1UNSA 3B2FA 3SR6A 1HXYD 3BK1A 3EGRA 2AQ2B 1XLQA 1SSNA 1SJHD 4NAWB 1FCLA 3WCQA 1JALA 1JWAD 1AYFA 2JX5A 3KQ4A 4XWWA 4LK0M 4OZAA 1CJEA 4M0WA 1CK1A 2TSSA 4C7YA 1DOIA 2INPE 4ZYSA 1GAQB 2LHEA 3AECB 5C3JB 4YXDB 4LTUA 3P4QB 2FE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GB4 A;  4WH4 A;  4D2K A;  1K53 A;  2QMT A;  1XCT L;  2JU6 X;  2I2Y A;  2PTL A;  4KGT A;  5JXV A;  1MHH E;  1F2R C;  1P7E A;  1JML A;  4OZB A;  1IGD A;  2IGH A;  2N9L A;  5HHD G;  1FCC C;  2JZP A;  4KGR A;  1K50 A;  3FIL A;  4GLS C;  2KDM A;  1KH0 A;  2J53 A;  5BMI A;  2JXT A;  2J52 A;  2RPV A;  4MAC A;  1GB1 A;  2OED A;  1HEZ E;  1P7F A;  1FD6 A;  4IKG A;  1K52 A;  2KAC A;  2KN4 A;  4KGS A;  1MHX A;  1QKZ A;  2KQ4 X;  1YMH E;  2PLP A;  1MVK A;  1XCQ L;  4OZC A;  2LUM A;  1K51 A;  2ZW1 A;  2EEL A;  3UI3 A;  1HZ5 A;  1IBX A;  1IBX B;  3MP9 A;  1IGC A;  1PGB A;  1C9F A;  2GB1 A;  4HKZ E;  1PGX A;  2N7J A;  1ZXH A;  2N9K A;  5BMH A;  2NMQ A;  2KWD A;  1D4B A;  2JSV X;  1MPE A;  1YNT E;  2LGI A;  2K0P A;  3V3X A;  2JWU A;  4HJG E;  1MI0 A;  1Q10 A;  2I38 A;  4IOI E;  1EM7 A;  5HG2 A;  5HFY A;  2QSD A;  5BMG A;  2ONQ A;  2RMM A;  5HI1 A;  1PGA A;  2ZW0 A;  1HZ6 A;  3FIL B;  2IGD A;  2PW9 A;  1FCL A;  1F2R I;  2IGG A;  2LHD A;  4OZA A;  1XF5 L;  2ON8 A;  2GI9 A;  2LHE A;  1UWX A;  3GB1 A; 
#chains in the Genus database with same CATH topology
 2FID A;  4KZ0 A;  1KF6 B;  2WXJ A;  2O2V B;  1P7E A;  4N58 A;  3SDL C;  3AE1 B;  2SAK A;  2L3Z A;  2MLB A;  2R2Q A;  1NYR A;  5CHV C;  1OEY A;  1WX8 A;  4ZHO A;  5J18 A;  4GGQ A;  2AL3 A;  2IY0 B;  3HM6 X;  1JW9 D;  2MHJ A;  1D3Z A;  2W3R A;  5D7G A;  3DBH I;  4HXD A;  3VRA B;  4IG7 B;  1BUI C;  1NEK B;  2KNB A;  2V4L A;  1AWD A;  2KX0 A;  3CWI A;  1F1H A;  2SEB D;  1EWY C;  5JH5 C;  3NUH B;  2BKR B;  3RNB C;  2KYW A;  1IGC A;  4EZK A;  1I4R A;  1WXA A;  4M8N A;  1E9M A;  3ZJT A;  2AWT A;  4WWN A;  1SBB B;  3Q8F A;  1AAR A;  4ITK A;  5G55 A;  1ZGU B;  3T3O A;  2KFK B;  2I38 A;  4S0R A;  3RD2 A;  2KN5 A;  3H1U A;  2WXL A;  2ZJD A;  1WJ6 A;  2K39 A;  3BVG A;  1UUP A;  2RMM A;  1UZX B;  1NYQ A;  1WXQ A;  4GSW A;  2G4S A;  2RR9 A;  2KC2 A;  1RAX A;  4REZ A;  4HVB A;  2RD0 A;  1SB3 C;  2L52 A;  2NBV B;  3R2I A;  3R2T A;  1OGW A;  4HPM B;  2KAN A;  1XLN A;  3HVD A;  1WE7 A;  3W1S A;  1MG8 A;  4RGO S;  3DBL B;  4C00 A;  4IM0 A;  3NS8 A;  3RZW C;  1K50 A;  4XE0 A;  1C78 A;  3BY4 B;  1E0Z A;  3EEC A;  5EDS A;  1QIL A;  1STE A;  3X23 A;  2FNJ B;  4GDK B;  2MP2 A;  1GB1 A;  4ICV A;  3H9D A;  4B0M A;  1QKZ A;  2M0A A;  4JIO U;  1C4P A;  2RSU A;  3TEX A;  2HJ1 A;  2N7D A;  2JY6 A;  2LUM A;  2KFJ A;  5KHQ A;  3A9K A;  4BKG A;  2ZW1 A;  2OJW A;  1WM2 A;  4PK1 A;  3JW0 X;  2Y3A A;  2LGD A;  4MGY E;  1XD3 B;  2L00 B;  2MBB B;  4C4V B;  2HJ8 A;  1P98 A;  2WS3 B;  1J7B A;  1DYQ A;  1V1P A;  4HEA 1;  3K9O B;  1RFK A;  1HTO A;  3Q8C A;  1MPE A;  4JX1 C;  1MJD A;  3PGE A;  3R7R A;  2GBK A;  2YEP F;  4N6E B;  2FCS A;  1N62 A;  2KD0 A;  2W54 A;  4G3X B;  1TKG A;  1WH3 A;  3AE3 B;  5DPT A;  2LRW A;  4K3C A;  2KJ6 A;  4LJP B;  4PT5 A;  4IW0 A;  3APD A;  3IFW B;  3VTV A;  4M02 A;  1B9R A;  1JWB D;  1XLP A;  2GBJ A;  4B6W A;  2M17 A;  4A55 A;  2NPT B;  1E6E B;  1T0S C;  2NR2 A;  3AE8 B;  3J9C A;  3IG3 A;  4JLC A;  1ZDV A;  3ZRF A;  4WJP A;  2LMC A;  3RCZ A;  4KSK C;  4WQO B;  4EZJ A;  2FCQ A;  1E5W A;  1V81 A;  1J0G A;  4YT0 B;  4HRO A;  1KLU D;  4GMV A;  1T3Q A;  1V2Y A;  4W9E A;  2L0T A;  2OOB B;  2BPS A;  4NAW A;  5EE0 A;  4ANX A;  1JQ4 A;  4GLS C;  1WXS A;  4RGM A;  4DHZ B;  1OFF A;  2NVU I;  3N9Y C;  3HVZ A;  1WX7 A;  2KDM A;  4NJ7 A;  1YJ1 A;  1EO6 A;  2MJ3 A;  2OED A;  3NOB A;  2BKF A;  1K52 A;  4JWU C;  2INN E;  1RYJ A;  3W9C B;  3WAM A;  5E6N A;  3MHZ A;  4ZOH C;  3SD5 A;  4RGT A;  3IT4 B;  1YN5 A;  2O6V B;  4NQK E;  1IBX A;  4URK A;  3RNE C;  3Q8E A;  2REX A;  1KTK A;  3BYY B;  3HUI A;  4FJZ A;  1OTR B;  3EC8 A;  2K6Q A;  1BML C;  4WWO A;  2LD9 A;  1CZP A;  4RM8 A;  4JL9 A;  2MBQ A;  5H92 C;  4NJC A;  4PS3 A;  5D94 A;  5EE1 A;  2DHZ A;  1SE3 A;  2IZV B;  3BYT B;  2L32 A;  3RN9 C;  4JQW C;  2G9H D;  2LRU A;  1D5M C;  2K6D B;  1N60 A;  2IBI B;  3TEZ A;  2W55 A;  1E8X A;  4CYE A;  3PLU A;  4XDD A;  4IWP A;  4HK2 A;  2VZK D;  3SEB A;  5DPS A;  3APC A;  3QWZ B;  3ZW3 A;  2KK8 A;  3RNC C;  3EFU A;  4W9K A;  1QZE A;  3NY5 A;  1K53 A;  2C9W B;  3QK0 A;  2JU6 X;  3TEY A;  2IY1 B;  1YQ3 B;  4ZRI A;  2VH1 A;  3FIL A;  3PT2 B;  1N5X A;  3B0A A;  2PJH A;  3QA8 A;  4HCP B;  3DBR B;  2J53 A;  2AEH A;  3M62 B;  1DOX A;  2J52 A;  2JXT A;  3TBL D;  2LWP A;  2JYT A;  1T0R C;  2WDQ B;  1WZ0 A;  3LB8 C;  3P42 A;  2CJO A;  3HK0 A;  2QIL A;  2DWQ A;  1H8C A;  4LJO B;  2G3Q B;  1VCB A;  1L6V A;  1PUT A;  3I63 C;  1TGZ B;  2B3A A;  2L76 A;  2ACZ B;  2KTR B;  1GC7 A;  1EUV B;  4LCD E;  4IWO A;  1VZ6 A;  2JRH A;  2BVC A;  2Y5C A;  5AZF A;  1EF1 A;  4IWQ A;  1R4N I;  2ZCC A;  1YN3 A;  1QOB A;  2RDH A;  2IDY A;  4IUM B;  1ZXH A;  2LVQ A;  2N1W A;  4WJO A;  4ZRQ A;  1V8C A;  4DWF A;  3Q3F A;  1ZDX A;  2ZZP B;  1L7Y A;  2WXP A;  3AV8 A;  2KVZ A;  2JWU A;  1TZ1 A;  2JWZ A;  3IT6 B;  3PS6 A;  4AJY B;  1JWU D;  4LDT D;  1HA5 A;  4E74 A;  2PVO D;  2H89 B;  4GOC A;  3MHS D;  1C79 A;  4TKN A;  2CHX A;  2V3N A;  3BK1 A;  3EGR A;  3C19 A;  1FCL A;  1AYF A;  3KQ4 A;  1CJE A;  4M0W A;  1CK1 A;  2TSS A;  4ZYS A;  2INP E;  4E71 A;  1GAQ B;  2LHE A;  2EKE C;  4I6P A;  2XBB C;  4LTU A;  2C7M B;  4GIV A;  3KW5 B;  1ZKH A;  2QMT A;  3V05 A;  1WMH A;  1WXV A;  4OZB A;  3X0W A;  2IGH A;  3W1S C;  5FR3 A;  3DVN V;  4I6N B;  3IVF A;  2WYQ A;  1F0Z A;  2GOW A;  1ISN A;  3DBS A;  1C76 A;  2M4N A;  1GG3 A;  2KHW B;  4FHJ A;  2IND C;  4C80 A;  2GRI A;  1I4G A;  2KOX A;  1P0R A;  1QOG A;  1SJE D;  1YX6 B;  3NG0 A;  4PS7 A;  1ZP0 B;  1F52 A;  4ZRP A;  5FKA C;  4OZC A;  2G1E A;  4BBN C;  3GZN I;  1HZ5 A;  3B2G A;  3N1Y C;  2KWU B;  1SIJ A;  1C4C A;  5AZG A;  3AU5 A;  2WXG A;  1C3T A;  2KTF A;  5D6J B;  1EWC A;  4FLH A;  3BZD B;  2WQY B;  2KVR A;  5IKC M;  2L1A A;  3DVN U;  2C60 A;  3GE8 C;  3QIJ A;  1R4M B;  1ROE A;  2Y5P A;  3N3K B;  3APF A;  3AE2 B;  1UGJ A;  2J0M A;  1C4A A;  1L4Z B;  4MGZ E;  5DCN A;  3AH7 A;  2WP9 B;  1F77 A;  4BOS C;  1WJ4 A;  1XQQ A;  1LQB A;  1NDD A;  2KAJ A;  2L0F A;  5CHW A;  1KFY B;  4WAF A;  3S2A A;  3UGB B;  4HKQ A;  2BS3 B;  1V9J A;  3ZVV A;  3GP7 A;  5KHO A;  3UF8 A;  1I4P A;  3GB1 A;  4WH4 A;  3BVM A;  1NVI D;  3L13 A;  5G2N A;  2I2Y A;  3ZDT A;  3U7D A;  2H88 B;  1F2R C;  4P1B C;  3B1L X;  2HD5 B;  2N0S B;  2ASQ A;  1PQS A;  2JUO A;  2MH7 A;  2IO1 B;  4I6L B;  4OHJ A;  2DEN B;  3AEA B;  3BVZ A;  4HRS A;  4B95 A;  3GOE A;  4HDQ A;  5EE3 A;  3AXC A;  3JSV B;  4AUQ C;  3PRZ A;  4MJS A;  2LJI A;  1TS5 A;  2MJE A;  1PFD A;  3AE9 B;  1UD7 A;  3SU8 X;  1WGD A;  1N61 A;  3NVV A;  5D3I B;  4TSS A;  1XCQ L;  3VQI A;  2RGF A;  5L83 A;  2MBO A;  1N5W A;  4HDO A;  1ZXI A;  1Q5W B;  2WX0 A;  3KWV A;  5D3D A;  2KQ7 A;  2LVP A;  1OQQ A;  1C9F A;  3QHT A;  1RFA A;  1FIQ A;  4K7W A;  1LM8 B;  3HRD D;  2N7J A;  3PZ7 A;  1YQ4 B;  3KWL A;  1TT5 B;  1E8Z A;  2D07 B;  1E10 A;  4WJN A;  4FAD A;  1TS2 A;  2CHW A;  3V3X A;  3IAS 1;  4XGA B;  2INC C;  2K3U A;  3DCG A;  3ONS A;  4EKU A;  3IHP C;  3MTN B;  5JZE B;  5J2R A;  2ZVO A;  4GU2 A;  2E6X A;  4HLE A;  2WXR A;  3QAQ A;  1TZO A;  4W9J A;  5BMG A;  2ONQ A;  4EE2 A;  4RNA A;  1D5Z C;  4MH0 E;  4JWS C;  3KUZ A;  3JYU A;  5D2M B;  5FR6 A;  2OHF A;  1M4V A;  1V1O A;  1WYW B;  4DHZ E;  1Z2M A;  4W9G A;  4MM3 B;  4KDL B;  2WDV B;  1EU3 A;  2PPH A;  3Q3O C;  2MRP A;  1MHH E;  3WAP A;  3ZDM C;  2YVC A;  3PHW B;  4RM9 A;  2BYV E;  3D32 A;  3PVL A;  3U30 A;  2D3C A;  4DBG A;  4XWT A;  3URY A;  1YN4 A;  1TS3 A;  3A1Q B;  3RNA C;  1TKE A;  2KMA A;  1JWS D;  3LYY A;  1WSP A;  2WDR B;  2WXI A;  4J3O D;  5G5G A;  2MSE D;  4DXF A;  4ARI A;  4YWG G;  2QDF A;  4FBJ B;  1TY0 A;  5CX3 A;  2MW5 A;  2KO3 A;  3U4E G;  1MFW A;  2BQQ A;  1GNU A;  2LGS A;  4AS1 A;  2AQ3 B;  1L4D B;  4TQ1 A;  3TUO A;  1L2N A;  2N9P C;  3TSS A;  4BBN F;  4IDI A;  4C4V A;  1I4X A;  4NY0 A;  2N9E B;  3A33 B;  1QQR A;  1KOT A;  3DQV A;  4M8M A;  1YNT E;  3ML9 A;  1V6E A;  4JGH B;  5C23 A;  3KYD D;  1QF6 A;  2N4F A;  4W9L A;  2MCN B;  5AZH A;  3V6E B;  4OVV A;  4IOI E;  2WNM A;  3ZTC A;  3KVF B;  4KIK A;  3NS1 A;  1DOY A;  3T3N A;  4C7Z A;  4NNJ B;  2L05 A;  1CQV A;  1FXA A;  2IGG A;  2M0X A;  4WWM A;  1FNU A;  2LI5 A;  1VR9 A;  2MP2 B;  1UWX A;  1VRA B;  4TMA B;  1UEL A;  1XCT L;  4MDK E;  4RH6 A;  1QOA A;  2LGX A;  4MGK E;  1HE8 A;  4K7S A;  3SHQ A;  2IO2 B;  2JZP A;  3A4R A;  2UU7 A;  2WX1 A;  3PZD A;  2IPK D;  3A9K B;  2CU3 A;  1XLO A;  1KM7 A;  1KH0 A;  3DBL I;  5BMI A;  5E6P A;  2FUG 1;  5E6O A;  2CJN A;  1P9D U;  2KMM A;  1I4Q A;  1T5X D;  1TJE A;  3BIN A;  2KJR A;  3BK2 A;  2HE7 A;  4YSZ B;  4DHJ D;  1V1P B;  1MHX A;  3P63 A;  4IC7 B;  2PLP A;  4L23 A;  3DHG C;  3PZ8 A;  5LNK 1;  2DZM A;  1HTQ A;  2AYO B;  3ZJV A;  2KDB A;  2JQR B;  2V1Y A;  4W9D A;  4A8X C;  1TIF A;  1E8W A;  2EEL A;  1IPG A;  4GN1 A;  1TBE A;  2WXM A;  2NBW B;  4BOZ B;  3H7P A;  2BWE S;  2YEP B;  1Q0W B;  2L7R A;  1WIA A;  2K25 A;  3ZTD A;  1JCK B;  1NEN B;  1EU4 A;  2D10 A;  2JSV X;  2ZPY A;  4ZRJ A;  4ICU A;  2KQS A;  4GXB A;  4IM2 A;  2K0P A;  3W5U B;  3T8M A;  3H8H A;  1WJN A;  2AX5 A;  1RRB A;  1Q10 A;  1KLG D;  1L0X B;  1WFY A;  4H2A A;  4K3B A;  4FHK A;  1UNS A;  3SR6 A;  1WR6 E;  1SSN A;  4AP4 C;  4NAW B;  2MA9 B;  5JHA A;  1UH6 A;  1JAL A;  1JWA D;  2JX5 A;  4OZA A;  1DOI A;  1P3Q U;  2ZNV C;  3VDZ A;  4AJW A;  5DPR A;  2QC8 A;  4DK5 A;  5C1Z A;  4HJK A;  5BO4 B;  1ET9 A;  3Q3J A;  1YX5 B;  1NBF C;  3ZNZ B;  5IN7 A;  3ZLZ A;  2EKI A;  3PHX B;  3AE4 B;  3FKY A;  4KGR A;  3VTW A;  4B9K A;  1YD8 U;  3L10 B;  2K22 A;  3PRE A;  5AUI A;  3Q69 A;  3HIZ A;  2Z0D B;  1VD2 A;  1L6U A;  1SE9 A;  3NZU A;  2A4Z A;  1FM0 D;  1UBI A;  1GUA B;  1FRR A;  2KN4 A;  2RPQ A;  3V62 A;  2LFI A;  3WAL A;  3PO0 A;  3NRZ A;  4R3D A;  3VR8 B;  1SF0 A;  2J0J A;  2KT7 A;  4AQ7 A;  4RCO A;  1SIF A;  4PYU A;  1K8R B;  3QCA A;  5H8Y E;  3DWM A;  1FFV A;  3MP9 A;  2N1V A;  2WDT B;  3R66 C;  1L0V B;  4P7I A;  1XEE A;  1DGJ A;  4RMA A;  4P6V F;  1WJU A;  1U4A A;  2IO0 B;  3KUD B;  4ANW A;  4XX5 A;  4RF0 A;  5GMV A;  4EFO A;  3H6N A;  2KDF B;  2EMT A;  4L2Y A;  4LNO A;  4G0N B;  3P1M A;  1V97 A;  2WXO A;  2PE9 A;  1NI3 A;  3UIN B;  2LXC A;  2MQJ A;  1SEB D;  3ETR A;  5C2T B;  1UBQ A;  2CU1 A;  1IYF A;  1XO3 A;  4MSQ B;  5EE9 A;  1PGA A;  1LGR A;  3AB5 A;  3EUB 2;  3FIL B;  3AEG B;  2PW9 A;  4RF1 A;  4W9I A;  4BZA A;  2BBC A;  4TV3 A;  3EHV A;  1JRO A;  2J42 A;  3TEW A;  4MEM A;  2ZEQ A;  2WXK A;  4G50 A;  4ZYN A;  4Q2J A;  2DZJ A;  3CIR B;  2XK5 A;  4DHJ B;  4ANV A;  2XNA C;  4KV2 A;  2K8B A;  3JVZ X;  3VFK A;  3U7Z A;  2PIA A;  2FUH B;  1A70 A;  3RPF C;  3AEB B;  4DDG D;  4QAY A;  4W9H A;  2D3B A;  1T0Q C;  1R7S A;  3ZYY X;  3N1X C;  4KGS A;  3V60 A;  3OWE B;  3DBR I;  3UQB A;  1WM3 A;  2CS4 A;  1MVK A;  2LGY A;  4II3 B;  2WXN A;  4A3P A;  1UGM A;  1WYG A;  4DDI D;  1TTN A;  1MG4 A;  3ZGZ A;  1WGR A;  3O13 A;  1YQB A;  3A9J A;  1J7A A;  1ESF A;  2ZVN A;  1XT9 B;  2A5U A;  2WXH A;  5G5H A;  1CMX B;  4NQL B;  4WJQ A;  3Q6B A;  1C77 A;  1LFD A;  3M3J A;  4M0W B;  4O1N A;  2CKH B;  3BII D;  2X38 A;  3VR9 B;  4YL8 A;  4HCN B;  1FNV A;  1J7C A;  3ZKJ C;  1EM7 A;  1RLF A;  2ZCB A;  2QSD A;  3A4S C;  2MWS B;  1RM6 C;  1J19 A;  2BW2 A;  3VAW A;  4YTP B;  2ZW0 A;  3AE5 B;  2G4D B;  4OW0 A;  4DXG A;  5FK9 C;  4KSL C;  2ICI A;  2L8J A;  1SE2 A;  2VZK B;  3Q8A A;  4MGI E;  3U2S C;  2JYE A;  2N7E A;  1YIW A;  1FXI A;  1WY8 A;  3CST A;  3WAO A;  4KDI C;  2PTL A;  2WWZ A;  4GDL A;  1D6E C;  4EOY A;  1WWT A;  2NS5 A;  5HHD G;  3Q8B A;  2DBY A;  2K8H A;  3ZO5 B;  3R8B A;  2KKC A;  3RMK C;  3P4R B;  2JRI B;  3DBH B;  4L1B A;  1V86 A;  4MAC A;  3TJP A;  3R3M A;  5MPO A;  2O2V A;  1OEY J;  1S1Q B;  3ENE A;  3NVZ A;  4US9 A;  2KQ4 X;  2M56 B;  3RUL A;  1YMH E;  2HDE A;  2QEJ C;  2BF8 B;  1FPY A;  1N63 A;  1K51 A;  1YOV B;  1GPX A;  2FBW B;  3FAH A;  4NZL B;  3V61 A;  1AN8 A;  4KVG B;  3HHM A;  3Q14 C;  4BAX A;  3GS2 A;  3L4P A;  4K81 A;  1JWM D;  1VLB A;  4AWJ A;  3RZF A;  2MJD A;  4NJ6 A;  2GLS A;  3QC8 B;  3DHI C;  1WRD B;  1FO4 A;  3T9L A;  4OVU A;  1Y8R C;  1WGH A;  4II2 B;  5AEK B;  3ZJU A;  4LDT B;  1ZW7 A;  4USA A;  2KJH B;  1R4M I;  5HI1 A;  5IO9 A;  3NVY A;  2N9X A;  2V9H A;  3DOW A;  5LLI A;  3P2B A;  4DXA B;  2ZPN A;  3DVG X;  2IJ0 A;  2K9X A;  4YSY B;  4MM3 A;  3C8Y A;  2KFK A;  4MJS B;  3TIX A;  2MBH A;  1LXD A;  1WX9 A;  2Z0E B;  2QJL A;  2NTS A;  4LNK A;  5JHB A;  4LNF A;  2NBU A;  2DZI A;  4S17 A;  4TUU A;  4A90 A;  3RYT A;  3A1Q A;  2QIE B;  4CQN A;  2MEK A;  2FAZ A;  4UDU C;  2RPV A;  2VRR B;  2DAJ A;  2UWQ A;  4C56 C;  3ZNH B;  4IKG A;  2GBR A;  3VH3 B;  1QLB B;  1ZUD 2;  2PE6 B;  3FC4 A;  1G6J A;  1VJK A;  2O6V D;  1TKY A;  2MBE A;  3RNF C;  3AE6 B;  1UWM A;  2DYM A;  5TSS A;  4F7Z A;  1PGB A;  4GDK A;  4XDC A;  5DPW A;  3EA6 A;  2J7Q B;  3O65 B;  3L17 A;  4XYC A;  3DVG Y;  3NHE B;  2C5L C;  3SFE B;  4HKZ E;  1PGX A;  1VZ7 A;  4BKS D;  2FCM A;  3MC0 B;  4FJY A;  3L0W B;  2N9K A;  3TL5 A;  1L0Y B;  3HM3 A;  4ZHP A;  3KYC D;  1KLV A;  4B0E A;  3AN1 A;  1FXT B;  2M19 A;  3NZS A;  1M94 A;  4CHK A;  4G11 A;  1ACC A;  2JF5 A;  2AQ2 B;  2EMS A;  2I1J A;  4XWW A;  4IM3 A;  4LK0 M;  1V5T A;  4C7Y A;  2I1K A;  3QX1 A;  1IP9 A;  5C3J B;  4YXD B;  2FE8 A;  2W82 A;  4K1R B;  4D2K A;  2LAS A;  4KZC A;  2HTH A;  3N30 A;  5IA7 A;  3LJ3 A;  1JML A;  2Z59 B;  5LXH A;  4HPL B;  2N9L A;  2JZ3 B;  3KUC B;  1IUE A;  2NPT A;  3ECI A;  2HTM E;  1FMA D;  3Q3M C;  1E90 A;  3RNG C;  4A3O A;  2KLC A;  2NTT A;  4ANU A;  4WAA A;  3LDZ E;  1HEZ E;  4EUT A;  1T6B X;  1RWS A;  3IAM 1;  3I9V 1;  4GB9 A;  4BFR A;  2GBM A;  2OJR A;  3DWG C;  3ZIM A;  3ZQ4 A;  4F1S A;  2DYO A;  2KWC A;  3DPD A;  5BYS A;  3OLM D;  2RDB C;  1E7P B;  4FN2 A;  3WAN A;  4NPN A;  3VH4 B;  3RI7 C;  3OG5 A;  5BYQ A;  1J8C A;  1YJI A;  1PYW D;  2BGF A;  3I5J C;  1WGG A;  2KDE B;  4KIK B;  4N59 A;  2DYB A;  4J6I A;  3L16 A;  4A9A A;  4F8C B;  2K8C A;  2NMQ A;  1V5O A;  2PMV A;  2O6V A;  2Q5W D;  2LGI A;  2V3P A;  2D2Q A;  1Q1O A;  2M8S A;  3OJ3 A;  2E3T A;  1MI0 A;  2Z8L A;  3ZNI D;  2MX2 A;  2QCZ A;  3KH0 A;  4FUL A;  2DZK A;  1KJT A;  2W3S A;  4OVZ A;  1A5R A;  4ZRK A;  4KKI A;  4HPP A;  4YTN B;  3NZ3 A;  1SGH A;  2BT6 A;  3ALB A;  4BKS A;  2V3S A;  2BB5 A;  1GOZ A;  4YSX B;  1T0Y A;  2AL6 A;  4N9F 4;  2JZZ A;  1XF5 L;  4JPS A;  1WGK A;  1FEH A;  2GI9 A;  4M01 A;  3I57 A;  2X8X X;  5GXG B;  1GB4 A;  3W5V B;  1QT9 A;  4BVU C;  3NJT A;  3EFC A;  4ACF A;  1I4H A;  2M1M A;  2PKO A;  2LUE A;  3MJ5 A;  1FCC C;  1JRP A;  3Q3N C;  3PLV A;  3AMZ A;  3H7S A;  1I7H A;  2AQ1 B;  3K9P B;  2G45 B;  4A6Q A;  3BWU D;  2V4I B;  3OJ4 B;  3H7P B;  1UF0 A;  2YLM A;  2WGS A;  4XZ4 A;  3Q2A C;  2LVO A;  1TS4 A;  4KX6 B;  4JE3 B;  1FFU A;  1R4N B;  2CR5 A;  3CF6 E;  3B08 A;  3PRP B;  4ASW C;  3PSE B;  3N1Z C;  2KZR A;  3I3T B;  2WLB A;  2UYZ B;  4FJV B;  1IBX B;  5IAA C;  1D5X C;  3MFG A;  3VTU A;  2WHI A;  5LXI B;  2D5G A;  4ZDV A;  3N20 C;  3DHH C;  3CSF A;  2GB1 A;  1WE6 A;  1N6Z A;  4WWP A;  3VVW B;  3VUY A;  4WIP A;  1HQR D;  3U8Z A;  5BMH A;  3ZUN A;  2GBN A;  3ZRC A;  1D4B A;  2LJ5 A;  1F9J A;  5L95 C;  3ZXV A;  1ENF A;  2KTR A;  3DDC B;  3UQA A;  2KC1 A;  1GJZ A;  2GMI C;  3PPA A;  4HJG E;  3ZNG C;  2DX5 B;  2BS2 B;  4MT5 A;  2D3G A;  1NI2 A;  2WU5 B;  3QJZ A;  4MSM B;  5HG2 A;  2DLB A;  2PEA A;  5T8I A;  1WXM A;  4EZL A;  3V6C B;  2WXQ A;  4US8 A;  2KLG A;  3VUX A;  1PDX A;  1FRD A;  4EEW A;  4WUR A;  1F2R I;  3SFD B;  1Y56 A;  1VDV A;  2ON8 A;  5CTR C;  1B1Z A;  3OAW A;  4MEL A;  4MH8 A;  1TYG B;  2KMC A;  4RFB A;  2K5P A;  3RUI B;  1YJJ A;  1KRH A;  5JXV A;  1VZ8 A;  3QQ8 B;  3VXW A;  2DNF A;  4W9F A;  4TQ0 A;  3VRB B;  3RT3 B;  3LXF A;  2R61 A;  2BWF A;  3P4P B;  2V0G A;  2C7H A;  2WXF A;  2LZ6 A;  4WQM A;  2BYF A;  3CMM B;  3IBE A;  1P7F A;  1FD6 A;  3KLS X;  4K7U A;  2KAC A;  4HWI B;  3UIO B;  1FNW A;  3GZN B;  2NCN A;  3ZXR A;  1WRI A;  3AE7 B;  3ABV B;  3PV1 A;  1X1M A;  3MC8 A;  3IXS A;  2FIF A;  1BXT A;  3RFZ B;  3UI3 A;  2JXX A;  2KDI A;  5IOI A;  5TR5 A;  2WU2 B;  2R2O A;  2BYE A;  2J4X A;  2XEW A;  3E9S A;  3MC9 A;  5CHF A;  1BT0 A;  1E7V A;  3TMP B;  3L54 A;  3M95 A;  2KXJ A;  2KWD A;  3AEE B;  4P1C C;  2C7N B;  4W9C A;  1ET6 A;  2L83 A;  2LEK A;  4X57 B;  2KWV B;  5J17 A;  1S3S G;  4PS8 A;  1C1Y B;  3AUL A;  2D3A A;  5HFY A;  2XK5 B;  5HKH A;  3ML8 A;  1EF5 A;  3U52 E;  3W2D A;  1JRU A;  1HZ6 A;  1TY2 A;  1H4R A;  2IGD A;  1QOF A;  2JVC A;  1WF9 A;  2LHD A;  1WGY A;  3E56 A;  2FCN A;  1WI0 A;  2RDG A;  4LNN A;  4P16 A;  1WMH B;  1V80 A;  2IYD B;  4KGT A;  2DAF A;  2LXA A;  5I4D A;  2BB6 A;  1IGD A;  3B9J A;  4BKT A;  3AED B;  4FA6 A;  3A9J B;  2Y5B B;  2JPH A;  3GE3 C;  3WA0 A;  3AU4 A;  1E8Y A;  2BTE A;  3AM9 A;  4YTM B;  4M00 A;  1L5P A;  1SXT A;  1ZOY B;  1Z5S B;  1SE4 A;  4E3C A;  4DQO C;  3MJW A;  3AEF B;  3QAR A;  4ARC A;  2PVG C;  1XXG A;  3VHT C;  3TCA A;  3C0R B;  1AW7 A;  4KKJ A;  4PYZ A;  2JT4 B;  5BYR A;  3VUW A;  2W9N A;  2BS4 B;  4AOF A;  5AUK A;  1GC6 A;  4XC2 A;  1WR1 A;  3PRM B;  3AI5 A;  3JSV A;  3NVW A;  2IO3 B;  2BYT A;  1LO5 D;  1I35 A;  3P4S B;  5IP4 D;  1P1A A;  3N32 A;  2J0K A;  4LLG M;  4NAM A;  4LNI A;  2B76 B;  1OQY A;  3M63 B;  1V49 A;  2QHO A;  1ZPS A;  5E6J A;  1ZE3 D;  3R7Q A;  1I42 A;  1OQR A;  3WIM A;  4RGN A;  2D11 A;  3W1Y A;  3PTF C;  3L08 A;  2XN9 C;  2KX3 A;  4FXC A;  4GDL B;  2K1F A;  2CHZ A;  3B2F A;  1HXY D;  1WZ3 A;  1XLQ A;  2VH2 A;  4A20 A;  3UIP B;  1SJH D;  3WCQ A;  2ZNV B;  3AEC B;  1E7U A;  3P4Q B;  4CO7 A; 
#chains in the Genus database with same CATH homology
 2W82 A;  4D2K A;  1KF6 B;  2QMT A;  2WXJ A;  3V05 A;  1ET9 A;  4OZB A;  1P7E A;  1JML A;  4N58 A;  2IGH A;  3AE1 B;  2SAK A;  2EKI A;  2N9L A;  3AE4 B;  1NYR A;  5FR3 A;  4KGR A;  1IUE A;  2K22 A;  2HTM E;  5AUI A;  1FMA D;  3Q69 A;  1F0Z A;  2NTT A;  4ZHO A;  1L6U A;  1C76 A;  1HEZ E;  1JW9 D;  1T6B X;  1FM0 D;  1RWS A;  3IAM 1;  3I9V 1;  1FRR A;  4C80 A;  2GRI A;  2KN4 A;  1I4G A;  2W3R A;  2LFI A;  3DWG C;  5D7G A;  3ZQ4 A;  2DYO A;  3PO0 A;  3NRZ A;  5BYS A;  4R3D A;  3VRA B;  3VR8 B;  1SF0 A;  1QOG A;  4AQ7 A;  1SJE D;  1E7P B;  1BUI C;  1NEK B;  1ZP0 B;  4RCO A;  4ZRP A;  5FKA C;  4OZC A;  1AWD A;  2G1E A;  3CWI A;  2SEB D;  1EWY C;  5H8Y E;  3DWM A;  3NUH B;  1FFV A;  1HZ5 A;  3MP9 A;  1IGC A;  3B2G A;  1L0V B;  5BYQ A;  1I4R A;  1YJI A;  1PYW D;  1SIJ A;  1C4C A;  1XEE A;  1E9M A;  1DGJ A;  3ZJT A;  4N59 A;  4P6V F;  2WXG A;  4A9A A;  1SBB B;  4RF0 A;  2NMQ A;  3Q8F A;  1EWC A;  3BZD B;  2WQY B;  4ITK A;  4L2Y A;  2PMV A;  2L1A A;  3P1M A;  2Q5W D;  1V97 A;  2LGI A;  2V3P A;  2WXO A;  3T3O A;  2E3T A;  2Z8L A;  1MI0 A;  1ROE A;  1NI3 A;  2Y5P A;  2I38 A;  3AE2 B;  2W3S A;  1SEB D;  1UGJ A;  4OVZ A;  3ETR A;  2WXL A;  5C2T B;  3BVG A;  1XO3 A;  1UUP A;  5EE9 A;  1C4A A;  4KKI A;  1L4Z B;  4YTN B;  2RMM A;  3NZ3 A;  3AH7 A;  1PGA A;  2WP9 B;  2BT6 A;  1F77 A;  3AB5 A;  3EUB 2;  3FIL B;  3AEG B;  1NYQ A;  1WXQ A;  2PW9 A;  4RF1 A;  2KAJ A;  2BB5 A;  1GOZ A;  4YSX B;  2BBC A;  1KFY B;  4WAF A;  1JRO A;  2J42 A;  4REZ A;  3TEW A;  1XF5 L;  4JPS A;  1WGK A;  4HKQ A;  2BS3 B;  1FEH A;  2GI9 A;  3GP7 A;  1SB3 C;  1I4P A;  3I57 A;  3GB1 A;  5GXG B;  2WXK A;  2L52 A;  1GB4 A;  4WH4 A;  3R2I A;  3W5V B;  3BVM A;  3R2T A;  1QT9 A;  4Q2J A;  1NVI D;  3CIR B;  2I2Y A;  1XLN A;  2H88 B;  3HVD A;  3W1S A;  1F2R C;  2XNA C;  4RGO S;  1I4H A;  2PKO A;  2N0S B;  3MJ5 A;  1FCC C;  1JRP A;  2MH7 A;  4OHJ A;  1K50 A;  4XE0 A;  3U7Z A;  1C78 A;  2PIA A;  3AEA B;  3BVZ A;  3AMZ A;  1A70 A;  1I7H A;  3RPF C;  4HRS A;  2AQ1 B;  1E0Z A;  3AEB B;  1QIL A;  5EE3 A;  1STE A;  4A6Q A;  3BWU D;  4GDK B;  1GB1 A;  2V4I B;  1R7S A;  3ZYY X;  2LJI A;  1TS5 A;  2MJE A;  4KGS A;  1PFD A;  3AE9 B;  4B0M A;  3OWE B;  1QKZ A;  1TS4 A;  4KX6 B;  2M0A A;  1C4P A;  4JE3 B;  1FFU A;  1N61 A;  3NVV A;  5D3I B;  1MVK A;  4TSS A;  3TEX A;  1XCQ L;  3VQI A;  2WXN A;  1N5W A;  2LUM A;  1WYG A;  1ZXI A;  2ZW1 A;  3ZGZ A;  3O13 A;  2WLB A;  1IBX B;  1D5X C;  3KWV A;  2Y3A A;  3MFG A;  5D3D A;  1J7A A;  1ESF A;  1OQQ A;  1C9F A;  2D5G A;  1FIQ A;  2GB1 A;  2WS3 B;  2WXH A;  3HRD D;  5G5H A;  2N7J A;  3PZ7 A;  1J7B A;  1DYQ A;  1V1P A;  1YQ4 B;  3KWL A;  4HEA 1;  4WIP A;  1HQR D;  5BMH A;  1E10 A;  1TS2 A;  1RFK A;  1D4B A;  1C77 A;  3Q8C A;  1ENF A;  1MPE A;  4JX1 C;  4O1N A;  3V3X A;  3IAS 1;  3BII D;  2YEP F;  2K3U A;  4HJG E;  4N6E B;  2X38 A;  3VR9 B;  1N62 A;  1FNV A;  2BS2 B;  1J7C A;  4MT5 A;  2W54 A;  1TKG A;  2WU5 B;  1EM7 A;  2E6X A;  2WXR A;  3AE3 B;  5HG2 A;  2DLB A;  4PT5 A;  1TZO A;  2QSD A;  5BMG A;  2ONQ A;  1RM6 C;  4EE2 A;  2BW2 A;  5T8I A;  4RNA A;  1D5Z C;  1JWB D;  1B9R A;  1XLP A;  4YTP B;  4JWS C;  2WXQ A;  2ZW0 A;  4US8 A;  3AE5 B;  1PDX A;  1FRD A;  4OW0 A;  4A55 A;  1E6E B;  2OHF A;  4DXG A;  5FK9 C;  1M4V A;  4WUR A;  3AE8 B;  1F2R I;  3SFD B;  1V1O A;  2ICI A;  3J9C A;  1Y56 A;  1ZDV A;  1SE2 A;  1VDV A;  2ON8 A;  2VZK B;  4MM3 B;  2LMC A;  3Q8A A;  1B1Z A;  2WDV B;  4MH8 A;  3U2S C;  1TYG B;  2JYE A;  4RFB A;  1EU3 A;  2K5P A;  1FXI A;  1YJJ A;  4YT0 B;  4HRO A;  1KLU D;  2PTL A;  1KRH A;  5JXV A;  1MHH E;  1T3Q A;  1VZ8 A;  1D6E C;  1WWT A;  4TQ0 A;  5HHD G;  3VRB B;  3Q8B A;  2DBY A;  5EE0 A;  1JQ4 A;  4GLS C;  4RGM A;  3LXF A;  1OFF A;  3R8B A;  3N9Y C;  4XWT A;  3HVZ A;  3URY A;  1YN4 A;  1TS3 A;  2KDM A;  2R61 A;  3P4R B;  3P4P B;  1TKE A;  4L1B A;  2V0G A;  2WXF A;  4WQM A;  2MJ3 A;  4MAC A;  2OED A;  1P7F A;  1JWS D;  1FD6 A;  5MPO A;  3LYY A;  1K52 A;  1WSP A;  3KLS X;  2INN E;  1RYJ A;  4JWU C;  3W9C B;  2WDR B;  2KAC A;  2WXI A;  1FNW A;  4J3O D;  5G5G A;  3NVZ A;  4DXF A;  1WRI A;  4US9 A;  2KQ4 X;  3MHZ A;  4ARI A;  4YWG G;  2M56 B;  1YMH E;  3AE7 B;  2HDE A;  3ABV B;  1TY0 A;  2QEJ C;  4ZOH C;  4RGT A;  3IXS A;  3IT4 B;  1YN5 A;  1N63 A;  1BXT A;  3RFZ B;  1K51 A;  3U4E G;  3UI3 A;  1GPX A;  2FBW B;  3FAH A;  1IBX A;  4NZL B;  4AS1 A;  2AQ3 B;  1L4D B;  4TQ1 A;  3TUO A;  3Q8E A;  1AN8 A;  1KTK A;  2WU2 B;  3BYY B;  3HUI A;  3TSS A;  2J4X A;  4IDI A;  3E9S A;  3GS2 A;  1I4X A;  1BML C;  1CZP A;  3L4P A;  5H92 C;  4NJC A;  1JWM D;  1VLB A;  2KWD A;  5EE1 A;  3AEE B;  1QQR A;  2MJD A;  1SE3 A;  1YNT E;  3BYT B;  1ET6 A;  2L83 A;  2L32 A;  2LEK A;  1QF6 A;  1FO4 A;  2G9H D;  4IOI E;  2WNM A;  3ZJU A;  5HFY A;  1D5M C;  1N60 A;  4USA A;  3TEZ A;  2W55 A;  3NS1 A;  1DOY A;  3T3N A;  3U52 E;  4C7Z A;  5HI1 A;  3W2D A;  4XDD A;  3NVY A;  1HZ6 A;  1TY2 A;  2IGD A;  1CQV A;  1FXA A;  1QOF A;  2IGG A;  2IJ0 A;  2LHD A;  2VZK D;  4WWM A;  3SEB A;  2K9X A;  4YSY B;  1FNU A;  3C8Y A;  1VR9 A;  3E56 A;  1UWX A;  1VRA B;  2RDG A;  4TMA B;  1K53 A;  4P16 A;  1XCT L;  4RH6 A;  2JU6 X;  3TEY A;  4KGT A;  1QOA A;  2QJL A;  5I4D A;  2BB6 A;  2NTS A;  1IGD A;  3B9J A;  1YQ3 B;  3AED B;  2JZP A;  3FIL A;  2IPK D;  1N5X A;  2CU3 A;  4A90 A;  1XLO A;  1KH0 A;  2J53 A;  2QIE B;  5BMI A;  4CQN A;  2MEK A;  4UDU C;  2FUG 1;  2J52 A;  2JXT A;  2RPV A;  2BTE A;  2CJN A;  1DOX A;  2KMM A;  1I4Q A;  1T5X D;  3AM9 A;  1TJE A;  4C56 C;  4YTM B;  1L5P A;  2JYT A;  3BK2 A;  1SXT A;  1ZOY B;  4IKG A;  2WDQ B;  1SE4 A;  4YSZ B;  1QLB B;  3LB8 C;  4DQO C;  3AEF B;  2CJO A;  3P42 A;  4ARC A;  1V1P B;  1MHX A;  2DWQ A;  2QIL A;  2PVG C;  3P63 A;  1ZUD 2;  1XXG A;  1AW7 A;  4KKJ A;  3FC4 A;  1L6V A;  1PUT A;  2PLP A;  4L23 A;  1VJK A;  2ACZ B;  3PZ8 A;  5LNK 1;  3ZJV A;  5BYR A;  1TKY A;  2JQR B;  4A8X C;  1VZ6 A;  2BS4 B;  1UWM A;  3AE6 B;  2EEL A;  5AUK A;  2Y5C A;  2DYM A;  5TSS A;  1PGB A;  4XDC A;  3EA6 A;  2WXM A;  3NVW A;  3SFE B;  4HKZ E;  1YN3 A;  2BYT A;  1PGX A;  1QOB A;  2RDH A;  2YEP B;  1LO5 D;  1VZ7 A;  2IDY A;  3MC0 B;  1ZXH A;  3P4S B;  4ZRQ A;  2N9K A;  1V8C A;  1L0Y B;  4LLG M;  1JCK B;  1NEN B;  4NAM A;  2B76 B;  1EU4 A;  2JSV X;  4ZHP A;  1ZDX A;  4B0E A;  1ZPS A;  5E6J A;  2WXP A;  3AV8 A;  1ZE3 D;  2K0P A;  3W5U B;  2JWU A;  3H8H A;  3AN1 A;  1OQR A;  2AX5 A;  3IT6 B;  4RGN A;  1Q10 A;  2M19 A;  1KLG D;  1L0X B;  4H2A A;  1JWU D;  1HA5 A;  2PVO D;  2H89 B;  1ACC A;  1C79 A;  2XN9 C;  4FXC A;  4GDL B;  2V3N A;  1UNS A;  3B2F A;  3SR6 A;  1HXY D;  3BK1 A;  3EGR A;  2AQ2 B;  1XLQ A;  1SSN A;  1SJH D;  4NAW B;  1FCL A;  3WCQ A;  1JAL A;  1JWA D;  1AYF A;  2JX5 A;  3KQ4 A;  4XWW A;  4LK0 M;  4OZA A;  1CJE A;  4M0W A;  1CK1 A;  2TSS A;  4C7Y A;  1DOI A;  2INP E;  4ZYS A;  1GAQ B;  2LHE A;  3AEC B;  5C3J B;  4YXD B;  4LTU A;  3P4Q B;  2FE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...