1XCTL

Complex hcv core-fab 19d9d6-protein l mutant (d55a, l57h, y64w) in space group p21212
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
70
structure length
70
Chain Sequence
TPEEPKEEVTIKVNLIFADGKIQTAEFKGTFEEATAEAYRYAALHAKVNGEWTADLEDGGNHMNIKFAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein C
publication title Different crystal packing in Fab-protein L semi-disordered peptide complex.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
total genus 15
structure length 70
sequence length 70
chains with identical sequence M
ec nomenclature
pdb deposition date 2004-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1xctL00
2KDMA 1MHHE 1Q10A 4IOIE 1EM7A 3GB1A 1HEZE 1YNTE 1F2RI 2QSDA 2GB1A 1IGCA 2KACA 2JXTA 2LHDA 1GB1A 2PTLA 2JU6X 2RPVA 1FCLA 2JZPA 2I2YA 1XCTL 2J52A 1QKZA 1F2RC 2LUMA 4KGSA 5BMHA 4D2KA 5JXVA 4HKZE 2N9KA 5BMIA 4KGTA 5BMGA 1P7FA 2KN4A 1IBXB 4OZBA 5HHDG 4HJGE 3FILB 1PGAA 4KGRA 2EELA 1GB4A 2PLPA 1K52A 5HG2A 5HI1A 2KWDA 2JSVX 2NMQA 4IKGA 2N9LA 2ZW0A 1IGDA 1HZ5A 1P7EA 1C9FA 2N7JA 1XF5L 1FD6A 2ZW1A 1MVKA 1PGXA 2IGDA 1K53A 1IBXA 1K51A 1XCQL 2ON8A 1UWXA 4OZCA 3FILA 2KQ4X 1PGBA 2PW9A 1K50A 4OZAA 1KH0A 3UI3A 2QMTA 2GI9A 2RMMA 2IGHA 1D4BA 2IGGA 1HZ6A 2LGIA 5HFYA 1ZXHA 1MHXA 1FCCC 2ONQA 4WH4A 2OEDA 2K0PA 1MI0A 1MPEA 1YMHE 2LHEA 2J53A 4GLSC 4MACA 3V3XA 3MP9A 1JMLA 2I38A 2JWUA
chains in the Genus database with same CATH superfamily
2KTFA 2KDMA 4AJWA 5D3DA 3AV8A 2BYTA 3W1YA 1KLVA 3O65B 3ZRFA 3H7SA 2JY6A 1Q0WB 2VH1A 1L6VA 3Q3JA 1G6JA 2WP9B 2W3RA 4F7ZA 2UU7A 4W9LA 4GDKA 3SFDB 4FN2A 3RZFA 4DHJD 4IDIA 1E10A 2DNFA 2O6VA 2D10A 2LUEA 4P1BC 2I2YA 2RDGA 4ZRQA 3SFEB 1UBIA 2FCNA 1GOZA 3DHGC 4MH0E 2DYBA 2LGSA 4MJSB 2MH7A 3ZQ4A 3AECB 1TKGA 5G5GA 4IWOA 4LLGM 1XLQA 5IAAC 3ZDTA 3QWZB 2KFKB 1E7UA 4YSXB 4GN1A 3C19A 3B2FA 3RNGC 4GDLB 3ZXRA 2MHJA 2ZW1A 2PE9A 1IBXA 2PE6B 3L10B 3FILA 3N1XC 2LMCA 2L0FA 1Y8RC 2BS2B 2D3AA 4IWQA 2RDHA 4MSMB 4WAAA 1QLBB 4I6LB 1CJEA 1WGDA 3Q8AA 1T3QA 4US8A 1L4ZB 2KHWB 4YXDB 3SEBA 3BINA 2G4SA 1L2NA 3P63A 4ZYSA 1QILA 1MPEA 4CYEA 3RN9C 4XWWA 1LO5D 4JGHB 4K7UA 1P3QU 3ZXVA 1MFWA 5LLIA 2WXIA 2VZKD 2YEPF 3I3TB 3IHPC 4JIOU 2MBOA 4BOZB 1F2RI 1PDXA 2KMAA 4NY0A 1WMHA 3DVNV 4RFBA 5H8YE 2KACA 4GDLA 1FIQA 3QA8A 4E3CA 4BBNF 3GP7A 2WNMA 5IP4D 4RGMA 3TMPB 4LNKA 3NZSA 3QQ8B 3ZIMA 1WJUA 4OW0A 1WJ6A 5E6PA 1VDVA 1TY2A 1GUAB 2K6DB 4N9F4 3MC0B 5J17A 3QJZA 3QCAA 1WM2A 4ZRJA 3RNFC 1ZE3D 3MHZA 4EUTA 2SEBD 3GE3C 1QT9A 1L4DB 4ZOHC 4GMVA 2JRIB 2LI5A 3VUYA 1E8WA 1UUPA 1K53A 4K1RB 2V3NA 4ZYNA 2V3SA 5AEKB 1I4HA 1PGBA 3JSVB 2JRHA 4HEA1 3ENEA 3P4PB 1YD8U 1RWSA 3DQVA 3URYA 3A1QA 1S1QB 5HFYA 3RUIB 3CF6E 2DENB 1VR9A 3RNEC 2IY1B 5JH5C 2KLGA 2MQJA 4IM0A 4DXFA 1FRDA 4PYUA 2MP2A 2WWZA 1ESFA 2LASA 4NAWB 1PYWD 1MHHE 2KKCA 1L0VB 2MBHA 2ZPNA 2LVQA 1YNTE 1FFUA 4ARIA 3Q3FA 1N5WA 1CZPA 1ZXIA 2G45B 5BO4B 3DBHB 3ZNHB 1D5ZC 4LDTB 1T5XD 3K9PB 2IY0B 2JU6X 2KOXA 2K1FA 4DHJB 1IYFA 5JZEB 3ZO5B 1XLNA 2L8JA 1EU4A 2LUMA 3ZKJC 1L5PA 3AE9B 4GSWA 3WALA 3L16A 3PS6A 2BWFA 1P0RA 2CJOA 4RH6A 1NEKB 2M17A 4NPNA 1WSPA 2Y5PA 1WR1A 3H6NA 4WJQA 3EFUA 1VZ8A 1WJNA 4E74A 4K81A 3ZNZB 1NI3A 1FO4A 3WAMA 4M02A 3X23A 1YN3A 4LK0M 3HIZA 4NJCA 4NQKE 4M01A 1TS2A 3NVVA 3AE5B 5LXHA 4NAWA 4MGKE 2M0XA 2GMIC 2N9XA 3MC8A 1Z5SB 4JX1C 1EUVB 2WQYB 2DZMA 1B9RA 4URKA 1HXYD 3U4EG 2WHIA 3A9KA 5CHWA 4GU2A 4BOSC 1WI0A 1HA5A 3GOEA 4N59A 2BF8B 4K7WA 2WU5B 4QAYA 3MC9A 1RM6C 2GBMA 3WA0A 3CWIA 1YMHE 5EE0A 2KMCA 4XDDA 4NJ6A 2VZKB 3A4RA 1FNVA 2REXA 2R2OA 4FULA 4MDKE 3U30A 4Q2JA 1OEYJ 4YTPB 2JQRB 4EZLA 4W9KA 3DBLB 3AI5A 5IO9A 2KJHB 2JXXA 4AP4C 1UWMA 3M3JA 1AN8A 4YSZB 3QC8B 1K8RB 1TKEA 1OQQA 1JALA 4A6QA 1E9MA 4M0WB 4B9KA 1GAQB 1AARA 2J0KA 3CSTA 2KVZA 3H7PB 1FFVA 1B1ZA 1VJKA 4RGTA 4W9JA 1BXTA 1I7HA 1A5RA 2WXJA 1YQ3B 4XZ4A 3RYTA 3L4PA 2ZCCA 3C0RB 1SBBB 3RCZA 1C3TA 3DWMA 3EECA 4A3OA 4A3PA 2WXOA 4ARCA 4TQ1A 4G11A 3R7QA 2LXCA 3VDZA 2EKEC 5IA7A 1WWTA 2WXNA 4F8CB 4P16A 5HKHA 5D94A 4XDCA 2MCNB 1TZ1A 4HROA 4C00A 3KUDB 2PW9A 2PKOA 3B0AA 3N1YC 3MJ5A 1MJDA 1V49A 1ET6A 1WGHA 1JRPA 3VR8B 4KIKB 5AZFA 2IDYA 3B08A 3PLVA 2X8XX 5JHAA 4AQ7A 2N9PC 5KHOA 1RFAA 4MGYE 3RNAC 1E8YA 3ZTDA 1L0YB 4IWPA 2GLSA 4ZDVA 1C1YB 1WF9A 4EZJA 1WRIA 4MH8A 3RFZB 5EE9A 1UBQA 1WE6A 4USAA 3TEZA 4JLCA 3VXWA 4ICUA 2LZ6A 3AMZA 3N20C 3NUHB 4LNOA 3VRAB 2MW5A 2N0SB 1F77A 3ZTCA 4N6EB 2K39A 4ANVA 2NPTB 4HRSA 1V2YA 3LDZE 3BZDB 3HK0A 4S0RA 4XC2A 2FCQA 2B76B 2WDVB 4KKJA 4KGRA 4WWOA 4GIVA 2CJNA 3QHTA 1L7YA 3U7DA 2FCSA 2HE7A 2NTSA 3T3OA 2PEAA 3HM3A 1ZDXA 4FXCA 3KUZA 1T0YA 2JSVX 4PS7A 2N9EB 4US9A 3WAPA 2PVGC 3IG3A 3QK0A 5EDSA 5L95C 1SXTA 4I6PA 1YQ4B 3IVFA 1KM7A 2B3AA 1N61A 2MRPA 2QHOA 4WJPA 4LNFA 2LEKA 2VH2A 4FBJB 2M56B 3WIMA 4YSYB 2V3PA 1KH0A 2GBKA 4II2B 4R3DA 1D5MC 1I4XA 1HZ6A 2L05A 4ZRIA 4LTUA 2KLCA 1UD7A 4GDKB 2N7EA 2KXJA 2O6VB 2D3GA 3BYYB 4FLHA 4HLEA 1JMLA 4H2AA 3CMMB 3P4QB 1KTKA 1C77A 1OQRA 1TS4A 1SE2A 1ZW7A 3H9DA 4AWJA 4C4VA 1YJ1A 3VRBB 1QF6A 3VQIA 3NY5A 3Q8CA 2Y5CA 3U52E 1V80A 1FXIA 4RGOS 4KZ0A 4NNJB 1E90A 4GOCA 4AS1A 2XN9C 1J8CA 1GC6A 1VZ6A 3TL5A 1E6EB 2DYOA 4HKZE 1XLOA 2KZRA 4KGTA 1P7FA 1VRAB 3PZDA 1IBXB 2M19A 5BYSA 1SF0A 2V1YA 3FILB 3VTWA 2INPE 4KVGB 2K8HA 3W5VB 3AN1A 2FAZA 5HG2A 4TV3A 4EE2A 1WX9A 1GG3A 5HI1A 3AU4A 4JL9A 2QEJC 1X1MA 2N7DA 1FNWA 4BKSA 2N9LA 1HZ5A 1MG4A 2PPHA 4OVUA 3SD5A 3VTUA 2KDBA 3TSSA 1E8XA 1XCQL 3AH7A 2V4LA 4LNNA 4ITKA 4ANXA 3EUB2 2WDRB 4W9IA 2LRWA 4J3OD 2KQ7A 2IGHA 2KJ6A 5D6JB 1YN4A 1SB3C 2LJIA 3ML8A 1WMHB 5AZHA 3VFKA 2IO3B 1T0RC 2WYQA 3DVNU 2L76A 2JYEA 3WANA 1HE8A 4HDQA 4MGIE 2LWPA 1PUTA 1AYFA 4IM3A 1WE7A 2FE8A 1Q10A 1EM7A 5C2TB 2MX2A 3ZUNA 3AEAB 2C7MB 2X38A 5T8IA 3TIXA 1UF0A 1QOAA 1TY0A 2N1WA 4BKGA 2L52A 3KYDD 3NRZA 3TEYA 1TYGB 4A9AA 2OOBB 2PTLA 2WXFA 1KLUD 4B6WA 3BWUD 1RYJA 2A4ZA 3A9JA 4HCPB 1JROA 3Q6BA 4YWGG 1TJEA 5I4DA 3DOWA 2XK5A 4BFRA 3AEBB 2AL3A 5HHDG 2KNBA 4WJOA 4P6VF 1NBFC 2AL6A 1DGJA 3DBRI 5CHFA 2H89B 1GB4A 5IOIA 2LFIA 2EMSA 3MFGA 1NI2A 3NS1A 4M00A 1Q5WB 3A1QB 3ZJUA 3L08A 5GXGB 4PK1A 3PPAA 4IC7B 2GOWA 5KHQA 4XX5A 2L3ZA 1WXQA 4ACFA 3AE4B 1IUEA 1A70A 3HVDA 3BY4B 2HTME 2MP2B 2Z59B 2QCZA 4M8MA 2KO3A 3I5JC 2M4NA 2NBUA 4TUUA 4XE0A 3DHIC 5C23A 3W9CB 3K9OB 3OLMD 2L7RA 3KLSX 1F0ZA 4HKQA 2KANA 3M63B 5BYRA 2D2QA 4PS8A 2MJ3A 3AEFB 4W9CA 1R4MB 3OAWA 3I63C 1SE9A 3BVGA 2BYFA 3L17A 1EWYC 4KDIC 4EFOA 4RM9A 5TSSA 3UIOB 3SR6A 4BZAA 3X0WA 2CR5A 3LYYA 2W3SA 2QJLA 1JQ4A 2LHDA 3ETRA 3T3NA 2LGXA 3IT6B 2KFJA 2RR9A 2JZPA 2NCNA 2WS3B 3PO0A 5D7GA 2DYMA 4REZA 3VH4B 2Z8LA 1WZ0A 2KC2A 4RGNA 3BK2A 2N9KA 4L2YA 1FXTB 3H8HA 4CO7A 2RGFA 3KUCB 1L0XB 2JVCA 2G3QB 4P7IA 2BGFA 2DZIA 1FNUA 2AYOB 3VVWB 4TSSA 3NS8A 5H92C 3ZGZA 2K9XA 3A9KB 4MGZE 4MEMA 1RAXA 4L23A 1JWAD 1Q1OA 5E6JA 3PREA 1AWDA 2JX5A 3PV1A 2JYTA 2V9HA 3NVWA 4C80A 1E8ZA 3W1SC 1UGJA 2YLMA 1V86A 3Q8BA 1VD2A 1EO6A 3QARA 3B2GA 1K50A 2QC8A 4JWUC 5E6NA 2BS3B 2IJ0A 1WM3A 3AB5A 1WZ3A 1WX7A 1BUIC 4ASWC 1T0QC 1QOFA 3DDCB 4TQ0A 1WGGA 1RFKA 1V81A 2ONQA 4J6IA 1EWCA 4CHKA 4DWFA 4A20A 3BK1A 2C7HA 3GE8C 2AX5A 2FUG1 2UYZB 4E71A 1NDDA 3ZJVA 3R8BA 4HXDA 3DVGY 1WJ4A 4HPMB 2XBBC 3ZVVA 1IGCA 1R4NI 1RLFA 3BVZA 2JXTA 3UGBB 2M8SA 4NAMA 2ZNVB 2LVPA 2FUHB 2RPVA 1SIJA 3PHWB 4BKSD 1LM8B 2W54A 2WXHA 4RF0A 3VAWA 4YL8A 2KYWA 4KX6B 3WAOA 3SDLC 3B1LX 3PTFC 4AOFA 3RPFC 2PVOD 2J42A 1WXMA 4CQNA 5FK9C 2BPSA 2J4XA 1PGAA 2EELA 2L0TA 3MHSD 3EFCA 4W9FA 4GGQA 2KQSA 2KWDA 1J19A 4IKGA 1P7EA 4JWSC 2WX1A 3OWEB 4FADA 3R66C 4WQOB 4RM8A 1FEHA 4ZHPA 4C56C 2LJ5A 2BB6A 2KJRA 5DPWA 1MVKA 2LRUA 2BS4B 1D3ZA 2JT4B 2MLBA 2KQ4X 3P4RB 3PVLA 4WAFA 2MA9B 2O2VA 3GZNI 5CX3A 2BBCA 2WDTB 2CU1A 2DBYA 1H8CA 1EU3A 2AQ3B 1GC7A 3HM6X 3Q69A 3KH0A 1N5XA 1F9JA 1STEA 3EC8A 5J18A 4W9DA 3IXSA 2J53A 2W82A 5MPOA 4MACA 3PRPB 5FKAC 2NR2A 3PZ8A 2WGSA 4HWIB 1E7PB 3PLUA 4JE3B 1T0SC 1HEZE 3MTNB 2WXPA 2MJEA 2MSED 4W9GA 3QX1A 3JW0X 3E9SA 3TEWA 2BTEA 3AE8B 2W9NA 2GBJA 1C4CA 3IT4B 2KTRA 3I9V1 4LCDE 3RULA 1P9DU 1XCTL 3RZWC 5BMHA 2KX3A 3I57A 1SE3A 4OZBA 1WXSA 4HPPA 3ALBA 2CHXA 1C4PA 4W9EA 1T6BX 1QOGA 3AEEB 1QOBA 1WRDB 1JWMD 3B9JA 3VR9B 3HRDD 2G4DB 2KD0A 1E0ZA 1FD6A 3NVZA 2Y5BB 1K51A 1QQRA 2TSSA 2DAFA 1ZGUB 4UDUC 1VLBA 2C7NB 2YEPB 3RD2A 1XXGA 2GI9A 4C4VB 3LXFA 1D4BA 2AEHA 3OJ4B 4YT0B 3SHQA 1WY8A 1SE4A 5AZGA 2HJ8A 1ET9A 2NBVB 2R2QA 2AWTA 1V5TA 2ZVNA 1EF1A 2WLBA 5GMVA 3J9CA 3KWVA 1ZP0B 1XQQA 4DQOC 2KDFB 1S3SG 2FNJB 3GB1A 3ZNID 1EF5A 2AQ2B 2L32A 3Q2AC 2DLBA 2IO0B 4IW0A 3DBLI 3KYCD 4FA6A 3N1ZC 1JWSD 2ZJDA 4JPSA 1LQBA 2JUOA 3AXCA 1QKZA 1F2RC 5CTRC 1WXAA 3U8ZA 2HD5B 3R7RA 3BVMA 2LXAA 4HDOA 3Q3NC 3ZJTA 2BVCA 1KOTA 2RDBC 1F52A 3TBLD 1XLPA 5EE3A 4A8XC 2Q5WD 4NJ7A 3RNBC 2EKIA 5E6OA 1ACCA 1P98A 1M94A 5FR6A 2R61A 3BIID 1PGXA 2IGDA 1L6UA 2WXMA 2K5PA 3V60A 1UWXA 2NVUI 2MWSB 1I4RA 3U2SC 3MJWA 1JCKB 4N58A 2DHZA 2QMTA 3Q14C 1XT9B 2IGGA 2HJ1A 1JW9D 2PIAA 2INCC 2UWQA 2JF5A 3AE7B 1GNUA 4DBGA 3WCQA 4G3XB 2LGIA 3UINB 3EHVA 2WXLA 1ZXHA 4WH4A 2OEDA 4LDTD 3NZ3A 4XGAB 1FPYA 1SJED 1KF6B 3ML9A 3Q3OC 1V1PA 2MEKA 4G0NB 3A9JB 3AULA 3DBSA 2I38A 2L00B 3TJPA 1D6EC 4K7SA 2XK5B 3D32A 4X57B 4WJNA 4ZHOA 4K3CA 4O1NA 3PHXB 1XEEA 2KAJA 4YTNB 2C60A 1PFDA 2BW2A 3UIPB 1FCLA 2K6QA 2J52A 1YIWA 2Y3AA 1UELA 4NZLB 1I4PA 3IBEA 4D2KA 1ROEA 3RNCC 3TCAA 4BAXA 2ASQA 3ONSA 5JHBA 1JWUD 3VUWA 4PS3A 2KT7A 1GJZA 4XYCA 3AE3B 4L1BA 1CK1A 3PSEB 1YQBA 3EA6A 1C76A 2JZ3B 2ZEQA 3Q8EA 3W5UB 1TTNA 1JWBD 4B0EA 3JYUA 4GXBA 3BYTB 1V97A 4ANUA 4DXAB 2DWQA 1XD3B 3N30A 4C7ZA 2IZVB 1IGDA 5C3JB 2WX0A 1C9FA 1YOVB 2E3TA 2H88B 2BKRB 1YX6B 3PRZA 1WGKA 4OZCA 1F1HA 4MJSA 1TBEA 3PT2B 2J0MA 3A33B 4WURA 4K3BA 4OZAA 2L1AA 3NG0A 3OG5A 2M1MA 2XEWA 1J0GA 2PJHA 2SAKA 3P4SB 2KFKA 1C78A 3FAHA 1R4NB 1TS5A 2V4IB 3IAS1 2LGDA 2ZCBA 5LXIB 1U4AA 4I6NB 2K8BA 1MHXA 4KSLC 1SSNA 3DHHC 2JZZA 3RMKC 2DZKA 3JVZX 3ZNGC 1GPXA 1SJHD 5IKCM 1OEYA 3RI7C 2FCMA 2BB5A 3TEXA 3GS2A 3AE1B 2Z0DB 1TZOA 2IO1B 3T8MA 5EE1A 2MBBB 2QIEB 2XNAC 1Z2MA 1BMLC 2LD9A 5C1ZA 2BQQA 4KZCA 4HPLB 4OHJA 3N3KB 2WXQA 1GB1A 2KWVB 3R3MA 4DHZE 5G5HA 2BKFA 2KVRA 2HDEA 1NYRA 4EZKA 2D3BA 3FC4A 2ICIA 3NZUA 3ZDMC 3APFA 2DX5B 5JXVA 1FM0D 3KVFB 4RF1A 3P2BA 2KN4A 1YJIA 1R7SA 1ZKHA 1YX5B 2KK8A 2WXKA 3GZNB 3ZRCA 1ENFA 1WH3A 1K52A 3QIJA 4FHJA 1D5XC 1TIFA 3Q3MC 2NMQA 3DCGA 2I1KA 4LJPB 2BWES 1J7BA 1C79A 2K3UA 2A5UA 3AEDB 1TT5B 2DZJA 4HK2A 2OJRA 3T9LA 3SU8X 2W55A 1JRUA 2ON8A 1ZUD2 2E6XA 4M8NA 3NOBA 2NTTA 3Q8FA 4A90A 1KRHA 3KQ4A 2K25A 5G55A 3UI3A 3R2TA 1I4GA 2ZZPB 5DCNA 2CHZA 3H1UA 3C8YA 1DYQA 3OJ3A 4AJYB 1FRRA 2ACZB 1SIFA 3AE6B 5D2MB 1DOXA 4HVBA 1E5WA 2LHEA 4GLSC 2CU3A 3DWGC 3N9YC 3JSVA 1KLGD 1DOYA 2GRIA 3DVGX 1ZDVA 1FMAD 4IOIE 1V1OA 1Y56A 2ZPYA 3M62B 2CS4A 4LNIA 2QSDA 4FHKA 2D5GA 4KKIA 5DPRA 2JWZA 4KSKC 1TKYA 4WQMA 4II3B 2LGYA 1J7AA 4DDGD 1AW7A 1CMXB 1MG8A 3VHTC 1E7VA 1I4QA 4KGSA 2YVCA 4FJYA 1HTOA 1WX8A 3LB8C 5FR3A 3L0WB 4DDID 4HJGE 1V8CA 4RNAA 3W1SA 1YN5A 2KWUB 2RPQA 3LJ3A 2O2VB 1YJJA 2HTHA 2KDEB 5G2NA 3R2IA 4KV2A 4OVVA 1WXVA 1N62A 2GBNA 4YTMB 4ZRPA 5DPSA 2ZW0A 3TUOA 1ZPSA 2IO2B 2C5LC 3V62A 2D07B 5TR5A 1WYGA 1WIAA 3L54A 2QDFA 3CIRB 1N6ZA 2O6VD 1TGZB 2N1VA 2ZNVC 3V6CB 2RMMA 4KDLB 3APDA 2BYVE 2INDC 1NENB 1P1AA 2CKHB 3NVYA 3HHMA 3KW5B 4FJVB 2LVOA 2OHFA 1WR6E 3NJTA 5LNK1 3ZW3A 2JPHA 2N4FA 2IBIB 2K0PA 3UF8A 2KTRB 2L83A 4WWPA 4ZRKA 4F1SA 1R4MI 5CHVC 1NVID 1OFFA 2KC1A 2KDIA 1KFYB 2JWUA 3S2AA 4IUMB 1WFYA 3RT3B 1KJTA 3AEGB 2V0GA 2M0AA 4HJKA 3UQAA 3O13A 3PGEA 5AUIA 2KN5A 4TKNA 4W9HA 1TS3A 1FXAA 1UZXB 5J2RA 2OJWA 4IG7B 3UQBA 1RRBA 2QILA 1J7CA 4B95A 2KX0A 1V5OA 2NBWB 4EKUA 2MBQA 1QZEA 1NYQA 5BMIA 5BMGA 1WGYA 1VZ7A 2D11A 4ICVA 2G1EA 4ANWA 1PQSA 1SGHA 3ZLZA 3PZ7A 2PLPA 4RMAA 2BYEA 1WGRA 3DBHI 4OVZA 4C7YA 4WIPA 3EGRA 2BT6A 2NS5A 4BVUC 4M0WA 4XWTA 4PYZA 2N7JA 2WXRA 3E56A 3H7PA 3VUXA 2WXGA 1I42A 2FIDA 1H4RA 1N63A 3FKYA 2MBEA 3A4SC 3P1MA 1ISNA 3PRMB 2EMTA 2DAJA 4MELA 4WWNA 2AQ1B 2J0JA 2IYDB 2WU2B 4G50A 3IAM1 2RSUA 1LFDA 2IPKD 3HVZA 4AUQC 3HUIA 1I35A 5L83A 1M4VA 2D3CA 1WYWB 4MT5A 4A55A 3NHEB 2KWCA 3V3XA 2J7QB 1BT0A 5BYQA 5IN7A 4DXGA 2PMVA 1VCBA 3KWLA 3U7ZA 2GBRA 2GB1A 2INNE 4DHZB 3QAQA 3ABVB 4PT5A 2CHWA 4MSQB 4KIKA 3CSFA 3V6EB 2VRRB 4WWMA 4EOYA 1V6EA 4EEWA 2WDQB 1V9JA 1LGRA 3N32A 2K8CA 1IPGA 3M95A 4MM3B 1HTQA 4S17A 1LXDA 3DBRB 4HCNB 1C4AA 4TMAB 3V05A 2FIFA 3IFWB 4BBNC 4DK5A 2G9HD 1UH6A 3ZYYX 4RCOA 3DPDA 4P1CC 5D3IB 4GB9A 2C9WB 1N60A 1HQRD 3VTVA 2ZVOA 2K22A 4JQWC 2KMMA 1XF5L 4IM2A 4LJOB 2NPTA 3L13A 1IP9A 5DPTA 1SEBD 4BKTA 3P42A 3AE2B 3W2DA 1UNSA 3AM9A 1V1PB 3APCA 1XO3A 1OQYA 3ECIA 2Z0EB 1OGWA 3VH3B 2I1JA 5AUKA 2MJDA 2FBWB 1ZOYB 4B0MA 1OTRB 4MM3A 1FCCC 1MI0A 3V61A 1DOIA 4NQLB 3AU5A 3MP9A 4FJZA 1CQVA 1UGMA 2RD0A
chains in the Genus database with same CATH topology
2KDMA 1TZOA 3AV8A 1L0YB 5D3DA 5EE1A 3ZJVA 3R8BA 2BYTA 2QIEB 2XNAC 1WRIA 1BMLC 4MH8A 3RFZB 1IGCA 1L6VA 5EE9A 2WP9B 4OHJA 3BVZA 2W3RA 2JXTA 2WXQA 4USAA 4NAMA 3TEZA 1GB1A 5G5HA 3SFDB 3AMZA 3NUHB 2HDEA 2RPVA 1SIJA 4IDIA 1E10A 1NYRA 2I2YA 3VRAB 2N0SB 2RDGA 3FC4A 1F77A 2W54A 2ICIA 2WXHA 4RF0A 5JXVA 4N6EB 4KX6B 4ZRQA 3SFEB 1FM0D 4RF1A 4HRSA 2KN4A 1GOZA 1YJIA 3RPFC 3BZDB 1R7SA 2PVOD 2J42A 4CQNA 5FK9C 2J4XA 2B76B 2WDVB 4KKJA 1PGAA 4KGRA 2WXKA 2EELA 2MH7A 2CJNA 3ZQ4A 3AECB 1ENFA 1TKGA 5G5GA 1K52A 2NTSA 3T3OA 4LLGM 1XLQA 1D5XC 1ZDXA 4FXCA 2KWDA 2JSVX 4YSXB 2NMQA 4IKGA 4US9A 1J7BA 1C79A 1P7EA 2K3UA 3OWEB 4JWSC 2PVGC 3AEDB 3B2FA 4GDLB 1FEHA 1SXTA 4ZHPA 4C56C 1YQ4B 2BB6A 2ZW1A 1MVKA 2W55A 1IBXA 2BS4B 1N61A 2ON8A 1ZUD2 3FILA 2E6XA 2LMCA 2KQ4X 2LEKA 2BS2B 2NTTA 3P4RB 2M56B 3Q8FA 4WAFA 4A90A 1KRHA 4YSYB 2V3PA 3KQ4A 2RDHA 1QLBB 1KH0A 3UI3A 3R2TA 1I4GA 1CJEA 3Q8AA 4R3DA 2BBCA 1T3QA 1D5MC 2DBYA 4US8A 3TEXA 1I4XA 1HZ6A 1L4ZB 1EU3A 4YXDB 4LTUA 3SEBA 2AQ3B 3C8YA 1DYQA 3P63A 3Q69A 4ZYSA 1FRRA 2ACZB 1N5XA 3AE6B 1QILA 1MPEA 4GDKB 1STEA 1DOXA 4XWWA 1LO5D 2LHEA 5MPOA 3IXSA 2J53A 2W82A 3BYYB 4GLSC 4MACA 2CU3A 3DWGC 5FKAC 3N9YC 1KLGD 1DOYA 2GRIA 1JMLA 2WXIA 4H2AA 2VZKD 3P4QB 3PZ8A 1KTKA 1ZDVA 1FMAD 1C77A 1OQRA 2YEPF 1E7PB 1SE2A 1TS4A 4IOIE 4JE3B 1V1OA 3VRBB 1Y56A 1QF6A 1HEZE 1F2RI 2WXPA 2MJEA 2QSDA 1PDXA 2D5GA 4KKIA 3VQIA 3E9SA 3TEWA 4RFBA 5H8YE 2BTEA 1TKYA 2KACA 3Q8CA 4WQMA 2Y5CA 3AE8B 1FIQA 3U52E 1J7AA 1FXIA 4RGOS 3GP7A 1C4CA 3IT4B 2WNMA 1AW7A 3I9V1 4RGMA 1I4QA 1XCTL 4AS1A 2XN9C 4KGSA 5BMHA 1VZ6A 1E6EB 2DYOA 4HKZE 1XLOA 3I57A 4KGTA 4OW0A 3LB8C 1P7FA 1SE3A 5FR3A 1VRAB 1IBXB 2M19A 4OZBA 5BYSA 1SF0A 1V8CA 1VDVA 4HJGE 4RNAA 3FILB 3W1SA 1YN5A 1TY2A 2INPE 1C4PA 3W5VB 3MC0B 3AN1A 1YJJA 5HG2A 1T6BX 4EE2A 3R2IA 1QOGA 3AEEB 1QOBA 5HI1A 1ZE3D 3MHZA 2SEBD 1N62A 4YTMB 2QEJC 4ZRPA 1FNWA 1JWMD 3B9JA 1QT9A 1L4DB 2N9LA 2ZW0A 3VR9B 1HZ5A 3HRDD 3TUOA 1ZPSA 4ZOHC 1E0ZA 1FD6A 3NVZA 1WYGA 1UUPA 3TSSA 1K53A 2V3NA 1K51A 3CIRB 1XCQL 1QQRA 3AH7A 4ITKA 2TSSA 1I4HA 1PGBA 3EUB2 4UDUC 2WDRB 1VLBA 4HEA1 2YEPB 1XXGA 4J3OD 2GI9A 2RMMA 2IGHA 3LXFA 3P4PB 1D4BA 1RWSA 1YN4A 1NENB 3URYA 1SB3C 2LJIA 3NVYA 4YT0B 1SE4A 2OHFA 5HFYA 1ET9A 1VR9A 5LNK1 2K0PA 2L83A 2WLBA 2JYEA 4DXFA 1FRDA 3J9CA 1NVID 1OFFA 1ESFA 4NAWB 2JWUA 1KFYB 1AYFA 1ZP0B 1PYWD 1PUTA 3KWVA 2FE8A 1MHHE 4DQOC 1Q10A 1L0VB 1EM7A 3GB1A 5C2TB 1YNTE 3AEGB 1FFUA 2V0GA 3AEAB 2M0AA 4ARIA 2X38A 5T8IA 2AQ2B 2L32A 1N5WA 1CZPA 1ZXIA 3O13A 5AUIA 2DLBA 1QOAA 1TY0A 1TS3A 2L52A 1FXAA 1D5ZC 3NRZA 3TEYA 1TYGB 4A9AA 1T5XD 2PTLA 1JWSD 2WXFA 2JU6X 4JPSA 2QILA 1XLNA 1KLUD 1J7CA 1EU4A 1QKZA 1F2RC 2LUMA 3BWUD 1L5PA 1RYJA 3AE9B 1JROA 4YWGG 1TJEA 3BVMA 1NYQA 5I4DA 5BMIA 5BMGA 1VZ7A 3ZJTA 2G1EA 3AEBB 5HHDG 2CJOA 4RH6A 1NEKB 1WSPA 2Y5PA 4P6VF 3PZ7A 1DGJA 1GB4A 2H89B 2PLPA 1XLPA 2LFIA 1VZ8A 5EE3A 4OVZA 4A8XC 1NI3A 3MFGA 4C7YA 1FO4A 3NS1A 1YN3A 4LK0M 2Q5WD 4WIPA 3EGRA 2BT6A 4NJCA 1TS2A 2EKIA 3NVVA 3AE5B 4M0WA 4XWTA 3ZJUA 5GXGB 1ACCA 2N7JA 2WXRA 3E56A 2WXGA 2R61A 3BIID 1PGXA 2IGDA 1L6UA 1WXQA 2WXMA 2K5PA 3AE4B 1N63A 1IUEA 1A70A 3HVDA 1UWXA 4JX1C 1I4RA 2HTME 3P1MA 3U2SC 2WQYB 1B9RA 1JCKB 1HXYD 4N58A 2QMTA 3U4EG 2IGGA 4XE0A 1JW9D 2PIAA 2AQ1B 2WU2B 3W9CB 3IAM1 1F0ZA 3AE7B 3KLSX 1HA5A 4HKQA 2IPKD 3WCQA 3HVZA 2LGIA 4N59A 5BYRA 3HUIA 2WXLA 1M4VA 1ZXHA 2WU5B 2MJ3A 4WH4A 2OEDA 1RM6C 3AEFB 4MT5A 4A55A 3CWIA 3NZ3A 1SJED 1YMHE 1KF6B 5EE0A 4XDDA 3V3XA 1V1PA 2MEKA 2VZKB 1FNVA 5BYQA 2I38A 3BVGA 1D6EC 4DXGA 2PMVA 1EWYC 4Q2JA 3KWLA 3U7ZA 4YTPB 2JQRB 2GB1A 2INNE 5TSSA 4ZHOA 3SR6A 4O1NA 1UWMA 3LYYA 3ABVB 4PT5A 2W3SA 1AN8A 2QJLA 1XEEA 1JQ4A 2LHDA 3ETRA 3T3NA 4YSZB 2KAJA 1TKEA 3IT6B 4YTNB 1PFDA 2BW2A 1OQQA 1JALA 1FCLA 4WWMA 2JZPA 2WS3B 4A6QA 3PO0A 2J52A 1E9MA 2WDQB 5D7GA 2Y3AA 4NZLB 2DYMA 1GAQB 4REZA 2Z8LA 1I4PA 4D2KA 1ROEA 4RGNA 1FFVA 2N9KA 3BK2A 1B1ZA 1VJKA 1JWUD 4MM3B 4RGTA 1BXTA 4L2YA 3H8HA 1I7HA 3AE3B 2WXJA 1YQ3B 1L0XB 1C4AA 4L1BA 4TMAB 1CK1A 3EA6A 1C76A 3L4PA 1FNUA 3V05A 1SBBB 4TSSA 2G9HD 3Q8EA 3W5UB 3DWMA 5H92C 1JWBD 4B0EA 3ZGZA 3ZYYX 4RCOA 2K9XA 2WXOA 3BYTB 1V97A 5D3IB 4TQ1A 4ARCA 4L23A 2DWQA 1N60A 1HQRD 4C7ZA 1JWAD 5E6JA 1IGDA 5C3JB 1C9FA 2E3TA 2K22A 2KMMA 2H88B 1AWDA 1WWTA 2JX5A 2WXNA 1XF5L 2JYTA 3NVWA 4C80A 4P16A 1SEBD 1UGJA 3P42A 4XDCA 3AE2B 4HROA 3Q8BA 3W2DA 1WGKA 4OZCA 1UNSA 3B2GA 3AM9A 1V1PB 4WURA 1XO3A 2PW9A 1K50A 4OZAA 4JWUC 2L1AA 2PKOA 2BS3B 2IJ0A 3MJ5A 5AUKA 2SAKA 3P4SB 3AB5A 1C78A 2MJDA 1BUIC 3FAHA 1ET6A 1TS5A 2FBWB 2V4IB 1ZOYB 1JRPA 3IAS1 3VR8B 4B0MA 1QOFA 4TQ0A 1RFKA 1MHXA 1FCCC 2ONQA 1SSNA 2IDYA 1MI0A 1DOIA 1EWCA 1GPXA 1SJHD 3BK1A 4AQ7A 3MP9A 2BB5A 2AX5A 1CQVA 2FUG1 3GS2A 3AE1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KDM A;  1MHH E;  1Q10 A;  4IOI E;  1EM7 A;  3GB1 A;  1HEZ E;  1YNT E;  1F2R I;  2QSD A;  2GB1 A;  1IGC A;  2KAC A;  2JXT A;  2LHD A;  1GB1 A;  2PTL A;  2JU6 X;  2RPV A;  1FCL A;  2JZP A;  2I2Y A;  1XCT L;  2J52 A;  1QKZ A;  1F2R C;  2LUM A;  4KGS A;  5BMH A;  4D2K A;  5JXV A;  4HKZ E;  2N9K A;  5BMI A;  4KGT A;  5BMG A;  1P7F A;  2KN4 A;  1IBX B;  4OZB A;  5HHD G;  4HJG E;  3FIL B;  1PGA A;  4KGR A;  2EEL A;  1GB4 A;  2PLP A;  1K52 A;  5HG2 A;  5HI1 A;  2KWD A;  2JSV X;  2NMQ A;  4IKG A;  2N9L A;  2ZW0 A;  1IGD A;  1HZ5 A;  1P7E A;  1C9F A;  2N7J A;  1XF5 L;  1FD6 A;  2ZW1 A;  1MVK A;  1PGX A;  2IGD A;  1K53 A;  1IBX A;  1K51 A;  1XCQ L;  2ON8 A;  1UWX A;  4OZC A;  3FIL A;  2KQ4 X;  1PGB A;  2PW9 A;  1K50 A;  4OZA A;  1KH0 A;  3UI3 A;  2QMT A;  2GI9 A;  2RMM A;  2IGH A;  1D4B A;  2IGG A;  1HZ6 A;  2LGI A;  5HFY A;  1ZXH A;  1MHX A;  1FCC C;  2ONQ A;  4WH4 A;  2OED A;  2K0P A;  1MI0 A;  1MPE A;  1YMH E;  2LHE A;  2J53 A;  4GLS C;  4MAC A;  3V3X A;  3MP9 A;  1JML A;  2I38 A;  2JWU A; 
#chains in the Genus database with same CATH topology
 2KTF A;  2KDM A;  4AJW A;  5D3D A;  3AV8 A;  2BYT A;  3W1Y A;  1KLV A;  3O65 B;  3ZRF A;  3H7S A;  2JY6 A;  1Q0W B;  2VH1 A;  1L6V A;  3Q3J A;  1G6J A;  2WP9 B;  2W3R A;  4F7Z A;  2UU7 A;  4W9L A;  4GDK A;  3SFD B;  4FN2 A;  3RZF A;  4DHJ D;  4IDI A;  1E10 A;  2DNF A;  2O6V A;  2D10 A;  2LUE A;  4P1B C;  2I2Y A;  2RDG A;  4ZRQ A;  3SFE B;  1UBI A;  2FCN A;  1GOZ A;  3DHG C;  4MH0 E;  2DYB A;  2LGS A;  4MJS B;  2MH7 A;  3ZQ4 A;  3AEC B;  1TKG A;  5G5G A;  4IWO A;  4LLG M;  1XLQ A;  5IAA C;  3ZDT A;  3QWZ B;  2KFK B;  1E7U A;  4YSX B;  4GN1 A;  3C19 A;  3B2F A;  3RNG C;  4GDL B;  3ZXR A;  2MHJ A;  2ZW1 A;  2PE9 A;  1IBX A;  2PE6 B;  3L10 B;  3FIL A;  3N1X C;  2LMC A;  2L0F A;  1Y8R C;  2BS2 B;  2D3A A;  4IWQ A;  2RDH A;  4MSM B;  4WAA A;  1QLB B;  4I6L B;  1CJE A;  1WGD A;  3Q8A A;  1T3Q A;  4US8 A;  1L4Z B;  2KHW B;  4YXD B;  3SEB A;  3BIN A;  2G4S A;  1L2N A;  3P63 A;  4ZYS A;  1QIL A;  1MPE A;  4CYE A;  3RN9 C;  4XWW A;  1LO5 D;  4JGH B;  4K7U A;  1P3Q U;  3ZXV A;  1MFW A;  5LLI A;  2WXI A;  2VZK D;  2YEP F;  3I3T B;  3IHP C;  4JIO U;  2MBO A;  4BOZ B;  1F2R I;  1PDX A;  2KMA A;  4NY0 A;  1WMH A;  3DVN V;  4RFB A;  5H8Y E;  2KAC A;  4GDL A;  1FIQ A;  3QA8 A;  4E3C A;  4BBN F;  3GP7 A;  2WNM A;  5IP4 D;  4RGM A;  3TMP B;  4LNK A;  3NZS A;  3QQ8 B;  3ZIM A;  1WJU A;  4OW0 A;  1WJ6 A;  5E6P A;  1VDV A;  1TY2 A;  1GUA B;  2K6D B;  4N9F 4;  3MC0 B;  5J17 A;  3QJZ A;  3QCA A;  1WM2 A;  4ZRJ A;  3RNF C;  1ZE3 D;  3MHZ A;  4EUT A;  2SEB D;  3GE3 C;  1QT9 A;  1L4D B;  4ZOH C;  4GMV A;  2JRI B;  2LI5 A;  3VUY A;  1E8W A;  1UUP A;  1K53 A;  4K1R B;  2V3N A;  4ZYN A;  2V3S A;  5AEK B;  1I4H A;  1PGB A;  3JSV B;  2JRH A;  4HEA 1;  3ENE A;  3P4P B;  1YD8 U;  1RWS A;  3DQV A;  3URY A;  3A1Q A;  1S1Q B;  5HFY A;  3RUI B;  3CF6 E;  2DEN B;  1VR9 A;  3RNE C;  2IY1 B;  5JH5 C;  2KLG A;  2MQJ A;  4IM0 A;  4DXF A;  1FRD A;  4PYU A;  2MP2 A;  2WWZ A;  1ESF A;  2LAS A;  4NAW B;  1PYW D;  1MHH E;  2KKC A;  1L0V B;  2MBH A;  2ZPN A;  2LVQ A;  1YNT E;  1FFU A;  4ARI A;  3Q3F A;  1N5W A;  1CZP A;  1ZXI A;  2G45 B;  5BO4 B;  3DBH B;  3ZNH B;  1D5Z C;  4LDT B;  1T5X D;  3K9P B;  2IY0 B;  2JU6 X;  2KOX A;  2K1F A;  4DHJ B;  1IYF A;  5JZE B;  3ZO5 B;  1XLN A;  2L8J A;  1EU4 A;  2LUM A;  3ZKJ C;  1L5P A;  3AE9 B;  4GSW A;  3WAL A;  3L16 A;  3PS6 A;  2BWF A;  1P0R A;  2CJO A;  4RH6 A;  1NEK B;  2M17 A;  4NPN A;  1WSP A;  2Y5P A;  1WR1 A;  3H6N A;  4WJQ A;  3EFU A;  1VZ8 A;  1WJN A;  4E74 A;  4K81 A;  3ZNZ B;  1NI3 A;  1FO4 A;  3WAM A;  4M02 A;  3X23 A;  1YN3 A;  4LK0 M;  3HIZ A;  4NJC A;  4NQK E;  4M01 A;  1TS2 A;  3NVV A;  3AE5 B;  5LXH A;  4NAW A;  4MGK E;  2M0X A;  2GMI C;  2N9X A;  3MC8 A;  1Z5S B;  4JX1 C;  1EUV B;  2WQY B;  2DZM A;  1B9R A;  4URK A;  1HXY D;  3U4E G;  2WHI A;  3A9K A;  5CHW A;  4GU2 A;  4BOS C;  1WI0 A;  1HA5 A;  3GOE A;  4N59 A;  2BF8 B;  4K7W A;  2WU5 B;  4QAY A;  3MC9 A;  1RM6 C;  2GBM A;  3WA0 A;  3CWI A;  1YMH E;  5EE0 A;  2KMC A;  4XDD A;  4NJ6 A;  2VZK B;  3A4R A;  1FNV A;  2REX A;  2R2O A;  4FUL A;  4MDK E;  3U30 A;  4Q2J A;  1OEY J;  4YTP B;  2JQR B;  4EZL A;  4W9K A;  3DBL B;  3AI5 A;  5IO9 A;  2KJH B;  2JXX A;  4AP4 C;  1UWM A;  3M3J A;  1AN8 A;  4YSZ B;  3QC8 B;  1K8R B;  1TKE A;  1OQQ A;  1JAL A;  4A6Q A;  1E9M A;  4M0W B;  4B9K A;  1GAQ B;  1AAR A;  2J0K A;  3CST A;  2KVZ A;  3H7P B;  1FFV A;  1B1Z A;  1VJK A;  4RGT A;  4W9J A;  1BXT A;  1I7H A;  1A5R A;  2WXJ A;  1YQ3 B;  4XZ4 A;  3RYT A;  3L4P A;  2ZCC A;  3C0R B;  1SBB B;  3RCZ A;  1C3T A;  3DWM A;  3EEC A;  4A3O A;  4A3P A;  2WXO A;  4ARC A;  4TQ1 A;  4G11 A;  3R7Q A;  2LXC A;  3VDZ A;  2EKE C;  5IA7 A;  1WWT A;  2WXN A;  4F8C B;  4P16 A;  5HKH A;  5D94 A;  4XDC A;  2MCN B;  1TZ1 A;  4HRO A;  4C00 A;  3KUD B;  2PW9 A;  2PKO A;  3B0A A;  3N1Y C;  3MJ5 A;  1MJD A;  1V49 A;  1ET6 A;  1WGH A;  1JRP A;  3VR8 B;  4KIK B;  5AZF A;  2IDY A;  3B08 A;  3PLV A;  2X8X X;  5JHA A;  4AQ7 A;  2N9P C;  5KHO A;  1RFA A;  4MGY E;  3RNA C;  1E8Y A;  3ZTD A;  1L0Y B;  4IWP A;  2GLS A;  4ZDV A;  1C1Y B;  1WF9 A;  4EZJ A;  1WRI A;  4MH8 A;  3RFZ B;  5EE9 A;  1UBQ A;  1WE6 A;  4USA A;  3TEZ A;  4JLC A;  3VXW A;  4ICU A;  2LZ6 A;  3AMZ A;  3N20 C;  3NUH B;  4LNO A;  3VRA B;  2MW5 A;  2N0S B;  1F77 A;  3ZTC A;  4N6E B;  2K39 A;  4ANV A;  2NPT B;  4HRS A;  1V2Y A;  3LDZ E;  3BZD B;  3HK0 A;  4S0R A;  4XC2 A;  2FCQ A;  2B76 B;  2WDV B;  4KKJ A;  4KGR A;  4WWO A;  4GIV A;  2CJN A;  3QHT A;  1L7Y A;  3U7D A;  2FCS A;  2HE7 A;  2NTS A;  3T3O A;  2PEA A;  3HM3 A;  1ZDX A;  4FXC A;  3KUZ A;  1T0Y A;  2JSV X;  4PS7 A;  2N9E B;  4US9 A;  3WAP A;  2PVG C;  3IG3 A;  3QK0 A;  5EDS A;  5L95 C;  1SXT A;  4I6P A;  1YQ4 B;  3IVF A;  1KM7 A;  2B3A A;  1N61 A;  2MRP A;  2QHO A;  4WJP A;  4LNF A;  2LEK A;  2VH2 A;  4FBJ B;  2M56 B;  3WIM A;  4YSY B;  2V3P A;  1KH0 A;  2GBK A;  4II2 B;  4R3D A;  1D5M C;  1I4X A;  1HZ6 A;  2L05 A;  4ZRI A;  4LTU A;  2KLC A;  1UD7 A;  4GDK B;  2N7E A;  2KXJ A;  2O6V B;  2D3G A;  3BYY B;  4FLH A;  4HLE A;  1JML A;  4H2A A;  3CMM B;  3P4Q B;  1KTK A;  1C77 A;  1OQR A;  1TS4 A;  1SE2 A;  1ZW7 A;  3H9D A;  4AWJ A;  4C4V A;  1YJ1 A;  3VRB B;  1QF6 A;  3VQI A;  3NY5 A;  3Q8C A;  2Y5C A;  3U52 E;  1V80 A;  1FXI A;  4RGO S;  4KZ0 A;  4NNJ B;  1E90 A;  4GOC A;  4AS1 A;  2XN9 C;  1J8C A;  1GC6 A;  1VZ6 A;  3TL5 A;  1E6E B;  2DYO A;  4HKZ E;  1XLO A;  2KZR A;  4KGT A;  1P7F A;  1VRA B;  3PZD A;  1IBX B;  2M19 A;  5BYS A;  1SF0 A;  2V1Y A;  3FIL B;  3VTW A;  2INP E;  4KVG B;  2K8H A;  3W5V B;  3AN1 A;  2FAZ A;  5HG2 A;  4TV3 A;  4EE2 A;  1WX9 A;  1GG3 A;  5HI1 A;  3AU4 A;  4JL9 A;  2QEJ C;  1X1M A;  2N7D A;  1FNW A;  4BKS A;  2N9L A;  1HZ5 A;  1MG4 A;  2PPH A;  4OVU A;  3SD5 A;  3VTU A;  2KDB A;  3TSS A;  1E8X A;  1XCQ L;  3AH7 A;  2V4L A;  4LNN A;  4ITK A;  4ANX A;  3EUB 2;  2WDR B;  4W9I A;  2LRW A;  4J3O D;  2KQ7 A;  2IGH A;  2KJ6 A;  5D6J B;  1YN4 A;  1SB3 C;  2LJI A;  3ML8 A;  1WMH B;  5AZH A;  3VFK A;  2IO3 B;  1T0R C;  2WYQ A;  3DVN U;  2L76 A;  2JYE A;  3WAN A;  1HE8 A;  4HDQ A;  4MGI E;  2LWP A;  1PUT A;  1AYF A;  4IM3 A;  1WE7 A;  2FE8 A;  1Q10 A;  1EM7 A;  5C2T B;  2MX2 A;  3ZUN A;  3AEA B;  2C7M B;  2X38 A;  5T8I A;  3TIX A;  1UF0 A;  1QOA A;  1TY0 A;  2N1W A;  4BKG A;  2L52 A;  3KYD D;  3NRZ A;  3TEY A;  1TYG B;  4A9A A;  2OOB B;  2PTL A;  2WXF A;  1KLU D;  4B6W A;  3BWU D;  1RYJ A;  2A4Z A;  3A9J A;  4HCP B;  1JRO A;  3Q6B A;  4YWG G;  1TJE A;  5I4D A;  3DOW A;  2XK5 A;  4BFR A;  3AEB B;  2AL3 A;  5HHD G;  2KNB A;  4WJO A;  4P6V F;  1NBF C;  2AL6 A;  1DGJ A;  3DBR I;  5CHF A;  2H89 B;  1GB4 A;  5IOI A;  2LFI A;  2EMS A;  3MFG A;  1NI2 A;  3NS1 A;  4M00 A;  1Q5W B;  3A1Q B;  3ZJU A;  3L08 A;  5GXG B;  4PK1 A;  3PPA A;  4IC7 B;  2GOW A;  5KHQ A;  4XX5 A;  2L3Z A;  1WXQ A;  4ACF A;  3AE4 B;  1IUE A;  1A70 A;  3HVD A;  3BY4 B;  2HTM E;  2MP2 B;  2Z59 B;  2QCZ A;  4M8M A;  2KO3 A;  3I5J C;  2M4N A;  2NBU A;  4TUU A;  4XE0 A;  3DHI C;  5C23 A;  3W9C B;  3K9O B;  3OLM D;  2L7R A;  3KLS X;  1F0Z A;  4HKQ A;  2KAN A;  3M63 B;  5BYR A;  2D2Q A;  4PS8 A;  2MJ3 A;  3AEF B;  4W9C A;  1R4M B;  3OAW A;  3I63 C;  1SE9 A;  3BVG A;  2BYF A;  3L17 A;  1EWY C;  4KDI C;  4EFO A;  4RM9 A;  5TSS A;  3UIO B;  3SR6 A;  4BZA A;  3X0W A;  2CR5 A;  3LYY A;  2W3S A;  2QJL A;  1JQ4 A;  2LHD A;  3ETR A;  3T3N A;  2LGX A;  3IT6 B;  2KFJ A;  2RR9 A;  2JZP A;  2NCN A;  2WS3 B;  3PO0 A;  5D7G A;  2DYM A;  4REZ A;  3VH4 B;  2Z8L A;  1WZ0 A;  2KC2 A;  4RGN A;  3BK2 A;  2N9K A;  4L2Y A;  1FXT B;  3H8H A;  4CO7 A;  2RGF A;  3KUC B;  1L0X B;  2JVC A;  2G3Q B;  4P7I A;  2BGF A;  2DZI A;  1FNU A;  2AYO B;  3VVW B;  4TSS A;  3NS8 A;  5H92 C;  3ZGZ A;  2K9X A;  3A9K B;  4MGZ E;  4MEM A;  1RAX A;  4L23 A;  1JWA D;  1Q1O A;  5E6J A;  3PRE A;  1AWD A;  2JX5 A;  3PV1 A;  2JYT A;  2V9H A;  3NVW A;  4C80 A;  1E8Z A;  3W1S C;  1UGJ A;  2YLM A;  1V86 A;  3Q8B A;  1VD2 A;  1EO6 A;  3QAR A;  3B2G A;  1K50 A;  2QC8 A;  4JWU C;  5E6N A;  2BS3 B;  2IJ0 A;  1WM3 A;  3AB5 A;  1WZ3 A;  1WX7 A;  1BUI C;  4ASW C;  1T0Q C;  1QOF A;  3DDC B;  4TQ0 A;  1WGG A;  1RFK A;  1V81 A;  2ONQ A;  4J6I A;  1EWC A;  4CHK A;  4DWF A;  4A20 A;  3BK1 A;  2C7H A;  3GE8 C;  2AX5 A;  2FUG 1;  2UYZ B;  4E71 A;  1NDD A;  3ZJV A;  3R8B A;  4HXD A;  3DVG Y;  1WJ4 A;  4HPM B;  2XBB C;  3ZVV A;  1IGC A;  1R4N I;  1RLF A;  3BVZ A;  2JXT A;  3UGB B;  2M8S A;  4NAM A;  2ZNV B;  2LVP A;  2FUH B;  2RPV A;  1SIJ A;  3PHW B;  4BKS D;  1LM8 B;  2W54 A;  2WXH A;  4RF0 A;  3VAW A;  4YL8 A;  2KYW A;  4KX6 B;  3WAO A;  3SDL C;  3B1L X;  3PTF C;  4AOF A;  3RPF C;  2PVO D;  2J42 A;  1WXM A;  4CQN A;  5FK9 C;  2BPS A;  2J4X A;  1PGA A;  2EEL A;  2L0T A;  3MHS D;  3EFC A;  4W9F A;  4GGQ A;  2KQS A;  2KWD A;  1J19 A;  4IKG A;  1P7E A;  4JWS C;  2WX1 A;  3OWE B;  4FAD A;  3R66 C;  4WQO B;  4RM8 A;  1FEH A;  4ZHP A;  4C56 C;  2LJ5 A;  2BB6 A;  2KJR A;  5DPW A;  1MVK A;  2LRU A;  2BS4 B;  1D3Z A;  2JT4 B;  2MLB A;  2KQ4 X;  3P4R B;  3PVL A;  4WAF A;  2MA9 B;  2O2V A;  3GZN I;  5CX3 A;  2BBC A;  2WDT B;  2CU1 A;  2DBY A;  1H8C A;  1EU3 A;  2AQ3 B;  1GC7 A;  3HM6 X;  3Q69 A;  3KH0 A;  1N5X A;  1F9J A;  1STE A;  3EC8 A;  5J18 A;  4W9D A;  3IXS A;  2J53 A;  2W82 A;  5MPO A;  4MAC A;  3PRP B;  5FKA C;  2NR2 A;  3PZ8 A;  2WGS A;  4HWI B;  1E7P B;  3PLU A;  4JE3 B;  1T0S C;  1HEZ E;  3MTN B;  2WXP A;  2MJE A;  2MSE D;  4W9G A;  3QX1 A;  3JW0 X;  3E9S A;  3TEW A;  2BTE A;  3AE8 B;  2W9N A;  2GBJ A;  1C4C A;  3IT4 B;  2KTR A;  3I9V 1;  4LCD E;  3RUL A;  1P9D U;  1XCT L;  3RZW C;  5BMH A;  2KX3 A;  3I57 A;  1SE3 A;  4OZB A;  1WXS A;  4HPP A;  3ALB A;  2CHX A;  1C4P A;  4W9E A;  1T6B X;  1QOG A;  3AEE B;  1QOB A;  1WRD B;  1JWM D;  3B9J A;  3VR9 B;  3HRD D;  2G4D B;  2KD0 A;  1E0Z A;  1FD6 A;  3NVZ A;  2Y5B B;  1K51 A;  1QQR A;  2TSS A;  2DAF A;  1ZGU B;  4UDU C;  1VLB A;  2C7N B;  2YEP B;  3RD2 A;  1XXG A;  2GI9 A;  4C4V B;  3LXF A;  1D4B A;  2AEH A;  3OJ4 B;  4YT0 B;  3SHQ A;  1WY8 A;  1SE4 A;  5AZG A;  2HJ8 A;  1ET9 A;  2NBV B;  2R2Q A;  2AWT A;  1V5T A;  2ZVN A;  1EF1 A;  2WLB A;  5GMV A;  3J9C A;  3KWV A;  1ZP0 B;  1XQQ A;  4DQO C;  2KDF B;  1S3S G;  2FNJ B;  3GB1 A;  3ZNI D;  1EF5 A;  2AQ2 B;  2L32 A;  3Q2A C;  2DLB A;  2IO0 B;  4IW0 A;  3DBL I;  3KYC D;  4FA6 A;  3N1Z C;  1JWS D;  2ZJD A;  4JPS A;  1LQB A;  2JUO A;  3AXC A;  1QKZ A;  1F2R C;  5CTR C;  1WXA A;  3U8Z A;  2HD5 B;  3R7R A;  3BVM A;  2LXA A;  4HDO A;  3Q3N C;  3ZJT A;  2BVC A;  1KOT A;  2RDB C;  1F52 A;  3TBL D;  1XLP A;  5EE3 A;  4A8X C;  2Q5W D;  4NJ7 A;  3RNB C;  2EKI A;  5E6O A;  1ACC A;  1P98 A;  1M94 A;  5FR6 A;  2R61 A;  3BII D;  1PGX A;  2IGD A;  1L6U A;  2WXM A;  2K5P A;  3V60 A;  1UWX A;  2NVU I;  2MWS B;  1I4R A;  3U2S C;  3MJW A;  1JCK B;  4N58 A;  2DHZ A;  2QMT A;  3Q14 C;  1XT9 B;  2IGG A;  2HJ1 A;  1JW9 D;  2PIA A;  2INC C;  2UWQ A;  2JF5 A;  3AE7 B;  1GNU A;  4DBG A;  3WCQ A;  4G3X B;  2LGI A;  3UIN B;  3EHV A;  2WXL A;  1ZXH A;  4WH4 A;  2OED A;  4LDT D;  3NZ3 A;  4XGA B;  1FPY A;  1SJE D;  1KF6 B;  3ML9 A;  3Q3O C;  1V1P A;  2MEK A;  4G0N B;  3A9J B;  3AUL A;  3DBS A;  2I38 A;  2L00 B;  3TJP A;  1D6E C;  4K7S A;  2XK5 B;  3D32 A;  4X57 B;  4WJN A;  4ZHO A;  4K3C A;  4O1N A;  3PHX B;  1XEE A;  2KAJ A;  4YTN B;  2C60 A;  1PFD A;  2BW2 A;  3UIP B;  1FCL A;  2K6Q A;  2J52 A;  1YIW A;  2Y3A A;  1UEL A;  4NZL B;  1I4P A;  3IBE A;  4D2K A;  1ROE A;  3RNC C;  3TCA A;  4BAX A;  2ASQ A;  3ONS A;  5JHB A;  1JWU D;  3VUW A;  4PS3 A;  2KT7 A;  1GJZ A;  4XYC A;  3AE3 B;  4L1B A;  1CK1 A;  3PSE B;  1YQB A;  3EA6 A;  1C76 A;  2JZ3 B;  2ZEQ A;  3Q8E A;  3W5U B;  1TTN A;  1JWB D;  4B0E A;  3JYU A;  4GXB A;  3BYT B;  1V97 A;  4ANU A;  4DXA B;  2DWQ A;  1XD3 B;  3N30 A;  4C7Z A;  2IZV B;  1IGD A;  5C3J B;  2WX0 A;  1C9F A;  1YOV B;  2E3T A;  2H88 B;  2BKR B;  1YX6 B;  3PRZ A;  1WGK A;  4OZC A;  1F1H A;  4MJS A;  1TBE A;  3PT2 B;  2J0M A;  3A33 B;  4WUR A;  4K3B A;  4OZA A;  2L1A A;  3NG0 A;  3OG5 A;  2M1M A;  2XEW A;  1J0G A;  2PJH A;  2SAK A;  3P4S B;  2KFK A;  1C78 A;  3FAH A;  1R4N B;  1TS5 A;  2V4I B;  3IAS 1;  2LGD A;  2ZCB A;  5LXI B;  1U4A A;  4I6N B;  2K8B A;  1MHX A;  4KSL C;  1SSN A;  3DHH C;  2JZZ A;  3RMK C;  2DZK A;  3JVZ X;  3ZNG C;  1GPX A;  1SJH D;  5IKC M;  1OEY A;  3RI7 C;  2FCM A;  2BB5 A;  3TEX A;  3GS2 A;  3AE1 B;  2Z0D B;  1TZO A;  2IO1 B;  3T8M A;  5EE1 A;  2MBB B;  2QIE B;  2XNA C;  1Z2M A;  1BML C;  2LD9 A;  5C1Z A;  2BQQ A;  4KZC A;  4HPL B;  4OHJ A;  3N3K B;  2WXQ A;  1GB1 A;  2KWV B;  3R3M A;  4DHZ E;  5G5H A;  2BKF A;  2KVR A;  2HDE A;  1NYR A;  4EZK A;  2D3B A;  3FC4 A;  2ICI A;  3NZU A;  3ZDM C;  3APF A;  2DX5 B;  5JXV A;  1FM0 D;  3KVF B;  4RF1 A;  3P2B A;  2KN4 A;  1YJI A;  1R7S A;  1ZKH A;  1YX5 B;  2KK8 A;  2WXK A;  3GZN B;  3ZRC A;  1ENF A;  1WH3 A;  1K52 A;  3QIJ A;  4FHJ A;  1D5X C;  1TIF A;  3Q3M C;  2NMQ A;  3DCG A;  2I1K A;  4LJP B;  2BWE S;  1J7B A;  1C79 A;  2K3U A;  2A5U A;  3AED B;  1TT5 B;  2DZJ A;  4HK2 A;  2OJR A;  3T9L A;  3SU8 X;  2W55 A;  1JRU A;  2ON8 A;  1ZUD 2;  2E6X A;  4M8N A;  3NOB A;  2NTT A;  3Q8F A;  4A90 A;  1KRH A;  3KQ4 A;  2K25 A;  5G55 A;  3UI3 A;  3R2T A;  1I4G A;  2ZZP B;  5DCN A;  2CHZ A;  3H1U A;  3C8Y A;  1DYQ A;  3OJ3 A;  4AJY B;  1FRR A;  2ACZ B;  1SIF A;  3AE6 B;  5D2M B;  1DOX A;  4HVB A;  1E5W A;  2LHE A;  4GLS C;  2CU3 A;  3DWG C;  3N9Y C;  3JSV A;  1KLG D;  1DOY A;  2GRI A;  3DVG X;  1ZDV A;  1FMA D;  4IOI E;  1V1O A;  1Y56 A;  2ZPY A;  3M62 B;  2CS4 A;  4LNI A;  2QSD A;  4FHK A;  2D5G A;  4KKI A;  5DPR A;  2JWZ A;  4KSK C;  1TKY A;  4WQM A;  4II3 B;  2LGY A;  1J7A A;  4DDG D;  1AW7 A;  1CMX B;  1MG8 A;  3VHT C;  1E7V A;  1I4Q A;  4KGS A;  2YVC A;  4FJY A;  1HTO A;  1WX8 A;  3LB8 C;  5FR3 A;  3L0W B;  4DDI D;  4HJG E;  1V8C A;  4RNA A;  3W1S A;  1YN5 A;  2KWU B;  2RPQ A;  3LJ3 A;  2O2V B;  1YJJ A;  2HTH A;  2KDE B;  5G2N A;  3R2I A;  4KV2 A;  4OVV A;  1WXV A;  1N62 A;  2GBN A;  4YTM B;  4ZRP A;  5DPS A;  2ZW0 A;  3TUO A;  1ZPS A;  2IO2 B;  2C5L C;  3V62 A;  2D07 B;  5TR5 A;  1WYG A;  1WIA A;  3L54 A;  2QDF A;  3CIR B;  1N6Z A;  2O6V D;  1TGZ B;  2N1V A;  2ZNV C;  3V6C B;  2RMM A;  4KDL B;  3APD A;  2BYV E;  2IND C;  1NEN B;  1P1A A;  2CKH B;  3NVY A;  3HHM A;  3KW5 B;  4FJV B;  2LVO A;  2OHF A;  1WR6 E;  3NJT A;  5LNK 1;  3ZW3 A;  2JPH A;  2N4F A;  2IBI B;  2K0P A;  3UF8 A;  2KTR B;  2L83 A;  4WWP A;  4ZRK A;  4F1S A;  1R4M I;  5CHV C;  1NVI D;  1OFF A;  2KC1 A;  2KDI A;  1KFY B;  2JWU A;  3S2A A;  4IUM B;  1WFY A;  3RT3 B;  1KJT A;  3AEG B;  2V0G A;  2M0A A;  4HJK A;  3UQA A;  3O13 A;  3PGE A;  5AUI A;  2KN5 A;  4TKN A;  4W9H A;  1TS3 A;  1FXA A;  1UZX B;  5J2R A;  2OJW A;  4IG7 B;  3UQB A;  1RRB A;  2QIL A;  1J7C A;  4B95 A;  2KX0 A;  1V5O A;  2NBW B;  4EKU A;  2MBQ A;  1QZE A;  1NYQ A;  5BMI A;  5BMG A;  1WGY A;  1VZ7 A;  2D11 A;  4ICV A;  2G1E A;  4ANW A;  1PQS A;  1SGH A;  3ZLZ A;  3PZ7 A;  2PLP A;  4RMA A;  2BYE A;  1WGR A;  3DBH I;  4OVZ A;  4C7Y A;  4WIP A;  3EGR A;  2BT6 A;  2NS5 A;  4BVU C;  4M0W A;  4XWT A;  4PYZ A;  2N7J A;  2WXR A;  3E56 A;  3H7P A;  3VUX A;  2WXG A;  1I42 A;  2FID A;  1H4R A;  1N63 A;  3FKY A;  2MBE A;  3A4S C;  3P1M A;  1ISN A;  3PRM B;  2EMT A;  2DAJ A;  4MEL A;  4WWN A;  2AQ1 B;  2J0J A;  2IYD B;  2WU2 B;  4G50 A;  3IAM 1;  2RSU A;  1LFD A;  2IPK D;  3HVZ A;  4AUQ C;  3HUI A;  1I35 A;  5L83 A;  1M4V A;  2D3C A;  1WYW B;  4MT5 A;  4A55 A;  3NHE B;  2KWC A;  3V3X A;  2J7Q B;  1BT0 A;  5BYQ A;  5IN7 A;  4DXG A;  2PMV A;  1VCB A;  3KWL A;  3U7Z A;  2GBR A;  2GB1 A;  2INN E;  4DHZ B;  3QAQ A;  3ABV B;  4PT5 A;  2CHW A;  4MSQ B;  4KIK A;  3CSF A;  3V6E B;  2VRR B;  4WWM A;  4EOY A;  1V6E A;  4EEW A;  2WDQ B;  1V9J A;  1LGR A;  3N32 A;  2K8C A;  1IPG A;  3M95 A;  4MM3 B;  1HTQ A;  4S17 A;  1LXD A;  3DBR B;  4HCN B;  1C4A A;  4TMA B;  3V05 A;  2FIF A;  3IFW B;  4BBN C;  4DK5 A;  2G9H D;  1UH6 A;  3ZYY X;  4RCO A;  3DPD A;  4P1C C;  5D3I B;  4GB9 A;  2C9W B;  1N60 A;  1HQR D;  3VTV A;  2ZVO A;  2K22 A;  4JQW C;  2KMM A;  1XF5 L;  4IM2 A;  4LJO B;  2NPT A;  3L13 A;  1IP9 A;  5DPT A;  1SEB D;  4BKT A;  3P42 A;  3AE2 B;  3W2D A;  1UNS A;  3AM9 A;  1V1P B;  3APC A;  1XO3 A;  1OQY A;  3ECI A;  2Z0E B;  1OGW A;  3VH3 B;  2I1J A;  5AUK A;  2MJD A;  2FBW B;  1ZOY B;  4B0M A;  1OTR B;  4MM3 A;  1FCC C;  1MI0 A;  3V61 A;  1DOI A;  4NQL B;  3AU5 A;  3MP9 A;  4FJZ A;  1CQV A;  1UGM A;  2RD0 A; 
#chains in the Genus database with same CATH homology
 2KDM A;  1TZO A;  3AV8 A;  1L0Y B;  5D3D A;  5EE1 A;  3ZJV A;  3R8B A;  2BYT A;  2QIE B;  2XNA C;  1WRI A;  1BML C;  4MH8 A;  3RFZ B;  1IGC A;  1L6V A;  5EE9 A;  2WP9 B;  4OHJ A;  3BVZ A;  2W3R A;  2JXT A;  2WXQ A;  4USA A;  4NAM A;  3TEZ A;  1GB1 A;  5G5H A;  3SFD B;  3AMZ A;  3NUH B;  2HDE A;  2RPV A;  1SIJ A;  4IDI A;  1E10 A;  1NYR A;  2I2Y A;  3VRA B;  2N0S B;  2RDG A;  3FC4 A;  1F77 A;  2W54 A;  2ICI A;  2WXH A;  4RF0 A;  5JXV A;  4N6E B;  4KX6 B;  4ZRQ A;  3SFE B;  1FM0 D;  4RF1 A;  4HRS A;  2KN4 A;  1GOZ A;  1YJI A;  3RPF C;  3BZD B;  1R7S A;  2PVO D;  2J42 A;  4CQN A;  5FK9 C;  2J4X A;  2B76 B;  2WDV B;  4KKJ A;  1PGA A;  4KGR A;  2WXK A;  2EEL A;  2MH7 A;  2CJN A;  3ZQ4 A;  3AEC B;  1ENF A;  1TKG A;  5G5G A;  1K52 A;  2NTS A;  3T3O A;  4LLG M;  1XLQ A;  1D5X C;  1ZDX A;  4FXC A;  2KWD A;  2JSV X;  4YSX B;  2NMQ A;  4IKG A;  4US9 A;  1J7B A;  1C79 A;  1P7E A;  2K3U A;  3OWE B;  4JWS C;  2PVG C;  3AED B;  3B2F A;  4GDL B;  1FEH A;  1SXT A;  4ZHP A;  4C56 C;  1YQ4 B;  2BB6 A;  2ZW1 A;  1MVK A;  2W55 A;  1IBX A;  2BS4 B;  1N61 A;  2ON8 A;  1ZUD 2;  3FIL A;  2E6X A;  2LMC A;  2KQ4 X;  2LEK A;  2BS2 B;  2NTT A;  3P4R B;  2M56 B;  3Q8F A;  4WAF A;  4A90 A;  1KRH A;  4YSY B;  2V3P A;  3KQ4 A;  2RDH A;  1QLB B;  1KH0 A;  3UI3 A;  3R2T A;  1I4G A;  1CJE A;  3Q8A A;  4R3D A;  2BBC A;  1T3Q A;  1D5M C;  2DBY A;  4US8 A;  3TEX A;  1I4X A;  1HZ6 A;  1L4Z B;  1EU3 A;  4YXD B;  4LTU A;  3SEB A;  2AQ3 B;  3C8Y A;  1DYQ A;  3P63 A;  3Q69 A;  4ZYS A;  1FRR A;  2ACZ B;  1N5X A;  3AE6 B;  1QIL A;  1MPE A;  4GDK B;  1STE A;  1DOX A;  4XWW A;  1LO5 D;  2LHE A;  5MPO A;  3IXS A;  2J53 A;  2W82 A;  3BYY B;  4GLS C;  4MAC A;  2CU3 A;  3DWG C;  5FKA C;  3N9Y C;  1KLG D;  1DOY A;  2GRI A;  1JML A;  2WXI A;  4H2A A;  2VZK D;  3P4Q B;  3PZ8 A;  1KTK A;  1ZDV A;  1FMA D;  1C77 A;  1OQR A;  2YEP F;  1E7P B;  1SE2 A;  1TS4 A;  4IOI E;  4JE3 B;  1V1O A;  3VRB B;  1Y56 A;  1QF6 A;  1HEZ E;  1F2R I;  2WXP A;  2MJE A;  2QSD A;  1PDX A;  2D5G A;  4KKI A;  3VQI A;  3E9S A;  3TEW A;  4RFB A;  5H8Y E;  2BTE A;  1TKY A;  2KAC A;  3Q8C A;  4WQM A;  2Y5C A;  3AE8 B;  1FIQ A;  3U52 E;  1J7A A;  1FXI A;  4RGO S;  3GP7 A;  1C4C A;  3IT4 B;  2WNM A;  1AW7 A;  3I9V 1;  4RGM A;  1I4Q A;  1XCT L;  4AS1 A;  2XN9 C;  4KGS A;  5BMH A;  1VZ6 A;  1E6E B;  2DYO A;  4HKZ E;  1XLO A;  3I57 A;  4KGT A;  4OW0 A;  3LB8 C;  1P7F A;  1SE3 A;  5FR3 A;  1VRA B;  1IBX B;  2M19 A;  4OZB A;  5BYS A;  1SF0 A;  1V8C A;  1VDV A;  4HJG E;  4RNA A;  3FIL B;  3W1S A;  1YN5 A;  1TY2 A;  2INP E;  1C4P A;  3W5V B;  3MC0 B;  3AN1 A;  1YJJ A;  5HG2 A;  1T6B X;  4EE2 A;  3R2I A;  1QOG A;  3AEE B;  1QOB A;  5HI1 A;  1ZE3 D;  3MHZ A;  2SEB D;  1N62 A;  4YTM B;  2QEJ C;  4ZRP A;  1FNW A;  1JWM D;  3B9J A;  1QT9 A;  1L4D B;  2N9L A;  2ZW0 A;  3VR9 B;  1HZ5 A;  3HRD D;  3TUO A;  1ZPS A;  4ZOH C;  1E0Z A;  1FD6 A;  3NVZ A;  1WYG A;  1UUP A;  3TSS A;  1K53 A;  2V3N A;  1K51 A;  3CIR B;  1XCQ L;  1QQR A;  3AH7 A;  4ITK A;  2TSS A;  1I4H A;  1PGB A;  3EUB 2;  4UDU C;  2WDR B;  1VLB A;  4HEA 1;  2YEP B;  1XXG A;  4J3O D;  2GI9 A;  2RMM A;  2IGH A;  3LXF A;  3P4P B;  1D4B A;  1RWS A;  1YN4 A;  1NEN B;  3URY A;  1SB3 C;  2LJI A;  3NVY A;  4YT0 B;  1SE4 A;  2OHF A;  5HFY A;  1ET9 A;  1VR9 A;  5LNK 1;  2K0P A;  2L83 A;  2WLB A;  2JYE A;  4DXF A;  1FRD A;  3J9C A;  1NVI D;  1OFF A;  1ESF A;  4NAW B;  2JWU A;  1KFY B;  1AYF A;  1ZP0 B;  1PYW D;  1PUT A;  3KWV A;  2FE8 A;  1MHH E;  4DQO C;  1Q10 A;  1L0V B;  1EM7 A;  3GB1 A;  5C2T B;  1YNT E;  3AEG B;  1FFU A;  2V0G A;  3AEA B;  2M0A A;  4ARI A;  2X38 A;  5T8I A;  2AQ2 B;  2L32 A;  1N5W A;  1CZP A;  1ZXI A;  3O13 A;  5AUI A;  2DLB A;  1QOA A;  1TY0 A;  1TS3 A;  2L52 A;  1FXA A;  1D5Z C;  3NRZ A;  3TEY A;  1TYG B;  4A9A A;  1T5X D;  2PTL A;  1JWS D;  2WXF A;  2JU6 X;  4JPS A;  2QIL A;  1XLN A;  1KLU D;  1J7C A;  1EU4 A;  1QKZ A;  1F2R C;  2LUM A;  3BWU D;  1L5P A;  1RYJ A;  3AE9 B;  1JRO A;  4YWG G;  1TJE A;  3BVM A;  1NYQ A;  5I4D A;  5BMI A;  5BMG A;  1VZ7 A;  3ZJT A;  2G1E A;  3AEB B;  5HHD G;  2CJO A;  4RH6 A;  1NEK B;  1WSP A;  2Y5P A;  4P6V F;  3PZ7 A;  1DGJ A;  1GB4 A;  2H89 B;  2PLP A;  1XLP A;  2LFI A;  1VZ8 A;  5EE3 A;  4OVZ A;  4A8X C;  1NI3 A;  3MFG A;  4C7Y A;  1FO4 A;  3NS1 A;  1YN3 A;  4LK0 M;  2Q5W D;  4WIP A;  3EGR A;  2BT6 A;  4NJC A;  1TS2 A;  2EKI A;  3NVV A;  3AE5 B;  4M0W A;  4XWT A;  3ZJU A;  5GXG B;  1ACC A;  2N7J A;  2WXR A;  3E56 A;  2WXG A;  2R61 A;  3BII D;  1PGX A;  2IGD A;  1L6U A;  1WXQ A;  2WXM A;  2K5P A;  3AE4 B;  1N63 A;  1IUE A;  1A70 A;  3HVD A;  1UWX A;  4JX1 C;  1I4R A;  2HTM E;  3P1M A;  3U2S C;  2WQY B;  1B9R A;  1JCK B;  1HXY D;  4N58 A;  2QMT A;  3U4E G;  2IGG A;  4XE0 A;  1JW9 D;  2PIA A;  2AQ1 B;  2WU2 B;  3W9C B;  3IAM 1;  1F0Z A;  3AE7 B;  3KLS X;  1HA5 A;  4HKQ A;  2IPK D;  3WCQ A;  3HVZ A;  2LGI A;  4N59 A;  5BYR A;  3HUI A;  2WXL A;  1M4V A;  1ZXH A;  2WU5 B;  2MJ3 A;  4WH4 A;  2OED A;  1RM6 C;  3AEF B;  4MT5 A;  4A55 A;  3CWI A;  3NZ3 A;  1SJE D;  1YMH E;  1KF6 B;  5EE0 A;  4XDD A;  3V3X A;  1V1P A;  2MEK A;  2VZK B;  1FNV A;  5BYQ A;  2I38 A;  3BVG A;  1D6E C;  4DXG A;  2PMV A;  1EWY C;  4Q2J A;  3KWL A;  3U7Z A;  4YTP B;  2JQR B;  2GB1 A;  2INN E;  5TSS A;  4ZHO A;  3SR6 A;  4O1N A;  1UWM A;  3LYY A;  3ABV B;  4PT5 A;  2W3S A;  1AN8 A;  2QJL A;  1XEE A;  1JQ4 A;  2LHD A;  3ETR A;  3T3N A;  4YSZ B;  2KAJ A;  1TKE A;  3IT6 B;  4YTN B;  1PFD A;  2BW2 A;  1OQQ A;  1JAL A;  1FCL A;  4WWM A;  2JZP A;  2WS3 B;  4A6Q A;  3PO0 A;  2J52 A;  1E9M A;  2WDQ B;  5D7G A;  2Y3A A;  4NZL B;  2DYM A;  1GAQ B;  4REZ A;  2Z8L A;  1I4P A;  4D2K A;  1ROE A;  4RGN A;  1FFV A;  2N9K A;  3BK2 A;  1B1Z A;  1VJK A;  1JWU D;  4MM3 B;  4RGT A;  1BXT A;  4L2Y A;  3H8H A;  1I7H A;  3AE3 B;  2WXJ A;  1YQ3 B;  1L0X B;  1C4A A;  4L1B A;  4TMA B;  1CK1 A;  3EA6 A;  1C76 A;  3L4P A;  1FNU A;  3V05 A;  1SBB B;  4TSS A;  2G9H D;  3Q8E A;  3W5U B;  3DWM A;  5H92 C;  1JWB D;  4B0E A;  3ZGZ A;  3ZYY X;  4RCO A;  2K9X A;  2WXO A;  3BYT B;  1V97 A;  5D3I B;  4TQ1 A;  4ARC A;  4L23 A;  2DWQ A;  1N60 A;  1HQR D;  4C7Z A;  1JWA D;  5E6J A;  1IGD A;  5C3J B;  1C9F A;  2E3T A;  2K22 A;  2KMM A;  2H88 B;  1AWD A;  1WWT A;  2JX5 A;  2WXN A;  1XF5 L;  2JYT A;  3NVW A;  4C80 A;  4P16 A;  1SEB D;  1UGJ A;  3P42 A;  4XDC A;  3AE2 B;  4HRO A;  3Q8B A;  3W2D A;  1WGK A;  4OZC A;  1UNS A;  3B2G A;  3AM9 A;  1V1P B;  4WUR A;  1XO3 A;  2PW9 A;  1K50 A;  4OZA A;  4JWU C;  2L1A A;  2PKO A;  2BS3 B;  2IJ0 A;  3MJ5 A;  5AUK A;  2SAK A;  3P4S B;  3AB5 A;  1C78 A;  2MJD A;  1BUI C;  3FAH A;  1ET6 A;  1TS5 A;  2FBW B;  2V4I B;  1ZOY B;  1JRP A;  3IAS 1;  3VR8 B;  4B0M A;  1QOF A;  4TQ0 A;  1RFK A;  1MHX A;  1FCC C;  2ONQ A;  1SSN A;  2IDY A;  1MI0 A;  1DOI A;  1EWC A;  1GPX A;  1SJH D;  3BK1 A;  4AQ7 A;  3MP9 A;  2BB5 A;  2AX5 A;  1CQV A;  2FUG 1;  3GS2 A;  3AE1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...