1XCTL

Complex hcv core-fab 19d9d6-protein l mutant (d55a, l57h, y64w) in space group p21212
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
70
structure length
70
Chain Sequence
TPEEPKEEVTIKVNLIFADGKIQTAEFKGTFEEATAEAYRYAALHAKVNGEWTADLEDGGNHMNIKFAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Different crystal packing in Fab-protein L semi-disordered peptide complex.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
molecule keywords Capsid protein C
total genus 15
structure length 70
sequence length 70
chains with identical sequence M
ec nomenclature
pdb deposition date 2004-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1xctL00
2JXTA 4KGRA 2ON8A 3V3XA 1K51A 3FILA 2J53A 4GLSC 3UI3A 1C9FA 1PGAA 1HEZE 1MHXA 2IGHA 4WH4A 2IGGA 4KGSA 1UWXA 2KACA 2LHEA 1Q10A 4HJGE 3MP9A 4KGTA 2I38A 2GB1A 5HHDG 1IGDA 1FCCC 2JZPA 1ZXHA 1XCQL 1YMHE 1IBXA 2N7JA 1MPEA 2JSVX 4OZAA 3GB1A 2PLPA 1PGBA 1EM7A 2LGIA 1K52A 5HG2A 4OZBA 5HI1A 1IGCA 1XCTL 1XF5L 1P7EA 1YNTE 2RPVA 1MVKA 2ZW1A 1HZ6A 1KH0A 5BMHA 1K53A 1IBXB 2J52A 2GI9A 2JWUA 2PW9A 2N9LA 2KDMA 5BMGA 1JMLA 2NMQA 2QMTA 4OZCA 4IKGA 1K50A 1GB4A 1MHHE 2I2YA 2EELA 1F2RI 4D2KA 1FCLA 4MACA 1GB1A 2OEDA 2ONQA 5JXVA 2JU6X 2LHDA 2LUMA 1F2RC 2RMMA 1P7FA 5BMIA 4HKZE 1MI0A 2PTLA 2N9KA 2IGDA 3FILB 1HZ5A 5HFYA 1D4BA 2QSDA 1FD6A 2ZW0A 1PGXA 2KQ4X 2K0PA 2KN4A 4IOIE 1QKZA 2KWDA
chains in the Genus database with same CATH superfamily
5C2TB 4W9CA 2WS3B 4HVBA 1EWCA 4HK2A 2D10A 1MG4A 2EKEC 3NVZA 2IGHA 2D07B 2N7EA 2K8CA 2K8HA 1UNSA 2W9NA 3OJ3A 4IWPA 1UWXA 2BKRB 2EKIA 2M0XA 3U7DA 2LRWA 3VHTC 2MW5A 3B2GA 3MP9A 1JW9D 4YSXB 1PYWD 4W9JA 3W1SA 2DZIA 1CK1A 1C76A 1YQ3B 4WIPA 2KVRA 3AE3B 1VZ7A 2O6VA 4JWSC 1YMHE 1D5MC 4FXCA 3T8MA 3RNGC 2D5GA 1KJTA 4OZBA 4A6QA 1WXAA 3TJPA 4LLGM 2GMIC 3AEGB 1T3QA 2L83A 1E90A 1P7EA 2IPKD 3OAWA 1JALA 1FO4A 4YSYB 3VR8B 1JWBD 4USAA 1VR9A 1N5WA 3MTNB 1WX7A 3ENEA 2N4FA 5AUIA 2PW9A 2OJWA 3NG0A 3HM6X 2V9HA 4OZCA 3ZTDA 1N60A 1MG8A 1YIWA 4GDKA 4DHZB 1ZDXA 3I3TB 3MC0B 1EU3A 1R7SA 3KQ4A 2QHOA 2Q5WD 5G5GA 1T6BX 3QA8A 4HWIB 3VH3B 1UF0A 3M63B 1ET6A 2LZ6A 5IOIA 2LHDA 4ANUA 3AEBB 3T3NA 1G6JA 2V4LA 2MLBA 4II3B 2X38A 3V60A 4MEMA 3BYYB 2J7QB 2W82A 1ZKHA 5BYQA 5L95C 3B2FA 4IOIE 1OFFA 3KW5B 3VUWA 3VR9B 4US8A 1S1QB 4XWWA 4BBNC 1F0ZA 1U4AA 5E6JA 4RF0A 1YQBA 3ALBA 1GC6A 2FIFA 2BTEA 2DAJA 5TSSA 1FRRA 2L0FA 2L8JA 3P4QB 3EFUA 3VTVA 3P4SB 3BWUD 3RULA 1FCCC 5JZEB 2ZEQA 1EF1A 5GMVA 5D2MB 2INCC 1K52A 1RYJA 4LNFA 1AWDA 2QJLA 4O1NA 1E0ZA 2Z8LA 4ZYNA 1XCTL 4XYCA 1XF5L 2W54A 4B6WA 1B9RA 1YNTE 4K7SA 5D94A 1SIFA 3A1QB 4FADA 4M0WA 2GI9A 5EE9A 1N62A 2BF8B 1JMLA 2QMTA 4JPSA 5D3DA 2E6XA 4B95A 1E9MA 1GB4A 1MHHE 2QC8A 5GXGB 2E3TA 3TUOA 2KDBA 3ZLZA 1WY8A 1I4QA 1NI3A 2ONQA 3P42A 1V49A 3Q8AA 3EC8A 2DBYA 2BB6A 1P7FA 1MI0A 5G2NA 1R4MB 3ZNID 4KSKC 3I57A 3HK0A 3Q69A 3EHVA 3PHWB 1XLQA 3VQIA 3EECA 1YN3A 2FCSA 3I9V1 3AMZA 2ZVOA 3AH7A 4M8NA 3RNAC 2M8SA 2YLMA 4E3CA 2ZZPB 5DPSA 3DBHI 3UINB 2D3BA 2BWFA 2DAFA 4XE0A 3L0WB 1UGJA 2MBHA 1FPYA 2JF5A 1WH3A 2JZ3B 2KDIA 2WXOA 1FFUA 2KJHB 1ISNA 4C7ZA 4TUUA 5BO4B 2N7DA 2LGYA 2OHFA 2WXQA 4OZAA 4MGIE 5FK9C 4AWJA 3DQVA 1KF6B 4LTUA 4I6NB 2BPSA 2NPTB 5D3IB 2AWTA 2CHZA 2DYBA 4WWOA 2ZCBA 3T9LA 2LWPA 1IUEA 1JRUA 4FHJA 2PE9A 2KMCA 1C3TA 2KXJA 4L2YA 2KLCA 3QHTA 3JVZX 1WWTA 2KK8A 5IKCM 5LXHA 4TMAB 2KTRA 5AEKB 1WMHA 3A9KB 1NVID 2CU1A 2AQ2B 3VTUA 1UGMA 2I1JA 2PIAA 1V86A 1F2RC 1Y56A 2AL3A 2O6VB 3R2IA 4MDKE 1QLBB 1E8XA 5LNK1 4IUMB 3KWVA 1YD8U 2KX0A 2JQRB 1WJ4A 4YL8A 4IWOA 1ESFA 3NJTA 3NZUA 1F1HA 4WQOB 4EFOA 1T0QC 2J53A 2PJHA 2KDEB 4HKQA 4JWUC 2NS5A 2IO2B 1UELA 4MT5A 2IBIB 1M94A 2EMSA 4A3OA 1L7YA 5LLIA 4MGYE 2GB1A 5DPWA 1MJDA 2XK5A 1C1YB 2BGFA 4G50A 4BKGA 1JWSD 2FE8A 2MP2B 1XCQL 1WX8A 1E6EB 1A5RA 4E74A 2BVCA 3L16A 1XEEA 3P63A 3RI7C 1FMAD 4YT0B 4ZDVA 4KZCA 1PGBA 3IAM1 3PRMB 2BBCA 3SU8X 4NAWB 3AN1A 3EUB2 3BVZA 1TS5A 2NBVB 2L05A 2JRIB 3VH4B 3O13A 4JLCA 1YQ4B 3R66C 2CHWA 1WYWB 1HXYD 2J52A 2RR9A 1KLGD 1C78A 2WWZA 3W5VB 4DXGA 2KX3A 4WJNA 2EELA 2V1YA 2WXKA 3H1UA 4XDDA 1NDDA 3FAHA 2RDHA 1VD2A 3BY4B 2PPHA 4KIKA 1KLVA 4G3XB 4PS3A 1WR6E 2N9KA 5JHBA 5HFYA 2LMCA 2LASA 4WURA 4DQOC 2VH1A 2KHWB 1QKZA 1E7UA 4P1BC 5J17A 3CIRB 5HKHA 2DLBA 4TQ0A 3RZFA 1XLNA 3FILA 1CMXB 4A90A 1WM3A 1YN5A 2X8XX 2UYZB 3H7PA 3N1YC 3OLMD 2ZPYA 2VRRB 2IO0B 2LHEA 3MJWA 3QC8B 3V05A 4RGNA 3K9PB 3IAS1 1L4DB 2DX5B 2KD0A 1YX6B 1YOVB 3JSVA 3PZ7A 4FULA 4RGMA 3L17A 1C4AA 1RRBA 4B0EA 5CHFA 3PZ8A 1FEHA 3L10B 1XQQA 1SGHA 3W9CB 2BYVE 5BYRA 4LNOA 1E7VA 4J3OD 3ML8A 3O65B 2PVOD 1A70A 4F8CB 3UGBB 4DDGD 1SXTA 4WJOA 2PE6B 1N5XA 3P2BA 4FHKA 3ZQ4A 3AE8B 2RPVA 2HTHA 3ZGZA 4HEA1 4WQMA 4M01A 1ZW7A 5BMGA 1UUPA 3IHPC 3AEDB 5AZFA 3ZXRA 3VRAB 1F52A 2FBWB 2WXMA 1TS4A 2K39A 4NJCA 4NQLB 4WJQA 4HRSA 4BOSC 4Q2JA 3C0RB 5KHQA 3TIXA 2V0GA 3QX1A 1P0RA 3IVFA 2FAZA 5LXIB 4HKZE 1N6ZA 3R8BA 4DWFA 5TR5A 3FILB 5AUKA 4G0NB 2WXNA 2KWUB 2L3ZA 3SEBA 1WSPA 2KNBA 4YSZB 1TYGB 1L0XB 4PS8A 4A8XC 1D5XC 2KT7A 2LRUA 3NVYA 2WXGA 4TQ1A 1GC7A 1QOFA 3M62B 1XLPA 2MJEA 5FR3A 2W3RA 4KGTA 4R3DA 2O6VD 2PKOA 4OW0A 3K9OB 3H6NA 1L6VA 3ZRFA 3PRZA 4JQWC 1Z2MA 5MPOA 1IBXA 4ZRIA 4XZ4A 4WWMA 3ZDTA 3ZVVA 2LGIA 1OTRB 3B08A 3KUDB 3RUIB 3RNEC 4DHZE 4NAWA 4ZRKA 1RFAA 2JZZA 1Q0WB 1TJEA 1GJZA 1WGYA 1LQBA 4N59A 1IBXB 1FFVA 2WXLA 4ACFA 4REZA 2B76B 3WCQA 2MP2A 3A4SC 1YN4A 1J19A 4ZHOA 4QAYA 3ZUNA 2QDFA 2XK5B 2LUEA 3ETRA 3L4PA 2H89B 3MHZA 2KC2A 3IT6B 2INDC 4W9LA 2ZVNA 3NS8A 1VDVA 3TCAA 1LFDA 2LUMA 4IM0A 3U7ZA 4HDQA 4XGAB 2GBMA 1P1AA 1V6EA 2QSDA 4P16A 3KH0A 3PRPB 4DDID 2Y3AA 4HJKA 1DOYA 1Q1OA 1WGRA 1FIQA 4I6PA 3QAQA 2VH2A 3UI3A 4WWNA 3ZJVA 1PGAA 4EE2A 2DZKA 3LDZE 2KC1A 3DBRI 1I7HA 3W2DA 4GGQA 2C60A 2O2VA 2K25A 1JWAD 2BS2B 2O2VB 1KM7A 2N0SB 4GDLB 3RNBC 2KWCA 4MSMB 4AOFA 5DPTA 3U52E 1NYQA 2A4ZA 1FXTB 2C5LC 4K1RB 3H7PB 2JPHA 3Q6BA 2BWES 3ZJUA 3MC9A 1TGZB 3IFWB 2LGDA 4RFBA 2FCNA 5CHWA 3B9JA 4MJSB 2DZJA 2KQ7A 2C7HA 2BKFA 5D6JB 1UWMA 3AE7B 3S2AA 1LO5D 1ZUD2 3GE8C 4TKNA 1D5ZC 1DOXA 3R7QA 2N9LA 1TKYA 2KDMA 4DXAB 2WXIA 3ZXVA 1QOBA 4TSSA 3RT3B 1OEYA 4D2KA 2KTFA 2C9WB 2KOXA 4I6LB 2G45B 5JXVA 1C77A 4OVVA 1E10A 2MBOA 1CQVA 2ZNVB 4C56C 2RPQA 1WI0A 3ABVB 3RNFC 3IXSA 3L08A 3DVNV 2ZCCA 4IM2A 4S0RA 4C00A 4MSQB 1C79A 2MWSB 1LM8B 2N9XA 1QILA 2ON8A 1HE8A 1PFDA 3AU5A 1CJEA 2A5UA 1UH6A 2L32A 4KIKB 4PT5A 2OOBB 2KACA 3L13A 1ZE3D 3H7SA 2K9XA 4ANVA 3PS6A 3GS2A 3AV8A 5C23A 3VTWA 3QWZB 4W9GA 2REXA 1BMLC 4HCNB 1NEKB 1T0SC 3GP7A 2LEKA 2D11A 3WAPA 1E8YA 2K1FA 4WAFA 4ZRQA 4EZJA 4M0WB 4S17A 1DGJA 2R61A 2LGXA 3NUHB 4YXDB 4B9KA 2JVCA 5CHVC 1E5WA 3AEEB 3P4RB 2DWQA 3BVGA 4ICUA 1FNUA 1HQRD 4UDUC 4F1SA 1C4PA 2KANA 2C7NB 2RDBC 3KLSX 2KFJA 5IAAC 3BINA 4YWGG 2LXAA 1RWSA 2BW2A 4NPNA 2JT4B 3APDA 3D32A 1ZDVA 3VVWB 2JUOA 3A4RA 4RM9A 2KVZA 3FKYA 2KLGA 2K8BA 4K7UA 3M3JA 2CJNA 2JU6X 1P9DU 1N61A 4KV2A 4RNAA 3M95A 3WA0A 5EE3A 2WDRB 1WGGA 2WHIA 1TZOA 5BMIA 4LDTB 4A20A 1HZ5A 2KFKA 2FCQA 1CZPA 2DHZA 4LDTD 2HDEA 2L0TA 3N1XC 3P4PB 4FJVB 1EWYC 3N20C 2QILA 4FJYA 2MEKA 4ZRJA 1HEZE 4W9HA 3QQ8B 2AQ3B 2IGGA 3OG5A 2D3GA 2ZPNA 4YTMB 1EO6A 1V9JA 3LXFA 3DBSA 1V97A 5C3JB 3AE9B 3HVDA 2LD9A 4GDKB 3ONSA 2V3SA 1V1PA 2CJOA 2AQ1B 1PQSA 1WRIA 1MPEA 1JRPA 2NCNA 2AEHA 2MSED 5EE1A 3RCZA 1V2YA 2QIEB 2IY0B 1HTQA 4MGZE 3VXWA 1IGCA 2CKHB 1BT0A 1XO3A 3AE4B 1H8CA 2ZW1A 4DHJB 4KVGB 2HD5B 2NTTA 2Z0DB 4OVZA 4IC7B 1T5XD 3CF6E 4RCOA 2FUHB 1SF0A 2WX1A 2BYEA 1SIJA 4GU2A 1SE9A 2K6DB 1FCLA 3KUZA 4KDIC 1ACCA 4ARCA 2BYFA 1NENB 2OJRA 1FXIA 3N32A 1TS2A 4DK5A 1DOIA 3CSTA 2K3UA 2AL6A 5JHAA 1WXQA 2CS4A 1WXSA 3NZSA 1UD7A 2WXRA 2KWDA 1TT5B 2AX5A 3HIZA 4RH6A 2KYWA 3L54A 1V1OA 1JWUD 2GRIA 2LJIA 4M02A 3V61A 4RM8A 1WXVA 3LJ3A 3AI5A 4WH4A 4GXBA 1PUTA 5DCNA 4BKSA 1RAXA 2ZNVC 1D3ZA 1Q10A 4ASWC 1E8ZA 1P98A 2LJ5A 1EU4A 3ZNHB 2D3AA 4ZOHC 3W1SC 3OJ4B 4N58A 5HHDG 3DHGC 2QCZA 3HM3A 4NQKE 2BS3B 1H4RA 1ZXHA 3PT2B 1VJKA 3PHXB 3AULA 2KDFB 5E6OA 3V6CB 1R4MI 4XWTA 2W55A 3NZ3A 1JROA 1J0GA 4BBNF 1WRDB 5HI1A 2J4XA 4N9F4 1I4RA 4K7WA 4II2B 1WZ0A 3CMMB 4IG7B 1KFYB 2ICIA 5JH5C 1C4CA 4GB9A 4PS7A 2MA9B 1MVKA 3EGRA 3SHQA 2NR2A 5H92C 1KH0A 1K53A 1J8CA 3UIOB 2JWUA 4KKJA 1WR1A 1IP9A 2INNE 3TEYA 3PREA 1ROEA 2N9PC 1K50A 2MBEA 4GMVA 2MJ3A 1QOAA 4FA6A 2BB5A 5E6PA 4W9DA 5DPRA 2OEDA 1FXAA 1ZPSA 3WAMA 1Q5WB 3ZNGC 3X0WA 3PSEB 2DENB 1V8CA 3VAWA 4NJ6A 1VLBA 3PZDA 1D4BA 1F77A 1QZEA 3U2SC 1JCKB 1IPGA 2L1AA 3N30A 2INPE 3NHEB 2UWQA 1V5OA 3BIID 1WXMA 5KHOA 4JIOU 3UIPB 2R2OA 3U8ZA 3LB8C 4G11A 1AYFA 4XX5A 3TSSA 2EMTA 1KTKA 4CYEA 4J6IA 3DCGA 2WLBA 2XNAC 4MH0E 5BYSA 4KZ0A 3DHIC 1NYRA 3AE1B 3RMKC 5FKAC 4KKIA 1OQQA 1FNVA 3WIMA 2V3NA 1LXDA 1E8WA 3IG3A 2DYOA 4KSLC 3SFEB 1S3SG 2LXCA 3TEWA 1I4GA 4LNIA 5IP4D 2D3CA 4X57B 3ZTCA 1OQYA 4PK1A 1WE6A 3AEFB 3PGEA 2J0KA 3PTFC 3E56A 3ZNZB 1I42A 1VRAB 5BMHA 1TY2A 2ZJDA 1WGKA 3KYDD 1SSNA 2R2QA 4C4VB 4OHJA 1SE3A 4CO7A 4PYZA 1OEYJ 2LFIA 2WP9B 1AN8A 5IA7A 2M17A 2MRPA 2YVCA 1SE2A 1R4NB 3RPFC 4RF1A 4BAXA 2KQSA 1D6EC 3SDLC 4MACA 1GB1A 2LVPA 1FNWA 2KJRA 2H88B 4MM3B 5J18A 4P6VF 3HHMA 2PVGC 2IY1B 3RZWC 4US9A 1GG3A 3A1QA 1ENFA 4IM3A 5E6NA 1V1PB 4HXDA 2DYMA 4EEWA 2K0PA 3PPAA 1YJIA 3W5UB 2KN5A 3BYTB 2IJ0A 3Q8BA 2B3AA 3GE3C 2WDQB 1WJ6A 1EUVB 1WJUA 1K51A 2CR5A 3GZNI 2JRHA 4WJPA 1ZOYB 1VCBA 4CQNA 2L00B 2XEWA 4M8MA 1E7PB 4NNJB 3AU4A 4N6EB 5FR6A 5AZHA 2HTME 4YTPB 4KGSA 1L4ZB 2G3QB 4BKTA 5EE0A 4NY0A 1BUIC 4HPPA 3MFGA 1WIAA 2N1WA 1JWMD 2FCMA 3J9CA 1XXGA 1SBBB 3CWIA 3HRDD 1NBFC 3AE2B 4RGTA 4B0MA 3UQBA 2JSVX 3A33B 3W1YA 2WDVB 2K5PA 2BT6A 1Y8RC 4W9EA 1WJNA 3UQAA 3NY5A 4LK0M 3TEZA 3MJ5A 3RD2A 3SFDB 1STEA 5I4DA 3DPDA 3JYUA 1L2NA 2QEJC 3APFA 5IO9A 1HZ6A 4TV3A 1WZ3A 3QARA 3R3MA 5CTRC 1UBQA 3DVNU 1XD3B 4URKA 4RGOS 2RSUA 2WU5B 3DBRB 1N63A 2DNFA 2J0JA 4LNNA 2WX0A 1EF5A 4HPMB 1J7AA 2BYTA 2KZRA 2MBBB 1ZGUB 2KFKB 1QOGA 2RD0A 2JWZA 3ZKJC 1OQRA 2WDTB 3ZO5B 4WWPA 1RFKA 3NOBA 2RMMA 2Z59B 4W9FA 3DWMA 3Q8FA 1Z5SB 3NVVA 4GDLA 3E9SA 1PGXA 4K3BA 2KN4A 4AUQC 5G55A 1R4NI 3AM9A 1WFYA 3GOEA 1TY0A 2Y5BB 1IYFA 3AEAB 3A9JA 1PDXA 3VDZA 1K8RB 2WXHA 2Z0EB 4HROA 2WXFA 2L7RA 2LVQA 2XBBC 4W9IA 3PLVA 4DBGA 5J2RA 5EDSA 5L83A 4ZYSA 3TL5A 4F7ZA 3SR6A 2ASQA 2IYDB 2KO3A 2I38A 1SJHD 2IZVB 4LCDE 3HUIA 2M0AA 3TMPB 1TKGA 2NBWB 3URYA 3KUCB 1I35A 1UBIA 4KX6B 4IDIA 1FM0D 3LYYA 3AXCA 4AJYB 5HG2A 3N1ZC 3Q3FA 4JGHB 2HJ1A 3JW0X 1RM6C 2WXPA 2J42A 2JYTA 2SAKA 3RN9C 2C7MB 3APCA 3AE6B 3DBHB 3Q2AC 5H8YE 2MH7A 2G4SA 1RLFA 1WM2A 4LJOB 4L1BA 3KVFB 2MHJA 3DVGY 1HA5A 4K81A 1L0VB 3BZDB 2DZMA 2M4NA 3GZNB 2CU3A 4FN2A 1QF6A 3IBEA 2WQYB 4AJWA 3QK0A 3AECB 3VUYA 1GOZA 2PTLA 3ML9A 2IO3B 3BK2A 2IGDA 3NVWA 4BVUC 2VZKB 1FD6A 3BVMA 4W9KA 1YX5B 1SJED 4YTNB 1KLUD 3ZYYX 3WALA 3VFKA 1TTNA 2GBKA 4WAAA 3QCAA 2MJDA 2WNMA 3C19A 1C9FA 5G5HA 4NZLB 2CHXA 4ANWA 5CX3A 2MX2A 3UF8A 3OWEB 4HJGE 1WGHA 1B1ZA 1SEBD 3I5JC 4P7IA 1L5PA 1XT9B 2KMMA 3T3OA 2I1KA 3KWLA 4MJSA 1WGDA 3QJZA 4ICVA 2GBJA 4MH8A 2UU7A 2JZPA 3DWGC 1V80A 3RFZB 1I4PA 3NRZA 2M56B 2N7JA 2NTSA 1GNUA 2KMAA 4BKSD 3JSVB 3DOWA 1YJ1A 4P1CC 3ZW3A 3PVLA 2HE7A 1J7BA 3R2TA 4M00A 1AW7A 1V81A 1UZXB 2KWVB 1ZXIA 3DVGX 3ZIMA 2D2QA 2NMQA 4FLHA 4ITKA 1OGWA 3V62A 1QQRA 2Y5CA 1MFWA 2JY6A 4AP4C 4PYUA 1GUAB 4JX1C 3U4EG 4CHKA 1F9JA 3R7RA 1KRHA 4A55A 1X1MA 4RMAA 5C1ZA 1AARA 3B0AA 2N1VA 4H2AA 1L6UA 2ZW0A 3PV1A 2KQ4X 2RDGA 2TSSA 4C80A 3Q3OC 1LGRA 2GLSA 2W3SA 3Q3JA 2FUG1 3CSFA 2NBUA 2JXTA 4JE3B 4KGRA 1BXTA 3DBLI 2YEPB 2KAJA 3ECIA 2AYOB 3MC8A 4C7YA 3I63C 4LNKA 1SB3C 2KJ6A 2WGSA 1TBEA 4MELA 1GPXA 3Q3NC 4XC2A 2LVOA 3VRBB 3HVZA 5IN7A 3SD5A 2IDYA 1VZ8A 4FBJB 2L52A 3VUXA 2MCNB 1T0YA 2KKCA 3ZJTA 5T8IA 1TZ1A 4K3CA 4IWQA 2WXJA 4KDLB 4C4VA 5D7GA 3DDCB 3ZDMC 3GB1A 4EZKA 1JQ4A 2J0MA 1EM7A 3U30A 3RYTA 3Q8CA 4HLEA 3KYCD 2K22A 2WYQA 4EOYA 4AS1A 2G4DB 4A3PA 3QIJA 4AQ7A 2RGFA 4E71A 3WANA 4EKUA 3C8YA 1TKEA 3Q3MC 2LGSA 1NI2A 1DYQA 4OVUA 2V3PA 4EZLA 3WAOA 1FRDA 3H8HA 3TEXA 1F2RI 3Q14C 3NS1A 2N9EB 3FC4A 2WU2B 4NJ7A 4GOCA 4GN1A 3A9JB 1I4HA 1SE4A 2FNJB 2BQQA 1KOTA 3V6EB 2GOWA 2IO1B 3A9KA 3P1MA 1WE7A 3AB5A 2V4IB 1WMHB 2PMVA 2KTRB 3V3XA 1ET9A 1TIFA 4GLSC 2ACZB 2BS4B 4JL9A 2GBRA 4EUTA 1MHXA 4ZHPA 1WF9A 4GSWA 3AE5B 4FJZA 1V5TA 4A9AA 3IT4B 1WX9A 1P3QU 2NPTA 4LJPB 2PEAA 1IGDA 2K6QA 3DBLB 2FIDA 3N9YC 2GBNA 2XN9C 2VZKD 4ARIA 3N3KB 4HCPB 1QT9A 2M1MA 4BOZB 4BZAA 1TS3A 4BFRA 2PLPA 2YEPF 4DXFA 1GAQB 4IW0A 3TBLD 1J7CA 3BK1A 1T0RC 1L0YB 4HDOA 4ZRPA 2LI5A 2MBQA 1M4VA 3DHHC 3B1LX 2G9HD 2MQJA 1ZP0B 4MM3A 4IKGA 2I2YA 4GIVA 3H9DA 3EA6A 1WYGA 5AZGA 2L76A 2Y5PA 1HTOA 2M19A 4XDCA 3EFCA 3MHSD 2HJ8A 3Q8EA 2JYEA 2JXXA 4DHJD 4HPLB 1YJJA 2NVUI 2JX5A 3PO0A 4MGKE 1I4XA 4NAMA 4L23A 3X23A 2G1EA 2SEBD 1VZ6A 4ANXA 3ZRCA 3PLUA 3RNCC 1XLOA
chains in the Genus database with same CATH topology
5C2TB 3P4PB 3CIRB 1EWYC 2DLBA 2QILA 4TQ0A 2WS3B 1TY0A 2MEKA 1XLNA 3FILA 4A90A 1EWCA 3AEAB 1YN5A 1PDXA 1HEZE 3NVZA 2AQ3B 2IGHA 2WXHA 2IGGA 4HROA 1UNSA 2WXFA 1UWXA 2LHEA 2EKIA 3V05A 3B2GA 4YTMB 3MP9A 1JW9D 4YSXB 4ZYSA 4RGNA 3IAS1 1L4DB 3LXFA 1PYWD 3SR6A 2I38A 1V97A 5C3JB 3AE9B 3HVDA 3W1SA 4GDKB 1SJHD 3PZ7A 4RGMA 1CK1A 3HUIA 1C4AA 1V1PA 2M0AA 1C76A 1TKGA 1YQ3B 2CJOA 2AQ1B 4WIPA 4B0EA 3PZ8A 3AE3B 1VZ7A 4JWSC 1YMHE 1FEHA 1D5MC 1MPEA 1WRIA 3URYA 4FXCA 1JRPA 3W9CB 4KX6B 5BYRA 5EE1A 4IDIA 1FM0D 2D5GA 2QIEB 4J3OD 3LYYA 5HG2A 2PVOD 4OZBA 4A6QA 1A70A 1IGCA 4LLGM 1SXTA 3AEGB 1XO3A 1N5XA 1T3QA 2L83A 1RM6C 2IPKD 1P7EA 2J42A 2WXPA 3AE4B 2JYTA 3ZQ4A 1JALA 3AE8B 1FO4A 2RPVA 4YSYB 2ZW1A 3VR8B 2SAKA 1JWBD 3ZGZA 4USAA 1VR9A 4HEA1 1N5WA 4WQMA 5AUIA 2PW9A 2NTTA 4OVZA 3AE6B 5BMGA 1UUPA 5H8YE 1T5XD 4RCOA 2MH7A 1SF0A 4OZCA 3AEDB 3VRAB 1N60A 2FBWB 2WXMA 4L1BA 1TS4A 1ZDXA 1SIJA 3MC0B 4NJCA 1EU3A 1FCLA 4HRSA 1R7SA 1ACCA 3KQ4A 4Q2JA 4ARCA 2Q5WD 5G5GA 1T6BX 1HA5A 1L0VB 3BZDB 2V0GA 1NENB 2CU3A 1ET6A 1QF6A 2LHDA 1FXIA 2WQYB 3AECB 3AEBB 1GOZA 2PTLA 1TS2A 4HKZE 3R8BA 3T3NA 3BK2A 2IGDA 3NVWA 3FILB 1DOIA 2X38A 2K3UA 2VZKB 1FD6A 3BVMA 5AUKA 1WXQA 3BYYB 2WXNA 1SJED 2W82A 5BYQA 4YTNB 3B2FA 1KLUD 4IOIE 1OFFA 3ZYYX 3SEBA 2WXRA 1WSPA 3VR9B 2KWDA 4US8A 4XWWA 2AX5A 4YSZB 4RH6A 1TYGB 1L0XB 1V1OA 1F0ZA 1JWUD 2GRIA 2LJIA 2MJDA 5E6JA 2WNMA 4A8XC 4RF0A 1C9FA 1D5XC 5G5HA 4NZLB 2BTEA 4WH4A 3NVYA 1PUTA 3OWEB 2WXGA 5TSSA 1FRRA 1Q10A 4HJGE 4TQ1A 1QOFA 1B1ZA 1XLPA 1SEBD 2MJEA 3P4QB 5FR3A 2W3RA 1EU4A 1L5PA 2KMMA 3T3OA 3P4SB 3KWLA 4ZOHC 4KGTA 4N58A 4R3DA 3BWUD 2PKOA 5HHDG 4OW0A 4MH8A 1FCCC 1L6VA 2JZPA 3DWGC 2BS3B 3RFZB 1I4PA 1ZXHA 3NRZA 1VJKA 5MPOA 2M56B 2N7JA 1IBXA 4WWMA 2NTSA 4XWTA 2W55A 2LGIA 3NZ3A 1K52A 1RYJA 1J7BA 1JROA 5HI1A 2J4XA 3R2TA 1I4RA 1AWDA 2QJLA 4O1NA 1E0ZA 2Z8LA 1AW7A 1KFYB 1TJEA 1XCTL 1XF5L 2ICIA 2W54A 1C4CA 1B9RA 1YNTE 1MVKA 3EGRA 5H92C 1KH0A 1K53A 4N59A 1IBXB 4M0WA 2GI9A 2JWUA 1ZXIA 1FFVA 2WXLA 5EE9A 1N62A 4REZA 4KKJA 1JMLA 2B76B 2NMQA 2QMTA 4ITKA 2INNE 4JPSA 3WCQA 3TEYA 5D3DA 1YN4A 2E6XA 1ROEA 4ZHOA 1E9MA 1K50A 1MHHE 1GB4A 5GXGB 2E3TA 2MJ3A 1QQRA 2Y5CA 3ETRA 1QOAA 2BB5A 3L4PA 2H89B 3MHZA 3TUOA 2OEDA 1FXAA 1ZPSA 4JX1C 2ONQA 1I4QA 1NI3A 3IT6B 3P42A 3U4EG 3Q8AA 2DBYA 1KRHA 1VDVA 4A55A 2BB6A 2LUMA 1V8CA 1P7FA 3U7ZA 1MI0A 1VLBA 4H2AA 1L6UA 2QSDA 1D4BA 1F77A 2ZW0A 4P16A 2KQ4X 2RDGA 3U2SC 2TSSA 4C80A 3I57A 3Q69A 1JCKB 2L1AA 2W3SA 2Y3AA 2FUG1 1XLQA 2INPE 3VQIA 1DOYA 1YN3A 2JXTA 3BIID 4JE3B 1BXTA 4KGRA 3I9V1 2YEPB 1FIQA 2KAJA 3AMZA 4C7YA 3AH7A 3UI3A 3ZJVA 1PGAA 4EE2A 1SB3C 3LB8C 1AYFA 3TSSA 1GPXA 1KTKA 3VRBB 2WLBA 2XNAC 4XE0A 5BYSA 1I7HA 3W2DA 3HVZA 2IDYA 1VZ8A 1UGJA 2L52A 1JWAD 1NYRA 2BS2B 3AE1B 5FKAC 4KKIA 2N0SB 4GDLB 2WXOA 1FFUA 3ZJTA 3U52E 1NYQA 5T8IA 1OQQA 4C7ZA 1FNVA 2V3NA 2WXJA 2OHFA 2DYOA 3ZJUA 2WXQA 5D7GA 3SFEB 4OZAA 4RFBA 5FK9C 3GB1A 3TEWA 1I4GA 1KF6B 4LTUA 1JQ4A 1EM7A 3B9JA 5D3IB 3Q8CA 1UWMA 3AEFB 3AE7B 2K22A 4AS1A 1LO5D 1IUEA 4AQ7A 3E56A 1VRAB 5BMHA 1TY2A 1ZUD2 3C8YA 1WGKA 1TKEA 1SSNA 1DYQA 2V3PA 1D5ZC 4L2YA 4OHJA 1DOXA 2N9LA 1WWTA 1SE3A 1TKYA 2KDMA 2WXIA 2LFIA 2WP9B 1AN8A 1FRDA 1QOBA 3H8HA 4TSSA 3TEXA 4TMAB 1SE2A 1F2RI 3RPFC 4RF1A 1D6EC 4D2KA 3NS1A 4MACA 1GB1A 1NVID 3FC4A 1FNWA 2WU2B 2AQ2B 2H88B 4MM3B 5JXVA 1C77A 4P6VF 1E10A 2PVGC 1CQVA 4US9A 2PIAA 4C56C 1I4HA 1F2RC 1SE4A 1Y56A 3ABVB 3R2IA 1ENFA 1QLBB 3IXSA 1V1PB 5LNK1 2DYMA 2K0PA 3KWVA 1YJIA 1C79A 3W5UB 2JQRB 3P1MA 3BYTB 3AB5A 2IJ0A 3Q8BA 2V4IB 2PMVA 1ESFA 2WDQB 1QILA 2ON8A 1PFDA 3V3XA 1ET9A 1K51A 2J53A 4HKQA 4GLSC 2ACZB 1CJEA 4JWUC 1ZOYB 2BS4B 4CQNA 1E7PB 1MHXA 4ZHPA 2L32A 4N6EB 4MT5A 2HTME 4PT5A 4YTPB 4KGSA 2KACA 1ZE3D 3AE5B 1L4ZB 2K9XA 4A9AA 3IT4B 5EE0A 3GS2A 3AV8A 1BUIC 2GB1A 3MFGA 1IGDA 1JWMD 1BMLC 1NEKB 1XXGA 1SBBB 3GP7A 3J9CA 3CWIA 3HRDD 2LEKA 3AE2B 3N9YC 1JWSD 2FE8A 2XN9C 4RGTA 2VZKD 4ARIA 1XCQL 1E6EB 4B0MA 4WAFA 1XEEA 2JSVX 3P63A 4ZRQA 1QT9A 1DGJA 4NAWB 2R61A 1FMAD 1TS3A 3NUHB 4YT0B 4YXDB 2WDVB 2PLPA 2YEPF 4DXFA 2K5PA 2BT6A 1PGBA 1GAQB 3IAM1 2BBCA 1J7CA 3AEEB 3BK1A 3AN1A 3EUB2 3P4RB 3BVZA 2DWQA 4LK0M 3MJ5A 3SFDB 3TEZA 1TS5A 3BVGA 1L0YB 1FNUA 1STEA 5I4DA 3O13A 4ZRPA 2QEJC 1YQ4B 1HQRD 4UDUC 1HZ6A 1C4PA 1HXYD 1M4VA 2J52A 1KLGD 1C78A 3KLSX 2G9HD 4RGOS 1ZP0B 4YWGG 2WU5B 3W5VB 1RWSA 2BW2A 4DXGA 4IKGA 1ZDVA 1N63A 2I2YA 2EELA 2WXKA 3EA6A 1WYGA 1J7AA 4XDDA 3FAHA 2BYTA 2Y5PA 1QOGA 2RDHA 2CJNA 1OQRA 2JU6X 2M19A 4XDCA 1N61A 4RNAA 5EE3A 1RFKA 2WDRB 2JYEA 3Q8EA 2RMMA 1TZOA 1YJJA 5BMIA 3DWMA 3Q8FA 2N9KA 3NVVA 2JX5A 3PO0A 1HZ5A 1I4XA 4NAMA 4L23A 5HFYA 2LMCA 1CZPA 2G1EA 3E9SA 1PGXA 2SEBD 4WURA 2HDEA 2KN4A 1VZ6A 4DQOC 3AM9A 1QKZA 1XLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JXT A;  4KGR A;  2ON8 A;  3V3X A;  1K51 A;  3FIL A;  2J53 A;  4GLS C;  3UI3 A;  1C9F A;  1PGA A;  1HEZ E;  1MHX A;  2IGH A;  4WH4 A;  2IGG A;  4KGS A;  1UWX A;  2KAC A;  2LHE A;  1Q10 A;  4HJG E;  3MP9 A;  4KGT A;  2I38 A;  2GB1 A;  5HHD G;  1IGD A;  1FCC C;  2JZP A;  1ZXH A;  1XCQ L;  1YMH E;  1IBX A;  2N7J A;  1MPE A;  2JSV X;  4OZA A;  3GB1 A;  2PLP A;  1PGB A;  1EM7 A;  2LGI A;  1K52 A;  5HG2 A;  4OZB A;  5HI1 A;  1IGC A;  1XCT L;  1XF5 L;  1P7E A;  1YNT E;  2RPV A;  1MVK A;  2ZW1 A;  1HZ6 A;  1KH0 A;  5BMH A;  1K53 A;  1IBX B;  2J52 A;  2GI9 A;  2JWU A;  2PW9 A;  2N9L A;  2KDM A;  5BMG A;  1JML A;  2NMQ A;  2QMT A;  4OZC A;  4IKG A;  1K50 A;  1GB4 A;  1MHH E;  2I2Y A;  2EEL A;  1F2R I;  4D2K A;  1FCL A;  4MAC A;  1GB1 A;  2OED A;  2ONQ A;  5JXV A;  2JU6 X;  2LHD A;  2LUM A;  1F2R C;  2RMM A;  1P7F A;  5BMI A;  4HKZ E;  1MI0 A;  2PTL A;  2N9K A;  2IGD A;  3FIL B;  1HZ5 A;  5HFY A;  1D4B A;  2QSD A;  1FD6 A;  2ZW0 A;  1PGX A;  2KQ4 X;  2K0P A;  2KN4 A;  4IOI E;  1QKZ A;  2KWD A; 
#chains in the Genus database with same CATH topology
 5C2T B;  4W9C A;  2WS3 B;  4HVB A;  1EWC A;  4HK2 A;  2D10 A;  1MG4 A;  2EKE C;  3NVZ A;  2IGH A;  2D07 B;  2N7E A;  2K8C A;  2K8H A;  1UNS A;  2W9N A;  3OJ3 A;  4IWP A;  1UWX A;  2BKR B;  2EKI A;  2M0X A;  3U7D A;  2LRW A;  3VHT C;  2MW5 A;  3B2G A;  3MP9 A;  1JW9 D;  4YSX B;  1PYW D;  4W9J A;  3W1S A;  2DZI A;  1CK1 A;  1C76 A;  1YQ3 B;  4WIP A;  2KVR A;  3AE3 B;  1VZ7 A;  2O6V A;  4JWS C;  1YMH E;  1D5M C;  4FXC A;  3T8M A;  3RNG C;  2D5G A;  1KJT A;  4OZB A;  4A6Q A;  1WXA A;  3TJP A;  4LLG M;  2GMI C;  3AEG B;  1T3Q A;  2L83 A;  1E90 A;  1P7E A;  2IPK D;  3OAW A;  1JAL A;  1FO4 A;  4YSY B;  3VR8 B;  1JWB D;  4USA A;  1VR9 A;  1N5W A;  3MTN B;  1WX7 A;  3ENE A;  2N4F A;  5AUI A;  2PW9 A;  2OJW A;  3NG0 A;  3HM6 X;  2V9H A;  4OZC A;  3ZTD A;  1N60 A;  1MG8 A;  1YIW A;  4GDK A;  4DHZ B;  1ZDX A;  3I3T B;  3MC0 B;  1EU3 A;  1R7S A;  3KQ4 A;  2QHO A;  2Q5W D;  5G5G A;  1T6B X;  3QA8 A;  4HWI B;  3VH3 B;  1UF0 A;  3M63 B;  1ET6 A;  2LZ6 A;  5IOI A;  2LHD A;  4ANU A;  3AEB B;  3T3N A;  1G6J A;  2V4L A;  2MLB A;  4II3 B;  2X38 A;  3V60 A;  4MEM A;  3BYY B;  2J7Q B;  2W82 A;  1ZKH A;  5BYQ A;  5L95 C;  3B2F A;  4IOI E;  1OFF A;  3KW5 B;  3VUW A;  3VR9 B;  4US8 A;  1S1Q B;  4XWW A;  4BBN C;  1F0Z A;  1U4A A;  5E6J A;  4RF0 A;  1YQB A;  3ALB A;  1GC6 A;  2FIF A;  2BTE A;  2DAJ A;  5TSS A;  1FRR A;  2L0F A;  2L8J A;  3P4Q B;  3EFU A;  3VTV A;  3P4S B;  3BWU D;  3RUL A;  1FCC C;  5JZE B;  2ZEQ A;  1EF1 A;  5GMV A;  5D2M B;  2INC C;  1K52 A;  1RYJ A;  4LNF A;  1AWD A;  2QJL A;  4O1N A;  1E0Z A;  2Z8L A;  4ZYN A;  1XCT L;  4XYC A;  1XF5 L;  2W54 A;  4B6W A;  1B9R A;  1YNT E;  4K7S A;  5D94 A;  1SIF A;  3A1Q B;  4FAD A;  4M0W A;  2GI9 A;  5EE9 A;  1N62 A;  2BF8 B;  1JML A;  2QMT A;  4JPS A;  5D3D A;  2E6X A;  4B95 A;  1E9M A;  1GB4 A;  1MHH E;  2QC8 A;  5GXG B;  2E3T A;  3TUO A;  2KDB A;  3ZLZ A;  1WY8 A;  1I4Q A;  1NI3 A;  2ONQ A;  3P42 A;  1V49 A;  3Q8A A;  3EC8 A;  2DBY A;  2BB6 A;  1P7F A;  1MI0 A;  5G2N A;  1R4M B;  3ZNI D;  4KSK C;  3I57 A;  3HK0 A;  3Q69 A;  3EHV A;  3PHW B;  1XLQ A;  3VQI A;  3EEC A;  1YN3 A;  2FCS A;  3I9V 1;  3AMZ A;  2ZVO A;  3AH7 A;  4M8N A;  3RNA C;  2M8S A;  2YLM A;  4E3C A;  2ZZP B;  5DPS A;  3DBH I;  3UIN B;  2D3B A;  2BWF A;  2DAF A;  4XE0 A;  3L0W B;  1UGJ A;  2MBH A;  1FPY A;  2JF5 A;  1WH3 A;  2JZ3 B;  2KDI A;  2WXO A;  1FFU A;  2KJH B;  1ISN A;  4C7Z A;  4TUU A;  5BO4 B;  2N7D A;  2LGY A;  2OHF A;  2WXQ A;  4OZA A;  4MGI E;  5FK9 C;  4AWJ A;  3DQV A;  1KF6 B;  4LTU A;  4I6N B;  2BPS A;  2NPT B;  5D3I B;  2AWT A;  2CHZ A;  2DYB A;  4WWO A;  2ZCB A;  3T9L A;  2LWP A;  1IUE A;  1JRU A;  4FHJ A;  2PE9 A;  2KMC A;  1C3T A;  2KXJ A;  4L2Y A;  2KLC A;  3QHT A;  3JVZ X;  1WWT A;  2KK8 A;  5IKC M;  5LXH A;  4TMA B;  2KTR A;  5AEK B;  1WMH A;  3A9K B;  1NVI D;  2CU1 A;  2AQ2 B;  3VTU A;  1UGM A;  2I1J A;  2PIA A;  1V86 A;  1F2R C;  1Y56 A;  2AL3 A;  2O6V B;  3R2I A;  4MDK E;  1QLB B;  1E8X A;  5LNK 1;  4IUM B;  3KWV A;  1YD8 U;  2KX0 A;  2JQR B;  1WJ4 A;  4YL8 A;  4IWO A;  1ESF A;  3NJT A;  3NZU A;  1F1H A;  4WQO B;  4EFO A;  1T0Q C;  2J53 A;  2PJH A;  2KDE B;  4HKQ A;  4JWU C;  2NS5 A;  2IO2 B;  1UEL A;  4MT5 A;  2IBI B;  1M94 A;  2EMS A;  4A3O A;  1L7Y A;  5LLI A;  4MGY E;  2GB1 A;  5DPW A;  1MJD A;  2XK5 A;  1C1Y B;  2BGF A;  4G50 A;  4BKG A;  1JWS D;  2FE8 A;  2MP2 B;  1XCQ L;  1WX8 A;  1E6E B;  1A5R A;  4E74 A;  2BVC A;  3L16 A;  1XEE A;  3P63 A;  3RI7 C;  1FMA D;  4YT0 B;  4ZDV A;  4KZC A;  1PGB A;  3IAM 1;  3PRM B;  2BBC A;  3SU8 X;  4NAW B;  3AN1 A;  3EUB 2;  3BVZ A;  1TS5 A;  2NBV B;  2L05 A;  2JRI B;  3VH4 B;  3O13 A;  4JLC A;  1YQ4 B;  3R66 C;  2CHW A;  1WYW B;  1HXY D;  2J52 A;  2RR9 A;  1KLG D;  1C78 A;  2WWZ A;  3W5V B;  4DXG A;  2KX3 A;  4WJN A;  2EEL A;  2V1Y A;  2WXK A;  3H1U A;  4XDD A;  1NDD A;  3FAH A;  2RDH A;  1VD2 A;  3BY4 B;  2PPH A;  4KIK A;  1KLV A;  4G3X B;  4PS3 A;  1WR6 E;  2N9K A;  5JHB A;  5HFY A;  2LMC A;  2LAS A;  4WUR A;  4DQO C;  2VH1 A;  2KHW B;  1QKZ A;  1E7U A;  4P1B C;  5J17 A;  3CIR B;  5HKH A;  2DLB A;  4TQ0 A;  3RZF A;  1XLN A;  3FIL A;  1CMX B;  4A90 A;  1WM3 A;  1YN5 A;  2X8X X;  2UYZ B;  3H7P A;  3N1Y C;  3OLM D;  2ZPY A;  2VRR B;  2IO0 B;  2LHE A;  3MJW A;  3QC8 B;  3V05 A;  4RGN A;  3K9P B;  3IAS 1;  1L4D B;  2DX5 B;  2KD0 A;  1YX6 B;  1YOV B;  3JSV A;  3PZ7 A;  4FUL A;  4RGM A;  3L17 A;  1C4A A;  1RRB A;  4B0E A;  5CHF A;  3PZ8 A;  1FEH A;  3L10 B;  1XQQ A;  1SGH A;  3W9C B;  2BYV E;  5BYR A;  4LNO A;  1E7V A;  4J3O D;  3ML8 A;  3O65 B;  2PVO D;  1A70 A;  4F8C B;  3UGB B;  4DDG D;  1SXT A;  4WJO A;  2PE6 B;  1N5X A;  3P2B A;  4FHK A;  3ZQ4 A;  3AE8 B;  2RPV A;  2HTH A;  3ZGZ A;  4HEA 1;  4WQM A;  4M01 A;  1ZW7 A;  5BMG A;  1UUP A;  3IHP C;  3AED B;  5AZF A;  3ZXR A;  3VRA B;  1F52 A;  2FBW B;  2WXM A;  1TS4 A;  2K39 A;  4NJC A;  4NQL B;  4WJQ A;  4HRS A;  4BOS C;  4Q2J A;  3C0R B;  5KHQ A;  3TIX A;  2V0G A;  3QX1 A;  1P0R A;  3IVF A;  2FAZ A;  5LXI B;  4HKZ E;  1N6Z A;  3R8B A;  4DWF A;  5TR5 A;  3FIL B;  5AUK A;  4G0N B;  2WXN A;  2KWU B;  2L3Z A;  3SEB A;  1WSP A;  2KNB A;  4YSZ B;  1TYG B;  1L0X B;  4PS8 A;  4A8X C;  1D5X C;  2KT7 A;  2LRU A;  3NVY A;  2WXG A;  4TQ1 A;  1GC7 A;  1QOF A;  3M62 B;  1XLP A;  2MJE A;  5FR3 A;  2W3R A;  4KGT A;  4R3D A;  2O6V D;  2PKO A;  4OW0 A;  3K9O B;  3H6N A;  1L6V A;  3ZRF A;  3PRZ A;  4JQW C;  1Z2M A;  5MPO A;  1IBX A;  4ZRI A;  4XZ4 A;  4WWM A;  3ZDT A;  3ZVV A;  2LGI A;  1OTR B;  3B08 A;  3KUD B;  3RUI B;  3RNE C;  4DHZ E;  4NAW A;  4ZRK A;  1RFA A;  2JZZ A;  1Q0W B;  1TJE A;  1GJZ A;  1WGY A;  1LQB A;  4N59 A;  1IBX B;  1FFV A;  2WXL A;  4ACF A;  4REZ A;  2B76 B;  3WCQ A;  2MP2 A;  3A4S C;  1YN4 A;  1J19 A;  4ZHO A;  4QAY A;  3ZUN A;  2QDF A;  2XK5 B;  2LUE A;  3ETR A;  3L4P A;  2H89 B;  3MHZ A;  2KC2 A;  3IT6 B;  2IND C;  4W9L A;  2ZVN A;  3NS8 A;  1VDV A;  3TCA A;  1LFD A;  2LUM A;  4IM0 A;  3U7Z A;  4HDQ A;  4XGA B;  2GBM A;  1P1A A;  1V6E A;  2QSD A;  4P16 A;  3KH0 A;  3PRP B;  4DDI D;  2Y3A A;  4HJK A;  1DOY A;  1Q1O A;  1WGR A;  1FIQ A;  4I6P A;  3QAQ A;  2VH2 A;  3UI3 A;  4WWN A;  3ZJV A;  1PGA A;  4EE2 A;  2DZK A;  3LDZ E;  2KC1 A;  3DBR I;  1I7H A;  3W2D A;  4GGQ A;  2C60 A;  2O2V A;  2K25 A;  1JWA D;  2BS2 B;  2O2V B;  1KM7 A;  2N0S B;  4GDL B;  3RNB C;  2KWC A;  4MSM B;  4AOF A;  5DPT A;  3U52 E;  1NYQ A;  2A4Z A;  1FXT B;  2C5L C;  4K1R B;  3H7P B;  2JPH A;  3Q6B A;  2BWE S;  3ZJU A;  3MC9 A;  1TGZ B;  3IFW B;  2LGD A;  4RFB A;  2FCN A;  5CHW A;  3B9J A;  4MJS B;  2DZJ A;  2KQ7 A;  2C7H A;  2BKF A;  5D6J B;  1UWM A;  3AE7 B;  3S2A A;  1LO5 D;  1ZUD 2;  3GE8 C;  4TKN A;  1D5Z C;  1DOX A;  3R7Q A;  2N9L A;  1TKY A;  2KDM A;  4DXA B;  2WXI A;  3ZXV A;  1QOB A;  4TSS A;  3RT3 B;  1OEY A;  4D2K A;  2KTF A;  2C9W B;  2KOX A;  4I6L B;  2G45 B;  5JXV A;  1C77 A;  4OVV A;  1E10 A;  2MBO A;  1CQV A;  2ZNV B;  4C56 C;  2RPQ A;  1WI0 A;  3ABV B;  3RNF C;  3IXS A;  3L08 A;  3DVN V;  2ZCC A;  4IM2 A;  4S0R A;  4C00 A;  4MSQ B;  1C79 A;  2MWS B;  1LM8 B;  2N9X A;  1QIL A;  2ON8 A;  1HE8 A;  1PFD A;  3AU5 A;  1CJE A;  2A5U A;  1UH6 A;  2L32 A;  4KIK B;  4PT5 A;  2OOB B;  2KAC A;  3L13 A;  1ZE3 D;  3H7S A;  2K9X A;  4ANV A;  3PS6 A;  3GS2 A;  3AV8 A;  5C23 A;  3VTW A;  3QWZ B;  4W9G A;  2REX A;  1BML C;  4HCN B;  1NEK B;  1T0S C;  3GP7 A;  2LEK A;  2D11 A;  3WAP A;  1E8Y A;  2K1F A;  4WAF A;  4ZRQ A;  4EZJ A;  4M0W B;  4S17 A;  1DGJ A;  2R61 A;  2LGX A;  3NUH B;  4YXD B;  4B9K A;  2JVC A;  5CHV C;  1E5W A;  3AEE B;  3P4R B;  2DWQ A;  3BVG A;  4ICU A;  1FNU A;  1HQR D;  4UDU C;  4F1S A;  1C4P A;  2KAN A;  2C7N B;  2RDB C;  3KLS X;  2KFJ A;  5IAA C;  3BIN A;  4YWG G;  2LXA A;  1RWS A;  2BW2 A;  4NPN A;  2JT4 B;  3APD A;  3D32 A;  1ZDV A;  3VVW B;  2JUO A;  3A4R A;  4RM9 A;  2KVZ A;  3FKY A;  2KLG A;  2K8B A;  4K7U A;  3M3J A;  2CJN A;  2JU6 X;  1P9D U;  1N61 A;  4KV2 A;  4RNA A;  3M95 A;  3WA0 A;  5EE3 A;  2WDR B;  1WGG A;  2WHI A;  1TZO A;  5BMI A;  4LDT B;  4A20 A;  1HZ5 A;  2KFK A;  2FCQ A;  1CZP A;  2DHZ A;  4LDT D;  2HDE A;  2L0T A;  3N1X C;  3P4P B;  4FJV B;  1EWY C;  3N20 C;  2QIL A;  4FJY A;  2MEK A;  4ZRJ A;  1HEZ E;  4W9H A;  3QQ8 B;  2AQ3 B;  2IGG A;  3OG5 A;  2D3G A;  2ZPN A;  4YTM B;  1EO6 A;  1V9J A;  3LXF A;  3DBS A;  1V97 A;  5C3J B;  3AE9 B;  3HVD A;  2LD9 A;  4GDK B;  3ONS A;  2V3S A;  1V1P A;  2CJO A;  2AQ1 B;  1PQS A;  1WRI A;  1MPE A;  1JRP A;  2NCN A;  2AEH A;  2MSE D;  5EE1 A;  3RCZ A;  1V2Y A;  2QIE B;  2IY0 B;  1HTQ A;  4MGZ E;  3VXW A;  1IGC A;  2CKH B;  1BT0 A;  1XO3 A;  3AE4 B;  1H8C A;  2ZW1 A;  4DHJ B;  4KVG B;  2HD5 B;  2NTT A;  2Z0D B;  4OVZ A;  4IC7 B;  1T5X D;  3CF6 E;  4RCO A;  2FUH B;  1SF0 A;  2WX1 A;  2BYE A;  1SIJ A;  4GU2 A;  1SE9 A;  2K6D B;  1FCL A;  3KUZ A;  4KDI C;  1ACC A;  4ARC A;  2BYF A;  1NEN B;  2OJR A;  1FXI A;  3N32 A;  1TS2 A;  4DK5 A;  1DOI A;  3CST A;  2K3U A;  2AL6 A;  5JHA A;  1WXQ A;  2CS4 A;  1WXS A;  3NZS A;  1UD7 A;  2WXR A;  2KWD A;  1TT5 B;  2AX5 A;  3HIZ A;  4RH6 A;  2KYW A;  3L54 A;  1V1O A;  1JWU D;  2GRI A;  2LJI A;  4M02 A;  3V61 A;  4RM8 A;  1WXV A;  3LJ3 A;  3AI5 A;  4WH4 A;  4GXB A;  1PUT A;  5DCN A;  4BKS A;  1RAX A;  2ZNV C;  1D3Z A;  1Q10 A;  4ASW C;  1E8Z A;  1P98 A;  2LJ5 A;  1EU4 A;  3ZNH B;  2D3A A;  4ZOH C;  3W1S C;  3OJ4 B;  4N58 A;  5HHD G;  3DHG C;  2QCZ A;  3HM3 A;  4NQK E;  2BS3 B;  1H4R A;  1ZXH A;  3PT2 B;  1VJK A;  3PHX B;  3AUL A;  2KDF B;  5E6O A;  3V6C B;  1R4M I;  4XWT A;  2W55 A;  3NZ3 A;  1JRO A;  1J0G A;  4BBN F;  1WRD B;  5HI1 A;  2J4X A;  4N9F 4;  1I4R A;  4K7W A;  4II2 B;  1WZ0 A;  3CMM B;  4IG7 B;  1KFY B;  2ICI A;  5JH5 C;  1C4C A;  4GB9 A;  4PS7 A;  2MA9 B;  1MVK A;  3EGR A;  3SHQ A;  2NR2 A;  5H92 C;  1KH0 A;  1K53 A;  1J8C A;  3UIO B;  2JWU A;  4KKJ A;  1WR1 A;  1IP9 A;  2INN E;  3TEY A;  3PRE A;  1ROE A;  2N9P C;  1K50 A;  2MBE A;  4GMV A;  2MJ3 A;  1QOA A;  4FA6 A;  2BB5 A;  5E6P A;  4W9D A;  5DPR A;  2OED A;  1FXA A;  1ZPS A;  3WAM A;  1Q5W B;  3ZNG C;  3X0W A;  3PSE B;  2DEN B;  1V8C A;  3VAW A;  4NJ6 A;  1VLB A;  3PZD A;  1D4B A;  1F77 A;  1QZE A;  3U2S C;  1JCK B;  1IPG A;  2L1A A;  3N30 A;  2INP E;  3NHE B;  2UWQ A;  1V5O A;  3BII D;  1WXM A;  5KHO A;  4JIO U;  3UIP B;  2R2O A;  3U8Z A;  3LB8 C;  4G11 A;  1AYF A;  4XX5 A;  3TSS A;  2EMT A;  1KTK A;  4CYE A;  4J6I A;  3DCG A;  2WLB A;  2XNA C;  4MH0 E;  5BYS A;  4KZ0 A;  3DHI C;  1NYR A;  3AE1 B;  3RMK C;  5FKA C;  4KKI A;  1OQQ A;  1FNV A;  3WIM A;  2V3N A;  1LXD A;  1E8W A;  3IG3 A;  2DYO A;  4KSL C;  3SFE B;  1S3S G;  2LXC A;  3TEW A;  1I4G A;  4LNI A;  5IP4 D;  2D3C A;  4X57 B;  3ZTC A;  1OQY A;  4PK1 A;  1WE6 A;  3AEF B;  3PGE A;  2J0K A;  3PTF C;  3E56 A;  3ZNZ B;  1I42 A;  1VRA B;  5BMH A;  1TY2 A;  2ZJD A;  1WGK A;  3KYD D;  1SSN A;  2R2Q A;  4C4V B;  4OHJ A;  1SE3 A;  4CO7 A;  4PYZ A;  1OEY J;  2LFI A;  2WP9 B;  1AN8 A;  5IA7 A;  2M17 A;  2MRP A;  2YVC A;  1SE2 A;  1R4N B;  3RPF C;  4RF1 A;  4BAX A;  2KQS A;  1D6E C;  3SDL C;  4MAC A;  1GB1 A;  2LVP A;  1FNW A;  2KJR A;  2H88 B;  4MM3 B;  5J18 A;  4P6V F;  3HHM A;  2PVG C;  2IY1 B;  3RZW C;  4US9 A;  1GG3 A;  3A1Q A;  1ENF A;  4IM3 A;  5E6N A;  1V1P B;  4HXD A;  2DYM A;  4EEW A;  2K0P A;  3PPA A;  1YJI A;  3W5U B;  2KN5 A;  3BYT B;  2IJ0 A;  3Q8B A;  2B3A A;  3GE3 C;  2WDQ B;  1WJ6 A;  1EUV B;  1WJU A;  1K51 A;  2CR5 A;  3GZN I;  2JRH A;  4WJP A;  1ZOY B;  1VCB A;  4CQN A;  2L00 B;  2XEW A;  4M8M A;  1E7P B;  4NNJ B;  3AU4 A;  4N6E B;  5FR6 A;  5AZH A;  2HTM E;  4YTP B;  4KGS A;  1L4Z B;  2G3Q B;  4BKT A;  5EE0 A;  4NY0 A;  1BUI C;  4HPP A;  3MFG A;  1WIA A;  2N1W A;  1JWM D;  2FCM A;  3J9C A;  1XXG A;  1SBB B;  3CWI A;  3HRD D;  1NBF C;  3AE2 B;  4RGT A;  4B0M A;  3UQB A;  2JSV X;  3A33 B;  3W1Y A;  2WDV B;  2K5P A;  2BT6 A;  1Y8R C;  4W9E A;  1WJN A;  3UQA A;  3NY5 A;  4LK0 M;  3TEZ A;  3MJ5 A;  3RD2 A;  3SFD B;  1STE A;  5I4D A;  3DPD A;  3JYU A;  1L2N A;  2QEJ C;  3APF A;  5IO9 A;  1HZ6 A;  4TV3 A;  1WZ3 A;  3QAR A;  3R3M A;  5CTR C;  1UBQ A;  3DVN U;  1XD3 B;  4URK A;  4RGO S;  2RSU A;  2WU5 B;  3DBR B;  1N63 A;  2DNF A;  2J0J A;  4LNN A;  2WX0 A;  1EF5 A;  4HPM B;  1J7A A;  2BYT A;  2KZR A;  2MBB B;  1ZGU B;  2KFK B;  1QOG A;  2RD0 A;  2JWZ A;  3ZKJ C;  1OQR A;  2WDT B;  3ZO5 B;  4WWP A;  1RFK A;  3NOB A;  2RMM A;  2Z59 B;  4W9F A;  3DWM A;  3Q8F A;  1Z5S B;  3NVV A;  4GDL A;  3E9S A;  1PGX A;  4K3B A;  2KN4 A;  4AUQ C;  5G55 A;  1R4N I;  3AM9 A;  1WFY A;  3GOE A;  1TY0 A;  2Y5B B;  1IYF A;  3AEA B;  3A9J A;  1PDX A;  3VDZ A;  1K8R B;  2WXH A;  2Z0E B;  4HRO A;  2WXF A;  2L7R A;  2LVQ A;  2XBB C;  4W9I A;  3PLV A;  4DBG A;  5J2R A;  5EDS A;  5L83 A;  4ZYS A;  3TL5 A;  4F7Z A;  3SR6 A;  2ASQ A;  2IYD B;  2KO3 A;  2I38 A;  1SJH D;  2IZV B;  4LCD E;  3HUI A;  2M0A A;  3TMP B;  1TKG A;  2NBW B;  3URY A;  3KUC B;  1I35 A;  1UBI A;  4KX6 B;  4IDI A;  1FM0 D;  3LYY A;  3AXC A;  4AJY B;  5HG2 A;  3N1Z C;  3Q3F A;  4JGH B;  2HJ1 A;  3JW0 X;  1RM6 C;  2WXP A;  2J42 A;  2JYT A;  2SAK A;  3RN9 C;  2C7M B;  3APC A;  3AE6 B;  3DBH B;  3Q2A C;  5H8Y E;  2MH7 A;  2G4S A;  1RLF A;  1WM2 A;  4LJO B;  4L1B A;  3KVF B;  2MHJ A;  3DVG Y;  1HA5 A;  4K81 A;  1L0V B;  3BZD B;  2DZM A;  2M4N A;  3GZN B;  2CU3 A;  4FN2 A;  1QF6 A;  3IBE A;  2WQY B;  4AJW A;  3QK0 A;  3AEC B;  3VUY A;  1GOZ A;  2PTL A;  3ML9 A;  2IO3 B;  3BK2 A;  2IGD A;  3NVW A;  4BVU C;  2VZK B;  1FD6 A;  3BVM A;  4W9K A;  1YX5 B;  1SJE D;  4YTN B;  1KLU D;  3ZYY X;  3WAL A;  3VFK A;  1TTN A;  2GBK A;  4WAA A;  3QCA A;  2MJD A;  2WNM A;  3C19 A;  1C9F A;  5G5H A;  4NZL B;  2CHX A;  4ANW A;  5CX3 A;  2MX2 A;  3UF8 A;  3OWE B;  4HJG E;  1WGH A;  1B1Z A;  1SEB D;  3I5J C;  4P7I A;  1L5P A;  1XT9 B;  2KMM A;  3T3O A;  2I1K A;  3KWL A;  4MJS A;  1WGD A;  3QJZ A;  4ICV A;  2GBJ A;  4MH8 A;  2UU7 A;  2JZP A;  3DWG C;  1V80 A;  3RFZ B;  1I4P A;  3NRZ A;  2M56 B;  2N7J A;  2NTS A;  1GNU A;  2KMA A;  4BKS D;  3JSV B;  3DOW A;  1YJ1 A;  4P1C C;  3ZW3 A;  3PVL A;  2HE7 A;  1J7B A;  3R2T A;  4M00 A;  1AW7 A;  1V81 A;  1UZX B;  2KWV B;  1ZXI A;  3DVG X;  3ZIM A;  2D2Q A;  2NMQ A;  4FLH A;  4ITK A;  1OGW A;  3V62 A;  1QQR A;  2Y5C A;  1MFW A;  2JY6 A;  4AP4 C;  4PYU A;  1GUA B;  4JX1 C;  3U4E G;  4CHK A;  1F9J A;  3R7R A;  1KRH A;  4A55 A;  1X1M A;  4RMA A;  5C1Z A;  1AAR A;  3B0A A;  2N1V A;  4H2A A;  1L6U A;  2ZW0 A;  3PV1 A;  2KQ4 X;  2RDG A;  2TSS A;  4C80 A;  3Q3O C;  1LGR A;  2GLS A;  2W3S A;  3Q3J A;  2FUG 1;  3CSF A;  2NBU A;  2JXT A;  4JE3 B;  4KGR A;  1BXT A;  3DBL I;  2YEP B;  2KAJ A;  3ECI A;  2AYO B;  3MC8 A;  4C7Y A;  3I63 C;  4LNK A;  1SB3 C;  2KJ6 A;  2WGS A;  1TBE A;  4MEL A;  1GPX A;  3Q3N C;  4XC2 A;  2LVO A;  3VRB B;  3HVZ A;  5IN7 A;  3SD5 A;  2IDY A;  1VZ8 A;  4FBJ B;  2L52 A;  3VUX A;  2MCN B;  1T0Y A;  2KKC A;  3ZJT A;  5T8I A;  1TZ1 A;  4K3C A;  4IWQ A;  2WXJ A;  4KDL B;  4C4V A;  5D7G A;  3DDC B;  3ZDM C;  3GB1 A;  4EZK A;  1JQ4 A;  2J0M A;  1EM7 A;  3U30 A;  3RYT A;  3Q8C A;  4HLE A;  3KYC D;  2K22 A;  2WYQ A;  4EOY A;  4AS1 A;  2G4D B;  4A3P A;  3QIJ A;  4AQ7 A;  2RGF A;  4E71 A;  3WAN A;  4EKU A;  3C8Y A;  1TKE A;  3Q3M C;  2LGS A;  1NI2 A;  1DYQ A;  4OVU A;  2V3P A;  4EZL A;  3WAO A;  1FRD A;  3H8H A;  3TEX A;  1F2R I;  3Q14 C;  3NS1 A;  2N9E B;  3FC4 A;  2WU2 B;  4NJ7 A;  4GOC A;  4GN1 A;  3A9J B;  1I4H A;  1SE4 A;  2FNJ B;  2BQQ A;  1KOT A;  3V6E B;  2GOW A;  2IO1 B;  3A9K A;  3P1M A;  1WE7 A;  3AB5 A;  2V4I B;  1WMH B;  2PMV A;  2KTR B;  3V3X A;  1ET9 A;  1TIF A;  4GLS C;  2ACZ B;  2BS4 B;  4JL9 A;  2GBR A;  4EUT A;  1MHX A;  4ZHP A;  1WF9 A;  4GSW A;  3AE5 B;  4FJZ A;  1V5T A;  4A9A A;  3IT4 B;  1WX9 A;  1P3Q U;  2NPT A;  4LJP B;  2PEA A;  1IGD A;  2K6Q A;  3DBL B;  2FID A;  3N9Y C;  2GBN A;  2XN9 C;  2VZK D;  4ARI A;  3N3K B;  4HCP B;  1QT9 A;  2M1M A;  4BOZ B;  4BZA A;  1TS3 A;  4BFR A;  2PLP A;  2YEP F;  4DXF A;  1GAQ B;  4IW0 A;  3TBL D;  1J7C A;  3BK1 A;  1T0R C;  1L0Y B;  4HDO A;  4ZRP A;  2LI5 A;  2MBQ A;  1M4V A;  3DHH C;  3B1L X;  2G9H D;  2MQJ A;  1ZP0 B;  4MM3 A;  4IKG A;  2I2Y A;  4GIV A;  3H9D A;  3EA6 A;  1WYG A;  5AZG A;  2L76 A;  2Y5P A;  1HTO A;  2M19 A;  4XDC A;  3EFC A;  3MHS D;  2HJ8 A;  3Q8E A;  2JYE A;  2JXX A;  4DHJ D;  4HPL B;  1YJJ A;  2NVU I;  2JX5 A;  3PO0 A;  4MGK E;  1I4X A;  4NAM A;  4L23 A;  3X23 A;  2G1E A;  2SEB D;  1VZ6 A;  4ANX A;  3ZRC A;  3PLU A;  3RNC C;  1XLO A; 
#chains in the Genus database with same CATH homology
 5C2T B;  3P4P B;  3CIR B;  1EWY C;  2DLB A;  2QIL A;  4TQ0 A;  2WS3 B;  1TY0 A;  2MEK A;  1XLN A;  3FIL A;  4A90 A;  1EWC A;  3AEA B;  1YN5 A;  1PDX A;  1HEZ E;  3NVZ A;  2AQ3 B;  2IGH A;  2WXH A;  2IGG A;  4HRO A;  1UNS A;  2WXF A;  1UWX A;  2LHE A;  2EKI A;  3V05 A;  3B2G A;  4YTM B;  3MP9 A;  1JW9 D;  4YSX B;  4ZYS A;  4RGN A;  3IAS 1;  1L4D B;  3LXF A;  1PYW D;  3SR6 A;  2I38 A;  1V97 A;  5C3J B;  3AE9 B;  3HVD A;  3W1S A;  4GDK B;  1SJH D;  3PZ7 A;  4RGM A;  1CK1 A;  3HUI A;  1C4A A;  1V1P A;  2M0A A;  1C76 A;  1TKG A;  1YQ3 B;  2CJO A;  2AQ1 B;  4WIP A;  4B0E A;  3PZ8 A;  3AE3 B;  1VZ7 A;  4JWS C;  1YMH E;  1FEH A;  1D5M C;  1MPE A;  1WRI A;  3URY A;  4FXC A;  1JRP A;  3W9C B;  4KX6 B;  5BYR A;  5EE1 A;  4IDI A;  1FM0 D;  2D5G A;  2QIE B;  4J3O D;  3LYY A;  5HG2 A;  2PVO D;  4OZB A;  4A6Q A;  1A70 A;  1IGC A;  4LLG M;  1SXT A;  3AEG B;  1XO3 A;  1N5X A;  1T3Q A;  2L83 A;  1RM6 C;  2IPK D;  1P7E A;  2J42 A;  2WXP A;  3AE4 B;  2JYT A;  3ZQ4 A;  1JAL A;  3AE8 B;  1FO4 A;  2RPV A;  4YSY B;  2ZW1 A;  3VR8 B;  2SAK A;  1JWB D;  3ZGZ A;  4USA A;  1VR9 A;  4HEA 1;  1N5W A;  4WQM A;  5AUI A;  2PW9 A;  2NTT A;  4OVZ A;  3AE6 B;  5BMG A;  1UUP A;  5H8Y E;  1T5X D;  4RCO A;  2MH7 A;  1SF0 A;  4OZC A;  3AED B;  3VRA B;  1N60 A;  2FBW B;  2WXM A;  4L1B A;  1TS4 A;  1ZDX A;  1SIJ A;  3MC0 B;  4NJC A;  1EU3 A;  1FCL A;  4HRS A;  1R7S A;  1ACC A;  3KQ4 A;  4Q2J A;  4ARC A;  2Q5W D;  5G5G A;  1T6B X;  1HA5 A;  1L0V B;  3BZD B;  2V0G A;  1NEN B;  2CU3 A;  1ET6 A;  1QF6 A;  2LHD A;  1FXI A;  2WQY B;  3AEC B;  3AEB B;  1GOZ A;  2PTL A;  1TS2 A;  4HKZ E;  3R8B A;  3T3N A;  3BK2 A;  2IGD A;  3NVW A;  3FIL B;  1DOI A;  2X38 A;  2K3U A;  2VZK B;  1FD6 A;  3BVM A;  5AUK A;  1WXQ A;  3BYY B;  2WXN A;  1SJE D;  2W82 A;  5BYQ A;  4YTN B;  3B2F A;  1KLU D;  4IOI E;  1OFF A;  3ZYY X;  3SEB A;  2WXR A;  1WSP A;  3VR9 B;  2KWD A;  4US8 A;  4XWW A;  2AX5 A;  4YSZ B;  4RH6 A;  1TYG B;  1L0X B;  1V1O A;  1F0Z A;  1JWU D;  2GRI A;  2LJI A;  2MJD A;  5E6J A;  2WNM A;  4A8X C;  4RF0 A;  1C9F A;  1D5X C;  5G5H A;  4NZL B;  2BTE A;  4WH4 A;  3NVY A;  1PUT A;  3OWE B;  2WXG A;  5TSS A;  1FRR A;  1Q10 A;  4HJG E;  4TQ1 A;  1QOF A;  1B1Z A;  1XLP A;  1SEB D;  2MJE A;  3P4Q B;  5FR3 A;  2W3R A;  1EU4 A;  1L5P A;  2KMM A;  3T3O A;  3P4S B;  3KWL A;  4ZOH C;  4KGT A;  4N58 A;  4R3D A;  3BWU D;  2PKO A;  5HHD G;  4OW0 A;  4MH8 A;  1FCC C;  1L6V A;  2JZP A;  3DWG C;  2BS3 B;  3RFZ B;  1I4P A;  1ZXH A;  3NRZ A;  1VJK A;  5MPO A;  2M56 B;  2N7J A;  1IBX A;  4WWM A;  2NTS A;  4XWT A;  2W55 A;  2LGI A;  3NZ3 A;  1K52 A;  1RYJ A;  1J7B A;  1JRO A;  5HI1 A;  2J4X A;  3R2T A;  1I4R A;  1AWD A;  2QJL A;  4O1N A;  1E0Z A;  2Z8L A;  1AW7 A;  1KFY B;  1TJE A;  1XCT L;  1XF5 L;  2ICI A;  2W54 A;  1C4C A;  1B9R A;  1YNT E;  1MVK A;  3EGR A;  5H92 C;  1KH0 A;  1K53 A;  4N59 A;  1IBX B;  4M0W A;  2GI9 A;  2JWU A;  1ZXI A;  1FFV A;  2WXL A;  5EE9 A;  1N62 A;  4REZ A;  4KKJ A;  1JML A;  2B76 B;  2NMQ A;  2QMT A;  4ITK A;  2INN E;  4JPS A;  3WCQ A;  3TEY A;  5D3D A;  1YN4 A;  2E6X A;  1ROE A;  4ZHO A;  1E9M A;  1K50 A;  1MHH E;  1GB4 A;  5GXG B;  2E3T A;  2MJ3 A;  1QQR A;  2Y5C A;  3ETR A;  1QOA A;  2BB5 A;  3L4P A;  2H89 B;  3MHZ A;  3TUO A;  2OED A;  1FXA A;  1ZPS A;  4JX1 C;  2ONQ A;  1I4Q A;  1NI3 A;  3IT6 B;  3P42 A;  3U4E G;  3Q8A A;  2DBY A;  1KRH A;  1VDV A;  4A55 A;  2BB6 A;  2LUM A;  1V8C A;  1P7F A;  3U7Z A;  1MI0 A;  1VLB A;  4H2A A;  1L6U A;  2QSD A;  1D4B A;  1F77 A;  2ZW0 A;  4P16 A;  2KQ4 X;  2RDG A;  3U2S C;  2TSS A;  4C80 A;  3I57 A;  3Q69 A;  1JCK B;  2L1A A;  2W3S A;  2Y3A A;  2FUG 1;  1XLQ A;  2INP E;  3VQI A;  1DOY A;  1YN3 A;  2JXT A;  3BII D;  4JE3 B;  1BXT A;  4KGR A;  3I9V 1;  2YEP B;  1FIQ A;  2KAJ A;  3AMZ A;  4C7Y A;  3AH7 A;  3UI3 A;  3ZJV A;  1PGA A;  4EE2 A;  1SB3 C;  3LB8 C;  1AYF A;  3TSS A;  1GPX A;  1KTK A;  3VRB B;  2WLB A;  2XNA C;  4XE0 A;  5BYS A;  1I7H A;  3W2D A;  3HVZ A;  2IDY A;  1VZ8 A;  1UGJ A;  2L52 A;  1JWA D;  1NYR A;  2BS2 B;  3AE1 B;  5FKA C;  4KKI A;  2N0S B;  4GDL B;  2WXO A;  1FFU A;  3ZJT A;  3U52 E;  1NYQ A;  5T8I A;  1OQQ A;  4C7Z A;  1FNV A;  2V3N A;  2WXJ A;  2OHF A;  2DYO A;  3ZJU A;  2WXQ A;  5D7G A;  3SFE B;  4OZA A;  4RFB A;  5FK9 C;  3GB1 A;  3TEW A;  1I4G A;  1KF6 B;  4LTU A;  1JQ4 A;  1EM7 A;  3B9J A;  5D3I B;  3Q8C A;  1UWM A;  3AEF B;  3AE7 B;  2K22 A;  4AS1 A;  1LO5 D;  1IUE A;  4AQ7 A;  3E56 A;  1VRA B;  5BMH A;  1TY2 A;  1ZUD 2;  3C8Y A;  1WGK A;  1TKE A;  1SSN A;  1DYQ A;  2V3P A;  1D5Z C;  4L2Y A;  4OHJ A;  1DOX A;  2N9L A;  1WWT A;  1SE3 A;  1TKY A;  2KDM A;  2WXI A;  2LFI A;  2WP9 B;  1AN8 A;  1FRD A;  1QOB A;  3H8H A;  4TSS A;  3TEX A;  4TMA B;  1SE2 A;  1F2R I;  3RPF C;  4RF1 A;  1D6E C;  4D2K A;  3NS1 A;  4MAC A;  1GB1 A;  1NVI D;  3FC4 A;  1FNW A;  2WU2 B;  2AQ2 B;  2H88 B;  4MM3 B;  5JXV A;  1C77 A;  4P6V F;  1E10 A;  2PVG C;  1CQV A;  4US9 A;  2PIA A;  4C56 C;  1I4H A;  1F2R C;  1SE4 A;  1Y56 A;  3ABV B;  3R2I A;  1ENF A;  1QLB B;  3IXS A;  1V1P B;  5LNK 1;  2DYM A;  2K0P A;  3KWV A;  1YJI A;  1C79 A;  3W5U B;  2JQR B;  3P1M A;  3BYT B;  3AB5 A;  2IJ0 A;  3Q8B A;  2V4I B;  2PMV A;  1ESF A;  2WDQ B;  1QIL A;  2ON8 A;  1PFD A;  3V3X A;  1ET9 A;  1K51 A;  2J53 A;  4HKQ A;  4GLS C;  2ACZ B;  1CJE A;  4JWU C;  1ZOY B;  2BS4 B;  4CQN A;  1E7P B;  1MHX A;  4ZHP A;  2L32 A;  4N6E B;  4MT5 A;  2HTM E;  4PT5 A;  4YTP B;  4KGS A;  2KAC A;  1ZE3 D;  3AE5 B;  1L4Z B;  2K9X A;  4A9A A;  3IT4 B;  5EE0 A;  3GS2 A;  3AV8 A;  1BUI C;  2GB1 A;  3MFG A;  1IGD A;  1JWM D;  1BML C;  1NEK B;  1XXG A;  1SBB B;  3GP7 A;  3J9C A;  3CWI A;  3HRD D;  2LEK A;  3AE2 B;  3N9Y C;  1JWS D;  2FE8 A;  2XN9 C;  4RGT A;  2VZK D;  4ARI A;  1XCQ L;  1E6E B;  4B0M A;  4WAF A;  1XEE A;  2JSV X;  3P63 A;  4ZRQ A;  1QT9 A;  1DGJ A;  4NAW B;  2R61 A;  1FMA D;  1TS3 A;  3NUH B;  4YT0 B;  4YXD B;  2WDV B;  2PLP A;  2YEP F;  4DXF A;  2K5P A;  2BT6 A;  1PGB A;  1GAQ B;  3IAM 1;  2BBC A;  1J7C A;  3AEE B;  3BK1 A;  3AN1 A;  3EUB 2;  3P4R B;  3BVZ A;  2DWQ A;  4LK0 M;  3MJ5 A;  3SFD B;  3TEZ A;  1TS5 A;  3BVG A;  1L0Y B;  1FNU A;  1STE A;  5I4D A;  3O13 A;  4ZRP A;  2QEJ C;  1YQ4 B;  1HQR D;  4UDU C;  1HZ6 A;  1C4P A;  1HXY D;  1M4V A;  2J52 A;  1KLG D;  1C78 A;  3KLS X;  2G9H D;  4RGO S;  1ZP0 B;  4YWG G;  2WU5 B;  3W5V B;  1RWS A;  2BW2 A;  4DXG A;  4IKG A;  1ZDV A;  1N63 A;  2I2Y A;  2EEL A;  2WXK A;  3EA6 A;  1WYG A;  1J7A A;  4XDD A;  3FAH A;  2BYT A;  2Y5P A;  1QOG A;  2RDH A;  2CJN A;  1OQR A;  2JU6 X;  2M19 A;  4XDC A;  1N61 A;  4RNA A;  5EE3 A;  1RFK A;  2WDR B;  2JYE A;  3Q8E A;  2RMM A;  1TZO A;  1YJJ A;  5BMI A;  3DWM A;  3Q8F A;  2N9K A;  3NVV A;  2JX5 A;  3PO0 A;  1HZ5 A;  1I4X A;  4NAM A;  4L23 A;  5HFY A;  2LMC A;  1CZP A;  2G1E A;  3E9S A;  1PGX A;  2SEB D;  4WUR A;  2HDE A;  2KN4 A;  1VZ6 A;  4DQO C;  3AM9 A;  1QKZ A;  1XLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...