4AWJA

Pvhl:elob:eloc complex, in complex with capped hydroxyproline
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
103
structure length
100
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADTFEALIEPFSSPPELPDVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting Fragment-Based Lead Discovery at the Von Hippel-Lindau Protein:Hypoxia Inducible Factor 1Alpha Protein-Protein Interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
total genus 22
structure length 100
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2012-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4awjA00
2RGFA 2KDEB 3WAOA 2QHOA 2AYOB 3K9PB 4IUMB 3TCAA 1GUAB 1X1MA 1WGYA 3OJ4B 1YIWA 2D10A 2KXJA 2K25A 2KWCA 4DDID 5JHBA 4LDTD 2LASA 3ZRFA 3NZUA 4AUQC 1WXMA 3D32A 4HWIB 1Q0WB 4EFOA 2M17A 2NPTB 4DDGD 2BWES 5JZEB 5DPRA 4FULA 1SE9A 2JXXA 3ZO5B 4NQLB 1G6JA 3A33B 3DBLI 1WH3A 1P1AA 1WXVA 4MJSB 2L00B 3ALBA 4W9FA 2FAZA 2LRUA 3QAQA 4KSKC 2LJ5A 3V62A 1Z2MA 2BGFA 1WX7A 2KLCA 2KTRA 3BINA 3R7RA 3PGEA 3DBRI 3RULA 2V4LA 3L08A 2AEHA 2XEWA 3PHXB 1WZ0A 1F9JA 1H4RA 4KDIC 4WQOB 4BOZB 1C3TA 2CS4A 4IM2A 1E8ZA 2FUHB 1TGZB 3QK0A 2KZRA 3AI5A 2NS5A 1T0YA 4IM3A 3DOWA 4KDLB 2KDBA 3HM6X 4GB9A 3NOBA 2ASQA 3RZFA 1V80A 3MHSD 4JIOU 3B0AA 1WJ4A 2KANA 3ZIMA 1I35A 5CTRC 2CR5A 2ZPYA 1WY8A 5C1ZA 2XK5B 3PRZA 4X57B 2LI5A 2O2VB 4KIKA 4TQ1A 2Z0EB 4W9GA 2V3SA 1ZW7A 2L0FA 5AZFA 1V2YA 1VCBA 2ZVOA 3CMMB 2UWQA 1WGRA 1NI2A 3DVNV 4JL9A 4NPNA 3EFUA 2M8SA 4ANWA 3H6NA 2EKEC 1TZ1A 3PZDA 2AL3A 5E6OA 4FHJA 2XBBC 3TMPB 3PVLA 3ECIA 3DPDA 2BWFA 3WANA 4GXBA 1V5TA 5LXIB 2KMAA 2N7EA 2BKFA 2MW5A 3ML9A 3QQ8B 4WWOA 1ISNA 3R3MA 3VDZA 4MGZE 1L7YA 2CHXA 1AARA 2GBKA 4FJVB 3U8ZA 3UIOB 1KJTA 1C1YB 3PT2B 2Z0DB 2JF5A 4G0NB 4HDQA 2MRPA 2D2QA 2IBIB 3IFWB 4JQWC 1EUVB 3DDCB 3IHPC 5E6NA 4M0WB 3ONSA 4KSLC 1OEYA 3APCA 3WAMA 3PSEB 3QX1A 3QARA 4HDOA 2KVRA 5JH5C 3GZNI 2K6QA 2DZMA 4IM0A 4XC2A 1UD7A 4GOCA 1GG3A 2KFKA 3N32A 1WI0A 3L54A 2GBNA 5JHAA 4GDLB 2IO3B 4HK2A 4HCPB 4MGYE 4XX5A 2RSUA 2WDTB 3MJWA 3VUXA 4BBNF 3C0RB 2KO3A 2WX1A 1P98A 2KHWB 4M8MA 2ZNVC 3ZNID 3OJ3A 3AU5A 1CMXB 1WGHA 4BBNC 2ZEQA 2RR9A 4B95A 2K1FA 4FLHA 2PJHA 3ENEA 1HE8A 4MGKE 1WIAA 3DCGA 3ZRCA 1UBQA 1GJZA 4IW0A 2HD5B 2LRWA 1WM2A 4TQ0A 4LCDE 2DZJA 4GMVA 4HPMB 4GU2A 4YL8A 2N1WA 4ZRKA 4ASWC 4BKTA 2ZVNA 3N30A 3M95A 1WGGA 1XQQA 4A3OA 5DPTA 2CU1A 3V60A 3VUWA 1J19A 1EO6A 1GC7A 4AJYB 1V81A 5KHQA 4PS7A 4HVBA 3W1SA 4CHKA 3RYTA 4I6LB 4AWJA 3PS6A 4MELA 3I3TB 3TJPA 5J2RA 3SU8X 2KTFA 1XD3B 3KVFB 4AJWA 4JLCA 2MBHA 2JRHA 2DZIA 2FIDA 4MJSA 5D7GA 1WXSA 2KDIA 2MSED 3VUYA 2ZNVB 3ZUNA 4DHJD 1WYWB 2DZKA 2XK5A 3KUZA 4W9EA 4G50A 2BF8B 3UGBB 3SDLC 2W9NA 2KK8A 2MA9B 4B6WA 2GOWA 1S3SG 4RMAA 3RD2A 3U30A 4FHKA 1LM8B 1XT9B 2PE6B 2O6VB 1Q1OA 1EF5A 1NDDA 5BO4B 3UINB 2J0JA 2IY1B 2V1YA 3NZSA 1M94A 5D94A 1E7VA 4IWPA 2PPHA 4N9F4 2LZ6A 4ANUA 4HXDA 2O6VA 3ZDMC 5L95C 3HM3A 3A9JB 4OVVA 5TR5A 2JZZA 3UIPB 2RPQA 3U7DA 3ZNZB 2MBQA 4W9JA 4B9KA 2FIFA 3V6EB 3ML8A 4KV2A 4BFRA 2L8JA 4E3CA 4MSMB 3A9KA 1V49A 3KW5B 2IZVB 3PTFC 1RAXA 2M0XA 1IYFA 1U4AA 3HK0A 3IG3A 2JT4B 2JZ3B 4DHZB 3IVFA 1WR6E 2LGXA 1WM3A 4EZJA 1D3ZA 3APDA 4K81A 4W9CA 2KDFB 2OJRA 3OLMD 2J0KA 4ANXA 2WWZA 5AZGA 2FCQA 4GN1A 4AP4C 3T8MA 2N1VA 2HJ8A 2JRIB 2KN5A 4GSWA 3QWZB 2UYZB 4MDKE 4FA6A 5DPWA 4ZYNA 4ICUA 4W9HA 2WX0A 3CSTA 4J6IA 1V86A 2CHWA 2I1JA 1E7UA 4W9LA 5C23A 4PS8A 4II2B 3KH0A 2DYBA 3VTWA 2MCNB 2HE7A 3AULA 5G2NA 5GMVA 1KOTA 2HTHA 5AZHA 4XZ4A 2DYMA 1GNUA 3O65B 4P7IA 4TKNA 1WGDA 2N4FA 2PE9A 1WX9A 3A1QB 2NR2A 3EC8A 4FBJB 2KJ6A 5DPSA 2WYQA 1P0RA 2ZJDA 2J7QB 3VXWA 2JWZA 2KJRA 1OGWA 3L10B 2MWSB 2NBUA 3DVNU 2FNJB 4WAAA 2LUEA 2L05A 5CHWA 1WFYA 3V61A 2KC2A 2KWUB 2MP2A 1PQSA 2KQSA 2O6VD 4DHZE 2L76A 4G3XB 3M62B 1BT0A 5D6JB 3RT3B 2GBRA 5CHFA 4W9DA 3JSVB 2BYFA 3Q3JA 2AWTA 4NQKE 3ZW3A 2R2QA 3A4SC 4FADA 1LQBA 4LJOB 1YD8U 4F8CB 2CHZA 4DXAB 4WWPA 5LLIA 4K7WA 1OEYJ 5EDSA 3H7PA 3KYCD 2K8CA 4NJ6A 3LJ3A 2RD0A 2JPHA 4K1RB 4BKSA 2KQ7A 2DAFA 3R66C 1SGHA 3NY5A 4FJYA 1FXTB 4ZDVA 3A4RA 5L83A 3W1SC 1E90A 2A4ZA 3H9DA 2KKCA 3H7SA 2BYEA 2G3QB 4A3PA 4EKUA 2JVCA 4IWQA 1WMHA 4LDTB 1EF1A 1Q5WB 4NAWB 3PRPB 2LXCA 4NNJB 4BVUC 1UGMA 3DBHI 2K8BA 4ZRIA 3ZLZA 5G55A 2LWPA 4NAWA 2N9EB 2KFKB 1YJ1A 3CSFA 4MH0E 3VH4B 1L2NA 4II3B 4NJ7A 4K7UA 4KIKB 3L16A 2REXA 1P3QU 3L17A 2G4DB 4HJKA 2DYOA 3K9OB 4GDKB 3HHMA 1WJNA 4PS3A 2K39A 5IAAC 2O2VA 3AXCA 4MM3A 4PYZA 4ANVA 5DCNA 5D2MB 1R4MI 2K8HA 4RM8A 1Z5SB 3QCAA 4K7SA 2MBBB 2GBMA 3EHVA 2N9PC 1P9DU 1MG8A 3A9KB 1H8CA 5LXHA 3N3KB 4I6NB 4KZ0A 3V6CB 2C5LC 1KLVA 2G4SA 2MBEA 2M4NA 3TL5A 4CYEA 4BOSC 3CF6E 4WJPA 4URKA 4F1SA 3UQBA 2Z59B 3SD5A 4RM9A 2C9WB 1ZKHA 3TBLD 4MSQB 5CHVC 1RLFA 2Y5BB 3DQVA 2ZPNA 4EEWA 3JYUA 4LJPB 4PYUA 1WJUA 3WAPA 2BKRB 3RCZA 3L0WB 4EUTA 3OAWA 2LGDA 1UBIA 2BYVE 3QC8B 3DBSA 2NBWB 3PLVA 3PV1A 2C7MB 3AU4A 2N7DA 1IPGA 2KLGA 5J18A 3KUCB 4WJNA 3VFKA 2MQJA 1LXDA 1RFAA 4KVGB 2GBJA 2J0MA 3B1LX 4ZRJA 4BKSD 3W1YA 2KMCA 2LVOA 3WA0A 2KWVB 4DHJB 4IG7B 1ZGUB 2L7RA 2LD9A 2BPSA 4I6PA 3KYDD 3X0WA 4FN2A 4FJZA 2AL6A 4W9KA 3Q3FA 4GIVA 3VTVA 1V5OA 1S1QB 2KFJA 2N9XA 3A9JA 3DVGY 5E6PA 4DWFA 2IO0B 5J17A 4CO7A 2KX0A 4ICVA 4M8NA 3MTNB 2FCMA 3PLUA 2KTRB 3R7QA 3WALA 1UELA 1J8CA 1E8XA 1E8WA 3T9LA 2IY0B 3ZKJC 3QHTA 1JRUA 3SHQA 4OVUA 3VTUA 3ZTDA 2NBVB 1I42A 2YLMA 2MLBA 1KM7A 2C7HA 2FCNA 3JVZX 3VAWA 2MX2A 1V6EA 2ZCCA 3PPAA 1WE6A 3QA8A 2K6DB 1LFDA 2DENB 2M1MA 1Y8RC 2LVQA 4DBGA 2KC1A 2JUOA 1YX5B 2L3ZA 3H7PB 3PHWB 5IA7A 1IP9A 3VQIA 1R4NI 1WR1A 2GMIC 5HKHA 3DVGX 1WE7A 2MBOA 1A5RA 2LVPA 3EECA 1J0GA 2A5UA 2C60A 2IYDB 1TBEA 1E8YA 2IO2B 2DX5B 1K8RB 1WXAA 3LDZE 1E5WA 4WJOA 1WJ6A 3RZWC 2R2OA 2KX3A 5CX3A 4HLEA 5FR6A 2I1KA 2G45B 4AOFA 2C7NB 3ZVVA 3ZDTA 2OOBB 2KOXA 3GOEA 3NS8A 1WMHB 3UF8A 2KJHB 3VH3B 3APFA 2DHZA 3QJZA 3VHTC 3PRMB 1WF9A 2LGYA 2EMTA 3UQAA 3VVWB 4MEMA 2CKHB 4BKGA 4IC7B 5AEKB 1V9JA 2PEAA 3X23A 2KD0A 2NPTA 3TIXA 4HCNB 3PREA 4EOYA 1WX8A 2ZCBA 3JW0X 3IBEA 4GDKA 3JSVA 4E74A 3P2BA 4IWOA 4TV3A 3H1UA 1VD2A 1GC6A 4JGHB 1RRBA 4WJQA 3ZTCA 3ZNGC 4G11A 1OQYA 4F7ZA 2B3AA 2IO1B 4WWNA 1UH6A 3QIJA 4GDLA 3ZNHB 2MP2B 4NY0A 4E71A 1WRDB 1YX6B 2L0TA 4EZKA 2D3GA 4KZCA 1OTRB 2LXAA 1SIFA 1WZ3A 3A1QA 4DK5A 4W9IA 4EZLA 3NHEB 2FCSA 2DAJA 3HIZA 4GGQA 3S2AA 1NBFC 1UZXB 2KNBA 5KHOA 3KUDB 4A20A 3M63B 1QZEA 2NVUI 1YQBA 2VRRB 4HPLB 3BY4B 2YVCA 4MGIE 2NCNA 3M3JA 2ZZPB 3B08A 2D11A 2EMSA 2D07B 3L13A 2JY6A 4TUUA 1TTNA 3RUIB 3WIMA
chains in the Genus database with same CATH superfamily
1QT9A 4YSXB 4K3BA 3ETRA 3R8BA 1WGYA 3OJ4B 2D10A 2L83A 3GE3C 3U7ZA 1WXMA 4KKIA 2M17A 2NPTB 2R61A 3W9CB 3ZQ4A 2BWES 2EKIA 5DPRA 1ESFA 4PK1A 1P1AA 2L00B 4W9FA 2FAZA 2LJ5A 5EE9A 3V62A 2ONQA 1TKYA 3I57A 1BMLC 2WXFA 3PGEA 2V4LA 2XEWA 1L0XB 1JWAD 1F9JA 4WQOB 2CS4A 4KDLB 1V80A 3ZIMA 4JIOU 4D2KA 1WJ4A 3CIRB 3O13A 2M56B 2WXMA 3FC4A 2MJDA 2LI5A 2O2VB 4TQ1A 2V3SA 2LGSA 5AZFA 1VCBA 1BUIC 1DGJA 2BQQA 2UWQA 2N9LA 1WGRA 4NPNA 2M8SA 4ANWA 1M4VA 4LNKA 1ZE3D 3ECIA 3W2DA 1V5TA 3NRZA 2VH2A 1HA5A 3R3MA 3UIOB 3PT2B 2Z0DB 1RYJA 2JF5A 2INDC 3IXSA 3Q14C 2HDEA 5AUIA 4M0WB 1Y56A 5FR3A 3PSEB 3QX1A 4MACA 4B0EA 3EUB2 1STEA 3GZNI 2K6QA 4IM0A 4GOCA 1GG3A 2KFKA 1WI0A 5MPOA 5G5HA 4XX5A 3VUXA 1L6VA 3BIID 3NJTA 4BBNF 3BWUD 2KHWB 3ZNID 1CMXB 2WLBA 3LYYA 2ZEQA 3P4RB 5C2TB 2PJHA 2QC8A 3ENEA 3DCGA 2LRWA 1WM2A 2QSDA 4TQ0A 3AECB 2J42A 2V9HA 4GMVA 4YL8A 4ZRKA 2ZVNA 4A3OA 5DPTA 3VUWA 2E6XA 1GC7A 1NVID 1V81A 3RYTA 1E7PB 4MELA 4US8A 1SE3A 4ZOHC 3SU8X 1XD3B 3KVFB 4JLCA 2JRHA 2MBHA 2KWDA 1TJEA 2ZNVB 4JWSC 3ZUNA 1LO5D 1VRAB 2DZKA 3RMKC 1I4GA 4G50A 3EA6A 4A8XC 2W9NA 2MA9B 4B6WA 1SJHD 3RD2A 1NDDA 3DHGC 2V1YA 1JWUD 5BMGA 2PPHA 2G9HD 3HM3A 1EWCA 4OVVA 4AS1A 4W9JA 2ACZB 3ML8A 4BFRA 2L8JA 1SE4A 2W55A 1IYFA 3RNEC 2V0GA 4K3CA 2LGXA 2KMMA 4USAA 3OLMD 2WWZA 1YJJA 2RDBC 4FA6A 2UYZB 1Q10A 3WCQA 4ZYNA 3Q69A 4ICUA 4W9HA 2KYWA 3CSTA 1V86A 3NVVA 1JROA 1EM7A 5C23A 3IAS1 5IOIA 1C78A 2INCC 2W3RA 1PDXA 1N5WA 3O65B 1GNUA 2PE9A 2WXQA 1XXGA 2NR2A 1FFVA 3KQ4A 3EGRA 3MC0B 1PFDA 3VXWA 2KJRA 1FM0D 4KX6B 4UDUC 2BBCA 2CJNA 2FBWB 4G3XB 1BT0A 3P1MA 3Q8BA 1FNUA 1I4RA 1HQRD 1YOVB 1SEBD 3Q3JA 2AWTA 4FADA 2R2QA 2Y3AA 1YD8U 3U4EG 5LLIA 5EDSA 1YN3A 3E9SA 3LJ3A 1C79A 2RD0A 3TUOA 4WH4A 1NEKB 1F2RI 3NY5A 4EE2A 3A4RA 1E90A 3H9DA 3H7SA 2QILA 1QLBB 1EU3A 2JVCA 3P4SB 2L52A 1SJED 4C80A 1UGMA 2K8BA 4ZRIA 5G55A 4NAWA 4MH0E 4K7UA 1KH0A 3K9OB 3HHMA 1SSNA 2K39A 4NZLB 4K7SA 2MBBB 3EHVA 2N9PC 2QJLA 3DBRB 3SR6A 3A9KB 3N3KB 2TSSA 2WDRB 2C5LC 4L2YA 3ZJTA 3CF6E 4WJPA 1MPEA 2C9WB 3TBLD 4MSQB 5CHVC 3AN1A 1R7SA 2ZPNA 3UI3A 3JYUA 4PYUA 1WJUA 4MH8A 2LGDA 4H2AA 3PLVA 4YTMB 3AEGB 2N7DA 4HKZE 4ZRJA 2E3TA 2KWVB 2AQ1B 4C7YA 2Y5PA 2BPSA 3AM9A 4L1BA 1T6BX 1V5OA 1S1QB 4LNOA 2KFJA 2MJ3A 2IO0B 4M8NA 3ABVB 2KTRB 2PKOA 3R7QA 1E8XA 1E8WA 1GOZA 3QHTA 1JRUA 3ZTDA 2BT6A 5TSSA 3N20C 2C7HA 3JVZX 2ZCCA 3BZDB 3QA8A 1A70A 2D3BA 2WXOA 2DENB 4HEA1 1F0ZA 3B9JA 1Y8RC 1KLUD 5IA7A 3KWLA 3PZ8A 1WR1A 1WWTA 4REZA 2MBOA 1A5RA 3I5JC 2LVPA 1J0GA 2A5UA 2IYDB 2KVZA 2KT7A 1TBEA 1E8YA 2J53A 2IO2B 3VRAB 2D5GA 4WJOA 3RZWC 2R2OA 4HLEA 2KOXA 3UF8A 2K5PA 3IT6B 2BYTA 3N9YC 2D3CA 3H8HA 2GB1A 3AMZA 1ET9A 3VVWB 3OG5A 2CKHB 2W3SA 4MEMA 4M00A 2NPTA 4M02A 3TIXA 1OQRA 3Q3MC 4EOYA 1ZXHA 1WX8A 2XN9C 3JW0X 4GDKA 3P2BA 4RF0A 1VD2A 1QOFA 1UNSA 3DWGC 4WJQA 4G11A 1OQYA 3J9CA 1IGCA 1ZUD2 3TSSA 3RN9C 2D3GA 4DK5A 1JQ4A 2FCSA 3U52E 2WHIA 4GGQA 4ARIA 5KHOA 3KUDB 2QEJC 2V4IB 3W5VB 5IP4D 2VRRB 5HI1A 1K53A 3TEXA 1I4PA 3HRDD 3RUIB 3N1XC 3Q3NC 2WXLA 5AUKA 2WXIA 4IUMB 3TCAA 1GUAB 1GAQB 2Y5CA 5JHBA 4LDTD 3GP7A 3NZUA 1Q0WB 1DYQA 4FULA 1SE9A 1G6JA 3DBLI 4XGAB 1WXVA 3ALBA 4KSKC 2WNMA 1V1OA 2KTRA 3BINA 3R7RA 3P42A 3DBRI 3L08A 4KDIC 2N0SB 1JWMD 5I4DA 2BS3B 3TEZA 3DOWA 3HM6X 4GB9A 3NOBA 3RZFA 3AE1B 2W54A 1ZDXA 1E10A 2CR5A 1NENB 5C1ZA 3OWEB 4KIKA 2JWUA 1V2YA 1TS5A 1T0QC 1WGKA 1NI2A 4QAYA 1VZ8A 3EFUA 2EKEC 2AL3A 2BWFA 3N1YC 2N7EA 2MW5A 3KLSX 3ML9A 5BYQA 1MG4A 4MGZE 2CHXA 2GBKA 3ZYYX 4LNNA 4G0NB 4HDQA 2IBIB 4JQWC 3IHPC 5E6NA 2JU6X 3SEBA 2PVOD 3AH7A 3URYA 2DZMA 1FCLA 1UD7A 1I4HA 3L54A 1XCQL 3AE9B 2RMMA 4PT5A 1SXTA 2WDTB 3MJWA 3C0RB 2WX1A 3OJ3A 4ZHOA 4ZYSA 2MEKA 2KACA 3ZRCA 1UBQA 1V8CA 2GI9A 4FXCA 4JE3B 1YN5A 4ASWC 4BKTA 2WXKA 1HZ5A 1HXYD 3GB1A 4JX1C 1SE2A 4AJYB 4HVBA 1DOXA 2BS4B 4OVZA 4C4VA 4MJSA 3BYTB 3VUYA 2MSED 4YSYB 4ACFA 1XLNA 1JWSD 1WYWB 4WWMA 4W9EA 5EE0A 4P6VF 3B2FA 3SDLC 4FHKA 2O6VB 1EF5A 5BO4B 2AQ3B 4IWPA 2LZ6A 5E6JA 4HXDA 3NG0A 3A9JB 5TR5A 1F52A 1ROEA 1TIFA 3A9KA 1V49A 1RAXA 1XO3A 2LHDA 1PUTA 2X38A 3HK0A 3IG3A 2JT4B 1PGBA 1D4BA 1WR6E 2PMVA 4W9CA 1K51A 2KDFB 2OJRA 4P1BC 2J0KA 3TEWA 2N9KA 3LXFA 2MHJA 2DNFA 1N61A 3QWZB 1SIJA 2AQ2B 4J6IA 4XDDA 1V97A 3VTWA 2HE7A 3AULA 5G2NA 5GMVA 2HTHA 4YT0B 2OEDA 3T3OA 2VH1A 2DYMA 2N4FA 3HVDA 2JX5A 2KJ6A 1AW7A 2ZJDA 1OGWA 3DVNU 2LUEA 1TY0A 5CHWA 3V61A 4IOIE 2KWUB 2MP2A 2KQSA 1MHXA 2L76A 2KN4A 3RT3B 2WXNA 2V3PA 5BYSA 1GB1A 2CHZA 4DXAB 3Q8CA 3IAM1 3H7PA 4NJ6A 4BKSA 2DAFA 1SGHA 4ZDVA 1FXTB 4N6EB 3W1SC 1UWXA 1ACCA 4EKUA 2BB6A 3SFDB 2JXTA 1WMHA 1JALA 4A6QA 4RH6A 1Q5WB 1IBXB 2LXCA 4NNJB 1C4AA 2IGGA 3NVZA 3Q2AC 3L16A 1TY2A 4MM3A 4PYZA 1I4QA 5DCNA 5D2MB 1R4MI 1CQVA 2OHFA 2FE8A 3QCAA 1P9DU 2M0AA 2RDHA 5FKAC 1MG8A 1H8CA 5LXHA 1TT5B 2GRIA 1KLVA 2G4SA 3L4PA 2MBEA 3PO0A 3UQBA 4F1SA 1PGAA 3SD5A 1HTQA 2EELA 2Y5BB 3L0WB 3OAWA 2NBWB 1VJKA 2C7MB 2WXHA 1IPGA 3KUCB 4KVGB 2J0MA 4OZCA 4BKSD 3U2SC 3W1YA 3WA0A 3PZ7A 4OW0A 2ZW0A 2N9XA 2WQYB 1UUPA 4DWFA 4ICVA 1P7EA 3MTNB 3WALA 1UELA 4WQMA 3RNGC 3T9LA 2IY0B 3ZKJC 1I42A 4OVUA 3VTUA 2YLMA 1AN8A 1KRHA 1LGRA 5FK9C 3MC8A 3VAWA 2MX2A 4RCOA 1B1ZA 3FILA 1D5ZC 1ET6A 1LFDA 1JWBD 2LVQA 3FKYA 4DBGA 2L3ZA 1YX5B 3PHWB 2D3AA 3P4PB 1IP9A 4S17A 5HKHA 3I9V1 1WXAA 2AX5A 2MJEA 1FMAD 4OZAA 4AOFA 4C56C 3ZVVA 3ZDTA 2DBYA 1RFKA 1WMHB 2KJHB 4CQNA 1FRDA 2LGYA 2EMTA 5D3IB 1QF6A 1ZXIA 2VZKB 3X23A 3ZGZA 4HCNB 3PREA 2NMQA 4E74A 3JSVA 3MHZA 2INPE 3H1UA 4TV3A 1GC6A 4JGHB 1RRBA 2IO1B 4WWNA 4GDLA 3QIJA 5H8YE 3ZNHB 2MP2B 4E71A 4EZKA 1EWYC 2LXAA 1SIFA 1QOAA 3NHEB 3HIZA 3S2AA 1NBFC 2KNBA 5G5GA 1YN4A 2J4XA 1TZOA 3M63B 1YQBA 3T3NA 2YVCA 3M3JA 2RDGA 2INNE 3AEDB 3LB8C 2JY6A 1FNWA 4ZRQA 3WAOA 2AYOB 3K9PB 1N5XA 4Q2JA 1X1MA 2KXJA 2K25A 2KWCA 2LASA 5IO9A 3ZRFA 2KQ4X 3D32A 4HWIB 1F1HA 5JZEB 2BW2A 3ZO5B 1C76A 4NQLB 3A33B 1WH3A 3TEYA 1OQQA 3QAQA 1JMLA 4BAXA 1Z2MA 4A90A 1WX7A 1C77A 3PHXB 1WZ0A 1H4RA 4BOZB 5HG2A 4IM2A 3RNBC 1TGZB 3R2IA 3QK0A 1XLQA 3AI5A 2NS5A 1T0YA 4IM3A 2KDBA 1ZOYB 3MHSD 3B0AA 2KANA 1FD6A 1KF6B 1I35A 5CTRC 1K52A 3PRZA 1L4DB 2SEBD 3RNCC 2MH7A 1J7BA 1ZW7A 1T0SC 1C4CA 2ZVOA 2CJOA 4JL9A 3H6NA 1TZ1A 3RI7C 5E6OA 2XBBC 5EE1A 1RM6C 3WANA 4GXBA 2WDVB 3AE2B 5LXIB 1L7YA 1KJTA 3BVGA 3AEFB 1JRPA 1C1YB 2D2QA 2MRPA 3IFWB 3ONSA 4DXFA 4KSLC 4HDOA 1E6EB 2KVRA 1FFUA 4XC2A 4LNFA 4ZHPA 3ZJVA 2GBNA 3ZJUA 2IO3B 4NJCA 3VR9B 3AE8B 4KKJA 1P98A 2ZNVC 4HRSA 2DWQA 3AU5A 4MT5A 2K1FA 4FLHA 5C3JB 1HE8A 1WIAA 1GJZA 2HD5B 5GXGB 2DZJA 2LGIA 1SF0A 1WGGA 1XQQA 2CU1A 3V60A 1J19A 5KHQA 3RPFC 4DXGA 1EU4A 4AWJA 3PS6A 3I3TB 2KTFA 4AJWA 1GPXA 1WXSA 2KDIA 2W82A 4NAMA 2XK5A 3KUZA 1IUEA 3UGBB 2KK8A 2GOWA 1S3SG 3DWMA 3U30A 1LM8B 4A9AA 1VDVA 3UINB 2J0JA 4P16A 3NZSA 1M94A 1FXIA 4N9F4 3ZDMC 2K9XA 2JZZA 3UIPB 2RPQA 2FIFA 3V6EB 4KV2A 4MSMB 4BZAA 4HROA 3KW5B 2IZVB 3R2TA 1ZDVA 5HFYA 2PIAA 4ITKA 3AE3B 2JZ3B 1FIQA 1KFYB 3IVFA 1WM3A 2IDYA 1D3ZA 3APDA 2WU5B 1RWSA 5AZGA 4GN1A 4RGNA 3T8MA 2N1VA 1TKGA 4MDKE 1VZ6A 2CHWA 2I1JA 4WURA 2UU7A 3BK1A 4II2B 2DYBA 2MCNB 3DBHB 3I63C 2JQRB 1E9MA 1KOTA 4P7IA 1J7AA 4TKNA 4OZBA 1WX9A 3A1QB 1T0RC 1SBBB 2BB5A 2WYQA 1P0RA 1FXAA 3BK2A 1MVKA 2J7QB 2YEPF 3L10B 2MWSB 4WAAA 2L05A 1WFYA 4XWWA 3Q8AA 2SAKA 3ZW3A 4NQKE 1LQBA 2FUG1 4LJOB 4F8CB 1MJDA 2ON8A 4K7WA 3KYCD 2K8CA 2IPKD 4K1RB 3R66C 3HUIA 4RGTA 4RF1A 1WRIA 5T8IA 5L83A 2A4ZA 2KKCA 4A3PA 3AE7B 4IWQA 4LDTB 1EF1A 3BVMA 4NAWB 5BMHA 1L5PA 4BVUC 2Q5WD 3DBHI 3ZLZA 1TYGB 3CSFA 3VH4B 2WXPA 4NJ7A 1YQ4B 2QIEB 2G4DB 4HJKA 2DYOA 1N63A 1WJNA 4PS3A 2WXJA 1C4PA 1FRRA 2K8HA 4RM8A 1Z5SB 1YJIA 3NUHB 2GBMA 1WXQA 2ZW1A 4KZ0A 3V6CB 2M4NA 3CWIA 4IDIA 1R4NB 1XLPA 1KTKA 1D5MC 3NS1A 1VLBA 1R4MB 4EEWA 1T3QA 1UF0A 1YQ3B 3WAPA 2BKRB 2BYVE 4JWUC 1J7CA 2LJIA 2KLGA 5J18A 4WJNA 3VFKA 2MQJA 1LXDA 2GBJA 2XNAC 2KMCA 5BYRA 4DHJB 3NVWA 1HEZE 1ZGUB 4A55A 2QDFA 4I6PA 3KYDD 1TS4A 1FEHA 2AL6A 4W9KA 3VTVA 2N7JA 3A9JA 3DVGY 2CU3A 2Z8LA 3V3XA 4WAFA 2WP9B 1J8CA 4YWGG 2K3UA 2MLBA 1KM7A 2FCNA 3W5UB 1BXTA 3PPAA 2K6DB 4RGOS 1PGXA 2M1MA 2VZKD 2JUOA 3H7PB 3VQIA 1R4NI 1ENFA 1UGJA 4AQ7A 3EECA 2C60A 2WDQB 2DX5B 1AYFA 4C7ZA 2KX3A 5CX3A 2C7NB 3GOEA 3NS8A 3VH3B 2DHZA 3Q3OC 3PRMB 1WF9A 1D6EC 4RFBA 4B0MA 5AEKB 1V9JA 2KD0A 1D5XC 2ZCBA 3IBEA 4IWOA 1FNVA 1DOYA 1FCCC 1N60A 3ZTCA 3ZNGC 4F7ZA 2B3AA 1L6UA 1UH6A 1WRDB 1YX6B 1F77A 1QQRA 1WZ3A 4EZLA 5LNK1 1UZXB 4TMAB 4A20A 4WIPA 3VR8B 1B9RA 2NCNA 2ZZPB 2WXRA 1ZP0B 3L13A 4RM9A 2LFIA 1IGDA 4GLSC 2RGFA 2KDEB 3AE5B 3VRBB 2QHOA 3GS2A 1QKZA 1YIWA 2JZPA 3GE8C 1JW9D 4KGSA 4DDID 4AUQC 4KGRA 4EFOA 4S0RA 4DDGD 1XCTL 2L32A 2JXXA 1HZ6A 4MJSB 2LRUA 2BGFA 1P7FA 2KLCA 3RULA 2AEHA 3P63A 2I2YA 1C3TA 5BMIA 1E8ZA 2FUHB 1KLGD 2KZRA 2HTME 3AB5A 2ASQA 1HTOA 4MM3B 2ZPYA 1WY8A 2XK5B 4X57B 4W9GA 2Z0EB 1C9FA 2L0FA 4RGMA 3CMMB 1MFWA 4LTUA 3DVNV 1IBXA 1OFFA 3PZDA 1TKEA 4FHJA 3TMPB 1PYWD 3PVLA 3DPDA 2KMAA 2BKFA 3SFEB 3QQ8B 1N6ZA 4WWOA 1ISNA 3VDZA 5EE3A 1AARA 3U8ZA 4FJVB 2DLBA 1EUVB 3DDCB 1V1PA 2M19A 5HHDG 3HVZA 1OEYA 3APCA 3WAMA 3QARA 2K22A 4C00A 5JH5C 3EFCA 2LMCA 3C19A 1VR9A 3N32A 3DHIC 5JHAA 4GDLB 2BVCA 1GB4A 4HK2A 4HCPB 4MGYE 2B76B 2RSUA 4LK0M 2KO3A 1V1PB 1I7HA 4M8MA 2KAJA 1YMHE 1WGHA 4BBNC 2RR9A 4B95A 1F2RC 1FO4A 1CZPA 2PTLA 4ARCA 4MGKE 3MC9A 4XYCA 4IW0A 2KDMA 2BS2B 2YEPB 4LCDE 4RNAA 4HPMB 4GU2A 2N1WA 3FAHA 3N30A 3M95A 1EO6A 4L23A 4IKGA 3E56A 4PS7A 3W1SA 4CHKA 1XLOA 4I6LB 3TJPA 5J2RA 1TS2A 1WYGA 2V3NA 2DZIA 2FIDA 5D7GA 3AE6B 2J52A 4DHJD 1SB3C 1XEEA 2BF8B 5IN7A 4RMAA 1AWDA 1XT9B 2PE6B 1Q1OA 3ZXRA 2ICIA 1WSPA 2JYTA 2WXGA 4M01A 2IY1B 2LEKA 5D94A 1E7VA 2RPVA 4ANUA 2O6VA 5L95C 4N59A 3ZNZB 3U7DA 2MBQA 4B9KA 4E3CA 1I4XA 3AV8A 3PTFC 2M0XA 1YNTE 1U4AA 4DHZB 4EZJA 2OJWA 2H89B 4K81A 1NYRA 4ANXA 2FCQA 4AP4C 3RNAC 2HJ8A 2JRIB 2KN5A 4GSWA 5DPWA 2QCZA 2PW9A 1VZ7A 2WX0A 1E7UA 4W9LA 4PS8A 1UWMA 3KH0A 1ZPSA 3P4QB 3DHHC 4OHJA 5AZHA 4XZ4A 1WGDA 2G1EA 3IT4B 1XF5L 3EC8A 2L1AA 4FBJB 5DPSA 1QILA 2JWZA 2NBUA 2FNJB 2IGDA 2KC2A 1PQSA 4LLGM 2O6VD 4DHZE 1MI0A 1CJEA 3M62B 5D6JB 2GBRA 5CHFA 4W9DA 2PLPA 1TS3A 2BYFA 3JSVB 3A4SC 2WS3B 2LUMA 2IJ0A 4TSSA 4WWPA 1OEYJ 2JPHA 3ZXVA 2KQ7A 4FJYA 2NTSA 5H92C 2BYEA 4O1NA 2G3QB 4XWTA 1E0ZA 5D3DA 4C4VB 3PRPB 4YTNB 1CK1A 1L0YB 3C8YA 2LWPA 2N9EB 2KFKB 1YJ1A 3Q8FA 1L2NA 4LNIA 4II3B 4KIKB 2REXA 1P3QU 3L17A 4J3OD 4GDKB 3Q6BA 5IAAC 2O2VA 4M0WA 3AXCA 3MFGA 4ANVA 1K50A 3MJ5A 3FILB 4R3DA 4I6NB 4N58A 2I38A 3NVYA 3TL5A 4CYEA 4BOSC 4URKA 2Z59B 2BTEA 1ZKHA 1RLFA 3DQVA 5JXVA 4YXDB 4LJPB 1L4ZB 3RCZA 2HJ1A 4EUTA 1UBIA 3QC8B 3DBSA 3PV1A 3AU4A 1RFAA 4ZRPA 2JYEA 1JCKB 3B1LX 1DOIA 2LVOA 5IKCM 4XE0A 2QMTA 3B2GA 4IG7B 2L7RA 2LD9A 4XDCA 3X0WA 4FN2A 4FJZA 3Q3FA 4GIVA 2NTTA 5E6PA 2GLSA 3BYYB 1N62A 3GZNB 5J17A 2K0PA 4CO7A 3RNFC 2KX0A 2FCMA 3PLUA 3SHQA 3Q8EA 3NZ3A 2NBVB 4YSZB 2PVGC 4HPPA 4KGTA 4DQOC 1V6EA 4US9A 1WE6A 3MP9A 1L0VB 2KC1A 1NYQA 2GMIC 3AEAB 3KWVA 3DVGX 1WE7A 2WU2B 2H88B 1K8RB 3LDZE 1E5WA 1WJ6A 5FR6A 2I1KA 2G45B 2X8XX 3V05A 2OOBB 1NI3A 3APFA 3QJZA 3VHTC 1T5XD 3UQAA 4BKGA 4IC7B 2PEAA 1QOBA 3BVZA 2IGHA 4JPSA 4HJGE 3DBLB 4HKQA 4YTPB 1FPYA 3RFZB 1MHHE 1QOGA 2JSVX 4NY0A 2L0TA 4KZCA 1OTRB 3A1QA 4W9IA 2DAJA 4P1CC 1QZEA 2NVUI 4HPLB 3BY4B 4MGIE 3B08A 3AEEB 2D11A 3AEBB 2LHEA 2EMSA 2D07B 3AE4B 4TUUA 3WIMA 1TTNA 2WGSA 3N1ZC
chains in the Genus database with same CATH topology
2RGFA 2KDEB 3WAOA 2QHOA 2AYOB 3K9PB 4IUMB 3TCAA 1GUAB 1X1MA 1WGYA 3OJ4B 1YIWA 2D10A 2KXJA 2K25A 2KWCA 4DDID 5JHBA 4LDTD 2LASA 3ZRFA 3NZUA 4AUQC 1WXMA 3D32A 4HWIB 1Q0WB 4EFOA 2M17A 2NPTB 4DDGD 2BWES 5JZEB 5DPRA 4FULA 1SE9A 2JXXA 3ZO5B 4NQLB 1G6JA 3A33B 3DBLI 1WH3A 1P1AA 1WXVA 4MJSB 2L00B 3ALBA 4W9FA 2FAZA 2LRUA 3QAQA 4KSKC 2LJ5A 3V62A 1Z2MA 2BGFA 1WX7A 2KLCA 2KTRA 3BINA 3R7RA 3PGEA 3DBRI 3RULA 2V4LA 3L08A 2AEHA 2XEWA 3PHXB 1WZ0A 1F9JA 1H4RA 4KDIC 4WQOB 4BOZB 1C3TA 2CS4A 4IM2A 1E8ZA 2FUHB 1TGZB 3QK0A 2KZRA 3AI5A 2NS5A 1T0YA 4IM3A 3DOWA 4KDLB 2KDBA 3HM6X 4GB9A 3NOBA 2ASQA 3RZFA 1V80A 3MHSD 4JIOU 3B0AA 1WJ4A 2KANA 3ZIMA 1I35A 5CTRC 2CR5A 2ZPYA 1WY8A 5C1ZA 2XK5B 3PRZA 4X57B 2LI5A 2O2VB 4KIKA 4TQ1A 2Z0EB 4W9GA 2V3SA 1ZW7A 2L0FA 5AZFA 1V2YA 1VCBA 2ZVOA 3CMMB 2UWQA 1WGRA 1NI2A 3DVNV 4JL9A 4NPNA 3EFUA 2M8SA 4ANWA 3H6NA 2EKEC 1TZ1A 3PZDA 2AL3A 5E6OA 4FHJA 2XBBC 3TMPB 3PVLA 3ECIA 3DPDA 2BWFA 3WANA 4GXBA 1V5TA 5LXIB 2KMAA 2N7EA 2BKFA 2MW5A 3ML9A 3QQ8B 4WWOA 1ISNA 3R3MA 3VDZA 4MGZE 1L7YA 2CHXA 1AARA 2GBKA 4FJVB 3U8ZA 3UIOB 1KJTA 1C1YB 3PT2B 2Z0DB 2JF5A 4G0NB 4HDQA 2MRPA 2D2QA 2IBIB 3IFWB 4JQWC 1EUVB 3DDCB 3IHPC 5E6NA 4M0WB 3ONSA 4KSLC 1OEYA 3APCA 3WAMA 3PSEB 3QX1A 3QARA 4HDOA 2KVRA 5JH5C 3GZNI 2K6QA 2DZMA 4IM0A 4XC2A 1UD7A 4GOCA 1GG3A 2KFKA 3N32A 1WI0A 3L54A 2GBNA 5JHAA 4GDLB 2IO3B 4HK2A 4HCPB 4MGYE 4XX5A 2RSUA 2WDTB 3MJWA 3VUXA 4BBNF 3C0RB 2KO3A 2WX1A 1P98A 2KHWB 4M8MA 2ZNVC 3ZNID 3OJ3A 3AU5A 1CMXB 1WGHA 4BBNC 2ZEQA 2RR9A 4B95A 2K1FA 4FLHA 2PJHA 3ENEA 1HE8A 4MGKE 1WIAA 3DCGA 3ZRCA 1UBQA 1GJZA 4IW0A 2HD5B 2LRWA 1WM2A 4TQ0A 4LCDE 2DZJA 4GMVA 4HPMB 4GU2A 4YL8A 2N1WA 4ZRKA 4ASWC 4BKTA 2ZVNA 3N30A 3M95A 1WGGA 1XQQA 4A3OA 5DPTA 2CU1A 3V60A 3VUWA 1J19A 1EO6A 1GC7A 4AJYB 1V81A 5KHQA 4PS7A 4HVBA 3W1SA 4CHKA 3RYTA 4I6LB 4AWJA 3PS6A 4MELA 3I3TB 3TJPA 5J2RA 3SU8X 2KTFA 1XD3B 3KVFB 4AJWA 4JLCA 2MBHA 2JRHA 2DZIA 2FIDA 4MJSA 5D7GA 1WXSA 2KDIA 2MSED 3VUYA 2ZNVB 3ZUNA 4DHJD 1WYWB 2DZKA 2XK5A 3KUZA 4W9EA 4G50A 2BF8B 3UGBB 3SDLC 2W9NA 2KK8A 2MA9B 4B6WA 2GOWA 1S3SG 4RMAA 3RD2A 3U30A 4FHKA 1LM8B 1XT9B 2PE6B 2O6VB 1Q1OA 1EF5A 1NDDA 5BO4B 3UINB 2J0JA 2IY1B 2V1YA 3NZSA 1M94A 5D94A 1E7VA 4IWPA 2PPHA 4N9F4 2LZ6A 4ANUA 4HXDA 2O6VA 3ZDMC 5L95C 3HM3A 3A9JB 4OVVA 5TR5A 2JZZA 3UIPB 2RPQA 3U7DA 3ZNZB 2MBQA 4W9JA 4B9KA 2FIFA 3V6EB 3ML8A 4KV2A 4BFRA 2L8JA 4E3CA 4MSMB 3A9KA 1V49A 3KW5B 2IZVB 3PTFC 1RAXA 2M0XA 1IYFA 1U4AA 3HK0A 3IG3A 2JT4B 2JZ3B 4DHZB 3IVFA 1WR6E 2LGXA 1WM3A 4EZJA 1D3ZA 3APDA 4K81A 4W9CA 2KDFB 2OJRA 3OLMD 2J0KA 4ANXA 2WWZA 5AZGA 2FCQA 4GN1A 4AP4C 3T8MA 2N1VA 2HJ8A 2JRIB 2KN5A 4GSWA 3QWZB 2UYZB 4MDKE 4FA6A 5DPWA 4ZYNA 4ICUA 4W9HA 2WX0A 3CSTA 4J6IA 1V86A 2CHWA 2I1JA 1E7UA 4W9LA 5C23A 4PS8A 4II2B 3KH0A 2DYBA 3VTWA 2MCNB 2HE7A 3AULA 5G2NA 5GMVA 1KOTA 2HTHA 5AZHA 4XZ4A 2DYMA 1GNUA 3O65B 4P7IA 4TKNA 1WGDA 2N4FA 2PE9A 1WX9A 3A1QB 2NR2A 3EC8A 4FBJB 2KJ6A 5DPSA 2WYQA 1P0RA 2ZJDA 2J7QB 3VXWA 2JWZA 2KJRA 1OGWA 3L10B 2MWSB 2NBUA 3DVNU 2FNJB 4WAAA 2LUEA 2L05A 5CHWA 1WFYA 3V61A 2KC2A 2KWUB 2MP2A 1PQSA 2KQSA 2O6VD 4DHZE 2L76A 4G3XB 3M62B 1BT0A 5D6JB 3RT3B 2GBRA 5CHFA 4W9DA 3JSVB 2BYFA 3Q3JA 2AWTA 4NQKE 3ZW3A 2R2QA 3A4SC 4FADA 1LQBA 4LJOB 1YD8U 4F8CB 2CHZA 4DXAB 4WWPA 5LLIA 4K7WA 1OEYJ 5EDSA 3H7PA 3KYCD 2K8CA 4NJ6A 3LJ3A 2RD0A 2JPHA 4K1RB 4BKSA 2KQ7A 2DAFA 3R66C 1SGHA 3NY5A 4FJYA 1FXTB 4ZDVA 3A4RA 5L83A 3W1SC 1E90A 2A4ZA 3H9DA 2KKCA 3H7SA 2BYEA 2G3QB 4A3PA 4EKUA 2JVCA 4IWQA 1WMHA 4LDTB 1EF1A 1Q5WB 4NAWB 3PRPB 2LXCA 4NNJB 4BVUC 1UGMA 3DBHI 2K8BA 4ZRIA 3ZLZA 5G55A 2LWPA 4NAWA 2N9EB 2KFKB 1YJ1A 3CSFA 4MH0E 3VH4B 1L2NA 4II3B 4NJ7A 4K7UA 4KIKB 3L16A 2REXA 1P3QU 3L17A 2G4DB 4HJKA 2DYOA 3K9OB 4GDKB 3HHMA 1WJNA 4PS3A 2K39A 5IAAC 2O2VA 3AXCA 4MM3A 4PYZA 4ANVA 5DCNA 5D2MB 1R4MI 2K8HA 4RM8A 1Z5SB 3QCAA 4K7SA 2MBBB 2GBMA 3EHVA 2N9PC 1P9DU 1MG8A 3A9KB 1H8CA 5LXHA 3N3KB 4I6NB 4KZ0A 3V6CB 2C5LC 1KLVA 2G4SA 2MBEA 2M4NA 3TL5A 4CYEA 4BOSC 3CF6E 4WJPA 4URKA 4F1SA 3UQBA 2Z59B 3SD5A 4RM9A 2C9WB 1ZKHA 3TBLD 4MSQB 5CHVC 1RLFA 2Y5BB 3DQVA 2ZPNA 4EEWA 3JYUA 4LJPB 4PYUA 1WJUA 3WAPA 2BKRB 3RCZA 3L0WB 4EUTA 3OAWA 2LGDA 1UBIA 2BYVE 3QC8B 3DBSA 2NBWB 3PLVA 3PV1A 2C7MB 3AU4A 2N7DA 1IPGA 2KLGA 5J18A 3KUCB 4WJNA 3VFKA 2MQJA 1LXDA 1RFAA 4KVGB 2GBJA 2J0MA 3B1LX 4ZRJA 4BKSD 3W1YA 2KMCA 2LVOA 3WA0A 2KWVB 4DHJB 4IG7B 1ZGUB 2L7RA 2LD9A 2BPSA 4I6PA 3KYDD 3X0WA 4FN2A 4FJZA 2AL6A 4W9KA 3Q3FA 4GIVA 3VTVA 1V5OA 1S1QB 2KFJA 2N9XA 3A9JA 3DVGY 5E6PA 4DWFA 2IO0B 5J17A 4CO7A 2KX0A 4ICVA 4M8NA 3MTNB 2FCMA 3PLUA 2KTRB 3R7QA 3WALA 1UELA 1J8CA 1E8XA 1E8WA 3T9LA 2IY0B 3ZKJC 3QHTA 1JRUA 3SHQA 4OVUA 3VTUA 3ZTDA 2NBVB 1I42A 2YLMA 2MLBA 1KM7A 2C7HA 2FCNA 3JVZX 3VAWA 2MX2A 1V6EA 2ZCCA 3PPAA 1WE6A 3QA8A 2K6DB 1LFDA 2DENB 2M1MA 1Y8RC 2LVQA 4DBGA 2KC1A 2JUOA 1YX5B 2L3ZA 3H7PB 3PHWB 5IA7A 1IP9A 3VQIA 1R4NI 1WR1A 2GMIC 5HKHA 3DVGX 1WE7A 2MBOA 1A5RA 2LVPA 3EECA 1J0GA 2A5UA 2C60A 2IYDB 1TBEA 1E8YA 2IO2B 2DX5B 1K8RB 1WXAA 3LDZE 1E5WA 4WJOA 1WJ6A 3RZWC 2R2OA 2KX3A 5CX3A 4HLEA 5FR6A 2I1KA 2G45B 4AOFA 2C7NB 3ZVVA 3ZDTA 2OOBB 2KOXA 3GOEA 3NS8A 1WMHB 3UF8A 2KJHB 3VH3B 3APFA 2DHZA 3QJZA 3VHTC 3PRMB 1WF9A 2LGYA 2EMTA 3UQAA 3VVWB 4MEMA 2CKHB 4BKGA 4IC7B 5AEKB 1V9JA 2PEAA 3X23A 2KD0A 2NPTA 3TIXA 4HCNB 3PREA 4EOYA 1WX8A 2ZCBA 3JW0X 3IBEA 4GDKA 3JSVA 4E74A 3P2BA 4IWOA 4TV3A 3H1UA 1VD2A 1GC6A 4JGHB 1RRBA 4WJQA 3ZTCA 3ZNGC 4G11A 1OQYA 4F7ZA 2B3AA 2IO1B 4WWNA 1UH6A 3QIJA 4GDLA 3ZNHB 2MP2B 4NY0A 4E71A 1WRDB 1YX6B 2L0TA 4EZKA 2D3GA 4KZCA 1OTRB 2LXAA 1SIFA 1WZ3A 3A1QA 4DK5A 4W9IA 4EZLA 3NHEB 2FCSA 2DAJA 3HIZA 4GGQA 3S2AA 1NBFC 1UZXB 2KNBA 5KHOA 3KUDB 4A20A 3M63B 1QZEA 2NVUI 1YQBA 2VRRB 4HPLB 3BY4B 2YVCA 4MGIE 2NCNA 3M3JA 2ZZPB 3B08A 2D11A 2EMSA 2D07B 3L13A 2JY6A 4TUUA 1TTNA 3RUIB 3WIMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RGF A;  2KDE B;  3WAO A;  2QHO A;  2AYO B;  3K9P B;  4IUM B;  3TCA A;  1GUA B;  1X1M A;  1WGY A;  3OJ4 B;  1YIW A;  2D10 A;  2KXJ A;  2K25 A;  2KWC A;  4DDI D;  5JHB A;  4LDT D;  2LAS A;  3ZRF A;  3NZU A;  4AUQ C;  1WXM A;  3D32 A;  4HWI B;  1Q0W B;  4EFO A;  2M17 A;  2NPT B;  4DDG D;  2BWE S;  5JZE B;  5DPR A;  4FUL A;  1SE9 A;  2JXX A;  3ZO5 B;  4NQL B;  1G6J A;  3A33 B;  3DBL I;  1WH3 A;  1P1A A;  1WXV A;  4MJS B;  2L00 B;  3ALB A;  4W9F A;  2FAZ A;  2LRU A;  3QAQ A;  4KSK C;  2LJ5 A;  3V62 A;  1Z2M A;  2BGF A;  1WX7 A;  2KLC A;  2KTR A;  3BIN A;  3R7R A;  3PGE A;  3DBR I;  3RUL A;  2V4L A;  3L08 A;  2AEH A;  2XEW A;  3PHX B;  1WZ0 A;  1F9J A;  1H4R A;  4KDI C;  4WQO B;  4BOZ B;  1C3T A;  2CS4 A;  4IM2 A;  1E8Z A;  2FUH B;  1TGZ B;  3QK0 A;  2KZR A;  3AI5 A;  2NS5 A;  1T0Y A;  4IM3 A;  3DOW A;  4KDL B;  2KDB A;  3HM6 X;  4GB9 A;  3NOB A;  2ASQ A;  3RZF A;  1V80 A;  3MHS D;  4JIO U;  3B0A A;  1WJ4 A;  2KAN A;  3ZIM A;  1I35 A;  5CTR C;  2CR5 A;  2ZPY A;  1WY8 A;  5C1Z A;  2XK5 B;  3PRZ A;  4X57 B;  2LI5 A;  2O2V B;  4KIK A;  4TQ1 A;  2Z0E B;  4W9G A;  2V3S A;  1ZW7 A;  2L0F A;  5AZF A;  1V2Y A;  1VCB A;  2ZVO A;  3CMM B;  2UWQ A;  1WGR A;  1NI2 A;  3DVN V;  4JL9 A;  4NPN A;  3EFU A;  2M8S A;  4ANW A;  3H6N A;  2EKE C;  1TZ1 A;  3PZD A;  2AL3 A;  5E6O A;  4FHJ A;  2XBB C;  3TMP B;  3PVL A;  3ECI A;  3DPD A;  2BWF A;  3WAN A;  4GXB A;  1V5T A;  5LXI B;  2KMA A;  2N7E A;  2BKF A;  2MW5 A;  3ML9 A;  3QQ8 B;  4WWO A;  1ISN A;  3R3M A;  3VDZ A;  4MGZ E;  1L7Y A;  2CHX A;  1AAR A;  2GBK A;  4FJV B;  3U8Z A;  3UIO B;  1KJT A;  1C1Y B;  3PT2 B;  2Z0D B;  2JF5 A;  4G0N B;  4HDQ A;  2MRP A;  2D2Q A;  2IBI B;  3IFW B;  4JQW C;  1EUV B;  3DDC B;  3IHP C;  5E6N A;  4M0W B;  3ONS A;  4KSL C;  1OEY A;  3APC A;  3WAM A;  3PSE B;  3QX1 A;  3QAR A;  4HDO A;  2KVR A;  5JH5 C;  3GZN I;  2K6Q A;  2DZM A;  4IM0 A;  4XC2 A;  1UD7 A;  4GOC A;  1GG3 A;  2KFK A;  3N32 A;  1WI0 A;  3L54 A;  2GBN A;  5JHA A;  4GDL B;  2IO3 B;  4HK2 A;  4HCP B;  4MGY E;  4XX5 A;  2RSU A;  2WDT B;  3MJW A;  3VUX A;  4BBN F;  3C0R B;  2KO3 A;  2WX1 A;  1P98 A;  2KHW B;  4M8M A;  2ZNV C;  3ZNI D;  3OJ3 A;  3AU5 A;  1CMX B;  1WGH A;  4BBN C;  2ZEQ A;  2RR9 A;  4B95 A;  2K1F A;  4FLH A;  2PJH A;  3ENE A;  1HE8 A;  4MGK E;  1WIA A;  3DCG A;  3ZRC A;  1UBQ A;  1GJZ A;  4IW0 A;  2HD5 B;  2LRW A;  1WM2 A;  4TQ0 A;  4LCD E;  2DZJ A;  4GMV A;  4HPM B;  4GU2 A;  4YL8 A;  2N1W A;  4ZRK A;  4ASW C;  4BKT A;  2ZVN A;  3N30 A;  3M95 A;  1WGG A;  1XQQ A;  4A3O A;  5DPT A;  2CU1 A;  3V60 A;  3VUW A;  1J19 A;  1EO6 A;  1GC7 A;  4AJY B;  1V81 A;  5KHQ A;  4PS7 A;  4HVB A;  3W1S A;  4CHK A;  3RYT A;  4I6L B;  4AWJ A;  3PS6 A;  4MEL A;  3I3T B;  3TJP A;  5J2R A;  3SU8 X;  2KTF A;  1XD3 B;  3KVF B;  4AJW A;  4JLC A;  2MBH A;  2JRH A;  2DZI A;  2FID A;  4MJS A;  5D7G A;  1WXS A;  2KDI A;  2MSE D;  3VUY A;  2ZNV B;  3ZUN A;  4DHJ D;  1WYW B;  2DZK A;  2XK5 A;  3KUZ A;  4W9E A;  4G50 A;  2BF8 B;  3UGB B;  3SDL C;  2W9N A;  2KK8 A;  2MA9 B;  4B6W A;  2GOW A;  1S3S G;  4RMA A;  3RD2 A;  3U30 A;  4FHK A;  1LM8 B;  1XT9 B;  2PE6 B;  2O6V B;  1Q1O A;  1EF5 A;  1NDD A;  5BO4 B;  3UIN B;  2J0J A;  2IY1 B;  2V1Y A;  3NZS A;  1M94 A;  5D94 A;  1E7V A;  4IWP A;  2PPH A;  4N9F 4;  2LZ6 A;  4ANU A;  4HXD A;  2O6V A;  3ZDM C;  5L95 C;  3HM3 A;  3A9J B;  4OVV A;  5TR5 A;  2JZZ A;  3UIP B;  2RPQ A;  3U7D A;  3ZNZ B;  2MBQ A;  4W9J A;  4B9K A;  2FIF A;  3V6E B;  3ML8 A;  4KV2 A;  4BFR A;  2L8J A;  4E3C A;  4MSM B;  3A9K A;  1V49 A;  3KW5 B;  2IZV B;  3PTF C;  1RAX A;  2M0X A;  1IYF A;  1U4A A;  3HK0 A;  3IG3 A;  2JT4 B;  2JZ3 B;  4DHZ B;  3IVF A;  1WR6 E;  2LGX A;  1WM3 A;  4EZJ A;  1D3Z A;  3APD A;  4K81 A;  4W9C A;  2KDF B;  2OJR A;  3OLM D;  2J0K A;  4ANX A;  2WWZ A;  5AZG A;  2FCQ A;  4GN1 A;  4AP4 C;  3T8M A;  2N1V A;  2HJ8 A;  2JRI B;  2KN5 A;  4GSW A;  3QWZ B;  2UYZ B;  4MDK E;  4FA6 A;  5DPW A;  4ZYN A;  4ICU A;  4W9H A;  2WX0 A;  3CST A;  4J6I A;  1V86 A;  2CHW A;  2I1J A;  1E7U A;  4W9L A;  5C23 A;  4PS8 A;  4II2 B;  3KH0 A;  2DYB A;  3VTW A;  2MCN B;  2HE7 A;  3AUL A;  5G2N A;  5GMV A;  1KOT A;  2HTH A;  5AZH A;  4XZ4 A;  2DYM A;  1GNU A;  3O65 B;  4P7I A;  4TKN A;  1WGD A;  2N4F A;  2PE9 A;  1WX9 A;  3A1Q B;  2NR2 A;  3EC8 A;  4FBJ B;  2KJ6 A;  5DPS A;  2WYQ A;  1P0R A;  2ZJD A;  2J7Q B;  3VXW A;  2JWZ A;  2KJR A;  1OGW A;  3L10 B;  2MWS B;  2NBU A;  3DVN U;  2FNJ B;  4WAA A;  2LUE A;  2L05 A;  5CHW A;  1WFY A;  3V61 A;  2KC2 A;  2KWU B;  2MP2 A;  1PQS A;  2KQS A;  2O6V D;  4DHZ E;  2L76 A;  4G3X B;  3M62 B;  1BT0 A;  5D6J B;  3RT3 B;  2GBR A;  5CHF A;  4W9D A;  3JSV B;  2BYF A;  3Q3J A;  2AWT A;  4NQK E;  3ZW3 A;  2R2Q A;  3A4S C;  4FAD A;  1LQB A;  4LJO B;  1YD8 U;  4F8C B;  2CHZ A;  4DXA B;  4WWP A;  5LLI A;  4K7W A;  1OEY J;  5EDS A;  3H7P A;  3KYC D;  2K8C A;  4NJ6 A;  3LJ3 A;  2RD0 A;  2JPH A;  4K1R B;  4BKS A;  2KQ7 A;  2DAF A;  3R66 C;  1SGH A;  3NY5 A;  4FJY A;  1FXT B;  4ZDV A;  3A4R A;  5L83 A;  3W1S C;  1E90 A;  2A4Z A;  3H9D A;  2KKC A;  3H7S A;  2BYE A;  2G3Q B;  4A3P A;  4EKU A;  2JVC A;  4IWQ A;  1WMH A;  4LDT B;  1EF1 A;  1Q5W B;  4NAW B;  3PRP B;  2LXC A;  4NNJ B;  4BVU C;  1UGM A;  3DBH I;  2K8B A;  4ZRI A;  3ZLZ A;  5G55 A;  2LWP A;  4NAW A;  2N9E B;  2KFK B;  1YJ1 A;  3CSF A;  4MH0 E;  3VH4 B;  1L2N A;  4II3 B;  4NJ7 A;  4K7U A;  4KIK B;  3L16 A;  2REX A;  1P3Q U;  3L17 A;  2G4D B;  4HJK A;  2DYO A;  3K9O B;  4GDK B;  3HHM A;  1WJN A;  4PS3 A;  2K39 A;  5IAA C;  2O2V A;  3AXC A;  4MM3 A;  4PYZ A;  4ANV A;  5DCN A;  5D2M B;  1R4M I;  2K8H A;  4RM8 A;  1Z5S B;  3QCA A;  4K7S A;  2MBB B;  2GBM A;  3EHV A;  2N9P C;  1P9D U;  1MG8 A;  3A9K B;  1H8C A;  5LXH A;  3N3K B;  4I6N B;  4KZ0 A;  3V6C B;  2C5L C;  1KLV A;  2G4S A;  2MBE A;  2M4N A;  3TL5 A;  4CYE A;  4BOS C;  3CF6 E;  4WJP A;  4URK A;  4F1S A;  3UQB A;  2Z59 B;  3SD5 A;  4RM9 A;  2C9W B;  1ZKH A;  3TBL D;  4MSQ B;  5CHV C;  1RLF A;  2Y5B B;  3DQV A;  2ZPN A;  4EEW A;  3JYU A;  4LJP B;  4PYU A;  1WJU A;  3WAP A;  2BKR B;  3RCZ A;  3L0W B;  4EUT A;  3OAW A;  2LGD A;  1UBI A;  2BYV E;  3QC8 B;  3DBS A;  2NBW B;  3PLV A;  3PV1 A;  2C7M B;  3AU4 A;  2N7D A;  1IPG A;  2KLG A;  5J18 A;  3KUC B;  4WJN A;  3VFK A;  2MQJ A;  1LXD A;  1RFA A;  4KVG B;  2GBJ A;  2J0M A;  3B1L X;  4ZRJ A;  4BKS D;  3W1Y A;  2KMC A;  2LVO A;  3WA0 A;  2KWV B;  4DHJ B;  4IG7 B;  1ZGU B;  2L7R A;  2LD9 A;  2BPS A;  4I6P A;  3KYD D;  3X0W A;  4FN2 A;  4FJZ A;  2AL6 A;  4W9K A;  3Q3F A;  4GIV A;  3VTV A;  1V5O A;  1S1Q B;  2KFJ A;  2N9X A;  3A9J A;  3DVG Y;  5E6P A;  4DWF A;  2IO0 B;  5J17 A;  4CO7 A;  2KX0 A;  4ICV A;  4M8N A;  3MTN B;  2FCM A;  3PLU A;  2KTR B;  3R7Q A;  3WAL A;  1UEL A;  1J8C A;  1E8X A;  1E8W A;  3T9L A;  2IY0 B;  3ZKJ C;  3QHT A;  1JRU A;  3SHQ A;  4OVU A;  3VTU A;  3ZTD A;  2NBV B;  1I42 A;  2YLM A;  2MLB A;  1KM7 A;  2C7H A;  2FCN A;  3JVZ X;  3VAW A;  2MX2 A;  1V6E A;  2ZCC A;  3PPA A;  1WE6 A;  3QA8 A;  2K6D B;  1LFD A;  2DEN B;  2M1M A;  1Y8R C;  2LVQ A;  4DBG A;  2KC1 A;  2JUO A;  1YX5 B;  2L3Z A;  3H7P B;  3PHW B;  5IA7 A;  1IP9 A;  3VQI A;  1R4N I;  1WR1 A;  2GMI C;  5HKH A;  3DVG X;  1WE7 A;  2MBO A;  1A5R A;  2LVP A;  3EEC A;  1J0G A;  2A5U A;  2C60 A;  2IYD B;  1TBE A;  1E8Y A;  2IO2 B;  2DX5 B;  1K8R B;  1WXA A;  3LDZ E;  1E5W A;  4WJO A;  1WJ6 A;  3RZW C;  2R2O A;  2KX3 A;  5CX3 A;  4HLE A;  5FR6 A;  2I1K A;  2G45 B;  4AOF A;  2C7N B;  3ZVV A;  3ZDT A;  2OOB B;  2KOX A;  3GOE A;  3NS8 A;  1WMH B;  3UF8 A;  2KJH B;  3VH3 B;  3APF A;  2DHZ A;  3QJZ A;  3VHT C;  3PRM B;  1WF9 A;  2LGY A;  2EMT A;  3UQA A;  3VVW B;  4MEM A;  2CKH B;  4BKG A;  4IC7 B;  5AEK B;  1V9J A;  2PEA A;  3X23 A;  2KD0 A;  2NPT A;  3TIX A;  4HCN B;  3PRE A;  4EOY A;  1WX8 A;  2ZCB A;  3JW0 X;  3IBE A;  4GDK A;  3JSV A;  4E74 A;  3P2B A;  4IWO A;  4TV3 A;  3H1U A;  1VD2 A;  1GC6 A;  4JGH B;  1RRB A;  4WJQ A;  3ZTC A;  3ZNG C;  4G11 A;  1OQY A;  4F7Z A;  2B3A A;  2IO1 B;  4WWN A;  1UH6 A;  3QIJ A;  4GDL A;  3ZNH B;  2MP2 B;  4NY0 A;  4E71 A;  1WRD B;  1YX6 B;  2L0T A;  4EZK A;  2D3G A;  4KZC A;  1OTR B;  2LXA A;  1SIF A;  1WZ3 A;  3A1Q A;  4DK5 A;  4W9I A;  4EZL A;  3NHE B;  2FCS A;  2DAJ A;  3HIZ A;  4GGQ A;  3S2A A;  1NBF C;  1UZX B;  2KNB A;  5KHO A;  3KUD B;  4A20 A;  3M63 B;  1QZE A;  2NVU I;  1YQB A;  2VRR B;  4HPL B;  3BY4 B;  2YVC A;  4MGI E;  2NCN A;  3M3J A;  2ZZP B;  3B08 A;  2D11 A;  2EMS A;  2D07 B;  3L13 A;  2JY6 A;  4TUU A;  1TTN A;  3RUI B;  3WIM A; 
#chains in the Genus database with same CATH topology
 1QT9 A;  4YSX B;  4K3B A;  3ETR A;  3R8B A;  1WGY A;  3OJ4 B;  2D10 A;  2L83 A;  3GE3 C;  3U7Z A;  1WXM A;  4KKI A;  2M17 A;  2NPT B;  2R61 A;  3W9C B;  3ZQ4 A;  2BWE S;  2EKI A;  5DPR A;  1ESF A;  4PK1 A;  1P1A A;  2L00 B;  4W9F A;  2FAZ A;  2LJ5 A;  5EE9 A;  3V62 A;  2ONQ A;  1TKY A;  3I57 A;  1BML C;  2WXF A;  3PGE A;  2V4L A;  2XEW A;  1L0X B;  1JWA D;  1F9J A;  4WQO B;  2CS4 A;  4KDL B;  1V80 A;  3ZIM A;  4JIO U;  4D2K A;  1WJ4 A;  3CIR B;  3O13 A;  2M56 B;  2WXM A;  3FC4 A;  2MJD A;  2LI5 A;  2O2V B;  4TQ1 A;  2V3S A;  2LGS A;  5AZF A;  1VCB A;  1BUI C;  1DGJ A;  2BQQ A;  2UWQ A;  2N9L A;  1WGR A;  4NPN A;  2M8S A;  4ANW A;  1M4V A;  4LNK A;  1ZE3 D;  3ECI A;  3W2D A;  1V5T A;  3NRZ A;  2VH2 A;  1HA5 A;  3R3M A;  3UIO B;  3PT2 B;  2Z0D B;  1RYJ A;  2JF5 A;  2IND C;  3IXS A;  3Q14 C;  2HDE A;  5AUI A;  4M0W B;  1Y56 A;  5FR3 A;  3PSE B;  3QX1 A;  4MAC A;  4B0E A;  3EUB 2;  1STE A;  3GZN I;  2K6Q A;  4IM0 A;  4GOC A;  1GG3 A;  2KFK A;  1WI0 A;  5MPO A;  5G5H A;  4XX5 A;  3VUX A;  1L6V A;  3BII D;  3NJT A;  4BBN F;  3BWU D;  2KHW B;  3ZNI D;  1CMX B;  2WLB A;  3LYY A;  2ZEQ A;  3P4R B;  5C2T B;  2PJH A;  2QC8 A;  3ENE A;  3DCG A;  2LRW A;  1WM2 A;  2QSD A;  4TQ0 A;  3AEC B;  2J42 A;  2V9H A;  4GMV A;  4YL8 A;  4ZRK A;  2ZVN A;  4A3O A;  5DPT A;  3VUW A;  2E6X A;  1GC7 A;  1NVI D;  1V81 A;  3RYT A;  1E7P B;  4MEL A;  4US8 A;  1SE3 A;  4ZOH C;  3SU8 X;  1XD3 B;  3KVF B;  4JLC A;  2JRH A;  2MBH A;  2KWD A;  1TJE A;  2ZNV B;  4JWS C;  3ZUN A;  1LO5 D;  1VRA B;  2DZK A;  3RMK C;  1I4G A;  4G50 A;  3EA6 A;  4A8X C;  2W9N A;  2MA9 B;  4B6W A;  1SJH D;  3RD2 A;  1NDD A;  3DHG C;  2V1Y A;  1JWU D;  5BMG A;  2PPH A;  2G9H D;  3HM3 A;  1EWC A;  4OVV A;  4AS1 A;  4W9J A;  2ACZ B;  3ML8 A;  4BFR A;  2L8J A;  1SE4 A;  2W55 A;  1IYF A;  3RNE C;  2V0G A;  4K3C A;  2LGX A;  2KMM A;  4USA A;  3OLM D;  2WWZ A;  1YJJ A;  2RDB C;  4FA6 A;  2UYZ B;  1Q10 A;  3WCQ A;  4ZYN A;  3Q69 A;  4ICU A;  4W9H A;  2KYW A;  3CST A;  1V86 A;  3NVV A;  1JRO A;  1EM7 A;  5C23 A;  3IAS 1;  5IOI A;  1C78 A;  2INC C;  2W3R A;  1PDX A;  1N5W A;  3O65 B;  1GNU A;  2PE9 A;  2WXQ A;  1XXG A;  2NR2 A;  1FFV A;  3KQ4 A;  3EGR A;  3MC0 B;  1PFD A;  3VXW A;  2KJR A;  1FM0 D;  4KX6 B;  4UDU C;  2BBC A;  2CJN A;  2FBW B;  4G3X B;  1BT0 A;  3P1M A;  3Q8B A;  1FNU A;  1I4R A;  1HQR D;  1YOV B;  1SEB D;  3Q3J A;  2AWT A;  4FAD A;  2R2Q A;  2Y3A A;  1YD8 U;  3U4E G;  5LLI A;  5EDS A;  1YN3 A;  3E9S A;  3LJ3 A;  1C79 A;  2RD0 A;  3TUO A;  4WH4 A;  1NEK B;  1F2R I;  3NY5 A;  4EE2 A;  3A4R A;  1E90 A;  3H9D A;  3H7S A;  2QIL A;  1QLB B;  1EU3 A;  2JVC A;  3P4S B;  2L52 A;  1SJE D;  4C80 A;  1UGM A;  2K8B A;  4ZRI A;  5G55 A;  4NAW A;  4MH0 E;  4K7U A;  1KH0 A;  3K9O B;  3HHM A;  1SSN A;  2K39 A;  4NZL B;  4K7S A;  2MBB B;  3EHV A;  2N9P C;  2QJL A;  3DBR B;  3SR6 A;  3A9K B;  3N3K B;  2TSS A;  2WDR B;  2C5L C;  4L2Y A;  3ZJT A;  3CF6 E;  4WJP A;  1MPE A;  2C9W B;  3TBL D;  4MSQ B;  5CHV C;  3AN1 A;  1R7S A;  2ZPN A;  3UI3 A;  3JYU A;  4PYU A;  1WJU A;  4MH8 A;  2LGD A;  4H2A A;  3PLV A;  4YTM B;  3AEG B;  2N7D A;  4HKZ E;  4ZRJ A;  2E3T A;  2KWV B;  2AQ1 B;  4C7Y A;  2Y5P A;  2BPS A;  3AM9 A;  4L1B A;  1T6B X;  1V5O A;  1S1Q B;  4LNO A;  2KFJ A;  2MJ3 A;  2IO0 B;  4M8N A;  3ABV B;  2KTR B;  2PKO A;  3R7Q A;  1E8X A;  1E8W A;  1GOZ A;  3QHT A;  1JRU A;  3ZTD A;  2BT6 A;  5TSS A;  3N20 C;  2C7H A;  3JVZ X;  2ZCC A;  3BZD B;  3QA8 A;  1A70 A;  2D3B A;  2WXO A;  2DEN B;  4HEA 1;  1F0Z A;  3B9J A;  1Y8R C;  1KLU D;  5IA7 A;  3KWL A;  3PZ8 A;  1WR1 A;  1WWT A;  4REZ A;  2MBO A;  1A5R A;  3I5J C;  2LVP A;  1J0G A;  2A5U A;  2IYD B;  2KVZ A;  2KT7 A;  1TBE A;  1E8Y A;  2J53 A;  2IO2 B;  3VRA B;  2D5G A;  4WJO A;  3RZW C;  2R2O A;  4HLE A;  2KOX A;  3UF8 A;  2K5P A;  3IT6 B;  2BYT A;  3N9Y C;  2D3C A;  3H8H A;  2GB1 A;  3AMZ A;  1ET9 A;  3VVW B;  3OG5 A;  2CKH B;  2W3S A;  4MEM A;  4M00 A;  2NPT A;  4M02 A;  3TIX A;  1OQR A;  3Q3M C;  4EOY A;  1ZXH A;  1WX8 A;  2XN9 C;  3JW0 X;  4GDK A;  3P2B A;  4RF0 A;  1VD2 A;  1QOF A;  1UNS A;  3DWG C;  4WJQ A;  4G11 A;  1OQY A;  3J9C A;  1IGC A;  1ZUD 2;  3TSS A;  3RN9 C;  2D3G A;  4DK5 A;  1JQ4 A;  2FCS A;  3U52 E;  2WHI A;  4GGQ A;  4ARI A;  5KHO A;  3KUD B;  2QEJ C;  2V4I B;  3W5V B;  5IP4 D;  2VRR B;  5HI1 A;  1K53 A;  3TEX A;  1I4P A;  3HRD D;  3RUI B;  3N1X C;  3Q3N C;  2WXL A;  5AUK A;  2WXI A;  4IUM B;  3TCA A;  1GUA B;  1GAQ B;  2Y5C A;  5JHB A;  4LDT D;  3GP7 A;  3NZU A;  1Q0W B;  1DYQ A;  4FUL A;  1SE9 A;  1G6J A;  3DBL I;  4XGA B;  1WXV A;  3ALB A;  4KSK C;  2WNM A;  1V1O A;  2KTR A;  3BIN A;  3R7R A;  3P42 A;  3DBR I;  3L08 A;  4KDI C;  2N0S B;  1JWM D;  5I4D A;  2BS3 B;  3TEZ A;  3DOW A;  3HM6 X;  4GB9 A;  3NOB A;  3RZF A;  3AE1 B;  2W54 A;  1ZDX A;  1E10 A;  2CR5 A;  1NEN B;  5C1Z A;  3OWE B;  4KIK A;  2JWU A;  1V2Y A;  1TS5 A;  1T0Q C;  1WGK A;  1NI2 A;  4QAY A;  1VZ8 A;  3EFU A;  2EKE C;  2AL3 A;  2BWF A;  3N1Y C;  2N7E A;  2MW5 A;  3KLS X;  3ML9 A;  5BYQ A;  1MG4 A;  4MGZ E;  2CHX A;  2GBK A;  3ZYY X;  4LNN A;  4G0N B;  4HDQ A;  2IBI B;  4JQW C;  3IHP C;  5E6N A;  2JU6 X;  3SEB A;  2PVO D;  3AH7 A;  3URY A;  2DZM A;  1FCL A;  1UD7 A;  1I4H A;  3L54 A;  1XCQ L;  3AE9 B;  2RMM A;  4PT5 A;  1SXT A;  2WDT B;  3MJW A;  3C0R B;  2WX1 A;  3OJ3 A;  4ZHO A;  4ZYS A;  2MEK A;  2KAC A;  3ZRC A;  1UBQ A;  1V8C A;  2GI9 A;  4FXC A;  4JE3 B;  1YN5 A;  4ASW C;  4BKT A;  2WXK A;  1HZ5 A;  1HXY D;  3GB1 A;  4JX1 C;  1SE2 A;  4AJY B;  4HVB A;  1DOX A;  2BS4 B;  4OVZ A;  4C4V A;  4MJS A;  3BYT B;  3VUY A;  2MSE D;  4YSY B;  4ACF A;  1XLN A;  1JWS D;  1WYW B;  4WWM A;  4W9E A;  5EE0 A;  4P6V F;  3B2F A;  3SDL C;  4FHK A;  2O6V B;  1EF5 A;  5BO4 B;  2AQ3 B;  4IWP A;  2LZ6 A;  5E6J A;  4HXD A;  3NG0 A;  3A9J B;  5TR5 A;  1F52 A;  1ROE A;  1TIF A;  3A9K A;  1V49 A;  1RAX A;  1XO3 A;  2LHD A;  1PUT A;  2X38 A;  3HK0 A;  3IG3 A;  2JT4 B;  1PGB A;  1D4B A;  1WR6 E;  2PMV A;  4W9C A;  1K51 A;  2KDF B;  2OJR A;  4P1B C;  2J0K A;  3TEW A;  2N9K A;  3LXF A;  2MHJ A;  2DNF A;  1N61 A;  3QWZ B;  1SIJ A;  2AQ2 B;  4J6I A;  4XDD A;  1V97 A;  3VTW A;  2HE7 A;  3AUL A;  5G2N A;  5GMV A;  2HTH A;  4YT0 B;  2OED A;  3T3O A;  2VH1 A;  2DYM A;  2N4F A;  3HVD A;  2JX5 A;  2KJ6 A;  1AW7 A;  2ZJD A;  1OGW A;  3DVN U;  2LUE A;  1TY0 A;  5CHW A;  3V61 A;  4IOI E;  2KWU B;  2MP2 A;  2KQS A;  1MHX A;  2L76 A;  2KN4 A;  3RT3 B;  2WXN A;  2V3P A;  5BYS A;  1GB1 A;  2CHZ A;  4DXA B;  3Q8C A;  3IAM 1;  3H7P A;  4NJ6 A;  4BKS A;  2DAF A;  1SGH A;  4ZDV A;  1FXT B;  4N6E B;  3W1S C;  1UWX A;  1ACC A;  4EKU A;  2BB6 A;  3SFD B;  2JXT A;  1WMH A;  1JAL A;  4A6Q A;  4RH6 A;  1Q5W B;  1IBX B;  2LXC A;  4NNJ B;  1C4A A;  2IGG A;  3NVZ A;  3Q2A C;  3L16 A;  1TY2 A;  4MM3 A;  4PYZ A;  1I4Q A;  5DCN A;  5D2M B;  1R4M I;  1CQV A;  2OHF A;  2FE8 A;  3QCA A;  1P9D U;  2M0A A;  2RDH A;  5FKA C;  1MG8 A;  1H8C A;  5LXH A;  1TT5 B;  2GRI A;  1KLV A;  2G4S A;  3L4P A;  2MBE A;  3PO0 A;  3UQB A;  4F1S A;  1PGA A;  3SD5 A;  1HTQ A;  2EEL A;  2Y5B B;  3L0W B;  3OAW A;  2NBW B;  1VJK A;  2C7M B;  2WXH A;  1IPG A;  3KUC B;  4KVG B;  2J0M A;  4OZC A;  4BKS D;  3U2S C;  3W1Y A;  3WA0 A;  3PZ7 A;  4OW0 A;  2ZW0 A;  2N9X A;  2WQY B;  1UUP A;  4DWF A;  4ICV A;  1P7E A;  3MTN B;  3WAL A;  1UEL A;  4WQM A;  3RNG C;  3T9L A;  2IY0 B;  3ZKJ C;  1I42 A;  4OVU A;  3VTU A;  2YLM A;  1AN8 A;  1KRH A;  1LGR A;  5FK9 C;  3MC8 A;  3VAW A;  2MX2 A;  4RCO A;  1B1Z A;  3FIL A;  1D5Z C;  1ET6 A;  1LFD A;  1JWB D;  2LVQ A;  3FKY A;  4DBG A;  2L3Z A;  1YX5 B;  3PHW B;  2D3A A;  3P4P B;  1IP9 A;  4S17 A;  5HKH A;  3I9V 1;  1WXA A;  2AX5 A;  2MJE A;  1FMA D;  4OZA A;  4AOF A;  4C56 C;  3ZVV A;  3ZDT A;  2DBY A;  1RFK A;  1WMH B;  2KJH B;  4CQN A;  1FRD A;  2LGY A;  2EMT A;  5D3I B;  1QF6 A;  1ZXI A;  2VZK B;  3X23 A;  3ZGZ A;  4HCN B;  3PRE A;  2NMQ A;  4E74 A;  3JSV A;  3MHZ A;  2INP E;  3H1U A;  4TV3 A;  1GC6 A;  4JGH B;  1RRB A;  2IO1 B;  4WWN A;  4GDL A;  3QIJ A;  5H8Y E;  3ZNH B;  2MP2 B;  4E71 A;  4EZK A;  1EWY C;  2LXA A;  1SIF A;  1QOA A;  3NHE B;  3HIZ A;  3S2A A;  1NBF C;  2KNB A;  5G5G A;  1YN4 A;  2J4X A;  1TZO A;  3M63 B;  1YQB A;  3T3N A;  2YVC A;  3M3J A;  2RDG A;  2INN E;  3AED B;  3LB8 C;  2JY6 A;  1FNW A;  4ZRQ A;  3WAO A;  2AYO B;  3K9P B;  1N5X A;  4Q2J A;  1X1M A;  2KXJ A;  2K25 A;  2KWC A;  2LAS A;  5IO9 A;  3ZRF A;  2KQ4 X;  3D32 A;  4HWI B;  1F1H A;  5JZE B;  2BW2 A;  3ZO5 B;  1C76 A;  4NQL B;  3A33 B;  1WH3 A;  3TEY A;  1OQQ A;  3QAQ A;  1JML A;  4BAX A;  1Z2M A;  4A90 A;  1WX7 A;  1C77 A;  3PHX B;  1WZ0 A;  1H4R A;  4BOZ B;  5HG2 A;  4IM2 A;  3RNB C;  1TGZ B;  3R2I A;  3QK0 A;  1XLQ A;  3AI5 A;  2NS5 A;  1T0Y A;  4IM3 A;  2KDB A;  1ZOY B;  3MHS D;  3B0A A;  2KAN A;  1FD6 A;  1KF6 B;  1I35 A;  5CTR C;  1K52 A;  3PRZ A;  1L4D B;  2SEB D;  3RNC C;  2MH7 A;  1J7B A;  1ZW7 A;  1T0S C;  1C4C A;  2ZVO A;  2CJO A;  4JL9 A;  3H6N A;  1TZ1 A;  3RI7 C;  5E6O A;  2XBB C;  5EE1 A;  1RM6 C;  3WAN A;  4GXB A;  2WDV B;  3AE2 B;  5LXI B;  1L7Y A;  1KJT A;  3BVG A;  3AEF B;  1JRP A;  1C1Y B;  2D2Q A;  2MRP A;  3IFW B;  3ONS A;  4DXF A;  4KSL C;  4HDO A;  1E6E B;  2KVR A;  1FFU A;  4XC2 A;  4LNF A;  4ZHP A;  3ZJV A;  2GBN A;  3ZJU A;  2IO3 B;  4NJC A;  3VR9 B;  3AE8 B;  4KKJ A;  1P98 A;  2ZNV C;  4HRS A;  2DWQ A;  3AU5 A;  4MT5 A;  2K1F A;  4FLH A;  5C3J B;  1HE8 A;  1WIA A;  1GJZ A;  2HD5 B;  5GXG B;  2DZJ A;  2LGI A;  1SF0 A;  1WGG A;  1XQQ A;  2CU1 A;  3V60 A;  1J19 A;  5KHQ A;  3RPF C;  4DXG A;  1EU4 A;  4AWJ A;  3PS6 A;  3I3T B;  2KTF A;  4AJW A;  1GPX A;  1WXS A;  2KDI A;  2W82 A;  4NAM A;  2XK5 A;  3KUZ A;  1IUE A;  3UGB B;  2KK8 A;  2GOW A;  1S3S G;  3DWM A;  3U30 A;  1LM8 B;  4A9A A;  1VDV A;  3UIN B;  2J0J A;  4P16 A;  3NZS A;  1M94 A;  1FXI A;  4N9F 4;  3ZDM C;  2K9X A;  2JZZ A;  3UIP B;  2RPQ A;  2FIF A;  3V6E B;  4KV2 A;  4MSM B;  4BZA A;  4HRO A;  3KW5 B;  2IZV B;  3R2T A;  1ZDV A;  5HFY A;  2PIA A;  4ITK A;  3AE3 B;  2JZ3 B;  1FIQ A;  1KFY B;  3IVF A;  1WM3 A;  2IDY A;  1D3Z A;  3APD A;  2WU5 B;  1RWS A;  5AZG A;  4GN1 A;  4RGN A;  3T8M A;  2N1V A;  1TKG A;  4MDK E;  1VZ6 A;  2CHW A;  2I1J A;  4WUR A;  2UU7 A;  3BK1 A;  4II2 B;  2DYB A;  2MCN B;  3DBH B;  3I63 C;  2JQR B;  1E9M A;  1KOT A;  4P7I A;  1J7A A;  4TKN A;  4OZB A;  1WX9 A;  3A1Q B;  1T0R C;  1SBB B;  2BB5 A;  2WYQ A;  1P0R A;  1FXA A;  3BK2 A;  1MVK A;  2J7Q B;  2YEP F;  3L10 B;  2MWS B;  4WAA A;  2L05 A;  1WFY A;  4XWW A;  3Q8A A;  2SAK A;  3ZW3 A;  4NQK E;  1LQB A;  2FUG 1;  4LJO B;  4F8C B;  1MJD A;  2ON8 A;  4K7W A;  3KYC D;  2K8C A;  2IPK D;  4K1R B;  3R66 C;  3HUI A;  4RGT A;  4RF1 A;  1WRI A;  5T8I A;  5L83 A;  2A4Z A;  2KKC A;  4A3P A;  3AE7 B;  4IWQ A;  4LDT B;  1EF1 A;  3BVM A;  4NAW B;  5BMH A;  1L5P A;  4BVU C;  2Q5W D;  3DBH I;  3ZLZ A;  1TYG B;  3CSF A;  3VH4 B;  2WXP A;  4NJ7 A;  1YQ4 B;  2QIE B;  2G4D B;  4HJK A;  2DYO A;  1N63 A;  1WJN A;  4PS3 A;  2WXJ A;  1C4P A;  1FRR A;  2K8H A;  4RM8 A;  1Z5S B;  1YJI A;  3NUH B;  2GBM A;  1WXQ A;  2ZW1 A;  4KZ0 A;  3V6C B;  2M4N A;  3CWI A;  4IDI A;  1R4N B;  1XLP A;  1KTK A;  1D5M C;  3NS1 A;  1VLB A;  1R4M B;  4EEW A;  1T3Q A;  1UF0 A;  1YQ3 B;  3WAP A;  2BKR B;  2BYV E;  4JWU C;  1J7C A;  2LJI A;  2KLG A;  5J18 A;  4WJN A;  3VFK A;  2MQJ A;  1LXD A;  2GBJ A;  2XNA C;  2KMC A;  5BYR A;  4DHJ B;  3NVW A;  1HEZ E;  1ZGU B;  4A55 A;  2QDF A;  4I6P A;  3KYD D;  1TS4 A;  1FEH A;  2AL6 A;  4W9K A;  3VTV A;  2N7J A;  3A9J A;  3DVG Y;  2CU3 A;  2Z8L A;  3V3X A;  4WAF A;  2WP9 B;  1J8C A;  4YWG G;  2K3U A;  2MLB A;  1KM7 A;  2FCN A;  3W5U B;  1BXT A;  3PPA A;  2K6D B;  4RGO S;  1PGX A;  2M1M A;  2VZK D;  2JUO A;  3H7P B;  3VQI A;  1R4N I;  1ENF A;  1UGJ A;  4AQ7 A;  3EEC A;  2C60 A;  2WDQ B;  2DX5 B;  1AYF A;  4C7Z A;  2KX3 A;  5CX3 A;  2C7N B;  3GOE A;  3NS8 A;  3VH3 B;  2DHZ A;  3Q3O C;  3PRM B;  1WF9 A;  1D6E C;  4RFB A;  4B0M A;  5AEK B;  1V9J A;  2KD0 A;  1D5X C;  2ZCB A;  3IBE A;  4IWO A;  1FNV A;  1DOY A;  1FCC C;  1N60 A;  3ZTC A;  3ZNG C;  4F7Z A;  2B3A A;  1L6U A;  1UH6 A;  1WRD B;  1YX6 B;  1F77 A;  1QQR A;  1WZ3 A;  4EZL A;  5LNK 1;  1UZX B;  4TMA B;  4A20 A;  4WIP A;  3VR8 B;  1B9R A;  2NCN A;  2ZZP B;  2WXR A;  1ZP0 B;  3L13 A;  4RM9 A;  2LFI A;  1IGD A;  4GLS C;  2RGF A;  2KDE B;  3AE5 B;  3VRB B;  2QHO A;  3GS2 A;  1QKZ A;  1YIW A;  2JZP A;  3GE8 C;  1JW9 D;  4KGS A;  4DDI D;  4AUQ C;  4KGR A;  4EFO A;  4S0R A;  4DDG D;  1XCT L;  2L32 A;  2JXX A;  1HZ6 A;  4MJS B;  2LRU A;  2BGF A;  1P7F A;  2KLC A;  3RUL A;  2AEH A;  3P63 A;  2I2Y A;  1C3T A;  5BMI A;  1E8Z A;  2FUH B;  1KLG D;  2KZR A;  2HTM E;  3AB5 A;  2ASQ A;  1HTO A;  4MM3 B;  2ZPY A;  1WY8 A;  2XK5 B;  4X57 B;  4W9G A;  2Z0E B;  1C9F A;  2L0F A;  4RGM A;  3CMM B;  1MFW A;  4LTU A;  3DVN V;  1IBX A;  1OFF A;  3PZD A;  1TKE A;  4FHJ A;  3TMP B;  1PYW D;  3PVL A;  3DPD A;  2KMA A;  2BKF A;  3SFE B;  3QQ8 B;  1N6Z A;  4WWO A;  1ISN A;  3VDZ A;  5EE3 A;  1AAR A;  3U8Z A;  4FJV B;  2DLB A;  1EUV B;  3DDC B;  1V1P A;  2M19 A;  5HHD G;  3HVZ A;  1OEY A;  3APC A;  3WAM A;  3QAR A;  2K22 A;  4C00 A;  5JH5 C;  3EFC A;  2LMC A;  3C19 A;  1VR9 A;  3N32 A;  3DHI C;  5JHA A;  4GDL B;  2BVC A;  1GB4 A;  4HK2 A;  4HCP B;  4MGY E;  2B76 B;  2RSU A;  4LK0 M;  2KO3 A;  1V1P B;  1I7H A;  4M8M A;  2KAJ A;  1YMH E;  1WGH A;  4BBN C;  2RR9 A;  4B95 A;  1F2R C;  1FO4 A;  1CZP A;  2PTL A;  4ARC A;  4MGK E;  3MC9 A;  4XYC A;  4IW0 A;  2KDM A;  2BS2 B;  2YEP B;  4LCD E;  4RNA A;  4HPM B;  4GU2 A;  2N1W A;  3FAH A;  3N30 A;  3M95 A;  1EO6 A;  4L23 A;  4IKG A;  3E56 A;  4PS7 A;  3W1S A;  4CHK A;  1XLO A;  4I6L B;  3TJP A;  5J2R A;  1TS2 A;  1WYG A;  2V3N A;  2DZI A;  2FID A;  5D7G A;  3AE6 B;  2J52 A;  4DHJ D;  1SB3 C;  1XEE A;  2BF8 B;  5IN7 A;  4RMA A;  1AWD A;  1XT9 B;  2PE6 B;  1Q1O A;  3ZXR A;  2ICI A;  1WSP A;  2JYT A;  2WXG A;  4M01 A;  2IY1 B;  2LEK A;  5D94 A;  1E7V A;  2RPV A;  4ANU A;  2O6V A;  5L95 C;  4N59 A;  3ZNZ B;  3U7D A;  2MBQ A;  4B9K A;  4E3C A;  1I4X A;  3AV8 A;  3PTF C;  2M0X A;  1YNT E;  1U4A A;  4DHZ B;  4EZJ A;  2OJW A;  2H89 B;  4K81 A;  1NYR A;  4ANX A;  2FCQ A;  4AP4 C;  3RNA C;  2HJ8 A;  2JRI B;  2KN5 A;  4GSW A;  5DPW A;  2QCZ A;  2PW9 A;  1VZ7 A;  2WX0 A;  1E7U A;  4W9L A;  4PS8 A;  1UWM A;  3KH0 A;  1ZPS A;  3P4Q B;  3DHH C;  4OHJ A;  5AZH A;  4XZ4 A;  1WGD A;  2G1E A;  3IT4 B;  1XF5 L;  3EC8 A;  2L1A A;  4FBJ B;  5DPS A;  1QIL A;  2JWZ A;  2NBU A;  2FNJ B;  2IGD A;  2KC2 A;  1PQS A;  4LLG M;  2O6V D;  4DHZ E;  1MI0 A;  1CJE A;  3M62 B;  5D6J B;  2GBR A;  5CHF A;  4W9D A;  2PLP A;  1TS3 A;  2BYF A;  3JSV B;  3A4S C;  2WS3 B;  2LUM A;  2IJ0 A;  4TSS A;  4WWP A;  1OEY J;  2JPH A;  3ZXV A;  2KQ7 A;  4FJY A;  2NTS A;  5H92 C;  2BYE A;  4O1N A;  2G3Q B;  4XWT A;  1E0Z A;  5D3D A;  4C4V B;  3PRP B;  4YTN B;  1CK1 A;  1L0Y B;  3C8Y A;  2LWP A;  2N9E B;  2KFK B;  1YJ1 A;  3Q8F A;  1L2N A;  4LNI A;  4II3 B;  4KIK B;  2REX A;  1P3Q U;  3L17 A;  4J3O D;  4GDK B;  3Q6B A;  5IAA C;  2O2V A;  4M0W A;  3AXC A;  3MFG A;  4ANV A;  1K50 A;  3MJ5 A;  3FIL B;  4R3D A;  4I6N B;  4N58 A;  2I38 A;  3NVY A;  3TL5 A;  4CYE A;  4BOS C;  4URK A;  2Z59 B;  2BTE A;  1ZKH A;  1RLF A;  3DQV A;  5JXV A;  4YXD B;  4LJP B;  1L4Z B;  3RCZ A;  2HJ1 A;  4EUT A;  1UBI A;  3QC8 B;  3DBS A;  3PV1 A;  3AU4 A;  1RFA A;  4ZRP A;  2JYE A;  1JCK B;  3B1L X;  1DOI A;  2LVO A;  5IKC M;  4XE0 A;  2QMT A;  3B2G A;  4IG7 B;  2L7R A;  2LD9 A;  4XDC A;  3X0W A;  4FN2 A;  4FJZ A;  3Q3F A;  4GIV A;  2NTT A;  5E6P A;  2GLS A;  3BYY B;  1N62 A;  3GZN B;  5J17 A;  2K0P A;  4CO7 A;  3RNF C;  2KX0 A;  2FCM A;  3PLU A;  3SHQ A;  3Q8E A;  3NZ3 A;  2NBV B;  4YSZ B;  2PVG C;  4HPP A;  4KGT A;  4DQO C;  1V6E A;  4US9 A;  1WE6 A;  3MP9 A;  1L0V B;  2KC1 A;  1NYQ A;  2GMI C;  3AEA B;  3KWV A;  3DVG X;  1WE7 A;  2WU2 B;  2H88 B;  1K8R B;  3LDZ E;  1E5W A;  1WJ6 A;  5FR6 A;  2I1K A;  2G45 B;  2X8X X;  3V05 A;  2OOB B;  1NI3 A;  3APF A;  3QJZ A;  3VHT C;  1T5X D;  3UQA A;  4BKG A;  4IC7 B;  2PEA A;  1QOB A;  3BVZ A;  2IGH A;  4JPS A;  4HJG E;  3DBL B;  4HKQ A;  4YTP B;  1FPY A;  3RFZ B;  1MHH E;  1QOG A;  2JSV X;  4NY0 A;  2L0T A;  4KZC A;  1OTR B;  3A1Q A;  4W9I A;  2DAJ A;  4P1C C;  1QZE A;  2NVU I;  4HPL B;  3BY4 B;  4MGI E;  3B08 A;  3AEE B;  2D11 A;  3AEB B;  2LHE A;  2EMS A;  2D07 B;  3AE4 B;  4TUU A;  3WIM A;  1TTN A;  2WGS A;  3N1Z C; 
#chains in the Genus database with same CATH homology
 2RGF A;  2KDE B;  3WAO A;  2QHO A;  2AYO B;  3K9P B;  4IUM B;  3TCA A;  1GUA B;  1X1M A;  1WGY A;  3OJ4 B;  1YIW A;  2D10 A;  2KXJ A;  2K25 A;  2KWC A;  4DDI D;  5JHB A;  4LDT D;  2LAS A;  3ZRF A;  3NZU A;  4AUQ C;  1WXM A;  3D32 A;  4HWI B;  1Q0W B;  4EFO A;  2M17 A;  2NPT B;  4DDG D;  2BWE S;  5JZE B;  5DPR A;  4FUL A;  1SE9 A;  2JXX A;  3ZO5 B;  4NQL B;  1G6J A;  3A33 B;  3DBL I;  1WH3 A;  1P1A A;  1WXV A;  4MJS B;  2L00 B;  3ALB A;  4W9F A;  2FAZ A;  2LRU A;  3QAQ A;  4KSK C;  2LJ5 A;  3V62 A;  1Z2M A;  2BGF A;  1WX7 A;  2KLC A;  2KTR A;  3BIN A;  3R7R A;  3PGE A;  3DBR I;  3RUL A;  2V4L A;  3L08 A;  2AEH A;  2XEW A;  3PHX B;  1WZ0 A;  1F9J A;  1H4R A;  4KDI C;  4WQO B;  4BOZ B;  1C3T A;  2CS4 A;  4IM2 A;  1E8Z A;  2FUH B;  1TGZ B;  3QK0 A;  2KZR A;  3AI5 A;  2NS5 A;  1T0Y A;  4IM3 A;  3DOW A;  4KDL B;  2KDB A;  3HM6 X;  4GB9 A;  3NOB A;  2ASQ A;  3RZF A;  1V80 A;  3MHS D;  4JIO U;  3B0A A;  1WJ4 A;  2KAN A;  3ZIM A;  1I35 A;  5CTR C;  2CR5 A;  2ZPY A;  1WY8 A;  5C1Z A;  2XK5 B;  3PRZ A;  4X57 B;  2LI5 A;  2O2V B;  4KIK A;  4TQ1 A;  2Z0E B;  4W9G A;  2V3S A;  1ZW7 A;  2L0F A;  5AZF A;  1V2Y A;  1VCB A;  2ZVO A;  3CMM B;  2UWQ A;  1WGR A;  1NI2 A;  3DVN V;  4JL9 A;  4NPN A;  3EFU A;  2M8S A;  4ANW A;  3H6N A;  2EKE C;  1TZ1 A;  3PZD A;  2AL3 A;  5E6O A;  4FHJ A;  2XBB C;  3TMP B;  3PVL A;  3ECI A;  3DPD A;  2BWF A;  3WAN A;  4GXB A;  1V5T A;  5LXI B;  2KMA A;  2N7E A;  2BKF A;  2MW5 A;  3ML9 A;  3QQ8 B;  4WWO A;  1ISN A;  3R3M A;  3VDZ A;  4MGZ E;  1L7Y A;  2CHX A;  1AAR A;  2GBK A;  4FJV B;  3U8Z A;  3UIO B;  1KJT A;  1C1Y B;  3PT2 B;  2Z0D B;  2JF5 A;  4G0N B;  4HDQ A;  2MRP A;  2D2Q A;  2IBI B;  3IFW B;  4JQW C;  1EUV B;  3DDC B;  3IHP C;  5E6N A;  4M0W B;  3ONS A;  4KSL C;  1OEY A;  3APC A;  3WAM A;  3PSE B;  3QX1 A;  3QAR A;  4HDO A;  2KVR A;  5JH5 C;  3GZN I;  2K6Q A;  2DZM A;  4IM0 A;  4XC2 A;  1UD7 A;  4GOC A;  1GG3 A;  2KFK A;  3N32 A;  1WI0 A;  3L54 A;  2GBN A;  5JHA A;  4GDL B;  2IO3 B;  4HK2 A;  4HCP B;  4MGY E;  4XX5 A;  2RSU A;  2WDT B;  3MJW A;  3VUX A;  4BBN F;  3C0R B;  2KO3 A;  2WX1 A;  1P98 A;  2KHW B;  4M8M A;  2ZNV C;  3ZNI D;  3OJ3 A;  3AU5 A;  1CMX B;  1WGH A;  4BBN C;  2ZEQ A;  2RR9 A;  4B95 A;  2K1F A;  4FLH A;  2PJH A;  3ENE A;  1HE8 A;  4MGK E;  1WIA A;  3DCG A;  3ZRC A;  1UBQ A;  1GJZ A;  4IW0 A;  2HD5 B;  2LRW A;  1WM2 A;  4TQ0 A;  4LCD E;  2DZJ A;  4GMV A;  4HPM B;  4GU2 A;  4YL8 A;  2N1W A;  4ZRK A;  4ASW C;  4BKT A;  2ZVN A;  3N30 A;  3M95 A;  1WGG A;  1XQQ A;  4A3O A;  5DPT A;  2CU1 A;  3V60 A;  3VUW A;  1J19 A;  1EO6 A;  1GC7 A;  4AJY B;  1V81 A;  5KHQ A;  4PS7 A;  4HVB A;  3W1S A;  4CHK A;  3RYT A;  4I6L B;  4AWJ A;  3PS6 A;  4MEL A;  3I3T B;  3TJP A;  5J2R A;  3SU8 X;  2KTF A;  1XD3 B;  3KVF B;  4AJW A;  4JLC A;  2MBH A;  2JRH A;  2DZI A;  2FID A;  4MJS A;  5D7G A;  1WXS A;  2KDI A;  2MSE D;  3VUY A;  2ZNV B;  3ZUN A;  4DHJ D;  1WYW B;  2DZK A;  2XK5 A;  3KUZ A;  4W9E A;  4G50 A;  2BF8 B;  3UGB B;  3SDL C;  2W9N A;  2KK8 A;  2MA9 B;  4B6W A;  2GOW A;  1S3S G;  4RMA A;  3RD2 A;  3U30 A;  4FHK A;  1LM8 B;  1XT9 B;  2PE6 B;  2O6V B;  1Q1O A;  1EF5 A;  1NDD A;  5BO4 B;  3UIN B;  2J0J A;  2IY1 B;  2V1Y A;  3NZS A;  1M94 A;  5D94 A;  1E7V A;  4IWP A;  2PPH A;  4N9F 4;  2LZ6 A;  4ANU A;  4HXD A;  2O6V A;  3ZDM C;  5L95 C;  3HM3 A;  3A9J B;  4OVV A;  5TR5 A;  2JZZ A;  3UIP B;  2RPQ A;  3U7D A;  3ZNZ B;  2MBQ A;  4W9J A;  4B9K A;  2FIF A;  3V6E B;  3ML8 A;  4KV2 A;  4BFR A;  2L8J A;  4E3C A;  4MSM B;  3A9K A;  1V49 A;  3KW5 B;  2IZV B;  3PTF C;  1RAX A;  2M0X A;  1IYF A;  1U4A A;  3HK0 A;  3IG3 A;  2JT4 B;  2JZ3 B;  4DHZ B;  3IVF A;  1WR6 E;  2LGX A;  1WM3 A;  4EZJ A;  1D3Z A;  3APD A;  4K81 A;  4W9C A;  2KDF B;  2OJR A;  3OLM D;  2J0K A;  4ANX A;  2WWZ A;  5AZG A;  2FCQ A;  4GN1 A;  4AP4 C;  3T8M A;  2N1V A;  2HJ8 A;  2JRI B;  2KN5 A;  4GSW A;  3QWZ B;  2UYZ B;  4MDK E;  4FA6 A;  5DPW A;  4ZYN A;  4ICU A;  4W9H A;  2WX0 A;  3CST A;  4J6I A;  1V86 A;  2CHW A;  2I1J A;  1E7U A;  4W9L A;  5C23 A;  4PS8 A;  4II2 B;  3KH0 A;  2DYB A;  3VTW A;  2MCN B;  2HE7 A;  3AUL A;  5G2N A;  5GMV A;  1KOT A;  2HTH A;  5AZH A;  4XZ4 A;  2DYM A;  1GNU A;  3O65 B;  4P7I A;  4TKN A;  1WGD A;  2N4F A;  2PE9 A;  1WX9 A;  3A1Q B;  2NR2 A;  3EC8 A;  4FBJ B;  2KJ6 A;  5DPS A;  2WYQ A;  1P0R A;  2ZJD A;  2J7Q B;  3VXW A;  2JWZ A;  2KJR A;  1OGW A;  3L10 B;  2MWS B;  2NBU A;  3DVN U;  2FNJ B;  4WAA A;  2LUE A;  2L05 A;  5CHW A;  1WFY A;  3V61 A;  2KC2 A;  2KWU B;  2MP2 A;  1PQS A;  2KQS A;  2O6V D;  4DHZ E;  2L76 A;  4G3X B;  3M62 B;  1BT0 A;  5D6J B;  3RT3 B;  2GBR A;  5CHF A;  4W9D A;  3JSV B;  2BYF A;  3Q3J A;  2AWT A;  4NQK E;  3ZW3 A;  2R2Q A;  3A4S C;  4FAD A;  1LQB A;  4LJO B;  1YD8 U;  4F8C B;  2CHZ A;  4DXA B;  4WWP A;  5LLI A;  4K7W A;  1OEY J;  5EDS A;  3H7P A;  3KYC D;  2K8C A;  4NJ6 A;  3LJ3 A;  2RD0 A;  2JPH A;  4K1R B;  4BKS A;  2KQ7 A;  2DAF A;  3R66 C;  1SGH A;  3NY5 A;  4FJY A;  1FXT B;  4ZDV A;  3A4R A;  5L83 A;  3W1S C;  1E90 A;  2A4Z A;  3H9D A;  2KKC A;  3H7S A;  2BYE A;  2G3Q B;  4A3P A;  4EKU A;  2JVC A;  4IWQ A;  1WMH A;  4LDT B;  1EF1 A;  1Q5W B;  4NAW B;  3PRP B;  2LXC A;  4NNJ B;  4BVU C;  1UGM A;  3DBH I;  2K8B A;  4ZRI A;  3ZLZ A;  5G55 A;  2LWP A;  4NAW A;  2N9E B;  2KFK B;  1YJ1 A;  3CSF A;  4MH0 E;  3VH4 B;  1L2N A;  4II3 B;  4NJ7 A;  4K7U A;  4KIK B;  3L16 A;  2REX A;  1P3Q U;  3L17 A;  2G4D B;  4HJK A;  2DYO A;  3K9O B;  4GDK B;  3HHM A;  1WJN A;  4PS3 A;  2K39 A;  5IAA C;  2O2V A;  3AXC A;  4MM3 A;  4PYZ A;  4ANV A;  5DCN A;  5D2M B;  1R4M I;  2K8H A;  4RM8 A;  1Z5S B;  3QCA A;  4K7S A;  2MBB B;  2GBM A;  3EHV A;  2N9P C;  1P9D U;  1MG8 A;  3A9K B;  1H8C A;  5LXH A;  3N3K B;  4I6N B;  4KZ0 A;  3V6C B;  2C5L C;  1KLV A;  2G4S A;  2MBE A;  2M4N A;  3TL5 A;  4CYE A;  4BOS C;  3CF6 E;  4WJP A;  4URK A;  4F1S A;  3UQB A;  2Z59 B;  3SD5 A;  4RM9 A;  2C9W B;  1ZKH A;  3TBL D;  4MSQ B;  5CHV C;  1RLF A;  2Y5B B;  3DQV A;  2ZPN A;  4EEW A;  3JYU A;  4LJP B;  4PYU A;  1WJU A;  3WAP A;  2BKR B;  3RCZ A;  3L0W B;  4EUT A;  3OAW A;  2LGD A;  1UBI A;  2BYV E;  3QC8 B;  3DBS A;  2NBW B;  3PLV A;  3PV1 A;  2C7M B;  3AU4 A;  2N7D A;  1IPG A;  2KLG A;  5J18 A;  3KUC B;  4WJN A;  3VFK A;  2MQJ A;  1LXD A;  1RFA A;  4KVG B;  2GBJ A;  2J0M A;  3B1L X;  4ZRJ A;  4BKS D;  3W1Y A;  2KMC A;  2LVO A;  3WA0 A;  2KWV B;  4DHJ B;  4IG7 B;  1ZGU B;  2L7R A;  2LD9 A;  2BPS A;  4I6P A;  3KYD D;  3X0W A;  4FN2 A;  4FJZ A;  2AL6 A;  4W9K A;  3Q3F A;  4GIV A;  3VTV A;  1V5O A;  1S1Q B;  2KFJ A;  2N9X A;  3A9J A;  3DVG Y;  5E6P A;  4DWF A;  2IO0 B;  5J17 A;  4CO7 A;  2KX0 A;  4ICV A;  4M8N A;  3MTN B;  2FCM A;  3PLU A;  2KTR B;  3R7Q A;  3WAL A;  1UEL A;  1J8C A;  1E8X A;  1E8W A;  3T9L A;  2IY0 B;  3ZKJ C;  3QHT A;  1JRU A;  3SHQ A;  4OVU A;  3VTU A;  3ZTD A;  2NBV B;  1I42 A;  2YLM A;  2MLB A;  1KM7 A;  2C7H A;  2FCN A;  3JVZ X;  3VAW A;  2MX2 A;  1V6E A;  2ZCC A;  3PPA A;  1WE6 A;  3QA8 A;  2K6D B;  1LFD A;  2DEN B;  2M1M A;  1Y8R C;  2LVQ A;  4DBG A;  2KC1 A;  2JUO A;  1YX5 B;  2L3Z A;  3H7P B;  3PHW B;  5IA7 A;  1IP9 A;  3VQI A;  1R4N I;  1WR1 A;  2GMI C;  5HKH A;  3DVG X;  1WE7 A;  2MBO A;  1A5R A;  2LVP A;  3EEC A;  1J0G A;  2A5U A;  2C60 A;  2IYD B;  1TBE A;  1E8Y A;  2IO2 B;  2DX5 B;  1K8R B;  1WXA A;  3LDZ E;  1E5W A;  4WJO A;  1WJ6 A;  3RZW C;  2R2O A;  2KX3 A;  5CX3 A;  4HLE A;  5FR6 A;  2I1K A;  2G45 B;  4AOF A;  2C7N B;  3ZVV A;  3ZDT A;  2OOB B;  2KOX A;  3GOE A;  3NS8 A;  1WMH B;  3UF8 A;  2KJH B;  3VH3 B;  3APF A;  2DHZ A;  3QJZ A;  3VHT C;  3PRM B;  1WF9 A;  2LGY A;  2EMT A;  3UQA A;  3VVW B;  4MEM A;  2CKH B;  4BKG A;  4IC7 B;  5AEK B;  1V9J A;  2PEA A;  3X23 A;  2KD0 A;  2NPT A;  3TIX A;  4HCN B;  3PRE A;  4EOY A;  1WX8 A;  2ZCB A;  3JW0 X;  3IBE A;  4GDK A;  3JSV A;  4E74 A;  3P2B A;  4IWO A;  4TV3 A;  3H1U A;  1VD2 A;  1GC6 A;  4JGH B;  1RRB A;  4WJQ A;  3ZTC A;  3ZNG C;  4G11 A;  1OQY A;  4F7Z A;  2B3A A;  2IO1 B;  4WWN A;  1UH6 A;  3QIJ A;  4GDL A;  3ZNH B;  2MP2 B;  4NY0 A;  4E71 A;  1WRD B;  1YX6 B;  2L0T A;  4EZK A;  2D3G A;  4KZC A;  1OTR B;  2LXA A;  1SIF A;  1WZ3 A;  3A1Q A;  4DK5 A;  4W9I A;  4EZL A;  3NHE B;  2FCS A;  2DAJ A;  3HIZ A;  4GGQ A;  3S2A A;  1NBF C;  1UZX B;  2KNB A;  5KHO A;  3KUD B;  4A20 A;  3M63 B;  1QZE A;  2NVU I;  1YQB A;  2VRR B;  4HPL B;  3BY4 B;  2YVC A;  4MGI E;  2NCN A;  3M3J A;  2ZZP B;  3B08 A;  2D11 A;  2EMS A;  2D07 B;  3L13 A;  2JY6 A;  4TUU A;  1TTN A;  3RUI B;  3WIM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...