4AWJA

Pvhl:elob:eloc complex, in complex with capped hydroxyproline
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
103
structure length
100
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADTFEALIEPFSSPPELPDVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Dissecting Fragment-Based Lead Discovery at the Von Hippel-Lindau Protein:Hypoxia Inducible Factor 1Alpha Protein-Protein Interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 22
structure length 100
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2012-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4awjA00
4CO7A 4LDTB 2BYFA 1LFDA 2DZJA 1HE8A 2DHZA 2I1JA 2K25A 2K6QA 3N32A 4FHKA 4DDID 3QIJA 5JZEB 1I35A 3RT3B 3DVGY 2JRIB 1WJ4A 1WE7A 1LXDA 2JRHA 2GBKA 4HCPB 1UBIA 3M63B 3PT2B 1VCBA 3DVNV 2JXXA 3LDZE 3T9LA 4IWPA 5DPSA 3ZIMA 1VD2A 5LXIB 4KDLB 3QQ8B 5AEKB 3WA0A 4FN2A 5IA7A 1WGGA 1WGHA 3H7SA 2ZCCA 4ANVA 4F8CB 1WR6E 2O2VA 4F1SA 1TGZB 2PEAA 4K7UA 4BKGA 1LM8B 2G45B 2JPHA 1EO6A 2W9NA 3VUYA 2RD0A 2VRRB 3B1LX 1WXAA 3L16A 4PS7A 2BKFA 2BKRB 4BOSC 4GDLA 3ZNID 3QHTA 3IG3A 4ZDVA 1P98A 1F9JA 4IM0A 5FR6A 3VAWA 1E5WA 4DWFA 1E8ZA 1ZW7A 2LRUA 3V6EB 4ANXA 1WX9A 1V6EA 2A5UA 2N1VA 3PGEA 3PHWB 3RYTA 3PHXB 2LD9A 2LWPA 2PPHA 3ZUNA 2BWFA 1NI2A 3OLMD 4G3XB 1P0RA 2CKHB 4K7SA 4MEMA 2IO0B 4KIKB 1WMHB 4MSQB 4W9LA 2R2QA 2DAJA 4HDQA 5AZFA 3PRPB 3APFA 1J8CA 2Y5BB 3GZNI 1UZXB 4NJ6A 1YD8U 1T0YA 2IO1B 3N3KB 4ZRIA 4M8MA 3V61A 3ZRFA 3EECA 3ZNHB 2DYOA 3SU8X 2BGFA 2LGXA 3WALA 3QWZB 1UELA 1P3QU 2CS4A 3R7QA 4FA6A 2KDIA 2DX5B 4PS8A 1E90A 3DOWA 2BF8B 1RAXA 1WM3A 2R2OA 2CR5A 2LXAA 2KWVB 2AL6A 4BBNC 1GC7A 2MBBB 3VFKA 3U30A 3U8ZA 3PVLA 2D3GA 1EF1A 5JHAA 3ALBA 1Z5SB 4HPLB 4FBJB 1RFAA 5KHOA 4FADA 3P2BA 1E8WA 1WJUA 2L0FA 3S2AA 1SE9A 3PSEB 4NY0A 4KIKA 3VHTC 1XT9B 1WMHA 4E3CA 2KNBA 4PS3A 3AXCA 2C60A 5JHBA 4EKUA 3A1QB 5L95C 3DBLI 4KSLC 5TR5A 3T8MA 1TTNA 2FIFA 1GC6A 2WYQA 5EDSA 1IYFA 1OGWA 3UQBA 4DHJB 1D3ZA 5BO4B 5E6PA 5D94A 1RLFA 4TUUA 3RUIB 2KTFA 4TKNA 2RPQA 1WXMA 4XC2A 4KV2A 4WAAA 3L0WB 3EC8A 5DPWA 2AEHA 3L10B 4WJPA 1C1YB 3DBHI 3B08A 1NDDA 3K9OB 4LCDE 4B6WA 1YX5B 4TV3A 4RMAA 3EHVA 4IUMB 2KJHB 3JVZX 4A3OA 4TQ0A 1WY8A 2RGFA 3ZDTA 2IY1B 3AI5A 1J0GA 4WJQA 3UINB 2KX3A 2WDTB 3DVNU 3SD5A 1U4AA 4FULA 3H6NA 4HDOA 1CMXB 1V2YA 4HWIB 4K81A 1M94A 4IM3A 5G2NA 1UH6A 1R4NI 1V5OA 2MBHA 3A1QA 3JSVA 2BWES 2KTRB 3Q3JA 3I3TB 1GG3A 3UGBB 2HE7A 1WX8A 5KHQA 1X1MA 3OJ4B 2KC1A 3IHPC 2GBNA 5GMVA 2ZPYA 2JWZA 4WWOA 3PTFC 2NR2A 1WRDB 3B0AA 1UD7A 4W9HA 1Y8RC 2Z0EB 4HPMB 4X57B 1G6JA 2J0MA 2AYOB 2XK5A 3GOEA 1BT0A 4EOYA 3ONSA 2KXJA 2K39A 2JY6A 3N30A 4MSMB 2CHZA 4BKTA 4XX5A 3DQVA 1WFYA 4DDGD 4MDKE 4GSWA 1WGRA 3ZRCA 2V3SA 2O6VD 5E6OA 5L83A 1ZKHA 4K7WA 2LVQA 4IM2A 3L08A 2FIDA 2LZ6A 4WQOB 3IFWB 3TJPA 4ANWA 5LXHA 4IG7B 2EMTA 1E7VA 1WGYA 4W9GA 3V60A 2M1MA 3NS8A 3OJ3A 3MTNB 4W9JA 2KTRA 1C3TA 4NPNA 4GN1A 4DHZE 2C7MB 2MSED 4KDIC 2N1WA 4DHZB 4A3PA 3A9KA 2DZKA 3TL5A 3VH3B 3HM3A 4GB9A 3DBRI 3PZDA 1S3SG 3VUXA 2MBQA 4JL9A 4W9KA 2GBJA 2IZVB 2G3QB 1WJ6A 1Z2MA 2NPTB 4WJOA 3KUCB 3RZWC 3NY5A 3APDA 2N9PC 4KSKC 1J19A 2KQSA 2LRWA 1UBQA 1GJZA 2J7QB 2JZZA 2I1KA 2L76A 4EZKA 5J18A 2UYZB 1WH3A 3M95A 5IAAC 5AZGA 4JGHB 4NAWB 4EUTA 2NBUA 3AU4A 1V86A 2BYVE 2EMSA 2UWQA 2N9EB 2LJ5A 1ISNA 2L8JA 2LVPA 2NVUI 2GBMA 4GMVA 4OVUA 1WIAA 3ML9A 4WJNA 3ZKJC 4URKA 1EF5A 2KWCA 2GMIC 3UQAA 4W9IA 2WX1A 3DCGA 3H9DA 2MA9B 4MELA 2RR9A 2KO3A 2JT4B 3R66C 2BPSA 1WXVA 1KM7A 3ML8A 2EKEC 1H8CA 1R4MI 2ASQA 1OQYA 2GBRA 2ZNVC 3JYUA 4W9CA 5AZHA 1YQBA 4ANUA 1WM2A 2NPTA 3ZLZA 4AOFA 4KVGB 2K8HA 2MP2A 2ZVOA 4BKSD 2FCNA 3TCAA 3ZNGC 2K8CA 4K1RB 2AL3A 1V9JA 2KMCA 4II2B 3X0WA 3JSVB 2IYDB 2A4ZA 3A33B 2PJHA 4MJSB 4NAWA 3RD2A 3TMPB 4ASWC 3QAQA 5G55A 2KJRA 2JUOA 1V81A 5D6JB 2ZCBA 2C7HA 1UGMA 2JZ3B 2DYMA 2FCMA 2XBBC 3JW0X 4FJVB 4PYUA 3WANA 2ZNVB 2PE9A 2REXA 1AARA 1WF9A 5DCNA 3K9PB 3KYCD 3ZNZB 4BVUC 1I42A 1NBFC 4GIVA 4BFRA 2M17A 1WGDA 3SDLC 3DPDA 3PS6A 2HD5B 2IO3B 2XK5B 3V62A 2MCNB 4ZRJA 1S1QB 3UF8A 3RULA 2LGDA 1SGHA 2ZZPB 1H4RA 2DAFA 2LI5A 4OVVA 2KWUB 2N7DA 2ZVNA 3CSTA 2IO2B 3PRMB 4G0NB 4E74A 2CU1A 2OOBB 4G11A 2MWSB 2N9XA 4ZRKA 2KHWB 4W9DA 4HVBA 2KVRA 3VTWA 4AJYB 1KOTA 3BY4B 5D2MB 4MJSA 4MGIE 3H1UA 3KW5B 4JIOU 3H7PB 1SIFA 5HKHA 2ZJDA 2IY0B 4AP4C 1WI0A 3PV1A 2O6VB 3A9KB 3KYDD 3MHSD 2DYBA 4ZYNA 4N9F4 4BOZB 4MGYE 4E71A 2MBOA 2KD0A 4ICUA 2KFKA 2WX0A 4NQLB 4HCNB 4GXBA 4EZLA 1P1AA 2BYEA 2K8BA 4TQ1A 3QARA 4KZ0A 1E8YA 1WZ0A 3WAPA 2KQ7A 3A4SC 3L54A 2V4LA 2N4FA 2KDEB 3VXWA 2JF5A 2MRPA 2KKCA 3VTVA 2KOXA 4I6LB 1XQQA 4KZCA 3PLUA 5DPTA 1TZ1A 3APCA 3R3MA 2MQJA 4P7IA 4GDKB 2D11A 3LJ3A 4YL8A 2KK8A 1FXTB 2MLBA 2C9WB 3AU5A 4M8NA 2LVOA 4IWOA 3ZTCA 3HIZA 4DK5A 2J0JA 3QC8B 2NCNA 2KANA 2ZPNA 4RM9A 3W1SC 2KDBA 3AULA 3WAMA 2KZRA 3H7PA 5CX3A 2FNJB 2O6VA 1GNUA 4DXAB 4I6PA 5J2RA 3A4RA 3PREA 2HTHA 2J0KA 4FLHA 4A20A 2OJRA 4HK2A 4IWQA 4LDTD 3PLVA 1GUAB 3HHMA 3NOBA 1WX7A 2NBVB 3QCAA 1MG8A 3QA8A 2MP2B 2L3ZA 2DZMA 2YLMA 1OEYJ 4M0WB 2C7NB 4ICVA 1WJNA 3IBEA 4IW0A 2G4SA 4HLEA 3TBLD 4EZJA 3KVFB 2L00B 3VTUA 1L2NA 2PE6B 4GDKA 3V6CB 4G50A 2B3AA 5DPRA 2WWZA 2FCSA 4AUQC 2KMAA 2IBIB 5J17A 1IPGA 1ZGUB 3VQIA 2ZEQA 3KH0A 4HJKA 5CTRC 3U7DA 2Z0DB 4LJOB 5JH5C 4II3B 1KLVA 3OAWA 4NQKE 4J6IA 3O65B 3R7RA 2RSUA 3QK0A 2DENB 2QHOA 1E7UA 1YIWA 2AWTA 1K8RB 2M4NA 3MJWA 3DBSA 1OEYA 1IP9A 3ZDMC 4IC7B 4NJ7A 4WWNA 2LUEA 1JRUA 2KLGA 2L7RA 3PRZA 1WYWB 4I6NB 1Q0WB 2L0TA 4EEWA 5C1ZA 1L7YA 2NBWB 3M3JA 1LQBA 1Q5WB 3C0RB 1XD3B 3UIPB 3W1SA 3KUZA 3VVWB 4F7ZA 1RRBA 2MW5A 2GOWA 4MH0E 1PQSA 2L05A 4JLCA 4BKSA 4AJWA 4BBNF 5C23A 2DZIA 3VH4B 1YJ1A 2KFKB 2KX0A 2D07B 3HM6X 4JQWC 3QX1A 4AWJA 2KFJA 4MGKE 4WWPA 1V49A 5D7GA 2MX2A 3ZVVA 4GOCA 4HXDA 3UIOB 4FHJA 2HJ8A 2CHXA 2D10A 4B9KA 2KLCA 2KDFB 3CF6E 1Q1OA 3IVFA 3L17A 1A5RA 4B95A 4EFOA 2FUHB 2V1YA 3A9JB 4MGZE 3QJZA 4CYEA 5E6NA 2K1FA 2LXCA 3CMMB 3L13A 1WR1A 1WZ3A 2G4DB 2KN5A 2M0XA 3EFUA 3HK0A 3M62B 5LLIA 2K6DB 3PPAA 3VDZA 1V5TA 1WE6A 2XEWA 1P9DU 2CHWA 4XZ4A 2KC2A 3CSFA 4W9EA 3RZFA 4LJPB 5CHFA 2LGYA 4GGQA 3W1YA 3ENEA 3DDCB 3WIMA 2FAZA 1YX6B 1QZEA 2LASA 4GU2A 4PYZA 4FJZA 3DVGX 4W9FA 4MM3A 2D2QA 2Z59B 3NZUA 5CHVC 2KJ6A 3KUDB 1V80A 3RCZA 4DHJD 1WXSA 4FJYA 1EUVB 2C5LC 3BINA 2NS5A 4NNJB 3ZTDA 3VUWA 3X23A 3NHEB 2O2VB 1KJTA 2M8SA 3NZSA 3ECIA 3SHQA 5CHWA 1E8XA 4DBGA 1TBEA 2YVCA 3ZO5B 3D32A 3Q3FA 2N7EA 2JVCA 2FCQA 4RM8A 3TIXA 3WAOA 4CHKA 3ZW3A 3A9JA 1OTRB 4GDLB 2MBEA
chains in the Genus database with same CATH superfamily
4CO7A 1EWCA 2BYFA 2DZJA 4FHKA 3QIJA 5AUIA 1I35A 3RT3B 3L4PA 5MPOA 1NENB 2JXXA 1B9RA 3ZIMA 1VD2A 5LXIB 3QQ8B 4JX1C 1DOIA 1WGGA 1WGHA 1FD6A 2ZCCA 2OJWA 3LXFA 4F8CB 2O2VA 4F1SA 3B2FA 2K0PA 4LNOA 2VRRB 1WXAA 1F77A 1QF6A 4ZDVA 4IM0A 5FR6A 4XGAB 1ZW7A 2LRUA 3V6EB 4ANXA 3RYTA 1V6EA 2N1VA 3PHWB 1KF6B 3PHXB 2LWPA 4RH6A 3ZUNA 3OLMD 2LFIA 4G3XB 2CKHB 4K7SA 4HDQA 2JWUA 3APFA 2Y5BB 3GZNI 1UZXB 4NJ6A 2GLSA 1SSNA 4ZRIA 1WRIA 3GE3C 2DWQA 2BGFA 3SR6A 2IGDA 2GB1A 1QQRA 2WDRB 1DOYA 2KDIA 4PS8A 1WM3A 2CR5A 2LXAA 3N1XC 2K5PA 4DXFA 2SEBD 3TEWA 1EF1A 1TJEA 4HPLB 3DHGC 3PSEB 1L4DB 4KIKA 1WMHA 3AV8A 4RFBA 4PS3A 5L95C 4GLSC 4KSLC 4TMAB 1T5XD 3T8MA 1TTNA 3NVZA 4USAA 3NUHB 3RUIB 2KTFA 2YEPB 4XC2A 3R2IA 3L0WB 4ZHOA 3NVWA 3L10B 4WJPA 3W5VB 3B08A 3K9OB 2L32A 4RGMA 1ET9A 4YT0B 2BB5A 3EHVA 4IUMB 3JVZX 1WY8A 2IY1B 4WJQA 3BK2A 3SD5A 1U4AA 3H6NA 1EU4A 3GS2A 1V5OA 3JSVA 3I3TB 1TYGB 1BMLC 3E56A 4C56C 3BVGA 2WXKA 1OQQA 3IHPC 3FAHA 2ZPYA 4M01A 1N63A 2NR2A 4X57B 4EOYA 2KXJA 1LO5D 2K39A 1TIFA 4NJCA 3DQVA 4MDKE 3ZRCA 1WGRA 5L83A 1ZKHA 4K7WA 4IM2A 1CZPA 5BMGA 4A55A 4IOIE 1SIJA 1FMAD 1C3TA 4GN1A 1MPEA 4DHZE 2C7MB 4MH8A 1UF0A 2J42A 1SB3C 2WU2B 4P1CC 3Q2AC 2GBJA 2WS3B 1Z2MA 2M56B 4PT5A 4C00A 3LB8C 2PKOA 5EE3A 3M95A 4JGHB 4NAWB 3NZ3A 2BS3B 3AU4A 2IJ0A 2LJ5A 1AWDA 2L8JA 2LVPA 2GBMA 3ZKJC 4P1BC 4US9A 3UQAA 4W9IA 3DCGA 2KO3A 2JT4B 3AE3B 2QIEB 4YTPB 3MFGA 4AOFA 4KVGB 2K8HA 2MP2A 4YSZB 4CQNA 2FCNA 1IUEA 1Q10A 2IYDB 3A33B 2PJHA 2WXMA 2KJRA 2JUOA 1WYGA 4L2YA 3FILB 2DYMA 4PYUA 1E7PB 3WANA 3K9PB 2QJLA 3BVZA 4BFRA 2M17A 2XK5B 3V62A 1MVKA 1N61A 3RFZB 5TSSA 2ZZPB 3Q8CA 2SAKA 3R8BA 2KWUB 2ZVNA 4G0NB 1ET6A 1SJHD 1VZ8A 1XLNA 2CU1A 2OOBB 3MP9A 2MWSB 4ZRKA 4XWTA 3VTWA 3Q3MC 5HKHA 2HDEA 2W82A 2W54A 4N9F4 4E71A 2KD0A 4ICUA 3ZJUA 1C9FA 2ZW0A 4TQ1A 3QARA 3Q8EA 3Q3OC 1E8YA 3WAPA 2JYTA 2V4LA 5FKAC 2KDEB 3VXWA 2KKCA 3N1ZC 1P7FA 4KZCA 1MHXA 4LTUA 1CJEA 4P7IA 1SEBD 2C9WB 2LVOA 3IAM1 3ZQ4A 2GI9A 2ZPNA 3H7PA 5D3IB 4K3BA 2O6VA 2KWDA 5HG2A 1NYQA 4I6PA 5J2RA 3A4RA 3PREA 2HTHA 2I38A 4FLHA 1PFDA 2XNAC 3RNAC 3QCAA 1MG8A 1OEYJ 4M0WB 2C7NB 1XO3A 1HZ5A 3IBEA 1AW7A 4GDKA 4G50A 5DPRA 3W5UB 1FIQA 4LNFA 2DNFA 2KMAA 2WU5B 2IBIB 1IPGA 1ZGUB 3P4QB 3KH0A 2RDBC 4HJKA 2KACA 5JH5C 2KT7A 1D5XC 1WSPA 1TY2A 1ACCA 1E7UA 1YIWA 1K8RB 1OEYA 3RNBC 4IC7B 4NJ7A 4WWNA 4QAYA 1WYWB 1Q0WB 2L0TA 1L7YA 4REZA 1LQBA 2JX5A 4LLGM 3W1SA 2BYTA 1JMLA 4BBNF 5BMIA 5C23A 1YJ1A 2KFKB 1I4RA 3HM6X 3QX1A 2ACZB 1I4HA 1JWUD 4WWPA 2JZPA 5D7GA 2MX2A 4HXDA 3UIOB 1XLQA 2IPKD 2QCZA 1YJJA 3L17A 1A5RA 4EFOA 3Q8BA 2MJEA 2LXCA 2LJIA 3L13A 1UWMA 4H2AA 2G4DB 1MJDA 2K6DB 3VDZA 1WE6A 5AUKA 4MACA 4W9EA 3UI3A 3DBLB 3KWVA 3WIMA 2LASA 4OZCA 4W9FA 1MI0A 2D2QA 2KJ6A 1V80A 1WXSA 2PW9A 3DBHB 3NHEB 2O2VB 2V3PA 3IXSA 1E8XA 3ZO5B 2N7EA 2FCQA 3BYTB 5LNK1 3TUOA 4A9AA 4CHKA 3A9JA 1OTRB 2CJNA 5HI1A 2DHZA 4DDID 3ZGZA 5JZEB 1FEHA 3DVGY 1LXDA 2JRHA 2M0AA 1R4NB 1UBIA 3PT2B 1VCBA 3DHIC 3LDZE 1T6BX 3J9CA 4C7ZA 2JQRB 5IO9A 5AEKB 1YQ4B 1WR6E 3VRAB 1T0RC 2NMQA 1TGZB 2V4IB 3SFEB 1EO6A 2W9NA 1IBXA 2AQ1B 4GDLA 3ZNID 1F9JA 1YQ3B 1E8ZA 3PGEA 2A5UA 4KX6B 2LD9A 2FE8A 5BMHA 3P4PB 4MEMA 2IO0B 4KIKB 1WMHB 4MSQB 4XDDA 2QDFA 2DAJA 3MHZA 3DBRB 5AZFA 3PRPB 1CQVA 4DQOC 3N3KB 4M8MA 4JWUC 3EECA 1MHHE 2UU7A 1C76A 3WALA 1UELA 2PLPA 3OG5A 2KAJA 1OQRA 4RF1A 1RWSA 3DOWA 1FNWA 4Q2JA 2R2OA 2AL6A 2MBBB 3AEAB 4JE3B 3PVLA 4AS1A 5JHAA 3ALBA 1Z5SB 4FADA 1RFAA 5KHOA 2LEKA 3P2BA 2L0FA 3ZJVA 1JROA 3DHHC 1XT9B 2WXOA 5I4DA 1SE4A 2KNBA 2Y3AA 2WXLA 3DBLI 1QOFA 3NJTA 2FIFA 3AE5B 2WYQA 1IYFA 4OZAA 1RLFA 1EWYC 4TKNA 2RPQA 3OWEB 4WAAA 1YN3A 5DPWA 2AEHA 3DBHI 4ZRQA 1YX5B 4TV3A 4RMAA 2PIAA 3BK1A 3I57A 1VRAB 3ZDTA 2N9LA 3AI5A 2KX3A 4OVZA 3DVNU 1V2YA 1Y56A 2V9HA 5G2NA 1R4NI 4YWGG 4YSYB 2L83A 3MJ5A 5KHQA 4C4VA 2VH2A 1L0VB 1SXTA 1T3QA 3R2TA 1XLOA 4WWOA 3B0AA 2Z8LA 4MT5A 4A90A 2JY6A 3N30A 2CHZA 4XX5A 4DDGD 2EELA 5E6OA 2LVQA 2LZ6A 3KWLA 5LXHA 4IG7B 1ZXIA 1T0QC 2M1MA 3OJ3A 2KTRA 2D5GA 4NPNA 2MSED 2N1WA 2JXTA 3A9KA 3RNGC 3VH3B 1GB4A 3HM3A 3DBRI 3PZDA 3AE7B 3BYYB 2IGGA 2IZVB 3KUCB 4KSKC 1J19A 2LRWA 1UBQA 1GJZA 2I1KA 4TSSA 2WXJA 2UYZB 1HTQA 5AZGA 1N60A 1V86A 2BYVE 2EMSA 2UWQA 2N9EB 2LGSA 4GMVA 4HRSA 4OVUA 2K22A 1WIAA 4WJNA 4LK0M 3H9DA 1L6UA 2MA9B 4MELA 3AH7A 2BPSA 2ASQA 1OQYA 4ANUA 1YQBA 1ZOYB 2NPTA 3ZLZA 2ZVOA 5FK9C 2K8CA 2AL3A 2KMCA 2A4ZA 1EM7A 1YJIA 5D6JB 2C7HA 3B2GA 2ZNVB 2WLBA 4GIVA 4RGTA 3SDLC 3DPDA 2HD5B 2IO3B 2MCNB 1S1QB 2LGDA 1WGKA 1SGHA 4OVVA 2BTEA 3CSTA 2J4XA 2WQYB 3PRMB 3SFDB 5BYRA 1F0ZA 4W9DA 2QMTA 1KOTA 3Q8AA 2VZKB 5D2MB 3BVMA 4RNAA 4JIOU 3KW5B 3H7PB 2ZJDA 1XEEA 2IY0B 4RGOS 4AP4C 1WI0A 1FXAA 2O6VB 1FPYA 3KYDD 1XF5L 2MBOA 2OEDA 2BYEA 2BS4B 1WZ0A 3A4SC 4JPSA 3L54A 2JF5A 2KN4A 4I6LB 1TS3A 3HVDA 3R3MA 2MQJA 4GDKB 1KLGD 2QSDA 3IT4B 2KK8A 5FR3A 3AU5A 4DK5A 3QC8B 2NCNA 4RM9A 2KDBA 1B1ZA 3HRDD 3NVYA 1TS2A 1GNUA 1C4PA 2J0KA 4IWQA 4HK2A 2ZW1A 3PLVA 1GUAB 1MFWA 2WXGA 2DZMA 3GE8C 2QC8A 5G5HA 2KQ4X 1NEKB 2AQ2B 2G4SA 4HLEA 1NI3A 4EZJA 3KVFB 1ZXHA 1L2NA 2RPVA 3V6CB 1FNUA 5D3DA 5J17A 1DYQA 3BIID 3U7DA 4LJOB 4A8XC 3LYYA 1KLVA 3OAWA 2DENB 2QHOA 2TSSA 3Q69A 2L7RA 3PRZA 4I6NB 3B9JA 4EEWA 5C1ZA 2D3BA 2NBWB 2LHEA 1XLPA 2JU6X 1C77A 3C0RB 1XD3B 3KUZA 5IN7A 4JWSC 4MH0E 1PQSA 3PO0A 3AEBB 4JLCA 1QT9A 4BKSA 1LGRA 2DZIA 3VH4B 4AWJA 2PVGC 1V49A 3AEFB 1E6EB 2HJ8A 2BT6A 2D10A 3MC0B 3IVFA 2OHFA 3ETRA 2FUHB 2V1YA 3A9JB 3QJZA 4O1NA 2K1FA 2WXNA 3M62B 1WZ3A 2M0XA 4ITKA 3RI7C 2XEWA 2CHWA 5EE9A 2KC2A 4L23A 4LJPB 4XWWA 3ENEA 1VR9A 1QZEA 4LNNA 4PYZA 4FJZA 3NZUA 3RCZA 1SE3A 2NS5A 4NNJB 3ZTDA 1KJTA 3AE2B 3RNCC 3SHQA 1TBEA 1V8CA 3Q3FA 1WWTA 1J7BA 2JVCA 3ZXRA 3TIXA 1IBXB 1F2RC 3ZW3A 4GDLB 2MBEA 4R3DA 4LDTB 1LFDA 1HE8A 3N32A 2K25A 2JRIB 3P63A 2GBKA 3DVNV 3T9LA 2PTLA 4KDLB 1ZE3D 4EE2A 3H7SA 1QOBA 4HEA1 3U4EG 2PEAA 4BKGA 1LM8B 1FO4A 3AECB 1FRRA 3B1LX 3ZXVA 2BW2A 3VR9B 2BKFA 2BKRB 4BOSC 3QHTA 3IG3A 1P98A 2N9KA 3VAWA 4OZBA 4DWFA 2X38A 1WX9A 2INDC 1TS5A 4WAFA 2BWFA 2G9HD 1E0ZA 3N9YC 2M19A 1P0RA 3P1MA 4HPPA 3EGRA 3I9V1 3KLSX 1J8CA 2EKIA 4IKGA 2KDMA 2IO1B 3V61A 4RCOA 3ZNHB 2DYOA 1I4PA 3SU8X 1F52A 1JW9D 2WNMA 2LGXA 3NRZA 4J3OD 1E9MA 1FCCC 2CS4A 1HXYD 2DX5B 2BF8B 1SBBB 3P4RB 2YEPF 2ON8A 4BBNC 1TT5B 1GC7A 1CK1A 5IKCM 1WJUA 3S2AA 1SE9A 3AXCA 2C60A 4A6QA 4US8A 5JHBA 3T3NA 3W2DA 1OGWA 4D2KA 1JQ4A 1D3ZA 5BO4B 5E6PA 4C4VB 1STEA 1KTKA 1QKZA 2INPE 2JYEA 3EC8A 2MJ3A 1VLBA 1C1YB 1UGJA 4B6WA 2AX5A 2E6XA 3UINB 2WDTB 3CWIA 1CMXB 1M94A 4IM3A 3V3XA 3A1QA 2KTRB 1GG3A 2HE7A 1WX8A 5EE0A 1OFFA 2GBNA 3NVVA 3PTFC 1WRDB 1UD7A 4W9HA 2J0MA 2AYOB 2XK5A 3GOEA 3ONSA 1IGDA 2VZKD 3U7ZA 1ROEA 2O6VD 4ANWA 1E7VA 1M4VA 4W9GA 3FKYA 3V60A 4W9JA 1UUPA 3NG0A 4KDIC 2K3UA 4A3PA 4DHZB 1XCQL 3NS1A 2WDQB 4GB9A 1S3SG 3VUXA 2MBQA 4JL9A 1PGBA 4W9KA 2G3QB 1WJ6A 2NPTB 4WJOA 3RZWC 2QILA 3APDA 2Y5PA 2N9PC 3RMKC 2KQSA 2J7QB 3DWMA 4EZKA 2MEKA 4EUTA 4K3CA 1N5WA 1VJKA 2NVUI 1YN5A 2BVCA 3ML9A 4URKA 1F1HA 2KWCA 2GMIC 3N20C 4LNIA 4N59A 1KM7A 3ML8A 1E10A 2EKEC 1IGCA 1MG4A 2WXFA 4W9CA 5GXGB 1KRHA 3ZNGC 4M00A 1QLBB 4K1RB 3TEYA 3X0WA 4II2B 4XDCA 3JSVB 4ASWC 2FBWB 3RD2A 3QAQA 1L5PA 2WHIA 1I4XA 1V81A 2QEJC 1GAQB 2E3TA 3JW0X 2XBBC 4FJVB 4DXGA 1NBFC 4PK1A 3IAS1 3Q14C 3GB1A 3I63C 3UF8A 2K9XA 4KGSA 1H4RA 2DAFA 2LI5A 4ARIA 2IO2B 4E74A 4G11A 4YTNB 2KHWB 3RNFC 4HVBA 2KVRA 4AJYB 3N1YC 4MJSA 3AN1A 3H1UA 4MGIE 4NAMA 2D3AA 2FUG1 4XE0A 3PV1A 3KQ4A 3MHSD 3TSSA 1V1PA 1J7CA 1RYJA 2WDVB 1A70A 2KFKA 4NQLB 1VZ7A 4HCNB 2WXQA 4GXBA 1P1AA 1V97A 2RMMA 4KZ0A 3AE6B 1XCTL 2KQ7A 1L0YB 2N4FA 2KVZA 3C19A 2Y5CA 2KOXA 3PLUA 1DGJA 2D11A 3H8HA 3LJ3A 4YL8A 4RF0A 2MLBA 1TKGA 3ZTCA 2MJDA 3HIZA 2J0JA 2KANA 3P42A 4WQMA 1BUIC 5CX3A 3IT6B 2B76B 3AE8B 2WXRA 4A20A 2HJ1A 3BWUD 2OJRA 4LDTD 1HEZE 1JRPA 3HHMA 3QA8A 2MP2B 1P7EA 1D5MC 1WJNA 2J52A 4L1BA 4IW0A 3DWGC 2INCC 1JWSD 2L52A 2FCSA 4WIPA 4BZAA 2ZEQA 3I5JC 2Z0DB 1FXIA 3PZ7A 1L0XB 4NQKE 3O65B 2RSUA 5C3JB 2M4NA 1K50A 5H8YE 2H89B 1FRDA 1FNVA 3ABVB 1FCLA 3M3JA 3AEEB 1Q5WB 4HKQA 1L6VA 3VVWB 4F7ZA 1RRBA 4HROA 3EUB2 3AMZA 2ONQA 5E6JA 5HHDG 2BBCA 4AJWA 3GP7A 1HA5A 4YXDB 2KX0A 1TS4A 3AE4B 4HKZE 2KFJA 1BXTA 5JXVA 3V05A 3EFCA 4FHJA 1JALA 3FC4A 2CHXA 4B9KA 2KLCA 2KDFB 3CF6E 1Q1OA 4B95A 4MGZE 4KKJA 1PDXA 1T0SC 4CYEA 5E6NA 3BZDB 1TKYA 3CMMB 3RNEC 1SJED 1D5ZC 1V5TA 1XXGA 4XZ4A 1ESFA 3CSFA 3RZFA 2LGYA 2LMCA 3W1YA 1ZUD2 3DDCB 2FAZA 4GU2A 2WXPA 1FFUA 4MM3A 5CHVC 1ENFA 2CU3A 1EUVB 2C5LC 1HQRD 2LUMA 3BINA 4FJYA 3X23A 2M8SA 3NZSA 3ECIA 5CHWA 1SF0A 5G5GA 2INNE 4RM8A 1UNSA 3PS6A 4IWOA 3DVGX 4PS7A 1RFKA 1C78A 2K6QA 2I1JA 1K53A 3ZJTA 1F2RI 1WJ4A 1WE7A 4HCPB 4KKIA 2WGSA 1EU3A 3M63B 4IWPA 5DPSA 2N7JA 5C2TB 3WA0A 1R7SA 4FN2A 5IA7A 4ANVA 1V1OA 1GPXA 4K7UA 1QOAA 2G45B 2JPHA 3VUYA 2RD0A 3L16A 2LHDA 1YN4A 4AQ7A 3W9CB 1FFVA 2KMMA 2JSVX 1E5WA 2PMVA 3AM9A 3O13A 3Q6BA 4WURA 2PPHA 2MH7A 1NI2A 3P4SB 1YOVB 3AE9B 3WCQA 4W9LA 1D4BA 2R2QA 1K51A 3C8YA 1YD8U 1T0YA 5IOIA 4P16A 1I7HA 3ZRFA 3EA6A 1VZ6A 1SE2A 3QWZB 1HZ6A 1P3QU 1YMHE 1TZOA 3R7QA 4FA6A 1E90A 1RAXA 2Q5WD 2KWVB 2BB6A 3VFKA 2J53A 2D3CA 3U30A 3U8ZA 2D3GA 2DLBA 4FBJB 4ZOHC 1E8WA 3VHTC 4NY0A 4E3CA 2PVOD 4EKUA 3A1QB 1R4MB 4ARCA 5TR5A 1GOZA 1GC6A 5EDSA 3UQBA 3HUIA 4DHJB 4NZLB 5D94A 4TUUA 3U52E 1WXMA 3RN9C 4KV2A 1NDDA 1N5XA 4LCDE 5T8IA 2KJHB 4A3OA 4TQ0A 2RGFA 1J0GA 4FULA 4HDOA 4HWIB 4K81A 1QOGA 1UH6A 1UWXA 2MBHA 2BWES 3Q3JA 3UGBB 1I4QA 1X1MA 3OJ4B 2KC1A 5GMVA 2JWZA 3AEDB 1G6JA 1Y8RC 2Z0EB 4HPMB 1PYWD 1BT0A 3AEGB 3MC8A 2H88B 4MSMB 2XN9C 4BKTA 2VH1A 1WFYA 1JWMD 4GSWA 2V3SA 3L08A 2FIDA 4WQOB 3TJPA 3IFWB 2EMTA 1WGYA 1PUTA 3TEZA 3NS8A 3MTNB 1KFYB 1HTOA 1KLUD 2AQ3B 1JWAD 2DZKA 3TL5A 2X8XX 2NTTA 4OW0A 4B0MA 1GB1A 1N62A 3TEXA 3NY5A 4XYCA 4KGRA 4HJGE 2V3NA 2JZZA 5BYSA 2L76A 5J18A 4C80A 3CIRB 1WH3A 5IAAC 2NBUA 1TY0A 1ISNA 4KGTA 4ZRPA 2MHJA 1EF5A 4OHJA 2WX1A 2W3RA 2I2YA 2RR9A 3R66C 1WXVA 1N6ZA 1H8CA 1R4MI 2NTSA 2GBRA 2ZNVC 3JYUA 5BYQA 5AZHA 3U2SC 1WM2A 4BKSD 3TCAA 2W55A 4M02A 1V9JA 4MJSB 4NAWA 3TMPB 4ZYSA 5G55A 4IDIA 3URYA 2ZCBA 1V1PB 1UGMA 2JZ3B 2FCMA 2PE9A 2REXA 1AARA 1WF9A 5DCNA 4BVUC 3KYCD 3ZNZB 1I42A 1DOXA 1WGDA 5H92C 4ZRJA 2DBYA 3RULA 4S0RA 2N7DA 2G1EA 1K52A 2N9XA 4B0EA 3BY4B 1VDVA 1D6EC 1SIFA 2RDGA 3A9KB 2DYBA 2RDHA 2WXIA 4ZYNA 3FILA 4BOZB 4MGYE 2WX0A 1ZDXA 4N6EB 2CJOA 4EZLA 2K8BA 4WWMA 1PGXA 1C4CA 1YNTE 2GRIA 4ACFA 2MRPA 2WXHA 3VTVA 1XQQA 4FXCA 1I4GA 5DPTA 1TZ1A 3APCA 4LNKA 1C4AA 5EE1A 1FXTB 4M8NA 1AN8A 1TKEA 3WAMA 3W1SC 3AULA 2KZRA 2LGIA 3T3OA 2FNJB 4DXAB 4ZHPA 4YSXB 2W3SA 1WXQA 3NOBA 1WX7A 2NBVB 2L3ZA 2YLMA 4ICVA 4C7YA 3TBLD 1ZP0B 1ZDVA 2L00B 3VTUA 2PE6B 2B3AA 3RPFC 2WWZA 2ICIA 4AUQC 2BQQA 1J7AA 3SEBA 2N0SB 3VQIA 5CTRC 3VR8B 3AB5A 4II3B 4J6IA 3R7RA 3QK0A 2AWTA 3MJWA 3DBSA 3VRBB 1IP9A 3ZDMC 2LUEA 1JRUA 2KLGA 2R61A 4M0WA 3PZ8A 2V0GA 1L4ZB 2WP9B 4BAXA 4S17A 3E9SA 3UIPB 1JWBD 2MW5A 2GOWA 1RM6C 3GZNB 2L05A 2IDYA 4MM3B 3Q3NC 2BS2B 3Q8FA 4P6VF 4RGNA 3ZYYX 2D07B 4JQWC 5IP4D 4MGKE 2KYWA 1FM0D 2HTME 3ZVVA 4GOCA 3MC9A 4N58A 1C79A 1JCKB 1WR1A 2KN5A 5LLIA 3HK0A 3EFUA 1PGAA 3PPAA 1AYFA 1P9DU 2L1AA 5CHFA 3HVZA 4GGQA 4YTMB 1YX6B 1NYRA 2Z59B 3KUDB 4DHJD 1KH0A 4UDUC 3VUWA 1NVID 1ZPSA 4WH4A 4DBGA 5HFYA 2YVCA 3D32A 3AE1B 3WAOA 1QILA 2IGHA
chains in the Genus database with same CATH topology
4CO7A 4LDTB 2BYFA 1LFDA 2DZJA 1HE8A 2DHZA 2I1JA 2K25A 2K6QA 3N32A 4FHKA 4DDID 3QIJA 5JZEB 1I35A 3RT3B 3DVGY 2JRIB 1WJ4A 1WE7A 1LXDA 2JRHA 2GBKA 4HCPB 1UBIA 3M63B 3PT2B 1VCBA 3DVNV 2JXXA 3LDZE 3T9LA 4IWPA 5DPSA 3ZIMA 1VD2A 5LXIB 4KDLB 3QQ8B 5AEKB 3WA0A 4FN2A 5IA7A 1WGGA 1WGHA 3H7SA 2ZCCA 4ANVA 4F8CB 1WR6E 2O2VA 4F1SA 1TGZB 2PEAA 4K7UA 4BKGA 1LM8B 2G45B 2JPHA 1EO6A 2W9NA 3VUYA 2RD0A 2VRRB 3B1LX 1WXAA 3L16A 4PS7A 2BKFA 2BKRB 4BOSC 4GDLA 3ZNID 3QHTA 3IG3A 4ZDVA 1P98A 1F9JA 4IM0A 5FR6A 3VAWA 1E5WA 4DWFA 1E8ZA 1ZW7A 2LRUA 3V6EB 4ANXA 1WX9A 1V6EA 2A5UA 2N1VA 3PGEA 3PHWB 3RYTA 3PHXB 2LD9A 2LWPA 2PPHA 3ZUNA 2BWFA 1NI2A 3OLMD 4G3XB 1P0RA 2CKHB 4K7SA 4MEMA 2IO0B 4KIKB 1WMHB 4MSQB 4W9LA 2R2QA 2DAJA 4HDQA 5AZFA 3PRPB 3APFA 1J8CA 2Y5BB 3GZNI 1UZXB 4NJ6A 1YD8U 1T0YA 2IO1B 3N3KB 4ZRIA 4M8MA 3V61A 3ZRFA 3EECA 3ZNHB 2DYOA 3SU8X 2BGFA 2LGXA 3WALA 3QWZB 1UELA 1P3QU 2CS4A 3R7QA 4FA6A 2KDIA 2DX5B 4PS8A 1E90A 3DOWA 2BF8B 1RAXA 1WM3A 2R2OA 2CR5A 2LXAA 2KWVB 2AL6A 4BBNC 1GC7A 2MBBB 3VFKA 3U30A 3U8ZA 3PVLA 2D3GA 1EF1A 5JHAA 3ALBA 1Z5SB 4HPLB 4FBJB 1RFAA 5KHOA 4FADA 3P2BA 1E8WA 1WJUA 2L0FA 3S2AA 1SE9A 3PSEB 4NY0A 4KIKA 3VHTC 1XT9B 1WMHA 4E3CA 2KNBA 4PS3A 3AXCA 2C60A 5JHBA 4EKUA 3A1QB 5L95C 3DBLI 4KSLC 5TR5A 3T8MA 1TTNA 2FIFA 1GC6A 2WYQA 5EDSA 1IYFA 1OGWA 3UQBA 4DHJB 1D3ZA 5BO4B 5E6PA 5D94A 1RLFA 4TUUA 3RUIB 2KTFA 4TKNA 2RPQA 1WXMA 4XC2A 4KV2A 4WAAA 3L0WB 3EC8A 5DPWA 2AEHA 3L10B 4WJPA 1C1YB 3DBHI 3B08A 1NDDA 3K9OB 4LCDE 4B6WA 1YX5B 4TV3A 4RMAA 3EHVA 4IUMB 2KJHB 3JVZX 4A3OA 4TQ0A 1WY8A 2RGFA 3ZDTA 2IY1B 3AI5A 1J0GA 4WJQA 3UINB 2KX3A 2WDTB 3DVNU 3SD5A 1U4AA 4FULA 3H6NA 4HDOA 1CMXB 1V2YA 4HWIB 4K81A 1M94A 4IM3A 5G2NA 1UH6A 1R4NI 1V5OA 2MBHA 3A1QA 3JSVA 2BWES 2KTRB 3Q3JA 3I3TB 1GG3A 3UGBB 2HE7A 1WX8A 5KHQA 1X1MA 3OJ4B 2KC1A 3IHPC 2GBNA 5GMVA 2ZPYA 2JWZA 4WWOA 3PTFC 2NR2A 1WRDB 3B0AA 1UD7A 4W9HA 1Y8RC 2Z0EB 4HPMB 4X57B 1G6JA 2J0MA 2AYOB 2XK5A 3GOEA 1BT0A 4EOYA 3ONSA 2KXJA 2K39A 2JY6A 3N30A 4MSMB 2CHZA 4BKTA 4XX5A 3DQVA 1WFYA 4DDGD 4MDKE 4GSWA 1WGRA 3ZRCA 2V3SA 2O6VD 5E6OA 5L83A 1ZKHA 4K7WA 2LVQA 4IM2A 3L08A 2FIDA 2LZ6A 4WQOB 3IFWB 3TJPA 4ANWA 5LXHA 4IG7B 2EMTA 1E7VA 1WGYA 4W9GA 3V60A 2M1MA 3NS8A 3OJ3A 3MTNB 4W9JA 2KTRA 1C3TA 4NPNA 4GN1A 4DHZE 2C7MB 2MSED 4KDIC 2N1WA 4DHZB 4A3PA 3A9KA 2DZKA 3TL5A 3VH3B 3HM3A 4GB9A 3DBRI 3PZDA 1S3SG 3VUXA 2MBQA 4JL9A 4W9KA 2GBJA 2IZVB 2G3QB 1WJ6A 1Z2MA 2NPTB 4WJOA 3KUCB 3RZWC 3NY5A 3APDA 2N9PC 4KSKC 1J19A 2KQSA 2LRWA 1UBQA 1GJZA 2J7QB 2JZZA 2I1KA 2L76A 4EZKA 5J18A 2UYZB 1WH3A 3M95A 5IAAC 5AZGA 4JGHB 4NAWB 4EUTA 2NBUA 3AU4A 1V86A 2BYVE 2EMSA 2UWQA 2N9EB 2LJ5A 1ISNA 2L8JA 2LVPA 2NVUI 2GBMA 4GMVA 4OVUA 1WIAA 3ML9A 4WJNA 3ZKJC 4URKA 1EF5A 2KWCA 2GMIC 3UQAA 4W9IA 2WX1A 3DCGA 3H9DA 2MA9B 4MELA 2RR9A 2KO3A 2JT4B 3R66C 2BPSA 1WXVA 1KM7A 3ML8A 2EKEC 1H8CA 1R4MI 2ASQA 1OQYA 2GBRA 2ZNVC 3JYUA 4W9CA 5AZHA 1YQBA 4ANUA 1WM2A 2NPTA 3ZLZA 4AOFA 4KVGB 2K8HA 2MP2A 2ZVOA 4BKSD 2FCNA 3TCAA 3ZNGC 2K8CA 4K1RB 2AL3A 1V9JA 2KMCA 4II2B 3X0WA 3JSVB 2IYDB 2A4ZA 3A33B 2PJHA 4MJSB 4NAWA 3RD2A 3TMPB 4ASWC 3QAQA 5G55A 2KJRA 2JUOA 1V81A 5D6JB 2ZCBA 2C7HA 1UGMA 2JZ3B 2DYMA 2FCMA 2XBBC 3JW0X 4FJVB 4PYUA 3WANA 2ZNVB 2PE9A 2REXA 1AARA 1WF9A 5DCNA 3K9PB 3KYCD 3ZNZB 4BVUC 1I42A 1NBFC 4GIVA 4BFRA 2M17A 1WGDA 3SDLC 3DPDA 3PS6A 2HD5B 2IO3B 2XK5B 3V62A 2MCNB 4ZRJA 1S1QB 3UF8A 3RULA 2LGDA 1SGHA 2ZZPB 1H4RA 2DAFA 2LI5A 4OVVA 2KWUB 2N7DA 2ZVNA 3CSTA 2IO2B 3PRMB 4G0NB 4E74A 2CU1A 2OOBB 4G11A 2MWSB 2N9XA 4ZRKA 2KHWB 4W9DA 4HVBA 2KVRA 3VTWA 4AJYB 1KOTA 3BY4B 5D2MB 4MJSA 4MGIE 3H1UA 3KW5B 4JIOU 3H7PB 1SIFA 5HKHA 2ZJDA 2IY0B 4AP4C 1WI0A 3PV1A 2O6VB 3A9KB 3KYDD 3MHSD 2DYBA 4ZYNA 4N9F4 4BOZB 4MGYE 4E71A 2MBOA 2KD0A 4ICUA 2KFKA 2WX0A 4NQLB 4HCNB 4GXBA 4EZLA 1P1AA 2BYEA 2K8BA 4TQ1A 3QARA 4KZ0A 1E8YA 1WZ0A 3WAPA 2KQ7A 3A4SC 3L54A 2V4LA 2N4FA 2KDEB 3VXWA 2JF5A 2MRPA 2KKCA 3VTVA 2KOXA 4I6LB 1XQQA 4KZCA 3PLUA 5DPTA 1TZ1A 3APCA 3R3MA 2MQJA 4P7IA 4GDKB 2D11A 3LJ3A 4YL8A 2KK8A 1FXTB 2MLBA 2C9WB 3AU5A 4M8NA 2LVOA 4IWOA 3ZTCA 3HIZA 4DK5A 2J0JA 3QC8B 2NCNA 2KANA 2ZPNA 4RM9A 3W1SC 2KDBA 3AULA 3WAMA 2KZRA 3H7PA 5CX3A 2FNJB 2O6VA 1GNUA 4DXAB 4I6PA 5J2RA 3A4RA 3PREA 2HTHA 2J0KA 4FLHA 4A20A 2OJRA 4HK2A 4IWQA 4LDTD 3PLVA 1GUAB 3HHMA 3NOBA 1WX7A 2NBVB 3QCAA 1MG8A 3QA8A 2MP2B 2L3ZA 2DZMA 2YLMA 1OEYJ 4M0WB 2C7NB 4ICVA 1WJNA 3IBEA 4IW0A 2G4SA 4HLEA 3TBLD 4EZJA 3KVFB 2L00B 3VTUA 1L2NA 2PE6B 4GDKA 3V6CB 4G50A 2B3AA 5DPRA 2WWZA 2FCSA 4AUQC 2KMAA 2IBIB 5J17A 1IPGA 1ZGUB 3VQIA 2ZEQA 3KH0A 4HJKA 5CTRC 3U7DA 2Z0DB 4LJOB 5JH5C 4II3B 1KLVA 3OAWA 4NQKE 4J6IA 3O65B 3R7RA 2RSUA 3QK0A 2DENB 2QHOA 1E7UA 1YIWA 2AWTA 1K8RB 2M4NA 3MJWA 3DBSA 1OEYA 1IP9A 3ZDMC 4IC7B 4NJ7A 4WWNA 2LUEA 1JRUA 2KLGA 2L7RA 3PRZA 1WYWB 4I6NB 1Q0WB 2L0TA 4EEWA 5C1ZA 1L7YA 2NBWB 3M3JA 1LQBA 1Q5WB 3C0RB 1XD3B 3UIPB 3W1SA 3KUZA 3VVWB 4F7ZA 1RRBA 2MW5A 2GOWA 4MH0E 1PQSA 2L05A 4JLCA 4BKSA 4AJWA 4BBNF 5C23A 2DZIA 3VH4B 1YJ1A 2KFKB 2KX0A 2D07B 3HM6X 4JQWC 3QX1A 4AWJA 2KFJA 4MGKE 4WWPA 1V49A 5D7GA 2MX2A 3ZVVA 4GOCA 4HXDA 3UIOB 4FHJA 2HJ8A 2CHXA 2D10A 4B9KA 2KLCA 2KDFB 3CF6E 1Q1OA 3IVFA 3L17A 1A5RA 4B95A 4EFOA 2FUHB 2V1YA 3A9JB 4MGZE 3QJZA 4CYEA 5E6NA 2K1FA 2LXCA 3CMMB 3L13A 1WR1A 1WZ3A 2G4DB 2KN5A 2M0XA 3EFUA 3HK0A 3M62B 5LLIA 2K6DB 3PPAA 3VDZA 1V5TA 1WE6A 2XEWA 1P9DU 2CHWA 4XZ4A 2KC2A 3CSFA 4W9EA 3RZFA 4LJPB 5CHFA 2LGYA 4GGQA 3W1YA 3ENEA 3DDCB 3WIMA 2FAZA 1YX6B 1QZEA 2LASA 4GU2A 4PYZA 4FJZA 3DVGX 4W9FA 4MM3A 2D2QA 2Z59B 3NZUA 5CHVC 2KJ6A 3KUDB 1V80A 3RCZA 4DHJD 1WXSA 4FJYA 1EUVB 2C5LC 3BINA 2NS5A 4NNJB 3ZTDA 3VUWA 3X23A 3NHEB 2O2VB 1KJTA 2M8SA 3NZSA 3ECIA 3SHQA 5CHWA 1E8XA 4DBGA 1TBEA 2YVCA 3ZO5B 3D32A 3Q3FA 2N7EA 2JVCA 2FCQA 4RM8A 3TIXA 3WAOA 4CHKA 3ZW3A 3A9JA 1OTRB 4GDLB 2MBEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CO7 A;  4LDT B;  2BYF A;  1LFD A;  2DZJ A;  1HE8 A;  2DHZ A;  2I1J A;  2K25 A;  2K6Q A;  3N32 A;  4FHK A;  4DDI D;  3QIJ A;  5JZE B;  1I35 A;  3RT3 B;  3DVG Y;  2JRI B;  1WJ4 A;  1WE7 A;  1LXD A;  2JRH A;  2GBK A;  4HCP B;  1UBI A;  3M63 B;  3PT2 B;  1VCB A;  3DVN V;  2JXX A;  3LDZ E;  3T9L A;  4IWP A;  5DPS A;  3ZIM A;  1VD2 A;  5LXI B;  4KDL B;  3QQ8 B;  5AEK B;  3WA0 A;  4FN2 A;  5IA7 A;  1WGG A;  1WGH A;  3H7S A;  2ZCC A;  4ANV A;  4F8C B;  1WR6 E;  2O2V A;  4F1S A;  1TGZ B;  2PEA A;  4K7U A;  4BKG A;  1LM8 B;  2G45 B;  2JPH A;  1EO6 A;  2W9N A;  3VUY A;  2RD0 A;  2VRR B;  3B1L X;  1WXA A;  3L16 A;  4PS7 A;  2BKF A;  2BKR B;  4BOS C;  4GDL A;  3ZNI D;  3QHT A;  3IG3 A;  4ZDV A;  1P98 A;  1F9J A;  4IM0 A;  5FR6 A;  3VAW A;  1E5W A;  4DWF A;  1E8Z A;  1ZW7 A;  2LRU A;  3V6E B;  4ANX A;  1WX9 A;  1V6E A;  2A5U A;  2N1V A;  3PGE A;  3PHW B;  3RYT A;  3PHX B;  2LD9 A;  2LWP A;  2PPH A;  3ZUN A;  2BWF A;  1NI2 A;  3OLM D;  4G3X B;  1P0R A;  2CKH B;  4K7S A;  4MEM A;  2IO0 B;  4KIK B;  1WMH B;  4MSQ B;  4W9L A;  2R2Q A;  2DAJ A;  4HDQ A;  5AZF A;  3PRP B;  3APF A;  1J8C A;  2Y5B B;  3GZN I;  1UZX B;  4NJ6 A;  1YD8 U;  1T0Y A;  2IO1 B;  3N3K B;  4ZRI A;  4M8M A;  3V61 A;  3ZRF A;  3EEC A;  3ZNH B;  2DYO A;  3SU8 X;  2BGF A;  2LGX A;  3WAL A;  3QWZ B;  1UEL A;  1P3Q U;  2CS4 A;  3R7Q A;  4FA6 A;  2KDI A;  2DX5 B;  4PS8 A;  1E90 A;  3DOW A;  2BF8 B;  1RAX A;  1WM3 A;  2R2O A;  2CR5 A;  2LXA A;  2KWV B;  2AL6 A;  4BBN C;  1GC7 A;  2MBB B;  3VFK A;  3U30 A;  3U8Z A;  3PVL A;  2D3G A;  1EF1 A;  5JHA A;  3ALB A;  1Z5S B;  4HPL B;  4FBJ B;  1RFA A;  5KHO A;  4FAD A;  3P2B A;  1E8W A;  1WJU A;  2L0F A;  3S2A A;  1SE9 A;  3PSE B;  4NY0 A;  4KIK A;  3VHT C;  1XT9 B;  1WMH A;  4E3C A;  2KNB A;  4PS3 A;  3AXC A;  2C60 A;  5JHB A;  4EKU A;  3A1Q B;  5L95 C;  3DBL I;  4KSL C;  5TR5 A;  3T8M A;  1TTN A;  2FIF A;  1GC6 A;  2WYQ A;  5EDS A;  1IYF A;  1OGW A;  3UQB A;  4DHJ B;  1D3Z A;  5BO4 B;  5E6P A;  5D94 A;  1RLF A;  4TUU A;  3RUI B;  2KTF A;  4TKN A;  2RPQ A;  1WXM A;  4XC2 A;  4KV2 A;  4WAA A;  3L0W B;  3EC8 A;  5DPW A;  2AEH A;  3L10 B;  4WJP A;  1C1Y B;  3DBH I;  3B08 A;  1NDD A;  3K9O B;  4LCD E;  4B6W A;  1YX5 B;  4TV3 A;  4RMA A;  3EHV A;  4IUM B;  2KJH B;  3JVZ X;  4A3O A;  4TQ0 A;  1WY8 A;  2RGF A;  3ZDT A;  2IY1 B;  3AI5 A;  1J0G A;  4WJQ A;  3UIN B;  2KX3 A;  2WDT B;  3DVN U;  3SD5 A;  1U4A A;  4FUL A;  3H6N A;  4HDO A;  1CMX B;  1V2Y A;  4HWI B;  4K81 A;  1M94 A;  4IM3 A;  5G2N A;  1UH6 A;  1R4N I;  1V5O A;  2MBH A;  3A1Q A;  3JSV A;  2BWE S;  2KTR B;  3Q3J A;  3I3T B;  1GG3 A;  3UGB B;  2HE7 A;  1WX8 A;  5KHQ A;  1X1M A;  3OJ4 B;  2KC1 A;  3IHP C;  2GBN A;  5GMV A;  2ZPY A;  2JWZ A;  4WWO A;  3PTF C;  2NR2 A;  1WRD B;  3B0A A;  1UD7 A;  4W9H A;  1Y8R C;  2Z0E B;  4HPM B;  4X57 B;  1G6J A;  2J0M A;  2AYO B;  2XK5 A;  3GOE A;  1BT0 A;  4EOY A;  3ONS A;  2KXJ A;  2K39 A;  2JY6 A;  3N30 A;  4MSM B;  2CHZ A;  4BKT A;  4XX5 A;  3DQV A;  1WFY A;  4DDG D;  4MDK E;  4GSW A;  1WGR A;  3ZRC A;  2V3S A;  2O6V D;  5E6O A;  5L83 A;  1ZKH A;  4K7W A;  2LVQ A;  4IM2 A;  3L08 A;  2FID A;  2LZ6 A;  4WQO B;  3IFW B;  3TJP A;  4ANW A;  5LXH A;  4IG7 B;  2EMT A;  1E7V A;  1WGY A;  4W9G A;  3V60 A;  2M1M A;  3NS8 A;  3OJ3 A;  3MTN B;  4W9J A;  2KTR A;  1C3T A;  4NPN A;  4GN1 A;  4DHZ E;  2C7M B;  2MSE D;  4KDI C;  2N1W A;  4DHZ B;  4A3P A;  3A9K A;  2DZK A;  3TL5 A;  3VH3 B;  3HM3 A;  4GB9 A;  3DBR I;  3PZD A;  1S3S G;  3VUX A;  2MBQ A;  4JL9 A;  4W9K A;  2GBJ A;  2IZV B;  2G3Q B;  1WJ6 A;  1Z2M A;  2NPT B;  4WJO A;  3KUC B;  3RZW C;  3NY5 A;  3APD A;  2N9P C;  4KSK C;  1J19 A;  2KQS A;  2LRW A;  1UBQ A;  1GJZ A;  2J7Q B;  2JZZ A;  2I1K A;  2L76 A;  4EZK A;  5J18 A;  2UYZ B;  1WH3 A;  3M95 A;  5IAA C;  5AZG A;  4JGH B;  4NAW B;  4EUT A;  2NBU A;  3AU4 A;  1V86 A;  2BYV E;  2EMS A;  2UWQ A;  2N9E B;  2LJ5 A;  1ISN A;  2L8J A;  2LVP A;  2NVU I;  2GBM A;  4GMV A;  4OVU A;  1WIA A;  3ML9 A;  4WJN A;  3ZKJ C;  4URK A;  1EF5 A;  2KWC A;  2GMI C;  3UQA A;  4W9I A;  2WX1 A;  3DCG A;  3H9D A;  2MA9 B;  4MEL A;  2RR9 A;  2KO3 A;  2JT4 B;  3R66 C;  2BPS A;  1WXV A;  1KM7 A;  3ML8 A;  2EKE C;  1H8C A;  1R4M I;  2ASQ A;  1OQY A;  2GBR A;  2ZNV C;  3JYU A;  4W9C A;  5AZH A;  1YQB A;  4ANU A;  1WM2 A;  2NPT A;  3ZLZ A;  4AOF A;  4KVG B;  2K8H A;  2MP2 A;  2ZVO A;  4BKS D;  2FCN A;  3TCA A;  3ZNG C;  2K8C A;  4K1R B;  2AL3 A;  1V9J A;  2KMC A;  4II2 B;  3X0W A;  3JSV B;  2IYD B;  2A4Z A;  3A33 B;  2PJH A;  4MJS B;  4NAW A;  3RD2 A;  3TMP B;  4ASW C;  3QAQ A;  5G55 A;  2KJR A;  2JUO A;  1V81 A;  5D6J B;  2ZCB A;  2C7H A;  1UGM A;  2JZ3 B;  2DYM A;  2FCM A;  2XBB C;  3JW0 X;  4FJV B;  4PYU A;  3WAN A;  2ZNV B;  2PE9 A;  2REX A;  1AAR A;  1WF9 A;  5DCN A;  3K9P B;  3KYC D;  3ZNZ B;  4BVU C;  1I42 A;  1NBF C;  4GIV A;  4BFR A;  2M17 A;  1WGD A;  3SDL C;  3DPD A;  3PS6 A;  2HD5 B;  2IO3 B;  2XK5 B;  3V62 A;  2MCN B;  4ZRJ A;  1S1Q B;  3UF8 A;  3RUL A;  2LGD A;  1SGH A;  2ZZP B;  1H4R A;  2DAF A;  2LI5 A;  4OVV A;  2KWU B;  2N7D A;  2ZVN A;  3CST A;  2IO2 B;  3PRM B;  4G0N B;  4E74 A;  2CU1 A;  2OOB B;  4G11 A;  2MWS B;  2N9X A;  4ZRK A;  2KHW B;  4W9D A;  4HVB A;  2KVR A;  3VTW A;  4AJY B;  1KOT A;  3BY4 B;  5D2M B;  4MJS A;  4MGI E;  3H1U A;  3KW5 B;  4JIO U;  3H7P B;  1SIF A;  5HKH A;  2ZJD A;  2IY0 B;  4AP4 C;  1WI0 A;  3PV1 A;  2O6V B;  3A9K B;  3KYD D;  3MHS D;  2DYB A;  4ZYN A;  4N9F 4;  4BOZ B;  4MGY E;  4E71 A;  2MBO A;  2KD0 A;  4ICU A;  2KFK A;  2WX0 A;  4NQL B;  4HCN B;  4GXB A;  4EZL A;  1P1A A;  2BYE A;  2K8B A;  4TQ1 A;  3QAR A;  4KZ0 A;  1E8Y A;  1WZ0 A;  3WAP A;  2KQ7 A;  3A4S C;  3L54 A;  2V4L A;  2N4F A;  2KDE B;  3VXW A;  2JF5 A;  2MRP A;  2KKC A;  3VTV A;  2KOX A;  4I6L B;  1XQQ A;  4KZC A;  3PLU A;  5DPT A;  1TZ1 A;  3APC A;  3R3M A;  2MQJ A;  4P7I A;  4GDK B;  2D11 A;  3LJ3 A;  4YL8 A;  2KK8 A;  1FXT B;  2MLB A;  2C9W B;  3AU5 A;  4M8N A;  2LVO A;  4IWO A;  3ZTC A;  3HIZ A;  4DK5 A;  2J0J A;  3QC8 B;  2NCN A;  2KAN A;  2ZPN A;  4RM9 A;  3W1S C;  2KDB A;  3AUL A;  3WAM A;  2KZR A;  3H7P A;  5CX3 A;  2FNJ B;  2O6V A;  1GNU A;  4DXA B;  4I6P A;  5J2R A;  3A4R A;  3PRE A;  2HTH A;  2J0K A;  4FLH A;  4A20 A;  2OJR A;  4HK2 A;  4IWQ A;  4LDT D;  3PLV A;  1GUA B;  3HHM A;  3NOB A;  1WX7 A;  2NBV B;  3QCA A;  1MG8 A;  3QA8 A;  2MP2 B;  2L3Z A;  2DZM A;  2YLM A;  1OEY J;  4M0W B;  2C7N B;  4ICV A;  1WJN A;  3IBE A;  4IW0 A;  2G4S A;  4HLE A;  3TBL D;  4EZJ A;  3KVF B;  2L00 B;  3VTU A;  1L2N A;  2PE6 B;  4GDK A;  3V6C B;  4G50 A;  2B3A A;  5DPR A;  2WWZ A;  2FCS A;  4AUQ C;  2KMA A;  2IBI B;  5J17 A;  1IPG A;  1ZGU B;  3VQI A;  2ZEQ A;  3KH0 A;  4HJK A;  5CTR C;  3U7D A;  2Z0D B;  4LJO B;  5JH5 C;  4II3 B;  1KLV A;  3OAW A;  4NQK E;  4J6I A;  3O65 B;  3R7R A;  2RSU A;  3QK0 A;  2DEN B;  2QHO A;  1E7U A;  1YIW A;  2AWT A;  1K8R B;  2M4N A;  3MJW A;  3DBS A;  1OEY A;  1IP9 A;  3ZDM C;  4IC7 B;  4NJ7 A;  4WWN A;  2LUE A;  1JRU A;  2KLG A;  2L7R A;  3PRZ A;  1WYW B;  4I6N B;  1Q0W B;  2L0T A;  4EEW A;  5C1Z A;  1L7Y A;  2NBW B;  3M3J A;  1LQB A;  1Q5W B;  3C0R B;  1XD3 B;  3UIP B;  3W1S A;  3KUZ A;  3VVW B;  4F7Z A;  1RRB A;  2MW5 A;  2GOW A;  4MH0 E;  1PQS A;  2L05 A;  4JLC A;  4BKS A;  4AJW A;  4BBN F;  5C23 A;  2DZI A;  3VH4 B;  1YJ1 A;  2KFK B;  2KX0 A;  2D07 B;  3HM6 X;  4JQW C;  3QX1 A;  4AWJ A;  2KFJ A;  4MGK E;  4WWP A;  1V49 A;  5D7G A;  2MX2 A;  3ZVV A;  4GOC A;  4HXD A;  3UIO B;  4FHJ A;  2HJ8 A;  2CHX A;  2D10 A;  4B9K A;  2KLC A;  2KDF B;  3CF6 E;  1Q1O A;  3IVF A;  3L17 A;  1A5R A;  4B95 A;  4EFO A;  2FUH B;  2V1Y A;  3A9J B;  4MGZ E;  3QJZ A;  4CYE A;  5E6N A;  2K1F A;  2LXC A;  3CMM B;  3L13 A;  1WR1 A;  1WZ3 A;  2G4D B;  2KN5 A;  2M0X A;  3EFU A;  3HK0 A;  3M62 B;  5LLI A;  2K6D B;  3PPA A;  3VDZ A;  1V5T A;  1WE6 A;  2XEW A;  1P9D U;  2CHW A;  4XZ4 A;  2KC2 A;  3CSF A;  4W9E A;  3RZF A;  4LJP B;  5CHF A;  2LGY A;  4GGQ A;  3W1Y A;  3ENE A;  3DDC B;  3WIM A;  2FAZ A;  1YX6 B;  1QZE A;  2LAS A;  4GU2 A;  4PYZ A;  4FJZ A;  3DVG X;  4W9F A;  4MM3 A;  2D2Q A;  2Z59 B;  3NZU A;  5CHV C;  2KJ6 A;  3KUD B;  1V80 A;  3RCZ A;  4DHJ D;  1WXS A;  4FJY A;  1EUV B;  2C5L C;  3BIN A;  2NS5 A;  4NNJ B;  3ZTD A;  3VUW A;  3X23 A;  3NHE B;  2O2V B;  1KJT A;  2M8S A;  3NZS A;  3ECI A;  3SHQ A;  5CHW A;  1E8X A;  4DBG A;  1TBE A;  2YVC A;  3ZO5 B;  3D32 A;  3Q3F A;  2N7E A;  2JVC A;  2FCQ A;  4RM8 A;  3TIX A;  3WAO A;  4CHK A;  3ZW3 A;  3A9J A;  1OTR B;  4GDL B;  2MBE A; 
#chains in the Genus database with same CATH topology
 4CO7 A;  1EWC A;  2BYF A;  2DZJ A;  4FHK A;  3QIJ A;  5AUI A;  1I35 A;  3RT3 B;  3L4P A;  5MPO A;  1NEN B;  2JXX A;  1B9R A;  3ZIM A;  1VD2 A;  5LXI B;  3QQ8 B;  4JX1 C;  1DOI A;  1WGG A;  1WGH A;  1FD6 A;  2ZCC A;  2OJW A;  3LXF A;  4F8C B;  2O2V A;  4F1S A;  3B2F A;  2K0P A;  4LNO A;  2VRR B;  1WXA A;  1F77 A;  1QF6 A;  4ZDV A;  4IM0 A;  5FR6 A;  4XGA B;  1ZW7 A;  2LRU A;  3V6E B;  4ANX A;  3RYT A;  1V6E A;  2N1V A;  3PHW B;  1KF6 B;  3PHX B;  2LWP A;  4RH6 A;  3ZUN A;  3OLM D;  2LFI A;  4G3X B;  2CKH B;  4K7S A;  4HDQ A;  2JWU A;  3APF A;  2Y5B B;  3GZN I;  1UZX B;  4NJ6 A;  2GLS A;  1SSN A;  4ZRI A;  1WRI A;  3GE3 C;  2DWQ A;  2BGF A;  3SR6 A;  2IGD A;  2GB1 A;  1QQR A;  2WDR B;  1DOY A;  2KDI A;  4PS8 A;  1WM3 A;  2CR5 A;  2LXA A;  3N1X C;  2K5P A;  4DXF A;  2SEB D;  3TEW A;  1EF1 A;  1TJE A;  4HPL B;  3DHG C;  3PSE B;  1L4D B;  4KIK A;  1WMH A;  3AV8 A;  4RFB A;  4PS3 A;  5L95 C;  4GLS C;  4KSL C;  4TMA B;  1T5X D;  3T8M A;  1TTN A;  3NVZ A;  4USA A;  3NUH B;  3RUI B;  2KTF A;  2YEP B;  4XC2 A;  3R2I A;  3L0W B;  4ZHO A;  3NVW A;  3L10 B;  4WJP A;  3W5V B;  3B08 A;  3K9O B;  2L32 A;  4RGM A;  1ET9 A;  4YT0 B;  2BB5 A;  3EHV A;  4IUM B;  3JVZ X;  1WY8 A;  2IY1 B;  4WJQ A;  3BK2 A;  3SD5 A;  1U4A A;  3H6N A;  1EU4 A;  3GS2 A;  1V5O A;  3JSV A;  3I3T B;  1TYG B;  1BML C;  3E56 A;  4C56 C;  3BVG A;  2WXK A;  1OQQ A;  3IHP C;  3FAH A;  2ZPY A;  4M01 A;  1N63 A;  2NR2 A;  4X57 B;  4EOY A;  2KXJ A;  1LO5 D;  2K39 A;  1TIF A;  4NJC A;  3DQV A;  4MDK E;  3ZRC A;  1WGR A;  5L83 A;  1ZKH A;  4K7W A;  4IM2 A;  1CZP A;  5BMG A;  4A55 A;  4IOI E;  1SIJ A;  1FMA D;  1C3T A;  4GN1 A;  1MPE A;  4DHZ E;  2C7M B;  4MH8 A;  1UF0 A;  2J42 A;  1SB3 C;  2WU2 B;  4P1C C;  3Q2A C;  2GBJ A;  2WS3 B;  1Z2M A;  2M56 B;  4PT5 A;  4C00 A;  3LB8 C;  2PKO A;  5EE3 A;  3M95 A;  4JGH B;  4NAW B;  3NZ3 A;  2BS3 B;  3AU4 A;  2IJ0 A;  2LJ5 A;  1AWD A;  2L8J A;  2LVP A;  2GBM A;  3ZKJ C;  4P1B C;  4US9 A;  3UQA A;  4W9I A;  3DCG A;  2KO3 A;  2JT4 B;  3AE3 B;  2QIE B;  4YTP B;  3MFG A;  4AOF A;  4KVG B;  2K8H A;  2MP2 A;  4YSZ B;  4CQN A;  2FCN A;  1IUE A;  1Q10 A;  2IYD B;  3A33 B;  2PJH A;  2WXM A;  2KJR A;  2JUO A;  1WYG A;  4L2Y A;  3FIL B;  2DYM A;  4PYU A;  1E7P B;  3WAN A;  3K9P B;  2QJL A;  3BVZ A;  4BFR A;  2M17 A;  2XK5 B;  3V62 A;  1MVK A;  1N61 A;  3RFZ B;  5TSS A;  2ZZP B;  3Q8C A;  2SAK A;  3R8B A;  2KWU B;  2ZVN A;  4G0N B;  1ET6 A;  1SJH D;  1VZ8 A;  1XLN A;  2CU1 A;  2OOB B;  3MP9 A;  2MWS B;  4ZRK A;  4XWT A;  3VTW A;  3Q3M C;  5HKH A;  2HDE A;  2W82 A;  2W54 A;  4N9F 4;  4E71 A;  2KD0 A;  4ICU A;  3ZJU A;  1C9F A;  2ZW0 A;  4TQ1 A;  3QAR A;  3Q8E A;  3Q3O C;  1E8Y A;  3WAP A;  2JYT A;  2V4L A;  5FKA C;  2KDE B;  3VXW A;  2KKC A;  3N1Z C;  1P7F A;  4KZC A;  1MHX A;  4LTU A;  1CJE A;  4P7I A;  1SEB D;  2C9W B;  2LVO A;  3IAM 1;  3ZQ4 A;  2GI9 A;  2ZPN A;  3H7P A;  5D3I B;  4K3B A;  2O6V A;  2KWD A;  5HG2 A;  1NYQ A;  4I6P A;  5J2R A;  3A4R A;  3PRE A;  2HTH A;  2I38 A;  4FLH A;  1PFD A;  2XNA C;  3RNA C;  3QCA A;  1MG8 A;  1OEY J;  4M0W B;  2C7N B;  1XO3 A;  1HZ5 A;  3IBE A;  1AW7 A;  4GDK A;  4G50 A;  5DPR A;  3W5U B;  1FIQ A;  4LNF A;  2DNF A;  2KMA A;  2WU5 B;  2IBI B;  1IPG A;  1ZGU B;  3P4Q B;  3KH0 A;  2RDB C;  4HJK A;  2KAC A;  5JH5 C;  2KT7 A;  1D5X C;  1WSP A;  1TY2 A;  1ACC A;  1E7U A;  1YIW A;  1K8R B;  1OEY A;  3RNB C;  4IC7 B;  4NJ7 A;  4WWN A;  4QAY A;  1WYW B;  1Q0W B;  2L0T A;  1L7Y A;  4REZ A;  1LQB A;  2JX5 A;  4LLG M;  3W1S A;  2BYT A;  1JML A;  4BBN F;  5BMI A;  5C23 A;  1YJ1 A;  2KFK B;  1I4R A;  3HM6 X;  3QX1 A;  2ACZ B;  1I4H A;  1JWU D;  4WWP A;  2JZP A;  5D7G A;  2MX2 A;  4HXD A;  3UIO B;  1XLQ A;  2IPK D;  2QCZ A;  1YJJ A;  3L17 A;  1A5R A;  4EFO A;  3Q8B A;  2MJE A;  2LXC A;  2LJI A;  3L13 A;  1UWM A;  4H2A A;  2G4D B;  1MJD A;  2K6D B;  3VDZ A;  1WE6 A;  5AUK A;  4MAC A;  4W9E A;  3UI3 A;  3DBL B;  3KWV A;  3WIM A;  2LAS A;  4OZC A;  4W9F A;  1MI0 A;  2D2Q A;  2KJ6 A;  1V80 A;  1WXS A;  2PW9 A;  3DBH B;  3NHE B;  2O2V B;  2V3P A;  3IXS A;  1E8X A;  3ZO5 B;  2N7E A;  2FCQ A;  3BYT B;  5LNK 1;  3TUO A;  4A9A A;  4CHK A;  3A9J A;  1OTR B;  2CJN A;  5HI1 A;  2DHZ A;  4DDI D;  3ZGZ A;  5JZE B;  1FEH A;  3DVG Y;  1LXD A;  2JRH A;  2M0A A;  1R4N B;  1UBI A;  3PT2 B;  1VCB A;  3DHI C;  3LDZ E;  1T6B X;  3J9C A;  4C7Z A;  2JQR B;  5IO9 A;  5AEK B;  1YQ4 B;  1WR6 E;  3VRA B;  1T0R C;  2NMQ A;  1TGZ B;  2V4I B;  3SFE B;  1EO6 A;  2W9N A;  1IBX A;  2AQ1 B;  4GDL A;  3ZNI D;  1F9J A;  1YQ3 B;  1E8Z A;  3PGE A;  2A5U A;  4KX6 B;  2LD9 A;  2FE8 A;  5BMH A;  3P4P B;  4MEM A;  2IO0 B;  4KIK B;  1WMH B;  4MSQ B;  4XDD A;  2QDF A;  2DAJ A;  3MHZ A;  3DBR B;  5AZF A;  3PRP B;  1CQV A;  4DQO C;  3N3K B;  4M8M A;  4JWU C;  3EEC A;  1MHH E;  2UU7 A;  1C76 A;  3WAL A;  1UEL A;  2PLP A;  3OG5 A;  2KAJ A;  1OQR A;  4RF1 A;  1RWS A;  3DOW A;  1FNW A;  4Q2J A;  2R2O A;  2AL6 A;  2MBB B;  3AEA B;  4JE3 B;  3PVL A;  4AS1 A;  5JHA A;  3ALB A;  1Z5S B;  4FAD A;  1RFA A;  5KHO A;  2LEK A;  3P2B A;  2L0F A;  3ZJV A;  1JRO A;  3DHH C;  1XT9 B;  2WXO A;  5I4D A;  1SE4 A;  2KNB A;  2Y3A A;  2WXL A;  3DBL I;  1QOF A;  3NJT A;  2FIF A;  3AE5 B;  2WYQ A;  1IYF A;  4OZA A;  1RLF A;  1EWY C;  4TKN A;  2RPQ A;  3OWE B;  4WAA A;  1YN3 A;  5DPW A;  2AEH A;  3DBH I;  4ZRQ A;  1YX5 B;  4TV3 A;  4RMA A;  2PIA A;  3BK1 A;  3I57 A;  1VRA B;  3ZDT A;  2N9L A;  3AI5 A;  2KX3 A;  4OVZ A;  3DVN U;  1V2Y A;  1Y56 A;  2V9H A;  5G2N A;  1R4N I;  4YWG G;  4YSY B;  2L83 A;  3MJ5 A;  5KHQ A;  4C4V A;  2VH2 A;  1L0V B;  1SXT A;  1T3Q A;  3R2T A;  1XLO A;  4WWO A;  3B0A A;  2Z8L A;  4MT5 A;  4A90 A;  2JY6 A;  3N30 A;  2CHZ A;  4XX5 A;  4DDG D;  2EEL A;  5E6O A;  2LVQ A;  2LZ6 A;  3KWL A;  5LXH A;  4IG7 B;  1ZXI A;  1T0Q C;  2M1M A;  3OJ3 A;  2KTR A;  2D5G A;  4NPN A;  2MSE D;  2N1W A;  2JXT A;  3A9K A;  3RNG C;  3VH3 B;  1GB4 A;  3HM3 A;  3DBR I;  3PZD A;  3AE7 B;  3BYY B;  2IGG A;  2IZV B;  3KUC B;  4KSK C;  1J19 A;  2LRW A;  1UBQ A;  1GJZ A;  2I1K A;  4TSS A;  2WXJ A;  2UYZ B;  1HTQ A;  5AZG A;  1N60 A;  1V86 A;  2BYV E;  2EMS A;  2UWQ A;  2N9E B;  2LGS A;  4GMV A;  4HRS A;  4OVU A;  2K22 A;  1WIA A;  4WJN A;  4LK0 M;  3H9D A;  1L6U A;  2MA9 B;  4MEL A;  3AH7 A;  2BPS A;  2ASQ A;  1OQY A;  4ANU A;  1YQB A;  1ZOY B;  2NPT A;  3ZLZ A;  2ZVO A;  5FK9 C;  2K8C A;  2AL3 A;  2KMC A;  2A4Z A;  1EM7 A;  1YJI A;  5D6J B;  2C7H A;  3B2G A;  2ZNV B;  2WLB A;  4GIV A;  4RGT A;  3SDL C;  3DPD A;  2HD5 B;  2IO3 B;  2MCN B;  1S1Q B;  2LGD A;  1WGK A;  1SGH A;  4OVV A;  2BTE A;  3CST A;  2J4X A;  2WQY B;  3PRM B;  3SFD B;  5BYR A;  1F0Z A;  4W9D A;  2QMT A;  1KOT A;  3Q8A A;  2VZK B;  5D2M B;  3BVM A;  4RNA A;  4JIO U;  3KW5 B;  3H7P B;  2ZJD A;  1XEE A;  2IY0 B;  4RGO S;  4AP4 C;  1WI0 A;  1FXA A;  2O6V B;  1FPY A;  3KYD D;  1XF5 L;  2MBO A;  2OED A;  2BYE A;  2BS4 B;  1WZ0 A;  3A4S C;  4JPS A;  3L54 A;  2JF5 A;  2KN4 A;  4I6L B;  1TS3 A;  3HVD A;  3R3M A;  2MQJ A;  4GDK B;  1KLG D;  2QSD A;  3IT4 B;  2KK8 A;  5FR3 A;  3AU5 A;  4DK5 A;  3QC8 B;  2NCN A;  4RM9 A;  2KDB A;  1B1Z A;  3HRD D;  3NVY A;  1TS2 A;  1GNU A;  1C4P A;  2J0K A;  4IWQ A;  4HK2 A;  2ZW1 A;  3PLV A;  1GUA B;  1MFW A;  2WXG A;  2DZM A;  3GE8 C;  2QC8 A;  5G5H A;  2KQ4 X;  1NEK B;  2AQ2 B;  2G4S A;  4HLE A;  1NI3 A;  4EZJ A;  3KVF B;  1ZXH A;  1L2N A;  2RPV A;  3V6C B;  1FNU A;  5D3D A;  5J17 A;  1DYQ A;  3BII D;  3U7D A;  4LJO B;  4A8X C;  3LYY A;  1KLV A;  3OAW A;  2DEN B;  2QHO A;  2TSS A;  3Q69 A;  2L7R A;  3PRZ A;  4I6N B;  3B9J A;  4EEW A;  5C1Z A;  2D3B A;  2NBW B;  2LHE A;  1XLP A;  2JU6 X;  1C77 A;  3C0R B;  1XD3 B;  3KUZ A;  5IN7 A;  4JWS C;  4MH0 E;  1PQS A;  3PO0 A;  3AEB B;  4JLC A;  1QT9 A;  4BKS A;  1LGR A;  2DZI A;  3VH4 B;  4AWJ A;  2PVG C;  1V49 A;  3AEF B;  1E6E B;  2HJ8 A;  2BT6 A;  2D10 A;  3MC0 B;  3IVF A;  2OHF A;  3ETR A;  2FUH B;  2V1Y A;  3A9J B;  3QJZ A;  4O1N A;  2K1F A;  2WXN A;  3M62 B;  1WZ3 A;  2M0X A;  4ITK A;  3RI7 C;  2XEW A;  2CHW A;  5EE9 A;  2KC2 A;  4L23 A;  4LJP B;  4XWW A;  3ENE A;  1VR9 A;  1QZE A;  4LNN A;  4PYZ A;  4FJZ A;  3NZU A;  3RCZ A;  1SE3 A;  2NS5 A;  4NNJ B;  3ZTD A;  1KJT A;  3AE2 B;  3RNC C;  3SHQ A;  1TBE A;  1V8C A;  3Q3F A;  1WWT A;  1J7B A;  2JVC A;  3ZXR A;  3TIX A;  1IBX B;  1F2R C;  3ZW3 A;  4GDL B;  2MBE A;  4R3D A;  4LDT B;  1LFD A;  1HE8 A;  3N32 A;  2K25 A;  2JRI B;  3P63 A;  2GBK A;  3DVN V;  3T9L A;  2PTL A;  4KDL B;  1ZE3 D;  4EE2 A;  3H7S A;  1QOB A;  4HEA 1;  3U4E G;  2PEA A;  4BKG A;  1LM8 B;  1FO4 A;  3AEC B;  1FRR A;  3B1L X;  3ZXV A;  2BW2 A;  3VR9 B;  2BKF A;  2BKR B;  4BOS C;  3QHT A;  3IG3 A;  1P98 A;  2N9K A;  3VAW A;  4OZB A;  4DWF A;  2X38 A;  1WX9 A;  2IND C;  1TS5 A;  4WAF A;  2BWF A;  2G9H D;  1E0Z A;  3N9Y C;  2M19 A;  1P0R A;  3P1M A;  4HPP A;  3EGR A;  3I9V 1;  3KLS X;  1J8C A;  2EKI A;  4IKG A;  2KDM A;  2IO1 B;  3V61 A;  4RCO A;  3ZNH B;  2DYO A;  1I4P A;  3SU8 X;  1F52 A;  1JW9 D;  2WNM A;  2LGX A;  3NRZ A;  4J3O D;  1E9M A;  1FCC C;  2CS4 A;  1HXY D;  2DX5 B;  2BF8 B;  1SBB B;  3P4R B;  2YEP F;  2ON8 A;  4BBN C;  1TT5 B;  1GC7 A;  1CK1 A;  5IKC M;  1WJU A;  3S2A A;  1SE9 A;  3AXC A;  2C60 A;  4A6Q A;  4US8 A;  5JHB A;  3T3N A;  3W2D A;  1OGW A;  4D2K A;  1JQ4 A;  1D3Z A;  5BO4 B;  5E6P A;  4C4V B;  1STE A;  1KTK A;  1QKZ A;  2INP E;  2JYE A;  3EC8 A;  2MJ3 A;  1VLB A;  1C1Y B;  1UGJ A;  4B6W A;  2AX5 A;  2E6X A;  3UIN B;  2WDT B;  3CWI A;  1CMX B;  1M94 A;  4IM3 A;  3V3X A;  3A1Q A;  2KTR B;  1GG3 A;  2HE7 A;  1WX8 A;  5EE0 A;  1OFF A;  2GBN A;  3NVV A;  3PTF C;  1WRD B;  1UD7 A;  4W9H A;  2J0M A;  2AYO B;  2XK5 A;  3GOE A;  3ONS A;  1IGD A;  2VZK D;  3U7Z A;  1ROE A;  2O6V D;  4ANW A;  1E7V A;  1M4V A;  4W9G A;  3FKY A;  3V60 A;  4W9J A;  1UUP A;  3NG0 A;  4KDI C;  2K3U A;  4A3P A;  4DHZ B;  1XCQ L;  3NS1 A;  2WDQ B;  4GB9 A;  1S3S G;  3VUX A;  2MBQ A;  4JL9 A;  1PGB A;  4W9K A;  2G3Q B;  1WJ6 A;  2NPT B;  4WJO A;  3RZW C;  2QIL A;  3APD A;  2Y5P A;  2N9P C;  3RMK C;  2KQS A;  2J7Q B;  3DWM A;  4EZK A;  2MEK A;  4EUT A;  4K3C A;  1N5W A;  1VJK A;  2NVU I;  1YN5 A;  2BVC A;  3ML9 A;  4URK A;  1F1H A;  2KWC A;  2GMI C;  3N20 C;  4LNI A;  4N59 A;  1KM7 A;  3ML8 A;  1E10 A;  2EKE C;  1IGC A;  1MG4 A;  2WXF A;  4W9C A;  5GXG B;  1KRH A;  3ZNG C;  4M00 A;  1QLB B;  4K1R B;  3TEY A;  3X0W A;  4II2 B;  4XDC A;  3JSV B;  4ASW C;  2FBW B;  3RD2 A;  3QAQ A;  1L5P A;  2WHI A;  1I4X A;  1V81 A;  2QEJ C;  1GAQ B;  2E3T A;  3JW0 X;  2XBB C;  4FJV B;  4DXG A;  1NBF C;  4PK1 A;  3IAS 1;  3Q14 C;  3GB1 A;  3I63 C;  3UF8 A;  2K9X A;  4KGS A;  1H4R A;  2DAF A;  2LI5 A;  4ARI A;  2IO2 B;  4E74 A;  4G11 A;  4YTN B;  2KHW B;  3RNF C;  4HVB A;  2KVR A;  4AJY B;  3N1Y C;  4MJS A;  3AN1 A;  3H1U A;  4MGI E;  4NAM A;  2D3A A;  2FUG 1;  4XE0 A;  3PV1 A;  3KQ4 A;  3MHS D;  3TSS A;  1V1P A;  1J7C A;  1RYJ A;  2WDV B;  1A70 A;  2KFK A;  4NQL B;  1VZ7 A;  4HCN B;  2WXQ A;  4GXB A;  1P1A A;  1V97 A;  2RMM A;  4KZ0 A;  3AE6 B;  1XCT L;  2KQ7 A;  1L0Y B;  2N4F A;  2KVZ A;  3C19 A;  2Y5C A;  2KOX A;  3PLU A;  1DGJ A;  2D11 A;  3H8H A;  3LJ3 A;  4YL8 A;  4RF0 A;  2MLB A;  1TKG A;  3ZTC A;  2MJD A;  3HIZ A;  2J0J A;  2KAN A;  3P42 A;  4WQM A;  1BUI C;  5CX3 A;  3IT6 B;  2B76 B;  3AE8 B;  2WXR A;  4A20 A;  2HJ1 A;  3BWU D;  2OJR A;  4LDT D;  1HEZ E;  1JRP A;  3HHM A;  3QA8 A;  2MP2 B;  1P7E A;  1D5M C;  1WJN A;  2J52 A;  4L1B A;  4IW0 A;  3DWG C;  2INC C;  1JWS D;  2L52 A;  2FCS A;  4WIP A;  4BZA A;  2ZEQ A;  3I5J C;  2Z0D B;  1FXI A;  3PZ7 A;  1L0X B;  4NQK E;  3O65 B;  2RSU A;  5C3J B;  2M4N A;  1K50 A;  5H8Y E;  2H89 B;  1FRD A;  1FNV A;  3ABV B;  1FCL A;  3M3J A;  3AEE B;  1Q5W B;  4HKQ A;  1L6V A;  3VVW B;  4F7Z A;  1RRB A;  4HRO A;  3EUB 2;  3AMZ A;  2ONQ A;  5E6J A;  5HHD G;  2BBC A;  4AJW A;  3GP7 A;  1HA5 A;  4YXD B;  2KX0 A;  1TS4 A;  3AE4 B;  4HKZ E;  2KFJ A;  1BXT A;  5JXV A;  3V05 A;  3EFC A;  4FHJ A;  1JAL A;  3FC4 A;  2CHX A;  4B9K A;  2KLC A;  2KDF B;  3CF6 E;  1Q1O A;  4B95 A;  4MGZ E;  4KKJ A;  1PDX A;  1T0S C;  4CYE A;  5E6N A;  3BZD B;  1TKY A;  3CMM B;  3RNE C;  1SJE D;  1D5Z C;  1V5T A;  1XXG A;  4XZ4 A;  1ESF A;  3CSF A;  3RZF A;  2LGY A;  2LMC A;  3W1Y A;  1ZUD 2;  3DDC B;  2FAZ A;  4GU2 A;  2WXP A;  1FFU A;  4MM3 A;  5CHV C;  1ENF A;  2CU3 A;  1EUV B;  2C5L C;  1HQR D;  2LUM A;  3BIN A;  4FJY A;  3X23 A;  2M8S A;  3NZS A;  3ECI A;  5CHW A;  1SF0 A;  5G5G A;  2INN E;  4RM8 A;  1UNS A;  3PS6 A;  4IWO A;  3DVG X;  4PS7 A;  1RFK A;  1C78 A;  2K6Q A;  2I1J A;  1K53 A;  3ZJT A;  1F2R I;  1WJ4 A;  1WE7 A;  4HCP B;  4KKI A;  2WGS A;  1EU3 A;  3M63 B;  4IWP A;  5DPS A;  2N7J A;  5C2T B;  3WA0 A;  1R7S A;  4FN2 A;  5IA7 A;  4ANV A;  1V1O A;  1GPX A;  4K7U A;  1QOA A;  2G45 B;  2JPH A;  3VUY A;  2RD0 A;  3L16 A;  2LHD A;  1YN4 A;  4AQ7 A;  3W9C B;  1FFV A;  2KMM A;  2JSV X;  1E5W A;  2PMV A;  3AM9 A;  3O13 A;  3Q6B A;  4WUR A;  2PPH A;  2MH7 A;  1NI2 A;  3P4S B;  1YOV B;  3AE9 B;  3WCQ A;  4W9L A;  1D4B A;  2R2Q A;  1K51 A;  3C8Y A;  1YD8 U;  1T0Y A;  5IOI A;  4P16 A;  1I7H A;  3ZRF A;  3EA6 A;  1VZ6 A;  1SE2 A;  3QWZ B;  1HZ6 A;  1P3Q U;  1YMH E;  1TZO A;  3R7Q A;  4FA6 A;  1E90 A;  1RAX A;  2Q5W D;  2KWV B;  2BB6 A;  3VFK A;  2J53 A;  2D3C A;  3U30 A;  3U8Z A;  2D3G A;  2DLB A;  4FBJ B;  4ZOH C;  1E8W A;  3VHT C;  4NY0 A;  4E3C A;  2PVO D;  4EKU A;  3A1Q B;  1R4M B;  4ARC A;  5TR5 A;  1GOZ A;  1GC6 A;  5EDS A;  3UQB A;  3HUI A;  4DHJ B;  4NZL B;  5D94 A;  4TUU A;  3U52 E;  1WXM A;  3RN9 C;  4KV2 A;  1NDD A;  1N5X A;  4LCD E;  5T8I A;  2KJH B;  4A3O A;  4TQ0 A;  2RGF A;  1J0G A;  4FUL A;  4HDO A;  4HWI B;  4K81 A;  1QOG A;  1UH6 A;  1UWX A;  2MBH A;  2BWE S;  3Q3J A;  3UGB B;  1I4Q A;  1X1M A;  3OJ4 B;  2KC1 A;  5GMV A;  2JWZ A;  3AED B;  1G6J A;  1Y8R C;  2Z0E B;  4HPM B;  1PYW D;  1BT0 A;  3AEG B;  3MC8 A;  2H88 B;  4MSM B;  2XN9 C;  4BKT A;  2VH1 A;  1WFY A;  1JWM D;  4GSW A;  2V3S A;  3L08 A;  2FID A;  4WQO B;  3TJP A;  3IFW B;  2EMT A;  1WGY A;  1PUT A;  3TEZ A;  3NS8 A;  3MTN B;  1KFY B;  1HTO A;  1KLU D;  2AQ3 B;  1JWA D;  2DZK A;  3TL5 A;  2X8X X;  2NTT A;  4OW0 A;  4B0M A;  1GB1 A;  1N62 A;  3TEX A;  3NY5 A;  4XYC A;  4KGR A;  4HJG E;  2V3N A;  2JZZ A;  5BYS A;  2L76 A;  5J18 A;  4C80 A;  3CIR B;  1WH3 A;  5IAA C;  2NBU A;  1TY0 A;  1ISN A;  4KGT A;  4ZRP A;  2MHJ A;  1EF5 A;  4OHJ A;  2WX1 A;  2W3R A;  2I2Y A;  2RR9 A;  3R66 C;  1WXV A;  1N6Z A;  1H8C A;  1R4M I;  2NTS A;  2GBR A;  2ZNV C;  3JYU A;  5BYQ A;  5AZH A;  3U2S C;  1WM2 A;  4BKS D;  3TCA A;  2W55 A;  4M02 A;  1V9J A;  4MJS B;  4NAW A;  3TMP B;  4ZYS A;  5G55 A;  4IDI A;  3URY A;  2ZCB A;  1V1P B;  1UGM A;  2JZ3 B;  2FCM A;  2PE9 A;  2REX A;  1AAR A;  1WF9 A;  5DCN A;  4BVU C;  3KYC D;  3ZNZ B;  1I42 A;  1DOX A;  1WGD A;  5H92 C;  4ZRJ A;  2DBY A;  3RUL A;  4S0R A;  2N7D A;  2G1E A;  1K52 A;  2N9X A;  4B0E A;  3BY4 B;  1VDV A;  1D6E C;  1SIF A;  2RDG A;  3A9K B;  2DYB A;  2RDH A;  2WXI A;  4ZYN A;  3FIL A;  4BOZ B;  4MGY E;  2WX0 A;  1ZDX A;  4N6E B;  2CJO A;  4EZL A;  2K8B A;  4WWM A;  1PGX A;  1C4C A;  1YNT E;  2GRI A;  4ACF A;  2MRP A;  2WXH A;  3VTV A;  1XQQ A;  4FXC A;  1I4G A;  5DPT A;  1TZ1 A;  3APC A;  4LNK A;  1C4A A;  5EE1 A;  1FXT B;  4M8N A;  1AN8 A;  1TKE A;  3WAM A;  3W1S C;  3AUL A;  2KZR A;  2LGI A;  3T3O A;  2FNJ B;  4DXA B;  4ZHP A;  4YSX B;  2W3S A;  1WXQ A;  3NOB A;  1WX7 A;  2NBV B;  2L3Z A;  2YLM A;  4ICV A;  4C7Y A;  3TBL D;  1ZP0 B;  1ZDV A;  2L00 B;  3VTU A;  2PE6 B;  2B3A A;  3RPF C;  2WWZ A;  2ICI A;  4AUQ C;  2BQQ A;  1J7A A;  3SEB A;  2N0S B;  3VQI A;  5CTR C;  3VR8 B;  3AB5 A;  4II3 B;  4J6I A;  3R7R A;  3QK0 A;  2AWT A;  3MJW A;  3DBS A;  3VRB B;  1IP9 A;  3ZDM C;  2LUE A;  1JRU A;  2KLG A;  2R61 A;  4M0W A;  3PZ8 A;  2V0G A;  1L4Z B;  2WP9 B;  4BAX A;  4S17 A;  3E9S A;  3UIP B;  1JWB D;  2MW5 A;  2GOW A;  1RM6 C;  3GZN B;  2L05 A;  2IDY A;  4MM3 B;  3Q3N C;  2BS2 B;  3Q8F A;  4P6V F;  4RGN A;  3ZYY X;  2D07 B;  4JQW C;  5IP4 D;  4MGK E;  2KYW A;  1FM0 D;  2HTM E;  3ZVV A;  4GOC A;  3MC9 A;  4N58 A;  1C79 A;  1JCK B;  1WR1 A;  2KN5 A;  5LLI A;  3HK0 A;  3EFU A;  1PGA A;  3PPA A;  1AYF A;  1P9D U;  2L1A A;  5CHF A;  3HVZ A;  4GGQ A;  4YTM B;  1YX6 B;  1NYR A;  2Z59 B;  3KUD B;  4DHJ D;  1KH0 A;  4UDU C;  3VUW A;  1NVI D;  1ZPS A;  4WH4 A;  4DBG A;  5HFY A;  2YVC A;  3D32 A;  3AE1 B;  3WAO A;  1QIL A;  2IGH A; 
#chains in the Genus database with same CATH homology
 4CO7 A;  4LDT B;  2BYF A;  1LFD A;  2DZJ A;  1HE8 A;  2DHZ A;  2I1J A;  2K25 A;  2K6Q A;  3N32 A;  4FHK A;  4DDI D;  3QIJ A;  5JZE B;  1I35 A;  3RT3 B;  3DVG Y;  2JRI B;  1WJ4 A;  1WE7 A;  1LXD A;  2JRH A;  2GBK A;  4HCP B;  1UBI A;  3M63 B;  3PT2 B;  1VCB A;  3DVN V;  2JXX A;  3LDZ E;  3T9L A;  4IWP A;  5DPS A;  3ZIM A;  1VD2 A;  5LXI B;  4KDL B;  3QQ8 B;  5AEK B;  3WA0 A;  4FN2 A;  5IA7 A;  1WGG A;  1WGH A;  3H7S A;  2ZCC A;  4ANV A;  4F8C B;  1WR6 E;  2O2V A;  4F1S A;  1TGZ B;  2PEA A;  4K7U A;  4BKG A;  1LM8 B;  2G45 B;  2JPH A;  1EO6 A;  2W9N A;  3VUY A;  2RD0 A;  2VRR B;  3B1L X;  1WXA A;  3L16 A;  4PS7 A;  2BKF A;  2BKR B;  4BOS C;  4GDL A;  3ZNI D;  3QHT A;  3IG3 A;  4ZDV A;  1P98 A;  1F9J A;  4IM0 A;  5FR6 A;  3VAW A;  1E5W A;  4DWF A;  1E8Z A;  1ZW7 A;  2LRU A;  3V6E B;  4ANX A;  1WX9 A;  1V6E A;  2A5U A;  2N1V A;  3PGE A;  3PHW B;  3RYT A;  3PHX B;  2LD9 A;  2LWP A;  2PPH A;  3ZUN A;  2BWF A;  1NI2 A;  3OLM D;  4G3X B;  1P0R A;  2CKH B;  4K7S A;  4MEM A;  2IO0 B;  4KIK B;  1WMH B;  4MSQ B;  4W9L A;  2R2Q A;  2DAJ A;  4HDQ A;  5AZF A;  3PRP B;  3APF A;  1J8C A;  2Y5B B;  3GZN I;  1UZX B;  4NJ6 A;  1YD8 U;  1T0Y A;  2IO1 B;  3N3K B;  4ZRI A;  4M8M A;  3V61 A;  3ZRF A;  3EEC A;  3ZNH B;  2DYO A;  3SU8 X;  2BGF A;  2LGX A;  3WAL A;  3QWZ B;  1UEL A;  1P3Q U;  2CS4 A;  3R7Q A;  4FA6 A;  2KDI A;  2DX5 B;  4PS8 A;  1E90 A;  3DOW A;  2BF8 B;  1RAX A;  1WM3 A;  2R2O A;  2CR5 A;  2LXA A;  2KWV B;  2AL6 A;  4BBN C;  1GC7 A;  2MBB B;  3VFK A;  3U30 A;  3U8Z A;  3PVL A;  2D3G A;  1EF1 A;  5JHA A;  3ALB A;  1Z5S B;  4HPL B;  4FBJ B;  1RFA A;  5KHO A;  4FAD A;  3P2B A;  1E8W A;  1WJU A;  2L0F A;  3S2A A;  1SE9 A;  3PSE B;  4NY0 A;  4KIK A;  3VHT C;  1XT9 B;  1WMH A;  4E3C A;  2KNB A;  4PS3 A;  3AXC A;  2C60 A;  5JHB A;  4EKU A;  3A1Q B;  5L95 C;  3DBL I;  4KSL C;  5TR5 A;  3T8M A;  1TTN A;  2FIF A;  1GC6 A;  2WYQ A;  5EDS A;  1IYF A;  1OGW A;  3UQB A;  4DHJ B;  1D3Z A;  5BO4 B;  5E6P A;  5D94 A;  1RLF A;  4TUU A;  3RUI B;  2KTF A;  4TKN A;  2RPQ A;  1WXM A;  4XC2 A;  4KV2 A;  4WAA A;  3L0W B;  3EC8 A;  5DPW A;  2AEH A;  3L10 B;  4WJP A;  1C1Y B;  3DBH I;  3B08 A;  1NDD A;  3K9O B;  4LCD E;  4B6W A;  1YX5 B;  4TV3 A;  4RMA A;  3EHV A;  4IUM B;  2KJH B;  3JVZ X;  4A3O A;  4TQ0 A;  1WY8 A;  2RGF A;  3ZDT A;  2IY1 B;  3AI5 A;  1J0G A;  4WJQ A;  3UIN B;  2KX3 A;  2WDT B;  3DVN U;  3SD5 A;  1U4A A;  4FUL A;  3H6N A;  4HDO A;  1CMX B;  1V2Y A;  4HWI B;  4K81 A;  1M94 A;  4IM3 A;  5G2N A;  1UH6 A;  1R4N I;  1V5O A;  2MBH A;  3A1Q A;  3JSV A;  2BWE S;  2KTR B;  3Q3J A;  3I3T B;  1GG3 A;  3UGB B;  2HE7 A;  1WX8 A;  5KHQ A;  1X1M A;  3OJ4 B;  2KC1 A;  3IHP C;  2GBN A;  5GMV A;  2ZPY A;  2JWZ A;  4WWO A;  3PTF C;  2NR2 A;  1WRD B;  3B0A A;  1UD7 A;  4W9H A;  1Y8R C;  2Z0E B;  4HPM B;  4X57 B;  1G6J A;  2J0M A;  2AYO B;  2XK5 A;  3GOE A;  1BT0 A;  4EOY A;  3ONS A;  2KXJ A;  2K39 A;  2JY6 A;  3N30 A;  4MSM B;  2CHZ A;  4BKT A;  4XX5 A;  3DQV A;  1WFY A;  4DDG D;  4MDK E;  4GSW A;  1WGR A;  3ZRC A;  2V3S A;  2O6V D;  5E6O A;  5L83 A;  1ZKH A;  4K7W A;  2LVQ A;  4IM2 A;  3L08 A;  2FID A;  2LZ6 A;  4WQO B;  3IFW B;  3TJP A;  4ANW A;  5LXH A;  4IG7 B;  2EMT A;  1E7V A;  1WGY A;  4W9G A;  3V60 A;  2M1M A;  3NS8 A;  3OJ3 A;  3MTN B;  4W9J A;  2KTR A;  1C3T A;  4NPN A;  4GN1 A;  4DHZ E;  2C7M B;  2MSE D;  4KDI C;  2N1W A;  4DHZ B;  4A3P A;  3A9K A;  2DZK A;  3TL5 A;  3VH3 B;  3HM3 A;  4GB9 A;  3DBR I;  3PZD A;  1S3S G;  3VUX A;  2MBQ A;  4JL9 A;  4W9K A;  2GBJ A;  2IZV B;  2G3Q B;  1WJ6 A;  1Z2M A;  2NPT B;  4WJO A;  3KUC B;  3RZW C;  3NY5 A;  3APD A;  2N9P C;  4KSK C;  1J19 A;  2KQS A;  2LRW A;  1UBQ A;  1GJZ A;  2J7Q B;  2JZZ A;  2I1K A;  2L76 A;  4EZK A;  5J18 A;  2UYZ B;  1WH3 A;  3M95 A;  5IAA C;  5AZG A;  4JGH B;  4NAW B;  4EUT A;  2NBU A;  3AU4 A;  1V86 A;  2BYV E;  2EMS A;  2UWQ A;  2N9E B;  2LJ5 A;  1ISN A;  2L8J A;  2LVP A;  2NVU I;  2GBM A;  4GMV A;  4OVU A;  1WIA A;  3ML9 A;  4WJN A;  3ZKJ C;  4URK A;  1EF5 A;  2KWC A;  2GMI C;  3UQA A;  4W9I A;  2WX1 A;  3DCG A;  3H9D A;  2MA9 B;  4MEL A;  2RR9 A;  2KO3 A;  2JT4 B;  3R66 C;  2BPS A;  1WXV A;  1KM7 A;  3ML8 A;  2EKE C;  1H8C A;  1R4M I;  2ASQ A;  1OQY A;  2GBR A;  2ZNV C;  3JYU A;  4W9C A;  5AZH A;  1YQB A;  4ANU A;  1WM2 A;  2NPT A;  3ZLZ A;  4AOF A;  4KVG B;  2K8H A;  2MP2 A;  2ZVO A;  4BKS D;  2FCN A;  3TCA A;  3ZNG C;  2K8C A;  4K1R B;  2AL3 A;  1V9J A;  2KMC A;  4II2 B;  3X0W A;  3JSV B;  2IYD B;  2A4Z A;  3A33 B;  2PJH A;  4MJS B;  4NAW A;  3RD2 A;  3TMP B;  4ASW C;  3QAQ A;  5G55 A;  2KJR A;  2JUO A;  1V81 A;  5D6J B;  2ZCB A;  2C7H A;  1UGM A;  2JZ3 B;  2DYM A;  2FCM A;  2XBB C;  3JW0 X;  4FJV B;  4PYU A;  3WAN A;  2ZNV B;  2PE9 A;  2REX A;  1AAR A;  1WF9 A;  5DCN A;  3K9P B;  3KYC D;  3ZNZ B;  4BVU C;  1I42 A;  1NBF C;  4GIV A;  4BFR A;  2M17 A;  1WGD A;  3SDL C;  3DPD A;  3PS6 A;  2HD5 B;  2IO3 B;  2XK5 B;  3V62 A;  2MCN B;  4ZRJ A;  1S1Q B;  3UF8 A;  3RUL A;  2LGD A;  1SGH A;  2ZZP B;  1H4R A;  2DAF A;  2LI5 A;  4OVV A;  2KWU B;  2N7D A;  2ZVN A;  3CST A;  2IO2 B;  3PRM B;  4G0N B;  4E74 A;  2CU1 A;  2OOB B;  4G11 A;  2MWS B;  2N9X A;  4ZRK A;  2KHW B;  4W9D A;  4HVB A;  2KVR A;  3VTW A;  4AJY B;  1KOT A;  3BY4 B;  5D2M B;  4MJS A;  4MGI E;  3H1U A;  3KW5 B;  4JIO U;  3H7P B;  1SIF A;  5HKH A;  2ZJD A;  2IY0 B;  4AP4 C;  1WI0 A;  3PV1 A;  2O6V B;  3A9K B;  3KYD D;  3MHS D;  2DYB A;  4ZYN A;  4N9F 4;  4BOZ B;  4MGY E;  4E71 A;  2MBO A;  2KD0 A;  4ICU A;  2KFK A;  2WX0 A;  4NQL B;  4HCN B;  4GXB A;  4EZL A;  1P1A A;  2BYE A;  2K8B A;  4TQ1 A;  3QAR A;  4KZ0 A;  1E8Y A;  1WZ0 A;  3WAP A;  2KQ7 A;  3A4S C;  3L54 A;  2V4L A;  2N4F A;  2KDE B;  3VXW A;  2JF5 A;  2MRP A;  2KKC A;  3VTV A;  2KOX A;  4I6L B;  1XQQ A;  4KZC A;  3PLU A;  5DPT A;  1TZ1 A;  3APC A;  3R3M A;  2MQJ A;  4P7I A;  4GDK B;  2D11 A;  3LJ3 A;  4YL8 A;  2KK8 A;  1FXT B;  2MLB A;  2C9W B;  3AU5 A;  4M8N A;  2LVO A;  4IWO A;  3ZTC A;  3HIZ A;  4DK5 A;  2J0J A;  3QC8 B;  2NCN A;  2KAN A;  2ZPN A;  4RM9 A;  3W1S C;  2KDB A;  3AUL A;  3WAM A;  2KZR A;  3H7P A;  5CX3 A;  2FNJ B;  2O6V A;  1GNU A;  4DXA B;  4I6P A;  5J2R A;  3A4R A;  3PRE A;  2HTH A;  2J0K A;  4FLH A;  4A20 A;  2OJR A;  4HK2 A;  4IWQ A;  4LDT D;  3PLV A;  1GUA B;  3HHM A;  3NOB A;  1WX7 A;  2NBV B;  3QCA A;  1MG8 A;  3QA8 A;  2MP2 B;  2L3Z A;  2DZM A;  2YLM A;  1OEY J;  4M0W B;  2C7N B;  4ICV A;  1WJN A;  3IBE A;  4IW0 A;  2G4S A;  4HLE A;  3TBL D;  4EZJ A;  3KVF B;  2L00 B;  3VTU A;  1L2N A;  2PE6 B;  4GDK A;  3V6C B;  4G50 A;  2B3A A;  5DPR A;  2WWZ A;  2FCS A;  4AUQ C;  2KMA A;  2IBI B;  5J17 A;  1IPG A;  1ZGU B;  3VQI A;  2ZEQ A;  3KH0 A;  4HJK A;  5CTR C;  3U7D A;  2Z0D B;  4LJO B;  5JH5 C;  4II3 B;  1KLV A;  3OAW A;  4NQK E;  4J6I A;  3O65 B;  3R7R A;  2RSU A;  3QK0 A;  2DEN B;  2QHO A;  1E7U A;  1YIW A;  2AWT A;  1K8R B;  2M4N A;  3MJW A;  3DBS A;  1OEY A;  1IP9 A;  3ZDM C;  4IC7 B;  4NJ7 A;  4WWN A;  2LUE A;  1JRU A;  2KLG A;  2L7R A;  3PRZ A;  1WYW B;  4I6N B;  1Q0W B;  2L0T A;  4EEW A;  5C1Z A;  1L7Y A;  2NBW B;  3M3J A;  1LQB A;  1Q5W B;  3C0R B;  1XD3 B;  3UIP B;  3W1S A;  3KUZ A;  3VVW B;  4F7Z A;  1RRB A;  2MW5 A;  2GOW A;  4MH0 E;  1PQS A;  2L05 A;  4JLC A;  4BKS A;  4AJW A;  4BBN F;  5C23 A;  2DZI A;  3VH4 B;  1YJ1 A;  2KFK B;  2KX0 A;  2D07 B;  3HM6 X;  4JQW C;  3QX1 A;  4AWJ A;  2KFJ A;  4MGK E;  4WWP A;  1V49 A;  5D7G A;  2MX2 A;  3ZVV A;  4GOC A;  4HXD A;  3UIO B;  4FHJ A;  2HJ8 A;  2CHX A;  2D10 A;  4B9K A;  2KLC A;  2KDF B;  3CF6 E;  1Q1O A;  3IVF A;  3L17 A;  1A5R A;  4B95 A;  4EFO A;  2FUH B;  2V1Y A;  3A9J B;  4MGZ E;  3QJZ A;  4CYE A;  5E6N A;  2K1F A;  2LXC A;  3CMM B;  3L13 A;  1WR1 A;  1WZ3 A;  2G4D B;  2KN5 A;  2M0X A;  3EFU A;  3HK0 A;  3M62 B;  5LLI A;  2K6D B;  3PPA A;  3VDZ A;  1V5T A;  1WE6 A;  2XEW A;  1P9D U;  2CHW A;  4XZ4 A;  2KC2 A;  3CSF A;  4W9E A;  3RZF A;  4LJP B;  5CHF A;  2LGY A;  4GGQ A;  3W1Y A;  3ENE A;  3DDC B;  3WIM A;  2FAZ A;  1YX6 B;  1QZE A;  2LAS A;  4GU2 A;  4PYZ A;  4FJZ A;  3DVG X;  4W9F A;  4MM3 A;  2D2Q A;  2Z59 B;  3NZU A;  5CHV C;  2KJ6 A;  3KUD B;  1V80 A;  3RCZ A;  4DHJ D;  1WXS A;  4FJY A;  1EUV B;  2C5L C;  3BIN A;  2NS5 A;  4NNJ B;  3ZTD A;  3VUW A;  3X23 A;  3NHE B;  2O2V B;  1KJT A;  2M8S A;  3NZS A;  3ECI A;  3SHQ A;  5CHW A;  1E8X A;  4DBG A;  1TBE A;  2YVC A;  3ZO5 B;  3D32 A;  3Q3F A;  2N7E A;  2JVC A;  2FCQ A;  4RM8 A;  3TIX A;  3WAO A;  4CHK A;  3ZW3 A;  3A9J A;  1OTR B;  4GDL B;  2MBE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...