4AWJA

Pvhl:elob:eloc complex, in complex with capped hydroxyproline
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
103
structure length
100
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADTFEALIEPFSSPPELPDVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting Fragment-Based Lead Discovery at the Von Hippel-Lindau Protein:Hypoxia Inducible Factor 1Alpha Protein-Protein Interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
total genus 22
structure length 100
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2012-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4awjA00
1EO6A 4E3CA 1TZ1A 5IA7A 3IG3A 2LRWA 4MDKE 1V80A 2KJ6A 4FBJB 4HJKA 2BKFA 4IC7B 2KTRA 5CTRC 4RMAA 4AJWA 3DDCB 1NDDA 3QA8A 4AP4C 3VH4B 2V3SA 4JIOU 3RCZA 1EF5A 5C1ZA 1L2NA 3NHEB 3ZVVA 2NCNA 4JGHB 3VTWA 1D3ZA 5G55A 2O2VB 1WGYA 2IBIB 1JRUA 4MSQB 3WAMA 4W9LA 4WJPA 4WWNA 4F8CB 3BY4B 2KK8A 4FJZA 3KUZA 2JT4B 4W9JA 1VD2A 1E8YA 2V1YA 2CU1A 4W9HA 2BYVE 2J0JA 4BBNF 3QX1A 4DHZB 3APDA 2ZCCA 4TQ1A 3TMPB 3CSFA 5G2NA 3IFWB 1G6JA 1LFDA 2Y5BB 1WRDB 3M3JA 3PVLA 2CKHB 2ZPNA 3AULA 2NR2A 1IYFA 4FADA 3DBLI 5CHVC 2C5LC 2N4FA 2DAFA 3TL5A 2VRRB 2G4DB 1UZXB 3A1QB 4I6NB 4ZRJA 4WQOB 3ZW3A 2MRPA 1J19A 1RRBA 2MSED 4PYUA 4MJSA 1TBEA 2PPHA 2REXA 1SE9A 1LXDA 1M94A 5D6JB 2HTHA 3B0AA 1GJZA 1E7UA 2D2QA 4J6IA 4MJSB 4NAWA 5D7GA 3JVZX 4M8MA 1X1MA 2A5UA 1V6EA 1S1QB 2WYQA 3A4SC 4TQ0A 4MGYE 3IBEA 5L95C 4IW0A 3PRZA 4JLCA 5D2MB 3U7DA 4EEWA 3ZO5B 2M8SA 2XK5B 3ZNZB 1XD3B 4EOYA 2BKRB 1E8ZA 2C60A 2CHWA 4EUTA 5LXIB 2K25A 1WZ0A 5KHOA 4TV3A 4AUQC 1GC6A 4K1RB 3BINA 1UBQA 1WGRA 2KJRA 3T8MA 3QCAA 2KXJA 2KDIA 2AL3A 3KUCB 2ZNVC 4NQKE 3ZRCA 3W1SA 4RM8A 3IHPC 3ML9A 2N1WA 5LXHA 4WWOA 1WX9A 2GBJA 3K9PB 3RYTA 2CHZA 3W1YA 4ASWC 4GSWA 2KTRB 4TKNA 4DHJB 2FIFA 3A9KB 4BBNC 4EFOA 2GBNA 5J18A 1E5WA 4X57B 4XX5A 1KM7A 3VQIA 3PGEA 4KSKC 2NPTB 1EUVB 2LZ6A 5AEKB 3P2BA 4DXAB 3RD2A 4LDTD 2WWZA 4G0NB 4IWQA 4ZRIA 2LASA 3PT2B 3A9JA 3ZUNA 3A1QA 3T9LA 5AZFA 4KZCA 3QIJA 3ZNHB 2B3AA 2ZVOA 5TR5A 2I1JA 2MBOA 3AU4A 3L0WB 2KDFB 1UH6A 3SDLC 2PE9A 1V5TA 1Z5SB 3B1LX 1WR6E 3OLMD 5FR6A 2R2OA 1KLVA 3PS6A 2DAJA 1I42A 2PJHA 4NNJB 1WMHA 2ZEQA 1E8WA 1V9JA 1WJ4A 2L00B 4WWPA 1H8CA 4II2B 2DENB 3HM6X 4ZDVA 3RZFA 3QK0A 4EKUA 3ZRFA 2O6VB 1ZKHA 2KD0A 1LM8B 3DBRI 1WJNA 3ECIA 4MH0E 2KVRA 1NBFC 2ZPYA 4MGIE 2HE7A 1KOTA 2J7QB 3ENEA 2KDBA 2OJRA 1UGMA 2JPHA 3DVGX 1P98A 5JZEB 4E71A 2FCQA 1C3TA 1TTNA 4M8NA 1Q1OA 1YQBA 2IY1B 2JF5A 2LUEA 3NY5A 1WX8A 2JVCA 4FJYA 5D94A 3WA0A 3JSVA 2KX0A 2KZRA 4A3OA 2IZVB 4B95A 2JY6A 2Z0DB 2K6QA 3NZUA 2K8HA 2GBMA 4MM3A 4PS8A 3RULA 3HM3A 4KIKA 4IWOA 4KZ0A 2MP2B 2A4ZA 2L0FA 3KYDD 5AZGA 4HPLB 2KFJA 2L7RA 2D10A 2FCMA 3Q3JA 1WH3A 2MP2A 3WALA 3VVWB 3PLUA 2K8BA 2JXXA 3OAWA 4HWIB 3H7PB 3Q3FA 1ZW7A 4W9EA 2J0MA 2ZZPB 3M95A 1WM2A 1L7YA 1R4MI 3MTNB 3V6CB 1P3QU 2C7MB 2IO3B 4DHJD 1J0GA 3R66C 4DDGD 3APFA 3N32A 3VHTC 3B08A 1E7VA 1Z2MA 4BVUC 1U4AA 3VH3B 2N7DA 3RZWC 1XQQA 1Y8RC 2YLMA 3ONSA 1YJ1A 3VUYA 4NY0A 1J8CA 2NBVB 1VCBA 2IO2B 4MEMA 1GUAB 2ZVNA 2KANA 2D07B 1Q5WB 1V81A 2DYBA 2N9XA 2WX1A 3EFUA 2G3QB 3X23A 3VUXA 4RM9A 3HK0A 3DVGY 3V61A 3AXCA 3UGBB 5EDSA 2KHWB 4XC2A 2KWVB 1WXVA 3AU5A 4IG7B 3QC8B 2IO1B 1TGZB 3TBLD 1WX7A 3WANA 4A3PA 4II3B 4ICVA 2LXCA 3APCA 3W1SC 5JHBA 1WGHA 4F7ZA 2N9EB 1YX5B 2DYOA 1E90A 2NS5A 1UD7A 1YIWA 1QZEA 3MJWA 2JZZA 5L83A 3NOBA 4LJPB 3RUIB 2BWFA 1WGDA 2IYDB 1C1YB 2LGXA 2NBUA 2L8JA 2KTFA 3H1UA 3UIPB 3PRMB 4NJ7A 4ANWA 2ZCBA 3CF6E 2JUOA 5E6OA 2DHZA 4GN1A 4PS3A 2LVPA 1WMHB 2KX3A 4MGZE 3TCAA 4F1SA 1KJTA 4GDKA 2JZ3B 2ZJDA 4GIVA 2KWUB 3VDZA 1S3SG 4FULA 2IY0B 3VTVA 1A5RA 4GU2A 2BYEA 1AARA 4DK5A 4XZ4A 2M4NA 1V49A 2FUHB 4NQLB 3EC8A 1RAXA 2O6VD 4FA6A 2MBHA 3V60A 2Z59B 3A33B 3MHSD 1RFAA 3VFKA 3OJ4B 1UELA 1WJUA 3WIMA 3OJ3A 4GGQA 1LQBA 5LLIA 4K7WA 2RR9A 1WY8A 4GDLA 2M17A 4IUMB 3U8ZA 4CO7A 4KV2A 1UBIA 4PS7A 2K1FA 2JRHA 3V62A 4GDLB 3VAWA 3VXWA 4BKSD 3ZTDA 4IM2A 2HJ8A 5E6NA 1XT9B 1WXAA 3H7SA 3RT3B 2MCNB 2KKCA 2MA9B 3R7RA 2LRUA 2MWSB 3DCGA 1R4NI 4W9DA 4CYEA 3QWZB 3M63B 2MX2A 2C7NB 2RGFA 2CR5A 1ZGUB 4HCPB 5DPRA 3SU8X 3X0WA 1I35A 2BGFA 4KVGB 2IO0B 3KUDB 2EKEC 4FHKA 4FHJA 3UINB 4WJNA 4BOSC 2MBQA 1WJ6A 2KMAA 2MLBA 4ANUA 2BPSA 3KYCD 2KFKB 4W9GA 4IM0A 1WE7A 1E8XA 2D11A 2KLGA 4G11A 4BKGA 1MG8A 4LCDE 3PHXB 1WGGA 4AOFA 3ZNGC 4KIKB 3EHVA 3UIOB 1WYWB 2KOXA 1GC7A 4W9CA 2C7HA 5CX3A 3QHTA 5E6PA 1WFYA 5HKHA 2NPTA 4GXBA 4WAAA 3K9OB 2N9PC 1EF1A 1OEYA 3H7PA 4HK2A 4OVUA 2MW5A 2AWTA 4EZLA 1NI2A 4MGKE 4HLEA 2XEWA 2PEAA 3DBSA 4HVBA 3TIXA 3PZDA 5CHFA 5DPSA 4EZKA 3LJ3A 5AZHA 4G50A 3ZLZA 2V4LA 2FIDA 2LXAA 3N3KB 4BKSA 2W9NA 2MBEA 5DPWA 2NVUI 4I6PA 2NBWB 4BOZB 3L16A 4GDKB 3R7QA 2L05A 4N9F4 4K7SA 3C0RB 1WE6A 3ZKJC 2LGDA 3A9JB 3UQAA 2RSUA 2CHXA 2JRIB 3KH0A 4KDIC 4GMVA 3JYUA 4HXDA 1P1AA 2O6VA 3KW5B 4NPNA 3V6EB 2J0KA 1BT0A 3PREA 2UWQA 4IM3A 1GNUA 3JW0X 5C23A 1K8RB 2KFKA 3ML8A 2FAZA 3N30A 4DBGA 3R3MA 3UF8A 2OOBB 1WXSA 4P7IA 3D32A 5KHQA 2EMSA 4NJ6A 1WXMA 2HD5B 3PLVA 4GOCA 5GMVA 2R2QA 1RLFA 2WDTB 4YL8A 4AWJA 3L10B 2LVQA 4BKTA 3CMMB 4BFRA 3QQ8B 1P9DU 3VUWA 2DX5B 1IPGA 2Z0EB 3AI5A 2LGYA 2L76A 1V5OA 4G3XB 4JQWC 4JL9A 1SIFA 1WR1A 3IVFA 2AL6A 4W9FA 2I1KA 1WIAA 2EMTA 2GBRA 4M0WB 1OEYJ 1PQSA 3GZNI 4I6LB 1V2YA 3NZSA 2FCNA 1WZ3A 5DPTA 3QARA 3U30A 2KWCA 3O65B 4K81A 2BF8B 2D3GA 1Q0WB 3L54A 4AJYB 4W9KA 3GOEA 2KJHB 3DVNV 4CHKA 2RPQA 3H9DA 4W9IA 3HIZA 1IP9A 3VTUA 3PPAA 2KDEB 4KDLB 2G4SA 3ZDMC 2KQ7A 4ZYNA 3DVNU 4B6WA 2XBBC 2AEHA 5DCNA 2LI5A 2JWZA 2LD9A 1F9JA 5BO4B 3SHQA 2KQSA 2KLCA 3DOWA 4PYZA 2AYOB 4K7UA 3CSTA 4KSLC 2UYZB 2G45B 3H6NA 3DQVA 1WM3A 4B9KA 2L0TA 3WAOA 2MQJA 5J2RA 2PE6B 1CMXB 3EECA 2ZNVB 2KNBA 2DZKA 3HHMA 3L17A 4ICUA 3ZTCA 2KMCA 3UQBA 3QJZA 2K39A 4GB9A 4FJVB 4LDTB 4IWPA 2FCSA 3ZIMA 5JHAA 2KN5A 3PHWB 4MELA 2C9WB 3M62B 2KC2A 4MSMB 3PSEB 2N7EA 3QAQA 3DPDA 3I3TB 4OVVA 4HPMB 2GOWA 2O2VA 2XK5A 4TUUA 2K6DB 4LJOB 2MBBB 5JH5C 2BYFA 3ALBA 4E74A 3S2AA 1YD8U 3PV1A 1ISNA 1SGHA 2DZMA 2WX0A 3PTFC 2LVOA 3LDZE 4A20A 3ZNID 4DHZE 2M1MA 4HDOA 2DYMA 2N1VA 3WAPA 2K8CA 1P0RA 2DZJA 3ZDTA 4DDID 4HDQA 2DZIA 3SD5A 1OQYA 3DBHI 4FN2A 4WJQA 2YVCA 1V86A 5CHWA 3A9KA 2BWES 5IAAC 2LWPA 2CS4A 3L13A 3KVFB 4DWFA 1HE8A 2GBKA 4HCNB 1YX6B 3TJPA 1WI0A 3A4RA 2KO3A 1GG3A 2KC1A 3JSVB 1T0YA 1OTRB 4ANXA 4WJOA 5J17A 2FNJB 3PRPB 2ASQA 4URKA 2GMIC 2RD0A 4FLHA 3NS8A 4ANVA 2LJ5A 1H4RA 2QHOA 1FXTB 4EZJA 2M0XA 1OGWA 1WF9A 3L08A 4NAWB 2L3ZA 4ZRKA
chains in the Genus database with same CATH superfamily
3IG3A 1NYRA 2LRWA 4M0WA 2QCZA 2BKFA 2KN4A 2KTRA 3N1YC 4RMAA 5CTRC 4AJWA 1F52A 1ESFA 2XNAC 1FFUA 1NEKB 2WU5B 5C1ZA 3NHEB 1YQ3B 3ZVVA 1D3ZA 1JRUA 4MSQB 1OQRA 3BY4B 1RYJA 1L6VA 2JT4B 1VD2A 1E8YA 4Q2JA 4L2YA 2CU1A 1XF5L 2BYVE 3AE7B 3QX1A 4TQ1A 2QIEB 3IFWB 2W3RA 3MC0B 2CKHB 1IYFA 2H89B 4MT5A 1P7FA 2WDQB 2C5LC 1ROEA 2DAFA 3TL5A 2VRRB 4I6NB 3RNFC 3P4RB 1J19A 1TBEA 2PPHA 1GJZA 2WXKA 2D2QA 2SEBD 3P42A 2VZKB 2E3TA 4JLCA 5D2MB 1FEHA 3ZNZB 2KWDA 1L4ZB 1WZ0A 1GC6A 3T8MA 3QCAA 2KXJA 3ZRCA 1P7EA 3W1SA 3ML9A 1XCQL 1KH0A 1CQVA 3W1YA 1I4GA 1T5XD 4TKNA 2Z8LA 4B0EA 4XX5A 4X57B 2PIAA 2HJ1A 3C8YA 1TZOA 5HFYA 2Y3AA 4ACFA 2WWZA 4IWQA 4ZRIA 2LASA 1ZUD2 3PT2B 3IXSA 1WSPA 3A1QA 4ZRQA 1TJEA 1QT9A 1I4XA 2ZVOA 1YN5A 1WGKA 3CWIA 1Z5SB 3B1LX 5H92C 2N9KA 1L0VB 2DAJA 1C76A 2PJHA 1E8WA 4FXCA 1VLBA 4WWPA 1FRDA 4ZDVA 3HM6X 4EKUA 2KD0A 1LM8B 4WWMA 3B2FA 2KVRA 2QDFA 4P16A 2HE7A 3DVGX 3GE8C 5JZEB 1TTNA 1Q1OA 1YQBA 3NY5A 2KX0A 1N61A 2JY6A 4RNAA 3NZUA 2GLSA 2OHFA 1CK1A 4KIKA 4JWSC 2A4ZA 2KFJA 2LEKA 2FCMA 1FXIA 4HJGE 1WH3A 3VVWB 3PLUA 1ZE3D 2JXXA 3KQ4A 1ZW7A 2J0MA 2ZZPB 4K3CA 1WM2A 4XDCA 3NS1A 3WCQA 2C7MB 4DDGD 3BVZA 1STEA 3RFZB 1U4AA 1JRPA 3AE2B 1Y8RC 2WXFA 2YLMA 1J8CA 1YJ1A 1VCBA 2IO2B 1C77A 1GUAB 2WX1A 3EFUA 3RPFC 4RGOS 1C78A 2K22A 4RM9A 3HK0A 3ZJUA 3V61A 1MHXA 4A55A 1WXVA 4JE3B 2KVZA 2INDC 2IO1B 3TBLD 2J52A 4A90A 3O13A 2N9EB 1E90A 3NOBA 3RUIB 1GB1A 2BWFA 1WGDA 1C9FA 1SE4A 2LGXA 3HRDD 2VH2A 3FKYA 3H1UA 3UIPB 4ANWA 4L23A 4USAA 3AE6B 5H8YE 4GIVA 4GU2A 4DK5A 4QAYA 2L1AA 1KTKA 2Z59B 2X8XX 3OJ4B 1UELA 3OJ3A 1LQBA 3NRZA 1PYWD 4GLSC 3VAWA 4PS7A 1J7BA 4GDLB 5BMGA 5E6NA 2MJ3A 3R2TA 4HKQA 3QWZB 2MX2A 2C7NB 1ZGUB 2IGHA 3SU8X 3P4SB 1T3QA 3UINB 4WJNA 1R7SA 3IT6B 1D5ZC 1TIFA 2MLBA 2BPSA 2PW9A 5T8IA 4TSSA 5HG2A 2KLGA 4G11A 3PHXB 3ZNGC 2KOXA 3QHTA 5IKCM 3K9OB 4WAFA 1EF1A 3HVDA 1F1HA 1NI2A 2AQ3B 3RNBC 1FNUA 1GAQB 5DPSA 5G5GA 1RWSA 3N3KB 2W9NA 2MBEA 1CJEA 4EE2A 2QEJC 3R7QA 2L05A 4N9F4 4N6EB 3C0RB 3ZKJC 2RDHA 2JRIB 3TEZA 4XWWA 1KLUD 1MFWA 1GNUA 2ACZB 1DGJA 2KFKA 3AM9A 2FAZA 4S17A 2OOBB 1WXSA 3AH7A 2EMSA 4MH8A 2BYTA 2HD5B 3IT4B 2R2QA 4YL8A 4AWJA 1ENFA 2LHEA 1NVID 1P9DU 2Z0EB 4G3XB 1WR1A 3IVFA 1OEYJ 1V2YA 1WZ3A 5DPTA 3U30A 3O65B 1VR9A 2D3AA 4BZAA 2DLBA 2KQ7A 4B6WA 4KGTA 3GB1A 5BO4B 3Q8CA 3DOWA 1FCCC 2G45B 4N59A 4A6QA 3WAOA 2MQJA 3EECA 3HHMA 3PHWB 3RI7C 1FRRA 3NJTA 3M62B 3PSEB 3I3TB 4OVVA 1D5XC 3Q69A 1FNWA 1HTQA 4TUUA 2K6DB 2ICIA 4LJOB 2JQRB 5JH5C 1C4PA 3PV1A 1SGHA 2WX0A 2LVOA 4A20A 4DHZE 2K8CA 2DZIA 2AQ1B 4FN2A 4WJQA 2BWES 3L13A 1D6EC 2BVCA 1WI0A 3A4RA 2KO3A 3LYYA 1GG3A 2KC1A 1IUEA 2K5PA 4ANXA 2FNJB 3PRPB 4KGSA 2GMIC 1L0XB 2BBCA 4C4VB 1FNVA 3HVZA 2M0XA 1OGWA 1TZ1A 1PGBA 1V80A 2KJ6A 4FBJB 4IC7B 3C19A 3DDCB 2NMQA 2V3SA 4OW0A 3RCZA 1BMLC 4JGHB 2VZKD 5G55A 1XLOA 4C4VA 3AE3B 1NYQA 3ZXRA 4HPPA 2BS4B 2J0JA 1EM7A 3TMPB 2ZCCA 3M3JA 2KAJA 2KT7A 1HA5A 1HQRD 2BS3B 1V97A 1FPYA 2V9HA 2J53A 2K0PA 2MRPA 3NVVA 3N1XC 4MJSA 1LXDA 5D6JB 2HTHA 1K50A 4MJSB 3DHHC 4TMAB 1EU3A 4NAWA 2VH1A 5D7GA 3AE4B 4XYCA 4HROA 1N60A 2KDMA 4TQ0A 4UDUC 2JYEA 5L95C 3ZO5B 2MH7A 2XK5B 1XD3B 5LXIB 3KWLA 5TSSA 1UBQA 2KJRA 2WXHA 2ZNVC 2B76B 3IHPC 2N1WA 5LXHA 1UF0A 3NG0A 2KTRB 4DHJB 3A9KB 4BBNC 4EFOA 2GBNA 2WS3B 5J18A 3V3XA 4KSKC 2NPTB 1EUVB 1TKEA 1I4PA 4DXAB 3A9JA 3ZUNA 5AZFA 4KZCA 4LTUA 3ZNHB 2B3AA 2MBOA 3L0WB 2GRIA 1UH6A 1VDVA 2ZW0A 2PE9A 1V5TA 1JWSD 3GP7A 4YSXB 1ZPSA 4M01A 3DWGC 1I42A 2L00B 1V9JA 4C56C 1ZP0B 2DENB 1EU4A 3RZFA 3AEAB 2MJDA 1K53A 3DBRI 1WJNA 3ECIA 1ZDXA 4MH0E 4WH4A 2J7QB 2KDBA 1AW7A 1QLBB 2X38A 3IAM1 4P6VF 1C4CA 1E9MA 2FCQA 1HTOA 2JF5A 2LUEA 5D94A 3JSVA 4A3OA 4B95A 4NJCA 3DWMA 5AUKA 2Z0DB 2GBMA 3H8HA 3U2SC 3RULA 1RM6C 2MP2B 2D10A 2IJ0A 1MJDA 2K8BA 3Q3MC 2PMVA 5I4DA 1WWTA 3VRBB 3V6CB 3R66C 3VH3B 3SFEB 3RNAC 1XQQA 2INNE 2W54A 3SEBA 2W55A 1Q5WB 2N9XA 2G3QB 3X23A 1OQQA 2FE8A 2INPE 3UGBB 1ZDVA 3PZ8A 2KWVB 3AU5A 3QC8B 2BS2B 4ICVA 2LXCA 3APCA 3W1SC 5JHBA 2DYOA 1UD7A 2RDGA 2JZZA 3MJWA 4LJPB 3IAS1 4N58A 1JWAD 1C1YB 1N5XA 2KTFA 2ZCBA 2JUOA 5E6OA 2DHZA 2OEDA 4GN1A 2LVPA 3TCAA 4WURA 2JZ3B 2ZJDA 3VDZA 1S3SG 4FULA 3R8BA 1V49A 2FUHB 1RAXA 2MBHA 2WDVB 3A33B 3MHSD 1KLGD 4GGQA 3ABVB 4K7WA 2RR9A 1WY8A 1IGDA 2WU2B 1UBIA 3VXWA 3ZTDA 2WGSA 4IM2A 1R4NB 2HJ8A 2KKCA 2MWSB 3DBRB 3M63B 2RGFA 4HCPB 5DPRA 1I35A 2JXTA 2BGFA 3AMZA 5LNK1 3KYCD 3Q14C 1VZ7A 1UWXA 1HXYD 4BKGA 1MG8A 3CIRB 1WYWB 2C7HA 5CX3A 1YN4A 1WFYA 5HKHA 2JX5A 2NPTA 4GXBA 1J7CA 4LNOA 1ZOYB 3H7PA 4EZLA 2MW5A 2AWTA 4ZHOA 2N7JA 4HLEA 2PEAA 3DBSA 2R61A 3LJ3A 1PUTA 2TSSA 4G50A 3ZLZA 2V0GA 3AV8A 1C4AA 2FIDA 2LXAA 2NVUI 2IPKD 4NAMA 1WYGA 1TY2A 3KH0A 4OHJA 5BYRA 2O6VA 2MHJA 4NPNA 2RDBC 3AB5A 3JW0X 5C23A 1K8RB 1L0YB 3N30A 4DBGA 4YTPB 3R3MA 3D32A 5IP4D 3PLVA 3L10B 2LVQA 3QQ8B 3VUWA 1UUPA 1FO4A 2DNFA 3AI5A 4JQWC 1V5OA 1YQ4B 1SIFA 4W9FA 3BIID 2I1KA 1WIAA 3FILA 4C80A 3NZSA 3AEEB 3ZXVA 4K81A 2D3GA 3AEFB 2NTTA 2KJHB 3DVNV 1YJJA 4LK0M 2HDEA 2RPQA 4CQNA 3HIZA 1JMLA 3VTUA 1UWMA 2KDEB 3ZDMC 1FIQA 1GOZA 4PYZA 2KQSA 2KLCA 3VR9B 1TS3A 4KSLC 3BK2A 2KYWA 3RNCC 3H6NA 3DQVA 4B9KA 4HRSA 2INCC 3N1ZC 2DZKA 5IOIA 3L17A 2LGIA 3KWVA 4MELA 3N20C 2BT6A 2ONQA 4KKJA 2LHDA 4C7YA 2N7EA 4R3DA 3QAQA 4RF1A 4YSYB 2XK5A 2JZPA 1SJHD 2DZMA 3PTFC 4RH6A 4HDOA 2N1VA 1HEZE 4HDQA 3AE9B 2YVCA 5IAAC 3A9KA 1XCTL 3P1MA 3TJPA 1F2RI 4A8XC 1SB3C 5FK9C 2ASQA 1TT5B 1KF6B 3FC4A 3NS8A 2QHOA 4EZJA 1WF9A 3WAMA 5AUIA 1EO6A 2WXNA 4MDKE 2ZW1A 2L32A 4HJKA 3J9CA 3ZYYX 1NDDA 3QA8A 3VH4B 4M02A 1EF5A 5JXVA 1L2NA 1JCKB 2D3BA 1E10A 3BVGA 3VTWA 2O2VB 2H88B 1ET6A 4W9LA 4W9JA 5EE1A 1E7PB 3TEWA 2JYTA 1TY0A 1LFDA 2DBYA 3PVLA 1L4DB 3AULA 3RNEC 1SXTA 2NR2A 4FADA 3P63A 3FILB 1E6EB 2D3CA 2G4DB 1JROA 1UZXB 3A1QB 4ZRJA 4WQOB 1SEBD 1RRBA 2BTEA 2REXA 1SE9A 2N0SB 1B9RA 1E7UA 1DOXA 1TS5A 3JVZX 4M8MA 4PK1A 1X1MA 1V6EA 3Q3OC 1JWUD 3IBEA 2I2YA 1T0QC 4IW0A 3PRZA 3U7DA 4S0RA 2M8SA 2BB6A 4HEA1 4ZOHC 1PGXA 1NI3A 3B2GA 4EOYA 2CHWA 1E8ZA 2C60A 4EUTA 2K25A 4ITKA 5KHOA 4TV3A 4AUQC 1WXQA 1WGRA 4IOIE 3URYA 4D2KA 1ACCA 4RM8A 4WWOA 1WX9A 2GBJA 3RYTA 4J3OD 4ASWC 4K3BA 2W3SA 2FIFA 2PVGC 1E5WA 3VQIA 3PGEA 1AN8A 3RNGC 5E6JA 5AEKB 3DHGC 1LGRA 4LDTD 4OZAA 1ZXHA 5HHDG 4LNKA 1MVKA 1JWMD 4DXGA 1QKZA 3AU4A 3NVWA 2WP9B 1EWCA 2KDFB 1XEEA 3SDLC 3I5JC 2GI9A 5FR6A 2K9XA 2R2OA 1KLVA 2FUG1 2RMMA 1WMHA 2IGDA 1WJ4A 4II2B 1IGCA 1YNTE 3ZRFA 4RGMA 4O1NA 2JSVX 2WXRA 1NBFC 3E9SA 1KOTA 4A9AA 1AYFA 3ENEA 1L5PA 2WXJA 2WLBA 2WXIA 4YTMB 1C3TA 2L52A 1BUIC 2IY1B 4FJYA 2JVCA 2LJIA 3WA0A 2KZRA 2IZVB 2K8HA 2N9LA 3HM3A 4E71A 4IWOA 4KZ0A 5AZGA 2IGGA 1MPEA 3Q3JA 1MHHE 3WALA 2WQYB 5C3JB 3M95A 4JPSA 1L7YA 3MTNB 3Q2AC 4BAXA 1BXTA 1P3QU 2IO3B 3APFA 3N32A 1E7VA 1Z2MA 1OFFA 3VUYA 4NY0A 2Y5PA 4US9A 1XO3A 2DYBA 3W5UB 1I4HA 3LXFA 3DVGY 3AXCA 2AQ2B 3EFCA 2PVOD 1TGZB 3W5VB 3WANA 4A3PA 2LUMA 4II3B 1I7HA 1WGHA 4F7ZA 1YN3A 2NS5A 3GE3C 1QZEA 4AQ7A 5BYQA 2NBUA 2QC8A 3NVYA 4NJ7A 3CF6E 3KLSX 1GB4A 1DOIA 1NENB 2W82A 4RF0A 4MGZE 1WMHB 4F1SA 1KJTA 4GDKA 2KMMA 4B0MA 1CZPA 4DQOC 2KWUB 2RPVA 1A5RA 4LNFA 1AARA 4XZ4A 1F77A 3EC8A 4FA6A 4NZLB 3V60A 5C2TB 3VFKA 1RFAA 3N9YC 1WJUA 3WIMA 1V8CA 3UI3A 4GDLA 2M17A 3U8ZA 2CJOA 3MHZA 4KV2A 4BKSD 3RT3B 2MA9B 2K3UA 2ON8A 4W9DA 3DCGA 4CYEA 3Q8AA 1SBBB 3X0WA 4KVGB 3KUDB 4ZHPA 3E56A 4BOSC 2KMAA 1QOAA 3SR6A 4IM0A 1WE7A 1E8XA 4C00A 5BMIA 4AOFA 1AWDA 4KIKB 1QOBA 3GS2A 4WAAA 3MC8A 2N9PC 3Q3NC 1EWYC 3RMKC 1OEYA 3I57A 4OVUA 4MGKE 2G9HD 3AE5B 4HVBA 3PZDA 2J42A 4EZKA 5AZHA 2YEPB 2V4LA 4BKSA 1MI0A 1YMHE 1K52A 4I6PA 2NBWB 4XE0A 4OZBA 3A9JB 3UQAA 2RSUA 2CHXA 4HXDA 1P1AA 3KW5B 1BT0A 2CU3A 3P4PB 2UWQA 1HZ6A 4IM3A 1Y56A 3UF8A 4IKGA 5KHQA 2Q5WD 2MEKA 3AE1B 1UGJA 2JWUA 2V3NA 2DX5B 1D5MC 3B9JA 2AL6A 2EMTA 2GBRA 3LB8C 1PQSA 3DBLB 2M0AA 2M56B 2KWCA 1Q0WB 4AJYB 4W9KA 3GOEA 2V4IB 4CHKA 2PKOA 3H9DA 1IP9A 3BVMA 1V1PA 4ZYNA 3BYYB 2XBBC 2AEHA 5DCNA 2G1EA 3DHIC 3BZDB 1FM0D 1IBXA 2AYOB 3CSTA 2Y5CA 1WM3A 1IBXB 2KACA 5GXGB 2KNBA 1RFKA 3ZTCA 3GZNB 2KMCA 4WIPA 1ET9A 2AX5A 2K39A 4FJVB 4LDTB 4IWPA 3ZIMA 1MG4A 5JHAA 2KN5A 3ETRA 1JQ4A 2YEPF 2I38A 3DPDA 4HPMB 2GOWA 1VZ6A 2MBBB 3NVZA 2BYFA 1TS2A 4E74A 2MJEA 4YTNB 2DWQA 1ISNA 2M1MA 2DYMA 3WAPA 1P0RA 2V3PA 1VRAB 4C7ZA 1OQYA 2CJNA 3DBHI 3VRAB 1V86A 5CHWA 3EGRA 2LWPA 3I9V1 4DWFA 2GBKA 2LFIA 3NZ3A 2WXMA 3JSVB 3Q8BA 5J17A 1N5WA 4URKA 2WXPA 2RD0A 4FLHA 2LJ5A 1H4RA 1TS4A 3L08A 4NAWB 4E3CA 5IA7A 2IDYA 5IO9A 4AP4C 4JIOU 3TUOA 1QOGA 2NCNA 1WGYA 2IBIB 3MJ5A 4WJPA 4WWNA 4F8CB 2KK8A 4FJZA 4MM3B 3KUZA 1I4QA 2V1YA 4W9HA 2GB1A 4BBNF 4DHZB 1B1ZA 3APDA 3CSFA 5G2NA 1G6JA 2Y5BB 1WRDB 2ZPNA 3DBLI 5CHVC 3VR8B 2N4FA 4RGNA 3ZW3A 1TKGA 2MSED 4PYUA 3T3OA 1M94A 3B0AA 4J6IA 1V1PB 4WQMA 1YJIA 1SIJA 2A5UA 1S1QB 2WYQA 3A4SC 3AEDB 4MGYE 4DXFA 3EUB2 4EEWA 5MPOA 1L6UA 2BKRB 4ZYSA 5D3DA 4K1RB 3BINA 3KUCB 2KDIA 2AL3A 4NQKE 3TEXA 4M00A 2EKIA 3Q6BA 3K9PB 2CHZA 4GSWA 3EA6A 4PT5A 2XN9C 1KM7A 4OZCA 1A70A 2LZ6A 3P2BA 3RD2A 1Q10A 3AEGB 4G0NB 1JALA 3OWEB 4KX6B 3T9LA 3QIJA 2OJWA 4XDDA 5TR5A 2I1JA 3AN1A 5EE3A 5HI1A 1N63A 4US8A 1WR6E 3OLMD 3PS6A 3RN9C 1HZ5A 4NNJB 3NUHB 2ZEQA 1H8CA 4JWUC 2WHIA 3Q8FA 1VJKA 3QK0A 5BYSA 2O6VB 1ZKHA 3AE8B 1SJED 3U4EG 2ZPYA 4MGIE 2OJRA 1UGMA 2JPHA 1P98A 2SAKA 4M8NA 1WX8A 4LNIA 1D4BA 1T6BX 3FAHA 4KGRA 2K6QA 4MM3A 5EE0A 4PS8A 2QSDA 2L0FA 3KYDD 4KKIA 4HPLB 2L7RA 1J7AA 2MP2A 3OAWA 4HWIB 3H7PB 3Q3FA 4W9EA 1VZ8A 1R4MI 3W9CB 1SE3A 4DHJD 1J0GA 5IN7A 3VHTC 3B08A 2JU6X 4BVUC 4AS1A 1JWBD 2N7DA 3RZWC 3ONSA 2NBVB 2QJLA 1R4MB 4REZA 4MEMA 1SE2A 2ZVNA 2KANA 2D07B 3OG5A 1V81A 5FR3A 3VUXA 1F2RC 3BK1A 3PO0A 1QOFA 3ZQ4A 1C79A 5EDSA 2KHWB 4XC2A 3V05A 4IG7B 2WXGA 1WX7A 4XGAB 4LNNA 3HUIA 2E6XA 1YX5B 1YIWA 1XXGA 5L83A 1XLPA 4P1BC 5EE9A 2IYDB 4RFBA 4ARCA 1TYGB 4YWGG 1GPXA 2WNMA 2L8JA 3PRMB 4P1CC 4PS3A 2KX3A 1SF0A 1I4RA 3VTVA 2IY0B 1N6ZA 2BYEA 1FMAD 4MACA 2M4NA 2NTSA 4XWTA 3Q8EA 2WDRB 4NQLB 2O6VD 3BYTB 2LMCA 4H2AA 4JX1C 3MFGA 5LLIA 1DYQA 2EELA 4IUMB 1WRIA 4CO7A 3U7ZA 3V62A 2K1FA 2JRHA 1T0SC 4L1BA 1QILA 1XT9B 1WXAA 3H7SA 2M19A 2MCNB 3R7RA 2LRUA 1R4NI 2CR5A 2WXOA 2PTLA 2IO0B 1FCLA 1PGAA 2EKEC 4FHKA 4FHJA 4YSZB 1UNSA 2MBQA 1WJ6A 4ANUA 4ZRPA 4W9GA 2KFKB 2D11A 1JW9D 3I63C 4LCDE 5BMHA 1WGGA 1DOYA 3EHVA 3UIOB 1GC7A 4W9CA 2L83A 1KRHA 5E6PA 5FKAC 3SFDB 4YT0B 4HK2A 1YOVB 2KQ4X 1LO5D 2WXQA 1K51A 2XEWA 1PFDA 5G5HA 3TIXA 5CHFA 2QILA 3T3NA 3TEYA 4LLGM 1T0RC 2UU7A 1QQRA 5DPWA 4BOZB 3L16A 2J4XA 4GDKB 2LGSA 1FD6A 4K7SA 3AECB 3ZGZA 3DBHB 2BW2A 1WE6A 2LGDA 4KDIC 4GMVA 3JYUA 1TKYA 1PDXA 3ZJTA 3V6EB 2J0KA 3PREA 4OVZA 2FBWB 3ML8A 1ZXIA 4P7IA 4NJ6A 1WXMA 4GOCA 5GMVA 1RLFA 2WDTB 1F0ZA 3ZJVA 3MP9A 4BKTA 3CMMB 4BFRA 1SSNA 4YXDB 2PLPA 1IPGA 2LGYA 2L76A 4JL9A 4M0WB 4I6LB 3GZNI 3MC9A 2FCNA 1E0ZA 3QARA 2BF8B 3P4QB 3L54A 3PZ7A 4W9IA 3PPAA 4KDLB 1N62A 2G4SA 3DVNU 2LI5A 2JWZA 2LD9A 1F9JA 3AEBB 3BWUD 3SHQA 1FXAA 4K7UA 2UYZB 1KFYB 2L0TA 5J2RA 3U52E 2PE6B 4HKZE 1CMXB 2ZNVB 1XLQA 4IDIA 4ICUA 3UQBA 3QJZA 4GB9A 2FCSA 1V1OA 2C9WB 2KC2A 4MSMB 1XLNA 2O2VA 2BB5A 3ALBA 3W2DA 3S2AA 3TSSA 1M4VA 1YD8U 4ARIA 3LDZE 3ZNID 3ZDTA 4DDID 2DZJA 2D5GA 3SD5A 2HTME 2WXLA 4RCOA 2CS4A 2BQQA 3KVFB 1HE8A 4HCNB 1YX6B 1QF6A 2QMTA 3L4PA 1T0YA 1OTRB 4WJOA 3R2IA 5D3IB 4ANVA 4RGTA 1FXTB 1FFVA 2L3ZA 4ZRKA
chains in the Genus database with same CATH topology
1EO6A 4E3CA 1TZ1A 5IA7A 3IG3A 2LRWA 4MDKE 1V80A 2KJ6A 4FBJB 4HJKA 2BKFA 4IC7B 2KTRA 5CTRC 4RMAA 4AJWA 3DDCB 1NDDA 3QA8A 4AP4C 3VH4B 2V3SA 4JIOU 3RCZA 1EF5A 5C1ZA 1L2NA 3NHEB 3ZVVA 2NCNA 4JGHB 3VTWA 1D3ZA 5G55A 2O2VB 1WGYA 2IBIB 1JRUA 4MSQB 3WAMA 4W9LA 4WJPA 4WWNA 4F8CB 3BY4B 2KK8A 4FJZA 3KUZA 2JT4B 4W9JA 1VD2A 1E8YA 2V1YA 2CU1A 4W9HA 2BYVE 2J0JA 4BBNF 3QX1A 4DHZB 3APDA 2ZCCA 4TQ1A 3TMPB 3CSFA 5G2NA 3IFWB 1G6JA 1LFDA 2Y5BB 1WRDB 3M3JA 3PVLA 2CKHB 2ZPNA 3AULA 2NR2A 1IYFA 4FADA 3DBLI 5CHVC 2C5LC 2N4FA 2DAFA 3TL5A 2VRRB 2G4DB 1UZXB 3A1QB 4I6NB 4ZRJA 4WQOB 3ZW3A 2MRPA 1J19A 1RRBA 2MSED 4PYUA 4MJSA 1TBEA 2PPHA 2REXA 1SE9A 1LXDA 1M94A 5D6JB 2HTHA 3B0AA 1GJZA 1E7UA 2D2QA 4J6IA 4MJSB 4NAWA 5D7GA 3JVZX 4M8MA 1X1MA 2A5UA 1V6EA 1S1QB 2WYQA 3A4SC 4TQ0A 4MGYE 3IBEA 5L95C 4IW0A 3PRZA 4JLCA 5D2MB 3U7DA 4EEWA 3ZO5B 2M8SA 2XK5B 3ZNZB 1XD3B 4EOYA 2BKRB 1E8ZA 2C60A 2CHWA 4EUTA 5LXIB 2K25A 1WZ0A 5KHOA 4TV3A 4AUQC 1GC6A 4K1RB 3BINA 1UBQA 1WGRA 2KJRA 3T8MA 3QCAA 2KXJA 2KDIA 2AL3A 3KUCB 2ZNVC 4NQKE 3ZRCA 3W1SA 4RM8A 3IHPC 3ML9A 2N1WA 5LXHA 4WWOA 1WX9A 2GBJA 3K9PB 3RYTA 2CHZA 3W1YA 4ASWC 4GSWA 2KTRB 4TKNA 4DHJB 2FIFA 3A9KB 4BBNC 4EFOA 2GBNA 5J18A 1E5WA 4X57B 4XX5A 1KM7A 3VQIA 3PGEA 4KSKC 2NPTB 1EUVB 2LZ6A 5AEKB 3P2BA 4DXAB 3RD2A 4LDTD 2WWZA 4G0NB 4IWQA 4ZRIA 2LASA 3PT2B 3A9JA 3ZUNA 3A1QA 3T9LA 5AZFA 4KZCA 3QIJA 3ZNHB 2B3AA 2ZVOA 5TR5A 2I1JA 2MBOA 3AU4A 3L0WB 2KDFB 1UH6A 3SDLC 2PE9A 1V5TA 1Z5SB 3B1LX 1WR6E 3OLMD 5FR6A 2R2OA 1KLVA 3PS6A 2DAJA 1I42A 2PJHA 4NNJB 1WMHA 2ZEQA 1E8WA 1V9JA 1WJ4A 2L00B 4WWPA 1H8CA 4II2B 2DENB 3HM6X 4ZDVA 3RZFA 3QK0A 4EKUA 3ZRFA 2O6VB 1ZKHA 2KD0A 1LM8B 3DBRI 1WJNA 3ECIA 4MH0E 2KVRA 1NBFC 2ZPYA 4MGIE 2HE7A 1KOTA 2J7QB 3ENEA 2KDBA 2OJRA 1UGMA 2JPHA 3DVGX 1P98A 5JZEB 4E71A 2FCQA 1C3TA 1TTNA 4M8NA 1Q1OA 1YQBA 2IY1B 2JF5A 2LUEA 3NY5A 1WX8A 2JVCA 4FJYA 5D94A 3WA0A 3JSVA 2KX0A 2KZRA 4A3OA 2IZVB 4B95A 2JY6A 2Z0DB 2K6QA 3NZUA 2K8HA 2GBMA 4MM3A 4PS8A 3RULA 3HM3A 4KIKA 4IWOA 4KZ0A 2MP2B 2A4ZA 2L0FA 3KYDD 5AZGA 4HPLB 2KFJA 2L7RA 2D10A 2FCMA 3Q3JA 1WH3A 2MP2A 3WALA 3VVWB 3PLUA 2K8BA 2JXXA 3OAWA 4HWIB 3H7PB 3Q3FA 1ZW7A 4W9EA 2J0MA 2ZZPB 3M95A 1WM2A 1L7YA 1R4MI 3MTNB 3V6CB 1P3QU 2C7MB 2IO3B 4DHJD 1J0GA 3R66C 4DDGD 3APFA 3N32A 3VHTC 3B08A 1E7VA 1Z2MA 4BVUC 1U4AA 3VH3B 2N7DA 3RZWC 1XQQA 1Y8RC 2YLMA 3ONSA 1YJ1A 3VUYA 4NY0A 1J8CA 2NBVB 1VCBA 2IO2B 4MEMA 1GUAB 2ZVNA 2KANA 2D07B 1Q5WB 1V81A 2DYBA 2N9XA 2WX1A 3EFUA 2G3QB 3X23A 3VUXA 4RM9A 3HK0A 3DVGY 3V61A 3AXCA 3UGBB 5EDSA 2KHWB 4XC2A 2KWVB 1WXVA 3AU5A 4IG7B 3QC8B 2IO1B 1TGZB 3TBLD 1WX7A 3WANA 4A3PA 4II3B 4ICVA 2LXCA 3APCA 3W1SC 5JHBA 1WGHA 4F7ZA 2N9EB 1YX5B 2DYOA 1E90A 2NS5A 1UD7A 1YIWA 1QZEA 3MJWA 2JZZA 5L83A 3NOBA 4LJPB 3RUIB 2BWFA 1WGDA 2IYDB 1C1YB 2LGXA 2NBUA 2L8JA 2KTFA 3H1UA 3UIPB 3PRMB 4NJ7A 4ANWA 2ZCBA 3CF6E 2JUOA 5E6OA 2DHZA 4GN1A 4PS3A 2LVPA 1WMHB 2KX3A 4MGZE 3TCAA 4F1SA 1KJTA 4GDKA 2JZ3B 2ZJDA 4GIVA 2KWUB 3VDZA 1S3SG 4FULA 2IY0B 3VTVA 1A5RA 4GU2A 2BYEA 1AARA 4DK5A 4XZ4A 2M4NA 1V49A 2FUHB 4NQLB 3EC8A 1RAXA 2O6VD 4FA6A 2MBHA 3V60A 2Z59B 3A33B 3MHSD 1RFAA 3VFKA 3OJ4B 1UELA 1WJUA 3WIMA 3OJ3A 4GGQA 1LQBA 5LLIA 4K7WA 2RR9A 1WY8A 4GDLA 2M17A 4IUMB 3U8ZA 4CO7A 4KV2A 1UBIA 4PS7A 2K1FA 2JRHA 3V62A 4GDLB 3VAWA 3VXWA 4BKSD 3ZTDA 4IM2A 2HJ8A 5E6NA 1XT9B 1WXAA 3H7SA 3RT3B 2MCNB 2KKCA 2MA9B 3R7RA 2LRUA 2MWSB 3DCGA 1R4NI 4W9DA 4CYEA 3QWZB 3M63B 2MX2A 2C7NB 2RGFA 2CR5A 1ZGUB 4HCPB 5DPRA 3SU8X 3X0WA 1I35A 2BGFA 4KVGB 2IO0B 3KUDB 2EKEC 4FHKA 4FHJA 3UINB 4WJNA 4BOSC 2MBQA 1WJ6A 2KMAA 2MLBA 4ANUA 2BPSA 3KYCD 2KFKB 4W9GA 4IM0A 1WE7A 1E8XA 2D11A 2KLGA 4G11A 4BKGA 1MG8A 4LCDE 3PHXB 1WGGA 4AOFA 3ZNGC 4KIKB 3EHVA 3UIOB 1WYWB 2KOXA 1GC7A 4W9CA 2C7HA 5CX3A 3QHTA 5E6PA 1WFYA 5HKHA 2NPTA 4GXBA 4WAAA 3K9OB 2N9PC 1EF1A 1OEYA 3H7PA 4HK2A 4OVUA 2MW5A 2AWTA 4EZLA 1NI2A 4MGKE 4HLEA 2XEWA 2PEAA 3DBSA 4HVBA 3TIXA 3PZDA 5CHFA 5DPSA 4EZKA 3LJ3A 5AZHA 4G50A 3ZLZA 2V4LA 2FIDA 2LXAA 3N3KB 4BKSA 2W9NA 2MBEA 5DPWA 2NVUI 4I6PA 2NBWB 4BOZB 3L16A 4GDKB 3R7QA 2L05A 4N9F4 4K7SA 3C0RB 1WE6A 3ZKJC 2LGDA 3A9JB 3UQAA 2RSUA 2CHXA 2JRIB 3KH0A 4KDIC 4GMVA 3JYUA 4HXDA 1P1AA 2O6VA 3KW5B 4NPNA 3V6EB 2J0KA 1BT0A 3PREA 2UWQA 4IM3A 1GNUA 3JW0X 5C23A 1K8RB 2KFKA 3ML8A 2FAZA 3N30A 4DBGA 3R3MA 3UF8A 2OOBB 1WXSA 4P7IA 3D32A 5KHQA 2EMSA 4NJ6A 1WXMA 2HD5B 3PLVA 4GOCA 5GMVA 2R2QA 1RLFA 2WDTB 4YL8A 4AWJA 3L10B 2LVQA 4BKTA 3CMMB 4BFRA 3QQ8B 1P9DU 3VUWA 2DX5B 1IPGA 2Z0EB 3AI5A 2LGYA 2L76A 1V5OA 4G3XB 4JQWC 4JL9A 1SIFA 1WR1A 3IVFA 2AL6A 4W9FA 2I1KA 1WIAA 2EMTA 2GBRA 4M0WB 1OEYJ 1PQSA 3GZNI 4I6LB 1V2YA 3NZSA 2FCNA 1WZ3A 5DPTA 3QARA 3U30A 2KWCA 3O65B 4K81A 2BF8B 2D3GA 1Q0WB 3L54A 4AJYB 4W9KA 3GOEA 2KJHB 3DVNV 4CHKA 2RPQA 3H9DA 4W9IA 3HIZA 1IP9A 3VTUA 3PPAA 2KDEB 4KDLB 2G4SA 3ZDMC 2KQ7A 4ZYNA 3DVNU 4B6WA 2XBBC 2AEHA 5DCNA 2LI5A 2JWZA 2LD9A 1F9JA 5BO4B 3SHQA 2KQSA 2KLCA 3DOWA 4PYZA 2AYOB 4K7UA 3CSTA 4KSLC 2UYZB 2G45B 3H6NA 3DQVA 1WM3A 4B9KA 2L0TA 3WAOA 2MQJA 5J2RA 2PE6B 1CMXB 3EECA 2ZNVB 2KNBA 2DZKA 3HHMA 3L17A 4ICUA 3ZTCA 2KMCA 3UQBA 3QJZA 2K39A 4GB9A 4FJVB 4LDTB 4IWPA 2FCSA 3ZIMA 5JHAA 2KN5A 3PHWB 4MELA 2C9WB 3M62B 2KC2A 4MSMB 3PSEB 2N7EA 3QAQA 3DPDA 3I3TB 4OVVA 4HPMB 2GOWA 2O2VA 2XK5A 4TUUA 2K6DB 4LJOB 2MBBB 5JH5C 2BYFA 3ALBA 4E74A 3S2AA 1YD8U 3PV1A 1ISNA 1SGHA 2DZMA 2WX0A 3PTFC 2LVOA 3LDZE 4A20A 3ZNID 4DHZE 2M1MA 4HDOA 2DYMA 2N1VA 3WAPA 2K8CA 1P0RA 2DZJA 3ZDTA 4DDID 4HDQA 2DZIA 3SD5A 1OQYA 3DBHI 4FN2A 4WJQA 2YVCA 1V86A 5CHWA 3A9KA 2BWES 5IAAC 2LWPA 2CS4A 3L13A 3KVFB 4DWFA 1HE8A 2GBKA 4HCNB 1YX6B 3TJPA 1WI0A 3A4RA 2KO3A 1GG3A 2KC1A 3JSVB 1T0YA 1OTRB 4ANXA 4WJOA 5J17A 2FNJB 3PRPB 2ASQA 4URKA 2GMIC 2RD0A 4FLHA 3NS8A 4ANVA 2LJ5A 1H4RA 2QHOA 1FXTB 4EZJA 2M0XA 1OGWA 1WF9A 3L08A 4NAWB 2L3ZA 4ZRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EO6 A;  4E3C A;  1TZ1 A;  5IA7 A;  3IG3 A;  2LRW A;  4MDK E;  1V80 A;  2KJ6 A;  4FBJ B;  4HJK A;  2BKF A;  4IC7 B;  2KTR A;  5CTR C;  4RMA A;  4AJW A;  3DDC B;  1NDD A;  3QA8 A;  4AP4 C;  3VH4 B;  2V3S A;  4JIO U;  3RCZ A;  1EF5 A;  5C1Z A;  1L2N A;  3NHE B;  3ZVV A;  2NCN A;  4JGH B;  3VTW A;  1D3Z A;  5G55 A;  2O2V B;  1WGY A;  2IBI B;  1JRU A;  4MSQ B;  3WAM A;  4W9L A;  4WJP A;  4WWN A;  4F8C B;  3BY4 B;  2KK8 A;  4FJZ A;  3KUZ A;  2JT4 B;  4W9J A;  1VD2 A;  1E8Y A;  2V1Y A;  2CU1 A;  4W9H A;  2BYV E;  2J0J A;  4BBN F;  3QX1 A;  4DHZ B;  3APD A;  2ZCC A;  4TQ1 A;  3TMP B;  3CSF A;  5G2N A;  3IFW B;  1G6J A;  1LFD A;  2Y5B B;  1WRD B;  3M3J A;  3PVL A;  2CKH B;  2ZPN A;  3AUL A;  2NR2 A;  1IYF A;  4FAD A;  3DBL I;  5CHV C;  2C5L C;  2N4F A;  2DAF A;  3TL5 A;  2VRR B;  2G4D B;  1UZX B;  3A1Q B;  4I6N B;  4ZRJ A;  4WQO B;  3ZW3 A;  2MRP A;  1J19 A;  1RRB A;  2MSE D;  4PYU A;  4MJS A;  1TBE A;  2PPH A;  2REX A;  1SE9 A;  1LXD A;  1M94 A;  5D6J B;  2HTH A;  3B0A A;  1GJZ A;  1E7U A;  2D2Q A;  4J6I A;  4MJS B;  4NAW A;  5D7G A;  3JVZ X;  4M8M A;  1X1M A;  2A5U A;  1V6E A;  1S1Q B;  2WYQ A;  3A4S C;  4TQ0 A;  4MGY E;  3IBE A;  5L95 C;  4IW0 A;  3PRZ A;  4JLC A;  5D2M B;  3U7D A;  4EEW A;  3ZO5 B;  2M8S A;  2XK5 B;  3ZNZ B;  1XD3 B;  4EOY A;  2BKR B;  1E8Z A;  2C60 A;  2CHW A;  4EUT A;  5LXI B;  2K25 A;  1WZ0 A;  5KHO A;  4TV3 A;  4AUQ C;  1GC6 A;  4K1R B;  3BIN A;  1UBQ A;  1WGR A;  2KJR A;  3T8M A;  3QCA A;  2KXJ A;  2KDI A;  2AL3 A;  3KUC B;  2ZNV C;  4NQK E;  3ZRC A;  3W1S A;  4RM8 A;  3IHP C;  3ML9 A;  2N1W A;  5LXH A;  4WWO A;  1WX9 A;  2GBJ A;  3K9P B;  3RYT A;  2CHZ A;  3W1Y A;  4ASW C;  4GSW A;  2KTR B;  4TKN A;  4DHJ B;  2FIF A;  3A9K B;  4BBN C;  4EFO A;  2GBN A;  5J18 A;  1E5W A;  4X57 B;  4XX5 A;  1KM7 A;  3VQI A;  3PGE A;  4KSK C;  2NPT B;  1EUV B;  2LZ6 A;  5AEK B;  3P2B A;  4DXA B;  3RD2 A;  4LDT D;  2WWZ A;  4G0N B;  4IWQ A;  4ZRI A;  2LAS A;  3PT2 B;  3A9J A;  3ZUN A;  3A1Q A;  3T9L A;  5AZF A;  4KZC A;  3QIJ A;  3ZNH B;  2B3A A;  2ZVO A;  5TR5 A;  2I1J A;  2MBO A;  3AU4 A;  3L0W B;  2KDF B;  1UH6 A;  3SDL C;  2PE9 A;  1V5T A;  1Z5S B;  3B1L X;  1WR6 E;  3OLM D;  5FR6 A;  2R2O A;  1KLV A;  3PS6 A;  2DAJ A;  1I42 A;  2PJH A;  4NNJ B;  1WMH A;  2ZEQ A;  1E8W A;  1V9J A;  1WJ4 A;  2L00 B;  4WWP A;  1H8C A;  4II2 B;  2DEN B;  3HM6 X;  4ZDV A;  3RZF A;  3QK0 A;  4EKU A;  3ZRF A;  2O6V B;  1ZKH A;  2KD0 A;  1LM8 B;  3DBR I;  1WJN A;  3ECI A;  4MH0 E;  2KVR A;  1NBF C;  2ZPY A;  4MGI E;  2HE7 A;  1KOT A;  2J7Q B;  3ENE A;  2KDB A;  2OJR A;  1UGM A;  2JPH A;  3DVG X;  1P98 A;  5JZE B;  4E71 A;  2FCQ A;  1C3T A;  1TTN A;  4M8N A;  1Q1O A;  1YQB A;  2IY1 B;  2JF5 A;  2LUE A;  3NY5 A;  1WX8 A;  2JVC A;  4FJY A;  5D94 A;  3WA0 A;  3JSV A;  2KX0 A;  2KZR A;  4A3O A;  2IZV B;  4B95 A;  2JY6 A;  2Z0D B;  2K6Q A;  3NZU A;  2K8H A;  2GBM A;  4MM3 A;  4PS8 A;  3RUL A;  3HM3 A;  4KIK A;  4IWO A;  4KZ0 A;  2MP2 B;  2A4Z A;  2L0F A;  3KYD D;  5AZG A;  4HPL B;  2KFJ A;  2L7R A;  2D10 A;  2FCM A;  3Q3J A;  1WH3 A;  2MP2 A;  3WAL A;  3VVW B;  3PLU A;  2K8B A;  2JXX A;  3OAW A;  4HWI B;  3H7P B;  3Q3F A;  1ZW7 A;  4W9E A;  2J0M A;  2ZZP B;  3M95 A;  1WM2 A;  1L7Y A;  1R4M I;  3MTN B;  3V6C B;  1P3Q U;  2C7M B;  2IO3 B;  4DHJ D;  1J0G A;  3R66 C;  4DDG D;  3APF A;  3N32 A;  3VHT C;  3B08 A;  1E7V A;  1Z2M A;  4BVU C;  1U4A A;  3VH3 B;  2N7D A;  3RZW C;  1XQQ A;  1Y8R C;  2YLM A;  3ONS A;  1YJ1 A;  3VUY A;  4NY0 A;  1J8C A;  2NBV B;  1VCB A;  2IO2 B;  4MEM A;  1GUA B;  2ZVN A;  2KAN A;  2D07 B;  1Q5W B;  1V81 A;  2DYB A;  2N9X A;  2WX1 A;  3EFU A;  2G3Q B;  3X23 A;  3VUX A;  4RM9 A;  3HK0 A;  3DVG Y;  3V61 A;  3AXC A;  3UGB B;  5EDS A;  2KHW B;  4XC2 A;  2KWV B;  1WXV A;  3AU5 A;  4IG7 B;  3QC8 B;  2IO1 B;  1TGZ B;  3TBL D;  1WX7 A;  3WAN A;  4A3P A;  4II3 B;  4ICV A;  2LXC A;  3APC A;  3W1S C;  5JHB A;  1WGH A;  4F7Z A;  2N9E B;  1YX5 B;  2DYO A;  1E90 A;  2NS5 A;  1UD7 A;  1YIW A;  1QZE A;  3MJW A;  2JZZ A;  5L83 A;  3NOB A;  4LJP B;  3RUI B;  2BWF A;  1WGD A;  2IYD B;  1C1Y B;  2LGX A;  2NBU A;  2L8J A;  2KTF A;  3H1U A;  3UIP B;  3PRM B;  4NJ7 A;  4ANW A;  2ZCB A;  3CF6 E;  2JUO A;  5E6O A;  2DHZ A;  4GN1 A;  4PS3 A;  2LVP A;  1WMH B;  2KX3 A;  4MGZ E;  3TCA A;  4F1S A;  1KJT A;  4GDK A;  2JZ3 B;  2ZJD A;  4GIV A;  2KWU B;  3VDZ A;  1S3S G;  4FUL A;  2IY0 B;  3VTV A;  1A5R A;  4GU2 A;  2BYE A;  1AAR A;  4DK5 A;  4XZ4 A;  2M4N A;  1V49 A;  2FUH B;  4NQL B;  3EC8 A;  1RAX A;  2O6V D;  4FA6 A;  2MBH A;  3V60 A;  2Z59 B;  3A33 B;  3MHS D;  1RFA A;  3VFK A;  3OJ4 B;  1UEL A;  1WJU A;  3WIM A;  3OJ3 A;  4GGQ A;  1LQB A;  5LLI A;  4K7W A;  2RR9 A;  1WY8 A;  4GDL A;  2M17 A;  4IUM B;  3U8Z A;  4CO7 A;  4KV2 A;  1UBI A;  4PS7 A;  2K1F A;  2JRH A;  3V62 A;  4GDL B;  3VAW A;  3VXW A;  4BKS D;  3ZTD A;  4IM2 A;  2HJ8 A;  5E6N A;  1XT9 B;  1WXA A;  3H7S A;  3RT3 B;  2MCN B;  2KKC A;  2MA9 B;  3R7R A;  2LRU A;  2MWS B;  3DCG A;  1R4N I;  4W9D A;  4CYE A;  3QWZ B;  3M63 B;  2MX2 A;  2C7N B;  2RGF A;  2CR5 A;  1ZGU B;  4HCP B;  5DPR A;  3SU8 X;  3X0W A;  1I35 A;  2BGF A;  4KVG B;  2IO0 B;  3KUD B;  2EKE C;  4FHK A;  4FHJ A;  3UIN B;  4WJN A;  4BOS C;  2MBQ A;  1WJ6 A;  2KMA A;  2MLB A;  4ANU A;  2BPS A;  3KYC D;  2KFK B;  4W9G A;  4IM0 A;  1WE7 A;  1E8X A;  2D11 A;  2KLG A;  4G11 A;  4BKG A;  1MG8 A;  4LCD E;  3PHX B;  1WGG A;  4AOF A;  3ZNG C;  4KIK B;  3EHV A;  3UIO B;  1WYW B;  2KOX A;  1GC7 A;  4W9C A;  2C7H A;  5CX3 A;  3QHT A;  5E6P A;  1WFY A;  5HKH A;  2NPT A;  4GXB A;  4WAA A;  3K9O B;  2N9P C;  1EF1 A;  1OEY A;  3H7P A;  4HK2 A;  4OVU A;  2MW5 A;  2AWT A;  4EZL A;  1NI2 A;  4MGK E;  4HLE A;  2XEW A;  2PEA A;  3DBS A;  4HVB A;  3TIX A;  3PZD A;  5CHF A;  5DPS A;  4EZK A;  3LJ3 A;  5AZH A;  4G50 A;  3ZLZ A;  2V4L A;  2FID A;  2LXA A;  3N3K B;  4BKS A;  2W9N A;  2MBE A;  5DPW A;  2NVU I;  4I6P A;  2NBW B;  4BOZ B;  3L16 A;  4GDK B;  3R7Q A;  2L05 A;  4N9F 4;  4K7S A;  3C0R B;  1WE6 A;  3ZKJ C;  2LGD A;  3A9J B;  3UQA A;  2RSU A;  2CHX A;  2JRI B;  3KH0 A;  4KDI C;  4GMV A;  3JYU A;  4HXD A;  1P1A A;  2O6V A;  3KW5 B;  4NPN A;  3V6E B;  2J0K A;  1BT0 A;  3PRE A;  2UWQ A;  4IM3 A;  1GNU A;  3JW0 X;  5C23 A;  1K8R B;  2KFK A;  3ML8 A;  2FAZ A;  3N30 A;  4DBG A;  3R3M A;  3UF8 A;  2OOB B;  1WXS A;  4P7I A;  3D32 A;  5KHQ A;  2EMS A;  4NJ6 A;  1WXM A;  2HD5 B;  3PLV A;  4GOC A;  5GMV A;  2R2Q A;  1RLF A;  2WDT B;  4YL8 A;  4AWJ A;  3L10 B;  2LVQ A;  4BKT A;  3CMM B;  4BFR A;  3QQ8 B;  1P9D U;  3VUW A;  2DX5 B;  1IPG A;  2Z0E B;  3AI5 A;  2LGY A;  2L76 A;  1V5O A;  4G3X B;  4JQW C;  4JL9 A;  1SIF A;  1WR1 A;  3IVF A;  2AL6 A;  4W9F A;  2I1K A;  1WIA A;  2EMT A;  2GBR A;  4M0W B;  1OEY J;  1PQS A;  3GZN I;  4I6L B;  1V2Y A;  3NZS A;  2FCN A;  1WZ3 A;  5DPT A;  3QAR A;  3U30 A;  2KWC A;  3O65 B;  4K81 A;  2BF8 B;  2D3G A;  1Q0W B;  3L54 A;  4AJY B;  4W9K A;  3GOE A;  2KJH B;  3DVN V;  4CHK A;  2RPQ A;  3H9D A;  4W9I A;  3HIZ A;  1IP9 A;  3VTU A;  3PPA A;  2KDE B;  4KDL B;  2G4S A;  3ZDM C;  2KQ7 A;  4ZYN A;  3DVN U;  4B6W A;  2XBB C;  2AEH A;  5DCN A;  2LI5 A;  2JWZ A;  2LD9 A;  1F9J A;  5BO4 B;  3SHQ A;  2KQS A;  2KLC A;  3DOW A;  4PYZ A;  2AYO B;  4K7U A;  3CST A;  4KSL C;  2UYZ B;  2G45 B;  3H6N A;  3DQV A;  1WM3 A;  4B9K A;  2L0T A;  3WAO A;  2MQJ A;  5J2R A;  2PE6 B;  1CMX B;  3EEC A;  2ZNV B;  2KNB A;  2DZK A;  3HHM A;  3L17 A;  4ICU A;  3ZTC A;  2KMC A;  3UQB A;  3QJZ A;  2K39 A;  4GB9 A;  4FJV B;  4LDT B;  4IWP A;  2FCS A;  3ZIM A;  5JHA A;  2KN5 A;  3PHW B;  4MEL A;  2C9W B;  3M62 B;  2KC2 A;  4MSM B;  3PSE B;  2N7E A;  3QAQ A;  3DPD A;  3I3T B;  4OVV A;  4HPM B;  2GOW A;  2O2V A;  2XK5 A;  4TUU A;  2K6D B;  4LJO B;  2MBB B;  5JH5 C;  2BYF A;  3ALB A;  4E74 A;  3S2A A;  1YD8 U;  3PV1 A;  1ISN A;  1SGH A;  2DZM A;  2WX0 A;  3PTF C;  2LVO A;  3LDZ E;  4A20 A;  3ZNI D;  4DHZ E;  2M1M A;  4HDO A;  2DYM A;  2N1V A;  3WAP A;  2K8C A;  1P0R A;  2DZJ A;  3ZDT A;  4DDI D;  4HDQ A;  2DZI A;  3SD5 A;  1OQY A;  3DBH I;  4FN2 A;  4WJQ A;  2YVC A;  1V86 A;  5CHW A;  3A9K A;  2BWE S;  5IAA C;  2LWP A;  2CS4 A;  3L13 A;  3KVF B;  4DWF A;  1HE8 A;  2GBK A;  4HCN B;  1YX6 B;  3TJP A;  1WI0 A;  3A4R A;  2KO3 A;  1GG3 A;  2KC1 A;  3JSV B;  1T0Y A;  1OTR B;  4ANX A;  4WJO A;  5J17 A;  2FNJ B;  3PRP B;  2ASQ A;  4URK A;  2GMI C;  2RD0 A;  4FLH A;  3NS8 A;  4ANV A;  2LJ5 A;  1H4R A;  2QHO A;  1FXT B;  4EZJ A;  2M0X A;  1OGW A;  1WF9 A;  3L08 A;  4NAW B;  2L3Z A;  4ZRK A; 
#chains in the Genus database with same CATH topology
 3IG3 A;  1NYR A;  2LRW A;  4M0W A;  2QCZ A;  2BKF A;  2KN4 A;  2KTR A;  3N1Y C;  4RMA A;  5CTR C;  4AJW A;  1F52 A;  1ESF A;  2XNA C;  1FFU A;  1NEK B;  2WU5 B;  5C1Z A;  3NHE B;  1YQ3 B;  3ZVV A;  1D3Z A;  1JRU A;  4MSQ B;  1OQR A;  3BY4 B;  1RYJ A;  1L6V A;  2JT4 B;  1VD2 A;  1E8Y A;  4Q2J A;  4L2Y A;  2CU1 A;  1XF5 L;  2BYV E;  3AE7 B;  3QX1 A;  4TQ1 A;  2QIE B;  3IFW B;  2W3R A;  3MC0 B;  2CKH B;  1IYF A;  2H89 B;  4MT5 A;  1P7F A;  2WDQ B;  2C5L C;  1ROE A;  2DAF A;  3TL5 A;  2VRR B;  4I6N B;  3RNF C;  3P4R B;  1J19 A;  1TBE A;  2PPH A;  1GJZ A;  2WXK A;  2D2Q A;  2SEB D;  3P42 A;  2VZK B;  2E3T A;  4JLC A;  5D2M B;  1FEH A;  3ZNZ B;  2KWD A;  1L4Z B;  1WZ0 A;  1GC6 A;  3T8M A;  3QCA A;  2KXJ A;  3ZRC A;  1P7E A;  3W1S A;  3ML9 A;  1XCQ L;  1KH0 A;  1CQV A;  3W1Y A;  1I4G A;  1T5X D;  4TKN A;  2Z8L A;  4B0E A;  4XX5 A;  4X57 B;  2PIA A;  2HJ1 A;  3C8Y A;  1TZO A;  5HFY A;  2Y3A A;  4ACF A;  2WWZ A;  4IWQ A;  4ZRI A;  2LAS A;  1ZUD 2;  3PT2 B;  3IXS A;  1WSP A;  3A1Q A;  4ZRQ A;  1TJE A;  1QT9 A;  1I4X A;  2ZVO A;  1YN5 A;  1WGK A;  3CWI A;  1Z5S B;  3B1L X;  5H92 C;  2N9K A;  1L0V B;  2DAJ A;  1C76 A;  2PJH A;  1E8W A;  4FXC A;  1VLB A;  4WWP A;  1FRD A;  4ZDV A;  3HM6 X;  4EKU A;  2KD0 A;  1LM8 B;  4WWM A;  3B2F A;  2KVR A;  2QDF A;  4P16 A;  2HE7 A;  3DVG X;  3GE8 C;  5JZE B;  1TTN A;  1Q1O A;  1YQB A;  3NY5 A;  2KX0 A;  1N61 A;  2JY6 A;  4RNA A;  3NZU A;  2GLS A;  2OHF A;  1CK1 A;  4KIK A;  4JWS C;  2A4Z A;  2KFJ A;  2LEK A;  2FCM A;  1FXI A;  4HJG E;  1WH3 A;  3VVW B;  3PLU A;  1ZE3 D;  2JXX A;  3KQ4 A;  1ZW7 A;  2J0M A;  2ZZP B;  4K3C A;  1WM2 A;  4XDC A;  3NS1 A;  3WCQ A;  2C7M B;  4DDG D;  3BVZ A;  1STE A;  3RFZ B;  1U4A A;  1JRP A;  3AE2 B;  1Y8R C;  2WXF A;  2YLM A;  1J8C A;  1YJ1 A;  1VCB A;  2IO2 B;  1C77 A;  1GUA B;  2WX1 A;  3EFU A;  3RPF C;  4RGO S;  1C78 A;  2K22 A;  4RM9 A;  3HK0 A;  3ZJU A;  3V61 A;  1MHX A;  4A55 A;  1WXV A;  4JE3 B;  2KVZ A;  2IND C;  2IO1 B;  3TBL D;  2J52 A;  4A90 A;  3O13 A;  2N9E B;  1E90 A;  3NOB A;  3RUI B;  1GB1 A;  2BWF A;  1WGD A;  1C9F A;  1SE4 A;  2LGX A;  3HRD D;  2VH2 A;  3FKY A;  3H1U A;  3UIP B;  4ANW A;  4L23 A;  4USA A;  3AE6 B;  5H8Y E;  4GIV A;  4GU2 A;  4DK5 A;  4QAY A;  2L1A A;  1KTK A;  2Z59 B;  2X8X X;  3OJ4 B;  1UEL A;  3OJ3 A;  1LQB A;  3NRZ A;  1PYW D;  4GLS C;  3VAW A;  4PS7 A;  1J7B A;  4GDL B;  5BMG A;  5E6N A;  2MJ3 A;  3R2T A;  4HKQ A;  3QWZ B;  2MX2 A;  2C7N B;  1ZGU B;  2IGH A;  3SU8 X;  3P4S B;  1T3Q A;  3UIN B;  4WJN A;  1R7S A;  3IT6 B;  1D5Z C;  1TIF A;  2MLB A;  2BPS A;  2PW9 A;  5T8I A;  4TSS A;  5HG2 A;  2KLG A;  4G11 A;  3PHX B;  3ZNG C;  2KOX A;  3QHT A;  5IKC M;  3K9O B;  4WAF A;  1EF1 A;  3HVD A;  1F1H A;  1NI2 A;  2AQ3 B;  3RNB C;  1FNU A;  1GAQ B;  5DPS A;  5G5G A;  1RWS A;  3N3K B;  2W9N A;  2MBE A;  1CJE A;  4EE2 A;  2QEJ C;  3R7Q A;  2L05 A;  4N9F 4;  4N6E B;  3C0R B;  3ZKJ C;  2RDH A;  2JRI B;  3TEZ A;  4XWW A;  1KLU D;  1MFW A;  1GNU A;  2ACZ B;  1DGJ A;  2KFK A;  3AM9 A;  2FAZ A;  4S17 A;  2OOB B;  1WXS A;  3AH7 A;  2EMS A;  4MH8 A;  2BYT A;  2HD5 B;  3IT4 B;  2R2Q A;  4YL8 A;  4AWJ A;  1ENF A;  2LHE A;  1NVI D;  1P9D U;  2Z0E B;  4G3X B;  1WR1 A;  3IVF A;  1OEY J;  1V2Y A;  1WZ3 A;  5DPT A;  3U30 A;  3O65 B;  1VR9 A;  2D3A A;  4BZA A;  2DLB A;  2KQ7 A;  4B6W A;  4KGT A;  3GB1 A;  5BO4 B;  3Q8C A;  3DOW A;  1FCC C;  2G45 B;  4N59 A;  4A6Q A;  3WAO A;  2MQJ A;  3EEC A;  3HHM A;  3PHW B;  3RI7 C;  1FRR A;  3NJT A;  3M62 B;  3PSE B;  3I3T B;  4OVV A;  1D5X C;  3Q69 A;  1FNW A;  1HTQ A;  4TUU A;  2K6D B;  2ICI A;  4LJO B;  2JQR B;  5JH5 C;  1C4P A;  3PV1 A;  1SGH A;  2WX0 A;  2LVO A;  4A20 A;  4DHZ E;  2K8C A;  2DZI A;  2AQ1 B;  4FN2 A;  4WJQ A;  2BWE S;  3L13 A;  1D6E C;  2BVC A;  1WI0 A;  3A4R A;  2KO3 A;  3LYY A;  1GG3 A;  2KC1 A;  1IUE A;  2K5P A;  4ANX A;  2FNJ B;  3PRP B;  4KGS A;  2GMI C;  1L0X B;  2BBC A;  4C4V B;  1FNV A;  3HVZ A;  2M0X A;  1OGW A;  1TZ1 A;  1PGB A;  1V80 A;  2KJ6 A;  4FBJ B;  4IC7 B;  3C19 A;  3DDC B;  2NMQ A;  2V3S A;  4OW0 A;  3RCZ A;  1BML C;  4JGH B;  2VZK D;  5G55 A;  1XLO A;  4C4V A;  3AE3 B;  1NYQ A;  3ZXR A;  4HPP A;  2BS4 B;  2J0J A;  1EM7 A;  3TMP B;  2ZCC A;  3M3J A;  2KAJ A;  2KT7 A;  1HA5 A;  1HQR D;  2BS3 B;  1V97 A;  1FPY A;  2V9H A;  2J53 A;  2K0P A;  2MRP A;  3NVV A;  3N1X C;  4MJS A;  1LXD A;  5D6J B;  2HTH A;  1K50 A;  4MJS B;  3DHH C;  4TMA B;  1EU3 A;  4NAW A;  2VH1 A;  5D7G A;  3AE4 B;  4XYC A;  4HRO A;  1N60 A;  2KDM A;  4TQ0 A;  4UDU C;  2JYE A;  5L95 C;  3ZO5 B;  2MH7 A;  2XK5 B;  1XD3 B;  5LXI B;  3KWL A;  5TSS A;  1UBQ A;  2KJR A;  2WXH A;  2ZNV C;  2B76 B;  3IHP C;  2N1W A;  5LXH A;  1UF0 A;  3NG0 A;  2KTR B;  4DHJ B;  3A9K B;  4BBN C;  4EFO A;  2GBN A;  2WS3 B;  5J18 A;  3V3X A;  4KSK C;  2NPT B;  1EUV B;  1TKE A;  1I4P A;  4DXA B;  3A9J A;  3ZUN A;  5AZF A;  4KZC A;  4LTU A;  3ZNH B;  2B3A A;  2MBO A;  3L0W B;  2GRI A;  1UH6 A;  1VDV A;  2ZW0 A;  2PE9 A;  1V5T A;  1JWS D;  3GP7 A;  4YSX B;  1ZPS A;  4M01 A;  3DWG C;  1I42 A;  2L00 B;  1V9J A;  4C56 C;  1ZP0 B;  2DEN B;  1EU4 A;  3RZF A;  3AEA B;  2MJD A;  1K53 A;  3DBR I;  1WJN A;  3ECI A;  1ZDX A;  4MH0 E;  4WH4 A;  2J7Q B;  2KDB A;  1AW7 A;  1QLB B;  2X38 A;  3IAM 1;  4P6V F;  1C4C A;  1E9M A;  2FCQ A;  1HTO A;  2JF5 A;  2LUE A;  5D94 A;  3JSV A;  4A3O A;  4B95 A;  4NJC A;  3DWM A;  5AUK A;  2Z0D B;  2GBM A;  3H8H A;  3U2S C;  3RUL A;  1RM6 C;  2MP2 B;  2D10 A;  2IJ0 A;  1MJD A;  2K8B A;  3Q3M C;  2PMV A;  5I4D A;  1WWT A;  3VRB B;  3V6C B;  3R66 C;  3VH3 B;  3SFE B;  3RNA C;  1XQQ A;  2INN E;  2W54 A;  3SEB A;  2W55 A;  1Q5W B;  2N9X A;  2G3Q B;  3X23 A;  1OQQ A;  2FE8 A;  2INP E;  3UGB B;  1ZDV A;  3PZ8 A;  2KWV B;  3AU5 A;  3QC8 B;  2BS2 B;  4ICV A;  2LXC A;  3APC A;  3W1S C;  5JHB A;  2DYO A;  1UD7 A;  2RDG A;  2JZZ A;  3MJW A;  4LJP B;  3IAS 1;  4N58 A;  1JWA D;  1C1Y B;  1N5X A;  2KTF A;  2ZCB A;  2JUO A;  5E6O A;  2DHZ A;  2OED A;  4GN1 A;  2LVP A;  3TCA A;  4WUR A;  2JZ3 B;  2ZJD A;  3VDZ A;  1S3S G;  4FUL A;  3R8B A;  1V49 A;  2FUH B;  1RAX A;  2MBH A;  2WDV B;  3A33 B;  3MHS D;  1KLG D;  4GGQ A;  3ABV B;  4K7W A;  2RR9 A;  1WY8 A;  1IGD A;  2WU2 B;  1UBI A;  3VXW A;  3ZTD A;  2WGS A;  4IM2 A;  1R4N B;  2HJ8 A;  2KKC A;  2MWS B;  3DBR B;  3M63 B;  2RGF A;  4HCP B;  5DPR A;  1I35 A;  2JXT A;  2BGF A;  3AMZ A;  5LNK 1;  3KYC D;  3Q14 C;  1VZ7 A;  1UWX A;  1HXY D;  4BKG A;  1MG8 A;  3CIR B;  1WYW B;  2C7H A;  5CX3 A;  1YN4 A;  1WFY A;  5HKH A;  2JX5 A;  2NPT A;  4GXB A;  1J7C A;  4LNO A;  1ZOY B;  3H7P A;  4EZL A;  2MW5 A;  2AWT A;  4ZHO A;  2N7J A;  4HLE A;  2PEA A;  3DBS A;  2R61 A;  3LJ3 A;  1PUT A;  2TSS A;  4G50 A;  3ZLZ A;  2V0G A;  3AV8 A;  1C4A A;  2FID A;  2LXA A;  2NVU I;  2IPK D;  4NAM A;  1WYG A;  1TY2 A;  3KH0 A;  4OHJ A;  5BYR A;  2O6V A;  2MHJ A;  4NPN A;  2RDB C;  3AB5 A;  3JW0 X;  5C23 A;  1K8R B;  1L0Y B;  3N30 A;  4DBG A;  4YTP B;  3R3M A;  3D32 A;  5IP4 D;  3PLV A;  3L10 B;  2LVQ A;  3QQ8 B;  3VUW A;  1UUP A;  1FO4 A;  2DNF A;  3AI5 A;  4JQW C;  1V5O A;  1YQ4 B;  1SIF A;  4W9F A;  3BII D;  2I1K A;  1WIA A;  3FIL A;  4C80 A;  3NZS A;  3AEE B;  3ZXV A;  4K81 A;  2D3G A;  3AEF B;  2NTT A;  2KJH B;  3DVN V;  1YJJ A;  4LK0 M;  2HDE A;  2RPQ A;  4CQN A;  3HIZ A;  1JML A;  3VTU A;  1UWM A;  2KDE B;  3ZDM C;  1FIQ A;  1GOZ A;  4PYZ A;  2KQS A;  2KLC A;  3VR9 B;  1TS3 A;  4KSL C;  3BK2 A;  2KYW A;  3RNC C;  3H6N A;  3DQV A;  4B9K A;  4HRS A;  2INC C;  3N1Z C;  2DZK A;  5IOI A;  3L17 A;  2LGI A;  3KWV A;  4MEL A;  3N20 C;  2BT6 A;  2ONQ A;  4KKJ A;  2LHD A;  4C7Y A;  2N7E A;  4R3D A;  3QAQ A;  4RF1 A;  4YSY B;  2XK5 A;  2JZP A;  1SJH D;  2DZM A;  3PTF C;  4RH6 A;  4HDO A;  2N1V A;  1HEZ E;  4HDQ A;  3AE9 B;  2YVC A;  5IAA C;  3A9K A;  1XCT L;  3P1M A;  3TJP A;  1F2R I;  4A8X C;  1SB3 C;  5FK9 C;  2ASQ A;  1TT5 B;  1KF6 B;  3FC4 A;  3NS8 A;  2QHO A;  4EZJ A;  1WF9 A;  3WAM A;  5AUI A;  1EO6 A;  2WXN A;  4MDK E;  2ZW1 A;  2L32 A;  4HJK A;  3J9C A;  3ZYY X;  1NDD A;  3QA8 A;  3VH4 B;  4M02 A;  1EF5 A;  5JXV A;  1L2N A;  1JCK B;  2D3B A;  1E10 A;  3BVG A;  3VTW A;  2O2V B;  2H88 B;  1ET6 A;  4W9L A;  4W9J A;  5EE1 A;  1E7P B;  3TEW A;  2JYT A;  1TY0 A;  1LFD A;  2DBY A;  3PVL A;  1L4D B;  3AUL A;  3RNE C;  1SXT A;  2NR2 A;  4FAD A;  3P63 A;  3FIL B;  1E6E B;  2D3C A;  2G4D B;  1JRO A;  1UZX B;  3A1Q B;  4ZRJ A;  4WQO B;  1SEB D;  1RRB A;  2BTE A;  2REX A;  1SE9 A;  2N0S B;  1B9R A;  1E7U A;  1DOX A;  1TS5 A;  3JVZ X;  4M8M A;  4PK1 A;  1X1M A;  1V6E A;  3Q3O C;  1JWU D;  3IBE A;  2I2Y A;  1T0Q C;  4IW0 A;  3PRZ A;  3U7D A;  4S0R A;  2M8S A;  2BB6 A;  4HEA 1;  4ZOH C;  1PGX A;  1NI3 A;  3B2G A;  4EOY A;  2CHW A;  1E8Z A;  2C60 A;  4EUT A;  2K25 A;  4ITK A;  5KHO A;  4TV3 A;  4AUQ C;  1WXQ A;  1WGR A;  4IOI E;  3URY A;  4D2K A;  1ACC A;  4RM8 A;  4WWO A;  1WX9 A;  2GBJ A;  3RYT A;  4J3O D;  4ASW C;  4K3B A;  2W3S A;  2FIF A;  2PVG C;  1E5W A;  3VQI A;  3PGE A;  1AN8 A;  3RNG C;  5E6J A;  5AEK B;  3DHG C;  1LGR A;  4LDT D;  4OZA A;  1ZXH A;  5HHD G;  4LNK A;  1MVK A;  1JWM D;  4DXG A;  1QKZ A;  3AU4 A;  3NVW A;  2WP9 B;  1EWC A;  2KDF B;  1XEE A;  3SDL C;  3I5J C;  2GI9 A;  5FR6 A;  2K9X A;  2R2O A;  1KLV A;  2FUG 1;  2RMM A;  1WMH A;  2IGD A;  1WJ4 A;  4II2 B;  1IGC A;  1YNT E;  3ZRF A;  4RGM A;  4O1N A;  2JSV X;  2WXR A;  1NBF C;  3E9S A;  1KOT A;  4A9A A;  1AYF A;  3ENE A;  1L5P A;  2WXJ A;  2WLB A;  2WXI A;  4YTM B;  1C3T A;  2L52 A;  1BUI C;  2IY1 B;  4FJY A;  2JVC A;  2LJI A;  3WA0 A;  2KZR A;  2IZV B;  2K8H A;  2N9L A;  3HM3 A;  4E71 A;  4IWO A;  4KZ0 A;  5AZG A;  2IGG A;  1MPE A;  3Q3J A;  1MHH E;  3WAL A;  2WQY B;  5C3J B;  3M95 A;  4JPS A;  1L7Y A;  3MTN B;  3Q2A C;  4BAX A;  1BXT A;  1P3Q U;  2IO3 B;  3APF A;  3N32 A;  1E7V A;  1Z2M A;  1OFF A;  3VUY A;  4NY0 A;  2Y5P A;  4US9 A;  1XO3 A;  2DYB A;  3W5U B;  1I4H A;  3LXF A;  3DVG Y;  3AXC A;  2AQ2 B;  3EFC A;  2PVO D;  1TGZ B;  3W5V B;  3WAN A;  4A3P A;  2LUM A;  4II3 B;  1I7H A;  1WGH A;  4F7Z A;  1YN3 A;  2NS5 A;  3GE3 C;  1QZE A;  4AQ7 A;  5BYQ A;  2NBU A;  2QC8 A;  3NVY A;  4NJ7 A;  3CF6 E;  3KLS X;  1GB4 A;  1DOI A;  1NEN B;  2W82 A;  4RF0 A;  4MGZ E;  1WMH B;  4F1S A;  1KJT A;  4GDK A;  2KMM A;  4B0M A;  1CZP A;  4DQO C;  2KWU B;  2RPV A;  1A5R A;  4LNF A;  1AAR A;  4XZ4 A;  1F77 A;  3EC8 A;  4FA6 A;  4NZL B;  3V60 A;  5C2T B;  3VFK A;  1RFA A;  3N9Y C;  1WJU A;  3WIM A;  1V8C A;  3UI3 A;  4GDL A;  2M17 A;  3U8Z A;  2CJO A;  3MHZ A;  4KV2 A;  4BKS D;  3RT3 B;  2MA9 B;  2K3U A;  2ON8 A;  4W9D A;  3DCG A;  4CYE A;  3Q8A A;  1SBB B;  3X0W A;  4KVG B;  3KUD B;  4ZHP A;  3E56 A;  4BOS C;  2KMA A;  1QOA A;  3SR6 A;  4IM0 A;  1WE7 A;  1E8X A;  4C00 A;  5BMI A;  4AOF A;  1AWD A;  4KIK B;  1QOB A;  3GS2 A;  4WAA A;  3MC8 A;  2N9P C;  3Q3N C;  1EWY C;  3RMK C;  1OEY A;  3I57 A;  4OVU A;  4MGK E;  2G9H D;  3AE5 B;  4HVB A;  3PZD A;  2J42 A;  4EZK A;  5AZH A;  2YEP B;  2V4L A;  4BKS A;  1MI0 A;  1YMH E;  1K52 A;  4I6P A;  2NBW B;  4XE0 A;  4OZB A;  3A9J B;  3UQA A;  2RSU A;  2CHX A;  4HXD A;  1P1A A;  3KW5 B;  1BT0 A;  2CU3 A;  3P4P B;  2UWQ A;  1HZ6 A;  4IM3 A;  1Y56 A;  3UF8 A;  4IKG A;  5KHQ A;  2Q5W D;  2MEK A;  3AE1 B;  1UGJ A;  2JWU A;  2V3N A;  2DX5 B;  1D5M C;  3B9J A;  2AL6 A;  2EMT A;  2GBR A;  3LB8 C;  1PQS A;  3DBL B;  2M0A A;  2M56 B;  2KWC A;  1Q0W B;  4AJY B;  4W9K A;  3GOE A;  2V4I B;  4CHK A;  2PKO A;  3H9D A;  1IP9 A;  3BVM A;  1V1P A;  4ZYN A;  3BYY B;  2XBB C;  2AEH A;  5DCN A;  2G1E A;  3DHI C;  3BZD B;  1FM0 D;  1IBX A;  2AYO B;  3CST A;  2Y5C A;  1WM3 A;  1IBX B;  2KAC A;  5GXG B;  2KNB A;  1RFK A;  3ZTC A;  3GZN B;  2KMC A;  4WIP A;  1ET9 A;  2AX5 A;  2K39 A;  4FJV B;  4LDT B;  4IWP A;  3ZIM A;  1MG4 A;  5JHA A;  2KN5 A;  3ETR A;  1JQ4 A;  2YEP F;  2I38 A;  3DPD A;  4HPM B;  2GOW A;  1VZ6 A;  2MBB B;  3NVZ A;  2BYF A;  1TS2 A;  4E74 A;  2MJE A;  4YTN B;  2DWQ A;  1ISN A;  2M1M A;  2DYM A;  3WAP A;  1P0R A;  2V3P A;  1VRA B;  4C7Z A;  1OQY A;  2CJN A;  3DBH I;  3VRA B;  1V86 A;  5CHW A;  3EGR A;  2LWP A;  3I9V 1;  4DWF A;  2GBK A;  2LFI A;  3NZ3 A;  2WXM A;  3JSV B;  3Q8B A;  5J17 A;  1N5W A;  4URK A;  2WXP A;  2RD0 A;  4FLH A;  2LJ5 A;  1H4R A;  1TS4 A;  3L08 A;  4NAW B;  4E3C A;  5IA7 A;  2IDY A;  5IO9 A;  4AP4 C;  4JIO U;  3TUO A;  1QOG A;  2NCN A;  1WGY A;  2IBI B;  3MJ5 A;  4WJP A;  4WWN A;  4F8C B;  2KK8 A;  4FJZ A;  4MM3 B;  3KUZ A;  1I4Q A;  2V1Y A;  4W9H A;  2GB1 A;  4BBN F;  4DHZ B;  1B1Z A;  3APD A;  3CSF A;  5G2N A;  1G6J A;  2Y5B B;  1WRD B;  2ZPN A;  3DBL I;  5CHV C;  3VR8 B;  2N4F A;  4RGN A;  3ZW3 A;  1TKG A;  2MSE D;  4PYU A;  3T3O A;  1M94 A;  3B0A A;  4J6I A;  1V1P B;  4WQM A;  1YJI A;  1SIJ A;  2A5U A;  1S1Q B;  2WYQ A;  3A4S C;  3AED B;  4MGY E;  4DXF A;  3EUB 2;  4EEW A;  5MPO A;  1L6U A;  2BKR B;  4ZYS A;  5D3D A;  4K1R B;  3BIN A;  3KUC B;  2KDI A;  2AL3 A;  4NQK E;  3TEX A;  4M00 A;  2EKI A;  3Q6B A;  3K9P B;  2CHZ A;  4GSW A;  3EA6 A;  4PT5 A;  2XN9 C;  1KM7 A;  4OZC A;  1A70 A;  2LZ6 A;  3P2B A;  3RD2 A;  1Q10 A;  3AEG B;  4G0N B;  1JAL A;  3OWE B;  4KX6 B;  3T9L A;  3QIJ A;  2OJW A;  4XDD A;  5TR5 A;  2I1J A;  3AN1 A;  5EE3 A;  5HI1 A;  1N63 A;  4US8 A;  1WR6 E;  3OLM D;  3PS6 A;  3RN9 C;  1HZ5 A;  4NNJ B;  3NUH B;  2ZEQ A;  1H8C A;  4JWU C;  2WHI A;  3Q8F A;  1VJK A;  3QK0 A;  5BYS A;  2O6V B;  1ZKH A;  3AE8 B;  1SJE D;  3U4E G;  2ZPY A;  4MGI E;  2OJR A;  1UGM A;  2JPH A;  1P98 A;  2SAK A;  4M8N A;  1WX8 A;  4LNI A;  1D4B A;  1T6B X;  3FAH A;  4KGR A;  2K6Q A;  4MM3 A;  5EE0 A;  4PS8 A;  2QSD A;  2L0F A;  3KYD D;  4KKI A;  4HPL B;  2L7R A;  1J7A A;  2MP2 A;  3OAW A;  4HWI B;  3H7P B;  3Q3F A;  4W9E A;  1VZ8 A;  1R4M I;  3W9C B;  1SE3 A;  4DHJ D;  1J0G A;  5IN7 A;  3VHT C;  3B08 A;  2JU6 X;  4BVU C;  4AS1 A;  1JWB D;  2N7D A;  3RZW C;  3ONS A;  2NBV B;  2QJL A;  1R4M B;  4REZ A;  4MEM A;  1SE2 A;  2ZVN A;  2KAN A;  2D07 B;  3OG5 A;  1V81 A;  5FR3 A;  3VUX A;  1F2R C;  3BK1 A;  3PO0 A;  1QOF A;  3ZQ4 A;  1C79 A;  5EDS A;  2KHW B;  4XC2 A;  3V05 A;  4IG7 B;  2WXG A;  1WX7 A;  4XGA B;  4LNN A;  3HUI A;  2E6X A;  1YX5 B;  1YIW A;  1XXG A;  5L83 A;  1XLP A;  4P1B C;  5EE9 A;  2IYD B;  4RFB A;  4ARC A;  1TYG B;  4YWG G;  1GPX A;  2WNM A;  2L8J A;  3PRM B;  4P1C C;  4PS3 A;  2KX3 A;  1SF0 A;  1I4R A;  3VTV A;  2IY0 B;  1N6Z A;  2BYE A;  1FMA D;  4MAC A;  2M4N A;  2NTS A;  4XWT A;  3Q8E A;  2WDR B;  4NQL B;  2O6V D;  3BYT B;  2LMC A;  4H2A A;  4JX1 C;  3MFG A;  5LLI A;  1DYQ A;  2EEL A;  4IUM B;  1WRI A;  4CO7 A;  3U7Z A;  3V62 A;  2K1F A;  2JRH A;  1T0S C;  4L1B A;  1QIL A;  1XT9 B;  1WXA A;  3H7S A;  2M19 A;  2MCN B;  3R7R A;  2LRU A;  1R4N I;  2CR5 A;  2WXO A;  2PTL A;  2IO0 B;  1FCL A;  1PGA A;  2EKE C;  4FHK A;  4FHJ A;  4YSZ B;  1UNS A;  2MBQ A;  1WJ6 A;  4ANU A;  4ZRP A;  4W9G A;  2KFK B;  2D11 A;  1JW9 D;  3I63 C;  4LCD E;  5BMH A;  1WGG A;  1DOY A;  3EHV A;  3UIO B;  1GC7 A;  4W9C A;  2L83 A;  1KRH A;  5E6P A;  5FKA C;  3SFD B;  4YT0 B;  4HK2 A;  1YOV B;  2KQ4 X;  1LO5 D;  2WXQ A;  1K51 A;  2XEW A;  1PFD A;  5G5H A;  3TIX A;  5CHF A;  2QIL A;  3T3N A;  3TEY A;  4LLG M;  1T0R C;  2UU7 A;  1QQR A;  5DPW A;  4BOZ B;  3L16 A;  2J4X A;  4GDK B;  2LGS A;  1FD6 A;  4K7S A;  3AEC B;  3ZGZ A;  3DBH B;  2BW2 A;  1WE6 A;  2LGD A;  4KDI C;  4GMV A;  3JYU A;  1TKY A;  1PDX A;  3ZJT A;  3V6E B;  2J0K A;  3PRE A;  4OVZ A;  2FBW B;  3ML8 A;  1ZXI A;  4P7I A;  4NJ6 A;  1WXM A;  4GOC A;  5GMV A;  1RLF A;  2WDT B;  1F0Z A;  3ZJV A;  3MP9 A;  4BKT A;  3CMM B;  4BFR A;  1SSN A;  4YXD B;  2PLP A;  1IPG A;  2LGY A;  2L76 A;  4JL9 A;  4M0W B;  4I6L B;  3GZN I;  3MC9 A;  2FCN A;  1E0Z A;  3QAR A;  2BF8 B;  3P4Q B;  3L54 A;  3PZ7 A;  4W9I A;  3PPA A;  4KDL B;  1N62 A;  2G4S A;  3DVN U;  2LI5 A;  2JWZ A;  2LD9 A;  1F9J A;  3AEB B;  3BWU D;  3SHQ A;  1FXA A;  4K7U A;  2UYZ B;  1KFY B;  2L0T A;  5J2R A;  3U52 E;  2PE6 B;  4HKZ E;  1CMX B;  2ZNV B;  1XLQ A;  4IDI A;  4ICU A;  3UQB A;  3QJZ A;  4GB9 A;  2FCS A;  1V1O A;  2C9W B;  2KC2 A;  4MSM B;  1XLN A;  2O2V A;  2BB5 A;  3ALB A;  3W2D A;  3S2A A;  3TSS A;  1M4V A;  1YD8 U;  4ARI A;  3LDZ E;  3ZNI D;  3ZDT A;  4DDI D;  2DZJ A;  2D5G A;  3SD5 A;  2HTM E;  2WXL A;  4RCO A;  2CS4 A;  2BQQ A;  3KVF B;  1HE8 A;  4HCN B;  1YX6 B;  1QF6 A;  2QMT A;  3L4P A;  1T0Y A;  1OTR B;  4WJO A;  3R2I A;  5D3I B;  4ANV A;  4RGT A;  1FXT B;  1FFV A;  2L3Z A;  4ZRK A; 
#chains in the Genus database with same CATH homology
 1EO6 A;  4E3C A;  1TZ1 A;  5IA7 A;  3IG3 A;  2LRW A;  4MDK E;  1V80 A;  2KJ6 A;  4FBJ B;  4HJK A;  2BKF A;  4IC7 B;  2KTR A;  5CTR C;  4RMA A;  4AJW A;  3DDC B;  1NDD A;  3QA8 A;  4AP4 C;  3VH4 B;  2V3S A;  4JIO U;  3RCZ A;  1EF5 A;  5C1Z A;  1L2N A;  3NHE B;  3ZVV A;  2NCN A;  4JGH B;  3VTW A;  1D3Z A;  5G55 A;  2O2V B;  1WGY A;  2IBI B;  1JRU A;  4MSQ B;  3WAM A;  4W9L A;  4WJP A;  4WWN A;  4F8C B;  3BY4 B;  2KK8 A;  4FJZ A;  3KUZ A;  2JT4 B;  4W9J A;  1VD2 A;  1E8Y A;  2V1Y A;  2CU1 A;  4W9H A;  2BYV E;  2J0J A;  4BBN F;  3QX1 A;  4DHZ B;  3APD A;  2ZCC A;  4TQ1 A;  3TMP B;  3CSF A;  5G2N A;  3IFW B;  1G6J A;  1LFD A;  2Y5B B;  1WRD B;  3M3J A;  3PVL A;  2CKH B;  2ZPN A;  3AUL A;  2NR2 A;  1IYF A;  4FAD A;  3DBL I;  5CHV C;  2C5L C;  2N4F A;  2DAF A;  3TL5 A;  2VRR B;  2G4D B;  1UZX B;  3A1Q B;  4I6N B;  4ZRJ A;  4WQO B;  3ZW3 A;  2MRP A;  1J19 A;  1RRB A;  2MSE D;  4PYU A;  4MJS A;  1TBE A;  2PPH A;  2REX A;  1SE9 A;  1LXD A;  1M94 A;  5D6J B;  2HTH A;  3B0A A;  1GJZ A;  1E7U A;  2D2Q A;  4J6I A;  4MJS B;  4NAW A;  5D7G A;  3JVZ X;  4M8M A;  1X1M A;  2A5U A;  1V6E A;  1S1Q B;  2WYQ A;  3A4S C;  4TQ0 A;  4MGY E;  3IBE A;  5L95 C;  4IW0 A;  3PRZ A;  4JLC A;  5D2M B;  3U7D A;  4EEW A;  3ZO5 B;  2M8S A;  2XK5 B;  3ZNZ B;  1XD3 B;  4EOY A;  2BKR B;  1E8Z A;  2C60 A;  2CHW A;  4EUT A;  5LXI B;  2K25 A;  1WZ0 A;  5KHO A;  4TV3 A;  4AUQ C;  1GC6 A;  4K1R B;  3BIN A;  1UBQ A;  1WGR A;  2KJR A;  3T8M A;  3QCA A;  2KXJ A;  2KDI A;  2AL3 A;  3KUC B;  2ZNV C;  4NQK E;  3ZRC A;  3W1S A;  4RM8 A;  3IHP C;  3ML9 A;  2N1W A;  5LXH A;  4WWO A;  1WX9 A;  2GBJ A;  3K9P B;  3RYT A;  2CHZ A;  3W1Y A;  4ASW C;  4GSW A;  2KTR B;  4TKN A;  4DHJ B;  2FIF A;  3A9K B;  4BBN C;  4EFO A;  2GBN A;  5J18 A;  1E5W A;  4X57 B;  4XX5 A;  1KM7 A;  3VQI A;  3PGE A;  4KSK C;  2NPT B;  1EUV B;  2LZ6 A;  5AEK B;  3P2B A;  4DXA B;  3RD2 A;  4LDT D;  2WWZ A;  4G0N B;  4IWQ A;  4ZRI A;  2LAS A;  3PT2 B;  3A9J A;  3ZUN A;  3A1Q A;  3T9L A;  5AZF A;  4KZC A;  3QIJ A;  3ZNH B;  2B3A A;  2ZVO A;  5TR5 A;  2I1J A;  2MBO A;  3AU4 A;  3L0W B;  2KDF B;  1UH6 A;  3SDL C;  2PE9 A;  1V5T A;  1Z5S B;  3B1L X;  1WR6 E;  3OLM D;  5FR6 A;  2R2O A;  1KLV A;  3PS6 A;  2DAJ A;  1I42 A;  2PJH A;  4NNJ B;  1WMH A;  2ZEQ A;  1E8W A;  1V9J A;  1WJ4 A;  2L00 B;  4WWP A;  1H8C A;  4II2 B;  2DEN B;  3HM6 X;  4ZDV A;  3RZF A;  3QK0 A;  4EKU A;  3ZRF A;  2O6V B;  1ZKH A;  2KD0 A;  1LM8 B;  3DBR I;  1WJN A;  3ECI A;  4MH0 E;  2KVR A;  1NBF C;  2ZPY A;  4MGI E;  2HE7 A;  1KOT A;  2J7Q B;  3ENE A;  2KDB A;  2OJR A;  1UGM A;  2JPH A;  3DVG X;  1P98 A;  5JZE B;  4E71 A;  2FCQ A;  1C3T A;  1TTN A;  4M8N A;  1Q1O A;  1YQB A;  2IY1 B;  2JF5 A;  2LUE A;  3NY5 A;  1WX8 A;  2JVC A;  4FJY A;  5D94 A;  3WA0 A;  3JSV A;  2KX0 A;  2KZR A;  4A3O A;  2IZV B;  4B95 A;  2JY6 A;  2Z0D B;  2K6Q A;  3NZU A;  2K8H A;  2GBM A;  4MM3 A;  4PS8 A;  3RUL A;  3HM3 A;  4KIK A;  4IWO A;  4KZ0 A;  2MP2 B;  2A4Z A;  2L0F A;  3KYD D;  5AZG A;  4HPL B;  2KFJ A;  2L7R A;  2D10 A;  2FCM A;  3Q3J A;  1WH3 A;  2MP2 A;  3WAL A;  3VVW B;  3PLU A;  2K8B A;  2JXX A;  3OAW A;  4HWI B;  3H7P B;  3Q3F A;  1ZW7 A;  4W9E A;  2J0M A;  2ZZP B;  3M95 A;  1WM2 A;  1L7Y A;  1R4M I;  3MTN B;  3V6C B;  1P3Q U;  2C7M B;  2IO3 B;  4DHJ D;  1J0G A;  3R66 C;  4DDG D;  3APF A;  3N32 A;  3VHT C;  3B08 A;  1E7V A;  1Z2M A;  4BVU C;  1U4A A;  3VH3 B;  2N7D A;  3RZW C;  1XQQ A;  1Y8R C;  2YLM A;  3ONS A;  1YJ1 A;  3VUY A;  4NY0 A;  1J8C A;  2NBV B;  1VCB A;  2IO2 B;  4MEM A;  1GUA B;  2ZVN A;  2KAN A;  2D07 B;  1Q5W B;  1V81 A;  2DYB A;  2N9X A;  2WX1 A;  3EFU A;  2G3Q B;  3X23 A;  3VUX A;  4RM9 A;  3HK0 A;  3DVG Y;  3V61 A;  3AXC A;  3UGB B;  5EDS A;  2KHW B;  4XC2 A;  2KWV B;  1WXV A;  3AU5 A;  4IG7 B;  3QC8 B;  2IO1 B;  1TGZ B;  3TBL D;  1WX7 A;  3WAN A;  4A3P A;  4II3 B;  4ICV A;  2LXC A;  3APC A;  3W1S C;  5JHB A;  1WGH A;  4F7Z A;  2N9E B;  1YX5 B;  2DYO A;  1E90 A;  2NS5 A;  1UD7 A;  1YIW A;  1QZE A;  3MJW A;  2JZZ A;  5L83 A;  3NOB A;  4LJP B;  3RUI B;  2BWF A;  1WGD A;  2IYD B;  1C1Y B;  2LGX A;  2NBU A;  2L8J A;  2KTF A;  3H1U A;  3UIP B;  3PRM B;  4NJ7 A;  4ANW A;  2ZCB A;  3CF6 E;  2JUO A;  5E6O A;  2DHZ A;  4GN1 A;  4PS3 A;  2LVP A;  1WMH B;  2KX3 A;  4MGZ E;  3TCA A;  4F1S A;  1KJT A;  4GDK A;  2JZ3 B;  2ZJD A;  4GIV A;  2KWU B;  3VDZ A;  1S3S G;  4FUL A;  2IY0 B;  3VTV A;  1A5R A;  4GU2 A;  2BYE A;  1AAR A;  4DK5 A;  4XZ4 A;  2M4N A;  1V49 A;  2FUH B;  4NQL B;  3EC8 A;  1RAX A;  2O6V D;  4FA6 A;  2MBH A;  3V60 A;  2Z59 B;  3A33 B;  3MHS D;  1RFA A;  3VFK A;  3OJ4 B;  1UEL A;  1WJU A;  3WIM A;  3OJ3 A;  4GGQ A;  1LQB A;  5LLI A;  4K7W A;  2RR9 A;  1WY8 A;  4GDL A;  2M17 A;  4IUM B;  3U8Z A;  4CO7 A;  4KV2 A;  1UBI A;  4PS7 A;  2K1F A;  2JRH A;  3V62 A;  4GDL B;  3VAW A;  3VXW A;  4BKS D;  3ZTD A;  4IM2 A;  2HJ8 A;  5E6N A;  1XT9 B;  1WXA A;  3H7S A;  3RT3 B;  2MCN B;  2KKC A;  2MA9 B;  3R7R A;  2LRU A;  2MWS B;  3DCG A;  1R4N I;  4W9D A;  4CYE A;  3QWZ B;  3M63 B;  2MX2 A;  2C7N B;  2RGF A;  2CR5 A;  1ZGU B;  4HCP B;  5DPR A;  3SU8 X;  3X0W A;  1I35 A;  2BGF A;  4KVG B;  2IO0 B;  3KUD B;  2EKE C;  4FHK A;  4FHJ A;  3UIN B;  4WJN A;  4BOS C;  2MBQ A;  1WJ6 A;  2KMA A;  2MLB A;  4ANU A;  2BPS A;  3KYC D;  2KFK B;  4W9G A;  4IM0 A;  1WE7 A;  1E8X A;  2D11 A;  2KLG A;  4G11 A;  4BKG A;  1MG8 A;  4LCD E;  3PHX B;  1WGG A;  4AOF A;  3ZNG C;  4KIK B;  3EHV A;  3UIO B;  1WYW B;  2KOX A;  1GC7 A;  4W9C A;  2C7H A;  5CX3 A;  3QHT A;  5E6P A;  1WFY A;  5HKH A;  2NPT A;  4GXB A;  4WAA A;  3K9O B;  2N9P C;  1EF1 A;  1OEY A;  3H7P A;  4HK2 A;  4OVU A;  2MW5 A;  2AWT A;  4EZL A;  1NI2 A;  4MGK E;  4HLE A;  2XEW A;  2PEA A;  3DBS A;  4HVB A;  3TIX A;  3PZD A;  5CHF A;  5DPS A;  4EZK A;  3LJ3 A;  5AZH A;  4G50 A;  3ZLZ A;  2V4L A;  2FID A;  2LXA A;  3N3K B;  4BKS A;  2W9N A;  2MBE A;  5DPW A;  2NVU I;  4I6P A;  2NBW B;  4BOZ B;  3L16 A;  4GDK B;  3R7Q A;  2L05 A;  4N9F 4;  4K7S A;  3C0R B;  1WE6 A;  3ZKJ C;  2LGD A;  3A9J B;  3UQA A;  2RSU A;  2CHX A;  2JRI B;  3KH0 A;  4KDI C;  4GMV A;  3JYU A;  4HXD A;  1P1A A;  2O6V A;  3KW5 B;  4NPN A;  3V6E B;  2J0K A;  1BT0 A;  3PRE A;  2UWQ A;  4IM3 A;  1GNU A;  3JW0 X;  5C23 A;  1K8R B;  2KFK A;  3ML8 A;  2FAZ A;  3N30 A;  4DBG A;  3R3M A;  3UF8 A;  2OOB B;  1WXS A;  4P7I A;  3D32 A;  5KHQ A;  2EMS A;  4NJ6 A;  1WXM A;  2HD5 B;  3PLV A;  4GOC A;  5GMV A;  2R2Q A;  1RLF A;  2WDT B;  4YL8 A;  4AWJ A;  3L10 B;  2LVQ A;  4BKT A;  3CMM B;  4BFR A;  3QQ8 B;  1P9D U;  3VUW A;  2DX5 B;  1IPG A;  2Z0E B;  3AI5 A;  2LGY A;  2L76 A;  1V5O A;  4G3X B;  4JQW C;  4JL9 A;  1SIF A;  1WR1 A;  3IVF A;  2AL6 A;  4W9F A;  2I1K A;  1WIA A;  2EMT A;  2GBR A;  4M0W B;  1OEY J;  1PQS A;  3GZN I;  4I6L B;  1V2Y A;  3NZS A;  2FCN A;  1WZ3 A;  5DPT A;  3QAR A;  3U30 A;  2KWC A;  3O65 B;  4K81 A;  2BF8 B;  2D3G A;  1Q0W B;  3L54 A;  4AJY B;  4W9K A;  3GOE A;  2KJH B;  3DVN V;  4CHK A;  2RPQ A;  3H9D A;  4W9I A;  3HIZ A;  1IP9 A;  3VTU A;  3PPA A;  2KDE B;  4KDL B;  2G4S A;  3ZDM C;  2KQ7 A;  4ZYN A;  3DVN U;  4B6W A;  2XBB C;  2AEH A;  5DCN A;  2LI5 A;  2JWZ A;  2LD9 A;  1F9J A;  5BO4 B;  3SHQ A;  2KQS A;  2KLC A;  3DOW A;  4PYZ A;  2AYO B;  4K7U A;  3CST A;  4KSL C;  2UYZ B;  2G45 B;  3H6N A;  3DQV A;  1WM3 A;  4B9K A;  2L0T A;  3WAO A;  2MQJ A;  5J2R A;  2PE6 B;  1CMX B;  3EEC A;  2ZNV B;  2KNB A;  2DZK A;  3HHM A;  3L17 A;  4ICU A;  3ZTC A;  2KMC A;  3UQB A;  3QJZ A;  2K39 A;  4GB9 A;  4FJV B;  4LDT B;  4IWP A;  2FCS A;  3ZIM A;  5JHA A;  2KN5 A;  3PHW B;  4MEL A;  2C9W B;  3M62 B;  2KC2 A;  4MSM B;  3PSE B;  2N7E A;  3QAQ A;  3DPD A;  3I3T B;  4OVV A;  4HPM B;  2GOW A;  2O2V A;  2XK5 A;  4TUU A;  2K6D B;  4LJO B;  2MBB B;  5JH5 C;  2BYF A;  3ALB A;  4E74 A;  3S2A A;  1YD8 U;  3PV1 A;  1ISN A;  1SGH A;  2DZM A;  2WX0 A;  3PTF C;  2LVO A;  3LDZ E;  4A20 A;  3ZNI D;  4DHZ E;  2M1M A;  4HDO A;  2DYM A;  2N1V A;  3WAP A;  2K8C A;  1P0R A;  2DZJ A;  3ZDT A;  4DDI D;  4HDQ A;  2DZI A;  3SD5 A;  1OQY A;  3DBH I;  4FN2 A;  4WJQ A;  2YVC A;  1V86 A;  5CHW A;  3A9K A;  2BWE S;  5IAA C;  2LWP A;  2CS4 A;  3L13 A;  3KVF B;  4DWF A;  1HE8 A;  2GBK A;  4HCN B;  1YX6 B;  3TJP A;  1WI0 A;  3A4R A;  2KO3 A;  1GG3 A;  2KC1 A;  3JSV B;  1T0Y A;  1OTR B;  4ANX A;  4WJO A;  5J17 A;  2FNJ B;  3PRP B;  2ASQ A;  4URK A;  2GMI C;  2RD0 A;  4FLH A;  3NS8 A;  4ANV A;  2LJ5 A;  1H4R A;  2QHO A;  1FXT B;  4EZJ A;  2M0X A;  1OGW A;  1WF9 A;  3L08 A;  4NAW B;  2L3Z A;  4ZRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...