4AWJA

Pvhl:elob:eloc complex, in complex with capped hydroxyproline
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
103
structure length
100
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADTFEALIEPFSSPPELPDVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting Fragment-Based Lead Discovery at the Von Hippel-Lindau Protein:Hypoxia Inducible Factor 1Alpha Protein-Protein Interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
total genus 22
structure length 100
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2012-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4awjA00
2D10A 3PREA 4IWPA 1OGWA 2KJHB 4ZRJA 2KDBA 4KVGB 2DZMA 2IY1B 2AEHA 2Y5BB 1E8YA 3B0AA 1WGRA 1XQQA 2MBHA 5D7GA 3VH4B 1T0YA 1WMHA 3DVGY 3IHPC 4KDIC 2JXXA 1WZ3A 2CHZA 1HE8A 4WQOB 1V5OA 3A4RA 3L08A 2DAFA 2MQJA 3ONSA 5CHWA 2JZZA 2XBBC 4LDTB 1WR6E 2Z59B 3H9DA 1C3TA 2RSUA 4A3OA 4HPLB 5JH5C 3H6NA 3VTUA 4FN2A 1K8RB 3N30A 2AL3A 3A1QB 1V2YA 2MBQA 3QCAA 4BBNF 2K6DB 2BKRB 4PS3A 2C60A 2JUOA 4KIKA 3IVFA 2KANA 1WJUA 2ZZPB 2EMSA 2L8JA 2KO3A 3CSTA 1IYFA 1Z5SB 2K39A 1UGMA 2UWQA 3UIOB 1UD7A 1IP9A 2JPHA 2DYOA 4KSKC 2BKFA 2MP2A 4GDLB 4B95A 4BFRA 1NBFC 4IWQA 4G0NB 2L76A 3AI5A 3JW0X 2LGXA 4DK5A 1UH6A 1KOTA 4E3CA 3DPDA 3WIMA 2LWPA 1UBIA 4URKA 2MA9B 3V6CB 3DBSA 3DBHI 3GZNI 3B1LX 4LCDE 4EZKA 3KUDB 5JZEB 4ICVA 4NNJB 1BT0A 3IFWB 3M62B 2KVRA 4HDQA 5JHBA 3EC8A 1RFAA 3VFKA 5C1ZA 4K7WA 3ZLZA 2C7MB 2FIFA 3ML8A 4PS7A 3VDZA 4IW0A 4FHKA 1H4RA 5L83A 1YQBA 5L95C 4IM3A 1WY8A 2D3GA 3QX1A 2G45B 2GMIC 1XD3B 3KYCD 4EZJA 5D94A 2DAJA 1RRBA 2BYEA 1D3ZA 2LD9A 3PS6A 3UQBA 2L3ZA 1GJZA 4BKSA 4ICUA 1OTRB 1V81A 1CMXB 2KMAA 4BKTA 2D11A 2KK8A 4GMVA 2CU1A 3QHTA 2R2OA 4M0WB 5CHVC 5GMVA 2LGYA 2MBEA 4ANUA 3P2BA 2ZPNA 2KKCA 2BYFA 4XC2A 3AULA 3R7QA 4E74A 1WE7A 4GDKB 3UIPB 3M3JA 3MJWA 1E7UA 2N9XA 2N7EA 3V61A 3ZRFA 4HLEA 4AJWA 2AWTA 4ANWA 2V1YA 4DWFA 3VQIA 4HDOA 2DYMA 2LXAA 4GN1A 5AZHA 5EDSA 3ZTDA 2LZ6A 1WGGA 3K9OB 2IY0B 3QC8B 4NAWA 3PV1A 3VHTC 1WZ0A 4NPNA 2G4SA 3QQ8B 2FUHB 3M95A 4P7IA 4FJYA 4K7UA 2ZPYA 3ZO5B 5AZFA 2DX5B 3CMMB 2N1VA 2LRWA 4OVVA 5J17A 1XT9B 2MCNB 3PTFC 4MGIE 2KWCA 4TKNA 2V4LA 3L10B 4AUQC 2KOXA 3BINA 1H8CA 2QHOA 1UBQA 2D2QA 4HPMB 2KX3A 3D32A 4G11A 3V62A 3T9LA 4JQWC 1QZEA 4X57B 4B6WA 1X1MA 2KN5A 2LJ5A 2NBUA 1WFYA 1LQBA 5KHOA 2NVUI 5DPRA 4DDID 2BWES 2MBOA 3OAWA 3R7RA 2AYOB 2JRIB 3U30A 4MSQB 3QA8A 1SGHA 3ECIA 4MSMB 4EOYA 4ZDVA 4JGHB 2K8HA 2M1MA 3ZNGC 2JZ3B 1WH3A 3EFUA 3AXCA 3PLUA 4OVUA 2KTFA 2KXJA 2NBWB 3VTWA 2BF8B 2KX0A 4W9JA 2CS4A 1KM7A 1P1AA 3VH3B 1WJ6A 2C7HA 3RD2A 1U4AA 2IBIB 3DQVA 2RD0A 3V60A 3WALA 5LLIA 1ZW7A 2RGFA 3WANA 4LDTD 4I6PA 2HJ8A 2FIDA 3I3TB 4EFOA 2C7NB 4IC7B 2FCQA 5IAAC 3W1SC 4GIVA 3A4SC 1J0GA 4HXDA 1KJTA 4JL9A 2ZVNA 4IWOA 1V5TA 3NZUA 1SE9A 1WGDA 3IBEA 4M8MA 1G6JA 1WR1A 2KJ6A 2I1JA 4N9F4 2KZRA 4WJPA 3RZFA 4AOFA 2CHXA 2I1KA 2L05A 3A1QA 3GOEA 4AP4C 5CX3A 1J8CA 3PGEA 4HWIB 2LXCA 1WX8A 2GBKA 1Y8RC 3PVLA 1J19A 3A33B 1TTNA 1NI2A 3APDA 4IG7B 1EUVB 5TR5A 3DVNV 3TBLD 4MJSA 3VUWA 2NS5A 3APCA 2FCNA 4RM9A 2CKHB 2ASQA 4BOSC 2FNJB 2KDIA 1A5RA 1S3SG 2O6VA 2Z0EB 4TUUA 1EF1A 2L7RA 2PE6B 4II2B 2KNBA 1WMHB 3WAMA 3ZRCA 3TIXA 3TCAA 1WX9A 3ENEA 2EMTA 3Q3FA 3TJPA 2L0FA 3Q3JA 3N32A 4A3PA 2N4FA 5J2RA 2IO2B 3ML9A 4W9EA 3UQAA 3HHMA 4KZ0A 4ASWC 2DYBA 2N9EB 2LVPA 4BOZB 2C5LC 2JY6A 5E6OA 3VXWA 2D07B 2M17A 3VUYA 3PHWB 3H7PA 3LDZE 2GOWA 4DHJB 2ZCCA 2IZVB 2J0KA 5DPTA 4ZRIA 4AJYB 2K25A 2O6VB 3A9JB 3PLVA 3UINB 3PHXB 2LVOA 3L0WB 3RUIB 2GBJA 2KDFB 2PE9A 4WWPA 2O2VA 2MLBA 4MJSB 5E6PA 4FHJA 1L7YA 3ZNZB 4W9CA 4WWNA 3QIJA 2LVQA 2VRRB 2ZCBA 2J7QB 1LXDA 2BGFA 4FADA 2L0TA 4LJOB 1ZGUB 2FCMA 3NHEB 3ZKJC 4F8CB 3RT3B 3ZDMC 3PRPB 1S1QB 4KSLC 3UGBB 3ZVVA 5G2NA 1WJNA 3X23A 2WWZA 4FULA 1E8WA 2HD5B 1MG8A 1WGHA 4WAAA 3SU8X 3X0WA 2DHZA 5DCNA 4XZ4A 1TBEA 2MSED 5KHQA 3M63B 2MWSB 4HCNB 4HJKA 2EKEC 4DDGD 4KIKB 2GBMA 4FJZA 2J0JA 5JHAA 3VUXA 5FR6A 3DOWA 2BYVE 1GG3A 2LI5A 4MGKE 3W1YA 2N9PC 2LRUA 2KDEB 2KWUB 2REXA 1UZXB 4K7SA 3A9KA 3UF8A 1WM2A 1WF9A 1Q5WB 3PT2B 1PQSA 2NPTA 4IM0A 1R4NI 3PSEB 5CTRC 4NY0A 4ZRKA 3HIZA 4F7ZA 2OJRA 3QJZA 2LASA 4DHJD 1WI0A 3CSFA 4BVUC 1WM3A 2KWVB 3BY4B 2LUEA 3QWZB 3KVFB 4PS8A 1ZKHA 3NZSA 4JLCA 4PYZA 4DXAB 4GOCA 1WXVA 3IG3A 3JSVB 3R66C 2KD0A 1WRDB 2PJHA 3SD5A 1LM8B 4CO7A 2ZNVC 2KFJA 2N1WA 4IUMB 3ZUNA 1VCBA 1P9DU 2KFKA 4MELA 3HM3A 2YVCA 3RULA 4FA6A 3MTNB 1E90A 1WYWB 2ZJDA 3HM6X 3NOBA 3A9KB 4EZLA 3ZDTA 3NY5A 3AU5A 3KYDD 3JVZX 4BKGA 2K8CA 2A5UA 1V49A 4II3B 4DHZE 2KHWB 2KC1A 1I42A 2V3SA 3C0RB 3MHSD 4W9DA 4EEWA 2W9NA 3ZNID 4KDLB 1YD8U 3TMPB 2DZKA 4G50A 1TZ1A 1FXTB 3CF6E 3KUZA 4I6NB 2MP2B 2BPSA 4AWJA 2XK5A 4GU2A 3KW5B 2MBBB 4FJVB 2HE7A 1WIAA 2ZEQA 4HVBA 1E8ZA 4TQ0A 3S2AA 4GB9A 5DPWA 1V6EA 3W1SA 4J6IA 1NDDA 2O2VB 2B3AA 2NR2A 1GNUA 1OEYA 2DENB 2DZIA 2O6VD 2XEWA 2ZNVB 4LJPB 1KLVA 5C23A 2IO3B 1V80A 1JRUA 2KLCA 4W9FA 4WWOA 2N7DA 4ANVA 5J18A 4MDKE 5CHFA 4JIOU 1ISNA 1R4MI 4GDKA 2IO0B 2JVCA 4MGYE 2BWFA 3O65B 3H7SA 3QAQA 2OOBB 2CR5A 3RCZA 1GUAB 3B08A 5BO4B 2LGDA 3L54A 2K8BA 3JSVA 3JYUA 3PRMB 5D2MB 3RYTA 3SHQA 2KMCA 2A4ZA 3HK0A 5LXIB 3QK0A 3H7PB 4KV2A 3ZNHB 4BBNC 4FBJB 2AL6A 1GC7A 3LJ3A 5LXHA 3PPAA 5DPSA 2R2QA 2KTRA 4YL8A 4NQLB 5G55A 2FAZA 3U8ZA 2KJRA 2IO1B 2KFKB 2MRPA 1VD2A 3K9PB 3PZDA 4KZCA 2NPTB 2Z0DB 4G3XB 5E6NA 1E8XA 3L17A 1E7VA 5AZGA 1GC6A 1EO6A 3RZWC 1TGZB 4WJQA 3L16A 5HKHA 2K6QA 2KQSA 4PYUA 2JF5A 1UELA 4CHKA 4GXBA 3V6EB 1WX7A 2M4NA 3R3MA 3DBRI 4K81A 2JRHA 2G3QB 1LFDA 1V86A 2IYDB 3KUCB 1OEYJ 2PEAA 2PPHA 3DVNU 4GSWA 4WJNA 1C1YB 4ANXA 4BKSD 4IM2A 2JWZA 4B9KA 4GDLA 4EUTA 4W9HA 2NBVB 3L13A 4FLHA 3ZW3A 2C9WB 1IPGA 2CHWA 2ZVOA 3VTVA 2UYZB 4HK2A 4WJOA 1YX5B 2L00B 1RLFA 3EECA 1P0RA 1WXAA 3WAOA 2GBRA 4DHZB 2WX1A 2JT4B 2MX2A 3ZTCA 4ZYNA 3H1UA 3OLMD 3N3KB 3WAPA 4MM3A 1V9JA 2RPQA 3DVGX 4CYEA 2KQ7A 4MH0E 2GBNA 5IA7A 4NJ6A 2KLGA 3DBLI 4E71A 2KC2A 1RAXA 5AEKB 3U7DA 3SDLC 3QARA 4EKUA 4TV3A 5D6JB 4XX5A 2M8SA 3OJ3A 1E5WA 2WX0A 1L2NA 2K1FA 3APFA 2G4DB 2HTHA 4RMAA 1M94A 4W9LA 4RM8A 1P98A 3ALBA 1Z2MA 4NQKE 1YJ1A 4F1SA 1WE6A 2M0XA 3T8MA 2XK5B 3EHVA 3TL5A 3WA0A 2DZJA 1EF5A 2WDTB 1WJ4A 4DBGA 4I6LB 3ZIMA 2J0MA 4W9GA 1I35A 4MGZE 1WGYA 2YLMA 3DCGA 1WXSA 2RR9A 2KTRB 4W9IA 1P3QU 3A9JA 4A20A 3DDCB 3OJ4B 4GGQA 3VVWB 1OQYA 2FCSA 3PRZA 1Q1OA 1SIFA 1WXMA 2NCNA 1YIWA 4M8NA 4HCPB 2WYQA 4W9KA 1AARA 4NAWB 3AU4A 3VAWA 1YX6B 2MW5A 1Q0WB 3KH0A 4K1RB 1F9JA 3NS8A 4MEMA 4NJ7A 4TQ1A
chains in the Genus database with same CATH superfamily
3CIRB 2KDBA 3I63C 1MJDA 2MBHA 1UNSA 1WMHA 2NMQA 3IHPC 4KDIC 2CHZA 1HE8A 2W54A 4WQOB 1V5OA 3L08A 2IDYA 2DAFA 4LDTB 1WR6E 1FMAD 1C3TA 4A3OA 4OZAA 2N9LA 2AL3A 3A1QB 4KKIA 2BKRB 3NVZA 2EMSA 2L8JA 1V1PA 4A6QA 2D3BA 1UGMA 3I9V1 2UWQA 2JPHA 4BFRA 4B95A 4IWQA 4G0NB 2H88B 3AI5A 3VRAB 2WXMA 1KOTA 3WIMA 2LWPA 3FKYA 1UBIA 2MA9B 3DBHI 4LCDE 4EZKA 2DBYA 4ICVA 1QKZA 3IFWB 3M62B 2KVRA 5C1ZA 3ABVB 3ZLZA 3ML8A 1YQBA 2D3GA 3ZXVA 2GI9A 4EZJA 2DAJA 1D3ZA 4XGAB 3DWGC 3PS6A 3UQBA 5EE3A 5I4DA 1Q10A 2AQ1B 2KK8A 2CU1A 2R2OA 4M0WB 5GMVA 1MVKA 2BYFA 2WXFA 1MFWA 2WXLA 3UIPB 1WSPA 2N9XA 3RNGC 3ZRFA 1L4DB 4BAXA 1ET6A 4HDOA 4JWUC 5AZHA 3VHTC 2WU5B 2GRIA 4P7IA 4C56C 2N1VA 2WU2B 5J17A 1L2NA 1XT9B 4OZBA 4TKNA 3L10B 4XYCA 2BS2B 2KOXA 3BINA 3V62A 2I2YA 1QZEA 1FNUA 2LJ5A 4WURA 1R4MB 3RN9C 2RDBC 3U30A 2WLBA 4MSQB 3ECIA 2M1MA 5JXVA 1JRPA 2SAKA 2KXJA 1VDVA 1MI0A 1AN8A 4W9JA 3RFZB 2LHEA 4K3CA 5HG2A 1QQRA 2C7HA 3RD2A 2IBIB 2RD0A 1HTOA 1F0ZA 2HJ8A 3I3TB 4IC7B 3AE8B 4GIVA 2INPE 5BMGA 1E0ZA 4JL9A 1YN3A 4LNNA 2WGSA 2DWQA 1V5TA 1SE9A 2G1EA 1WR1A 3PO0A 3RZFA 4AOFA 4EE2A 3A1QA 5FR3A 3AE4B 4AP4C 2V0GA 1WRIA 4ZRQA 4C4VA 2INDC 1IGCA 2LXCA 5LNK1 1EUVB 3TBLD 1CZPA 4MJSA 3APCA 4RM9A 3AE6B 4II2B 2KNBA 1SJED 3AN1A 2JWUA 4B0MA 3Q3JA 1C79A 5E6JA 2IO2B 1E9MA 4W9EA 3UQAA 1ZOYB 3UI3A 2KYWA 4OZCA 3EFCA 1PGBA 4XE0A 3VXWA 2M17A 3LXFA 3GE3C 3LDZE 4DHJB 5D3IB 3HVZA 1GOZA 3Q2AC 2J0KA 5DPTA 4ZRIA 2K25A 3L0WB 3RUIB 2PE9A 3AEAB 4MJSB 3ZNZB 3Q8FA 2VRRB 4XDCA 1C9FA 4K3BA 2QMTA 3ZVVA 2E3TA 2RMMA 3RMKC 1MG8A 4CQNA 3FILA 2WXPA 3P4RB 5IP4D 2EKEC 2GB1A 1ENFA 5FR6A 2BYVE 2LI5A 2N9PC 2LRUA 2KDEB 2QCZA 4ITKA 1UZXB 4K7SA 2WXKA 3BIID 1FCCC 2MEKA 1C77A 3BYYB 2NPTA 1R4NI 3HIZA 3QJZA 2JSVX 1UWXA 4BVUC 4L2YA 3QWZB 1ZKHA 4YWGG 4JLCA 5G5GA 1AWDA 1WXVA 3R66C 3IG3A 1XLNA 3SD5A 1L0YB 3RULA 3TEWA 3AMZA 1FFVA 4FA6A 3MTNB 1E90A 3HM6X 4EZLA 3WCQA 3MC0B 3AU5A 4BKGA 3JVZX 2A5UA 1I42A 2JYEA 4L1BA 4W9DA 4EEWA 3BYTB 3TMPB 1TZ1A 3B9JA 2AQ2B 4I6NB 2MP2B 2BPSA 3AEFB 2RDGA 3KW5B 2XN9C 1WIAA 1DOYA 3W5VB 1B1ZA 4GB9A 3S2AA 4TQ0A 3W1SA 2J53A 2O2VB 2BB5A 2NR2A 2ZNVB 2XEWA 2DENB 1I4GA 4WIPA 3N20C 3RNCC 1JRUA 5J18A 5CHFA 1N60A 1QLBB 1ET9A 2IO0B 2ZW0A 2CR5A 3RCZA 2PW9A 3PRMB 5D2MB 3URYA 2KMCA 5LXIB 3BWUD 3QK0A 3ZNHB 5LXHA 1UF0A 1KTKA 2FAZA 2KJRA 3KQ4A 2IO1B 3PZDA 4KZCA 1M4VA 2Z0DB 4LNFA 1VZ8A 3L17A 3RNEC 4TMAB 1GC6A 2L32A 1F2RC 4M01A 3Q8EA 3R3MA 4HROA 4DXFA 1FCLA 1V86A 1OEYJ 2BTEA 4BKSD 2R61A 2JWZA 3ZW3A 2CHWA 4HK2A 4WJOA 1YX5B 2BS4B 4KGTA 4DHZB 5IN7A 3T3OA 3N3KB 3IT6B 4M0WA 3DVGX 3DBLI 5C2TB 5EE9A 1RAXA 3P4QB 3IAS1 2BB6A 2G4DB 2HTHA 3R8BA 2J52A 1TYGB 4NQKE 1WE6A 2M0XA 1YJJA 1RM6C 2W3SA 4DBGA 4I6LB 3ZIMA 1EU4A 4W9GA 1I35A 4MGZE 2Q5WD 1VZ7A 2YLMA 1WXSA 1FXIA 2RR9A 4M00A 1P3QU 3DDCB 4ZYSA 1Q1OA 4NAWB 3AU4A 3VAWA 3Q8AA 3KH0A 4ZHPA 1F9JA 4N59A 4XWWA 1NYRA 2Y5CA 3NS8A 3AB5A 2D10A 2KJHB 4ZRJA 2FBWB 3B0AA 3SEBA 2CJNA 4DQOC 2JXXA 4YT0B 5BYSA 3U2SC 3VTUA 1V2YA 1L6UA 3QCAA 4BBNF 3LYYA 2C60A 2KANA 1WJUA 2ZZPB 1PYWD 1FNVA 3UIOB 4KSKC 1NBFC 1TT5B 2CJOA 4ARIA 2L76A 2WNMA 2QC8A 4DK5A 3TUOA 2M0AA 3Q8CA 3DBSA 2WXRA 3GZNI 3B1LX 4RGOS 5JZEB 1XO3A 2LHDA 5JHBA 2Y5PA 4AS1A 1RFAA 1YOVB 2FIFA 2KT7A 4FHKA 1H4RA 5L83A 1E7PB 3W2DA 2GMIC 4HEA1 5D94A 1RRBA 2BYEA 2PTLA 4BKSA 2D11A 1F77A 4LNIA 4GMVA 1TS2A 3QHTA 1FRRA 2LGYA 2ZPNA 2KKCA 3B2FA 4GDKB 4US9A 4ANWA 4RNAA 4DWFA 3Q6BA 2WP9B 2W55A 3QC8B 4HKZE 1NYQA 4ZHOA 1WZ0A 4NPNA 2G4SA 3FILB 4FJYA 4K7UA 2ZPYA 1D4BA 1IBXA 3CMMB 2LRWA 4C7YA 3TSSA 2QIEB 4OVVA 3PTFC 2D2QA 4G11A 2OJWA 1JWAD 4JQWC 3T9LA 4B6WA 2KN5A 3GZNB 1QT9A 5KHOA 2NVUI 4MACA 2JRIB 3QA8A 4NAMA 4ZDVA 4P1CC 4JGHB 3N1YC 1BUIC 1ZDXA 4ARCA 1WH3A 3DBRB 5FKAC 1TS4A 5HHDG 2KTFA 2BF8B 4OHJA 2CS4A 2FE8A 5IO9A 1GPXA 1FFUA 1YQ3B 1ROEA 5LLIA 2RGFA 4I6PA 2FIDA 4EFOA 2C7NB 1WYGA 1TS3A 2ZVNA 1L5PA 3ZGZA 1QF6A 2I1JA 4N9F4 2QJLA 3ZJUA 2I1KA 4A55A 1FXAA 2L05A 3PGEA 2WS3B 4HWIB 1B9RA 1WX8A 1J19A 4IG7B 1NI2A 5TR5A 3IXSA 3VUWA 2MHJA 2NS5A 2FCNA 2HJ1A 2CKHB 4BOSC 2FNJB 2KDIA 1A5RA 2O6VA 3Q3OC 3WAMA 1HQRD 1WX9A 3ENEA 1P7FA 4RF1A 5H92C 2N4FA 4P1BC 1L0XB 3H8HA 2LVPA 2JY6A 3VR8B 1XLQA 3MHZA 3VUYA 3O13A 4RGNA 2N7JA 1TKEA 2LJIA 5HI1A 1EWYC 2GBJA 2KDFB 4WWPA 3BVZA 4RGMA 2MLBA 5E6PA 4RCOA 1HZ6A 1I4QA 2LVQA 4HPPA 2J7QB 4LJOB 1LO5D 1ZGUB 2FCMA 3ZKJC 3P4SB 3PRPB 1S1QB 4KSLC 1UWMA 1JQ4A 5BMIA 2PLPA 5BMHA 2WWZA 3RNBC 3AE7B 1JMLA 2VH1A 2MSED 2MJDA 4DDGD 4KIKB 3ETRA 2J0JA 3DOWA 1GG3A 4LK0M 2KWUB 4B0EA 3A9KA 3UF8A 1VJKA 1Q5WB 1J7AA 1PQSA 2VZKB 3I5JC 4F7ZA 2OJRA 1XF5L 1OFFA 3CSFA 1WM3A 3BY4B 1XLPA 3KVFB 1RWSA 1BXTA 2M56B 1TY2A 2PJHA 2KDMA 1LM8B 3AE3B 1TS5A 3ZUNA 1FIQA 4MELA 1J7CA 3N1XC 3NOBA 2WDQB 1K50A 3AE9B 3DHGC 2KHWB 2PKOA 3C0RB 1F52A 2AX5A 1XCQL 4AWJA 4GU2A 2DNFA 4HVBA 4N58A 1DOXA 2K0PA 1NDDA 1YMHE 4KKJA 4N6EB 1GNUA 1TZOA 2IO3B 2N7DA 2LGIA 1NVID 1HTQA 4JIOU 3BK2A 1EWCA 1ISNA 2JVCA 4MGYE 2IGGA 2BWFA 3QAQA 1V8CA 2LGDA 4XWTA 4C00A 4KV2A 3H7PB 4BBNC 2KTRA 4USAA 4YL8A 3KWVA 3U8ZA 2OHFA 2MRPA 2KFKB 4G3XB 1TJEA 2MH7A 1E7VA 1DGJA 2D5GA 3RZWC 3P63A 3L16A 1NI3A 2M4NA 2JRHA 4WAFA 2G3QB 4GSWA 3C19A 1C1YB 1QOGA 1V97A 4IM2A 2H89B 4B9KA 5D3DA 4W9HA 3L13A 2UU7A 4FLHA 4YSYB 3VTVA 1V1OA 1WXAA 2GBRA 1HZ5A 3WAPA 4MM3A 1QOBA 4CYEA 4MH0E 2GBNA 5AEKB 2W3RA 3T3NA 4TV3A 4XX5A 1AYFA 2WX0A 2K1FA 2IJ0A 1JWUD 4LTUA 1M94A 4RM8A 4C7ZA 1Z2MA 1C4PA 3AE1B 2XK5B 4RFBA 5EE1A 1EF5A 2YEPF 2W82A 1N61A 1WGYA 1EU3A 1LGRA 4YSZB 3OJ4B 3VVWB 1OQYA 3AV8A 3KLSX 4JWSC 4MH8A 3AH7A 1YIWA 1XXGA 2WYQA 1SBBB 1HXYD 2BW2A 1AARA 1TY0A 1YX6B 2MW5A 4K1RB 4NJ7A 1JWMD 2HDEA 4IWPA 1OGWA 2DZMA 2Y5BB 1XQQA 2PVOD 4HJGE 1T0YA 3HVDA 3SFEB 3A4RA 4LNKA 2K22A 3ONSA 5CHWA 1SXTA 2RSUA 5JH5C 2JYTA 4HPLB 3L4PA 1K8RB 5BYQA 4PS3A 3IVFA 2XNAC 1IYFA 2KO3A 3CSTA 1Z5SB 1WWTA 1DYQA 2DYOA 1GB4A 4GDLB 4WH4A 3JW0X 1UH6A 4E3CA 3DPDA 4URKA 3DWMA 3V6CB 3KUDB 1SF0A 2NTTA 2KVZA 4NNJB 1KLUD 1BT0A 2LUMA 1TIFA 1YNTE 1SJHD 4K7WA 3VDZA 2ZW1A 4PS7A 4IW0A 1FO4A 2G45B 2B76B 2JZPA 3BK1A 1GJZA 4JPSA 3SFDB 4ICUA 1V81A 1CMXB 2QDFA 2PIAA 2KMAA 4H2AA 4BKTA 4YTMB 5CHVC 2KQ4X 1ZUD2 1RFKA 4ANUA 2LGSA 4XC2A 3ZYYX 2BT6A 1WE7A 2J42A 3DBHB 1E7UA 3V61A 2WQYB 4HLEA 4AJWA 2AWTA 4GN1A 4FXCA 1WGGA 3PV1A 2N0SB 3M95A 1MPEA 3ZO5B 5AZFA 4KGRA 2MCNB 4AUQC 2KWCA 2BYTA 1H8CA 2I38A 1UBQA 3BVMA 4HPMB 1N5WA 2QSDA 1SSNA 2G9HD 4DDID 3OAWA 2AYOB 1I4HA 4EOYA 2K8HA 1WGKA 4J3OD 3ZNGC 2JZ3B 3EFUA 1D5XC 3PLUA 4OVUA 3TEYA 1ZXIA 3AM9A 1KM7A 1P1AA 3P1MA 1QOAA 1WJ6A 3ZXRA 1U4AA 1QOFA 3IAM1 2WXHA 3LB8C 2HTME 1XLOA 2FCQA 3IT4B 2NTSA 3W1SC 3A4SC 3PZ7A 4HXDA 3V05A 1KJTA 1VLBA 3IBEA 2INCC 1R4NB 1PUTA 2KJ6A 4TSSA 4WJPA 3W5UB 1OQQA 2WHIA 1I4PA 4IOIE 5CX3A 5HFYA 1J8CA 1TTNA 3APDA 1FEHA 2QILA 3DVNV 2ASQA 3U4EG 2Z0EB 4TUUA 1EF1A 2PE6B 1WMHB 3ZRCA 2WXOA 3AEGB 3TJPA 2KAJA 2L0FA 4RGTA 3N32A 4A3PA 3ML9A 3HHMA 1FNWA 3Q8BA 4ASWC 2N9EB 3NG0A 1D6EC 4BOZB 2C5LC 1OQRA 5EE0A 4OVZA 5E6OA 3U7ZA 2D07B 3PHWB 2GOWA 2ZCCA 3PZ8A 5TSSA 2IZVB 2VZKD 3UINB 1JW9D 3PHXB 2LVOA 1ZDVA 2X38A 4FHJA 4S0RA 2IPKD 2X8XX 3QIJA 2ZCBA 1JALA 3VR9B 2L0TA 3HRDD 4NZLB 4PT5A 2BBCA 3RT3B 3NUHB 1WJNA 3X0WA 2DHZA 5DCNA 2DLBA 1TBEA 5KHQA 2MWSB 4HCNB 4HJKA 1D5ZC 5IKCM 1J7BA 5JHAA 4RH6A 3VUXA 1DOIA 4S17A 2ICIA 3W1YA 3R2TA 3ZQ4A 2REXA 1WF9A 4DXGA 3PT2B 2PVGC 4IM0A 5CTRC 1ZPSA 4NY0A 2M19A 4YSXB 3NVYA 2K3UA 4PS8A 3TEZA 3NZSA 4DXAB 4GOCA 3JSVB 2KD0A 3U52E 4CO7A 2L52A 2ZNVC 2KFJA 3ZJVA 1XCTL 2LMCA 4IUMB 2ONQA 2KFKA 2YVCA 2WDVB 2ON8A 3ZDTA 4KX6B 1V49A 3J9CA 3MHSD 2W9NA 3ZNID 4KDLB 1YD8U 4G50A 5H8YE 2XK5A 4FJVB 2HE7A 2ZEQA 4AQ7A 1E8ZA 2YEPB 5DPWA 1V6EA 3R2IA 4J6IA 3RNFC 2B3AA 2JU6X 2O6VD 1PGAA 4KGSA 5C23A 2KLCA 4W9FA 3AE5B 4WWOA 4ZOHC 4MDKE 5G5HA 1TKYA 1R4MI 3O65B 5AUIA 1I4XA 1FPYA 3RYTA 3HK0A 3LJ3A 1GC7A 4LLGM 4NQLB 5G55A 5MPOA 1ZE3D 1L4ZB 1VD2A 2AQ3B 1JWSD 1T0QC 4O1NA 1EO6A 4YTPB 3CWIA 4WJQA 2FUG1 2K6QA 4PYUA 1UELA 4GXBA 1WX7A 2Y3AA 1YJIA 3DBRI 2IYDB 3KUCB 2PEAA 3DVNU 5FK9C 1IBXB 4GDLA 2JX5A 4EUTA 2NBVB 3P4PB 3EA6A 1I4RA 2C9WB 1SB3C 1T5XD 1K52A 2L00B 1RLFA 2WDRB 1P0RA 3WAOA 2JT4B 2MX2A 4ZYNA 3H1UA 1V9JA 1T0SC 4NJ6A 2KLGA 1K53A 3U7DA 3QARA 2TSSA 4EKUA 4A9AA 1JROA 1E5WA 1PDXA 1K51A 2WXNA 2L83A 1P98A 2WXJA 1FRDA 1P7EA 3NVWA 3EHVA 3WA0A 2DZJA 1WJ4A 3GE8C 3MC8A 2QEJC 3EUB2 3NS1A 1I7HA 4W9IA 3RNAC 3A9JA 4A20A 4GGQA 2V9HA 3PRZA 1R7SA 1SIFA 1WXMA 1ZXHA 4HCPB 5IOIA 3SR6A 5AUKA 4W9KA 1N62A 3FAHA 4TQ1A 4IKGA 3PREA 2D3CA 1CK1A 1T0RC 4KVGB 2IY1B 2AEHA 1E8YA 1WGRA 1VZ6A 5D7GA 3VH4B 4HRSA 4YXDB 3DVGY 1WZ3A 3OG5A 4WQMA 2MQJA 4JX1C 1N63A 2JZZA 2XBBC 2Z59B 3H9DA 3H6NA 1MHXA 4FN2A 1MG4A 3N30A 1ESFA 2MBQA 2K6DB 2JUOA 4KIKA 1N5XA 2N9KA 2K39A 1NEKB 2EKIA 3NJTA 4REZA 1IP9A 1UD7A 2BKFA 4R3DA 2MP2A 1YN4A 5GXGB 1KH0A 2LGXA 2D3AA 1KFYB 3AEEB 2E6XA 1SE2A 3AEBB 4XDDA 3N1ZC 4HDQA 3EC8A 3VFKA 2WXIA 2C7MB 1SEBD 1L6VA 4IM3A 5L95C 1WY8A 4HKQA 3QX1A 1F1HA 1XEEA 1C78A 1XD3B 3KYCD 3W9CB 2LD9A 2L3ZA 1OTRB 1SE4A 1V1PB 2MBEA 3P2BA 1HA5A 3AULA 3R7QA 3KWLA 4E74A 3EGRA 3M3JA 3MJWA 2IGDA 2N7EA 3MC9A 2V1YA 3VQIA 2DYMA 2LXAA 1N6ZA 5EDSA 3ZTDA 2LZ6A 3E9SA 3K9OB 2IY0B 4NAWA 1CJEA 3B2GA 3QQ8B 2FUHB 1FD6A 3N9YC 2DX5B 2OEDA 3NVVA 1UUPA 3AE2B 4UDUC 4MGIE 2V4LA 4ACFA 2QHOA 2KX3A 3D32A 3I57A 1AW7A 4X57B 1X1MA 2NBUA 1JCKB 1WFYA 1LQBA 3Q14C 5DPRA 2BWES 2MBOA 3R7RA 1SGHA 4MSMB 4P16A 2SEBD 3GS2A 3AXCA 2NBWB 4QAYA 3VTWA 5C3JB 2KX0A 2WXGA 3P42A 3VH3B 3DQVA 2RPVA 2MJ3A 1A70A 1MHHE 3V60A 3WALA 1ZW7A 3WANA 4LDTD 2BQQA 4L23A 5IAAC 2KWDA 4D2KA 1J0GA 2RDHA 4IWOA 3DBLB 1T3QA 4M8MA 1WGDA 1VR9A 1T6BX 2JXTA 3NZUA 2LEKA 2IGHA 3ZJTA 1G6JA 2KZRA 2CHXA 1E6EB 2KN4A 3GOEA 1KRHA 2J4XA 4C4VB 3PVLA 2GBKA 1Y8RC 2MJEA 3A33B 2WXQA 1S3SG 2V3PA 2KACA 3DHHC 2L7RA 3TIXA 3TCAA 1E10A 1CQVA 4A8XC 2L1AA 2EMTA 3Q3FA 4NJCA 1GB1A 3RPFC 1L0VB 5J2RA 4KZ0A 2DYBA 1F2RI 2BS3B 3H7PA 1TKGA 1ACCA 2K5PA 4AJYB 3A9JB 2O6VB 3PLVA 3C8YA 2O2VA 1ZP0B 1L7YA 4W9CA 4WWNA 1LXDA 1JWBD 2BGFA 4FADA 3TEXA 3NHEB 4F8CB 3Q69A 3ZDMC 3BZDB 2EELA 3UGBB 5G2NA 2GLSA 4JE3B 3X23A 4FULA 1E8WA 2HD5B 1WGHA 4WAAA 3SU8X 4RF0A 3OWEB 4XZ4A 4GLSC 1YN5A 3M63B 2GBMA 4FJZA 4Q2JA 4BZAA 4MGKE 3DHIC 3GP7A 1WM2A 3MP9A 3PSEB 4ZRKA 1YQ4B 2JQRB 4IDIA 2LASA 4DHJD 1WI0A 3MJ5A 2KWVB 2LUEA 2INNE 4PYZA 3Q3NC 1GAQB 3AECB 1WRDB 4US8A 2N1WA 4M02A 1VCBA 1P9DU 2ACZB 3HM3A 4A90A 1WYWB 2ZJDA 3A9KB 3NY5A 3KYDD 2K8CA 4II3B 4DHZE 1D5MC 5T8IA 2KC1A 2V3SA 2CU3A 1SE3A 2DZKA 1FXTB 3CF6E 3KUZA 1PFDA 4ZRPA 3RI7C 1RYJA 2MBBB 4OW0A 1WXQA 3BVGA 4PK1A 1KLVA 1OEYA 4LJPB 2DZIA 3HUIA 1V80A 4ANVA 1IGDA 3AEDB 4GDKA 2BVCA 1HEZE 3H7SA 1QILA 2OOBB 2LFIA 1GUAB 3B08A 5BO4B 3MFGA 3L54A 2K8BA 3JSVA 3JYUA 3SHQA 2A4ZA 1BMLC 4FBJB 1KLGD 2AL6A 3PPAA 5DPSA 2R2QA 1STEA 3E56A 4MT5A 3K9PB 2NPTB 5E6NA 1E8XA 2K9XA 5AZGA 2PMVA 1TGZB 5HKHA 2KQSA 2JF5A 4CHKA 3V6EB 4P6VF 1FM0D 2VH2A 4K81A 1LFDA 2PPHA 3GB1A 4WJNA 4ANXA 1IPGA 2ZVOA 2UYZB 3V3XA 3EECA 2WX1A 3ZTCA 1NENB 3OLMD 2RPQA 1EM7A 2KQ7A 5IA7A 4E71A 2V4IB 2KC2A 3SDLC 1UGJA 1KF6B 4MM3B 5D6JB 2M8SA 3OJ3A 3APFA 4YTNB 4RMAA 4W9LA 1VRAB 1SIJA 3FC4A 3ALBA 1YJ1A 4C80A 3NZ3A 4F1SA 3T8MA 3TL5A 2WDTB 1C4AA 3VRBB 3Q3MC 2J0MA 3DCGA 5BYRA 2KTRB 1C76A 2FCSA 1C4CA 4WWMA 2NCNA 3NRZA 4M8NA 1PGXA 2V3NA 1IUEA 1Q0WB 2KMMA 4MEMA 1Y56A 2Z8LA 4LNOA
chains in the Genus database with same CATH topology
2D10A 3PREA 4IWPA 1OGWA 2KJHB 4ZRJA 2KDBA 4KVGB 2DZMA 2IY1B 2AEHA 2Y5BB 1E8YA 3B0AA 1WGRA 1XQQA 2MBHA 5D7GA 3VH4B 1T0YA 1WMHA 3DVGY 3IHPC 4KDIC 2JXXA 1WZ3A 2CHZA 1HE8A 4WQOB 1V5OA 3A4RA 3L08A 2DAFA 2MQJA 3ONSA 5CHWA 2JZZA 2XBBC 4LDTB 1WR6E 2Z59B 3H9DA 1C3TA 2RSUA 4A3OA 4HPLB 5JH5C 3H6NA 3VTUA 4FN2A 1K8RB 3N30A 2AL3A 3A1QB 1V2YA 2MBQA 3QCAA 4BBNF 2K6DB 2BKRB 4PS3A 2C60A 2JUOA 4KIKA 3IVFA 2KANA 1WJUA 2ZZPB 2EMSA 2L8JA 2KO3A 3CSTA 1IYFA 1Z5SB 2K39A 1UGMA 2UWQA 3UIOB 1UD7A 1IP9A 2JPHA 2DYOA 4KSKC 2BKFA 2MP2A 4GDLB 4B95A 4BFRA 1NBFC 4IWQA 4G0NB 2L76A 3AI5A 3JW0X 2LGXA 4DK5A 1UH6A 1KOTA 4E3CA 3DPDA 3WIMA 2LWPA 1UBIA 4URKA 2MA9B 3V6CB 3DBSA 3DBHI 3GZNI 3B1LX 4LCDE 4EZKA 3KUDB 5JZEB 4ICVA 4NNJB 1BT0A 3IFWB 3M62B 2KVRA 4HDQA 5JHBA 3EC8A 1RFAA 3VFKA 5C1ZA 4K7WA 3ZLZA 2C7MB 2FIFA 3ML8A 4PS7A 3VDZA 4IW0A 4FHKA 1H4RA 5L83A 1YQBA 5L95C 4IM3A 1WY8A 2D3GA 3QX1A 2G45B 2GMIC 1XD3B 3KYCD 4EZJA 5D94A 2DAJA 1RRBA 2BYEA 1D3ZA 2LD9A 3PS6A 3UQBA 2L3ZA 1GJZA 4BKSA 4ICUA 1OTRB 1V81A 1CMXB 2KMAA 4BKTA 2D11A 2KK8A 4GMVA 2CU1A 3QHTA 2R2OA 4M0WB 5CHVC 5GMVA 2LGYA 2MBEA 4ANUA 3P2BA 2ZPNA 2KKCA 2BYFA 4XC2A 3AULA 3R7QA 4E74A 1WE7A 4GDKB 3UIPB 3M3JA 3MJWA 1E7UA 2N9XA 2N7EA 3V61A 3ZRFA 4HLEA 4AJWA 2AWTA 4ANWA 2V1YA 4DWFA 3VQIA 4HDOA 2DYMA 2LXAA 4GN1A 5AZHA 5EDSA 3ZTDA 2LZ6A 1WGGA 3K9OB 2IY0B 3QC8B 4NAWA 3PV1A 3VHTC 1WZ0A 4NPNA 2G4SA 3QQ8B 2FUHB 3M95A 4P7IA 4FJYA 4K7UA 2ZPYA 3ZO5B 5AZFA 2DX5B 3CMMB 2N1VA 2LRWA 4OVVA 5J17A 1XT9B 2MCNB 3PTFC 4MGIE 2KWCA 4TKNA 2V4LA 3L10B 4AUQC 2KOXA 3BINA 1H8CA 2QHOA 1UBQA 2D2QA 4HPMB 2KX3A 3D32A 4G11A 3V62A 3T9LA 4JQWC 1QZEA 4X57B 4B6WA 1X1MA 2KN5A 2LJ5A 2NBUA 1WFYA 1LQBA 5KHOA 2NVUI 5DPRA 4DDID 2BWES 2MBOA 3OAWA 3R7RA 2AYOB 2JRIB 3U30A 4MSQB 3QA8A 1SGHA 3ECIA 4MSMB 4EOYA 4ZDVA 4JGHB 2K8HA 2M1MA 3ZNGC 2JZ3B 1WH3A 3EFUA 3AXCA 3PLUA 4OVUA 2KTFA 2KXJA 2NBWB 3VTWA 2BF8B 2KX0A 4W9JA 2CS4A 1KM7A 1P1AA 3VH3B 1WJ6A 2C7HA 3RD2A 1U4AA 2IBIB 3DQVA 2RD0A 3V60A 3WALA 5LLIA 1ZW7A 2RGFA 3WANA 4LDTD 4I6PA 2HJ8A 2FIDA 3I3TB 4EFOA 2C7NB 4IC7B 2FCQA 5IAAC 3W1SC 4GIVA 3A4SC 1J0GA 4HXDA 1KJTA 4JL9A 2ZVNA 4IWOA 1V5TA 3NZUA 1SE9A 1WGDA 3IBEA 4M8MA 1G6JA 1WR1A 2KJ6A 2I1JA 4N9F4 2KZRA 4WJPA 3RZFA 4AOFA 2CHXA 2I1KA 2L05A 3A1QA 3GOEA 4AP4C 5CX3A 1J8CA 3PGEA 4HWIB 2LXCA 1WX8A 2GBKA 1Y8RC 3PVLA 1J19A 3A33B 1TTNA 1NI2A 3APDA 4IG7B 1EUVB 5TR5A 3DVNV 3TBLD 4MJSA 3VUWA 2NS5A 3APCA 2FCNA 4RM9A 2CKHB 2ASQA 4BOSC 2FNJB 2KDIA 1A5RA 1S3SG 2O6VA 2Z0EB 4TUUA 1EF1A 2L7RA 2PE6B 4II2B 2KNBA 1WMHB 3WAMA 3ZRCA 3TIXA 3TCAA 1WX9A 3ENEA 2EMTA 3Q3FA 3TJPA 2L0FA 3Q3JA 3N32A 4A3PA 2N4FA 5J2RA 2IO2B 3ML9A 4W9EA 3UQAA 3HHMA 4KZ0A 4ASWC 2DYBA 2N9EB 2LVPA 4BOZB 2C5LC 2JY6A 5E6OA 3VXWA 2D07B 2M17A 3VUYA 3PHWB 3H7PA 3LDZE 2GOWA 4DHJB 2ZCCA 2IZVB 2J0KA 5DPTA 4ZRIA 4AJYB 2K25A 2O6VB 3A9JB 3PLVA 3UINB 3PHXB 2LVOA 3L0WB 3RUIB 2GBJA 2KDFB 2PE9A 4WWPA 2O2VA 2MLBA 4MJSB 5E6PA 4FHJA 1L7YA 3ZNZB 4W9CA 4WWNA 3QIJA 2LVQA 2VRRB 2ZCBA 2J7QB 1LXDA 2BGFA 4FADA 2L0TA 4LJOB 1ZGUB 2FCMA 3NHEB 3ZKJC 4F8CB 3RT3B 3ZDMC 3PRPB 1S1QB 4KSLC 3UGBB 3ZVVA 5G2NA 1WJNA 3X23A 2WWZA 4FULA 1E8WA 2HD5B 1MG8A 1WGHA 4WAAA 3SU8X 3X0WA 2DHZA 5DCNA 4XZ4A 1TBEA 2MSED 5KHQA 3M63B 2MWSB 4HCNB 4HJKA 2EKEC 4DDGD 4KIKB 2GBMA 4FJZA 2J0JA 5JHAA 3VUXA 5FR6A 3DOWA 2BYVE 1GG3A 2LI5A 4MGKE 3W1YA 2N9PC 2LRUA 2KDEB 2KWUB 2REXA 1UZXB 4K7SA 3A9KA 3UF8A 1WM2A 1WF9A 1Q5WB 3PT2B 1PQSA 2NPTA 4IM0A 1R4NI 3PSEB 5CTRC 4NY0A 4ZRKA 3HIZA 4F7ZA 2OJRA 3QJZA 2LASA 4DHJD 1WI0A 3CSFA 4BVUC 1WM3A 2KWVB 3BY4B 2LUEA 3QWZB 3KVFB 4PS8A 1ZKHA 3NZSA 4JLCA 4PYZA 4DXAB 4GOCA 1WXVA 3IG3A 3JSVB 3R66C 2KD0A 1WRDB 2PJHA 3SD5A 1LM8B 4CO7A 2ZNVC 2KFJA 2N1WA 4IUMB 3ZUNA 1VCBA 1P9DU 2KFKA 4MELA 3HM3A 2YVCA 3RULA 4FA6A 3MTNB 1E90A 1WYWB 2ZJDA 3HM6X 3NOBA 3A9KB 4EZLA 3ZDTA 3NY5A 3AU5A 3KYDD 3JVZX 4BKGA 2K8CA 2A5UA 1V49A 4II3B 4DHZE 2KHWB 2KC1A 1I42A 2V3SA 3C0RB 3MHSD 4W9DA 4EEWA 2W9NA 3ZNID 4KDLB 1YD8U 3TMPB 2DZKA 4G50A 1TZ1A 1FXTB 3CF6E 3KUZA 4I6NB 2MP2B 2BPSA 4AWJA 2XK5A 4GU2A 3KW5B 2MBBB 4FJVB 2HE7A 1WIAA 2ZEQA 4HVBA 1E8ZA 4TQ0A 3S2AA 4GB9A 5DPWA 1V6EA 3W1SA 4J6IA 1NDDA 2O2VB 2B3AA 2NR2A 1GNUA 1OEYA 2DENB 2DZIA 2O6VD 2XEWA 2ZNVB 4LJPB 1KLVA 5C23A 2IO3B 1V80A 1JRUA 2KLCA 4W9FA 4WWOA 2N7DA 4ANVA 5J18A 4MDKE 5CHFA 4JIOU 1ISNA 1R4MI 4GDKA 2IO0B 2JVCA 4MGYE 2BWFA 3O65B 3H7SA 3QAQA 2OOBB 2CR5A 3RCZA 1GUAB 3B08A 5BO4B 2LGDA 3L54A 2K8BA 3JSVA 3JYUA 3PRMB 5D2MB 3RYTA 3SHQA 2KMCA 2A4ZA 3HK0A 5LXIB 3QK0A 3H7PB 4KV2A 3ZNHB 4BBNC 4FBJB 2AL6A 1GC7A 3LJ3A 5LXHA 3PPAA 5DPSA 2R2QA 2KTRA 4YL8A 4NQLB 5G55A 2FAZA 3U8ZA 2KJRA 2IO1B 2KFKB 2MRPA 1VD2A 3K9PB 3PZDA 4KZCA 2NPTB 2Z0DB 4G3XB 5E6NA 1E8XA 3L17A 1E7VA 5AZGA 1GC6A 1EO6A 3RZWC 1TGZB 4WJQA 3L16A 5HKHA 2K6QA 2KQSA 4PYUA 2JF5A 1UELA 4CHKA 4GXBA 3V6EB 1WX7A 2M4NA 3R3MA 3DBRI 4K81A 2JRHA 2G3QB 1LFDA 1V86A 2IYDB 3KUCB 1OEYJ 2PEAA 2PPHA 3DVNU 4GSWA 4WJNA 1C1YB 4ANXA 4BKSD 4IM2A 2JWZA 4B9KA 4GDLA 4EUTA 4W9HA 2NBVB 3L13A 4FLHA 3ZW3A 2C9WB 1IPGA 2CHWA 2ZVOA 3VTVA 2UYZB 4HK2A 4WJOA 1YX5B 2L00B 1RLFA 3EECA 1P0RA 1WXAA 3WAOA 2GBRA 4DHZB 2WX1A 2JT4B 2MX2A 3ZTCA 4ZYNA 3H1UA 3OLMD 3N3KB 3WAPA 4MM3A 1V9JA 2RPQA 3DVGX 4CYEA 2KQ7A 4MH0E 2GBNA 5IA7A 4NJ6A 2KLGA 3DBLI 4E71A 2KC2A 1RAXA 5AEKB 3U7DA 3SDLC 3QARA 4EKUA 4TV3A 5D6JB 4XX5A 2M8SA 3OJ3A 1E5WA 2WX0A 1L2NA 2K1FA 3APFA 2G4DB 2HTHA 4RMAA 1M94A 4W9LA 4RM8A 1P98A 3ALBA 1Z2MA 4NQKE 1YJ1A 4F1SA 1WE6A 2M0XA 3T8MA 2XK5B 3EHVA 3TL5A 3WA0A 2DZJA 1EF5A 2WDTB 1WJ4A 4DBGA 4I6LB 3ZIMA 2J0MA 4W9GA 1I35A 4MGZE 1WGYA 2YLMA 3DCGA 1WXSA 2RR9A 2KTRB 4W9IA 1P3QU 3A9JA 4A20A 3DDCB 3OJ4B 4GGQA 3VVWB 1OQYA 2FCSA 3PRZA 1Q1OA 1SIFA 1WXMA 2NCNA 1YIWA 4M8NA 4HCPB 2WYQA 4W9KA 1AARA 4NAWB 3AU4A 3VAWA 1YX6B 2MW5A 1Q0WB 3KH0A 4K1RB 1F9JA 3NS8A 4MEMA 4NJ7A 4TQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D10 A;  3PRE A;  4IWP A;  1OGW A;  2KJH B;  4ZRJ A;  2KDB A;  4KVG B;  2DZM A;  2IY1 B;  2AEH A;  2Y5B B;  1E8Y A;  3B0A A;  1WGR A;  1XQQ A;  2MBH A;  5D7G A;  3VH4 B;  1T0Y A;  1WMH A;  3DVG Y;  3IHP C;  4KDI C;  2JXX A;  1WZ3 A;  2CHZ A;  1HE8 A;  4WQO B;  1V5O A;  3A4R A;  3L08 A;  2DAF A;  2MQJ A;  3ONS A;  5CHW A;  2JZZ A;  2XBB C;  4LDT B;  1WR6 E;  2Z59 B;  3H9D A;  1C3T A;  2RSU A;  4A3O A;  4HPL B;  5JH5 C;  3H6N A;  3VTU A;  4FN2 A;  1K8R B;  3N30 A;  2AL3 A;  3A1Q B;  1V2Y A;  2MBQ A;  3QCA A;  4BBN F;  2K6D B;  2BKR B;  4PS3 A;  2C60 A;  2JUO A;  4KIK A;  3IVF A;  2KAN A;  1WJU A;  2ZZP B;  2EMS A;  2L8J A;  2KO3 A;  3CST A;  1IYF A;  1Z5S B;  2K39 A;  1UGM A;  2UWQ A;  3UIO B;  1UD7 A;  1IP9 A;  2JPH A;  2DYO A;  4KSK C;  2BKF A;  2MP2 A;  4GDL B;  4B95 A;  4BFR A;  1NBF C;  4IWQ A;  4G0N B;  2L76 A;  3AI5 A;  3JW0 X;  2LGX A;  4DK5 A;  1UH6 A;  1KOT A;  4E3C A;  3DPD A;  3WIM A;  2LWP A;  1UBI A;  4URK A;  2MA9 B;  3V6C B;  3DBS A;  3DBH I;  3GZN I;  3B1L X;  4LCD E;  4EZK A;  3KUD B;  5JZE B;  4ICV A;  4NNJ B;  1BT0 A;  3IFW B;  3M62 B;  2KVR A;  4HDQ A;  5JHB A;  3EC8 A;  1RFA A;  3VFK A;  5C1Z A;  4K7W A;  3ZLZ A;  2C7M B;  2FIF A;  3ML8 A;  4PS7 A;  3VDZ A;  4IW0 A;  4FHK A;  1H4R A;  5L83 A;  1YQB A;  5L95 C;  4IM3 A;  1WY8 A;  2D3G A;  3QX1 A;  2G45 B;  2GMI C;  1XD3 B;  3KYC D;  4EZJ A;  5D94 A;  2DAJ A;  1RRB A;  2BYE A;  1D3Z A;  2LD9 A;  3PS6 A;  3UQB A;  2L3Z A;  1GJZ A;  4BKS A;  4ICU A;  1OTR B;  1V81 A;  1CMX B;  2KMA A;  4BKT A;  2D11 A;  2KK8 A;  4GMV A;  2CU1 A;  3QHT A;  2R2O A;  4M0W B;  5CHV C;  5GMV A;  2LGY A;  2MBE A;  4ANU A;  3P2B A;  2ZPN A;  2KKC A;  2BYF A;  4XC2 A;  3AUL A;  3R7Q A;  4E74 A;  1WE7 A;  4GDK B;  3UIP B;  3M3J A;  3MJW A;  1E7U A;  2N9X A;  2N7E A;  3V61 A;  3ZRF A;  4HLE A;  4AJW A;  2AWT A;  4ANW A;  2V1Y A;  4DWF A;  3VQI A;  4HDO A;  2DYM A;  2LXA A;  4GN1 A;  5AZH A;  5EDS A;  3ZTD A;  2LZ6 A;  1WGG A;  3K9O B;  2IY0 B;  3QC8 B;  4NAW A;  3PV1 A;  3VHT C;  1WZ0 A;  4NPN A;  2G4S A;  3QQ8 B;  2FUH B;  3M95 A;  4P7I A;  4FJY A;  4K7U A;  2ZPY A;  3ZO5 B;  5AZF A;  2DX5 B;  3CMM B;  2N1V A;  2LRW A;  4OVV A;  5J17 A;  1XT9 B;  2MCN B;  3PTF C;  4MGI E;  2KWC A;  4TKN A;  2V4L A;  3L10 B;  4AUQ C;  2KOX A;  3BIN A;  1H8C A;  2QHO A;  1UBQ A;  2D2Q A;  4HPM B;  2KX3 A;  3D32 A;  4G11 A;  3V62 A;  3T9L A;  4JQW C;  1QZE A;  4X57 B;  4B6W A;  1X1M A;  2KN5 A;  2LJ5 A;  2NBU A;  1WFY A;  1LQB A;  5KHO A;  2NVU I;  5DPR A;  4DDI D;  2BWE S;  2MBO A;  3OAW A;  3R7R A;  2AYO B;  2JRI B;  3U30 A;  4MSQ B;  3QA8 A;  1SGH A;  3ECI A;  4MSM B;  4EOY A;  4ZDV A;  4JGH B;  2K8H A;  2M1M A;  3ZNG C;  2JZ3 B;  1WH3 A;  3EFU A;  3AXC A;  3PLU A;  4OVU A;  2KTF A;  2KXJ A;  2NBW B;  3VTW A;  2BF8 B;  2KX0 A;  4W9J A;  2CS4 A;  1KM7 A;  1P1A A;  3VH3 B;  1WJ6 A;  2C7H A;  3RD2 A;  1U4A A;  2IBI B;  3DQV A;  2RD0 A;  3V60 A;  3WAL A;  5LLI A;  1ZW7 A;  2RGF A;  3WAN A;  4LDT D;  4I6P A;  2HJ8 A;  2FID A;  3I3T B;  4EFO A;  2C7N B;  4IC7 B;  2FCQ A;  5IAA C;  3W1S C;  4GIV A;  3A4S C;  1J0G A;  4HXD A;  1KJT A;  4JL9 A;  2ZVN A;  4IWO A;  1V5T A;  3NZU A;  1SE9 A;  1WGD A;  3IBE A;  4M8M A;  1G6J A;  1WR1 A;  2KJ6 A;  2I1J A;  4N9F 4;  2KZR A;  4WJP A;  3RZF A;  4AOF A;  2CHX A;  2I1K A;  2L05 A;  3A1Q A;  3GOE A;  4AP4 C;  5CX3 A;  1J8C A;  3PGE A;  4HWI B;  2LXC A;  1WX8 A;  2GBK A;  1Y8R C;  3PVL A;  1J19 A;  3A33 B;  1TTN A;  1NI2 A;  3APD A;  4IG7 B;  1EUV B;  5TR5 A;  3DVN V;  3TBL D;  4MJS A;  3VUW A;  2NS5 A;  3APC A;  2FCN A;  4RM9 A;  2CKH B;  2ASQ A;  4BOS C;  2FNJ B;  2KDI A;  1A5R A;  1S3S G;  2O6V A;  2Z0E B;  4TUU A;  1EF1 A;  2L7R A;  2PE6 B;  4II2 B;  2KNB A;  1WMH B;  3WAM A;  3ZRC A;  3TIX A;  3TCA A;  1WX9 A;  3ENE A;  2EMT A;  3Q3F A;  3TJP A;  2L0F A;  3Q3J A;  3N32 A;  4A3P A;  2N4F A;  5J2R A;  2IO2 B;  3ML9 A;  4W9E A;  3UQA A;  3HHM A;  4KZ0 A;  4ASW C;  2DYB A;  2N9E B;  2LVP A;  4BOZ B;  2C5L C;  2JY6 A;  5E6O A;  3VXW A;  2D07 B;  2M17 A;  3VUY A;  3PHW B;  3H7P A;  3LDZ E;  2GOW A;  4DHJ B;  2ZCC A;  2IZV B;  2J0K A;  5DPT A;  4ZRI A;  4AJY B;  2K25 A;  2O6V B;  3A9J B;  3PLV A;  3UIN B;  3PHX B;  2LVO A;  3L0W B;  3RUI B;  2GBJ A;  2KDF B;  2PE9 A;  4WWP A;  2O2V A;  2MLB A;  4MJS B;  5E6P A;  4FHJ A;  1L7Y A;  3ZNZ B;  4W9C A;  4WWN A;  3QIJ A;  2LVQ A;  2VRR B;  2ZCB A;  2J7Q B;  1LXD A;  2BGF A;  4FAD A;  2L0T A;  4LJO B;  1ZGU B;  2FCM A;  3NHE B;  3ZKJ C;  4F8C B;  3RT3 B;  3ZDM C;  3PRP B;  1S1Q B;  4KSL C;  3UGB B;  3ZVV A;  5G2N A;  1WJN A;  3X23 A;  2WWZ A;  4FUL A;  1E8W A;  2HD5 B;  1MG8 A;  1WGH A;  4WAA A;  3SU8 X;  3X0W A;  2DHZ A;  5DCN A;  4XZ4 A;  1TBE A;  2MSE D;  5KHQ A;  3M63 B;  2MWS B;  4HCN B;  4HJK A;  2EKE C;  4DDG D;  4KIK B;  2GBM A;  4FJZ A;  2J0J A;  5JHA A;  3VUX A;  5FR6 A;  3DOW A;  2BYV E;  1GG3 A;  2LI5 A;  4MGK E;  3W1Y A;  2N9P C;  2LRU A;  2KDE B;  2KWU B;  2REX A;  1UZX B;  4K7S A;  3A9K A;  3UF8 A;  1WM2 A;  1WF9 A;  1Q5W B;  3PT2 B;  1PQS A;  2NPT A;  4IM0 A;  1R4N I;  3PSE B;  5CTR C;  4NY0 A;  4ZRK A;  3HIZ A;  4F7Z A;  2OJR A;  3QJZ A;  2LAS A;  4DHJ D;  1WI0 A;  3CSF A;  4BVU C;  1WM3 A;  2KWV B;  3BY4 B;  2LUE A;  3QWZ B;  3KVF B;  4PS8 A;  1ZKH A;  3NZS A;  4JLC A;  4PYZ A;  4DXA B;  4GOC A;  1WXV A;  3IG3 A;  3JSV B;  3R66 C;  2KD0 A;  1WRD B;  2PJH A;  3SD5 A;  1LM8 B;  4CO7 A;  2ZNV C;  2KFJ A;  2N1W A;  4IUM B;  3ZUN A;  1VCB A;  1P9D U;  2KFK A;  4MEL A;  3HM3 A;  2YVC A;  3RUL A;  4FA6 A;  3MTN B;  1E90 A;  1WYW B;  2ZJD A;  3HM6 X;  3NOB A;  3A9K B;  4EZL A;  3ZDT A;  3NY5 A;  3AU5 A;  3KYD D;  3JVZ X;  4BKG A;  2K8C A;  2A5U A;  1V49 A;  4II3 B;  4DHZ E;  2KHW B;  2KC1 A;  1I42 A;  2V3S A;  3C0R B;  3MHS D;  4W9D A;  4EEW A;  2W9N A;  3ZNI D;  4KDL B;  1YD8 U;  3TMP B;  2DZK A;  4G50 A;  1TZ1 A;  1FXT B;  3CF6 E;  3KUZ A;  4I6N B;  2MP2 B;  2BPS A;  4AWJ A;  2XK5 A;  4GU2 A;  3KW5 B;  2MBB B;  4FJV B;  2HE7 A;  1WIA A;  2ZEQ A;  4HVB A;  1E8Z A;  4TQ0 A;  3S2A A;  4GB9 A;  5DPW A;  1V6E A;  3W1S A;  4J6I A;  1NDD A;  2O2V B;  2B3A A;  2NR2 A;  1GNU A;  1OEY A;  2DEN B;  2DZI A;  2O6V D;  2XEW A;  2ZNV B;  4LJP B;  1KLV A;  5C23 A;  2IO3 B;  1V80 A;  1JRU A;  2KLC A;  4W9F A;  4WWO A;  2N7D A;  4ANV A;  5J18 A;  4MDK E;  5CHF A;  4JIO U;  1ISN A;  1R4M I;  4GDK A;  2IO0 B;  2JVC A;  4MGY E;  2BWF A;  3O65 B;  3H7S A;  3QAQ A;  2OOB B;  2CR5 A;  3RCZ A;  1GUA B;  3B08 A;  5BO4 B;  2LGD A;  3L54 A;  2K8B A;  3JSV A;  3JYU A;  3PRM B;  5D2M B;  3RYT A;  3SHQ A;  2KMC A;  2A4Z A;  3HK0 A;  5LXI B;  3QK0 A;  3H7P B;  4KV2 A;  3ZNH B;  4BBN C;  4FBJ B;  2AL6 A;  1GC7 A;  3LJ3 A;  5LXH A;  3PPA A;  5DPS A;  2R2Q A;  2KTR A;  4YL8 A;  4NQL B;  5G55 A;  2FAZ A;  3U8Z A;  2KJR A;  2IO1 B;  2KFK B;  2MRP A;  1VD2 A;  3K9P B;  3PZD A;  4KZC A;  2NPT B;  2Z0D B;  4G3X B;  5E6N A;  1E8X A;  3L17 A;  1E7V A;  5AZG A;  1GC6 A;  1EO6 A;  3RZW C;  1TGZ B;  4WJQ A;  3L16 A;  5HKH A;  2K6Q A;  2KQS A;  4PYU A;  2JF5 A;  1UEL A;  4CHK A;  4GXB A;  3V6E B;  1WX7 A;  2M4N A;  3R3M A;  3DBR I;  4K81 A;  2JRH A;  2G3Q B;  1LFD A;  1V86 A;  2IYD B;  3KUC B;  1OEY J;  2PEA A;  2PPH A;  3DVN U;  4GSW A;  4WJN A;  1C1Y B;  4ANX A;  4BKS D;  4IM2 A;  2JWZ A;  4B9K A;  4GDL A;  4EUT A;  4W9H A;  2NBV B;  3L13 A;  4FLH A;  3ZW3 A;  2C9W B;  1IPG A;  2CHW A;  2ZVO A;  3VTV A;  2UYZ B;  4HK2 A;  4WJO A;  1YX5 B;  2L00 B;  1RLF A;  3EEC A;  1P0R A;  1WXA A;  3WAO A;  2GBR A;  4DHZ B;  2WX1 A;  2JT4 B;  2MX2 A;  3ZTC A;  4ZYN A;  3H1U A;  3OLM D;  3N3K B;  3WAP A;  4MM3 A;  1V9J A;  2RPQ A;  3DVG X;  4CYE A;  2KQ7 A;  4MH0 E;  2GBN A;  5IA7 A;  4NJ6 A;  2KLG A;  3DBL I;  4E71 A;  2KC2 A;  1RAX A;  5AEK B;  3U7D A;  3SDL C;  3QAR A;  4EKU A;  4TV3 A;  5D6J B;  4XX5 A;  2M8S A;  3OJ3 A;  1E5W A;  2WX0 A;  1L2N A;  2K1F A;  3APF A;  2G4D B;  2HTH A;  4RMA A;  1M94 A;  4W9L A;  4RM8 A;  1P98 A;  3ALB A;  1Z2M A;  4NQK E;  1YJ1 A;  4F1S A;  1WE6 A;  2M0X A;  3T8M A;  2XK5 B;  3EHV A;  3TL5 A;  3WA0 A;  2DZJ A;  1EF5 A;  2WDT B;  1WJ4 A;  4DBG A;  4I6L B;  3ZIM A;  2J0M A;  4W9G A;  1I35 A;  4MGZ E;  1WGY A;  2YLM A;  3DCG A;  1WXS A;  2RR9 A;  2KTR B;  4W9I A;  1P3Q U;  3A9J A;  4A20 A;  3DDC B;  3OJ4 B;  4GGQ A;  3VVW B;  1OQY A;  2FCS A;  3PRZ A;  1Q1O A;  1SIF A;  1WXM A;  2NCN A;  1YIW A;  4M8N A;  4HCP B;  2WYQ A;  4W9K A;  1AAR A;  4NAW B;  3AU4 A;  3VAW A;  1YX6 B;  2MW5 A;  1Q0W B;  3KH0 A;  4K1R B;  1F9J A;  3NS8 A;  4MEM A;  4NJ7 A;  4TQ1 A; 
#chains in the Genus database with same CATH topology
 3CIR B;  2KDB A;  3I63 C;  1MJD A;  2MBH A;  1UNS A;  1WMH A;  2NMQ A;  3IHP C;  4KDI C;  2CHZ A;  1HE8 A;  2W54 A;  4WQO B;  1V5O A;  3L08 A;  2IDY A;  2DAF A;  4LDT B;  1WR6 E;  1FMA D;  1C3T A;  4A3O A;  4OZA A;  2N9L A;  2AL3 A;  3A1Q B;  4KKI A;  2BKR B;  3NVZ A;  2EMS A;  2L8J A;  1V1P A;  4A6Q A;  2D3B A;  1UGM A;  3I9V 1;  2UWQ A;  2JPH A;  4BFR A;  4B95 A;  4IWQ A;  4G0N B;  2H88 B;  3AI5 A;  3VRA B;  2WXM A;  1KOT A;  3WIM A;  2LWP A;  3FKY A;  1UBI A;  2MA9 B;  3DBH I;  4LCD E;  4EZK A;  2DBY A;  4ICV A;  1QKZ A;  3IFW B;  3M62 B;  2KVR A;  5C1Z A;  3ABV B;  3ZLZ A;  3ML8 A;  1YQB A;  2D3G A;  3ZXV A;  2GI9 A;  4EZJ A;  2DAJ A;  1D3Z A;  4XGA B;  3DWG C;  3PS6 A;  3UQB A;  5EE3 A;  5I4D A;  1Q10 A;  2AQ1 B;  2KK8 A;  2CU1 A;  2R2O A;  4M0W B;  5GMV A;  1MVK A;  2BYF A;  2WXF A;  1MFW A;  2WXL A;  3UIP B;  1WSP A;  2N9X A;  3RNG C;  3ZRF A;  1L4D B;  4BAX A;  1ET6 A;  4HDO A;  4JWU C;  5AZH A;  3VHT C;  2WU5 B;  2GRI A;  4P7I A;  4C56 C;  2N1V A;  2WU2 B;  5J17 A;  1L2N A;  1XT9 B;  4OZB A;  4TKN A;  3L10 B;  4XYC A;  2BS2 B;  2KOX A;  3BIN A;  3V62 A;  2I2Y A;  1QZE A;  1FNU A;  2LJ5 A;  4WUR A;  1R4M B;  3RN9 C;  2RDB C;  3U30 A;  2WLB A;  4MSQ B;  3ECI A;  2M1M A;  5JXV A;  1JRP A;  2SAK A;  2KXJ A;  1VDV A;  1MI0 A;  1AN8 A;  4W9J A;  3RFZ B;  2LHE A;  4K3C A;  5HG2 A;  1QQR A;  2C7H A;  3RD2 A;  2IBI B;  2RD0 A;  1HTO A;  1F0Z A;  2HJ8 A;  3I3T B;  4IC7 B;  3AE8 B;  4GIV A;  2INP E;  5BMG A;  1E0Z A;  4JL9 A;  1YN3 A;  4LNN A;  2WGS A;  2DWQ A;  1V5T A;  1SE9 A;  2G1E A;  1WR1 A;  3PO0 A;  3RZF A;  4AOF A;  4EE2 A;  3A1Q A;  5FR3 A;  3AE4 B;  4AP4 C;  2V0G A;  1WRI A;  4ZRQ A;  4C4V A;  2IND C;  1IGC A;  2LXC A;  5LNK 1;  1EUV B;  3TBL D;  1CZP A;  4MJS A;  3APC A;  4RM9 A;  3AE6 B;  4II2 B;  2KNB A;  1SJE D;  3AN1 A;  2JWU A;  4B0M A;  3Q3J A;  1C79 A;  5E6J A;  2IO2 B;  1E9M A;  4W9E A;  3UQA A;  1ZOY B;  3UI3 A;  2KYW A;  4OZC A;  3EFC A;  1PGB A;  4XE0 A;  3VXW A;  2M17 A;  3LXF A;  3GE3 C;  3LDZ E;  4DHJ B;  5D3I B;  3HVZ A;  1GOZ A;  3Q2A C;  2J0K A;  5DPT A;  4ZRI A;  2K25 A;  3L0W B;  3RUI B;  2PE9 A;  3AEA B;  4MJS B;  3ZNZ B;  3Q8F A;  2VRR B;  4XDC A;  1C9F A;  4K3B A;  2QMT A;  3ZVV A;  2E3T A;  2RMM A;  3RMK C;  1MG8 A;  4CQN A;  3FIL A;  2WXP A;  3P4R B;  5IP4 D;  2EKE C;  2GB1 A;  1ENF A;  5FR6 A;  2BYV E;  2LI5 A;  2N9P C;  2LRU A;  2KDE B;  2QCZ A;  4ITK A;  1UZX B;  4K7S A;  2WXK A;  3BII D;  1FCC C;  2MEK A;  1C77 A;  3BYY B;  2NPT A;  1R4N I;  3HIZ A;  3QJZ A;  2JSV X;  1UWX A;  4BVU C;  4L2Y A;  3QWZ B;  1ZKH A;  4YWG G;  4JLC A;  5G5G A;  1AWD A;  1WXV A;  3R66 C;  3IG3 A;  1XLN A;  3SD5 A;  1L0Y B;  3RUL A;  3TEW A;  3AMZ A;  1FFV A;  4FA6 A;  3MTN B;  1E90 A;  3HM6 X;  4EZL A;  3WCQ A;  3MC0 B;  3AU5 A;  4BKG A;  3JVZ X;  2A5U A;  1I42 A;  2JYE A;  4L1B A;  4W9D A;  4EEW A;  3BYT B;  3TMP B;  1TZ1 A;  3B9J A;  2AQ2 B;  4I6N B;  2MP2 B;  2BPS A;  3AEF B;  2RDG A;  3KW5 B;  2XN9 C;  1WIA A;  1DOY A;  3W5V B;  1B1Z A;  4GB9 A;  3S2A A;  4TQ0 A;  3W1S A;  2J53 A;  2O2V B;  2BB5 A;  2NR2 A;  2ZNV B;  2XEW A;  2DEN B;  1I4G A;  4WIP A;  3N20 C;  3RNC C;  1JRU A;  5J18 A;  5CHF A;  1N60 A;  1QLB B;  1ET9 A;  2IO0 B;  2ZW0 A;  2CR5 A;  3RCZ A;  2PW9 A;  3PRM B;  5D2M B;  3URY A;  2KMC A;  5LXI B;  3BWU D;  3QK0 A;  3ZNH B;  5LXH A;  1UF0 A;  1KTK A;  2FAZ A;  2KJR A;  3KQ4 A;  2IO1 B;  3PZD A;  4KZC A;  1M4V A;  2Z0D B;  4LNF A;  1VZ8 A;  3L17 A;  3RNE C;  4TMA B;  1GC6 A;  2L32 A;  1F2R C;  4M01 A;  3Q8E A;  3R3M A;  4HRO A;  4DXF A;  1FCL A;  1V86 A;  1OEY J;  2BTE A;  4BKS D;  2R61 A;  2JWZ A;  3ZW3 A;  2CHW A;  4HK2 A;  4WJO A;  1YX5 B;  2BS4 B;  4KGT A;  4DHZ B;  5IN7 A;  3T3O A;  3N3K B;  3IT6 B;  4M0W A;  3DVG X;  3DBL I;  5C2T B;  5EE9 A;  1RAX A;  3P4Q B;  3IAS 1;  2BB6 A;  2G4D B;  2HTH A;  3R8B A;  2J52 A;  1TYG B;  4NQK E;  1WE6 A;  2M0X A;  1YJJ A;  1RM6 C;  2W3S A;  4DBG A;  4I6L B;  3ZIM A;  1EU4 A;  4W9G A;  1I35 A;  4MGZ E;  2Q5W D;  1VZ7 A;  2YLM A;  1WXS A;  1FXI A;  2RR9 A;  4M00 A;  1P3Q U;  3DDC B;  4ZYS A;  1Q1O A;  4NAW B;  3AU4 A;  3VAW A;  3Q8A A;  3KH0 A;  4ZHP A;  1F9J A;  4N59 A;  4XWW A;  1NYR A;  2Y5C A;  3NS8 A;  3AB5 A;  2D10 A;  2KJH B;  4ZRJ A;  2FBW B;  3B0A A;  3SEB A;  2CJN A;  4DQO C;  2JXX A;  4YT0 B;  5BYS A;  3U2S C;  3VTU A;  1V2Y A;  1L6U A;  3QCA A;  4BBN F;  3LYY A;  2C60 A;  2KAN A;  1WJU A;  2ZZP B;  1PYW D;  1FNV A;  3UIO B;  4KSK C;  1NBF C;  1TT5 B;  2CJO A;  4ARI A;  2L76 A;  2WNM A;  2QC8 A;  4DK5 A;  3TUO A;  2M0A A;  3Q8C A;  3DBS A;  2WXR A;  3GZN I;  3B1L X;  4RGO S;  5JZE B;  1XO3 A;  2LHD A;  5JHB A;  2Y5P A;  4AS1 A;  1RFA A;  1YOV B;  2FIF A;  2KT7 A;  4FHK A;  1H4R A;  5L83 A;  1E7P B;  3W2D A;  2GMI C;  4HEA 1;  5D94 A;  1RRB A;  2BYE A;  2PTL A;  4BKS A;  2D11 A;  1F77 A;  4LNI A;  4GMV A;  1TS2 A;  3QHT A;  1FRR A;  2LGY A;  2ZPN A;  2KKC A;  3B2F A;  4GDK B;  4US9 A;  4ANW A;  4RNA A;  4DWF A;  3Q6B A;  2WP9 B;  2W55 A;  3QC8 B;  4HKZ E;  1NYQ A;  4ZHO A;  1WZ0 A;  4NPN A;  2G4S A;  3FIL B;  4FJY A;  4K7U A;  2ZPY A;  1D4B A;  1IBX A;  3CMM B;  2LRW A;  4C7Y A;  3TSS A;  2QIE B;  4OVV A;  3PTF C;  2D2Q A;  4G11 A;  2OJW A;  1JWA D;  4JQW C;  3T9L A;  4B6W A;  2KN5 A;  3GZN B;  1QT9 A;  5KHO A;  2NVU I;  4MAC A;  2JRI B;  3QA8 A;  4NAM A;  4ZDV A;  4P1C C;  4JGH B;  3N1Y C;  1BUI C;  1ZDX A;  4ARC A;  1WH3 A;  3DBR B;  5FKA C;  1TS4 A;  5HHD G;  2KTF A;  2BF8 B;  4OHJ A;  2CS4 A;  2FE8 A;  5IO9 A;  1GPX A;  1FFU A;  1YQ3 B;  1ROE A;  5LLI A;  2RGF A;  4I6P A;  2FID A;  4EFO A;  2C7N B;  1WYG A;  1TS3 A;  2ZVN A;  1L5P A;  3ZGZ A;  1QF6 A;  2I1J A;  4N9F 4;  2QJL A;  3ZJU A;  2I1K A;  4A55 A;  1FXA A;  2L05 A;  3PGE A;  2WS3 B;  4HWI B;  1B9R A;  1WX8 A;  1J19 A;  4IG7 B;  1NI2 A;  5TR5 A;  3IXS A;  3VUW A;  2MHJ A;  2NS5 A;  2FCN A;  2HJ1 A;  2CKH B;  4BOS C;  2FNJ B;  2KDI A;  1A5R A;  2O6V A;  3Q3O C;  3WAM A;  1HQR D;  1WX9 A;  3ENE A;  1P7F A;  4RF1 A;  5H92 C;  2N4F A;  4P1B C;  1L0X B;  3H8H A;  2LVP A;  2JY6 A;  3VR8 B;  1XLQ A;  3MHZ A;  3VUY A;  3O13 A;  4RGN A;  2N7J A;  1TKE A;  2LJI A;  5HI1 A;  1EWY C;  2GBJ A;  2KDF B;  4WWP A;  3BVZ A;  4RGM A;  2MLB A;  5E6P A;  4RCO A;  1HZ6 A;  1I4Q A;  2LVQ A;  4HPP A;  2J7Q B;  4LJO B;  1LO5 D;  1ZGU B;  2FCM A;  3ZKJ C;  3P4S B;  3PRP B;  1S1Q B;  4KSL C;  1UWM A;  1JQ4 A;  5BMI A;  2PLP A;  5BMH A;  2WWZ A;  3RNB C;  3AE7 B;  1JML A;  2VH1 A;  2MSE D;  2MJD A;  4DDG D;  4KIK B;  3ETR A;  2J0J A;  3DOW A;  1GG3 A;  4LK0 M;  2KWU B;  4B0E A;  3A9K A;  3UF8 A;  1VJK A;  1Q5W B;  1J7A A;  1PQS A;  2VZK B;  3I5J C;  4F7Z A;  2OJR A;  1XF5 L;  1OFF A;  3CSF A;  1WM3 A;  3BY4 B;  1XLP A;  3KVF B;  1RWS A;  1BXT A;  2M56 B;  1TY2 A;  2PJH A;  2KDM A;  1LM8 B;  3AE3 B;  1TS5 A;  3ZUN A;  1FIQ A;  4MEL A;  1J7C A;  3N1X C;  3NOB A;  2WDQ B;  1K50 A;  3AE9 B;  3DHG C;  2KHW B;  2PKO A;  3C0R B;  1F52 A;  2AX5 A;  1XCQ L;  4AWJ A;  4GU2 A;  2DNF A;  4HVB A;  4N58 A;  1DOX A;  2K0P A;  1NDD A;  1YMH E;  4KKJ A;  4N6E B;  1GNU A;  1TZO A;  2IO3 B;  2N7D A;  2LGI A;  1NVI D;  1HTQ A;  4JIO U;  3BK2 A;  1EWC A;  1ISN A;  2JVC A;  4MGY E;  2IGG A;  2BWF A;  3QAQ A;  1V8C A;  2LGD A;  4XWT A;  4C00 A;  4KV2 A;  3H7P B;  4BBN C;  2KTR A;  4USA A;  4YL8 A;  3KWV A;  3U8Z A;  2OHF A;  2MRP A;  2KFK B;  4G3X B;  1TJE A;  2MH7 A;  1E7V A;  1DGJ A;  2D5G A;  3RZW C;  3P63 A;  3L16 A;  1NI3 A;  2M4N A;  2JRH A;  4WAF A;  2G3Q B;  4GSW A;  3C19 A;  1C1Y B;  1QOG A;  1V97 A;  4IM2 A;  2H89 B;  4B9K A;  5D3D A;  4W9H A;  3L13 A;  2UU7 A;  4FLH A;  4YSY B;  3VTV A;  1V1O A;  1WXA A;  2GBR A;  1HZ5 A;  3WAP A;  4MM3 A;  1QOB A;  4CYE A;  4MH0 E;  2GBN A;  5AEK B;  2W3R A;  3T3N A;  4TV3 A;  4XX5 A;  1AYF A;  2WX0 A;  2K1F A;  2IJ0 A;  1JWU D;  4LTU A;  1M94 A;  4RM8 A;  4C7Z A;  1Z2M A;  1C4P A;  3AE1 B;  2XK5 B;  4RFB A;  5EE1 A;  1EF5 A;  2YEP F;  2W82 A;  1N61 A;  1WGY A;  1EU3 A;  1LGR A;  4YSZ B;  3OJ4 B;  3VVW B;  1OQY A;  3AV8 A;  3KLS X;  4JWS C;  4MH8 A;  3AH7 A;  1YIW A;  1XXG A;  2WYQ A;  1SBB B;  1HXY D;  2BW2 A;  1AAR A;  1TY0 A;  1YX6 B;  2MW5 A;  4K1R B;  4NJ7 A;  1JWM D;  2HDE A;  4IWP A;  1OGW A;  2DZM A;  2Y5B B;  1XQQ A;  2PVO D;  4HJG E;  1T0Y A;  3HVD A;  3SFE B;  3A4R A;  4LNK A;  2K22 A;  3ONS A;  5CHW A;  1SXT A;  2RSU A;  5JH5 C;  2JYT A;  4HPL B;  3L4P A;  1K8R B;  5BYQ A;  4PS3 A;  3IVF A;  2XNA C;  1IYF A;  2KO3 A;  3CST A;  1Z5S B;  1WWT A;  1DYQ A;  2DYO A;  1GB4 A;  4GDL B;  4WH4 A;  3JW0 X;  1UH6 A;  4E3C A;  3DPD A;  4URK A;  3DWM A;  3V6C B;  3KUD B;  1SF0 A;  2NTT A;  2KVZ A;  4NNJ B;  1KLU D;  1BT0 A;  2LUM A;  1TIF A;  1YNT E;  1SJH D;  4K7W A;  3VDZ A;  2ZW1 A;  4PS7 A;  4IW0 A;  1FO4 A;  2G45 B;  2B76 B;  2JZP A;  3BK1 A;  1GJZ A;  4JPS A;  3SFD B;  4ICU A;  1V81 A;  1CMX B;  2QDF A;  2PIA A;  2KMA A;  4H2A A;  4BKT A;  4YTM B;  5CHV C;  2KQ4 X;  1ZUD 2;  1RFK A;  4ANU A;  2LGS A;  4XC2 A;  3ZYY X;  2BT6 A;  1WE7 A;  2J42 A;  3DBH B;  1E7U A;  3V61 A;  2WQY B;  4HLE A;  4AJW A;  2AWT A;  4GN1 A;  4FXC A;  1WGG A;  3PV1 A;  2N0S B;  3M95 A;  1MPE A;  3ZO5 B;  5AZF A;  4KGR A;  2MCN B;  4AUQ C;  2KWC A;  2BYT A;  1H8C A;  2I38 A;  1UBQ A;  3BVM A;  4HPM B;  1N5W A;  2QSD A;  1SSN A;  2G9H D;  4DDI D;  3OAW A;  2AYO B;  1I4H A;  4EOY A;  2K8H A;  1WGK A;  4J3O D;  3ZNG C;  2JZ3 B;  3EFU A;  1D5X C;  3PLU A;  4OVU A;  3TEY A;  1ZXI A;  3AM9 A;  1KM7 A;  1P1A A;  3P1M A;  1QOA A;  1WJ6 A;  3ZXR A;  1U4A A;  1QOF A;  3IAM 1;  2WXH A;  3LB8 C;  2HTM E;  1XLO A;  2FCQ A;  3IT4 B;  2NTS A;  3W1S C;  3A4S C;  3PZ7 A;  4HXD A;  3V05 A;  1KJT A;  1VLB A;  3IBE A;  2INC C;  1R4N B;  1PUT A;  2KJ6 A;  4TSS A;  4WJP A;  3W5U B;  1OQQ A;  2WHI A;  1I4P A;  4IOI E;  5CX3 A;  5HFY A;  1J8C A;  1TTN A;  3APD A;  1FEH A;  2QIL A;  3DVN V;  2ASQ A;  3U4E G;  2Z0E B;  4TUU A;  1EF1 A;  2PE6 B;  1WMH B;  3ZRC A;  2WXO A;  3AEG B;  3TJP A;  2KAJ A;  2L0F A;  4RGT A;  3N32 A;  4A3P A;  3ML9 A;  3HHM A;  1FNW A;  3Q8B A;  4ASW C;  2N9E B;  3NG0 A;  1D6E C;  4BOZ B;  2C5L C;  1OQR A;  5EE0 A;  4OVZ A;  5E6O A;  3U7Z A;  2D07 B;  3PHW B;  2GOW A;  2ZCC A;  3PZ8 A;  5TSS A;  2IZV B;  2VZK D;  3UIN B;  1JW9 D;  3PHX B;  2LVO A;  1ZDV A;  2X38 A;  4FHJ A;  4S0R A;  2IPK D;  2X8X X;  3QIJ A;  2ZCB A;  1JAL A;  3VR9 B;  2L0T A;  3HRD D;  4NZL B;  4PT5 A;  2BBC A;  3RT3 B;  3NUH B;  1WJN A;  3X0W A;  2DHZ A;  5DCN A;  2DLB A;  1TBE A;  5KHQ A;  2MWS B;  4HCN B;  4HJK A;  1D5Z C;  5IKC M;  1J7B A;  5JHA A;  4RH6 A;  3VUX A;  1DOI A;  4S17 A;  2ICI A;  3W1Y A;  3R2T A;  3ZQ4 A;  2REX A;  1WF9 A;  4DXG A;  3PT2 B;  2PVG C;  4IM0 A;  5CTR C;  1ZPS A;  4NY0 A;  2M19 A;  4YSX B;  3NVY A;  2K3U A;  4PS8 A;  3TEZ A;  3NZS A;  4DXA B;  4GOC A;  3JSV B;  2KD0 A;  3U52 E;  4CO7 A;  2L52 A;  2ZNV C;  2KFJ A;  3ZJV A;  1XCT L;  2LMC A;  4IUM B;  2ONQ A;  2KFK A;  2YVC A;  2WDV B;  2ON8 A;  3ZDT A;  4KX6 B;  1V49 A;  3J9C A;  3MHS D;  2W9N A;  3ZNI D;  4KDL B;  1YD8 U;  4G50 A;  5H8Y E;  2XK5 A;  4FJV B;  2HE7 A;  2ZEQ A;  4AQ7 A;  1E8Z A;  2YEP B;  5DPW A;  1V6E A;  3R2I A;  4J6I A;  3RNF C;  2B3A A;  2JU6 X;  2O6V D;  1PGA A;  4KGS A;  5C23 A;  2KLC A;  4W9F A;  3AE5 B;  4WWO A;  4ZOH C;  4MDK E;  5G5H A;  1TKY A;  1R4M I;  3O65 B;  5AUI A;  1I4X A;  1FPY A;  3RYT A;  3HK0 A;  3LJ3 A;  1GC7 A;  4LLG M;  4NQL B;  5G55 A;  5MPO A;  1ZE3 D;  1L4Z B;  1VD2 A;  2AQ3 B;  1JWS D;  1T0Q C;  4O1N A;  1EO6 A;  4YTP B;  3CWI A;  4WJQ A;  2FUG 1;  2K6Q A;  4PYU A;  1UEL A;  4GXB A;  1WX7 A;  2Y3A A;  1YJI A;  3DBR I;  2IYD B;  3KUC B;  2PEA A;  3DVN U;  5FK9 C;  1IBX B;  4GDL A;  2JX5 A;  4EUT A;  2NBV B;  3P4P B;  3EA6 A;  1I4R A;  2C9W B;  1SB3 C;  1T5X D;  1K52 A;  2L00 B;  1RLF A;  2WDR B;  1P0R A;  3WAO A;  2JT4 B;  2MX2 A;  4ZYN A;  3H1U A;  1V9J A;  1T0S C;  4NJ6 A;  2KLG A;  1K53 A;  3U7D A;  3QAR A;  2TSS A;  4EKU A;  4A9A A;  1JRO A;  1E5W A;  1PDX A;  1K51 A;  2WXN A;  2L83 A;  1P98 A;  2WXJ A;  1FRD A;  1P7E A;  3NVW A;  3EHV A;  3WA0 A;  2DZJ A;  1WJ4 A;  3GE8 C;  3MC8 A;  2QEJ C;  3EUB 2;  3NS1 A;  1I7H A;  4W9I A;  3RNA C;  3A9J A;  4A20 A;  4GGQ A;  2V9H A;  3PRZ A;  1R7S A;  1SIF A;  1WXM A;  1ZXH A;  4HCP B;  5IOI A;  3SR6 A;  5AUK A;  4W9K A;  1N62 A;  3FAH A;  4TQ1 A;  4IKG A;  3PRE A;  2D3C A;  1CK1 A;  1T0R C;  4KVG B;  2IY1 B;  2AEH A;  1E8Y A;  1WGR A;  1VZ6 A;  5D7G A;  3VH4 B;  4HRS A;  4YXD B;  3DVG Y;  1WZ3 A;  3OG5 A;  4WQM A;  2MQJ A;  4JX1 C;  1N63 A;  2JZZ A;  2XBB C;  2Z59 B;  3H9D A;  3H6N A;  1MHX A;  4FN2 A;  1MG4 A;  3N30 A;  1ESF A;  2MBQ A;  2K6D B;  2JUO A;  4KIK A;  1N5X A;  2N9K A;  2K39 A;  1NEK B;  2EKI A;  3NJT A;  4REZ A;  1IP9 A;  1UD7 A;  2BKF A;  4R3D A;  2MP2 A;  1YN4 A;  5GXG B;  1KH0 A;  2LGX A;  2D3A A;  1KFY B;  3AEE B;  2E6X A;  1SE2 A;  3AEB B;  4XDD A;  3N1Z C;  4HDQ A;  3EC8 A;  3VFK A;  2WXI A;  2C7M B;  1SEB D;  1L6V A;  4IM3 A;  5L95 C;  1WY8 A;  4HKQ A;  3QX1 A;  1F1H A;  1XEE A;  1C78 A;  1XD3 B;  3KYC D;  3W9C B;  2LD9 A;  2L3Z A;  1OTR B;  1SE4 A;  1V1P B;  2MBE A;  3P2B A;  1HA5 A;  3AUL A;  3R7Q A;  3KWL A;  4E74 A;  3EGR A;  3M3J A;  3MJW A;  2IGD A;  2N7E A;  3MC9 A;  2V1Y A;  3VQI A;  2DYM A;  2LXA A;  1N6Z A;  5EDS A;  3ZTD A;  2LZ6 A;  3E9S A;  3K9O B;  2IY0 B;  4NAW A;  1CJE A;  3B2G A;  3QQ8 B;  2FUH B;  1FD6 A;  3N9Y C;  2DX5 B;  2OED A;  3NVV A;  1UUP A;  3AE2 B;  4UDU C;  4MGI E;  2V4L A;  4ACF A;  2QHO A;  2KX3 A;  3D32 A;  3I57 A;  1AW7 A;  4X57 B;  1X1M A;  2NBU A;  1JCK B;  1WFY A;  1LQB A;  3Q14 C;  5DPR A;  2BWE S;  2MBO A;  3R7R A;  1SGH A;  4MSM B;  4P16 A;  2SEB D;  3GS2 A;  3AXC A;  2NBW B;  4QAY A;  3VTW A;  5C3J B;  2KX0 A;  2WXG A;  3P42 A;  3VH3 B;  3DQV A;  2RPV A;  2MJ3 A;  1A70 A;  1MHH E;  3V60 A;  3WAL A;  1ZW7 A;  3WAN A;  4LDT D;  2BQQ A;  4L23 A;  5IAA C;  2KWD A;  4D2K A;  1J0G A;  2RDH A;  4IWO A;  3DBL B;  1T3Q A;  4M8M A;  1WGD A;  1VR9 A;  1T6B X;  2JXT A;  3NZU A;  2LEK A;  2IGH A;  3ZJT A;  1G6J A;  2KZR A;  2CHX A;  1E6E B;  2KN4 A;  3GOE A;  1KRH A;  2J4X A;  4C4V B;  3PVL A;  2GBK A;  1Y8R C;  2MJE A;  3A33 B;  2WXQ A;  1S3S G;  2V3P A;  2KAC A;  3DHH C;  2L7R A;  3TIX A;  3TCA A;  1E10 A;  1CQV A;  4A8X C;  2L1A A;  2EMT A;  3Q3F A;  4NJC A;  1GB1 A;  3RPF C;  1L0V B;  5J2R A;  4KZ0 A;  2DYB A;  1F2R I;  2BS3 B;  3H7P A;  1TKG A;  1ACC A;  2K5P A;  4AJY B;  3A9J B;  2O6V B;  3PLV A;  3C8Y A;  2O2V A;  1ZP0 B;  1L7Y A;  4W9C A;  4WWN A;  1LXD A;  1JWB D;  2BGF A;  4FAD A;  3TEX A;  3NHE B;  4F8C B;  3Q69 A;  3ZDM C;  3BZD B;  2EEL A;  3UGB B;  5G2N A;  2GLS A;  4JE3 B;  3X23 A;  4FUL A;  1E8W A;  2HD5 B;  1WGH A;  4WAA A;  3SU8 X;  4RF0 A;  3OWE B;  4XZ4 A;  4GLS C;  1YN5 A;  3M63 B;  2GBM A;  4FJZ A;  4Q2J A;  4BZA A;  4MGK E;  3DHI C;  3GP7 A;  1WM2 A;  3MP9 A;  3PSE B;  4ZRK A;  1YQ4 B;  2JQR B;  4IDI A;  2LAS A;  4DHJ D;  1WI0 A;  3MJ5 A;  2KWV B;  2LUE A;  2INN E;  4PYZ A;  3Q3N C;  1GAQ B;  3AEC B;  1WRD B;  4US8 A;  2N1W A;  4M02 A;  1VCB A;  1P9D U;  2ACZ B;  3HM3 A;  4A90 A;  1WYW B;  2ZJD A;  3A9K B;  3NY5 A;  3KYD D;  2K8C A;  4II3 B;  4DHZ E;  1D5M C;  5T8I A;  2KC1 A;  2V3S A;  2CU3 A;  1SE3 A;  2DZK A;  1FXT B;  3CF6 E;  3KUZ A;  1PFD A;  4ZRP A;  3RI7 C;  1RYJ A;  2MBB B;  4OW0 A;  1WXQ A;  3BVG A;  4PK1 A;  1KLV A;  1OEY A;  4LJP B;  2DZI A;  3HUI A;  1V80 A;  4ANV A;  1IGD A;  3AED B;  4GDK A;  2BVC A;  1HEZ E;  3H7S A;  1QIL A;  2OOB B;  2LFI A;  1GUA B;  3B08 A;  5BO4 B;  3MFG A;  3L54 A;  2K8B A;  3JSV A;  3JYU A;  3SHQ A;  2A4Z A;  1BML C;  4FBJ B;  1KLG D;  2AL6 A;  3PPA A;  5DPS A;  2R2Q A;  1STE A;  3E56 A;  4MT5 A;  3K9P B;  2NPT B;  5E6N A;  1E8X A;  2K9X A;  5AZG A;  2PMV A;  1TGZ B;  5HKH A;  2KQS A;  2JF5 A;  4CHK A;  3V6E B;  4P6V F;  1FM0 D;  2VH2 A;  4K81 A;  1LFD A;  2PPH A;  3GB1 A;  4WJN A;  4ANX A;  1IPG A;  2ZVO A;  2UYZ B;  3V3X A;  3EEC A;  2WX1 A;  3ZTC A;  1NEN B;  3OLM D;  2RPQ A;  1EM7 A;  2KQ7 A;  5IA7 A;  4E71 A;  2V4I B;  2KC2 A;  3SDL C;  1UGJ A;  1KF6 B;  4MM3 B;  5D6J B;  2M8S A;  3OJ3 A;  3APF A;  4YTN B;  4RMA A;  4W9L A;  1VRA B;  1SIJ A;  3FC4 A;  3ALB A;  1YJ1 A;  4C80 A;  3NZ3 A;  4F1S A;  3T8M A;  3TL5 A;  2WDT B;  1C4A A;  3VRB B;  3Q3M C;  2J0M A;  3DCG A;  5BYR A;  2KTR B;  1C76 A;  2FCS A;  1C4C A;  4WWM A;  2NCN A;  3NRZ A;  4M8N A;  1PGX A;  2V3N A;  1IUE A;  1Q0W B;  2KMM A;  4MEM A;  1Y56 A;  2Z8L A;  4LNO A; 
#chains in the Genus database with same CATH homology
 2D10 A;  3PRE A;  4IWP A;  1OGW A;  2KJH B;  4ZRJ A;  2KDB A;  4KVG B;  2DZM A;  2IY1 B;  2AEH A;  2Y5B B;  1E8Y A;  3B0A A;  1WGR A;  1XQQ A;  2MBH A;  5D7G A;  3VH4 B;  1T0Y A;  1WMH A;  3DVG Y;  3IHP C;  4KDI C;  2JXX A;  1WZ3 A;  2CHZ A;  1HE8 A;  4WQO B;  1V5O A;  3A4R A;  3L08 A;  2DAF A;  2MQJ A;  3ONS A;  5CHW A;  2JZZ A;  2XBB C;  4LDT B;  1WR6 E;  2Z59 B;  3H9D A;  1C3T A;  2RSU A;  4A3O A;  4HPL B;  5JH5 C;  3H6N A;  3VTU A;  4FN2 A;  1K8R B;  3N30 A;  2AL3 A;  3A1Q B;  1V2Y A;  2MBQ A;  3QCA A;  4BBN F;  2K6D B;  2BKR B;  4PS3 A;  2C60 A;  2JUO A;  4KIK A;  3IVF A;  2KAN A;  1WJU A;  2ZZP B;  2EMS A;  2L8J A;  2KO3 A;  3CST A;  1IYF A;  1Z5S B;  2K39 A;  1UGM A;  2UWQ A;  3UIO B;  1UD7 A;  1IP9 A;  2JPH A;  2DYO A;  4KSK C;  2BKF A;  2MP2 A;  4GDL B;  4B95 A;  4BFR A;  1NBF C;  4IWQ A;  4G0N B;  2L76 A;  3AI5 A;  3JW0 X;  2LGX A;  4DK5 A;  1UH6 A;  1KOT A;  4E3C A;  3DPD A;  3WIM A;  2LWP A;  1UBI A;  4URK A;  2MA9 B;  3V6C B;  3DBS A;  3DBH I;  3GZN I;  3B1L X;  4LCD E;  4EZK A;  3KUD B;  5JZE B;  4ICV A;  4NNJ B;  1BT0 A;  3IFW B;  3M62 B;  2KVR A;  4HDQ A;  5JHB A;  3EC8 A;  1RFA A;  3VFK A;  5C1Z A;  4K7W A;  3ZLZ A;  2C7M B;  2FIF A;  3ML8 A;  4PS7 A;  3VDZ A;  4IW0 A;  4FHK A;  1H4R A;  5L83 A;  1YQB A;  5L95 C;  4IM3 A;  1WY8 A;  2D3G A;  3QX1 A;  2G45 B;  2GMI C;  1XD3 B;  3KYC D;  4EZJ A;  5D94 A;  2DAJ A;  1RRB A;  2BYE A;  1D3Z A;  2LD9 A;  3PS6 A;  3UQB A;  2L3Z A;  1GJZ A;  4BKS A;  4ICU A;  1OTR B;  1V81 A;  1CMX B;  2KMA A;  4BKT A;  2D11 A;  2KK8 A;  4GMV A;  2CU1 A;  3QHT A;  2R2O A;  4M0W B;  5CHV C;  5GMV A;  2LGY A;  2MBE A;  4ANU A;  3P2B A;  2ZPN A;  2KKC A;  2BYF A;  4XC2 A;  3AUL A;  3R7Q A;  4E74 A;  1WE7 A;  4GDK B;  3UIP B;  3M3J A;  3MJW A;  1E7U A;  2N9X A;  2N7E A;  3V61 A;  3ZRF A;  4HLE A;  4AJW A;  2AWT A;  4ANW A;  2V1Y A;  4DWF A;  3VQI A;  4HDO A;  2DYM A;  2LXA A;  4GN1 A;  5AZH A;  5EDS A;  3ZTD A;  2LZ6 A;  1WGG A;  3K9O B;  2IY0 B;  3QC8 B;  4NAW A;  3PV1 A;  3VHT C;  1WZ0 A;  4NPN A;  2G4S A;  3QQ8 B;  2FUH B;  3M95 A;  4P7I A;  4FJY A;  4K7U A;  2ZPY A;  3ZO5 B;  5AZF A;  2DX5 B;  3CMM B;  2N1V A;  2LRW A;  4OVV A;  5J17 A;  1XT9 B;  2MCN B;  3PTF C;  4MGI E;  2KWC A;  4TKN A;  2V4L A;  3L10 B;  4AUQ C;  2KOX A;  3BIN A;  1H8C A;  2QHO A;  1UBQ A;  2D2Q A;  4HPM B;  2KX3 A;  3D32 A;  4G11 A;  3V62 A;  3T9L A;  4JQW C;  1QZE A;  4X57 B;  4B6W A;  1X1M A;  2KN5 A;  2LJ5 A;  2NBU A;  1WFY A;  1LQB A;  5KHO A;  2NVU I;  5DPR A;  4DDI D;  2BWE S;  2MBO A;  3OAW A;  3R7R A;  2AYO B;  2JRI B;  3U30 A;  4MSQ B;  3QA8 A;  1SGH A;  3ECI A;  4MSM B;  4EOY A;  4ZDV A;  4JGH B;  2K8H A;  2M1M A;  3ZNG C;  2JZ3 B;  1WH3 A;  3EFU A;  3AXC A;  3PLU A;  4OVU A;  2KTF A;  2KXJ A;  2NBW B;  3VTW A;  2BF8 B;  2KX0 A;  4W9J A;  2CS4 A;  1KM7 A;  1P1A A;  3VH3 B;  1WJ6 A;  2C7H A;  3RD2 A;  1U4A A;  2IBI B;  3DQV A;  2RD0 A;  3V60 A;  3WAL A;  5LLI A;  1ZW7 A;  2RGF A;  3WAN A;  4LDT D;  4I6P A;  2HJ8 A;  2FID A;  3I3T B;  4EFO A;  2C7N B;  4IC7 B;  2FCQ A;  5IAA C;  3W1S C;  4GIV A;  3A4S C;  1J0G A;  4HXD A;  1KJT A;  4JL9 A;  2ZVN A;  4IWO A;  1V5T A;  3NZU A;  1SE9 A;  1WGD A;  3IBE A;  4M8M A;  1G6J A;  1WR1 A;  2KJ6 A;  2I1J A;  4N9F 4;  2KZR A;  4WJP A;  3RZF A;  4AOF A;  2CHX A;  2I1K A;  2L05 A;  3A1Q A;  3GOE A;  4AP4 C;  5CX3 A;  1J8C A;  3PGE A;  4HWI B;  2LXC A;  1WX8 A;  2GBK A;  1Y8R C;  3PVL A;  1J19 A;  3A33 B;  1TTN A;  1NI2 A;  3APD A;  4IG7 B;  1EUV B;  5TR5 A;  3DVN V;  3TBL D;  4MJS A;  3VUW A;  2NS5 A;  3APC A;  2FCN A;  4RM9 A;  2CKH B;  2ASQ A;  4BOS C;  2FNJ B;  2KDI A;  1A5R A;  1S3S G;  2O6V A;  2Z0E B;  4TUU A;  1EF1 A;  2L7R A;  2PE6 B;  4II2 B;  2KNB A;  1WMH B;  3WAM A;  3ZRC A;  3TIX A;  3TCA A;  1WX9 A;  3ENE A;  2EMT A;  3Q3F A;  3TJP A;  2L0F A;  3Q3J A;  3N32 A;  4A3P A;  2N4F A;  5J2R A;  2IO2 B;  3ML9 A;  4W9E A;  3UQA A;  3HHM A;  4KZ0 A;  4ASW C;  2DYB A;  2N9E B;  2LVP A;  4BOZ B;  2C5L C;  2JY6 A;  5E6O A;  3VXW A;  2D07 B;  2M17 A;  3VUY A;  3PHW B;  3H7P A;  3LDZ E;  2GOW A;  4DHJ B;  2ZCC A;  2IZV B;  2J0K A;  5DPT A;  4ZRI A;  4AJY B;  2K25 A;  2O6V B;  3A9J B;  3PLV A;  3UIN B;  3PHX B;  2LVO A;  3L0W B;  3RUI B;  2GBJ A;  2KDF B;  2PE9 A;  4WWP A;  2O2V A;  2MLB A;  4MJS B;  5E6P A;  4FHJ A;  1L7Y A;  3ZNZ B;  4W9C A;  4WWN A;  3QIJ A;  2LVQ A;  2VRR B;  2ZCB A;  2J7Q B;  1LXD A;  2BGF A;  4FAD A;  2L0T A;  4LJO B;  1ZGU B;  2FCM A;  3NHE B;  3ZKJ C;  4F8C B;  3RT3 B;  3ZDM C;  3PRP B;  1S1Q B;  4KSL C;  3UGB B;  3ZVV A;  5G2N A;  1WJN A;  3X23 A;  2WWZ A;  4FUL A;  1E8W A;  2HD5 B;  1MG8 A;  1WGH A;  4WAA A;  3SU8 X;  3X0W A;  2DHZ A;  5DCN A;  4XZ4 A;  1TBE A;  2MSE D;  5KHQ A;  3M63 B;  2MWS B;  4HCN B;  4HJK A;  2EKE C;  4DDG D;  4KIK B;  2GBM A;  4FJZ A;  2J0J A;  5JHA A;  3VUX A;  5FR6 A;  3DOW A;  2BYV E;  1GG3 A;  2LI5 A;  4MGK E;  3W1Y A;  2N9P C;  2LRU A;  2KDE B;  2KWU B;  2REX A;  1UZX B;  4K7S A;  3A9K A;  3UF8 A;  1WM2 A;  1WF9 A;  1Q5W B;  3PT2 B;  1PQS A;  2NPT A;  4IM0 A;  1R4N I;  3PSE B;  5CTR C;  4NY0 A;  4ZRK A;  3HIZ A;  4F7Z A;  2OJR A;  3QJZ A;  2LAS A;  4DHJ D;  1WI0 A;  3CSF A;  4BVU C;  1WM3 A;  2KWV B;  3BY4 B;  2LUE A;  3QWZ B;  3KVF B;  4PS8 A;  1ZKH A;  3NZS A;  4JLC A;  4PYZ A;  4DXA B;  4GOC A;  1WXV A;  3IG3 A;  3JSV B;  3R66 C;  2KD0 A;  1WRD B;  2PJH A;  3SD5 A;  1LM8 B;  4CO7 A;  2ZNV C;  2KFJ A;  2N1W A;  4IUM B;  3ZUN A;  1VCB A;  1P9D U;  2KFK A;  4MEL A;  3HM3 A;  2YVC A;  3RUL A;  4FA6 A;  3MTN B;  1E90 A;  1WYW B;  2ZJD A;  3HM6 X;  3NOB A;  3A9K B;  4EZL A;  3ZDT A;  3NY5 A;  3AU5 A;  3KYD D;  3JVZ X;  4BKG A;  2K8C A;  2A5U A;  1V49 A;  4II3 B;  4DHZ E;  2KHW B;  2KC1 A;  1I42 A;  2V3S A;  3C0R B;  3MHS D;  4W9D A;  4EEW A;  2W9N A;  3ZNI D;  4KDL B;  1YD8 U;  3TMP B;  2DZK A;  4G50 A;  1TZ1 A;  1FXT B;  3CF6 E;  3KUZ A;  4I6N B;  2MP2 B;  2BPS A;  4AWJ A;  2XK5 A;  4GU2 A;  3KW5 B;  2MBB B;  4FJV B;  2HE7 A;  1WIA A;  2ZEQ A;  4HVB A;  1E8Z A;  4TQ0 A;  3S2A A;  4GB9 A;  5DPW A;  1V6E A;  3W1S A;  4J6I A;  1NDD A;  2O2V B;  2B3A A;  2NR2 A;  1GNU A;  1OEY A;  2DEN B;  2DZI A;  2O6V D;  2XEW A;  2ZNV B;  4LJP B;  1KLV A;  5C23 A;  2IO3 B;  1V80 A;  1JRU A;  2KLC A;  4W9F A;  4WWO A;  2N7D A;  4ANV A;  5J18 A;  4MDK E;  5CHF A;  4JIO U;  1ISN A;  1R4M I;  4GDK A;  2IO0 B;  2JVC A;  4MGY E;  2BWF A;  3O65 B;  3H7S A;  3QAQ A;  2OOB B;  2CR5 A;  3RCZ A;  1GUA B;  3B08 A;  5BO4 B;  2LGD A;  3L54 A;  2K8B A;  3JSV A;  3JYU A;  3PRM B;  5D2M B;  3RYT A;  3SHQ A;  2KMC A;  2A4Z A;  3HK0 A;  5LXI B;  3QK0 A;  3H7P B;  4KV2 A;  3ZNH B;  4BBN C;  4FBJ B;  2AL6 A;  1GC7 A;  3LJ3 A;  5LXH A;  3PPA A;  5DPS A;  2R2Q A;  2KTR A;  4YL8 A;  4NQL B;  5G55 A;  2FAZ A;  3U8Z A;  2KJR A;  2IO1 B;  2KFK B;  2MRP A;  1VD2 A;  3K9P B;  3PZD A;  4KZC A;  2NPT B;  2Z0D B;  4G3X B;  5E6N A;  1E8X A;  3L17 A;  1E7V A;  5AZG A;  1GC6 A;  1EO6 A;  3RZW C;  1TGZ B;  4WJQ A;  3L16 A;  5HKH A;  2K6Q A;  2KQS A;  4PYU A;  2JF5 A;  1UEL A;  4CHK A;  4GXB A;  3V6E B;  1WX7 A;  2M4N A;  3R3M A;  3DBR I;  4K81 A;  2JRH A;  2G3Q B;  1LFD A;  1V86 A;  2IYD B;  3KUC B;  1OEY J;  2PEA A;  2PPH A;  3DVN U;  4GSW A;  4WJN A;  1C1Y B;  4ANX A;  4BKS D;  4IM2 A;  2JWZ A;  4B9K A;  4GDL A;  4EUT A;  4W9H A;  2NBV B;  3L13 A;  4FLH A;  3ZW3 A;  2C9W B;  1IPG A;  2CHW A;  2ZVO A;  3VTV A;  2UYZ B;  4HK2 A;  4WJO A;  1YX5 B;  2L00 B;  1RLF A;  3EEC A;  1P0R A;  1WXA A;  3WAO A;  2GBR A;  4DHZ B;  2WX1 A;  2JT4 B;  2MX2 A;  3ZTC A;  4ZYN A;  3H1U A;  3OLM D;  3N3K B;  3WAP A;  4MM3 A;  1V9J A;  2RPQ A;  3DVG X;  4CYE A;  2KQ7 A;  4MH0 E;  2GBN A;  5IA7 A;  4NJ6 A;  2KLG A;  3DBL I;  4E71 A;  2KC2 A;  1RAX A;  5AEK B;  3U7D A;  3SDL C;  3QAR A;  4EKU A;  4TV3 A;  5D6J B;  4XX5 A;  2M8S A;  3OJ3 A;  1E5W A;  2WX0 A;  1L2N A;  2K1F A;  3APF A;  2G4D B;  2HTH A;  4RMA A;  1M94 A;  4W9L A;  4RM8 A;  1P98 A;  3ALB A;  1Z2M A;  4NQK E;  1YJ1 A;  4F1S A;  1WE6 A;  2M0X A;  3T8M A;  2XK5 B;  3EHV A;  3TL5 A;  3WA0 A;  2DZJ A;  1EF5 A;  2WDT B;  1WJ4 A;  4DBG A;  4I6L B;  3ZIM A;  2J0M A;  4W9G A;  1I35 A;  4MGZ E;  1WGY A;  2YLM A;  3DCG A;  1WXS A;  2RR9 A;  2KTR B;  4W9I A;  1P3Q U;  3A9J A;  4A20 A;  3DDC B;  3OJ4 B;  4GGQ A;  3VVW B;  1OQY A;  2FCS A;  3PRZ A;  1Q1O A;  1SIF A;  1WXM A;  2NCN A;  1YIW A;  4M8N A;  4HCP B;  2WYQ A;  4W9K A;  1AAR A;  4NAW B;  3AU4 A;  3VAW A;  1YX6 B;  2MW5 A;  1Q0W B;  3KH0 A;  4K1R B;  1F9J A;  3NS8 A;  4MEM A;  4NJ7 A;  4TQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...