4AWJA

Pvhl:elob:eloc complex, in complex with capped hydroxyproline
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
103
structure length
100
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADTFEALIEPFSSPPELPDVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Dissecting Fragment-Based Lead Discovery at the Von Hippel-Lindau Protein:Hypoxia Inducible Factor 1Alpha Protein-Protein Interface.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 100
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2012-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4awjA00
2Z59B 3ONSA 1E7VA 2N1VA 4AJYB 5DPRA 4PS7A 4MSQB 2FIFA 3QQ8B 4FADA 2KFKA 4GXBA 2LVQA 4MM3A 5D2MB 3RULA 3TL5A 3MTNB 3JVZX 4DDGD 3AI5A 5E6PA 2GBMA 3QC8B 3PLUA 2KTRA 2D2QA 2M8SA 4DHJD 2NPTA 1WFYA 4MGIE 2JT4B 3ECIA 2JXXA 3RCZA 1WJUA 3WALA 3K9PB 3ALBA 3ENEA 2KJRA 2FIDA 4TUUA 1WIAA 1V2YA 4EUTA 3V6EB 2I1KA 2KWCA 4MGYE 3BY4B 1UBIA 4IM3A 4AWJA 3RZFA 2RGFA 3APCA 4NQKE 2KZRA 4MSMB 3KH0A 3VH4B 1NI2A 4BBNC 2IZVB 2PE6B 2ZCBA 5CHFA 2C7NB 2MW5A 2D3GA 3AXCA 2ASQA 2M4NA 4NPNA 2UWQA 4G11A 2CKHB 3PGEA 5DCNA 1LXDA 2PJHA 4MGKE 5LLIA 2EMSA 2NS5A 3M63B 2DHZA 5AZFA 1RAXA 1WXAA 4G0NB 1WGYA 2K8BA 3APFA 2L7RA 2HJ8A 3N32A 2KDFB 3BINA 4FN2A 1X1MA 4KSKC 2AWTA 1V80A 2KVRA 2XK5A 3VVWB 5J17A 4JLCA 3W1YA 2KN5A 2EKEC 1UELA 2LJ5A 2JRHA 1EF5A 4K7WA 2N9XA 5KHOA 5IA7A 2ZNVB 2LRUA 2ZPYA 2IY0B 3A9JB 3K9OB 2A5UA 1I35A 2V3SA 3ML8A 1WMHA 2QHOA 3TBLD 2C9WB 4I6LB 4HPLB 4W9KA 3RD2A 2IO3B 2LWPA 1E8WA 5AZHA 4EKUA 4W9HA 1S3SG 4WJQA 1E8XA 1WE6A 4ICUA 3T8MA 2IO1B 3DVGY 1YIWA 2ZCCA 2MCNB 4MJSA 3JW0X 1NDDA 2PE9A 4HWIB 5CHWA 5D94A 4P7IA 2MP2A 1D3ZA 3U30A 2K39A 3KUZA 4WWNA 4ZRJA 2V1YA 4I6PA 1L2NA 1QZEA 1J19A 2J0KA 4ZRIA 1ZGUB 1G6JA 1KM7A 3A4SC 2B3AA 2K8HA 2J0JA 2UYZB 1P3QU 4NAWB 1P9DU 2KXJA 4WJPA 4FBJB 4KV2A 3WAMA 2C5LC 2LVPA 2O2VB 2REXA 4TQ1A 3WIMA 3OJ4B 3QK0A 3A9KB 4JGHB 5DPSA 4HJKA 4ICVA 3QA8A 2Y5BB 4MDKE 1PQSA 1WGRA 2A4ZA 4HDOA 2BGFA 4ZDVA 4JL9A 5AEKB 4W9IA 3A33B 3PHXB 4GDKA 4AOFA 3VAWA 1TGZB 1IPGA 5E6NA 4YL8A 3L16A 3UIPB 3LJ3A 2O6VB 2MWSB 3VDZA 4HK2A 1UGMA 4KIKA 2LGXA 1EF1A 4F7ZA 3B1LX 2RR9A 2RSUA 2WDTB 4KDLB 3ZTCA 2L8JA 2N9PC 2M17A 1LQBA 2MBEA 2KLCA 2KOXA 3AULA 3V6CB 3EC8A 3MJWA 2HD5B 3KYDD 4W9DA 1Y8RC 2IYDB 1KJTA 4PYUA 1KLVA 2ZVOA 2M1MA 2WYQA 2ZVNA 1GC7A 2K6DB 4XX5A 3JYUA 4W9GA 4IC7B 2WX0A 3NZUA 3M95A 4IUMB 3A1QB 2LXAA 4MGZE 4ASWC 3QWZB 4HLEA 3PS6A 3PVLA 1MG8A 3OLMD 3NOBA 3KUDB 2WX1A 3VTVA 1WX7A 3HK0A 1E5WA 5EDSA 4OVVA 2AL6A 2NBWB 2L05A 2L0FA 2K1FA 2NPTB 2LVOA 2LASA 2JZZA 2KJ6A 4IM0A 3WAPA 2PEAA 2PPHA 2KDIA 4EZLA 3PT2B 3T9LA 2YVCA 4JIOU 4K7UA 5G55A 3X23A 3UF8A 4CHKA 4EOYA 1JRUA 4NJ7A 4W9JA 3L54A 4II2B 1WJ4A 1RFAA 4B9KA 2G3QB 4N9F4 1I42A 1H8CA 4KZCA 4LJOB 4A3OA 2BYEA 4DXAB 3H7PA 4IWQA 5L95C 4LDTB 1V9JA 2MBHA 2J7QB 1XQQA 2DZJA 2KANA 1WE7A 2L76A 1YD8U 4KDIC 3ZW3A 3HHMA 2FCMA 2DZKA 2LZ6A 2C7HA 3PREA 2EMTA 4GMVA 4CO7A 2KC1A 2DX5B 2DYBA 1TTNA 4HXDA 2DYMA 4OVUA 3WAOA 1GG3A 2G4DB 5JHBA 1SE9A 4II3B 2C60A 2IO2B 4HCPB 2M0XA 2ZNVC 1WM3A 3TCAA 5JHAA 2D11A 2RPQA 4GDLB 1NBFC 2I1JA 4EEWA 3APDA 3UIOB 3NY5A 3ZO5B 3HIZA 1WI0A 5LXHA 4GOCA 4XC2A 1SGHA 5JH5C 1E8YA 1OTRB 2MLBA 4IM2A 1C1YB 2IBIB 3ZNZB 2BYFA 2KK8A 3UQAA 2JVCA 4FULA 2MX2A 3ZUNA 1EO6A 3VFKA 1V86A 2CR5A 4ANUA 2GBNA 2KX0A 4PS8A 1V5TA 4DHJB 2MBOA 3MHSD 1UD7A 5D6JB 3DOWA 2RD0A 3AU4A 4IWOA 4KSLC 1V5OA 4F1SA 1WZ3A 1WX9A 2KC2A 2N1WA 1E7UA 4MJSB 4GIVA 2MP2B 4BKTA 2FCQA 4AP4C 4G3XB 2LD9A 1WGDA 3QIJA 4MH0E 4GSWA 3UQBA 2L00B 5JZEB 2KDEB 4DWFA 2KLGA 2KO3A 5J18A 2J0MA 4LJPB 1WH3A 3W1SC 1M94A 3L10B 1WR1A 3SHQA 1H4RA 3IBEA 3QAQA 4WWPA 2JF5A 4FJYA 1OEYA 1WGHA 2JY6A 3D32A 3PHWB 3RZWC 1YX6B 1WZ0A 4TKNA 2CU1A 3A9JA 4TV3A 3JSVB 2JZ3B 4DHZE 2AYOB 4DK5A 3KUCB 3NZSA 2GBKA 4PYZA 4EFOA 4FLHA 4AJWA 4NQLB 4FHJA 3IFWB 3P2BA 4W9EA 1IYFA 1LFDA 2KMCA 4I6NB 3GZNI 4EZKA 3M62B 4K1RB 2MBBB 3DBLI 5TR5A 3PZDA 4FA6A 2ZEQA 3KYCD 4HDQA 1GC6A 3CMMB 2JUOA 3ZDTA 1XT9B 2FCNA 1OGWA 1UH6A 2CHZA 2NCNA 2AEHA 2NVUI 3Q3JA 3R3MA 4NAWA 3ZKJC 2N9EB 3ZLZA 1WXSA 1WX8A 2O2VA 2DZMA 1EUVB 3A9KA 3QX1A 3S2AA 3SU8X 1P98A 1VD2A 4B6WA 2BWFA 2LGYA 3PRPB 3IHPC 3PRMB 2NBVB 4HCNB 2IY1B 3UINB 2K8CA 3W1SA 2KD0A 3SD5A 3CSTA 4G50A 4LDTD 3PSEB 2KFKB 1ISNA 2DAJA 3VUWA 4ANVA 1HE8A 4GU2A 2JWZA 4BKSA 1UBQA 2G45B 2MBQA 5GMVA 2KTRB 4RM9A 1GUAB 3EFUA 1AARA 3EHVA 3IG3A 5CHVC 4WJOA 3U7DA 1V6EA 2Z0DB 3VH3B 4BOZB 2DENB 4M0WB 4ZYNA 3V60A 4KVGB 4K81A 3R7QA 1YJ1A 5G2NA 3PV1A 1WF9A 2GBRA 4GB9A 1V81A 2VRRB 3WA0A 4RM8A 2LUEA 1BT0A 2L3ZA 3A1QA 4CYEA 2KJHB 3DVGX 4BFRA 5KHQA 1GNUA 1A5RA 5CX3A 2LRWA 2K25A 3EECA 1E8ZA 2JRIB 2D10A 3VTWA 4NNJB 3PLVA 2LXCA 1WY8A 2KHWB 2MQJA 2NR2A 3C0RB 3ZNID 2MSED 3DBRI 3DBHI 3PTFC 2IO0B 1J0GA 3DDCB 1Z5SB 3X0WA 4M8MA 2ZZPB 2L0TA 4GN1A 1L7YA 2KQ7A 3NHEB 2KTFA 4K7SA 1KOTA 3QHTA 1T0YA 1R4MI 2D07B 1WXVA 2FCSA 2N7DA 4HVBA 3SDLC 4A3PA 1TBEA 4WQOB 2KX3A 4TQ0A 1IP9A 2ZJDA 2R2QA 2XK5B 3CSFA 5HKHA 3V62A 1Q1OA 2XEWA 1ZKHA 4AUQC 2GMIC 3ZVVA 2MRPA 1WRDB 4RMAA 3ZRFA 5C1ZA 3V61A 1E90A 3RUIB 3H1UA 5J2RA 1LM8B 2DAFA 3A4RA 3R7RA 3O65B 4X57B 1P0RA 1RLFA 1WMHB 3OAWA 3PRZA 3L17A 4W9LA 5CTRC 1GJZA 5E6OA 4IWPA 2KWUB 2OJRA 3CF6E 4IG7B 4FHKA 4W9FA 3B08A 3IVFA 2NBUA 4J6IA 3ZNHB 2OOBB 4FJZA 1F9JA 4ANXA 2HE7A 3U8ZA 2W9NA 4FJVB 1TZ1A 2GOWA 2DZIA 4GDLA 2N7EA 2O6VD 3H7SA 3H6NA 3QJZA 5IAAC 1XD3B 1R4NI 4MELA 3L13A 1OEYJ 2JPHA 2HTHA 3L08A 3TJPA 3VTUA 4BKSD 1WJ6A 2G4SA 5C23A 4LCDE 4DHZB 3DVNV 3VQIA 2LGDA 3AU5A 2KMAA 3ZRCA 4URKA 2LI5A 4PS3A 1U4AA 4MEMA 4BOSC 1UZXB 3ZNGC 1YX5B 1V49A 4W9CA 2FUHB 5BO4B 1YQBA 2DYOA 2KFJA 2AL3A 3RT3B 3TIXA 4JQWC 5DPTA 2CS4A 3KVFB 2V4LA 1WR6E 1Q5WB 4GDKB 4GGQA 4WJNA 3QARA 2CHWA 3WANA 4B95A 2KWVB 4F8CB 1WGGA 1WM2A 4KIKB 4A20A 4E3CA 2R2OA 5LXIB 1C3TA 3ZDMC 1WJNA 4BKGA 2GBJA 3DQVA 3PPAA 3VXWA 3ZTDA 2BYVE 4E74A 3OJ3A 1WXMA 1K8RB 3VUYA 2Z0EB 2KQSA 1WYWB 2FAZA 3VUXA 4E71A 2KDBA 3LDZE 2WWZA 4BVUC 3JSVA 2ZPNA 3N3KB 3KW5B 5DPWA 3B0AA 3ZIMA 1J8CA 4ZRKA 3M3JA 1SIFA 2BKFA 4ANWA 1ZW7A 2FNJB 2C7MB 2YLMA 2XBBC 2KNBA 3TMPB 4NY0A 4NJ6A 2N4FA 3H9DA 2O6VA 3HM6X 3RYTA 1RRBA 4KZ0A 2KKCA 4WAAA 4DBGA 4M8NA 4BBNF 2K6QA 1OQYA 3QCAA 5FR6A 3VHTC 2BWES 3I3TB 3DCGA 3N30A 3R66C 4XZ4A 3L0WB 2BKRB 4HPMB 3NS8A 5D7GA 5L83A 1FXTB 2BPSA 1S1QB 4EZJA 3GOEA 1VCBA 3DBSA 3HM3A 1CMXB 4DDID 3DPDA 2BF8B 2MA9B 3ML9A 5AZGA 3Q3FA 3DVNU 3H7PB 1P1AA 1Z2MA 4IW0A 2CHXA 1Q0WB 3UGBB 4WWOA
chains in the Genus database with same CATH superfamily
2Z59B 5DPRA 4MSQB 4GXBA 4MM3A 5TSSA 1Y56A 4DDGD 5E6PA 3PLUA 2KTRA 2G1EA 5E6JA 2WXLA 3ECIA 4DXGA 4NJCA 2JXXA 2WP9B 3WALA 4M0WA 3ALBA 2FIDA 4EUTA 4MGYE 1UBIA 2I2YA 4AWJA 4XE0A 1NEKB 4NQKE 2Y5PA 3KH0A 3P4SB 3VH4B 3NVYA 3GE3C 2PE6B 2MW5A 1AYFA 2CKHB 3RNAC 5DCNA 3TEWA 1FXAA 1QF6A 4WURA 1GAQB 5AZFA 1RAXA 2EKEC 2QMTA 1UELA 3KWLA 1QT9A 2LRUA 2ZPYA 3VR9B 2A5UA 1I35A 1FD6A 1WSPA 3GS2A 5FKAC 4HPLB 3RD2A 2IO3B 1E8WA 1S3SG 1WE6A 2J53A 1YIWA 1D3ZA 1NDDA 4P7IA 1UWXA 4C7ZA 3U30A 1JMLA 3SFEB 1L2NA 2K5PA 1G6JA 1KM7A 1YQ4B 2J0JA 2UYZB 4WJPA 1VZ6A 2KACA 2RMMA 1GB1A 4C80A 4HJKA 2PVOD 1SF0A 2A4ZA 4HDOA 2V9HA 4ZDVA 4RGMA 2RDGA 2WXMA 4GDKA 1TGZB 1XLPA 4YL8A 3UIPB 2MWSB 1UGMA 3Q3MC 3ZXRA 2RSUA 3ZTCA 2L8JA 1LQBA 3AE6B 2KOXA 3AULA 3KYDD 2IYDB 1ET6A 2ZVOA 2ZVNA 1PGBA 4WQMA 4XX5A 4C4VA 1ESFA 1L5PA 3N9YC 4M02A 2WX1A 2VZKB 1I7HA 1E5WA 1KLGD 4OVVA 5EDSA 4C56C 2L0FA 2K1FA 1ENFA 2LASA 3WAPA 4UDUC 5G55A 4JIOU 3X23A 2IJ0A 2VH1A 4B9KA 5HG2A 4N9F4 2D5GA 3H8HA 4A3OA 4DXAB 3H7PA 2MBHA 5T8IA 2ZW1A 1JQ4A 4KDIC 1YD8U 2ICIA 3ZW3A 3HHMA 3PREA 2EMTA 3NJTA 1V1PA 2DX5B 1TTNA 4HXDA 1CZPA 1PUTA 5JHBA 4II3B 3Q3NC 2EKIA 2ZNVC 3TCAA 2RPQA 3TSSA 2JYTA 2W55A 1XXGA 3UIOB 4XWWA 2ZW0A 3NY5A 1UGJA 1WXQA 3GE8C 1TY0A 1TJEA 3ZNZB 3UQAA 3P4RB 3ZUNA 1FRDA 1V8CA 2GBNA 1V5TA 1UD7A 5D6JB 2K0PA 4IWOA 1WX9A 2KC2A 4A90A 1C9FA 5AUKA 2MHJA 4HRSA 2N0SB 4WWMA 4GIVA 2WU5B 4BKTA 4G3XB 1WGDA 4O1NA 4MH0E 4GSWA 3UQBA 2L00B 4PK1A 4OZCA 2KO3A 4ZHPA 5FK9C 2WXGA 1H4RA 3IBEA 1FNWA 3EUB2 3V60A 2JY6A 3PHWB 4TKNA 4TV3A 2LHEA 3VR8B 4DHZE 1TS4A 2AYOB 3KUCB 4PYZA 3RN9C 4EFOA 1JCKB 1XCQL 4TMAB 4W9EA 1IYFA 1LFDA 2KMCA 3GZNI 3M62B 4K1RB 5BYQA 1VRAB 1ZP0B 3PZDA 1EU4A 1QOFA 1DOYA 3N20C 1GC6A 2JUOA 1D4BA 2PVGC 1SXTA 3ZKJC 4NAWA 2NVUI 3ZLZA 2N9EB 1WXSA 2O2VA 1UUPA 3S2AA 5HFYA 3N1YC 3PRMB 3CSTA 4G50A 3PSEB 3IAM1 1ISNA 3AE2B 1MI0A 2BB6A 2MJEA 1NYRA 2MBQA 5GMVA 1T0RC 3EFUA 1P7EA 1SSNA 4BOZB 3VH3B 2DBYA 2PMVA 4KVGB 1E0ZA 3R7QA 1QQRA 1WF9A 2Z8LA 4GB9A 2BT6A 1CK1A 3GB1A 4ZYSA 3A1QA 3GP7A 4CYEA 2KT7A 3MP9A 5KHQA 1GNUA 1A5RA 5CX3A 4RF1A 2LRWA 2LJIA 1IGCA 4ZHOA 4NNJB 2LXCA 1WY8A 2KHWB 2E3TA 3DBRI 1J0GA 2QILA 2V3PA 3DDCB 1SJHD 3RI7C 1L7YA 2CU3A 2N7DA 2FCSA 4J3OD 4WQOB 1MJDA 2R61A 2INNE 4JX1C 1D5XC 3ZVVA 2JWUA 1E90A 4X57B 1RLFA 3PRZA 1GJZA 3R2TA 5E6OA 2KWUB 1YN4A 4W9FA 1C77A 3B08A 3ZYYX 4A9AA 1NENB 3H7SA 3QJZA 2CJNA 2WXNA 1XD3B 2HTHA 2PW9A 1WJ6A 4DHZB 1QLBB 2LGDA 3AU5A 2KMAA 5BMHA 3AM9A 4MEMA 3AN1A 3OG5A 2PKOA 4W9CA 1YQBA 3RFZB 3DBLB 3QARA 4B95A 2KWVB 2NTTA 1FCCC 3Q69A 2LUMA 5H8YE 3KLSX 3LDZE 4OZAA 1FO4A 3P42A 2ZPNA 2XN9C 3I5JC 1JW9D 2QJLA 2WXHA 2YLMA 4LNKA 3RNCC 4C00A 2O6VA 2B76B 1OQYA 5FR6A 3R66C 1YN3A 1KTKA 1HEZE 1S1QB 3MC8A 1T0SC 2WDQB 3MHZA 1KFYB 2BF8B 5AZGA 1RM6C 4P6VF 2X38A 3C8YA 2LGIA 2N1VA 1FNVA 2KFKA 2WDRB 3RULA 5MPOA 1FXIA 3MTNB 3JVZX 1BMLC 3MFGA 2D3CA 1FMAD 4RGOS 1WFYA 3RCZA 3EGRA 3K9PB 3AE1B 1WIAA 2WXPA 2IGHA 1TT5B 2KVZA 4IM3A 2RGFA 2KZRA 3NZ3A 2AX5A 4BBNC 2D3GA 3AXCA 2ASQA 2JXTA 3BK1A 2QEJC 3PGEA 1YJJA 4HROA 2EMSA 3AE4B 4G0NB 5EE0A 1HTOA 3T3NA 1HZ5A 2HJ8A 2WXQA 3AB5A 3W5VB 4RH6A 2KVRA 2XK5A 2BVCA 2N7JA 1JWSD 2KN5A 2QIEB 2JRHA 1EF5A 2N9XA 2ZNVB 3K9OB 4YTPB 1KRHA 1WMHA 1PYWD 4W9KA 2LWPA 5AZHA 4EKUA 1OFFA 2MJ3A 4WJQA 1E8XA 3DVGY 2MCNB 1OQRA 4MJSA 2RPVA 2K39A 4WWNA 2W3SA 2V1YA 4I6PA 1J19A 2J0KA 1I4RA 1ZGUB 2W3RA 2B3AA 2K8HA 2ACZB 4BZAA 3W9CB 4M00A 2KXJA 3U7ZA 1J7BA 4KV2A 3WAMA 2XNAC 3A9KB 3AEFB 1T6BX 2WNMA 4ICVA 2Y5BB 2CJOA 2BGFA 4KGTA 5AEKB 4W9IA 3A33B 3PHXB 4AOFA 3Q2AC 2WS3B 1IPGA 2ONQA 2O6VB 4RNAA 3Q8EA 1EF1A 4F7ZA 4KDLB 2WDTB 4PT5A 3U4EG 2N9PC 2BBCA 2MBEA 2NTSA 3V6CB 2HD5B 4M01A 1Y8RC 5IOIA 1KLVA 1YMHE 1E9MA 4W9GA 1UNSA 1FPYA 4IUMB 4ASWC 3I57A 4HLEA 1FM0D 1MHHE 3PVLA 1MG8A 3OLMD 2DNFA 3NOBA 3KUDB 1WX7A 1C79A 2L05A 3KQ4A 2KJ6A 2KDIA 3PT2B 4CHKA 4RFBA 1JRUA 4EOYA 2IDYA 2G3QB 3EA6A 1JROA 5BYSA 5L95C 1V9JA 3AEGB 2DZJA 1AW7A 4XYCA 3CIRB 3SEBA 2H89B 2KQ4X 4KGSA 1JWMD 2DYBA 1SIJA 2DYMA 1ZE3D 4US9A 1SE9A 1YNTE 3NS1A 4HCPB 4GDLB 2I1JA 3ZO5B 3HIZA 3P4PB 1SGHA 4XC2A 1E8YA 1OTRB 2IGGA 2BYFA 4FULA 2MX2A 1EO6A 1V86A 2CR5A 4ANUA 2OJWA 2KX0A 2MBOA 3FILA 2KYWA 3DOWA 4KSLC 1WZ3A 3OWEB 1E7UA 4MJSB 2FCQA 3BIID 1C4CA 2LD9A 3ZJVA 5JZEB 2KDEB 1J7CA 2J0MA 4C7YA 1WR1A 1OEYA 3D32A 2AQ3B 3A9JA 3Q6BA 1ACCA 1ROEA 1QILA 4NQLB 2PIAA 3IFWB 3ETRA 4EZKA 5TR5A 1C76A 3E56A 4FA6A 2ZEQA 4BAXA 3ZDTA 5I4DA 5BMIA 1OGWA 1UH6A 2M0AA 2DZMA 1C78A 1EUVB 2J42A 1CJEA 1MG4A 3IT6B 2WHIA 2WGSA 4KX6B 2LGYA 3IHPC 2IY1B 3UINB 2N9KA 2K8CA 2KD0A 1KH0A 3ZXVA 1FIQA 2WXRA 4MM3B 3VUWA 4ANVA 1HE8A 4GU2A 2JWZA 2N9LA 1UBQA 2KTRB 4RM9A 3AEBB 1SEBD 3IG3A 4WJOA 3U7DA 1V6EA 2Z0DB 3TEXA 4M0WB 4ZYNA 3E9SA 1CQVA 4B0MA 1FRRA 1HZ6A 3URYA 2LUEA 2KJHB 3DVGX 4N6EB 1TKYA 3EECA 2D10A 3L4PA 3VRAB 1AWDA 1BUIC 5BYRA 4LLGM 3DBHI 2IO0B 2LGSA 4REZA 4M8MA 2LHDA 2L0TA 2LFIA 4D2KA 2EELA 3NHEB 3PO0A 4P1CC 2RDHA 1R4MI 1YQ3B 1WXVA 2D07B 3SDLC 3B2FA 1TBEA 4A3PA 1IP9A 1P7FA 2ZJDA 1AN8A 5HKHA 1Q1OA 1N6ZA 1SBBB 2PLPA 5FR3A 2MRPA 1I4XA 4YTNB 1E6EB 3V61A 5C1ZA 3H1UA 3VRBB 1UWMA 3L17A 1L4ZB 4W9LA 4A8XC 3LB8C 2NBUA 1TIFA 3DHGC 1F9JA 3IXSA 2DZIA 3PZ7A 2N7EA 1L0XB 3U2SC 3H6NA 4IOIE 2UU7A 1DOIA 1R4NI 5IAAC 3V05A 3L08A 2HTME 2JPHA 3FAHA 3ZRCA 2MEKA 4URKA 2LI5A 3BYTB 4PS3A 4LK0M 1IBXA 2FUHB 5H92C 2DYOA 3RT3B 2CS4A 3KVFB 3GZNB 4GDKB 3WANA 1VLBA 2V4IB 4DQOC 1K51A 3AMZA 2H88B 4CQNA 1BXTA 1C3TA 5LXIB 4RGNA 3LYYA 1WJNA 2GBJA 3AE8B 3DQVA 3VXWA 4E74A 1K52A 3VUYA 3U52E 3UI3A 3JSVA 4C4VB 1TKGA 5DPWA 2L1AA 3M3JA 4ANWA 4JE3B 2FNJB 2V0GA 3AEAB 2XBBC 3Q8AA 3RYTA 1QOBA 4WAAA 3TEZA 3I3TB 2INPE 2L52A 1RYJA 2BKRB 3WCQA 2MA9B 3B9JA 3ML9A 4ZOHC 4WIPA 3Q3FA 1B9RA 3H7PB 3ONSA 2BQQA 4AJYB 3DBRB 2LVQA 2J4XA 5D2MB 1WGKA 4Q2JA 3BVZA 1XLOA 1V1PB 1TZOA 3LXFA 2D2QA 2M8SA 3AE7B 4DHJD 2NPTA 2JT4B 1V2YA 3V6EB 2I1KA 2KWCA 3BY4B 4MSMB 5EE9A 4KKIA 2ZCBA 5CHFA 4JPSA 2BTEA 2M4NA 4NPNA 2UWQA 1LXDA 2INDC 4ZRQA 1NI3A 2DHZA 1ET9A 1WXAA 2INCC 1WGYA 3APFA 2KDFB 3BINA 4FN2A 1X1MA 2K3UA 2AWTA 5J17A 4JLCA 1EM7A 3W1YA 4A55A 4OZBA 2LJ5A 3P1MA 4K7WA 3KWVA 5KHOA 5IA7A 2IGDA 2IY0B 2QHOA 3AE9B 2RDBC 2C9WB 4W9HA 4ICUA 1F52A 4S0RA 2ZCCA 4L23A 3JW0X 2PE9A 1YOVB 2MP2A 3KUZA 4ZRJA 3FKYA 4ZRIA 3RNEC 2K9XA 4YSZB 3A4SC 4MT5A 1P3QU 4NAWB 1VZ7A 1P9DU 4FBJB 2C5LC 2LVPA 2O2VB 2REXA 4TQ1A 2WXIA 1L4DB 1M4VA 1WGRA 1XEEA 3VAWA 4YXDB 3NVWA 3L16A 3LJ3A 4KIKA 1SB3C 2LGXA 3B1LX 2X8XX 2M17A 2KLCA 5LNK1 2GRIA 4W9DA 1B1ZA 1KJTA 4PYUA 4YSXB 1PGAA 2M1MA 2WYQA 4LNOA 2K6DB 2GI9A 3A1QB 1MPEA 2LXAA 4MGZE 3QWZB 1LGRA 1N63A 3PS6A 3VTVA 3RNFC 5G5GA 4YTMB 4RGTA 2KN4A 2NPTB 1ZXIA 2JZZA 4IM0A 2PEAA 2PPHA 2SAKA 4EZLA 1LO5D 2YVCA 4K7UA 4ZRPA 3UF8A 4NJ7A 4W9JA 1VJKA 3L54A 4II2B 2L32A 1WJ4A 4WAFA 1RFAA 4LJOB 3N1XC 1L0VB 2BYEA 3R2IA 4IWQA 4LDTB 2L76A 1WE7A 2LMCA 2FCMA 2LZ6A 2C7HA 3DWGC 4GMVA 4CO7A 4OHJA 4OVUA 3WAOA 2BB5A 2KWDA 2G4DB 2C60A 2IO2B 2M0XA 1WM3A 1N61A 5JHAA 2D11A 1FEHA 1NBFC 4EEWA 5IP4D 4B0EA 5LXHA 3SFDB 4HPPA 2MLBA 4IM2A 2IBIB 2KK8A 2JVCA 1N5XA 3VFKA 4PS8A 3MHSD 3AH7A 2RD0A 1V5OA 4F1SA 2OEDA 1TS3A 4YT0B 1SJED 1QOAA 2BS2B 2MP2B 3RNGC 1F77A 1GPXA 3AECB 1N5WA 1M94A 3SHQA 2E6XA 3QAQA 4WWPA 1WGHA 1YX6B 1WZ0A 2JZ3B 1D5ZC 4DK5A 3NZSA 4FLHA 1JWAD 3PZ8A 1SE4A 4R3DA 3HRDD 2MBBB 4HDQA 2WXJA 1XT9B 4A6QA 2DLBA 2DWQA 3DWMA 2AEHA 1WX8A 1D6EC 2PTLA 3QX1A 4XGAB 3SU8X 1P98A 1VD2A 2BWFA 3PRPB 2NBVB 2K22A 4HCNB 1OQQA 1NYQA 3W1SA 2WDVB 2GB1A 2IPKD 2KFKB 3I9V1 1DGJA 1L0YB 5GXGB 4BKSA 3EHVA 4MH8A 2VRRB 3WA0A 4RM8A 2JZPA 4BFRA 4NZLB 2W82A 3VTWA 2MQJA 3C0RB 2NR2A 3ZNID 1DYQA 4FXCA 5IKCM 4L1BA 2ZZPB 4GN1A 2SEBD 4K7SA 2KQ7A 4JWUC 1KLUD 1KOTA 3R8BA 2QDFA 4KKJA 2KX3A 4AS1A 2XK5B 3CSFA 4P16A 1ZUD2 1K53A 2XEWA 1UF0A 3Q8BA 1WRDB 1T3QA 3ZRFA 1RFKA 1LM8B 2DAFA 3R7RA 3O65B 1WMHB 5CTRC 4IDIA 4XWTA 1PGXA 2OJRA 4ACFA 3IVFA 4J6IA 1IGDA 3U8ZA 1TZ1A 2FBWB 3L13A 1OEYJ 3TJPA 3VTUA 4BKSD 2QCZA 2G4SA 3DVNV 3BYYB 3VQIA 3Q8CA 1UZXB 3ZNGC 1YX5B 1V49A 2HJ1A 1E7PB 5BO4B 2KFJA 2AL3A 1QOGA 4JQWC 1Q5WB 4GGQA 2CHWA 3MJ5A 5D3DA 4F8CB 1WGGA 1DOXA 1WM2A 2JX5A 2VZKD 2NMQA 3ZDMC 2BW2A 3Q3OC 4MACA 2BYVE 1WXMA 2Z0EB 1EWCA 3AV8A 3VUXA 3AEEB 2KDBA 4BVUC 2J52A 4DXFA 3B0AA 1E10A 4ZRKA 1SIFA 2BKFA 1JWUD 2KNBA 4NY0A 4NJ6A 2N4FA 3H9DA 1RRBA 4DBGA 3AE3B 1K50A 5EE1A 3DCGA 2FE8A 4HPMB 5L83A 5D7GA 2BPSA 2YEPB 3HM3A 3DHHC 4LNIA 4DDID 3DPDA 3RMKC 2Q5WD 1XF5L 1Z2MA 3Q8FA 3UGBB 4OW0A 4WWOA 1E7VA 4PS7A 5EE3A 2FIFA 3QQ8B 4FADA 3DBHB 1D5MC 1FFVA 3AI5A 2GBMA 3QC8B 1KF6B 1R4MB 4MGIE 2VH2A 1WRIA 1WJUA 4N58A 4YSYB 2BS3B 3ENEA 2KJRA 3BVGA 4TUUA 4N59A 3B2GA 3RZFA 5IO9A 3APCA 2WU2B 1NI2A 1VDVA 2IZVB 2C7NB 4G11A 5HI1A 3ZGZA 3FILB 2PJHA 4MGKE 5LLIA 1PFDA 2NS5A 3M63B 2M56B 1XCTL 3TEYA 3ABVB 2K8BA 4HJGE 1T5XD 2L7RA 1R4NB 3N32A 2L83A 4KSKC 1V80A 3VVWB 3IAS1 3ZQ4A 3P63A 4TSSA 1F2RI 3BK2A 1XO3A 5C3JB 1XLQA 4US8A 1I4PA 3A9JB 1NVID 2V3SA 3ML8A 3TBLD 4I6LB 1L6VA 3T8MA 2IO1B 5CHWA 4HWIB 5D94A 1QZEA 4USAA 1QKZA 4LTUA 4S17A 1N60A 3WIMA 3OJ4B 3QK0A 4JGHB 3DHIC 5DPSA 3QA8A 4MDKE 1PQSA 4XDDA 4JL9A 2WXFA 5E6NA 2AQ2B 3RPFC 3VDZA 4HK2A 2ON8A 2RR9A 3ZJUA 2WQYB 3EC8A 3MJWA 1GC7A 3JYUA 4H2AA 4IC7B 2WX0A 3NZUA 3M95A 1I4QA 1TYGB 1TY2A 1HXYD 3HK0A 2AL6A 2NBWB 1VZ8A 5JXVA 2LVOA 2MJDA 4AQ7A 3NRZA 3BZDB 3T9LA 1IUEA 4HEA1 2D3AA 3N1ZC 1I42A 1H8CA 1YJIA 4KZCA 3AEDB 1MHXA 1F1HA 2J7QB 1N62A 1XQQA 4K3BA 2KANA 4HKZE 4EE2A 2DZKA 4QAYA 4HKQA 2KC1A 2BS4B 1GG3A 1SE3A 3SR6A 1WWTA 1HQRD 4L2YA 3APDA 1ZDVA 2V3NA 1WI0A 4GOCA 5JH5C 3I63C 1C1YB 1YN5A 1GOZA 1IBXB 1ZPSA 2AQ1B 3TUOA 3NVVA 5HHDG 4DHJB 5AUIA 1RWSA 3AU4A 2N1WA 2JQRB 4AP4C 1HA5A 2KAJA 3QIJA 1MVKA 5D3IB 3HUIA 4DWFA 2KLGA 2QC8A 5J18A 2WLBA 2WXKA 4LJPB 1WH3A 2Y3AA 4LNNA 3W1SC 3L10B 2BYTA 2KMMA 4KGRA 2JF5A 4FJYA 3RZWC 3TL5A 2CU1A 3JSVB 3FC4A 2GBKA 3W5UB 1JWBD 4AJWA 4FHJA 1TKEA 3P2BA 2G9HD 4I6NB 3NUHB 3DBLI 3RNBC 1EWYC 3KYCD 3CMMB 1ZOYB 2FCNA 2CHZA 3R3MA 2NCNA 3Q3JA 1XLNA 3C19A 4K3CA 3A9KA 4B6WA 4OVZA 2Y5CA 2JSVX 3SD5A 4LDTD 2M19A 2DAJA 1I4GA 2WXOA 1V97A 3AE5B 2G45B 3HVDA 1GUAB 1AARA 1VR9A 5CHVC 2KDMA 1C4AA 2DENB 3MC0B 4K81A 3W2DA 1YJ1A 5G2NA 3PV1A 2GBRA 1J7AA 1V81A 5IN7A 1BT0A 2L3ZA 2W54A 4GLSC 4NAMA 1ZDXA 3HVZA 2K25A 3O13A 1E8ZA 2JRIB 3PLVA 1I4HA 5C2TB 1F2RC 2D3BA 2MSED 3PTFC 3X0WA 1Z5SB 1STEA 4ITKA 2LEKA 3EFCA 3NVZA 2KTFA 3QHTA 1A70A 1T0YA 3MC9A 4HVBA 2GLSA 4TQ0A 1T0QC 2R2QA 3V3XA 1Q10A 3V62A 1WYGA 4XDCA 4JWSC 1ZKHA 2MH7A 4AUQC 2GMIC 2FUG1 4RMAA 3RUIB 5J2RA 3A4RA 3Q14C 1P0RA 3OAWA 4ARCA 1L6UA 4IWPA 4IG7B 3CF6E 4FHKA 3P4QB 1PDXA 2QSDA 3ZNHB 2OOBB 4FJZA 4ANXA 1EU3A 2HE7A 2W9NA 4FJVB 1R7SA 2YEPF 3CWIA 2GOWA 1C4PA 4GDLA 2O6VD 4IKGA 1ZXHA 4MELA 2HDEA 4YWGG 5C23A 4LCDE 1HTQA 4ARIA 1TS5A 1U4AA 4BOSC 3TIXA 5DPTA 2V4LA 4RCOA 1WR6E 5BMGA 4WJNA 2I38A 4KIKB 4A20A 4E3CA 2R2OA 1GB4A 4BKGA 3PPAA 3ZTDA 3OJ3A 3T3OA 1TS2A 1K8RB 2KQSA 3BVMA 1WYWB 2FAZA 1V1OA 4E71A 3BWUD 2WWZA 3N3KB 3KW5B 4WH4A 3ZIMA 1J8CA 1F0ZA 1FCLA 1ZW7A 2C7MB 1FFUA 1MFWA 3TMPB 1JALA 1FNUA 3HM6X 4KZ0A 2KKCA 4RF0A 4M8NA 2OHFA 4BBNF 2JU6X 2K6QA 3IT4B 3QCAA 3VHTC 2BWES 3N30A 4LNFA 4XZ4A 3L0WB 3NS8A 1FXTB 4EZJA 3GOEA 1VCBA 4P1BC 3DBSA 1JRPA 1CMXB 3NG0A 3ZJTA 2TSSA 1SE2A 5G5HA 3DVNU 1P1AA 4IW0A 3J9CA 2CHXA 1Q0WB 2JYEA
chains in the Genus database with same CATH topology
2Z59B 3ONSA 1E7VA 2N1VA 4AJYB 5DPRA 4PS7A 4MSQB 2FIFA 3QQ8B 4FADA 2KFKA 4GXBA 2LVQA 4MM3A 5D2MB 3RULA 3TL5A 3MTNB 3JVZX 4DDGD 3AI5A 5E6PA 2GBMA 3QC8B 3PLUA 2KTRA 2D2QA 2M8SA 4DHJD 2NPTA 1WFYA 4MGIE 2JT4B 3ECIA 2JXXA 3RCZA 1WJUA 3WALA 3K9PB 3ALBA 3ENEA 2KJRA 2FIDA 4TUUA 1WIAA 1V2YA 4EUTA 3V6EB 2I1KA 2KWCA 4MGYE 3BY4B 1UBIA 4IM3A 4AWJA 3RZFA 2RGFA 3APCA 4NQKE 2KZRA 4MSMB 3KH0A 3VH4B 1NI2A 4BBNC 2IZVB 2PE6B 2ZCBA 5CHFA 2C7NB 2MW5A 2D3GA 3AXCA 2ASQA 2M4NA 4NPNA 2UWQA 4G11A 2CKHB 3PGEA 5DCNA 1LXDA 2PJHA 4MGKE 5LLIA 2EMSA 2NS5A 3M63B 2DHZA 5AZFA 1RAXA 1WXAA 4G0NB 1WGYA 2K8BA 3APFA 2L7RA 2HJ8A 3N32A 2KDFB 3BINA 4FN2A 1X1MA 4KSKC 2AWTA 1V80A 2KVRA 2XK5A 3VVWB 5J17A 4JLCA 3W1YA 2KN5A 2EKEC 1UELA 2LJ5A 2JRHA 1EF5A 4K7WA 2N9XA 5KHOA 5IA7A 2ZNVB 2LRUA 2ZPYA 2IY0B 3A9JB 3K9OB 2A5UA 1I35A 2V3SA 3ML8A 1WMHA 2QHOA 3TBLD 2C9WB 4I6LB 4HPLB 4W9KA 3RD2A 2IO3B 2LWPA 1E8WA 5AZHA 4EKUA 4W9HA 1S3SG 4WJQA 1E8XA 1WE6A 4ICUA 3T8MA 2IO1B 3DVGY 1YIWA 2ZCCA 2MCNB 4MJSA 3JW0X 1NDDA 2PE9A 4HWIB 5CHWA 5D94A 4P7IA 2MP2A 1D3ZA 3U30A 2K39A 3KUZA 4WWNA 4ZRJA 2V1YA 4I6PA 1L2NA 1QZEA 1J19A 2J0KA 4ZRIA 1ZGUB 1G6JA 1KM7A 3A4SC 2B3AA 2K8HA 2J0JA 2UYZB 1P3QU 4NAWB 1P9DU 2KXJA 4WJPA 4FBJB 4KV2A 3WAMA 2C5LC 2LVPA 2O2VB 2REXA 4TQ1A 3WIMA 3OJ4B 3QK0A 3A9KB 4JGHB 5DPSA 4HJKA 4ICVA 3QA8A 2Y5BB 4MDKE 1PQSA 1WGRA 2A4ZA 4HDOA 2BGFA 4ZDVA 4JL9A 5AEKB 4W9IA 3A33B 3PHXB 4GDKA 4AOFA 3VAWA 1TGZB 1IPGA 5E6NA 4YL8A 3L16A 3UIPB 3LJ3A 2O6VB 2MWSB 3VDZA 4HK2A 1UGMA 4KIKA 2LGXA 1EF1A 4F7ZA 3B1LX 2RR9A 2RSUA 2WDTB 4KDLB 3ZTCA 2L8JA 2N9PC 2M17A 1LQBA 2MBEA 2KLCA 2KOXA 3AULA 3V6CB 3EC8A 3MJWA 2HD5B 3KYDD 4W9DA 1Y8RC 2IYDB 1KJTA 4PYUA 1KLVA 2ZVOA 2M1MA 2WYQA 2ZVNA 1GC7A 2K6DB 4XX5A 3JYUA 4W9GA 4IC7B 2WX0A 3NZUA 3M95A 4IUMB 3A1QB 2LXAA 4MGZE 4ASWC 3QWZB 4HLEA 3PS6A 3PVLA 1MG8A 3OLMD 3NOBA 3KUDB 2WX1A 3VTVA 1WX7A 3HK0A 1E5WA 5EDSA 4OVVA 2AL6A 2NBWB 2L05A 2L0FA 2K1FA 2NPTB 2LVOA 2LASA 2JZZA 2KJ6A 4IM0A 3WAPA 2PEAA 2PPHA 2KDIA 4EZLA 3PT2B 3T9LA 2YVCA 4JIOU 4K7UA 5G55A 3X23A 3UF8A 4CHKA 4EOYA 1JRUA 4NJ7A 4W9JA 3L54A 4II2B 1WJ4A 1RFAA 4B9KA 2G3QB 4N9F4 1I42A 1H8CA 4KZCA 4LJOB 4A3OA 2BYEA 4DXAB 3H7PA 4IWQA 5L95C 4LDTB 1V9JA 2MBHA 2J7QB 1XQQA 2DZJA 2KANA 1WE7A 2L76A 1YD8U 4KDIC 3ZW3A 3HHMA 2FCMA 2DZKA 2LZ6A 2C7HA 3PREA 2EMTA 4GMVA 4CO7A 2KC1A 2DX5B 2DYBA 1TTNA 4HXDA 2DYMA 4OVUA 3WAOA 1GG3A 2G4DB 5JHBA 1SE9A 4II3B 2C60A 2IO2B 4HCPB 2M0XA 2ZNVC 1WM3A 3TCAA 5JHAA 2D11A 2RPQA 4GDLB 1NBFC 2I1JA 4EEWA 3APDA 3UIOB 3NY5A 3ZO5B 3HIZA 1WI0A 5LXHA 4GOCA 4XC2A 1SGHA 5JH5C 1E8YA 1OTRB 2MLBA 4IM2A 1C1YB 2IBIB 3ZNZB 2BYFA 2KK8A 3UQAA 2JVCA 4FULA 2MX2A 3ZUNA 1EO6A 3VFKA 1V86A 2CR5A 4ANUA 2GBNA 2KX0A 4PS8A 1V5TA 4DHJB 2MBOA 3MHSD 1UD7A 5D6JB 3DOWA 2RD0A 3AU4A 4IWOA 4KSLC 1V5OA 4F1SA 1WZ3A 1WX9A 2KC2A 2N1WA 1E7UA 4MJSB 4GIVA 2MP2B 4BKTA 2FCQA 4AP4C 4G3XB 2LD9A 1WGDA 3QIJA 4MH0E 4GSWA 3UQBA 2L00B 5JZEB 2KDEB 4DWFA 2KLGA 2KO3A 5J18A 2J0MA 4LJPB 1WH3A 3W1SC 1M94A 3L10B 1WR1A 3SHQA 1H4RA 3IBEA 3QAQA 4WWPA 2JF5A 4FJYA 1OEYA 1WGHA 2JY6A 3D32A 3PHWB 3RZWC 1YX6B 1WZ0A 4TKNA 2CU1A 3A9JA 4TV3A 3JSVB 2JZ3B 4DHZE 2AYOB 4DK5A 3KUCB 3NZSA 2GBKA 4PYZA 4EFOA 4FLHA 4AJWA 4NQLB 4FHJA 3IFWB 3P2BA 4W9EA 1IYFA 1LFDA 2KMCA 4I6NB 3GZNI 4EZKA 3M62B 4K1RB 2MBBB 3DBLI 5TR5A 3PZDA 4FA6A 2ZEQA 3KYCD 4HDQA 1GC6A 3CMMB 2JUOA 3ZDTA 1XT9B 2FCNA 1OGWA 1UH6A 2CHZA 2NCNA 2AEHA 2NVUI 3Q3JA 3R3MA 4NAWA 3ZKJC 2N9EB 3ZLZA 1WXSA 1WX8A 2O2VA 2DZMA 1EUVB 3A9KA 3QX1A 3S2AA 3SU8X 1P98A 1VD2A 4B6WA 2BWFA 2LGYA 3PRPB 3IHPC 3PRMB 2NBVB 4HCNB 2IY1B 3UINB 2K8CA 3W1SA 2KD0A 3SD5A 3CSTA 4G50A 4LDTD 3PSEB 2KFKB 1ISNA 2DAJA 3VUWA 4ANVA 1HE8A 4GU2A 2JWZA 4BKSA 1UBQA 2G45B 2MBQA 5GMVA 2KTRB 4RM9A 1GUAB 3EFUA 1AARA 3EHVA 3IG3A 5CHVC 4WJOA 3U7DA 1V6EA 2Z0DB 3VH3B 4BOZB 2DENB 4M0WB 4ZYNA 3V60A 4KVGB 4K81A 3R7QA 1YJ1A 5G2NA 3PV1A 1WF9A 2GBRA 4GB9A 1V81A 2VRRB 3WA0A 4RM8A 2LUEA 1BT0A 2L3ZA 3A1QA 4CYEA 2KJHB 3DVGX 4BFRA 5KHQA 1GNUA 1A5RA 5CX3A 2LRWA 2K25A 3EECA 1E8ZA 2JRIB 2D10A 3VTWA 4NNJB 3PLVA 2LXCA 1WY8A 2KHWB 2MQJA 2NR2A 3C0RB 3ZNID 2MSED 3DBRI 3DBHI 3PTFC 2IO0B 1J0GA 3DDCB 1Z5SB 3X0WA 4M8MA 2ZZPB 2L0TA 4GN1A 1L7YA 2KQ7A 3NHEB 2KTFA 4K7SA 1KOTA 3QHTA 1T0YA 1R4MI 2D07B 1WXVA 2FCSA 2N7DA 4HVBA 3SDLC 4A3PA 1TBEA 4WQOB 2KX3A 4TQ0A 1IP9A 2ZJDA 2R2QA 2XK5B 3CSFA 5HKHA 3V62A 1Q1OA 2XEWA 1ZKHA 4AUQC 2GMIC 3ZVVA 2MRPA 1WRDB 4RMAA 3ZRFA 5C1ZA 3V61A 1E90A 3RUIB 3H1UA 5J2RA 1LM8B 2DAFA 3A4RA 3R7RA 3O65B 4X57B 1P0RA 1RLFA 1WMHB 3OAWA 3PRZA 3L17A 4W9LA 5CTRC 1GJZA 5E6OA 4IWPA 2KWUB 2OJRA 3CF6E 4IG7B 4FHKA 4W9FA 3B08A 3IVFA 2NBUA 4J6IA 3ZNHB 2OOBB 4FJZA 1F9JA 4ANXA 2HE7A 3U8ZA 2W9NA 4FJVB 1TZ1A 2GOWA 2DZIA 4GDLA 2N7EA 2O6VD 3H7SA 3H6NA 3QJZA 5IAAC 1XD3B 1R4NI 4MELA 3L13A 1OEYJ 2JPHA 2HTHA 3L08A 3TJPA 3VTUA 4BKSD 1WJ6A 2G4SA 5C23A 4LCDE 4DHZB 3DVNV 3VQIA 2LGDA 3AU5A 2KMAA 3ZRCA 4URKA 2LI5A 4PS3A 1U4AA 4MEMA 4BOSC 1UZXB 3ZNGC 1YX5B 1V49A 4W9CA 2FUHB 5BO4B 1YQBA 2DYOA 2KFJA 2AL3A 3RT3B 3TIXA 4JQWC 5DPTA 2CS4A 3KVFB 2V4LA 1WR6E 1Q5WB 4GDKB 4GGQA 4WJNA 3QARA 2CHWA 3WANA 4B95A 2KWVB 4F8CB 1WGGA 1WM2A 4KIKB 4A20A 4E3CA 2R2OA 5LXIB 1C3TA 3ZDMC 1WJNA 4BKGA 2GBJA 3DQVA 3PPAA 3VXWA 3ZTDA 2BYVE 4E74A 3OJ3A 1WXMA 1K8RB 3VUYA 2Z0EB 2KQSA 1WYWB 2FAZA 3VUXA 4E71A 2KDBA 3LDZE 2WWZA 4BVUC 3JSVA 2ZPNA 3N3KB 3KW5B 5DPWA 3B0AA 3ZIMA 1J8CA 4ZRKA 3M3JA 1SIFA 2BKFA 4ANWA 1ZW7A 2FNJB 2C7MB 2YLMA 2XBBC 2KNBA 3TMPB 4NY0A 4NJ6A 2N4FA 3H9DA 2O6VA 3HM6X 3RYTA 1RRBA 4KZ0A 2KKCA 4WAAA 4DBGA 4M8NA 4BBNF 2K6QA 1OQYA 3QCAA 5FR6A 3VHTC 2BWES 3I3TB 3DCGA 3N30A 3R66C 4XZ4A 3L0WB 2BKRB 4HPMB 3NS8A 5D7GA 5L83A 1FXTB 2BPSA 1S1QB 4EZJA 3GOEA 1VCBA 3DBSA 3HM3A 1CMXB 4DDID 3DPDA 2BF8B 2MA9B 3ML9A 5AZGA 3Q3FA 3DVNU 3H7PB 1P1AA 1Z2MA 4IW0A 2CHXA 1Q0WB 3UGBB 4WWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z59 B;  3ONS A;  1E7V A;  2N1V A;  4AJY B;  5DPR A;  4PS7 A;  4MSQ B;  2FIF A;  3QQ8 B;  4FAD A;  2KFK A;  4GXB A;  2LVQ A;  4MM3 A;  5D2M B;  3RUL A;  3TL5 A;  3MTN B;  3JVZ X;  4DDG D;  3AI5 A;  5E6P A;  2GBM A;  3QC8 B;  3PLU A;  2KTR A;  2D2Q A;  2M8S A;  4DHJ D;  2NPT A;  1WFY A;  4MGI E;  2JT4 B;  3ECI A;  2JXX A;  3RCZ A;  1WJU A;  3WAL A;  3K9P B;  3ALB A;  3ENE A;  2KJR A;  2FID A;  4TUU A;  1WIA A;  1V2Y A;  4EUT A;  3V6E B;  2I1K A;  2KWC A;  4MGY E;  3BY4 B;  1UBI A;  4IM3 A;  4AWJ A;  3RZF A;  2RGF A;  3APC A;  4NQK E;  2KZR A;  4MSM B;  3KH0 A;  3VH4 B;  1NI2 A;  4BBN C;  2IZV B;  2PE6 B;  2ZCB A;  5CHF A;  2C7N B;  2MW5 A;  2D3G A;  3AXC A;  2ASQ A;  2M4N A;  4NPN A;  2UWQ A;  4G11 A;  2CKH B;  3PGE A;  5DCN A;  1LXD A;  2PJH A;  4MGK E;  5LLI A;  2EMS A;  2NS5 A;  3M63 B;  2DHZ A;  5AZF A;  1RAX A;  1WXA A;  4G0N B;  1WGY A;  2K8B A;  3APF A;  2L7R A;  2HJ8 A;  3N32 A;  2KDF B;  3BIN A;  4FN2 A;  1X1M A;  4KSK C;  2AWT A;  1V80 A;  2KVR A;  2XK5 A;  3VVW B;  5J17 A;  4JLC A;  3W1Y A;  2KN5 A;  2EKE C;  1UEL A;  2LJ5 A;  2JRH A;  1EF5 A;  4K7W A;  2N9X A;  5KHO A;  5IA7 A;  2ZNV B;  2LRU A;  2ZPY A;  2IY0 B;  3A9J B;  3K9O B;  2A5U A;  1I35 A;  2V3S A;  3ML8 A;  1WMH A;  2QHO A;  3TBL D;  2C9W B;  4I6L B;  4HPL B;  4W9K A;  3RD2 A;  2IO3 B;  2LWP A;  1E8W A;  5AZH A;  4EKU A;  4W9H A;  1S3S G;  4WJQ A;  1E8X A;  1WE6 A;  4ICU A;  3T8M A;  2IO1 B;  3DVG Y;  1YIW A;  2ZCC A;  2MCN B;  4MJS A;  3JW0 X;  1NDD A;  2PE9 A;  4HWI B;  5CHW A;  5D94 A;  4P7I A;  2MP2 A;  1D3Z A;  3U30 A;  2K39 A;  3KUZ A;  4WWN A;  4ZRJ A;  2V1Y A;  4I6P A;  1L2N A;  1QZE A;  1J19 A;  2J0K A;  4ZRI A;  1ZGU B;  1G6J A;  1KM7 A;  3A4S C;  2B3A A;  2K8H A;  2J0J A;  2UYZ B;  1P3Q U;  4NAW B;  1P9D U;  2KXJ A;  4WJP A;  4FBJ B;  4KV2 A;  3WAM A;  2C5L C;  2LVP A;  2O2V B;  2REX A;  4TQ1 A;  3WIM A;  3OJ4 B;  3QK0 A;  3A9K B;  4JGH B;  5DPS A;  4HJK A;  4ICV A;  3QA8 A;  2Y5B B;  4MDK E;  1PQS A;  1WGR A;  2A4Z A;  4HDO A;  2BGF A;  4ZDV A;  4JL9 A;  5AEK B;  4W9I A;  3A33 B;  3PHX B;  4GDK A;  4AOF A;  3VAW A;  1TGZ B;  1IPG A;  5E6N A;  4YL8 A;  3L16 A;  3UIP B;  3LJ3 A;  2O6V B;  2MWS B;  3VDZ A;  4HK2 A;  1UGM A;  4KIK A;  2LGX A;  1EF1 A;  4F7Z A;  3B1L X;  2RR9 A;  2RSU A;  2WDT B;  4KDL B;  3ZTC A;  2L8J A;  2N9P C;  2M17 A;  1LQB A;  2MBE A;  2KLC A;  2KOX A;  3AUL A;  3V6C B;  3EC8 A;  3MJW A;  2HD5 B;  3KYD D;  4W9D A;  1Y8R C;  2IYD B;  1KJT A;  4PYU A;  1KLV A;  2ZVO A;  2M1M A;  2WYQ A;  2ZVN A;  1GC7 A;  2K6D B;  4XX5 A;  3JYU A;  4W9G A;  4IC7 B;  2WX0 A;  3NZU A;  3M95 A;  4IUM B;  3A1Q B;  2LXA A;  4MGZ E;  4ASW C;  3QWZ B;  4HLE A;  3PS6 A;  3PVL A;  1MG8 A;  3OLM D;  3NOB A;  3KUD B;  2WX1 A;  3VTV A;  1WX7 A;  3HK0 A;  1E5W A;  5EDS A;  4OVV A;  2AL6 A;  2NBW B;  2L05 A;  2L0F A;  2K1F A;  2NPT B;  2LVO A;  2LAS A;  2JZZ A;  2KJ6 A;  4IM0 A;  3WAP A;  2PEA A;  2PPH A;  2KDI A;  4EZL A;  3PT2 B;  3T9L A;  2YVC A;  4JIO U;  4K7U A;  5G55 A;  3X23 A;  3UF8 A;  4CHK A;  4EOY A;  1JRU A;  4NJ7 A;  4W9J A;  3L54 A;  4II2 B;  1WJ4 A;  1RFA A;  4B9K A;  2G3Q B;  4N9F 4;  1I42 A;  1H8C A;  4KZC A;  4LJO B;  4A3O A;  2BYE A;  4DXA B;  3H7P A;  4IWQ A;  5L95 C;  4LDT B;  1V9J A;  2MBH A;  2J7Q B;  1XQQ A;  2DZJ A;  2KAN A;  1WE7 A;  2L76 A;  1YD8 U;  4KDI C;  3ZW3 A;  3HHM A;  2FCM A;  2DZK A;  2LZ6 A;  2C7H A;  3PRE A;  2EMT A;  4GMV A;  4CO7 A;  2KC1 A;  2DX5 B;  2DYB A;  1TTN A;  4HXD A;  2DYM A;  4OVU A;  3WAO A;  1GG3 A;  2G4D B;  5JHB A;  1SE9 A;  4II3 B;  2C60 A;  2IO2 B;  4HCP B;  2M0X A;  2ZNV C;  1WM3 A;  3TCA A;  5JHA A;  2D11 A;  2RPQ A;  4GDL B;  1NBF C;  2I1J A;  4EEW A;  3APD A;  3UIO B;  3NY5 A;  3ZO5 B;  3HIZ A;  1WI0 A;  5LXH A;  4GOC A;  4XC2 A;  1SGH A;  5JH5 C;  1E8Y A;  1OTR B;  2MLB A;  4IM2 A;  1C1Y B;  2IBI B;  3ZNZ B;  2BYF A;  2KK8 A;  3UQA A;  2JVC A;  4FUL A;  2MX2 A;  3ZUN A;  1EO6 A;  3VFK A;  1V86 A;  2CR5 A;  4ANU A;  2GBN A;  2KX0 A;  4PS8 A;  1V5T A;  4DHJ B;  2MBO A;  3MHS D;  1UD7 A;  5D6J B;  3DOW A;  2RD0 A;  3AU4 A;  4IWO A;  4KSL C;  1V5O A;  4F1S A;  1WZ3 A;  1WX9 A;  2KC2 A;  2N1W A;  1E7U A;  4MJS B;  4GIV A;  2MP2 B;  4BKT A;  2FCQ A;  4AP4 C;  4G3X B;  2LD9 A;  1WGD A;  3QIJ A;  4MH0 E;  4GSW A;  3UQB A;  2L00 B;  5JZE B;  2KDE B;  4DWF A;  2KLG A;  2KO3 A;  5J18 A;  2J0M A;  4LJP B;  1WH3 A;  3W1S C;  1M94 A;  3L10 B;  1WR1 A;  3SHQ A;  1H4R A;  3IBE A;  3QAQ A;  4WWP A;  2JF5 A;  4FJY A;  1OEY A;  1WGH A;  2JY6 A;  3D32 A;  3PHW B;  3RZW C;  1YX6 B;  1WZ0 A;  4TKN A;  2CU1 A;  3A9J A;  4TV3 A;  3JSV B;  2JZ3 B;  4DHZ E;  2AYO B;  4DK5 A;  3KUC B;  3NZS A;  2GBK A;  4PYZ A;  4EFO A;  4FLH A;  4AJW A;  4NQL B;  4FHJ A;  3IFW B;  3P2B A;  4W9E A;  1IYF A;  1LFD A;  2KMC A;  4I6N B;  3GZN I;  4EZK A;  3M62 B;  4K1R B;  2MBB B;  3DBL I;  5TR5 A;  3PZD A;  4FA6 A;  2ZEQ A;  3KYC D;  4HDQ A;  1GC6 A;  3CMM B;  2JUO A;  3ZDT A;  1XT9 B;  2FCN A;  1OGW A;  1UH6 A;  2CHZ A;  2NCN A;  2AEH A;  2NVU I;  3Q3J A;  3R3M A;  4NAW A;  3ZKJ C;  2N9E B;  3ZLZ A;  1WXS A;  1WX8 A;  2O2V A;  2DZM A;  1EUV B;  3A9K A;  3QX1 A;  3S2A A;  3SU8 X;  1P98 A;  1VD2 A;  4B6W A;  2BWF A;  2LGY A;  3PRP B;  3IHP C;  3PRM B;  2NBV B;  4HCN B;  2IY1 B;  3UIN B;  2K8C A;  3W1S A;  2KD0 A;  3SD5 A;  3CST A;  4G50 A;  4LDT D;  3PSE B;  2KFK B;  1ISN A;  2DAJ A;  3VUW A;  4ANV A;  1HE8 A;  4GU2 A;  2JWZ A;  4BKS A;  1UBQ A;  2G45 B;  2MBQ A;  5GMV A;  2KTR B;  4RM9 A;  1GUA B;  3EFU A;  1AAR A;  3EHV A;  3IG3 A;  5CHV C;  4WJO A;  3U7D A;  1V6E A;  2Z0D B;  3VH3 B;  4BOZ B;  2DEN B;  4M0W B;  4ZYN A;  3V60 A;  4KVG B;  4K81 A;  3R7Q A;  1YJ1 A;  5G2N A;  3PV1 A;  1WF9 A;  2GBR A;  4GB9 A;  1V81 A;  2VRR B;  3WA0 A;  4RM8 A;  2LUE A;  1BT0 A;  2L3Z A;  3A1Q A;  4CYE A;  2KJH B;  3DVG X;  4BFR A;  5KHQ A;  1GNU A;  1A5R A;  5CX3 A;  2LRW A;  2K25 A;  3EEC A;  1E8Z A;  2JRI B;  2D10 A;  3VTW A;  4NNJ B;  3PLV A;  2LXC A;  1WY8 A;  2KHW B;  2MQJ A;  2NR2 A;  3C0R B;  3ZNI D;  2MSE D;  3DBR I;  3DBH I;  3PTF C;  2IO0 B;  1J0G A;  3DDC B;  1Z5S B;  3X0W A;  4M8M A;  2ZZP B;  2L0T A;  4GN1 A;  1L7Y A;  2KQ7 A;  3NHE B;  2KTF A;  4K7S A;  1KOT A;  3QHT A;  1T0Y A;  1R4M I;  2D07 B;  1WXV A;  2FCS A;  2N7D A;  4HVB A;  3SDL C;  4A3P A;  1TBE A;  4WQO B;  2KX3 A;  4TQ0 A;  1IP9 A;  2ZJD A;  2R2Q A;  2XK5 B;  3CSF A;  5HKH A;  3V62 A;  1Q1O A;  2XEW A;  1ZKH A;  4AUQ C;  2GMI C;  3ZVV A;  2MRP A;  1WRD B;  4RMA A;  3ZRF A;  5C1Z A;  3V61 A;  1E90 A;  3RUI B;  3H1U A;  5J2R A;  1LM8 B;  2DAF A;  3A4R A;  3R7R A;  3O65 B;  4X57 B;  1P0R A;  1RLF A;  1WMH B;  3OAW A;  3PRZ A;  3L17 A;  4W9L A;  5CTR C;  1GJZ A;  5E6O A;  4IWP A;  2KWU B;  2OJR A;  3CF6 E;  4IG7 B;  4FHK A;  4W9F A;  3B08 A;  3IVF A;  2NBU A;  4J6I A;  3ZNH B;  2OOB B;  4FJZ A;  1F9J A;  4ANX A;  2HE7 A;  3U8Z A;  2W9N A;  4FJV B;  1TZ1 A;  2GOW A;  2DZI A;  4GDL A;  2N7E A;  2O6V D;  3H7S A;  3H6N A;  3QJZ A;  5IAA C;  1XD3 B;  1R4N I;  4MEL A;  3L13 A;  1OEY J;  2JPH A;  2HTH A;  3L08 A;  3TJP A;  3VTU A;  4BKS D;  1WJ6 A;  2G4S A;  5C23 A;  4LCD E;  4DHZ B;  3DVN V;  3VQI A;  2LGD A;  3AU5 A;  2KMA A;  3ZRC A;  4URK A;  2LI5 A;  4PS3 A;  1U4A A;  4MEM A;  4BOS C;  1UZX B;  3ZNG C;  1YX5 B;  1V49 A;  4W9C A;  2FUH B;  5BO4 B;  1YQB A;  2DYO A;  2KFJ A;  2AL3 A;  3RT3 B;  3TIX A;  4JQW C;  5DPT A;  2CS4 A;  3KVF B;  2V4L A;  1WR6 E;  1Q5W B;  4GDK B;  4GGQ A;  4WJN A;  3QAR A;  2CHW A;  3WAN A;  4B95 A;  2KWV B;  4F8C B;  1WGG A;  1WM2 A;  4KIK B;  4A20 A;  4E3C A;  2R2O A;  5LXI B;  1C3T A;  3ZDM C;  1WJN A;  4BKG A;  2GBJ A;  3DQV A;  3PPA A;  3VXW A;  3ZTD A;  2BYV E;  4E74 A;  3OJ3 A;  1WXM A;  1K8R B;  3VUY A;  2Z0E B;  2KQS A;  1WYW B;  2FAZ A;  3VUX A;  4E71 A;  2KDB A;  3LDZ E;  2WWZ A;  4BVU C;  3JSV A;  2ZPN A;  3N3K B;  3KW5 B;  5DPW A;  3B0A A;  3ZIM A;  1J8C A;  4ZRK A;  3M3J A;  1SIF A;  2BKF A;  4ANW A;  1ZW7 A;  2FNJ B;  2C7M B;  2YLM A;  2XBB C;  2KNB A;  3TMP B;  4NY0 A;  4NJ6 A;  2N4F A;  3H9D A;  2O6V A;  3HM6 X;  3RYT A;  1RRB A;  4KZ0 A;  2KKC A;  4WAA A;  4DBG A;  4M8N A;  4BBN F;  2K6Q A;  1OQY A;  3QCA A;  5FR6 A;  3VHT C;  2BWE S;  3I3T B;  3DCG A;  3N30 A;  3R66 C;  4XZ4 A;  3L0W B;  2BKR B;  4HPM B;  3NS8 A;  5D7G A;  5L83 A;  1FXT B;  2BPS A;  1S1Q B;  4EZJ A;  3GOE A;  1VCB A;  3DBS A;  3HM3 A;  1CMX B;  4DDI D;  3DPD A;  2BF8 B;  2MA9 B;  3ML9 A;  5AZG A;  3Q3F A;  3DVN U;  3H7P B;  1P1A A;  1Z2M A;  4IW0 A;  2CHX A;  1Q0W B;  3UGB B;  4WWO A; 
#chains in the Genus database with same CATH topology
 2Z59 B;  5DPR A;  4MSQ B;  4GXB A;  4MM3 A;  5TSS A;  1Y56 A;  4DDG D;  5E6P A;  3PLU A;  2KTR A;  2G1E A;  5E6J A;  2WXL A;  3ECI A;  4DXG A;  4NJC A;  2JXX A;  2WP9 B;  3WAL A;  4M0W A;  3ALB A;  2FID A;  4EUT A;  4MGY E;  1UBI A;  2I2Y A;  4AWJ A;  4XE0 A;  1NEK B;  4NQK E;  2Y5P A;  3KH0 A;  3P4S B;  3VH4 B;  3NVY A;  3GE3 C;  2PE6 B;  2MW5 A;  1AYF A;  2CKH B;  3RNA C;  5DCN A;  3TEW A;  1FXA A;  1QF6 A;  4WUR A;  1GAQ B;  5AZF A;  1RAX A;  2EKE C;  2QMT A;  1UEL A;  3KWL A;  1QT9 A;  2LRU A;  2ZPY A;  3VR9 B;  2A5U A;  1I35 A;  1FD6 A;  1WSP A;  3GS2 A;  5FKA C;  4HPL B;  3RD2 A;  2IO3 B;  1E8W A;  1S3S G;  1WE6 A;  2J53 A;  1YIW A;  1D3Z A;  1NDD A;  4P7I A;  1UWX A;  4C7Z A;  3U30 A;  1JML A;  3SFE B;  1L2N A;  2K5P A;  1G6J A;  1KM7 A;  1YQ4 B;  2J0J A;  2UYZ B;  4WJP A;  1VZ6 A;  2KAC A;  2RMM A;  1GB1 A;  4C80 A;  4HJK A;  2PVO D;  1SF0 A;  2A4Z A;  4HDO A;  2V9H A;  4ZDV A;  4RGM A;  2RDG A;  2WXM A;  4GDK A;  1TGZ B;  1XLP A;  4YL8 A;  3UIP B;  2MWS B;  1UGM A;  3Q3M C;  3ZXR A;  2RSU A;  3ZTC A;  2L8J A;  1LQB A;  3AE6 B;  2KOX A;  3AUL A;  3KYD D;  2IYD B;  1ET6 A;  2ZVO A;  2ZVN A;  1PGB A;  4WQM A;  4XX5 A;  4C4V A;  1ESF A;  1L5P A;  3N9Y C;  4M02 A;  2WX1 A;  2VZK B;  1I7H A;  1E5W A;  1KLG D;  4OVV A;  5EDS A;  4C56 C;  2L0F A;  2K1F A;  1ENF A;  2LAS A;  3WAP A;  4UDU C;  5G55 A;  4JIO U;  3X23 A;  2IJ0 A;  2VH1 A;  4B9K A;  5HG2 A;  4N9F 4;  2D5G A;  3H8H A;  4A3O A;  4DXA B;  3H7P A;  2MBH A;  5T8I A;  2ZW1 A;  1JQ4 A;  4KDI C;  1YD8 U;  2ICI A;  3ZW3 A;  3HHM A;  3PRE A;  2EMT A;  3NJT A;  1V1P A;  2DX5 B;  1TTN A;  4HXD A;  1CZP A;  1PUT A;  5JHB A;  4II3 B;  3Q3N C;  2EKI A;  2ZNV C;  3TCA A;  2RPQ A;  3TSS A;  2JYT A;  2W55 A;  1XXG A;  3UIO B;  4XWW A;  2ZW0 A;  3NY5 A;  1UGJ A;  1WXQ A;  3GE8 C;  1TY0 A;  1TJE A;  3ZNZ B;  3UQA A;  3P4R B;  3ZUN A;  1FRD A;  1V8C A;  2GBN A;  1V5T A;  1UD7 A;  5D6J B;  2K0P A;  4IWO A;  1WX9 A;  2KC2 A;  4A90 A;  1C9F A;  5AUK A;  2MHJ A;  4HRS A;  2N0S B;  4WWM A;  4GIV A;  2WU5 B;  4BKT A;  4G3X B;  1WGD A;  4O1N A;  4MH0 E;  4GSW A;  3UQB A;  2L00 B;  4PK1 A;  4OZC A;  2KO3 A;  4ZHP A;  5FK9 C;  2WXG A;  1H4R A;  3IBE A;  1FNW A;  3EUB 2;  3V60 A;  2JY6 A;  3PHW B;  4TKN A;  4TV3 A;  2LHE A;  3VR8 B;  4DHZ E;  1TS4 A;  2AYO B;  3KUC B;  4PYZ A;  3RN9 C;  4EFO A;  1JCK B;  1XCQ L;  4TMA B;  4W9E A;  1IYF A;  1LFD A;  2KMC A;  3GZN I;  3M62 B;  4K1R B;  5BYQ A;  1VRA B;  1ZP0 B;  3PZD A;  1EU4 A;  1QOF A;  1DOY A;  3N20 C;  1GC6 A;  2JUO A;  1D4B A;  2PVG C;  1SXT A;  3ZKJ C;  4NAW A;  2NVU I;  3ZLZ A;  2N9E B;  1WXS A;  2O2V A;  1UUP A;  3S2A A;  5HFY A;  3N1Y C;  3PRM B;  3CST A;  4G50 A;  3PSE B;  3IAM 1;  1ISN A;  3AE2 B;  1MI0 A;  2BB6 A;  2MJE A;  1NYR A;  2MBQ A;  5GMV A;  1T0R C;  3EFU A;  1P7E A;  1SSN A;  4BOZ B;  3VH3 B;  2DBY A;  2PMV A;  4KVG B;  1E0Z A;  3R7Q A;  1QQR A;  1WF9 A;  2Z8L A;  4GB9 A;  2BT6 A;  1CK1 A;  3GB1 A;  4ZYS A;  3A1Q A;  3GP7 A;  4CYE A;  2KT7 A;  3MP9 A;  5KHQ A;  1GNU A;  1A5R A;  5CX3 A;  4RF1 A;  2LRW A;  2LJI A;  1IGC A;  4ZHO A;  4NNJ B;  2LXC A;  1WY8 A;  2KHW B;  2E3T A;  3DBR I;  1J0G A;  2QIL A;  2V3P A;  3DDC B;  1SJH D;  3RI7 C;  1L7Y A;  2CU3 A;  2N7D A;  2FCS A;  4J3O D;  4WQO B;  1MJD A;  2R61 A;  2INN E;  4JX1 C;  1D5X C;  3ZVV A;  2JWU A;  1E90 A;  4X57 B;  1RLF A;  3PRZ A;  1GJZ A;  3R2T A;  5E6O A;  2KWU B;  1YN4 A;  4W9F A;  1C77 A;  3B08 A;  3ZYY X;  4A9A A;  1NEN B;  3H7S A;  3QJZ A;  2CJN A;  2WXN A;  1XD3 B;  2HTH A;  2PW9 A;  1WJ6 A;  4DHZ B;  1QLB B;  2LGD A;  3AU5 A;  2KMA A;  5BMH A;  3AM9 A;  4MEM A;  3AN1 A;  3OG5 A;  2PKO A;  4W9C A;  1YQB A;  3RFZ B;  3DBL B;  3QAR A;  4B95 A;  2KWV B;  2NTT A;  1FCC C;  3Q69 A;  2LUM A;  5H8Y E;  3KLS X;  3LDZ E;  4OZA A;  1FO4 A;  3P42 A;  2ZPN A;  2XN9 C;  3I5J C;  1JW9 D;  2QJL A;  2WXH A;  2YLM A;  4LNK A;  3RNC C;  4C00 A;  2O6V A;  2B76 B;  1OQY A;  5FR6 A;  3R66 C;  1YN3 A;  1KTK A;  1HEZ E;  1S1Q B;  3MC8 A;  1T0S C;  2WDQ B;  3MHZ A;  1KFY B;  2BF8 B;  5AZG A;  1RM6 C;  4P6V F;  2X38 A;  3C8Y A;  2LGI A;  2N1V A;  1FNV A;  2KFK A;  2WDR B;  3RUL A;  5MPO A;  1FXI A;  3MTN B;  3JVZ X;  1BML C;  3MFG A;  2D3C A;  1FMA D;  4RGO S;  1WFY A;  3RCZ A;  3EGR A;  3K9P B;  3AE1 B;  1WIA A;  2WXP A;  2IGH A;  1TT5 B;  2KVZ A;  4IM3 A;  2RGF A;  2KZR A;  3NZ3 A;  2AX5 A;  4BBN C;  2D3G A;  3AXC A;  2ASQ A;  2JXT A;  3BK1 A;  2QEJ C;  3PGE A;  1YJJ A;  4HRO A;  2EMS A;  3AE4 B;  4G0N B;  5EE0 A;  1HTO A;  3T3N A;  1HZ5 A;  2HJ8 A;  2WXQ A;  3AB5 A;  3W5V B;  4RH6 A;  2KVR A;  2XK5 A;  2BVC A;  2N7J A;  1JWS D;  2KN5 A;  2QIE B;  2JRH A;  1EF5 A;  2N9X A;  2ZNV B;  3K9O B;  4YTP B;  1KRH A;  1WMH A;  1PYW D;  4W9K A;  2LWP A;  5AZH A;  4EKU A;  1OFF A;  2MJ3 A;  4WJQ A;  1E8X A;  3DVG Y;  2MCN B;  1OQR A;  4MJS A;  2RPV A;  2K39 A;  4WWN A;  2W3S A;  2V1Y A;  4I6P A;  1J19 A;  2J0K A;  1I4R A;  1ZGU B;  2W3R A;  2B3A A;  2K8H A;  2ACZ B;  4BZA A;  3W9C B;  4M00 A;  2KXJ A;  3U7Z A;  1J7B A;  4KV2 A;  3WAM A;  2XNA C;  3A9K B;  3AEF B;  1T6B X;  2WNM A;  4ICV A;  2Y5B B;  2CJO A;  2BGF A;  4KGT A;  5AEK B;  4W9I A;  3A33 B;  3PHX B;  4AOF A;  3Q2A C;  2WS3 B;  1IPG A;  2ONQ A;  2O6V B;  4RNA A;  3Q8E A;  1EF1 A;  4F7Z A;  4KDL B;  2WDT B;  4PT5 A;  3U4E G;  2N9P C;  2BBC A;  2MBE A;  2NTS A;  3V6C B;  2HD5 B;  4M01 A;  1Y8R C;  5IOI A;  1KLV A;  1YMH E;  1E9M A;  4W9G A;  1UNS A;  1FPY A;  4IUM B;  4ASW C;  3I57 A;  4HLE A;  1FM0 D;  1MHH E;  3PVL A;  1MG8 A;  3OLM D;  2DNF A;  3NOB A;  3KUD B;  1WX7 A;  1C79 A;  2L05 A;  3KQ4 A;  2KJ6 A;  2KDI A;  3PT2 B;  4CHK A;  4RFB A;  1JRU A;  4EOY A;  2IDY A;  2G3Q B;  3EA6 A;  1JRO A;  5BYS A;  5L95 C;  1V9J A;  3AEG B;  2DZJ A;  1AW7 A;  4XYC A;  3CIR B;  3SEB A;  2H89 B;  2KQ4 X;  4KGS A;  1JWM D;  2DYB A;  1SIJ A;  2DYM A;  1ZE3 D;  4US9 A;  1SE9 A;  1YNT E;  3NS1 A;  4HCP B;  4GDL B;  2I1J A;  3ZO5 B;  3HIZ A;  3P4P B;  1SGH A;  4XC2 A;  1E8Y A;  1OTR B;  2IGG A;  2BYF A;  4FUL A;  2MX2 A;  1EO6 A;  1V86 A;  2CR5 A;  4ANU A;  2OJW A;  2KX0 A;  2MBO A;  3FIL A;  2KYW A;  3DOW A;  4KSL C;  1WZ3 A;  3OWE B;  1E7U A;  4MJS B;  2FCQ A;  3BII D;  1C4C A;  2LD9 A;  3ZJV A;  5JZE B;  2KDE B;  1J7C A;  2J0M A;  4C7Y A;  1WR1 A;  1OEY A;  3D32 A;  2AQ3 B;  3A9J A;  3Q6B A;  1ACC A;  1ROE A;  1QIL A;  4NQL B;  2PIA A;  3IFW B;  3ETR A;  4EZK A;  5TR5 A;  1C76 A;  3E56 A;  4FA6 A;  2ZEQ A;  4BAX A;  3ZDT A;  5I4D A;  5BMI A;  1OGW A;  1UH6 A;  2M0A A;  2DZM A;  1C78 A;  1EUV B;  2J42 A;  1CJE A;  1MG4 A;  3IT6 B;  2WHI A;  2WGS A;  4KX6 B;  2LGY A;  3IHP C;  2IY1 B;  3UIN B;  2N9K A;  2K8C A;  2KD0 A;  1KH0 A;  3ZXV A;  1FIQ A;  2WXR A;  4MM3 B;  3VUW A;  4ANV A;  1HE8 A;  4GU2 A;  2JWZ A;  2N9L A;  1UBQ A;  2KTR B;  4RM9 A;  3AEB B;  1SEB D;  3IG3 A;  4WJO A;  3U7D A;  1V6E A;  2Z0D B;  3TEX A;  4M0W B;  4ZYN A;  3E9S A;  1CQV A;  4B0M A;  1FRR A;  1HZ6 A;  3URY A;  2LUE A;  2KJH B;  3DVG X;  4N6E B;  1TKY A;  3EEC A;  2D10 A;  3L4P A;  3VRA B;  1AWD A;  1BUI C;  5BYR A;  4LLG M;  3DBH I;  2IO0 B;  2LGS A;  4REZ A;  4M8M A;  2LHD A;  2L0T A;  2LFI A;  4D2K A;  2EEL A;  3NHE B;  3PO0 A;  4P1C C;  2RDH A;  1R4M I;  1YQ3 B;  1WXV A;  2D07 B;  3SDL C;  3B2F A;  1TBE A;  4A3P A;  1IP9 A;  1P7F A;  2ZJD A;  1AN8 A;  5HKH A;  1Q1O A;  1N6Z A;  1SBB B;  2PLP A;  5FR3 A;  2MRP A;  1I4X A;  4YTN B;  1E6E B;  3V61 A;  5C1Z A;  3H1U A;  3VRB B;  1UWM A;  3L17 A;  1L4Z B;  4W9L A;  4A8X C;  3LB8 C;  2NBU A;  1TIF A;  3DHG C;  1F9J A;  3IXS A;  2DZI A;  3PZ7 A;  2N7E A;  1L0X B;  3U2S C;  3H6N A;  4IOI E;  2UU7 A;  1DOI A;  1R4N I;  5IAA C;  3V05 A;  3L08 A;  2HTM E;  2JPH A;  3FAH A;  3ZRC A;  2MEK A;  4URK A;  2LI5 A;  3BYT B;  4PS3 A;  4LK0 M;  1IBX A;  2FUH B;  5H92 C;  2DYO A;  3RT3 B;  2CS4 A;  3KVF B;  3GZN B;  4GDK B;  3WAN A;  1VLB A;  2V4I B;  4DQO C;  1K51 A;  3AMZ A;  2H88 B;  4CQN A;  1BXT A;  1C3T A;  5LXI B;  4RGN A;  3LYY A;  1WJN A;  2GBJ A;  3AE8 B;  3DQV A;  3VXW A;  4E74 A;  1K52 A;  3VUY A;  3U52 E;  3UI3 A;  3JSV A;  4C4V B;  1TKG A;  5DPW A;  2L1A A;  3M3J A;  4ANW A;  4JE3 B;  2FNJ B;  2V0G A;  3AEA B;  2XBB C;  3Q8A A;  3RYT A;  1QOB A;  4WAA A;  3TEZ A;  3I3T B;  2INP E;  2L52 A;  1RYJ A;  2BKR B;  3WCQ A;  2MA9 B;  3B9J A;  3ML9 A;  4ZOH C;  4WIP A;  3Q3F A;  1B9R A;  3H7P B;  3ONS A;  2BQQ A;  4AJY B;  3DBR B;  2LVQ A;  2J4X A;  5D2M B;  1WGK A;  4Q2J A;  3BVZ A;  1XLO A;  1V1P B;  1TZO A;  3LXF A;  2D2Q A;  2M8S A;  3AE7 B;  4DHJ D;  2NPT A;  2JT4 B;  1V2Y A;  3V6E B;  2I1K A;  2KWC A;  3BY4 B;  4MSM B;  5EE9 A;  4KKI A;  2ZCB A;  5CHF A;  4JPS A;  2BTE A;  2M4N A;  4NPN A;  2UWQ A;  1LXD A;  2IND C;  4ZRQ A;  1NI3 A;  2DHZ A;  1ET9 A;  1WXA A;  2INC C;  1WGY A;  3APF A;  2KDF B;  3BIN A;  4FN2 A;  1X1M A;  2K3U A;  2AWT A;  5J17 A;  4JLC A;  1EM7 A;  3W1Y A;  4A55 A;  4OZB A;  2LJ5 A;  3P1M A;  4K7W A;  3KWV A;  5KHO A;  5IA7 A;  2IGD A;  2IY0 B;  2QHO A;  3AE9 B;  2RDB C;  2C9W B;  4W9H A;  4ICU A;  1F52 A;  4S0R A;  2ZCC A;  4L23 A;  3JW0 X;  2PE9 A;  1YOV B;  2MP2 A;  3KUZ A;  4ZRJ A;  3FKY A;  4ZRI A;  3RNE C;  2K9X A;  4YSZ B;  3A4S C;  4MT5 A;  1P3Q U;  4NAW B;  1VZ7 A;  1P9D U;  4FBJ B;  2C5L C;  2LVP A;  2O2V B;  2REX A;  4TQ1 A;  2WXI A;  1L4D B;  1M4V A;  1WGR A;  1XEE A;  3VAW A;  4YXD B;  3NVW A;  3L16 A;  3LJ3 A;  4KIK A;  1SB3 C;  2LGX A;  3B1L X;  2X8X X;  2M17 A;  2KLC A;  5LNK 1;  2GRI A;  4W9D A;  1B1Z A;  1KJT A;  4PYU A;  4YSX B;  1PGA A;  2M1M A;  2WYQ A;  4LNO A;  2K6D B;  2GI9 A;  3A1Q B;  1MPE A;  2LXA A;  4MGZ E;  3QWZ B;  1LGR A;  1N63 A;  3PS6 A;  3VTV A;  3RNF C;  5G5G A;  4YTM B;  4RGT A;  2KN4 A;  2NPT B;  1ZXI A;  2JZZ A;  4IM0 A;  2PEA A;  2PPH A;  2SAK A;  4EZL A;  1LO5 D;  2YVC A;  4K7U A;  4ZRP A;  3UF8 A;  4NJ7 A;  4W9J A;  1VJK A;  3L54 A;  4II2 B;  2L32 A;  1WJ4 A;  4WAF A;  1RFA A;  4LJO B;  3N1X C;  1L0V B;  2BYE A;  3R2I A;  4IWQ A;  4LDT B;  2L76 A;  1WE7 A;  2LMC A;  2FCM A;  2LZ6 A;  2C7H A;  3DWG C;  4GMV A;  4CO7 A;  4OHJ A;  4OVU A;  3WAO A;  2BB5 A;  2KWD A;  2G4D B;  2C60 A;  2IO2 B;  2M0X A;  1WM3 A;  1N61 A;  5JHA A;  2D11 A;  1FEH A;  1NBF C;  4EEW A;  5IP4 D;  4B0E A;  5LXH A;  3SFD B;  4HPP A;  2MLB A;  4IM2 A;  2IBI B;  2KK8 A;  2JVC A;  1N5X A;  3VFK A;  4PS8 A;  3MHS D;  3AH7 A;  2RD0 A;  1V5O A;  4F1S A;  2OED A;  1TS3 A;  4YT0 B;  1SJE D;  1QOA A;  2BS2 B;  2MP2 B;  3RNG C;  1F77 A;  1GPX A;  3AEC B;  1N5W A;  1M94 A;  3SHQ A;  2E6X A;  3QAQ A;  4WWP A;  1WGH A;  1YX6 B;  1WZ0 A;  2JZ3 B;  1D5Z C;  4DK5 A;  3NZS A;  4FLH A;  1JWA D;  3PZ8 A;  1SE4 A;  4R3D A;  3HRD D;  2MBB B;  4HDQ A;  2WXJ A;  1XT9 B;  4A6Q A;  2DLB A;  2DWQ A;  3DWM A;  2AEH A;  1WX8 A;  1D6E C;  2PTL A;  3QX1 A;  4XGA B;  3SU8 X;  1P98 A;  1VD2 A;  2BWF A;  3PRP B;  2NBV B;  2K22 A;  4HCN B;  1OQQ A;  1NYQ A;  3W1S A;  2WDV B;  2GB1 A;  2IPK D;  2KFK B;  3I9V 1;  1DGJ A;  1L0Y B;  5GXG B;  4BKS A;  3EHV A;  4MH8 A;  2VRR B;  3WA0 A;  4RM8 A;  2JZP A;  4BFR A;  4NZL B;  2W82 A;  3VTW A;  2MQJ A;  3C0R B;  2NR2 A;  3ZNI D;  1DYQ A;  4FXC A;  5IKC M;  4L1B A;  2ZZP B;  4GN1 A;  2SEB D;  4K7S A;  2KQ7 A;  4JWU C;  1KLU D;  1KOT A;  3R8B A;  2QDF A;  4KKJ A;  2KX3 A;  4AS1 A;  2XK5 B;  3CSF A;  4P16 A;  1ZUD 2;  1K53 A;  2XEW A;  1UF0 A;  3Q8B A;  1WRD B;  1T3Q A;  3ZRF A;  1RFK A;  1LM8 B;  2DAF A;  3R7R A;  3O65 B;  1WMH B;  5CTR C;  4IDI A;  4XWT A;  1PGX A;  2OJR A;  4ACF A;  3IVF A;  4J6I A;  1IGD A;  3U8Z A;  1TZ1 A;  2FBW B;  3L13 A;  1OEY J;  3TJP A;  3VTU A;  4BKS D;  2QCZ A;  2G4S A;  3DVN V;  3BYY B;  3VQI A;  3Q8C A;  1UZX B;  3ZNG C;  1YX5 B;  1V49 A;  2HJ1 A;  1E7P B;  5BO4 B;  2KFJ A;  2AL3 A;  1QOG A;  4JQW C;  1Q5W B;  4GGQ A;  2CHW A;  3MJ5 A;  5D3D A;  4F8C B;  1WGG A;  1DOX A;  1WM2 A;  2JX5 A;  2VZK D;  2NMQ A;  3ZDM C;  2BW2 A;  3Q3O C;  4MAC A;  2BYV E;  1WXM A;  2Z0E B;  1EWC A;  3AV8 A;  3VUX A;  3AEE B;  2KDB A;  4BVU C;  2J52 A;  4DXF A;  3B0A A;  1E10 A;  4ZRK A;  1SIF A;  2BKF A;  1JWU D;  2KNB A;  4NY0 A;  4NJ6 A;  2N4F A;  3H9D A;  1RRB A;  4DBG A;  3AE3 B;  1K50 A;  5EE1 A;  3DCG A;  2FE8 A;  4HPM B;  5L83 A;  5D7G A;  2BPS A;  2YEP B;  3HM3 A;  3DHH C;  4LNI A;  4DDI D;  3DPD A;  3RMK C;  2Q5W D;  1XF5 L;  1Z2M A;  3Q8F A;  3UGB B;  4OW0 A;  4WWO A;  1E7V A;  4PS7 A;  5EE3 A;  2FIF A;  3QQ8 B;  4FAD A;  3DBH B;  1D5M C;  1FFV A;  3AI5 A;  2GBM A;  3QC8 B;  1KF6 B;  1R4M B;  4MGI E;  2VH2 A;  1WRI A;  1WJU A;  4N58 A;  4YSY B;  2BS3 B;  3ENE A;  2KJR A;  3BVG A;  4TUU A;  4N59 A;  3B2G A;  3RZF A;  5IO9 A;  3APC A;  2WU2 B;  1NI2 A;  1VDV A;  2IZV B;  2C7N B;  4G11 A;  5HI1 A;  3ZGZ A;  3FIL B;  2PJH A;  4MGK E;  5LLI A;  1PFD A;  2NS5 A;  3M63 B;  2M56 B;  1XCT L;  3TEY A;  3ABV B;  2K8B A;  4HJG E;  1T5X D;  2L7R A;  1R4N B;  3N32 A;  2L83 A;  4KSK C;  1V80 A;  3VVW B;  3IAS 1;  3ZQ4 A;  3P63 A;  4TSS A;  1F2R I;  3BK2 A;  1XO3 A;  5C3J B;  1XLQ A;  4US8 A;  1I4P A;  3A9J B;  1NVI D;  2V3S A;  3ML8 A;  3TBL D;  4I6L B;  1L6V A;  3T8M A;  2IO1 B;  5CHW A;  4HWI B;  5D94 A;  1QZE A;  4USA A;  1QKZ A;  4LTU A;  4S17 A;  1N60 A;  3WIM A;  3OJ4 B;  3QK0 A;  4JGH B;  3DHI C;  5DPS A;  3QA8 A;  4MDK E;  1PQS A;  4XDD A;  4JL9 A;  2WXF A;  5E6N A;  2AQ2 B;  3RPF C;  3VDZ A;  4HK2 A;  2ON8 A;  2RR9 A;  3ZJU A;  2WQY B;  3EC8 A;  3MJW A;  1GC7 A;  3JYU A;  4H2A A;  4IC7 B;  2WX0 A;  3NZU A;  3M95 A;  1I4Q A;  1TYG B;  1TY2 A;  1HXY D;  3HK0 A;  2AL6 A;  2NBW B;  1VZ8 A;  5JXV A;  2LVO A;  2MJD A;  4AQ7 A;  3NRZ A;  3BZD B;  3T9L A;  1IUE A;  4HEA 1;  2D3A A;  3N1Z C;  1I42 A;  1H8C A;  1YJI A;  4KZC A;  3AED B;  1MHX A;  1F1H A;  2J7Q B;  1N62 A;  1XQQ A;  4K3B A;  2KAN A;  4HKZ E;  4EE2 A;  2DZK A;  4QAY A;  4HKQ A;  2KC1 A;  2BS4 B;  1GG3 A;  1SE3 A;  3SR6 A;  1WWT A;  1HQR D;  4L2Y A;  3APD A;  1ZDV A;  2V3N A;  1WI0 A;  4GOC A;  5JH5 C;  3I63 C;  1C1Y B;  1YN5 A;  1GOZ A;  1IBX B;  1ZPS A;  2AQ1 B;  3TUO A;  3NVV A;  5HHD G;  4DHJ B;  5AUI A;  1RWS A;  3AU4 A;  2N1W A;  2JQR B;  4AP4 C;  1HA5 A;  2KAJ A;  3QIJ A;  1MVK A;  5D3I B;  3HUI A;  4DWF A;  2KLG A;  2QC8 A;  5J18 A;  2WLB A;  2WXK A;  4LJP B;  1WH3 A;  2Y3A A;  4LNN A;  3W1S C;  3L10 B;  2BYT A;  2KMM A;  4KGR A;  2JF5 A;  4FJY A;  3RZW C;  3TL5 A;  2CU1 A;  3JSV B;  3FC4 A;  2GBK A;  3W5U B;  1JWB D;  4AJW A;  4FHJ A;  1TKE A;  3P2B A;  2G9H D;  4I6N B;  3NUH B;  3DBL I;  3RNB C;  1EWY C;  3KYC D;  3CMM B;  1ZOY B;  2FCN A;  2CHZ A;  3R3M A;  2NCN A;  3Q3J A;  1XLN A;  3C19 A;  4K3C A;  3A9K A;  4B6W A;  4OVZ A;  2Y5C A;  2JSV X;  3SD5 A;  4LDT D;  2M19 A;  2DAJ A;  1I4G A;  2WXO A;  1V97 A;  3AE5 B;  2G45 B;  3HVD A;  1GUA B;  1AAR A;  1VR9 A;  5CHV C;  2KDM A;  1C4A A;  2DEN B;  3MC0 B;  4K81 A;  3W2D A;  1YJ1 A;  5G2N A;  3PV1 A;  2GBR A;  1J7A A;  1V81 A;  5IN7 A;  1BT0 A;  2L3Z A;  2W54 A;  4GLS C;  4NAM A;  1ZDX A;  3HVZ A;  2K25 A;  3O13 A;  1E8Z A;  2JRI B;  3PLV A;  1I4H A;  5C2T B;  1F2R C;  2D3B A;  2MSE D;  3PTF C;  3X0W A;  1Z5S B;  1STE A;  4ITK A;  2LEK A;  3EFC A;  3NVZ A;  2KTF A;  3QHT A;  1A70 A;  1T0Y A;  3MC9 A;  4HVB A;  2GLS A;  4TQ0 A;  1T0Q C;  2R2Q A;  3V3X A;  1Q10 A;  3V62 A;  1WYG A;  4XDC A;  4JWS C;  1ZKH A;  2MH7 A;  4AUQ C;  2GMI C;  2FUG 1;  4RMA A;  3RUI B;  5J2R A;  3A4R A;  3Q14 C;  1P0R A;  3OAW A;  4ARC A;  1L6U A;  4IWP A;  4IG7 B;  3CF6 E;  4FHK A;  3P4Q B;  1PDX A;  2QSD A;  3ZNH B;  2OOB B;  4FJZ A;  4ANX A;  1EU3 A;  2HE7 A;  2W9N A;  4FJV B;  1R7S A;  2YEP F;  3CWI A;  2GOW A;  1C4P A;  4GDL A;  2O6V D;  4IKG A;  1ZXH A;  4MEL A;  2HDE A;  4YWG G;  5C23 A;  4LCD E;  1HTQ A;  4ARI A;  1TS5 A;  1U4A A;  4BOS C;  3TIX A;  5DPT A;  2V4L A;  4RCO A;  1WR6 E;  5BMG A;  4WJN A;  2I38 A;  4KIK B;  4A20 A;  4E3C A;  2R2O A;  1GB4 A;  4BKG A;  3PPA A;  3ZTD A;  3OJ3 A;  3T3O A;  1TS2 A;  1K8R B;  2KQS A;  3BVM A;  1WYW B;  2FAZ A;  1V1O A;  4E71 A;  3BWU D;  2WWZ A;  3N3K B;  3KW5 B;  4WH4 A;  3ZIM A;  1J8C A;  1F0Z A;  1FCL A;  1ZW7 A;  2C7M B;  1FFU A;  1MFW A;  3TMP B;  1JAL A;  1FNU A;  3HM6 X;  4KZ0 A;  2KKC A;  4RF0 A;  4M8N A;  2OHF A;  4BBN F;  2JU6 X;  2K6Q A;  3IT4 B;  3QCA A;  3VHT C;  2BWE S;  3N30 A;  4LNF A;  4XZ4 A;  3L0W B;  3NS8 A;  1FXT B;  4EZJ A;  3GOE A;  1VCB A;  4P1B C;  3DBS A;  1JRP A;  1CMX B;  3NG0 A;  3ZJT A;  2TSS A;  1SE2 A;  5G5H A;  3DVN U;  1P1A A;  4IW0 A;  3J9C A;  2CHX A;  1Q0W B;  2JYE A; 
#chains in the Genus database with same CATH homology
 2Z59 B;  3ONS A;  1E7V A;  2N1V A;  4AJY B;  5DPR A;  4PS7 A;  4MSQ B;  2FIF A;  3QQ8 B;  4FAD A;  2KFK A;  4GXB A;  2LVQ A;  4MM3 A;  5D2M B;  3RUL A;  3TL5 A;  3MTN B;  3JVZ X;  4DDG D;  3AI5 A;  5E6P A;  2GBM A;  3QC8 B;  3PLU A;  2KTR A;  2D2Q A;  2M8S A;  4DHJ D;  2NPT A;  1WFY A;  4MGI E;  2JT4 B;  3ECI A;  2JXX A;  3RCZ A;  1WJU A;  3WAL A;  3K9P B;  3ALB A;  3ENE A;  2KJR A;  2FID A;  4TUU A;  1WIA A;  1V2Y A;  4EUT A;  3V6E B;  2I1K A;  2KWC A;  4MGY E;  3BY4 B;  1UBI A;  4IM3 A;  4AWJ A;  3RZF A;  2RGF A;  3APC A;  4NQK E;  2KZR A;  4MSM B;  3KH0 A;  3VH4 B;  1NI2 A;  4BBN C;  2IZV B;  2PE6 B;  2ZCB A;  5CHF A;  2C7N B;  2MW5 A;  2D3G A;  3AXC A;  2ASQ A;  2M4N A;  4NPN A;  2UWQ A;  4G11 A;  2CKH B;  3PGE A;  5DCN A;  1LXD A;  2PJH A;  4MGK E;  5LLI A;  2EMS A;  2NS5 A;  3M63 B;  2DHZ A;  5AZF A;  1RAX A;  1WXA A;  4G0N B;  1WGY A;  2K8B A;  3APF A;  2L7R A;  2HJ8 A;  3N32 A;  2KDF B;  3BIN A;  4FN2 A;  1X1M A;  4KSK C;  2AWT A;  1V80 A;  2KVR A;  2XK5 A;  3VVW B;  5J17 A;  4JLC A;  3W1Y A;  2KN5 A;  2EKE C;  1UEL A;  2LJ5 A;  2JRH A;  1EF5 A;  4K7W A;  2N9X A;  5KHO A;  5IA7 A;  2ZNV B;  2LRU A;  2ZPY A;  2IY0 B;  3A9J B;  3K9O B;  2A5U A;  1I35 A;  2V3S A;  3ML8 A;  1WMH A;  2QHO A;  3TBL D;  2C9W B;  4I6L B;  4HPL B;  4W9K A;  3RD2 A;  2IO3 B;  2LWP A;  1E8W A;  5AZH A;  4EKU A;  4W9H A;  1S3S G;  4WJQ A;  1E8X A;  1WE6 A;  4ICU A;  3T8M A;  2IO1 B;  3DVG Y;  1YIW A;  2ZCC A;  2MCN B;  4MJS A;  3JW0 X;  1NDD A;  2PE9 A;  4HWI B;  5CHW A;  5D94 A;  4P7I A;  2MP2 A;  1D3Z A;  3U30 A;  2K39 A;  3KUZ A;  4WWN A;  4ZRJ A;  2V1Y A;  4I6P A;  1L2N A;  1QZE A;  1J19 A;  2J0K A;  4ZRI A;  1ZGU B;  1G6J A;  1KM7 A;  3A4S C;  2B3A A;  2K8H A;  2J0J A;  2UYZ B;  1P3Q U;  4NAW B;  1P9D U;  2KXJ A;  4WJP A;  4FBJ B;  4KV2 A;  3WAM A;  2C5L C;  2LVP A;  2O2V B;  2REX A;  4TQ1 A;  3WIM A;  3OJ4 B;  3QK0 A;  3A9K B;  4JGH B;  5DPS A;  4HJK A;  4ICV A;  3QA8 A;  2Y5B B;  4MDK E;  1PQS A;  1WGR A;  2A4Z A;  4HDO A;  2BGF A;  4ZDV A;  4JL9 A;  5AEK B;  4W9I A;  3A33 B;  3PHX B;  4GDK A;  4AOF A;  3VAW A;  1TGZ B;  1IPG A;  5E6N A;  4YL8 A;  3L16 A;  3UIP B;  3LJ3 A;  2O6V B;  2MWS B;  3VDZ A;  4HK2 A;  1UGM A;  4KIK A;  2LGX A;  1EF1 A;  4F7Z A;  3B1L X;  2RR9 A;  2RSU A;  2WDT B;  4KDL B;  3ZTC A;  2L8J A;  2N9P C;  2M17 A;  1LQB A;  2MBE A;  2KLC A;  2KOX A;  3AUL A;  3V6C B;  3EC8 A;  3MJW A;  2HD5 B;  3KYD D;  4W9D A;  1Y8R C;  2IYD B;  1KJT A;  4PYU A;  1KLV A;  2ZVO A;  2M1M A;  2WYQ A;  2ZVN A;  1GC7 A;  2K6D B;  4XX5 A;  3JYU A;  4W9G A;  4IC7 B;  2WX0 A;  3NZU A;  3M95 A;  4IUM B;  3A1Q B;  2LXA A;  4MGZ E;  4ASW C;  3QWZ B;  4HLE A;  3PS6 A;  3PVL A;  1MG8 A;  3OLM D;  3NOB A;  3KUD B;  2WX1 A;  3VTV A;  1WX7 A;  3HK0 A;  1E5W A;  5EDS A;  4OVV A;  2AL6 A;  2NBW B;  2L05 A;  2L0F A;  2K1F A;  2NPT B;  2LVO A;  2LAS A;  2JZZ A;  2KJ6 A;  4IM0 A;  3WAP A;  2PEA A;  2PPH A;  2KDI A;  4EZL A;  3PT2 B;  3T9L A;  2YVC A;  4JIO U;  4K7U A;  5G55 A;  3X23 A;  3UF8 A;  4CHK A;  4EOY A;  1JRU A;  4NJ7 A;  4W9J A;  3L54 A;  4II2 B;  1WJ4 A;  1RFA A;  4B9K A;  2G3Q B;  4N9F 4;  1I42 A;  1H8C A;  4KZC A;  4LJO B;  4A3O A;  2BYE A;  4DXA B;  3H7P A;  4IWQ A;  5L95 C;  4LDT B;  1V9J A;  2MBH A;  2J7Q B;  1XQQ A;  2DZJ A;  2KAN A;  1WE7 A;  2L76 A;  1YD8 U;  4KDI C;  3ZW3 A;  3HHM A;  2FCM A;  2DZK A;  2LZ6 A;  2C7H A;  3PRE A;  2EMT A;  4GMV A;  4CO7 A;  2KC1 A;  2DX5 B;  2DYB A;  1TTN A;  4HXD A;  2DYM A;  4OVU A;  3WAO A;  1GG3 A;  2G4D B;  5JHB A;  1SE9 A;  4II3 B;  2C60 A;  2IO2 B;  4HCP B;  2M0X A;  2ZNV C;  1WM3 A;  3TCA A;  5JHA A;  2D11 A;  2RPQ A;  4GDL B;  1NBF C;  2I1J A;  4EEW A;  3APD A;  3UIO B;  3NY5 A;  3ZO5 B;  3HIZ A;  1WI0 A;  5LXH A;  4GOC A;  4XC2 A;  1SGH A;  5JH5 C;  1E8Y A;  1OTR B;  2MLB A;  4IM2 A;  1C1Y B;  2IBI B;  3ZNZ B;  2BYF A;  2KK8 A;  3UQA A;  2JVC A;  4FUL A;  2MX2 A;  3ZUN A;  1EO6 A;  3VFK A;  1V86 A;  2CR5 A;  4ANU A;  2GBN A;  2KX0 A;  4PS8 A;  1V5T A;  4DHJ B;  2MBO A;  3MHS D;  1UD7 A;  5D6J B;  3DOW A;  2RD0 A;  3AU4 A;  4IWO A;  4KSL C;  1V5O A;  4F1S A;  1WZ3 A;  1WX9 A;  2KC2 A;  2N1W A;  1E7U A;  4MJS B;  4GIV A;  2MP2 B;  4BKT A;  2FCQ A;  4AP4 C;  4G3X B;  2LD9 A;  1WGD A;  3QIJ A;  4MH0 E;  4GSW A;  3UQB A;  2L00 B;  5JZE B;  2KDE B;  4DWF A;  2KLG A;  2KO3 A;  5J18 A;  2J0M A;  4LJP B;  1WH3 A;  3W1S C;  1M94 A;  3L10 B;  1WR1 A;  3SHQ A;  1H4R A;  3IBE A;  3QAQ A;  4WWP A;  2JF5 A;  4FJY A;  1OEY A;  1WGH A;  2JY6 A;  3D32 A;  3PHW B;  3RZW C;  1YX6 B;  1WZ0 A;  4TKN A;  2CU1 A;  3A9J A;  4TV3 A;  3JSV B;  2JZ3 B;  4DHZ E;  2AYO B;  4DK5 A;  3KUC B;  3NZS A;  2GBK A;  4PYZ A;  4EFO A;  4FLH A;  4AJW A;  4NQL B;  4FHJ A;  3IFW B;  3P2B A;  4W9E A;  1IYF A;  1LFD A;  2KMC A;  4I6N B;  3GZN I;  4EZK A;  3M62 B;  4K1R B;  2MBB B;  3DBL I;  5TR5 A;  3PZD A;  4FA6 A;  2ZEQ A;  3KYC D;  4HDQ A;  1GC6 A;  3CMM B;  2JUO A;  3ZDT A;  1XT9 B;  2FCN A;  1OGW A;  1UH6 A;  2CHZ A;  2NCN A;  2AEH A;  2NVU I;  3Q3J A;  3R3M A;  4NAW A;  3ZKJ C;  2N9E B;  3ZLZ A;  1WXS A;  1WX8 A;  2O2V A;  2DZM A;  1EUV B;  3A9K A;  3QX1 A;  3S2A A;  3SU8 X;  1P98 A;  1VD2 A;  4B6W A;  2BWF A;  2LGY A;  3PRP B;  3IHP C;  3PRM B;  2NBV B;  4HCN B;  2IY1 B;  3UIN B;  2K8C A;  3W1S A;  2KD0 A;  3SD5 A;  3CST A;  4G50 A;  4LDT D;  3PSE B;  2KFK B;  1ISN A;  2DAJ A;  3VUW A;  4ANV A;  1HE8 A;  4GU2 A;  2JWZ A;  4BKS A;  1UBQ A;  2G45 B;  2MBQ A;  5GMV A;  2KTR B;  4RM9 A;  1GUA B;  3EFU A;  1AAR A;  3EHV A;  3IG3 A;  5CHV C;  4WJO A;  3U7D A;  1V6E A;  2Z0D B;  3VH3 B;  4BOZ B;  2DEN B;  4M0W B;  4ZYN A;  3V60 A;  4KVG B;  4K81 A;  3R7Q A;  1YJ1 A;  5G2N A;  3PV1 A;  1WF9 A;  2GBR A;  4GB9 A;  1V81 A;  2VRR B;  3WA0 A;  4RM8 A;  2LUE A;  1BT0 A;  2L3Z A;  3A1Q A;  4CYE A;  2KJH B;  3DVG X;  4BFR A;  5KHQ A;  1GNU A;  1A5R A;  5CX3 A;  2LRW A;  2K25 A;  3EEC A;  1E8Z A;  2JRI B;  2D10 A;  3VTW A;  4NNJ B;  3PLV A;  2LXC A;  1WY8 A;  2KHW B;  2MQJ A;  2NR2 A;  3C0R B;  3ZNI D;  2MSE D;  3DBR I;  3DBH I;  3PTF C;  2IO0 B;  1J0G A;  3DDC B;  1Z5S B;  3X0W A;  4M8M A;  2ZZP B;  2L0T A;  4GN1 A;  1L7Y A;  2KQ7 A;  3NHE B;  2KTF A;  4K7S A;  1KOT A;  3QHT A;  1T0Y A;  1R4M I;  2D07 B;  1WXV A;  2FCS A;  2N7D A;  4HVB A;  3SDL C;  4A3P A;  1TBE A;  4WQO B;  2KX3 A;  4TQ0 A;  1IP9 A;  2ZJD A;  2R2Q A;  2XK5 B;  3CSF A;  5HKH A;  3V62 A;  1Q1O A;  2XEW A;  1ZKH A;  4AUQ C;  2GMI C;  3ZVV A;  2MRP A;  1WRD B;  4RMA A;  3ZRF A;  5C1Z A;  3V61 A;  1E90 A;  3RUI B;  3H1U A;  5J2R A;  1LM8 B;  2DAF A;  3A4R A;  3R7R A;  3O65 B;  4X57 B;  1P0R A;  1RLF A;  1WMH B;  3OAW A;  3PRZ A;  3L17 A;  4W9L A;  5CTR C;  1GJZ A;  5E6O A;  4IWP A;  2KWU B;  2OJR A;  3CF6 E;  4IG7 B;  4FHK A;  4W9F A;  3B08 A;  3IVF A;  2NBU A;  4J6I A;  3ZNH B;  2OOB B;  4FJZ A;  1F9J A;  4ANX A;  2HE7 A;  3U8Z A;  2W9N A;  4FJV B;  1TZ1 A;  2GOW A;  2DZI A;  4GDL A;  2N7E A;  2O6V D;  3H7S A;  3H6N A;  3QJZ A;  5IAA C;  1XD3 B;  1R4N I;  4MEL A;  3L13 A;  1OEY J;  2JPH A;  2HTH A;  3L08 A;  3TJP A;  3VTU A;  4BKS D;  1WJ6 A;  2G4S A;  5C23 A;  4LCD E;  4DHZ B;  3DVN V;  3VQI A;  2LGD A;  3AU5 A;  2KMA A;  3ZRC A;  4URK A;  2LI5 A;  4PS3 A;  1U4A A;  4MEM A;  4BOS C;  1UZX B;  3ZNG C;  1YX5 B;  1V49 A;  4W9C A;  2FUH B;  5BO4 B;  1YQB A;  2DYO A;  2KFJ A;  2AL3 A;  3RT3 B;  3TIX A;  4JQW C;  5DPT A;  2CS4 A;  3KVF B;  2V4L A;  1WR6 E;  1Q5W B;  4GDK B;  4GGQ A;  4WJN A;  3QAR A;  2CHW A;  3WAN A;  4B95 A;  2KWV B;  4F8C B;  1WGG A;  1WM2 A;  4KIK B;  4A20 A;  4E3C A;  2R2O A;  5LXI B;  1C3T A;  3ZDM C;  1WJN A;  4BKG A;  2GBJ A;  3DQV A;  3PPA A;  3VXW A;  3ZTD A;  2BYV E;  4E74 A;  3OJ3 A;  1WXM A;  1K8R B;  3VUY A;  2Z0E B;  2KQS A;  1WYW B;  2FAZ A;  3VUX A;  4E71 A;  2KDB A;  3LDZ E;  2WWZ A;  4BVU C;  3JSV A;  2ZPN A;  3N3K B;  3KW5 B;  5DPW A;  3B0A A;  3ZIM A;  1J8C A;  4ZRK A;  3M3J A;  1SIF A;  2BKF A;  4ANW A;  1ZW7 A;  2FNJ B;  2C7M B;  2YLM A;  2XBB C;  2KNB A;  3TMP B;  4NY0 A;  4NJ6 A;  2N4F A;  3H9D A;  2O6V A;  3HM6 X;  3RYT A;  1RRB A;  4KZ0 A;  2KKC A;  4WAA A;  4DBG A;  4M8N A;  4BBN F;  2K6Q A;  1OQY A;  3QCA A;  5FR6 A;  3VHT C;  2BWE S;  3I3T B;  3DCG A;  3N30 A;  3R66 C;  4XZ4 A;  3L0W B;  2BKR B;  4HPM B;  3NS8 A;  5D7G A;  5L83 A;  1FXT B;  2BPS A;  1S1Q B;  4EZJ A;  3GOE A;  1VCB A;  3DBS A;  3HM3 A;  1CMX B;  4DDI D;  3DPD A;  2BF8 B;  2MA9 B;  3ML9 A;  5AZG A;  3Q3F A;  3DVN U;  3H7P B;  1P1A A;  1Z2M A;  4IW0 A;  2CHX A;  1Q0W B;  3UGB B;  4WWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...