2LFIA

Solution nmr structure of a mucbp domain (fragment 187-294) of the protein lba1460 from lactobacillus acidophilus, northeast structural genomics consortium target lar80a
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
122
structure length
122
Chain Sequence
MIEPIKRTQVVTQTIHYRYEDGAVAHDDHVVSLIFTQSGKRDLTNGKEIWDSKWSLTQTFEALPSPVIIGYTADKPMVGPDEVTVDSKNFLDKQNREETVIYSANTITQNKKDGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Protein LBA1460
publication title Solution NMR structure of a MucBP domain (fragment 187-294) of the protein LBA1460 from Lactobacillus acidophilus, Northeast structural genomics consortium target LaR80A
rcsb
source organism Lactobacillus acidophilus
total genus 16
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2011-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17966 Mub_B2 Mub B2-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.460 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2lfiA00
4MT5A 2LFIA 3Q69A 3NZ3A 3LYYA 3I57A
chains in the Genus database with same CATH superfamily
4C4VB 3DHHC 2KC2A 2XEWA 3ZDMC 3C0RB 2DYMA 3MHZA 3TEWA 4ASWC 2DAJA 4KGSA 1NYQA 1FO4A 3OG5A 4FJYA 5G5HA 1GJZA 4NQKE 3Q3MC 1YIWA 3C8YA 3A9JB 4OHJA 5G2NA 4K3BA 3FKYA 4WWPA 1I35A 2LGSA 5EE1A 1I4QA 1E90A 3MTNB 1K53A 3FILB 3HK0A 2HD5B 2HJ8A 2LGXA 1GNUA 4NZLB 1F77A 1UD7A 2DBYA 4HDOA 1ZP0B 4HKQA 3T3OA 3A1QA 1H8CA 4K7UA 4PYUA 2NS5A 3MC9A 3U7DA 2GOWA 3BY4B 3Q3OC 3H7PB 1WR1A 3WAOA 1UELA 2FUHB 2CKHB 4PS3A 4ZRKA 2IJ0A 1E0ZA 4WQOB 1D3ZA 3K9OB 3R7QA 3WAMA 4DXGA 3P1MA 4KKJA 2KACA 5E6PA 1ZDVA 2YVCA 3IXSA 5FR3A 2ZVNA 1JROA 2Z59B 3A4SC 1NI2A 3PGEA 3L13A 2KK8A 4IWQA 3PT2B 2KWVB 2L1AA 1YJIA 4LJOB 3AEBB 1D6EC 2BYEA 2PE6B 1SE2A 3B08A 1JWAD 2RGFA 4GB9A 2RPVA 1F52A 1VCBA 4A20A 2KD0A 1TKEA 3ONSA 2KYWA 3PTFC 2OJRA 3PV1A 4URKA 2MW5A 2BT6A 2KVRA 3EFCA 1HTQA 4TUUA 3RT3B 3VTWA 4IM3A 2WQYB 1ZGUB 2LJ5A 3QC8B 1JALA 3AV8A 4RGNA 1OEYJ 2IO1B 1N63A 1NVID 2V9HA 1FCLA 1XLPA 1R4MI 2R2QA 3EECA 1XLQA 4OVUA 2N7DA 2N7EA 2ZCBA 3NJTA 4M0WB 3WCQA 4OW0A 2ZNVB 2NBWB 4DHJB 3CMMB 2H88B 4HXDA 1SEBD 2KDEB 1N5XA 2MX2A 3MC8A 2KFKA 2PVOD 5EE3A 4B95A 3ML9A 2AX5A 4MH0E 1WXAA 2LZ6A 3ZNID 2K22A 3A1QB 4IDIA 1ZW7A 2JWUA 4AOFA 3PSEB 3V62A 4I6PA 5HFYA 4MGIE 3AE1B 1C78A 2M4NA 1KM7A 4MELA 2LXAA 3AE7B 2DX5B 2BTEA 1RFKA 3U7ZA 3ZNGC 2C9WB 1WXVA 2LGDA 5GMVA 1TIFA 1UGMA 3RZWC 2L7RA 4K81A 1WXSA 4C80A 1WM3A 4FJVB 2D11A 1FM0D 2BBCA 1EO6A 1AWDA 3LDZE 4W9KA 1UGJA 2KNBA 3JW0X 1YJ1A 2NMQA 2XN9C 4GSWA 4AP4C 2WDRB 3L17A 1SF0A 1Q10A 4HDQA 2K8CA 2WX0A 2K8HA 2WXRA 4ZOHC 2IO3B 2MJDA 4ICUA 1G6JA 1Q0WB 2D5GA 1DYQA 1L2NA 2D3CA 2MJ3A 3DBHB 3N1ZC 1V8CA 2DZJA 3H6NA 5JZEB 1QZEA 4B0EA 3TL5A 1LO5D 5CTRC 1UBQA 2DENB 3QA8A 1IP9A 5CHFA 3VQIA 4XZ4A 4II3B 2VH1A 5IOIA 3UIPB 2AL6A 4IWOA 5H92C 3W1SA 4REZA 2VZKB 2O6VA 1BMLC 3AE2B 1WFYA 2KX3A 5KHQA 3GS2A 4K1RB 3FC4A 3JSVA 4JWUC 2QILA 1EM7A 4WAAA 2JRIB 2CHWA 3UF8A 2KMCA 2BGFA 2LUEA 2WXNA 1P1AA 2WS3B 3DVNU 3KWVA 2H89B 1HTOA 5E6JA 2ZW0A 2FAZA 2KFKB 2DZIA 4WURA 1GB1A 4BFRA 3ZW3A 4PS7A 3D32A 3VUYA 2DZMA 3APFA 5BO4B 2KKCA 4WJNA 3GE3C 3NZUA 4M8NA 2QEJC 3PS6A 2BKFA 3RULA 1K52A 1AYFA 4I6NB 4R3DA 5DPSA 4LNFA 5AZGA 1ACCA 4MJSA 2C7HA 2KC1A 4ARCA 4LLGM 4GLSC 5TSSA 1T3QA 1EF1A 3BVGA 4K7SA 3V60A 4TKNA 1I7HA 2KN5A 2C7NB 1IGDA 1UUPA 3RNFC 1L4DB 3ZQ4A 3O65B 4KZCA 3TIXA 1T0SC 1ET6A 4BKGA 4RNAA 2G9HD 3PVLA 1XT9B 2ON8A 4NAMA 1P0RA 2WP9B 3HVZA 4XDDA 5I4DA 2KFJA 1HEZE 1FNUA 3VAWA 4US8A 2EMTA 2EELA 2V3NA 4S0RA 3TUOA 4FHJA 5BMHA 1FEHA 4GDLA 2L3ZA 2KWDA 4S17A 1TBEA 2FUG1 3Q69A 2YEPF 1DGJA 3U4EG 1VLBA 3B9JA 3PZ7A 2G45B 4ZRJA 4ZHPA 2I1JA 4OVVA 2FCSA 2R2OA 4M8MA 2FCMA 4IW0A 1XO3A 2O6VB 3ZJTA 3NY5A 2Y5BB 3KW5B 4JE3B 1KF6B 4CHKA 2FNJB 3FAHA 2V0GA 3JSVB 2O2VA 1XLOA 2N1WA 2MBHA 1E8WA 2V3SA 5CHWA 2IY0B 4ANXA 1D5ZC 3PRPB 3Q8BA 3PRZA 3KYCD 2ZVOA 4MT5A 2BS2B 1GC7A 2PTLA 2L83A 5IN7A 1KLGD 2M0AA 4E3CA 1WGRA 1WI0A 1RWSA 2ZPNA 3P4SB 4JGHB 3BWUD 3QHTA 1WGHA 3AEDB 2MCNB 4P6VF 4W9JA 1TJEA 3P63A 2DYOA 1IGCA 2J42A 2OEDA 4FJZA 2D3BA 2NBUA 5HKHA 1MHXA 1J7CA 2CJOA 3RZFA 2CJNA 2WXMA 1N5WA 3AE8B 3SHQA 1BXTA 2L76A 3AM9A 3N1YC 2MQJA 3ZGZA 2C60A 3DBLB 1IYFA 2ZEQA 4HPLB 3VH3B 3L0WB 4WIPA 1WR6E 3MJ5A 2ZJDA 2LHEA 3ZDTA 5HI1A 3CWIA 3HM6X 2D3GA 1XCTL 2JZ3B 4KV2A 4GDLB 2UYZB 1Z2MA 5GXGB 4XX5A 2B3AA 2WXHA 4KIKA 1MJDA 1WRDB 4C00A 3AE4B 2CU1A 3BYYB 3M95A 2WHIA 2WXIA 4EZLA 1TY0A 2OHFA 4HWIB 1I4XA 4XE0A 2O2VB 3IBEA 1L0YB 3QCAA 4MH8A 3SFDB 3VRBB 2W55A 4RM9A 4KSKC 1OQRA 4GGQA 4MGZE 2MLBA 1JRUA 2MBQA 4WAFA 1WX8A 2D10A 2B76B 4PT5A 1V49A 3WA0A 1WJ6A 4HCNB 2JPHA 4UDUC 4MACA 1UWXA 2KDFB 1WYGA 2KMAA 3H9DA 1E5WA 3V6CB 1ESFA 1EU4A 5J17A 4NNJB 3AEAB 4FADA 4NJ6A 2C7MB 2HTHA 1OQYA 4RMAA 1QOGA 4MDKE 4XWTA 4NAWB 2K8BA 4P1CC 5FR6A 1TKYA 3JYUA 4XDCA 3TEYA 2K39A 1X1MA 2E6XA 1WGYA 3P4QB 2IY1B 4HK2A 3NG0A 2V4IB 3QK0A 4Q2JA 1R7SA 2QSDA 2XNAC 1TS4A 4A8XC 1WMHA 2Y5PA 3RNAC 5D7GA 2IZVB 4YTNB 1KTKA 2EKIA 2VRRB 3OLMD 3HVDA 4JLCA 1LQBA 3NS1A 3NS8A 1TTNA 2QCZA 3AN1A 4EE2A 3N30A 1VZ7A 2CU3A 2GBKA 2KJHB 1YD8U 4F8CB 1WX9A 4DK5A 3SDLC 1E7VA 4J3OD 3NUHB 4HJKA 2MWSB 1EF5A 2RDGA 2E3TA 3B2FA 2G4SA 2I38A 3NVYA 2KWCA 1FFVA 5FK9C 4ZHOA 1ZE3D 5MPOA 1HZ5A 1EU3A 2RMMA 2FIDA 4C7ZA 3Q8AA 1FRRA 2CS4A 3L10B 3EA6A 2HE7A 1C76A 3ZO5B 4G0NB 1GC6A 1VDVA 3ZLZA 3I3TB 1RYJA 3Q2AC 3AEGB 2GRIA 1IPGA 3O13A 4AUQC 3Q8CA 4YSYB 1R4NB 3W1YA 4YXDB 1LGRA 5AZHA 2BYFA 1E8ZA 3R3MA 4BZAA 1V2YA 2HTME 2NCNA 3DOWA 2KN4A 2NTSA 2W3RA 2NVUI 4KDLB 1EWCA 2FBWB 2LXCA 2PE9A 4KVGB 4HPPA 2BYTA 2K6DB 3L4PA 3P4PB 2DZKA 3GB1A 1QQRA 3SFEB 3ZRCA 1D4BA 4P7IA 1DOIA 2NTTA 1WE6A 1WXMA 2UWQA 1FCCC 2A5UA 4WWNA 2LGIA 3LYYA 4NQLB 1PGXA 3E56A 3MFGA 1ZXIA 2BVCA 3X0WA 1U4AA 4EZJA 4ICVA 4EZKA 4LTUA 3DWGC 1J7BA 4LCDE 3WANA 2WWZA 3GZNB 3VH4B 1LFDA 1JQ4A 4DXFA 2KJ6A 4JWSC 2WU5B 1SB3C 2W54A 5IP4D 3DHGC 1ET9A 2OJWA 3BK1A 4QAYA 4OZCA 1SIFA 1FXAA 3L08A 4XWWA 4DBGA 2JRHA 1JWSD 3EFUA 1RAXA 1MVKA 1LM8B 4TQ0A 2LASA 4IWPA 1N61A 2GLSA 2PVGC 2M17A 1V86A 3HHMA 3QAQA 2M1MA 2PMVA 2IGDA 4RH6A 4EKUA 1QOFA 2BW2A 4HRSA 2D3AA 3BIID 4YWGG 1CQVA 1NYRA 2YLMA 3ABVB 5AEKB 4H2AA 2KTFA 2WXGA 1KLVA 2XBBC 1KJTA 1JWMD 1J8CA 2AEHA 2ZCCA 4L2YA 1OTRB 5D6JB 5JHAA 3VHTC 2WXQA 1ZXHA 3IHPC 3AU5A 2WXLA 2BKRB 1IUEA 1VRAB 4MEMA 2V1YA 3SEBA 1E6EB 2PJHA 1STEA 2KTRA 3RNEC 2LFIA 3ZJVA 3N9YC 2TSSA 2WNMA 4LNOA 2KXJA 3PZDA 1PGBA 5IA7A 3ZTCA 1TS2A 4ZRIA 3W5VB 3V61A 3P2BA 2EMSA 1RFAA 2WU2B 1HZ6A 2L0FA 3QARA 4US9A 1KOTA 1AW7A 4M00A 3UQBA 3BVMA 3DWMA 3EGRA 2KT7A 4KZ0A 3ZVVA 4MGYE 3VR8B 1OQQA 2N9LA 1DOXA 1T0YA 2BB5A 1YQ3B 4XGAB 5DPWA 2FCNA 4N58A 2QJLA 3PO0A 1E10A 2KAJA 3Q3NC 2AQ1B 3RUIB 1YJJA 3RN9C 5EE9A 1QLBB 3DVNV 3U30A 3AU4A 2AL3A 2W3SA 1FD6A 2JVCA 3AB5A 3I63C 1WF9A 3PRMB 3NVZA 2J0JA 1GUAB 1QKZA 3VTVA 2SAKA 1Q1OA 1FPYA 1E8YA 3DBLI 4D2KA 2LJIA 4NPNA 1V97A 4KKIA 2C5LC 1FFUA 1I4HA 2GBMA 3JVZX 2I2YA 5HHDG 3TEXA 3MJWA 1IBXA 5BYSA 2WDTB 4G11A 1YQBA 3N32A 1S1QB 2MEKA 4KDIC 2RDBC 4WJPA 2IPKD 3RYTA 4AS1A 2D07B 5AZFA 3B1LX 1XD3B 4PS8A 5DCNA 1KH0A 3LXFA 3E9SA 1WZ3A 3MC0B 3GP7A 4DHZB 4IUMB 4ACFA 5JXVA 3VTUA 4C56C 3T9LA 1QOBA 1LXDA 1WXQA 2KTRB 4YTPB 2GMIC 3AE5B 1WY8A 3KUCB 1R4MB 1WGDA 4YSZB 1CZPA 2PKOA 5IKCM 5LXHA 3ZIMA 3AE6B 3Q8FA 1YN4A 1MG4A 2JXTA 1TT5B 1VJKA 2FIFA 3KVFB 4TMAB 2KX0A 2GBJA 3Q6BA 2M8SA 5FKAC 4FLHA 5JHBA 1QT9A 1XEEA 1YMHE 1ENFA 2KLGA 1Z5SB 2KDMA 3PHXB 3V05A 3IAS1 1ROEA 3CSTA 1PQSA 3NZSA 4FN2A 3N3KB 3WIMA 5C2TB 3AE9B 4YT0B 3BVZA 2ZNVC 4USAA 3HRDD 4W9IA 3AE3B 1BT0A 3SU8X 3NOBA 3AMZA 4IG7B 1KRHA 4BBNC 1CK1A 4EOYA 2IGHA 2ZW1A 3T3NA 4W9DA 1V1PA 1FMAD 3PHWB 3UINB 2N9KA 1P9DU 4LK0M 4YTMB 3PREA 1TS5A 1I4PA 4JL9A 1T6BX 2LRWA 1M94A 1GB4A 3AEEB 2IGGA 4AWJA 3VUXA 4GDKA 4XYCA 1RLFA 2K6QA 1WH3A 2N1VA 5D3DA 4MSQB 1JW9D 2LD9A 2LVQA 4LNKA 4MJSB 2R61A 4N59A 4RM8A 2D2QA 4HROA 1TS3A 2K9XA 4IC7B 1L6UA 1WRIA 4HVBA 5LNK1 4NY0A 4FXCA 2J4XA 1WX7A 4LDTD 1FRDA 3KWLA 1E9MA 1SJED 2KANA 3M62B 3BZDB 3DPDA 1R4NI 4HCPB 1TZ1A 1T0RC 1QF6A 3KQ4A 4J6IA 3P4RB 1A5RA 3AECB 4RFBA 2IO2B 2GBRA 4ZDVA 5BYQA 2JXXA 2IBIB 3EHVA 1V9JA 1J7AA 4GMVA 4HEA1 1GG3A 1VR9A 2KMMA 1GAQB 1UWMA 3ENEA 3ZNHB 2N9XA 3NHEB 2V3PA 3OJ3A 2QIEB 4A6QA 1K8RB 2MBOA 4EEWA 2MH7A 1QILA 1SE3A 2M56B 1FNVA 2AYOB 3KYDD 3TSSA 3KH0A 4ZRPA 4C7YA 3HIZA 3NVVA 4JPSA 5IAAC 5G55A 2QMTA 2J53A 4XC2A 2W9NA 1JCKB 2BYVE 4KX6B 1DOYA 4WJQA 5D2MB 2BS3B 4BKSD 1SXTA 4ZRQA 3TEZA 1WE7A 4JX1C 3GZNI 1B1ZA 4WQMA 2JYTA 2NR2A 2WDQB 1SSNA 2WGSA 2Y5CA 4ITKA 4MM3A 4KGRA 2LRUA 3DVGX 5BMIA 4E74A 4JQWC 2LEKA 3VVWB 2N9PC 4CQNA 1Q5WB 3RNGC 4N9F4 1ISNA 2JY6A 4G3XB 4HPMB 2BWES 5L83A 3N1XC 2CR5A 3DBRB 2WDVB 5EE0A 4BAXA 1PGAA 1ZKHA 2QHOA 3UQAA 3ZTDA 1SBBB 2X8XX 4BBNF 3NRZA 1L6VA 2N0SB 3RCZA 3DCGA 1N62A 4GN1A 3ZNZB 3V6EB 2LGYA 1C4PA 2JU6X 3GOEA 2UU7A 3UIOB 1L5PA 4LJPB 3DBSA 4MSMB 1L0XB 4RGMA 3HUIA 2FCQA 1C4CA 3HM3A 3MP9A 3PLVA 3URYA 4DDGD 3EUB2 2M19A 1E7UA 1XF5L 2ASQA 2JT4B 5CHVC 2INCC 2J0KA 2K0PA 4M0WA 3PPAA 4ZYSA 1PDXA 1SE9A 2EKEC 2GB1A 2J7QB 3ALBA 3W1SC 2L8JA 1F2RI 3DBHI 2JF5A 4AQ7A 4KIKB 2DHZA 2LVPA 2RSUA 1S3SG 3DQVA 4FHKA 1XLNA 1L0VB 4A3PA 3OWEB 4DHJD 3Q3JA 5L95C 2ACZB 4DDID 1JWUD 2W82A 1TKGA 2CHZA 5C3JB 1C77A 2KHWB 4W9CA 4ANWA 4M02A 3U2SC 2LMCA 4MM3B 1H4RA 1XXGA 3KLSX 1RRBA 1UZXB 1V81A 2DAFA 2G1EA 2QDFA 2L0TA 3H7SA 1NEKB 4DWFA 3ZXRA 3IT4B 2MJEA 4A90A 2IDYA 4X57B 1CMXB 2KZRA 3RPFC 1D5XC 2N9EB 2WYQA 3QIJA 1YQ4B 3SR6A 1C1YB 2INPE 3PZ8A 1WMHB 3NZ3A 1NENB 3N20C 2Q5WD 2RD0A 1JRPA 3W5UB 3AXCA 3I9V1 2DLBA 4BOSC 1PFDA 1ZPSA 3CIRB 5CX3A 4W9LA 1TGZB 3IVFA 2RDHA 2Z0DB 1GPXA 4BKTA 4L1BA 4HKZE 1D5MC 3U52E 1I42A 1HXYD 1YX6B 1M4VA 4RF0A 1TZOA 3UGBB 1V80A 2BF8B 5AUIA 3ZYYX 2MP2A 3LJ3A 4RF1A 1P7EA 3AEFB 3AH7A 3CF6E 2MBEA 1T0QC 1MG8A 4AJYB 4A3OA 5HG2A 1N60A 2VZKD 5C1ZA 2IO0B 1OGWA 3ZUNA 3ZXVA 1T5XD 1XQQA 1ZOYB 1K51A 4IM0A 4W9HA 2MHJA 3APCA 2G4DB 1NDDA 2GI9A 3T8MA 3IAM1 1AARA 3BINA 4FA6A 1UH6A 4BVUC 1Y8RC 2V4LA 1EWYC 1E7PB 1I4RA 5BMGA 2Y3AA 2ZPYA 3ETRA 2K1FA 1YN5A 4GU2A 4ANUA 2WXFA 5EDSA 1F1HA 4DXAB 4MGKE 4B9KA 5H8YE 2KO3A 2WXOA 1L7YA 3ZKJC 4GIVA 2BWFA 1MHHE 3R2TA 1P7FA 4GOCA 4IOIE 3QX1A 3I57A 4WWMA 3QJZA 1YX5B 3OJ4B 1FXIA 1J19A 3VFKA 2KQ7A 2KWUB 3APDA 4HLEA 5J18A 4JIOU 2OOBB 2L52A 5E6NA 2L00B 5LXIB 2JYEA 3B2GA 3PLUA 1A70A 3BK2A 3A4RA 1C4AA 3W2DA 1UF0A 2AQ2B 4K3CA 2SEBD 2JSVX 3KUDB 2JQRB 3TBLD 3RFZB 4A9AA 4NJCA 2MP2B 4B6WA 1SIJA 2BB6A 4II2B 2MBBB 4EUTA 5C23A 1WSPA 2L05A 1RM6C 4N6EB 1NBFC 2O6VD 3BYTB 3VDZA 2BQQA 4DQOC 3QQ8B 1UBIA 3RMKC 2J0MA 2PEAA 4IM2A 1MFWA 1WYWB 2DYBA 2N7JA 2KVZA 1V5OA 3Q8EA 4OZAA 1SJHD 3X23A 5D94A 3B0AA 2WXKA 4CYEA 4RGTA 2XK5A 2PLPA 2AWTA 2JUOA 3GE8C 2ZZPB 2RPQA 2WXJA 3L54A 2NPTA 2M0XA 4M01A 2VH2A 3TJPA 3VRAB 4P1BC 2PPHA 1WJ4A 1WJUA 5JH5C 2DNFA 5LLIA 1F0ZA 4CO7A 3UI3A 2Z8LA 3EC8A 1CJEA 2K25A 4I6LB 1ZDXA 2A4ZA 3Q3FA 3I5JC 2Z0EB 1TYGB 3KUZA 2INDC 2KJRA 1V5TA 1WIAA 2WLBA 3L16A 4TSSA 3ZRFA 5DPTA 3H1UA 3R66C 3DHIC 1L4ZB 1C9FA 3DDCB 1TY2A 3IFWB 1WWTA 3DBRI 1JMLA 2MA9B 3DVGY 2PW9A 1KLUD 3R8BA 1SGHA 3WALA 1N6ZA 4F1SA 4BOZB 2KDBA 1FNWA 1WGKA 1WJNA 1HE8A 5J2RA 1QOAA 1XCQL 3M3JA 5AUKA 2KQ4X 5BYRA 1ZUD2 1VD2A 2I1KA 1MI0A 4FULA 2AQ3B 1GOZA 3A9KA 4NJ7A 2CHXA 4WWOA 1B9RA 5IO9A 1IBXB 2IYDB 4P16A 2KLCA 3VUWA 4GXBA 1EUVB 1Y56A 2QC8A 4WH4A 3TCAA 4KSLC 4K7WA 5D3IB 4HJGE 2WXPA 1C79A 3TMPB 2LWPA 3W9CB 2LVOA 2NBVB 3CSFA 2KOXA 4NAWA 3RI7C 4RCOA 4ANVA 2G3QB 1SE4A 1WGGA 4LNNA 4AJWA 1V1OA 2XK5B 2BPSA 4B0MA 4C4VA 4YSXB 5TR5A 2NPTB 1JWBD 1V6EA 1F2RC 5E6OA 3MHSD 2LHDA 3C19A 1UNSA 2JZPA 2KDIA 3H8HA 1P3QU 1KFYB 1BUIC 2HJ1A 4IKGA 3U8ZA 4F7ZA 3A9JA 2JZZA 4LNIA 1WM2A 4W9EA 2INNE 4TQ1A 1P98A 1VZ6A 2MSED 3R7RA 4KGTA 2JX5A 2L32A 1WZ0A 3ZJUA 4BKSA 3FILA 3K9PB 2KQSA 3P42A 3LB8C 1AN8A 3Q14C 4DHZE 3J9CA 1I4GA 2DWQA 2HDEA 3A33B 2REXA 2J52A 2GBNA 1HQRD 4E71A 5T8IA 4WJOA 3H7PA 1E8XA 4G50A 4FBJB 2K3UA 3IT6B 4ARIA 1F9JA 3SD5A 4A55A 1FIQA 1V1PB 2FE8A 5DPRA 1C3TA 4EFOA 2JWZA 4O1NA 1PUTA 3RNBC 4L23A 4OZBA 3VXWA 3A9KB 1HA5A 4OVZA 3AULA 1YOVB 3M63B 2YEPB 2ONQA 2X38A 4GDKB 3R2IA 1YNTE 1FXTB 4LDTB 1VZ8A 4PYZA 5G5GA 3AI5A 2ICIA 4PK1A 3ML8A 1MPEA 2MRPA 2K5PA 4YL8A 1OEYA 3NVWA 3RD2A 3RNCC 3QWZB 2PIAA 1NI3A 4RGOS 3VR9B 1K50A 2RR9A 4TV3A 4W9FA 3WAPA 1OFFA 2LUMA 3OAWA 1J0GA 4W9GA 3S2AA 4ZYNA 2N4FA 2BS4B 1PYWD 3V3XA 2LI5A 2WX1A 1YN3A 5KHOA 3IG3A 3ECIA
chains in the Genus database with same CATH topology
1D5MC 1FFUA 1HXYD 1I4HA 1M4VA 4RF0A 1TZOA 3AEDB 2I2YA 5HHDG 3TEXA 1IBXA 5BYSA 4P6VF 2DYMA 3MHZA 5AUIA 3ZYYX 3TEWA 1TJEA 3P63A 2DYOA 1IGCA 4RF1A 4KGSA 1P7EA 1NYQA 3AEFB 2J42A 3AH7A 1FO4A 2OEDA 2MEKA 5G5HA 2IPKD 1MHXA 4AS1A 5HG2A 1J7CA 1N60A 2VZKD 2CJOA 2CJNA 3C8YA 4OHJA 2WXMA 1KH0A 3LXFA 1N5WA 3AE8B 1BXTA 3E9SA 3MC0B 5EE1A 3GP7A 1T5XD 1ZOYB 1I4QA 3AM9A 1K51A 3ZGZA 1K53A 3FILB 5JXVA 4C56C 4NZLB 1QOBA 1F77A 2DBYA 1WXQA 2GI9A 4WIPA 1ZP0B 3IAM1 4HKQA 4YTPB 3AE5B 3T3OA 3MJ5A 2LHEA 1EWYC 4YSZB 1E7PB 1I4RA 5BMGA 2Y3AA 1CZPA 2PKOA 5HI1A 3CWIA 3ETRA 3AE6B 3Q8FA 1YN4A 1YN5A 1XCTL 2IJ0A 1E0ZA 2WXFA 2JXTA 4GDLB 1VJKA 4DXGA 3P1MA 4KKJA 2KACA 4TMAB 5GXGB 5H8YE 1ZDVA 5FKAC 3IXSA 2WXHA 2WXOA 1QT9A 5FR3A 1XEEA 1JROA 1YMHE 1ENFA 3AE4B 2KDMA 3BYYB 3V05A 3IAS1 2WXIA 1ROEA 1MHHE 3R2TA 1P7FA 1TY0A 2OHFA 4IOIE 1I4XA 3I57A 4WWMA 4XE0A 1L0YB 4MH8A 3SFDB 3VRBB 2W55A 2L1AA 3AE9B 5C2TB 1YJIA 4YT0B 1FXIA 3BVZA 4USAA 3HRDD 1OQRA 3AE3B 3AEBB 1D6EC 4WAFA 3AMZA 2B76B 4PT5A 1SE2A 1KRHA 1CK1A 2IGHA 1JWAD 2L52A 2ZW1A 4MACA 4UDUC 3T3NA 1UWXA 1V1PA 1WYGA 1FMAD 2RPVA 2JYEA 3B2GA 2N9KA 1ESFA 1EU4A 4LK0M 4YTMB 1A70A 1I4PA 1TS5A 1TKEA 1T6BX 3BK2A 3AEAB 1C4AA 3W2DA 1QOGA 2AQ2B 4XWTA 1GB4A 4NAWB 3AEEB 2BT6A 2IGGA 2SEBD 2JSVX 2JQRB 1TKYA 3RFZB 4A9AA 4XDCA 3TEYA 2WQYB 4NJCA 1SIJA 2E6XA 3P4QB 1JALA 3AV8A 4RGNA 1N63A 1NVID 2V4IB 5D3DA 1JW9D 4Q2JA 2BB6A 1FCLA 1R7SA 2QSDA 2XNAC 1WSPA 1XLPA 1TS4A 4A8XC 1RM6C 2R61A 4N6EB 2Y5PA 1XLQA 4N59A 5D7GA 3BYTB 4HROA 1KTKA 4YTNB 2EKIA 3U52E 4DQOC 1TS3A 2K9XA 3HVDA 1L6UA 3NS1A 3WCQA 4OW0A 1WRIA 5LNK1 4FXCA 2J4XA 2H88B 3AN1A 4EE2A 1SEBD 1FRDA 1VZ7A 2CU3A 3KWLA 1E9MA 1SJED 1N5XA 3BZDB 2N7JA 3Q8EA 2PVOD 5EE3A 4OZAA 1QF6A 2AX5A 3KQ4A 1SJHD 4J3OD 3NUHB 2K22A 4IDIA 3P4RB 2JWUA 2RDGA 2E3TA 3B2FA 3AECB 4RFBA 2I38A 3NVYA 2WXKA 5BYQA 1FFVA 4RGTA 5FK9C 4ZHOA 1ZE3D 5HFYA 3AE1B 5MPOA 2PLPA 1C78A 1HZ5A 1J7AA 4HEA1 1EU3A 2RMMA 4C7ZA 3Q8AA 1FRRA 1VR9A 2KMMA 1GAQB 1UWMA 2WXJA 3EA6A 3AE7B 2BTEA 1RFKA 2V3PA 3U7ZA 2QIEB 1C76A 3VRAB 4A6QA 1VDVA 2MH7A 1RYJA 4C80A 3AEGB 2GRIA 1F0ZA 1QILA 1FM0D 1SE3A 2M56B 2BBCA 3O13A 1FNVA 3UI3A 2Z8LA 3Q8CA 4YSYB 1CJEA 1AWDA 1ZDXA 3TSSA 4YXDB 4ZRPA 1TYGB 1UGJA 4TSSA 2WLBA 4C7YA 3NVVA 4JPSA 2NMQA 2J53A 2QMTA 2XN9C 1L4ZB 2HTME 1C9FA 1JCKB 2WDRB 4KX6B 1SF0A 1DOYA 1Q10A 1TY2A 2WXRA 2KN4A 2NTSA 2W3RA 2MJDA 4ZOHC 2BS3B 1SXTA 1WWTA 2D5GA 4ZRQA 1DYQA 1EWCA 3TEZA 2FBWB 4JX1C 1B1ZA 1JMLA 2MJ3A 4WQMA 1V8CA 2PW9A 2JYTA 1KLUD 2WDQB 3R8BA 1SSNA 2BYTA 2Y5CA 3L4PA 4ITKA 4B0EA 4KGRA 3P4PB 1LO5D 1FNWA 1WGKA 5BMIA 3GB1A 1QQRA 1QOAA 1XCQL 3SFEB 5AUKA 2LEKA 3VQIA 1D4BA 2KQ4X 5BYRA 1ZUD2 1DOIA 2NTTA 4CQNA 1FCCC 1MI0A 2LGIA 3LYYA 1PGXA 5H92C 3W1SA 4REZA 2AQ3B 2VZKB 3E56A 1GOZA 3MFGA 1ZXIA 1BMLC 1B9RA 3AE2B 4LTUA 3DWGC 1IBXB 1J7BA 3GS2A 4P16A 3FC4A 4JWUC 2QILA 1JQ4A 1EM7A 1Y56A 2WDVB 4DXFA 5EE0A 4JWSC 2WU5B 1SB3C 2W54A 1PGAA 4WH4A 1ET9A 3BK1A 1SBBB 2WXNA 4OZCA 3NRZA 5D3IB 1FXAA 2WS3B 1C79A 1L6VA 2WXPA 3KWVA 2H89B 2N0SB 4HJGE 5E6JA 4XWWA 3W9CB 2ZW0A 1JWSD 1N62A 4WURA 1GB1A 1MVKA 4TQ0A 1C4PA 2JU6X 4RCOA 1N61A 1L5PA 2PVGC 1SE4A 1V1OA 1L0XB 4RGMA 2PMVA 3HUIA 2IGDA 4B0MA 2QEJC 4YSXB 1K52A 1C4CA 3MP9A 4RH6A 1AYFA 3URYA 4R3DA 1JWBD 1QOFA 3EUB2 1F2RC 2M19A 1ACCA 1XF5L 2LHDA 1UNSA 2BW2A 4HRSA 2JZPA 3BIID 4ARCA 4LLGM 4YWGG 3H8HA 2K0PA 1CQVA 4M0WA 1KFYB 4GLSC 1PDXA 1NYRA 1BUIC 3ABVB 5TSSA 4ZYSA 1T3QA 4IKGA 3BVGA 2GB1A 4H2AA 1F2RI 1I7HA 2WXGA 1IGDA 1UUPA 1JWMD 2INNE 4AQ7A 4L2YA 4TQ1A 1VZ6A 1L4DB 4KGTA 2JX5A 2L32A 2WXQA 3ZQ4A 1ZXHA 3ZJUA 3FILA 3P42A 1ET6A 2WXLA 1XLNA 1L0VB 3LB8C 3OWEB 1AN8A 1IUEA 4RNAA 1VRAB 2ACZB 2G9HD 3SEBA 1E6EB 1I4GA 3J9CA 1STEA 2DWQA 2HDEA 2LFIA 3ZJVA 1JWUD 2ON8A 2W82A 2J52A 4NAMA 3N9YC 1TKGA 2TSSA 1HQRD 2WNMA 2WP9B 3HVZA 4XDDA 5C3JB 5I4DA 5T8IA 1C77A 1HEZE 1PGBA 1FNUA 2K3UA 3IT6B 4US8A 3U2SC 2LMCA 4ARIA 4MM3B 2EELA 1XXGA 2V3NA 1TS2A 3TUOA 3KLSX 3W5VB 5BMHA 4A55A 1FIQA 1V1PB 1FEHA 2KWDA 2WU2B 2FE8A 2FUG1 2G1EA 3Q69A 1HZ6A 2YEPF 4US9A 1DGJA 3U4EG 4O1NA 1AW7A 1PUTA 1NEKB 3BVMA 4L23A 4OZBA 1VLBA 3B9JA 3DWMA 3PZ7A 3EGRA 4ZHPA 1XO3A 3BWUD 3IT4B 1HA5A 2MJEA 4OVZA 3ZJTA 3VR8B 1OQQA 2N9LA 1DOXA 4A90A 2IDYA 2YEPB 4JE3B 2ONQA 1KF6B 2X38A 4GDKB 3R2IA 2BB5A 3RPFC 1YNTE 1YQ3B 1D5XC 3FAHA 2V0GA 1VZ8A 5G5GA 1XLOA 4N58A 2ICIA 1YQ4B 3SR6A 1MPEA 2QJLA 2K5PA 3PO0A 1E10A 2KAJA 2INPE 2AQ1B 1YJJA 3NVWA 3PZ8A 1D5ZC 2PIAA 3Q8BA 3NZ3A 1NI3A 1NENB 4RGOS 5EE9A 1K50A 1QLBB 2Q5WD 3VR9B 1JRPA 3W5UB 2W3SA 4MT5A 1OFFA 2BS2B 3I9V1 2DLBA 2LUMA 2PTLA 1PFDA 1ZPSA 2L83A 3CIRB 1FD6A 3AB5A 1KLGD 2M0AA 1RWSA 3NVZA 1QKZA 2BS4B 1PYWD 3P4SB 2RDHA 2SAKA 3V3XA 1YN3A 4D2KA 2LJIA 1GPXA 1V97A 4KKIA 4L1BA 4HKZE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MT5 A;  2LFI A;  3Q69 A;  3NZ3 A;  3LYY A;  3I57 A; 
#chains in the Genus database with same CATH topology
 4C4V B;  3DHH C;  2KC2 A;  2XEW A;  3ZDM C;  3C0R B;  2DYM A;  3MHZ A;  3TEW A;  4ASW C;  2DAJ A;  4KGS A;  1NYQ A;  1FO4 A;  3OG5 A;  4FJY A;  5G5H A;  1GJZ A;  4NQK E;  3Q3M C;  1YIW A;  3C8Y A;  3A9J B;  4OHJ A;  5G2N A;  4K3B A;  3FKY A;  4WWP A;  1I35 A;  2LGS A;  5EE1 A;  1I4Q A;  1E90 A;  3MTN B;  1K53 A;  3FIL B;  3HK0 A;  2HD5 B;  2HJ8 A;  2LGX A;  1GNU A;  4NZL B;  1F77 A;  1UD7 A;  2DBY A;  4HDO A;  1ZP0 B;  4HKQ A;  3T3O A;  3A1Q A;  1H8C A;  4K7U A;  4PYU A;  2NS5 A;  3MC9 A;  3U7D A;  2GOW A;  3BY4 B;  3Q3O C;  3H7P B;  1WR1 A;  3WAO A;  1UEL A;  2FUH B;  2CKH B;  4PS3 A;  4ZRK A;  2IJ0 A;  1E0Z A;  4WQO B;  1D3Z A;  3K9O B;  3R7Q A;  3WAM A;  4DXG A;  3P1M A;  4KKJ A;  2KAC A;  5E6P A;  1ZDV A;  2YVC A;  3IXS A;  5FR3 A;  2ZVN A;  1JRO A;  2Z59 B;  3A4S C;  1NI2 A;  3PGE A;  3L13 A;  2KK8 A;  4IWQ A;  3PT2 B;  2KWV B;  2L1A A;  1YJI A;  4LJO B;  3AEB B;  1D6E C;  2BYE A;  2PE6 B;  1SE2 A;  3B08 A;  1JWA D;  2RGF A;  4GB9 A;  2RPV A;  1F52 A;  1VCB A;  4A20 A;  2KD0 A;  1TKE A;  3ONS A;  2KYW A;  3PTF C;  2OJR A;  3PV1 A;  4URK A;  2MW5 A;  2BT6 A;  2KVR A;  3EFC A;  1HTQ A;  4TUU A;  3RT3 B;  3VTW A;  4IM3 A;  2WQY B;  1ZGU B;  2LJ5 A;  3QC8 B;  1JAL A;  3AV8 A;  4RGN A;  1OEY J;  2IO1 B;  1N63 A;  1NVI D;  2V9H A;  1FCL A;  1XLP A;  1R4M I;  2R2Q A;  3EEC A;  1XLQ A;  4OVU A;  2N7D A;  2N7E A;  2ZCB A;  3NJT A;  4M0W B;  3WCQ A;  4OW0 A;  2ZNV B;  2NBW B;  4DHJ B;  3CMM B;  2H88 B;  4HXD A;  1SEB D;  2KDE B;  1N5X A;  2MX2 A;  3MC8 A;  2KFK A;  2PVO D;  5EE3 A;  4B95 A;  3ML9 A;  2AX5 A;  4MH0 E;  1WXA A;  2LZ6 A;  3ZNI D;  2K22 A;  3A1Q B;  4IDI A;  1ZW7 A;  2JWU A;  4AOF A;  3PSE B;  3V62 A;  4I6P A;  5HFY A;  4MGI E;  3AE1 B;  1C78 A;  2M4N A;  1KM7 A;  4MEL A;  2LXA A;  3AE7 B;  2DX5 B;  2BTE A;  1RFK A;  3U7Z A;  3ZNG C;  2C9W B;  1WXV A;  2LGD A;  5GMV A;  1TIF A;  1UGM A;  3RZW C;  2L7R A;  4K81 A;  1WXS A;  4C80 A;  1WM3 A;  4FJV B;  2D11 A;  1FM0 D;  2BBC A;  1EO6 A;  1AWD A;  3LDZ E;  4W9K A;  1UGJ A;  2KNB A;  3JW0 X;  1YJ1 A;  2NMQ A;  2XN9 C;  4GSW A;  4AP4 C;  2WDR B;  3L17 A;  1SF0 A;  1Q10 A;  4HDQ A;  2K8C A;  2WX0 A;  2K8H A;  2WXR A;  4ZOH C;  2IO3 B;  2MJD A;  4ICU A;  1G6J A;  1Q0W B;  2D5G A;  1DYQ A;  1L2N A;  2D3C A;  2MJ3 A;  3DBH B;  3N1Z C;  1V8C A;  2DZJ A;  3H6N A;  5JZE B;  1QZE A;  4B0E A;  3TL5 A;  1LO5 D;  5CTR C;  1UBQ A;  2DEN B;  3QA8 A;  1IP9 A;  5CHF A;  3VQI A;  4XZ4 A;  4II3 B;  2VH1 A;  5IOI A;  3UIP B;  2AL6 A;  4IWO A;  5H92 C;  3W1S A;  4REZ A;  2VZK B;  2O6V A;  1BML C;  3AE2 B;  1WFY A;  2KX3 A;  5KHQ A;  3GS2 A;  4K1R B;  3FC4 A;  3JSV A;  4JWU C;  2QIL A;  1EM7 A;  4WAA A;  2JRI B;  2CHW A;  3UF8 A;  2KMC A;  2BGF A;  2LUE A;  2WXN A;  1P1A A;  2WS3 B;  3DVN U;  3KWV A;  2H89 B;  1HTO A;  5E6J A;  2ZW0 A;  2FAZ A;  2KFK B;  2DZI A;  4WUR A;  1GB1 A;  4BFR A;  3ZW3 A;  4PS7 A;  3D32 A;  3VUY A;  2DZM A;  3APF A;  5BO4 B;  2KKC A;  4WJN A;  3GE3 C;  3NZU A;  4M8N A;  2QEJ C;  3PS6 A;  2BKF A;  3RUL A;  1K52 A;  1AYF A;  4I6N B;  4R3D A;  5DPS A;  4LNF A;  5AZG A;  1ACC A;  4MJS A;  2C7H A;  2KC1 A;  4ARC A;  4LLG M;  4GLS C;  5TSS A;  1T3Q A;  1EF1 A;  3BVG A;  4K7S A;  3V60 A;  4TKN A;  1I7H A;  2KN5 A;  2C7N B;  1IGD A;  1UUP A;  3RNF C;  1L4D B;  3ZQ4 A;  3O65 B;  4KZC A;  3TIX A;  1T0S C;  1ET6 A;  4BKG A;  4RNA A;  2G9H D;  3PVL A;  1XT9 B;  2ON8 A;  4NAM A;  1P0R A;  2WP9 B;  3HVZ A;  4XDD A;  5I4D A;  2KFJ A;  1HEZ E;  1FNU A;  3VAW A;  4US8 A;  2EMT A;  2EEL A;  2V3N A;  4S0R A;  3TUO A;  4FHJ A;  5BMH A;  1FEH A;  4GDL A;  2L3Z A;  2KWD A;  4S17 A;  1TBE A;  2FUG 1;  3Q69 A;  2YEP F;  1DGJ A;  3U4E G;  1VLB A;  3B9J A;  3PZ7 A;  2G45 B;  4ZRJ A;  4ZHP A;  2I1J A;  4OVV A;  2FCS A;  2R2O A;  4M8M A;  2FCM A;  4IW0 A;  1XO3 A;  2O6V B;  3ZJT A;  3NY5 A;  2Y5B B;  3KW5 B;  4JE3 B;  1KF6 B;  4CHK A;  2FNJ B;  3FAH A;  2V0G A;  3JSV B;  2O2V A;  1XLO A;  2N1W A;  2MBH A;  1E8W A;  2V3S A;  5CHW A;  2IY0 B;  4ANX A;  1D5Z C;  3PRP B;  3Q8B A;  3PRZ A;  3KYC D;  2ZVO A;  4MT5 A;  2BS2 B;  1GC7 A;  2PTL A;  2L83 A;  5IN7 A;  1KLG D;  2M0A A;  4E3C A;  1WGR A;  1WI0 A;  1RWS A;  2ZPN A;  3P4S B;  4JGH B;  3BWU D;  3QHT A;  1WGH A;  3AED B;  2MCN B;  4P6V F;  4W9J A;  1TJE A;  3P63 A;  2DYO A;  1IGC A;  2J42 A;  2OED A;  4FJZ A;  2D3B A;  2NBU A;  5HKH A;  1MHX A;  1J7C A;  2CJO A;  3RZF A;  2CJN A;  2WXM A;  1N5W A;  3AE8 B;  3SHQ A;  1BXT A;  2L76 A;  3AM9 A;  3N1Y C;  2MQJ A;  3ZGZ A;  2C60 A;  3DBL B;  1IYF A;  2ZEQ A;  4HPL B;  3VH3 B;  3L0W B;  4WIP A;  1WR6 E;  3MJ5 A;  2ZJD A;  2LHE A;  3ZDT A;  5HI1 A;  3CWI A;  3HM6 X;  2D3G A;  1XCT L;  2JZ3 B;  4KV2 A;  4GDL B;  2UYZ B;  1Z2M A;  5GXG B;  4XX5 A;  2B3A A;  2WXH A;  4KIK A;  1MJD A;  1WRD B;  4C00 A;  3AE4 B;  2CU1 A;  3BYY B;  3M95 A;  2WHI A;  2WXI A;  4EZL A;  1TY0 A;  2OHF A;  4HWI B;  1I4X A;  4XE0 A;  2O2V B;  3IBE A;  1L0Y B;  3QCA A;  4MH8 A;  3SFD B;  3VRB B;  2W55 A;  4RM9 A;  4KSK C;  1OQR A;  4GGQ A;  4MGZ E;  2MLB A;  1JRU A;  2MBQ A;  4WAF A;  1WX8 A;  2D10 A;  2B76 B;  4PT5 A;  1V49 A;  3WA0 A;  1WJ6 A;  4HCN B;  2JPH A;  4UDU C;  4MAC A;  1UWX A;  2KDF B;  1WYG A;  2KMA A;  3H9D A;  1E5W A;  3V6C B;  1ESF A;  1EU4 A;  5J17 A;  4NNJ B;  3AEA B;  4FAD A;  4NJ6 A;  2C7M B;  2HTH A;  1OQY A;  4RMA A;  1QOG A;  4MDK E;  4XWT A;  4NAW B;  2K8B A;  4P1C C;  5FR6 A;  1TKY A;  3JYU A;  4XDC A;  3TEY A;  2K39 A;  1X1M A;  2E6X A;  1WGY A;  3P4Q B;  2IY1 B;  4HK2 A;  3NG0 A;  2V4I B;  3QK0 A;  4Q2J A;  1R7S A;  2QSD A;  2XNA C;  1TS4 A;  4A8X C;  1WMH A;  2Y5P A;  3RNA C;  5D7G A;  2IZV B;  4YTN B;  1KTK A;  2EKI A;  2VRR B;  3OLM D;  3HVD A;  4JLC A;  1LQB A;  3NS1 A;  3NS8 A;  1TTN A;  2QCZ A;  3AN1 A;  4EE2 A;  3N30 A;  1VZ7 A;  2CU3 A;  2GBK A;  2KJH B;  1YD8 U;  4F8C B;  1WX9 A;  4DK5 A;  3SDL C;  1E7V A;  4J3O D;  3NUH B;  4HJK A;  2MWS B;  1EF5 A;  2RDG A;  2E3T A;  3B2F A;  2G4S A;  2I38 A;  3NVY A;  2KWC A;  1FFV A;  5FK9 C;  4ZHO A;  1ZE3 D;  5MPO A;  1HZ5 A;  1EU3 A;  2RMM A;  2FID A;  4C7Z A;  3Q8A A;  1FRR A;  2CS4 A;  3L10 B;  3EA6 A;  2HE7 A;  1C76 A;  3ZO5 B;  4G0N B;  1GC6 A;  1VDV A;  3ZLZ A;  3I3T B;  1RYJ A;  3Q2A C;  3AEG B;  2GRI A;  1IPG A;  3O13 A;  4AUQ C;  3Q8C A;  4YSY B;  1R4N B;  3W1Y A;  4YXD B;  1LGR A;  5AZH A;  2BYF A;  1E8Z A;  3R3M A;  4BZA A;  1V2Y A;  2HTM E;  2NCN A;  3DOW A;  2KN4 A;  2NTS A;  2W3R A;  2NVU I;  4KDL B;  1EWC A;  2FBW B;  2LXC A;  2PE9 A;  4KVG B;  4HPP A;  2BYT A;  2K6D B;  3L4P A;  3P4P B;  2DZK A;  3GB1 A;  1QQR A;  3SFE B;  3ZRC A;  1D4B A;  4P7I A;  1DOI A;  2NTT A;  1WE6 A;  1WXM A;  2UWQ A;  1FCC C;  2A5U A;  4WWN A;  2LGI A;  3LYY A;  4NQL B;  1PGX A;  3E56 A;  3MFG A;  1ZXI A;  2BVC A;  3X0W A;  1U4A A;  4EZJ A;  4ICV A;  4EZK A;  4LTU A;  3DWG C;  1J7B A;  4LCD E;  3WAN A;  2WWZ A;  3GZN B;  3VH4 B;  1LFD A;  1JQ4 A;  4DXF A;  2KJ6 A;  4JWS C;  2WU5 B;  1SB3 C;  2W54 A;  5IP4 D;  3DHG C;  1ET9 A;  2OJW A;  3BK1 A;  4QAY A;  4OZC A;  1SIF A;  1FXA A;  3L08 A;  4XWW A;  4DBG A;  2JRH A;  1JWS D;  3EFU A;  1RAX A;  1MVK A;  1LM8 B;  4TQ0 A;  2LAS A;  4IWP A;  1N61 A;  2GLS A;  2PVG C;  2M17 A;  1V86 A;  3HHM A;  3QAQ A;  2M1M A;  2PMV A;  2IGD A;  4RH6 A;  4EKU A;  1QOF A;  2BW2 A;  4HRS A;  2D3A A;  3BII D;  4YWG G;  1CQV A;  1NYR A;  2YLM A;  3ABV B;  5AEK B;  4H2A A;  2KTF A;  2WXG A;  1KLV A;  2XBB C;  1KJT A;  1JWM D;  1J8C A;  2AEH A;  2ZCC A;  4L2Y A;  1OTR B;  5D6J B;  5JHA A;  3VHT C;  2WXQ A;  1ZXH A;  3IHP C;  3AU5 A;  2WXL A;  2BKR B;  1IUE A;  1VRA B;  4MEM A;  2V1Y A;  3SEB A;  1E6E B;  2PJH A;  1STE A;  2KTR A;  3RNE C;  2LFI A;  3ZJV A;  3N9Y C;  2TSS A;  2WNM A;  4LNO A;  2KXJ A;  3PZD A;  1PGB A;  5IA7 A;  3ZTC A;  1TS2 A;  4ZRI A;  3W5V B;  3V61 A;  3P2B A;  2EMS A;  1RFA A;  2WU2 B;  1HZ6 A;  2L0F A;  3QAR A;  4US9 A;  1KOT A;  1AW7 A;  4M00 A;  3UQB A;  3BVM A;  3DWM A;  3EGR A;  2KT7 A;  4KZ0 A;  3ZVV A;  4MGY E;  3VR8 B;  1OQQ A;  2N9L A;  1DOX A;  1T0Y A;  2BB5 A;  1YQ3 B;  4XGA B;  5DPW A;  2FCN A;  4N58 A;  2QJL A;  3PO0 A;  1E10 A;  2KAJ A;  3Q3N C;  2AQ1 B;  3RUI B;  1YJJ A;  3RN9 C;  5EE9 A;  1QLB B;  3DVN V;  3U30 A;  3AU4 A;  2AL3 A;  2W3S A;  1FD6 A;  2JVC A;  3AB5 A;  3I63 C;  1WF9 A;  3PRM B;  3NVZ A;  2J0J A;  1GUA B;  1QKZ A;  3VTV A;  2SAK A;  1Q1O A;  1FPY A;  1E8Y A;  3DBL I;  4D2K A;  2LJI A;  4NPN A;  1V97 A;  4KKI A;  2C5L C;  1FFU A;  1I4H A;  2GBM A;  3JVZ X;  2I2Y A;  5HHD G;  3TEX A;  3MJW A;  1IBX A;  5BYS A;  2WDT B;  4G11 A;  1YQB A;  3N32 A;  1S1Q B;  2MEK A;  4KDI C;  2RDB C;  4WJP A;  2IPK D;  3RYT A;  4AS1 A;  2D07 B;  5AZF A;  3B1L X;  1XD3 B;  4PS8 A;  5DCN A;  1KH0 A;  3LXF A;  3E9S A;  1WZ3 A;  3MC0 B;  3GP7 A;  4DHZ B;  4IUM B;  4ACF A;  5JXV A;  3VTU A;  4C56 C;  3T9L A;  1QOB A;  1LXD A;  1WXQ A;  2KTR B;  4YTP B;  2GMI C;  3AE5 B;  1WY8 A;  3KUC B;  1R4M B;  1WGD A;  4YSZ B;  1CZP A;  2PKO A;  5IKC M;  5LXH A;  3ZIM A;  3AE6 B;  3Q8F A;  1YN4 A;  1MG4 A;  2JXT A;  1TT5 B;  1VJK A;  2FIF A;  3KVF B;  4TMA B;  2KX0 A;  2GBJ A;  3Q6B A;  2M8S A;  5FKA C;  4FLH A;  5JHB A;  1QT9 A;  1XEE A;  1YMH E;  1ENF A;  2KLG A;  1Z5S B;  2KDM A;  3PHX B;  3V05 A;  3IAS 1;  1ROE A;  3CST A;  1PQS A;  3NZS A;  4FN2 A;  3N3K B;  3WIM A;  5C2T B;  3AE9 B;  4YT0 B;  3BVZ A;  2ZNV C;  4USA A;  3HRD D;  4W9I A;  3AE3 B;  1BT0 A;  3SU8 X;  3NOB A;  3AMZ A;  4IG7 B;  1KRH A;  4BBN C;  1CK1 A;  4EOY A;  2IGH A;  2ZW1 A;  3T3N A;  4W9D A;  1V1P A;  1FMA D;  3PHW B;  3UIN B;  2N9K A;  1P9D U;  4LK0 M;  4YTM B;  3PRE A;  1TS5 A;  1I4P A;  4JL9 A;  1T6B X;  2LRW A;  1M94 A;  1GB4 A;  3AEE B;  2IGG A;  4AWJ A;  3VUX A;  4GDK A;  4XYC A;  1RLF A;  2K6Q A;  1WH3 A;  2N1V A;  5D3D A;  4MSQ B;  1JW9 D;  2LD9 A;  2LVQ A;  4LNK A;  4MJS B;  2R61 A;  4N59 A;  4RM8 A;  2D2Q A;  4HRO A;  1TS3 A;  2K9X A;  4IC7 B;  1L6U A;  1WRI A;  4HVB A;  5LNK 1;  4NY0 A;  4FXC A;  2J4X A;  1WX7 A;  4LDT D;  1FRD A;  3KWL A;  1E9M A;  1SJE D;  2KAN A;  3M62 B;  3BZD B;  3DPD A;  1R4N I;  4HCP B;  1TZ1 A;  1T0R C;  1QF6 A;  3KQ4 A;  4J6I A;  3P4R B;  1A5R A;  3AEC B;  4RFB A;  2IO2 B;  2GBR A;  4ZDV A;  5BYQ A;  2JXX A;  2IBI B;  3EHV A;  1V9J A;  1J7A A;  4GMV A;  4HEA 1;  1GG3 A;  1VR9 A;  2KMM A;  1GAQ B;  1UWM A;  3ENE A;  3ZNH B;  2N9X A;  3NHE B;  2V3P A;  3OJ3 A;  2QIE B;  4A6Q A;  1K8R B;  2MBO A;  4EEW A;  2MH7 A;  1QIL A;  1SE3 A;  2M56 B;  1FNV A;  2AYO B;  3KYD D;  3TSS A;  3KH0 A;  4ZRP A;  4C7Y A;  3HIZ A;  3NVV A;  4JPS A;  5IAA C;  5G55 A;  2QMT A;  2J53 A;  4XC2 A;  2W9N A;  1JCK B;  2BYV E;  4KX6 B;  1DOY A;  4WJQ A;  5D2M B;  2BS3 B;  4BKS D;  1SXT A;  4ZRQ A;  3TEZ A;  1WE7 A;  4JX1 C;  3GZN I;  1B1Z A;  4WQM A;  2JYT A;  2NR2 A;  2WDQ B;  1SSN A;  2WGS A;  2Y5C A;  4ITK A;  4MM3 A;  4KGR A;  2LRU A;  3DVG X;  5BMI A;  4E74 A;  4JQW C;  2LEK A;  3VVW B;  2N9P C;  4CQN A;  1Q5W B;  3RNG C;  4N9F 4;  1ISN A;  2JY6 A;  4G3X B;  4HPM B;  2BWE S;  5L83 A;  3N1X C;  2CR5 A;  3DBR B;  2WDV B;  5EE0 A;  4BAX A;  1PGA A;  1ZKH A;  2QHO A;  3UQA A;  3ZTD A;  1SBB B;  2X8X X;  4BBN F;  3NRZ A;  1L6V A;  2N0S B;  3RCZ A;  3DCG A;  1N62 A;  4GN1 A;  3ZNZ B;  3V6E B;  2LGY A;  1C4P A;  2JU6 X;  3GOE A;  2UU7 A;  3UIO B;  1L5P A;  4LJP B;  3DBS A;  4MSM B;  1L0X B;  4RGM A;  3HUI A;  2FCQ A;  1C4C A;  3HM3 A;  3MP9 A;  3PLV A;  3URY A;  4DDG D;  3EUB 2;  2M19 A;  1E7U A;  1XF5 L;  2ASQ A;  2JT4 B;  5CHV C;  2INC C;  2J0K A;  2K0P A;  4M0W A;  3PPA A;  4ZYS A;  1PDX A;  1SE9 A;  2EKE C;  2GB1 A;  2J7Q B;  3ALB A;  3W1S C;  2L8J A;  1F2R I;  3DBH I;  2JF5 A;  4AQ7 A;  4KIK B;  2DHZ A;  2LVP A;  2RSU A;  1S3S G;  3DQV A;  4FHK A;  1XLN A;  1L0V B;  4A3P A;  3OWE B;  4DHJ D;  3Q3J A;  5L95 C;  2ACZ B;  4DDI D;  1JWU D;  2W82 A;  1TKG A;  2CHZ A;  5C3J B;  1C77 A;  2KHW B;  4W9C A;  4ANW A;  4M02 A;  3U2S C;  2LMC A;  4MM3 B;  1H4R A;  1XXG A;  3KLS X;  1RRB A;  1UZX B;  1V81 A;  2DAF A;  2G1E A;  2QDF A;  2L0T A;  3H7S A;  1NEK B;  4DWF A;  3ZXR A;  3IT4 B;  2MJE A;  4A90 A;  2IDY A;  4X57 B;  1CMX B;  2KZR A;  3RPF C;  1D5X C;  2N9E B;  2WYQ A;  3QIJ A;  1YQ4 B;  3SR6 A;  1C1Y B;  2INP E;  3PZ8 A;  1WMH B;  3NZ3 A;  1NEN B;  3N20 C;  2Q5W D;  2RD0 A;  1JRP A;  3W5U B;  3AXC A;  3I9V 1;  2DLB A;  4BOS C;  1PFD A;  1ZPS A;  3CIR B;  5CX3 A;  4W9L A;  1TGZ B;  3IVF A;  2RDH A;  2Z0D B;  1GPX A;  4BKT A;  4L1B A;  4HKZ E;  1D5M C;  3U52 E;  1I42 A;  1HXY D;  1YX6 B;  1M4V A;  4RF0 A;  1TZO A;  3UGB B;  1V80 A;  2BF8 B;  5AUI A;  3ZYY X;  2MP2 A;  3LJ3 A;  4RF1 A;  1P7E A;  3AEF B;  3AH7 A;  3CF6 E;  2MBE A;  1T0Q C;  1MG8 A;  4AJY B;  4A3O A;  5HG2 A;  1N60 A;  2VZK D;  5C1Z A;  2IO0 B;  1OGW A;  3ZUN A;  3ZXV A;  1T5X D;  1XQQ A;  1ZOY B;  1K51 A;  4IM0 A;  4W9H A;  2MHJ A;  3APC A;  2G4D B;  1NDD A;  2GI9 A;  3T8M A;  3IAM 1;  1AAR A;  3BIN A;  4FA6 A;  1UH6 A;  4BVU C;  1Y8R C;  2V4L A;  1EWY C;  1E7P B;  1I4R A;  5BMG A;  2Y3A A;  2ZPY A;  3ETR A;  2K1F A;  1YN5 A;  4GU2 A;  4ANU A;  2WXF A;  5EDS A;  1F1H A;  4DXA B;  4MGK E;  4B9K A;  5H8Y E;  2KO3 A;  2WXO A;  1L7Y A;  3ZKJ C;  4GIV A;  2BWF A;  1MHH E;  3R2T A;  1P7F A;  4GOC A;  4IOI E;  3QX1 A;  3I57 A;  4WWM A;  3QJZ A;  1YX5 B;  3OJ4 B;  1FXI A;  1J19 A;  3VFK A;  2KQ7 A;  2KWU B;  3APD A;  4HLE A;  5J18 A;  4JIO U;  2OOB B;  2L52 A;  5E6N A;  2L00 B;  5LXI B;  2JYE A;  3B2G A;  3PLU A;  1A70 A;  3BK2 A;  3A4R A;  1C4A A;  3W2D A;  1UF0 A;  2AQ2 B;  4K3C A;  2SEB D;  2JSV X;  3KUD B;  2JQR B;  3TBL D;  3RFZ B;  4A9A A;  4NJC A;  2MP2 B;  4B6W A;  1SIJ A;  2BB6 A;  4II2 B;  2MBB B;  4EUT A;  5C23 A;  1WSP A;  2L05 A;  1RM6 C;  4N6E B;  1NBF C;  2O6V D;  3BYT B;  3VDZ A;  2BQQ A;  4DQO C;  3QQ8 B;  1UBI A;  3RMK C;  2J0M A;  2PEA A;  4IM2 A;  1MFW A;  1WYW B;  2DYB A;  2N7J A;  2KVZ A;  1V5O A;  3Q8E A;  4OZA A;  1SJH D;  3X23 A;  5D94 A;  3B0A A;  2WXK A;  4CYE A;  4RGT A;  2XK5 A;  2PLP A;  2AWT A;  2JUO A;  3GE8 C;  2ZZP B;  2RPQ A;  2WXJ A;  3L54 A;  2NPT A;  2M0X A;  4M01 A;  2VH2 A;  3TJP A;  3VRA B;  4P1B C;  2PPH A;  1WJ4 A;  1WJU A;  5JH5 C;  2DNF A;  5LLI A;  1F0Z A;  4CO7 A;  3UI3 A;  2Z8L A;  3EC8 A;  1CJE A;  2K25 A;  4I6L B;  1ZDX A;  2A4Z A;  3Q3F A;  3I5J C;  2Z0E B;  1TYG B;  3KUZ A;  2IND C;  2KJR A;  1V5T A;  1WIA A;  2WLB A;  3L16 A;  4TSS A;  3ZRF A;  5DPT A;  3H1U A;  3R66 C;  3DHI C;  1L4Z B;  1C9F A;  3DDC B;  1TY2 A;  3IFW B;  1WWT A;  3DBR I;  1JML A;  2MA9 B;  3DVG Y;  2PW9 A;  1KLU D;  3R8B A;  1SGH A;  3WAL A;  1N6Z A;  4F1S A;  4BOZ B;  2KDB A;  1FNW A;  1WGK A;  1WJN A;  1HE8 A;  5J2R A;  1QOA A;  1XCQ L;  3M3J A;  5AUK A;  2KQ4 X;  5BYR A;  1ZUD 2;  1VD2 A;  2I1K A;  1MI0 A;  4FUL A;  2AQ3 B;  1GOZ A;  3A9K A;  4NJ7 A;  2CHX A;  4WWO A;  1B9R A;  5IO9 A;  1IBX B;  2IYD B;  4P16 A;  2KLC A;  3VUW A;  4GXB A;  1EUV B;  1Y56 A;  2QC8 A;  4WH4 A;  3TCA A;  4KSL C;  4K7W A;  5D3I B;  4HJG E;  2WXP A;  1C79 A;  3TMP B;  2LWP A;  3W9C B;  2LVO A;  2NBV B;  3CSF A;  2KOX A;  4NAW A;  3RI7 C;  4RCO A;  4ANV A;  2G3Q B;  1SE4 A;  1WGG A;  4LNN A;  4AJW A;  1V1O A;  2XK5 B;  2BPS A;  4B0M A;  4C4V A;  4YSX B;  5TR5 A;  2NPT B;  1JWB D;  1V6E A;  1F2R C;  5E6O A;  3MHS D;  2LHD A;  3C19 A;  1UNS A;  2JZP A;  2KDI A;  3H8H A;  1P3Q U;  1KFY B;  1BUI C;  2HJ1 A;  4IKG A;  3U8Z A;  4F7Z A;  3A9J A;  2JZZ A;  4LNI A;  1WM2 A;  4W9E A;  2INN E;  4TQ1 A;  1P98 A;  1VZ6 A;  2MSE D;  3R7R A;  4KGT A;  2JX5 A;  2L32 A;  1WZ0 A;  3ZJU A;  4BKS A;  3FIL A;  3K9P B;  2KQS A;  3P42 A;  3LB8 C;  1AN8 A;  3Q14 C;  4DHZ E;  3J9C A;  1I4G A;  2DWQ A;  2HDE A;  3A33 B;  2REX A;  2J52 A;  2GBN A;  1HQR D;  4E71 A;  5T8I A;  4WJO A;  3H7P A;  1E8X A;  4G50 A;  4FBJ B;  2K3U A;  3IT6 B;  4ARI A;  1F9J A;  3SD5 A;  4A55 A;  1FIQ A;  1V1P B;  2FE8 A;  5DPR A;  1C3T A;  4EFO A;  2JWZ A;  4O1N A;  1PUT A;  3RNB C;  4L23 A;  4OZB A;  3VXW A;  3A9K B;  1HA5 A;  4OVZ A;  3AUL A;  1YOV B;  3M63 B;  2YEP B;  2ONQ A;  2X38 A;  4GDK B;  3R2I A;  1YNT E;  1FXT B;  4LDT B;  1VZ8 A;  4PYZ A;  5G5G A;  3AI5 A;  2ICI A;  4PK1 A;  3ML8 A;  1MPE A;  2MRP A;  2K5P A;  4YL8 A;  1OEY A;  3NVW A;  3RD2 A;  3RNC C;  3QWZ B;  2PIA A;  1NI3 A;  4RGO S;  3VR9 B;  1K50 A;  2RR9 A;  4TV3 A;  4W9F A;  3WAP A;  1OFF A;  2LUM A;  3OAW A;  1J0G A;  4W9G A;  3S2A A;  4ZYN A;  2N4F A;  2BS4 B;  1PYW D;  3V3X A;  2LI5 A;  2WX1 A;  1YN3 A;  5KHO A;  3IG3 A;  3ECI A; 
#chains in the Genus database with same CATH homology
 1D5M C;  1FFU A;  1HXY D;  1I4H A;  1M4V A;  4RF0 A;  1TZO A;  3AED B;  2I2Y A;  5HHD G;  3TEX A;  1IBX A;  5BYS A;  4P6V F;  2DYM A;  3MHZ A;  5AUI A;  3ZYY X;  3TEW A;  1TJE A;  3P63 A;  2DYO A;  1IGC A;  4RF1 A;  4KGS A;  1P7E A;  1NYQ A;  3AEF B;  2J42 A;  3AH7 A;  1FO4 A;  2OED A;  2MEK A;  5G5H A;  2IPK D;  1MHX A;  4AS1 A;  5HG2 A;  1J7C A;  1N60 A;  2VZK D;  2CJO A;  2CJN A;  3C8Y A;  4OHJ A;  2WXM A;  1KH0 A;  3LXF A;  1N5W A;  3AE8 B;  1BXT A;  3E9S A;  3MC0 B;  5EE1 A;  3GP7 A;  1T5X D;  1ZOY B;  1I4Q A;  3AM9 A;  1K51 A;  3ZGZ A;  1K53 A;  3FIL B;  5JXV A;  4C56 C;  4NZL B;  1QOB A;  1F77 A;  2DBY A;  1WXQ A;  2GI9 A;  4WIP A;  1ZP0 B;  3IAM 1;  4HKQ A;  4YTP B;  3AE5 B;  3T3O A;  3MJ5 A;  2LHE A;  1EWY C;  4YSZ B;  1E7P B;  1I4R A;  5BMG A;  2Y3A A;  1CZP A;  2PKO A;  5HI1 A;  3CWI A;  3ETR A;  3AE6 B;  3Q8F A;  1YN4 A;  1YN5 A;  1XCT L;  2IJ0 A;  1E0Z A;  2WXF A;  2JXT A;  4GDL B;  1VJK A;  4DXG A;  3P1M A;  4KKJ A;  2KAC A;  4TMA B;  5GXG B;  5H8Y E;  1ZDV A;  5FKA C;  3IXS A;  2WXH A;  2WXO A;  1QT9 A;  5FR3 A;  1XEE A;  1JRO A;  1YMH E;  1ENF A;  3AE4 B;  2KDM A;  3BYY B;  3V05 A;  3IAS 1;  2WXI A;  1ROE A;  1MHH E;  3R2T A;  1P7F A;  1TY0 A;  2OHF A;  4IOI E;  1I4X A;  3I57 A;  4WWM A;  4XE0 A;  1L0Y B;  4MH8 A;  3SFD B;  3VRB B;  2W55 A;  2L1A A;  3AE9 B;  5C2T B;  1YJI A;  4YT0 B;  1FXI A;  3BVZ A;  4USA A;  3HRD D;  1OQR A;  3AE3 B;  3AEB B;  1D6E C;  4WAF A;  3AMZ A;  2B76 B;  4PT5 A;  1SE2 A;  1KRH A;  1CK1 A;  2IGH A;  1JWA D;  2L52 A;  2ZW1 A;  4MAC A;  4UDU C;  3T3N A;  1UWX A;  1V1P A;  1WYG A;  1FMA D;  2RPV A;  2JYE A;  3B2G A;  2N9K A;  1ESF A;  1EU4 A;  4LK0 M;  4YTM B;  1A70 A;  1I4P A;  1TS5 A;  1TKE A;  1T6B X;  3BK2 A;  3AEA B;  1C4A A;  3W2D A;  1QOG A;  2AQ2 B;  4XWT A;  1GB4 A;  4NAW B;  3AEE B;  2BT6 A;  2IGG A;  2SEB D;  2JSV X;  2JQR B;  1TKY A;  3RFZ B;  4A9A A;  4XDC A;  3TEY A;  2WQY B;  4NJC A;  1SIJ A;  2E6X A;  3P4Q B;  1JAL A;  3AV8 A;  4RGN A;  1N63 A;  1NVI D;  2V4I B;  5D3D A;  1JW9 D;  4Q2J A;  2BB6 A;  1FCL A;  1R7S A;  2QSD A;  2XNA C;  1WSP A;  1XLP A;  1TS4 A;  4A8X C;  1RM6 C;  2R61 A;  4N6E B;  2Y5P A;  1XLQ A;  4N59 A;  5D7G A;  3BYT B;  4HRO A;  1KTK A;  4YTN B;  2EKI A;  3U52 E;  4DQO C;  1TS3 A;  2K9X A;  3HVD A;  1L6U A;  3NS1 A;  3WCQ A;  4OW0 A;  1WRI A;  5LNK 1;  4FXC A;  2J4X A;  2H88 B;  3AN1 A;  4EE2 A;  1SEB D;  1FRD A;  1VZ7 A;  2CU3 A;  3KWL A;  1E9M A;  1SJE D;  1N5X A;  3BZD B;  2N7J A;  3Q8E A;  2PVO D;  5EE3 A;  4OZA A;  1QF6 A;  2AX5 A;  3KQ4 A;  1SJH D;  4J3O D;  3NUH B;  2K22 A;  4IDI A;  3P4R B;  2JWU A;  2RDG A;  2E3T A;  3B2F A;  3AEC B;  4RFB A;  2I38 A;  3NVY A;  2WXK A;  5BYQ A;  1FFV A;  4RGT A;  5FK9 C;  4ZHO A;  1ZE3 D;  5HFY A;  3AE1 B;  5MPO A;  2PLP A;  1C78 A;  1HZ5 A;  1J7A A;  4HEA 1;  1EU3 A;  2RMM A;  4C7Z A;  3Q8A A;  1FRR A;  1VR9 A;  2KMM A;  1GAQ B;  1UWM A;  2WXJ A;  3EA6 A;  3AE7 B;  2BTE A;  1RFK A;  2V3P A;  3U7Z A;  2QIE B;  1C76 A;  3VRA B;  4A6Q A;  1VDV A;  2MH7 A;  1RYJ A;  4C80 A;  3AEG B;  2GRI A;  1F0Z A;  1QIL A;  1FM0 D;  1SE3 A;  2M56 B;  2BBC A;  3O13 A;  1FNV A;  3UI3 A;  2Z8L A;  3Q8C A;  4YSY B;  1CJE A;  1AWD A;  1ZDX A;  3TSS A;  4YXD B;  4ZRP A;  1TYG B;  1UGJ A;  4TSS A;  2WLB A;  4C7Y A;  3NVV A;  4JPS A;  2NMQ A;  2J53 A;  2QMT A;  2XN9 C;  1L4Z B;  2HTM E;  1C9F A;  1JCK B;  2WDR B;  4KX6 B;  1SF0 A;  1DOY A;  1Q10 A;  1TY2 A;  2WXR A;  2KN4 A;  2NTS A;  2W3R A;  2MJD A;  4ZOH C;  2BS3 B;  1SXT A;  1WWT A;  2D5G A;  4ZRQ A;  1DYQ A;  1EWC A;  3TEZ A;  2FBW B;  4JX1 C;  1B1Z A;  1JML A;  2MJ3 A;  4WQM A;  1V8C A;  2PW9 A;  2JYT A;  1KLU D;  2WDQ B;  3R8B A;  1SSN A;  2BYT A;  2Y5C A;  3L4P A;  4ITK A;  4B0E A;  4KGR A;  3P4P B;  1LO5 D;  1FNW A;  1WGK A;  5BMI A;  3GB1 A;  1QQR A;  1QOA A;  1XCQ L;  3SFE B;  5AUK A;  2LEK A;  3VQI A;  1D4B A;  2KQ4 X;  5BYR A;  1ZUD 2;  1DOI A;  2NTT A;  4CQN A;  1FCC C;  1MI0 A;  2LGI A;  3LYY A;  1PGX A;  5H92 C;  3W1S A;  4REZ A;  2AQ3 B;  2VZK B;  3E56 A;  1GOZ A;  3MFG A;  1ZXI A;  1BML C;  1B9R A;  3AE2 B;  4LTU A;  3DWG C;  1IBX B;  1J7B A;  3GS2 A;  4P16 A;  3FC4 A;  4JWU C;  2QIL A;  1JQ4 A;  1EM7 A;  1Y56 A;  2WDV B;  4DXF A;  5EE0 A;  4JWS C;  2WU5 B;  1SB3 C;  2W54 A;  1PGA A;  4WH4 A;  1ET9 A;  3BK1 A;  1SBB B;  2WXN A;  4OZC A;  3NRZ A;  5D3I B;  1FXA A;  2WS3 B;  1C79 A;  1L6V A;  2WXP A;  3KWV A;  2H89 B;  2N0S B;  4HJG E;  5E6J A;  4XWW A;  3W9C B;  2ZW0 A;  1JWS D;  1N62 A;  4WUR A;  1GB1 A;  1MVK A;  4TQ0 A;  1C4P A;  2JU6 X;  4RCO A;  1N61 A;  1L5P A;  2PVG C;  1SE4 A;  1V1O A;  1L0X B;  4RGM A;  2PMV A;  3HUI A;  2IGD A;  4B0M A;  2QEJ C;  4YSX B;  1K52 A;  1C4C A;  3MP9 A;  4RH6 A;  1AYF A;  3URY A;  4R3D A;  1JWB D;  1QOF A;  3EUB 2;  1F2R C;  2M19 A;  1ACC A;  1XF5 L;  2LHD A;  1UNS A;  2BW2 A;  4HRS A;  2JZP A;  3BII D;  4ARC A;  4LLG M;  4YWG G;  3H8H A;  2K0P A;  1CQV A;  4M0W A;  1KFY B;  4GLS C;  1PDX A;  1NYR A;  1BUI C;  3ABV B;  5TSS A;  4ZYS A;  1T3Q A;  4IKG A;  3BVG A;  2GB1 A;  4H2A A;  1F2R I;  1I7H A;  2WXG A;  1IGD A;  1UUP A;  1JWM D;  2INN E;  4AQ7 A;  4L2Y A;  4TQ1 A;  1VZ6 A;  1L4D B;  4KGT A;  2JX5 A;  2L32 A;  2WXQ A;  3ZQ4 A;  1ZXH A;  3ZJU A;  3FIL A;  3P42 A;  1ET6 A;  2WXL A;  1XLN A;  1L0V B;  3LB8 C;  3OWE B;  1AN8 A;  1IUE A;  4RNA A;  1VRA B;  2ACZ B;  2G9H D;  3SEB A;  1E6E B;  1I4G A;  3J9C A;  1STE A;  2DWQ A;  2HDE A;  2LFI A;  3ZJV A;  1JWU D;  2ON8 A;  2W82 A;  2J52 A;  4NAM A;  3N9Y C;  1TKG A;  2TSS A;  1HQR D;  2WNM A;  2WP9 B;  3HVZ A;  4XDD A;  5C3J B;  5I4D A;  5T8I A;  1C77 A;  1HEZ E;  1PGB A;  1FNU A;  2K3U A;  3IT6 B;  4US8 A;  3U2S C;  2LMC A;  4ARI A;  4MM3 B;  2EEL A;  1XXG A;  2V3N A;  1TS2 A;  3TUO A;  3KLS X;  3W5V B;  5BMH A;  4A55 A;  1FIQ A;  1V1P B;  1FEH A;  2KWD A;  2WU2 B;  2FE8 A;  2FUG 1;  2G1E A;  3Q69 A;  1HZ6 A;  2YEP F;  4US9 A;  1DGJ A;  3U4E G;  4O1N A;  1AW7 A;  1PUT A;  1NEK B;  3BVM A;  4L23 A;  4OZB A;  1VLB A;  3B9J A;  3DWM A;  3PZ7 A;  3EGR A;  4ZHP A;  1XO3 A;  3BWU D;  3IT4 B;  1HA5 A;  2MJE A;  4OVZ A;  3ZJT A;  3VR8 B;  1OQQ A;  2N9L A;  1DOX A;  4A90 A;  2IDY A;  2YEP B;  4JE3 B;  2ONQ A;  1KF6 B;  2X38 A;  4GDK B;  3R2I A;  2BB5 A;  3RPF C;  1YNT E;  1YQ3 B;  1D5X C;  3FAH A;  2V0G A;  1VZ8 A;  5G5G A;  1XLO A;  4N58 A;  2ICI A;  1YQ4 B;  3SR6 A;  1MPE A;  2QJL A;  2K5P A;  3PO0 A;  1E10 A;  2KAJ A;  2INP E;  2AQ1 B;  1YJJ A;  3NVW A;  3PZ8 A;  1D5Z C;  2PIA A;  3Q8B A;  3NZ3 A;  1NI3 A;  1NEN B;  4RGO S;  5EE9 A;  1K50 A;  1QLB B;  2Q5W D;  3VR9 B;  1JRP A;  3W5U B;  2W3S A;  4MT5 A;  1OFF A;  2BS2 B;  3I9V 1;  2DLB A;  2LUM A;  2PTL A;  1PFD A;  1ZPS A;  2L83 A;  3CIR B;  1FD6 A;  3AB5 A;  1KLG D;  2M0A A;  1RWS A;  3NVZ A;  1QKZ A;  2BS4 B;  1PYW D;  3P4S B;  2RDH A;  2SAK A;  3V3X A;  1YN3 A;  4D2K A;  2LJI A;  1GPX A;  1V97 A;  4KKI A;  4L1B A;  4HKZ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...