2N0SB

Haddock model of ferredoxin and [fefe] hydrogenase complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
94
structure length
94
Chain Sequence
b'YKVTLKTPSGDKTIECPADTYILDAAEEAGLDLPYSCRAGACSSCAGKVAAGTVDQSDQSFLDDAQMGNGFVLTCVAYPTSDCTIQTHQEEALY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fe-hydrogenase
molecule tags Oxidoreductase
source organism Chlamydomonas reinhardtii
publication title Structural Insight into the Complex of Ferredoxin and [FeFe] Hydrogenase from Chlamydomonas reinhardtii.
pubmed doi rcsb
total genus 19
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2n0sB00
1SB3C 1YJIA 3NVYA 5EE9A 4YTMB 5AUKA 4JWSC 1E6EB 3FAHA 3LXFA 1XLNA 3LB8C 3NVZA 4ITKA 4WWMA 1TKEA 3AN1A 1QOFA 3PO0A 4N59A 1B9RA 1N62A 2WDRB 1E10A 1JROA 4ZHPA 1JRPA 3AE4B 2H88B 4YSYB 4YTPB 5AUIA 3AE7B 1DOXA 1WWTA 1R7SA 4N6EB 3P1MA 5EE3A 2H89B 1QT9A 2OHFA 2N0SB 3L4PA 4IDIA 4ZHOA 1RWSA 3AM9A 2QIEB 2K9XA 3VR9B 4US9A 2JX5A 3AMZA 2PIAA 1FM0D 1TKYA 2WLBA 1NI3A 1AWDA 5EE0A 2L83A 1UWMA 3DWMA 5C2TB 2EKIA 1FRRA 1TJEA 2W55A 3BIID 3AEFB 1FFUA 1NENB 2KMMA 5MPOA 1QLBB 2M19A 3AEGB 3AEDB 3P4PB 4HRSA 1J7AA 3AE9B 4N58A 4C7YA 1DOYA 1F0ZA 1AYFA 3AEBB 1SIJA 2FBWB 1N5XA 3CWIA 3P4QB 3AV8A 1DGJA 4HROA 4LTUA 1WYGA 3RPFC 1GPXA 1FXAA 1KF6B 1V97A 4YSZB 3AE3B 1ZXIA 4JWUC 1N61A 3W5UB 2MH7A 3B9JA 1J7CA 3WCQA 1FMAD 1DOIA 2AX5A 1J7BA 2BS2B 2BS3B 3NVWA 2Y5CA 4USAA 5GXGB 1ZUD2 1CZPA 1L6UA 1QOGA 1GAQB 2K5PA 1N5WA 1NVID 3AE2B 2WQYB 3ZYYX 1E0ZA 1YQ4B 1FO4A 3AH7A 4YTNB 4A9AA 2M56B 3P63A 1T3QA 2QJLA 2PKOA 3HVZA 2HTME 1VJKA 3SFEB 4US8A 2WS3B 1FRDA 2CJOA 2W3RA 1OQRA 3VRBB 1OQQA 1JQ4A 3AEAB 3HRDD 3ABVB 4JX1C 2K22A 1VLBA 3ETRA 1WGKA 1OFFA 2CU3A 3AB5A 3AE1B 2WDVB 3HUIA 4YT0B 4C7ZA 1XLOA 4KX6B 4C80A 1JALA 1NYRA 3AECB 1YJJA 1ZOYB 2ACZB 1L6VA 2BS4B 2DWQA 1V8CA 2KAJA 2PVGC 3NRZA 5EE1A 3W9CB 1FIQA 1RFKA 1E9MA 3B2FA 5H92C 1CJEA 2MJDA 2W3SA 3SR6A 3W5VB 1IUEA 2LEKA 2MJ3A 3NS1A 3NVVA 1TKGA 2BT6A 1NYQA 2E3TA 5G5GA 5H8YE 1XO3A 3DWGC 1N60A 1RYJA 5C3JB 1EWYC 3AE6B 2B76B 4WQMA 4ZOHC 1I7HA 3VR8B 3VRAB 1SF0A 1QOBA 3CIRB 5G5HA 2DBYA 1TYGB 2WU2B 3FC4A 3P4SB 1PFDA 1XLPA 2PVOD 2WDQB 1QF6A 1ZP0B 1VDVA 1PDXA 3AE5B 1KFYB 4YSXB 1NEKB 1FXIA 2JQRB 1YQ3B 4YXDB 2G1EA 3SFDB 1JWBD 1XLQA 1A70A 3AEEB 1WXQA 1N63A 1RM6C 2L52A 1L5PA 1FFVA 3AE8B 1WRIA 3KWLA 3P4RB 1JWAD 2W54A 2WP9B 3EUB2 1KRHA 3B2GA 2WU5B 2CJNA 2MJEA 1PUTA 1E7PB 4FXCA 1QOAA 4P6VF 1L0VB 1ROEA 2Q5WD 1JW9D
chains in the Genus database with same CATH superfamily
1YJIA 4RCOA 1GNUA 4YSYB 5AUIA 1RFAA 2L7RA 2FUG1 4PK1A 2N0SB 3PS6A 1EF5A 2LXAA 1L0YB 1TY0A 3QCAA 1LGRA 1PGBA 2DHZA 2J53A 3PRPB 1QLBB 4N58A 4HEA1 4BBNC 4G3XB 2ICIA 4W9GA 4RGOS 1FNUA 5LXIB 5D3DA 4OZBA 1M94A 1N61A 4GOCA 2KN5A 2AL6A 2MBBB 2QCZA 3ALBA 4AWJA 3MTNB 4JGHB 2DENB 2WHIA 2EELA 4M8MA 2V9HA 1M4VA 2OJRA 1RAXA 4K81A 2PKOA 1I4PA 2I2YA 1FRDA 3DVNU 5TR5A 3UIOB 4MGZE 1WJNA 2K22A 2G45B 4WJQA 3VAWA 4LK0M 1GB4A 3AECB 3OJ4B 1L0XB 1IUEA 4RF0A 4A90A 4IWOA 5H8YE 3W1SA 1N60A 3MHZA 2R2OA 2XBBC 3RZWC 5G5HA 3U4EG 4C00A 4REZA 2KOXA 3QHTA 4YXDB 3RZFA 3A9KA 4RGNA 2BQQA 4KGRA 2Z59B 4C4VB 1AARA 3QQ8B 3B2GA 4RGTA 2L0FA 5G55A 3I9V1 1S3SG 3R3MA 4KZ0A 5EE9A 5AUKA 4JWSC 4PYUA 2V3NA 3GP7A 4OVUA 4ZHPA 1BT0A 2N7DA 1V86A 3H7PB 1T6BX 3TCAA 4TKNA 3H8HA 4R3DA 3NG0A 2BBCA 4US9A 2LGSA 3UQAA 4FBJB 3TEYA 3DBRI 3Q8BA 4BKSD 3ZGZA 4GU2A 4W9EA 5BMGA 1R4MB 2JVCA 3HK0A 1AYFA 4II2B 3L08A 5CX3A 1YD8U 3RD2A 3T3OA 3RUIB 3ZVVA 2D3BA 2ZVOA 3WA0A 2HD5B 2MSED 3B9JA 1D5ZC 3WALA 3NVWA 2RD0A 1E0ZA 4L1BA 2ASQA 2KWDA 2IY0B 4HWIB 2MA9B 2CJOA 1OQRA 2DLBA 3ONSA 2KHWB 5IN7A 3PRMB 1T0YA 3IG3A 1EU3A 4GLSC 5FKAC 1NI2A 2BGFA 2V4IB 4ZOHC 3TEZA 3KUCB 1EM7A 1TYGB 3AE5B 1IPGA 5BMIA 2MWSB 3HHMA 1F9JA 3S2AA 2D07B 2JYEA 3ML8A 2CJNA 2DNFA 2INDC 3NOBA 1L7YA 2KWUB 3QK0A 2RPQA 3NVYA 3RNEC 4ANUA 4MSMB 1WYWB 1HTQA 1XLNA 3TL5A 1JWMD 2J0JA 4ITKA 2JY6A 5G2NA 1R7SA 4NY0A 2GRIA 3LJ3A 2B3AA 2WXOA 4B95A 4K7SA 3AU4A 4ZHOA 2O6VB 1WX8A 3MC9A 2WXKA 3V05A 4JLCA 2QMTA 4L23A 1QKZA 4F8CB 2LJIA 4A8XC 3MJ5A 4P1BC 1DOYA 3AE9B 3IT6B 3JSVB 1UNSA 3DHIC 1E5WA 4FJZA 2KX0A 2GLSA 3AV8A 3VFKA 3Q6BA 3WCQA 2WWZA 1WGGA 4WJPA 4RM8A 3HM3A 3PZ8A 4HKZE 3N3KB 1WI0A 2NPTA 2XN9C 4RH6A 1BXTA 4XX5A 1Z5SB 2IPKD 1PGAA 3A1QB 3QARA 4MGKE 3Q2AC 2OJWA 1XEEA 2BF8B 3AE1B 1KLGD 1U4AA 2GMIC 1HZ6A 2M8SA 1WGDA 1NDDA 1C3TA 1RYJA 2DZIA 1I7HA 2A5UA 3Q8EA 3ENEA 5C23A 4EUTA 1RLFA 5D6JB 3M95A 1FXIA 3NZSA 4P16A 1MHXA 2MP2B 4TSSA 2ZPYA 1IP9A 4MGIE 2AQ3B 3AE8B 1MPEA 3KWLA 4B0MA 4WWPA 4NJCA 2PE6B 1IYFA 4A20A 5IOIA 4P1CC 2ZW1A 4P6VF 2DZMA 2IZVB 3U7DA 3FAHA 5JHAA 3QAQA 4GN1A 3C8YA 3NHEB 3K9PB 1E7UA 4N6EB 2FCMA 4PS3A 5CHWA 5E6OA 2IDYA 3IAS1 2WLBA 1UGJA 1H4RA 1GG3A 1KJTA 2FCNA 2NBVB 1OGWA 3ZTCA 5JXVA 4G11A 1TS4A 2NBWB 3AEDB 5LXHA 1GB1A 3APCA 2N7JA 5D2MB 2V4LA 4K7UA 3SU8X 4S0RA 2INCC 2LASA 3R7QA 3W5UB 2J0MA 4M0WA 3OAWA 1A5RA 3ZO5B 4BVUC 3O65B 4A3PA 3SD5A 1AW7A 4LNOA 4MM3B 2KDIA 3EFUA 3ZYYX 1EU4A 4HCNB 3DBHB 1V2YA 2LUMA 3V6EB 4US8A 4AS1A 2W3RA 3N1XC 2BWES 2J0KA 1TT5B 3B0AA 4C7ZA 4YT0B 4IM2A 1MJDA 3V60A 2J7QB 1V8CA 3ZNGC 2KVZA 4JQWC 5DPSA 1YMHE 1G6JA 4WAAA 2IGGA 5C1ZA 3DWGC 2FUHB 1GJZA 2KDEB 3CIRB 2BB6A 1QF6A 4YSXB 2BW2A 2JQRB 1V6EA 3PLUA 4KSLC 2WXGA 1L4ZB 2BYTA 1FCCC 1JRUA 4IW0A 3EC8A 5HKHA 3KQ4A 2K8CA 1ROEA 1VZ6A 1WX7A 3UGBB 4LJOB 3NVZA 4N59A 1XD3B 3TEXA 1WWTA 4AJYB 2DAFA 3L10B 3L54A 4XDCA 2ZEQA 4FHKA 1FNWA 1WZ3A 5HHDG 1D5XC 2C5LC 4OZAA 1V49A 2MW5A 3ZUNA 1PYWD 3PZ7A 1C79A 3ZNHB 5MPOA 1XT9B 1F0ZA 1V5OA 1Z2MA 1WGRA 3ML9A 4XZ4A 1DYQA 2RDHA 3BVGA 3BK2A 5L95C 1FXAA 2CHZA 4JWUC 1WGHA 2BWFA 2G4DB 3VHTC 1YX5B 1WJUA 1AN8A 1ZUD2 4NJ7A 3DQVA 1N5WA 3N32A 2LVQA 4G0NB 2MBOA 2FIFA 3TJPA 3ZW3A 3L0WB 3ZNID 2RPVA 4JX1C 5IAAC 3H7PA 1HXYD 1ACCA 1ZW7A 2OEDA 4FN2A 3W1SC 3E56A 1D3ZA 2V1YA 1R4MI 3AE6B 4PYZA 4WQMA 4C4VA 4BFRA 1KH0A 4DDID 2PPHA 3P4SB 2KNBA 2PVOD 1HQRD 1PDXA 3GE8C 1YQ3B 1MI0A 2Z0EB 4LDTB 3VQIA 3AXCA 4JIOU 2FNJB 1WRIA 2LHDA 1CMXB 4KVGB 1PUTA 4FHJA 1UUPA 4NQLB 4OZCA 4YTMB 4LNIA 5EDSA 4MACA 1E10A 2NTSA 4F7ZA 1K8RB 1VCBA 3BK1A 4KV2A 1ZE3D 5EE0A 1WE6A 3VH4B 2M0XA 2LMCA 1FXTB 1ZXHA 3PREA 2A4ZA 2LRUA 4WAFA 3RMKC 1T0SC 2KQ7A 3AU5A 2JYTA 3P4QB 3GE3C 2K39A 2KZRA 2WXJA 4ZYNA 2KN4A 2D10A 4AQ7A 1OEYJ 1FMAD 2AX5A 1D6EC 1QILA 2BS3B 4USAA 2BKRB 2K5PA 1GC6A 2JRIB 3WAPA 2WXRA 3SHQA 4W9KA 2M56B 2WXIA 1CK1A 4RF1A 1D4BA 3N1YC 3NZ3A 3WIMA 2LD9A 4HVBA 1KM7A 1OQYA 4MJSA 2MCNB 3U7ZA 2KLCA 1I35A 1E9MA 1HEZE 1F52A 3JW0X 3SDLC 2K25A 2LVOA 1JCKB 5IP4D 3QC8B 3ZDMC 1ZP0B 5D7GA 3W1YA 2ZPNA 1P9DU 2UU7A 3PHXB 4WWOA 2INNE 1N63A 3BYTB 5KHOA 3UINB 4AJWA 2FCQA 4WIPA 2NBUA 4WJOA 2G3QB 2KQ4X 1RRBA 3DPDA 3BVZA 4LNKA 2ZVNA 4KKJA 4MJSB 3A9JB 4WWMA 2UWQA 3PO0A 5JH5C 2NMQA 4I6PA 1P98A 2N9XA 2BTEA 2PEAA 3TMPB 2D3CA 2V0GA 1NI3A 1ZDVA 1R4NI 2L83A 2NR2A 1FRRA 1VR9A 1LM8B 4TQ1A 3NJTA 3P4PB 4DXAB 4M0WB 1J7AA 4PT5A 3X0WA 1WY8A 2RDBC 4IM0A 1SE9A 3CWIA 3PVLA 1KF6B 4RGMA 2UYZB 1TZOA 2Z0DB 3R8BA 4MH8A 3RNGC 3R66C 1J7BA 5BYRA 2Y5CA 2I38A 2AL3A 4RFBA 1I4RA 5LNK1 3RI7C 2WQYB 3DOWA 3AH7A 2LZ6A 2XNAC 4W9DA 2IO1B 5GMVA 1LFDA 4G50A 1WR6E 1L2NA 1IGDA 2WDVB 1FIQA 4HPMB 1SE2A 2MJDA 3PLVA 4YWGG 1PQSA 3T9LA 3I63C 1N6ZA 4OHJA 4BBNF 3EFCA 2YEPB 2J52A 2PMVA 3KYDD 3L13A 4RNAA 1FCLA 1XLPA 1F77A 3TSSA 3PPAA 3SFDB 1JWBD 2WXQA 2KTRA 1SJHD 4PS7A 1RM6C 1L5PA 1JWAD 2FCSA 1NBFC 3CMMB 3W2DA 1FD6A 2NCNA 3ZJUA 1TY2A 1JW9D 2KJ6A 3LXFA 4DDGD 4MSQB 2JF5A 1C4CA 1I42A 1R4NB 3P1MA 5AEKB 1QT9A 1FPYA 4K3CA 4AUQC 4IDIA 2JUOA 4A3OA 4EKUA 2JX5A 2AYOB 2PIAA 2ZJDA 1XF5L 2KDMA 3ZTDA 3JYUA 1FFUA 2FE8A 4CO7A 2DX5B 2HJ8A 2KXJA 3AEBB 2CS4A 4W9CA 4O1NA 2KQSA 1QQRA 2GB1A 1WXAA 2KWVB 1J0GA 4IOIE 3TUOA 2LRWA 2MH7A 1YNTE 4EOYA 4A55A 5E6PA 4GDKB 5HFYA 3HIZA 3O13A 4TUUA 2O6VD 1T3QA 4N9F4 4B6WA 2HTHA 1L4DB 1WGYA 5T8IA 3VRBB 4HKQA 1UF0A 5IA7A 2KDFB 4MELA 1JALA 3NRZA 2KAJA 3C0RB 3PV1A 3QX1A 1ZDXA 4HJKA 5EE1A 3W5VB 1E8WA 2MJ3A 2L32A 4ZDVA 1XO3A 2KMCA 3VRAB 1WXSA 4LDTD 4MT5A 3IVFA 1EF1A 2MLBA 4II3B 1I4GA 4CYEA 1K50A 3PZDA 3E9SA 1STEA 3A4SC 1WH3A 1TZ1A 2VH1A 2WP9B 3RULA 4F1SA 2INPE 1QOAA 3R7RA 5JZEB 4CHKA 3VUXA 4IWPA 3ZLZA 1Y56A 3ZNZB 3AN1A 1B9RA 3QJZA 2IGDA 2WDRB 2DYOA 3AE4B 1TGZB 2QDFA 4FJVB 2GBRA 3OLMD 2DAJA 3HM6X 3K9OB 1I4QA 1ZPSA 2N9EB 3L4PA 4NZLB 4FA6A 2M0AA 2YLMA 2AWTA 3AM9A 1TIFA 3PT2B 2K9XA 3N1ZC 2LWPA 5KHQA 3AMZA 4UDUC 1FM0D 3T8MA 3VVWB 2YVCA 3NZUA 4GDKA 3N20C 3A4RA 1NENB 5E6NA 4FLHA 4NQKE 2D11A 3WAMA 4AP4C 4KIKB 1DGJA 2CHWA 4GMVA 3Q8AA 3TBLD 1GUAB 3V3XA 1C77A 3IAM1 4HJGE 4HDOA 2ONQA 2K8HA 2QJLA 1XCQL 2KACA 2BB5A 2N1WA 1WXMA 2N7EA 1UBIA 2JWUA 1ZOYB 3W9CB 3KLSX 5H92C 5JHBA 2LEKA 2RSUA 1NYQA 4NAMA 1S1QB 2IYDB 2LUEA 3UI3A 4OW0A 1VDVA 3EGRA 3IXSA 4HPLB 4I6NB 2KTRB 1WM2A 1NEKB 1YIWA 4EZLA 3ECIA 1KLUD 1CQVA 4XDDA 3VUYA 5J2RA 3DVGX 2ZZPB 1HZ5A 1WMHA 4HLEA 4DBGA 2WX0A 4W9IA 3JVZX 3LB8C 3A33B 3DCGA 1N62A 1YN3A 1JROA 2MEKA 2MQJA 2C7HA 1HE8A 3A1QA 1P7EA 3KH0A 3MC8A 3DBSA 4KZCA 4MDKE 1WE7A 3DWMA 2M4NA 1ENFA 2C60A 2L05A 3I5JC 4J6IA 2KMMA 1E8YA 4ACFA 2KDBA 2MBEA 1P0RA 2WYQA 5FR3A 3UF8A 3Q3JA 1YJ1A 1WYGA 3RPFC 2JXXA 2OOBB 1ZXIA 3EA6A 2C9WB 3JSVA 3Q8FA 1C4PA 2KFKB 4FULA 4ARIA 1V81A 4TMAB 3VTVA 1YOVB 3RCZA 5FK9C 4W9FA 2L00B 1V1PA 5J18A 1FNVA 1F1HA 3ABVB 1V80A 3QWZB 2QHOA 2CU3A 3KUZA 4WWNA 4J3OD 3A9JA 2PVGC 3M63B 4LNFA 3BWUD 1RFKA 3SR6A 1C78A 1TKGA 5G5GA 3NY5A 1SBBB 3VR8B 4HK2A 5BYQA 4DXGA 4ZRKA 4L2YA 3T3NA 2Y5BB 2KD0A 1WJ6A 2LVPA 2KJRA 3B08A 1WXQA 2SEBD 5CHVC 2L52A 3VTWA 1BUIC 1E8XA 3Q3MC 2CU1A 2W54A 4W9JA 3IFWB 3Q3FA 1Q1OA 4FXCA 2N9PC 2B76B 2XK5A 3IT4B 4S17A 4M8NA 1I4XA 1DOXA 3DVNV 1V9JA 1UH6A 2K6DB 2PJHA 4K7WA 3PHWB 1XQQA 1YX6B 3VR9B 3NUHB 3AULA 4CQNA 4M01A 2W82A 3BZDB 5C2TB 1J19A 2REXA 4PS8A 4FADA 2LGIA 2W9NA 3TEWA 4C7YA 2K1FA 3FILB 5D94A 3VTUA 4LTUA 1IGCA 2J42A 2IBIB 5IKCM 1B1ZA 5BYSA 1L6UA 2K0PA 2RR9A 4WJNA 3SEBA 1I4HA 1JWUD 3PRZA 3AE2B 4RM9A 4DHJD 1FO4A 3OWEB 3D32A 3HVZA 2HTME 4EFOA 1WZ0A 1OQQA 3UQBA 3AEAB 1V5TA 1EO6A 1LXDA 1WGKA 3ETRA 3HUIA 2RDGA 3APFA 1NYRA 2ACZB 1L6VA 3KUDB 1OEYA 1UBQA 3RN9C 2W3SA 2V3PA 2JPHA 1C76A 3I57A 1P7FA 1T5XD 4ASWC 3ZQ4A 1J8CA 4KGSA 1SF0A 3QIJA 2RMMA 2KO3A 4YL8A 1WIAA 2O2VA 2WXHA 3DHHC 5J17A 4NAWA 2O2VB 4XC2A 4QAYA 1FFVA 1SGHA 4FJYA 3Q3NC 3EUB2 5DPRA 2DYMA 4IC7B 3BVMA 1WFYA 2R61A 1H8CA 1E6EB 1TKEA 1TBEA 1SXTA 5TSSA 4YTPB 3AE7B 2QILA 2IGHA 1WXVA 2LGXA 3OG5A 5EE3A 3C19A 4GB9A 4WQOB 3ZRCA 2QIEB 4HDQA 1LO5D 3RNAC 3DBLI 4KSKC 1VZ7A 5LLIA 1F2RI 3DBHI 4DHZB 2GBJA 4EE2A 5HI1A 1V97A 4WURA 2EMTA 4K1RB 1XXGA 3EHVA 5AZGA 5GXGB 1TS3A 3RNCC 4AOFA 2R2QA 4D2KA 3IHPC 2VH2A 2GBKA 2BYVE 1VJKA 4MEMA 3ZJVA 5DPTA 2D2QA 4EZJA 2EMSA 1JQ4A 4GIVA 1ET6A 1X1MA 2L3ZA 1JWSD 2JXTA 3AB5A 2BYEA 2KYWA 1XLOA 3VH3B 3WANA 2DWQA 3GZNI 2KKCA 4JPSA 1KTKA 1EWCA 3Q14C 2CHXA 4BZAA 1GC7A 2BT6A 3UIPB 2E3TA 5C3JB 2MBQA 1EWYC 1ET9A 4KGTA 4GDLA 4MGYE 1ZKHA 2MBHA 1EUVB 2G1EA 1WSPA 1A70A 3AEEB 2QEJC 3H1UA 4BOZB 2MJEA 2PTLA 5BMHA 4NPNA 4W9HA 1VRAB 3V61A 2LI5A 1XCTL 2IO3B 2JZZA 3ZJTA 1ISNA 3KVFB 2BVCA 3VUWA 3EECA 4DHJB 2H89B 2OHFA 1V1PB 2NS5A 2CKHB 3ZRFA 3H7SA 1TKYA 1UWXA 3KWVA 4IKGA 4XWWA 2K6QA 3LYYA 3V62A 4MM3A 2W55A 2MHJA 2I1KA 2KFKA 2HE7A 1C9FA 4ANXA 4HROA 3MJWA 2LFIA 1GPXA 3AE3B 2KWCA 3DVGY 3PSEB 3QA8A 3H6NA 4P7IA 2Y5PA 4M02A 2D3GA 1T0QC 2Y3AA 1QOGA 1NVID 1YQ4B 2GBMA 1P1AA 4YTNB 1E7VA 2V3SA 2NTTA 4LCDE 2G9HD 1YN4A 1SIFA 4XE0A 2KC2A 4DHZE 3VDZA 4I6LB 2KFJA 4HPPA 2BS4B 3DBRB 2PE9A 4ICVA 3B2FA 5BO4B 2K8BA 3ZIMA 1WMHB 3NVVA 4IUMB 5D3IB 2QSDA 2LXCA 2SAKA 5CHFA 1QOBA 2WU2B 1WF9A 3FC4A 1PFDA 1SEBD 2GBNA 2ZNVC 3ZXRA 2MP2A 1T0RC 2KC1A 2WXFA 2DYBA 4BKSA 4A6QA 4DQOC 2IY1B 4IM3A 2WU5B 4B0EA 3MFGA 5AZHA 1VD2A 3URYA 1L0VB 1SB3C 2N1VA 2LGDA 2RGFA 3MP9A 4ZYSA 4IG7B 3CF6E 4HCPB 2DZJA 5CTRC 2KMAA 2D5GA 3B1LX 4XWTA 1WM3A 2FAZA 2XEWA 1IBXB 2NPTB 1UWMA 4IWQA 2VZKD 2IO0B 2JRHA 3BIID 2YEPF 3Q3OC 2HDEA 1BMLC 2M19A 2VZKB 2QC8A 4KIKA 1KOTA 5I4DA 2KJHB 4YSZB 2KX3A 3MHSD 1C4AA 3ZDTA 3MC0B 2EKEC 3FKYA 1MFWA 1Q0WB 2BS2B 4WH4A 4ZRJA 1MVKA 2HJ1A 4KDLB 2CR5A 2JSVX 2O6VA 3PGEA 4BAXA 2C7NB 2JZ3B 5E6JA 2WXMA 1OFFA 2BPSA 5DPWA 4MH0E 3GB1A 2WNMA 4ICUA 2BKFA 2WXNA 3Q8CA 3VXWA 2WDQB 1ZGUB 2N9KA 2ZCCA 1GOZA 3RNBC 4TV3A 2K3UA 1XLQA 2J4XA 4RMAA 3P4RB 4Q2JA 3V6CB 4GDLB 4X57B 4KKIA 2N9LA 5IO9A 1K51A 1TS2A 4GXBA 1WR1A 3RT3B 2M1MA 1QOFA 1TTNA 1SJED 4ARCA 3U2SC 2C7MB 3DHGC 4DWFA 2X8XX 1HTOA 1RWSA 1MG8A 4ZRQA 4DXFA 5L83A 3Q69A 2Z8LA 3PTFC 3J9CA 3N9YC 2L76A 1HA5A 4HXDA 3L17A 4XYCA 2ON8A 1VZ8A 3HVDA 4HRSA 3AEGB 3RYTA 3U52E 1SIJA 3P42A 1N5XA 3L16A 2ZCBA 1LQBA 2KT7A 3GS2A 2IO2B 3KYCD 3R2TA 4ANVA 4ZRPA 1CZPA 4W9LA 3U30A 4JL9A 4DK5A 1IBXA 2MX2A 3P2BA 2KANA 3P63A 2WXLA 1D5MC 3SFEB 3APDA 2WS3B 1TS5A 2JWZA 3HRDD 4M00A 2WXPA 2LJ5A 1C1YB 4KDIC 4ANWA 1F2RC 2GOWA 1CJEA 1OTRB 4E3CA 4BKGA 2TSSA 1FEHA 4JE3B 1Q10A 2ZNVB 5HG2A 2KLGA 3GZNB 2LGYA 4LLGM 4BOSC 2BYFA 1KFYB 3A9KB 4XGAB 2AEHA 2MRPA 2WDTB 3BYYB 4NAWB 1V1OA 4BKTA 1P3QU 3GOEA 1SE3A 1SE4A 2KTFA 2FIDA 3M62B 1K53A 4EZKA 2DZKA 2E6XA 3LDZE 3M3JA 5DCNA 1JMLA 2Q5WD 3AI5A 4TQ0A 3ZKJC 3TIXA 3CSFA 1JRPA 1WJ4A 2H88B 2IJ0A 1MG4A 4C56C 2WX1A 2L0TA 3KW5B 2KK8A 4NNJB 1YN5A 1AWDA 1E8ZA 2EKIA 1TJEA 3RNFC 1PGXA 2NVUI 3AEFB 4GGQA 2JT4B 2JU6X 3R2IA 2JZPA 3BY4B 3DBLB 4OVZA 4LJPB 4URKA 2FBWB 3FILA 3BINA 2L1AA 1Q5WB 1ESFA 3OJ3A 1J7CA 2L8JA 2AQ2B 1DOIA 1UD7A 1SSNA 4B9KA 1Y8RC 1GAQB 4ZRIA 1E90A 3DDCB 3U8ZA 4NJ6A 1QZEA 4LNNA 4A9AA 3N30A 3CSTA 4E71A 4K3BA 2VRRB 2G4SA 4OVVA 5FR6A 1VLBA 2AQ1B 1KLVA 2GI9A 3IBEA 4KX6B 4C80A 2WGSA 3H9DA 1YJJA 1WX9A 3NS8A 2LHEA 4H2AA 2XK5B 3NS1A 2D3AA 3WAOA 4GSWA 2PLPA 2KVRA 4E74A 2DBYA 4EEWA 2M17A 3ZXVA 1WRDB 3RFZB 2I1JA 3X23A 2N4FA 1K52A 5AZFA 1UELA 1UGMA 2PW9A 1MHHE 2X38A 1YQBA 2ZW0A 1E7PB 1UZXB 3I3TB 1KRHA
chains in the Genus database with same CATH topology
1YJIA 1XCTL 4RCOA 1Y56A 3NVZA 3AN1A 4N59A 3ZJTA 1B9RA 2IGDA 2WDRB 2DYOA 3AE4B 4YSYB 5AUIA 3TEXA 1WWTA 2FUG1 2H89B 2OHFA 2N0SB 1V1PB 4XDCA 3L4PA 1I4QA 1ZPSA 4NZLB 2M0AA 3AM9A 1FNWA 5HHDG 2K9XA 1D5XC 3AMZA 4OZAA 4UDUC 1FM0D 1TKYA 1UWXA 1L0YB 1TY0A 3KWVA 4IKGA 4XWWA 1PGBA 1PYWD 3LYYA 2J53A 2W55A 3PZ7A 1C79A 1NENB 5MPOA 1QLBB 4N58A 4HEA1 1F0ZA 2ICIA 4RGOS 1FNUA 1C9FA 1DYQA 2RDHA 5D3DA 3BVGA 1DGJA 3BK2A 4HROA 2LFIA 4OZBA 1GPXA 1FXAA 3AE3B 4JWUC 1N61A 3Q8AA 2Y5PA 3V3XA 1AN8A 2Y3AA 1ZUD2 1C77A 3IAM1 4HJGE 1QOGA 1N5WA 2EELA 1NVID 2ONQA 1YQ4B 1M4VA 4YTNB 2QJLA 2PKOA 1I4PA 2NTTA 2I2YA 1FRDA 2G9HD 1YN4A 1XCQL 4XE0A 2KACA 2RPVA 4JX1C 2K22A 2BB5A 1HXYD 1ACCA 4LK0M 1GB4A 2OEDA 3AECB 2JWUA 1ZOYB 2BS4B 3W9CB 1L0XB 3KLSX 3B2FA 5H92C 1IUEA 2LEKA 4RF0A 4A90A 3NVVA 3E56A 5D3IB 1NYQA 5H8YE 3W1SA 2QSDA 4NAMA 1N60A 3MHZA 2SAKA 3AE6B 4WQMA 3UI3A 4OW0A 1KH0A 1QOBA 5G5HA 3U4EG 2WU2B 3FC4A 3P4SB 4REZA 1PFDA 2PVOD 1HQRD 1SEBD 1VDVA 3EGRA 1PDXA 3IXSA 1NEKB 1YQ3B 4YXDB 1MI0A 1KLUD 3VQIA 1CQVA 4RGNA 2WXFA 4XDDA 1WRIA 4KGRA 2LHDA 4A6QA 4DQOC 3B2GA 4RGTA 1HZ5A 2WU5B 3I9V1 1PUTA 1UUPA 3MFGA 4B0EA 3URYA 4OZCA 1L0VB 1SB3C 4YTMB 5EE9A 5AUKA 4JWSC 3LB8C 3MP9A 2V3NA 1N62A 3GP7A 1YN3A 1JROA 2NTSA 2MEKA 4MACA 4ZHPA 1E10A 4ZYSA 1T6BX 1P7EA 3H8HA 3BK1A 2D5GA 4R3DA 2BBCA 1ZE3D 4US9A 4XWTA 5EE0A 3TEYA 1IBXB 1UWMA 3DWMA 3Q8BA 2LMCA 2VZKD 3BIID 3ZGZA 1ENFA 1ZXHA 2YEPF 4WAFA 5BMGA 2HDEA 2KMMA 1BMLC 2M19A 2VZKB 2JYTA 1AYFA 5FR3A 3P4QB 3T3OA 1WYGA 3RPFC 5I4DA 4YSZB 1C4AA 1ZXIA 3EA6A 3MC0B 3Q8FA 2WXJA 3B9JA 1C4PA 2KN4A 4AQ7A 1FMAD 1D5ZC 2AX5A 2BS2B 1D6EC 1QILA 2BS3B 3NVWA 4USAA 4ARIA 4WH4A 1MVKA 2K5PA 4TMAB 1E0ZA 2WXRA 4L1BA 2M56B 5FK9C 2WXIA 2KWDA 2JSVX 1CK1A 4RF1A 2CJOA 1D4BA 1OQRA 1V1PA 1FNVA 3ABVB 5E6JA 2DLBA 3NZ3A 2WXMA 1OFFA 2CU3A 4J3OD 2PVGC 1EU3A 3U7ZA 3BWUD 1RFKA 1E9MA 1HEZE 3GB1A 4GLSC 3SR6A 5FKAC 2V4IB 1C78A 1TKGA 5G5GA 4ZOHC 1SBBB 3VR8B 3TEZA 2WNMA 1EM7A 1JCKB 2WXNA 1TYGB 3Q8CA 5BYQA 4DXGA 2WDQB 4L2YA 1ZP0B 2N9KA 3AE5B 3T3NA 1GOZA 5D7GA 2K3UA 1XLQA 5BMIA 2INNE 1WXQA 2SEBD 1N63A 2J4XA 3BYTB 2L52A 1BUIC 4WIPA 3P4RB 4Q2JA 4GDLB 2JYEA 2W54A 4KKIA 2KQ4X 2N9LA 2CJNA 1K51A 1TS2A 4FXCA 3BVZA 2B76B 3NVYA 4KKJA 1XLNA 1JWMD 4ITKA 4WWMA 3IT4B 1QOFA 3PO0A 2NMQA 1I4XA 1DOXA 1R7SA 2GRIA 2BTEA 1SJED 4ARCA 3U2SC 2WXOA 4ZHOA 1RWSA 4ZRQA 4DXFA 3VR9B 3NUHB 3Q69A 2WXKA 2Z8LA 3V05A 2V0GA 1NI3A 1ZDVA 4CQNA 3J9CA 2L83A 2W82A 3BZDB 3N9YC 2QMTA 1HA5A 4L23A 1FRRA 1QKZA 1VR9A 2LJIA 5C2TB 4TQ1A 4A8XC 2LGIA 2ON8A 3MJ5A 1VZ8A 3HVDA 3P4PB 3AEGB 4HRSA 3TEWA 4PT5A 1J7AA 3AE9B 3IT6B 4C7YA 1DOYA 3U52E 1SIJA 1UNSA 3P42A 1N5XA 3CWIA 3FILB 3AV8A 4LTUA 1IGCA 1KF6B 3GS2A 4RGMA 1TZOA 3R8BA 4MH8A 2J42A 3R2TA 3WCQA 1J7BA 1B1ZA 4ZRPA 5BYRA 2Y5CA 2I38A 1CZPA 1L6UA 2K0PA 5BYSA 4RFBA 1I4RA 3PZ8A 1I4HA 4HKZE 3SEBA 1JWUD 3AE2B 5LNK1 2WQYB 1IBXA 2XN9C 1FO4A 3AH7A 3OWEB 4RH6A 2XNAC 2WXLA 1D5MC 3P63A 3SFEB 3HVZA 2HTME 1BXTA 2WS3B 1TS5A 2IPKD 1ROEA 1OQQA 1PGAA 3AEAB 3HRDD 3ETRA 1WGKA 2WXPA 1XEEA 3HUIA 1IGDA 2RDGA 2WDVB 1KLGD 3AE1B 1NYRA 2ACZB 1L6VA 1HZ6A 1FIQA 1F2RC 1SE2A 1CJEA 2MJDA 2W3SA 2V3PA 1C76A 3I57A 1P7FA 2TSSA 4YWGG 1T5XD 1FEHA 4JE3B 1Q10A 5HG2A 1RYJA 3ZQ4A 1I7HA 4OHJA 4KGSA 1SF0A 2YEPB 3Q8EA 2RMMA 2J52A 2PMVA 4LLGM 4RNAA 1FCLA 1XLPA 1F77A 3TSSA 1KFYB 2WXHA 1FXIA 3BYYB 4NAWB 4P16A 1JWBD 1V1OA 3SFDB 1MHXA 2WXQA 4TSSA 1SJHD 1RM6C 1SE3A 1L5PA 1FFVA 2AQ3B 3AE8B 1MPEA 3KWLA 1SE4A 4B0MA 1JWAD 1K53A 4NJCA 3EUB2 3W2DA 2DYMA 1FD6A 2E6XA 3BVMA 3ZJUA 2ZW1A 2R61A 1TY2A 4P6VF 1JMLA 2Q5WD 1JW9D 1E6EB 3FAHA 3LXFA 4TQ0A 1TKEA 3C8YA 1SXTA 5TSSA 1JRPA 2H88B 4YTPB 1C4CA 3AE7B 2QILA 2IGHA 4N6EB 3P1MA 2IJ0A 5EE3A 1QT9A 4C56C 4IDIA 2QIEB 1LO5D 2IDYA 1YN5A 2JX5A 3IAS1 2PIAA 2WLBA 1XF5L 1UGJA 1AWDA 2KDMA 1VZ7A 2EKIA 1TJEA 1PGXA 3AEFB 1F2RI 5JXVA 2JU6X 3R2IA 2JZPA 1TS4A 1FFUA 2FE8A 4EE2A 3AEDB 1GB1A 2N7JA 3AEBB 4OVZA 4O1NA 1QQRA 2FBWB 5HI1A 2GB1A 3FILA 1V97A 4IOIE 3TUOA 4WURA 3W5UB 2L1AA 2MH7A 1ESFA 1XXGA 1J7CA 4M0WA 2AQ2B 1DOIA 1YNTE 1SSNA 4A55A 5GXGB 1TS3A 1GAQB 1AW7A 4GDKB 4MM3B 4D2KA 5HFYA 3ZYYX 1EU4A 3O13A 4A9AA 1T3QA 2LUMA 1VJKA 4US8A 4AS1A 3ZJVA 2W3RA 1L4DB 5T8IA 3VRBB 1JQ4A 4HKQA 1ET6A 1VLBA 2AQ1B 1JWSD 2JXTA 3AB5A 4C7ZA 4YT0B 2GI9A 1XLOA 4KX6B 4C80A 1JALA 1YJJA 3NRZA 2DWQA 1V8CA 2KAJA 5EE1A 1ZDXA 2LHEA 4H2AA 4JPSA 1KTKA 1EWCA 3W5VB 2MJ3A 1YMHE 3NS1A 2L32A 2BT6A 2E3TA 1XO3A 2IGGA 3DWGC 5C3JB 1EWYC 2PLPA 3VRAB 1ET9A 4KGTA 3CIRB 4MT5A 2BB6A 2DBYA 1QF6A 4YSXB 2BW2A 1I4GA 2JQRB 2G1EA 1WSPA 1K50A 1A70A 3AEEB 3E9SA 3RFZB 1STEA 2WXGA 1K52A 2QEJC 1L4ZB 2BYTA 1FCCC 2WP9B 2PW9A 1MHHE 2MJEA 2INPE 2X38A 2PTLA 2ZW0A 1E7PB 3KQ4A 5BMHA 1QOAA 1KRHA 1VRAB 1VZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SB3 C;  1YJI A;  3NVY A;  5EE9 A;  4YTM B;  5AUK A;  4JWS C;  1E6E B;  3FAH A;  3LXF A;  1XLN A;  3LB8 C;  3NVZ A;  4ITK A;  4WWM A;  1TKE A;  3AN1 A;  1QOF A;  3PO0 A;  4N59 A;  1B9R A;  1N62 A;  2WDR B;  1E10 A;  1JRO A;  4ZHP A;  1JRP A;  3AE4 B;  2H88 B;  4YSY B;  4YTP B;  5AUI A;  3AE7 B;  1DOX A;  1WWT A;  1R7S A;  4N6E B;  3P1M A;  5EE3 A;  2H89 B;  1QT9 A;  2OHF A;  2N0S B;  3L4P A;  4IDI A;  4ZHO A;  1RWS A;  3AM9 A;  2QIE B;  2K9X A;  3VR9 B;  4US9 A;  2JX5 A;  3AMZ A;  2PIA A;  1FM0 D;  1TKY A;  2WLB A;  1NI3 A;  1AWD A;  5EE0 A;  2L83 A;  1UWM A;  3DWM A;  5C2T B;  2EKI A;  1FRR A;  1TJE A;  2W55 A;  3BII D;  3AEF B;  1FFU A;  1NEN B;  2KMM A;  5MPO A;  1QLB B;  2M19 A;  3AEG B;  3AED B;  3P4P B;  4HRS A;  1J7A A;  3AE9 B;  4N58 A;  4C7Y A;  1DOY A;  1F0Z A;  1AYF A;  3AEB B;  1SIJ A;  2FBW B;  1N5X A;  3CWI A;  3P4Q B;  3AV8 A;  1DGJ A;  4HRO A;  4LTU A;  1WYG A;  3RPF C;  1GPX A;  1FXA A;  1KF6 B;  1V97 A;  4YSZ B;  3AE3 B;  1ZXI A;  4JWU C;  1N61 A;  3W5U B;  2MH7 A;  3B9J A;  1J7C A;  3WCQ A;  1FMA D;  1DOI A;  2AX5 A;  1J7B A;  2BS2 B;  2BS3 B;  3NVW A;  2Y5C A;  4USA A;  5GXG B;  1ZUD 2;  1CZP A;  1L6U A;  1QOG A;  1GAQ B;  2K5P A;  1N5W A;  1NVI D;  3AE2 B;  2WQY B;  3ZYY X;  1E0Z A;  1YQ4 B;  1FO4 A;  3AH7 A;  4YTN B;  4A9A A;  2M56 B;  3P63 A;  1T3Q A;  2QJL A;  2PKO A;  3HVZ A;  2HTM E;  1VJK A;  3SFE B;  4US8 A;  2WS3 B;  1FRD A;  2CJO A;  2W3R A;  1OQR A;  3VRB B;  1OQQ A;  1JQ4 A;  3AEA B;  3HRD D;  3ABV B;  4JX1 C;  2K22 A;  1VLB A;  3ETR A;  1WGK A;  1OFF A;  2CU3 A;  3AB5 A;  3AE1 B;  2WDV B;  3HUI A;  4YT0 B;  4C7Z A;  1XLO A;  4KX6 B;  4C80 A;  1JAL A;  1NYR A;  3AEC B;  1YJJ A;  1ZOY B;  2ACZ B;  1L6V A;  2BS4 B;  2DWQ A;  1V8C A;  2KAJ A;  2PVG C;  3NRZ A;  5EE1 A;  3W9C B;  1FIQ A;  1RFK A;  1E9M A;  3B2F A;  5H92 C;  1CJE A;  2MJD A;  2W3S A;  3SR6 A;  3W5V B;  1IUE A;  2LEK A;  2MJ3 A;  3NS1 A;  3NVV A;  1TKG A;  2BT6 A;  1NYQ A;  2E3T A;  5G5G A;  5H8Y E;  1XO3 A;  3DWG C;  1N60 A;  1RYJ A;  5C3J B;  1EWY C;  3AE6 B;  2B76 B;  4WQM A;  4ZOH C;  1I7H A;  3VR8 B;  3VRA B;  1SF0 A;  1QOB A;  3CIR B;  5G5H A;  2DBY A;  1TYG B;  2WU2 B;  3FC4 A;  3P4S B;  1PFD A;  1XLP A;  2PVO D;  2WDQ B;  1QF6 A;  1ZP0 B;  1VDV A;  1PDX A;  3AE5 B;  1KFY B;  4YSX B;  1NEK B;  1FXI A;  2JQR B;  1YQ3 B;  4YXD B;  2G1E A;  3SFD B;  1JWB D;  1XLQ A;  1A70 A;  3AEE B;  1WXQ A;  1N63 A;  1RM6 C;  2L52 A;  1L5P A;  1FFV A;  3AE8 B;  1WRI A;  3KWL A;  3P4R B;  1JWA D;  2W54 A;  2WP9 B;  3EUB 2;  1KRH A;  3B2G A;  2WU5 B;  2CJN A;  2MJE A;  1PUT A;  1E7P B;  4FXC A;  1QOA A;  4P6V F;  1L0V B;  1ROE A;  2Q5W D;  1JW9 D; 
#chains in the Genus database with same CATH topology
 1YJI A;  4RCO A;  1GNU A;  4YSY B;  5AUI A;  1RFA A;  2L7R A;  2FUG 1;  4PK1 A;  2N0S B;  3PS6 A;  1EF5 A;  2LXA A;  1L0Y B;  1TY0 A;  3QCA A;  1LGR A;  1PGB A;  2DHZ A;  2J53 A;  3PRP B;  1QLB B;  4N58 A;  4HEA 1;  4BBN C;  4G3X B;  2ICI A;  4W9G A;  4RGO S;  1FNU A;  5LXI B;  5D3D A;  4OZB A;  1M94 A;  1N61 A;  4GOC A;  2KN5 A;  2AL6 A;  2MBB B;  2QCZ A;  3ALB A;  4AWJ A;  3MTN B;  4JGH B;  2DEN B;  2WHI A;  2EEL A;  4M8M A;  2V9H A;  1M4V A;  2OJR A;  1RAX A;  4K81 A;  2PKO A;  1I4P A;  2I2Y A;  1FRD A;  3DVN U;  5TR5 A;  3UIO B;  4MGZ E;  1WJN A;  2K22 A;  2G45 B;  4WJQ A;  3VAW A;  4LK0 M;  1GB4 A;  3AEC B;  3OJ4 B;  1L0X B;  1IUE A;  4RF0 A;  4A90 A;  4IWO A;  5H8Y E;  3W1S A;  1N60 A;  3MHZ A;  2R2O A;  2XBB C;  3RZW C;  5G5H A;  3U4E G;  4C00 A;  4REZ A;  2KOX A;  3QHT A;  4YXD B;  3RZF A;  3A9K A;  4RGN A;  2BQQ A;  4KGR A;  2Z59 B;  4C4V B;  1AAR A;  3QQ8 B;  3B2G A;  4RGT A;  2L0F A;  5G55 A;  3I9V 1;  1S3S G;  3R3M A;  4KZ0 A;  5EE9 A;  5AUK A;  4JWS C;  4PYU A;  2V3N A;  3GP7 A;  4OVU A;  4ZHP A;  1BT0 A;  2N7D A;  1V86 A;  3H7P B;  1T6B X;  3TCA A;  4TKN A;  3H8H A;  4R3D A;  3NG0 A;  2BBC A;  4US9 A;  2LGS A;  3UQA A;  4FBJ B;  3TEY A;  3DBR I;  3Q8B A;  4BKS D;  3ZGZ A;  4GU2 A;  4W9E A;  5BMG A;  1R4M B;  2JVC A;  3HK0 A;  1AYF A;  4II2 B;  3L08 A;  5CX3 A;  1YD8 U;  3RD2 A;  3T3O A;  3RUI B;  3ZVV A;  2D3B A;  2ZVO A;  3WA0 A;  2HD5 B;  2MSE D;  3B9J A;  1D5Z C;  3WAL A;  3NVW A;  2RD0 A;  1E0Z A;  4L1B A;  2ASQ A;  2KWD A;  2IY0 B;  4HWI B;  2MA9 B;  2CJO A;  1OQR A;  2DLB A;  3ONS A;  2KHW B;  5IN7 A;  3PRM B;  1T0Y A;  3IG3 A;  1EU3 A;  4GLS C;  5FKA C;  1NI2 A;  2BGF A;  2V4I B;  4ZOH C;  3TEZ A;  3KUC B;  1EM7 A;  1TYG B;  3AE5 B;  1IPG A;  5BMI A;  2MWS B;  3HHM A;  1F9J A;  3S2A A;  2D07 B;  2JYE A;  3ML8 A;  2CJN A;  2DNF A;  2IND C;  3NOB A;  1L7Y A;  2KWU B;  3QK0 A;  2RPQ A;  3NVY A;  3RNE C;  4ANU A;  4MSM B;  1WYW B;  1HTQ A;  1XLN A;  3TL5 A;  1JWM D;  2J0J A;  4ITK A;  2JY6 A;  5G2N A;  1R7S A;  4NY0 A;  2GRI A;  3LJ3 A;  2B3A A;  2WXO A;  4B95 A;  4K7S A;  3AU4 A;  4ZHO A;  2O6V B;  1WX8 A;  3MC9 A;  2WXK A;  3V05 A;  4JLC A;  2QMT A;  4L23 A;  1QKZ A;  4F8C B;  2LJI A;  4A8X C;  3MJ5 A;  4P1B C;  1DOY A;  3AE9 B;  3IT6 B;  3JSV B;  1UNS A;  3DHI C;  1E5W A;  4FJZ A;  2KX0 A;  2GLS A;  3AV8 A;  3VFK A;  3Q6B A;  3WCQ A;  2WWZ A;  1WGG A;  4WJP A;  4RM8 A;  3HM3 A;  3PZ8 A;  4HKZ E;  3N3K B;  1WI0 A;  2NPT A;  2XN9 C;  4RH6 A;  1BXT A;  4XX5 A;  1Z5S B;  2IPK D;  1PGA A;  3A1Q B;  3QAR A;  4MGK E;  3Q2A C;  2OJW A;  1XEE A;  2BF8 B;  3AE1 B;  1KLG D;  1U4A A;  2GMI C;  1HZ6 A;  2M8S A;  1WGD A;  1NDD A;  1C3T A;  1RYJ A;  2DZI A;  1I7H A;  2A5U A;  3Q8E A;  3ENE A;  5C23 A;  4EUT A;  1RLF A;  5D6J B;  3M95 A;  1FXI A;  3NZS A;  4P16 A;  1MHX A;  2MP2 B;  4TSS A;  2ZPY A;  1IP9 A;  4MGI E;  2AQ3 B;  3AE8 B;  1MPE A;  3KWL A;  4B0M A;  4WWP A;  4NJC A;  2PE6 B;  1IYF A;  4A20 A;  5IOI A;  4P1C C;  2ZW1 A;  4P6V F;  2DZM A;  2IZV B;  3U7D A;  3FAH A;  5JHA A;  3QAQ A;  4GN1 A;  3C8Y A;  3NHE B;  3K9P B;  1E7U A;  4N6E B;  2FCM A;  4PS3 A;  5CHW A;  5E6O A;  2IDY A;  3IAS 1;  2WLB A;  1UGJ A;  1H4R A;  1GG3 A;  1KJT A;  2FCN A;  2NBV B;  1OGW A;  3ZTC A;  5JXV A;  4G11 A;  1TS4 A;  2NBW B;  3AED B;  5LXH A;  1GB1 A;  3APC A;  2N7J A;  5D2M B;  2V4L A;  4K7U A;  3SU8 X;  4S0R A;  2INC C;  2LAS A;  3R7Q A;  3W5U B;  2J0M A;  4M0W A;  3OAW A;  1A5R A;  3ZO5 B;  4BVU C;  3O65 B;  4A3P A;  3SD5 A;  1AW7 A;  4LNO A;  4MM3 B;  2KDI A;  3EFU A;  3ZYY X;  1EU4 A;  4HCN B;  3DBH B;  1V2Y A;  2LUM A;  3V6E B;  4US8 A;  4AS1 A;  2W3R A;  3N1X C;  2BWE S;  2J0K A;  1TT5 B;  3B0A A;  4C7Z A;  4YT0 B;  4IM2 A;  1MJD A;  3V60 A;  2J7Q B;  1V8C A;  3ZNG C;  2KVZ A;  4JQW C;  5DPS A;  1YMH E;  1G6J A;  4WAA A;  2IGG A;  5C1Z A;  3DWG C;  2FUH B;  1GJZ A;  2KDE B;  3CIR B;  2BB6 A;  1QF6 A;  4YSX B;  2BW2 A;  2JQR B;  1V6E A;  3PLU A;  4KSL C;  2WXG A;  1L4Z B;  2BYT A;  1FCC C;  1JRU A;  4IW0 A;  3EC8 A;  5HKH A;  3KQ4 A;  2K8C A;  1ROE A;  1VZ6 A;  1WX7 A;  3UGB B;  4LJO B;  3NVZ A;  4N59 A;  1XD3 B;  3TEX A;  1WWT A;  4AJY B;  2DAF A;  3L10 B;  3L54 A;  4XDC A;  2ZEQ A;  4FHK A;  1FNW A;  1WZ3 A;  5HHD G;  1D5X C;  2C5L C;  4OZA A;  1V49 A;  2MW5 A;  3ZUN A;  1PYW D;  3PZ7 A;  1C79 A;  3ZNH B;  5MPO A;  1XT9 B;  1F0Z A;  1V5O A;  1Z2M A;  1WGR A;  3ML9 A;  4XZ4 A;  1DYQ A;  2RDH A;  3BVG A;  3BK2 A;  5L95 C;  1FXA A;  2CHZ A;  4JWU C;  1WGH A;  2BWF A;  2G4D B;  3VHT C;  1YX5 B;  1WJU A;  1AN8 A;  1ZUD 2;  4NJ7 A;  3DQV A;  1N5W A;  3N32 A;  2LVQ A;  4G0N B;  2MBO A;  2FIF A;  3TJP A;  3ZW3 A;  3L0W B;  3ZNI D;  2RPV A;  4JX1 C;  5IAA C;  3H7P A;  1HXY D;  1ACC A;  1ZW7 A;  2OED A;  4FN2 A;  3W1S C;  3E56 A;  1D3Z A;  2V1Y A;  1R4M I;  3AE6 B;  4PYZ A;  4WQM A;  4C4V A;  4BFR A;  1KH0 A;  4DDI D;  2PPH A;  3P4S B;  2KNB A;  2PVO D;  1HQR D;  1PDX A;  3GE8 C;  1YQ3 B;  1MI0 A;  2Z0E B;  4LDT B;  3VQI A;  3AXC A;  4JIO U;  2FNJ B;  1WRI A;  2LHD A;  1CMX B;  4KVG B;  1PUT A;  4FHJ A;  1UUP A;  4NQL B;  4OZC A;  4YTM B;  4LNI A;  5EDS A;  4MAC A;  1E10 A;  2NTS A;  4F7Z A;  1K8R B;  1VCB A;  3BK1 A;  4KV2 A;  1ZE3 D;  5EE0 A;  1WE6 A;  3VH4 B;  2M0X A;  2LMC A;  1FXT B;  1ZXH A;  3PRE A;  2A4Z A;  2LRU A;  4WAF A;  3RMK C;  1T0S C;  2KQ7 A;  3AU5 A;  2JYT A;  3P4Q B;  3GE3 C;  2K39 A;  2KZR A;  2WXJ A;  4ZYN A;  2KN4 A;  2D10 A;  4AQ7 A;  1OEY J;  1FMA D;  2AX5 A;  1D6E C;  1QIL A;  2BS3 B;  4USA A;  2BKR B;  2K5P A;  1GC6 A;  2JRI B;  3WAP A;  2WXR A;  3SHQ A;  4W9K A;  2M56 B;  2WXI A;  1CK1 A;  4RF1 A;  1D4B A;  3N1Y C;  3NZ3 A;  3WIM A;  2LD9 A;  4HVB A;  1KM7 A;  1OQY A;  4MJS A;  2MCN B;  3U7Z A;  2KLC A;  1I35 A;  1E9M A;  1HEZ E;  1F52 A;  3JW0 X;  3SDL C;  2K25 A;  2LVO A;  1JCK B;  5IP4 D;  3QC8 B;  3ZDM C;  1ZP0 B;  5D7G A;  3W1Y A;  2ZPN A;  1P9D U;  2UU7 A;  3PHX B;  4WWO A;  2INN E;  1N63 A;  3BYT B;  5KHO A;  3UIN B;  4AJW A;  2FCQ A;  4WIP A;  2NBU A;  4WJO A;  2G3Q B;  2KQ4 X;  1RRB A;  3DPD A;  3BVZ A;  4LNK A;  2ZVN A;  4KKJ A;  4MJS B;  3A9J B;  4WWM A;  2UWQ A;  3PO0 A;  5JH5 C;  2NMQ A;  4I6P A;  1P98 A;  2N9X A;  2BTE A;  2PEA A;  3TMP B;  2D3C A;  2V0G A;  1NI3 A;  1ZDV A;  1R4N I;  2L83 A;  2NR2 A;  1FRR A;  1VR9 A;  1LM8 B;  4TQ1 A;  3NJT A;  3P4P B;  4DXA B;  4M0W B;  1J7A A;  4PT5 A;  3X0W A;  1WY8 A;  2RDB C;  4IM0 A;  1SE9 A;  3CWI A;  3PVL A;  1KF6 B;  4RGM A;  2UYZ B;  1TZO A;  2Z0D B;  3R8B A;  4MH8 A;  3RNG C;  3R66 C;  1J7B A;  5BYR A;  2Y5C A;  2I38 A;  2AL3 A;  4RFB A;  1I4R A;  5LNK 1;  3RI7 C;  2WQY B;  3DOW A;  3AH7 A;  2LZ6 A;  2XNA C;  4W9D A;  2IO1 B;  5GMV A;  1LFD A;  4G50 A;  1WR6 E;  1L2N A;  1IGD A;  2WDV B;  1FIQ A;  4HPM B;  1SE2 A;  2MJD A;  3PLV A;  4YWG G;  1PQS A;  3T9L A;  3I63 C;  1N6Z A;  4OHJ A;  4BBN F;  3EFC A;  2YEP B;  2J52 A;  2PMV A;  3KYD D;  3L13 A;  4RNA A;  1FCL A;  1XLP A;  1F77 A;  3TSS A;  3PPA A;  3SFD B;  1JWB D;  2WXQ A;  2KTR A;  1SJH D;  4PS7 A;  1RM6 C;  1L5P A;  1JWA D;  2FCS A;  1NBF C;  3CMM B;  3W2D A;  1FD6 A;  2NCN A;  3ZJU A;  1TY2 A;  1JW9 D;  2KJ6 A;  3LXF A;  4DDG D;  4MSQ B;  2JF5 A;  1C4C A;  1I42 A;  1R4N B;  3P1M A;  5AEK B;  1QT9 A;  1FPY A;  4K3C A;  4AUQ C;  4IDI A;  2JUO A;  4A3O A;  4EKU A;  2JX5 A;  2AYO B;  2PIA A;  2ZJD A;  1XF5 L;  2KDM A;  3ZTD A;  3JYU A;  1FFU A;  2FE8 A;  4CO7 A;  2DX5 B;  2HJ8 A;  2KXJ A;  3AEB B;  2CS4 A;  4W9C A;  4O1N A;  2KQS A;  1QQR A;  2GB1 A;  1WXA A;  2KWV B;  1J0G A;  4IOI E;  3TUO A;  2LRW A;  2MH7 A;  1YNT E;  4EOY A;  4A55 A;  5E6P A;  4GDK B;  5HFY A;  3HIZ A;  3O13 A;  4TUU A;  2O6V D;  1T3Q A;  4N9F 4;  4B6W A;  2HTH A;  1L4D B;  1WGY A;  5T8I A;  3VRB B;  4HKQ A;  1UF0 A;  5IA7 A;  2KDF B;  4MEL A;  1JAL A;  3NRZ A;  2KAJ A;  3C0R B;  3PV1 A;  3QX1 A;  1ZDX A;  4HJK A;  5EE1 A;  3W5V B;  1E8W A;  2MJ3 A;  2L32 A;  4ZDV A;  1XO3 A;  2KMC A;  3VRA B;  1WXS A;  4LDT D;  4MT5 A;  3IVF A;  1EF1 A;  2MLB A;  4II3 B;  1I4G A;  4CYE A;  1K50 A;  3PZD A;  3E9S A;  1STE A;  3A4S C;  1WH3 A;  1TZ1 A;  2VH1 A;  2WP9 B;  3RUL A;  4F1S A;  2INP E;  1QOA A;  3R7R A;  5JZE B;  4CHK A;  3VUX A;  4IWP A;  3ZLZ A;  1Y56 A;  3ZNZ B;  3AN1 A;  1B9R A;  3QJZ A;  2IGD A;  2WDR B;  2DYO A;  3AE4 B;  1TGZ B;  2QDF A;  4FJV B;  2GBR A;  3OLM D;  2DAJ A;  3HM6 X;  3K9O B;  1I4Q A;  1ZPS A;  2N9E B;  3L4P A;  4NZL B;  4FA6 A;  2M0A A;  2YLM A;  2AWT A;  3AM9 A;  1TIF A;  3PT2 B;  2K9X A;  3N1Z C;  2LWP A;  5KHQ A;  3AMZ A;  4UDU C;  1FM0 D;  3T8M A;  3VVW B;  2YVC A;  3NZU A;  4GDK A;  3N20 C;  3A4R A;  1NEN B;  5E6N A;  4FLH A;  4NQK E;  2D11 A;  3WAM A;  4AP4 C;  4KIK B;  1DGJ A;  2CHW A;  4GMV A;  3Q8A A;  3TBL D;  1GUA B;  3V3X A;  1C77 A;  3IAM 1;  4HJG E;  4HDO A;  2ONQ A;  2K8H A;  2QJL A;  1XCQ L;  2KAC A;  2BB5 A;  2N1W A;  1WXM A;  2N7E A;  1UBI A;  2JWU A;  1ZOY B;  3W9C B;  3KLS X;  5H92 C;  5JHB A;  2LEK A;  2RSU A;  1NYQ A;  4NAM A;  1S1Q B;  2IYD B;  2LUE A;  3UI3 A;  4OW0 A;  1VDV A;  3EGR A;  3IXS A;  4HPL B;  4I6N B;  2KTR B;  1WM2 A;  1NEK B;  1YIW A;  4EZL A;  3ECI A;  1KLU D;  1CQV A;  4XDD A;  3VUY A;  5J2R A;  3DVG X;  2ZZP B;  1HZ5 A;  1WMH A;  4HLE A;  4DBG A;  2WX0 A;  4W9I A;  3JVZ X;  3LB8 C;  3A33 B;  3DCG A;  1N62 A;  1YN3 A;  1JRO A;  2MEK A;  2MQJ A;  2C7H A;  1HE8 A;  3A1Q A;  1P7E A;  3KH0 A;  3MC8 A;  3DBS A;  4KZC A;  4MDK E;  1WE7 A;  3DWM A;  2M4N A;  1ENF A;  2C60 A;  2L05 A;  3I5J C;  4J6I A;  2KMM A;  1E8Y A;  4ACF A;  2KDB A;  2MBE A;  1P0R A;  2WYQ A;  5FR3 A;  3UF8 A;  3Q3J A;  1YJ1 A;  1WYG A;  3RPF C;  2JXX A;  2OOB B;  1ZXI A;  3EA6 A;  2C9W B;  3JSV A;  3Q8F A;  1C4P A;  2KFK B;  4FUL A;  4ARI A;  1V81 A;  4TMA B;  3VTV A;  1YOV B;  3RCZ A;  5FK9 C;  4W9F A;  2L00 B;  1V1P A;  5J18 A;  1FNV A;  1F1H A;  3ABV B;  1V80 A;  3QWZ B;  2QHO A;  2CU3 A;  3KUZ A;  4WWN A;  4J3O D;  3A9J A;  2PVG C;  3M63 B;  4LNF A;  3BWU D;  1RFK A;  3SR6 A;  1C78 A;  1TKG A;  5G5G A;  3NY5 A;  1SBB B;  3VR8 B;  4HK2 A;  5BYQ A;  4DXG A;  4ZRK A;  4L2Y A;  3T3N A;  2Y5B B;  2KD0 A;  1WJ6 A;  2LVP A;  2KJR A;  3B08 A;  1WXQ A;  2SEB D;  5CHV C;  2L52 A;  3VTW A;  1BUI C;  1E8X A;  3Q3M C;  2CU1 A;  2W54 A;  4W9J A;  3IFW B;  3Q3F A;  1Q1O A;  4FXC A;  2N9P C;  2B76 B;  2XK5 A;  3IT4 B;  4S17 A;  4M8N A;  1I4X A;  1DOX A;  3DVN V;  1V9J A;  1UH6 A;  2K6D B;  2PJH A;  4K7W A;  3PHW B;  1XQQ A;  1YX6 B;  3VR9 B;  3NUH B;  3AUL A;  4CQN A;  4M01 A;  2W82 A;  3BZD B;  5C2T B;  1J19 A;  2REX A;  4PS8 A;  4FAD A;  2LGI A;  2W9N A;  3TEW A;  4C7Y A;  2K1F A;  3FIL B;  5D94 A;  3VTU A;  4LTU A;  1IGC A;  2J42 A;  2IBI B;  5IKC M;  1B1Z A;  5BYS A;  1L6U A;  2K0P A;  2RR9 A;  4WJN A;  3SEB A;  1I4H A;  1JWU D;  3PRZ A;  3AE2 B;  4RM9 A;  4DHJ D;  1FO4 A;  3OWE B;  3D32 A;  3HVZ A;  2HTM E;  4EFO A;  1WZ0 A;  1OQQ A;  3UQB A;  3AEA B;  1V5T A;  1EO6 A;  1LXD A;  1WGK A;  3ETR A;  3HUI A;  2RDG A;  3APF A;  1NYR A;  2ACZ B;  1L6V A;  3KUD B;  1OEY A;  1UBQ A;  3RN9 C;  2W3S A;  2V3P A;  2JPH A;  1C76 A;  3I57 A;  1P7F A;  1T5X D;  4ASW C;  3ZQ4 A;  1J8C A;  4KGS A;  1SF0 A;  3QIJ A;  2RMM A;  2KO3 A;  4YL8 A;  1WIA A;  2O2V A;  2WXH A;  3DHH C;  5J17 A;  4NAW A;  2O2V B;  4XC2 A;  4QAY A;  1FFV A;  1SGH A;  4FJY A;  3Q3N C;  3EUB 2;  5DPR A;  2DYM A;  4IC7 B;  3BVM A;  1WFY A;  2R61 A;  1H8C A;  1E6E B;  1TKE A;  1TBE A;  1SXT A;  5TSS A;  4YTP B;  3AE7 B;  2QIL A;  2IGH A;  1WXV A;  2LGX A;  3OG5 A;  5EE3 A;  3C19 A;  4GB9 A;  4WQO B;  3ZRC A;  2QIE B;  4HDQ A;  1LO5 D;  3RNA C;  3DBL I;  4KSK C;  1VZ7 A;  5LLI A;  1F2R I;  3DBH I;  4DHZ B;  2GBJ A;  4EE2 A;  5HI1 A;  1V97 A;  4WUR A;  2EMT A;  4K1R B;  1XXG A;  3EHV A;  5AZG A;  5GXG B;  1TS3 A;  3RNC C;  4AOF A;  2R2Q A;  4D2K A;  3IHP C;  2VH2 A;  2GBK A;  2BYV E;  1VJK A;  4MEM A;  3ZJV A;  5DPT A;  2D2Q A;  4EZJ A;  2EMS A;  1JQ4 A;  4GIV A;  1ET6 A;  1X1M A;  2L3Z A;  1JWS D;  2JXT A;  3AB5 A;  2BYE A;  2KYW A;  1XLO A;  3VH3 B;  3WAN A;  2DWQ A;  3GZN I;  2KKC A;  4JPS A;  1KTK A;  1EWC A;  3Q14 C;  2CHX A;  4BZA A;  1GC7 A;  2BT6 A;  3UIP B;  2E3T A;  5C3J B;  2MBQ A;  1EWY C;  1ET9 A;  4KGT A;  4GDL A;  4MGY E;  1ZKH A;  2MBH A;  1EUV B;  2G1E A;  1WSP A;  1A70 A;  3AEE B;  2QEJ C;  3H1U A;  4BOZ B;  2MJE A;  2PTL A;  5BMH A;  4NPN A;  4W9H A;  1VRA B;  3V61 A;  2LI5 A;  1XCT L;  2IO3 B;  2JZZ A;  3ZJT A;  1ISN A;  3KVF B;  2BVC A;  3VUW A;  3EEC A;  4DHJ B;  2H89 B;  2OHF A;  1V1P B;  2NS5 A;  2CKH B;  3ZRF A;  3H7S A;  1TKY A;  1UWX A;  3KWV A;  4IKG A;  4XWW A;  2K6Q A;  3LYY A;  3V62 A;  4MM3 A;  2W55 A;  2MHJ A;  2I1K A;  2KFK A;  2HE7 A;  1C9F A;  4ANX A;  4HRO A;  3MJW A;  2LFI A;  1GPX A;  3AE3 B;  2KWC A;  3DVG Y;  3PSE B;  3QA8 A;  3H6N A;  4P7I A;  2Y5P A;  4M02 A;  2D3G A;  1T0Q C;  2Y3A A;  1QOG A;  1NVI D;  1YQ4 B;  2GBM A;  1P1A A;  4YTN B;  1E7V A;  2V3S A;  2NTT A;  4LCD E;  2G9H D;  1YN4 A;  1SIF A;  4XE0 A;  2KC2 A;  4DHZ E;  3VDZ A;  4I6L B;  2KFJ A;  4HPP A;  2BS4 B;  3DBR B;  2PE9 A;  4ICV A;  3B2F A;  5BO4 B;  2K8B A;  3ZIM A;  1WMH B;  3NVV A;  4IUM B;  5D3I B;  2QSD A;  2LXC A;  2SAK A;  5CHF A;  1QOB A;  2WU2 B;  1WF9 A;  3FC4 A;  1PFD A;  1SEB D;  2GBN A;  2ZNV C;  3ZXR A;  2MP2 A;  1T0R C;  2KC1 A;  2WXF A;  2DYB A;  4BKS A;  4A6Q A;  4DQO C;  2IY1 B;  4IM3 A;  2WU5 B;  4B0E A;  3MFG A;  5AZH A;  1VD2 A;  3URY A;  1L0V B;  1SB3 C;  2N1V A;  2LGD A;  2RGF A;  3MP9 A;  4ZYS A;  4IG7 B;  3CF6 E;  4HCP B;  2DZJ A;  5CTR C;  2KMA A;  2D5G A;  3B1L X;  4XWT A;  1WM3 A;  2FAZ A;  2XEW A;  1IBX B;  2NPT B;  1UWM A;  4IWQ A;  2VZK D;  2IO0 B;  2JRH A;  3BII D;  2YEP F;  3Q3O C;  2HDE A;  1BML C;  2M19 A;  2VZK B;  2QC8 A;  4KIK A;  1KOT A;  5I4D A;  2KJH B;  4YSZ B;  2KX3 A;  3MHS D;  1C4A A;  3ZDT A;  3MC0 B;  2EKE C;  3FKY A;  1MFW A;  1Q0W B;  2BS2 B;  4WH4 A;  4ZRJ A;  1MVK A;  2HJ1 A;  4KDL B;  2CR5 A;  2JSV X;  2O6V A;  3PGE A;  4BAX A;  2C7N B;  2JZ3 B;  5E6J A;  2WXM A;  1OFF A;  2BPS A;  5DPW A;  4MH0 E;  3GB1 A;  2WNM A;  4ICU A;  2BKF A;  2WXN A;  3Q8C A;  3VXW A;  2WDQ B;  1ZGU B;  2N9K A;  2ZCC A;  1GOZ A;  3RNB C;  4TV3 A;  2K3U A;  1XLQ A;  2J4X A;  4RMA A;  3P4R B;  4Q2J A;  3V6C B;  4GDL B;  4X57 B;  4KKI A;  2N9L A;  5IO9 A;  1K51 A;  1TS2 A;  4GXB A;  1WR1 A;  3RT3 B;  2M1M A;  1QOF A;  1TTN A;  1SJE D;  4ARC A;  3U2S C;  2C7M B;  3DHG C;  4DWF A;  2X8X X;  1HTO A;  1RWS A;  1MG8 A;  4ZRQ A;  4DXF A;  5L83 A;  3Q69 A;  2Z8L A;  3PTF C;  3J9C A;  3N9Y C;  2L76 A;  1HA5 A;  4HXD A;  3L17 A;  4XYC A;  2ON8 A;  1VZ8 A;  3HVD A;  4HRS A;  3AEG B;  3RYT A;  3U52 E;  1SIJ A;  3P42 A;  1N5X A;  3L16 A;  2ZCB A;  1LQB A;  2KT7 A;  3GS2 A;  2IO2 B;  3KYC D;  3R2T A;  4ANV A;  4ZRP A;  1CZP A;  4W9L A;  3U30 A;  4JL9 A;  4DK5 A;  1IBX A;  2MX2 A;  3P2B A;  2KAN A;  3P63 A;  2WXL A;  1D5M C;  3SFE B;  3APD A;  2WS3 B;  1TS5 A;  2JWZ A;  3HRD D;  4M00 A;  2WXP A;  2LJ5 A;  1C1Y B;  4KDI C;  4ANW A;  1F2R C;  2GOW A;  1CJE A;  1OTR B;  4E3C A;  4BKG A;  2TSS A;  1FEH A;  4JE3 B;  1Q10 A;  2ZNV B;  5HG2 A;  2KLG A;  3GZN B;  2LGY A;  4LLG M;  4BOS C;  2BYF A;  1KFY B;  3A9K B;  4XGA B;  2AEH A;  2MRP A;  2WDT B;  3BYY B;  4NAW B;  1V1O A;  4BKT A;  1P3Q U;  3GOE A;  1SE3 A;  1SE4 A;  2KTF A;  2FID A;  3M62 B;  1K53 A;  4EZK A;  2DZK A;  2E6X A;  3LDZ E;  3M3J A;  5DCN A;  1JML A;  2Q5W D;  3AI5 A;  4TQ0 A;  3ZKJ C;  3TIX A;  3CSF A;  1JRP A;  1WJ4 A;  2H88 B;  2IJ0 A;  1MG4 A;  4C56 C;  2WX1 A;  2L0T A;  3KW5 B;  2KK8 A;  4NNJ B;  1YN5 A;  1AWD A;  1E8Z A;  2EKI A;  1TJE A;  3RNF C;  1PGX A;  2NVU I;  3AEF B;  4GGQ A;  2JT4 B;  2JU6 X;  3R2I A;  2JZP A;  3BY4 B;  3DBL B;  4OVZ A;  4LJP B;  4URK A;  2FBW B;  3FIL A;  3BIN A;  2L1A A;  1Q5W B;  1ESF A;  3OJ3 A;  1J7C A;  2L8J A;  2AQ2 B;  1DOI A;  1UD7 A;  1SSN A;  4B9K A;  1Y8R C;  1GAQ B;  4ZRI A;  1E90 A;  3DDC B;  3U8Z A;  4NJ6 A;  1QZE A;  4LNN A;  4A9A A;  3N30 A;  3CST A;  4E71 A;  4K3B A;  2VRR B;  2G4S A;  4OVV A;  5FR6 A;  1VLB A;  2AQ1 B;  1KLV A;  2GI9 A;  3IBE A;  4KX6 B;  4C80 A;  2WGS A;  3H9D A;  1YJJ A;  1WX9 A;  3NS8 A;  2LHE A;  4H2A A;  2XK5 B;  3NS1 A;  2D3A A;  3WAO A;  4GSW A;  2PLP A;  2KVR A;  4E74 A;  2DBY A;  4EEW A;  2M17 A;  3ZXV A;  1WRD B;  3RFZ B;  2I1J A;  3X23 A;  2N4F A;  1K52 A;  5AZF A;  1UEL A;  1UGM A;  2PW9 A;  1MHH E;  2X38 A;  1YQB A;  2ZW0 A;  1E7P B;  1UZX B;  3I3T B;  1KRH A; 
#chains in the Genus database with same CATH homology
 1YJI A;  1XCT L;  4RCO A;  1Y56 A;  3NVZ A;  3AN1 A;  4N59 A;  3ZJT A;  1B9R A;  2IGD A;  2WDR B;  2DYO A;  3AE4 B;  4YSY B;  5AUI A;  3TEX A;  1WWT A;  2FUG 1;  2H89 B;  2OHF A;  2N0S B;  1V1P B;  4XDC A;  3L4P A;  1I4Q A;  1ZPS A;  4NZL B;  2M0A A;  3AM9 A;  1FNW A;  5HHD G;  2K9X A;  1D5X C;  3AMZ A;  4OZA A;  4UDU C;  1FM0 D;  1TKY A;  1UWX A;  1L0Y B;  1TY0 A;  3KWV A;  4IKG A;  4XWW A;  1PGB A;  1PYW D;  3LYY A;  2J53 A;  2W55 A;  3PZ7 A;  1C79 A;  1NEN B;  5MPO A;  1QLB B;  4N58 A;  4HEA 1;  1F0Z A;  2ICI A;  4RGO S;  1FNU A;  1C9F A;  1DYQ A;  2RDH A;  5D3D A;  3BVG A;  1DGJ A;  3BK2 A;  4HRO A;  2LFI A;  4OZB A;  1GPX A;  1FXA A;  3AE3 B;  4JWU C;  1N61 A;  3Q8A A;  2Y5P A;  3V3X A;  1AN8 A;  2Y3A A;  1ZUD 2;  1C77 A;  3IAM 1;  4HJG E;  1QOG A;  1N5W A;  2EEL A;  1NVI D;  2ONQ A;  1YQ4 B;  1M4V A;  4YTN B;  2QJL A;  2PKO A;  1I4P A;  2NTT A;  2I2Y A;  1FRD A;  2G9H D;  1YN4 A;  1XCQ L;  4XE0 A;  2KAC A;  2RPV A;  4JX1 C;  2K22 A;  2BB5 A;  1HXY D;  1ACC A;  4LK0 M;  1GB4 A;  2OED A;  3AEC B;  2JWU A;  1ZOY B;  2BS4 B;  3W9C B;  1L0X B;  3KLS X;  3B2F A;  5H92 C;  1IUE A;  2LEK A;  4RF0 A;  4A90 A;  3NVV A;  3E56 A;  5D3I B;  1NYQ A;  5H8Y E;  3W1S A;  2QSD A;  4NAM A;  1N60 A;  3MHZ A;  2SAK A;  3AE6 B;  4WQM A;  3UI3 A;  4OW0 A;  1KH0 A;  1QOB A;  5G5H A;  3U4E G;  2WU2 B;  3FC4 A;  3P4S B;  4REZ A;  1PFD A;  2PVO D;  1HQR D;  1SEB D;  1VDV A;  3EGR A;  1PDX A;  3IXS A;  1NEK B;  1YQ3 B;  4YXD B;  1MI0 A;  1KLU D;  3VQI A;  1CQV A;  4RGN A;  2WXF A;  4XDD A;  1WRI A;  4KGR A;  2LHD A;  4A6Q A;  4DQO C;  3B2G A;  4RGT A;  1HZ5 A;  2WU5 B;  3I9V 1;  1PUT A;  1UUP A;  3MFG A;  4B0E A;  3URY A;  4OZC A;  1L0V B;  1SB3 C;  4YTM B;  5EE9 A;  5AUK A;  4JWS C;  3LB8 C;  3MP9 A;  2V3N A;  1N62 A;  3GP7 A;  1YN3 A;  1JRO A;  2NTS A;  2MEK A;  4MAC A;  4ZHP A;  1E10 A;  4ZYS A;  1T6B X;  1P7E A;  3H8H A;  3BK1 A;  2D5G A;  4R3D A;  2BBC A;  1ZE3 D;  4US9 A;  4XWT A;  5EE0 A;  3TEY A;  1IBX B;  1UWM A;  3DWM A;  3Q8B A;  2LMC A;  2VZK D;  3BII D;  3ZGZ A;  1ENF A;  1ZXH A;  2YEP F;  4WAF A;  5BMG A;  2HDE A;  2KMM A;  1BML C;  2M19 A;  2VZK B;  2JYT A;  1AYF A;  5FR3 A;  3P4Q B;  3T3O A;  1WYG A;  3RPF C;  5I4D A;  4YSZ B;  1C4A A;  1ZXI A;  3EA6 A;  3MC0 B;  3Q8F A;  2WXJ A;  3B9J A;  1C4P A;  2KN4 A;  4AQ7 A;  1FMA D;  1D5Z C;  2AX5 A;  2BS2 B;  1D6E C;  1QIL A;  2BS3 B;  3NVW A;  4USA A;  4ARI A;  4WH4 A;  1MVK A;  2K5P A;  4TMA B;  1E0Z A;  2WXR A;  4L1B A;  2M56 B;  5FK9 C;  2WXI A;  2KWD A;  2JSV X;  1CK1 A;  4RF1 A;  2CJO A;  1D4B A;  1OQR A;  1V1P A;  1FNV A;  3ABV B;  5E6J A;  2DLB A;  3NZ3 A;  2WXM A;  1OFF A;  2CU3 A;  4J3O D;  2PVG C;  1EU3 A;  3U7Z A;  3BWU D;  1RFK A;  1E9M A;  1HEZ E;  3GB1 A;  4GLS C;  3SR6 A;  5FKA C;  2V4I B;  1C78 A;  1TKG A;  5G5G A;  4ZOH C;  1SBB B;  3VR8 B;  3TEZ A;  2WNM A;  1EM7 A;  1JCK B;  2WXN A;  1TYG B;  3Q8C A;  5BYQ A;  4DXG A;  2WDQ B;  4L2Y A;  1ZP0 B;  2N9K A;  3AE5 B;  3T3N A;  1GOZ A;  5D7G A;  2K3U A;  1XLQ A;  5BMI A;  2INN E;  1WXQ A;  2SEB D;  1N63 A;  2J4X A;  3BYT B;  2L52 A;  1BUI C;  4WIP A;  3P4R B;  4Q2J A;  4GDL B;  2JYE A;  2W54 A;  4KKI A;  2KQ4 X;  2N9L A;  2CJN A;  1K51 A;  1TS2 A;  4FXC A;  3BVZ A;  2B76 B;  3NVY A;  4KKJ A;  1XLN A;  1JWM D;  4ITK A;  4WWM A;  3IT4 B;  1QOF A;  3PO0 A;  2NMQ A;  1I4X A;  1DOX A;  1R7S A;  2GRI A;  2BTE A;  1SJE D;  4ARC A;  3U2S C;  2WXO A;  4ZHO A;  1RWS A;  4ZRQ A;  4DXF A;  3VR9 B;  3NUH B;  3Q69 A;  2WXK A;  2Z8L A;  3V05 A;  2V0G A;  1NI3 A;  1ZDV A;  4CQN A;  3J9C A;  2L83 A;  2W82 A;  3BZD B;  3N9Y C;  2QMT A;  1HA5 A;  4L23 A;  1FRR A;  1QKZ A;  1VR9 A;  2LJI A;  5C2T B;  4TQ1 A;  4A8X C;  2LGI A;  2ON8 A;  3MJ5 A;  1VZ8 A;  3HVD A;  3P4P B;  3AEG B;  4HRS A;  3TEW A;  4PT5 A;  1J7A A;  3AE9 B;  3IT6 B;  4C7Y A;  1DOY A;  3U52 E;  1SIJ A;  1UNS A;  3P42 A;  1N5X A;  3CWI A;  3FIL B;  3AV8 A;  4LTU A;  1IGC A;  1KF6 B;  3GS2 A;  4RGM A;  1TZO A;  3R8B A;  4MH8 A;  2J42 A;  3R2T A;  3WCQ A;  1J7B A;  1B1Z A;  4ZRP A;  5BYR A;  2Y5C A;  2I38 A;  1CZP A;  1L6U A;  2K0P A;  5BYS A;  4RFB A;  1I4R A;  3PZ8 A;  1I4H A;  4HKZ E;  3SEB A;  1JWU D;  3AE2 B;  5LNK 1;  2WQY B;  1IBX A;  2XN9 C;  1FO4 A;  3AH7 A;  3OWE B;  4RH6 A;  2XNA C;  2WXL A;  1D5M C;  3P63 A;  3SFE B;  3HVZ A;  2HTM E;  1BXT A;  2WS3 B;  1TS5 A;  2IPK D;  1ROE A;  1OQQ A;  1PGA A;  3AEA B;  3HRD D;  3ETR A;  1WGK A;  2WXP A;  1XEE A;  3HUI A;  1IGD A;  2RDG A;  2WDV B;  1KLG D;  3AE1 B;  1NYR A;  2ACZ B;  1L6V A;  1HZ6 A;  1FIQ A;  1F2R C;  1SE2 A;  1CJE A;  2MJD A;  2W3S A;  2V3P A;  1C76 A;  3I57 A;  1P7F A;  2TSS A;  4YWG G;  1T5X D;  1FEH A;  4JE3 B;  1Q10 A;  5HG2 A;  1RYJ A;  3ZQ4 A;  1I7H A;  4OHJ A;  4KGS A;  1SF0 A;  2YEP B;  3Q8E A;  2RMM A;  2J52 A;  2PMV A;  4LLG M;  4RNA A;  1FCL A;  1XLP A;  1F77 A;  3TSS A;  1KFY B;  2WXH A;  1FXI A;  3BYY B;  4NAW B;  4P16 A;  1JWB D;  1V1O A;  3SFD B;  1MHX A;  2WXQ A;  4TSS A;  1SJH D;  1RM6 C;  1SE3 A;  1L5P A;  1FFV A;  2AQ3 B;  3AE8 B;  1MPE A;  3KWL A;  1SE4 A;  4B0M A;  1JWA D;  1K53 A;  4NJC A;  3EUB 2;  3W2D A;  2DYM A;  1FD6 A;  2E6X A;  3BVM A;  3ZJU A;  2ZW1 A;  2R61 A;  1TY2 A;  4P6V F;  1JML A;  2Q5W D;  1JW9 D;  1E6E B;  3FAH A;  3LXF A;  4TQ0 A;  1TKE A;  3C8Y A;  1SXT A;  5TSS A;  1JRP A;  2H88 B;  4YTP B;  1C4C A;  3AE7 B;  2QIL A;  2IGH A;  4N6E B;  3P1M A;  2IJ0 A;  5EE3 A;  1QT9 A;  4C56 C;  4IDI A;  2QIE B;  1LO5 D;  2IDY A;  1YN5 A;  2JX5 A;  3IAS 1;  2PIA A;  2WLB A;  1XF5 L;  1UGJ A;  1AWD A;  2KDM A;  1VZ7 A;  2EKI A;  1TJE A;  1PGX A;  3AEF B;  1F2R I;  5JXV A;  2JU6 X;  3R2I A;  2JZP A;  1TS4 A;  1FFU A;  2FE8 A;  4EE2 A;  3AED B;  1GB1 A;  2N7J A;  3AEB B;  4OVZ A;  4O1N A;  1QQR A;  2FBW B;  5HI1 A;  2GB1 A;  3FIL A;  1V97 A;  4IOI E;  3TUO A;  4WUR A;  3W5U B;  2L1A A;  2MH7 A;  1ESF A;  1XXG A;  1J7C A;  4M0W A;  2AQ2 B;  1DOI A;  1YNT E;  1SSN A;  4A55 A;  5GXG B;  1TS3 A;  1GAQ B;  1AW7 A;  4GDK B;  4MM3 B;  4D2K A;  5HFY A;  3ZYY X;  1EU4 A;  3O13 A;  4A9A A;  1T3Q A;  2LUM A;  1VJK A;  4US8 A;  4AS1 A;  3ZJV A;  2W3R A;  1L4D B;  5T8I A;  3VRB B;  1JQ4 A;  4HKQ A;  1ET6 A;  1VLB A;  2AQ1 B;  1JWS D;  2JXT A;  3AB5 A;  4C7Z A;  4YT0 B;  2GI9 A;  1XLO A;  4KX6 B;  4C80 A;  1JAL A;  1YJJ A;  3NRZ A;  2DWQ A;  1V8C A;  2KAJ A;  5EE1 A;  1ZDX A;  2LHE A;  4H2A A;  4JPS A;  1KTK A;  1EWC A;  3W5V B;  2MJ3 A;  1YMH E;  3NS1 A;  2L32 A;  2BT6 A;  2E3T A;  1XO3 A;  2IGG A;  3DWG C;  5C3J B;  1EWY C;  2PLP A;  3VRA B;  1ET9 A;  4KGT A;  3CIR B;  4MT5 A;  2BB6 A;  2DBY A;  1QF6 A;  4YSX B;  2BW2 A;  1I4G A;  2JQR B;  2G1E A;  1WSP A;  1K50 A;  1A70 A;  3AEE B;  3E9S A;  3RFZ B;  1STE A;  2WXG A;  1K52 A;  2QEJ C;  1L4Z B;  2BYT A;  1FCC C;  2WP9 B;  2PW9 A;  1MHH E;  2MJE A;  2INP E;  2X38 A;  2PTL A;  2ZW0 A;  1E7P B;  3KQ4 A;  5BMH A;  1QOA A;  1KRH A;  1VRA B;  1VZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...