2N0SB

Haddock model of ferredoxin and [fefe] hydrogenase complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
94
structure length
94
Chain Sequence
YKVTLKTPSGDKTIECPADTYILDAAEEAGLDLPYSCRAGACSSCAGKVAAGTVDQSDQSFLDDAQMGNGFVLTCVAYPTSDCTIQTHQEEALY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insight into the Complex of Ferredoxin and [FeFe] Hydrogenase from Chlamydomonas reinhardtii.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Oxidoreductase
molecule keywords Fe-hydrogenase
total genus 19
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2n0sB00
4P6VF 2WLBA 2QJLA 3NS1A 1J7AA 1B9RA 1GAQB 1L0VB 1QF6A 2FBWB 1L5PA 1V97A 3DWMA 1PFDA 1XLQA 3NVWA 5H8YE 2BT6A 2PVGC 4HRSA 1N5WA 1DGJA 1T3QA 1VDVA 3ETRA 2BS4B 1E0ZA 1F0ZA 1OQQA 1JWBD 2PKOA 3AE7B 3AH7A 5AUKA 1XLOA 2MJEA 3B2FA 1AWDA 4IDIA 3AEFB 4ITKA 3AV8A 2L52A 1TJEA 1JW9D 2K5PA 5G5GA 3NVVA 2WDVB 2H89B 1N5XA 2Q5WD 4N6EB 5EE9A 3AE5B 2QIEB 1XLNA 2Y5CA 4JWSC 4YTPB 1ZOYB 1R7SA 1WWTA 1VJKA 3AEGB 3B9JA 3NVYA 3AE3B 4ZHOA 2M19A 3AEDB 3AE9B 1QLBB 1RFKA 2PVOD 3FAHA 1NYRA 1JRPA 2E3TA 3AEBB 4HROA 3NVZA 1TYGB 4YTNB 1XO3A 1NI3A 2BS3B 2PIAA 1N60A 3CIRB 3HUIA 1L6VA 1DOXA 1GPXA 1ZP0B 2WS3B 1IUEA 3BIID 4N59A 1QOBA 1N63A 1RM6C 3AM9A 4YXDB 2B76B 1DOIA 3AE1B 1NENB 1QOGA 1FM0D 1RWSA 3NRZA 1L6UA 3P4QB 2CJNA 3B2GA 1QOAA 4C80A 1JWAD 2OHFA 2H88B 1V8CA 1YJJA 4A9AA 4YTMB 1YQ3B 5C2TB 3AN1A 2W55A 5C3JB 1QT9A 1WRIA 1NVID 1E7PB 1J7CA 3AE6B 1E9MA 2BS2B 3P63A 1DOYA 1FRDA 2M56B 4C7YA 2MH7A 1KRHA 5EE1A 2AX5A 3AE2B 3P4SB 5AUIA 1ZXIA 1ROEA 4KX6B 1SF0A 1JROA 3P4RB 1JALA 1OFFA 1FXIA 1UWMA 4YSZB 1FIQA 1FFVA 2G1EA 1TKYA 2W54A 3P4PB 5G5HA 1CJEA 2HTME 3ZYYX 1TKEA 2EKIA 3AECB 3LB8C 1EWYC 3HRDD 5GXGB 1FXAA 1I7HA 4ZHPA 2L83A 4USAA 1E6EB 3AB5A 1NEKB 1SIJA 2CJOA 3LXFA 1J7BA 1WYGA 3FC4A 4YT0B 3SFDB 1WGKA 2W3SA 3W5VB 3AMZA 3PO0A 4WWMA 2WU5B 2K22A 4C7ZA 1RYJA 1PUTA 2KAJA 3DWGC 2K9XA 5H92C 1FMAD 3W5UB 1KF6B 4US8A 4JX1C 1E10A 1A70A 3AEAB 1N62A 2WDRB 1PDXA 2WP9B 2MJDA 1YQ4B 2WDQB 3SFEB 2WU2B 1WXQA 3L4PA 3KWLA 2W3RA 1YJIA 3AEEB 3VR8B 3VRAB 1NYQA 2JX5A 2MJ3A 1AYFA 3WCQA 3SR6A 3RPFC 4FXCA 4US9A 5EE3A 1FFUA 3P1MA 1VLBA 1JQ4A 4N58A 1OQRA 2WQYB 1TKGA 4JWUC 2JQRB 3VRBB 5EE0A 1XLPA 1FRRA 2ACZB 4ZOHC 4LTUA 1QOFA 2DBYA 3VR9B 2CU3A 2LEKA 1N61A 3EUB2 3ABVB 4YSYB 2DWQA 2KMMA 1SB3C 1ZUD2 3W9CB 3HVZA 4YSXB 4WQMA 5MPOA 1CZPA 1FO4A 3AE8B 3CWIA 3AE4B 1KFYB 2N0SB
chains in the Genus database with same CATH superfamily
4G3XB 2QJLA 2IPKD 2BWES 2MBQA 1MHXA 3H7SA 1QF6A 5IKCM 3DWMA 4XZ4A 2LWPA 5BO4B 2BKFA 2BS4B 1JWBD 1UUPA 1XLOA 3B2FA 4A3PA 3A9JB 2DENB 1OQYA 2WYQA 2K5PA 2Q5WD 1JCKB 5EE9A 2KTFA 3WALA 1ZOYB 2V3SA 2CHZA 4ANUA 3MTNB 3A9KA 1HEZE 2KN5A 3Q3MC 3QAQA 3IT6B 3CIRB 4S0RA 3VUXA 2GOWA 2INCC 1ZP0B 2G3QB 4LNNA 1Q1OA 2WXNA 3DVGX 4AWJA 4ZRIA 1E8YA 1RAXA 2GBKA 2WX1A 5C3JB 2XK5B 1DOYA 4ZRKA 3PTFC 3VXWA 3RMKC 3EGRA 1BUIC 3Q3OC 2V9HA 3UF8A 2W54A 1HZ5A 1ZGUB 1KM7A 3TEXA 4BOSC 1TKEA 3SU8X 2NMQA 4DHJD 4MJSA 3M62B 4XX5A 4CHKA 4AS1A 2C60A 3C0RB 3H6NA 2KLCA 2SAKA 3WAOA 1GUAB 4ANXA 2MP2A 4I6PA 1D6EC 1KTKA 4IM3A 4IOIE 1WSPA 5CX3A 1UZXB 2MJ3A 3I57A 3KH0A 3RPFC 1UGMA 1F2RI 4BBNC 4BVUC 2N1VA 1S3SG 1XLPA 2ICIA 3EUB2 1FCLA 1DYQA 4YSYB 5HI1A 2WXJA 4YSXB 1WYWB 2KTRB 2D10A 3QCAA 2LGYA 2INDC 4P6VF 1EWCA 2AYOB 5JH5C 2QILA 4IG7B 2LJIA 2K8BA 3AE7B 2GBNA 3NZSA 2DZIA 2H89B 3R8BA 1IGCA 4KDLB 2WDTB 3NHEB 1KH0A 3N1ZC 4ZHOA 2KD0A 1RFKA 3DQVA 3FAHA 3T8MA 3ZXVA 3CF6E 4YTNB 1NI3A 2BS3B 2PIAA 1WIAA 4GDLA 1L6VA 1GPXA 5JHAA 3PZ8A 4M01A 2KT7A 3AM9A 1C3TA 1DOIA 1NENB 3PV1A 2JUOA 3ZNHB 1CMXB 2K39A 2KN4A 1WJUA 4S17A 3AE6B 3RNFC 4DWFA 1WJ6A 1TT5B 3EA6A 2WXFA 3VUYA 1Q10A 3VTUA 1P9DU 1WGGA 2AL3A 4LNKA 4G11A 2ZW1A 5LXHA 1ZW7A 3L54A 1TIFA 2LGSA 2KFJA 3QQ8B 3Q3FA 5IOIA 3W5UB 1KF6B 1J8CA 3AEAB 3TJPA 2K25A 1R4NB 2WDQB 3DPDA 5CTRC 2M0XA 3A9JA 4GMVA 4GOCA 4W9IA 4BBNF 4J6IA 3RN9C 4YL8A 5D2MB 4IC7B 1M94A 2IJ0A 1FPYA 3DHHC 3VR9B 2CU3A 2MBBB 2DWQA 1CZPA 4RF0A 1SJED 3QK0A 3RNAC 3UIOB 4O1NA 2WXGA 2IO3B 1KFYB 2XNAC 3NS1A 1R4MI 2KACA 1L0VB 1IBXA 2G4SA 3CSTA 2J0JA 3RNCC 1VZ7A 4WWNA 4IDIA 2JXXA 2JPHA 3AV8A 2N4FA 3NOBA 5G5GA 4N6EB 3J9CA 3W2DA 3AE5B 1F9JA 3H9DA 1YMHE 2RGFA 2WXKA 2O2VA 4IWOA 1NYRA 4RCOA 2C7NB 4EZLA 3HUIA 2LVPA 3OG5A 4R3DA 1UF0A 1L4DB 2IBIB 3JW0X 2L76A 1AARA 2CU1A 2ONQA 4P1CC 3DBLB 3BVMA 1NI2A 1TY0A 3AE2B 4HCPB 1IYFA 1ROEA 1D4BA 4PYZA 2C5LC 1F2RC 2QCZA 3P42A 1V81A 3GZNB 2N9PC 1EWYC 2ZNVC 5BYQA 1WYGA 4ZDVA 2BPSA 3ONSA 1PUTA 3RI7C 2CKHB 1WXAA 4ANVA 1LM8B 3TIXA 1VZ8A 2LUMA 1PDXA 1TZOA 1JMLA 1YQ4B 2HJ1A 1MVKA 1V1PA 3WIMA 2W3RA 3VRAB 1NYQA 3PGEA 3WCQA 1XEEA 5JZEB 4FXCA 1WR1A 1TKGA 2ZNVB 1PGBA 3ZLZA 1N61A 4WQOB 3BVZA 3X23A 2QEJC 3X0WA 2EMSA 3SD5A 4AQ7A 3R7RA 5HG2A 4LNIA 2JU6X 2LHEA 1HA5A 2PVGC 2BYFA 3IAS1 2NPTA 1HQRD 1Z5SB 1AWDA 3PS6A 1K50A 3PREA 3VFKA 1YQBA 2DHZA 4TMAB 1MPEA 1BMLC 3R2IA 4EZKA 2M19A 4ANWA 2BYVE 3DBHB 4FADA 3BZDB 1XO3A 4HCNB 2WS3B 4XE0A 5JHBA 3QHTA 1N63A 4MACA 3BINA 1A5RA 2MQJA 1WGHA 2PMVA 2WXLA 1TS2A 1T0SC 4EEWA 1EU3A 4FHKA 5KHQA 1I42A 3DBHI 4GDKB 1WGDA 3BK2A 1FXIA 3WAMA 4B95A 5IN7A 3OLMD 3AECB 1I7HA 2IO0B 4USAA 2LGIA 3NZUA 2N9EB 2HJ8A 5GMVA 4EE2A 2KAJA 2G4DB 2OJRA 3TBLD 3VTVA 2KX0A 4EFOA 4A8XC 3H8HA 4W9HA 1BT0A 3PLUA 1L4ZB 1RRBA 2LRUA 1GB1A 1VLBA 3V3XA 2L8JA 3HM3A 4IM2A 3VUWA 4DHJB 3KW5B 4DHZB 3E56A 1I35A 3Q8CA 3W9CB 4WQMA 2ZCCA 4OZBA 2V3NA 3VH3B 2KWDA 1L5PA 4ARCA 4TKNA 5D94A 5H8YE 4KGRA 3ZGZA 2KDBA 2MWSB 2UU7A 4KZ0A 2L52A 4WWPA 2BB6A 2DYOA 4M8NA 1E5WA 2Z0DB 4DXFA 4AJYB 1JRPA 2GBRA 2AEHA 4A6QA 2KLGA 3DVGY 3GE8C 3DBLI 3A33B 2KWUB 1XXGA 2B76B 2V4IB 3Q8BA 4HPLB 2RDHA 3CMMB 4HDOA 3N1XC 3P4QB 2NBUA 4C80A 5LLIA 1XF5L 5IAAC 4OW0A 5C2TB 3TSSA 4F1SA 3ZJVA 2JVCA 1E7PB 3P63A 4MGKE 2KXJA 3HM6X 4RGOS 4II2B 1FIQA 1FFVA 1P7FA 2G1EA 3R3MA 5I4DA 1CJEA 5HFYA 3LB8C 2L83A 4F7ZA 3FC4A 1HTQA 1C4CA 3URYA 1F1HA 4CYEA 1VD2A 3ML8A 1UBIA 2GLSA 2KC2A 2WDRB 3QC8B 2MJDA 3AXCA 3NZ3A 5C1ZA 1ET9A 2C7MB 4ZRPA 1YN4A 4KGTA 2BWFA 2KKCA 2N9XA 4M0WA 1IGDA 4C00A 2WWZA 3VQIA 3S2AA 3MP9A 2I38A 4F8CB 3MHSD 3H1UA 1JWUD 4BOZB 2YEPF 1SBBB 3MC0B 3DBSA 1V97A 1EO6A 4H2AA 5AUKA 3ZDMC 4PK1A 2D2QA 2KMCA 2M0AA 3B08A 4ITKA 2M4NA 4C4VB 1LO5D 4RNAA 4FJYA 2HD5B 1ET6A 2WXHA 1D5MC 1SJHD 1V5TA 3ENEA 5DCNA 2FCSA 1H8CA 4WAFA 2DZMA 2NS5A 2WX0A 1L6UA 3DHGC 5IO9A 1STEA 2IGGA 1KOTA 1WM3A 2NTSA 1VRAB 1KRHA 1JROA 3U7ZA 3FILB 2J0MA 2LJ5A 3P4PB 2DYMA 3UINB 2EKIA 4IKGA 1WI0A 4D2KA 1V49A 1GB4A 1V1PB 1NEKB 2W82A 3SFDB 2BW2A 1WGKA 3IHPC 4L2YA 1P0RA 1P7EA 3ZDTA 2BB5A 4C7ZA 2L7RA 1F77A 4M00A 1Z2MA 2E6XA 1HXYD 1SIFA 4JX1C 4W9GA 3HK0A 1PYWD 4RMAA 1WXQA 2RDGA 2PE9A 4US9A 4HKQA 1QOFA 3I5JC 2KQ4X 3T3NA 2LUEA 4MGIE 1J7AA 3LDZE 2FAZA 5J18A 3V61A 1EUVB 5G55A 3H7PB 4HRSA 4NJ6A 3N20C 4JIOU 4DQOC 1QZEA 3QIJA 3VDZA 3JVZX 2HE7A 1Y8RC 3AE9B 2J53A 2PVOD 1V1OA 1TTNA 2NBVB 3V62A 3M63B 1FM0D 1IPGA 3PZ7A 1QOAA 2JZ3B 2EELA 4OHJA 1YNTE 2K6QA 1VCBA 3JSVA 1E9MA 3B0AA 3JYUA 4WWOA 1WGYA 2KQ7A 3DVNU 4PS7A 3A4RA 4RM8A 3KUCB 3M3JA 2D3GA 1D5ZC 2MRPA 2RMMA 2X8XX 3R7QA 2D11A 1S1QB 1WR6E 3AMZA 3C19A 1FEHA 4N9F4 2K22A 3DWGC 4HKZE 2IYDB 2KANA 3ZO5B 2YVCA 4MM3A 1A70A 1HZ6A 2TSSA 2L0FA 2PJHA 5FR6A 2YLMA 2OEDA 4HK2A 4WJQA 3SDLC 3W1SC 4IWPA 3Q3NC 2L00B 2M1MA 1SGHA 3P1MA 3RCZA 3VVWB 1V9JA 4ZYNA 2RPVA 1K53A 2CHWA 4FJZA 2G45B 1FO4A 2MSED 4MDKE 4OZAA 3BYYB 1WM2A 2BF8B 4MT5A 1LGRA 3RZWC 1PFDA 3IVFA 4GXBA 5CHVC 2BT6A 4LJOB 1DGJA 1T3QA 1OQQA 2PKOA 3TUOA 3O13A 1NBFC 4RH6A 2MCNB 2J42A 1VR9A 3Q6BA 2I1KA 3VAWA 2AWTA 3O65B 1OTRB 3AE1B 1U4AA 3NRZA 3UGBB 3B2GA 2Z0EB 4B0MA 3DBRI 2JY6A 3DHIC 1ZXIA 1AN8A 4KX6B 1UWMA 5BYSA 3QWZB 2D3CA 3ZIMA 1KJTA 1P1AA 4TV3A 5DPWA 3R66C 4L23A 3W5VB 1ISNA 3PO0A 5BMGA 5J17A 1N6ZA 2WXRA 2Y5BB 1L7YA 4TUUA 1I4PA 4XWTA 4BKSA 3TMPB 2IDYA 2HDEA 1VZ6A 3ZW3A 2BYEA 3UIPB 2D07B 1UNSA 1IBXB 3EHVA 3ML9A 4LLGM 4CO7A 3WAPA 4TQ1A 2KNBA 1YD8U 2XK5A 4P16A 3OAWA 1XCTL 3MJ5A 1B9RA 1GAQB 4II3B 5FR3A 3SEBA 2XN9C 3T9LA 2AQ3B 2ON8A 3MJWA 2HTHA 3IFWB 2N9KA 1EF1A 3GZNI 4RF1A 4XYCA 2ZZPB 2XEWA 5AZGA 3A9KB 4W9DA 2QIEB 3N9YC 4YTPB 5D3IB 1VJKA 3AE3B 2JRHA 1K51A 2YEPB 1D5XC 2J52A 2FNJB 2RPQA 3KWVA 2J7QB 2BGFA 1C77A 4RGMA 1WXMA 5IA7A 1RM6C 1Y56A 2KMAA 3TCAA 3PVLA 2NVUI 4BKSD 4WURA 1JWAD 2KFKB 2H88B 4KSLC 1CQVA 4EOYA 1FNUA 3U52E 4A9AA 1FXTB 1MHHE 3V6EB 3AN1A 2KOXA 2W55A 1J7CA 2LVOA 2JZZA 5EE1A 3L13A 2QDFA 4W9FA 3P4RB 1OFFA 2JZPA 1UD7A 3AB5A 3N1YC 1SIJA 4P1BC 4KIKA 4UDUC 4YT0B 1FNWA 3PZDA 3RNGC 1P98A 2KHWB 1RYJA 3ZNID 4DXGA 2EMTA 2AL6A 3DBRB 1WE6A 1UELA 3SFEB 3U4EG 4LNOA 4W9JA 1ZXHA 4GGQA 2KYWA 1ZE3D 5IP4D 3SR6A 3E9SA 4PYUA 5E6OA 4M8MA 5EE3A 1SE9A 4AJWA 1OQRA 4PS8A 4ZOHC 2KK8A 2PLPA 4JLCA 2MEKA 3NG0A 3Q8FA 3HHMA 2AQ2B 4MSMB 4KGSA 2WHIA 3I63C 5HKHA 2BVCA 3NVWA 3Q2AC 1XQQA 3MC9A 4DHZE 2KZRA 1EF5A 1XCQL 1MG8A 4MEMA 3NVVA 1N5XA 4FBJB 3Q8EA 2BBCA 3L0WB 2L05A 2KQSA 2LMCA 3AEDB 1R4MB 3AEBB 2D3BA 4HROA 3V05A 3GS2A 4HLEA 3RULA 4MM3B 2EKEC 2GB1A 4KIKB 5EDSA 2V3PA 4OVUA 2OHFA 2FUHB 1SE3A 1YX6B 3GOEA 2K3UA 3Q3JA 4QAYA 2AX5A 2MBHA 3P4SB 5TR5A 1YN5A 4WJOA 3ZYYX 1SE2A 2KFKA 3R2TA 3HRDD 1OEYJ 1FXAA 3TL5A 4G0NB 4HPMB 1XD3B 3LXFA 3CSFA 2RD0A 1E8WA 1ACCA 1V2YA 4GU2A 5H92C 3ZXRA 4LK0M 2KWCA 4BKGA 3LJ3A 5AEKB 3VTWA 1QQRA 4EZJA 2K1FA 3DCGA 4XDDA 2PTLA 5FKAC 1FFUA 3I9V1 3AU5A 4ZRJA 3WANA 1TGZB 2KDMA 3VHTC 1PQSA 3DDCB 2DLBA 4NAWB 3AI5A 1TS3A 3ABVB 2KMMA 2IO1B 4ZYSA 5MPOA 1KLVA 1MG4A 4K7WA 4GIVA 3PPAA 2FBWB 2NR2A 3QJZA 1C9FA 1WJNA 2M8SA 1FNVA 3AH7A 1PGAA 2ZVOA 4EUTA 4MELA 4DDGD 4RGTA 2WDVB 4XGAB 2ZVNA 3ZQ4A 2V1YA 4NZLB 3M95A 1OGWA 4FA6A 1AW7A 1I4RA 3NUHB 3V6CB 2RR9A 1TYGB 4NQKE 2KVZA 4W9EA 2LFIA 1C78A 2VRRB 4NQLB 4FULA 5DPTA 4EKUA 4B0EA 2DAJA 4WJPA 4KV2A 3U30A 1WGRA 2DX5B 2VH2A 5DPRA 1TKYA 2PEAA 3PSEB 2V0GA 2D5GA 3ALBA 1E6EB 4GLSC 1TZ1A 1G6JA 2ASQA 1K8RB 3ZTCA 3EFUA 2K6DB 1RLFA 4BFRA 1YX5B 2MX2A 1FMAD 4US8A 4KDIC 5AZHA 2KC1A 2MA9B 4PS3A 1I4GA 2IY0B 3FILA 3UQBA 3L4PA 3AEEB 4TQ0A 1AYFA 4GN1A 3ZKJC 3APFA 2XBBC 3MC8A 2FIFA 4ICUA 1SXTA 1FRRA 2X38A 1F52A 3GP7A 1ZUD2 2IGHA 3N32A 2FE8A 2QC8A 3DVNV 2BTEA 3ETRA 3GE3C 3ZRCA 4NAWA 2WGSA 3W1YA 2MJEA 2L0TA 2C7HA 1JW9D 2R2QA 1ZKHA 4B9KA 4C4VA 2ZW0A 3NY5A 4RFBA 2INPE 3PRPB 1WRDB 3N30A 1N60A 1DOXA 2MW5A 3Q14C 3ZJTA 4YXDB 1R4NI 1V80A 4K3CA 2JRIB 1XT9B 1WXSA 2KO3A 2N7JA 3APCA 5E6PA 2ZPYA 1HE8A 1T6BX 1MFWA 2UYZB 2Z8LA 4M02A 1TY2A 4DDID 4XDCA 2ZEQA 3KUDB 3AULA 3L16A 4M0WB 1I4QA 2LVQA 3ZNZB 2LXCA 5GXGB 5KHOA 3LYYA 3L17A 4BKTA 1YN3A 5BMHA 1J7BA 4MH8A 3TEYA 2JSVX 4WWMA 4A20A 2FCNA 2DNFA 4I6LB 1HTOA 4B6WA 2KX3A 1SSNA 2L3ZA 2GBMA 2G9HD 1LFDA 1UBQA 1JRUA 3IG3A 3AU4A 3A1QB 4JL9A 4A3OA 1WH3A 2IZVB 3EECA 4LTUA 3PT2B 2KTRA 3PHWB 4BAXA 3PRZA 4FJVB 1D3ZA 4REZA 2N0SB 4FN2A 1TS4A 4WH4A 3RUIB 2FIDA 4GDLB 4K1RB 5C23A 1N5WA 1VDVA 4KSKC 4L1BA 5FK9C 4DK5A 2CHXA 4LCDE 4LDTB 4GB9A 3AEFB 3RNEC 1I4HA 2Y5CA 4JWSC 1UGJA 1WMHA 3AEGB 5HHDG 4OVVA 2WXPA 3Q8AA 1QLBB 2LZ6A 4ACFA 2E3TA 3NVZA 3RNBC 1J19A 1T0YA 3KUZA 4WAAA 2KDFB 1WX7A 2MP2B 3BIID 4N59A 2BKRB 1RWSA 3C8YA 4HVBA 2CJNA 2MBOA 4FHJA 1YJJA 2AQ1B 2IGDA 5LNK1 4LDTD 2BS2B 1FRDA 3TEZA 4NJCA 3APDA 4KVGB 1E90A 3A1QA 1QKZA 4JQWC 4A90A 5J2RA 4ZHPA 2LXAA 1GC6A 4MSQB 2CJOA 2JWZA 3QARA 1GOZA 2W3SA 4C56C 5DPSA 1ZDXA 3IXSA 4LNFA 4W9LA 3RZFA 2LI5A 1T5XD 1C79A 3I3TB 1RFAA 1Q0WB 4HWIB 1UH6A 3KWLA 3RYTA 4DBGA 4WIPA 1SEBD 2LASA 2SEBD 1KLUD 2CS4A 4AUQC 2ACZB 4NJ7A 3HVDA 4AP4C 2K0PA 4HJKA 3TEWA 3RT3B 1FCCC 2M17A 2BQQA 3QA8A 4GDKA 2Y3AA 3AE8B 3BWUD 4HDQA 2WXQA 2WLBA 3OWEB 3L08A 4AOFA 1XLQA 2KVRA 3BY4B 1E0ZA 2V4LA 4J3OD 5CHWA 5E6NA 2RDBC 2GMIC 2QMTA 4Q2JA 4ASWC 3KVFB 4A55A 1XLNA 5D6JB 5BMIA 1B1ZA 3NVYA 1C4AA 4XWWA 2D3AA 3W1SA 2MLBA 3DOWA 4MGYE 1V6EA 3FKYA 2O6VA 1LQBA 1IUEA 2I2YA 5G2NA 2NPTB 2LD9A 3H7PA 4HJGE 3IBEA 1J0GA 4LJPB 1V5OA 4X57B 1ZPSA 3PLVA 1JWMD 1YOVB 1QT9A 1NVID 2KJHB 4JPSA 2JT4B 1SF0A 2WXMA 1ENFA 5G5HA 1LXDA 4P7IA 1OEYA 4KKJA 2IY1B 2VH1A 2REXA 1WX9A 2K8HA 2JWUA 2WU5B 2VZKD 2WXIA 2GBJA 3BYTB 4CQNA 2K9XA 4IM0A 3BVGA 3OJ4B 2I1JA 1WMHB 1N62A 2DZKA 4NAMA 2W9NA 2WU2B 5D3DA 1C1YB 1EU4A 1YJIA 2JX5A 2QSDA 3ZRFA 1TBEA 1T0QC 1JQ4A 2FUG1 2N7DA 1GG3A 4E74A 4E71A 2J4XA 2LEKA 4RM9A 1GNUA 3CWIA 3RFZB 2KDIA 2VZKB 2UWQA 3T3OA 3OJ3A 4GSWA 2KDEB 4W9CA 3MHZA 1WX8A 1QILA 1F0ZA 2FCQA 1TJEA 4WJNA 4YWGG 1V86A 3B1LX 4NPNA 1E7UA 4MH0E 2L32A 2O2VB 1R7SA 2Y5PA 3B9JA 1NDDA 2JYEA 3U8ZA 2FCMA 4MGZE 3ZUNA 3ZJUA 1L2NA 1E8ZA 1QOGA 2INNE 3IT4B 1V8CA 4KZCA 3K9OB 1WE7A 4YTMB 1YQ3B 4JE3B 3KYCD 2KWVB 2M56B 2C9WB 4URKA 1KLGD 1JALA 3WA0A 4YSZB 1Q5WB 2NTTA 2HTME 1ZDVA 3KQ4A 4DXAB 5T8IA 4IW0A 4NY0A 4K7SA 3RD2A 1IP9A 1WZ3A 2LGDA 3BK1A 1GC7A 1T0RC 3U2SC 1E7VA 1H4RA 3V60A 2KJRA 2DYBA 1E10A 3QX1A 2WP9B 3NS8A 2LHDA 1ESFA 1SE4A 2ZCBA 2DAFA 4RGNA 3PRMB 2B3AA 1MJDA 4FLHA 4N58A 2KJ6A 3JSVB 4XC2A 2WQYB 4JWUC 2JQRB 5EE0A 2DBYA 3ZNGC 4JGHB 5CHFA 1SB3C 2JYTA 3HVZA 3EC8A 2N9LA 1WRIA 3N3KB 4HPPA 1JWSD 1L0XB 1UWXA 2Z59B 2K8CA 5D7GA 2A4ZA 5BYRA 5AZFA 1WFYA 3HIZA 4ICVA 4G50A 1P3QU 3MFGA 1YIWA 3ZTDA 3U7DA 1PGXA 1WWTA 2R61A 2LRWA 3ZVVA 3UQAA 4HXDA 2LGXA 1E8XA 4ARIA 1FD6A 3EFCA 4TSSA 2GI9A 1YJ1A 1X1MA 1L0YB 2NCNA 2RSUA 2J0KA 1QOBA 2N1WA 2ZPNA 2NBWB 2R2OA 4HEA1 2JXTA 3KYDD 2O6VD 3GB1A 3VH4B 1MI0A 5E6JA 4C7YA 2QHOA 2MH7A 1BXTA 2A5UA 5AUIA 2OJWA 1K52A 3D32A 3L10B 1I4XA 2N7EA 4KKIA 4K81A 3K9PB 4OZCA 5TSSA 4IWQA 3IAM1 5L95C 4NNJB 1EM7A 1GJZA 5LXIB 2CR5A 1WY8A 2MHJA 4OVZA 3A4SC 2DZJA 4E3CA 2JF5A 3KLSX 1C4PA 3PHXB 2MBEA 2O6VB 1M4VA 3ECIA 1WXVA 2IO2B 2WNMA 4K7UA 4PT5A 2WXOA 2L1AA 3UI3A 2BYTA 2ZJDA 4MJSB 4BZAA 3VR8B 3P2BA 1WJ4A 2PPHA 4ZRQA 4W9KA 1CK1A 1C76A 5JXVA 3Q69A 1WF9A 3VRBB 2GRIA 2PE6B 3SHQA 1TS5A 2PW9A 4I6NB 3NJTA 2OOBB 4IUMB 1WZ0A 5L83A 3AE4B 4K3BA
chains in the Genus database with same CATH topology
1XCTL 2QJLA 3MJ5A 2IPKD 1TS4A 1B9RA 1GAQB 4WH4A 1MHXA 2KWDA 4GDLB 1L5PA 1QF6A 3DWMA 4ARCA 5FR3A 3SEBA 2XN9C 5H8YE 2AQ3B 2ON8A 4KGRA 1N5WA 1VDVA 4L1BA 5FK9C 2BS4B 3ZGZA 1JWBD 1UUPA 2N9KA 1XLOA 3B2FA 4RF1A 3AEFB 2L52A 2K5PA 2Q5WD 1JCKB 2BB6A 5EE9A 1I4HA 2DYOA 2QIEB 2Y5CA 1UGJA 3N9YC 4JWSC 4YTPB 1ZOYB 5D3IB 1VJKA 3AEGB 5HHDG 3AE3B 4DXFA 1K51A 2WXPA 2YEPB 1QLBB 1D5XC 2J52A 3Q8AA 1JRPA 1HEZE 2E3TA 3KWVA 4A6QA 3NVZA 3IT6B 1C77A 4RGMA 3CIRB 1ZP0B 3BIID 4N59A 1RM6C 1Y56A 1XXGA 2B76B 2WXNA 2V4IB 3Q8BA 1RWSA 2RDHA 3C8YA 3P4QB 2CJNA 4WURA 4C80A 1JWAD 2H88B 1XF5L 1CQVA 1FNUA 1YJJA 3U52E 2AQ1B 4A9AA 1MHHE 2IGDA 5LNK1 4OW0A 5C2TB 3TSSA 3AN1A 2W55A 5C3JB 3ZJVA 1DOYA 1E7PB 1J7CA 2BS2B 3P63A 1FRDA 3TEZA 5EE1A 4NJCA 3EGRA 4RGOS 1BUIC 3P4RB 1OFFA 1QKZA 1FIQA 1FFVA 1P7FA 2G1EA 2JZPA 5I4DA 2W54A 1HZ5A 3TEXA 4A90A 1CJEA 1TKEA 5HFYA 3LB8C 4ZHPA 2L83A 2NMQA 3AB5A 1SIJA 2CJOA 4UDUC 4AS1A 3FC4A 1FNWA 4YT0B 1GOZA 2W3SA 1C4CA 3URYA 4C56C 1ZDXA 3IXSA 1RYJA 2SAKA 4DXGA 1T5XD 1C79A 1D6EC 1KTKA 2WDRB 3SFEB 2MJDA 3U4EG 1ZXHA 3NZ3A 4IOIE 1WSPA 3KWLA 1ZE3D 2MJ3A 3I57A 3SR6A 3RPFC 4WIPA 1SEBD 3E9SA 5EE3A 1ET9A 4ZRPA 1F2RI 1YN4A 1OQRA 2SEBD 4KGTA 1KLUD 4M0WA 1XLPA 1IGDA 2ACZB 2ICIA 4ZOHC 3HVDA 3VQIA 2K0PA 3EUB2 3TEWA 1FCLA 1DYQA 4YSYB 1FCCC 2PLPA 3MP9A 5HI1A 2WXJA 2MEKA 4YSXB 2I38A 2Y3AA 3AE8B 3BWUD 3Q8FA 2WXQA 2AQ2B 4KGSA 2WLBA 4P6VF 3OWEB 1EWCA 1JWUD 2YEPF 1SBBB 3MC0B 1V97A 1XLQA 2QILA 3NVWA 4H2AA 1E0ZA 4J3OD 2LJIA 3AE7B 5AUKA 2M0AA 2QMTA 4Q2JA 1XCQL 4ITKA 1LO5D 3NVVA 4RNAA 2H89B 1N5XA 4A55A 3R8BA 1XLNA 1IGCA 3Q8EA 5BMIA 1B1ZA 2BBCA 3NVYA 1KH0A 1C4AA 2LMCA 3AEDB 4ZHOA 1ET6A 2WXHA 3W1SA 4XWWA 1D5MC 1RFKA 3FAHA 3AEBB 3V05A 4HROA 1SJHD 3GS2A 4YTNB 1NI3A 2BS3B 2PIAA 4MM3B 1L6VA 1GPXA 2GB1A 1IUEA 3PZ8A 4WAFA 3AM9A 2I2YA 1DOIA 1NENB 2V3PA 1L6UA 4HJGE 2OHFA 1SE3A 2KN4A 1ZPSA 1STEA 2K3UA 2IGGA 1JWMD 1QT9A 1NVID 3AE6B 2NTSA 1VRAB 1KRHA 3EA6A 2AX5A 3P4SB 4JPSA 1JROA 1SF0A 2WXFA 3U7ZA 1YN5A 3FILB 1Q10A 2WXMA 1ENFA 2DYMA 3P4PB 5G5HA 3ZYYX 1SE2A 2EKIA 4IKGA 3R2TA 4D2KA 4KKJA 3HRDD 1FXAA 1GB4A 2ZW1A 1V1PB 1NEKB 2W82A 3LXFA 3SFDB 2BW2A 1ACCA 1WGKA 4L2YA 2JWUA 1P7EA 2WU5B 2VZKD 2BB5A 4C7ZA 2WXIA 1F77A 3BYTB 4CQNA 2K9XA 3BVGA 5H92C 2E6XA 1HXYD 4LK0M 3W5UB 1KF6B 4JX1C 3AEAB 1N62A 1PYWD 2WDQB 4NAMA 1QQRA 1WXQA 2WU2B 5D3DA 2RDGA 1EU4A 1YJIA 4XDDA 2JX5A 2PTLA 2QSDA 5FKAC 4US9A 1FFUA 1JQ4A 3I9V1 2IJ0A 2KDMA 2FUG1 4HKQA 2DLBA 1QOFA 4NAWB 2CU3A 2LEKA 2J4XA 3VR9B 1TS3A 2KQ4X 3ABVB 2DWQA 2KMMA 4ZYSA 5MPOA 3T3NA 1CZPA 4RF0A 1SJED 3CWIA 3RFZB 2VZKB 4O1NA 2WXGA 2XNAC 1KFYB 3T3OA 3NS1A 1J7AA 2KACA 1L0VB 1IBXA 3MHZA 2FBWB 1QILA 1C9FA 4HRSA 1F0ZA 1FNVA 3AH7A 1VZ7A 1PGAA 4IDIA 3AV8A 4DQOC 1TJEA 4RGTA 4YWGG 5G5GA 2WDVB 4N6EB 3J9CA 3W2DA 3AE5B 2L32A 3ZQ4A 1R7SA 2Y5PA 3B9JA 4NZLB 1YMHE 2JYEA 1AW7A 2WXKA 3AE9B 2J53A 2PVOD 1I4RA 3NUHB 1NYRA 1V1OA 4RCOA 1TYGB 2LFIA 3HUIA 3ZJUA 1QOGA 1C78A 1FM0D 4R3DA 3PZ7A 1L4DB 1QOAA 2INNE 2EELA 3IT4B 1V8CA 4OHJA 4B0EA 4YTMB 1YNTE 1YQ3B 4JE3B 2ONQA 1E9MA 2M56B 3BVMA 1TY0A 3AE2B 1ROEA 1KLGD 1D4BA 1F2RC 1JALA 3P42A 4YSZB 2NTTA 1TKYA 2HTME 1D5ZC 1ZDVA 1EWYC 2RMMA 2V0GA 3KQ4A 2D5GA 4GLSC 1E6EB 5T8IA 5BYQA 1WYGA 3AMZA 3BK1A 1FEHA 3U2SC 2K22A 1PUTA 3DWGC 4HKZE 1FMAD 4US8A 1E10A 1A70A 1VZ8A 1HZ6A 2LUMA 1PDXA 2LHDA 2TSSA 1TZOA 1JMLA 1YQ4B 2WP9B 1I4GA 1MVKA 1V1PA 2OEDA 3FILA 3L4PA 2W3RA 3VRAB 3AEEB 4TQ0A 1ESFA 1NYQA 1SE4A 3WCQA 1AYFA 1XEEA 4RGNA 4FXCA 3P1MA 4N58A 2WQYB 1TKGA 4JWUC 2JQRB 1SXTA 5EE0A 1FRRA 1PGBA 2RPVA 2X38A 2DBYA 1K53A 1N61A 3GP7A 1SB3C 1ZUD2 2JYTA 3HVZA 1FO4A 3BVZA 2N9LA 2IGHA 2QEJC 1WRIA 4OZAA 4AQ7A 2FE8A 5HG2A 1JWSD 1L0XB 1UWXA 3BYYB 4MT5A 2BTEA 5D7GA 1PFDA 2JU6X 2LHEA 2BT6A 1HA5A 2PVGC 5BYRA 3IAS1 1DGJA 1T3QA 3ETRA 1OQQA 2PKOA 3TUOA 1HQRD 2MJEA 1AWDA 3O13A 1K50A 1JW9D 3MFGA 4TMAB 4RH6A 1MPEA 2J42A 2ZW0A 1BMLC 1VR9A 4RFBA 3R2IA 2INPE 1PGXA 1WWTA 2R61A 2M19A 4ARIA 1FD6A 4TSSA 3BZDB 2GI9A 1XO3A 1N60A 1L0YB 1DOXA 2WS3B 4XE0A 1QOBA 1N63A 4MACA 3ZJTA 4YXDB 3AE1B 4HEA1 3NRZA 3B2GA 2PMVA 2WXLA 1TS2A 4B0MA 2N7JA 2JXTA 1EU3A 1T6BX 3GB1A 1MI0A 5E6JA 2Z8LA 1TY2A 4C7YA 2MH7A 4GDKB 1BXTA 4XDCA 5AUIA 3BK2A 1ZXIA 1AN8A 4KX6B 1K52A 1UWMA 1FXIA 1I4QA 1I4XA 5BYSA 4KKIA 4OZBA 4OZCA 3AECB 5TSSA 5GXGB 1I7HA 3LYYA 3IAM1 4USAA 2LGIA 1YN3A 1EM7A 5BMHA 1J7BA 4MH8A 3TEYA 4L23A 3W5VB 2JSVX 3PO0A 4WWMA 4EE2A 5BMGA 4OVZA 2WXRA 2KAJA 1I4PA 4XWTA 3KLSX 1C4PA 1SSNA 1M4VA 2IDYA 2G9HD 2WNMA 4A8XC 3H8HA 4PT5A 2WXOA 2L1AA 3UI3A 2BYTA 2HDEA 3VR8B 1L4ZB 1VZ6A 4ZRQA 1GB1A 1VLBA 1CK1A 1C76A 1UNSA 3V3XA 5JXVA 3Q69A 3VRBB 2GRIA 1IBXB 4LTUA 3E56A 1TS5A 2PW9A 4LLGM 3Q8CA 3W9CB 4WQMA 4TQ1A 3AE4B 2V3NA 4P16A 4REZA 2N0SB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P6V F;  2WLB A;  2QJL A;  3NS1 A;  1J7A A;  1B9R A;  1GAQ B;  1L0V B;  1QF6 A;  2FBW B;  1L5P A;  1V97 A;  3DWM A;  1PFD A;  1XLQ A;  3NVW A;  5H8Y E;  2BT6 A;  2PVG C;  4HRS A;  1N5W A;  1DGJ A;  1T3Q A;  1VDV A;  3ETR A;  2BS4 B;  1E0Z A;  1F0Z A;  1OQQ A;  1JWB D;  2PKO A;  3AE7 B;  3AH7 A;  5AUK A;  1XLO A;  2MJE A;  3B2F A;  1AWD A;  4IDI A;  3AEF B;  4ITK A;  3AV8 A;  2L52 A;  1TJE A;  1JW9 D;  2K5P A;  5G5G A;  3NVV A;  2WDV B;  2H89 B;  1N5X A;  2Q5W D;  4N6E B;  5EE9 A;  3AE5 B;  2QIE B;  1XLN A;  2Y5C A;  4JWS C;  4YTP B;  1ZOY B;  1R7S A;  1WWT A;  1VJK A;  3AEG B;  3B9J A;  3NVY A;  3AE3 B;  4ZHO A;  2M19 A;  3AED B;  3AE9 B;  1QLB B;  1RFK A;  2PVO D;  3FAH A;  1NYR A;  1JRP A;  2E3T A;  3AEB B;  4HRO A;  3NVZ A;  1TYG B;  4YTN B;  1XO3 A;  1NI3 A;  2BS3 B;  2PIA A;  1N60 A;  3CIR B;  3HUI A;  1L6V A;  1DOX A;  1GPX A;  1ZP0 B;  2WS3 B;  1IUE A;  3BII D;  4N59 A;  1QOB A;  1N63 A;  1RM6 C;  3AM9 A;  4YXD B;  2B76 B;  1DOI A;  3AE1 B;  1NEN B;  1QOG A;  1FM0 D;  1RWS A;  3NRZ A;  1L6U A;  3P4Q B;  2CJN A;  3B2G A;  1QOA A;  4C80 A;  1JWA D;  2OHF A;  2H88 B;  1V8C A;  1YJJ A;  4A9A A;  4YTM B;  1YQ3 B;  5C2T B;  3AN1 A;  2W55 A;  5C3J B;  1QT9 A;  1WRI A;  1NVI D;  1E7P B;  1J7C A;  3AE6 B;  1E9M A;  2BS2 B;  3P63 A;  1DOY A;  1FRD A;  2M56 B;  4C7Y A;  2MH7 A;  1KRH A;  5EE1 A;  2AX5 A;  3AE2 B;  3P4S B;  5AUI A;  1ZXI A;  1ROE A;  4KX6 B;  1SF0 A;  1JRO A;  3P4R B;  1JAL A;  1OFF A;  1FXI A;  1UWM A;  4YSZ B;  1FIQ A;  1FFV A;  2G1E A;  1TKY A;  2W54 A;  3P4P B;  5G5H A;  1CJE A;  2HTM E;  3ZYY X;  1TKE A;  2EKI A;  3AEC B;  3LB8 C;  1EWY C;  3HRD D;  5GXG B;  1FXA A;  1I7H A;  4ZHP A;  2L83 A;  4USA A;  1E6E B;  3AB5 A;  1NEK B;  1SIJ A;  2CJO A;  3LXF A;  1J7B A;  1WYG A;  3FC4 A;  4YT0 B;  3SFD B;  1WGK A;  2W3S A;  3W5V B;  3AMZ A;  3PO0 A;  4WWM A;  2WU5 B;  2K22 A;  4C7Z A;  1RYJ A;  1PUT A;  2KAJ A;  3DWG C;  2K9X A;  5H92 C;  1FMA D;  3W5U B;  1KF6 B;  4US8 A;  4JX1 C;  1E10 A;  1A70 A;  3AEA B;  1N62 A;  2WDR B;  1PDX A;  2WP9 B;  2MJD A;  1YQ4 B;  2WDQ B;  3SFE B;  2WU2 B;  1WXQ A;  3L4P A;  3KWL A;  2W3R A;  1YJI A;  3AEE B;  3VR8 B;  3VRA B;  1NYQ A;  2JX5 A;  2MJ3 A;  1AYF A;  3WCQ A;  3SR6 A;  3RPF C;  4FXC A;  4US9 A;  5EE3 A;  1FFU A;  3P1M A;  1VLB A;  1JQ4 A;  4N58 A;  1OQR A;  2WQY B;  1TKG A;  4JWU C;  2JQR B;  3VRB B;  5EE0 A;  1XLP A;  1FRR A;  2ACZ B;  4ZOH C;  4LTU A;  1QOF A;  2DBY A;  3VR9 B;  2CU3 A;  2LEK A;  1N61 A;  3EUB 2;  3ABV B;  4YSY B;  2DWQ A;  2KMM A;  1SB3 C;  1ZUD 2;  3W9C B;  3HVZ A;  4YSX B;  4WQM A;  5MPO A;  1CZP A;  1FO4 A;  3AE8 B;  3CWI A;  3AE4 B;  1KFY B;  2N0S B; 
#chains in the Genus database with same CATH topology
 4G3X B;  2QJL A;  2IPK D;  2BWE S;  2MBQ A;  1MHX A;  3H7S A;  1QF6 A;  5IKC M;  3DWM A;  4XZ4 A;  2LWP A;  5BO4 B;  2BKF A;  2BS4 B;  1JWB D;  1UUP A;  1XLO A;  3B2F A;  4A3P A;  3A9J B;  2DEN B;  1OQY A;  2WYQ A;  2K5P A;  2Q5W D;  1JCK B;  5EE9 A;  2KTF A;  3WAL A;  1ZOY B;  2V3S A;  2CHZ A;  4ANU A;  3MTN B;  3A9K A;  1HEZ E;  2KN5 A;  3Q3M C;  3QAQ A;  3IT6 B;  3CIR B;  4S0R A;  3VUX A;  2GOW A;  2INC C;  1ZP0 B;  2G3Q B;  4LNN A;  1Q1O A;  2WXN A;  3DVG X;  4AWJ A;  4ZRI A;  1E8Y A;  1RAX A;  2GBK A;  2WX1 A;  5C3J B;  2XK5 B;  1DOY A;  4ZRK A;  3PTF C;  3VXW A;  3RMK C;  3EGR A;  1BUI C;  3Q3O C;  2V9H A;  3UF8 A;  2W54 A;  1HZ5 A;  1ZGU B;  1KM7 A;  3TEX A;  4BOS C;  1TKE A;  3SU8 X;  2NMQ A;  4DHJ D;  4MJS A;  3M62 B;  4XX5 A;  4CHK A;  4AS1 A;  2C60 A;  3C0R B;  3H6N A;  2KLC A;  2SAK A;  3WAO A;  1GUA B;  4ANX A;  2MP2 A;  4I6P A;  1D6E C;  1KTK A;  4IM3 A;  4IOI E;  1WSP A;  5CX3 A;  1UZX B;  2MJ3 A;  3I57 A;  3KH0 A;  3RPF C;  1UGM A;  1F2R I;  4BBN C;  4BVU C;  2N1V A;  1S3S G;  1XLP A;  2ICI A;  3EUB 2;  1FCL A;  1DYQ A;  4YSY B;  5HI1 A;  2WXJ A;  4YSX B;  1WYW B;  2KTR B;  2D10 A;  3QCA A;  2LGY A;  2IND C;  4P6V F;  1EWC A;  2AYO B;  5JH5 C;  2QIL A;  4IG7 B;  2LJI A;  2K8B A;  3AE7 B;  2GBN A;  3NZS A;  2DZI A;  2H89 B;  3R8B A;  1IGC A;  4KDL B;  2WDT B;  3NHE B;  1KH0 A;  3N1Z C;  4ZHO A;  2KD0 A;  1RFK A;  3DQV A;  3FAH A;  3T8M A;  3ZXV A;  3CF6 E;  4YTN B;  1NI3 A;  2BS3 B;  2PIA A;  1WIA A;  4GDL A;  1L6V A;  1GPX A;  5JHA A;  3PZ8 A;  4M01 A;  2KT7 A;  3AM9 A;  1C3T A;  1DOI A;  1NEN B;  3PV1 A;  2JUO A;  3ZNH B;  1CMX B;  2K39 A;  2KN4 A;  1WJU A;  4S17 A;  3AE6 B;  3RNF C;  4DWF A;  1WJ6 A;  1TT5 B;  3EA6 A;  2WXF A;  3VUY A;  1Q10 A;  3VTU A;  1P9D U;  1WGG A;  2AL3 A;  4LNK A;  4G11 A;  2ZW1 A;  5LXH A;  1ZW7 A;  3L54 A;  1TIF A;  2LGS A;  2KFJ A;  3QQ8 B;  3Q3F A;  5IOI A;  3W5U B;  1KF6 B;  1J8C A;  3AEA B;  3TJP A;  2K25 A;  1R4N B;  2WDQ B;  3DPD A;  5CTR C;  2M0X A;  3A9J A;  4GMV A;  4GOC A;  4W9I A;  4BBN F;  4J6I A;  3RN9 C;  4YL8 A;  5D2M B;  4IC7 B;  1M94 A;  2IJ0 A;  1FPY A;  3DHH C;  3VR9 B;  2CU3 A;  2MBB B;  2DWQ A;  1CZP A;  4RF0 A;  1SJE D;  3QK0 A;  3RNA C;  3UIO B;  4O1N A;  2WXG A;  2IO3 B;  1KFY B;  2XNA C;  3NS1 A;  1R4M I;  2KAC A;  1L0V B;  1IBX A;  2G4S A;  3CST A;  2J0J A;  3RNC C;  1VZ7 A;  4WWN A;  4IDI A;  2JXX A;  2JPH A;  3AV8 A;  2N4F A;  3NOB A;  5G5G A;  4N6E B;  3J9C A;  3W2D A;  3AE5 B;  1F9J A;  3H9D A;  1YMH E;  2RGF A;  2WXK A;  2O2V A;  4IWO A;  1NYR A;  4RCO A;  2C7N B;  4EZL A;  3HUI A;  2LVP A;  3OG5 A;  4R3D A;  1UF0 A;  1L4D B;  2IBI B;  3JW0 X;  2L76 A;  1AAR A;  2CU1 A;  2ONQ A;  4P1C C;  3DBL B;  3BVM A;  1NI2 A;  1TY0 A;  3AE2 B;  4HCP B;  1IYF A;  1ROE A;  1D4B A;  4PYZ A;  2C5L C;  1F2R C;  2QCZ A;  3P42 A;  1V81 A;  3GZN B;  2N9P C;  1EWY C;  2ZNV C;  5BYQ A;  1WYG A;  4ZDV A;  2BPS A;  3ONS A;  1PUT A;  3RI7 C;  2CKH B;  1WXA A;  4ANV A;  1LM8 B;  3TIX A;  1VZ8 A;  2LUM A;  1PDX A;  1TZO A;  1JML A;  1YQ4 B;  2HJ1 A;  1MVK A;  1V1P A;  3WIM A;  2W3R A;  3VRA B;  1NYQ A;  3PGE A;  3WCQ A;  1XEE A;  5JZE B;  4FXC A;  1WR1 A;  1TKG A;  2ZNV B;  1PGB A;  3ZLZ A;  1N61 A;  4WQO B;  3BVZ A;  3X23 A;  2QEJ C;  3X0W A;  2EMS A;  3SD5 A;  4AQ7 A;  3R7R A;  5HG2 A;  4LNI A;  2JU6 X;  2LHE A;  1HA5 A;  2PVG C;  2BYF A;  3IAS 1;  2NPT A;  1HQR D;  1Z5S B;  1AWD A;  3PS6 A;  1K50 A;  3PRE A;  3VFK A;  1YQB A;  2DHZ A;  4TMA B;  1MPE A;  1BML C;  3R2I A;  4EZK A;  2M19 A;  4ANW A;  2BYV E;  3DBH B;  4FAD A;  3BZD B;  1XO3 A;  4HCN B;  2WS3 B;  4XE0 A;  5JHB A;  3QHT A;  1N63 A;  4MAC A;  3BIN A;  1A5R A;  2MQJ A;  1WGH A;  2PMV A;  2WXL A;  1TS2 A;  1T0S C;  4EEW A;  1EU3 A;  4FHK A;  5KHQ A;  1I42 A;  3DBH I;  4GDK B;  1WGD A;  3BK2 A;  1FXI A;  3WAM A;  4B95 A;  5IN7 A;  3OLM D;  3AEC B;  1I7H A;  2IO0 B;  4USA A;  2LGI A;  3NZU A;  2N9E B;  2HJ8 A;  5GMV A;  4EE2 A;  2KAJ A;  2G4D B;  2OJR A;  3TBL D;  3VTV A;  2KX0 A;  4EFO A;  4A8X C;  3H8H A;  4W9H A;  1BT0 A;  3PLU A;  1L4Z B;  1RRB A;  2LRU A;  1GB1 A;  1VLB A;  3V3X A;  2L8J A;  3HM3 A;  4IM2 A;  3VUW A;  4DHJ B;  3KW5 B;  4DHZ B;  3E56 A;  1I35 A;  3Q8C A;  3W9C B;  4WQM A;  2ZCC A;  4OZB A;  2V3N A;  3VH3 B;  2KWD A;  1L5P A;  4ARC A;  4TKN A;  5D94 A;  5H8Y E;  4KGR A;  3ZGZ A;  2KDB A;  2MWS B;  2UU7 A;  4KZ0 A;  2L52 A;  4WWP A;  2BB6 A;  2DYO A;  4M8N A;  1E5W A;  2Z0D B;  4DXF A;  4AJY B;  1JRP A;  2GBR A;  2AEH A;  4A6Q A;  2KLG A;  3DVG Y;  3GE8 C;  3DBL I;  3A33 B;  2KWU B;  1XXG A;  2B76 B;  2V4I B;  3Q8B A;  4HPL B;  2RDH A;  3CMM B;  4HDO A;  3N1X C;  3P4Q B;  2NBU A;  4C80 A;  5LLI A;  1XF5 L;  5IAA C;  4OW0 A;  5C2T B;  3TSS A;  4F1S A;  3ZJV A;  2JVC A;  1E7P B;  3P63 A;  4MGK E;  2KXJ A;  3HM6 X;  4RGO S;  4II2 B;  1FIQ A;  1FFV A;  1P7F A;  2G1E A;  3R3M A;  5I4D A;  1CJE A;  5HFY A;  3LB8 C;  2L83 A;  4F7Z A;  3FC4 A;  1HTQ A;  1C4C A;  3URY A;  1F1H A;  4CYE A;  1VD2 A;  3ML8 A;  1UBI A;  2GLS A;  2KC2 A;  2WDR B;  3QC8 B;  2MJD A;  3AXC A;  3NZ3 A;  5C1Z A;  1ET9 A;  2C7M B;  4ZRP A;  1YN4 A;  4KGT A;  2BWF A;  2KKC A;  2N9X A;  4M0W A;  1IGD A;  4C00 A;  2WWZ A;  3VQI A;  3S2A A;  3MP9 A;  2I38 A;  4F8C B;  3MHS D;  3H1U A;  1JWU D;  4BOZ B;  2YEP F;  1SBB B;  3MC0 B;  3DBS A;  1V97 A;  1EO6 A;  4H2A A;  5AUK A;  3ZDM C;  4PK1 A;  2D2Q A;  2KMC A;  2M0A A;  3B08 A;  4ITK A;  2M4N A;  4C4V B;  1LO5 D;  4RNA A;  4FJY A;  2HD5 B;  1ET6 A;  2WXH A;  1D5M C;  1SJH D;  1V5T A;  3ENE A;  5DCN A;  2FCS A;  1H8C A;  4WAF A;  2DZM A;  2NS5 A;  2WX0 A;  1L6U A;  3DHG C;  5IO9 A;  1STE A;  2IGG A;  1KOT A;  1WM3 A;  2NTS A;  1VRA B;  1KRH A;  1JRO A;  3U7Z A;  3FIL B;  2J0M A;  2LJ5 A;  3P4P B;  2DYM A;  3UIN B;  2EKI A;  4IKG A;  1WI0 A;  4D2K A;  1V49 A;  1GB4 A;  1V1P B;  1NEK B;  2W82 A;  3SFD B;  2BW2 A;  1WGK A;  3IHP C;  4L2Y A;  1P0R A;  1P7E A;  3ZDT A;  2BB5 A;  4C7Z A;  2L7R A;  1F77 A;  4M00 A;  1Z2M A;  2E6X A;  1HXY D;  1SIF A;  4JX1 C;  4W9G A;  3HK0 A;  1PYW D;  4RMA A;  1WXQ A;  2RDG A;  2PE9 A;  4US9 A;  4HKQ A;  1QOF A;  3I5J C;  2KQ4 X;  3T3N A;  2LUE A;  4MGI E;  1J7A A;  3LDZ E;  2FAZ A;  5J18 A;  3V61 A;  1EUV B;  5G55 A;  3H7P B;  4HRS A;  4NJ6 A;  3N20 C;  4JIO U;  4DQO C;  1QZE A;  3QIJ A;  3VDZ A;  3JVZ X;  2HE7 A;  1Y8R C;  3AE9 B;  2J53 A;  2PVO D;  1V1O A;  1TTN A;  2NBV B;  3V62 A;  3M63 B;  1FM0 D;  1IPG A;  3PZ7 A;  1QOA A;  2JZ3 B;  2EEL A;  4OHJ A;  1YNT E;  2K6Q A;  1VCB A;  3JSV A;  1E9M A;  3B0A A;  3JYU A;  4WWO A;  1WGY A;  2KQ7 A;  3DVN U;  4PS7 A;  3A4R A;  4RM8 A;  3KUC B;  3M3J A;  2D3G A;  1D5Z C;  2MRP A;  2RMM A;  2X8X X;  3R7Q A;  2D11 A;  1S1Q B;  1WR6 E;  3AMZ A;  3C19 A;  1FEH A;  4N9F 4;  2K22 A;  3DWG C;  4HKZ E;  2IYD B;  2KAN A;  3ZO5 B;  2YVC A;  4MM3 A;  1A70 A;  1HZ6 A;  2TSS A;  2L0F A;  2PJH A;  5FR6 A;  2YLM A;  2OED A;  4HK2 A;  4WJQ A;  3SDL C;  3W1S C;  4IWP A;  3Q3N C;  2L00 B;  2M1M A;  1SGH A;  3P1M A;  3RCZ A;  3VVW B;  1V9J A;  4ZYN A;  2RPV A;  1K53 A;  2CHW A;  4FJZ A;  2G45 B;  1FO4 A;  2MSE D;  4MDK E;  4OZA A;  3BYY B;  1WM2 A;  2BF8 B;  4MT5 A;  1LGR A;  3RZW C;  1PFD A;  3IVF A;  4GXB A;  5CHV C;  2BT6 A;  4LJO B;  1DGJ A;  1T3Q A;  1OQQ A;  2PKO A;  3TUO A;  3O13 A;  1NBF C;  4RH6 A;  2MCN B;  2J42 A;  1VR9 A;  3Q6B A;  2I1K A;  3VAW A;  2AWT A;  3O65 B;  1OTR B;  3AE1 B;  1U4A A;  3NRZ A;  3UGB B;  3B2G A;  2Z0E B;  4B0M A;  3DBR I;  2JY6 A;  3DHI C;  1ZXI A;  1AN8 A;  4KX6 B;  1UWM A;  5BYS A;  3QWZ B;  2D3C A;  3ZIM A;  1KJT A;  1P1A A;  4TV3 A;  5DPW A;  3R66 C;  4L23 A;  3W5V B;  1ISN A;  3PO0 A;  5BMG A;  5J17 A;  1N6Z A;  2WXR A;  2Y5B B;  1L7Y A;  4TUU A;  1I4P A;  4XWT A;  4BKS A;  3TMP B;  2IDY A;  2HDE A;  1VZ6 A;  3ZW3 A;  2BYE A;  3UIP B;  2D07 B;  1UNS A;  1IBX B;  3EHV A;  3ML9 A;  4LLG M;  4CO7 A;  3WAP A;  4TQ1 A;  2KNB A;  1YD8 U;  2XK5 A;  4P16 A;  3OAW A;  1XCT L;  3MJ5 A;  1B9R A;  1GAQ B;  4II3 B;  5FR3 A;  3SEB A;  2XN9 C;  3T9L A;  2AQ3 B;  2ON8 A;  3MJW A;  2HTH A;  3IFW B;  2N9K A;  1EF1 A;  3GZN I;  4RF1 A;  4XYC A;  2ZZP B;  2XEW A;  5AZG A;  3A9K B;  4W9D A;  2QIE B;  3N9Y C;  4YTP B;  5D3I B;  1VJK A;  3AE3 B;  2JRH A;  1K51 A;  2YEP B;  1D5X C;  2J52 A;  2FNJ B;  2RPQ A;  3KWV A;  2J7Q B;  2BGF A;  1C77 A;  4RGM A;  1WXM A;  5IA7 A;  1RM6 C;  1Y56 A;  2KMA A;  3TCA A;  3PVL A;  2NVU I;  4BKS D;  4WUR A;  1JWA D;  2KFK B;  2H88 B;  4KSL C;  1CQV A;  4EOY A;  1FNU A;  3U52 E;  4A9A A;  1FXT B;  1MHH E;  3V6E B;  3AN1 A;  2KOX A;  2W55 A;  1J7C A;  2LVO A;  2JZZ A;  5EE1 A;  3L13 A;  2QDF A;  4W9F A;  3P4R B;  1OFF A;  2JZP A;  1UD7 A;  3AB5 A;  3N1Y C;  1SIJ A;  4P1B C;  4KIK A;  4UDU C;  4YT0 B;  1FNW A;  3PZD A;  3RNG C;  1P98 A;  2KHW B;  1RYJ A;  3ZNI D;  4DXG A;  2EMT A;  2AL6 A;  3DBR B;  1WE6 A;  1UEL A;  3SFE B;  3U4E G;  4LNO A;  4W9J A;  1ZXH A;  4GGQ A;  2KYW A;  1ZE3 D;  5IP4 D;  3SR6 A;  3E9S A;  4PYU A;  5E6O A;  4M8M A;  5EE3 A;  1SE9 A;  4AJW A;  1OQR A;  4PS8 A;  4ZOH C;  2KK8 A;  2PLP A;  4JLC A;  2MEK A;  3NG0 A;  3Q8F A;  3HHM A;  2AQ2 B;  4MSM B;  4KGS A;  2WHI A;  3I63 C;  5HKH A;  2BVC A;  3NVW A;  3Q2A C;  1XQQ A;  3MC9 A;  4DHZ E;  2KZR A;  1EF5 A;  1XCQ L;  1MG8 A;  4MEM A;  3NVV A;  1N5X A;  4FBJ B;  3Q8E A;  2BBC A;  3L0W B;  2L05 A;  2KQS A;  2LMC A;  3AED B;  1R4M B;  3AEB B;  2D3B A;  4HRO A;  3V05 A;  3GS2 A;  4HLE A;  3RUL A;  4MM3 B;  2EKE C;  2GB1 A;  4KIK B;  5EDS A;  2V3P A;  4OVU A;  2OHF A;  2FUH B;  1SE3 A;  1YX6 B;  3GOE A;  2K3U A;  3Q3J A;  4QAY A;  2AX5 A;  2MBH A;  3P4S B;  5TR5 A;  1YN5 A;  4WJO A;  3ZYY X;  1SE2 A;  2KFK A;  3R2T A;  3HRD D;  1OEY J;  1FXA A;  3TL5 A;  4G0N B;  4HPM B;  1XD3 B;  3LXF A;  3CSF A;  2RD0 A;  1E8W A;  1ACC A;  1V2Y A;  4GU2 A;  5H92 C;  3ZXR A;  4LK0 M;  2KWC A;  4BKG A;  3LJ3 A;  5AEK B;  3VTW A;  1QQR A;  4EZJ A;  2K1F A;  3DCG A;  4XDD A;  2PTL A;  5FKA C;  1FFU A;  3I9V 1;  3AU5 A;  4ZRJ A;  3WAN A;  1TGZ B;  2KDM A;  3VHT C;  1PQS A;  3DDC B;  2DLB A;  4NAW B;  3AI5 A;  1TS3 A;  3ABV B;  2KMM A;  2IO1 B;  4ZYS A;  5MPO A;  1KLV A;  1MG4 A;  4K7W A;  4GIV A;  3PPA A;  2FBW B;  2NR2 A;  3QJZ A;  1C9F A;  1WJN A;  2M8S A;  1FNV A;  3AH7 A;  1PGA A;  2ZVO A;  4EUT A;  4MEL A;  4DDG D;  4RGT A;  2WDV B;  4XGA B;  2ZVN A;  3ZQ4 A;  2V1Y A;  4NZL B;  3M95 A;  1OGW A;  4FA6 A;  1AW7 A;  1I4R A;  3NUH B;  3V6C B;  2RR9 A;  1TYG B;  4NQK E;  2KVZ A;  4W9E A;  2LFI A;  1C78 A;  2VRR B;  4NQL B;  4FUL A;  5DPT A;  4EKU A;  4B0E A;  2DAJ A;  4WJP A;  4KV2 A;  3U30 A;  1WGR A;  2DX5 B;  2VH2 A;  5DPR A;  1TKY A;  2PEA A;  3PSE B;  2V0G A;  2D5G A;  3ALB A;  1E6E B;  4GLS C;  1TZ1 A;  1G6J A;  2ASQ A;  1K8R B;  3ZTC A;  3EFU A;  2K6D B;  1RLF A;  4BFR A;  1YX5 B;  2MX2 A;  1FMA D;  4US8 A;  4KDI C;  5AZH A;  2KC1 A;  2MA9 B;  4PS3 A;  1I4G A;  2IY0 B;  3FIL A;  3UQB A;  3L4P A;  3AEE B;  4TQ0 A;  1AYF A;  4GN1 A;  3ZKJ C;  3APF A;  2XBB C;  3MC8 A;  2FIF A;  4ICU A;  1SXT A;  1FRR A;  2X38 A;  1F52 A;  3GP7 A;  1ZUD 2;  2IGH A;  3N32 A;  2FE8 A;  2QC8 A;  3DVN V;  2BTE A;  3ETR A;  3GE3 C;  3ZRC A;  4NAW A;  2WGS A;  3W1Y A;  2MJE A;  2L0T A;  2C7H A;  1JW9 D;  2R2Q A;  1ZKH A;  4B9K A;  4C4V A;  2ZW0 A;  3NY5 A;  4RFB A;  2INP E;  3PRP B;  1WRD B;  3N30 A;  1N60 A;  1DOX A;  2MW5 A;  3Q14 C;  3ZJT A;  4YXD B;  1R4N I;  1V80 A;  4K3C A;  2JRI B;  1XT9 B;  1WXS A;  2KO3 A;  2N7J A;  3APC A;  5E6P A;  2ZPY A;  1HE8 A;  1T6B X;  1MFW A;  2UYZ B;  2Z8L A;  4M02 A;  1TY2 A;  4DDI D;  4XDC A;  2ZEQ A;  3KUD B;  3AUL A;  3L16 A;  4M0W B;  1I4Q A;  2LVQ A;  3ZNZ B;  2LXC A;  5GXG B;  5KHO A;  3LYY A;  3L17 A;  4BKT A;  1YN3 A;  5BMH A;  1J7B A;  4MH8 A;  3TEY A;  2JSV X;  4WWM A;  4A20 A;  2FCN A;  2DNF A;  4I6L B;  1HTO A;  4B6W A;  2KX3 A;  1SSN A;  2L3Z A;  2GBM A;  2G9H D;  1LFD A;  1UBQ A;  1JRU A;  3IG3 A;  3AU4 A;  3A1Q B;  4JL9 A;  4A3O A;  1WH3 A;  2IZV B;  3EEC A;  4LTU A;  3PT2 B;  2KTR A;  3PHW B;  4BAX A;  3PRZ A;  4FJV B;  1D3Z A;  4REZ A;  2N0S B;  4FN2 A;  1TS4 A;  4WH4 A;  3RUI B;  2FID A;  4GDL B;  4K1R B;  5C23 A;  1N5W A;  1VDV A;  4KSK C;  4L1B A;  5FK9 C;  4DK5 A;  2CHX A;  4LCD E;  4LDT B;  4GB9 A;  3AEF B;  3RNE C;  1I4H A;  2Y5C A;  4JWS C;  1UGJ A;  1WMH A;  3AEG B;  5HHD G;  4OVV A;  2WXP A;  3Q8A A;  1QLB B;  2LZ6 A;  4ACF A;  2E3T A;  3NVZ A;  3RNB C;  1J19 A;  1T0Y A;  3KUZ A;  4WAA A;  2KDF B;  1WX7 A;  2MP2 B;  3BII D;  4N59 A;  2BKR B;  1RWS A;  3C8Y A;  4HVB A;  2CJN A;  2MBO A;  4FHJ A;  1YJJ A;  2AQ1 B;  2IGD A;  5LNK 1;  4LDT D;  2BS2 B;  1FRD A;  3TEZ A;  4NJC A;  3APD A;  4KVG B;  1E90 A;  3A1Q A;  1QKZ A;  4JQW C;  4A90 A;  5J2R A;  4ZHP A;  2LXA A;  1GC6 A;  4MSQ B;  2CJO A;  2JWZ A;  3QAR A;  1GOZ A;  2W3S A;  4C56 C;  5DPS A;  1ZDX A;  3IXS A;  4LNF A;  4W9L A;  3RZF A;  2LI5 A;  1T5X D;  1C79 A;  3I3T B;  1RFA A;  1Q0W B;  4HWI B;  1UH6 A;  3KWL A;  3RYT A;  4DBG A;  4WIP A;  1SEB D;  2LAS A;  2SEB D;  1KLU D;  2CS4 A;  4AUQ C;  2ACZ B;  4NJ7 A;  3HVD A;  4AP4 C;  2K0P A;  4HJK A;  3TEW A;  3RT3 B;  1FCC C;  2M17 A;  2BQQ A;  3QA8 A;  4GDK A;  2Y3A A;  3AE8 B;  3BWU D;  4HDQ A;  2WXQ A;  2WLB A;  3OWE B;  3L08 A;  4AOF A;  1XLQ A;  2KVR A;  3BY4 B;  1E0Z A;  2V4L A;  4J3O D;  5CHW A;  5E6N A;  2RDB C;  2GMI C;  2QMT A;  4Q2J A;  4ASW C;  3KVF B;  4A55 A;  1XLN A;  5D6J B;  5BMI A;  1B1Z A;  3NVY A;  1C4A A;  4XWW A;  2D3A A;  3W1S A;  2MLB A;  3DOW A;  4MGY E;  1V6E A;  3FKY A;  2O6V A;  1LQB A;  1IUE A;  2I2Y A;  5G2N A;  2NPT B;  2LD9 A;  3H7P A;  4HJG E;  3IBE A;  1J0G A;  4LJP B;  1V5O A;  4X57 B;  1ZPS A;  3PLV A;  1JWM D;  1YOV B;  1QT9 A;  1NVI D;  2KJH B;  4JPS A;  2JT4 B;  1SF0 A;  2WXM A;  1ENF A;  5G5H A;  1LXD A;  4P7I A;  1OEY A;  4KKJ A;  2IY1 B;  2VH1 A;  2REX A;  1WX9 A;  2K8H A;  2JWU A;  2WU5 B;  2VZK D;  2WXI A;  2GBJ A;  3BYT B;  4CQN A;  2K9X A;  4IM0 A;  3BVG A;  3OJ4 B;  2I1J A;  1WMH B;  1N62 A;  2DZK A;  4NAM A;  2W9N A;  2WU2 B;  5D3D A;  1C1Y B;  1EU4 A;  1YJI A;  2JX5 A;  2QSD A;  3ZRF A;  1TBE A;  1T0Q C;  1JQ4 A;  2FUG 1;  2N7D A;  1GG3 A;  4E74 A;  4E71 A;  2J4X A;  2LEK A;  4RM9 A;  1GNU A;  3CWI A;  3RFZ B;  2KDI A;  2VZK B;  2UWQ A;  3T3O A;  3OJ3 A;  4GSW A;  2KDE B;  4W9C A;  3MHZ A;  1WX8 A;  1QIL A;  1F0Z A;  2FCQ A;  1TJE A;  4WJN A;  4YWG G;  1V86 A;  3B1L X;  4NPN A;  1E7U A;  4MH0 E;  2L32 A;  2O2V B;  1R7S A;  2Y5P A;  3B9J A;  1NDD A;  2JYE A;  3U8Z A;  2FCM A;  4MGZ E;  3ZUN A;  3ZJU A;  1L2N A;  1E8Z A;  1QOG A;  2INN E;  3IT4 B;  1V8C A;  4KZC A;  3K9O B;  1WE7 A;  4YTM B;  1YQ3 B;  4JE3 B;  3KYC D;  2KWV B;  2M56 B;  2C9W B;  4URK A;  1KLG D;  1JAL A;  3WA0 A;  4YSZ B;  1Q5W B;  2NTT A;  2HTM E;  1ZDV A;  3KQ4 A;  4DXA B;  5T8I A;  4IW0 A;  4NY0 A;  4K7S A;  3RD2 A;  1IP9 A;  1WZ3 A;  2LGD A;  3BK1 A;  1GC7 A;  1T0R C;  3U2S C;  1E7V A;  1H4R A;  3V60 A;  2KJR A;  2DYB A;  1E10 A;  3QX1 A;  2WP9 B;  3NS8 A;  2LHD A;  1ESF A;  1SE4 A;  2ZCB A;  2DAF A;  4RGN A;  3PRM B;  2B3A A;  1MJD A;  4FLH A;  4N58 A;  2KJ6 A;  3JSV B;  4XC2 A;  2WQY B;  4JWU C;  2JQR B;  5EE0 A;  2DBY A;  3ZNG C;  4JGH B;  5CHF A;  1SB3 C;  2JYT A;  3HVZ A;  3EC8 A;  2N9L A;  1WRI A;  3N3K B;  4HPP A;  1JWS D;  1L0X B;  1UWX A;  2Z59 B;  2K8C A;  5D7G A;  2A4Z A;  5BYR A;  5AZF A;  1WFY A;  3HIZ A;  4ICV A;  4G50 A;  1P3Q U;  3MFG A;  1YIW A;  3ZTD A;  3U7D A;  1PGX A;  1WWT A;  2R61 A;  2LRW A;  3ZVV A;  3UQA A;  4HXD A;  2LGX A;  1E8X A;  4ARI A;  1FD6 A;  3EFC A;  4TSS A;  2GI9 A;  1YJ1 A;  1X1M A;  1L0Y B;  2NCN A;  2RSU A;  2J0K A;  1QOB A;  2N1W A;  2ZPN A;  2NBW B;  2R2O A;  4HEA 1;  2JXT A;  3KYD D;  2O6V D;  3GB1 A;  3VH4 B;  1MI0 A;  5E6J A;  4C7Y A;  2QHO A;  2MH7 A;  1BXT A;  2A5U A;  5AUI A;  2OJW A;  1K52 A;  3D32 A;  3L10 B;  1I4X A;  2N7E A;  4KKI A;  4K81 A;  3K9P B;  4OZC A;  5TSS A;  4IWQ A;  3IAM 1;  5L95 C;  4NNJ B;  1EM7 A;  1GJZ A;  5LXI B;  2CR5 A;  1WY8 A;  2MHJ A;  4OVZ A;  3A4S C;  2DZJ A;  4E3C A;  2JF5 A;  3KLS X;  1C4P A;  3PHX B;  2MBE A;  2O6V B;  1M4V A;  3ECI A;  1WXV A;  2IO2 B;  2WNM A;  4K7U A;  4PT5 A;  2WXO A;  2L1A A;  3UI3 A;  2BYT A;  2ZJD A;  4MJS B;  4BZA A;  3VR8 B;  3P2B A;  1WJ4 A;  2PPH A;  4ZRQ A;  4W9K A;  1CK1 A;  1C76 A;  5JXV A;  3Q69 A;  1WF9 A;  3VRB B;  2GRI A;  2PE6 B;  3SHQ A;  1TS5 A;  2PW9 A;  4I6N B;  3NJT A;  2OOB B;  4IUM B;  1WZ0 A;  5L83 A;  3AE4 B;  4K3B A; 
#chains in the Genus database with same CATH homology
 1XCT L;  2QJL A;  3MJ5 A;  2IPK D;  1TS4 A;  1B9R A;  1GAQ B;  4WH4 A;  1MHX A;  2KWD A;  4GDL B;  1L5P A;  1QF6 A;  3DWM A;  4ARC A;  5FR3 A;  3SEB A;  2XN9 C;  5H8Y E;  2AQ3 B;  2ON8 A;  4KGR A;  1N5W A;  1VDV A;  4L1B A;  5FK9 C;  2BS4 B;  3ZGZ A;  1JWB D;  1UUP A;  2N9K A;  1XLO A;  3B2F A;  4RF1 A;  3AEF B;  2L52 A;  2K5P A;  2Q5W D;  1JCK B;  2BB6 A;  5EE9 A;  1I4H A;  2DYO A;  2QIE B;  2Y5C A;  1UGJ A;  3N9Y C;  4JWS C;  4YTP B;  1ZOY B;  5D3I B;  1VJK A;  3AEG B;  5HHD G;  3AE3 B;  4DXF A;  1K51 A;  2WXP A;  2YEP B;  1QLB B;  1D5X C;  2J52 A;  3Q8A A;  1JRP A;  1HEZ E;  2E3T A;  3KWV A;  4A6Q A;  3NVZ A;  3IT6 B;  1C77 A;  4RGM A;  3CIR B;  1ZP0 B;  3BII D;  4N59 A;  1RM6 C;  1Y56 A;  1XXG A;  2B76 B;  2WXN A;  2V4I B;  3Q8B A;  1RWS A;  2RDH A;  3C8Y A;  3P4Q B;  2CJN A;  4WUR A;  4C80 A;  1JWA D;  2H88 B;  1XF5 L;  1CQV A;  1FNU A;  1YJJ A;  3U52 E;  2AQ1 B;  4A9A A;  1MHH E;  2IGD A;  5LNK 1;  4OW0 A;  5C2T B;  3TSS A;  3AN1 A;  2W55 A;  5C3J B;  3ZJV A;  1DOY A;  1E7P B;  1J7C A;  2BS2 B;  3P63 A;  1FRD A;  3TEZ A;  5EE1 A;  4NJC A;  3EGR A;  4RGO S;  1BUI C;  3P4R B;  1OFF A;  1QKZ A;  1FIQ A;  1FFV A;  1P7F A;  2G1E A;  2JZP A;  5I4D A;  2W54 A;  1HZ5 A;  3TEX A;  4A90 A;  1CJE A;  1TKE A;  5HFY A;  3LB8 C;  4ZHP A;  2L83 A;  2NMQ A;  3AB5 A;  1SIJ A;  2CJO A;  4UDU C;  4AS1 A;  3FC4 A;  1FNW A;  4YT0 B;  1GOZ A;  2W3S A;  1C4C A;  3URY A;  4C56 C;  1ZDX A;  3IXS A;  1RYJ A;  2SAK A;  4DXG A;  1T5X D;  1C79 A;  1D6E C;  1KTK A;  2WDR B;  3SFE B;  2MJD A;  3U4E G;  1ZXH A;  3NZ3 A;  4IOI E;  1WSP A;  3KWL A;  1ZE3 D;  2MJ3 A;  3I57 A;  3SR6 A;  3RPF C;  4WIP A;  1SEB D;  3E9S A;  5EE3 A;  1ET9 A;  4ZRP A;  1F2R I;  1YN4 A;  1OQR A;  2SEB D;  4KGT A;  1KLU D;  4M0W A;  1XLP A;  1IGD A;  2ACZ B;  2ICI A;  4ZOH C;  3HVD A;  3VQI A;  2K0P A;  3EUB 2;  3TEW A;  1FCL A;  1DYQ A;  4YSY B;  1FCC C;  2PLP A;  3MP9 A;  5HI1 A;  2WXJ A;  2MEK A;  4YSX B;  2I38 A;  2Y3A A;  3AE8 B;  3BWU D;  3Q8F A;  2WXQ A;  2AQ2 B;  4KGS A;  2WLB A;  4P6V F;  3OWE B;  1EWC A;  1JWU D;  2YEP F;  1SBB B;  3MC0 B;  1V97 A;  1XLQ A;  2QIL A;  3NVW A;  4H2A A;  1E0Z A;  4J3O D;  2LJI A;  3AE7 B;  5AUK A;  2M0A A;  2QMT A;  4Q2J A;  1XCQ L;  4ITK A;  1LO5 D;  3NVV A;  4RNA A;  2H89 B;  1N5X A;  4A55 A;  3R8B A;  1XLN A;  1IGC A;  3Q8E A;  5BMI A;  1B1Z A;  2BBC A;  3NVY A;  1KH0 A;  1C4A A;  2LMC A;  3AED B;  4ZHO A;  1ET6 A;  2WXH A;  3W1S A;  4XWW A;  1D5M C;  1RFK A;  3FAH A;  3AEB B;  3V05 A;  4HRO A;  1SJH D;  3GS2 A;  4YTN B;  1NI3 A;  2BS3 B;  2PIA A;  4MM3 B;  1L6V A;  1GPX A;  2GB1 A;  1IUE A;  3PZ8 A;  4WAF A;  3AM9 A;  2I2Y A;  1DOI A;  1NEN B;  2V3P A;  1L6U A;  4HJG E;  2OHF A;  1SE3 A;  2KN4 A;  1ZPS A;  1STE A;  2K3U A;  2IGG A;  1JWM D;  1QT9 A;  1NVI D;  3AE6 B;  2NTS A;  1VRA B;  1KRH A;  3EA6 A;  2AX5 A;  3P4S B;  4JPS A;  1JRO A;  1SF0 A;  2WXF A;  3U7Z A;  1YN5 A;  3FIL B;  1Q10 A;  2WXM A;  1ENF A;  2DYM A;  3P4P B;  5G5H A;  3ZYY X;  1SE2 A;  2EKI A;  4IKG A;  3R2T A;  4D2K A;  4KKJ A;  3HRD D;  1FXA A;  1GB4 A;  2ZW1 A;  1V1P B;  1NEK B;  2W82 A;  3LXF A;  3SFD B;  2BW2 A;  1ACC A;  1WGK A;  4L2Y A;  2JWU A;  1P7E A;  2WU5 B;  2VZK D;  2BB5 A;  4C7Z A;  2WXI A;  1F77 A;  3BYT B;  4CQN A;  2K9X A;  3BVG A;  5H92 C;  2E6X A;  1HXY D;  4LK0 M;  3W5U B;  1KF6 B;  4JX1 C;  3AEA B;  1N62 A;  1PYW D;  2WDQ B;  4NAM A;  1QQR A;  1WXQ A;  2WU2 B;  5D3D A;  2RDG A;  1EU4 A;  1YJI A;  4XDD A;  2JX5 A;  2PTL A;  2QSD A;  5FKA C;  4US9 A;  1FFU A;  1JQ4 A;  3I9V 1;  2IJ0 A;  2KDM A;  2FUG 1;  4HKQ A;  2DLB A;  1QOF A;  4NAW B;  2CU3 A;  2LEK A;  2J4X A;  3VR9 B;  1TS3 A;  2KQ4 X;  3ABV B;  2DWQ A;  2KMM A;  4ZYS A;  5MPO A;  3T3N A;  1CZP A;  4RF0 A;  1SJE D;  3CWI A;  3RFZ B;  2VZK B;  4O1N A;  2WXG A;  2XNA C;  1KFY B;  3T3O A;  3NS1 A;  1J7A A;  2KAC A;  1L0V B;  1IBX A;  3MHZ A;  2FBW B;  1QIL A;  1C9F A;  4HRS A;  1F0Z A;  1FNV A;  3AH7 A;  1VZ7 A;  1PGA A;  4IDI A;  3AV8 A;  4DQO C;  1TJE A;  4RGT A;  4YWG G;  5G5G A;  2WDV B;  4N6E B;  3J9C A;  3W2D A;  3AE5 B;  2L32 A;  3ZQ4 A;  1R7S A;  2Y5P A;  3B9J A;  4NZL B;  1YMH E;  2JYE A;  1AW7 A;  2WXK A;  3AE9 B;  2J53 A;  2PVO D;  1I4R A;  3NUH B;  1NYR A;  1V1O A;  4RCO A;  1TYG B;  2LFI A;  3HUI A;  3ZJU A;  1QOG A;  1C78 A;  1FM0 D;  4R3D A;  3PZ7 A;  1L4D B;  1QOA A;  2INN E;  2EEL A;  3IT4 B;  1V8C A;  4OHJ A;  4B0E A;  4YTM B;  1YNT E;  1YQ3 B;  4JE3 B;  2ONQ A;  1E9M A;  2M56 B;  3BVM A;  1TY0 A;  3AE2 B;  1ROE A;  1KLG D;  1D4B A;  1F2R C;  1JAL A;  3P42 A;  4YSZ B;  2NTT A;  1TKY A;  2HTM E;  1D5Z C;  1ZDV A;  1EWY C;  2RMM A;  2V0G A;  3KQ4 A;  2D5G A;  4GLS C;  1E6E B;  5T8I A;  5BYQ A;  1WYG A;  3AMZ A;  3BK1 A;  1FEH A;  3U2S C;  2K22 A;  1PUT A;  3DWG C;  4HKZ E;  1FMA D;  4US8 A;  1E10 A;  1A70 A;  1VZ8 A;  1HZ6 A;  2LUM A;  1PDX A;  2LHD A;  2TSS A;  1TZO A;  1JML A;  1YQ4 B;  2WP9 B;  1I4G A;  1MVK A;  1V1P A;  2OED A;  3FIL A;  3L4P A;  2W3R A;  3VRA B;  3AEE B;  4TQ0 A;  1ESF A;  1NYQ A;  1SE4 A;  3WCQ A;  1AYF A;  1XEE A;  4RGN A;  4FXC A;  3P1M A;  4N58 A;  2WQY B;  1TKG A;  4JWU C;  2JQR B;  1SXT A;  5EE0 A;  1FRR A;  1PGB A;  2RPV A;  2X38 A;  2DBY A;  1K53 A;  1N61 A;  3GP7 A;  1SB3 C;  1ZUD 2;  2JYT A;  3HVZ A;  1FO4 A;  3BVZ A;  2N9L A;  2IGH A;  2QEJ C;  1WRI A;  4OZA A;  4AQ7 A;  2FE8 A;  5HG2 A;  1JWS D;  1L0X B;  1UWX A;  3BYY B;  4MT5 A;  2BTE A;  5D7G A;  1PFD A;  2JU6 X;  2LHE A;  2BT6 A;  1HA5 A;  2PVG C;  5BYR A;  3IAS 1;  1DGJ A;  1T3Q A;  3ETR A;  1OQQ A;  2PKO A;  3TUO A;  1HQR D;  2MJE A;  1AWD A;  3O13 A;  1K50 A;  1JW9 D;  3MFG A;  4TMA B;  4RH6 A;  1MPE A;  2J42 A;  2ZW0 A;  1BML C;  1VR9 A;  4RFB A;  3R2I A;  2INP E;  1PGX A;  1WWT A;  2R61 A;  2M19 A;  4ARI A;  1FD6 A;  4TSS A;  3BZD B;  2GI9 A;  1XO3 A;  1N60 A;  1L0Y B;  1DOX A;  2WS3 B;  4XE0 A;  1QOB A;  1N63 A;  4MAC A;  3ZJT A;  4YXD B;  3AE1 B;  4HEA 1;  3NRZ A;  3B2G A;  2PMV A;  2WXL A;  1TS2 A;  4B0M A;  2N7J A;  2JXT A;  1EU3 A;  1T6B X;  3GB1 A;  1MI0 A;  5E6J A;  2Z8L A;  1TY2 A;  4C7Y A;  2MH7 A;  4GDK B;  1BXT A;  4XDC A;  5AUI A;  3BK2 A;  1ZXI A;  1AN8 A;  4KX6 B;  1K52 A;  1UWM A;  1FXI A;  1I4Q A;  1I4X A;  5BYS A;  4KKI A;  4OZB A;  4OZC A;  3AEC B;  5TSS A;  5GXG B;  1I7H A;  3LYY A;  3IAM 1;  4USA A;  2LGI A;  1YN3 A;  1EM7 A;  5BMH A;  1J7B A;  4MH8 A;  3TEY A;  4L23 A;  3W5V B;  2JSV X;  3PO0 A;  4WWM A;  4EE2 A;  5BMG A;  4OVZ A;  2WXR A;  2KAJ A;  1I4P A;  4XWT A;  3KLS X;  1C4P A;  1SSN A;  1M4V A;  2IDY A;  2G9H D;  2WNM A;  4A8X C;  3H8H A;  4PT5 A;  2WXO A;  2L1A A;  3UI3 A;  2BYT A;  2HDE A;  3VR8 B;  1L4Z B;  1VZ6 A;  4ZRQ A;  1GB1 A;  1VLB A;  1CK1 A;  1C76 A;  1UNS A;  3V3X A;  5JXV A;  3Q69 A;  3VRB B;  2GRI A;  1IBX B;  4LTU A;  3E56 A;  1TS5 A;  2PW9 A;  4LLG M;  3Q8C A;  3W9C B;  4WQM A;  4TQ1 A;  3AE4 B;  2V3N A;  4P16 A;  4REZ A;  2N0S B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...