2N0SB

Haddock model of ferredoxin and [fefe] hydrogenase complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
94
structure length
94
Chain Sequence
YKVTLKTPSGDKTIECPADTYILDAAEEAGLDLPYSCRAGACSSCAGKVAAGTVDQSDQSFLDDAQMGNGFVLTCVAYPTSDCTIQTHQEEALY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Fe-hydrogenase
publication title Structural Insight into the Complex of Ferredoxin and [FeFe] Hydrogenase from Chlamydomonas reinhardtii.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
total genus 19
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2n0sB00
4HRSA 1JW9D 1QOGA 2WP9B 5EE9A 2WQYB 2QIEB 4C7YA 4JWUC 1NEKB 1FIQA 2DWQA 3AE2B 2CJOA 4YTNB 1FO4A 1KRHA 3B2FA 3AEDB 1RM6C 1F0ZA 2PVGC 1IUEA 2WDVB 2W54A 4C7ZA 3KWLA 3P4RB 5GXGB 1KF6B 3VRAB 3LXFA 4YSXB 1PFDA 1DGJA 1N60A 3P4SB 4WQMA 3AEFB 2MJDA 1N62A 1TKEA 1SIJA 5G5GA 1E0ZA 1I7HA 3SFDB 4US8A 1B9RA 4N58A 1V8CA 1JRPA 4USAA 3W9CB 4YXDB 2MJEA 2W55A 1J7BA 3L4PA 4LTUA 2BS2B 1UWMA 3AE9B 1JQ4A 2B76B 1VLBA 1QF6A 1XLPA 5C3JB 1WWTA 1CZPA 1VDVA 3SFEB 1E6EB 1YQ4B 4ITKA 1SB3C 1N61A 2K22A 2L52A 4WWMA 3FAHA 1RFKA 3NVZA 1OFFA 3NVVA 1L6UA 3P4PB 3DWGC 1ROEA 4KX6B 2M19A 1JALA 1TKGA 2BS3B 2MH7A 2Q5WD 4YSZB 2ACZB 3HRDD 1AWDA 1PDXA 1YQ3B 1KFYB 2FBWB 3W5UB 1AYFA 3AMZA 3NS1A 1DOXA 3DWMA 1QOAA 1TJEA 3P63A 1FRDA 1OQRA 3CIRB 3CWIA 1PUTA 1YJJA 3ETRA 1XO3A 4YTMB 3AM9A 4YSYB 4N59A 2BS4B 1E10A 3WCQA 3AE3B 1SF0A 1XLQA 1DOIA 2WU2B 1T3QA 2Y5CA 3AE5B 4JWSC 2WDRB 1N63A 3AV8A 4JX1C 2MJ3A 3RPFC 2WU5B 3AB5A 3AN1A 1TKYA 3AECB 3B2GA 2HTME 3SR6A 3BIID 3NVYA 1FFVA 2BT6A 4YT0B 1R7SA 2CU3A 1NI3A 5AUIA 1XLNA 2K5PA 4ZHOA 1WGKA 2W3RA 2G1EA 1J7CA 1ZXIA 3B9JA 3P4QB 4A9AA 5MPOA 1E9MA 1FFUA 2LEKA 5C2TB 3AEGB 1OQQA 1WRIA 1WYGA 2OHFA 1DOYA 4C80A 1ZP0B 5G5HA 4ZHPA 1NYQA 1JROA 1CJEA 1FM0D 1QLBB 1WXQA 2PIAA 2M56B 1NYRA 1GPXA 2N0SB 3P1MA 5H92C 1YJIA 3W5VB 1L0VB 1N5XA 1JWBD 3PO0A 4ZOHC 2H89B 3AEAB 1RYJA 1GAQB 1FXAA 1XLOA 1L5PA 1V97A 4P6VF 2WDQB 3AE4B 1FRRA 2H88B 1ZOYB 3AH7A 4US9A 1FMAD 2CJNA 2WLBA 3LB8C 1RWSA 1L6VA 2KAJA 5EE1A 5H8YE 2PKOA 3AEEB 3HUIA 1EWYC 2E3TA 1ZUD2 2QJLA 1NENB 2EKIA 2AX5A 3VR8B 2KMMA 3VRBB 2JQRB 5EE0A 1N5WA 1NVID 1FXIA 3AE6B 4IDIA 4YTPB 1QOBA 2WS3B 1VJKA 2JX5A 3AE8B 5AUKA 2L83A 3NVWA 1QT9A 4FXCA 1J7AA 2DBYA 3AEBB 1E7PB 1A70A 5EE3A 3ZYYX 1JWAD 3ABVB 3EUB2 2K9XA 1QOFA 3FC4A 3AE1B 1TYGB 3NRZA 4HROA 4N6EB 3HVZA 3AE7B 3VR9B 2W3SA 2PVOD
chains in the Genus database with same CATH superfamily
2D11A 4AJWA 3Q69A 1TS4A 4JLCA 1WGGA 4IG7B 4HPPA 4AS1A 2CS4A 1I42A 2Z0EB 1DGJA 2MLBA 1F52A 2V4IB 4NAWB 3ZQ4A 3A33B 3BVZA 4GXBA 3PS6A 1J7BA 1A5RA 4MEMA 4DXFA 2V3NA 1P1AA 3M63B 2LJ5A 3N32A 2N9KA 3A9JA 1ZDVA 2XNAC 1YN3A 1SXTA 1P7FA 5D3DA 3AMZA 5DCNA 1OQRA 4ZRPA 5CHWA 2HTHA 2K8HA 4MGYE 3AE5B 4DHJD 4JWSC 2LHDA 2MJ3A 2D3BA 1TKYA 2LRWA 3BWUD 1FFVA 1NI3A 1WGRA 5L95C 1TS5A 2J53A 4LNFA 4FJYA 3P4QB 2XK5B 2LEKA 2C7NB 3DBLB 4C80A 4ZRJA 4F1SA 2PIAA 1QLBB 1NYRA 1N5XA 2ZNVB 3ENEA 1GAQB 5D3IB 1FRRA 2H88B 4KV2A 1FMAD 3IBEA 2KJ6A 5EE0A 2JU6X 1V49A 3AE8B 4ZRKA 2HJ1A 5D7GA 2LASA 3EUB2 3QARA 4HCPB 1GUAB 4YWGG 5IAAC 3R66C 2VZKD 1TS2A 4M0WB 4HJGE 4HKZE 1C78A 2C7MB 4YTNB 2WXFA 1JMLA 1STEA 2VH1A 1M94A 1QKZA 3PSEB 4G11A 1MFWA 2R2QA 3DVNV 1N62A 1VZ7A 2ZPNA 4EKUA 2R2OA 1PGAA 1KLVA 2CR5A 2N9PC 1E6EB 4A8XC 4CHKA 4L23A 3VH4B 5LXHA 3RT3B 2BS3B 3N20C 2WXRA 1S3SG 5HHDG 2KK8A 1AYFA 4TMAB 1QOAA 2CU1A 4XDCA 3ZTDA 4XWWA 3QIJA 1E5WA 4K7SA 5CX3A 3H7PB 1UF0A 2KWDA 3AN1A 4PS8A 4RH6A 3QCAA 3BZDB 4HCNB 1LQBA 1PGXA 3NZ3A 2BF8B 3WANA 2PPHA 5BMIA 2BYVE 2BWES 1JROA 3M3JA 1J0GA 3OWEB 2RGFA 4HPMB 2M56B 2WXOA 3P1MA 3N3KB 4ZDVA 1PGBA 2JUOA 5C1ZA 2JWZA 3L54A 1IGCA 3Q3OC 3T3OA 3BK2A 2E3TA 2N9XA 3DHIC 1TY0A 4DDGD 1K50A 3DBHI 4FJZA 2L83A 4MH0E 3TEYA 1TTNA 2MBQA 2LGIA 3NS8A 4HROA 1WX8A 2PTLA 2GBMA 5J17A 2WP9B 4WQOB 1OEYJ 4HKQA 2QEJC 1L4DB 2KOXA 1IUEA 3O65B 4HDOA 3VAWA 3HM6X 4MSQB 2J4XA 1B9RA 3H6NA 1FD6A 2MJEA 2C60A 4IOIE 3EGRA 1JWSD 4CQNA 3TJPA 4A20A 2FIDA 4G0NB 4WAAA 4CO7A 1EU3A 4WWMA 2I1JA 2B3AA 2MHJA 4PS7A 2DAFA 4W9FA 1LM8B 2NBWB 4XGAB 1NI2A 2O2VA 1FPYA 1QF6A 3LYYA 5IO9A 4BVUC 1UWXA 2WXGA 4GU2A 2BTEA 4RCOA 2N7JA 2G45B 4JPSA 1QILA 4IW0A 2DX5B 3WA0A 2BT6A 2YLMA 1ET9A 1T0QC 2KDEB 4W9EA 2JZ3B 1SE2A 1J7CA 2JT4B 1HZ6A 2PLPA 3QJZA 1P0RA 3DBHB 2DZKA 4JQWC 3TL5A 3TIXA 1E7UA 2J7QB 1RFAA 3PPAA 2Z8LA 2CJNA 3ZTCA 1GNUA 1EWYC 5FR6A 4S17A 4B9KA 4KKJA 4IDIA 5BO4B 4CYEA 4HWIB 4LCDE 1JWAD 4AOFA 3AE7B 1XD3B 3B08A 3C8YA 4FJVB 1SE4A 1SEBD 4BZAA 1KRHA 4YL8A 2WXKA 5GXGB 5BMHA 2MX2A 1WY8A 3ML9A 2BGFA 3AEFB 4M8MA 5G5GA 4HJKA 4D2KA 1JRPA 1ENFA 2HJ8A 3L4PA 3MJ5A 3VHTC 1LGRA 1I4QA 1F1HA 4ANXA 2K22A 2K1FA 3FAHA 1ISNA 4WURA 2FCMA 3DWGC 2IGHA 1I4RA 3QK0A 3A9KA 2LUMA 2WXIA 2L7RA 2ZEQA 3W5UB 4OZCA 1DOXA 2KLGA 2UU7A 4MDKE 4YSYB 2N1WA 2X38A 3EHVA 2EELA 3IXSA 3GP7A 3GE8C 2DHZA 4HXDA 4DHZB 2IO1B 2ZZPB 2M0AA 1MPEA 4WWNA 3V6EB 1V81A 3RFZB 3FILA 1K53A 2GLSA 4BBNF 1F2RC 2OEDA 4IUMB 2FUG1 4ZHPA 3DCGA 1EWCA 3VFKA 3ZNID 4K3BA 1IYFA 2KC2A 2PKOA 2FE8A 4NQLB 5CHVC 5IA7A 1N5WA 4WJQA 1NVID 2PMVA 3CF6E 3MC9A 1TYGB 3QA8A 4XYCA 2KDBA 2MP2B 4LK0M 2JF5A 3ZLZA 2UWQA 1UNSA 4Q2JA 4REZA 3L08A 2N9LA 2KJRA 4UDUC 1FCLA 2MA9B 2GI9A 3ONSA 2JXTA 2Y5BB 1I7HA 4W9LA 2QHOA 4USAA 4TUUA 1I4XA 4W9IA 1VR9A 4W9CA 3JSVB 5E6OA 1N61A 3FKYA 4I6LB 2LD9A 1L6UA 3NVVA 3NHEB 1ROEA 3ZW3A 3E56A 2E6XA 2Q5WD 2MH7A 4KIKB 2K8BA 4G50A 1FRDA 2NTSA 4I6NB 1PUTA 1EF5A 3NJTA 3ZO5B 4MGZE 1YX5B 2LFIA 4WJOA 4NAMA 4F7ZA 3AE3B 2KACA 2KFKB 2KTRB 5AZGA 3AU4A 5LNK1 1N63A 3A1QB 4OVZA 4WIPA 1GB4A 4P16A 2FNJB 2G4SA 1G6JA 1R7SA 2JZZA 3N30A 1ZGUB 1Z2MA 4GDLA 4IM3A 1YN4A 3WAMA 3ZXRA 2L3ZA 3ALBA 1SJHD 4II3B 4AP4C 2Z0DB 5C23A 1Q0WB 3A4RA 2ZJDA 4GOCA 5H92C 5TR5A 1XT9B 1YX6B 3I3TB 3M95A 1JRUA 2MBBB 2V4LA 2ZW0A 3AEEB 3TBLD 3SEBA 3VRBB 2KQ7A 5D94A 2RDGA 2AQ1B 4JGHB 2RMMA 3S2AA 1WM3A 1VZ8A 4K1RB 4TQ0A 1B1ZA 1CQVA 3NRZA 4BKSA 2KNBA 3ECIA 4ASWC 3OJ3A 2QIEB 2KJHB 2TSSA 4JWUC 3AE2B 3B1LX 3VDZA 1EM7A 1UELA 1V86A 3Q8AA 3KLSX 3UI3A 4J3OD 2ZNVC 4XX5A 3P4SB 1KOTA 1YN5A 2BYTA 4US8A 3I9V1 1WJUA 4NAWA 2KO3A 3ZVVA 4KZCA 5LLIA 2NR2A 4DBGA 3TUOA 1I4HA 4M02A 3NY5A 4IC7B 2V1YA 2L0FA 4ZYNA 1JALA 2DYBA 4JL9A 5L83A 1PDXA 3NS1A 1K52A 3IT6B 3AM9A 1I4GA 1UBIA 3N1XC 3DDCB 2INPE 4AJYB 2J42A 2NPTB 4XE0A 1Y8RC 1C9FA 4DDID 1YMHE 2W3RA 1UUPA 1ZXIA 2RR9A 3B9JA 4M8NA 4FBJB 1E9MA 5DPWA 1AW7A 2XK5A 2BQQA 4BKSD 1WYGA 1F9JA 2MBEA 2DAJA 2LVPA 2NCNA 2MCNB 1WR6E 3RI7C 2A5UA 4ZOHC 2SAKA 3GB1A 2WDQB 3AE4B 1IPGA 4HK2A 3DPDA 1FXTB 2LVQA 1YD8U 5AUKA 3AXCA 3PREA 3X23A 3Q3NC 2K9XA 3VTVA 2N9EB 4RGOS 4W9GA 2K25A 4KSLC 1C4AA 1T0SC 1WMHB 3N1ZC 3ML8A 2KQSA 1EU4A 3UGBB 2YVCA 4K7UA 1FIQA 4M0WA 3SDLC 3B2FA 4KVGB 3HM3A 1WF9A 2PVGC 4MT5A 1YIWA 1SIJA 1V6EA 3Q8EA 3SFDB 1VCBA 4N58A 1WGYA 4H2AA 2R61A 1PQSA 3HHMA 4LTUA 2KN4A 5DPSA 3WIMA 4DXAB 2M1MA 1WXSA 5IOIA 5HG2A 4NNJB 1E8XA 1RFKA 3N9YC 2JWUA 2L76A 4BAXA 3PHXB 4B6WA 1P98A 1TY2A 2K0PA 1HZ5A 5FKAC 3CWIA 3ETRA 2ZCCA 1MHHE 1T0YA 1QQRA 5BYSA 5IP4D 2WU5B 4C56C 2KC1A 3Q3MC 3H7PA 1UD7A 1V2YA 2L0TA 1Y56A 4OVUA 2BPSA 2XEWA 3R3MA 2PEAA 4OVVA 5J18A 4NJ6A 4OW0A 3UQBA 2WXMA 5KHOA 1FM0D 2QILA 2D3AA 2V3PA 1WRDB 4IKGA 4RM9A 3PO0A 2H89B 2DENB 4K3CA 1OGWA 3PTFC 2JZPA 1Q1OA 1L5PA 1OQYA 2M4NA 4DHZE 2V9HA 4B0EA 1FCCC 2QJLA 1EUVB 2WX0A 3VR8B 2I38A 2IO0B 5AZHA 2KD0A 4NQKE 3QWZB 2WXHA 2MBOA 2N7DA 3R2TA 1L0YB 3GS2A 2JX5A 5IKCM 1A70A 4OZBA 3RNCC 3OG5A 2DZIA 2LUEA 3HVZA 2GMIC 1WJNA 3T3NA 2JXXA 1MI0A 2RSUA 4W9KA 4FULA 1V5TA 3AEDB 2OOBB 1J8CA 1F0ZA 2WDVB 3RNGC 3DHGC 4NZLB 3KWLA 4C4VB 4FLHA 1D6EC 4W9HA 2MJDA 1KH0A 1BXTA 5HFYA 4ZYSA 2B76B 5C3JB 1C77A 2SEBD 2QMTA 3I57A 2LVOA 3DVNU 3RUIB 2Z59B 3HRDD 1UGJA 1YQ3B 2ZW1A 4RMAA 2HDEA 2IDYA 1DOIA 1T3QA 3AI5A 3RPFC 4K7WA 4EOYA 3B2GA 2V3SA 2BW2A 1C4PA 3P2BA 5BMGA 3HK0A 4KKIA 1V80A 2KMCA 4MM3B 3J9CA 2L00B 1L7YA 1ZP0B 5G5HA 4MGKE 2WXJA 1YJ1A 1BT0A 1I35A 2G3QB 2KMAA 3AH7A 2YEPF 3GZNI 1F77A 1WSPA 2KAJA 4URKA 3V60A 4ANUA 1ZXHA 2DYMA 3MP9A 3W2DA 2J0MA 1J7AA 2G4DB 2AYOB 3VUXA 1HQRD 1C3TA 4ICVA 2KLCA 2YEPB 2D07B 2CJOA 3H7SA 1XCTL 1X1MA 1RM6C 1EO6A 3LXFA 2J0KA 1K8RB 1ZKHA 2WDTB 4AWJA 1SGHA 1UWMA 2OJWA 2WWZA 4BBNC 3VUYA 3RNBC 1WWTA 2L52A 2D3GA 4IWOA 1UH6A 2WNMA 2KDFB 4QAYA 1E8WA 3MTNB 3VQIA 1IBXB 4GLSC 3RD2A 1YQBA 1KLUD 2O6VB 1AWDA 5E6PA 3CIRB 3BINA 2N1VA 4N59A 2X8XX 4JIOU 2Y5CA 2RDBC 3PZ7A 1L2NA 4XC2A 2KYWA 3VUWA 2DYOA 2LRUA 3GZNB 1HE8A 2K3UA 3JVZX 4EEWA 2WYQA 3EA6A 3PZDA 4GDKB 2GBRA 1P7EA 5HI1A 4LDTB 2LI5A 1R4NI 2ZPYA 4II2B 3HVDA 4MGIE 2KVRA 1GPXA 4LNNA 2BB5A 2GBKA 1JWBD 4LNIA 3K9PB 3URYA 2J52A 1FNWA 5E6NA 2GRIA 1WGDA 3KYDD 1NENB 2KTFA 4BKGA 3AE6B 3DVGX 4P1CC 3C19A 1QOBA 2M17A 1VJKA 4FXCA 4IWPA 4N6EB 2W82A 4WJPA 3PZ8A 3PGEA 4MJSB 3R7QA 2WXPA 4M01A 1C76A 2BKRB 1MVKA 2MP2A 2AWTA 1E7VA 2IPKD 5TSSA 1GB1A 1E8YA 3L10B 4XWTA 1HTOA 1N60A 2RDHA 4PYZA 2GBNA 3VTWA 4N9F4 2KWVB 3PVLA 4WWOA 2ASQA 1C4CA 2AL3A 2LXCA 2BS2B 1R4MI 3UIOB 2CHXA 3ZIMA 2M8SA 1XLPA 2LWPA 4W9JA 2INDC 4FHJA 3JSVA 4BOSC 1TZ1A 2KX3A 1Q5WB 1YNTE 5AEKB 1KTKA 3NVZA 1T6BX 1TIFA 2FCQA 5BYQA 3V05A 4TSSA 4B95A 3PRPB 1KFYB 1XF5L 3DVGY 4KIKA 2IGGA 3AU5A 3T9LA 4YTMB 1IGDA 1R4NB 1AN8A 2WDRB 2KFKA 2KTRA 4R3DA 2EMSA 3A1QA 3IG3A 3BIID 2IJ0A 2FCNA 2BVCA 2G1EA 2NTTA 3PLUA 1D5XC 3LDZE 3H8HA 2LXAA 3VH3B 3PLVA 5FR3A 3RNFC 2D10A 2LJIA 3X0WA 3Q8BA 2KQ4X 4X57B 1WYWB 4US9A 5EE1A 1TBEA 4A3PA 2AX5A 2VRRB 4LJPB 2PE6B 1S1QB 4A6QA 2DLBA 4JE3B 4EZKA 3QX1A 2W3SA 1R4MB 3D32A 4LJOB 1WGHA 3RULA 5AZFA 4ZRQA 1FO4A 1V1PB 2IY1B 3LJ3A 1FEHA 1KM7A 4PT5A 2V0GA 5CTRC 1KF6B 3UQAA 4WQMA 5G55A 3SD5A 4MELA 2ONQA 3QAQA 1V8CA 5E6JA 5EDSA 2RPVA 4NJ7A 3BVMA 2XN9C 3RMKC 2L8JA 2JRHA 4M00A 1GJZA 2K8CA 1PYWD 3PRZA 3Q8FA 2MBHA 3R8BA 2ICIA 3NUHB 4GIVA 1QZEA 3CSFA 2HTME 5KHQA 4IWQA 3WAPA 3KUDB 2NPTA 4NY0A 2MW5A 3B0AA 3L16A 3AULA 4A9AA 1BUIC 3SU8X 3IHPC 2K39A 3U4EG 3RZFA 3L17A 2LGDA 4ANVA 1GC7A 2XBBC 4DHJB 1ZOYB 3LB8C 1J19A 4O1NA 3O13A 1VZ6A 2EKIA 1KLGD 2DNFA 3C0RB 1XXGA 4RGMA 1FNVA 1LXDA 3R2IA 2J0JA 2MSED 3RN9C 1MJDA 4TV3A 2KFJA 4J6IA 4RFBA 4NJCA 1GOZA 1JW9D 1QOGA 1H8CA 4I6PA 2WQYB 2Y3AA 5EE9A 3V61A 1WMHA 4EZJA 1WH3A 3WAOA 4EE2A 5JHBA 4PS3A 3VVWB 1L4ZB 2LHEA 4W9DA 3QQ8B 1SE9A 3Q14C 2WGSA 2KHWB 3DHHC 2INCC 1U4AA 3ZRFA 1VLBA 2VZKB 3VXWA 1YQ4B 3BK1A 3A9JB 4MSMB 1WJ4A 2IYDB 2QDFA 4WJNA 4DWFA 3GOEA 1FNUA 2DZMA 3PT2B 3UIPB 2K6DB 2BBCA 2ACZB 1T0RC 3Q2AC 2LGSA 3P63A 1XO3A 1WI0A 2LMCA 1V9JA 3I63C 2L32A 3ZJTA 3AECB 2IY0B 1WX9A 2G9HD 1WR1A 1WGKA 2OJRA 2KZRA 3H1UA 1E90A 2JVCA 1D3ZA 5C2TB 4GGQA 1WRIA 3GE3C 3ZJVA 1NYQA 1UGMA 1OTRB 3IAM1 1V97A 3R7RA 3U7ZA 3RNAC 5H8YE 2JQRB 2CHZA 4ARCA 1WZ3A 3OLMD 1GG3A 2GBJA 4XZ4A 1TZOA 3AE1B 2FCSA 1C79A 2REXA 3VR9B 2QCZA 4XDDA 4E3CA 4C7YA 4RF1A 1SE3A 2DWQA 3APDA 4KDLB 3CSTA 4C7ZA 3MC8A 2IZVB 4KGTA 3NG0A 4ANWA 4C4VA 3NZSA 3ZDTA 1E0ZA 4E71A 2KX0A 4YXDB 2I2YA 2AL6A 2D5GA 3DBRI 4FN2A 3AE9B 4ARIA 3PHWB 5DPRA 1SBBB 2WXLA 4ITKA 3U30A 3ZXVA 1SB3C 2GOWA 1OFFA 4HEA1 1ZPSA 1WFYA 4ZRIA 3JW0X 2FBWB 3PV1A 4WWPA 1L0XB 1D5ZC 1ET6A 4LNKA 2LZ6A 4G3XB 2W9NA 4S0RA 1HXYD 2I1KA 2KDMA 2EMTA 2A4ZA 1WJ6A 3L0WB 1XLNA 2D3CA 4ZHOA 2BKFA 4LLGM 1JCKB 5JHAA 1WIAA 4DQOC 3RZWC 2OHFA 1DOYA 4MM3A 2IBIB 4L1BA 2D2QA 4WAFA 2NMQA 2C9WB 3W5VB 1VRAB 3E9SA 3ZUNA 3IFWB 4YSZB 3VTUA 1YOVB 1RWSA 2CKHB 1NBFC 4YTPB 1N6ZA 1RAXA 4K81A 4F8CB 4WH4A 2GB1A 3DBRB 3U7DA 1WE6A 4PYUA 2BYEA 4MH8A 4E74A 3NZUA 1WXMA 2W54A 2JRIB 1UZXB 2L1AA 3KYCD 3EFCA 4LNOA 2FAZA 1AARA 4A3OA 3U2SC 1TGZB 3MHZA 3W9CB 3Q8CA 3TSSA 1OEYA 1JQ4A 2RD0A 4RF0A 3ZGZA 3APCA 2NVUI 3EECA 2C5LC 2JYTA 4KX6B 1D5MC 4OZAA 3IVFA 3EC8A 4AQ7A 2M0XA 1TKGA 2O2VB 1IBXA 2RPQA 2ZCBA 2O6VA 3DWMA 1TJEA 1WXVA 5GMVA 3RNEC 1BMLC 3NOBA 3W1SC 2L05A 3WCQA 4HVBA 2WU2B 3CMMB 3KUZA 2KKCA 2LGXA 2AQ3B 1V5OA 4OHJA 2LGYA 3V6CB 1T5XD 4B0MA 2FIFA 2IO2B 4GDKA 2MRPA 2EKEC 1Z5SB 3V3XA 5J2RA 1WXAA 1L0VB 4A55A 3AEAB 1P3QU 1XLOA 4MACA 1JWMD 3OJ4B 2WLBA 3I5JC 2ZVNA 2AQ2B 3EFUA 3HUIA 1ZUD2 3H9DA 1LO5D 2KMMA 4TQ1A 4ICUA 2Y5PA 2PJHA 3MHSD 2KWCA 3APFA 3AEBB 3KQ4A 3ZYYX 3TEWA 3JYUA 3T8MA 3FC4A 4RGTA 5BYRA 1ACCA 3K9OB 1E8ZA 3KUCB 4HRSA 1Q10A 1XEEA 4MJSA 1M4VA 1MG4A 1HA5A 3IT4B 2KANA 2JSVX 3TEZA 4GSWA 4KSKC 4P7IA 3P4RB 2KXJA 1JWUD 1PFDA 1XCQL 1DYQA 2O6VD 3W1SA 3BY4B 4C00A 1LFDA 4HPLB 1TKEA 1TS3A 3SHQA 2JY6A 1P9DU 5FK9C 2W55A 4BOZB 2NBUA 1H4RA 5DPTA 2DZJA 4L2YA 3W1YA 2WXNA 1CZPA 1VDVA 1D4BA 2N4FA 3SFEB 4GMVA 3Q3JA 2MWSB 1NDDA 2C7HA 3P4PB 4DXGA 2M19A 3A9KB 1SJED 5HKHA 2INNE 1KJTA 1GC6A 3ZJUA 2BYFA 3P42A 3BYYB 3DQVA 4LDTD 4BFRA 1YJJA 3U52E 3BYTB 1WE7A 1SF0A 1XLQA 4EZLA 3RCZA 3QC8B 2UYZB 3U8ZA 1F2RI 3KWVA 3SR6A 3NVYA 4YT0B 2FUHB 2KVZA 5AUIA 2K5PA 5JXVA 2WX1A 5JZEB 1MG8A 5MPOA 3FILB 4ACFA 3KVFB 3AEGB 1OQQA 2BWFA 3Q6BA 1ZW7A 2IGDA 3BVGA 1CJEA 3Q3FA 3DBSA 2NBVB 3ZRCA 2AEHA 1HTQA 3TMPB 3MC0B 2QSDA 1UBQA 1WX7A 4P6VF 1ESFA 3TCAA 3ZDMC 5I4DA 4RGNA 1FXIA 3MFGA 5D2MB 3NVWA 1XQQA 4HLEA 2DBYA 5EE3A 1E7PB 4TKNA 4RM8A 5D6JB 1NEKB 5IN7A 2PW9A 1ZE3D 2BB6A 4GB9A 3ZNGC 1V1PA 1CMXB 2KWUB 3VRAB 2IO3B 1I4PA 4YSXB 1WZ0A 3TEXA 4IM2A 1CK1A 2KT7A 3A4SC 2QC8A 2MQJA 3OAWA 3PRMB 1MHXA 4AUQC 1RRBA 2WXQA 3IAS1 1WM2A 4IM0A 2MEKA 3HIZA 5CHFA 1V1OA 1SSNA 4KGSA 3UINB 5JH5C 4FADA 4FA6A 3DOWA 2HE7A 2K6QA 4PK1A 2N7EA 3L13A 4EFOA 1HEZE 2BS4B 4A90A 4GN1A 4KDIC 1VD2A 4JX1C 3AV8A 3V62A 2JYEA 3AB5A 1EF1A 3WALA 4BKTA 2CU3A 2HD5B 4RNAA 4GDLB 1TT5B 3KW5B 1FFUA 2KN5A 4KZ0A 1RLFA 3N1YC 3UF8A 2PE9A 4FHKA 3ZKJC 4EUTA 2CHWA 5G2NA 1WXQA 4P1BC 3KH0A 2N0SB 5LXIB 1YJIA 3M62B 3ZNHB 3ZNZB 1RYJA 1FXAA 1E10A 1SIFA 1IP9A 1L6VA 2NS5A 2JPHA 2KDIA 5T8IA 4HDQA 2ON8A 1C1YB 1ZDXA 2ZVOA 3MJWA 3DBLI 2WHIA 2WS3B 3RYTA 1QT9A 4DK5A 4KGRA 2VH2A 3ABVB 3QHTA 1QOFA 1K51A 4NPNA 2PVOD
chains in the Genus database with same CATH topology
4XDDA 2YEPB 3Q69A 4C7YA 1TS4A 4RF1A 1SE3A 2DWQA 2CJOA 1UNSA 4Q2JA 4REZA 1XCTL 2N9LA 1RM6C 4UDUC 4C7ZA 4AS1A 4KGTA 3LXFA 1FCLA 1DGJA 2GI9A 2JXTA 2V4IB 1E0ZA 4NAWB 1I7HA 3ZQ4A 3BVZA 4USAA 4YXDB 2I2YA 1I4XA 1J7BA 2D5GA 1UWMA 3AE9B 4ARIA 1VR9A 4DXFA 1WWTA 2V3NA 1SBBB 2WXLA 4ITKA 1SB3C 1N61A 2L52A 1OFFA 2N9KA 3NVVA 1L6UA 1ZDVA 2WNMA 1ROEA 3E56A 4HEA1 3VQIA 1IBXB 2XNAC 4GLSC 1ZPSA 2E6XA 1YN3A 2MH7A 2Q5WD 1KLUD 1SXTA 1AWDA 2FBWB 1P7FA 5D3DA 3AMZA 1L0XB 1FRDA 1D5ZC 1OQRA 2NTSA 1PUTA 1ET6A 3CIRB 4ZRPA 4N59A 2LFIA 4NAMA 3AE3B 2KACA 2Y5CA 3AE5B 4JWSC 5LNK1 1N63A 2LHDA 2MJ3A 1HXYD 3PZ7A 4OVZA 4WIPA 1TKYA 1GB4A 4P16A 2KDMA 3BWUD 1FFVA 1R7SA 2DYOA 1NI3A 1XLNA 2K3UA 4ZHOA 2J53A 1TS5A 4LLGM 3P4QB 1JCKB 3EA6A 1YN4A 2LEKA 4GDKB 4DQOC 1DOYA 2OHFA 1P7EA 5HI1A 4C80A 1SJHD 4L1BA 2PIAA 1QLBB 4WAFA 2NMQA 1NYRA 3HVDA 1GPXA 2BB5A 5H92C 3W5VB 1N5XA 1JWBD 1VRAB 1GAQB 3E9SA 5D3IB 4YSZB 1FRRA 2H88B 1FMAD 3URYA 1RWSA 2J52A 1FNWA 2ZW0A 3AEEB 2GRIA 1NENB 3SEBA 3VRBB 5EE0A 3AE6B 2JU6X 2RDGA 4YTPB 2AQ1B 1QOBA 2RMMA 1VJKA 3AE8B 1VZ8A 4FXCA 4TQ0A 5D7GA 1B1ZA 3EUB2 1CQVA 3NRZA 4N6EB 2W82A 4YWGG 3PZ8A 2WXPA 2VZKD 2GB1A 4WH4A 1TS2A 1C76A 4HJGE 1MVKA 2QIEB 4HKZE 1C78A 2TSSA 3AE2B 4JWUC 4MH8A 4YTNB 2IPKD 1JMLA 1STEA 2WXFA 1EM7A 5TSSA 1GB1A 2W54A 1QKZA 3Q8AA 3KLSX 3UI3A 4XWTA 2L1AA 4J3OD 1N60A 3P4SB 2RDHA 1YN5A 1N62A 3U2SC 2BYTA 4US8A 3I9V1 1VZ7A 3MHZA 3W9CB 3Q8CA 1C4CA 3TSSA 1PGAA 2BS2B 3TUOA 1JQ4A 1I4HA 1XLPA 4RF0A 3ZGZA 1E6EB 1YNTE 4A8XC 1KTKA 3NVZA 1T6BX 2JYTA 4KX6B 1D5MC 5BYQA 3V05A 4OZAA 4TSSA 4L23A 4AQ7A 1JALA 1TKGA 2BS3B 2WXRA 1IBXA 1PDXA 1KFYB 1XF5L 5HHDG 1AYFA 3NS1A 4TMAB 3DWMA 1QOAA 1TJEA 1K52A 2IGGA 3IT6B 4YTMB 3AM9A 1IGDA 4XDCA 1BMLC 4XWWA 3WCQA 2WU2B 1AN8A 1I4GA 2WDRB 2KWDA 3AN1A 2INPE 4R3DA 2J42A 4RH6A 4XE0A 3BIID 2IJ0A 1C9FA 1YMHE 3BZDB 2AQ3B 2W3RA 1UUPA 2G1EA 1ZXIA 4OHJA 3B9JA 1PGXA 3NZ3A 1T5XD 1E9MA 4B0MA 1AW7A 2NTTA 1WYGA 1D5XC 5BMIA 3H8HA 1JROA 3V3XA 3OWEB 2M56B 2WXOA 3P1MA 1L0VB 4ZOHC 4A55A 5FR3A 3AEAB 1PGBA 1XLOA 2SAKA 2LJIA 2WDQB 3AE4B 2KQ4X 3GB1A 3Q8BA 4MACA 1JWMD 1IGCA 2WLBA 4US9A 2AQ2B 5EE1A 3T3OA 3BK2A 3HUIA 2E3TA 1ZUD2 2AX5A 1LO5D 2KMMA 4TQ1A 1TY0A 2Y5PA 1K50A 5AUKA 2L83A 3TEYA 4A6QA 3KQ4A 2DLBA 3AEBB 3TEWA 4JE3B 2LGIA 3ZYYX 2K9XA 4HROA 3FC4A 4RGTA 4RGOS 5BYRA 1ACCA 2W3SA 1C4AA 2PTLA 4HRSA 1Q10A 1XEEA 2WP9B 1M4VA 1EU4A 4HKQA 1FIQA 2QEJC 4M0WA 1HA5A 3IT4B 1L4DB 4ZRQA 1V1PB 2JSVX 3B2FA 1FO4A 3TEZA 1FEHA 4PT5A 2PVGC 2V0GA 1IUEA 3P4RB 1KF6B 1JWUD 1PFDA 1XCQL 1DYQA 4MT5A 3W1SA 4WQMA 1TKEA 1SIJA 3Q8EA 3SFDB 1TS3A 2ONQA 2J4XA 1B9RA 4N58A 1V8CA 4H2AA 2R61A 5FK9C 1FD6A 2MJEA 2W55A 5E6JA 4IOIE 4LTUA 2RPVA 3EGRA 3BVMA 2KN4A 4L2YA 1JWSD 2XN9C 2WXNA 4CQNA 1CZPA 1VDVA 1D4BA 3SFEB 5HG2A 1EU3A 4WWMA 1RFKA 3N9YC 3P4PB 4DXGA 2JWUA 2M19A 1SJED 2INNE 1TY2A 2K0PA 3ZJUA 1HZ5A 5FKAC 1PYWD 3P42A 3Q8FA 3BYYB 1QF6A 3LYYA 3CWIA 1YJJA 1UWXA 2WXGA 3ETRA 3R8BA 2ICIA 3NUHB 3U52E 3BYTB 4RCOA 1MHHE 2BTEA 1SF0A 1XLQA 1QQRA 5BYSA 2N7JA 4JPSA 2WU5B 1QILA 4C56C 2HTME 1F2RI 3KWVA 3SR6A 3NVYA 2BT6A 4YT0B 1ET9A 5AUIA 2K5PA 1SE2A 1J7CA 1Y56A 5JXVA 4A9AA 5MPOA 1BUIC 1HZ6A 3FILB 2PLPA 3AEGB 1OQQA 3U4EG 4OW0A 2IGDA 3BVGA 2WXMA 1CJEA 1FM0D 2QILA 2V3PA 4IKGA 3MC0B 2QSDA 3PO0A 2H89B 2JZPA 4P6VF 2Z8LA 1L5PA 1ZOYB 1ESFA 2CJNA 3LB8C 5I4DA 4B0EA 1FCCC 4O1NA 1EWYC 2QJLA 1VZ6A 3O13A 2EKIA 3VR8B 1KLGD 2I38A 4RGNA 1FXIA 4KKJA 4IDIA 2WXHA 3R2TA 1XXGA 1L0YB 3GS2A 3MFGA 2JX5A 4RGMA 1FNVA 3NVWA 3R2IA 2DBYA 5EE3A 1E7PB 1A70A 1JWAD 4OZBA 3HVZA 3AE7B 3T3NA 4RFBA 4NJCA 1GOZA 1JW9D 1QOGA 5EE9A 2WQYB 2Y3AA 1MI0A 3C8YA 1NEKB 1SE4A 1SEBD 1KRHA 2PW9A 1ZE3D 3AEDB 4EE2A 2BB6A 2WXKA 1F0ZA 1L4ZB 1V1PA 2LHEA 2WDVB 4NZLB 3KWLA 5GXGB 3VRAB 1I4PA 4YSXB 5BMHA 1D6EC 3TEXA 3AEFB 2MJDA 1KH0A 1CK1A 5G5GA 4D2KA 1BXTA 1JRPA 5HFYA 1ENFA 4ZYSA 3L4PA 3MJ5A 2B76B 1VLBA 5C3JB 1I4QA 2VZKB 1MHXA 1C77A 2SEBD 1YQ4B 2WXQA 2K22A 3BK1A 3IAS1 3FAHA 4WURA 2MEKA 2QMTA 3DWGC 1V1OA 1FNUA 2IGHA 3I57A 1I4RA 1SSNA 4KGSA 2LUMA 2BBCA 2ACZB 1UGJA 2WXIA 3HRDD 1YQ3B 2ZW1A 3W5UB 4OZCA 1DOXA 3P63A 2HDEA 1HEZE 1XO3A 4YSYB 2BS4B 2IDYA 1DOIA 2LMCA 1T3QA 2X38A 4A90A 4JX1C 3RPFC 2L32A 3AV8A 3ZJTA 2EELA 2JYEA 3AB5A 3IXSA 3AECB 3GP7A 3B2GA 2BW2A 1C4PA 2CU3A 5BMGA 4RNAA 4GDLB 2G9HD 2M0AA 1WGKA 1MPEA 1FFUA 4KKIA 3RFZB 4MM3B 5C2TB 3FILA 1K53A 1WRIA 3J9CA 1F2RC 2OEDA 1ZP0B 2FUG1 5G5HA 4ZHPA 3ZJVA 1NYQA 1EWCA 1WXQA 2WXJA 2N0SB 1YJIA 1RYJA 3IAM1 1FXAA 1V97A 1E10A 3U7ZA 3AH7A 2YEPF 1F77A 1L6VA 1WSPA 2KAJA 5H8YE 2PKOA 2FE8A 5T8IA 2ON8A 2JQRB 4ARCA 1N5WA 1ZDXA 1NVID 2PMVA 1ZXHA 2WS3B 2DYMA 3MP9A 3W2DA 1QT9A 1J7AA 4KGRA 3ABVB 1QOFA 1K51A 1TZOA 1TYGB 3AE1B 1HQRD 1C79A 3VR9B 2PVOD 4LK0M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HRS A;  1JW9 D;  1QOG A;  2WP9 B;  5EE9 A;  2WQY B;  2QIE B;  4C7Y A;  4JWU C;  1NEK B;  1FIQ A;  2DWQ A;  3AE2 B;  2CJO A;  4YTN B;  1FO4 A;  1KRH A;  3B2F A;  3AED B;  1RM6 C;  1F0Z A;  2PVG C;  1IUE A;  2WDV B;  2W54 A;  4C7Z A;  3KWL A;  3P4R B;  5GXG B;  1KF6 B;  3VRA B;  3LXF A;  4YSX B;  1PFD A;  1DGJ A;  1N60 A;  3P4S B;  4WQM A;  3AEF B;  2MJD A;  1N62 A;  1TKE A;  1SIJ A;  5G5G A;  1E0Z A;  1I7H A;  3SFD B;  4US8 A;  1B9R A;  4N58 A;  1V8C A;  1JRP A;  4USA A;  3W9C B;  4YXD B;  2MJE A;  2W55 A;  1J7B A;  3L4P A;  4LTU A;  2BS2 B;  1UWM A;  3AE9 B;  1JQ4 A;  2B76 B;  1VLB A;  1QF6 A;  1XLP A;  5C3J B;  1WWT A;  1CZP A;  1VDV A;  3SFE B;  1E6E B;  1YQ4 B;  4ITK A;  1SB3 C;  1N61 A;  2K22 A;  2L52 A;  4WWM A;  3FAH A;  1RFK A;  3NVZ A;  1OFF A;  3NVV A;  1L6U A;  3P4P B;  3DWG C;  1ROE A;  4KX6 B;  2M19 A;  1JAL A;  1TKG A;  2BS3 B;  2MH7 A;  2Q5W D;  4YSZ B;  2ACZ B;  3HRD D;  1AWD A;  1PDX A;  1YQ3 B;  1KFY B;  2FBW B;  3W5U B;  1AYF A;  3AMZ A;  3NS1 A;  1DOX A;  3DWM A;  1QOA A;  1TJE A;  3P63 A;  1FRD A;  1OQR A;  3CIR B;  3CWI A;  1PUT A;  1YJJ A;  3ETR A;  1XO3 A;  4YTM B;  3AM9 A;  4YSY B;  4N59 A;  2BS4 B;  1E10 A;  3WCQ A;  3AE3 B;  1SF0 A;  1XLQ A;  1DOI A;  2WU2 B;  1T3Q A;  2Y5C A;  3AE5 B;  4JWS C;  2WDR B;  1N63 A;  3AV8 A;  4JX1 C;  2MJ3 A;  3RPF C;  2WU5 B;  3AB5 A;  3AN1 A;  1TKY A;  3AEC B;  3B2G A;  2HTM E;  3SR6 A;  3BII D;  3NVY A;  1FFV A;  2BT6 A;  4YT0 B;  1R7S A;  2CU3 A;  1NI3 A;  5AUI A;  1XLN A;  2K5P A;  4ZHO A;  1WGK A;  2W3R A;  2G1E A;  1J7C A;  1ZXI A;  3B9J A;  3P4Q B;  4A9A A;  5MPO A;  1E9M A;  1FFU A;  2LEK A;  5C2T B;  3AEG B;  1OQQ A;  1WRI A;  1WYG A;  2OHF A;  1DOY A;  4C80 A;  1ZP0 B;  5G5H A;  4ZHP A;  1NYQ A;  1JRO A;  1CJE A;  1FM0 D;  1QLB B;  1WXQ A;  2PIA A;  2M56 B;  1NYR A;  1GPX A;  2N0S B;  3P1M A;  5H92 C;  1YJI A;  3W5V B;  1L0V B;  1N5X A;  1JWB D;  3PO0 A;  4ZOH C;  2H89 B;  3AEA B;  1RYJ A;  1GAQ B;  1FXA A;  1XLO A;  1L5P A;  1V97 A;  4P6V F;  2WDQ B;  3AE4 B;  1FRR A;  2H88 B;  1ZOY B;  3AH7 A;  4US9 A;  1FMA D;  2CJN A;  2WLB A;  3LB8 C;  1RWS A;  1L6V A;  2KAJ A;  5EE1 A;  5H8Y E;  2PKO A;  3AEE B;  3HUI A;  1EWY C;  2E3T A;  1ZUD 2;  2QJL A;  1NEN B;  2EKI A;  2AX5 A;  3VR8 B;  2KMM A;  3VRB B;  2JQR B;  5EE0 A;  1N5W A;  1NVI D;  1FXI A;  3AE6 B;  4IDI A;  4YTP B;  1QOB A;  2WS3 B;  1VJK A;  2JX5 A;  3AE8 B;  5AUK A;  2L83 A;  3NVW A;  1QT9 A;  4FXC A;  1J7A A;  2DBY A;  3AEB B;  1E7P B;  1A70 A;  5EE3 A;  3ZYY X;  1JWA D;  3ABV B;  3EUB 2;  2K9X A;  1QOF A;  3FC4 A;  3AE1 B;  1TYG B;  3NRZ A;  4HRO A;  4N6E B;  3HVZ A;  3AE7 B;  3VR9 B;  2W3S A;  2PVO D; 
#chains in the Genus database with same CATH topology
 2D11 A;  4AJW A;  3Q69 A;  1TS4 A;  4JLC A;  1WGG A;  4IG7 B;  4HPP A;  4AS1 A;  2CS4 A;  1I42 A;  2Z0E B;  1DGJ A;  2MLB A;  1F52 A;  2V4I B;  4NAW B;  3ZQ4 A;  3A33 B;  3BVZ A;  4GXB A;  3PS6 A;  1J7B A;  1A5R A;  4MEM A;  4DXF A;  2V3N A;  1P1A A;  3M63 B;  2LJ5 A;  3N32 A;  2N9K A;  3A9J A;  1ZDV A;  2XNA C;  1YN3 A;  1SXT A;  1P7F A;  5D3D A;  3AMZ A;  5DCN A;  1OQR A;  4ZRP A;  5CHW A;  2HTH A;  2K8H A;  4MGY E;  3AE5 B;  4DHJ D;  4JWS C;  2LHD A;  2MJ3 A;  2D3B A;  1TKY A;  2LRW A;  3BWU D;  1FFV A;  1NI3 A;  1WGR A;  5L95 C;  1TS5 A;  2J53 A;  4LNF A;  4FJY A;  3P4Q B;  2XK5 B;  2LEK A;  2C7N B;  3DBL B;  4C80 A;  4ZRJ A;  4F1S A;  2PIA A;  1QLB B;  1NYR A;  1N5X A;  2ZNV B;  3ENE A;  1GAQ B;  5D3I B;  1FRR A;  2H88 B;  4KV2 A;  1FMA D;  3IBE A;  2KJ6 A;  5EE0 A;  2JU6 X;  1V49 A;  3AE8 B;  4ZRK A;  2HJ1 A;  5D7G A;  2LAS A;  3EUB 2;  3QAR A;  4HCP B;  1GUA B;  4YWG G;  5IAA C;  3R66 C;  2VZK D;  1TS2 A;  4M0W B;  4HJG E;  4HKZ E;  1C78 A;  2C7M B;  4YTN B;  2WXF A;  1JML A;  1STE A;  2VH1 A;  1M94 A;  1QKZ A;  3PSE B;  4G11 A;  1MFW A;  2R2Q A;  3DVN V;  1N62 A;  1VZ7 A;  2ZPN A;  4EKU A;  2R2O A;  1PGA A;  1KLV A;  2CR5 A;  2N9P C;  1E6E B;  4A8X C;  4CHK A;  4L23 A;  3VH4 B;  5LXH A;  3RT3 B;  2BS3 B;  3N20 C;  2WXR A;  1S3S G;  5HHD G;  2KK8 A;  1AYF A;  4TMA B;  1QOA A;  2CU1 A;  4XDC A;  3ZTD A;  4XWW A;  3QIJ A;  1E5W A;  4K7S A;  5CX3 A;  3H7P B;  1UF0 A;  2KWD A;  3AN1 A;  4PS8 A;  4RH6 A;  3QCA A;  3BZD B;  4HCN B;  1LQB A;  1PGX A;  3NZ3 A;  2BF8 B;  3WAN A;  2PPH A;  5BMI A;  2BYV E;  2BWE S;  1JRO A;  3M3J A;  1J0G A;  3OWE B;  2RGF A;  4HPM B;  2M56 B;  2WXO A;  3P1M A;  3N3K B;  4ZDV A;  1PGB A;  2JUO A;  5C1Z A;  2JWZ A;  3L54 A;  1IGC A;  3Q3O C;  3T3O A;  3BK2 A;  2E3T A;  2N9X A;  3DHI C;  1TY0 A;  4DDG D;  1K50 A;  3DBH I;  4FJZ A;  2L83 A;  4MH0 E;  3TEY A;  1TTN A;  2MBQ A;  2LGI A;  3NS8 A;  4HRO A;  1WX8 A;  2PTL A;  2GBM A;  5J17 A;  2WP9 B;  4WQO B;  1OEY J;  4HKQ A;  2QEJ C;  1L4D B;  2KOX A;  1IUE A;  3O65 B;  4HDO A;  3VAW A;  3HM6 X;  4MSQ B;  2J4X A;  1B9R A;  3H6N A;  1FD6 A;  2MJE A;  2C60 A;  4IOI E;  3EGR A;  1JWS D;  4CQN A;  3TJP A;  4A20 A;  2FID A;  4G0N B;  4WAA A;  4CO7 A;  1EU3 A;  4WWM A;  2I1J A;  2B3A A;  2MHJ A;  4PS7 A;  2DAF A;  4W9F A;  1LM8 B;  2NBW B;  4XGA B;  1NI2 A;  2O2V A;  1FPY A;  1QF6 A;  3LYY A;  5IO9 A;  4BVU C;  1UWX A;  2WXG A;  4GU2 A;  2BTE A;  4RCO A;  2N7J A;  2G45 B;  4JPS A;  1QIL A;  4IW0 A;  2DX5 B;  3WA0 A;  2BT6 A;  2YLM A;  1ET9 A;  1T0Q C;  2KDE B;  4W9E A;  2JZ3 B;  1SE2 A;  1J7C A;  2JT4 B;  1HZ6 A;  2PLP A;  3QJZ A;  1P0R A;  3DBH B;  2DZK A;  4JQW C;  3TL5 A;  3TIX A;  1E7U A;  2J7Q B;  1RFA A;  3PPA A;  2Z8L A;  2CJN A;  3ZTC A;  1GNU A;  1EWY C;  5FR6 A;  4S17 A;  4B9K A;  4KKJ A;  4IDI A;  5BO4 B;  4CYE A;  4HWI B;  4LCD E;  1JWA D;  4AOF A;  3AE7 B;  1XD3 B;  3B08 A;  3C8Y A;  4FJV B;  1SE4 A;  1SEB D;  4BZA A;  1KRH A;  4YL8 A;  2WXK A;  5GXG B;  5BMH A;  2MX2 A;  1WY8 A;  3ML9 A;  2BGF A;  3AEF B;  4M8M A;  5G5G A;  4HJK A;  4D2K A;  1JRP A;  1ENF A;  2HJ8 A;  3L4P A;  3MJ5 A;  3VHT C;  1LGR A;  1I4Q A;  1F1H A;  4ANX A;  2K22 A;  2K1F A;  3FAH A;  1ISN A;  4WUR A;  2FCM A;  3DWG C;  2IGH A;  1I4R A;  3QK0 A;  3A9K A;  2LUM A;  2WXI A;  2L7R A;  2ZEQ A;  3W5U B;  4OZC A;  1DOX A;  2KLG A;  2UU7 A;  4MDK E;  4YSY B;  2N1W A;  2X38 A;  3EHV A;  2EEL A;  3IXS A;  3GP7 A;  3GE8 C;  2DHZ A;  4HXD A;  4DHZ B;  2IO1 B;  2ZZP B;  2M0A A;  1MPE A;  4WWN A;  3V6E B;  1V81 A;  3RFZ B;  3FIL A;  1K53 A;  2GLS A;  4BBN F;  1F2R C;  2OED A;  4IUM B;  2FUG 1;  4ZHP A;  3DCG A;  1EWC A;  3VFK A;  3ZNI D;  4K3B A;  1IYF A;  2KC2 A;  2PKO A;  2FE8 A;  4NQL B;  5CHV C;  5IA7 A;  1N5W A;  4WJQ A;  1NVI D;  2PMV A;  3CF6 E;  3MC9 A;  1TYG B;  3QA8 A;  4XYC A;  2KDB A;  2MP2 B;  4LK0 M;  2JF5 A;  3ZLZ A;  2UWQ A;  1UNS A;  4Q2J A;  4REZ A;  3L08 A;  2N9L A;  2KJR A;  4UDU C;  1FCL A;  2MA9 B;  2GI9 A;  3ONS A;  2JXT A;  2Y5B B;  1I7H A;  4W9L A;  2QHO A;  4USA A;  4TUU A;  1I4X A;  4W9I A;  1VR9 A;  4W9C A;  3JSV B;  5E6O A;  1N61 A;  3FKY A;  4I6L B;  2LD9 A;  1L6U A;  3NVV A;  3NHE B;  1ROE A;  3ZW3 A;  3E56 A;  2E6X A;  2Q5W D;  2MH7 A;  4KIK B;  2K8B A;  4G50 A;  1FRD A;  2NTS A;  4I6N B;  1PUT A;  1EF5 A;  3NJT A;  3ZO5 B;  4MGZ E;  1YX5 B;  2LFI A;  4WJO A;  4NAM A;  4F7Z A;  3AE3 B;  2KAC A;  2KFK B;  2KTR B;  5AZG A;  3AU4 A;  5LNK 1;  1N63 A;  3A1Q B;  4OVZ A;  4WIP A;  1GB4 A;  4P16 A;  2FNJ B;  2G4S A;  1G6J A;  1R7S A;  2JZZ A;  3N30 A;  1ZGU B;  1Z2M A;  4GDL A;  4IM3 A;  1YN4 A;  3WAM A;  3ZXR A;  2L3Z A;  3ALB A;  1SJH D;  4II3 B;  4AP4 C;  2Z0D B;  5C23 A;  1Q0W B;  3A4R A;  2ZJD A;  4GOC A;  5H92 C;  5TR5 A;  1XT9 B;  1YX6 B;  3I3T B;  3M95 A;  1JRU A;  2MBB B;  2V4L A;  2ZW0 A;  3AEE B;  3TBL D;  3SEB A;  3VRB B;  2KQ7 A;  5D94 A;  2RDG A;  2AQ1 B;  4JGH B;  2RMM A;  3S2A A;  1WM3 A;  1VZ8 A;  4K1R B;  4TQ0 A;  1B1Z A;  1CQV A;  3NRZ A;  4BKS A;  2KNB A;  3ECI A;  4ASW C;  3OJ3 A;  2QIE B;  2KJH B;  2TSS A;  4JWU C;  3AE2 B;  3B1L X;  3VDZ A;  1EM7 A;  1UEL A;  1V86 A;  3Q8A A;  3KLS X;  3UI3 A;  4J3O D;  2ZNV C;  4XX5 A;  3P4S B;  1KOT A;  1YN5 A;  2BYT A;  4US8 A;  3I9V 1;  1WJU A;  4NAW A;  2KO3 A;  3ZVV A;  4KZC A;  5LLI A;  2NR2 A;  4DBG A;  3TUO A;  1I4H A;  4M02 A;  3NY5 A;  4IC7 B;  2V1Y A;  2L0F A;  4ZYN A;  1JAL A;  2DYB A;  4JL9 A;  5L83 A;  1PDX A;  3NS1 A;  1K52 A;  3IT6 B;  3AM9 A;  1I4G A;  1UBI A;  3N1X C;  3DDC B;  2INP E;  4AJY B;  2J42 A;  2NPT B;  4XE0 A;  1Y8R C;  1C9F A;  4DDI D;  1YMH E;  2W3R A;  1UUP A;  1ZXI A;  2RR9 A;  3B9J A;  4M8N A;  4FBJ B;  1E9M A;  5DPW A;  1AW7 A;  2XK5 A;  2BQQ A;  4BKS D;  1WYG A;  1F9J A;  2MBE A;  2DAJ A;  2LVP A;  2NCN A;  2MCN B;  1WR6 E;  3RI7 C;  2A5U A;  4ZOH C;  2SAK A;  3GB1 A;  2WDQ B;  3AE4 B;  1IPG A;  4HK2 A;  3DPD A;  1FXT B;  2LVQ A;  1YD8 U;  5AUK A;  3AXC A;  3PRE A;  3X23 A;  3Q3N C;  2K9X A;  3VTV A;  2N9E B;  4RGO S;  4W9G A;  2K25 A;  4KSL C;  1C4A A;  1T0S C;  1WMH B;  3N1Z C;  3ML8 A;  2KQS A;  1EU4 A;  3UGB B;  2YVC A;  4K7U A;  1FIQ A;  4M0W A;  3SDL C;  3B2F A;  4KVG B;  3HM3 A;  1WF9 A;  2PVG C;  4MT5 A;  1YIW A;  1SIJ A;  1V6E A;  3Q8E A;  3SFD B;  1VCB A;  4N58 A;  1WGY A;  4H2A A;  2R61 A;  1PQS A;  3HHM A;  4LTU A;  2KN4 A;  5DPS A;  3WIM A;  4DXA B;  2M1M A;  1WXS A;  5IOI A;  5HG2 A;  4NNJ B;  1E8X A;  1RFK A;  3N9Y C;  2JWU A;  2L76 A;  4BAX A;  3PHX B;  4B6W A;  1P98 A;  1TY2 A;  2K0P A;  1HZ5 A;  5FKA C;  3CWI A;  3ETR A;  2ZCC A;  1MHH E;  1T0Y A;  1QQR A;  5BYS A;  5IP4 D;  2WU5 B;  4C56 C;  2KC1 A;  3Q3M C;  3H7P A;  1UD7 A;  1V2Y A;  2L0T A;  1Y56 A;  4OVU A;  2BPS A;  2XEW A;  3R3M A;  2PEA A;  4OVV A;  5J18 A;  4NJ6 A;  4OW0 A;  3UQB A;  2WXM A;  5KHO A;  1FM0 D;  2QIL A;  2D3A A;  2V3P A;  1WRD B;  4IKG A;  4RM9 A;  3PO0 A;  2H89 B;  2DEN B;  4K3C A;  1OGW A;  3PTF C;  2JZP A;  1Q1O A;  1L5P A;  1OQY A;  2M4N A;  4DHZ E;  2V9H A;  4B0E A;  1FCC C;  2QJL A;  1EUV B;  2WX0 A;  3VR8 B;  2I38 A;  2IO0 B;  5AZH A;  2KD0 A;  4NQK E;  3QWZ B;  2WXH A;  2MBO A;  2N7D A;  3R2T A;  1L0Y B;  3GS2 A;  2JX5 A;  5IKC M;  1A70 A;  4OZB A;  3RNC C;  3OG5 A;  2DZI A;  2LUE A;  3HVZ A;  2GMI C;  1WJN A;  3T3N A;  2JXX A;  1MI0 A;  2RSU A;  4W9K A;  4FUL A;  1V5T A;  3AED B;  2OOB B;  1J8C A;  1F0Z A;  2WDV B;  3RNG C;  3DHG C;  4NZL B;  3KWL A;  4C4V B;  4FLH A;  1D6E C;  4W9H A;  2MJD A;  1KH0 A;  1BXT A;  5HFY A;  4ZYS A;  2B76 B;  5C3J B;  1C77 A;  2SEB D;  2QMT A;  3I57 A;  2LVO A;  3DVN U;  3RUI B;  2Z59 B;  3HRD D;  1UGJ A;  1YQ3 B;  2ZW1 A;  4RMA A;  2HDE A;  2IDY A;  1DOI A;  1T3Q A;  3AI5 A;  3RPF C;  4K7W A;  4EOY A;  3B2G A;  2V3S A;  2BW2 A;  1C4P A;  3P2B A;  5BMG A;  3HK0 A;  4KKI A;  1V80 A;  2KMC A;  4MM3 B;  3J9C A;  2L00 B;  1L7Y A;  1ZP0 B;  5G5H A;  4MGK E;  2WXJ A;  1YJ1 A;  1BT0 A;  1I35 A;  2G3Q B;  2KMA A;  3AH7 A;  2YEP F;  3GZN I;  1F77 A;  1WSP A;  2KAJ A;  4URK A;  3V60 A;  4ANU A;  1ZXH A;  2DYM A;  3MP9 A;  3W2D A;  2J0M A;  1J7A A;  2G4D B;  2AYO B;  3VUX A;  1HQR D;  1C3T A;  4ICV A;  2KLC A;  2YEP B;  2D07 B;  2CJO A;  3H7S A;  1XCT L;  1X1M A;  1RM6 C;  1EO6 A;  3LXF A;  2J0K A;  1K8R B;  1ZKH A;  2WDT B;  4AWJ A;  1SGH A;  1UWM A;  2OJW A;  2WWZ A;  4BBN C;  3VUY A;  3RNB C;  1WWT A;  2L52 A;  2D3G A;  4IWO A;  1UH6 A;  2WNM A;  2KDF B;  4QAY A;  1E8W A;  3MTN B;  3VQI A;  1IBX B;  4GLS C;  3RD2 A;  1YQB A;  1KLU D;  2O6V B;  1AWD A;  5E6P A;  3CIR B;  3BIN A;  2N1V A;  4N59 A;  2X8X X;  4JIO U;  2Y5C A;  2RDB C;  3PZ7 A;  1L2N A;  4XC2 A;  2KYW A;  3VUW A;  2DYO A;  2LRU A;  3GZN B;  1HE8 A;  2K3U A;  3JVZ X;  4EEW A;  2WYQ A;  3EA6 A;  3PZD A;  4GDK B;  2GBR A;  1P7E A;  5HI1 A;  4LDT B;  2LI5 A;  1R4N I;  2ZPY A;  4II2 B;  3HVD A;  4MGI E;  2KVR A;  1GPX A;  4LNN A;  2BB5 A;  2GBK A;  1JWB D;  4LNI A;  3K9P B;  3URY A;  2J52 A;  1FNW A;  5E6N A;  2GRI A;  1WGD A;  3KYD D;  1NEN B;  2KTF A;  4BKG A;  3AE6 B;  3DVG X;  4P1C C;  3C19 A;  1QOB A;  2M17 A;  1VJK A;  4FXC A;  4IWP A;  4N6E B;  2W82 A;  4WJP A;  3PZ8 A;  3PGE A;  4MJS B;  3R7Q A;  2WXP A;  4M01 A;  1C76 A;  2BKR B;  1MVK A;  2MP2 A;  2AWT A;  1E7V A;  2IPK D;  5TSS A;  1GB1 A;  1E8Y A;  3L10 B;  4XWT A;  1HTO A;  1N60 A;  2RDH A;  4PYZ A;  2GBN A;  3VTW A;  4N9F 4;  2KWV B;  3PVL A;  4WWO A;  2ASQ A;  1C4C A;  2AL3 A;  2LXC A;  2BS2 B;  1R4M I;  3UIO B;  2CHX A;  3ZIM A;  2M8S A;  1XLP A;  2LWP A;  4W9J A;  2IND C;  4FHJ A;  3JSV A;  4BOS C;  1TZ1 A;  2KX3 A;  1Q5W B;  1YNT E;  5AEK B;  1KTK A;  3NVZ A;  1T6B X;  1TIF A;  2FCQ A;  5BYQ A;  3V05 A;  4TSS A;  4B95 A;  3PRP B;  1KFY B;  1XF5 L;  3DVG Y;  4KIK A;  2IGG A;  3AU5 A;  3T9L A;  4YTM B;  1IGD A;  1R4N B;  1AN8 A;  2WDR B;  2KFK A;  2KTR A;  4R3D A;  2EMS A;  3A1Q A;  3IG3 A;  3BII D;  2IJ0 A;  2FCN A;  2BVC A;  2G1E A;  2NTT A;  3PLU A;  1D5X C;  3LDZ E;  3H8H A;  2LXA A;  3VH3 B;  3PLV A;  5FR3 A;  3RNF C;  2D10 A;  2LJI A;  3X0W A;  3Q8B A;  2KQ4 X;  4X57 B;  1WYW B;  4US9 A;  5EE1 A;  1TBE A;  4A3P A;  2AX5 A;  2VRR B;  4LJP B;  2PE6 B;  1S1Q B;  4A6Q A;  2DLB A;  4JE3 B;  4EZK A;  3QX1 A;  2W3S A;  1R4M B;  3D32 A;  4LJO B;  1WGH A;  3RUL A;  5AZF A;  4ZRQ A;  1FO4 A;  1V1P B;  2IY1 B;  3LJ3 A;  1FEH A;  1KM7 A;  4PT5 A;  2V0G A;  5CTR C;  1KF6 B;  3UQA A;  4WQM A;  5G55 A;  3SD5 A;  4MEL A;  2ONQ A;  3QAQ A;  1V8C A;  5E6J A;  5EDS A;  2RPV A;  4NJ7 A;  3BVM A;  2XN9 C;  3RMK C;  2L8J A;  2JRH A;  4M00 A;  1GJZ A;  2K8C A;  1PYW D;  3PRZ A;  3Q8F A;  2MBH A;  3R8B A;  2ICI A;  3NUH B;  4GIV A;  1QZE A;  3CSF A;  2HTM E;  5KHQ A;  4IWQ A;  3WAP A;  3KUD B;  2NPT A;  4NY0 A;  2MW5 A;  3B0A A;  3L16 A;  3AUL A;  4A9A A;  1BUI C;  3SU8 X;  3IHP C;  2K39 A;  3U4E G;  3RZF A;  3L17 A;  2LGD A;  4ANV A;  1GC7 A;  2XBB C;  4DHJ B;  1ZOY B;  3LB8 C;  1J19 A;  4O1N A;  3O13 A;  1VZ6 A;  2EKI A;  1KLG D;  2DNF A;  3C0R B;  1XXG A;  4RGM A;  1FNV A;  1LXD A;  3R2I A;  2J0J A;  2MSE D;  3RN9 C;  1MJD A;  4TV3 A;  2KFJ A;  4J6I A;  4RFB A;  4NJC A;  1GOZ A;  1JW9 D;  1QOG A;  1H8C A;  4I6P A;  2WQY B;  2Y3A A;  5EE9 A;  3V61 A;  1WMH A;  4EZJ A;  1WH3 A;  3WAO A;  4EE2 A;  5JHB A;  4PS3 A;  3VVW B;  1L4Z B;  2LHE A;  4W9D A;  3QQ8 B;  1SE9 A;  3Q14 C;  2WGS A;  2KHW B;  3DHH C;  2INC C;  1U4A A;  3ZRF A;  1VLB A;  2VZK B;  3VXW A;  1YQ4 B;  3BK1 A;  3A9J B;  4MSM B;  1WJ4 A;  2IYD B;  2QDF A;  4WJN A;  4DWF A;  3GOE A;  1FNU A;  2DZM A;  3PT2 B;  3UIP B;  2K6D B;  2BBC A;  2ACZ B;  1T0R C;  3Q2A C;  2LGS A;  3P63 A;  1XO3 A;  1WI0 A;  2LMC A;  1V9J A;  3I63 C;  2L32 A;  3ZJT A;  3AEC B;  2IY0 B;  1WX9 A;  2G9H D;  1WR1 A;  1WGK A;  2OJR A;  2KZR A;  3H1U A;  1E90 A;  2JVC A;  1D3Z A;  5C2T B;  4GGQ A;  1WRI A;  3GE3 C;  3ZJV A;  1NYQ A;  1UGM A;  1OTR B;  3IAM 1;  1V97 A;  3R7R A;  3U7Z A;  3RNA C;  5H8Y E;  2JQR B;  2CHZ A;  4ARC A;  1WZ3 A;  3OLM D;  1GG3 A;  2GBJ A;  4XZ4 A;  1TZO A;  3AE1 B;  2FCS A;  1C79 A;  2REX A;  3VR9 B;  2QCZ A;  4XDD A;  4E3C A;  4C7Y A;  4RF1 A;  1SE3 A;  2DWQ A;  3APD A;  4KDL B;  3CST A;  4C7Z A;  3MC8 A;  2IZV B;  4KGT A;  3NG0 A;  4ANW A;  4C4V A;  3NZS A;  3ZDT A;  1E0Z A;  4E71 A;  2KX0 A;  4YXD B;  2I2Y A;  2AL6 A;  2D5G A;  3DBR I;  4FN2 A;  3AE9 B;  4ARI A;  3PHW B;  5DPR A;  1SBB B;  2WXL A;  4ITK A;  3U30 A;  3ZXV A;  1SB3 C;  2GOW A;  1OFF A;  4HEA 1;  1ZPS A;  1WFY A;  4ZRI A;  3JW0 X;  2FBW B;  3PV1 A;  4WWP A;  1L0X B;  1D5Z C;  1ET6 A;  4LNK A;  2LZ6 A;  4G3X B;  2W9N A;  4S0R A;  1HXY D;  2I1K A;  2KDM A;  2EMT A;  2A4Z A;  1WJ6 A;  3L0W B;  1XLN A;  2D3C A;  4ZHO A;  2BKF A;  4LLG M;  1JCK B;  5JHA A;  1WIA A;  4DQO C;  3RZW C;  2OHF A;  1DOY A;  4MM3 A;  2IBI B;  4L1B A;  2D2Q A;  4WAF A;  2NMQ A;  2C9W B;  3W5V B;  1VRA B;  3E9S A;  3ZUN A;  3IFW B;  4YSZ B;  3VTU A;  1YOV B;  1RWS A;  2CKH B;  1NBF C;  4YTP B;  1N6Z A;  1RAX A;  4K81 A;  4F8C B;  4WH4 A;  2GB1 A;  3DBR B;  3U7D A;  1WE6 A;  4PYU A;  2BYE A;  4MH8 A;  4E74 A;  3NZU A;  1WXM A;  2W54 A;  2JRI B;  1UZX B;  2L1A A;  3KYC D;  3EFC A;  4LNO A;  2FAZ A;  1AAR A;  4A3O A;  3U2S C;  1TGZ B;  3MHZ A;  3W9C B;  3Q8C A;  3TSS A;  1OEY A;  1JQ4 A;  2RD0 A;  4RF0 A;  3ZGZ A;  3APC A;  2NVU I;  3EEC A;  2C5L C;  2JYT A;  4KX6 B;  1D5M C;  4OZA A;  3IVF A;  3EC8 A;  4AQ7 A;  2M0X A;  1TKG A;  2O2V B;  1IBX A;  2RPQ A;  2ZCB A;  2O6V A;  3DWM A;  1TJE A;  1WXV A;  5GMV A;  3RNE C;  1BML C;  3NOB A;  3W1S C;  2L05 A;  3WCQ A;  4HVB A;  2WU2 B;  3CMM B;  3KUZ A;  2KKC A;  2LGX A;  2AQ3 B;  1V5O A;  4OHJ A;  2LGY A;  3V6C B;  1T5X D;  4B0M A;  2FIF A;  2IO2 B;  4GDK A;  2MRP A;  2EKE C;  1Z5S B;  3V3X A;  5J2R A;  1WXA A;  1L0V B;  4A55 A;  3AEA B;  1P3Q U;  1XLO A;  4MAC A;  1JWM D;  3OJ4 B;  2WLB A;  3I5J C;  2ZVN A;  2AQ2 B;  3EFU A;  3HUI A;  1ZUD 2;  3H9D A;  1LO5 D;  2KMM A;  4TQ1 A;  4ICU A;  2Y5P A;  2PJH A;  3MHS D;  2KWC A;  3APF A;  3AEB B;  3KQ4 A;  3ZYY X;  3TEW A;  3JYU A;  3T8M A;  3FC4 A;  4RGT A;  5BYR A;  1ACC A;  3K9O B;  1E8Z A;  3KUC B;  4HRS A;  1Q10 A;  1XEE A;  4MJS A;  1M4V A;  1MG4 A;  1HA5 A;  3IT4 B;  2KAN A;  2JSV X;  3TEZ A;  4GSW A;  4KSK C;  4P7I A;  3P4R B;  2KXJ A;  1JWU D;  1PFD A;  1XCQ L;  1DYQ A;  2O6V D;  3W1S A;  3BY4 B;  4C00 A;  1LFD A;  4HPL B;  1TKE A;  1TS3 A;  3SHQ A;  2JY6 A;  1P9D U;  5FK9 C;  2W55 A;  4BOZ B;  2NBU A;  1H4R A;  5DPT A;  2DZJ A;  4L2Y A;  3W1Y A;  2WXN A;  1CZP A;  1VDV A;  1D4B A;  2N4F A;  3SFE B;  4GMV A;  3Q3J A;  2MWS B;  1NDD A;  2C7H A;  3P4P B;  4DXG A;  2M19 A;  3A9K B;  1SJE D;  5HKH A;  2INN E;  1KJT A;  1GC6 A;  3ZJU A;  2BYF A;  3P42 A;  3BYY B;  3DQV A;  4LDT D;  4BFR A;  1YJJ A;  3U52 E;  3BYT B;  1WE7 A;  1SF0 A;  1XLQ A;  4EZL A;  3RCZ A;  3QC8 B;  2UYZ B;  3U8Z A;  1F2R I;  3KWV A;  3SR6 A;  3NVY A;  4YT0 B;  2FUH B;  2KVZ A;  5AUI A;  2K5P A;  5JXV A;  2WX1 A;  5JZE B;  1MG8 A;  5MPO A;  3FIL B;  4ACF A;  3KVF B;  3AEG B;  1OQQ A;  2BWF A;  3Q6B A;  1ZW7 A;  2IGD A;  3BVG A;  1CJE A;  3Q3F A;  3DBS A;  2NBV B;  3ZRC A;  2AEH A;  1HTQ A;  3TMP B;  3MC0 B;  2QSD A;  1UBQ A;  1WX7 A;  4P6V F;  1ESF A;  3TCA A;  3ZDM C;  5I4D A;  4RGN A;  1FXI A;  3MFG A;  5D2M B;  3NVW A;  1XQQ A;  4HLE A;  2DBY A;  5EE3 A;  1E7P B;  4TKN A;  4RM8 A;  5D6J B;  1NEK B;  5IN7 A;  2PW9 A;  1ZE3 D;  2BB6 A;  4GB9 A;  3ZNG C;  1V1P A;  1CMX B;  2KWU B;  3VRA B;  2IO3 B;  1I4P A;  4YSX B;  1WZ0 A;  3TEX A;  4IM2 A;  1CK1 A;  2KT7 A;  3A4S C;  2QC8 A;  2MQJ A;  3OAW A;  3PRM B;  1MHX A;  4AUQ C;  1RRB A;  2WXQ A;  3IAS 1;  1WM2 A;  4IM0 A;  2MEK A;  3HIZ A;  5CHF A;  1V1O A;  1SSN A;  4KGS A;  3UIN B;  5JH5 C;  4FAD A;  4FA6 A;  3DOW A;  2HE7 A;  2K6Q A;  4PK1 A;  2N7E A;  3L13 A;  4EFO A;  1HEZ E;  2BS4 B;  4A90 A;  4GN1 A;  4KDI C;  1VD2 A;  4JX1 C;  3AV8 A;  3V62 A;  2JYE A;  3AB5 A;  1EF1 A;  3WAL A;  4BKT A;  2CU3 A;  2HD5 B;  4RNA A;  4GDL B;  1TT5 B;  3KW5 B;  1FFU A;  2KN5 A;  4KZ0 A;  1RLF A;  3N1Y C;  3UF8 A;  2PE9 A;  4FHK A;  3ZKJ C;  4EUT A;  2CHW A;  5G2N A;  1WXQ A;  4P1B C;  3KH0 A;  2N0S B;  5LXI B;  1YJI A;  3M62 B;  3ZNH B;  3ZNZ B;  1RYJ A;  1FXA A;  1E10 A;  1SIF A;  1IP9 A;  1L6V A;  2NS5 A;  2JPH A;  2KDI A;  5T8I A;  4HDQ A;  2ON8 A;  1C1Y B;  1ZDX A;  2ZVO A;  3MJW A;  3DBL I;  2WHI A;  2WS3 B;  3RYT A;  1QT9 A;  4DK5 A;  4KGR A;  2VH2 A;  3ABV B;  3QHT A;  1QOF A;  1K51 A;  4NPN A;  2PVO D; 
#chains in the Genus database with same CATH homology
 4XDD A;  2YEP B;  3Q69 A;  4C7Y A;  1TS4 A;  4RF1 A;  1SE3 A;  2DWQ A;  2CJO A;  1UNS A;  4Q2J A;  4REZ A;  1XCT L;  2N9L A;  1RM6 C;  4UDU C;  4C7Z A;  4AS1 A;  4KGT A;  3LXF A;  1FCL A;  1DGJ A;  2GI9 A;  2JXT A;  2V4I B;  1E0Z A;  4NAW B;  1I7H A;  3ZQ4 A;  3BVZ A;  4USA A;  4YXD B;  2I2Y A;  1I4X A;  1J7B A;  2D5G A;  1UWM A;  3AE9 B;  4ARI A;  1VR9 A;  4DXF A;  1WWT A;  2V3N A;  1SBB B;  2WXL A;  4ITK A;  1SB3 C;  1N61 A;  2L52 A;  1OFF A;  2N9K A;  3NVV A;  1L6U A;  1ZDV A;  2WNM A;  1ROE A;  3E56 A;  4HEA 1;  3VQI A;  1IBX B;  2XNA C;  4GLS C;  1ZPS A;  2E6X A;  1YN3 A;  2MH7 A;  2Q5W D;  1KLU D;  1SXT A;  1AWD A;  2FBW B;  1P7F A;  5D3D A;  3AMZ A;  1L0X B;  1FRD A;  1D5Z C;  1OQR A;  2NTS A;  1PUT A;  1ET6 A;  3CIR B;  4ZRP A;  4N59 A;  2LFI A;  4NAM A;  3AE3 B;  2KAC A;  2Y5C A;  3AE5 B;  4JWS C;  5LNK 1;  1N63 A;  2LHD A;  2MJ3 A;  1HXY D;  3PZ7 A;  4OVZ A;  4WIP A;  1TKY A;  1GB4 A;  4P16 A;  2KDM A;  3BWU D;  1FFV A;  1R7S A;  2DYO A;  1NI3 A;  1XLN A;  2K3U A;  4ZHO A;  2J53 A;  1TS5 A;  4LLG M;  3P4Q B;  1JCK B;  3EA6 A;  1YN4 A;  2LEK A;  4GDK B;  4DQO C;  1DOY A;  2OHF A;  1P7E A;  5HI1 A;  4C80 A;  1SJH D;  4L1B A;  2PIA A;  1QLB B;  4WAF A;  2NMQ A;  1NYR A;  3HVD A;  1GPX A;  2BB5 A;  5H92 C;  3W5V B;  1N5X A;  1JWB D;  1VRA B;  1GAQ B;  3E9S A;  5D3I B;  4YSZ B;  1FRR A;  2H88 B;  1FMA D;  3URY A;  1RWS A;  2J52 A;  1FNW A;  2ZW0 A;  3AEE B;  2GRI A;  1NEN B;  3SEB A;  3VRB B;  5EE0 A;  3AE6 B;  2JU6 X;  2RDG A;  4YTP B;  2AQ1 B;  1QOB A;  2RMM A;  1VJK A;  3AE8 B;  1VZ8 A;  4FXC A;  4TQ0 A;  5D7G A;  1B1Z A;  3EUB 2;  1CQV A;  3NRZ A;  4N6E B;  2W82 A;  4YWG G;  3PZ8 A;  2WXP A;  2VZK D;  2GB1 A;  4WH4 A;  1TS2 A;  1C76 A;  4HJG E;  1MVK A;  2QIE B;  4HKZ E;  1C78 A;  2TSS A;  3AE2 B;  4JWU C;  4MH8 A;  4YTN B;  2IPK D;  1JML A;  1STE A;  2WXF A;  1EM7 A;  5TSS A;  1GB1 A;  2W54 A;  1QKZ A;  3Q8A A;  3KLS X;  3UI3 A;  4XWT A;  2L1A A;  4J3O D;  1N60 A;  3P4S B;  2RDH A;  1YN5 A;  1N62 A;  3U2S C;  2BYT A;  4US8 A;  3I9V 1;  1VZ7 A;  3MHZ A;  3W9C B;  3Q8C A;  1C4C A;  3TSS A;  1PGA A;  2BS2 B;  3TUO A;  1JQ4 A;  1I4H A;  1XLP A;  4RF0 A;  3ZGZ A;  1E6E B;  1YNT E;  4A8X C;  1KTK A;  3NVZ A;  1T6B X;  2JYT A;  4KX6 B;  1D5M C;  5BYQ A;  3V05 A;  4OZA A;  4TSS A;  4L23 A;  4AQ7 A;  1JAL A;  1TKG A;  2BS3 B;  2WXR A;  1IBX A;  1PDX A;  1KFY B;  1XF5 L;  5HHD G;  1AYF A;  3NS1 A;  4TMA B;  3DWM A;  1QOA A;  1TJE A;  1K52 A;  2IGG A;  3IT6 B;  4YTM B;  3AM9 A;  1IGD A;  4XDC A;  1BML C;  4XWW A;  3WCQ A;  2WU2 B;  1AN8 A;  1I4G A;  2WDR B;  2KWD A;  3AN1 A;  2INP E;  4R3D A;  2J42 A;  4RH6 A;  4XE0 A;  3BII D;  2IJ0 A;  1C9F A;  1YMH E;  3BZD B;  2AQ3 B;  2W3R A;  1UUP A;  2G1E A;  1ZXI A;  4OHJ A;  3B9J A;  1PGX A;  3NZ3 A;  1T5X D;  1E9M A;  4B0M A;  1AW7 A;  2NTT A;  1WYG A;  1D5X C;  5BMI A;  3H8H A;  1JRO A;  3V3X A;  3OWE B;  2M56 B;  2WXO A;  3P1M A;  1L0V B;  4ZOH C;  4A55 A;  5FR3 A;  3AEA B;  1PGB A;  1XLO A;  2SAK A;  2LJI A;  2WDQ B;  3AE4 B;  2KQ4 X;  3GB1 A;  3Q8B A;  4MAC A;  1JWM D;  1IGC A;  2WLB A;  4US9 A;  2AQ2 B;  5EE1 A;  3T3O A;  3BK2 A;  3HUI A;  2E3T A;  1ZUD 2;  2AX5 A;  1LO5 D;  2KMM A;  4TQ1 A;  1TY0 A;  2Y5P A;  1K50 A;  5AUK A;  2L83 A;  3TEY A;  4A6Q A;  3KQ4 A;  2DLB A;  3AEB B;  3TEW A;  4JE3 B;  2LGI A;  3ZYY X;  2K9X A;  4HRO A;  3FC4 A;  4RGT A;  4RGO S;  5BYR A;  1ACC A;  2W3S A;  1C4A A;  2PTL A;  4HRS A;  1Q10 A;  1XEE A;  2WP9 B;  1M4V A;  1EU4 A;  4HKQ A;  1FIQ A;  2QEJ C;  4M0W A;  1HA5 A;  3IT4 B;  1L4D B;  4ZRQ A;  1V1P B;  2JSV X;  3B2F A;  1FO4 A;  3TEZ A;  1FEH A;  4PT5 A;  2PVG C;  2V0G A;  1IUE A;  3P4R B;  1KF6 B;  1JWU D;  1PFD A;  1XCQ L;  1DYQ A;  4MT5 A;  3W1S A;  4WQM A;  1TKE A;  1SIJ A;  3Q8E A;  3SFD B;  1TS3 A;  2ONQ A;  2J4X A;  1B9R A;  4N58 A;  1V8C A;  4H2A A;  2R61 A;  5FK9 C;  1FD6 A;  2MJE A;  2W55 A;  5E6J A;  4IOI E;  4LTU A;  2RPV A;  3EGR A;  3BVM A;  2KN4 A;  4L2Y A;  1JWS D;  2XN9 C;  2WXN A;  4CQN A;  1CZP A;  1VDV A;  1D4B A;  3SFE B;  5HG2 A;  1EU3 A;  4WWM A;  1RFK A;  3N9Y C;  3P4P B;  4DXG A;  2JWU A;  2M19 A;  1SJE D;  2INN E;  1TY2 A;  2K0P A;  3ZJU A;  1HZ5 A;  5FKA C;  1PYW D;  3P42 A;  3Q8F A;  3BYY B;  1QF6 A;  3LYY A;  3CWI A;  1YJJ A;  1UWX A;  2WXG A;  3ETR A;  3R8B A;  2ICI A;  3NUH B;  3U52 E;  3BYT B;  4RCO A;  1MHH E;  2BTE A;  1SF0 A;  1XLQ A;  1QQR A;  5BYS A;  2N7J A;  4JPS A;  2WU5 B;  1QIL A;  4C56 C;  2HTM E;  1F2R I;  3KWV A;  3SR6 A;  3NVY A;  2BT6 A;  4YT0 B;  1ET9 A;  5AUI A;  2K5P A;  1SE2 A;  1J7C A;  1Y56 A;  5JXV A;  4A9A A;  5MPO A;  1BUI C;  1HZ6 A;  3FIL B;  2PLP A;  3AEG B;  1OQQ A;  3U4E G;  4OW0 A;  2IGD A;  3BVG A;  2WXM A;  1CJE A;  1FM0 D;  2QIL A;  2V3P A;  4IKG A;  3MC0 B;  2QSD A;  3PO0 A;  2H89 B;  2JZP A;  4P6V F;  2Z8L A;  1L5P A;  1ZOY B;  1ESF A;  2CJN A;  3LB8 C;  5I4D A;  4B0E A;  1FCC C;  4O1N A;  1EWY C;  2QJL A;  1VZ6 A;  3O13 A;  2EKI A;  3VR8 B;  1KLG D;  2I38 A;  4RGN A;  1FXI A;  4KKJ A;  4IDI A;  2WXH A;  3R2T A;  1XXG A;  1L0Y B;  3GS2 A;  3MFG A;  2JX5 A;  4RGM A;  1FNV A;  3NVW A;  3R2I A;  2DBY A;  5EE3 A;  1E7P B;  1A70 A;  1JWA D;  4OZB A;  3HVZ A;  3AE7 B;  3T3N A;  4RFB A;  4NJC A;  1GOZ A;  1JW9 D;  1QOG A;  5EE9 A;  2WQY B;  2Y3A A;  1MI0 A;  3C8Y A;  1NEK B;  1SE4 A;  1SEB D;  1KRH A;  2PW9 A;  1ZE3 D;  3AED B;  4EE2 A;  2BB6 A;  2WXK A;  1F0Z A;  1L4Z B;  1V1P A;  2LHE A;  2WDV B;  4NZL B;  3KWL A;  5GXG B;  3VRA B;  1I4P A;  4YSX B;  5BMH A;  1D6E C;  3TEX A;  3AEF B;  2MJD A;  1KH0 A;  1CK1 A;  5G5G A;  4D2K A;  1BXT A;  1JRP A;  5HFY A;  1ENF A;  4ZYS A;  3L4P A;  3MJ5 A;  2B76 B;  1VLB A;  5C3J B;  1I4Q A;  2VZK B;  1MHX A;  1C77 A;  2SEB D;  1YQ4 B;  2WXQ A;  2K22 A;  3BK1 A;  3IAS 1;  3FAH A;  4WUR A;  2MEK A;  2QMT A;  3DWG C;  1V1O A;  1FNU A;  2IGH A;  3I57 A;  1I4R A;  1SSN A;  4KGS A;  2LUM A;  2BBC A;  2ACZ B;  1UGJ A;  2WXI A;  3HRD D;  1YQ3 B;  2ZW1 A;  3W5U B;  4OZC A;  1DOX A;  3P63 A;  2HDE A;  1HEZ E;  1XO3 A;  4YSY B;  2BS4 B;  2IDY A;  1DOI A;  2LMC A;  1T3Q A;  2X38 A;  4A90 A;  4JX1 C;  3RPF C;  2L32 A;  3AV8 A;  3ZJT A;  2EEL A;  2JYE A;  3AB5 A;  3IXS A;  3AEC B;  3GP7 A;  3B2G A;  2BW2 A;  1C4P A;  2CU3 A;  5BMG A;  4RNA A;  4GDL B;  2G9H D;  2M0A A;  1WGK A;  1MPE A;  1FFU A;  4KKI A;  3RFZ B;  4MM3 B;  5C2T B;  3FIL A;  1K53 A;  1WRI A;  3J9C A;  1F2R C;  2OED A;  1ZP0 B;  2FUG 1;  5G5H A;  4ZHP A;  3ZJV A;  1NYQ A;  1EWC A;  1WXQ A;  2WXJ A;  2N0S B;  1YJI A;  1RYJ A;  3IAM 1;  1FXA A;  1V97 A;  1E10 A;  3U7Z A;  3AH7 A;  2YEP F;  1F77 A;  1L6V A;  1WSP A;  2KAJ A;  5H8Y E;  2PKO A;  2FE8 A;  5T8I A;  2ON8 A;  2JQR B;  4ARC A;  1N5W A;  1ZDX A;  1NVI D;  2PMV A;  1ZXH A;  2WS3 B;  2DYM A;  3MP9 A;  3W2D A;  1QT9 A;  1J7A A;  4KGR A;  3ABV B;  1QOF A;  1K51 A;  1TZO A;  1TYG B;  3AE1 B;  1HQR D;  1C79 A;  3VR9 B;  2PVO D;  4LK0 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...