2N0SB

Haddock model of ferredoxin and [fefe] hydrogenase complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
94
structure length
94
Chain Sequence
YKVTLKTPSGDKTIECPADTYILDAAEEAGLDLPYSCRAGACSSCAGKVAAGTVDQSDQSFLDDAQMGNGFVLTCVAYPTSDCTIQTHQEEALY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fe-hydrogenase
publication title Structural Insight into the Complex of Ferredoxin and [FeFe] Hydrogenase from Chlamydomonas reinhardtii.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Oxidoreductase
total genus 19
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2n0sB00
1XLOA 3HUIA 1E0ZA 3P4PB 1OQRA 1RFKA 1JWAD 1N63A 1TYGB 2PVGC 4JWUC 3P4RB 3WCQA 3AH7A 1J7BA 1QOAA 1WRIA 1J7AA 1VDVA 3ETRA 1DOYA 4P6VF 2LEKA 2N0SB 3AV8A 3RPFC 1L6UA 2KAJA 1L5PA 3SFDB 3CIRB 1F0ZA 2L52A 3SFEB 1N5WA 1VJKA 3VRAB 4JWSC 1E7PB 4C7ZA 2ACZB 3AE8B 3CWIA 1OQQA 1XLPA 1QT9A 3LXFA 1GPXA 5G5HA 4YSXB 1V97A 2W3SA 1QOFA 1XLQA 3AEBB 5EE0A 1NEKB 1N62A 3ZYYX 1YJJA 2K22A 2W55A 2WDRB 2PKOA 1RYJA 1TKGA 1L0VB 3B2FA 1RWSA 3NVVA 4WWMA 5H92C 5C3JB 1NYQA 1XO3A 2WU5B 1JQ4A 3KWLA 2QIEB 3NVYA 1IUEA 1E6EB 1JWBD 1N61A 1OFFA 1R7SA 3AECB 3AE1B 3NS1A 3P1MA 3AEEB 1PDXA 3P4SB 4ZHPA 3VRBB 4USAA 3L4PA 3AE2B 4FXCA 1FMAD 1WYGA 3AE9B 1I7HA 1TKYA 3HRDD 1JROA 4JX1C 2KMMA 1FFVA 2H88B 1VLBA 1PUTA 3VR8B 2WU2B 2WS3B 4WQMA 5EE9A 1QF6A 2MJDA 1B9RA 1DGJA 1E10A 5C2TB 2L83A 2WDVB 1PFDA 3NVWA 1N60A 4C7YA 3NVZA 2JX5A 3AEAB 4ITKA 1KRHA 4YT0B 2WDQB 1FXIA 1FO4A 2MJ3A 3P63A 4YTPB 3AE6B 2MJEA 2BS4B 3BIID 2QJLA 4N59A 4N6EB 5H8YE 2EKIA 2OHFA 1FIQA 2BT6A 2FBWB 2DWQA 1AYFA 2B76B 2G1EA 4YXDB 3VR9B 2K5PA 3AEFB 1NENB 5EE1A 1NVID 1RM6C 2HTME 2BS2B 1JRPA 1JW9D 1WXQA 1CZPA 1ROEA 1YQ3B 2JQRB 2M19A 2M56B 3AE4B 3W5UB 2CU3A 1SF0A 2PIAA 1KFYB 3AEGB 1V8CA 1SIJA 2Q5WD 2WLBA 1YJIA 3B9JA 1EWYC 1T3QA 4LTUA 4A9AA 1ZP0B 2WQYB 1FM0D 5GXGB 3FC4A 4KX6B 5MPOA 3AMZA 1JALA 4N58A 1XLNA 4YTNB 2CJNA 3AE3B 1NYRA 5AUKA 1FRRA 2E3TA 2BS3B 3W5VB 4YSYB 1YQ4B 1L6VA 1NI3A 3B2GA 2H89B 2WP9B 1CJEA 4YSZB 4HRSA 1UWMA 2Y5CA 3LB8C 5AUIA 3NRZA 4US8A 4US9A 2W54A 3DWMA 4ZOHC 4HROA 2W3RA 1N5XA 3SR6A 2K9XA 1KF6B 3AB5A 1J7CA 1TJEA 1ZOYB 4ZHOA 4IDIA 5G5GA 3HVZA 1WWTA 1ZUD2 3W9CB 1ZXIA 4C80A 2DBYA 1A70A 1SB3C 1E9MA 1GAQB 3ABVB 3AE5B 3AEDB 2PVOD 3P4QB 3PO0A 1FXAA 1QOBA 2CJOA 1DOXA 1DOIA 1AWDA 5EE3A 2AX5A 3DWGC 1FFUA 4YTMB 1FRDA 3FAHA 3AM9A 3EUB2 1WGKA 3AN1A 2MH7A 1QOGA 3AE7B 1TKEA 1QLBB
chains in the Genus database with same CATH superfamily
3CF6E 1KOTA 4HWIB 2KDMA 1RLFA 1L0XB 1WZ3A 3PSEB 2KFJA 3AH7A 4M8MA 3RPFC 3R2IA 3BVMA 3HIZA 4K7UA 3Q8CA 3IT6B 1M94A 3ZDMC 5HKHA 2LXCA 1R4NI 1MPEA 2W55A 1RYJA 1KH0A 4TKNA 1ESFA 4XC2A 4RGMA 1M4VA 3VTVA 3TMPB 3WALA 3OAWA 4BOZB 1LM8B 1RRBA 5CHFA 1T0RC 4KDLB 1T5XD 1L4DB 1I4HA 2WS3B 2QILA 2WXHA 5JH5C 1WIAA 4ITKA 4MJSB 4CYEA 1KRHA 4YTPB 2BWES 4ZRQA 1TS3A 4URKA 2KVZA 3CSTA 4NNJB 4N59A 5TR5A 2WXIA 4GGQA 2EKIA 3OWEB 4NJCA 3EECA 1QZEA 1TS5A 4M00A 2VZKD 3RYTA 4LTUA 1IGDA 2WQYB 1YD8U 1FM0D 2RPVA 2GLSA 2WYQA 1UBIA 3NZ3A 1UNSA 2MBQA 5HHDG 1T0QC 5CTRC 3VDZA 5IP4D 3RNCC 3ZQ4A 1WSPA 1A70A 2R2QA 2FCNA 1FXAA 1J8CA 3VAWA 2NPTB 1GOZA 3FAHA 4KIKA 1HTOA 4EFOA 3VTUA 2L32A 3B08A 3S2AA 2NTTA 3QX1A 4JWUC 1UGJA 1TY0A 3VTWA 4UDUC 3M95A 5FR6A 2CS4A 2L52A 3VRAB 2ZW0A 4ZRIA 3LXFA 2IJ0A 4WH4A 1MHXA 4ARCA 3NVVA 1RWSA 2QIEB 2N4FA 3PZDA 5D3DA 4BBNC 3ZDTA 2W9NA 4FJYA 2J0KA 2IYDB 5BYRA 4ZYSA 1I4QA 4WQMA 2RDHA 2NBWB 2E6XA 1NI2A 4LK0M 4KV2A 3AEAB 3UINB 2N9XA 2PE6B 4HK2A 2MJ3A 5D2MB 1PYWD 1L2NA 2LUEA 2WXJA 1V5TA 1C79A 3P2BA 4G0NB 2C5LC 1I4RA 1TIFA 3W5UB 2JWZA 1A5RA 2WDTB 1JCKB 3ONSA 2JUOA 2DYOA 2LUMA 1KTKA 1KJTA 1C3TA 3B9JA 4H2AA 3ZIMA 2JRIB 3V05A 3URYA 2NMQA 2E3TA 4GU2A 4YSYB 1L0YB 3RN9C 3A9KB 1IP9A 3V61A 3JSVA 2K6QA 1FNVA 2KO3A 4ZHOA 3PRMB 1VRAB 3ZXVA 2RGFA 3OG5A 3TEXA 2JPHA 3AXCA 1Q0WB 1C4CA 2EMTA 1E9MA 3ABVB 3DBSA 2N1VA 1TTNA 3PO0A 1HQRD 4XZ4A 1FFUA 2RDBC 1FRDA 4MELA 2J0MA 2ZVNA 3L16A 1EU4A 4F1SA 1JMLA 4XYCA 3WCQA 1TYGB 2PVGC 1JWSD 3FKYA 1DOYA 3N1XC 2N0SB 2G4SA 2LVQA 2RD0A 4GSWA 4BZAA 4JWSC 2CHZA 3CWIA 3DOWA 1PGBA 1XQQA 1WM3A 2B3AA 5I4DA 4P1CC 1Q1OA 3RNBC 5H92C 2D5GA 3PREA 2V3NA 1C76A 3V3XA 1V80A 1JWBD 3V60A 1IBXA 2NTSA 3SEBA 1HEZE 1T6BX 1WH3A 3PHXB 2KMMA 1VLBA 3ZJVA 1E10A 1I35A 4S17A 3IAS1 1R4MB 1PFDA 4C7YA 4G11A 3NUHB 1FO4A 3MC0B 2G3QB 4TV3A 3RZFA 4XWWA 1X1MA 2DNFA 5EE1A 4M0WB 3PZ7A 4WJOA 2WLBA 2WXGA 1EWYC 1WGYA 4L23A 4TSSA 4FN2A 4K3CA 2OOBB 2KLCA 3AE3B 4PS7A 2GB1A 3DVNU 2BYTA 3B2GA 4AOFA 2R61A 1UWMA 3MHZA 3GB1A 5BMHA 2PTLA 4HROA 5L83A 2NS5A 4YL8A 4RH6A 3PRPB 1T0YA 4DXFA 3RD2A 3UGBB 4C80A 5FK9C 4G3XB 1OEYA 3QCAA 3N1YC 1MG4A 4XX5A 1BT0A 1PGAA 4NY0A 3E9SA 1LQBA 1WE6A 2IGHA 2O6VA 1MVKA 1J0GA 1I4PA 3SFDB 1ZPSA 5JZEB 4AS1A 2KX0A 1P1AA 4NAWB 3RZWC 3H7SA 3QK0A 4TUUA 3B2FA 2TSSA 3BK1A 1NYQA 2C7MB 3RUIB 1VD2A 1DYQA 3AECB 2WHIA 2CU1A 5AZGA 5IAAC 4ZRJA 2ZPYA 2H88B 1IPGA 1F77A 3RNEC 2ZW1A 3DVGY 2BPSA 4GIVA 1WFYA 3AE6B 1WM2A 1SGHA 4N6EB 2LVPA 2B76B 2N7JA 4FBJB 2DENB 1UUPA 3X23A 2GBMA 2INDC 1GC7A 4D2KA 1Y8RC 1ZP0B 5MPOA 5BMGA 2KDBA 3UQBA 4GOCA 1IBXB 2KXJA 1V81A 4XWTA 3UIPB 1OEYJ 2FAZA 3VUYA 3TL5A 3U8ZA 1HZ6A 3W1SC 4LDTB 2W54A 1V9JA 3SR6A 1SJED 2YEPB 1XEEA 2M17A 1ZOYB 2MRPA 3Q8AA 4FLHA 1AN8A 4BVUC 1ZUD2 4WAAA 4L1BA 2FCSA 4S0RA 5IN7A 5DCNA 3EFCA 1YX6B 3AE5B 5DPTA 2KC2A 3UIOB 2KACA 4YTMB 4HPLB 4I6LB 4XDDA 3V62A 2JZZA 5TSSA 3P4PB 5D3IB 2WXKA 3IAM1 5D7GA 3MC8A 1ACCA 3T8MA 2WXNA 1L5PA 4P16A 4HKQA 2L8JA 2LRUA 2ICIA 2IY1B 3M62B 1K53A 3PHWB 2KN4A 3AE8B 4B9KA 1QKZA 1GPXA 3FILB 4KVGB 1WX8A 3PZ8A 3AEBB 2WXOA 2IDYA 4AJYB 4OZCA 1WGHA 4WWMA 1UGMA 4LNOA 2KWUB 2L1AA 4RGOS 3P1MA 1OFFA 3NS1A 1WMHA 3P4SB 2KYWA 2K8HA 4FXCA 1WE7A 4MGZE 2KTRB 2MQJA 1ZDVA 3NZUA 1GG3A 3HM6X 1TGZB 1WRDB 3DVGX 1I42A 2OHFA 2G1EA 3WAMA 2FUHB 4NPNA 2V4IB 4IOIE 2CU3A 4LNIA 2JZ3B 2XEWA 5G55A 3QAQA 1WGDA 1SIJA 1WR1A 3QARA 2AQ2B 2SEBD 2KJRA 3APCA 3RULA 2GBKA 4DXAB 2UWQA 4NAMA 2YVCA 3QWZB 2OEDA 3N1ZC 3AU4A 1SXTA 3KYDD 1KF6B 4OHJA 1F1HA 1S1QB 1HZ5A 4MSQB 1UZXB 2INCC 1B1ZA 4BOSC 4WWOA 3H6NA 3NG0A 3J9CA 5LXIB 2LVOA 4MGKE 4DWFA 3MFGA 1SE2A 1V2YA 4W9CA 1IYFA 4RFBA 1TZOA 1SE9A 2JF5A 2W3SA 4BKSD 1WXVA 4AP4C 3JW0X 1KM7A 3BWUD 1XO3A 1D5ZC 2G4DB 2BYEA 1R4MI 2HTHA 3Q8BA 3CSFA 2JT4B 3RMKC 4B0MA 2V3PA 3TEWA 1TKYA 2MBBB 2DZIA 5BO4B 1FFVA 3L10B 4LNKA 4DXGA 2VH1A 4HLEA 2KDIA 3KUCB 3H7PB 4B6WA 4X57B 1L7YA 1UBQA 4F8CB 4DDID 2M19A 4GN1A 3GZNI 3HVDA 2FUG1 3A9KA 3X0WA 3PV1A 4LJOB 4W9KA 1PQSA 2JVCA 1WMHB 4JE3B 4YTNB 1SSNA 1SJHD 3A33B 2AYOB 2FE8A 2AQ3B 3W1SA 2LD9A 2BVCA 3ECIA 3SU8X 2V9HA 1XXGA 2WXLA 3DCGA 2N7EA 3ZNZB 1ZW7A 2KANA 1SB3C 2L0TA 3TUOA 5J18A 1ET9A 2BF8B 3EUB2 1QOGA 2XK5A 1QLBB 4ANUA 3EGRA 4IG7B 1UD7A 3N20C 2L0FA 4HVBA 3Q3NC 4PK1A 4KSLC 3A9JA 1XLPA 3WIMA 2HE7A 2N9EB 1V1PA 2MLBA 4HJKA 1NEKB 3JVZX 1K52A 4BKGA 4G50A 4K81A 3QQ8B 2K0PA 1OTRB 3A1QB 4FJZA 4ZRKA 2IY0B 1CK1A 2DZJA 2L7RA 3NY5A 2DAJA 3U7ZA 2BKFA 2ONQA 3MJ5A 2FCQA 4A8XC 2LGYA 4M0WA 3KH0A 2KQ7A 2MBEA 3IFWB 4WJQA 2RR9A 1FNUA 1RAXA 4FJVB 4OVUA 4YXDB 3VR9B 2M56B 5CX3A 4K7SA 2G45B 2VZKB 1V8CA 1S3SG 2N1WA 4KX6B 2EELA 3B0AA 1GUAB 3A4RA 4PT5A 2Y5CA 3K9OB 2BQQA 2IGGA 1V6EA 2KK8A 2JYEA 5JHAA 4US9A 2LI5A 3R66C 1N5XA 4IUMB 2KDFB 3ZJTA 4RF1A 3QC8B 3KWVA 4ZDVA 4EOYA 3DQVA 3EFUA 1EUVB 4IKGA 2DX5B 2DYMA 5EE3A 2IBIB 5LNK1 1V86A 4A9AA 4OW0A 3L17A 3IT4B 1RFKA 4MM3A 1EF1A 4NAWA 3ETRA 1P98A 1J7AA 3O65B 5LLIA 2KAJA 3BINA 4WQOB 2I1JA 1N5WA 1VJKA 2KNBA 3PS6A 4A3OA 1OQQA 3WAPA 5AEKB 4LNFA 4KZCA 4W9JA 2L3ZA 1XD3B 4DHJD 1ISNA 1WJ4A 1YJJA 2PKOA 4IC7B 1V5OA 4MACA 4DHZB 2LZ6A 4MEMA 3KWLA 2IZVB 3BY4B 2M0XA 1VCBA 4HCNB 3L4PA 5L95C 4HEA1 1JRUA 2PW9A 4E3CA 4JX1C 2XK5B 2LHDA 5BYQA 4MGYE 3HHMA 3GE8C 3PLUA 3VR8B 1QF6A 4HDOA 2K25A 2WXFA 1E8XA 1C78A 2SAKA 3NS8A 4O1NA 2MJEA 3A9JB 3C0RB 4M02A 4MH8A 1AYFA 5HG2A 1F2RC 1XCQL 1ROEA 3PRZA 1V1PB 3OJ3A 3VXWA 3AEGB 3M3JA 2J0JA 4JLCA 4ICUA 3DBRI 4KGTA 1NYRA 1WI0A 2J42A 3Q2AC 5GMVA 4W9FA 3H1UA 1J7CA 3NHEB 3HVZA 1ZXIA 3VUWA 2KVRA 1WXSA 2MP2A 1D5MC 3AEDB 2LMCA 3EHVA 3M63B 3ZRCA 3KVFB 4CO7A 2JXXA 1E0ZA 4LJPB 3FILA 2BW2A 1VDVA 1L6UA 1R4NB 2PJHA 1E8ZA 2XNAC 1F0ZA 2LHEA 2N9PC 3DHGC 2K22A 4Q2JA 2L00B 1WGGA 4II3B 2RPQA 1K51A 2KTRA 1RFAA 4JQWC 1IUEA 1N61A 2ZVOA 1PDXA 2DAFA 2BYFA 1TZ1A 3VRBB 4MSMB 3APDA 2ZZPB 3TCAA 4IWPA 1GC6A 4EEWA 4QAYA 3Q69A 5AZFA 1SE3A 1MHHE 1H8CA 1WXAA 2INPE 1TS2A 4IWQA 4ARIA 4MM3B 1KLUD 3NVWA 4NJ6A 2ZEQA 4YT0B 3SD5A 2JRHA 4LDTD 2IO1B 3RI7C 2ZNVB 3SHQA 2BKRB 3GP7A 1HE8A 2KHWB 2D2QA 2JQRB 4PS3A 2OJRA 2Q5WD 3I63C 5GXGB 2LGIA 3I3TB 1JALA 3IG3A 4DBGA 5AUKA 1Q5WB 4TQ1A 3TSSA 3ZNID 4OZAA 3VH3B 4CQNA 4WJPA 1YQ4B 4NZLB 2LWPA 1E90A 5J2RA 3H9DA 2Z59B 3R7RA 4ZOHC 5KHOA 1TJEA 2VRRB 2VH2A 1YN4A 4MDKE 4NQLB 1WR6E 2CR5A 2KWCA 1QOBA 1EO6A 5FR3A 3U2SC 2BBCA 1U4AA 2PMVA 2MW5A 4ACFA 4MT5A 3ALBA 3AE7B 3W1YA 4IM0A 3Q3JA 2JU6X 4C4VA 4P6VF 2QCZA 3NZSA 4KGRA 3SFEB 3Q3OC 4ICVA 2O6VD 4AWJA 5IKCM 1V97A 2GOWA 4GXBA 1LXDA 2WXMA 1L0VB 3LYYA 2MP2B 1SBBB 4KSKC 3GOEA 3O13A 4GMVA 2O2VA 3AE9B 1I7HA 2L05A 3DDCB 5IOIA 1F52A 2RDGA 3H7PA 2D10A 3BVGA 3R2TA 1NBFC 4C00A 1BUIC 2KWVB 4BKTA 5H8YE 1D3ZA 1WJ6A 1FCCC 1NENB 2GRIA 4A3PA 1G6JA 4M01A 1CZPA 2KD0A 3OJ4B 1SF0A 2MWSB 1C77A 4MH0E 5BMIA 4HPPA 3KW5B 4ASWC 2BS3B 1Z5SB 3MTNB 4WAFA 1FXTB 5J17A 3LB8C 2KX3A 4US8A 4WWPA 1WY8A 2KJHB 2W3RA 5CHWA 2NVUI 3N30A 2AL3A 2K9XA 2KFKA 5G5GA 3Q3FA 4OVZA 1E7UA 1GJZA 2WXRA 3U7DA 1P3QU 1DOXA 2LASA 1IGCA 2KC1A 4B95A 1OGWA 4K3BA 3UF8A 1GB4A 2GMIC 4B0EA 3A4SC 2UYZB 4ANXA 1J7BA 5E6OA 3IXSA 4IW0A 3ZO5B 3PPAA 3T9LA 4E71A 3HM3A 1FEHA 1E7PB 3D32A 2NCNA 4WWNA 3A1QA 2R2OA 2W82A 2V3SA 1JQ4A 4MGIE 3QHTA 3AE1B 1QILA 2QHOA 3L0WB 4WJNA 3VUXA 2DHZA 1P7EA 1WYGA 3ZJUA 2ZNVC 1JROA 4KKJA 2KKCA 5C2TB 3NVZA 2JX5A 2WDQB 4C4VB 3RNAC 2JY6A 4HJGE 4FADA 4TMAB 1HTQA 3BYTB 2BGFA 2I38A 1RM6C 3TEZA 1JRPA 3HK0A 4J3OD 1YQ3B 5C23A 4F7ZA 2D07B 2RSUA 4GLSC 2C9WB 1LGRA 5BYSA 3QJZA 2WGSA 2KMCA 2GBJA 2D11A 2A4ZA 4N58A 1AARA 4KZ0A 5HI1A 3UI3A 3DHIC 4A6QA 2O2VB 3I9V1 2GI9A 4HCPB 1FCLA 3NRZA 1WYWB 3Q8FA 2FCMA 2MHJA 1MJDA 3W2DA 2KLGA 3T3NA 3E56A 2LGDA 4K7WA 4TQ0A 2WX0A 1WWTA 4USAA 2BWFA 2MSED 1DOIA 1Z2MA 3DVNV 2L76A 3BYYB 3AM9A 3ZNHB 1TKEA 3QA8A 1BMLC 2MBHA 4M8NA 2CKHB 2LXAA 1YN5A 1QOAA 3CMMB 5E6NA 3N3KB 2LEKA 3H8HA 3MHSD 2KQSA 1Y56A 4YSXB 1QOFA 3LJ3A 2DYBA 3V6EB 2C7HA 1SIFA 2KFKB 1WX7A 3P42A 2I2YA 3I5JC 2WNMA 1E6EB 1P0RA 3N32A 1XF5L 2AL6A 2MBOA 3R3MA 1LO5D 2WU2B 1FNWA 3TBLD 4RGNA 1B9RA 1YMHE 4EE2A 1N60A 2J7QB 2QMTA 4W9DA 1FXIA 3P63A 1J19A 4EZJA 3T3OA 2BS4B 3BIID 2FBWB 1YQBA 2DWQA 2WXPA 4R3DA 1UELA 2ZPNA 4BAXA 4XE0A 1JW9D 5D94A 4GDKB 1KFYB 3I57A 1VZ7A 1CMXB 2JWUA 2V0GA 3DBLB 3PGEA 3FC4A 4N9F4 1Q10A 2CHXA 1E7VA 1WZ0A 1STEA 2LJIA 4YSZB 2WP9B 1CJEA 4HRSA 2LFIA 1KLGD 3ZVVA 1ET6A 5AUIA 2YLMA 4IM2A 2KN5A 1TS4A 3BZDB 2HJ1A 4IDIA 2QEJC 2MX2A 3B1LX 2JXTA 3W9CB 2BYVE 2JZPA 3IHPC 1GAQB 4ANWA 4A55A 4BFRA 4KDIC 3AN1A 2K1FA 4FHKA 3KLSX 1I4XA 5FKAC 2NBUA 1N63A 3DPDA 1PGXA 1WX9A 2Z0EB 1C4AA 3DHHC 4OZBA 4L2YA 4C7ZA 3MP9A 3AULA 1QT9A 4EKUA 1XLQA 3GS2A 3L13A 5EE0A 4OVVA 4CHKA 1EU3A 4W9HA 2QDFA 3ZXRA 2WU5B 1V1OA 2ON8A 1SE4A 4HPMB 2KWDA 2LRWA 3QIJA 1XT9B 3NJTA 1FMAD 1YOVB 1PUTA 4AUQC 2J4XA 4JPSA 3R7QA 1LFDA 2L83A 1D5XC 2WX1A 2GBRA 3ZUNA 3ZW3A 3PTFC 3LDZE 1QQRA 5AZHA 2J52A 4C56C 2IPKD 2K5PA 2M0AA 3AEFB 1NVID 3VFKA 2HTME 5IA7A 3PLVA 1YN3A 4KKIA 3DBHB 1YJIA 2YEPF 2IGDA 2KOXA 2HDEA 1C1YB 2CJNA 3K9PB 3RNGC 4RM9A 3WANA 3L08A 1T0SC 4ZRPA 2LJ5A 4XGAB 2AQ1B 3KQ4A 2PLPA 3ML8A 2KJ6A 4LLGM 5C1ZA 2D3AA 2FNJB 3OLMD 2DBYA 3IVFA 1WXMA 2MCNB 1TT5B 1FD6A 3WA0A 1AWDA 2WWZA 2QC8A 1JWMD 4J6IA 1WGKA 3NOBA 4EZKA 3HUIA 3WAOA 1E8WA 2V4LA 4IWOA 1ZGUB 4DDGD 3P4RB 4KIKB 3UQAA 2N7DA 1HXYD 2AWTA 2Y5PA 5HFYA 5CHVC 5DPWA 2KMAA 4LNNA 5JHBA 1K8RB 1VZ8A 2K8BA 1N62A 4W9EA 2WDRB 4GB9A 4DHJB 1TKGA 3U30A 1EM7A 2Y5BB 4FA6A 1R7SA 1UH6A 3L54A 3VHTC 4ZHPA 2K8CA 2D3BA 5JXVA 2QSDA 1E8YA 5D6JB 3HRDD 2KQ4X 5EE9A 1WF9A 2WDVB 2INNE 1NDDA 3GZNB 2QJLA 2M8SA 1FIQA 2K39A 2FIDA 4DQOC 4BBNF 1UWXA 3U52E 3AE4B 3VH4B 4FULA 2ZJDA 2PIAA 1E5WA 1ZE3D 2M1MA 3GE3C 2D3CA 1GB1A 1WJNA 2ZCBA 4HDQA 1EF5A 3Q14C 2I1KA 1L6VA 1NI3A 1F9JA 5E6PA 3ZKJC 3V6CB 2CHWA 1F2RI 4W9LA 4I6PA 4EZLA 3SDLC 1YX5B 3ZTDA 2KZRA 4LCDE 4ANVA 3IBEA 4XDCA 5EDSA 3JSVB 3RT3B 4AQ7A 2Y3AA 2AX5A 2MH7A 2ASQA 4A20A 1V49A 1XLOA 3BK2A 2BTEA 1C9FA 2UU7A 2KTFA 1D4BA 3MC9A 1C4PA 1VR9A 3PVLA 3N9YC 3AV8A 4P1BC 2X38A 3CIRB 5DPSA 1VZ6A 4EUTA 3U4EG 3ML9A 1ENFA 4RNAA 3ZGZA 1WJUA 1EWCA 2LGXA 3ZYYX 4REZA 3JYUA 5IO9A 4GDLA 3AEEB 4P7IA 2EKEC 3TEYA 2NBVB 3BVZA 3PT2B 1DGJA 4PYUA 4RF0A 1KLVA 1P9DU 3DBLI 4RMAA 2JSVX 3R8BA 2BB5A 4RM8A 3C19A 1GNUA 1WXQA 3Q8EA 2J53A 2MEKA 3ZLZA 4PYZA 1SEBD 2XBBC 3AMZA 3VQIA 1FRRA 3W5VB 4A90A 1AW7A 2N9LA 3RCZA 5G2NA 2NR2A 2H89B 4DK5A 3DWMA 3ZTCA 1TBEA 2HD5B 2N9KA 5T8IA 4FHJA 2WXQA 3AB5A 3MJWA 4RCOA 3ENEA 4IM3A 3ZNGC 3P4QB 1K50A 2CJOA 1ZKHA 2D3GA 4KGSA 3TIXA 2EMSA 4DHZE 3EC8A 3C8YA 4JL9A 1OQRA 1P7FA 2XN9C 2Z8LA 1JWAD 1WGRA 4MJSA 1WRIA 1OQYA 2Z0DB 2K6DB 2X8XX 4BKSA 4K1RB 4PS8A 2V1YA 2GBNA 1ZXHA 2FIFA 2ACZB 2O6VB 1XCTL 2ZCCA 5G5HA 1MG8A 5DPRA 2C7NB 3KYCD 5C3JB 5KHQA 1YJ1A 4I6NB 3NVYA 1CQVA 1MFWA 2DZKA 2PE9A 2IO0B 3ZRFA 1TY2A 3AE2B 2REXA 2RMMA 2PPHA 2HJ8A 2MJDA 3Q3MC 4HXDA 3DBHI 4GDKA 4JIOU 4HKZE 3EA6A 2MA9B 4RGTA 4AJWA 2JYTA 1H4RA 2BT6A 2AEHA 2IO2B 3DBRB 2NPTA 2BS2B 1I4GA 2IO3B 3VVWB 2PEAA 1L4ZB 1T3QA 2K3UA 3AI5A 4NJ7A 4E74A 2BB6A 4GDLB 2C60A 2G9HD 1FPYA 4YWGG 1XLNA 2DLBA 2LGSA 5LXHA 1JWUD 1YIWA 3TJPA 1HA5A 5E6JA 3RNFC 1YNTE 1D6EC 4WIPA 3Q6BA 1BXTA 2KDEB 1ZDXA 1N6ZA 4JGHB 2A5UA 3KUZA 4W9IA 4W9GA 4NQKE 2KT7A 2DZMA 4WURA 4II2B 3RFZB 3AU5A 2OJWA 2PVOD 2M4NA 1UF0A 3DWGC 3KUDB 1MI0A 4ZYNA 3APFA
chains in the Genus database with same CATH topology
1I4XA 5FKAC 3P4PB 5TSSA 1E0ZA 5D3IB 2KDMA 2WXKA 1L0XB 1N63A 3IAM1 3FILA 2BW2A 3AH7A 5D7GA 1PGXA 1VDVA 1ACCA 3RPFC 1L6UA 2WXNA 3R2IA 1L5PA 2XNAC 1C4AA 4P16A 4HKQA 1F0ZA 2ICIA 3BVMA 4OZBA 4L2YA 3Q8CA 1K53A 4C7ZA 3IT6B 3MP9A 2KN4A 3AE8B 1QT9A 1QKZA 1GPXA 3FILB 1XLQA 2LHEA 3AEBB 3GS2A 2WXOA 3PZ8A 1MPEA 2IDYA 5EE0A 2W55A 2K22A 4Q2JA 4OZCA 1K51A 1RYJA 1EU3A 4WWMA 1KH0A 2WU5B 1V1OA 2ON8A 2L1AA 1IUEA 1N61A 4RGOS 3P1MA 1OFFA 1ESFA 3NS1A 3P4SB 1M4VA 1SE4A 4RGMA 1PDXA 2KWDA 3VRBB 4FXCA 1FMAD 3Q69A 1PUTA 1T5XD 1SE3A 1MHHE 1L4DB 1I4HA 1ZDVA 2INPE 2J4XA 2QILA 2WS3B 1TS2A 2WXHA 4JPSA 4MM3B 1KLUD 2L83A 3NVWA 1D5XC 4ARIA 4YT0B 4ITKA 1KRHA 4YTPB 4ZRQA 1TS3A 4N59A 2WXIA 1QQRA 2EKIA 3GP7A 2OHFA 3OWEB 2J52A 2G1EA 4C56C 4NJCA 2IPKD 2K5PA 2M0AA 3AEFB 1NVID 2JQRB 2HTME 2V4IB 4IOIE 1TS5A 2CU3A 2VZKD 1YN3A 4KKIA 2Q5WD 1SIJA 4LTUA 1YJIA 1IGDA 2AQ2B 2SEBD 2YEPF 2IGDA 2WQYB 1FM0D 5GXGB 2LGIA 1JALA 2HDEA 2CJNA 5AUKA 2RPVA 4TQ1A 3TSSA 4OZAA 4CQNA 1YQ4B 4NAMA 4ZRPA 4NZLB 3NZ3A 2AQ1B 2OEDA 4ZOHC 3KQ4A 1UNSA 2PLPA 1SXTA 5HHDG 1KF6B 4OHJA 1TJEA 4LLGM 1YN4A 1HZ5A 3ZQ4A 1WSPA 2DBYA 1A70A 1B1ZA 1FD6A 1FXAA 1QOBA 5FR3A 3U2SC 1AWDA 2BBCA 2PMVA 1GOZA 1JWMD 3FAHA 1WGKA 4MT5A 3J9CA 3AE7B 3HUIA 2L32A 2NTTA 4JWUC 1UGJA 1TY0A 1SE2A 2JU6X 3MFGA 3P4RB 4UDUC 4P6VF 4KGRA 1HXYD 2L52A 3SFEB 2Y5PA 3VRAB 5HFYA 2ZW0A 4RFBA 1TZOA 3LXFA 2IJ0A 4WH4A 1V97A 2W3SA 1VZ8A 1N62A 1MHXA 2WDRB 4ARCA 2WXMA 1TKGA 1L0VB 3NVVA 1RWSA 3BWUD 3LYYA 1XO3A 1D5ZC 2QIEB 1EM7A 1R7SA 5D3DA 3Q8BA 4ZHPA 1SBBB 4B0MA 2V3PA 5JXVA 2QSDA 3O13A 3TEWA 3AE9B 1I7HA 1TKYA 3HRDD 2KQ4X 1FFVA 2RDGA 4ZYSA 5BYRA 1I4QA 4WQMA 2RDHA 5EE9A 2E6XA 3BVGA 3R2TA 2WDVB 2INNE 4LK0M 3AEAB 4DXGA 2MJ3A 1PYWD 2WXJA 1BUIC 2QJLA 1C79A 5H8YE 1FIQA 4DQOC 1UWXA 1FCCC 3U52E 1I4RA 1NENB 2GRIA 2M19A 3AE4B 1CZPA 3W5UB 1SF0A 3HVDA 1JCKB 2PIAA 2DYOA 2LUMA 1KTKA 1ZE3D 1C77A 2FUG1 3B9JA 4H2AA 5BMIA 3V05A 1GB1A 3URYA 4JE3B 2NMQA 4YTNB 2E3TA 2BS3B 1SSNA 1SJHD 4WAFA 4YSYB 1L6VA 1NI3A 1L0YB 2FE8A 2AQ3B 3LB8C 3W1SA 4US8A 1XXGA 2WXLA 2W3RA 1F2RI 1FNVA 2K9XA 4ZHOA 5G5GA 1VRAB 4OVZA 3TEXA 2WXRA 1C4CA 1SB3C 1E9MA 3ABVB 1DOXA 3PO0A 1HQRD 4XDCA 4AQ7A 2Y3AA 2AX5A 3TUOA 1FFUA 1FRDA 1ET9A 1IGCA 3EUB2 2MH7A 1EU4A 1QOGA 1JMLA 1GB4A 1QLBB 3EGRA 1XLOA 3BK2A 2BTEA 4B0EA 1C9FA 1D4BA 1C4PA 1TYGB 1VR9A 2PVGC 1JWSD 3WCQA 1J7BA 1DOYA 3N9YC 3IXSA 2N0SB 3AV8A 2X38A 3CIRB 1VZ6A 1FEHA 4JWSC 1E7PB 3U4EG 3CWIA 1XLPA 1ENFA 1PGBA 4RNAA 3ZGZA 1V1PA 5I4DA 1EWCA 1NEKB 3ZYYX 2W82A 1K52A 4REZA 5H92C 2D5GA 2V3NA 1JQ4A 1C76A 3V3XA 1JWBD 1IBXA 2K0PA 3AE1B 2NTSA 3SEBA 1QILA 3AEEB 3TEYA 1HEZE 1P7EA 1T6BX 1CK1A 1WYGA 3ZJUA 1JROA 2KMMA 1VLBA 3U7ZA 3BVZA 3ZJVA 2ONQA 3MJ5A 4KKJA 4A8XC 1DGJA 1E10A 5C2TB 3IAS1 1PFDA 4C7YA 3NVZA 2JX5A 4M0WA 3NUHB 2WDQB 4RF0A 1FO4A 3MC0B 1FNUA 2JSVX 4HJGE 3R8BA 4TMAB 4YXDB 2BB5A 3BYTB 3VR9B 4XWWA 5EE1A 2I38A 1RM6C 3TEZA 2M56B 1JRPA 1WXQA 3Q8EA 1YQ3B 4J3OD 2J53A 3PZ7A 2VZKB 2MEKA 1V8CA 2WLBA 2WXGA 4GLSC 1EWYC 5BYSA 4L23A 4TSSA 4KX6B 1SEBD 3AMZA 2EELA 4N58A 3VQIA 3AE3B 1FRRA 5HI1A 3W5VB 4A90A 1AW7A 2N9LA 3UI3A 2GB1A 2BYTA 3B2GA 4A6QA 3I9V1 2H89B 2GI9A 4PT5A 2R61A 1UWMA 2Y5CA 3MHZA 2IGGA 1FCLA 3NRZA 3GB1A 2JYEA 3Q8FA 4US9A 5BMHA 2PTLA 3DWMA 4HROA 1N5XA 3W2DA 5T8IA 2N9KA 3T3NA 2WXQA 3AB5A 3E56A 4RH6A 3ZJTA 4RF1A 4TQ0A 4DXFA 3KWVA 4RCOA 1WWTA 4C80A 5FK9C 4USAA 3P4QB 1K50A 2CJOA 4IKGA 1DOIA 2DYMA 5EE3A 4KGSA 3BYYB 3AM9A 5LNK1 1TKEA 4A9AA 4OW0A 1PGAA 1BMLC 3C8YA 3E9SA 1OQRA 2IGHA 3IT4B 1RFKA 1P7FA 2XN9C 2Z8LA 1JWAD 1MVKA 1YN5A 1QOAA 1WRIA 3ETRA 1J7AA 2LEKA 1I4PA 2KAJA 3SFDB 3H8HA 1ZPSA 1N5WA 1VJKA 1ZXHA 2ACZB 4AS1A 1OQQA 1XCTL 1Y56A 4NAWB 5G5HA 4YSXB 1QOFA 1YJJA 2PKOA 3B2FA 3P42A 4MACA 2TSSA 5C3JB 3BK1A 2I2YA 1NYQA 3KWLA 1CQVA 3NVYA 2WNMA 1E6EB 1XF5L 1DYQA 3AECB 3L4PA 4HEA1 1TY2A 3AE2B 2RMMA 2PW9A 4JX1C 5BYQA 2LHDA 1LO5D 2H88B 3VR8B 2WU2B 1F77A 1FNWA 4RGNA 2ZW1A 1QF6A 2MJDA 1B9RA 2WXFA 1YMHE 4EE2A 1N60A 2QMTA 1FXIA 3P63A 1C78A 2SAKA 3AE6B 4O1NA 2MJEA 2BS4B 4HKZE 3BIID 3EA6A 4RGTA 3T3OA 4N6EB 2JYTA 4MH8A 2BT6A 2FBWB 2DWQA 1AYFA 2B76B 2WXPA 2N7JA 4R3DA 5HG2A 1F2RC 1UUPA 1XCQL 1JW9D 1I4GA 1ROEA 2BS2B 4XE0A 1V1PB 4GDKB 1KFYB 3AEGB 4D2KA 3I57A 1VZ7A 2JWUA 1L4ZB 1T3QA 2K3UA 2V0GA 1ZP0B 2BB6A 4GDLB 5MPOA 2G9HD 3FC4A 5BMGA 4KGTA 1IBXB 4YWGG 1Q10A 1XLNA 2DLBA 1NYRA 4XWTA 2J42A 1STEA 1JWUD 2LJIA 4YSZB 1HA5A 2WP9B 1CJEA 1HZ6A 4HRSA 2LFIA 1KLGD 5E6JA 1YNTE 1ET6A 1D6EC 5AUIA 4WIPA 1BXTA 1ZDXA 2W54A 3SR6A 1SJED 2YEPB 1TS4A 3BZDB 1J7CA 1XEEA 1ZOYB 3Q8AA 2QEJC 4IDIA 3HVZA 1AN8A 4WURA 1ZUD2 2JXTA 1ZXIA 3W9CB 3RFZB 2JZPA 4L1BA 1GAQB 3AE5B 4A55A 3AEDB 1D5MC 2PVOD 2LMCA 2KACA 3DWGC 4YTMB 3AN1A 1MI0A 4XDDA 3KLSX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XLO A;  3HUI A;  1E0Z A;  3P4P B;  1OQR A;  1RFK A;  1JWA D;  1N63 A;  1TYG B;  2PVG C;  4JWU C;  3P4R B;  3WCQ A;  3AH7 A;  1J7B A;  1QOA A;  1WRI A;  1J7A A;  1VDV A;  3ETR A;  1DOY A;  4P6V F;  2LEK A;  2N0S B;  3AV8 A;  3RPF C;  1L6U A;  2KAJ A;  1L5P A;  3SFD B;  3CIR B;  1F0Z A;  2L52 A;  3SFE B;  1N5W A;  1VJK A;  3VRA B;  4JWS C;  1E7P B;  4C7Z A;  2ACZ B;  3AE8 B;  3CWI A;  1OQQ A;  1XLP A;  1QT9 A;  3LXF A;  1GPX A;  5G5H A;  4YSX B;  1V97 A;  2W3S A;  1QOF A;  1XLQ A;  3AEB B;  5EE0 A;  1NEK B;  1N62 A;  3ZYY X;  1YJJ A;  2K22 A;  2W55 A;  2WDR B;  2PKO A;  1RYJ A;  1TKG A;  1L0V B;  3B2F A;  1RWS A;  3NVV A;  4WWM A;  5H92 C;  5C3J B;  1NYQ A;  1XO3 A;  2WU5 B;  1JQ4 A;  3KWL A;  2QIE B;  3NVY A;  1IUE A;  1E6E B;  1JWB D;  1N61 A;  1OFF A;  1R7S A;  3AEC B;  3AE1 B;  3NS1 A;  3P1M A;  3AEE B;  1PDX A;  3P4S B;  4ZHP A;  3VRB B;  4USA A;  3L4P A;  3AE2 B;  4FXC A;  1FMA D;  1WYG A;  3AE9 B;  1I7H A;  1TKY A;  3HRD D;  1JRO A;  4JX1 C;  2KMM A;  1FFV A;  2H88 B;  1VLB A;  1PUT A;  3VR8 B;  2WU2 B;  2WS3 B;  4WQM A;  5EE9 A;  1QF6 A;  2MJD A;  1B9R A;  1DGJ A;  1E10 A;  5C2T B;  2L83 A;  2WDV B;  1PFD A;  3NVW A;  1N60 A;  4C7Y A;  3NVZ A;  2JX5 A;  3AEA B;  4ITK A;  1KRH A;  4YT0 B;  2WDQ B;  1FXI A;  1FO4 A;  2MJ3 A;  3P63 A;  4YTP B;  3AE6 B;  2MJE A;  2BS4 B;  3BII D;  2QJL A;  4N59 A;  4N6E B;  5H8Y E;  2EKI A;  2OHF A;  1FIQ A;  2BT6 A;  2FBW B;  2DWQ A;  1AYF A;  2B76 B;  2G1E A;  4YXD B;  3VR9 B;  2K5P A;  3AEF B;  1NEN B;  5EE1 A;  1NVI D;  1RM6 C;  2HTM E;  2BS2 B;  1JRP A;  1JW9 D;  1WXQ A;  1CZP A;  1ROE A;  1YQ3 B;  2JQR B;  2M19 A;  2M56 B;  3AE4 B;  3W5U B;  2CU3 A;  1SF0 A;  2PIA A;  1KFY B;  3AEG B;  1V8C A;  1SIJ A;  2Q5W D;  2WLB A;  1YJI A;  3B9J A;  1EWY C;  1T3Q A;  4LTU A;  4A9A A;  1ZP0 B;  2WQY B;  1FM0 D;  5GXG B;  3FC4 A;  4KX6 B;  5MPO A;  3AMZ A;  1JAL A;  4N58 A;  1XLN A;  4YTN B;  2CJN A;  3AE3 B;  1NYR A;  5AUK A;  1FRR A;  2E3T A;  2BS3 B;  3W5V B;  4YSY B;  1YQ4 B;  1L6V A;  1NI3 A;  3B2G A;  2H89 B;  2WP9 B;  1CJE A;  4YSZ B;  4HRS A;  1UWM A;  2Y5C A;  3LB8 C;  5AUI A;  3NRZ A;  4US8 A;  4US9 A;  2W54 A;  3DWM A;  4ZOH C;  4HRO A;  2W3R A;  1N5X A;  3SR6 A;  2K9X A;  1KF6 B;  3AB5 A;  1J7C A;  1TJE A;  1ZOY B;  4ZHO A;  4IDI A;  5G5G A;  3HVZ A;  1WWT A;  1ZUD 2;  3W9C B;  1ZXI A;  4C80 A;  2DBY A;  1A70 A;  1SB3 C;  1E9M A;  1GAQ B;  3ABV B;  3AE5 B;  3AED B;  2PVO D;  3P4Q B;  3PO0 A;  1FXA A;  1QOB A;  2CJO A;  1DOX A;  1DOI A;  1AWD A;  5EE3 A;  2AX5 A;  3DWG C;  1FFU A;  4YTM B;  1FRD A;  3FAH A;  3AM9 A;  3EUB 2;  1WGK A;  3AN1 A;  2MH7 A;  1QOG A;  3AE7 B;  1TKE A;  1QLB B; 
#chains in the Genus database with same CATH topology
 3CF6 E;  1KOT A;  4HWI B;  2KDM A;  1RLF A;  1L0X B;  1WZ3 A;  3PSE B;  2KFJ A;  3AH7 A;  4M8M A;  3RPF C;  3R2I A;  3BVM A;  3HIZ A;  4K7U A;  3Q8C A;  3IT6 B;  1M94 A;  3ZDM C;  5HKH A;  2LXC A;  1R4N I;  1MPE A;  2W55 A;  1RYJ A;  1KH0 A;  4TKN A;  1ESF A;  4XC2 A;  4RGM A;  1M4V A;  3VTV A;  3TMP B;  3WAL A;  3OAW A;  4BOZ B;  1LM8 B;  1RRB A;  5CHF A;  1T0R C;  4KDL B;  1T5X D;  1L4D B;  1I4H A;  2WS3 B;  2QIL A;  2WXH A;  5JH5 C;  1WIA A;  4ITK A;  4MJS B;  4CYE A;  1KRH A;  4YTP B;  2BWE S;  4ZRQ A;  1TS3 A;  4URK A;  2KVZ A;  3CST A;  4NNJ B;  4N59 A;  5TR5 A;  2WXI A;  4GGQ A;  2EKI A;  3OWE B;  4NJC A;  3EEC A;  1QZE A;  1TS5 A;  4M00 A;  2VZK D;  3RYT A;  4LTU A;  1IGD A;  2WQY B;  1YD8 U;  1FM0 D;  2RPV A;  2GLS A;  2WYQ A;  1UBI A;  3NZ3 A;  1UNS A;  2MBQ A;  5HHD G;  1T0Q C;  5CTR C;  3VDZ A;  5IP4 D;  3RNC C;  3ZQ4 A;  1WSP A;  1A70 A;  2R2Q A;  2FCN A;  1FXA A;  1J8C A;  3VAW A;  2NPT B;  1GOZ A;  3FAH A;  4KIK A;  1HTO A;  4EFO A;  3VTU A;  2L32 A;  3B08 A;  3S2A A;  2NTT A;  3QX1 A;  4JWU C;  1UGJ A;  1TY0 A;  3VTW A;  4UDU C;  3M95 A;  5FR6 A;  2CS4 A;  2L52 A;  3VRA B;  2ZW0 A;  4ZRI A;  3LXF A;  2IJ0 A;  4WH4 A;  1MHX A;  4ARC A;  3NVV A;  1RWS A;  2QIE B;  2N4F A;  3PZD A;  5D3D A;  4BBN C;  3ZDT A;  2W9N A;  4FJY A;  2J0K A;  2IYD B;  5BYR A;  4ZYS A;  1I4Q A;  4WQM A;  2RDH A;  2NBW B;  2E6X A;  1NI2 A;  4LK0 M;  4KV2 A;  3AEA B;  3UIN B;  2N9X A;  2PE6 B;  4HK2 A;  2MJ3 A;  5D2M B;  1PYW D;  1L2N A;  2LUE A;  2WXJ A;  1V5T A;  1C79 A;  3P2B A;  4G0N B;  2C5L C;  1I4R A;  1TIF A;  3W5U B;  2JWZ A;  1A5R A;  2WDT B;  1JCK B;  3ONS A;  2JUO A;  2DYO A;  2LUM A;  1KTK A;  1KJT A;  1C3T A;  3B9J A;  4H2A A;  3ZIM A;  2JRI B;  3V05 A;  3URY A;  2NMQ A;  2E3T A;  4GU2 A;  4YSY B;  1L0Y B;  3RN9 C;  3A9K B;  1IP9 A;  3V61 A;  3JSV A;  2K6Q A;  1FNV A;  2KO3 A;  4ZHO A;  3PRM B;  1VRA B;  3ZXV A;  2RGF A;  3OG5 A;  3TEX A;  2JPH A;  3AXC A;  1Q0W B;  1C4C A;  2EMT A;  1E9M A;  3ABV B;  3DBS A;  2N1V A;  1TTN A;  3PO0 A;  1HQR D;  4XZ4 A;  1FFU A;  2RDB C;  1FRD A;  4MEL A;  2J0M A;  2ZVN A;  3L16 A;  1EU4 A;  4F1S A;  1JML A;  4XYC A;  3WCQ A;  1TYG B;  2PVG C;  1JWS D;  3FKY A;  1DOY A;  3N1X C;  2N0S B;  2G4S A;  2LVQ A;  2RD0 A;  4GSW A;  4BZA A;  4JWS C;  2CHZ A;  3CWI A;  3DOW A;  1PGB A;  1XQQ A;  1WM3 A;  2B3A A;  5I4D A;  4P1C C;  1Q1O A;  3RNB C;  5H92 C;  2D5G A;  3PRE A;  2V3N A;  1C76 A;  3V3X A;  1V80 A;  1JWB D;  3V60 A;  1IBX A;  2NTS A;  3SEB A;  1HEZ E;  1T6B X;  1WH3 A;  3PHX B;  2KMM A;  1VLB A;  3ZJV A;  1E10 A;  1I35 A;  4S17 A;  3IAS 1;  1R4M B;  1PFD A;  4C7Y A;  4G11 A;  3NUH B;  1FO4 A;  3MC0 B;  2G3Q B;  4TV3 A;  3RZF A;  4XWW A;  1X1M A;  2DNF A;  5EE1 A;  4M0W B;  3PZ7 A;  4WJO A;  2WLB A;  2WXG A;  1EWY C;  1WGY A;  4L23 A;  4TSS A;  4FN2 A;  4K3C A;  2OOB B;  2KLC A;  3AE3 B;  4PS7 A;  2GB1 A;  3DVN U;  2BYT A;  3B2G A;  4AOF A;  2R61 A;  1UWM A;  3MHZ A;  3GB1 A;  5BMH A;  2PTL A;  4HRO A;  5L83 A;  2NS5 A;  4YL8 A;  4RH6 A;  3PRP B;  1T0Y A;  4DXF A;  3RD2 A;  3UGB B;  4C80 A;  5FK9 C;  4G3X B;  1OEY A;  3QCA A;  3N1Y C;  1MG4 A;  4XX5 A;  1BT0 A;  1PGA A;  4NY0 A;  3E9S A;  1LQB A;  1WE6 A;  2IGH A;  2O6V A;  1MVK A;  1J0G A;  1I4P A;  3SFD B;  1ZPS A;  5JZE B;  4AS1 A;  2KX0 A;  1P1A A;  4NAW B;  3RZW C;  3H7S A;  3QK0 A;  4TUU A;  3B2F A;  2TSS A;  3BK1 A;  1NYQ A;  2C7M B;  3RUI B;  1VD2 A;  1DYQ A;  3AEC B;  2WHI A;  2CU1 A;  5AZG A;  5IAA C;  4ZRJ A;  2ZPY A;  2H88 B;  1IPG A;  1F77 A;  3RNE C;  2ZW1 A;  3DVG Y;  2BPS A;  4GIV A;  1WFY A;  3AE6 B;  1WM2 A;  1SGH A;  4N6E B;  2LVP A;  2B76 B;  2N7J A;  4FBJ B;  2DEN B;  1UUP A;  3X23 A;  2GBM A;  2IND C;  1GC7 A;  4D2K A;  1Y8R C;  1ZP0 B;  5MPO A;  5BMG A;  2KDB A;  3UQB A;  4GOC A;  1IBX B;  2KXJ A;  1V81 A;  4XWT A;  3UIP B;  1OEY J;  2FAZ A;  3VUY A;  3TL5 A;  3U8Z A;  1HZ6 A;  3W1S C;  4LDT B;  2W54 A;  1V9J A;  3SR6 A;  1SJE D;  2YEP B;  1XEE A;  2M17 A;  1ZOY B;  2MRP A;  3Q8A A;  4FLH A;  1AN8 A;  4BVU C;  1ZUD 2;  4WAA A;  4L1B A;  2FCS A;  4S0R A;  5IN7 A;  5DCN A;  3EFC A;  1YX6 B;  3AE5 B;  5DPT A;  2KC2 A;  3UIO B;  2KAC A;  4YTM B;  4HPL B;  4I6L B;  4XDD A;  3V62 A;  2JZZ A;  5TSS A;  3P4P B;  5D3I B;  2WXK A;  3IAM 1;  5D7G A;  3MC8 A;  1ACC A;  3T8M A;  2WXN A;  1L5P A;  4P16 A;  4HKQ A;  2L8J A;  2LRU A;  2ICI A;  2IY1 B;  3M62 B;  1K53 A;  3PHW B;  2KN4 A;  3AE8 B;  4B9K A;  1QKZ A;  1GPX A;  3FIL B;  4KVG B;  1WX8 A;  3PZ8 A;  3AEB B;  2WXO A;  2IDY A;  4AJY B;  4OZC A;  1WGH A;  4WWM A;  1UGM A;  4LNO A;  2KWU B;  2L1A A;  4RGO S;  3P1M A;  1OFF A;  3NS1 A;  1WMH A;  3P4S B;  2KYW A;  2K8H A;  4FXC A;  1WE7 A;  4MGZ E;  2KTR B;  2MQJ A;  1ZDV A;  3NZU A;  1GG3 A;  3HM6 X;  1TGZ B;  1WRD B;  3DVG X;  1I42 A;  2OHF A;  2G1E A;  3WAM A;  2FUH B;  4NPN A;  2V4I B;  4IOI E;  2CU3 A;  4LNI A;  2JZ3 B;  2XEW A;  5G55 A;  3QAQ A;  1WGD A;  1SIJ A;  1WR1 A;  3QAR A;  2AQ2 B;  2SEB D;  2KJR A;  3APC A;  3RUL A;  2GBK A;  4DXA B;  2UWQ A;  4NAM A;  2YVC A;  3QWZ B;  2OED A;  3N1Z C;  3AU4 A;  1SXT A;  3KYD D;  1KF6 B;  4OHJ A;  1F1H A;  1S1Q B;  1HZ5 A;  4MSQ B;  1UZX B;  2INC C;  1B1Z A;  4BOS C;  4WWO A;  3H6N A;  3NG0 A;  3J9C A;  5LXI B;  2LVO A;  4MGK E;  4DWF A;  3MFG A;  1SE2 A;  1V2Y A;  4W9C A;  1IYF A;  4RFB A;  1TZO A;  1SE9 A;  2JF5 A;  2W3S A;  4BKS D;  1WXV A;  4AP4 C;  3JW0 X;  1KM7 A;  3BWU D;  1XO3 A;  1D5Z C;  2G4D B;  2BYE A;  1R4M I;  2HTH A;  3Q8B A;  3CSF A;  2JT4 B;  3RMK C;  4B0M A;  2V3P A;  3TEW A;  1TKY A;  2MBB B;  2DZI A;  5BO4 B;  1FFV A;  3L10 B;  4LNK A;  4DXG A;  2VH1 A;  4HLE A;  2KDI A;  3KUC B;  3H7P B;  4B6W A;  4X57 B;  1L7Y A;  1UBQ A;  4F8C B;  4DDI D;  2M19 A;  4GN1 A;  3GZN I;  3HVD A;  2FUG 1;  3A9K A;  3X0W A;  3PV1 A;  4LJO B;  4W9K A;  1PQS A;  2JVC A;  1WMH B;  4JE3 B;  4YTN B;  1SSN A;  1SJH D;  3A33 B;  2AYO B;  2FE8 A;  2AQ3 B;  3W1S A;  2LD9 A;  2BVC A;  3ECI A;  3SU8 X;  2V9H A;  1XXG A;  2WXL A;  3DCG A;  2N7E A;  3ZNZ B;  1ZW7 A;  2KAN A;  1SB3 C;  2L0T A;  3TUO A;  5J18 A;  1ET9 A;  2BF8 B;  3EUB 2;  1QOG A;  2XK5 A;  1QLB B;  4ANU A;  3EGR A;  4IG7 B;  1UD7 A;  3N20 C;  2L0F A;  4HVB A;  3Q3N C;  4PK1 A;  4KSL C;  3A9J A;  1XLP A;  3WIM A;  2HE7 A;  2N9E B;  1V1P A;  2MLB A;  4HJK A;  1NEK B;  3JVZ X;  1K52 A;  4BKG A;  4G50 A;  4K81 A;  3QQ8 B;  2K0P A;  1OTR B;  3A1Q B;  4FJZ A;  4ZRK A;  2IY0 B;  1CK1 A;  2DZJ A;  2L7R A;  3NY5 A;  2DAJ A;  3U7Z A;  2BKF A;  2ONQ A;  3MJ5 A;  2FCQ A;  4A8X C;  2LGY A;  4M0W A;  3KH0 A;  2KQ7 A;  2MBE A;  3IFW B;  4WJQ A;  2RR9 A;  1FNU A;  1RAX A;  4FJV B;  4OVU A;  4YXD B;  3VR9 B;  2M56 B;  5CX3 A;  4K7S A;  2G45 B;  2VZK B;  1V8C A;  1S3S G;  2N1W A;  4KX6 B;  2EEL A;  3B0A A;  1GUA B;  3A4R A;  4PT5 A;  2Y5C A;  3K9O B;  2BQQ A;  2IGG A;  1V6E A;  2KK8 A;  2JYE A;  5JHA A;  4US9 A;  2LI5 A;  3R66 C;  1N5X A;  4IUM B;  2KDF B;  3ZJT A;  4RF1 A;  3QC8 B;  3KWV A;  4ZDV A;  4EOY A;  3DQV A;  3EFU A;  1EUV B;  4IKG A;  2DX5 B;  2DYM A;  5EE3 A;  2IBI B;  5LNK 1;  1V86 A;  4A9A A;  4OW0 A;  3L17 A;  3IT4 B;  1RFK A;  4MM3 A;  1EF1 A;  4NAW A;  3ETR A;  1P98 A;  1J7A A;  3O65 B;  5LLI A;  2KAJ A;  3BIN A;  4WQO B;  2I1J A;  1N5W A;  1VJK A;  2KNB A;  3PS6 A;  4A3O A;  1OQQ A;  3WAP A;  5AEK B;  4LNF A;  4KZC A;  4W9J A;  2L3Z A;  1XD3 B;  4DHJ D;  1ISN A;  1WJ4 A;  1YJJ A;  2PKO A;  4IC7 B;  1V5O A;  4MAC A;  4DHZ B;  2LZ6 A;  4MEM A;  3KWL A;  2IZV B;  3BY4 B;  2M0X A;  1VCB A;  4HCN B;  3L4P A;  5L95 C;  4HEA 1;  1JRU A;  2PW9 A;  4E3C A;  4JX1 C;  2XK5 B;  2LHD A;  5BYQ A;  4MGY E;  3HHM A;  3GE8 C;  3PLU A;  3VR8 B;  1QF6 A;  4HDO A;  2K25 A;  2WXF A;  1E8X A;  1C78 A;  2SAK A;  3NS8 A;  4O1N A;  2MJE A;  3A9J B;  3C0R B;  4M02 A;  4MH8 A;  1AYF A;  5HG2 A;  1F2R C;  1XCQ L;  1ROE A;  3PRZ A;  1V1P B;  3OJ3 A;  3VXW A;  3AEG B;  3M3J A;  2J0J A;  4JLC A;  4ICU A;  3DBR I;  4KGT A;  1NYR A;  1WI0 A;  2J42 A;  3Q2A C;  5GMV A;  4W9F A;  3H1U A;  1J7C A;  3NHE B;  3HVZ A;  1ZXI A;  3VUW A;  2KVR A;  1WXS A;  2MP2 A;  1D5M C;  3AED B;  2LMC A;  3EHV A;  3M63 B;  3ZRC A;  3KVF B;  4CO7 A;  2JXX A;  1E0Z A;  4LJP B;  3FIL A;  2BW2 A;  1VDV A;  1L6U A;  1R4N B;  2PJH A;  1E8Z A;  2XNA C;  1F0Z A;  2LHE A;  2N9P C;  3DHG C;  2K22 A;  4Q2J A;  2L00 B;  1WGG A;  4II3 B;  2RPQ A;  1K51 A;  2KTR A;  1RFA A;  4JQW C;  1IUE A;  1N61 A;  2ZVO A;  1PDX A;  2DAF A;  2BYF A;  1TZ1 A;  3VRB B;  4MSM B;  3APD A;  2ZZP B;  3TCA A;  4IWP A;  1GC6 A;  4EEW A;  4QAY A;  3Q69 A;  5AZF A;  1SE3 A;  1MHH E;  1H8C A;  1WXA A;  2INP E;  1TS2 A;  4IWQ A;  4ARI A;  4MM3 B;  1KLU D;  3NVW A;  4NJ6 A;  2ZEQ A;  4YT0 B;  3SD5 A;  2JRH A;  4LDT D;  2IO1 B;  3RI7 C;  2ZNV B;  3SHQ A;  2BKR B;  3GP7 A;  1HE8 A;  2KHW B;  2D2Q A;  2JQR B;  4PS3 A;  2OJR A;  2Q5W D;  3I63 C;  5GXG B;  2LGI A;  3I3T B;  1JAL A;  3IG3 A;  4DBG A;  5AUK A;  1Q5W B;  4TQ1 A;  3TSS A;  3ZNI D;  4OZA A;  3VH3 B;  4CQN A;  4WJP A;  1YQ4 B;  4NZL B;  2LWP A;  1E90 A;  5J2R A;  3H9D A;  2Z59 B;  3R7R A;  4ZOH C;  5KHO A;  1TJE A;  2VRR B;  2VH2 A;  1YN4 A;  4MDK E;  4NQL B;  1WR6 E;  2CR5 A;  2KWC A;  1QOB A;  1EO6 A;  5FR3 A;  3U2S C;  2BBC A;  1U4A A;  2PMV A;  2MW5 A;  4ACF A;  4MT5 A;  3ALB A;  3AE7 B;  3W1Y A;  4IM0 A;  3Q3J A;  2JU6 X;  4C4V A;  4P6V F;  2QCZ A;  3NZS A;  4KGR A;  3SFE B;  3Q3O C;  4ICV A;  2O6V D;  4AWJ A;  5IKC M;  1V97 A;  2GOW A;  4GXB A;  1LXD A;  2WXM A;  1L0V B;  3LYY A;  2MP2 B;  1SBB B;  4KSK C;  3GOE A;  3O13 A;  4GMV A;  2O2V A;  3AE9 B;  1I7H A;  2L05 A;  3DDC B;  5IOI A;  1F52 A;  2RDG A;  3H7P A;  2D10 A;  3BVG A;  3R2T A;  1NBF C;  4C00 A;  1BUI C;  2KWV B;  4BKT A;  5H8Y E;  1D3Z A;  1WJ6 A;  1FCC C;  1NEN B;  2GRI A;  4A3P A;  1G6J A;  4M01 A;  1CZP A;  2KD0 A;  3OJ4 B;  1SF0 A;  2MWS B;  1C77 A;  4MH0 E;  5BMI A;  4HPP A;  3KW5 B;  4ASW C;  2BS3 B;  1Z5S B;  3MTN B;  4WAF A;  1FXT B;  5J17 A;  3LB8 C;  2KX3 A;  4US8 A;  4WWP A;  1WY8 A;  2KJH B;  2W3R A;  5CHW A;  2NVU I;  3N30 A;  2AL3 A;  2K9X A;  2KFK A;  5G5G A;  3Q3F A;  4OVZ A;  1E7U A;  1GJZ A;  2WXR A;  3U7D A;  1P3Q U;  1DOX A;  2LAS A;  1IGC A;  2KC1 A;  4B95 A;  1OGW A;  4K3B A;  3UF8 A;  1GB4 A;  2GMI C;  4B0E A;  3A4S C;  2UYZ B;  4ANX A;  1J7B A;  5E6O A;  3IXS A;  4IW0 A;  3ZO5 B;  3PPA A;  3T9L A;  4E71 A;  3HM3 A;  1FEH A;  1E7P B;  3D32 A;  2NCN A;  4WWN A;  3A1Q A;  2R2O A;  2W82 A;  2V3S A;  1JQ4 A;  4MGI E;  3QHT A;  3AE1 B;  1QIL A;  2QHO A;  3L0W B;  4WJN A;  3VUX A;  2DHZ A;  1P7E A;  1WYG A;  3ZJU A;  2ZNV C;  1JRO A;  4KKJ A;  2KKC A;  5C2T B;  3NVZ A;  2JX5 A;  2WDQ B;  4C4V B;  3RNA C;  2JY6 A;  4HJG E;  4FAD A;  4TMA B;  1HTQ A;  3BYT B;  2BGF A;  2I38 A;  1RM6 C;  3TEZ A;  1JRP A;  3HK0 A;  4J3O D;  1YQ3 B;  5C23 A;  4F7Z A;  2D07 B;  2RSU A;  4GLS C;  2C9W B;  1LGR A;  5BYS A;  3QJZ A;  2WGS A;  2KMC A;  2GBJ A;  2D11 A;  2A4Z A;  4N58 A;  1AAR A;  4KZ0 A;  5HI1 A;  3UI3 A;  3DHI C;  4A6Q A;  2O2V B;  3I9V 1;  2GI9 A;  4HCP B;  1FCL A;  3NRZ A;  1WYW B;  3Q8F A;  2FCM A;  2MHJ A;  1MJD A;  3W2D A;  2KLG A;  3T3N A;  3E56 A;  2LGD A;  4K7W A;  4TQ0 A;  2WX0 A;  1WWT A;  4USA A;  2BWF A;  2MSE D;  1DOI A;  1Z2M A;  3DVN V;  2L76 A;  3BYY B;  3AM9 A;  3ZNH B;  1TKE A;  3QA8 A;  1BML C;  2MBH A;  4M8N A;  2CKH B;  2LXA A;  1YN5 A;  1QOA A;  3CMM B;  5E6N A;  3N3K B;  2LEK A;  3H8H A;  3MHS D;  2KQS A;  1Y56 A;  4YSX B;  1QOF A;  3LJ3 A;  2DYB A;  3V6E B;  2C7H A;  1SIF A;  2KFK B;  1WX7 A;  3P42 A;  2I2Y A;  3I5J C;  2WNM A;  1E6E B;  1P0R A;  3N32 A;  1XF5 L;  2AL6 A;  2MBO A;  3R3M A;  1LO5 D;  2WU2 B;  1FNW A;  3TBL D;  4RGN A;  1B9R A;  1YMH E;  4EE2 A;  1N60 A;  2J7Q B;  2QMT A;  4W9D A;  1FXI A;  3P63 A;  1J19 A;  4EZJ A;  3T3O A;  2BS4 B;  3BII D;  2FBW B;  1YQB A;  2DWQ A;  2WXP A;  4R3D A;  1UEL A;  2ZPN A;  4BAX A;  4XE0 A;  1JW9 D;  5D94 A;  4GDK B;  1KFY B;  3I57 A;  1VZ7 A;  1CMX B;  2JWU A;  2V0G A;  3DBL B;  3PGE A;  3FC4 A;  4N9F 4;  1Q10 A;  2CHX A;  1E7V A;  1WZ0 A;  1STE A;  2LJI A;  4YSZ B;  2WP9 B;  1CJE A;  4HRS A;  2LFI A;  1KLG D;  3ZVV A;  1ET6 A;  5AUI A;  2YLM A;  4IM2 A;  2KN5 A;  1TS4 A;  3BZD B;  2HJ1 A;  4IDI A;  2QEJ C;  2MX2 A;  3B1L X;  2JXT A;  3W9C B;  2BYV E;  2JZP A;  3IHP C;  1GAQ B;  4ANW A;  4A55 A;  4BFR A;  4KDI C;  3AN1 A;  2K1F A;  4FHK A;  3KLS X;  1I4X A;  5FKA C;  2NBU A;  1N63 A;  3DPD A;  1PGX A;  1WX9 A;  2Z0E B;  1C4A A;  3DHH C;  4OZB A;  4L2Y A;  4C7Z A;  3MP9 A;  3AUL A;  1QT9 A;  4EKU A;  1XLQ A;  3GS2 A;  3L13 A;  5EE0 A;  4OVV A;  4CHK A;  1EU3 A;  4W9H A;  2QDF A;  3ZXR A;  2WU5 B;  1V1O A;  2ON8 A;  1SE4 A;  4HPM B;  2KWD A;  2LRW A;  3QIJ A;  1XT9 B;  3NJT A;  1FMA D;  1YOV B;  1PUT A;  4AUQ C;  2J4X A;  4JPS A;  3R7Q A;  1LFD A;  2L83 A;  1D5X C;  2WX1 A;  2GBR A;  3ZUN A;  3ZW3 A;  3PTF C;  3LDZ E;  1QQR A;  5AZH A;  2J52 A;  4C56 C;  2IPK D;  2K5P A;  2M0A A;  3AEF B;  1NVI D;  3VFK A;  2HTM E;  5IA7 A;  3PLV A;  1YN3 A;  4KKI A;  3DBH B;  1YJI A;  2YEP F;  2IGD A;  2KOX A;  2HDE A;  1C1Y B;  2CJN A;  3K9P B;  3RNG C;  4RM9 A;  3WAN A;  3L08 A;  1T0S C;  4ZRP A;  2LJ5 A;  4XGA B;  2AQ1 B;  3KQ4 A;  2PLP A;  3ML8 A;  2KJ6 A;  4LLG M;  5C1Z A;  2D3A A;  2FNJ B;  3OLM D;  2DBY A;  3IVF A;  1WXM A;  2MCN B;  1TT5 B;  1FD6 A;  3WA0 A;  1AWD A;  2WWZ A;  2QC8 A;  1JWM D;  4J6I A;  1WGK A;  3NOB A;  4EZK A;  3HUI A;  3WAO A;  1E8W A;  2V4L A;  4IWO A;  1ZGU B;  4DDG D;  3P4R B;  4KIK B;  3UQA A;  2N7D A;  1HXY D;  2AWT A;  2Y5P A;  5HFY A;  5CHV C;  5DPW A;  2KMA A;  4LNN A;  5JHB A;  1K8R B;  1VZ8 A;  2K8B A;  1N62 A;  4W9E A;  2WDR B;  4GB9 A;  4DHJ B;  1TKG A;  3U30 A;  1EM7 A;  2Y5B B;  4FA6 A;  1R7S A;  1UH6 A;  3L54 A;  3VHT C;  4ZHP A;  2K8C A;  2D3B A;  5JXV A;  2QSD A;  1E8Y A;  5D6J B;  3HRD D;  2KQ4 X;  5EE9 A;  1WF9 A;  2WDV B;  2INN E;  1NDD A;  3GZN B;  2QJL A;  2M8S A;  1FIQ A;  2K39 A;  2FID A;  4DQO C;  4BBN F;  1UWX A;  3U52 E;  3AE4 B;  3VH4 B;  4FUL A;  2ZJD A;  2PIA A;  1E5W A;  1ZE3 D;  2M1M A;  3GE3 C;  2D3C A;  1GB1 A;  1WJN A;  2ZCB A;  4HDQ A;  1EF5 A;  3Q14 C;  2I1K A;  1L6V A;  1NI3 A;  1F9J A;  5E6P A;  3ZKJ C;  3V6C B;  2CHW A;  1F2R I;  4W9L A;  4I6P A;  4EZL A;  3SDL C;  1YX5 B;  3ZTD A;  2KZR A;  4LCD E;  4ANV A;  3IBE A;  4XDC A;  5EDS A;  3JSV B;  3RT3 B;  4AQ7 A;  2Y3A A;  2AX5 A;  2MH7 A;  2ASQ A;  4A20 A;  1V49 A;  1XLO A;  3BK2 A;  2BTE A;  1C9F A;  2UU7 A;  2KTF A;  1D4B A;  3MC9 A;  1C4P A;  1VR9 A;  3PVL A;  3N9Y C;  3AV8 A;  4P1B C;  2X38 A;  3CIR B;  5DPS A;  1VZ6 A;  4EUT A;  3U4E G;  3ML9 A;  1ENF A;  4RNA A;  3ZGZ A;  1WJU A;  1EWC A;  2LGX A;  3ZYY X;  4REZ A;  3JYU A;  5IO9 A;  4GDL A;  3AEE B;  4P7I A;  2EKE C;  3TEY A;  2NBV B;  3BVZ A;  3PT2 B;  1DGJ A;  4PYU A;  4RF0 A;  1KLV A;  1P9D U;  3DBL I;  4RMA A;  2JSV X;  3R8B A;  2BB5 A;  4RM8 A;  3C19 A;  1GNU A;  1WXQ A;  3Q8E A;  2J53 A;  2MEK A;  3ZLZ A;  4PYZ A;  1SEB D;  2XBB C;  3AMZ A;  3VQI A;  1FRR A;  3W5V B;  4A90 A;  1AW7 A;  2N9L A;  3RCZ A;  5G2N A;  2NR2 A;  2H89 B;  4DK5 A;  3DWM A;  3ZTC A;  1TBE A;  2HD5 B;  2N9K A;  5T8I A;  4FHJ A;  2WXQ A;  3AB5 A;  3MJW A;  4RCO A;  3ENE A;  4IM3 A;  3ZNG C;  3P4Q B;  1K50 A;  2CJO A;  1ZKH A;  2D3G A;  4KGS A;  3TIX A;  2EMS A;  4DHZ E;  3EC8 A;  3C8Y A;  4JL9 A;  1OQR A;  1P7F A;  2XN9 C;  2Z8L A;  1JWA D;  1WGR A;  4MJS A;  1WRI A;  1OQY A;  2Z0D B;  2K6D B;  2X8X X;  4BKS A;  4K1R B;  4PS8 A;  2V1Y A;  2GBN A;  1ZXH A;  2FIF A;  2ACZ B;  2O6V B;  1XCT L;  2ZCC A;  5G5H A;  1MG8 A;  5DPR A;  2C7N B;  3KYC D;  5C3J B;  5KHQ A;  1YJ1 A;  4I6N B;  3NVY A;  1CQV A;  1MFW A;  2DZK A;  2PE9 A;  2IO0 B;  3ZRF A;  1TY2 A;  3AE2 B;  2REX A;  2RMM A;  2PPH A;  2HJ8 A;  2MJD A;  3Q3M C;  4HXD A;  3DBH I;  4GDK A;  4JIO U;  4HKZ E;  3EA6 A;  2MA9 B;  4RGT A;  4AJW A;  2JYT A;  1H4R A;  2BT6 A;  2AEH A;  2IO2 B;  3DBR B;  2NPT A;  2BS2 B;  1I4G A;  2IO3 B;  3VVW B;  2PEA A;  1L4Z B;  1T3Q A;  2K3U A;  3AI5 A;  4NJ7 A;  4E74 A;  2BB6 A;  4GDL B;  2C60 A;  2G9H D;  1FPY A;  4YWG G;  1XLN A;  2DLB A;  2LGS A;  5LXH A;  1JWU D;  1YIW A;  3TJP A;  1HA5 A;  5E6J A;  3RNF C;  1YNT E;  1D6E C;  4WIP A;  3Q6B A;  1BXT A;  2KDE B;  1ZDX A;  1N6Z A;  4JGH B;  2A5U A;  3KUZ A;  4W9I A;  4W9G A;  4NQK E;  2KT7 A;  2DZM A;  4WUR A;  4II2 B;  3RFZ B;  3AU5 A;  2OJW A;  2PVO D;  2M4N A;  1UF0 A;  3DWG C;  3KUD B;  1MI0 A;  4ZYN A;  3APF A; 
#chains in the Genus database with same CATH homology
 1I4X A;  5FKA C;  3P4P B;  5TSS A;  1E0Z A;  5D3I B;  2KDM A;  2WXK A;  1L0X B;  1N63 A;  3IAM 1;  3FIL A;  2BW2 A;  3AH7 A;  5D7G A;  1PGX A;  1VDV A;  1ACC A;  3RPF C;  1L6U A;  2WXN A;  3R2I A;  1L5P A;  2XNA C;  1C4A A;  4P16 A;  4HKQ A;  1F0Z A;  2ICI A;  3BVM A;  4OZB A;  4L2Y A;  3Q8C A;  1K53 A;  4C7Z A;  3IT6 B;  3MP9 A;  2KN4 A;  3AE8 B;  1QT9 A;  1QKZ A;  1GPX A;  3FIL B;  1XLQ A;  2LHE A;  3AEB B;  3GS2 A;  2WXO A;  3PZ8 A;  1MPE A;  2IDY A;  5EE0 A;  2W55 A;  2K22 A;  4Q2J A;  4OZC A;  1K51 A;  1RYJ A;  1EU3 A;  4WWM A;  1KH0 A;  2WU5 B;  1V1O A;  2ON8 A;  2L1A A;  1IUE A;  1N61 A;  4RGO S;  3P1M A;  1OFF A;  1ESF A;  3NS1 A;  3P4S B;  1M4V A;  1SE4 A;  4RGM A;  1PDX A;  2KWD A;  3VRB B;  4FXC A;  1FMA D;  3Q69 A;  1PUT A;  1T5X D;  1SE3 A;  1MHH E;  1L4D B;  1I4H A;  1ZDV A;  2INP E;  2J4X A;  2QIL A;  2WS3 B;  1TS2 A;  2WXH A;  4JPS A;  4MM3 B;  1KLU D;  2L83 A;  3NVW A;  1D5X C;  4ARI A;  4YT0 B;  4ITK A;  1KRH A;  4YTP B;  4ZRQ A;  1TS3 A;  4N59 A;  2WXI A;  1QQR A;  2EKI A;  3GP7 A;  2OHF A;  3OWE B;  2J52 A;  2G1E A;  4C56 C;  4NJC A;  2IPK D;  2K5P A;  2M0A A;  3AEF B;  1NVI D;  2JQR B;  2HTM E;  2V4I B;  4IOI E;  1TS5 A;  2CU3 A;  2VZK D;  1YN3 A;  4KKI A;  2Q5W D;  1SIJ A;  4LTU A;  1YJI A;  1IGD A;  2AQ2 B;  2SEB D;  2YEP F;  2IGD A;  2WQY B;  1FM0 D;  5GXG B;  2LGI A;  1JAL A;  2HDE A;  2CJN A;  5AUK A;  2RPV A;  4TQ1 A;  3TSS A;  4OZA A;  4CQN A;  1YQ4 B;  4NAM A;  4ZRP A;  4NZL B;  3NZ3 A;  2AQ1 B;  2OED A;  4ZOH C;  3KQ4 A;  1UNS A;  2PLP A;  1SXT A;  5HHD G;  1KF6 B;  4OHJ A;  1TJE A;  4LLG M;  1YN4 A;  1HZ5 A;  3ZQ4 A;  1WSP A;  2DBY A;  1A70 A;  1B1Z A;  1FD6 A;  1FXA A;  1QOB A;  5FR3 A;  3U2S C;  1AWD A;  2BBC A;  2PMV A;  1GOZ A;  1JWM D;  3FAH A;  1WGK A;  4MT5 A;  3J9C A;  3AE7 B;  3HUI A;  2L32 A;  2NTT A;  4JWU C;  1UGJ A;  1TY0 A;  1SE2 A;  2JU6 X;  3MFG A;  3P4R B;  4UDU C;  4P6V F;  4KGR A;  1HXY D;  2L52 A;  3SFE B;  2Y5P A;  3VRA B;  5HFY A;  2ZW0 A;  4RFB A;  1TZO A;  3LXF A;  2IJ0 A;  4WH4 A;  1V97 A;  2W3S A;  1VZ8 A;  1N62 A;  1MHX A;  2WDR B;  4ARC A;  2WXM A;  1TKG A;  1L0V B;  3NVV A;  1RWS A;  3BWU D;  3LYY A;  1XO3 A;  1D5Z C;  2QIE B;  1EM7 A;  1R7S A;  5D3D A;  3Q8B A;  4ZHP A;  1SBB B;  4B0M A;  2V3P A;  5JXV A;  2QSD A;  3O13 A;  3TEW A;  3AE9 B;  1I7H A;  1TKY A;  3HRD D;  2KQ4 X;  1FFV A;  2RDG A;  4ZYS A;  5BYR A;  1I4Q A;  4WQM A;  2RDH A;  5EE9 A;  2E6X A;  3BVG A;  3R2T A;  2WDV B;  2INN E;  4LK0 M;  3AEA B;  4DXG A;  2MJ3 A;  1PYW D;  2WXJ A;  1BUI C;  2QJL A;  1C79 A;  5H8Y E;  1FIQ A;  4DQO C;  1UWX A;  1FCC C;  3U52 E;  1I4R A;  1NEN B;  2GRI A;  2M19 A;  3AE4 B;  1CZP A;  3W5U B;  1SF0 A;  3HVD A;  1JCK B;  2PIA A;  2DYO A;  2LUM A;  1KTK A;  1ZE3 D;  1C77 A;  2FUG 1;  3B9J A;  4H2A A;  5BMI A;  3V05 A;  1GB1 A;  3URY A;  4JE3 B;  2NMQ A;  4YTN B;  2E3T A;  2BS3 B;  1SSN A;  1SJH D;  4WAF A;  4YSY B;  1L6V A;  1NI3 A;  1L0Y B;  2FE8 A;  2AQ3 B;  3LB8 C;  3W1S A;  4US8 A;  1XXG A;  2WXL A;  2W3R A;  1F2R I;  1FNV A;  2K9X A;  4ZHO A;  5G5G A;  1VRA B;  4OVZ A;  3TEX A;  2WXR A;  1C4C A;  1SB3 C;  1E9M A;  3ABV B;  1DOX A;  3PO0 A;  1HQR D;  4XDC A;  4AQ7 A;  2Y3A A;  2AX5 A;  3TUO A;  1FFU A;  1FRD A;  1ET9 A;  1IGC A;  3EUB 2;  2MH7 A;  1EU4 A;  1QOG A;  1JML A;  1GB4 A;  1QLB B;  3EGR A;  1XLO A;  3BK2 A;  2BTE A;  4B0E A;  1C9F A;  1D4B A;  1C4P A;  1TYG B;  1VR9 A;  2PVG C;  1JWS D;  3WCQ A;  1J7B A;  1DOY A;  3N9Y C;  3IXS A;  2N0S B;  3AV8 A;  2X38 A;  3CIR B;  1VZ6 A;  1FEH A;  4JWS C;  1E7P B;  3U4E G;  3CWI A;  1XLP A;  1ENF A;  1PGB A;  4RNA A;  3ZGZ A;  1V1P A;  5I4D A;  1EWC A;  1NEK B;  3ZYY X;  2W82 A;  1K52 A;  4REZ A;  5H92 C;  2D5G A;  2V3N A;  1JQ4 A;  1C76 A;  3V3X A;  1JWB D;  1IBX A;  2K0P A;  3AE1 B;  2NTS A;  3SEB A;  1QIL A;  3AEE B;  3TEY A;  1HEZ E;  1P7E A;  1T6B X;  1CK1 A;  1WYG A;  3ZJU A;  1JRO A;  2KMM A;  1VLB A;  3U7Z A;  3BVZ A;  3ZJV A;  2ONQ A;  3MJ5 A;  4KKJ A;  4A8X C;  1DGJ A;  1E10 A;  5C2T B;  3IAS 1;  1PFD A;  4C7Y A;  3NVZ A;  2JX5 A;  4M0W A;  3NUH B;  2WDQ B;  4RF0 A;  1FO4 A;  3MC0 B;  1FNU A;  2JSV X;  4HJG E;  3R8B A;  4TMA B;  4YXD B;  2BB5 A;  3BYT B;  3VR9 B;  4XWW A;  5EE1 A;  2I38 A;  1RM6 C;  3TEZ A;  2M56 B;  1JRP A;  1WXQ A;  3Q8E A;  1YQ3 B;  4J3O D;  2J53 A;  3PZ7 A;  2VZK B;  2MEK A;  1V8C A;  2WLB A;  2WXG A;  4GLS C;  1EWY C;  5BYS A;  4L23 A;  4TSS A;  4KX6 B;  1SEB D;  3AMZ A;  2EEL A;  4N58 A;  3VQI A;  3AE3 B;  1FRR A;  5HI1 A;  3W5V B;  4A90 A;  1AW7 A;  2N9L A;  3UI3 A;  2GB1 A;  2BYT A;  3B2G A;  4A6Q A;  3I9V 1;  2H89 B;  2GI9 A;  4PT5 A;  2R61 A;  1UWM A;  2Y5C A;  3MHZ A;  2IGG A;  1FCL A;  3NRZ A;  3GB1 A;  2JYE A;  3Q8F A;  4US9 A;  5BMH A;  2PTL A;  3DWM A;  4HRO A;  1N5X A;  3W2D A;  5T8I A;  2N9K A;  3T3N A;  2WXQ A;  3AB5 A;  3E56 A;  4RH6 A;  3ZJT A;  4RF1 A;  4TQ0 A;  4DXF A;  3KWV A;  4RCO A;  1WWT A;  4C80 A;  5FK9 C;  4USA A;  3P4Q B;  1K50 A;  2CJO A;  4IKG A;  1DOI A;  2DYM A;  5EE3 A;  4KGS A;  3BYY B;  3AM9 A;  5LNK 1;  1TKE A;  4A9A A;  4OW0 A;  1PGA A;  1BML C;  3C8Y A;  3E9S A;  1OQR A;  2IGH A;  3IT4 B;  1RFK A;  1P7F A;  2XN9 C;  2Z8L A;  1JWA D;  1MVK A;  1YN5 A;  1QOA A;  1WRI A;  3ETR A;  1J7A A;  2LEK A;  1I4P A;  2KAJ A;  3SFD B;  3H8H A;  1ZPS A;  1N5W A;  1VJK A;  1ZXH A;  2ACZ B;  4AS1 A;  1OQQ A;  1XCT L;  1Y56 A;  4NAW B;  5G5H A;  4YSX B;  1QOF A;  1YJJ A;  2PKO A;  3B2F A;  3P42 A;  4MAC A;  2TSS A;  5C3J B;  3BK1 A;  2I2Y A;  1NYQ A;  3KWL A;  1CQV A;  3NVY A;  2WNM A;  1E6E B;  1XF5 L;  1DYQ A;  3AEC B;  3L4P A;  4HEA 1;  1TY2 A;  3AE2 B;  2RMM A;  2PW9 A;  4JX1 C;  5BYQ A;  2LHD A;  1LO5 D;  2H88 B;  3VR8 B;  2WU2 B;  1F77 A;  1FNW A;  4RGN A;  2ZW1 A;  1QF6 A;  2MJD A;  1B9R A;  2WXF A;  1YMH E;  4EE2 A;  1N60 A;  2QMT A;  1FXI A;  3P63 A;  1C78 A;  2SAK A;  3AE6 B;  4O1N A;  2MJE A;  2BS4 B;  4HKZ E;  3BII D;  3EA6 A;  4RGT A;  3T3O A;  4N6E B;  2JYT A;  4MH8 A;  2BT6 A;  2FBW B;  2DWQ A;  1AYF A;  2B76 B;  2WXP A;  2N7J A;  4R3D A;  5HG2 A;  1F2R C;  1UUP A;  1XCQ L;  1JW9 D;  1I4G A;  1ROE A;  2BS2 B;  4XE0 A;  1V1P B;  4GDK B;  1KFY B;  3AEG B;  4D2K A;  3I57 A;  1VZ7 A;  2JWU A;  1L4Z B;  1T3Q A;  2K3U A;  2V0G A;  1ZP0 B;  2BB6 A;  4GDL B;  5MPO A;  2G9H D;  3FC4 A;  5BMG A;  4KGT A;  1IBX B;  4YWG G;  1Q10 A;  1XLN A;  2DLB A;  1NYR A;  4XWT A;  2J42 A;  1STE A;  1JWU D;  2LJI A;  4YSZ B;  1HA5 A;  2WP9 B;  1CJE A;  1HZ6 A;  4HRS A;  2LFI A;  1KLG D;  5E6J A;  1YNT E;  1ET6 A;  1D6E C;  5AUI A;  4WIP A;  1BXT A;  1ZDX A;  2W54 A;  3SR6 A;  1SJE D;  2YEP B;  1TS4 A;  3BZD B;  1J7C A;  1XEE A;  1ZOY B;  3Q8A A;  2QEJ C;  4IDI A;  3HVZ A;  1AN8 A;  4WUR A;  1ZUD 2;  2JXT A;  1ZXI A;  3W9C B;  3RFZ B;  2JZP A;  4L1B A;  1GAQ B;  3AE5 B;  4A55 A;  3AED B;  1D5M C;  2PVO D;  2LMC A;  2KAC A;  3DWG C;  4YTM B;  3AN1 A;  1MI0 A;  4XDD A;  3KLS X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...