2N0SB

Haddock model of ferredoxin and [fefe] hydrogenase complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
94
structure length
94
Chain Sequence
YKVTLKTPSGDKTIECPADTYILDAAEEAGLDLPYSCRAGACSSCAGKVAAGTVDQSDQSFLDDAQMGNGFVLTCVAYPTSDCTIQTHQEEALY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fe-hydrogenase
publication title Structural Insight into the Complex of Ferredoxin and [FeFe] Hydrogenase from Chlamydomonas reinhardtii.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Oxidoreductase
total genus 19
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2n0sB00
1QT9A 1WXQA 5EE9A 4C7ZA 1TYGB 5H92C 1XLQA 2LEKA 1T3QA 2G1EA 2JQRB 2Q5WD 2WU5B 3HVZA 4YTPB 5EE3A 2WP9B 1WYGA 3B9JA 2AX5A 3AEGB 2CJNA 1FM0D 2WU2B 3L4PA 4JWSC 4YT0B 3AE9B 1PFDA 3VRBB 2M19A 3B2FA 2PKOA 1J7AA 1I7HA 2DBYA 1WWTA 5C2TB 3BIID 1JW9D 3AEAB 1QOBA 4USAA 2Y5CA 5MPOA 3NVVA 3P4PB 3P63A 1L5PA 2N0SB 1J7BA 2H88B 2WS3B 1CJEA 2WDRB 4KX6B 1NVID 1ZUD2 1TJEA 1R7SA 1YQ4B 3NS1A 3VR9B 4YXDB 3FAHA 1FRDA 3AE6B 1CZPA 1VDVA 2W54A 3HRDD 1FFVA 1FIQA 1NYQA 5C3JB 3AMZA 1JWAD 4P6VF 1N63A 1DOIA 1SF0A 1A70A 2B76B 2W3RA 1IUEA 1YJJA 4IDIA 3SFEB 2M56B 3W9CB 1FRRA 4HRSA 1UWMA 2CU3A 3P1MA 2DWQA 3AE4B 3ETRA 2KAJA 1E6EB 1RYJA 4LTUA 3AE2B 1RM6C 5H8YE 3AE8B 4WWMA 1L6VA 1E10A 3P4SB 3ABVB 1PUTA 3AEFB 3KWLA 3VRAB 1N5WA 3WCQA 4ZHOA 1F0ZA 1NI3A 1EWYC 2HTME 4N59A 1FXAA 1SB3C 1V97A 1E7PB 3DWGC 4FXCA 3AV8A 3NRZA 3NVZA 1ZP0B 5AUKA 2BS4B 2OHFA 5AUIA 1ZOYB 1WRIA 4WQMA 1L6UA 1FMAD 1OQRA 1N60A 1VJKA 3LXFA 4HROA 2BS2B 1XLNA 2L83A 2MJ3A 2W3SA 1NYRA 3SR6A 1B9RA 5EE0A 1E0ZA 3FC4A 4N58A 1JALA 1XLPA 1FXIA 1SIJA 3AH7A 1AWDA 1XO3A 1J7CA 1AYFA 5G5HA 3AEBB 1NENB 1QLBB 1OQQA 2BS3B 3PO0A 3CIRB 2QJLA 3AE5B 3AEDB 3AB5A 2MJEA 4JWUC 3VR8B 3W5UB 3AE7B 1JQ4A 1ZXIA 4ZOHC 1TKYA 2EKIA 4C7YA 4US8A 4YTMB 2PIAA 1ROEA 3ZYYX 1N5XA 3NVYA 3P4QB 3AECB 3DWMA 1QF6A 4YTNB 3SFDB 4YSXB 1FO4A 1XLOA 1KF6B 2ACZB 2WDQB 1E9MA 5EE1A 4C80A 1KFYB 2MJDA 2PVOD 2BT6A 1VLBA 1PDXA 1YQ3B 2CJOA 2L52A 4US9A 1JRPA 2QIEB 1WGKA 5G5GA 1NEKB 1QOFA 2E3TA 3B2GA 1RWSA 1DGJA 1RFKA 2WQYB 4YSYB 1L0VB 4YSZB 2MH7A 2JX5A 1V8CA 3AN1A 1JROA 3EUB2 1TKGA 3HUIA 4ITKA 1QOGA 2PVGC 1DOXA 3W5VB 2H89B 1N61A 2WDVB 3LB8C 3AE1B 1TKEA 4JX1C 2FBWB 5GXGB 3AM9A 4ZHPA 2K22A 1N62A 3NVWA 1YJIA 3RPFC 1JWBD 2W55A 1DOYA 2WLBA 1GPXA 4N6EB 1GAQB 1FFUA 1QOAA 2K9XA 3AEEB 3P4RB 2KMMA 2K5PA 1OFFA 3AE3B 3CWIA 4A9AA 1KRHA
chains in the Genus database with same CATH superfamily
3SD5A 1WFYA 5CTRC 1FNUA 2KO3A 2N9XA 2AX5A 3AEGB 2RDBC 4RF0A 3Q3MC 4ARIA 2WU2B 1GUAB 4ICUA 4YT0B 2ZCBA 2J0KA 4MH8A 5BYRA 3AEAB 2D3CA 2WHIA 2KNBA 1L5PA 2N0SB 2KDEB 3PZDA 2ZVNA 2I1KA 1ZUD2 1YQ4B 4LDTB 3DBHB 3WIMA 1VDVA 2RPVA 2UWQA 3D32A 1NYQA 2W3RA 2ZNVB 2JF5A 3PV1A 1BUIC 3TCAA 3PGEA 3W1YA 3MJ5A 3WCQA 1NI2A 1J8CA 1XCQL 2QDFA 2KX3A 2MP2A 1GOZA 2Z0DB 3ZNGC 4CHKA 1IGCA 5CHVC 3VVWB 3APCA 3AI5A 4A3OA 5DPWA 4WQMA 1TT5B 3KVFB 1FMAD 3Q8AA 1U4AA 4HLEA 4E71A 1XLNA 4ANUA 2IO2B 2W82A 1KLUD 4FADA 4S0RA 4XE0A 2L76A 2PPHA 3N1XC 4RM8A 4MELA 3DBLB 2LGSA 3C19A 3TIXA 4C4VA 4JPSA 4YSZB 2CU1A 3WA0A 3EUB2 4XGAB 1QOGA 2PVGC 3RNEC 2KC2A 1V9JA 2RSUA 3BK1A 3BY4B 4BKTA 1QOAA 3CWIA 1YJ1A 2DYBA 3NUHB 4K3BA 1T0QC 3ZRFA 3IFWB 4L1BA 3NHEB 1T3QA 3R7QA 2LJ5A 3WAOA 2G9HD 3B9JA 2KLCA 2QCZA 3B2FA 4RCOA 3LJ3A 2FCNA 3OJ3A 1C3TA 1T0RC 1XCTL 2QILA 3AULA 2MBHA 4S17A 1TJEA 3ENEA 1UH6A 4GDKA 4ANXA 3R3MA 5BO4B 1WX9A 3SFEB 4AJWA 2BYTA 4FJVB 1UWMA 2GBRA 4XWTA 5DPRA 2C5LC 4LTUA 4KSLC 3ABVB 2GOWA 1XXGA 2INNE 3VTVA 1Z2MA 3QWZB 1YQBA 3RNBC 1P3QU 4C4VB 3VTUA 2WXNA 2KMAA 3U52E 1EM7A 3LXFA 1FCCC 1WGDA 2BWES 1IGDA 2TSSA 2KXJA 3WAMA 1P1AA 4N58A 4NAWA 2JU6X 2KWUB 2YEPB 1VZ6A 3TJPA 4P7IA 2O6VD 5HFYA 3PLUA 2ASQA 3DBRB 2INCC 1AN8A 4K7SA 4H2AA 4C56C 1FO4A 3VQIA 4C80A 3HHMA 3Q3NC 4EOYA 1C9FA 4IOIE 1YNTE 2CHWA 2ZEQA 4GDKB 4W9HA 1HXYD 1WJUA 3AN1A 3EA6A 4MM3B 2KOXA 3W5VB 1TZOA 2H89B 2WGSA 2D3GA 3DHIC 2J0MA 2V9HA 5FR3A 2D5GA 3ZNZB 3MC8A 1N62A 2R2QA 2IGDA 3DVNV 1GAQB 2CR5A 4B95A 3TEZA 1KH0A 2N9KA 2NPTA 3Q6BA 1TYGB 4KKJA 3O13A 2LEKA 2JQRB 2ZPYA 3P42A 3PZ7A 2KD0A 3ZW3A 5FKAC 2DBYA 1YN5A 3V6CB 5JXVA 3UGBB 3A9KA 1KLVA 3H6NA 4NNJB 4XYCA 2MSED 2JWUA 1JWMD 4NAMA 2L0FA 3AE4B 1HZ6A 3ZJUA 2FUHB 4NJ6A 2M0XA 2HTME 2KMCA 4KZ0A 2SAKA 1SE2A 4ZRQA 3ZVVA 1ZOYB 5JHAA 3VTWA 2FNJB 5JHBA 2QSDA 3R8BA 1OQYA 3A1QA 1XO3A 3QCAA 2MBQA 2KANA 2BS3B 3AEDB 3DVNU 1SXTA 3T3OA 3I57A 2EKEC 5DCNA 4IUMB 1J0GA 4K7UA 2EMSA 4HKZE 2KZRA 2IGHA 2L00B 4KSKC 5LXHA 1KFYB 2L7RA 3I3TB 4OVUA 2DZJA 3A9KB 1WGKA 3VFKA 4IW0A 5TR5A 2PE6B 4FJYA 1RWSA 1ENFA 3PRMB 2ZJDA 2K6DB 1F1HA 3B08A 2L3ZA 3PLVA 3MP9A 4LDTD 5DPTA 3AE1B 3L17A 2IY0B 3X0WA 1XQQA 3MHZA 2CS4A 4WJPA 1OFFA 1C4AA 2MEKA 3BVGA 2MLBA 3IAS1 3GOEA 2DYMA 1C4PA 4CO7A 4FA6A 2KT7A 2LGIA 4KKIA 1DYQA 2JWZA 1I7HA 5D6JB 4KGRA 5MPOA 2AEHA 1WH3A 1JRUA 2CHZA 2H88B 1ZPSA 1FXTB 4BVUC 2NBVB 2LMCA 1T5XD 1L0XB 5LLIA 4KZCA 1D5ZC 3AXCA 2DZIA 3H7PA 5BMGA 3URYA 5TSSA 1I4QA 3KWLA 2MBOA 1PQSA 2N7EA 4FXCA 4DDGD 4AUQC 3ZGZA 1E90A 2GBNA 4M8MA 1I4HA 4M00A 3ONSA 1T0SC 4M0WA 3RNCC 3BK2A 2OOBB 3K9PB 5EE0A 1FXIA 1AWDA 4TQ0A 3EC8A 1C77A 1MJDA 5FK9C 3VDZA 1ZXIA 4I6PA 1TS3A 1WIAA 3KLSX 3NZUA 1N5XA 4YSXB 1E7VA 3GE3C 3QARA 1STEA 3NZSA 2J42A 1WRDB 3Q3OC 4EE2A 3GZNB 2WYQA 1QOFA 1TIFA 2Y3AA 5CHWA 3RUIB 3H7PB 1GB4A 3QJZA 2DZKA 4KGTA 4ITKA 3MC0B 3M62B 2WXQA 2WDVB 2PMVA 4HCNB 4JX1C 1P7FA 1JWBD 2W55A 3BYTB 1QQRA 3L10B 2VH2A 2K9XA 4IM0A 4GLSC 3P4RB 2KJRA 2JYEA 4A9AA 1AYFA 1KRHA 1Y8RC 3N1YC 4HKQA 3W1SA 5H92C 4M0WB 5AZHA 2KACA 1EWCA 2WX0A 1FM0D 3L4PA 4LNNA 5J18A 3AE9B 4FHKA 3RI7C 3RZFA 3N32A 4FJZA 3BYYB 3SDLC 2O6VB 3IT4B 3E9SA 3VR9B 4DXFA 1WZ3A 5C3JB 3AMZA 1ACCA 3UIOB 5AEKB 1A70A 3EGRA 1EU4A 4JL9A 4A3PA 1V5TA 2LVPA 4EKUA 1L6VA 4MEMA 5HHDG 3VRAB 1N5WA 4KV2A 1KJTA 3NRZA 3NVZA 4OZCA 3VUYA 2KFKA 4PS7A 3QAQA 5JH5C 4AS1A 2FIDA 4FN2A 1F2RC 2N9LA 3ZTCA 2BGFA 2L1AA 4W9CA 1ZDXA 3FKYA 3E56A 3CSTA 3ML9A 1X1MA 3EHVA 3AE7B 2K8HA 1UGJA 4MH0E 2D07B 3MFGA 1ZW7A 2I1JA 3KYDD 3NS8A 2MJDA 3OLMD 1UZXB 2NBUA 1VCBA 2K25A 4I6NB 2C60A 1TS2A 2Z59B 2BYFA 3VUXA 2LWPA 3DOWA 3HM3A 4Q2JA 3MC9A 2DYOA 2L8JA 2C7HA 2HTHA 4KDIC 2BKFA 3RCZA 2KX0A 4WIPA 5IKCM 1DOYA 3CMMB 1CQVA 4N6EB 4WWPA 3RULA 1EO6A 5EE9A 4G11A 3HVZA 3UF8A 3FILB 4URKA 5CHFA 4YTPB 3DDCB 2UYZB 2I2YA 3LYYA 2M0AA 2C9WB 4II2B 4EEWA 5E6PA 1QOBA 3PS6A 5JZEB 1WSPA 3B0AA 1KTKA 2J4XA 4K3CA 2DNFA 3PVLA 2JRIB 4PK1A 3A4SC 1IUEA 2IBIB 2WXPA 3ZDMC 1BXTA 2DWQA 2KAJA 2QHOA 1TTNA 4TKNA 3KWVA 1EWYC 1V97A 1V6EA 5EDSA 4IG7B 4B0EA 1ZP0B 2IO1B 3IBEA 3T3NA 2L32A 3N30A 1OQRA 3L13A 4HROA 3FC4A 5E6OA 2LRUA 4TUUA 1NENB 1LGRA 5G2NA 4JWUC 4US8A 4I6LB 2XK5B 2LFIA 2PTLA 2XNAC 1AW7A 4HPPA 2V1YA 3JSVA 4HWIB 1VR9A 1UELA 4MGIE 1C79A 2ZZPB 1ZDVA 2X8XX 3OJ4B 2R61A 2MRPA 1EF1A 1V5OA 2KVRA 1YOVB 3DQVA 3SU8X 3K9OB 3CSFA 4RGNA 5BYQA 1N6ZA 4RNAA 4OVVA 4MJSA 2MW5A 4GXBA 3NOBA 2NCNA 2KDFB 4O1NA 1WXMA 4ANWA 1WX7A 3DBLI 3ALBA 2WU5B 4F7ZA 4YL8A 1E8ZA 1D3ZA 1MI0A 3BIID 2KTFA 3P63A 3Q3JA 2D3AA 1E5WA 5D7GA 3PTFC 1CZPA 2O2VA 4MGZE 2MP2B 3H9DA 2KDMA 2A4ZA 1YJJA 4IDIA 1SGHA 2I38A 1FRRA 3P1MA 4G3XB 1E6EB 4AOFA 3N1ZC 1MG4A 1ESFA 3AEFB 2WX1A 1NI3A 1FXAA 1T6BX 2JZ3B 4TV3A 2LHDA 4IWPA 1R4MB 4GSWA 5G55A 1WM3A 1VZ7A 4P1CC 1B9RA 1VRAB 2R2OA 1GB1A 3RNGC 2LGYA 5DPSA 3TEYA 1K51A 2M1MA 3L08A 3PO0A 3QC8B 1D4BA 1WXAA 2LXAA 5C1ZA 1C76A 1ROEA 4XDCA 3C0RB 4YTNB 3SFDB 2V0GA 3PRPB 3ZQ4A 1VD2A 5AZGA 5KHQA 5J2RA 1P0RA 1FPYA 4KGSA 2QIEB 2WXRA 4JLCA 2J53A 4M8NA 4YSYB 1D6EC 2J52A 1JROA 2YLMA 3HUIA 1XEEA 3LB8C 1JWUD 3PZ8A 3OAWA 3V61A 1FFUA 4F1SA 2KMMA 1E8XA 2ZPNA 4BZAA 4W9GA 4PYUA 2K0PA 4NY0A 3MTNB 1WGHA 2AYOB 2AQ3B 2HDEA 3A4RA 2OJRA 1MHXA 4ZYSA 1NDDA 4MSMB 2GB1A 1YX5B 2RDGA 2PJHA 1P7EA 4ZRIA 5C2TB 2GBMA 4DK5A 4B0MA 4PT5A 2IO3B 2JY6A 2M17A 5E6NA 4B9KA 2W54A 2WXGA 3A9JA 3WALA 2KFJA 1CK1A 2KQ7A 5IOIA 2EELA 3TSSA 1K50A 2N9EB 3RD2A 3KW5B 3UQAA 2KTRA 4NAWB 2LGDA 4A55A 2WXLA 3ZKJC 3GP7A 4K7WA 3ML8A 4KIKA 1V86A 3LDZE 2IY1B 2JSVX 4HPLB 4W9FA 2MBBB 4LNOA 4RGTA 1XD3B 2W3SA 1NYRA 3VHTC 3PSEB 1L7YA 5G5HA 4AP4C 1TGZB 1SE4A 3DHHC 4FHJA 4EZJA 3R2TA 3AE5B 4G50A 4HDQA 1GC7A 3P4QB 5BMIA 1KF6B 1Y56A 2WXOA 2HJ1A 3DCGA 3CF6E 4BAXA 4TQ1A 1V2YA 1WM2A 4DDID 1F2RI 3ZNID 1B1ZA 1K8RB 3Q69A 2MX2A 3IVFA 3A9JB 4ACFA 1L0VB 1V8CA 3TMPB 3GB1A 3ZTDA 1I4XA 3N20C 1CMXB 1YN4A 2NPTB 1N61A 3L0WB 2GBJA 4BBNC 2LXCA 3HK0A 2JZPA 1C78A 2KTRB 2VH1A 3AE3B 4DHZE 4KIKB 3NJTA 1QKZA 4PS8A 3V3XA 2RD0A 3IAM1 3P4PB 4X57B 2K8BA 4FLHA 5BYSA 3AE6B 3UINB 3HRDD 4ZDVA 4DHJB 1JWAD 2E6XA 2BYEA 4II3B 1K53A 2CU3A 2LZ6A 3C8YA 1UUPA 2G45B 1FCLA 2GI9A 4HK2A 4ZHOA 3VH4B 3PHWB 1E7PB 4JE3B 3A1QB 2VZKB 5AUKA 2NMQA 1VJKA 3U7ZA 2GLSA 2BS2B 1MG8A 1D5MC 3H1UA 1UBQA 4DXAB 3RN9C 1GG3A 3O65B 3CIRB 3AB5A 2REXA 3KUZA 1M94A 4P16A 1PYWD 5BMHA 2N1VA 1V1OA 2NR2A 2WDQB 1I4GA 3QA8A 4BBNF 1JWSD 1EUVB 2VRRB 4JQWC 2BVCA 4DBGA 4HJKA 3R66C 1DGJA 4OZAA 1IYFA 1F77A 4GB9A 4XC2A 3SEBA 3ZRCA 3IHPC 4WJQA 5GXGB 4BKGA 3NVWA 1WF9A 1H8CA 2IO0B 3QQ8B 2K5PA 3GZNI 1PGBA 2IGGA 1XT9B 2CJNA 4GN1A 2PKOA 4UDUC 1WWTA 1WMHA 2Y5CA 4W9LA 2BBCA 4NZLB 1L4ZB 4P6VF 1ZXHA 2B76B 1IBXA 1WJ6A 1Q0WB 1RYJA 3P2BA 4YWGG 1LO5D 4K1RB 3AE8B 1KOTA 3T8MA 1F0ZA 3DHGC 4JIOU 1WXVA 4N59A 3DWGC 3R7RA 2FE8A 3L16A 2EMTA 4MGKE 4WQOB 1R4NB 2MJ3A 3PPAA 3VH3B 2V4LA 5I4DA 2G3QB 4RGOS 3T9LA 1F52A 2KVZA 4BKSA 4GOCA 2NBWB 2Z0EB 2MJEA 2DLBA 2BW2A 2PIAA 4QAYA 2FCMA 1V81A 2DAFA 1E9MA 1WMHB 1WY8A 2HE7A 3H8HA 1H4RA 2LASA 3PHXB 1J19A 3ZXRA 3UI3A 3DVGY 1GJZA 2SEBD 2INDC 2C7NB 2KN4A 3EECA 5LNK1 2JXXA 1Q5WB 1WGYA 5AZFA 1OEYJ 1FEHA 2M8SA 3S2AA 4ZYNA 5HKHA 3VRBB 1J7AA 2BPSA 5FR6A 3U4EG 5HI1A 2LVQA 2ON8A 2KQSA 4LJPB 3QIJA 3NY5A 2D10A 4WAFA 1EF5A 1FRDA 3Q8CA 1V1PA 1FIQA 2WXJA 1DOIA 2M56B 2KFKB 4LLGM 1I4RA 2V3PA 2BF8B 2PEAA 2LI5A 1TY0A 4A20A 2C7MB 1UBIA 2K8CA 4W9DA 3NZ3A 1P98A 2JZZA 2MCNB 2KKCA 5IAAC 3Q8EA 1L6UA 3U8ZA 4LNIA 5KHOA 1TZ1A 3ZXVA 1E0ZA 4C00A 2MBEA 2LD9A 5L95C 4BOZB 1SIJA 2QC8A 1HQRD 1J7CA 1T0YA 3GE8C 2LRWA 2XN9C 1OQQA 3HM6X 2QJLA 1TKYA 4ANVA 2ICIA 2MWSB 3PRZA 2KYWA 4M01A 1WYWB 2JRHA 4LNKA 3DBHI 4A8XC 4AQ7A 1ET6A 2LGXA 2ZVOA 2AL6A 3HIZA 3B2GA 1V1PB 1RFKA 1L4DB 1RFAA 4FULA 2RR9A 4LNFA 1Z5SB 2WXMA 3I9V1 4M02A 4DHJD 1YIWA 1FNWA 2CKHB 3IXSA 3KH0A 2VZKD 4JWSC 4DHZB 2XEWA 3MJWA 5CX3A 1HA5A 1SSNA 3Q8BA 4W9KA 4HCPB 3VAWA 1Q10A 1PGXA 2N4FA 2FAZA 2K6QA 1WR1A 3RZWC 1N63A 1MFWA 4GDLA 1OEYA 1UD7A 1LXDA 3AE2B 3DVGX 3P4SB 2KLGA 2V4IB 4OZBA 2BQQA 4RGMA 2FCQA 5IO9A 1ZGUB 4LCDE 2MHJA 2KK8A 1Q1OA 2OHFA 3N3KB 2V3SA 4WAAA 4EFOA 2GRIA 3RNAC 1KM7A 1YX6B 4F8CB 2PE9A 1QLBB 3ECIA 3JSVB 3W5UB 2KDIA 3AU4A 4TSSA 3GS2A 4ZOHC 3RT3B 2WXFA 4C7YA 2AL3A 3PREA 1R4MI 4DXGA 4WJNA 2Y5BB 2BT6A 1VLBA 2L52A 1SBBB 1JRPA 4MJSB 2X38A 5J17A 4MDKE 3BZDB 5T8IA 4OHJA 3W1SC 2JYTA 4GDLB 3IG3A 3RNFC 1WE7A 2K3UA 4DWFA 3VXWA 1GPXA 4B6WA 1UGMA 2OEDA 1OTRB 4MM3A 2L0TA 2ONQA 1QILA 4C7ZA 1I4PA 1YD8U 2Q5WD 5EE3A 4HJGE 3APFA 2O2VB 1HZ5A 1TBEA 3DBRI 4USAA 3NVVA 4J6IA 4GGQA 2GMIC 2WS3B 4KX6B 1NVID 4YXDB 1R7SA 3FAHA 1MPEA 1MVKA 2QMTA 3M3JA 5GMVA 1G6JA 2WXKA 3TEWA 1WR6E 1P9DU 1FD6A 3RFZB 3V6EB 3L54A 1SB3C 3AV8A 2IYDB 2G4DB 2BS4B 3TBLD 1SJHD 3RYTA 1MHHE 2LVOA 1XLPA 2RMMA 3AH7A 3X23A 4ZRPA 1JQ4A 1PGAA 4WURA 3U30A 2FUG1 3PT2B 2EKIA 4ICVA 1E8YA 3NVYA 3DWMA 1QF6A 3QX1A 5D3DA 1E8WA 4NQKE 3NG0A 4MSQB 4LK0M 4D2KA 2V3NA 2MQJA 2BTEA 1YQ3B 4US9A 4MT5A 1SE9A 5G5GA 1WJNA 2KC1A 2MH7A 2K39A 4HVBA 4BKSD 1E7UA 1JCKB 4LJOB 1WJ4A 4NPNA 3OWEB 2ZNVC 4WWOA 3JW0X 1RLFA 2PW9A 2WLBA 1IPGA 4HPMB 1LM8B 5E6JA 3RMKC 3ZJVA 4EUTA 4W9EA 2WXHA 3I5JC 2NTTA 3V62A 2Y5PA 3W2DA 3WAPA 3M63B 2G1EA 4AJYB 4W9JA 2JPHA 2KJ6A 2AQ2B 4PS3A 3ZJTA 2QEJC 2J0JA 4G0NB 3NS1A 3ZNHB 1LQBA 4RM9A 2HD5B 1JMLA 3UIPB 1WXSA 4HRSA 2NTSA 3ETRA 3Q2AC 1RM6C 2IDYA 4JGHB 2RPQA 4OW0A 5L83A 1PUTA 4XDDA 1WZ0A 2D11A 4AWJA 4EZLA 2M4NA 1ET9A 4TMAB 3MHSD 1WRIA 2N1WA 3OG5A 1TY2A 3U2SC 2OJWA 5C23A 3TL5A 2IZVB 3BVMA 2L83A 1SIFA 4XX5A 3KUCB 1JALA 5D3IB 2D2QA 1HTQA 2KQ4X 4A90A 2J7QB 4IWQA 2KWDA 2ACZB 4XZ4A 2LJIA 1GC6A 2PVOD 2DENB 1RRBA 4BOSC 1L2NA 4A6QA 4KDLB 1WI0A 2WNMA 3ZIMA 2YVCA 4IKGA 2MA9B 3M95A 4EZKA 1M4VA 1TKGA 3N9YC 1TKEA 2FBWB 1V80A 3J9CA 4IM3A 4ZHPA 2UU7A 3VUWA 2WWZA 2PLPA 2IJ0A 2ZW1A 1WXQA 3BWUD 4XWWA 2AWTA 1XLQA 4HEA1 2WP9B 4E3CA 4WH4A 2W9NA 2M19A 1YN3A 4J3OD 1J7BA 2CHXA 4HDOA 1CJEA 2WDRB 3JVZX 3EFCA 1FFVA 2KWVB 1L0YB 3WANA 1SF0A 2AQ1B 3W9CB 3B1LX 2L05A 4FBJB 5IP4D 5D94A 2JT4B 2O6VA 1E10A 4KVGB 3TUOA 2RGFA 4IC7B 1RAXA 4CYEA 3KYCD 3ZO5B 1YMHE 4IM2A 4CQNA 3R2IA 1XF5L 1N60A 2BKRB 2LUMA 2INPE 4NQLB 3IT6B 1SJED 4L2YA 1OGWA 4ZRKA 4W9IA 1ZKHA 4GIVA 1IP9A 3VR8B 1ZE3D 2N9PC 1EU3A 3KUDB 4MGYE 1ISNA 4L23A 2NS5A 1XLOA 1C1YB 2B3AA 3TEXA 4NJ7A 1R4NI 1HEZE 4GMVA 2D3BA 1BT0A 2NVUI 2E3TA 4REZA 4N9F4 2WQYB 4WWNA 2JX5A 2KJHB 1DOXA 1I35A 5HG2A 1TS5A 4OVZA 3AU5A 2KN5A 2ZCCA 1YJIA 3RPFC 4ASWC 3AEEB 1WX8A 3Q14C 1QT9A 5IA7A 4RH6A 2YEPF 1WYGA 1FNVA 3ZUNA 4NJCA 2N7JA 2DZMA 2KDBA 1PFDA 2HJ8A 3A33B 1IBXB 2G4SA 1JW9D 3JYUA 2BB6A 4GU2A 2BYVE 2K1FA 1KLGD 1HE8A 1D5XC 3FILA 4E74A 3H7SA 2BB5A 2JUOA 2DAJA 4RFBA 2LUEA 3SHQA 2WDTB 4ZRJA 1TS4A 3DPDA 1UNSA 2A5UA 1QZEA 2FCSA 1F9JA 4MACA 5H8YE 4WWMA 4RF1A 4R3DA 1S3SG 3QK0A 3UQBA 2GBKA 1UWXA 4RMAA 2DX5B 4BFRA 3HVDA 2BWFA 5AUIA 1NBFC 3KQ4A 1SEBD 3I63C 5IN7A 3SR6A 1A5RA 4PYZA 3V60A 3Q8FA 1AARA 3BVZA 3QHTA 3Q3FA 3AEBB 1WGRA 2JVCA 3U7DA 1C4CA 2ZW0A 4YTMB 1SE3A 1WGGA 3DBSA 3ZYYX 1V49A 3AECB 1S1QB 1GNUA 5EE1A 2N7DA 2LHEA 3ZDTA 4DQOC 2KWCA 2KHWB 3EFUA 2RDHA 1PDXA 2CJOA 2FIFA 1I42A 4IWOA 3BINA 1LFDA 2Z8LA 2XK5A 1NEKB 1VZ8A 1WE6A 4K81A 5LXIB 1K52A 3V05A 1BMLC 3APDA 2XBBC 1UF0A 3ZLZA 2JXTA 2IPKD 5D2MB 3AM9A 2K22A 4ARCA 4HXDA 4P1BC 2DHZA 4WJOA 2WXIA 1HTOA
chains in the Genus database with same CATH topology
4HKQA 2ONQA 1QILA 4C7ZA 1I4PA 3W1SA 5H92C 2KACA 2Q5WD 5EE3A 4HJGE 1EWCA 1FNUA 2AX5A 3AEGB 4RF0A 1FM0D 1QKZA 2WU2B 1HZ5A 3L4PA 4YT0B 3AE9B 4ARIA 4MH8A 5BYRA 3AEAB 4USAA 3V3XA 3IAM1 3NVVA 3P4PB 1L5PA 2N0SB 3BYYB 2WS3B 3IT4B 4KX6B 1NVID 3E9SA 1ZUD2 3VR9B 1R7SA 1YQ4B 4YXDB 5BYSA 3FAHA 3AE6B 1VDVA 1MPEA 1MVKA 2RPVA 3HRDD 2QMTA 1NYQA 4DXFA 3AMZA 1ACCA 1JWAD 5C3JB 2E6XA 2W3RA 1A70A 3EGRA 2WXKA 1EU4A 1K53A 3TEWA 1BUIC 2CU3A 3C8YA 1UUPA 1FCLA 1FD6A 2GI9A 1L6VA 3MJ5A 4ZHOA 5HHDG 3VRAB 3WCQA 1N5WA 3RFZB 1XCQL 1SB3C 1E7PB 3AV8A 1GOZA 4JE3B 1IGCA 3NRZA 3NVZA 2VZKB 4OZCA 5AUKA 2BS4B 1SJHD 4WQMA 2NMQA 4AS1A 1FMAD 3Q8AA 1VJKA 3U7ZA 1F2RC 1MHHE 2N9LA 2BS2B 1XLNA 2L1AA 1D5MC 1ZDXA 3E56A 2W82A 1XLPA 2RMMA 3AH7A 4ZRPA 1KLUD 3CIRB 3AB5A 1JQ4A 1PGAA 3AE7B 4WURA 1UGJA 2FUG1 2EKIA 4P16A 1PYWD 5BMHA 3NVYA 3MFGA 3DWMA 1V1OA 1QF6A 2WDQB 5D3DA 1I4GA 2MJDA 4XE0A 4LK0M 4D2KA 2V3NA 2BTEA 1JWSD 1YQ3B 4US9A 4MT5A 1TS2A 5G5GA 4Q2JA 1DGJA 4JPSA 4OZAA 2MH7A 4YSZB 2DYOA 1F77A 3EUB2 1JCKB 1QOGA 2PVGC 3SEBA 5GXGB 3OWEB 3BK1A 4WIPA 3NVWA 1DOYA 2PW9A 1CQVA 2WLBA 4N6EB 5E6JA 3ZJVA 1QOAA 2K5PA 3CWIA 3NUHB 1PGBA 2WXHA 2NTTA 5EE9A 2Y5PA 3W2DA 4L1BA 1T3QA 2G1EA 3HVZA 3FILB 4YTPB 2IGGA 2G9HD 3B9JA 2CJNA 2I2YA 3LYYA 2M0AA 3B2FA 2PKOA 4RCOA 4UDUC 1WWTA 1QOBA 2AQ2B 2Y5CA 1WSPA 3ZJTA 1XCTL 2QEJC 2BBCA 4NZLB 2QILA 1TJEA 1KTKA 2J4XA 3NS1A 1L4ZB 4P6VF 1ZXHA 2B76B 3SFEB 1IUEA 1JMLA 2BYTA 1IBXA 4HRSA 1UWMA 2WXPA 1BXTA 2DWQA 2NTSA 4XWTA 3ETRA 2KAJA 1RYJA 4LTUA 4YWGG 1LO5D 1RM6C 2IDYA 3KWVA 3AE8B 4OW0A 3ABVB 1PUTA 1F0ZA 4XDDA 1EWYC 1XXGA 4N59A 2INNE 1V97A 3DWGC 2FE8A 1ET9A 4B0EA 4TMAB 1ZP0B 3T3NA 2L32A 1WRIA 2WXNA 3U52E 1TY2A 3U2SC 1EM7A 1OQRA 3LXFA 1FCCC 1IGDA 3BVMA 4HROA 2TSSA 2L83A 2MJ3A 3FC4A 4N58A 1JALA 5D3IB 2JU6X 5I4DA 4RGOS 1AYFA 2KQ4X 1NENB 2YEPB 1VZ6A 2MJEA 4JWUC 4A90A 5HFYA 2DLBA 1AN8A 2BW2A 4US8A 2PIAA 4H2AA 4C56C 2KWDA 2LFIA 2PTLA 2XNAC 1FO4A 1AW7A 3VQIA 2ACZB 1E9MA 4C80A 2LJIA 2PVOD 1C9FA 1VR9A 3H8HA 1C79A 4IOIE 1YNTE 1ZDVA 4A6QA 2WNMA 2R61A 4GDKB 4IKGA 1HXYD 3AN1A 1M4VA 3EA6A 4RGNA 5BYQA 1TKGA 4MM3B 3UI3A 3N9YC 3W5VB 1TZOA 2H89B 4RNAA 1TKEA 2SEBD 2FBWB 3J9CA 5FR3A 2D5GA 2KN4A 4ZHPA 1N62A 2IGDA 2PLPA 5LNK1 1GAQB 2IJ0A 2ZW1A 4O1NA 1FEHA 3TEZA 1WXQA 3BWUD 4XWWA 1KH0A 2N9KA 1TYGB 4KKJA 1XLQA 2LEKA 2WU5B 2JQRB 3O13A 3P42A 4HEA1 3PZ7A 2WP9B 4WH4A 5FKAC 3VRBB 2M19A 1J7AA 2DBYA 3U4EG 1MI0A 1YN5A 1YN3A 3BIID 5HI1A 2ON8A 5JXVA 3P63A 4J3OD 1J7BA 1CJEA 2WDRB 4WAFA 5D7GA 1FRDA 3Q8CA 1CZPA 1V1PA 1FFVA 1FIQA 2JWUA 2WXJA 2KDMA 1JWMD 1L0YB 1DOIA 1SF0A 2AQ1B 4NAMA 1YJJA 4IDIA 2I38A 2M56B 4LLGM 1FRRA 3W9CB 1I4RA 3P1MA 2V3PA 3AE4B 1HZ6A 1E6EB 3ZJUA 1E10A 1TY0A 1ESFA 3AEFB 3TUOA 1NI3A 2HTME 1FXAA 3NZ3A 2SAKA 1SE2A 1T6BX 4ZRQA 1YMHE 1ZOYB 2LHDA 4CQNA 3Q8EA 3R2IA 1L6UA 1XF5L 1N60A 1VZ7A 2LUMA 2INPE 3IT6B 1SJED 4L2YA 1E0ZA 1B9RA 1VRAB 2QSDA 1GB1A 3R8BA 1SIJA 3TEYA 1K51A 1HQRD 1J7CA 1XO3A 2XN9C 1OQQA 2BS3B 3PO0A 2QJLA 1D4BA 3AEDB 3VR8B 1SXTA 3T3OA 1ZE3D 3I57A 1EU3A 1TKYA 2ICIA 1C76A 1ROEA 4L23A 4HKZE 4XDCA 4YTNB 3SFDB 2V0GA 1XLOA 3TEXA 2IGHA 3ZQ4A 1KFYB 4A8XC 1HEZE 4AQ7A 1ET6A 4KGSA 2QIEB 1WGKA 2WXRA 2J53A 2E3TA 3B2GA 1V1PB 1RWSA 1ENFA 4REZA 1RFKA 2WQYB 4YSYB 1D6EC 2J52A 2JX5A 1L4DB 1JROA 3HUIA 1DOXA 2WXMA 1XEEA 5HG2A 3MP9A 1TS5A 3I9V1 3AE1B 3LB8C 1JWUD 3PZ8A 4OVZA 3RPFC 1YJIA 3MHZA 1FFUA 3AEEB 2KMMA 1OFFA 1C4AA 2MEKA 3BVGA 2K0PA 1QT9A 3IAS1 4RH6A 1FNWA 3IXSA 2DYMA 1C4PA 2YEPF 2AQ3B 2HDEA 1MHXA 1WYGA 1FNVA 4ZYSA 4NJCA 2LGIA 2N7JA 2VZKD 2GB1A 1DYQA 4JWSC 2RDGA 1PFDA 4KKIA 1P7EA 1I7HA 1IBXB 5C2TB 4KGRA 1JW9D 5MPOA 1HA5A 2BB6A 1SSNA 3Q8BA 2H88B 4B0MA 1ZPSA 4PT5A 1KLGD 1Q10A 1PGXA 2LMCA 1D5XC 1T5XD 1L0XB 3FILA 1D5ZC 2W54A 2WXGA 2BB5A 4RFBA 1N63A 5BMGA 1CK1A 3URYA 1TS4A 5TSSA 1UNSA 3AE2B 2EELA 4MACA 5H8YE 4WWMA 3TSSA 3P4SB 2V4IB 1I4QA 1K50A 4OZBA 3KWLA 4RF1A 4RGMA 4R3DA 4FXCA 1UWXA 4NAWB 3ZGZA 4A55A 3HVDA 2WXLA 5AUIA 2OHFA 3GP7A 3KQ4A 1I4HA 2JSVX 2GRIA 1SEBD 4M0WA 4RGTA 3BK2A 2W3SA 3SR6A 1NYRA 5EE0A 3Q8FA 1FXIA 1AWDA 5G5HA 3BVZA 4TQ0A 3AEBB 1SE4A 1QLBB 1C77A 3R2TA 3AE5B 3W5UB 5FK9C 4TSSA 1C4CA 1ZXIA 3GS2A 4ZOHC 2WXFA 4C7YA 2ZW0A 1TS3A 3KLSX 1SE3A 3ZYYX 1N5XA 4YTMB 3P4QB 3AECB 5BMIA 4YSXB 4DXGA 1KF6B 1Y56A 2WXOA 5EE1A 1STEA 2LHEA 4DQOC 2J42A 2BT6A 1VLBA 2RDHA 1PDXA 4TQ1A 2CJOA 2L52A 1SBBB 1JRPA 4EE2A 1F2RI 2X38A 1B1ZA 2Z8LA 3BZDB 1NEKB 1VZ8A 3Q69A 1QOFA 5T8IA 4OHJA 2Y3AA 1L0VB 2JYTA 1K52A 1V8CA 3V05A 3GB1A 1GB4A 1I4XA 4GDLB 1BMLC 4KGTA 4ITKA 3MC0B 1YN4A 2WXQA 1N61A 2WDVB 2PMVA 2JXTA 2IPKD 2K3UA 4JX1C 3AM9A 1P7FA 2K22A 4ARCA 2JZPA 1JWBD 2W55A 1C78A 3BYTB 1QQRA 1GPXA 2K9XA 4GLSC 3P4RB 2OEDA 3AE3B 2JYEA 4A9AA 1KRHA 2WXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QT9 A;  1WXQ A;  5EE9 A;  4C7Z A;  1TYG B;  5H92 C;  1XLQ A;  2LEK A;  1T3Q A;  2G1E A;  2JQR B;  2Q5W D;  2WU5 B;  3HVZ A;  4YTP B;  5EE3 A;  2WP9 B;  1WYG A;  3B9J A;  2AX5 A;  3AEG B;  2CJN A;  1FM0 D;  2WU2 B;  3L4P A;  4JWS C;  4YT0 B;  3AE9 B;  1PFD A;  3VRB B;  2M19 A;  3B2F A;  2PKO A;  1J7A A;  1I7H A;  2DBY A;  1WWT A;  5C2T B;  3BII D;  1JW9 D;  3AEA B;  1QOB A;  4USA A;  2Y5C A;  5MPO A;  3NVV A;  3P4P B;  3P63 A;  1L5P A;  2N0S B;  1J7B A;  2H88 B;  2WS3 B;  1CJE A;  2WDR B;  4KX6 B;  1NVI D;  1ZUD 2;  1TJE A;  1R7S A;  1YQ4 B;  3NS1 A;  3VR9 B;  4YXD B;  3FAH A;  1FRD A;  3AE6 B;  1CZP A;  1VDV A;  2W54 A;  3HRD D;  1FFV A;  1FIQ A;  1NYQ A;  5C3J B;  3AMZ A;  1JWA D;  4P6V F;  1N63 A;  1DOI A;  1SF0 A;  1A70 A;  2B76 B;  2W3R A;  1IUE A;  1YJJ A;  4IDI A;  3SFE B;  2M56 B;  3W9C B;  1FRR A;  4HRS A;  1UWM A;  2CU3 A;  3P1M A;  2DWQ A;  3AE4 B;  3ETR A;  2KAJ A;  1E6E B;  1RYJ A;  4LTU A;  3AE2 B;  1RM6 C;  5H8Y E;  3AE8 B;  4WWM A;  1L6V A;  1E10 A;  3P4S B;  3ABV B;  1PUT A;  3AEF B;  3KWL A;  3VRA B;  1N5W A;  3WCQ A;  4ZHO A;  1F0Z A;  1NI3 A;  1EWY C;  2HTM E;  4N59 A;  1FXA A;  1SB3 C;  1V97 A;  1E7P B;  3DWG C;  4FXC A;  3AV8 A;  3NRZ A;  3NVZ A;  1ZP0 B;  5AUK A;  2BS4 B;  2OHF A;  5AUI A;  1ZOY B;  1WRI A;  4WQM A;  1L6U A;  1FMA D;  1OQR A;  1N60 A;  1VJK A;  3LXF A;  4HRO A;  2BS2 B;  1XLN A;  2L83 A;  2MJ3 A;  2W3S A;  1NYR A;  3SR6 A;  1B9R A;  5EE0 A;  1E0Z A;  3FC4 A;  4N58 A;  1JAL A;  1XLP A;  1FXI A;  1SIJ A;  3AH7 A;  1AWD A;  1XO3 A;  1J7C A;  1AYF A;  5G5H A;  3AEB B;  1NEN B;  1QLB B;  1OQQ A;  2BS3 B;  3PO0 A;  3CIR B;  2QJL A;  3AE5 B;  3AED B;  3AB5 A;  2MJE A;  4JWU C;  3VR8 B;  3W5U B;  3AE7 B;  1JQ4 A;  1ZXI A;  4ZOH C;  1TKY A;  2EKI A;  4C7Y A;  4US8 A;  4YTM B;  2PIA A;  1ROE A;  3ZYY X;  1N5X A;  3NVY A;  3P4Q B;  3AEC B;  3DWM A;  1QF6 A;  4YTN B;  3SFD B;  4YSX B;  1FO4 A;  1XLO A;  1KF6 B;  2ACZ B;  2WDQ B;  1E9M A;  5EE1 A;  4C80 A;  1KFY B;  2MJD A;  2PVO D;  2BT6 A;  1VLB A;  1PDX A;  1YQ3 B;  2CJO A;  2L52 A;  4US9 A;  1JRP A;  2QIE B;  1WGK A;  5G5G A;  1NEK B;  1QOF A;  2E3T A;  3B2G A;  1RWS A;  1DGJ A;  1RFK A;  2WQY B;  4YSY B;  1L0V B;  4YSZ B;  2MH7 A;  2JX5 A;  1V8C A;  3AN1 A;  1JRO A;  3EUB 2;  1TKG A;  3HUI A;  4ITK A;  1QOG A;  2PVG C;  1DOX A;  3W5V B;  2H89 B;  1N61 A;  2WDV B;  3LB8 C;  3AE1 B;  1TKE A;  4JX1 C;  2FBW B;  5GXG B;  3AM9 A;  4ZHP A;  2K22 A;  1N62 A;  3NVW A;  1YJI A;  3RPF C;  1JWB D;  2W55 A;  1DOY A;  2WLB A;  1GPX A;  4N6E B;  1GAQ B;  1FFU A;  1QOA A;  2K9X A;  3AEE B;  3P4R B;  2KMM A;  2K5P A;  1OFF A;  3AE3 B;  3CWI A;  4A9A A;  1KRH A; 
#chains in the Genus database with same CATH topology
 3SD5 A;  1WFY A;  5CTR C;  1FNU A;  2KO3 A;  2N9X A;  2AX5 A;  3AEG B;  2RDB C;  4RF0 A;  3Q3M C;  4ARI A;  2WU2 B;  1GUA B;  4ICU A;  4YT0 B;  2ZCB A;  2J0K A;  4MH8 A;  5BYR A;  3AEA B;  2D3C A;  2WHI A;  2KNB A;  1L5P A;  2N0S B;  2KDE B;  3PZD A;  2ZVN A;  2I1K A;  1ZUD 2;  1YQ4 B;  4LDT B;  3DBH B;  3WIM A;  1VDV A;  2RPV A;  2UWQ A;  3D32 A;  1NYQ A;  2W3R A;  2ZNV B;  2JF5 A;  3PV1 A;  1BUI C;  3TCA A;  3PGE A;  3W1Y A;  3MJ5 A;  3WCQ A;  1NI2 A;  1J8C A;  1XCQ L;  2QDF A;  2KX3 A;  2MP2 A;  1GOZ A;  2Z0D B;  3ZNG C;  4CHK A;  1IGC A;  5CHV C;  3VVW B;  3APC A;  3AI5 A;  4A3O A;  5DPW A;  4WQM A;  1TT5 B;  3KVF B;  1FMA D;  3Q8A A;  1U4A A;  4HLE A;  4E71 A;  1XLN A;  4ANU A;  2IO2 B;  2W82 A;  1KLU D;  4FAD A;  4S0R A;  4XE0 A;  2L76 A;  2PPH A;  3N1X C;  4RM8 A;  4MEL A;  3DBL B;  2LGS A;  3C19 A;  3TIX A;  4C4V A;  4JPS A;  4YSZ B;  2CU1 A;  3WA0 A;  3EUB 2;  4XGA B;  1QOG A;  2PVG C;  3RNE C;  2KC2 A;  1V9J A;  2RSU A;  3BK1 A;  3BY4 B;  4BKT A;  1QOA A;  3CWI A;  1YJ1 A;  2DYB A;  3NUH B;  4K3B A;  1T0Q C;  3ZRF A;  3IFW B;  4L1B A;  3NHE B;  1T3Q A;  3R7Q A;  2LJ5 A;  3WAO A;  2G9H D;  3B9J A;  2KLC A;  2QCZ A;  3B2F A;  4RCO A;  3LJ3 A;  2FCN A;  3OJ3 A;  1C3T A;  1T0R C;  1XCT L;  2QIL A;  3AUL A;  2MBH A;  4S17 A;  1TJE A;  3ENE A;  1UH6 A;  4GDK A;  4ANX A;  3R3M A;  5BO4 B;  1WX9 A;  3SFE B;  4AJW A;  2BYT A;  4FJV B;  1UWM A;  2GBR A;  4XWT A;  5DPR A;  2C5L C;  4LTU A;  4KSL C;  3ABV B;  2GOW A;  1XXG A;  2INN E;  3VTV A;  1Z2M A;  3QWZ B;  1YQB A;  3RNB C;  1P3Q U;  4C4V B;  3VTU A;  2WXN A;  2KMA A;  3U52 E;  1EM7 A;  3LXF A;  1FCC C;  1WGD A;  2BWE S;  1IGD A;  2TSS A;  2KXJ A;  3WAM A;  1P1A A;  4N58 A;  4NAW A;  2JU6 X;  2KWU B;  2YEP B;  1VZ6 A;  3TJP A;  4P7I A;  2O6V D;  5HFY A;  3PLU A;  2ASQ A;  3DBR B;  2INC C;  1AN8 A;  4K7S A;  4H2A A;  4C56 C;  1FO4 A;  3VQI A;  4C80 A;  3HHM A;  3Q3N C;  4EOY A;  1C9F A;  4IOI E;  1YNT E;  2CHW A;  2ZEQ A;  4GDK B;  4W9H A;  1HXY D;  1WJU A;  3AN1 A;  3EA6 A;  4MM3 B;  2KOX A;  3W5V B;  1TZO A;  2H89 B;  2WGS A;  2D3G A;  3DHI C;  2J0M A;  2V9H A;  5FR3 A;  2D5G A;  3ZNZ B;  3MC8 A;  1N62 A;  2R2Q A;  2IGD A;  3DVN V;  1GAQ B;  2CR5 A;  4B95 A;  3TEZ A;  1KH0 A;  2N9K A;  2NPT A;  3Q6B A;  1TYG B;  4KKJ A;  3O13 A;  2LEK A;  2JQR B;  2ZPY A;  3P42 A;  3PZ7 A;  2KD0 A;  3ZW3 A;  5FKA C;  2DBY A;  1YN5 A;  3V6C B;  5JXV A;  3UGB B;  3A9K A;  1KLV A;  3H6N A;  4NNJ B;  4XYC A;  2MSE D;  2JWU A;  1JWM D;  4NAM A;  2L0F A;  3AE4 B;  1HZ6 A;  3ZJU A;  2FUH B;  4NJ6 A;  2M0X A;  2HTM E;  2KMC A;  4KZ0 A;  2SAK A;  1SE2 A;  4ZRQ A;  3ZVV A;  1ZOY B;  5JHA A;  3VTW A;  2FNJ B;  5JHB A;  2QSD A;  3R8B A;  1OQY A;  3A1Q A;  1XO3 A;  3QCA A;  2MBQ A;  2KAN A;  2BS3 B;  3AED B;  3DVN U;  1SXT A;  3T3O A;  3I57 A;  2EKE C;  5DCN A;  4IUM B;  1J0G A;  4K7U A;  2EMS A;  4HKZ E;  2KZR A;  2IGH A;  2L00 B;  4KSK C;  5LXH A;  1KFY B;  2L7R A;  3I3T B;  4OVU A;  2DZJ A;  3A9K B;  1WGK A;  3VFK A;  4IW0 A;  5TR5 A;  2PE6 B;  4FJY A;  1RWS A;  1ENF A;  3PRM B;  2ZJD A;  2K6D B;  1F1H A;  3B08 A;  2L3Z A;  3PLV A;  3MP9 A;  4LDT D;  5DPT A;  3AE1 B;  3L17 A;  2IY0 B;  3X0W A;  1XQQ A;  3MHZ A;  2CS4 A;  4WJP A;  1OFF A;  1C4A A;  2MEK A;  3BVG A;  2MLB A;  3IAS 1;  3GOE A;  2DYM A;  1C4P A;  4CO7 A;  4FA6 A;  2KT7 A;  2LGI A;  4KKI A;  1DYQ A;  2JWZ A;  1I7H A;  5D6J B;  4KGR A;  5MPO A;  2AEH A;  1WH3 A;  1JRU A;  2CHZ A;  2H88 B;  1ZPS A;  1FXT B;  4BVU C;  2NBV B;  2LMC A;  1T5X D;  1L0X B;  5LLI A;  4KZC A;  1D5Z C;  3AXC A;  2DZI A;  3H7P A;  5BMG A;  3URY A;  5TSS A;  1I4Q A;  3KWL A;  2MBO A;  1PQS A;  2N7E A;  4FXC A;  4DDG D;  4AUQ C;  3ZGZ A;  1E90 A;  2GBN A;  4M8M A;  1I4H A;  4M00 A;  3ONS A;  1T0S C;  4M0W A;  3RNC C;  3BK2 A;  2OOB B;  3K9P B;  5EE0 A;  1FXI A;  1AWD A;  4TQ0 A;  3EC8 A;  1C77 A;  1MJD A;  5FK9 C;  3VDZ A;  1ZXI A;  4I6P A;  1TS3 A;  1WIA A;  3KLS X;  3NZU A;  1N5X A;  4YSX B;  1E7V A;  3GE3 C;  3QAR A;  1STE A;  3NZS A;  2J42 A;  1WRD B;  3Q3O C;  4EE2 A;  3GZN B;  2WYQ A;  1QOF A;  1TIF A;  2Y3A A;  5CHW A;  3RUI B;  3H7P B;  1GB4 A;  3QJZ A;  2DZK A;  4KGT A;  4ITK A;  3MC0 B;  3M62 B;  2WXQ A;  2WDV B;  2PMV A;  4HCN B;  4JX1 C;  1P7F A;  1JWB D;  2W55 A;  3BYT B;  1QQR A;  3L10 B;  2VH2 A;  2K9X A;  4IM0 A;  4GLS C;  3P4R B;  2KJR A;  2JYE A;  4A9A A;  1AYF A;  1KRH A;  1Y8R C;  3N1Y C;  4HKQ A;  3W1S A;  5H92 C;  4M0W B;  5AZH A;  2KAC A;  1EWC A;  2WX0 A;  1FM0 D;  3L4P A;  4LNN A;  5J18 A;  3AE9 B;  4FHK A;  3RI7 C;  3RZF A;  3N32 A;  4FJZ A;  3BYY B;  3SDL C;  2O6V B;  3IT4 B;  3E9S A;  3VR9 B;  4DXF A;  1WZ3 A;  5C3J B;  3AMZ A;  1ACC A;  3UIO B;  5AEK B;  1A70 A;  3EGR A;  1EU4 A;  4JL9 A;  4A3P A;  1V5T A;  2LVP A;  4EKU A;  1L6V A;  4MEM A;  5HHD G;  3VRA B;  1N5W A;  4KV2 A;  1KJT A;  3NRZ A;  3NVZ A;  4OZC A;  3VUY A;  2KFK A;  4PS7 A;  3QAQ A;  5JH5 C;  4AS1 A;  2FID A;  4FN2 A;  1F2R C;  2N9L A;  3ZTC A;  2BGF A;  2L1A A;  4W9C A;  1ZDX A;  3FKY A;  3E56 A;  3CST A;  3ML9 A;  1X1M A;  3EHV A;  3AE7 B;  2K8H A;  1UGJ A;  4MH0 E;  2D07 B;  3MFG A;  1ZW7 A;  2I1J A;  3KYD D;  3NS8 A;  2MJD A;  3OLM D;  1UZX B;  2NBU A;  1VCB A;  2K25 A;  4I6N B;  2C60 A;  1TS2 A;  2Z59 B;  2BYF A;  3VUX A;  2LWP A;  3DOW A;  3HM3 A;  4Q2J A;  3MC9 A;  2DYO A;  2L8J A;  2C7H A;  2HTH A;  4KDI C;  2BKF A;  3RCZ A;  2KX0 A;  4WIP A;  5IKC M;  1DOY A;  3CMM B;  1CQV A;  4N6E B;  4WWP A;  3RUL A;  1EO6 A;  5EE9 A;  4G11 A;  3HVZ A;  3UF8 A;  3FIL B;  4URK A;  5CHF A;  4YTP B;  3DDC B;  2UYZ B;  2I2Y A;  3LYY A;  2M0A A;  2C9W B;  4II2 B;  4EEW A;  5E6P A;  1QOB A;  3PS6 A;  5JZE B;  1WSP A;  3B0A A;  1KTK A;  2J4X A;  4K3C A;  2DNF A;  3PVL A;  2JRI B;  4PK1 A;  3A4S C;  1IUE A;  2IBI B;  2WXP A;  3ZDM C;  1BXT A;  2DWQ A;  2KAJ A;  2QHO A;  1TTN A;  4TKN A;  3KWV A;  1EWY C;  1V97 A;  1V6E A;  5EDS A;  4IG7 B;  4B0E A;  1ZP0 B;  2IO1 B;  3IBE A;  3T3N A;  2L32 A;  3N30 A;  1OQR A;  3L13 A;  4HRO A;  3FC4 A;  5E6O A;  2LRU A;  4TUU A;  1NEN B;  1LGR A;  5G2N A;  4JWU C;  4US8 A;  4I6L B;  2XK5 B;  2LFI A;  2PTL A;  2XNA C;  1AW7 A;  4HPP A;  2V1Y A;  3JSV A;  4HWI B;  1VR9 A;  1UEL A;  4MGI E;  1C79 A;  2ZZP B;  1ZDV A;  2X8X X;  3OJ4 B;  2R61 A;  2MRP A;  1EF1 A;  1V5O A;  2KVR A;  1YOV B;  3DQV A;  3SU8 X;  3K9O B;  3CSF A;  4RGN A;  5BYQ A;  1N6Z A;  4RNA A;  4OVV A;  4MJS A;  2MW5 A;  4GXB A;  3NOB A;  2NCN A;  2KDF B;  4O1N A;  1WXM A;  4ANW A;  1WX7 A;  3DBL I;  3ALB A;  2WU5 B;  4F7Z A;  4YL8 A;  1E8Z A;  1D3Z A;  1MI0 A;  3BII D;  2KTF A;  3P63 A;  3Q3J A;  2D3A A;  1E5W A;  5D7G A;  3PTF C;  1CZP A;  2O2V A;  4MGZ E;  2MP2 B;  3H9D A;  2KDM A;  2A4Z A;  1YJJ A;  4IDI A;  1SGH A;  2I38 A;  1FRR A;  3P1M A;  4G3X B;  1E6E B;  4AOF A;  3N1Z C;  1MG4 A;  1ESF A;  3AEF B;  2WX1 A;  1NI3 A;  1FXA A;  1T6B X;  2JZ3 B;  4TV3 A;  2LHD A;  4IWP A;  1R4M B;  4GSW A;  5G55 A;  1WM3 A;  1VZ7 A;  4P1C C;  1B9R A;  1VRA B;  2R2O A;  1GB1 A;  3RNG C;  2LGY A;  5DPS A;  3TEY A;  1K51 A;  2M1M A;  3L08 A;  3PO0 A;  3QC8 B;  1D4B A;  1WXA A;  2LXA A;  5C1Z A;  1C76 A;  1ROE A;  4XDC A;  3C0R B;  4YTN B;  3SFD B;  2V0G A;  3PRP B;  3ZQ4 A;  1VD2 A;  5AZG A;  5KHQ A;  5J2R A;  1P0R A;  1FPY A;  4KGS A;  2QIE B;  2WXR A;  4JLC A;  2J53 A;  4M8N A;  4YSY B;  1D6E C;  2J52 A;  1JRO A;  2YLM A;  3HUI A;  1XEE A;  3LB8 C;  1JWU D;  3PZ8 A;  3OAW A;  3V61 A;  1FFU A;  4F1S A;  2KMM A;  1E8X A;  2ZPN A;  4BZA A;  4W9G A;  4PYU A;  2K0P A;  4NY0 A;  3MTN B;  1WGH A;  2AYO B;  2AQ3 B;  2HDE A;  3A4R A;  2OJR A;  1MHX A;  4ZYS A;  1NDD A;  4MSM B;  2GB1 A;  1YX5 B;  2RDG A;  2PJH A;  1P7E A;  4ZRI A;  5C2T B;  2GBM A;  4DK5 A;  4B0M A;  4PT5 A;  2IO3 B;  2JY6 A;  2M17 A;  5E6N A;  4B9K A;  2W54 A;  2WXG A;  3A9J A;  3WAL A;  2KFJ A;  1CK1 A;  2KQ7 A;  5IOI A;  2EEL A;  3TSS A;  1K50 A;  2N9E B;  3RD2 A;  3KW5 B;  3UQA A;  2KTR A;  4NAW B;  2LGD A;  4A55 A;  2WXL A;  3ZKJ C;  3GP7 A;  4K7W A;  3ML8 A;  4KIK A;  1V86 A;  3LDZ E;  2IY1 B;  2JSV X;  4HPL B;  4W9F A;  2MBB B;  4LNO A;  4RGT A;  1XD3 B;  2W3S A;  1NYR A;  3VHT C;  3PSE B;  1L7Y A;  5G5H A;  4AP4 C;  1TGZ B;  1SE4 A;  3DHH C;  4FHJ A;  4EZJ A;  3R2T A;  3AE5 B;  4G50 A;  4HDQ A;  1GC7 A;  3P4Q B;  5BMI A;  1KF6 B;  1Y56 A;  2WXO A;  2HJ1 A;  3DCG A;  3CF6 E;  4BAX A;  4TQ1 A;  1V2Y A;  1WM2 A;  4DDI D;  1F2R I;  3ZNI D;  1B1Z A;  1K8R B;  3Q69 A;  2MX2 A;  3IVF A;  3A9J B;  4ACF A;  1L0V B;  1V8C A;  3TMP B;  3GB1 A;  3ZTD A;  1I4X A;  3N20 C;  1CMX B;  1YN4 A;  2NPT B;  1N61 A;  3L0W B;  2GBJ A;  4BBN C;  2LXC A;  3HK0 A;  2JZP A;  1C78 A;  2KTR B;  2VH1 A;  3AE3 B;  4DHZ E;  4KIK B;  3NJT A;  1QKZ A;  4PS8 A;  3V3X A;  2RD0 A;  3IAM 1;  3P4P B;  4X57 B;  2K8B A;  4FLH A;  5BYS A;  3AE6 B;  3UIN B;  3HRD D;  4ZDV A;  4DHJ B;  1JWA D;  2E6X A;  2BYE A;  4II3 B;  1K53 A;  2CU3 A;  2LZ6 A;  3C8Y A;  1UUP A;  2G45 B;  1FCL A;  2GI9 A;  4HK2 A;  4ZHO A;  3VH4 B;  3PHW B;  1E7P B;  4JE3 B;  3A1Q B;  2VZK B;  5AUK A;  2NMQ A;  1VJK A;  3U7Z A;  2GLS A;  2BS2 B;  1MG8 A;  1D5M C;  3H1U A;  1UBQ A;  4DXA B;  3RN9 C;  1GG3 A;  3O65 B;  3CIR B;  3AB5 A;  2REX A;  3KUZ A;  1M94 A;  4P16 A;  1PYW D;  5BMH A;  2N1V A;  1V1O A;  2NR2 A;  2WDQ B;  1I4G A;  3QA8 A;  4BBN F;  1JWS D;  1EUV B;  2VRR B;  4JQW C;  2BVC A;  4DBG A;  4HJK A;  3R66 C;  1DGJ A;  4OZA A;  1IYF A;  1F77 A;  4GB9 A;  4XC2 A;  3SEB A;  3ZRC A;  3IHP C;  4WJQ A;  5GXG B;  4BKG A;  3NVW A;  1WF9 A;  1H8C A;  2IO0 B;  3QQ8 B;  2K5P A;  3GZN I;  1PGB A;  2IGG A;  1XT9 B;  2CJN A;  4GN1 A;  2PKO A;  4UDU C;  1WWT A;  1WMH A;  2Y5C A;  4W9L A;  2BBC A;  4NZL B;  1L4Z B;  4P6V F;  1ZXH A;  2B76 B;  1IBX A;  1WJ6 A;  1Q0W B;  1RYJ A;  3P2B A;  4YWG G;  1LO5 D;  4K1R B;  3AE8 B;  1KOT A;  3T8M A;  1F0Z A;  3DHG C;  4JIO U;  1WXV A;  4N59 A;  3DWG C;  3R7R A;  2FE8 A;  3L16 A;  2EMT A;  4MGK E;  4WQO B;  1R4N B;  2MJ3 A;  3PPA A;  3VH3 B;  2V4L A;  5I4D A;  2G3Q B;  4RGO S;  3T9L A;  1F52 A;  2KVZ A;  4BKS A;  4GOC A;  2NBW B;  2Z0E B;  2MJE A;  2DLB A;  2BW2 A;  2PIA A;  4QAY A;  2FCM A;  1V81 A;  2DAF A;  1E9M A;  1WMH B;  1WY8 A;  2HE7 A;  3H8H A;  1H4R A;  2LAS A;  3PHX B;  1J19 A;  3ZXR A;  3UI3 A;  3DVG Y;  1GJZ A;  2SEB D;  2IND C;  2C7N B;  2KN4 A;  3EEC A;  5LNK 1;  2JXX A;  1Q5W B;  1WGY A;  5AZF A;  1OEY J;  1FEH A;  2M8S A;  3S2A A;  4ZYN A;  5HKH A;  3VRB B;  1J7A A;  2BPS A;  5FR6 A;  3U4E G;  5HI1 A;  2LVQ A;  2ON8 A;  2KQS A;  4LJP B;  3QIJ A;  3NY5 A;  2D10 A;  4WAF A;  1EF5 A;  1FRD A;  3Q8C A;  1V1P A;  1FIQ A;  2WXJ A;  1DOI A;  2M56 B;  2KFK B;  4LLG M;  1I4R A;  2V3P A;  2BF8 B;  2PEA A;  2LI5 A;  1TY0 A;  4A20 A;  2C7M B;  1UBI A;  2K8C A;  4W9D A;  3NZ3 A;  1P98 A;  2JZZ A;  2MCN B;  2KKC A;  5IAA C;  3Q8E A;  1L6U A;  3U8Z A;  4LNI A;  5KHO A;  1TZ1 A;  3ZXV A;  1E0Z A;  4C00 A;  2MBE A;  2LD9 A;  5L95 C;  4BOZ B;  1SIJ A;  2QC8 A;  1HQR D;  1J7C A;  1T0Y A;  3GE8 C;  2LRW A;  2XN9 C;  1OQQ A;  3HM6 X;  2QJL A;  1TKY A;  4ANV A;  2ICI A;  2MWS B;  3PRZ A;  2KYW A;  4M01 A;  1WYW B;  2JRH A;  4LNK A;  3DBH I;  4A8X C;  4AQ7 A;  1ET6 A;  2LGX A;  2ZVO A;  2AL6 A;  3HIZ A;  3B2G A;  1V1P B;  1RFK A;  1L4D B;  1RFA A;  4FUL A;  2RR9 A;  4LNF A;  1Z5S B;  2WXM A;  3I9V 1;  4M02 A;  4DHJ D;  1YIW A;  1FNW A;  2CKH B;  3IXS A;  3KH0 A;  2VZK D;  4JWS C;  4DHZ B;  2XEW A;  3MJW A;  5CX3 A;  1HA5 A;  1SSN A;  3Q8B A;  4W9K A;  4HCP B;  3VAW A;  1Q10 A;  1PGX A;  2N4F A;  2FAZ A;  2K6Q A;  1WR1 A;  3RZW C;  1N63 A;  1MFW A;  4GDL A;  1OEY A;  1UD7 A;  1LXD A;  3AE2 B;  3DVG X;  3P4S B;  2KLG A;  2V4I B;  4OZB A;  2BQQ A;  4RGM A;  2FCQ A;  5IO9 A;  1ZGU B;  4LCD E;  2MHJ A;  2KK8 A;  1Q1O A;  2OHF A;  3N3K B;  2V3S A;  4WAA A;  4EFO A;  2GRI A;  3RNA C;  1KM7 A;  1YX6 B;  4F8C B;  2PE9 A;  1QLB B;  3ECI A;  3JSV B;  3W5U B;  2KDI A;  3AU4 A;  4TSS A;  3GS2 A;  4ZOH C;  3RT3 B;  2WXF A;  4C7Y A;  2AL3 A;  3PRE A;  1R4M I;  4DXG A;  4WJN A;  2Y5B B;  2BT6 A;  1VLB A;  2L52 A;  1SBB B;  1JRP A;  4MJS B;  2X38 A;  5J17 A;  4MDK E;  3BZD B;  5T8I A;  4OHJ A;  3W1S C;  2JYT A;  4GDL B;  3IG3 A;  3RNF C;  1WE7 A;  2K3U A;  4DWF A;  3VXW A;  1GPX A;  4B6W A;  1UGM A;  2OED A;  1OTR B;  4MM3 A;  2L0T A;  2ONQ A;  1QIL A;  4C7Z A;  1I4P A;  1YD8 U;  2Q5W D;  5EE3 A;  4HJG E;  3APF A;  2O2V B;  1HZ5 A;  1TBE A;  3DBR I;  4USA A;  3NVV A;  4J6I A;  4GGQ A;  2GMI C;  2WS3 B;  4KX6 B;  1NVI D;  4YXD B;  1R7S A;  3FAH A;  1MPE A;  1MVK A;  2QMT A;  3M3J A;  5GMV A;  1G6J A;  2WXK A;  3TEW A;  1WR6 E;  1P9D U;  1FD6 A;  3RFZ B;  3V6E B;  3L54 A;  1SB3 C;  3AV8 A;  2IYD B;  2G4D B;  2BS4 B;  3TBL D;  1SJH D;  3RYT A;  1MHH E;  2LVO A;  1XLP A;  2RMM A;  3AH7 A;  3X23 A;  4ZRP A;  1JQ4 A;  1PGA A;  4WUR A;  3U30 A;  2FUG 1;  3PT2 B;  2EKI A;  4ICV A;  1E8Y A;  3NVY A;  3DWM A;  1QF6 A;  3QX1 A;  5D3D A;  1E8W A;  4NQK E;  3NG0 A;  4MSQ B;  4LK0 M;  4D2K A;  2V3N A;  2MQJ A;  2BTE A;  1YQ3 B;  4US9 A;  4MT5 A;  1SE9 A;  5G5G A;  1WJN A;  2KC1 A;  2MH7 A;  2K39 A;  4HVB A;  4BKS D;  1E7U A;  1JCK B;  4LJO B;  1WJ4 A;  4NPN A;  3OWE B;  2ZNV C;  4WWO A;  3JW0 X;  1RLF A;  2PW9 A;  2WLB A;  1IPG A;  4HPM B;  1LM8 B;  5E6J A;  3RMK C;  3ZJV A;  4EUT A;  4W9E A;  2WXH A;  3I5J C;  2NTT A;  3V62 A;  2Y5P A;  3W2D A;  3WAP A;  3M63 B;  2G1E A;  4AJY B;  4W9J A;  2JPH A;  2KJ6 A;  2AQ2 B;  4PS3 A;  3ZJT A;  2QEJ C;  2J0J A;  4G0N B;  3NS1 A;  3ZNH B;  1LQB A;  4RM9 A;  2HD5 B;  1JML A;  3UIP B;  1WXS A;  4HRS A;  2NTS A;  3ETR A;  3Q2A C;  1RM6 C;  2IDY A;  4JGH B;  2RPQ A;  4OW0 A;  5L83 A;  1PUT A;  4XDD A;  1WZ0 A;  2D11 A;  4AWJ A;  4EZL A;  2M4N A;  1ET9 A;  4TMA B;  3MHS D;  1WRI A;  2N1W A;  3OG5 A;  1TY2 A;  3U2S C;  2OJW A;  5C23 A;  3TL5 A;  2IZV B;  3BVM A;  2L83 A;  1SIF A;  4XX5 A;  3KUC B;  1JAL A;  5D3I B;  2D2Q A;  1HTQ A;  2KQ4 X;  4A90 A;  2J7Q B;  4IWQ A;  2KWD A;  2ACZ B;  4XZ4 A;  2LJI A;  1GC6 A;  2PVO D;  2DEN B;  1RRB A;  4BOS C;  1L2N A;  4A6Q A;  4KDL B;  1WI0 A;  2WNM A;  3ZIM A;  2YVC A;  4IKG A;  2MA9 B;  3M95 A;  4EZK A;  1M4V A;  1TKG A;  3N9Y C;  1TKE A;  2FBW B;  1V80 A;  3J9C A;  4IM3 A;  4ZHP A;  2UU7 A;  3VUW A;  2WWZ A;  2PLP A;  2IJ0 A;  2ZW1 A;  1WXQ A;  3BWU D;  4XWW A;  2AWT A;  1XLQ A;  4HEA 1;  2WP9 B;  4E3C A;  4WH4 A;  2W9N A;  2M19 A;  1YN3 A;  4J3O D;  1J7B A;  2CHX A;  4HDO A;  1CJE A;  2WDR B;  3JVZ X;  3EFC A;  1FFV A;  2KWV B;  1L0Y B;  3WAN A;  1SF0 A;  2AQ1 B;  3W9C B;  3B1L X;  2L05 A;  4FBJ B;  5IP4 D;  5D94 A;  2JT4 B;  2O6V A;  1E10 A;  4KVG B;  3TUO A;  2RGF A;  4IC7 B;  1RAX A;  4CYE A;  3KYC D;  3ZO5 B;  1YMH E;  4IM2 A;  4CQN A;  3R2I A;  1XF5 L;  1N60 A;  2BKR B;  2LUM A;  2INP E;  4NQL B;  3IT6 B;  1SJE D;  4L2Y A;  1OGW A;  4ZRK A;  4W9I A;  1ZKH A;  4GIV A;  1IP9 A;  3VR8 B;  1ZE3 D;  2N9P C;  1EU3 A;  3KUD B;  4MGY E;  1ISN A;  4L23 A;  2NS5 A;  1XLO A;  1C1Y B;  2B3A A;  3TEX A;  4NJ7 A;  1R4N I;  1HEZ E;  4GMV A;  2D3B A;  1BT0 A;  2NVU I;  2E3T A;  4REZ A;  4N9F 4;  2WQY B;  4WWN A;  2JX5 A;  2KJH B;  1DOX A;  1I35 A;  5HG2 A;  1TS5 A;  4OVZ A;  3AU5 A;  2KN5 A;  2ZCC A;  1YJI A;  3RPF C;  4ASW C;  3AEE B;  1WX8 A;  3Q14 C;  1QT9 A;  5IA7 A;  4RH6 A;  2YEP F;  1WYG A;  1FNV A;  3ZUN A;  4NJC A;  2N7J A;  2DZM A;  2KDB A;  1PFD A;  2HJ8 A;  3A33 B;  1IBX B;  2G4S A;  1JW9 D;  3JYU A;  2BB6 A;  4GU2 A;  2BYV E;  2K1F A;  1KLG D;  1HE8 A;  1D5X C;  3FIL A;  4E74 A;  3H7S A;  2BB5 A;  2JUO A;  2DAJ A;  4RFB A;  2LUE A;  3SHQ A;  2WDT B;  4ZRJ A;  1TS4 A;  3DPD A;  1UNS A;  2A5U A;  1QZE A;  2FCS A;  1F9J A;  4MAC A;  5H8Y E;  4WWM A;  4RF1 A;  4R3D A;  1S3S G;  3QK0 A;  3UQB A;  2GBK A;  1UWX A;  4RMA A;  2DX5 B;  4BFR A;  3HVD A;  2BWF A;  5AUI A;  1NBF C;  3KQ4 A;  1SEB D;  3I63 C;  5IN7 A;  3SR6 A;  1A5R A;  4PYZ A;  3V60 A;  3Q8F A;  1AAR A;  3BVZ A;  3QHT A;  3Q3F A;  3AEB B;  1WGR A;  2JVC A;  3U7D A;  1C4C A;  2ZW0 A;  4YTM B;  1SE3 A;  1WGG A;  3DBS A;  3ZYY X;  1V49 A;  3AEC B;  1S1Q B;  1GNU A;  5EE1 A;  2N7D A;  2LHE A;  3ZDT A;  4DQO C;  2KWC A;  2KHW B;  3EFU A;  2RDH A;  1PDX A;  2CJO A;  2FIF A;  1I42 A;  4IWO A;  3BIN A;  1LFD A;  2Z8L A;  2XK5 A;  1NEK B;  1VZ8 A;  1WE6 A;  4K81 A;  5LXI B;  1K52 A;  3V05 A;  1BML C;  3APD A;  2XBB C;  1UF0 A;  3ZLZ A;  2JXT A;  2IPK D;  5D2M B;  3AM9 A;  2K22 A;  4ARC A;  4HXD A;  4P1B C;  2DHZ A;  4WJO A;  2WXI A;  1HTO A; 
#chains in the Genus database with same CATH homology
 4HKQ A;  2ONQ A;  1QIL A;  4C7Z A;  1I4P A;  3W1S A;  5H92 C;  2KAC A;  2Q5W D;  5EE3 A;  4HJG E;  1EWC A;  1FNU A;  2AX5 A;  3AEG B;  4RF0 A;  1FM0 D;  1QKZ A;  2WU2 B;  1HZ5 A;  3L4P A;  4YT0 B;  3AE9 B;  4ARI A;  4MH8 A;  5BYR A;  3AEA B;  4USA A;  3V3X A;  3IAM 1;  3NVV A;  3P4P B;  1L5P A;  2N0S B;  3BYY B;  2WS3 B;  3IT4 B;  4KX6 B;  1NVI D;  3E9S A;  1ZUD 2;  3VR9 B;  1R7S A;  1YQ4 B;  4YXD B;  5BYS A;  3FAH A;  3AE6 B;  1VDV A;  1MPE A;  1MVK A;  2RPV A;  3HRD D;  2QMT A;  1NYQ A;  4DXF A;  3AMZ A;  1ACC A;  1JWA D;  5C3J B;  2E6X A;  2W3R A;  1A70 A;  3EGR A;  2WXK A;  1EU4 A;  1K53 A;  3TEW A;  1BUI C;  2CU3 A;  3C8Y A;  1UUP A;  1FCL A;  1FD6 A;  2GI9 A;  1L6V A;  3MJ5 A;  4ZHO A;  5HHD G;  3VRA B;  3WCQ A;  1N5W A;  3RFZ B;  1XCQ L;  1SB3 C;  1E7P B;  3AV8 A;  1GOZ A;  4JE3 B;  1IGC A;  3NRZ A;  3NVZ A;  2VZK B;  4OZC A;  5AUK A;  2BS4 B;  1SJH D;  4WQM A;  2NMQ A;  4AS1 A;  1FMA D;  3Q8A A;  1VJK A;  3U7Z A;  1F2R C;  1MHH E;  2N9L A;  2BS2 B;  1XLN A;  2L1A A;  1D5M C;  1ZDX A;  3E56 A;  2W82 A;  1XLP A;  2RMM A;  3AH7 A;  4ZRP A;  1KLU D;  3CIR B;  3AB5 A;  1JQ4 A;  1PGA A;  3AE7 B;  4WUR A;  1UGJ A;  2FUG 1;  2EKI A;  4P16 A;  1PYW D;  5BMH A;  3NVY A;  3MFG A;  3DWM A;  1V1O A;  1QF6 A;  2WDQ B;  5D3D A;  1I4G A;  2MJD A;  4XE0 A;  4LK0 M;  4D2K A;  2V3N A;  2BTE A;  1JWS D;  1YQ3 B;  4US9 A;  4MT5 A;  1TS2 A;  5G5G A;  4Q2J A;  1DGJ A;  4JPS A;  4OZA A;  2MH7 A;  4YSZ B;  2DYO A;  1F77 A;  3EUB 2;  1JCK B;  1QOG A;  2PVG C;  3SEB A;  5GXG B;  3OWE B;  3BK1 A;  4WIP A;  3NVW A;  1DOY A;  2PW9 A;  1CQV A;  2WLB A;  4N6E B;  5E6J A;  3ZJV A;  1QOA A;  2K5P A;  3CWI A;  3NUH B;  1PGB A;  2WXH A;  2NTT A;  5EE9 A;  2Y5P A;  3W2D A;  4L1B A;  1T3Q A;  2G1E A;  3HVZ A;  3FIL B;  4YTP B;  2IGG A;  2G9H D;  3B9J A;  2CJN A;  2I2Y A;  3LYY A;  2M0A A;  3B2F A;  2PKO A;  4RCO A;  4UDU C;  1WWT A;  1QOB A;  2AQ2 B;  2Y5C A;  1WSP A;  3ZJT A;  1XCT L;  2QEJ C;  2BBC A;  4NZL B;  2QIL A;  1TJE A;  1KTK A;  2J4X A;  3NS1 A;  1L4Z B;  4P6V F;  1ZXH A;  2B76 B;  3SFE B;  1IUE A;  1JML A;  2BYT A;  1IBX A;  4HRS A;  1UWM A;  2WXP A;  1BXT A;  2DWQ A;  2NTS A;  4XWT A;  3ETR A;  2KAJ A;  1RYJ A;  4LTU A;  4YWG G;  1LO5 D;  1RM6 C;  2IDY A;  3KWV A;  3AE8 B;  4OW0 A;  3ABV B;  1PUT A;  1F0Z A;  4XDD A;  1EWY C;  1XXG A;  4N59 A;  2INN E;  1V97 A;  3DWG C;  2FE8 A;  1ET9 A;  4B0E A;  4TMA B;  1ZP0 B;  3T3N A;  2L32 A;  1WRI A;  2WXN A;  3U52 E;  1TY2 A;  3U2S C;  1EM7 A;  1OQR A;  3LXF A;  1FCC C;  1IGD A;  3BVM A;  4HRO A;  2TSS A;  2L83 A;  2MJ3 A;  3FC4 A;  4N58 A;  1JAL A;  5D3I B;  2JU6 X;  5I4D A;  4RGO S;  1AYF A;  2KQ4 X;  1NEN B;  2YEP B;  1VZ6 A;  2MJE A;  4JWU C;  4A90 A;  5HFY A;  2DLB A;  1AN8 A;  2BW2 A;  4US8 A;  2PIA A;  4H2A A;  4C56 C;  2KWD A;  2LFI A;  2PTL A;  2XNA C;  1FO4 A;  1AW7 A;  3VQI A;  2ACZ B;  1E9M A;  4C80 A;  2LJI A;  2PVO D;  1C9F A;  1VR9 A;  3H8H A;  1C79 A;  4IOI E;  1YNT E;  1ZDV A;  4A6Q A;  2WNM A;  2R61 A;  4GDK B;  4IKG A;  1HXY D;  3AN1 A;  1M4V A;  3EA6 A;  4RGN A;  5BYQ A;  1TKG A;  4MM3 B;  3UI3 A;  3N9Y C;  3W5V B;  1TZO A;  2H89 B;  4RNA A;  1TKE A;  2SEB D;  2FBW B;  3J9C A;  5FR3 A;  2D5G A;  2KN4 A;  4ZHP A;  1N62 A;  2IGD A;  2PLP A;  5LNK 1;  1GAQ B;  2IJ0 A;  2ZW1 A;  4O1N A;  1FEH A;  3TEZ A;  1WXQ A;  3BWU D;  4XWW A;  1KH0 A;  2N9K A;  1TYG B;  4KKJ A;  1XLQ A;  2LEK A;  2WU5 B;  2JQR B;  3O13 A;  3P42 A;  4HEA 1;  3PZ7 A;  2WP9 B;  4WH4 A;  5FKA C;  3VRB B;  2M19 A;  1J7A A;  2DBY A;  3U4E G;  1MI0 A;  1YN5 A;  1YN3 A;  3BII D;  5HI1 A;  2ON8 A;  5JXV A;  3P63 A;  4J3O D;  1J7B A;  1CJE A;  2WDR B;  4WAF A;  5D7G A;  1FRD A;  3Q8C A;  1CZP A;  1V1P A;  1FFV A;  1FIQ A;  2JWU A;  2WXJ A;  2KDM A;  1JWM D;  1L0Y B;  1DOI A;  1SF0 A;  2AQ1 B;  4NAM A;  1YJJ A;  4IDI A;  2I38 A;  2M56 B;  4LLG M;  1FRR A;  3W9C B;  1I4R A;  3P1M A;  2V3P A;  3AE4 B;  1HZ6 A;  1E6E B;  3ZJU A;  1E10 A;  1TY0 A;  1ESF A;  3AEF B;  3TUO A;  1NI3 A;  2HTM E;  1FXA A;  3NZ3 A;  2SAK A;  1SE2 A;  1T6B X;  4ZRQ A;  1YMH E;  1ZOY B;  2LHD A;  4CQN A;  3Q8E A;  3R2I A;  1L6U A;  1XF5 L;  1N60 A;  1VZ7 A;  2LUM A;  2INP E;  3IT6 B;  1SJE D;  4L2Y A;  1E0Z A;  1B9R A;  1VRA B;  2QSD A;  1GB1 A;  3R8B A;  1SIJ A;  3TEY A;  1K51 A;  1HQR D;  1J7C A;  1XO3 A;  2XN9 C;  1OQQ A;  2BS3 B;  3PO0 A;  2QJL A;  1D4B A;  3AED B;  3VR8 B;  1SXT A;  3T3O A;  1ZE3 D;  3I57 A;  1EU3 A;  1TKY A;  2ICI A;  1C76 A;  1ROE A;  4L23 A;  4HKZ E;  4XDC A;  4YTN B;  3SFD B;  2V0G A;  1XLO A;  3TEX A;  2IGH A;  3ZQ4 A;  1KFY B;  4A8X C;  1HEZ E;  4AQ7 A;  1ET6 A;  4KGS A;  2QIE B;  1WGK A;  2WXR A;  2J53 A;  2E3T A;  3B2G A;  1V1P B;  1RWS A;  1ENF A;  4REZ A;  1RFK A;  2WQY B;  4YSY B;  1D6E C;  2J52 A;  2JX5 A;  1L4D B;  1JRO A;  3HUI A;  1DOX A;  2WXM A;  1XEE A;  5HG2 A;  3MP9 A;  1TS5 A;  3I9V 1;  3AE1 B;  3LB8 C;  1JWU D;  3PZ8 A;  4OVZ A;  3RPF C;  1YJI A;  3MHZ A;  1FFU A;  3AEE B;  2KMM A;  1OFF A;  1C4A A;  2MEK A;  3BVG A;  2K0P A;  1QT9 A;  3IAS 1;  4RH6 A;  1FNW A;  3IXS A;  2DYM A;  1C4P A;  2YEP F;  2AQ3 B;  2HDE A;  1MHX A;  1WYG A;  1FNV A;  4ZYS A;  4NJC A;  2LGI A;  2N7J A;  2VZK D;  2GB1 A;  1DYQ A;  4JWS C;  2RDG A;  1PFD A;  4KKI A;  1P7E A;  1I7H A;  1IBX B;  5C2T B;  4KGR A;  1JW9 D;  5MPO A;  1HA5 A;  2BB6 A;  1SSN A;  3Q8B A;  2H88 B;  4B0M A;  1ZPS A;  4PT5 A;  1KLG D;  1Q10 A;  1PGX A;  2LMC A;  1D5X C;  1T5X D;  1L0X B;  3FIL A;  1D5Z C;  2W54 A;  2WXG A;  2BB5 A;  4RFB A;  1N63 A;  5BMG A;  1CK1 A;  3URY A;  1TS4 A;  5TSS A;  1UNS A;  3AE2 B;  2EEL A;  4MAC A;  5H8Y E;  4WWM A;  3TSS A;  3P4S B;  2V4I B;  1I4Q A;  1K50 A;  4OZB A;  3KWL A;  4RF1 A;  4RGM A;  4R3D A;  4FXC A;  1UWX A;  4NAW B;  3ZGZ A;  4A55 A;  3HVD A;  2WXL A;  5AUI A;  2OHF A;  3GP7 A;  3KQ4 A;  1I4H A;  2JSV X;  2GRI A;  1SEB D;  4M0W A;  4RGT A;  3BK2 A;  2W3S A;  3SR6 A;  1NYR A;  5EE0 A;  3Q8F A;  1FXI A;  1AWD A;  5G5H A;  3BVZ A;  4TQ0 A;  3AEB B;  1SE4 A;  1QLB B;  1C77 A;  3R2T A;  3AE5 B;  3W5U B;  5FK9 C;  4TSS A;  1C4C A;  1ZXI A;  3GS2 A;  4ZOH C;  2WXF A;  4C7Y A;  2ZW0 A;  1TS3 A;  3KLS X;  1SE3 A;  3ZYY X;  1N5X A;  4YTM B;  3P4Q B;  3AEC B;  5BMI A;  4YSX B;  4DXG A;  1KF6 B;  1Y56 A;  2WXO A;  5EE1 A;  1STE A;  2LHE A;  4DQO C;  2J42 A;  2BT6 A;  1VLB A;  2RDH A;  1PDX A;  4TQ1 A;  2CJO A;  2L52 A;  1SBB B;  1JRP A;  4EE2 A;  1F2R I;  2X38 A;  1B1Z A;  2Z8L A;  3BZD B;  1NEK B;  1VZ8 A;  3Q69 A;  1QOF A;  5T8I A;  4OHJ A;  2Y3A A;  1L0V B;  2JYT A;  1K52 A;  1V8C A;  3V05 A;  3GB1 A;  1GB4 A;  1I4X A;  4GDL B;  1BML C;  4KGT A;  4ITK A;  3MC0 B;  1YN4 A;  2WXQ A;  1N61 A;  2WDV B;  2PMV A;  2JXT A;  2IPK D;  2K3U A;  4JX1 C;  3AM9 A;  1P7F A;  2K22 A;  4ARC A;  2JZP A;  1JWB D;  2W55 A;  1C78 A;  3BYT B;  1QQR A;  1GPX A;  2K9X A;  4GLS C;  3P4R B;  2OED A;  3AE3 B;  2JYE A;  4A9A A;  1KRH A;  2WXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...