2RDGA

Crystal structure of staphylococcal superantigen-like protein 11 in complex with sialyl lewis x
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
192
structure length
192
Chain Sequence
VRSQATQDLSEYYNRPYFDLRNLSGYREGNTVTFINHYQQTDVKLEGKDKDKIKDGNNENLDVFVVREGSGRQADNNSIGGITKTNRTQHIDTVQNVNLLVSKSTGQHTTSVTSTNYSIYKEEISLKELDFKLRKHLIDKHDLYKTEPKDSKIRVTMKNGDFYTFELNKKLQTHRMGDVIDGRNIEKIEVNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Superantigen-like protein 11
publication title The crystal structure of staphylococcal superantigen-like protein 11 in complex with sialyl Lewis X reveals the mechanism for cell binding and immune inhibition
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 56
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2007-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2rdgA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2rdgA01
1PRTD 3W2DA 4L63B 3V05A 1BCPC 1ESFA 1RD9D 1AN8A 1EEFD 1RDPD 1G8ZD 1V1OA 1ENFA 3EFXD 1D5MC 1JWUD 1PYWD 2NTTA 4RGTA 1CHQD 1LTID 1PTOC 2ICIA 2O2LD 4RFBA 4Z9CB 1I4QA 2XN9C 3R8BA 1JCKB 2G9HD 2SEBD 1LTAD 1EWCA 4UDUC 4OHJA 3CHBD 3DWQA 4O1NA 2XNAC 1JR0D 1LT4D 1LTTD 4RH6A 1BCPB 4DXGA 1BXTA 1LT3D 1SJED 1DYQA 1ET9A 1I4XA 1FNVA 1S5DD 1V1PA 1YN3A 1TS3A 1SE3A 1BCPF 1PTOB 1TS4A 1HTLD 3MC0B 1PRTC 4RCOA 3R2IA 1JWMD 5TSSA 1PTOF 1CQVA 4K6LA 2RDGA 3DWPA 1RCVD 2QEJC 1SJHD 2XRQD 1HA5A 1FNUA 1DJRD 3KLSX 1PTOH 4RGOS 3EA6A 4L6TB 1LLRD 1EFID 1RF2D 1L0YB 1I4HA 3BVGA 1YN4A 1SE2A 5ELBA 1LTSD 1D5ZC 1PRTB 2AQ1B 4RGNA 3OWEB 1XXGA 1CHPD 5ELFA 1B1ZA 1FD7D 1S5BD 1GOZA 1CT1D 3SEBA 1PRTF 1SBBB 1STEA 1PZJD 1F77A 4RHRA 1LT5D 1FGBD 2Z8LA 1UNSA 1V1PB 3BZDB 1UUPA 3BVMA 1LTRD 3GP7A 4ZYSA 1CK1A 1TS2A 1T5XD 1KLGD 5FK9C 1YN5A 1LT6D 2IPKD 4RHSA 2TSSA 1QILA 1I4GA 2WV6D 5ELCA 1B44D 1FNWA 1PZID 1BCPD 3BYYB 3BVZA 1S5CD 4TSSA 1LTBD 1HQRD 1KLUD 1EEID 1TS5A 2RDHA 1EU3A 2XRSD 5FKAC 2CHBD 3URYA 4DXFA 1L0XB 1D5XC 2AQ3B 2QILA 1PTOD 4C56C 1XTCD 2J4XA 3O13A 1JWSD 4BWGB 1TY2A 1HXYD 1SE4A 1AW7A 1D6EC 5D3IB 1ET6A 2NTSA 1JQYD 2IJ0A 3MFGA 4RGMA 1M4VA 1LO5D 1I4RA 2AQ2B 4NZLB 1I4PA 1EU4A 3TSSA 1MD2D 1SEBD 1TY0A 5I4DA 1PZKD 1KTKA 1S5FD 5D3DA 1S5ED 3BYTB 5ELEA 1SXTA 3DWAA 5ELDA 2R61A 1LTGD 3R2TA
chains in the Genus database with same CATH superfamily
2DNCA 2FXQA 4LF5Q 1F2LA 1E2ZA 3U50C 2WS3B 2FIDA 4HPMB 4OVUA 2KEDA 3ZUNA 2LRWA 4MDKE 4CQNA 5I2YA 4GKKL 3P4RB 5E3FA 5IKCM 3S24A 4LTUA 2M56B 1ZDXA 2WXHA 3ZRFA 1LQBA 4LFAL 1WYDA 3RNCC 2K33A 3VDYA 4NAMA 1WFQA 4JPBW 1I35A 4RAUC 4A3FB 1LT4D 4J6HA 3N9YC 2GBKA 2SNSA 1HR0Q 3A9KB 5EE9A 3U7ZA 3GE8C 4MM3B 2KC1A 5JJLA 5E7NA 2R92G 2WXIA 5LNK1 1U0LA 4CDFC 4DK6C 2LRUA 4BY7H 4DR5L 5E6OA 3VHTC 3RMKC 1HCZA 1EQRA 2IGHA 3IAM1 4EGVA 1EY6A 3B08A 2KUMA 2KK8A 1D3ZA 2FHTA 4QL5A 1MJDA 1WXAA 3CMMB 2LVQA 3Q69A 2I38A 5E6NA 4KDIC 1C48A 2ONQA 1ASYA 3PO2B 2R2OA 2DZJA 1TKGA 2HTHA 3H7PB 3GZNB 4A8XC 4BOSC 3AE7B 4DK3C 1CA5A 4A93H 3MHSD 4DWFA 3T3OA 2QGQA 3H91A 4GNXB 1YI2A 1NI2A 2JJQA 3B0AA 4CHKA 3BWUD 1TWHB 4LDTB 1SE2A 4NKLA 1SLJA 3KLWA 3A0JA 5ELBA 5G3LD 3HOXH 4KHPL 1QZHA 2MBEA 4OVVA 4F8CB 3CWIA 3D0FA 2QJLA 4F88A 2LFNA 4RG1A 4LFCL 3APDA 3UQBA 1UE1A 2PTLA 1S1QB 1SB3C 3I4MH 2EELA 1LT5D 4XYOA 2EJFC 1F52A 4DHZB 5L83A 2UUCQ 3CQZB 1WRIA 3LJ3A 5IAAC 2I2YA 4LJPB 3BS1A 2Q2TA 3J7A5 1LM8B 3OTOQ 2KDIA 3HK0A 3NVVA 2AMCB 3AEGB 2HCIA 1QVGA 3V62A 4ZKBB 3TREA 4EX5A 2FNJB 2RDFA 3IFTA 3SHLA 4KKIA 1F9QA 1V8CA 3EHVA 1IXRA 3A55A 3LGJA 3VR4A 1YZ6A 5CHWA 4ABNA 2ICEC 4FXCA 1EU3A 5JEAG 3M4OB 5C3EB 1XO3A 4DV0Q 2JWUA 3GTPB 3DBLB 2B63B 3RUZA 2JY6A 2F0EA 4KKSA 3RNEC 3E0JA 3CIRB 3B1LX 3GTJB 3S2AA 3KFUA 1VQAA 1WY8A 2I5LX 4EVOA 2JYTA 2B76B 4JYAL 5C5MA 4JI4L 2A6HD 4H2AA 5IO9A 3Q3OC 3PO3B 5D3DA 3CCEA 1EM7A 1QUQA 3K5LA 2JA6B 2L83A 2IY0B 5C0XG 4G11A 1PRTD 2YU9H 2K04A 3ML9A 1V1QA 1RD9D 3K5MA 3OWFA 4DHZE 1KDAA 4BKTA 3DBSA 4RM8A 2LGSA 2HT1A 3ZTCA 2WHIA 1U4MA 4IKGA 5M5XH 1CKOA 2EYPA 4WJ4A 1PYWD 4JBJA 4P75A 1L2FA 1CHQD 4LFBQ 2KOLA 2ZXOA 4GN1A 4HKQA 2HUGA 1P3QU 1T0SC 2QDFA 2WNMA 3EECA 2XTIA 1BBUA 4EQNA 4LF4Q 4YY3L 2NN6H 3GTOB 1SIJA 1VCIA 3K0XA 3CSFA 3NVWA 4JI7Q 2C35B 4KY6A 4DXGA 2RMMA 2CHZA 2RSUA 1WGYA 4K81A 1GC6A 1SF0A 2K14A 2R93H 3RZFA 2V4IB 2DN8A 1WX9A 4IUUA 5D7GA 2MFIA 4US8A 4IPCA 2UU9Q 3Q8AA 1UWXA 3TS2A 1V80A 2WXGA 3UINB 3PTFC 5IN7A 3JVZX 3VFKA 1S3OA 2NVQB 1PRTC 5BO4B 3R2IA 2MWSB 5DPSA 4A3GB 4IJLA 1MG4A 4II2B 1CQVA 3W5VB 2LKVA 1RCVD 2QEJC 3ONAB 2ZM6L 4DV6L 3RI7C 2K5DA 1E10A 1DJRD 1YVCA 1KLVA 2VB2X 4GB9A 2GLSA 2I5MX 1KDBA 2FCQA 3HS0C 2QCZA 3RNAC 5IP9G 3NS8A 2LMCB 1KIXA 2CH4A 2WDVB 3HOVB 4N9F4 2AQ1B 3OHXC 2NVXH 3VAWA 1EY5A 1VQHA 2F0UA 4WJWA 2JRIB 2WIIB 3NXWA 2R7ZH 1I6HH 2DX5B 2G1EA 2GMIC 3GO5A 2E2JB 1TKEA 1Q1OA 1MI0A 2FE8A 3N32A 3L0OA 5CMDA 4HDQA 1L4ZB 1MVKA 4LNOA 4ZLTF 4MGYE 3U2SC 4KKTA 1STAA 3P4QB 5HURA 2VH1A 1L1OC 5M3FG 2L3ZA 3HKSA 3TDQA 1Z6HA 2UYZB 3K8AA 1K8MA 3AE2B 3E56A 4KV2A 3ZKJC 3AM9A 1S4ZA 2MJEA 4M0WA 1LM0A 2F0PA 2YTXA 4WURA 1XMOL 2NN6I 3VUXA 1I4GA 4NW2A 2PW9A 2EQSA 1VQNA 3ZQ4A 1C4QA 1KLUD 1W2BA 1RRBA 1A0IA 1Y14B 1GUAB 2KFKA 2RQXA 4JI5Q 4EUTA 2JSOA 1R9TB 1V9PA 4BBRH 3KF6B 5C5LA 3ZLZA 2Z6KA 1HQMC 1PH8A 3S15H 2K28A 4IN3A 2Z59B 3VA5A 3EGRA 4KK7A 1AW7A 2F0LA 2WB1B 2FCSA 2CW0D 4A3IH 2ATWA 4P16A 3HOWB 2WAQG 1LV9A 4PK1A 5COYA 1WTVA 5C4JB 1CJEA 4RGMA 2I1JA 1S72A 3FKYA 5KHQA 3E9IA 2AYOB 4FJZA 3D3RA 5C4ZA 5G5GA 1I4PA 3I4NG 4P74A 1WTOA 4HTHA 1RKNA 2IO2B 3KF8A 4CO7A 1PYBA 4ANXA 5JHBA 2DY7A 2BTEA 2E5LL 1VQCA 2KHIA 4JW0A 4QF4A 3G6EA 1SE8A 4DK1A 1LFDA 1SGHA 3AE8B 3ECIA 4Q2JA 1VQFA 2D3CA 3U4ZA 2RSNA 1HTOA 5I9OA 3DCGA 1Q8IA 4FHJA 1I42A 4LJZC 5IIFA 4DR2L 3IVFA 2NR2A 1D5MC 5CC4A 1OEYA 1CKNA 4ICVA 1SYEA 1TQOA 1TWFH 4W9EA 4TQ0A 3HRZC 3ND8A 1Y69U 1SNDA 1LTAD 2SEBD 3QWNA 2DJGC 3F2UA 1PVOA 2UXCQ 4M02A 1N36L 4HJ8A 1U4LA 4DXAB 1T9HA 1BUIC 2JA7G 1EIHA 4DV3L 5IGDA 2J42A 3SDLC 1ZKOA 3C1FA 4X66L 5BR8Q 2EY1A 1HNWL 1XLQA 2OEOA 3GDEA 2L4NA 3VYTA 4EQPA 1QOAA 2V9HA 4XQJA 3MC8A 2EYFA 2JQRB 4A90A 2F3IA 2K4KA 2WB1E 5CYUA 4MACA 3RZOB 4S17A 2JK8A 2EY2A 3S17H 2K75A 4KTAA 4HROA 3ZVVA 2BE5D 4K6LA 2KDMA 4B3MQ 3NZSA 3H15A 1NR4A 5IYDG 3QG1A 4K8IA 4DAVA 1K83B 2MW5A 3E6ZX 4BY1B 1V6EA 1OXUA 1V86A 1OXXK 1VQ4A 3PZDA 2WKDA 5KIXA 1C8CA 3F2DA 3IRBA 1VQLA 3E0EA 3PUYA 3HOUG 3E5SA 2O5IC 2KQSA 1YN4A 3QK0A 3WAPA 2XSCA 3GV6A 5EGTA 1PRTB 1EUJA 4AQYL 1KNEA 3NY5A 2KYWA 3S16B 1WGGA 3KUPA 3NUHB 2KNBA 1B2TA 1GNUA 4B9KA 5ELFA 1AZPA 1WR6E 3PIOA 3S9WA 3PS6A 4HAEA 4JI1Q 4CKBA 1K8OA 2YLMA 1KH0A 1STBA 3A4RA 5LHY1 4AYBB 2DAJA 2M00A 4JV5L 3R66C 2N4FA 4N6EB 1Z47A 2N7JA 3U4VA 2LASA 3WIMA 3H3VI 2BE5C 1UD7A 4F8MA 3RN2A 1CKMA 1PLFA 3KQ4A 4I7AA 1HZAA 3NZ3A 2DJFC 3K6OA 1QILA 2F3WA 1C4CA 5H92C 1L1OB 4DR5Q 3FVQA 1O78A 3TN2A 3B2GA 3FILA 1TWGB 4YIJA 1C9OA 4ZRZA 4HEDA 1OXTA 4LF5L 2UXBQ 3Q8EA 4MGIE 3PRPB 4CYEA 4KIKA 3N1YC 1XTCD 2AUJD 2FFKB 2BPSA 1NMGA 1Q10A 2D3BA 3LYYA 1F2YA 1JWSD 1EWIA 2PKOA 2ZJPA 4DR3Q 2KJRA 1XX8A 3A9JB 2NTSA 1JQYD 1I6VC 3T1YL 2D62A 5LL6S 5J2RA 2KWVB 3PREA 4BVUC 3M4OH 4A3LG 2BS4B 2K32A 4JCVE 3X3MA 2KWUB 3A7AB 4KKUA 3CRKC 3TP5A 1HH2P 3HOZG 1DCZA 5BYSA 3GTPH 1EOTA 3KUCB 1MD2D 1SEBD 2CWPA 1ZYRD 3CPFA 1HR0L 4DDID 4ZRJA 3NRZA 3NS1A 4JL9A 1YJ1A 5T1IA 3T4AC 3GTJH 4HJ9A 3O65B 2OHFA 4UY8C 2ZXPA 1SAPA 3J80L 3QAQA 2NS5A 5G2NA 3TS0A 1YNXA 3T9LA 3TJPA 3CD6A 2VH2A 3GZNI 4ANWA 1A5RA 1RIPA 3MWYW 4QQBX 1BOSA 3V2TA 1V5TA 2M0XA 2WWZA 3NG0A 3DBHB 4U673 1C1YB 1B3AA 3S1RB 4EQ5A 3M9BA 2JA6H 3ER0A 2EOTA 1E5WA 1MHWC 3J80E 1IP9A 4H02A 4OZBA 2KTFA 1H9RA 1VQ9A 5KYLA 4LUZA 4MELA 2Z4IA 2GBNA 2K5QA 3AE5B 2B2VC 1FNVA 1CMXB 2KQ3A 1DGSA 1EIYB 4E3CA 3RFZB 2BDOA 1VMCA 5AZGA 4EOYA 5EE1A 1ZYRC 5IODA 2R7ZG 1T0RC 4R4TA 4UP8A 3GTOH 1P1AA 3F1ZA 2QEXA 2ZPYA 4BZAA 1EQQA 5M3MB 3MC9A 2YTVA 2K9XA 4IUNA 3UDGA 2UUCL 4KZCA 1AEXA 1Y1WG 1SSNA 4F1SA 1C78A 1AARA 2A1AA 1YQ3B 2HD3A 2XIWA 2NVQH 5EDSA 3TZDA 4TRDA 3GB1A 5KYIA 4POGA 3HG9A 1N34Q 2J7QB 1WX8A 2F0KA 3F2CA 2K6DB 3ZNZB 2B3GA 5KHOA 1E22A 3DBLI 3HUIA 2XVSA 1XXGA 3MXUA 4YSXB 1EZ8A 4PZ7A 3R7RA 2KHJA 1STEA 1Q90A 3GTQB 2D3GA 1B7YB 3SK8A 1QCBD 1VRAB 1H9SB 1KRSA 3D6CA 1WD1A 4N59A 3NHHA 4JBWA 2KDEB 4HEA1 3BINA 4KGSA 4ASWC 2MRPA 1WXSA 3HOVH 1WTWA 1LTRD 1E8XA 3EFUA 4WJPA 2E2JH 4DV1L 5JJIA 1I50B 2NPTA 3Q3NC 1G6JA 1KAWA 1T5EA 4RHSA 4FVMA 3J7ZC 2KHWB 1GJZA 5CV8A 3VDZA 5BMHA 3N52A 3U7DA 3IBEA 3A1QA 1VQKA 1R7SA 4LMQD 4N8FA 1UWMA 2VB3X 1X55A 3JAME 4U68A 1I3QB 1FVIA 1NBFC 2LZ6A 1D5XC 5C4HA 2DUDA 3NE5B 1NTGA 1GHKA 3Q8BA 3VR6A 2KENA 2QDLA 5DM63 2Z1CA 3ERSX 4FYDA 3HHMA 1RL2A 2ID0A 3ULPA 5HGTA 2JN4A 2J0KA 5IOIA 3CCJA 4DV6Q 1RODA 2ZEQA 5D3IB 1NYQA 2ZVOA 3TP8A 3CCSA 4LFBL 5JPNC 1FD6A 2DY8A 3HM3A 1MI2A 2F0SA 2ZPNA 2IY5B 2DNFA 1PH3A 3BK1A 4QJFA 4LF4L 4K14A 4KDLB 4X64L 4JI7L 4LK1C 1S5ED 3H7SA 3R3MA 2L0FA 4MNOA 4B3TQ 3S1QH 4DV5Q 2NMQA 3M95A 4L63B 1WZ0A 3HOWH 1KRTA 3GD7A 4WRDA 4OO1H 5C4JH 1RDPD 3DHGC 4JOIC 4KLKA 2IGGA 3W1GA 3RN9C 4IM0A 4A3FG 4WQMA 5IA7A 2J0MA 4K8JA 3KYCD 2V3PA 2XN9C 1VJKA 4HXDA 3OOCA 1KD1C 2KCMA 1P98A 3L2PA 4O1NA 1DOXA 4YTPB 1XPRA 1XMOQ 1QVCA 4HJ5A 3EUB2 1DOIA 1WE6A 3TQYA 4GXBA 3DVNV 2MH7A 3WOEA 2WDTB 3S2HB 1X32A 3TEXA 4ILWA 4DPGA 2L8JA 3PO2G 3GTGB 2BT6A 4C3JH 3R7QA 1M90C 2MPMA 1V2YA 4HK2A 3C19A 3SR1A 4RCOA 5IP4D 1X54A 2R93B 4RKLA 1VD2A 4HIOA 2KBNA 3SHQA 3DWPA 1YIJA 1CZPA 3DUZA 2KCCA 5J39A 3IAS1 4XT3B 1MBYA 2D5DA 3MTSA 4L6TB 4K5XA 4W9KA 3JC66 3I63C 4REZA 3K9PB 4CGYB 1D5ZC 1IBKQ 3QARA 3I5JC 3OW7A 3VR2A 4X3SA 3OSOA 2DZMA 3VTVA 4ZDVA 4ZHOA 1M94A 4LAAA 5G5HA 2IO3B 4BKSD 3ENEA 4WFN3 2HD5B 5BN5A 1B1ZA 1K83H 1B8AA 4BY1H 2H89B 3PVLA 2L7RA 1YJJA 4DR2Q 4QUFA 3S1MB 5GAEC 2M4NA 2WXPA 2DLBA 3ZJTA 1WSPA 1JE5A 2B2YC 3UDXA 4OO1I 2KTRA 1WXQA 4W9HA 3EBEA 2KVZA 2ZVNA 4ARIA 4II3B 3S16H 3CAMA 1J19A 2L12A 2MP2B 3KJOA 2O2VB 4XXEA 1ONLA 1TS2A 1OFFA 4K0KL 2MBOA 3P2BA 5FLXc 5D14A 3EQLC 3J81L 4ODGA 1TJEA 5C3EG 3M4QA 5JH5C 1VQGA 2F0FA 4WJOA 2BCOA 2C5CA 4A3JG 4KVGB 1HNWQ 2B63G 1FXAA 2PVGC 2KD0A 1E8ZA 4WIPA 3DVGX 1TS5A 1NY4A 2WXQA 5FJ8H 2XRSD 4DV2Q 2CHBD 1G91A 3MXPA 3J81E 4B3RQ 3A9KA 2LEKA 1UE6A 2I0QA 1RYJA 2D0OA 2F4VL 1K73C 4IQZA 1OGWA 2BYVE 4MM3A 1E0ZA 3PZ8A 2LGXA 2PNRC 5IGEA 1OXVA 3AB9A 1QOBA 4IFDI 1SR3A 2K5VA 3PO3G 5C44G 2VY3A 3TMEA 2JA8G 4L1BA 3J80i 2A5HA 1EQTA 1U4PA 3VR3A 4IURA 2UU7A 2JA5B 2AQ2B 2EXZA 1K9MC 2UXCL 3PMFA 4AQYQ 1WWTA 5CBAE 3AEEB 3HOYG 1N60A 2ZNVC 3H7PA 4GGQA 5ELDA 4A3IB 1LTGD 5E4XA 1P8LA 3PRZA 3KK7A 2N8NA 3V05A 5BR8L 4GNXA 1PGXA 3PT2B 1JROA 4C3HG 3J81j 3Q8FA 3EN2A 2K6QA 1KFYB 4DHJB 2VRRB 1TKYA 4XGAB 3K80C 3V6CB 3TRZA 1MGSA 3NVZA 1IBLL 3HKZB 4JV5Q 3RLFA 1DOMA 5EE3A 5E1FA 2NVYB 1ZXIA 1XWEA 2V4DA 4C3IB 4WJQA 4I6LB 2ZTDA 1H9JA 2JEBI 1RM6C 4MTNA 4DR1Q 1Q8KA 2I46A 1GUTA 3CHBD 2XNAC 4B3ML 3M7NA 1PQSA 5EPLA 1P9DU 5I2XA 2G4SA 4ZHPA 4R8NA 1C0AA 3H1UA 5IOCA 4TMAB 3BU2A 2BH2A 1JOOA 3DM3A 2Z0DB 2O6VD 3WALA 1JW9D 1V81A 4AJYB 4IUVA 4GLAC 2PMZB 2VQFQ 1STNA 4XWWA 3FC4A 4OZCA 3I3CA 1TS3A 3I56A 4LF7L 5IT9L 1Q1BA 2BA0A 4A3GG 1N6ZA 5CV9A 2MBHA 1SE3A 3VUWA 1BCPF 1IYFA 2B2UA 2JYOA 4A3DH 3W1SC 4DR7L 2HIXA 3GV3A 1TS4A 1W6KA 2F0TA 1F9RA 3QR8A 4BBSH 3VXWA 1HTLD 1WOCA 3AFQA 2B8FA 2JXMB 5KGUA 5IYCH 1FJGL 5IYBH 1DXMA 2CH4W 1ZOYB 3CU7A 3Q2AC 5DPWA 5LXIB 4R8IA 5IT9E 4JI1L 5GMVA 3T1YQ 2MUYA 1K53A 1EWHA 1XLOA 1TU2B 2LS01 2HDEA 5JOBA 3FDTA 3RMHA 1NE3A 3J9CA 4NNJB 2HQEA 4A3EG 4BXXG 1G6PA 1EFID 1JT8A 1E0BA 1L0YB 1Y8OB 4KN7C 1GM5A 1C76A 5DPTA 1F9PA 3OIQA 1NMFA 5C6AA 3AN1A 3KYDD 3S17B 5M3MH 2XGTA 2F3VA 2N3SA 4TUUA 2KEEA 3KDFB 4APVA 4WJ3M 3APFA 4IC7B 4CHTB 4IPHA 3DBRB 4IUMB 3E9SA 3JAMi 2F0WA 1Y1VG 3KWVA 1V49A 1CT1D 1N62A 3G71A 4FULA 3HKZE 4A3MG 4GU2A 1A2TA 3BJUA 1ZDVA 3PZ7A 1FGBD 4IWQA 1XF5L 3RNGC 1WIAA 4OX9Q 3BIID 3I3TB 5LL6X 2UXBL 4XDCA 1V1PB 4IM3A 5IGGA 1SMYD 3EJIA 3WOFA 1ISNA 4ZYSA 4DR3L 4ARCA 4ITKA 1WGDA 2Z6BA 5K36H 2KAJA 2BDNA 4HWIB 2PMZE 2XEWA 3GTQH 1X6OA 2DGYA 3A8IE 3I72A 2TSSA 1K50A 4LCDE 1WYGA 4B0EA 3L10B 3VUYA 4TSSA 1YD8U 1HE8A 2B2WC 1E2VA 1H9KA 4DXFA 1KABA 3UE0A 4W9FA 3DBHI 5BYRA 3TMPB 1JB7A 4OO1G 1EY4A 3RNUA 4IUQA 5HY6A 3L17A 2RKSA 4FF2A 2LWPA 1I50H 1WGKA 2KJHB 2IZVB 2VUMH 3UGBB 1NNXA 4DK0A 2MLBA 3A56A 3WAOA 2ASQA 4K3BA 2DYBA 1F0ZA 1PH4A 1SSOA 1WTRA 1I3QH 5CX3A 4C7YA 1RWSA 3NHEB 2FJ2A 4K3CA 3AEFB 3PIP3 1WE7A 3ZJYC 3IT6B 2N7DA 2UXDQ 3KBGA 2F0GA 3N6RA 1WCMB 4QB4A 3I7FA 1IGCA 2JU6X 5DPRA 1OXSC 2V1YA 1UBIA 2LD9A 1Q81C 3QB3A 3K57A 2JYEA 3JYUA 5J18A 1U4RA 2TMPA 4IFDG 1VR9A 1ENFA 3EFXD 2IGDA 1V8QA 2SNMA 4TQUS 2ZXRA 1BKBA 4Z9CB 4HIDA 1FRDA 3MEHA 3R8BA 4KSKC 4R4QA 4TKNA 5BMGA 1O80A 1WJ4A 2ZNVB 4M01A 1C3TA 2KHSA 3UI3A 2JT4B 4DV1Q 1LTTD 2JF5A 3T51B 1NYRA 2PQAB 3HGBA 4X6AH 1HEZE 4J6IA 1Z5SB 4GN5A 4PS3A 3SU8X 4IPGA 2M17A 1YN3A 4C1NI 3B2FA 1N34L 3NP8A 4A3CH 2PE9A 3VTUA 4OWTB 3HEJA 4O0AA 3ULJA 3J7AF 4BY1G 1R4QB 3MHBA 3MC0B 2ZJQA 2V3NA 4YSZB 3N1XC 4IOIE 5JXVA 1JWMD 1YJWA 3UQAA 4NJCA 2AL6A 4P72A 3CCQA 1EYDA 3S2HH 2D07B 2EKIA 4WH4A 5KNCA 1XNQQ 5JEAJ 3HZXA 3KLSX 1YIWA 3GTGH 3EA6A 4IFDJ 3KF6A 1PDXA 2W9NA 4X64Q 4NPNA 2K5PA 3WCQA 1IBXB 1I4HA 1VQEA 5L37A 1VZ6A 2D11A 3PO0A 5JJZA 2K8HA 1PMRA 4YL8A 2ES2A 4A3BH 3VQIA 2FBWB 3QOLA 1GUNA 2VZAA 3PCOB 2LGIA 2A6HC 1IKMA 2IW3A 1YX5B 1U9RA 2BYFA 3OAWA 3T16A 2MP1A 3J81i 1EO6A 4NP5A 5I6WA 3PIO3 1L6UA 2WP9B 4QAYA 4DNIA 3VA7A 3RULA 2K8BA 2KMAA 3BZDB 3A74A 5C0XJ 3Q22A 4DUYL 3Q3FA 4WWMA 2VQEQ 2AX5A 4KSLC 4CBVA 1WGHA 2KJ6A 2LHEA 2O6VB 3H6NA 1DOYA 2INPE 4B9XA 3TCAA 2IBIB 3RPFC 1VZ8A 4GSWA 3S1MH 4GLSC 1Q1EA 4LF9Q 5FLMH 5ELCA 5JHAA 2PW7A 1PZID 3PHWB 3BYYB 2CCZA 2UUAQ 3U30A 2RVLA 4L8JA 2EJGC 2RGFA 2C7HA 1L0XB 3X23A 3NSWA 4B3TL 4OELB 4DV5L 4HIMA 3IHPC 5C23A 2EIFA 2ZTCA 3BDCA 1WVLA 3HRDD 5C3XA 2ALYB 2SAKA 1B53A 3TIXA 5H1SE 2JP1A 4CKEA 1UELA 4K1RB 1SE4A 5CV5A 1UEAB 1EWYC 2DWQA 3IXSA 2F0QA 3FPUB 4A3KG 1YX6B 5EBDA 4ANUA 1WJ6A 2J53A 4JI6Q 4L5RC 4FADA 3DM1A 1A3VA 2R7FA 1OEYJ 1R4MB 1OQQA 2I07B 4A9AA 3SFEB 4XC2A 3H0GG 1SRUA 2K22A 4ANVA 2DNEA 2B8GA 2LVOA 4HPLB 1A6XA 3TZUA 3LDZE 2JA5H 1TT5B 4N9TA 1FR3A 5EE0A 1RHPA 4ZRIA 1N33L 4EQOA 1YJNA 2K25A 2X6GA 3S1QB 2JXXA 2WXRA 1N9WA 3VR9B 4K0KQ 1HFGA 4OHJA 1IL2A 2K5HA 2E2HB 1JALA 1WMHB 1QNKA 1KAAA 2K5WA 3PIPA 5C1ZA 1WJJA 3KUZA 1DYQA 4M8MA 3TEHB 1QOFA 3KW5B 4K7UA 1K51A 4IWPA 1GKHA 3M7GA 2XK5B 4X3UA 2NVYH 2BH8A 1IBKL 2NVTB 1VMPA 4C3IH 4DQOC 1TZOA 4AQ7A 2R3ZA 4BY7G 4CJ0B 2MQJA 2F4VQ 4HDOA 1FFVA 2WGSA 2RR9A 2N1VA 3SFDB 4HCSA 1QQRA 3B6YA 3AMZA 3STBD 1PTOF 1DOKA 1L1OA 1KM7A 2KMMA 3DWGC 4G7ZC 1HZ6A 5FO7B 1Q46A 4P73A 3VRBB 1LGRA 1YITA 4ZOHC 2BOSA 1N61A 4YWGG 1FMAD 1IZ6A 1TVXA 1NR2A 4C3JB 1V9JA 1ML0D 3CC2A 2C9WB 3T1HQ 4A93G 1WH3A 4DGZA 2D5GA 2L00B 2CJOA 1EFWA 4EKUA 1PFMA 2CW0C 2MSED 2JRHA 2EYJA 2Y0SG 4FXGC 1CA6A 3SR6A 3S14B 2WFWA 1YOVB 3TEYA 4K6DA 3IL8A 5H8YE 2YEPF 4Q0FA 3HOXG 3A9JA 3D6WA 3IKJA 1JJGA 3A8JE 2RDBC 3CCVA 3GOEA 3RNBC 1K0SA 1QOGA 2G9DA 5ELOA 1A3UA 1GOZA 1JE4A 4GDKB 4DV2L 1NI3A 2JQOA 4PQXA 1IBLQ 4B3RL 2RD0A 5AZFA 3HIZA 1JWAD 1VQ7A 2X69A 3I4MG 2CQAA 5D94A 4IJHA 4FF3A 1GO3E 3Q0AA 1AE2A 3RZDB 1K3RA 3BVMA 1RLFA 3STBC 5EQ0A 4KZ0A 1B50A 2PZUA 3SDZA 2E74C 4G4KA 1PV4A 1DM0B 3CKIB 4RCNA 4P1CC 1XMQQ 2Y3AA 4PS8A 5JVG3 3RT3B 3V3XA 3DOWA 1EZ6A 1EIGA 1X65A 3NELA 4LF7Q 1BCPD 1JMLA 1VQIA 3I55A 2LXJA 3IAYA 2WLBA 4MH8A 4DR7Q 4R4IA 2M8SA 4CJ2C 5LMNW 2MBQA 1F9SA 1FJGQ 4C56C 2O4XA 1X3QA 1CFMA 3Q14C 1TKWB 3QWZB 4KD4A 1Z9FA 4MN3A 4XZ4A 1UZXB 2HCCA 2WXLA 1CM9A 5IGFA 1CZWA 4O42A 3L08A 3LXFA 3C1EA 3C8YA 4KY5A 5CGKA 4DR1L 1YHAA 2MJ8A 5AEKB 2N49A 5I4DA 1PZKD 1S5FD 3PF4A 2V3SA 3DWAA 2YYZA 3MFYA 4MSMB 3I2ZA 2VXWA 5HHDG 2A69D 2VQFL 2K03A 2GVBA 3AU5A 4A3CG 4WJNA 2NBUA 4DBGA 1BCPC 4H7BA 3NWSA 3ALBA 4DK5A 1HNZQ 4EFOA 1FXIA 2J52A 4OGQC 4ZRPA 4GDLB 4MT5A 3VH4B 1J5EL 4L5SA 3RCZA 1LTID 3SE0A 4DV4L 3U9OA 2JVCA 1WCMH 4DN4M 3CMAA 2WXJA 4CDCC 1EWCA 1WI5A 1JORA 2JZZA 2X38A 4P6VF 1VQPA 5C4XB 1E90A 2NN6G 2INNE 1XT9B 3VR8B 1LABA 1H9SA 2JA9A 4NB3A 1ET9A 1I4XA 1QNUA 1S5DD 3NTIA 5NUCA 2KJXA 2R93G 2J0TD 4A55A 5FR6A 2N1WA 2LI5A 3RUIB 3CP0A 2RSOA 3QIAA 3WWVA 2MA9B 4W9JA 4C2MB 2EY5A 1AZQA 2OTJA 2GA4B 1WD0A 2A5UA 4AYBE 1GD7A 4PZ8A 5KNDA 2K8CA 2GOWA 1U5KA 1BO0A 2QF7A 2RDGA 4IOCA 2KOXA 4I7ZC 3NBHB 4OX9L 1HA5A 3GTMB 3PQIA 3A33B 4A3DB 3P1HA 3SK6A 2RBMA 2ZW1A 1J8CA 5M3FB 4BBSB 2F03A 1V5OA 4OEMB 3DWMA 3NVYA 4ZRKA 3ITPA 1LTSD 1XCTL 5JJKA 2B2TC 5FLMG 3KLSA 5HI1A 2L0CA 2PI2E 2K50A 3J7YW 3MZ5A 2INCC 1B9MA 2A6ED 3OWEB 3P20A 1FD7D 3ETRA 1F1HA 2L32A 5EPKA 4NXML 5E4WC 3K81C 4JVZA 3I73A 4DUZL 3U58A 1XYIA 5CTRC 1FEHA 3HVDA 3MXGA 2ZW0A 2F0NA 3NBIA 4YTMB 3DLLA 4N8X1 1ACCA 2MEKA 4W9DA 1KNAA 2QDBA 4TVAB 1HZCA 4QY7A 1FCCC 5GAGC 2CU1A 2IY1B 1WTXA 3VVWB 4C4VB 4K5VA 4FJYA 3GP7A 3P42A 3CF6E 1KLGD 1WR1A 3OLMD 4TKOB 2ZCCA 3FPPA 1BUVT 2O5JC 2I1KA 4BS9A 1QB5D 2OEDA 3ZTDA 3ZXRA 2VS1A 1NSNS 1FNWA 2IHEA 2WAQB 3OMCA 3KVFB 4FHKA 4HJKA 2F0DA 1S5CD 2IHFA 2UXDL 4JG2A 3URYA 2M9VA 3VYUA 3I4NB 4OONA 1TIID 2AQ3B 4P71A 2ON8A 4W9GA 1PXUA 2KVRA 4YCUA 4BBRG 1TBEA 4NJ7A 4L5TA 2W3SA 2FMCA 4AP4C 4PMWA 2FUHB 1SYBA 3W1BA 3ONSA 5DLQE 1UAPA 2REXA 3I8ZA 4IALA 4A3IG 1Y8PB 3JAML 1IW7D 5IP7H 3DEOA 1ROEA 2L11A 1CZGA 3DEPA 5A35A 1B70B 3MJ5A 2CU3A 2WX0A 2VUMB 3UDFA 2JX5A 2B2VA 4GOPC 3KH0A 2D0PA 1O7YA 3HKZG 3V96A 4HVBA 3ABVB 2QC8A 3KUDB 4FDBA 4IO9A 1IPGA 2JA7B 1EUVB 5IT9c 5CR3A 1QVFA 2FAZA 3CPWA 1KHIA 1RFAA 5GROA 3M63B 4MIUA 5FO9B 2NTTA 4DUYQ 2B3AA 1K3BC 1QJOA 4DA2A 2KN5A 3DVNU 3TP7A 1J6QA 4FA6A 4Y7NB 3CW2C 2KC2A 5CV7A 2KXJA 1I94L 3ZDMC 2KLGA 2P5ZX 2K6AA 1XNQL 1T0YA 1ZUD2 2GRIA 4OIJA 2EPBA 2WAQE 1BCPB 4HSVA 1J7CA 4F7ZA 1H8CA 3BDOA 2F0MA 1IW7C 4GKJL 2JUOA 4S3SA 4ALPA 1WX7A 5A2QE 2WXMA 3HOUB 3PLUA 2LJ5A 2MP2A 2VZKD 3KOJA 2O2VA 4CDEC 1A8VA 4QIWB 4YWKA 4K2LA 3AU7A 1SNCA 1XNRQ 4ID6A 3QJYA 2E2HH 1UF0A 2PO4A 4PMBA 5TSSA 1XJVA 1GUOA 4HPPA 2KZRA 2L05A 4XE0A 4HR7B 4AH6A 1SJHD 4FNFA 3PLVA 3VRAB 1FNUA 1BNZA 2IWHA 3Q6SA 1E24A 2NVTH 1WXMA 1AYFA 4AWJA 4PG3A 1GPXA 2VQEL 3V61A 1TWCH 2FCNA 2CQOA 1ZPSA 1QLBB 2E2DC 3L16A 1RTNA 1VQOA 1E8WA 4LF9L 1KF6B 3FKIB 2WINB 1FYCA 2L1AA 2AHOB 2I5HA 3MTNB 4YWMA 1C77A 2G5DA 2UUAL 1GB1A 4AUQC 4NQLB 1IYJB 4X3TA 1UH6A 5EPJA 2FIFA 3H3VC 1JJCB 2BWFA 2XWBB 4RHRA 1I7HA 3RD2A 1VQJA 1Z7TA 1N33Q 2Z8LA 3KYHC 4HIKA 3S14H 1IGDA 1L0VB 2IYDB 3LX0A 3LB8C 4A3BB 2DZKA 4BFRA 4LNNA 1OTRB 2SOBA 4RM9A 1P16A 3AB5A 3KJPA 2L5TA 4NPSA 2HDMA 5AUIA 1EQVA 1II3A 2KVMA 5FK9C 4W9CA 1NUCA 2H5XA 4IUPA 4FXKC 4XT1B 1YHBA 1R4MI 1R4NB 5LXHA 2ASBA 3N3KB 3Q3JA 4QMGA 3ZO5B 4ICUA 2CHXA 2OOBB 4E74A 1GHJA 5JEAH 4QIWE 2QW7A 3SK4A 1LTBD 2HQLA 3RZDH 4TQ1A 4JI6L 3HOZB 3AE9B 2XBBC 2YVCA 5M5YB 1WTPA 2QILA 3G6JB 1IYUA 1PTOD 1W6JA 3TBLD 2JPHA 4JOIA 2KECA 3NOBA 3T53B 2NZOA 4HN7A 2NZ1D 2HE7A 3BG3A 3OPOA 4KJNA 4O2DA 1SROA 3RLOA 1EY9A 2N9PC 4ZYNA 3F8TA 1ILPA 1CUKA 3MFGA 2A4ZA 5GAHC 3JSVB 3JW0X 4NJ6A 1XPUA 4IDIA 2DAFA 1BBWA 5BN4A 2N88A 1WM2A 2LUMA 2BQQA 5KNBA 1P7EA 5D2MB 4JPSA 2L9HA 3SK5A 5C0XH 3PPAA 2QIEB 2D2QA 3L4PA 2EE1A 3GQBA 3IG3A 3R2TA 3FAHA 4LF6Q 1ENAA 1K8AC 2MJ3A 2F52A 2CWAA 1X3PA 4KI0A 1HJPA 5LMUQ 3M3YB 2DZIA 2M19A 3D32A 3PSEB 2IX3A 2BWES 3P1MA 5CORA 2MO1A 2GN5A 3W9CB 1FCLA 4ZAIA 1JJ2A 3KDFA 2RPQA 1PTOC 2W55A 4OIKA 4I6PA 5HGQA 4NAWB 2G9HD 2MGSA 1FIQA 4GOPB 3AEAB 2JA6G 3RD4A 1PFBA 4K7SA 4N9PA 1Z2MA 4RH6A 1WRDB 1BXTA 3I4OA 4G0NB 2D10A 1NBWA 3T1HL 3RLNA 1AWDA 1D1IA 3CRLC 3QIJA 3K7UC 3U9SA 1Y1WB 1V1PA 3W5OA 1WM3A 1FM0D 1YMHE 4M00A 1QZEA 3PGZA 2WXFA 5AZHA 3L7ZC 2K3UA 2D2CC 4DR4Q 5C4XH 3D4DA 4C1NK 4KJOA 4AIMA 3HVZA 1UWVA 2C9OA 3HM6X 3DXJC 5KRUA 4NXNQ 2AL3A 2KDFB 1MFWA 2B2YA 2KX0A 1HRJA 3DDCB 4NQKE 2BA1A 2OT2A 3MAQA 1YNJD 3K7AB 2JE6I 3ZIMA 1BMLC 4MJSB 1ZP0B 1LACA 5E6JA 1WGRA 1N32L 2RPVA 4C2MH 1ASZA 2NUCA 1E9MA 1OQRA 1IHZA 4KY7A 2BB6A 2RCNA 3GE3C 4Y52H 2LJIA 1XMQL 2YTYA 4E6IA 1VLBA 4WQOB 2VL6A 1BBXC 2EMSA 2Q2HA 4P7IA 3GTMH 1IL8A 2F0IA 2Q8RE 3H09A 1PH1A 1ILQA 4X65L 1G2TA 1J5EQ 3SVMA 1V97A 5M3FH 2CVRA 2B39A 3TEZA 4BKSA 4OL7A 4DV4Q 4LNKA 3OJ4B 3R3OA 3AFPA 5DNFA 4IWOA 1YQBA 1EY7A 4DAYB 1VF5C 4J8QA 4UP9A 4MHEA 1L6VA 4HMIA 1UBQA 2EMTA 3TL5A 2BYTA 3HOVG 1F2MA 2KN4A 4FF1A 1VQ8A 3QX1A 1YNJC 3VYSA 4OWXB 3AU4A 2IPKD 3L13A 4WAFA 2K5NA 2GBRA 2VZKB 1B44D 2AEHA 1JWBD 1MG8A 1YNTE 3A5UA 2CKZB 4GOCA 3AEVA 3PSIA 5E6PA 3U8ZA 3QC8B 1Y8RC 3H9DA 4CDDC 1RTOA 2A19A 4EZKA 1MSHA 3D8GA 1KJTA 1UE7A 4FJVB 2PQAA 3GTKB 2KDBA 5K5PA 3NQIA 2JEAI 2N7EA 2R7DA 5GADC 3FRPB 1HNZL 4R4OA 5T8IA 3O13A 2ZJRA 3RZWC 1HUMA 1HXYD 2QSDA 1SFOH 3U52E 2ENBA 2RCFA 2LFIA 1GC7A 1BDOA 4GMVA 3I4NH 4DAMA 4XTCS 4A6QA 1G291 4FO2A 2LSSA 1D7QA 5DCNA 4XYQA 3WANA 1TY0A 4ZCKA 2KFJA 2DBYA 2NYZD 1N5XA 4X3KA 2KANA 3AE3B 2OQKA 3P4SB 2R61A 2KWDA 2G3QB 4WAAA 4YCWA 4NXMQ 2WB1G 4DUZQ 1IBXA 3W1SA 4YWLA 1EEFD 3CCLA 1V43A 3HOWG 1PYSB 3LNNA 4R4CA 5F2DA 2Q2IA 2Q5WD 1V1OA 1HR0W 4LF8Q 1WXVA 1XQQA 1JWUD 5DEHA 4RGTA 3ND9A 3SD5A 3MXNB 1I4QA 2JWZA 1NCVA 2L15A 4WWNA 5EKKA 2IT1A 3DWQA 4UP7A 2ACZB 1STYA 3MHZA 1L4DB 1ZW7A 3ZJUA 2QMTA 4AOFA 2JA7H 4X62Q 1SJED 1SMYC 2NCNA 4RWSC 1R4PB 2A74C 4KHZA 4L5QA 1JOKA 1X3GA 2AWOA 2IDYA 3MP9A 3EVQA 4F87A 4GN4B 1CSQA 4LLGM 1GVPA 1TTNA 3FHWA 3PUXA 1PTOB 1ICWA 4Y7NH 2O6VA 2PQEA 1P0RA 3RN5A 3U4EG 3NQTA 1H4RA 1J9OA 4C3JG 2ZCBA 3ML8A 1X9NA 1N8RC 2HHHL 2KX3A 3G7LA 3LWUA 2LMCA 4J15A 4JC0A 3HP3A 2KCTA 5IYDH 1KC8C 2EYMA 2HDLA 4A75A 2OTLA 1CQFA 3HOUH 5CV4A 3AEDB 4MTKA 2YEPB 1A70A 2HTME 2WX1A 2KACA 2WXKA 3OJ3A 2NZHA 1LLRD 4A3PA 1HHVA 3BVGA 3IT4B 1RJTA 1SNPA 4KN4C 3NPPA 3G4SA 4JI3Q 1XEEA 1CSPA 1YQ4B 2FUG1 1A3TA 4OZAA 1CHPD 5FR3A 3CCMA 2B2WA 3APCA 5DM73 4EZJA 4A3JB 3SEBA 1J7BA 2ZTEA 5I6YA 5ELNA 3QHTA 4MSQB 4URKA 5J3BA 4Q5VA 5D6JB 3ZXVA 1QWYA 3PHXB 1FO4A 5FLXL 3FEWX 2MNAA 2CJNA 1WFYA 2X8XX 4JQWC 1I94Q 4S0RA 3ZW3A 3AH7A 2AWNA 3FKIH 1CK1A 3DMUA 2WKCA 2Z0SA 2EDGA 2H1EA 4JE3B 5HFYA 2R2QA 1XPOA 5C44B 2UUBQ 1TT2A 5FLXE 4JBMA 4GKJQ 2N0SB 2KWCA 4IM2A 2JA8B 3E9HA 2JZ3B 2K1FA 3TBIB 3M4YA 3GTLB 2LHDA 1UGJA 2KA7A 4H44C 1NAPA 4P2CB 4DV7L 1X56A 1L7YA 2KT7A 2N9XA 3S2DH 2X6LA 1HNXQ 4KGTA 3ERQA 4AYBG 5FJ8G 4JK1C 4BAXA 1RAXA 1WMHA 2OCEA 3HOYB 1L5PA 4AJWA 2W82A 2K05A 2QKIC 3TEWA 3N1ZC 4BBNF 4RF0A 4B9WA 2D9UA 2C5LC 5EKIA 4UPAA 2XK5A 4C3HB 3MJWA 1TZ1A 4HCPB 2AWTA 1D1KA 4A3LH 2N55A 3HOZH 4B0MA 2Z4HA 1YNND 5ISRA 4YCVA 5M5YH 4CKCA 3DHIC 2C60A 1E7PB 3DHQA 1F2RC 2CHWA 3WA0A 3V6EB 1Q82C 2PEAA 5CHFA 1KTKA 2JZPA 3PRMB 2M2LA 1GXDC 1SXTA 1UEBA 2NWGA 4B3SQ 3NEMA 4PYZA 1B9RA 3W2DA 2KQ4X 1FRRA 2L52A 4DR6Q 2Z6KC 4JI0L 1VQBA 5C4XG 1C4PA 3T56B 4X57B 2L1BA 3PV0A 3SXHA 4K2KA 1XNRL 3T8MA 3J80c 1GAQB 4QUCA 3IFWB 3KLRA 3ULLA 2EYOA 2F1MA 1EIFA 4GDKA 2RF4A 3M3YH 3RR5A 1STHA 2Y5BB 1LT3D 2WU5B 5BN3A 2UWQA 2V4LA 3QA8A 4YHHQ 1YNNC 4PYUA 2EY6A 1Y8NB 1B4OA 4A3EB 2V1CC 4IPDA 1H9MA 1PGAA 3BZCA 1I5FA 4A3DG 4I65A 3DPDA 2OF1A 4D2KA 3L0WB 2BKRB 4LW1A 5C3JB 2NB0A 3ZNID 2R92B 4BBSG 2FCMA 1B3QA 1QZGA 4FBJB 1TIFA 5IYCG 1Q12A 4DDGD 5IYBG 1QUQB 1Y1VB 4H0LC 1Y1WH 1R4NI 1MIUA 1TWAB 1AE3A 4A3MB 4JGHB 1RFKA 2C7NB 1X3EA 2EZVA 2K7VA 1VQMA 2OWOA 3S1NB 2DENB 2GBJA 3L9AX 4TV3A 3P63A 5D65A 4GS3A 1RF2D 4G7OC 4IW0A 2FMMA 4XDXA 2E6XA 1EY8A 2OJWA 1JQ4A 4ULLA 3I70A 3PUVA 5M3MG 4OWWB 3K7AH 3OG5A 3Q8DA 4JI2Q 2QA4A 5BYQA 2Q8TA 3DQVA 1VQ5A 4ZUJA 1VQDA 1XLNA 1TWCB 1SIFA 4UAIA 1GUGA 3VR5A 1JB3A 2CKHB 2BYEA 1XCQL 1SDFA 3ZNHB 3HFZB 1BQQT 2F0JA 2E3TA 4BA2I 1OQYA 1UUPA 2MHJA 4OXPA 2Q8IB 2BVCA 2GBMA 1T5XD 1X3FA 2PI2A 1SYFA 1IUEA 4FP5D 2M1MA 4GDLA 2PNHA 3WAMA 5M9OA 1NVID 5K36G 1IBMQ 1KXLA 3AE1B 4USAA 3NZUA 1FGUA 3JAMc 2LXKA 1KQSA 3BY4B 1EEID 2RDHA 5EJWA 4PV1C 2MHVA 4ME3A 5M5WB 1SYDA 4MZ9A 4GIVA 5LLIA 1BT0A 3EFCA 1QE6A 1PFSA 4PMCA 1D4BA 4LF6L 5EBCA 4HJ7A 2A8VA 5DAUA 5AJ3Q 5LMUL 1HZ9A 4PT5A 2IO1B 4EEWA 1JRPA 3NK9A 3H3VH 3AQQA 4RA8A 3AYHB 1IKLA 4JI8Q 1PA6A 4JWSC 5LMNQ 3C2PA 2VUMG 1VF7A 2HIVA 4W9LA 4DNTB 3AMUA 5FOBB 1N32Q 3H8HA 3QCAA 4FN2A 4POFA 4PZ6A 1FPYA 2BW2A 4JIOU 1XLPA 3N20C 3PUWA 3GTKH 1E7UA 1T3QA 4KX6B 4YT0B 1YHQA 2K1BA 3UDIA 1C4AA 3A4SC 1S3SG 3NBHA 1Q86C 1QT9A 5IE8A 1N5WA 3VH3B 2OQ0A 4X65Q 1JMCA 1ESFA 4A3FH 1KRHA 1K8RB 3Q8CA 3AV8A 4XDDA 5HG2A 1WTQA 4PNYA 4M0WB 1HFNA 5IWAL 1NDDA 4XWTA 4LUVA 2N9LA 4DR4L 4A20A 3H94A 3T13A 1PH7A 1SYCA 1MJEA 1X1MA 2DYMA 3EIVA 4KV6A 2O2LD 2MCNB 3BDLA 4XQQA 2G4DB 2ZJDA 1JCKB 5T1GA 4NXNL 3AXCA 4XIGS 1OTCA 4DAPA 2RHSB 5CBEE 2N78A 2KFKB 2Z0EB 3K9OB 1OO9B 2W54A 2MJDA 4GLVB 1K52A 3AECB 4YTNB 3ZYYX 4L23A 4I6NB 5JVH3 3QO2A 2DYOA 3B9JA 2KKCA 3PO2H 2H4OA 3KBXA 4C4VA 2INDC 3W1YA 3C46A 1O7IA 2QCPX 3P75A 4GKKQ 1FFUA 1WTHA 3VTWA 1ZE3D 4EE2A 1TWHH 1BVSA 4LFAQ 1FL0A 3M85A 3KF8B 4MGKE 2VNUD 1EYCA 5C3WA 2KMCA 5HKHA 2HJ8A 3AEBB 3FKIG 3CXCA 1PTOH 3QOJA 1JOQA 2PCFB 4RGOS 2HJ1A 1TYGB 2L76A 4M1UB 4KGRA 1C7YA 1DOLA 5IGBA 2MQHA 4V190 3TUOA 3DBRI 1VDZA 2PJHA 3A8KE 3CQZH 5I9PA 4JBKA 1CKNB 2EKEC 5CHVC 2MX2A 3NWTA 2PLPA 4DKAC 1VS0A 3P7JA 4LUOA 4A3BG 2IO0B 3P4PB 1D2BA 2PPHA 2E2IB 4WWPA 1PFDA 1SBBB 1QG7A 1E7VA 4YSYB 2A69C 4GLXA 1MPEA 4A4IA 1UNSA 1FXTB 4RMAA 2PZWA 4C7ZA 4M8NA 3NTHA 1EYGA 3CSTA 5C3EH 2PIAA 1VZ7A 1YN5A 3AULA 2DHZA 4ZK9B 3QQ8B 4EZLA 4A3JH 1LT6D 3IFDA 2B63H 1PFNA 3K59A 4KHPQ 1MHXA 1TXYA 4A76A 2EYHA 2WU2B 3BVZA 2WDRB 3J81c 3ZNGC 4LFCQ 4IG7B 5GXGB 4DFAA 4A3KB 1N63A 1WF9A 2WACA 4QGUA 3RYTA 1SMXA 2JXTA 2PZTA 1EY0A 2HHHQ 3ZGZA 4HSPA 1K28A 2J4XA 3R93A 2G45B 1DONA 3PO3H 5C44H 3L3OC 4DNRB 5MPOA 4BWGB 1TY2A 1E8YA 3H0GB 2JA8H 4LF8L 4HJGE 4BOZB 3GTLH 2E76C 4JWUC 1SE9A 3NENA 1A15A 1LO5D 3W5UB 2WP8J 3ZRCA 3NTKA 3M4PA 3Q3MC 3HOYH 4NZLB 1KOTA 1ESRA 5JAVA 4X62L 1LTLA 1PH5A 2EVBA 5G3LF 1SFOB 4C3HH 2Y5PA 2ZT9C 5EKLA 4XX5A 3BK2A 4KMUC 1E7ZA 4NDXA 4J3OD 3Q24A 1E3PA 1F9JA 4JLCA 2K0PA 5JPMC 1UE5A 1GUSA 1MSGA 2A6EC 3CCUA 3M62B 4LJOB 2JA5G 4RFBA 4BY7B 1F2ZA 4RNAA 4JYAQ 2F0VA 4UDUC 4N58A 3FILB 2IX0A 4M8AA 4JI4Q 2LVPA 3OTOL 3Q23A 2YV5A 1BR9A 1JR0D 1VQ6A 1GUWA 4MH0E 1DZ1A 5AUKA 4K5WA 2K01A 1A62A 4KIKB 1U4AA 4A3GH 4DV7Q 2A73B 1CI3M 3C0RB 2B2TA 4A93B 2NBVB 2J7ZA 4HJAA 4JI3L 1LXDA 5G55A 2Y0SB 4R1JA 1JC7A 4C3IG 1VCBA 2C7MB 3CF5A 4DV0L 1ZXTA 2LUEA 3MA2B 2NBWB 1TR5A 3HOXB 2FINB 1ICFB 1EL0A 4DHJD 4HLEA 4BA1I 1ZGUB 2LGYA 3DHHC 4YY3Q 3A54A 4QCLA 3OIPA 2PMVA 4A3EH 4BXXH 1D8LA 5A2QL 2KQ7A 2MO0A 5CV6A 3KWLA 3I4MB 3FMCA 3MEFA 5FO8B 3UE1A 2R92H 4E71A 3TP6A 1ZEQX 3QJZA 1E6EB 1PUTA 2UUBL 1Q7YC 5TR5A 4KHVA 1J8IA 2GI9A 1Y1VH 3V60A 4HMJA 2PW5A 1TWAH 4RGNA 4NMZA 4A3MH 1EOVA 1S5BD 1WZ3A 4JI0Q 3JSVA 3S1NH 1MHHE 1PRTF 1HNXL 2GB1A 5KEEA 3G48A 1S40A 2WQYB 1HPCA 2QHOA 5EAYA 2ZM6Q 2BF8B 1G2SA 1UGMA 1PDQA 4BBNC 3L54A 2WXOA 2AUKA 2XWJB 1NJIC 3ZDTA 1L2NA 4GZYC 2B29A 1JRUA 1KL9A 4HRSA 3SGIA 1MJCA 5JZEB 1R9TH 1K0RA 2CS4A 1WJUA 2Q2UA 4NY0A 2PYKA 1YJIA 2WV6D 3D31A 4DF7A 2PVOD 2EXDA 3N30A 2Y0SE 4NAWA 3GS2A 1HQRD 1GG3A 1Q5WB 4GOPA 5FKAC 1A63A 2N9KA 3J7AV 1HZ5A 2KO3A 2UU9L 1HTPA 4B3SL 2H88B 2EJMA 2LY7A 4DR6L 1H95A 1MKHA 1L0WA 3T3NA 2F0HA 4RMFA 2YU9B 1ET6A 4FF4A 2KLCA 4RKBA 3MVVA 3S2DB 4PS7A 2SDFA 5J17A 5M5WH 5GQOA 4W9IA 1SNQA 1M4VA 2Y5CA 1EYAA 1AP0A 2L55A 5M5XB 1J7AA 3CMEA 1E1TA 1EU4A 4KKJA 4K7WA 1W3SA 1SNOA 2F4IA 1K8GA 5ELEA 3F2BA 3BYTB 4LDTD 2NVUI 4LNFA 1GB4A 1AH9A 4HCEA 4YHHL 2BGFA 2WDQB 3C3LA 3LWEA 1YJ9A 2JSVX 3AE6B 4MJSA 4DU9A 4P1BC 4IFDH 1AN8A 4R9WA 5AFWA 2ZZPB 4ZKCB 4C00A 2LGDA 5IY0A 2M0AA 1G8ZD 4MEMA 2NPTB 4ME5A 2BB5A 4LK0M 1WJNA 4JX1C 5IGCA 4XQNA 3H6MA 2ICIA 1PGBA 3A1QB 3K5OA 2AKWB 3K58A 1M8AA 1XTDA 3ICEA 3UIPB 2K52A 2MBBB 1J0GA 2RA4A 3PV1A 3OW2A 1WCMG 1AFPA 1Q3LA 3DVGY 2BS2B 4RF1A 2PE6B 4A3OA 2V0GA 2GVAA 4CJ1B 2E5LQ 3RZOH 4G57A 2LXCA 4FXDA 1QKZA 3NJTA 3A7LA 4FLHA 4AS1A 3W3AA 4DAYA 4US9A 4MGZE 4GNXC 1TGZB 3I90A 1VDVA 3RNFC 4JI5L 3CC7A 4JI2L 1PH9A 1GJXA 3PUZA 1SYGA 2E75C 3K0YA 4J1MA 4HKZE 4WWOA 1HUNA 2NVXB 4B95A 3OMGA 2Z9HA 2A68D 2N9EB 2XRQD 2R7ZB 1I6HB 1Y56A 4ACFA 1N36Q 5J22A 3AI5A 4KD3A 1YEZA 3PF5A 1WYWB 5J1ZA 4DV3Q 3I4LA 4OVZA 1KDCA 2E8GA 4X66Q 4GN3B 2LXAA 4C80A 4UHVA 1LYLA 2R6GA 3FP9A 2VW9A 1HA6A 1EF1A 3EC8A 1IBML 1G51A 2B2UC 3X3NA 1ZKHA 4H13C 2KCNA 1PHJA 1O7LA 5IWAQ 4OW0A 4F7XA 4HCNB 1PZJD 1F77A 1STGA 1PH6A 1C9FA 3UI2A 1CTMA 3A5ZB 4LWCA 4ZQ3A 4LNIA 1IYVA 1Q0WB 1E1OA 5AJ3L 3X0WA 1QF6A 3EROA 4LNQA 1O7ZA 2WXNA 4G3XB 3UF8A 1BF4A 1TWGH 3E3XA 4WORA 3WDNA 2RHQB 4JI8L 1QOHA 2IL8A 4BBRB 3K5NA 5LMNL 1G6ZA 2A68C 1C79A 2BKFA 3D4WA 5IP9H 2E2IH 2F0OA 3S15B 1HZBA 2OJRA 4IOAA 3I9V1 2BBCA 3CCRA 1B9NA 3VYRA 4IUTA 1DD2A 4YXDB 3MXNA 1P7FA 4B08A 1EF5A 1NEKB 4R3DA 3ZJVA 1HTQA 1SN8A 3BZKA 4IZ8A 5L95C 5C0XI 3OYYA 1F2RI 3M3JA 2OXPA 4ZUIA 1T0QC 1A2UA 4G50A 3Q6BA 1YBYA 5C2TB 4V0BA 3CC4A 2BS3B 3UIOB 1T6BX 4XYCA 2PPBC 1D6EC 5BMIA 1XD3B 1PH2A 4B6WA 2L0TA 2D3AA 2IJ0A 1ENCA 1LUZA 2WYQA 3D4RA 2CFMA 3NUCA 4A3KH 1ZXHA 3PGEA 1M1KC 1I4RA 1SNMA 2NBFA 2IX1A 3AE4B 4BKGA 2EYLA 3TSSA 1E2WA 1NENB 1WI0A 3I57A 4L2YA 1TWFB 5IP7G 2CR5A 1DGJA 2KTRB 4ZRQA 2K39A 3I91A 3S1RH 2J0JA 3H0GH 4G7HC 2W3RA 1JICA
chains in the Genus database with same CATH topology
2DNCA 1F2LA 1E2ZA 2WS3B 2KEDA 4CQNA 5I2YA 3P4RB 5E3FA 4LTUA 2M56B 1ZDXA 2WXHA 2K33A 4NAMA 4RAUC 4A3FB 1LT4D 4J6HA 3N9YC 5EE9A 2SNSA 3U7ZA 4MM3B 2WXIA 5LNK1 1HCZA 2IGHA 3IAM1 4EGVA 1EY6A 2KUMA 2FHTA 3Q69A 2I38A 1C48A 2ONQA 3PO2B 1TKGA 4A8XC 3T3OA 3AE7B 1CA5A 3H91A 3BWUD 1TWHB 1SE2A 4NKLA 5ELBA 5G3LD 3CWIA 2QJLA 4F88A 2LFNA 2PTLA 1SB3C 2EELA 1LT5D 4XYOA 2EJFC 1WRIA 3CQZB 2I2YA 3BS1A 3NVVA 3AEGB 2HCIA 4ZKBB 2RDFA 3IFTA 3SHLA 4KKIA 1F9QA 1V8CA 3A55A 3VR4A 4ABNA 2ICEC 4FXCA 1EU3A 5JEAG 3M4OB 5C3EB 1XO3A 2JWUA 3GTPB 2B63B 3RUZA 2F0EA 4KKSA 3E0JA 3GTJB 4EVOA 2JYTA 2B76B 5C5MA 2A6HD 4H2AA 3PO3B 5D3DA 1EM7A 2L83A 3K5LA 2JA6B 5C0XG 1PRTD 2K04A 1RD9D 3K5MA 3OWFA 1KDAA 1U4MA 4IKGA 2EYPA 1PYWD 1CHQD 2KOLA 2ZXOA 4HKQA 2HUGA 2WNMA 4EQNA 2NN6H 3GTOB 1SIJA 1VCIA 3NVWA 4KY6A 4DXGA 2RMMA 1SF0A 2V4IB 2DN8A 4IUUA 5D7GA 4US8A 3Q8AA 1UWXA 2WXGA 2NVQB 1PRTC 3R2IA 4A3GB 1CQVA 3W5VB 2LKVA 1RCVD 2QEJC 3ONAB 1E10A 2K5DA 1DJRD 2VB2X 1KDBA 3HS0C 2LMCB 2WDVB 3HOVB 2AQ1B 3OHXC 1EY5A 2F0UA 4WJWA 2WIIB 3NXWA 2G1EA 3GO5A 2E2JB 1TKEA 1MI0A 2FE8A 5CMDA 1L4ZB 1MVKA 3U2SC 4ZLTF 4KKTA 1STAA 3P4QB 5HURA 3TDQA 1Z6HA 3AE2B 1K8MA 3E56A 3AM9A 1S4ZA 2MJEA 4M0WA 2F0PA 4WURA 2NN6I 1I4GA 4NW2A 2PW9A 3ZQ4A 1C4QA 1KLUD 2RQXA 2JSOA 1R9TB 5C5LA 1HQMC 2K28A 4IN3A 3VA5A 3EGRA 4KK7A 1AW7A 2F0LA 2WB1B 2CW0D 4P16A 3HOWB 1LV9A 5COYA 1WTVA 5C4JB 1CJEA 4RGMA 3D3RA 5C4ZA 5G5GA 1I4PA 1WTOA 4HTHA 1RKNA 3KF8A 2BTEA 2DY7A 3AE8B 4QF4A 4DK1A 4Q2JA 2RSNA 5I9OA 1Q8IA 4LJZC 5IIFA 1D5MC 5CC4A 1SYEA 1TQOA 4TQ0A 3HRZC 3ND8A 1Y69U 1SNDA 1LTAD 2SEBD 3QWNA 3F2UA 1U4LA 1BUIC 1EIHA 5IGDA 2J42A 1ZKOA 3C1FA 1XLQA 2EY1A 2OEOA 4EQPA 2L4NA 3VYTA 1QOAA 4XQJA 2EYFA 2JQRB 4A90A 5CYUA 4MACA 3RZOB 2EY2A 4KTAA 4HROA 2BE5D 4K6LA 2KDMA 1NR4A 3QG1A 4K8IA 4DAVA 1K83B 3E6ZX 4BY1B 1OXUA 1OXXK 2WKDA 5KIXA 1C8CA 3PUYA 3E5SA 2O5IC 1YN4A 2XSCA 3GV6A 5EGTA 1PRTB 1KNEA 3S16B 3KUPA 3NUHB 1B2TA 5ELFA 1AZPA 3S9WA 4HAEA 4CKBA 1K8OA 1KH0A 1STBA 5LHY1 4AYBB 2M00A 4N6EB 1Z47A 2N7JA 2BE5C 4F8MA 1PLFA 3KQ4A 3NZ3A 1QILA 3K6OA 2F3WA 1C4CA 5H92C 3FVQA 1O78A 3TN2A 3B2GA 3FILA 1TWGB 4YIJA 4ZRZA 4HEDA 1OXTA 3Q8EA 1XTCD 2AUJD 2FFKB 1Q10A 3LYYA 1F2YA 1JWSD 2PKOA 1XX8A 2NTSA 1JQYD 1I6VC 2D62A 5LL6S 2BS4B 2K32A 3X3MA 3A7AB 4KKUA 3CRKC 3TP5A 1DCZA 5BYSA 1EOTA 1MD2D 1SEBD 1ZYRD 3NRZA 3NS1A 5T1IA 3T4AC 2OHFA 2ZXPA 1SAPA 3J80L 3MWYW 1BOSA 3V2TA 4U673 1B3AA 3S1RB 2EOTA 3J80E 4OZBA 1H9RA 5KYLA 2Z4IA 2K5QA 3AE5B 2B2VC 1FNVA 2KQ3A 3RFZB 2BDOA 1VMCA 5EE1A 1ZYRC 5IODA 5M3MB 2K9XA 4IUNA 1AEXA 1SSNA 1C78A 1YQ3B 2XIWA 3TZDA 4TRDA 3GB1A 5KYIA 3HG9A 2F0KA 3HUIA 2XVSA 1XXGA 3MXUA 4YSXB 1EZ8A 1STEA 1Q90A 3GTQB 3SK8A 1QCBD 1VRAB 1H9SB 3D6CA 1WD1A 4N59A 3NHHA 4JBWA 4HEA1 4KGSA 1WTWA 1LTRD 1I50B 1T5EA 4RHSA 4FVMA 5CV8A 5BMHA 3N52A 1R7SA 4LMQD 1UWMA 4RF0A 2VB3X 3JAME 4U68A 1I3QB 1D5XC 5C4HA 3NE5B 1GHKA 3Q8BA 3VR6A 5DM63 4FYDA 2Z1CA 2ID0A 5HGTA 1RODA 5D3IB 1NYQA 3TP8A 5JPNC 1FD6A 2DY8A 1MI2A 2F0SA 3BK1A 4K14A 4LK1C 1S5ED 2NMQA 4L63B 3GD7A 4WRDA 4OO1H 1RDPD 2IGGA 4WQMA 4K8JA 2V3PA 2XN9C 1VJKA 3OOCA 4O1NA 1DOXA 4YTPB 3EUB2 1DOIA 2MH7A 3WOEA 3S2HB 1X32A 3TEXA 4ILWA 3GTGB 2BT6A 2MPMA 3SR1A 4RCOA 2R93B 4RKLA 3DWPA 1CZPA 3DUZA 2KCCA 5J39A 3IAS1 4XT3B 1MBYA 2D5DA 3MTSA 4L6TB 4K5XA 4REZA 4CGYB 1D5ZC 3OW7A 3VR2A 4X3SA 3OSOA 4ZHOA 4LAAA 5G5HA 4WFN3 5BN5A 1B1ZA 2H89B 1YJJA 4QUFA 3S1MB 2WXPA 2DLBA 3ZJTA 1WSPA 2B2YC 4OO1I 1WXQA 4ARIA 2L12A 4XXEA 1ONLA 1TS2A 1OFFA 1TJEA 5D14A 3EQLC 3J81L 4ODGA 2F0FA 2BCOA 2C5CA 1FXAA 2PVGC 4WIPA 1TS5A 2WXQA 2XRSD 2CHBD 1G91A 3MXPA 3J81E 2LEKA 1RYJA 4IQZA 1E0ZA 3PZ8A 2PNRC 5IGEA 1OXVA 3AB9A 1QOBA 4IFDI 3TMEA 4L1BA 2A5HA 1EQTA 1U4PA 3VR3A 4IURA 2JA5B 2AQ2B 2EXZA 3PMFA 1WWTA 5CBAE 3AEEB 1N60A 5ELDA 4A3IB 1LTGD 5E4XA 3KK7A 1PGXA 3V05A 3Q8FA 1JROA 4C3HG 1KFYB 1TKYA 1MGSA 3NVZA 3HKZB 3RLFA 1DOMA 5EE3A 5E1FA 2NVYB 1ZXIA 1XWEA 2V4DA 4C3IB 1H9JA 2JEBI 1RM6C 2I46A 1GUTA 3CHBD 2XNAC 3M7NA 3CIRB 5EPLA 4ZHPA 5I2XA 4R8NA 4TMAB 5IOCA 1JOOA 1JW9D 4IUVA 2PMZB 1STNA 4XWWA 3FC4A 4OZCA 3I3CA 1TS3A 5IT9L 1Q1BA 2BA0A 5CV9A 1SE3A 1BCPF 2B2UA 2JYOA 3GV3A 1TS4A 1W6KA 2F0TA 1F9RA 1HTLD 5KGUA 2B8FA 2JXMB 1DXMA 1ZOYB 3CU7A 4R8IA 5IT9E 2MUYA 1K53A 1EWHA 1XLOA 1TU2B 2LS01 2HDEA 5JOBA 3FDTA 3RMHA 3J9CA 2HQEA 1EFID 1C76A 1E0BA 1L0YB 1Y8OB 4KN7C 1F9PA 3OIQA 5C6AA 3AN1A 3S17B 2F3VA 2KEEA 4CHTB 3E9SA 2F0WA 3KWVA 1CT1D 1N62A 1A2TA 1ZDVA 3PZ7A 1FGBD 1XF5L 4XDCA 3BIID 5LL6X 1V1PB 5IGGA 1SMYD 3EJIA 3WOFA 4ZYSA 4ARCA 4ITKA 2KAJA 5K36H 2BDNA 3A8IE 3I72A 2TSSA 1K50A 1WYGA 4B0EA 4TSSA 2B2WC 1E2VA 1H9KA 4DXFA 1KABA 5BYRA 4OO1G 1EY4A 4IUQA 2RKSA 4FF2A 1WGKA 4DK0A 3A56A 1F0ZA 1SSOA 1WTRA 4C7YA 1RWSA 2FJ2A 3AEFB 3PIP3 3IT6B 3KBGA 2F0GA 3N6RA 1WCMB 4QB4A 1IGCA 2JU6X 1OXSC 3QB3A 3K57A 2JYEA 1U4RA 2TMPA 4IFDG 1VR9A 1ENFA 3EFXD 2IGDA 1V8QA 2SNMA 4TQUS 2ZXRA 1FRDA 4Z9CB 3MEHA 3R8BA 5BMGA 1O80A 2KHSA 3UI3A 1LTTD 3T51B 1NYRA 3HGBA 1HEZE 1YN3A 4C1NI 3B2FA 3NP8A 3HEJA 3J7AF 1R4QB 3MHBA 3MC0B 2V3NA 5JXVA 4YSZB 4IOIE 1JWMD 4NJCA 1EYDA 2EKIA 4WH4A 5KNCA 5JEAJ 3HZXA 3KLSX 3EA6A 4IFDJ 1PDXA 3WCQA 1IBXB 2K5PA 1I4HA 1VZ6A 3PO0A 5JJZA 1PMRA 3VQIA 2FBWB 3QOLA 1GUNA 2LGIA 2A6HC 1IKMA 2IW3A 1U9RA 3T16A 2MP1A 4NP5A 5I6WA 3PIO3 1L6UA 2WP9B 3VA7A 3BZDB 5C0XJ 3Q22A 4WWMA 2AX5A 4CBVA 2LHEA 1DOYA 2INPE 4B9XA 3RPFC 1VZ8A 4GLSC 1Q1EA 5ELCA 2PW7A 1PZID 3BYYB 2RVLA 4L8JA 2EJGC 1L0XB 3NSWA 3BDCA 1WVLA 3HRDD 5C3XA 2SAKA 1B53A 2JP1A 4CKEA 1SE4A 5CV5A 1UEAB 1EWYC 2DWQA 3IXSA 2F0QA 3FPUB 5EBDA 2J53A 3DM1A 1A3VA 1OQQA 2I07B 4A9AA 3SFEB 2K22A 2DNEA 2B8GA 1A6XA 3TZUA 4N9TA 1FR3A 5EE0A 1RHPA 4EQOA 2X6GA 3S1QB 2WXRA 3VR9B 1HFGA 4OHJA 2E2HB 1JALA 1QNKA 1KAAA 2K5WA 1DYQA 1QOFA 1K51A 3M7GA 4X3UA 2NVTB 1VMPA 4DQOC 1TZOA 4AQ7A 2R3ZA 4CJ0B 1FFVA 3SFDB 4HCSA 1QQRA 3AMZA 1PTOF 1DOKA 3DWGC 2KMMA 4G7ZC 1HZ6A 5FO7B 3VRBB 4ZOHC 2BOSA 1N61A 4YWGG 1FMAD 4C3JB 1TVXA 1NR2A 1ML0D 2D5GA 4DGZA 2CJOA 1PFMA 2CW0C 2EYJA 1CA6A 4FXGC 3SR6A 3S14B 3TEYA 4K6DA 3IL8A 5H8YE 2YEPF 4Q0FA 3D6WA 3IKJA 3A8JE 1QOGA 2G9DA 1A3UA 1GOZA 1JE4A 4GDKB 1NI3A 4PQXA 1JWAD 2X69A 2CQAA 4FF3A 3Q0AA 3RZDB 3BVMA 5EQ0A 1B50A 2PZUA 3SDZA 2E74C 4G4KA 1DM0B 3CKIB 4RCNA 2Y3AA 5JVG3 3V3XA 1EZ6A 1EIGA 1BCPD 1JMLA 4MH8A 3IAYA 2WLBA 4CJ2C 1F9SA 4C56C 2O4XA 1X3QA 1CFMA 1TKWB 4KD4A 4MN3A 2HCCA 2WXLA 1CM9A 5IGFA 1CZWA 4O42A 3LXFA 3C1EA 3C8YA 4KY5A 5CGKA 2MJ8A 5I4DA 1PZKD 1S5FD 3DWAA 2YYZA 3MFYA 2VXWA 5HHDG 2A69D 2K03A 1BCPC 4H7BA 3NWSA 1FXIA 2J52A 4OGQC 4ZRPA 4GDLB 4MT5A 1LTID 3SE0A 3U9OA 4DN4M 2WXJA 2X38A 1EWCA 1JORA 4P6VF 5C4XB 2NN6G 2INNE 3VR8B 1LABA 1H9SA 1ET9A 1I4XA 1QNUA 1S5DD 3NTIA 5NUCA 2KJXA 2J0TD 4A55A 3QIAA 2RSOA 4C2MB 2EY5A 1AZQA 2GA4B 1WD0A 5KNDA 1BO0A 2QF7A 2RDGA 4I7ZC 1HA5A 3GTMB 4A3DB 3P1HA 3SK6A 2RBMA 2ZW1A 5M3FB 4BBSB 2F03A 3NVYA 3DWMA 3ITPA 1LTSD 1XCTL 2B2TC 3KLSA 5HI1A 2L0CA 3J7YW 3MZ5A 1B9MA 2A6ED 3OWEB 3P20A 1FD7D 3ETRA 2L32A 5EPKA 5E4WC 3I73A 1XYIA 1FEHA 3HVDA 3MXGA 2ZW0A 2F0NA 3NBIA 4YTMB 1ACCA 2MEKA 1KNAA 2QDBA 1FCCC 1WTXA 4K5VA 3GP7A 3P42A 1KLGD 4TKOB 3FPPA 1BUVT 2O5JC 2OEDA 4BS9A 1QB5D 1NSNS 1FNWA 2WAQB 3OMCA 2F0DA 1S5CD 3URYA 2M9VA 3VYUA 3I4NB 1TIID 2AQ3B 2ON8A 1PXUA 2W3SA 2FMCA 4PMWA 1SYBA 1UAPA 3I8ZA 4IALA 1Y8PB 3JAML 1IW7D 3DEOA 1ROEA 2L11A 1CZGA 3DEPA 5A35A 3MJ5A 2CU3A 2VUMB 2JX5A 2B2VA 1O7YA 3V96A 3ABVB 2JA7B 5CR3A 4MIUA 5FO9B 2NTTA 1QJOA 4DA2A 3TP7A 4Y7NB 5CV7A 2K6AA 1ZUD2 2GRIA 4OIJA 2EPBA 1BCPB 4HSVA 1J7CA 3BDOA 2F0MA 1IW7C 4S3SA 5A2QE 2WXMA 3HOUB 2VZKD 4QIWB 4K2LA 3AU7A 1SNCA 4ID6A 3QJYA 2PO4A 4PMBA 5TSSA 1GUOA 4XE0A 4HR7B 1SJHD 4FNFA 3VRAB 1FNUA 1BNZA 2IWHA 3Q6SA 1AYFA 1GPXA 1ZPSA 1QLBB 2E2DC 1RTNA 2L1AA 1KF6B 3FKIB 2WINB 1FYCA 1C77A 1GB1A 4X3TA 5EPJA 3H3VC 2XWBB 4RHRA 1I7HA 1Z7TA 2Z8LA 1IGDA 1L0VB 3LB8C 3LX0A 4A3BB 2SOBA 3AB5A 2L5TA 2HDMA 5AUIA 1EQVA 1II3A 2KVMA 5FK9C 1NUCA 4IUPA 4FXKC 4XT1B 4QMGA 1GHJA 5JEAH 3SK4A 1LTBD 4TQ1A 3HOZB 3AE9B 5M5YB 1WTPA 2QILA 3G6JB 1IYUA 1PTOD 1W6JA 2KECA 3T53B 4HN7A 2NZ1D 3BG3A 3OPOA 4KJNA 1EY9A 1ILPA 3MFGA 4IDIA 5BN4A 2N88A 5KNBA 1P7EA 4JPSA 2L9HA 3SK5A 5C0XH 2QIEB 3L4PA 2EE1A 3GQBA 3R2TA 3FAHA 1ENAA 2MJ3A 3M3YB 2M19A 1X3PA 4KI0A 2IX3A 3P1MA 5CORA 3W9CB 1FCLA 4ZAIA 1PTOC 2W55A 4OIKA 4NAWB 2G9HD 2MGSA 1FIQA 3AEAB 3RD4A 1PFBA 4N9PA 4RH6A 1BXTA 1AWDA 1D1IA 3CRLC 3U9SA 1Y1WB 1V1PA 1YMHE 1FM0D 2WXFA 3L7ZC 2K3UA 2D2CC 3D4DA 4C1NK 4KJOA 3HVZA 2C9OA 3DXJC 5KRUA 2B2YA 1HRJA 2BA1A 2OT2A 3MAQA 1YNJD 3K7AB 2JE6I 1BMLC 1ZP0B 1LACA 5E6JA 2RPVA 2NUCA 1E9MA 1OQRA 1IHZA 4KY7A 2BB6A 2LJIA 4E6IA 1VLBA 1BBXC 1IL8A 2F0IA 2Q8RE 3H09A 1ILQA 1G2TA 3SVMA 1V97A 2CVRA 2B39A 3TEZA 4OL7A 3R3OA 5DNFA 1EY7A 1VF5C 4J8QA 1L6VA 4MHEA 2BYTA 4HMIA 1F2MA 2KN4A 4FF1A 1YNJC 3VYSA 2IPKD 4WAFA 2VZKB 1B44D 1JWBD 1YNTE 1RTOA 1MSHA 3D8GA 3GTKB 5K5PA 3NQIA 2JEAI 3FRPB 5T8IA 3O13A 1HUMA 1HXYD 2QSDA 3U52E 2ENBA 2LFIA 1BDOA 4XTCS 4A6QA 1G291 4FO2A 4XYQA 1TY0A 3AE3B 2DBYA 2NYZD 1N5XA 4X3KA 3P4SB 2R61A 2KWDA 1IBXA 3W1SA 1EEFD 1V43A 3LNNA 2Q5WD 5F2DA 1V1OA 1JWUD 5DEHA 4RGTA 3ND9A 1I4QA 1NCVA 5EKKA 2IT1A 3DWQA 2ACZB 3ZJUA 1STYA 3MHZA 1L4DB 2QMTA 1SJED 1SMYC 4RWSC 1R4PB 2A74C 4KHZA 3MP9A 1JOKA 2AWOA 2IDYA 3EVQA 4F87A 4LLGM 3PUXA 1PTOB 1ICWA 2PQEA 3U4EG 3NQTA 1J9OA 4C3JG 3G7LA 3LWUA 2LMCA 3HP3A 2EYMA 2HDLA 1CQFA 5CV4A 3AEDB 2YEPB 1A70A 2HTME 2WXKA 2KACA 1LLRD 1HHVA 3BVGA 3IT4B 1RJTA 1SNPA 4KN4C 3NPPA 2FUG1 1XEEA 1YQ4B 1A3TA 4OZAA 1CHPD 5FR3A 2B2WA 5DM73 4A3JB 3SEBA 1J7BA 5I6YA 4Q5VA 1QWYA 1FO4A 5FLXL 3FEWX 2CJNA 3AH7A 2AWNA 1CK1A 3DMUA 2WKCA 2EDGA 2H1EA 4JE3B 5HFYA 5C44B 1TT2A 5FLXE 2N0SB 2JA8B 2LUMA 3TBIB 3M4YA 3GTLB 2LHDA 1UGJA 2KA7A 4H44C 1NAPA 4P2CB 4KGTA 2X6LA 3ERQA 4JK1C 3HOYB 1L5PA 2W82A 2K05A 2QKIC 3TEWA 4B9WA 2D9UA 5EKIA 4C3HB 1D1KA 2N55A 4B0MA 2Z4HA 1YNND 5ISRA 4CKCA 1E7PB 3DHQA 1F2RC 1KTKA 2JZPA 2M2LA 1GXDC 1SXTA 2NWGA 1B9RA 3W2DA 2KQ4X 1FRRA 2L52A 1C4PA 3T56B 2L1BA 3PV0A 3SXHA 4K2KA 1GAQB 4QUCA 3KLRA 2EYOA 2F1MA 1STHA 1LT3D 2WU5B 5BN3A 1YNNC 2EY6A 1Y8NB 1B4OA 4A3EB 1H9MA 1PGAA 4I65A 2OF1A 4D2KA 5C3JB 2NB0A 2R92B 1Q12A 1Y1VB 4H0LC 1TWAB 4A3MB 1RFKA 2EZVA 2K7VA 3S1NB 3L9AX 3P63A 5D65A 1RF2D 4G7OC 2FMMA 4XDXA 2E6XA 1EY8A 1JQ4A 4ULLA 3I70A 3PUVA 5BYQA 2Q8TA 4ZUJA 1XLNA 1TWCB 4UAIA 1GUGA 3VR5A 1JB3A 1XCQL 1SDFA 1BQQT 2F0JA 2E3TA 4BA2I 1UUPA 2Q8IB 1T5XD 1SYFA 1IUEA 4FP5D 5M9OA 1NVID 5K36G 3AE1B 4USAA 1EEID 2RDHA 5EJWA 4PV1C 2MHVA 5M5WB 1SYDA 1QE6A 4PMCA 1D4BA 5EBCA 5DAUA 4PT5A 1JRPA 3NK9A 4RA8A 1IKLA 4JWSC 3C2PA 1VF7A 4DNTB 3AMUA 5FOBB 3H8HA 2BW2A 1XLPA 3PUWA 1T3QA 4KX6B 4YT0B 2K1BA 1C4AA 3NBHA 1QT9A 1N5WA 1ESFA 3Q8CA 1KRHA 5HG2A 3AV8A 4XDDA 1WTQA 4PNYA 1HFNA 4XWTA 2N9LA 3H94A 3T13A 1SYCA 2DYMA 4KV6A 2O2LD 3BDLA 4XQQA 1JCKB 5T1GA 4XIGS 4DAPA 5CBEE 1OO9B 2W54A 2MJDA 1K52A 3AECB 4YTNB 3ZYYX 4L23A 5JVH3 3QO2A 2DYOA 3B9JA 2H4OA 3KBXA 3C46A 3P75A 2QCPX 1FFUA 1ZE3D 4EE2A 3M85A 2VNUD 1EYCA 5C3WA 3AEBB 1PTOH 3QOJA 1JOQA 2PCFB 4RGOS 1TYGB 4M1UB 4KGRA 1DOLA 5IGBA 4V190 3TUOA 1VDZA 3A8KE 5I9PA 3NWTA 2PLPA 3P7JA 3P4PB 1D2BA 2E2IB 1PFDA 1SBBB 1QG7A 4YSYB 2A69C 1MPEA 1UNSA 2PZWA 4C7ZA 3NTHA 2PIAA 1VZ7A 1YN5A 4ZK9B 1LT6D 3IFDA 1PFNA 3K59A 1MHXA 2WU2B 2EYHA 3BVZA 2WDRB 5GXGB 4DFAA 4A3KB 1N63A 2WACA 2JXTA 2PZTA 1EY0A 3ZGZA 4HSPA 3R93A 2J4XA 1DONA 3L3OC 4DNRB 5MPOA 4BWGB 1TY2A 3H0GB 4HJGE 2E76C 4JWUC 1A15A 1LO5D 3W5UB 2WP8J 3NTKA 4NZLB 1ESRA 5JAVA 2EVBA 5G3LF 1SFOB 2Y5PA 2ZT9C 5EKLA 3BK2A 4KMUC 4NDXA 4J3OD 3Q24A 2K0PA 5JPMC 1GUSA 1MSGA 2A6EC 4RFBA 4BY7B 1F2ZA 4RNAA 2F0VA 4UDUC 4N58A 3FILB 2IX0A 4M8AA 3Q23A 1BR9A 1JR0D 1GUWA 1DZ1A 5AUKA 4K5WA 2K01A 2A73B 1CI3M 2B2TA 4A93B 2J7ZA 2Y0SB 1JC7A 4C3IG 1ZXTA 3MA2B 1TR5A 3HOXB 2FINB 1EL0A 4BA1I 3A54A 4QCLA 3OIPA 2PMVA 3KWLA 5A2QL 5CV6A 3I4MB 3FMCA 5FO8B 3TP6A 1ZEQX 1E6EB 1PUTA 4KHVA 1J8IA 2GI9A 4HMJA 2PW5A 4RGNA 4NMZA 1S5BD 1MHHE 1PRTF 2GB1A 5KEEA 2WQYB 1HPCA 1G2SA 1PDQA 2WXOA 2AUKA 2XWJB 4GZYC 4HRSA 2PYKA 1YJIA 2WV6D 3D31A 4DF7A 2PVOD 3GS2A 1HQRD 2N9KA 5FKAC 3J7AV 1HZ5A 1HTPA 2H88B 2EJMA 2LY7A 3T3NA 2F0HA 2YU9B 1ET6A 4FF4A 4RKBA 3MVVA 3S2DB 2SDFA 1SNQA 1M4VA 2Y5CA 1EYAA 1AP0A 2L55A 5M5XB 1J7AA 1EU4A 4KKJA 1SNOA 2F4IA 5ELEA 3BYTB 1GB4A 4HCEA 2WDQB 3C3LA 3LWEA 2JSVX 3AE6B 4DU9A 4IFDH 1AN8A 4R9WA 5AFWA 4ZKCB 2M0AA 1G8ZD 4ME5A 2BB5A 4LK0M 4JX1C 5IGCA 4XQNA 3H6MA 2ICIA 1PGBA 3K5OA 3K58A 1M8AA 2RA4A 1AFPA 1Q3LA 2BS2B 4RF1A 2V0GA 4CJ1B 4G57A 4FXDA 1QKZA 4AS1A 3A7LA 3W3AA 4DAYA 4US9A 3I90A 1VDVA 1GJXA 3PUZA 1SYGA 2E75C 3K0YA 4J1MA 4HKZE 1HUNA 2NVXB 3OMGA 2A68D 2XRQD 2R7ZB 1I6HB 1Y56A 5J22A 4KD3A 5J1ZA 3I4LA 4OVZA 1KDCA 4C80A 2R6GA 1HA6A 2B2UC 3X3NA 4H13C 2KCNA 1O7LA 4OW0A 4F7XA 1PZJD 1F77A 1STGA 1C9FA 3UI2A 1CTMA