2RDGA

Crystal structure of staphylococcal superantigen-like protein 11 in complex with sialyl lewis x
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
192
structure length
192
Chain Sequence
VRSQATQDLSEYYNRPYFDLRNLSGYREGNTVTFINHYQQTDVKLEGKDKDKIKDGNNENLDVFVVREGSGRQADNNSIGGITKTNRTQHIDTVQNVNLLVSKSTGQHTTSVTSTNYSIYKEEISLKELDFKLRKHLIDKHDLYKTEPKDSKIRVTMKNGDFYTFELNKKLQTHRMGDVIDGRNIEKIEVNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of staphylococcal superantigen-like protein 11 in complex with sialyl Lewis X reveals the mechanism for cell binding and immune inhibition
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
molecule keywords Superantigen-like protein 11
total genus 56
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2007-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2rdgA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2rdgA01
3W2DA 1G8ZD 1KTKA 1LTSD 2AQ1B 2G9HD 4RGTA 3TSSA 3KLSX 5TSSA 1LLRD 4UDUC 4RH6A 1JWSD 5ELBA 3GP7A 1YN4A 5ELCA 2IPKD 2J4XA 1PTOH 4RHSA 1EFID 4DXFA 1FNWA 1LTID 1S5FD 3URYA 1SE4A 2TSSA 1LT3D 1S5CD 4RGNA 1SJHD 5ELEA 1D5ZC 1ET6A 1KLUD 4OHJA 3OWEB 2AQ2B 1PTOF 4L63B 2WV6D 4NZLB 1TS2A 1PTOD 1BCPB 1FNUA 1S5DD 1V1PA 1YN3A 1JR0D 1I4GA 1LO5D 1BCPD 1QILA 3EFXD 4O1NA 1RCVD 2NTSA 1B1ZA 1UUPA 1RD9D 2SEBD 1BCPC 1CHPD 1CQVA 1LT5D 1D5XC 2XRSD 3BYYB 3V05A 1JCKB 2RDGA 4L6TB 1FD7D 1CHQD 2XNAC 3SEBA 1PRTB 5ELFA 1I4QA 3BZDB 1KLGD 2XN9C 4BWGB 1LT4D 1TS3A 1S5ED 1D5MC 1LTBD 2XRQD 4TSSA 1PYWD 1AN8A 5D3IB 1SEBD 3R2IA 1CK1A 1FGBD 3O13A 1ESFA 1XXGA 1HQRD 2QILA 1EEID 1ENFA 3EA6A 1ET9A 2Z8LA 4RFBA 1B44D 1RDPD 1GOZA 1CT1D 1DJRD 1RF2D 2O2LD 1S5BD 1T5XD 5I4DA 4DXGA 1EEFD 3MFGA 1PTOC 1PRTF 1SE2A 1YN5A 1HTLD 1PRTD 2QEJC 1SXTA 1EU3A 1M4VA 1PRTC 3CHBD 3BVZA 4ZYSA 1PZID 1UNSA 1D6EC 1PZKD 4Z9CB 1EU4A 1F77A 1AW7A 4K6LA 1TS4A 1LTAD 2IJ0A 4RGMA 1PTOB 3BVMA 1I4PA 1TY2A 1I4HA 2NTTA 5D3DA 1JWMD 1BCPF 2CHBD 1L0YB 1V1PB 1LTGD 1FNVA 4RHRA 1L0XB 3DWPA 1TY0A 3R8BA 1LTTD 1JWUD 2RDHA 1MD2D 5FKAC 1STEA 1HXYD 3BVGA 3R2TA 1I4XA 1PZJD 1BXTA 1LTRD 3MC0B 3DWAA 1XTCD 2ICIA 1SJED 1I4RA 1JQYD 1DYQA 1SE3A 5FK9C 1V1OA 3BYTB 1SBBB 1TS5A 5ELDA 2AQ3B 1EWCA 2R61A 4RCOA 3DWQA 1HA5A 4C56C 4RGOS 1LT6D
chains in the Genus database with same CATH superfamily
4B9KA 4M02A 3SK4A 4OO1G 4A3PA 1FJGL 2JXTA 2M8SA 2IGDA 2KQ4X 3M4OH 2ZCCA 1BVSA 5AFWA 4KX6B 1K8GA 2GVAA 4K5VA 2B63B 2N0SB 4KY6A 2A73B 2EIFA 1OEYA 4PYZA 1STGA 4FDBA 4HJAA 1TT5B 1RYJA 3K59A 2CVRA 1FMAD 2NZHA 4CO7A 4LFAQ 4LFCQ 1E7VA 1TBEA 2R92B 4MGZE 1AH9A 4C4VB 2VUMB 2F3WA 2WP9B 2BS3B 1T0QC 1Y1WB 2EKEC 2WB1G 1VZ8A 3H09A 4K2KA 1WRIA 1X32A 2LI5A 2AHOB 3LGJA 3TZDA 1FNUA 4HCSA 3UDIA 4CKEA 3N30A 1BBXC 1WGYA 2I1JA 4N9TA 2EQSA 1VLBA 3I3CA 3GTMB 1Q1BA 3CQZB 3DBHB 1I42A 2INCC 2RPVA 4WJQA 5C0XH 4K6DA 3K9OB 5JZEB 2N7JA 3PF4A 1TGZB 3PIOA 1TWFH 3MAQA 3VR6A 5C3XA 4L5RC 1YMHE 1YNTE 2LFNA 1Q8IA 4M0WB 4JBMA 1WSPA 1SE8A 1ZXTA 4K14A 5ELFA 2JXXA 1SMYD 1EOVA 2QJLA 4IUVA 1CZWA 2IW3A 4WORA 3HRDD 4G57A 2AMCB 4JWUC 4C4VA 2C7MB 3PUVA 4IFDG 2QCPX 2B63H 1EWYC 5M5WH 2LGXA 4GLXA 3A7AB 2I0QA 3R2IA 1CK1A 3M4OB 3AE4B 2Z1CA 2N55A 2QILA 1WE6A 2IL8A 3QIJA 1QUQB 2IX3A 4YCVA 3RD2A 3PUXA 5KRUA 1SNPA 1E6EB 1E8YA 5C4HA 3QR8A 4AQYL 4KZ0A 1KNEA 2FE8A 2ZM6L 2KMCA 3KBXA 4UP7A 1EIYB 1F9SA 1K83H 1V5TA 5G2NA 3VTWA 3KLSA 1FD6A 2E74C 1D4BA 3QOJA 4AYBB 4XQNA 1EFWA 4V190 3AEVA 3PHXB 1EOTA 1Y14B 1WGRA 3NZUA 4KGSA 2FXQA 1ICFB 3BVZA 1U4AA 4K7WA 3I72A 3I63C 1Y1VB 1JOQA 4F7XA 1EQQA 3MHZA 3LWUA 3QG1A 1XQQA 4DK1A 4C3JH 1SROA 1N8RC 1EY8A 2LXJA 1MHHE 2GOWA 1H4RA 2GBRA 1XWEA 3U9OA 4DR3L 3I56A 5T8IA 3B1LX 3H9DA 1AFPA 3E6ZX 2F3IA 4GKJL 1AZPA 4L5SA 3WCQA 4GDKB 3I9V1 3STBD 3SXHA 5IWAQ 3DDCB 3G4SA 3QOLA 3X3MA 3BVGA 1C4QA 3R2TA 3ZYYX 5IYCG 1RLFA 3AECB 1LXDA 3DBRI 4JIOU 5LLIA 2V1CC 1SIFA 3DM3A 3AE9B 4AQYQ 1P7FA 2ZPYA 3D0FA 2JA7B 1DM0B 4K8JA 2Z59B 1P7EA 1EWCA 1KDBA 2BDNA 1V81A 5JPNC 4CGYB 2RSNA 1WYDA 4ZCKA 3K57A 1J7BA 4A3DH 1WX9A 2PKOA 1ZKOA 3DVGY 1KTKA 2AQ1B 3IHPC 1RAXA 5IGFA 1RJTA 1HJPA 2YTYA 1J0GA 1PH6A 2PW9A 2LRUA 4ZUIA 2HTME 1NI3A 2J4XA 2BS4B 1EFID 3QHTA 4YSXB 4YHHL 3HOWH 1FIQA 2NWGA 3G71A 1G2TA 2MO1A 4KV6A 3KF6A 5IP7G 2ZTEA 1NBWA 1KLUD 4OHJA 1VR9A 3AEFB 3H6MA 3AV8A 3STBC 2EMSA 3FKYA 2N9KA 4M8NA 1YNNC 1H9MA 1TS2A 4DR2L 2K3UA 1LQBA 4A3JB 4FJZA 4GDLA 3A9KB 2IT1A 1YJ1A 1TWFB 2ASBA 4A55A 3P2BA 3HOWB 3VR2A 2JU6X 4GLSC 1JR0D 1I4GA 3PQIA 1VQ7A 4F7ZA 3AEEB 3UF8A 2CJNA 1S40A 4BXXH 5F2DA 1V9PA 2FMMA 3NRZA 4WAFA 1RD9D 3AQQA 1CHPD 3KYHC 1A2TA 1D5XC 5J39A 4DV5Q 5HI1A 2VB2X 1CHQD 4DV0L 4MGKE 1JJGA 1PH5A 1PRTB 1VDVA 3VRBB 1T0RC 4XX5A 3V62A 4YWMA 1H9SA 1K8AC 4FF1A 1J8IA 5BMIA 1Q8KA 4JOIC 4EQNA 3NP8A 2J7ZA 5IP7H 3CW2C 3PGEA 4LFBQ 4A9AA 3FDTA 2ES2A 5IGCA 4NAMA 2CS4A 3EJIA 1S4ZA 2XTIA 3I4LA 4J8QA 1EEID 4BAXA 1P3QU 2XSCA 3RZOH 2LUEA 2INNE 2VZKD 1EY5A 3PF5A 1JORA 2DZIA 3JC66 5EKIA 3ICEA 1Q46A 2B3GA 2LFIA 5JJLA 4A3KG 4DXGA 3G6JB 4FHKA 1ZE3D 4XWTA 3TRZA 2D62A 4NJ6A 4IDIA 1SXTA 4NXML 1SFOH 4MNOA 4DAMA 1Y1VH 3ZQ4A 2BKFA 3J7ZC 4JBJA 3PO2H 1IPGA 1FXAA 2L0TA 3PPAA 2PW7A 2PZTA 1C9OA 3UE0A 1TS4A 1PH2A 3RFZB 3D4WA 1I4PA 1ICWA 4A3LH 1K52A 4GXBA 2R92G 1V49A 4WFN3 1V1QA 5M3FB 1ZDXA 2DGYA 4DV1Q 4NW2A 1V6EA 1VQAA 5GAHC 1GUGA 2KTRB 1CI3M 2K5VA 4G4KA 3DWPA 2C60A 1XCTL 5JJZA 4PS3A 1IBXB 1UE5A 2BWFA 4ARCA 3BS1A 1JMCA 2D0PA 3CAMA 1QZGA 1OXUA 1HXYD 4ALPA 4YY3L 1GJXA 2KTFA 4JOIA 1TZOA 1N36L 2PE9A 2XVSA 4TMAB 3BG3A 4E74A 1NMGA 2F52A 3MVVA 1OQYA 4IOCA 1WXMA 2WXMA 3H7SA 4KJNA 4DV0Q 1EYGA 2PCFB 2F03A 3MHBA 2PTLA 2B2VC 3ZRCA 5EKKA 1KC8C 4UY8C 3A33B 3RNGC 1NR4A 2KEEA 2BGFA 3GTJH 1YNND 2M2LA 4K5XA 3TSSA 1GC6A 2GVBA 1PDXA 2JN4A 1PQSA 2MP1A 2E5LQ 1MSHA 2WB1E 3K9PB 4FLHA 1A6XA 2EYFA 2KJXA 4GDLB 1LV9A 1RRBA 2PW5A 5EGTA 5M3FH 2V9HA 3URYA 3TL5A 4C1NI 2B2VA 3WAOA 1LT3D 2B63G 1VQHA 2V4LA 3LXFA 1X54A 1VQJA 1IGCA 4C7YA 4WJNA 1W6KA 1L0VB 4CBVA 2K4KA 2VRRB 3RMHA 2K05A 2VY3A 3WAPA 3KUCB 4MH8A 1FCCC 2VUMG 1UWXA 2CR5A 4LUVA 1IKLA 1UF0A 4XGAB 2GBNA 1WGKA 4HAEA 4PMCA 3GO5A 1Y1VG 3WWVA 2BB6A 5J18A 4MM3B 1II3A 4OWWB 2Y5CA 2BA1A 1YJJA 1TT2A 4GN4B 4JI4Q 2L76A 3NBHB 5HGTA 4MSMB 2L83A 1MVKA 4DUZL 3OTOL 3KVFB 4X3KA 2K5DA 2O6VB 3L16A 4DNIA 3KWVA 1CKNB 1KH0A 4OWTB 1XD3B 3NVYA 4P75A 2Z0DB 1QZHA 2VS1A 5KNBA 3B9JA 4HSPA 4HRSA 1NSNS 1K73C 2F3VA 1XLOA 3K7AB 3UIPB 4NKLA 3KH0A 3BZCA 1VF7A 1D5MC 3A74A 3QARA 1WTWA 5EPJA 4CKCA 4CJ2C 1AN8A 2P5ZX 1V80A 1R4PB 2HD3A 3J80L 2DBYA 1Y8NB 4MGYE 1LUZA 1HQRD 1QVCA 1OTRB 2JP1A 1Y8RC 4GMVA 4IWQA 3D8GA 1WMHA 2BYTA 5FLXL 2Z8LA 1YHAA 2CJOA 3RLOA 4QY7A 5E6OA 1RDPD 4IJHA 4REZA 3SFEB 5KYLA 1K3RA 1O80A 1HCZA 4IFDI 2RDBC 1KNAA 3A8IE 4LUZA 4W9CA 4C7ZA 2K75A 3FEWX 3AE7B 1PRTF 3NWTA 2REXA 2W9NA 3I4NG 1SYFA 4BKTA 4NPSA 1ISNA 1F9RA 2IY1B 3BDOA 4KN7C 1UEAB 3QWNA 1KRTA 3GE3C 1C3TA 1K51A 1YOVB 4CHKA 2YLMA 4L2YA 5DM73 4JGHB 1HNZL 4C3IG 2MEKA 3VA7A 1OXVA 2JVCA 1E2ZA 2I5MX 2KA7A 2C9OA 4MTKA 1IZ6A 1JB7A 4JI2L 2IZVB 3FP9A 2K25A 4YWGG 2MJEA 5CTRC 4KSKC 3VUWA 3HOWG 1A3VA 1JWUD 2RDHA 1XPUA 2JRIB 4CJ0B 3AE8B 2PQEA 2G9DA 4KKIA 4LCDE 2NN6H 4C3HH 1B9NA 4B3TQ 2ZXRA 3I4MG 4KIKA 4BBSB 1BT0A 1U4PA 2ICIA 5AZFA 3OSOA 4DF7A 4OO1I 4WIPA 2TMPA 1V1OA 2RF4A 4ZLTF 3P4PB 4YIJA 4A3MH 1RFAA 1NVID 1NYQA 5COYA 3HOXB 1J5EQ 1KFYB 1LACA 3W2DA 1EY6A 2WLBA 3DBRB 3W9CB 3EFUA 4KTAA 4IWPA 1F9QA 5CR3A 2PPBC 2INDC 2WU5B 2M0XA 4A3OA 1TIID 3GP7A 1BF4A 3IAM1 3S1QB 4P1CC 1BNZA 2G4SA 2WP8J 1IBXA 1ZGUB 4LAAA 4NMZA 2MSED 5G3LD 2MBHA 4PT5A 1EZ8A 3PVLA 4L23A 4HMIA 4OXPA 4PS7A 4NPNA 4DR3Q 1K28A 3CP0A 1JT8A 2JYEA 3PLVA 4URKA 4CQNA 1R7SA 3CU7A 2L4NA 4HSVA 3PMFA 1NI2A 3QO2A 1YJIA 1EF1A 3HFZB 1I50H 4C3JG 1WTXA 2R7ZB 4G11A 5CV9A 3KUPA 1YJWA 1A70A 3BU2A 3FMCA 3ML8A 2A5HA 4MACA 4P1BC 3VXWA 3PGZA 2XK5B 1DGJA 4NXMQ 1L4ZB 3TN2A 4O1NA 1P0RA 1UBIA 4DR5L 4TQ1A 2DX5B 2BE5C 2C35B 3I70A 4BY1G 3BYYB 3I4OA 1Y69U 2LWPA 1J6QA 2H5XA 2RDGA 3W1BA 4HIDA 2ACZB 3ERQA 2I07B 2MBQA 1NMFA 4GN3B 3A9JB 3HM3A 4ANVA 3DUZA 3D4DA 5LXIB 3U30A 3KOJA 2JXMB 4GN5A 2MBEA 1E9MA 3VYUA 2CWPA 1WJ4A 1P98A 2ZT9C 1B8AA 1E1OA 2V3NA 5IN7A 1WXSA 1FRRA 2AWTA 1TS3A 3L10B 2RCNA 3CRKC 1IYVA 1ZXHA 2O6VA 2WDVB 3KQ4A 3KLWA 3MZ5A 3V3XA 5GXGB 1L4DB 3O13A 1Y56A 4B9XA 3MP9A 2EY1A 3PIPA 2V4DA 3NVZA 2IO3B 2WXQA 3GOEA 3EIVA 2JA8G 4B3SL 2E2JH 3TS0A 4X64L 3NUHB 3AULA 1A62A 3TQYA 3LX0A 2KOXA 4ZYNA 1VQDA 2KVMA 4IFDJ 4BZAA 5I9OA 3J81i 3K7UC 4ULLA 2QEJC 4MT5A 1HZ6A 4A3JH 3K5MA 1HTOA 3S24A 2HD5B 1PFSA 5M3MB 2KNBA 5CBEE 2KJHB 2AL6A 4M0WA 3TIXA 1HTQA 5BYSA 5K5PA 3S1NB 1F2RI 1FM0D 5DPTA 3ECIA 1CTMA 5EE0A 1IHZA 2WINB 2N1VA 1MGSA 4EQPA 4A3IG 4HLEA 1XPOA 2K1FA 2B8FA 4KK7A 1FNVA 1N33L 5T1GA 3DPDA 3SU8X 5AZGA 4W9EA 4EZLA 3KJOA 1EO6A 1WMHB 2DAFA 3WALA 4HDQA 3TP7A 1VQBA 4HR7B 3H94A 4PS8A 2KEDA 3LB8C 1Z9FA 2IHEA 5FKAC 4DV6Q 4H2AA 4RMFA 3F1ZA 4F8MA 3GTGH 1STEA 1TWAH 2A1AA 4GS3A 1WM2A 2PI2A 3Q8EA 1SIJA 1SNCA 4JI5L 1VQNA 5BR8Q 3EECA 2F4VL 3RYTA 3Q3FA 2A69C 4KY7A 4LNIA 4W9GA 5HKHA 2N9PC 1IBLQ 4BY7B 3BK2A 2LGIA 3I90A 3A9JA 4DR4L 3U52E 1KDCA 4OIKA 2AQ3B 1VS0A 3NS1A 2B2WC 4LF8L 3I2ZA 1GVPA 3VVWB 5I6WA 3QIAA 2JQOA 3T1HL 3AFQA 4H7BA 4MHEA 3E9IA 4JLCA 4EE2A 1PFNA 4DN4M 4RGTA 1GUAB 3AEGB 3AFPA 3GTQH 4DHZE 3EGRA 1Q5WB 5C1ZA 5CHFA 1A63A 4HKZE 3PO3G 1WVLA 2W54A 4GDKA 4YCUA 4GU2A 5E7NA 1VQPA 1FNWA 1VQ9A 2YYZA 4HVBA 5HY6A 4HMJA 1QOHA 2EY6A 2ZJRA 4X3TA 1YQBA 2SDFA 4IWOA 2WIIB 3T9LA 1SN8A 1HZ9A 2QKIC 3CCEA 3I3TB 3UI2A 4DNRB 5LL6X 4HJGE 2KUMA 4JI1L 4JCVE 5CMDA 1JJ2A 5KHOA 5C4ZA 4YY3Q 1N32Q 1GB1A 3GDEA 4PZ8A 1O7IA 3L3OC 2KCTA 4DR1L 1V1PA 1YN3A 1N9WA 2JZ3B 4JK1C 1KAWA 2R7DA 4QGUA 4C3IB 2M1MA 2BBCA 3EN2A 3A8KE 2YVCA 1E0ZA 1TQOA 4X66Q 1IGDA 2IO2B 3OG5A 3RPFC 3A8JE 4JYAL 3F8TA 3ZTCA 2V4IB 1IKMA 3EVQA 4QJFA 1CA5A 4MDKE 5C44H 1QQRA 4XQQA 3K0YA 5IYCH 3MTNB 2QA4A 4UP9A 1WF9A 1FJGQ 4HK2A 4YCWA 4BWGB 2MA9B 1DOMA 3MC8A 3V6EB 1WRDB 3VR3A 1HR0W 2B2YC 2XRQD 3GV6A 4DQOC 3P63A 3ONSA 1UGJA 1H9JA 4W9KA 5CBAE 5FLXc 4Y7NH 4C2MB 4AJYB 4IQZA 3ZVVA 2N7EA 1EY0A 5CV8A 4ABNA 5FO9B 2XIWA 4TVAB 2KX0A 1EWIA 1JOOA 3N3KB 1XMQL 5IOIA 2QDFA 4NJ7A 2WXJA 4EQ5A 1CT1D 1DJRD 1WYWB 4QUCA 3RZDH 4C80A 2NMQA 1S5BD 4A93B 2CH4W 1EY4A 4MSQB 4C1NK 4DAYA 1U4RA 2VXWA 1JOKA 4GLVB 2L1BA 2WAQB 1RFKA 4ZRJA 1K53A 4DDID 3R66C 3NS8A 3P1HA 4WWMA 4HEA1 2KHSA 3NBHA 1D6EC 1QKZA 1KD1C 2R92H 3BK1A 4TKOB 3DWMA 1TY2A 1N61A 2J52A 2EJMA 2E3TA 3GD7A 4WJWA 1ZEQX 5HGQA 3S2DH 3GTQB 5LMNW 1GC7A 5H92C 3CMMB 4O0AA 3ZGZA 3ZW3A 2EOTA 2N78A 4I6NB 3A4RA 4OW0A 5KHQA 1ZOYB 3KUZA 4HCPB 1WGGA 2LGDA 1HRJA 2KN4A 3J7AV 3GTLB 4BOZB 5DM63 2J0TD 1QVFA 1LTRD 3W5VB 5IP9G 1XMOL 1N6ZA 3GV3A 4HWIB 2PVOD 3T51B 3S2AA 4BY1B 1SYGA 4KKSA 2AL3A 2D3CA 3KYDD 1SJED 1XCQL 2FUG1 5LMUQ 3I4MB 3L4PA 3SK8A 4ICUA 2R61A 3TEXA 3S1MB 3DWQA 2X8XX 4HPPA 4DDGD 2Z4HA 4C3HB 2NVTB 4E71A 2LUMA 4B3SQ 4H44C 3C2PA 1GHKA 2PJHA 5DPWA 3TP6A 3LWEA 2HIXA 1QOAA 1IXRA 2INPE 2F0MA 4II3B 2DUDA 2GA4B 4KGRA 4UAIA 1Z5SB 4HJ7A 1GUNA 5ELCA 3HOYB 1Z2MA 4IG7B 3SHLA 3JSVB 4YSYB 1E5WA 1VZ6A 3TBIB 3DHQA 3S1NH 4K0KQ 2B2TA 1SJHD 3VYSA 2VB3X 3HP3A 3VTVA 2QIEB 3OWEB 3KF6B 3ZO5B 5EDSA 1PTOF 4X3UA 1PH3A 1MBYA 4JW0A 1K0RA 5BYRA 2KAJA 3S1RB 3JSVA 1P8LA 2EY2A 1CA6A 4KDLB 1B4OA 4I65A 1KL9A 2B39A 2E2DC 1U4LA 1AE2A 3SGIA 4B0EA 4IZ8A 5AJ3L 2BT6A 3Q3OC 3CKIB 1KABA 2K5HA 1GKHA 1GD7A 1B9MA 3CPFA 4FN2A 1LGRA 3J81c 4JI2Q 4JI5Q 2Z0EB 3U4EG 1BCPC 3SR1A 1WR1A 2EYHA 2JYTA 3HVZA 2F4VQ 3S16H 5C5MA 2MRPA 4KKUA 4X57B 1PDQA 2UUBQ 3I4MH 4BOSC 1Z47A 3K7AH 3UDFA 1Y1WG 4W9LA 4UHVA 1PVOA 4DK5A 3TMPB 4O2DA 3SR6A 3ZJUA 4U68A 2F0TA 5IYBH 3UE1A 4ILWA 4H13C 2K32A 2MP2B 2NVYH 3CRLC 2DNFA 1R4MI 1PYWD 3HZXA 3L0OA 4JBWA 4P16A 2CHXA 2OJRA 4LF6L 4FXDA 1F1HA 2EZVA 2F0JA 3VR8B 1A15A 3N6RA 4E6IA 3CCSA 1J9OA 2BVCA 1FCLA 1EZ6A 3KJPA 2UWQA 1JC7A 3VDZA 4FNFA 2L0FA 1P16A 1T5XD 4R8NA 4NXNQ 3GTKH 1YQ3B 2K6QA 1PTOC 4L5TA 2KDIA 2WNMA 1SE2A 5IAAC 2A68D 1XYIA 3ZNHB 5CV6A 1Q1OA 2KQ7A 4ASWC 1E8ZA 3OWFA 1WTOA 2L7RA 4GB9A 1UNSA 1V2YA 1DXMA 1VQEA 1PH7A 2WU2B 3RNCC 4DAYB 3APCA 1C76A 1C7YA 2KWCA 2HDMA 5FLMG 2VL6A 1X3PA 2NTTA 5ELOA 1PHJA 3S1QH 1B50A 1R4NI 2AWOA 2N1WA 1BCPF 4LF5Q 3S16B 1EQTA 4JI4L 4A3CG 2K8CA 2LVQA 3ZNZB 2E2JB 5KIXA 1UZXB 3T16A 1ENCA 2E2IB 2DYBA 3QQ8B 4PZ7A 1HEZE 1RTOA 3F2CA 1B2TA 1O78A 1FXTB 2ZEQA 4NQLB 5HG2A 4S3SA 5D14A 2KC1A 3AE1B 3S15H 2FCSA 1SNDA 4K3BA 3NJTA 1VZ7A 3P75A 2NBUA 2H1EA 1SDFA 3U8ZA 2EYJA 3AEAB 3NPPA 2GBKA 2O2VA 2L12A 5CGKA 4NAWB 1XTDA 2RD0A 4CDCC 4OX9Q 4IFDH 1CKOA 3C1EA 4QL5A 4A75A 5AUIA 1I94L 1QNKA 1UH6A 1K8RB 5CORA 2ZM6Q 4HIKA 1JROA 5I6YA 3L54A 2NVXH 1IBMQ 1PMRA 3S2HH 1DONA 4IPCA 3CQZH 5C3EG 1K0SA 1U5KA 3Q69A 1LTID 4P73A 3R3OA 2LKVA 4X64Q 2PEAA 3H0GG 3IBEA 2R3ZA 3C1FA 4DV2Q 3KBGA 3I7FA 3RNEC 1F0ZA 3TEYA 3GTOB 1L1OB 3ZDTA 2MNAA 3BJUA 3TDQA 1YQ4B 4A3LG 3KUDB 1A8VA 1C9FA 2GMIC 4LDTB 1JALA 5EPLA 4RAUC 3FKIH 1S5DD 1HPCA 2Y0SE 1HUNA 4XYCA 3MXNB 1EIGA 1EM7A 2E2HH 2L3ZA 3IT6B 4AOFA 4BBNF 1F9PA 2HDLA 3RD4A 5DEHA 1OXXK 4OO1H 1CQVA 1XMOQ 3V6CB 5JHAA 4MTNA 3M3YB 3NY5A 1HNZQ 3S17B 2ZCBA 1FD7D 3FKIB 3P1MA 1X9NA 3VR5A 5IGEA 2F0EA 2FCQA 1NAPA 4YSZB 3GTPB 1VQMA 2NPTB 2I5HA 3DBLB 5E1FA 4L1BA 1R9TH 3NUCA 1LT4D 2M00A 2PZWA 1X55A 3OOCA 1V5OA 4RMAA 2RDFA 1Q3LA 4IURA 2AWNA 4G7HC 4DV2L 1BKBA 4OONA 1NTGA 2DNEA 2F0QA 3VUXA 1B44D 3FVQA 1HTPA 3T1HQ 1GJZA 1SE9A 2MP2A 3MXNA 2PLPA 3UGBB 4S0RA 2QW7A 4C3HG 1MKHA 1X3FA 2ZPNA 1WI5A 3EBEA 2UUAL 2RCFA 1IBML 1K50A 5EKLA 5C0XG 4A3MB 1BBWA 4ODGA 4X62Q 2OWOA 2DN8A 1PRTC 2KN5A 1VRAB 1QOBA 4KD3A 3EQLC 2KVZA 2VH1A 4QB4A 3N20C 4GNXB 1F77A 4IUNA 1YNXA 2IJ0A 3DHGC 1ZKHA 2GRIA 2Y5BB 3BVMA 5C4XB 1CJEA 2R6GA 5D3DA 1QOFA 3AE5B 2OOBB 1T6BX 1L0YB 2K01A 1PFMA 4RHRA 1XLNA 4MELA 2LD9A 4LNKA 5IE8A 2Y0SB 2H89B 2OEDA 3KF8A 3OHXC 3NE5B 4HN7A 4HJ8A 2UUBL 1LTTD 2A8VA 1G91A 1I6HH 3U4VA 1I5FA 1TYGB 2FCNA 4KGTA 3VH4B 1B9RA 3JYUA 2KFKA 2NB0A 5C5LA 2KDEB 3A54A 2IX0A 3NXWA 3D6WA 4LW1A 1FO4A 5JVH3 3U9SA 3IVFA 1GUOA 2PZUA 1M8AA 5IT9L 3L0WB 2WXIA 4J1MA 4M1UB 4GGQA 3N1XC 2QHOA 4OZCA 4XC2A 2Q2TA 2CQOA 1V97A 2JA9A 3CSFA 3QJZA 2MW5A 4QF4A 4ZKBB 1EWHA 3AI5A 4G7OC 4TRDA 3H3VH 3LYYA 2Z6KA 4P72A 4K5WA 4KJOA 3ULLA 3TREA 3X3NA 2J53A 1K8OA 3KLSX 3T56B 1OXTA 3BWUD 2MFIA 1C78A 4IUPA 3TBLD 3LJ3A 1WCMH 3ND8A 3P4RB 4RHSA 4YTPB 4BBRG 1B70B 3NTKA 2KDBA 3DEOA 3W5UB 4N8FA 5I2XA 5IYBG 2UXBL 2F1MA 4TUUA 3PUYA 4A3FG 2JA6H 3U7DA 3HG9A 4W9JA 5DPSA 1CKMA 1KDAA 2A6HC 3JAME 1E3PA 3HGBA 3M3YH 2LGYA 2WYQA 1Y8OB 2KECA 1ONLA 1HZAA 1PXUA 4IOIE 1XJVA 1KOTA 5KGUA 3QB3A 4OVUA 3QX1A 4A3BG 3A1QB 5IYDG 1KJTA 2PO4A 2EYPA 2A6EC 4QMGA 4LF9L 2HTHA 4IPDA 1MFWA 3T1YL 3VYRA 1B3AA 1LTLA 1CSPA 3T53B 4K2LA 4R4OA 1XLQA 3OLMD 2BB5A 3HEJA 5D2MB 4CDEC 4IW0A 2JA5H 1FL0A 1KLGD 2KLGA 3RLFA 2IHFA 2OTLA 1TWGB 2WDRB 4FULA 1Z6HA 5IT9c 1W6JA 2CU3A 2PVGC 1GUTA 1ESFA 2ICEC 2L11A 4JI3Q 3V60A 3NQTA 3HOYH 1J19A 3SK5A 2A6HD 3VQIA 1Y8PB 1TKEA 4OIJA 1SSOA 1WXQA 2HJ8A 5CYUA 3ONAB 2DWQA 1U4MA 1JRUA 4IUUA 2KLCA 1WY8A 1MIUA 4P2CB 3K5NA 4B95A 2B2YA 2FFKB 3QJYA 1WJ6A 4MN3A 3RI7C 2I2YA 4JC0A 3RUIB 5JH5C 1G291 1M4VA 1E24A 4BKSD 3AE3B 1PLFA 1PA6A 2L8JA 3ZLZA 1X3QA 2SOBA 5C0XJ 3OW2A 2NPTA 1GAQB 1A3UA 4POFA 4DV5L 1SFOB 5TR5A 3H0GB 1IBKQ 1N34L 2K8BA 1JWMD 5C4JH 3TP8A 2N4FA 3DHHC 4IM2A 2RA4A 5H8YE 1V1PB 1DOLA 4C3IH 5BO4B 3MHSD 4N6EB 4DUYQ 2GB1A 2PQAA 1STNA 1L0XB 5FO8B 3EFCA 2KYWA 2F0UA 1LM8B 1Q12A 1IYJB 2L5TA 2EDGA 1LM0A 5BN5A 2QMTA 5BN4A 1X6OA 2OF1A 3Q8CA 1WTVA 2OQ0A 2E8GA 1ESRA 1K9MC 4LF6Q 4MGIE 1ZDVA 3CIRB 1XNRL 4BY7H 1BXTA 2A69D 4XDCA 3SDLC 4BVUC 4ZAIA 2MGSA 3G7LA 3MC9A 2OJWA 4IC7B 3NELA 4LK0M 3VHTC 2VQFL 1SE3A 2X38A 4UPAA 4J6IA 2Q2IA 4APVA 1P9DU 2XWBB 1UGMA 5ELDA 1F2LA 2B76B 1R4NB 4F87A 1VQGA 3EHVA 1Q90A 1VQIA 2Q8RE 1C1YB 1WCMB 2MH7A 4BA1I 4WURA 3NBIA 4DHJB 2L32A 1NJIC 2JWUA 2Z6BA 2N88A 3TP5A 3ML9A 3DLLA 4FF2A 3B08A 1C4PA 4JI0L 1T5EA 4HKQA 3IAYA 4UDUC 1VQ6A 2D3AA 2BPSA 5CV5A 1TVXA 1SR3A 5E4XA 2K6AA 5NUCA 2YEPB 2JA7G 4BBSG 1WJUA 4GIVA 1A2UA 1V9JA 2BYFA 1I3QH 5BYQA 4XTCS 1OXSC 2YTXA 1WGDA 3N1YC 1JICA 2KZRA 4RCNA 1T3QA 3HOVG 4TQ0A 4WAAA 1QCBD 3TCAA 1I7HA 4U673 2UUAQ 3IT4B 1CUKA 2LMCB 5J22A 1VQ8A 1QILA 3ZRFA 1SAPA 1X65A 2E2IH 4LK1C 4TKNA 2ZNVB 5D94A 3OYYA 2B2TC 1E10A 2QGQA 3DMUA 2BKRB 2MPMA 5K36G 1NDDA 5IA7A 3T3NA 4A3EG 3ZJVA 2E75C 1WYGA 1JRPA 3PRMB 3CC7A 2IGHA 5JHBA 2QF7A 4PNYA 2ENBA 4GOPA 3BZDB 1KAAA 2K50A 4B9WA 3HOZG 1IYFA 4A4IA 4IOAA 1GG3A 2F0KA 3NG0A 4RM8A 2LRWA 2Q5WD 3E0JA 4LLGM 2KMAA 1SNMA 2CW0D 4YTMB 2KOLA 4H02A 1Q7YC 3KK7A 4RKBA 4XYQA 3V96A 5GADC 2CFMA 3VR9B 1SYCA 1WZ3A 5C3EH 3OJ3A 4EZKA 3P4QB 1SNQA 5I4DA 1TWGH 3L2PA 2LVPA 4XZ4A 4XXEA 2L52A 2R2OA 2RPQA 3VYTA 2N49A 3CHBD 1H9KA 2HCIA 2XBBC 3Q2AC 3BY4B 5LMNQ 1SF0A 1HHVA 1WXAA 4ANUA 1B53A 4DHZB 4FADA 5LHY1 3DOWA 3GB1A 4M01A 3RT3B 3TS2A 2A5UA 2C7NB 1DOIA 2M17A 3RN2A 2FAZA 4A90A 1QF6A 3RLNA 4IJLA 2WXLA 3A4SC 3R93A 1LFDA 2ZZPB 3IFWB 1TY0A 4W9HA 4DBGA 1O7ZA 4GSWA 3DWGC 3KWLA 3PSEB 5M3MG 4RKLA 4X66L 3GS2A 1TWHB 1PZJD 2R7FA 3A9KA 2MJ8A 1WZ0A 1WE7A 1XTCD 2MUYA 3W5OA 3AMUA 3BDLA 1I4RA 2EJFC 1SSNA 1PH8A 4MH0E 2NR2A 3KLRA 1ILPA 4OL7A 5HURA 4LF9Q 1VQ5A 4Q5VA 3T1YQ 3QWZB 1M90C 4CHTB 2CH4A 4ZDVA 2A4ZA 1MSGA 2ZNVC 1AEXA 1G8ZD 1LABA 5M5XH 1WI0A 2G9HD 2WB1B 1SMXA 3S2HB 1GXDC 2D3BA 3TMEA 3HIZA 3VH3B 3HOXH 2KX3A 2KWDA 1SYDA 4HJKA 1IYUA 1YN4A 3J81L 2D2QA 1WTRA 3R3MA 2CQAA 3CMAA 3RZFA 4N9F4 3ZNGC 2B2UC 4YWKA 1S5FD 2WKDA 1MJEA 3RR5A 1SE4A 1D8LA 2KCCA 5C3WA 5M5WB 3VDYA 1YJ9A 4BBRB 4WRDA 1MHXA 2WXNA 5C44G 3W1SC 1WFYA 4WQMA 4NP5A 1RTNA 2Z4IA 3M3JA 4IM0A 3A5UA 1V8CA 2E6XA 4B0MA 1D3ZA 1BCPB 3A0JA 1EYAA 5J3BA 4NXNL 3ENEA 3Q8AA 3C46A 4KI0A 3I4NH 2WKCA 2NN6I 1I6VC 5JEAJ 3JAML 3PO3B 2BE5D 1VQKA 3FILB 3ZXVA 1RCVD 3I55A 4EVOA 3Q3NC 2CW0C 2LY7A 1ML0D 2L0CA 1WJJA 5A2QL 5BR8L 1H95A 1E7UA 1IW7C 4XDXA 2EELA 1JCKB 3BDCA 4G7ZC 1SRUA 2F0GA 4GKJQ 3E56A 1ZPSA 3JAMc 4KLKA 3HOZH 3HUIA 3NHEB 4GZYC 2JA6B 2N7DA 2WDQB 1B7YB 1N33Q 2OXPA 2G5DA 2ZXPA 3RNBC 2RGFA 4F8CB 3D4RA 3F2BA 2YEPF 2ZTCA 1HUMA 4IALA 4TSSA 4B3RL 4RG1A 1VD2A 5D3IB 5C23A 3PSIA 2D2CC 4JQWC 1SEBD 1QZEA 2DLBA 4R4CA 5E6NA 1N62A 1VCIA 4LTUA 4QAYA 1PGXA 4GLAC 2RKSA 3M95A 1E1TA 1IUEA 2L9HA 4JVZA 4NB3A 5T1IA 1GOZA 2IY5B 2K22A 3ZJTA 1YX5B 3CC4A 2PPHA 3PRPB 1X56A 3GZNB 3CD6A 1RODA 1BUVT 1ZXIA 1YNJD 3OMCA 3RCZA 3CCQA 1YBYA 5IIFA 2K0PA 4A20A 5BMHA 1FRDA 3HKZG 2N8NA 2F0PA 4BXXG 4KZCA 4OEMB 2NCNA 4P71A 4JI1Q 4OVVA 2IWHA 2Z9HA 2UXBQ 4K6LA 3K80C 1LTAD 1KF6B 2LASA 2KENA 4QCLA 2F0OA 2XWJB 1VCBA 2D10A 3B2GA 1WM3A 4LUOA 4DAPA 4FXGC 1J7AA 2V3PA 4HXDA 5EE1A 3QK0A 3PO0A 4GOCA 4LNQA 3RN9C 4HCEA 5GAGC 2CKZB 3I4NB 2G1EA 4AWJA 4RM9A 1DOYA 4FXCA 4B3RQ 2KWVB 2RQXA 4XIGS 1QWYA 3VA5A 1GNUA 3H0GH 2FINB 1VJKA 1HQMC 4JPSA 2KC2A 1XX8A 1A0IA 4R1JA 5C0XI 5AEKB 1EY7A 2RVLA 1C0AA 1JWBD 1T0YA 5JJIA 1XLPA 2LEKA 3N32A 4RWSC 3L9AX 5FK9C 4JL9A 2MWSB 3K5LA 3OIQA 2L00B 1KRHA 2MHJA 4LJOB 3APDA 2MO0A 4A8XC 2B2WA 1HA5A 5DLQE 2NS5A 2BOSA 2AKWB 2NVXB 2AX5A 2M9VA 2LS01 4FP5D 1LTSD 5LXHA 1WCMG 4XE0A 3TEZA 2I5LX 3RULA 4G50A 1T9HA 3D31A 1IBKL 4ZKCB 5EAYA 4P6VF 3IRBA 3CCLA 2NVQB 4A3DB 2N9XA 3AU5A 2D11A 2D5DA 2TSSA 4RGNA 1S5CD 2W55A 2JA5B 2DJGC 2QC8A 1LYLA 1STYA 4L8JA 5GAEC 4FBJB 3G6EA 1JQ4A 2NBFA 2N3SA 4FHJA 4XT1B 3K5OA 3KDFA 1HH2P 1CZGA 5JJKA 2IDYA 5MPOA 2KBNA 1L6UA 2D9UA 1VQLA 5I9PA 1LO5D 2V0GA 4D2KA 3A5ZB 3EFXD 5DAUA 3HOYG 4FO2A 3H6NA 4ITKA 1YITA 1WOCA 2CHZA 3OAWA 2JZPA 1U0LA 1WJNA 3UIOB 3AEBB 4OX9L 2ID0A 2E2HB 1LT5D 1NEKB 3M4QA 4IPGA 4L6TB 3V05A 2NZOA 2ASQA 2L15A 3PCOB 3GTOH 2PE6B 4C3JB 4X65Q 2R7ZG 2MJ3A 2NBWB 3PO2B 2GBJA 4KHZA 2C5LC 3H3VC 1I4QA 3H8HA 1JB3A 1YNJC 4A3KB 4GOPC 1XNRQ 2KHWB 3BIID 3C3LA 5BN3A 1BDOA 2K28A 3A55A 4N8X1 3SK6A 1HNXQ 3PHWB 2N9EB 2NVQH 3AMZA 3HOZB 2KFJA 2VQFQ 4II2B 2KXJA 5EBCA 4LMQD 4DV7Q 1SGHA 3H7PA 2EPBA 4LF8Q 1K83B 1ET9A 2PQAB 1Z7TA 1WTHA 3NOBA 2DYOA 1NYRA 3AU4A 2VZAA 1VQCA 2O2LD 4KKTA 4N58A 4A3GB 4TV3A 5EE9A 1ZYRC 3NTIA 3HKSA 4DPGA 4US8A 5EJWA 2EYLA 1YN5A 3EC8A 1PRTD 3T13A 4DK6C 4GNXC 5EQ0A 2MCNB 2R93H 3K6OA 4LJZC 2KHIA 4IKGA 2PI2E 1CZPA 3MXUA 4LDTD 1C79A 3UI3A 1C4CA 1YIJA 5C44B 1KM7A 4F1SA 1VMPA 3NVWA 4K8IA 3PV1A 2WXKA 2CHBD 1N5WA 2ALYB 4Y52H 5GROA 4YXDB 5IO9A 3RUZA 2J7QB 2MLBA 1QUQA 3A1QA 3RMKC 5IYDH 3WAMA 1STBA 4UP8A 1FGUA 1JW9D 3M62B 2BH2A 2G3QB 4I6LB 2JA7H 4EZJA 3VTUA 1F9JA 3VR4A 3DWAA 3U7ZA 1STHA 2B29A 1Y1WH 4EOYA 1VQ4A 4HEDA 1Q10A 2K39A 4JI6Q 1SBBB 1DD2A 1TS5A 2WXPA 3W3AA 4JE3B 1EL0A 4ZRZA 2OQKA 5E6JA 2BWES 2JY6A 1HNXL 1JE4A 5A35A 1TU2B 3VUYA 3E3XA 4RA8A 5TSSA 1ASYA 1LLRD 4LF7Q 2HDEA 3PLUA 5IY0A 1RIPA 2J0KA 4DV7L 1JWSD 2JF5A 2I46A 4KY5A 2K9XA 2IPKD 2R93G 1C77A 3JW0X 4GKKL 4BY7G 2IBIB 4ZUJA 1L7YA 3AXCA 4HJ9A 2K7VA 3J80i 3L7ZC 2XK5A 1ET6A 3GTPH 1WGHA 3J80c 2WXOA 1MPEA 2KD0A 2QDBA 3P42A 4AQ7A 5IKCM 1Q0WB 3DQVA 2WV6D 4X62L 3BINA 4A76A 3PZ7A 3CCRA 4R4QA 4LF5L 1H9RA 2HHHL 2C7HA 3UDGA 1QLBB 1C4AA 4K3CA 3E9HA 1UAPA 5CX3A 1PYSB 1BCPD 2DY8A 4KHVA 5HHDG 4EKUA 3ZNID 2A6ED 4DNTB 5C3EB 2W3SA 2L55A 1TXYA 3L13A 1BOSA 2NTSA 3FRPB 2RBMA 4A3IH 4FF3A 3AM9A 4NNJB 1STAA 2HJ1A 3C0RB 4N9PA 3AN1A 3W1GA 2FMCA 2JE6I 1HNWL 3B2FA 2XNAC 2GBMA 1GPXA 2UU9L 2F0SA 5IWAL 3ULJA 2JRHA 2VQEL 1DCZA 3M63B 2AUJD 1ZYRD 3WOEA 2QEXA 2KQSA 4IPHA 1S5ED 1LTBD 2JA6G 3AYHB 1TR5A 1DZ1A 4AJWA 2G4DB 4W9DA 1Q1EA 2UYZB 5JPMC 4BKSA 2J0JA 4NY0A 3VFKA 3UDXA 4F88A 2YTVA 1ENFA 2BDOA 4RFBA 2VNUD 2KKCA 2X69A 3PRZA 3QA8A 4PMBA 5KNCA 4ZHOA 5C4JB 3IKJA 4TQUS 2K5WA 4A3EH 2Q8TA 1MI0A 3KDFB 1YX6B 1BBUA 1TWCH 2HUGA 5ELNA 2MBBB 1MHWC 2LXCA 3NVVA 2K04A 1OFFA 4G0NB 4EEWA 1BQQT 3C8YA 4HPMB 2BW2A 1C8CA 5A2QE 5AUKA 1HE8A 2Z0SA 1TJEA 2LXKA 4BY1H 1EU3A 4EGVA 1OQQA 3CCMA 4DR5Q 4K0KL 2K5QA 3D6CA 5CV7A 3RZWC 4B3MQ 1UD7A 3R7QA 1PTOB 3HOVH 4A3GH 2SNSA 4L5QA 2K52A 2EXDA 4WJPA 4A93G 4K7SA 1E0BA 3PUWA 4WJOA 1X1MA 4P7IA 3H7PB 2WAQG 5BMGA 3OTOQ 2KO3A 2UXCL 1ENAA 3HOXG 5H1SE 1L6VA 2O5IC 1HZBA 1E8WA 1OQRA 1HFGA 1XNQQ 2D3GA 4X3SA 2AYOB 4B6WA 2IX1A 3S1MH 3MC0B 3E5SA 3ZTDA 1TKYA 2F4IA 2I38A 4XT3B 4OWXB 4Q0FA 1JQYD 1UE7A 3CF6E 2D0OA 4JI7Q 3F2UA 4JYAQ 2NBVB 1BMLC 2IO0B 2ZVNA 3B6YA 2XGTA 1WTQA 2LHDA 3PIP3 4DUZQ 5IODA 3PZ8A 2RSOA 4RGOS 1LT6D 1T0SC 3BZKA 2LXAA 2D5GA 5L95C 3ABVB 2EYOA 1YJNA 2XEWA 3H91A 4Y7NB 3OW7A 2KCNA 4MEMA 4M8MA 4NQKE 5G55A 1E8XA 2M56B 1PTOH 4LF4Q 1G6JA 3E9SA 2B2UA 4I6PA 5CHWA 2M0AA 3FPUB 2ZJQA 1D5ZC 3DXJC 3W1SA 4A3GG 4NDXA 2UUCL 1PV4A 4WQOB 3Q22A 5KYIA 1EIFA 1TKGA 2JA5G 3J7AF 1WR6E 3CCJA 3UQAA 1MG4A 2KHJA 2VH2A 3GTGB 1CQFA 1NBFC 5J17A 2QCZA 3I91A 2ZJDA 4KSLC 1E7ZA 2NVUI 1TWCB 2V3SA 2ZW0A 3Q3JA 5M5YH 4NJCA 3M9BA 4M8AA 4MJSB 1MI2A 1L1OC 1C48A 1UUPA 5AZHA 2BH8A 2WX1A 2CHWA 4IM3A 4JBKA 2ZVOA 3HRZC 3ETRA 4LNNA 3ULPA 2RMMA 1NENB 4HIOA 3CC2A 2GLSA 2BCOA 5E3FA 2PNHA 2AEHA 1SLJA 2B8GA 2BYVE 5FJ8G 1I3QB 1SB3C 1UBQA 2J0MA 2NYZD 4DFAA 3DVNU 2CKHB 3WOFA 5IGDA 2R2QA 3NENA 2WDTB 2F0WA 1KHIA 2XN9C 4R4TA 1N36Q 3SD5A 3PO2G 1MJCA 4OZAA 1QNUA 1NCVA 4KMUC 3J80E 1R4QB 1NNXA 1X3EA 2IY0B 2MJDA 1XT9B 3DBHI 1FGBD 2WXRA 3NTHA 3PTFC 4DHJD 4E3CA 1N5XA 4LFCL 4LFAL 4DWFA 3EA6A 2PYKA 3ND9A 2H88B 1IL8A 2JT4B 2LVOA 1F2MA 5M3FG 1EF5A 2W82A 3N1ZC 1E90A 4A3IB 5L37A 4CYEA 1ILQA 4JI8L 1RF2D 4DK3C 1GHJA 2NVTH 4KHPL 4GN1A 4ARIA 3S14H 2EJGC 2JWZA 4DR1Q 5D7GA 4ZK9B 5JOBA 1NR2A 2WS3B 3PREA 1AYFA 1PH9A 1IL2A 5G3LF 2X6GA 2K03A 1YHQA 2F0DA 2BTEA 2WXFA 1PZID 2F0FA 4JV5Q 4LF7L 5DPRA 3HHMA 1H9SB 1EU4A 5I2YA 4RGMA 4EFOA 1OTCA 3GTLH 3IL8A 3L08A 1I4HA 4MIUA 3NZ3A 2GI9A 4DU9A 5GMVA 2EY5A 2KFKB 3MJWA 4AUQC 4WWNA 3SHQA 1TWAB 3MWYW 1MG8A 1LTGD 2M4NA 3MTSA 1F2YA 3CCUA 1N32L 2KACA 3J81j 3HOUG 4DGZA 1WX7A 3KF8B 4ICVA 3ERSX 5IGGA 2Y5PA 4OZBA 3V61A 2Q2UA 5E6PA 4LWCA 1WFQA 3T3OA 4ID6A 3LDZE 2LGSA 2HHHQ 2K1BA 3TJPA 4N59A 3H15A 2FIDA 3FC4A 3L17A 2LJ5A 3OJ4B 2B3AA 2RR9A 3M4YA 4FYDA 2Q2HA 3IXSA 1F2ZA 2MQJA 4A6QA 3PT2B 3I73A 1TKWB 2DZKA 3IFTA 4I7ZC 2FBWB 1S3SG 3JAMi 2LSSA 3FILA 3Q0AA 3PO3H 2JUOA 1UWMA 2LZ6A 1VDZA 5LMNL 2JX5A 5ELBA 4C2MH 4R8IA 1N60A 2O6VD 3Q8BA 1GM5A 3Q6BA 2F0IA 2KJ6A 1WD0A 2H4OA 2K33A 4ME3A 3FPPA 1RL2A 1SMYC 3V2TA 4USAA 1D2BA 3WDNA 5ELEA 2R93B 4KKJA 3AU7A 1CFMA 4BBSH 2JZZA 2WQYB 3ZUNA 2JEAI 2FHTA 4NZLB 1E2WA 2K5PA 1PTOD 1XF5L 4KDIC 1WTPA 3DHIC 2N9LA 1PFBA 1GO3E 5C6AA 2UU7A 1CM9A 1OGWA 3DBSA 5IP4D 1SNOA 2UXDL 2BQQA 4BKGA 4JG2A 2HQEA 2ZJPA 3IG3A 2YU9H 3RNAC 3APFA 3RN5A 2FCMA 3MXPA 1PYBA 4JI6L 2EMTA 1I35A 1B1ZA 2O4XA 2ATWA 1G2SA 1EIHA 4HCNB 2SEBD 3K81C 2YV5A 2KQ3A 4FXKC 2BYEA 2XRSD 2MHVA 3MXGA 4CDFC 3J81E 2OCEA 1IBLL 1RM6C 4DR7L 4WJ3M 4AS1A 5IGBA 1YD8U 3H3VI 3CXCA 3AE2B 1HZ5A 4FJVB 3KW5B 1I94Q 2FIFA 1PH1A 3GTKB 2EXZA 2E76C 1QT9A 4ZHPA 3ZDMC 1SYEA 1JWAD 3DVGX 1YZ6A 4EX5A 2WXGA 3RZDB 2K6DB 2J42A 5J1ZA 1ACCA 3E0EA 1KLVA 3X0WA 2WHIA 1F2RC 5FLMH 3DBLI 4K7UA 2NVYB 4PQXA 3MFGA 4JI7L 4A3BH 3S2DB 1E7PB 2F0NA 2IYDB 2BS2B 3HS0C 4GKKQ 4JWSC 4IO9A 3ER0A 4W9IA 3OMGA 4ZYSA 1KRSA 2O5JC 3OPOA 4Z9CB 1AZQA 2OEOA 1WD1A 3MFYA 2M19A 2HT1A 2AUKA 2V1YA 1M1KC 1GUSA 3U50C 1CSQA 3CMEA 1Q81C 3S14B 2KWUB 3TUOA 2Y3AA 2QDLA 1EY9A 3DM1A 1O7LA 2ZXOA 2RSUA 1YI2A 2JJQA 2DYMA 2KT7A 3EUB2 1HFNA 4PMWA 1PFDA 2UXDQ 3WIMA 2DY7A 4S17A 5FR6A 3NEMA 4LFBL 2YU9B 3GTMH 1E22A 1FR3A 1VQOA 2JEBI 1YVCA 3FHWA 3KFUA 4WJ4A 2KMMA 2PMVA 4YTNB 1I4XA 2VZKB 3J7YW 2DZMA 3CF5A 1L5PA 5CV4A 5M3MH 5C4XG 3VAWA 1DOKA 4FVMA 3A7LA 5FLXE 4AYBE 2VUMH 4DR6L 3BYTB 4K1RB 3M7NA 1RKNA 3DEPA 4RCOA 4J6HA 4KN4C 4CDDC 1I6HB 1FFVA 1QOGA 1XEEA 4KIKB 1UE6A 1DYQA 1VQFA 5CC4A 1Q86C 3KYCD 1KIXA 4RH6A 4JI3L 5E4WC 4IUMB 3MEFA 2EYMA 3GQBA 4NAWA 4ZRPA 1K8MA 3MEHA 1TTNA 3EROA 4DXFA 4QIWE 3D3RA 5G5GA 3WANA 3GZNI 5CHVC 2JPHA 3HVDA 4FA6A 2LMCA 5HFYA 3RNUA 4POGA 2JYOA 1WX8A 1XO3A 4KD4A 2OT2A 1FXIA 1FVIA 2AQ2B 4L63B 4WWPA 2Z6KC 1WH3A 1XNQL 1V86A 4X6AH 4ZOHC 1V43A 1NUCA 5FO7B 3CPWA 1HR0Q 2WXHA 3M7GA 3M85A 1VF5C 1FPYA 2MBOA 1BO0A 4DA2A 1H8CA 4H0LC 2EKIA 4QIWB 3P4SB 4EQOA 3R7RA 4DR6Q 4HROA 3P7JA 3PV0A 2JSOA 3NHHA 5M9OA 4DUYL 4A3FB 1S72A 4KV2A 5J2RA 2JA8B 2FJ2A 3HOUB 3M4PA 3K0XA 2UXCQ 2KANA 3CSTA 2I1KA 3SEBA 1J8CA 3SFDB 2K8HA 3Q8FA 4R3DA 3SDZA 1XPRA 3G48A 2RHQB 2E5LL 1KXLA 4J3OD 4DXAB 2X6LA 2SNMA 4XWWA 1TWHH 4IN3A 4DV3Q 4LF4L 1ASZA 4A3BB 1J5EL 2HE7A 1JE5A 1JMLA 3C19A 3QCAA 4HPLB 3NZSA 1RHPA 3S17H 1XXGA 1D1KA 2KCMA 1S3OA 4DR4Q 1G6ZA 1AWDA 1RWSA 1TIFA 5FJ8H 1EUVB 2OTJA 4DAVA 3IAS1 3TZUA 3N52A 3ZXRA 5D65A 2Q8IB 4YHHQ 4AYBG 2EE1A 4Q2JA 5JAVA 2O2VB 3PUZA 1V8QA 1WXVA 4ME5A 2DAJA 1FFUA 3HK0A 1EEFD 3AB9A 1E2VA 1HR0L 4XDDA 3UQBA 1L2NA 1G51A 1MJDA 1AP0A 3I57A 1ROEA 1W2BA 2IO1B 3S1RH 4KVGB 2KDFB 2WWZA 4BBRH 2QSDA 5IOCA 5JXVA 1PZKD 1DOXA 1AW7A 3Q14C 3S15B 2UUCQ 1PUTA 1S1QB 3S9WA 3HM6X 5AJ3Q 4A93H 4YT0B 4B08A 4MZ9A 2KTRA 2D07B 3JVZX 4EUTA 1ZP0B 2K14A 3U58A 1PGBA 4ANXA 2C5CA 5M5XB 5KEEA 2JSVX 1O7YA 2WFWA 4I7AA 4P74A 1J7CA 4DV4Q 1W3SA 1D7QA 1HNWQ 3R8BA 4GNXA 3HKZB 1PH4A 1G6PA 3NWSA 1WWTA 3X23A 2UU9Q 5ISRA 2KJRA 4RF1A 3LNNA 4RNAA 1DGSA 4HDOA 1N63A 1VMCA 1QB5D 4OELB 4GOPB 5L83A 2F0VA 5DCNA 3VRAB 4BFRA 4HTHA 1K3BC 3QAQA 4O42A 2NZ1D 3Q8DA 3K8AA 1P1AA 4FJYA 2IGGA 4PZ6A 3HKZE 2PMZB 4C56C 3Q24A 2GN5A 2CWAA 3I5JC 1AE3A 2HIVA 4LNFA 4MJSA 4M00A 4K81A 4JV5L 1UE1A 2LHEA 5KNDA 4ZRKA 1A5RA 3RZOB 3PS6A 1PGAA 5G5HA 2MX2A 1XMQQ 4AP4C 3OIPA 3J9CA 2L05A 2CCZA 4JI8Q 4KHPQ 3AH7A 1CKNA 4JPBW 4HJ5A 4RF0A 4PV1C 1I50B 2R7ZH 5GQOA 4AH6A 2JQRB 1HZCA 4A3JG 2WX0A 4IUQA 4YL8A 3PIO3 3CWIA 1N34Q 1YIWA 3UINB 2A68C 3FKIG 4ZRIA 1QVGA 1X3GA 1YHBA 4DV1L 3HOUH 4CJ1B 3D32A 5C3JB 3N9YC 2PNRC 2OHFA 4CKBA 3ALBA 3AE6B 3P20A 2JA8H 4US9A 1QE6A 1YEZA 2PIAA 1JJCB 4DV6L 3AB5A 4A3DG 2MQHA 3TEWA 1L1OA 4V0BA 2ONQA 4ZRQA 1GUWA 5JEAG 3H1UA 1EUJA 4WH4A 4W9FA 4B3ML 4C00A 3Q3MC 4DV4L 2CU1A 5IP9H 2F0HA 1ZUD2 3I8ZA 3HOVB 2DJFC 3O65B 2FNJB 2L1AA 3ZJYC 3J7A5 2HCCA 4PK1A 1UWVA 2KVRA 2A74C 2ZW1A 4B3TL 3ITPA 4R9WA 3AEDB 1HA6A 5DNFA 2W3RA 1BR9A 2ZTDA 1QG7A 3CCVA 4A3MG 1U9RA 3DCGA 4OVZA 3DVNV 4A3CH 2A19A 3F2DA 5LMUL 2KDMA 3FAHA 1CMXB 3MJ5A 1IP9A 3K58A 4XYOA 3A56A 3RNFC 2LJIA 4ACFA 5JVG3 4IUTA 1EYDA 4A3EB 4XQJA 1OO9B 5IT9E 3GTJB 2BF8B 1D1IA 2G45B 4MM3A 5C2TB 2PMZE 3WA0A 2JK8A 4J15A 2WACA 4G3XB 1F52A 5C4XH 1L2FA 5EE3A 2DZJA 4R4IA 1B3QA 5EBDA 4BA2I 4BBNC 2EVBA 1L0WA 4WWOA 1FYCA 2Y0SG 3GE8C 1A3TA 1HTLD 2DNCA 5EPKA 2KK8A 3U4ZA 4QUFA 5JEAH 3NQIA 4QQBX 3T8MA 2VW9A 3W1YA 3SE0A 1GB4A 2WAQE 3NSWA 5LL6S 4JI0Q 1NE3A 3ZKJC 1AARA 2NUCA 1UEBA 4DK0A 2K5NA 5FOBB 1KQSA 1EYCA 1UELA 4LNOA 3ZIMA 5D6JB 4YWLA 2BA0A 4DR2Q 3B0AA 3Q6SA 1IW7D 3SVMA 4A3FH 5M5YB 1ZW7A 4JX1C 1EQVA 4OGQC 3PZDA 4PYUA 5FR3A 5LNK1 1NY4A 2FUHB 4AIMA 1MD2D 4X65L 1WIAA 3NK9A 2SAKA 3U2SC 4FF4A 1BUIC 4HIMA 1R9TB 1M94A 1TZ1A 2DHZA 2HQLA 4A3KH 3TEHB 3Q23A 4ANWA 2NN6G 4DV3L 2WGSA 4ZQ3A 5K36H 2DENB 4LJPB 2C9WB 1R4MB 4DR7Q 3QC8B 4PG3A 2VQEQ 3MA2B 1OEYJ 3IFDA 1FEHA 1Q82C 2F0LA 2RHSB 2ON8A 4DKAC 1EQRA 1SYBA 4BS9A 3T4AC 1QJOA
chains in the Genus database with same CATH topology
3SK4A 4OO1G 2JXTA 2IGDA 2KQ4X 5AFWA 4KX6B 2N0SB 4K5VA 2B63B 4KY6A 2A73B 1STGA 1RYJA 3K59A 2CVRA 1FMAD 2R92B 2VUMB 2F3WA 2WP9B 2BS3B 1Y1WB 1VZ8A 3H09A 4K2KA 1WRIA 1X32A 3TZDA 1FNUA 4HCSA 4CKEA 1BBXC 4N9TA 1VLBA 3I3CA 3GTMB 1Q1BA 3CQZB 2RPVA 5C0XH 4K6DA 2N7JA 3MAQA 3VR6A 5C3XA 1YMHE 1YNTE 2LFNA 1Q8IA 1WSPA 1ZXTA 4K14A 5ELFA 1SMYD 2QJLA 4IUVA 1CZWA 2IW3A 4WORA 3HRDD 4G57A 4JWUC 3PUVA 4IFDG 2QCPX 1EWYC 3A7AB 3R2IA 1CK1A 3M4OB 3AE4B 2Z1CA 2N55A 2QILA 2IL8A 2IX3A 3PUXA 5KRUA 1SNPA 1E6EB 5C4HA 1KNEA 2FE8A 3KBXA 1F9SA 3KLSA 1FD6A 2E74C 1D4BA 3QOJA 4AYBB 4XQNA 4V190 1EOTA 4KGSA 3BVZA 3I72A 1Y1VB 1JOQA 4F7XA 3MHZA 3LWUA 3QG1A 4DK1A 1EY8A 1MHHE 1XWEA 3U9OA 5T8IA 1AFPA 3E6ZX 3WCQA 1AZPA 4GDKB 3I9V1 3SXHA 3QOLA 3X3MA 3BVGA 1C4QA 3R2TA 3ZYYX 3AECB 3AE9B 1P7FA 2JA7B 1DM0B 4K8JA 1P7EA 1EWCA 1KDBA 2BDNA 5JPNC 4CGYB 2RSNA 3K57A 1J7BA 2PKOA 1ZKOA 1KTKA 2AQ1B 5IGFA 1RJTA 2PW9A 4ZUIA 2HTME 1NI3A 2J4XA 2BS4B 1EFID 4YSXB 1FIQA 2NWGA 1G2TA 4KV6A 1KLUD 4OHJA 1VR9A 3AEFB 3H6MA 3AV8A 2N9KA 1YNNC 1H9MA 1TS2A 2K3UA 4A3JB 2IT1A 4A55A 1TWFB 3HOWB 3VR2A 2JU6X 4GLSC 1JR0D 1I4GA 3AEEB 2CJNA 5F2DA 2FMMA 3NRZA 4WAFA 1RD9D 1CHPD 1A2TA 1D5XC 5J39A 5HI1A 2VB2X 1CHQD 1PRTB 1VDVA 3VRBB 1H9SA 4FF1A 1J8IA 5BMIA 4EQNA 3NP8A 2J7ZA 4A9AA 3FDTA 5IGCA 3EJIA 1S4ZA 3I4LA 4J8QA 1EEID 2XSCA 2INNE 2VZKD 1EY5A 1JORA 5EKIA 2LFIA 4DXGA 3G6JB 1ZE3D 4XWTA 2D62A 4IDIA 1SXTA 3ZQ4A 1FXAA 2PW7A 2PZTA 1TS4A 3RFZB 3D4WA 1I4PA 1ICWA 1K52A 4WFN3 5M3FB 1ZDXA 4NW2A 1GUGA 1CI3M 4G4KA 3DWPA 1XCTL 5JJZA 1IBXB 4ARCA 3BS1A 1OXUA 1HXYD 1GJXA 2XVSA 4TMAB 3BG3A 3MVVA 2WXMA 4KJNA 2PCFB 2F03A 3MHBA 2PTLA 2B2VC 5EKKA 1NR4A 2KEEA 1YNND 2M2LA 4K5XA 3TSSA 1PDXA 2MP1A 1MSHA 1A6XA 2EYFA 2KJXA 4GDLB 1LV9A 2PW5A 5EGTA 3URYA 4C1NI 2B2VA 1LT3D 3LXFA 1IGCA 4C7YA 1W6KA 1L0VB 4CBVA 3RMHA 2K05A 4MH8A 1FCCC 1UWXA 1IKLA 1WGKA 4HAEA 4PMCA 3GO5A 2BB6A 4MM3B 1II3A 2Y5CA 2BA1A 1YJJA 1TT2A 5HGTA 2L83A 1MVKA 4X3KA 2K5DA 3KWVA 1KH0A 3NVYA 5KNBA 3B9JA 4HSPA 4HRSA 1NSNS 1XLOA 2F3VA 3K7AB 4NKLA 1VF7A 1D5MC 1WTWA 5EPJA 4CKCA 4CJ2C 1AN8A 1R4PB 3J80L 2DBYA 1Y8NB 1HQRD 2BYTA 2JP1A 3D8GA 5FLXL 2Z8LA 2CJOA 1RDPD 4REZA 3SFEB 5KYLA 1O80A 1HCZA 4IFDI 1KNAA 3A8IE 4C7ZA 3FEWX 3AE7B 1PRTF 3NWTA 1SYFA 1F9RA 3BDOA 4KN7C 1UEAB 3QWNA 1K51A 4L2YA 5DM73 4C3IG 2MEKA 3VA7A 1OXVA 1E2ZA 2KA7A 2C9OA 4YWGG 2MJEA 1A3VA 1JWUD 2RDHA 4CJ0B 3AE8B 2PQEA 2G9DA 4KKIA 2NN6H 1B9NA 2ZXRA 4BBSB 1U4PA 2ICIA 3OSOA 4DF7A 4OO1I 4WIPA 2TMPA 1V1OA 4ZLTF 3P4PB 4YIJA 1NVID 1NYQA 5COYA 3HOXB 1KFYB 1LACA 3W2DA 1EY6A 2WLBA 3W9CB 4KTAA 1F9QA 5CR3A 2PPBC 2WU5B 1TIID 3GP7A 1BF4A 3IAM1 3S1QB 1BNZA 2WP8J 1IBXA 4LAAA 4NMZA 5G3LD 4PT5A 1EZ8A 4L23A 4HMIA 2JYEA 4CQNA 1R7SA 3CU7A 2L4NA 4HSVA 3PMFA 1YJIA 3QO2A 4NAMA 4C3JG 1WTXA 2R7ZB 5CV9A 3KUPA 1A70A 3FMCA 2A5HA 4MACA 1DGJA 1L4ZB 3TN2A 4O1NA 4TQ1A 2BE5C 3I70A 1Y69U 3BYYB 2RDGA 2ACZB 3ERQA 2I07B 3DUZA 3D4DA 2JXMB 1E9MA 3VYUA 2V3NA 2ZT9C 1FRRA 1TS3A 3CRKC 1IYVA 1ZXHA 2WDVB 3KQ4A 3MZ5A 3V3XA 5GXGB 1L4DB 3O13A 1Y56A 4B9XA 3MP9A 2EY1A 2V4DA 3NVZA 2WXQA 3NUHB 3LX0A 4IFDJ 2KVMA 5I9OA 4ULLA 2QEJC 4MT5A 1HZ6A 3K5MA 5M3MB 5CBEE 4M0WA 5BYSA 5K5PA 3S1NB 1F2RI 1FM0D 5EE0A 1CTMA 1IHZA 2WINB 1MGSA 4EQPA 2B8FA 4KK7A 1FNVA 5T1GA 3TP7A 4HR7B 3H94A 2KEDA 3LB8C 5FKAC 4H2AA 4F8MA 1STEA 3Q8EA 1SIJA 1SNCA 2A69C 4KY7A 4BY7B 3BK2A 2LGIA 3I90A 3U52E 1KDCA 4OIKA 2AQ3B 3NS1A 2B2WC 5I6WA 3QIAA 4H7BA 4MHEA 4EE2A 1PFNA 4DN4M 4RGTA 3AEGB 3EGRA 4HKZE 2W54A 1WVLA 1FNWA 2YYZA 4HMJA 1QOHA 2EY6A 4X3TA 2SDFA 2WIIB 2QKIC 3UI2A 4DNRB 5LL6X 4HJGE 2KUMA 5CMDA 5C4ZA 1GB1A 3L3OC 1V1PA 1YN3A 4JK1C 4C3IB 2BBCA 3A8KE 1E0ZA 1TQOA 1IGDA 3RPFC 3A8JE 2V4IB 1IKMA 3EVQA 1CA5A 1QQRA 4XQQA 3K0YA 4BWGB 1DOMA 3VR3A 2B2YC 2XRQD 3GV6A 4DQOC 3P63A 1UGJA 1H9JA 5CBAE 4C2MB 4IQZA 1EY0A 5CV8A 4ABNA 5FO9B 2XIWA 1JOOA 2WXJA 1CT1D 1DJRD 4QUCA 4C80A 2NMQA 1S5BD 4A93B 1EY4A 4C1NK 4DAYA 1U4RA 2VXWA 1JOKA 2L1BA 2WAQB 1RFKA 1K53A 4WWMA 3P1HA 4HEA1 2KHSA 3NBHA 1D6EC 1QKZA 3BK1A 4TKOB 3DWMA 1TY2A 1N61A 2J52A 2EJMA 2E3TA 3GD7A 4WJWA 1ZEQX 3GTQB 5H92C 3ZGZA 2EOTA 4OW0A 1ZOYB 1HRJA 2KN4A 3J7AV 3GTLB 5DM63 2J0TD 1LTRD 3W5VB 3GV3A 2PVOD 3T51B 4BY1B 1SYGA 4KKSA 1SJED 1XCQL 2FUG1 3I4MB 3L4PA 3SK8A 2R61A 3TEXA 3S1MB 3DWQA 2Z4HA 4C3HB 2NVTB 2LUMA 1GHKA 4H44C 3C2PA 3TP6A 3LWEA 1QOAA 2INPE 2F0MA 2GA4B 4KGRA 4UAIA 1GUNA 5ELCA 3HOYB 3SHLA 4YSYB 1VZ6A 3TBIB 3DHQA 2B2TA 1SJHD 3VYSA 2VB3X 3HP3A 2QIEB 3OWEB 1PTOF 4X3UA 1MBYA 5BYRA 2KAJA 3S1RB 2EY2A 1CA6A 1B4OA 4I65A 2B39A 2E2DC 1U4LA 4B0EA 4IZ8A 2BT6A 3CKIB 1KABA 1B9MA 3U4EG 1BCPC 3SR1A 3HVZA 2EYHA 2JYTA 5C5MA 4KKUA 1PDQA 1Z47A 3SR6A 3ZJUA 4U68A 2F0TA 4ILWA 4H13C 2K32A 3CRLC 1PYWD 3HZXA 4JBWA 4P16A 4FXDA 2EZVA 2F0JA 3VR8B 1A15A 3N6RA 4E6IA 1J9OA 1FCLA 1EZ6A 1JC7A 4FNFA 1T5XD 4R8NA 1YQ3B 1PTOC 2WNMA 1SE2A 2A68D 1XYIA 5CV6A 3OWFA 1WTOA 1UNSA 1DXMA 2WU2B 1C76A 2HDMA 1X3PA 2NTTA 1B50A 2AWOA 1BCPF 3S16B 1EQTA 2E2JB 5KIXA 3T16A 1ENCA 2E2IB 1GB4A 1HEZE 1RTOA 1B2TA 1O78A 5HG2A 4S3SA 5D14A 3AE1B 1SNDA 1VZ7A 3P75A 2H1EA 1SDFA 2EYJA 3AEAB 3NPPA 2L12A 5CGKA 4NAWB 4IFDH 3C1EA 5AUIA 1QNKA 5CORA 1JROA 5I6YA 1PMRA 1DONA 3Q69A 1LTID 3R3OA 2LKVA 2R3ZA 3C1FA 3KBGA 1F0ZA 3TEYA 3GTOB 1YQ4B 3TDQA 1C9FA 1JALA 5EPLA 4RAUC 1S5DD 1HPCA 1HUNA 1EIGA 1EM7A 3IT6B 1F9PA 2HDLA 3RD4A 5DEHA 1OXXK 4OO1H 1CQVA 3M3YB 3S17B 1FD7D 3FKIB 3P1MA 3VR5A 5IGEA 2F0EA 1NAPA 4YSZB 3GTPB 5E1FA 4L1BA 1LT4D 2M00A 2PZWA 3NUCA 3OOCA 2RDFA 1Q3LA 4IURA 2AWNA 4G7HC 2DNEA 2F0QA 1B44D 3FVQA 1HTPA 2PLPA 3MXNA 4C3HG 1K50A 5EKLA 5C0XG 4A3MB 4ODGA 2DN8A 1PRTC 1VRAB 1QOBA 4KD3A 3EQLC 4QB4A 1F77A 4IUNA 2IJ0A 2GRIA 3BVMA 5C4XB 1CJEA 2R6GA 5D3DA 1QOFA 3AE5B 1T6BX 1L0YB 2K01A 1PFMA 4RHRA 1XLNA 2Y0SB 2H89B 2OEDA 3KF8A 3OHXC 3NE5B 4HN7A 1G91A 1TYGB 1LTTD 1B9RA 4KGTA 2NB0A 5C5LA 3A54A 2IX0A 3NXWA 3D6WA 1FO4A 5JVH3 3U9SA 1GUOA 2PZUA 1M8AA 5IT9L 2WXIA 4J1MA 4M1UB 4OZCA 1V97A 4QF4A 4ZKBB 1EWHA 4G7OC 4TRDA 3LYYA 4K5WA 4KJOA 3X3NA 2J53A 1K8OA 3KLSX 3T56B 1OXTA 3BWUD 1C78A 4IUPA 3ND8A 3P4RB 4RHSA 4YTPB 3W5UB 3NTKA 3DEOA 5I2XA 2F1MA 3PUYA 3HG9A 1KDAA 2A6HC 3JAME 3HGBA 1Y8OB 2KECA 1ONLA 1PXUA 4IOIE 5KGUA 3QB3A 2PO4A 2EYPA 2A6EC 4QMGA 3VYRA 1B3AA 3T53B 4K2LA 1XLQA 2BB5A 3HEJA 1KLGD 3RLFA 1TWGB 2WDRB 1Z6HA 1W6JA 2CU3A 2PVGC 1GUTA 1ESFA 2ICEC 2L11A 3NQTA 3SK5A 2A6HD 3VQIA 1Y8PB 1TKEA 4OIJA 1SSOA 1WXQA 5CYUA 3ONAB 2DWQA 1U4MA 4IUUA 4P2CB 3K5NA 2B2YA 2FFKB 3QJYA 4MN3A 2I2YA 1G291 1M4VA 3AE3B 1PLFA 1X3QA 2SOBA 5C0XJ 1GAQB 1A3UA 1SFOB 3H0GB 1JWMD 3TP8A 5H8YE 2RA4A 1V1PB 1DOLA 4N6EB 2GB1A 1STNA 1L0XB 5FO8B 2F0UA 2QMTA 1Q12A 2EDGA 2L5TA 5BN5A 5BN4A 2OF1A 3Q8CA 1WTVA 1ESRA 1ZDVA 3CIRB 1BXTA 2A69D 4XDCA 4ZAIA 2MGSA 3G7LA 4LK0M 1SE3A 2X38A 2XWBB 5ELDA 1F2LA 2B76B 4F87A 4WURA 1Q90A 2Q8RE 2MH7A 1WCMB 4BA1I 3NBIA 2L32A 2JWUA 3TP5A 2N88A 4FF2A 1C4PA 1T5EA 4HKQA 3IAYA 4UDUC 5CV5A 1TVXA 5E4XA 2K6AA 5NUCA 2YEPB 1A2UA 5BYQA 4XTCS 1OXSC 1JICA 4TQ0A 4RCNA 1T3QA 1QCBD 1I7HA 4U673 3IT4B 2LMCB 5J22A 1QILA 1SAPA 4LK1C 2B2TC 1E10A 3DMUA 2MPMA 5K36G 3T3NA 3ZJVA 2E75C 1JRPA 2IGHA 2QF7A 4PNYA 2ENBA 3BZDB 1KAAA 4B9WA 2F0KA 2Q5WD 3E0JA 4LLGM 1SNMA 2CW0D 4YTMB 2KOLA 3KK7A 4RKBA 4XYQA 3V96A 3VR9B 1SYCA 3P4QB 1SNQA 5I4DA 4XXEA 2L52A 3VYTA 3CHBD 1H9KA 2HCIA 1SF0A 1HHVA 1B53A 5LHY1 3GB1A 1DOIA 1QF6A 4A90A 2WXLA 3R93A 1TY0A 1O7ZA 3DWGC 3KWLA 4RKLA 3GS2A 1TWHB 1PZJD 2MJ8A 1XTCD 2MUYA 3AMUA 3BDLA 1I4RA 2EJFC 1SSNA 3KLRA 1ILPA 4OL7A 5HURA 4Q5VA 4CHTB 1MSGA 1AEXA 1G8ZD 1LABA 2G9HD 2WB1B 3S2HB 1GXDC 3TMEA 2KWDA 1SYDA 1IYUA 1YN4A 3J81L 1WTRA 2CQAA 2B2UC 1S5FD 2WKDA 1SE4A 2KCCA 5C3WA 5M5WB 4BBRB 4WRDA 1MHXA 2WXNA 4WQMA 4NP5A 1RTNA 2Z4IA 1V8CA 2E6XA 4B0MA 1BCPB 1EYAA 3Q8AA 3C46A 4KI0A 2WKCA 2NN6I 1I6VC 5JEAJ 3JAML 3PO3B 2BE5D 3FILB 1RCVD 4EVOA 2CW0C 2LY7A 1ML0D 2L0CA 5A2QL 1IW7C 4XDXA 2EELA 1JCKB 3BDCA 4G7ZC 2F0GA 3E56A 1ZPSA 3HUIA 4GZYC 2JA6B 2WDQB 2OXPA 2ZXPA 3D4RA 2YEPF 1HUMA 4IALA 4TSSA 5D3IB 2D2CC 1SEBD 2DLBA 1N62A 1VCIA 4LTUA 1PGXA 2RKSA 1IUEA 2L9HA 5T1IA 1GOZA 2K22A 3ZJTA 1RODA 1BUVT 1ZXIA 1YNJD 3OMCA 5IIFA 2K0PA 5BMHA 1FRDA 2F0PA 2IWHA 4K6LA 1LTAD 1KF6B 4QCLA 2F0OA 2XWJB 3B2GA 4DAPA 1J7AA 4FXGC 2V3PA 5EE1A 3PO0A 4HCEA 3I4NB 2G1EA 1DOYA 4FXCA 2RQXA 4XIGS 1QWYA 3VA5A 2FINB 1VJKA 1HQMC 4JPSA 1XX8A 5C0XI 1EY7A 2RVLA 1JWBD 1XLPA 2LEKA 4RWSC 3L9AX 5FK9C 3K5LA 3OIQA 1KRHA 4A8XC 2B2WA 1HA5A 2BOSA 2NVXB 2AX5A 2M9VA 2LS01 4FP5D 1LTSD 3TEZA 4XE0A 3D31A 4ZKCB 4P6VF 2NVQB 4A3DB 2D5DA 2TSSA 4RGNA 1S5CD 2W55A 2JA5B 1STYA 4L8JA 1JQ4A 2NBFA 4XT1B 3K5OA 1CZGA 2IDYA 5MPOA 1L6UA 2D9UA 5I9PA 1LO5D 2V0GA 4D2KA 3EFXD 5DAUA 4FO2A 4ITKA 2JZPA 3AEBB 2ID0A 2E2HB 1LT5D 1NEKB 3V05A 4L6TB 4C3JB 2MJ3A 3PO2B 4KHZA 3H3VC 1I4QA 3H8HA 1JB3A 1YNJC 4A3KB 3BIID 3C3LA 5BN3A 1BDOA 2K28A 3A55A 3SK6A 3AMZA 3HOZB 5EBCA 4LMQD 2EPBA 1K83B 1ET9A 1Z7TA 2DYOA 1NYRA 4KKTA 4N58A 2O2LD 4A3GB 5EE9A 1ZYRC 3NTIA 4US8A 5EJWA 2EYLA 1YN5A 1PRTD 3T13A 5EQ0A 3K6OA 4LJZC 4IKGA 1CZPA 3MXUA 1C79A 3UI3A 1C4CA 5C44B 1VMPA 3NVWA 4K8IA 2WXKA 2CHBD 1N5WA 4YXDB 3RUZA 1STBA 1JW9D 3VR4A 3DWAA 3U7ZA 1STHA 4HEDA 1Q10A 1SBBB 1DD2A 1TS5A 2WXPA 3W3AA 4JE3B 1EL0A 4ZRZA 5E6JA 1JE4A 5A35A 1TU2B 4RA8A 2HDEA 5TSSA 1LLRD 1JWSD 2I46A 4KY5A 2K9XA 2IPKD 1C77A 4ZUJA 2K7VA 3L7ZC 1ET6A 2WXOA 1MPEA 3P42A 2QDBA 4AQ7A 2WV6D 3PZ7A 1H9RA 1QLBB 1C4AA 1UAPA 4KHVA 1BCPD 2DY8A 5HHDG 2A6ED 4DNTB 5C3EB 2W3SA 2L55A 1BOSA 2NTSA 3FRPB 2RBMA 4FF3A 3AM9A 1STAA 4N9PA 3AN1A 2FMCA 2JE6I 3B2FA 2XNAC 1GPXA 2F0SA 1DCZA 2AUJD 1ZYRD 3WOEA 1S5ED 1LTBD 1TR5A 1DZ1A 1Q1EA 5JPMC 4F88A 1ENFA 2BDOA 4RFBA 2VNUD 2X69A 4PMBA 5KNCA 4ZHOA 5C4JB 3IKJA 4TQUS 2K5WA 2Q8TA 1MI0A 3NVVA 2HUGA 2K04A 1OFFA 1BQQT 3C8YA 2BW2A 1C8CA 5A2QE 5AUKA 1TJEA 1EU3A 4EGVA 1OQQA 2K5QA 3D6CA 5CV7A 1PTOB 2SNSA 1E0BA 3PUWA 5BMGA 1ENAA 1L6VA 1OQRA 2O5IC 1HFGA 4X3SA 2IX1A 3MC0B 3E5SA 1TKYA 2F4IA 2I38A 4XT3B 4Q0FA 1JQYD 3F2UA 1BMLC 1WTQA 2LHDA 3PIP3 5IODA 3PZ8A 4RGOS 2RSOA 1LT6D 2D5GA 3ABVB 2EYOA 3H91A 4Y7NB 3OW7A 2KCNA 2M56B 1PTOH 3E9SA 2B2UA 2M0AA 3FPUB 1D5ZC 3DXJC 3W1SA 4NDXA 3Q22A 5KYIA 1TKGA 3J7AF 3GTGB 1CQFA 3I91A 1TWCB 2ZW0A 4NJCA 4M8AA 1MI2A 1C48A 1UUPA 3HRZC 3ETRA 2RMMA 1NENB 2BCOA 5E3FA 2B8GA 1SB3C 1I3QB 2NYZD 4DFAA 3WOFA 5IGDA 2F0WA 2XN9C 4OZAA 1QNUA 1NCVA 4KMUC 3J80E 1R4QB 2MJDA 1FGBD 2WXRA 3NTHA 1N5XA 3EA6A 2PYKA 3ND9A 2H88B 1IL8A 1F2MA 2W82A 4A3IB 1ILQA 1RF2D 4ARIA 1GHJA 2EJGC 5D7GA 4ZK9B 5JOBA 1NR2A 2WS3B 1AYFA 5G3LF 2X6GA 2K03A 2F0DA 2BTEA 2WXFA 1PZID 2F0FA 1H9SB 1EU4A 5I2YA 4RGMA 3IL8A 1I4HA 4MIUA 3NZ3A 2GI9A 4DU9A 2EY5A 1TWAB 3MWYW 1LTGD 3MTSA 1F2YA 2KACA 4DGZA 5IGGA 4OZBA 2Y5PA 3T3OA 4ID6A 2K1BA 4N59A 3FC4A 3M4YA 4FYDA 3IXSA 1F2ZA 4A6QA 3I73A 1TKWB 3IFTA 4I7ZC 2FBWB 3FILA 3Q0AA 1UWMA 1VDZA 2JX5A 5ELBA 4R8IA 1N60A 3Q8BA 2F0IA 1WD0A 2H4OA 2K33A 3FPPA 1SMYC 3V2TA 4USAA 1D2BA 3WDNA 5ELEA 2R93B 4KKJA 3AU7A 1CFMA 2WQYB 2JEAI 2FHTA 4NZLB 1E2WA 2K5PA 1PTOD 1XF5L 1WTPA 2N9LA 1PFBA 5C6AA 1CM9A 1SNOA 2HQEA 3MXPA 1B1ZA 2O4XA 1G2SA 1EIHA 2SEBD 4FXKC 2KQ3A 2XRSD 2MHVA 3MXGA 3J81E 1RM6C 4AS1A 5IGBA 3AE2B 1HZ5A 3GTKB 2EXZA 2E76C 1QT9A 4ZHPA 1SYEA 1JWAD 2WXGA 3RZDB 2J42A 5J1ZA 1ACCA 1F2RC 2NVYB 4PQXA 3MFGA 1E7PB 3S2DB 2F0NA 2BS2B 3HS0C 4JWSC 3OMGA 4ZYSA 2O5JC 3OPOA 4Z9CB 1AZQA 2OEOA 1WD1A 3MFYA 2M19A 2AUKA 1GUSA 3S14B 3TUOA 2Y3AA 1EY9A 3DM1A 1O7LA 2ZXOA 2DYMA 3EUB2 1HFNA 4PMWA 1PFDA 2DY7A 2YU9B 1FR3A 2JEBI 2KMMA 2PMVA 4YTNB 1I4XA 2VZKB 3J7YW 1L5PA 5CV4A 1DOKA 4FVMA 3A7LA 5FLXE 3BYTB 3M7NA 1RKNA 3DEPA 4RCOA 4J6HA 4KN4C 1I6HB 1FFVA 1QOGA 1XEEA 1DYQA 5CC4A 4RH6A 5E4WC 2EYMA 3GQBA 4ZRPA 1K8MA 3MEHA 3EROA 4DXFA 3D3RA 5G5GA 3HVDA 2LMCA 5HFYA 2JYOA 1XO3A 4KD4A 2OT2A 1FXIA 2AQ2B 4L63B 4ZOHC 1V43A 1NUCA 5FO7B 2WXHA 3M7GA 3M85A 1VF5C 1BO0A 4DA2A 4H0LC 2EKIA 4QIWB 3P4SB 4EQOA 4HROA 3P7JA 3PV0A 2JSOA 3NHHA 5M9OA 4A3FB 2JA8B 2FJ2A 3HOUB 3SEBA 3SFDB 4R3DA 3SDZA 4J3OD 2X6LA 2SNMA 4XWWA 4IN3A 4A3BB 1JMLA 1RHPA 1TZOA 1XXGA 1D1KA 1G6ZA 1WYGA 1AWDA 1RWSA 4DAVA 3IAS1 3TZUA 3N52A 5D65A 2Q8IB 2EE1A 4Q2JA 5JAVA 3PUZA 1V8QA 4ME5A 1FFUA 1EEFD 3AB9A 1E2VA 4XDDA 1AP0A 3I57A 1ROEA 2QSDA 5IOCA 5JXVA 1PZKD 1DOXA 1AW7A 3S15B 1PUTA 3S9WA 4YT0B 4B08A 1ZP0B 1PGBA 2C5CA 5M5XB 5KEEA 2JSVX 1O7YA 3Q8FA 1J7CA 3R8BA 3HKZB 1WWTA 3NWSA 5ISRA 4RF1A 3LNNA 4RNAA 1N63A 1VMCA 1QB5D 2F0VA 3VRAB 4HTHA 4O42A 2NZ1D 2IGGA 2PMZB 4C56C 3Q24A 2LHEA 5KNDA 3RZOB 1PGAA 5G5HA 3OIPA 3J9CA 3AH7A 4RF0A 4PV1C 1I50B 2JQRB 4IUQA 3PIO3 3CWIA 2A68C 5C3JB 4CJ1B 3N9YC 2PNRC 2OHFA 4CKBA 3AE6B 3P20A 4US9A 1QE6A 2PIAA 3AB5A 3TEWA 2ONQA 4V0BA 4ZRQA 1GUWA 5JEAG 4WH4A 2F0HA 1ZUD2 3I8ZA 3HOVB 2L1AA 2HCCA 2ZW1A 2A74C 3ITPA 4R9WA 3AEDB 1HA6A 5DNFA 2W3RA 1BR9A 1QG7A 1U9RA