2RDGA

Crystal structure of staphylococcal superantigen-like protein 11 in complex with sialyl lewis x
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
192
structure length
192
Chain Sequence
b'VRSQATQDLSEYYNRPYFDLRNLSGYREGNTVTFINHYQQTDVKLEGKDKDKIKDGNNENLDVFVVREGSGRQADNNSIGGITKTNRTQHIDTVQNVNLLVSKSTGQHTTSVTSTNYSIYKEEISLKELDFKLRKHLIDKHDLYKTEPKDSKIRVTMKNGDFYTFELNKKLQTHRMGDVIDGRNIEKIEVNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superantigen-like protein 11
publication title The crystal structure of staphylococcal superantigen-like protein 11 in complex with sialyl Lewis X reveals the mechanism for cell binding and immune inhibition
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 56
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2007-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2rdgA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2rdgA01
4RGMA 1KLUD 1LT5D 1EEFD 1LT6D 1SJED 2Z8LA 3GP7A 1LTID 1JCKB 2ICIA 1ET6A 1EFID 1RF2D 1JR0D 1JWMD 1I4XA 1I4PA 1TS2A 2RDGA 4Z9CB 1FNUA 1SJHD 1LT3D 5I4DA 1EEID 1SE3A 1V1PB 1S5DD 1D5MC 3R2TA 1PTOH 1AN8A 5ELEA 3CHBD 1BCPD 4RFBA 1S5FD 1ET9A 3BVGA 1JWUD 4OHJA 4DXGA 1SBBB 1JWSD 1B44D 1DJRD 1I4QA 1LO5D 1RDPD 1FNWA 2AQ1B 1TY2A 4UDUC 1QILA 3BYYB 1HTLD 4RHRA 2IPKD 1V1OA 3EFXD 3R2IA 1HXYD 5ELCA 3URYA 1LTSD 1RD9D 4L63B 3MFGA 1DYQA 1LLRD 1LTGD 1S5ED 1YN5A 1PRTC 1PZID 1S5CD 1PRTB 1YN3A 1V1PA 4RHSA 1FGBD 1KTKA 4BWGB 2WV6D 1BCPF 3SEBA 4RH6A 3BYTB 2O2LD 1TS4A 1SXTA 1LTBD 2AQ3B 1CQVA 4K6LA 1UUPA 1FNVA 3V05A 4TSSA 1UNSA 4RCOA 2CHBD 3OWEB 3DWQA 5D3DA 2QILA 2XRQD 1RCVD 1PRTD 2R61A 1SEBD 1S5BD 5ELBA 1PTOC 1EU4A 2XNAC 1PTOB 1YN4A 3MC0B 2IJ0A 1B1ZA 1ESFA 1F77A 1G8ZD 1M4VA 1PYWD 2XRSD 1CHPD 1CT1D 1STEA 2G9HD 2XN9C 1LTTD 1LTRD 1HQRD 2J4XA 1XXGA 4L6TB 3BVMA 1I4HA 3DWPA 1HA5A 2AQ2B 5FK9C 5ELDA 5FKAC 1XTCD 1AW7A 1PZKD 2SEBD 3R8BA 4NZLB 1TS3A 3TSSA 2QEJC 4RGTA 1PTOF 1EU3A 2NTSA 3W2DA 1BXTA 5D3IB 1PTOD 2TSSA 5ELFA 1JQYD 1KLGD 1T5XD 1GOZA 1LT4D 1MD2D 1PRTF 1TS5A 3BZDB 1L0YB 1L0XB 1CHQD 4DXFA 1EWCA 1LTAD 3BVZA 3O13A 1SE2A 2NTTA 5TSSA 4ZYSA 1ENFA 1D5XC 1D5ZC 4C56C 1CK1A 1I4GA 1I4RA 3DWAA 3KLSX 4RGOS 1BCPC 1SE4A 2RDHA 1BCPB 4RGNA 1D6EC 1FD7D 1PZJD 3EA6A 4O1NA 1TY0A
chains in the Genus database with same CATH superfamily
1D1KA 2D5GA 3R7QA 1F2RC 1JCKB 3M62B 3KLSA 1K8GA 2VZAA 3GTOH 5CHFA 2PNRC 3PSIA 1YJJA 4CYEA 2PJHA 3A56A 3S15B 1M8AA 4DR2L 1Y56A 2ZW0A 3LYYA 5G2NA 4DAYA 3H15A 1BR9A 4JBKA 3UI2A 3OSOA 5IGBA 2K5HA 1J7AA 2K0PA 4EUTA 1PTOH 5K36H 3GV6A 4L5TA 3S2HH 1JMCA 2D07B 1WGHA 2A68C 3QAQA 5JH5C 2M1MA 1MHWC 1WX8A 1HEZE 2KLCA 3ZRCA 4GIVA 3I57A 2DGYA 3M4YA 2B8FA 1DJRD 1JT8A 2KVMA 1HRJA 1SYBA 4ABNA 2DYMA 1T0YA 1STHA 4H2AA 3MXNA 4IOAA 4LUVA 2VUMH 1VDZA 2JSVX 4Q2JA 2KCNA 3PUXA 4A3FG 3VDYA 2WLBA 5ELCA 3NENA 1LTSD 1RD9D 2MH7A 2UWQA 3UIOB 1B2TA 1HTPA 4JBMA 4KKUA 4DR3L 1P0RA 3B2FA 4FJZA 2D2CC 3HOVB 4NXNL 3S1QB 1EIHA 2ZZPB 1B3QA 4CKBA 4DV3Q 3IT4B 2IDYA 3QJZA 4EFOA 4LFCL 2YU9B 1KNEA 2Q8TA 3S16H 1VQOA 1WGGA 3I91A 4K0KQ 3J80L 1NAPA 5IP9H 4B3RQ 3MAQA 2HHHL 4II2B 5J1ZA 4ANVA 3RN2A 3JC66 5GQOA 5IT9c 2SOBA 5E4XA 4C3HG 2HTHA 3HUIA 3K7AH 4IM0A 4IDIA 2R2OA 4XT3B 4LFAQ 4M0WA 3CW2C 1R9TH 1EY5A 1NNXA 3NP8A 5LMNL 2J53A 2N1VA 1IP9A 1WTVA 4TV3A 5G55A 1RCVD 2OCEA 1IXRA 4LF9L 3JVZX 3VR8B 1KABA 4JYAQ 5DCNA 1F77A 2NN6H 4K5WA 3RNEC 5DPRA 4M8AA 2KQSA 4BOSC 4CDCC 2K3UA 1MJEA 1E7PB 4LF6Q 2TMPA 5D7GA 1QF6A 1FCLA 4NMZA 1RFKA 3OW2A 3FDTA 1PGBA 3HOUH 3CCLA 1M1KC 1N33L 4A4IA 3TP6A 2IHEA 4ACFA 2DY7A 4RF0A 1BBUA 1I94Q 1WXSA 4FNFA 3RD4A 1QB5D 1QZGA 3AEFB 4J8QA 3KUDB 4MH8A 3NQIA 2WXOA 3EFCA 2NZOA 1XYIA 4YSZB 4X64Q 1IL8A 1GC6A 5IYCH 3PIP3 1XEEA 3CWIA 2ZM6Q 3FEWX 1ZXTA 1ASZA 4OXPA 2EE1A 3KFUA 4JI1L 3H6MA 3DXJC 1U4MA 3PZDA 4WURA 4CO7A 3PGEA 4KHZA 1L0VB 2H89B 4AQYL 2ZVOA 1U4RA 4E6IA 3TJPA 2LXKA 3U4EG 4P7IA 2D62A 1HUNA 2QGQA 1BCPC 4LF8Q 3AULA 3KVFB 1IBMQ 2I46A 3L17A 4RGMA 4U673 4GS3A 2K25A 4JI4Q 4EKUA 1T0RC 1SJED 1X1MA 5HKHA 4IWOA 4MNOA 3GTMB 2BDOA 1JJCB 2PQAB 2NYZD 2V4DA 4KN4C 3NOBA 3BK1A 4MGZE 1I6HB 1BUIC 2QIEB 1LT3D 1RYJA 3M3JA 1ML0D 4A3KB 1EWHA 1KJTA 1IBLQ 4YWGG 5EAYA 1GUGA 3R2TA 3Q69A 1W6KA 1ZYRD 4RFBA 1S5FD 2HDLA 3ALBA 4YTMB 3NK9A 1V8QA 1AWDA 1Y14B 3H3VC 4IUUA 4JBJA 3QB3A 4IUMB 3G7LA 1MIUA 1UWVA 4JI2Q 1WXQA 3GS2A 2CFMA 3S17H 1KRHA 2K8CA 1SRUA 4C3IH 4DR6Q 2ZNVB 1V1OA 3AU7A 4GDKA 4OO1I 2JZZA 4FULA 2D3BA 3FC4A 4XE0A 1K8RB 1OFFA 3RLNA 4L63B 5GAEC 3VA7A 1DYQA 4IM3A 1NMFA 1S5ED 3P20A 2JWZA 2WDTB 2WKDA 4BBRG 5JEAJ 2KENA 3AEDB 3CMAA 4X57B 1L6UA 4MACA 4LJZC 1WGYA 2QSDA 2AYOB 4EQ5A 2H88B 4RH6A 3FHWA 2JQRB 2JEAI 3DVGY 2K28A 3WAMA 2XK5A 1WE7A 1QNKA 4H0LC 1UZXB 4IN3A 4DR7Q 5M3FG 1N32Q 1P7FA 2B2WC 1LTBD 5CHWA 2M8SA 1FNVA 2PO4A 3GOEA 5BYQA 3KLWA 1VQ5A 1R7SA 3EFUA 5C44H 4B3RL 1DOXA 4K3CA 1C3TA 3I2ZA 4LF4Q 4RM8A 2D9UA 1V6EA 4FHJA 2J0JA 3V96A 4A3KG 2JA7G 2LRUA 4P1CC 2PW5A 4HEA1 4POGA 2INNE 1F9PA 4RA8A 1TZOA 3BDLA 1L1OB 5AFWA 5I2YA 3CSFA 4TKNA 3ZJVA 1TQOA 3VR2A 2G9HD 5HI1A 2R7ZG 1SDFA 4ID6A 2R93G 2KCMA 1WJNA 2N7JA 4HCNB 4MTNA 5ELDA 1VQ9A 1MFWA 3LJ3A 3CAMA 2L76A 3ER0A 5EJWA 4YT0B 3TDQA 3SU8X 3DM1A 4N8FA 3NZSA 3TIXA 2WAQB 3AEBB 1HZ9A 1WI5A 3D0FA 4LUZA 4DF7A 1SFOH 1CKMA 3JAMi 5CC4A 3TREA 3H7PA 3RMKC 2JX5A 2KN5A 4ZRQA 3HEJA 2DN8A 5C4JB 1XNQL 4QIWE 5IYBH 5IYDG 3Q2AC 4FP5D 1PDQA 4DPGA 2PI2A 4A3MB 3S14B 1STYA 4DDGD 1UEAB 3AFPA 3H0GH 3G4SA 4A3BG 1IGDA 4XT1B 4FN2A 1KRSA 3HOZB 3H9DA 3K7UC 4WWMA 1Q8IA 2A6HC 3KF6B 1XLNA 1K83H 1I4GA 1N9WA 1WXAA 2CJOA 2XVSA 1GG3A 1YNND 2IT1A 2JQOA 2MGSA 2BQQA 4MM3A 2D3GA 4O1NA 4OVZA 2NPTB 2PVGC 2IY0B 2F0GA 4MEMA 2CS4A 3NS8A 2MQHA 2JRHA 4NNJB 4IUTA 1LM0A 1XMOQ 4RNAA 4A9AA 2G45B 4TVAB 5ELOA 4C3JG 5C6AA 3K58A 2ZXRA 3DBLI 4KGSA 3VUYA 1XJVA 1DGJA 2CW0C 3QG1A 1B50A 4DN4M 3X23A 1VRAB 2Z6KC 3KK7A 2K03A 2KD0A 3A5UA 5LXHA 2UXDL 5ELEA 1YJNA 1HNXL 4YWMA 2B2VC 4ZLTF 1I50H 4K8IA 5JAVA 5C0XJ 1NI3A 2LJ5A 5HGTA 3PRPB 4OHJA 2BA1A 2VQEQ 2KJ6A 2MRPA 3AI5A 1LO5D 2QC8A 2K5QA 1TGZB 2PE9A 3AYHB 4JV5Q 3MHBA 5LL6X 2WAQG 4OO1H 4C2MH 3R7RA 1PYBA 2PZWA 3FP9A 2I1JA 1E3PA 1MI2A 3M85A 4IALA 2BF8B 4TMAB 2F0DA 1HZ5A 2SAKA 3A33B 4Y7NB 3HOYB 5E6JA 4DR6L 1HFGA 1YN5A 2V4IB 2FE8A 2MBQA 2N9PC 4ME3A 2YVCA 2Q2TA 3EBEA 4JBWA 2NVYH 2AUJD 1KNAA 1VD2A 1K3BC 2RPQA 4DUZQ 2JYOA 4DNTB 2ES2A 3AE5B 3M3YB 4BBSH 3ZTDA 4A20A 4L23A 3U9OA 1AARA 2K9XA 1C48A 3GQBA 4HVBA 1PVOA 2LEKA 2AQ3B 1UUPA 2KJXA 2MBHA 3UI3A 1IZ6A 5KEEA 4QUFA 2B8GA 2RDFA 3UE0A 1BBXC 2IX1A 2CHBD 4ITKA 2AX5A 1C9FA 2L8JA 1HPCA 4YY3Q 1E22A 4P71A 1KM7A 2KA7A 4CDFC 1N32L 3CMMB 2K6QA 3WOEA 3LB8C 4ARIA 5BMHA 2K7VA 1VCBA 4FXCA 4F1SA 2L32A 2IJ0A 1MHXA 1TWHB 2DWQA 2WAQE 3DLLA 3SK8A 3CCSA 4A3EB 2UXBL 1V97A 2EXZA 4IURA 4DV4L 2NR2A 3LWEA 3S15H 3PREA 5C4XG 2CQOA 1X3EA 4NQLB 2WWZA 1U5KA 4LW1A 5GAGC 2KEEA 4GOPB 1XNRQ 3U8ZA 4DV0L 3JAME 4R8IA 2M17A 1WF9A 2NS5A 3P63A 4TQ0A 3KLRA 2IO0B 1ICFB 1IBXB 3I70A 2SEBD 1Y8OB 4GLAC 2SNMA 1H9SA 2WQYB 4HJKA 1CKOA 2ZJRA 2NTSA 3W2DA 3HIZA 2E2DC 5D3IB 2RD0A 4ZYNA 4GNXB 3C0RB 1T3QA 3AE4B 2KACA 1T5XD 3WA0A 1MD2D 3ULJA 4EQNA 2G1EA 4CJ0B 4N59A 2W9NA 3PO3B 4HN7A 2NTTA 4XYQA 3ULPA 2WYQA 3D4DA 4KD4A 5FLXc 4ODGA 3DBSA 4QL5A 3Q8AA 2D0PA 4F7ZA 2MX2A 5CV7A 3HOVH 2CVRA 3A0JA 3S1QH 4JPSA 3X3MA 3W5UB 2B2UA 2DZJA 2KMCA 1OTCA 2YU9H 4K7UA 2MFIA 1SE4A 4X6AH 2D11A 2NMQA 3RD2A 2FIFA 1N62A 4IQZA 3P7JA 4O42A 5DLQE 2KLGA 3U7ZA 1NVID 3HVZA 3MXGA 1R4MB 1AE3A 1TZ1A 1ET6A 2PTLA 1Y1WG 2ZTEA 4IOCA 2Y5BB 1S72A 3RNFC 1B9NA 5F2DA 3J7A5 1TIFA 2UUAL 2B2YC 2M00A 1M94A 2GVBA 2OQ0A 1XMOL 2AWOA 5C3EB 3AE2B 4A75A 2JXTA 2HIVA 3ZLZA 3T51B 3ZNZB 4PYUA 3AE6B 3TS2A 3AN1A 2Z1CA 2UUBQ 1WYDA 1EQQA 5AJ3Q 1GUSA 5BN5A 1STAA 1X3FA 4LF5Q 1GNUA 5CHVC 5J2RA 1B44D 1EL0A 3FMCA 1FR3A 1DD2A 4KIKA 2GVAA 3PV0A 1NSNS 1TY2A 3K9OB 4B95A 2WXGA 4B3ML 4L2YA 1E8YA 3RNCC 2QF7A 3N3KB 3DMUA 4WAAA 1KOTA 4JV5L 4ZOHC 3SFDB 2K1FA 2PQAA 3NTIA 2RQXA 1SE9A 1XCTL 4JWSC 1WTWA 2EYOA 2LKVA 3VR3A 2JEBI 1TKWB 1KXLA 1JOQA 1PYSB 3JSVB 3X0WA 2EJGC 1PRTC 2BS3B 3GE3C 3ABVB 2QEXA 3V60A 4D2KA 1BCPF 4HCEA 1OGWA 2LXAA 4JI6L 1UWMA 2NBFA 4G0NB 3SD5A 4HMJA 3OW7A 1VZ8A 1B9RA 2FJ2A 4K5XA 3NWSA 1PGAA 2KTFA 3N20C 4AQ7A 1RIPA 4LUOA 2VUMG 1JOKA 5CV6A 3V62A 4B9KA 1I3QB 1KHIA 1RWSA 3TEYA 4KMUC 2YV5A 4DUZL 2DZKA 1WJJA 1QWYA 3MC9A 2DX5B 3P4RB 1OXXK 5BYRA 2K33A 4HDQA 3WCQA 2CWAA 2ZCCA 4C4VB 2XRQD 3E9HA 2JK8A 3NG0A 4WJPA 2LVOA 1N61A 3MFYA 1KDAA 1FM0D 1JWAD 1EYAA 3ZYYX 3GTMH 1XCQL 2DHZA 2JSOA 3MC0B 4LK0M 2KHJA 1HNWQ 5HFYA 2OT2A 4XQNA 5IA7A 4E71A 2VQFL 1STNA 1I6HH 1VQ6A 4A3KH 1NUCA 1QVGA 2I38A 3BDOA 3CC7A 4HSVA 3WOFA 1H9KA 4FADA 5FK9C 3M63B 2L55A 1L4DB 1WOCA 3FRPB 2BB6A 2W82A 1WD1A 1EY4A 1M90C 4PMCA 4IWPA 5ELFA 1ENCA 2J7ZA 2PKOA 1T6BX 2NZHA 2M56B 1J8CA 1V80A 5GADC 5JZEB 1CJEA 4USAA 1PFSA 4IG7B 2EMTA 4B3TL 1L1OA 4GN3B 1OQYA 3I56A 3HOUG 2L11A 2IX0A 2XIWA 1L5PA 4CJ2C 3WIMA 1VQNA 4IFDJ 1QQRA 2D0OA 4CKEA 4L8JA 1XX8A 5L95C 1I4RA 1E2WA 2BOSA 1QOAA 2FIDA 3NWTA 2E75C 3UE1A 2MJEA 1D1IA 4BY1B 1P3QU 4GDLA 4BOZB 2E8GA 1FRDA 4YSXB 4NDXA 3LWUA 3VR6A 1HHVA 1I4XA 1HR0W 3DM3A 1I4PA 1HTOA 1A2TA 4DV1Q 4ZDVA 1MJCA 2F0QA 1GAQB 2L7RA 2WNMA 1VLBA 3PF4A 2WXIA 2J0TD 4GLSC 3AH7A 2Y5PA 3AV8A 2OOBB 5COYA 3CHBD 3GV3A 1T0SC 4A3CH 1GVPA 3TN2A 3MZ5A 2VY3A 1Q3LA 2K8HA 4KSKC 2VS1A 3KF6A 4KY7A 4RCNA 1RHPA 5IGGA 3DBRB 4UHVA 4ZRZA 1BO0A 3EN2A 2NUCA 4MGIE 3Q3MC 3TQYA 1RFAA 1VQEA 1MSGA 4DR2Q 2IPKD 5LMUL 3EECA 4RMAA 1OEYA 1GUWA 1V9PA 3NBHA 4BS9A 5BN4A 1TBEA 3RULA 5G3LF 4CDDC 3EVQA 1X54A 1YNTE 1KAWA 1LTGD 1GUAB 3I72A 1YN3A 1VQLA 5CV5A 4A8XC 2N88A 5C4JH 4P1BC 4PZ7A 1WM2A 2D10A 1CI3M 1Z6HA 5M5WB 5IO9A 3ERQA 3Q8BA 4A3MH 1RODA 3S14H 4XZ4A 1VQKA 3GDEA 2O2LD 4C3IG 2E5LQ 1LFDA 4ZHOA 3IL8A 1HH2P 1PFDA 1L0WA 3HOZH 4LNNA 1IW7C 1TR5A 3PO2B 2MNAA 5HY6A 4IJLA 2PMZB 4DV7L 4DR3Q 2EYFA 4JPBW 4YCUA 5D3DA 1GM5A 2QILA 2BKFA 2BCOA 4X65L 1O78A 1X9NA 3UDIA 4LFCQ 5KYLA 2XNAC 3RN9C 3N52A 1PV4A 2LD9A 1UE6A 2X6GA 1LTRD 2HHHQ 2E74C 1NDDA 1P1AA 3ZW3A 2A69C 2CJNA 1MI0A 3T56B 3B08A 4L6TB 5DM73 3QOJA 3L54A 2BW2A 1HR0L 3G6JB 2CU3A 4EX5A 3HKZG 3K57A 2CCZA 5LMNQ 1WWTA 3BK2A 3AE8B 5C44G 2O5JC 1J7BA 3A8KE 3DWGC 3F2UA 4LF9Q 5JJIA 2WXQA 5CTRC 4GOCA 2D3CA 2F3IA 2EYHA 4FXDA 2HJ1A 4BKSD 2VH1A 3S2DB 1GOZA 2I07B 4P2CB 4A3DB 5JVH3 2MJ3A 4X3SA 2N49A 3IT6B 3I4NB 1RAXA 5E7NA 4FHKA 4KSLC 5EKIA 4PMBA 2LRWA 5FR6A 2IY1B 4UP9A 5M5YB 4IC7B 2E2JB 2A5UA 2MBBB 1LUZA 3A9JB 1PUTA 4WJ3M 1RKNA 3BDCA 3VR4A 1N33Q 4Y7NH 1WD0A 3LGJA 1HZBA 5EKKA 3HOYH 2KDBA 2NWGA 1WZ0A 2FNJB 1EY6A 2PLPA 5BR8Q 4GOPA 4JLCA 1OXVA 4K14A 3RN5A 3DOWA 3I4MB 3FILA 1IBXA 2RDHA 1D6EC 1NCVA 2K5VA 3G48A 1YITA 4DK3C 3M3YH 4MELA 3UF8A 4UP7A 3OOCA 2VB3X 2Z8LA 2FBWB 5KNBA 2NBWB 2RBMA 4TRDA 3NJTA 2RHQB 4LNFA 1X3QA 2JPHA 4MGKE 2A5HA 4LAAA 2IO3B 1RF2D 4BFRA 1WRDB 2KQ3A 1K0RA 2V4LA 3HKZE 3J80E 4KKTA 4QQBX 4QY7A 1RM6C 2MPMA 4LFBL 1Y69U 2KHSA 1SN8A 3GTQB 3IFTA 2FMCA 1KH0A 3U30A 2V3NA 4HR7B 1S5DD 1SMYD 4LNQA 3H91A 2LVQA 4GN4B 1TVXA 5IODA 3CMEA 3APFA 1DZ1A 4HWIB 4DAMA 4DV1L 1Y8RC 2BPSA 1TWHH 5FR3A 4A3EH 2MUYA 2KQ4X 2JA8B 3QR8A 4R4IA 3MC8A 3BG3A 1TYGB 1FJGQ 4I6PA 3T3OA 4J15A 1JWSD 3GTLB 3W3AA 1O7LA 3A74A 2J0MA 2K39A 1RDPD 1QILA 2HCIA 1SIFA 2JRIB 4RHRA 2Q2UA 2K50A 4IM2A 1EOTA 2EY5A 4JI7L 1G2SA 5CBEE 4A3DG 1SB3C 3DPDA 2N1WA 2RCFA 1XPOA 3D3RA 2JJQA 1ZW7A 3Q24A 2BTEA 1Q1BA 1Q10A 3H7SA 2A68D 2C9WB 2WXJA 1X32A 2YTXA 3KJPA 4K81A 3ZIMA 2BYTA 1WIAA 2HIXA 2C5LC 2A73B 4B0MA 1J5EQ 1FGBD 3PO3H 5IGDA 2KMAA 4AJWA 4QJFA 3DVGX 3BYTB 2JZ3B 1GUNA 4OO1G 2KOXA 3CRKC 4II3B 1GB1A 2I5MX 2YEPB 4HPMB 1V86A 5C23A 2H1EA 1C4CA 2BT6A 5LXIB 2QMTA 2RPVA 3T1HL 4NY0A 2KOLA 4OL7A 3PRZA 3ZJUA 2CWPA 4W9GA 3PV1A 1O80A 3HVDA 2E5LL 1FO4A 3TZDA 5CMDA 5G5HA 5HURA 4KV2A 2EJFC 4YWLA 4A3LG 4N8X1 5EQ0A 2L0CA 2PZTA 2MW5A 3ZNGC 1NYRA 2L1BA 3OIQA 2L05A 2LXJA 1CT1D 2Q2HA 4BBSG 2MLBA 3JSVA 2KECA 2WB1B 3V3XA 3PUVA 3HZXA 3EC8A 4M02A 1Z47A 2EYPA 4FF4A 5C3EH 4LK1C 4YXDB 2MO1A 1UE1A 3RUZA 2AL6A 4ICVA 4JI0L 1G291 3CPFA 4UPAA 3J81L 1A70A 1WJ4A 2M19A 1YJ1A 2PI2E 4BY7B 1PTOF 1WCMB 1FRRA 1JROA 3K6OA 1ISNA 3ERSX 5C0XH 1ASYA 1YIWA 4IPCA 1KLGD 3OJ4B 1LT4D 1PRTF 2Y5CA 3PZ8A 3QQ8B 4IKGA 3N1ZC 1UE5A 1VF7A 3KF8B 2K52A 2YTYA 4JK1C 1EZ6A 3M7NA 1PH8A 1H9MA 4GU2A 5JVG3 2ZT9C 3K5OA 1Y1VB 4PV1C 3NTKA 3OJ3A 5EBDA 5KNDA 4W9JA 1EQRA 4C56C 1WMHB 1OO9B 3VQIA 3A1QB 2KJHB 3SHLA 3ZDMC 2JYTA 4G4KA 1I7HA 3IFWB 3QCAA 3TMPB 1BCPB 1IYFA 1PZJD 5KNCA 1PMRA 4EZJA 1T5EA 2MP1A 2JVCA 3KUZA 4C00A 5BR8L 1K8OA 2O2VA 2KNBA 1LTID 1XNQQ 4HIMA 4MT5A 2OTLA 1H9JA 1SNQA 3CC2A 1I3QH 2RDBC 4W9CA 4DV2L 3HOXB 1NI2A 4WQOB 4DWFA 2WDRB 1FCCC 3NELA 1MG4A 5AZFA 4NB3A 1SE3A 3HOVG 2VH2A 4QCLA 4FYDA 4FXGC 2WB1G 3OG5A 1IUEA 4AIMA 1XQQA 5EE0A 2HUGA 1WGRA 1Q86C 2L9HA 1AP0A 4JCVE 2K04A 2DAJA 1N36Q 1BCPD 3L3OC 1YX6B 4W9LA 1N60A 5AUKA 2Z0SA 3C2PA 4JQWC 3DBHB 4JX1C 5FLMH 4KN7C 2SNSA 1HJPA 3KUCB 4I6LB 5AZHA 3T16A 3AE3B 3U7DA 4MIUA 1K3RA 5JJZA 1YX5B 1UEBA 4XWWA 1EZ8A 4DK0A 1MVKA 2CH4W 1FJGL 1CZWA 1TWFB 3ND8A 3K59A 1CMXB 3V6CB 3HKSA 4EOYA 4HSPA 4ZHPA 2KHIA 2PYKA 4U68A 3URYA 2D2QA 1E5WA 2UXDQ 1HNXQ 1NY4A 2W54A 3A54A 3MFGA 5A35A 1QOBA 2FUG1 2N9XA 1E0ZA 4W9EA 1E9MA 2A1AA 2EDGA 1HTQA 4W9FA 2LJIA 2OTJA 2B2UC 1A5RA 4NQKE 3IAYA 2FCQA 1T9HA 3KWVA 4NW2A 3VHTC 4RAUC 3UDXA 3ECIA 4QF4A 3GB1A 2F0TA 1J5EL 1P9DU 2WB1E 4YWKA 4CHTB 3A7AB 4RCOA 4JI5L 2IHFA 4GKJL 2BYVE 2ON8A 1EUVB 4F88A 2IO1B 3A7LA 4IZ8A 5ELBA 4BY1H 2VXWA 5C1ZA 5IIFA 1YOVB 3W9CB 1QJOA 3PZ7A 1VQCA 1EYGA 2J52A 2M0XA 4M00A 1LTTD 1QUQA 2K6AA 2J4XA 1KC8C 2DBYA 1TKEA 1HA5A 2MP2B 3EROA 2PW9A 3SR1A 3DWMA 1HE8A 3U4VA 5G5GA 2MJDA 1PZKD 4ANUA 4YIJA 2KZRA 5IN7A 1PGXA 1EU3A 3CP0A 3BWUD 4NJ6A 4PNYA 2UXBQ 2QDLA 5IT9E 5LHY1 1FEHA 1H4RA 4DV4Q 4X66L 1N34L 4OWWB 3DHQA 3RZOB 2F3VA 3A4RA 4DV0Q 3S1NB 3RMHA 2NVUI 1EOVA 2XSCA 2K1BA 1L2NA 3J7AF 2JUOA 4MHEA 3GTPB 4BVUC 4NP5A 2H4OA 4DKAC 1WVLA 1TIID 4K7SA 3NVYA 1R4NB 2WDQB 1V8CA 4HRSA 3RNUA 4A93B 1VQMA 2ATWA 3AB5A 2DNEA 3P1MA 1H95A 2WP9B 1VQBA 4N9F4 4WWOA 3NBIA 5M5WH 4NPNA 3KUPA 5C5LA 2K75A 4DBGA 2ZNVC 2E2HB 3ZJYC 2Z4IA 3PIPA 1XPRA 2D3AA 3L16A 1J8IA 2L00B 3PO2H 1S40A 3QARA 3RZWC 4R8NA 4KY6A 2LGIA 1A15A 2XGTA 1B4OA 1HA6A 3GZNB 3RI7C 1K8AC 2VW9A 3VA5A 3A9KB 4MJSB 4AS1A 3HOWB 2FXQA 3GO5A 3CCVA 4HJ7A 3NVVA 2A6HD 3A5ZB 2K5WA 1ZEQX 1O7ZA 4DR5Q 5K5PA 3C1EA 4NXMQ 3MJWA 2CKHB 3DEOA 1ET9A 5T1IA 1FXAA 4PT5A 2V3PA 3E9IA 2R7DA 4DA2A 1Q12A 1PH9A 1FXIA 3F1ZA 1FNWA 2AQ1B 4DV6L 4LDTB 3CCEA 1N36L 2A19A 5EPLA 1DM0B 1HTLD 5CORA 3LX0A 2UUAQ 1WR1A 3KYDD 2HDEA 2CW0D 4X3KA 1BUVT 2ASQA 2R7FA 3A55A 3U2SC 3H1UA 2HCCA 1QVCA 3HGBA 3OIPA 4LWCA 1I5FA 3S2DH 1HZ6A 2MBEA 3N32A 4A3DH 4A3CG 2W3RA 2IGGA 2WXRA 3I4NH 1X55A 4RHSA 2ALYB 2WIIB 1F9SA 5M5YH 2WDVB 3APCA 1Q1EA 1X56A 2E2JH 4GSWA 4LDTD 4XWTA 2C60A 3M9BA 3UDFA 1PH1A 4B3MQ 3TEWA 5EKLA 4DQOC 1F2MA 4FF3A 4HMIA 1JICA 1UNSA 2LWPA 3B0AA 4DHZB 2F52A 5GXGB 3I4MH 5IOIA 2F4IA 3K5LA 4IFDH 4OZAA 3PF5A 2A6ED 4DUYL 2GBKA 2NB0A 3W1SA 2E2IB 4WORA 4JI6Q 3HOWG 1NBFC 5IWAQ 1SNCA 3DVNU 4YTNB 5J3BA 4A3MG 2C5CA 1B7YB 3W1BA 4ANXA 4IWQA 3FVQA 1HQRD 4A3LH 4EQPA 1LXDA 4W9IA 3PUWA 4KKSA 2DNFA 3HOZG 2W55A 2EJMA 1VQAA 2EYMA 3NXWA 3VRBB 4L1BA 4I7AA 3C3LA 1VQGA 1OQQA 1HNZQ 5ELNA 3EGRA 1WTXA 3IAM1 3F2CA 2KBNA 4C1NI 2WX1A 3JW0X 2JA8H 1D4BA 1CQFA 1YJ9A 1VF5C 2AEHA 3DBHI 4DDID 4P6VF 5D2MB 1D2BA 2VQFQ 4BKGA 3H3VI 3BS1A 3E5SA 3QHTA 2PZUA 1TKYA 2OHFA 4E74A 1QOGA 5C2TB 3TBLD 4XDCA 5LNK1 4IUVA 2ZTDA 1R4QB 2WX0A 2GLSA 2BKRB 4A3JB 3RPFC 1QCBD 3O65B 3GD7A 4DR1Q 4FVMA 5J22A 4G7HC 3TCAA 3R3MA 3DWAA 2Q2IA 2ACZB 4RGOS 2R3ZA 1TWCB 2BE5D 3M95A 2KC2A 3S2AA 4C7YA 3EA6A 2WXNA 2RA4A 3IRBA 3FAHA 3FKIB 2KO3A 1LT5D 2GBRA 1BF4A 1EEFD 1LT6D 2JA9A 1QVFA 1JALA 4WJOA 3RUIB 4S0RA 3Q22A 3C46A 4B3TQ 2AWNA 3AQQA 1EFID 3AM9A 4YCWA 5BO4B 2GA4B 2DY8A 5IGEA 1SJHD 3L9AX 4TUUA 1EIGA 1W6JA 3D6CA 3KF8A 3HOYG 4CKCA 3GTKB 1YJIA 3STBC 1C78A 3ZXVA 1ZUD2 4FA6A 4KJOA 3MA2B 2VZKB 1WXMA 4LNIA 4OW0A 1KDBA 1JRUA 2MHVA 5GMVA 2EIFA 5JEAG 5H1SE 2G5DA 1WMHA 1MSHA 4QGUA 4H02A 5T8IA 2GBNA 4DR5L 2INDC 1S3OA 3T4AC 4NXML 2G4DB 1GXDC 3NHEB 1WFQA 3IHPC 2KQ7A 4KX6B 1AE2A 4XDDA 4BY7H 2F0MA 1N63A 1WCMH 4C80A 2BYFA 2IY5B 3TEHB 4WAFA 4US9A 1BT0A 3ENEA 2AMCB 5IE8A 2KTRB 2VZKD 2GBJA 5EPJA 4A3EG 2JXMB 1NBWA 1PH6A 1QZHA 3QIAA 1CA6A 2HTME 1PRTB 2E3TA 4DHZE 3NE5B 4C1NK 2WV6D 1EWIA 4GOPC 1EO6A 2MQJA 3RR5A 2KDIA 1K53A 1A63A 2F0SA 1Y1VH 1VDVA 1E6EB 5IOCA 3OMGA 5LMUQ 1AZQA 2EYLA 1OQRA 2QKIC 4JOIA 1C9OA 3FKYA 1B3AA 3FPUB 1CUKA 1PH5A 3ONAB 3K0YA 1EY8A 2PMVA 3CCQA 1GUTA 1YQBA 5LLIA 1PRTD 3IXSA 1D8LA 2RKSA 4QAYA 3UQAA 4DAYB 1PTOC 1Q90A 5FOBB 3PO3G 3L0OA 5FO9B 1YMHE 4GXBA 3HOXH 1X65A 4P72A 2M9VA 4HDOA 1CFMA 1II3A 1SNMA 2BH8A 2WS3B 3VTWA 1EY7A 5EE1A 5IWAL 3GZNI 5IP7H 4DV7Q 3W1YA 3AU5A 1E7ZA 1CKNB 4NAMA 2B2TA 2C7NB 3MXNB 4KV6A 4X65Q 2JA5B 4ME5A 2B2WA 4G57A 3L7ZC 1ZP0B 2ZJDA 3H3VH 3ZRFA 1C76A 4YCVA 5FO7B 3PO0A 4R4OA 3JAML 3QIJA 1PH2A 2WXKA 4HK2A 1HNZL 3BZDB 2F0FA 1AFPA 1L0XB 1CHQD 3EQLC 1QE6A 2N3SA 3KH0A 4O2DA 1TWFH 4GZYC 4HJGE 1GB4A 1TWGB 1HR0Q 5C3EG 4ZYSA 3J7AV 1FIQA 1KF6B 3K8AA 4XC2A 5L37A 3BJUA 1QLBB 1YNXA 4XYOA 2MP2A 3A4SC 1WTRA 1SYFA 3T1YL 1XT9B 5C0XG 4GB9A 1SYCA 4LCDE 3NUCA 2G3QB 2WKCA 1DONA 4DR1L 2N8NA 4HTHA 3J7YW 4KKJA 2F0NA 3PHWB 1GD7A 4DR4L 2R92B 1Y8PB 2RSOA 3B6YA 4PK1A 2ZCBA 4Z9CB 2KANA 5CBAE 2DUDA 1NEKB 1OTRB 3EUB2 5DM63 5L83A 5I9OA 3U9SA 4A3IB 4EQOA 5H8YE 3J81j 2K5NA 3G6EA 1Q8KA 1WFYA 2INPE 2KCCA 3DHIC 1SE8A 3Q3NC 1UE7A 1NE3A 3NTHA 3ZO5B 3MWYW 1RLFA 2Q8RE 3Q8DA 1HZAA 3OTOL 3H8HA 5FLXE 3D4WA 3TUOA 2F0VA 4LTUA 1WYWB 1J0GA 1PQSA 1PFNA 1J6QA 2GI9A 2HD5B 2KWUB 3TMEA 4LFBQ 1FL0A 1IBKL 1P7EA 2NVQB 1VZ7A 3J81c 2R6GA 1IYVA 1HXYD 3RNGC 4FF2A 2XWJB 4A3PA 5JOBA 1PLFA 5BMIA 1PHJA 1KAAA 4JI8L 1QT9A 1VMPA 3A9KA 2BYEA 2IL8A 3D31A 5FLMG 4MJSA 4P75A 1O7YA 4ANWA 3BU2A 4BWGB 2I0QA 4RWSC 3RZOH 3W5OA 5FJ8H 3S1NH 4HCPB 1IKMA 1FYCA 1YQ4B 4S3SA 3PQIA 3J80i 3GTPH 2DJGC 4QUCA 3D6WA 1SXTA 4JI7Q 1TTNA 4LLGM 2PIAA 2Y0SB 2ZJQA 1KLVA 4A93H 3AU4A 1ZOYB 2NPTA 3CCMA 2R92G 2N7DA 3KWLA 1EM7A 1I6VC 4LNOA 5C4ZA 4LF7L 1SIJA 2R61A 1Q5WB 3N6RA 2G9DA 2EKIA 1EIFA 2YYZA 4B9WA 4GLXA 2E2HH 1O7IA 1FXTB 1YN4A 2K05A 2B63B 1UD7A 1E7VA 2KX3A 2XRSD 2KWCA 1PYWD 4W9KA 1M4VA 3PT2B 4JIOU 3PIO3 1ILPA 2ICEC 5BN3A 3HOWH 3NPPA 4K7WA 1A3VA 4PS3A 3T1HQ 3TZUA 3CQZB 5DPTA 4B9XA 4JI3L 2LMCB 3SK4A 1FMAD 3GTJB 2QEJC 4EVOA 3NZUA 4AJYB 1EUJA 4GDKB 4BY1G 2UXCL 2XEWA 4GKKL 1UELA 4PS7A 2FAZA 1WI0A 5KHQA 3NY5A 2UUCL 3KYHC 3KBGA 3PUYA 4OIKA 4L5SA 1U4PA 2A69D 5JPMC 4MTKA 3DCGA 3SK6A 3P4SB 1E8WA 1ZPSA 2L1AA 3C1FA 2MBOA 3L13A 1ENFA 2QW7A 4JI0Q 1EY9A 1CTMA 1R4MI 4XGAB 3TL5A 1EFWA 2C9OA 3GTGB 3SVMA 1VJKA 5A2QL 3Q3OC 1JQ4A 3PCOB 1PH3A 3CCUA 1NENB 4I65A 2X38A 3CSTA 1V2YA 2Y0SG 3QO2A 1FD7D 4K2LA 1V1QA 3K9PB 4DU9A 3K80C 4JW0A 1KFYB 2OQKA 2V0GA 1X3PA 2IZVB 3HFZB 3M4QA 5D65A 1UWXA 1SGHA 4J6HA 3T13A 4K5VA 1V5OA 3DDCB 2KEDA 1I42A 4BBNC 1TS2A 4P74A 4EZKA 5C0XI 3HM6X 4MN3A 1V1PB 2MEKA 5GAHC 2E6XA 2E2IH 1VQFA 5JPNC 3MTSA 4OX9L 4X3TA 4DNRB 1WTPA 1C77A 4HJ5A 4AH6A 2PE6B 2O4XA 3D32A 5CGKA 4KLKA 4DXGA 2RVLA 2WXPA 5EDSA 2PQEA 1BBWA 4HPLB 3A8JE 1CZPA 1U4LA 1JMLA 2WXMA 3PO2G 4YHHL 2AKWB 2WHIA 4WJNA 4DV2Q 3G71A 1SLJA 1TT2A 5JEAH 4OZBA 4DK1A 3ZGZA 3ZNID 4BXXH 4GN1A 1WY8A 4OEMB 3PMFA 4GNXA 1YBYA 4YTPB 5DAUA 4HKZE 1Q7YC 3NVZA 1BQQT 1NR4A 3VUXA 2BA0A 2Y0SE 1G6JA 2EVBA 1LLRD 2K01A 2F0IA 1YNJC 2LFNA 3DEPA 1PXUA 1UH6A 3PSEB 2PNHA 2F0WA 4PQXA 4TQ1A 4A3OA 2RCNA 2NVXB 2WU2B 3W1GA 2HDMA 2FUHB 3BZCA 2LGSA 3ML9A 3VTUA 1HZCA 4ICUA 1TU2B 4A3JH 4X3UA 2N9LA 4TSSA 2EY1A 5IGCA 3ZTCA 3QJYA 2KVZA 1D7QA 1NTGA 2J7QB 3CXCA 3UINB 1GO3E 4JE3B 3PLUA 2LI5A 1F9QA 4A3FB 1ZKOA 2AWTA 1TXYA 4IOIE 3FKIH 1E2ZA 1SEBD 4M1UB 3I4NG 3CD6A 2FMMA 3AEVA 5E6OA 3AEGB 1ESFA 3EJIA 4RKLA 1E2VA 1YEZA 1K73C 2PMZE 2F03A 2OJWA 3T53B 1F1HA 3GTKH 4ILWA 3P2BA 3AEEB 1CSPA 1GUOA 1SMYC 4WFN3 1IHZA 2QJLA 4JI5Q 4ASWC 2MWSB 3MHSD 5C3JB 4GKJQ 3I4MG 1P16A 4LNKA 4IFDG 2QHOA 4C3HB 3Q3JA 1ACCA 3BY4B 3R3OA 2B29A 4W9DA 3SDZA 2V3SA 4WJQA 1XTDA 3VRAB 3Q6BA 1N5XA 4WRDA 4RKBA 3FPPA 4V190 1EWCA 3M7GA 3UGBB 3OHXC 3ZXRA 2PPBC 3SE0A 1F0ZA 2CU1A 2KC1A 5AUIA 2N0SB 3PLVA 3RZDB 2AHOB 5E6PA 2VB2X 3AECB 1Z5SB 1D5ZC 5HHDG 3DUZA 5E1FA 2JA8G 1V49A 2JP1A 4KY5A 3Q8CA 1PFBA 1A8VA 2LVPA 4CBVA 1WJ6A 1FD6A 3KLSX 1MG8A 3RT3B 4PZ8A 1Q82C 3SXHA 1XWEA 4BAXA 1CKNA 1N34Q 4X66Q 3S1MB 1S1QB 2F0EA 4URKA 3RFZB 1KLUD 5AZGA 1SROA 2EY6A 3W1SC 3K5MA 4KZCA 2N78A 4ZQ3A 3DBRI 4XTCS 1WXVA 4C4VA 2K32A 1T0QC 3VYUA 5I4DA 4G50A 3VYRA 2OEOA 3TP8A 3NVWA 4G7OC 3PGZA 1ROEA 1E0BA 5EGTA 1DXMA 1UAPA 2MCNB 2CKZB 5FO8B 2CQAA 2Z4HA 3VYTA 4YSYB 1SYDA 4KHVA 1E90A 3CPWA 2JWUA 1NYQA 4AUQC 3F8TA 4B3SL 1H9SB 4JVZA 1SBBB 5JJLA 1XO3A 3ULLA 1E1OA 3DBLB 2CR5A 3DHGC 1Q0WB 1VZ6A 4NJ7A 3L2PA 1BDOA 1IL2A 1K50A 3H6NA 4R4QA 2A4ZA 3CU7A 1EIYB 1XF5L 2LHEA 1KL9A 4KDLB 5D14A 4IPDA 3HK0A 2JA5H 1XLQA 1YJWA 1NJIC 3R2IA 1WGDA 3SDLC 1NMGA 2EELA 4DFAA 3WAOA 4FJVB 1HQMC 1S5CD 2KFKB 3B9JA 4Q5VA 1VQIA 4PS8A 3UIPB 4DV6Q 1TWGH 3Q23A 2WU5B 2MO0A 5CV8A 3B1LX 2WXLA 2FCSA 3M4PA 1TS4A 2JXXA 4WIPA 1OXUA 2GN5A 1CQVA 1DOMA 4BY7G 2JYEA 2UYZB 1WCMG 3VVWB 4NKLA 1C8CA 2KAJA 3B2GA 5H92C 3KBXA 1RTOA 1EF1A 2K5PA 1V9JA 3WWVA 1WTHA 4UY8C 1EU4A 3UDGA 1A0IA 4M01A 4K2KA 2X69A 2F4VL 3V2TA 2R92H 1DGSA 2IGDA 4BBRB 2N4FA 4J6IA 1Y1VG 1EQTA 2Z9HA 4RG1A 3QC8B 3SHQA 1STBA 5DPWA 1XXGA 4A3IH 4L5RC 3BVMA 1I4HA 5E6NA 1K52A 2KUMA 4JG2A 4KIKB 4X62L 4APVA 1OEYJ 2NZ1D 4IW0A 3T8MA 4Q0FA 5M3FB 1IPGA 3P42A 1E8XA 2REXA 4QIWB 3PTFC 1D3ZA 1MKHA 4DUYQ 4ZAIA 2OXPA 3OYYA 3PVLA 1C79A 1G2TA 2MSED 1H8CA 4NJCA 4H44C 2KJRA 4KK7A 3SR6A 1A62A 2IX3A 2KX0A 1L0YB 4DV5L 3HOXG 1C0AA 1I35A 2JA7B 1G6ZA 2JU6X 2P5ZX 2YTVA 5M3MB 3L10B 3I55A 4J1MA 4RF1A 3BVZA 3O13A 3AB9A 4IFDI 3RNBC 2NVQH 3CRLC 2LASA 3VFKA 3VDZA 1P98A 2VNUD 5IP7G 4A76A 1V43A 1F2RI 4OZCA 4LMQD 4O0AA 3RLFA 2R7ZB 1FGUA 2KN4A 4XYCA 2QDFA 1EQVA 2R93B 5JJKA 2W3SA 4HLEA 3DQVA 3KJOA 1B70B 2JT4B 3QA8A 4JOIC 2AUKA 4ZRJA 5MPOA 3OMCA 3S24A 5JHAA 2LMCA 1ZYRC 1ZKHA 2LHDA 4FLHA 4OONA 4TQUS 2O6VB 1WZ3A 1C4QA 3E3XA 1SNPA 2LSSA 3GP7A 1YI2A 1ZDXA 4LJPB 1L2FA 3SK5A 3WDNA 2ICIA 3S1RB 1Q81C 2YLMA 3IFDA 1SNOA 5I6WA 3TRZA 2M4NA 2RDGA 1VQ4A 1EYDA 2QDBA 1W2BA 5BMGA 1JW9D 2A8VA 4HJ9A 2DNCA 2RMMA 1IYJB 1D5MC 4BKSA 4JC0A 2B63H 1PA6A 1JWBD 2F0LA 2O6VD 2B3GA 4A3BB 3BVGA 4OWTB 2Q8IB 2K8BA 1JWUD 3I63C 2B2TC 3HRDD 2WXHA 1ILQA 4DV3L 1E1TA 2CHWA 1RL2A 4US8A 2ZXOA 4ZUJA 2KHWB 4N9TA 3MXPA 3CQZH 4ZKBB 4K0KL 3A8IE 3L4PA 3I4OA 3BYYB 1LQBA 3AE1B 3ZNHB 3GTJH 1WX9A 2DLBA 2RHSB 4CQNA 3QK0A 2WACA 5M3MG 1BOSA 3EFXD 4C3JB 4R3DA 2M2LA 1QOHA 1X6OA 4LFAL 2JF5A 5J18A 5G3LD 3JAMc 2C7MB 2PPHA 1V1PA 2K14A 1KTKA 2V9HA 4IPGA 3SEBA 3A9JA 3OWFA 2ID0A 1F52A 2EPBA 1XPUA 4JYAL 1EY0A 1A3UA 4BA2I 3K0XA 2N9EB 1EF5A 4LF6L 3GTGH 2PEAA 1HFNA 1TT5B 4CHKA 4CDEC 4GDLB 1LGRA 3Q0AA 4OVUA 3Q6SA 4BBNF 4S17A 2IWHA 4QMGA 1C1YB 3OWEB 4WJWA 1V81A 3DWQA 1K28A 3IAS1 4ZUIA 3K5NA 2ZW1A 2Z6BA 3CCJA 1ZDVA 3I9V1 4KDIC 1LACA 1PH7A 4DAPA 1I94L 2L3ZA 1JE4A 1L1OC 3OAWA 5FJ8G 3P1HA 1G8ZD 4WJ4A 4JL9A 4A3GB 2L12A 4ZKCB 2DZIA 4X64L 5KGUA 1QKZA 1LTLA 2KKCA 3DWPA 2ZM6L 2GB1A 4A93G 1DOYA 4FO2A 5FKAC 1MBYA 1VQDA 2KWVB 3GE8C 4G3XB 4LJOB 4GLVB 2PCFB 3J7ZC 4FF1A 3KDFB 5LL6S 5DPSA 1KQSA 1U9RA 1FPYA 1K51A 2DZMA 4AWJA 1BXTA 4QB4A 4HCSA 1MPEA 1YNNC 3MVVA 1AEXA 1WTQA 3NBHB 3F2BA 4LF8L 3RCZA 4JGHB 1JB7A 1IBML 4H7BA 1U4AA 3E0EA 5DNFA 4DXFA 3VR5A 4F87A 2KT7A 4JI4L 1BKBA 4N9PA 3H09A 5TSSA 4HJAA 2EZVA 1IYUA 2MJ8A 3MP9A 3V6EB 4HAEA 1AYFA 4ARCA 1SSOA 5IT9L 2JA6B 3M4OB 5C4XB 3T3NA 2NVTB 2EXDA 1ICWA 3GTQH 4FDBA 2F3WA 1IBLL 2KDMA 3P75A 3K81C 3R66C 2CH4A 2NVXH 4N6EB 1JORA 3AMUA 2K5DA 4ZRKA 1EYCA 5GROA 3HP3A 3GTLH 2X6LA 3VUWA 4BZAA 2EY2A 2KYWA 4OIJA 2DYBA 1GHJA 3NRZA 3HS0C 4JI2L 3U52E 2ZXPA 2PW7A 1WJUA 3CC4A 2BVCA 1X3GA 3U4ZA 2A6EC 1EEID 5C4HA 4A3FH 2BH2A 3S9WA 1TWAB 4A3GG 4WWPA 1GJXA 3E0JA 2KK8A 2UU9Q 5EBCA 4CGYB 1AN8A 3T1YQ 4NPSA 2ZJPA 1C4AA 4P73A 4XQQA 2DAFA 4RM9A 3UQBA 5M5XB 1N6ZA 1I4QA 1FVIA 1SAPA 1KD1C 4DR4Q 4REZA 1ZGUB 4UDUC 4JWUC 4XIGS 1MHHE 2UU7A 2JZPA 4DR7L 3EIVA 2XTIA 3L08A 1SYEA 3D4RA 4C3HH 3STBD 1Y1WB 2MA9B 1U0LA 4NAWB 2Q5WD 5EE9A 3PPAA 1DOLA 1PH4A 1WRIA 1GC7A 5KHOA 2BGFA 1GKHA 4LF4L 2RR9A 4EEWA 2JA6G 3OTOQ 3ICEA 4A90A 4IPHA 5ISRA 2ZPYA 2F0OA 1NR2A 3HG9A 3FILB 5I2XA 1VQ8A 3RZDH 2F1MA 4EZLA 3I7FA 2F0JA 1IBKQ 2Z0DB 4BXXG 3TEZA 2OWOA 1YIJA 3A1QA 2KCTA 3I4LA 3AE7B 4K6LA 3CIRB 3CF6E 3NZ3A 3GTOB 3N30A 2I5LX 2F0PA 5I9PA 3MEHA 2BE5C 4JI8Q 5TR5A 1N5WA 4IUPA 3S1MH 4WWNA 2A74C 1G91A 1S5BD 2BS4B 3OLMD 3CF5A 1PTOB 2V1YA 3S2HB 4WH4A 5IAAC 1WTOA 2BB5A 2LGDA 2YEPF 4KGRA 1CHPD 4R4TA 1STEA 3N1XC 2L52A 2N55A 2KFKA 4A3JG 3BIID 1K8MA 4L5QA 1S3SG 3WAPA 4RMFA 1XTCD 1CA5A 4EGVA 1F2ZA 1AW7A 3R8BA 3N1YC 2VUMB 2LUMA 1TS3A 4LF7Q 4I6NB 4FJYA 4ULLA 3FKIG 4E3CA 1R4PB 5KYIA 1A3TA 4GNXC 1WSPA 1PTOD 4ZK9B 4HIDA 2L5TA 2TSSA 2BDNA 4PMWA 1R4NI 1Z2MA 2L0TA 2NCNA 2GMIC 1IKLA 1E7UA 2OJRA 4UAIA 1J9OA 4EE2A 1LTAD 3MHZA 4AP4C 1KIXA 2HT1A 3S16B 3ML8A 2LS01 1DOIA 4GGQA 4JI3Q 1G6PA 2KDFB 2LZ6A 2OEDA 3MTNB 3Q3FA 5IKCM 1QNUA 2EOTA 3HRZC 3VH3B 1K0SA 2BS2B 3K7AB 2LGXA 1CK1A 2UXCQ 4GKKQ 3VR9B 1R9TB 4RGNA 2NBUA 4B0EA 4N58A 1JJGA 2UUCQ 1YHQA 2R2QA 3BZKA 4XX5A 1F2LA 1TY0A 5M9OA 3AE9B 1EWYC 3E56A 2VQEL 1RTNA 1VMCA 4HIOA 4AOFA 1P8LA 1JR0D 1JWMD 2WINB 2CHXA 3ITPA 4K6DA 5K36G 1Q1OA 1FNUA 3AFQA 3N9YC 4KZ0A 2NBVB 4FBJB 1BMLC 3RYTA 5NUCA 1E24A 5C3XA 1L7YA 4GMVA 3U58A 4Y52H 3HOUB 3I73A 4KJNA 3LDZE 3KOJA 3I8ZA 2VL6A 2RF4A 1VCIA 1VS0A 2C7HA 4G11A 1GJZA 4BBRH 1ESRA 2SDFA 1F2YA 4KKIA 1CSQA 2EYJA 1BVSA 1JC7A 4HXDA 2UU9L 1WYGA 2KMMA 4DK5A 4W9HA 4M0WB 2O6VA 2PVOD 2G4SA 2DYOA 2KFJA 5BYSA 2WFWA 5M3FH 1JE5A 4MSMB 3NUHB 3PHXB 4A6QA 3RLOA 1WX7A 2GBMA 1Q46A 4V0BA 1V5TA 2FCNA 1WM3A 5E3FA 5IY0A 4OX9Q 5CV9A 2K22A 4DHJB 1JB3A 4K8JA 4YY3L 3NQTA 5D6JB 1DOKA 1PZID 5IP9G 1UGJA 2JA7H 2N9KA 5M3MH 1YHBA 2Y3AA 2FINB 1A6XA 5KIXA 1AH9A 3RZFA 1FFVA 2RGFA 1TKGA 3APDA 4YHHQ 1ONLA 4FXKC 3LXFA 1L4ZB 2QCPX 2R7ZH 2CHZA 2VRRB 2HE7A 1YHAA 3U50C 5EPKA 2R93H 2M0AA 4KHPQ 2JA5G 2O2VB 3V05A 1XNRL 3PS6A 2QA4A 4XDXA 4KI0A 1C4PA 3F2DA 3ZUNA 4DHJD 2ZVNA 3TEXA 2NN6G 1JJ2A 3I3TB 2LXCA 1H9RA 5A2QE 2LUEA 4HKQA 3NEMA 1G51A 4F8MA 2FCMA 3S1RH 1K9MC 1B1ZA 2BWES 1Z7TA 4AYBB 4HPPA 5T1GA 1WR6E 1QZEA 2I5HA 1YQ3B 3E9SA 2E76C 4KVGB 4K1RB 2V1CC 5IYDH 2H5XA 2Z6KA 4MDKE 3IKJA 3HM3A 5D94A 3ZJTA 1XMQQ 3L0WB 2B2VA 1BNZA 2ENBA 4BA1I 3S17B 4C3IB 1ZXIA 1UF0A 4NZLB 4A3BH 3J81i 4P16A 2MHJA 5IP4D 4RGTA 1QG7A 4OGQC 2ZPNA 2F0KA 1JOOA 5C3WA 5IGFA 3J80c 2L15A 5IYCG 1RJTA 2GOWA 2L0FA 2XWBB 1ZE3D 3I5JC 2Z59B 1RRBA 1JQYD 2KDEB 2RSUA 3KW5B 5AEKB 1TS5A 5HG2A 3Q8EA 3ND9A 1PFMA 1UGMA 4DGZA 2EQSA 4A3IG 4I7ZC 3HHMA 4IUQA 1WH3A 1XD3B 3VTVA 2ASBA 4C3JH 3WALA 3CKIB 1QOFA 1OXTA 1GHKA 2EMSA 1VQJA 2IYDB 1D5XC 1A2UA 2OF1A 1F9JA 4GN5A 3QWNA 4CJ1B 2ZEQA 2LY7A 3EHVA 5CX3A 1IW7D 2DENB 3Q8FA 3HKZB 3AMZA 1CZGA 1E8ZA 4R4CA 5C44B 1SSNA 3I3CA 4ZCKA 1WE6A 1E10A 2O5IC 1B53A 4G7ZC 1VQPA 3KDFA 2UUBL 2Z0EB 4LF5L 1ENAA 5AJ3L 2IGHA 4MGYE 2JN4A 1GPXA 1AZPA 4XQJA 5KRUA 4B6WA 4POFA 4IJHA 2FFKB 1SR3A 1ZXHA 3PUZA 3I90A 5I6YA 4WQMA 3IG3A 1YZ6A 4KD3A 2X8XX 4AYBG 2IW3A 1QUQB 1LM8B 1J19A 3VXWA 1B8AA 2J0KA 4KTAA 3ZVVA 2ZTCA 2XK5B 3NHHA 2B76B 4A3GH 1HUMA 2HD3A 2K6DB 1SNDA 1SMXA 1SFOB 1VQ7A 1XLOA 1DCZA 1S4ZA 1VR9A 4KGTA 4BKTA 4PG3A 3OPOA 4M8MA 2AL3A 4MSQB 4YL8A 4R1JA 4J3OD 4ZRIA 3CCRA 4NXNQ 1LABA 5CV4A 3ETRA 4PZ6A 2BBCA 5J17A 4DAVA 4F8CB 5FLXL 3AEAB 5DEHA 3IVFA 3SFEB 3W5VB 3T9LA 5J39A 1KRTA 3TS0A 3KYCD 3QX1A 2K4KA 2F0HA 2B63G 2EKEC 1MJDA 3H0GB 1C7YA 3E6ZX 4MH0E 3QWZB 3IBEA 4B3SQ 1W3SA 2D5DA 3TBIB 2B3AA 5CYUA 1K83B 2L83A 3DVNV 4K3BA 2WP8J 1JRPA 2LGYA 1VQHA 3RNAC 4MZ9A 3VAWA 3AXCA 1HNWL 4HJ8A 2KVRA 1KDCA 5HGQA 4A55A 3NSWA 3P4PB 1Z9FA 4H13C 2JA6H 5C4XH 3M4OH 3KQ4A 2NVTH 4OWXB 4PYZA 1CM9A 3D8GA 4IUNA 4AYBE 2XBBC 1J7CA 4F7XA 1UBIA 3V61A 1SYGA 3SGIA 3C19A 3VYSA 3WANA 3H7PB 2HQLA 1IGCA 1YNJD 1XLPA 1F9RA 4KHPL 3C8YA 3NS1A 1LYLA 2F0UA 3LNNA 3J9CA 4NAWA 2B39A 4DK6C 4HIKA 1I50B 3ZQ4A 3MXUA 3PRMB 2I1KA 3J81E 2XN9C 3VH4B 2B2YA 5CR3A 3ZKJC 1Y8NB 3QOLA 1SF0A 1B9MA 5JXVA 2NN6I 1YD8U 4ZRPA 4IO9A 4R9WA 3H94A 1TWAH 2RSNA 1TJEA 1WGKA 1MGSA 2QCZA 2WGSA 2AQ2B 4M8NA 2IBIB 2DJFC 4UP8A 4C2MB 2BWFA 4HROA 2N7EA 4C7ZA 4MM3B 2KXJA 5JHBA 3R93A 2ONQA 3TSSA 2WXFA 2L4NA 4TKOB 4HEDA 5C5MA 5M5XH 3MEFA 3ONSA 2GRIA 4B08A 1XMQL 1LV9A 2F4VQ 5IYBG 1TWCH 4DNIA 1N8RC 1L6VA 1UBQA 3TP5A 4JI1Q 1OXSC 3Q14C 4XXEA 4OVVA 1YVCA 1PDXA 4ALPA 2I2YA 3PIOA 3ZDTA 2NVYB 3H0GG 4AQYQ 3P4QB 2HJ8A 3BINA 1SE2A 1Y1WH 2FHTA 3MJ5A 2KWDA 4X62Q 2KTRA 4BBSB 3JYUA 1FFUA 1STGA 5LMNW 2INCC 2IO2B 5EE3A 3DHHC 2JY6A 3X3NA 2HQEA 2JE6I 2J42A 3TP7A 2C35B 1HCZA 5E4WC 4OELB 4DXAB 4DV5Q 2LFIA
chains in the Genus database with same CATH topology
1D1KA 2D5GA 1F2RC 1JCKB 3KLSA 2PNRC 1YJJA 3A56A 3S15B 1M8AA 1Y56A 2ZW0A 3LYYA 4DAYA 1BR9A 3UI2A 3OSOA 5IGBA 1J7AA 2K0PA 1PTOH 5K36H 3GV6A 2A68C 1HEZE 3I57A 3M4YA 2B8FA 1DJRD 2KVMA 1HRJA 1SYBA 4ABNA 2DYMA 1STHA 4H2AA 3MXNA 4Q2JA 1VDZA 2JSVX 2KCNA 3PUXA 2WLBA 5ELCA 1LTSD 1RD9D 2MH7A 1B2TA 1HTPA 4KKUA 3B2FA 2D2CC 3HOVB 1EIHA 3S1QB 4CKBA 3IT4B 2IDYA 2YU9B 1KNEA 2Q8TA 3I91A 3J80L 1NAPA 3MAQA 5J1ZA 2SOBA 5E4XA 4C3HG 3HUIA 4IDIA 4XT3B 4M0WA 1EY5A 3NP8A 2J53A 1WTVA 1RCVD 3VR8B 1KABA 1F77A 2NN6H 4K5WA 4M8AA 2K3UA 1E7PB 2TMPA 5D7GA 1QF6A 1FCLA 4NMZA 1RFKA 3FDTA 1PGBA 3TP6A 2DY7A 4RF0A 4FNFA 3RD4A 1QB5D 3AEFB 4J8QA 4MH8A 3NQIA 2WXOA 1XYIA 4YSZB 1IL8A 3PIP3 1XEEA 3CWIA 3FEWX 1ZXTA 2EE1A 3H6MA 3DXJC 1U4MA 4WURA 4KHZA 1L0VB 2H89B 1U4RA 4E6IA 3U4EG 2D62A 1HUNA 1BCPC 2I46A 4RGMA 4U673 1SJED 3GTMB 2BDOA 2NYZD 2V4DA 4KN4C 3BK1A 1I6HB 1BUIC 2QIEB 1LT3D 1RYJA 1ML0D 4A3KB 1EWHA 4YWGG 1GUGA 3R2TA 3Q69A 1W6KA 1ZYRD 4RFBA 1S5FD 2HDLA 4YTMB 3NK9A 1V8QA 1AWDA 3H3VC 4IUUA 3QB3A 3G7LA 1WXQA 3GS2A 1KRHA 1V1OA 3AU7A 4OO1I 3FC4A 4XE0A 1OFFA 4L63B 3VA7A 1DYQA 1S5ED 3P20A 2WKDA 5JEAJ 3AEDB 1L6UA 4MACA 4LJZC 2QSDA 2H88B 4RH6A 2JQRB 2JEAI 2K28A 1QNKA 4H0LC 4IN3A 1P7FA 2B2WC 1LTBD 1FNVA 2PO4A 5BYQA 1R7SA 1DOXA 2D9UA 3V96A 2PW5A 4HEA1 2INNE 1F9PA 4RA8A 1TZOA 3BDLA 5I2YA 5AFWA 3ZJVA 1TQOA 3VR2A 2G9HD 5HI1A 1SDFA 4ID6A 2N7JA 5ELDA 5EJWA 4YT0B 3TDQA 3DM1A 2WAQB 3AEBB 4DF7A 5CC4A 2JX5A 4ZRQA 3HEJA 2DN8A 5C4JB 4FP5D 1PDQA 4A3MB 3S14B 1STYA 1UEAB 1IGDA 4XT1B 3HOZB 4WWMA 1Q8IA 2A6HC 1XLNA 1I4GA 2CJOA 2XVSA 1YNND 2IT1A 4OVZA 2MGSA 4O1NA 2PVGC 2F0GA 4IUTA 4RNAA 4A9AA 4C3JG 5C6AA 3K58A 2ZXRA 4KGSA 1DGJA 2CW0C 3QG1A 1B50A 4DN4M 1VRAB 3KK7A 2K03A 5ELEA 4ZLTF 2B2VC 5JAVA 4K8IA 5C0XJ 1NI3A 5HGTA 4OHJA 2BA1A 1LO5D 2K5QA 3MHBA 5LL6X 4OO1H 2PZWA 1MI2A 3M85A 4IALA 4TMAB 2F0DA 1HZ5A 2SAKA 4Y7NB 3HOYB 5E6JA 1HFGA 1YN5A 2V4IB 2FE8A 4JBWA 2AUJD 1KNAA 2JYOA 4DNTB 3AE5B 3M3YB 4L23A 3U9OA 2K9XA 1C48A 3GQBA 2LEKA 2AQ3B 1UUPA 2KJXA 3UI3A 5KEEA 4QUFA 2B8GA 2RDFA 1BBXC 2IX1A 4ITKA 2CHBD 2AX5A 1C9FA 1HPCA 2KA7A 3WOEA 3LB8C 4ARIA 5BMHA 2K7VA 4FXCA 2L32A 2IJ0A 1MHXA 1TWHB 2DWQA 4A3EB 3SK8A 1V97A 2EXZA 4IURA 3LWEA 2KEEA 3JAME 4R8IA 3P63A 4TQ0A 1IBXB 3KLRA 3I70A 2SEBD 1Y8OB 2SNMA 1H9SA 2WQYB 2NTSA 3W2DA 2E2DC 5D3IB 1T3QA 3AE4B 2KACA 1T5XD 1MD2D 4EQNA 2G1EA 4CJ0B 4N59A 3PO3B 4HN7A 2NTTA 4XYQA 3D4DA 4KD4A 4ODGA 3Q8AA 5CV7A 2CVRA 4JPSA 3X3MA 3W5UB 2B2UA 2NMQA 1SE4A 1N62A 4IQZA 3P7JA 4O42A 3U7ZA 1NVID 3HVZA 3MXGA 1ET6A 2PTLA 1B9NA 5F2DA 2B2YC 2M00A 3AE2B 2AWOA 5C3EB 2JXTA 3T51B 3AE6B 3AN1A 2Z1CA 1GUSA 5BN5A 1STAA 1B44D 1EL0A 3FMCA 1FR3A 1DD2A 1DOYA 3PV0A 1NSNS 1TY2A 2WXGA 4L2YA 2QF7A 3DMUA 4ZOHC 3SFDB 3NTIA 2RQXA 4JWSC 1XCTL 1WTWA 2EYOA 2LKVA 3VR3A 2JEBI 1TKWB 1JOQA 2EJGC 1PRTC 2BS3B 3ABVB 4D2KA 1BCPF 4HCEA 1UWMA 2NBFA 4HMJA 3OW7A 1VZ8A 1B9RA 2FJ2A 4K5XA 3NWSA 1PGAA 4AQ7A 1JOKA 5CV6A 1I3QB 1RWSA 3TEYA 4KMUC 3P4RB 1QWYA 3WCQA 1OXXK 5BYRA 2K33A 2XRQD 1N61A 3MFYA 1KDAA 1FM0D 1JWAD 1EYAA 3ZYYX 1XCQL 2JSOA 3MC0B 4LK0M 5HFYA 2OT2A 4XQNA 1STNA 1NUCA 2I38A 3BDOA 3WOFA 4HSVA 1H9KA 5FK9C 2L55A 1L4DB 3FRPB 2BB6A 2W82A 1WD1A 1EY4A 4PMCA 5ELFA 1ENCA 2J7ZA 2PKOA 1T6BX 2M56B 1CJEA 4USAA 2L11A 2IX0A 2XIWA 1L5PA 4CJ2C 4IFDJ 1QQRA 4CKEA 4L8JA 1XX8A 1I4RA 1E2WA 2BOSA 1QOAA 3NWTA 2E75C 2MJEA 1D1IA 4BY1B 4YSXB 1FRDA 4NDXA 3LWUA 3VR6A 1HHVA 1I4XA 1I4PA 1A2TA 2F0QA 1GAQB 2WNMA 1VLBA 2WXIA 2J0TD 4GLSC 3AH7A 2Y5PA 3AV8A 5COYA 3CHBD 3GV3A 3TN2A 3MZ5A 1Q3LA 4RCNA 4KY7A 5IGGA 1RHPA 4ZRZA 1BO0A 2NUCA 1MSGA 2IPKD 1GUWA 3NBHA 4BS9A 5BN4A 5G3LF 3EVQA 1YNTE 1LTGD 3I72A 1YN3A 5CV5A 4A8XC 2N88A 1CI3M 1Z6HA 5M5WB 3ERQA 3Q8BA 1RODA 2O2LD 4C3IG 4ZHOA 3IL8A 1PFDA 1IW7C 1TR5A 3PO2B 2PMZB 2EYFA 5D3DA 2QILA 2BCOA 1O78A 5KYLA 2XNAC 3N52A 2X6GA 1LTRD 2E74C 2A69C 2CJNA 1MI0A 3T56B 4L6TB 5DM73 3QOJA 2BW2A 3G6JB 2CU3A 1WWTA 3K57A 3BK2A 3AE8B 2O5JC 1J7BA 3A8KE 3DWGC 3F2UA 2WXQA 2EYHA 4FXDA 3S2DB 1GOZA 2I07B 4P2CB 4A3DB 5JVH3 2MJ3A 4X3SA 3IT6B 3I4NB 5EKIA 4PMBA 5M5YB 2E2JB 1PUTA 1RKNA 3BDCA 3VR4A 1WD0A 5EKKA 2NWGA 1EY6A 2PLPA 1OXVA 4K14A 3I4MB 3FILA 1IBXA 2RDHA 1D6EC 1NCVA 3OOCA 2VB3X 2Z8LA 2FBWB 5KNBA 3ZGZA 2RBMA 4TRDA 1X3QA 2A5HA 4LAAA 1RF2D 2KQ3A 3J80E 4KKTA 1RM6C 2MPMA 1KH0A 1Y69U 2KHSA 3GTQB 3IFTA 2FMCA 2V3NA 4HR7B 1S5DD 1SMYD 3H91A 1TVXA 5IODA 1DZ1A 5FR3A 2MUYA 2KQ4X 2JA8B 3BG3A 1TYGB 3T3OA 1JWSD 3GTLB 3W3AA 1O7LA 1RDPD 1QILA 2HCIA 4RHRA 1EOTA 2EY5A 1G2SA 5CBEE 1SB3C 3D3RA 2BTEA 3Q24A 1Q1BA 1Q10A 2A68D 2WXJA 1X32A 2BYTA 2A73B 4B0MA 1FGBD 5IGDA 3BYTB 1GUNA 4OO1G 3CRKC 1GB1A 2YEPB 2H1EA 1C4CA 2BT6A 2QMTA 2RPVA 2KOLA 4OL7A 3ZJUA 1O80A 3HVDA 1FO4A 3TZDA 5CMDA 5G5HA 5HURA 2EJFC 5EQ0A 2L0CA 2PZTA 1NYRA 2L1BA 3OIQA 1CT1D 2KECA 2WB1B 3V3XA 3PUVA 3HZXA 1Z47A 2EYPA 4FF4A 4LK1C 4YXDB 3RUZA 1G291 3J81L 1A70A 2M19A 4BY7B 1PTOF 1WCMB 1FRRA 1JROA 3K6OA 5C0XH 1KLGD 1LT4D 1PRTF 2Y5CA 3PZ8A 4IKGA 1VF7A 4JK1C 1EZ6A 3M7NA 1H9MA 5JVG3 2ZT9C 1Y1VB 3K5OA 4PV1C 3NTKA 5EBDA 5KNDA 4C56C 1OO9B 3VQIA 3SHLA 2JYTA 4G4KA 1I7HA 1BCPB 1PZJD 5KNCA 1PMRA 1T5EA 2MP1A 1K8OA 1LTID 4MT5A 1H9JA 1SNQA 3HOXB 2WDRB 1FCCC 1SE3A 4QCLA 4FYDA 4FXGC 1IUEA 5EE0A 2HUGA 2L9HA 1AP0A 2K04A 5AUKA 1BCPD 3L3OC 1N60A 3C2PA 4JX1C 4KN7C 2SNSA 3T16A 3AE3B 4MIUA 5JJZA 4XWWA 1EZ8A 4DK0A 1MVKA 1CZWA 1TWFB 3ND8A 3K59A 4HSPA 4ZHPA 2PYKA 4U68A 3URYA 2W54A 3A54A 3MFGA 5A35A 1QOBA 2FUG1 1E0ZA 1E9MA 2EDGA 2LJIA 2B2UC 3IAYA 3KWVA 4NW2A 4RAUC 4QF4A 3GB1A 2F0TA 4CHTB 3A7AB 4RCOA 2ON8A 4F88A 3A7LA 4IZ8A 5ELBA 2VXWA 5IIFA 3W9CB 1QJOA 3PZ7A 2J52A 1LTTD 2K6AA 2J4XA 2DBYA 1TKEA 1HA5A 3EROA 2PW9A 3SR1A 3DWMA 5G5GA 2MJDA 1PZKD 4YIJA 1PGXA 1EU3A 3BWUD 4PNYA 5IT9E 5LHY1 1FEHA 3DHQA 3RZOB 2F3VA 3S1NB 3RMHA 2XSCA 2K1BA 3J7AF 4MHEA 3GTPB 4NP5A 2H4OA 1WVLA 1TIID 3NVYA 2WDQB 1V8CA 4HRSA 4A93B 3AB5A 2DNEA 3P1MA 2WP9B 3NBIA 3KUPA 5C5LA 2E2HB 2Z4IA 1J8IA 4R8NA 4KY6A 2LGIA 1A15A 1B4OA 1HA6A 4AS1A 3VA5A 3HOWB 3GO5A 3NVVA 2A6HD 2K5WA 1ZEQX 1O7ZA 5K5PA 3C1EA 3DEOA 1ET9A 5T1IA 1FXAA 4PT5A 2V3PA 4DA2A 1Q12A 1FXIA 1FNWA 2AQ1B 5EPLA 1DM0B 1HTLD 5CORA 3LX0A 2HDEA 2CW0D 4X3KA 1BUVT 3A55A 3U2SC 2HCCA 3HGBA 3OIPA 1HZ6A 2W3RA 2IGGA 2WXRA 4RHSA 2WIIB 1F9SA 2WDVB 1Q1EA 4XWTA 3TEWA 5EKLA 4DQOC 1F2MA 4FF3A 4HMIA 1JICA 1UNSA 5GXGB 2F4IA 3K5LA 4IFDH 4OZAA 2A6ED 3W1SA 2NB0A 2E2IB 4WORA 1SNCA 4YTNB 2C5CA 3FVQA 1HQRD 4EQPA 3PUWA 4KKSA 2W55A 2EJMA 2EYMA 3NXWA 3VRBB 4L1BA 3C3LA 1OQQA 3EGRA 3IAM1 1WTXA 4C1NI 1D4BA 1CQFA 1VF5C 4P6VF 1D2BA 3BS1A 3E5SA 2PZUA 1TKYA 2OHFA 1QOGA 5C2TB 4XDCA 5LNK1 4IUVA 1R4QB 3RPFC 4A3JB 1QCBD 3GD7A 4FVMA 5J22A 4G7HC 3DWAA 2ACZB 4RGOS 2R3ZA 1TWCB 2BE5D 4C7YA 3EA6A 2WXNA 2RA4A 3FAHA 3FKIB 1LT5D 1BF4A 1EEFD 1LT6D 1JALA 3Q22A 3C46A 3AM9A 2AWNA 1EFID 2GA4B 2DY8A 5IGEA 1SJHD 3L9AX 1EIGA 1W6JA 3D6CA 3KF8A 3GTKB 4CKCA 1YJIA 1C78A 1ZUD2 4KJOA 3MA2B 2VZKB 4OW0A 1KDBA 2MHVA 5JEAG 1MSHA 5T8IA 3T4AC 1GXDC 4KX6B 4XDDA 2F0MA 1N63A 4C80A 4WAFA 4US9A 2VZKD 5EPJA 2JXMB 3QIAA 1CA6A 2HTME 1PRTB 2E3TA 3NE5B 4C1NK 2WV6D 1K53A 2F0SA 1VDVA 1E6EB 5IOCA 3OMGA 1AZQA 2EYLA 1OQRA 2QKIC 1B3AA 3FPUB 3ONAB 3K0YA 1EY8A 2PMVA 1GUTA 1PRTD 3IXSA 2RKSA 1PTOC 1Q90A 5FOBB 5FO9B 1YMHE 2M9VA 1CFMA 1II3A 1SNMA 2WS3B 1EY7A 5EE1A 4NAMA 2B2TA 4KV6A 2JA5B 4ME5A 2B2WA 4G57A 3L7ZC 1ZP0B 1C76A 5FO7B 3PO0A 3JAML 2WXKA 3BZDB 2F0FA 1AFPA 1L0XB 1CHQD 3EQLC 1QE6A 4HJGE 4GZYC 1GB4A 1TWGB 4ZYSA 3J7AV 1FIQA 1KF6B 1QLBB 4XYOA 1WTRA 1SYFA 5C0XG 1SYCA 3NUCA 2WKCA 1DONA 4HTHA 3J7YW 4KKJA 2F0NA 2R92B 1Y8PB 2RSOA 4Z9CB 5CBAE 1NEKB 3EUB2 5DM63 5I9OA 3U9SA 4A3IB 4EQOA 5H8YE 2INPE 2KCCA 3NTHA 3MWYW 2Q8RE 3TUOA 3H8HA 5FLXE 3D4WA 2F0VA 4LTUA 1PFNA 2GI9A 3TMEA 1P7EA 2NVQB 1VZ7A 2R6GA 1IYVA 1HXYD 4FF2A 2XWJB 5JOBA 1PLFA 5BMIA 1KAAA 1QT9A 1VMPA 2IL8A 3D31A 1O7YA 4BWGB 4RWSC 1IKMA 1FYCA 1YQ4B 4S3SA 4QUCA 3D6WA 1SXTA 4LLGM 2PIAA 2Y0SB 1ZOYB 3KWLA 1EM7A 1I6VC 5C4ZA 1SIJA 2R61A 3N6RA 2G9DA 2EKIA 2YYZA 4B9WA 1YN4A 2K05A 2B63B 2XRSD 1PYWD 1M4VA 3PIO3 1ILPA 2ICEC 5BN3A 3NPPA 1A3VA 3TZUA 3CQZB 4B9XA 2LMCB 3SK4A 1FMAD 3GTJB 2QEJC 4EVOA 4GDKB 3KBGA 3PUYA 4OIKA 1U4PA 2A69D 5JPMC 3SK6A 3P4SB 1ZPSA 2L1AA 3C1FA 1ENFA 1EY9A 1CTMA 2C9OA 3GTGB 3SVMA 1VJKA 5A2QL 1JQ4A 1NENB 4I65A 2X38A 3QO2A 1FD7D 4K2LA 4DU9A 1KFYB 2V0GA 1X3PA 5D65A 1UWXA 4J6HA 3T13A 4K5VA 2KEDA 1TS2A 5C0XI 4MN3A 1V1PB 2MEKA 2E6XA 5JPNC 3MTSA 4X3TA 4DNRB 1WTPA 1C77A 2O4XA 5CGKA 4DXGA 2RVLA 2WXPA 2PQEA 3A8JE 1CZPA 1U4LA 1JMLA 2WXMA 1TT2A 5JEAH 4OZBA 4DK1A 3PMFA 4YTPB 5DAUA 4HKZE 3NVZA 1BQQT 1NR4A 2BA0A 2EVBA 1LLRD 2K01A 2F0IA 1YNJC 2LFNA 3DEPA 1PXUA 4TQ1A 2F0WA 4PQXA 2NVXB 2WU2B 2HDMA 1TU2B 4X3UA 2N9LA 4TSSA 2EY1A 5IGCA 3QJYA 4JE3B 1F9QA 4A3FB 1ZKOA 4IOIE 1E2ZA 1SEBD 4M1UB 2FMMA 3AEGB 1ESFA 3EJIA 4RKLA 1E2VA 2F03A 3T53B 4ILWA 3AEEB 4WFN3 1GUOA 1SMYC 1IHZA 2QJLA 5C3JB 4IFDG 4C3HB 1ACCA 3R3OA 3SDZA 3VRAB 1N5XA 4WRDA 4RKBA 3FPPA 4V190 1EWCA 3M7GA 3OHXC 2PPBC 3SE0A 1F0ZA 5AUIA 2N0SB 3RZDB 2VB2X 3AECB 1D5ZC 5HHDG 3DUZA 5E1FA 3Q8CA 2JP1A 4KY5A 1PFBA 4CBVA 1FD6A 3KLSX 3SXHA 1XWEA 3S1MB 3RFZB 2F0EA 1KLUD 2EY6A 3K5MA 4ZQ3A 4XTCS 2K32A 3VYUA 5I4DA 3VYRA 2OEOA 3TP8A 3NVWA 4G7OC 1ROEA 1E0BA 5EGTA 1DXMA 1UAPA 5FO8B 2CQAA 2Z4HA 3VYTA 4YSYB 1SYDA 4KHVA 2JWUA 1NYQA 1H9SB 1SBBB 1XO3A 1VZ6A 1BDOA 1K50A 3CU7A 1XF5L 2LHEA 5D14A 1XLQA 3R2IA 2EELA 4DFAA 1HQMC 1S5CD 3B9JA 4Q5VA 3Q23A 2WU5B 5CV8A 2WXLA 1TS4A 4WIPA 1OXUA 1DOMA 1CQVA 2JYEA 4NKLA 1C8CA 2KAJA 3B2GA 5H92C 3KBXA 1RTOA 2K5PA 1EU4A 4K2KA 2X69A 3V2TA 2IGDA 4BBRB 1EQTA 1STBA 1XXGA 3BVMA 1I4HA 1K52A 2KUMA 2NZ1D 4Q0FA 5M3FB 3P42A 4QIWB 4ZAIA 2OXPA 1C79A 1G2TA 4NJCA 4H44C 4KK7A 3SR6A 2IX3A 1L0YB 2JA7B 1G6ZA 2JU6X 5M3MB 4RF1A 4J1MA 3BVZA 3O13A 3AB9A 4IFDI 3CRLC 2VNUD 1V43A 1F2RI 4OZCA 4LMQD 2R7ZB 3RLFA 2KN4A 1EQVA 2R93B 2W3SA 5MPOA 2AUKA 3OMCA 2LMCA 1ZYRC 2LHDA 4TQUS 1C4QA 1SNPA 3GP7A 1ZDXA 3SK5A 3WDNA 2ICIA 3S1RB 3IFDA 1SNOA 5I6WA 2RDGA 1EYDA 2QDBA 5BMGA 1JW9D 2DNCA 2RMMA 1D5MC 1JWBD 2F0LA 4A3BB 3BVGA 2Q8IB 1JWUD 2B2TC 3HRDD 2WXHA 1ILQA 4US8A 2ZXOA 4ZUJA 4N9TA 3MXPA 4ZKBB 3L4PA 3A8IE 3BYYB 3AE1B 2DLBA 4CQNA 2WACA 1BOSA 3EFXD 4C3JB 4R3DA 2M2LA 1QOHA 5G3LD 1V1PA 1KTKA 3SEBA 3OWFA 2ID0A 2EPBA 1EY0A 1A3UA 4BA2I 1HFNA 4GDLB 3Q0AA 3Q6SA 2IWHA 4QMGA 3OWEB 4WJWA 3DWQA 3IAS1 4ZUIA 3K5NA 2ZW1A 3I9V1 1ZDVA 1LACA 4DAPA 1JE4A 3P1HA 1G8ZD 4A3GB 2L12A 4ZKCB 5KGUA 1QKZA 3DWPA 2GB1A 4FO2A 5FKAC 1MBYA 2PCFB 4FF1A 5LL6S 1U9RA 1K51A 1BXTA 4QB4A 4HCSA 1MPEA 1YNNC 3MVVA 1AEXA 1WTQA 4H7BA 5DNFA 4DXFA 3VR5A 4F87A 4N9PA 3H09A 5TSSA 2EZVA 3MP9A 1IYUA 2MJ8A 4HAEA 1AYFA 4ARCA 1SSOA 5IT9L 2JA6B 3M4OB 5C4XB 3T3NA 2NVTB 1ICWA 2F3WA 2KDMA 3P75A 4N6EB 1JORA 3AMUA 2K5DA 1EYCA 3HP3A 2X6LA 2EY2A 4OIJA 3NRZA 1GHJA 3HS0C 3U52E 2ZXPA 2PW7A 2A6EC 1EEID 5C4HA 3S9WA 1TWAB 1GJXA 3E0JA 5EBCA 4CGYB 1AN8A 1C4AA 4XQQA 5M5XB 1I4QA 1SAPA 4REZA 4UDUC 4JWUC 4XIGS 1MHHE 2JZPA 1SYEA 3D4RA 1Y1WB 4NAWB 2Q5WD 5EE9A 1DOLA 1WRIA 4A90A 5ISRA 2F0OA 1NR2A 3HG9A 3FILB 5I2XA 2F1MA 2F0JA 3TEZA 3I4LA 3AE7B 4K6LA 3CIRB 3NZ3A 3GTOB 2F0PA 5I9PA 3MEHA 2BE5C 1N5WA 4IUPA 2A74C 1G91A 1S5BD 2BS4B 1PTOB 3S2HB 4WH4A 1WTOA 2BB5A 4KGRA 2YEPF 1CHPD 1STEA 2L52A 2N55A 3BIID 1K8MA 1XTCD 1CA5A 4EGVA 1F2ZA 1AW7A 3R8BA 2VUMB 2LUMA 1TS3A 4ULLA 1R4PB 5KYIA 1A3TA 1WSPA 1PTOD 4ZK9B 2L5TA 2TSSA 2BDNA 4PMWA 1IKLA 4UAIA 1J9OA 4EE2A 1LTAD 3MHZA 3S16B 2LS01 1DOIA 2OEDA 1QNUA 2EOTA 3HRZC 2BS2B 3K7AB 1CK1A 3VR9B 1R9TB 4RGNA 4B0EA 4N58A 1F2LA 1TY0A 5M9OA 3AE9B 1EWYC 3E56A 1RTNA 1VMCA 1JR0D 1JWMD 2WINB 3ITPA 4K6DA 5K36G 1FNUA 3N9YC 1BMLC 5NUCA 5C3XA 3HOUB 3I73A 4KJNA 3I8ZA 1VCIA 1ESRA 2SDFA 1F2YA 4KKIA 2EYJA 1JC7A 1WYGA 2KMMA 2PVOD 2DYOA 5BYSA 3NUHB 4A6QA 4V0BA 5E3FA 5CV9A 2K22A 1JB3A 4K8JA 3NQTA 1DOKA 1PZID 1UGJA 2N9KA 2Y3AA 2FINB 1A6XA 5KIXA 1FFVA 1TKGA 1ONLA 4FXKC 3LXFA 1L4ZB 2QCPX 5EPKA 2M0AA 3V05A 4XDXA 4KI0A 1C4PA 3TEXA 2NN6G 1H9RA 5A2QE 4HKQA 4F8MA 1B1ZA 1Z7TA 4AYBB 5T1GA 3E9SA 1YQ3B 2E76C 3IKJA 3ZJTA 2B2VA 1BNZA 2ENBA 4BA1I 3S17B 4C3IB 1ZXIA 4NZLB 4P16A 4RGTA 1QG7A 4OGQC 2F0KA 1JOOA 5C3WA 5IGFA 1RJTA 2XWBB 1ZE3D 1JQYD 1TS5A 5HG2A 3Q8EA 3ND9A 1PFMA 4DGZA 4I7ZC 4IUQA 3CKIB 1QOFA 1OXTA 1GHKA 1D5XC 1A2UA 2OF1A 3QWNA 4CJ1B 2LY7A 1IW7D 3Q8FA 3HKZB 3AMZA 1CZGA 5C44B 1SSNA 3I3CA 1E10A 2O5IC 1B53A 4G7ZC 1ENAA 2IGHA 1GPXA 1AZPA 4XQJA 5KRUA 2FFKB 1ZXHA 3PUZA 3I90A 5I6YA 4WQMA 4KD3A 2IW3A 4KTAA 3NHHA 2B76B 1HUMA 1SNDA 1SFOB 1XLOA 1DCZA 1S4ZA 1VR9A 4KGTA 3OPOA 4J3OD 1LABA 5CV4A 3ETRA 2BBCA 4DAVA 5FLXL 3AEAB 5DEHA 3SFEB 3W5VB 5J39A 2F0HA 3H0GB 3E6ZX 2D5DA 3TBIB 5CYUA 1K83B 2L83A 2WP8J 1JRPA 1KDCA 4A55A 3NSWA 3P4PB 4H13C 3KQ4A 1CM9A 3D8GA 4IUNA 1J7CA 4F7XA 1SYGA 3VYSA 1IGCA 1YNJD