2GOWA

Solution structure of bc059385 from homo sapiens
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
116
structure length
116
Chain Sequence
b'SSNVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein 3
publication title Solution structure of a membrane-anchored ubiquitin-fold (MUB) protein from Homo sapiens.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 17
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2006-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13881 Rad60-SLD_2 Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2gowA01
1I42A 2ZPNA 3L10B 3N32A 3S2AA 3U30A 1FXTB 2N4FA 3U7DA 3M3JA 2IO2B 4GMVA 1TBEA 1OGWA 1WMHA 1VD2A 3DVGX 3ONSA 1CMXB 1Y8RC 4HK2A 2HJ8A 2V3SA 2O2VA 3VXWA 3TJPA 2HE7A 4AWJA 4ICUA 4DBGA 1I35A 1WXVA 2KD0A 2KLGA 3VHTC 1WZ0A 2DYBA 2IZVB 3A9KA 1WJ6A 3AULA 2GOWA 3V6CB 2KX0A 4IW0A 4KZCA 4CHKA 3VUYA 3PTFC 4GGQA 3IFWB 5D6JB 2BKRB 3IHPC 4WWNA 2KTRA 4MGIE 2MCNB 3VFKA 2GBJA 3ZNGC 2KC2A 1GJZA 2ZPYA 2L76A 4ANWA 2BYEA 2PE6B 5D94A 5BO4B 3DQVA 5E6PA 1E8YA 1V80A 1WIAA 4IWPA 3OAWA 3ALBA 4BBNC 5J2RA 1WY8A 1RAXA 5C1ZA 3H1UA 4FA6A 2D10A 2NBWB 1S3SG 2DX5B 3PRZA 1K8RB 2KWUB 2K6QA 3NZUA 3DVGY 2BF8B 1IYFA 2D2QA 2G3QB 2ZCBA 3L13A 3ZTDA 4ANVA 1Z5SB 1WJNA 4GDLB 4MDKE 2K25A 1EF1A 4F7ZA 3EECA 4EZKA 3K9OB 2O6VA 3GOEA 2KWCA 1LFDA 2PJHA 2KFKB 2N7DA 2DYMA 2HD5B 1NDDA 4J6IA 3V62A 4G11A 1P3QU 4IM3A 4ZRKA 2RGFA 5CHWA 2L3ZA 1V81A 4WJQA 1YJ1A 3Q3FA 5LLIA 2LXAA 2LVPA 4MSQB 2K8HA 2MSED 2Z0EB 4FN2A 4GOCA 4ZYNA 2EMSA 3RCZA 2A5UA 3VTUA 3MHSD 4LJPB 2ZNVB 4XX5A 3QWZB 2AYOB 2MP2B 1UGMA 3OJ3A 2IY0B 4MJSB 3PSEB 2L00B 1GC6A 3HM6X 5D2MB 3RT3B 1GG3A 3ZKJC 3AU4A 4LDTD 3VH3B 4BVUC 2BYFA 3RUIB 2BGFA 2KZRA 2MWSB 4BKGA 4B9KA 2KX3A 3WAMA 1J19A 2DAFA 3ZNHB 2IO0B 5DPWA 4IG7B 4PS7A 2FIDA 2KJHB 2LRUA 5G2NA 3JVZX 2FUHB 4II2B 2EMTA 2MBHA 2LUEA 3L08A 3AXCA 5JHBA 2KHWB 2MRPA 3IBEA 4DDGD 5LXIB 4K81A 2LJ5A 1LXDA 1JRUA 1VCBA 2CKHB 3CSTA 4M0WB 4JQWC 4F8CB 2LRWA 3KYDD 2KFJA 2GMIC 3QC8B 2IYDB 3V6EB 3CF6E 4DHJB 1OEYA 4DWFA 1J8CA 3PPAA 2AEHA 1RLFA 1Q1OA 2WX0A 2OOBB 4A3OA 5FR6A 4AP4C 2K8BA 2LI5A 4AOFA 4BFRA 4LJOB 5KHQA 2IO1B 3MTNB 4PYUA 2G45B 3QIJA 4AUQC 3ML8A 2AL3A 1WXAA 2KN5A 3UIOB 2ASQA 3VTWA 1ZKHA 3KVFB 2L05A 4W9GA 3U8ZA 3JSVA 2K8CA 3P2BA 3UGBB 5L95C 2NBUA 3QCAA 4URKA 4I6PA 1L2NA 2MA9B 1WXMA 2C5LC 1EF5A 2L8JA 3CMMB 4TV3A 2D07B 4M8MA 2L0TA 2ZCCA 2J0KA 3T8MA 4AJWA 1UD7A 4E74A 4EZLA 4K7UA 1IPGA 1R4MI 4MM3A 2CHZA 2NPTA 2UYZB 3SD5A 2N1VA 4ZDVA 2CR5A 3ML9A 1V9JA 3V60A 1SE9A 2GBKA 3B08A 4YL8A 2RD0A 3MJWA 4FJYA 3ZO5B 3TBLD 2JF5A 1WFYA 4FJVB 1V6EA 3PGEA 4GDKA 4DXAB 1YX6B 1ZGUB 5DPTA 3I3TB 4EEWA 1ZW7A 3UQAA 2JT4B 3A9JA 5DCNA 2LWPA 1PQSA 4W9DA 2D3GA 1UH6A 2DENB 3QJZA 3PVLA 1TGZB 1BT0A 4B95A 2WX1A 2KJ6A 1EUVB 3ZRCA 1GNUA 4TKNA 5GMVA 1F9JA 4A20A 4GB9A 2ZVOA 3A1QB 4X57B 4EOYA 2REXA 3DVNV 1Q0WB 1H4RA 1E5WA 1UZXB 3TMPB 1XQQA 1Q5WB 1E7VA 3KUCB 2KDIA 4JIOU 3UF8A 3NY5A 2C7NB 2XK5B 2DZJA 4ANUA 3M95A 1WJ4A 4KIKB 4RMAA 3RZWC 2KXJA 2CHXA 2BWES 1QZEA 1WI0A 2FCQA 2K6DB 2KWVB 2NS5A 4GN1A 4IWOA 3C0RB 2DAJA 1YX5B 4NJ6A 4NQLB 3APDA 4KSLC 3VDZA 1E7UA 4W9IA 1NI2A 4LDTB 4DHZB 2KDBA 1TZ1A 1KJTA 1WH3A 4N9F4 4AJYB 2I1JA 2AWTA 5L83A 3SDLC 1WE7A 2K39A 2A4ZA 2N9EB 2MBBB 4FULA 4JL9A 2ZZPB 3X0WA 2DZIA 5DPRA 5J17A 2FAZA 4FHKA 2XK5A 3T9LA 3L16A 2MBQA 5KHOA 3UQBA 1C3TA 4FBJB 2FNJB 2IO3B 4BOSC 2GBRA 1WYWB 2FCSA 3DOWA 5JH5C 3M63B 3SHQA 2KK8A 3WALA 1P98A 1T0YA 4K7SA 4PS8A 2CHWA 2WWZA 4NPNA 4NNJB 4B6WA 1SIFA 1P0RA 4GDLA 4JLCA 3VH4B 4E3CA 3NHEB 1LM8B 2LVOA 4KDLB 2M8SA 3WIMA 2B3AA 2JY6A 4HWIB 5EDSA 2FIFA 5IAAC 2KFKA 2QHOA 1WGYA 3ZDMC 2XBBC 4MSMB 2C9WB 2O6VD 3APCA 4FLHA 3ZVVA 1Z2MA 1S1QB 2KLCA 4LCDE 3PHWB 3WAOA 2V4LA 4ICVA 3R66C 1YD8U 2UWQA 4MGZE 4KVGB 3ECIA 1UBIA 1YIWA 1OQYA 1P1AA 3H7SA 3ZRFA 2MLBA 2J0MA 2MP2A 5JHAA 4GSWA 4W9CA 4XC2A 1KOTA 3PV1A 4IWQA 4MJSA 1WR1A 1WXSA 5AZGA 3AI5A 2YVCA 3QK0A 5LXHA 4W9EA 5IA7A 2G4DB 3K9PB 1RFAA 2FCMA 2MBEA 3DPDA 3NZSA 4WJPA 2JZZA 2WYQA 2LVQA 2KTFA 3N3KB 2G4SA 4GU2A 5DPSA 1WX7A 2Z59B 3N30A 2FCNA 2KDEB 2IY1B 4MH0E 2C60A 4HJKA 1M94A 2N9PC 3PRMB 2LD9A 3WAPA 2KMCA 4FADA 2M4NA 3ZW3A 2YLMA 3VQIA 2MQJA 2M0XA 3VUWA 3APFA 3BINA 5E6OA 2JZ3B 3HK0A 3VVWB 3ZNID 2OJRA 3RD2A 2KQ7A 3GZNI 4TQ1A 2BWFA 3DDCB 3D32A 4NY0A 1MG8A 3KH0A 3L0WB 3LDZE 4I6NB 1KLVA 1HE8A 1WMHB 3W1YA 3LJ3A 1P9DU 2ZNVC 1WX9A 3PT2B 2BKFA 2KKCA 3WANA 4PS3A 4W9FA 3RZFA 4KZ0A 4MEMA 2O2VB 1OTRB 4KDIC 3ZTCA 5JZEB 2BYVE 2Y5BB 3PREA 3ZLZA 4KSKC 2NVUI 2ZVNA 2HTHA 3A9KB 4F1SA 3L54A 1KM7A 3QA8A 4IM2A 2J0JA 3PZDA 2V1YA 2W9NA 3PS6A 1C1YB 4DHJD 2DZKA 2KTRB 2LGYA 3IG3A 4TUUA 2M17A 4OVUA 5AEKB 1YQBA 3HM3A 5CHVC 4MELA 4BOZB 2CS4A 4CO7A 1OEYJ 2MX2A 4EKUA 5TR5A 1WM3A 3DVNU 4NAWB 3OLMD 2JXXA 1V2YA 3EFUA 1H8CA 3EHVA 3H9DA 2XEWA 4HCPB 2R2QA 3WA0A 3OJ4B 1WX8A 4W9KA 2NR2A 2PPHA 4XZ4A 3V61A 3QHTA 4PYZA 1GUAB 2JRHA 2VRRB 4WQOB 3A1QA 3JW0X 1R4NI 2O6VB 1V5TA 2DYOA 3M62B 3AU5A 4HCNB 3HHMA 3CSFA 4RM9A 4BBNF 3RYTA 4KV2A 1WF9A 3R7RA 5HKHA 2Z0DB 2IBIB 2KO3A 4NAWA 4WWPA 4KIKA 2DZMA 4ANXA 3EC8A 3ZUNA 4HLEA 3A33B 4HVBA 2JVCA 2KJRA 1L7YA 3KW5B 1E8WA 2I1KA 2LGDA 5CHFA 1WRDB 2LGXA 4DDID 3KYCD 2LASA 3SU8X 3A4RA 3QAQA 5J18A 2KMAA 2JWZA 4HXDA 4HDQA 4BKSA 4DHZE 4JGHB 3DBLI 4RM8A 4W9LA 4II3B 2C7MB 2LZ6A 2R2OA 4K7WA 3H6NA 3DBRI 1D3ZA 4MGKE 1WGHA 1LQBA 4EFOA 5AZFA 1EO6A 4DK5A 3QARA 4W9JA 4TQ0A 3NS8A 3O65B 3W1SA 4IM0A 3B1LX 2RPQA 2KQSA 3JYUA 3ZDTA 4G0NB 3Q3JA 3PRPB 1SGHA 3ZIMA 2KVRA 4MGYE 2J7QB 3IVFA 3R7QA 4G50A 1UBQA 2JUOA 1WJUA 2RR9A 2ZEQA 2N9XA 1UELA 2C7HA 3PHXB 2MBOA 4FJZA 5CX3A 1E90A 1WR6E 2AL6A 3X23A 4HPLB 4I6LB 3TIXA 2K1FA 2GBMA 4CYEA 3TCAA 4BKSD 4K1RB 1V86A 3UIPB 3BY4B 5C23A 4GXBA 1AARA 1GC7A 1NBFC 4W9HA 2PEAA 1IP9A 1WGRA 2JPHA 2KANA 2MW5A 4FHJA 4EUTA 2L7RA 2DHZA 3JSVB 3QQ8B 4ZRJA 5D7GA 2JRIB 1WGGA 2KOXA 3QX1A 1V5OA 4A3PA 2NBVB 4EZJA 4E71A 2BPSA 3H7PB 4IUMB 2KDFB 2L0FA 2CU1A 4NQKE 4WWOA 2M1MA 2EKEC 3ENEA 3DBHI 4NJ7A 4P7IA 1ISNA 2D11A 2WDTB 3L17A 1XT9B 3DBSA 4IC7B 4G3XB 3VTVA 2NPTB 1RRBA 2NCNA 3ZNZB 1E8XA 2LXCA 3B0AA 3RULA 5E6NA 4WJOA 2KNBA 2GBNA 4BKTA 2ZJDA 3W1SC 1U4AA 4HPMB 4WAAA 2RSUA 1WM2A 2KC1A 3HIZA 3KUDB 5G55A 3NOBA 3VAWA 4GDKB 2N7EA 3A4SC 1XD3B 4OVVA 3PLVA 1G6JA 3PLUA 2PE9A 3A9JB 3H7PA 1WGDA 4M8NA 3VUXA 1WZ3A 3DCGA 1A5RA 1J0GA 4WJNA 5CTRC 3TL5A 5AZHA 4ZRIA 1TTNA 4HDOA 3UINB 1X1MA 3KUZA 4GIVA 4ASWC 1V49A 1WE6A 3R3MA 2N1WA 1E8ZA
chains in the Genus database with same CATH superfamily
1DGJA 4BAXA 3L10B 3N32A 2JXTA 1XLQA 1FXTB 3U7DA 3AMZA 3DVGX 3R8BA 4L23A 4HK2A 4NAMA 1TY2A 2FBWB 3TJPA 1SE4A 4ICUA 5BYRA 1WXVA 2G9HD 2KLGA 3VHTC 2WXJA 1WYGA 3AULA 2ICIA 2GOWA 2M19A 1IGCA 4IW0A 4GGQA 1XCQL 3RFZB 2GBJA 1GJZA 4OZAA 4C7ZA 2PE6B 3DQVA 5E6PA 1E8YA 3OAWA 3ALBA 1WY8A 2JYEA 1S3SG 2OJWA 2D2QA 2G3QB 2ZCBA 3L13A 3ZTDA 1WJNA 2I38A 1FPYA 1EF1A 1ET9A 4BZAA 2KFKB 4YT0B 2N7DA 2HD5B 1YQ3B 4J6IA 5GXGB 1JWUD 3BK1A 1AN8A 4IM3A 3MP9A 2N9LA 4WJQA 3NG0A 3Q3FA 2LXAA 4MSQB 1MFWA 2LFIA 2EMSA 3VTUA 2KT7A 4LJPB 1QOBA 2FE8A 3QWZB 3BVMA 3OJ3A 2KAJA 3O13A 1PFDA 1DYQA 2KZRA 4TMAB 4BKGA 4B9KA 1J19A 2DAFA 3Q3NC 2IO0B 3SFEB 5DPWA 4PS7A 5G2NA 3JVZX 3ZXVA 3AB5A 2Y3AA 3Q69A 2MBHA 3IBEA 2WGSA 2CKHB 3CSTA 3DWMA 4M0WB 2PVOD 2KYWA 3GZNB 2D5GA 2LHEA 4C7YA 4DHJB 2WX0A 2LI5A 3MHZA 3MTNB 4PYUA 2G45B 1EU3A 3N1YC 3UIOB 4J3OD 3KVFB 3AH7A 1SF0A 4RGOS 4ITKA 1I7HA 3UGBB 4LK0M 2NBUA 3NS1A 1WXMA 2C5LC 3CMMB 4TV3A 4LLGM 2V9HA 1JQ4A 3P4QB 4MH8A 4E74A 1IPGA 1R4MI 1I4QA 3SD5A 2INPE 5H92C 4A6QA 3ML9A 1PUTA 4YL8A 2RD0A 4FJYA 1WFYA 4DXAB 4ZHOA 5DPTA 4KGSA 2I2YA 4EEWA 3C19A 3UQAA 2BBCA 5DCNA 4WWMA 1TGZB 4B95A 5MPOA 1GNUA 1J7BA 2EKIA 3I57A 4RH6A 4EOYA 2REXA 3PZ7A 1UZXB 2X38A 3TMPB 2BS2B 2LHDA 2JWUA 3RZWC 1WI0A 2KWVB 2NS5A 2IGGA 4XDDA 1PGBA 3C0RB 5IN7A 3VDZA 1E7UA 4W9IA 4LDTB 4WAFA 2VZKD 1WH3A 2JQRB 4N9F4 2I1JA 1YOVB 1V1OA 1WE7A 4FULA 1JWAD 3ZXRA 1KLUD 3X0WA 4FHKA 4MT5A 4US8A 2XK5A 3T9LA 1QOAA 1C3TA 4FBJB 2FCSA 3DOWA 1NI3A 3M63B 3WALA 3TEXA 4S0RA 3TSSA 4GDLA 4JLCA 1LM8B 2M8SA 2B3AA 2JY6A 5EDSA 5IAAC 2QHOA 2UU7A 3Q8BA 1L4DB 3ZVVA 4JPSA 5G5HA 4ICVA 1IBXA 3R66C 2UWQA 4JWSC 1UBIA 3C8YA 3OWEB 2J0MA 1ZPSA 4GSWA 4IWQA 3FILB 2PLPA 1WXSA 3AI5A 2YVCA 3QK0A 1QLBB 3IT6B 2LGIA 2WLBA 5C2TB 3DPDA 1JCKB 2XNAC 2K22A 3N3KB 2G4SA 3RNEC 2Z59B 4EE2A 1DOXA 2KMCA 4FADA 2M4NA 4XDCA 2YLMA 3DHGC 4HPPA 5AUKA 3RNAC 3BINA 4D2KA 3HK0A 2DNFA 2JSVX 2RDBC 1HE8A 4HRSA 4YTMB 2INDC 3LJ3A 2QMTA 5HI1A 3PT2B 3AE9B 4KZ0A 1OTRB 5JZEB 2Y5BB 3PREA 4KSKC 2NVUI 2ZVNA 4F1SA 1XCTL 3QA8A 4IM2A 3PZDA 4B0EA 1C1YB 1Y56A 2M17A 4OVUA 5IKCM 4BOZB 3MJ5A 1FO4A 1OEYJ 1YMHE 2MX2A 5EE9A 1OQQA 1WM3A 3RPFC 1UF0A 1V2YA 2IDYA 1EWCA 1Q10A 3OJ4B 2NR2A 2PPHA 2W54A 1SJHD 3V61A 1N61A 1IGDA 4PYZA 1GUAB 2JRHA 2XN9C 4P16A 3B2GA 3DBRB 3HHMA 4BBNF 1FXIA 3NVYA 5HKHA 2KO3A 4LNOA 2Y5CA 4KIKA 2BB6A 3R2TA 2N0SB 2KJRA 1MVKA 2IGDA 3Q8FA 3KYCD 4YTPB 4DDID 5J18A 3QAQA 1KF6B 2JWZA 1N6ZA 3ZQ4A 4JGHB 3EGRA 3TEZA 4KGRA 3ZJTA 2LZ6A 2R2OA 4L1BA 1D3ZA 4B0MA 1EO6A 4DK5A 1BXTA 2PKOA 3W1SA 3ZDTA 2RPQA 1PYWD 3N20C 1N5XA 1YJJA 1C4CA 2N9XA 4LNFA 2C7HA 3PHXB 2MBOA 4FJZA 2KWDA 2MHJA 1JW9D 4ZYSA 3BWUD 2AL6A 2V3NA 2K1FA 1F77A 4K1RB 1WWTA 5C23A 1I4GA 2MW5A 2L7RA 2JYTA 5D7GA 1HZ6A 1V5OA 1L6VA 4NJCA 4NQKE 1E10A 2M1MA 3DBHI 1XLPA 1XT9B 1ACCA 3DBSA 4HKZE 1RRBA 1QOFA 5G5GA 2LXCA 2PMVA 2RSUA 3HIZA 3VAWA 3A4SC 1WGDA 3VUXA 5I4DA 3TL5A 4HDOA 3UINB 2MEKA 2K9XA 4NZLB 1TKGA 3U30A 3DHHC 4GMVA 1TT5B 3ONSA 1CMXB 1Y8RC 1K51A 1LO5D 1ESFA 2O2VA 3VXWA 4DBGA 1I35A 2DYBA 1KLGD 3V6CB 4KZCA 4WQMA 2BKRB 3IHPC 2AX5A 2MCNB 1FRRA 3VFKA 1XLOA 3ZNGC 4RF0A 2L76A 5BO4B 1WIAA 2SAKA 2FUG1 4FA6A 3J9CA 2D10A 2DX5B 1XEEA 1FNVA 3T3NA 1IYFA 4ANVA 2WXLA 4GDLB 1N60A 4MDKE 2Z8LA 4S17A 2K25A 4F7ZA 1L6UA 1GPXA 3V62A 1T0SC 4M02A 1P3QU 1SE2A 5D3DA 1SEBD 2L3ZA 2GI9A 2LVPA 2K8HA 2RDHA 2Z0EB 4FN2A 4GOCA 1UGJA 1FRDA 2JU6X 1UWXA 2QC8A 2IY0B 3KWLA 2L00B 1GC6A 3ZKJC 3RT3B 3AU4A 4BVUC 1WSPA 4OVZA 2D3BA 2KACA 1SIJA 2J53A 3GE8C 2LRUA 4II2B 3U7ZA 2EMTA 3L08A 3AXCA 1C76A 1FD6A 2H88B 1JRUA 1AW7A 4F8CB 3KYDD 2GMIC 4ZRPA 1P7EA 2IYDB 3V6EB 1OEYA 1J8CA 3PPAA 2AEHA 1RLFA 4LTUA 1JWBD 2OOBB 4A3OA 2V3PA 3NUHB 1I4PA 2IO1B 3NJTA 4AUQC 3ML8A 2KDMA 5IO9A 3VTWA 5FR3A 2NMQA 4Q2JA 5HFYA 3JSVA 3QCAA 2E3TA 2MA9B 3RI7C 2J42A 2D07B 2L0TA 2ZCCA 1SSNA 3AEEB 1XLNA 4OZCA 4ZDVA 1F0ZA 3AE6B 2MH7A 4FJVB 1HXYD 2MJEA 3LXFA 1BT0A 2KJ6A 3ZRCA 1VZ8A 4TKNA 1E0ZA 5GMVA 3N1XC 4GB9A 4YWGG 4X57B 2CJOA 1XQQA 1Q5WB 1E7VA 1V97A 3BK2A 4KIKB 4RMAA 2CHXA 2QCZA 1HA5A 1BUIC 2BWES 1QKZA 3U4EG 1QZEA 2K6DB 4GN1A 4IWOA 1YX5B 4REZA 4NQLB 2KDBA 3DBLB 1D5ZC 3I9V1 1IUEA 2AWTA 5L83A 3SDLC 2BW2A 4JL9A 2N9EB 5J17A 4CQNA 2FAZA 2HJ1A 3L16A 4BOSC 2LUMA 5JH5C 2KK8A 4K7SA 2WDQB 2CHWA 4NPNA 1TZOA 2MJDA 2WXOA 1GOZA 2W3RA 5D3IB 1QQRA 2XBBC 1S1QB 3WAOA 3ZJUA 2W55A 4MGZE 1E7PB 1OFFA 3H7SA 3ZRFA 1JALA 4XC2A 3PV1A 4MJSA 1WR1A 4YSXB 2K3UA 3VRBB 5LXHA 4W9EA 3RNGC 5C3JB 2MBEA 1WRIA 2WYQA 4GU2A 5DPSA 4JWUC 1WX7A 3N30A 2KDEB 2GB1A 2BQQA 2IY1B 2C60A 1M94A 2N9PC 3PRMB 2LD9A 2KMMA 3ZW3A 3VQIA 2MQJA 3APFA 2JZ3B 3VVWB 3ZNID 3VRAB 5E6JA 2AQ2B 3IAM1 5H8YE 2H89B 1ENFA 2D3CA 2N7JA 3DDCB 1ET6A 3KH0A 1TKYA 3LDZE 4N58A 1KLVA 1ZXHA 3BVZA 1P9DU 2ZNVC 1WX9A 1ZXIA 5TSSA 2KKCA 3WANA 4PS3A 4MEMA 2O2VB 2HTHA 2J0JA 1R4NB 3PS6A 1B9RA 4DHJD 5BYSA 1L0YB 1I4HA 4OHJA 3IG3A 2AQ3B 1JRPA 3HM3A 1QOGA 1MPEA 3U2SC 2CS4A 1MJDA 4NAWB 1H8CA 3H9DA 2XEWA 4HCPB 4W9KA 4XWWA 3AE4B 4WIPA 3A1QA 1TS3A 2DYOA 3AU5A 3WCQA 3NVZA 1VRAB 3RYTA 4KV2A 2DZMA 3ZUNA 3W2DA 3ABVB 1RWSA 2IGHA 1L7YA 1ZDXA 2HTME 1E8WA 1T0RC 1M4VA 2LASA 3A4RA 4IDIA 3UI3A 3AEAB 4HXDA 1PGAA 2ACZB 4W9LA 4II3B 4O1NA 2C7MB 3H6NA 3DBRI 1WGHA 1LQBA 1SXTA 3QARA 1ROEA 3L4PA 4IM0A 3KLSX 3W9CB 3NVWA 2KVRA 3R7QA 4G50A 3HVZA 1FFUA 4QAYA 4I6LB 3TIXA 2JX5A 4BKSD 1C79A 3SR6A 1GC7A 3T3OA 1FCLA 4EUTA 3JSVB 1CQVA 1WGGA 1EM7A 2K0PA 2NBVB 4EZJA 3H7PB 4IUMB 1R4MB 2KDFB 2HDEA 4WWOA 1GB1A 2EKEC 3ENEA 4P7IA 1ISNA 2WDTB 3VTVA 4H2AA 2NCNA 1LGRA 3B0AA 3RULA 3AN1A 2GBNA 1NEKB 1D6EC 1OQRA 3PLVA 1J0GA 1K50A 1A5RA 3AV8A 5CTRC 5AZHA 4N6EB 1V49A 1I42A 2N4FA 2IO2B 1CJEA 1OGWA 1WMHA 3I63C 1DOIA 2CJNA 2L32A 4YSYB 2HJ8A 1SE3A 2HE7A 2LMCA 2KD0A 4HKQA 3AECB 3CIRB 1WJ6A 3MC0B 2WXMA 3IFWB 4M00A 2BYTA 3EFCA 3BYTB 5D94A 1V80A 4IWPA 4BBNC 5J2RA 3H1UA 3H8HA 2JZPA 2KWUB 3NZUA 2BF8B 1VZ7A 1K53A 1L0XB 4AQ7A 4OW0A 3EECA 3IT4B 2PJHA 2N9KA 4TSSA 2QJLA 1FIQA 3P63A 2RGFA 1HQRD 1EU4A 1WGKA 1T6BX 3HVDA 3MHSD 5BMGA 1UNSA 4MJSB 3PSEB 1GG3A 2BYFA 2BGFA 2KX3A 3WAMA 3ZNHB 3BIID 2AQ1B 3SFDB 4IG7B 2FIDA 2J52A 4DXFA 5JHBA 2WXIA 2KHWB 2MRPA 5LXIB 2R61A 4K81A 1LXDA 2V0GA 2QSDA 2KQ4X 4JQWC 3RNFC 3CF6E 4AS1A 1Q1OA 4YSZB 5FR6A 4P1CC 2K8BA 3AM9A 1D4BA 5KHQA 2RMMA 1TIFA 2OHFA 2AL3A 4WH4A 2ASQA 3EA6A 1ZKHA 1VJKA 4IOIE 4W9GA 4A90A 3W5UB 3P2BA 5L95C 1C9FA 4URKA 4I6PA 1L2NA 2LJIA 3T8MA 4KKJA 4AJWA 1UD7A 1SBBB 2CHZA 4LNIA 2UYZB 2NTSA 2N1VA 3E9SA 2CR5A 4HEA1 2W82A 3I5JC 2GBKA 3MJWA 3OG5A 3TBLD 4GDKA 1V6EA 1ZGUB 3I3TB 3A9JA 4W9DA 2WXHA 1UH6A 2DENB 3QJZA 3PVLA 2BB5A 2WXPA 1L4ZB 1EUVB 1KRHA 1C4AA 1F9JA 1QILA 3A1QB 3DVNV 1Q0WB 1H4RA 2DLBA 3KUCB 2KDIA 3UF8A 5T8IA 4R3DA 2C7NB 2XK5B 2FCQA 2DAJA 4NJ6A 1NI2A 3AE1B 4C4VA 1TZ1A 3P4PB 5LNK1 4K3BA 2WU2B 2Y5PA 2A4ZA 2MBBB 4HROA 2DZIA 1C77A 5DPRA 1STEA 2MBQA 3UQBA 1ZDVA 2FNJB 2GBRA 1WYWB 1IBXB 1KH0A 3NVVA 3SHQA 1P98A 1T0YA 2WWZA 1RM6C 3ZYYX 4NNJB 1SIFA 3NHEB 4JX1C 2LVOA 4KDLB 4C80A 3WIMA 2FIFA 1DOYA 4MSMB 2C9WB 2O6VD 3APCA 3Q14C 4FLHA 2BS3B 3ZGZA 1HTOA 2INNE 1Z2MA 2V4LA 3AE8B 1YD8U 4KVGB 4DXGA 1YIWA 1QT9A 1OQYA 1YNTE 3V05A 2MP2A 2PVGC 4W9CA 2KVZA 1TS2A 3ETRA 5AZGA 1C78A 5IA7A 2G4DB 4C56C 3K9PB 3RNCC 4WJPA 2LVQA 2KTFA 4XYCA 2M56B 4HJKA 2ZW0A 4RNAA 5IP4D 3FC4A 2INCC 1N62A 2OJRA 3RD2A 3GZNI 3N1ZC 3DHIC 3D32A 1XF5L 5EE1A 3L0WB 4I6NB 1WMHB 3W1YA 5HHDG 2MJ3A 1I4RA 4W9FA 1A70A 3RZFA 4KDIC 3ZTCA 5BYQA 1KFYB 4XGAB 1KM7A 2W9NA 3RN9C 4MACA 4TUUA 2QIEB 2NTTA 1FCCC 4MELA 4CO7A 3R2IA 1TKEA 4EKUA 3EUB2 3EFUA 2L1AA 2QDFA 3WA0A 4XZ4A 3QHTA 1ZUD2 2VRRB 2IPKD 4WQOB 2WHIA 1R4NI 1V5TA 2LEKA 3M62B 1PDXA 3CSFA 4A55A 2V4IB 2IBIB 2BT6A 1TJEA 1TS4A 3EC8A 4HLEA 3A33B 3KW5B 2I1KA 1WRDB 1NENB 1YN5A 3PO0A 2WU5B 2K5PA 3VR8B 1VLBA 1VR9A 4RCOA 2GLSA 2GRIA 4MGKE 3E56A 4EFOA 1ZE3D 4W9JA 3RMKC 4TQ0A 2QEJC 1YQ4B 2DWQA 4RF1A 3O65B 3B1LX 3PRPB 5JXVA 3ZIMA 4YTNB 2J7QB 3IVFA 4US9A 4ARCA 2JUOA 5CX3A 2VH1A 1WR6E 1TS5A 4HJGE 2GBMA 3TCAA 3BY4B 4GXBA 1NBFC 2WQYB 2PEAA 2JPHA 2KANA 3Q3MC 2DHZA 3P1MA 2JRIB 4KKIA 2KOXA 1XO3A 1L5PA 4E71A 2L0FA 2CU1A 2Q5WD 4NJ7A 1HZ5A 2PIAA 4IC7B 4G3XB 3U52E 3ZNZB 1RFKA 4USAA 5E6NA 1UWMA 2ZJDA 1U4AA 4HPMB 1WM2A 1C4PA 2VH2A 5G55A 3NOBA 4GDKB 2N7EA 3TEYA 3A9JB 4M8NA 2KN4A 3DCGA 3NZ3A 1F1HA 2VZKB 4WJNA 1MHHE 3TEWA 4ZRIA 1X1MA 3KUZA 4GIVA 4PT5A 4ASWC 1WE6A 1YJIA 3ZJVA 2ZPNA 1VZ6A 3AEBB 3S2AA 4YXDB 3M3JA 1TBEA 1HEZE 1VD2A 5AUIA 2V3SA 4AWJA 2TSSA 1JWMD 1WZ0A 2IZVB 3A9KA 2W3SA 4C4VB 2KX0A 4CHKA 1TY0A 3VUYA 3PTFC 5D6JB 4WWNA 2KTRA 4MGIE 2J4XA 2KC2A 2ZPYA 4ANWA 4XWTA 2BYEA 3P4RB 4JE3B 3Q8EA 3IAS1 3GP7A 1RAXA 5C1ZA 2NBWB 3PRZA 1K8RB 2K6QA 3DVGY 1F2RI 1Z5SB 3W5VB 4EZKA 3K9OB 2O6VA 3GOEA 2KWCA 1LFDA 1WXQA 2DYMA 1T3QA 1NDDA 2L83A 4G11A 4IKGA 2ON8A 4ZRQA 2WXGA 4ZRKA 3V3XA 5CHWA 1V81A 3HUIA 3B9JA 1E9MA 1YJ1A 5LLIA 1VDVA 1P7FA 2ONQA 2MSED 4ZYNA 3LYYA 3RCZA 2A5UA 3BVGA 1V8CA 2ZNVB 3AEFB 4XX5A 4RGTA 2AYOB 2MP2B 1T5XD 1UGMA 1HTQA 3HM6X 5D2MB 4LDTD 3VH3B 3RUIB 2M0AA 2MWSB 1V1PA 1J7CA 2LGSA 1F2RC 1N5WA 2KJHB 2FUHB 4N59A 2LUEA 3AE2B 4DDGD 1FMAD 1JROA 2LJ5A 1J7AA 1B1ZA 1VCBA 1YN4A 4OZBA 2LRWA 2KFJA 3QC8B 4DWFA 3AE7B 4AP4C 4AOFA 4BFRA 4LJOB 3QIJA 2WNMA 2KN5A 1WXAA 1GB4A 1BMLC 1I4XA 2WS3B 2L05A 3U8ZA 3BYYB 4KGTA 2K8CA 3AEGB 2WXKA 1EF5A 2L8JA 4FXCA 4M8MA 2J0KA 1SB3C 1R7SA 3RNBC 4EZLA 4K7UA 4MM3A 1FXAA 2NPTA 1N63A 1V9JA 3V60A 1SE9A 2E6XA 3B08A 4XE0A 4UDUC 3ZO5B 2JF5A 3PGEA 1YX6B 1ZW7A 2JT4B 1YN3A 2LWPA 1PQSA 3IXSA 2D3GA 2YEPF 2WX1A 1CZPA 3DWGC 4A20A 2SEBD 2ZVOA 3MC8A 1D5XC 1E5WA 3AE3B 3FAHA 4JIOU 2BTEA 3NY5A 1XXGA 2DZJA 4ANUA 1ZP0B 1WJ4A 3M95A 2KXJA 4K3CA 3Q8AA 3APDA 4KSLC 2BVCA 4P1BC 4DHZB 1KJTA 3CWIA 4AJYB 3Q6BA 2K39A 2ZZPB 3FKYA 4ARIA 5KHOA 1K52A 2PTLA 2IO3B 4PS8A 2PW9A 2OEDA 2WXRA 4B6WA 4DQOC 1P0RA 3VH4B 4E3CA 3Q2AC 2ZW1A 4HWIB 2KFKA 5HG2A 3P4SB 1WGYA 3ZDMC 3AE5B 1SJED 2WP9B 2YEPB 2KLCA 4LCDE 5EE3A 3PHWB 3GB1A 4ZOHC 3ECIA 2B76B 1PGXA 1P1AA 2MLBA 4WURA 4RGNA 5JHAA 1KOTA 3HRDD 2EELA 2IJ0A 3MC9A 1ZOYB 1JMLA 1RFAA 2FCMA 3NZSA 4PK1A 2JZZA 1NVID 2FCNA 3URYA 4MH0E 4ZHPA 4LNKA 3WAPA 4M0WA 3VUWA 2M0XA 1QF6A 5E6OA 2WXFA 1NYRA 2KQ7A 4M01A 4TQ1A 5BMIA 2BWFA 4NY0A 1MG8A 5IOIA 1MG4A 2BKFA 2BYVE 4LNNA 2WDVB 1JWSD 3ZLZA 3A9KB 1NYQA 3P42A 3L54A 1AYFA 2V1YA 2DZKA 2DBYA 2KTRB 5BMHA 3GS2A 2RDGA 5FK9C 2D3AA 2LGYA 4A9AA 1TYGB 5AEKB 1YQBA 5CHVC 1RYJA 4GLSC 5TR5A 3DVNU 3OLMD 2JXXA 1FM0D 3Q3OC 4P6VF 1L0VB 3EHVA 4KX6B 2R2QA 3LB8C 2L52A 1WX8A 3MFGA 4A8XC 4ACFA 3KQ4A 3NRZA 3N9YC 3AEDB 3JW0X 2O6VB 1FNUA 4HCNB 4RM9A 4RGMA 3SEBA 1WF9A 3GE3C 2G1EA 2WXQA 3R7RA 2Z0DB 4NAWA 4WWPA 4ANXA 4HVBA 1KTKA 2JVCA 1MHXA 4L2YA 2LGDA 5CHFA 2LGXA 2QILA 3SU8X 2KMAA 5FKAC 4HDQA 4BKSA 4DHZE 3DBLI 4RM8A 1D5MC 4K7WA 1FEHA 1V1PB 1GAQB 3B2FA 5AZFA 1T0QC 3NS8A 3JYUA 2KQSA 4G0NB 3Q3JA 1SGHA 4MGYE 3DBHB 1UBQA 1E6EB 2RR9A 1WJUA 2ZEQA 1UUPA 1UELA 1MI0A 2WDRB 2WXNA 3KWVA 1E90A 3X23A 1EWYC 4HPLB 4CYEA 1V86A 3UIPB 4C00A 1AARA 4W9HA 1IP9A 1WGRA 4FHJA 4RFBA 3TUOA 3QQ8B 4ZRJA 2RPVA 2X8XX 2CU3A 3QX1A 4A3PA 2BPSA 3FILA 3VR9B 2D11A 3L17A 4MM3B 3PZ8A 2NPTB 1F52A 3BZDB 1E8XA 1FFVA 4WJOA 2KNBA 4BKTA 3W1SC 4WAAA 2KC1A 3KUDB 1FNWA 3Q8CA 1XD3B 2BS4B 4OVVA 1G6JA 3PLUA 2PE9A 3H7PA 1WZ3A 1TTNA 5EE0A 3R3MA 2N1WA 1E8ZA 1CK1A 1AWDA
chains in the Genus database with same CATH topology
1I42A 2ZPNA 3L10B 3N32A 3S2AA 3U30A 1FXTB 2N4FA 3U7DA 3M3JA 2IO2B 4GMVA 1TBEA 1OGWA 1WMHA 1VD2A 3DVGX 3ONSA 1CMXB 1Y8RC 4HK2A 2HJ8A 2V3SA 2O2VA 3VXWA 3TJPA 2HE7A 4AWJA 4ICUA 4DBGA 1I35A 1WXVA 2KD0A 2KLGA 3VHTC 1WZ0A 2DYBA 2IZVB 3A9KA 1WJ6A 3AULA 2GOWA 3V6CB 2KX0A 4IW0A 4KZCA 4CHKA 3VUYA 3PTFC 4GGQA 3IFWB 5D6JB 2BKRB 3IHPC 4WWNA 2KTRA 4MGIE 2MCNB 3VFKA 2GBJA 3ZNGC 2KC2A 1GJZA 2ZPYA 2L76A 4ANWA 2BYEA 2PE6B 5D94A 5BO4B 3DQVA 5E6PA 1E8YA 1V80A 1WIAA 4IWPA 3OAWA 3ALBA 4BBNC 5J2RA 1WY8A 1RAXA 5C1ZA 3H1UA 4FA6A 2D10A 2NBWB 1S3SG 2DX5B 3PRZA 1K8RB 2KWUB 2K6QA 3NZUA 3DVGY 2BF8B 1IYFA 2D2QA 2G3QB 2ZCBA 3L13A 3ZTDA 4ANVA 1Z5SB 1WJNA 4GDLB 4MDKE 2K25A 1EF1A 4F7ZA 3EECA 4EZKA 3K9OB 2O6VA 3GOEA 2KWCA 1LFDA 2PJHA 2KFKB 2N7DA 2DYMA 2HD5B 1NDDA 4J6IA 3V62A 4G11A 1P3QU 4IM3A 4ZRKA 2RGFA 5CHWA 2L3ZA 1V81A 4WJQA 1YJ1A 3Q3FA 5LLIA 2LXAA 2LVPA 4MSQB 2K8HA 2MSED 2Z0EB 4FN2A 4GOCA 4ZYNA 2EMSA 3RCZA 2A5UA 3VTUA 3MHSD 4LJPB 2ZNVB 4XX5A 3QWZB 2AYOB 2MP2B 1UGMA 3OJ3A 2IY0B 4MJSB 3PSEB 2L00B 1GC6A 3HM6X 5D2MB 3RT3B 1GG3A 3ZKJC 3AU4A 4LDTD 3VH3B 4BVUC 2BYFA 3RUIB 2BGFA 2KZRA 2MWSB 4BKGA 4B9KA 2KX3A 3WAMA 1J19A 2DAFA 3ZNHB 2IO0B 5DPWA 4IG7B 4PS7A 2FIDA 2KJHB 2LRUA 5G2NA 3JVZX 2FUHB 4II2B 2EMTA 2MBHA 2LUEA 3L08A 3AXCA 5JHBA 2KHWB 2MRPA 3IBEA 4DDGD 5LXIB 4K81A 2LJ5A 1LXDA 1JRUA 1VCBA 2CKHB 3CSTA 4M0WB 4JQWC 4F8CB 2LRWA 3KYDD 2KFJA 2GMIC 3QC8B 2IYDB 3V6EB 3CF6E 4DHJB 1OEYA 4DWFA 1J8CA 3PPAA 2AEHA 1RLFA 1Q1OA 2WX0A 2OOBB 4A3OA 5FR6A 4AP4C 2K8BA 2LI5A 4AOFA 4BFRA 4LJOB 5KHQA 2IO1B 3MTNB 4PYUA 2G45B 3QIJA 4AUQC 3ML8A 2AL3A 1WXAA 2KN5A 3UIOB 2ASQA 3VTWA 1ZKHA 3KVFB 2L05A 4W9GA 3U8ZA 3JSVA 2K8CA 3P2BA 3UGBB 5L95C 2NBUA 3QCAA 4URKA 4I6PA 1L2NA 2MA9B 1WXMA 2C5LC 1EF5A 2L8JA 3CMMB 4TV3A 2D07B 4M8MA 2L0TA 2ZCCA 2J0KA 3T8MA 4AJWA 1UD7A 4E74A 4EZLA 4K7UA 1IPGA 1R4MI 4MM3A 2CHZA 2NPTA 2UYZB 3SD5A 2N1VA 4ZDVA 2CR5A 3ML9A 1V9JA 3V60A 1SE9A 2GBKA 3B08A 4YL8A 2RD0A 3MJWA 4FJYA 3ZO5B 3TBLD 2JF5A 1WFYA 4FJVB 1V6EA 3PGEA 4GDKA 4DXAB 1YX6B 1ZGUB 5DPTA 3I3TB 4EEWA 1ZW7A 3UQAA 2JT4B 3A9JA 5DCNA 2LWPA 1PQSA 4W9DA 2D3GA 1UH6A 2DENB 3QJZA 3PVLA 1TGZB 1BT0A 4B95A 2WX1A 2KJ6A 1EUVB 3ZRCA 1GNUA 4TKNA 5GMVA 1F9JA 4A20A 4GB9A 2ZVOA 3A1QB 4X57B 4EOYA 2REXA 3DVNV 1Q0WB 1H4RA 1E5WA 1UZXB 3TMPB 1XQQA 1Q5WB 1E7VA 3KUCB 2KDIA 4JIOU 3UF8A 3NY5A 2C7NB 2XK5B 2DZJA 4ANUA 3M95A 1WJ4A 4KIKB 4RMAA 3RZWC 2KXJA 2CHXA 2BWES 1QZEA 1WI0A 2FCQA 2K6DB 2KWVB 2NS5A 4GN1A 4IWOA 3C0RB 2DAJA 1YX5B 4NJ6A 4NQLB 3APDA 4KSLC 3VDZA 1E7UA 4W9IA 1NI2A 4LDTB 4DHZB 2KDBA 1TZ1A 1KJTA 1WH3A 4N9F4 4AJYB 2I1JA 2AWTA 5L83A 3SDLC 1WE7A 2K39A 2A4ZA 2N9EB 2MBBB 4FULA 4JL9A 2ZZPB 3X0WA 2DZIA 5DPRA 5J17A 2FAZA 4FHKA 2XK5A 3T9LA 3L16A 2MBQA 5KHOA 3UQBA 1C3TA 4FBJB 2FNJB 2IO3B 4BOSC 2GBRA 1WYWB 2FCSA 3DOWA 5JH5C 3M63B 3SHQA 2KK8A 3WALA 1P98A 1T0YA 4K7SA 4PS8A 2CHWA 2WWZA 4NPNA 4NNJB 4B6WA 1SIFA 1P0RA 4GDLA 4JLCA 3VH4B 4E3CA 3NHEB 1LM8B 2LVOA 4KDLB 2M8SA 3WIMA 2B3AA 2JY6A 4HWIB 5EDSA 2FIFA 5IAAC 2KFKA 2QHOA 1WGYA 3ZDMC 2XBBC 4MSMB 2C9WB 2O6VD 3APCA 4FLHA 3ZVVA 1Z2MA 1S1QB 2KLCA 4LCDE 3PHWB 3WAOA 2V4LA 4ICVA 3R66C 1YD8U 2UWQA 4MGZE 4KVGB 3ECIA 1UBIA 1YIWA 1OQYA 1P1AA 3H7SA 3ZRFA 2MLBA 2J0MA 2MP2A 5JHAA 4GSWA 4W9CA 4XC2A 1KOTA 3PV1A 4IWQA 4MJSA 1WR1A 1WXSA 5AZGA 3AI5A 2YVCA 3QK0A 5LXHA 4W9EA 5IA7A 2G4DB 3K9PB 1RFAA 2FCMA 2MBEA 3DPDA 3NZSA 4WJPA 2JZZA 2WYQA 2LVQA 2KTFA 3N3KB 2G4SA 4GU2A 5DPSA 1WX7A 2Z59B 3N30A 2FCNA 2KDEB 2IY1B 4MH0E 2C60A 4HJKA 1M94A 2N9PC 3PRMB 2LD9A 3WAPA 2KMCA 4FADA 2M4NA 3ZW3A 2YLMA 3VQIA 2MQJA 2M0XA 3VUWA 3APFA 3BINA 5E6OA 2JZ3B 3HK0A 3VVWB 3ZNID 2OJRA 3RD2A 2KQ7A 3GZNI 4TQ1A 2BWFA 3DDCB 3D32A 4NY0A 1MG8A 3KH0A 3L0WB 3LDZE 4I6NB 1KLVA 1HE8A 1WMHB 3W1YA 3LJ3A 1P9DU 2ZNVC 1WX9A 3PT2B 2BKFA 2KKCA 3WANA 4PS3A 4W9FA 3RZFA 4KZ0A 4MEMA 2O2VB 1OTRB 4KDIC 3ZTCA 5JZEB 2BYVE 2Y5BB 3PREA 3ZLZA 4KSKC 2NVUI 2ZVNA 2HTHA 3A9KB 4F1SA 3L54A 1KM7A 3QA8A 4IM2A 2J0JA 3PZDA 2V1YA 2W9NA 3PS6A 1C1YB 4DHJD 2DZKA 2KTRB 2LGYA 3IG3A 4TUUA 2M17A 4OVUA 5AEKB 1YQBA 3HM3A 5CHVC 4MELA 4BOZB 2CS4A 4CO7A 1OEYJ 2MX2A 4EKUA 5TR5A 1WM3A 3DVNU 4NAWB 3OLMD 2JXXA 1V2YA 3EFUA 1H8CA 3EHVA 3H9DA 2XEWA 4HCPB 2R2QA 3WA0A 3OJ4B 1WX8A 4W9KA 2NR2A 2PPHA 4XZ4A 3V61A 3QHTA 4PYZA 1GUAB 2JRHA 2VRRB 4WQOB 3A1QA 3JW0X 1R4NI 2O6VB 1V5TA 2DYOA 3M62B 3AU5A 4HCNB 3HHMA 3CSFA 4RM9A 4BBNF 3RYTA 4KV2A 1WF9A 3R7RA 5HKHA 2Z0DB 2IBIB 2KO3A 4NAWA 4WWPA 4KIKA 2DZMA 4ANXA 3EC8A 3ZUNA 4HLEA 3A33B 4HVBA 2JVCA 2KJRA 1L7YA 3KW5B 1E8WA 2I1KA 2LGDA 5CHFA 1WRDB 2LGXA 4DDID 3KYCD 2LASA 3SU8X 3A4RA 3QAQA 5J18A 2KMAA 2JWZA 4HXDA 4HDQA 4BKSA 4DHZE 4JGHB 3DBLI 4RM8A 4W9LA 4II3B 2C7MB 2LZ6A 2R2OA 4K7WA 3H6NA 3DBRI 1D3ZA 4MGKE 1WGHA 1LQBA 4EFOA 5AZFA 1EO6A 4DK5A 3QARA 4W9JA 4TQ0A 3NS8A 3O65B 3W1SA 4IM0A 3B1LX 2RPQA 2KQSA 3JYUA 3ZDTA 4G0NB 3Q3JA 3PRPB 1SGHA 3ZIMA 2KVRA 4MGYE 2J7QB 3IVFA 3R7QA 4G50A 1UBQA 2JUOA 1WJUA 2RR9A 2ZEQA 2N9XA 1UELA 2C7HA 3PHXB 2MBOA 4FJZA 5CX3A 1E90A 1WR6E 2AL6A 3X23A 4HPLB 4I6LB 3TIXA 2K1FA 2GBMA 4CYEA 3TCAA 4BKSD 4K1RB 1V86A 3UIPB 3BY4B 5C23A 4GXBA 1AARA 1GC7A 1NBFC 4W9HA 2PEAA 1IP9A 1WGRA 2JPHA 2KANA 2MW5A 4FHJA 4EUTA 2L7RA 2DHZA 3JSVB 3QQ8B 4ZRJA 5D7GA 2JRIB 1WGGA 2KOXA 3QX1A 1V5OA 4A3PA 2NBVB 4EZJA 4E71A 2BPSA 3H7PB 4IUMB 2KDFB 2L0FA 2CU1A 4NQKE 4WWOA 2M1MA 2EKEC 3ENEA 3DBHI 4NJ7A 4P7IA 1ISNA 2D11A 2WDTB 3L17A 1XT9B 3DBSA 4IC7B 4G3XB 3VTVA 2NPTB 1RRBA 2NCNA 3ZNZB 1E8XA 2LXCA 3B0AA 3RULA 5E6NA 4WJOA 2KNBA 2GBNA 4BKTA 2ZJDA 3W1SC 1U4AA 4HPMB 4WAAA 2RSUA 1WM2A 2KC1A 3HIZA 3KUDB 5G55A 3NOBA 3VAWA 4GDKB 2N7EA 3A4SC 1XD3B 4OVVA 3PLVA 1G6JA 3PLUA 2PE9A 3A9JB 3H7PA 1WGDA 4M8NA 3VUXA 1WZ3A 3DCGA 1A5RA 1J0GA 4WJNA 5CTRC 3TL5A 5AZHA 4ZRIA 1TTNA 4HDOA 3UINB 1X1MA 3KUZA 4GIVA 4ASWC 1V49A 1WE6A 3R3MA 2N1WA 1E8ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I42 A;  2ZPN A;  3L10 B;  3N32 A;  3S2A A;  3U30 A;  1FXT B;  2N4F A;  3U7D A;  3M3J A;  2IO2 B;  4GMV A;  1TBE A;  1OGW A;  1WMH A;  1VD2 A;  3DVG X;  3ONS A;  1CMX B;  1Y8R C;  4HK2 A;  2HJ8 A;  2V3S A;  2O2V A;  3VXW A;  3TJP A;  2HE7 A;  4AWJ A;  4ICU A;  4DBG A;  1I35 A;  1WXV A;  2KD0 A;  2KLG A;  3VHT C;  1WZ0 A;  2DYB A;  2IZV B;  3A9K A;  1WJ6 A;  3AUL A;  2GOW A;  3V6C B;  2KX0 A;  4IW0 A;  4KZC A;  4CHK A;  3VUY A;  3PTF C;  4GGQ A;  3IFW B;  5D6J B;  2BKR B;  3IHP C;  4WWN A;  2KTR A;  4MGI E;  2MCN B;  3VFK A;  2GBJ A;  3ZNG C;  2KC2 A;  1GJZ A;  2ZPY A;  2L76 A;  4ANW A;  2BYE A;  2PE6 B;  5D94 A;  5BO4 B;  3DQV A;  5E6P A;  1E8Y A;  1V80 A;  1WIA A;  4IWP A;  3OAW A;  3ALB A;  4BBN C;  5J2R A;  1WY8 A;  1RAX A;  5C1Z A;  3H1U A;  4FA6 A;  2D10 A;  2NBW B;  1S3S G;  2DX5 B;  3PRZ A;  1K8R B;  2KWU B;  2K6Q A;  3NZU A;  3DVG Y;  2BF8 B;  1IYF A;  2D2Q A;  2G3Q B;  2ZCB A;  3L13 A;  3ZTD A;  4ANV A;  1Z5S B;  1WJN A;  4GDL B;  4MDK E;  2K25 A;  1EF1 A;  4F7Z A;  3EEC A;  4EZK A;  3K9O B;  2O6V A;  3GOE A;  2KWC A;  1LFD A;  2PJH A;  2KFK B;  2N7D A;  2DYM A;  2HD5 B;  1NDD A;  4J6I A;  3V62 A;  4G11 A;  1P3Q U;  4IM3 A;  4ZRK A;  2RGF A;  5CHW A;  2L3Z A;  1V81 A;  4WJQ A;  1YJ1 A;  3Q3F A;  5LLI A;  2LXA A;  2LVP A;  4MSQ B;  2K8H A;  2MSE D;  2Z0E B;  4FN2 A;  4GOC A;  4ZYN A;  2EMS A;  3RCZ A;  2A5U A;  3VTU A;  3MHS D;  4LJP B;  2ZNV B;  4XX5 A;  3QWZ B;  2AYO B;  2MP2 B;  1UGM A;  3OJ3 A;  2IY0 B;  4MJS B;  3PSE B;  2L00 B;  1GC6 A;  3HM6 X;  5D2M B;  3RT3 B;  1GG3 A;  3ZKJ C;  3AU4 A;  4LDT D;  3VH3 B;  4BVU C;  2BYF A;  3RUI B;  2BGF A;  2KZR A;  2MWS B;  4BKG A;  4B9K A;  2KX3 A;  3WAM A;  1J19 A;  2DAF A;  3ZNH B;  2IO0 B;  5DPW A;  4IG7 B;  4PS7 A;  2FID A;  2KJH B;  2LRU A;  5G2N A;  3JVZ X;  2FUH B;  4II2 B;  2EMT A;  2MBH A;  2LUE A;  3L08 A;  3AXC A;  5JHB A;  2KHW B;  2MRP A;  3IBE A;  4DDG D;  5LXI B;  4K81 A;  2LJ5 A;  1LXD A;  1JRU A;  1VCB A;  2CKH B;  3CST A;  4M0W B;  4JQW C;  4F8C B;  2LRW A;  3KYD D;  2KFJ A;  2GMI C;  3QC8 B;  2IYD B;  3V6E B;  3CF6 E;  4DHJ B;  1OEY A;  4DWF A;  1J8C A;  3PPA A;  2AEH A;  1RLF A;  1Q1O A;  2WX0 A;  2OOB B;  4A3O A;  5FR6 A;  4AP4 C;  2K8B A;  2LI5 A;  4AOF A;  4BFR A;  4LJO B;  5KHQ A;  2IO1 B;  3MTN B;  4PYU A;  2G45 B;  3QIJ A;  4AUQ C;  3ML8 A;  2AL3 A;  1WXA A;  2KN5 A;  3UIO B;  2ASQ A;  3VTW A;  1ZKH A;  3KVF B;  2L05 A;  4W9G A;  3U8Z A;  3JSV A;  2K8C A;  3P2B A;  3UGB B;  5L95 C;  2NBU A;  3QCA A;  4URK A;  4I6P A;  1L2N A;  2MA9 B;  1WXM A;  2C5L C;  1EF5 A;  2L8J A;  3CMM B;  4TV3 A;  2D07 B;  4M8M A;  2L0T A;  2ZCC A;  2J0K A;  3T8M A;  4AJW A;  1UD7 A;  4E74 A;  4EZL A;  4K7U A;  1IPG A;  1R4M I;  4MM3 A;  2CHZ A;  2NPT A;  2UYZ B;  3SD5 A;  2N1V A;  4ZDV A;  2CR5 A;  3ML9 A;  1V9J A;  3V60 A;  1SE9 A;  2GBK A;  3B08 A;  4YL8 A;  2RD0 A;  3MJW A;  4FJY A;  3ZO5 B;  3TBL D;  2JF5 A;  1WFY A;  4FJV B;  1V6E A;  3PGE A;  4GDK A;  4DXA B;  1YX6 B;  1ZGU B;  5DPT A;  3I3T B;  4EEW A;  1ZW7 A;  3UQA A;  2JT4 B;  3A9J A;  5DCN A;  2LWP A;  1PQS A;  4W9D A;  2D3G A;  1UH6 A;  2DEN B;  3QJZ A;  3PVL A;  1TGZ B;  1BT0 A;  4B95 A;  2WX1 A;  2KJ6 A;  1EUV B;  3ZRC A;  1GNU A;  4TKN A;  5GMV A;  1F9J A;  4A20 A;  4GB9 A;  2ZVO A;  3A1Q B;  4X57 B;  4EOY A;  2REX A;  3DVN V;  1Q0W B;  1H4R A;  1E5W A;  1UZX B;  3TMP B;  1XQQ A;  1Q5W B;  1E7V A;  3KUC B;  2KDI A;  4JIO U;  3UF8 A;  3NY5 A;  2C7N B;  2XK5 B;  2DZJ A;  4ANU A;  3M95 A;  1WJ4 A;  4KIK B;  4RMA A;  3RZW C;  2KXJ A;  2CHX A;  2BWE S;  1QZE A;  1WI0 A;  2FCQ A;  2K6D B;  2KWV B;  2NS5 A;  4GN1 A;  4IWO A;  3C0R B;  2DAJ A;  1YX5 B;  4NJ6 A;  4NQL B;  3APD A;  4KSL C;  3VDZ A;  1E7U A;  4W9I A;  1NI2 A;  4LDT B;  4DHZ B;  2KDB A;  1TZ1 A;  1KJT A;  1WH3 A;  4N9F 4;  4AJY B;  2I1J A;  2AWT A;  5L83 A;  3SDL C;  1WE7 A;  2K39 A;  2A4Z A;  2N9E B;  2MBB B;  4FUL A;  4JL9 A;  2ZZP B;  3X0W A;  2DZI A;  5DPR A;  5J17 A;  2FAZ A;  4FHK A;  2XK5 A;  3T9L A;  3L16 A;  2MBQ A;  5KHO A;  3UQB A;  1C3T A;  4FBJ B;  2FNJ B;  2IO3 B;  4BOS C;  2GBR A;  1WYW B;  2FCS A;  3DOW A;  5JH5 C;  3M63 B;  3SHQ A;  2KK8 A;  3WAL A;  1P98 A;  1T0Y A;  4K7S A;  4PS8 A;  2CHW A;  2WWZ A;  4NPN A;  4NNJ B;  4B6W A;  1SIF A;  1P0R A;  4GDL A;  4JLC A;  3VH4 B;  4E3C A;  3NHE B;  1LM8 B;  2LVO A;  4KDL B;  2M8S A;  3WIM A;  2B3A A;  2JY6 A;  4HWI B;  5EDS A;  2FIF A;  5IAA C;  2KFK A;  2QHO A;  1WGY A;  3ZDM C;  2XBB C;  4MSM B;  2C9W B;  2O6V D;  3APC A;  4FLH A;  3ZVV A;  1Z2M A;  1S1Q B;  2KLC A;  4LCD E;  3PHW B;  3WAO A;  2V4L A;  4ICV A;  3R66 C;  1YD8 U;  2UWQ A;  4MGZ E;  4KVG B;  3ECI A;  1UBI A;  1YIW A;  1OQY A;  1P1A A;  3H7S A;  3ZRF A;  2MLB A;  2J0M A;  2MP2 A;  5JHA A;  4GSW A;  4W9C A;  4XC2 A;  1KOT A;  3PV1 A;  4IWQ A;  4MJS A;  1WR1 A;  1WXS A;  5AZG A;  3AI5 A;  2YVC A;  3QK0 A;  5LXH A;  4W9E A;  5IA7 A;  2G4D B;  3K9P B;  1RFA A;  2FCM A;  2MBE A;  3DPD A;  3NZS A;  4WJP A;  2JZZ A;  2WYQ A;  2LVQ A;  2KTF A;  3N3K B;  2G4S A;  4GU2 A;  5DPS A;  1WX7 A;  2Z59 B;  3N30 A;  2FCN A;  2KDE B;  2IY1 B;  4MH0 E;  2C60 A;  4HJK A;  1M94 A;  2N9P C;  3PRM B;  2LD9 A;  3WAP A;  2KMC A;  4FAD A;  2M4N A;  3ZW3 A;  2YLM A;  3VQI A;  2MQJ A;  2M0X A;  3VUW A;  3APF A;  3BIN A;  5E6O A;  2JZ3 B;  3HK0 A;  3VVW B;  3ZNI D;  2OJR A;  3RD2 A;  2KQ7 A;  3GZN I;  4TQ1 A;  2BWF A;  3DDC B;  3D32 A;  4NY0 A;  1MG8 A;  3KH0 A;  3L0W B;  3LDZ E;  4I6N B;  1KLV A;  1HE8 A;  1WMH B;  3W1Y A;  3LJ3 A;  1P9D U;  2ZNV C;  1WX9 A;  3PT2 B;  2BKF A;  2KKC A;  3WAN A;  4PS3 A;  4W9F A;  3RZF A;  4KZ0 A;  4MEM A;  2O2V B;  1OTR B;  4KDI C;  3ZTC A;  5JZE B;  2BYV E;  2Y5B B;  3PRE A;  3ZLZ A;  4KSK C;  2NVU I;  2ZVN A;  2HTH A;  3A9K B;  4F1S A;  3L54 A;  1KM7 A;  3QA8 A;  4IM2 A;  2J0J A;  3PZD A;  2V1Y A;  2W9N A;  3PS6 A;  1C1Y B;  4DHJ D;  2DZK A;  2KTR B;  2LGY A;  3IG3 A;  4TUU A;  2M17 A;  4OVU A;  5AEK B;  1YQB A;  3HM3 A;  5CHV C;  4MEL A;  4BOZ B;  2CS4 A;  4CO7 A;  1OEY J;  2MX2 A;  4EKU A;  5TR5 A;  1WM3 A;  3DVN U;  4NAW B;  3OLM D;  2JXX A;  1V2Y A;  3EFU A;  1H8C A;  3EHV A;  3H9D A;  2XEW A;  4HCP B;  2R2Q A;  3WA0 A;  3OJ4 B;  1WX8 A;  4W9K A;  2NR2 A;  2PPH A;  4XZ4 A;  3V61 A;  3QHT A;  4PYZ A;  1GUA B;  2JRH A;  2VRR B;  4WQO B;  3A1Q A;  3JW0 X;  1R4N I;  2O6V B;  1V5T A;  2DYO A;  3M62 B;  3AU5 A;  4HCN B;  3HHM A;  3CSF A;  4RM9 A;  4BBN F;  3RYT A;  4KV2 A;  1WF9 A;  3R7R A;  5HKH A;  2Z0D B;  2IBI B;  2KO3 A;  4NAW A;  4WWP A;  4KIK A;  2DZM A;  4ANX A;  3EC8 A;  3ZUN A;  4HLE A;  3A33 B;  4HVB A;  2JVC A;  2KJR A;  1L7Y A;  3KW5 B;  1E8W A;  2I1K A;  2LGD A;  5CHF A;  1WRD B;  2LGX A;  4DDI D;  3KYC D;  2LAS A;  3SU8 X;  3A4R A;  3QAQ A;  5J18 A;  2KMA A;  2JWZ A;  4HXD A;  4HDQ A;  4BKS A;  4DHZ E;  4JGH B;  3DBL I;  4RM8 A;  4W9L A;  4II3 B;  2C7M B;  2LZ6 A;  2R2O A;  4K7W A;  3H6N A;  3DBR I;  1D3Z A;  4MGK E;  1WGH A;  1LQB A;  4EFO A;  5AZF A;  1EO6 A;  4DK5 A;  3QAR A;  4W9J A;  4TQ0 A;  3NS8 A;  3O65 B;  3W1S A;  4IM0 A;  3B1L X;  2RPQ A;  2KQS A;  3JYU A;  3ZDT A;  4G0N B;  3Q3J A;  3PRP B;  1SGH A;  3ZIM A;  2KVR A;  4MGY E;  2J7Q B;  3IVF A;  3R7Q A;  4G50 A;  1UBQ A;  2JUO A;  1WJU A;  2RR9 A;  2ZEQ A;  2N9X A;  1UEL A;  2C7H A;  3PHX B;  2MBO A;  4FJZ A;  5CX3 A;  1E90 A;  1WR6 E;  2AL6 A;  3X23 A;  4HPL B;  4I6L B;  3TIX A;  2K1F A;  2GBM A;  4CYE A;  3TCA A;  4BKS D;  4K1R B;  1V86 A;  3UIP B;  3BY4 B;  5C23 A;  4GXB A;  1AAR A;  1GC7 A;  1NBF C;  4W9H A;  2PEA A;  1IP9 A;  1WGR A;  2JPH A;  2KAN A;  2MW5 A;  4FHJ A;  4EUT A;  2L7R A;  2DHZ A;  3JSV B;  3QQ8 B;  4ZRJ A;  5D7G A;  2JRI B;  1WGG A;  2KOX A;  3QX1 A;  1V5O A;  4A3P A;  2NBV B;  4EZJ A;  4E71 A;  2BPS A;  3H7P B;  4IUM B;  2KDF B;  2L0F A;  2CU1 A;  4NQK E;  4WWO A;  2M1M A;  2EKE C;  3ENE A;  3DBH I;  4NJ7 A;  4P7I A;  1ISN A;  2D11 A;  2WDT B;  3L17 A;  1XT9 B;  3DBS A;  4IC7 B;  4G3X B;  3VTV A;  2NPT B;  1RRB A;  2NCN A;  3ZNZ B;  1E8X A;  2LXC A;  3B0A A;  3RUL A;  5E6N A;  4WJO A;  2KNB A;  2GBN A;  4BKT A;  2ZJD A;  3W1S C;  1U4A A;  4HPM B;  4WAA A;  2RSU A;  1WM2 A;  2KC1 A;  3HIZ A;  3KUD B;  5G55 A;  3NOB A;  3VAW A;  4GDK B;  2N7E A;  3A4S C;  1XD3 B;  4OVV A;  3PLV A;  1G6J A;  3PLU A;  2PE9 A;  3A9J B;  3H7P A;  1WGD A;  4M8N A;  3VUX A;  1WZ3 A;  3DCG A;  1A5R A;  1J0G A;  4WJN A;  5CTR C;  3TL5 A;  5AZH A;  4ZRI A;  1TTN A;  4HDO A;  3UIN B;  1X1M A;  3KUZ A;  4GIV A;  4ASW C;  1V49 A;  1WE6 A;  3R3M A;  2N1W A;  1E8Z A; 
#chains in the Genus database with same CATH topology
 1DGJ A;  4BAX A;  3L10 B;  3N32 A;  2JXT A;  1XLQ A;  1FXT B;  3U7D A;  3AMZ A;  3DVG X;  3R8B A;  4L23 A;  4HK2 A;  4NAM A;  1TY2 A;  2FBW B;  3TJP A;  1SE4 A;  4ICU A;  5BYR A;  1WXV A;  2G9H D;  2KLG A;  3VHT C;  2WXJ A;  1WYG A;  3AUL A;  2ICI A;  2GOW A;  2M19 A;  1IGC A;  4IW0 A;  4GGQ A;  1XCQ L;  3RFZ B;  2GBJ A;  1GJZ A;  4OZA A;  4C7Z A;  2PE6 B;  3DQV A;  5E6P A;  1E8Y A;  3OAW A;  3ALB A;  1WY8 A;  2JYE A;  1S3S G;  2OJW A;  2D2Q A;  2G3Q B;  2ZCB A;  3L13 A;  3ZTD A;  1WJN A;  2I38 A;  1FPY A;  1EF1 A;  1ET9 A;  4BZA A;  2KFK B;  4YT0 B;  2N7D A;  2HD5 B;  1YQ3 B;  4J6I A;  5GXG B;  1JWU D;  3BK1 A;  1AN8 A;  4IM3 A;  3MP9 A;  2N9L A;  4WJQ A;  3NG0 A;  3Q3F A;  2LXA A;  4MSQ B;  1MFW A;  2LFI A;  2EMS A;  3VTU A;  2KT7 A;  4LJP B;  1QOB A;  2FE8 A;  3QWZ B;  3BVM A;  3OJ3 A;  2KAJ A;  3O13 A;  1PFD A;  1DYQ A;  2KZR A;  4TMA B;  4BKG A;  4B9K A;  1J19 A;  2DAF A;  3Q3N C;  2IO0 B;  3SFE B;  5DPW A;  4PS7 A;  5G2N A;  3JVZ X;  3ZXV A;  3AB5 A;  2Y3A A;  3Q69 A;  2MBH A;  3IBE A;  2WGS A;  2CKH B;  3CST A;  3DWM A;  4M0W B;  2PVO D;  2KYW A;  3GZN B;  2D5G A;  2LHE A;  4C7Y A;  4DHJ B;  2WX0 A;  2LI5 A;  3MHZ A;  3MTN B;  4PYU A;  2G45 B;  1EU3 A;  3N1Y C;  3UIO B;  4J3O D;  3KVF B;  3AH7 A;  1SF0 A;  4RGO S;  4ITK A;  1I7H A;  3UGB B;  4LK0 M;  2NBU A;  3NS1 A;  1WXM A;  2C5L C;  3CMM B;  4TV3 A;  4LLG M;  2V9H A;  1JQ4 A;  3P4Q B;  4MH8 A;  4E74 A;  1IPG A;  1R4M I;  1I4Q A;  3SD5 A;  2INP E;  5H92 C;  4A6Q A;  3ML9 A;  1PUT A;  4YL8 A;  2RD0 A;  4FJY A;  1WFY A;  4DXA B;  4ZHO A;  5DPT A;  4KGS A;  2I2Y A;  4EEW A;  3C19 A;  3UQA A;  2BBC A;  5DCN A;  4WWM A;  1TGZ B;  4B95 A;  5MPO A;  1GNU A;  1J7B A;  2EKI A;  3I57 A;  4RH6 A;  4EOY A;  2REX A;  3PZ7 A;  1UZX B;  2X38 A;  3TMP B;  2BS2 B;  2LHD A;  2JWU A;  3RZW C;  1WI0 A;  2KWV B;  2NS5 A;  2IGG A;  4XDD A;  1PGB A;  3C0R B;  5IN7 A;  3VDZ A;  1E7U A;  4W9I A;  4LDT B;  4WAF A;  2VZK D;  1WH3 A;  2JQR B;  4N9F 4;  2I1J A;  1YOV B;  1V1O A;  1WE7 A;  4FUL A;  1JWA D;  3ZXR A;  1KLU D;  3X0W A;  4FHK A;  4MT5 A;  4US8 A;  2XK5 A;  3T9L A;  1QOA A;  1C3T A;  4FBJ B;  2FCS A;  3DOW A;  1NI3 A;  3M63 B;  3WAL A;  3TEX A;  4S0R A;  3TSS A;  4GDL A;  4JLC A;  1LM8 B;  2M8S A;  2B3A A;  2JY6 A;  5EDS A;  5IAA C;  2QHO A;  2UU7 A;  3Q8B A;  1L4D B;  3ZVV A;  4JPS A;  5G5H A;  4ICV A;  1IBX A;  3R66 C;  2UWQ A;  4JWS C;  1UBI A;  3C8Y A;  3OWE B;  2J0M A;  1ZPS A;  4GSW A;  4IWQ A;  3FIL B;  2PLP A;  1WXS A;  3AI5 A;  2YVC A;  3QK0 A;  1QLB B;  3IT6 B;  2LGI A;  2WLB A;  5C2T B;  3DPD A;  1JCK B;  2XNA C;  2K22 A;  3N3K B;  2G4S A;  3RNE C;  2Z59 B;  4EE2 A;  1DOX A;  2KMC A;  4FAD A;  2M4N A;  4XDC A;  2YLM A;  3DHG C;  4HPP A;  5AUK A;  3RNA C;  3BIN A;  4D2K A;  3HK0 A;  2DNF A;  2JSV X;  2RDB C;  1HE8 A;  4HRS A;  4YTM B;  2IND C;  3LJ3 A;  2QMT A;  5HI1 A;  3PT2 B;  3AE9 B;  4KZ0 A;  1OTR B;  5JZE B;  2Y5B B;  3PRE A;  4KSK C;  2NVU I;  2ZVN A;  4F1S A;  1XCT L;  3QA8 A;  4IM2 A;  3PZD A;  4B0E A;  1C1Y B;  1Y56 A;  2M17 A;  4OVU A;  5IKC M;  4BOZ B;  3MJ5 A;  1FO4 A;  1OEY J;  1YMH E;  2MX2 A;  5EE9 A;  1OQQ A;  1WM3 A;  3RPF C;  1UF0 A;  1V2Y A;  2IDY A;  1EWC A;  1Q10 A;  3OJ4 B;  2NR2 A;  2PPH A;  2W54 A;  1SJH D;  3V61 A;  1N61 A;  1IGD A;  4PYZ A;  1GUA B;  2JRH A;  2XN9 C;  4P16 A;  3B2G A;  3DBR B;  3HHM A;  4BBN F;  1FXI A;  3NVY A;  5HKH A;  2KO3 A;  4LNO A;  2Y5C A;  4KIK A;  2BB6 A;  3R2T A;  2N0S B;  2KJR A;  1MVK A;  2IGD A;  3Q8F A;  3KYC D;  4YTP B;  4DDI D;  5J18 A;  3QAQ A;  1KF6 B;  2JWZ A;  1N6Z A;  3ZQ4 A;  4JGH B;  3EGR A;  3TEZ A;  4KGR A;  3ZJT A;  2LZ6 A;  2R2O A;  4L1B A;  1D3Z A;  4B0M A;  1EO6 A;  4DK5 A;  1BXT A;  2PKO A;  3W1S A;  3ZDT A;  2RPQ A;  1PYW D;  3N20 C;  1N5X A;  1YJJ A;  1C4C A;  2N9X A;  4LNF A;  2C7H A;  3PHX B;  2MBO A;  4FJZ A;  2KWD A;  2MHJ A;  1JW9 D;  4ZYS A;  3BWU D;  2AL6 A;  2V3N A;  2K1F A;  1F77 A;  4K1R B;  1WWT A;  5C23 A;  1I4G A;  2MW5 A;  2L7R A;  2JYT A;  5D7G A;  1HZ6 A;  1V5O A;  1L6V A;  4NJC A;  4NQK E;  1E10 A;  2M1M A;  3DBH I;  1XLP A;  1XT9 B;  1ACC A;  3DBS A;  4HKZ E;  1RRB A;  1QOF A;  5G5G A;  2LXC A;  2PMV A;  2RSU A;  3HIZ A;  3VAW A;  3A4S C;  1WGD A;  3VUX A;  5I4D A;  3TL5 A;  4HDO A;  3UIN B;  2MEK A;  2K9X A;  4NZL B;  1TKG A;  3U30 A;  3DHH C;  4GMV A;  1TT5 B;  3ONS A;  1CMX B;  1Y8R C;  1K51 A;  1LO5 D;  1ESF A;  2O2V A;  3VXW A;  4DBG A;  1I35 A;  2DYB A;  1KLG D;  3V6C B;  4KZC A;  4WQM A;  2BKR B;  3IHP C;  2AX5 A;  2MCN B;  1FRR A;  3VFK A;  1XLO A;  3ZNG C;  4RF0 A;  2L76 A;  5BO4 B;  1WIA A;  2SAK A;  2FUG 1;  4FA6 A;  3J9C A;  2D10 A;  2DX5 B;  1XEE A;  1FNV A;  3T3N A;  1IYF A;  4ANV A;  2WXL A;  4GDL B;  1N60 A;  4MDK E;  2Z8L A;  4S17 A;  2K25 A;  4F7Z A;  1L6U A;  1GPX A;  3V62 A;  1T0S C;  4M02 A;  1P3Q U;  1SE2 A;  5D3D A;  1SEB D;  2L3Z A;  2GI9 A;  2LVP A;  2K8H A;  2RDH A;  2Z0E B;  4FN2 A;  4GOC A;  1UGJ A;  1FRD A;  2JU6 X;  1UWX A;  2QC8 A;  2IY0 B;  3KWL A;  2L00 B;  1GC6 A;  3ZKJ C;  3RT3 B;  3AU4 A;  4BVU C;  1WSP A;  4OVZ A;  2D3B A;  2KAC A;  1SIJ A;  2J53 A;  3GE8 C;  2LRU A;  4II2 B;  3U7Z A;  2EMT A;  3L08 A;  3AXC A;  1C76 A;  1FD6 A;  2H88 B;  1JRU A;  1AW7 A;  4F8C B;  3KYD D;  2GMI C;  4ZRP A;  1P7E A;  2IYD B;  3V6E B;  1OEY A;  1J8C A;  3PPA A;  2AEH A;  1RLF A;  4LTU A;  1JWB D;  2OOB B;  4A3O A;  2V3P A;  3NUH B;  1I4P A;  2IO1 B;  3NJT A;  4AUQ C;  3ML8 A;  2KDM A;  5IO9 A;  3VTW A;  5FR3 A;  2NMQ A;  4Q2J A;  5HFY A;  3JSV A;  3QCA A;  2E3T A;  2MA9 B;  3RI7 C;  2J42 A;  2D07 B;  2L0T A;  2ZCC A;  1SSN A;  3AEE B;  1XLN A;  4OZC A;  4ZDV A;  1F0Z A;  3AE6 B;  2MH7 A;  4FJV B;  1HXY D;  2MJE A;  3LXF A;  1BT0 A;  2KJ6 A;  3ZRC A;  1VZ8 A;  4TKN A;  1E0Z A;  5GMV A;  3N1X C;  4GB9 A;  4YWG G;  4X57 B;  2CJO A;  1XQQ A;  1Q5W B;  1E7V A;  1V97 A;  3BK2 A;  4KIK B;  4RMA A;  2CHX A;  2QCZ A;  1HA5 A;  1BUI C;  2BWE S;  1QKZ A;  3U4E G;  1QZE A;  2K6D B;  4GN1 A;  4IWO A;  1YX5 B;  4REZ A;  4NQL B;  2KDB A;  3DBL B;  1D5Z C;  3I9V 1;  1IUE A;  2AWT A;  5L83 A;  3SDL C;  2BW2 A;  4JL9 A;  2N9E B;  5J17 A;  4CQN A;  2FAZ A;  2HJ1 A;  3L16 A;  4BOS C;  2LUM A;  5JH5 C;  2KK8 A;  4K7S A;  2WDQ B;  2CHW A;  4NPN A;  1TZO A;  2MJD A;  2WXO A;  1GOZ A;  2W3R A;  5D3I B;  1QQR A;  2XBB C;  1S1Q B;  3WAO A;  3ZJU A;  2W55 A;  4MGZ E;  1E7P B;  1OFF A;  3H7S A;  3ZRF A;  1JAL A;  4XC2 A;  3PV1 A;  4MJS A;  1WR1 A;  4YSX B;  2K3U A;  3VRB B;  5LXH A;  4W9E A;  3RNG C;  5C3J B;  2MBE A;  1WRI A;  2WYQ A;  4GU2 A;  5DPS A;  4JWU C;  1WX7 A;  3N30 A;  2KDE B;  2GB1 A;  2BQQ A;  2IY1 B;  2C60 A;  1M94 A;  2N9P C;  3PRM B;  2LD9 A;  2KMM A;  3ZW3 A;  3VQI A;  2MQJ A;  3APF A;  2JZ3 B;  3VVW B;  3ZNI D;  3VRA B;  5E6J A;  2AQ2 B;  3IAM 1;  5H8Y E;  2H89 B;  1ENF A;  2D3C A;  2N7J A;  3DDC B;  1ET6 A;  3KH0 A;  1TKY A;  3LDZ E;  4N58 A;  1KLV A;  1ZXH A;  3BVZ A;  1P9D U;  2ZNV C;  1WX9 A;  1ZXI A;  5TSS A;  2KKC A;  3WAN A;  4PS3 A;  4MEM A;  2O2V B;  2HTH A;  2J0J A;  1R4N B;  3PS6 A;  1B9R A;  4DHJ D;  5BYS A;  1L0Y B;  1I4H A;  4OHJ A;  3IG3 A;  2AQ3 B;  1JRP A;  3HM3 A;  1QOG A;  1MPE A;  3U2S C;  2CS4 A;  1MJD A;  4NAW B;  1H8C A;  3H9D A;  2XEW A;  4HCP B;  4W9K A;  4XWW A;  3AE4 B;  4WIP A;  3A1Q A;  1TS3 A;  2DYO A;  3AU5 A;  3WCQ A;  3NVZ A;  1VRA B;  3RYT A;  4KV2 A;  2DZM A;  3ZUN A;  3W2D A;  3ABV B;  1RWS A;  2IGH A;  1L7Y A;  1ZDX A;  2HTM E;  1E8W A;  1T0R C;  1M4V A;  2LAS A;  3A4R A;  4IDI A;  3UI3 A;  3AEA B;  4HXD A;  1PGA A;  2ACZ B;  4W9L A;  4II3 B;  4O1N A;  2C7M B;  3H6N A;  3DBR I;  1WGH A;  1LQB A;  1SXT A;  3QAR A;  1ROE A;  3L4P A;  4IM0 A;  3KLS X;  3W9C B;  3NVW A;  2KVR A;  3R7Q A;  4G50 A;  3HVZ A;  1FFU A;  4QAY A;  4I6L B;  3TIX A;  2JX5 A;  4BKS D;  1C79 A;  3SR6 A;  1GC7 A;  3T3O A;  1FCL A;  4EUT A;  3JSV B;  1CQV A;  1WGG A;  1EM7 A;  2K0P A;  2NBV B;  4EZJ A;  3H7P B;  4IUM B;  1R4M B;  2KDF B;  2HDE A;  4WWO A;  1GB1 A;  2EKE C;  3ENE A;  4P7I A;  1ISN A;  2WDT B;  3VTV A;  4H2A A;  2NCN A;  1LGR A;  3B0A A;  3RUL A;  3AN1 A;  2GBN A;  1NEK B;  1D6E C;  1OQR A;  3PLV A;  1J0G A;  1K50 A;  1A5R A;  3AV8 A;  5CTR C;  5AZH A;  4N6E B;  1V49 A;  1I42 A;  2N4F A;  2IO2 B;  1CJE A;  1OGW A;  1WMH A;  3I63 C;  1DOI A;  2CJN A;  2L32 A;  4YSY B;  2HJ8 A;  1SE3 A;  2HE7 A;  2LMC A;  2KD0 A;  4HKQ A;  3AEC B;  3CIR B;  1WJ6 A;  3MC0 B;  2WXM A;  3IFW B;  4M00 A;  2BYT A;  3EFC A;  3BYT B;  5D94 A;  1V80 A;  4IWP A;  4BBN C;  5J2R A;  3H1U A;  3H8H A;  2JZP A;  2KWU B;  3NZU A;  2BF8 B;  1VZ7 A;  1K53 A;  1L0X B;  4AQ7 A;  4OW0 A;  3EEC A;  3IT4 B;  2PJH A;  2N9K A;  4TSS A;  2QJL A;  1FIQ A;  3P63 A;  2RGF A;  1HQR D;  1EU4 A;  1WGK A;  1T6B X;  3HVD A;  3MHS D;  5BMG A;  1UNS A;  4MJS B;  3PSE B;  1GG3 A;  2BYF A;  2BGF A;  2KX3 A;  3WAM A;  3ZNH B;  3BII D;  2AQ1 B;  3SFD B;  4IG7 B;  2FID A;  2J52 A;  4DXF A;  5JHB A;  2WXI A;  2KHW B;  2MRP A;  5LXI B;  2R61 A;  4K81 A;  1LXD A;  2V0G A;  2QSD A;  2KQ4 X;  4JQW C;  3RNF C;  3CF6 E;  4AS1 A;  1Q1O A;  4YSZ B;  5FR6 A;  4P1C C;  2K8B A;  3AM9 A;  1D4B A;  5KHQ A;  2RMM A;  1TIF A;  2OHF A;  2AL3 A;  4WH4 A;  2ASQ A;  3EA6 A;  1ZKH A;  1VJK A;  4IOI E;  4W9G A;  4A90 A;  3W5U B;  3P2B A;  5L95 C;  1C9F A;  4URK A;  4I6P A;  1L2N A;  2LJI A;  3T8M A;  4KKJ A;  4AJW A;  1UD7 A;  1SBB B;  2CHZ A;  4LNI A;  2UYZ B;  2NTS A;  2N1V A;  3E9S A;  2CR5 A;  4HEA 1;  2W82 A;  3I5J C;  2GBK A;  3MJW A;  3OG5 A;  3TBL D;  4GDK A;  1V6E A;  1ZGU B;  3I3T B;  3A9J A;  4W9D A;  2WXH A;  1UH6 A;  2DEN B;  3QJZ A;  3PVL A;  2BB5 A;  2WXP A;  1L4Z B;  1EUV B;  1KRH A;  1C4A A;  1F9J A;  1QIL A;  3A1Q B;  3DVN V;  1Q0W B;  1H4R A;  2DLB A;  3KUC B;  2KDI A;  3UF8 A;  5T8I A;  4R3D A;  2C7N B;  2XK5 B;  2FCQ A;  2DAJ A;  4NJ6 A;  1NI2 A;  3AE1 B;  4C4V A;  1TZ1 A;  3P4P B;  5LNK 1;  4K3B A;  2WU2 B;  2Y5P A;  2A4Z A;  2MBB B;  4HRO A;  2DZI A;  1C77 A;  5DPR A;  1STE A;  2MBQ A;  3UQB A;  1ZDV A;  2FNJ B;  2GBR A;  1WYW B;  1IBX B;  1KH0 A;  3NVV A;  3SHQ A;  1P98 A;  1T0Y A;  2WWZ A;  1RM6 C;  3ZYY X;  4NNJ B;  1SIF A;  3NHE B;  4JX1 C;  2LVO A;  4KDL B;  4C80 A;  3WIM A;  2FIF A;  1DOY A;  4MSM B;  2C9W B;  2O6V D;  3APC A;  3Q14 C;  4FLH A;  2BS3 B;  3ZGZ A;  1HTO A;  2INN E;  1Z2M A;  2V4L A;  3AE8 B;  1YD8 U;  4KVG B;  4DXG A;  1YIW A;  1QT9 A;  1OQY A;  1YNT E;  3V05 A;  2MP2 A;  2PVG C;  4W9C A;  2KVZ A;  1TS2 A;  3ETR A;  5AZG A;  1C78 A;  5IA7 A;  2G4D B;  4C56 C;  3K9P B;  3RNC C;  4WJP A;  2LVQ A;  2KTF A;  4XYC A;  2M56 B;  4HJK A;  2ZW0 A;  4RNA A;  5IP4 D;  3FC4 A;  2INC C;  1N62 A;  2OJR A;  3RD2 A;  3GZN I;  3N1Z C;  3DHI C;  3D32 A;  1XF5 L;  5EE1 A;  3L0W B;  4I6N B;  1WMH B;  3W1Y A;  5HHD G;  2MJ3 A;  1I4R A;  4W9F A;  1A70 A;  3RZF A;  4KDI C;  3ZTC A;  5BYQ A;  1KFY B;  4XGA B;  1KM7 A;  2W9N A;  3RN9 C;  4MAC A;  4TUU A;  2QIE B;  2NTT A;  1FCC C;  4MEL A;  4CO7 A;  3R2I A;  1TKE A;  4EKU A;  3EUB 2;  3EFU A;  2L1A A;  2QDF A;  3WA0 A;  4XZ4 A;  3QHT A;  1ZUD 2;  2VRR B;  2IPK D;  4WQO B;  2WHI A;  1R4N I;  1V5T A;  2LEK A;  3M62 B;  1PDX A;  3CSF A;  4A55 A;  2V4I B;  2IBI B;  2BT6 A;  1TJE A;  1TS4 A;  3EC8 A;  4HLE A;  3A33 B;  3KW5 B;  2I1K A;  1WRD B;  1NEN B;  1YN5 A;  3PO0 A;  2WU5 B;  2K5P A;  3VR8 B;  1VLB A;  1VR9 A;  4RCO A;  2GLS A;  2GRI A;  4MGK E;  3E56 A;  4EFO A;  1ZE3 D;  4W9J A;  3RMK C;  4TQ0 A;  2QEJ C;  1YQ4 B;  2DWQ A;  4RF1 A;  3O65 B;  3B1L X;  3PRP B;  5JXV A;  3ZIM A;  4YTN B;  2J7Q B;  3IVF A;  4US9 A;  4ARC A;  2JUO A;  5CX3 A;  2VH1 A;  1WR6 E;  1TS5 A;  4HJG E;  2GBM A;  3TCA A;  3BY4 B;  4GXB A;  1NBF C;  2WQY B;  2PEA A;  2JPH A;  2KAN A;  3Q3M C;  2DHZ A;  3P1M A;  2JRI B;  4KKI A;  2KOX A;  1XO3 A;  1L5P A;  4E71 A;  2L0F A;  2CU1 A;  2Q5W D;  4NJ7 A;  1HZ5 A;  2PIA A;  4IC7 B;  4G3X B;  3U52 E;  3ZNZ B;  1RFK A;  4USA A;  5E6N A;  1UWM A;  2ZJD A;  1U4A A;  4HPM B;  1WM2 A;  1C4P A;  2VH2 A;  5G55 A;  3NOB A;  4GDK B;  2N7E A;  3TEY A;  3A9J B;  4M8N A;  2KN4 A;  3DCG A;  3NZ3 A;  1F1H A;  2VZK B;  4WJN A;  1MHH E;  3TEW A;  4ZRI A;  1X1M A;  3KUZ A;  4GIV A;  4PT5 A;  4ASW C;  1WE6 A;  1YJI A;  3ZJV A;  2ZPN A;  1VZ6 A;  3AEB B;  3S2A A;  4YXD B;  3M3J A;  1TBE A;  1HEZ E;  1VD2 A;  5AUI A;  2V3S A;  4AWJ A;  2TSS A;  1JWM D;  1WZ0 A;  2IZV B;  3A9K A;  2W3S A;  4C4V B;  2KX0 A;  4CHK A;  1TY0 A;  3VUY A;  3PTF C;  5D6J B;  4WWN A;  2KTR A;  4MGI E;  2J4X A;  2KC2 A;  2ZPY A;  4ANW A;  4XWT A;  2BYE A;  3P4R B;  4JE3 B;  3Q8E A;  3IAS 1;  3GP7 A;  1RAX A;  5C1Z A;  2NBW B;  3PRZ A;  1K8R B;  2K6Q A;  3DVG Y;  1F2R I;  1Z5S B;  3W5V B;  4EZK A;  3K9O B;  2O6V A;  3GOE A;  2KWC A;  1LFD A;  1WXQ A;  2DYM A;  1T3Q A;  1NDD A;  2L83 A;  4G11 A;  4IKG A;  2ON8 A;  4ZRQ A;  2WXG A;  4ZRK A;  3V3X A;  5CHW A;  1V81 A;  3HUI A;  3B9J A;  1E9M A;  1YJ1 A;  5LLI A;  1VDV A;  1P7F A;  2ONQ A;  2MSE D;  4ZYN A;  3LYY A;  3RCZ A;  2A5U A;  3BVG A;  1V8C A;  2ZNV B;  3AEF B;  4XX5 A;  4RGT A;  2AYO B;  2MP2 B;  1T5X D;  1UGM A;  1HTQ A;  3HM6 X;  5D2M B;  4LDT D;  3VH3 B;  3RUI B;  2M0A A;  2MWS B;  1V1P A;  1J7C A;  2LGS A;  1F2R C;  1N5W A;  2KJH B;  2FUH B;  4N59 A;  2LUE A;  3AE2 B;  4DDG D;  1FMA D;  1JRO A;  2LJ5 A;  1J7A A;  1B1Z A;  1VCB A;  1YN4 A;  4OZB A;  2LRW A;  2KFJ A;  3QC8 B;  4DWF A;  3AE7 B;  4AP4 C;  4AOF A;  4BFR A;  4LJO B;  3QIJ A;  2WNM A;  2KN5 A;  1WXA A;  1GB4 A;  1BML C;  1I4X A;  2WS3 B;  2L05 A;  3U8Z A;  3BYY B;  4KGT A;  2K8C A;  3AEG B;  2WXK A;  1EF5 A;  2L8J A;  4FXC A;  4M8M A;  2J0K A;  1SB3 C;  1R7S A;  3RNB C;  4EZL A;  4K7U A;  4MM3 A;  1FXA A;  2NPT A;  1N63 A;  1V9J A;  3V60 A;  1SE9 A;  2E6X A;  3B08 A;  4XE0 A;  4UDU C;  3ZO5 B;  2JF5 A;  3PGE A;  1YX6 B;  1ZW7 A;  2JT4 B;  1YN3 A;  2LWP A;  1PQS A;  3IXS A;  2D3G A;  2YEP F;  2WX1 A;  1CZP A;  3DWG C;  4A20 A;  2SEB D;  2ZVO A;  3MC8 A;  1D5X C;  1E5W A;  3AE3 B;  3FAH A;  4JIO U;  2BTE A;  3NY5 A;  1XXG A;  2DZJ A;  4ANU A;  1ZP0 B;  1WJ4 A;  3M95 A;  2KXJ A;  4K3C A;  3Q8A A;  3APD A;  4KSL C;  2BVC A;  4P1B C;  4DHZ B;  1KJT A;  3CWI A;  4AJY B;  3Q6B A;  2K39 A;  2ZZP B;  3FKY A;  4ARI A;  5KHO A;  1K52 A;  2PTL A;  2IO3 B;  4PS8 A;  2PW9 A;  2OED A;  2WXR A;  4B6W A;  4DQO C;  1P0R A;  3VH4 B;  4E3C A;  3Q2A C;  2ZW1 A;  4HWI B;  2KFK A;  5HG2 A;  3P4S B;  1WGY A;  3ZDM C;  3AE5 B;  1SJE D;  2WP9 B;  2YEP B;  2KLC A;  4LCD E;  5EE3 A;  3PHW B;  3GB1 A;  4ZOH C;  3ECI A;  2B76 B;  1PGX A;  1P1A A;  2MLB A;  4WUR A;  4RGN A;  5JHA A;  1KOT A;  3HRD D;  2EEL A;  2IJ0 A;  3MC9 A;  1ZOY B;  1JML A;  1RFA A;  2FCM A;  3NZS A;  4PK1 A;  2JZZ A;  1NVI D;  2FCN A;  3URY A;  4MH0 E;  4ZHP A;  4LNK A;  3WAP A;  4M0W A;  3VUW A;  2M0X A;  1QF6 A;  5E6O A;  2WXF A;  1NYR A;  2KQ7 A;  4M01 A;  4TQ1 A;  5BMI A;  2BWF A;  4NY0 A;  1MG8 A;  5IOI A;  1MG4 A;  2BKF A;  2BYV E;  4LNN A;  2WDV B;  1JWS D;  3ZLZ A;  3A9K B;  1NYQ A;  3P42 A;  3L54 A;  1AYF A;  2V1Y A;  2DZK A;  2DBY A;  2KTR B;  5BMH A;  3GS2 A;  2RDG A;  5FK9 C;  2D3A A;  2LGY A;  4A9A A;  1TYG B;  5AEK B;  1YQB A;  5CHV C;  1RYJ A;  4GLS C;  5TR5 A;  3DVN U;  3OLM D;  2JXX A;  1FM0 D;  3Q3O C;  4P6V F;  1L0V B;  3EHV A;  4KX6 B;  2R2Q A;  3LB8 C;  2L52 A;  1WX8 A;  3MFG A;  4A8X C;  4ACF A;  3KQ4 A;  3NRZ A;  3N9Y C;  3AED B;  3JW0 X;  2O6V B;  1FNU A;  4HCN B;  4RM9 A;  4RGM A;  3SEB A;  1WF9 A;  3GE3 C;  2G1E A;  2WXQ A;  3R7R A;  2Z0D B;  4NAW A;  4WWP A;  4ANX A;  4HVB A;  1KTK A;  2JVC A;  1MHX A;  4L2Y A;  2LGD A;  5CHF A;  2LGX A;  2QIL A;  3SU8 X;  2KMA A;  5FKA C;  4HDQ A;  4BKS A;  4DHZ E;  3DBL I;  4RM8 A;  1D5M C;  4K7W A;  1FEH A;  1V1P B;  1GAQ B;  3B2F A;  5AZF A;  1T0Q C;  3NS8 A;  3JYU A;  2KQS A;  4G0N B;  3Q3J A;  1SGH A;  4MGY E;  3DBH B;  1UBQ A;  1E6E B;  2RR9 A;  1WJU A;  2ZEQ A;  1UUP A;  1UEL A;  1MI0 A;  2WDR B;  2WXN A;  3KWV A;  1E90 A;  3X23 A;  1EWY C;  4HPL B;  4CYE A;  1V86 A;  3UIP B;  4C00 A;  1AAR A;  4W9H A;  1IP9 A;  1WGR A;  4FHJ A;  4RFB A;  3TUO A;  3QQ8 B;  4ZRJ A;  2RPV A;  2X8X X;  2CU3 A;  3QX1 A;  4A3P A;  2BPS A;  3FIL A;  3VR9 B;  2D11 A;  3L17 A;  4MM3 B;  3PZ8 A;  2NPT B;  1F52 A;  3BZD B;  1E8X A;  1FFV A;  4WJO A;  2KNB A;  4BKT A;  3W1S C;  4WAA A;  2KC1 A;  3KUD B;  1FNW A;  3Q8C A;  1XD3 B;  2BS4 B;  4OVV A;  1G6J A;  3PLU A;  2PE9 A;  3H7P A;  1WZ3 A;  1TTN A;  5EE0 A;  3R3M A;  2N1W A;  1E8Z A;  1CK1 A;  1AWD A; 
#chains in the Genus database with same CATH homology
 1I42 A;  2ZPN A;  3L10 B;  3N32 A;  3S2A A;  3U30 A;  1FXT B;  2N4F A;  3U7D A;  3M3J A;  2IO2 B;  4GMV A;  1TBE A;  1OGW A;  1WMH A;  1VD2 A;  3DVG X;  3ONS A;  1CMX B;  1Y8R C;  4HK2 A;  2HJ8 A;  2V3S A;  2O2V A;  3VXW A;  3TJP A;  2HE7 A;  4AWJ A;  4ICU A;  4DBG A;  1I35 A;  1WXV A;  2KD0 A;  2KLG A;  3VHT C;  1WZ0 A;  2DYB A;  2IZV B;  3A9K A;  1WJ6 A;  3AUL A;  2GOW A;  3V6C B;  2KX0 A;  4IW0 A;  4KZC A;  4CHK A;  3VUY A;  3PTF C;  4GGQ A;  3IFW B;  5D6J B;  2BKR B;  3IHP C;  4WWN A;  2KTR A;  4MGI E;  2MCN B;  3VFK A;  2GBJ A;  3ZNG C;  2KC2 A;  1GJZ A;  2ZPY A;  2L76 A;  4ANW A;  2BYE A;  2PE6 B;  5D94 A;  5BO4 B;  3DQV A;  5E6P A;  1E8Y A;  1V80 A;  1WIA A;  4IWP A;  3OAW A;  3ALB A;  4BBN C;  5J2R A;  1WY8 A;  1RAX A;  5C1Z A;  3H1U A;  4FA6 A;  2D10 A;  2NBW B;  1S3S G;  2DX5 B;  3PRZ A;  1K8R B;  2KWU B;  2K6Q A;  3NZU A;  3DVG Y;  2BF8 B;  1IYF A;  2D2Q A;  2G3Q B;  2ZCB A;  3L13 A;  3ZTD A;  4ANV A;  1Z5S B;  1WJN A;  4GDL B;  4MDK E;  2K25 A;  1EF1 A;  4F7Z A;  3EEC A;  4EZK A;  3K9O B;  2O6V A;  3GOE A;  2KWC A;  1LFD A;  2PJH A;  2KFK B;  2N7D A;  2DYM A;  2HD5 B;  1NDD A;  4J6I A;  3V62 A;  4G11 A;  1P3Q U;  4IM3 A;  4ZRK A;  2RGF A;  5CHW A;  2L3Z A;  1V81 A;  4WJQ A;  1YJ1 A;  3Q3F A;  5LLI A;  2LXA A;  2LVP A;  4MSQ B;  2K8H A;  2MSE D;  2Z0E B;  4FN2 A;  4GOC A;  4ZYN A;  2EMS A;  3RCZ A;  2A5U A;  3VTU A;  3MHS D;  4LJP B;  2ZNV B;  4XX5 A;  3QWZ B;  2AYO B;  2MP2 B;  1UGM A;  3OJ3 A;  2IY0 B;  4MJS B;  3PSE B;  2L00 B;  1GC6 A;  3HM6 X;  5D2M B;  3RT3 B;  1GG3 A;  3ZKJ C;  3AU4 A;  4LDT D;  3VH3 B;  4BVU C;  2BYF A;  3RUI B;  2BGF A;  2KZR A;  2MWS B;  4BKG A;  4B9K A;  2KX3 A;  3WAM A;  1J19 A;  2DAF A;  3ZNH B;  2IO0 B;  5DPW A;  4IG7 B;  4PS7 A;  2FID A;  2KJH B;  2LRU A;  5G2N A;  3JVZ X;  2FUH B;  4II2 B;  2EMT A;  2MBH A;  2LUE A;  3L08 A;  3AXC A;  5JHB A;  2KHW B;  2MRP A;  3IBE A;  4DDG D;  5LXI B;  4K81 A;  2LJ5 A;  1LXD A;  1JRU A;  1VCB A;  2CKH B;  3CST A;  4M0W B;  4JQW C;  4F8C B;  2LRW A;  3KYD D;  2KFJ A;  2GMI C;  3QC8 B;  2IYD B;  3V6E B;  3CF6 E;  4DHJ B;  1OEY A;  4DWF A;  1J8C A;  3PPA A;  2AEH A;  1RLF A;  1Q1O A;  2WX0 A;  2OOB B;  4A3O A;  5FR6 A;  4AP4 C;  2K8B A;  2LI5 A;  4AOF A;  4BFR A;  4LJO B;  5KHQ A;  2IO1 B;  3MTN B;  4PYU A;  2G45 B;  3QIJ A;  4AUQ C;  3ML8 A;  2AL3 A;  1WXA A;  2KN5 A;  3UIO B;  2ASQ A;  3VTW A;  1ZKH A;  3KVF B;  2L05 A;  4W9G A;  3U8Z A;  3JSV A;  2K8C A;  3P2B A;  3UGB B;  5L95 C;  2NBU A;  3QCA A;  4URK A;  4I6P A;  1L2N A;  2MA9 B;  1WXM A;  2C5L C;  1EF5 A;  2L8J A;  3CMM B;  4TV3 A;  2D07 B;  4M8M A;  2L0T A;  2ZCC A;  2J0K A;  3T8M A;  4AJW A;  1UD7 A;  4E74 A;  4EZL A;  4K7U A;  1IPG A;  1R4M I;  4MM3 A;  2CHZ A;  2NPT A;  2UYZ B;  3SD5 A;  2N1V A;  4ZDV A;  2CR5 A;  3ML9 A;  1V9J A;  3V60 A;  1SE9 A;  2GBK A;  3B08 A;  4YL8 A;  2RD0 A;  3MJW A;  4FJY A;  3ZO5 B;  3TBL D;  2JF5 A;  1WFY A;  4FJV B;  1V6E A;  3PGE A;  4GDK A;  4DXA B;  1YX6 B;  1ZGU B;  5DPT A;  3I3T B;  4EEW A;  1ZW7 A;  3UQA A;  2JT4 B;  3A9J A;  5DCN A;  2LWP A;  1PQS A;  4W9D A;  2D3G A;  1UH6 A;  2DEN B;  3QJZ A;  3PVL A;  1TGZ B;  1BT0 A;  4B95 A;  2WX1 A;  2KJ6 A;  1EUV B;  3ZRC A;  1GNU A;  4TKN A;  5GMV A;  1F9J A;  4A20 A;  4GB9 A;  2ZVO A;  3A1Q B;  4X57 B;  4EOY A;  2REX A;  3DVN V;  1Q0W B;  1H4R A;  1E5W A;  1UZX B;  3TMP B;  1XQQ A;  1Q5W B;  1E7V A;  3KUC B;  2KDI A;  4JIO U;  3UF8 A;  3NY5 A;  2C7N B;  2XK5 B;  2DZJ A;  4ANU A;  3M95 A;  1WJ4 A;  4KIK B;  4RMA A;  3RZW C;  2KXJ A;  2CHX A;  2BWE S;  1QZE A;  1WI0 A;  2FCQ A;  2K6D B;  2KWV B;  2NS5 A;  4GN1 A;  4IWO A;  3C0R B;  2DAJ A;  1YX5 B;  4NJ6 A;  4NQL B;  3APD A;  4KSL C;  3VDZ A;  1E7U A;  4W9I A;  1NI2 A;  4LDT B;  4DHZ B;  2KDB A;  1TZ1 A;  1KJT A;  1WH3 A;  4N9F 4;  4AJY B;  2I1J A;  2AWT A;  5L83 A;  3SDL C;  1WE7 A;  2K39 A;  2A4Z A;  2N9E B;  2MBB B;  4FUL A;  4JL9 A;  2ZZP B;  3X0W A;  2DZI A;  5DPR A;  5J17 A;  2FAZ A;  4FHK A;  2XK5 A;  3T9L A;  3L16 A;  2MBQ A;  5KHO A;  3UQB A;  1C3T A;  4FBJ B;  2FNJ B;  2IO3 B;  4BOS C;  2GBR A;  1WYW B;  2FCS A;  3DOW A;  5JH5 C;  3M63 B;  3SHQ A;  2KK8 A;  3WAL A;  1P98 A;  1T0Y A;  4K7S A;  4PS8 A;  2CHW A;  2WWZ A;  4NPN A;  4NNJ B;  4B6W A;  1SIF A;  1P0R A;  4GDL A;  4JLC A;  3VH4 B;  4E3C A;  3NHE B;  1LM8 B;  2LVO A;  4KDL B;  2M8S A;  3WIM A;  2B3A A;  2JY6 A;  4HWI B;  5EDS A;  2FIF A;  5IAA C;  2KFK A;  2QHO A;  1WGY A;  3ZDM C;  2XBB C;  4MSM B;  2C9W B;  2O6V D;  3APC A;  4FLH A;  3ZVV A;  1Z2M A;  1S1Q B;  2KLC A;  4LCD E;  3PHW B;  3WAO A;  2V4L A;  4ICV A;  3R66 C;  1YD8 U;  2UWQ A;  4MGZ E;  4KVG B;  3ECI A;  1UBI A;  1YIW A;  1OQY A;  1P1A A;  3H7S A;  3ZRF A;  2MLB A;  2J0M A;  2MP2 A;  5JHA A;  4GSW A;  4W9C A;  4XC2 A;  1KOT A;  3PV1 A;  4IWQ A;  4MJS A;  1WR1 A;  1WXS A;  5AZG A;  3AI5 A;  2YVC A;  3QK0 A;  5LXH A;  4W9E A;  5IA7 A;  2G4D B;  3K9P B;  1RFA A;  2FCM A;  2MBE A;  3DPD A;  3NZS A;  4WJP A;  2JZZ A;  2WYQ A;  2LVQ A;  2KTF A;  3N3K B;  2G4S A;  4GU2 A;  5DPS A;  1WX7 A;  2Z59 B;  3N30 A;  2FCN A;  2KDE B;  2IY1 B;  4MH0 E;  2C60 A;  4HJK A;  1M94 A;  2N9P C;  3PRM B;  2LD9 A;  3WAP A;  2KMC A;  4FAD A;  2M4N A;  3ZW3 A;  2YLM A;  3VQI A;  2MQJ A;  2M0X A;  3VUW A;  3APF A;  3BIN A;  5E6O A;  2JZ3 B;  3HK0 A;  3VVW B;  3ZNI D;  2OJR A;  3RD2 A;  2KQ7 A;  3GZN I;  4TQ1 A;  2BWF A;  3DDC B;  3D32 A;  4NY0 A;  1MG8 A;  3KH0 A;  3L0W B;  3LDZ E;  4I6N B;  1KLV A;  1HE8 A;  1WMH B;  3W1Y A;  3LJ3 A;  1P9D U;  2ZNV C;  1WX9 A;  3PT2 B;  2BKF A;  2KKC A;  3WAN A;  4PS3 A;  4W9F A;  3RZF A;  4KZ0 A;  4MEM A;  2O2V B;  1OTR B;  4KDI C;  3ZTC A;  5JZE B;  2BYV E;  2Y5B B;  3PRE A;  3ZLZ A;  4KSK C;  2NVU I;  2ZVN A;  2HTH A;  3A9K B;  4F1S A;  3L54 A;  1KM7 A;  3QA8 A;  4IM2 A;  2J0J A;  3PZD A;  2V1Y A;  2W9N A;  3PS6 A;  1C1Y B;  4DHJ D;  2DZK A;  2KTR B;  2LGY A;  3IG3 A;  4TUU A;  2M17 A;  4OVU A;  5AEK B;  1YQB A;  3HM3 A;  5CHV C;  4MEL A;  4BOZ B;  2CS4 A;  4CO7 A;  1OEY J;  2MX2 A;  4EKU A;  5TR5 A;  1WM3 A;  3DVN U;  4NAW B;  3OLM D;  2JXX A;  1V2Y A;  3EFU A;  1H8C A;  3EHV A;  3H9D A;  2XEW A;  4HCP B;  2R2Q A;  3WA0 A;  3OJ4 B;  1WX8 A;  4W9K A;  2NR2 A;  2PPH A;  4XZ4 A;  3V61 A;  3QHT A;  4PYZ A;  1GUA B;  2JRH A;  2VRR B;  4WQO B;  3A1Q A;  3JW0 X;  1R4N I;  2O6V B;  1V5T A;  2DYO A;  3M62 B;  3AU5 A;  4HCN B;  3HHM A;  3CSF A;  4RM9 A;  4BBN F;  3RYT A;  4KV2 A;  1WF9 A;  3R7R A;  5HKH A;  2Z0D B;  2IBI B;  2KO3 A;  4NAW A;  4WWP A;  4KIK A;  2DZM A;  4ANX A;  3EC8 A;  3ZUN A;  4HLE A;  3A33 B;  4HVB A;  2JVC A;  2KJR A;  1L7Y A;  3KW5 B;  1E8W A;  2I1K A;  2LGD A;  5CHF A;  1WRD B;  2LGX A;  4DDI D;  3KYC D;  2LAS A;  3SU8 X;  3A4R A;  3QAQ A;  5J18 A;  2KMA A;  2JWZ A;  4HXD A;  4HDQ A;  4BKS A;  4DHZ E;  4JGH B;  3DBL I;  4RM8 A;  4W9L A;  4II3 B;  2C7M B;  2LZ6 A;  2R2O A;  4K7W A;  3H6N A;  3DBR I;  1D3Z A;  4MGK E;  1WGH A;  1LQB A;  4EFO A;  5AZF A;  1EO6 A;  4DK5 A;  3QAR A;  4W9J A;  4TQ0 A;  3NS8 A;  3O65 B;  3W1S A;  4IM0 A;  3B1L X;  2RPQ A;  2KQS A;  3JYU A;  3ZDT A;  4G0N B;  3Q3J A;  3PRP B;  1SGH A;  3ZIM A;  2KVR A;  4MGY E;  2J7Q B;  3IVF A;  3R7Q A;  4G50 A;  1UBQ A;  2JUO A;  1WJU A;  2RR9 A;  2ZEQ A;  2N9X A;  1UEL A;  2C7H A;  3PHX B;  2MBO A;  4FJZ A;  5CX3 A;  1E90 A;  1WR6 E;  2AL6 A;  3X23 A;  4HPL B;  4I6L B;  3TIX A;  2K1F A;  2GBM A;  4CYE A;  3TCA A;  4BKS D;  4K1R B;  1V86 A;  3UIP B;  3BY4 B;  5C23 A;  4GXB A;  1AAR A;  1GC7 A;  1NBF C;  4W9H A;  2PEA A;  1IP9 A;  1WGR A;  2JPH A;  2KAN A;  2MW5 A;  4FHJ A;  4EUT A;  2L7R A;  2DHZ A;  3JSV B;  3QQ8 B;  4ZRJ A;  5D7G A;  2JRI B;  1WGG A;  2KOX A;  3QX1 A;  1V5O A;  4A3P A;  2NBV B;  4EZJ A;  4E71 A;  2BPS A;  3H7P B;  4IUM B;  2KDF B;  2L0F A;  2CU1 A;  4NQK E;  4WWO A;  2M1M A;  2EKE C;  3ENE A;  3DBH I;  4NJ7 A;  4P7I A;  1ISN A;  2D11 A;  2WDT B;  3L17 A;  1XT9 B;  3DBS A;  4IC7 B;  4G3X B;  3VTV A;  2NPT B;  1RRB A;  2NCN A;  3ZNZ B;  1E8X A;  2LXC A;  3B0A A;  3RUL A;  5E6N A;  4WJO A;  2KNB A;  2GBN A;  4BKT A;  2ZJD A;  3W1S C;  1U4A A;  4HPM B;  4WAA A;  2RSU A;  1WM2 A;  2KC1 A;  3HIZ A;  3KUD B;  5G55 A;  3NOB A;  3VAW A;  4GDK B;  2N7E A;  3A4S C;  1XD3 B;  4OVV A;  3PLV A;  1G6J A;  3PLU A;  2PE9 A;  3A9J B;  3H7P A;  1WGD A;  4M8N A;  3VUX A;  1WZ3 A;  3DCG A;  1A5R A;  1J0G A;  4WJN A;  5CTR C;  3TL5 A;  5AZH A;  4ZRI A;  1TTN A;  4HDO A;  3UIN B;  1X1M A;  3KUZ A;  4GIV A;  4ASW C;  1V49 A;  1WE6 A;  3R3M A;  2N1W A;  1E8Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...