2GOWA

Solution structure of bc059385 from homo sapiens
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
116
structure length
116
Chain Sequence
SSNVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein 3
publication title Solution structure of a membrane-anchored ubiquitin-fold (MUB) protein from Homo sapiens.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 17
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2006-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13881 Rad60-SLD_2 Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2gowA01
3VUWA 5CHFA 2YLMA 4IWPA 4NPNA 2RGFA 1TGZB 4W9CA 5E6OA 2NS5A 1R4MI 3AU4A 3HIZA 2K8HA 3VH3B 5AEKB 5C1ZA 3C0RB 4CHKA 2KMAA 3ALBA 3ENEA 1YIWA 3VH4B 4E71A 4K7UA 3H7PA 1NBFC 3VTWA 3RZWC 2MP2A 2D07B 4LDTB 4ZRKA 4ICVA 1Q1OA 1WX7A 1LM8B 1V5OA 4ICUA 1WH3A 2KFKA 2ZJDA 3UINB 3K9OB 5JH5C 4EKUA 3DBHI 3PRZA 3ZDTA 3DQVA 3Q3JA 2K8CA 3K9PB 4PS8A 2HJ8A 3H7PB 3PS6A 4AOFA 2MX2A 3DBRI 4HK2A 2MP2B 3A9KA 2BYVE 3QK0A 1WJ6A 4CYEA 2DHZA 4BKSA 3H7SA 1UH6A 2JF5A 1IYFA 1SGHA 1EUVB 3AI5A 2ZCBA 3QHTA 4LJPB 4W9EA 3QA8A 4HCNB 5KHQA 5AZGA 3L16A 2PE6B 3KW5B 3MJWA 3S2AA 1VD2A 2KO3A 2HD5B 2N9XA 2WDTB 3JYUA 4M0WB 4XX5A 3ZVVA 4DDID 1YX6B 4FHJA 2MLBA 2ZPNA 3T9LA 3JW0X 4GXBA 5AZHA 2K1FA 3WAPA 3KUCB 3V6CB 1WMHB 2KWUB 1VCBA 2K39A 3B1LX 3VTUA 4GDLA 3CSTA 4GOCA 3SU8X 3KYDD 4M8MA 2GBNA 3TJPA 4EUTA 5D6JB 3DBSA 3KUDB 1P0RA 3PTFC 2OOBB 3AULA 2LVPA 4JQWC 1WYWB 2BPSA 2YVCA 3QJZA 2XK5B 1E8XA 2IYDB 4MH0E 3SD5A 3WAMA 4WWPA 4AUQC 4HLEA 2AYOB 4FADA 2EKEC 1F9JA 4WJPA 4ZRJA 4ZYNA 3PZDA 2LASA 2K6DB 5G55A 2LVOA 1XD3B 1E7UA 2IO3B 1EF5A 4GMVA 3W1SA 3A4SC 3KVFB 3N32A 4FLHA 3M62B 4G0NB 4DHJD 2KC2A 1V2YA 3R7RA 3UQAA 2LD9A 5D7GA 4FA6A 2GBJA 3DCGA 4N9F4 5BO4B 2FUHB 1YJ1A 4K1RB 4F7ZA 2KDBA 4HDQA 1H8CA 4K81A 3VTVA 2WWZA 2FCMA 3B08A 3APCA 4KIKB 1NI2A 1GC6A 4EZJA 4WWOA 3ZNGC 2V3SA 3N30A 4J6IA 1PQSA 2PPHA 1J19A 2JRIB 2KKCA 2LWPA 2KDEB 3TMPB 3NHEB 3RULA 4AJWA 3V60A 4KSKC 2CKHB 2NBUA 3ZNHB 4ZRIA 1UELA 2DX5B 2IBIB 3TCAA 3VXWA 3DBLI 2JY6A 2GBMA 1FXTB 3SDLC 2J0JA 2JUOA 3PSEB 4B9KA 3PHWB 4ANUA 1WGGA 4MSMB 2MBEA 3QIJA 5LXIB 4BOZB 4FHKA 4RMAA 3QAQA 4W9HA 3ZTDA 1WE7A 2PEAA 3ZRFA 3TBLD 1ZW7A 2K6QA 1V81A 3V6EB 2ZVNA 4G50A 1UZXB 1YX5B 4EEWA 1GC7A 4EZKA 2ZNVB 2RD0A 3NY5A 3WIMA 4IM2A 4I6NB 2KC1A 2KTRB 2C7HA 3ZDMC 2NBVB 4YL8A 1QZEA 4MDKE 1D3ZA 2MCNB 1WJ4A 3RUIB 1WGHA 1C1YB 2GMIC 4FULA 2MW5A 4MGIE 2IO1B 4RM8A 4MEMA 1C3TA 1KLVA 3AU5A 3VAWA 4WQOB 4FBJB 2N9EB 3B0AA 1Q5WB 3VUXA 4DHJB 1U4AA 3CF6E 2LJ5A 4MSQB 1UBQA 4NJ7A 3ZLZA 3L10B 2IZVB 2KLCA 2MBBB 3ML8A 3U8ZA 5L83A 2IY1B 3IG3A 1LXDA 1ISNA 2D11A 2Z59B 3VQIA 4K7SA 4TQ1A 3JSVB 1V9JA 2NPTA 4HCPB 3VUYA 4GN1A 1L2NA 4W9JA 1I42A 4FJVB 3PGEA 3PHXB 2ZVOA 2ZZPB 1WMHA 2DYMA 4ASWC 2MBOA 3VVWB 4DK5A 2M4NA 4W9LA 4JGHB 4BVUC 4I6LB 2NPTB 1TBEA 2L76A 1V80A 2EMSA 2B3AA 1V86A 2XK5A 3DVGX 1LQBA 2DAFA 2A4ZA 2L8JA 3ZNID 1SIFA 2A5UA 2EMTA 3CSFA 5AZFA 3PREA 4II2B 2BKFA 4XZ4A 2XBBC 2DYBA 2RSUA 4DXAB 3NOBA 3QCAA 2JPHA 3VFKA 4A3PA 4I6PA 1CMXB 2NVUI 2K8BA 1E8ZA 2O6VD 2JRHA 2LXCA 1OQYA 3IBEA 3KUZA 3DVNV 4TKNA 4A3OA 3I3TB 4HXDA 4MGZE 5GMVA 2KK8A 2VRRB 1J0GA 3W1SC 3QWZB 5D2MB 3PRPB 2MRPA 2DZJA 2KWCA 2N7DA 3APDA 5DPTA 5J18A 1IPGA 1Q0WB 5LXHA 2LUEA 2N7EA 3NZUA 4B95A 3IHPC 4II3B 3SHQA 4KIKA 4F1SA 1L7YA 1WFYA 2KWVB 2Z0EB 4WWNA 1GNUA 4NNJB 3UF8A 4E74A 1KOTA 2ZCCA 1WXVA 1E5WA 2C7MB 2AL3A 4BBNF 4P7IA 2J0KA 3HK0A 2KJ6A 4IWQA 2KFJA 5TR5A 4MJSB 2G45B 4LDTD 2FCNA 4IWOA 4MM3A 3UGBB 1MG8A 2LGYA 4E3CA 5CTRC 1UBIA 3A33B 1UGMA 2C60A 4LJOB 1WXMA 3WA0A 3H9DA 1E8YA 4DHZB 1WM3A 3MHSD 3JVZX 5L95C 4NJ6A 3M95A 2KXJA 1GG3A 2V1YA 2ASQA 3EECA 2LGXA 2UYZB 2AEHA 5E6PA 2BWFA 3DOWA 4AJYB 4BKTA 2I1KA 1WY8A 2DZKA 2IO2B 2MWSB 3GOEA 4HJKA 2CHZA 2KLGA 2O2VB 2CHXA 3QX1A 2L0TA 5JHAA 1E90A 3HM3A 4BKSD 2KNBA 3PLVA 2BYEA 3RCZA 2FCSA 3ZTCA 2ZNVC 4W9FA 4HDOA 3M63B 2RR9A 5IA7A 2LGDA 2WX1A 4KSLC 3DVGY 4W9DA 2IO0B 1WJUA 2KTRA 2NCNA 4WJQA 5FR6A 3R7QA 2KDFB 5HKHA 3PRMB 2M8SA 3OJ4B 3WANA 3ZNZB 3H1UA 3V61A 3PLUA 1BT0A 2MA9B 2KTFA 2LRWA 1LFDA 4TUUA 1WXAA 4JIOU 5CX3A 3DVNU 3ZIMA 2KJRA 2KQSA 2O6VA 2LRUA 3APFA 3N3KB 1P9DU 2KJHB 1M94A 2D2QA 2CR5A 4HVBA 3OJ3A 3BINA 1RLFA 4PS7A 3X0WA 1XQQA 3D32A 3OLMD 5JZEB 5CHWA 1WJNA 2G3QB 4WAAA 1WM2A 3PT2B 2JZZA 3QARA 2O6VB 4EZLA 2FIFA 3NS8A 4IM0A 2KANA 3WAOA 2I1JA 4URKA 1S3SG 1YD8U 2L0FA 5DPSA 1OEYJ 5LLIA 2BYFA 3CMMB 3M3JA 4BFRA 3JSVA 4WJNA 3OAWA 3A1QB 3AXCA 4PYUA 4OVUA 1WF9A 2FAZA 4IC7B 2MSED 3LJ3A 1KJTA 4IM3A 2L7RA 2LVQA 4M8NA 4F8CB 1RFAA 2RPQA 1V6EA 3QQ8B 4OVVA 2KD0A 3RYTA 2QHOA 4LCDE 1WE6A 4NAWB 4IG7B 5C23A 1WIAA 2Z0DB 2DENB 5D94A 3RD2A 2MQJA 1KM7A 4ZDVA 4DHZE 4GB9A 2DAJA 3U30A 3UIPB 1V49A 2CS4A 4BBNC 2L00B 3NZSA 4DBGA 4TV3A 4B6WA 5EDSA 3A4RA 1K8RB 4NQLB 1RAXA 2C5LC 2C9WB 1TTNA 4FJZA 4W9IA 2N4FA 4X57B 2CHWA 3TIXA 5JHBA 5IAAC 4AWJA 4JLCA 2V4LA 4CO7A 1WR6E 3W1YA 2L05A 2WX0A 2JVCA 2W9NA 4DDGD 4BKGA 1WR1A 1IP9A 2KFKB 3ONSA 3V62A 2G4SA 1OTRB 2DZIA 3BY4B 3R66C 3DPDA 1A5RA 1G6JA 2K25A 2ZPYA 2HTHA 1SE9A 4EOYA 1OEYA 1EO6A 2XEWA 3L17A 2KVRA 3A9KB 3L13A 1ZGUB 2KDIA 1XT9B 2JZ3B 5E6NA 4MGYE 4A20A 3GZNI 2N9PC 2DYOA 3DDCB 4IUMB 1GUAB 4G11A 3UIOB 4AP4C 2GOWA 3R3MA 2BKRB 3ZRCA 1NDDA 3L54A 2JWZA 4ANWA 2J0MA 3EC8A 2BGFA 3KH0A 3HM6X 3ZO5B 3IFWB 1J8CA 1T0YA 4FN2A 4KVGB 3EFUA 4ANXA 4MJSA 4MELA 4GIVA 2C7NB 4PS3A 2GBRA 2JXXA 2BWES 3RZFA 3L0WB 2KMCA 3UQBA 1V5TA 2MBHA 3PV1A 1UD7A 3T8MA 4GDLB 4MGKE 1WI0A 1P98A 2LZ6A 3L08A 3H6NA 4KZCA 3HHMA 3RT3B 2D10A 3TL5A 3VHTC 4KDLB 1WZ0A 3QC8B 4JL9A 1E7VA 1JRUA 2LI5A 1WGRA 3WALA 3LDZE 3Q3FA 4NY0A 4TQ0A 5DPRA 1Z5SB 4KV2A 2BF8B 5J2RA 2O2VA 1YQBA 2LXAA 2KX0A 1H4RA 2CU1A 4FJYA 2GBKA 3PPAA 3ZUNA 2JT4B 2IY0B 2FCQA 3ECIA 1OGWA 2Y5BB 2AL6A 2PE9A 1GJZA 1P1AA 4BOSC 4GDKA 2KOXA 5CHVC 4IW0A 2KHWB 2R2QA 4XC2A 5KHOA 2G4DB 4NQKE 4KDIC 4K7WA 2REXA 3A9JB 2NR2A 1WX8A 4EFOA 2MBQA 2R2OA 1RRBA 3IVFA 3O65B 2NBWB 1S1QB 2M0XA 3PVLA 2OJRA 4GDKB 2M17A 2ZEQA 1HE8A 2HE7A 5J17A 4KZ0A 3U7DA 4DWFA 4WJOA 3X23A 1TZ1A 5DPWA 4HWIB 1AARA 1X1MA 2AWTA 2D3GA 2KX3A 2N1VA 4HPMB 2UWQA 4W9KA 1EF1A 2FNJB 4PYZA 2KN5A 1WGDA 4ANVA 1WRDB 2DZMA 4GSWA 3EHVA 3ML9A 2L3ZA 2J7QB 4HPLB 3MTNB 1I35A 4GGQA 3P2BA 4G3XB 3ZW3A 2M1MA 3VDZA 3A9JA 3A1QA 1WXSA 1Z2MA 1Y8RC 1P3QU 1ZKHA 2KQ7A 2KZRA 3KYCD 4W9GA 1R4NI 1WX9A 3ZKJC 5G2NA 2FIDA 4RM9A 2WYQA 1WZ3A 2PJHA 5DCNA 1WGYA 4NAWA 1E8WA 4GU2A 2N1WA
chains in the Genus database with same CATH superfamily
1N63A 2JYTA 2JYEA 1ZXHA 3AU4A 3VH3B 3C0RB 4CHKA 3ALBA 1YIWA 3H8HA 4WIPA 1QOBA 2MP2A 2W55A 2WLBA 2J4XA 4ZRKA 1I4QA 4ICVA 4ZYSA 1V5OA 4ICUA 2DNFA 3UINB 3K9OB 2WXGA 1CJEA 3PRZA 3ETRA 3ZDTA 3DQVA 2K8CA 5EE3A 2WXMA 3H7PB 5FK9C 4RGTA 4JWUC 1SGHA 5T8IA 3AI5A 4YTPB 4W9EA 3AEGB 5AZGA 5HI1A 1V1OA 2N9XA 1HTQA 4DDID 1WXQA 2MLBA 2V9HA 1VCBA 3B1LX 1MVKA 2GBNA 2LVPA 2BT6A 4MH0E 1E8XA 5H92C 2IGDA 2W3SA 2EKEC 4ZYNA 1ZXIA 2IO3B 3A4SC 2KC2A 5D7GA 1PGAA 3DCGA 3Q8AA 1JROA 2M19A 1QOGA 2WXKA 2WDQB 4HDQA 1SIJA 2WWZA 2NTSA 3DBLB 1VZ6A 4KIKB 1GC6A 3RN9C 2JU6X 2AX5A 2JRIB 3V60A 4KSKC 1TKYA 3NG0A 2E6XA 3TCAA 1SE2A 2JY6A 2G9HD 2GBMA 2JUOA 3PSEB 1T3QA 2RDGA 4OW0A 3W5UB 1N61A 4BOZB 4OZAA 4FHKA 1P7FA 4W9HA 2PEAA 4ARCA 1JQ4A 2ZVNA 3SR6A 3NVZA 3TUOA 1VDVA 1FFUA 1UWXA 3BWUD 3WIMA 4I6NB 2KC1A 3ZDMC 1T5XD 1C4CA 2NBVB 1QZEA 2MCNB 4ITKA 2GMIC 1FRRA 4LNFA 4MEMA 4FBJB 3EUB2 1RFKA 3V05A 3B0AA 4DHJB 1U4AA 2JXTA 4MSQB 3L10B 2IZVB 2KLCA 3RI7C 3U52E 1LXDA 1MJDA 1ISNA 3ZJVA 2QEJC 1C4PA 3ZQ4A 4GN1A 5D3DA 1I42A 2IGHA 3TEXA 3EFCA 2K9XA 4W9LA 2NPTB 3IXSA 4YSYB 1IGDA 2L76A 2SEBD 2B3AA 1D5XC 2UU7A 2XK5A 1MHXA 3CIRB 3DVGX 1LQBA 1N60A 1FCLA 3CSFA 2N9KA 3NOBA 3VFKA 2JPHA 1PGXA 2BS4B 2R61A 3VRAB 4HXDA 5GMVA 1FCCC 1J0GA 2VH1A 3W2DA 2DZJA 5J18A 1IPGA 1Q0WB 3VR8B 2N7EA 3AEBB 3IHPC 2WXPA 2Y5CA 2JSVX 4WWMA 1WFYA 2Z0EB 2MJEA 3I5JC 2ZCCA 2KFJA 2D3AA 3PZ7A 2FCNA 4IWOA 1PFDA 4YWGG 4MM3A 1MG8A 2LGYA 1UBIA 3A33B 5AUIA 4LJOB 1WXMA 4RH6A 4DHZB 1E8YA 3ZJTA 1WM3A 3MHSD 2V1YA 1NI3A 2UYZB 1JCKB 1ROEA 2WXJA 4AQ7A 2BWFA 1I7HA 2I1KA 2DZKA 4HJKA 2KLGA 1T0QC 2D5GA 3AEDB 4BKSD 2BYEA 3Q3NC 2ZNVC 1QF6A 2M0AA 3M63B 3DVGY 4WJQA 1WJUA 5FR6A 1V97A 4ZHPA 5HKHA 3PRMB 3OJ4B 3ZNZB 3H1UA 1GOZA 1LFDA 5CX3A 2O6VA 2CR5A 1RLFA 1HZ5A 1FXIA 1T0SC 2I2YA 2WQYB 4P16A 1D5ZC 3PT2B 4YSXB 4OVZA 3WAOA 4URKA 1YD8U 2L0FA 2INCC 4BFRA 4WJNA 5FKAC 4PYUA 4IC7B 1YOVB 3LJ3A 2LVQA 1RFAA 1KLGD 4OVVA 3RYTA 3C8YA 4NAWB 2INDC 2Z0DB 5D94A 4US9A 5GXGB 2DAJA 4BBNC 2KAJA 2L00B 4H2AA 4B6WA 1K8RB 4NQLB 4FJZA 4W9IA 2N4FA 3KWLA 3RNBC 1NVID 2GB1A 4HKZE 2NTTA 1C79A 2WX0A 1IP9A 1Y56A 3RPFC 3AN1A 4KKJA 3V62A 2DZIA 3AE7B 2ZPYA 2HTHA 4EOYA 1EO6A 1ZGUB 1KLUD 1STEA 3UIOB 3V3XA 3R3MA 3ZRCA 1EWCA 3HM6X 3ZO5B 3IFWB 4XDCA 1J8CA 4ANXA 3EFUA 1WWTA 2N9LA 1XLPA 4GIVA 3L0WB 4JPSA 1V5TA 3TEYA 4ARIA 3T8MA 1SE4A 2V3PA 3L08A 3H6NA 4KZCA 5EE0A 2D10A 3TL5A 3VHTC 1JRUA 4TQ0A 5DPRA 3DHHC 5H8YE 2LXAA 3EGRA 3P4SB 2CU1A 1T0RC 3ECIA 2AL6A 4DXGA 2PE9A 1GJZA 4BOSC 4GDKA 2KHWB 4HROA 3ZYYX 2REXA 1ZP0B 2M0XA 2L83A 1I4PA 1ET9A 4DWFA 4WJOA 3X23A 4HWIB 4IDIA 2D3GA 2UWQA 4M01A 4W9KA 2QC8A 2KN5A 1R4NB 4REZA 2L3ZA 3ZGZA 3OWEB 2QDFA 1C76A 2X38A 4GGQA 4HEA1 3VDZA 1P3QU 3B2GA 5G2NA 2FIDA 1WZ3A 4C7ZA 3A9JB 3VUWA 2YLMA 4NPNA 1TGZB 4W9CA 2NS5A 5C1ZA 4Q2JA 5JXVA 2KMAA 3ENEA 4K7UA 1NBFC 3RZWC 1OQRA 2D07B 1AYFA 1HA5A 2KFKA 5JH5C 3DBHI 3K9PB 4YXDB 2MX2A 2GLSA 4HK2A 3BIID 3QK0A 1WJ6A 4CYEA 3C19A 2INPE 3MC8A 1SBBB 2HJ1A 2JF5A 1DYQA 2ZCBA 2WXFA 3MJWA 1KH0A 2HD5B 3JYUA 3B2FA 3ZVVA 1YX6B 3P4QB 2ONQA 4ZOHC 4GXBA 1OQQA 2BYTA 2KWUB 3AE5B 3RNEC 5BMHA 2X8XX 2IPKD 4GDLA 3Q3OC 2KMMA 4EUTA 3AULA 4N58A 2YVCA 2XK5B 3KQ4A 1QOAA 4HKQA 4WJPA 2LASA 2K6DB 1E9MA 2LVOA 1XD3B 1EF5A 4GMVA 3N32A 2WXLA 3AH7A 1HQRD 4DHJD 3R7RA 3UQAA 4N9F4 1YJ1A 4K1RB 1H8CA 4K81A 3NUHB 1YJJA 3B08A 3APCA 1OFFA 2K22A 2V3SA 3N30A 4J6IA 1PQSA 4L1BA 1J19A 4AJWA 4MM3B 2ON8A 4ZRIA 4O1NA 2PTLA 3U4EG 2PW9A 4MT5A 2KACA 2J0JA 4B9KA 3PHWB 3O13A 1I4HA 2MBEA 3QIJA 5LXIB 1SSNA 4A90A 3QAQA 3DWMA 1ZW7A 1V81A 4N6EB 3E9SA 2PVGC 4EEWA 1YN3A 3AE8B 1AN8A 1QILA 3VR9B 5FR3A 3B9JA 1D3ZA 2W54A 3LB8C 1WGHA 4FULA 4ZRQA 4RM8A 1KLVA 3AU5A 3VAWA 4C4VA 2B76B 1Q5WB 3VUXA 1ZDVA 2KVZA 2XN9C 4NJ7A 3NVVA 3ML8A 4QAYA 4M0WA 3U8ZA 1VZ8A 2IY1B 2Z59B 3EA6A 2JWUA 1L6UA 3VUYA 4W9JA 3PHXB 2CU3A 2ZVOA 1WMHA 1WRIA 4TSSA 3VVWB 4UDUC 2M4NA 4JGHB 1TT5B 1TS5A 1UGJA 2EMSA 4DQOC 2A4ZA 3GE3C 3ZNID 1SIFA 2EMTA 4KX6B 3AECB 3PREA 2XBBC 2WXIA 2BB5A 1D6EC 4A3PA 2NVUI 1E8ZA 3DVNV 2KK8A 2VRRB 1NENB 1FM0D 2N7DA 5DPTA 5LXHA 1VZ7A 3LYYA 4HJGE 2OJWA 3NZUA 4B95A 3AE4B 1MI0A 2KWVB 3E56A 3UF8A 4E74A 1KOTA 2W3RA 3AV8A 4WAFA 2AL3A 2J0KA 3HK0A 1HXYD 3N1YC 4IWQA 5TR5A 3BYYB 4RF1A 2C60A 2RPVA 2D3BA 4JWSC 2AEHA 3P63A 5E6PA 4AJYB 1IBXB 4YTMB 1EM7A 1KFYB 2CHXA 5JHAA 1E90A 3PLVA 3RCZA 3ZTCA 4HDOA 2RR9A 4KSLC 2IO0B 2WXQA 2NCNA 3P42A 1WXAA 4JIOU 5LNK1 1P9DU 5IO9A 1GB1A 3U2SC 4PS7A 3X0WA 3D32A 3OLMD 1LO5D 3GB1A 4WAAA 4WQMA 3P4PB 4EZLA 2FIFA 2H88B 2QMTA 2MJ3A 3P1MA 1B9RA 5DPSA 1V8CA 5LLIA 3Q8BA 3CMMB 4EE2A 1DOXA 4RNAA 4S17A 3ABVB 2MSED 1KJTA 2JZPA 1WYGA 4IM3A 2L7RA 1C77A 2EELA 2KD0A 2QHOA 4KGRA 4P6VF 3RD2A 1I4RA 4ZDVA 4DHZE 2N7JA 1V49A 1IUEA 1TKGA 2CS4A 2N0SB 3NZSA 5EDSA 1RAXA 3TIXA 3N20C 4JLCA 2IJ0A 3W1YA 4DDGD 2L05A 2QSDA 1WR1A 1QOFA 3Q8EA 2KFKB 2LEKA 3RNCC 1FMAD 3R66C 3BY4B 1G6JA 2K25A 1OEYA 3DWGC 2KVRA 4RCOA 5TSSA 3URYA 2JZ3B 5E6NA 5C3JB 1VR9A 3GZNI 2N9PC 3DDCB 2YEPB 4P1CC 2BKRB 3L54A 2JWZA 2PMVA 2J0MA 5HG2A 1KRHA 1T0YA 3TEWA 2GBRA 2BWES 1NYQA 2J53A 2SAKA 4L23A 1CQVA 1UD7A 4GDLB 1WI0A 2D3CA 3HHMA 1FFVA 2L52A 2LMCA 1FNWA 2LI5A 1WGRA 3WALA 5G5HA 4L2YA 1WSPA 4NY0A 1Z5SB 4LLGM 1MFWA 2O2VA 4FJYA 1H4RA 3ZUNA 4ACFA 2GBKA 3I57A 3PPAA 2IY0B 2FCQA 1QQRA 2WXNA 5CHVC 1RYJA 1CZPA 1M4VA 2R2QA 5KHOA 2G4DB 1XLQA 2WU5B 4K7WA 2NR2A 2LHDA 3MC0B 3PVLA 1HE8A 2GRIA 1FXAA 2WDVB 5J17A 3U7DA 4A8XC 4HPPA 1TZ1A 2WNMA 1AARA 2KX3A 2N1VA 4HPMB 1EF1A 4PYZA 4ANVA 3ML9A 4HPLB 5BYSA 4B0MA 3MTNB 1K51A 2FBWB 4G3XB 3ZW3A 2GI9A 1WXSA 1C9FA 3MP9A 1E10A 4YTNB 2MH7A 1ZKHA 1JMLA 3KYCD 4W9GA 1BUIC 1WX9A 3ZKJC 1WGYA 4WURA 2VZKB 5CHFA 2VH2A 2RGFA 5E6OA 1TYGB 3HIZA 4NAMA 5AEKB 4B0EA 2BB6A 3VH4B 2OEDA 3T3NA 4E71A 3H7PA 2V0GA 2RDHA 1Q1OA 2MEKA 1WH3A 2ZJDA 5IP4D 4EKUA 1P7EA 4PS8A 3BK1A 2HJ8A 4AOFA 1JWAD 5I4DA 2MP2B 2BYVE 1PDXA 1L0VB 3H7SA 1UH6A 4C4VB 1IYFA 1EUVB 4LJPB 3GP7A 3QA8A 3S2AA 1B1ZA 3DHIC 4M0WB 2RMMA 1FO4A 4FHJA 4OHJA 3CWIA 4LNKA 4R3DA 3KUCB 1WMHB 2K39A 3VTUA 4BAXA 4GOCA 3NZ3A 3KYDD 2H89B 3HVZA 4FXCA 4M8MA 3FC4A 1L6VA 5D6JB 3DBSA 1P0RA 4JQWC 1WYWB 3QJZA 2IYDB 1ESFA 3WAMA 4WWPA 4LNIA 4AUQC 4FADA 1D4BA 4ZRJA 3AMZA 4KKIA 1F2RC 5IN7A 5EE1A 1QLBB 3KVFB 4D2KA 3M62B 1N6ZA 4FA6A 2GBJA 1SJED 1TKEA 4XYCA 3HUIA 2FUHB 1F77A 1MG4A 4F7ZA 2KDBA 1V1PA 2QJLA 1NI2A 4US8A 4WWOA 3ZNGC 3BVZA 2LWPA 3Q2AC 2KDEB 3NHEB 1DOIA 2CKHB 2NBUA 2DWQA 1UELA 2DX5B 2IBIB 3VXWA 3DBLI 4LTUA 1UWMA 3ZTDA 3ZRFA 1EU3A 2K6QA 2HDEA 1ZDXA 4G50A 4K3CA 4EZKA 2ZNVB 2RD0A 2C7HA 1HEZE 1YN5A 3RUIB 1C1YB 2AQ2B 1JWSD 2W82A 4MGIE 4WQOB 2L1AA 2N9EB 2V4IB 3IAS1 2AQ1B 3CF6E 1MHHE 1UBQA 3I63C 3ZLZA 1RM6C 2MBBB 3MHZA 5HFYA 1ET6A 5L83A 2D11A 3VQIA 4TQ1A 4A9AA 1V9JA 2NPTA 4HCPB 3NJTA 1L2NA 5BYQA 4FJVB 2MBOA 2J42A 1HZ6A 4WH4A 4RF0A 4BVUC 4C00A 1V80A 3GZNB 1YJIA 2L8JA 2A5UA 1UF0A 5AZFA 2BKFA 4XZ4A 4DXAB 2BBCA 4I6PA 1CMXB 2E3TA 3IBEA 4TKNA 2LXCA 3SFEB 4MGZE 2KN4A 5MPOA 3QWZB 5D2MB 2MRPA 3APDA 2DBYA 2LUEA 2WU2B 4DXFA 4II3B 1E6EB 2LUMA 4F1SA 1L7YA 4WWNA 1GNUA 2C7MB 1SB3C 3MC9A 3NS1A 4YSZB 2KJ6A 4LDTD 5CTRC 1UGMA 3MFGA 4XE0A 2LHEA 3HVDA 4NJ6A 3M95A 2KXJA 3FAHA 1GG3A 2G1EA 1TY2A 3EECA 3DOWA 4KGTA 1WY8A 1TZOA 3GOEA 2CHZA 1JRPA 1NEKB 2O2VB 1FD6A 3Q14C 2L0TA 2WXRA 1PYWD 3HM3A 2PVOD 5IA7A 2M56B 4W9DA 4PK1A 2KTRA 3R7QA 1FNUA 2KDFB 3WANA 3PLUA 2MA9B 4IKGA 2PIAA 3DVNU 1BXTA 3AE1B 3KWVA 3APFA 1XF5L 3Q6BA 2KJHB 1L0YB 1M94A 2D2QA 3L4PA 2LGIA 2IGGA 5AUKA 3BYTB 5C2TB 1L5PA 5JZEB 1XCTL 1YNTE 3QARA 2O6VB 2KANA 2I1JA 1S3SG 2LJIA 2BYFA 3M3JA 3JSVA 2PLPA 4XWTA 3AXCA 2J52A 4OVUA 3BZDB 4M8NA 1JALA 2RPQA 2WHIA 2WXHA 5C23A 1WIAA 2MQJA 1XO3A 4JX1C 4TV3A 3A4RA 2C5LC 4X57B 2C9WB 1TTNA 5JHBA 1A5RA 2FUG1 4MH8A 1WGKA 5E6JA 2V4LA 4C7YA 2LFIA 2JVCA 2W9NA 4BKGA 2BW2A 3AEFB 3DPDA 1PGBA 1D5MC 3L13A 4A6QA 1XT9B 1I4XA 2DYOA 4IUMB 4G11A 4P1BC 3SFDB 3EC8A 3VRBB 3KH0A 2VZKD 4FN2A 4KVGB 4MJSA 4ZRPA 4MELA 2JXXA 3RZFA 4LK0M 1MPEA 1YQ4B 3UQBA 2MBHA 3BVGA 3RT3B 1TIFA 1ZOYB 4JL9A 1E7VA 2DLBA 4AS1A 3LDZE 2BQQA 4KV2A 2BF8B 5J2RA 2YEPF 1YQBA 2KX0A 1UUPA 1OGWA 3LXFA 3FKYA 1P1AA 2KOXA 1RWSA 4NQKE 4XDDA 3BVMA 1WX8A 4EFOA 2R2OA 1RRBA 3IVFA 3O65B 3W9CB 1S1QB 4GDKB 2ZEQA 2HE7A 1V1PB 3AE6B 1X1MA 2AWTA 1XEEA 3KLSX 2BVCA 4NZLB 5BMGA 1WRDB 3FILA 2KYWA 1I35A 3P2BA 2M1MA 3A9JA 2BTEA 3A1QA 1L4ZB 1Y8RC 1XLNA 3PO0A 2KZRA 1R4NI 1DOYA 2K0PA 1ZPSA 4RM9A 4OZCA 1T6BX 1K50A 3I9V1 3Q3MC 5DCNA 4GU2A 2N1WA 4IWPA 3IT4B 1R7SA 1TS3A 3DBHB 3AE9B 1R4MI 2K8HA 1HTOA 1VRAB 3IAM1 1FNVA 3N1XC 2CJNA 3VTWA 4LDTB 3DHGC 1N62A 1WX7A 1LM8B 1YMHE 2BS3B 2Z8LA 3Q3JA 3AEAB 1XCQL 2BS2B 3PS6A 1TS2A 2L32A 3DBRI 3A9KA 2DHZA 4BKSA 3QHTA 3TSSA 4HCNB 5KHQA 3L16A 2PE6B 3KW5B 4A55A 1VD2A 2KO3A 2WDTB 4XX5A 4GLSC 1YQ3B 3BK2A 3GE8C 4LNNA 2WP9B 2ZPNA 3T9LA 3JW0X 5AZHA 4HRSA 2K1FA 3WAPA 3V6CB 4NJCA 3CSTA 3SU8X 3HRDD 3TJPA 3KUDB 3PTFC 2OOBB 2CJOA 2BPSA 2ICIA 3SD5A 1KF6B 1EU4A 5D3IB 4HLEA 2AYOB 1F9JA 1FPYA 1TY0A 3PZDA 1EWYC 1SXTA 5G55A 1C4AA 1E7UA 1F52A 3W1SA 1E7PB 4FLHA 5EE9A 4G0NB 2Y3AA 4YT0B 1V2YA 1AWDA 2LD9A 1TS4A 5BO4B 2TSSA 2I38A 1I4GA 4C56C 2LGSA 3VTVA 2FCMA 1KTKA 4RGOS 1GAQB 3SEBA 1F0ZA 4EZJA 3T3OA 1F2RI 1LGRA 2KKCA 2PPHA 4JE3B 3TMPB 3RULA 1JWMD 3ZNHB 1L0XB 5BMIA 1FXTB 3PZ8A 3SDLC 1ZE3D 4M00A 4ANUA 1WGGA 1Q10A 2WGSA 4MSMB 4RMAA 2QILA 1WE7A 3TBLD 3V6EB 2Q5WD 1VJKA 1UZXB 1YX5B 1GC7A 1J7BA 4IOIE 4RGNA 3NY5A 4IM2A 2KTRB 2RDBC 4YL8A 4MDKE 1WJ4A 2MW5A 3AM9A 1UNSA 2IO1B 1JWBD 1GPXA 1C3TA 2IDYA 1QT9A 5G5GA 1DGJA 3RMKC 1N5XA 2LJ5A 1E0ZA 3RNGC 4RFBA 3IG3A 1ACCA 4K7SA 3JSVB 3PGEA 3OG5A 2ZZPB 2DYMA 4ASWC 4DK5A 1NYRA 4LNOA 1J7AA 4I6LB 3IT6B 1TBEA 1V86A 2DAFA 1SJHD 5BYRA 3P4RB 1SEBD 4J3OD 1ZUD2 4II2B 4USAA 2DYBA 2RSUA 3QCAA 1FRDA 2K8BA 2O6VD 2JRHA 4A3OA 1OQYA 3KUZA 3U7ZA 3I3TB 4C80A 2KDMA 3W1SC 3PRPB 2KWCA 2QIEB 1JWUD 3SHQA 4KIKA 4CQNA 2V3NA 4NNJB 2MJDA 1F1HA 1WXVA 1E5WA 4BBNF 4P7IA 4S0RA 4XWWA 4MJSB 2G45B 4RGMA 2QCZA 4XGAB 3AB5A 3UGBB 2XNAC 4E3CA 1IBXA 3WA0A 1N5WA 3H9DA 2AQ3B 3ZJUA 5L95C 3JVZX 3N9YC 3RNAC 3UI3A 2ASQA 3AEEB 2LGXA 1IGCA 3N1ZC 4BKTA 2IO2B 2MWSB 2ZW1A 3QX1A 3NVYA 2KNBA 2FCSA 1XLOA 4K3BA 1C78A 4W9FA 1BMLC 2LGDA 2WX1A 3R2TA 2M8SA 3V61A 1L4DB 1BT0A 2KTFA 2LRWA 4TUUA 1QKZA 4BZAA 3ZIMA 2KJRA 2KQSA 2LRUA 3R2IA 5HHDG 5IKCM 3N3KB 3ZXRA 4HVBA 3OJ3A 2KT7A 3BINA 1XQQA 2NMQA 2JQRB 5CHWA 1WJNA 2G3QB 1R4MB 1WM2A 2JZZA 1SF0A 3FILB 2PKOA 3NS8A 4IM0A 1OEYJ 3GS2A 3OAWA 3A1QB 5IOIA 1WF9A 2FAZA 4F8CB 3TEZA 1V6EA 3QQ8B 3ZXVA 3DBRB 4MACA 1FIQA 4LCDE 1WE6A 4IG7B 2K5PA 1ENFA 2DENB 1KM7A 4GB9A 3U30A 3UIPB 4KGSA 1AW7A 4PT5A 4DBGA 2WXOA 1K53A 4N59A 2CHWA 5IAAC 4AWJA 4CO7A 3W5VB 1WR6E 3WCQA 2ZW0A 3ONSA 2G4SA 1OTRB 1A70A 1SE9A 1CK1A 2XEWA 3L17A 3A9KB 2WS3B 2KDIA 4MGYE 3J9CA 4A20A 1GUAB 4AP4C 2GOWA 1SE3A 1NDDA 1PUTA 3Q69A 4ANWA 2BGFA 4ZHOA 1JW9D 2Y5PA 2KQ4X 2C7NB 4PS3A 2MHJA 2KMCA 3PV1A 4MGKE 1P98A 2LZ6A 3MJ5A 2K3UA 4KDLB 1WZ0A 2INNE 3QC8B 3NRZA 2ACZB 3Q3FA 1FEHA 1GB4A 3RFZB 2JT4B 1TJEA 4OZBA 2Y5BB 3R8BA 2WDRB 4IW0A 4XC2A 1XXGA 4KDIC 2EKIA 2JX5A 2MBQA 2NBWB 2OHFA 2OJRA 2M17A 3NVWA 4KZ0A 1VLBA 5DPWA 3AE2B 4TMAB 2FNJB 3Q8FA 1WGDA 2DZMA 4GSWA 3EHVA 2J7QB 1J7CA 3Q8CA 4M02A 1K52A 1Z2MA 3RNFC 3AE3B 2KQ7A 1YN4A 2HTME 2FE8A 2WYQA 2PJHA 2KWDA 4NAWA 1E8WA
chains in the Genus database with same CATH topology
3VUWA 5CHFA 2YLMA 4IWPA 4NPNA 2RGFA 1TGZB 4W9CA 5E6OA 2NS5A 1R4MI 3AU4A 3HIZA 2K8HA 3VH3B 5AEKB 5C1ZA 3C0RB 4CHKA 2KMAA 3ALBA 3ENEA 1YIWA 3VH4B 4E71A 4K7UA 3H7PA 1NBFC 3VTWA 3RZWC 2MP2A 2D07B 4LDTB 4ZRKA 4ICVA 1Q1OA 1WX7A 1LM8B 1V5OA 4ICUA 1WH3A 2KFKA 2ZJDA 3UINB 3K9OB 5JH5C 4EKUA 3DBHI 3PRZA 3ZDTA 3DQVA 3Q3JA 2K8CA 3K9PB 4PS8A 2HJ8A 3H7PB 3PS6A 4AOFA 2MX2A 3DBRI 4HK2A 2MP2B 3A9KA 2BYVE 3QK0A 1WJ6A 4CYEA 2DHZA 4BKSA 3H7SA 1UH6A 2JF5A 1IYFA 1SGHA 1EUVB 3AI5A 2ZCBA 3QHTA 4LJPB 4W9EA 3QA8A 4HCNB 5KHQA 5AZGA 3L16A 2PE6B 3KW5B 3MJWA 3S2AA 1VD2A 2KO3A 2HD5B 2N9XA 2WDTB 3JYUA 4M0WB 4XX5A 3ZVVA 4DDID 1YX6B 4FHJA 2MLBA 2ZPNA 3T9LA 3JW0X 4GXBA 5AZHA 2K1FA 3WAPA 3KUCB 3V6CB 1WMHB 2KWUB 1VCBA 2K39A 3B1LX 3VTUA 4GDLA 3CSTA 4GOCA 3SU8X 3KYDD 4M8MA 2GBNA 3TJPA 4EUTA 5D6JB 3DBSA 3KUDB 1P0RA 3PTFC 2OOBB 3AULA 2LVPA 4JQWC 1WYWB 2BPSA 2YVCA 3QJZA 2XK5B 1E8XA 2IYDB 4MH0E 3SD5A 3WAMA 4WWPA 4AUQC 4HLEA 2AYOB 4FADA 2EKEC 1F9JA 4WJPA 4ZRJA 4ZYNA 3PZDA 2LASA 2K6DB 5G55A 2LVOA 1XD3B 1E7UA 2IO3B 1EF5A 4GMVA 3W1SA 3A4SC 3KVFB 3N32A 4FLHA 3M62B 4G0NB 4DHJD 2KC2A 1V2YA 3R7RA 3UQAA 2LD9A 5D7GA 4FA6A 2GBJA 3DCGA 4N9F4 5BO4B 2FUHB 1YJ1A 4K1RB 4F7ZA 2KDBA 4HDQA 1H8CA 4K81A 3VTVA 2WWZA 2FCMA 3B08A 3APCA 4KIKB 1NI2A 1GC6A 4EZJA 4WWOA 3ZNGC 2V3SA 3N30A 4J6IA 1PQSA 2PPHA 1J19A 2JRIB 2KKCA 2LWPA 2KDEB 3TMPB 3NHEB 3RULA 4AJWA 3V60A 4KSKC 2CKHB 2NBUA 3ZNHB 4ZRIA 1UELA 2DX5B 2IBIB 3TCAA 3VXWA 3DBLI 2JY6A 2GBMA 1FXTB 3SDLC 2J0JA 2JUOA 3PSEB 4B9KA 3PHWB 4ANUA 1WGGA 4MSMB 2MBEA 3QIJA 5LXIB 4BOZB 4FHKA 4RMAA 3QAQA 4W9HA 3ZTDA 1WE7A 2PEAA 3ZRFA 3TBLD 1ZW7A 2K6QA 1V81A 3V6EB 2ZVNA 4G50A 1UZXB 1YX5B 4EEWA 1GC7A 4EZKA 2ZNVB 2RD0A 3NY5A 3WIMA 4IM2A 4I6NB 2KC1A 2KTRB 2C7HA 3ZDMC 2NBVB 4YL8A 1QZEA 4MDKE 1D3ZA 2MCNB 1WJ4A 3RUIB 1WGHA 1C1YB 2GMIC 4FULA 2MW5A 4MGIE 2IO1B 4RM8A 4MEMA 1C3TA 1KLVA 3AU5A 3VAWA 4WQOB 4FBJB 2N9EB 3B0AA 1Q5WB 3VUXA 4DHJB 1U4AA 3CF6E 2LJ5A 4MSQB 1UBQA 4NJ7A 3ZLZA 3L10B 2IZVB 2KLCA 2MBBB 3ML8A 3U8ZA 5L83A 2IY1B 3IG3A 1LXDA 1ISNA 2D11A 2Z59B 3VQIA 4K7SA 4TQ1A 3JSVB 1V9JA 2NPTA 4HCPB 3VUYA 4GN1A 1L2NA 4W9JA 1I42A 4FJVB 3PGEA 3PHXB 2ZVOA 2ZZPB 1WMHA 2DYMA 4ASWC 2MBOA 3VVWB 4DK5A 2M4NA 4W9LA 4JGHB 4BVUC 4I6LB 2NPTB 1TBEA 2L76A 1V80A 2EMSA 2B3AA 1V86A 2XK5A 3DVGX 1LQBA 2DAFA 2A4ZA 2L8JA 3ZNID 1SIFA 2A5UA 2EMTA 3CSFA 5AZFA 3PREA 4II2B 2BKFA 4XZ4A 2XBBC 2DYBA 2RSUA 4DXAB 3NOBA 3QCAA 2JPHA 3VFKA 4A3PA 4I6PA 1CMXB 2NVUI 2K8BA 1E8ZA 2O6VD 2JRHA 2LXCA 1OQYA 3IBEA 3KUZA 3DVNV 4TKNA 4A3OA 3I3TB 4HXDA 4MGZE 5GMVA 2KK8A 2VRRB 1J0GA 3W1SC 3QWZB 5D2MB 3PRPB 2MRPA 2DZJA 2KWCA 2N7DA 3APDA 5DPTA 5J18A 1IPGA 1Q0WB 5LXHA 2LUEA 2N7EA 3NZUA 4B95A 3IHPC 4II3B 3SHQA 4KIKA 4F1SA 1L7YA 1WFYA 2KWVB 2Z0EB 4WWNA 1GNUA 4NNJB 3UF8A 4E74A 1KOTA 2ZCCA 1WXVA 1E5WA 2C7MB 2AL3A 4BBNF 4P7IA 2J0KA 3HK0A 2KJ6A 4IWQA 2KFJA 5TR5A 4MJSB 2G45B 4LDTD 2FCNA 4IWOA 4MM3A 3UGBB 1MG8A 2LGYA 4E3CA 5CTRC 1UBIA 3A33B 1UGMA 2C60A 4LJOB 1WXMA 3WA0A 3H9DA 1E8YA 4DHZB 1WM3A 3MHSD 3JVZX 5L95C 4NJ6A 3M95A 2KXJA 1GG3A 2V1YA 2ASQA 3EECA 2LGXA 2UYZB 2AEHA 5E6PA 2BWFA 3DOWA 4AJYB 4BKTA 2I1KA 1WY8A 2DZKA 2IO2B 2MWSB 3GOEA 4HJKA 2CHZA 2KLGA 2O2VB 2CHXA 3QX1A 2L0TA 5JHAA 1E90A 3HM3A 4BKSD 2KNBA 3PLVA 2BYEA 3RCZA 2FCSA 3ZTCA 2ZNVC 4W9FA 4HDOA 3M63B 2RR9A 5IA7A 2LGDA 2WX1A 4KSLC 3DVGY 4W9DA 2IO0B 1WJUA 2KTRA 2NCNA 4WJQA 5FR6A 3R7QA 2KDFB 5HKHA 3PRMB 2M8SA 3OJ4B 3WANA 3ZNZB 3H1UA 3V61A 3PLUA 1BT0A 2MA9B 2KTFA 2LRWA 1LFDA 4TUUA 1WXAA 4JIOU 5CX3A 3DVNU 3ZIMA 2KJRA 2KQSA 2O6VA 2LRUA 3APFA 3N3KB 1P9DU 2KJHB 1M94A 2D2QA 2CR5A 4HVBA 3OJ3A 3BINA 1RLFA 4PS7A 3X0WA 1XQQA 3D32A 3OLMD 5JZEB 5CHWA 1WJNA 2G3QB 4WAAA 1WM2A 3PT2B 2JZZA 3QARA 2O6VB 4EZLA 2FIFA 3NS8A 4IM0A 2KANA 3WAOA 2I1JA 4URKA 1S3SG 1YD8U 2L0FA 5DPSA 1OEYJ 5LLIA 2BYFA 3CMMB 3M3JA 4BFRA 3JSVA 4WJNA 3OAWA 3A1QB 3AXCA 4PYUA 4OVUA 1WF9A 2FAZA 4IC7B 2MSED 3LJ3A 1KJTA 4IM3A 2L7RA 2LVQA 4M8NA 4F8CB 1RFAA 2RPQA 1V6EA 3QQ8B 4OVVA 2KD0A 3RYTA 2QHOA 4LCDE 1WE6A 4NAWB 4IG7B 5C23A 1WIAA 2Z0DB 2DENB 5D94A 3RD2A 2MQJA 1KM7A 4ZDVA 4DHZE 4GB9A 2DAJA 3U30A 3UIPB 1V49A 2CS4A 4BBNC 2L00B 3NZSA 4DBGA 4TV3A 4B6WA 5EDSA 3A4RA 1K8RB 4NQLB 1RAXA 2C5LC 2C9WB 1TTNA 4FJZA 4W9IA 2N4FA 4X57B 2CHWA 3TIXA 5JHBA 5IAAC 4AWJA 4JLCA 2V4LA 4CO7A 1WR6E 3W1YA 2L05A 2WX0A 2JVCA 2W9NA 4DDGD 4BKGA 1WR1A 1IP9A 2KFKB 3ONSA 3V62A 2G4SA 1OTRB 2DZIA 3BY4B 3R66C 3DPDA 1A5RA 1G6JA 2K25A 2ZPYA 2HTHA 1SE9A 4EOYA 1OEYA 1EO6A 2XEWA 3L17A 2KVRA 3A9KB 3L13A 1ZGUB 2KDIA 1XT9B 2JZ3B 5E6NA 4MGYE 4A20A 3GZNI 2N9PC 2DYOA 3DDCB 4IUMB 1GUAB 4G11A 3UIOB 4AP4C 2GOWA 3R3MA 2BKRB 3ZRCA 1NDDA 3L54A 2JWZA 4ANWA 2J0MA 3EC8A 2BGFA 3KH0A 3HM6X 3ZO5B 3IFWB 1J8CA 1T0YA 4FN2A 4KVGB 3EFUA 4ANXA 4MJSA 4MELA 4GIVA 2C7NB 4PS3A 2GBRA 2JXXA 2BWES 3RZFA 3L0WB 2KMCA 3UQBA 1V5TA 2MBHA 3PV1A 1UD7A 3T8MA 4GDLB 4MGKE 1WI0A 1P98A 2LZ6A 3L08A 3H6NA 4KZCA 3HHMA 3RT3B 2D10A 3TL5A 3VHTC 4KDLB 1WZ0A 3QC8B 4JL9A 1E7VA 1JRUA 2LI5A 1WGRA 3WALA 3LDZE 3Q3FA 4NY0A 4TQ0A 5DPRA 1Z5SB 4KV2A 2BF8B 5J2RA 2O2VA 1YQBA 2LXAA 2KX0A 1H4RA 2CU1A 4FJYA 2GBKA 3PPAA 3ZUNA 2JT4B 2IY0B 2FCQA 3ECIA 1OGWA 2Y5BB 2AL6A 2PE9A 1GJZA 1P1AA 4BOSC 4GDKA 2KOXA 5CHVC 4IW0A 2KHWB 2R2QA 4XC2A 5KHOA 2G4DB 4NQKE 4KDIC 4K7WA 2REXA 3A9JB 2NR2A 1WX8A 4EFOA 2MBQA 2R2OA 1RRBA 3IVFA 3O65B 2NBWB 1S1QB 2M0XA 3PVLA 2OJRA 4GDKB 2M17A 2ZEQA 1HE8A 2HE7A 5J17A 4KZ0A 3U7DA 4DWFA 4WJOA 3X23A 1TZ1A 5DPWA 4HWIB 1AARA 1X1MA 2AWTA 2D3GA 2KX3A 2N1VA 4HPMB 2UWQA 4W9KA 1EF1A 2FNJB 4PYZA 2KN5A 1WGDA 4ANVA 1WRDB 2DZMA 4GSWA 3EHVA 3ML9A 2L3ZA 2J7QB 4HPLB 3MTNB 1I35A 4GGQA 3P2BA 4G3XB 3ZW3A 2M1MA 3VDZA 3A9JA 3A1QA 1WXSA 1Z2MA 1Y8RC 1P3QU 1ZKHA 2KQ7A 2KZRA 3KYCD 4W9GA 1R4NI 1WX9A 3ZKJC 5G2NA 2FIDA 4RM9A 2WYQA 1WZ3A 2PJHA 5DCNA 1WGYA 4NAWA 1E8WA 4GU2A 2N1WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VUW A;  5CHF A;  2YLM A;  4IWP A;  4NPN A;  2RGF A;  1TGZ B;  4W9C A;  5E6O A;  2NS5 A;  1R4M I;  3AU4 A;  3HIZ A;  2K8H A;  3VH3 B;  5AEK B;  5C1Z A;  3C0R B;  4CHK A;  2KMA A;  3ALB A;  3ENE A;  1YIW A;  3VH4 B;  4E71 A;  4K7U A;  3H7P A;  1NBF C;  3VTW A;  3RZW C;  2MP2 A;  2D07 B;  4LDT B;  4ZRK A;  4ICV A;  1Q1O A;  1WX7 A;  1LM8 B;  1V5O A;  4ICU A;  1WH3 A;  2KFK A;  2ZJD A;  3UIN B;  3K9O B;  5JH5 C;  4EKU A;  3DBH I;  3PRZ A;  3ZDT A;  3DQV A;  3Q3J A;  2K8C A;  3K9P B;  4PS8 A;  2HJ8 A;  3H7P B;  3PS6 A;  4AOF A;  2MX2 A;  3DBR I;  4HK2 A;  2MP2 B;  3A9K A;  2BYV E;  3QK0 A;  1WJ6 A;  4CYE A;  2DHZ A;  4BKS A;  3H7S A;  1UH6 A;  2JF5 A;  1IYF A;  1SGH A;  1EUV B;  3AI5 A;  2ZCB A;  3QHT A;  4LJP B;  4W9E A;  3QA8 A;  4HCN B;  5KHQ A;  5AZG A;  3L16 A;  2PE6 B;  3KW5 B;  3MJW A;  3S2A A;  1VD2 A;  2KO3 A;  2HD5 B;  2N9X A;  2WDT B;  3JYU A;  4M0W B;  4XX5 A;  3ZVV A;  4DDI D;  1YX6 B;  4FHJ A;  2MLB A;  2ZPN A;  3T9L A;  3JW0 X;  4GXB A;  5AZH A;  2K1F A;  3WAP A;  3KUC B;  3V6C B;  1WMH B;  2KWU B;  1VCB A;  2K39 A;  3B1L X;  3VTU A;  4GDL A;  3CST A;  4GOC A;  3SU8 X;  3KYD D;  4M8M A;  2GBN A;  3TJP A;  4EUT A;  5D6J B;  3DBS A;  3KUD B;  1P0R A;  3PTF C;  2OOB B;  3AUL A;  2LVP A;  4JQW C;  1WYW B;  2BPS A;  2YVC A;  3QJZ A;  2XK5 B;  1E8X A;  2IYD B;  4MH0 E;  3SD5 A;  3WAM A;  4WWP A;  4AUQ C;  4HLE A;  2AYO B;  4FAD A;  2EKE C;  1F9J A;  4WJP A;  4ZRJ A;  4ZYN A;  3PZD A;  2LAS A;  2K6D B;  5G55 A;  2LVO A;  1XD3 B;  1E7U A;  2IO3 B;  1EF5 A;  4GMV A;  3W1S A;  3A4S C;  3KVF B;  3N32 A;  4FLH A;  3M62 B;  4G0N B;  4DHJ D;  2KC2 A;  1V2Y A;  3R7R A;  3UQA A;  2LD9 A;  5D7G A;  4FA6 A;  2GBJ A;  3DCG A;  4N9F 4;  5BO4 B;  2FUH B;  1YJ1 A;  4K1R B;  4F7Z A;  2KDB A;  4HDQ A;  1H8C A;  4K81 A;  3VTV A;  2WWZ A;  2FCM A;  3B08 A;  3APC A;  4KIK B;  1NI2 A;  1GC6 A;  4EZJ A;  4WWO A;  3ZNG C;  2V3S A;  3N30 A;  4J6I A;  1PQS A;  2PPH A;  1J19 A;  2JRI B;  2KKC A;  2LWP A;  2KDE B;  3TMP B;  3NHE B;  3RUL A;  4AJW A;  3V60 A;  4KSK C;  2CKH B;  2NBU A;  3ZNH B;  4ZRI A;  1UEL A;  2DX5 B;  2IBI B;  3TCA A;  3VXW A;  3DBL I;  2JY6 A;  2GBM A;  1FXT B;  3SDL C;  2J0J A;  2JUO A;  3PSE B;  4B9K A;  3PHW B;  4ANU A;  1WGG A;  4MSM B;  2MBE A;  3QIJ A;  5LXI B;  4BOZ B;  4FHK A;  4RMA A;  3QAQ A;  4W9H A;  3ZTD A;  1WE7 A;  2PEA A;  3ZRF A;  3TBL D;  1ZW7 A;  2K6Q A;  1V81 A;  3V6E B;  2ZVN A;  4G50 A;  1UZX B;  1YX5 B;  4EEW A;  1GC7 A;  4EZK A;  2ZNV B;  2RD0 A;  3NY5 A;  3WIM A;  4IM2 A;  4I6N B;  2KC1 A;  2KTR B;  2C7H A;  3ZDM C;  2NBV B;  4YL8 A;  1QZE A;  4MDK E;  1D3Z A;  2MCN B;  1WJ4 A;  3RUI B;  1WGH A;  1C1Y B;  2GMI C;  4FUL A;  2MW5 A;  4MGI E;  2IO1 B;  4RM8 A;  4MEM A;  1C3T A;  1KLV A;  3AU5 A;  3VAW A;  4WQO B;  4FBJ B;  2N9E B;  3B0A A;  1Q5W B;  3VUX A;  4DHJ B;  1U4A A;  3CF6 E;  2LJ5 A;  4MSQ B;  1UBQ A;  4NJ7 A;  3ZLZ A;  3L10 B;  2IZV B;  2KLC A;  2MBB B;  3ML8 A;  3U8Z A;  5L83 A;  2IY1 B;  3IG3 A;  1LXD A;  1ISN A;  2D11 A;  2Z59 B;  3VQI A;  4K7S A;  4TQ1 A;  3JSV B;  1V9J A;  2NPT A;  4HCP B;  3VUY A;  4GN1 A;  1L2N A;  4W9J A;  1I42 A;  4FJV B;  3PGE A;  3PHX B;  2ZVO A;  2ZZP B;  1WMH A;  2DYM A;  4ASW C;  2MBO A;  3VVW B;  4DK5 A;  2M4N A;  4W9L A;  4JGH B;  4BVU C;  4I6L B;  2NPT B;  1TBE A;  2L76 A;  1V80 A;  2EMS A;  2B3A A;  1V86 A;  2XK5 A;  3DVG X;  1LQB A;  2DAF A;  2A4Z A;  2L8J A;  3ZNI D;  1SIF A;  2A5U A;  2EMT A;  3CSF A;  5AZF A;  3PRE A;  4II2 B;  2BKF A;  4XZ4 A;  2XBB C;  2DYB A;  2RSU A;  4DXA B;  3NOB A;  3QCA A;  2JPH A;  3VFK A;  4A3P A;  4I6P A;  1CMX B;  2NVU I;  2K8B A;  1E8Z A;  2O6V D;  2JRH A;  2LXC A;  1OQY A;  3IBE A;  3KUZ A;  3DVN V;  4TKN A;  4A3O A;  3I3T B;  4HXD A;  4MGZ E;  5GMV A;  2KK8 A;  2VRR B;  1J0G A;  3W1S C;  3QWZ B;  5D2M B;  3PRP B;  2MRP A;  2DZJ A;  2KWC A;  2N7D A;  3APD A;  5DPT A;  5J18 A;  1IPG A;  1Q0W B;  5LXH A;  2LUE A;  2N7E A;  3NZU A;  4B95 A;  3IHP C;  4II3 B;  3SHQ A;  4KIK A;  4F1S A;  1L7Y A;  1WFY A;  2KWV B;  2Z0E B;  4WWN A;  1GNU A;  4NNJ B;  3UF8 A;  4E74 A;  1KOT A;  2ZCC A;  1WXV A;  1E5W A;  2C7M B;  2AL3 A;  4BBN F;  4P7I A;  2J0K A;  3HK0 A;  2KJ6 A;  4IWQ A;  2KFJ A;  5TR5 A;  4MJS B;  2G45 B;  4LDT D;  2FCN A;  4IWO A;  4MM3 A;  3UGB B;  1MG8 A;  2LGY A;  4E3C A;  5CTR C;  1UBI A;  3A33 B;  1UGM A;  2C60 A;  4LJO B;  1WXM A;  3WA0 A;  3H9D A;  1E8Y A;  4DHZ B;  1WM3 A;  3MHS D;  3JVZ X;  5L95 C;  4NJ6 A;  3M95 A;  2KXJ A;  1GG3 A;  2V1Y A;  2ASQ A;  3EEC A;  2LGX A;  2UYZ B;  2AEH A;  5E6P A;  2BWF A;  3DOW A;  4AJY B;  4BKT A;  2I1K A;  1WY8 A;  2DZK A;  2IO2 B;  2MWS B;  3GOE A;  4HJK A;  2CHZ A;  2KLG A;  2O2V B;  2CHX A;  3QX1 A;  2L0T A;  5JHA A;  1E90 A;  3HM3 A;  4BKS D;  2KNB A;  3PLV A;  2BYE A;  3RCZ A;  2FCS A;  3ZTC A;  2ZNV C;  4W9F A;  4HDO A;  3M63 B;  2RR9 A;  5IA7 A;  2LGD A;  2WX1 A;  4KSL C;  3DVG Y;  4W9D A;  2IO0 B;  1WJU A;  2KTR A;  2NCN A;  4WJQ A;  5FR6 A;  3R7Q A;  2KDF B;  5HKH A;  3PRM B;  2M8S A;  3OJ4 B;  3WAN A;  3ZNZ B;  3H1U A;  3V61 A;  3PLU A;  1BT0 A;  2MA9 B;  2KTF A;  2LRW A;  1LFD A;  4TUU A;  1WXA A;  4JIO U;  5CX3 A;  3DVN U;  3ZIM A;  2KJR A;  2KQS A;  2O6V A;  2LRU A;  3APF A;  3N3K B;  1P9D U;  2KJH B;  1M94 A;  2D2Q A;  2CR5 A;  4HVB A;  3OJ3 A;  3BIN A;  1RLF A;  4PS7 A;  3X0W A;  1XQQ A;  3D32 A;  3OLM D;  5JZE B;  5CHW A;  1WJN A;  2G3Q B;  4WAA A;  1WM2 A;  3PT2 B;  2JZZ A;  3QAR A;  2O6V B;  4EZL A;  2FIF A;  3NS8 A;  4IM0 A;  2KAN A;  3WAO A;  2I1J A;  4URK A;  1S3S G;  1YD8 U;  2L0F A;  5DPS A;  1OEY J;  5LLI A;  2BYF A;  3CMM B;  3M3J A;  4BFR A;  3JSV A;  4WJN A;  3OAW A;  3A1Q B;  3AXC A;  4PYU A;  4OVU A;  1WF9 A;  2FAZ A;  4IC7 B;  2MSE D;  3LJ3 A;  1KJT A;  4IM3 A;  2L7R A;  2LVQ A;  4M8N A;  4F8C B;  1RFA A;  2RPQ A;  1V6E A;  3QQ8 B;  4OVV A;  2KD0 A;  3RYT A;  2QHO A;  4LCD E;  1WE6 A;  4NAW B;  4IG7 B;  5C23 A;  1WIA A;  2Z0D B;  2DEN B;  5D94 A;  3RD2 A;  2MQJ A;  1KM7 A;  4ZDV A;  4DHZ E;  4GB9 A;  2DAJ A;  3U30 A;  3UIP B;  1V49 A;  2CS4 A;  4BBN C;  2L00 B;  3NZS A;  4DBG A;  4TV3 A;  4B6W A;  5EDS A;  3A4R A;  1K8R B;  4NQL B;  1RAX A;  2C5L C;  2C9W B;  1TTN A;  4FJZ A;  4W9I A;  2N4F A;  4X57 B;  2CHW A;  3TIX A;  5JHB A;  5IAA C;  4AWJ A;  4JLC A;  2V4L A;  4CO7 A;  1WR6 E;  3W1Y A;  2L05 A;  2WX0 A;  2JVC A;  2W9N A;  4DDG D;  4BKG A;  1WR1 A;  1IP9 A;  2KFK B;  3ONS A;  3V62 A;  2G4S A;  1OTR B;  2DZI A;  3BY4 B;  3R66 C;  3DPD A;  1A5R A;  1G6J A;  2K25 A;  2ZPY A;  2HTH A;  1SE9 A;  4EOY A;  1OEY A;  1EO6 A;  2XEW A;  3L17 A;  2KVR A;  3A9K B;  3L13 A;  1ZGU B;  2KDI A;  1XT9 B;  2JZ3 B;  5E6N A;  4MGY E;  4A20 A;  3GZN I;  2N9P C;  2DYO A;  3DDC B;  4IUM B;  1GUA B;  4G11 A;  3UIO B;  4AP4 C;  2GOW A;  3R3M A;  2BKR B;  3ZRC A;  1NDD A;  3L54 A;  2JWZ A;  4ANW A;  2J0M A;  3EC8 A;  2BGF A;  3KH0 A;  3HM6 X;  3ZO5 B;  3IFW B;  1J8C A;  1T0Y A;  4FN2 A;  4KVG B;  3EFU A;  4ANX A;  4MJS A;  4MEL A;  4GIV A;  2C7N B;  4PS3 A;  2GBR A;  2JXX A;  2BWE S;  3RZF A;  3L0W B;  2KMC A;  3UQB A;  1V5T A;  2MBH A;  3PV1 A;  1UD7 A;  3T8M A;  4GDL B;  4MGK E;  1WI0 A;  1P98 A;  2LZ6 A;  3L08 A;  3H6N A;  4KZC A;  3HHM A;  3RT3 B;  2D10 A;  3TL5 A;  3VHT C;  4KDL B;  1WZ0 A;  3QC8 B;  4JL9 A;  1E7V A;  1JRU A;  2LI5 A;  1WGR A;  3WAL A;  3LDZ E;  3Q3F A;  4NY0 A;  4TQ0 A;  5DPR A;  1Z5S B;  4KV2 A;  2BF8 B;  5J2R A;  2O2V A;  1YQB A;  2LXA A;  2KX0 A;  1H4R A;  2CU1 A;  4FJY A;  2GBK A;  3PPA A;  3ZUN A;  2JT4 B;  2IY0 B;  2FCQ A;  3ECI A;  1OGW A;  2Y5B B;  2AL6 A;  2PE9 A;  1GJZ A;  1P1A A;  4BOS C;  4GDK A;  2KOX A;  5CHV C;  4IW0 A;  2KHW B;  2R2Q A;  4XC2 A;  5KHO A;  2G4D B;  4NQK E;  4KDI C;  4K7W A;  2REX A;  3A9J B;  2NR2 A;  1WX8 A;  4EFO A;  2MBQ A;  2R2O A;  1RRB A;  3IVF A;  3O65 B;  2NBW B;  1S1Q B;  2M0X A;  3PVL A;  2OJR A;  4GDK B;  2M17 A;  2ZEQ A;  1HE8 A;  2HE7 A;  5J17 A;  4KZ0 A;  3U7D A;  4DWF A;  4WJO A;  3X23 A;  1TZ1 A;  5DPW A;  4HWI B;  1AAR A;  1X1M A;  2AWT A;  2D3G A;  2KX3 A;  2N1V A;  4HPM B;  2UWQ A;  4W9K A;  1EF1 A;  2FNJ B;  4PYZ A;  2KN5 A;  1WGD A;  4ANV A;  1WRD B;  2DZM A;  4GSW A;  3EHV A;  3ML9 A;  2L3Z A;  2J7Q B;  4HPL B;  3MTN B;  1I35 A;  4GGQ A;  3P2B A;  4G3X B;  3ZW3 A;  2M1M A;  3VDZ A;  3A9J A;  3A1Q A;  1WXS A;  1Z2M A;  1Y8R C;  1P3Q U;  1ZKH A;  2KQ7 A;  2KZR A;  3KYC D;  4W9G A;  1R4N I;  1WX9 A;  3ZKJ C;  5G2N A;  2FID A;  4RM9 A;  2WYQ A;  1WZ3 A;  2PJH A;  5DCN A;  1WGY A;  4NAW A;  1E8W A;  4GU2 A;  2N1W A; 
#chains in the Genus database with same CATH topology
 1N63 A;  2JYT A;  2JYE A;  1ZXH A;  3AU4 A;  3VH3 B;  3C0R B;  4CHK A;  3ALB A;  1YIW A;  3H8H A;  4WIP A;  1QOB A;  2MP2 A;  2W55 A;  2WLB A;  2J4X A;  4ZRK A;  1I4Q A;  4ICV A;  4ZYS A;  1V5O A;  4ICU A;  2DNF A;  3UIN B;  3K9O B;  2WXG A;  1CJE A;  3PRZ A;  3ETR A;  3ZDT A;  3DQV A;  2K8C A;  5EE3 A;  2WXM A;  3H7P B;  5FK9 C;  4RGT A;  4JWU C;  1SGH A;  5T8I A;  3AI5 A;  4YTP B;  4W9E A;  3AEG B;  5AZG A;  5HI1 A;  1V1O A;  2N9X A;  1HTQ A;  4DDI D;  1WXQ A;  2MLB A;  2V9H A;  1VCB A;  3B1L X;  1MVK A;  2GBN A;  2LVP A;  2BT6 A;  4MH0 E;  1E8X A;  5H92 C;  2IGD A;  2W3S A;  2EKE C;  4ZYN A;  1ZXI A;  2IO3 B;  3A4S C;  2KC2 A;  5D7G A;  1PGA A;  3DCG A;  3Q8A A;  1JRO A;  2M19 A;  1QOG A;  2WXK A;  2WDQ B;  4HDQ A;  1SIJ A;  2WWZ A;  2NTS A;  3DBL B;  1VZ6 A;  4KIK B;  1GC6 A;  3RN9 C;  2JU6 X;  2AX5 A;  2JRI B;  3V60 A;  4KSK C;  1TKY A;  3NG0 A;  2E6X A;  3TCA A;  1SE2 A;  2JY6 A;  2G9H D;  2GBM A;  2JUO A;  3PSE B;  1T3Q A;  2RDG A;  4OW0 A;  3W5U B;  1N61 A;  4BOZ B;  4OZA A;  4FHK A;  1P7F A;  4W9H A;  2PEA A;  4ARC A;  1JQ4 A;  2ZVN A;  3SR6 A;  3NVZ A;  3TUO A;  1VDV A;  1FFU A;  1UWX A;  3BWU D;  3WIM A;  4I6N B;  2KC1 A;  3ZDM C;  1T5X D;  1C4C A;  2NBV B;  1QZE A;  2MCN B;  4ITK A;  2GMI C;  1FRR A;  4LNF A;  4MEM A;  4FBJ B;  3EUB 2;  1RFK A;  3V05 A;  3B0A A;  4DHJ B;  1U4A A;  2JXT A;  4MSQ B;  3L10 B;  2IZV B;  2KLC A;  3RI7 C;  3U52 E;  1LXD A;  1MJD A;  1ISN A;  3ZJV A;  2QEJ C;  1C4P A;  3ZQ4 A;  4GN1 A;  5D3D A;  1I42 A;  2IGH A;  3TEX A;  3EFC A;  2K9X A;  4W9L A;  2NPT B;  3IXS A;  4YSY B;  1IGD A;  2L76 A;  2SEB D;  2B3A A;  1D5X C;  2UU7 A;  2XK5 A;  1MHX A;  3CIR B;  3DVG X;  1LQB A;  1N60 A;  1FCL A;  3CSF A;  2N9K A;  3NOB A;  3VFK A;  2JPH A;  1PGX A;  2BS4 B;  2R61 A;  3VRA B;  4HXD A;  5GMV A;  1FCC C;  1J0G A;  2VH1 A;  3W2D A;  2DZJ A;  5J18 A;  1IPG A;  1Q0W B;  3VR8 B;  2N7E A;  3AEB B;  3IHP C;  2WXP A;  2Y5C A;  2JSV X;  4WWM A;  1WFY A;  2Z0E B;  2MJE A;  3I5J C;  2ZCC A;  2KFJ A;  2D3A A;  3PZ7 A;  2FCN A;  4IWO A;  1PFD A;  4YWG G;  4MM3 A;  1MG8 A;  2LGY A;  1UBI A;  3A33 B;  5AUI A;  4LJO B;  1WXM A;  4RH6 A;  4DHZ B;  1E8Y A;  3ZJT A;  1WM3 A;  3MHS D;  2V1Y A;  1NI3 A;  2UYZ B;  1JCK B;  1ROE A;  2WXJ A;  4AQ7 A;  2BWF A;  1I7H A;  2I1K A;  2DZK A;  4HJK A;  2KLG A;  1T0Q C;  2D5G A;  3AED B;  4BKS D;  2BYE A;  3Q3N C;  2ZNV C;  1QF6 A;  2M0A A;  3M63 B;  3DVG Y;  4WJQ A;  1WJU A;  5FR6 A;  1V97 A;  4ZHP A;  5HKH A;  3PRM B;  3OJ4 B;  3ZNZ B;  3H1U A;  1GOZ A;  1LFD A;  5CX3 A;  2O6V A;  2CR5 A;  1RLF A;  1HZ5 A;  1FXI A;  1T0S C;  2I2Y A;  2WQY B;  4P16 A;  1D5Z C;  3PT2 B;  4YSX B;  4OVZ A;  3WAO A;  4URK A;  1YD8 U;  2L0F A;  2INC C;  4BFR A;  4WJN A;  5FKA C;  4PYU A;  4IC7 B;  1YOV B;  3LJ3 A;  2LVQ A;  1RFA A;  1KLG D;  4OVV A;  3RYT A;  3C8Y A;  4NAW B;  2IND C;  2Z0D B;  5D94 A;  4US9 A;  5GXG B;  2DAJ A;  4BBN C;  2KAJ A;  2L00 B;  4H2A A;  4B6W A;  1K8R B;  4NQL B;  4FJZ A;  4W9I A;  2N4F A;  3KWL A;  3RNB C;  1NVI D;  2GB1 A;  4HKZ E;  2NTT A;  1C79 A;  2WX0 A;  1IP9 A;  1Y56 A;  3RPF C;  3AN1 A;  4KKJ A;  3V62 A;  2DZI A;  3AE7 B;  2ZPY A;  2HTH A;  4EOY A;  1EO6 A;  1ZGU B;  1KLU D;  1STE A;  3UIO B;  3V3X A;  3R3M A;  3ZRC A;  1EWC A;  3HM6 X;  3ZO5 B;  3IFW B;  4XDC A;  1J8C A;  4ANX A;  3EFU A;  1WWT A;  2N9L A;  1XLP A;  4GIV A;  3L0W B;  4JPS A;  1V5T A;  3TEY A;  4ARI A;  3T8M A;  1SE4 A;  2V3P A;  3L08 A;  3H6N A;  4KZC A;  5EE0 A;  2D10 A;  3TL5 A;  3VHT C;  1JRU A;  4TQ0 A;  5DPR A;  3DHH C;  5H8Y E;  2LXA A;  3EGR A;  3P4S B;  2CU1 A;  1T0R C;  3ECI A;  2AL6 A;  4DXG A;  2PE9 A;  1GJZ A;  4BOS C;  4GDK A;  2KHW B;  4HRO A;  3ZYY X;  2REX A;  1ZP0 B;  2M0X A;  2L83 A;  1I4P A;  1ET9 A;  4DWF A;  4WJO A;  3X23 A;  4HWI B;  4IDI A;  2D3G A;  2UWQ A;  4M01 A;  4W9K A;  2QC8 A;  2KN5 A;  1R4N B;  4REZ A;  2L3Z A;  3ZGZ A;  3OWE B;  2QDF A;  1C76 A;  2X38 A;  4GGQ A;  4HEA 1;  3VDZ A;  1P3Q U;  3B2G A;  5G2N A;  2FID A;  1WZ3 A;  4C7Z A;  3A9J B;  3VUW A;  2YLM A;  4NPN A;  1TGZ B;  4W9C A;  2NS5 A;  5C1Z A;  4Q2J A;  5JXV A;  2KMA A;  3ENE A;  4K7U A;  1NBF C;  3RZW C;  1OQR A;  2D07 B;  1AYF A;  1HA5 A;  2KFK A;  5JH5 C;  3DBH I;  3K9P B;  4YXD B;  2MX2 A;  2GLS A;  4HK2 A;  3BII D;  3QK0 A;  1WJ6 A;  4CYE A;  3C19 A;  2INP E;  3MC8 A;  1SBB B;  2HJ1 A;  2JF5 A;  1DYQ A;  2ZCB A;  2WXF A;  3MJW A;  1KH0 A;  2HD5 B;  3JYU A;  3B2F A;  3ZVV A;  1YX6 B;  3P4Q B;  2ONQ A;  4ZOH C;  4GXB A;  1OQQ A;  2BYT A;  2KWU B;  3AE5 B;  3RNE C;  5BMH A;  2X8X X;  2IPK D;  4GDL A;  3Q3O C;  2KMM A;  4EUT A;  3AUL A;  4N58 A;  2YVC A;  2XK5 B;  3KQ4 A;  1QOA A;  4HKQ A;  4WJP A;  2LAS A;  2K6D B;  1E9M A;  2LVO A;  1XD3 B;  1EF5 A;  4GMV A;  3N32 A;  2WXL A;  3AH7 A;  1HQR D;  4DHJ D;  3R7R A;  3UQA A;  4N9F 4;  1YJ1 A;  4K1R B;  1H8C A;  4K81 A;  3NUH B;  1YJJ A;  3B08 A;  3APC A;  1OFF A;  2K22 A;  2V3S A;  3N30 A;  4J6I A;  1PQS A;  4L1B A;  1J19 A;  4AJW A;  4MM3 B;  2ON8 A;  4ZRI A;  4O1N A;  2PTL A;  3U4E G;  2PW9 A;  4MT5 A;  2KAC A;  2J0J A;  4B9K A;  3PHW B;  3O13 A;  1I4H A;  2MBE A;  3QIJ A;  5LXI B;  1SSN A;  4A90 A;  3QAQ A;  3DWM A;  1ZW7 A;  1V81 A;  4N6E B;  3E9S A;  2PVG C;  4EEW A;  1YN3 A;  3AE8 B;  1AN8 A;  1QIL A;  3VR9 B;  5FR3 A;  3B9J A;  1D3Z A;  2W54 A;  3LB8 C;  1WGH A;  4FUL A;  4ZRQ A;  4RM8 A;  1KLV A;  3AU5 A;  3VAW A;  4C4V A;  2B76 B;  1Q5W B;  3VUX A;  1ZDV A;  2KVZ A;  2XN9 C;  4NJ7 A;  3NVV A;  3ML8 A;  4QAY A;  4M0W A;  3U8Z A;  1VZ8 A;  2IY1 B;  2Z59 B;  3EA6 A;  2JWU A;  1L6U A;  3VUY A;  4W9J A;  3PHX B;  2CU3 A;  2ZVO A;  1WMH A;  1WRI A;  4TSS A;  3VVW B;  4UDU C;  2M4N A;  4JGH B;  1TT5 B;  1TS5 A;  1UGJ A;  2EMS A;  4DQO C;  2A4Z A;  3GE3 C;  3ZNI D;  1SIF A;  2EMT A;  4KX6 B;  3AEC B;  3PRE A;  2XBB C;  2WXI A;  2BB5 A;  1D6E C;  4A3P A;  2NVU I;  1E8Z A;  3DVN V;  2KK8 A;  2VRR B;  1NEN B;  1FM0 D;  2N7D A;  5DPT A;  5LXH A;  1VZ7 A;  3LYY A;  4HJG E;  2OJW A;  3NZU A;  4B95 A;  3AE4 B;  1MI0 A;  2KWV B;  3E56 A;  3UF8 A;  4E74 A;  1KOT A;  2W3R A;  3AV8 A;  4WAF A;  2AL3 A;  2J0K A;  3HK0 A;  1HXY D;  3N1Y C;  4IWQ A;  5TR5 A;  3BYY B;  4RF1 A;  2C60 A;  2RPV A;  2D3B A;  4JWS C;  2AEH A;  3P63 A;  5E6P A;  4AJY B;  1IBX B;  4YTM B;  1EM7 A;  1KFY B;  2CHX A;  5JHA A;  1E90 A;  3PLV A;  3RCZ A;  3ZTC A;  4HDO A;  2RR9 A;  4KSL C;  2IO0 B;  2WXQ A;  2NCN A;  3P42 A;  1WXA A;  4JIO U;  5LNK 1;  1P9D U;  5IO9 A;  1GB1 A;  3U2S C;  4PS7 A;  3X0W A;  3D32 A;  3OLM D;  1LO5 D;  3GB1 A;  4WAA A;  4WQM A;  3P4P B;  4EZL A;  2FIF A;  2H88 B;  2QMT A;  2MJ3 A;  3P1M A;  1B9R A;  5DPS A;  1V8C A;  5LLI A;  3Q8B A;  3CMM B;  4EE2 A;  1DOX A;  4RNA A;  4S17 A;  3ABV B;  2MSE D;  1KJT A;  2JZP A;  1WYG A;  4IM3 A;  2L7R A;  1C77 A;  2EEL A;  2KD0 A;  2QHO A;  4KGR A;  4P6V F;  3RD2 A;  1I4R A;  4ZDV A;  4DHZ E;  2N7J A;  1V49 A;  1IUE A;  1TKG A;  2CS4 A;  2N0S B;  3NZS A;  5EDS A;  1RAX A;  3TIX A;  3N20 C;  4JLC A;  2IJ0 A;  3W1Y A;  4DDG D;  2L05 A;  2QSD A;  1WR1 A;  1QOF A;  3Q8E A;  2KFK B;  2LEK A;  3RNC C;  1FMA D;  3R66 C;  3BY4 B;  1G6J A;  2K25 A;  1OEY A;  3DWG C;  2KVR A;  4RCO A;  5TSS A;  3URY A;  2JZ3 B;  5E6N A;  5C3J B;  1VR9 A;  3GZN I;  2N9P C;  3DDC B;  2YEP B;  4P1C C;  2BKR B;  3L54 A;  2JWZ A;  2PMV A;  2J0M A;  5HG2 A;  1KRH A;  1T0Y A;  3TEW A;  2GBR A;  2BWE S;  1NYQ A;  2J53 A;  2SAK A;  4L23 A;  1CQV A;  1UD7 A;  4GDL B;  1WI0 A;  2D3C A;  3HHM A;  1FFV A;  2L52 A;  2LMC A;  1FNW A;  2LI5 A;  1WGR A;  3WAL A;  5G5H A;  4L2Y A;  1WSP A;  4NY0 A;  1Z5S B;  4LLG M;  1MFW A;  2O2V A;  4FJY A;  1H4R A;  3ZUN A;  4ACF A;  2GBK A;  3I57 A;  3PPA A;  2IY0 B;  2FCQ A;  1QQR A;  2WXN A;  5CHV C;  1RYJ A;  1CZP A;  1M4V A;  2R2Q A;  5KHO A;  2G4D B;  1XLQ A;  2WU5 B;  4K7W A;  2NR2 A;  2LHD A;  3MC0 B;  3PVL A;  1HE8 A;  2GRI A;  1FXA A;  2WDV B;  5J17 A;  3U7D A;  4A8X C;  4HPP A;  1TZ1 A;  2WNM A;  1AAR A;  2KX3 A;  2N1V A;  4HPM B;  1EF1 A;  4PYZ A;  4ANV A;  3ML9 A;  4HPL B;  5BYS A;  4B0M A;  3MTN B;  1K51 A;  2FBW B;  4G3X B;  3ZW3 A;  2GI9 A;  1WXS A;  1C9F A;  3MP9 A;  1E10 A;  4YTN B;  2MH7 A;  1ZKH A;  1JML A;  3KYC D;  4W9G A;  1BUI C;  1WX9 A;  3ZKJ C;  1WGY A;  4WUR A;  2VZK B;  5CHF A;  2VH2 A;  2RGF A;  5E6O A;  1TYG B;  3HIZ A;  4NAM A;  5AEK B;  4B0E A;  2BB6 A;  3VH4 B;  2OED A;  3T3N A;  4E71 A;  3H7P A;  2V0G A;  2RDH A;  1Q1O A;  2MEK A;  1WH3 A;  2ZJD A;  5IP4 D;  4EKU A;  1P7E A;  4PS8 A;  3BK1 A;  2HJ8 A;  4AOF A;  1JWA D;  5I4D A;  2MP2 B;  2BYV E;  1PDX A;  1L0V B;  3H7S A;  1UH6 A;  4C4V B;  1IYF A;  1EUV B;  4LJP B;  3GP7 A;  3QA8 A;  3S2A A;  1B1Z A;  3DHI C;  4M0W B;  2RMM A;  1FO4 A;  4FHJ A;  4OHJ A;  3CWI A;  4LNK A;  4R3D A;  3KUC B;  1WMH B;  2K39 A;  3VTU A;  4BAX A;  4GOC A;  3NZ3 A;  3KYD D;  2H89 B;  3HVZ A;  4FXC A;  4M8M A;  3FC4 A;  1L6V A;  5D6J B;  3DBS A;  1P0R A;  4JQW C;  1WYW B;  3QJZ A;  2IYD B;  1ESF A;  3WAM A;  4WWP A;  4LNI A;  4AUQ C;  4FAD A;  1D4B A;  4ZRJ A;  3AMZ A;  4KKI A;  1F2R C;  5IN7 A;  5EE1 A;  1QLB B;  3KVF B;  4D2K A;  3M62 B;  1N6Z A;  4FA6 A;  2GBJ A;  1SJE D;  1TKE A;  4XYC A;  3HUI A;  2FUH B;  1F77 A;  1MG4 A;  4F7Z A;  2KDB A;  1V1P A;  2QJL A;  1NI2 A;  4US8 A;  4WWO A;  3ZNG C;  3BVZ A;  2LWP A;  3Q2A C;  2KDE B;  3NHE B;  1DOI A;  2CKH B;  2NBU A;  2DWQ A;  1UEL A;  2DX5 B;  2IBI B;  3VXW A;  3DBL I;  4LTU A;  1UWM A;  3ZTD A;  3ZRF A;  1EU3 A;  2K6Q A;  2HDE A;  1ZDX A;  4G50 A;  4K3C A;  4EZK A;  2ZNV B;  2RD0 A;  2C7H A;  1HEZ E;  1YN5 A;  3RUI B;  1C1Y B;  2AQ2 B;  1JWS D;  2W82 A;  4MGI E;  4WQO B;  2L1A A;  2N9E B;  2V4I B;  3IAS 1;  2AQ1 B;  3CF6 E;  1MHH E;  1UBQ A;  3I63 C;  3ZLZ A;  1RM6 C;  2MBB B;  3MHZ A;  5HFY A;  1ET6 A;  5L83 A;  2D11 A;  3VQI A;  4TQ1 A;  4A9A A;  1V9J A;  2NPT A;  4HCP B;  3NJT A;  1L2N A;  5BYQ A;  4FJV B;  2MBO A;  2J42 A;  1HZ6 A;  4WH4 A;  4RF0 A;  4BVU C;  4C00 A;  1V80 A;  3GZN B;  1YJI A;  2L8J A;  2A5U A;  1UF0 A;  5AZF A;  2BKF A;  4XZ4 A;  4DXA B;  2BBC A;  4I6P A;  1CMX B;  2E3T A;  3IBE A;  4TKN A;  2LXC A;  3SFE B;  4MGZ E;  2KN4 A;  5MPO A;  3QWZ B;  5D2M B;  2MRP A;  3APD A;  2DBY A;  2LUE A;  2WU2 B;  4DXF A;  4II3 B;  1E6E B;  2LUM A;  4F1S A;  1L7Y A;  4WWN A;  1GNU A;  2C7M B;  1SB3 C;  3MC9 A;  3NS1 A;  4YSZ B;  2KJ6 A;  4LDT D;  5CTR C;  1UGM A;  3MFG A;  4XE0 A;  2LHE A;  3HVD A;  4NJ6 A;  3M95 A;  2KXJ A;  3FAH A;  1GG3 A;  2G1E A;  1TY2 A;  3EEC A;  3DOW A;  4KGT A;  1WY8 A;  1TZO A;  3GOE A;  2CHZ A;  1JRP A;  1NEK B;  2O2V B;  1FD6 A;  3Q14 C;  2L0T A;  2WXR A;  1PYW D;  3HM3 A;  2PVO D;  5IA7 A;  2M56 B;  4W9D A;  4PK1 A;  2KTR A;  3R7Q A;  1FNU A;  2KDF B;  3WAN A;  3PLU A;  2MA9 B;  4IKG A;  2PIA A;  3DVN U;  1BXT A;  3AE1 B;  3KWV A;  3APF A;  1XF5 L;  3Q6B A;  2KJH B;  1L0Y B;  1M94 A;  2D2Q A;  3L4P A;  2LGI A;  2IGG A;  5AUK A;  3BYT B;  5C2T B;  1L5P A;  5JZE B;  1XCT L;  1YNT E;  3QAR A;  2O6V B;  2KAN A;  2I1J A;  1S3S G;  2LJI A;  2BYF A;  3M3J A;  3JSV A;  2PLP A;  4XWT A;  3AXC A;  2J52 A;  4OVU A;  3BZD B;  4M8N A;  1JAL A;  2RPQ A;  2WHI A;  2WXH A;  5C23 A;  1WIA A;  2MQJ A;  1XO3 A;  4JX1 C;  4TV3 A;  3A4R A;  2C5L C;  4X57 B;  2C9W B;  1TTN A;  5JHB A;  1A5R A;  2FUG 1;  4MH8 A;  1WGK A;  5E6J A;  2V4L A;  4C7Y A;  2LFI A;  2JVC A;  2W9N A;  4BKG A;  2BW2 A;  3AEF B;  3DPD A;  1PGB A;  1D5M C;  3L13 A;  4A6Q A;  1XT9 B;  1I4X A;  2DYO A;  4IUM B;  4G11 A;  4P1B C;  3SFD B;  3EC8 A;  3VRB B;  3KH0 A;  2VZK D;  4FN2 A;  4KVG B;  4MJS A;  4ZRP A;  4MEL A;  2JXX A;  3RZF A;  4LK0 M;  1MPE A;  1YQ4 B;  3UQB A;  2MBH A;  3BVG A;  3RT3 B;  1TIF A;  1ZOY B;  4JL9 A;  1E7V A;  2DLB A;  4AS1 A;  3LDZ E;  2BQQ A;  4KV2 A;  2BF8 B;  5J2R A;  2YEP F;  1YQB A;  2KX0 A;  1UUP A;  1OGW A;  3LXF A;  3FKY A;  1P1A A;  2KOX A;  1RWS A;  4NQK E;  4XDD A;  3BVM A;  1WX8 A;  4EFO A;  2R2O A;  1RRB A;  3IVF A;  3O65 B;  3W9C B;  1S1Q B;  4GDK B;  2ZEQ A;  2HE7 A;  1V1P B;  3AE6 B;  1X1M A;  2AWT A;  1XEE A;  3KLS X;  2BVC A;  4NZL B;  5BMG A;  1WRD B;  3FIL A;  2KYW A;  1I35 A;  3P2B A;  2M1M A;  3A9J A;  2BTE A;  3A1Q A;  1L4Z B;  1Y8R C;  1XLN A;  3PO0 A;  2KZR A;  1R4N I;  1DOY A;  2K0P A;  1ZPS A;  4RM9 A;  4OZC A;  1T6B X;  1K50 A;  3I9V 1;  3Q3M C;  5DCN A;  4GU2 A;  2N1W A;  4IWP A;  3IT4 B;  1R7S A;  1TS3 A;  3DBH B;  3AE9 B;  1R4M I;  2K8H A;  1HTO A;  1VRA B;  3IAM 1;  1FNV A;  3N1X C;  2CJN A;  3VTW A;  4LDT B;  3DHG C;  1N62 A;  1WX7 A;  1LM8 B;  1YMH E;  2BS3 B;  2Z8L A;  3Q3J A;  3AEA B;  1XCQ L;  2BS2 B;  3PS6 A;  1TS2 A;  2L32 A;  3DBR I;  3A9K A;  2DHZ A;  4BKS A;  3QHT A;  3TSS A;  4HCN B;  5KHQ A;  3L16 A;  2PE6 B;  3KW5 B;  4A55 A;  1VD2 A;  2KO3 A;  2WDT B;  4XX5 A;  4GLS C;  1YQ3 B;  3BK2 A;  3GE8 C;  4LNN A;  2WP9 B;  2ZPN A;  3T9L A;  3JW0 X;  5AZH A;  4HRS A;  2K1F A;  3WAP A;  3V6C B;  4NJC A;  3CST A;  3SU8 X;  3HRD D;  3TJP A;  3KUD B;  3PTF C;  2OOB B;  2CJO A;  2BPS A;  2ICI A;  3SD5 A;  1KF6 B;  1EU4 A;  5D3I B;  4HLE A;  2AYO B;  1F9J A;  1FPY A;  1TY0 A;  3PZD A;  1EWY C;  1SXT A;  5G55 A;  1C4A A;  1E7U A;  1F52 A;  3W1S A;  1E7P B;  4FLH A;  5EE9 A;  4G0N B;  2Y3A A;  4YT0 B;  1V2Y A;  1AWD A;  2LD9 A;  1TS4 A;  5BO4 B;  2TSS A;  2I38 A;  1I4G A;  4C56 C;  2LGS A;  3VTV A;  2FCM A;  1KTK A;  4RGO S;  1GAQ B;  3SEB A;  1F0Z A;  4EZJ A;  3T3O A;  1F2R I;  1LGR A;  2KKC A;  2PPH A;  4JE3 B;  3TMP B;  3RUL A;  1JWM D;  3ZNH B;  1L0X B;  5BMI A;  1FXT B;  3PZ8 A;  3SDL C;  1ZE3 D;  4M00 A;  4ANU A;  1WGG A;  1Q10 A;  2WGS A;  4MSM B;  4RMA A;  2QIL A;  1WE7 A;  3TBL D;  3V6E B;  2Q5W D;  1VJK A;  1UZX B;  1YX5 B;  1GC7 A;  1J7B A;  4IOI E;  4RGN A;  3NY5 A;  4IM2 A;  2KTR B;  2RDB C;  4YL8 A;  4MDK E;  1WJ4 A;  2MW5 A;  3AM9 A;  1UNS A;  2IO1 B;  1JWB D;  1GPX A;  1C3T A;  2IDY A;  1QT9 A;  5G5G A;  1DGJ A;  3RMK C;  1N5X A;  2LJ5 A;  1E0Z A;  3RNG C;  4RFB A;  3IG3 A;  1ACC A;  4K7S A;  3JSV B;  3PGE A;  3OG5 A;  2ZZP B;  2DYM A;  4ASW C;  4DK5 A;  1NYR A;  4LNO A;  1J7A A;  4I6L B;  3IT6 B;  1TBE A;  1V86 A;  2DAF A;  1SJH D;  5BYR A;  3P4R B;  1SEB D;  4J3O D;  1ZUD 2;  4II2 B;  4USA A;  2DYB A;  2RSU A;  3QCA A;  1FRD A;  2K8B A;  2O6V D;  2JRH A;  4A3O A;  1OQY A;  3KUZ A;  3U7Z A;  3I3T B;  4C80 A;  2KDM A;  3W1S C;  3PRP B;  2KWC A;  2QIE B;  1JWU D;  3SHQ A;  4KIK A;  4CQN A;  2V3N A;  4NNJ B;  2MJD A;  1F1H A;  1WXV A;  1E5W A;  4BBN F;  4P7I A;  4S0R A;  4XWW A;  4MJS B;  2G45 B;  4RGM A;  2QCZ A;  4XGA B;  3AB5 A;  3UGB B;  2XNA C;  4E3C A;  1IBX A;  3WA0 A;  1N5W A;  3H9D A;  2AQ3 B;  3ZJU A;  5L95 C;  3JVZ X;  3N9Y C;  3RNA C;  3UI3 A;  2ASQ A;  3AEE B;  2LGX A;  1IGC A;  3N1Z C;  4BKT A;  2IO2 B;  2MWS B;  2ZW1 A;  3QX1 A;  3NVY A;  2KNB A;  2FCS A;  1XLO A;  4K3B A;  1C78 A;  4W9F A;  1BML C;  2LGD A;  2WX1 A;  3R2T A;  2M8S A;  3V61 A;  1L4D B;  1BT0 A;  2KTF A;  2LRW A;  4TUU A;  1QKZ A;  4BZA A;  3ZIM A;  2KJR A;  2KQS A;  2LRU A;  3R2I A;  5HHD G;  5IKC M;  3N3K B;  3ZXR A;  4HVB A;  3OJ3 A;  2KT7 A;  3BIN A;  1XQQ A;  2NMQ A;  2JQR B;  5CHW A;  1WJN A;  2G3Q B;  1R4M B;  1WM2 A;  2JZZ A;  1SF0 A;  3FIL B;  2PKO A;  3NS8 A;  4IM0 A;  1OEY J;  3GS2 A;  3OAW A;  3A1Q B;  5IOI A;  1WF9 A;  2FAZ A;  4F8C B;  3TEZ A;  1V6E A;  3QQ8 B;  3ZXV A;  3DBR B;  4MAC A;  1FIQ A;  4LCD E;  1WE6 A;  4IG7 B;  2K5P A;  1ENF A;  2DEN B;  1KM7 A;  4GB9 A;  3U30 A;  3UIP B;  4KGS A;  1AW7 A;  4PT5 A;  4DBG A;  2WXO A;  1K53 A;  4N59 A;  2CHW A;  5IAA C;  4AWJ A;  4CO7 A;  3W5V B;  1WR6 E;  3WCQ A;  2ZW0 A;  3ONS A;  2G4S A;  1OTR B;  1A70 A;  1SE9 A;  1CK1 A;  2XEW A;  3L17 A;  3A9K B;  2WS3 B;  2KDI A;  4MGY E;  3J9C A;  4A20 A;  1GUA B;  4AP4 C;  2GOW A;  1SE3 A;  1NDD A;  1PUT A;  3Q69 A;  4ANW A;  2BGF A;  4ZHO A;  1JW9 D;  2Y5P A;  2KQ4 X;  2C7N B;  4PS3 A;  2MHJ A;  2KMC A;  3PV1 A;  4MGK E;  1P98 A;  2LZ6 A;  3MJ5 A;  2K3U A;  4KDL B;  1WZ0 A;  2INN E;  3QC8 B;  3NRZ A;  2ACZ B;  3Q3F A;  1FEH A;  1GB4 A;  3RFZ B;  2JT4 B;  1TJE A;  4OZB A;  2Y5B B;  3R8B A;  2WDR B;  4IW0 A;  4XC2 A;  1XXG A;  4KDI C;  2EKI A;  2JX5 A;  2MBQ A;  2NBW B;  2OHF A;  2OJR A;  2M17 A;  3NVW A;  4KZ0 A;  1VLB A;  5DPW A;  3AE2 B;  4TMA B;  2FNJ B;  3Q8F A;  1WGD A;  2DZM A;  4GSW A;  3EHV A;  2J7Q B;  1J7C A;  3Q8C A;  4M02 A;  1K52 A;  1Z2M A;  3RNF C;  3AE3 B;  2KQ7 A;  1YN4 A;  2HTM E;  2FE8 A;  2WYQ A;  2PJH A;  2KWD A;  4NAW A;  1E8W A; 
#chains in the Genus database with same CATH homology
 3VUW A;  5CHF A;  2YLM A;  4IWP A;  4NPN A;  2RGF A;  1TGZ B;  4W9C A;  5E6O A;  2NS5 A;  1R4M I;  3AU4 A;  3HIZ A;  2K8H A;  3VH3 B;  5AEK B;  5C1Z A;  3C0R B;  4CHK A;  2KMA A;  3ALB A;  3ENE A;  1YIW A;  3VH4 B;  4E71 A;  4K7U A;  3H7P A;  1NBF C;  3VTW A;  3RZW C;  2MP2 A;  2D07 B;  4LDT B;  4ZRK A;  4ICV A;  1Q1O A;  1WX7 A;  1LM8 B;  1V5O A;  4ICU A;  1WH3 A;  2KFK A;  2ZJD A;  3UIN B;  3K9O B;  5JH5 C;  4EKU A;  3DBH I;  3PRZ A;  3ZDT A;  3DQV A;  3Q3J A;  2K8C A;  3K9P B;  4PS8 A;  2HJ8 A;  3H7P B;  3PS6 A;  4AOF A;  2MX2 A;  3DBR I;  4HK2 A;  2MP2 B;  3A9K A;  2BYV E;  3QK0 A;  1WJ6 A;  4CYE A;  2DHZ A;  4BKS A;  3H7S A;  1UH6 A;  2JF5 A;  1IYF A;  1SGH A;  1EUV B;  3AI5 A;  2ZCB A;  3QHT A;  4LJP B;  4W9E A;  3QA8 A;  4HCN B;  5KHQ A;  5AZG A;  3L16 A;  2PE6 B;  3KW5 B;  3MJW A;  3S2A A;  1VD2 A;  2KO3 A;  2HD5 B;  2N9X A;  2WDT B;  3JYU A;  4M0W B;  4XX5 A;  3ZVV A;  4DDI D;  1YX6 B;  4FHJ A;  2MLB A;  2ZPN A;  3T9L A;  3JW0 X;  4GXB A;  5AZH A;  2K1F A;  3WAP A;  3KUC B;  3V6C B;  1WMH B;  2KWU B;  1VCB A;  2K39 A;  3B1L X;  3VTU A;  4GDL A;  3CST A;  4GOC A;  3SU8 X;  3KYD D;  4M8M A;  2GBN A;  3TJP A;  4EUT A;  5D6J B;  3DBS A;  3KUD B;  1P0R A;  3PTF C;  2OOB B;  3AUL A;  2LVP A;  4JQW C;  1WYW B;  2BPS A;  2YVC A;  3QJZ A;  2XK5 B;  1E8X A;  2IYD B;  4MH0 E;  3SD5 A;  3WAM A;  4WWP A;  4AUQ C;  4HLE A;  2AYO B;  4FAD A;  2EKE C;  1F9J A;  4WJP A;  4ZRJ A;  4ZYN A;  3PZD A;  2LAS A;  2K6D B;  5G55 A;  2LVO A;  1XD3 B;  1E7U A;  2IO3 B;  1EF5 A;  4GMV A;  3W1S A;  3A4S C;  3KVF B;  3N32 A;  4FLH A;  3M62 B;  4G0N B;  4DHJ D;  2KC2 A;  1V2Y A;  3R7R A;  3UQA A;  2LD9 A;  5D7G A;  4FA6 A;  2GBJ A;  3DCG A;  4N9F 4;  5BO4 B;  2FUH B;  1YJ1 A;  4K1R B;  4F7Z A;  2KDB A;  4HDQ A;  1H8C A;  4K81 A;  3VTV A;  2WWZ A;  2FCM A;  3B08 A;  3APC A;  4KIK B;  1NI2 A;  1GC6 A;  4EZJ A;  4WWO A;  3ZNG C;  2V3S A;  3N30 A;  4J6I A;  1PQS A;  2PPH A;  1J19 A;  2JRI B;  2KKC A;  2LWP A;  2KDE B;  3TMP B;  3NHE B;  3RUL A;  4AJW A;  3V60 A;  4KSK C;  2CKH B;  2NBU A;  3ZNH B;  4ZRI A;  1UEL A;  2DX5 B;  2IBI B;  3TCA A;  3VXW A;  3DBL I;  2JY6 A;  2GBM A;  1FXT B;  3SDL C;  2J0J A;  2JUO A;  3PSE B;  4B9K A;  3PHW B;  4ANU A;  1WGG A;  4MSM B;  2MBE A;  3QIJ A;  5LXI B;  4BOZ B;  4FHK A;  4RMA A;  3QAQ A;  4W9H A;  3ZTD A;  1WE7 A;  2PEA A;  3ZRF A;  3TBL D;  1ZW7 A;  2K6Q A;  1V81 A;  3V6E B;  2ZVN A;  4G50 A;  1UZX B;  1YX5 B;  4EEW A;  1GC7 A;  4EZK A;  2ZNV B;  2RD0 A;  3NY5 A;  3WIM A;  4IM2 A;  4I6N B;  2KC1 A;  2KTR B;  2C7H A;  3ZDM C;  2NBV B;  4YL8 A;  1QZE A;  4MDK E;  1D3Z A;  2MCN B;  1WJ4 A;  3RUI B;  1WGH A;  1C1Y B;  2GMI C;  4FUL A;  2MW5 A;  4MGI E;  2IO1 B;  4RM8 A;  4MEM A;  1C3T A;  1KLV A;  3AU5 A;  3VAW A;  4WQO B;  4FBJ B;  2N9E B;  3B0A A;  1Q5W B;  3VUX A;  4DHJ B;  1U4A A;  3CF6 E;  2LJ5 A;  4MSQ B;  1UBQ A;  4NJ7 A;  3ZLZ A;  3L10 B;  2IZV B;  2KLC A;  2MBB B;  3ML8 A;  3U8Z A;  5L83 A;  2IY1 B;  3IG3 A;  1LXD A;  1ISN A;  2D11 A;  2Z59 B;  3VQI A;  4K7S A;  4TQ1 A;  3JSV B;  1V9J A;  2NPT A;  4HCP B;  3VUY A;  4GN1 A;  1L2N A;  4W9J A;  1I42 A;  4FJV B;  3PGE A;  3PHX B;  2ZVO A;  2ZZP B;  1WMH A;  2DYM A;  4ASW C;  2MBO A;  3VVW B;  4DK5 A;  2M4N A;  4W9L A;  4JGH B;  4BVU C;  4I6L B;  2NPT B;  1TBE A;  2L76 A;  1V80 A;  2EMS A;  2B3A A;  1V86 A;  2XK5 A;  3DVG X;  1LQB A;  2DAF A;  2A4Z A;  2L8J A;  3ZNI D;  1SIF A;  2A5U A;  2EMT A;  3CSF A;  5AZF A;  3PRE A;  4II2 B;  2BKF A;  4XZ4 A;  2XBB C;  2DYB A;  2RSU A;  4DXA B;  3NOB A;  3QCA A;  2JPH A;  3VFK A;  4A3P A;  4I6P A;  1CMX B;  2NVU I;  2K8B A;  1E8Z A;  2O6V D;  2JRH A;  2LXC A;  1OQY A;  3IBE A;  3KUZ A;  3DVN V;  4TKN A;  4A3O A;  3I3T B;  4HXD A;  4MGZ E;  5GMV A;  2KK8 A;  2VRR B;  1J0G A;  3W1S C;  3QWZ B;  5D2M B;  3PRP B;  2MRP A;  2DZJ A;  2KWC A;  2N7D A;  3APD A;  5DPT A;  5J18 A;  1IPG A;  1Q0W B;  5LXH A;  2LUE A;  2N7E A;  3NZU A;  4B95 A;  3IHP C;  4II3 B;  3SHQ A;  4KIK A;  4F1S A;  1L7Y A;  1WFY A;  2KWV B;  2Z0E B;  4WWN A;  1GNU A;  4NNJ B;  3UF8 A;  4E74 A;  1KOT A;  2ZCC A;  1WXV A;  1E5W A;  2C7M B;  2AL3 A;  4BBN F;  4P7I A;  2J0K A;  3HK0 A;  2KJ6 A;  4IWQ A;  2KFJ A;  5TR5 A;  4MJS B;  2G45 B;  4LDT D;  2FCN A;  4IWO A;  4MM3 A;  3UGB B;  1MG8 A;  2LGY A;  4E3C A;  5CTR C;  1UBI A;  3A33 B;  1UGM A;  2C60 A;  4LJO B;  1WXM A;  3WA0 A;  3H9D A;  1E8Y A;  4DHZ B;  1WM3 A;  3MHS D;  3JVZ X;  5L95 C;  4NJ6 A;  3M95 A;  2KXJ A;  1GG3 A;  2V1Y A;  2ASQ A;  3EEC A;  2LGX A;  2UYZ B;  2AEH A;  5E6P A;  2BWF A;  3DOW A;  4AJY B;  4BKT A;  2I1K A;  1WY8 A;  2DZK A;  2IO2 B;  2MWS B;  3GOE A;  4HJK A;  2CHZ A;  2KLG A;  2O2V B;  2CHX A;  3QX1 A;  2L0T A;  5JHA A;  1E90 A;  3HM3 A;  4BKS D;  2KNB A;  3PLV A;  2BYE A;  3RCZ A;  2FCS A;  3ZTC A;  2ZNV C;  4W9F A;  4HDO A;  3M63 B;  2RR9 A;  5IA7 A;  2LGD A;  2WX1 A;  4KSL C;  3DVG Y;  4W9D A;  2IO0 B;  1WJU A;  2KTR A;  2NCN A;  4WJQ A;  5FR6 A;  3R7Q A;  2KDF B;  5HKH A;  3PRM B;  2M8S A;  3OJ4 B;  3WAN A;  3ZNZ B;  3H1U A;  3V61 A;  3PLU A;  1BT0 A;  2MA9 B;  2KTF A;  2LRW A;  1LFD A;  4TUU A;  1WXA A;  4JIO U;  5CX3 A;  3DVN U;  3ZIM A;  2KJR A;  2KQS A;  2O6V A;  2LRU A;  3APF A;  3N3K B;  1P9D U;  2KJH B;  1M94 A;  2D2Q A;  2CR5 A;  4HVB A;  3OJ3 A;  3BIN A;  1RLF A;  4PS7 A;  3X0W A;  1XQQ A;  3D32 A;  3OLM D;  5JZE B;  5CHW A;  1WJN A;  2G3Q B;  4WAA A;  1WM2 A;  3PT2 B;  2JZZ A;  3QAR A;  2O6V B;  4EZL A;  2FIF A;  3NS8 A;  4IM0 A;  2KAN A;  3WAO A;  2I1J A;  4URK A;  1S3S G;  1YD8 U;  2L0F A;  5DPS A;  1OEY J;  5LLI A;  2BYF A;  3CMM B;  3M3J A;  4BFR A;  3JSV A;  4WJN A;  3OAW A;  3A1Q B;  3AXC A;  4PYU A;  4OVU A;  1WF9 A;  2FAZ A;  4IC7 B;  2MSE D;  3LJ3 A;  1KJT A;  4IM3 A;  2L7R A;  2LVQ A;  4M8N A;  4F8C B;  1RFA A;  2RPQ A;  1V6E A;  3QQ8 B;  4OVV A;  2KD0 A;  3RYT A;  2QHO A;  4LCD E;  1WE6 A;  4NAW B;  4IG7 B;  5C23 A;  1WIA A;  2Z0D B;  2DEN B;  5D94 A;  3RD2 A;  2MQJ A;  1KM7 A;  4ZDV A;  4DHZ E;  4GB9 A;  2DAJ A;  3U30 A;  3UIP B;  1V49 A;  2CS4 A;  4BBN C;  2L00 B;  3NZS A;  4DBG A;  4TV3 A;  4B6W A;  5EDS A;  3A4R A;  1K8R B;  4NQL B;  1RAX A;  2C5L C;  2C9W B;  1TTN A;  4FJZ A;  4W9I A;  2N4F A;  4X57 B;  2CHW A;  3TIX A;  5JHB A;  5IAA C;  4AWJ A;  4JLC A;  2V4L A;  4CO7 A;  1WR6 E;  3W1Y A;  2L05 A;  2WX0 A;  2JVC A;  2W9N A;  4DDG D;  4BKG A;  1WR1 A;  1IP9 A;  2KFK B;  3ONS A;  3V62 A;  2G4S A;  1OTR B;  2DZI A;  3BY4 B;  3R66 C;  3DPD A;  1A5R A;  1G6J A;  2K25 A;  2ZPY A;  2HTH A;  1SE9 A;  4EOY A;  1OEY A;  1EO6 A;  2XEW A;  3L17 A;  2KVR A;  3A9K B;  3L13 A;  1ZGU B;  2KDI A;  1XT9 B;  2JZ3 B;  5E6N A;  4MGY E;  4A20 A;  3GZN I;  2N9P C;  2DYO A;  3DDC B;  4IUM B;  1GUA B;  4G11 A;  3UIO B;  4AP4 C;  2GOW A;  3R3M A;  2BKR B;  3ZRC A;  1NDD A;  3L54 A;  2JWZ A;  4ANW A;  2J0M A;  3EC8 A;  2BGF A;  3KH0 A;  3HM6 X;  3ZO5 B;  3IFW B;  1J8C A;  1T0Y A;  4FN2 A;  4KVG B;  3EFU A;  4ANX A;  4MJS A;  4MEL A;  4GIV A;  2C7N B;  4PS3 A;  2GBR A;  2JXX A;  2BWE S;  3RZF A;  3L0W B;  2KMC A;  3UQB A;  1V5T A;  2MBH A;  3PV1 A;  1UD7 A;  3T8M A;  4GDL B;  4MGK E;  1WI0 A;  1P98 A;  2LZ6 A;  3L08 A;  3H6N A;  4KZC A;  3HHM A;  3RT3 B;  2D10 A;  3TL5 A;  3VHT C;  4KDL B;  1WZ0 A;  3QC8 B;  4JL9 A;  1E7V A;  1JRU A;  2LI5 A;  1WGR A;  3WAL A;  3LDZ E;  3Q3F A;  4NY0 A;  4TQ0 A;  5DPR A;  1Z5S B;  4KV2 A;  2BF8 B;  5J2R A;  2O2V A;  1YQB A;  2LXA A;  2KX0 A;  1H4R A;  2CU1 A;  4FJY A;  2GBK A;  3PPA A;  3ZUN A;  2JT4 B;  2IY0 B;  2FCQ A;  3ECI A;  1OGW A;  2Y5B B;  2AL6 A;  2PE9 A;  1GJZ A;  1P1A A;  4BOS C;  4GDK A;  2KOX A;  5CHV C;  4IW0 A;  2KHW B;  2R2Q A;  4XC2 A;  5KHO A;  2G4D B;  4NQK E;  4KDI C;  4K7W A;  2REX A;  3A9J B;  2NR2 A;  1WX8 A;  4EFO A;  2MBQ A;  2R2O A;  1RRB A;  3IVF A;  3O65 B;  2NBW B;  1S1Q B;  2M0X A;  3PVL A;  2OJR A;  4GDK B;  2M17 A;  2ZEQ A;  1HE8 A;  2HE7 A;  5J17 A;  4KZ0 A;  3U7D A;  4DWF A;  4WJO A;  3X23 A;  1TZ1 A;  5DPW A;  4HWI B;  1AAR A;  1X1M A;  2AWT A;  2D3G A;  2KX3 A;  2N1V A;  4HPM B;  2UWQ A;  4W9K A;  1EF1 A;  2FNJ B;  4PYZ A;  2KN5 A;  1WGD A;  4ANV A;  1WRD B;  2DZM A;  4GSW A;  3EHV A;  3ML9 A;  2L3Z A;  2J7Q B;  4HPL B;  3MTN B;  1I35 A;  4GGQ A;  3P2B A;  4G3X B;  3ZW3 A;  2M1M A;  3VDZ A;  3A9J A;  3A1Q A;  1WXS A;  1Z2M A;  1Y8R C;  1P3Q U;  1ZKH A;  2KQ7 A;  2KZR A;  3KYC D;  4W9G A;  1R4N I;  1WX9 A;  3ZKJ C;  5G2N A;  2FID A;  4RM9 A;  2WYQ A;  1WZ3 A;  2PJH A;  5DCN A;  1WGY A;  4NAW A;  1E8W A;  4GU2 A;  2N1W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...