2GOWA

Solution structure of bc059385 from homo sapiens
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
116
structure length
116
Chain Sequence
SSNVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a membrane-anchored ubiquitin-fold (MUB) protein from Homo sapiens.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords Ubiquitin-like protein 3
total genus 17
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2006-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13881 Rad60-SLD_2 Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2gowA01
2CHXA 5DPTA 5JZEB 2I1JA 4ZYNA 4ICVA 2BYVE 2NBWB 2AYOB 2O6VA 3EFUA 5IAAC 2HTHA 2K6DB 2MBBB 4B9KA 4FJVB 1WY8A 2KC2A 2N9PC 2KK8A 4GIVA 4XX5A 3M62B 5EDSA 2LD9A 5DPSA 3N32A 2QHOA 5C23A 2KJ6A 4M0WB 4AJWA 1LM8B 4PS7A 1SE9A 2IBIB 3AI5A 2KHWB 4DHZB 5D94A 3ENEA 3UINB 2K6QA 1WMHB 2N7EA 4NQLB 3WALA 4HPMB 3ZTCA 2LASA 4NJ6A 3RYTA 2MP2B 2NBUA 3H9DA 2ASQA 2KLCA 3OLMD 4WJOA 4MH0E 3RZFA 2Z0DB 4MSMB 4DK5A 4HPLB 2BF8B 2VRRB 4FJYA 3VUXA 1V86A 1FXTB 2D2QA 5E6NA 5KHQA 4NQKE 4YL8A 2M1MA 2MA9B 3A4SC 1WGHA 2KQSA 4G0NB 4KIKA 1C3TA 4HCNB 2KTFA 2KWVB 3NHEB 2KFKA 1OGWA 4GDLA 2EMSA 3KW5B 3L17A 3VTWA 2LI5A 2JXXA 4GDKB 2W9NA 2V3SA 3N30A 1P1AA 1V49A 3NOBA 1V81A 1SIFA 3RZWC 2G4SA 2KN5A 2LVQA 2AWTA 1LQBA 4K7SA 5BO4B 3U7DA 3QIJA 4EFOA 2L7RA 2LVOA 4HJKA 3T9LA 4DXAB 3QQ8B 1YJ1A 4EEWA 3DPDA 2V4LA 1NDDA 2LUEA 2BWES 3AXCA 2LRWA 4GSWA 1TBEA 2KZRA 3TMPB 4KIKB 3APFA 2XK5A 3L16A 1S1QB 4MDKE 1WMHA 3ZO5B 2PE9A 2ZNVB 3GZNI 2LVPA 5IA7A 2HE7A 2XK5B 5CHFA 3VAWA 1P0RA 4BFRA 2JRHA 2L76A 4LDTB 2FAZA 2DHZA 2FUHB 2M8SA 1IP9A 2KX0A 1RFAA 3QAQA 3VTUA 1VCBA 3PS6A 2LXCA 4IWPA 3WA0A 2K8CA 3ZIMA 1J8CA 4DWFA 2L8JA 2KO3A 1XQQA 4MGIE 2OOBB 2ZPYA 2I1KA 4B6WA 2LGYA 3PRPB 4WJNA 2DX5B 4EZJA 4B95A 4AOFA 3CF6E 4W9CA 1OEYJ 4A20A 2K8BA 4TQ1A 1E7VA 2J0JA 2N1WA 2RSUA 3ZDMC 3PLVA 3M95A 4ANWA 2O2VB 5L83A 3PVLA 3SHQA 1TTNA 1R4NI 1V5TA 2V1YA 2ZCBA 2R2QA 3NS8A 4MJSB 2C9WB 2BKFA 2JRIB 4PYUA 4WJQA 1MG8A 2BGFA 3DVNU 3VUWA 1IPGA 1Q0WB 1UH6A 1V5OA 4FBJB 2BKRB 1L2NA 2KD0A 3SU8X 2J0MA 4E3CA 2L05A 2PE6B 3UIPB 2YLMA 2NBVB 5AZHA 5LXHA 3N3KB 2XBBC 3NY5A 3H1UA 1WM3A 3PT2B 3ZRCA 5CX3A 3HM3A 1LXDA 4K7WA 4GMVA 5AZFA 2LJ5A 2D11A 3IFWB 2D3GA 3R66C 4IG7B 2CS4A 2MP2A 2KANA 3VUYA 2DZKA 2BPSA 2KDFB 3LJ3A 4DDID 1YQBA 3QCAA 2CKHB 3ZLZA 4E71A 3IG3A 3JSVB 5DCNA 3R3MA 2A5UA 1WJ6A 4IUMB 2FIDA 2L0FA 2O2VA 4ANVA 2JVCA 5CHWA 4KVGB 2WWZA 3V6CB 1Q1OA 4WQOB 3HK0A 4ASWC 4G50A 1WZ3A 3ZNGC 2C7HA 3QA8A 3DQVA 2DYBA 2IO1B 2KDEB 1P9DU 1WXMA 1WIAA 1WM2A 2PPHA 4I6PA 2J0KA 3OAWA 1E8WA 2A4ZA 2K8HA 2JF5A 2LGXA 2NR2A 1IYFA 3WAOA 4BOSC 4AUQC 5J18A 1Q5WB 3ALBA 4HLEA 3VFKA 2BWFA 1LFDA 3A9KB 3VQIA 3RCZA 1E8ZA 3UGBB 4WWOA 1C1YB 2KVRA 3EECA 3W1SA 1KM7A 2ZVNA 2JZZA 4G3XB 1L7YA 3HHMA 3X0WA 2KXJA 1H4RA 2CHWA 1EF5A 5JH5C 2IO3B 2FCNA 4HXDA 1WXVA 2KDBA 2R2OA 4N9F4 2KMCA 2B3AA 1PQSA 4K81A 3OJ4B 3UQAA 1E8XA 1GNUA 1WE6A 4PS3A 2XEWA 4TKNA 4BKTA 3DCGA 2RR9A 4GN1A 4KV2A 3PHXB 2LWPA 4EZLA 1HE8A 2AL3A 1XD3B 2N7DA 5G2NA 4DBGA 1WXAA 4K1RB 1Z5SB 4RMAA 4JQWC 2K39A 2L00B 4KSLC 4XC2A 1CMXB 2JUOA 4FN2A 1P98A 2K25A 3L13A 1E7UA 2ZJDA 2N9XA 4AJYB 5JHAA 2CR5A 4ZRJA 2KTRA 4HK2A 4IWOA 5G55A 3HIZA 1GC6A 2NPTA 3B1LX 3H7PB 3PGEA 3PTFC 4NJ7A 2KJHB 1WJ4A 2G4DB 3VDZA 1GJZA 4II2B 2MBHA 1TZ1A 1WX8A 4BBNC 4IM0A 4MGYE 5HKHA 4II3B 5J2RA 2IYDB 4GB9A 3WANA 2WX1A 2M0XA 3JVZX 3PLUA 4FHKA 4GOCA 4MELA 4W9GA 4DDGD 2BYEA 1D3ZA 2DZIA 3ONSA 1RRBA 2LZ6A 2N1VA 1Y8RC 4M8NA 3MJWA 1WI0A 1WGRA 2KC1A 5LXIB 1J0GA 3DOWA 4DHJB 3Q3FA 4I6LB 3TJPA 3PREA 4NY0A 5D7GA 4EZKA 1WGGA 1WX7A 4W9HA 1E5WA 4W9KA 3A33B 1G6JA 2UYZB 2C60A 3BINA 3UIOB 5CTRC 3EHVA 4FA6A 4JIOU 1UD7A 4IM2A 4W9FA 1M94A 1KOTA 1XT9B 1EUVB 2DENB 3UQBA 3A4RA 4GDKA 1EO6A 5LLIA 3CSFA 3TIXA 2KOXA 2GBJA 1WRDB 3TL5A 1WYWB 1V9JA 1YX6B 3L08A 3O65B 1WE7A 3VVWB 4KDIC 3GOEA 4W9IA 4WWPA 3ZTDA 1WR1A 3MTNB 4URKA 1E8YA 2IY0B 2DAJA 5KHOA 1ISNA 2AEHA 2DZJA 4J6IA 1ZGUB 4EKUA 4NNJB 1UBQA 4JGHB 2L0TA 4MEMA 4M8MA 1RLFA 2WX0A 3CSTA 4CO7A 3KUDB 3A9JA 3JYUA 2AL6A 1H8CA 3ML9A 3WAPA 4NAWB 2KFKB 2KTRB 4GDLB 4MSQB 2RGFA 2KMAA 2JY6A 2GBKA 4OVVA 2MBOA 3RD2A 2KNBA 3V6EB 2JWZA 3S2AA 2KJRA 2KQ7A 2JPHA 3H7SA 2MQJA 4FULA 3VHTC 1I35A 4BKSA 4MGKE 1WR6E 3PV1A 3KYCD 2CU1A 4GXBA 5AZGA 3R7QA 3SD5A 5D2MB 3X23A 3ML8A 4DHZE 4CYEA 1GC7A 3AULA 2OJRA 1I42A 2ZEQA 1WZ0A 3RULA 3OJ3A 2YVCA 3DBRI 1U4AA 3A9KA 2N4FA 1R4MI 3ZVVA 3A1QA 4G11A 2WYQA 1WFYA 2KWUB 3B0AA 2JT4B 4WWNA 4LDTD 3PZDA 3DVNV 4BBNF 1NBFC 4KSKC 4JL9A 2KX3A 2NPTB 4LCDE 3QARA 1F9JA 5JHBA 4ICUA 2ZZPB 4F8CB 1QZEA 2N9EB 4KZ0A 1P3QU 4W9DA 2HD5B 3VTVA 2O6VD 4AP4C 4IM3A 3CMMB 3PRZA 1V2YA 4OVUA 1X1MA 3ZNZB 5D6JB 1E90A 1JRUA 2ZVOA 1A5RA 2DAFA 2FCQA 4AWJA 1ZKHA 5AEKB 2KWCA 1UGMA 2G45B 1NI2A 2IO2B 5E6OA 1J19A 4PS8A 3IHPC 4HDOA 2C7NB 3ZNID 2FNJB 2FIFA 2WDTB 3ZNHB 3Q3JA 4FJZA 1EF1A 3V60A 5J17A 4WJPA 4EOYA 3A1QB 4IWQA 5L95C 2IY1B 2KDIA 3M63B 3IVFA 3KH0A 1T0YA 3KVFB 4ANUA 3HM6X 3ZRFA 3KYDD 4W9EA 2FCSA 3DBHI 2Z0EB 3WAMA 2MRPA 3H6NA 4MGZE 1OQYA 3H7PA 3QJZA 2FCMA 1WJNA 4P7IA 3AU5A 5E6PA 4HVBA 1YIWA 4FLHA 3RUIB 4ZRKA 3WIMA 2Y5BB 4W9LA 3VH4B 3P2BA 2G3QB 3DBSA 3ZUNA 3PHWB 4IW0A 5C1ZA 2M17A 2DYMA 1UELA 2PEAA 3DVGX 3RT3B 2MCNB 3ZKJC 2NS5A 1WX9A 4IC7B 4TUUA 2RD0A 2NVUI 4NPNA 2EMTA 1BT0A 4FHJA 4BKSD 3QWZB 3L0WB 1UZXB 3KUCB 4K7UA 1VD2A 4BVUC 3EC8A 3QK0A 4NAWA 3DBLI 3VXWA 2REXA 4KZCA 1WGDA 3MHSD 4I6NB 3U30A 4F1SA 2RPQA 1V80A 2KLGA 1KLVA 4W9JA 4PYZA 2D07B 3JSVA 4GU2A 4KDLB 3W1YA 1WF9A 1YD8U 1SGHA 4LJOB 5FR6A 2BYFA 2DYOA 1GG3A 1OTRB 2MBQA 2M4NA 2JZ3B 2O6VB 3TCAA 3L10B 5DPRA 4TQ0A 2HJ8A 2KKCA 3V61A 4JLCA 2LXAA 1WH3A 3APDA 4HCPB 1GUAB 4FADA 1KJTA 4EUTA 4RM8A 1Z2MA 2GBNA 2IZVB 3NZUA 4CHKA 2MBEA 2ZNVC 3L54A 3IBEA 3U8ZA 1OEYA 2KFJA 3PRMB 3SDLC 3UF8A 4HWIB 2Z59B 3AU4A 3DDCB 3ECIA 3APCA 4BKGA 2L3ZA 3C0RB 3V62A 3PSEB 4GGQA 3TBLD 2GBRA 4E74A 2GMIC 2PJHA 4MM3A 3ZDTA 2IO0B 3BY4B 1UBIA 2LRUA 3VH3B 2EKEC 3W1SC 1WXSA 3K9PB 4LJPB 4X57B 1WGYA 2K1FA 4ZRIA 1AARA 2MWSB 5TR5A 3A9JB 1RAXA 4ANXA 3T8MA 2NCNA 3NZSA 3PPAA 5CHVC 4HDQA 1V6EA 3JW0X 2C5LC 3QX1A 3LDZE 1TGZB 4A3PA 2J7QB 2MX2A 3D32A 4XZ4A 4TV3A 2MSED 2DZMA 1S3SG 3M3JA 2ZCCA 4BOZB 2ZPNA 4DHJD 3QC8B 4F7ZA 1WJUA 4ZDVA 2GBMA 4MJSA 1YX5B 4RM9A 4A3OA 3QHTA 5GMVA 5DPWA 2GOWA 3DVGY 3R7RA 3ZW3A 4WAAA 3B08A 1K8RB 3I3TB 2MLBA 1ZW7A 3KUZA 2UWQA 2D10A 3K9OB 2CHZA 2C7MB 2LGDA 2MW5A
chains in the Genus database with same CATH superfamily
2CHXA 5DPTA 1ZXIA 4HPPA 5EE1A 4XX5A 3U2SC 3M62B 2BT6A 5DPSA 3N32A 2QHOA 4RH6A 3BVGA 1R4MB 2RDGA 1LM8B 4PS7A 4AJWA 4DHZB 3ENEA 2MP2B 1AYFA 2ASQA 3OLMD 4MH0E 4K3BA 1K50A 4DK5A 2BF8B 4FJYA 3ZJUA 2D2QA 5KHQA 1CJEA 4YL8A 3GE8C 3NHEB 1OGWA 3L17A 4WQMA 1NENB 2JXXA 3U52E 3RMKC 1NEKB 1SIFA 2G4SA 4Q2JA 5BO4B 3R2TA 4AQ7A 1I4GA 4DXAB 3QQ8B 1YJ1A 3C19A 3DPDA 1PYWD 4EEWA 1OQQA 2V4LA 2LRWA 1XCTL 4BAXA 1SXTA 2XK5A 3ABVB 1S1QB 1J7CA 2PE9A 2WXHA 2LVPA 5CHFA 1P0RA 1L4ZB 2FUHB 2LXCA 2GI9A 3DBRB 2DWQA 1T5XD 2WXJA 3Q3OC 1J8CA 1D6EC 3Q6BA 2KO3A 3RN9C 1JQ4A 2PMVA 4MGIE 2OOBB 2ZPYA 2I1KA 4B6WA 4B95A 4AOFA 4W9CA 1QKZA 1VDVA 2RMMA 4TQ1A 2J0JA 3NS1A 3PLVA 3IAS1 5L83A 3SHQA 1TTNA 1R4NI 4MJSB 4KX6B 1JWAD 4WJQA 1MG8A 2BGFA 1WGKA 1WWTA 2IJ0A 1L2NA 2WXNA 4JWUC 1PFDA 2WXOA 1V97A 4P1CC 1NVID 2J0MA 2BS4B 3UIPB 5LXHA 1XEEA 1L6UA 2LJ5A 1C77A 1EWYC 1P7FA 4OZCA 1NI3A 3R66C 2KANA 2BPSA 4DDID 5TSSA 4E71A 3JSVB 3R3MA 2SAKA 2A5UA 2V9HA 5G5HA 4IUMB 1SSNA 4ANVA 2MEKA 2JVCA 5CHWA 2G1EA 1EM7A 2QILA 4G50A 2C7HA 2DYBA 1P9DU 3AE5B 5T8IA 1WXMA 1WIAA 3NG0A 1E8WA 2A4ZA 2K8HA 2LGXA 1XLPA 3VFKA 1LFDA 2KQ4X 3LB8C 4KGTA 1XCQL 4WWMA 3HHMA 1C79A 1EU3A 1KF6B 5BYRA 2FCNA 4HXDA 2KDBA 3AMZA 3ZYYX 3NVYA 3UI3A 3Q8AA 4K81A 3UQAA 3VR8B 1WE6A 3Q8CA 2XEWA 2MJDA 4BKTA 1E9MA 3TEXA 2KWDA 2ACZB 2N7DA 5G2NA 2K39A 4XC2A 4NZLB 1CMXB 1RYJA 2XN9C 2X38A 1P98A 3Q69A 5JHAA 2LMCA 3P63A 1KLGD 2CR5A 4HK2A 4IWOA 4M01A 1GC6A 3PGEA 1GJZA 3LYYA 1N5WA 4II2B 1GB1A 2GB1A 4BBNC 4HEA1 3IT6B 5HKHA 2WX1A 4GOCA 4W9GA 4DDGD 2XNAC 2DZIA 1RRBA 5BYSA 4M8NA 3MJWA 1WGRA 3Q3FA 1TYGB 4I6LB 1UWMA 2I38A 1GOZA 4NY0A 1TS3A 1WGGA 1E5WA 4JPSA 2BBCA 3A33B 1R4NB 2UYZB 1J7AA 3BINA 2CJNA 5CTRC 2L1AA 1D4BA 1UD7A 2NMQA 2DENB 3SEBA 3UQBA 1BXTA 1EO6A 2GBJA 1WRDB 3IT4B 3TL5A 1WE7A 3Q3NC 1L4DB 4W9IA 3H8HA 4WWPA 3RI7C 4URKA 1E8YA 2IY0B 2BS3B 1E0ZA 2AEHA 3IXSA 4J6IA 3I63C 4EKUA 2JX5A 2L0TA 4M8MA 3CSTA 4CO7A 3KUDB 2KFKB 2KMAA 2GBKA 5HI1A 3RNAC 3S2AA 3VHTC 2ZW1A 1FRDA 1P7EA 5AZGA 3GB1A 3RNFC 1I42A 2RDHA 3ZVVA 4G11A 2KWUB 3B0AA 3AE1B 1FMAD 1YNTE 2K5PA 1QZEA 4JE3B 4KZ0A 4IM3A 5HG2A 5D6JB 2ZVOA 2FCQA 1J7BA 5AEKB 1SEBD 1UGMA 1C78A 2IO2B 4XDCA 3IHPC 2D3CA 3DHGC 4A90A 4WH4A 4EOYA 3IVFA 1T0YA 3KVFB 5D3DA 3ZRFA 5AUKA 3DBHI 1L5PA 1E7PB 2RDBC 4IKGA 2HTME 1ZUD2 1A70A 5BMHA 1XF5L 1YIWA 4ZRKA 3WIMA 2Y5BB 4RGNA 3VH4B 2PVOD 2PEAA 3ZKJC 1BT0A 1UZXB 2Y3AA 1VD2A 4BVUC 2X8XX 3EC8A 3QK0A 1MPEA 3DBLI 4KZCA 1WGDA 4F1SA 2RPQA 1QILA 4KDLB 1SGHA 3P4QB 2V0GA 2BYFA 2DYOA 1OTRB 3EA6A 3TCAA 2UU7A 2HJ8A 2KKCA 3VRAB 2BQQA 3APDA 4HCPB 4JWSC 1KJTA 4RM8A 2MBEA 3IBEA 5IOIA 1BMLC 1OEYA 2KFJA 4XDDA 2L3ZA 1L0VB 4C80A 2QSDA 4HKQA 3AEFB 4E74A 1D5MC 1UBIA 4LJPB 4X57B 2K1FA 4DXGA 2AX5A 3NVZA 2WXRA 4ANXA 1TJEA 1HTOA 2C5LC 3QX1A 1TY2A 4YT0B 2LGIA 4LNOA 5H92C 1VJKA 2HDEA 1WJUA 4ZDVA 4MJSA 2MJEA 5DPWA 2GOWA 1QF6A 3R7RA 3N9YC 3ZW3A 2JYEA 3B08A 3Q14C 2INDC 3KQ4A 1EU4A 2D10A 2WP9B 1YJJA 2LGDA 4LNNA 1ET9A 2K3UA 2BYVE 3EFUA 2AYOB 2V3NA 3AV8A 2B76B 4FJVB 2N9PC 2KC2A 4GIVA 5EDSA 2LGSA 2KJ6A 1V1PB 4IDIA 2Y5PA 5D94A 2QJLA 1I4PA 4NQLB 3SFDB 2KMMA 4RCOA 1C76A 3H9DA 3RZFA 2Z0DB 4MSMB 2WLBA 3VUXA 1V86A 1XLNA 1MI0A 4NQKE 3TSSA 1C3TA 2M1MA 4BZAA 3A4SC 4G0NB 5C3JB 2ICIA 1F1HA 2KWVB 4GDLA 4M02A 4R3DA 2CU3A 2VH1A 2W9NA 2V3SA 2JWUA 1CZPA 3NOBA 2KN5A 3W5UB 2AWTA 1DOIA 3U7DA 2LVOA 1YN4A 4HJKA 3T9LA 1NDDA 2LUEA 2IGDA 1TBEA 2KZRA 1WMHA 3ZO5B 5IA7A 2XK5B 4LDTB 2M8SA 2BW2A 4IWPA 3WA0A 5FKAC 2L8JA 1VZ6A 3SFEB 3AEBB 5IP4D 3AB5A 2LGYA 3ZXRA 2DX5B 2WS3B 4A20A 1DOYA 2VZKB 2K8BA 1E7VA 2KN4A 1F2RI 1STEA 3ZDMC 4ANWA 3PVLA 2N7JA 2R2QA 3AE7B 4DXFA 2C9WB 2BKFA 3VUWA 4KKIA 1IPGA 2FUG1 1Q0WB 1V5OA 4FBJB 2BKRB 4YWGG 3W2DA 4CQNA 2RPVA 3HVZA 2YLMA 1N63A 2NBVB 2EELA 3N3KB 3NY5A 3GE3C 3H1UA 5CX3A 4P1BC 3BVMA 4K7WA 4GMVA 3FC4A 2D11A 2PKOA 2D3GA 3IFWB 4IG7B 2MP2A 1N60A 2KDFB 1YQBA 3QCAA 2CKHB 2NTSA 3IG3A 1WJ6A 2FIDA 2O2VA 4KVGB 3V6CB 1BUIC 1Q1OA 4ASWC 3HK0A 1HTQA 1WZ3A 2IO1B 1C4CA 3AEEB 4XYCA 2PPHA 1ENFA 2NR2A 5EE0A 2HJ1A 2LHDA 4AUQC 3ALBA 4YTMB 2BWFA 3VQIA 3UGBB 4YTPB 3WCQA 2JZZA 3ZXVA 2MHJA 2WXFA 3AE3B 2D5GA 5JH5C 4N9F4 2KMCA 2WXPA 5MPOA 4S17A 2J42A 4TKNA 3DCGA 4MM3B 5EE9A 2WGSA 1ROEA 4RMAA 2JYTA 1FNWA 2MJ3A 4HROA 1YQ3B 3I5JC 2N9XA 1TS4A 2WQYB 1ET6A 2G9HD 3B1LX 1I7HA 1WJ4A 2MBHA 1TZ1A 1WX8A 2H89B 2EKIA 2WXMA 5J2RA 4S0RA 3TEYA 2IYDB 2LJIA 3JVZX 3ZGZA 2BYEA 3ONSA 2N1VA 1Y8RC 5FR3A 1JWBD 2KC1A 5BYQA 3B2GA 3TJPA 3GZNB 3DHHC 3CWIA 3PREA 2QC8A 4EZKA 3ZJVA 4QAYA 4W9KA 2R61A 3FILA 2J53A 2W3RA 3UIOB 3EHVA 1QOAA 2N9LA 4IM2A 4W9FA 1M94A 1TS5A 1KOTA 1XT9B 3A4RA 1IUEA 4GDKA 5LLIA 3CSFA 1K53A 2KOXA 1WYWB 3AE8B 1YX6B 3L08A 3O65B 3VVWB 1VLBA 2JQRB 2WX0A 1OFFA 2OJWA 3A9JA 2KTRB 3Q8FA 4MACA 2KNBA 2KQ7A 2MQJA 1I35A 3ZJTA 2L32A 4RGTA 1HEZE 1SE3A 1K51A 3R7QA 5D2MB 3X23A 3BIID 2OJRA 3FILB 1MHXA 1WZ0A 3DBRI 2GLSA 2WYQA 4YSZB 4WWNA 3PZDA 3DBLB 4KSKC 4LCDE 3RNCC 4ICUA 4F8CB 5HHDG 3E9SA 2N9EB 2HD5B 4AP4C 3Q8BA 1A5RA 3RPFC 4AWJA 1C4AA 1SE2A 2G45B 5E6OA 3N1YC 4C4VA 3W9CB 3BYTB 2C7NB 4HDOA 3ZNID 1EF1A 3V60A 1HQRD 4WJPA 3A1QB 3M63B 3KH0A 4ANUA 4A55A 3HM6X 1SBBB 1SE4A 4W9EA 2FCSA 2Z0EB 4MGZE 1WJNA 5E6PA 4HVBA 3OWEB 3AE4B 2G3QB 1TKEA 4IW0A 2M17A 2DYMA 2VZKD 3BYYB 1WYGA 3DVGX 4ZYSA 1WX9A 4TUUA 1JCKB 2EMTA 4FHJA 1FNVA 4BKSD 5E6JA 3KUCB 3EUB2 4K7UA 1HZ6A 1UUPA 4L2YA 4NAWA 4I6NB 4C4VB 2QDFA 4M0WA 1WF9A 1YD8U 2LUMA 5FR6A 2WU2B 2JZ3B 2O6VB 4K3CA 1XXGA 3V61A 4JLCA 1NYQA 2IGGA 2LXAA 3L4PA 1HXYD 4FADA 4EUTA 1Z2MA 4L1BA 3U4EG 1ZP0B 4HWIB 2Z59B 3IAM1 1ZDXA 3C0RB 3V62A 3PSEB 3TBLD 2GBRA 2PJHA 4MM3A 1EWCA 1N5XA 4RF0A 2J52A 2E6XA 3ZDTA 3BY4B 2LRUA 1AARA 2MWSB 1I4HA 5TR5A 3A9JB 3V05A 4XWTA 1NYRA 4EE2A 3TEZA 4WURA 4US8A 1PGAA 2MX2A 3D32A 4XZ4A 4TV3A 2DZMA 2BB5A 4BOZB 3R8BA 2ZPNA 4C7YA 4F7ZA 2M56B 2GBMA 3Q2AC 4RM9A 3MC9A 3PZ8A 3DVGY 4PT5A 2W82A 4ZRQA 3I3TB 1RFKA 4KKJA 3BZDB 3T8MA 2C7MB 2MW5A 3MJ5A 5JZEB 1TIFA 2I1JA 1YMHE 5IAAC 2K6DB 2MBBB 2WXKA 4B9KA 4XE0A 1UWXA 2KACA 2KK8A 5C23A 3TUOA 2KHWB 4ZHPA 3UINB 5GXGB 1WMHB 2N7EA 3WALA 4HPMB 3ZTCA 2LASA 3RYTA 2NBUA 4WJOA 2KLCA 2WDQB 1F2RC 4HPLB 2VRRB 1B9RA 1FXTB 5E6NA 2DLBA 4PK1A 2KQSA 1SJED 4HCNB 2KTFA 2BB6A 3RZWC 1V81A 2LVQA 2ON8A 2LFIA 1TZOA 3QIJA 4EFOA 2L7RA 1T0SC 1ZXHA 2BWES 2E3TA 3AXCA 1PUTA 4GSWA 4ITKA 3L16A 1UF0A 2BYTA 2ZNVB 3AECB 3GZNI 3O13A 1ESFA 3VAWA 2JRHA 2FAZA 1IP9A 1RFAA 1JWSD 3VTUA 1VCBA 3EGRA 3DBHB 4ZOHC 2LHEA 3ZIMA 2M19A 1JROA 3AM9A 1XQQA 4MH8A 4EZJA 1OEYJ 2SEBD 2N1WA 2O2VB 3OG5A 4ARIA 2JZPA 1B1ZA 2ZCBA 2D3BA 2JRIB 2YEPB 1UH6A 2WNMA 2L83A 2L05A 2PE6B 1IBXA 5AZHA 2XBBC 1V1PA 1WM3A 3HM3A 1LXDA 1YN5A 2N9KA 3LJ3A 4RNAA 1XLOA 2L0FA 1F77A 1Q10A 4WQOB 3QA8A 3DQVA 4MT5A 4RGOS 1WM2A 4USAA 3OAWA 2KAJA 4KGSA 4BOSC 1C4PA 1Y56A 1E8ZA 2KVRA 3W1SA 1KM7A 1YOVB 3GP7A 3X0WA 2IO3B 2FBWB 1WXVA 2R2OA 1PQSA 1E8XA 1GNUA 2J4XA 1TS2A 1FXIA 4KV2A 3PHXB 1HE8A 2AL3A 3MHZA 5BMIA 4DBGA 1WXAA 1SJHD 4JQWC 4KSLC 3AE6B 4FN2A 3ETRA 2ZJDA 4O1NA 4AJYB 4ZRJA 1VZ7A 2KTRA 4RFBA 3W5VB 5G55A 3H7PB 3PTFC 4HRSA 4NJ7A 2G4DB 2AQ2B 1QLBB 4IM0A 2K9XA 4MGYE 2KVZA 4II3B 3I9V1 4GB9A 4A8XC 2M0XA 1XO3A 2DBYA 3PLUA 4FHKA 2LZ6A 2CJOA 1YQ4B 4JX1C 1J0GA 3ZQ4A 1KH0A 3KWLA 1D5ZC 1WX7A 3P4PB 5D7GA 2KT7A 2JU6X 1G6JA 4FA6A 4JIOU 4B0MA 1E10A 2PW9A 1ACCA 4YSYB 3B9JA 3TIXA 1V9JA 4ZRPA 2LEKA 4KDIC 3GOEA 3ZTDA 5KHOA 2WDRB 2DZJA 1ZGUB 4NNJB 1UBQA 4MEMA 1JMLA 1RLFA 1T0QC 1IGCA 3ML9A 4NAWB 4GDLB 2H88B 1MG4A 2MBOA 5FK9C 4FULA 5AUIA 1WR6E 4GXBA 2CU1A 2TSSA 3KWVA 4CYEA 4H2AA 3AULA 3RULA 3OJ3A 2YVCA 1U4AA 1R4MI 1N6ZA 3HRDD 1T0RC 1WFYA 4LDTD 4TSSA 1WRIA 1ZOYB 4BBNF 1CK1A 2WHIA 4ACFA 2KX3A 2NPTB 4P6VF 3QARA 2N0SB 2BVCA 2D3AA 2O6VD 3CMMB 3PRZA 1K52A 1FIQA 3FKYA 1X1MA 3ZNZB 1E90A 1JRUA 2DAFA 1ZKHA 2KWCA 1T6BX 1NI2A 1J19A 4PS8A 2FNJB 3ZNHB 5J17A 4FJZA 4TMAB 2IY1B 2KDIA 1WSPA 1C9FA 4NJCA 1CQVA 2MRPA 3WAMA 4XWWA 3H6NA 1OQYA 1QOBA 4P7IA 3NVVA 5IO9A 2K0PA 3RUIB 1FD6A 1XLQA 3P2BA 5C1ZA 1R7SA 1UELA 3NJTA 2NS5A 2NVUI 4YTNB 1I4QA 3L0WB 4KGRA 4LK0M 3VXWA 2REXA 3MHSD 1KLVA 4N58A 3P4RB 1ZDVA 2D07B 3JSVA 3W1YA 3DWMA 1GG3A 2MH7A 3DWGC 2MBQA 3AE2B 4UDUC 1F0ZA 2FE8A 1KRHA 3L10B 1QOGA 5DPRA 2IPKD 2IZVB 2GBNA 2WU5B 3NZUA 2ZNVC 3U8ZA 3PRMB 4NAMA 3SDLC 3UF8A 3AU4A 3APCA 1PGBA 3LXFA 4OVZA 1T3QA 1JRPA 4GGQA 1UGJA 2GMIC 3PO0A 2I2YA 3VH3B 2EKEC 4RGMA 1KFYB 3K9PB 4L23A 3KLSX 4A9AA 2AQ3B 1RWSA 2ZW0A 3T3NA 3NZSA 2K22A 3R2IA 4HDQA 1OQRA 4J3OD 4OHJA 4US9A 1TGZB 4A3PA 2J7QB 3AEGB 1GAQB 2MSED 1QOFA 3M3JA 2ZCCA 4FXCA 1AW7A 4DHJD 4LNFA 3Q8EA 3QHTA 1JWMD 2VH2A 3FAHA 2MLBA 1ZW7A 3J9CA 3KUZA 2UWQA 1FRRA 2CHZA 1E6EB 1JALA 2MA9B 3AE9B 4ZYNA 3MC8A 4ICVA 2NBWB 2O6VA 3P42A 2HTHA 4B0EA 1PGXA 1WY8A 5BMGA 4WAFA 1V8CA 2LD9A 1KTKA 4M0WB 4P16A 1FPYA 1SE9A 2IBIB 3AI5A 3NRZA 2K6QA 1LGRA 2JSVX 3B2FA 4NJ6A 3VR9B 1MJDA 1FCCC 1ZPSA 3BWUD 2Q5WD 4KIKA 1WGHA 2KFKA 3VTWA 2EMSA 3KW5B 3RNBC 2LI5A 4GDKB 1RM6C 1TKGA 2W3SA 3GS2A 3N30A 1P1AA 1V49A 4C00A 1LQBA 4K7SA 4HKZE 1JWUD 3TMPB 4KIKB 3APFA 4MDKE 1YN3A 2INNE 2OHFA 2HE7A 1DOXA 1VZ8A 4BFRA 2L76A 4IOIE 2DHZA 2KX0A 3QAQA 3PS6A 4ZHOA 3VRBB 2K8CA 4A6QA 4DWFA 3PRPB 3E56A 4WJNA 3CF6E 1UNSA 2QCZA 2RSUA 2ONQA 4LNKA 3M95A 2IDYA 3BVZA 1V5TA 3NS8A 2V1YA 2KYWA 1L0XB 4PYUA 2Y5CA 3DVNU 4YXDB 1FXAA 1YJIA 2PLPA 3DHIC 2KD0A 1HA5A 3SU8X 1GB4A 4E3CA 2V4IB 2YEPF 2WXLA 3PT2B 2JXTA 4GLSC 4OZBA 3ZRCA 3PZ7A 4OZAA 1IBXB 5AZFA 4DQOC 5D3IB 2CS4A 1PDXA 3VUYA 2DZKA 1DYQA 2WXQA 3ZLZA 1TT5B 5DCNA 2IGHA 4AS1A 2WWZA 2BS2B 3ZNGC 2KDEB 4HJGE 1SB3C 1N62A 4I6PA 2J0KA 2JF5A 1IYFA 3WAOA 3AEAB 4LNIA 5J18A 1Q5WB 4HLEA 3A9KB 2WXGA 3RCZA 1MFWA 4WWOA 1C1YB 4M00A 3HVDA 1L0YB 3EECA 2Z8LA 3TEWA 2ZVNA 4G3XB 1L7YA 5EE3A 2KXJA 1H4RA 2CHWA 1EF5A 3NVWA 3N1ZC 2B3AA 3OJ4B 4PS3A 3SR6A 5C2TB 2RR9A 4GN1A 2LWPA 4EZLA 1XD3B 4K1RB 1Z5SB 2L00B 5IN7A 1MVKA 2JUOA 4C56C 2PVGC 3N20C 2K25A 3L13A 1E7UA 2INPE 3RNEC 3HIZA 2NPTA 2KJHB 3VDZA 2BTEA 3WANA 3P4SB 4MELA 1D3ZA 2W55A 3MC0B 1WI0A 3N1XC 1I4XA 5LXIB 4LTUA 3DOWA 3MP9A 4DHJB 5IKCM 3Q3MC 1V1OA 4W9HA 1MHHE 2QMTA 2GRIA 2C60A 2OEDA 1EUVB 1FCLA 5G5GA 1JW9D 3U7ZA 1VR9A 3AH7A 1QQRA 1L6VA 1FFUA 3I57A 3T3OA 1WR1A 3MTNB 2DAJA 1ISNA 3BK2A 1AWDA 4JGHB 1WXQA 3JYUA 2AL6A 1H8CA 3WAPA 2WXIA 4MSQB 2RGFA 2JY6A 1FEHA 4OVVA 3RD2A 3V6EB 2JWZA 2KJRA 3H7SA 2JPHA 4MGKE 1FM0D 3PV1A 3KYCD 3SD5A 3ML8A 4DHZE 1GC7A 2ZEQA 1I4RA 1GPXA 3A9KA 2N4FA 3A1QA 4D2KA 2JT4B 3DVNV 1NBFC 4LLGM 4JL9A 2L52A 1F9JA 1SIJA 5JHBA 1FFVA 2ZZPB 1P3QU 4W9DA 3VTVA 3NUHB 4N59A 1V2YA 4OVUA 1IGDA 4OW0A 3EFCA 5LNK1 4XGAB 4YSXB 3AN1A 2WDTB 2FIFA 3Q3JA 4C7ZA 4IWQA 5L95C 2V3PA 1LO5D 3KYDD 4N6EB 1FNUA 3H7PA 3QJZA 2FCMA 3RFZB 3AU5A 4FLHA 4W9LA 3ZUNA 3DBSA 3PHWB 1M4VA 2DNFA 3RT3B 2MCNB 4IC7B 2NTTA 2RD0A 4NPNA 1ZE3D 1SF0A 3QWZB 2AQ1B 5I4DA 1D5XC 2W54A 2INCC 1HZ5A 3U30A 1V80A 2KLGA 4W9JA 4ARCA 4PYZA 3AEDB 3CIRB 4GU2A 4LJOB 3V3XA 2M4NA 4TQ0A 1WH3A 1GUAB 4RF1A 4CHKA 3L54A 2PTLA 2QEJC 1QT9A 1DGJA 3DDCB 3ECIA 4BKGA 5H8YE 2WDVB 1N61A 2M0AA 2IO0B 3W1SC 1VRAB 1WXSA 1WGYA 3HUIA 4ZRIA 1FO4A 2QIEB 3URYA 1RAXA 2NCNA 3PPAA 3MFGA 3NZ3A 5HFYA 5CHVC 1V6EA 3JW0X 3LDZE 4WIPA 5JXVA 1AN8A 3RNGC 3P1MA 1S3SG 2PIAA 3QC8B 1YX5B 4A3OA 5GMVA 1TY0A 4REZA 2KDMA 4WAAA 1F52A 1KLUD 3C8YA 1TKYA 1K8RB 3BK1A 3K9OB 4BKSA
chains in the Genus database with same CATH topology
2CHXA 5DPTA 5JZEB 2I1JA 4ZYNA 4ICVA 2BYVE 2NBWB 2AYOB 2O6VA 3EFUA 5IAAC 2HTHA 2K6DB 2MBBB 4B9KA 4FJVB 1WY8A 2KC2A 2N9PC 2KK8A 4GIVA 4XX5A 3M62B 5EDSA 2LD9A 5DPSA 3N32A 2QHOA 5C23A 2KJ6A 4M0WB 4AJWA 1LM8B 4PS7A 1SE9A 2IBIB 3AI5A 2KHWB 4DHZB 5D94A 3ENEA 3UINB 2K6QA 1WMHB 2N7EA 4NQLB 3WALA 4HPMB 3ZTCA 2LASA 4NJ6A 3RYTA 2MP2B 2NBUA 3H9DA 2ASQA 2KLCA 3OLMD 4WJOA 4MH0E 3RZFA 2Z0DB 4MSMB 4DK5A 4HPLB 2BF8B 2VRRB 4FJYA 3VUXA 1V86A 1FXTB 2D2QA 5E6NA 5KHQA 4NQKE 4YL8A 2M1MA 2MA9B 3A4SC 1WGHA 2KQSA 4G0NB 4KIKA 1C3TA 4HCNB 2KTFA 2KWVB 3NHEB 2KFKA 1OGWA 4GDLA 2EMSA 3KW5B 3L17A 3VTWA 2LI5A 2JXXA 4GDKB 2W9NA 2V3SA 3N30A 1P1AA 1V49A 3NOBA 1V81A 1SIFA 3RZWC 2G4SA 2KN5A 2LVQA 2AWTA 1LQBA 4K7SA 5BO4B 3U7DA 3QIJA 4EFOA 2L7RA 2LVOA 4HJKA 3T9LA 4DXAB 3QQ8B 1YJ1A 4EEWA 3DPDA 2V4LA 1NDDA 2LUEA 2BWES 3AXCA 2LRWA 4GSWA 1TBEA 2KZRA 3TMPB 4KIKB 3APFA 2XK5A 3L16A 1S1QB 4MDKE 1WMHA 3ZO5B 2PE9A 2ZNVB 3GZNI 2LVPA 5IA7A 2HE7A 2XK5B 5CHFA 3VAWA 1P0RA 4BFRA 2JRHA 2L76A 4LDTB 2FAZA 2DHZA 2FUHB 2M8SA 1IP9A 2KX0A 1RFAA 3QAQA 3VTUA 1VCBA 3PS6A 2LXCA 4IWPA 3WA0A 2K8CA 3ZIMA 1J8CA 4DWFA 2L8JA 2KO3A 1XQQA 4MGIE 2OOBB 2ZPYA 2I1KA 4B6WA 2LGYA 3PRPB 4WJNA 2DX5B 4EZJA 4B95A 4AOFA 3CF6E 4W9CA 1OEYJ 4A20A 2K8BA 4TQ1A 1E7VA 2J0JA 2N1WA 2RSUA 3ZDMC 3PLVA 3M95A 4ANWA 2O2VB 5L83A 3PVLA 3SHQA 1TTNA 1R4NI 1V5TA 2V1YA 2ZCBA 2R2QA 3NS8A 4MJSB 2C9WB 2BKFA 2JRIB 4PYUA 4WJQA 1MG8A 2BGFA 3DVNU 3VUWA 1IPGA 1Q0WB 1UH6A 1V5OA 4FBJB 2BKRB 1L2NA 2KD0A 3SU8X 2J0MA 4E3CA 2L05A 2PE6B 3UIPB 2YLMA 2NBVB 5AZHA 5LXHA 3N3KB 2XBBC 3NY5A 3H1UA 1WM3A 3PT2B 3ZRCA 5CX3A 3HM3A 1LXDA 4K7WA 4GMVA 5AZFA 2LJ5A 2D11A 3IFWB 2D3GA 3R66C 4IG7B 2CS4A 2MP2A 2KANA 3VUYA 2DZKA 2BPSA 2KDFB 3LJ3A 4DDID 1YQBA 3QCAA 2CKHB 3ZLZA 4E71A 3IG3A 3JSVB 5DCNA 3R3MA 2A5UA 1WJ6A 4IUMB 2FIDA 2L0FA 2O2VA 4ANVA 2JVCA 5CHWA 4KVGB 2WWZA 3V6CB 1Q1OA 4WQOB 3HK0A 4ASWC 4G50A 1WZ3A 3ZNGC 2C7HA 3QA8A 3DQVA 2DYBA 2IO1B 2KDEB 1P9DU 1WXMA 1WIAA 1WM2A 2PPHA 4I6PA 2J0KA 3OAWA 1E8WA 2A4ZA 2K8HA 2JF5A 2LGXA 2NR2A 1IYFA 3WAOA 4BOSC 4AUQC 5J18A 1Q5WB 3ALBA 4HLEA 3VFKA 2BWFA 1LFDA 3A9KB 3VQIA 3RCZA 1E8ZA 3UGBB 4WWOA 1C1YB 2KVRA 3EECA 3W1SA 1KM7A 2ZVNA 2JZZA 4G3XB 1L7YA 3HHMA 3X0WA 2KXJA 1H4RA 2CHWA 1EF5A 5JH5C 2IO3B 2FCNA 4HXDA 1WXVA 2KDBA 2R2OA 4N9F4 2KMCA 2B3AA 1PQSA 4K81A 3OJ4B 3UQAA 1E8XA 1GNUA 1WE6A 4PS3A 2XEWA 4TKNA 4BKTA 3DCGA 2RR9A 4GN1A 4KV2A 3PHXB 2LWPA 4EZLA 1HE8A 2AL3A 1XD3B 2N7DA 5G2NA 4DBGA 1WXAA 4K1RB 1Z5SB 4RMAA 4JQWC 2K39A 2L00B 4KSLC 4XC2A 1CMXB 2JUOA 4FN2A 1P98A 2K25A 3L13A 1E7UA 2ZJDA 2N9XA 4AJYB 5JHAA 2CR5A 4ZRJA 2KTRA 4HK2A 4IWOA 5G55A 3HIZA 1GC6A 2NPTA 3B1LX 3H7PB 3PGEA 3PTFC 4NJ7A 2KJHB 1WJ4A 2G4DB 3VDZA 1GJZA 4II2B 2MBHA 1TZ1A 1WX8A 4BBNC 4IM0A 4MGYE 5HKHA 4II3B 5J2RA 2IYDB 4GB9A 3WANA 2WX1A 2M0XA 3JVZX 3PLUA 4FHKA 4GOCA 4MELA 4W9GA 4DDGD 2BYEA 1D3ZA 2DZIA 3ONSA 1RRBA 2LZ6A 2N1VA 1Y8RC 4M8NA 3MJWA 1WI0A 1WGRA 2KC1A 5LXIB 1J0GA 3DOWA 4DHJB 3Q3FA 4I6LB 3TJPA 3PREA 4NY0A 5D7GA 4EZKA 1WGGA 1WX7A 4W9HA 1E5WA 4W9KA 3A33B 1G6JA 2UYZB 2C60A 3BINA 3UIOB 5CTRC 3EHVA 4FA6A 4JIOU 1UD7A 4IM2A 4W9FA 1M94A 1KOTA 1XT9B 1EUVB 2DENB 3UQBA 3A4RA 4GDKA 1EO6A 5LLIA 3CSFA 3TIXA 2KOXA 2GBJA 1WRDB 3TL5A 1WYWB 1V9JA 1YX6B 3L08A 3O65B 1WE7A 3VVWB 4KDIC 3GOEA 4W9IA 4WWPA 3ZTDA 1WR1A 3MTNB 4URKA 1E8YA 2IY0B 2DAJA 5KHOA 1ISNA 2AEHA 2DZJA 4J6IA 1ZGUB 4EKUA 4NNJB 1UBQA 4JGHB 2L0TA 4MEMA 4M8MA 1RLFA 2WX0A 3CSTA 4CO7A 3KUDB 3A9JA 3JYUA 2AL6A 1H8CA 3ML9A 3WAPA 4NAWB 2KFKB 2KTRB 4GDLB 4MSQB 2RGFA 2KMAA 2JY6A 2GBKA 4OVVA 2MBOA 3RD2A 2KNBA 3V6EB 2JWZA 3S2AA 2KJRA 2KQ7A 2JPHA 3H7SA 2MQJA 4FULA 3VHTC 1I35A 4BKSA 4MGKE 1WR6E 3PV1A 3KYCD 2CU1A 4GXBA 5AZGA 3R7QA 3SD5A 5D2MB 3X23A 3ML8A 4DHZE 4CYEA 1GC7A 3AULA 2OJRA 1I42A 2ZEQA 1WZ0A 3RULA 3OJ3A 2YVCA 3DBRI 1U4AA 3A9KA 2N4FA 1R4MI 3ZVVA 3A1QA 4G11A 2WYQA 1WFYA 2KWUB 3B0AA 2JT4B 4WWNA 4LDTD 3PZDA 3DVNV 4BBNF 1NBFC 4KSKC 4JL9A 2KX3A 2NPTB 4LCDE 3QARA 1F9JA 5JHBA 4ICUA 2ZZPB 4F8CB 1QZEA 2N9EB 4KZ0A 1P3QU 4W9DA 2HD5B 3VTVA 2O6VD 4AP4C 4IM3A 3CMMB 3PRZA 1V2YA 4OVUA 1X1MA 3ZNZB 5D6JB 1E90A 1JRUA 2ZVOA 1A5RA 2DAFA 2FCQA 4AWJA 1ZKHA 5AEKB 2KWCA 1UGMA 2G45B 1NI2A 2IO2B 5E6OA 1J19A 4PS8A 3IHPC 4HDOA 2C7NB 3ZNID 2FNJB 2FIFA 2WDTB 3ZNHB 3Q3JA 4FJZA 1EF1A 3V60A 5J17A 4WJPA 4EOYA 3A1QB 4IWQA 5L95C 2IY1B 2KDIA 3M63B 3IVFA 3KH0A 1T0YA 3KVFB 4ANUA 3HM6X 3ZRFA 3KYDD 4W9EA 2FCSA 3DBHI 2Z0EB 3WAMA 2MRPA 3H6NA 4MGZE 1OQYA 3H7PA 3QJZA 2FCMA 1WJNA 4P7IA 3AU5A 5E6PA 4HVBA 1YIWA 4FLHA 3RUIB 4ZRKA 3WIMA 2Y5BB 4W9LA 3VH4B 3P2BA 2G3QB 3DBSA 3ZUNA 3PHWB 4IW0A 5C1ZA 2M17A 2DYMA 1UELA 2PEAA 3DVGX 3RT3B 2MCNB 3ZKJC 2NS5A 1WX9A 4IC7B 4TUUA 2RD0A 2NVUI 4NPNA 2EMTA 1BT0A 4FHJA 4BKSD 3QWZB 3L0WB 1UZXB 3KUCB 4K7UA 1VD2A 4BVUC 3EC8A 3QK0A 4NAWA 3DBLI 3VXWA 2REXA 4KZCA 1WGDA 3MHSD 4I6NB 3U30A 4F1SA 2RPQA 1V80A 2KLGA 1KLVA 4W9JA 4PYZA 2D07B 3JSVA 4GU2A 4KDLB 3W1YA 1WF9A 1YD8U 1SGHA 4LJOB 5FR6A 2BYFA 2DYOA 1GG3A 1OTRB 2MBQA 2M4NA 2JZ3B 2O6VB 3TCAA 3L10B 5DPRA 4TQ0A 2HJ8A 2KKCA 3V61A 4JLCA 2LXAA 1WH3A 3APDA 4HCPB 1GUAB 4FADA 1KJTA 4EUTA 4RM8A 1Z2MA 2GBNA 2IZVB 3NZUA 4CHKA 2MBEA 2ZNVC 3L54A 3IBEA 3U8ZA 1OEYA 2KFJA 3PRMB 3SDLC 3UF8A 4HWIB 2Z59B 3AU4A 3DDCB 3ECIA 3APCA 4BKGA 2L3ZA 3C0RB 3V62A 3PSEB 4GGQA 3TBLD 2GBRA 4E74A 2GMIC 2PJHA 4MM3A 3ZDTA 2IO0B 3BY4B 1UBIA 2LRUA 3VH3B 2EKEC 3W1SC 1WXSA 3K9PB 4LJPB 4X57B 1WGYA 2K1FA 4ZRIA 1AARA 2MWSB 5TR5A 3A9JB 1RAXA 4ANXA 3T8MA 2NCNA 3NZSA 3PPAA 5CHVC 4HDQA 1V6EA 3JW0X 2C5LC 3QX1A 3LDZE 1TGZB 4A3PA 2J7QB 2MX2A 3D32A 4XZ4A 4TV3A 2MSED 2DZMA 1S3SG 3M3JA 2ZCCA 4BOZB 2ZPNA 4DHJD 3QC8B 4F7ZA 1WJUA 4ZDVA 2GBMA 4MJSA 1YX5B 4RM9A 4A3OA 3QHTA 5GMVA 5DPWA 2GOWA 3DVGY 3R7RA 3ZW3A 4WAAA 3B08A 1K8RB 3I3TB 2MLBA 1ZW7A 3KUZA 2UWQA 2D10A 3K9OB 2CHZA 2C7MB 2LGDA 2MW5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CHX A;  5DPT A;  5JZE B;  2I1J A;  4ZYN A;  4ICV A;  2BYV E;  2NBW B;  2AYO B;  2O6V A;  3EFU A;  5IAA C;  2HTH A;  2K6D B;  2MBB B;  4B9K A;  4FJV B;  1WY8 A;  2KC2 A;  2N9P C;  2KK8 A;  4GIV A;  4XX5 A;  3M62 B;  5EDS A;  2LD9 A;  5DPS A;  3N32 A;  2QHO A;  5C23 A;  2KJ6 A;  4M0W B;  4AJW A;  1LM8 B;  4PS7 A;  1SE9 A;  2IBI B;  3AI5 A;  2KHW B;  4DHZ B;  5D94 A;  3ENE A;  3UIN B;  2K6Q A;  1WMH B;  2N7E A;  4NQL B;  3WAL A;  4HPM B;  3ZTC A;  2LAS A;  4NJ6 A;  3RYT A;  2MP2 B;  2NBU A;  3H9D A;  2ASQ A;  2KLC A;  3OLM D;  4WJO A;  4MH0 E;  3RZF A;  2Z0D B;  4MSM B;  4DK5 A;  4HPL B;  2BF8 B;  2VRR B;  4FJY A;  3VUX A;  1V86 A;  1FXT B;  2D2Q A;  5E6N A;  5KHQ A;  4NQK E;  4YL8 A;  2M1M A;  2MA9 B;  3A4S C;  1WGH A;  2KQS A;  4G0N B;  4KIK A;  1C3T A;  4HCN B;  2KTF A;  2KWV B;  3NHE B;  2KFK A;  1OGW A;  4GDL A;  2EMS A;  3KW5 B;  3L17 A;  3VTW A;  2LI5 A;  2JXX A;  4GDK B;  2W9N A;  2V3S A;  3N30 A;  1P1A A;  1V49 A;  3NOB A;  1V81 A;  1SIF A;  3RZW C;  2G4S A;  2KN5 A;  2LVQ A;  2AWT A;  1LQB A;  4K7S A;  5BO4 B;  3U7D A;  3QIJ A;  4EFO A;  2L7R A;  2LVO A;  4HJK A;  3T9L A;  4DXA B;  3QQ8 B;  1YJ1 A;  4EEW A;  3DPD A;  2V4L A;  1NDD A;  2LUE A;  2BWE S;  3AXC A;  2LRW A;  4GSW A;  1TBE A;  2KZR A;  3TMP B;  4KIK B;  3APF A;  2XK5 A;  3L16 A;  1S1Q B;  4MDK E;  1WMH A;  3ZO5 B;  2PE9 A;  2ZNV B;  3GZN I;  2LVP A;  5IA7 A;  2HE7 A;  2XK5 B;  5CHF A;  3VAW A;  1P0R A;  4BFR A;  2JRH A;  2L76 A;  4LDT B;  2FAZ A;  2DHZ A;  2FUH B;  2M8S A;  1IP9 A;  2KX0 A;  1RFA A;  3QAQ A;  3VTU A;  1VCB A;  3PS6 A;  2LXC A;  4IWP A;  3WA0 A;  2K8C A;  3ZIM A;  1J8C A;  4DWF A;  2L8J A;  2KO3 A;  1XQQ A;  4MGI E;  2OOB B;  2ZPY A;  2I1K A;  4B6W A;  2LGY A;  3PRP B;  4WJN A;  2DX5 B;  4EZJ A;  4B95 A;  4AOF A;  3CF6 E;  4W9C A;  1OEY J;  4A20 A;  2K8B A;  4TQ1 A;  1E7V A;  2J0J A;  2N1W A;  2RSU A;  3ZDM C;  3PLV A;  3M95 A;  4ANW A;  2O2V B;  5L83 A;  3PVL A;  3SHQ A;  1TTN A;  1R4N I;  1V5T A;  2V1Y A;  2ZCB A;  2R2Q A;  3NS8 A;  4MJS B;  2C9W B;  2BKF A;  2JRI B;  4PYU A;  4WJQ A;  1MG8 A;  2BGF A;  3DVN U;  3VUW A;  1IPG A;  1Q0W B;  1UH6 A;  1V5O A;  4FBJ B;  2BKR B;  1L2N A;  2KD0 A;  3SU8 X;  2J0M A;  4E3C A;  2L05 A;  2PE6 B;  3UIP B;  2YLM A;  2NBV B;  5AZH A;  5LXH A;  3N3K B;  2XBB C;  3NY5 A;  3H1U A;  1WM3 A;  3PT2 B;  3ZRC A;  5CX3 A;  3HM3 A;  1LXD A;  4K7W A;  4GMV A;  5AZF A;  2LJ5 A;  2D11 A;  3IFW B;  2D3G A;  3R66 C;  4IG7 B;  2CS4 A;  2MP2 A;  2KAN A;  3VUY A;  2DZK A;  2BPS A;  2KDF B;  3LJ3 A;  4DDI D;  1YQB A;  3QCA A;  2CKH B;  3ZLZ A;  4E71 A;  3IG3 A;  3JSV B;  5DCN A;  3R3M A;  2A5U A;  1WJ6 A;  4IUM B;  2FID A;  2L0F A;  2O2V A;  4ANV A;  2JVC A;  5CHW A;  4KVG B;  2WWZ A;  3V6C B;  1Q1O A;  4WQO B;  3HK0 A;  4ASW C;  4G50 A;  1WZ3 A;  3ZNG C;  2C7H A;  3QA8 A;  3DQV A;  2DYB A;  2IO1 B;  2KDE B;  1P9D U;  1WXM A;  1WIA A;  1WM2 A;  2PPH A;  4I6P A;  2J0K A;  3OAW A;  1E8W A;  2A4Z A;  2K8H A;  2JF5 A;  2LGX A;  2NR2 A;  1IYF A;  3WAO A;  4BOS C;  4AUQ C;  5J18 A;  1Q5W B;  3ALB A;  4HLE A;  3VFK A;  2BWF A;  1LFD A;  3A9K B;  3VQI A;  3RCZ A;  1E8Z A;  3UGB B;  4WWO A;  1C1Y B;  2KVR A;  3EEC A;  3W1S A;  1KM7 A;  2ZVN A;  2JZZ A;  4G3X B;  1L7Y A;  3HHM A;  3X0W A;  2KXJ A;  1H4R A;  2CHW A;  1EF5 A;  5JH5 C;  2IO3 B;  2FCN A;  4HXD A;  1WXV A;  2KDB A;  2R2O A;  4N9F 4;  2KMC A;  2B3A A;  1PQS A;  4K81 A;  3OJ4 B;  3UQA A;  1E8X A;  1GNU A;  1WE6 A;  4PS3 A;  2XEW A;  4TKN A;  4BKT A;  3DCG A;  2RR9 A;  4GN1 A;  4KV2 A;  3PHX B;  2LWP A;  4EZL A;  1HE8 A;  2AL3 A;  1XD3 B;  2N7D A;  5G2N A;  4DBG A;  1WXA A;  4K1R B;  1Z5S B;  4RMA A;  4JQW C;  2K39 A;  2L00 B;  4KSL C;  4XC2 A;  1CMX B;  2JUO A;  4FN2 A;  1P98 A;  2K25 A;  3L13 A;  1E7U A;  2ZJD A;  2N9X A;  4AJY B;  5JHA A;  2CR5 A;  4ZRJ A;  2KTR A;  4HK2 A;  4IWO A;  5G55 A;  3HIZ A;  1GC6 A;  2NPT A;  3B1L X;  3H7P B;  3PGE A;  3PTF C;  4NJ7 A;  2KJH B;  1WJ4 A;  2G4D B;  3VDZ A;  1GJZ A;  4II2 B;  2MBH A;  1TZ1 A;  1WX8 A;  4BBN C;  4IM0 A;  4MGY E;  5HKH A;  4II3 B;  5J2R A;  2IYD B;  4GB9 A;  3WAN A;  2WX1 A;  2M0X A;  3JVZ X;  3PLU A;  4FHK A;  4GOC A;  4MEL A;  4W9G A;  4DDG D;  2BYE A;  1D3Z A;  2DZI A;  3ONS A;  1RRB A;  2LZ6 A;  2N1V A;  1Y8R C;  4M8N A;  3MJW A;  1WI0 A;  1WGR A;  2KC1 A;  5LXI B;  1J0G A;  3DOW A;  4DHJ B;  3Q3F A;  4I6L B;  3TJP A;  3PRE A;  4NY0 A;  5D7G A;  4EZK A;  1WGG A;  1WX7 A;  4W9H A;  1E5W A;  4W9K A;  3A33 B;  1G6J A;  2UYZ B;  2C60 A;  3BIN A;  3UIO B;  5CTR C;  3EHV A;  4FA6 A;  4JIO U;  1UD7 A;  4IM2 A;  4W9F A;  1M94 A;  1KOT A;  1XT9 B;  1EUV B;  2DEN B;  3UQB A;  3A4R A;  4GDK A;  1EO6 A;  5LLI A;  3CSF A;  3TIX A;  2KOX A;  2GBJ A;  1WRD B;  3TL5 A;  1WYW B;  1V9J A;  1YX6 B;  3L08 A;  3O65 B;  1WE7 A;  3VVW B;  4KDI C;  3GOE A;  4W9I A;  4WWP A;  3ZTD A;  1WR1 A;  3MTN B;  4URK A;  1E8Y A;  2IY0 B;  2DAJ A;  5KHO A;  1ISN A;  2AEH A;  2DZJ A;  4J6I A;  1ZGU B;  4EKU A;  4NNJ B;  1UBQ A;  4JGH B;  2L0T A;  4MEM A;  4M8M A;  1RLF A;  2WX0 A;  3CST A;  4CO7 A;  3KUD B;  3A9J A;  3JYU A;  2AL6 A;  1H8C A;  3ML9 A;  3WAP A;  4NAW B;  2KFK B;  2KTR B;  4GDL B;  4MSQ B;  2RGF A;  2KMA A;  2JY6 A;  2GBK A;  4OVV A;  2MBO A;  3RD2 A;  2KNB A;  3V6E B;  2JWZ A;  3S2A A;  2KJR A;  2KQ7 A;  2JPH A;  3H7S A;  2MQJ A;  4FUL A;  3VHT C;  1I35 A;  4BKS A;  4MGK E;  1WR6 E;  3PV1 A;  3KYC D;  2CU1 A;  4GXB A;  5AZG A;  3R7Q A;  3SD5 A;  5D2M B;  3X23 A;  3ML8 A;  4DHZ E;  4CYE A;  1GC7 A;  3AUL A;  2OJR A;  1I42 A;  2ZEQ A;  1WZ0 A;  3RUL A;  3OJ3 A;  2YVC A;  3DBR I;  1U4A A;  3A9K A;  2N4F A;  1R4M I;  3ZVV A;  3A1Q A;  4G11 A;  2WYQ A;  1WFY A;  2KWU B;  3B0A A;  2JT4 B;  4WWN A;  4LDT D;  3PZD A;  3DVN V;  4BBN F;  1NBF C;  4KSK C;  4JL9 A;  2KX3 A;  2NPT B;  4LCD E;  3QAR A;  1F9J A;  5JHB A;  4ICU A;  2ZZP B;  4F8C B;  1QZE A;  2N9E B;  4KZ0 A;  1P3Q U;  4W9D A;  2HD5 B;  3VTV A;  2O6V D;  4AP4 C;  4IM3 A;  3CMM B;  3PRZ A;  1V2Y A;  4OVU A;  1X1M A;  3ZNZ B;  5D6J B;  1E90 A;  1JRU A;  2ZVO A;  1A5R A;  2DAF A;  2FCQ A;  4AWJ A;  1ZKH A;  5AEK B;  2KWC A;  1UGM A;  2G45 B;  1NI2 A;  2IO2 B;  5E6O A;  1J19 A;  4PS8 A;  3IHP C;  4HDO A;  2C7N B;  3ZNI D;  2FNJ B;  2FIF A;  2WDT B;  3ZNH B;  3Q3J A;  4FJZ A;  1EF1 A;  3V60 A;  5J17 A;  4WJP A;  4EOY A;  3A1Q B;  4IWQ A;  5L95 C;  2IY1 B;  2KDI A;  3M63 B;  3IVF A;  3KH0 A;  1T0Y A;  3KVF B;  4ANU A;  3HM6 X;  3ZRF A;  3KYD D;  4W9E A;  2FCS A;  3DBH I;  2Z0E B;  3WAM A;  2MRP A;  3H6N A;  4MGZ E;  1OQY A;  3H7P A;  3QJZ A;  2FCM A;  1WJN A;  4P7I A;  3AU5 A;  5E6P A;  4HVB A;  1YIW A;  4FLH A;  3RUI B;  4ZRK A;  3WIM A;  2Y5B B;  4W9L A;  3VH4 B;  3P2B A;  2G3Q B;  3DBS A;  3ZUN A;  3PHW B;  4IW0 A;  5C1Z A;  2M17 A;  2DYM A;  1UEL A;  2PEA A;  3DVG X;  3RT3 B;  2MCN B;  3ZKJ C;  2NS5 A;  1WX9 A;  4IC7 B;  4TUU A;  2RD0 A;  2NVU I;  4NPN A;  2EMT A;  1BT0 A;  4FHJ A;  4BKS D;  3QWZ B;  3L0W B;  1UZX B;  3KUC B;  4K7U A;  1VD2 A;  4BVU C;  3EC8 A;  3QK0 A;  4NAW A;  3DBL I;  3VXW A;  2REX A;  4KZC A;  1WGD A;  3MHS D;  4I6N B;  3U30 A;  4F1S A;  2RPQ A;  1V80 A;  2KLG A;  1KLV A;  4W9J A;  4PYZ A;  2D07 B;  3JSV A;  4GU2 A;  4KDL B;  3W1Y A;  1WF9 A;  1YD8 U;  1SGH A;  4LJO B;  5FR6 A;  2BYF A;  2DYO A;  1GG3 A;  1OTR B;  2MBQ A;  2M4N A;  2JZ3 B;  2O6V B;  3TCA A;  3L10 B;  5DPR A;  4TQ0 A;  2HJ8 A;  2KKC A;  3V61 A;  4JLC A;  2LXA A;  1WH3 A;  3APD A;  4HCP B;  1GUA B;  4FAD A;  1KJT A;  4EUT A;  4RM8 A;  1Z2M A;  2GBN A;  2IZV B;  3NZU A;  4CHK A;  2MBE A;  2ZNV C;  3L54 A;  3IBE A;  3U8Z A;  1OEY A;  2KFJ A;  3PRM B;  3SDL C;  3UF8 A;  4HWI B;  2Z59 B;  3AU4 A;  3DDC B;  3ECI A;  3APC A;  4BKG A;  2L3Z A;  3C0R B;  3V62 A;  3PSE B;  4GGQ A;  3TBL D;  2GBR A;  4E74 A;  2GMI C;  2PJH A;  4MM3 A;  3ZDT A;  2IO0 B;  3BY4 B;  1UBI A;  2LRU A;  3VH3 B;  2EKE C;  3W1S C;  1WXS A;  3K9P B;  4LJP B;  4X57 B;  1WGY A;  2K1F A;  4ZRI A;  1AAR A;  2MWS B;  5TR5 A;  3A9J B;  1RAX A;  4ANX A;  3T8M A;  2NCN A;  3NZS A;  3PPA A;  5CHV C;  4HDQ A;  1V6E A;  3JW0 X;  2C5L C;  3QX1 A;  3LDZ E;  1TGZ B;  4A3P A;  2J7Q B;  2MX2 A;  3D32 A;  4XZ4 A;  4TV3 A;  2MSE D;  2DZM A;  1S3S G;  3M3J A;  2ZCC A;  4BOZ B;  2ZPN A;  4DHJ D;  3QC8 B;  4F7Z A;  1WJU A;  4ZDV A;  2GBM A;  4MJS A;  1YX5 B;  4RM9 A;  4A3O A;  3QHT A;  5GMV A;  5DPW A;  2GOW A;  3DVG Y;  3R7R A;  3ZW3 A;  4WAA A;  3B08 A;  1K8R B;  3I3T B;  2MLB A;  1ZW7 A;  3KUZ A;  2UWQ A;  2D10 A;  3K9O B;  2CHZ A;  2C7M B;  2LGD A;  2MW5 A; 
#chains in the Genus database with same CATH topology
 2CHX A;  5DPT A;  1ZXI A;  4HPP A;  5EE1 A;  4XX5 A;  3U2S C;  3M62 B;  2BT6 A;  5DPS A;  3N32 A;  2QHO A;  4RH6 A;  3BVG A;  1R4M B;  2RDG A;  1LM8 B;  4PS7 A;  4AJW A;  4DHZ B;  3ENE A;  2MP2 B;  1AYF A;  2ASQ A;  3OLM D;  4MH0 E;  4K3B A;  1K50 A;  4DK5 A;  2BF8 B;  4FJY A;  3ZJU A;  2D2Q A;  5KHQ A;  1CJE A;  4YL8 A;  3GE8 C;  3NHE B;  1OGW A;  3L17 A;  4WQM A;  1NEN B;  2JXX A;  3U52 E;  3RMK C;  1NEK B;  1SIF A;  2G4S A;  4Q2J A;  5BO4 B;  3R2T A;  4AQ7 A;  1I4G A;  4DXA B;  3QQ8 B;  1YJ1 A;  3C19 A;  3DPD A;  1PYW D;  4EEW A;  1OQQ A;  2V4L A;  2LRW A;  1XCT L;  4BAX A;  1SXT A;  2XK5 A;  3ABV B;  1S1Q B;  1J7C A;  2PE9 A;  2WXH A;  2LVP A;  5CHF A;  1P0R A;  1L4Z B;  2FUH B;  2LXC A;  2GI9 A;  3DBR B;  2DWQ A;  1T5X D;  2WXJ A;  3Q3O C;  1J8C A;  1D6E C;  3Q6B A;  2KO3 A;  3RN9 C;  1JQ4 A;  2PMV A;  4MGI E;  2OOB B;  2ZPY A;  2I1K A;  4B6W A;  4B95 A;  4AOF A;  4W9C A;  1QKZ A;  1VDV A;  2RMM A;  4TQ1 A;  2J0J A;  3NS1 A;  3PLV A;  3IAS 1;  5L83 A;  3SHQ A;  1TTN A;  1R4N I;  4MJS B;  4KX6 B;  1JWA D;  4WJQ A;  1MG8 A;  2BGF A;  1WGK A;  1WWT A;  2IJ0 A;  1L2N A;  2WXN A;  4JWU C;  1PFD A;  2WXO A;  1V97 A;  4P1C C;  1NVI D;  2J0M A;  2BS4 B;  3UIP B;  5LXH A;  1XEE A;  1L6U A;  2LJ5 A;  1C77 A;  1EWY C;  1P7F A;  4OZC A;  1NI3 A;  3R66 C;  2KAN A;  2BPS A;  4DDI D;  5TSS A;  4E71 A;  3JSV B;  3R3M A;  2SAK A;  2A5U A;  2V9H A;  5G5H A;  4IUM B;  1SSN A;  4ANV A;  2MEK A;  2JVC A;  5CHW A;  2G1E A;  1EM7 A;  2QIL A;  4G50 A;  2C7H A;  2DYB A;  1P9D U;  3AE5 B;  5T8I A;  1WXM A;  1WIA A;  3NG0 A;  1E8W A;  2A4Z A;  2K8H A;  2LGX A;  1XLP A;  3VFK A;  1LFD A;  2KQ4 X;  3LB8 C;  4KGT A;  1XCQ L;  4WWM A;  3HHM A;  1C79 A;  1EU3 A;  1KF6 B;  5BYR A;  2FCN A;  4HXD A;  2KDB A;  3AMZ A;  3ZYY X;  3NVY A;  3UI3 A;  3Q8A A;  4K81 A;  3UQA A;  3VR8 B;  1WE6 A;  3Q8C A;  2XEW A;  2MJD A;  4BKT A;  1E9M A;  3TEX A;  2KWD A;  2ACZ B;  2N7D A;  5G2N A;  2K39 A;  4XC2 A;  4NZL B;  1CMX B;  1RYJ A;  2XN9 C;  2X38 A;  1P98 A;  3Q69 A;  5JHA A;  2LMC A;  3P63 A;  1KLG D;  2CR5 A;  4HK2 A;  4IWO A;  4M01 A;  1GC6 A;  3PGE A;  1GJZ A;  3LYY A;  1N5W A;  4II2 B;  1GB1 A;  2GB1 A;  4BBN C;  4HEA 1;  3IT6 B;  5HKH A;  2WX1 A;  4GOC A;  4W9G A;  4DDG D;  2XNA C;  2DZI A;  1RRB A;  5BYS A;  4M8N A;  3MJW A;  1WGR A;  3Q3F A;  1TYG B;  4I6L B;  1UWM A;  2I38 A;  1GOZ A;  4NY0 A;  1TS3 A;  1WGG A;  1E5W A;  4JPS A;  2BBC A;  3A33 B;  1R4N B;  2UYZ B;  1J7A A;  3BIN A;  2CJN A;  5CTR C;  2L1A A;  1D4B A;  1UD7 A;  2NMQ A;  2DEN B;  3SEB A;  3UQB A;  1BXT A;  1EO6 A;  2GBJ A;  1WRD B;  3IT4 B;  3TL5 A;  1WE7 A;  3Q3N C;  1L4D B;  4W9I A;  3H8H A;  4WWP A;  3RI7 C;  4URK A;  1E8Y A;  2IY0 B;  2BS3 B;  1E0Z A;  2AEH A;  3IXS A;  4J6I A;  3I63 C;  4EKU A;  2JX5 A;  2L0T A;  4M8M A;  3CST A;  4CO7 A;  3KUD B;  2KFK B;  2KMA A;  2GBK A;  5HI1 A;  3RNA C;  3S2A A;  3VHT C;  2ZW1 A;  1FRD A;  1P7E A;  5AZG A;  3GB1 A;  3RNF C;  1I42 A;  2RDH A;  3ZVV A;  4G11 A;  2KWU B;  3B0A A;  3AE1 B;  1FMA D;  1YNT E;  2K5P A;  1QZE A;  4JE3 B;  4KZ0 A;  4IM3 A;  5HG2 A;  5D6J B;  2ZVO A;  2FCQ A;  1J7B A;  5AEK B;  1SEB D;  1UGM A;  1C78 A;  2IO2 B;  4XDC A;  3IHP C;  2D3C A;  3DHG C;  4A90 A;  4WH4 A;  4EOY A;  3IVF A;  1T0Y A;  3KVF B;  5D3D A;  3ZRF A;  5AUK A;  3DBH I;  1L5P A;  1E7P B;  2RDB C;  4IKG A;  2HTM E;  1ZUD 2;  1A70 A;  5BMH A;  1XF5 L;  1YIW A;  4ZRK A;  3WIM A;  2Y5B B;  4RGN A;  3VH4 B;  2PVO D;  2PEA A;  3ZKJ C;  1BT0 A;  1UZX B;  2Y3A A;  1VD2 A;  4BVU C;  2X8X X;  3EC8 A;  3QK0 A;  1MPE A;  3DBL I;  4KZC A;  1WGD A;  4F1S A;  2RPQ A;  1QIL A;  4KDL B;  1SGH A;  3P4Q B;  2V0G A;  2BYF A;  2DYO A;  1OTR B;  3EA6 A;  3TCA A;  2UU7 A;  2HJ8 A;  2KKC A;  3VRA B;  2BQQ A;  3APD A;  4HCP B;  4JWS C;  1KJT A;  4RM8 A;  2MBE A;  3IBE A;  5IOI A;  1BML C;  1OEY A;  2KFJ A;  4XDD A;  2L3Z A;  1L0V B;  4C80 A;  2QSD A;  4HKQ A;  3AEF B;  4E74 A;  1D5M C;  1UBI A;  4LJP B;  4X57 B;  2K1F A;  4DXG A;  2AX5 A;  3NVZ A;  2WXR A;  4ANX A;  1TJE A;  1HTO A;  2C5L C;  3QX1 A;  1TY2 A;  4YT0 B;  2LGI A;  4LNO A;  5H92 C;  1VJK A;  2HDE A;  1WJU A;  4ZDV A;  4MJS A;  2MJE A;  5DPW A;  2GOW A;  1QF6 A;  3R7R A;  3N9Y C;  3ZW3 A;  2JYE A;  3B08 A;  3Q14 C;  2IND C;  3KQ4 A;  1EU4 A;  2D10 A;  2WP9 B;  1YJJ A;  2LGD A;  4LNN A;  1ET9 A;  2K3U A;  2BYV E;  3EFU A;  2AYO B;  2V3N A;  3AV8 A;  2B76 B;  4FJV B;  2N9P C;  2KC2 A;  4GIV A;  5EDS A;  2LGS A;  2KJ6 A;  1V1P B;  4IDI A;  2Y5P A;  5D94 A;  2QJL A;  1I4P A;  4NQL B;  3SFD B;  2KMM A;  4RCO A;  1C76 A;  3H9D A;  3RZF A;  2Z0D B;  4MSM B;  2WLB A;  3VUX A;  1V86 A;  1XLN A;  1MI0 A;  4NQK E;  3TSS A;  1C3T A;  2M1M A;  4BZA A;  3A4S C;  4G0N B;  5C3J B;  2ICI A;  1F1H A;  2KWV B;  4GDL A;  4M02 A;  4R3D A;  2CU3 A;  2VH1 A;  2W9N A;  2V3S A;  2JWU A;  1CZP A;  3NOB A;  2KN5 A;  3W5U B;  2AWT A;  1DOI A;  3U7D A;  2LVO A;  1YN4 A;  4HJK A;  3T9L A;  1NDD A;  2LUE A;  2IGD A;  1TBE A;  2KZR A;  1WMH A;  3ZO5 B;  5IA7 A;  2XK5 B;  4LDT B;  2M8S A;  2BW2 A;  4IWP A;  3WA0 A;  5FKA C;  2L8J A;  1VZ6 A;  3SFE B;  3AEB B;  5IP4 D;  3AB5 A;  2LGY A;  3ZXR A;  2DX5 B;  2WS3 B;  4A20 A;  1DOY A;  2VZK B;  2K8B A;  1E7V A;  2KN4 A;  1F2R I;  1STE A;  3ZDM C;  4ANW A;  3PVL A;  2N7J A;  2R2Q A;  3AE7 B;  4DXF A;  2C9W B;  2BKF A;  3VUW A;  4KKI A;  1IPG A;  2FUG 1;  1Q0W B;  1V5O A;  4FBJ B;  2BKR B;  4YWG G;  3W2D A;  4CQN A;  2RPV A;  3HVZ A;  2YLM A;  1N63 A;  2NBV B;  2EEL A;  3N3K B;  3NY5 A;  3GE3 C;  3H1U A;  5CX3 A;  4P1B C;  3BVM A;  4K7W A;  4GMV A;  3FC4 A;  2D11 A;  2PKO A;  2D3G A;  3IFW B;  4IG7 B;  2MP2 A;  1N60 A;  2KDF B;  1YQB A;  3QCA A;  2CKH B;  2NTS A;  3IG3 A;  1WJ6 A;  2FID A;  2O2V A;  4KVG B;  3V6C B;  1BUI C;  1Q1O A;  4ASW C;  3HK0 A;  1HTQ A;  1WZ3 A;  2IO1 B;  1C4C A;  3AEE B;  4XYC A;  2PPH A;  1ENF A;  2NR2 A;  5EE0 A;  2HJ1 A;  2LHD A;  4AUQ C;  3ALB A;  4YTM B;  2BWF A;  3VQI A;  3UGB B;  4YTP B;  3WCQ A;  2JZZ A;  3ZXV A;  2MHJ A;  2WXF A;  3AE3 B;  2D5G A;  5JH5 C;  4N9F 4;  2KMC A;  2WXP A;  5MPO A;  4S17 A;  2J42 A;  4TKN A;  3DCG A;  4MM3 B;  5EE9 A;  2WGS A;  1ROE A;  4RMA A;  2JYT A;  1FNW A;  2MJ3 A;  4HRO A;  1YQ3 B;  3I5J C;  2N9X A;  1TS4 A;  2WQY B;  1ET6 A;  2G9H D;  3B1L X;  1I7H A;  1WJ4 A;  2MBH A;  1TZ1 A;  1WX8 A;  2H89 B;  2EKI A;  2WXM A;  5J2R A;  4S0R A;  3TEY A;  2IYD B;  2LJI A;  3JVZ X;  3ZGZ A;  2BYE A;  3ONS A;  2N1V A;  1Y8R C;  5FR3 A;  1JWB D;  2KC1 A;  5BYQ A;  3B2G A;  3TJP A;  3GZN B;  3DHH C;  3CWI A;  3PRE A;  2QC8 A;  4EZK A;  3ZJV A;  4QAY A;  4W9K A;  2R61 A;  3FIL A;  2J53 A;  2W3R A;  3UIO B;  3EHV A;  1QOA A;  2N9L A;  4IM2 A;  4W9F A;  1M94 A;  1TS5 A;  1KOT A;  1XT9 B;  3A4R A;  1IUE A;  4GDK A;  5LLI A;  3CSF A;  1K53 A;  2KOX A;  1WYW B;  3AE8 B;  1YX6 B;  3L08 A;  3O65 B;  3VVW B;  1VLB A;  2JQR B;  2WX0 A;  1OFF A;  2OJW A;  3A9J A;  2KTR B;  3Q8F A;  4MAC A;  2KNB A;  2KQ7 A;  2MQJ A;  1I35 A;  3ZJT A;  2L32 A;  4RGT A;  1HEZ E;  1SE3 A;  1K51 A;  3R7Q A;  5D2M B;  3X23 A;  3BII D;  2OJR A;  3FIL B;  1MHX A;  1WZ0 A;  3DBR I;  2GLS A;  2WYQ A;  4YSZ B;  4WWN A;  3PZD A;  3DBL B;  4KSK C;  4LCD E;  3RNC C;  4ICU A;  4F8C B;  5HHD G;  3E9S A;  2N9E B;  2HD5 B;  4AP4 C;  3Q8B A;  1A5R A;  3RPF C;  4AWJ A;  1C4A A;  1SE2 A;  2G45 B;  5E6O A;  3N1Y C;  4C4V A;  3W9C B;  3BYT B;  2C7N B;  4HDO A;  3ZNI D;  1EF1 A;  3V60 A;  1HQR D;  4WJP A;  3A1Q B;  3M63 B;  3KH0 A;  4ANU A;  4A55 A;  3HM6 X;  1SBB B;  1SE4 A;  4W9E A;  2FCS A;  2Z0E B;  4MGZ E;  1WJN A;  5E6P A;  4HVB A;  3OWE B;  3AE4 B;  2G3Q B;  1TKE A;  4IW0 A;  2M17 A;  2DYM A;  2VZK D;  3BYY B;  1WYG A;  3DVG X;  4ZYS A;  1WX9 A;  4TUU A;  1JCK B;  2EMT A;  4FHJ A;  1FNV A;  4BKS D;  5E6J A;  3KUC B;  3EUB 2;  4K7U A;  1HZ6 A;  1UUP A;  4L2Y A;  4NAW A;  4I6N B;  4C4V B;  2QDF A;  4M0W A;  1WF9 A;  1YD8 U;  2LUM A;  5FR6 A;  2WU2 B;  2JZ3 B;  2O6V B;  4K3C A;  1XXG A;  3V61 A;  4JLC A;  1NYQ A;  2IGG A;  2LXA A;  3L4P A;  1HXY D;  4FAD A;  4EUT A;  1Z2M A;  4L1B A;  3U4E G;  1ZP0 B;  4HWI B;  2Z59 B;  3IAM 1;  1ZDX A;  3C0R B;  3V62 A;  3PSE B;  3TBL D;  2GBR A;  2PJH A;  4MM3 A;  1EWC A;  1N5X A;  4RF0 A;  2J52 A;  2E6X A;  3ZDT A;  3BY4 B;  2LRU A;  1AAR A;  2MWS B;  1I4H A;  5TR5 A;  3A9J B;  3V05 A;  4XWT A;  1NYR A;  4EE2 A;  3TEZ A;  4WUR A;  4US8 A;  1PGA A;  2MX2 A;  3D32 A;  4XZ4 A;  4TV3 A;  2DZM A;  2BB5 A;  4BOZ B;  3R8B A;  2ZPN A;  4C7Y A;  4F7Z A;  2M56 B;  2GBM A;  3Q2A C;  4RM9 A;  3MC9 A;  3PZ8 A;  3DVG Y;  4PT5 A;  2W82 A;  4ZRQ A;  3I3T B;  1RFK A;  4KKJ A;  3BZD B;  3T8M A;  2C7M B;  2MW5 A;  3MJ5 A;  5JZE B;  1TIF A;  2I1J A;  1YMH E;  5IAA C;  2K6D B;  2MBB B;  2WXK A;  4B9K A;  4XE0 A;  1UWX A;  2KAC A;  2KK8 A;  5C23 A;  3TUO A;  2KHW B;  4ZHP A;  3UIN B;  5GXG B;  1WMH B;  2N7E A;  3WAL A;  4HPM B;  3ZTC A;  2LAS A;  3RYT A;  2NBU A;  4WJO A;  2KLC A;  2WDQ B;  1F2R C;  4HPL B;  2VRR B;  1B9R A;  1FXT B;  5E6N A;  2DLB A;  4PK1 A;  2KQS A;  1SJE D;  4HCN B;  2KTF A;  2BB6 A;  3RZW C;  1V81 A;  2LVQ A;  2ON8 A;  2LFI A;  1TZO A;  3QIJ A;  4EFO A;  2L7R A;  1T0S C;  1ZXH A;  2BWE S;  2E3T A;  3AXC A;  1PUT A;  4GSW A;  4ITK A;  3L16 A;  1UF0 A;  2BYT A;  2ZNV B;  3AEC B;  3GZN I;  3O13 A;  1ESF A;  3VAW A;  2JRH A;  2FAZ A;  1IP9 A;  1RFA A;  1JWS D;  3VTU A;  1VCB A;  3EGR A;  3DBH B;  4ZOH C;  2LHE A;  3ZIM A;  2M19 A;  1JRO A;  3AM9 A;  1XQQ A;  4MH8 A;  4EZJ A;  1OEY J;  2SEB D;  2N1W A;  2O2V B;  3OG5 A;  4ARI A;  2JZP A;  1B1Z A;  2ZCB A;  2D3B A;  2JRI B;  2YEP B;  1UH6 A;  2WNM A;  2L83 A;  2L05 A;  2PE6 B;  1IBX A;  5AZH A;  2XBB C;  1V1P A;  1WM3 A;  3HM3 A;  1LXD A;  1YN5 A;  2N9K A;  3LJ3 A;  4RNA A;  1XLO A;  2L0F A;  1F77 A;  1Q10 A;  4WQO B;  3QA8 A;  3DQV A;  4MT5 A;  4RGO S;  1WM2 A;  4USA A;  3OAW A;  2KAJ A;  4KGS A;  4BOS C;  1C4P A;  1Y56 A;  1E8Z A;  2KVR A;  3W1S A;  1KM7 A;  1YOV B;  3GP7 A;  3X0W A;  2IO3 B;  2FBW B;  1WXV A;  2R2O A;  1PQS A;  1E8X A;  1GNU A;  2J4X A;  1TS2 A;  1FXI A;  4KV2 A;  3PHX B;  1HE8 A;  2AL3 A;  3MHZ A;  5BMI A;  4DBG A;  1WXA A;  1SJH D;  4JQW C;  4KSL C;  3AE6 B;  4FN2 A;  3ETR A;  2ZJD A;  4O1N A;  4AJY B;  4ZRJ A;  1VZ7 A;  2KTR A;  4RFB A;  3W5V B;  5G55 A;  3H7P B;  3PTF C;  4HRS A;  4NJ7 A;  2G4D B;  2AQ2 B;  1QLB B;  4IM0 A;  2K9X A;  4MGY E;  2KVZ A;  4II3 B;  3I9V 1;  4GB9 A;  4A8X C;  2M0X A;  1XO3 A;  2DBY A;  3PLU A;  4FHK A;  2LZ6 A;  2CJO A;  1YQ4 B;  4JX1 C;  1J0G A;  3ZQ4 A;  1KH0 A;  3KWL A;  1D5Z C;  1WX7 A;  3P4P B;  5D7G A;  2KT7 A;  2JU6 X;  1G6J A;  4FA6 A;  4JIO U;  4B0M A;  1E10 A;  2PW9 A;  1ACC A;  4YSY B;  3B9J A;  3TIX A;  1V9J A;  4ZRP A;  2LEK A;  4KDI C;  3GOE A;  3ZTD A;  5KHO A;  2WDR B;  2DZJ A;  1ZGU B;  4NNJ B;  1UBQ A;  4MEM A;  1JML A;  1RLF A;  1T0Q C;  1IGC A;  3ML9 A;  4NAW B;  4GDL B;  2H88 B;  1MG4 A;  2MBO A;  5FK9 C;  4FUL A;  5AUI A;  1WR6 E;  4GXB A;  2CU1 A;  2TSS A;  3KWV A;  4CYE A;  4H2A A;  3AUL A;  3RUL A;  3OJ3 A;  2YVC A;  1U4A A;  1R4M I;  1N6Z A;  3HRD D;  1T0R C;  1WFY A;  4LDT D;  4TSS A;  1WRI A;  1ZOY B;  4BBN F;  1CK1 A;  2WHI A;  4ACF A;  2KX3 A;  2NPT B;  4P6V F;  3QAR A;  2N0S B;  2BVC A;  2D3A A;  2O6V D;  3CMM B;  3PRZ A;  1K52 A;  1FIQ A;  3FKY A;  1X1M A;  3ZNZ B;  1E90 A;  1JRU A;  2DAF A;  1ZKH A;  2KWC A;  1T6B X;  1NI2 A;  1J19 A;  4PS8 A;  2FNJ B;  3ZNH B;  5J17 A;  4FJZ A;  4TMA B;  2IY1 B;  2KDI A;  1WSP A;  1C9F A;  4NJC A;  1CQV A;  2MRP A;  3WAM A;  4XWW A;  3H6N A;  1OQY A;  1QOB A;  4P7I A;  3NVV A;  5IO9 A;  2K0P A;  3RUI B;  1FD6 A;  1XLQ A;  3P2B A;  5C1Z A;  1R7S A;  1UEL A;  3NJT A;  2NS5 A;  2NVU I;  4YTN B;  1I4Q A;  3L0W B;  4KGR A;  4LK0 M;  3VXW A;  2REX A;  3MHS D;  1KLV A;  4N58 A;  3P4R B;  1ZDV A;  2D07 B;  3JSV A;  3W1Y A;  3DWM A;  1GG3 A;  2MH7 A;  3DWG C;  2MBQ A;  3AE2 B;  4UDU C;  1F0Z A;  2FE8 A;  1KRH A;  3L10 B;  1QOG A;  5DPR A;  2IPK D;  2IZV B;  2GBN A;  2WU5 B;  3NZU A;  2ZNV C;  3U8Z A;  3PRM B;  4NAM A;  3SDL C;  3UF8 A;  3AU4 A;  3APC A;  1PGB A;  3LXF A;  4OVZ A;  1T3Q A;  1JRP A;  4GGQ A;  1UGJ A;  2GMI C;  3PO0 A;  2I2Y A;  3VH3 B;  2EKE C;  4RGM A;  1KFY B;  3K9P B;  4L23 A;  3KLS X;  4A9A A;  2AQ3 B;  1RWS A;  2ZW0 A;  3T3N A;  3NZS A;  2K22 A;  3R2I A;  4HDQ A;  1OQR A;  4J3O D;  4OHJ A;  4US9 A;  1TGZ B;  4A3P A;  2J7Q B;  3AEG B;  1GAQ B;  2MSE D;  1QOF A;  3M3J A;  2ZCC A;  4FXC A;  1AW7 A;  4DHJ D;  4LNF A;  3Q8E A;  3QHT A;  1JWM D;  2VH2 A;  3FAH A;  2MLB A;  1ZW7 A;  3J9C A;  3KUZ A;  2UWQ A;  1FRR A;  2CHZ A;  1E6E B;  1JAL A;  2MA9 B;  3AE9 B;  4ZYN A;  3MC8 A;  4ICV A;  2NBW B;  2O6V A;  3P42 A;  2HTH A;  4B0E A;  1PGX A;  1WY8 A;  5BMG A;  4WAF A;  1V8C A;  2LD9 A;  1KTK A;  4M0W B;  4P16 A;  1FPY A;  1SE9 A;  2IBI B;  3AI5 A;  3NRZ A;  2K6Q A;  1LGR A;  2JSV X;  3B2F A;  4NJ6 A;  3VR9 B;  1MJD A;  1FCC C;  1ZPS A;  3BWU D;  2Q5W D;  4KIK A;  1WGH A;  2KFK A;  3VTW A;  2EMS A;  3KW5 B;  3RNB C;  2LI5 A;  4GDK B;  1RM6 C;  1TKG A;  2W3S A;  3GS2 A;  3N30 A;  1P1A A;  1V49 A;  4C00 A;  1LQB A;  4K7S A;  4HKZ E;  1JWU D;  3TMP B;  4KIK B;  3APF A;  4MDK E;  1YN3 A;  2INN E;  2OHF A;  2HE7 A;  1DOX A;  1VZ8 A;  4BFR A;  2L76 A;  4IOI E;  2DHZ A;  2KX0 A;  3QAQ A;  3PS6 A;  4ZHO A;  3VRB B;  2K8C A;  4A6Q A;  4DWF A;  3PRP B;  3E56 A;  4WJN A;  3CF6 E;  1UNS A;  2QCZ A;  2RSU A;  2ONQ A;  4LNK A;  3M95 A;  2IDY A;  3BVZ A;  1V5T A;  3NS8 A;  2V1Y A;  2KYW A;  1L0X B;  4PYU A;  2Y5C A;  3DVN U;  4YXD B;  1FXA A;  1YJI A;  2PLP A;  3DHI C;  2KD0 A;  1HA5 A;  3SU8 X;  1GB4 A;  4E3C A;  2V4I B;  2YEP F;  2WXL A;  3PT2 B;  2JXT A;  4GLS C;  4OZB A;  3ZRC A;  3PZ7 A;  4OZA A;  1IBX B;  5AZF A;  4DQO C;  5D3I B;  2CS4 A;  1PDX A;  3VUY A;  2DZK A;  1DYQ A;  2WXQ A;  3ZLZ A;  1TT5 B;  5DCN A;  2IGH A;  4AS1 A;  2WWZ A;  2BS2 B;  3ZNG C;  2KDE B;  4HJG E;  1SB3 C;  1N62 A;  4I6P A;  2J0K A;  2JF5 A;  1IYF A;  3WAO A;  3AEA B;  4LNI A;  5J18 A;  1Q5W B;  4HLE A;  3A9K B;  2WXG A;  3RCZ A;  1MFW A;  4WWO A;  1C1Y B;  4M00 A;  3HVD A;  1L0Y B;  3EEC A;  2Z8L A;  3TEW A;  2ZVN A;  4G3X B;  1L7Y A;  5EE3 A;  2KXJ A;  1H4R A;  2CHW A;  1EF5 A;  3NVW A;  3N1Z C;  2B3A A;  3OJ4 B;  4PS3 A;  3SR6 A;  5C2T B;  2RR9 A;  4GN1 A;  2LWP A;  4EZL A;  1XD3 B;  4K1R B;  1Z5S B;  2L00 B;  5IN7 A;  1MVK A;  2JUO A;  4C56 C;  2PVG C;  3N20 C;  2K25 A;  3L13 A;  1E7U A;  2INP E;  3RNE C;  3HIZ A;  2NPT A;  2KJH B;  3VDZ A;  2BTE A;  3WAN A;  3P4S B;  4MEL A;  1D3Z A;  2W55 A;  3MC0 B;  1WI0 A;  3N1X C;  1I4X A;  5LXI B;  4LTU A;  3DOW A;  3MP9 A;  4DHJ B;  5IKC M;  3Q3M C;  1V1O A;  4W9H A;  1MHH E;  2QMT A;  2GRI A;  2C60 A;  2OED A;  1EUV B;  1FCL A;  5G5G A;  1JW9 D;  3U7Z A;  1VR9 A;  3AH7 A;  1QQR A;  1L6V A;  1FFU A;  3I57 A;  3T3O A;  1WR1 A;  3MTN B;  2DAJ A;  1ISN A;  3BK2 A;  1AWD A;  4JGH B;  1WXQ A;  3JYU A;  2AL6 A;  1H8C A;  3WAP A;  2WXI A;  4MSQ B;  2RGF A;  2JY6 A;  1FEH A;  4OVV A;  3RD2 A;  3V6E B;  2JWZ A;  2KJR A;  3H7S A;  2JPH A;  4MGK E;  1FM0 D;  3PV1 A;  3KYC D;  3SD5 A;  3ML8 A;  4DHZ E;  1GC7 A;  2ZEQ A;  1I4R A;  1GPX A;  3A9K A;  2N4F A;  3A1Q A;  4D2K A;  2JT4 B;  3DVN V;  1NBF C;  4LLG M;  4JL9 A;  2L52 A;  1F9J A;  1SIJ A;  5JHB A;  1FFV A;  2ZZP B;  1P3Q U;  4W9D A;  3VTV A;  3NUH B;  4N59 A;  1V2Y A;  4OVU A;  1IGD A;  4OW0 A;  3EFC A;  5LNK 1;  4XGA B;  4YSX B;  3AN1 A;  2WDT B;  2FIF A;  3Q3J A;  4C7Z A;  4IWQ A;  5L95 C;  2V3P A;  1LO5 D;  3KYD D;  4N6E B;  1FNU A;  3H7P A;  3QJZ A;  2FCM A;  3RFZ B;  3AU5 A;  4FLH A;  4W9L A;  3ZUN A;  3DBS A;  3PHW B;  1M4V A;  2DNF A;  3RT3 B;  2MCN B;  4IC7 B;  2NTT A;  2RD0 A;  4NPN A;  1ZE3 D;  1SF0 A;  3QWZ B;  2AQ1 B;  5I4D A;  1D5X C;  2W54 A;  2INC C;  1HZ5 A;  3U30 A;  1V80 A;  2KLG A;  4W9J A;  4ARC A;  4PYZ A;  3AED B;  3CIR B;  4GU2 A;  4LJO B;  3V3X A;  2M4N A;  4TQ0 A;  1WH3 A;  1GUA B;  4RF1 A;  4CHK A;  3L54 A;  2PTL A;  2QEJ C;  1QT9 A;  1DGJ A;  3DDC B;  3ECI A;  4BKG A;  5H8Y E;  2WDV B;  1N61 A;  2M0A A;  2IO0 B;  3W1S C;  1VRA B;  1WXS A;  1WGY A;  3HUI A;  4ZRI A;  1FO4 A;  2QIE B;  3URY A;  1RAX A;  2NCN A;  3PPA A;  3MFG A;  3NZ3 A;  5HFY A;  5CHV C;  1V6E A;  3JW0 X;  3LDZ E;  4WIP A;  5JXV A;  1AN8 A;  3RNG C;  3P1M A;  1S3S G;  2PIA A;  3QC8 B;  1YX5 B;  4A3O A;  5GMV A;  1TY0 A;  4REZ A;  2KDM A;  4WAA A;  1F52 A;  1KLU D;  3C8Y A;  1TKY A;  1K8R B;  3BK1 A;  3K9O B;  4BKS A; 
#chains in the Genus database with same CATH homology
 2CHX A;  5DPT A;  5JZE B;  2I1J A;  4ZYN A;  4ICV A;  2BYV E;  2NBW B;  2AYO B;  2O6V A;  3EFU A;  5IAA C;  2HTH A;  2K6D B;  2MBB B;  4B9K A;  4FJV B;  1WY8 A;  2KC2 A;  2N9P C;  2KK8 A;  4GIV A;  4XX5 A;  3M62 B;  5EDS A;  2LD9 A;  5DPS A;  3N32 A;  2QHO A;  5C23 A;  2KJ6 A;  4M0W B;  4AJW A;  1LM8 B;  4PS7 A;  1SE9 A;  2IBI B;  3AI5 A;  2KHW B;  4DHZ B;  5D94 A;  3ENE A;  3UIN B;  2K6Q A;  1WMH B;  2N7E A;  4NQL B;  3WAL A;  4HPM B;  3ZTC A;  2LAS A;  4NJ6 A;  3RYT A;  2MP2 B;  2NBU A;  3H9D A;  2ASQ A;  2KLC A;  3OLM D;  4WJO A;  4MH0 E;  3RZF A;  2Z0D B;  4MSM B;  4DK5 A;  4HPL B;  2BF8 B;  2VRR B;  4FJY A;  3VUX A;  1V86 A;  1FXT B;  2D2Q A;  5E6N A;  5KHQ A;  4NQK E;  4YL8 A;  2M1M A;  2MA9 B;  3A4S C;  1WGH A;  2KQS A;  4G0N B;  4KIK A;  1C3T A;  4HCN B;  2KTF A;  2KWV B;  3NHE B;  2KFK A;  1OGW A;  4GDL A;  2EMS A;  3KW5 B;  3L17 A;  3VTW A;  2LI5 A;  2JXX A;  4GDK B;  2W9N A;  2V3S A;  3N30 A;  1P1A A;  1V49 A;  3NOB A;  1V81 A;  1SIF A;  3RZW C;  2G4S A;  2KN5 A;  2LVQ A;  2AWT A;  1LQB A;  4K7S A;  5BO4 B;  3U7D A;  3QIJ A;  4EFO A;  2L7R A;  2LVO A;  4HJK A;  3T9L A;  4DXA B;  3QQ8 B;  1YJ1 A;  4EEW A;  3DPD A;  2V4L A;  1NDD A;  2LUE A;  2BWE S;  3AXC A;  2LRW A;  4GSW A;  1TBE A;  2KZR A;  3TMP B;  4KIK B;  3APF A;  2XK5 A;  3L16 A;  1S1Q B;  4MDK E;  1WMH A;  3ZO5 B;  2PE9 A;  2ZNV B;  3GZN I;  2LVP A;  5IA7 A;  2HE7 A;  2XK5 B;  5CHF A;  3VAW A;  1P0R A;  4BFR A;  2JRH A;  2L76 A;  4LDT B;  2FAZ A;  2DHZ A;  2FUH B;  2M8S A;  1IP9 A;  2KX0 A;  1RFA A;  3QAQ A;  3VTU A;  1VCB A;  3PS6 A;  2LXC A;  4IWP A;  3WA0 A;  2K8C A;  3ZIM A;  1J8C A;  4DWF A;  2L8J A;  2KO3 A;  1XQQ A;  4MGI E;  2OOB B;  2ZPY A;  2I1K A;  4B6W A;  2LGY A;  3PRP B;  4WJN A;  2DX5 B;  4EZJ A;  4B95 A;  4AOF A;  3CF6 E;  4W9C A;  1OEY J;  4A20 A;  2K8B A;  4TQ1 A;  1E7V A;  2J0J A;  2N1W A;  2RSU A;  3ZDM C;  3PLV A;  3M95 A;  4ANW A;  2O2V B;  5L83 A;  3PVL A;  3SHQ A;  1TTN A;  1R4N I;  1V5T A;  2V1Y A;  2ZCB A;  2R2Q A;  3NS8 A;  4MJS B;  2C9W B;  2BKF A;  2JRI B;  4PYU A;  4WJQ A;  1MG8 A;  2BGF A;  3DVN U;  3VUW A;  1IPG A;  1Q0W B;  1UH6 A;  1V5O A;  4FBJ B;  2BKR B;  1L2N A;  2KD0 A;  3SU8 X;  2J0M A;  4E3C A;  2L05 A;  2PE6 B;  3UIP B;  2YLM A;  2NBV B;  5AZH A;  5LXH A;  3N3K B;  2XBB C;  3NY5 A;  3H1U A;  1WM3 A;  3PT2 B;  3ZRC A;  5CX3 A;  3HM3 A;  1LXD A;  4K7W A;  4GMV A;  5AZF A;  2LJ5 A;  2D11 A;  3IFW B;  2D3G A;  3R66 C;  4IG7 B;  2CS4 A;  2MP2 A;  2KAN A;  3VUY A;  2DZK A;  2BPS A;  2KDF B;  3LJ3 A;  4DDI D;  1YQB A;  3QCA A;  2CKH B;  3ZLZ A;  4E71 A;  3IG3 A;  3JSV B;  5DCN A;  3R3M A;  2A5U A;  1WJ6 A;  4IUM B;  2FID A;  2L0F A;  2O2V A;  4ANV A;  2JVC A;  5CHW A;  4KVG B;  2WWZ A;  3V6C B;  1Q1O A;  4WQO B;  3HK0 A;  4ASW C;  4G50 A;  1WZ3 A;  3ZNG C;  2C7H A;  3QA8 A;  3DQV A;  2DYB A;  2IO1 B;  2KDE B;  1P9D U;  1WXM A;  1WIA A;  1WM2 A;  2PPH A;  4I6P A;  2J0K A;  3OAW A;  1E8W A;  2A4Z A;  2K8H A;  2JF5 A;  2LGX A;  2NR2 A;  1IYF A;  3WAO A;  4BOS C;  4AUQ C;  5J18 A;  1Q5W B;  3ALB A;  4HLE A;  3VFK A;  2BWF A;  1LFD A;  3A9K B;  3VQI A;  3RCZ A;  1E8Z A;  3UGB B;  4WWO A;  1C1Y B;  2KVR A;  3EEC A;  3W1S A;  1KM7 A;  2ZVN A;  2JZZ A;  4G3X B;  1L7Y A;  3HHM A;  3X0W A;  2KXJ A;  1H4R A;  2CHW A;  1EF5 A;  5JH5 C;  2IO3 B;  2FCN A;  4HXD A;  1WXV A;  2KDB A;  2R2O A;  4N9F 4;  2KMC A;  2B3A A;  1PQS A;  4K81 A;  3OJ4 B;  3UQA A;  1E8X A;  1GNU A;  1WE6 A;  4PS3 A;  2XEW A;  4TKN A;  4BKT A;  3DCG A;  2RR9 A;  4GN1 A;  4KV2 A;  3PHX B;  2LWP A;  4EZL A;  1HE8 A;  2AL3 A;  1XD3 B;  2N7D A;  5G2N A;  4DBG A;  1WXA A;  4K1R B;  1Z5S B;  4RMA A;  4JQW C;  2K39 A;  2L00 B;  4KSL C;  4XC2 A;  1CMX B;  2JUO A;  4FN2 A;  1P98 A;  2K25 A;  3L13 A;  1E7U A;  2ZJD A;  2N9X A;  4AJY B;  5JHA A;  2CR5 A;  4ZRJ A;  2KTR A;  4HK2 A;  4IWO A;  5G55 A;  3HIZ A;  1GC6 A;  2NPT A;  3B1L X;  3H7P B;  3PGE A;  3PTF C;  4NJ7 A;  2KJH B;  1WJ4 A;  2G4D B;  3VDZ A;  1GJZ A;  4II2 B;  2MBH A;  1TZ1 A;  1WX8 A;  4BBN C;  4IM0 A;  4MGY E;  5HKH A;  4II3 B;  5J2R A;  2IYD B;  4GB9 A;  3WAN A;  2WX1 A;  2M0X A;  3JVZ X;  3PLU A;  4FHK A;  4GOC A;  4MEL A;  4W9G A;  4DDG D;  2BYE A;  1D3Z A;  2DZI A;  3ONS A;  1RRB A;  2LZ6 A;  2N1V A;  1Y8R C;  4M8N A;  3MJW A;  1WI0 A;  1WGR A;  2KC1 A;  5LXI B;  1J0G A;  3DOW A;  4DHJ B;  3Q3F A;  4I6L B;  3TJP A;  3PRE A;  4NY0 A;  5D7G A;  4EZK A;  1WGG A;  1WX7 A;  4W9H A;  1E5W A;  4W9K A;  3A33 B;  1G6J A;  2UYZ B;  2C60 A;  3BIN A;  3UIO B;  5CTR C;  3EHV A;  4FA6 A;  4JIO U;  1UD7 A;  4IM2 A;  4W9F A;  1M94 A;  1KOT A;  1XT9 B;  1EUV B;  2DEN B;  3UQB A;  3A4R A;  4GDK A;  1EO6 A;  5LLI A;  3CSF A;  3TIX A;  2KOX A;  2GBJ A;  1WRD B;  3TL5 A;  1WYW B;  1V9J A;  1YX6 B;  3L08 A;  3O65 B;  1WE7 A;  3VVW B;  4KDI C;  3GOE A;  4W9I A;  4WWP A;  3ZTD A;  1WR1 A;  3MTN B;  4URK A;  1E8Y A;  2IY0 B;  2DAJ A;  5KHO A;  1ISN A;  2AEH A;  2DZJ A;  4J6I A;  1ZGU B;  4EKU A;  4NNJ B;  1UBQ A;  4JGH B;  2L0T A;  4MEM A;  4M8M A;  1RLF A;  2WX0 A;  3CST A;  4CO7 A;  3KUD B;  3A9J A;  3JYU A;  2AL6 A;  1H8C A;  3ML9 A;  3WAP A;  4NAW B;  2KFK B;  2KTR B;  4GDL B;  4MSQ B;  2RGF A;  2KMA A;  2JY6 A;  2GBK A;  4OVV A;  2MBO A;  3RD2 A;  2KNB A;  3V6E B;  2JWZ A;  3S2A A;  2KJR A;  2KQ7 A;  2JPH A;  3H7S A;  2MQJ A;  4FUL A;  3VHT C;  1I35 A;  4BKS A;  4MGK E;  1WR6 E;  3PV1 A;  3KYC D;  2CU1 A;  4GXB A;  5AZG A;  3R7Q A;  3SD5 A;  5D2M B;  3X23 A;  3ML8 A;  4DHZ E;  4CYE A;  1GC7 A;  3AUL A;  2OJR A;  1I42 A;  2ZEQ A;  1WZ0 A;  3RUL A;  3OJ3 A;  2YVC A;  3DBR I;  1U4A A;  3A9K A;  2N4F A;  1R4M I;  3ZVV A;  3A1Q A;  4G11 A;  2WYQ A;  1WFY A;  2KWU B;  3B0A A;  2JT4 B;  4WWN A;  4LDT D;  3PZD A;  3DVN V;  4BBN F;  1NBF C;  4KSK C;  4JL9 A;  2KX3 A;  2NPT B;  4LCD E;  3QAR A;  1F9J A;  5JHB A;  4ICU A;  2ZZP B;  4F8C B;  1QZE A;  2N9E B;  4KZ0 A;  1P3Q U;  4W9D A;  2HD5 B;  3VTV A;  2O6V D;  4AP4 C;  4IM3 A;  3CMM B;  3PRZ A;  1V2Y A;  4OVU A;  1X1M A;  3ZNZ B;  5D6J B;  1E90 A;  1JRU A;  2ZVO A;  1A5R A;  2DAF A;  2FCQ A;  4AWJ A;  1ZKH A;  5AEK B;  2KWC A;  1UGM A;  2G45 B;  1NI2 A;  2IO2 B;  5E6O A;  1J19 A;  4PS8 A;  3IHP C;  4HDO A;  2C7N B;  3ZNI D;  2FNJ B;  2FIF A;  2WDT B;  3ZNH B;  3Q3J A;  4FJZ A;  1EF1 A;  3V60 A;  5J17 A;  4WJP A;  4EOY A;  3A1Q B;  4IWQ A;  5L95 C;  2IY1 B;  2KDI A;  3M63 B;  3IVF A;  3KH0 A;  1T0Y A;  3KVF B;  4ANU A;  3HM6 X;  3ZRF A;  3KYD D;  4W9E A;  2FCS A;  3DBH I;  2Z0E B;  3WAM A;  2MRP A;  3H6N A;  4MGZ E;  1OQY A;  3H7P A;  3QJZ A;  2FCM A;  1WJN A;  4P7I A;  3AU5 A;  5E6P A;  4HVB A;  1YIW A;  4FLH A;  3RUI B;  4ZRK A;  3WIM A;  2Y5B B;  4W9L A;  3VH4 B;  3P2B A;  2G3Q B;  3DBS A;  3ZUN A;  3PHW B;  4IW0 A;  5C1Z A;  2M17 A;  2DYM A;  1UEL A;  2PEA A;  3DVG X;  3RT3 B;  2MCN B;  3ZKJ C;  2NS5 A;  1WX9 A;  4IC7 B;  4TUU A;  2RD0 A;  2NVU I;  4NPN A;  2EMT A;  1BT0 A;  4FHJ A;  4BKS D;  3QWZ B;  3L0W B;  1UZX B;  3KUC B;  4K7U A;  1VD2 A;  4BVU C;  3EC8 A;  3QK0 A;  4NAW A;  3DBL I;  3VXW A;  2REX A;  4KZC A;  1WGD A;  3MHS D;  4I6N B;  3U30 A;  4F1S A;  2RPQ A;  1V80 A;  2KLG A;  1KLV A;  4W9J A;  4PYZ A;  2D07 B;  3JSV A;  4GU2 A;  4KDL B;  3W1Y A;  1WF9 A;  1YD8 U;  1SGH A;  4LJO B;  5FR6 A;  2BYF A;  2DYO A;  1GG3 A;  1OTR B;  2MBQ A;  2M4N A;  2JZ3 B;  2O6V B;  3TCA A;  3L10 B;  5DPR A;  4TQ0 A;  2HJ8 A;  2KKC A;  3V61 A;  4JLC A;  2LXA A;  1WH3 A;  3APD A;  4HCP B;  1GUA B;  4FAD A;  1KJT A;  4EUT A;  4RM8 A;  1Z2M A;  2GBN A;  2IZV B;  3NZU A;  4CHK A;  2MBE A;  2ZNV C;  3L54 A;  3IBE A;  3U8Z A;  1OEY A;  2KFJ A;  3PRM B;  3SDL C;  3UF8 A;  4HWI B;  2Z59 B;  3AU4 A;  3DDC B;  3ECI A;  3APC A;  4BKG A;  2L3Z A;  3C0R B;  3V62 A;  3PSE B;  4GGQ A;  3TBL D;  2GBR A;  4E74 A;  2GMI C;  2PJH A;  4MM3 A;  3ZDT A;  2IO0 B;  3BY4 B;  1UBI A;  2LRU A;  3VH3 B;  2EKE C;  3W1S C;  1WXS A;  3K9P B;  4LJP B;  4X57 B;  1WGY A;  2K1F A;  4ZRI A;  1AAR A;  2MWS B;  5TR5 A;  3A9J B;  1RAX A;  4ANX A;  3T8M A;  2NCN A;  3NZS A;  3PPA A;  5CHV C;  4HDQ A;  1V6E A;  3JW0 X;  2C5L C;  3QX1 A;  3LDZ E;  1TGZ B;  4A3P A;  2J7Q B;  2MX2 A;  3D32 A;  4XZ4 A;  4TV3 A;  2MSE D;  2DZM A;  1S3S G;  3M3J A;  2ZCC A;  4BOZ B;  2ZPN A;  4DHJ D;  3QC8 B;  4F7Z A;  1WJU A;  4ZDV A;  2GBM A;  4MJS A;  1YX5 B;  4RM9 A;  4A3O A;  3QHT A;  5GMV A;  5DPW A;  2GOW A;  3DVG Y;  3R7R A;  3ZW3 A;  4WAA A;  3B08 A;  1K8R B;  3I3T B;  2MLB A;  1ZW7 A;  3KUZ A;  2UWQ A;  2D10 A;  3K9O B;  2CHZ A;  2C7M B;  2LGD A;  2MW5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...