2GOWA

Solution structure of bc059385 from homo sapiens
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
116
structure length
116
Chain Sequence
SSNVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Ubiquitin-like protein 3
publication title Solution structure of a membrane-anchored ubiquitin-fold (MUB) protein from Homo sapiens.
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2006-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13881 Rad60-SLD_2 Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2gowA01
2C7MB 1IPGA 2JT4B 2BYFA 2KFKA 3L17A 1YX6B 3VUYA 2KANA 2LWPA 3GOEA 3VUXA 4EEWA 3KUDB 3L16A 1IP9A 3M95A 4CHKA 4E71A 1WXMA 3EC8A 1RFAA 2JWZA 3A9KB 3BINA 2N7DA 1WE6A 2QHOA 3JSVB 1E8YA 2R2QA 2BPSA 2PEAA 3LDZE 5BO4B 3X23A 1SIFA 4FJYA 4GXBA 1V2YA 5DCNA 1U4AA 2OJRA 3DVGX 4W9GA 3UGBB 1SGHA 4LJOB 4BOSC 2M17A 1WZ3A 2K8CA 1WJ4A 2FAZA 4IWOA 3QK0A 1JRUA 4ANVA 3AU4A 2G4SA 2PE9A 4MGZE 3PSEB 3H7PB 1WR6E 3V61A 3KW5B 3A9KA 1L2NA 3UQBA 2L0FA 2JRHA 3JSVA 3C0RB 1OEYJ 4WWPA 2NBUA 3ZNID 2MCNB 1IYFA 2KFJA 1Q5WB 3GZNI 2LVOA 3PZDA 3ZRFA 2IO1B 4HK2A 4AWJA 1R4NI 4MDKE 1WX9A 3A9JB 3IBEA 5DPTA 3SDLC 4KV2A 4PS8A 2AEHA 2K6QA 2D10A 3H7PA 4K7SA 4HLEA 2BGFA 2D11A 3H6NA 5C1ZA 3ML9A 5E6NA 3SD5A 2NPTA 2CHZA 5CX3A 2JXXA 2YVCA 4WQOB 3UQAA 1OEYA 1XD3B 4ASWC 1ZW7A 4GDLA 5L95C 4MH0E 2IYDB 4EKUA 4OVVA 2NS5A 4W9HA 4BKTA 5L83A 1E8XA 2K1FA 1GUAB 1WGRA 2W9NA 3A9JA 4FHKA 3VH4B 2J7QB 5KHQA 2O6VA 3VFKA 3RZFA 1WMHB 1OGWA 4GGQA 3VDZA 2LGDA 3IFWB 4I6NB 3TJPA 1EF1A 4NY0A 3KYDD 4JL9A 4LDTB 4NAWB 3QX1A 1SE9A 2KMCA 4II3B 1GNUA 2GOWA 4HPLB 3TMPB 2HTHA 2LZ6A 2FIFA 2KKCA 1UD7A 2NVUI 1XQQA 3QAQA 4MELA 4XX5A 4ZDVA 1WGGA 4KDIC 3CF6E 5DPRA 2O2VA 1J0GA 3RD2A 2Z0DB 4K7UA 1V5OA 4HVBA 2G3QB 4W9EA 4DDGD 3APCA 5CHVC 3ZIMA 1WMHA 4ANUA 3CMMB 3UIOB 4BOZB 3OJ4B 4CYEA 4EZKA 1LM8B 3H1UA 5LXIB 4BKSD 2LVQA 5D7GA 2D07B 4NAWA 3X0WA 1Q1OA 3PVLA 4AJWA 3ZDMC 2WDTB 3NS8A 1E8WA 3VUWA 5JHAA 2ZZPB 4N9F4 1M94A 1I42A 1TTNA 3M63B 1WGYA 4WWOA 1UZXB 1WI0A 4NJ6A 1G6JA 1KM7A 2FCQA 1NI2A 2JZZA 2DYBA 2M0XA 2ZPNA 3WAPA 2LI5A 2BWES 2ZJDA 3DBSA 2JRIB 2M8SA 1RRBA 4FLHA 3QWZB 1ISNA 3RYTA 3PGEA 2N1VA 4W9JA 1WF9A 4K81A 4B9KA 3T8MA 3VQIA 1WFYA 2L00B 2XEWA 3D32A 1RAXA 2CHXA 2K6DB 2AL6A 4URKA 4KZ0A 2KTFA 2DZJA 2KWCA 2LGXA 2MBQA 2C9WB 4KVGB 4EUTA 2J0KA 2A5UA 1WXVA 2IY1B 3R3MA 2DYOA 3ALBA 2M4NA 1XT9B 2RD0A 3W1SA 3APDA 4HWIB 3RCZA 4TQ0A 3WALA 4PS7A 1LXDA 2PJHA 4GN1A 4XC2A 4TKNA 1I35A 2EMSA 3AXCA 4BVUC 2V3SA 4ZRJA 2CKHB 4NJ7A 2DX5B 2C7NB 5KHOA 1Z5SB 3P2BA 2K8HA 3H9DA 1MG8A 2K39A 4M0WB 1WY8A 1P98A 3NOBA 2G4DB 4RM9A 2JVCA 4KDLB 4WAAA 4ANXA 3TBLD 2L76A 4W9DA 4IM3A 1UBQA 3QIJA 4WJQA 3KVFB 3ZTDA 4M8MA 3PHXB 4LJPB 3U8ZA 4A20A 4FN2A 2KN5A 2ZNVC 4I6LB 1NDDA 4E74A 4PYZA 2DENB 3DCGA 3VTVA 2WX1A 2AWTA 3L54A 1V49A 5JHBA 1Q0WB 2LXCA 3S2AA 2FIDA 3DDCB 2WX0A 1WX8A 3B1LX 4GMVA 3SU8X 3VTWA 3ZNHB 2OOBB 3TL5A 2LVPA 3RZWC 3PHWB 3HHMA 4HDQA 2FUHB 2KX0A 2REXA 4W9FA 4II2B 2MBEA 3WIMA 3ZDTA 2GBKA 2DYMA 3B0AA 1R4MI 1UH6A 2A4ZA 5GMVA 1V86A 2MP2B 4KSKC 1E90A 5FR6A 5LXHA 2FCNA 4K7WA 4BKGA 1WGHA 4ZYNA 3SHQA 4EOYA 2NBWB 3VAWA 3O65B 2EMTA 2KDIA 3AI5A 3NHEB 5AZFA 1P0RA 3K9OB 4GOCA 5J2RA 3IG3A 4J6IA 2RPQA 3DVGY 1H8CA 2JY6A 4F1SA 2GBJA 1WIAA 4DXAB 3TIXA 1P9DU 3PRPB 2KC1A 4JIOU 4G11A 3DBRI 2AL3A 2FNJB 5C23A 3WAOA 4IC7B 4IUMB 1WX7A 4KZCA 1V9JA 5J18A 1V80A 4HJKA 2C7HA 2N9EB 2KO3A 4NNJB 5D94A 3V6CB 3RULA 4I6PA 4CO7A 2KD0A 1P1AA 2KHWB 3VXWA 3ZUNA 2KDEB 2GMIC 4G3XB 3DOWA 2O6VD 5DPWA 3VHTC 1WJ6A 1WM2A 3W1YA 3QHTA 3RUIB 4WJOA 2D3GA 1UBIA 3QA8A 2L8JA 4M8NA 3R7QA 4EZJA 3U7DA 4MJSB 4HPMB 3H7SA 5JZEB 2ZCBA 2R2OA 3EFUA 3VVWB 5CHFA 3KUZA 2PE6B 1OTRB 1LFDA 2PPHA 3IHPC 2MRPA 3PLUA 4FADA 2L0TA 1E8ZA 4IM2A 3V62A 4DK5A 2KWVB 5CTRC 5CHWA 4FA6A 2MA9B 4FULA 4P7IA 2YLMA 2AYOB 2MBHA 3VTUA 4B6WA 2Z59B 3PRMB 1YIWA 3KH0A 2RSUA 2HD5B 2KLCA 3K9PB 4A3OA 3CSTA 3QCAA 3ZTCA 1OQYA 4A3PA 4PS3A 2VRRB 1WJUA 2DAJA 4MJSA 4DBGA 3CSFA 1YJ1A 3PS6A 4DDID 1P3QU 3B08A 3WANA 1AARA 3RT3B 4LCDE 3ECIA 3NZUA 4W9LA 3DVNV 4BFRA 5HKHA 2Y5BB 4E3CA 3Q3FA 3NZSA 5IA7A 2HE7A 1YX5B 1ZGUB 2LASA 2DZIA 1J8CA 4DWFA 2IO2B 4MM3A 5D2MB 2FCMA 2C60A 2XK5B 5DPSA 3HM6X 3PPAA 4BBNC 2KMAA 2RR9A 2K25A 2JUOA 2N7EA 3ZLZA 1QZEA 4TQ1A 2J0MA 3R66C 1NBFC 3L0WB 1YQBA 3LJ3A 4ZRKA 2M1MA 1BT0A 2KJHB 2ZVOA 5E6OA 3QQ8B 3M62B 3UF8A 3KYCD 2N9PC 3MTNB 2IO0B 2B3AA 3EECA 4IWPA 1D3ZA 2I1JA 4HCPB 2MBBB 4MEMA 2XK5A 4GDKB 4KIKB 2BYEA 5JH5C 1PQSA 1WH3A 2GBRA 2KZRA 4EFOA 3EHVA 3DVNU 1GG3A 4GIVA 3A1QB 4WJPA 4AJYB 2NBVB 2BKRB 4AP4C 2KQSA 2DZMA 4MGYE 4IG7B 4G50A 4DHJD 1ZKHA 4HCNB 4ICUA 3U30A 2J0JA 1TZ1A 2KTRB 4ANWA 2MX2A 3VH3B 2BWFA 4FHJA 4F7ZA 3N32A 4GDKA 3R7RA 4KIKA 2GBNA 3UIPB 1GC6A 4MSQB 2KDBA 1J19A 2CU1A 2MWSB 3A1QA 2KXJA 3ZVVA 5TR5A 1TGZB 2DHZA 2DAFA 3T9LA 5IAAC 2L05A 2ZVNA 2MSED 2KQ7A 2ZNVB 1WR1A 2KK8A 3BY4B 2L3ZA 2NPTB 4JQWC 2LGYA 4X57B 1A5RA 2C5LC 1VCBA 4YL8A 1WRDB 2KTRA 3I3TB 3N3KB 1TBEA 3ONSA 4GDLB 2ZEQA 3JVZX 5AZHA 1C3TA 3M3JA 4NPNA 3QJZA 3L13A 1C1YB 4AUQC 4FJVB 2NR2A 3DPDA 1S3SG 1UGMA 2O6VB 3ZW3A 2CS4A 2CHWA 4ZRIA 2UWQA 4RM8A 4WJNA 1Y8RC 3MJWA 2MW5A 5E6PA 3MHSD 1EUVB 3JYUA 3TCAA 3PT2B 4NQKE 1E7UA 2MBOA 3WA0A 2KJ6A 4IW0A 2LUEA 3A4SC 3L08A 5AZGA 1WGDA 1T0YA 2MP2A 2LXAA 2WWZA 4RMAA 2LRUA 4XZ4A 4K1RB 2GBMA 2IZVB 2KDFB 2O2VB 2KNBA 1WXAA 2FCSA 4HDOA 2ZPYA 1S1QB 4WWNA 2ZCCA 1E7VA 3Q3JA 4F8CB 2DZKA 3JW0X 4OVUA 1V81A 4TUUA 5G2NA 2I1KA 3QARA 4W9IA 4BKSA 3PTFC 1HE8A 2HJ8A 2KX3A 2IBIB 3PLVA 2LRWA 3IVFA 4MGKE 2BYVE 2V4LA 1Z2MA 1K8RB 3ENEA 4W9CA 4AOFA 1V5TA 2D2QA 3HM3A 2L7RA 3DQVA 2KOXA 2LJ5A 3A33B 3OAWA 3A4RA 1WZ0A 2MQJA 3ZRCA 2KLGA 4KSLC 3AU5A 4FBJB 3ZNGC 2G45B 2KC2A 1LQBA 3WAMA 4EZLA 5J17A 2RGFA 3PREA 3HIZA 4TV3A 2BKFA 1L7YA 4MGIE 1X1MA 2ASQA 1KJTA 3AULA 4GB9A 4LDTD 3UINB 2Z0EB 2V1YA 3PV1A 4DHZE 3W1SC 2N1WA 3V6EB 1H4RA 3ZNZB 4GU2A 3APFA 1V6EA 2N9XA 4JLCA 2UYZB 4W9KA 3OLMD 1WM3A 4JGHB 3ZO5B 2CR5A 1GJZA 1EF5A 1CMXB 3HK0A 2MLBA 5LLIA 3OJ3A 2IO3B 2IY0B 1WJNA 2K8BA 2KJRA 1GC7A 2KWUB 2LD9A 2BF8B 4GSWA 4DHZB 5AEKB 1VD2A 2KFKB 3DBLI 2XBBC 2EKEC 1RLFA 1FXTB 1WE7A 4ICVA 1WXSA 2WYQA 3ZKJC 1KLVA 4IWQA 4B95A 1E5WA 2NCNA 2JPHA 4FJZA 4G0NB 1UELA 2KVRA 3ML8A 5EDSA 4BBNF 3KUCB 3N30A 1F9JA 4MSMB 4DHJB 3L10B 1YD8U 1WYWB 2JF5A 4PYUA 3PRZA 5G55A 4NQLB 4HXDA 3V60A 1KOTA 3NY5A 1EO6A 3QC8B 4IM0A 2N4FA 2JZ3B 3DBHI 5D6JB
chains in the Genus database with same CATH superfamily
4MT5A 4WAFA 1V1OA 3VUYA 1D5XC 5IP4D 3L16A 1IP9A 4CHKA 1RFAA 2JWZA 2PVOD 5IN7A 1N5WA 3W9CB 2OJRA 3DVGX 2V0GA 4BOSC 4IWOA 3AU4A 2PIAA 1JW9D 2G4SA 2QIEB 3AE8B 3PSEB 3T3NA 3SFDB 1J7AA 1SE4A 3C0RB 2EELA 3AEGB 3ZNID 2MCNB 1IYFA 2KFJA 1NVID 3GZNI 1HTQA 1R4NI 1ZXHA 3RNEC 4KV2A 4PS8A 2K6QA 4HLEA 3H6NA 2NPTA 1L4ZB 1Q10A 2AQ1B 1ZW7A 1L0VB 4RCOA 4ZOHC 5L83A 2NS5A 4BKTA 1WGRA 4J3OD 1WMHB 4GGQA 1B1ZA 3GE3C 1YN4A 4NAWB 4II3B 2LZ6A 2WGSA 1XQQA 4MELA 4XX5A 4ZDVA 1WGGA 2O2VA 2BB5A 4RF0A 2Z0DB 5C3JB 3FILA 1V5OA 4HVBA 2QDFA 2WXKA 1WMHA 3UIOB 2JYTA 5D7GA 1QQRA 4NAWA 1HTOA 1JCKB 2D5GA 1FCCC 4BZAA 3RMKC 4WQMA 1M94A 3W2DA 2IJ0A 1NI2A 3VR8B 2BWES 5JXVA 1XEEA 1RRBA 4FLHA 3AMZA 3DBLB 2LEKA 4PK1A 4ARIA 1FEHA 1WF9A 4B9KA 3D32A 2FUG1 4URKA 1FRDA 2DZJA 4YSXB 1SJED 3WCQA 4EUTA 2MBQA 3R8BA 1WXVA 1IGCA 1F0ZA 3ALBA 3W1SA 1N61A 2PJHA 1HQRD 4TKNA 2KQ4X 3Q8AA 2EMSA 4ZRJA 2CKHB 3HVZA 3P2BA 2FBWB 1MG8A 4IKGA 4M0WB 3W5UB 3NOBA 1P98A 1N6ZA 2G4DB 4XGAB 2DLBA 1SXTA 4LNKA 4LJPB 2KN5A 2ZNVC 5BMGA 2DENB 1V49A 3S2AA 4M0WA 2HJ1A 3ZNHB 4GMVA 2OOBB 3HHMA 4HDQA 1TS3A 4HJGE 4W9FA 4II2B 2TSSA 3WIMA 2GBKA 5GMVA 1SF0A 5C2TB 3SHQA 4EOYA 3DHIC 2EMTA 1FMAD 2KDIA 1P0RA 4ARCA 4OVZA 5J2RA 4XE0A 2RPQA 3DVGY 2JY6A 2QJLA 4DXAB 1P9DU 2G9HD 5AUKA 1TY0A 4IC7B 1XLNA 1WX7A 4KZCA 1V9JA 3V6CB 2KHWB 2MJ3A 1FFVA 1YJJA 2NTTA 3VHTC 3RUIB 2MJEA 2D3GA 3R7QA 3I9V1 3PZ7A 3VVWB 3KUZA 1LFDA 3PLUA 1FNVA 4FADA 1E8ZA 4IM2A 3V62A 1VRAB 2KWVB 4P7IA 3LB8C 1M4VA 4N6EB 3ZTCA 4A3PA 1YQ4B 2VRRB 1L0XB 3WANA 3ZYYX 3RT3B 3NZUA 4W9LA 3DVNV 2W55A 3Q3FA 3NZSA 5IA7A 1CQVA 3ETRA 4TSSA 2LASA 2IO2B 2IGDA 2FCMA 2H89B 1N60A 3NVVA 2RR9A 4PT5A 3ZLZA 2INDC 3R66C 3GE8C 3LJ3A 2M1MA 1MJDA 5LNK1 3OWEB 3QQ8B 1TT5B 3UF8A 2N9PC 2IO0B 2B3AA 1D3ZA 2I1JA 4HCPB 3AE4B 1XLPA 1PQSA 4EFOA 3EHVA 4IOIE 4WJPA 1MHXA 4RH6A 3NJTA 2BKRB 1PDXA 4HRSA 4G50A 2KDMA 1C79A 2J0JA 4ANWA 2CJOA 3UIPB 1VZ6A 2KDBA 2WXLA 1J19A 3T3OA 1IGDA 3ZVVA 5IAAC 1T0QC 2L05A 4LJOB 1LO5D 1I4GA 3I3TB 1DOIA 3NZ3A 3ZJUA 1TBEA 2IGGA 3ONSA 2ZEQA 1JROA 2QEJC 1SSNA 4YSYB 1TS4A 1S3SG 1PGBA 2QMTA 4WIPA 2CHWA 4LNIA 2CU3A 3H8HA 4WJNA 1Y8RC 2CJNA 3JYUA 3PT2B 2LUEA 3L08A 4LNFA 1R7SA 2LRUA 1AN8A 2KDFB 1WXAA 2FCSA 4HDOA 2ZPYA 3Q3JA 4F8CB 4K3CA 2DZKA 1V81A 2I1KA 1E9MA 3CWIA 2LRWA 3IVFA 3MJ5A 3RI7C 3BVGA 3DQVA 3NG0A 2KOXA 3OAWA 1J7BA 1E0ZA 3ZRCA 3FC4A 2E3TA 2KC2A 2VH1A 4P1CC 1I4HA 3AULA 4LDTD 1QT9A 2L1AA 2V3PA 3UINB 2V1YA 4MACA 4OZBA 3PV1A 3V6EB 1H4RA 4P1BC 3ZNZB 4GU2A 4JWUC 1CMXB 3J9CA 2MLBA 2IY0B 4KKIA 1VD2A 4JX1C 3HVDA 1FXTB 1WE7A 4ICVA 1WXSA 4IWQA 2LHEA 2JPHA 1T0SC 2NCNA 2QC8A 4BBNF 1STEA 3N30A 4MSMB 5BMIA 2JF5A 1WYWB 5G55A 3V60A 1KOTA 5EE1A 2JU6X 5BYRA 2Y3AA 3BVZA 1IPGA 2BYFA 1N63A 4C80A 2KANA 2LWPA 3AE6B 1KH0A 3GOEA 4EEWA 5FKAC 3EC8A 3A9KB 4LLGM 2N7DA 1WE6A 2R2QA 3IAS1 2BPSA 5BO4B 3RNFC 1JALA 1QOGA 5DCNA 3UGBB 3RNCC 1FRRA 2INCC 1NENB 5FK9C 1WR6E 3V61A 3KW5B 3A9KA 1RWSA 2NBUA 3PZDA 4RGNA 1TS5A 2IO1B 4AWJA 4MDKE 1ZDXA 3A9JB 3IBEA 4OZCA 1OQRA 1FXIA 1YJIA 1V1PB 2D11A 3SD5A 5CX3A 5IKCM 5AUIA 3UQAA 2RDHA 3MHZA 1OEYA 2FE8A 2JX5A 1KLGD 2IYDB 4EKUA 4OVVA 4W9HA 1HZ6A 2K1FA 1GUAB 4FHKA 3A9JA 1E10A 2O6VA 3Q6BA 5BMHA 1V1PA 4I6NB 3IFWB 1K53A 4NY0A 1RYJA 3KYDD 1UF0A 2W3SA 5D3DA 3GS2A 4C56C 1XLQA 5HHDG 1GNUA 2GOWA 4KGSA 2ACZB 3Q8BA 3TMPB 2KKCA 3QAQA 1UD7A 1DOXA 5DPRA 1J0GA 3RD2A 4K7UA 2K9XA 5CHVC 3ZIMA 3CMMB 4CYEA 3IAM1 2LFIA 2GRIA 4C4VB 2ZW1A 4NAMA 4BKSD 2LVQA 3X0WA 1P7FA 4AJWA 3N1ZC 1ZOYB 3BK1A 3U7ZA 4WWMA 1Y56A 2BW2A 1WI0A 1L4DB 4MM3B 1KM7A 2M0XA 2ZPNA 2LUMA 4C4VA 3QWZB 1ISNA 2N1VA 3VQIA 2L00B 3IXSA 1RAXA 2M0AA 4JWSC 4KZ0A 4ACFA 2KTFA 2BB6A 2C9WB 2J0KA 2A5UA 2IY1B 3V05A 2M4NA 3LYYA 2RD0A 3RCZA 2Y5CA 3MP9A 4B0EA 1C76A 2M19A 1GB4A 4NJ7A 2DX5B 5KHOA 3H9DA 1SBBB 1WY8A 4ANXA 2G1EA 3TBLD 2L76A 4IM3A 2M56B 3KVFB 1WGKA 3U8ZA 1SB3C 3NVYA 2MJDA 2WX1A 1T6BX 2WX0A 3B1LX 3C8YA 4A6QA 2LVPA 3RFZB 2WXIA 1FPYA 1NYQA 5EE9A 3E9SA 2DYMA 2A4ZA 1MI0A 1V86A 1E90A 2KACA 2NBWB 4J6IA 1H8CA 2GBJA 2GLSA 3TIXA 1JRPA 4FXCA 2FNJB 5J18A 1V80A 4HJKA 2BYTA 4NNJB 1GAQB 1T0RC 1P1AA 2JXTA 3VXWA 4DQOC 2KDEB 1FCLA 4G3XB 2AX5A 3W1YA 1WM2A 1TS2A 4M8NA 1UBIA 2L8JA 4YWGG 2VZKB 3H7SA 4S0RA 2R2OA 4DXGA 3I5JC 3IHPC 3IT4B 2DWQA 4DK5A 5CHWA 4FULA 3OG5A 3VTUA 2Z59B 3KH0A 2RSUA 2KLCA 3K9PB 1QOAA 4PS3A 1VDVA 1C77A 1CJEA 2WDVB 1YJ1A 2ON8A 4N59A 1P3QU 3ECIA 1XCTL 5HI1A 1I7HA 2HE7A 1YX5B 4RF1A 4YSZB 1T5XD 1J8CA 3PPAA 4BBNC 2J4XA 2K25A 2N7EA 1QZEA 4KX6B 2J0MA 1VZ8A 3MFGA 3AV8A 3L0WB 2KJHB 2ZVOA 3RPFC 4ZHOA 2LGIA 2D3AA 2AQ2B 2WXPA 4MEMA 4A90A 4GDKB 2KZRA 2V9HA 5G5GA 1A70A 2J53A 1IBXB 1WRIA 4MGYE 3RNGC 4ICUA 3U30A 1TZ1A 2KTRB 1BUIC 3N32A 4GDKA 1K51A 2GBNA 3GZNB 1R4NB 2KXJA 5TR5A 1TGZB 2DHZA 1P7EA 3T9LA 1IBXA 2ZNVB 2KQ7A 4ZRPA 1WR1A 2KK8A 1L6UA 2L3ZA 4X57B 2WXJA 4NJCA 1VCBA 4YL8A 1WRDB 1FNUA 2KTRA 4IDIA 5H8YE 4GDLB 1JWAD 3M3JA 4NPNA 1C1YB 3DHHC 2CS4A 4ZRIA 2XN9C 2MW5A 4LNOA 5E6PA 1EUVB 4OHJA 1E7UA 1F77A 4O1NA 2LJIA 3A4SC 3BVMA 3TEYA 1T0YA 4RMAA 3P4PB 2V4IB 2KNBA 2RPVA 3UI3A 2ZCCA 3EA6A 3JW0X 1PFDA 3R2TA 3QARA 2IBIB 4A55A 3ENEA 4USAA 2D2QA 2L7RA 3A33B 1FXAA 1WZ0A 3C19A 1TKYA 2KWDA 1V8CA 1LQBA 3WAMA 4NZLB 3PREA 4MGIE 4GB9A 3U52E 1OQQA 2N9XA 3SEBA 4M02A 1EF5A 2BVCA 1GOZA 3HK0A 3OJ3A 1VLBA 2KWUB 4GSWA 5AEKB 2KFKB 1XXGA 1I4PA 2XBBC 1RLFA 4B95A 3ZGZA 2KVRA 3ML8A 1HZ5A 3KUCB 3Q3MC 1DOYA 5T8IA 3PRZA 1SE3A 3NY5A 3QC8B 2KYWA 4RM8A 3DBHI 3Q8FA 2JT4B 2KFKA 1YX6B 3BYYB 4UDUC 3VUXA 3KUDB 1MHHE 4S17A 3SFEB 3M95A 1WXMA 2Q5WD 1AYFA 1TKEA 2QHOA 5EE0A 3HUIA 1XCQL 4FJYA 4GXBA 2WXRA 4W9GA 5I4DA 1SGHA 2M17A 4LNNA 1WZ3A 2K8CA 3QK0A 4ANVA 1K52A 1AW7A 3NRZA 2PE9A 1L2NA 3AN1A 3UQBA 2L0FA 2JRHA 2K22A 2MH7A 1Q5WB 2WP9B 3NVWA 3ZRFA 1QLBB 1WX9A 3U2SC 3N1XC 1D4BA 1LGRA 2AEHA 2D10A 2X38A 5E6NA 4XYCA 2LMCA 4A9AA 3DWGC 2JXXA 2YVCA 4WQOB 4ASWC 1XLOA 5L95C 4L23A 1L0YB 2IGHA 1FD6A 2W9NA 4C7YA 2J7QB 1N5XA 3VFKA 2PKOA 1OGWA 3VDZA 1I4QA 1UWMA 1EF1A 4LDTB 3QX1A 2ZW0A 1SE9A 2HDEA 2KMCA 2FIFA 2NVUI 3B2GA 1YN5A 2Z8LA 1XF5L 4KDIC 3CF6E 2G3QB 4W9EA 3HRDD 1C78A 3APCA 4BOZB 3OJ4B 2WXQA 3H1UA 2D07B 3PVLA 3ZDMC 3AH7A 3NS8A 4P6VF 3VUWA 5JHAA 2ZZPB 1E6EB 1TTNA 3M63B 1WGYA 1UZXB 2BS3B 2FCQA 2JZZA 2PMVA 3WAPA 2ZJDA 3URYA 1WSPA 1BXTA 2JRIB 2SEBD 2NTSA 1FNWA 4W9JA 2KN4A 3T8MA 1WFYA 2XEWA 4XDDA 2AL6A 3EUB2 3Q14C 3P42A 1PUTA 1MPEA 3R3MA 2DYOA 3APDA 3AEEB 3WALA 4PS7A 1LXDA 4Q2JA 1I35A 3AE5B 3RN9C 3O13A 1ET9A 1Z5SB 2K8HA 3N20C 4KGTA 4RM9A 4KDLB 3W5VB 4W9DA 1UBQA 4WJQA 3ZTDA 4M8MA 3PHXB 4A20A 4FN2A 1ZXIA 1KTKA 4I6LB 4E74A 5HFYA 3DCGA 2AWTA 3GB1A 1Q0WB 2KVZA 4GLSC 2FIDA 3DDCB 1KRHA 1WX8A 1J7CA 1AWDA 3RZWC 3PHWB 2KX0A 2REXA 1TY2A 2MBEA 3ZDTA 4KKJA 1R4MI 3TEZA 2MP2B 4KSKC 5FR6A 2FCNA 4K7WA 4BKGA 4ZYNA 1L6VA 3AEBB 1YN3A 3VAWA 2WNMA 3K9OB 4GOCA 1C4PA 4JIOU 3DBRI 2AL3A 2B76B 4KGRA 5FR3A 2N9EB 2KO3A 3RULA 3TSSA 2KD0A 4ZHPA 3R2IA 2GMIC 2O6VD 3TEXA 3QHTA 4WJOA 1XO3A 1D6EC 4MJSB 4HPMB 2ZCBA 3EFUA 2N0SB 2PPHA 3TUOA 4D2KA 1ROEA 2IPKD 2MA9B 3MC9A 2OHFA 2JYEA 2R61A 1YIWA 1PGAA 3AE2B 2HD5B 3CSTA 3QCAA 1WJUA 1PYWD 4MJSA 3N1YC 3PS6A 4FA6A 3B08A 4LCDE 2WLBA 1JMLA 3B2FA 5HKHA 2J52A 2Y5BB 3TEWA 1ZGUB 4CQNA 2INNE 2DZIA 4MM3A 4YTMB 2K5PA 4OZAA 5H92C 2JUOA 3AE3B 4TQ1A 1NBFC 1BT0A 3BZDB 3M62B 3KYCD 4AS1A 3EECA 4IWPA 1BMLC 2MBBB 3VRAB 3BYTB 2GBRA 2IDYA 2JZPA 2LGSA 4GIVA 1F2RI 4YXDB 1ZUD2 2KMMA 2NBVB 3DHGC 4AP4C 2YEPF 1I4RA 3AM9A 4RNAA 4DHJD 3AE9B 1ZKHA 2X8XX 4HCNB 5MPOA 2WQYB 3VH3B 2BWFA 4FHJA 4F7ZA 1GC6A 5EE3A 4MSQB 4JPSA 1ENFA 2MWSB 2DAFA 3NVZA 2ZVNA 5TSSA 3BY4B 2BBCA 2NPTB 1A5RA 5G5HA 2C5LC 1L5PA 1N62A 4RFBA 2I38A 1C3TA 5AZHA 1R4MB 3QJZA 4AUQC 3DPDA 3ZW3A 3EFCA 2UWQA 1QKZA 4C7ZA 3MJWA 3MHSD 2PTLA 3WA0A 1SE2A 2KJ6A 2LXAA 3DBRB 4K1RB 2O2VB 3FILB 2I2YA 1E7VA 5BYQA 2WDQB 1DGJA 2WU5B 4QAYA 1YNTE 4W9IA 3SR6A 3PTFC 1HE8A 3P4QB 3MC0B 2HJ8A 2KX3A 3PLVA 1FIQA 1JWSD 1T3QA 1Z2MA 1K8RB 4W9CA 4AOFA 3HM3A 2KLGA 4KSLC 3ZXVA 3I63C 4YTNB 1D5ZC 3E56A 4WH4A 1QOFA 1VZ7A 2RGFA 3HIZA 4TV3A 2BKFA 1L7YA 5IO9A 1X1MA 2ASQA 1KJTA 2V3NA 2Z0EB 1JWUD 1WYGA 4DHZE 4ZRQA 2N1WA 3W1SC 3APFA 3FKYA 1V6EA 2WXNA 2UYZB 1WM3A 4JGHB 1GJZA 1ESFA 2L32A 2KJRA 2K8BA 1GC7A 4DHZB 2BF8B 3IT6B 2EKEC 2VZKD 2WHIA 2L83A 2WYQA 2WS3B 3ZKJC 1KLVA 1E5WA 4C00A 4G0NB 1UELA 5EDSA 1F2RC 3L10B 1FFUA 1YD8U 5HG2A 4NQLB 4HXDA 1EO6A 2JZ3B 1GPXA 5D6JB 2C7MB 4US8A 2PLPA 3L17A 1ZDVA 1ZE3D 1ZP0B 4E71A 2J42A 3BINA 3JSVB 1E8YA 2PEAA 3LDZE 3X23A 1SIFA 2JSVX 1V2YA 3VRBB 1UUPA 1U4AA 4K3BA 3DWMA 4RGOS 1WJ4A 2FAZA 2K3UA 2PVGC 1JRUA 1F1HA 4HEA1 4MGZE 4ZYSA 3H7PB 2D3CA 3JSVA 2RDGA 1OEYJ 3V3XA 1HXYD 4WWPA 2W54A 2RMMA 1CZPA 2LVOA 4HK2A 1ET6A 5DPTA 2BT6A 3SDLC 4HPPA 1EM7A 3BIID 2LHDA 4K7SA 3H7PA 2BGFA 4WURA 5C1ZA 3ML9A 2CHZA 1TZOA 3NS1A 3P1MA 4RGMA 1XD3B 3NUHB 4GDLA 3Q8CA 3B9JA 4MH0E 2GB1A 3ZXRA 1E8XA 5KHQA 3VH4B 3AEFB 3U4EG 3RZFA 1NI3A 2OJWA 1WWTA 1QOBA 2LGDA 3TJPA 3AB5A 4JL9A 1I4XA 2VH2A 1TYGB 4HPLB 2HTHA 2NMQA 1K50A 2UU7A 2XNAC 2QCZA 4DDGD 4ANUA 4EZKA 1LM8B 4HROA 5LXIB 1Q1OA 2H88B 2WDTB 3GP7A 1E8WA 2ONQA 3Q69A 4N9F4 1I42A 4WWOA 4NJ6A 1EWCA 1G6JA 2W82A 3AE7B 2DYBA 2LI5A 3DBSA 1WXQA 2M8SA 4HKZE 1ACCA 3RYTA 3ZJVA 3PGEA 1SJHD 4K81A 2K6DB 2CHXA 1OFFA 2PW9A 3P4RB 2KWCA 2LGXA 1SIJA 4KVGB 3RNBC 2BQQA 1JWBD 1XT9B 4HWIB 4TQ0A 1MFWA 4XC2A 4GN1A 3Q2AC 2SAKA 1KLUD 3AXCA 4BVUC 3AEAB 3EGRA 2V3SA 4US9A 2C7NB 1C4CA 3PO0A 2K39A 3ZJTA 1EU3A 2DBYA 1YQ3B 2JVCA 4WAAA 3BWUD 2AQ3B 3QIJA 2ICIA 3Q3NC 1NDDA 2YEPB 4PYZA 3VTVA 4YTPB 5E6JA 5JHBA 3L54A 2LXCA 3VTWA 3SU8X 3TL5A 2E6XA 5GXGB 1UWXA 2WU2B 2FUHB 3B0AA 1UH6A 1NYRA 1IUEA 5LXHA 1V97A 1WGHA 2WXFA 3O65B 1B9RA 3AI5A 4MH8A 1QILA 3ABVB 3NHEB 3MC8A 4OW0A 5AZFA 1TIFA 3IG3A 3KWLA 4F1SA 1WIAA 3PRPB 2KC1A 5D3IB 4G11A 5BYSA 5C23A 3WAOA 3KWVA 4IUMB 3VR9B 2C7HA 4JE3B 5D94A 1DYQA 4I6PA 4YT0B 3ZUNA 2QSDA 4P16A 3DOWA 5DPWA 1WJ6A 3QA8A 4EZJA 2WDRB 3I57A 3U7DA 2L52A 1F52A 3P4SB 1PGXA 5JZEB 5CHFA 2EKIA 2PE6B 1OTRB 3CIRB 1KFYB 2MRPA 1TKGA 2L0TA 4M01A 5CTRC 2QILA 2YLMA 2AYOB 2MBHA 4B6WA 3PRMB 4A3OA 1YOVB 1OQYA 2DAJA 2OEDA 4DBGA 3CSFA 4DDID 2BS4B 1AARA 2MHJA 2BTEA 4BFRA 4E3CA 2D3BA 1C4AA 4DWFA 5D2MB 2C60A 2XK5B 4BAXA 3AE1B 5DPSA 3HM6X 2KMAA 1JWMD 2N9LA 1FM0D 1C9FA 1VR9A 3DBHB 2WXMA 1YQBA 4ZRKA 2INPE 3AECB 3KLSX 5E6OA 3Q3OC 3MTNB 4XWTA 2DNFA 1YMHE 2XK5A 4KIKB 2BYEA 5JH5C 1WH3A 4XDCA 3Q8EA 1EWYC 3DVNU 1GG3A 3A1QB 1FO4A 4AJYB 5IOIA 2GI9A 2WXOA 1QF6A 2DZMA 2KQSA 4L2YA 1SEBD 4IG7B 1NEKB 1UGJA 2MX2A 3R7RA 4KIKA 1EU4A 4B0MA 2CU1A 3A1QA 2BS2B 3LXFA 4EE2A 2Y5PA 2JQRB 2MSED 4RGTA 4CO7A 3AEDB 4JQWC 2LGYA 2JWUA 4HKQA 3N3KB 1TJEA 3JVZX 4DXFA 1VJKA 3L13A 2K0PA 4FJVB 2NR2A 2O6VB 1UGMA 4N58A 2MEKA 4TMAB 1ZPSA 3TCAA 4NQKE 2MBOA 4IW0A 5AZGA 1WGDA 2MP2A 4R3DA 2WWZA 2KT7A 1RM6C 4XZ4A 2GBMA 2IZVB 4LK0M 1S1QB 4WWNA 2KAJA 4AQ7A 4M00A 4OVUA 4TUUA 5G2NA 4BKSA 4A8XC 4MGKE 2BYVE 2V4LA 1V5TA 3ZQ4A 2LJ5A 3A4RA 1HEZE 2MQJA 1RFKA 1CK1A 2N7JA 3AU5A 4FBJB 3ZNGC 1UNSA 1KF6B 2G45B 4ITKA 4EZLA 5J17A 1MVKA 1HA5A 3RNAC 4LTUA 3L4PA 3P63A 1MG4A 4L1BA 4JLCA 3BK2A 2W3RA 4H2AA 4W9KA 3OLMD 3ZO5B 2CR5A 1D5MC 5LLIA 2IO3B 1WJNA 2LD9A 3DBLI 3N9YC 1E7PB 2N9KA 4REZA 2WXHA 3FAHA 2WXGA 3PZ8A 4FJZA 4XWWA 2HTME 1F9JA 4DHJB 1JQ4A 4PYUA 1GB1A 3KQ4A 4IM0A 2RDBC 2N4FA
chains in the Genus database with same CATH topology
2C7MB 1IPGA 2JT4B 2BYFA 2KFKA 3L17A 1YX6B 3VUYA 2KANA 2LWPA 3GOEA 3VUXA 4EEWA 3KUDB 3L16A 1IP9A 3M95A 4CHKA 4E71A 1WXMA 3EC8A 1RFAA 2JWZA 3A9KB 3BINA 2N7DA 1WE6A 2QHOA 3JSVB 1E8YA 2R2QA 2BPSA 2PEAA 3LDZE 5BO4B 3X23A 1SIFA 4FJYA 4GXBA 1V2YA 5DCNA 1U4AA 2OJRA 3DVGX 4W9GA 3UGBB 1SGHA 4LJOB 4BOSC 2M17A 1WZ3A 2K8CA 1WJ4A 2FAZA 4IWOA 3QK0A 1JRUA 4ANVA 3AU4A 2G4SA 2PE9A 4MGZE 3PSEB 3H7PB 1WR6E 3V61A 3KW5B 3A9KA 1L2NA 3UQBA 2L0FA 2JRHA 3JSVA 3C0RB 1OEYJ 4WWPA 2NBUA 3ZNID 2MCNB 1IYFA 2KFJA 1Q5WB 3GZNI 2LVOA 3PZDA 3ZRFA 2IO1B 4HK2A 4AWJA 1R4NI 4MDKE 1WX9A 3A9JB 3IBEA 5DPTA 3SDLC 4KV2A 4PS8A 2AEHA 2K6QA 2D10A 3H7PA 4K7SA 4HLEA 2BGFA 2D11A 3H6NA 5C1ZA 3ML9A 5E6NA 3SD5A 2NPTA 2CHZA 5CX3A 2JXXA 2YVCA 4WQOB 3UQAA 1OEYA 1XD3B 4ASWC 1ZW7A 4GDLA 5L95C 4MH0E 2IYDB 4EKUA 4OVVA 2NS5A 4W9HA 4BKTA 5L83A 1E8XA 2K1FA 1GUAB 1WGRA 2W9NA 3A9JA 4FHKA 3VH4B 2J7QB 5KHQA 2O6VA 3VFKA 3RZFA 1WMHB 1OGWA 4GGQA 3VDZA 2LGDA 3IFWB 4I6NB 3TJPA 1EF1A 4NY0A 3KYDD 4JL9A 4LDTB 4NAWB 3QX1A 1SE9A 2KMCA 4II3B 1GNUA 2GOWA 4HPLB 3TMPB 2HTHA 2LZ6A 2FIFA 2KKCA 1UD7A 2NVUI 1XQQA 3QAQA 4MELA 4XX5A 4ZDVA 1WGGA 4KDIC 3CF6E 5DPRA 2O2VA 1J0GA 3RD2A 2Z0DB 4K7UA 1V5OA 4HVBA 2G3QB 4W9EA 4DDGD 3APCA 5CHVC 3ZIMA 1WMHA 4ANUA 3CMMB 3UIOB 4BOZB 3OJ4B 4CYEA 4EZKA 1LM8B 3H1UA 5LXIB 4BKSD 2LVQA 5D7GA 2D07B 4NAWA 3X0WA 1Q1OA 3PVLA 4AJWA 3ZDMC 2WDTB 3NS8A 1E8WA 3VUWA 5JHAA 2ZZPB 4N9F4 1M94A 1I42A 1TTNA 3M63B 1WGYA 4WWOA 1UZXB 1WI0A 4NJ6A 1G6JA 1KM7A 2FCQA 1NI2A 2JZZA 2DYBA 2M0XA 2ZPNA 3WAPA 2LI5A 2BWES 2ZJDA 3DBSA 2JRIB 2M8SA 1RRBA 4FLHA 3QWZB 1ISNA 3RYTA 3PGEA 2N1VA 4W9JA 1WF9A 4K81A 4B9KA 3T8MA 3VQIA 1WFYA 2L00B 2XEWA 3D32A 1RAXA 2CHXA 2K6DB 2AL6A 4URKA 4KZ0A 2KTFA 2DZJA 2KWCA 2LGXA 2MBQA 2C9WB 4KVGB 4EUTA 2J0KA 2A5UA 1WXVA 2IY1B 3R3MA 2DYOA 3ALBA 2M4NA 1XT9B 2RD0A 3W1SA 3APDA 4HWIB 3RCZA 4TQ0A 3WALA 4PS7A 1LXDA 2PJHA 4GN1A 4XC2A 4TKNA 1I35A 2EMSA 3AXCA 4BVUC 2V3SA 4ZRJA 2CKHB 4NJ7A 2DX5B 2C7NB 5KHOA 1Z5SB 3P2BA 2K8HA 3H9DA 1MG8A 2K39A 4M0WB 1WY8A 1P98A 3NOBA 2G4DB 4RM9A 2JVCA 4KDLB 4WAAA 4ANXA 3TBLD 2L76A 4W9DA 4IM3A 1UBQA 3QIJA 4WJQA 3KVFB 3ZTDA 4M8MA 3PHXB 4LJPB 3U8ZA 4A20A 4FN2A 2KN5A 2ZNVC 4I6LB 1NDDA 4E74A 4PYZA 2DENB 3DCGA 3VTVA 2WX1A 2AWTA 3L54A 1V49A 5JHBA 1Q0WB 2LXCA 3S2AA 2FIDA 3DDCB 2WX0A 1WX8A 3B1LX 4GMVA 3SU8X 3VTWA 3ZNHB 2OOBB 3TL5A 2LVPA 3RZWC 3PHWB 3HHMA 4HDQA 2FUHB 2KX0A 2REXA 4W9FA 4II2B 2MBEA 3WIMA 3ZDTA 2GBKA 2DYMA 3B0AA 1R4MI 1UH6A 2A4ZA 5GMVA 1V86A 2MP2B 4KSKC 1E90A 5FR6A 5LXHA 2FCNA 4K7WA 4BKGA 1WGHA 4ZYNA 3SHQA 4EOYA 2NBWB 3VAWA 3O65B 2EMTA 2KDIA 3AI5A 3NHEB 5AZFA 1P0RA 3K9OB 4GOCA 5J2RA 3IG3A 4J6IA 2RPQA 3DVGY 1H8CA 2JY6A 4F1SA 2GBJA 1WIAA 4DXAB 3TIXA 1P9DU 3PRPB 2KC1A 4JIOU 4G11A 3DBRI 2AL3A 2FNJB 5C23A 3WAOA 4IC7B 4IUMB 1WX7A 4KZCA 1V9JA 5J18A 1V80A 4HJKA 2C7HA 2N9EB 2KO3A 4NNJB 5D94A 3V6CB 3RULA 4I6PA 4CO7A 2KD0A 1P1AA 2KHWB 3VXWA 3ZUNA 2KDEB 2GMIC 4G3XB 3DOWA 2O6VD 5DPWA 3VHTC 1WJ6A 1WM2A 3W1YA 3QHTA 3RUIB 4WJOA 2D3GA 1UBIA 3QA8A 2L8JA 4M8NA 3R7QA 4EZJA 3U7DA 4MJSB 4HPMB 3H7SA 5JZEB 2ZCBA 2R2OA 3EFUA 3VVWB 5CHFA 3KUZA 2PE6B 1OTRB 1LFDA 2PPHA 3IHPC 2MRPA 3PLUA 4FADA 2L0TA 1E8ZA 4IM2A 3V62A 4DK5A 2KWVB 5CTRC 5CHWA 4FA6A 2MA9B 4FULA 4P7IA 2YLMA 2AYOB 2MBHA 3VTUA 4B6WA 2Z59B 3PRMB 1YIWA 3KH0A 2RSUA 2HD5B 2KLCA 3K9PB 4A3OA 3CSTA 3QCAA 3ZTCA 1OQYA 4A3PA 4PS3A 2VRRB 1WJUA 2DAJA 4MJSA 4DBGA 3CSFA 1YJ1A 3PS6A 4DDID 1P3QU 3B08A 3WANA 1AARA 3RT3B 4LCDE 3ECIA 3NZUA 4W9LA 3DVNV 4BFRA 5HKHA 2Y5BB 4E3CA 3Q3FA 3NZSA 5IA7A 2HE7A 1YX5B 1ZGUB 2LASA 2DZIA 1J8CA 4DWFA 2IO2B 4MM3A 5D2MB 2FCMA 2C60A 2XK5B 5DPSA 3HM6X 3PPAA 4BBNC 2KMAA 2RR9A 2K25A 2JUOA 2N7EA 3ZLZA 1QZEA 4TQ1A 2J0MA 3R66C 1NBFC 3L0WB 1YQBA 3LJ3A 4ZRKA 2M1MA 1BT0A 2KJHB 2ZVOA 5E6OA 3QQ8B 3M62B 3UF8A 3KYCD 2N9PC 3MTNB 2IO0B 2B3AA 3EECA 4IWPA 1D3ZA 2I1JA 4HCPB 2MBBB 4MEMA 2XK5A 4GDKB 4KIKB 2BYEA 5JH5C 1PQSA 1WH3A 2GBRA 2KZRA 4EFOA 3EHVA 3DVNU 1GG3A 4GIVA 3A1QB 4WJPA 4AJYB 2NBVB 2BKRB 4AP4C 2KQSA 2DZMA 4MGYE 4IG7B 4G50A 4DHJD 1ZKHA 4HCNB 4ICUA 3U30A 2J0JA 1TZ1A 2KTRB 4ANWA 2MX2A 3VH3B 2BWFA 4FHJA 4F7ZA 3N32A 4GDKA 3R7RA 4KIKA 2GBNA 3UIPB 1GC6A 4MSQB 2KDBA 1J19A 2CU1A 2MWSB 3A1QA 2KXJA 3ZVVA 5TR5A 1TGZB 2DHZA 2DAFA 3T9LA 5IAAC 2L05A 2ZVNA 2MSED 2KQ7A 2ZNVB 1WR1A 2KK8A 3BY4B 2L3ZA 2NPTB 4JQWC 2LGYA 4X57B 1A5RA 2C5LC 1VCBA 4YL8A 1WRDB 2KTRA 3I3TB 3N3KB 1TBEA 3ONSA 4GDLB 2ZEQA 3JVZX 5AZHA 1C3TA 3M3JA 4NPNA 3QJZA 3L13A 1C1YB 4AUQC 4FJVB 2NR2A 3DPDA 1S3SG 1UGMA 2O6VB 3ZW3A 2CS4A 2CHWA 4ZRIA 2UWQA 4RM8A 4WJNA 1Y8RC 3MJWA 2MW5A 5E6PA 3MHSD 1EUVB 3JYUA 3TCAA 3PT2B 4NQKE 1E7UA 2MBOA 3WA0A 2KJ6A 4IW0A 2LUEA 3A4SC 3L08A 5AZGA 1WGDA 1T0YA 2MP2A 2LXAA 2WWZA 4RMAA 2LRUA 4XZ4A 4K1RB 2GBMA 2IZVB 2KDFB 2O2VB 2KNBA 1WXAA 2FCSA 4HDOA 2ZPYA 1S1QB 4WWNA 2ZCCA 1E7VA 3Q3JA 4F8CB 2DZKA 3JW0X 4OVUA 1V81A 4TUUA 5G2NA 2I1KA 3QARA 4W9IA 4BKSA 3PTFC 1HE8A 2HJ8A 2KX3A 2IBIB 3PLVA 2LRWA 3IVFA 4MGKE 2BYVE 2V4LA 1Z2MA 1K8RB 3ENEA 4W9CA 4AOFA 1V5TA 2D2QA 3HM3A 2L7RA 3DQVA 2KOXA 2LJ5A 3A33B 3OAWA 3A4RA 1WZ0A 2MQJA 3ZRCA 2KLGA 4KSLC 3AU5A 4FBJB 3ZNGC 2G45B 2KC2A 1LQBA 3WAMA 4EZLA 5J17A 2RGFA 3PREA 3HIZA 4TV3A 2BKFA 1L7YA 4MGIE 1X1MA 2ASQA 1KJTA 3AULA 4GB9A 4LDTD 3UINB 2Z0EB 2V1YA 3PV1A 4DHZE 3W1SC 2N1WA 3V6EB 1H4RA 3ZNZB 4GU2A 3APFA 1V6EA 2N9XA 4JLCA 2UYZB 4W9KA 3OLMD 1WM3A 4JGHB 3ZO5B 2CR5A 1GJZA 1EF5A 1CMXB 3HK0A 2MLBA 5LLIA 3OJ3A 2IO3B 2IY0B 1WJNA 2K8BA 2KJRA 1GC7A 2KWUB 2LD9A 2BF8B 4GSWA 4DHZB 5AEKB 1VD2A 2KFKB 3DBLI 2XBBC 2EKEC 1RLFA 1FXTB 1WE7A 4ICVA 1WXSA 2WYQA 3ZKJC 1KLVA 4IWQA 4B95A 1E5WA 2NCNA 2JPHA 4FJZA 4G0NB 1UELA 2KVRA 3ML8A 5EDSA 4BBNF 3KUCB 3N30A 1F9JA 4MSMB 4DHJB 3L10B 1YD8U 1WYWB 2JF5A 4PYUA 3PRZA 5G55A 4NQLB 4HXDA 3V60A 1KOTA 3NY5A 1EO6A 3QC8B 4IM0A 2N4FA 2JZ3B 3DBHI 5D6JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C7M B;  1IPG A;  2JT4 B;  2BYF A;  2KFK A;  3L17 A;  1YX6 B;  3VUY A;  2KAN A;  2LWP A;  3GOE A;  3VUX A;  4EEW A;  3KUD B;  3L16 A;  1IP9 A;  3M95 A;  4CHK A;  4E71 A;  1WXM A;  3EC8 A;  1RFA A;  2JWZ A;  3A9K B;  3BIN A;  2N7D A;  1WE6 A;  2QHO A;  3JSV B;  1E8Y A;  2R2Q A;  2BPS A;  2PEA A;  3LDZ E;  5BO4 B;  3X23 A;  1SIF A;  4FJY A;  4GXB A;  1V2Y A;  5DCN A;  1U4A A;  2OJR A;  3DVG X;  4W9G A;  3UGB B;  1SGH A;  4LJO B;  4BOS C;  2M17 A;  1WZ3 A;  2K8C A;  1WJ4 A;  2FAZ A;  4IWO A;  3QK0 A;  1JRU A;  4ANV A;  3AU4 A;  2G4S A;  2PE9 A;  4MGZ E;  3PSE B;  3H7P B;  1WR6 E;  3V61 A;  3KW5 B;  3A9K A;  1L2N A;  3UQB A;  2L0F A;  2JRH A;  3JSV A;  3C0R B;  1OEY J;  4WWP A;  2NBU A;  3ZNI D;  2MCN B;  1IYF A;  2KFJ A;  1Q5W B;  3GZN I;  2LVO A;  3PZD A;  3ZRF A;  2IO1 B;  4HK2 A;  4AWJ A;  1R4N I;  4MDK E;  1WX9 A;  3A9J B;  3IBE A;  5DPT A;  3SDL C;  4KV2 A;  4PS8 A;  2AEH A;  2K6Q A;  2D10 A;  3H7P A;  4K7S A;  4HLE A;  2BGF A;  2D11 A;  3H6N A;  5C1Z A;  3ML9 A;  5E6N A;  3SD5 A;  2NPT A;  2CHZ A;  5CX3 A;  2JXX A;  2YVC A;  4WQO B;  3UQA A;  1OEY A;  1XD3 B;  4ASW C;  1ZW7 A;  4GDL A;  5L95 C;  4MH0 E;  2IYD B;  4EKU A;  4OVV A;  2NS5 A;  4W9H A;  4BKT A;  5L83 A;  1E8X A;  2K1F A;  1GUA B;  1WGR A;  2W9N A;  3A9J A;  4FHK A;  3VH4 B;  2J7Q B;  5KHQ A;  2O6V A;  3VFK A;  3RZF A;  1WMH B;  1OGW A;  4GGQ A;  3VDZ A;  2LGD A;  3IFW B;  4I6N B;  3TJP A;  1EF1 A;  4NY0 A;  3KYD D;  4JL9 A;  4LDT B;  4NAW B;  3QX1 A;  1SE9 A;  2KMC A;  4II3 B;  1GNU A;  2GOW A;  4HPL B;  3TMP B;  2HTH A;  2LZ6 A;  2FIF A;  2KKC A;  1UD7 A;  2NVU I;  1XQQ A;  3QAQ A;  4MEL A;  4XX5 A;  4ZDV A;  1WGG A;  4KDI C;  3CF6 E;  5DPR A;  2O2V A;  1J0G A;  3RD2 A;  2Z0D B;  4K7U A;  1V5O A;  4HVB A;  2G3Q B;  4W9E A;  4DDG D;  3APC A;  5CHV C;  3ZIM A;  1WMH A;  4ANU A;  3CMM B;  3UIO B;  4BOZ B;  3OJ4 B;  4CYE A;  4EZK A;  1LM8 B;  3H1U A;  5LXI B;  4BKS D;  2LVQ A;  5D7G A;  2D07 B;  4NAW A;  3X0W A;  1Q1O A;  3PVL A;  4AJW A;  3ZDM C;  2WDT B;  3NS8 A;  1E8W A;  3VUW A;  5JHA A;  2ZZP B;  4N9F 4;  1M94 A;  1I42 A;  1TTN A;  3M63 B;  1WGY A;  4WWO A;  1UZX B;  1WI0 A;  4NJ6 A;  1G6J A;  1KM7 A;  2FCQ A;  1NI2 A;  2JZZ A;  2DYB A;  2M0X A;  2ZPN A;  3WAP A;  2LI5 A;  2BWE S;  2ZJD A;  3DBS A;  2JRI B;  2M8S A;  1RRB A;  4FLH A;  3QWZ B;  1ISN A;  3RYT A;  3PGE A;  2N1V A;  4W9J A;  1WF9 A;  4K81 A;  4B9K A;  3T8M A;  3VQI A;  1WFY A;  2L00 B;  2XEW A;  3D32 A;  1RAX A;  2CHX A;  2K6D B;  2AL6 A;  4URK A;  4KZ0 A;  2KTF A;  2DZJ A;  2KWC A;  2LGX A;  2MBQ A;  2C9W B;  4KVG B;  4EUT A;  2J0K A;  2A5U A;  1WXV A;  2IY1 B;  3R3M A;  2DYO A;  3ALB A;  2M4N A;  1XT9 B;  2RD0 A;  3W1S A;  3APD A;  4HWI B;  3RCZ A;  4TQ0 A;  3WAL A;  4PS7 A;  1LXD A;  2PJH A;  4GN1 A;  4XC2 A;  4TKN A;  1I35 A;  2EMS A;  3AXC A;  4BVU C;  2V3S A;  4ZRJ A;  2CKH B;  4NJ7 A;  2DX5 B;  2C7N B;  5KHO A;  1Z5S B;  3P2B A;  2K8H A;  3H9D A;  1MG8 A;  2K39 A;  4M0W B;  1WY8 A;  1P98 A;  3NOB A;  2G4D B;  4RM9 A;  2JVC A;  4KDL B;  4WAA A;  4ANX A;  3TBL D;  2L76 A;  4W9D A;  4IM3 A;  1UBQ A;  3QIJ A;  4WJQ A;  3KVF B;  3ZTD A;  4M8M A;  3PHX B;  4LJP B;  3U8Z A;  4A20 A;  4FN2 A;  2KN5 A;  2ZNV C;  4I6L B;  1NDD A;  4E74 A;  4PYZ A;  2DEN B;  3DCG A;  3VTV A;  2WX1 A;  2AWT A;  3L54 A;  1V49 A;  5JHB A;  1Q0W B;  2LXC A;  3S2A A;  2FID A;  3DDC B;  2WX0 A;  1WX8 A;  3B1L X;  4GMV A;  3SU8 X;  3VTW A;  3ZNH B;  2OOB B;  3TL5 A;  2LVP A;  3RZW C;  3PHW B;  3HHM A;  4HDQ A;  2FUH B;  2KX0 A;  2REX A;  4W9F A;  4II2 B;  2MBE A;  3WIM A;  3ZDT A;  2GBK A;  2DYM A;  3B0A A;  1R4M I;  1UH6 A;  2A4Z A;  5GMV A;  1V86 A;  2MP2 B;  4KSK C;  1E90 A;  5FR6 A;  5LXH A;  2FCN A;  4K7W A;  4BKG A;  1WGH A;  4ZYN A;  3SHQ A;  4EOY A;  2NBW B;  3VAW A;  3O65 B;  2EMT A;  2KDI A;  3AI5 A;  3NHE B;  5AZF A;  1P0R A;  3K9O B;  4GOC A;  5J2R A;  3IG3 A;  4J6I A;  2RPQ A;  3DVG Y;  1H8C A;  2JY6 A;  4F1S A;  2GBJ A;  1WIA A;  4DXA B;  3TIX A;  1P9D U;  3PRP B;  2KC1 A;  4JIO U;  4G11 A;  3DBR I;  2AL3 A;  2FNJ B;  5C23 A;  3WAO A;  4IC7 B;  4IUM B;  1WX7 A;  4KZC A;  1V9J A;  5J18 A;  1V80 A;  4HJK A;  2C7H A;  2N9E B;  2KO3 A;  4NNJ B;  5D94 A;  3V6C B;  3RUL A;  4I6P A;  4CO7 A;  2KD0 A;  1P1A A;  2KHW B;  3VXW A;  3ZUN A;  2KDE B;  2GMI C;  4G3X B;  3DOW A;  2O6V D;  5DPW A;  3VHT C;  1WJ6 A;  1WM2 A;  3W1Y A;  3QHT A;  3RUI B;  4WJO A;  2D3G A;  1UBI A;  3QA8 A;  2L8J A;  4M8N A;  3R7Q A;  4EZJ A;  3U7D A;  4MJS B;  4HPM B;  3H7S A;  5JZE B;  2ZCB A;  2R2O A;  3EFU A;  3VVW B;  5CHF A;  3KUZ A;  2PE6 B;  1OTR B;  1LFD A;  2PPH A;  3IHP C;  2MRP A;  3PLU A;  4FAD A;  2L0T A;  1E8Z A;  4IM2 A;  3V62 A;  4DK5 A;  2KWV B;  5CTR C;  5CHW A;  4FA6 A;  2MA9 B;  4FUL A;  4P7I A;  2YLM A;  2AYO B;  2MBH A;  3VTU A;  4B6W A;  2Z59 B;  3PRM B;  1YIW A;  3KH0 A;  2RSU A;  2HD5 B;  2KLC A;  3K9P B;  4A3O A;  3CST A;  3QCA A;  3ZTC A;  1OQY A;  4A3P A;  4PS3 A;  2VRR B;  1WJU A;  2DAJ A;  4MJS A;  4DBG A;  3CSF A;  1YJ1 A;  3PS6 A;  4DDI D;  1P3Q U;  3B08 A;  3WAN A;  1AAR A;  3RT3 B;  4LCD E;  3ECI A;  3NZU A;  4W9L A;  3DVN V;  4BFR A;  5HKH A;  2Y5B B;  4E3C A;  3Q3F A;  3NZS A;  5IA7 A;  2HE7 A;  1YX5 B;  1ZGU B;  2LAS A;  2DZI A;  1J8C A;  4DWF A;  2IO2 B;  4MM3 A;  5D2M B;  2FCM A;  2C60 A;  2XK5 B;  5DPS A;  3HM6 X;  3PPA A;  4BBN C;  2KMA A;  2RR9 A;  2K25 A;  2JUO A;  2N7E A;  3ZLZ A;  1QZE A;  4TQ1 A;  2J0M A;  3R66 C;  1NBF C;  3L0W B;  1YQB A;  3LJ3 A;  4ZRK A;  2M1M A;  1BT0 A;  2KJH B;  2ZVO A;  5E6O A;  3QQ8 B;  3M62 B;  3UF8 A;  3KYC D;  2N9P C;  3MTN B;  2IO0 B;  2B3A A;  3EEC A;  4IWP A;  1D3Z A;  2I1J A;  4HCP B;  2MBB B;  4MEM A;  2XK5 A;  4GDK B;  4KIK B;  2BYE A;  5JH5 C;  1PQS A;  1WH3 A;  2GBR A;  2KZR A;  4EFO A;  3EHV A;  3DVN U;  1GG3 A;  4GIV A;  3A1Q B;  4WJP A;  4AJY B;  2NBV B;  2BKR B;  4AP4 C;  2KQS A;  2DZM A;  4MGY E;  4IG7 B;  4G50 A;  4DHJ D;  1ZKH A;  4HCN B;  4ICU A;  3U30 A;  2J0J A;  1TZ1 A;  2KTR B;  4ANW A;  2MX2 A;  3VH3 B;  2BWF A;  4FHJ A;  4F7Z A;  3N32 A;  4GDK A;  3R7R A;  4KIK A;  2GBN A;  3UIP B;  1GC6 A;  4MSQ B;  2KDB A;  1J19 A;  2CU1 A;  2MWS B;  3A1Q A;  2KXJ A;  3ZVV A;  5TR5 A;  1TGZ B;  2DHZ A;  2DAF A;  3T9L A;  5IAA C;  2L05 A;  2ZVN A;  2MSE D;  2KQ7 A;  2ZNV B;  1WR1 A;  2KK8 A;  3BY4 B;  2L3Z A;  2NPT B;  4JQW C;  2LGY A;  4X57 B;  1A5R A;  2C5L C;  1VCB A;  4YL8 A;  1WRD B;  2KTR A;  3I3T B;  3N3K B;  1TBE A;  3ONS A;  4GDL B;  2ZEQ A;  3JVZ X;  5AZH A;  1C3T A;  3M3J A;  4NPN A;  3QJZ A;  3L13 A;  1C1Y B;  4AUQ C;  4FJV B;  2NR2 A;  3DPD A;  1S3S G;  1UGM A;  2O6V B;  3ZW3 A;  2CS4 A;  2CHW A;  4ZRI A;  2UWQ A;  4RM8 A;  4WJN A;  1Y8R C;  3MJW A;  2MW5 A;  5E6P A;  3MHS D;  1EUV B;  3JYU A;  3TCA A;  3PT2 B;  4NQK E;  1E7U A;  2MBO A;  3WA0 A;  2KJ6 A;  4IW0 A;  2LUE A;  3A4S C;  3L08 A;  5AZG A;  1WGD A;  1T0Y A;  2MP2 A;  2LXA A;  2WWZ A;  4RMA A;  2LRU A;  4XZ4 A;  4K1R B;  2GBM A;  2IZV B;  2KDF B;  2O2V B;  2KNB A;  1WXA A;  2FCS A;  4HDO A;  2ZPY A;  1S1Q B;  4WWN A;  2ZCC A;  1E7V A;  3Q3J A;  4F8C B;  2DZK A;  3JW0 X;  4OVU A;  1V81 A;  4TUU A;  5G2N A;  2I1K A;  3QAR A;  4W9I A;  4BKS A;  3PTF C;  1HE8 A;  2HJ8 A;  2KX3 A;  2IBI B;  3PLV A;  2LRW A;  3IVF A;  4MGK E;  2BYV E;  2V4L A;  1Z2M A;  1K8R B;  3ENE A;  4W9C A;  4AOF A;  1V5T A;  2D2Q A;  3HM3 A;  2L7R A;  3DQV A;  2KOX A;  2LJ5 A;  3A33 B;  3OAW A;  3A4R A;  1WZ0 A;  2MQJ A;  3ZRC A;  2KLG A;  4KSL C;  3AU5 A;  4FBJ B;  3ZNG C;  2G45 B;  2KC2 A;  1LQB A;  3WAM A;  4EZL A;  5J17 A;  2RGF A;  3PRE A;  3HIZ A;  4TV3 A;  2BKF A;  1L7Y A;  4MGI E;  1X1M A;  2ASQ A;  1KJT A;  3AUL A;  4GB9 A;  4LDT D;  3UIN B;  2Z0E B;  2V1Y A;  3PV1 A;  4DHZ E;  3W1S C;  2N1W A;  3V6E B;  1H4R A;  3ZNZ B;  4GU2 A;  3APF A;  1V6E A;  2N9X A;  4JLC A;  2UYZ B;  4W9K A;  3OLM D;  1WM3 A;  4JGH B;  3ZO5 B;  2CR5 A;  1GJZ A;  1EF5 A;  1CMX B;  3HK0 A;  2MLB A;  5LLI A;  3OJ3 A;  2IO3 B;  2IY0 B;  1WJN A;  2K8B A;  2KJR A;  1GC7 A;  2KWU B;  2LD9 A;  2BF8 B;  4GSW A;  4DHZ B;  5AEK B;  1VD2 A;  2KFK B;  3DBL I;  2XBB C;  2EKE C;  1RLF A;  1FXT B;  1WE7 A;  4ICV A;  1WXS A;  2WYQ A;  3ZKJ C;  1KLV A;  4IWQ A;  4B95 A;  1E5W A;  2NCN A;  2JPH A;  4FJZ A;  4G0N B;  1UEL A;  2KVR A;  3ML8 A;  5EDS A;  4BBN F;  3KUC B;  3N30 A;  1F9J A;  4MSM B;  4DHJ B;  3L10 B;  1YD8 U;  1WYW B;  2JF5 A;  4PYU A;  3PRZ A;  5G55 A;  4NQL B;  4HXD A;  3V60 A;  1KOT A;  3NY5 A;  1EO6 A;  3QC8 B;  4IM0 A;  2N4F A;  2JZ3 B;  3DBH I;  5D6J B; 
#chains in the Genus database with same CATH topology
 4MT5 A;  4WAF A;  1V1O A;  3VUY A;  1D5X C;  5IP4 D;  3L16 A;  1IP9 A;  4CHK A;  1RFA A;  2JWZ A;  2PVO D;  5IN7 A;  1N5W A;  3W9C B;  2OJR A;  3DVG X;  2V0G A;  4BOS C;  4IWO A;  3AU4 A;  2PIA A;  1JW9 D;  2G4S A;  2QIE B;  3AE8 B;  3PSE B;  3T3N A;  3SFD B;  1J7A A;  1SE4 A;  3C0R B;  2EEL A;  3AEG B;  3ZNI D;  2MCN B;  1IYF A;  2KFJ A;  1NVI D;  3GZN I;  1HTQ A;  1R4N I;  1ZXH A;  3RNE C;  4KV2 A;  4PS8 A;  2K6Q A;  4HLE A;  3H6N A;  2NPT A;  1L4Z B;  1Q10 A;  2AQ1 B;  1ZW7 A;  1L0V B;  4RCO A;  4ZOH C;  5L83 A;  2NS5 A;  4BKT A;  1WGR A;  4J3O D;  1WMH B;  4GGQ A;  1B1Z A;  3GE3 C;  1YN4 A;  4NAW B;  4II3 B;  2LZ6 A;  2WGS A;  1XQQ A;  4MEL A;  4XX5 A;  4ZDV A;  1WGG A;  2O2V A;  2BB5 A;  4RF0 A;  2Z0D B;  5C3J B;  3FIL A;  1V5O A;  4HVB A;  2QDF A;  2WXK A;  1WMH A;  3UIO B;  2JYT A;  5D7G A;  1QQR A;  4NAW A;  1HTO A;  1JCK B;  2D5G A;  1FCC C;  4BZA A;  3RMK C;  4WQM A;  1M94 A;  3W2D A;  2IJ0 A;  1NI2 A;  3VR8 B;  2BWE S;  5JXV A;  1XEE A;  1RRB A;  4FLH A;  3AMZ A;  3DBL B;  2LEK A;  4PK1 A;  4ARI A;  1FEH A;  1WF9 A;  4B9K A;  3D32 A;  2FUG 1;  4URK A;  1FRD A;  2DZJ A;  4YSX B;  1SJE D;  3WCQ A;  4EUT A;  2MBQ A;  3R8B A;  1WXV A;  1IGC A;  1F0Z A;  3ALB A;  3W1S A;  1N61 A;  2PJH A;  1HQR D;  4TKN A;  2KQ4 X;  3Q8A A;  2EMS A;  4ZRJ A;  2CKH B;  3HVZ A;  3P2B A;  2FBW B;  1MG8 A;  4IKG A;  4M0W B;  3W5U B;  3NOB A;  1P98 A;  1N6Z A;  2G4D B;  4XGA B;  2DLB A;  1SXT A;  4LNK A;  4LJP B;  2KN5 A;  2ZNV C;  5BMG A;  2DEN B;  1V49 A;  3S2A A;  4M0W A;  2HJ1 A;  3ZNH B;  4GMV A;  2OOB B;  3HHM A;  4HDQ A;  1TS3 A;  4HJG E;  4W9F A;  4II2 B;  2TSS A;  3WIM A;  2GBK A;  5GMV A;  1SF0 A;  5C2T B;  3SHQ A;  4EOY A;  3DHI C;  2EMT A;  1FMA D;  2KDI A;  1P0R A;  4ARC A;  4OVZ A;  5J2R A;  4XE0 A;  2RPQ A;  3DVG Y;  2JY6 A;  2QJL A;  4DXA B;  1P9D U;  2G9H D;  5AUK A;  1TY0 A;  4IC7 B;  1XLN A;  1WX7 A;  4KZC A;  1V9J A;  3V6C B;  2KHW B;  2MJ3 A;  1FFV A;  1YJJ A;  2NTT A;  3VHT C;  3RUI B;  2MJE A;  2D3G A;  3R7Q A;  3I9V 1;  3PZ7 A;  3VVW B;  3KUZ A;  1LFD A;  3PLU A;  1FNV A;  4FAD A;  1E8Z A;  4IM2 A;  3V62 A;  1VRA B;  2KWV B;  4P7I A;  3LB8 C;  1M4V A;  4N6E B;  3ZTC A;  4A3P A;  1YQ4 B;  2VRR B;  1L0X B;  3WAN A;  3ZYY X;  3RT3 B;  3NZU A;  4W9L A;  3DVN V;  2W55 A;  3Q3F A;  3NZS A;  5IA7 A;  1CQV A;  3ETR A;  4TSS A;  2LAS A;  2IO2 B;  2IGD A;  2FCM A;  2H89 B;  1N60 A;  3NVV A;  2RR9 A;  4PT5 A;  3ZLZ A;  2IND C;  3R66 C;  3GE8 C;  3LJ3 A;  2M1M A;  1MJD A;  5LNK 1;  3OWE B;  3QQ8 B;  1TT5 B;  3UF8 A;  2N9P C;  2IO0 B;  2B3A A;  1D3Z A;  2I1J A;  4HCP B;  3AE4 B;  1XLP A;  1PQS A;  4EFO A;  3EHV A;  4IOI E;  4WJP A;  1MHX A;  4RH6 A;  3NJT A;  2BKR B;  1PDX A;  4HRS A;  4G50 A;  2KDM A;  1C79 A;  2J0J A;  4ANW A;  2CJO A;  3UIP B;  1VZ6 A;  2KDB A;  2WXL A;  1J19 A;  3T3O A;  1IGD A;  3ZVV A;  5IAA C;  1T0Q C;  2L05 A;  4LJO B;  1LO5 D;  1I4G A;  3I3T B;  1DOI A;  3NZ3 A;  3ZJU A;  1TBE A;  2IGG A;  3ONS A;  2ZEQ A;  1JRO A;  2QEJ C;  1SSN A;  4YSY B;  1TS4 A;  1S3S G;  1PGB A;  2QMT A;  4WIP A;  2CHW A;  4LNI A;  2CU3 A;  3H8H A;  4WJN A;  1Y8R C;  2CJN A;  3JYU A;  3PT2 B;  2LUE A;  3L08 A;  4LNF A;  1R7S A;  2LRU A;  1AN8 A;  2KDF B;  1WXA A;  2FCS A;  4HDO A;  2ZPY A;  3Q3J A;  4F8C B;  4K3C A;  2DZK A;  1V81 A;  2I1K A;  1E9M A;  3CWI A;  2LRW A;  3IVF A;  3MJ5 A;  3RI7 C;  3BVG A;  3DQV A;  3NG0 A;  2KOX A;  3OAW A;  1J7B A;  1E0Z A;  3ZRC A;  3FC4 A;  2E3T A;  2KC2 A;  2VH1 A;  4P1C C;  1I4H A;  3AUL A;  4LDT D;  1QT9 A;  2L1A A;  2V3P A;  3UIN B;  2V1Y A;  4MAC A;  4OZB A;  3PV1 A;  3V6E B;  1H4R A;  4P1B C;  3ZNZ B;  4GU2 A;  4JWU C;  1CMX B;  3J9C A;  2MLB A;  2IY0 B;  4KKI A;  1VD2 A;  4JX1 C;  3HVD A;  1FXT B;  1WE7 A;  4ICV A;  1WXS A;  4IWQ A;  2LHE A;  2JPH A;  1T0S C;  2NCN A;  2QC8 A;  4BBN F;  1STE A;  3N30 A;  4MSM B;  5BMI A;  2JF5 A;  1WYW B;  5G55 A;  3V60 A;  1KOT A;  5EE1 A;  2JU6 X;  5BYR A;  2Y3A A;  3BVZ A;  1IPG A;  2BYF A;  1N63 A;  4C80 A;  2KAN A;  2LWP A;  3AE6 B;  1KH0 A;  3GOE A;  4EEW A;  5FKA C;  3EC8 A;  3A9K B;  4LLG M;  2N7D A;  1WE6 A;  2R2Q A;  3IAS 1;  2BPS A;  5BO4 B;  3RNF C;  1JAL A;  1QOG A;  5DCN A;  3UGB B;  3RNC C;  1FRR A;  2INC C;  1NEN B;  5FK9 C;  1WR6 E;  3V61 A;  3KW5 B;  3A9K A;  1RWS A;  2NBU A;  3PZD A;  4RGN A;  1TS5 A;  2IO1 B;  4AWJ A;  4MDK E;  1ZDX A;  3A9J B;  3IBE A;  4OZC A;  1OQR A;  1FXI A;  1YJI A;  1V1P B;  2D11 A;  3SD5 A;  5CX3 A;  5IKC M;  5AUI A;  3UQA A;  2RDH A;  3MHZ A;  1OEY A;  2FE8 A;  2JX5 A;  1KLG D;  2IYD B;  4EKU A;  4OVV A;  4W9H A;  1HZ6 A;  2K1F A;  1GUA B;  4FHK A;  3A9J A;  1E10 A;  2O6V A;  3Q6B A;  5BMH A;  1V1P A;  4I6N B;  3IFW B;  1K53 A;  4NY0 A;  1RYJ A;  3KYD D;  1UF0 A;  2W3S A;  5D3D A;  3GS2 A;  4C56 C;  1XLQ A;  5HHD G;  1GNU A;  2GOW A;  4KGS A;  2ACZ B;  3Q8B A;  3TMP B;  2KKC A;  3QAQ A;  1UD7 A;  1DOX A;  5DPR A;  1J0G A;  3RD2 A;  4K7U A;  2K9X A;  5CHV C;  3ZIM A;  3CMM B;  4CYE A;  3IAM 1;  2LFI A;  2GRI A;  4C4V B;  2ZW1 A;  4NAM A;  4BKS D;  2LVQ A;  3X0W A;  1P7F A;  4AJW A;  3N1Z C;  1ZOY B;  3BK1 A;  3U7Z A;  4WWM A;  1Y56 A;  2BW2 A;  1WI0 A;  1L4D B;  4MM3 B;  1KM7 A;  2M0X A;  2ZPN A;  2LUM A;  4C4V A;  3QWZ B;  1ISN A;  2N1V A;  3VQI A;  2L00 B;  3IXS A;  1RAX A;  2M0A A;  4JWS C;  4KZ0 A;  4ACF A;  2KTF A;  2BB6 A;  2C9W B;  2J0K A;  2A5U A;  2IY1 B;  3V05 A;  2M4N A;  3LYY A;  2RD0 A;  3RCZ A;  2Y5C A;  3MP9 A;  4B0E A;  1C76 A;  2M19 A;  1GB4 A;  4NJ7 A;  2DX5 B;  5KHO A;  3H9D A;  1SBB B;  1WY8 A;  4ANX A;  2G1E A;  3TBL D;  2L76 A;  4IM3 A;  2M56 B;  3KVF B;  1WGK A;  3U8Z A;  1SB3 C;  3NVY A;  2MJD A;  2WX1 A;  1T6B X;  2WX0 A;  3B1L X;  3C8Y A;  4A6Q A;  2LVP A;  3RFZ B;  2WXI A;  1FPY A;  1NYQ A;  5EE9 A;  3E9S A;  2DYM A;  2A4Z A;  1MI0 A;  1V86 A;  1E90 A;  2KAC A;  2NBW B;  4J6I A;  1H8C A;  2GBJ A;  2GLS A;  3TIX A;  1JRP A;  4FXC A;  2FNJ B;  5J18 A;  1V80 A;  4HJK A;  2BYT A;  4NNJ B;  1GAQ B;  1T0R C;  1P1A A;  2JXT A;  3VXW A;  4DQO C;  2KDE B;  1FCL A;  4G3X B;  2AX5 A;  3W1Y A;  1WM2 A;  1TS2 A;  4M8N A;  1UBI A;  2L8J A;  4YWG G;  2VZK B;  3H7S A;  4S0R A;  2R2O A;  4DXG A;  3I5J C;  3IHP C;  3IT4 B;  2DWQ A;  4DK5 A;  5CHW A;  4FUL A;  3OG5 A;  3VTU A;  2Z59 B;  3KH0 A;  2RSU A;  2KLC A;  3K9P B;  1QOA A;  4PS3 A;  1VDV A;  1C77 A;  1CJE A;  2WDV B;  1YJ1 A;  2ON8 A;  4N59 A;  1P3Q U;  3ECI A;  1XCT L;  5HI1 A;  1I7H A;  2HE7 A;  1YX5 B;  4RF1 A;  4YSZ B;  1T5X D;  1J8C A;  3PPA A;  4BBN C;  2J4X A;  2K25 A;  2N7E A;  1QZE A;  4KX6 B;  2J0M A;  1VZ8 A;  3MFG A;  3AV8 A;  3L0W B;  2KJH B;  2ZVO A;  3RPF C;  4ZHO A;  2LGI A;  2D3A A;  2AQ2 B;  2WXP A;  4MEM A;  4A90 A;  4GDK B;  2KZR A;  2V9H A;  5G5G A;  1A70 A;  2J53 A;  1IBX B;  1WRI A;  4MGY E;  3RNG C;  4ICU A;  3U30 A;  1TZ1 A;  2KTR B;  1BUI C;  3N32 A;  4GDK A;  1K51 A;  2GBN A;  3GZN B;  1R4N B;  2KXJ A;  5TR5 A;  1TGZ B;  2DHZ A;  1P7E A;  3T9L A;  1IBX A;  2ZNV B;  2KQ7 A;  4ZRP A;  1WR1 A;  2KK8 A;  1L6U A;  2L3Z A;  4X57 B;  2WXJ A;  4NJC A;  1VCB A;  4YL8 A;  1WRD B;  1FNU A;  2KTR A;  4IDI A;  5H8Y E;  4GDL B;  1JWA D;  3M3J A;  4NPN A;  1C1Y B;  3DHH C;  2CS4 A;  4ZRI A;  2XN9 C;  2MW5 A;  4LNO A;  5E6P A;  1EUV B;  4OHJ A;  1E7U A;  1F77 A;  4O1N A;  2LJI A;  3A4S C;  3BVM A;  3TEY A;  1T0Y A;  4RMA A;  3P4P B;  2V4I B;  2KNB A;  2RPV A;  3UI3 A;  2ZCC A;  3EA6 A;  3JW0 X;  1PFD A;  3R2T A;  3QAR A;  2IBI B;  4A55 A;  3ENE A;  4USA A;  2D2Q A;  2L7R A;  3A33 B;  1FXA A;  1WZ0 A;  3C19 A;  1TKY A;  2KWD A;  1V8C A;  1LQB A;  3WAM A;  4NZL B;  3PRE A;  4MGI E;  4GB9 A;  3U52 E;  1OQQ A;  2N9X A;  3SEB A;  4M02 A;  1EF5 A;  2BVC A;  1GOZ A;  3HK0 A;  3OJ3 A;  1VLB A;  2KWU B;  4GSW A;  5AEK B;  2KFK B;  1XXG A;  1I4P A;  2XBB C;  1RLF A;  4B95 A;  3ZGZ A;  2KVR A;  3ML8 A;  1HZ5 A;  3KUC B;  3Q3M C;  1DOY A;  5T8I A;  3PRZ A;  1SE3 A;  3NY5 A;  3QC8 B;  2KYW A;  4RM8 A;  3DBH I;  3Q8F A;  2JT4 B;  2KFK A;  1YX6 B;  3BYY B;  4UDU C;  3VUX A;  3KUD B;  1MHH E;  4S17 A;  3SFE B;  3M95 A;  1WXM A;  2Q5W D;  1AYF A;  1TKE A;  2QHO A;  5EE0 A;  3HUI A;  1XCQ L;  4FJY A;  4GXB A;  2WXR A;  4W9G A;  5I4D A;  1SGH A;  2M17 A;  4LNN A;  1WZ3 A;  2K8C A;  3QK0 A;  4ANV A;  1K52 A;  1AW7 A;  3NRZ A;  2PE9 A;  1L2N A;  3AN1 A;  3UQB A;  2L0F A;  2JRH A;  2K22 A;  2MH7 A;  1Q5W B;  2WP9 B;  3NVW A;  3ZRF A;  1QLB B;  1WX9 A;  3U2S C;  3N1X C;  1D4B A;  1LGR A;  2AEH A;  2D10 A;  2X38 A;  5E6N A;  4XYC A;  2LMC A;  4A9A A;  3DWG C;  2JXX A;  2YVC A;  4WQO B;  4ASW C;  1XLO A;  5L95 C;  4L23 A;  1L0Y B;  2IGH A;  1FD6 A;  2W9N A;  4C7Y A;  2J7Q B;  1N5X A;  3VFK A;  2PKO A;  1OGW A;  3VDZ A;  1I4Q A;  1UWM A;  1EF1 A;  4LDT B;  3QX1 A;  2ZW0 A;  1SE9 A;  2HDE A;  2KMC A;  2FIF A;  2NVU I;  3B2G A;  1YN5 A;  2Z8L A;  1XF5 L;  4KDI C;  3CF6 E;  2G3Q B;  4W9E A;  3HRD D;  1C78 A;  3APC A;  4BOZ B;  3OJ4 B;  2WXQ A;  3H1U A;  2D07 B;  3PVL A;  3ZDM C;  3AH7 A;  3NS8 A;  4P6V F;  3VUW A;  5JHA A;  2ZZP B;  1E6E B;  1TTN A;  3M63 B;  1WGY A;  1UZX B;  2BS3 B;  2FCQ A;  2JZZ A;  2PMV A;  3WAP A;  2ZJD A;  3URY A;  1WSP A;  1BXT A;  2JRI B;  2SEB D;  2NTS A;  1FNW A;  4W9J A;  2KN4 A;  3T8M A;  1WFY A;  2XEW A;  4XDD A;  2AL6 A;  3EUB 2;  3Q14 C;  3P42 A;  1PUT A;  1MPE A;  3R3M A;  2DYO A;  3APD A;  3AEE B;  3WAL A;  4PS7 A;  1LXD A;  4Q2J A;  1I35 A;  3AE5 B;  3RN9 C;  3O13 A;  1ET9 A;  1Z5S B;  2K8H A;  3N20 C;  4KGT A;  4RM9 A;  4KDL B;  3W5V B;  4W9D A;  1UBQ A;  4WJQ A;  3ZTD A;  4M8M A;  3PHX B;  4A20 A;  4FN2 A;  1ZXI A;  1KTK A;  4I6L B;  4E74 A;  5HFY A;  3DCG A;  2AWT A;  3GB1 A;  1Q0W B;  2KVZ A;  4GLS C;  2FID A;  3DDC B;  1KRH A;  1WX8 A;  1J7C A;  1AWD A;  3RZW C;  3PHW B;  2KX0 A;  2REX A;  1TY2 A;  2MBE A;  3ZDT A;  4KKJ A;  1R4M I;  3TEZ A;  2MP2 B;  4KSK C;  5FR6 A;  2FCN A;  4K7W A;  4BKG A;  4ZYN A;  1L6V A;  3AEB B;  1YN3 A;  3VAW A;  2WNM A;  3K9O B;  4GOC A;  1C4P A;  4JIO U;  3DBR I;  2AL3 A;  2B76 B;  4KGR A;  5FR3 A;  2N9E B;  2KO3 A;  3RUL A;  3TSS A;  2KD0 A;  4ZHP A;  3R2I A;  2GMI C;  2O6V D;  3TEX A;  3QHT A;  4WJO A;  1XO3 A;  1D6E C;  4MJS B;  4HPM B;  2ZCB A;  3EFU A;  2N0S B;  2PPH A;  3TUO A;  4D2K A;  1ROE A;  2IPK D;  2MA9 B;  3MC9 A;  2OHF A;  2JYE A;  2R61 A;  1YIW A;  1PGA A;  3AE2 B;  2HD5 B;  3CST A;  3QCA A;  1WJU A;  1PYW D;  4MJS A;  3N1Y C;  3PS6 A;  4FA6 A;  3B08 A;  4LCD E;  2WLB A;  1JML A;  3B2F A;  5HKH A;  2J52 A;  2Y5B B;  3TEW A;  1ZGU B;  4CQN A;  2INN E;  2DZI A;  4MM3 A;  4YTM B;  2K5P A;  4OZA A;  5H92 C;  2JUO A;  3AE3 B;  4TQ1 A;  1NBF C;  1BT0 A;  3BZD B;  3M62 B;  3KYC D;  4AS1 A;  3EEC A;  4IWP A;  1BML C;  2MBB B;  3VRA B;  3BYT B;  2GBR A;  2IDY A;  2JZP A;  2LGS A;  4GIV A;  1F2R I;  4YXD B;  1ZUD 2;  2KMM A;  2NBV B;  3DHG C;  4AP4 C;  2YEP F;  1I4R A;  3AM9 A;  4RNA A;  4DHJ D;  3AE9 B;  1ZKH A;  2X8X X;  4HCN B;  5MPO A;  2WQY B;  3VH3 B;  2BWF A;  4FHJ A;  4F7Z A;  1GC6 A;  5EE3 A;  4MSQ B;  4JPS A;  1ENF A;  2MWS B;  2DAF A;  3NVZ A;  2ZVN A;  5TSS A;  3BY4 B;  2BBC A;  2NPT B;  1A5R A;  5G5H A;  2C5L C;  1L5P A;  1N62 A;  4RFB A;  2I38 A;  1C3T A;  5AZH A;  1R4M B;  3QJZ A;  4AUQ C;  3DPD A;  3ZW3 A;  3EFC A;  2UWQ A;  1QKZ A;  4C7Z A;  3MJW A;  3MHS D;  2PTL A;  3WA0 A;  1SE2 A;  2KJ6 A;  2LXA A;  3DBR B;  4K1R B;  2O2V B;  3FIL B;  2I2Y A;  1E7V A;  5BYQ A;  2WDQ B;  1DGJ A;  2WU5 B;  4QAY A;  1YNT E;  4W9I A;  3SR6 A;  3PTF C;  1HE8 A;  3P4Q B;  3MC0 B;  2HJ8 A;  2KX3 A;  3PLV A;  1FIQ A;  1JWS D;  1T3Q A;  1Z2M A;  1K8R B;  4W9C A;  4AOF A;  3HM3 A;  2KLG A;  4KSL C;  3ZXV A;  3I63 C;  4YTN B;  1D5Z C;  3E56 A;  4WH4 A;  1QOF A;  1VZ7 A;  2RGF A;  3HIZ A;  4TV3 A;  2BKF A;  1L7Y A;  5IO9 A;  1X1M A;  2ASQ A;  1KJT A;  2V3N A;  2Z0E B;  1JWU D;  1WYG A;  4DHZ E;  4ZRQ A;  2N1W A;  3W1S C;  3APF A;  3FKY A;  1V6E A;  2WXN A;  2UYZ B;  1WM3 A;  4JGH B;  1GJZ A;  1ESF A;  2L32 A;  2KJR A;  2K8B A;  1GC7 A;  4DHZ B;  2BF8 B;  3IT6 B;  2EKE C;  2VZK D;  2WHI A;  2L83 A;  2WYQ A;  2WS3 B;  3ZKJ C;  1KLV A;  1E5W A;  4C00 A;  4G0N B;  1UEL A;  5EDS A;  1F2R C;  3L10 B;  1FFU A;  1YD8 U;  5HG2 A;  4NQL B;  4HXD A;  1EO6 A;  2JZ3 B;  1GPX A;  5D6J B;  2C7M B;  4US8 A;  2PLP A;  3L17 A;  1ZDV A;  1ZE3 D;  1ZP0 B;  4E71 A;  2J42 A;  3BIN A;  3JSV B;  1E8Y A;  2PEA A;  3LDZ E;  3X23 A;  1SIF A;  2JSV X;  1V2Y A;  3VRB B;  1UUP A;  1U4A A;  4K3B A;  3DWM A;  4RGO S;  1WJ4 A;  2FAZ A;  2K3U A;  2PVG C;  1JRU A;  1F1H A;  4HEA 1;  4MGZ E;  4ZYS A;  3H7P B;  2D3C A;  3JSV A;  2RDG A;  1OEY J;  3V3X A;  1HXY D;  4WWP A;  2W54 A;  2RMM A;  1CZP A;  2LVO A;  4HK2 A;  1ET6 A;  5DPT A;  2BT6 A;  3SDL C;  4HPP A;  1EM7 A;  3BII D;  2LHD A;  4K7S A;  3H7P A;  2BGF A;  4WUR A;  5C1Z A;  3ML9 A;  2CHZ A;  1TZO A;  3NS1 A;  3P1M A;  4RGM A;  1XD3 B;  3NUH B;  4GDL A;  3Q8C A;  3B9J A;  4MH0 E;  2GB1 A;  3ZXR A;  1E8X A;  5KHQ A;  3VH4 B;  3AEF B;  3U4E G;  3RZF A;  1NI3 A;  2OJW A;  1WWT A;  1QOB A;  2LGD A;  3TJP A;  3AB5 A;  4JL9 A;  1I4X A;  2VH2 A;  1TYG B;  4HPL B;  2HTH A;  2NMQ A;  1K50 A;  2UU7 A;  2XNA C;  2QCZ A;  4DDG D;  4ANU A;  4EZK A;  1LM8 B;  4HRO A;  5LXI B;  1Q1O A;  2H88 B;  2WDT B;  3GP7 A;  1E8W A;  2ONQ A;  3Q69 A;  4N9F 4;  1I42 A;  4WWO A;  4NJ6 A;  1EWC A;  1G6J A;  2W82 A;  3AE7 B;  2DYB A;  2LI5 A;  3DBS A;  1WXQ A;  2M8S A;  4HKZ E;  1ACC A;  3RYT A;  3ZJV A;  3PGE A;  1SJH D;  4K81 A;  2K6D B;  2CHX A;  1OFF A;  2PW9 A;  3P4R B;  2KWC A;  2LGX A;  1SIJ A;  4KVG B;  3RNB C;  2BQQ A;  1JWB D;  1XT9 B;  4HWI B;  4TQ0 A;  1MFW A;  4XC2 A;  4GN1 A;  3Q2A C;  2SAK A;  1KLU D;  3AXC A;  4BVU C;  3AEA B;  3EGR A;  2V3S A;  4US9 A;  2C7N B;  1C4C A;  3PO0 A;  2K39 A;  3ZJT A;  1EU3 A;  2DBY A;  1YQ3 B;  2JVC A;  4WAA A;  3BWU D;  2AQ3 B;  3QIJ A;  2ICI A;  3Q3N C;  1NDD A;  2YEP B;  4PYZ A;  3VTV A;  4YTP B;  5E6J A;  5JHB A;  3L54 A;  2LXC A;  3VTW A;  3SU8 X;  3TL5 A;  2E6X A;  5GXG B;  1UWX A;  2WU2 B;  2FUH B;  3B0A A;  1UH6 A;  1NYR A;  1IUE A;  5LXH A;  1V97 A;  1WGH A;  2WXF A;  3O65 B;  1B9R A;  3AI5 A;  4MH8 A;  1QIL A;  3ABV B;  3NHE B;  3MC8 A;  4OW0 A;  5AZF A;  1TIF A;  3IG3 A;  3KWL A;  4F1S A;  1WIA A;  3PRP B;  2KC1 A;  5D3I B;  4G11 A;  5BYS A;  5C23 A;  3WAO A;  3KWV A;  4IUM B;  3VR9 B;  2C7H A;  4JE3 B;  5D94 A;  1DYQ A;  4I6P A;  4YT0 B;  3ZUN A;  2QSD A;  4P16 A;  3DOW A;  5DPW A;  1WJ6 A;  3QA8 A;  4EZJ A;  2WDR B;  3I57 A;  3U7D A;  2L52 A;  1F52 A;  3P4S B;  1PGX A;  5JZE B;  5CHF A;  2EKI A;  2PE6 B;  1OTR B;  3CIR B;  1KFY B;  2MRP A;  1TKG A;  2L0T A;  4M01 A;  5CTR C;  2QIL A;  2YLM A;  2AYO B;  2MBH A;  4B6W A;  3PRM B;  4A3O A;  1YOV B;  1OQY A;  2DAJ A;  2OED A;  4DBG A;  3CSF A;  4DDI D;  2BS4 B;  1AAR A;  2MHJ A;  2BTE A;  4BFR A;  4E3C A;  2D3B A;  1C4A A;  4DWF A;  5D2M B;  2C60 A;  2XK5 B;  4BAX A;  3AE1 B;  5DPS A;  3HM6 X;  2KMA A;  1JWM D;  2N9L A;  1FM0 D;  1C9F A;  1VR9 A;  3DBH B;  2WXM A;  1YQB A;  4ZRK A;  2INP E;  3AEC B;  3KLS X;  5E6O A;  3Q3O C;  3MTN B;  4XWT A;  2DNF A;  1YMH E;  2XK5 A;  4KIK B;  2BYE A;  5JH5 C;  1WH3 A;  4XDC A;  3Q8E A;  1EWY C;  3DVN U;  1GG3 A;  3A1Q B;  1FO4 A;  4AJY B;  5IOI A;  2GI9 A;  2WXO A;  1QF6 A;  2DZM A;  2KQS A;  4L2Y A;  1SEB D;  4IG7 B;  1NEK B;  1UGJ A;  2MX2 A;  3R7R A;  4KIK A;  1EU4 A;  4B0M A;  2CU1 A;  3A1Q A;  2BS2 B;  3LXF A;  4EE2 A;  2Y5P A;  2JQR B;  2MSE D;  4RGT A;  4CO7 A;  3AED B;  4JQW C;  2LGY A;  2JWU A;  4HKQ A;  3N3K B;  1TJE A;  3JVZ X;  4DXF A;  1VJK A;  3L13 A;  2K0P A;  4FJV B;  2NR2 A;  2O6V B;  1UGM A;  4N58 A;  2MEK A;  4TMA B;  1ZPS A;  3TCA A;  4NQK E;  2MBO A;  4IW0 A;  5AZG A;  1WGD A;  2MP2 A;  4R3D A;  2WWZ A;  2KT7 A;  1RM6 C;  4XZ4 A;  2GBM A;  2IZV B;  4LK0 M;  1S1Q B;  4WWN A;  2KAJ A;  4AQ7 A;  4M00 A;  4OVU A;  4TUU A;  5G2N A;  4BKS A;  4A8X C;  4MGK E;  2BYV E;  2V4L A;  1V5T A;  3ZQ4 A;  2LJ5 A;  3A4R A;  1HEZ E;  2MQJ A;  1RFK A;  1CK1 A;  2N7J A;  3AU5 A;  4FBJ B;  3ZNG C;  1UNS A;  1KF6 B;  2G45 B;  4ITK A;  4EZL A;  5J17 A;  1MVK A;  1HA5 A;  3RNA C;  4LTU A;  3L4P A;  3P63 A;  1MG4 A;  4L1B A;  4JLC A;  3BK2 A;  2W3R A;  4H2A A;  4W9K A;  3OLM D;  3ZO5 B;  2CR5 A;  1D5M C;  5LLI A;  2IO3 B;  1WJN A;  2LD9 A;  3DBL I;  3N9Y C;  1E7P B;  2N9K A;  4REZ A;  2WXH A;  3FAH A;  2WXG A;  3PZ8 A;  4FJZ A;  4XWW A;  2HTM E;  1F9J A;  4DHJ B;  1JQ4 A;  4PYU A;  1GB1 A;  3KQ4 A;  4IM0 A;  2RDB C;  2N4F A; 
#chains in the Genus database with same CATH homology
 2C7M B;  1IPG A;  2JT4 B;  2BYF A;  2KFK A;  3L17 A;  1YX6 B;  3VUY A;  2KAN A;  2LWP A;  3GOE A;  3VUX A;  4EEW A;  3KUD B;  3L16 A;  1IP9 A;  3M95 A;  4CHK A;  4E71 A;  1WXM A;  3EC8 A;  1RFA A;  2JWZ A;  3A9K B;  3BIN A;  2N7D A;  1WE6 A;  2QHO A;  3JSV B;  1E8Y A;  2R2Q A;  2BPS A;  2PEA A;  3LDZ E;  5BO4 B;  3X23 A;  1SIF A;  4FJY A;  4GXB A;  1V2Y A;  5DCN A;  1U4A A;  2OJR A;  3DVG X;  4W9G A;  3UGB B;  1SGH A;  4LJO B;  4BOS C;  2M17 A;  1WZ3 A;  2K8C A;  1WJ4 A;  2FAZ A;  4IWO A;  3QK0 A;  1JRU A;  4ANV A;  3AU4 A;  2G4S A;  2PE9 A;  4MGZ E;  3PSE B;  3H7P B;  1WR6 E;  3V61 A;  3KW5 B;  3A9K A;  1L2N A;  3UQB A;  2L0F A;  2JRH A;  3JSV A;  3C0R B;  1OEY J;  4WWP A;  2NBU A;  3ZNI D;  2MCN B;  1IYF A;  2KFJ A;  1Q5W B;  3GZN I;  2LVO A;  3PZD A;  3ZRF A;  2IO1 B;  4HK2 A;  4AWJ A;  1R4N I;  4MDK E;  1WX9 A;  3A9J B;  3IBE A;  5DPT A;  3SDL C;  4KV2 A;  4PS8 A;  2AEH A;  2K6Q A;  2D10 A;  3H7P A;  4K7S A;  4HLE A;  2BGF A;  2D11 A;  3H6N A;  5C1Z A;  3ML9 A;  5E6N A;  3SD5 A;  2NPT A;  2CHZ A;  5CX3 A;  2JXX A;  2YVC A;  4WQO B;  3UQA A;  1OEY A;  1XD3 B;  4ASW C;  1ZW7 A;  4GDL A;  5L95 C;  4MH0 E;  2IYD B;  4EKU A;  4OVV A;  2NS5 A;  4W9H A;  4BKT A;  5L83 A;  1E8X A;  2K1F A;  1GUA B;  1WGR A;  2W9N A;  3A9J A;  4FHK A;  3VH4 B;  2J7Q B;  5KHQ A;  2O6V A;  3VFK A;  3RZF A;  1WMH B;  1OGW A;  4GGQ A;  3VDZ A;  2LGD A;  3IFW B;  4I6N B;  3TJP A;  1EF1 A;  4NY0 A;  3KYD D;  4JL9 A;  4LDT B;  4NAW B;  3QX1 A;  1SE9 A;  2KMC A;  4II3 B;  1GNU A;  2GOW A;  4HPL B;  3TMP B;  2HTH A;  2LZ6 A;  2FIF A;  2KKC A;  1UD7 A;  2NVU I;  1XQQ A;  3QAQ A;  4MEL A;  4XX5 A;  4ZDV A;  1WGG A;  4KDI C;  3CF6 E;  5DPR A;  2O2V A;  1J0G A;  3RD2 A;  2Z0D B;  4K7U A;  1V5O A;  4HVB A;  2G3Q B;  4W9E A;  4DDG D;  3APC A;  5CHV C;  3ZIM A;  1WMH A;  4ANU A;  3CMM B;  3UIO B;  4BOZ B;  3OJ4 B;  4CYE A;  4EZK A;  1LM8 B;  3H1U A;  5LXI B;  4BKS D;  2LVQ A;  5D7G A;  2D07 B;  4NAW A;  3X0W A;  1Q1O A;  3PVL A;  4AJW A;  3ZDM C;  2WDT B;  3NS8 A;  1E8W A;  3VUW A;  5JHA A;  2ZZP B;  4N9F 4;  1M94 A;  1I42 A;  1TTN A;  3M63 B;  1WGY A;  4WWO A;  1UZX B;  1WI0 A;  4NJ6 A;  1G6J A;  1KM7 A;  2FCQ A;  1NI2 A;  2JZZ A;  2DYB A;  2M0X A;  2ZPN A;  3WAP A;  2LI5 A;  2BWE S;  2ZJD A;  3DBS A;  2JRI B;  2M8S A;  1RRB A;  4FLH A;  3QWZ B;  1ISN A;  3RYT A;  3PGE A;  2N1V A;  4W9J A;  1WF9 A;  4K81 A;  4B9K A;  3T8M A;  3VQI A;  1WFY A;  2L00 B;  2XEW A;  3D32 A;  1RAX A;  2CHX A;  2K6D B;  2AL6 A;  4URK A;  4KZ0 A;  2KTF A;  2DZJ A;  2KWC A;  2LGX A;  2MBQ A;  2C9W B;  4KVG B;  4EUT A;  2J0K A;  2A5U A;  1WXV A;  2IY1 B;  3R3M A;  2DYO A;  3ALB A;  2M4N A;  1XT9 B;  2RD0 A;  3W1S A;  3APD A;  4HWI B;  3RCZ A;  4TQ0 A;  3WAL A;  4PS7 A;  1LXD A;  2PJH A;  4GN1 A;  4XC2 A;  4TKN A;  1I35 A;  2EMS A;  3AXC A;  4BVU C;  2V3S A;  4ZRJ A;  2CKH B;  4NJ7 A;  2DX5 B;  2C7N B;  5KHO A;  1Z5S B;  3P2B A;  2K8H A;  3H9D A;  1MG8 A;  2K39 A;  4M0W B;  1WY8 A;  1P98 A;  3NOB A;  2G4D B;  4RM9 A;  2JVC A;  4KDL B;  4WAA A;  4ANX A;  3TBL D;  2L76 A;  4W9D A;  4IM3 A;  1UBQ A;  3QIJ A;  4WJQ A;  3KVF B;  3ZTD A;  4M8M A;  3PHX B;  4LJP B;  3U8Z A;  4A20 A;  4FN2 A;  2KN5 A;  2ZNV C;  4I6L B;  1NDD A;  4E74 A;  4PYZ A;  2DEN B;  3DCG A;  3VTV A;  2WX1 A;  2AWT A;  3L54 A;  1V49 A;  5JHB A;  1Q0W B;  2LXC A;  3S2A A;  2FID A;  3DDC B;  2WX0 A;  1WX8 A;  3B1L X;  4GMV A;  3SU8 X;  3VTW A;  3ZNH B;  2OOB B;  3TL5 A;  2LVP A;  3RZW C;  3PHW B;  3HHM A;  4HDQ A;  2FUH B;  2KX0 A;  2REX A;  4W9F A;  4II2 B;  2MBE A;  3WIM A;  3ZDT A;  2GBK A;  2DYM A;  3B0A A;  1R4M I;  1UH6 A;  2A4Z A;  5GMV A;  1V86 A;  2MP2 B;  4KSK C;  1E90 A;  5FR6 A;  5LXH A;  2FCN A;  4K7W A;  4BKG A;  1WGH A;  4ZYN A;  3SHQ A;  4EOY A;  2NBW B;  3VAW A;  3O65 B;  2EMT A;  2KDI A;  3AI5 A;  3NHE B;  5AZF A;  1P0R A;  3K9O B;  4GOC A;  5J2R A;  3IG3 A;  4J6I A;  2RPQ A;  3DVG Y;  1H8C A;  2JY6 A;  4F1S A;  2GBJ A;  1WIA A;  4DXA B;  3TIX A;  1P9D U;  3PRP B;  2KC1 A;  4JIO U;  4G11 A;  3DBR I;  2AL3 A;  2FNJ B;  5C23 A;  3WAO A;  4IC7 B;  4IUM B;  1WX7 A;  4KZC A;  1V9J A;  5J18 A;  1V80 A;  4HJK A;  2C7H A;  2N9E B;  2KO3 A;  4NNJ B;  5D94 A;  3V6C B;  3RUL A;  4I6P A;  4CO7 A;  2KD0 A;  1P1A A;  2KHW B;  3VXW A;  3ZUN A;  2KDE B;  2GMI C;  4G3X B;  3DOW A;  2O6V D;  5DPW A;  3VHT C;  1WJ6 A;  1WM2 A;  3W1Y A;  3QHT A;  3RUI B;  4WJO A;  2D3G A;  1UBI A;  3QA8 A;  2L8J A;  4M8N A;  3R7Q A;  4EZJ A;  3U7D A;  4MJS B;  4HPM B;  3H7S A;  5JZE B;  2ZCB A;  2R2O A;  3EFU A;  3VVW B;  5CHF A;  3KUZ A;  2PE6 B;  1OTR B;  1LFD A;  2PPH A;  3IHP C;  2MRP A;  3PLU A;  4FAD A;  2L0T A;  1E8Z A;  4IM2 A;  3V62 A;  4DK5 A;  2KWV B;  5CTR C;  5CHW A;  4FA6 A;  2MA9 B;  4FUL A;  4P7I A;  2YLM A;  2AYO B;  2MBH A;  3VTU A;  4B6W A;  2Z59 B;  3PRM B;  1YIW A;  3KH0 A;  2RSU A;  2HD5 B;  2KLC A;  3K9P B;  4A3O A;  3CST A;  3QCA A;  3ZTC A;  1OQY A;  4A3P A;  4PS3 A;  2VRR B;  1WJU A;  2DAJ A;  4MJS A;  4DBG A;  3CSF A;  1YJ1 A;  3PS6 A;  4DDI D;  1P3Q U;  3B08 A;  3WAN A;  1AAR A;  3RT3 B;  4LCD E;  3ECI A;  3NZU A;  4W9L A;  3DVN V;  4BFR A;  5HKH A;  2Y5B B;  4E3C A;  3Q3F A;  3NZS A;  5IA7 A;  2HE7 A;  1YX5 B;  1ZGU B;  2LAS A;  2DZI A;  1J8C A;  4DWF A;  2IO2 B;  4MM3 A;  5D2M B;  2FCM A;  2C60 A;  2XK5 B;  5DPS A;  3HM6 X;  3PPA A;  4BBN C;  2KMA A;  2RR9 A;  2K25 A;  2JUO A;  2N7E A;  3ZLZ A;  1QZE A;  4TQ1 A;  2J0M A;  3R66 C;  1NBF C;  3L0W B;  1YQB A;  3LJ3 A;  4ZRK A;  2M1M A;  1BT0 A;  2KJH B;  2ZVO A;  5E6O A;  3QQ8 B;  3M62 B;  3UF8 A;  3KYC D;  2N9P C;  3MTN B;  2IO0 B;  2B3A A;  3EEC A;  4IWP A;  1D3Z A;  2I1J A;  4HCP B;  2MBB B;  4MEM A;  2XK5 A;  4GDK B;  4KIK B;  2BYE A;  5JH5 C;  1PQS A;  1WH3 A;  2GBR A;  2KZR A;  4EFO A;  3EHV A;  3DVN U;  1GG3 A;  4GIV A;  3A1Q B;  4WJP A;  4AJY B;  2NBV B;  2BKR B;  4AP4 C;  2KQS A;  2DZM A;  4MGY E;  4IG7 B;  4G50 A;  4DHJ D;  1ZKH A;  4HCN B;  4ICU A;  3U30 A;  2J0J A;  1TZ1 A;  2KTR B;  4ANW A;  2MX2 A;  3VH3 B;  2BWF A;  4FHJ A;  4F7Z A;  3N32 A;  4GDK A;  3R7R A;  4KIK A;  2GBN A;  3UIP B;  1GC6 A;  4MSQ B;  2KDB A;  1J19 A;  2CU1 A;  2MWS B;  3A1Q A;  2KXJ A;  3ZVV A;  5TR5 A;  1TGZ B;  2DHZ A;  2DAF A;  3T9L A;  5IAA C;  2L05 A;  2ZVN A;  2MSE D;  2KQ7 A;  2ZNV B;  1WR1 A;  2KK8 A;  3BY4 B;  2L3Z A;  2NPT B;  4JQW C;  2LGY A;  4X57 B;  1A5R A;  2C5L C;  1VCB A;  4YL8 A;  1WRD B;  2KTR A;  3I3T B;  3N3K B;  1TBE A;  3ONS A;  4GDL B;  2ZEQ A;  3JVZ X;  5AZH A;  1C3T A;  3M3J A;  4NPN A;  3QJZ A;  3L13 A;  1C1Y B;  4AUQ C;  4FJV B;  2NR2 A;  3DPD A;  1S3S G;  1UGM A;  2O6V B;  3ZW3 A;  2CS4 A;  2CHW A;  4ZRI A;  2UWQ A;  4RM8 A;  4WJN A;  1Y8R C;  3MJW A;  2MW5 A;  5E6P A;  3MHS D;  1EUV B;  3JYU A;  3TCA A;  3PT2 B;  4NQK E;  1E7U A;  2MBO A;  3WA0 A;  2KJ6 A;  4IW0 A;  2LUE A;  3A4S C;  3L08 A;  5AZG A;  1WGD A;  1T0Y A;  2MP2 A;  2LXA A;  2WWZ A;  4RMA A;  2LRU A;  4XZ4 A;  4K1R B;  2GBM A;  2IZV B;  2KDF B;  2O2V B;  2KNB A;  1WXA A;  2FCS A;  4HDO A;  2ZPY A;  1S1Q B;  4WWN A;  2ZCC A;  1E7V A;  3Q3J A;  4F8C B;  2DZK A;  3JW0 X;  4OVU A;  1V81 A;  4TUU A;  5G2N A;  2I1K A;  3QAR A;  4W9I A;  4BKS A;  3PTF C;  1HE8 A;  2HJ8 A;  2KX3 A;  2IBI B;  3PLV A;  2LRW A;  3IVF A;  4MGK E;  2BYV E;  2V4L A;  1Z2M A;  1K8R B;  3ENE A;  4W9C A;  4AOF A;  1V5T A;  2D2Q A;  3HM3 A;  2L7R A;  3DQV A;  2KOX A;  2LJ5 A;  3A33 B;  3OAW A;  3A4R A;  1WZ0 A;  2MQJ A;  3ZRC A;  2KLG A;  4KSL C;  3AU5 A;  4FBJ B;  3ZNG C;  2G45 B;  2KC2 A;  1LQB A;  3WAM A;  4EZL A;  5J17 A;  2RGF A;  3PRE A;  3HIZ A;  4TV3 A;  2BKF A;  1L7Y A;  4MGI E;  1X1M A;  2ASQ A;  1KJT A;  3AUL A;  4GB9 A;  4LDT D;  3UIN B;  2Z0E B;  2V1Y A;  3PV1 A;  4DHZ E;  3W1S C;  2N1W A;  3V6E B;  1H4R A;  3ZNZ B;  4GU2 A;  3APF A;  1V6E A;  2N9X A;  4JLC A;  2UYZ B;  4W9K A;  3OLM D;  1WM3 A;  4JGH B;  3ZO5 B;  2CR5 A;  1GJZ A;  1EF5 A;  1CMX B;  3HK0 A;  2MLB A;  5LLI A;  3OJ3 A;  2IO3 B;  2IY0 B;  1WJN A;  2K8B A;  2KJR A;  1GC7 A;  2KWU B;  2LD9 A;  2BF8 B;  4GSW A;  4DHZ B;  5AEK B;  1VD2 A;  2KFK B;  3DBL I;  2XBB C;  2EKE C;  1RLF A;  1FXT B;  1WE7 A;  4ICV A;  1WXS A;  2WYQ A;  3ZKJ C;  1KLV A;  4IWQ A;  4B95 A;  1E5W A;  2NCN A;  2JPH A;  4FJZ A;  4G0N B;  1UEL A;  2KVR A;  3ML8 A;  5EDS A;  4BBN F;  3KUC B;  3N30 A;  1F9J A;  4MSM B;  4DHJ B;  3L10 B;  1YD8 U;  1WYW B;  2JF5 A;  4PYU A;  3PRZ A;  5G55 A;  4NQL B;  4HXD A;  3V60 A;  1KOT A;  3NY5 A;  1EO6 A;  3QC8 B;  4IM0 A;  2N4F A;  2JZ3 B;  3DBH I;  5D6J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...