3O13A

Crystal structure of a superantigen-like protein (sav0433) from staphylococcus aureus mu50 at 2.05 a resolution
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
194
structure length
187
Chain Sequence
EVRSQATQDLSEYYKGRGFELTNVTGYKYGNKVTFIDNSQQIDVTLTGNEKLTVKDDDEVSNVDVFVVREGSSAITTSIGGITKTNGTQHKDTVQNVNLSVSKSTSVTSEYYSIYKEEISLKELDFKLRKHLIDKHDLYKTEPKDSKIRITMKNGGYYTFELNKKLQPHRMGDTIDSRNIEKIEVNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superantigen-like protein
publication title Crystal structure of a superantigen-like protein (SAV0433) from Staphylococcus aureus MU50 at 2.05 A resolution
rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Toxin
total genus 55
structure length 187
sequence length 194
ec nomenclature
pdb deposition date 2010-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3o13A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3o13A01
1EEID 3W2DA 1SEBD 1BCPB 1S5CD 1D5XC 1JQYD 1LO5D 3KLSX 2TSSA 2Z8LA 1ESFA 1TS4A 4UDUC 2NTTA 1D6EC 1UNSA 1AW7A 3BYTB 1LTRD 1PRTF 3GP7A 1CHPD 4TSSA 1EEFD 1CQVA 1I4QA 4C56C 1YN4A 1JWMD 1ENFA 1RD9D 1XXGA 1RDPD 4L6TB 2ICIA 1SXTA 3R8BA 1ET6A 1I4PA 2R61A 1SJED 2AQ1B 1STEA 1T5XD 1FGBD 1JCKB 1B44D 2XRSD 3MFGA 1FD7D 4BWGB 1BCPF 3R2IA 1V1PB 1AN8A 1PYWD 1B1ZA 1DYQA 2J4XA 3BYYB 3OWEB 1F77A 4OHJA 1L0YB 2G9HD 1XTCD 1JR0D 5FK9C 1LT3D 1S5FD 1TY2A 1TY0A 1PTOB 5FKAC 1EFID 1PTOD 2WV6D 1GOZA 1LTAD 1CHQD 4RGMA 5ELFA 4RGTA 1EU3A 4RH6A 4ZYSA 1YN5A 2RDGA 3URYA 1LTSD 1BCPC 4RHSA 1FNVA 2QILA 1EU4A 1I4GA 4RFBA 4O1NA 1FNWA 1SE2A 4DXGA 4NZLB 2IPKD 1DJRD 3DWAA 2NTSA 1LLRD 1I4RA 2XNAC 3R2TA 1S5BD 5D3DA 5I4DA 1MD2D 1PRTC 4RCOA 1QILA 1LTID 1RCVD 3EA6A 1LTTD 1PZJD 4RHRA 1FNUA 2AQ2B 1CT1D 1G8ZD 1LT5D 1HQRD 4RGOS 1HA5A 1PTOF 1TS2A 1V1PA 3BVMA 5ELEA 2O2LD 1L0XB 3DWPA 1PZKD 1TS5A 1UUPA 3TSSA 3EFXD 2XRQD 1KLUD 5ELBA 1I4HA 5ELDA 1YN3A 1KTKA 4Z9CB 1LT4D 1SBBB 1V1OA 1LT6D 1SJHD 3BVZA 1M4VA 1SE4A 1BCPD 1D5MC 1S5ED 5D3IB 1PTOH 2RDHA 3BZDB 1I4XA 4RGNA 1TS3A 1BXTA 1PZID 1PRTB 1HTLD 2QEJC 3CHBD 1LTBD 5ELCA 1PRTD 4L63B 1LTGD 1PTOC 2SEBD 2XN9C 1S5DD 1EWCA 3SEBA 1ET9A 3O13A 2IJ0A 1CK1A 1JWUD 3V05A 3BVGA 1RF2D 2AQ3B 3MC0B 5TSSA 1D5ZC 1JWSD 1HXYD 1KLGD 3DWQA 4K6LA 2CHBD 4DXFA 1SE3A
chains in the Genus database with same CATH superfamily
1KRSA 3KW5B 3GTKH 4JCVE 2KWCA 4DN4M 5EE1A 2HJ1A 4C4VB 3P4SB 3H9DA 2LUMA 2F1MA 3VRBB 2KHJA 2A73B 2R92G 5HHDG 4GS3A 1ESFA 4NXNQ 1TS4A 4HJ9A 3HKZE 2WXLA 3L54A 3VR2A 2J0KA 2EY6A 2HIVA 1N61A 4ULLA 1HZ6A 3BINA 3ND9A 2N0SB 2K9XA 2JX5A 1T9HA 3QIJA 4CQNA 2K33A 5IP9G 1SIJA 2RCNA 2JQOA 2ZCBA 3HKSA 2DY7A 2PMZB 4L5QA 1K8MA 3TDQA 2UUCL 3A9KB 4N59A 4AQYQ 1GUOA 2GVBA 2ICEC 3HOXH 1N34L 4A3DG 3J81E 3NWSA 3T8MA 2JK8A 1CI3M 5F2DA 2KYWA 3TEZA 5IN7A 3M95A 5EDSA 2EIFA 2WDRB 3KBXA 4HPPA 3H0GB 4N58A 1EO6A 1ENCA 2LGXA 1B1ZA 1DOKA 4G11A 1X1MA 1F77A 1GM5A 4DR7Q 2CS4A 4ZYNA 1X3FA 2Y5BB 1TWCH 5FR3A 1YMHE 4IUNA 1WFQA 2G4SA 3VRAB 3X23A 4W9DA 4HROA 2BTEA 1GC6A 3QA8A 2EY1A 1IYUA 3Q24A 2Z0SA 4K7SA 2PPBC 2IGGA 2KC2A 1QVGA 1WE7A 1PTOD 4C3JH 4X65L 4C4VA 2PIAA 5ELFA 4QJFA 1WR6E 2RDGA 3MHZA 4HJ7A 2VQEL 3URYA 1B53A 1VQLA 2O5JC 4F1SA 2ZZPB 3DMUA 4RHSA 1KABA 3I4LA 5E4WC 3CXCA 2JA5B 4RFBA 2O4XA 4NPSA 4M0WB 4ZDVA 5IE8A 3FMCA 5C4XB 4HXDA 4HJKA 4F8CB 3B2GA 1ONLA 4ZRIA 3FAHA 3D4DA 5C5LA 1JICA 4URKA 3FILA 1SN8A 1A15A 4DUZL 3C1EA 2YTYA 3JAML 4EVOA 2RDFA 1LT5D 1X56A 2CVRA 2CKZB 2A5HA 1XQQA 4ICUA 3FKIB 4DHJB 1O7IA 3IRBA 4B95A 2WS3B 5ELEA 1ZKHA 2D2QA 2LZ6A 3TSSA 3QAQA 1Q8KA 1UBIA 2BKFA 1HNZL 2N49A 2AYOB 2ZXRA 1NE3A 4EQOA 3CC7A 1WH3A 3TL5A 2ZJDA 1SE4A 4XDXA 1BCPD 1D5MC 3ZUNA 3NTHA 1BUIC 2BDOA 4FBJB 3PUWA 1LTLA 1R4QB 2KCTA 3BZDB 1R4MI 1KC8C 4A9AA 1L1OC 3D31A 4W9JA 1K8AC 2PI2A 1SYEA 1YJWA 4JI8Q 1WR1A 2OXPA 3RZWC 1CKNB 2QEJC 2JA6G 4RAUC 2N7EA 1EYAA 1CFMA 3RN9C 4A8XC 4WIPA 3J81c 4IPHA 1IP9A 4EZLA 4W9KA 1IGDA 5BR8L 2NBWB 3QC8B 4M0WA 2Z59B 5EE9A 4JW0A 2LRUA 3V05A 5J22A 2DHZA 3JC66 4IPGA 4B3TQ 2MP2B 3KUDB 1Z6HA 2KQSA 2JA7B 1LGRA 4FXCA 4FN2A 1GHJA 5C3EH 4MJSA 3FHWA 1FO4A 1HJPA 2B8GA 1KLVA 2Q8TA 4GN4B 1EIHA 1YX6B 3FC4A 3AXCA 1YNXA 1DM0B 4F88A 2BOSA 3J81i 1YJNA 3A1QA 3BZCA 3I56A 3P75A 1X55A 5IOCA 2Y0SG 3CWIA 4ZLTF 1WF9A 4A3GG 1MSHA 3S1RB 4GKJL 4K14A 1CQVA 3RNGC 3DXJC 3M85A 3PO3B 1O7YA 3DHHC 5CV4A 1HR0Q 2B63G 3SXHA 3ULPA 1Z9FA 4DDID 2EYOA 2JZPA 1I94Q 1ESRA 2PNHA 2B2UC 1SF0A 3HEJA 4CHTB 3S2DB 5H92C 1NY4A 1CKNA 4XX5A 5GADC 4M00A 1WX9A 1PYWD 3K59A 1DYQA 2J4XA 1WM3A 3PRZA 3OWEB 3K7AH 4Y52H 1M90C 4FLHA 1AYFA 1VQKA 4TMAB 3ALBA 5BYQA 3HOUG 2A1AA 2G9HD 4BKSA 4IUTA 2MP2A 3MC9A 4G50A 3NBHB 2GI9A 2KMAA 2A69C 1B4OA 4A3IB 4JI7L 2A6HC 3K5OA 4KHPL 3AEEB 3UI2A 4OWWB 1WSPA 3KWVA 2NMQA 4FJVB 2LXJA 3W1GA 4K0KQ 4RGTA 4E71A 3JSVB 3HOVH 2FJ2A 2F3WA 2K3UA 2LD9A 2M2LA 1HUNA 1F1HA 4C3IG 4MGIE 1NSNS 3K6OA 3GTMH 1XPOA 2QILA 4KKUA 2UUBL 1RFKA 1SE9A 2HDMA 3F2CA 2R92B 2M17A 4CDDC 1Q86C 3ZNGC 2WXQA 1SROA 3I4NH 3PO2H 3IFTA 2DAFA 4RF1A 3I4MH 5IP4D 2PI2E 4DV7L 1FXIA 1AE3A 4A3BH 3AE9B 3IHPC 5CHWA 3TS0A 2HHHQ 4DHZE 2DBYA 1B8AA 1VQ4A 2NZHA 2BW2A 1D2BA 1E8XA 3F1ZA 2J7ZA 1CQFA 1K83B 3BG3A 1F0ZA 2IGDA 1Y1WG 1FXTB 3EFUA 2B2TA 3HOWH 2A74C 5EBCA 1SGHA 1UE5A 2BS3B 2KXJA 3I73A 3NOBA 1XNRQ 4DFAA 3GE8C 2F0GA 3S2HH 1LT6D 4QF4A 3QK0A 3RULA 3D3RA 2RHQB 4YTPB 3R93A 2F0UA 3NBHA 4ILWA 3Q69A 3C1FA 1K28A 2WDQB 3BDLA 4IFDI 1VQGA 3FRPB 1YBYA 2ZJRA 1WMHA 1PYSB 2EMTA 1PZID 4FF4A 1STAA 2KMMA 2KFKB 2AEHA 2NR2A 2GBKA 1LABA 1J9OA 2VUMB 4KDLB 5HG2A 2Q5WD 1VQ9A 1S5DD 1WOCA 2RBMA 3O13A 4MTNA 3GZNB 4YXDB 2EMSA 2ZTDA 3DVNU 2LMCB 2K8HA 5D7GA 2CHBD 3H15A 4N9TA 3O65B 2WIIB 5D3DA 1J8IA 2W55A 5LLIA 2VZKB 1VZ7A 2L11A 4LF7L 4IPCA 1J8CA 1LO5D 1WZ0A 4ZRPA 1UNSA 1AW7A 2W54A 1B3AA 3RUZA 5JZEB 3V96A 2LXKA 4LF4L 1TVXA 2WX1A 4XYQA 1P7FA 3A7LA 1KRTA 3T16A 2FBWB 2QEXA 3RZDB 4GU2A 3VH3B 4H7BA 1EWHA 4Y7NH 1K51A 4PYZA 5K36H 3W3AA 3CF6E 1C48A 2B2YA 4HJAA 1F2MA 5JPNC 2ZXOA 3CF5A 3HP3A 3SR6A 4LNIA 4ZHOA 4NY0A 3AU7A 3PQIA 1R4NI 1YOVB 3NUCA 1H9RA 2QMTA 1SJED 3E56A 1GC7A 1TWFB 1T5XD 3L08A 4BWGB 1I42A 1RODA 1VQDA 1ZXIA 3L9AX 1ZEQX 1PV4A 4WAAA 1L4ZB 2KFKA 3HK0A 3DHQA 4KLKA 5C44H 4OONA 4L2YA 2I46A 4MT5A 5CORA 5FLXL 3U7ZA 2MLBA 2JA6B 4P73A 4LFCL 3TS2A 2WHIA 4JLCA 3VDZA 4BOZB 3A9JB 1NBWA 1ISNA 3DOWA 4IM3A 1N36Q 2E2IB 1WTHA 2RSNA 5LL6S 2QIEB 3PCOB 1JE5A 3FEWX 1EUVB 1TY0A 3RZFA 5DPTA 2BYFA 2N9EB 1VQMA 3FVQA 4KHVA 5IT9c 4I7ZC 5CBEE 1I6HB 1ZPSA 4AOFA 2ZTEA 1XPRA 4DAYB 3OJ4B 1ZDXA 2RKSA 2BE5D 3D4WA 3GQBA 3KLWA 1G91A 3A8JE 4KSKC 5E6NA 4HIDA 3B1LX 4CHKA 2M56B 4PZ6A 1PDQA 4LF8L 4JI1Q 4ACFA 1SR3A 3B0AA 3QIAA 2Y0SB 3DBLB 4NAWB 1WXMA 4C2MH 1BR9A 4PMCA 4RCNA 1U5KA 3VR5A 1MD2D 4CJ0B 4A3GB 3OJ3A 4WJNA 4XE0A 5BMGA 3T1HQ 1XLOA 1YHBA 4DV2L 4G7ZC 3OTOL 4P74A 1F2RI 3H7PA 4G7HC 3RUIB 2KOLA 1G8ZD 2INDC 3TBIB 4NNJB 2B63B 1PTOF 2A69D 1P3QU 1B9NA 1TT5B 2V4IB 4DDGD 4WWPA 2A6HD 4IM0A 2GA4B 3VHTC 3RD2A 1C79A 2IY0B 2WNMA 1KLUD 1YN3A 2JRHA 2MBBB 4Z9CB 1FR3A 2JE6I 2L1AA 5K5PA 5CV5A 3A9JA 4PK1A 4B3RL 1AARA 2NVQH 4K6DA 4HIKA 3HM6X 4EZKA 2A6EC 2KN5A 2ZVOA 3VA5A 4RNAA 4XC2A 1ZW7A 1WM2A 3PGEA 3GTLB 3HOUB 2BWFA 3UE0A 3K80C 2FCNA 2B29A 1Z2MA 4J1MA 3N20C 3K7UC 4DAYA 1KAAA 2FMCA 1I5FA 3C19A 3AE8B 5CBAE 5HI1A 1PDXA 4LNKA 1DCZA 3A7AB 1N33L 1Y69U 4MELA 3HKZG 2PW9A 3PRPB 3S16B 2AUJD 1T0RC 3ETRA 3ZVVA 3H3VC 1YJIA 3NXWA 4C3IB 1E2VA 3M3YB 1YI2A 4LFAL 1KLGD 3DWQA 4JYAQ 1PYBA 5ISRA 1UGMA 1BCPB 2RDBC 1JC7A 1UE7A 2ASBA 2D3CA 1JQYD 1K0SA 5ELOA 2PCFB 4DUYQ 5M5YB 3DBHB 1I4QA 1TWGB 4MGZE 3ZKJC 1ICFB 4YHHQ 1Y1WB 3BIID 1SNOA 3PS6A 3ZNZB 4B0MA 1RD9D 2LGIA 1Y14B 3GS2A 2ICIA 2FMMA 3J7AV 4P72A 2KHIA 1OQYA 1E7UA 2BT6A 2D10A 3WAMA 3J7YW 3EJIA 4FXKC 4DR5Q 3GTPB 2FNJB 4DR3L 1FGBD 2BB5A 4IWOA 1F9SA 3NQTA 4R4CA 2I2YA 3ZJYC 5JEAH 2SAKA 2B2VA 1KJTA 3PSEB 5LXIB 3AECB 3EROA 1L2FA 3PUVA 1EFWA 1NBFC 1P98A 4OW0A 3NRZA 2I1KA 2VXWA 2AL3A 2IY5B 4FA6A 3SK6A 3G4SA 2BBCA 2JZ3B 2M0XA 3E6ZX 3HOXG 2NVXB 2MW5A 3AB5A 3TIXA 1FMAD 1GNUA 3N1XC 5I6YA 1HH2P 1OXUA 5GQOA 1PH3A 4JQWC 2JPHA 2N88A 2CJOA 2DN8A 1EY6A 4RH6A 2CH4A 3H6NA 3RLNA 2GBMA 2RR9A 3TP8A 4HMJA 5C4JB 3VR4A 3L0OA 4C7ZA 1AE2A 4XWTA 3AE6B 4DR2Q 3DWAA 2XNAC 3PIOA 1NVID 3GTJB 1Q0WB 4C3JG 4JI2Q 4U673 2KAJA 3VA7A 5M5XH 4NP5A 1VQPA 1GUAB 1A2TA 2JWZA 3CQZH 4DXAB 2MBEA 2RQXA 3VR8B 3GTGH 3RNFC 5GXGB 2K7VA 3PLVA 2AWNA 4YWMA 1HZ5A 1SAPA 4A55A 4DK3C 3APFA 2J0TD 3HFZB 4OL7A 1BT0A 1V9JA 2L7RA 4DWFA 2KLCA 1LUZA 2V9HA 4FF1A 4DHJD 5E7NA 5LL6X 2KDFB 3ABVB 2LEKA 1S3SG 4YY3Q 4NXMQ 1F2RC 1YQ4B 2XRQD 1WGRA 2R7FA 3DBRI 3SVMA 2JWUA 5CGKA 3CKIB 1B70B 1TQOA 2XTIA 1F2LA 1A3TA 1X3QA 3CCLA 1HNXQ 5GAHC 1K8OA 1FJGL 2KCCA 1XPUA 1S5ED 1QOAA 1WRDB 2FCMA 4LUZA 3QQ8B 1CZPA 1QWYA 1BUVT 4EOYA 2IX3A 1I4XA 3ZLZA 3TJPA 4S17A 1NMGA 1SYCA 2K5DA 1PH9A 5ELCA 3OWFA 2CWAA 4HRSA 3CRLC 2INNE 3KVFB 2L76A 3PIP3 4WURA 3C0RB 4REZA 2VB2X 4H44C 1PXUA 4UY8C 4UP7A 4BY7H 3QHTA 4LK0M 2L0TA 1L0WA 1Q10A 3QO2A 2VH1A 4N8X1 2A68C 4FP5D 4K2LA 5H8YE 1S72A 1GJXA 4R4OA 2HQEA 3AFQA 4QAYA 5J17A 3EBEA 3LB8C 3BJUA 4K6LA 3CAMA 4XXEA 3TN2A 2VL6A 3UI3A 1Y1VH 2WB1G 2GLSA 2D3AA 3NTIA 2LVPA 3WWVA 2FFKB 3T1YL 3U52E 1D5XC 4A3FH 1VDZA 1DD2A 2A6ED 3KLSX 4TKOB 2Y5PA 3FPUB 2WXIA 1EQRA 5DPRA 4GXBA 5EJWA 4QIWE 5AFWA 3ZJVA 1BBUA 2ZJQA 1TR5A 3TREA 4XQJA 3HHMA 4WQOB 2KVMA 4DR4Q 5D6JB 1Y8OB 2NB0A 4AYBG 4JI0L 1WD0A 4L6TB 4BKGA 1TT2A 5DPSA 3SDZA 2K05A 2N9PC 2Q2TA 4DK5A 3ND8A 4EQ5A 2AUKA 5I9PA 3CCSA 1F9JA 1Y8RC 2IGHA 3N1ZC 3VUWA 2UU9Q 1F9PA 3N3KB 2V1CC 3OSOA 5AJ3Q 3BYYB 4WJWA 1V49A 3NJTA 3ZGZA 3OOCA 4GZYC 1C77A 2C7NB 4UHVA 3AE4B 1VD2A 4ZQ3A 1HA6A 1YJ1A 2LSSA 3E9SA 3EECA 4IKGA 2F0EA 3J80L 1PFSA 1JWBD 2XSCA 2E2DC 3UIOB 2F0HA 4AWJA 1OXTA 5M5WH 3S1NB 3VXWA 3WAOA 1EZ8A 4G3XB 3Q14C 5FJ8H 4LUOA 1BBWA 1EFID 3AI5A 4OZAA 2C7MB 3U2SC 3PUZA 4C80A 3GTQH 2MEKA 2Z0DB 2EXDA 5FR6A 1IW7C 3NPPA 4EQPA 1OO9B 4KVGB 1UWVA 4JWUC 3F2BA 1B2TA 4RM8A 4DXGA 3CCUA 4UAIA 4GN3B 1SNDA 3TP7A 2BS2B 4APVA 1LLRD 3ICEA 2VNUD 4IW0A 3JW0X 1FVIA 2VW9A 5LMNL 2LXCA 3HOVG 1QILA 2BF8B 1NI2A 4OX9L 5M3FH 5KIXA 3GTKB 1QT9A 1JOOA 5M3MH 2LUEA 3J81j 4ICVA 3WIMA 4GNXC 3VR6A 2LGYA 1VF5C 5C3XA 2BGFA 3J80E 4PV1C 4IOCA 3K5NA 2E75C 4LWCA 3I4NG 3L3OC 3PO2G 2UXDQ 3AE7B 4OXPA 1ZYRC 4GLVB 3I4MG 2RF4A 2L4NA 2F0QA 1XCTL 2FE8A 1L1OA 1OQQA 4A3BG 3CMMB 3PREA 2CU3A 3DM3A 1UH6A 3PO0A 3BU2A 4G7OC 3FDTA 2DYOA 2JSVX 3IAS1 4JBMA 3HOXB 3HOWG 5EKIA 3DQVA 3NY5A 1BXTA 1PRTB 1JRPA 2HJ8A 1TYGB 2LY7A 2C5CA 3DEPA 1BDOA 4KTAA 5C4ZA 1S3OA 2PVOD 2IO1B 4QCLA 3PZ7A 1E8YA 3HGBA 1V8CA 4DF7A 3CMEA 1TWCB 1L0VB 4KKTA 4FHKA 3N30A 3UQAA 2IHEA 1N32L 3MC0B 4C3HH 1YJ9A 3AMZA 4DU9A 3GTOH 4IUUA 2XWJB 4P71A 1EOVA 1SMYC 1WGGA 1S5CD 3E0JA 2KFJA 3T13A 2VRRB 2VZKD 4C3JB 4A3CH 2QC8A 2MO0A 3I2ZA 3P4PB 1BF4A 4FO2A 1TIID 1J7AA 1UWXA 4JI5Q 3BYTB 3SU8X 1GB1A 4BBNF 1VZ6A 4IUPA 4K2KA 4A76A 1ZUD2 3H8HA 3L4PA 1HR0W 4X66Q 3V6EB 1YD8U 2YEPF 4YWKA 2B2UA 4DV5L 3GOEA 5CHFA 2HUGA 5H1SE 4A3EH 3V6CB 4LNOA 2F0VA 4ZCKA 4ALPA 2A68D 1VRAB 3E5SA 1WXAA 3VFKA 2KHSA 4DV0L 2UU7A 1M8AA 5FLMH 3AEFB 4O2DA 4LJPB 3NK9A 4YSXB 1V80A 3IL8A 1E8WA 4JWSC 1JT8A 1TKWB 1LM8B 1F9QA 2D9UA 3A54A 2K6AA 1PH8A 4JGHB 5K36G 3TCAA 1P0RA 1J5EQ 1WGDA 3G48A 1XTCD 3J80c 1Y56A 2BKRB 3IFDA 2KA7A 2IWHA 1LT3D 3BDOA 4LF5Q 1FM0D 3DVNV 3Q3NC 1JJ2A 4J6IA 5FO7B 4DV1Q 3SHLA 1WVLA 1DOIA 1R4MB 4LLGM 3I8ZA 5MPOA 1UELA 1QNKA 5C44G 1PH4A 3DEOA 2D07B 2G1EA 1I3QH 2K5HA 1STGA 2ZCCA 2KTFA 4EQNA 4GKKL 4FF2A 2KWVB 2QKIC 1L5PA 2WB1B 2QHOA 2WU5B 2QJLA 1FNVA 2MNAA 2IT1A 3L13A 3DUZA 5AZGA 4O1NA 3J80i 3BWUD 1VF7A 4MACA 1PGBA 1I4RA 1PMRA 1S5BD 3G6EA 2DGYA 1WXVA 3TBLD 4DAMA 4X62L 3OLMD 2WP9B 4Q5VA 4DV6L 2NPTB 1NR2A 1V5TA 3C46A 1DOYA 1STYA 4M01A 3EHVA 3AEGB 2IBIB 4LNFA 4AYBB 3A56A 1KIXA 5C0XJ 1IBML 4YL8A 2VZAA 4LF6L 1P1AA 4HMIA 1QVFA 1I4HA 3M9BA 1KTKA 3MXGA 1IL8A 3M4QA 4JG2A 4LUVA 3ZYYX 4A93H 2UXCL 3MXUA 1WRIA 1QB5D 1IW7D 4DV3Q 3N6RA 5IODA 1XEEA 1X3PA 4HKZE 3FP9A 4BA1I 4KZCA 4P6VF 2MQJA 3H09A 3AN1A 3RNAC 2YVCA 5C6AA 1VQEA 1SYBA 4A3LH 1PFDA 3A9KA 3IG3A 4E3CA 1R9TH 4V190 5HFYA 4WJ3M 1DXMA 4LNQA 3EGRA 4NJ7A 3K5MA 1BOSA 1WGYA 1WGKA 3K7AB 4S0RA 1E3PA 2R3ZA 3TZUA 3P63A 3SK5A 4GDKB 2JXXA 5JOBA 3S1QB 1JWUD 2CHZA 2F4VQ 1OQRA 1YHAA 5TSSA 2UUAQ 1QCBD 1ZYRD 2K32A 2ENBA 2NPTA 3SDLC 1SYGA 4TQUS 1XMOQ 3WAPA 2DZKA 4DQOC 2HTME 4TVAB 3RT3B 2I5MX 1RYJA 2DENB 1YNTE 4C00A 2SDFA 1YNNC 2KOXA 5IA7A 1HRJA 2ZW0A 4AQ7A 4MZ9A 1LTRD 4LFBQ 2G4DB 1CHPD 5CV9A 3ZXVA 3KJPA 3GTMB 4A3OA 1D4BA 2ZTCA 4NW2A 4DR1L 4DR6L 5KNDA 3OW7A 2KVZA 4KY5A 2MRPA 4YTMB 3I4NB 3PO2B 2QDFA 4DNTB 3X0WA 3I4MB 3TZDA 4ZRKA 4RKLA 2UXBL 4B6WA 2L15A 2PZTA 4WWOA 1UAPA 3JAME 3ERSX 4QQBX 1STEA 2AWOA 4LW1A 3MFGA 2WDTB 2MSED 4WAFA 4HCEA 3PT2B 1SMYD 4GN5A 4X3UA 1DGJA 2Y3AA 1MBYA 2JYOA 3HOWB 1IPGA 2KQ7A 1H95A 4KN4C 1I6VC 2LGSA 3KYHC 1HNWL 4OHJA 1M94A 4PQXA 1X54A 3AV8A 2WAQE 3S2HB 2IX0A 5IWAL 3UF8A 3LX0A 3U9SA 1S5FD 1A63A 1JRUA 2DWQA 4KKIA 4LF9L 2PNRC 5JEAG 3I55A 1G6ZA 3N1YC 4FADA 4F87A 4H13C 2WV6D 4JI6Q 2F0MA 2KX0A 1Q5WB 2R2QA 5KNBA 4WH4A 1GUTA 3U7DA 1JORA 3U30A 4IOAA 1KDCA 2F0LA 2MJ3A 5KEEA 3J7A5 5A35A 1BNZA 2N7JA 1QNUA 5T1IA 3CC2A 4LDTB 3QWNA 1WTOA 2K01A 4A3PA 3OAWA 4IFDJ 1IXRA 1PRTC 2N4FA 2B3GA 2PMZE 4RCOA 3U4ZA 3L2PA 2KJHB 1QZEA 4HK2A 1PA6A 2YU9H 2KANA 2AQ2B 3CW2C 3F2UA 5GAEC 5L95C 5C4XH 3P42A 3ZIMA 4G0NB 2F0JA 1D8LA 1N32Q 3DHGC 3IT4B 4A3MH 5CR3A 5M9OA 3AU5A 3MC8A 2R93H 1V1OA 5KRUA 2PKOA 1BKBA 2K8CA 2WXRA 5D94A 3BVZA 1SDFA 4B3MQ 1XF5L 2HD5B 2MGSA 4Y7NB 4GOPC 4BXXH 2WKCA 3GD7A 2ZVNA 2K4KA 1O80A 2K5QA 3AE3B 4B08A 1Q1OA 2R7ZG 5IYDH 1R4NB 2PEAA 4HKQA 2HDLA 1BMLC 4B9KA 3VTUA 3JAMc 1QLBB 2XGTA 3TEWA 1KNEA 2BYTA 1YHQA 2XN9C 1STBA 1ZXTA 5C44B 2KEDA 1ET9A 3CMAA 2EZVA 2WXOA 2EYLA 1T0SC 1WYDA 4A3DB 4KGRA 5LMUL 4PT5A 1HE8A 1DZ1A 2MHJA 4ODGA 2RA4A 1OXVA 1GVPA 1HFGA 1HPCA 4US8A 1IBXB 4BY1H 2XWBB 1GB4A 4BY7G 4HJ5A 3KLSA 3Q8BA 4ASWC 4GIVA 3JAMi 1QE6A 2JP1A 3Q23A 2B8FA 4JI3L 3CCMA 4O0AA 1MG8A 3JSVA 4WFN3 2KTRB 3JVZX 1KDBA 1Y1VG 3HZXA 4C56C 1MJEA 3A5ZB 1YN4A 1XXGA 1I7HA 2UUCQ 4A3FG 4C2MB 4K81A 3R8BA 4X57B 5IGBA 4GKKQ 3AMUA 2DJFC 3RPFC 4GDLB 1TWHB 2L0CA 1N34Q 1FRDA 1WXQA 4J3OD 2V3NA 1X32A 3S1RH 2BS4B 4NQKE 1TKGA 1DOXA 1UE1A 1JCKB 5CV6A 1KOTA 3MTSA 3SK4A 4HAEA 3B6YA 3NVWA 1V1PB 3UE1A 1QZHA 2WXGA 1JJCB 4OWTB 1K9MC 2MJ8A 4IALA 3Q3FA 3I9V1 5C23A 4K3CA 4DV6Q 1ENAA 1YNND 1C9FA 3T51B 2OJWA 3AE1B 2I38A 1HQMC 2RHSB 2YTVA 5FK9C 2NVQB 2N9KA 3RYTA 3V60A 3HG9A 2D62A 5CC4A 1IBXA 4AP4C 4X65Q 4LF6Q 3DDCB 1T6BX 2JEAI 4F7XA 3GE3C 3L7ZC 4K7WA 3C2PA 2VQEQ 4BBRH 1EY0A 3Q3MC 1QUQB 4TQ0A 2HIXA 1K73C 1J7CA 3PV1A 1L4DB 1HTPA 4PYUA 2J52A 4POFA 1J7BA 4FDBA 3PV0A 1A5RA 3ULJA 2JT4B 1TWAH 5IGFA 5FJ8G 3BY4B 4KY7A 3MP9A 5EE0A 2EE1A 4B0EA 1YX5B 4W9HA 4DUZQ 4BBSH 5IYCH 4N9F4 3UQBA 3S14H 5C5MA 3E3XA 1OEYJ 3L0WB 4ABNA 5J2RA 2LMCA 3NS1A 2EJFC 2M00A 1HA5A 2D2CC 1TS2A 4MDKE 1V1PA 1FGUA 3RNUA 1VZ8A 1TU2B 2O2LD 2K5PA 1NUCA 5HGQA 1DOLA 1TJEA 3LGJA 2PMVA 1HNZQ 5EPJA 2HTHA 1LT4D 2B2WC 2CJNA 2W3RA 1MJCA 1RL2A 5M3MG 1K83H 4DV4L 3AEDB 2PO4A 2FAZA 4LJZC 1EYGA 1VQ6A 4HLEA 5I9OA 3ZDTA 2L5TA 4R8NA 1N62A 4JC0A 1HTLD 1OEYA 3DM1A 2M4NA 1PRTD 3Q22A 2K1BA 4DR1Q 1QUQA 1H9MA 4DR6Q 1F2ZA 5IP7H 4WWNA 2NN6I 4CYEA 4GLAC 2NN6H 1F2YA 3KOJA 5BR8Q 3P4QB 4A3JH 1VQHA 2BA0A 2O2VB 1P8LA 3L10B 5FLXE 4OIKA 3NHEB 1ZDVA 4KMUC 3UDGA 2UXBQ 2VY3A 1SLJA 1UEAB 3A55A 1GD7A 1JQ4A 2X38A 2JVCA 1C4QA 5GAGC 2DYBA 4FULA 4YIJA 1SE3A 3A4RA 1W3SA 2JU6X 2AHOB 5E4XA 2VUMH 1PH7A 1FFVA 4J6HA 1K53A 1SIFA 1HUMA 4ZAIA 2DNEA 3N9YC 2WXMA 1Q7YC 4HJGE 4HN7A 5C2TB 4MM3B 2DNCA 4XQQA 3B08A 1TKYA 3D0FA 2J0MA 1T5EA 4H02A 1AZPA 3GP7A 4GKJQ 4W9EA 1Q3LA 4C3HG 4DAVA 1TKEA 5LXHA 2P5ZX 3MJ5A 1WTVA 4XGAB 4KJNA 2NVTH 2K22A 1C3TA 4A75A 2KCMA 4A3CG 2H88B 5M5XB 1Z5SB 4GNXB 1SRUA 1VCBA 2AL6A 3CQZB 1S4ZA 3K58A 3JYUA 3KUCB 4PS8A 3T3OA 1VMCA 4NAWA 1N6ZA 1SB3C 1MHHE 2LHEA 1B44D 2A4ZA 3DHIC 3TQYA 1BCPF 1HZ9A 2SOBA 3MFYA 4HJ8A 3EFCA 2X69A 2R7ZB 2DUDA 2CW0C 4A20A 3S9WA 4A3EG 1AP0A 2ZPNA 4ZOHC 4OIJA 2OCEA 3DBRB 1L0YB 3WANA 3OMGA 4IG7B 2D5GA 5AZFA 3PHXB 4AS1A 1VQOA 2FUG1 4CDEC 3AULA 4X64L 1VQCA 5FLMG 1Q82C 2AKWB 2WWZA 3Q3JA 3HM3A 4JI7Q 2EKEC 4KX6B 1EYDA 1C4AA 4KHPQ 3J9CA 3K0XA 3I91A 1SNQA 4X3SA 4ARCA 3S24A 2LFNA 4FJZA 1YITA 4XZ4A 1RJTA 1EU3A 1AEXA 2K6DB 4MM3A 3A8KE 4DBGA 1EQTA 1U4PA 2K50A 3ZNID 3LXFA 2K39A 3LWUA 5IKCM 2UUBQ 4BY7B 3B9JA 1E6EB 3KDFB 2OTLA 4NDXA 2GN5A 1SFOH 5J1ZA 3DBSA 2KT7A 1I6HH 2N9XA 3K0YA 3RLFA 3MZ5A 5EPLA 5FLXc 3CCVA 3S15H 1NEKB 4RMAA 1PFMA 4DV7Q 1L7YA 3R7RA 4HTHA 3RNBC 4CKBA 1WTPA 1PZJD 1SNCA 1CT1D 4FNFA 3P4RB 5E6OA 4L1BA 4A3FB 3R3OA 4WQMA 2DY8A 1GUGA 1V97A 4PNYA 2OT2A 4CJ1B 3APDA 4HDQA 1IYFA 2IW3A 1DGSA 2CFMA 1UUPA 3HRZC 3KK7A 5LMUQ 3QG1A 4ID6A 1WTWA 1TZOA 4Q0FA 2IYDB 2ZM6L 1IGCA 5CV7A 2NS5A 1VJKA 1XLNA 2MH7A 4USAA 4CJ2C 2MJEA 3H1UA 3KH0A 2VB3X 4YWLA 5BYRA 1D1IA 2IDYA 3T56B 3VYUA 5FOBB 3WOFA 2XEWA 2E8GA 1C1YB 1KF6B 1PTOH 1A8VA 1V2YA 4JI3Q 4IWQA 3H94A 2ATWA 1CZGA 4IUQA 1XNQL 2G5DA 1MGSA 1NTGA 1RM6C 1TGZB 1DONA 5JVH3 2ZNVB 1OXSC 2MJDA 2CQOA 2DJGC 2K75A 3ERQA 3VYSA 1T0QC 2JY6A 3LDZE 2BVCA 4HPMB 4HPLB 1WX7A 4IWPA 2E5LL 4KDIC 3KDFA 3SEBA 2E2JB 2KNBA 3GTLH 3PPAA 2INPE 1WTQA 1CK1A 4Q2JA 2PTLA 2DZIA 2RSOA 1B9MA 1K3BC 1E7PB 2AQ3B 4KJOA 4MTKA 1E0ZA 1VQ8A 2Y0SE 4A3LG 5M5WB 5JJLA 1WI0A 1GJZA 5T8IA 2K04A 2NVUI 4KSLC 1ROEA 4R3DA 1IBLL 4LF7Q 1TZ1A 5IY0A 4B3SL 1XJVA 3AE2B 3W1SC 1VR9A 1WCMH 2Q2UA 1MHWC 2IL8A 2Z6KC 4F7ZA 2GOWA 3P1MA 1VQ5A 2LWPA 1OTCA 4LF4Q 1EEFD 4OEMB 3PZ8A 2GVAA 3VR3A 5ELNA 4L23A 4YSYB 5AUKA 3RMKC 1F9RA 1H9KA 3H6MA 4HSPA 4MH8A 4EX5A 1EOTA 3CC4A 4KKSA 1EYCA 1WIAA 2WAQG 3HVZA 5IOIA 1NAPA 3U4VA 5DCNA 1B3QA 1YIJA 4C1NI 4AQYL 1Y8PB 2K14A 4GSWA 4CGYB 3S1MH 2PE9A 2QGQA 3QOJA 1QJOA 1HTQA 1TIFA 5M3MB 1NCVA 3K57A 2PYKA 1M1KC 1GAQB 2ZT9C 3R2IA 3IKJA 5HKHA 2BB6A 4BVUC 4DK0A 2F0TA 4CKEA 2C9WB 2NBUA 5IGEA 4DR7L 2RD0A 4LFCQ 1WTXA 2DNFA 2H5XA 1W6KA 4KGSA 2M9VA 3PZDA 3GTPH 1WJNA 1H8CA 4PMWA 3OMCA 1P9DU 1QOHA 1PH1A 3IXSA 2LVOA 2PQAB 3NEMA 5C3EG 1GOZA 1LTAD 1CHQD 1JOKA 4ZYSA 2WLBA 5KHQA 1K50A 3KF6B 4MSMB 1BQQT 4JOIC 1MPEA 4AJYB 2OEDA 1XYIA 2L55A 3CD6A 1I4GA 4LF8Q 2OOBB 1NYQA 2IPKD 1DJRD 3PF5A 3APCA 3NS8A 1A70A 5I4DA 4LDTD 4TUUA 3HVDA 4O42A 2CW0D 4C3HB 4DV2Q 1JE4A 1U4LA 4BFRA 3OTOQ 2OTJA 4JPBW 3EA6A 4UP8A 3UDIA 3MHSD 5C4JH 2XK5B 1XWEA 5JPMC 4HIMA 3AE5B 3HKZB 3HOYH 3LJ3A 4W9CA 1EIGA 2I5LX 1AZQA 3A5UA 4KIKB 1L0XB 3T4AC 1L6UA 1QQRA 1G6JA 2EJMA 5BN3A 5ELBA 3CRKC 2NVYH 1A0IA 1CMXB 1GUWA 4JBJA 5CX3A 2L8JA 1B9RA 4B3RQ 5KYLA 4FHJA 1JALA 3CCRA 2F0IA 1UE6A 2H4OA 4HSVA 2ES2A 2FXQA 3TMEA 4LCDE 4A3EB 2CWPA 2RDHA 3ZDMC 3RZOH 4IPDA 3UDXA 2PQAA 4RGNA 5C4XG 2E6XA 2IX1A 3V62A 1Y8NB 2IO2B 1G51A 1OXXK 4L5RC 4A3MG 3ER0A 3CHBD 2LS01 1LTBD 1LFDA 3KF6A 2R93G 2KK8A 1Q1EA 3MXNB 1PTOC 2K28A 3CCEA 1N33Q 1MKHA 1FPYA 3SHQA 4BXXG 4HIOA 4BOSC 1K8RB 5G3LD 3DVGY 2I07B 2JA8H 4C1NK 3M7GA 3AEAB 3MXPA 3KBGA 1RF2D 5IYDG 4LFAQ 4KV6A 4DNRB 5A2QL 4K8JA 4B3TL 4JV5L 3NBIA 2CKHB 2N1WA 1V81A 2JUOA 4P1BC 2UYZB 1K8GA 2MO1A 4FXDA 2E2HH 2I0QA 2KBNA 1T0YA 4GLSC 4YTNB 2NBFA 1CKMA 3C3LA 1SSNA 2EQSA 1GO3E 4WJ4A 4IDIA 4R4IA 4OGQC 1XLQA 2FIDA 1I3QB 3U50C 4CDCC 3CIRB 1D6EC 3EN2A 4RMFA 5D65A 3RD4A 4CKCA 2X8XX 3ITPA 1PRTF 1P7EA 3NZ3A 4XYCA 4A3KH 5JAVA 1TXYA 3VH4B 4DKAC 1RTOA 3ZRFA 1H9SB 2A19A 4ZK9B 3HOZH 2WDVB 4BY1G 2BH2A 1HR0L 3X3MA 2RGFA 3E9HA 1TTNA 2B76B 3ZJUA 2V1YA 4TQ1A 1I94L 4KGTA 4DR3Q 4K5XA 3IAYA 4M8MA 4C7YA 2MPMA 3MXNA 4CO7A 2Z1CA 1G2TA 4OVUA 4GOPB 4UPAA 1KRHA 5A2QE 4MNOA 2K5WA 3U58A 3UIPB 3QCAA 4DK6C 4ANUA 3VQIA 1MJDA 2WGSA 2LVQA 4R1JA 2K5NA 1Q8IA 2BH8A 2L1BA 1WXSA 4QGUA 3OIQA 2L05A 2OJRA 2WFWA 1I50H 4GMVA 2WACA 2YYZA 1PVOA 4II3B 4K0KL 3M4OH 5LNK1 2NZOA 1R9TB 4M8NA 1D3ZA 1LTSD 5JHBA 1WYGA 5I2XA 3P20A 2OHFA 3KJOA 1N9WA 1EU4A 5IGDA 4H2AA 1SE2A 1C0AA 2ZXPA 3Q2AC 5GROA 2EELA 2JRIB 4MHEA 2ZNVC 2WXHA 3I72A 1BBXC 4BBRG 1LYLA 2SNMA 1D1KA 4P2CB 1E0BA 2D5DA 2HHHL 2G45B 2RPQA 4MSQB 1RRBA 1FEHA 2HQLA 1VQJA 2F0SA 1HHVA 1A2UA 2WAQB 3TUOA 5IIFA 3S17H 1FL0A 1IUEA 4MEMA 1N5XA 4GLXA 1KXLA 2EY2A 4GOPA 1Q12A 3ML8A 1S1QB 3A0JA 1E1TA 3GV6A 2Z4HA 4J15A 1W6JA 3EVQA 2LGDA 2BYVE 4P16A 1XNRL 2IY1B 2XVSA 1IHZA 3EQLC 1ZGUB 1IBLQ 1M4VA 2Q2HA 5IYCG 4BBSG 4XWWA 2F0KA 1FJGQ 4B3SQ 5BO4B 1NI3A 4HWIB 2EYPA 2CHWA 2IO0B 2QW7A 2VS1A 3QR8A 3DWGC 3ENEA 3GB1A 2M19A 1C9OA 3SGIA 4JI4L 4OO1H 3A74A 2YTXA 4OO1I 1N60A 2RMMA 5FO9B 3CSTA 1E8ZA 1UWMA 3IAM1 3NUHB 3TEYA 1I35A 2KC1A 4OWXB 1GHKA 3HUIA 3IVFA 5C3EB 4NPNA 2EDGA 1RKNA 3RN2A 3VYRA 5COYA 5TR5A 1EWCA 2ID0A 2KD0A 4L8JA 1OGWA 4IQZA 1A3UA 3PGZA 3FILB 1VQIA 3SD5A 3PIPA 3G7LA 3QX1A 4XIGS 3MJWA 3NELA 3AU4A 5IYBH 3G71A 4I6PA 1VQBA 3RLOA 5IP7G 3EC8A 1KAWA 3WOEA 1QZGA 2NN6G 3T1YQ 1A6XA 4XYOA 3PHWB 1ICWA 2YV5A 4IJLA 4A3JG 5J18A 2TSSA 2Z8LA 3MEFA 1HTOA 3CP0A 3FPPA 4LTUA 5E6PA 4ZKCB 2WXFA 3M4PA 3I7FA 1XO3A 2X6GA 4N6EB 4POGA 1JWMD 2EY5A 1EZ6A 2D0OA 2VUMG 4ANWA 5KGUA 3VDYA 4JI0Q 4WJQA 1FCCC 2C60A 3R7QA 1TBEA 2Z6BA 2INCC 4DHZB 2JF5A 4K7UA 1MSGA 1OTRB 4IJHA 3T3NA 2YU9B 4KHZA 3WCQA 1DOMA 2XRSD 5BN5A 4P7IA 2Z9HA 4JBKA 4QMGA 4XDDA 3A33B 4BZAA 2V3SA 2N3SA 4JL9A 2GBRA 3I4OA 2Y5CA 3WA0A 1CJEA 4A3MB 1Q81C 2KMCA 2WXJA 2EYMA 2K52A 3HOVB 4W9GA 2R93B 3I90A 3SFEB 1JR0D 4MJSB 5I6WA 1JJGA 1N36L 1JMCA 1U4AA 2K5VA 4W9IA 1YNJC 4ZUIA 3A1QB 3OIPA 4GB9A 5HY6A 3ZTDA 4JK1C 3F8TA 1WGHA 4QY7A 4RGMA 4L5TA 4RA8A 1YN5A 4EFOA 3SE0A 4A3BB 3BDCA 5BN4A 2KDIA 1O7LA 3NZSA 4P75A 1PGXA 4E6IA 4FVMA 3KYDD 4LK1C 4JI1L 3M3JA 2FCSA 2KENA 4JIOU 3VTWA 2LXAA 5LMNQ 3ML9A 1G6PA 4XDCA 1XD3B 4GDKA 2KECA 1CA6A 3T1HL 1LTID 4OX9Q 5C0XI 1FFUA 5BYSA 5C0XH 1FNUA 2JN4A 1ZP0B 2XBBC 2F3IA 3GDEA 3GO5A 4BY1B 1FIQA 4K5VA 5JJIA 4IN3A 4RGOS 3H0GH 2B2WA 3BVMA 2G3QB 2GB1A 3QJZA 2G9DA 4RF0A 3KYCD 3EFXD 4ZRZA 4JV5Q 2WXKA 1EWYC 1RHPA 4KKJA 3M7NA 2KEEA 1E2WA 1SBBB 1AH9A 4TKNA 2L9HA 5EGTA 2PJHA 2O5IC 3ZW3A 2MBQA 4IUVA 2LJIA 2ZEQA 1IYJB 1CA5A 2ZW1A 4IZ8A 1MI0A 3MA2B 4YWGG 1EY9A 4A93G 4OVZA 1R7SA 1TS3A 3J7AF 4HCPB 3OYYA 2F0PA 2GBJA 3U8ZA 1E7VA 1HZBA 3ZRCA 1EY7A 2JXMB 2JQRB 1N63A 4R8IA 3NSWA 2JXTA 2WB1E 2JA5H 2RPVA 1A62A 2BE5C 3R3MA 4LNNA 3KLRA 3W5UB 4N8FA 2KDBA 4NQLB 4EGVA 1AFPA 1E5WA 3IT6B 3Q8CA 5IAAC 3A4SC 1GG3A 4JYAL 2OEOA 2JSOA 4N9PA 3UINB 3L17A 1EEID 5CMDA 2QF7A 2D11A 2NUCA 2C5LC 3BZKA 3FKIH 3Q8AA 2WU2B 1Z47A 1C76A 3G6JB 3S1QH 4AYBE 2NTTA 4BBRB 1PH2A 5AUIA 3PUXA 3M4YA 4ITKA 4TSSA 2F0OA 4DUYL 3Q3OC 4ME5A 1G291 2IHFA 1TWAB 4DV5Q 3KQ4A 4YHHL 2EJGC 2D3BA 1WMHB 2FHTA 5G3LF 1UZXB 1RDPD 5CV8A 5IT9L 1WY8A 5G5HA 4HEDA 1WCMG 1V86A 1CUKA 1KFYB 4B9XA 4EZJA 3QOLA 4DV0Q 4BBSB 1CZWA 1JMLA 2ALYB 2F52A 1KNAA 4DR5L 3S14B 2W3SA 4AIMA 2DZJA 1XMQL 1FD7D 4U68A 3BK1A 2EYFA 2N8NA 3TP5A 2JYTA 1EIYB 2C35B 5C3WA 1BO0A 4IOIE 2L12A 4K5WA 4YT0B 3ZNHB 4CBVA 2LKVA 1WX8A 3QB3A 1VCIA 4LMQD 3F2DA 2K25A 2W82A 4K3BA 4BBNC 1GXDC 3D6WA 2L0FA 4II2B 5G2NA 1SNMA 1UD7A 1WI5A 2KQ3A 4WRDA 4I65A 2DX5B 2JA7H 1RWSA 1XCQL 1VQAA 2O6VD 2PE6B 1KDAA 4FF3A 1G2SA 4M1UB 1GUNA 1F52A 3CCJA 2JZZA 4YCUA 3TMPB 1OFFA 1UBQA 3WDNA 2DZMA 3PIO3 2KWDA 4P1CC 1UGJA 3FKYA 1CKOA 2L52A 1WJUA 2PVGC 4BAXA 1T3QA 2KUMA 1WFYA 2ASQA 2Z0EB 1WD1A 1EQQA 4A3JB 5IT9E 2LFIA 2MCNB 3AB9A 4CDFC 3PO3H 4IFDH 3TEXA 4DR2L 3ZQ4A 1EM7A 4JI4Q 1UF0A 2N55A 2AMCB 5KNCA 5I2YA 3CSFA 3STBC 4X62Q 4JI2L 3WALA 4R9WA 5T1GA 1IZ6A 3V2TA 1RCVD 5IGGA 3H3VI 2TMPA 3H3VH 2F0FA 4RHRA 1JROA 3AQQA 3EIVA 1ILQA 1MIUA 3S2DH 2PZWA 1K52A 1RLFA 4GOCA 4ARIA 1YNJD 1IBMQ 3IBEA 1Q90A 1PZKD 4ZRQA 1Q46A 4YY3L 4NXML 2UXCQ 1LXDA 1VDVA 2X6LA 2ON8A 2H1EA 1C78A 1EQVA 1N5WA 1SSOA 3QARA 1C4PA 2NVTB 1HNXL 1X3GA 4A3IH 4F8MA 3QJYA 3HOYG 5KYIA 2KTRA 2WKDA 1QF6A 1W2BA 5HGTA 3ZO5B 3LNNA 3PUYA 2QDLA 2EPBA 2LHDA 3AH7A 2CCZA 1NNXA 1LTGD 4GDLA 4M02A 2BCOA 4YCWA 1PFBA 2QDBA 5AZHA 3E9IA 2R92H 3KFUA 3M63B 1WJ6A 1V8QA 2IJ0A 2V4DA 5JJZA 1SYDA 3BVGA 4KN7C 3H7PB 2KKCA 3K8AA 2M8SA 4TV3A 1EIFA 3W1SA 1NYRA 4W9LA 3C8YA 2IZVB 1TY2A 3VUYA 3W2DA 2Z6KA 1NR4A 5IP9H 5M3FG 3NVZA 3RNEC 2J7QB 4DGZA 1FD6A 1PH5A 1RFAA 4AJWA 1PFNA 2EOTA 1HEZE 4OVVA 3K5LA 3V61A 5IGCA 4KD4A 4UDUC 2WQYB 1LV9A 4X3TA 2JA8G 4DK1A 1X9NA 4A3DH 1KD1C 2BQQA 2KDEB 1EL0A 3PSIA 2YLMA 1WE6A 4D2KA 3SK8A 2B39A 3NG0A 2F0WA 2F0DA 1SFOB 4OELB 1ZE3D 3DVGX 3ZJTA 4DR4L 3I3TB 2GBNA 1ASZA 3S15B 4XTCS 1VMPA 4B9WA 5JXVA 1PHJA 4TRDA 1EY4A 5GMVA 1SE8A 3X3NA 4ANXA 2R61A 1O78A 2OQ0A 4A3KG 4IO9A 2UU9L 3I63C 1AN8A 4A90A 5AJ3L 4HVBA 4IM2A 2JJQA 3HOZG 1KQSA 3E0EA 3VTVA 4A93B 5JEAJ 3GZNI 5DM73 1HNWQ 1MFWA 3M62B 1TWHH 2E76C 5IWAQ 1QVCA 1VQNA 2GRIA 1WTRA 2N9LA 3PMFA 1H4RA 1L6VA 3W9CB 2F4IA 4LF9Q 1MG4A 3U9OA 2FINB 2J42A 2AX5A 2PQEA 1PTOB 4JOIA 3LYYA 3KUPA 4RWSC 3L16A 3HIZA 2R7DA 4MH0E 1L2NA 1VLBA 5J39A 4MIUA 5JHAA 3MEHA 3GTGB 1CM9A 2ACZB 3TP6A 3NTKA 1JOQA 3K81C 4A6QA 2EXZA 3CPFA 1PGAA 2KO3A 2MFIA 1FNWA 3PVLA 4NZLB 3RZDH 3ZTCA 2RVLA 3K9OB 3QWZB 1FCLA 2JEBI 2GMIC 2O2VA 1RIPA 1EF1A 3Q6BA 4YCVA 3EUB2 2BDNA 2PZUA 3AM9A 5C1ZA 2N1VA 2HT1A 1STHA 2VH2A 4NAMA 3IFWB 1JB3A 1TWFH 4PG3A 2HCIA 1XLPA 3RI7C 1HQRD 4XT3B 1WZ3A 1E90A 1SMXA 4QL5A 2MA9B 1C8CA 2RSUA 2Q8IB 1WCMB 3UDFA 3KUZA 3S2AA 2KZRA 4EEWA 1E24A 4QIWB 3DWPA 2K6QA 2N7DA 1TS5A 3RCZA 4PS7A 2OQKA 3NENA 4G4KA 2UXDL 2R2OA 2JA6H 2JYEA 2MBHA 3DPDA 2K0PA 2E2IH 2B2TC 2FCQA 2NWGA 5EKLA 1ZXHA 2KDMA 5D3IB 3I57A 4RM9A 2D0PA 1VQFA 4AH6A 1QG7A 4R4QA 1YIWA 3S1MB 5DPWA 3STBD 3KWLA 2PLPA 4GNXA 2WINB 4L63B 3ONAB 1AWDA 1QOBA 1Y1VB 4WJPA 5EQ0A 3MAQA 2Q8RE 4KD3A 4FYDA 5D14A 1C4CA 1MI2A 1PH6A 3W1YA 3DBLI 4US9A 5BMHA 4A3GH 4OO1G 1WYWB 4BA2I 1V5OA 1XMQQ 1FRRA 4J8QA 1E1OA 4DXFA 2CHXA 3ULLA 2KCNA 1RTNA 2J53A 1J0GA 1U4MA 4HR7B 2V0GA 4A4IA 3I70A 2VQFL 1IL2A 2B63H 3ECIA 4DNIA 1EUJA 3CCQA 4HCNB 4OZBA 1WJ4A 5KHOA 2KHWB 3D6CA 3N52A 4I7AA 2HD3A 3W5OA 4JI5L 1HZCA 1X65A 1FXAA 5EPKA 4GGQA 1KM7A 3NE5B 1NENB 4QUCA 3AYHB 5IYBG 4X66L 3D32A 4KK7A 4UP9A 1YQBA 2V4LA 1LQBA 2WX0A 3HOUH 1KL9A 2NCNA 1IBKL 3PF4A 2K8BA 4FJYA 4ANVA 2AQ1B 1NJIC 1E22A 5G55A 3Q8FA 4HEA1 2B2YC 3H7SA 3B2FA 3HOYB 4E74A 3SFDB 1R4PB 5J3BA 3R66C 5EBDA 5L83A 1MVKA 2OF1A 1O7ZA 3S16H 3GTQB 3KF8B 1J5EL 2NVYB 1GUSA 1Q1BA 4NXNL 2ZPYA 5HURA 4X3KA 1D7QA 1V6EA 5AEKB 4C3IH 3M3YH 2BYEA 5JH5C 4G57A 4WORA 4LF5L 4ZHPA 3RNCC 3W5VB 1N8RC 1HFNA 2CQAA 1H9JA 1K0RA 5FO8B 3CPWA 4DV1L 3OW2A 2R7ZH 3RZOB 2DLBA 4QB4A 3I3CA 1XT9B 5E1FA 2KWUB 1MHXA 2NYZD 5DLQE 4NKLA 3MHBA 5M3FB 3DBHI 2WP8J 4R4TA 5M5YH 4WJOA 3VVWB 1JW9D 1TWGH 1Y1WH 2W9NA 3ZXRA 5NUCA 2V3PA 1GPXA 3BS1A 3R2TA 2JA8B 1U9RA 1IYVA 2OWOA 2MWSB 4FXGC 4GN1A 3BK2A 5L37A 4S3SA 4LAAA 3TEHB 1C7YA 2BA1A 1LTTD 5E6JA 3GV3A 3NP8A 2E2HB 3NVVA 4LJOB 2B3AA 4MGYE 2O6VB 2DYMA 1ML0D 1QKZA 1VQ7A 1P16A 2KX3A 4KY6A 1EY8A 1ILPA 2M0AA 1YVCA 3P1HA 1X3EA 2CR5A 4IC7B 4BKSD 1S40A 4A3KB 3KF8A 2J0JA 2K1FA 2HE7A 2BWES 2HDEA 5G5GA 4DV3L 2NVXH 1PQSA 2FIFA 3HS0C 2M1MA 5C0XG 1YQ3B 3HOZB 2KACA 1IKLA 1EY5A 3H91A 2HCCA 3NVYA 5D2MB 4M8AA 4DV4Q 4DA2A 3H0GG 3PLUA 4V0BA 4AUQC 3AEBB 4XQNA 4DPGA 1II3A 2CH4W 1QOFA 1QOGA 3CU7A 2L3ZA 1CSQA 3GTOB 1EF5A 2IO3B 1U0LA 2JA9A 3Q8EA 5C3JB 2RCFA 2SEBD 3NQIA 3P2BA 2LASA 5DEHA 4MGKE 4YSZB 3SR1A 3UGBB 1J6QA 3GTJH 3W1BA 2LI5A 2NZ1D 2BPSA 3ONSA 4BKTA 4K8IA 4BS9A 2N78A 2F4VL 1JWSD 4X6AH 1HXYD 2MHVA 1EWIA 2UUAL 4IUMB 5CTRC 2EYHA 4ME3A 1PUTA 1SEBD 2XIWA 1XMOL 2KJXA 1BVSA 1I50B 3MWYW 2KVRA 1STNA 2O6VA 2QSDA 2R6GA 2E2JH 4ZKBB 2JA5G 4EUTA 3M4OB 1E7ZA 2MP1A 1L1OB 3TRZA 3NZUA 4JPSA 4LFBL 3AFPA 2MUYA 4JI8L 5CYUA 2F0NA 3V3XA 1ENFA 3PRMB 5EKKA 2I1JA 4I6NB 3FKIG 1XTDA 5IO9A 2LRWA 1SXTA 3PTFC 1ET6A 2E3TA 4HDOA 1YJJA 2K03A 2L00B 1I4PA 5BMIA 2L83A 4JX1C 2L32A 2SNSA 5DM63 5LHY1 1YZ6A 2QCZA 3S17B 2XK5A 2A5UA 1E10A 4PZ8A 1KH0A 1IKMA 4PS3A 2F03A 5EAYA 2D3GA 3AEVA 2MX2A 1FYCA 4KIKA 2PW5A 4W9FA 4RG1A 2B2VC 4PZ7A 2CU1A 2UWQA 4X64Q 4KV2A 3DWMA 2EKIA 2PW7A 4DAPA 4ZRJA 2C9OA 5JJKA 4H0LC 4RKBA 1JWAD 1ASYA 1NDDA 1J19A 2WYQA 1PLFA 5FKAC 3DCGA 4JVZA 4NJ6A 4JI6L 1KHIA 3D8GA 1E2ZA 2EYJA 4PMBA 1B7YB 3VAWA 3T9LA 1LACA 3RMHA 1BCPC 2Q2IA 3OHXC 4I6LB 1B50A 4NMZA 2JA7G 1K3RA 3OG5A 3A8IE 5LMNW 3VUXA 4K1RB 4JBWA 3MTNB 2NTSA 4WWMA 1WJJA 2F3VA 1ACCA 3VR9B 3RFZB 5C4HA 5EE3A 1SNPA 2QA4A 3RR5A 3LWEA 1V9PA 2KLGA 4QUFA 4KI0A 5CHVC 1VS0A 4L5SA 4HCSA 3K9PB 3U4EG 1HZAA 2C7HA 2FUHB 3PO3G 4EKUA 4IFDG 2NBVB 4JE3B 2E74C 2LJ5A 2KN4A 5ELDA 2ZM6Q 2KQ4X 1V1QA 3T53B 4EE2A 2MBOA 1SJHD 1YEZA 1HCZA 4B3ML 2WXNA 4KZ0A 2VQFQ 3S1NH 1E9MA 3N32A 5E3FA 3Q8DA 4NB3A 1WWTA 1NMFA 1Z7TA 2Z4IA 1H9SA 2ZJPA 2A8VA 1UEBA 2KJ6A 2WXPA 1ZOYB 3P7JA 4MN3A 3VYTA 3J7ZC 1XNQQ 1RAXA 2REXA 1X6OA 1SYFA 1GKHA 5DNFA 1V43A 3DLLA 3RN5A 3NWTA 2I5HA 1XX8A 3Q0AA 1CSPA 2AWTA 5DAUA 2QCPX 4ZUJA 3J81L 3HRDD 1A3VA 2ONQA 2EVBA 3NHHA 1U4RA 2YEPB 2MQHA 2E5LQ 5JVG3 4IURA 4A3IG 3MVVA 4OZCA 1ZKOA 1IBKQ 2KJRA 2PPHA 4NJCA 1CTMA 3OPOA 2H89B 1D5ZC 1LM0A 3D4RA 1JB7A 3Q6SA 2DAJA 3I5JC 4XT1B
chains in the Genus database with same CATH topology
5EE1A 4DN4M 3P4SB 2LUMA 2F1MA 3VRBB 2A73B 5HHDG 1ESFA 1TS4A 2WXLA 3VR2A 2EY6A 1N61A 4ULLA 1HZ6A 3ND9A 2N0SB 2K9XA 2JX5A 4CQNA 2K33A 1SIJA 2DY7A 2PMZB 1K8MA 3TDQA 4N59A 1GUOA 2ICEC 3J81E 3NWSA 1CI3M 5F2DA 3TEZA 2WDRB 3KBXA 4N58A 3H0GB 1ENCA 1B1ZA 1DOKA 1F77A 5FR3A 1YMHE 4IUNA 3VRAB 2BTEA 4HROA 2EY1A 1IYUA 3Q24A 2PPBC 1PTOD 2PIAA 5ELFA 2RDGA 3MHZA 3URYA 1B53A 2O5JC 3DMUA 4RHSA 1KABA 3I4LA 5E4WC 2JA5B 4RFBA 2O4XA 3FMCA 5C4XB 3B2GA 1ONLA 3FAHA 3D4DA 5C5LA 1JICA 3FILA 1A15A 3C1EA 3JAML 4EVOA 2RDFA 1LT5D 2CVRA 2A5HA 3FKIB 2WS3B 5ELEA 3TSSA 2ZXRA 4EQOA 1SE4A 4XDXA 1BCPD 1D5MC 3NTHA 1BUIC 2BDOA 3PUWA 1R4QB 3BZDB 4A9AA 3D31A 1SYEA 2OXPA 2QEJC 4RAUC 1EYAA 1CFMA 4A8XC 4WIPA 1IGDA 4M0WA 5EE9A 3V05A 5J22A 1Z6HA 2JA7B 4FXCA 1GHJA 1FO4A 2B8GA 2Q8TA 1EIHA 3FC4A 1DM0B 4F88A 2BOSA 3P75A 5IOCA 3CWIA 4ZLTF 1MSHA 3S1RB 4K14A 1CQVA 3DXJC 3M85A 3PO3B 1O7YA 5CV4A 3SXHA 2EYOA 2JZPA 1ESRA 2B2UC 1SF0A 3HEJA 4CHTB 3S2DB 5H92C 1PYWD 3K59A 1DYQA 2J4XA 3OWEB 1AYFA 4TMAB 5BYQA 2G9HD 4IUTA 2GI9A 2A69C 1B4OA 4A3IB 2A6HC 3K5OA 3AEEB 3UI2A 1WSPA 3KWVA 2NMQA 4RGTA 2FJ2A 2F3WA 2K3UA 2M2LA 1HUNA 4C3IG 1NSNS 3K6OA 2QILA 4KKUA 1RFKA 2HDMA 2R92B 2WXQA 4RF1A 3IFTA 1FXIA 3AE9B 2DBYA 2BW2A 1D2BA 2J7ZA 1CQFA 1K83B 3BG3A 1F0ZA 2IGDA 2B2TA 2A74C 5EBCA 2BS3B 3I73A 4DFAA 2F0GA 1LT6D 4QF4A 3D3RA 4YTPB 3R93A 2F0UA 3NBHA 4ILWA 3Q69A 3C1FA 2WDQB 3BDLA 4IFDI 3FRPB 1PZID 4FF4A 1STAA 2KMMA 1LABA 1J9OA 2VUMB 5HG2A 2Q5WD 1S5DD 2RBMA 3O13A 4YXDB 2LMCB 5D7GA 2CHBD 4N9TA 2WIIB 5D3DA 1J8IA 2W55A 2VZKB 1VZ7A 2L11A 1LO5D 4ZRPA 1UNSA 1AW7A 2W54A 1B3AA 3RUZA 3V96A 1TVXA 4XYQA 1P7FA 3A7LA 3T16A 2FBWB 3RZDB 4H7BA 1EWHA 1K51A 5K36H 3W3AA 1C48A 2B2YA 1F2MA 5JPNC 2ZXOA 3HP3A 3SR6A 4ZHOA 3AU7A 2QMTA 3NUCA 1H9RA 3E56A 1SJED 1TWFB 1T5XD 4BWGB 1RODA 1ZXIA 3L9AX 1ZEQX 1L4ZB 3DHQA 4L2YA 2I46A 4MT5A 5CORA 5FLXL 3U7ZA 2JA6B 2E2IB 2RSNA 5LL6S 2QIEB 3FEWX 1TY0A 3FVQA 4KHVA 4I7ZC 5CBEE 1I6HB 1ZPSA 1ZDXA 2RKSA 2BE5D 3D4WA 3GQBA 1G91A 3A8JE 2M56B 1PDQA 3QIAA 2Y0SB 4NAWB 2IGGA 1BR9A 4PMCA 4RCNA 3VR5A 4CJ0B 1MD2D 4A3GB 4XE0A 5BMGA 1XLOA 4G7ZC 1F2RI 4G7HC 2KOLA 1G8ZD 3TBIB 2B63B 1PTOF 2A69D 2V4IB 1B9NA 2A6HD 2GA4B 1C79A 2WNMA 1KLUD 1YN3A 4Z9CB 1FR3A 2JE6I 2L1AA 5K5PA 5CV5A 4K6DA 2A6EC 4RNAA 3VA5A 3GTLB 3HOUB 4J1MA 4DAYA 1KAAA 2FMCA 3AE8B 5CBAE 5HI1A 1PDXA 1DCZA 3A7AB 1Y69U 2PW9A 3S16B 2AUJD 3ETRA 3H3VC 1YJIA 3NXWA 4C3IB 1E2VA 3M3YB 1KLGD 3DWQA 5ISRA 1BCPB 1JC7A 1JQYD 2PCFB 5M5YB 1I4QA 1TWGB 3BIID 1Y1WB 4B0MA 1SNOA 1RD9D 2LGIA 3GS2A 2ICIA 2FMMA 3J7AV 2BT6A 3J7YW 3EJIA 4FXKC 3GTPB 1FGBD 2BB5A 1F9SA 3NQTA 2I2YA 5JEAH 2SAKA 2B2VA 3AECB 3EROA 3PUVA 4OW0A 3NRZA 2VXWA 3SK6A 2BBCA 3E6ZX 2NVXB 3AB5A 1FMAD 5I6YA 1OXUA 2N88A 2CJOA 2DN8A 1EY6A 4RH6A 3TP8A 4HMJA 5C4JB 3VR4A 4C7ZA 4XWTA 3AE6B 3DWAA 2XNAC 1NVID 3GTJB 4C3JG 2KAJA 4U673 3VA7A 4NP5A 1A2TA 2RQXA 3VR8B 5GXGB 2K7VA 2AWNA 1HZ5A 1SAPA 4A55A 2J0TD 4OL7A 4FF1A 5LL6X 3ABVB 2LEKA 1F2RC 1YQ4B 2XRQD 3SVMA 2JWUA 5CGKA 3CKIB 1TQOA 1F2LA 1A3TA 1X3QA 1K8OA 2KCCA 1QOAA 1S5ED 1CZPA 1QWYA 1BUVT 2IX3A 1I4XA 1SYCA 2K5DA 5ELCA 3OWFA 4HRSA 3CRLC 2INNE 3PIP3 4WURA 4REZA 2VB2X 4H44C 1PXUA 4LK0M 1Q10A 3QO2A 5H8YE 2A68C 4FP5D 4K2LA 1GJXA 2HQEA 3LB8C 4K6LA 4XXEA 3TN2A 3UI3A 3NTIA 2FFKB 3U52E 1D5XC 1DD2A 1VDZA 2A6ED 3KLSX 4TKOB 2Y5PA 3FPUB 2WXIA 5EJWA 5AFWA 3ZJVA 1TR5A 4XQJA 2KVMA 1Y8OB 2NB0A 1WD0A 4L6TB 1TT2A 3SDZA 2K05A 3ND8A 2AUKA 5I9PA 2IGHA 1F9PA 3OSOA 3BYYB 4WJWA 3ZGZA 3OOCA 4GZYC 1C77A 3AE4B 4ZQ3A 1HA6A 3E9SA 4IKGA 2F0EA 3J80L 1JWBD 2XSCA 2E2DC 2F0HA 1OXTA 3S1NB 1EZ8A 1EFID 4OZAA 3U2SC 3PUZA 4C80A 2MEKA 1IW7C 3NPPA 4EQPA 1OO9B 4JWUC 1B2TA 4DXGA 4UAIA 3TP7A 1SNDA 2BS2B 1LLRD 2VNUD 1QILA 5KIXA 3GTKB 1QT9A 1JOOA 3VR6A 1VF5C 5C3XA 3J80E 4PV1C 3K5NA 2E75C 3AE7B 3L3OC 1ZYRC 2L4NA 2F0QA 1XCTL 2FE8A 1OQQA 2CU3A 3PO0A 4G7OC 3FDTA 2DYOA 2JSVX 3IAS1 3HOXB 5EKIA 1BXTA 1PRTB 1JRPA 1TYGB 2LY7A 2C5CA 3DEPA 1BDOA 4KTAA 5C4ZA 2PVOD 4QCLA 3PZ7A 3HGBA 1V8CA 4DF7A 1L0VB 1TWCB 4KKTA 3MC0B 3AMZA 4DU9A 4IUUA 2XWJB 1SMYC 1S5CD 3E0JA 3T13A 2VZKD 4C3JB 3P4PB 1BF4A 4FO2A 1TIID 1J7AA 1UWXA 3BYTB 1GB1A 1VZ6A 4IUPA 4K2KA 1ZUD2 3H8HA 3L4PA 2YEPF 2B2UA 2HUGA 2F0VA 2A68D 1VRAB 3E5SA 2KHSA 1M8AA 3AEFB 3NK9A 4YSXB 3IL8A 4JWSC 1TKWB 1F9QA 2D9UA 3A54A 2K6AA 5K36G 1XTCD 1Y56A 3IFDA 2KA7A 2IWHA 1LT3D 3BDOA 1FM0D 5FO7B 1WVLA 3SHLA 1DOIA 4LLGM 3I8ZA 5MPOA 1QNKA 3DEOA 2G1EA 1STGA 4EQNA 4FF2A 2QKIC 1L5PA 2WB1B 2WU5B 2QJLA 1FNVA 2IT1A 3DUZA 4O1NA 3BWUD 1VF7A 4MACA 1PGBA 1I4RA 1PMRA 1S5BD 2WP9B 4Q5VA 1NR2A 1DOYA 3C46A 1STYA 3AEGB 4AYBB 3A56A 5C0XJ 4HMIA 1I4HA 1KTKA 3MXGA 1IL8A 3ZYYX 1WRIA 2ZW1A 3MXUA 1QB5D 1IW7D 3N6RA 5IODA 1XEEA 1X3PA 4HKZE 4BA1I 4P6VF 3H09A 3AN1A 5C6AA 1SYBA 1PFDA 4V190 5HFYA 1DXMA 3EGRA 3K5MA 1BOSA 1WGKA 3K7AB 2R3ZA 3TZUA 3P63A 4GDKB 3SK5A 5JOBA 3S1QB 1JWUD 1OQRA 5TSSA 1QCBD 1ZYRD 2K32A 2ENBA 1SYGA 4TQUS 4DQOC 2HTME 1RYJA 1YNTE 2SDFA 1YNNC 1HRJA 2ZW0A 4AQ7A 1LTRD 1CHPD 5CV9A 1D4BA 3GTMB 4NW2A 5KNDA 3OW7A 4KY5A 4YTMB 3I4NB 3PO2B 4DNTB 3I4MB 3TZDA 4RKLA 2PZTA 1UAPA 3JAME 1STEA 2AWOA 3MFGA 4WAFA 4HCEA 1SMYD 4X3UA 1DGJA 2Y3AA 1MBYA 2JYOA 3HOWB 4KN4C 1I6VC 4OHJA 4PQXA 3AV8A 3S2HB 2IX0A 3LX0A 3U9SA 1S5FD 2DWQA 4KKIA 2PNRC 5JEAG 1G6ZA 4F87A 4H13C 2WV6D 2F0MA 5KNBA 4WH4A 1GUTA 1JORA 1KDCA 2F0LA 2MJ3A 5KEEA 5A35A 1BNZA 2N7JA 1QNUA 5T1IA 3QWNA 1WTOA 2K01A 4IFDJ 1PRTC 4RCOA 2AQ2B 3F2UA 3P42A 2F0JA 3IT4B 5CR3A 5M9OA 1V1OA 5KRUA 2PKOA 2WXRA 3BVZA 1SDFA 1XF5L 2MGSA 4Y7NB 2WKCA 3GD7A 1O80A 2K5QA 3AE3B 4B08A 4HKQA 2HDLA 1BMLC 1QLBB 3TEWA 1KNEA 2BYTA 2XN9C 1STBA 1ZXTA 5C44B 2KEDA 1ET9A 2EZVA 2WXOA 2EYLA 4A3DB 4KGRA 4PT5A 1DZ1A 4ODGA 2RA4A 1OXVA 1HPCA 1HFGA 4US8A 1IBXB 2XWBB 1GB4A 3KLSA 3Q8BA 1QE6A 2JP1A 3Q23A 2B8FA 4WFN3 1KDBA 4C56C 3HZXA 1YN4A 1XXGA 1I7HA 4C2MB 3R8BA 5IGBA 3AMUA 3RPFC 4GDLB 1TWHB 2L0CA 1FRDA 1WXQA 4J3OD 2V3NA 1X32A 2BS4B 1DOXA 1TKGA 1JCKB 5CV6A 3MTSA 3SK4A 4HAEA 3NVWA 1V1PB 2WXGA 2MJ8A 4IALA 3I9V1 1ENAA 1YNND 1C9FA 3T51B 3AE1B 2I38A 1HQMC 2NVQB 5FK9C 2N9KA 3HG9A 2D62A 5CC4A 1IBXA 1T6BX 2JEAI 4F7XA 3L7ZC 3C2PA 1EY0A 4TQ0A 1J7CA 1L4DB 1HTPA 2J52A 1J7BA 3PV0A 5IGFA 4KY7A 3MP9A 5EE0A 2EE1A 4B0EA 5C5MA 4ABNA 2LMCA 3NS1A 2EJFC 2M00A 1HA5A 2D2CC 1TS2A 1V1PA 1VZ8A 1TU2B 2O2LD 2K5PA 1NUCA 1DOLA 1TJEA 2PMVA 5EPJA 1LT4D 2B2WC 2CJNA 2W3RA 3AEDB 2PO4A 4LJZC 5I9OA 2L5TA 4R8NA 1N62A 1HTLD 3DM1A 1PRTD 3Q22A 2K1BA 1H9MA 1F2ZA 2NN6I 2NN6H 1F2YA 3P4QB 2BA0A 5FLXE 4OIKA 1ZDVA 4KMUC 1UEAB 3A55A 1JQ4A 2X38A 1C4QA 4YIJA 1SE3A 2JU6X 5E4XA 1K53A 1FFVA 4J6HA 1HUMA 4ZAIA 2DNEA 3N9YC 2WXMA 4HJGE 4HN7A 5C2TB 4MM3B 2DNCA 4XQQA 1TKYA 1T5EA 1AZPA 3GP7A 1Q3LA 4C3HG 4DAVA 1TKEA 3MJ5A 1WTVA 4KJNA 2K22A 2H88B 5M5XB 3CQZB 1S4ZA 3K58A 3T3OA 1VMCA 1SB3C 1MHHE 2LHEA 1B44D 1BCPF 2SOBA 3MFYA 2X69A 2R7ZB 2CW0C 3S9WA 1AP0A 4ZOHC 4OIJA 1L0YB 3OMGA 4AS1A 2D5GA 2FUG1 4KX6B 1EYDA 1C4AA 3J9CA 3I91A 1SNQA 4X3SA 4ARCA 2LFNA 1RJTA 1EU3A 1AEXA 3A8KE 1EQTA 1U4PA 3LXFA 3LWUA 4BY7B 3B9JA 1E6EB 4NDXA 5J1ZA 3K0YA 3RLFA 3MZ5A 5EPLA 1NEKB 1PFMA 4HTHA 4CKBA 1WTPA 1PZJD 1SNCA 1CT1D 4FNFA 3P4RB 4L1BA 4A3FB 3R3OA 4WQMA 2DY8A 1GUGA 1V97A 4PNYA 2OT2A 4CJ1B 2IW3A 3HRZC 1UUPA 3KK7A 1TZOA 3QG1A 4ID6A 1WTWA 4Q0FA 1IGCA 5CV7A 1VJKA 1XLNA 2MH7A 4USAA 4CJ2C 2MJEA 2VB3X 5BYRA 1D1IA 2IDYA 3T56B 3VYUA 5FOBB 3WOFA 1KF6B 1PTOH 3H94A 1CZGA 4IUQA 1RM6C 1MGSA 1DONA 5JVH3 1OXSC 2MJDA 3ERQA 3VYSA 3SEBA 2E2JB 2INPE 1WTQA 1CK1A 4Q2JA 2PTLA 2RSOA 1B9MA 1E7PB 2AQ3B 4KJOA 1E0ZA 5M5WB 5T8IA 2K04A 1ROEA 4R3DA 3AE2B 1VR9A 2IL8A 3P1MA 1EEFD 3PZ8A 4YSYB 3VR3A 4L23A 5AUKA 1F9RA 1H9KA 3H6MA 4HSPA 4MH8A 1EOTA 4KKSA 1EYCA 3HVZA 1NAPA 4C1NI 1Y8PB 4CGYB 3QOJA 1QJOA 5M3MB 1NCVA 3K57A 2PYKA 1GAQB 2ZT9C 3R2IA 3IKJA 2BB6A 4DK0A 2F0TA 4CKEA 5IGEA 1WTXA 1W6KA 4KGSA 2M9VA 4PMWA 3OMCA 1QOHA 3IXSA 1GOZA 1LTAD 1CHQD 1JOKA 4ZYSA 2WLBA 1K50A 1BQQT 1MPEA 2OEDA 1XYIA 2L55A 1I4GA 1NYQA 2IPKD 1DJRD 1A70A 5I4DA 3HVDA 4O42A 2CW0D 4C3HB 1JE4A 1U4LA 3EA6A 1XWEA 5JPMC 3AE5B 3HKZB 1EIGA 1AZQA 1L0XB 3T4AC 1L6UA 1QQRA 2EJMA 5BN3A 5ELBA 3CRKC 1GUWA 1B9RA 5KYLA 1JALA 2F0IA 2H4OA 4HSVA 3TMEA 4A3EB 2RDHA 2E6XA 4RGNA 2IX1A 1Y8NB 1OXXK 3CHBD 2LS01 1LTBD 1Q1EA 1PTOC 2K28A 5G3LD 2I07B 4C1NK 3M7GA 3AEAB 3MXPA 3KBGA 1RF2D 5A2QL 4KV6A 4DNRB 4K8JA 3NBIA 4FXDA 4GLSC 4YTNB 2NBFA 3C3LA 1SSNA 4IDIA 4OGQC 1XLQA 1I3QB 3CIRB 1D6EC 5D65A 3RD4A 4CKCA 3NZ3A 3ITPA 1PRTF 1P7EA 5JAVA 1RTOA 1H9SB 4ZK9B 2WDVB 3X3MA 2B76B 3ZJUA 4TQ1A 4KGTA 4K5XA 3IAYA 4C7YA 2MPMA 3MXNA 2Z1CA 1G2TA 1KRHA 5A2QE 2K5WA 3VQIA 1Q8IA 2L1BA 3OIQA 2WACA 2YYZA 5LNK1 1R9TB 1LTSD 1WYGA 5I2XA 3P20A 2OHFA 1EU4A 5IGDA 4H2AA 1SE2A 2ZXPA 2EELA 4MHEA 2WXHA 3I72A 1BBXC 2SNMA 1D1KA 4P2CB 1E0BA 2D5DA 1FEHA 3TUOA 2F0SA 1HHVA 1A2UA 2WAQB 5IIFA 1IUEA 1N5XA 2EY2A 1Q12A 4P16A 3GV6A 2Z4HA 1W6JA 3EVQA 2XVSA 1IHZA 3EQLC 1M4VA 4XWWA 2F0KA 1NI3A 2EYPA 3DWGC 3GB1A 2M19A 4OO1I 2RMMA 1N60A 4OO1H 5FO9B 1UWMA 3IAM1 3NUHB 3TEYA 3HUIA 1GHKA 5C3EB 2EDGA 1RKNA 3VYRA 5COYA 1EWCA 2ID0A 4L8JA 4IQZA 1A3UA 3FILB 3G7LA 4XIGS 3WOEA 2NN6G 1A6XA 4XYOA 1ICWA 2TSSA 2Z8LA 3FPPA 4LTUA 4ZKCB 2WXFA 1XO3A 2X6GA 4N6EB 1JWMD 2EY5A 1EZ6A 5KGUA 1FCCC 1MSGA 3T3NA 2YU9B 4KHZA 3WCQA 1DOMA 2XRSD 5BN5A 4XDDA 4QMGA 2Y5CA 1CJEA 4A3MB 2WXJA 2EYMA 3HOVB 2R93B 3I90A 3SFEB 1JR0D 5I6WA 1YNJC 4ZUIA 3OIPA 4JK1C 4RGMA 4RA8A 1YN5A 3SE0A 4A3BB 3BDCA 5BN4A 1O7LA 1PGXA 4E6IA 4FVMA 4LK1C 4XDCA 2KECA 1CA6A 1LTID 5C0XI 1FFUA 5BYSA 5C0XH 1FNUA 1ZP0B 3GO5A 4BY1B 1FIQA 4K5VA 4IN3A 4RGOS 2B2WA 3BVMA 2GB1A 2G9DA 4RF0A 3EFXD 4ZRZA 2WXKA 1EWYC 1RHPA 4KKJA 3M7NA 2KEEA 1E2WA 1SBBB 2L9HA 5EGTA 2O5IC 4IUVA 2LJIA 1CA5A 4IZ8A 1MI0A 3MA2B 4YWGG 1EY9A 4OVZA 1R7SA 1TS3A 3J7AF 2F0PA 1EY7A 2JXMB 2JQRB 1N63A 4R8IA 3NSWA 2JXTA 2RPVA 2BE5C 3KLRA 3W5UB 4EGVA 1AFPA 3IT6B 3Q8CA 2OEOA 2JSOA 4N9PA 1EEID 5CMDA 2QF7A 2NUCA 3Q8AA 2WU2B 1Z47A 1C76A 3G6JB 2NTTA 4BBRB 5AUIA 3PUXA 3M4YA 4ITKA 4TSSA 2F0OA 4ME5A 1G291 1TWAB 3KQ4A 2EJGC 2FHTA 5G3LF 5G5HA 1RDPD 5CV8A 5IT9L 4HEDA 1KFYB 4B9XA 3QOLA 4BBSB 1CZWA 1JMLA 3S14B 1KNAA 2W3SA 1FD7D 4U68A 3BK1A 2EYFA 3TP5A 2JYTA 5C3WA 1BO0A 4IOIE 2L12A 4K5WA 4YT0B 4CBVA 2LKVA 3QB3A 1VCIA 4LMQD 2W82A 1GXDC 3D6WA 1SNMA 2KQ3A 4WRDA 4I65A 1RWSA 1XCQL 1KDAA 4FF3A 1G2SA 4M1UB 1GUNA 1OFFA 3WDNA 3PIO3 2KWDA 1UGJA 2L52A 2PVGC 1T3QA 2KUMA 1WD1A 4A3JB 5IT9E 2LFIA 3AB9A 4IFDH 3TEXA 3ZQ4A 1EM7A 2N55A 5KNCA 5I2YA 4R9WA 5T1GA 3V2TA 5IGGA 1RCVD 2TMPA 2F0FA 4RHRA 1JROA 1K52A 1ILQA 2PZWA 4ARIA 1YNJD 1Q90A 1PZKD 4ZRQA 1VDVA 2X6LA 2ON8A 2H1EA 1C78A 1EQVA 1N5WA 1SSOA 1C4PA 2NVTB 4F8MA 3QJYA 5KYIA 2WKDA 1QF6A 5HGTA 3LNNA 3PUYA 2EPBA 2LHDA 3AH7A 1LTGD 2BCOA 1PFBA 2QDBA 1V8QA 2IJ0A 2V4DA 5JJZA 1SYDA 3BVGA 4KN7C 3W1SA 1NYRA 3C8YA 1TY2A 3W2DA 1NR4A 3NVZA 1FD6A 4DGZA 1PFNA 2EOTA 1HEZE 3K5LA 5IGCA 4KD4A 4UDUC 2WQYB 1LV9A 4X3TA 4DK1A 1EL0A 4D2KA 3SK8A 2B39A 2F0WA 2F0DA 1SFOB 1ZE3D 3ZJTA 3S15B 4XTCS 1VMPA 4B9WA 5JXVA 4TRDA 1EY4A 3X3NA 2R61A 1O78A 1AN8A 4A90A 4A93B 5JEAJ 5DM73 2E76C 2GRIA 1WTRA 2N9LA 3PMFA 1L6VA 3W9CB 2F4IA 3U9OA 2FINB 2J42A 2AX5A 2PQEA 1PTOB 3LYYA 3KUPA 4RWSC 1VLBA 5J39A 4MIUA 3MEHA 3GTGB 1CM9A 2ACZB 3TP6A 3NTKA 1JOQA 4A6QA 2EXZA 1PGAA 4NZLB 1FNWA 2RVLA 1FCLA 2JEBI 3EUB2 2BDNA 2PZUA 3AM9A 1STHA 4NAMA 1JB3A 2HCIA 1XLPA 1HQRD 4XT3B 1C8CA 2Q8IB 1WCMB 4QIWB 3DWPA 1TS5A 4G4KA 2JYEA 2K0PA 2B2TC 2NWGA 5EKLA 1ZXHA 2KDMA 5D3IB 3I57A 1QG7A 3S1MB 3KWLA 2PLPA 2WINB 4L63B 3ONAB 1AWDA 1QOBA 1Y1VB 5EQ0A 3MAQA 2Q8RE 4KD3A 4FYDA 5D14A 1C4CA 1MI2A 4US9A 5BMHA 4OO1G 4BA2I 1FRRA 4DXFA 4J8QA 2KCNA 1RTNA 2J53A 1U4MA 4HR7B 2V0GA 3I70A 4OZBA 3D6CA 3N52A 1FXAA 5EPKA 3NE5B 1NENB 4QUCA 4KK7A 2AQ1B 3Q8FA 4HEA1 2B2YC 3B2FA 3HOYB 3SFDB 1R4PB 5EBDA 1MVKA 2OF1A 1O7ZA 3GTQB 2NVYB 1GUSA 1Q1BA 5HURA 4X3KA 4G57A 4WORA 4ZHPA 3W5VB 1HFNA 2CQAA 1H9JA 5FO8B 3RZOB 2DLBA 4QB4A 3I3CA 5E1FA 1MHXA 2NYZD 4NKLA 3MHBA 5M3FB 2WP8J 1JW9D 5NUCA 2V3PA 1GPXA 3BS1A 3R2TA 2JA8B 1U9RA 1IYVA 4FXGC 3BK2A 4S3SA 4LAAA 2BA1A 1LTTD 5E6JA 3GV3A 3NP8A 2E2HB 3NVVA 2DYMA 1ML0D 1QKZA 4KY6A 1EY8A 1ILPA 2M0AA 3P1HA 4A3KB 3KF8A 2HDEA 5G5GA 3HS0C 5C0XG 1YQ3B 3HOZB 2KACA 1IKLA 1EY5A 3H91A 2HCCA 3NVYA 4M8AA 4DA2A 4V0BA 3AEBB 4XQNA 1II3A 1QOFA 1QOGA 3CU7A 3GTOB 3Q8EA 5C3JB 2SEBD 3NQIA 5DEHA 4YSZB 3SR1A 2NZ1D 4K8IA 4BS9A 1JWSD 1HXYD 2MHVA 2EYHA 1PUTA 1SEBD 2XIWA 2KJXA 1I50B 3MWYW 1STNA 2QSDA 2R6GA 4ZKBB 3M4OB 2MP1A 4JPSA 2MUYA 5CYUA 2F0NA 3V3XA 1ENFA 5EKKA 1SXTA 1ET6A 2E3TA 1YJJA 2K03A 1I4PA 5BMIA 2L83A 4JX1C 2L32A 2SNSA 5DM63 5LHY1 3S17B 1E10A 1KH0A 1IKMA 2F03A 1FYCA 2PW5A 2B2VC 3DWMA 2EKIA 2PW7A 4DAPA 2C9OA 4H0LC 4RKBA 1JWAD 1PLFA 5FKAC 3D8GA 1E2ZA 2EYJA 4PMBA 1LACA 3RMHA 1BCPC 3OHXC 1B50A 4NMZA 3A8IE 4JBWA 4WWMA