3O13A

Crystal structure of a superantigen-like protein (sav0433) from staphylococcus aureus mu50 at 2.05 a resolution
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
194
structure length
187
Chain Sequence
EVRSQATQDLSEYYKGRGFELTNVTGYKYGNKVTFIDNSQQIDVTLTGNEKLTVKDDDEVSNVDVFVVREGSSAITTSIGGITKTNGTQHKDTVQNVNLSVSKSTSVTSEYYSIYKEEISLKELDFKLRKHLIDKHDLYKTEPKDSKIRITMKNGGYYTFELNKKLQPHRMGDTIDSRNIEKIEVNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a superantigen-like protein (SAV0433) from Staphylococcus aureus MU50 at 2.05 A resolution
rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Toxin
molecule keywords Superantigen-like protein
total genus 55
structure length 187
sequence length 194
ec nomenclature
pdb deposition date 2010-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3o13A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3o13A01
2R61A 3DWAA 5ELCA 1PZID 1D5ZC 4RCOA 1S5FD 1SE3A 1BCPF 1KLUD 4C56C 1UNSA 1PTOB 1EU3A 1LTBD 2Z8LA 2NTSA 1KTKA 4RHSA 1LO5D 1S5DD 1TS2A 1FNVA 1SE4A 5FK9C 3BVZA 3BVGA 1CQVA 5D3IB 1ET9A 4L6TB 1PRTF 1RD9D 1L0XB 1JCKB 3SEBA 1SXTA 4DXFA 1EFID 1DYQA 1S5CD 1HXYD 1PYWD 4RHRA 1T5XD 3MC0B 1CHQD 1F77A 5TSSA 2G9HD 2XRSD 3URYA 1BXTA 3W2DA 4L63B 1TY0A 3DWPA 4UDUC 3R2IA 1I4XA 1MD2D 2XRQD 1I4QA 1LT3D 1D5XC 1UUPA 1SE2A 2SEBD 3OWEB 1JWSD 1EEID 1I4HA 1LTRD 1JR0D 4NZLB 1JWUD 1PZKD 1LT5D 1B44D 1BCPC 1RCVD 4BWGB 5ELEA 1SJED 1XXGA 2CHBD 3GP7A 1I4GA 1RDPD 4K6LA 1V1PA 2ICIA 1LLRD 1AN8A 3MFGA 1TS3A 1YN3A 5ELDA 5I4DA 1CT1D 2RDHA 1LT6D 4RGMA 1STEA 3R8BA 1LTAD 1BCPB 2RDGA 1RF2D 3TSSA 5FKAC 1S5BD 4OHJA 1BCPD 1SEBD 4Z9CB 2O2LD 2AQ3B 1I4RA 3EA6A 3BZDB 3V05A 1FNUA 2NTTA 3BYTB 1CHPD 2XN9C 1PTOF 1LTTD 1GOZA 1D5MC 4O1NA 2WV6D 2TSSA 5D3DA 4DXGA 1LTGD 1JWMD 1PRTD 1HQRD 1LT4D 4RGTA 1FD7D 1YN4A 1HA5A 3BYYB 1ET6A 1FGBD 2XNAC 3BVMA 3O13A 5ELFA 1EEFD 1V1OA 1TS4A 4RH6A 1PRTB 2IJ0A 3DWQA 4RFBA 2AQ2B 1PTOH 1SBBB 2QEJC 1CK1A 1QILA 3KLSX 1SJHD 2QILA 1V1PB 1LTID 1YN5A 4ZYSA 1AW7A 1TS5A 1S5ED 1EWCA 1L0YB 1D6EC 1PRTC 4RGNA 1ENFA 3CHBD 1I4PA 1FNWA 1ESFA 1G8ZD 4TSSA 4RGOS 2J4XA 1PZJD 1KLGD 1M4VA 1PTOC 2AQ1B 2IPKD 5ELBA 1B1ZA 1PTOD 1LTSD 1HTLD 1DJRD 1JQYD 1TY2A 1XTCD 3EFXD 3R2TA 1EU4A
chains in the Genus database with same CATH superfamily
2SDFA 4AH6A 2IDYA 4MGZE 2FINB 4WH4A 4JK1C 3PF4A 1I6HB 3DMUA 4KMUC 1U0LA 3F2DA 2JE6I 4ZDVA 2W3RA 3OOCA 2FUHB 2CKHB 1V49A 3QHTA 2ID0A 1W3SA 4DA2A 1YVCA 4IOCA 3RYTA 4WJWA 1B70B 2AHOB 3A8JE 1WTWA 1FFUA 1K8RB 1E8YA 2M8SA 3BVGA 1TWFH 3EN2A 3M7NA 1YZ6A 4YXDB 3V96A 1IKMA 3C1FA 2Q5WD 2B29A 3FMCA 3EHVA 2OOBB 3Q3JA 5EGTA 1SLJA 2MO0A 3S15H 1CKOA 2KTFA 4AOFA 1T0SC 1EO6A 1FO4A 1TWFB 2XTIA 1SN8A 2IX0A 4HJ8A 5M3FB 2GBKA 2N1VA 1CHQD 1F77A 1C4QA 4HSPA 1PA6A 2J52A 1MI2A 4ZK9B 4EKUA 4K2KA 2K0PA 4CGYB 2KC2A 2HTME 2WXNA 4YCUA 5C5LA 2EZVA 1ZP0B 5FOBB 5HG2A 1MD2D 1I4QA 3S14B 4DAMA 4IOAA 5G2NA 1SE2A 3I4NB 3RNFC 3ZO5B 4I6NB 3PUZA 2G4SA 2V4DA 2ZTDA 1V5OA 1UH6A 1V80A 5M5YH 1SFOH 1VQEA 3DUZA 3PO3H 4F87A 5IP4D 3K5LA 4B9WA 5L83A 5EPKA 4GN1A 4X3KA 3TIXA 3GTKH 1IPGA 3M63B 4HWIB 1OTRB 3SR1A 4EQPA 1LTAD 1EY4A 1JJGA 1I50H 3NXWA 1K73C 1AFPA 1S5BD 4MSMB 1JQ4A 2A69D 3QCAA 2C60A 4JI3L 3SE0A 1UWVA 1HEZE 3QIJA 3G7LA 4J8QA 4DWFA 1A5RA 4OL7A 4A3DH 3KUCB 4NJ7A 2N3SA 2EDGA 3H0GG 1LTTD 3HM6X 1MPEA 4K0KQ 3V6CB 2EPBA 2HQLA 4CYEA 2F0NA 3EVQA 3I4MB 2D3CA 4NXML 1G91A 1FD6A 3FAHA 1J5EQ 5C4JB 1HQRD 2WGSA 3ZUNA 4RGTA 3K8AA 3NUHB 1YN4A 2N55A 1YHBA 2EIFA 5EAYA 3HOWG 3NHHA 3AEVA 2K6QA 2LWPA 5CORA 3CCSA 4RM9A 5AJ3Q 3TEZA 3HRDD 4DV2L 2MNAA 1Q1OA 3VVWB 1MKHA 4LMQD 2EMTA 4K5XA 3KUZA 3L16A 2WFWA 2QMTA 4GGQA 3WDNA 3WAMA 4BKTA 1TS5A 5C0XI 3GTJH 3RN9C 1N33L 3VYTA 4XDCA 4DK1A 1PYBA 2PW7A 3IRBA 3RNEC 3S15B 3NUCA 4DNIA 3UGBB 4JBJA 1CFMA 1FNWA 1ZKOA 4R4TA 3MTNB 5G3LD 2ICEC 4YY3Q 4IUMB 3A7LA 3H6NA 4YTPB 4KJNA 1PTOC 4LFCQ 1EOTA 1U4PA 4PS7A 1EYCA 2RCFA 1QVFA 4PV1C 4C1NI 3GTJB 4A3BH 2WXRA 3A1QA 1F0ZA 1MSGA 2BH8A 2A68D 1IL8A 1LV9A 4BBRH 5A2QL 4LFBQ 3A9KB 3I57A 1M1KC 3NSWA 3DWAA 4G57A 3HOVH 1WFYA 1R4MB 3PIPA 1KLUD 3KJOA 4GSWA 3JYUA 1VCIA 1EQVA 4K0KL 1QZGA 1WGDA 3GTMB 5F2DA 3IHPC 4DDID 1K83H 4R3DA 4QF4A 1YNXA 4NXNQ 4BY7G 2OTLA 2K3UA 4JI2Q 2KJRA 1KRSA 4LF4L 4N6EB 1CTMA 4JV5L 3F2UA 4A3JB 4NW2A 1G6ZA 4IC7B 5IT9L 2MX2A 1EFID 4X65L 2KT7A 2MP2B 3MP9A 4YIJA 2BYEA 2AWTA 4QIWE 4JBWA 2DYBA 5E4XA 3ZXVA 2XRSD 4P16A 3VHTC 1X56A 1MJCA 4A3KB 4N9F4 3T51B 1WM2A 1A3TA 1HTPA 1YJIA 2WU2B 3F2CA 1Q12A 3ETRA 3FC4A 4KZCA 1WTHA 1XNQL 4CQNA 2FHTA 1XEEA 3VR6A 1PVOA 2KMCA 3VA7A 4YL8A 4YWLA 1TJEA 2KUMA 3VAWA 1K50A 2KFKB 1S3OA 2A8VA 4EUTA 3GTPB 4US9A 5FO9B 2N8NA 1XJVA 1WXMA 2ALYB 2Y3AA 4WQOB 4HLEA 2LHEA 4C2MB 2EYJA 1FYCA 2VL6A 2M56B 1F2RI 2AEHA 3IG3A 2EXDA 3E6ZX 2O2VA 2KFKA 1D4BA 1XMOL 2PZUA 1K8MA 4ZAIA 2A68C 4QQBX 1FFVA 4GDKA 5C3XA 2G45B 5CBEE 3QWZB 2Z6KA 4MM3A 4C2MH 2AWOA 1K8AC 5I2YA 2NZOA 3HOVB 1IBLQ 3RNCC 1IYJB 3RUZA 2Y5PA 1C77A 4NP5A 2F3WA 2NVUI 1V81A 2WXGA 5JEAJ 1H4RA 3NJTA 4A3GH 4FP5D 3EFUA 3S2DH 1NR4A 4R4IA 3PIOA 4G3XB 1WCMG 4FXKC 4O1NA 4OVVA 1F2ZA 5D3DA 1VQCA 3VH4B 1SFOB 2MO1A 4B3MQ 1T3QA 4ZRIA 5E4WC 2B2UA 1V2YA 2PW9A 3PZ7A 1RM6C 3FHWA 1OXXK 1CKNA 2CW0C 3OIQA 3U30A 1EEFD 4HRSA 3K5OA 4RH6A 4DK3C 4POFA 1O7ZA 4XYCA 2J0MA 1ILQA 3WAPA 2HD3A 5CBAE 5IP9H 2EYFA 3CC2A 1H9RA 4GKKQ 2R93H 4HIOA 2KTRA 3QK0A 4LFAQ 2I1JA 4HDOA 2JXTA 4IKGA 4BY1H 3KK7A 1NMGA 4DR4L 1O7LA 1NI2A 4HKZE 3ML9A 2NVYH 2NVTB 1UELA 2NBFA 1WM3A 4W9HA 4A90A 5JH5C 2F0TA 2K5VA 2KHJA 5G3LF 3TZUA 3AMUA 2JVCA 1R4PB 4HMJA 5C44H 1XMOQ 3NQIA 3AI5A 1ENAA 3U7DA 4BKGA 1TY2A 1Z7TA 4K5WA 3AEBB 4GDLA 5CHFA 1WXSA 5JHBA 2RHQB 2N7JA 3LB8C 3TQYA 5K5PA 1WJ6A 4BBNF 3HOUG 2LS01 2K4KA 2EOTA 2G9DA 4G4KA 3B0AA 4F8MA 1UNSA 3A4SC 3S16H 3H09A 3PV0A 1ZPSA 2KN5A 1TWGB 4JYAL 2K6DB 4UP8A 2KBNA 2JSVX 1LACA 4OVZA 2I1KA 1Q1EA 4E71A 4ABNA 1WD0A 2KVZA 4S17A 1G51A 1Q86C 4DK0A 1IBLL 1PH7A 1JCKB 3V6EB 1VQ6A 2D9UA 1IBMQ 1PYWD 3PF5A 2XBBC 2WU5B 1T5XD 1B4OA 1XLQA 2IO2B 4FF2A 2LKVA 3U4VA 2D3BA 3H8HA 1JJ2A 1QOHA 4JI4Q 2B63H 3JAMi 3R66C 3RD2A 5DEHA 2LGYA 3H1UA 1XWEA 2GBRA 1I4XA 3K9PB 4HIMA 5M5YB 1A15A 2KHIA 1QVGA 3VRAB 5BN4A 5BYSA 2WXMA 1HZ9A 2SAKA 3DM1A 1WZ3A 2WWZA 1PH3A 1PYSB 4A3IB 3FPPA 5IE8A 1AP0A 1TT2A 1FM0D 3GQBA 1Q82C 2MJEA 1H9SA 1XCTL 1Y8PB 3EBEA 2D3GA 4DV3L 2DYOA 3H94A 3H7SA 4TUUA 2LRWA 2GA4B 4C1NK 1JB7A 3W3AA 3KW5B 5DAUA 4LF7L 3ZNGC 2UXBL 3CWIA 3U9SA 4BY7B 1YNJD 2RSNA 4DKAC 1XCQL 2F3VA 1SMXA 4PQXA 3GD7A 1ICFB 4QCLA 4CKEA 1QOGA 3V05A 2D3AA 3UE1A 1GHKA 4G7OC 5KHOA 2INDC 4II2B 2E6XA 4X64L 1YD8U 3PZDA 4BOSC 2H1EA 2RKSA 3B08A 3HOUB 1N34L 4N9TA 1SNOA 2WX0A 3N20C 2L15A 1F9PA 2QGQA 2LZ6A 3RPFC 4A3KG 2XSCA 3ERSX 1PRTD 3A55A 3RLOA 3VYSA 2VQFL 4A3BG 4M8NA 5C2TB 1ACCA 3BYYB 2JA7B 4LF6Q 3WWVA 5C23A 1STHA 4A3MB 4HXDA 3KQ4A 1MHHE 1DOYA 2F03A 2A5UA 2C5CA 2QDLA 3E56A 1C8CA 3P42A 4PZ6A 1PTOH 1SBBB 4CDDC 4BXXH 4X57B 3SU8X 5LXIB 4AQYQ 3G48A 3NY5A 1C9FA 2EJFC 2FXQA 3M4YA 2R7FA 1VQ7A 1YN5A 1GM5A 1C4AA 4K81A 1SNMA 1SAPA 1HZAA 4A93G 1ZUD2 2L52A 3Q8CA 4QY7A 3T4AC 2V0GA 1NSNS 2B8GA 3AE9B 2LD9A 3BZKA 1J7AA 4BBSH 2N4FA 4ZRQA 1SR3A 5IAAC 1KRHA 3AMZA 2H88B 1IHZA 3MC9A 3NZ3A 3TP6A 1VRAB 4JW0A 1AWDA 2XK5A 3CSTA 2CQOA 4V190 5LL6S 4RKBA 1B3AA 5J22A 3C2PA 3HKZG 2K14A 2IL8A 4X3TA 2R61A 1X32A 4G0NB 4GLSC 2D2QA 3M3YH 2R2QA 1PZID 3SD5A 4CDCC 1E7UA 4JE3B 1K52A 3S17B 3SDZA 3P2BA 3SFDB 4YSXB 1ILPA 1WMHB 4RHSA 1YX6B 1FNVA 1UE1A 4E6IA 2JY6A 1WYWB 4IM3A 4NKLA 3KWVA 4DV6L 3K59A 4TKNA 5EE1A 2NVYB 2VZKD 1DYQA 4TKOB 5LMNW 3LNNA 3ND9A 2C7NB 4BAXA 1RLFA 3DPDA 1Q81C 4B3RL 1PFDA 3CSFA 4G11A 3W2DA 3KF6B 3DLLA 1OGWA 1BR9A 3MC8A 4GB9A 1N32Q 2YV5A 4PK1A 5KGUA 4DR1Q 2ZXOA 1LTLA 2OQKA 2O6VA 1S72A 2IO0B 1I4HA 3UDIA 1Q10A 3UF8A 4G7ZC 4QGUA 3AEDB 3AE3B 2KC1A 3TP5A 2IGHA 5JJZA 1EYDA 3NWSA 3PCOB 1FR3A 1GUOA 1YMHE 4GLVB 4IUPA 3RLFA 2K6AA 5M5XH 1K0SA 1PGAA 3HK0A 4M00A 1HFGA 4L8JA 2ICIA 4WJNA 4FBJB 3TMPB 1STNA 3MEFA 1ZW7A 1WJ4A 1A8VA 1QWYA 4ULLA 4BS9A 3IAYA 1U5KA 1RF2D 1EOVA 3TSSA 4OX9Q 1YQ4B 2XWJB 2BB5A 1JWAD 5KRUA 4AYBB 4HJ7A 2R7ZG 2K1FA 4HKQA 1JRPA 1SGHA 3ZJVA 1DGSA 2A4ZA 2HDMA 2PLPA 1YNNC 4LF9L 4TRDA 1KFYB 4RF1A 4HIKA 4S3SA 5J1ZA 2Q2TA 3M4OB 3PO2H 2BS3B 3N52A 1GNUA 1P9DU 2RA4A 1LTGD 4TMAB 4L5SA 2K01A 2L0TA 4C3HB 1A70A 2WXPA 4A9AA 4FXDA 4AWJA 4WORA 3J81i 4KV6A 2MBQA 4AQ7A 1FGBD 4IN3A 5IYBG 3TBIB 3O65B 3PUYA 4HSVA 2PE9A 2IJ0A 5K36G 1SYCA 1QZHA 4YSYB 2AKWB 2TMPA 3Q6BA 4AQYL 3MHZA 3LDZE 4PT5A 3E3XA 1TTNA 4W9FA 1QILA 4X66L 4JGHB 2LSSA 2VW9A 3A33B 3A54A 3W5VB 2N0SB 3AM9A 2PYKA 2E2DC 3QX1A 2V1YA 2QIEB 4IJHA 1D8LA 2QDFA 2WXLA 4NJCA 1AYFA 4HTHA 1C48A 1WTXA 1AH9A 1QJOA 4BA1I 3QQ8B 2IPKD 5IIFA 3CPWA 2YEPB 3AE2B 3SR6A 3VDZA 2JA5H 3ZNHB 3ZVVA 2WDTB 3NVZA 1V9JA 4KV2A 1SYEA 3DVGY 1YBYA 1SYDA 2L7RA 3QOJA 4MH8A 4CHKA 5IGCA 3T1YL 5FJ8H 4YTNB 1D5ZC 1FJGL 4W9IA 3N1YC 5DPWA 3PSIA 2MQJA 4BBNC 3S2DB 1GB1A 3KWLA 4LK1C 2ONQA 1TKEA 4C3HG 2VRRB 4L23A 4A3BB 4DBGA 3J81c 1PH6A 1A3UA 1VDZA 3BS1A 4HJGE 5EKLA 3V2TA 4X6AH 2JXMB 3RN5A 1VQMA 1WOCA 3TEXA 2F0LA 1WFQA 3PUVA 1E1OA 3CP0A 3C19A 3SFEB 3SXHA 4CBVA 1XD3B 1VQ4A 4IUNA 3KYHC 5BR8Q 3D31A 1KAWA 3L2PA 5JXVA 1CKMA 4AJYB 1CSPA 4R4QA 5C0XJ 3KUPA 3RLNA 2OJWA 3DOWA 3DBRB 1K3RA 3UDFA 4PMCA 2I38A 4ZOHC 1OQQA 4NQLB 4GN4B 4A3OA 3OMGA 2PZWA 4GKJQ 2SEBD 1STBA 2PQAB 3DM3A 1UGJA 3QA8A 5HURA 1VQFA 3PGZA 1EWYC 2KOXA 3CCVA 1JOOA 4JI3Q 3V62A 3V3XA 1SJED 1XXGA 4WQMA 4JPBW 4WURA 1E7VA 1C9OA 1TWCB 1XO3A 1K28A 1JMCA 1WTPA 2EELA 1LM0A 5DM73 3IT6B 3JSVB 1I5FA 2IYDB 5T1GA 4K7SA 1ZYRD 2Z0SA 1BCPB 5HHDG 3VXWA 1ZYRC 2KLGA 3KOJA 4A3FB 2AUKA 4J1MA 3S1NB 2KWDA 2KQ3A 3J80i 4KKIA 2IT1A 2JSOA 2HDEA 1CUKA 1SNQA 2ZM6Q 2NWGA 4JPSA 3MXNB 2HUGA 2NN6I 4K2LA 5AZFA 1Y8OB 1RWSA 4J6HA 4KK7A 4EQOA 4FHKA 3HKZE 1SRUA 3CCJA 3AU4A 1Q3LA 2FMMA 2VZAA 3PT2B 5G5GA 2WV6D 3ZW3A 4YHHQ 1FRDA 3ZXRA 2MWSB 4BBSB 2MHJA 3TZDA 1V8CA 4TQ0A 1CQFA 2PMZE 3OSOA 2WDRB 1XNRL 4IM2A 3E9SA 4EQ5A 2FBWB 5JJLA 3TBLD 3PV1A 4C3JG 2F0OA 3KF8B 1BT0A 5E7NA 1J8CA 3L3OC 1LXDA 4HEA1 2NZHA 3U4ZA 1G2TA 3BIID 4DR3Q 1WE7A 1TYGB 3CMAA 2JA8G 2P5ZX 3ULJA 3PVLA 4JBMA 2RVLA 2CH4A 2QILA 3Q3FA 5AJ3L 1L4ZB 3RULA 3X23A 1IW7D 1UAPA 1LTID 1F2RC 2NPTA 1QG7A 3H3VI 2XEWA 2GN5A 2JX5A 5HY6A 4DV4L 1KAAA 3TCAA 1YEZA 2A6HC 1K0RA 3TP7A 4B08A 4EX5A 2B2YA 5T8IA 1M94A 4DN4M 4FULA 2WQYB 3NVYA 3IFDA 4DR3L 5ELBA 3Q8BA 3QJZA 4YTMB 1FCLA 5T1IA 5C0XG 4DR5Q 3EFXD 1X3GA 3R2TA 4RMFA 2Y0SG 4G7HC 3APCA 3DWMA 1A3VA 2FMCA 1IBXB 4NAWA 1FRRA 3W9CB 2BTEA 2V1CC 2K03A 5C44B 1YJNA 1S1QB 2K39A 3N1XC 1X65A 3CU7A 5L37A 2V3NA 4QUFA 1TZ1A 3DHIC 3B9JA 4Q2JA 2RR9A 2YYZA 1LO5D 5M3FH 1SE8A 2CKZB 4KD4A 4YWGG 5JZEB 1HA6A 2IZVB 2HJ8A 1KDBA 4HJ9A 1QOAA 3KYDD 3GTPH 2NR2A 3PSEB 4DXFA 3R3OA 1KDAA 2OT2A 1NUCA 3TS2A 3K6OA 4IUVA 2E5LQ 1T5EA 3PRPB 2K52A 2JA8B 3APFA 4B3SQ 3NRZA 4MACA 3X3NA 2EVBA 3UIOB 3VR9B 3URYA 3I4MG 1BXTA 4WJ4A 1NTGA 1O78A 2GVAA 1VQHA 2Z4IA 1PH8A 2K5PA 3L54A 2F0DA 4ANVA 1FCCC 3UDGA 1LT3D 3I55A 1N60A 3DBHB 1NENB 1JWSD 2KJHB 5EE3A 1GUSA 2R93G 4LNNA 3I56A 4WRDA 4A3GB 1K53A 3ALBA 5M5WB 3A9JA 4ARIA 2MLBA 3Q8FA 2G5DA 4NJ6A 1U4LA 2F4VL 2H5XA 2QDBA 4F7XA 1K9MC 1AARA 1YIWA 4R4CA 2A6EC 4C3IH 5M5WH 2JQRB 1EM7A 1P1AA 1NI3A 3G4SA 4WJOA 1H95A 2DNEA 4K3BA 5LLIA 4XT1B 4I6LB 3CW2C 2OWOA 3NOBA 2JT4B 4BVUC 1RFKA 1BCPD 1SE9A 5COYA 2DHZA 1PH5A 2WXQA 3CF6E 4A3EB 4HCEA 1JC7A 3NQTA 1KF6B 3CD6A 5BYRA 1HUNA 3C8YA 2R6GA 1NY4A 5IN7A 1A0IA 4IWOA 3TL5A 4IO9A 4URKA 2JYTA 3WANA 1MI0A 2O2VB 2ZCBA 5LHY1 3GTLH 1Y1VB 5C4XB 3PHWB 4W9CA 1BBWA 4XDDA 2JWZA 2ZW1A 4UP7A 1Y1WG 3NTKA 2XNAC 3BVMA 3PO2G 3AE7B 5JHAA 2JF5A 1X3EA 4IFDJ 1EY9A 4A3JG 3NZSA 1XNQQ 2CCZA 4GMVA 2DJGC 2LASA 4XYOA 1Y1VH 2Z6BA 2EY6A 3Q24A 4HPLB 3KLSX 3CMEA 3TREA 3KVFB 2RPVA 5D14A 2K75A 1X1MA 4ANXA 4ANWA 2GVBA 2RD0A 1FMAD 2M4NA 2Y0SE 1F2LA 2KDBA 2ZM6L 4IFDH 2J4XA 2C5LC 3WALA 5C4ZA 4NY0A 4XT3B 1M4VA 3OTOQ 1TXYA 4AIMA 1JOQA 3T9LA 3D3RA 3WAOA 2NCNA 1XTCD 1DJRD 2IGGA 1XX8A 2QEXA 4JI6Q 2K8CA 4C3HH 3HZXA 3J7YW 2WAQG 4JQWC 3GE8C 2L5TA 1YNTE 5IYDG 1XF5L 4LF5Q 1GG3A 3AU5A 5C0XH 3I9V1 1CJEA 4ZRKA 2MCNB 3I7FA 3K0XA 3M7GA 2K50A 3OAWA 1PFNA 1SE4A 1ZXTA 3P7JA 4OWXB 2N78A 2NVQB 2CHWA 4C3IB 5C4JH 1TWCH 4V0BA 3RUIB 2CWPA 3NWTA 3GV3A 1VQ5A 2WDQB 2DAJA 3I3CA 3JAMc 4LF9Q 2KDFB 1FIQA 3OMCA 2JQOA 3HOZG 1KJTA 4ZHOA 2PE6B 3ZJTA 1SB3C 3KYCD 3N3KB 4PZ8A 3G71A 4CHTB 3R2IA 1YI2A 2OXPA 4O2DA 4ICUA 1Y1WB 2IHFA 2E2JH 2KQ7A 2CW0D 2L05A 5IA7A 3EIVA 1A2UA 2F52A 3QB3A 4DV0Q 1TIFA 3AECB 1IP9A 3RMKC 1RYJA 3Q3MC 1LT5D 4JI5L 3HUIA 4A3CG 3D6CA 4BY1G 2HJ1A 2R2OA 1F2MA 4K7UA 2Y0SB 4LJZC 1P0RA 2LGSA 2K5HA 2Q2HA 5FLXc 5MPOA 1E10A 4J6IA 1AN8A 5EBCA 4HJKA 3V61A 4N8X1 4L5QA 2JA6B 4IFDG 2EMSA 5I4DA 4M0WA 1F9RA 2B2WC 2R7DA 1C4CA 3VUXA 4B3SL 4MTKA 4POGA 2RDGA 5E6OA 1KHIA 3R7QA 2L55A 3GTKB 2RDBC 2DUDA 2KCNA 5DNFA 5IKCM 3U7ZA 2D0OA 4BKSA 3I72A 2LVPA 1H9SB 1HNXL 2E8GA 2RSUA 1U4MA 1XPRA 1CHPD 1MFWA 5FO7B 1AZPA 3T3OA 1E24A 3TDQA 3ENEA 3VTVA 5C44G 3DHHC 2J53A 4ITKA 3Q3OC 3ABVB 1JWMD 2VS1A 2BGFA 4MDKE 2YTXA 2Q8IB 3O13A 5CV9A 1ZE3D 2FAZA 2KJXA 2JP1A 4GOPA 1TT5B 3AE1B 3GTGB 2A74C 3M62B 4DR6Q 2B2TA 1ASYA 3W1BA 1STAA 1K51A 2KCMA 4H13C 1E2VA 4EFOA 2WIIB 3AE8B 4RG1A 4UAIA 3ULLA 4XC2A 1Q0WB 1KL9A 1L0YB 1D6EC 2B2TC 5E1FA 1STGA 2YEPF 3VUWA 1ENFA 1WZ0A 4JI1Q 4JI0L 1STYA 2QCZA 3C0RB 1YNND 2MGSA 4TSSA 1TZOA 2JEAI 1RAXA 4LUZA 3TJPA 4N59A 4I6PA 1PH1A 1BF4A 4RA8A 2JRHA 4IM0A 3A8KE 2JA7H 3GTOH 4MH0E 1X3FA 1KNAA 1PXUA 4IURA 2DAFA 4MIUA 2LEKA 5JAVA 1TQOA 4GLAC 1KD1C 1H9MA 3APDA 4N58A 2DBYA 3I4NH 1A6XA 3GOEA 2J42A 2BKRB 4LF5L 4YHHL 1FL0A 4B0EA 1HPCA 2ZTEA 1HR0W 1XTDA 3QIAA 2JPHA 1EU3A 2JA9A 1UBIA 5CV5A 3FKYA 2PZTA 1QOBA 2MBEA 2QC8A 4US8A 2FFKB 3GTOB 1LQBA 2ZPNA 1S5DD 3QG1A 2PMVA 2F0PA 4DV4Q 4AUQC 4X3SA 2KDIA 3BZCA 1ET9A 2X6GA 2WP9B 3C46A 4OO1H 2IY1B 1PRTF 1RD9D 1C7YA 1LGRA 4KLKA 3CCLA 4WJ3M 2ZJQA 4M8AA 2C35B 4HJ5A 1WY8A 1EUJA 3M4OH 2MRPA 3QOLA 4E3CA 1WSPA 2QA4A 1DCZA 4JI7Q 3DQVA 3PTFC 4FA6A 1GUAB 2W82A 1SSNA 4UY8C 3EJIA 4ARCA 3H91A 2KK8A 1N61A 2DZIA 2FCMA 2LJIA 1IYFA 3WIMA 3F8TA 4DV7Q 3MJ5A 3CQZH 4JG2A 1QT9A 5BN3A 2EKIA 3GDEA 2EYLA 4H44C 3DEOA 3A9KA 3NTHA 3HOWB 1EZ6A 3K0YA 1HE8A 3L4PA 1EEID 3VR4A 2PVGC 2H4OA 3D8GA 5IGDA 2HIVA 2DLBA 4GKJL 3CRKC 2XWBB 4FXGC 3U4EG 2SNMA 1PGBA 1EL0A 2FIDA 4NMZA 2GRIA 2B8FA 2K33A 5M3MG 5IT9c 1LLRD 2KCTA 4JI1L 2X38A 4KY7A 1O7IA 5DLQE 3PRMB 3UI2A 2KOLA 1GUWA 1WX9A 2ZNVC 4RGMA 5DPSA 4IWPA 2LHDA 3L17A 1H9JA 3DHQA 4DU9A 4S0RA 1RRBA 1QF6A 1EYAA 1I6HH 5AEKB 4M02A 5C4XH 1IBKQ 3GTLB 5FJ8G 1N62A 1N34Q 2KMAA 1SDFA 4USAA 3ZNID 1FNUA 4LFAL 2WAQE 2N9XA 4ME3A 1MBYA 2XN9C 1DXMA 3OWFA 2JU6X 1ISNA 1V86A 4M01A 1GOZA 1EY0A 2GBJA 3PUWA 3ZDMC 2JEBI 4UHVA 4REZA 1HZBA 5IOCA 5JPMC 4B3RQ 4K6DA 1I42A 2NB0A 1G291 1B7YB 1ET6A 3N9YC 3OW7A 4UPAA 4FF3A 4IPCA 4JYAQ 1GVPA 4OO1I 2NPTB 4RFBA 2UU9L 4IG7B 2IW3A 4DV6Q 1VQBA 5BYQA 1N9WA 4HVBA 4DXAB 3RZDB 1TBEA 3I5JC 2G4DB 2F0MA 2L1BA 3FP9A 2BDNA 5FLMH 3GTQB 2LUEA 3RNBC 5M9OA 2B3AA 3G6JB 2JA6G 4LDTD 3SGIA 3VQIA 3IXSA 3H3VC 1UF0A 1I4PA 3X3MA 3GTQH 1LUZA 4DUZL 1ZDVA 2CJNA 1C0AA 3LGJA 4K14A 2PTLA 1PZJD 4AYBG 5CMDA 2I07B 2VB2X 2R7ZB 3T1YQ 4W9DA 2PI2A 2KMMA 1RKNA 1WYDA 4PNYA 2AX5A 2F0IA 1J9OA 2L83A 4R1JA 4ZRJA 3VA5A 5D94A 4MGIE 1LYLA 4DR6L 5NUCA 4RCOA 2GMIC 4C7YA 3DXJC 3SK5A 1YHQA 4P71A 3RNUA 3A9JB 3DVNU 1LTBD 1F9QA 3BK2A 3MWYW 1HCZA 2C9OA 2Z1CA 4LUOA 1EWHA 5IODA 4XXEA 3GO5A 1L4DB 3PLUA 4LDTB 4IFDI 4ILWA 1N36Q 2E3TA 4OWTB 2AL6A 1HUMA 5BMHA 3KH0A 2MUYA 2EXZA 3LX0A 2WB1G 2BQQA 3ECIA 2F3IA 2M0XA 1E8XA 4MM3B 3VR8B 4OIKA 1HXYD 3AE4B 1XYIA 4GNXC 4GOCA 2N9LA 3KJPA 2RCNA 3VTWA 5C1ZA 1QUQB 1Y14B 1NVID 5A35A 3M4PA 4FDBA 2EKEC 4HJAA 4JOIA 1PDXA 4GOPC 2LGDA 4A8XC 2K5WA 4DHJB 2F0KA 2DZMA 2NN6H 4LF4Q 1D5XC 5M5XB 3ZJYC 1V5TA 4HCPB 4WWNA 3OWEB 2B63B 4W9GA 4KHPQ 1F2YA 1B9NA 1F9JA 1L1OB 1AE2A 1PGXA 5JVH3 2BYVE 2LVOA 1I35A 1QNKA 2QKIC 2JA6H 4JC0A 3ONAB 2UUBQ 3FILA 1YNJC 2J7ZA 2Q2IA 1E8ZA 4GDKB 2Z9HA 3H6MA 3PS6A 4KDIC 4HR7B 4YT0B 1ZEQX 2NVXH 1IYVA 1R9TH 1MIUA 2EY1A 3W1SA 3ZQ4A 4OXPA 4DAYA 5J18A 2NBWB 2O6VD 3J80c 3BU2A 3FPUB 3H7PB 1WGYA 3HEJA 3VDYA 3ICEA 2PJHA 2UYZB 2M1MA 1G2SA 2A1AA 2XK5B 4NNJB 3IKJA 4AYBE 1N6ZA 3HOXH 4JV5Q 3OYYA 2NVQH 1P3QU 2ZT9C 2LGIA 4A3LH 3S9WA 4GU2A 3R7RA 4ZQ3A 4X64Q 2E2IH 2DZJA 2QSDA 1WTRA 4FJVB 2A73B 2OTJA 3D4DA 1KQSA 1OFFA 3I63C 4DXGA 1T9HA 1JE5A 2F4IA 3MXPA 2PPBC 2KYWA 3I4OA 3UDXA 4PS8A 3T1HL 4RWSC 1VQAA 4QB4A 4QIWB 5HGTA 4DV5L 5IGEA 3M3YB 2HHHQ 1WXAA 3A8IE 3RI7C 3I4NG 4FADA 1ASZA 1QE6A 1VS0A 2DY7A 2KEDA 4EGVA 3IVFA 4R4OA 2C7MB 4CDEC 1EIYB 4A3GG 2WS3B 3NS1A 3QARA 1NEKB 1EIHA 4EQNA 1V8QA 4CJ2C 5BMIA 3CCUA 3NEMA 4JI6L 4CKCA 3M9BA 3CC7A 4LFBL 5J2RA 3H3VH 5IY0A 4IOIE 2A5HA 3DEPA 2VH1A 3DVGX 1NYRA 1EWCA 2D07B 2L9HA 4RCNA 2JYEA 4LFCL 3JSVA 3F2BA 3AQQA 3TN2A 1F9SA 4PZ7A 3TMEA 4O0AA 4TQ1A 3PO3B 4JIOU 1EFWA 5E6JA 3EGRA 1UEBA 4ZRZA 3DBRI 4LF6L 1IYUA 2KKCA 4EZLA 1VD2A 3MHBA 1WX8A 1EU4A 4KKSA 1HFNA 1IBML 1E7PB 2JZPA 2L8JA 1KIXA 2MBHA 3PPAA 3IAM1 4FHJA 4IW0A 4DQOC 5I9OA 1E2WA 4TQUS 4XDXA 2N7EA 1SE3A 3K57A 2Y5BB 2JYOA 2KWCA 1FXIA 4N9PA 2D10A 4OO1G 3L0WB 4JX1C 2UUAQ 2DYMA 4LF7Q 2DJFC 4NB3A 3RN2A 2K5DA 1TWAH 4A3MG 3GTMH 2BT6A 4K5VA 1QB5D 3S1MH 4IALA 3ITPA 4X3UA 1EF5A 3IL8A 1I7HA 1XT9B 5CHVC 2PNHA 5FLXE 1B53A 1TU2B 3GV6A 3PQIA 2EQSA 1VQKA 1QOFA 4Y52H 3F1ZA 2L00B 4LTUA 5BMGA 4B3ML 2LFNA 1FXTB 5C6AA 2YU9B 4ZHPA 4DHJD 1Q8KA 2VH2A 3PREA 1MGSA 3SHQA 1DOMA 3PO2B 4HK2A 2VQFQ 1YQ3B 3FKIB 4JI4L 5IP9G 1VQPA 3K80C 4RF0A 2V4LA 5HI1A 3R93A 1NR2A 1ROEA 3Q8EA 4LNQA 4BWGB 1RCVD 2OJRA 5AZGA 2B2VA 2KQ4X 5JEAH 1OQYA 5BN5A 4PMBA 2PCFB 5GQOA 2Q8TA 1V1PA 3HOYB 2E2JB 4FXCA 4ZKBB 4R8IA 5KNBA 2ATWA 2LVQA 4PS3A 3RT3B 2JN4A 1ONLA 1WD1A 2IY5B 4P74A 3BINA 2DENB 2BH2A 2MSED 2F0EA 4FN2A 3ZKJC 4L5RC 4HAEA 1SIFA 1UE7A 1E5WA 3UE0A 2BVCA 4Y7NH 2MJ3A 2UXBQ 4A6QA 2YTYA 1Q1BA 4LJPB 2RGFA 1SEBD 2QCPX 2GBNA 1X3QA 2D62A 3BZDB 3A1QB 2IBIB 1E22A 3K5MA 5GADC 4NAMA 1WX7A 5EPLA 2LI5A 2Z0DB 4A20A 2VUMH 5E6PA 3K81C 5HGQA 3AYHB 4GZYC 2E5LL 2I5LX 2W9NA 4OELB 2JA8H 1BBXC 3JVZX 2E75C 3NVVA 4P2CB 1K8OA 3GB1A 1HZ5A 3W1YA 4XQJA 1OXVA 1WGGA 2MH7A 4CJ1B 4XTCS 2BWES 4OIJA 5KYIA 2QHOA 1W6JA 1EY6A 3BJUA 3RMHA 4FF1A 3CIRB 5IT9E 4GKKL 1NAPA 5IOIA 2R93B 3IBEA 3VRBB 1GUGA 1V6EA 2XGTA 2V4IB 4KGRA 1GHJA 5GMVA 2WXOA 3NBHB 1M90C 4EOYA 3Q23A 4BY7H 4JI5Q 4MNOA 4MHEA 4NPNA 4ZYSA 2BKFA 5LNK1 3FVQA 3TUOA 2XVSA 5J39A 3HOXB 1WRDB 2LXKA 2KJ6A 4XGAB 5H8YE 1JORA 4I65A 2F0QA 4F88A 1RTNA 1WVLA 1UWMA 1K8GA 5BO4B 1NCVA 3I4MH 3B1LX 3QWNA 3U58A 1GAQB 3QC8B 1B9MA 1B1ZA 2CVRA 3CPFA 2BA1A 1PTOD 3LXFA 2ZNVB 3PRZA 3RNGC 1HTLD 3AFPA 2M2LA 2NN6G 4GXBA 4YWKA 1WMHA 1BO0A 3J81j 3K7UC 3AB9A 5LMUQ 1GC7A 4U68A 2BCOA 2O6VB 4II3B 4G50A 5CR3A 1E0ZA 2AUJD 1WWTA 1RIPA 1ZGUB 4DF7A 1QZEA 1T0YA 3Q22A 1N33Q 1A63A 3VH3B 3VFKA 4A3FH 3L13A 4FYDA 1WI0A 1MHXA 2JA5B 2MP2A 3JC66 3MTSA 1S3SG 3MVVA 2B2YC 4C3JB 2JRIB 2IY0B 3ZLZA 2BA0A 2WX1A 4K7WA 3NE5B 1GUTA 2UXCL 1L1OA 1QNUA 1SMYC 1OO9B 3VR2A 2BDOA 1RHPA 1A2TA 1CZPA 1GJZA 1OXUA 4A3MH 3UI3A 5C3WA 4RHRA 1B9RA 2F1MA 2N9EB 1IGDA 3K9OB 4APVA 5ISRA 4ZLTF 2EJMA 1HHVA 3Q2AC 2F0FA 1Y8RC 4FJZA 4L63B 3BK1A 1KLVA 2E74C 1CSQA 3HOXG 1OTCA 1TY0A 3DWPA 3H9DA 1FJGQ 4B3TQ 1D2BA 3A4RA 4JCVE 3P63A 1VQ9A 4NDXA 3J81E 3UINB 1W2BA 4KJOA 1JR0D 3J81L 1UEAB 2KECA 3Q69A 1B44D 1HTOA 3EROA 4B0MA 1GO3E 2Q8RE 1O80A 2KDEB 2OCEA 1I4GA 1EY7A 2NVTH 1SIJA 3E5SA 2RSOA 3MFGA 4N8FA 3TS0A 1JW9D 1V43A 1ESRA 1DOIA 1P7FA 2KZRA 5C5MA 5IO9A 3ZTCA 1STEA 3A74A 1PHJA 3HS0C 3C1EA 3U2SC 1MSHA 4DR2Q 4LNKA 3SDLC 2LY7A 1JALA 3G6EA 1VQ8A 5C3EH 2FE8A 1L7YA 2D11A 2O2LD 3ML8A 2IO3B 2AQ3B 3D4RA 1YJ1A 2WB1E 4CJ0B 5D2MB 2BPSA 1UBQA 2KEEA 5BR8L 1EQTA 3DBLB 1DOLA 1NMFA 4WWPA 2X69A 3TP8A 3DBSA 2M00A 3GE3C 1DGJA 2MQHA 3ND8A 1WJUA 1SROA 4ANUA 3RZOB 2OF1A 3I73A 4ZUJA 2LFIA 4MEMA 4L5TA 1GB4A 2HHHL 4DFAA 4C00A 3I4LA 2K8HA 1QVCA 4GNXB 1KRTA 5AZHA 2KTRB 3P1MA 4A3PA 1HNZQ 3PLVA 2AQ2B 2LMCA 3HG9A 1VQGA 5D6JB 2UUCL 2L0FA 4B6WA 2EY2A 4X65Q 1IL2A 2BB6A 2ZCCA 3BWUD 4W9JA 2NZ1D 4ME5A 5DPRA 2WHIA 1G6JA 4ZYNA 5DCNA 1S5ED 4EZKA 3SK8A 1HJPA 4RNAA 1MVKA 1GD7A 4EE2A 1ESFA 4B3TL 5K36H 4RGOS 4LUVA 2E2HH 4KI0A 3A5UA 1IUEA 1WR6E 4K3CA 2WP8J 1C3TA 4IUUA 4LW1A 5M3MH 2ES2A 1VMCA 3K7AH 2HT1A 1JQYD 3PIP3 3TEYA 2INPE 4X66Q 2B2WA 1NJIC 1BUIC 1N8RC 2J0KA 3AN1A 5M3MB 1PFBA 1N63A 2UUBL 4PMWA 4QL5A 4DNRB 3S1MB 4NXMQ 3Q3NC 4IJLA 4B9KA 4CO7A 2WKDA 3PHXB 2CQAA 2Z8LA 2NTSA 3GTGH 2CS4A 2WXKA 3HOZH 3I3TB 4XE0A 5FR3A 3NPPA 1U4RA 4D2KA 2JA7G 4MELA 1VQIA 5CV8A 1D3ZA 3BVZA 1C1YB 1R4MI 2N1WA 3EFCA 2F0GA 5CC4A 4GOPB 2A6HD 2ZJPA 2F0HA 1EYGA 2ZEQA 3L9AX 4H0LC 1HR0Q 1XLOA 3HM3A 2KHSA 3FRPB 2YLMA 4BFRA 3MEHA 3KFUA 1R7SA 4WIPA 3MXGA 2CH4W 1II3A 2KANA 1WCMB 4RMAA 4IUTA 1L0WA 2DWQA 1PLFA 1UWXA 3MJWA 1UE6A 2F0JA 1YJJA 3DVNV 1S40A 3W5UB 2RHSB 2L12A 3FILB 4LK0M 3HKSA 5KNDA 2ACZB 5JEAG 4A76A 2IX3A 2I5MX 4DV0L 1VDVA 3ER0A 5CV4A 4A93H 5KYLA 1C78A 3M85A 1PZKD 4KHZA 3NK9A 1ZXIA 4Q0FA 2ZVOA 1U4AA 2KVRA 1SNPA 3Q0AA 3X0WA 2OQ0A 4CDFC 3S2HB 3ZRFA 4IUQA 1XPUA 1TS3A 2MJDA 3DWGC 2K5NA 2GI9A 2WKCA 2WINB 4BXXG 4A93B 5CHWA 3Q14C 3SK6A 1GJXA 3I2ZA 3MXNA 1EZ8A 1DD2A 2JA5G 3M95A 4KKJA 2IGDA 3KUDB 3OLMD 4WJPA 2M9VA 3D6WA 2KQSA 5IYCH 2INCC 2PW5A 3MA2B 4OHJA 4MGYE 3VR5A 3SHLA 4GNXA 1EQQA 1HNWQ 5CV7A 1F52A 1SYGA 2BW2A 3AEFB 1FVIA 2R92G 4OX9L 5IGGA 5EQ0A 3N1ZC 1ENCA 1HZCA 1PTOF 4H7BA 1IZ6A 1Q46A 1R4NI 4BA2I 2E2HB 4A3EH 2ZPYA 4JWSC 4YCVA 3HOWH 1J8IA 1J0GA 2N88A 1L2NA 2AWNA 1X6OA 1RTOA 1XLPA 4ZKCB 2PKOA 1IBXA 3MXUA 1J19A 4BKSD 3NHEB 5IYDH 2PQAA 4MTNA 1R4QB 3OPOA 3H0GH 4KKUA 3W1SC 2K32A 1L6UA 2GLSA 2D5GA 2IWHA 1TKGA 3MFYA 2EJGC 1D1KA 4KN7C 1EY8A 4HPMB 1SJHD 2WLBA 3NENA 4Y7NB 1C4PA 4C80A 1B8AA 1JJCB 2UXDL 2L1AA 4C3JH 3KDFA 3AE5B 1PRTC 1SYBA 3U8ZA 4ZCKA 2KHWB 3Q8DA 1TWHB 2MA9B 1VMPA 4DUYQ 3NS8A 1B2TA 1Z9FA 2HIXA 3PZ8A 4I7AA 1WCMH 4GN5A 2UU9Q 2VQEQ 5E6NA 1ZDXA 1KM7A 1SNDA 3KBGA 4K1RB 4KSLC 2R92B 4OZBA 5D7GA 3SK4A 5FR6A 1L6VA 2ZXPA 3RCZA 1GPXA 3R3MA 1OQRA 1L0VB 1Z2MA 3EC8A 1I3QH 2KN4A 4M8MA 1ZXHA 3ZJUA 2D0PA 1PTOB 2KVMA 3HFZB 4XYQA 2RMMA 5HKHA 2PI2E 5C4XG 4OWWB 1GC6A 2JUOA 2MBBB 4C4VB 2C7HA 1JMLA 2UUAL 4DK5A 4KN4C 4LAAA 1CQVA 1GXDC 2LXAA 1Z5SB 2PMZB 4BBRG 2UWQA 4A3EG 5KEEA 2KA7A 3WOFA 3H7PA 2EYMA 2OEDA 4A4IA 4R9WA 4OONA 2BE5D 1Q90A 2DZKA 1T0QC 4JI8Q 1WXVA 4A3IH 1CMXB 3CCMA 1I94Q 2MHVA 3D32A 2X8XX 2C9WB 2QW7A 4UDUC 3VTUA 2MJ8A 1DM0B 3I90A 2O4XA 1WJNA 3RZWC 4Q5VA 4BOZB 5EKIA 1BDOA 1HH2P 2FIFA 2GOWA 2GB1A 3B2FA 1JWUD 2Y5CA 3AULA 5LXHA 3FEWX 1TVXA 5ELEA 2R7ZH 3OJ4B 1NNXA 3GP7A 4XQNA 3S1NH 2PEAA 1RDPD 1TWHH 1LFDA 4H2AA 2UXCQ 1L2FA 1C79A 1UZXB 3S1RH 5IWAQ 2FCNA 2D5DA 3U50C 1CT1D 5C3EG 3KLRA 2UXDQ 1JB3A 4KD3A 1TIID 3P20A 3JAML 3CCEA 5IP7G 3C3LA 2H89B 2KX0A 3HGBA 5JPNC 2KD0A 5HFYA 4P72A 3AXCA 1CKNB 2HQEA 1BNZA 4B95A 3PO0A 4H02A 4GIVA 2NYZD 5J17A 3V60A 2NTTA 4X62Q 1WTOA 2V3SA 3WOEA 5LMNQ 2WAQB 1VQLA 1BMLC 1TWGH 3S14H 3L10B 3LWEA 4GLXA 2F0VA 2TSSA 1Y56A 4O42A 4DHZE 2K25A 4ACFA 5FLXL 4DV3Q 1CM9A 2KXJA 2BYTA 1B3QA 1HQMC 4DAPA 2KNBA 4P6VF 3I91A 3NBHA 3NELA 1PH4A 1VQNA 1JROA 3J80E 2CJOA 3CAMA 1V1OA 1TS4A 1DOXA 4ODGA 4A3IG 5I9PA 2BE5C 3T13A 3EUB2 2L3ZA 2MPMA 1EUVB 4HCNB 2VZKB 5I2XA 4XX5A 2XIWA 4P73A 4DR7L 2N49A 3P75A 2CR5A 2F0WA 3P4PB 4ASWC 4F8CB 1AW7A 4MZ9A 3ZIMA 5J3BA 4DAYB 3HVDA 3ZTDA 2NVXB 1Y8NB 4J3OD 5EJWA 4KKTA 1Q8IA 5FLMG 2R3ZA 4DUZQ 2LXCA 2K5QA 4WWOA 3LWUA 4JOIC 4DR4Q 2LUMA 2CHZA 4NPSA 1KLGD 3HOUH 2VNUD 2M0AA 2OEOA 1RL2A 1PFMA 1Y69U 2ZJDA 3KBXA 3S1QB 3L0OA 1RFAA 5AUIA 2A19A 4KTAA 2W54A 4IZ8A 1N32L 5ELCA 4YWMA 4CKBA 1S5FD 1BCPF 3QR8A 5C3EB 2DN8A 4DNTB 3HVZA 1KNEA 5IGFA 2HE7A 5LMUL 4HMIA 4IDIA 2K28A 2ON8A 1WR1A 2EYPA 2KDMA 3L7ZC 3D0FA 2CU1A 1PH2A 1TS2A 4JVZA 2JXXA 2GBMA 2VUMG 4PYUA 4X62L 3BDLA 1P8LA 2JJQA 3W5OA 5LL6X 4HEDA 2LGXA 1TGZB 1PUTA 4XIGS 1SXTA 1I94L 2O5JC 1X3PA 4TVAB 3NTIA 4DV1Q 1D1IA 1GKHA 1G6PA 5CGKA 2ZW0A 1E6EB 3TRZA 1O7YA 4FJYA 1IXRA 3ULPA 1PH9A 3BDOA 3NBIA 1QCBD 3LJ3A 1TR5A 3RZDH 1P98A 1NE3A 4GN3B 2XRQD 3P4QB 3RNAC 2B2UC 1XNRQ 1UUPA 3CRLC 5KIXA 4DAVA 2NBUA 1V1QA 2MP1A 1K83B 4IQZA 2JK8A 4LNOA 3UQBA 2CU3A 1Z6HA 1P7EA 1BCPC 3A0JA 4ALPA 4KGTA 4EZJA 2PNRC 4K8JA 2CHBD 3PIO3 3MZ5A 4KX6B 2KCCA 3BDCA 4K6LA 4KVGB 4XWWA 3T8MA 1T6BX 1IGCA 5KNCA 5IYCG 1E9MA 3Q8AA 2RDHA 3B6YA 4MJSB 3L08A 1HZ6A 1L1OC 4IPHA 1C76A 4LF8L 4A3DB 4JI8L 3AEAB 1ML0D 1EIGA 1CZWA 5FKAC 1CA6A 3RFZB 4PYZA 1B50A 4DDGD 2UUCQ 4YSZB 1IBKL 2M17A 2K05A 3AE6B 4P75A 2YTVA 5IP7H 3DBLI 2YU9H 2LJ5A 4A3JH 4A3KH 5JJKA 1YX5B 2N7DA 3HKZB 1R4NB 2BOSA 3HP3A 4NAWB 3T1HQ 2REXA 4DGZA 3S16B 1UGMA 3P4RB 4DV7L 3AU7A 4DR7Q 4OEMB 1J5EL 3T3NA 4FF4A 4MT5A 2DNFA 4A3CH 1FD7D 4WAFA 4EEWA 2ZXRA 1HA5A 2RDFA 1VQOA 5ELFA 4EVOA 2ZJRA 5GAGC 2PVOD 1BOSA 1QKZA 1HTQA 2N9PC 3OTOL 3STBC 4TV3A 4XZ4A 3GS2A 2ZTCA 2WYQA 4K8IA 3T16A 1OEYJ 3P1HA 4MGKE 1V9PA 5GROA 1MG4A 5M3FG 1MG8A 4F1SA 4C4VA 2B76B 1FEHA 3HOYG 3J9CA 4E74A 1V1PB 3NP8A 3ZDTA 4IWQA 3PMFA 4L1BA 2K04A 1SMYD 3A7AB 5C4HA 5ELNA 4FVMA 4J15A 4RGNA 1PDQA 1BQQT 3CHBD 2PO4A 4DV5Q 2JZZA 4GDLB 1EQRA 3A56A 1FGUA 4QMGA 5ELOA 5GAHC 2LXJA 3FKIG 1NBWA 1J7BA 4L2YA 2I0QA 4W9KA 2I46A 4M1UB 2AQ1B 3CXCA 1P16A 4KHPL 1LTSD 1DOKA 2JWUA 5E3FA 3MAQA 1X54A 2A69C 3IFWB 3NZUA 4KGSA 4DV1L 1MJEA 2W55A 3RR5A 2SOBA 4OZAA 3ZNZB 1QLBB 4B9XA 1X55A 3KF8A 1YJ9A 2ZVNA 2ZZPB 3SVMA 3QO2A 1RJTA 1AEXA 2B2VC 3E9HA 4BBSG 1D7QA 2FUG1 3IT4B 1IW7C 2X6LA 2KLCA 1KTKA 4LF8Q 4LLGM 1CA5A 3DBHI 2O5IC 4DHZB 1PFSA 2BWFA 2CHXA 2RF4A 5D3IB 3T56B 3S24A 1JWBD 3KLWA 2E76C 3S17H 3GZNI 3SEBA 4DK6C 1VF7A 2WDVB 1Y1WH 1FPYA 2M19A 1E7ZA 1NDDA 2HDLA 3H0GB 3PUXA 3OIPA 2I2YA 4QAYA 3J7AF 5A2QE 1FXAA 2KFJA 1WTQA 1VLBA 3K5NA 4KIKB 2UU7A 4PG3A 1Y1VG 2BF8B 1WXQA 2KX3A 1HNWL 3WCQA 3H15A 4IPGA 3PO3G 2EYHA 1JOKA 4KZ0A 2L32A 1LTRD 2Z59B 2W3SA 2FNJB 4NZLB 4BZAA 3IFTA 2ASQA 3S1RB 4KSKC 1AZQA 3OJ3A 1XLNA 4FLHA 1N5XA 4A55A 1WGRA 2INNE 3DHGC 3RZOH 5AUKA 2WACA 1WYGA 5EDSA 4DPGA 3KF6A 3CKIB 1YN3A 3HRZC 2BBCA 3HHMA 1LT6D 1A62A 4UP9A 2L76A 2D2CC 5TR5A 1N5WA 4LWCA 1J6QA 2G1EA 5C3JB 5H92C 3K58A 2Q2UA 1WH3A 3S2HH 1QQRA 2MW5A 3CC4A 1I3QB 1MHWC 2AYOB 4BBRB 3CQZB 1WF9A 2VY3A 3IAS1 3BYTB 1NYQA 4FO2A 1ZOYB 2YVCA 2WXFA 3VR3A 4JL9A 3UQAA 3MHSD 1H9KA 2N9KA 5CX3A 4XQQA 2J7QB 1YITA 4HIDA 1HR0L 3E0EA 1D5MC 1HNXQ 2BS2B 4M0WB 3AEGB 4JBKA 1KABA 1OEYA 1IKLA 5JJIA 4DR1L 1EIFA 1YQBA 2AL3A 2PIAA 5EBDA 2KENA 4P1CC 1K3BC 5CYUA 1S4ZA 4NXNL 1UD7A 4DR5L 2E2IB 4NQKE 2B63G 3S1QH 1M8AA 3ZGZA 3EQLC 3J80L 1EWIA 4GS3A 1E2ZA 1PRTB 1E8WA 2Z0EB 1JT8A 2WXJA 4OGQC 2QEJC 3KDFB 3N6RA 1WGKA 2BYFA 1CK1A 3ZYYX 1EF1A 1VZ6A 3D4WA 2QJLA 5G55A 3TEWA 3OW2A 4KHVA 1SF0A 2HTHA 2PPHA 1HRJA 2FCQA 1WTVA 2EY5A 5I6WA 3HOZB 3I70A 2CFMA 2LRUA 3BY4B 4MJSA 4A3DG 3VYRA 1VR9A 1BUVT 3HOYH 1Q5WB 1TKYA 1EY5A 4YY3L 1G8ZD 2AMCB 4OZCA 4A3FG 1KC8C 3NVWA 4MSQB 3A5ZB 1E3PA 3UIPB 4OW0A 4HPPA 2NBVB 1CI3M 2L11A 1N36L 4WJQA 4RAUC 3ONSA 1HNZL 3LYYA 4MN3A 2VQEL 5EE0A 2A6ED 5LMNL 3TEHB 5JOBA 3FKIH 3JAME 5CV6A 3AFQA 2JZ3B 3AB5A 2K1BA 3PGEA 2FJ2A 3AEEB 1WI5A 3U52E 1W6KA 4C56C 4HCSA 3GZNB 2K22A 3QAQA 4KIKA 3VUYA 5DPTA 2V3PA 2RQXA 1PV4A 1GUNA 2QF7A 1XMQL 3W1GA 2RPQA 5FK9C 3J7A5 1DZ1A 1VF5C 2K7VA 4A75A 5AFWA 5GXGB 1SSOA 2BS4B 4L6TB 4HDQA 1WIAA 1NBFC 2MEKA 1L0XB 1OXTA 2DY8A 4F7ZA 4HN7A 3BG3A 4KY6A 4ID6A 3S2AA 3AV8A 2KACA 1TWAB 2HCIA 5IYBH 4W9LA 3E0JA 2HD5B 1S5CD 4U673 4WWMA 5GAEC 5FO8B 1I50B 3MC0B 2Z4HA 5TSSA 4W9EA 3B2GA 3VYUA 1WJJA 2G9HD 1TKWB 2VXWA 5IWAL 1XPOA 5D65A 3JW0X 1VCBA 3QJYA 2RBMA 3N32A 4DUYL 2OHFA 1ZKHA 2V9HA 2NMQA 4LNIA 4DR2L 1SYFA 4IPDA 1XQQA 2G3QB 3OG5A 1LM8B 1BBUA 4WFN3 2K8BA 2F0SA 2L0CA 2LMCB 4JLCA 4OVUA 5CTRC 4JI2L 3M3JA 4LNFA 4JI7L 4QJFA 4FNFA 2F4VQ 3N30A 1BVSA 2VB3X 3I8ZA 1X9NA 2WXHA 5H1SE 1VJKA 4HROA 5EE9A 3WA0A 2KWUB 2KAJA 2MFIA 5EKKA 3J7ZC 1V97A 1OXSC 4RKLA 3T53B 1SNCA 1KDCA 2F0UA 2IHEA 4KY5A 4KDLB 5L95C 3R8BA 2DGYA 3AH7A 1VQDA 5I6YA 5IGBA 1MJDA 1YHAA 2PQEA 4AJWA 3CCQA 4Z9CB 4RM8A 1I6VC 1WRIA 1I4RA 1PMRA 2ENBA 3EA6A 4ZUIA 3CF5A 1CZGA 1ICWA 2I5HA 4R8NA 2WB1B 2MBOA 2IX1A 1YOVB 4P1BC 3E9IA 3P4SB 3STBD 2DNCA 3ERQA 3RD4A 1DONA 1YJWA 5JVG3 3NG0A 2NUCA 2HCCA 1BKBA 2B3GA 1KH0A 1WGHA 2FCSA 1RODA 2SNSA 2EYOA 1Q7YC 2WXIA 3DCGA 1E90A 5G5HA 4JWUC 4WAAA 1Z47A 1LT4D 3U9OA 2NS5A 1KXLA 3CMMB 3HIZA 3CCRA 1E1TA 4YCWA 4JI0Q 1AE3A 1XMQQ 1JICA 2VUMB 2K9XA 3J7AV 3EECA 2R92H 1R9TB 4C3IG 1YIJA 2IO1B 3DWQA 2WNMA 4XWTA 4ZRPA 5EPJA 3KLSA 1H8CA 1WE6A 4P7IA 2ASBA 4ICVA 2KWVB 2B39A 2EE1A 2CWAA 3FDTA 3M4QA 1L5PA 2J0JA 3RZFA 3ZRCA 3Q6SA 4C7ZA 1QUQA 4DV2Q 4LCDE 2KO3A 1UE5A 3K7AB 2J0TD 5KHQA 4QUCA 1VQJA 4I7ZC 1JE4A 1U9RA 4A3LG 1J7CA 1PQSA 1T0RC 1E0BA 5DM63 1JRUA 1VZ7A 2DX5B 4LJOB 2Z6KC 3OHXC 1LABA 3HOVG 1F1HA 1VZ8A 4AP4C 4AS1A 2L4NA 3DDCB 4BY1B 5ELDA 1KOTA
chains in the Genus database with same CATH topology
2SDFA 2IDYA 2FINB 4WH4A 4JK1C 1I6HB 3DMUA 4KMUC 2JE6I 2W3RA 3OOCA 2ID0A 4DA2A 4WJWA 3A8JE 1WTWA 1FFUA 3BVGA 3M7NA 4YXDB 3V96A 1IKMA 3C1FA 2Q5WD 3FMCA 5EGTA 1FO4A 1TWFB 2IX0A 5M3FB 1CHQD 1F77A 1C4QA 4HSPA 2J52A 1MI2A 4ZK9B 4K2KA 2K0PA 4CGYB 2WXNA 2HTME 5C5LA 2EZVA 1ZP0B 5HG2A 5FOBB 1MD2D 1I4QA 3S14B 1SE2A 3I4NB 3PUZA 2V4DA 3DUZA 4F87A 3K5LA 4B9WA 5EPKA 4X3KA 3SR1A 4EQPA 1LTAD 1EY4A 3NXWA 1AFPA 1S5BD 1JQ4A 2A69D 3SE0A 1HEZE 3G7LA 4J8QA 4OL7A 2EDGA 1LTTD 1MPEA 2EPBA 2F0NA 3EVQA 3I4MB 1FD6A 1G91A 3FAHA 5C4JB 1HQRD 4RGTA 3NUHB 1YN4A 2N55A 3NHHA 5CORA 3TEZA 3HRDD 4LMQD 4K5XA 2QMTA 3WDNA 1TS5A 5C0XI 3VYTA 4XDCA 4DK1A 2PW7A 3S15B 3NUCA 1CFMA 1FNWA 1ZKOA 5G3LD 2ICEC 3A7LA 4YTPB 4KJNA 1PTOC 1EOTA 1U4PA 1EYCA 1F0ZA 4PV1C 4C1NI 3GTJB 2WXRA 1MSGA 2A68D 1IL8A 1LV9A 5A2QL 3I57A 3NSWA 3DWAA 4G57A 1KLUD 1VCIA 1EQVA 3GTMB 5F2DA 4R3DA 4QF4A 2K3UA 4N6EB 1CTMA 3F2UA 4A3JB 4NW2A 1G6ZA 5IT9L 1EFID 3MP9A 4YIJA 4JBWA 5E4XA 2XRSD 4P16A 4A3KB 3T51B 1A3TA 1HTPA 1YJIA 2WU2B 1Q12A 3ETRA 3FC4A 4CQNA 2FHTA 1XEEA 3VR6A 3VA7A 1TJEA 2KUMA 1K50A 3GTPB 4US9A 5FO9B 2Y3AA 2LHEA 4C2MB 2EYJA 1FYCA 2M56B 1F2RI 3E6ZX 2PZUA 1K8MA 4ZAIA 2A68C 1FFVA 5C3XA 5CBEE 2AWOA 5I2YA 3HOVB 2Y5PA 3RUZA 1C77A 4NP5A 2F3WA 2WXGA 5JEAJ 4FP5D 1NR4A 4O1NA 4FXKC 1F2ZA 5D3DA 1SFOB 1T3QA 5E4WC 2B2UA 2PW9A 3PZ7A 1RM6C 1OXXK 2CW0C 3OIQA 1EEFD 4HRSA 3K5OA 4RH6A 1O7ZA 1ILQA 5CBAE 2EYFA 1H9RA 2JXTA 4IKGA 3KK7A 1O7LA 4HKZE 2NVTB 2NBFA 4A90A 2F0TA 5G3LF 3TZUA 3AMUA 1R4PB 4HMJA 3NQIA 1ENAA 1TY2A 1Z7TA 4K5WA 3AEBB 2N7JA 3LB8C 5K5PA 2LS01 4G4KA 2EOTA 2G9DA 4F8MA 1UNSA 1ZPSA 3H09A 3PV0A 1TWGB 2JSVX 1LACA 4OVZA 1Q1EA 4ABNA 1WD0A 4DK0A 1JCKB 2D9UA 1PYWD 2WU5B 1T5XD 1B4OA 1XLQA 3H8HA 4FF2A 2LKVA 1QOHA 5DEHA 1XWEA 1I4XA 5M5YB 1A15A 3VRAB 5BN4A 5BYSA 2WXMA 2SAKA 3DM1A 4A3IB 3FPPA 1AP0A 1FM0D 1TT2A 3GQBA 2MJEA 1H9SA 1XCTL 1Y8PB 2DYOA 3H94A 2GA4B 4C1NK 3W3AA 5DAUA 3CWIA 3U9SA 4BY7B 1YNJD 2RSNA 1XCQL 2F3VA 4PQXA 3GD7A 4QCLA 4CKEA 1QOGA 3V05A 1GHKA 4G7OC 2E6XA 2H1EA 2RKSA 3HOUB 4N9TA 1SNOA 1F9PA 3RPFC 2XSCA 1PRTD 3A55A 3VYSA 5C2TB 1ACCA 3BYYB 2JA7B 1STHA 4A3MB 3KQ4A 1MHHE 1DOYA 2F03A 3E56A 2C5CA 1C8CA 3P42A 1PTOH 1SBBB 1C9FA 2EJFC 3M4YA 1YN5A 1C4AA 1SNMA 1SAPA 2L52A 1ZUD2 3Q8CA 3T4AC 2V0GA 1NSNS 2B8GA 3AE9B 1J7AA 4ZRQA 1KRHA 3AMZA 2H88B 1IHZA 3NZ3A 3TP6A 1VRAB 1AWDA 4V190 5LL6S 4RKBA 1B3AA 5J22A 3C2PA 2IL8A 4X3TA 2R61A 1X32A 4GLSC 1PZID 4JE3B 1K52A 3S17B 3SDZA 3SFDB 4YSXB 1ILPA 4RHSA 1FNVA 4E6IA 4NKLA 3KWVA 3K59A 5EE1A 2NVYB 2VZKD 4TKOB 1DYQA 3LNNA 3ND9A 1PFDA 3W2DA 1BR9A 5KGUA 2ZXOA 1I4HA 1Q10A 4G7ZC 3AEDB 3AE3B 3TP5A 2IGHA 5JJZA 1EYDA 3NWSA 1FR3A 1GUOA 1YMHE 4IUPA 3RLFA 2K6AA 1PGAA 1HFGA 4L8JA 2ICIA 1STNA 1QWYA 4ULLA 4BS9A 3IAYA 1RF2D 3TSSA 1YQ4B 2XWJB 2BB5A 1JWAD 5KRUA 4AYBB 4HKQA 1JRPA 3ZJVA 2HDMA 2PLPA 1YNNC 4TRDA 1KFYB 4RF1A 4S3SA 5J1ZA 3M4OB 2BS3B 3N52A 2RA4A 1LTGD 4TMAB 2K01A 4C3HB 1A70A 2WXPA 4A9AA 4FXDA 4WORA 4KV6A 4AQ7A 1FGBD 4IN3A 3TBIB 3PUYA 4HSVA 2IJ0A 5K36G 1SYCA 4YSYB 2TMPA 3MHZA 4PT5A 1QILA 3A54A 3W5VB 2N0SB 3AM9A 2PYKA 2E2DC 2QIEB 2WXLA 4NJCA 1AYFA 4HTHA 1C48A 1WTXA 1QJOA 4BA1I 2IPKD 5IIFA 2YEPB 3AE2B 3SR6A 3NVZA 1SYEA 4MH8A 1SYDA 3QOJA 5IGCA 4YTNB 1D5ZC 3S2DB 1GB1A 3KWLA 4LK1C 2ONQA 1TKEA 4C3HG 4L23A 4A3BB 1A3UA 1VDZA 3BS1A 4HJGE 5EKLA 3V2TA 2JXMB 3TEXA 2F0LA 3PUVA 1D4BA 3SFEB 3SXHA 4CBVA 4IUNA 3D31A 5JXVA 5C0XJ 3KUPA 4PMCA 2I38A 4ZOHC 1OQQA 3OMGA 2PZWA 2SEBD 1STBA 1UGJA 5HURA 1EWYC 1JOOA 3V3XA 1SJED 1XXGA 4WQMA 4WURA 1TWCB 1XO3A 1WTPA 2EELA 5DM73 3IT6B 5T1GA 1ZYRD 1BCPB 5HHDG 1ZYRC 4A3FB 2AUKA 4J1MA 3S1NB 2KWDA 2KQ3A 4KKIA 2IT1A 2JSOA 2HDEA 1SNQA 2NWGA 4JPSA 2HUGA 2NN6I 4K2LA 1Y8OB 1RWSA 4J6HA 4KK7A 4EQOA 5G5GA 1Q3LA 2FMMA 2WV6D 1FRDA 4BBSB 3TZDA 1V8CA 4TQ0A 1CQFA 3OSOA 2WDRB 3E9SA 2FBWB 4C3JG 2F0OA 3L3OC 4HEA1 1G2TA 3BIID 1TYGB 2RVLA 2QILA 1L4ZB 1IW7D 1UAPA 1LTID 1F2RC 1QG7A 2JX5A 1KAAA 2A6HC 3TP7A 4B08A 5T8IA 2B2YA 4DN4M 2WQYB 3NVYA 3IFDA 5ELBA 3Q8BA 4YTMB 1FCLA 5T1IA 5C0XG 3EFXD 3R2TA 4G7HC 3DWMA 1A3VA 2FMCA 1IBXB 1FRRA 3W9CB 2BTEA 2K03A 5C44B 3CU7A 2V3NA 4QUFA 4Q2JA 3B9JA 2YYZA 1LO5D 4KD4A 4YWGG 1HA6A 1KDBA 1QOAA 4DXFA 3R3OA 1KDAA 2OT2A 1NUCA 3K6OA 4IUVA 1T5EA 2JA8B 4MACA 3NRZA 3X3NA 2EVBA 3VR9B 3URYA 1BXTA 1O78A 2Z4IA 2K5PA 2F0DA 1FCCC 1LT3D 1N60A 1NENB 1JWSD 5EE3A 1GUSA 4A3GB 4WRDA 1K53A 5M5WB 4ARIA 3Q8FA 1U4LA 2QDBA 4F7XA 2A6EC 2JQRB 1EM7A 1NI3A 2DNEA 4XT1B 1RFKA 1BCPD 5COYA 2WXQA 4A3EB 4HCEA 1JC7A 3NQTA 1KF6B 5BYRA 1HUNA 3C8YA 2R6GA 2JYTA 1MI0A 5LHY1 5C4XB 1Y1VB 4XDDA 2ZW1A 3AE7B 3NTKA 2XNAC 3BVMA 4IFDJ 1EY9A 4XYOA 2EY6A 3Q24A 3KLSX 2RPVA 5D14A 1FMAD 1F2LA 4IFDH 2J4XA 5C4ZA 4XT3B 1M4VA 1JOQA 3D3RA 1XTCD 1DJRD 2IGGA 1XX8A 3HZXA 3J7YW 2L5TA 1YNTE 1XF5L 5C0XH 3I9V1 1CJEA 3M7GA 1PFNA 1SE4A 1ZXTA 3P7JA 2NVQB 4C3IB 4V0BA 3NWTA 3GV3A 2WDQB 3I3CA 1FIQA 3OMCA 4ZHOA 3ZJTA 1SB3C 4CHTB 3R2IA 2OXPA 1Y1WB 2CW0D 1A2UA 3QB3A 3AECB 1RYJA 1LT5D 3HUIA 3D6CA 1F2MA 2Y0SB 4LJZC 5MPOA 1E10A 1AN8A 5EBCA 2JA6B 4IFDG 4M0WA 5I4DA 1F9RA 2B2WC 1C4CA 2RDGA 2L55A 3GTKB 2KCNA 5DNFA 3U7ZA 3I72A 1H9SB 1U4MA 1CHPD 5FO7B 1AZPA 3T3OA 3TDQA 2J53A 4ITKA 3ABVB 1JWMD 2Q8IB 3O13A 5CV9A 1ZE3D 2KJXA 2JP1A 3AE1B 3GTGB 2A74C 2B2TA 1STAA 1K51A 4H13C 1E2VA 2WIIB 3AE8B 4UAIA 1L0YB 2B2TC 1D6EC 5E1FA 2YEPF 1STGA 1ENFA 1STYA 1YNND 2MGSA 4TSSA 1TZOA 2JEAI 4N59A 1BF4A 4RA8A 3A8KE 4IURA 1KNAA 1PXUA 2LEKA 4MIUA 5JAVA 1TQOA 1H9MA 4N58A 2DBYA 1A6XA 2J42A 4B0EA 1HPCA 3QIAA 1EU3A 5CV5A 2PZTA 1QOBA 4US8A 2FFKB 3GTOB 1S5DD 3QG1A 2PMVA 2F0PA 4X3SA 1ET9A 2X6GA 2WP9B 3C46A 4OO1H 1PRTF 1RD9D 4M8AA 3QOLA 1WSPA 1DCZA 2W82A 1SSNA 3EJIA 4ARCA 3H91A 1N61A 2LJIA 3MJ5A 1QT9A 5BN3A 2EKIA 2EYLA 4H44C 3DEOA 3NTHA 3HOWB 1EZ6A 3K0YA 3L4PA 1EEID 3VR4A 2PVGC 2H4OA 3D8GA 5IGDA 2DLBA 3CRKC 2XWBB 4FXGC 3U4EG 2SNMA 1PGBA 1EL0A 2GRIA 4NMZA 2B8FA 2K33A 1LLRD 2X38A 4KY7A 3UI2A 2KOLA 1GUWA 4RGMA 2LHDA 1H9JA 3DHQA 4DU9A 1QF6A 1EYAA 3GTLB 1N62A 1SDFA 4USAA 1FNUA 1MBYA 2XN9C 1DXMA 3OWFA 2JU6X 1GOZA 1EY0A 3PUWA 2JEBI 4REZA 5IOCA 5JPMC 4K6DA 2NB0A 1G291 1ET6A 3N9YC 3OW7A 4FF3A 4OO1I 4RFBA 2IW3A 5BYQA 3RZDB 2F0MA 2L1BA 2BDNA 3GTQB 5M9OA 3G6JB 3VQIA 3IXSA 3H3VC 1I4PA 3X3MA 1ZDVA 2CJNA 4K14A 2PTLA 1PZJD 5CMDA 2R7ZB 2I07B 2VB2X 2KMMA 1RKNA 4PNYA 2AX5A 2F0IA 1J9OA 2L83A 3VA5A 5NUCA 4RCOA 4C7YA 3DXJC 3SK5A 1LTBD 1F9QA 3BK2A 3MWYW 1HCZA 2C9OA 2Z1CA 1EWHA 5IODA 4XXEA 3GO5A 1L4DB 4IFDI 4ILWA 2E3TA 1HUMA 5BMHA 2MUYA 2EXZA 3LX0A 4MM3B 3VR8B 4OIKA 1HXYD 3AE4B 1XYIA 2N9LA 1NVID 5A35A 1PDXA 4A8XC 2K5WA 2F0KA 2NN6H 1D5XC 5M5XB 3OWEB 2B63B 1F2YA 1B9NA 1PGXA 5JVH3 1QNKA 2QKIC 3ONAB 3FILA 1YNJC 2J7ZA 4GDKB 3H6MA 4HR7B 4YT0B 1ZEQX 1IYVA 3W1SA 2EY1A 3ZQ4A 4DAYA 3FPUB 3HEJA 1G2SA 3IKJA 2ZT9C 2LGIA 3S9WA 4ZQ3A 2QSDA 1WTRA 2A73B 3D4DA 1OFFA 4DXGA 3MXPA 2PPBC 2F4IA 4RWSC 4QIWB 4QB4A 5HGTA 3M3YB 5IGEA 3A8IE 1QE6A 2DY7A 2KEDA 4EGVA 2WS3B 3NS1A 1NEKB 1EIHA 4EQNA 1V8QA 4CJ2C 5BMIA 4CKCA 4IOIE 2A5HA 3DEPA 1NYRA 1EWCA 2L9HA 4RCNA 2JYEA 3TN2A 1F9SA 3TMEA 4TQ1A 3PO3B 5E6JA 3EGRA 4ZRZA 1IYUA 3MHBA 1EU4A 4KKSA 1HFNA 1E7PB 2JZPA 3IAM1 4DQOC 5I9OA 1E2WA 4TQUS 4XDXA 1SE3A 3K57A 2JYOA 1FXIA 4N9PA 4OO1G 4JX1C 2DYMA 2K5DA 2BT6A 4K5VA 1QB5D 4IALA 3ITPA 4X3UA 3IL8A 1I7HA 5FLXE 1B53A 1TU2B 3GV6A 1QOFA 4LTUA 3TUOA 5BMGA 2LFNA 5C6AA 2YU9B 4ZHPA 1MGSA 1DOMA 3PO2B 1YQ3B 3FKIB 4RF0A 5HI1A 3R93A 1NR2A 1ROEA 3Q8EA 4BWGB 1RCVD 2B2VA 2KQ4X 5JEAH 5BN5A 4PMBA 2PCFB 2Q8TA 3HOYB 1V1PA 2E2JB 4FXCA 4ZKBB 4R8IA 5KNBA 1WD1A 1ONLA 2F0EA 4HAEA 2MJ3A 4A6QA 1Q1BA 1SEBD 2QCPX 1X3QA 2D62A 3BZDB 3K5MA 4NAMA 5EPLA 4GZYC 1BBXC 2E75C 3NVVA 4P2CB 1K8OA 3GB1A 1HZ5A 4XQJA 1OXVA 2MH7A 4CJ1B 4XTCS 4OIJA 5KYIA 1W6JA 1EY6A 4FF1A 3RMHA 3CIRB 5IT9E 3VRBB 1NAPA 2R93B 1GUGA 2V4IB 4KGRA 1GHJA 2WXOA 3Q23A 4MHEA 4ZYSA 5LNK1 3FVQA 2XVSA 3HOXB 5J39A 5H8YE 1JORA 4I65A 2F0QA 4F88A 1RTNA 1WVLA 1UWMA 1NCVA 3QWNA 1GAQB 1B9MA 1B1ZA 2CVRA 3LXFA 2BA1A 1PTOD 1HTLD 2M2LA 2NN6G 1BO0A 3AB9A 4U68A 2BCOA 5CR3A 1E0ZA 2AUJD 1WWTA 4DF7A 3Q22A 4FYDA 1MHXA 2JA5B 3MTSA 3MVVA 2B2YC 4C3JB 2BA0A 3NE5B 1GUTA 1QNUA 1SMYC 1OO9B 3VR2A 2BDOA 1RHPA 1A2TA 1CZPA 1OXUA 3UI3A 5C3WA 4RHRA 1B9RA 2F1MA 1IGDA 5ISRA 4ZLTF 2EJMA 1HHVA 2F0FA 4L63B 3BK1A 2E74C 1TY0A 3DWPA 1D2BA 3P63A 4NDXA 3J81E 4KJOA 1JR0D 3J81L 1UEAB 2KECA 3Q69A 1B44D 3EROA 4B0MA 2Q8RE 1O80A 1I4GA 1EY7A 1SIJA 3E5SA 2RSOA 3MFGA 1JW9D 1V43A 1ESRA 1DOIA 1P7FA 5C5MA 1STEA 3HS0C 3C1EA 3U2SC 1MSHA 2LY7A 1JALA 2FE8A 2O2LD 2AQ3B 3D4RA 4CJ0B 2KEEA 1EQTA 1DOLA 2X69A 3TP8A 2M00A 1DGJA 3ND8A 3RZOB 2OF1A 3I73A 4ZUJA 2LFIA 1GB4A 4DFAA 3I4LA 3P1MA 2AQ2B 2LMCA 3HG9A 2EY2A 2BB6A 3BWUD 2NZ1D 4ME5A 1S5ED 3SK8A 4RNAA 1MVKA 4EE2A 1ESFA 5K36H 4RGOS 4KI0A 1IUEA 2WP8J 4IUUA 1VMCA 1JQYD 3PIP3 3TEYA 2INPE 2B2WA 1BUIC 3AN1A 5M3MB 1PFBA 1N63A 4PMWA 3S1MB 4DNRB 2WKDA 2CQAA 2Z8LA 2NTSA 2WXKA 4XE0A 5FR3A 3NPPA 1U4RA 4D2KA 5CV8A 3BVZA 2F0GA 5CC4A 2A6HD 2F0HA 3L9AX 4H0LC 1XLOA 2KHSA 3FRPB 3MEHA 1R7SA 4WIPA 3MXGA 1II3A 1WCMB 4IUTA 2DWQA 1PLFA 1UWXA 2F0JA 1YJJA 3W5UB 2L12A 3FILB 4LK0M 5KNDA 2ACZB 5JEAG 2IX3A 1VDVA 5CV4A 1C78A 5KYLA 3M85A 1PZKD 4KHZA 3NK9A 1ZXIA 4Q0FA 1SNPA 3Q0AA 3S2HB 4IUQA 1TS3A 2MJDA 3DWGC 2GI9A 2WKCA 2WINB 4A93B 3SK6A 1GJXA 3MXNA 1DD2A 1EZ8A 4KKJA 2IGDA 2M9VA 3D6WA 2PW5A 3MA2B 4OHJA 3VR5A 3SHLA 5CV7A 1SYGA 2BW2A 3AEFB 5IGGA 5EQ0A 1ENCA 1PTOF 4H7BA 4BA2I 2E2HB 4JWSC 1J8IA 2N88A 2AWNA 1RTOA 1XLPA 4ZKCB 2PKOA 1IBXA 3MXUA 1R4QB 3OPOA 4KKUA 2K32A 1L6UA 2D5GA 2IWHA 1TKGA 3MFYA 2EJGC 1D1KA 4KN7C 1EY8A 4C80A 1SJHD 2WLBA 4Y7NB 1C4PA 2L1AA 3AE5B 1PRTC 1SYBA 1TWHB 1VMPA 1B2TA 3PZ8A 1ZDXA 1SNDA 3KBGA 2R92B 4OZBA 5D7GA 3SK4A 1GPXA 1L6VA 2ZXPA 1OQRA 1L0VB 2KN4A 1ZXHA 3ZJUA 2KVMA 1PTOB 2RMMA 4XYQA 1JMLA 4KN4C 4LAAA 1CQVA 1GXDC 2PMZB 5KEEA 2KA7A 3WOFA 2EYMA 2OEDA 4R9WA 2BE5D 1Q90A 2MHVA 4UDUC 2MJ8A 1DM0B 3I90A 2O4XA 4Q5VA 5EKIA 1BDOA 2GB1A 3B2FA 1JWUD 2Y5CA 3FEWX 1TVXA 5ELEA 3GP7A 4XQNA 1RDPD 4H2AA 1C79A 2D5DA 1CT1D 3KLRA 1JB3A 4KD3A 1TIID 3P20A 3JAML 3C3LA 2H89B 3HGBA 5JPNC 5HFYA 2HQEA 1BNZA 3PO0A 2NYZD 2NTTA 1WTOA 3WOEA 2WAQB 1BMLC 3LWEA 2F0VA 2TSSA 1Y56A 4O42A 2BYTA 5FLXL 1CM9A 4DAPA 1HQMC 4P6VF 3I91A 3NBHA 1JROA 3J80E 2CJOA 1DOXA 1V1OA 1TS4A 4ODGA 5I9PA 2BE5C 3T13A 3EUB2 2MPMA 2VZKB 5I2XA 2XIWA 3P75A 2F0WA 3P4PB 1AW7A 3HVDA 2NVXB 1Y8NB 4J3OD 5EJWA 4KKTA 1Q8IA 2R3ZA 2K5QA 3LWUA 2LUMA 1KLGD 2VNUD 2M0AA 2OEOA 1PFMA 1Y69U 3KBXA 3S1QB 5AUIA 4KTAA 2W54A 4IZ8A 5ELCA 4CKBA 1S5FD 1BCPF 5C3EB 2DN8A 4DNTB 3HVZA 1KNEA 5IGFA 4IDIA 4HMIA 2K28A 2ON8A 2EYPA 2KDMA 3L7ZC 1TS2A 3BDLA 5LL6X 4HEDA 1PUTA 4XIGS 1SXTA 2O5JC 1X3PA 3NTIA 2ZW0A 1D1IA 5CGKA 1E6EB 1O7YA 3BDOA 3NBIA 1QCBD 1TR5A 2XRQD 3P4QB 2B2UC 1UUPA 3CRLC 5KIXA 4DAVA 2MP1A 1K83B 4IQZA 2CU3A 1Z6HA 1P7EA 1BCPC 4KGTA 2PNRC 3PIO3 2CHBD 4K8JA 3MZ5A 4KX6B 2KCCA 3BDCA 4K6LA 4XWWA 1T6BX 1IGCA 5KNCA 1E9MA 3Q8AA 2RDHA 1HZ6A 1C76A 4A3DB 3AEAB 1ML0D 1EIGA 1CZWA 5FKAC 1CA6A 3RFZB 1B50A 4YSZB 3AE6B 2K05A 3HKZB 2BOSA 3HP3A 4NAWB 4DGZA 3S16B 3P4RB 3T3NA 3AU7A 4FF4A 4MT5A 1FD7D 4WAFA 2ZXRA 1HA5A 2RDFA 5ELFA 4EVOA 2PVOD 1BOSA 1QKZA 3GS2A 4K8IA 3T16A 3P1HA 2B76B 1FEHA 3J9CA 1V1PB 3NP8A 3PMFA 4L1BA 2K04A 1SMYD 3A7AB 5C4HA 4FVMA 4RGNA 1BQQT 1PDQA 3CHBD 2PO4A 4GDLB 3A56A 4QMGA 1J7BA 4L2YA 2I46A 4M1UB 2AQ1B 1LTSD 1DOKA 2JWUA 5E3FA 3MAQA 2A69C 4KGSA 2W55A 2SOBA 4OZAA 1QLBB 4B9XA 3KF8A 3SVMA 3QO2A 1RJTA 1AEXA 2B2VC 3IT4B 2FUG1 1IW7C 2X6LA 1KTKA 4LLGM 1CA5A 2O5IC 5D3IB 3T56B 1JWBD 2E76C 3SEBA 2WDVB 1VF7A 2M19A 2HDLA 3H0GB 3PUXA 3OIPA 2I2YA 3J7AF 5A2QE 1FXAA 1WTQA 1VLBA 3K5NA 1WXQA 3WCQA 2EYHA 1JOKA 2L32A 1LTRD 2W3SA 4NZLB 3IFTA 3S1RB 1AZQA 1XLNA 4A55A 1N5XA 2INNE 5AUKA 2WACA 1WYGA 3CKIB 1YN3A 3HRZC 2BBCA 1LT6D 2D2CC 1N5WA 5C3JB 2G1EA 5H92C 3K58A 1QQRA 1I3QB 4BBRB 3CQZB 3IAS1 3BYTB 1NYQA 4FO2A 1ZOYB 2WXFA 3VR3A 1H9KA 2N9KA 4XQQA 2BS2B 1D5MC 3AEGB 1KABA 1IKLA 2PIAA 5EBDA 5CYUA 1S4ZA 2E2IB 3ZGZA 1M8AA 3EQLC 3J80L 1E2ZA 1PRTB 2WXJA 4OGQC 2QEJC 3N6RA 1WGKA 1CK1A 3ZYYX 1VZ6A 2QJLA 3D4WA 3TEWA 4KHVA 1SF0A 1HRJA 1WTVA 2EY5A 5I6WA 3HOZB 3I70A 3VYRA 1VR9A 1BUVT 1TKYA 1EY5A 4OZCA 1G8ZD 3NVWA 4OW0A 1CI3M 2L11A 4RAUC 3LYYA 4MN3A 5EE0A 2A6ED 5JOBA 3JAME 5CV6A 3AB5A 2K1BA 2FJ2A 3AEEB 3U52E 1W6KA 4C56C 4HCSA 2K22A 2V3PA 2RQXA 1GUNA 2QF7A 5FK9C 1DZ1A 1VF5C 2K7VA 5AFWA 5GXGB 1SSOA 2BS4B 4L6TB 2MEKA 1L0XB 1OXTA 2DY8A 4HN7A 3BG3A 4KY6A 4ID6A 3AV8A 2KACA 1TWAB 2HCIA 3E0JA 1S5CD 4U673 4WWMA 5FO8B 1I50B 3MC0B 2Z4HA 5TSSA 3B2GA 3VYUA 2G9HD 1TKWB 2VXWA 5D65A 3QJYA 2RBMA 2OHFA 2NMQA 1SYFA 4WFN3 2F0SA 2L0CA 2LMCB 4FNFA 2VB3X 3I8ZA 2WXHA 5EE9A 1VJKA 4HROA 2KAJA 5EKKA 1V97A 1OXSC 4RKLA 3T53B 1SNCA 1KDCA 2F0UA 4KY5A 3R8BA 3AH7A 5I6YA 5IGBA 2PQEA 4Z9CB <