3O13A

Crystal structure of a superantigen-like protein (sav0433) from staphylococcus aureus mu50 at 2.05 a resolution
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
194
structure length
187
Chain Sequence
EVRSQATQDLSEYYKGRGFELTNVTGYKYGNKVTFIDNSQQIDVTLTGNEKLTVKDDDEVSNVDVFVVREGSSAITTSIGGITKTNGTQHKDTVQNVNLSVSKSTSVTSEYYSIYKEEISLKELDFKLRKHLIDKHDLYKTEPKDSKIRITMKNGGYYTFELNKKLQPHRMGDTIDSRNIEKIEVNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Superantigen-like protein
publication title Crystal structure of a superantigen-like protein (SAV0433) from Staphylococcus aureus MU50 at 2.05 A resolution
rcsb
source organism Staphylococcus aureus subsp. aureus mu50
total genus 55
structure length 187
sequence length 194
ec nomenclature
pdb deposition date 2010-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3o13A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3o13A01
1S5ED 5TSSA 1KLUD 4RHSA 4OHJA 2WV6D 1TY0A 1LT6D 3R2IA 1FNWA 1JR0D 1PTOC 5ELBA 2RDGA 1LTID 1PYWD 4UDUC 3R8BA 1S5DD 1SE2A 3W2DA 1XXGA 1XTCD 3CHBD 3O13A 1UNSA 3R2TA 1HTLD 1KLGD 4Z9CB 1I4HA 1TS3A 1TS5A 1V1PA 3MC0B 5ELFA 5I4DA 3GP7A 1PRTC 4BWGB 1CQVA 1JWMD 1I4QA 1JWUD 2AQ2B 5D3DA 1RCVD 1I4RA 1HQRD 4K6LA 1TY2A 3V05A 1UUPA 2ICIA 2J4XA 2R61A 1FNVA 1LLRD 2QILA 5ELEA 3DWAA 4O1NA 1FNUA 1JWSD 1BCPC 1M4VA 2G9HD 2AQ3B 2AQ1B 2CHBD 1L0YB 1HA5A 2IPKD 1DJRD 1CHPD 1AN8A 3URYA 4RCOA 1B44D 2XN9C 4NZLB 1CHQD 1PTOD 1JCKB 1YN5A 1PZID 1SJED 1MD2D 1LT4D 1S5BD 5ELCA 1DYQA 1LTAD 2XRSD 1LTSD 1JQYD 1EU4A 1D6EC 1HXYD 1RF2D 1G8ZD 4DXGA 2Z8LA 4RGNA 5FKAC 3SEBA 1I4XA 1V1OA 3BZDB 4C56C 3KLSX 5D3IB 1PRTD 1I4GA 1ENFA 1LTGD 2RDHA 1GOZA 1BXTA 1CT1D 1B1ZA 1LT5D 1KTKA 1PRTF 1RDPD 1CK1A 1L0XB 1PRTB 1LTRD 1EEID 1D5ZC 2O2LD 4RFBA 3BYTB 4ZYSA 4RGTA 4RGOS 1BCPD 3DWQA 4DXFA 1STEA 3BVGA 1BCPF 1PTOF 1S5FD 1SE4A 3TSSA 1EU3A 2XNAC 1BCPB 1PTOB 1I4PA 1TS2A 2XRQD 1SBBB 1F77A 2SEBD 3MFGA 1PTOH 2TSSA 3BVZA 1D5MC 1SE3A 1LTTD 4RHRA 1YN4A 1EFID 1LTBD 2IJ0A 1ESFA 1EEFD 1SEBD 4RH6A 4L63B 2QEJC 1SJHD 2NTSA 5ELDA 1QILA 1AW7A 1ET6A 1D5XC 1ET9A 3DWPA 1SXTA 4RGMA 1T5XD 1FGBD 1S5CD 3EFXD 4L6TB 3EA6A 1FD7D 3BVMA 1LT3D 1PZJD 5FK9C 4TSSA 2NTTA 3OWEB 3BYYB 1TS4A 1YN3A 1LO5D 1V1PB 1EWCA 1PZKD 1RD9D
chains in the Genus database with same CATH superfamily
2JSVX 3RNUA 4G57A 2MO0A 2MBEA 1WJJA 4G50A 2IO1B 3ZGZA 2R7FA 2KBNA 2CH4A 1WCMB 2D07B 2EMTA 1TY0A 2LXJA 5EBCA 3NUCA 1N9WA 2UUAQ 4FO2A 2O6VA 1SRUA 2BCOA 4OONA 3MEHA 4DNRB 4A3EG 3U7ZA 3PT2B 1TKGA 2FAZA 2DY8A 2MBBB 2LS01 1PUTA 1MHXA 4KLKA 5ELNA 3HVDA 4V190 4AQYQ 4G11A 4E74A 4GLXA 2KJ6A 4BVUC 3BDOA 5FR6A 5ELFA 2ASBA 3HOUH 3GP7A 1PRTC 3HFZB 4BWGB 2I38A 3NS8A 3ZW3A 1MHWC 2M00A 4C3IH 5CHFA 3VRAB 1O7ZA 4P75A 2KC1A 2CKHB 1NBFC 1IW7D 4A93B 2LGDA 1TY2A 4YSXB 2CFMA 4X3TA 3PIOA 2KJXA 2OEDA 5BYSA 2WYQA 5EPJA 2DAJA 3LX0A 1RHPA 4MM3A 4LF5L 2QGQA 2E2IH 3A4RA 4CJ2C 2LD9A 1QF6A 1VQGA 2HJ1A 3JAME 1NNXA 1XO3A 1IBKL 1SE8A 1AN8A 4JG2A 5CC4A 2NVXB 4OW0A 4RF1A 1RLFA 5IGGA 3OJ3A 3A9KA 2WIIB 3CPWA 3AEFB 4MNOA 1TU2B 4X3KA 5DM63 1AFPA 2NN6G 1QKZA 3TZUA 2QIEB 3NS1A 3NUHB 1EYGA 3PO2H 1FXIA 3FVQA 1XJVA 4A55A 3G6EA 4YWGG 3HOXH 1KL9A 4KI0A 1XLNA 4JWSC 2M17A 3PF5A 3IAYA 3JAMi 1VZ6A 4POGA 4IO9A 3VTWA 3VVWB 1BBWA 1X6OA 1V8CA 2JXTA 3N30A 2MHVA 3KLSX 4ZQ3A 2ZCBA 3HM6X 2W9NA 2WXJA 4J6IA 2UUAL 1A3UA 3V3XA 1NDDA 5IGCA 2DZKA 1UWVA 1R4MI 2F0MA 1W6JA 3K7AB 2L1BA 2K6AA 2WXGA 1P1AA 2KWCA 2ZTEA 4A3IB 4E3CA 3NHHA 4AQYL 3P1HA 2MA9B 4G0NB 1WRDB 5IT9L 2CHXA 4C7ZA 4YL8A 1D3ZA 4NMZA 3ML9A 1XQQA 2HJ8A 2JYTA 2N9PC 2K9XA 2YEPF 1L4DB 3K9OB 2KQ7A 2QSDA 2Q2UA 1H9KA 4AJYB 1F77A 1E8ZA 3KF6A 5EE1A 2JN4A 3A8JE 3ULJA 1EEFD 2A68D 5CV4A 2NYZD 3ER0A 1FXTB 3DCGA 4MGZE 3WAPA 1EOTA 2ZJDA 4G7ZC 2L0CA 2OHFA 3NZUA 5IP9H 1T0QC 4DK6C 3HRDD 3A54A 3VH4B 4O42A 3J81c 4FHJA 1WWTA 3KYCD 3SDLC 1PZJD 3ULLA 3L7ZC 1M1KC 1VQIA 1EYDA 3WANA 2REXA 1YN3A 3C1FA 5IAAC 2PVGC 5H92C 1OXSC 2Y0SG 4MSQB 1E7UA 3B6YA 1K0RA 2D0OA 3QARA 1EY9A 1X3PA 3S17H 5DPSA 5CORA 2K8CA 1DOKA 2JA5B 4DKAC 1LT6D 4BXXH 3X0WA 4EKUA 3MXUA 3T3OA 3A1QA 3MJWA 4B0MA 1IYFA 2TMPA 1IYUA 1WFQA 1GUWA 3FKIH 2KLCA 1HQMC 4IURA 3CAMA 3VUYA 1GVPA 3E9IA 1EUVB 2WAQE 3LDZE 4XDCA 4MEMA 2AKWB 3AMUA 3FPPA 2I5LX 1HZ5A 2JE6I 1WJ4A 1IKMA 1EQTA 1K8MA 4J15A 1DOLA 5M3FG 2R92H 2JA7B 3HP3A 5I4DA 3Q0AA 4DK3C 2J42A 1V80A 3D4DA 3U9SA 2KHIA 3B9JA 4IWQA 5M3MB 3L9AX 5LL6S 4A3MH 4BBNF 3N32A 4C7YA 2DY7A 3QAQA 2Q8TA 1S1QB 5IOIA 1JOOA 1HNXQ 3FILB 1C1YB 2PCFB 3GZNI 5BR8Q 1MHHE 4XXEA 3F2CA 2KD0A 3PV1A 1OXVA 2F0NA 4EUTA 2R7ZB 4K1RB 2BYTA 5I9OA 1O80A 2PMVA 1KRSA 2PQEA 2WXOA 4KV6A 3P20A 4EQPA 1SAPA 1FIQA 1R4NB 4PS8A 2K50A 5EKKA 1LT4D 1YVCA 2KMAA 3J7ZC 1SFOB 2L83A 2LHEA 3RD2A 4PMCA 1K83H 1GC7A 4HIOA 3N6RA 4R1JA 3CCSA 3NBHB 1SNQA 2B29A 1WI0A 1I4XA 1E3PA 3OJ4B 4ZHOA 3DWMA 5EE3A 1NE3A 4WRDA 5GXGB 2AMCB 4IPCA 1PFSA 4OGQC 1U5KA 4ZCKA 3TS0A 1KTKA 3R66C 2XTIA 3UQBA 3NWSA 3VUWA 3ZTDA 1GUOA 3I4NB 1WGKA 1HZBA 4DR7Q 1ZPSA 2F3VA 1T6BX 3AI5A 2V4IB 1T9HA 4RGOS 1E7VA 1UEBA 2GVBA 2PO4A 1JJ2A 4DV6Q 3S2DB 4F7XA 3KBXA 2K6QA 1GB4A 3KLWA 1S5FD 1ZXIA 2K75A 1SE9A 2M8SA 5L37A 3KYDD 1BCPB 2WDVB 4BY1B 1MG4A 4L5QA 1UGMA 1HNXL 3QOLA 2JXXA 2C60A 4HJ8A 5ISRA 5BR8L 1V9JA 1F9SA 3JVZX 1Y1WB 4II3B 4RKLA 2J0JA 3OG5A 2MH7A 1BVSA 4S0RA 1SYDA 3PSEB 4CQNA 1WJ6A 1F9QA 2FIFA 2CU3A 2N7EA 3JYUA 1Q46A 1IBMQ 2BWFA 3ML8A 4DF7A 1OFFA 4DK5A 3C2PA 2LUMA 4DDID 2LFIA 1OEYJ 1UE6A 4A3OA 3GV3A 5IYDG 2O2VA 4FHKA 5J18A 2H89B 2RHSB 2RSOA 2C7MB 4K7WA 1I3QH 4LAAA 3BYYB 4LUVA 2IT1A 3DMUA 3H0GB 4B6WA 2YYZA 1C4AA 2CW0D 2Y5BB 2ZPNA 2K5DA 3CF6E 1C0AA 3Q23A 3L16A 2NUCA 4BOSC 5DEHA 1LABA 2Z9HA 1PH2A 5KNDA 1V81A 3AH7A 2EYHA 3EVQA 1G2TA 3B0AA 2UU7A 4DR7L 5C4HA 1QVGA 2X8XX 2PW9A 4P73A 1IPGA 5FJ8H 3S16B 4GKKQ 3DBLI 1ZW7A 1QZHA 1EO6A 1WX8A 4KN4C 5JVG3 2PJHA 2JUOA 4HMJA 2FNJB 2E76C 3S1NH 4DV6L 2D10A 3W5OA 3A33B 3ULPA 1IYVA 3QB3A 2MUYA 2L7RA 4YSZB 2WFWA 5G2NA 5JH5C 3QQ8B 2L32A 2R2QA 1JWMD 5C4XH 3MVVA 4N58A 3QOJA 4LFCQ 2KJHB 1SMXA 4A3BH 1V6EA 3P4PB 2K52A 2NVTB 4RNAA 5KYLA 3AE4B 3GV6A 3T16A 4Y7NH 2QILA 2WWZA 4KIKA 3X3NA 5C0XG 3HOYB 4DQOC 1IBML 1JWAD 1LGRA 1YQBA 4MT5A 1FNUA 4GOPC 4DR4Q 3TL5A 4WURA 4OZBA 1CHPD 3KLRA 3DLLA 3NP8A 4DAYA 1U4AA 2AEHA 2G4DB 4LNIA 2IZVB 2IL8A 2PQAA 3GTMH 3O65B 5C44G 4A3GH 2BYFA 2I5HA 1YJ1A 2KDBA 1MJEA 2BT6A 3KVFB 2NBWB 3G48A 1MIUA 1TQOA 1JQYD 2PKOA 5KHQA 1Q8KA 2UXDQ 2Z6BA 4DU9A 2F0LA 4K2LA 4E6IA 4C4VA 4XQJA 2NBFA 3B1LX 2WS3B 1PRTD 3CXCA 4OO1I 1K8OA 4GSWA 3HEJA 4DR3Q 4DAPA 4GKKL 2AUJD 2B3AA 2Q2HA 3A7AB 3QCAA 2K33A 3HKZG 4B9WA 2B2VC 3CMMB 3G4SA 2BWES 1ZUD2 5KYIA 3M3JA 4JCVE 3K7UC 5CV6A 1AZQA 2YU9B 1YOVB 2K0PA 4HEA1 2F0IA 4TQ0A 4DXFA 3Q6SA 4KKSA 2IO3B 2RMMA 2AHOB 3NTIA 2WXMA 4HJGE 4HWIB 3ZLZA 1BCPF 5HGQA 4XIGS 3U4VA 3S1MB 2NPTA 4LFCL 4R8IA 1RM6C 4HEDA 3KWVA 4WJOA 2EYOA 1SNOA 1XPOA 2BGFA 2ZVOA 3ZNGC 4X6AH 3HOUG 4B9XA 3NE5B 3TBIB 2KZRA 3KJOA 1MI0A 4C3IG 2QF7A 4DHJB 4G7HC 2J0KA 3I4MB 1R9TH 4DR4L 1UZXB 5BMIA 4IPGA 3OSOA 2KT7A 4K8IA 1AW7A 4K0KQ 5J3BA 2YVCA 4N59A 4MGIE 1FYCA 2EQSA 2K39A 1Q12A 1L6VA 3CKIB 2J7ZA 3T4AC 3DWPA 1GKHA 2B63B 3EBEA 2V4LA 5GROA 1ENAA 3BZKA 1WXMA 4FF4A 3EA6A 2YTYA 3VR2A 1Z5SB 2IGGA 1GO3E 1XNQQ 1XYIA 4I6PA 4XC2A 5FK9C 1Y69U 2LWPA 2UXDL 5BN4A 2IX0A 2EOTA 1YHBA 3K80C 3HOXG 1PZKD 1QB5D 1SNDA 3M4QA 3OIPA 4BBRH 3S1RH 4Q5VA 2C9WB 2EJFC 3WIMA 1WM3A 4DR3L 1QT9A 1C9OA 1SSOA 1F52A 2K1FA 3CCJA 1SIJA 4A3FB 3PRZA 3GTGB 2WNMA 3P42A 1HUNA 5I6WA 1GG3A 4I6NB 3K81C 3I5JC 5LHY1 1EWYC 5HGTA 5DPWA 2K1BA 1FJGQ 2MRPA 1DM0B 2MBQA 1ASZA 1KDAA 2KCCA 4JOIC 4AYBE 3MAQA 3EFCA 4MELA 1SNPA 1EZ8A 3NTHA 1KDCA 3NEMA 2LFNA 2MJ3A 3PUZA 3FC4A 3GE3C 5L95C 4KZ0A 2KVRA 1BNZA 3F8TA 5JHBA 4TUUA 1E2WA 1PLFA 4R4OA 2F4VQ 1Q1OA 4UP9A 2KJRA 3PO3B 4DR6Q 2IDYA 3L17A 5CV8A 3KF8B 4K0KL 2HE7A 4DDGD 3SHLA 3U58A 1UBQA 2PZTA 2ES2A 3NZSA 3AE7B 4NB3A 1A62A 4ACFA 4BA2I 2XGTA 4KKIA 4NJ7A 5MPOA 1WVLA 2N9XA 3WALA 5D65A 5IP9G 3CC7A 1XNQL 5LLIA 1RTOA 3RT3B 1IBLL 4HIMA 2ZXRA 5FO8B 5HKHA 3AM9A 3WWVA 3N1XC 4TRDA 3HOVG 1Y8OB 1CJEA 2RSNA 2A8VA 3I63C 2Z8LA 1AEXA 4DV0Q 3TCAA 2L76A 2PI2E 2ASQA 2EJMA 5C23A 3V96A 1X56A 5C4JB 4FF3A 1YIWA 3N1YC 1RDPD 1QCBD 3NRZA 4KDIC 4PT5A 4HDQA 4WWNA 1VQ7A 1FJGL 4BXXG 4CKBA 3BDCA 4ZYSA 3VUXA 1LTLA 1L1OB 2YU9H 3FKIG 2A69C 2L8JA 4J8QA 5EJWA 1QNUA 1VQAA 3HOZH 3MXNB 4LNOA 3U7DA 3GTQH 1XT9B 2XNAC 4B3SQ 3X23A 2V4DA 3RZFA 4AIMA 2R92G 4UP7A 3U4EG 2F4VL 3ZXRA 5HHDG 2PIAA 2LMCB 4DR6L 4BKTA 4PZ6A 3U2SC 4O2DA 5C3EB 2JA8H 3VR3A 4A3MG 2QEJC 1GUAB 1SJHD 1VRAB 2XWBB 4KHVA 2W54A 5FO7B 4YWLA 4LMQD 3M7GA 3DBHB 3MTSA 4DUYQ 1EYAA 3CCEA 2N1VA 4X3SA 4W9GA 3QR8A 1HPCA 5D2MB 3UF8A 1JB3A 2JPHA 2EDGA 3D32A 2Z0SA 2HTME 1HTQA 1HNWQ 5HI1A 1I50B 2EYMA 1O7YA 1K28A 1TT5B 5IE8A 1EY4A 3E0EA 1CMXB 2CJOA 4IPHA 4DV0L 1TS4A 2LJ5A 4FJYA 2LGXA 1IYJB 1DCZA 1V1PB 2EY6A 1V1QA 1VMCA 2DWQA 2M0XA 1BBUA 3ZXVA 5TSSA 4IALA 3ND8A 1WE6A 1FVIA 3EROA 2E5LQ 3V62A 1K8AC 1Z47A 1R4QB 4RHSA 2WB1G 2EY5A 2F0UA 5ELBA 4C3JB 3KYHC 1LTID 4PYZA 3T8MA 5C3WA 4A3LH 2FUG1 4IG7B 2QDLA 2E2HB 1C77A 1K8GA 1BUIC 2XSCA 1PQSA 4JC0A 3AEBB 1A2UA 1UNSA 2DN8A 4ME3A 2CU1A 4A3DH 3P2BA 4GKJQ 1BT0A 4II2B 1SROA 4W9IA 4IDIA 2KHSA 4B3SL 2N7JA 4YTMB 1WGHA 2MW5A 4GN4B 4C1NI 2Q2TA 4WIPA 1DOYA 3MHBA 3TJPA 1C4CA 1D1IA 3DXJC 4YHHQ 4A90A 1YNXA 3CF5A 1YI2A 4B3MQ 3JSVB 1EIGA 2BDOA 4PV1C 2D62A 2MPMA 4DUYL 1S3SG 1L0YB 3RR5A 1TWCH 2UUCQ 1N32Q 2BPSA 4GN1A 1M8AA 2PYKA 4P72A 2OCEA 2E3TA 2FMCA 4QUCA 1K8RB 1F9RA 4WJPA 2RQXA 4RCNA 5DLQE 1HNWL 4GNXB 4IC7B 2VXWA 1SF0A 3AV8A 4LF9Q 1YNJC 2ZJPA 2ICEC 2R93B 3J9CA 2JWUA 1DXMA 2E5LL 4XDDA 2V3PA 2JU6X 2PEAA 3M85A 1ESRA 1WZ3A 3CC4A 1WTQA 1IL8A 4JBWA 4A3JH 1AYFA 2D3AA 2KLGA 2B2WC 3D3RA 2LXKA 3OPOA 2Y0SE 3MXGA 4HCNB 3VA7A 2LZ6A 4KK7A 2O6VB 2KKCA 5AZGA 1WF9A 1UE7A 3LXFA 3D6WA 4L1BA 1B7YB 5JPMC 4GKJL 1WTXA 5FJ8G 3PGZA 4PMBA 1GC6A 4FULA 4FNFA 2IWHA 2RDBC 3IFDA 2GBNA 1G6PA 3HZXA 3TEXA 2WAQB 1EIFA 3K5MA 2IY1B 3G7LA 3M95A 5G5HA 4IQZA 2L0FA 2ZNVB 4XWTA 4YSYB 5GMVA 4IJLA 2HT1A 1WTRA 2BB6A 3PMFA 2BYEA 4CYEA 1U9RA 1SN8A 4YHHL 1KABA 4JI2Q 5C4XG 4ZUJA 3E6ZX 4B3ML 3KUZA 4JWUC 1XX8A 1WTPA 3JW0X 3CU7A 4A3BG 1KXLA 1N32L 1Y1VH 3GTOH 3FDTA 4DWFA 3Q8EA 1AARA 4MM3B 4LJZC 4YTNB 2DENB 3HHMA 4IM0A 4M0WA 1D5XC 2KA7A 3T1HQ 2NS5A 2BA1A 1P7FA 3SD5A 1NSNS 4F8MA 4XQNA 4MGYE 2YTVA 3A9KB 4LF9L 4WAAA 1ICWA 2QJLA 3ZNHB 2KAJA 2LRUA 4IZ8A 1Q8IA 1L6UA 1YX6B 1CKOA 2G5DA 3R93A 2WXPA 3CCMA 2I07B 4A3GG 3PHWB 2IGDA 2WDRB 4EQNA 3PIO3 1J9OA 4ZAIA 1MVKA 2H88B 3RNGC 4F8CB 1FFUA 1XCQL 3L4PA 1DGSA 3I2ZA 1VCBA 4HSVA 2C5LC 2ZNVC 4DUZQ 2WX0A 1WE7A 2KO3A 4XDXA 4WH4A 1J8CA 2YTXA 2OQKA 5EQ0A 2HD5B 3M4OH 5D7GA 4HPPA 3DEPA 2D9UA 4NKLA 2NVYB 1HJPA 5NUCA 2E2HH 3CIRB 2EXDA 1KLGD 2EKIA 1SYBA 2MQHA 4DHZB 2QHOA 1NMFA 1PFBA 4OIJA 1I4QA 1KRTA 1DGJA 2MBOA 2MNAA 4IUMB 2KQ3A 2Y5PA 1A2TA 4JI2L 1JMLA 1KLVA 4C3HH 4CKCA 2BH2A 4A3KB 1P8LA 2HUGA 1EQRA 5IGEA 1EWHA 1SR3A 2D3BA 1LM8B 1CKNB 4KY5A 4R4TA 2SDFA 2LXAA 2QMTA 3MJ5A 4MGKE 5G5GA 4ZLTF 3TRZA 2AQ3B 3T1HL 2X69A 2KFKA 3OMCA 2LSSA 4UPAA 1S3OA 4GN3B 3J7AF 4I65A 2A19A 2CVRA 1CI3M 1ISNA 4IUTA 3I91A 3WOFA 4BBSH 3UIOB 3ZNZB 2B39A 2KQ4X 4MHEA 3SR1A 3IAM1 4J6HA 4KHPQ 2Z4HA 3CCLA 4DHJD 1H95A 2DBYA 3GB1A 1HXYD 5DM73 3P75A 1G8ZD 2K5NA 3PUYA 4K14A 3SGIA 4DXGA 2E2JB 2R93H 1EIHA 1Y8NB 4DUZL 1ENFA 4KMUC 1GOZA 2NBUA 2ZT9C 4BBRG 1EOVA 5CGKA 3S9WA 3K59A 3BWUD 1S72A 2V0GA 1MBYA 4W9DA 2VUMG 3N20C 3BY4B 2BF8B 4WJWA 1KJTA 3MC9A 2UU9Q 3NQIA 3PRMB 2PVOD 5C3XA 1SYCA 1B8AA 1V5TA 1HE8A 4IW0A 2O5JC 5FLXL 1RRBA 4POFA 2WINB 3ERQA 3K8AA 5J1ZA 4DFAA 1ICFB 2Z1CA 4H7BA 3GTPH 2VNUD 4BY7B 4QCLA 4BKGA 1SE4A 3MHSD 4MTKA 4M8AA 1A3VA 1E7PB 5BMGA 1EU3A 1PTOB 4HJ9A 4D2KA 2K28A 2MBHA 1KAAA 3FMCA 1R4NI 5G3LD 4HJ7A 1CZGA 2D11A 2K7VA 3KOJA 3AE6B 4OX9Q 3HS0C 2ZJQA 3SK4A 4L63B 1N33Q 1B50A 2F0JA 4EE2A 5E6PA 1IBXB 1WI5A 2NTSA 3U9OA 4QF4A 4MJSA 1N62A 4DAMA 2WACA 1YBYA 4HLEA 4BBNC 1PH9A 1AZPA 3DBRB 2MJEA 2RPQA 1T5XD 3ECIA 2AL6A 2IHFA 4FN2A 3S1QH 1KF6B 4KHPL 2JRHA 1E1TA 1GHJA 2IX3A 1XPRA 1F0ZA 2G9DA 2F0HA 2BH8A 3PRPB 3MC8A 1HZAA 4LNQA 1C76A 1FPYA 2SNMA 4DK0A 2K3UA 3PUWA 1N5WA 1TKYA 2K03A 1E9MA 4L23A 1NYRA 4HVBA 4US8A 4NQKE 2A69D 3GDEA 3PZDA 5J22A 4NPNA 3EN2A 1QZGA 5M5XH 4APVA 1HFNA 2EELA 2KMCA 1ACCA 5C5MA 3OTOQ 1AP0A 4OHJA 2Z4IA 5H8YE 1KC8C 2MEKA 3I3TB 3AFPA 1PTOC 3P1MA 4NAWA 2C9OA 2UU9L 1WD0A 1NVID 1FD6A 3KQ4A 1P0RA 1ZKOA 1H9SB 4ZRKA 1XTCD 1TJEA 3CCVA 1F2LA 4LWCA 4R4CA 1MJDA 1B9NA 3HKZE 1OGWA 3S14H 3Q69A 3V6EB 2BS2B 2R3ZA 1TWFB 1KQSA 2IX1A 2FE8A 3ONSA 2F0VA 1QNKA 2WKCA 3ZYYX 4RWSC 3HOZG 1PH8A 2VS1A 5IGDA 4OX9L 4NAMA 4IPDA 4NNJB 1N33L 4RM9A 4BAXA 3OAWA 1WTHA 1K53A 1BDOA 1EQQA 1Q81C 1JWSD 3R3MA 1WCMH 1JW9D 3RNFC 2J52A 4KN7C 4XE0A 2JA8G 3TMPB 1E2VA 3CMAA 4GDKB 1Z9FA 3ZTCA 4K3CA 5IT9E 4C2MB 1V43A 3PIPA 2PNRC 4K6DA 3OWFA 2BDNA 2JP1A 3DHHC 1LTAD 5M5YB 5HG2A 3S15B 1VQPA 2LVQA 2O4XA 2PW5A 3SVMA 3AE1B 3QK0A 3Q6BA 1N8RC 3OOCA 3E56A 5JEAH 1I94Q 4QQBX 1WIAA 3OTOL 1PDQA 3WA0A 4P1BC 3V2TA 4W9KA 4NPSA 4A93H 3Q14C 3UINB 1A8VA 4LF6Q 4OVVA 3VRBB 1CK1A 2B2YC 3PUVA 3RI7C 1EUJA 2RD0A 1LACA 3IKJA 3CCUA 2OF1A 2NVXH 2A4ZA 4A3LG 2MCNB 2Z6KC 4IJHA 4XYCA 2LGIA 1RWSA 4HKZE 2EY1A 2WDTB 4KSLC 1RYJA 1STEA 3VR8B 4K5WA 1PTOF 5A35A 2W55A 1G51A 1IL2A 3NJTA 1VQMA 1PGBA 4A3DG 2GN5A 1BF4A 4AYBB 3NVZA 3A9JB 1PTOH 5D6JB 1YJWA 1Q3LA 2LY7A 1YN4A 3VR5A 1YNJD 4RMAA 3MZ5A 1EY8A 2F0KA 3AU4A 4KIKB 1VQ4A 4M02A 1QUQA 2PPHA 2XK5A 1E8XA 4PYUA 3N1ZC 1X54A 4Y52H 1LM0A 3K7AH 1J19A 3LGJA 4DHZE 4A4IA 3AU7A 2F03A 4LFAQ 3E3XA 3J7A5 1JALA 1DD2A 2HCIA 4A3IH 1PH5A 3KW5B 5CV5A 2F1MA 1R7SA 2DX5B 1QQRA 2KACA 3OWEB 4X64Q 1MKHA 3Q22A 1I94L 1EL0A 1JT8A 1TWAB 1KD1C 3DVNU 4C80A 4RMFA 2NB0A 3DDCB 1K51A 2MO1A 4OO1G 2DUDA 1XTDA 1WTOA 1KLUD 1WYWB 4HXDA 4C4VB 3VAWA 2H1EA 3RZWC 4R3DA 4ZYNA 2JA6G 4LF6L 2DJFC 1EY7A 1JR0D 1D1KA 4IUUA 5C0XJ 1V97A 3AB9A 4A3JG 1XNRQ 2N0SB 4LDTB 3S24A 4WJNA 3RPFC 4EFOA 3F2UA 1J6QA 5AZFA 1IP9A 1IGCA 1STAA 2Q8IB 4JV5Q 4RAUC 1VQEA 1ZEQX 1TS3A 2KX3A 1TS5A 4EVOA 2F3IA 1VS0A 2H5XA 1TWFH 4JGHB 1A63A 1H9RA 2HDLA 2RF4A 2NPTB 2AQ2B 1OQQA 4A3EB 5K36G 1WJNA 1MPEA 4IUQA 2E2DC 2KTRA 1STYA 2R61A 2KTFA 1TZ1A 1XF5L 4DR5Q 1TWGB 3TEWA 2DNCA 3CC2A 1JC7A 1QZEA 1O7LA 3APCA 1E0BA 1BCPC 3RCZA 3TBLD 5IP4D 4JBMA 2JA5H 3GD7A 1WFYA 5JJKA 2QKIC 4P16A 4RCOA 3UDGA 4LFAL 3W5UB 1Y1VG 1QOBA 3NVVA 2F0DA 3RLFA 2KHWB 3FKYA 5JJZA 4IOAA 1KAWA 1WX9A 3TQYA 3HGBA 1G6JA 3CRKC 3DVGY 2DYMA 1NJIC 4JIOU 1Q86C 1JE5A 2FJ2A 5M5YH 2K5WA 2JA7H 2WP9B 1X3QA 1RF2D 1ROEA 3FILA 4RGNA 2NVQB 3PTFC 4HSPA 3RNAC 1E90A 3P4RB 1RODA 5M3MH 5BMHA 3MTNB 4JW0A 3KDFA 3FEWX 4XX5A 1BUVT 4EQOA 3I8ZA 2L0TA 3H15A 1XNRL 4ANXA 1WTVA 2K14A 2R7ZH 1VQHA 4JV5L 2WB1E 3W1SC 3M9BA 1KNAA 3K0XA 4HR7B 4HTHA 3HOWG 5JJIA 2KK8A 5T8IA 1E5WA 2F0PA 2K22A 4A3PA 3E0JA 1NAPA 3GZNB 3D8GA 4JBJA 1B4OA 3NVWA 3K6OA 2WLBA 2ZTCA 2GBJA 1HZ9A 1UEAB 1SFOH 3Q8FA 1TWHB 5HY6A 1QVCA 1I4PA 2OT2A 4LF7Q 2SEBD 2CHZA 3KUDB 1QJOA 3H7PA 5K5PA 4DR5L 1CZPA 1L4ZB 4XZ4A 4NQLB 1SEBD 2HTHA 2WU5B 5M5WB 1JOQA 4F7ZA 4C3HG 2W82A 5BN5A 1OXXK 4DV7Q 4I7AA 3QX1A 4Q2JA 3I56A 2LRWA 1V49A 3SK5A 3NTKA 4WQMA 4DV4Q 1KNEA 4IOCA 1PYSB 2MJ8A 3I4NH 1BBXC 1T0RC 4JBKA 4RA8A 2SAKA 1CA6A 4UAIA 1J7AA 2OXPA 1JWBD 5C1ZA 4BBSG 3BU2A 3UI3A 1F2ZA 3S2DH 4NDXA 1VQFA 2X38A 2OTLA 2B2TC 1NENB 3VR9B 1GUGA 4REZA 1PH3A 1WR1A 1HRJA 2CHWA 4EX5A 2NZ1D 4MIUA 1F2YA 3B08A 4X66Q 4BY1H 4PS7A 3A8IE 1BO0A 1FGUA 3BZCA 2RR9A 4ZRQA 5FLXc 1QOGA 2XWJB 1Y1WH 2RDGA 3NENA 1Y56A 4NW2A 2VQEQ 5IYBH 5JOBA 2N8NA 4KKTA 4BKSD 2QEXA 2WGSA 5AFWA 3AMZA 1YZ6A 4A3CH 3J81j 2EXZA 2I1JA 2BS4B 2FIDA 2Y0SB 1HCZA 3BS1A 4FF2A 3RNCC 3DVNV 1ONLA 1I4HA 3U50C 3PHXB 3L10B 4GOPA 5JJLA 1B9MA 2I0QA 4LF7L 3DBHI 5LXHA 1JWUD 4P2CB 3PO2G 2WHIA 3W1GA 3CSTA 4IFDH 1H9JA 3K58A 4FYDA 3GE8C 1SIFA 2KCNA 3H0GH 4KGTA 1B53A 1U4PA 5I9PA 4DR2Q 2BKFA 3K9PB 4RF0A 4O1NA 3RULA 4KJOA 1B9RA 1D4BA 4DV7L 1YJ9A 4GLAC 1J5EQ 1M4VA 1E8YA 2CHBD 3E5SA 5IT9c 5M3FB 4LF4Q 4DNIA 4DV4L 2B2UC 4ZUIA 3S2HB 1DJRD 3URYA 1XLQA 2INCC 1MGSA 2RCNA 1HNZQ 1WGRA 3NHEB 4GDLB 5JZEB 5A2QL 1FO4A 3S16H 1R4PB 2V1YA 1PTOD 2WU2B 3TP6A 1OO9B 5EE0A 3MHZA 3W1BA 3VA5A 4L5TA 2XRSD 2FCSA 2RKSA 4DXAB 1JROA 3VYUA 4B08A 5LMNW 2WP8J 2B2VA 4OELB 4EEWA 5C6AA 2INNE 4X66L 3Q8DA 4DN4M 5D3IB 3IAS1 1XLOA 1I4GA 2PMZE 4R9WA 2NVTH 2VQEL 3MEFA 3ZKJC 5LMNQ 4YTPB 3ICEA 1QG7A 3HOYH 2CJNA 5C2TB 4LK1C 2ON8A 5EE9A 3RZDB 1NTGA 4EOYA 4YWKA 1WYDA 1VQJA 4DNTB 2A6HC 3BG3A 5CYUA 3ETRA 4K81A 4W9CA 4A6QA 4ZKBB 2VZAA 5KNBA 2DHZA 2ZPYA 1H8CA 4IWPA 1SDFA 4CJ1B 1F1HA 3A8KE 4N8X1 2O5IC 1WGYA 3K5OA 2HDMA 5KNCA 1TS2A 1TWHH 3ZQ4A 1K9MC 1N36Q 2YLMA 4DR2L 3Q3NC 3KH0A 1ILPA 2ZM6Q 4HJKA 5I2XA 1J5EL 4ARCA 4LF4L 4DR1Q 4NXMQ 5I2YA 1P98A 2IBIB 1U4MA 1QILA 1HNZL 4ZRIA 4MSMB 4LJOB 3UDFA 2E8GA 4TMAB 3VTVA 1RIPA 2RPVA 2M9VA 2N55A 4XGAB 3M3YB 4CHKA 1VCIA 1WCMG 2KC2A 2K5VA 3Q8AA 2A5HA 4L5SA 4EZKA 1PGAA 1VQKA 4WJ4A 2ZXOA 5C4ZA 3C3LA 4GS3A 3HM3A 1Q5WB 1KRHA 1V2YA 1Z6HA 1GXDC 2PTLA 1ILQA 2ID0A 4Q0FA 2HHHQ 2VZKB 3RNEC 1EWCA 3S1MH 4XYOA 1YNNC 3VFKA 5E3FA 1WJUA 1E24A 4LW1A 1DONA 2N49A 4JOIA 2PZUA 5LMNL 5JEAG 5IO9A 1F2MA 4L8JA 1HTOA 5KGUA 1VF7A 3HKSA 1EY5A 3I4MH 1WXSA 4B95A 2MWSB 1Z2MA 4A93G 1OTRB 3R7RA 1A3TA 1C3TA 2I2YA 1SGHA 3CHBD 2MP2A 3HIZA 2B63H 3M4YA 3ZJTA 1UH6A 4F87A 3A55A 3Q3JA 1CQVA 2WXRA 4WWMA 4URKA 2N88A 3ABVB 3ZRFA 4A76A 4ANVA 3J81L 5BYQA 1ML0D 2MP1A 1N36L 2M2LA 2BQQA 1L1OC 3TMEA 3ZDTA 1GAQB 2ZM6L 2UXCQ 2L15A 1C8CA 1UUPA 2J4XA 1FRDA 1Z7TA 4NXNQ 3P4SB 3PUXA 4US9A 4DR1L 4NXML 2N9EB 4ITKA 2FXQA 4OZCA 4GN5A 4A3FH 2PNHA 3GTGH 1U4LA 2Z0DB 1JE4A 5EDSA 2VL6A 2MHJA 4NZLB 5CV7A 4M0WB 4IUVA 3CQZB 3GTLB 2D3CA 4U68A 2N7DA 3EGRA 1L2NA 3RUZA 1WM2A 4ULLA 1S5BD 3D0FA 3DPDA 3HG9A 1F2RI 3KJPA 5CHWA 2HHHL 4PZ8A 2VRRB 3OW7A 4A3IG 2DZJA 1PXUA 3IHPC 1I35A 1LYLA 1QVFA 4GLVB 3LYYA 3VTUA 1WMHB 4C56C 1FXAA 4C00A 3MFYA 2HDEA 2F0QA 2WQYB 3HOWB 1C79A 1GUNA 2F0EA 3C0RB 4IKGA 1CT1D 2E74C 4HJAA 1LUZA 3OIQA 3AEGB 5C44B 1E2ZA 3PO3H 4GMVA 1L0XB 3NZ3A 2GLSA 3RZDH 2UXBQ 1SB3C 2FCMA 3EUB2 1BCPD 4FF1A 2K5HA 3DWQA 4AH6A 1P7EA 2GBMA 3QC8B 1W2BA 4LF8Q 4LK0M 4USAA 1A6XA 1SYEA 4JX1C 3CSFA 4KY7A 1PHJA 3EECA 4LCDE 3IRBA 4X62Q 4L2YA 1CKMA 4W9JA 5JXVA 2RGFA 3H6MA 2UXCL 3HKZB 1PH7A 4NXNL 1D5MC 2IJ0A 2PPBC 1ESFA 1DZ1A 3T53B 1TKEA 3CRLC 3AXCA 1YJJA 1WR6E 3QIJA 2KMMA 4HDOA 5E6NA 1T3QA 5C4JH 1VF5C 1UELA 3FAHA 1XWEA 1Q10A 4HPMB 2KDMA 2KQSA 1X1MA 1ET9A 2GRIA 2KFKB 2L05A 2F0SA 3UIPB 3D6CA 1ZP0B 1IKLA 1T0SC 2ZVNA 4YCUA 1Q1BA 4H2AA 3MXNA 2JA5G 1S5CD 3EFXD 3AEEB 3HOUB 1YX5B 4W9FA 5IIFA 4OXPA 3A56A 2BB5A 4C3IB 1C7YA 1L5PA 4ALPA 3PZ7A 1YHAA 2LMCA 2KDFB 4A8XC 1RD9D 1ZE3D 3Q3MC 4GNXC 2GI9A 1EF1A 4LLGM 2JA7G 2ACZB 3L0OA 3MA2B 2E2IB 3I70A 3CW2C 5J2RA 5M3MG 2IYDB 3NPPA 5C3EH 4NJCA 2UUCL 2UXBL 1D2BA 1J7CA 3A5ZB 5JAVA 3J80L 1TTNA 2D2CC 1WY8A 2E6XA 2LEKA 3H1UA 3PO2B 4TVAB 1LXDA 1VZ8A 1STHA 3IXSA 1E1OA 5F2DA 4HJ5A 2KUMA 3HOXB 4LF8L 1EYCA 4W9EA 1E0ZA 4QGUA 3F2DA 2R7ZG 3PLVA 1HTLD 4YCWA 2PE6B 4KSKC 3KUCB 3M4PA 4HROA 1V1PA 3FRPB 2CS4A 4X62L 4TQ1A 1C4QA 4AUQC 1I50H 1QWYA 2KDIA 2PLPA 1JOKA 3H6NA 1FR3A 1HEZE 3TIXA 4MTNA 5FR3A 2VB3X 3DBRI 3D4RA 1NR4A 4K6LA 4OEMB 3V05A 3WOEA 3N3KB 4KDLB 4GB9A 4ZOHC 1CSPA 2EY2A 2VH1A 3DWAA 3JC66 3WAOA 2JY6A 2WXHA 4C3JH 3AE3B 1IXRA 4MJSB 2Q5WD 3HK0A 2NZHA 4FBJB 1WXVA 1NI2A 4OIKA 1G91A 2K6DB 4ICVA 4S3SA 1L7YA 4K7UA 1PDXA 1JCKB 3CD6A 1MD2D 5ELCA 2B2WA 4IN3A 1KFYB 1PYBA 2F52A 3I4NG 4K7SA 1TGZB 1W3SA 4LTUA 2R6GA 2LXCA 3M7NA 3WDNA 1OEYA 5HFYA 2NR2A 3SEBA 2G1EA 4OL7A 3DWGC 2VZKD 3U30A 4CDDC 1LTGD 2L5TA 3KF6B 2KXJA 3P4QB 4BY1G 2F0GA 2K5QA 3ONAB 4KJNA 4CDFC 1LQBA 2IGHA 1PRTB 3BINA 4NAWB 3HOVB 2G3QB 1Y1WG 3JAML 2O2LD 4RFBA 1V5OA 3BYTB 3QG1A 2GB1A 4RGTA 5IYBG 2QA4A 1F2RC 1K0SA 1KH0A 4XYQA 2JEAI 4A3CG 3ZNID 5CBEE 4P1CC 2FFKB 3WCQA 4KV2A 1XMQQ 2AL3A 2RSUA 3NWTA 2XEWA 2WKDA 5IP7H 1MG8A 3PS6A 3S17B 1NMGA 1DOMA 1HUMA 5M9OA 5AZHA 1NUCA 3KLSA 3S2AA 3AB5A 2LHDA 1QE6A 1UE5A 5D14A 4RHRA 1ZXTA 1B70B 1LTBD 4RH6A 1HHVA 5AEKB 1BR9A 1L0VB 2K4KA 4IFDG 3PV0A 1YJIA 4JI6Q 1J8IA 4LNKA 3FKIB 1V9PA 3H0GG 5ELDA 2JEBI 5GQOA 2QC8A 1VQOA 1WX7A 4R4IA 4MZ9A 1CFMA 3HRZC 3A1QB 5CTRC 1N34Q 2KANA 2J53A 3AEAB 4OVZA 3VHTC 3V6CB 4BS9A 4RGMA 3IL8A 1YQ4B 5EBDA 4GGQA 2R92B 1FD7D 4RG1A 4ARIA 3TDQA 2B8GA 2L55A 1NR2A 3KWLA 5KRUA 5GAEC 3H7SA 2A6HD 4A3MB 1LO5D 3Q3FA 3ZJVA 4PK1A 1S5ED 4H13C 1F9JA 2OJRA 2LASA 2VW9A 3TEHB 1IHZA 2WXLA 2LUEA 3Q24A 4K3BA 3KBGA 2IO0B 1YJNA 4GXBA 5JHAA 4ZDVA 4KY6A 1Q0WB 1VZ7A 4KKUA 2LJIA 3R8BA 3E9SA 2DJGC 1RL2A 1EY0A 1GHKA 4YIJA 1I42A 2KWUB 4CHTB 5CR3A 4ODGA 3QIAA 4DA2A 3I55A 3PIP3 3HOYG 1WYGA 2CQAA 2LI5A 1K83B 5DPRA 1HFGA 3VYTA 2BW2A 1W6KA 1XMQL 5IKCM 3CPFA 2WB1B 2JZZA 1JICA 3NELA 3I9V1 3H09A 2UYZB 1FM0D 4B0EA 1FL0A 1HA6A 1I4RA 1HQRD 2RHQB 2EYPA 2KENA 2FBWB 5BO4B 3Q8CA 5FOBB 3STBC 4JI6L 5ELEA 4KD4A 5CX3A 1I7HA 2KCMA 1YNND 2LKVA 1JB7A 1VQBA 2IPKD 1N34L 1IZ6A 5FLXE 4WQOB 1QUQB 4KD3A 5L83A 2XK5B 4AP4C 2YV5A 1FRRA 2G4SA 1YN5A 2IHEA 4GLSC 1A0IA 4W9LA 3AE8B 1GJZA 4MH8A 2NVYH 1MJCA 2Z59B 2EE1A 1UBIA 4H44C 2OJWA 3FP9A 1CKNA 1B3QA 2B76B 1XMOQ 3D31A 4RM8A 3IFTA 3SHQA 3DBSA 5T1IA 3BDLA 2RDHA 4X57B 4A3KH 2OEOA 3V61A 1PRTF 4XWWA 1TKWB 2L52A 5T1GA 4IFDI 2V3SA 3RFZB 1STNA 3V60A 1EEID 3UQAA 3HOVH 4LUZA 1X65A 3N52A 1NY4A 5IYCH 4HIKA 1VMPA 4UY8C 3I4MG 4YT0B 5AUKA 4BKSA 4L5RC 1F9PA 1I3QB 4PG3A 3DUZA 1QLBB 3BVGA 4ASWC 5C3JB 3KUPA 2INDC 5BN3A 1CUKA 1LV9A 1PH1A 2B63G 2C7NB 3TSSA 2O2VB 3RNBC 2E75C 3G6JB 1OXUA 3IT6B 2EYJA 4HIDA 1A70A 3AFQA 2E2JH 2A74C 1SE3A 3ZJYC 2CKZB 5EPKA 1CSQA 2DYOA 1GD7A 2KTRB 3NVYA 3ND9A 2BA0A 4PMWA 2CR5A 2L11A 4ABNA 3CCRA 2VH2A 4UP8A 1YITA 3PZ8A 1HH2P 4QIWE 4B3RQ 2C35B 1Q90A 3QWZB 3ZUNA 4IM2A 4MH0E 3S1NB 4JPBW 4FXGC 4JK1C 1EF5A 3EFUA 4HAEA 4W9HA 2ATWA 4KX6B 4A3FG 2AYOB 2ZTDA 2DZIA 2L1AA 1WXAA 1YQ3B 2JJQA 3BVMA 1X9NA 2FUHB 2NN6I 1LT3D 3DEOA 5C4XB 2LVPA 1IUEA 3T9LA 3PO0A 1VQ9A 5C5LA 3W3AA 4A3BB 2W3RA 4BY7H 4ZRPA 4AOFA 1OQYA 3EIVA 1XMOL 3SFEB 4Y7NB 3AE2B 2EIFA 1VQDA 1X3GA 2JVCA 3C8YA 1PA6A 1IBXA 1C48A 1P9DU 3IT4B 2MSED 2WV6D 2GBKA 2DNFA 3KDFB 3TREA 3AYHB 4N9TA 1N6ZA 3L3OC 2NVUI 4A9AA 4HN7A 2MFIA 2PMZB 2DZMA 2MX2A 1ZGUB 1JJGA 3GTMB 1V86A 3A74A 3UDXA 1TT2A 3PO3G 2AWTA 4A3GB 4XTCS 2D5GA 4ANWA 4DPGA 1V8QA 5FO9B 3LWUA 4ZRJA 4DAYB 1GUTA 4WORA 1JMCA 5EPLA 4A20A 3MC0B 2KVZA 1PFNA 2PQAB 3OYYA 1R4MB 2X6LA 3QA8A 2CWAA 3GQBA 2LVOA 1CTMA 4IUPA 3NG0A 1B2TA 3PSIA 5AUIA 2J7QB 4CDCC 5EKLA 4JI4Q 1UF0A 1VR9A 4P7IA 2PZWA 1ZYRC 1GPXA 3H7PB 4B3RL 2NWGA 4XT3B 1CA5A 1AH9A 2ZXPA 5CMDA 1H9SA 4ILWA 2KX0A 5HURA 1B44D 4EZJA 3UE0A 2RDFA 3P63A 1Q82C 3J7YW 2CQOA 3QHTA 1HZCA 3SFDB 3ALBA 4YXDB 4JI8Q 1RJTA 3LB8C 2GA4B 2WXQA 2IY5B 2B2YA 3GS2A 4QUFA 3P7JA 1QOHA 1AE3A 4B3TQ 3VR6A 4UHVA 5FKAC 4DAVA 1H4RA 5H1SE 3BZDB 3KFUA 2NMQA 2EPBA 3W5VB 2DLBA 1KDBA 1R9TB 5TR5A 3J80c 2BS3B 2Z6KA 4H0LC 3MWYW 1Q7YC 2KOXA 2O6VD 2BKRB 2DGYA 2QCZA 3L2PA 2C5CA 2KFJA 4GDKA 4BZAA 3VR4A 1P16A 1TYGB 3NK9A 3OLMD 5IA7A 1HZ6A 1NBWA 5C3EG 3AULA 1ZKHA 1NI3A 2M4NA 4DV2Q 1TIID 1KOTA 4C2MH 1AE2A 2JF5A 3IVFA 5EKIA 3ERSX 2F3WA 2VY3A 4CDEC 3J7AV 3K5NA 3E9HA 4X64L 1OTCA 1L2FA 4OWXB 4LFBQ 3S1RB 3SK6A 1L0WA 4BBRB 1T5EA 5CV9A 3S15H 4GOPB 1JRUA 4JI4L 4S17A 2MQJA 2VUMB 1E10A 1HTPA 4KVGB 4DK1A 2A6EC 3BVZA 2N1WA 3GOEA 4J3OD 4DGZA 4YY3Q 4QY7A 4DV1Q 1GJXA 4AQ7A 3RLNA 2ZCCA 3VQIA 2KVMA 5FLMH 3EQLC 3L13A 2EZVA 4TKNA 3CP0A 3ZRCA 1J0GA 2B8FA 2J0TD 4MN3A 1A15A 1FCLA 1PMRA 3L54A 2HD3A 1SXTA 5GADC 3CWIA 2A73B 2N78A 3RN5A 4L6TB 2HQLA 4KTAA 4C3JG 2KOLA 4JI8L 3DVGX 1BKBA 2OQ0A 4K5VA 1QOAA 3NBHA 3PF4A 1H9MA 1YNTE 1ZDXA 3A9JA 4B3TL 4ID6A 4FDBA 1TBEA 2JSOA 2K8HA 3H9DA 5E6OA 1X3EA 3FHWA 2A1AA 3FPUB 1UWXA 1RAXA 5EAYA 1GB1A 1TR5A 5E1FA 3X3MA 4K8JA 1WH3A 2F0WA 2MGSA 5E4XA 1WRIA 1YD8U 2BVCA 5IODA 3JAMc 5DCNA 3AECB 2EMSA 3R2IA 4JI7Q 1N63A 2L3ZA 1WOCA 1SSNA 3AQQA 1MSHA 3PVLA 4ZHPA 1K3RA 4WJQA 4CKEA 3UGBB 4DV2L 4G4KA 2L9HA 2N9LA 4N8FA 2AX5A 3APFA 3BK1A 4N6EB 1PV4A 3O13A 2ZEQA 2I46A 3DM3A 4LFBL 1B3AA 2P5ZX 2ENBA 2CCZA 2L00B 1WSPA 3MXPA 1EFWA 2BOSA 1SMYC 4X3UA 3T1YQ 1EWIA 4M1UB 4YY3L 4DV1L 1XPUA 1RCVD 1TWAH 2IY0B 4JL9A 1GUSA 4GU2A 2PI2A 2GVAA 5E7NA 2EYFA 5IP7G 1FNVA 2EJGC 1E8WA 1LLRD 4M01A 2R93G 3Q3OC 3SXHA 3IBEA 2JYEA 3LNNA 3PQIA 2GOWA 3H3VI 2KECA 4YWMA 2SNSA 3RMHA 1CQFA 2XN9C 1M94A 4KGSA 1PGXA 1SLJA 1UGJA 3HOZB 2JWZA 3VDZA 1SJED 4QB4A 4G7OC 3GTQB 4I7ZC 2HIVA 3G71A 5E6JA 2KCTA 1PVOA 4OZAA 1EU4A 4E71A 2R7DA 2JZ3B 2H4OA 1XD3B 3TZDA 2NZOA 1VQ5A 3I57A 1O7IA 4EGVA 1DOIA 2A5UA 2LGSA 3W1SA 1V1OA 2BE5C 4O0AA 2JA8B 3CCQA 3TEZA 3D4WA 4GZYC 4A3EH 4JI7L 4OWWB 2WAQG 3DHQA 1BXTA 1LT5D 1B1ZA 1LFDA 4NJ6A 5J17A 3Q2AC 1TWGH 5DNFA 4WJ3M 1ZOYB 3I72A 5J39A 1K73C 1PH6A 4IOIE 4N9F4 1T0YA 3DOWA 3STBD 5KEEA 1D5ZC 1JJCB 2K04A 4R8NA 3EJIA 1RTNA 1AWDA 1VQCA 1YMHE 3DHIC 4WWPA 4JPSA 3ZDMC 3SR6A 2QW7A 1YEZA 2K05A 1IBLQ 2F0FA 2MP2B 2L4NA 3GO5A 4MACA 3UDIA 3KK7A 1JORA 3SDZA 2BTEA 5E4WC 3T1YL 2GBRA 3TS2A 1S4ZA 2XRQD 4TQUS 3DBLB 2K8BA 1O78A 2G45B 2TSSA 2K32A 1FEHA 2VUMH 2NVQH 2F4IA 1EIYB 3M62B 4P71A 1JQ4A 3PREA 5JEAJ 1II3A 5C0XI 3T3NA 3GTKB 2NN6H 2B2TA 2N4FA 1ET6A 1VQNA 2OOBB 2ALYB 2HCCA 1Y8PB 1CM9A 5EGTA 2JQRB 4A3DB 2L12A 1EQVA 2EYLA 2HIXA 1C78A 3RD4A 3HUIA 4AS1A 1IW7C 2FMMA 2Q2IA 4WWOA 1VLBA 4K2KA 2JX5A 3A7LA 2ONQA 3QWNA 3F2BA 1N60A 1C4PA 3ZIMA 2K25A 4PZ7A 1X32A 4P74A 4HPLB 2QCPX 2JA9A 4PQXA 4JI0Q 1TWCB 4M8MA 1FNWA 2AWNA 5M5WH 1M90C 1XLPA 3N9YC 5LMUQ 3LWEA 5CBAE 2KEEA 5A2QE 5KIXA 2JZPA 4A3KG 4JE3B 1VQ6A 4NY0A 2KNBA 4IM3A 1YIJA 1Y8RC 2KEDA 5JVH3 1QOFA 2KN5A 2ZZPB 5G55A 2X6GA 3QO2A 1Q1EA 5IYCG 2Y3AA 1NEKB 2R2OA 2JA6B 1C9FA 3B2GA 2N9KA 3VH3B 2B2UA 2N3SA 2OWOA 1VJKA 2KWDA 3ZO5B 4F1SA 5D3DA 3AN1A 3W1YA 5BYRA 4A3JB 1E6EB 4LNFA 1N5XA 4CJ0B 4ZRZA 4HKQA 3TP7A 1E22A 3SU8X 4QL5A 4HMIA 3GTJB 3WAMA 4BA1I 3RMKC 4EZLA 1U4RA 1S40A 4JQWC 1U0LA 1E7ZA 4ZK9B 1MFWA 3LJ3A 2JRIB 1HA5A 2XBBC 3BIID 3T56B 3U4ZA 4DV3Q 3RZOB 4NP5A 1OQRA 3H94A 1UWMA 2VQFQ 3R3OA 2D2QA 3PCOB 2K01A 4WFN3 2GMIC 2I1KA 2MLBA 2PE9A 4AJWA 1TVXA 1PZID 1OXTA 3TUOA 2JXMB 4ME5A 5AJ3Q 3NOBA 1EY6A 4BFRA 1IGDA 2A68C 3VDYA 2ZW0A 1PFMA 1D6EC 2Q8RE 3A5UA 1WTWA 3AEDB 1WZ0A 4TV3A 3T13A 4KKJA 4BOZB 3DM1A 4IUNA 1I6HB 3PPAA 2IO2B 4BY7G 1Y1VB 4JI0L 1I6VC 3GTOB 1D8LA 2FCQA 1STBA 5DAUA 3MP9A 4JI1Q 5LMUL 4GDLA 4YCVA 3H3VC 4J1MA 3IFWB 4HCSA 3RN9C 1ZYRD 2RA4A 1LTRD 1FCCC 2Z0EB 5M3FH 4DBGA 5ELOA 4JI5Q 4N9PA 2I5MX 2PW7A 3S2HH 1G6ZA 3L08A 4QJFA 1HR0W 1EM7A 2K5PA 4FJZA 3UI2A 4ANUA 3ITPA 1SYGA 5IOCA 2D3GA 2AUKA 2V3NA 3BK2A 5I6YA 4FJVB 2KYWA 2UUBQ 1SBBB 4A75A 1YHQA 2RCFA 2EVBA 3MFGA 4CBVA 1GM5A 2BBCA 3K5LA 3RN2A 3KF8A 1LTTD 1HR0Q 4JYAQ 1EFID 3HVZA 3IG3A 4FADA 2VB2X 4JVZA 5G3LF 3DQVA 4HRSA 5IY0A 3M63B 4H02A 4DV3L 3UE1A 3M4OB 5KHOA 3TEYA 2VQFL 3OHXC 3TN2A 2JYOA 2JT4B 3AE9B 3GTKH 3W9CB 5DPTA 3F1ZA 1VD2A 3I3CA 1MSGA 1FFVA 1Y14B 1TIFA 1SNCA 2M1MA 3NQTA 5AJ3L 2V9HA 2WXIA 3VYSA 4B9KA 3NBIA 3QJYA 2WXNA 1ZXHA 3I4LA 4MDKE 5GAGC 4TSSA 1KM7A 2NTTA 1X3FA 3J81E 1SYFA 1WGDA 3TP8A 2LGYA 4C3HB 4JI3Q 4FXCA 2QDFA 2M56B 3K0YA 5IWAQ 1WD1A 2ZW1A 2M0AA 4LDTD 4JI1L 2RBMA 1BMLC 3RYTA 5D94A 4TKOB 3I73A 1STGA 2F0OA 3J81i 4UDUC 1PYWD 2F0TA 2A6ED 1XEEA 3EC8A 1S5DD 4QAYA 1SE2A 4FA6A 4XT1B 4JI5L 1ENCA 4BBSB 1L1OA 3W2DA 1RKNA 3CMEA 1XXGA 4HK2A 4XQQA 4LNNA 4FXKC 3R2TA 3M3YH 4X65Q 2J0MA 4Z9CB 1NYQA 4OO1H 2DNEA 1BOSA 3DHGC 1EZ6A 1WGGA 2XIWA 4R4QA 5IGFA 2UUBL 1G291 2JA6H 4CO7A 2XVSA 1N61A 1I5FA 3OMGA 1HR0L 1K50A 4JYAL 1DOXA 1TXYA 2RVLA 3H3VH 2ICIA 2Y5CA 4M8NA 1NCVA 2B3GA 4HCPB 4JLCA 3I7FA 3GTJH 4IWOA 2D5DA 3A0JA 2G9HD 2QDBA 2AQ1B 3T51B 3PLUA 4M00A 5IN7A 1JRPA 2BYVE 5IYDH 4EQ5A 4LJPB 5FLMG 2CWPA 3RZOH 1A5RA 4KGRA 2FINB 1CHQD 3I90A 4LUOA 1KHIA 2D0PA 4DV5Q 4QIWB 4U673 1ASYA 3GTPB 3NY5A 3PGEA 1RFAA 4GOCA 3VXWA 1DYQA 4FLHA 1X55A 5K36H 2MJDA 5CHVC 1RFKA 3ZJUA 4JI3L 3TP5A 1LTSD 1PFDA 4ICUA 2KN4A 4CGYB 2IW3A 2OTJA 4FVMA 1UD7A 2KDEB 2FCNA 5IWAL 4I6LB 3Q8BA 1XCTL 2WXKA 3ENEA 1I6HH 1VQ8A 5IGBA 4QMGA 1SMYD 5COYA 1UE1A 1SNMA 4F88A 2ZJRA 3VYRA 3U52E 4IFDJ 2FHTA 4AYBG 2V1CC 3H91A 5LL6X 4V0BA 5LXIB 2UWQA 3QJZA 4PS3A 1G2SA 4K5XA 3S1QB 2KHJA 4X65L 4KHZA 1UAPA 2JK8A 2WXFA 1KIXA 1MI2A 2INPE 1TZOA 5LNK1 2CW0C 3A4SC 3CQZH 3GTLH 4FXDA 2C7HA 5GAHC 1VDZA 2AWOA 3C46A 4GIVA 4P6VF 3ZVVA 1WMHA 1J7BA 1VDVA 2W3SA 3RUIB 2NCNA 1WXQA 5M5XB 2NBVB 3EHVA 3B2FA 3AE5B 2YEPB 5C0XH 1D7QA 4WAFA 4ZKCB 3AU5A 2KWVB 2WX1A 4RKBA 3JSVA 1FMAD 2M19A 3C19A 3AEVA 3OW2A 3L0WB 3HOWH 1GNUA 2JQOA 3APDA 4G3XB 3U8ZA 3J80E 4OVUA 2HQEA 3SE0A 4LF5Q 3I4OA 2BE5D 2DAFA 1K3BC 1BQQT 4PNYA 5C44H 1VQLA 1ZDVA 4DV5L 1IBKQ 1CZWA 3K57A 4C1NK 4GNXA 3S14B 1FGBD 4FP5D 4HCEA 3SK8A 2DYBA 2SOBA 3NSWA 3NXWA 1K52A 3R7QA 3H8HA 4AWJA 2CH4W 2WDQB 3J80i 5JPNC 4OWTB 4KZCA 3RLOA 3BJUA 1P3QU 2EKEC 3C1EA 1PH4A
chains in the Genus database with same CATH topology
2JSVX 4G57A 3ZGZA 1WCMB 1TY0A 5EBCA 3NUCA 4FO2A 3U7ZA 2BCOA 4DNRB 3MEHA 1TKGA 2DY8A 2LS01 1PUTA 1MHXA 3HVDA 4V190 3BDOA 5ELFA 3GP7A 1PRTC 4BWGB 2I38A 2M00A 3VRAB 1O7ZA 1IW7D 4A93B 4YSXB 1TY2A 4X3TA 2OEDA 5BYSA 2KJXA 5EPJA 3LX0A 1RHPA 4CJ2C 1QF6A 3JAME 1XO3A 1AN8A 5CC4A 2NVXB 4OW0A 4RF1A 5IGGA 2WIIB 3AEFB 1TU2B 4X3KA 5DM63 1AFPA 2NN6G 1QKZA 3TZUA 2QIEB 3NS1A 3NUHB 1FXIA 4A55A 3FVQA 4YWGG 4KI0A 1XLNA 4JWSC 3IAYA 1VZ6A 1V8CA 2JXTA 2MHVA 3KLSX 4ZQ3A 2WXJA 1A3UA 3V3XA 5IGCA 2F0MA 1W6JA 3K7AB 2L1BA 2K6AA 2WXGA 4A3IB 3NHHA 3P1HA 5IT9L 4C7ZA 4NMZA 2JYTA 2K9XA 2YEPF 1L4DB 2QSDA 1H9KA 1F77A 5EE1A 3A8JE 1EEFD 2A68D 5CV4A 2NYZD 1EOTA 4G7ZC 2L0CA 2OHFA 3HRDD 3A54A 4O42A 1WWTA 1PZJD 3L7ZC 1EYDA 1YN3A 3C1FA 2PVGC 5H92C 1OXSC 1EY9A 1X3PA 5CORA 1DOKA 2JA5B 1LT6D 3T3OA 3MXUA 4B0MA 2TMPA 1IYUA 1GUWA 1HQMC 4IURA 4XDCA 3AMUA 3FPPA 1HZ5A 2JE6I 1IKMA 1EQTA 1K8MA 1DOLA 2JA7B 3HP3A 5I4DA 3Q0AA 2J42A 3D4DA 3U9SA 3B9JA 5M3MB 3L9AX 5LL6S 4C7YA 2DY7A 2Q8TA 1JOOA 3FILB 2PCFB 1MHHE 4XXEA 1OXVA 2F0NA 2R7ZB 2BYTA 5I9OA 1O80A 2PMVA 2PQEA 2WXOA 4KV6A 3P20A 4EQPA 1SAPA 1FIQA 5EKKA 1LT4D 1SFOB 2L83A 2LHEA 4PMCA 3N6RA 1SNQA 1I4XA 4ZHOA 3DWMA 5EE3A 4WRDA 5GXGB 4OGQC 1KTKA 3NWSA 1GUOA 3I4NB 1WGKA 1ZPSA 2F3VA 1T6BX 2V4IB 4RGOS 2PO4A 3S2DB 4F7XA 3KBXA 1GB4A 1S5FD 1ZXIA 1BCPB 2WDVB 4BY1B 3QOLA 5ISRA 1F9SA 1Y1WB 4RKLA 2MH7A 1SYDA 4CQNA 1F9QA 2CU3A 4DF7A 1OFFA 3C2PA 2LUMA 2LFIA 3GV3A 2H89B 2RSOA 4LAAA 3BYYB 2IT1A 3DMUA 3H0GB 2YYZA 1C4AA 2CW0D 2K5DA 3Q23A 2NUCA 5DEHA 1LABA 5KNDA 3AH7A 2EYHA 3EVQA 1G2TA 5C4HA 2PW9A 3S16B 4KN4C 5JVG3 4HMJA 2E76C 1IYVA 3QB3A 2MUYA 4YSZB 2L32A 1JWMD 3MVVA 4N58A 3QOJA 3P4PB 4RNAA 2NVTB 5KYLA 3AE4B 3GV6A 3T16A 2QILA 3X3NA 5C0XG 3HOYB 4DQOC 1JWAD 4MT5A 1FNUA 4WURA 4OZBA 1CHPD 3KLRA 3NP8A 4DAYA 2IL8A 2BT6A 1TQOA 1JQYD 2PKOA 4DU9A 2F0LA 4K2LA 4E6IA 4XQJA 2NBFA 2WS3B 1PRTD 4OO1I 1K8OA 3HEJA 4DAPA 2AUJD 3A7AB 2K33A 4B9WA 2B2VC 1ZUD2 5KYIA 1AZQA 5CV6A 2K0PA 2YU9B 4HEA1 2F0IA 4TQ0A 4DXFA 3Q6SA 4KKSA 2RMMA 4HJGE 3NTIA 2WXMA 1BCPF 4XIGS 3S1MB 3KWVA 4R8IA 1RM6C 4HEDA 2EYOA 1SNOA 4B9XA 3NE5B 3TBIB 1MI0A 4C3IG 2QF7A 4G7HC 3I4MB 5BMIA 3OSOA 4K8IA 1AW7A 4N59A 1FYCA 1Q12A 1L6VA 3CKIB 2J7ZA 3T4AC 3DWPA 2B63B 1ENAA 4FF4A 3EA6A 3VR2A 2IGGA 1XYIA 5FK9C 1Y69U 5BN4A 2IX0A 2EOTA 1PZKD 1QB5D 1SNDA 3OIPA 4Q5VA 2EJFC 1QT9A 1SSOA 1SIJA 4A3FB 3GTGB 2WNMA 3P42A 1HUNA 5I6WA 5LHY1 1EWYC 5HGTA 2K1BA 1DM0B 1KDAA 2KCCA 3MAQA 1SNPA 1EZ8A 3NTHA 1KDCA 2LFNA 2MJ3A 3PUZA 3FC4A 1BNZA 1E2WA 1PLFA 3PO3B 2IDYA 5CV8A 3SHLA 2PZTA 3AE7B 4BA2I 4KKIA 5MPOA 1WVLA 5D65A 1RTOA 2ZXRA 5FO8B 3AM9A 4TRDA 1Y8OB 1CJEA 2RSNA 2Z8LA 1AEXA 2EJMA 3V96A 5C4JB 4FF3A 1RDPD 1QCBD 3NRZA 4PT5A 4CKBA 3BDCA 4ZYSA 2A69C 4J8QA 5EJWA 1QNUA 2XNAC 2V4DA 3U4EG 5HHDG 2PIAA 2LMCB 3U2SC 5C3EB 3VR3A 2QEJC 1SJHD 1VRAB 2XWBB 4KHVA 2W54A 5FO7B 4LMQD 3M7GA 3MTSA 1EYAA 4X3SA 1HPCA 1JB3A 2EDGA 2HTME 5HI1A 1I50B 2EYMA 1O7YA 1EY4A 2CJOA 1TS4A 1DCZA 1V1PB 2EY6A 2DWQA 1VMCA 5TSSA 4IALA 3ND8A 3EROA 1Z47A 1R4QB 4RHSA 2EY5A 2F0UA 5ELBA 4C3JB 1LTID 5C3WA 2FUG1 2E2HB 1C77A 1BUIC 2XSCA 3AEBB 1A2UA 1UNSA 2DN8A 4IDIA 2KHSA 2N7JA 4YTMB 4C1NI 4WIPA 1DOYA 3MHBA 1C4CA 1D1IA 3DXJC 4A90A 1EIGA 2BDOA 4PV1C 2D62A 2MPMA 1L0YB 1M8AA 2PYKA 2E3TA 2FMCA 4QUCA 1F9RA 2RQXA 4RCNA 2VXWA 1SF0A 3AV8A 1YNJC 2ICEC 2R93B 3J9CA 2JWUA 1DXMA 4XDDA 2V3PA 2JU6X 3M85A 1ESRA 1WTQA 1IL8A 4JBWA 1AYFA 2B2WC 3D3RA 3OPOA 3MXGA 3VA7A 4KK7A 3LXFA 4L1BA 3D6WA 5JPMC 1WTXA 4PMBA 4FNFA 2IWHA 3IFDA 3HZXA 3TEXA 2WAQB 3K5MA 5G5HA 3G7LA 4IQZA 4XWTA 4YSYB 1WTRA 2BB6A 3PMFA 1U9RA 1KABA 4ZUJA 3E6ZX 4JWUC 1XX8A 1WTPA 3CU7A 3FDTA 3Q8EA 4MM3B 4LJZC 4YTNB 4M0WA 1D5XC 2KA7A 2BA1A 1P7FA 1NSNS 4F8MA 4XQNA 1ICWA 2QJLA 2KAJA 4IZ8A 1Q8IA 1L6UA 2WXPA 3R93A 2I07B 2IGDA 2WDRB 4EQNA 3PIO3 1J9OA 4ZAIA 1MVKA 2H88B 1FFUA 1XCQL 3L4PA 4HSVA 4XDXA 4WH4A 5EQ0A 5D7GA 3DEPA 2D9UA 4NKLA 2NVYB 5NUCA 3CIRB 1KLGD 2EKIA 1SYBA 1PFBA 4OIJA 5BYRA 1I4QA 1DGJA 2KQ3A 2Y5PA 1A2TA 1JMLA 4CKCA 4A3KB 2HUGA 5IGEA 1EWHA 4KY5A 5G5GA 2SDFA 2QMTA 3MJ5A 4ZLTF 2AQ3B 2X69A 3OMCA 3J7AF 4I65A 2CVRA 1CI3M 4IUTA 3I91A 3WOFA 2B39A 2KQ4X 4MHEA 3SR1A 3IAM1 4J6HA 2Z4HA 2DBYA 3GB1A 1HXYD 5DM73 3P75A 1G8ZD 3PUYA 4K14A 4DXGA 2E2JB 1EIHA 1Y8NB 1ENFA 4KMUC 1GOZA 2ZT9C 5CGKA 3S9WA 3K59A 3BWUD 2V0GA 1MBYA 4WJWA 3NQIA 2PVOD 5C3XA 1SYCA 2O5JC 5FLXL 2WINB 3ERQA 5J1ZA 4DFAA 2VNUD 2Z1CA 4H7BA 4BY7B 4QCLA 1SE4A 4M8AA 1A3VA 1E7PB 5BMGA 1EU3A 1PTOB 4D2KA 2K28A 1KAAA 3FMCA 5G3LD 3AE6B 1CZGA 2K7VA 3HS0C 3SK4A 4L63B 1B50A 2F0JA 4EE2A 1IBXB 2NTSA 3U9OA 4QF4A 1N62A 2WACA 1AZPA 2MJEA 1T5XD 1F0ZA 1KF6B 2IX3A 1GHJA 2G9DA 2F0HA 1C76A 2SNMA 4DK0A 2K3UA 3PUWA 1N5WA 1TKYA 2K03A 1E9MA 4L23A 1NYRA 4US8A 2A69D 5J22A 1HFNA 2EELA 1ACCA 5C5MA 1AP0A 4OHJA 2Z4IA 5H8YE 2MEKA 3P1MA 1PTOC 2C9OA 1NVID 1WD0A 1FD6A 3KQ4A 1ZKOA 1H9SB 1XTCD 1TJEA 1F2LA 3Q69A 1B9NA 2BS2B 2R3ZA 1TWFB 2IX1A 2FE8A 2F0VA 1QNKA 2WKCA 3ZYYX 4RWSC 5IGDA 4NAMA 1K53A 1BDOA 1JWSD 1JW9D 2J52A 4KN7C 4XE0A 1E2VA 4GDKB 5IT9E 4C2MB 1V43A 2PNRC 4K6DA 3OWFA 2BDNA 2JP1A 1LTAD 5M5YB 5HG2A 3S15B 2O4XA 2PW5A 3SVMA 3AE1B 3OOCA 5JEAH 1PDQA 3V2TA 3VRBB 1CK1A 2B2YC 3PUVA 1LACA 3IKJA 2OF1A 2LGIA 1RWSA 4HKZE 2EY1A 1RYJA 1STEA 3VR8B 4K5WA 1PTOF 5A35A 2W55A 1PGBA 1BF4A 4AYBB 3NVZA 1PTOH 1Q3LA 2LY7A 1YN4A 3VR5A 1YNJD 3MZ5A 1EY8A 2F0KA 2F03A 3AU7A 1JALA 1DD2A 2HCIA 5CV5A 2F1MA 1R7SA 1QQRA 2KACA 3OWEB 3Q22A 1EL0A 4C80A 1TWAB 2NB0A 1K51A 4OO1G 1WTOA 1KLUD 2H1EA 4R3DA 1EY7A 1JR0D 1D1KA 4IUUA 5C0XJ 1V97A 3AB9A 3RPFC 2N0SB 3F2UA 1IGCA 1STAA 2Q8IB 4RAUC 1ZEQX 1TS3A 1TS5A 4EVOA 1H9RA 2HDLA 2AQ2B 1OQQA 4A3EB 5K36G 1MPEA 4IUQA 2E2DC 1STYA 2R61A 1XF5L 1TWGB 3TEWA 2DNCA 1JC7A 1O7LA 1E0BA 1BCPC 3GD7A 4P16A 2QKIC 4RCOA 3W5UB 1QOBA 3NVVA 2F0DA 3RLFA 5JJZA 3HGBA 3CRKC 2DYMA 2FJ2A 2K5WA 2WP9B 1X3QA 1RF2D 1ROEA 3FILA 4RGNA 2NVQB 4HSPA 3P4RB 1RODA 5BMHA 3FEWX 1BUVT 4EQOA 3I8ZA 1WTVA 4HR7B 1KNAA 4HTHA 5T8IA 2K22A 2F0PA 3E0JA 1NAPA 3D8GA 1B4OA 3NVWA 3K6OA 2WLBA 1UEAB 3Q8FA 1TWHB 1I4PA 2OT2A 2SEBD 1QJOA 5K5PA 1CZPA 1L4ZB 1SEBD 2WU5B 5M5WB 1JOQA 4C3HG 2W82A 5BN5A 1OXXK 4Q2JA 3SK5A 3NTKA 4WQMA 1KNEA 2MJ8A 1BBXC 4RA8A 2SAKA 1CA6A 4UAIA 1J7AA 2OXPA 1JWBD 3UI3A 1F2ZA 4NDXA 2X38A 2B2TC 1NENB 3VR9B 1GUGA 4REZA 1HRJA 2NZ1D 4MIUA 1F2YA 3A8IE 1BO0A 4ZRQA 1QOGA 2XWJB 2RDGA 1Y56A 4NW2A 5JOBA 4KKTA 5AFWA 3AMZA 2EXZA 2BS4B 2Y0SB 1HCZA 3BS1A 4FF2A 1ONLA 1I4HA 1B9MA 1JWUD 4P2CB 4IFDH 1H9JA 3K58A 4FYDA 2KCNA 4KGTA 1B53A 1U4PA 5I9PA 1B9RA 4RF0A 4O1NA 4KJOA 1D4BA 1M4VA 2CHBD 3E5SA 5M3FB 3E56A 2B2UC 4ZUIA 3S2HB 1DJRD 3URYA 1XLQA 4GDLB 1MGSA 1FO4A 5A2QL 1R4PB 1PTOD 2WU2B 3TP6A 1OO9B 5EE0A 3MHZA 3VA5A 2XRSD 2RKSA 1JROA 3VYUA 4B08A 2WP8J 2B2VA 5C6AA 2INNE 4DN4M 5D3IB 3IAS1 1XLOA 1I4GA 4R9WA 4YTPB 1QG7A 2CJNA 5C2TB 4LK1C 2ON8A 5EE9A 3RZDB 4DNTB 2A6HC 3BG3A 5CYUA 3ETRA 4A6QA 4ZKBB 5KNBA 1SDFA 4CJ1B 3A8KE 2O5IC 3K5OA 2HDMA 5KNCA 1TS2A 3ZQ4A 1ILPA 5I2XA 4ARCA 5I2YA 1U4MA 1QILA 4TMAB 2RPVA 2M9VA 2N55A 3M3YB 1VCIA 3Q8AA 2A5HA 1PGAA 2ZXOA 5C4ZA 3C3LA 1KRHA 1Z6HA 1GXDC 2PTLA 1ILQA 2ID0A 4Q0FA 2VZKB 1EWCA 4XYOA 1YNNC 5E3FA 1DONA 2PZUA 5JEAG 1F2MA 4L8JA 5KGUA 1VF7A 1EY5A 1A3TA 2I2YA 3CHBD 3M4YA 3ZJTA 4F87A 3A55A 1CQVA 2WXRA 4WWMA 2N88A 3ABVB 3J81L 5BYQA 1ML0D 2MP1A 2M2LA 3TMEA 1GAQB 1C8CA 1FRDA 1UUPA 2J4XA 3P4SB 1Z7TA 4US9A 3PUXA 4ITKA 4OZCA 1U4LA 1JE4A 4NZLB 5CV7A 4IUVA 3CQZB 3GTLB 3EGRA 4U68A 3RUZA 4ULLA 1S5BD 3HG9A 1F2RI 3OW7A 1PXUA 3LYYA 4C56C 1FXAA 3MFYA 2HDEA 2F0QA 2WQYB 3HOWB 1C79A 1GUNA 2F0EA 4IKGA 1CT1D 2E74C 3OIQA 3AEGB 5C44B 1E2ZA 1L0XB 3NZ3A 1SB3C 3EUB2 1BCPD 4FF1A 3DWQA 1P7EA 4LK0M 4USAA 1A6XA 1SYEA 4JX1C 4KY7A 4L2YA 5JXVA 3H6MA 3HKZB 1D5MC 2IJ0A 2PPBC 1ESFA 1DZ1A 3T53B 1TKEA 3CRLC 1YJJA 2KMMA 1T3QA 3FAHA 1VF5C 1XWEA 1Q10A 2KDMA 1ET9A 2GRIA 2F0SA 3D6CA 1ZP0B 1IKLA 1Q1BA 4H2AA 3MXNA 1S5CD 3EFXD 3AEEB 3HOUB 5IIFA 2BB5A 3A56A 4C3IB 1L5PA 3PZ7A 2LMCA 4A8XC 1RD9D 1ZE3D 2GI9A 4LLGM 2ACZB 2E2IB 3MA2B 3I70A 4NJCA 3NPPA 1D2BA 1J7CA 5JAVA 3J80L 2E6XA 2LEKA 2D2CC 3IXSA 3SFDB 3PO2B 1VZ8A 1STHA 5F2DA 2KUMA 3HOXB 1EYCA 1E0ZA 1HTLD 4HROA 1V1PA 3FRPB 4TQ1A 1C4QA 2PLPA 1QWYA 1JOKA 1FR3A 1HEZE 5FR3A 2VB3X 3D4RA 1NR4A 4K6LA 3V05A 3WOEA 4ZOHC 2EY2A 3DWAA 2WXHA 3AE3B 2Q5WD 4OIKA 1G91A 4S3SA 1PDXA 1JCKB 1MD2D 5ELCA 2B2WA 4IN3A 1KFYB 4LTUA 2R6GA 3M7NA 3WDNA 5HFYA 3SEBA 2G1EA 4OL7A 3DWGC 1LTGD 2L5TA 3P4QB 2F0GA 2K5QA 3ONAB 4KJNA 2IGHA 4NAWB 1PRTB 3HOVB 3JAML 2O2LD 4RFBA 3BYTB 3QG1A 2GB1A 4RGTA 1F2RC 1KH0A 4XYQA 2JEAI 5CBEE 2FFKB 3WCQA 3NWTA 2WKDA 3S17B 1DOMA 1HUMA 5M9OA 1NUCA 3KLSA 3AB5A 2LHDA 5D14A 1QE6A 4RHRA 1ZXTA 1LTBD 4RH6A 1HHVA 1BR9A 1L0VB 4IFDG 3PV0A 1YJIA 1J8IA 3FKIB 5ELDA 2JEBI 1CFMA 3HRZC 2J53A 3AEAB 4OVZA 4BS9A 4RGMA 3IL8A 1YQ4B 5EBDA 2R92B 1FD7D 4ARIA 3TDQA 2B8GA 2L55A 1NR2A 3KWLA 5KRUA 2A6HD 4A3MB 1LO5D 3ZJVA 1S5ED 4H13C 1IHZA 2WXLA 3Q24A 3KBGA 4KY6A 1VZ7A 4KKUA 2LJIA 3R8BA 3E9SA 1GHKA 1EY0A 4YIJA 4CHTB 5CR3A 4ODGA 3QIAA 4DA2A 3PIP3 1WYGA 2CQAA 1K83B 1HFGA 3VYTA 2BW2A 1W6KA 2WB1B 1JICA 3I9V1 3H09A 1FM0D 4B0EA 1HA6A 1I4RA 1HQRD 2EYPA 2FBWB 3Q8CA 5FOBB 5ELEA 4KD4A 1I7HA 1YNND 2LKVA 2IPKD 5FLXE 4KD3A 1FRRA 1YN5A 4GLSC 3AE8B 4MH8A 2EE1A 4H44C 2B76B 3D31A 3IFTA 5T1IA 3BDLA 2RDHA 2OEOA 1PRTF 4XWWA 1TKWB 2L52A 5T1GA 4IFDI 3RFZB 1STNA 1EEID 2VZKD 5AUKA 3N52A 4YT0B 1VMPA 1F9PA 1I3QB 3DUZA 1QLBB 3BVGA 5C3JB 3KUPA 5BN3A 1LV9A 3TSSA 2E75C 3G6JB 1OXUA 3IT6B 2EYJA 1A70A 2A74C 1SE3A 5EPKA 2DYOA 3NVYA 3ND9A 2BA0A 4PMWA 4KX6B 2L11A 4ABNA 3PZ8A 1Q90A 3S1NB 4FXGC 4JK1C 4HAEA 2L1AA 1YQ3B 3BVMA 2NN6I 1LT3D 3DEOA 5C4XB 1IUEA 3PO0A 4ZRPA 5C5LA 3W3AA 4A3BB 2W3RA 3SFEB 4Y7NB 3AE2B 3C8YA 1IBXA 1C48A 3IT4B 2WV6D 4N9TA 3L3OC 4A9AA 4HN7A 2PMZB 3GTMB 2D5GA 1TT2A 4A3GB 4XTCS 1V8QA 5FO9B 3LWUA 1GUTA 4WORA 5EPLA 3MC0B 1PFNA 2X6LA 3GQBA 1CTMA 4IUPA 1B2TA 5AUIA 5EKLA 1VR9A 2PZWA 1ZYRC 1GPXA 2NWGA 4XT3B 1CA5A 2ZXPA 5CMDA 1H9SA 4ILWA 5HURA 1B44D 2RDFA 3P63A 3J7YW 4YXDB 1RJTA 3LB8C 2GA4B 2WXQA 2B2YA 3GS2A 4QUFA 3P7JA 1QOHA 3VR6A 5FKAC 4DAVA 3BZDB 2NMQA 2EPBA 3W5VB 2DLBA 1KDBA 1R9TB 2BS3B 4H0LC 3MWYW 2C5CA 3VR4A 1TYGB 3NK9A 1HZ6A 1NI3A 1TIID 5EKIA 2F3WA 3J7AV 3K5NA 3S1RB 3SK6A 4BBRB 1T5EA 5CV9A 2VUMB 1E10A 1HTPA 4DK1A 2A6EC 3BVZA 4J3OD 4DGZA 1GJXA 4AQ7A 3VQIA 2KVMA 3EQLC 2EZVA 2B8FA 2J0TD 4MN3A 1A15A 1FCLA 1PMRA 1SXTA 3CWIA 2A73B 4L6TB 4KTAA 4C3JG 2KOLA 1QOAA 4K5VA 3NBHA 1H9MA 1YNTE 1ZDXA 4ID6A 2JSOA 3FPUB 1UWXA 1GB1A 1TR5A 5E1FA 3X3MA 4K8JA 2F0WA 2MGSA 5E4XA 1WRIA 5IODA 3AECB 3R2IA 1N63A 1SSNA 1MSHA 4ZHPA 4CKEA 4G4KA 2L9HA 2N9LA 4N6EB 2AX5A 3BK1A 3O13A 2I46A 1B3AA 2ENBA 1WSPA 3MXPA 2BOSA 1SMYC 4X3UA 4M1UB 1RCVD 1GUSA 2EYFA 1FNVA 2EJGC 1LLRD 3SXHA 2JYEA 3LNNA 2KECA 2SNSA 3RMHA 1CQFA 2XN9C 4KGSA 1PGXA 1UGJA 3HOZB 1SJED 4QB4A 4G7OC 3GTQB 4I7ZC 5E6JA 4OZAA 1EU4A 2H4OA 3TZDA 3I57A 4EGVA 1DOIA 3W1SA 1V1OA 2BE5C 2JA8B 3TEZA 3D4WA 4GZYC 3DHQA 1BXTA 1LT5D 1B1ZA 5DNFA 1ZOYB 3I72A 5J39A 4IOIE 1AWDA 5KEEA 1D5ZC 2K04A 4R8NA 1YMHE 3EJIA 1RTNA 4JPSA 3SR6A 2K05A 2F0FA 2L4NA 3GO5A 4MACA 3KK7A 1JORA 3SDZA 2BTEA 5E4WC 1S4ZA 2XRQD 4TQUS 1O78A 2TSSA 2K32A 1FEHA 2F4IA 1JQ4A 5JEAJ 1II3A 5C0XI 3T3NA 3GTKB 2NN6H 2B2TA 1ET6A 2HCCA 1Y8PB 1CM9A 5EGTA 2JQRB 4A3DB 2L12A 1EQVA 2EYLA 1C78A 3RD4A 3HUIA 4AS1A 1IW7C 2FMMA 1VLBA 4K2KA 2JX5A 3A7LA 2ONQA 3QWNA 1N60A 1C4PA 1X32A 2QCPX 4PQXA 1TWCB 1FNWA 2AWNA 1XLPA 3N9YC 3LWEA 5CBAE 2KEEA 5A2QE 5KIXA 2JZPA 4JE3B 2KEDA 5JVH3 1QOFA 2X6GA 3QO2A 1Q1EA 2Y3AA 1NEKB 2JA6B 1C9FA 3B2GA 2N9KA 2B2UA 1VJKA 2KWDA 5D3DA 3AN1A 4A3JB 1E6EB 4HKQA 1N5XA 4CJ0B 4ZRZA 3TP7A 3GTJB 4HMIA 4BA1I 1U4RA 4ZK9B 1HA5A 3BIID 3T56B 3RZOB 1OQRA 1UWMA 4NP5A 3H94A 3R3OA 4WFN3 2K01A 1TVXA 1PZID 1OXTA 3TUOA 2JXMB 4ME5A 1EY6A 1IGDA 2A68C 2ZW0A 1PFMA 1D6EC 2Q8RE 1WTWA 3AEDB 3T13A 4KKJA 3DM1A 4IUNA 1I6HB 1Y1VB 3GTOB 1I6VC 1STBA 5DAUA 3MP9A 3H3VC 4J1MA 4HCSA 1ZYRD 2RA4A 1LTRD 1FCCC 4N9PA 2PW7A 1G6ZA 1EM7A 2K5PA 3UI2A 3ITPA 1SYGA 5IOCA 2AUKA 2V3NA 3BK2A 5I6YA 1SBBB 4CBVA 2EVBA 3MFGA 2BBCA 3K5LA 3KF8A 1LTTD 3HVZA 1EFID 2VB2X 5G3LF 4HRSA 3M4OB 3TEYA 3OHXC 3TN2A 2JYOA 3AE9B 3W9CB 3I3CA 1MSGA 1FFVA 1SNCA 2WXIA 3NQTA 3VYSA 3NBIA 3QJYA 2WXNA 1ZXHA 3I4LA 4TSSA 2NTTA 3J81E 1SYFA 3TP8A 4C3HB 4FXCA 2M56B 3K0YA 2ZW1A 1WD1A 2M0AA 2RBMA 1BMLC 4TKOB 3I73A 1STGA 2F0OA 1XEEA 4UDUC 1PYWD 2F0TA 2A6ED 1S5DD 1SE2A 4XT1B 4BBSB 1ENCA 3W2DA 1RKNA 1XXGA 4XQQA 4FXKC 3R2TA 4Z9CB 1NYQA 4OO1H 2DNEA 1BOSA 1EZ6A 2XIWA 5IGFA 1G291 2XVSA 1N61A 3OMGA 1K50A 1DOXA 2RVLA 2ICIA 2Y5CA 1NCVA 2D5DA 3T51B 2G9HD 2QDBA 2AQ1B 1JRPA 4KGRA 2FINB 1CHQD 3I90A 3GTPB 4QIWB 4U673 1DYQA 3ZJUA 2MJDA 5K36H 1RFKA 1PFDA 3TP5A 1LTSD 2KN4A 4CGYB 2IW3A 4FVMA 3Q8BA 1XCTL 2WXKA 5IGBA