3O13A

Crystal structure of a superantigen-like protein (sav0433) from staphylococcus aureus mu50 at 2.05 a resolution
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
194
structure length
187
Chain Sequence
b'EVRSQATQDLSEYYKGRGFELTNVTGYKYGNKVTFIDNSQQIDVTLTGNEKLTVKDDDEVSNVDVFVVREGSSAITTSIGGITKTNGTQHKDTVQNVNLSVSKSTSVTSEYYSIYKEEISLKELDFKLRKHLIDKHDLYKTEPKDSKIRITMKNGGYYTFELNKKLQPHRMGDTIDSRNIEKIEVNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superantigen-like protein
publication title Crystal structure of a superantigen-like protein (SAV0433) from Staphylococcus aureus MU50 at 2.05 A resolution
rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Toxin
total genus 55
structure length 187
sequence length 194
ec nomenclature
pdb deposition date 2010-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3o13A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3o13A01
1YN4A 1S5ED 1BCPF 1BCPD 1EWCA 1LTBD 5ELFA 1I4PA 2CHBD 4L63B 1KLUD 2NTTA 1RD9D 1SE2A 3DWQA 1ESFA 4RH6A 4RFBA 4DXFA 1TS4A 1SXTA 1I4RA 5D3DA 1CQVA 1V1PB 4TSSA 1BCPC 2AQ1B 1F77A 3BVZA 2Z8LA 2TSSA 3MFGA 5ELDA 1M4VA 1DYQA 1G8ZD 1LTTD 1S5BD 2XN9C 5D3IB 1I4QA 1JWUD 1TS3A 4RHSA 4RHRA 2R61A 4RGTA 4DXGA 1D5MC 1FGBD 5I4DA 1PRTB 1ET6A 2NTSA 1EU3A 1I4GA 2RDHA 1JR0D 1PRTF 1V1OA 1PRTD 4RGOS 1CT1D 4O1NA 1LTSD 1SE4A 1V1PA 1EFID 1GOZA 1FNVA 1LLRD 3BYTB 1FNWA 4RGMA 3V05A 3KLSX 1JQYD 1XTCD 3W2DA 2G9HD 3SEBA 1HQRD 4K6LA 4NZLB 1LT6D 2QEJC 3BZDB 1SJED 1D5ZC 1JCKB 1SJHD 1PRTC 1TY2A 2SEBD 3GP7A 3OWEB 1EEFD 1KLGD 1TY0A 5TSSA 3CHBD 4L6TB 3URYA 5ELEA 5FK9C 1I4HA 4RCOA 1LT4D 1CHPD 1SEBD 3TSSA 1UNSA 4BWGB 1SE3A 1MD2D 1PTOB 1YN3A 1RF2D 4ZYSA 4RGNA 2WV6D 1SBBB 1PTOF 1STEA 1PTOD 3DWAA 2AQ2B 2J4XA 5ELCA 1PZKD 1UUPA 2ICIA 1T5XD 1LTAD 1HTLD 1D5XC 1BXTA 1PYWD 2AQ3B 3BVGA 1AN8A 5ELBA 5FKAC 1TS5A 2O2LD 1DJRD 1B1ZA 1QILA 1JWSD 4C56C 3O13A 3EA6A 4UDUC 1LT5D 1S5FD 1YN5A 1EEID 1PZID 2XRSD 1HA5A 2XRQD 1AW7A 1B44D 1PTOC 2XNAC 1LTID 1LTRD 1TS2A 1PTOH 1CHQD 1EU4A 1D6EC 1JWMD 1LTGD 2RDGA 1HXYD 1I4XA 1S5DD 3DWPA 2IJ0A 1KTKA 3R2TA 4Z9CB 1CK1A 1S5CD 1ENFA 1L0XB 1L0YB 3BYYB 1RCVD 3BVMA 1FNUA 2QILA 1ET9A 4OHJA 1RDPD 3MC0B 1XXGA 2IPKD 3EFXD 1PZJD 3R2IA 1LT3D 3R8BA 1FD7D 1LO5D 1BCPB
chains in the Genus database with same CATH superfamily
2R7ZB 3M85A 1IBXB 4PT5A 1GM5A 1E22A 3AB5A 2AKWB 3KDFB 4I65A 4TUUA 1WI0A 1JB3A 2QDLA 5AJ3L 1KJTA 5L95C 2WXLA 1FD6A 4GN1A 4CYEA 5CV7A 4X66Q 2NTTA 4C80A 2JA6H 4G7OC 1OXVA 1XQQA 3M4OB 1EIHA 5G5GA 2N88A 4M8AA 5T1GA 1TS4A 4HIMA 5NUCA 1DOXA 2AYOB 1KQSA 1V81A 4NY0A 1BBUA 2D5DA 4A3FG 4WJQA 1OO9B 1GUNA 2K5NA 2B2UA 3BVZA 1RTOA 2IO1B 4HJGE 5CR3A 3AULA 2JSOA 2DZJA 2KECA 3WDNA 3EJIA 1I4QA 1JWUD 3CCMA 5C3WA 5LHY1 4LF5Q 2X8XX 1WJUA 2O6VD 1HUNA 1XCTL 3PUWA 2M1MA 3C0RB 3C1FA 1X3FA 2K4KA 5I4DA 3W1SA 1X3EA 5BO4B 4L5TA 2V1YA 2RDHA 3GTOB 1JJGA 2ZJDA 4A3FH 2WLBA 4O1NA 2E2HH 4J3OD 1QVFA 2BVCA 4CHTB 3BYTB 1FNWA 5LXHA 4FNFA 2I38A 4E3CA 2YEPF 2JA9A 3MTNB 4V0BA 3CKIB 5C4JH 2JA7H 5FLXE 1Y14B 4IPHA 2KENA 4K6LA 2O6VA 3ONSA 1LT6D 4FN2A 1MSGA 1STNA 2A6ED 2IDYA 3EQLC 3PO3B 4IURA 1SJHD 4A3MB 2DZIA 1YBYA 4L2YA 2IL8A 1UE5A 3J80i 3PVLA 4WJOA 4BXXG 3IKJA 1H9JA 1IBLQ 5ELEA 1F2LA 3KK7A 4ZLTF 5C0XJ 5G3LD 2KXJA 3RNGC 2ID0A 1FR3A 3U58A 2AL3A 4LNNA 2KCTA 2VB3X 1E6EB 2INPE 1PDXA 5M3MG 1PTOF 1YNNC 3QCAA 4P7IA 4NXML 3EHVA 1F9SA 2GMIC 1NY4A 4DR6L 3F1ZA 4LUOA 1K3BC 2PMVA 4Y52H 4BXXH 2WFWA 2DAJA 2EJGC 5IKCM 3I4NH 1PVOA 3H3VH 1UGJA 5FLMH 2L05A 1HPCA 2EY6A 4N9F4 2WYQA 4WJNA 4MM3A 4Q5VA 2ZJRA 2I2YA 3U7DA 5M3MH 1TS2A 4OVZA 5GROA 1KXLA 2R7ZG 3MWYW 4YTMB 2EIFA 3BDLA 4JI4L 4JI1Q 3SHLA 2VQEQ 4KSKC 2O5JC 3OJ3A 3A7LA 1Q1EA 1EY8A 1HZ5A 2EKIA 4M1UB 1EL0A 1FRRA 4RCNA 3ZRCA 2D3GA 3M7GA 1Q7YC 3K80C 3MXNA 4HIDA 1WY8A 1EQTA 1FEHA 2WWZA 4QAYA 2Q8RE 3PSIA 1YQBA 1WE6A 1KHIA 3LGJA 2NN6I 3AE1B 3EFXD 2MO1A 1YX6B 4DR7L 2PJHA 4IC7B 2D10A 3KDFA 5E6PA 1RL2A 1F9PA 3D4WA 1EWIA 4HWIB 1LO5D 1I35A 1BCPB 1EYDA 1SAPA 3J81j 2CCZA 4KK7A 2IX1A 4L5RC 1SYBA 1QZGA 3W1BA 2CQOA 3RMHA 4US9A 3ZNID 4DBGA 2DAFA 1YJWA 1N9WA 5FLXL 5EAYA 2JYEA 1TWGB 1WYGA 1TTNA 1N61A 1ESFA 2F03A 2H89B 3R3MA 3N52A 1SYEA 3E0EA 4RFBA 3TIXA 3TP5A 3KF6A 2L7RA 3IFWB 2KEDA 3VAWA 2IHFA 4B3RQ 1A6XA 2K8BA 3CIRB 4JBMA 1ZDVA 3N1ZC 1QG7A 1K3RA 2K5DA 2D3BA 4K2LA 5KNCA 3I91A 4ME5A 4ZYNA 3RN9C 4MGKE 5D3IB 1N32L 5CX3A 4A3MG 1WR1A 1NNXA 4DK0A 4L5QA 1CKNA 1NCVA 2OT2A 2RBMA 3T1YQ 1VJKA 4ALPA 4A9AA 3X3NA 4PYZA 2FXQA 2F0DA 4IM3A 5E6OA 1WRIA 2A19A 1EU3A 2GRIA 3A54A 2K0PA 4C3IB 4XQNA 5K36G 4JOIC 1VZ7A 2WDTB 4FVMA 1B3AA 5M5YB 1C9OA 3UDXA 2D62A 2NBFA 3A8KE 3OSOA 1YX5B 2E76C 3KLSX 1SYGA 2G9HD 4GDKB 1O78A 1NE3A 5M5WB 4A90A 4L23A 4GN5A 4LNOA 3HZXA 3U7ZA 1F0ZA 4H44C 1YNND 1IBML 3VR3A 1D5ZC 3TMEA 3Q6SA 1V9PA 2JQRB 1UWMA 2R3ZA 1KLGD 1TY0A 3CHBD 3HP3A 2KA7A 2WXMA 1WM3A 2E3TA 1LT4D 3AU5A 4NKLA 3PS6A 4LF8L 1CZPA 2ENBA 3IFTA 1SE8A 1PH8A 5IYDG 1EUVB 2KLGA 2CU3A 4DDID 1YN3A 4MDKE 5G5HA 4LJZC 4A93B 2DLBA 2Z6BA 4G57A 4AQYL 2EMTA 4LMQD 3RNCC 4H13C 4HSVA 4BS9A 1YJ1A 2EMSA 3JAMc 4FDBA 3P42A 4KV6A 2PNRC 1C77A 1XLOA 1IHZA 4DV2Q 2ZW1A 3MP9A 1D5XC 3J7ZC 3B1LX 2CWPA 1AN8A 2O2LD 4DV3Q 2HIVA 2QCPX 2PW5A 4DUZL 4K5WA 1J7BA 1FO4A 1G6ZA 3WCQA 3HIZA 4ZCKA 2UUCL 4US8A 1S3SG 5LLIA 3J7AF 1B9MA 2F0NA 1C0AA 4XXEA 1O7LA 5FO7B 2B3AA 3ND8A 1EU4A 2MP2B 3FAHA 1K8AC 4DV0L 1QUQA 2F3VA 1CKOA 3GTPH 1XEEA 3I56A 1I7HA 3PHWB 2IJ0A 3R2TA 4Z9CB 2R2QA 2UUAQ 1L0YB 2FUHB 3NTHA 2V3SA 1MJDA 5FJ8G 4IFDJ 3OWFA 3DHQA 2QILA 5GXGB 3CCJA 2EVBA 2IHEA 5D14A 4JYAL 2N9LA 4CJ1B 1BDOA 1JB7A 1LT3D 1ENCA 1QVCA 4JV5Q 4W9JA 3ML8A 3HK0A 4EQ5A 2LASA 1UEBA 1O7IA 3V2TA 3HOWB 1ASZA 3DXJC 2C7MB 4HCNB 2PMZB 3I2ZA 5ELFA 3RN5A 2Z6KC 1PH3A 1TZOA 4YT0B 1JE5A 2CHBD 3HOXB 3NZUA 2K14A 4HJ8A 4KJOA 3ZJUA 1JOKA 4LF6Q 4YHHQ 2L11A 1P0RA 4RH6A 1RWSA 4JC0A 3VR6A 2LRWA 3I4LA 2J53A 2ATWA 3Q24A 2Q8IB 5D3DA 2WX1A 1KC8C 3GTQH 4EZJA 3Q8DA 4X3UA 1IKMA 4HN7A 4QUFA 2KDEB 4NPSA 2K25A 3PREA 3I3TB 1GUSA 1B2TA 2EXZA 3JSVA 1TZ1A 4NNJB 5C5LA 3VH3B 5IY0A 4W9IA 4DFAA 4LNQA 2LGYA 4FADA 2N1WA 2HHHQ 3RFZB 2MPMA 3S17H 1A8VA 1PRTB 5I2XA 3HM3A 4TKOB 2R2OA 4I6NB 4HPLB 1DOLA 2LUMA 2W55A 1M8AA 5AJ3Q 2YU9H 4GLAC 4JOIA 4MTNA 5E3FA 3U4EG 1WF9A 1D4BA 1YITA 4IALA 4A93G 3AMZA 1V1PA 1FJGL 2GVAA 4AIMA 4C3JB 1ZXIA 2Z0EB 5J2RA 2WU2B 3VTUA 5H92C 2Q2IA 3CXCA 3CSFA 2BS4B 4YWGG 2C60A 4WJ3M 4GOPB 2MO0A 3PRMB 2L0TA 2X69A 3NBHA 3DCGA 4DHJB 3OWEB 3T3NA 5G2NA 1NAPA 5LMNL 4LFAL 5EJWA 2M0XA 1RTNA 1GB4A 3KBXA 4HIOA 1HFNA 2O2VB 2PVOD 2N1VA 4M00A 5DPTA 2E5LL 1YZ6A 2F0GA 1WH3A 1XPUA 4DAPA 4KKTA 3TBIB 5AZFA 2M2LA 2B76B 4DV6Q 5JJLA 4DAVA 4R8NA 1AE3A 1NDDA 1VQPA 4ANWA 2AQ3B 3BVGA 3GE3C 2KOLA 4X64L 1MBYA 1KRSA 1VF7A 3O13A 1E1OA 1A62A 4N8X1 4ZQ3A 1LT5D 4TRDA 2XVSA 5CGKA 3AU4A 4ZRIA 2JY6A 2SOBA 1WSPA 3AYHB 2ZTEA 2F0JA 4JI8Q 1J8IA 5MPOA 3HOVB 2OCEA 1N36L 2BS3B 3CW2C 2LI5A 4BBSB 5ISRA 1YJIA 1Y1VG 2ONQA 3R66C 1ONLA 2EY2A 1S40A 1N8RC 1JW9D 1C4CA 1SE9A 1T0QC 2NVUI 3I8ZA 1KTKA 5EE9A 1SFOB 3U30A 3HOXG 4FA6A 2C9OA 2F1MA 2LS01 4X6AH 1Z5SB 2HD5B 1VQ8A 4MGYE 1SIJA 2NZ1D 1WZ3A 1ZXTA 3AQQA 2JXXA 4NXMQ 1WD1A 2C9WB 4ANVA 2NCNA 5KHQA 1NBFC 3DM3A 3MZ5A 3AEGB 1XXGA 4K8IA 4DR6Q 2MBQA 5KHOA 2R92G 2MBEA 3Q23A 1PZJD 2REXA 2WHIA 4C7ZA 5KYIA 1Y1WB 1Y1VH 3N32A 5HGQA 3W5VB 4XDCA 3AE3B 2XWJB 3G7LA 3HOXH 2H1EA 1SGHA 2F0OA 4UHVA 2WP9B 4QMGA 3FC4A 2E2DC 3BWUD 1TWCB 2NWGA 3KJOA 2VH1A 4URKA 2Z6KA 3FP9A 2DN8A 2B63B 1RD9D 4JI4Q 3AH7A 3I4MH 3AE7B 4XGAB 2R92H 3FKIB 3DPDA 2VUMG 3EROA 4HAEA 1TT5B 4C4VB 5JEAJ 2M8SA 4TKNA 3DM1A 4RMFA 2WACA 4C3JG 2UXDL 1J7AA 5C4HA 2I1KA 5IN7A 2GOWA 3VTVA 1E7PB 1N33L 2N9KA 4D2KA 3NEMA 1O80A 4I7ZC 1VMCA 2PI2E 1RLFA 3DMUA 1YJ9A 4KI0A 1MSHA 4DUYL 3CAMA 1C7YA 2BOSA 1K50A 1WXMA 4LUVA 2XEWA 2W3SA 3P63A 2ZZPB 3A9KA 5BYSA 4N59A 2VUMH 1X3GA 3HGBA 4FHKA 1VQLA 2FFKB 2WAQB 1W2BA 3QWNA 3KWLA 3S1NH 2F0KA 1OQQA 2ON8A 1STGA 3AFPA 4RGOS 2F0SA 4MNOA 3ZIMA 1MJEA 3ZYYX 1BF4A 1F1HA 1SLJA 3K8AA 4JBWA 2BBCA 1HNWQ 1H8CA 3UE1A 2JK8A 1D2BA 3ZDTA 1VQIA 5CV8A 2HT1A 1TWHB 4R3DA 2LWPA 1KL9A 2FJ2A 1TY2A 1K53A 1WYWB 1EUJA 3E9HA 1EWHA 2VQFL 1HR0L 1EEFD 4K5VA 2KUMA 5EGTA 3VR2A 1UBIA 1X1MA 2KKCA 4KHPQ 3B2GA 3O65B 4LW1A 2LEKA 1J0GA 1ICFB 4QGUA 1I4HA 4W9HA 4ITKA 1SEBD 4LF4L 3HOVG 5G3LF 1IW7C 1LXDA 1CSQA 4BBSG 2LGXA 4F8CB 3ULLA 4F7XA 4ZHPA 1BQQT 4CDCC 3VDYA 4IFDI 3DBLI 3KF8B 5ELCA 1PZKD 2HDLA 3P4PB 1UUPA 2F0LA 3G48A 3LX0A 4USAA 4EOYA 1VZ8A 4OEMB 5IWAQ 5M3FH 1SN8A 3DVNU 1J8CA 3H0GH 2WXPA 2K5PA 3PLUA 1IYVA 3HOVH 3UI2A 4TVAB 4UP8A 3FILA 4YTNB 2EYMA 1HA5A 5BMIA 1E24A 1Y1WG 4BBSH 1IBMQ 2QA4A 2IT1A 1MPEA 1F2RC 4HDOA 2Z9HA 3T51B 4X65Q 1SFOH 5FOBB 2BDNA 3J81i 4BBRB 1JWMD 2ZM6L 1WRDB 2ZNVB 4A3KH 5J1ZA 4B3TL 2DBYA 3C46A 5CTRC 4TQ0A 4ZAIA 2Y5CA 1P3QU 1P7FA 3I63C 4LF8Q 2WXFA 2B63G 4P2CB 2VZKD 2WXGA 1ENFA 4GSWA 3WAOA 1VQ5A 1GC7A 4OO1H 4GU2A 3FKIG 4AQYQ 4CKBA 2KAJA 5KNBA 3MC0B 1E90A 4A3OA 3ZW3A 1JALA 5EKIA 2VS1A 3N9YC 3PUYA 4CO7A 3AB9A 3DWMA 3PF4A 2XK5A 4QF4A 4NAWA 2BB5A 3PZ7A 2PTLA 1IZ6A 2HIXA 4DUZQ 2DGYA 4A3EH 4YXDB 1S1QB 3K7AB 1ROEA 4BY7B 1FM0D 2UUCQ 4DNRB 1YN4A 1ZEQX 3C1EA 2B39A 3RLNA 2IBIB 4PMCA 3KW5B 4B95A 3FKIH 1CMXB 2JX5A 2I5LX 2YLMA 2UU9Q 2WAQG 4IOAA 2AWNA 4LDTD 4DV0Q 5IP4D 3LWUA 3NG0A 1GAQB 4EQPA 1WXQA 4AJWA 2KD0A 3D32A 2ALYB 4DXFA 4CHKA 4W9CA 3KUPA 3U4VA 3AE2B 1CQVA 3QIAA 2CHZA 3TREA 4TV3A 4GKJL 1EY4A 1UWXA 4N6EB 3S1QB 1DCZA 1BT0A 1DYQA 3NOBA 2LVPA 4ULLA 1EY9A 1XCQL 2K28A 5LL6S 5CORA 1DGJA 4JYAQ 1GO3E 2A5UA 1EY0A 4B3SL 2KQ3A 4FYDA 3TEZA 1HZ9A 2AWOA 4OWXB 1ET6A 2NTSA 3NELA 4J8QA 1DOIA 2QKIC 3VYUA 1K0RA 2WNMA 1CT1D 2KHSA 4HIKA 3S15B 3VUXA 1GOZA 3P20A 3KUZA 1SNPA 4M8NA 3PZDA 1X32A 3OTOL 1JQYD 1IW7D 1KAAA 5IT9c 1CA5A 3L16A 3M95A 3I4OA 4A4IA 3CCVA 2N9PC 4HDQA 4K3BA 2NN6G 3MC8A 3GTLH 1VMPA 3T13A 2GBKA 2I5MX 2MSED 2RCNA 3BK2A 1GPXA 3BG3A 3GTGB 4L5SA 4KGTA 1A2TA 3S1MH 2L55A 3OMGA 2E2JB 4ICUA 4NQKE 4JIOU 2FIDA 3VHTC 1GVPA 3AM9A 1WGYA 4JBKA 4YY3L 3KF8A 4P72A 4BWGB 1ACCA 1Q5WB 4BBRG 1B4OA 4ZYSA 1WYDA 3NHHA 1CFMA 4JI3Q 1II3A 4AH6A 1JE4A 1QB5D 2Z4HA 1WMHB 1TWFH 1PMRA 3D4DA 2J4XA 3CQZH 2IGDA 4UAIA 1SMXA 3RZDB 2BWFA 2JUOA 2V3PA 3MC9A 4EE2A 1TR5A 3J81c 2N0SB 4RKLA 3CCUA 4N9TA 1AFPA 3ZRFA 2CVRA 3EA6A 4LK0M 3TS0A 1K8RB 2F4VQ 1KD1C 3S2AA 4XYOA 1CHQD 4XQJA 1L5PA 4BY7G 4ZRQA 1OEYJ 5LMNQ 2OHFA 5E4XA 3HKSA 3EVQA 1HXYD 2L1AA 1I4XA 3IAYA 2GBNA 3MHZA 2WXIA 4MGZE 3WA0A 2OQ0A 4HVBA 4IZ8A 4P1CC 2KZRA 3CC2A 3K9OB 1X6OA 2A6EC 4IWQA 1L2NA 2G45B 2E5LQ 2YV5A 1XMOL 3H7PA 1VQMA 1WX7A 1Q90A 5CC4A 4GZYC 2BH2A 1SSNA 5DPRA 5C23A 5EPKA 2KHJA 1X54A 1P8LA 3W3AA 3K7AH 1JJCB 1OXUA 2QW7A 2Z0SA 4DR1L 4BY7H 1DZ1A 2J42A 4P16A 5M5XH 1KNEA 1D7QA 4X64Q 3J9CA 3M3YH 3IFDA 1MI2A 2K5WA 2MJ8A 1OTRB 1RYJA 3QR8A 4A3GG 4IUQA 3H1UA 2B8GA 1E8WA 4JPSA 2NR2A 1V8QA 1L6UA 1GG3A 5DPWA 1ICWA 1OXXK 1N36Q 4A6QA 4KY5A 4E6IA 4IO9A 2LMCA 1PYSB 2WXRA 3J80E 4B0EA 1VQNA 1WTXA 1EOTA 3PTFC 5JHAA 2AUJD 2NVTB 2BYFA 3ERQA 4ME3A 3S2HB 4B9WA 1TQOA 1JWBD 1SXTA 2Z1CA 4CDDC 3GTMB 1I4RA 1K8OA 2PE9A 2J0TD 5KYLA 1B9RA 2EYOA 1WVLA 1VQ4A 2ZXRA 4A3GH 5DCNA 4C2MB 1NJIC 3PHXB 3A4SC 1MKHA 2L0FA 1ZYRC 4PK1A 1K83B 4B9KA 4MJSB 3NS8A 3UIPB 2N78A 2K39A 3I72A 3GTKH 2JRHA 4KX6B 1FXTB 2JSVX 3BDOA 1V86A 1L2FA 3T16A 2MA9B 2ZTCA 1Z7TA 1LYLA 4X3KA 4RGMA 4IUTA 1AH9A 1SB3C 2G1EA 4G3XB 1UE6A 3RD4A 2DWQA 1H9SA 4K14A 4KHVA 3SEBA 3K57A 3PCOB 3DBRI 5C5MA 3AE4B 3FKYA 2F0FA 1MHWC 2UXDQ 3DUZA 2PNHA 2CR5A 2IGGA 4A20A 5CV5A 2DZKA 1N33Q 3DHIC 4FP5D 4CDEC 2D07B 1PFDA 5IGDA 1C4PA 3D31A 3K0YA 2PI2A 4PQXA 3JW0X 3JVZX 4DUYQ 3NENA 1HNXL 3TSSA 2I07B 1X65A 1W6KA 2UUBL 1BVSA 1AYFA 4IOCA 1AEXA 3PRPB 2G3QB 3EBEA 4DA2A 2KJ6A 4HLEA 2KTRB 4XT3B 1NR4A 5HHDG 3VA5A 1JWAD 1JMLA 4OVUA 3GOEA 2BH8A 1X9NA 3PO2G 3PLVA 3OYYA 2K1FA 5ELBA 4KHZA 3TEHB 1EIFA 2A68C 1V9JA 2PE6B 2BDOA 1CM9A 3C19A 2ZJQA 4II2B 4MACA 1T9HA 5AUIA 3VUYA 3AI5A 2X6LA 2XRSD 2EYFA 2L4NA 1YHQA 1TWAB 4LF7L 2MBOA 2F0VA 1HE8A 4YSYB 3E56A 4WJWA 2VQFQ 3D6CA 4OWTB 1HR0Q 1WGDA 3HVDA 2MH7A 1C78A 1D6EC 2KTFA 1W6JA 1VQBA 4DN4M 1KRTA 3PO2H 4LF4Q 3Q8BA 5I6YA 4HR7B 4HRSA 4I6LB 2KACA 3NVZA 4J15A 2XGTA 4GLSC 3K5LA 3W1YA 3LWEA 3T3OA 2K33A 3NWSA 2MFIA 1QE6A 2KYWA 2N4FA 2AMCB 4DAMA 2PMZE 1ESRA 2N7JA 3PGEA 3TP8A 4C1NK 2UYZB 4ID6A 3JAMi 4BY1B 5LXIB 3P4RB 1U9RA 2K05A 1S5ED 2GBRA 4AP4C 2JVCA 2P5ZX 4B9XA 2A73B 5IGCA 3S2HH 3M9BA 2OXPA 1R4NI 5IYCG 2ZM6Q 2IWHA 2DJGC 4B3TQ 3NQIA 1ZYRD 5C3EB 3CD6A 4ZRJA 1P1AA 3TL5A 4QL5A 1E7ZA 4ILWA 1VRAB 2QJLA 1G6PA 2INCC 2FNJB 2Y5BB 4TSSA 1BCPC 2MGSA 3Q3FA 4MZ9A 4UPAA 4WAAA 1YEZA 3MXPA 1WGKA 2R7ZH 1FRDA 1ZUD2 3MFGA 5BN4A 4JI0L 1IBXA 5AEKB 5GAEC 3OIPA 1LABA 5C44B 2LXJA 1MG4A 1BBXC 4W9FA 2LFIA 4A3LG 1D5MC 4C3HB 2H4OA 1TJEA 3HOYB 5I2YA 1F2MA 2JZ3B 2EJFC 4H02A 3M4OH 3A9JB 2KJHB 4NAMA 5A35A 3DBLB 4X57B 1E10A 1EFID 3APDA 3NS1A 3QWZB 3PV0A 2KOXA 1Q1BA 3P1HA 5EBDA 1HZ6A 1GB1A 4DKAC 2KDMA 4A3LH 3SK6A 2JWZA 3QAQA 4FLHA 1JCKB 4QQBX 4HCEA 3ICEA 4GKJQ 1O7YA 1SMYC 3TDQA 3E5SA 3PO3G 1BO0A 1XJVA 4L6TB 1KDAA 1N5WA 4GGQA 3TN2A 2JA8B 4M0WB 5HI1A 3GTOH 2PQAB 2A68D 4CKCA 4B3SQ 2VB2X 3RN2A 2BW2A 1VQFA 2LZ6A 2E8GA 2A4ZA 4K81A 4XYQA 2F0UA 3V60A 1ZP0B 4NW2A 3UQBA 1SBBB 4DHZB 2PLPA 2LFNA 1LUZA 2JF5A 3U9SA 3EUB2 2ICIA 3BJUA 2HJ1A 3QX1A 4Q2JA 1KNAA 3VR4A 2UXCQ 2DENB 4DDGD 3PO3H 1WTVA 1P98A 4A3MH 2V9HA 4APVA 3OTOQ 4GKKL 1XLPA 5DM63 3F2DA 4JG2A 1JRPA 2K32A 1NMGA 4LK1C 1G91A 3ONAB 3T9LA 2FCMA 5J3BA 2ACZB 1B44D 1E0BA 5K36H 1PQSA 1LTRD 2KCNA 4JI7Q 4BY1G 4IN3A 2L32A 3ZNHB 2MBBB 4S17A 1CQFA 2N7DA 5IP9G 1Z47A 5H8YE 3RNBC 3DVGX 4ABNA 3RI7C 1E7VA 1QJOA 3HM6X 4WIPA 1QWYA 5CHWA 3NRZA 2K5HA 2FCQA 3CC4A 5K5PA 4XYCA 3SHQA 4HTHA 3IL8A 4G4KA 3ULJA 5C3EG 2YVCA 4HPMB 3GV6A 4IWOA 1LM8B 1Y8NB 1XNRL 4OZBA 4HEDA 2KJRA 1TGZB 4OVVA 3L13A 4A3IB 3KLSA 4X62L 5IP9H 2PW9A 3R8BA 4AUQC 4EQNA 1L6VA 5IIFA 1S4ZA 5IYDH 4EZKA 3CF5A 1WX8A 5C44G 3Q3NC 4JE3B 1CSPA 4ICVA 2IY0B 2LHEA 1BCPD 2RSOA 2JRIB 3VUWA 1EWCA 4PMBA 4C3HG 5C3EH 3TZUA 1T3QA 5DM73 3HOYG 1KLUD 2C7NB 4F7ZA 3GV3A 2L1BA 4XDDA 3ZXRA 1U5KA 4O42A 3WOEA 5IGFA 1YHAA 4LJOB 2D3CA 4DK5A 3FHWA 1IUEA 2LKVA 4DR4L 4P73A 3E9SA 1L1OC 2HCIA 1WD0A 2LGSA 4IJHA 1NMFA 1QCBD 1K8GA 2WAQE 2AQ1B 4QUCA 1VDVA 1TVXA 2J0KA 1SSOA 1RKNA 2HJ8A 1XNQL 2PPBC 2K50A 3AEBB 4OZAA 2XN9C 2VW9A 4KGRA 4MIUA 3EFCA 1L1OB 3J7AV 1TS3A 4RA8A 2V4IB 3RPFC 1GD7A 3ZTDA 2CH4W 2R61A 4A3DB 4RGTA 1TWGH 4Y7NB 3C2PA 2KX0A 2EYPA 2I46A 4HEA1 3LYYA 4EQOA 3H6MA 4Q0FA 2KLCA 3D3RA 2NVXB 5FJ8H 1G6JA 2IY1B 5JHBA 1AZQA 5M9OA 4IPCA 5D2MB 1SMYD 2ZVNA 4C3IG 2KHIA 3M4QA 4IJLA 3Q22A 3LDZE 3NZ3A 1QOAA 5T8IA 5J17A 2KDIA 4GS3A 2QDBA 5CMDA 2JP1A 3OW2A 2RPVA 4W9DA 3S2DB 3IT4B 3JYUA 1WZ0A 4NZLB 1STHA 2CWAA 1T0SC 2CU1A 5FLXc 4YWLA 3DEOA 1RFAA 1PRTC 1SF0A 5JVH3 1WXVA 2MHJA 3BZKA 2VRRB 3Q8AA 1ZPSA 5TSSA 4RG1A 4UP7A 1E7UA 5BYRA 1E9MA 4C3IH 4RCOA 5C0XI 4JW0A 4FXGC 3G6JB 2LXCA 1UNSA 1WXSA 3N30A 1PTOB 2NMQA 5M5YH 1RF2D 4PS8A 4HJ5A 3SU8X 1L0VB 1STBA 3I3CA 4GDKA 5M5WH 2DNCA 1ILQA 4GOPC 1E2WA 2M19A 2DYOA 4E71A 2KCMA 4YTPB 1PYWD 5ELOA 4JI2L 1R4QB 5CV4A 2WKDA 3AEDB 1E0ZA 3KJPA 5C4ZA 2RSUA 4PV1C 2E74C 2UXBL 4HPPA 4A3IG 1PDQA 1QOGA 5JXVA 1HHVA 2ZW0A 4DV1L 3H3VI 5D6JB 3KYHC 4R4QA 3MTSA 4IM2A 2LHDA 2XIWA 4A93H 3CMAA 2HD3A 3IBEA 3F2BA 4ARIA 1B9NA 2J52A 2BYTA 4HCSA 5J18A 2UUBQ 3AMUA 3MHBA 3DBHI 2R93B 4MHEA 2E2IB 1SYFA 2JU6X 3AXCA 3PSEB 3MXGA 1UE1A 2NB0A 1FNUA 1X3QA 2D3AA 3UGBB 1UBQA 3S1RB 1N60A 4AYBB 4PS3A 3GTJB 3K5NA 1U4AA 3NQTA 1VQHA 3MFYA 5G55A 1WTRA 2A1AA 4HK2A 2MP2A 4NJ6A 4BOSC 2KVZA 1H4RA 2YTVA 2N3SA 2M4NA 4MSMB 1E8YA 3JC66 1QOBA 1XMQL 4LF7Q 2RGFA 1LFDA 2KVRA 3HOWG 2HTHA 3KWVA 2LXAA 2IGHA 4DK3C 5LMUL 3ZDMC 1DGSA 2KHWB 3Q3MC 1U4PA 3SGIA 1JT8A 4G50A 2AHOB 1O7ZA 3CCLA 1M90C 1JROA 2X38A 1A3VA 1IGCA 3DBRB 2Y5PA 1HZCA 4GN4B 1SYDA 1L1OA 1Y8OB 4YCUA 5HURA 3PF5A 4K1RB 5DAUA 3U52E 1F77A 4PG3A 3H94A 2MBHA 1YNXA 3HOWH 3VRAB 4F1SA 3APFA 2BF8B 5ELNA 5IODA 4LJPB 4QCLA 5JPMC 3DHGC 3T1HL 4A3CG 2KT7A 1GXDC 4F8MA 1I4GA 3GDEA 3MA2B 1PRTD 3M4YA 2OEOA 2MJEA 2GN5A 3NK9A 2MJDA 3HOUB 4A8XC 2OQKA 3SK4A 2NVQB 2KMAA 2WDRB 5HGTA 2A74C 2WB1B 3X0WA 4B6WA 2V4DA 2JE6I 3J7YW 2RCFA 5I9OA 3J81E 3W2DA 3GZNI 1X3PA 2Y0SB 1FIQA 2QC8A 4W9KA 3TEYA 2FE8A 5L83A 2NPTB 3WOFA 4A3CH 3GP7A 3K5OA 4DR7Q 3HS0C 5LMNW 2BCOA 2F0WA 4JI0Q 1Q0WB 2OOBB 1IGDA 4DHJD 1BKBA 4R4TA 3V96A 1L7YA 2CS4A 3DVGY 4RM9A 2LRUA 2K5VA 1MJCA 1HTQA 2XSCA 3UE0A 4R4OA 2JQOA 1I94L 2FCNA 1I50B 4PZ6A 1JJ2A 2JPHA 2VH2A 4C3JH 5EDSA 3AEAB 2QIEB 1GJZA 1MIUA 2D2QA 3ETRA 4HMJA 4IUVA 5FO9B 4EX5A 1PH9A 1E8XA 4HXDA 4WWOA 2R93G 3ABVB 3ZVVA 1IL8A 1J5EL 2KMCA 5BYQA 4ZDVA 4GOPA 4DR2L 2VNUD 1BXTA 1A0IA 3S16B 2CQAA 2EPBA 4QIWB 4HJ7A 2K52A 3KUCB 2RQXA 2D0PA 1G291 4WH4A 2KBNA 4AYBG 3VR8B 5CBEE 3MVVA 2K8CA 3N1YC 2O2VA 4A3PA 3S14B 3KLRA 4FXKC 3TS2A 3PO0A 1E2VA 4C1NI 4GNXB 1N32Q 3U50C 3ZJVA 2E2IH 1PA6A 1KABA 3UDFA 1R4NB 1QOFA 3H7SA 3RZOB 1GC6A 1WTPA 1IPGA 1V49A 1PLFA 2FMCA 1RHPA 3UDGA 4GDLB 3GTJH 4S3SA 2B2WC 1C4AA 1H95A 3V62A 1LACA 1ET9A 3B0AA 3RD2A 2L83A 3KOJA 2FHTA 2NUCA 1FGUA 1QNKA 2EDGA 1VQKA 4KV2A 1VR9A 4KSLC 4ZUIA 2BT6A 1IBLL 3CP0A 1H9RA 3Q0AA 4GKKQ 2VL6A 4OIKA 2ZNVC 3L08A 1PFMA 4TQUS 5EE3A 4JI6L 1PV4A 1SYCA 3DVNV 3GE8C 1JOQA 1D8LA 2EY5A 2INNE 4DV7L 1IYUA 1E8ZA 3QK0A 4PS7A 3B9JA 4R1JA 2RHSB 1I6HB 3VR9B 5IYBG 3NUHB 1DOMA 5KEEA 4BOZB 3HOUG 1WE7A 3HG9A 1PGBA 3NPPA 2PZTA 3H09A 3D4RA 4OW0A 2JEBI 1QQRA 1Y1WH 2FUG1 1QT9A 2Y0SG 4A3BB 4FJYA 3BZCA 4B3ML 3CF6E 5IGGA 2KANA 1XNRQ 5ELDA 4N9PA 1LTTD 4ZRZA 3A1QB 2KO3A 2M56B 1TWCH 1ISNA 3KYCD 1K52A 1Y69U 2QEXA 1Q81C 2Q2TA 2KX3A 2B63H 3UI3A 4JQWC 1FL0A 2JA5B 1JR0D 3UF8A 4C4VA 1IL2A 2QCZA 2LSSA 3E6ZX 2BQQA 4FJVB 3WAPA 1VQ9A 1M1KC 1SE4A 4JCVE 2FINB 2VXWA 2OJRA 2K22A 3P1MA 1NENB 3RNUA 5H1SE 3ZJYC 1XYIA 5BMGA 2HDEA 5JAVA 3HKZB 2Q5WD 4DR4Q 2QEJC 5JJZA 2LUEA 2W82A 1JOOA 4KDLB 2L12A 4TMAB 4BBNC 3L0OA 3T56B 4BAXA 4DAYB 1HR0W 2PKOA 2QDFA 4DGZA 1XNQQ 1E5WA 3TEXA 2PW7A 3RR5A 4DK1A 3URYA 1AWDA 4DF7A 1YD8U 4POFA 4GOCA 4QJFA 2XWBB 3IT6B 2BTEA 1KOTA 4ZHOA 2Z4IA 2BS2B 4KIKB 1A3TA 2IZVB 4BKGA 1TKGA 4L1BA 1TWHH 2BKRB 3AEFB 1LM0A 5C6AA 1DOYA 1TT2A 4QB4A 4A3JB 4OXPA 1TIFA 4FF1A 1YN5A 3AFQA 3WANA 2SAKA 2N9EB 1NVID 3T4AC 1N62A 4AQ7A 1C3TA 2HTME 1A5RA 1NR2A 3GQBA 4P1BC 3QJYA 5BN5A 1HTOA 3EN2A 1H9KA 1LTGD 2CJNA 2PPHA 3OJ4B 2KDBA 3ER0A 2K9XA 1QLBB 4ZRPA 1AP0A 2WINB 3DWPA 4UY8C 2KWVB 3EGRA 4XE0A 2YTXA 1CK1A 1T0YA 4YWKA 1VD2A 3NZSA 3VH4B 2NN6H 1C1YB 4JL9A 4WURA 3BYYB 2LD9A 2JA6B 1ZKHA 2WDVB 1VQDA 1JICA 2B2WA 2Q8TA 2FBWB 4WWPA 1RDPD 1I3QB 1VDZA 1C8CA 4FF2A 1FJGQ 1YMHE 4HCPB 2A6HC 3OMCA 1A63A 4I6PA 3E9IA 4JI2Q 2MWSB 3GD7A 5EPJA 4WJ4A 4R8IA 4V190 3ITPA 4KY7A 3NVYA 2N8NA 4BBRH 1IP9A 1V97A 2UXBQ 1Q8KA 2ZXOA 1I6HH 3ZNZB 2F0MA 1UZXB 5DPSA 1BCPF 3K5MA 1EYGA 2KCCA 5KGUA 2SNMA 4WRDA 3HRDD 4LFAQ 3RMKC 2BE5C 4FXCA 1I4PA 1SNCA 3P75A 3NXWA 1IBKL 3VQIA 5T1IA 2JA5G 4K3CA 1B70B 5AFWA 1XT9B 3BY4B 2AX5A 5IGBA 2J0JA 2R7FA 4YWMA 3QC8B 4A3FB 5CV6A 5LL6X 2E2HB 3AE8B 3WALA 1PH6A 2QMTA 5F2DA 3TP6A 1KIXA 3Q8CA 4YSZB 4XC2A 3I73A 2TSSA 5C4JB 2JA7B 2O4XA 1S5BD 4GN3B 4O2DA 1YNTE 2KWCA 1NUCA 2DUDA 2KJXA 2M00A 3NUCA 2LXKA 4RHSA 4WFN3 2O6VB 1RFKA 3A33B 3GO5A 4KGSA 2F0EA 1FCCC 5EE0A 2UUAL 3MJWA 4KDIC 1XMQQ 1HNZL 4LFBL 1WJJA 3RZWC 2EJMA 4ZUJA 4EVOA 2B29A 5C3JB 3D6WA 1UD7A 5LMUQ 1FNVA 1LLRD 4MELA 4P71A 3IHPC 1YHBA 1F2ZA 2QHOA 2A69C 4DAYA 2IX3A 1YIWA 1BR9A 1Y56A 3S1QH 2KQ7A 1EYCA 1Q3LA 4ZKCB 1N5XA 3VVWB 4OONA 1KFYB 2ZXPA 3A5UA 4RAUC 2UU7A 4FO2A 5IOIA 1KDCA 1E3PA 3PUXA 4A3JG 2L0CA 2V1CC 3I4NB 4XDXA 4DHZE 4IG7B 1K28A 2AL6A 4KIKA 1YQ4B 2H88B 4IUPA 4MM3B 2DYMA 3S15H 5M3MB 1JORA 1SE3A 1JMCA 2Y3AA 2ZJPA 3W9CB 3UIOB 3T1HQ 3DBHB 5JH5C 5BN3A 3JAME 2ZVOA 4RNAA 3STBC 4LF9L 4QY7A 1RM6C 3BINA 3SK5A 1FMAD 2D9UA 1F9RA 2CHWA 2K01A 5I6WA 4A3JH 1T5XD 5IGEA 1UAPA 4CDFC 3H15A 1Q8IA 2JA6G 1T5EA 2DY7A 3HFZB 3NBIA 3BS1A 2EELA 2ZPYA 2HCCA 1BUVT 3GTGH 3MXNB 1WI5A 4JLCA 1BBWA 1JWSD 1PYBA 1L0WA 2F0QA 4CBVA 2E2JH 4ASWC 3DDCB 2HHHL 1AW7A 3TCAA 1NI3A 4KD4A 2MNAA 4RF1A 4RKBA 3U9OA 1A15A 3LJ3A 2A6HD 1HA6A 4KN4C 4YSXB 1WMHA 5JPNC 2KK8A 5EPLA 3KH0A 1S5DD 3RZDH 2ZT9C 1I3QH 1I94Q 1C9FA 2PZUA 2TMPA 4NDXA 1WTWA 3I5JC 2B2TC 4DR3L 1GHKA 3CU7A 2A5HA 4OHJA 2M0AA 2CW0C 2BE5D 1J5EQ 4MGIE 5TR5A 3TQYA 4OO1I 5IOCA 4DR2Q 2O5IC 3VRBB 3KF6B 1HFGA 3ML9A 2H5XA 4ANUA 1FD7D 1X56A 2EYJA 3J80L 2JA7G 5DNFA 3A74A 3SFDB 3FVQA 1Z2MA 1YQ3B 1G51A 3AE5B 5C3XA 5C0XG 4GIVA 1K9MC 4MT5A 3TJPA 4PNYA 2PVGC 4DV6L 1GUWA 3I7FA 1V5OA 5AUKA 2KN4A 1CKNB 1TIID 1Z6HA 1G2SA 2N55A 1CZWA 2D11A 1SE2A 4BVUC 2HQEA 5EKLA 2IYDB 1RRBA 3GZNB 3HUIA 3R7RA 4IOIE 1BOSA 2JXTA 2LVQA 3CMMB 3IG3A 1H9MA 1CJEA 3PV1A 4IWPA 4WWMA 4WAFA 3K0XA 3ULPA 1Q1OA 4FBJB 2F0IA 3M4PA 4JI8L 3RLFA 5C0XH 1DONA 1HZAA 2WXJA 1WJ4A 1M4VA 1K0SA 4MTKA 2C35B 4KMUC 1WM2A 2NZHA 3W5OA 3JAML 2N7EA 1WGRA 2PCFB 3I4NG 4RHRA 2A69D 4KKIA 5FLMG 2MW5A 3L4PA 4LCDE 1KM7A 2HE7A 2IY5B 4JI6Q 4YL8A 1DOKA 2EKEC 1PRTF 4O0AA 2NVTH 4DXAB 4DV7Q 1UELA 1U4RA 3RULA 1LTSD 2WKCA 2DNFA 2NBUA 3GTMH 2G4DB 4S0RA 1EQVA 1NYRA 5D7GA 4AWJA 1CKMA 1Y8PB 1RAXA 2W54A 3M7NA 2DHZA 3WWVA 2K8HA 4K7WA 4C2MH 2OTLA 1EQRA 2V4LA 5E7NA 3C3LA 1MHHE 1Z9FA 1PGXA 4K0KL 1R4MI 4FULA 1KLVA 3W5UB 3ZGZA 1V80A 3A4RA 1SDFA 2KDFB 2DNEA 1K83H 3Q69A 3STBD 2IO3B 4MJSA 4AJYB 3I90A 2LJ5A 4B3MQ 3RT3B 3OIQA 5GQOA 4G7ZC 3HVZA 3L10B 3P4SB 2D2CC 5FK9C 5IYCH 4CKEA 1A70A 1V2YA 2CKHB 2BKFA 1SNOA 4P74A 4BA1I 4REZA 2M17A 3K7UC 3TP7A 2VY3A 2EZVA 3CCQA 1WFQA 4DV5L 2IX0A 3R3OA 4RGNA 2MLBA 3NJTA 2SDFA 3DWAA 1STEA 2LY7A 1L4ZB 3GTPB 1QUQB 2AQ2B 2CFMA 3P7JA 3B6YA 3I55A 4GXBA 3U8ZA 1MG8A 4GLXA 2ZCCA 1FYCA 1SNQA 4B08A 1B1ZA 5L37A 2RKSA 5EKKA 3CPWA 1EM7A 3RUZA 1B3QA 3NTKA 1FCLA 2DJFC 4UDUC 1TU2B 2V0GA 1EEID 1TKYA 2K5QA 1EIGA 2VZAA 2MUYA 2XRQD 1I5FA 3D0FA 3KLWA 4P75A 3SR6A 1LTID 2JZZA 2CW0D 1KAWA 1LTLA 3OOCA 1Q46A 2KTRA 4F88A 1J7CA 1K51A 1UF0A 2RHQB 4AYBE 1HNWL 3RCZA 3AU7A 1YOVB 2KMMA 1WOCA 4RMAA 1F2RI 3L0WB 1WCMB 2WS3B 2NYZD 4P6VF 2NBWB 3QIJA 2B2TA 3TEWA 2R7DA 4C00A 4K2KA 4KKSA 3CWIA 3VA7A 5HKHA 3HRZC 2G9DA 2IPKD 1TWAH 3TUOA 4KHPL 2RD0A 1SRUA 4N58A 5CHFA 3GTQB 4KZCA 2K04A 1CUKA 5BR8L 4JX1C 3UINB 4JI5L 1VQ6A 3HOZB 3CRLC 3JSVB 3QG1A 5KRUA 3KBGA 3B2FA 1EY6A 4L63B 1STAA 1G2TA 3S17B 3DWQA 2KNBA 3HHMA 5IWAL 1GUOA 4YY3Q 3KUDB 3J80c 2F52A 3G71A 2B2VC 2DY8A 2YU9B 2AEHA 5GADC 1PHJA 1SROA 1N34L 2INDC 4KKJA 1V1PB 3K81C 1HQMC 5EQ0A 3L17A 4ZRKA 4BY1H 3ALBA 1UGMA 2N49A 5KIXA 2PEAA 4XZ4A 4X65L 3N1XC 4RM8A 1VQJA 1QOHA 2Z0DB 2WB1E 2C5CA 3K9PB 3N3KB 1LGRA 3QOJA 1RJTA 3NBHB 4LUZA 2Y0SE 3FMCA 1DD2A 3VXWA 4H7BA 1YI2A 3RNFC 4XT1B 2L76A 1VQCA 2RVLA 4WJPA 4PMWA 1IBKQ 1CZGA 1NSNS 2ES2A 4K6DA 1YNJC 1KDBA 4IFDG 2MP1A 4OX9L 1HJPA 1HQRD 4TQ1A 1XMOQ 3E0JA 3FPUB 3DLLA 2C5LC 2B2YC 3BZDB 5C44H 1Y8RC 4NQLB 2Q2UA 3A5ZB 5KNDA 4FF3A 5C1ZA 4C3HH 1HH2P 3GS2A 4MN3A 4GB9A 1EYAA 1UEAB 3CSTA 4HJ9A 3HOYH 2UU9L 4DR1Q 5IE8A 1ZGUB 3A9JA 3PT2B 3PIOA 2UWQA 3I57A 4K7SA 5DEHA 2MQJA 3B08A 4IFDH 3IAS1 3WAMA 1MD2D 3RNAC 4QIWE 2JA8G 1VZ6A 1ML0D 2AUKA 3ERSX 1SIFA 2XBBC 3VTWA 1PH5A 4ACFA 1K8MA 1AE2A 1T0RC 2KFJA 1HNZQ 4LFBQ 1PH7A 2BA1A 1WCMG 2L5TA 2YEPB 5JZEB 2DX5B 1HTLD 4M02A 4K8JA 2WU5B 3V61A 1OFFA 4ODGA 2ZPNA 4OZCA 1CI3M 4PZ8A 1XD3B 3AEEB 2E6XA 1S5FD 5FR6A 1PZID 4HJAA 2G5DA 5CBAE 4M0WA 5J22A 2JA8H 2PQAA 1PTOC 1SR3A 5CV9A 3QARA 2GLSA 3H8HA 1Y1VB 4XTCS 2QF7A 2K6DB 1TBEA 1NBWA 1WCMH 3H91A 4NXNL 1XLNA 2J0MA 3HOZG 1N63A 1WJ6A 2D0OA 2OF1A 2WQYB 3I70A 4L8JA 2BYVE 2ASBA 1F2YA 1D1IA 1S5CD 2B8FA 3R93A 1WGHA 2JT4B 2KN5A 2MX2A 3RZFA 3SDLC 4IPDA 3SFEB 2K1BA 2OTJA 1OXTA 3BVMA 5I9PA 3I4MB 2BGFA 5GAGC 2R92B 1NEKB 5GAHC 4LF9Q 3A8IE 3ECIA 4DR5L 1M94A 1NYQA 1PH4A 2W3RA 3EIVA 2RA4A 1QNUA 4H2AA 2IO2B 1V8CA 2RDFA 3HOZH 2GBJA 5JVG3 3T53B 4HROA 1ZE3D 4LFCL 4JBJA 3IXSA 1F52A 1B8AA 1ENAA 1X55A 4IPGA 3C8YA 4JI3L 3KYDD 2WX0A 3SR1A 1HZBA 2LJIA 1YJJA 2BB6A 3EC8A 4DWFA 2VUMB 3A9KB 3OW7A 3BK1A 4LLGM 1HNXQ 1L4DB 4ANXA 3MXUA 1ZW7A 1VS0A 1UE7A 3S1NB 2C7HA 3MAQA 4WQMA 2B2VA 3IRBA 1XTDA 2PQEA 4WORA 3FRPB 4A3IH 3EECA 4DR3Q 1BNZA 2NBVB 3L7ZC 5EBCA 1EF1A 2F4VL 4R4CA 2F3WA 2AWTA 2LGDA 4XX5A 5E6NA 3QJZA 4J6HA 3UDIA 1EWYC 4LNFA 1YNJD 1OGWA 1EFWA 1HCZA 5IO9A 2KWUB 4OWWB 1HEZE 1C79A 1FGBD 1YVCA 4K5XA 1P7EA 3VFKA 2K7VA 2X6GA 4ZK9B 4BBNF 4A3DG 1VCIA 5E4WC 3M63B 2KEEA 3HKZE 1V1OA 1EOVA 2D5GA 2NZOA 2JZPA 4AS1A 2IO0B 3L3OC 2EQSA 3PUZA 4BKTA 3V05A 2KQSA 2L15A 3ZTCA 2R6GA 5IT9E 2OJWA 3Q6BA 3BDCA 3CC7A 4KN7C 3M62B 1P9DU 3I9V1 3SDZA 4HSPA 2FIFA 3RYTA 4BZAA 1EY5A 4II3B 4R9WA 5M3FB 1OQYA 2B2YA 4C7YA 1SJED 1S72A 2WXKA 3H0GB 4A3DH 4DV4L 4Y7NH 2ZTDA 4EKUA 1STYA 3N6RA 2NVXH 2BA0A 2JYOA 3FILB 1JQ4A 1XPRA 2K6AA 1GNUA 1CA6A 2JN4A 2RDBC 3PPAA 3SVMA 1GUTA 5FO8B 3F2UA 4I7AA 3K58A 3TZDA 3P2BA 4W9GA 1JRUA 1PTOD 1SNDA 4A3KB 1EIYB 2K03A 2BYEA 5JEAG 3S2DH 4J1MA 3QOLA 4PZ7A 2KWDA 2LGIA 2EYHA 1LTAD 3ZUNA 1TYGB 1FVIA 3I4MG 4CJ0B 2FAZA 3ZJTA 1GJXA 2CH4A 1UWVA 2E75C 4NP5A 3OHXC 4BA2I 2FMMA 1J19A 5D94A 4KD3A 4LWCA 3KVFB 3TRZA 3QA8A 4K0KQ 4B0MA 4LNKA 4NB3A 2GI9A 1HUMA 5IA7A 3CCRA 3J7A5 4RF0A 3A55A 1FPYA 4ZKBB 1PTOH 2XK5B 3NY5A 2GB1A 4MEMA 4NAWB 4X66L 1RODA 4A3EB 5JEAH 3PIPA 2NVYB 2MQHA 5E1FA 2VZKB 4EUTA 4OL7A 4LAAA 4IQZA 3ND9A 5IP7G 5HY6A 4UP9A 1ZDXA 3GB1A 1VLBA 2ICEC 3K59A 4DV5Q 2G4SA 1EF5A 1ZXHA 1IKLA 4N8FA 4XWTA 4X3SA 1KH0A 4GMVA 2WXNA 2KFKB 2N9XA 3X23A 5J39A 4M01A 3APCA 4EZLA 1GUGA 4OIJA 3W1GA 1QKZA 1GKHA 4LF5L 5E6JA 4CGYB 4GNXC 1AARA 1N6ZA 3EFUA 3U4ZA 2CHXA 2F0HA 4HKZE 3ZNGC 1MVKA 1FFVA 5IP7H 1PGAA 3DEPA 5IT9L 1VQAA 1Q12A 1OXSC 1EO6A 3ZLZA 4LDTB 2K75A 1LTBD 2KC2A 3SK8A 2R93H 5HG2A 1DXMA 1EY7A 3AEVA 4HJKA 1IXRA 1Q10A 3UQAA 3A7AB 3H6NA 3QHTA 2DZMA 3S1RH 2XTIA 5JJKA 1W3SA 4YCWA 1R4MB 2L00B 3LNNA 4JWSC 3PGZA 3KFUA 3FDTA 4KJNA 3LXFA 4BKSD 1IYJB 1D1KA 4JK1C 4H0LC 5M3FG 1G8ZD 2HDMA 3PMFA 4OGQC 2F0PA 4IM0A 3GTLB 3E3XA 3H0GG 3RUIB 3OPOA 3HEJA 1WTQA 2L8JA 2RMMA 3OG5A 4KLKA 3SE0A 3S1MB 5BR8Q 3X3MA 4IKGA 1XX8A 3J81L 1AZPA 2A8VA 2NS5A 4JGHB 5BMHA 1B7YB 4JI5Q 1MHXA 3Q8FA 1V43A 4G11A 3ZXVA 4BKSA 3N20C 3Q14C 1WXAA 3Q3JA 3CCSA 5GMVA 1RIPA 3T8MA 4A3KG 2RF4A 4A75A 3A0JA 1XTCD 1TWFB 3NP8A 2WB1G 3OLMD 3Q2AC 5CHVC 3CQZB 3U2SC 1XO3A 3FPPA 4BFRA 4OO1G 3R7QA 2WGSA 4KZ0A 2PZWA 2RSNA 1N34Q 3DHHC 1VQOA 3PUVA 5C4XB 3RNEC 1QF6A 2SEBD 4MH8A 2JEAI 2ASQA 1P16A 2MHVA 4JI1L 4U673 2VQEL 1YJNA 1GHJA 5IYBH 4X62Q 1FXIA 4WQOB 4R4IA 2CJOA 1S3OA 2Q2HA 1EQQA 2JWUA 4JWUC 1E2ZA 4NJCA 3HOUH 1FXAA 4DNIA 2WXHA 1HRJA 3A8JE 4DNTB 4A3EG 3PQIA 2NVQH 3PZ8A 3ZQ4A 5A2QE 2ZCBA 2CKZB 1BMLC 3MEFA 1U0LA 3NWTA 5IAAC 1R4PB 1XWEA 4JVZA 3V6EB 3IVFA 1C4QA 1OQRA 3QB3A 5AZHA 1PFSA 2NPTA 2QSDA 4XIGS 1WTOA 2I5HA 1TKEA 3ENEA 3VR5A 3H7PB 1QILA 4OX9Q 2HQLA 4C56C 3CCEA 4A76A 4G7HC 3PIO3 1KRHA 1WGGA 3Q3OC 2EXDA 4U68A 2NVYH 2XNAC 4DQOC 4GLVB 3F2CA 4NJ7A 5D65A 5M5XB 2GBMA 2B3GA 4IW0A 4W9LA 3M3YB 2FCSA 3IAM1 1I50H 2L3ZA 1J6QA 2W9NA 2RDGA 1GUAB 5FR3A 1K73C 1B50A 4IDIA 4KVGB 1BUIC 2KFKA 1R9TB 3AE6B 3NE5B 1L0XB 1PFNA 4KTAA 4B3RL 1RCVD 3S16H 2LMCB 2YYZA 3DQVA 2F3IA 4ZOHC 2K3UA 2EE1A 5C2TB 3NVVA 1MFWA 3DWGC 5COYA 1KF6B 3QQ8B 2SNSA 1E1TA 1A2UA 3MEHA 3S14H 1B53A 1R7SA 3Q8EA 3F8TA 1CTMA 3R2IA 2JYTA 3AV8A 4DPGA 1PXUA 3S9WA 4GNXA 5DLQE 3T1YL 4A3GB 1T6BX 1J9OA 1Q86C 2J7QB 1U4MA 2GA4B 1HTPA 3RZOH 5JJIA 3MHSD 1VQ7A 2I1JA 3V6CB 1WWTA 4GDLA 3GTKB 5HFYA 3L2PA 3BU2A 4NXNQ 1FFUA 4LTUA 2UXCL 1WR6E 3VYTA 4YIJA 2JJQA 1Q82C 4YCVA 4FXDA 2RPQA 4E74A 1ZOYB 2ZEQA 1XLQA 4G0NB 3NTIA 1U4LA 1XPOA 5LNK1 2B2UC 1EZ6A 4JPBW 3OAWA 1UH6A 4WWNA 1H9SB 1VF5C 2Z8LA 4DR5Q 4ARCA 4EGVA 4JI7L 1A3UA 5A2QL 4A3BG 1LQBA 3H9DA 2F4IA 3V3XA 3VYRA 5C4XG 2F0TA 4FF4A 1WJNA 3L9AX 4IUMB 2OWOA 1NI2A 4DXGA 3RLOA 3W1SC 2WXOA 4LFCQ 1TKWB 3DBSA 2GVBA 1NTGA 1LV9A 2EY1A 1ZKOA 4DV1Q 4POGA 2KQ4X 4LNIA 4A55A 1D3ZA 2KC1A 3CMEA 1SNMA 4DV2L 1ILPA 2OEDA 4W9EA 1I42A 4FHJA 2V3NA 4RWSC 4AOFA 3VDZA 4A3BH 3QO2A 4DV3L 1VQGA 1WFYA 5C4XH 3PRZA 3A1QA 5JOBA 1WTHA 2WDQB 1MI0A 1OEYA 2L9HA 3ZKJC 3KQ4A 1F9QA 4X3TA 1MGSA 2K6QA 2HUGA 4M8MA 4HMIA 1IYFA 3VYSA 3S24A 3HKZG 2PYKA 1VCBA 4KKUA 2JXMB 2BWES 3ZO5B 3LB8C 5CYUA 3TMPB 1QZHA 2LVOA 2MCNB 4CJ2C 2JA5H 2MJ3A 3WIMA 4PYUA 2M9VA 1CHPD 2Z59B 4NPNA 3NSWA 2I0QA 2QGQA 1V6EA 4DK6C 1ASYA 2WV6D 2EOTA 4F87A 3G4SA 1PH2A 1YIJA 2MRPA 1C48A 2EYLA 3PO2B 4HKQA 2L52A 1PFBA 2DYBA 2WP8J 4KY6A 3AE9B 3MJ5A 5AZGA 2J7ZA 1OTCA 3BIID 3NVWA 5FKAC 4EEWA 4XQQA 1TS5A 3H3VC 1WX9A 2IW3A 1DJRD 3M3JA 4K7UA 4MH0E 4JV5L 4IUUA 3A56A 3SXHA 4FJZA 3L54A 3DOWA 3CRKC 1C76A 4XWWA 5EE1A 2PIAA 1JC7A 3FEWX 3SD5A 4DV4Q 2WIIB 1WIAA 1R9TH 1DM0B 4LF6L 1V1QA 4YHHL 1XF5L 1PH1A 1PUTA 4CQNA 2BPSA 1I6VC 3P4QB 3NHEB 2YTYA 4NMZA 2KVMA 4IUNA 1TXYA 1V5TA 4OELB 2MEKA 1VQEA 4J6IA 4EFOA 4DU9A 1EZ8A 3D8GA 1QVGA 2WXQA 2RR9A 3K6OA 3G6EA 3AN1A 3TBLD 1QZEA 3CPFA 4MSQB 3AECB 2PO4A 3PIP3 1F9JA
chains in the Genus database with same CATH topology
2R7ZB 3M85A 1IBXB 4PT5A 3AB5A 4I65A 1JB3A 1FD6A 2WXLA 5CV7A 4C80A 2NTTA 4G7OC 1OXVA 3M4OB 1EIHA 5G5GA 2N88A 4M8AA 5T1GA 1TS4A 5NUCA 1DOXA 2D5DA 1OO9B 1GUNA 2B2UA 3BVZA 1RTOA 4HJGE 5CR3A 2JSOA 2KECA 3WDNA 3EJIA 1I4QA 1JWUD 5C3WA 5LHY1 3TEWA 1HUNA 1XCTL 3PUWA 3C1FA 5I4DA 3W1SA 2RDHA 3GTOB 2WLBA 4O1NA 4J3OD 4CHTB 3BYTB 1FNWA 4FNFA 2I38A 2YEPF 4V0BA 3CKIB 5FLXE 4K6LA 1LT6D 1MSGA 1STNA 2A6ED 2IDYA 3EQLC 3PO3B 4IURA 1SJHD 4A3MB 4L2YA 2IL8A 3IKJA 1H9JA 5ELEA 1F2LA 3KK7A 4ZLTF 5C0XJ 5G3LD 2ID0A 1FR3A 2VB3X 1E6EB 2INPE 1PDXA 1PTOF 1YNNC 1F9SA 2PMVA 2EJGC 1UGJA 1HPCA 2EY6A 4Q5VA 2I2YA 1TS2A 4OVZA 3MWYW 4YTMB 3BDLA 3SHLA 2O5JC 3A7LA 1Q1EA 1EY8A 1HZ5A 2EKIA 4M1UB 1EL0A 1FRRA 4RCNA 3M7GA 3MXNA 1EQTA 1FEHA 2Q8RE 2NN6I 3AE1B 3EFXD 1F9PA 3D4WA 1LO5D 1BCPB 1SAPA 1EYDA 4KK7A 2IX1A 1SYBA 3RMHA 4US9A 5FLXL 2JYEA 1TWGB 1WYGA 1N61A 1ESFA 2F03A 2H89B 3N52A 1SYEA 4RFBA 3TP5A 2KEDA 1A6XA 3CIRB 1ZDVA 1QG7A 2K5DA 4K2LA 5KNCA 3I91A 4ME5A 5D3IB 4DK0A 1NCVA 2OT2A 2RBMA 1VJKA 4A9AA 3X3NA 2F0DA 1WRIA 2GRIA 1EU3A 2K0PA 3A54A 4C3IB 4XQNA 5K36G 1VZ7A 4FVMA 1B3AA 5M5YB 2D62A 2NBFA 3A8KE 3OSOA 2E76C 3KLSX 1SYGA 2G9HD 4GDKB 1O78A 5M5WB 4A90A 4L23A 3HZXA 3U7ZA 1F0ZA 4H44C 1YNND 3VR3A 1D5ZC 3TMEA 3Q6SA 2JQRB 1UWMA 2R3ZA 1KLGD 1TY0A 3CHBD 3HP3A 2KA7A 2WXMA 2E3TA 1LT4D 4NKLA 1CZPA 2ENBA 3IFTA 2CU3A 1YN3A 5G5HA 4LJZC 4A93B 2DLBA 4G57A 4LMQD 4H13C 4HSVA 4BS9A 3P42A 4KV6A 2PNRC 1C77A 1XLOA 1IHZA 2ZW1A 3MP9A 1D5XC 1AN8A 2O2LD 2QCPX 2PW5A 4K5WA 1J7BA 1FO4A 1G6ZA 3WCQA 4US8A 3J7AF 1B9MA 2F0NA 4XXEA 1O7LA 5FO7B 3ND8A 1EU4A 3FAHA 2F3VA 1XEEA 1I7HA 2IJ0A 3R2TA 4Z9CB 1L0YB 3NTHA 4IFDJ 3OWFA 3DHQA 2QILA 5GXGB 2EVBA 5D14A 2N9LA 4CJ1B 1BDOA 1LT3D 1ENCA 3V2TA 3HOWB 3DXJC 2PMZB 5ELFA 4YT0B 1TZOA 2CHBD 3HOXB 4KJOA 3ZJUA 1JOKA 2L11A 1RWSA 4RH6A 3VR6A 3I4LA 2J53A 3Q24A 2Q8IB 5D3DA 4X3UA 1IKMA 4HN7A 4QUFA 1GUSA 1B2TA 2EXZA 5C5LA 4DFAA 3RFZB 2MPMA 1PRTB 5I2XA 4TKOB 1DOLA 2LUMA 2W55A 1M8AA 5E3FA 3U4EG 1D4BA 4IALA 3AMZA 1V1PA 4C3JB 1ZXIA 2WU2B 5H92C 2BS4B 4YWGG 2X69A 3NBHA 3OWEB 3T3NA 1NAPA 5EJWA 1RTNA 1GB4A 3KBXA 1HFNA 2PVOD 2F0GA 4DAPA 4KKTA 3TBIB 2M2LA 2B76B 4DAVA 4R8NA 2AQ3B 3BVGA 2KOLA 1MBYA 1VF7A 3O13A 5CGKA 4ZQ3A 1LT5D 4TRDA 2XVSA 2SOBA 1WSPA 2F0JA 1J8IA 5MPOA 3HOVB 2BS3B 4BBSB 5ISRA 1YJIA 2ONQA 1ONLA 2EY2A 1JW9D 1C4CA 3I8ZA 1KTKA 5EE9A 1SFOB 2C9OA 2F1MA 2LS01 1SIJA 2NZ1D 1ZXTA 1WD1A 3MZ5A 3AEGB 1XXGA 4K8IA 3Q23A 1PZJD 4C7ZA 5KYIA 1Y1WB 3W5VB 4XDCA 3AE3B 2XWJB 3G7LA 2H1EA 2WP9B 2F0OA 3FC4A 4QMGA 2E2DC 3BWUD 1TWCB 2NWGA 2DN8A 2B63B 1RD9D 3AH7A 3AE7B 3FKIB 3EROA 4HAEA 5JEAJ 3DM1A 2WACA 4C3JG 1J7AA 5C4HA 1E7PB 2N9KA 4D2KA 1O80A 4I7ZC 1VMCA 3DMUA 4KI0A 1MSHA 1K50A 2BOSA 2W3SA 3P63A 5BYSA 4N59A 3HGBA 2FFKB 2WAQB 3QWNA 3KWLA 2F0KA 1OQQA 2ON8A 1STGA 4RGOS 2F0SA 3ZYYX 1BF4A 2BBCA 4JBWA 1D2BA 5CV8A 1TWHB 4R3DA 2FJ2A 1K53A 1TY2A 1EWHA 1EEFD 4K5VA 2KUMA 5EGTA 3VR2A 3B2GA 2LEKA 1I4HA 4ITKA 1SEBD 5G3LF 1IW7C 4F7XA 4ZHPA 1BQQT 4IFDI 5ELCA 1PZKD 2HDLA 3P4PB 1UUPA 2F0LA 3LX0A 4USAA 1VZ8A 2WXPA 2K5PA 1IYVA 3UI2A 3FILA 4YTNB 2EYMA 1HA5A 5BMIA 1MPEA 2IT1A 1F2RC 3T51B 5FOBB 2BDNA 4BBRB 1JWMD 5J1ZA 2DBYA 3C46A 4TQ0A 4ZAIA 2Y5CA 1P7FA 2WXFA 4P2CB 2VZKD 2WXGA 1ENFA 4OO1H 4CKBA 2KAJA 5KNBA 3MC0B 1JALA 5EKIA 3N9YC 3PUYA 3AB9A 3DWMA 4QF4A 2BB5A 3PZ7A 2PTLA 4YXDB 3K7AB 1ROEA 4BY7B 1FM0D 1YN4A 4DNRB 1ZEQX 3C1EA 2B39A 4PMCA 2JX5A 2AWNA 3LWUA 1GAQB 4EQPA 1WXQA 4DXFA 3KUPA 3AE2B 1CQVA 3QIAA 4N6EB 1EY4A 1UWXA 3S1QB 1DCZA 1DYQA 4ULLA 1EY9A 1XCQL 2K28A 5LL6S 5CORA 1DGJA 1EY0A 2KQ3A 4FYDA 3TEZA 2AWOA 1ET6A 2NTSA 4J8QA 1DOIA 2QKIC 3VYUA 2WNMA 1CT1D 2KHSA 3S15B 1GOZA 3P20A 1SNPA 1X32A 1JQYD 1IW7D 1KAAA 1CA5A 2NN6G 1VMPA 3T13A 3BK2A 1GPXA 3BG3A 3GTGB 4KGTA 1A2TA 2L55A 3OMGA 2E2JB 3AM9A 3KF8A 4BWGB 1ACCA 1B4OA 4ZYSA 3NHHA 1CFMA 1II3A 1JE4A 1QB5D 2Z4HA 3D4DA 1PMRA 2J4XA 2IGDA 4UAIA 3RZDB 2V3PA 4EE2A 1TR5A 2N0SB 4RKLA 1AFPA 4N9TA 2CVRA 3EA6A 4LK0M 4XYOA 1CHQD 4XQJA 1L5PA 4ZRQA 2OHFA 5E4XA 3EVQA 1HXYD 2L1AA 1I4XA 3IAYA 3MHZA 2WXIA 4IZ8A 2A6EC 1Q90A 5CC4A 4GZYC 1SSNA 5EPKA 3W3AA 1DZ1A 1OXUA 2J42A 4P16A 1KNEA 3J9CA 3IFDA 1MI2A 2K5WA 2MJ8A 1RYJA 4IUQA 2B8GA 4JPSA 1V8QA 1L6UA 1ICWA 1OXXK 4A6QA 4KY5A 4E6IA 2WXRA 2LMCA 4B0EA 3J80E 1WTXA 1EOTA 2AUJD 2NVTB 3ERQA 3S2HB 4B9WA 1TQOA 1JWBD 1SXTA 2Z1CA 1K8OA 3GTMB 1I4RA 2J0TD 5KYLA 1B9RA 2EYOA 1WVLA 2ZXRA 4C2MB 1ZYRC 1K83B 3I72A 4KX6B 2JSVX 3BDOA 3T16A 1Z7TA 4X3KA 4RGMA 4IUTA 1SB3C 2G1EA 3RD4A 2DWQA 1H9SA 4K14A 4KHVA 3SEBA 3K57A 5C5MA 3AE4B 2F0FA 3DUZA 2IGGA 5CV5A 4FP5D 1PFDA 5IGDA 1C4PA 3D31A 3K0YA 4PQXA 3TSSA 2I07B 1W6KA 1AYFA 1AEXA 4DA2A 4XT3B 1NR4A 5HHDG 3VA5A 1JWAD 1JMLA 5ELBA 4KHZA 2A68C 2BDOA 1CM9A 4MACA 5AUIA 2X6LA 2XRSD 2EYFA 2L4NA 1TWAB 4YSYB 2F0VA 3E56A 4WJWA 3D6CA 3HVDA 2MH7A 1C78A 1D6EC 1W6JA 4DN4M 3Q8BA 5I6YA 4HR7B 4HRSA 2KACA 3NVZA 4GLSC 3K5LA 3T3OA 3LWEA 2K33A 3NWSA 1QE6A 1ESRA 2N7JA 3TP8A 4C1NK 4ID6A 4BY1B 3P4RB 1U9RA 2K05A 1S5ED 4B9XA 2A73B 5IGCA 2OXPA 2IWHA 3NQIA 1ZYRD 5C3EB 4ILWA 1VRAB 2QJLA 4TSSA 1BCPC 2MGSA 3MXPA 1WGKA 1FRDA 1ZUD2 1IBXA 3MFGA 5BN4A 3OIPA 1LABA 5C44B 1BBXC 2LFIA 1D5MC 4C3HB 2H4OA 1TJEA 3HOYB 5I2YA 1F2MA 2EJFC 4NAMA 5A35A 1E10A 1EFID 3NS1A 3PV0A 1Q1BA 3P1HA 5EBDA 1HZ6A 1GB1A 2KDMA 3SK6A 1JCKB 4HCEA 1O7YA 1SMYC 3TDQA 3E5SA 1BO0A 4L6TB 1KDAA 1N5WA 3TN2A 2JA8B 5HI1A 4CKCA 2A68D 2VB2X 2BW2A 4XYQA 2F0UA 1ZP0B 4NW2A 1SBBB 2PLPA 2LFNA 3EUB2 3U9SA 2ICIA 4Q2JA 1KNAA 3VR4A 1WTVA 1XLPA 5DM63 1JRPA 2K32A 4LK1C 1G91A 3ONAB 2ACZB 1B44D 1E0BA 5K36H 1LTRD 2KCNA 2L32A 4IN3A 1CQFA 5H8YE 1Z47A 4ABNA 1QJOA 4WIPA 1QWYA 3NRZA 5K5PA 4HTHA 3IL8A 4G4KA 3GV6A 1Y8NB 4OZBA 4HEDA 4A3IB 3KLSA 2PW9A 3R8BA 4EQNA 1L6VA 5IIFA 1S4ZA 4JE3B 2LHEA 1BCPD 2RSOA 1EWCA 4PMBA 4C3HG 1T3QA 3TZUA 5DM73 1KLUD 3GV3A 2L1BA 4XDDA 4O42A 3WOEA 5IGFA 1IUEA 2LKVA 3E9SA 2HCIA 1WD0A 1QCBD 1VDVA 2AQ1B 4QUCA 1TVXA 1SSOA 1RKNA 2PPBC 3AEBB 4OZAA 2XN9C 4KGRA 4MIUA 3J7AV 1TS3A 4RA8A 2V4IB 3RPFC 2R61A 4A3DB 4RGTA 4Y7NB 3C2PA 2EYPA 2I46A 4HEA1 3LYYA 4EQOA 3H6MA 4Q0FA 3D3RA 2NVXB 1AZQA 5M9OA 1SMYD 4C3IG 3Q22A 3NZ3A 1QOAA 5T8IA 2QDBA 5CMDA 2JP1A 2RPVA 3S2DB 3IT4B 4NZLB 1STHA 3DEOA 1PRTC 1SF0A 5JVH3 3Q8AA 1ZPSA 5TSSA 5BYRA 1E9MA 4RCOA 5C0XI 4FXGC 3G6JB 1UNSA 1PTOB 2NMQA 1RF2D 1L0VB 1STBA 3I3CA 2DNCA 1ILQA 1E2WA 2M19A 2DYOA 4YTPB 1PYWD 1R4QB 5CV4A 2WKDA 3AEDB 1E0ZA 5C4ZA 4PV1C 2E74C 1PDQA 1QOGA 5JXVA 1HHVA 2ZW0A 3MTSA 2LHDA 2XIWA 4ARIA 1B9NA 2J52A 2BYTA 4HCSA 3AMUA 3MHBA 2R93B 4MHEA 2E2IB 1SYFA 2JU6X 3MXGA 2NB0A 1FNUA 1X3QA 3S1RB 1N60A 4AYBB 3GTJB 3K5NA 3NQTA 3MFYA 1WTRA 1QOBA 3KWVA 2IGHA 1U4PA 1O7ZA 1JROA 2X38A 1A3VA 1IGCA 2Y5PA 1SYDA 1Y8OB 5HURA 5DAUA 3U52E 1F77A 3H94A 3VRAB 5IODA 4QCLA 5JPMC 1GXDC 4F8MA 1I4GA 3MA2B 1PRTD 3M4YA 2OEOA 2MJEA 3NK9A 2MJDA 3HOUB 4A8XC 3SK4A 2WDRB 2NVQB 5HGTA 2A74C 2WB1B 2V4DA 2JE6I 3J7YW 3J81E 5I9OA 3W2DA 1X3PA 2Y0SB 1FIQA 3TEYA 2FE8A 3WOFA 3GP7A 3K5OA 3HS0C 2BCOA 2F0WA 1IGDA 3V96A 2XSCA 1I50B 3AEAB 2QIEB 3ETRA 4HMJA 4IUVA 5FO9B 3ABVB 1IL8A 5BYQA 2VNUD 1BXTA 3S16B 2CQAA 2EPBA 4QIWB 2RQXA 4WH4A 1G291 3VR8B 5CBEE 3MVVA 3S14B 3KLRA 4FXKC 3PO0A 1E2VA 4C1NI 3ZJVA 1KABA 1QOFA 3RZOB 1WTPA 1PLFA 2FMCA 1RHPA 4GDLB 4S3SA 2B2WC 1C4AA 1LACA 1ET9A 2L83A 2FHTA 2NUCA 1QNKA 2EDGA 1VR9A 4ZUIA 2BT6A 1H9RA 3Q0AA 4OIKA 1PFMA 4TQUS 5EE3A 1SYCA 1JOQA 2EY5A 2INNE 1IYUA 3B9JA 1I6HB 3VR9B 3NUHB 1DOMA 5KEEA 3HG9A 1PGBA 3NPPA 2PZTA 3H09A 3D4RA 4OW0A 2JEBI 1QQRA 2FUG1 1QT9A 4A3BB 5IGGA 5ELDA 4N9PA 1LTTD 4ZRZA 2M56B 1K52A 1Y69U 3UI3A 2JA5B 1JR0D 3E6ZX 1SE4A 2FINB 2VXWA 2K22A 3P1MA 1NENB 1XYIA 5BMGA 2HDEA 5JAVA 3HKZB 2Q5WD 2QEJC 5JJZA 2W82A 1JOOA 4TMAB 2L12A 3T56B 2PKOA 4DGZA 3TEXA 2PW7A 4DK1A 3URYA 1AWDA 4DF7A 3IT6B 2XWBB 2BTEA 4ZHOA 2Z4IA 2BS2B 1A3TA 1TKGA 4L1BA 3AEFB 5C6AA 1DOYA 1TT2A 4QB4A 4A3JB 4FF1A 1YN5A 2SAKA 1NVID 3T4AC 1N62A 4AQ7A 2HTME 1NR2A 3GQBA 3QJYA 5BN5A 1H9KA 1LTGD 2CJNA 4ZRPA 2K9XA 1QLBB 1AP0A 2WINB 3DWPA 3EGRA 4XE0A 1CK1A 2NN6H 4WURA 3BYYB 2JA6B 2WDVB 1JICA 2B2WA 2Q8TA 2FBWB 1RDPD 1I3QB 1VDZA 1C8CA 4FF2A 1YMHE 2A6HC 3OMCA 3GD7A 5EPJA 4R8IA 4V190 3ITPA 4KY7A 3NVYA 1V97A 2ZXOA 2F0MA 1BCPF 3K5MA 2KCCA 5KGUA 2SNMA 4WRDA 3HRDD 2BE5C 4FXCA 1I4PA 1SNCA 3P75A 3NXWA 3VQIA 5T1IA 5AFWA 2AX5A 5IGBA 4A3FB 5CV6A 5LL6X 2E2HB 3AE8B 2QMTA 5F2DA 3TP6A 3Q8CA 4YSZB 3I73A 2TSSA 5C4JB 2JA7B 2O4XA 1S5BD 1YNTE 1NUCA 2KJXA 2M00A 3NUCA 4RHSA 4WFN3 1RFKA 3GO5A 4KGSA 2F0EA 1FCCC 5EE0A 2EJMA 4ZUJA 4EVOA 5C3JB 3D6WA 1FNVA 1LLRD 1F2ZA 2A69C 4DAYA 2IX3A 1BR9A 1Y56A 1EYCA 1Q3LA 4ZKCB 1N5XA 1KFYB 2ZXPA 4RAUC 4FO2A 1KDCA 3PUXA 2L0CA 3I4NB 4XDXA 1YQ4B 2H88B 4IUPA 4MM3B 2DYMA 5M3MB 1JORA 1SE3A 2Y3AA 3W9CB 5BN3A 3JAME 4RNAA 1RM6C 3SK5A 1FMAD 2D9UA 1F9RA 2K01A 5I6WA 1T5XD 5IGEA 1UAPA 1L4DB 1Q8IA 1T5EA 2DY7A 3NBIA 2EELA 3BS1A 2HCCA 1BUVT 1JWSD 4CBVA 2F0QA 1AW7A 1NI3A 4KD4A 4RF1A 4RKBA 3U9OA 1A15A 2A6HD 1HA6A 4KN4C 4YSXB 5JPNC 5EPLA 1S5DD 2ZT9C 1C9FA 2PZUA 2TMPA 4NDXA 1WTWA 2B2TC 1GHKA 3CU7A 2A5HA 4OHJA 2M0AA 2CW0C 2BE5D 4OO1I 5IOCA 2O5IC 3VRBB 1HFGA 1FD7D 2EYJA 3J80L 5DNFA 3SFDB 3FVQA 1YQ3B 3AE5B 5C3XA 5C0XG 4MT5A 4PNYA 2PVGC 1GUWA 5AUKA 2KN4A 1TIID 1Z6HA 1G2SA 2N55A 1CZWA 1SE2A 2HQEA 5EKLA 3HUIA 4IOIE 1BOSA 2JXTA 1H9MA 1CJEA 4WWMA 4WAFA 2F0IA 3RLFA 5C0XH 1DONA 2WXJA 1M4VA 4KMUC 3JAML 2PCFB 4RHRA 2A69D 4KKIA 3L4PA 1DOKA 1PRTF 1U4RA 1LTSD 2WKCA 1EQVA 1NYRA 5D7GA 1Y8PB 2W54A 3M7NA 3C3LA 1MHHE 1PGXA 3W5UB 3ZGZA 1SDFA 3Q69A 2DNEA 3I90A 3OIQA 4G7ZC 3P4SB 3HVZA 2D2CC 5FK9C 1A70A 4CKEA 1SNOA 4BA1I 4REZA 3TP7A 2EZVA 2IX0A 3R3OA 4RGNA 2SDFA 3DWAA 1STEA 2LY7A 1L4ZB 3GTPB 2AQ2B 3P7JA 1FYCA 1SNQA 4B08A 1B1ZA 1EM7A 2RKSA 5EKKA 3RUZA 3NTKA 1FCLA 4UDUC 1TU2B 2V0GA 1EEID 1TKYA 2K5QA 1EIGA 2MUYA 2XRQD 3SR6A 1LTID 2CW0D 3OOCA 4F88A 1J7CA 1K51A 3AU7A 2KMMA 1F2RI 1WCMB 2WS3B 2NYZD 4P6VF 2B2TA 4K2KA 4KKSA 3CWIA 3VA7A 3HRZC 2G9DA 2IPKD 3TUOA 4N58A 3GTQB 2K04A 4JX1C 3HOZB 3CRLC 3QG1A 5KRUA 3KBGA 3B2FA 1EY6A 4L63B 1STAA 1G2TA 3S17B 3DWQA 1GUOA 2B2VC 2DY8A 2YU9B 4KKJA 1V1PB 1HQMC 5EQ0A 5KIXA 1QOHA 2C5CA 3QOJA 1RJTA 3FMCA 1DD2A 4H7BA 4XT1B 2RVLA 4PMWA 1CZGA 1NSNS 4K6DA 1YNJC 1KDBA 4IFDG 2MP1A 1HQRD 4TQ1A 3E0JA 3FPUB 2B2YC 3BZDB 5KNDA 4FF3A 3GS2A 4MN3A 1EYAA 1UEAB 3I57A 5DEHA 4IFDH 3IAS1 1MD2D 1VZ6A 1ML0D 2AUKA 1K8MA 2BA1A 2L5TA 2YEPB 1HTLD 4K8JA 2WU5B 1OFFA 4ODGA 4OZCA 1CI3M 3AEEB 2E6XA 1S5FD 1PZID 5CBAE 4M0WA 5J22A 1PTOC 5CV9A 3H8HA 1Y1VB 4XTCS 2QF7A 3H91A 1XLNA 1N63A 2OF1A 2WQYB 3I70A 4L8JA 1F2YA 1D1IA 1S5CD 2B8FA 3R93A 3SFEB 2K1BA 1OXTA 3BVMA 5I9PA 3I4MB 1NEKB 2R92B 3A8IE 1NYQA 2W3RA 2RA4A 1QNUA 4H2AA 1V8CA 2RDFA 5JVG3 3T53B 4HROA 1ZE3D 3IXSA 1ENAA 3C8YA 3SR1A 2LJIA 1YJJA 2BB6A 2VUMB 3BK1A 3OW7A 4LLGM 3MXUA 3S1NB 3MAQA 4WQMA 2B2VA 2PQEA 4WORA 3FRPB 1BNZA 3L7ZC 5EBCA 2F3WA 4J6HA 1EWYC 1YNJD 1HCZA 1HEZE 1C79A 1FGBD 1P7EA 4K5XA 2K7VA 2X6GA 4ZK9B 1VCIA 5E4WC 2KEEA 1V1OA 2D5GA 2JZPA 4AS1A 3L3OC 3PUZA 3V05A 2R6GA 5IT9E 3BDCA 4KN7C 3I9V1 3SDZA 4HSPA 1EY5A 4R9WA 5M3FB 2B2YA 4C7YA 1SJED 2WXKA 3H0GB 1STYA 3N6RA 2BA0A 2JYOA 3FILB 1JQ4A 2K6AA 1CA6A 3SVMA 1GUTA 5FO8B 3F2UA 3K58A 3TZDA 1PTOD 1SNDA 4A3KB 2K03A 5JEAG 4J1MA 3QOLA 2KWDA 2LGIA 2EYHA 1LTAD 1TYGB 4CJ0B 3ZJTA 1GJXA 2E75C 4NP5A 3OHXC 4BA2I 2FMMA 4KD3A 4B0MA 2GI9A 1HUMA 4RF0A 3A55A 4ZKBB 1PTOH 4NAWB 2GB1A 1RODA 4A3EB 5JEAH 2NVYB 5E1FA 2VZKB 4OL7A 4LAAA 4IQZA 3ND9A 1ZDXA 3GB1A 1VLBA 2ICEC 3K59A 1ZXHA 1IKLA 4XWTA 4X3SA 1KH0A 2WXNA 5J39A 1GUGA 4OIJA 1QKZA 5E6JA 4CGYB 4HKZE 2F0HA 1MVKA 1FFVA 1PGAA 3DEPA 5IT9L 1Q12A 1OXSC 1LTBD 3SK8A 5HG2A 1DXMA 1EY7A 1Q10A 3A7AB 3LNNA 4JWSC 3FDTA 4KJNA 3LXFA 1D1KA 4JK1C 4H0LC 1G8ZD 2HDMA 3PMFA 4OGQC 2F0PA 3GTLB 3OPOA 3HEJA 1WTQA 2RMMA 3SE0A 3S1MB 3X3MA 4IKGA 1XX8A 3J81L 1AZPA 5BMHA 1MHXA 3Q8FA 1V43A 1XTCD 1TWFB 3NP8A 3U2SC 3CQZB 1XO3A 3FPPA 4OO1G 2PZWA 2RSNA 3PUVA 5C4XB 1QF6A 2SEBD 4MH8A 2JEAI 2MHVA 4U673 1GHJA 1FXIA 2CJOA 2JWUA 4JWUC 1E2ZA 4NJCA 1FXAA 2WXHA 3PZ8A 1HRJA 3A8JE 4DNTB 3ZQ4A 5A2QE 1BMLC 3NWTA 1R4PB 1XWEA 1C4QA 1OQRA 3QB3A 2QSDA 4XIGS 1WTOA 1TKEA 3VR5A 1QILA 4C56C 1KRHA 4G7HC 3PIO3 4U68A 2XNAC 4DQOC 5D65A 5M5XB 3M3YB 3IAM1 2RDGA 5FR3A 1B50A 4IDIA 1BUIC 1R9TB 3AE6B 3NE5B 1L0XB 1PFNA 4KTAA 1RCVD 2LMCB 2YYZA 4ZOHC 2K3UA 2EE1A 5C2TB 3NVVA 3DWGC 5COYA 1KF6B 2SNSA 1R7SA 1A2UA 3MEHA 3Q8EA 1B53A 1CTMA 3R2IA 2JYTA 3AV8A 1PXUA 3S9WA 1T6BX 4A3GB 1J9OA 1U4MA 2GA4B 1HTPA 1WWTA 5HFYA 3GTKB 1FFUA 4LTUA 3VYTA 4YIJA 4FXDA 1ZOYB 1XLQA 3NTIA 1U4LA 5LNK1 2B2UC 1EZ6A 1H9SB 1VF5C 2Z8LA 4ARCA 4EGVA 1A3UA 5A2QL 3V3XA 2F4IA 3VYRA 2F0TA 4FF4A 3L9AX 4DXGA 2WXOA 1TKWB 1LV9A 2EY1A 2KQ4X 1ZKOA 4A55A 1SNMA 1ILPA 2OEDA 2V3NA 4RWSC 3QO2A 5JOBA 2WDQB 1MI0A 2L9HA 3KQ4A 1F9QA 4X3TA 1MGSA