1PFDA

The solution structure of high plant parsley [2fe-2s] ferredoxin, nmr, 18 structures
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
96
structure length
96
Chain Sequence
ATYNVKLITPDGEVEFKCDDDVYVLDQAEEEGIDIPYSCRAGSCSSCAGKVVSGSIDQSDQSFLDDEQMDAGYVLTCHAYPTSDVVIETHKEEEIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN
publication title The solution structure of parsley [2Fe-2S]ferredoxin.
pubmed doi rcsb
molecule tags Electron transport
total genus 21
structure length 96
sequence length 96
ec nomenclature ec 1.7.7.2: Ferredoxin--nitrate reductase.
pdb deposition date 1998-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1pfdA00
3NVZA 1VJKA 2CU3A 2M56B 4YTPB 3W9CB 2E3TA 1KFYB 1SIJA 3P4RB 1DGJA 3WCQA 1DOXA 1ZXIA 3AECB 2DWQA 2PVGC 5EE9A 1L6UA 3W5UB 1VLBA 3FC4A 2BS2B 2JX5A 1TKYA 2CJNA 4JWUC 4JX1C 3AE4B 3NVVA 1E7PB 2W3SA 3KWLA 2QIEB 2KAJA 1A70A 1PUTA 2BT6A 2H88B 2DBYA 2MJEA 3L4PA 1TKGA 1N5WA 2FBWB 1GPXA 3CIRB 1OQQA 2MH7A 4YXDB 1XLQA 3P4SB 3HRDD 2MJDA 4ZHPA 1NI3A 3AH7A 4USAA 2W3RA 1JQ4A 3VRBB 1FXAA 1E6EB 1RM6C 1WRIA 1FIQA 3RPFC 1QOBA 5EE0A 3SR6A 2WDVB 4C7YA 4C80A 1N60A 3AE1B 1QOGA 2N0SB 1IUEA 2B76B 2JQRB 1JROA 2ACZB 1DOYA 1ROEA 1UWMA 1YJJA 1NEKB 4N58A 4N6EB 1JWAD 2K5PA 3ETRA 1N63A 3B2GA 5EE1A 2PVOD 1GAQB 3AEAB 1QLBB 4C7ZA 3AEDB 1AYFA 2WLBA 1FXIA 3SFDB 2PIAA 4YTNB 1QOFA 3VRAB 4YSZB 3AE9B 2BS3B 1TYGB 1R7SA 4WWMA 1YQ3B 1V8CA 4IDIA 1DOIA 1FFVA 1QT9A 1XLNA 5GXGB 3AE6B 3AMZA 3VR9B 1FMAD 4LTUA 5H92C 3NVWA 2W55A 2WP9B 2M19A 4YTMB 1J7BA 2LEKA 2W54A 5C3JB 4A9AA 1PDXA 2WU2B 3NS1A 3AE5B 1NYRA 4YSXB 3HUIA 1QF6A 1RFKA 1WXQA 2CJOA 1ZOYB 4HRSA 1E0ZA 1FFUA 1KRHA 1QOAA 2L52A 5H8YE 1XLOA 3AB5A 1JALA 5G5HA 3ZYYX 3AM9A 1KF6B 3AE3B 3W5VB 1NYQA 3AV8A 2G1EA 4YT0B 1XLPA 4JWSC 3P63A 1FM0D 1XO3A 2OHFA 4US9A 3P1MA 1YJIA 2BS4B 1WWTA 4HROA 5C2TB 3FAHA 2PKOA 2AX5A 3B9JA 1I7HA 1CZPA 1V97A 3NRZA 1CJEA 1ZP0B 2MJ3A 3AEBB 5MPOA 1FRDA 5AUIA 2KMMA 1N5XA 1TJEA 4WQMA 3DWMA 1B9RA 4YSYB 2Y5CA 2H89B 3VR8B 3ABVB 2WS3B 1L5PA 1TKEA 1L0VB 3P4PB 1RWSA 3SFEB 1L6VA 1F0ZA 1FRRA 2WU5B 4ZOHC 1OQRA 1SB3C 3AE7B 4ITKA 1E10A 2K9XA 3PO0A 2K22A 1SF0A 3AN1A 3EUB2 4ZHOA 3BIID 2WQYB 1JWBD 3P4QB 1NENB 4P6VF 4US8A 1ZUD2 1N62A 1JRPA 3AEFB 1FO4A 3AE2B 1JW9D 2Q5WD 2WDRB 1YQ4B 3B2FA 1OFFA 1T3QA 3LB8C 3NVYA 2EKIA 4KX6B 1WGKA 5G5GA 2L83A 4FXCA 2HTME 3DWGC 1NVID 3LXFA 3CWIA 2QJLA 5EE3A 1E9MA 3HVZA 5AUKA 1PFDA 2WDQB 1WYGA 1EWYC 1VDVA 4N59A 1AWDA 1J7AA 1N61A 3AE8B 3AEEB 1J7CA 3AEGB 1RYJA
chains in the Genus database with same CATH superfamily
3TIXA 1DOXA 3FC4A 1TKYA 2EMSA 3ZGZA 3FKYA 3GE8C 2H88B 4FN2A 1EUVB 2IGDA 1LQBA 4NAWB 4WWPA 5CHWA 5JHBA 5IA7A 2PE9A 2PLPA 4WQOB 5DPRA 1E7VA 3H7PA 2KACA 2OOBB 1FIQA 2BKRB 4XWTA 2ACZB 2C7NB 2N4FA 4DQOC 3RT3B 4GIVA 2OJRA 3LYYA 3B2GA 3GZNI 4C7ZA 2GBKA 3TSSA 1FXIA 3RZWC 4OZCA 3KQ4A 1YN5A 4HK2A 3RCZA 1T0RC 5TSSA 1TS3A 2HD5B 1E0ZA 2VH2A 4TKNA 3TCAA 4NNJB 3BVZA 2XNAC 4I6NB 2R2QA 1R4NI 4YT0B 3MJ5A 4ANXA 2C7HA 4S17A 3M3JA 2KVRA 3Q8AA 2KLGA 3RZFA 4C56C 4FADA 2V0GA 3DWMA 5IO9A 1E5WA 4RGNA 3BZDB 2H89B 5D3IB 2KO3A 3K9OB 3R66C 4LDTB 2KD0A 3KH0A 1WMHA 2WU5B 3N1XC 2INPE 2HJ1A 1WIAA 3RNGC 4XZ4A 3BIID 1WJ6A 1ZUD2 2SAKA 2QJLA 3KYCD 3GZNB 2IBIB 3P2BA 3AEGB 3ZXRA 2LVPA 3KUDB 1VZ7A 1VLBA 3AU5A 4XGAB 3C19A 2FCQA 3QWZB 3V61A 4FHKA 2KTRB 3GP7A 4C4VA 1TKGA 4OVVA 1SE9A 4NQLB 1V86A 1ESFA 1K52A 1R4NB 5BMHA 2R2OA 2FIDA 2INCC 4C7YA 3M62B 2UWQA 2CU1A 4NAMA 2GBMA 5CHFA 4IUMB 5BMGA 3R8BA 3AEAB 1EF1A 2KANA 3NUHB 2BS3B 1WR6E 5IN7A 3HM3A 2WNMA 2ZW0A 2JWUA 2LHDA 2L05A 3H6NA 3IT4B 2WU2B 3A9KB 2W82A 1NYRA 1N6ZA 3AE5B 1QF6A 1ZOYB 1L0XB 3DOWA 4FJZA 1L2NA 4BKSD 4ARCA 1C79A 1TZ1A 3EA6A 2O6VB 4KIKB 2N9EB 2JZPA 1I7HA 4MM3B 3VUWA 2LFIA 4BBNF 1ZXHA 1HE8A 3Q2AC 1B9RA 1GUAB 2KJRA 3H7SA 1WX9A 2M0XA 3KW5B 5DPWA 3EUB2 3TEYA 1WE6A 1I4XA 2D5GA 4WH4A 2QSDA 1HXYD 2ZEQA 1PFDA 1WYGA 3IT6B 3H9DA 3FILB 1IBXB 2D07B 4WAAA 2IGHA 4LJOB 1F2RI 1RLFA 3AE4B 2SEBD 3Q3JA 1BMLC 2JVCA 3IVFA 2D11A 2KN5A 2LGSA 4AUQC 5JXVA 2ZPYA 5DCNA 3U7ZA 1E6EB 2MHJA 5E6OA 1FCCC 4IWPA 4MSMB 1WJNA 2INDC 1FPYA 4EZJA 1GJZA 3ZJTA 1GC7A 3R7RA 3EHVA 1B1ZA 2WLBA 3RI7C 2N9LA 1UGJA 1SSNA 2KWDA 1FXTB 1QQRA 3BVMA 2MWSB 5IAAC 3N3KB 4P16A 2JYEA 2PPHA 4KVGB 2K8CA 3HK0A 2KMCA 2CJOA 1WRDB 3MJWA 3KUZA 3ZJVA 1FD6A 1P0RA 2NBUA 3ZDTA 3PPAA 2OHFA 1ZDXA 4HROA 1HTOA 2KDIA 4NAWA 4H2AA 2NTSA 2KQSA 1WZ3A 1CJEA 3A4SC 4MACA 1S3SG 4W9DA 1SIFA 1TJEA 2KC2A 1GB1A 2CR5A 2QHOA 2N9PC 4FHJA 4WWOA 2KDEB 1TGZB 4EZLA 4A3PA 1QKZA 1OGWA 5D94A 1D5ZC 4W9JA 2GI9A 4PK1A 2Y5BB 4ANUA 1AWDA 3AECB 2CU3A 2I1JA 3KYDD 1WGRA 4YTPB 2XK5B 1SIJA 2ZCBA 3N1ZC 2JWZA 2CJNA 3ZXVA 4JX1C 2KWUB 1HZ5A 3GB1A 4ZYNA 1IP9A 1D5MC 3MHSD 2YEPF 4KSKC 4IG7B 2MJDA 2L00B 1JQ4A 4DXFA 4NJ7A 2KYWA 1ET6A 1TS4A 1SE4A 5BYQA 2XEWA 1GG3A 1MG4A 4ZDVA 5HFYA 3U7DA 2K5PA 3L10B 4WURA 2WXJA 3A1QB 3SFDB 1VZ6A 3AE6B 3AULA 4RGOS 3EFCA 4MH8A 5D7GA 3NS1A 1V1OA 4HRSA 1WXQA 2HJ8A 5LXHA 4ICUA 1C4PA 2GBNA 2HTHA 1KF6B 3Q8CA 2KTRA 1A5RA 1YJIA 4CYEA 4BKTA 5MPOA 2IO0B 2G4SA 4P1BC 2UYZB 4HKZE 2LWPA 1HTQA 4Q2JA 2M0AA 4BBNC 1VRAB 3DBLI 2FUHB 4ZOHC 4P1CC 2A5UA 1Z2MA 2JF5A 4GDLA 3URYA 2V9HA 2BKFA 2Z0EB 3M95A 4W9KA 3SD5A 4GGQA 3NHEB 1VCBA 3B2FA 3NVYA 2DHZA 3T8MA 2I1KA 3QK0A 2MSED 2L3ZA 3QARA 2KDFB 3AU4A 2FE8A 3ENEA 2KXJA 1FEHA 1OEYJ 4KSLC 2KOXA 2JXXA 3QA8A 1A70A 3ZNID 1I4QA 1C78A 3PV1A 1GPXA 1HEZE 2NR2A 4II3B 4YXDB 3BYYB 2LMCA 3P4SB 2HE7A 4WJOA 4DHZB 2N9KA 4MM3A 4DXAB 4PS3A 1FXAA 4HEA1 1WI0A 4K7WA 4JQWC 2KZRA 2WDVB 5AZGA 4TSSA 3VH3B 3I3TB 1P7FA 5JZEB 1MI0A 4N58A 4FA6A 3R2IA 3SEBA 2YVCA 1TY0A 2EELA 1PGBA 5AZFA 3VRAB 4HVBA 2PTLA 3DBLB 2MBBB 1DOIA 2ZVOA 1XLNA 4MT5A 2V1YA 4GDKB 2L32A 2AL6A 1IBXA 3WAMA 4HPPA 3OAWA 2C60A 3BY4B 3IBEA 1MFWA 1IGDA 1WGDA 1WM2A 5G55A 2QC8A 4RM8A 3OJ4B 4W9HA 2BW2A 2GOWA 4HJGE 2KK8A 2MX2A 1TS5A 2W9NA 1K8RB 1K53A 2KMMA 4E3CA 1OTRB 3RNBC 4YSYB 2PEAA 1J8CA 2M1MA 1TKEA 1D5XC 3OJ3A 3ZKJC 3ZNGC 3LJ3A 4F1SA 3TEWA 3P4QB 1E8YA 1XXGA 4K7UA 4BOSC 2KJ6A 1VD2A 5IP4D 3PGEA 1GB4A 2J4XA 3PREA 1PGAA 4L23A 1ZE3D 2NBVB 2J0KA 2PVGC 3RFZB 1PYWD 4JGHB 1C4CA 3KUCB 1YJ1A 2NVUI 2FBWB 4DBGA 1BUIC 2DLBA 1RAXA 3ZTCA 4MH0E 2M8SA 1WRIA 3ZVVA 5DPTA 2JY6A 4DHZE 2BYTA 3RYTA 4ZYSA 2UU7A 3PRPB 3L17A 4WAFA 1UF0A 1WXVA 2I38A 2K1FA 3ETRA 2FIFA 5EE1A 2RSUA 1E8WA 3V05A 1MJDA 3ZIMA 2KDBA 5G2NA 4L1BA 3DBHI 2J7QB 1SJHD 3EFUA 3ZYYX 3W5VB 4IM2A 4GSWA 3P1MA 4EUTA 3JW0X 3RNEC 2WXHA 2ZNVB 2CHZA 4G11A 2LI5A 1P1AA 5L95C 1Q1OA 3ABVB 1L5PA 2BPSA 1CK1A 3A4RA 3H1UA 4MGIE 1AARA 3L16A 2K25A 4PT5A 3A1QA 2JRHA 2C5LC 4G50A 3U4EG 1JW9D 3LB8C 4M0WA 3OLMD 2QILA 1E9MA 3NZUA 4XC2A 2JRIB 2J53A 4RF1A 1J7CA 4NPNA 2MBQA 4NY0A 3DBRI 1M4VA 1L6UA 1KTKA 3DBHB 3MFGA 2KHWB 4DK5A 5LXIB 4AJWA 3RNAC 4L2YA 1WJUA 4XWWA 2Z59B 3PZ8A 2KQ7A 4MJSB 3HM6X 1EF5A 1I42A 2RPQA 5BO4B 2CS4A 1UWMA 1VZ8A 3MTNB 4MGYE 2VH1A 4WJPA 5JH5C 4OHJA 5J18A 2IZVB 5CHVC 1QOFA 3Q6BA 1S1QB 3PRMB 4IDIA 2AQ1B 4LTUA 3TUOA 3TEXA 4BVUC 3SDLC 2QEJC 4YTMB 1V49A 3P42A 3HUIA 1K50A 3NOBA 2IO2B 2KQ4X 4PYUA 3VUYA 2J42A 3AM9A 2G1EA 1WWTA 5C2TB 4TUUA 3VTWA 2FCSA 3U8ZA 3BINA 3DBRB 3NZSA 3ZUNA 3NRZA 2MJ3A 1MHXA 4REZA 2ASQA 4ASWC 2LVQA 3N32A 3AI5A 4KV2A 3AXCA 3B0AA 4WQMA 2JPHA 3VR8B 2WS3B 4W9FA 3X0WA 4MSQB 2L0TA 1FNUA 3TEZA 1T0QC 1SXTA 2MP2B 3PO0A 1WYWB 3A9JB 1JWBD 2KX0A 3V62A 2WX0A 2PE6B 2HTME 1NVID 1SGHA 1WXAA 2FAZA 1ZW7A 4LCDE 5LNK1 4GDKA 4NQKE 1JCKB 2G45B 4BKGA 2LGDA 1ZXIA 4X57B 3PZDA 3W5UB 5KHQA 2IO1B 1E8ZA 1WE7A 1PUTA 4AP4C 4AOFA 2WXLA 3EECA 1UBIA 2MH7A 2D3BA 4ARIA 1XLQA 2CHWA 2W3RA 1F52A 3VRBB 2XN9C 1N60A 3AE1B 1HQRD 2B76B 4I6LB 3W1YA 1WR1A 3DVGY 4OVUA 3ZJUA 3VVWB 2FCNA 1GNUA 1I4HA 2GB1A 1N63A 4HXDA 4TMAB 4YSZB 1IPGA 1TYGB 3VR9B 2D3CA 2QMTA 3RN9C 4DDID 4B0EA 4EOYA 2KFKA 2OJWA 3DVNV 1P9DU 2R61A 3AB5A 5G5HA 1UWXA 1ZPSA 4JWSC 2WXMA 2NPTB 4G0NB 5LLIA 1T6BX 1JWMD 5CX3A 3IHPC 3W1SA 4LLGM 1ZP0B 2RDGA 3TJPA 3APFA 1N5XA 3ZDMC 2NBWB 4EEWA 1TTNA 4IM3A 2VZKD 2Y5CA 4LJPB 3P4PB 1R4MI 1L0VB 4WJNA 3DCGA 5E6PA 1E7UA 1LFDA 1NENB 4US8A 1JRPA 3GS2A 3PSEB 1OEYA 1SJED 3VAWA 5J17A 3VFKA 4II2B 2N9XA 1EO6A 4BKSA 4MELA 3AE8B 4O1NA 4ZRQA 4BAXA 5EE9A 2DWQA 1H4RA 1V5OA 2L8JA 5D2MB 4N9F4 4DDGD 2WXQA 1C4AA 2KAJA 1KLVA 1WFYA 3R7QA 4P7IA 1N5WA 5JHAA 3CIRB 3W1SC 1WX8A 4URKA 1OQYA 3HIZA 3RMKC 2JYTA 3N9YC 3CMMB 2LVOA 3NG0A 2ZZPB 4W9LA 4HDQA 3ALBA 2BB6A 3NY5A 1JROA 1Z5SB 1DOYA 1YJJA 4OZBA 3ZTDA 2RGFA 1Q5WB 1AYFA 1R4MB 2JZZA 2LZ6A 4W9IA 2IO3B 3GOEA 2J0JA 3H7PB 1P3QU 1J7BA 2K3UA 1PDXA 2LGYA 2MEKA 4GU2A 1FCLA 4LNOA 4J3OD 1U4AA 2AYOB 3ML9A 2DZJA 5HI1A 1XO3A 1WGHA 3Q3FA 4M01A 2D10A 4XYCA 2BS4B 1V1PB 2DZKA 4YWGG 2KMAA 1FRDA 3E9SA 4YL8A 4HWIB 1YN3A 1WGGA 3ZW3A 3PLUA 1LO5D 2RR9A 3EC8A 4ZHOA 4EE2A 4P6VF 2G3QB 2DNFA 4TV3A 5FR6A 2NCNA 2WXRA 2EKIA 4FXCA 2KDMA 4D2KA 1FNVA 1YN4A 2MBHA 2GRIA 2BWES 4N59A 3ONSA 3X23A 2LUMA 2LD9A 2PW9A 2QDFA 2X8XX 3E56A 2M56B 2Y5PA 2LGIA 2E3TA 3O65B 3TMPB 1WMHB 1KJTA 1ISNA 4JWUC 1BT0A 2XBBC 4RF0A 2G9HD 2W3SA 2KVZA 2MJEA 4RCOA 4DWFA 3PRZA 5BYRA 1SEBD 4IWOA 2BYEA 1LGRA 5C23A 1HA5A 5AEKB 3RPFC 4F7ZA 2AEHA 4UDUC 1QOBA 2WWZA 1I4PA 3A9KA 1QOGA 2K0PA 3I57A 4TQ1A 3GE3C 1XF5L 3Q69A 4N6EB 4C4VB 2ZJDA 2PVOD 1K51A 1QLBB 3A9JA 3DVGX 2IY1B 3WIMA 2O6VA 4KIKA 3C0RB 1R7SA 2L1AA 2TSSA 1FMAD 3UQBA 2W55A 2BVCA 4A6QA 2WXOA 4CQNA 2KN4A 3Q3MC 1FFUA 2FNJB 4CO7A 1KOTA 2AQ3B 1C3TA 3IAS1 1L0YB 2KWVB 3MHZA 4US9A 3VXWA 1UBQA 3BK1A 2DYMA 2RPVA 3B9JA 3CSFA 4ACFA 1EU4A 1V97A 1YOVB 2DYBA 3KWVA 4HKQA 4ZRIA 5DPSA 2O2VB 4DHJD 1T0YA 1XD3B 5HKHA 1YIWA 3FILA 1I4GA 3NZ3A 3PLVA 4KDLB 1P7EA 1FRRA 4ANVA 4GMVA 5I4DA 4RM9A 2D3GA 1N62A 2I2YA 3V3XA 4K81A 3LXFA 3DVNU 3ZLZA 1C1YB 2LRUA 3Q3NC 1EWYC 4WWNA 3KVFB 1J7AA 3NVZA 3W9CB 1KFYB 3WCQA 4WIPA 2ZPNA 3L54A 4ICVA 2JX5A 1PGXA 3C8YA 1L4ZB 4NJ6A 1E90A 3QAQA 4E71A 2NPTA 5L83A 4FBJB 2RDHA 1V80A 4JIOU 1QILA 2M4NA 1IGCA 2OEDA 1YX6B 2LGXA 2PJHA 4AQ7A 1WXSA 2WYQA 2GBJA 2JQRB 3R2TA 5AZHA 4BOZB 1GAQB 5IKCM 1ZGUB 2WP9B 3RD2A 1WF9A 5BMIA 5C3JB 4HPMB 2IPKD 4PYZA 1ET9A 1QOAA 1NDDA 2JXTA 1C9FA 1XLOA 3N20C 4LNNA 3UINB 2MQJA 4MEMA 2V3NA 2B3AA 3TL5A 2LXAA 3V6EB 3MP9A 4JPSA 1H8CA 3APDA 2C9WB 2PKOA 5E6NA 2EMTA 4IM0A 5BYSA 1AN8A 3QIJA 4W9CA 4M8MA 1M94A 2MBEA 1TZOA 5AUIA 4WJQA 4HJKA 3T3OA 1L4DB 5CTRC 4FULA 2WXPA 3PHXB 2INNE 2XK5A 4W9EA 1MPEA 4K1RB 4ZRJA 4HCNB 4C00A 2K22A 1SF0A 3Q3OC 2DENB 1Y56A 1NBFC 5KHOA 3QCAA 1I35A 1F2RC 1UGMA 2L83A 3PHWB 4RGTA 1YMHE 2IYDB 1VDVA 2ZW1A 1ZKHA 1GOZA 1DGJA 1KM7A 4IC7B 2N7DA 4QAYA 5T8IA 3VTVA 2KC1A 2QIEB 1RFAA 4KGRA 2K8BA 3HHMA 1V1PA 1FNWA 1NI2A 2RMMA 3WALA 2WXIA 2L76A 3ZQ4A 1QZEA 4A3OA 3RUIB 4JL9A 3B08A 1WJ4A 4TQ0A 2D2QA 3ZNHB 2NTTA 2L0FA 1IYFA 2PIAA 2LASA 2Z0DB 3CF6E 4DXGA 1FFVA 1QT9A 4XDCA 2G4DB 4RH6A 2WDTB 1J19A 4A9AA 1RFKA 2MRPA 4XDDA 1KRHA 3M63B 4JLCA 5E6JA 1CMXB 3MC0B 3UIPB 2A4ZA 3RNCC 1EM7A 3U52E 2BYFA 2VZKB 3UI3A 1CZPA 1TIFA 1MG8A 1V81A 1V5TA 5FKAC 4IOIE 2WXFA 4GN1A 5IOIA 3N1YC 3U30A 4MGZE 2ICIA 2ONQA 4XX5A 1VR9A 2YLMA 1L6VA 1WH3A 2K6QA 1D3ZA 2WHIA 4ITKA 1J0GA 2WQYB 1Y8RC 4IWQA 1YQ4B 4KX6B 4K7SA 1KH0A 3NS8A 1CQVA 3L08A 1Q0WB 1TBEA 1N61A 4CHKA 1RYJA 2X38A 2RDBC 3J9CA 1PQSA 2MW5A 4GDLB 5FR3A 1AW7A 2KJHB 1OQQA 1WXMA 4K3CA 3HRDD 2BQQA 4KZCA 3AH7A 3QQ8B 5GMVA 4FJYA 1UH6A 3ECIA 2O2VA 3UIOB 4C80A 1IUEA 3D32A 1JWSD 2MA9B 3JSVB 1WY8A 3ZRCA 2BF8B 1STEA 3O13A 3SHQA 5EDSA 3JYUA 4YTNB 3AE9B 3RULA 1WSPA 1V8CA 3AMZA 3VTUA 3UGBB 2LEKA 4IW0A 1MHHE 2WGSA 4YSXB 2N7EA 3IG3A 2D3AA 1C76A 2L52A 5H8YE 1JALA 1D6EC 4RFBA 2JU6X 3WAPA 2VRRB 2C7MB 1D4BA 3KLSX 4I6PA 2REXA 1TY2A 3R3MA 2GBRA 2MBOA 2LRWA 2KWCA 4KGSA 3T9LA 3SFEB 2CKHB 2NMQA 3MC9A 1SB3C 3AE7B 3PTFC 2WXGA 4BZAA 3AE2B 3QX1A 4S0RA 4LDTD 1ZDVA 4FJVB 3PVLA 2WDQB 3JVZX 1JRUA 1DYQA 2WXKA 2YEPB 4GB9A 2KTFA 3AEEB 3DQVA 1E8XA 4RMAA 2LJIA 3P4RB 2BS2B 2IGGA 2L7RA 4OW0A 4G3XB 2K6DB 3ZRFA 2DBYA 4XE0A 3L4PA 1X1MA 1XCTL 3VH4B 2DAJA 1NI3A 1LM8B 2HDEA 3HVDA 2CHXA 3DHGC 1L7YA 1XT9B 5HG2A 3SR6A 4A90A 3VUXA 2JSVX 3S2AA 2MCNB 3BYTB 3ML8A 3Q8BA 1NEKB 2GLSA 2IJ0A 2RD0A 4M8NA 1JWAD 3W2DA 4PS8A 2JZ3B 1TS2A 5GXGB 3IXSA 3NJTA 2DYOA 3DHIC 3DBSA 2Y3AA 4HDOA 1KLGD 1F77A 3Q8EA 3Q8FA 3DHHC 4AJYB 4LNFA 1FM0D 3RNFC 2JT4B 2QCZA 1ACCA 1ENFA 4DHJB 1SE2A 2DZIA 4ZRPA 2V3SA 3Q14C 3BVGA 3VQIA 2WXNA 2ZCCA 2O6VD 1JWUD 1F1HA 3BWUD 4RNAA 5D6JB 1UNSA 1OQRA 1E10A 2ZNVC 1T3QA 1C77A 5G5GA 1MVKA 4LK0M 4AWJA 2IDYA 4HPLB 5AUKA 4MGKE 4MJSA 3DDCB 3ZNZB 2E6XA 2BWFA 1VJKA 4OZAA 2V4IB 4AS1A 1V9JA 4KZ0A 2AQ2B 3NVVA 1E7PB 2PMVA 4HCPB 2BT6A 2K39A 4GXBA 1EU3A 2ON8A 3EGRA 4M0WB 4EFOA 2JUOA 3IFWB 1F9JA 1T0SC 2KT7A 2KFJA 2IY0B 2DX5B 1XEEA 1WGYA 5EE0A 1V2YA 2N0SB 3H8HA 2J0MA 4FLHA 3PZ7A 1ROEA 3WANA 2V3PA 2BTEA 3AEDB 4BFRA 2BB5A 4OVZA 4WWMA 4M02A 3U2SC 2EKEC 4MDKE 2M19A 2W54A 4LNIA 3IAM1 4GOCA 4B0MA 1YNTE 4M00A 4JE3B 3AE3B 3K9PB 3MC8A 1XLPA 2MP2A 3P63A 4PS7A 5TR5A 1UD7A 4NJCA 5FK9C 4J6IA 2N1WA 3QJZA 2K8HA 1WZ0A 1YX5B 1UZXB 1XQQA 1T5XD 4KDIC 2KNBA 1JMLA 1RWSA 1F0ZA 3OWEB 2KLCA 3QC8B 3JSVA 4A20A 3QHTA 3AN1A 3AEFB 4A55A 3ZO5B 3WA0A 3VHTC 1WGKA 2DAFA 1P98A 2LUEA 3HVZA 1YQBA 3I63C 3I5JC 3VDZA 4EZKA 1XCQL 3APCA 1LXDA 4R3DA 3V6CB 4RGMA 2LXCA 4EKUA 4ZRKA 3KWLA 2LJ5A 3SU8X 5HHDG 4A8XC 4KKIA 4KGTA 1WM3A 2MLBA 4ZHPA 4USAA 1EWCA 5D3DA 1RM6C 3UQAA 2N1VA 2KX3A 4B9KA 3TBLD 2M17A 4ANWA 4NZLB 3DPDA 3CSTA 5J2RA 3N30A 2FCMA 3UF8A 1TT5B 1KLUD 1YQ3B 2BGFA 1WX7A 2AL3A 5H92C 3NVWA 3PS6A 4B95A 3PT2B 4F8CB 2N7JA 3L13A 4LNKA 2FUG1 3OG5A 2DZMA 1SBBB 3B1LX 1GC6A 1NYQA 3AV8A 4K3BA 1HZ6A 2ZVNA 1Q10A 3LDZE 3FAHA 2AX5A 2NS5A 4KKJA 3T3NA 3A33B 2KKCA 1UUPA 1BXTA 3AEBB 3I9V1 2J52A 2LHEA 2Z8LA 1UELA 2KFKB 1I4RA 2AWTA 1RRBA 2GMIC 4B6WA 1V6EA 2K9XA 4W9GA 1G6JA 3WAOA 1FO4A 2WX1A 4HLEA 3BK2A 2V4LA 3L0WB 3V60A 2Q5WD 2WDRB 1OFFA 4IKGA 1SE3A 3DWGC 4GLSC 3CWIA 4E74A 2BBCA 5C1ZA 5EE3A 2BYVE 1YD8U
chains in the Genus database with same CATH topology
2FE8A 2X38A 1DOXA 1FEHA 5EE9A 2DWQA 3FC4A 1TKYA 3J9CA 3ZGZA 4GDLB 2WXQA 1C4AA 2KAJA 1A70A 5FR3A 2H88B 1I4QA 1AW7A 1N5WA 2IGDA 1C78A 4NAWB 3CIRB 1HEZE 1OQQA 1GPXA 4YXDB 3BYYB 2LMCA 3HRDD 3P4SB 2PLPA 2N9KA 3AH7A 2KACA 1FXAA 4HEA1 1FIQA 2JYTA 3N9YC 2WDVB 4TSSA 4C80A 4XWTA 2BB6A 1IUEA 1JWSD 1JROA 2ACZB 1DOYA 1P7FA 1YJJA 1MI0A 4N58A 4OZBA 4DQOC 3LYYA 3B2GA 3R2IA 3SEBA 4C7ZA 1TY0A 1STEA 3O13A 1AYFA 3TSSA 1FXIA 2EELA 1PGBA 4OZCA 4YTNB 3VRAB 3AE9B 3KQ4A 1WSPA 1YN5A 2PTLA 1V8CA 1DOIA 1XLNA 5TSSA 3AMZA 4MT5A 1J7BA 2LEKA 1MHHE 1PDXA 2K3UA 4GDKB 4YSXB 1TS3A 2L32A 1IBXA 2MEKA 1E0ZA 1C76A 1FCLA 2L52A 5H8YE 3BVZA 4J3OD 1JALA 1D6EC 2XNAC 4RFBA 1IGDA 2JU6X 5HI1A 4YT0B 1XO3A 1D4BA 3MJ5A 2BS4B 3KLSX 1V1PB 2BW2A 1TY2A 4HJGE 3Q8AA 4YWGG 1TS5A 1FRDA 1K53A 2KMMA 4C56C 3E9SA 2V0GA 3DWMA 4YSYB 4RGNA 3BZDB 2H89B 4KGSA 5D3IB 1TKEA 1D5XC 3SFEB 1YN3A 2NMQA 2WU5B 1SB3C 1LO5D 2INPE 3AE7B 3TEWA 4ZHOA 3BIID 3P4QB 4EE2A 1XXGA 4P6VF 2WXGA 1ZUD2 3AE2B 2SAKA 2WXRA 2EKIA 1ZDVA 4FXCA 2KDMA 4D2KA 1FNVA 2QJLA 1YN4A 1GB4A 2GRIA 2WDQB 1DYQA 2WXKA 2YEPB 2J4XA 4N59A 3AEEB 3AEGB 1PGAA 2LUMA 2PW9A 3E56A 2M56B 2Y5PA 4L23A 2LGIA 2E3TA 2LJIA 3P4RB 1ZE3D 1VZ7A 2PVGC 3RFZB 1VLBA 1PYWD 2BS2B 2IGGA 4JWUC 1C4CA 4RF0A 2G9HD 2W3SA 4OW0A 3GP7A 2DBYA 2MJEA 4XE0A 3L4PA 1TKGA 4RCOA 1XCTL 2FBWB 1BUIC 2DLBA 5BYRA 1SEBD 1NI3A 1ESFA 2HDEA 1K52A 1WRIA 3HVDA 5BMHA 1HA5A 3RPFC 4UDUC 1QOBA 5HG2A 3SR6A 4C7YA 2BYTA 4A90A 1I4PA 4ZYSA 1QOGA 2K0PA 4WAFA 2JSVX 3I57A 4TQ1A 3BYTB 4NAMA 1XF5L 3Q8BA 3Q69A 1NEKB 2IJ0A 2I38A 4N6EB 1JWAD 3ETRA 3W2DA 5BMGA 3R8BA 5EE1A 2PVOD 1K51A 1QLBB 3AEAB 3V05A 3NUHB 2BS3B 1R7SA 1TS2A 2L1AA 2WNMA 2ZW0A 4L1BA 2JWUA 2TSSA 5GXGB 2LHDA 1FMAD 3IXSA 2W55A 2DYOA 4A6QA 3IT4B 2WU2B 2WXOA 2W82A 1NYRA 3AE5B 1QF6A 4CQNA 1ZOYB 2KN4A 2Y3AA 1FFUA 1L0XB 1KLGD 1F77A 1SJHD 3Q8EA 3ZYYX 4ARCA 2AQ3B 3IAS1 1L0YB 3Q8FA 1C79A 3W5VB 3MHZA 1FM0D 4US9A 3EA6A 3P1MA 1ACCA 1ENFA 2WXHA 1SE2A 3BK1A 4ZRPA 2JZPA 2DYMA 2RPVA 3B9JA 1I7HA 4MM3B 1EU4A 1V97A 2LFIA 3BVGA 3VQIA 2WXNA 3KWVA 4HKQA 1ZXHA 1JWUD 3BWUD 4RNAA 1B9RA 3FILA 1I4GA 3ABVB 1L5PA 3NZ3A 1CK1A 1P7EA 1FRRA 1UNSA 1OQRA 5I4DA 4PT5A 1E10A 3EUB2 3TEYA 1N62A 2I2YA 3U4EG 3V3XA 1JW9D 3LB8C 1T3QA 1C77A 5G5GA 1I4XA 4M0WA 1MVKA 3LXFA 2D5GA 4LK0M 2QSDA 2IDYA 1HXYD 4WH4A 2QILA 1E9MA 5AUKA 1PFDA 2J53A 4RF1A 1WYGA 1EWYC 1J7AA 3IT6B 1J7CA 3FILB 2E6XA 3NVZA 1IBXB 1VJKA 3W9CB 1KFYB 3WCQA 4OZAA 4WIPA 2IGHA 1M4VA 2V4IB 1L6UA 4AS1A 2AQ2B 1F2RI 2JX5A 1KTKA 1PGXA 3AE4B 1E7PB 2SEBD 1L4ZB 3C8YA 3NVVA 2PMVA 3MFGA 1BMLC 2BT6A 1EU3A 2ON8A 3EGRA 4L2YA 2RDHA 4XWWA 5JXVA 1QILA 1IGCA 3PZ8A 2OEDA 3U7ZA 1E6EB 1XEEA 5EE0A 1FCCC 4AQ7A 2N0SB 3H8HA 2JQRB 3R2TA 3PZ7A 1ROEA 1UWMA 1VZ8A 2V3PA 2BTEA 1GAQB 3ZJTA 3AEDB 1B1ZA 4OHJA 2BB5A 2WLBA 2N9LA 4OVZA 1QOFA 1UGJA 1SSNA 2KWDA 4WWMA 1QQRA 4IDIA 2AQ1B 3BVMA 3U2SC 4LTUA 3TUOA 3TEXA 2WP9B 2M19A 2QEJC 4P16A 4YTMB 2JYEA 2W54A 5BMIA 5C3JB 3P42A 3HUIA 3IAM1 2CJOA 1K50A 2IPKD 1ET9A 1QOAA 2JXTA 2KQ4X 1C9FA 1XLOA 4B0MA 1YNTE 3ZJVA 2J42A 4JE3B 3AM9A 2V3NA 3AE3B 1FD6A 2G1EA 1XLPA 3P63A 2OHFA 1WWTA 1ZDXA 3MP9A 4HROA 4NJCA 4JPSA 5FK9C 5C2TB 4H2AA 2NTSA 2PKOA 5BYSA 1AN8A 3NRZA 1CJEA 2MJ3A 1MHXA 4REZA 4MACA 1TZOA 5AUIA 1TJEA 1T5XD 4WQMA 3T3OA 1L4DB 3VR8B 2WS3B 2WXPA 1JMLA 1RWSA 1GB1A 1F0ZA 2INNE 1FNUA 1MPEA 3OWEB 3TEZA 1SXTA 3PO0A 2K22A 1SF0A 3AN1A 1JWBD 1Y56A 1QKZA 3AEFB 4A55A 1F2RC 1WGKA 1D5ZC 2L83A 4RGTA 2GI9A 2HTME 1NVID 1YMHE 3HVZA 1VDVA 1AWDA 5LNK1 2ZW1A 3AECB 1XCQL 1JCKB 2CU3A 4YTPB 1GOZA 1SIJA 1DGJA 4R3DA 1ZXIA 4RGMA 3W5UB 2CJNA 4JX1C 5T8IA 3KWLA 2QIEB 1HZ5A 1PUTA 3GB1A 5HHDG 1D5MC 4KGRA 4A8XC 2WXLA 4KGTA 4KKIA 2YEPF 2MH7A 4ARIA 1V1PA 1XLQA 2MJDA 1FNWA 4ZHPA 2RMMA 4USAA 2W3RA 1JQ4A 1EWCA 3VRBB 5D3DA 2WXIA 1RM6C 4DXFA 2XN9C 3ZQ4A 1ET6A 1N60A 1TS4A 1SE4A 1HQRD 3AE1B 5BYQA 4TQ0A 2B76B 4NZLB 3ZJUA 2NTTA 5HFYA 2K5PA 1I4HA 2GB1A 1N63A 4WURA 2WXJA 3SFDB 2PIAA 1KLUD 4TMAB 4YSZB 1TYGB 4DXGA 1YQ3B 1FFVA 1QT9A 4XDCA 1VZ6A 3AE6B 3VR9B 5H92C 3NVWA 4RGOS 2QMTA 4RH6A 4MH8A 2N7JA 5D7GA 4A9AA 3NS1A 4B0EA 2FUG1 1RFKA 1V1OA 1WXQA 4HRSA 4XDDA 1C4PA 1KRHA 2R61A 3AB5A 5G5HA 1SBBB 1UWXA 5E6JA 3MC0B 1KF6B 3Q8CA 1NYQA 3AV8A 1ZPSA 4JWSC 2WXMA 1YJIA 1HZ6A 1EM7A 1Q10A 1T6BX 3U52E 1JWMD 2VZKB 3FAHA 2AX5A 3UI3A 4KKJA 3T3NA 1CZPA 3W1SA 4LLGM 1UUPA 1BXTA 1ZP0B 2J52A 2LHEA 2Z8LA 3AEBB 2RDGA 3I9V1 5MPOA 5FKAC 4IOIE 1N5XA 2WXFA 1I4RA 2VZKD 4HKZE 2ICIA 2ONQA 2Y5CA 4Q2JA 3P4PB 2M0AA 1L0VB 1VR9A 1L6VA 1VRAB 4ZOHC 4ITKA 2K9XA 3URYA 2WQYB 1NENB 1FO4A 4US8A 1JRPA 3BK2A 3GS2A 2Q5WD 2WDRB 1YQ4B 3B2FA 1OFFA 3NVYA 4KX6B 1SJED 4IKGA 1KH0A 1SE3A 3DWGC 4GLSC 1CQVA 3CWIA 2BBCA 1N61A 3AE8B 4O1NA 5EE3A 1RYJA 4ZRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NVZ A;  1VJK A;  2CU3 A;  2M56 B;  4YTP B;  3W9C B;  2E3T A;  1KFY B;  1SIJ A;  3P4R B;  1DGJ A;  3WCQ A;  1DOX A;  1ZXI A;  3AEC B;  2DWQ A;  2PVG C;  5EE9 A;  1L6U A;  3W5U B;  1VLB A;  3FC4 A;  2BS2 B;  2JX5 A;  1TKY A;  2CJN A;  4JWU C;  4JX1 C;  3AE4 B;  3NVV A;  1E7P B;  2W3S A;  3KWL A;  2QIE B;  2KAJ A;  1A70 A;  1PUT A;  2BT6 A;  2H88 B;  2DBY A;  2MJE A;  3L4P A;  1TKG A;  1N5W A;  2FBW B;  1GPX A;  3CIR B;  1OQQ A;  2MH7 A;  4YXD B;  1XLQ A;  3P4S B;  3HRD D;  2MJD A;  4ZHP A;  1NI3 A;  3AH7 A;  4USA A;  2W3R A;  1JQ4 A;  3VRB B;  1FXA A;  1E6E B;  1RM6 C;  1WRI A;  1FIQ A;  3RPF C;  1QOB A;  5EE0 A;  3SR6 A;  2WDV B;  4C7Y A;  4C80 A;  1N60 A;  3AE1 B;  1QOG A;  2N0S B;  1IUE A;  2B76 B;  2JQR B;  1JRO A;  2ACZ B;  1DOY A;  1ROE A;  1UWM A;  1YJJ A;  1NEK B;  4N58 A;  4N6E B;  1JWA D;  2K5P A;  3ETR A;  1N63 A;  3B2G A;  5EE1 A;  2PVO D;  1GAQ B;  3AEA B;  1QLB B;  4C7Z A;  3AED B;  1AYF A;  2WLB A;  1FXI A;  3SFD B;  2PIA A;  4YTN B;  1QOF A;  3VRA B;  4YSZ B;  3AE9 B;  2BS3 B;  1TYG B;  1R7S A;  4WWM A;  1YQ3 B;  1V8C A;  4IDI A;  1DOI A;  1FFV A;  1QT9 A;  1XLN A;  5GXG B;  3AE6 B;  3AMZ A;  3VR9 B;  1FMA D;  4LTU A;  5H92 C;  3NVW A;  2W55 A;  2WP9 B;  2M19 A;  4YTM B;  1J7B A;  2LEK A;  2W54 A;  5C3J B;  4A9A A;  1PDX A;  2WU2 B;  3NS1 A;  3AE5 B;  1NYR A;  4YSX B;  3HUI A;  1QF6 A;  1RFK A;  1WXQ A;  2CJO A;  1ZOY B;  4HRS A;  1E0Z A;  1FFU A;  1KRH A;  1QOA A;  2L52 A;  5H8Y E;  1XLO A;  3AB5 A;  1JAL A;  5G5H A;  3ZYY X;  3AM9 A;  1KF6 B;  3AE3 B;  3W5V B;  1NYQ A;  3AV8 A;  2G1E A;  4YT0 B;  1XLP A;  4JWS C;  3P63 A;  1FM0 D;  1XO3 A;  2OHF A;  4US9 A;  3P1M A;  1YJI A;  2BS4 B;  1WWT A;  4HRO A;  5C2T B;  3FAH A;  2PKO A;  2AX5 A;  3B9J A;  1I7H A;  1CZP A;  1V97 A;  3NRZ A;  1CJE A;  1ZP0 B;  2MJ3 A;  3AEB B;  5MPO A;  1FRD A;  5AUI A;  2KMM A;  1N5X A;  1TJE A;  4WQM A;  3DWM A;  1B9R A;  4YSY B;  2Y5C A;  2H89 B;  3VR8 B;  3ABV B;  2WS3 B;  1L5P A;  1TKE A;  1L0V B;  3P4P B;  1RWS A;  3SFE B;  1L6V A;  1F0Z A;  1FRR A;  2WU5 B;  4ZOH C;  1OQR A;  1SB3 C;  3AE7 B;  4ITK A;  1E10 A;  2K9X A;  3PO0 A;  2K22 A;  1SF0 A;  3AN1 A;  3EUB 2;  4ZHO A;  3BII D;  2WQY B;  1JWB D;  3P4Q B;  1NEN B;  4P6V F;  4US8 A;  1ZUD 2;  1N62 A;  1JRP A;  3AEF B;  1FO4 A;  3AE2 B;  1JW9 D;  2Q5W D;  2WDR B;  1YQ4 B;  3B2F A;  1OFF A;  1T3Q A;  3LB8 C;  3NVY A;  2EKI A;  4KX6 B;  1WGK A;  5G5G A;  2L83 A;  4FXC A;  2HTM E;  3DWG C;  1NVI D;  3LXF A;  3CWI A;  2QJL A;  5EE3 A;  1E9M A;  3HVZ A;  5AUK A;  1PFD A;  2WDQ B;  1WYG A;  1EWY C;  1VDV A;  4N59 A;  1AWD A;  1J7A A;  1N61 A;  3AE8 B;  3AEE B;  1J7C A;  3AEG B;  1RYJ A; 
#chains in the Genus database with same CATH topology
 3TIX A;  1DOX A;  3FC4 A;  1TKY A;  2EMS A;  3ZGZ A;  3FKY A;  3GE8 C;  2H88 B;  4FN2 A;  1EUV B;  2IGD A;  1LQB A;  4NAW B;  4WWP A;  5CHW A;  5JHB A;  5IA7 A;  2PE9 A;  2PLP A;  4WQO B;  5DPR A;  1E7V A;  3H7P A;  2KAC A;  2OOB B;  1FIQ A;  2BKR B;  4XWT A;  2ACZ B;  2C7N B;  2N4F A;  4DQO C;  3RT3 B;  4GIV A;  2OJR A;  3LYY A;  3B2G A;  3GZN I;  4C7Z A;  2GBK A;  3TSS A;  1FXI A;  3RZW C;  4OZC A;  3KQ4 A;  1YN5 A;  4HK2 A;  3RCZ A;  1T0R C;  5TSS A;  1TS3 A;  2HD5 B;  1E0Z A;  2VH2 A;  4TKN A;  3TCA A;  4NNJ B;  3BVZ A;  2XNA C;  4I6N B;  2R2Q A;  1R4N I;  4YT0 B;  3MJ5 A;  4ANX A;  2C7H A;  4S17 A;  3M3J A;  2KVR A;  3Q8A A;  2KLG A;  3RZF A;  4C56 C;  4FAD A;  2V0G A;  3DWM A;  5IO9 A;  1E5W A;  4RGN A;  3BZD B;  2H89 B;  5D3I B;  2KO3 A;  3K9O B;  3R66 C;  4LDT B;  2KD0 A;  3KH0 A;  1WMH A;  2WU5 B;  3N1X C;  2INP E;  2HJ1 A;  1WIA A;  3RNG C;  4XZ4 A;  3BII D;  1WJ6 A;  1ZUD 2;  2SAK A;  2QJL A;  3KYC D;  3GZN B;  2IBI B;  3P2B A;  3AEG B;  3ZXR A;  2LVP A;  3KUD B;  1VZ7 A;  1VLB A;  3AU5 A;  4XGA B;  3C19 A;  2FCQ A;  3QWZ B;  3V61 A;  4FHK A;  2KTR B;  3GP7 A;  4C4V A;  1TKG A;  4OVV A;  1SE9 A;  4NQL B;  1V86 A;  1ESF A;  1K52 A;  1R4N B;  5BMH A;  2R2O A;  2FID A;  2INC C;  4C7Y A;  3M62 B;  2UWQ A;  2CU1 A;  4NAM A;  2GBM A;  5CHF A;  4IUM B;  5BMG A;  3R8B A;  3AEA B;  1EF1 A;  2KAN A;  3NUH B;  2BS3 B;  1WR6 E;  5IN7 A;  3HM3 A;  2WNM A;  2ZW0 A;  2JWU A;  2LHD A;  2L05 A;  3H6N A;  3IT4 B;  2WU2 B;  3A9K B;  2W82 A;  1NYR A;  1N6Z A;  3AE5 B;  1QF6 A;  1ZOY B;  1L0X B;  3DOW A;  4FJZ A;  1L2N A;  4BKS D;  4ARC A;  1C79 A;  1TZ1 A;  3EA6 A;  2O6V B;  4KIK B;  2N9E B;  2JZP A;  1I7H A;  4MM3 B;  3VUW A;  2LFI A;  4BBN F;  1ZXH A;  1HE8 A;  3Q2A C;  1B9R A;  1GUA B;  2KJR A;  3H7S A;  1WX9 A;  2M0X A;  3KW5 B;  5DPW A;  3EUB 2;  3TEY A;  1WE6 A;  1I4X A;  2D5G A;  4WH4 A;  2QSD A;  1HXY D;  2ZEQ A;  1PFD A;  1WYG A;  3IT6 B;  3H9D A;  3FIL B;  1IBX B;  2D07 B;  4WAA A;  2IGH A;  4LJO B;  1F2R I;  1RLF A;  3AE4 B;  2SEB D;  3Q3J A;  1BML C;  2JVC A;  3IVF A;  2D11 A;  2KN5 A;  2LGS A;  4AUQ C;  5JXV A;  2ZPY A;  5DCN A;  3U7Z A;  1E6E B;  2MHJ A;  5E6O A;  1FCC C;  4IWP A;  4MSM B;  1WJN A;  2IND C;  1FPY A;  4EZJ A;  1GJZ A;  3ZJT A;  1GC7 A;  3R7R A;  3EHV A;  1B1Z A;  2WLB A;  3RI7 C;  2N9L A;  1UGJ A;  1SSN A;  2KWD A;  1FXT B;  1QQR A;  3BVM A;  2MWS B;  5IAA C;  3N3K B;  4P16 A;  2JYE A;  2PPH A;  4KVG B;  2K8C A;  3HK0 A;  2KMC A;  2CJO A;  1WRD B;  3MJW A;  3KUZ A;  3ZJV A;  1FD6 A;  1P0R A;  2NBU A;  3ZDT A;  3PPA A;  2OHF A;  1ZDX A;  4HRO A;  1HTO A;  2KDI A;  4NAW A;  4H2A A;  2NTS A;  2KQS A;  1WZ3 A;  1CJE A;  3A4S C;  4MAC A;  1S3S G;  4W9D A;  1SIF A;  1TJE A;  2KC2 A;  1GB1 A;  2CR5 A;  2QHO A;  2N9P C;  4FHJ A;  4WWO A;  2KDE B;  1TGZ B;  4EZL A;  4A3P A;  1QKZ A;  1OGW A;  5D94 A;  1D5Z C;  4W9J A;  2GI9 A;  4PK1 A;  2Y5B B;  4ANU A;  1AWD A;  3AEC B;  2CU3 A;  2I1J A;  3KYD D;  1WGR A;  4YTP B;  2XK5 B;  1SIJ A;  2ZCB A;  3N1Z C;  2JWZ A;  2CJN A;  3ZXV A;  4JX1 C;  2KWU B;  1HZ5 A;  3GB1 A;  4ZYN A;  1IP9 A;  1D5M C;  3MHS D;  2YEP F;  4KSK C;  4IG7 B;  2MJD A;  2L00 B;  1JQ4 A;  4DXF A;  4NJ7 A;  2KYW A;  1ET6 A;  1TS4 A;  1SE4 A;  5BYQ A;  2XEW A;  1GG3 A;  1MG4 A;  4ZDV A;  5HFY A;  3U7D A;  2K5P A;  3L10 B;  4WUR A;  2WXJ A;  3A1Q B;  3SFD B;  1VZ6 A;  3AE6 B;  3AUL A;  4RGO S;  3EFC A;  4MH8 A;  5D7G A;  3NS1 A;  1V1O A;  4HRS A;  1WXQ A;  2HJ8 A;  5LXH A;  4ICU A;  1C4P A;  2GBN A;  2HTH A;  1KF6 B;  3Q8C A;  2KTR A;  1A5R A;  1YJI A;  4CYE A;  4BKT A;  5MPO A;  2IO0 B;  2G4S A;  4P1B C;  2UYZ B;  4HKZ E;  2LWP A;  1HTQ A;  4Q2J A;  2M0A A;  4BBN C;  1VRA B;  3DBL I;  2FUH B;  4ZOH C;  4P1C C;  2A5U A;  1Z2M A;  2JF5 A;  4GDL A;  3URY A;  2V9H A;  2BKF A;  2Z0E B;  3M95 A;  4W9K A;  3SD5 A;  4GGQ A;  3NHE B;  1VCB A;  3B2F A;  3NVY A;  2DHZ A;  3T8M A;  2I1K A;  3QK0 A;  2MSE D;  2L3Z A;  3QAR A;  2KDF B;  3AU4 A;  2FE8 A;  3ENE A;  2KXJ A;  1FEH A;  1OEY J;  4KSL C;  2KOX A;  2JXX A;  3QA8 A;  1A70 A;  3ZNI D;  1I4Q A;  1C78 A;  3PV1 A;  1GPX A;  1HEZ E;  2NR2 A;  4II3 B;  4YXD B;  3BYY B;  2LMC A;  3P4S B;  2HE7 A;  4WJO A;  4DHZ B;  2N9K A;  4MM3 A;  4DXA B;  4PS3 A;  1FXA A;  4HEA 1;  1WI0 A;  4K7W A;  4JQW C;  2KZR A;  2WDV B;  5AZG A;  4TSS A;  3VH3 B;  3I3T B;  1P7F A;  5JZE B;  1MI0 A;  4N58 A;  4FA6 A;  3R2I A;  3SEB A;  2YVC A;  1TY0 A;  2EEL A;  1PGB A;  5AZF A;  3VRA B;  4HVB A;  2PTL A;  3DBL B;  2MBB B;  1DOI A;  2ZVO A;  1XLN A;  4MT5 A;  2V1Y A;  4GDK B;  2L32 A;  2AL6 A;  1IBX A;  3WAM A;  4HPP A;  3OAW A;  2C60 A;  3BY4 B;  3IBE A;  1MFW A;  1IGD A;  1WGD A;  1WM2 A;  5G55 A;  2QC8 A;  4RM8 A;  3OJ4 B;  4W9H A;  2BW2 A;  2GOW A;  4HJG E;  2KK8 A;  2MX2 A;  1TS5 A;  2W9N A;  1K8R B;  1K53 A;  2KMM A;  4E3C A;  1OTR B;  3RNB C;  4YSY B;  2PEA A;  1J8C A;  2M1M A;  1TKE A;  1D5X C;  3OJ3 A;  3ZKJ C;  3ZNG C;  3LJ3 A;  4F1S A;  3TEW A;  3P4Q B;  1E8Y A;  1XXG A;  4K7U A;  4BOS C;  2KJ6 A;  1VD2 A;  5IP4 D;  3PGE A;  1GB4 A;  2J4X A;  3PRE A;  1PGA A;  4L23 A;  1ZE3 D;  2NBV B;  2J0K A;  2PVG C;  3RFZ B;  1PYW D;  4JGH B;  1C4C A;  3KUC B;  1YJ1 A;  2NVU I;  2FBW B;  4DBG A;  1BUI C;  2DLB A;  1RAX A;  3ZTC A;  4MH0 E;  2M8S A;  1WRI A;  3ZVV A;  5DPT A;  2JY6 A;  4DHZ E;  2BYT A;  3RYT A;  4ZYS A;  2UU7 A;  3PRP B;  3L17 A;  4WAF A;  1UF0 A;  1WXV A;  2I38 A;  2K1F A;  3ETR A;  2FIF A;  5EE1 A;  2RSU A;  1E8W A;  3V05 A;  1MJD A;  3ZIM A;  2KDB A;  5G2N A;  4L1B A;  3DBH I;  2J7Q B;  1SJH D;  3EFU A;  3ZYY X;  3W5V B;  4IM2 A;  4GSW A;  3P1M A;  4EUT A;  3JW0 X;  3RNE C;  2WXH A;  2ZNV B;  2CHZ A;  4G11 A;  2LI5 A;  1P1A A;  5L95 C;  1Q1O A;  3ABV B;  1L5P A;  2BPS A;  1CK1 A;  3A4R A;  3H1U A;  4MGI E;  1AAR A;  3L16 A;  2K25 A;  4PT5 A;  3A1Q A;  2JRH A;  2C5L C;  4G50 A;  3U4E G;  1JW9 D;  3LB8 C;  4M0W A;  3OLM D;  2QIL A;  1E9M A;  3NZU A;  4XC2 A;  2JRI B;  2J53 A;  4RF1 A;  1J7C A;  4NPN A;  2MBQ A;  4NY0 A;  3DBR I;  1M4V A;  1L6U A;  1KTK A;  3DBH B;  3MFG A;  2KHW B;  4DK5 A;  5LXI B;  4AJW A;  3RNA C;  4L2Y A;  1WJU A;  4XWW A;  2Z59 B;  3PZ8 A;  2KQ7 A;  4MJS B;  3HM6 X;  1EF5 A;  1I42 A;  2RPQ A;  5BO4 B;  2CS4 A;  1UWM A;  1VZ8 A;  3MTN B;  4MGY E;  2VH1 A;  4WJP A;  5JH5 C;  4OHJ A;  5J18 A;  2IZV B;  5CHV C;  1QOF A;  3Q6B A;  1S1Q B;  3PRM B;  4IDI A;  2AQ1 B;  4LTU A;  3TUO A;  3TEX A;  4BVU C;  3SDL C;  2QEJ C;  4YTM B;  1V49 A;  3P42 A;  3HUI A;  1K50 A;  3NOB A;  2IO2 B;  2KQ4 X;  4PYU A;  3VUY A;  2J42 A;  3AM9 A;  2G1E A;  1WWT A;  5C2T B;  4TUU A;  3VTW A;  2FCS A;  3U8Z A;  3BIN A;  3DBR B;  3NZS A;  3ZUN A;  3NRZ A;  2MJ3 A;  1MHX A;  4REZ A;  2ASQ A;  4ASW C;  2LVQ A;  3N32 A;  3AI5 A;  4KV2 A;  3AXC A;  3B0A A;  4WQM A;  2JPH A;  3VR8 B;  2WS3 B;  4W9F A;  3X0W A;  4MSQ B;  2L0T A;  1FNU A;  3TEZ A;  1T0Q C;  1SXT A;  2MP2 B;  3PO0 A;  1WYW B;  3A9J B;  1JWB D;  2KX0 A;  3V62 A;  2WX0 A;  2PE6 B;  2HTM E;  1NVI D;  1SGH A;  1WXA A;  2FAZ A;  1ZW7 A;  4LCD E;  5LNK 1;  4GDK A;  4NQK E;  1JCK B;  2G45 B;  4BKG A;  2LGD A;  1ZXI A;  4X57 B;  3PZD A;  3W5U B;  5KHQ A;  2IO1 B;  1E8Z A;  1WE7 A;  1PUT A;  4AP4 C;  4AOF A;  2WXL A;  3EEC A;  1UBI A;  2MH7 A;  2D3B A;  4ARI A;  1XLQ A;  2CHW A;  2W3R A;  1F52 A;  3VRB B;  2XN9 C;  1N60 A;  3AE1 B;  1HQR D;  2B76 B;  4I6L B;  3W1Y A;  1WR1 A;  3DVG Y;  4OVU A;  3ZJU A;  3VVW B;  2FCN A;  1GNU A;  1I4H A;  2GB1 A;  1N63 A;  4HXD A;  4TMA B;  4YSZ B;  1IPG A;  1TYG B;  3VR9 B;  2D3C A;  2QMT A;  3RN9 C;  4DDI D;  4B0E A;  4EOY A;  2KFK A;  2OJW A;  3DVN V;  1P9D U;  2R61 A;  3AB5 A;  5G5H A;  1UWX A;  1ZPS A;  4JWS C;  2WXM A;  2NPT B;  4G0N B;  5LLI A;  1T6B X;  1JWM D;  5CX3 A;  3IHP C;  3W1S A;  4LLG M;  1ZP0 B;  2RDG A;  3TJP A;  3APF A;  1N5X A;  3ZDM C;  2NBW B;  4EEW A;  1TTN A;  4IM3 A;  2VZK D;  2Y5C A;  4LJP B;  3P4P B;  1R4M I;  1L0V B;  4WJN A;  3DCG A;  5E6P A;  1E7U A;  1LFD A;  1NEN B;  4US8 A;  1JRP A;  3GS2 A;  3PSE B;  1OEY A;  1SJE D;  3VAW A;  5J17 A;  3VFK A;  4II2 B;  2N9X A;  1EO6 A;  4BKS A;  4MEL A;  3AE8 B;  4O1N A;  4ZRQ A;  4BAX A;  5EE9 A;  2DWQ A;  1H4R A;  1V5O A;  2L8J A;  5D2M B;  4N9F 4;  4DDG D;  2WXQ A;  1C4A A;  2KAJ A;  1KLV A;  1WFY A;  3R7Q A;  4P7I A;  1N5W A;  5JHA A;  3CIR B;  3W1S C;  1WX8 A;  4URK A;  1OQY A;  3HIZ A;  3RMK C;  2JYT A;  3N9Y C;  3CMM B;  2LVO A;  3NG0 A;  2ZZP B;  4W9L A;  4HDQ A;  3ALB A;  2BB6 A;  3NY5 A;  1JRO A;  1Z5S B;  1DOY A;  1YJJ A;  4OZB A;  3ZTD A;  2RGF A;  1Q5W B;  1AYF A;  1R4M B;  2JZZ A;  2LZ6 A;  4W9I A;  2IO3 B;  3GOE A;  2J0J A;  3H7P B;  1P3Q U;  1J7B A;  2K3U A;  1PDX A;  2LGY A;  2MEK A;  4GU2 A;  1FCL A;  4LNO A;  4J3O D;  1U4A A;  2AYO B;  3ML9 A;  2DZJ A;  5HI1 A;  1XO3 A;  1WGH A;  3Q3F A;  4M01 A;  2D10 A;  4XYC A;  2BS4 B;  1V1P B;  2DZK A;  4YWG G;  2KMA A;  1FRD A;  3E9S A;  4YL8 A;  4HWI B;  1YN3 A;  1WGG A;  3ZW3 A;  3PLU A;  1LO5 D;  2RR9 A;  3EC8 A;  4ZHO A;  4EE2 A;  4P6V F;  2G3Q B;  2DNF A;  4TV3 A;  5FR6 A;  2NCN A;  2WXR A;  2EKI A;  4FXC A;  2KDM A;  4D2K A;  1FNV A;  1YN4 A;  2MBH A;  2GRI A;  2BWE S;  4N59 A;  3ONS A;  3X23 A;  2LUM A;  2LD9 A;  2PW9 A;  2QDF A;  2X8X X;  3E56 A;  2M56 B;  2Y5P A;  2LGI A;  2E3T A;  3O65 B;  3TMP B;  1WMH B;  1KJT A;  1ISN A;  4JWU C;  1BT0 A;  2XBB C;  4RF0 A;  2G9H D;  2W3S A;  2KVZ A;  2MJE A;  4RCO A;  4DWF A;  3PRZ A;  5BYR A;  1SEB D;  4IWO A;  2BYE A;  1LGR A;  5C23 A;  1HA5 A;  5AEK B;  3RPF C;  4F7Z A;  2AEH A;  4UDU C;  1QOB A;  2WWZ A;  1I4P A;  3A9K A;  1QOG A;  2K0P A;  3I57 A;  4TQ1 A;  3GE3 C;  1XF5 L;  3Q69 A;  4N6E B;  4C4V B;  2ZJD A;  2PVO D;  1K51 A;  1QLB B;  3A9J A;  3DVG X;  2IY1 B;  3WIM A;  2O6V A;  4KIK A;  3C0R B;  1R7S A;  2L1A A;  2TSS A;  1FMA D;  3UQB A;  2W55 A;  2BVC A;  4A6Q A;  2WXO A;  4CQN A;  2KN4 A;  3Q3M C;  1FFU A;  2FNJ B;  4CO7 A;  1KOT A;  2AQ3 B;  1C3T A;  3IAS 1;  1L0Y B;  2KWV B;  3MHZ A;  4US9 A;  3VXW A;  1UBQ A;  3BK1 A;  2DYM A;  2RPV A;  3B9J A;  3CSF A;  4ACF A;  1EU4 A;  1V97 A;  1YOV B;  2DYB A;  3KWV A;  4HKQ A;  4ZRI A;  5DPS A;  2O2V B;  4DHJ D;  1T0Y A;  1XD3 B;  5HKH A;  1YIW A;  3FIL A;  1I4G A;  3NZ3 A;  3PLV A;  4KDL B;  1P7E A;  1FRR A;  4ANV A;  4GMV A;  5I4D A;  4RM9 A;  2D3G A;  1N62 A;  2I2Y A;  3V3X A;  4K81 A;  3LXF A;  3DVN U;  3ZLZ A;  1C1Y B;  2LRU A;  3Q3N C;  1EWY C;  4WWN A;  3KVF B;  1J7A A;  3NVZ A;  3W9C B;  1KFY B;  3WCQ A;  4WIP A;  2ZPN A;  3L54 A;  4ICV A;  2JX5 A;  1PGX A;  3C8Y A;  1L4Z B;  4NJ6 A;  1E90 A;  3QAQ A;  4E71 A;  2NPT A;  5L83 A;  4FBJ B;  2RDH A;  1V80 A;  4JIO U;  1QIL A;  2M4N A;  1IGC A;  2OED A;  1YX6 B;  2LGX A;  2PJH A;  4AQ7 A;  1WXS A;  2WYQ A;  2GBJ A;  2JQR B;  3R2T A;  5AZH A;  4BOZ B;  1GAQ B;  5IKC M;  1ZGU B;  2WP9 B;  3RD2 A;  1WF9 A;  5BMI A;  5C3J B;  4HPM B;  2IPK D;  4PYZ A;  1ET9 A;  1QOA A;  1NDD A;  2JXT A;  1C9F A;  1XLO A;  3N20 C;  4LNN A;  3UIN B;  2MQJ A;  4MEM A;  2V3N A;  2B3A A;  3TL5 A;  2LXA A;  3V6E B;  3MP9 A;  4JPS A;  1H8C A;  3APD A;  2C9W B;  2PKO A;  5E6N A;  2EMT A;  4IM0 A;  5BYS A;  1AN8 A;  3QIJ A;  4W9C A;  4M8M A;  1M94 A;  2MBE A;  1TZO A;  5AUI A;  4WJQ A;  4HJK A;  3T3O A;  1L4D B;  5CTR C;  4FUL A;  2WXP A;  3PHX B;  2INN E;  2XK5 A;  4W9E A;  1MPE A;  4K1R B;  4ZRJ A;  4HCN B;  4C00 A;  2K22 A;  1SF0 A;  3Q3O C;  2DEN B;  1Y56 A;  1NBF C;  5KHO A;  3QCA A;  1I35 A;  1F2R C;  1UGM A;  2L83 A;  3PHW B;  4RGT A;  1YMH E;  2IYD B;  1VDV A;  2ZW1 A;  1ZKH A;  1GOZ A;  1DGJ A;  1KM7 A;  4IC7 B;  2N7D A;  4QAY A;  5T8I A;  3VTV A;  2KC1 A;  2QIE B;  1RFA A;  4KGR A;  2K8B A;  3HHM A;  1V1P A;  1FNW A;  1NI2 A;  2RMM A;  3WAL A;  2WXI A;  2L76 A;  3ZQ4 A;  1QZE A;  4A3O A;  3RUI B;  4JL9 A;  3B08 A;  1WJ4 A;  4TQ0 A;  2D2Q A;  3ZNH B;  2NTT A;  2L0F A;  1IYF A;  2PIA A;  2LAS A;  2Z0D B;  3CF6 E;  4DXG A;  1FFV A;  1QT9 A;  4XDC A;  2G4D B;  4RH6 A;  2WDT B;  1J19 A;  4A9A A;  1RFK A;  2MRP A;  4XDD A;  1KRH A;  3M63 B;  4JLC A;  5E6J A;  1CMX B;  3MC0 B;  3UIP B;  2A4Z A;  3RNC C;  1EM7 A;  3U52 E;  2BYF A;  2VZK B;  3UI3 A;  1CZP A;  1TIF A;  1MG8 A;  1V81 A;  1V5T A;  5FKA C;  4IOI E;  2WXF A;  4GN1 A;  5IOI A;  3N1Y C;  3U30 A;  4MGZ E;  2ICI A;  2ONQ A;  4XX5 A;  1VR9 A;  2YLM A;  1L6V A;  1WH3 A;  2K6Q A;  1D3Z A;  2WHI A;  4ITK A;  1J0G A;  2WQY B;  1Y8R C;  4IWQ A;  1YQ4 B;  4KX6 B;  4K7S A;  1KH0 A;  3NS8 A;  1CQV A;  3L08 A;  1Q0W B;  1TBE A;  1N61 A;  4CHK A;  1RYJ A;  2X38 A;  2RDB C;  3J9C A;  1PQS A;  2MW5 A;  4GDL B;  5FR3 A;  1AW7 A;  2KJH B;  1OQQ A;  1WXM A;  4K3C A;  3HRD D;  2BQQ A;  4KZC A;  3AH7 A;  3QQ8 B;  5GMV A;  4FJY A;  1UH6 A;  3ECI A;  2O2V A;  3UIO B;  4C80 A;  1IUE A;  3D32 A;  1JWS D;  2MA9 B;  3JSV B;  1WY8 A;  3ZRC A;  2BF8 B;  1STE A;  3O13 A;  3SHQ A;  5EDS A;  3JYU A;  4YTN B;  3AE9 B;  3RUL A;  1WSP A;  1V8C A;  3AMZ A;  3VTU A;  3UGB B;  2LEK A;  4IW0 A;  1MHH E;  2WGS A;  4YSX B;  2N7E A;  3IG3 A;  2D3A A;  1C76 A;  2L52 A;  5H8Y E;  1JAL A;  1D6E C;  4RFB A;  2JU6 X;  3WAP A;  2VRR B;  2C7M B;  1D4B A;  3KLS X;  4I6P A;  2REX A;  1TY2 A;  3R3M A;  2GBR A;  2MBO A;  2LRW A;  2KWC A;  4KGS A;  3T9L A;  3SFE B;  2CKH B;  2NMQ A;  3MC9 A;  1SB3 C;  3AE7 B;  3PTF C;  2WXG A;  4BZA A;  3AE2 B;  3QX1 A;  4S0R A;  4LDT D;  1ZDV A;  4FJV B;  3PVL A;  2WDQ B;  3JVZ X;  1JRU A;  1DYQ A;  2WXK A;  2YEP B;  4GB9 A;  2KTF A;  3AEE B;  3DQV A;  1E8X A;  4RMA A;  2LJI A;  3P4R B;  2BS2 B;  2IGG A;  2L7R A;  4OW0 A;  4G3X B;  2K6D B;  3ZRF A;  2DBY A;  4XE0 A;  3L4P A;  1X1M A;  1XCT L;  3VH4 B;  2DAJ A;  1NI3 A;  1LM8 B;  2HDE A;  3HVD A;  2CHX A;  3DHG C;  1L7Y A;  1XT9 B;  5HG2 A;  3SR6 A;  4A90 A;  3VUX A;  2JSV X;  3S2A A;  2MCN B;  3BYT B;  3ML8 A;  3Q8B A;  1NEK B;  2GLS A;  2IJ0 A;  2RD0 A;  4M8N A;  1JWA D;  3W2D A;  4PS8 A;  2JZ3 B;  1TS2 A;  5GXG B;  3IXS A;  3NJT A;  2DYO A;  3DHI C;  3DBS A;  2Y3A A;  4HDO A;  1KLG D;  1F77 A;  3Q8E A;  3Q8F A;  3DHH C;  4AJY B;  4LNF A;  1FM0 D;  3RNF C;  2JT4 B;  2QCZ A;  1ACC A;  1ENF A;  4DHJ B;  1SE2 A;  2DZI A;  4ZRP A;  2V3S A;  3Q14 C;  3BVG A;  3VQI A;  2WXN A;  2ZCC A;  2O6V D;  1JWU D;  1F1H A;  3BWU D;  4RNA A;  5D6J B;  1UNS A;  1OQR A;  1E10 A;  2ZNV C;  1T3Q A;  1C77 A;  5G5G A;  1MVK A;  4LK0 M;  4AWJ A;  2IDY A;  4HPL B;  5AUK A;  4MGK E;  4MJS A;  3DDC B;  3ZNZ B;  2E6X A;  2BWF A;  1VJK A;  4OZA A;  2V4I B;  4AS1 A;  1V9J A;  4KZ0 A;  2AQ2 B;  3NVV A;  1E7P B;  2PMV A;  4HCP B;  2BT6 A;  2K39 A;  4GXB A;  1EU3 A;  2ON8 A;  3EGR A;  4M0W B;  4EFO A;  2JUO A;  3IFW B;  1F9J A;  1T0S C;  2KT7 A;  2KFJ A;  2IY0 B;  2DX5 B;  1XEE A;  1WGY A;  5EE0 A;  1V2Y A;  2N0S B;  3H8H A;  2J0M A;  4FLH A;  3PZ7 A;  1ROE A;  3WAN A;  2V3P A;  2BTE A;  3AED B;  4BFR A;  2BB5 A;  4OVZ A;  4WWM A;  4M02 A;  3U2S C;  2EKE C;  4MDK E;  2M19 A;  2W54 A;  4LNI A;  3IAM 1;  4GOC A;  4B0M A;  1YNT E;  4M00 A;  4JE3 B;  3AE3 B;  3K9P B;  3MC8 A;  1XLP A;  2MP2 A;  3P63 A;  4PS7 A;  5TR5 A;  1UD7 A;  4NJC A;  5FK9 C;  4J6I A;  2N1W A;  3QJZ A;  2K8H A;  1WZ0 A;  1YX5 B;  1UZX B;  1XQQ A;  1T5X D;  4KDI C;  2KNB A;  1JML A;  1RWS A;  1F0Z A;  3OWE B;  2KLC A;  3QC8 B;  3JSV A;  4A20 A;  3QHT A;  3AN1 A;  3AEF B;  4A55 A;  3ZO5 B;  3WA0 A;  3VHT C;  1WGK A;  2DAF A;  1P98 A;  2LUE A;  3HVZ A;  1YQB A;  3I63 C;  3I5J C;  3VDZ A;  4EZK A;  1XCQ L;  3APC A;  1LXD A;  4R3D A;  3V6C B;  4RGM A;  2LXC A;  4EKU A;  4ZRK A;  3KWL A;  2LJ5 A;  3SU8 X;  5HHD G;  4A8X C;  4KKI A;  4KGT A;  1WM3 A;  2MLB A;  4ZHP A;  4USA A;  1EWC A;  5D3D A;  1RM6 C;  3UQA A;  2N1V A;  2KX3 A;  4B9K A;  3TBL D;  2M17 A;  4ANW A;  4NZL B;  3DPD A;  3CST A;  5J2R A;  3N30 A;  2FCM A;  3UF8 A;  1TT5 B;  1KLU D;  1YQ3 B;  2BGF A;  1WX7 A;  2AL3 A;  5H92 C;  3NVW A;  3PS6 A;  4B95 A;  3PT2 B;  4F8C B;  2N7J A;  3L13 A;  4LNK A;  2FUG 1;  3OG5 A;  2DZM A;  1SBB B;  3B1L X;  1GC6 A;  1NYQ A;  3AV8 A;  4K3B A;  1HZ6 A;  2ZVN A;  1Q10 A;  3LDZ E;  3FAH A;  2AX5 A;  2NS5 A;  4KKJ A;  3T3N A;  3A33 B;  2KKC A;  1UUP A;  1BXT A;  3AEB B;  3I9V 1;  2J52 A;  2LHE A;  2Z8L A;  1UEL A;  2KFK B;  1I4R A;  2AWT A;  1RRB A;  2GMI C;  4B6W A;  1V6E A;  2K9X A;  4W9G A;  1G6J A;  3WAO A;  1FO4 A;  2WX1 A;  4HLE A;  3BK2 A;  2V4L A;  3L0W B;  3V60 A;  2Q5W D;  2WDR B;  1OFF A;  4IKG A;  1SE3 A;  3DWG C;  4GLS C;  3CWI A;  4E74 A;  2BBC A;  5C1Z A;  5EE3 A;  2BYV E;  1YD8 U; 
#chains in the Genus database with same CATH homology
 2FE8 A;  2X38 A;  1DOX A;  1FEH A;  5EE9 A;  2DWQ A;  3FC4 A;  1TKY A;  3J9C A;  3ZGZ A;  4GDL B;  2WXQ A;  1C4A A;  2KAJ A;  1A70 A;  5FR3 A;  2H88 B;  1I4Q A;  1AW7 A;  1N5W A;  2IGD A;  1C78 A;  4NAW B;  3CIR B;  1HEZ E;  1OQQ A;  1GPX A;  4YXD B;  3BYY B;  2LMC A;  3HRD D;  3P4S B;  2PLP A;  2N9K A;  3AH7 A;  2KAC A;  1FXA A;  4HEA 1;  1FIQ A;  2JYT A;  3N9Y C;  2WDV B;  4TSS A;  4C80 A;  4XWT A;  2BB6 A;  1IUE A;  1JWS D;  1JRO A;  2ACZ B;  1DOY A;  1P7F A;  1YJJ A;  1MI0 A;  4N58 A;  4OZB A;  4DQO C;  3LYY A;  3B2G A;  3R2I A;  3SEB A;  4C7Z A;  1TY0 A;  1STE A;  3O13 A;  1AYF A;  3TSS A;  1FXI A;  2EEL A;  1PGB A;  4OZC A;  4YTN B;  3VRA B;  3AE9 B;  3KQ4 A;  1WSP A;  1YN5 A;  2PTL A;  1V8C A;  1DOI A;  1XLN A;  5TSS A;  3AMZ A;  4MT5 A;  1J7B A;  2LEK A;  1MHH E;  1PDX A;  2K3U A;  4GDK B;  4YSX B;  1TS3 A;  2L32 A;  1IBX A;  2MEK A;  1E0Z A;  1C76 A;  1FCL A;  2L52 A;  5H8Y E;  3BVZ A;  4J3O D;  1JAL A;  1D6E C;  2XNA C;  4RFB A;  1IGD A;  2JU6 X;  5HI1 A;  4YT0 B;  1XO3 A;  1D4B A;  3MJ5 A;  2BS4 B;  3KLS X;  1V1P B;  2BW2 A;  1TY2 A;  4HJG E;  3Q8A A;  4YWG G;  1TS5 A;  1FRD A;  1K53 A;  2KMM A;  4C56 C;  3E9S A;  2V0G A;  3DWM A;  4YSY B;  4RGN A;  3BZD B;  2H89 B;  4KGS A;  5D3I B;  1TKE A;  1D5X C;  3SFE B;  1YN3 A;  2NMQ A;  2WU5 B;  1SB3 C;  1LO5 D;  2INP E;  3AE7 B;  3TEW A;  4ZHO A;  3BII D;  3P4Q B;  4EE2 A;  1XXG A;  4P6V F;  2WXG A;  1ZUD 2;  3AE2 B;  2SAK A;  2WXR A;  2EKI A;  1ZDV A;  4FXC A;  2KDM A;  4D2K A;  1FNV A;  2QJL A;  1YN4 A;  1GB4 A;  2GRI A;  2WDQ B;  1DYQ A;  2WXK A;  2YEP B;  2J4X A;  4N59 A;  3AEE B;  3AEG B;  1PGA A;  2LUM A;  2PW9 A;  3E56 A;  2M56 B;  2Y5P A;  4L23 A;  2LGI A;  2E3T A;  2LJI A;  3P4R B;  1ZE3 D;  1VZ7 A;  2PVG C;  3RFZ B;  1VLB A;  1PYW D;  2BS2 B;  2IGG A;  4JWU C;  1C4C A;  4RF0 A;  2G9H D;  2W3S A;  4OW0 A;  3GP7 A;  2DBY A;  2MJE A;  4XE0 A;  3L4P A;  1TKG A;  4RCO A;  1XCT L;  2FBW B;  1BUI C;  2DLB A;  5BYR A;  1SEB D;  1NI3 A;  1ESF A;  2HDE A;  1K52 A;  1WRI A;  3HVD A;  5BMH A;  1HA5 A;  3RPF C;  4UDU C;  1QOB A;  5HG2 A;  3SR6 A;  4C7Y A;  2BYT A;  4A90 A;  1I4P A;  4ZYS A;  1QOG A;  2K0P A;  4WAF A;  2JSV X;  3I57 A;  4TQ1 A;  3BYT B;  4NAM A;  1XF5 L;  3Q8B A;  3Q69 A;  1NEK B;  2IJ0 A;  2I38 A;  4N6E B;  1JWA D;  3ETR A;  3W2D A;  5BMG A;  3R8B A;  5EE1 A;  2PVO D;  1K51 A;  1QLB B;  3AEA B;  3V05 A;  3NUH B;  2BS3 B;  1R7S A;  1TS2 A;  2L1A A;  2WNM A;  2ZW0 A;  4L1B A;  2JWU A;  2TSS A;  5GXG B;  2LHD A;  1FMA D;  3IXS A;  2W55 A;  2DYO A;  4A6Q A;  3IT4 B;  2WU2 B;  2WXO A;  2W82 A;  1NYR A;  3AE5 B;  1QF6 A;  4CQN A;  1ZOY B;  2KN4 A;  2Y3A A;  1FFU A;  1L0X B;  1KLG D;  1F77 A;  1SJH D;  3Q8E A;  3ZYY X;  4ARC A;  2AQ3 B;  3IAS 1;  1L0Y B;  3Q8F A;  1C79 A;  3W5V B;  3MHZ A;  1FM0 D;  4US9 A;  3EA6 A;  3P1M A;  1ACC A;  1ENF A;  2WXH A;  1SE2 A;  3BK1 A;  4ZRP A;  2JZP A;  2DYM A;  2RPV A;  3B9J A;  1I7H A;  4MM3 B;  1EU4 A;  1V97 A;  2LFI A;  3BVG A;  3VQI A;  2WXN A;  3KWV A;  4HKQ A;  1ZXH A;  1JWU D;  3BWU D;  4RNA A;  1B9R A;  3FIL A;  1I4G A;  3ABV B;  1L5P A;  3NZ3 A;  1CK1 A;  1P7E A;  1FRR A;  1UNS A;  1OQR A;  5I4D A;  4PT5 A;  1E10 A;  3EUB 2;  3TEY A;  1N62 A;  2I2Y A;  3U4E G;  3V3X A;  1JW9 D;  3LB8 C;  1T3Q A;  1C77 A;  5G5G A;  1I4X A;  4M0W A;  1MVK A;  3LXF A;  2D5G A;  4LK0 M;  2QSD A;  2IDY A;  1HXY D;  4WH4 A;  2QIL A;  1E9M A;  5AUK A;  1PFD A;  2J53 A;  4RF1 A;  1WYG A;  1EWY C;  1J7A A;  3IT6 B;  1J7C A;  3FIL B;  2E6X A;  3NVZ A;  1IBX B;  1VJK A;  3W9C B;  1KFY B;  3WCQ A;  4OZA A;  4WIP A;  2IGH A;  1M4V A;  2V4I B;  1L6U A;  4AS1 A;  2AQ2 B;  1F2R I;  2JX5 A;  1KTK A;  1PGX A;  3AE4 B;  1E7P B;  2SEB D;  1L4Z B;  3C8Y A;  3NVV A;  2PMV A;  3MFG A;  1BML C;  2BT6 A;  1EU3 A;  2ON8 A;  3EGR A;  4L2Y A;  2RDH A;  4XWW A;  5JXV A;  1QIL A;  1IGC A;  3PZ8 A;  2OED A;  3U7Z A;  1E6E B;  1XEE A;  5EE0 A;  1FCC C;  4AQ7 A;  2N0S B;  3H8H A;  2JQR B;  3R2T A;  3PZ7 A;  1ROE A;  1UWM A;  1VZ8 A;  2V3P A;  2BTE A;  1GAQ B;  3ZJT A;  3AED B;  1B1Z A;  4OHJ A;  2BB5 A;  2WLB A;  2N9L A;  4OVZ A;  1QOF A;  1UGJ A;  1SSN A;  2KWD A;  4WWM A;  1QQR A;  4IDI A;  2AQ1 B;  3BVM A;  3U2S C;  4LTU A;  3TUO A;  3TEX A;  2WP9 B;  2M19 A;  2QEJ C;  4P16 A;  4YTM B;  2JYE A;  2W54 A;  5BMI A;  5C3J B;  3P42 A;  3HUI A;  3IAM 1;  2CJO A;  1K50 A;  2IPK D;  1ET9 A;  1QOA A;  2JXT A;  2KQ4 X;  1C9F A;  1XLO A;  4B0M A;  1YNT E;  3ZJV A;  2J42 A;  4JE3 B;  3AM9 A;  2V3N A;  3AE3 B;  1FD6 A;  2G1E A;  1XLP A;  3P63 A;  2OHF A;  1WWT A;  1ZDX A;  3MP9 A;  4HRO A;  4NJC A;  4JPS A;  5FK9 C;  5C2T B;  4H2A A;  2NTS A;  2PKO A;  5BYS A;  1AN8 A;  3NRZ A;  1CJE A;  2MJ3 A;  1MHX A;  4REZ A;  4MAC A;  1TZO A;  5AUI A;  1TJE A;  1T5X D;  4WQM A;  3T3O A;  1L4D B;  3VR8 B;  2WS3 B;  2WXP A;  1JML A;  1RWS A;  1GB1 A;  1F0Z A;  2INN E;  1FNU A;  1MPE A;  3OWE B;  3TEZ A;  1SXT A;  3PO0 A;  2K22 A;  1SF0 A;  3AN1 A;  1JWB D;  1Y56 A;  1QKZ A;  3AEF B;  4A55 A;  1F2R C;  1WGK A;  1D5Z C;  2L83 A;  4RGT A;  2GI9 A;  2HTM E;  1NVI D;  1YMH E;  3HVZ A;  1VDV A;  1AWD A;  5LNK 1;  2ZW1 A;  3AEC B;  1XCQ L;  1JCK B;  2CU3 A;  4YTP B;  1GOZ A;  1SIJ A;  1DGJ A;  4R3D A;  1ZXI A;  4RGM A;  3W5U B;  2CJN A;  4JX1 C;  5T8I A;  3KWL A;  2QIE B;  1HZ5 A;  1PUT A;  3GB1 A;  5HHD G;  1D5M C;  4KGR A;  4A8X C;  2WXL A;  4KGT A;  4KKI A;  2YEP F;  2MH7 A;  4ARI A;  1V1P A;  1XLQ A;  2MJD A;  1FNW A;  4ZHP A;  2RMM A;  4USA A;  2W3R A;  1JQ4 A;  1EWC A;  3VRB B;  5D3D A;  2WXI A;  1RM6 C;  4DXF A;  2XN9 C;  3ZQ4 A;  1ET6 A;  1N60 A;  1TS4 A;  1SE4 A;  1HQR D;  3AE1 B;  5BYQ A;  4TQ0 A;  2B76 B;  4NZL B;  3ZJU A;  2NTT A;  5HFY A;  2K5P A;  1I4H A;  2GB1 A;  1N63 A;  4WUR A;  2WXJ A;  3SFD B;  2PIA A;  1KLU D;  4TMA B;  4YSZ B;  1TYG B;  4DXG A;  1YQ3 B;  1FFV A;  1QT9 A;  4XDC A;  1VZ6 A;  3AE6 B;  3VR9 B;  5H92 C;  3NVW A;  4RGO S;  2QMT A;  4RH6 A;  4MH8 A;  2N7J A;  5D7G A;  4A9A A;  3NS1 A;  4B0E A;  2FUG 1;  1RFK A;  1V1O A;  1WXQ A;  4HRS A;  4XDD A;  1C4P A;  1KRH A;  2R61 A;  3AB5 A;  5G5H A;  1SBB B;  1UWX A;  5E6J A;  3MC0 B;  1KF6 B;  3Q8C A;  1NYQ A;  3AV8 A;  1ZPS A;  4JWS C;  2WXM A;  1YJI A;  1HZ6 A;  1EM7 A;  1Q10 A;  1T6B X;  3U52 E;  1JWM D;  2VZK B;  3FAH A;  2AX5 A;  3UI3 A;  4KKJ A;  3T3N A;  1CZP A;  3W1S A;  4LLG M;  1UUP A;  1BXT A;  1ZP0 B;  2J52 A;  2LHE A;  2Z8L A;  3AEB B;  2RDG A;  3I9V 1;  5MPO A;  5FKA C;  4IOI E;  1N5X A;  2WXF A;  1I4R A;  2VZK D;  4HKZ E;  2ICI A;  2ONQ A;  2Y5C A;  4Q2J A;  3P4P B;  2M0A A;  1L0V B;  1VR9 A;  1L6V A;  1VRA B;  4ZOH C;  4ITK A;  2K9X A;  3URY A;  2WQY B;  1NEN B;  1FO4 A;  4US8 A;  1JRP A;  3BK2 A;  3GS2 A;  2Q5W D;  2WDR B;  1YQ4 B;  3B2F A;  1OFF A;  3NVY A;  4KX6 B;  1SJE D;  4IKG A;  1KH0 A;  1SE3 A;  3DWG C;  4GLS C;  1CQV A;  3CWI A;  2BBC A;  1N61 A;  3AE8 B;  4O1N A;  5EE3 A;  1RYJ A;  4ZRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...