1PFDA

The solution structure of high plant parsley [2fe-2s] ferredoxin, nmr, 18 structures
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
96
structure length
96
Chain Sequence
b'ATYNVKLITPDGEVEFKCDDDVYVLDQAEEEGIDIPYSCRAGSCSSCAGKVVSGSIDQSDQSFLDDEQMDAGYVLTCHAYPTSDVVIETHKEEEIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN
publication title The solution structure of parsley [2Fe-2S]ferredoxin.
pubmed doi rcsb
molecule tags Electron transport
total genus 21
structure length 96
sequence length 96
ec nomenclature ec 1.7.7.2: Ferredoxin--nitrate reductase.
pdb deposition date 1998-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1pfdA00
4KX6B 1FM0D 2G1EA 2H89B 1DOXA 2BS3B 3AEBB 1DOYA 3PO0A 1ZXIA 3AECB 2LEKA 1JQ4A 3AEEB 3CWIA 5G5GA 2WQYB 1A70A 2WU2B 1QOBA 2H88B 1CJEA 1XLOA 2CJOA 3AN1A 3W5VB 2WDQB 2HTME 3W9CB 1OQQA 2KMMA 3NVVA 3EUB2 3AE4B 1JALA 3AE9B 1L6VA 1F0ZA 2MH7A 2DWQA 3SR6A 5H8YE 1RFKA 2N0SB 3HUIA 4FXCA 4WWMA 4YSZB 5C2TB 3ZYYX 1WXQA 4US9A 2L83A 1NI3A 3AE7B 1QLBB 1SB3C 4N59A 1B9RA 1E6EB 3LXFA 1QOFA 3AE8B 1E10A 1E0ZA 1IUEA 4ZOHC 4YSXB 3AE3B 2CU3A 3WCQA 1N60A 1YJIA 4C7YA 2Y5CA 1RM6C 5C3JB 3AH7A 1NVID 3L4PA 1OQRA 1VJKA 3P4PB 1OFFA 3B2FA 1CZPA 3AB5A 3B2GA 5EE1A 3VRAB 2EKIA 4YTMB 2QIEB 4YTPB 1FXIA 3NVYA 1SF0A 2JX5A 3NRZA 1UWMA 1ZOYB 2OHFA 2QJLA 1JWBD 5GXGB 2E3TA 1DGJA 1L0VB 3AE5B 4WQMA 1TKEA 5EE3A 3RPFC 1JROA 4N6EB 1JWAD 3DWMA 1N5WA 4IDIA 1J7AA 2MJEA 2CJNA 3VRBB 3W5UB 4YT0B 4JWSC 1QOGA 3SFEB 3AEDB 3FAHA 1QF6A 3NVWA 3HVZA 2PVOD 1FFVA 2PIAA 3ABVB 2BS4B 1TKGA 1FMAD 5EE9A 1N63A 3B9JA 4HRSA 4N58A 2FBWB 2K22A 4A9AA 5AUIA 3VR9B 1XLQA 5AUKA 3P4RB 3P4QB 1J7CA 3P63A 4JWUC 1QOAA 1V8CA 1TJEA 4HROA 5EE0A 1AWDA 1NYQA 1FFUA 2K9XA 2BT6A 3AE2B 1PDXA 1ZP0B 1WRIA 3AEAB 1J7BA 1VDVA 1E9MA 3NS1A 4P6VF 1WWTA 2K5PA 2WU5B 3P4SB 1RYJA 4JX1C 3KWLA 4YSYB 1XLPA 2M19A 5G5HA 1YQ4B 2WDVB 2PKOA 2L52A 1FRDA 1AYFA 1JW9D 2M56B 1FXAA 2MJDA 1N62A 2W55A 4C7ZA 1FIQA 1ROEA 3AEFB 1KFYB 2ACZB 3ETRA 3VR8B 3AE1B 4USAA 1JRPA 2W54A 1L5PA 4US8A 3AV8A 1YJJA 1EWYC 1NYRA 1XLNA 1KRHA 1SIJA 1KF6B 2MJ3A 5H92C 1I7HA 1T3QA 3NVZA 3P1MA 1TYGB 2KAJA 2W3SA 2DBYA 3CIRB 1RWSA 4ZHPA 4ZHOA 3FC4A 2BS2B 1NENB 1TKYA 1GPXA 3AM9A 4YTNB 1R7SA 1VLBA 1FRRA 3AEGB 1FO4A 4ITKA 1YQ3B 1N5XA 1V97A 1GAQB 1WGKA 1PFDA 2W3RA 2AX5A 2B76B 3HRDD 4LTUA 1NEKB 2WP9B 4YXDB 1PUTA 1ZUD2 2Q5WD 1XO3A 3SFDB 2JQRB 4C80A 1QT9A 1N61A 1WYGA 3DWGC 1L6UA 3AMZA 1DOIA 2WDRB 3AE6B 2WS3B 3LB8C 2WLBA 5MPOA 3BIID 2PVGC 1E7PB
chains in the Genus database with same CATH superfamily
4XX5A 3AEBB 5G5GA 1XLOA 2CJOA 2A4ZA 1ZXHA 4A6QA 3SR6A 2L7RA 4BKGA 2N9PC 2KTRB 1UZXB 4K81A 2D3AA 2I1KA 3T3OA 1PYWD 1WH3A 3KUCB 1CQVA 1UBQA 4YWGG 2G3QB 1P9DU 3Q3FA 3AH7A 4YTPB 1TS3A 2ZJDA 1ZOYB 4DQOC 2KQ4X 1WMHB 1YJ1A 2JYTA 2XK5B 3V3XA 3NVWA 2V4LA 4OZCA 3Q8FA 3KYDD 5LXIB 1MG8A 2QILA 4BKTA 3QA8A 4A9AA 3P4RB 4WJQA 4BFRA 1PDXA 2KKCA 3IAM1 3X23A 3P4SB 1HTOA 2LJ5A 1H4RA 4LCDE 2LHEA 4EUTA 2K8BA 4HEA1 5HG2A 1Y8RC 3OJ4B 3ETRA 3OAWA 2QCZA 1MPEA 3TCAA 1NYRA 4OZAA 4AJWA 2ZCBA 4GMVA 2QMTA 4MJSA 1LXDA 4GDKB 1R7SA 4J6IA 1FRRA 1YQ3B 1I35A 3Q14C 2SEBD 3DVNU 2Z59B 1DOIA 2WDRB 1WR6E 2I1JA 5D94A 2QEJC 3J9CA 1BUIC 3U30A 4KIKA 1IGCA 2ONQA 4LK0M 2MX2A 1TY0A 1MJDA 3ZDMC 4DHZB 3H7PA 3AI5A 3HIZA 3PLVA 4DWFA 1RAXA 2CHXA 5CTRC 4JGHB 2MHJA 2KMMA 1TBEA 3AE4B 3MFGA 2WXRA 4RMAA 2KVZA 4YSZB 2KFJA 1QLBB 4PS3A 3AE3B 4JLCA 2RDHA 2QHOA 1TZ1A 4N9F4 4W9FA 3NY5A 3AULA 3I9V1 5CX3A 1UWMA 3VVWB 1L0VB 4WQMA 2XNAC 3M3JA 3ONSA 1KLGD 4DBGA 1B1ZA 3R66C 3BVZA 1V1OA 3T9LA 2LUMA 3W2DA 2VZKD 3OWEB 4DHJB 1FMAD 4ICUA 3TL5A 3O65B 4N58A 2VH2A 4XWTA 2M0AA 2MLBA 1WJUA 4KSLC 1J7BA 3KUDB 3NS1A 1WWTA 2C5LC 2L0TA 4AP4C 1AYFA 1JW9D 4II3B 1V1PA 3PRMB 2W55A 1UD7A 2JYEA 1FIQA 4AQ7A 1U4AA 1L5PA 3R2IA 3VFKA 2GOWA 3L13A 1T3QA 1P1AA 4ICVA 2D07B 3IBEA 3RCZA 2M1MA 3AM9A 3TSSA 3N9YC 1GAQB 1WGKA 3K9OB 5KHQA 4LTUA 4YXDB 3H8HA 2INCC 1RFAA 4O1NA 3KWVA 3UF8A 3VTVA 2FUHB 5E6OA 4KX6B 1DOXA 5FR6A 4MELA 3PO0A 3ZRCA 3N20C 2DYMA 2HJ8A 2N7DA 4GGQA 3EC8A 3GE8C 2FCNA 3HUIA 2FAZA 2KJRA 4RM8A 3C0RB 5G2NA 1B9RA 4HKQA 1C4CA 1E6EB 2DZKA 2N9XA 1QOFA 3WIMA 1K50A 2CU3A 3WCQA 1YN3A 3B08A 3PZDA 1OQRA 1VJKA 3CF6E 3AB5A 5IP4D 2MBHA 2RGFA 3T8MA 2MBBB 2BB5A 3NVYA 2JX5A 2O6VB 2QJLA 3A4SC 2DZIA 3CSFA 1E8WA 2N1VA 3O13A 4A3OA 2C9WB 1WGDA 1BT0A 4A8XC 2PIAA 4AUQC 1ZDVA 3SDLC 2WX0A 2BPSA 4KZ0A 3B9JA 2FBWB 3VR9B 4URKA 5AUKA 3P4QB 1V8CA 3Q8BA 1WM3A 3GZNB 1F2RI 3ZNGC 1E9MA 3N30A 2RDBC 4B0MA 3M63B 2O2VB 3TJPA 2EMSA 3AXCA 3DBLB 3AV8A 5IOIA 1XLNA 3N32A 3MC9A 3JW0X 3NJTA 2AQ1B 3OJ3A 3P2BA 4BAXA 5C1ZA 1FNVA 4XWWA 2I2YA 2LWPA 3SU8X 2V3PA 4C56C 1E8ZA 1WF9A 2YLMA 3APFA 3ZO5B 2WS3B 2KYWA 2IY1B 2J4XA 4E74A 1OQYA 4BOSC 2BS3B 1WM2A 4WAAA 2L32A 5D3IB 1D6EC 2H88B 5L83A 1Z2MA 4NNJB 3PSEB 2KC2A 4M0WB 1AARA 3M62B 3H7SA 3QQ8B 4REZA 2NBUA 2DHZA 2N1WA 3A9KB 1OFFA 4W9HA 2QIEB 3QIJA 3NZUA 1TS4A 2CJNA 2MWSB 2ZPYA 3IVFA 1T0QC 2K8CA 4DDID 3NG0A 3TEWA 3SFEB 1HXYD 5HI1A 1I4HA 3DPDA 4RGMA 5EE9A 2KHWB 2KWDA 5C23A 2V4IB 2R2QA 4W9GA 1RRBA 2C60A 1T6BX 1R4NB 4K3CA 1XLQA 2WXKA 2JWZA 3W1SA 2KQSA 3AE2B 3CMMB 4I6PA 3BINA 2WU5B 4US8A 3A1QA 2JRIB 2N9LA 1F77A 4WIPA 2NTSA 3VR8B 3MP9A 2K8HA 1WE6A 2R61A 4FULA 1ZDXA 4ZYNA 1KF6B 3PZ7A 2CHZA 1KLUD 1YIWA 4ANUA 2BWES 4ZHPA 3AEGB 4MH0E 1BXTA 2M8SA 2BKRB 4K7WA 3NUHB 5BYQA 1L2NA 1R4MI 5DPRA 2M17A 1ZUD2 2DX5B 3V6CB 1XEEA 4XDDA 3UQAA 3V61A 1ET6A 4ZRIA 2D2QA 4B9KA 1ZXIA 4NAMA 4OZBA 3NZSA 2XBBC 3Q69A 2PE6B 5HHDG 3NVVA 2KX3A 1SE2A 2JWUA 2J52A 4MJSB 1QKZA 2KFKA 2G45B 1GB1A 3DBHB 4RF1A 3IAS1 4PK1A 3ZDTA 4YSXB 1YD8U 3QK0A 4M02A 3NS8A 4HPLB 3QAQA 3WALA 3L16A 2LXAA 1QILA 1TS2A 1WJ6A 1JROA 4P7IA 1GOZA 2WXLA 3VUYA 3H7PB 1VR9A 1WXVA 1P98A 4YT0B 4NQKE 1QF6A 1UUPA 3ZNZB 3HVZA 2PVOD 3Q8AA 5LXHA 1IP9A 1WXSA 4ASWC 4Q2JA 2G9HD 2Y5BB 4TV3A 2K9XA 2C7NB 1E8XA 4RM9A 5G5HA 2JZPA 4K3BA 1FRDA 4JPSA 4WJPA 1IBXA 3TUOA 1GC6A 2ACZB 3KLSX 1EU4A 1EF5A 2ZVNA 3R7RA 2KWUB 2NBWB 3C19A 1S1QB 1Q5WB 1RLFA 3EA6A 4C00A 3RFZB 5EDSA 2W3RA 3BYYB 3FILA 1PUTA 4MACA 2RD0A 1WFYA 2KWVB 1WJNA 4HDQA 5D2MB 2H89B 3UQBA 1WYWB 1V1PB 2KN5A 2NVUI 2IO2B 2J53A 2V3NA 2WQYB 1QOBA 3RNAC 3N3KB 1HZ6A 4IOIE 4FHJA 4JQWC 4HXDA 2WHIA 1RFKA 3LDZE 4OHJA 4KGSA 3ZYYX 2DAJA 4US9A 3SHQA 4FJYA 2ZEQA 2LZ6A 4CYEA 1TS5A 1NVID 2KNBA 2KDMA 2VRRB 1CZPA 5EE1A 2VZKB 4TMAB 1KTKA 2J0JA 1JWSD 3NRZA 2IO3B 3VUXA 1NBFC 2L8JA 1IYFA 5HKHA 4W9CA 4PS7A 1FFVA 3A4RA 1GUAB 2ASQA 4NAWA 4XC2A 3SEBA 4NZLB 2LVQA 5BO4B 4TKNA 2ZW0A 1V6EA 1VD2A 4JWUC 1J7CA 1LFDA 2NR2A 2PE9A 4HROA 3VH3B 3ML8A 2BT6A 4TQ1A 4HJGE 4WJNA 1BMLC 4YSYB 3BVMA 1FXAA 4KV2A 1SE9A 3U8ZA 1PGBA 2HJ1A 3RNCC 2BTEA 3U2SC 2V0GA 4A90A 4B95A 4HK2A 3TMPB 4F7ZA 3EFCA 4I6LB 1I7HA 2KAJA 3DHHC 3ZKJC 2HDEA 3A9JB 4L1BA 2B76B 3HRDD 4IWOA 2WP9B 2D3CA 3DCGA 4C80A 2JQRB 2K3UA 3PHXB 3VHTC 2DAFA 1ZPSA 1KM7A 2GRIA 3Q3OC 3ENEA 3BIID 3PV1A 3A33B 1XF5L 1SSNA 2VH1A 3ZVVA 1JQ4A 1GB4A 1Q10A 3GZNI 4IKGA 1J0GA 1C78A 4MGYE 4HLEA 1F0ZA 2I38A 4JE3B 1Q0WB 1TT5B 5CHFA 3UIOB 5BYRA 1P7EA 4N59A 5D3DA 2MRPA 4ZOHC 1F2RC 1WIAA 4LNIA 3NOBA 3TBLD 2BB6A 2AL3A 4HJKA 3V60A 2L05A 4ZYSA 1WGRA 3DOWA 5GXGB 3DBRB 1SGHA 3NZ3A 1TKEA 3URYA 5DPWA 2WXJA 2KDEB 3N1YC 4G11A 2KLCA 4IWPA 2INPE 4KVGB 2L00B 2NPTA 2RMMA 4RGNA 5BYSA 2L76A 1N63A 4OVUA 1HEZE 3V6EB 4DK5A 1L0YB 1TIFA 2KMCA 4D2KA 5CHWA 3WA0A 2WXQA 2CKHB 4PS8A 2OOBB 3M95A 3L10B 2KN4A 5TR5A 2IJ0A 2RPVA 2PTLA 4EEWA 4AS1A 3RZFA 2HD5B 1NENB 3IT4B 5JXVA 1SIFA 3LYYA 3D32A 1FO4A 3RT3B 1P7FA 1QT9A 2HE7A 4FJZA 4MH8A 1IGDA 1ACCA 2LVOA 5DPSA 1E7PB 2IPKD 4WWOA 1FM0D 1F52A 4I6NB 3A1QB 2NBVB 3ZQ4A 5GMVA 4WAFA 4E71A 1D3ZA 1JALA 5AZGA 4MM3B 1FNUA 2KC1A 5H8YE 2WYQA 3ECIA 2KLGA 3QWZB 4LJOB 2LGDA 3VTWA 1WX8A 2FIDA 4MGIE 4G0NB 1WZ0A 2N7JA 1C4AA 3TEXA 2LASA 1JWAD 2RPQA 2LJIA 3IT6B 3UGBB 2BYVE 2K25A 4MGKE 4IM0A 4LNOA 1L7YA 3ZTCA 2E6XA 3ABVB 4RGTA 4IW0A 5I4DA 4FJVB 4FHKA 2M0XA 1MFWA 5AUIA 2KFKB 1ISNA 2JY6A 2IY0B 4AJYB 1P3QU 2IYDB 3DHIC 3BY4B 2NMQA 3U4EG 4J3OD 2BF8B 2LD9A 1K53A 3U52E 2PJHA 4LDTD 1ESFA 4RNAA 2KZRA 1EWYC 3SD5A 2JXTA 3ZJUA 1C79A 3KW5B 1I4QA 2G4DB 1V9JA 2XK5A 4XGAB 4ZHOA 3JSVB 4RFBA 3HHMA 1YN5A 2WXPA 2IGDA 4CHKA 2INNE 2PPHA 3QX1A 2DNFA 3ZJVA 2KO3A 2Y5PA 3T3NA 1WXAA 3DWGC 1YQBA 4M8MA 1TY2A 3L17A 1I4PA 2BWFA 2PVGC 2LVPA 2M4NA 2RDGA 2FCQA 3CWIA 2GBJA 1A70A 3W5VB 2W9NA 3KUZA 3TEZA 3ZIMA 1YN4A 3UI3A 1FNWA 1NI2A 4FXCA 1CMXB 4L23A 2AQ2B 2WNMA 3LXFA 5D7GA 4LNNA 3FILB 2YEPF 2KDIA 1C4PA 3AE5B 3EECA 2BKFA 4XYCA 3GE3C 5J18A 2LI5A 1XCQL 3NHEB 4K1RB 4JWSC 1QOGA 2C7MB 4MEMA 2X8XX 1TKGA 2KXJA 2KX0A 5DCNA 2ZZPB 2LRWA 1JCKB 1L0XB 4P1BC 5G55A 1Z5SB 3W1SC 1VDVA 4TQ0A 1C1YB 1YQ4B 1V49A 4B0EA 1WE7A 1ROEA 1KFYB 2JSVX 4ARIA 1LGRA 2UWQA 3S2AA 4WJOA 1T0SC 1PGAA 4MSMB 4F8CB 3PZ8A 3CIRB 1L4DB 3FC4A 3IFWB 4NAWB 4ACFA 4M00A 1VLBA 1V97A 3N1XC 1P0RA 2AX5A 1PGXA 1K8RB 4L2YA 2WGSA 1V80A 3SFDB 3UIPB 1N61A 4II2B 2JRHA 3APCA 1JWUD 2LUEA 1AW7A 4NJ6A 3U7DA 1HTQA 1DOYA 3Q3MC 3AECB 4ANXA 3AN1A 4IUMB 2HTME 3ALBA 4NY0A 2XEWA 1KOTA 1VZ7A 4WWMA 4H2AA 5IAAC 2L83A 2WXOA 3AE7B 2L1AA 2NS5A 4NJ7A 3ZLZA 1VCBA 2PLPA 1LM8B 2Y5CA 3P4PB 4A3PA 3WANA 1EUVB 1I4RA 1WI0A 3BZDB 4HPPA 1UGMA 2WDTB 3VH4B 3B1LX 4HCNB 3PS6A 1ZKHA 1J7AA 5KHOA 3RNBC 3RULA 3R7QA 3W5UB 2GBMA 2PEAA 4FADA 4EZKA 2AWTA 1QOAA 1NYQA 4XDCA 5IA7A 4GXBA 4KIKB 4HVBA 3KWLA 2KQ7A 1MI0A 1UH6A 1K51A 4HCPB 3Q2AC 2MJDA 1N62A 4RH6A 1XD3B 2YEPB 2CHWA 2O6VA 2LGXA 1N6ZA 2REXA 1YJJA 1FD6A 4CO7A 1EM7A 2W3SA 4UDUC 2KD0A 1WRDB 4OVZA 1EWCA 5AZFA 2BBCA 2CR5A 3DBRI 2ICIA 2DYBA 2QSDA 1PQSA 3N1ZC 4C4VA 3E56A 5JH5C 2Q5WD 1XO3A 1WYGA 4GDLA 1TZOA 2NTTA 3AE6B 1D5MC 2KK8A 4RF0A 4WH4A 1SBBB 4WWNA 5JHBA 3EHVA 2MBQA 2K0PA 4ARCA 1FCLA 1OQQA 1KLVA 1EF1A 1ZGUB 2BW2A 3VAWA 4DDGD 4MGZE 2MCNB 1UGJA 3AE8B 3LJ3A 3PT2B 3PVLA 2IDYA 2XN9C 1LQBA 2IBIB 1JWBD 4KDIC 2JT4B 4N6EB 3TIXA 1WR1A 4HDOA 4DXGA 4FA6A 2D3BA 3RI7C 3ZUNA 3OLMD 1C77A 4IC7B 3PRZA 4XZ4A 2AEHA 1ZE3D 2WXGA 1YX5B 3FKYA 2K22A 4GB9A 2YVCA 5E6PA 1UWXA 1WRIA 2BYTA 4GOCA 1UF0A 3ZJTA 2L52A 3VUWA 4C7ZA 2KJ6A 3AEFB 4MSQB 2MP2A 2LGYA 3AE1B 1JRPA 1I4XA 5J2RA 4MT5A 3P1MA 2CU1A 3NVZA 1SXTA 4ZRQA 4S17A 1N5XA 3PTFC 4EFOA 2D5GA 2OEDA 1T0RC 1JMLA 4NJCA 4LLGM 1I4GA 1GNUA 2N7EA 2GBNA 1ET9A 2KDBA 2FUG1 4W9EA 2G1EA 3V62A 4EOYA 3PLUA 1WGYA 5IN7A 3W9CB 1R4MB 3AE9B 1V2YA 2AYOB 3EGRA 1HA5A 2WXNA 3HM6X 3Q6BA 3ZXRA 2GLSA 3E9SA 1UBIA 1N60A 4P1CC 2V3SA 1J19A 4YTMB 2K6QA 5DPTA 2EELA 1M4VA 1TGZB 1SF0A 2DZJA 2FCMA 4GLSC 4G3XB 1X1MA 3PPAA 3KYCD 4FN2A 3BYTB 2TSSA 1F9JA 3FAHA 2K6DB 3ZNHB 3ML9A 3OG5A 1VZ8A 3Q8EA 2JXXA 1YNTE 3DBLI 4HRSA 4LDTB 4BOZB 1OEYA 1TJEA 1AWDA 1FFUA 2LXCA 3MTNB 1FEHA 1WJ4A 4JX1C 4M8NA 1C9FA 3DBSA 3RN9C 4KGTA 2M56B 1MHXA 3AU5A 4HWIB 4W9KA 4QAYA 2IGGA 1RWSA 3ZTDA 2DLBA 3U7ZA 3BWUD 4WWPA 4NQLB 2KTFA 3GS2A 1NEKB 4EE2A 1A5RA 1NDDA 3MC0B 1I42A 2Z8LA 3RNFC 3KH0A 1D4BA 2WWZA 3Q3NC 1T0YA 3RYTA 2WU2B 1F1HA 2L3ZA 3DVGX 2MBEA 1MVKA 3IXSA 2V1YA 2D3GA 2ZNVC 1C3TA 1VZ6A 1IPGA 4A20A 4GIVA 2ON8A 4C7YA 5C3JB 2KMAA 2LRUA 1FXIA 1R4NI 1V5TA 3IG3A 4GN1A 3AU4A 2GBRA 2E3TA 1YOVB 1DGJA 3DWMA 2KVRA 3Q3JA 2KDFB 3B0AA 4K7UA 1E5WA 4ZRKA 4EKUA 3UINB 4TSSA 1JWMD 4FBJB 2ZW1A 2KACA 1YX6B 4MDKE 2JF5A 3BVGA 1EU3A 4WQOB 4IM3A 3PREA 4R3DA 3K9PB 3P63A 3R8BA 2DYOA 2BYEA 2IO0B 2GB1A 2RR9A 3HK0A 1GC7A 1RYJA 3VTUA 2LGIA 2JPHA 3QARA 4IM2A 4X57B 1ENFA 4P16A 3W1YA 2K39A 2MBOA 3H9DA 4USAA 1FXTB 1V86A 3H1UA 3MJWA 2MJ3A 3Q8CA 2KTRA 1FCCC 1SE3A 2R2OA 3DQVA 2LFIA 2UYZB 1L6UA 2WLBA 3DBHI 5MPOA 4S0RA 3I5JC 4CQNA 3PHWB 2AQ3B 1WMHA 3ZXVA 4XE0A 1WX7A 4IWQA 1G6JA 2LEKA 3HVDA 2MW5A 3R2TA 1LO5D 2WDQB 4NPNA 2J0KA 1CK1A 2FCSA 3EUB2 1L6VA 1WGGA 2LGSA 2N0SB 3QJZA 2KWCA 4LNKA 2BQQA 2B3AA 3DVNV 1UNSA 2CS4A 1E10A 2JZ3B 5LLIA 2LHDA 4C4VB 3DDCB 3A9JA 4GDLB 1IBXB 1Y56A 4KKJA 2JVCA 1XT9B 5EE3A 1H8CA 1KH0A 4IDIA 1M94A 4KKIA 3APDA 2WXMA 3RD2A 3AEDB 5CHVC 1S3SG 4GDKA 2C7HA 4FLHA 3JYUA 4B6WA 4LNFA 1C76A 2JUOA 4OW0A 5FR3A 2K5PA 1J8CA 2OJWA 4DHJD 2IGHA 2W82A 1OEYJ 2KJHB 4E3CA 2FNJB 2PW9A 2KT7A 3MHSD 1K52A 1TYGB 2DBYA 2Z0EB 1GPXA 4YTNB 4BBNC 2BYFA 1WGHA 1E8YA 4ZDVA 2PMVA 3QCAA 4AWJA 2J0MA 2INDC 4RCOA 5D6JB 3I57A 2WXHA 3RUIB 3AMZA 2MA9B 3MHZA 2LMCA 3PRPB 1OGWA 3GP7A 1E7UA 3AEEB 4ANVA 2MP2B 3BK2A 1CJEA 2KANA 1GJZA 3H6NA 3R3MA 1UELA 2BVCA 2J42A 2A5UA 4RGOS 2KOXA 2DWQA 3IHPC 1V5OA 2V9HA 1WX9A 1Q1OA 1D5XC 1NI3A 3KVFB 1SB3C 5T8IA 3WAPA 4WURA 1E0ZA 1IUEA 3V05A 4K7SA 2MEKA 1YJIA 1RM6C 1TTNA 1HZ5A 2IO1B 3B2GA 1T5XD 3RNGC 2OHFA 5E6NA 2N9EB 3RPFC 1QQRA 3ZGZA 2MJEA 3C8YA 4PYZA 1AN8A 4M01A 2N4FA 2DZMA 2J7QB 3RZWC 2O6VD 4KSKC 4MM3A 2L0FA 1STEA 1DYQA 1L4ZB 5FK9C 5BMGA 4G50A 1SJED 5EE0A 3I3TB 1MG4A 1XLPA 2M19A 2GBKA 2PKOA 3WAOA 1MHHE 1WXMA 2X38A 2GI9A 4KDLB 3JVZX 4KZCA 2NCNA 4JL9A 2QDFA 1SIJA 4PT5A 2Z0DB 1GG3A 3ZRFA 4DHZE 4ANWA 5JZEB 2BS2B 1JRUA 1TKYA 2HTHA 2RSUA 2SAKA 5AEKB 1XQQA 5HFYA 2WXFA 4TUUA 3P42A 1XXGA 4ZRPA 1D5ZC 1OTRB 3L08A 2ZVOA 3KQ4A 3CSTA 1HE8A 2WX1A 1WSPA 3MC8A 1YMHE 4AOFA 2ZPNA 3LB8C 2K1FA 3VXWA 4BKSD 3RMKC 3DHGC 3HM3A 4GSWA 3MJ5A 4PYUA 4YL8A 5BMIA 2FIFA 2NPTB 1E90A 2MH7A 4BVUC 4HPMB 5C2TB 1WXQA 4W9JA 4BZAA 5LNK1 5IO9A 3JSVA 3TEYA 2FE8A 4GU2A 3GOEA 2MSED 5IKCM 4KGRA 4W9LA 2N9KA 4IG7B 3L4PA 4EZLA 5L95C 3B2FA 3VRAB 3RNEC 2EKIA 4F1SA 3L0WB 3VDZA 2WXIA 2JZZA 4OVVA 2O2VA 5BMHA 1WZ3A 3L54A 3QC8B 1N5WA 1VRAB 5J17A 5TSSA 3VRBB 2DENB 2EMTA 2JU6X 5FKAC 1E7VA 1SE4A 1SEBD 2QC8A 2BS4B 4BKSA 5JHAA 2IZVB 4HKZE 2D10A 1ZW7A 1V81A 2GMIC 1ZP0B 3AEAB 4P6VF 2D11A 3GB1A 1XCTL 2WDVB 3WAMA 2MQJA 4W9DA 2W54A 4ZRJA 1WY8A 2ZNVB 5E6JA 4DXAB 1KRHA 4M0WA 5H92C 4JIOU 4W9IA 1HQRD 1SJHD 1KJTA 2ZCCA 1EO6A 2UU7A 4DXFA 2AL6A 4ITKA 3A9KA 3BK1A 1FPYA 1PFDA 3PGEA 4LJPB 5AZHA 4A55A 3X0WA 3QHTA 2OJRA 2BGFA 2G4SA 1QZEA 2Y3AA 3ZW3A 3EFUA 3I63C 3ZNID 3DVGY 3VQIA 4EZJA 4BBNF 2EKEC
chains in the Genus database with same CATH topology
1ET6A 1D4BA 3AEBB 2RDGA 1ZXIA 3CWIA 4NAMA 5G5GA 2WU2B 1A70A 4OZBA 1XLOA 3W5VB 2CJOA 3Q69A 3TEZA 5HHDG 3NVVA 1YN4A 3UI3A 1MVKA 1ZXHA 3IXSA 4A6QA 3SR6A 1FNWA 1SE2A 2JWUA 2J52A 4FXCA 1QKZA 1VZ6A 4L23A 1GB1A 2AQ2B 2WNMA 3T3OA 1PYWD 4RF1A 3IAS1 3LXFA 2ON8A 1CQVA 4YWGG 4YSXB 5D7GA 3FILB 2YEPF 4C7YA 5C3JB 3AH7A 4YTPB 1FXIA 1TS3A 1ZOYB 1QILA 4DQOC 2E3TA 1DGJA 1TS2A 1C4PA 2KQ4X 3AE5B 1JROA 2JYTA 3DWMA 1GOZA 1XCQL 2WXLA 1VR9A 4YT0B 4JWSC 1QOGA 1QF6A 1UUPA 3NVWA 3V3XA 3HVZA 2PVOD 4TSSA 3Q8AA 1JWMD 1TKGA 4OZCA 2ZW1A 3Q8FA 2KACA 2QILA 3BVGA 1EU3A 4A9AA 4R3DA 1JCKB 3P4RB 3P63A 4Q2JA 2G9HD 3R8BA 2DYOA 1L0XB 2K9XA 2GB1A 1PDXA 1VDVA 4TQ0A 3IAM1 3P4SB 1RYJA 5G5HA 1YQ4B 2LGIA 2JZPA 2LHEA 1FRDA 4B0EA 4JPSA 4HEA1 5HG2A 1IBXA 1ENFA 1ROEA 3TUOA 1KFYB 2ACZB 3ETRA 2JSVX 3KLSX 4P16A 4USAA 1MPEA 1EU4A 4ARIA 1NYRA 4OZAA 1PGAA 2MJ3A 3PZ8A 2QMTA 3Q8CA 3CIRB 1L4DB 3EA6A 3FC4A 4GDKB 4NAWB 1R7SA 1FCCC 1VLBA 1FRRA 1SE3A 1YQ3B 1V97A 3RFZB 2W3RA 2AX5A 1PGXA 3BYYB 3FILA 2SEBD 4L2YA 1PUTA 2LFIA 3SFDB 4MACA 1N61A 1L6UA 1DOIA 2WDRB 1JWUD 1AW7A 2QEJC 2WLBA 3J9CA 1BUIC 5MPOA 4CQNA 2AQ3B 1IGCA 2ONQA 4XE0A 2H89B 4LK0M 1V1PB 1TY0A 1DOYA 3AECB 2LEKA 2V3NA 2J53A 3HVDA 2WQYB 3R2TA 1QOBA 1LO5D 3AN1A 2WDQB 2HTME 1CK1A 2KMMA 1HZ6A 3EUB2 4IOIE 3AE4B 1L6VA 3MFGA 1RFKA 2N0SB 2WXRA 1VZ7A 4OHJA 4WWMA 4H2AA 4KGSA 3ZYYX 4YSZB 4US9A 2L83A 2WXOA 3AE7B 1QLBB 2L1AA 1UNSA 2PLPA 1E10A 1TS5A 3AE3B 2LHDA 2Y5CA 2RDHA 3P4PB 1NVID 2KDMA 1CZPA 5EE1A 2VZKB 4TMAB 1KTKA 4GDLB 1IBXB 1I4RA 3I9V1 1Y56A 1JWSD 4KKJA 3NRZA 1UWMA 3BZDB 1L0VB 4WQMA 5EE3A 2XNAC 1KH0A 4IDIA 1KLGD 1J7AA 4KKIA 1B1ZA 2WXMA 3W5UB 3BVZA 1V1OA 3AEDB 2LUMA 3W2DA 1FFVA 2VZKD 3SEBA 3OWEB 1FMAD 4NZLB 4N58A 4XWTA 2ZW0A 4JWUC 1J7CA 1C76A 2M0AA 1QOAA 4HROA 1NYQA 2BT6A 4OW0A 4XDCA 4TQ1A 4HJGE 1J7BA 5FR3A 1BMLC 3NS1A 1WWTA 2K5PA 3KWLA 4YSYB 3BVMA 1MI0A 2IGHA 1K51A 2W82A 1AYFA 1JW9D 1FXAA 1V1PA 1N62A 2MJDA 2W55A 2JYEA 1PGBA 2BTEA 1FIQA 4RH6A 2YEPB 2PW9A 3U2SC 4AQ7A 2V0GA 4A90A 1L5PA 3R2IA 1YJJA 1FD6A 1K52A 1I7HA 1T3QA 1EM7A 1TYGB 2KAJA 2W3SA 4UDUC 2DBYA 4OVZA 2HDEA 1EWCA 1GPXA 3AM9A 4YTNB 2BBCA 2ICIA 3TSSA 3N9YC 1GAQB 1WGKA 2QSDA 2PMVA 4L1BA 2B76B 3HRDD 4LTUA 2WP9B 4YXDB 4RCOA 3E56A 2Q5WD 1XO3A 4C80A 2JQRB 2K3UA 2WXHA 3I57A 3H8HA 1WYGA 3AMZA 1ZPSA 1TZOA 4O1NA 2NTTA 3AE6B 3KWVA 3MHZA 2GRIA 1D5MC 3BIID 2LMCA 4RF0A 4WH4A 1SBBB 1XF5L 1SSNA 4KX6B 1DOXA 3GP7A 3PO0A 1JQ4A 3AEEB 1GB4A 2K0PA 1Q10A 1CJEA 2DYMA 3BK2A 4ARCA 1FCLA 1OQQA 2J42A 2BW2A 4IKGA 1C78A 4RGOS 1F0ZA 2DWQA 2I38A 4JE3B 3HUIA 5BYRA 1UGJA 1D5XC 1NI3A 1P7EA 1SB3C 4N59A 5T8IA 4HKQA 1B9RA 1C4CA 1E6EB 5D3DA 1QOFA 3AE8B 4WURA 1E0ZA 1IUEA 4ZOHC 3V05A 1F2RC 1K50A 2CU3A 2MEKA 3WCQA 1YJIA 1YN3A 1RM6C 2BB6A 1OQRA 1HZ5A 1VJKA 2IDYA 3AB5A 3B2GA 2XN9C 4ZYSA 1T5XD 2BB5A 3NVYA 2JX5A 2QJLA 2OHFA 5GXGB 1JWBD 3NZ3A 1TKEA 3RPFC 3URYA 4N6EB 1QQRA 3ZGZA 4DXGA 2MJEA 2WXJA 3C8YA 3O13A 1AN8A 1C77A 2INPE 4A8XC 2PIAA 2RMMA 4RGNA 1ZE3D 1ZDVA 5BYSA 1N63A 2WXGA 3B9JA 1STEA 2FBWB 2K22A 1HEZE 3VR9B 1DYQA 5AUKA 1L4ZB 5FK9C 3P4QB 5BMGA 1V8CA 1SJED 5EE0A 3Q8BA 1F2RI 1UWXA 1WRIA 1E9MA 2BYTA 1L0YB 1XLPA 2M19A 4B0MA 3ZJTA 2PKOA 2L52A 1MHHE 4D2KA 2X38A 2GI9A 4C7ZA 2WXQA 3AEFB 3AE1B 1JRPA 1I4XA 3AV8A 1XLNA 1SIJA 2KN4A 4PT5A 4MT5A 3P1MA 3NVZA 2IJ0A 2RPVA 2PTLA 1SXTA 2AQ1B 4AS1A 2BS2B 1NENB 1TKYA 3IT4B 4ZRQA 5JXVA 2SAKA 1FNVA 4XWWA 3LYYA 2I2YA 1FO4A 5HFYA 1N5XA 1P7FA 2D5GA 2V3PA 2OEDA 2WXFA 3P42A 1XXGA 4C56C 4ZRPA 1D5ZC 1JMLA 3KQ4A 1QT9A 4NJCA 4LLGM 1WSPA 4MH8A 1I4GA 1YMHE 2WS3B 1IGDA 1ACCA 3LB8C 1ET9A 1E7PB 2IPKD 2FUG1 1FM0D 2G1EA 2J4XA 2BS3B 2L32A 5D3IB 3ZQ4A 1D6EC 2H88B 3MJ5A 4WAFA 5BMIA 3W9CB 1JALA 3AE9B 4MM3B 2MH7A 1FNUA 5H8YE 3EGRA 5C2TB 1HA5A 1WXQA 4REZA 5LNK1 2WXNA 3TEYA 2FE8A 3E9SA 1N60A 4KGRA 2N9KA 3L4PA 1OFFA 3B2FA 4YTMB 3VRAB 2EKIA 2EELA 1M4VA 2QIEB 2N7JA 1SF0A 1C4AA 2WXIA 4GLSC 3TEXA 5BMHA 1JWAD 1N5WA 1VRAB 2LJIA 3IT6B 1TS4A 2CJNA 3BYTB 5TSSA 3VRBB 2TSSA 2JU6X 3TEWA 5FKAC 3SFEB 1HXYD 3FAHA 5HI1A 1I4HA 1SE4A 1SEBD 2E6XA 3ABVB 2BS4B 4RGMA 4RGTA 5EE9A 1VZ8A 2KWDA 3Q8EA 2V4IB 5I4DA 1YNTE 4HRSA 1T6BX 5AUIA 1XLQA 4HKZE 2WXKA 1TJEA 3W1SA 1AWDA 1FFUA 3AE2B 1ZP0B 1FEHA 3AEAB 4P6VF 2WU5B 1XCTL 3GB1A 4JX1C 4US8A 2WDVB 1C9FA 2NMQA 3U4EG 4J3OD 4KGTA 2M56B 1MHXA 2N9LA 1K53A 1F77A 3U52E 4WIPA 2NTSA 3VR8B 3MP9A 1ESFA 4RNAA 2W54A 2R61A 5E6JA 1EWYC 1KRHA 1ZDXA 1KF6B 4M0WA 2IGGA 3PZ7A 5H92C 2JXTA 1KLUD 3ZJUA 1C79A 1I4QA 1HQRD 1RWSA 1SJHD 4ZHPA 4ZHOA 4RFBA 2DLBA 4DXFA 3AEGB 1YN5A 1BXTA 4ITKA 2WXPA 3BWUD 3U7ZA 2IGDA 3BK1A 2INNE 1PFDA 3NUHB 4A55A 5BYQA 3GS2A 1NEKB 3ZJVA 1ZUD2 3T3NA 2Y5PA 4EE2A 1XEEA 2Y3AA 3DWGC 3MC0B 4XDDA 1TY2A 3VQIA 2Z8LA 1I4PA 2PVGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KX6 B;  1FM0 D;  2G1E A;  2H89 B;  1DOX A;  2BS3 B;  3AEB B;  1DOY A;  3PO0 A;  1ZXI A;  3AEC B;  2LEK A;  1JQ4 A;  3AEE B;  3CWI A;  5G5G A;  2WQY B;  1A70 A;  2WU2 B;  1QOB A;  2H88 B;  1CJE A;  1XLO A;  2CJO A;  3AN1 A;  3W5V B;  2WDQ B;  2HTM E;  3W9C B;  1OQQ A;  2KMM A;  3NVV A;  3EUB 2;  3AE4 B;  1JAL A;  3AE9 B;  1L6V A;  1F0Z A;  2MH7 A;  2DWQ A;  3SR6 A;  5H8Y E;  1RFK A;  2N0S B;  3HUI A;  4FXC A;  4WWM A;  4YSZ B;  5C2T B;  3ZYY X;  1WXQ A;  4US9 A;  2L83 A;  1NI3 A;  3AE7 B;  1QLB B;  1SB3 C;  4N59 A;  1B9R A;  1E6E B;  3LXF A;  1QOF A;  3AE8 B;  1E10 A;  1E0Z A;  1IUE A;  4ZOH C;  4YSX B;  3AE3 B;  2CU3 A;  3WCQ A;  1N60 A;  1YJI A;  4C7Y A;  2Y5C A;  1RM6 C;  5C3J B;  3AH7 A;  1NVI D;  3L4P A;  1OQR A;  1VJK A;  3P4P B;  1OFF A;  3B2F A;  1CZP A;  3AB5 A;  3B2G A;  5EE1 A;  3VRA B;  2EKI A;  4YTM B;  2QIE B;  4YTP B;  1FXI A;  3NVY A;  1SF0 A;  2JX5 A;  3NRZ A;  1UWM A;  1ZOY B;  2OHF A;  2QJL A;  1JWB D;  5GXG B;  2E3T A;  1DGJ A;  1L0V B;  3AE5 B;  4WQM A;  1TKE A;  5EE3 A;  3RPF C;  1JRO A;  4N6E B;  1JWA D;  3DWM A;  1N5W A;  4IDI A;  1J7A A;  2MJE A;  2CJN A;  3VRB B;  3W5U B;  4YT0 B;  4JWS C;  1QOG A;  3SFE B;  3AED B;  3FAH A;  1QF6 A;  3NVW A;  3HVZ A;  2PVO D;  1FFV A;  2PIA A;  3ABV B;  2BS4 B;  1TKG A;  1FMA D;  5EE9 A;  1N63 A;  3B9J A;  4HRS A;  4N58 A;  2FBW B;  2K22 A;  4A9A A;  5AUI A;  3VR9 B;  1XLQ A;  5AUK A;  3P4R B;  3P4Q B;  1J7C A;  3P63 A;  4JWU C;  1QOA A;  1V8C A;  1TJE A;  4HRO A;  5EE0 A;  1AWD A;  1NYQ A;  1FFU A;  2K9X A;  2BT6 A;  3AE2 B;  1PDX A;  1ZP0 B;  1WRI A;  3AEA B;  1J7B A;  1VDV A;  1E9M A;  3NS1 A;  4P6V F;  1WWT A;  2K5P A;  2WU5 B;  3P4S B;  1RYJ A;  4JX1 C;  3KWL A;  4YSY B;  1XLP A;  2M19 A;  5G5H A;  1YQ4 B;  2WDV B;  2PKO A;  2L52 A;  1FRD A;  1AYF A;  1JW9 D;  2M56 B;  1FXA A;  2MJD A;  1N62 A;  2W55 A;  4C7Z A;  1FIQ A;  1ROE A;  3AEF B;  1KFY B;  2ACZ B;  3ETR A;  3VR8 B;  3AE1 B;  4USA A;  1JRP A;  2W54 A;  1L5P A;  4US8 A;  3AV8 A;  1YJJ A;  1EWY C;  1NYR A;  1XLN A;  1KRH A;  1SIJ A;  1KF6 B;  2MJ3 A;  5H92 C;  1I7H A;  1T3Q A;  3NVZ A;  3P1M A;  1TYG B;  2KAJ A;  2W3S A;  2DBY A;  3CIR B;  1RWS A;  4ZHP A;  4ZHO A;  3FC4 A;  2BS2 B;  1NEN B;  1TKY A;  1GPX A;  3AM9 A;  4YTN B;  1R7S A;  1VLB A;  1FRR A;  3AEG B;  1FO4 A;  4ITK A;  1YQ3 B;  1N5X A;  1V97 A;  1GAQ B;  1WGK A;  1PFD A;  2W3R A;  2AX5 A;  2B76 B;  3HRD D;  4LTU A;  1NEK B;  2WP9 B;  4YXD B;  1PUT A;  1ZUD 2;  2Q5W D;  1XO3 A;  3SFD B;  2JQR B;  4C80 A;  1QT9 A;  1N61 A;  1WYG A;  3DWG C;  1L6U A;  3AMZ A;  1DOI A;  2WDR B;  3AE6 B;  2WS3 B;  3LB8 C;  2WLB A;  5MPO A;  3BII D;  2PVG C;  1E7P B; 
#chains in the Genus database with same CATH topology
 4XX5 A;  3AEB B;  5G5G A;  1XLO A;  2CJO A;  2A4Z A;  1ZXH A;  4A6Q A;  3SR6 A;  2L7R A;  4BKG A;  2N9P C;  2KTR B;  1UZX B;  4K81 A;  2D3A A;  2I1K A;  3T3O A;  1PYW D;  1WH3 A;  3KUC B;  1CQV A;  1UBQ A;  4YWG G;  2G3Q B;  1P9D U;  3Q3F A;  3AH7 A;  4YTP B;  1TS3 A;  2ZJD A;  1ZOY B;  4DQO C;  2KQ4 X;  1WMH B;  1YJ1 A;  2JYT A;  2XK5 B;  3V3X A;  3NVW A;  2V4L A;  4OZC A;  3Q8F A;  3KYD D;  5LXI B;  1MG8 A;  2QIL A;  4BKT A;  3QA8 A;  4A9A A;  3P4R B;  4WJQ A;  4BFR A;  1PDX A;  2KKC A;  3IAM 1;  3X23 A;  3P4S B;  1HTO A;  2LJ5 A;  1H4R A;  4LCD E;  2LHE A;  4EUT A;  2K8B A;  4HEA 1;  5HG2 A;  1Y8R C;  3OJ4 B;  3ETR A;  3OAW A;  2QCZ A;  1MPE A;  3TCA A;  1NYR A;  4OZA A;  4AJW A;  2ZCB A;  4GMV A;  2QMT A;  4MJS A;  1LXD A;  4GDK B;  1R7S A;  4J6I A;  1FRR A;  1YQ3 B;  1I35 A;  3Q14 C;  2SEB D;  3DVN U;  2Z59 B;  1DOI A;  2WDR B;  1WR6 E;  2I1J A;  5D94 A;  2QEJ C;  3J9C A;  1BUI C;  3U30 A;  4KIK A;  1IGC A;  2ONQ A;  4LK0 M;  2MX2 A;  1TY0 A;  1MJD A;  3ZDM C;  4DHZ B;  3H7P A;  3AI5 A;  3HIZ A;  3PLV A;  4DWF A;  1RAX A;  2CHX A;  5CTR C;  4JGH B;  2MHJ A;  2KMM A;  1TBE A;  3AE4 B;  3MFG A;  2WXR A;  4RMA A;  2KVZ A;  4YSZ B;  2KFJ A;  1QLB B;  4PS3 A;  3AE3 B;  4JLC A;  2RDH A;  2QHO A;  1TZ1 A;  4N9F 4;  4W9F A;  3NY5 A;  3AUL A;  3I9V 1;  5CX3 A;  1UWM A;  3VVW B;  1L0V B;  4WQM A;  2XNA C;  3M3J A;  3ONS A;  1KLG D;  4DBG A;  1B1Z A;  3R66 C;  3BVZ A;  1V1O A;  3T9L A;  2LUM A;  3W2D A;  2VZK D;  3OWE B;  4DHJ B;  1FMA D;  4ICU A;  3TL5 A;  3O65 B;  4N58 A;  2VH2 A;  4XWT A;  2M0A A;  2MLB A;  1WJU A;  4KSL C;  1J7B A;  3KUD B;  3NS1 A;  1WWT A;  2C5L C;  2L0T A;  4AP4 C;  1AYF A;  1JW9 D;  4II3 B;  1V1P A;  3PRM B;  2W55 A;  1UD7 A;  2JYE A;  1FIQ A;  4AQ7 A;  1U4A A;  1L5P A;  3R2I A;  3VFK A;  2GOW A;  3L13 A;  1T3Q A;  1P1A A;  4ICV A;  2D07 B;  3IBE A;  3RCZ A;  2M1M A;  3AM9 A;  3TSS A;  3N9Y C;  1GAQ B;  1WGK A;  3K9O B;  5KHQ A;  4LTU A;  4YXD B;  3H8H A;  2INC C;  1RFA A;  4O1N A;  3KWV A;  3UF8 A;  3VTV A;  2FUH B;  5E6O A;  4KX6 B;  1DOX A;  5FR6 A;  4MEL A;  3PO0 A;  3ZRC A;  3N20 C;  2DYM A;  2HJ8 A;  2N7D A;  4GGQ A;  3EC8 A;  3GE8 C;  2FCN A;  3HUI A;  2FAZ A;  2KJR A;  4RM8 A;  3C0R B;  5G2N A;  1B9R A;  4HKQ A;  1C4C A;  1E6E B;  2DZK A;  2N9X A;  1QOF A;  3WIM A;  1K50 A;  2CU3 A;  3WCQ A;  1YN3 A;  3B08 A;  3PZD A;  1OQR A;  1VJK A;  3CF6 E;  3AB5 A;  5IP4 D;  2MBH A;  2RGF A;  3T8M A;  2MBB B;  2BB5 A;  3NVY A;  2JX5 A;  2O6V B;  2QJL A;  3A4S C;  2DZI A;  3CSF A;  1E8W A;  2N1V A;  3O13 A;  4A3O A;  2C9W B;  1WGD A;  1BT0 A;  4A8X C;  2PIA A;  4AUQ C;  1ZDV A;  3SDL C;  2WX0 A;  2BPS A;  4KZ0 A;  3B9J A;  2FBW B;  3VR9 B;  4URK A;  5AUK A;  3P4Q B;  1V8C A;  3Q8B A;  1WM3 A;  3GZN B;  1F2R I;  3ZNG C;  1E9M A;  3N30 A;  2RDB C;  4B0M A;  3M63 B;  2O2V B;  3TJP A;  2EMS A;  3AXC A;  3DBL B;  3AV8 A;  5IOI A;  1XLN A;  3N32 A;  3MC9 A;  3JW0 X;  3NJT A;  2AQ1 B;  3OJ3 A;  3P2B A;  4BAX A;  5C1Z A;  1FNV A;  4XWW A;  2I2Y A;  2LWP A;  3SU8 X;  2V3P A;  4C56 C;  1E8Z A;  1WF9 A;  2YLM A;  3APF A;  3ZO5 B;  2WS3 B;  2KYW A;  2IY1 B;  2J4X A;  4E74 A;  1OQY A;  4BOS C;  2BS3 B;  1WM2 A;  4WAA A;  2L32 A;  5D3I B;  1D6E C;  2H88 B;  5L83 A;  1Z2M A;  4NNJ B;  3PSE B;  2KC2 A;  4M0W B;  1AAR A;  3M62 B;  3H7S A;  3QQ8 B;  4REZ A;  2NBU A;  2DHZ A;  2N1W A;  3A9K B;  1OFF A;  4W9H A;  2QIE B;  3QIJ A;  3NZU A;  1TS4 A;  2CJN A;  2MWS B;  2ZPY A;  3IVF A;  1T0Q C;  2K8C A;  4DDI D;  3NG0 A;  3TEW A;  3SFE B;  1HXY D;  5HI1 A;  1I4H A;  3DPD A;  4RGM A;  5EE9 A;  2KHW B;  2KWD A;  5C23 A;  2V4I B;  2R2Q A;  4W9G A;  1RRB A;  2C60 A;  1T6B X;  1R4N B;  4K3C A;  1XLQ A;  2WXK A;  2JWZ A;  3W1S A;  2KQS A;  3AE2 B;  3CMM B;  4I6P A;  3BIN A;  2WU5 B;  4US8 A;  3A1Q A;  2JRI B;  2N9L A;  1F77 A;  4WIP A;  2NTS A;  3VR8 B;  3MP9 A;  2K8H A;  1WE6 A;  2R61 A;  4FUL A;  1ZDX A;  4ZYN A;  1KF6 B;  3PZ7 A;  2CHZ A;  1KLU D;  1YIW A;  4ANU A;  2BWE S;  4ZHP A;  3AEG B;  4MH0 E;  1BXT A;  2M8S A;  2BKR B;  4K7W A;  3NUH B;  5BYQ A;  1L2N A;  1R4M I;  5DPR A;  2M17 A;  1ZUD 2;  2DX5 B;  3V6C B;  1XEE A;  4XDD A;  3UQA A;  3V61 A;  1ET6 A;  4ZRI A;  2D2Q A;  4B9K A;  1ZXI A;  4NAM A;  4OZB A;  3NZS A;  2XBB C;  3Q69 A;  2PE6 B;  5HHD G;  3NVV A;  2KX3 A;  1SE2 A;  2JWU A;  2J52 A;  4MJS B;  1QKZ A;  2KFK A;  2G45 B;  1GB1 A;  3DBH B;  4RF1 A;  3IAS 1;  4PK1 A;  3ZDT A;  4YSX B;  1YD8 U;  3QK0 A;  4M02 A;  3NS8 A;  4HPL B;  3QAQ A;  3WAL A;  3L16 A;  2LXA A;  1QIL A;  1TS2 A;  1WJ6 A;  1JRO A;  4P7I A;  1GOZ A;  2WXL A;  3VUY A;  3H7P B;  1VR9 A;  1WXV A;  1P98 A;  4YT0 B;  4NQK E;  1QF6 A;  1UUP A;  3ZNZ B;  3HVZ A;  2PVO D;  3Q8A A;  5LXH A;  1IP9 A;  1WXS A;  4ASW C;  4Q2J A;  2G9H D;  2Y5B B;  4TV3 A;  2K9X A;  2C7N B;  1E8X A;  4RM9 A;  5G5H A;  2JZP A;  4K3B A;  1FRD A;  4JPS A;  4WJP A;  1IBX A;  3TUO A;  1GC6 A;  2ACZ B;  3KLS X;  1EU4 A;  1EF5 A;  2ZVN A;  3R7R A;  2KWU B;  2NBW B;  3C19 A;  1S1Q B;  1Q5W B;  1RLF A;  3EA6 A;  4C00 A;  3RFZ B;  5EDS A;  2W3R A;  3BYY B;  3FIL A;  1PUT A;  4MAC A;  2RD0 A;  1WFY A;  2KWV B;  1WJN A;  4HDQ A;  5D2M B;  2H89 B;  3UQB A;  1WYW B;  1V1P B;  2KN5 A;  2NVU I;  2IO2 B;  2J53 A;  2V3N A;  2WQY B;  1QOB A;  3RNA C;  3N3K B;  1HZ6 A;  4IOI E;  4FHJ A;  4JQW C;  4HXD A;  2WHI A;  1RFK A;  3LDZ E;  4OHJ A;  4KGS A;  3ZYY X;  2DAJ A;  4US9 A;  3SHQ A;  4FJY A;  2ZEQ A;  2LZ6 A;  4CYE A;  1TS5 A;  1NVI D;  2KNB A;  2KDM A;  2VRR B;  1CZP A;  5EE1 A;  2VZK B;  4TMA B;  1KTK A;  2J0J A;  1JWS D;  3NRZ A;  2IO3 B;  3VUX A;  1NBF C;  2L8J A;  1IYF A;  5HKH A;  4W9C A;  4PS7 A;  1FFV A;  3A4R A;  1GUA B;  2ASQ A;  4NAW A;  4XC2 A;  3SEB A;  4NZL B;  2LVQ A;  5BO4 B;  4TKN A;  2ZW0 A;  1V6E A;  1VD2 A;  4JWU C;  1J7C A;  1LFD A;  2NR2 A;  2PE9 A;  4HRO A;  3VH3 B;  3ML8 A;  2BT6 A;  4TQ1 A;  4HJG E;  4WJN A;  1BML C;  4YSY B;  3BVM A;  1FXA A;  4KV2 A;  1SE9 A;  3U8Z A;  1PGB A;  2HJ1 A;  3RNC C;  2BTE A;  3U2S C;  2V0G A;  4A90 A;  4B95 A;  4HK2 A;  3TMP B;  4F7Z A;  3EFC A;  4I6L B;  1I7H A;  2KAJ A;  3DHH C;  3ZKJ C;  2HDE A;  3A9J B;  4L1B A;  2B76 B;  3HRD D;  4IWO A;  2WP9 B;  2D3C A;  3DCG A;  4C80 A;  2JQR B;  2K3U A;  3PHX B;  3VHT C;  2DAF A;  1ZPS A;  1KM7 A;  2GRI A;  3Q3O C;  3ENE A;  3BII D;  3PV1 A;  3A33 B;  1XF5 L;  1SSN A;  2VH1 A;  3ZVV A;  1JQ4 A;  1GB4 A;  1Q10 A;  3GZN I;  4IKG A;  1J0G A;  1C78 A;  4MGY E;  4HLE A;  1F0Z A;  2I38 A;  4JE3 B;  1Q0W B;  1TT5 B;  5CHF A;  3UIO B;  5BYR A;  1P7E A;  4N59 A;  5D3D A;  2MRP A;  4ZOH C;  1F2R C;  1WIA A;  4LNI A;  3NOB A;  3TBL D;  2BB6 A;  2AL3 A;  4HJK A;  3V60 A;  2L05 A;  4ZYS A;  1WGR A;  3DOW A;  5GXG B;  3DBR B;  1SGH A;  3NZ3 A;  1TKE A;  3URY A;  5DPW A;  2WXJ A;  2KDE B;  3N1Y C;  4G11 A;  2KLC A;  4IWP A;  2INP E;  4KVG B;  2L00 B;  2NPT A;  2RMM A;  4RGN A;  5BYS A;  2L76 A;  1N63 A;  4OVU A;  1HEZ E;  3V6E B;  4DK5 A;  1L0Y B;  1TIF A;  2KMC A;  4D2K A;  5CHW A;  3WA0 A;  2WXQ A;  2CKH B;  4PS8 A;  2OOB B;  3M95 A;  3L10 B;  2KN4 A;  5TR5 A;  2IJ0 A;  2RPV A;  2PTL A;  4EEW A;  4AS1 A;  3RZF A;  2HD5 B;  1NEN B;  3IT4 B;  5JXV A;  1SIF A;  3LYY A;  3D32 A;  1FO4 A;  3RT3 B;  1P7F A;  1QT9 A;  2HE7 A;  4FJZ A;  4MH8 A;  1IGD A;  1ACC A;  2LVO A;  5DPS A;  1E7P B;  2IPK D;  4WWO A;  1FM0 D;  1F52 A;  4I6N B;  3A1Q B;  2NBV B;  3ZQ4 A;  5GMV A;  4WAF A;  4E71 A;  1D3Z A;  1JAL A;  5AZG A;  4MM3 B;  1FNU A;  2KC1 A;  5H8Y E;  2WYQ A;  3ECI A;  2KLG A;  3QWZ B;  4LJO B;  2LGD A;  3VTW A;  1WX8 A;  2FID A;  4MGI E;  4G0N B;  1WZ0 A;  2N7J A;  1C4A A;  3TEX A;  2LAS A;  1JWA D;  2RPQ A;  2LJI A;  3IT6 B;  3UGB B;  2BYV E;  2K25 A;  4MGK E;  4IM0 A;  4LNO A;  1L7Y A;  3ZTC A;  2E6X A;  3ABV B;  4RGT A;  4IW0 A;  5I4D A;  4FJV B;  4FHK A;  2M0X A;  1MFW A;  5AUI A;  2KFK B;  1ISN A;  2JY6 A;  2IY0 B;  4AJY B;  1P3Q U;  2IYD B;  3DHI C;  3BY4 B;  2NMQ A;  3U4E G;  4J3O D;  2BF8 B;  2LD9 A;  1K53 A;  3U52 E;  2PJH A;  4LDT D;  1ESF A;  4RNA A;  2KZR A;  1EWY C;  3SD5 A;  2JXT A;  3ZJU A;  1C79 A;  3KW5 B;  1I4Q A;  2G4D B;  1V9J A;  2XK5 A;  4XGA B;  4ZHO A;  3JSV B;  4RFB A;  3HHM A;  1YN5 A;  2WXP A;  2IGD A;  4CHK A;  2INN E;  2PPH A;  3QX1 A;  2DNF A;  3ZJV A;  2KO3 A;  2Y5P A;  3T3N A;  1WXA A;  3DWG C;  1YQB A;  4M8M A;  1TY2 A;  3L17 A;  1I4P A;  2BWF A;  2PVG C;  2LVP A;  2M4N A;  2RDG A;  2FCQ A;  3CWI A;  2GBJ A;  1A70 A;  3W5V B;  2W9N A;  3KUZ A;  3TEZ A;  3ZIM A;  1YN4 A;  3UI3 A;  1FNW A;  1NI2 A;  4FXC A;  1CMX B;  4L23 A;  2AQ2 B;  2WNM A;  3LXF A;  5D7G A;  4LNN A;  3FIL B;  2YEP F;  2KDI A;  1C4P A;  3AE5 B;  3EEC A;  2BKF A;  4XYC A;  3GE3 C;  5J18 A;  2LI5 A;  1XCQ L;  3NHE B;  4K1R B;  4JWS C;  1QOG A;  2C7M B;  4MEM A;  2X8X X;  1TKG A;  2KXJ A;  2KX0 A;  5DCN A;  2ZZP B;  2LRW A;  1JCK B;  1L0X B;  4P1B C;  5G55 A;  1Z5S B;  3W1S C;  1VDV A;  4TQ0 A;  1C1Y B;  1YQ4 B;  1V49 A;  4B0E A;  1WE7 A;  1ROE A;  1KFY B;  2JSV X;  4ARI A;  1LGR A;  2UWQ A;  3S2A A;  4WJO A;  1T0S C;  1PGA A;  4MSM B;  4F8C B;  3PZ8 A;  3CIR B;  1L4D B;  3FC4 A;  3IFW B;  4NAW B;  4ACF A;  4M00 A;  1VLB A;  1V97 A;  3N1X C;  1P0R A;  2AX5 A;  1PGX A;  1K8R B;  4L2Y A;  2WGS A;  1V80 A;  3SFD B;  3UIP B;  1N61 A;  4II2 B;  2JRH A;  3APC A;  1JWU D;  2LUE A;  1AW7 A;  4NJ6 A;  3U7D A;  1HTQ A;  1DOY A;  3Q3M C;  3AEC B;  4ANX A;  3AN1 A;  4IUM B;  2HTM E;  3ALB A;  4NY0 A;  2XEW A;  1KOT A;  1VZ7 A;  4WWM A;  4H2A A;  5IAA C;  2L83 A;  2WXO A;  3AE7 B;  2L1A A;  2NS5 A;  4NJ7 A;  3ZLZ A;  1VCB A;  2PLP A;  1LM8 B;  2Y5C A;  3P4P B;  4A3P A;  3WAN A;  1EUV B;  1I4R A;  1WI0 A;  3BZD B;  4HPP A;  1UGM A;  2WDT B;  3VH4 B;  3B1L X;  4HCN B;  3PS6 A;  1ZKH A;  1J7A A;  5KHO A;  3RNB C;  3RUL A;  3R7Q A;  3W5U B;  2GBM A;  2PEA A;  4FAD A;  4EZK A;  2AWT A;  1QOA A;  1NYQ A;  4XDC A;  5IA7 A;  4GXB A;  4KIK B;  4HVB A;  3KWL A;  2KQ7 A;  1MI0 A;  1UH6 A;  1K51 A;  4HCP B;  3Q2A C;  2MJD A;  1N62 A;  4RH6 A;  1XD3 B;  2YEP B;  2CHW A;  2O6V A;  2LGX A;  1N6Z A;  2REX A;  1YJJ A;  1FD6 A;  4CO7 A;  1EM7 A;  2W3S A;  4UDU C;  2KD0 A;  1WRD B;  4OVZ A;  1EWC A;  5AZF A;  2BBC A;  2CR5 A;  3DBR I;  2ICI A;  2DYB A;  2QSD A;  1PQS A;  3N1Z C;  4C4V A;  3E56 A;  5JH5 C;  2Q5W D;  1XO3 A;  1WYG A;  4GDL A;  1TZO A;  2NTT A;  3AE6 B;  1D5M C;  2KK8 A;  4RF0 A;  4WH4 A;  1SBB B;  4WWN A;  5JHB A;  3EHV A;  2MBQ A;  2K0P A;  4ARC A;  1FCL A;  1OQQ A;  1KLV A;  1EF1 A;  1ZGU B;  2BW2 A;  3VAW A;  4DDG D;  4MGZ E;  2MCN B;  1UGJ A;  3AE8 B;  3LJ3 A;  3PT2 B;  3PVL A;  2IDY A;  2XN9 C;  1LQB A;  2IBI B;  1JWB D;  4KDI C;  2JT4 B;  4N6E B;  3TIX A;  1WR1 A;  4HDO A;  4DXG A;  4FA6 A;  2D3B A;  3RI7 C;  3ZUN A;  3OLM D;  1C77 A;  4IC7 B;  3PRZ A;  4XZ4 A;  2AEH A;  1ZE3 D;  2WXG A;  1YX5 B;  3FKY A;  2K22 A;  4GB9 A;  2YVC A;  5E6P A;  1UWX A;  1WRI A;  2BYT A;  4GOC A;  1UF0 A;  3ZJT A;  2L52 A;  3VUW A;  4C7Z A;  2KJ6 A;  3AEF B;  4MSQ B;  2MP2 A;  2LGY A;  3AE1 B;  1JRP A;  1I4X A;  5J2R A;  4MT5 A;  3P1M A;  2CU1 A;  3NVZ A;  1SXT A;  4ZRQ A;  4S17 A;  1N5X A;  3PTF C;  4EFO A;  2D5G A;  2OED A;  1T0R C;  1JML A;  4NJC A;  4LLG M;  1I4G A;  1GNU A;  2N7E A;  2GBN A;  1ET9 A;  2KDB A;  2FUG 1;  4W9E A;  2G1E A;  3V62 A;  4EOY A;  3PLU A;  1WGY A;  5IN7 A;  3W9C B;  1R4M B;  3AE9 B;  1V2Y A;  2AYO B;  3EGR A;  1HA5 A;  2WXN A;  3HM6 X;  3Q6B A;  3ZXR A;  2GLS A;  3E9S A;  1UBI A;  1N60 A;  4P1C C;  2V3S A;  1J19 A;  4YTM B;  2K6Q A;  5DPT A;  2EEL A;  1M4V A;  1TGZ B;  1SF0 A;  2DZJ A;  2FCM A;  4GLS C;  4G3X B;  1X1M A;  3PPA A;  3KYC D;  4FN2 A;  3BYT B;  2TSS A;  1F9J A;  3FAH A;  2K6D B;  3ZNH B;  3ML9 A;  3OG5 A;  1VZ8 A;  3Q8E A;  2JXX A;  1YNT E;  3DBL I;  4HRS A;  4LDT B;  4BOZ B;  1OEY A;  1TJE A;  1AWD A;  1FFU A;  2LXC A;  3MTN B;  1FEH A;  1WJ4 A;  4JX1 C;  4M8N A;  1C9F A;  3DBS A;  3RN9 C;  4KGT A;  2M56 B;  1MHX A;  3AU5 A;  4HWI B;  4W9K A;  4QAY A;  2IGG A;  1RWS A;  3ZTD A;  2DLB A;  3U7Z A;  3BWU D;  4WWP A;  4NQL B;  2KTF A;  3GS2 A;  1NEK B;  4EE2 A;  1A5R A;  1NDD A;  3MC0 B;  1I42 A;  2Z8L A;  3RNF C;  3KH0 A;  1D4B A;  2WWZ A;  3Q3N C;  1T0Y A;  3RYT A;  2WU2 B;  1F1H A;  2L3Z A;  3DVG X;  2MBE A;  1MVK A;  3IXS A;  2V1Y A;  2D3G A;  2ZNV C;  1C3T A;  1VZ6 A;  1IPG A;  4A20 A;  4GIV A;  2ON8 A;  4C7Y A;  5C3J B;  2KMA A;  2LRU A;  1FXI A;  1R4N I;  1V5T A;  3IG3 A;  4GN1 A;  3AU4 A;  2GBR A;  2E3T A;  1YOV B;  1DGJ A;  3DWM A;  2KVR A;  3Q3J A;  2KDF B;  3B0A A;  4K7U A;  1E5W A;  4ZRK A;  4EKU A;  3UIN B;  4TSS A;  1JWM D;  4FBJ B;  2ZW1 A;  2KAC A;  1YX6 B;  4MDK E;  2JF5 A;  3BVG A;  1EU3 A;  4WQO B;  4IM3 A;  3PRE A;  4R3D A;  3K9P B;  3P63 A;  3R8B A;  2DYO A;  2BYE A;  2IO0 B;  2GB1 A;  2RR9 A;  3HK0 A;  1GC7 A;  1RYJ A;  3VTU A;  2LGI A;  2JPH A;  3QAR A;  4IM2 A;  4X57 B;  1ENF A;  4P16 A;  3W1Y A;  2K39 A;  2MBO A;  3H9D A;  4USA A;  1FXT B;  1V86 A;  3H1U A;  3MJW A;  2MJ3 A;  3Q8C A;  2KTR A;  1FCC C;  1SE3 A;  2R2O A;  3DQV A;  2LFI A;  2UYZ B;  1L6U A;  2WLB A;  3DBH I;  5MPO A;  4S0R A;  3I5J C;  4CQN A;  3PHW B;  2AQ3 B;  1WMH A;  3ZXV A;  4XE0 A;  1WX7 A;  4IWQ A;  1G6J A;  2LEK A;  3HVD A;  2MW5 A;  3R2T A;  1LO5 D;  2WDQ B;  4NPN A;  2J0K A;  1CK1 A;  2FCS A;  3EUB 2;  1L6V A;  1WGG A;  2LGS A;  2N0S B;  3QJZ A;  2KWC A;  4LNK A;  2BQQ A;  2B3A A;  3DVN V;  1UNS A;  2CS4 A;  1E10 A;  2JZ3 B;  5LLI A;  2LHD A;  4C4V B;  3DDC B;  3A9J A;  4GDL B;  1IBX B;  1Y56 A;  4KKJ A;  2JVC A;  1XT9 B;  5EE3 A;  1H8C A;  1KH0 A;  4IDI A;  1M94 A;  4KKI A;  3APD A;  2WXM A;  3RD2 A;  3AED B;  5CHV C;  1S3S G;  4GDK A;  2C7H A;  4FLH A;  3JYU A;  4B6W A;  4LNF A;  1C76 A;  2JUO A;  4OW0 A;  5FR3 A;  2K5P A;  1J8C A;  2OJW A;  4DHJ D;  2IGH A;  2W82 A;  1OEY J;  2KJH B;  4E3C A;  2FNJ B;  2PW9 A;  2KT7 A;  3MHS D;  1K52 A;  1TYG B;  2DBY A;  2Z0E B;  1GPX A;  4YTN B;  4BBN C;  2BYF A;  1WGH A;  1E8Y A;  4ZDV A;  2PMV A;  3QCA A;  4AWJ A;  2J0M A;  2IND C;  4RCO A;  5D6J B;  3I57 A;  2WXH A;  3RUI B;  3AMZ A;  2MA9 B;  3MHZ A;  2LMC A;  3PRP B;  1OGW A;  3GP7 A;  1E7U A;  3AEE B;  4ANV A;  2MP2 B;  3BK2 A;  1CJE A;  2KAN A;  1GJZ A;  3H6N A;  3R3M A;  1UEL A;  2BVC A;  2J42 A;  2A5U A;  4RGO S;  2KOX A;  2DWQ A;  3IHP C;  1V5O A;  2V9H A;  1WX9 A;  1Q1O A;  1D5X C;  1NI3 A;  3KVF B;  1SB3 C;  5T8I A;  3WAP A;  4WUR A;  1E0Z A;  1IUE A;  3V05 A;  4K7S A;  2MEK A;  1YJI A;  1RM6 C;  1TTN A;  1HZ5 A;  2IO1 B;  3B2G A;  1T5X D;  3RNG C;  2OHF A;  5E6N A;  2N9E B;  3RPF C;  1QQR A;  3ZGZ A;  2MJE A;  3C8Y A;  4PYZ A;  1AN8 A;  4M01 A;  2N4F A;  2DZM A;  2J7Q B;  3RZW C;  2O6V D;  4KSK C;  4MM3 A;  2L0F A;  1STE A;  1DYQ A;  1L4Z B;  5FK9 C;  5BMG A;  4G50 A;  1SJE D;  5EE0 A;  3I3T B;  1MG4 A;  1XLP A;  2M19 A;  2GBK A;  2PKO A;  3WAO A;  1MHH E;  1WXM A;  2X38 A;  2GI9 A;  4KDL B;  3JVZ X;  4KZC A;  2NCN A;  4JL9 A;  2QDF A;  1SIJ A;  4PT5 A;  2Z0D B;  1GG3 A;  3ZRF A;  4DHZ E;  4ANW A;  5JZE B;  2BS2 B;  1JRU A;  1TKY A;  2HTH A;  2RSU A;  2SAK A;  5AEK B;  1XQQ A;  5HFY A;  2WXF A;  4TUU A;  3P42 A;  1XXG A;  4ZRP A;  1D5Z C;  1OTR B;  3L08 A;  2ZVO A;  3KQ4 A;  3CST A;  1HE8 A;  2WX1 A;  1WSP A;  3MC8 A;  1YMH E;  4AOF A;  2ZPN A;  3LB8 C;  2K1F A;  3VXW A;  4BKS D;  3RMK C;  3DHG C;  3HM3 A;  4GSW A;  3MJ5 A;  4PYU A;  4YL8 A;  5BMI A;  2FIF A;  2NPT B;  1E90 A;  2MH7 A;  4BVU C;  4HPM B;  5C2T B;  1WXQ A;  4W9J A;  4BZA A;  5LNK 1;  5IO9 A;  3JSV A;  3TEY A;  2FE8 A;  4GU2 A;  3GOE A;  2MSE D;  5IKC M;  4KGR A;  4W9L A;  2N9K A;  4IG7 B;  3L4P A;  4EZL A;  5L95 C;  3B2F A;  3VRA B;  3RNE C;  2EKI A;  4F1S A;  3L0W B;  3VDZ A;  2WXI A;  2JZZ A;  4OVV A;  2O2V A;  5BMH A;  1WZ3 A;  3L54 A;  3QC8 B;  1N5W A;  1VRA B;  5J17 A;  5TSS A;  3VRB B;  2DEN B;  2EMT A;  2JU6 X;  5FKA C;  1E7V A;  1SE4 A;  1SEB D;  2QC8 A;  2BS4 B;  4BKS A;  5JHA A;  2IZV B;  4HKZ E;  2D10 A;  1ZW7 A;  1V81 A;  2GMI C;  1ZP0 B;  3AEA B;  4P6V F;  2D11 A;  3GB1 A;  1XCT L;  2WDV B;  3WAM A;  2MQJ A;  4W9D A;  2W54 A;  4ZRJ A;  1WY8 A;  2ZNV B;  5E6J A;  4DXA B;  1KRH A;  4M0W A;  5H92 C;  4JIO U;  4W9I A;  1HQR D;  1SJH D;  1KJT A;  2ZCC A;  1EO6 A;  2UU7 A;  4DXF A;  2AL6 A;  4ITK A;  3A9K A;  3BK1 A;  1FPY A;  1PFD A;  3PGE A;  4LJP B;  5AZH A;  4A55 A;  3X0W A;  3QHT A;  2OJR A;  2BGF A;  2G4S A;  1QZE A;  2Y3A A;  3ZW3 A;  3EFU A;  3I63 C;  3ZNI D;  3DVG Y;  3VQI A;  4EZJ A;  4BBN F;  2EKE C; 
#chains in the Genus database with same CATH homology
 1ET6 A;  1D4B A;  3AEB B;  2RDG A;  1ZXI A;  3CWI A;  4NAM A;  5G5G A;  2WU2 B;  1A70 A;  4OZB A;  1XLO A;  3W5V B;  2CJO A;  3Q69 A;  3TEZ A;  5HHD G;  3NVV A;  1YN4 A;  3UI3 A;  1MVK A;  1ZXH A;  3IXS A;  4A6Q A;  3SR6 A;  1FNW A;  1SE2 A;  2JWU A;  2J52 A;  4FXC A;  1QKZ A;  1VZ6 A;  4L23 A;  1GB1 A;  2AQ2 B;  2WNM A;  3T3O A;  1PYW D;  4RF1 A;  3IAS 1;  3LXF A;  2ON8 A;  1CQV A;  4YWG G;  4YSX B;  5D7G A;  3FIL B;  2YEP F;  4C7Y A;  5C3J B;  3AH7 A;  4YTP B;  1FXI A;  1TS3 A;  1ZOY B;  1QIL A;  4DQO C;  2E3T A;  1DGJ A;  1TS2 A;  1C4P A;  2KQ4 X;  3AE5 B;  1JRO A;  2JYT A;  3DWM A;  1GOZ A;  1XCQ L;  2WXL A;  1VR9 A;  4YT0 B;  4JWS C;  1QOG A;  1QF6 A;  1UUP A;  3NVW A;  3V3X A;  3HVZ A;  2PVO D;  4TSS A;  3Q8A A;  1JWM D;  1TKG A;  4OZC A;  2ZW1 A;  3Q8F A;  2KAC A;  2QIL A;  3BVG A;  1EU3 A;  4A9A A;  4R3D A;  1JCK B;  3P4R B;  3P63 A;  4Q2J A;  2G9H D;  3R8B A;  2DYO A;  1L0X B;  2K9X A;  2GB1 A;  1PDX A;  1VDV A;  4TQ0 A;  3IAM 1;  3P4S B;  1RYJ A;  5G5H A;  1YQ4 B;  2LGI A;  2JZP A;  2LHE A;  1FRD A;  4B0E A;  4JPS A;  4HEA 1;  5HG2 A;  1IBX A;  1ENF A;  1ROE A;  3TUO A;  1KFY B;  2ACZ B;  3ETR A;  2JSV X;  3KLS X;  4P16 A;  4USA A;  1MPE A;  1EU4 A;  4ARI A;  1NYR A;  4OZA A;  1PGA A;  2MJ3 A;  3PZ8 A;  2QMT A;  3Q8C A;  3CIR B;  1L4D B;  3EA6 A;  3FC4 A;  4GDK B;  4NAW B;  1R7S A;  1FCC C;  1VLB A;  1FRR A;  1SE3 A;  1YQ3 B;  1V97 A;  3RFZ B;  2W3R A;  2AX5 A;  1PGX A;  3BYY B;  3FIL A;  2SEB D;  4L2Y A;  1PUT A;  2LFI A;  3SFD B;  4MAC A;  1N61 A;  1L6U A;  1DOI A;  2WDR B;  1JWU D;  1AW7 A;  2QEJ C;  2WLB A;  3J9C A;  1BUI C;  5MPO A;  4CQN A;  2AQ3 B;  1IGC A;  2ONQ A;  4XE0 A;  2H89 B;  4LK0 M;  1V1P B;  1TY0 A;  1DOY A;  3AEC B;  2LEK A;  2V3N A;  2J53 A;  3HVD A;  2WQY B;  3R2T A;  1QOB A;  1LO5 D;  3AN1 A;  2WDQ B;  2HTM E;  1CK1 A;  2KMM A;  1HZ6 A;  3EUB 2;  4IOI E;  3AE4 B;  1L6V A;  3MFG A;  1RFK A;  2N0S B;  2WXR A;  1VZ7 A;  4OHJ A;  4WWM A;  4H2A A;  4KGS A;  3ZYY X;  4YSZ B;  4US9 A;  2L83 A;  2WXO A;  3AE7 B;  1QLB B;  2L1A A;  1UNS A;  2PLP A;  1E10 A;  1TS5 A;  3AE3 B;  2LHD A;  2Y5C A;  2RDH A;  3P4P B;  1NVI D;  2KDM A;  1CZP A;  5EE1 A;  2VZK B;  4TMA B;  1KTK A;  4GDL B;  1IBX B;  1I4R A;  3I9V 1;  1Y56 A;  1JWS D;  4KKJ A;  3NRZ A;  1UWM A;  3BZD B;  1L0V B;  4WQM A;  5EE3 A;  2XNA C;  1KH0 A;  4IDI A;  1KLG D;  1J7A A;  4KKI A;  1B1Z A;  2WXM A;  3W5U B;  3BVZ A;  1V1O A;  3AED B;  2LUM A;  3W2D A;  1FFV A;  2VZK D;  3SEB A;  3OWE B;  1FMA D;  4NZL B;  4N58 A;  4XWT A;  2ZW0 A;  4JWU C;  1J7C A;  1C76 A;  2M0A A;  1QOA A;  4HRO A;  1NYQ A;  2BT6 A;  4OW0 A;  4XDC A;  4TQ1 A;  4HJG E;  1J7B A;  5FR3 A;  1BML C;  3NS1 A;  1WWT A;  2K5P A;  3KWL A;  4YSY B;  3BVM A;  1MI0 A;  2IGH A;  1K51 A;  2W82 A;  1AYF A;  1JW9 D;  1FXA A;  1V1P A;  1N62 A;  2MJD A;  2W55 A;  2JYE A;  1PGB A;  2BTE A;  1FIQ A;  4RH6 A;  2YEP B;  2PW9 A;  3U2S C;  4AQ7 A;  2V0G A;  4A90 A;  1L5P A;  3R2I A;  1YJJ A;  1FD6 A;  1K52 A;  1I7H A;  1T3Q A;  1EM7 A;  1TYG B;  2KAJ A;  2W3S A;  4UDU C;  2DBY A;  4OVZ A;  2HDE A;  1EWC A;  1GPX A;  3AM9 A;  4YTN B;  2BBC A;  2ICI A;  3TSS A;  3N9Y C;  1GAQ B;  1WGK A;  2QSD A;  2PMV A;  4L1B A;  2B76 B;  3HRD D;  4LTU A;  2WP9 B;  4YXD B;  4RCO A;  3E56 A;  2Q5W D;  1XO3 A;  4C80 A;  2JQR B;  2K3U A;  2WXH A;  3I57 A;  3H8H A;  1WYG A;  3AMZ A;  1ZPS A;  1TZO A;  4O1N A;  2NTT A;  3AE6 B;  3KWV A;  3MHZ A;  2GRI A;  1D5M C;  3BII D;  2LMC A;  4RF0 A;  4WH4 A;  1SBB B;  1XF5 L;  1SSN A;  4KX6 B;  1DOX A;  3GP7 A;  3PO0 A;  1JQ4 A;  3AEE B;  1GB4 A;  2K0P A;  1Q10 A;  1CJE A;  2DYM A;  3BK2 A;  4ARC A;  1FCL A;  1OQQ A;  2J42 A;  2BW2 A;  4IKG A;  1C78 A;  4RGO S;  1F0Z A;  2DWQ A;  2I38 A;  4JE3 B;  3HUI A;  5BYR A;  1UGJ A;  1D5X C;  1NI3 A;  1P7E A;  1SB3 C;  4N59 A;  5T8I A;  4HKQ A;  1B9R A;  1C4C A;  1E6E B;  5D3D A;  1QOF A;  3AE8 B;  4WUR A;  1E0Z A;  1IUE A;  4ZOH C;  3V05 A;  1F2R C;  1K50 A;  2CU3 A;  2MEK A;  3WCQ A;  1YJI A;  1YN3 A;  1RM6 C;  2BB6 A;  1OQR A;  1HZ5 A;  1VJK A;  2IDY A;  3AB5 A;  3B2G A;  2XN9 C;  4ZYS A;  1T5X D;  2BB5 A;  3NVY A;  2JX5 A;  2QJL A;  2OHF A;  5GXG B;  1JWB D;  3NZ3 A;  1TKE A;  3RPF C;  3URY A;  4N6E B;  1QQR A;  3ZGZ A;  4DXG A;  2MJE A;  2WXJ A;  3C8Y A;  3O13 A;  1AN8 A;  1C77 A;  2INP E;  4A8X C;  2PIA A;  2RMM A;  4RGN A;  1ZE3 D;  1ZDV A;  5BYS A;  1N63 A;  2WXG A;  3B9J A;  1STE A;  2FBW B;  2K22 A;  1HEZ E;  3VR9 B;  1DYQ A;  5AUK A;  1L4Z B;  5FK9 C;  3P4Q B;  5BMG A;  1V8C A;  1SJE D;  5EE0 A;  3Q8B A;  1F2R I;  1UWX A;  1WRI A;  1E9M A;  2BYT A;  1L0Y B;  1XLP A;  2M19 A;  4B0M A;  3ZJT A;  2PKO A;  2L52 A;  1MHH E;  4D2K A;  2X38 A;  2GI9 A;  4C7Z A;  2WXQ A;  3AEF B;  3AE1 B;  1JRP A;  1I4X A;  3AV8 A;  1XLN A;  1SIJ A;  2KN4 A;  4PT5 A;  4MT5 A;  3P1M A;  3NVZ A;  2IJ0 A;  2RPV A;  2PTL A;  1SXT A;  2AQ1 B;  4AS1 A;  2BS2 B;  1NEN B;  1TKY A;  3IT4 B;  4ZRQ A;  5JXV A;  2SAK A;  1FNV A;  4XWW A;  3LYY A;  2I2Y A;  1FO4 A;  5HFY A;  1N5X A;  1P7F A;  2D5G A;  2V3P A;  2OED A;  2WXF A;  3P42 A;  1XXG A;  4C56 C;  4ZRP A;  1D5Z C;  1JML A;  3KQ4 A;  1QT9 A;  4NJC A;  4LLG M;  1WSP A;  4MH8 A;  1I4G A;  1YMH E;  2WS3 B;  1IGD A;  1ACC A;  3LB8 C;  1ET9 A;  1E7P B;  2IPK D;  2FUG 1;  1FM0 D;  2G1E A;  2J4X A;  2BS3 B;  2L32 A;  5D3I B;  3ZQ4 A;  1D6E C;  2H88 B;  3MJ5 A;  4WAF A;  5BMI A;  3W9C B;  1JAL A;  3AE9 B;  4MM3 B;  2MH7 A;  1FNU A;  5H8Y E;  3EGR A;  5C2T B;  1HA5 A;  1WXQ A;  4REZ A;  5LNK 1;  2WXN A;  3TEY A;  2FE8 A;  3E9S A;  1N60 A;  4KGR A;  2N9K A;  3L4P A;  1OFF A;  3B2F A;  4YTM B;  3VRA B;  2EKI A;  2EEL A;  1M4V A;  2QIE B;  2N7J A;  1SF0 A;  1C4A A;  2WXI A;  4GLS C;  3TEX A;  5BMH A;  1JWA D;  1N5W A;  1VRA B;  2LJI A;  3IT6 B;  1TS4 A;  2CJN A;  3BYT B;  5TSS A;  3VRB B;  2TSS A;  2JU6 X;  3TEW A;  5FKA C;  3SFE B;  1HXY D;  3FAH A;  5HI1 A;  1I4H A;  1SE4 A;  1SEB D;  2E6X A;  3ABV B;  2BS4 B;  4RGM A;  4RGT A;  5EE9 A;  1VZ8 A;  2KWD A;  3Q8E A;  2V4I B;  5I4D A;  1YNT E;  4HRS A;  1T6B X;  5AUI A;  1XLQ A;  4HKZ E;  2WXK A;  1TJE A;  3W1S A;  1AWD A;  1FFU A;  3AE2 B;  1ZP0 B;  1FEH A;  3AEA B;  4P6V F;  2WU5 B;  1XCT L;  3GB1 A;  4JX1 C;  4US8 A;  2WDV B;  1C9F A;  2NMQ A;  3U4E G;  4J3O D;  4KGT A;  2M56 B;  1MHX A;  2N9L A;  1K53 A;  1F77 A;  3U52 E;  4WIP A;  2NTS A;  3VR8 B;  3MP9 A;  1ESF A;  4RNA A;  2W54 A;  2R61 A;  5E6J A;  1EWY C;  1KRH A;  1ZDX A;  1KF6 B;  4M0W A;  2IGG A;  3PZ7 A;  5H92 C;  2JXT A;  1KLU D;  3ZJU A;  1C79 A;  1I4Q A;  1HQR D;  1RWS A;  1SJH D;  4ZHP A;  4ZHO A;  4RFB A;  2DLB A;  4DXF A;  3AEG B;  1YN5 A;  1BXT A;  4ITK A;  2WXP A;  3BWU D;  3U7Z A;  2IGD A;  3BK1 A;  2INN E;  1PFD A;  3NUH B;  4A55 A;  5BYQ A;  3GS2 A;  1NEK B;  3ZJV A;  1ZUD 2;  3T3N A;  2Y5P A;  4EE2 A;  1XEE A;  2Y3A A;  3DWG C;  3MC0 B;  4XDD A;  1TY2 A;  3VQI A;  2Z8L A;  1I4P A;  2PVG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...