1PFDA

The solution structure of high plant parsley [2fe-2s] ferredoxin, nmr, 18 structures
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
96
structure length
96
Chain Sequence
ATYNVKLITPDGEVEFKCDDDVYVLDQAEEEGIDIPYSCRAGSCSSCAGKVVSGSIDQSDQSFLDDEQMDAGYVLTCHAYPTSDVVIETHKEEEIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of parsley [2Fe-2S]ferredoxin.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords FERREDOXIN
total genus 21
structure length 96
sequence length 96
ec nomenclature ec 1.7.7.2: Ferredoxin--nitrate reductase.
pdb deposition date 1998-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1pfdA00
3P1MA 5AUKA 1SF0A 1ROEA 3P63A 4A9AA 5MPOA 4ITKA 1E7PB 2L83A 2WU5B 3NVWA 4N59A 1WXQA 2JQRB 3FC4A 1ZP0B 3L4PA 3AM9A 1SB3C 2BS4B 1DOYA 3AE6B 4US9A 1QF6A 1L0VB 1JALA 4JWSC 3ZYYX 1JW9D 1DOIA 2B76B 3VRAB 5GXGB 1NVID 1FFUA 3AECB 3AE9B 1KF6B 3SR6A 3HUIA 4P6VF 5C3JB 1XO3A 2CU3A 1OQQA 2N0SB 2G1EA 3SFEB 1E6EB 2AX5A 3B2GA 4US8A 1OQRA 1JWAD 1PDXA 1TKGA 4YTMB 1TJEA 1QT9A 1FMAD 1TYGB 1WRIA 3NVZA 2WDQB 3FAHA 1OFFA 2PVOD 3VRBB 2BS3B 2CJNA 4YSYB 3SFDB 3B9JA 4JWUC 1GAQB 3ETRA 4YTNB 1VJKA 2CJOA 1V8CA 2EKIA 2PIAA 3AE4B 2KMMA 4C80A 3W5UB 4HRSA 2WLBA 1DOXA 1FRDA 1AWDA 1NENB 1WGKA 4KX6B 4C7ZA 4N6EB 1YJIA 3CWIA 1XLOA 1IUEA 1A70A 1ZXIA 2DWQA 2WP9B 3LXFA 3P4QB 4IDIA 1SIJA 1YJJA 2HTME 1E10A 2W55A 5EE1A 5EE9A 2QJLA 2E3TA 1L5PA 1UWMA 2H88B 1N62A 2Y5CA 3VR8B 4N58A 2MH7A 1RM6C 3DWGC 5EE3A 5EE0A 1E9MA 2WDRB 3NRZA 1YQ3B 3NS1A 1AYFA 5C2TB 4USAA 1JROA 1VDVA 2WS3B 2MJ3A 4YXDB 3AH7A 1ZOYB 4YT0B 1QOAA 1QOBA 2K5PA 3WCQA 4YSZB 1WWTA 3CIRB 1DGJA 1CZPA 1JQ4A 1L6VA 2M19A 1JWBD 1QOFA 3DWMA 5G5HA 1GPXA 1KRHA 1FM0D 3AN1A 1PUTA 2JX5A 2W54A 3PO0A 1ZUD2 5AUIA 2KAJA 1NEKB 1JRPA 3W9CB 1TKYA 2OHFA 4JX1C 3AEEB 1FXIA 3BIID 1T3QA 3HVZA 1QLBB 3P4RB 1B9RA 3AV8A 1FFVA 3AEAB 5H8YE 1FRRA 3P4SB 3AE1B 3VR9B 3AEDB 2LEKA 2Q5WD 3NVVA 1I7HA 2MJEA 1YQ4B 1FIQA 1XLQA 3AE8B 4ZOHC 4YTPB 4ZHOA 1QOGA 3P4PB 1PFDA 4ZHPA 2BT6A 2W3SA 2M56B 4HROA 1N5XA 1F0ZA 1J7BA 1TKEA 1WYGA 3AE2B 1J7AA 1N61A 1RYJA 2PVGC 2WQYB 3KWLA 2ACZB 1R7SA 3NVYA 1N5WA 1CJEA 2DBYA 3AB5A 2BS2B 3AEFB 1NI3A 1KFYB 2K9XA 1NYRA 2PKOA 2QIEB 1EWYC 1NYQA 3AEBB 3AMZA 1L6UA 1FO4A 4YSXB 1XLNA 3EUB2 3HRDD 3RPFC 1FXAA 2W3RA 1J7CA 1N63A 4FXCA 2K22A 3AE7B 2H89B 2L52A 3AE5B 5G5GA 4WQMA 1VLBA 4WWMA 1RWSA 3AE3B 2WDVB 1N60A 1XLPA 3AEGB 5H92C 1E0ZA 3ABVB 3LB8C 4C7YA 2FBWB 2MJDA 4LTUA 2WU2B 1V97A 3W5VB 1RFKA 3B2FA
chains in the Genus database with same CATH superfamily
5JZEB 2WHIA 5BYSA 2AEHA 2WU5B 2E6XA 3FC4A 4WIPA 5BYQA 3PRMB 1L7YA 1ZDXA 4OZAA 2KD0A 3DBHI 1CK1A 2VZKD 2CU3A 4P1CC 2GBKA 2KWDA 2NMQA 1C76A 1FMAD 2WXHA 3OJ3A 2MHJA 1NBFC 1KTKA 1WX7A 4MT5A 3BK1A 5HI1A 1P1AA 3URYA 1TT5B 1IUEA 3L17A 1WE7A 2D3GA 4WWOA 2MH7A 1Z5SB 3L54A 3NS1A 1T0SC 4USAA 4C4VA 4A3PA 4FJYA 1J0GA 3P42A 2M19A 2AWTA 2AQ1B 3DHIC 3ZNHB 1GUAB 1LGRA 1ZUD2 1WGGA 2EMSA 2KACA 1FXIA 2IZVB 2O6VA 3RZWC 3V6CB 1ET9A 4MGYE 1D5ZC 5TR5A 3E9SA 4DQOC 2G4DB 3U52E 2GOWA 1I4QA 3ZTDA 3WALA 3R66C 2L32A 2ZNVC 2O2VB 2ZCBA 3TIXA 4MGIE 1CQVA 2DZIA 3M3JA 4ANVA 4ANWA 3AI5A 1SIFA 2MX2A 5IAAC 1SE4A 3DBLI 2UYZB 1C77A 1R4MB 4E74A 2GBNA 4MGZE 1N60A 3UI3A 3HK0A 2J0MA 2M0AA 4X57B 3DPDA 4JGHB 2LJIA 4J3OD 4LJPB 5LXIB 1Q1OA 3Q3FA 2SEBD 2MP2A 1S3SG 2BWES 4IUMB 2MRPA 3VRAB 2YEPB 1VZ8A 1KF6B 3HUIA 4P6VF 2JT4B 2NCNA 4US8A 3TUOA 1AN8A 2C7MB 1MI0A 1QT9A 2KX0A 2QSDA 2I38A 2CJOA 3GB1A 1FRDA 2GRIA 2HE7A 3C19A 2XBBC 5G2NA 2L05A 3ZRCA 4KSKC 2KN4A 4F1SA 4KIKB 4NNJB 3W1SA 3VQIA 2NS5A 2IPKD 2KFKB 4NQLB 4HJKA 2NTSA 1JWBD 5G5HA 3EHVA 4W9KA 1TS4A 3DBSA 2W54A 3L08A 1VZ7A 1SJED 3MJWA 1CMXB 3L16A 4M00A 4E71A 2BQQA 3Q8BA 4D2KA 1Q5WB 3AEDB 3Q8FA 1EM7A 1QQRA 3SHQA 2LVPA 1J7BA 3O13A 1N61A 2RR9A 4G50A 3NS8A 1P7EA 4B0EA 4MDKE 2KWUB 4FHKA 1K52A 2KC1A 2KMCA 1VRAB 3QQ8B 4FXCA 3IVFA 2K22A 1H8CA 4GOCA 1C79A 2KTRB 3DQVA 1MG4A 4IM2A 3V62A 4C56C 3Q8AA 2WXMA 5E6OA 1E0ZA 2INCC 2X38A 1WH3A 1V81A 1ROEA 5MPOA 5TSSA 1TS3A 1SB3C 3ZIMA 3AE6B 3J9CA 5DPWA 2LD9A 4BKSD 1KH0A 2O6VD 4B6WA 3RNGC 3SR6A 4PK1A 1GB1A 2R2QA 1XO3A 1E6EB 4W9DA 3A33B 4BOZB 2PE9A 3QCAA 1UELA 3EC8A 1TYGB 3ZXRA 4I6LB 3GP7A 2KYWA 5BO4B 4K81A 1Q0WB 4LLGM 2N9KA 2XNAC 3CWIA 2HTHA 1K8RB 2NBWB 3ZLZA 3DBRB 1E9MA 3I57A 4IG7B 5D94A 1YD8U 4KDLB 4IM0A 1SE3A 4YT0B 1SE9A 1FXTB 3DVGX 4RGMA 3NG0A 3I3TB 1ENFA 3ALBA 4M02A 5J17A 4TV3A 1T5XD 2V3PA 3ZUNA 2J0JA 1T3QA 5I4DA 2HJ1A 3I9V1 2JVCA 3VR9B 4KGSA 3WAMA 3IT4B 2LEKA 1WSPA 3GS2A 4DWFA 1YOVB 3KVFB 3W2DA 1WFYA 2A4ZA 1MJDA 2MWSB 3AEFB 2ON8A 2LVQA 3H7PA 3AULA 2BBCA 2NBUA 3ML9A 1E8XA 2V1YA 3N3KB 2LZ6A 1YNTE 3WAOA 4LTUA 3MC8A 3ZXVA 2KOXA 3UIPB 1KM7A 2GMIC 3DHHC 2LMCA 3N1ZC 1IBXB 1P98A 1K53A 1ISNA 4O1NA 4HDOA 3ENEA 5D3DA 2WWZA 1OGWA 3AE9B 3MFGA 3Q8EA 4MM3A 1TKGA 4YTMB 4RCOA 3TEYA 4ZYNA 2KDIA 2KLGA 4EFOA 3AE4B 4C80A 3RNAC 2CS4A 1ZGUB 1AWDA 1NENB 4KX6B 1TIFA 3V6EB 1GB4A 2L00B 1ET6A 5HFYA 2DWQA 2PTLA 3LXFA 1YJJA 1BUIC 1HQRD 1LXDA 2C9WB 2ZW0A 3BYTB 1MPEA 1WF9A 2BPSA 4XE0A 4RF1A 2WYQA 1WJUA 2MBBB 2DYMA 1QOAA 3M62B 2NVUI 3ZGZA 1KRHA 3QAQA 4EOYA 1GOZA 5AUIA 3V61A 3KUZA 2YVCA 1GG3A 2L3ZA 4NPNA 3P4RB 1ZW7A 4RH6A 4MH0E 2LHDA 3P4SB 4K3CA 3GOEA 3RNEC 3NVVA 3TL5A 5IKCM 1YQ4B 5CTRC 3E56A 3QWZB 2W3SA 2KTRA 3EECA 4KKIA 1V80A 4JL9A 3T8MA 3R8BA 1CJEA 3ZO5B 1QILA 1WR1A 1MHHE 1XLNA 4ANXA 1N6ZA 2FNJB 3RNCC 4ARCA 1V9JA 3MHSD 1VLBA 2LUMA 3BK2A 2KANA 3U30A 1SF0A 1EWCA 2GLSA 3PV1A 2JRHA 2XN9C 1WXSA 4LCDE 3M95A 4M01A 3T3OA 1QF6A 4XDDA 1XEEA 1JALA 1JW9D 1FNUA 1NVID 4BKTA 3ZJVA 2ZEQA 2LGYA 1NDDA 5L83A 1PDXA 1KLUD 4WAAA 2IBIB 3GE8C 1GAQB 4HK2A 4RM9A 1YMHE 3GZNB 2N7DA 4GB9A 2LGXA 1XCTL 3VTWA 2JXTA 3PLUA 3PSEB 4IKGA 4A8XC 1SIJA 3B0AA 3APDA 5HKHA 3BWUD 2E3TA 2WXQA 2RDGA 1UH6A 1WJNA 4C4VB 2BWFA 3IBEA 3CSFA 5C1ZA 2MBEA 2WXOA 5J2RA 3B08A 2IDYA 1PUTA 5CHVC 4L23A 3H1UA 1WE6A 2D3BA 2QILA 5BMHA 1FFVA 2K1FA 1I7HA 3EFUA 1HE8A 2REXA 3HVDA 4A55A 2DHZA 3OJ4B 2IY1B 1N5XA 1IGDA 2OJRA 2D3AA 1MVKA 2M4NA 3M63B 4M0WA 2FCQA 4RGOS 4B95A 5J18A 2I1JA 4M8MA 2I1KA 1FO4A 3X0WA 1HTQA 2FUHB 2H89B 2WNMA 2FCNA 2ZNVB 1YJ1A 2VH2A 4II2B 2GBJA 2KWCA 2MEKA 1F2RC 3JW0X 4HDQA 4DXFA 3R3MA 3A9KA 3PS6A 3B2FA 4C00A 1T6BX 3PLVA 1KJTA 3L4PA 4HVBA 1F1HA 3AM9A 1E7UA 1PGBA 1L0VB 2WXRA 2XK5A 2CHWA 4IC7B 3KWVA 3Q14C 1HEZE 3CF6E 2AX5A 1PQSA 3I63C 2ZCCA 1R4NI 1ZKHA 2WXLA 4RFBA 3UQAA 1K50A 2C7NB 3NUHB 2PIAA 2BYEA 3WIMA 4AP4C 2KMMA 2L0FA 1DOXA 4GXBA 4HRSA 4K1RB 1WGDA 5D7GA 3IHPC 1E10A 5EE1A 1WGRA 2L8JA 2KQ4X 2CHXA 1C4AA 1STEA 3R7QA 3H7SA 3QJZA 5EE0A 3PRZA 2DZJA 3ZKJC 4PT5A 2WS3B 5DPSA 4YXDB 1F2RI 4LNFA 4BBNF 2JY6A 4ICUA 4BFRA 3ZQ4A 1M94A 1F9JA 4GLSC 3AEEB 1UNSA 3BZDB 1V1PB 1QOGA 3N30A 4HROA 2N9EB 1WYGA 4FJVB 2PVGC 3KWLA 2JU6X 1G6JA 1JWMD 3RFZB 1NYRA 2KDEB 3KYCD 3HRDD 3K9OB 2W3RA 4PYZA 2IY0B 2QEJC 5FR3A 3Q2AC 3U8ZA 1L2NA 5JHAA 4LK0M 2OEDA 1F77A 3NJTA 2CHZA 4XX5A 5IN7A 4ZYSA 4OZCA 4AWJA 3RNBC 3VAWA 1I42A 4S0RA 1ZP0B 3Q3MC 2INDC 4KVGB 3GZNI 1ZE3D 1Q10A 3VUXA 4F7ZA 4XDCA 1C9FA 3U2SC 1BT0A 1JWAD 2LHEA 1GNUA 4ZRQA 3TSSA 2IO0B 3B9JA 2D07B 3ETRA 4W9EA 4GDLA 4KZ0A 3W5UB 4XYCA 4EZJA 3AXCA 3P4QB 4IDIA 4CO7A 3Q8CA 2K8BA 2QJLA 4IM3A 1L5PA 4I6PA 1RM6C 2N9PC 3TJPA 3SDLC 3IT6B 2IYDB 3CMMB 3V3XA 4NJ6A 4WJPA 2W9NA 4G3XB 3A1QB 1WWTA 1LO5D 4AJYB 2L0TA 2JXXA 2K8HA 2KC2A 4KGRA 4TQ1A 4HCNB 2JZ3B 1E8ZA 2PW9A 1WXVA 4FJZA 2J4XA 2BT6A 2Z59B 4IW0A 1TKEA 4A20A 2MBQA 1V6EA 2ACZB 2C7HA 1R7SA 2FCMA 2DBYA 1JWSD 1EU4A 3N32A 3AEBB 3UINB 3KUDB 3RPFC 5IOIA 1N63A 1JRUA 2LUEA 4OVVA 1I4GA 4MGKE 4OW0A 5FK9C 2L76A 3TBLD 3AE3B 4LNOA 1V97A 3W5VB 1FCLA 3P1MA 1IBXA 1UBQA 2JQRB 4JWSC 1KOTA 3N1YC 1DOIA 2D2QA 3EGRA 1P9DU 2K25A 5C3JB 2N7EA 3SFEB 2WXNA 1D5XC 2WDQB 2HJ8A 2PVOD 4YSYB 1YX6B 4JQWC 3DBHB 1VR9A 2CU1A 3RZFA 4MJSB 1D3ZA 4IOIE 1ZDVA 4MSMB 1WGKA 4HLEA 2V0GA 2Y3AA 5EDSA 4P1BC 1BXTA 3L13A 3PVLA 4HJGE 1WIAA 2RD0A 1C4PA 2MSED 1EUVB 4MEMA 2LRUA 5C23A 4A3OA 5HHDG 1C4CA 1FM0D 1RRBA 1Y56A 2NTTA 4TUUA 1C78A 1QZEA 3EA6A 3ONSA 1WXMA 1L0YB 3AEAB 3AV8A 4OZBA 1FRRA 1UUPA 4A90A 1ZPSA 2LXAA 3BYYB 5CHWA 4ZHOA 5L95C 1E5WA 1EF1A 4HKQA 4JPSA 4ASWC 3NZUA 2K9XA 3PZDA 1HTOA 3RYTA 4GU2A 4KKJA 2N9LA 3RUIB 1RWSA 2WDVB 3ZRFA 3PTFC 2IGGA 1YX5B 2M0XA 4B9KA 2AQ3B 1PGXA 2M8SA 3MTNB 2JWZA 3VUYA 1WM3A 3V05A 4XGAB 4GMVA 4J6IA 1ACCA 4TKNA 4REZA 3KW5B 1TJEA 1DYQA 3N20C 4YWGG 4CHKA 1WMHA 2BS3B 2CJNA 4L2YA 3LJ3A 3L10B 2RGFA 2K3UA 4N6EB 2Z0DB 4RNAA 4DBGA 1ZXIA 2FAZA 1SE2A 1N62A 2MBOA 2KX3A 1EO6A 3A4RA 1HA5A 3A9JA 1RLFA 2K6DB 2WDRB 4HXDA 2FUG1 4WJNA 2MJ3A 1HZ5A 1WGYA 3VH4B 1DGJA 2WX1A 3DVNU 1QOFA 3DWMA 1GPXA 4K3BA 1LQBA 2KLCA 4FULA 2D11A 2ZVOA 5HG2A 2O6VB 4OHJA 4EEWA 2KDMA 2Q5WD 1SXTA 4W9CA 4FA6A 1A5RA 4GN1A 1OQYA 4FBJB 1F0ZA 1RYJA 1L4DB 1T0YA 3T9LA 1YN4A 4M0WB 3JYUA 2J42A 1LFDA 1NI3A 1NYQA 3FILB 1SEBD 2JF5A 4G0NB 2A5UA 4W9HA 3AEGB 3H8HA 2X8XX 2D5GA 5E6NA 4DHZE 5AUKA 4UDUC 1GC7A 1UGMA 4MM3B 1J19A 1WXQA 3NZSA 4XZ4A 3ZYYX 2XK5B 2DAFA 3I5JC 4YL8A 4NQKE 1FNVA 2ZPYA 5AZFA 2TSSA 2BYTA 3DDCB 4W9IA 4XWWA 1KLGD 2BW2A 3VRBB 4URKA 1H4RA 4JWUC 2EKIA 3R2TA 4P7IA 1V5TA 3VHTC 4GSWA 4DDGD 1FNWA 2JRIB 1FPYA 2HTME 3PREA 2D3CA 2J53A 2OJWA 2H88B 4XC2A 4AS1A 4OVZA 4IWPA 2Y5BB 1P7FA 4ZRJA 2LWPA 1IYFA 2KKCA 3FILA 2FIDA 1VDVA 2KJRA 4KIKA 2C5LC 4ZRPA 1R4MI 4K7WA 4BOSC 4GIVA 4P16A 2V9HA 3R7RA 1I4XA 4AUQC 3FKYA 3OG5A 2PEAA 1QLBB 1WRDB 3PPAA 1L4ZB 1WZ0A 2WXFA 1AW7A 4W9JA 1PFDA 1AARA 4F8CB 2FIFA 1VD2A 2KK8A 2WQYB 3OAWA 3QC8B 3ZNZB 3TEXA 2GBRA 3ZNGC 2BS2B 2JZPA 4RGTA 3VTUA 3EUB2 1TS2A 1J7CA 1HZ6A 2IO2B 3AE5B 3LYYA 3SEBA 1E90A 4WWMA 3KQ4A 2Y5PA 4W9GA 3ABVB 1HXYD 5BMIA 4MELA 3Q3OC 2ZW1A 2WU2B 3P63A 2LJ5A 4BAXA 4HWIB 1DOYA 4US9A 3MC9A 3QARA 5FR6A 3TEWA 5GXGB 3QX1A 1OEYJ 2DYOA 1V1OA 2J0KA 2N0SB 2G1EA 4FHJA 2KVRA 2BTEA 1UGJA 2ZZPB 4ICVA 3GE3C 2C60A 1OFFA 2ICIA 1WZ3A 1VJKA 4H2AA 3VTVA 3JSVB 2YEPF 2RDHA 1V8CA 1YIWA 4MSQB 2SAKA 4LNKA 3NHEB 3B1LX 3MHZA 2Y5CA 3ZNID 2KJHB 4N58A 3PZ7A 5C2TB 1B1ZA 5IP4D 1S1QB 4WJOA 3ZTCA 1ZOYB 2K5PA 3ZDMC 1L6VA 4PYUA 4DDID 3PO0A 2AL6A 3ZVVA 3PHXB 4EUTA 4AQ7A 4HEA1 1TKYA 2QHOA 2MCNB 1IP9A 3BIID 1YN3A 3H6NA 1R4NB 2OOBB 3ZJUA 2CKHB 2LRWA 2KNBA 4KDIC 2K0PA 2KHWB 3Q6BA 3S2AA 3SU8X 4ARIA 2FE8A 5E6PA 5BYRA 2DZMA 2KDBA 1IGCA 4YSXB 3H9DA 2FCSA 2RPVA 2MA9B 2WGSA 3RD2A 3UIOB 2I2YA 3JSVA 2WXKA 2DENB 1FD6A 1XLPA 3VUWA 2FBWB 1SJHD 2DAJA 2INPE 3EFCA 4MH8A 1UZXB 1NI2A 5LLIA 2KN5A 2KTFA 4A6QA 1C3TA 3AECB 1WM2A 1D5MC 1OQQA 3BY4B 2R2OA 3B2GA 3DCGA 3U7DA 4DHJB 4BVUC 4NY0A 3IG3A 1I35A 4E3CA 2NPTB 4B0MA 3VDZA 2GI9A 4RMAA 1J8CA 4MJSA 2LXCA 3TCAA 1YJIA 1TY2A 2QC8A 4ZRKA 4ZRIA 1F52A 4S17A 2AQ2B 3VVWB 1FCCC 1JMLA 3A9KB 3DWGC 1Y8RC 2BYFA 5EE3A 2GBMA 3Q69A 5AEKB 1K51A 4OVUA 1MFWA 2UU7A 1P3QU 2KMAA 3WCQA 2LFIA 1CZPA 5IO9A 4TSSA 3AN1A 2KQSA 3C8YA 3LDZE 4BKSA 3UQBA 2DLBA 4DXAB 3V60A 1XLQA 3AE8B 3P4PB 1TS5A 4ZHPA 1V2YA 1MG8A 3WAPA 4WQOB 4M8NA 2D10A 1J7AA 2UWQA 3RMKC 3SD5A 2PKOA 3W1YA 4JIOU 3RI7C 3RT3B 1E8YA 3AE7B 1TBEA 3QHTA 4I6NB 2WXJA 4G11A 2DZKA 1WY8A 1V86A 2EELA 2MW5A 3ML8A 2NR2A 4FADA 4EKUA 4LNNA 4LDTD 2B76B 3ZJTA 5D3IB 4EZKA 3APCA 2Z0EB 2ONQA 4WWPA 2RPQA 3KYDD 1WRIA 2WXIA 2K6QA 2MQJA 1E7VA 3WA0A 3MC0B 2WLBA 3HM6X 3TEZA 2LGIA 2KT7A 2INNE 5G55A 1A70A 2AL3A 1IPGA 5EE9A 1XT9B 1GJZA 4L1BA 4W9FA 3D32A 3JVZX 2KZRA 4K7SA 3DVGY 1OEYA 3AH7A 4YSZB 3DOWA 3L0WB 1VCBA 4QAYA 2M1MA 2IO3B 4MACA 2DNFA 2JSVX 2JX5A 3KLSX 2OHFA 5AZGA 2KVZA 1EU3A 1RFAA 1QKZA 1EF5A 3AE1B 4NAWB 2RDBC 3HM3A 2PLPA 1WX9A 1XQQA 4PS3A 1FIQA 3N9YC 4ZOHC 2LGDA 1TZOA 3AE2B 2QDFA 2WDTB 1EWYC 3AMZA 4PS8A 1L6UA 2EMTA 1X1MA 4AOFA 2LGSA 3W1SC 2KJ6A 2L52A 4WQMA 1TGZB 3A1QA 3LB8C 4ANUA 4XWTA 2MJDA 2PJHA 5IA7A 2KQ7A 1L0XB 2NBVB 4ITKA 1E7PB 1XF5L 3IAS1 2G9HD 2GB1A 2MP2B 3X23A 2V3NA 3PZ8A 1XCQL 3AU5A 1LM8B 5KHOA 4BZAA 1OQRA 4CQNA 3NVZA 2RSUA 3HIZA 4ZDVA 4YTNB 4GDKB 3NZ3A 4NAWA 2WXPA 3Q3NC 4KV2A 2YLMA 5JHBA 4NZLB 2HD5B 3KUCB 1C1YB 2ASQA 2G4SA 2W55A 3ZDTA 2EKEC 3PT2B 3N1XC 1UWMA 4JE3B 5JH5C 5CX3A 2WX0A 3DBRI 2L1AA 5T8IA 3RULA 4Q2JA 3RCZA 2LASA 1QOBA 4IWQA 3CIRB 3IFWB 1WXAA 1PGAA 2B3AA 4LDTB 1JRPA 3W9CB 1YN5A 4BKGA 3RNFC 3O65B 4HCPB 1V5OA 2MLBA 2R61A 2BF8B 4KSLC 4IWOA 1WGHA 2N4FA 4FLHA 3A4SC 5D2MB 3BVZA 1WJ6A 2M56B 1ESFA 2V4IB 2BGFA 4PS7A 2JPHA 1E8WA 3AB5A 3BINA 4GGQA 2DYBA 4NAMA 4EZLA 1ZXHA 3PHWB 4GDKA 2VZKB 5G5GA 4CYEA 4LJOB 1BMLC 1D6EC 3VH3B 2BKFA 4HPLB 5DPRA 2XEWA 4HKZE 4RF0A 2DX5B 1D4BA 2BYVE 2JYEA 3WANA 4A9AA 2KO3A 3MP9A 2KWVB 3NVWA 4N59A 1XXGA 3AU4A 4FN2A 2KDFB 4DHJD 1UF0A 1FEHA 4HPMB 2PE6B 2BB5A 4EE2A 1XD3B 1TTNA 1FFUA 3K9PB 2LVOA 2RMMA 3VXWA 1TZ1A 4LNIA 2K8CA 1WI0A 2N1VA 3FAHA 3SFDB 3QIJA 2G3QB 3A9JB 1SGHA 1YQBA 1JCKB 1PYWD 5GMVA 2G45B 3C0RB 2BB6A 2WP9B 1OTRB 1I4PA 3ZW3A 3VR8B 4DK5A 2PMVA 1RAXA 4KGTA 4WURA 3NRZA 5FKAC 2N7JA 1VZ6A 2MBHA 4II3B 4ACFA 5LNK1 2JZZA 4WAFA 3APFA 2QCZA 4NJCA 3OWEB 2NPTA 5KHQA 2IGDA 3IAM1 3HVZA 2KFJA 1B9RA 5H8YE 3ECIA 3QA8A 1WMHB 4HPPA 2J7QB 2MJEA 4TMAB 3Q3JA 1T0QC 2ZPNA 2Z8LA 2HDEA 3P2BA 1M4VA 1JWUD 1N5WA 1UD7A 2IO1B 3PRPB 3H7PB 2CR5A 1FXAA 1SSNA 2JUOA 5DCNA 3BVGA 3IXSA 2M17A 3NY5A 1MHXA 2O2VA 3MJ5A 4R3DA 3QK0A 5D6JB 2VH1A 4RM8A 1RFKA 4W9LA 2W82A 3DBLB 3RN9C 2L83A 3TMPB 2BKRB 5LXHA 3CSTA 2BS4B 2LI5A 3NOBA 4KZCA 4N9F4 4JLCA 1Z2MA 4NJ7A 4TQ0A 1UBIA 3U7ZA 2IJ0A 2AYOB 1WJ4A 1I4RA 2ZVNA 3DHGC 1V49A 3DVNV 1KLVA 1U4AA 3KH0A 1TY0A 4C7ZA 4DXGA 1XLOA 3BVMA 3T3NA 1GC6A 2BVCA 2V4LA 4AJWA 1YQ3B 5CHFA 4WH4A 1AYFA 1JROA 2N9XA 4K7UA 3U4EG 2KXJA 2PPHA 2J52A 2JWUA 1JQ4A 3OLMD 3PGEA 1WR6E 2K39A 2WXGA 2KAJA 4WWNA 1NEKB 2ZJDA 5E6JA 4JX1C 1WX8A 2JYTA 4RGNA 1WYWB 2QMTA 2KFKA 4YTPB 1T0RC 1P0RA 4WJQA 2VRRB 2IGHA 3NVYA 2QIEB 1KFYB 1UWXA 5BMGA 3UGBB 4GDLB 2N1WA 2L7RA 1I4HA 1V1PA 3R2IA 5JXVA 5AZHA 3HHMA 2V3SA 5DPTA 4DHZB 1SBBB 5H92C 3UF8A 4C7YA 4BBNC 3VFKA
chains in the Genus database with same CATH topology
1SF0A 1EWCA 2AQ3B 5BYSA 1PGXA 2XN9C 2WU5B 2E6XA 3FC4A 4WIPA 5BYQA 3T3OA 1QF6A 4XDDA 1XEEA 1JALA 3V05A 1ZDXA 1JW9D 4OZAA 2B76B 3ZJTA 5D3IB 1FNUA 1NVID 1CK1A 3ZJVA 2VZKD 2CU3A 2ONQA 1ACCA 1PDXA 2NMQA 1KLUD 2KWDA 4REZA 1TJEA 1C76A 1DYQA 1FMAD 1WRIA 2WXIA 2WXHA 4YWGG 2BS3B 2CJNA 1KTKA 1GAQB 4L2YA 4MT5A 1YMHE 3MC0B 3BK1A 5HI1A 2WLBA 3TEZA 2LGIA 3URYA 1XCTL 2INNE 2K3UA 4N6EB 2JXTA 4RNAA 1IUEA 1A70A 1ZXIA 4IKGA 4A8XC 1SE2A 1SIJA 5EE9A 3BWUD 2E3TA 4L1BA 1N62A 2WXQA 2MH7A 1HA5A 2RDGA 2WDRB 3NS1A 4USAA 2FUG1 2MJ3A 1HZ5A 3AH7A 4YSZB 1DGJA 3P42A 2M19A 1QOFA 2WXOA 3DWMA 1GPXA 4MACA 2IDYA 2AQ1B 1PUTA 4L23A 2JSVX 2JX5A 3KLSX 1ZUD2 2OHFA 2KACA 1FXIA 1EU3A 2QILA 5BMHA 5HG2A 1QKZA 1ET9A 1FFVA 4OHJA 3AE1B 4NAWB 2KDMA 1D5ZC 2Q5WD 1I7HA 1SXTA 2PLPA 3E9SA 1FIQA 3N9YC 4DQOC 4ZOHC 3HVDA 3U52E 4A55A 1I4QA 1TZOA 1N5XA 1IGDA 1F0ZA 3AE2B 2L32A 1RYJA 1L4DB 1YN4A 1MVKA 1CQVA 4M0WA 4RGOS 2J42A 1NI3A 1FO4A 1EWYC 1NYQA 3AMZA 3FILB 1L6UA 1SEBD 1SE4A 1C77A 2H89B 2L52A 2WNMA 4WQMA 1N60A 3UI3A 2M0AA 2MEKA 1F2RC 3AEGB 3H8HA 3LB8C 2D5GA 4XWTA 2MJDA 4DXFA 3B2FA 5AUKA 4UDUC 1L0XB 4MM3B 1T6BX 2LJIA 4ITKA 4J3OD 1E7PB 1XF5L 1WXQA 3IAS1 3L4PA 3AM9A 1PGBA 2SEBD 2G9HD 1L0VB 2GB1A 3ZYYX 2WXRA 3VRAB 2YEPB 1VZ8A 2V3NA 3PZ8A 1XCQL 1KF6B 3KWVA 3HUIA 4P6VF 1FNVA 1HEZE 2AX5A 2TSSA 4US8A 3TUOA 1AN8A 1OQRA 2BYTA 4CQNA 1MI0A 1QT9A 4XWWA 3NVZA 1KLGD 2BW2A 3VRBB 2WXLA 4JWUC 4RFBA 2QSDA 4YTNB 1K50A 2I38A 2CJOA 4GDKB 3NZ3A 3NUHB 2EKIA 2PIAA 3R2TA 2WXPA 2KMMA 1DOXA 3GB1A 4HRSA 1FRDA 2GRIA 1FNWA 4NZLB 5D7GA 2HTME 1E10A 2W55A 5EE1A 2J53A 2KQ4X 2H88B 1UWMA 4JE3B 1C4AA 4AS1A 1STEA 4OVZA 1P7FA 5EE0A 2KN4A 3FILA 1VDVA 2L1AA 5T8IA 3W1SA 4PT5A 2WS3B 4Q2JA 4ZRPA 4YXDB 3VQIA 2IPKD 1QOBA 1F2RI 3CIRB 2NTSA 1JWBD 4P16A 5G5HA 1PGAA 3ZQ4A 1TS4A 2W54A 1I4XA 1SJED 1VZ7A 1JRPA 3W9CB 1YN5A 4GLSC 3AEEB 1QLBB 3Q8BA 4D2KA 2R61A 1L4ZB 1UNSA 2WXFA 3BZDB 3AEDB 3Q8FA 1EM7A 1AW7A 1V1PB 1QOGA 1PFDA 3BVZA 1QQRA 2M56B 1ESFA 4HROA 1J7BA 1WYGA 2V4IB 3O13A 1N61A 2PVGC 3KWLA 2WQYB 2JU6X 3TEXA 3AB5A 1JWMD 2JZPA 1P7EA 2BS2B 4RGTA 4B0EA 3RFZB 1NYRA 1K52A 3EUB2 3HRDD 1TS2A 2W3RA 1VRAB 4NAMA 1J7CA 4FXCA 1ZXHA 1HZ6A 2K22A 2QEJC 5FR3A 1C79A 2VZKB 3AE5B 3LYYA 3SEBA 5G5GA 4WWMA 4C56C 1BMLC 1D6EC 3Q8AA 2WXMA 2Y5PA 3KQ4A 3ABVB 2X38A 4LK0M 1E0ZA 1HXYD 5BMIA 2OEDA 1F77A 2ZW1A 2WU2B 4HKZE 4RF0A 1D4BA 1ROEA 2JYEA 3P63A 4A9AA 3MP9A 4ZYSA 5MPOA 4OZCA 5TSSA 3NVWA 4N59A 1TS3A 1XXGA 1DOYA 1ZP0B 1SB3C 3AE6B 4US9A 3J9CA 1FEHA 2BB5A 4EE2A 3TEWA 5GXGB 1ZE3D 1FFUA 1KH0A 1Q10A 2RMMA 3SR6A 2DYOA 1V1OA 1XO3A 4XDCA 1C9FA 2N0SB 2G1EA 1GB1A 1E6EB 3U2SC 1JWAD 2BTEA 2LHEA 1UGJA 1TYGB 4ZRQA 3FAHA 1OFFA 3SFDB 3TSSA 2ICIA 3B9JA 3ETRA 3GP7A 1VJKA 4H2AA 2YEPF 1JCKB 2RDHA 1V8CA 1PYWD 3W5UB 4LLGM 2N9KA 2XNAC 3CWIA 3P4QB 4IDIA 2BB6A 2WP9B 2SAKA 3Q8CA 1I4PA 3MHZA 2QJLA 1L5PA 2Y5CA 3VR8B 4N58A 2PMVA 1RM6C 4KGTA 4WURA 1E9MA 3PZ7A 3I57A 3NRZA 3IT6B 5FKAC 2N7JA 5C2TB 1B1ZA 1VZ6A 3V3XA 1ZOYB 4YT0B 1SE3A 5LNK1 2K5PA 1WWTA 1L6VA 1LO5D 4RGMA 4WAFA 1ENFA 3PO0A 4NJCA 4AQ7A 1T5XD 3OWEB 2V3PA 4HEA1 1TKYA 2IGDA 3BIID 3IAM1 1T3QA 3HVZA 4KGRA 4TQ1A 5I4DA 3I9V1 1YN3A 1B9RA 5H8YE 3VR9B 4KGSA 3ZJUA 3IT4B 2LEKA 2PW9A 1WSPA 2MJEA 4TMAB 3GS2A 2J4XA 2K0PA 2BT6A 3W2DA 2Z8LA 2HDEA 4ARIA 1TKEA 2FE8A 1M4VA 2ACZB 5BYRA 1JWUD 1R7SA 1N5WA 2DBYA 3AEFB 1JWSD 1IGCA 2ON8A 1EU4A 3AEBB 4YSXB 2BBCA 2RPVA 3RPFC 1FXAA 1SSNA 1N63A 2I2YA 3BVGA 1I4GA 3IXSA 2WXKA 4OW0A 1MHXA 5FK9C 1FD6A 3AE3B 1XLPA 3MJ5A 4R3DA 1YNTE 2FBWB 4LTUA 1V97A 1SJHD 3W5VB 1RFKA 1FCLA 3P1MA 2W82A 2INPE 4MH8A 1IBXA 2LMCA 2L83A 1IBXB 2JQRB 2BS4B 1K53A 4JWSC 4O1NA 4A6QA 1DOIA 3EGRA 5D3DA 3AECB 3AE9B 5C3JB 1D5MC 3MFGA 4TQ0A 1OQQA 3Q8EA 3SFEB 3U7ZA 2WXNA 2IJ0A 3B2GA 1TKGA 1D5XC 1I4RA 4YTMB 4RCOA 3TEYA 2WDQB 2PVOD 4B0MA 4YSYB 2GI9A 1VR9A 3AE4B 4IOIE 1ZDVA 4C80A 1AWDA 1NENB 1TY0A 1WGKA 4KX6B 4DXGA 4C7ZA 1YJIA 1GB4A 1TY2A 2V0GA 1XLOA 1ET6A 5HFYA 2DWQA 2PTLA 2Y3AA 3LXFA 1YJJA 1BUIC 3BVMA 3T3NA 2AQ2B 1HQRD 1BXTA 1FCCC 1JMLA 2ZW0A 3BYTB 3DWGC 1MPEA 5EE3A 4XE0A 1YQ3B 3Q69A 4WH4A 1AYFA 1K51A 1JROA 4RF1A 4HJGE 3U4EG 1C4PA 2DYMA 1QOAA 3WCQA 2LFIA 2J52A 2JWUA 1JQ4A 1CZPA 3ZGZA 5HHDG 1C4CA 4TSSA 1KRHA 1FM0D 3AN1A 2WXGA 1GOZA 5AUIA 2KAJA 1NEKB 1Y56A 2NTTA 5E6JA 3C8YA 1C78A 4JX1C 2DLBA 3EA6A 2JYTA 3P4RB 1L0YB 3AEAB 3AV8A 4OZBA 4RGNA 1FRRA 1UUPA 2LHDA 3P4SB 4RH6A 4A90A 1ZPSA 3NVVA 2QMTA 1YQ4B 1XLQA 3BYYB 3AE8B 4YTPB 4ZHOA 3P4PB 1TS5A 3E56A 4ZHPA 2W3SA 4HKQA 4KKIA 1J7AA 2IGHA 4JPSA 3NVYA 3R8BA 1CJEA 1QILA 2K9XA 1KFYB 1UWXA 2QIEB 2PKOA 5BMGA 1MHHE 1XLNA 4GDLB 1I4HA 1V1PA 3R2IA 5JXVA 3AE7B 4KKJA 2N9LA 4ARCA 2WXJA 1VLBA 1RWSA 2WDVB 1SBBB 5H92C 2LUMA 3BK2A 4C7YA 2IGGA 2EELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P1M A;  5AUK A;  1SF0 A;  1ROE A;  3P63 A;  4A9A A;  5MPO A;  4ITK A;  1E7P B;  2L83 A;  2WU5 B;  3NVW A;  4N59 A;  1WXQ A;  2JQR B;  3FC4 A;  1ZP0 B;  3L4P A;  3AM9 A;  1SB3 C;  2BS4 B;  1DOY A;  3AE6 B;  4US9 A;  1QF6 A;  1L0V B;  1JAL A;  4JWS C;  3ZYY X;  1JW9 D;  1DOI A;  2B76 B;  3VRA B;  5GXG B;  1NVI D;  1FFU A;  3AEC B;  3AE9 B;  1KF6 B;  3SR6 A;  3HUI A;  4P6V F;  5C3J B;  1XO3 A;  2CU3 A;  1OQQ A;  2N0S B;  2G1E A;  3SFE B;  1E6E B;  2AX5 A;  3B2G A;  4US8 A;  1OQR A;  1JWA D;  1PDX A;  1TKG A;  4YTM B;  1TJE A;  1QT9 A;  1FMA D;  1TYG B;  1WRI A;  3NVZ A;  2WDQ B;  3FAH A;  1OFF A;  2PVO D;  3VRB B;  2BS3 B;  2CJN A;  4YSY B;  3SFD B;  3B9J A;  4JWU C;  1GAQ B;  3ETR A;  4YTN B;  1VJK A;  2CJO A;  1V8C A;  2EKI A;  2PIA A;  3AE4 B;  2KMM A;  4C80 A;  3W5U B;  4HRS A;  2WLB A;  1DOX A;  1FRD A;  1AWD A;  1NEN B;  1WGK A;  4KX6 B;  4C7Z A;  4N6E B;  1YJI A;  3CWI A;  1XLO A;  1IUE A;  1A70 A;  1ZXI A;  2DWQ A;  2WP9 B;  3LXF A;  3P4Q B;  4IDI A;  1SIJ A;  1YJJ A;  2HTM E;  1E10 A;  2W55 A;  5EE1 A;  5EE9 A;  2QJL A;  2E3T A;  1L5P A;  1UWM A;  2H88 B;  1N62 A;  2Y5C A;  3VR8 B;  4N58 A;  2MH7 A;  1RM6 C;  3DWG C;  5EE3 A;  5EE0 A;  1E9M A;  2WDR B;  3NRZ A;  1YQ3 B;  3NS1 A;  1AYF A;  5C2T B;  4USA A;  1JRO A;  1VDV A;  2WS3 B;  2MJ3 A;  4YXD B;  3AH7 A;  1ZOY B;  4YT0 B;  1QOA A;  1QOB A;  2K5P A;  3WCQ A;  4YSZ B;  1WWT A;  3CIR B;  1DGJ A;  1CZP A;  1JQ4 A;  1L6V A;  2M19 A;  1JWB D;  1QOF A;  3DWM A;  5G5H A;  1GPX A;  1KRH A;  1FM0 D;  3AN1 A;  1PUT A;  2JX5 A;  2W54 A;  3PO0 A;  1ZUD 2;  5AUI A;  2KAJ A;  1NEK B;  1JRP A;  3W9C B;  1TKY A;  2OHF A;  4JX1 C;  3AEE B;  1FXI A;  3BII D;  1T3Q A;  3HVZ A;  1QLB B;  3P4R B;  1B9R A;  3AV8 A;  1FFV A;  3AEA B;  5H8Y E;  1FRR A;  3P4S B;  3AE1 B;  3VR9 B;  3AED B;  2LEK A;  2Q5W D;  3NVV A;  1I7H A;  2MJE A;  1YQ4 B;  1FIQ A;  1XLQ A;  3AE8 B;  4ZOH C;  4YTP B;  4ZHO A;  1QOG A;  3P4P B;  1PFD A;  4ZHP A;  2BT6 A;  2W3S A;  2M56 B;  4HRO A;  1N5X A;  1F0Z A;  1J7B A;  1TKE A;  1WYG A;  3AE2 B;  1J7A A;  1N61 A;  1RYJ A;  2PVG C;  2WQY B;  3KWL A;  2ACZ B;  1R7S A;  3NVY A;  1N5W A;  1CJE A;  2DBY A;  3AB5 A;  2BS2 B;  3AEF B;  1NI3 A;  1KFY B;  2K9X A;  1NYR A;  2PKO A;  2QIE B;  1EWY C;  1NYQ A;  3AEB B;  3AMZ A;  1L6U A;  1FO4 A;  4YSX B;  1XLN A;  3EUB 2;  3HRD D;  3RPF C;  1FXA A;  2W3R A;  1J7C A;  1N63 A;  4FXC A;  2K22 A;  3AE7 B;  2H89 B;  2L52 A;  3AE5 B;  5G5G A;  4WQM A;  1VLB A;  4WWM A;  1RWS A;  3AE3 B;  2WDV B;  1N60 A;  1XLP A;  3AEG B;  5H92 C;  1E0Z A;  3ABV B;  3LB8 C;  4C7Y A;  2FBW B;  2MJD A;  4LTU A;  2WU2 B;  1V97 A;  3W5V B;  1RFK A;  3B2F A; 
#chains in the Genus database with same CATH topology
 5JZE B;  2WHI A;  5BYS A;  2AEH A;  2WU5 B;  2E6X A;  3FC4 A;  4WIP A;  5BYQ A;  3PRM B;  1L7Y A;  1ZDX A;  4OZA A;  2KD0 A;  3DBH I;  1CK1 A;  2VZK D;  2CU3 A;  4P1C C;  2GBK A;  2KWD A;  2NMQ A;  1C76 A;  1FMA D;  2WXH A;  3OJ3 A;  2MHJ A;  1NBF C;  1KTK A;  1WX7 A;  4MT5 A;  3BK1 A;  5HI1 A;  1P1A A;  3URY A;  1TT5 B;  1IUE A;  3L17 A;  1WE7 A;  2D3G A;  4WWO A;  2MH7 A;  1Z5S B;  3L54 A;  3NS1 A;  1T0S C;  4USA A;  4C4V A;  4A3P A;  4FJY A;  1J0G A;  3P42 A;  2M19 A;  2AWT A;  2AQ1 B;  3DHI C;  3ZNH B;  1GUA B;  1LGR A;  1ZUD 2;  1WGG A;  2EMS A;  2KAC A;  1FXI A;  2IZV B;  2O6V A;  3RZW C;  3V6C B;  1ET9 A;  4MGY E;  1D5Z C;  5TR5 A;  3E9S A;  4DQO C;  2G4D B;  3U52 E;  2GOW A;  1I4Q A;  3ZTD A;  3WAL A;  3R66 C;  2L32 A;  2ZNV C;  2O2V B;  2ZCB A;  3TIX A;  4MGI E;  1CQV A;  2DZI A;  3M3J A;  4ANV A;  4ANW A;  3AI5 A;  1SIF A;  2MX2 A;  5IAA C;  1SE4 A;  3DBL I;  2UYZ B;  1C77 A;  1R4M B;  4E74 A;  2GBN A;  4MGZ E;  1N60 A;  3UI3 A;  3HK0 A;  2J0M A;  2M0A A;  4X57 B;  3DPD A;  4JGH B;  2LJI A;  4J3O D;  4LJP B;  5LXI B;  1Q1O A;  3Q3F A;  2SEB D;  2MP2 A;  1S3S G;  2BWE S;  4IUM B;  2MRP A;  3VRA B;  2YEP B;  1VZ8 A;  1KF6 B;  3HUI A;  4P6V F;  2JT4 B;  2NCN A;  4US8 A;  3TUO A;  1AN8 A;  2C7M B;  1MI0 A;  1QT9 A;  2KX0 A;  2QSD A;  2I38 A;  2CJO A;  3GB1 A;  1FRD A;  2GRI A;  2HE7 A;  3C19 A;  2XBB C;  5G2N A;  2L05 A;  3ZRC A;  4KSK C;  2KN4 A;  4F1S A;  4KIK B;  4NNJ B;  3W1S A;  3VQI A;  2NS5 A;  2IPK D;  2KFK B;  4NQL B;  4HJK A;  2NTS A;  1JWB D;  5G5H A;  3EHV A;  4W9K A;  1TS4 A;  3DBS A;  2W54 A;  3L08 A;  1VZ7 A;  1SJE D;  3MJW A;  1CMX B;  3L16 A;  4M00 A;  4E71 A;  2BQQ A;  3Q8B A;  4D2K A;  1Q5W B;  3AED B;  3Q8F A;  1EM7 A;  1QQR A;  3SHQ A;  2LVP A;  1J7B A;  3O13 A;  1N61 A;  2RR9 A;  4G50 A;  3NS8 A;  1P7E A;  4B0E A;  4MDK E;  2KWU B;  4FHK A;  1K52 A;  2KC1 A;  2KMC A;  1VRA B;  3QQ8 B;  4FXC A;  3IVF A;  2K22 A;  1H8C A;  4GOC A;  1C79 A;  2KTR B;  3DQV A;  1MG4 A;  4IM2 A;  3V62 A;  4C56 C;  3Q8A A;  2WXM A;  5E6O A;  1E0Z A;  2INC C;  2X38 A;  1WH3 A;  1V81 A;  1ROE A;  5MPO A;  5TSS A;  1TS3 A;  1SB3 C;  3ZIM A;  3AE6 B;  3J9C A;  5DPW A;  2LD9 A;  4BKS D;  1KH0 A;  2O6V D;  4B6W A;  3RNG C;  3SR6 A;  4PK1 A;  1GB1 A;  2R2Q A;  1XO3 A;  1E6E B;  4W9D A;  3A33 B;  4BOZ B;  2PE9 A;  3QCA A;  1UEL A;  3EC8 A;  1TYG B;  3ZXR A;  4I6L B;  3GP7 A;  2KYW A;  5BO4 B;  4K81 A;  1Q0W B;  4LLG M;  2N9K A;  2XNA C;  3CWI A;  2HTH A;  1K8R B;  2NBW B;  3ZLZ A;  3DBR B;  1E9M A;  3I57 A;  4IG7 B;  5D94 A;  1YD8 U;  4KDL B;  4IM0 A;  1SE3 A;  4YT0 B;  1SE9 A;  1FXT B;  3DVG X;  4RGM A;  3NG0 A;  3I3T B;  1ENF A;  3ALB A;  4M02 A;  5J17 A;  4TV3 A;  1T5X D;  2V3P A;  3ZUN A;  2J0J A;  1T3Q A;  5I4D A;  2HJ1 A;  3I9V 1;  2JVC A;  3VR9 B;  4KGS A;  3WAM A;  3IT4 B;  2LEK A;  1WSP A;  3GS2 A;  4DWF A;  1YOV B;  3KVF B;  3W2D A;  1WFY A;  2A4Z A;  1MJD A;  2MWS B;  3AEF B;  2ON8 A;  2LVQ A;  3H7P A;  3AUL A;  2BBC A;  2NBU A;  3ML9 A;  1E8X A;  2V1Y A;  3N3K B;  2LZ6 A;  1YNT E;  3WAO A;  4LTU A;  3MC8 A;  3ZXV A;  2KOX A;  3UIP B;  1KM7 A;  2GMI C;  3DHH C;  2LMC A;  3N1Z C;  1IBX B;  1P98 A;  1K53 A;  1ISN A;  4O1N A;  4HDO A;  3ENE A;  5D3D A;  2WWZ A;  1OGW A;  3AE9 B;  3MFG A;  3Q8E A;  4MM3 A;  1TKG A;  4YTM B;  4RCO A;  3TEY A;  4ZYN A;  2KDI A;  2KLG A;  4EFO A;  3AE4 B;  4C80 A;  3RNA C;  2CS4 A;  1ZGU B;  1AWD A;  1NEN B;  4KX6 B;  1TIF A;  3V6E B;  1GB4 A;  2L00 B;  1ET6 A;  5HFY A;  2DWQ A;  2PTL A;  3LXF A;  1YJJ A;  1BUI C;  1HQR D;  1LXD A;  2C9W B;  2ZW0 A;  3BYT B;  1MPE A;  1WF9 A;  2BPS A;  4XE0 A;  4RF1 A;  2WYQ A;  1WJU A;  2MBB B;  2DYM A;  1QOA A;  3M62 B;  2NVU I;  3ZGZ A;  1KRH A;  3QAQ A;  4EOY A;  1GOZ A;  5AUI A;  3V61 A;  3KUZ A;  2YVC A;  1GG3 A;  2L3Z A;  4NPN A;  3P4R B;  1ZW7 A;  4RH6 A;  4MH0 E;  2LHD A;  3P4S B;  4K3C A;  3GOE A;  3RNE C;  3NVV A;  3TL5 A;  5IKC M;  1YQ4 B;  5CTR C;  3E56 A;  3QWZ B;  2W3S A;  2KTR A;  3EEC A;  4KKI A;  1V80 A;  4JL9 A;  3T8M A;  3R8B A;  1CJE A;  3ZO5 B;  1QIL A;  1WR1 A;  1MHH E;  1XLN A;  4ANX A;  1N6Z A;  2FNJ B;  3RNC C;  4ARC A;  1V9J A;  3MHS D;  1VLB A;  2LUM A;  3BK2 A;  2KAN A;  3U30 A;  1SF0 A;  1EWC A;  2GLS A;  3PV1 A;  2JRH A;  2XN9 C;  1WXS A;  4LCD E;  3M95 A;  4M01 A;  3T3O A;  1QF6 A;  4XDD A;  1XEE A;  1JAL A;  1JW9 D;  1FNU A;  1NVI D;  4BKT A;  3ZJV A;  2ZEQ A;  2LGY A;  1NDD A;  5L83 A;  1PDX A;  1KLU D;  4WAA A;  2IBI B;  3GE8 C;  1GAQ B;  4HK2 A;  4RM9 A;  1YMH E;  3GZN B;  2N7D A;  4GB9 A;  2LGX A;  1XCT L;  3VTW A;  2JXT A;  3PLU A;  3PSE B;  4IKG A;  4A8X C;  1SIJ A;  3B0A A;  3APD A;  5HKH A;  3BWU D;  2E3T A;  2WXQ A;  2RDG A;  1UH6 A;  1WJN A;  4C4V B;  2BWF A;  3IBE A;  3CSF A;  5C1Z A;  2MBE A;  2WXO A;  5J2R A;  3B08 A;  2IDY A;  1PUT A;  5CHV C;  4L23 A;  3H1U A;  1WE6 A;  2D3B A;  2QIL A;  5BMH A;  1FFV A;  2K1F A;  1I7H A;  3EFU A;  1HE8 A;  2REX A;  3HVD A;  4A55 A;  2DHZ A;  3OJ4 B;  2IY1 B;  1N5X A;  1IGD A;  2OJR A;  2D3A A;  1MVK A;  2M4N A;  3M63 B;  4M0W A;  2FCQ A;  4RGO S;  4B95 A;  5J18 A;  2I1J A;  4M8M A;  2I1K A;  1FO4 A;  3X0W A;  1HTQ A;  2FUH B;  2H89 B;  2WNM A;  2FCN A;  2ZNV B;  1YJ1 A;  2VH2 A;  4II2 B;  2GBJ A;  2KWC A;  2MEK A;  1F2R C;  3JW0 X;  4HDQ A;  4DXF A;  3R3M A;  3A9K A;  3PS6 A;  3B2F A;  4C00 A;  1T6B X;  3PLV A;  1KJT A;  3L4P A;  4HVB A;  1F1H A;  3AM9 A;  1E7U A;  1PGB A;  1L0V B;  2WXR A;  2XK5 A;  2CHW A;  4IC7 B;  3KWV A;  3Q14 C;  1HEZ E;  3CF6 E;  2AX5 A;  1PQS A;  3I63 C;  2ZCC A;  1R4N I;  1ZKH A;  2WXL A;  4RFB A;  3UQA A;  1K50 A;  2C7N B;  3NUH B;  2PIA A;  2BYE A;  3WIM A;  4AP4 C;  2KMM A;  2L0F A;  1DOX A;  4GXB A;  4HRS A;  4K1R B;  1WGD A;  5D7G A;  3IHP C;  1E10 A;  5EE1 A;  1WGR A;  2L8J A;  2KQ4 X;  2CHX A;  1C4A A;  1STE A;  3R7Q A;  3H7S A;  3QJZ A;  5EE0 A;  3PRZ A;  2DZJ A;  3ZKJ C;  4PT5 A;  2WS3 B;  5DPS A;  4YXD B;  1F2R I;  4LNF A;  4BBN F;  2JY6 A;  4ICU A;  4BFR A;  3ZQ4 A;  1M94 A;  1F9J A;  4GLS C;  3AEE B;  1UNS A;  3BZD B;  1V1P B;  1QOG A;  3N30 A;  4HRO A;  2N9E B;  1WYG A;  4FJV B;  2PVG C;  3KWL A;  2JU6 X;  1G6J A;  1JWM D;  3RFZ B;  1NYR A;  2KDE B;  3KYC D;  3HRD D;  3K9O B;  2W3R A;  4PYZ A;  2IY0 B;  2QEJ C;  5FR3 A;  3Q2A C;  3U8Z A;  1L2N A;  5JHA A;  4LK0 M;  2OED A;  1F77 A;  3NJT A;  2CHZ A;  4XX5 A;  5IN7 A;  4ZYS A;  4OZC A;  4AWJ A;  3RNB C;  3VAW A;  1I42 A;  4S0R A;  1ZP0 B;  3Q3M C;  2IND C;  4KVG B;  3GZN I;  1ZE3 D;  1Q10 A;  3VUX A;  4F7Z A;  4XDC A;  1C9F A;  3U2S C;  1BT0 A;  1JWA D;  2LHE A;  1GNU A;  4ZRQ A;  3TSS A;  2IO0 B;  3B9J A;  2D07 B;  3ETR A;  4W9E A;  4GDL A;  4KZ0 A;  3W5U B;  4XYC A;  4EZJ A;  3AXC A;  3P4Q B;  4IDI A;  4CO7 A;  3Q8C A;  2K8B A;  2QJL A;  4IM3 A;  1L5P A;  4I6P A;  1RM6 C;  2N9P C;  3TJP A;  3SDL C;  3IT6 B;  2IYD B;  3CMM B;  3V3X A;  4NJ6 A;  4WJP A;  2W9N A;  4G3X B;  3A1Q B;  1WWT A;  1LO5 D;  4AJY B;  2L0T A;  2JXX A;  2K8H A;  2KC2 A;  4KGR A;  4TQ1 A;  4HCN B;  2JZ3 B;  1E8Z A;  2PW9 A;  1WXV A;  4FJZ A;  2J4X A;  2BT6 A;  2Z59 B;  4IW0 A;  1TKE A;  4A20 A;  2MBQ A;  1V6E A;  2ACZ B;  2C7H A;  1R7S A;  2FCM A;  2DBY A;  1JWS D;  1EU4 A;  3N32 A;  3AEB B;  3UIN B;  3KUD B;  3RPF C;  5IOI A;  1N63 A;  1JRU A;  2LUE A;  4OVV A;  1I4G A;  4MGK E;  4OW0 A;  5FK9 C;  2L76 A;  3TBL D;  3AE3 B;  4LNO A;  1V97 A;  3W5V B;  1FCL A;  3P1M A;  1IBX A;  1UBQ A;  2JQR B;  4JWS C;  1KOT A;  3N1Y C;  1DOI A;  2D2Q A;  3EGR A;  1P9D U;  2K25 A;  5C3J B;  2N7E A;  3SFE B;  2WXN A;  1D5X C;  2WDQ B;  2HJ8 A;  2PVO D;  4YSY B;  1YX6 B;  4JQW C;  3DBH B;  1VR9 A;  2CU1 A;  3RZF A;  4MJS B;  1D3Z A;  4IOI E;  1ZDV A;  4MSM B;  1WGK A;  4HLE A;  2V0G A;  2Y3A A;  5EDS A;  4P1B C;  1BXT A;  3L13 A;  3PVL A;  4HJG E;  1WIA A;  2RD0 A;  1C4P A;  2MSE D;  1EUV B;  4MEM A;  2LRU A;  5C23 A;  4A3O A;  5HHD G;  1C4C A;  1FM0 D;  1RRB A;  1Y56 A;  2NTT A;  4TUU A;  1C78 A;  1QZE A;  3EA6 A;  3ONS A;  1WXM A;  1L0Y B;  3AEA B;  3AV8 A;  4OZB A;  1FRR A;  1UUP A;  4A90 A;  1ZPS A;  2LXA A;  3BYY B;  5CHW A;  4ZHO A;  5L95 C;  1E5W A;  1EF1 A;  4HKQ A;  4JPS A;  4ASW C;  3NZU A;  2K9X A;  3PZD A;  1HTO A;  3RYT A;  4GU2 A;  4KKJ A;  2N9L A;  3RUI B;  1RWS A;  2WDV B;  3ZRF A;  3PTF C;  2IGG A;  1YX5 B;  2M0X A;  4B9K A;  2AQ3 B;  1PGX A;  2M8S A;  3MTN B;  2JWZ A;  3VUY A;  1WM3 A;  3V05 A;  4XGA B;  4GMV A;  4J6I A;  1ACC A;  4TKN A;  4REZ A;  3KW5 B;  1TJE A;  1DYQ A;  3N20 C;  4YWG G;  4CHK A;  1WMH A;  2BS3 B;  2CJN A;  4L2Y A;  3LJ3 A;  3L10 B;  2RGF A;  2K3U A;  4N6E B;  2Z0D B;  4RNA A;  4DBG A;  1ZXI A;  2FAZ A;  1SE2 A;  1N62 A;  2MBO A;  2KX3 A;  1EO6 A;  3A4R A;  1HA5 A;  3A9J A;  1RLF A;  2K6D B;  2WDR B;  4HXD A;  2FUG 1;  4WJN A;  2MJ3 A;  1HZ5 A;  1WGY A;  3VH4 B;  1DGJ A;  2WX1 A;  3DVN U;  1QOF A;  3DWM A;  1GPX A;  4K3B A;  1LQB A;  2KLC A;  4FUL A;  2D11 A;  2ZVO A;  5HG2 A;  2O6V B;  4OHJ A;  4EEW A;  2KDM A;  2Q5W D;  1SXT A;  4W9C A;  4FA6 A;  1A5R A;  4GN1 A;  1OQY A;  4FBJ B;  1F0Z A;  1RYJ A;  1L4D B;  1T0Y A;  3T9L A;  1YN4 A;  4M0W B;  3JYU A;  2J42 A;  1LFD A;  1NI3 A;  1NYQ A;  3FIL B;  1SEB D;  2JF5 A;  4G0N B;  2A5U A;  4W9H A;  3AEG B;  3H8H A;  2X8X X;  2D5G A;  5E6N A;  4DHZ E;  5AUK A;  4UDU C;  1GC7 A;  1UGM A;  4MM3 B;  1J19 A;  1WXQ A;  3NZS A;  4XZ4 A;  3ZYY X;  2XK5 B;  2DAF A;  3I5J C;  4YL8 A;  4NQK E;  1FNV A;  2ZPY A;  5AZF A;  2TSS A;  2BYT A;  3DDC B;  4W9I A;  4XWW A;  1KLG D;  2BW2 A;  3VRB B;  4URK A;  1H4R A;  4JWU C;  2EKI A;  3R2T A;  4P7I A;  1V5T A;  3VHT C;  4GSW A;  4DDG D;  1FNW A;  2JRI B;  1FPY A;  2HTM E;  3PRE A;  2D3C A;  2J53 A;  2OJW A;  2H88 B;  4XC2 A;  4AS1 A;  4OVZ A;  4IWP A;  2Y5B B;  1P7F A;  4ZRJ A;  2LWP A;  1IYF A;  2KKC A;  3FIL A;  2FID A;  1VDV A;  2KJR A;  4KIK A;  2C5L C;  4ZRP A;  1R4M I;  4K7W A;  4BOS C;  4GIV A;  4P16 A;  2V9H A;  3R7R A;  1I4X A;  4AUQ C;  3FKY A;  3OG5 A;  2PEA A;  1QLB B;  1WRD B;  3PPA A;  1L4Z B;  1WZ0 A;  2WXF A;  1AW7 A;  4W9J A;  1PFD A;  1AAR A;  4F8C B;  2FIF A;  1VD2 A;  2KK8 A;  2WQY B;  3OAW A;  3QC8 B;  3ZNZ B;  3TEX A;  2GBR A;  3ZNG C;  2BS2 B;  2JZP A;  4RGT A;  3VTU A;  3EUB 2;  1TS2 A;  1J7C A;  1HZ6 A;  2IO2 B;  3AE5 B;  3LYY A;  3SEB A;  1E90 A;  4WWM A;  3KQ4 A;  2Y5P A;  4W9G A;  3ABV B;  1HXY D;  5BMI A;  4MEL A;  3Q3O C;  2ZW1 A;  2WU2 B;  3P63 A;  2LJ5 A;  4BAX A;  4HWI B;  1DOY A;  4US9 A;  3MC9 A;  3QAR A;  5FR6 A;  3TEW A;  5GXG B;  3QX1 A;  1OEY J;  2DYO A;  1V1O A;  2J0K A;  2N0S B;  2G1E A;  4FHJ A;  2KVR A;  2BTE A;  1UGJ A;  2ZZP B;  4ICV A;  3GE3 C;  2C60 A;  1OFF A;  2ICI A;  1WZ3 A;  1VJK A;  4H2A A;  3VTV A;  3JSV B;  2YEP F;  2RDH A;  1V8C A;  1YIW A;  4MSQ B;  2SAK A;  4LNK A;  3NHE B;  3B1L X;  3MHZ A;  2Y5C A;  3ZNI D;  2KJH B;  4N58 A;  3PZ7 A;  5C2T B;  1B1Z A;  5IP4 D;  1S1Q B;  4WJO A;  3ZTC A;  1ZOY B;  2K5P A;  3ZDM C;  1L6V A;  4PYU A;  4DDI D;  3PO0 A;  2AL6 A;  3ZVV A;  3PHX B;  4EUT A;  4AQ7 A;  4HEA 1;  1TKY A;  2QHO A;  2MCN B;  1IP9 A;  3BII D;  1YN3 A;  3H6N A;  1R4N B;  2OOB B;  3ZJU A;  2CKH B;  2LRW A;  2KNB A;  4KDI C;  2K0P A;  2KHW B;  3Q6B A;  3S2A A;  3SU8 X;  4ARI A;  2FE8 A;  5E6P A;  5BYR A;  2DZM A;  2KDB A;  1IGC A;  4YSX B;  3H9D A;  2FCS A;  2RPV A;  2MA9 B;  2WGS A;  3RD2 A;  3UIO B;  2I2Y A;  3JSV A;  2WXK A;  2DEN B;  1FD6 A;  1XLP A;  3VUW A;  2FBW B;  1SJH D;  2DAJ A;  2INP E;  3EFC A;  4MH8 A;  1UZX B;  1NI2 A;  5LLI A;  2KN5 A;  2KTF A;  4A6Q A;  1C3T A;  3AEC B;  1WM2 A;  1D5M C;  1OQQ A;  3BY4 B;  2R2O A;  3B2G A;  3DCG A;  3U7D A;  4DHJ B;  4BVU C;  4NY0 A;  3IG3 A;  1I35 A;  4E3C A;  2NPT B;  4B0M A;  3VDZ A;  2GI9 A;  4RMA A;  1J8C A;  4MJS A;  2LXC A;  3TCA A;  1YJI A;  1TY2 A;  2QC8 A;  4ZRK A;  4ZRI A;  1F52 A;  4S17 A;  2AQ2 B;  3VVW B;  1FCC C;  1JML A;  3A9K B;  3DWG C;  1Y8R C;  2BYF A;  5EE3 A;  2GBM A;  3Q69 A;  5AEK B;  1K51 A;  4OVU A;  1MFW A;  2UU7 A;  1P3Q U;  2KMA A;  3WCQ A;  2LFI A;  1CZP A;  5IO9 A;  4TSS A;  3AN1 A;  2KQS A;  3C8Y A;  3LDZ E;  4BKS A;  3UQB A;  2DLB A;  4DXA B;  3V60 A;  1XLQ A;  3AE8 B;  3P4P B;  1TS5 A;  4ZHP A;  1V2Y A;  1MG8 A;  3WAP A;  4WQO B;  4M8N A;  2D10 A;  1J7A A;  2UWQ A;  3RMK C;  3SD5 A;  2PKO A;  3W1Y A;  4JIO U;  3RI7 C;  3RT3 B;  1E8Y A;  3AE7 B;  1TBE A;  3QHT A;  4I6N B;  2WXJ A;  4G11 A;  2DZK A;  1WY8 A;  1V86 A;  2EEL A;  2MW5 A;  3ML8 A;  2NR2 A;  4FAD A;  4EKU A;  4LNN A;  4LDT D;  2B76 B;  3ZJT A;  5D3I B;  4EZK A;  3APC A;  2Z0E B;  2ONQ A;  4WWP A;  2RPQ A;  3KYD D;  1WRI A;  2WXI A;  2K6Q A;  2MQJ A;  1E7V A;  3WA0 A;  3MC0 B;  2WLB A;  3HM6 X;  3TEZ A;  2LGI A;  2KT7 A;  2INN E;  5G55 A;  1A70 A;  2AL3 A;  1IPG A;  5EE9 A;  1XT9 B;  1GJZ A;  4L1B A;  4W9F A;  3D32 A;  3JVZ X;  2KZR A;  4K7S A;  3DVG Y;  1OEY A;  3AH7 A;  4YSZ B;  3DOW A;  3L0W B;  1VCB A;  4QAY A;  2M1M A;  2IO3 B;  4MAC A;  2DNF A;  2JSV X;  2JX5 A;  3KLS X;  2OHF A;  5AZG A;  2KVZ A;  1EU3 A;  1RFA A;  1QKZ A;  1EF5 A;  3AE1 B;  4NAW B;  2RDB C;  3HM3 A;  2PLP A;  1WX9 A;  1XQQ A;  4PS3 A;  1FIQ A;  3N9Y C;  4ZOH C;  2LGD A;  1TZO A;  3AE2 B;  2QDF A;  2WDT B;  1EWY C;  3AMZ A;  4PS8 A;  1L6U A;  2EMT A;  1X1M A;  4AOF A;  2LGS A;  3W1S C;  2KJ6 A;  2L52 A;  4WQM A;  1TGZ B;  3A1Q A;  3LB8 C;  4ANU A;  4XWT A;  2MJD A;  2PJH A;  5IA7 A;  2KQ7 A;  1L0X B;  2NBV B;  4ITK A;  1E7P B;  1XF5 L;  3IAS 1;  2G9H D;  2GB1 A;  2MP2 B;  3X23 A;  2V3N A;  3PZ8 A;  1XCQ L;  3AU5 A;  1LM8 B;  5KHO A;  4BZA A;  1OQR A;  4CQN A;  3NVZ A;  2RSU A;  3HIZ A;  4ZDV A;  4YTN B;  4GDK B;  3NZ3 A;  4NAW A;  2WXP A;  3Q3N C;  4KV2 A;  2YLM A;  5JHB A;  4NZL B;  2HD5 B;  3KUC B;  1C1Y B;  2ASQ A;  2G4S A;  2W55 A;  3ZDT A;  2EKE C;  3PT2 B;  3N1X C;  1UWM A;  4JE3 B;  5JH5 C;  5CX3 A;  2WX0 A;  3DBR I;  2L1A A;  5T8I A;  3RUL A;  4Q2J A;  3RCZ A;  2LAS A;  1QOB A;  4IWQ A;  3CIR B;  3IFW B;  1WXA A;  1PGA A;  2B3A A;  4LDT B;  1JRP A;  3W9C B;  1YN5 A;  4BKG A;  3RNF C;  3O65 B;  4HCP B;  1V5O A;  2MLB A;  2R61 A;  2BF8 B;  4KSL C;  4IWO A;  1WGH A;  2N4F A;  4FLH A;  3A4S C;  5D2M B;  3BVZ A;  1WJ6 A;  2M56 B;  1ESF A;  2V4I B;  2BGF A;  4PS7 A;  2JPH A;  1E8W A;  3AB5 A;  3BIN A;  4GGQ A;  2DYB A;  4NAM A;  4EZL A;  1ZXH A;  3PHW B;  4GDK A;  2VZK B;  5G5G A;  4CYE A;  4LJO B;  1BML C;  1D6E C;  3VH3 B;  2BKF A;  4HPL B;  5DPR A;  2XEW A;  4HKZ E;  4RF0 A;  2DX5 B;  1D4B A;  2BYV E;  2JYE A;  3WAN A;  4A9A A;  2KO3 A;  3MP9 A;  2KWV B;  3NVW A;  4N59 A;  1XXG A;  3AU4 A;  4FN2 A;  2KDF B;  4DHJ D;  1UF0 A;  1FEH A;  4HPM B;  2PE6 B;  2BB5 A;  4EE2 A;  1XD3 B;  1TTN A;  1FFU A;  3K9P B;  2LVO A;  2RMM A;  3VXW A;  1TZ1 A;  4LNI A;  2K8C A;  1WI0 A;  2N1V A;  3FAH A;  3SFD B;  3QIJ A;  2G3Q B;  3A9J B;  1SGH A;  1YQB A;  1JCK B;  1PYW D;  5GMV A;  2G45 B;  3C0R B;  2BB6 A;  2WP9 B;  1OTR B;  1I4P A;  3ZW3 A;  3VR8 B;  4DK5 A;  2PMV A;  1RAX A;  4KGT A;  4WUR A;  3NRZ A;  5FKA C;  2N7J A;  1VZ6 A;  2MBH A;  4II3 B;  4ACF A;  5LNK 1;  2JZZ A;  4WAF A;  3APF A;  2QCZ A;  4NJC A;  3OWE B;  2NPT A;  5KHQ A;  2IGD A;  3IAM 1;  3HVZ A;  2KFJ A;  1B9R A;  5H8Y E;  3ECI A;  3QA8 A;  1WMH B;  4HPP A;  2J7Q B;  2MJE A;  4TMA B;  3Q3J A;  1T0Q C;  2ZPN A;  2Z8L A;  2HDE A;  3P2B A;  1M4V A;  1JWU D;  1N5W A;  1UD7 A;  2IO1 B;  3PRP B;  3H7P B;  2CR5 A;  1FXA A;  1SSN A;  2JUO A;  5DCN A;  3BVG A;  3IXS A;  2M17 A;  3NY5 A;  1MHX A;  2O2V A;  3MJ5 A;  4R3D A;  3QK0 A;  5D6J B;  2VH1 A;  4RM8 A;  1RFK A;  4W9L A;  2W82 A;  3DBL B;  3RN9 C;  2L83 A;  3TMP B;  2BKR B;  5LXH A;  3CST A;  2BS4 B;  2LI5 A;  3NOB A;  4KZC A;  4N9F 4;  4JLC A;  1Z2M A;  4NJ7 A;  4TQ0 A;  1UBI A;  3U7Z A;  2IJ0 A;  2AYO B;  1WJ4 A;  1I4R A;  2ZVN A;  3DHG C;  1V49 A;  3DVN V;  1KLV A;  1U4A A;  3KH0 A;  1TY0 A;  4C7Z A;  4DXG A;  1XLO A;  3BVM A;  3T3N A;  1GC6 A;  2BVC A;  2V4L A;  4AJW A;  1YQ3 B;  5CHF A;  4WH4 A;  1AYF A;  1JRO A;  2N9X A;  4K7U A;  3U4E G;  2KXJ A;  2PPH A;  2J52 A;  2JWU A;  1JQ4 A;  3OLM D;  3PGE A;  1WR6 E;  2K39 A;  2WXG A;  2KAJ A;  4WWN A;  1NEK B;  2ZJD A;  5E6J A;  4JX1 C;  1WX8 A;  2JYT A;  4RGN A;  1WYW B;  2QMT A;  2KFK A;  4YTP B;  1T0R C;  1P0R A;  4WJQ A;  2VRR B;  2IGH A;  3NVY A;  2QIE B;  1KFY B;  1UWX A;  5BMG A;  3UGB B;  4GDL B;  2N1W A;  2L7R A;  1I4H A;  1V1P A;  3R2I A;  5JXV A;  5AZH A;  3HHM A;  2V3S A;  5DPT A;  4DHZ B;  1SBB B;  5H92 C;  3UF8 A;  4C7Y A;  4BBN C;  3VFK A; 
#chains in the Genus database with same CATH homology
 1SF0 A;  1EWC A;  2AQ3 B;  5BYS A;  1PGX A;  2XN9 C;  2WU5 B;  2E6X A;  3FC4 A;  4WIP A;  5BYQ A;  3T3O A;  1QF6 A;  4XDD A;  1XEE A;  1JAL A;  3V05 A;  1ZDX A;  1JW9 D;  4OZA A;  2B76 B;  3ZJT A;  5D3I B;  1FNU A;  1NVI D;  1CK1 A;  3ZJV A;  2VZK D;  2CU3 A;  2ONQ A;  1ACC A;  1PDX A;  2NMQ A;  1KLU D;  2KWD A;  4REZ A;  1TJE A;  1C76 A;  1DYQ A;  1FMA D;  1WRI A;  2WXI A;  2WXH A;  4YWG G;  2BS3 B;  2CJN A;  1KTK A;  1GAQ B;  4L2Y A;  4MT5 A;  1YMH E;  3MC0 B;  3BK1 A;  5HI1 A;  2WLB A;  3TEZ A;  2LGI A;  3URY A;  1XCT L;  2INN E;  2K3U A;  4N6E B;  2JXT A;  4RNA A;  1IUE A;  1A70 A;  1ZXI A;  4IKG A;  4A8X C;  1SE2 A;  1SIJ A;  5EE9 A;  3BWU D;  2E3T A;  4L1B A;  1N62 A;  2WXQ A;  2MH7 A;  1HA5 A;  2RDG A;  2WDR B;  3NS1 A;  4USA A;  2FUG 1;  2MJ3 A;  1HZ5 A;  3AH7 A;  4YSZ B;  1DGJ A;  3P42 A;  2M19 A;  1QOF A;  2WXO A;  3DWM A;  1GPX A;  4MAC A;  2IDY A;  2AQ1 B;  1PUT A;  4L23 A;  2JSV X;  2JX5 A;  3KLS X;  1ZUD 2;  2OHF A;  2KAC A;  1FXI A;  1EU3 A;  2QIL A;  5BMH A;  5HG2 A;  1QKZ A;  1ET9 A;  1FFV A;  4OHJ A;  3AE1 B;  4NAW B;  2KDM A;  1D5Z C;  2Q5W D;  1I7H A;  1SXT A;  2PLP A;  3E9S A;  1FIQ A;  3N9Y C;  4DQO C;  4ZOH C;  3HVD A;  3U52 E;  4A55 A;  1I4Q A;  1TZO A;  1N5X A;  1IGD A;  1F0Z A;  3AE2 B;  2L32 A;  1RYJ A;  1L4D B;  1YN4 A;  1MVK A;  1CQV A;  4M0W A;  4RGO S;  2J42 A;  1NI3 A;  1FO4 A;  1EWY C;  1NYQ A;  3AMZ A;  3FIL B;  1L6U A;  1SEB D;  1SE4 A;  1C77 A;  2H89 B;  2L52 A;  2WNM A;  4WQM A;  1N60 A;  3UI3 A;  2M0A A;  2MEK A;  1F2R C;  3AEG B;  3H8H A;  3LB8 C;  2D5G A;  4XWT A;  2MJD A;  4DXF A;  3B2F A;  5AUK A;  4UDU C;  1L0X B;  4MM3 B;  1T6B X;  2LJI A;  4ITK A;  4J3O D;  1E7P B;  1XF5 L;  1WXQ A;  3IAS 1;  3L4P A;  3AM9 A;  1PGB A;  2SEB D;  2G9H D;  1L0V B;  2GB1 A;  3ZYY X;  2WXR A;  3VRA B;  2YEP B;  1VZ8 A;  2V3N A;  3PZ8 A;  1XCQ L;  1KF6 B;  3KWV A;  3HUI A;  4P6V F;  1FNV A;  1HEZ E;  2AX5 A;  2TSS A;  4US8 A;  3TUO A;  1AN8 A;  1OQR A;  2BYT A;  4CQN A;  1MI0 A;  1QT9 A;  4XWW A;  3NVZ A;  1KLG D;  2BW2 A;  3VRB B;  2WXL A;  4JWU C;  4RFB A;  2QSD A;  4YTN B;  1K50 A;  2I38 A;  2CJO A;  4GDK B;  3NZ3 A;  3NUH B;  2EKI A;  2PIA A;  3R2T A;  2WXP A;  2KMM A;  1DOX A;  3GB1 A;  4HRS A;  1FRD A;  2GRI A;  1FNW A;  4NZL B;  5D7G A;  2HTM E;  1E10 A;  2W55 A;  5EE1 A;  2J53 A;  2KQ4 X;  2H88 B;  1UWM A;  4JE3 B;  1C4A A;  4AS1 A;  1STE A;  4OVZ A;  1P7F A;  5EE0 A;  2KN4 A;  3FIL A;  1VDV A;  2L1A A;  5T8I A;  3W1S A;  4PT5 A;  2WS3 B;  4Q2J A;  4ZRP A;  4YXD B;  3VQI A;  2IPK D;  1QOB A;  1F2R I;  3CIR B;  2NTS A;  1JWB D;  4P16 A;  5G5H A;  1PGA A;  3ZQ4 A;  1TS4 A;  2W54 A;  1I4X A;  1SJE D;  1VZ7 A;  1JRP A;  3W9C B;  1YN5 A;  4GLS C;  3AEE B;  1QLB B;  3Q8B A;  4D2K A;  2R61 A;  1L4Z B;  1UNS A;  2WXF A;  3BZD B;  3AED B;  3Q8F A;  1EM7 A;  1AW7 A;  1V1P B;  1QOG A;  1PFD A;  3BVZ A;  1QQR A;  2M56 B;  1ESF A;  4HRO A;  1J7B A;  1WYG A;  2V4I B;  3O13 A;  1N61 A;  2PVG C;  3KWL A;  2WQY B;  2JU6 X;  3TEX A;  3AB5 A;  1JWM D;  2JZP A;  1P7E A;  2BS2 B;  4RGT A;  4B0E A;  3RFZ B;  1NYR A;  1K52 A;  3EUB 2;  3HRD D;  1TS2 A;  2W3R A;  1VRA B;  4NAM A;  1J7C A;  4FXC A;  1ZXH A;  1HZ6 A;  2K22 A;  2QEJ C;  5FR3 A;  1C79 A;  2VZK B;  3AE5 B;  3LYY A;  3SEB A;  5G5G A;  4WWM A;  4C56 C;  1BML C;  1D6E C;  3Q8A A;  2WXM A;  2Y5P A;  3KQ4 A;  3ABV B;  2X38 A;  4LK0 M;  1E0Z A;  1HXY D;  5BMI A;  2OED A;  1F77 A;  2ZW1 A;  2WU2 B;  4HKZ E;  4RF0 A;  1D4B A;  1ROE A;  2JYE A;  3P63 A;  4A9A A;  3MP9 A;  4ZYS A;  5MPO A;  4OZC A;  5TSS A;  3NVW A;  4N59 A;  1TS3 A;  1XXG A;  1DOY A;  1ZP0 B;  1SB3 C;  3AE6 B;  4US9 A;  3J9C A;  1FEH A;  2BB5 A;  4EE2 A;  3TEW A;  5GXG B;  1ZE3 D;  1FFU A;  1KH0 A;  1Q10 A;  2RMM A;  3SR6 A;  2DYO A;  1V1O A;  1XO3 A;  4XDC A;  1C9F A;  2N0S B;  2G1E A;  1GB1 A;  1E6E B;  3U2S C;  1JWA D;  2BTE A;  2LHE A;  1UGJ A;  1TYG B;  4ZRQ A;  3FAH A;  1OFF A;  3SFD B;  3TSS A;  2ICI A;  3B9J A;  3ETR A;  3GP7 A;  1VJK A;  4H2A A;  2YEP F;  1JCK B;  2RDH A;  1V8C A;  1PYW D;  3W5U B;  4LLG M;  2N9K A;  2XNA C;  3CWI A;  3P4Q B;  4IDI A;  2BB6 A;  2WP9 B;  2SAK A;  3Q8C A;  1I4P A;  3MHZ A;  2QJL A;  1L5P A;  2Y5C A;  3VR8 B;  4N58 A;  2PMV A;  1RM6 C;  4KGT A;  4WUR A;  1E9M A;  3PZ7 A;  3I57 A;  3NRZ A;  3IT6 B;  5FKA C;  2N7J A;  5C2T B;  1B1Z A;  1VZ6 A;  3V3X A;  1ZOY B;  4YT0 B;  1SE3 A;  5LNK 1;  2K5P A;  1WWT A;  1L6V A;  1LO5 D;  4RGM A;  4WAF A;  1ENF A;  3PO0 A;  4NJC A;  4AQ7 A;  1T5X D;  3OWE B;  2V3P A;  4HEA 1;  1TKY A;  2IGD A;  3BII D;  3IAM 1;  1T3Q A;  3HVZ A;  4KGR A;  4TQ1 A;  5I4D A;  3I9V 1;  1YN3 A;  1B9R A;  5H8Y E;  3VR9 B;  4KGS A;  3ZJU A;  3IT4 B;  2LEK A;  2PW9 A;  1WSP A;  2MJE A;  4TMA B;  3GS2 A;  2J4X A;  2K0P A;  2BT6 A;  3W2D A;  2Z8L A;  2HDE A;  4ARI A;  1TKE A;  2FE8 A;  1M4V A;  2ACZ B;  5BYR A;  1JWU D;  1R7S A;  1N5W A;  2DBY A;  3AEF B;  1JWS D;  1IGC A;  2ON8 A;  1EU4 A;  3AEB B;  4YSX B;  2BBC A;  2RPV A;  3RPF C;  1FXA A;  1SSN A;  1N63 A;  2I2Y A;  3BVG A;  1I4G A;  3IXS A;  2WXK A;  4OW0 A;  1MHX A;  5FK9 C;  1FD6 A;  3AE3 B;  1XLP A;  3MJ5 A;  4R3D A;  1YNT E;  2FBW B;  4LTU A;  1V97 A;  1SJH D;  3W5V B;  1RFK A;  1FCL A;  3P1M A;  2W82 A;  2INP E;  4MH8 A;  1IBX A;  2LMC A;  2L83 A;  1IBX B;  2JQR B;  2BS4 B;  1K53 A;  4JWS C;  4O1N A;  4A6Q A;  1DOI A;  3EGR A;  5D3D A;  3AEC B;  3AE9 B;  5C3J B;  1D5M C;  3MFG A;  4TQ0 A;  1OQQ A;  3Q8E A;  3SFE B;  3U7Z A;  2WXN A;  2IJ0 A;  3B2G A;  1TKG A;  1D5X C;  1I4R A;  4YTM B;  4RCO A;  3TEY A;  2WDQ B;  2PVO D;  4B0M A;  4YSY B;  2GI9 A;  1VR9 A;  3AE4 B;  4IOI E;  1ZDV A;  4C80 A;  1AWD A;  1NEN B;  1TY0 A;  1WGK A;  4KX6 B;  4DXG A;  4C7Z A;  1YJI A;  1GB4 A;  1TY2 A;  2V0G A;  1XLO A;  1ET6 A;  5HFY A;  2DWQ A;  2PTL A;  2Y3A A;  3LXF A;  1YJJ A;  1BUI C;  3BVM A;  3T3N A;  2AQ2 B;  1HQR D;  1BXT A;  1FCC C;  1JML A;  2ZW0 A;  3BYT B;  3DWG C;  1MPE A;  5EE3 A;  4XE0 A;  1YQ3 B;  3Q69 A;  4WH4 A;  1AYF A;  1K51 A;  1JRO A;  4RF1 A;  4HJG E;  3U4E G;  1C4P A;  2DYM A;  1QOA A;  3WCQ A;  2LFI A;  2J52 A;  2JWU A;  1JQ4 A;  1CZP A;  3ZGZ A;  5HHD G;  1C4C A;  4TSS A;  1KRH A;  1FM0 D;  3AN1 A;  2WXG A;  1GOZ A;  5AUI A;  2KAJ A;  1NEK B;  1Y56 A;  2NTT A;  5E6J A;  3C8Y A;  1C78 A;  4JX1 C;  2DLB A;  3EA6 A;  2JYT A;  3P4R B;  1L0Y B;  3AEA B;  3AV8 A;  4OZB A;  4RGN A;  1FRR A;  1UUP A;  2LHD A;  3P4S B;  4RH6 A;  4A90 A;  1ZPS A;  3NVV A;  2QMT A;  1YQ4 B;  1XLQ A;  3BYY B;  3AE8 B;  4YTP B;  4ZHO A;  3P4P B;  1TS5 A;  3E56 A;  4ZHP A;  2W3S A;  4HKQ A;  4KKI A;  1J7A A;  2IGH A;  4JPS A;  3NVY A;  3R8B A;  1CJE A;  1QIL A;  2K9X A;  1KFY B;  1UWX A;  2QIE B;  2PKO A;  5BMG A;  1MHH E;  1XLN A;  4GDL B;  1I4H A;  1V1P A;  3R2I A;  5JXV A;  3AE7 B;  4KKJ A;  2N9L A;  4ARC A;  2WXJ A;  1VLB A;  1RWS A;  2WDV B;  1SBB B;  5H92 C;  2LUM A;  3BK2 A;  4C7Y A;  2IGG A;  2EEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...