1PFDA

The solution structure of high plant parsley [2fe-2s] ferredoxin, nmr, 18 structures
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
96
structure length
96
Chain Sequence
ATYNVKLITPDGEVEFKCDDDVYVLDQAEEEGIDIPYSCRAGSCSSCAGKVVSGSIDQSDQSFLDDEQMDAGYVLTCHAYPTSDVVIETHKEEEIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FERREDOXIN
publication title The solution structure of parsley [2Fe-2S]ferredoxin.
pubmed doi rcsb
total genus 21
structure length 96
sequence length 96
ec nomenclature ec 1.7.7.2: Ferredoxin--nitrate reductase.
pdb deposition date 1998-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1pfdA00
1ZOYB 3AV8A 1B9RA 1JRPA 3DWMA 1FRRA 1OFFA 5AUIA 1XLQA 2JQRB 3BIID 4FXCA 5C3JB 1FMAD 1SIJA 2K5PA 3LB8C 3AE7B 2CJOA 2H88B 3NRZA 1J7BA 1DGJA 1XLPA 2N0SB 1YJIA 1E7PB 2L83A 1OQQA 2PVGC 3AM9A 2K22A 2K9XA 4LTUA 5G5GA 3W5VB 4YSZB 5H92C 2WDVB 1QOBA 3AE5B 1L0VB 4N6EB 3SFEB 1NI3A 1QOGA 1VLBA 1XLNA 2PIAA 2WP9B 3AEGB 4N59A 1E10A 1T3QA 5EE0A 3CWIA 3NVZA 5MPOA 1UWMA 2OHFA 5H8YE 1QOAA 1FIQA 2WU2B 3CIRB 1N62A 1NVID 3AEBB 1WXQA 1NEKB 3VRAB 1XO3A 1N5WA 3W5UB 3ETRA 3AE9B 1NYQA 1VJKA 1JALA 1WRIA 1L6VA 2MJDA 2E3TA 2WQYB 3HVZA 4HROA 1TJEA 4ZOHC 1L5PA 2LEKA 3NVYA 1F0ZA 2CJNA 1PFDA 3AE6B 1N5XA 2JX5A 4YTNB 2WS3B 4P6VF 1E9MA 1N60A 2KAJA 2EKIA 1KF6B 1TKYA 2HTME 1TKGA 1J7CA 1WGKA 2H89B 1NYRA 2W3RA 3AE4B 3AECB 3ABVB 1FFUA 3B9JA 3FC4A 1CZPA 4US9A 5EE1A 2MJ3A 3DWGC 5GXGB 3VRBB 2MH7A 1QOFA 3LXFA 5AUKA 2BS2B 5EE9A 4JWSC 2G1EA 1FRDA 1RWSA 2M19A 2MJEA 3AB5A 3FAHA 3P4SB 3PO0A 3AE3B 3VR8B 2QIEB 4N58A 3P4RB 3NVVA 3AN1A 3B2GA 1FM0D 3HUIA 1FXAA 2QJLA 1TKEA 4YT0B 5G5HA 1E0ZA 1N61A 1PUTA 4C80A 1FO4A 1IUEA 2KMMA 1YJJA 2B76B 1DOYA 3AEFB 4YTPB 4WQMA 2W3SA 3L4PA 4KX6B 1CJEA 2BS3B 2CU3A 2WDQB 1AWDA 3W9CB 1JROA 1JQ4A 4US8A 2PKOA 4ZHOA 1EWYC 1SB3C 2AX5A 3AMZA 3AH7A 3B2FA 1L6UA 1V97A 4HRSA 1FXIA 1KRHA 1OQRA 1ZXIA 3AE2B 3AEDB 2M56B 2FBWB 1FFVA 1V8CA 3ZYYX 3P63A 4C7YA 4YTMB 2Q5WD 3AEAB 1WYGA 3KWLA 2W54A 1QF6A 1YQ3B 1DOXA 1QT9A 2ACZB 3NVWA 1QLBB 3SR6A 2DBYA 2L52A 2PVOD 1WWTA 1ROEA 2W55A 1YQ4B 1AYFA 1J7AA 1ZUD2 3P4QB 1XLOA 3AE8B 1A70A 1KFYB 1RFKA 4ITKA 3WCQA 3SFDB 3P1MA 1TYGB 1JW9D 1N63A 2DWQA 5EE3A 2WU5B 1JWBD 1RM6C 2WDRB 1RYJA 3AEEB 4WWMA 4A9AA 1ZP0B 1E6EB 3HRDD 3NS1A 4JX1C 1SF0A 1GPXA 3RPFC 4C7ZA 2WLBA 4YXDB 3VR9B 4USAA 1VDVA 5C2TB 1R7SA 1JWAD 4YSYB 1NENB 2BS4B 2Y5CA 4ZHPA 3AE1B 3EUB2 4JWUC 1DOIA 4IDIA 4YSXB 1PDXA 1GAQB 1I7HA 3P4PB 2BT6A
chains in the Genus database with same CATH superfamily
4NAWB 5BMIA 2Y5BB 4LDTB 4WWOA 3DBSA 4M00A 4FBJB 3H7PA 2NTSA 2Z0EB 2R2QA 2N0SB 1Q1OA 2YEPF 2JYEA 4TQ1A 3PTFC 2CS4A 4A3PA 4CO7A 3DVNV 2LXCA 4ICUA 3W1SC 1M4VA 4AQ7A 1XO3A 4ZRKA 2FCSA 3QIJA 5IA7A 3A33B 3Q2AC 5BMGA 1SJHD 4TUUA 4W9IA 4BZAA 2N9XA 4FJYA 3ZDTA 1WX8A 1CZPA 1VRAB 4PT5A 2K6DB 2YVCA 3VAWA 1PQSA 3TJPA 4K1RB 5D2MB 1TT5B 2K8BA 3PVLA 4RGTA 2MP2B 2KMMA 2W3SA 2VZKD 1VR9A 4GSWA 2BS3B 1RAXA 4REZA 3MJWA 2V4IB 3B08A 2MEKA 2NPTB 1YX6B 1V97A 2CKHB 2N9LA 1TS3A 4K7UA 3FILB 1WJ4A 2RGFA 1WYGA 4HKZE 2VRRB 2K1FA 4DHZE 1OGWA 2PVOD 5FR3A 2LGDA 4MGKE 2DYBA 4WWPA 2I2YA 1BT0A 1QKZA 3U30A 2NBUA 1YN5A 3DOWA 3TSSA 3W2DA 3RNAC 3QK0A 3PHWB 2BS4B 4MM3B 2MQJA 4MGZE 5E6OA 4BOSC 3OLMD 2KX0A 2N7EA 3AU5A 1WX7A 3LYYA 4EZKA 3HHMA 5C3JB 3WAMA 4CYEA 2LMCA 1J7BA 5AZGA 3APDA 3ALBA 4XGAB 4RM9A 3Q3NC 4YSZB 2I1JA 3I9V1 2WXHA 4C4VA 2IY0B 3U7ZA 1SIFA 5IP4D 2L76A 2KOXA 2DZKA 3VRAB 3GE8C 1N5WA 1T6BX 1F2RC 3I57A 3A9JA 1L6VA 2KTFA 1GC6A 2JRIB 3AE6B 1KLGD 2KFKB 4RMAA 1WGKA 1J7CA 2KWDA 4LK0M 3RN9C 3BVZA 2WXIA 3TEZA 3P4RB 3ML8A 1FXAA 3CSFA 1L0YB 2NVUI 1CJEA 4KGSA 2GOWA 2G4DB 3J9CA 3AH7A 4HEA1 2AQ2B 1VZ7A 3KQ4A 4DXGA 3IAS1 4LJPB 4BKGA 4LDTD 5EDSA 1PGXA 4WH4A 5JHAA 4XZ4A 1HA5A 3P4QB 1ZUD2 4W9GA 3M63B 5J18A 1TS4A 3P1MA 1YN4A 4B6WA 4M02A 1JRUA 4NJ7A 4JE3B 3RPFC 1VDVA 2ZVOA 1WFYA 4ARCA 3MHZA 2Z0DB 3UQBA 5AUIA 3BIID 5LLIA 1SIJA 3R66C 1DGJA 4FADA 3UIPB 2D3AA 1VZ8A 2M0AA 1R4MI 1D5ZC 2AQ1B 5T8IA 1D6EC 3Q14C 3W1YA 2PIAA 2JZ3B 2WP9B 3RZWC 1Y56A 2DX5B 4XX5A 1I35A 3ZUNA 3W1SA 1KJTA 3NZ3A 4HROA 2KT7A 1F0ZA 4JQWC 3KYDD 1N60A 2KAJA 1EF1A 1TKYA 4PYZA 3AECB 5DPSA 1QOFA 2BS2B 2HE7A 2RPQA 1GB4A 3QJZA 2NS5A 2KACA 3TEXA 4A8XC 2Y5PA 3ZJUA 2GRIA 2WDQB 3U2SC 1IGCA 2M1MA 2FUG1 1J19A 2KDFB 3B2FA 1C3TA 4C4VB 2WXLA 1WXAA 1FXIA 3EC8A 4XWTA 4M8MA 3DHIC 2VH1A 2IO3B 3SR6A 3A9JB 2KTRA 1E8XA 4FULA 1YN3A 5JXVA 1RM6C 4HJKA 3AEEB 2ZEQA 3JVZX 3UGBB 2LGXA 2REXA 1KM7A 2ONQA 2V9HA 4KIKA 1F77A 1OEYA 1FD6A 4DHZB 4ZRIA 4ASWC 4RM8A 4D2KA 2IO0B 4JIOU 4PS7A 4MELA 1OTRB 2LGSA 4K3CA 4CHKA 2INCC 4OZAA 5AZHA 4OZBA 3QCAA 5IN7A 3M95A 4HXDA 3PRPB 1ISNA 3EA6A 4L2YA 1HZ5A 3W5VB 4WURA 2C60A 4BKSA 1L7YA 4II3B 1LFDA 4RGOS 4ZYNA 4HPPA 2BYFA 1E90A 1R4NI 1FIQA 2DAJA 3WA0A 1R4MB 3R2TA 4HJGE 2MCNB 4ZRPA 1WRIA 5AEKB 1SSNA 1FNUA 1RRBA 2CJNA 1YMHE 4URKA 2NBVB 3URYA 2AQ3B 2KZRA 3TBLD 3A4RA 2H89B 3MC9A 4ZYSA 4XDCA 2MWSB 1NDDA 4DDGD 1WMHA 3FAHA 2XK5A 2KC1A 5J17A 2WXMA 3AN1A 3B2GA 1IBXA 1N61A 1PUTA 2B3AA 4LNOA 1JMLA 1E8YA 2JXXA 3BYTB 2BGFA 3JSVB 1AW7A 1SB3C 1V1PA 3N1YC 3PRZA 3NVWA 3UINB 5IAAC 4GXBA 2BYEA 3PHXB 1ROEA 1RLFA 1WX9A 3PSEB 4K81A 4ITKA 3PZ8A 2QEJC 1TYGB 2DWQA 2BTEA 2K8HA 4M01A 5CHFA 3L08A 3OJ3A 4GOCA 3N20C 3P2BA 5C2TB 2N7DA 4YSYB 2JSVX 2Z8LA 4LCDE 1ZOYB 1CK1A 2HDEA 2KNBA 4W9CA 1WZ3A 3NRZA 4GDKA 5DPWA 4JGHB 2M8SA 5FR6A 3AM9A 1S3SG 1V80A 2KVRA 2MBHA 4F1SA 3K9PB 2G45B 1J8CA 2IO1B 2GMIC 1KLUD 2AWTA 2JRHA 1K53A 1UWMA 2OHFA 1HTQA 4FJVB 2Z59B 4LNIA 2KTRB 2LXAA 1T0QC 1FXTB 1IPGA 4KIKB 2O6VD 1VZ6A 2W3RA 1PGBA 1R4NB 5EE1A 1XD3B 2MH7A 2IPKD 2MRPA 1C76A 2AL3A 4K7WA 2K39A 3AU4A 4HCNB 2IBIB 2XEWA 1UF0A 1SE3A 2LHEA 4AJWA 2MSED 3EFUA 1JROA 4US8A 3N30A 3GZNI 4WWNA 4F7ZA 5I4DA 4HRSA 3ZNZB 4IUMB 4ACFA 4W9JA 2WXQA 2KXJA 2BB5A 5C1ZA 1ET6A 4PK1A 1MHHE 4HLEA 3EGRA 4IM0A 2LFIA 2CHZA 3MJ5A 2GBKA 4A6QA 4A90A 2DZMA 3NY5A 3OWEB 4I6NB 2WDRB 2GB1A 1RYJA 1KLVA 1E6EB 2QHOA 4ANVA 4TV3A 2BPSA 2JZPA 4A55A 4KDIC 4USAA 1WMHB 1MJDA 2XK5B 3O13A 3U7DA 1YNTE 2WX0A 3EUB2 1P1AA 3OAWA 4TMAB 4YWGG 1U4AA 1IBXB 2K3UA 3V61A 3DHGC 2KN4A 1D5XC 3LB8C 1KTKA 2H88B 3D32A 3VQIA 1WRDB 5IOIA 2PVGC 4X57B 4DBGA 2K22A 2K9XA 3ZTCA 2MX2A 2KWVB 4A20A 1JWMD 4MT5A 2RPVA 1WR6E 2IGGA 3AEGB 1V1PB 3EFCA 3QQ8B 3LJ3A 1BUIC 2JXTA 3NJTA 2PLPA 2JWUA 1K50A 2FAZA 4AOFA 4AP4C 3IAM1 3DBLI 2HTME 4MGIE 4M0WA 1P7EA 1FFUA 2J0JA 2L1AA 5HFYA 3QC8B 1YD8U 3AB5A 5LXHA 3ZO5B 3AE3B 1YQBA 1OEYJ 3K9OB 1FO4A 4GLSC 3AEFB 1ET9A 2TSSA 2L32A 3L4PA 4GDKB 1HTOA 4BOZB 2PKOA 4K3BA 3NUHB 4WJNA 1L6UA 1FEHA 2IO2B 5JH5C 4CQNA 2MBOA 3N1ZC 4C7YA 1GG3A 1YQ3B 2DZIA 3GZNB 2WXKA 2DAFA 4C00A 2ZW1A 5CHVC 5EE3A 1ZW7A 1E7UA 2NTTA 1JCKB 4EUTA 3KW5B 2CHWA 3RD2A 1R7SA 4DXAB 3IBEA 5KHQA 4IDIA 1JRPA 2FIFA 4RF1A 2KN5A 1XLQA 2GI9A 3RUIB 3TCAA 3ZVVA 2WDVB 2ZVNA 4IW0A 3Q8CA 1I42A 1L4ZB 4LNNA 2RR9A 4KGRA 4AJYB 4HPLB 3WALA 5H8YE 2C9WB 3AEBB 3H9DA 2WNMA 1WXQA 1HE8A 3OJ4B 3HVZA 1XCQL 4BKSD 3HVDA 1Z5SB 5TR5A 4R3DA 3FC4A 4MJSA 1MHXA 1UD7A 3CSTA 4WJOA 4G0NB 2N1VA 1RWSA 1B1ZA 2ICIA 1FM0D 3V6EB 3KUCB 4G11A 1I4RA 1AN8A 3OG5A 2RDBC 1XF5L 3C19A 1XCTL 2MBEA 1KRHA 2R2OA 3I3TB 1WJ6A 1V8CA 4FLHA 4B0EA 1DOXA 4H2AA 3ZNGC 3ZXVA 2WXFA 2W55A 1AYFA 3H7PB 3WCQA 2AL6A 1JW9D 3Q8AA 1OQYA 4AWJA 3UIOB 5IKCM 2AYOB 3B0AA 1JWUD 4JX1C 5GMVA 5KHOA 3ZIMA 1WSPA 4YXDB 3VH4B 3BVMA 1UUPA 3RNFC 3TIXA 3VUYA 3T3OA 4L23A 3DWMA 1FRRA 1OFFA 4ANUA 2K5PA 1Y8RC 1C4PA 2CJOA 3P42A 1V9JA 5DCNA 3UF8A 2KDBA 2AEHA 3V3XA 2KMAA 3NVZA 2WDTB 2LHDA 1FCCC 1NEKB 4GIVA 1ZKHA 4JPSA 4TSSA 1JWSD 3DVNU 1NYQA 4WIPA 3B1LX 2D11A 1TJEA 1IGDA 3NVYA 1PFDA 4MH0E 2BBCA 4ZDVA 3V05A 2ON8A 4EFOA 4P1CC 4XE0A 1F52A 2MJEA 2INDC 5D94A 4C56C 4N58A 1I4GA 2OEDA 4HVBA 2XN9C 3AI5A 2WXPA 3WIMA 2ZPNA 5D7GA 3IFWB 1TY2A 2KDEB 1JQ4A 5JZEB 1TY0A 1UWXA 4B95A 3L16A 3JYUA 3QHTA 4DDID 4P7IA 3ZJTA 1YJ1A 4GB9A 3CF6E 3MHSD 2Q5WD 2GLSA 3ZRCA 1SEBD 1KFYB 3APFA 3RULA 3BYYB 4XWWA 5D3DA 2BW2A 3X23A 3X0WA 4N9F4 2DHZA 3WAPA 2RDGA 1EU4A 4KZ0A 4MJSB 3DDCB 4PS8A 5FK9C 1GPXA 4C7ZA 2HJ1A 4KKJA 1T5XD 2KQ4X 3LDZE 2Y5CA 3VDZA 4WAFA 1DOIA 1GAQB 5E6NA 1WF9A 2LJIA 1XEEA 4OVZA 2J0KA 1PYWD 2UU7A 3L10B 3T9LA 5CX3A 1OQQA 1SE4A 3TL5A 3N9YC 4ICVA 2SEBD 2LVPA 3AE5B 3GOEA 3EHVA 1NI3A 1QOGA 1VLBA 1LO5D 2K8CA 4ARIA 1WI0A 2RSUA 4KGTA 3PV1A 4S0RA 3AXCA 3ONSA 4KKIA 4KSLC 4P16A 3ETRA 1VJKA 1JALA 3ZGZA 1A5RA 3N32A 2DLBA 1F9JA 3DVGX 2E6XA 1N5XA 2EKEC 1WXVA 4TKNA 1E9MA 5BYQA 3ZDMC 1V81A 2DENB 3GB1A 4HDQA 4Q2JA 4AS1A 2QCZA 4OVUA 1CQVA 2KYWA 1SXTA 1FRDA 3P4SB 3H7SA 2FCMA 2O2VA 2QIEB 3NVVA 3HUIA 4FA6A 2DYMA 1P7FA 4HKQA 1IUEA 3NZSA 3RNBC 4WQMA 2JWZA 4NNJB 1N6ZA 2D2QA 3RNEC 4ZRJA 2ZCBA 2V1YA 1ZGUB 2W82A 4RF0A 3V62A 2KHWB 4MDKE 1QLBB 2QDFA 3VHTC 2RDHA 1WE6A 3PLUA 1XLOA 3SFDB 3HIZA 2D5GA 1Q10A 3HRDD 2KVZA 2NMQA 1TS2A 1UNSA 3ML9A 4DHJB 1JWAD 2BYTA 1ZDVA 2M17A 4W9FA 1TBEA 3IG3A 1FMAD 3PPAA 5HG2A 2UYZB 4LTUA 1TZ1A 1T0RC 4HCPB 2OJRA 4ZRQA 3KYCD 3SFEB 1DYQA 1XLNA 1UELA 2J7QB 2C5LC 2L00B 2D3CA 1GJZA 4NAWA 2WX1A 4IWOA 1V49A 4DQOC 1V6EA 5FKAC 4IM3A 4M8NA 1IYFA 4YTNB 3R7RA 4KVGB 2LZ6A 1ZE3D 2DYOA 3SD5A 4WQOB 2NR2A 1YOVB 4EZJA 1NYRA 2V0GA 1V5OA 2JY6A 1L4DB 3VRBB 2CR5A 1SE9A 2N9EB 2ZJDA 2M19A 1V2YA 2N7JA 3ZXRA 1TKEA 2KDMA 1H4RA 2B76B 2G9HD 4GDLA 1GNUA 1LXDA 2KO3A 2J42A 2L05A 2VZKB 1AARA 3RFZB 2LGIA 4IWPA 4YTMB 1QT9A 2HTHA 1WJNA 2L52A 4KSKC 1L0XB 3Q3OC 1S1QB 3RCZA 2BYVE 1V5TA 5BYRA 4BFRA 1EUVB 2W9NA 2LGYA 4LLGM 3VUXA 2KLGA 3BK1A 3FILA 2A4ZA 1FNVA 1NENB 4MSMB 3AE1B 2O2VB 4MEMA 2RMMA 2INNE 4W9KA 2HD5B 2WWZA 4RH6A 1WM3A 2CU1A 1XLPA 4LNKA 3DBRI 3DBHI 5G55A 2WXRA 3VFKA 2KK8A 2MBQA 1WXMA 1QOBA 3ZKJC 2IJ0A 4FN2A 3C0RB 4IG7B 3IXSA 3R7QA 2LD9A 5EE0A 4MGYE 4XYCA 1QOAA 2M0XA 3CIRB 3L54A 3A1QA 1VCBA 4RNAA 3AE9B 2LVQA 2E3TA 3SEBA 1HZ6A 1CMXB 4P6VF 4RFBA 4WAAA 4IOIE 3ABVB 1WGYA 1WM2A 2MJ3A 3DWGC 4IWQA 2J53A 3JW0X 3PLVA 3BINA 2Y3AA 3U52E 3PO0A 3BY4B 3M62B 4YT0B 4FJZA 3WANA 5BO4B 2FCNA 2ZNVB 1DOYA 5C23A 1I4QA 4E3CA 1K8RB 1ACCA 1AWDA 4DHJD 2KQ7A 3EECA 3KVFB 4ZHOA 2MBBB 1G6JA 2PEAA 5HKHA 2OJWA 1ZXIA 2M56B 3NG0A 1ENFA 1M94A 2IGHA 3AEAB 4FHKA 3KWLA 4GGQA 2J0MA 5L83A 3TUOA 3PS6A 2LVOA 1PGAA 1RFAA 3AE8B 2D3BA 1V1OA 1XT9B 2GBMA 2FUHB 4W9DA 2L0TA 4WWMA 1C78A 2YEPB 1XXGA 1TIFA 3SU8X 2BQQA 5DPRA 3UQAA 3N1XC 1PDXA 1MI0A 3RNCC 4JL9A 3A9KA 2RD0A 4GDLB 4II2B 4B9KA 2QMTA 3ZNHB 2M4NA 2V3NA 2X38A 1C4AA 5G5GA 3H6NA 3IT6B 2INPE 1WE7A 2NBWB 3ZLZA 1QZEA 1TZOA 2L7RA 3CWIA 3DBRB 3GE3C 3O65B 3DBHB 3W5UB 2WHIA 3QAQA 4NJ6A 4ZOHC 3KUDB 3KWVA 1YX5B 2MW5A 1GOZA 3APCA 1KF6B 4EE2A 1TKGA 5DPTA 3R3MA 3ZJVA 4L1BA 4A9AA 2A5UA 3Q6BA 2N1WA 2N9KA 3IHPC 2WXOA 1Q5WB 1MG8A 3VR8B 1T0YA 2ASQA 2V3PA 1E0ZA 4XC2A 4NQLB 4YTPB 2LJ5A 4KX6B 2JT4B 1TGZB 2G4SA 2CU3A 4ANXA 3N3KB 2OOBB 4IC7B 2IGDA 3ZQ4A 1FNWA 3QX1A 2VH2A 4MH8A 2UWQA 3TMPB 2FBWB 2DNFA 3ZYYX 1WGGA 2ACZB 4A3OA 5JHBA 4NY0A 3A1QB 1HEZE 3DBLB 1RFKA 3VUWA 1GUAB 1UH6A 4I6PA 1P3QU 4EEWA 1LM8B 1MG4A 3PREA 1ZP0B 1ZPSA 2EELA 2KANA 4W9EA 2O6VA 1P98A 2PE9A 1IP9A 4YSXB 1WJUA 1I7HA 2PPHA 1C77A 2L0FA 3MFGA 2ZPYA 2X8XX 3V6CB 4FXCA 3AE7B 1QILA 4BBNC 2I1KA 2G3QB 4MACA 1X1MA 1I4PA 1P9DU 2KKCA 4M0WB 1J0GA 4JLCA 2FCQA 3KH0A 2LWPA 3Q3MC 2ZCCA 4J6IA 5CHWA 2XBBC 2R61A 2WU2B 1N62A 1NVID 2BB6A 4WJPA 3SDLC 3FKYA 5GXGB 2WXJA 2ZNVC 2LEKA 2JX5A 3IVFA 1E8ZA 4IKGA 3PZDA 1C79A 3GP7A 3R2IA 4QAYA 3NZUA 4OHJA 4NQKE 3RNGC 2PE6B 4DWFA 3RMKC 4DK5A 3A9KB 3RT3B 1BMLC 1P0RA 5LNK1 2D3GA 1STEA 3W9CB 2YLMA 5E6JA 2V4LA 1EWYC 2PMVA 2PW9A 4S17A 2EMTA 1FFVA 3E9SA 4NJCA 2C7HA 4GU2A 2BVCA 3Q8BA 1EM7A 1C4CA 2JVCA 3BK2A 2PTLA 1VD2A 5D3IB 1A70A 3NS8A 3JSVA 3A4SC 1SE2A 2D10A 4GN1A 4DXFA 4TQ0A 4IM2A 1SF0A 3U8ZA 2WXGA 1UGMA 2MLBA 3RZFA 1SGHA 2KJ6A 4XDDA 1B9RA 1YIWA 3VTWA 2JQRB 2C7NB 1MFWA 1TS5A 1YJIA 2L83A 3HM6X 4OVVA 1H8CA 2MHJA 5HI1A 2C7MB 1E10A 2GBRA 1WGRA 1T3QA 4WJQA 1LGRA 2KX3A 2LI5A 2MJDA 2WQYB 4EZLA 1WH3A 1KOTA 3H1UA 2WS3B 3CMMB 2JPHA 4US9A 4W9LA 5BYSA 1WY8A 2K6QA 1HQRD 1TTNA 4BKTA 2D07B 2O6VB 5EE9A 4B0MA 3E56A 3L13A 3AULA 4I6LB 5LXIB 1ESFA 1D4BA 1UBQA 3RI7C 2LRWA 4F8CB 2KD0A 4BVUC 3S2AA 2QILA 2IYDB 1MPEA 1WIAA 4HK2A 3H8HA 4EOYA 3AEDB 3U4EG 3AE2B 1XQQA 3QWZB 2BKRB 1EU3A 4P1BC 2FE8A 4E71A 2JF5A 3QARA 2LRUA 1Z2MA 1FPYA 3VXWA 1V86A 3TEYA 3ENEA 1D3ZA 2WU5B 3IT4B 1E5WA 3DCGA 1JWBD 3DPDA 3I63C 3SHQA 4UDUC 2BKFA 2KWUB 3Q8EA 3I5JC 2FIDA 1UZXB 1I4XA 1K52A 2BT6A 2IZVB 4RCOA 1WGHA 2JU6X 3GS2A 1K51A 2BF8B 2NCNA 3L0WB 3PRMB 2SAKA 2KQSA 4HPMB 3PGEA 2K25A 3QA8A 3T3NA 1T0SC 5G2NA 4GMVA 1E7PB 2EMSA 4N6EB 1Q0WB 4N59A 3KUZA 2CHXA 1E7VA 1NBFC 3V60A 4G3XB 2JYTA 2KC2A 4KDLB 3ZTDA 1L5PA 1C9FA 4HDOA 2QC8A 3VH3B 1F2RI 2EKIA 2PJHA 3AE4B 4NPNA 3B9JA 3VR9B 3NHEB 1L2NA 4RGMA 4JWSC 3RYTA 2WGSA 2G1EA 1WXSA 3VTUA 5CTRC 5IO9A 1C1YB 2DZJA 2V3SA 5G5HA 2QSDA 4C80A 1SJED 1YJJA 1HXYD 2JUOA 2BWFA 2L8JA 4OZCA 2LUEA 4J3OD 2AX5A 3BVGA 3Q8FA 1OQRA 2GBNA 4AUQC 4OW0A 4LJOB 4O1NA 2JZZA 3BZDB 5D6JB 1QF6A 3PZ7A 2DBYA 1WWTA 2K0PA 2N9PC 1YQ4B 3Q3JA 5TSSA 5E6PA 2LASA 3TEWA 1EWCA 1GB1A 1MVKA 3L17A 1BXTA 3NOBA 2WLBA 4PYUA 3M3JA 4JWUC 3WAOA 2IDYA 3AV8A 3Q3FA 4FHJA 2LUMA 4RGNA 2MP2A 4KZCA 2N4FA 3DVGY 2J4XA 1UBIA 3KLSX 3DHHC 2I38A 4G50A 3VVWB 2NPTA 2L3ZA 4HWIB 5H92C 2J52A 3PT2B 1L0VB 4E74A 2KWCA 4NZLB 3MC0B 2KJHB 3HM3A 2WYQA 3ZW3A 2IY1B 5MPOA 3R8BA 2ZZPB 3MC8A 4ANWA 1F1HA 1D5MC 2GBJA 1GC7A 1LQBA 2XNAC 2KMCA 1QQRA 1SBBB 1NI2A 2WXNA 3MTNB 5BMHA 3ECIA 3LXFA 5AUKA 2KFJA 4MM3A 2FNJB 2ZW0A 1I4HA 2QJLA 2BWES 4EKUA 4BBNF 4LNFA 1ZDXA 3HK0A 1EO6A 2HJ8A 3VTVA 3AMZA 4K7SA 1WGDA 3ZRFA 3UI3A 3P63A 1WR1A 5AZFA 4W9HA 2W54A 4BAXA 3Q69A 4YL8A 3BWUD 2KLCA 4MSQB 3DQVA 5J2RA 1J7AA 1EF5A 4PS3A 1ZXHA 2MA9B 1N63A 1KH0A 2KJRA 3ZNID 5L95C 1UGJA 2KFKA 3NS1A 4KV2A 4NAMA 3T8MA 3C8YA 1E8WA 3MP9A 2KDIA 4ZHPA 1WZ0A 1FCLA 1WYWB 5HHDG 3P4PB
chains in the Genus database with same CATH topology
1ZOYB 1CK1A 1XEEA 2LJIA 2HDEA 4NAWB 5BMIA 1C77A 4OVZA 3MFGA 4FXCA 3AE7B 2NTSA 1PYWD 1QILA 3NRZA 2N0SB 4MACA 1OQQA 1SE4A 3AM9A 3N9YC 2YEPF 1I4PA 2JYEA 2SEBD 4TQ1A 3AE5B 1NI3A 1QOGA 1VLBA 1LO5D 1KLUD 4ARIA 1K53A 1UWMA 2OHFA 4KGTA 2R61A 1M4VA 2WU2B 1N62A 1NVID 2BB6A 4AQ7A 4KKIA 1XO3A 4P16A 3ETRA 5GXGB 1VJKA 1JALA 3ZGZA 2WXJA 2DLBA 5BMGA 2LEKA 1SJHD 2E6XA 1N5XA 2JX5A 1E9MA 5BYQA 1VZ6A 2W3RA 1PGBA 5EE1A 3GB1A 1CZPA 4Q2JA 4IKGA 1VRAB 4AS1A 1C79A 1CQVA 2MH7A 4PT5A 3GP7A 3R2IA 2IPKD 1C76A 1SXTA 4OHJA 1FRDA 3P4SB 2QIEB 3NVVA 3HUIA 2DYMA 4RGTA 1P7FA 4HKQA 1BMLC 1IUEA 2KMMA 1SE3A 2LHEA 5LNK1 4WQMA 2W3SA 2VZKD 1VR9A 1STEA 2BS3B 3W9CB 4REZA 1JROA 4US8A 2V4IB 5E6JA 2MEKA 1EWYC 2PMVA 2PW9A 1V97A 5I4DA 4HRSA 2N9LA 1TS3A 1FFVA 3E9SA 3FILB 4NJCA 2WXQA 2W82A 3Q8BA 1WYGA 1EM7A 2BB5A 4HKZE 1C4CA 4RF0A 1ET6A 3BK2A 1QLBB 1MHHE 2PTLA 3EGRA 2PVOD 5D3IB 2RDHA 2LFIA 5FR3A 1XLOA 3MJ5A 1A70A 3SFDB 4A6QA 4A90A 2I2YA 1QKZA 3OWEB 2D5GA 1Q10A 1SE2A 1YN5A 1RYJA 2GB1A 2WDRB 1E6EB 3TSSA 3HRDD 4DXFA 4TQ0A 2NMQA 3W2DA 1SF0A 1TS2A 1UNSA 2JZPA 2WXGA 4A55A 4USAA 1JWAD 2BS4B 3O13A 4MM3B 1YNTE 3EUB2 4TMAB 4YWGG 2BYTA 1IBXB 4XDDA 2K3UA 1B9RA 3LYYA 1ZDVA 2KN4A 2JQRB 1D5XC 5C3JB 1FMAD 3LB8C 1KTKA 2H88B 1TS5A 1J7BA 2LMCA 3VQIA 5HG2A 1YJIA 2L83A 2PVGC 2K22A 2K9XA 4LTUA 4YSZB 3I9V1 1JWMD 2WXHA 4MT5A 4ZRQA 3U7ZA 2RPVA 3SFEB 1DYQA 1XLNA 5HI1A 2IGGA 1E10A 3AEGB 1V1PB 1T3QA 1BUIC 2JXTA 2PLPA 2JWUA 3VRAB 1K50A 1N5WA 1T6BX 1F2RC 3I57A 4DQOC 2MJDA 1L6VA 2WQYB 5FKAC 3AE6B 4YTNB 2WS3B 1ZE3D 3IAM1 1KLGD 2DYOA 2HTME 1WGKA 1J7CA 1P7EA 4M0WA 1NYRA 4US9A 2V0GA 1FFUA 2L1AA 1L4DB 5BYSA 2KWDA 4LK0M 3VRBB 5HFYA 1HQRD 4B0MA 5EE9A 3E56A 3AB5A 1ESFA 2M19A 1D4BA 3AE3B 3BVZA 2WXIA 3TEZA 3P4RB 2N7JA 1FXAA 1TKEA 2KDMA 1FO4A 2QILA 1L0YB 2B76B 2G9HD 3AEFB 4GLSC 1ET9A 2TSSA 2L32A 3L4PA 1CJEA 4GDKB 1MPEA 4KGSA 2J42A 3H8HA 2PKOA 3NUHB 2VZKB 3J9CA 3AH7A 1L6UA 1FEHA 3RFZB 4HEA1 2AQ2B 3AEDB 3U4EG 3AE2B 4CQNA 1EU3A 1VZ7A 2LGIA 3KQ4A 4DXGA 4C7YA 2FE8A 3IAS1 4YTMB 1YQ3B 1QT9A 1PGXA 4WH4A 2L52A 1L0XB 1HA5A 3P4QB 1ZUD2 3TEYA 2WXKA 5BYRA 1TS4A 2ZW1A 3P1MA 5EE3A 1YN4A 2WU5B 3IT4B 1JWBD 4LLGM 4UDUC 2NTTA 4JE3B 1JCKB 3BK1A 3RPFC 3FILA 3Q8EA 1VDVA 1R7SA 1FNVA 1NENB 1I4XA 3AE1B 4IDIA 4ARCA 2BT6A 1K52A 2RMMA 4RCOA 3MHZA 1JRPA 2INNE 3GS2A 2JU6X 5AUIA 1K51A 4RF1A 1XLQA 2GI9A 3BIID 2SAKA 1SIJA 4RH6A 1DGJA 3T3NA 1XLPA 1VZ8A 2M0AA 1E7PB 1D5ZC 2WXRA 2WDVB 2AQ1B 5T8IA 3Q8CA 1D6EC 1QOBA 2IJ0A 4N6EB 1L4ZB 2PIAA 2WP9B 1Y56A 4N59A 3IXSA 4KGRA 5EE0A 5H8YE 1QOAA 3W1SA 3CIRB 2JYTA 3AEBB 2WNMA 1WXQA 4RNAA 3NZ3A 3AE9B 2E3TA 3HVZA 4HROA 3SEBA 1L5PA 1XCQL 1C9FA 1F0ZA 1HZ6A 3HVDA 4P6VF 1N60A 1F2RI 2KAJA 2EKIA 4RFBA 1TKYA 4R3DA 3AE4B 3AECB 4IOIE 3FC4A 3B9JA 3VR9B 3ABVB 1MHXA 2MJ3A 3DWGC 5HHDG 1QOFA 2J53A 2BS2B 4RGMA 1GB4A 4JWSC 2G1EA 1RWSA 2Y3AA 1B1ZA 2KACA 2ICIA 3U52E 3PO0A 3TEXA 5G5HA 1FM0D 4A8XC 4YT0B 2Y5PA 2QSDA 4C80A 1SJED 3ZJUA 1I4RA 1AN8A 1YJJA 2GRIA 1DOYA 1HXYD 1I4QA 1XF5L 2WDQB 1AWDA 1ACCA 1IGCA 1XCTL 4OZCA 3U2SC 4J3OD 2FUG1 4ZHOA 2AX5A 3B2FA 3BVGA 3Q8FA 2WXLA 1FXIA 1KRHA 1OQRA 1ZXIA 4OW0A 2M56B 4XWTA 1V8CA 4O1NA 1ENFA 3BZDB 2IGHA 3AEAB 4B0EA 3KWLA 1QF6A 1DOXA 3SR6A 3TUOA 3PZ7A 2DBYA 4H2AA 2WXFA 1WWTA 2W55A 2K0PA 1PGAA 1AYFA 1YQ4B 3AE8B 3WCQA 1V1OA 5TSSA 1JW9D 3Q8AA 1YN3A 5JXVA 1RM6C 3TEWA 3AEEB 1EWCA 4WWMA 1GB1A 1MVKA 1C78A 2YEPB 2ONQA 1JWUD 1BXTA 1F77A 4JX1C 1XXGA 1FD6A 1WSPA 2WLBA 4YXDB 3BVMA 4D2KA 1UUPA 4JWUC 3T3OA 1PDXA 1MI0A 2IDYA 3AV8A 4OZAA 2LUMA 4L23A 3DWMA 4OZBA 4RGNA 1FRRA 1OFFA 4GDLB 2QMTA 2K5PA 1C4PA 2V3NA 2CJOA 2X38A 2J4XA 1C4AA 3KLSX 3EA6A 2I38A 4L2YA 1HZ5A 5G5GA 3W5VB 3P42A 3IT6B 5H92C 2INPE 4WURA 2J52A 1L0VB 4NZLB 3MC0B 4RGOS 1TZOA 3V3XA 3CWIA 3NVZA 5MPOA 3R8BA 2LHDA 1FIQA 1FCCC 1NEKB 3R2TA 4HJGE 3W5UB 4JPSA 4TSSA 1JWSD 4WIPA 1NYQA 4ZRPA 1WRIA 1SSNA 1TJEA 1FNUA 1IGDA 3KWVA 1D5MC 4ZOHC 3NVYA 2CJNA 1PFDA 1YMHE 1GOZA 2XNAC 1QQRA 2BBCA 2AQ3B 3URYA 1KF6B 4EE2A 1TKGA 2H89B 3V05A 3ZJVA 1SBBB 4L1BA 4A9AA 2WXNA 2ON8A 4ZYSA 5BMHA 4XDCA 4XE0A 3LXFA 5AUKA 2N9KA 2WXOA 2MJEA 3VR8B 3FAHA 4C56C 4N58A 2WXMA 1I4GA 2ZW0A 2OEDA 2V3PA 2XN9C 3B2GA 3AN1A 1I4HA 2QJLA 1E0ZA 1IBXA 1N61A 1PUTA 2WXPA 5D7GA 1TY2A 4YTPB 4KX6B 1JMLA 3BYTB 1ZDXA 2CU3A 1JQ4A 2IGDA 1TY0A 1UWXA 3ZQ4A 1AW7A 1SB3C 3AMZA 1FNWA 4MH8A 2FBWB 3ZYYX 3UI3A 3ZJTA 3P63A 2Q5WD 1V1PA 2W54A 2ACZB 3NVWA 1SEBD 3Q69A 3BWUD 1HEZE 1ROEA 1J7AA 4ITKA 1KFYB 1RFKA 3BYYB 3PZ8A 2QEJC 4XWWA 1ZXHA 1TYGB 1N63A 2DWQA 5D3DA 2BTEA 1KH0A 2BW2A 2RDGA 1EU4A 1ZP0B 1UGJA 1ZPSA 5FK9C 3NS1A 2EELA 1GPXA 4NAMA 4C7ZA 3C8YA 4KKJA 1T5XD 2KQ4X 3MP9A 5C2TB 4ZHPA 4YSYB 2JSVX 2Y5CA 2Z8LA 1FCLA 4YSXB 4WAFA 1DOIA 1GAQB 1I7HA 3P4PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZOY B;  3AV8 A;  1B9R A;  1JRP A;  3DWM A;  1FRR A;  1OFF A;  5AUI A;  1XLQ A;  2JQR B;  3BII D;  4FXC A;  5C3J B;  1FMA D;  1SIJ A;  2K5P A;  3LB8 C;  3AE7 B;  2CJO A;  2H88 B;  3NRZ A;  1J7B A;  1DGJ A;  1XLP A;  2N0S B;  1YJI A;  1E7P B;  2L83 A;  1OQQ A;  2PVG C;  3AM9 A;  2K22 A;  2K9X A;  4LTU A;  5G5G A;  3W5V B;  4YSZ B;  5H92 C;  2WDV B;  1QOB A;  3AE5 B;  1L0V B;  4N6E B;  3SFE B;  1NI3 A;  1QOG A;  1VLB A;  1XLN A;  2PIA A;  2WP9 B;  3AEG B;  4N59 A;  1E10 A;  1T3Q A;  5EE0 A;  3CWI A;  3NVZ A;  5MPO A;  1UWM A;  2OHF A;  5H8Y E;  1QOA A;  1FIQ A;  2WU2 B;  3CIR B;  1N62 A;  1NVI D;  3AEB B;  1WXQ A;  1NEK B;  3VRA B;  1XO3 A;  1N5W A;  3W5U B;  3ETR A;  3AE9 B;  1NYQ A;  1VJK A;  1JAL A;  1WRI A;  1L6V A;  2MJD A;  2E3T A;  2WQY B;  3HVZ A;  4HRO A;  1TJE A;  4ZOH C;  1L5P A;  2LEK A;  3NVY A;  1F0Z A;  2CJN A;  1PFD A;  3AE6 B;  1N5X A;  2JX5 A;  4YTN B;  2WS3 B;  4P6V F;  1E9M A;  1N60 A;  2KAJ A;  2EKI A;  1KF6 B;  1TKY A;  2HTM E;  1TKG A;  1J7C A;  1WGK A;  2H89 B;  1NYR A;  2W3R A;  3AE4 B;  3AEC B;  3ABV B;  1FFU A;  3B9J A;  3FC4 A;  1CZP A;  4US9 A;  5EE1 A;  2MJ3 A;  3DWG C;  5GXG B;  3VRB B;  2MH7 A;  1QOF A;  3LXF A;  5AUK A;  2BS2 B;  5EE9 A;  4JWS C;  2G1E A;  1FRD A;  1RWS A;  2M19 A;  2MJE A;  3AB5 A;  3FAH A;  3P4S B;  3PO0 A;  3AE3 B;  3VR8 B;  2QIE B;  4N58 A;  3P4R B;  3NVV A;  3AN1 A;  3B2G A;  1FM0 D;  3HUI A;  1FXA A;  2QJL A;  1TKE A;  4YT0 B;  5G5H A;  1E0Z A;  1N61 A;  1PUT A;  4C80 A;  1FO4 A;  1IUE A;  2KMM A;  1YJJ A;  2B76 B;  1DOY A;  3AEF B;  4YTP B;  4WQM A;  2W3S A;  3L4P A;  4KX6 B;  1CJE A;  2BS3 B;  2CU3 A;  2WDQ B;  1AWD A;  3W9C B;  1JRO A;  1JQ4 A;  4US8 A;  2PKO A;  4ZHO A;  1EWY C;  1SB3 C;  2AX5 A;  3AMZ A;  3AH7 A;  3B2F A;  1L6U A;  1V97 A;  4HRS A;  1FXI A;  1KRH A;  1OQR A;  1ZXI A;  3AE2 B;  3AED B;  2M56 B;  2FBW B;  1FFV A;  1V8C A;  3ZYY X;  3P63 A;  4C7Y A;  4YTM B;  2Q5W D;  3AEA B;  1WYG A;  3KWL A;  2W54 A;  1QF6 A;  1YQ3 B;  1DOX A;  1QT9 A;  2ACZ B;  3NVW A;  1QLB B;  3SR6 A;  2DBY A;  2L52 A;  2PVO D;  1WWT A;  1ROE A;  2W55 A;  1YQ4 B;  1AYF A;  1J7A A;  1ZUD 2;  3P4Q B;  1XLO A;  3AE8 B;  1A70 A;  1KFY B;  1RFK A;  4ITK A;  3WCQ A;  3SFD B;  3P1M A;  1TYG B;  1JW9 D;  1N63 A;  2DWQ A;  5EE3 A;  2WU5 B;  1JWB D;  1RM6 C;  2WDR B;  1RYJ A;  3AEE B;  4WWM A;  4A9A A;  1ZP0 B;  1E6E B;  3HRD D;  3NS1 A;  4JX1 C;  1SF0 A;  1GPX A;  3RPF C;  4C7Z A;  2WLB A;  4YXD B;  3VR9 B;  4USA A;  1VDV A;  5C2T B;  1R7S A;  1JWA D;  4YSY B;  1NEN B;  2BS4 B;  2Y5C A;  4ZHP A;  3AE1 B;  3EUB 2;  4JWU C;  1DOI A;  4IDI A;  4YSX B;  1PDX A;  1GAQ B;  1I7H A;  3P4P B;  2BT6 A; 
#chains in the Genus database with same CATH topology
 4NAW B;  5BMI A;  2Y5B B;  4LDT B;  4WWO A;  3DBS A;  4M00 A;  4FBJ B;  3H7P A;  2NTS A;  2Z0E B;  2R2Q A;  2N0S B;  1Q1O A;  2YEP F;  2JYE A;  4TQ1 A;  3PTF C;  2CS4 A;  4A3P A;  4CO7 A;  3DVN V;  2LXC A;  4ICU A;  3W1S C;  1M4V A;  4AQ7 A;  1XO3 A;  4ZRK A;  2FCS A;  3QIJ A;  5IA7 A;  3A33 B;  3Q2A C;  5BMG A;  1SJH D;  4TUU A;  4W9I A;  4BZA A;  2N9X A;  4FJY A;  3ZDT A;  1WX8 A;  1CZP A;  1VRA B;  4PT5 A;  2K6D B;  2YVC A;  3VAW A;  1PQS A;  3TJP A;  4K1R B;  5D2M B;  1TT5 B;  2K8B A;  3PVL A;  4RGT A;  2MP2 B;  2KMM A;  2W3S A;  2VZK D;  1VR9 A;  4GSW A;  2BS3 B;  1RAX A;  4REZ A;  3MJW A;  2V4I B;  3B08 A;  2MEK A;  2NPT B;  1YX6 B;  1V97 A;  2CKH B;  2N9L A;  1TS3 A;  4K7U A;  3FIL B;  1WJ4 A;  2RGF A;  1WYG A;  4HKZ E;  2VRR B;  2K1F A;  4DHZ E;  1OGW A;  2PVO D;  5FR3 A;  2LGD A;  4MGK E;  2DYB A;  4WWP A;  2I2Y A;  1BT0 A;  1QKZ A;  3U30 A;  2NBU A;  1YN5 A;  3DOW A;  3TSS A;  3W2D A;  3RNA C;  3QK0 A;  3PHW B;  2BS4 B;  4MM3 B;  2MQJ A;  4MGZ E;  5E6O A;  4BOS C;  3OLM D;  2KX0 A;  2N7E A;  3AU5 A;  1WX7 A;  3LYY A;  4EZK A;  3HHM A;  5C3J B;  3WAM A;  4CYE A;  2LMC A;  1J7B A;  5AZG A;  3APD A;  3ALB A;  4XGA B;  4RM9 A;  3Q3N C;  4YSZ B;  2I1J A;  3I9V 1;  2WXH A;  4C4V A;  2IY0 B;  3U7Z A;  1SIF A;  5IP4 D;  2L76 A;  2KOX A;  2DZK A;  3VRA B;  3GE8 C;  1N5W A;  1T6B X;  1F2R C;  3I57 A;  3A9J A;  1L6V A;  2KTF A;  1GC6 A;  2JRI B;  3AE6 B;  1KLG D;  2KFK B;  4RMA A;  1WGK A;  1J7C A;  2KWD A;  4LK0 M;  3RN9 C;  3BVZ A;  2WXI A;  3TEZ A;  3P4R B;  3ML8 A;  1FXA A;  3CSF A;  1L0Y B;  2NVU I;  1CJE A;  4KGS A;  2GOW A;  2G4D B;  3J9C A;  3AH7 A;  4HEA 1;  2AQ2 B;  1VZ7 A;  3KQ4 A;  4DXG A;  3IAS 1;  4LJP B;  4BKG A;  4LDT D;  5EDS A;  1PGX A;  4WH4 A;  5JHA A;  4XZ4 A;  1HA5 A;  3P4Q B;  1ZUD 2;  4W9G A;  3M63 B;  5J18 A;  1TS4 A;  3P1M A;  1YN4 A;  4B6W A;  4M02 A;  1JRU A;  4NJ7 A;  4JE3 B;  3RPF C;  1VDV A;  2ZVO A;  1WFY A;  4ARC A;  3MHZ A;  2Z0D B;  3UQB A;  5AUI A;  3BII D;  5LLI A;  1SIJ A;  3R66 C;  1DGJ A;  4FAD A;  3UIP B;  2D3A A;  1VZ8 A;  2M0A A;  1R4M I;  1D5Z C;  2AQ1 B;  5T8I A;  1D6E C;  3Q14 C;  3W1Y A;  2PIA A;  2JZ3 B;  2WP9 B;  3RZW C;  1Y56 A;  2DX5 B;  4XX5 A;  1I35 A;  3ZUN A;  3W1S A;  1KJT A;  3NZ3 A;  4HRO A;  2KT7 A;  1F0Z A;  4JQW C;  3KYD D;  1N60 A;  2KAJ A;  1EF1 A;  1TKY A;  4PYZ A;  3AEC B;  5DPS A;  1QOF A;  2BS2 B;  2HE7 A;  2RPQ A;  1GB4 A;  3QJZ A;  2NS5 A;  2KAC A;  3TEX A;  4A8X C;  2Y5P A;  3ZJU A;  2GRI A;  2WDQ B;  3U2S C;  1IGC A;  2M1M A;  2FUG 1;  1J19 A;  2KDF B;  3B2F A;  1C3T A;  4C4V B;  2WXL A;  1WXA A;  1FXI A;  3EC8 A;  4XWT A;  4M8M A;  3DHI C;  2VH1 A;  2IO3 B;  3SR6 A;  3A9J B;  2KTR A;  1E8X A;  4FUL A;  1YN3 A;  5JXV A;  1RM6 C;  4HJK A;  3AEE B;  2ZEQ A;  3JVZ X;  3UGB B;  2LGX A;  2REX A;  1KM7 A;  2ONQ A;  2V9H A;  4KIK A;  1F77 A;  1OEY A;  1FD6 A;  4DHZ B;  4ZRI A;  4ASW C;  4RM8 A;  4D2K A;  2IO0 B;  4JIO U;  4PS7 A;  4MEL A;  1OTR B;  2LGS A;  4K3C A;  4CHK A;  2INC C;  4OZA A;  5AZH A;  4OZB A;  3QCA A;  5IN7 A;  3M95 A;  4HXD A;  3PRP B;  1ISN A;  3EA6 A;  4L2Y A;  1HZ5 A;  3W5V B;  4WUR A;  2C60 A;  4BKS A;  1L7Y A;  4II3 B;  1LFD A;  4RGO S;  4ZYN A;  4HPP A;  2BYF A;  1E90 A;  1R4N I;  1FIQ A;  2DAJ A;  3WA0 A;  1R4M B;  3R2T A;  4HJG E;  2MCN B;  4ZRP A;  1WRI A;  5AEK B;  1SSN A;  1FNU A;  1RRB A;  2CJN A;  1YMH E;  4URK A;  2NBV B;  3URY A;  2AQ3 B;  2KZR A;  3TBL D;  3A4R A;  2H89 B;  3MC9 A;  4ZYS A;  4XDC A;  2MWS B;  1NDD A;  4DDG D;  1WMH A;  3FAH A;  2XK5 A;  2KC1 A;  5J17 A;  2WXM A;  3AN1 A;  3B2G A;  1IBX A;  1N61 A;  1PUT A;  2B3A A;  4LNO A;  1JML A;  1E8Y A;  2JXX A;  3BYT B;  2BGF A;  3JSV B;  1AW7 A;  1SB3 C;  1V1P A;  3N1Y C;  3PRZ A;  3NVW A;  3UIN B;  5IAA C;  4GXB A;  2BYE A;  3PHX B;  1ROE A;  1RLF A;  1WX9 A;  3PSE B;  4K81 A;  4ITK A;  3PZ8 A;  2QEJ C;  1TYG B;  2DWQ A;  2BTE A;  2K8H A;  4M01 A;  5CHF A;  3L08 A;  3OJ3 A;  4GOC A;  3N20 C;  3P2B A;  5C2T B;  2N7D A;  4YSY B;  2JSV X;  2Z8L A;  4LCD E;  1ZOY B;  1CK1 A;  2HDE A;  2KNB A;  4W9C A;  1WZ3 A;  3NRZ A;  4GDK A;  5DPW A;  4JGH B;  2M8S A;  5FR6 A;  3AM9 A;  1S3S G;  1V80 A;  2KVR A;  2MBH A;  4F1S A;  3K9P B;  2G45 B;  1J8C A;  2IO1 B;  2GMI C;  1KLU D;  2AWT A;  2JRH A;  1K53 A;  1UWM A;  2OHF A;  1HTQ A;  4FJV B;  2Z59 B;  4LNI A;  2KTR B;  2LXA A;  1T0Q C;  1FXT B;  1IPG A;  4KIK B;  2O6V D;  1VZ6 A;  2W3R A;  1PGB A;  1R4N B;  5EE1 A;  1XD3 B;  2MH7 A;  2IPK D;  2MRP A;  1C76 A;  2AL3 A;  4K7W A;  2K39 A;  3AU4 A;  4HCN B;  2IBI B;  2XEW A;  1UF0 A;  1SE3 A;  2LHE A;  4AJW A;  2MSE D;  3EFU A;  1JRO A;  4US8 A;  3N30 A;  3GZN I;  4WWN A;  4F7Z A;  5I4D A;  4HRS A;  3ZNZ B;  4IUM B;  4ACF A;  4W9J A;  2WXQ A;  2KXJ A;  2BB5 A;  5C1Z A;  1ET6 A;  4PK1 A;  1MHH E;  4HLE A;  3EGR A;  4IM0 A;  2LFI A;  2CHZ A;  3MJ5 A;  2GBK A;  4A6Q A;  4A90 A;  2DZM A;  3NY5 A;  3OWE B;  4I6N B;  2WDR B;  2GB1 A;  1RYJ A;  1KLV A;  1E6E B;  2QHO A;  4ANV A;  4TV3 A;  2BPS A;  2JZP A;  4A55 A;  4KDI C;  4USA A;  1WMH B;  1MJD A;  2XK5 B;  3O13 A;  3U7D A;  1YNT E;  2WX0 A;  3EUB 2;  1P1A A;  3OAW A;  4TMA B;  4YWG G;  1U4A A;  1IBX B;  2K3U A;  3V61 A;  3DHG C;  2KN4 A;  1D5X C;  3LB8 C;  1KTK A;  2H88 B;  3D32 A;  3VQI A;  1WRD B;  5IOI A;  2PVG C;  4X57 B;  4DBG A;  2K22 A;  2K9X A;  3ZTC A;  2MX2 A;  2KWV B;  4A20 A;  1JWM D;  4MT5 A;  2RPV A;  1WR6 E;  2IGG A;  3AEG B;  1V1P B;  3EFC A;  3QQ8 B;  3LJ3 A;  1BUI C;  2JXT A;  3NJT A;  2PLP A;  2JWU A;  1K50 A;  2FAZ A;  4AOF A;  4AP4 C;  3IAM 1;  3DBL I;  2HTM E;  4MGI E;  4M0W A;  1P7E A;  1FFU A;  2J0J A;  2L1A A;  5HFY A;  3QC8 B;  1YD8 U;  3AB5 A;  5LXH A;  3ZO5 B;  3AE3 B;  1YQB A;  1OEY J;  3K9O B;  1FO4 A;  4GLS C;  3AEF B;  1ET9 A;  2TSS A;  2L32 A;  3L4P A;  4GDK B;  1HTO A;  4BOZ B;  2PKO A;  4K3B A;  3NUH B;  4WJN A;  1L6U A;  1FEH A;  2IO2 B;  5JH5 C;  4CQN A;  2MBO A;  3N1Z C;  4C7Y A;  1GG3 A;  1YQ3 B;  2DZI A;  3GZN B;  2WXK A;  2DAF A;  4C00 A;  2ZW1 A;  5CHV C;  5EE3 A;  1ZW7 A;  1E7U A;  2NTT A;  1JCK B;  4EUT A;  3KW5 B;  2CHW A;  3RD2 A;  1R7S A;  4DXA B;  3IBE A;  5KHQ A;  4IDI A;  1JRP A;  2FIF A;  4RF1 A;  2KN5 A;  1XLQ A;  2GI9 A;  3RUI B;  3TCA A;  3ZVV A;  2WDV B;  2ZVN A;  4IW0 A;  3Q8C A;  1I42 A;  1L4Z B;  4LNN A;  2RR9 A;  4KGR A;  4AJY B;  4HPL B;  3WAL A;  5H8Y E;  2C9W B;  3AEB B;  3H9D A;  2WNM A;  1WXQ A;  1HE8 A;  3OJ4 B;  3HVZ A;  1XCQ L;  4BKS D;  3HVD A;  1Z5S B;  5TR5 A;  4R3D A;  3FC4 A;  4MJS A;  1MHX A;  1UD7 A;  3CST A;  4WJO A;  4G0N B;  2N1V A;  1RWS A;  1B1Z A;  2ICI A;  1FM0 D;  3V6E B;  3KUC B;  4G11 A;  1I4R A;  1AN8 A;  3OG5 A;  2RDB C;  1XF5 L;  3C19 A;  1XCT L;  2MBE A;  1KRH A;  2R2O A;  3I3T B;  1WJ6 A;  1V8C A;  4FLH A;  4B0E A;  1DOX A;  4H2A A;  3ZNG C;  3ZXV A;  2WXF A;  2W55 A;  1AYF A;  3H7P B;  3WCQ A;  2AL6 A;  1JW9 D;  3Q8A A;  1OQY A;  4AWJ A;  3UIO B;  5IKC M;  2AYO B;  3B0A A;  1JWU D;  4JX1 C;  5GMV A;  5KHO A;  3ZIM A;  1WSP A;  4YXD B;  3VH4 B;  3BVM A;  1UUP A;  3RNF C;  3TIX A;  3VUY A;  3T3O A;  4L23 A;  3DWM A;  1FRR A;  1OFF A;  4ANU A;  2K5P A;  1Y8R C;  1C4P A;  2CJO A;  3P42 A;  1V9J A;  5DCN A;  3UF8 A;  2KDB A;  2AEH A;  3V3X A;  2KMA A;  3NVZ A;  2WDT B;  2LHD A;  1FCC C;  1NEK B;  4GIV A;  1ZKH A;  4JPS A;  4TSS A;  1JWS D;  3DVN U;  1NYQ A;  4WIP A;  3B1L X;  2D11 A;  1TJE A;  1IGD A;  3NVY A;  1PFD A;  4MH0 E;  2BBC A;  4ZDV A;  3V05 A;  2ON8 A;  4EFO A;  4P1C C;  4XE0 A;  1F52 A;  2MJE A;  2IND C;  5D94 A;  4C56 C;  4N58 A;  1I4G A;  2OED A;  4HVB A;  2XN9 C;  3AI5 A;  2WXP A;  3WIM A;  2ZPN A;  5D7G A;  3IFW B;  1TY2 A;  2KDE B;  1JQ4 A;  5JZE B;  1TY0 A;  1UWX A;  4B95 A;  3L16 A;  3JYU A;  3QHT A;  4DDI D;  4P7I A;  3ZJT A;  1YJ1 A;  4GB9 A;  3CF6 E;  3MHS D;  2Q5W D;  2GLS A;  3ZRC A;  1SEB D;  1KFY B;  3APF A;  3RUL A;  3BYY B;  4XWW A;  5D3D A;  2BW2 A;  3X23 A;  3X0W A;  4N9F 4;  2DHZ A;  3WAP A;  2RDG A;  1EU4 A;  4KZ0 A;  4MJS B;  3DDC B;  4PS8 A;  5FK9 C;  1GPX A;  4C7Z A;  2HJ1 A;  4KKJ A;  1T5X D;  2KQ4 X;  3LDZ E;  2Y5C A;  3VDZ A;  4WAF A;  1DOI A;  1GAQ B;  5E6N A;  1WF9 A;  2LJI A;  1XEE A;  4OVZ A;  2J0K A;  1PYW D;  2UU7 A;  3L10 B;  3T9L A;  5CX3 A;  1OQQ A;  1SE4 A;  3TL5 A;  3N9Y C;  4ICV A;  2SEB D;  2LVP A;  3AE5 B;  3GOE A;  3EHV A;  1NI3 A;  1QOG A;  1VLB A;  1LO5 D;  2K8C A;  4ARI A;  1WI0 A;  2RSU A;  4KGT A;  3PV1 A;  4S0R A;  3AXC A;  3ONS A;  4KKI A;  4KSL C;  4P16 A;  3ETR A;  1VJK A;  1JAL A;  3ZGZ A;  1A5R A;  3N32 A;  2DLB A;  1F9J A;  3DVG X;  2E6X A;  1N5X A;  2EKE C;  1WXV A;  4TKN A;  1E9M A;  5BYQ A;  3ZDM C;  1V81 A;  2DEN B;  3GB1 A;  4HDQ A;  4Q2J A;  4AS1 A;  2QCZ A;  4OVU A;  1CQV A;  2KYW A;  1SXT A;  1FRD A;  3P4S B;  3H7S A;  2FCM A;  2O2V A;  2QIE B;  3NVV A;  3HUI A;  4FA6 A;  2DYM A;  1P7F A;  4HKQ A;  1IUE A;  3NZS A;  3RNB C;  4WQM A;  2JWZ A;  4NNJ B;  1N6Z A;  2D2Q A;  3RNE C;  4ZRJ A;  2ZCB A;  2V1Y A;  1ZGU B;  2W82 A;  4RF0 A;  3V62 A;  2KHW B;  4MDK E;  1QLB B;  2QDF A;  3VHT C;  2RDH A;  1WE6 A;  3PLU A;  1XLO A;  3SFD B;  3HIZ A;  2D5G A;  1Q10 A;  3HRD D;  2KVZ A;  2NMQ A;  1TS2 A;  1UNS A;  3ML9 A;  4DHJ B;  1JWA D;  2BYT A;  1ZDV A;  2M17 A;  4W9F A;  1TBE A;  3IG3 A;  1FMA D;  3PPA A;  5HG2 A;  2UYZ B;  4LTU A;  1TZ1 A;  1T0R C;  4HCP B;  2OJR A;  4ZRQ A;  3KYC D;  3SFE B;  1DYQ A;  1XLN A;  1UEL A;  2J7Q B;  2C5L C;  2L00 B;  2D3C A;  1GJZ A;  4NAW A;  2WX1 A;  4IWO A;  1V49 A;  4DQO C;  1V6E A;  5FKA C;  4IM3 A;  4M8N A;  1IYF A;  4YTN B;  3R7R A;  4KVG B;  2LZ6 A;  1ZE3 D;  2DYO A;  3SD5 A;  4WQO B;  2NR2 A;  1YOV B;  4EZJ A;  1NYR A;  2V0G A;  1V5O A;  2JY6 A;  1L4D B;  3VRB B;  2CR5 A;  1SE9 A;  2N9E B;  2ZJD A;  2M19 A;  1V2Y A;  2N7J A;  3ZXR A;  1TKE A;  2KDM A;  1H4R A;  2B76 B;  2G9H D;  4GDL A;  1GNU A;  1LXD A;  2KO3 A;  2J42 A;  2L05 A;  2VZK B;  1AAR A;  3RFZ B;  2LGI A;  4IWP A;  4YTM B;  1QT9 A;  2HTH A;  1WJN A;  2L52 A;  4KSK C;  1L0X B;  3Q3O C;  1S1Q B;  3RCZ A;  2BYV E;  1V5T A;  5BYR A;  4BFR A;  1EUV B;  2W9N A;  2LGY A;  4LLG M;  3VUX A;  2KLG A;  3BK1 A;  3FIL A;  2A4Z A;  1FNV A;  1NEN B;  4MSM B;  3AE1 B;  2O2V B;  4MEM A;  2RMM A;  2INN E;  4W9K A;  2HD5 B;  2WWZ A;  4RH6 A;  1WM3 A;  2CU1 A;  1XLP A;  4LNK A;  3DBR I;  3DBH I;  5G55 A;  2WXR A;  3VFK A;  2KK8 A;  2MBQ A;  1WXM A;  1QOB A;  3ZKJ C;  2IJ0 A;  4FN2 A;  3C0R B;  4IG7 B;  3IXS A;  3R7Q A;  2LD9 A;  5EE0 A;  4MGY E;  4XYC A;  1QOA A;  2M0X A;  3CIR B;  3L54 A;  3A1Q A;  1VCB A;  4RNA A;  3AE9 B;  2LVQ A;  2E3T A;  3SEB A;  1HZ6 A;  1CMX B;  4P6V F;  4RFB A;  4WAA A;  4IOI E;  3ABV B;  1WGY A;  1WM2 A;  2MJ3 A;  3DWG C;  4IWQ A;  2J53 A;  3JW0 X;  3PLV A;  3BIN A;  2Y3A A;  3U52 E;  3PO0 A;  3BY4 B;  3M62 B;  4YT0 B;  4FJZ A;  3WAN A;  5BO4 B;  2FCN A;  2ZNV B;  1DOY A;  5C23 A;  1I4Q A;  4E3C A;  1K8R B;  1ACC A;  1AWD A;  4DHJ D;  2KQ7 A;  3EEC A;  3KVF B;  4ZHO A;  2MBB B;  1G6J A;  2PEA A;  5HKH A;  2OJW A;  1ZXI A;  2M56 B;  3NG0 A;  1ENF A;  1M94 A;  2IGH A;  3AEA B;  4FHK A;  3KWL A;  4GGQ A;  2J0M A;  5L83 A;  3TUO A;  3PS6 A;  2LVO A;  1PGA A;  1RFA A;  3AE8 B;  2D3B A;  1V1O A;  1XT9 B;  2GBM A;  2FUH B;  4W9D A;  2L0T A;  4WWM A;  1C78 A;  2YEP B;  1XXG A;  1TIF A;  3SU8 X;  2BQQ A;  5DPR A;  3UQA A;  3N1X C;  1PDX A;  1MI0 A;  3RNC C;  4JL9 A;  3A9K A;  2RD0 A;  4GDL B;  4II2 B;  4B9K A;  2QMT A;  3ZNH B;  2M4N A;  2V3N A;  2X38 A;  1C4A A;  5G5G A;  3H6N A;  3IT6 B;  2INP E;  1WE7 A;  2NBW B;  3ZLZ A;  1QZE A;  1TZO A;  2L7R A;  3CWI A;  3DBR B;  3GE3 C;  3O65 B;  3DBH B;  3W5U B;  2WHI A;  3QAQ A;  4NJ6 A;  4ZOH C;  3KUD B;  3KWV A;  1YX5 B;  2MW5 A;  1GOZ A;  3APC A;  1KF6 B;  4EE2 A;  1TKG A;  5DPT A;  3R3M A;  3ZJV A;  4L1B A;  4A9A A;  2A5U A;  3Q6B A;  2N1W A;  2N9K A;  3IHP C;  2WXO A;  1Q5W B;  1MG8 A;  3VR8 B;  1T0Y A;  2ASQ A;  2V3P A;  1E0Z A;  4XC2 A;  4NQL B;  4YTP B;  2LJ5 A;  4KX6 B;  2JT4 B;  1TGZ B;  2G4S A;  2CU3 A;  4ANX A;  3N3K B;  2OOB B;  4IC7 B;  2IGD A;  3ZQ4 A;  1FNW A;  3QX1 A;  2VH2 A;  4MH8 A;  2UWQ A;  3TMP B;  2FBW B;  2DNF A;  3ZYY X;  1WGG A;  2ACZ B;  4A3O A;  5JHB A;  4NY0 A;  3A1Q B;  1HEZ E;  3DBL B;  1RFK A;  3VUW A;  1GUA B;  1UH6 A;  4I6P A;  1P3Q U;  4EEW A;  1LM8 B;  1MG4 A;  3PRE A;  1ZP0 B;  1ZPS A;  2EEL A;  2KAN A;  4W9E A;  2O6V A;  1P98 A;  2PE9 A;  1IP9 A;  4YSX B;  1WJU A;  1I7H A;  2PPH A;  1C77 A;  2L0F A;  3MFG A;  2ZPY A;  2X8X X;  3V6C B;  4FXC A;  3AE7 B;  1QIL A;  4BBN C;  2I1K A;  2G3Q B;  4MAC A;  1X1M A;  1I4P A;  1P9D U;  2KKC A;  4M0W B;  1J0G A;  4JLC A;  2FCQ A;  3KH0 A;  2LWP A;  3Q3M C;  2ZCC A;  4J6I A;  5CHW A;  2XBB C;  2R61 A;  2WU2 B;  1N62 A;  1NVI D;  2BB6 A;  4WJP A;  3SDL C;  3FKY A;  5GXG B;  2WXJ A;  2ZNV C;  2LEK A;  2JX5 A;  3IVF A;  1E8Z A;  4IKG A;  3PZD A;  1C79 A;  3GP7 A;  3R2I A;  4QAY A;  3NZU A;  4OHJ A;  4NQK E;  3RNG C;  2PE6 B;  4DWF A;  3RMK C;  4DK5 A;  3A9K B;  3RT3 B;  1BML C;  1P0R A;  5LNK 1;  2D3G A;  1STE A;  3W9C B;  2YLM A;  5E6J A;  2V4L A;  1EWY C;  2PMV A;  2PW9 A;  4S17 A;  2EMT A;  1FFV A;  3E9S A;  4NJC A;  2C7H A;  4GU2 A;  2BVC A;  3Q8B A;  1EM7 A;  1C4C A;  2JVC A;  3BK2 A;  2PTL A;  1VD2 A;  5D3I B;  1A70 A;  3NS8 A;  3JSV A;  3A4S C;  1SE2 A;  2D10 A;  4GN1 A;  4DXF A;  4TQ0 A;  4IM2 A;  1SF0 A;  3U8Z A;  2WXG A;  1UGM A;  2MLB A;  3RZF A;  1SGH A;  2KJ6 A;  4XDD A;  1B9R A;  1YIW A;  3VTW A;  2JQR B;  2C7N B;  1MFW A;  1TS5 A;  1YJI A;  2L83 A;  3HM6 X;  4OVV A;  1H8C A;  2MHJ A;  5HI1 A;  2C7M B;  1E10 A;  2GBR A;  1WGR A;  1T3Q A;  4WJQ A;  1LGR A;  2KX3 A;  2LI5 A;  2MJD A;  2WQY B;  4EZL A;  1WH3 A;  1KOT A;  3H1U A;  2WS3 B;  3CMM B;  2JPH A;  4US9 A;  4W9L A;  5BYS A;  1WY8 A;  2K6Q A;  1HQR D;  1TTN A;  4BKT A;  2D07 B;  2O6V B;  5EE9 A;  4B0M A;  3E56 A;  3L13 A;  3AUL A;  4I6L B;  5LXI B;  1ESF A;  1D4B A;  1UBQ A;  3RI7 C;  2LRW A;  4F8C B;  2KD0 A;  4BVU C;  3S2A A;  2QIL A;  2IYD B;  1MPE A;  1WIA A;  4HK2 A;  3H8H A;  4EOY A;  3AED B;  3U4E G;  3AE2 B;  1XQQ A;  3QWZ B;  2BKR B;  1EU3 A;  4P1B C;  2FE8 A;  4E71 A;  2JF5 A;  3QAR A;  2LRU A;  1Z2M A;  1FPY A;  3VXW A;  1V86 A;  3TEY A;  3ENE A;  1D3Z A;  2WU5 B;  3IT4 B;  1E5W A;  3DCG A;  1JWB D;  3DPD A;  3I63 C;  3SHQ A;  4UDU C;  2BKF A;  2KWU B;  3Q8E A;  3I5J C;  2FID A;  1UZX B;  1I4X A;  1K52 A;  2BT6 A;  2IZV B;  4RCO A;  1WGH A;  2JU6 X;  3GS2 A;  1K51 A;  2BF8 B;  2NCN A;  3L0W B;  3PRM B;  2SAK A;  2KQS A;  4HPM B;  3PGE A;  2K25 A;  3QA8 A;  3T3N A;  1T0S C;  5G2N A;  4GMV A;  1E7P B;  2EMS A;  4N6E B;  1Q0W B;  4N59 A;  3KUZ A;  2CHX A;  1E7V A;  1NBF C;  3V60 A;  4G3X B;  2JYT A;  2KC2 A;  4KDL B;  3ZTD A;  1L5P A;  1C9F A;  4HDO A;  2QC8 A;  3VH3 B;  1F2R I;  2EKI A;  2PJH A;  3AE4 B;  4NPN A;  3B9J A;  3VR9 B;  3NHE B;  1L2N A;  4RGM A;  4JWS C;  3RYT A;  2WGS A;  2G1E A;  1WXS A;  3VTU A;  5CTR C;  5IO9 A;  1C1Y B;  2DZJ A;  2V3S A;  5G5H A;  2QSD A;  4C80 A;  1SJE D;  1YJJ A;  1HXY D;  2JUO A;  2BWF A;  2L8J A;  4OZC A;  2LUE A;  4J3O D;  2AX5 A;  3BVG A;  3Q8F A;  1OQR A;  2GBN A;  4AUQ C;  4OW0 A;  4LJO B;  4O1N A;  2JZZ A;  3BZD B;  5D6J B;  1QF6 A;  3PZ7 A;  2DBY A;  1WWT A;  2K0P A;  2N9P C;  1YQ4 B;  3Q3J A;  5TSS A;  5E6P A;  2LAS A;  3TEW A;  1EWC A;  1GB1 A;  1MVK A;  3L17 A;  1BXT A;  3NOB A;  2WLB A;  4PYU A;  3M3J A;  4JWU C;  3WAO A;  2IDY A;  3AV8 A;  3Q3F A;  4FHJ A;  2LUM A;  4RGN A;  2MP2 A;  4KZC A;  2N4F A;  3DVG Y;  2J4X A;  1UBI A;  3KLS X;  3DHH C;  2I38 A;  4G50 A;  3VVW B;  2NPT A;  2L3Z A;  4HWI B;  5H92 C;  2J52 A;  3PT2 B;  1L0V B;  4E74 A;  2KWC A;  4NZL B;  3MC0 B;  2KJH B;  3HM3 A;  2WYQ A;  3ZW3 A;  2IY1 B;  5MPO A;  3R8B A;  2ZZP B;  3MC8 A;  4ANW A;  1F1H A;  1D5M C;  2GBJ A;  1GC7 A;  1LQB A;  2XNA C;  2KMC A;  1QQR A;  1SBB B;  1NI2 A;  2WXN A;  3MTN B;  5BMH A;  3ECI A;  3LXF A;  5AUK A;  2KFJ A;  4MM3 A;  2FNJ B;  2ZW0 A;  1I4H A;  2QJL A;  2BWE S;  4EKU A;  4BBN F;  4LNF A;  1ZDX A;  3HK0 A;  1EO6 A;  2HJ8 A;  3VTV A;  3AMZ A;  4K7S A;  1WGD A;  3ZRF A;  3UI3 A;  3P63 A;  1WR1 A;  5AZF A;  4W9H A;  2W54 A;  4BAX A;  3Q69 A;  4YL8 A;  3BWU D;  2KLC A;  4MSQ B;  3DQV A;  5J2R A;  1J7A A;  1EF5 A;  4PS3 A;  1ZXH A;  2MA9 B;  1N63 A;  1KH0 A;  2KJR A;  3ZNI D;  5L95 C;  1UGJ A;  2KFK A;  3NS1 A;  4KV2 A;  4NAM A;  3T8M A;  3C8Y A;  1E8W A;  3MP9 A;  2KDI A;  4ZHP A;  1WZ0 A;  1FCL A;  1WYW B;  5HHD G;  3P4P B; 
#chains in the Genus database with same CATH homology
 1ZOY B;  1CK1 A;  1XEE A;  2LJI A;  2HDE A;  4NAW B;  5BMI A;  1C77 A;  4OVZ A;  3MFG A;  4FXC A;  3AE7 B;  2NTS A;  1PYW D;  1QIL A;  3NRZ A;  2N0S B;  4MAC A;  1OQQ A;  1SE4 A;  3AM9 A;  3N9Y C;  2YEP F;  1I4P A;  2JYE A;  2SEB D;  4TQ1 A;  3AE5 B;  1NI3 A;  1QOG A;  1VLB A;  1LO5 D;  1KLU D;  4ARI A;  1K53 A;  1UWM A;  2OHF A;  4KGT A;  2R61 A;  1M4V A;  2WU2 B;  1N62 A;  1NVI D;  2BB6 A;  4AQ7 A;  4KKI A;  1XO3 A;  4P16 A;  3ETR A;  5GXG B;  1VJK A;  1JAL A;  3ZGZ A;  2WXJ A;  2DLB A;  5BMG A;  2LEK A;  1SJH D;  2E6X A;  1N5X A;  2JX5 A;  1E9M A;  5BYQ A;  1VZ6 A;  2W3R A;  1PGB A;  5EE1 A;  3GB1 A;  1CZP A;  4Q2J A;  4IKG A;  1VRA B;  4AS1 A;  1C79 A;  1CQV A;  2MH7 A;  4PT5 A;  3GP7 A;  3R2I A;  2IPK D;  1C76 A;  1SXT A;  4OHJ A;  1FRD A;  3P4S B;  2QIE B;  3NVV A;  3HUI A;  2DYM A;  4RGT A;  1P7F A;  4HKQ A;  1BML C;  1IUE A;  2KMM A;  1SE3 A;  2LHE A;  5LNK 1;  4WQM A;  2W3S A;  2VZK D;  1VR9 A;  1STE A;  2BS3 B;  3W9C B;  4REZ A;  1JRO A;  4US8 A;  2V4I B;  5E6J A;  2MEK A;  1EWY C;  2PMV A;  2PW9 A;  1V97 A;  5I4D A;  4HRS A;  2N9L A;  1TS3 A;  1FFV A;  3E9S A;  3FIL B;  4NJC A;  2WXQ A;  2W82 A;  3Q8B A;  1WYG A;  1EM7 A;  2BB5 A;  4HKZ E;  1C4C A;  4RF0 A;  1ET6 A;  3BK2 A;  1QLB B;  1MHH E;  2PTL A;  3EGR A;  2PVO D;  5D3I B;  2RDH A;  2LFI A;  5FR3 A;  1XLO A;  3MJ5 A;  1A70 A;  3SFD B;  4A6Q A;  4A90 A;  2I2Y A;  1QKZ A;  3OWE B;  2D5G A;  1Q10 A;  1SE2 A;  1YN5 A;  1RYJ A;  2GB1 A;  2WDR B;  1E6E B;  3TSS A;  3HRD D;  4DXF A;  4TQ0 A;  2NMQ A;  3W2D A;  1SF0 A;  1TS2 A;  1UNS A;  2JZP A;  2WXG A;  4A55 A;  4USA A;  1JWA D;  2BS4 B;  3O13 A;  4MM3 B;  1YNT E;  3EUB 2;  4TMA B;  4YWG G;  2BYT A;  1IBX B;  4XDD A;  2K3U A;  1B9R A;  3LYY A;  1ZDV A;  2KN4 A;  2JQR B;  1D5X C;  5C3J B;  1FMA D;  3LB8 C;  1KTK A;  2H88 B;  1TS5 A;  1J7B A;  2LMC A;  3VQI A;  5HG2 A;  1YJI A;  2L83 A;  2PVG C;  2K22 A;  2K9X A;  4LTU A;  4YSZ B;  3I9V 1;  1JWM D;  2WXH A;  4MT5 A;  4ZRQ A;  3U7Z A;  2RPV A;  3SFE B;  1DYQ A;  1XLN A;  5HI1 A;  2IGG A;  1E10 A;  3AEG B;  1V1P B;  1T3Q A;  1BUI C;  2JXT A;  2PLP A;  2JWU A;  3VRA B;  1K50 A;  1N5W A;  1T6B X;  1F2R C;  3I57 A;  4DQO C;  2MJD A;  1L6V A;  2WQY B;  5FKA C;  3AE6 B;  4YTN B;  2WS3 B;  1ZE3 D;  3IAM 1;  1KLG D;  2DYO A;  2HTM E;  1WGK A;  1J7C A;  1P7E A;  4M0W A;  1NYR A;  4US9 A;  2V0G A;  1FFU A;  2L1A A;  1L4D B;  5BYS A;  2KWD A;  4LK0 M;  3VRB B;  5HFY A;  1HQR D;  4B0M A;  5EE9 A;  3E56 A;  3AB5 A;  1ESF A;  2M19 A;  1D4B A;  3AE3 B;  3BVZ A;  2WXI A;  3TEZ A;  3P4R B;  2N7J A;  1FXA A;  1TKE A;  2KDM A;  1FO4 A;  2QIL A;  1L0Y B;  2B76 B;  2G9H D;  3AEF B;  4GLS C;  1ET9 A;  2TSS A;  2L32 A;  3L4P A;  1CJE A;  4GDK B;  1MPE A;  4KGS A;  2J42 A;  3H8H A;  2PKO A;  3NUH B;  2VZK B;  3J9C A;  3AH7 A;  1L6U A;  1FEH A;  3RFZ B;  4HEA 1;  2AQ2 B;  3AED B;  3U4E G;  3AE2 B;  4CQN A;  1EU3 A;  1VZ7 A;  2LGI A;  3KQ4 A;  4DXG A;  4C7Y A;  2FE8 A;  3IAS 1;  4YTM B;  1YQ3 B;  1QT9 A;  1PGX A;  4WH4 A;  2L52 A;  1L0X B;  1HA5 A;  3P4Q B;  1ZUD 2;  3TEY A;  2WXK A;  5BYR A;  1TS4 A;  2ZW1 A;  3P1M A;  5EE3 A;  1YN4 A;  2WU5 B;  3IT4 B;  1JWB D;  4LLG M;  4UDU C;  2NTT A;  4JE3 B;  1JCK B;  3BK1 A;  3RPF C;  3FIL A;  3Q8E A;  1VDV A;  1R7S A;  1FNV A;  1NEN B;  1I4X A;  3AE1 B;  4IDI A;  4ARC A;  2BT6 A;  1K52 A;  2RMM A;  4RCO A;  3MHZ A;  1JRP A;  2INN E;  3GS2 A;  2JU6 X;  5AUI A;  1K51 A;  4RF1 A;  1XLQ A;  2GI9 A;  3BII D;  2SAK A;  1SIJ A;  4RH6 A;  1DGJ A;  3T3N A;  1XLP A;  1VZ8 A;  2M0A A;  1E7P B;  1D5Z C;  2WXR A;  2WDV B;  2AQ1 B;  5T8I A;  3Q8C A;  1D6E C;  1QOB A;  2IJ0 A;  4N6E B;  1L4Z B;  2PIA A;  2WP9 B;  1Y56 A;  4N59 A;  3IXS A;  4KGR A;  5EE0 A;  5H8Y E;  1QOA A;  3W1S A;  3CIR B;  2JYT A;  3AEB B;  2WNM A;  1WXQ A;  4RNA A;  3NZ3 A;  3AE9 B;  2E3T A;  3HVZ A;  4HRO A;  3SEB A;  1L5P A;  1XCQ L;  1C9F A;  1F0Z A;  1HZ6 A;  3HVD A;  4P6V F;  1N60 A;  1F2R I;  2KAJ A;  2EKI A;  4RFB A;  1TKY A;  4R3D A;  3AE4 B;  3AEC B;  4IOI E;  3FC4 A;  3B9J A;  3VR9 B;  3ABV B;  1MHX A;  2MJ3 A;  3DWG C;  5HHD G;  1QOF A;  2J53 A;  2BS2 B;  4RGM A;  1GB4 A;  4JWS C;  2G1E A;  1RWS A;  2Y3A A;  1B1Z A;  2KAC A;  2ICI A;  3U52 E;  3PO0 A;  3TEX A;  5G5H A;  1FM0 D;  4A8X C;  4YT0 B;  2Y5P A;  2QSD A;  4C80 A;  1SJE D;  3ZJU A;  1I4R A;  1AN8 A;  1YJJ A;  2GRI A;  1DOY A;  1HXY D;  1I4Q A;  1XF5 L;  2WDQ B;  1AWD A;  1ACC A;  1IGC A;  1XCT L;  4OZC A;  3U2S C;  4J3O D;  2FUG 1;  4ZHO A;  2AX5 A;  3B2F A;  3BVG A;  3Q8F A;  2WXL A;  1FXI A;  1KRH A;  1OQR A;  1ZXI A;  4OW0 A;  2M56 B;  4XWT A;  1V8C A;  4O1N A;  1ENF A;  3BZD B;  2IGH A;  3AEA B;  4B0E A;  3KWL A;  1QF6 A;  1DOX A;  3SR6 A;  3TUO A;  3PZ7 A;  2DBY A;  4H2A A;  2WXF A;  1WWT A;  2W55 A;  2K0P A;  1PGA A;  1AYF A;  1YQ4 B;  3AE8 B;  3WCQ A;  1V1O A;  5TSS A;  1JW9 D;  3Q8A A;  1YN3 A;  5JXV A;  1RM6 C;  3TEW A;  3AEE B;  1EWC A;  4WWM A;  1GB1 A;  1MVK A;  1C78 A;  2YEP B;  2ONQ A;  1JWU D;  1BXT A;  1F77 A;  4JX1 C;  1XXG A;  1FD6 A;  1WSP A;  2WLB A;  4YXD B;  3BVM A;  4D2K A;  1UUP A;  4JWU C;  3T3O A;  1PDX A;  1MI0 A;  2IDY A;  3AV8 A;  4OZA A;  2LUM A;  4L23 A;  3DWM A;  4OZB A;  4RGN A;  1FRR A;  1OFF A;  4GDL B;  2QMT A;  2K5P A;  1C4P A;  2V3N A;  2CJO A;  2X38 A;  2J4X A;  1C4A A;  3KLS X;  3EA6 A;  2I38 A;  4L2Y A;  1HZ5 A;  5G5G A;  3W5V B;  3P42 A;  3IT6 B;  5H92 C;  2INP E;  4WUR A;  2J52 A;  1L0V B;  4NZL B;  3MC0 B;  4RGO S;  1TZO A;  3V3X A;  3CWI A;  3NVZ A;  5MPO A;  3R8B A;  2LHD A;  1FIQ A;  1FCC C;  1NEK B;  3R2T A;  4HJG E;  3W5U B;  4JPS A;  4TSS A;  1JWS D;  4WIP A;  1NYQ A;  4ZRP A;  1WRI A;  1SSN A;  1TJE A;  1FNU A;  1IGD A;  3KWV A;  1D5M C;  4ZOH C;  3NVY A;  2CJN A;  1PFD A;  1YMH E;  1GOZ A;  2XNA C;  1QQR A;  2BBC A;  2AQ3 B;  3URY A;  1KF6 B;  4EE2 A;  1TKG A;  2H89 B;  3V05 A;  3ZJV A;  1SBB B;  4L1B A;  4A9A A;  2WXN A;  2ON8 A;  4ZYS A;  5BMH A;  4XDC A;  4XE0 A;  3LXF A;  5AUK A;  2N9K A;  2WXO A;  2MJE A;  3VR8 B;  3FAH A;  4C56 C;  4N58 A;  2WXM A;  1I4G A;  2ZW0 A;  2OED A;  2V3P A;  2XN9 C;  3B2G A;  3AN1 A;  1I4H A;  2QJL A;  1E0Z A;  1IBX A;  1N61 A;  1PUT A;  2WXP A;  5D7G A;  1TY2 A;  4YTP B;  4KX6 B;  1JML A;  3BYT B;  1ZDX A;  2CU3 A;  1JQ4 A;  2IGD A;  1TY0 A;  1UWX A;  3ZQ4 A;  1AW7 A;  1SB3 C;  3AMZ A;  1FNW A;  4MH8 A;  2FBW B;  3ZYY X;  3UI3 A;  3ZJT A;  3P63 A;  2Q5W D;  1V1P A;  2W54 A;  2ACZ B;  3NVW A;  1SEB D;  3Q69 A;  3BWU D;  1HEZ E;  1ROE A;  1J7A A;  4ITK A;  1KFY B;  1RFK A;  3BYY B;  3PZ8 A;  2QEJ C;  4XWW A;  1ZXH A;  1TYG B;  1N63 A;  2DWQ A;  5D3D A;  2BTE A;  1KH0 A;  2BW2 A;  2RDG A;  1EU4 A;  1ZP0 B;  1UGJ A;  1ZPS A;  5FK9 C;  3NS1 A;  2EEL A;  1GPX A;  4NAM A;  4C7Z A;  3C8Y A;  4KKJ A;  1T5X D;  2KQ4 X;  3MP9 A;  5C2T B;  4ZHP A;  4YSY B;  2JSV X;  2Y5C A;  2Z8L A;  1FCL A;  4YSX B;  4WAF A;  1DOI A;  1GAQ B;  1I7H A;  3P4P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...