5E6NA

Crystal structure of c. elegans lgg-2
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
113
structure length
111
Chain Sequence
PGSFKERRPFHERQKDVEEIRSQQPNKVPVIIERFDGERSLPLMDRCKFLVPEHITVAELMSIVRRRLQLHPQQAFFLLVNERSMNSMSMSNLYSQERDPDGFVYMVYTSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Protein lgg-2
publication title Structural Basis of the Differential Function of the Two C. elegans Atg8 Homologs, LGG-1 and LGG-2, in Autophagy
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 34
structure length 111
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5e6nA00
1H4RA 2C9WB 3RT3B 1EUVB 1SIFA 2C60A 5JHBA 4KDLB 4K81A 4XZ4A 3RYTA 4B6WA 2LI5A 2JT4B 2JXXA 2W9NA 2D10A 4EUTA 3MTNB 4MEMA 4BVUC 4AOFA 4BBNF 2KANA 3CMMB 1TBEA 5C23A 4IW0A 3V61A 4IM3A 1KJTA 3L17A 1UH6A 2G4SA 2ZZPB 1CMXB 2DYMA 2XK5A 1R4MI 1IPGA 2FCSA 2LWPA 2ZNVC 4FHJA 3H7SA 3RULA 2G45B 3AXCA 2J0KA 1YJ1A 3PTFC 2D07B 3QHTA 1P3QU 1YD8U 3ENEA 1OEYA 4TUUA 5LXHA 3ZTCA 2LD9A 4MGZE 4W9EA 2C7MB 3WAOA 2NPTB 4I6NB 2FNJB 3V6EB 3R3MA 3NY5A 1AARA 1RFAA 2DX5B 2XEWA 3WAPA 5L83A 1YQBA 4IM2A 2GOWA 3T8MA 4DHJB 1NI2A 3A9JA 4MSQB 3TL5A 2MCNB 4IG7B 2L7RA 3VHTC 3UGBB 2DHZA 4B95A 2KDFB 3KYDD 1WYWB 2PJHA 1Q5WB 2PPHA 2D11A 4EZJA 2AL3A 3K9OB 2K1FA 4KSKC 3A9KA 2FCQA 4DK5A 3V6CB 4B9KA 3QWZB 5JZEB 1V5OA 2IO0B 5G55A 4A3OA 4KZ0A 2N7EA 2PE9A 4HK2A 1NBFC 2LGXA 3ZIMA 3H7PA 2KOXA 1WF9A 2DZMA 2OOBB 3B1LX 1GG3A 2ZVOA 4IM0A 5KHOA 2C7HA 5DCNA 2FUHB 4TQ1A 3R66C 1EO6A 2N4FA 3LJ3A 3QAQA 1K8RB 3T9LA 4MJSB 3H9DA 4NAWB 1Y8RC 1JRUA 3RD2A 4W9GA 1WX9A 2BKFA 5AZFA 2C7NB 1S3SG 5EDSA 4TKNA 1WM2A 3U30A 3DVGX 2Y5BB 3PT2B 3ZTDA 3VXWA 1WX7A 2N1VA 4HCPB 2A4ZA 2MBEA 2MBBB 4ANUA 1WGHA 2FIDA 1WJUA 3ML8A 3IG3A 1E7VA 3WAMA 2K8HA 2O6VA 4FULA 3PLUA 2KQ7A 3CF6E 1E8ZA 4ZRIA 2AEHA 3L16A 4WWOA 2KC2A 2JWZA 1UBIA 3X23A 5L95C 2BPSA 3O65B 5CHFA 2FCNA 5E6NA 2O2VA 3A1QA 3JSVA 2BWFA 3PREA 3SD5A 2NBWB 2LVQA 1WR1A 2GBJA 3DQVA 4W9HA 4AJWA 3VUWA 4WAAA 3ZRCA 3KUDB 1WIAA 4TQ0A 3C0RB 4II3B 1G6JA 2IY1B 2N9XA 4ANVA 3N32A 2EMTA 2M17A 4G11A 4WWNA 4GDLB 3RCZA 1WE7A 3TJPA 4KSLC 3R7QA 2MWSB 2NCNA 4A20A 3B0AA 5J18A 3IBEA 3ZDTA 5DPWA 2KXJA 4AUQC 1U4AA 1V86A 1KM7A 3PV1A 4E74A 2MBOA 4FHKA 3ZNZB 3DCGA 4G0NB 1Z5SB 1Q0WB 2KD0A 2EMSA 4HVBA 3HK0A 5CHVC 2DYOA 4W9CA 1HE8A 3PRZA 3M63B 2G4DB 2KFKB 4AJYB 3A4RA 4GOCA 2MSED 2WDTB 3A33B 1J0GA 2ZVNA 3OJ3A 2RPQA 2KDBA 1UZXB 3M3JA 1GUAB 1UELA 3NZSA 3PHXB 3QC8B 4NAWA 1KLVA 4NNJB 1WGDA 2JRIB 3UINB 3V62A 2GBMA 1WFYA 3NS8A 1L7YA 1P9DU 2QHOA 2ZJDA 3RUIB 1Q1OA 2XBBC 2LVPA 4URKA 5HKHA 4RMAA 1WMHB 1WE6A 3AULA 5CTRC 1WM3A 2KHWB 3JYUA 4EKUA 4BKGA 4JGHB 3HIZA 2J0MA 1E5WA 2IO2B 2REXA 4GSWA 2B3AA 3ZDMC 2V3SA 2MBHA 1E7UA 4W9IA 5D94A 4ASWC 2BGFA 2V1YA 4W9JA 1E8WA 5G2NA 2L3ZA 3CSTA 2VRRB 1V81A 4ZRKA 2D2QA 2JY6A 3VDZA 4GXBA 1IYFA 2MA9B 3D32A 3L10B 4DWFA 1RRBA 3BINA 4RM8A 4G50A 3APFA 4FN2A 3TBLD 5DPRA 3ALBA 3L08A 1WXAA 3PZDA 3PSEB 2A5UA 3DDCB 4DHZB 2K39A 4GDLA 2LJ5A 2DZJA 4IWOA 1TTNA 3TMPB 3EFUA 1YIWA 2YLMA 2GMIC 1XQQA 2N1WA 5D6JB 2AYOB 3IVFA 3VTWA 3JVZX 2BWES 2KDIA 2OJRA 2JZZA 3HHMA 4MGYE 3VQIA 2CU1A 3AU5A 4WJPA 2KJHB 1C3TA 2KN5A 3L54A 4OVUA 3WIMA 4GDKB 4EFOA 2KFKA 2NBUA 2NVUI 1WGRA 2LUEA 3VVWB 1QZEA 3L13A 1WJNA 4FJVB 4IUMB 4X57B 1PQSA 2FAZA 3QARA 4CHKA 3APDA 4HXDA 4LCDE 2LGYA 2KWVB 1WRDB 4BOSC 4MH0E 1SGHA 2N7DA 2ZCBA 4W9FA 5AZGA 4DDGD 5LLIA 4GN1A 1V6EA 2JF5A 4GIVA 3R7RA 4MM3A 5E6OA 1ZW7A 2MW5A 5GMVA 4ZDVA 1Z2MA 1M94A 2LRWA 4GGQA 3M62B 4AWJA 3KYCD 2MRPA 4IWPA 1FXTB 2LGDA 3MJWA 4MSMB 1GNUA 4W9DA 3LDZE 2R2QA 2MQJA 3IHPC 1L2NA 2JVCA 4HJKA 3S2AA 1XT9B 2KMAA 1WR6E 2NPTA 3PHWB 4KV2A 3RZFA 2DAJA 2JUOA 2K8BA 4F8CB 3QIJA 3UQBA 2ZNVB 3DOWA 2LVOA 4M8NA 2G3QB 2M4NA 2M1MA 3OJ4B 4JL9A 1WI0A 2Z0DB 2DYBA 4HPMB 3K9PB 3WANA 1OQYA 1YX5B 2CHXA 4KVGB 5IAAC 2KTRB 4M0WB 3RZWC 2C5LC 2V4LA 2ZEQA 2KX0A 3HM6X 3PGEA 4EZLA 2ZPNA 2KWUB 1UBQA 1GC7A 4GMVA 1F9JA 2GBRA 3U7DA 1V9JA 1VD2A 4PYUA 3DVNV 4IWQA 4E3CA 3A9JB 4II2B 4WQOB 4DDID 4RM9A 3PPAA 4K7SA 2K8CA 3ZW3A 4NJ7A 2R2OA 3JW0X 4I6LB 3KUZA 3VTVA 1WXVA 4NY0A 3A9KB 2I1JA 1T0YA 4GDKA 1C1YB 3ZLZA 2CKHB 1OGWA 2NBVB 4MJSA 3DVNU 4KIKB 2WX1A 1E8YA 5IA7A 4WWPA 2WWZA 3VH4B 2J7QB 2D3GA 4YL8A 2CHWA 5JH5C 1D3ZA 3PVLA 1ZGUB 3NZUA 3VAWA 1TGZB 4OVVA 1WXSA 2KLGA 3BY4B 2KC1A 3M95A 4FLHA 3NOBA 2DENB 4HPLB 2L00B 2KZRA 2PE6B 5KHQA 2ASQA 2L0FA 3PRMB 3ZNGC 2M8SA 4CYEA 4CO7A 1E90A 1LFDA 3TCAA 3GOEA 1H8CA 2AL6A 2N9EB 1WGYA 4WJOA 4DHJD 4LDTB 1RAXA 2BYFA 2BYEA 4N9F4 2KTFA 5J2RA 2GBKA 4DBGA 4FA6A 1GC6A 4K7UA 3NHEB 2RSUA 2K25A 3Q3JA 4JIOU 1WZ3A 1S1QB 2JRHA 2ZCCA 3SDLC 4W9KA 4DXAB 4HCNB 2JZ3B 3VUYA 4ANXA 4P7IA 4ZYNA 3DBRI 1LXDA 1XD3B 4I6PA 3ZUNA 1X1MA 3QCAA 1OEYJ 2O6VB 4JQWC 2RD0A 1R4NI 2KX3A 2CR5A 3KUCB 1P1AA 3ONSA 1MG8A 4HWIB 4PYZA 3W1YA 3ZO5B 3QK0A 2MP2B 1V80A 2IO3B 4NQLB 1LQBA 2EKEC 2UYZB 5JHAA 1A5RA 4NPNA 1GJZA 2KQSA 3AU4A 1WH3A 2O2VB 3P2BA 3A1QB 3GZNI 3JSVB 2BF8B 5CX3A 2ZPYA 2KTRA 4PS8A 3QX1A 2LXCA 2LRUA 4F1SA 3SU8X 3X0WA 1P0RA 4G3XB 3U8ZA 4DHZE 3W1SA 2FCMA 1ISNA 1P98A 4ICUA 3W1SC 1LM8B 4ANWA 3UF8A 3MHSD 4MGKE 4BBNC 3SHQA 4PS7A 4BKSA 2AWTA 5FR6A 4KZCA 1WZ0A 3WALA 3H1UA 3OAWA 1V5TA 4GU2A 2DZIA 2I1KA 5E6PA 3ZVVA 2CS4A 1I42A 3VUXA 2KK8A 3QJZA 3QQ8B 1WGGA 1V2YA 5CHWA 2M0XA 4HDOA 4K7WA 2N9PC 4NJ6A 2IY0B 1E8XA 4NQKE 2BYVE 4GB9A 4KIKA 2PEAA 2JPHA 3DVGY 2DAFA 3A4SC 3EC8A 4ZRJA 2L0TA 1VCBA 2HJ8A 3ZRFA 1J8CA 3ML9A 2K6DB 5C1ZA 4J6IA 4BKTA 2L8JA 5AEKB 3Q3FA 1EF1A 1WMHA 2DZKA 3UIPB 1SE9A 4A3PA 3ZNHB 2GBNA 1I35A 5DPTA 1UD7A 4M8MA 3ZNID 4KDIC 5BO4B 4TV3A 4W9LA 2YVCA 4HLEA 4BFRA 3UQAA 3PLVA 2KJ6A 3KW5B 4EEWA 2Z0EB 3APCA 2CHZA 2LZ6A 4LJOB 2LASA 3H6NA 4F7ZA 1NDDA 3WA0A 4EOYA 4XC2A 1UGMA 4MGIE 2XK5B 3CSFA 4LJPB 5J17A 5AZHA 1OTRB 4E71A 2K6QA 4BKSD 3OLMD 3HM3A 1EF5A 2MP2A 3EECA 2IO1B 3ECIA 2KKCA 3UIOB 2KFJA 4MDKE 1KOTA 2NS5A 2BKRB 4JLCA 2J0JA 3EHVA 1J19A 2IYDB 2KWCA 2MX2A 2RR9A 2IBIB 2LXAA 3VH3B 1BT0A 3IFWB 2Z59B 4AP4C 5TR5A 4BOZB 3V60A 1WJ6A 4FADA 3I3TB 4FJYA 3N3KB 2MLBA 1YX6B 2KDEB 4WJNA 2L05A 1WX8A 3KVFB 4ICVA 3TIXA 2WX0A 1WY8A 4HDQA 2UWQA 4EZKA 2KJRA 3DPDA 2KMCA 3B08A 4K1RB 4MELA 2KVRA 2KNBA 4LDTD 3DBLI 1WXMA 4FJZA 4IC7B 1RLFA 2HTHA 2KO3A 2NR2A 3H7PB 2WYQA 1TZ1A 3QA8A 3DBHI 5LXIB 1WJ4A 2IZVB 2RGFA 3AI5A 3PRPB 5D7GA 4WJQA 2HD5B 3VFKA 1IP9A 2L76A 3DBSA 3KH0A 4XX5A 3VTUA 1ZKHA 2FIFA 4PS3A 5D2MB 3N30A 3PS6A 2HE7A 2MBQA 3L0WB 1V49A 2O6VD 5DPSA 2KLCA 3ZKJC 4FBJB
chains in the Genus database with same CATH superfamily
1H4RA 1FXAA 2IGDA 3Q8BA 4JWUC 3HVDA 5JHBA 4AQ7A 4XZ4A 4O1NA 1XXGA 2JT4B 3E9SA 5HFYA 2D10A 3MTNB 2ONQA 2KANA 3ZJVA 1TBEA 4PT5A 5IO9A 1UH6A 1STEA 2DYMA 2XK5A 1R4MI 2LWPA 3RULA 2E6XA 2J0KA 2D5GA 1QILA 3QHTA 1YD8U 3EGRA 3ZTCA 1NI3A 1GB4A 3Q3OC 2JWUA 3NY5A 3WAPA 5L83A 1I4RA 4DHJB 4MSQB 2CJOA 2L7RA 2KDFB 1HEZE 4P1BC 1NEKB 3A9KA 3ZJUA 4DK5A 3V6CB 4LLGM 5G55A 2N7EA 4HK2A 2LGXA 3ZIMA 1NYRA 2KOXA 5T8IA 3B1LX 2C7HA 1F0ZA 3R66C 1EO6A 1C76A 4NAWB 1Y8RC 2WXHA 5I4DA 4C7ZA 2PVOD 3Q8CA 2V0GA 1WX7A 1T5XD 2MBBB 1KF6B 3IG3A 1WGKA 3CF6E 2LEKA 2KMMA 4WWOA 3OWEB 1L4ZB 1JALA 2BWFA 3PREA 2NBWB 1K52A 2ICIA 2GBJA 3DQVA 2JXTA 2Q5WD 1SBBB 4WAAA 2KYWA 1CJEA 3KUDB 3ZRCA 2R61A 2M17A 4WWNA 1WE7A 3TJPA 4A20A 3B0AA 4XDDA 3ZDTA 1P7EA 2J53A 3PV1A 1KM7A 1MG4A 1Q0WB 2KD0A 3DHIC 1PYWD 3AV8A 2WDTB 3A33B 1MHHE 2BT6A 3NZSA 3M3JA 1GUAB 4JWSC 1KLVA 1MFWA 3UINB 2GBMA 1WFYA 2ZJDA 1Q1OA 4URKA 5HKHA 4RMAA 4OW0A 1WM3A 1ACCA 4ZYSA 2J0MA 4PK1A 4GSWA 1N63A 3ZDMC 2V3SA 1E7UA 2K5PA 1KLGD 3CSTA 2WGSA 1XLOA 2WP9B 2JY6A 3VDZA 3D32A 1RRBA 4G50A 3APFA 5DPRA 1BUIC 2A5UA 2BS3B 3DDCB 4DHZB 3Q3NC 3EFUA 4MACA 5C2TB 2N1WA 1FNWA 3W9CB 1V1PA 3JVZX 2OJRA 2JZZA 3HHMA 2KN5A 4OVUA 1TYGB 1TT5B 3IXSA 2NBUA 4HPPA 1WGRA 2LUEA 1M4VA 1QZEA 4D2KA 5G5HA 3TSSA 1Q10A 1JCKB 1SJED 1FFUA 5H92C 2K22A 4S17A 2K9XA 2KWVB 1OQRA 1SGHA 2N7DA 1JMLA 2Y5CA 2ZCBA 4M00A 3KLSX 2GB1A 4GIVA 4IDIA 5GMVA 3T3NA 4USAA 2N9KA 3KYCD 4HEA1 3SFDB 3MJWA 4MSMB 3LDZE 2R2QA 3B2FA 2ACZB 1IGDA 1KH0A 2EELA 2JUOA 2W3RA 2ZNVB 1JWBD 1HQRD 2XNAC 3OJ4B 1OQYA 1VJKA 3BVMA 2INPE 4XWTA 4M0WB 2C5LC 1FCLA 2ZPNA 1UBQA 1GC7A 1F9JA 2LJIA 1NVID 4E3CA 4IWQA 4WQOB 4DDID 4I6LB 3VTVA 3NJTA 2PMVA 4WH4A 1C1YB 2WX1A 1E8YA 3VH4B 5JH5C 1C4CA 2AQ1B 3GP7A 3V05A 3BY4B 3M95A 3MJ5A 2KZRA 5BMIA 2BYTA 1J7CA 2WHIA 4ARIA 4CO7A 1LFDA 3GOEA 2AL6A 4N58A 1RAXA 2KTFA 5J2RA 2WDRB 3NHEB 1EU3A 2K25A 3Q3JA 1S1QB 2JRHA 2ZCCA 1B1ZA 4ANXA 1FFVA 2JYTA 3QCAA 2O6VB 2KX3A 1P1AA 2DBYA 2MP2B 1V80A 2UYZB 5JHAA 1XO3A 1WH3A 2O2VB 2RDBC 5CX3A 4G3XB 3DHHC 4BBNC 2W3SA 4WWMA 3H1UA 4GU2A 1V5TA 2DZIA 4HRSA 1V2YA 5CHWA 2M0XA 2N9PC 2L32A 3MHZA 4NQKE 1QF6A 4ZHPA 5TSSA 1WYGA 4ZRJA 3ZRFA 1JWSD 2HJ8A 2K6DB 3Q8AA 5C1ZA 1TKYA 3BWUD 2DZKA 1J7BA 3AE5B 2X38A 2GBNA 4XWWA 5BO4B 3UQAA 1HTOA 2YVCA 4HLEA 3AEDB 3PLVA 2LGSA 2W54A 1DOXA 4EEWA 1OQQA 3APCA 1CZPA 2WQYB 3HVZA 2XK5B 4MGIE 4BKSD 3OLMD 3HM3A 3EECA 2INNE 3LYYA 3UIOB 1HA5A 2IYDB 1DGJA 2KWCA 2MX2A 3VH3B 3E56A 5EE3A 4FJYA 2KDEB 4WJNA 1AYFA 3LXFA 3KVFB 4ICVA 4HDQA 4EZKA 1V8CA 4MELA 1KRHA 1UWMA 4FJZA 2HTHA 1TZ1A 3QA8A 2RGFA 4WJQA 4A90A 1JW9D 3VFKA 1IP9A 2L76A 3DBSA 1ZKHA 2O6VD 5DPSA 2KLCA 1XCTL 2JZPA 4OHJA 1EUVB 1SIFA 1DYQA 1L4DB 4KDLB 2JXXA 3SR6A 4AOFA 1VRAB 1E7PB 2J42A 4RGNA 3I9V1 5C23A 3V61A 3L17A 1UGJA 1CMXB 2ON8A 1T6BX 4FHJA 2ZNVC 3H7SA 2WDVB 1I4QA 4YT0B 4MGZE 2FNJB 3R3MA 3FKYA 1AARA 4NZLB 3SFEB 1YQBA 4IM2A 4M01A 1NI2A 4C4VA 1N5WA 2QC8A 3UGBB 4YSYB 2PLPA 1YNTE 1WWTA 2PJHA 1Q5WB 4EZJA 1KLUD 2K1FA 4A55A 4B9KA 1D6EC 2V9HA 4Q2JA 4RNAA 2IO0B 1N5XA 1L0YB 2PE9A 3RNGC 1NBFC 1XLNA 2DZMA 2IGHA 1E10A 1GG3A 2L52A 3PO0A 3ZGZA 5DCNA 2WXOA 4RH6A 4MJSB 3RD2A 2AQ2B 2BKFA 2WXMA 1F2RC 2I2YA 1WM2A 3PT2B 2Y5BB 4HCPB 1GOZA 2DLBA 1E7VA 1R4NB 2O6VA 1YQ3B 2KC2A 2WXKA 2JWZA 3AB5A 5L95C 3I57A 2BPSA 3O65B 3BK1A 2FCNA 2O2VA 4FXCA 1WIAA 3NUHB 1G6JA 4JPSA 2VH2A 2OHFA 2QEJC 2N9XA 4G11A 3RNCC 3RCZA 3R7QA 2MWSB 3N1YC 1SXTA 1V86A 1V1PB 3NVYA 3ZNZB 4G0NB 2WXIA 4HVBA 2DYOA 4W9CA 1HE8A 1ESFA 3MFGA 3A4RA 3RI7C 1SSNA 2LHEA 1WRIA 2YEPF 5HG2A 1ZUD2 2RPQA 2KDBA 3QC8B 3ZYYX 3P4QB 1WXQA 5HI1A 1VR9A 4RFBA 2QHOA 1QQRA 1WMHB 5CTRC 1JWMD 3JYUA 4EKUA 4BKGA 4GLSC 3RN9C 4OVZA 2B3AA 2MBHA 5D94A 4ASWC 3U2SC 2V1YA 1E8WA 1L6VA 4ZHOA 1V81A 1PFDA 2M19A 2FUG1 1FRRA 1ZDXA 4DWFA 4XDCA 4RM8A 3AE4B 3C19A 3PSEB 2K39A 1LO5D 4N59A 2BB5A 2YLMA 2RMMA 3EA6A 3H8HA 4DXGA 2AYOB 3DBHB 1FO4A 2KDIA 5MPOA 2D3CA 2CU1A 5IN7A 3L54A 3WIMA 2KFKA 4KKJA 1ET9A 4TSSA 3AE9B 3QARA 3KWLA 4LCDE 3FC4A 1WRDB 4DQOC 1FNUA 5LLIA 4MM3A 4ZDVA 1ZW7A 1Z2MA 5LNK1 2WXNA 4AWJA 3J9CA 2MRPA 4IWPA 4OZBA 1GNUA 3V3XA 2MQJA 2L1AA 3IHPC 4HJKA 3S2AA 1XT9B 4J3OD 3RZFA 5IKCM 3DHGC 4F8CB 4M8NA 1FRDA 2G3QB 3NVVA 2Z0DB 1IUEA 3R2TA 2INDC 1F52A 1K51A 3K9PB 1HTQA 1F77A 2CHXA 5IAAC 3P4PB 5EE0A 1FXIA 3RZWC 2WDQB 3Q6BA 2V4LA 1TS4A 2MJDA 3HM6X 4EZLA 2KWUB 1EWCA 1XLPA 4PYUA 3AN1A 3A9JB 3P42A 4RM9A 4K7SA 3RNEC 4IOIE 5IP4D 3KUZA 1AWDA 2AX5A 2WXQA 3NZ3A 3ZLZA 4H2AA 2CKHB 4MJSA 5IA7A 4WWPA 2WWZA 4KGTA 3AH7A 2J7QB 3VR8B 4YL8A 1ZGUB 3NZUA 3VAWA 1TGZB 2I38A 1DOIA 1TJEA 5KHQA 2BBCA 2L0FA 4OZAA 2M8SA 4CYEA 3TCAA 1WGYA 4DHJD 2BYEA 4WQMA 3RNAC 1GC6A 1KTKA 4JIOU 1PGXA 3SDLC 1NENB 4HCNB 3VUYA 3DBRI 1OEYJ 1R4NI 4HWIB 1MG8A 2EKIA 1LQBA 3OG5A 2KQSA 3AU4A 1N62A 3JSVB 1D5XC 2BF8B 2KTRA 4PS8A 4DHZE 3W1SA 2FCMA 1ISNA 1PUTA 2M56B 3W1SC 1R7SA 1LM8B 4ANWA 2IDYA 3MHSD 4JX1C 3SHQA 2WU2B 2BB6A 1WZ0A 4KZCA 3OAWA 4LNNA 1I42A 3VUXA 2KK8A 3AE1B 3QJZA 1WGGA 3GE3C 1PGAA 4ACFA 4KIKA 3VRAB 2JPHA 1YN4A 4P1CC 3EC8A 2RDHA 3ML9A 4J6IA 3VR9B 4BKTA 2GI9A 1WMHA 3KQ4A 4A3PA 3ZNHB 4CQNA 4M02A 3ZNID 4TV3A 4BFRA 1AN8A 1TIFA 1IBXB 2LASA 3H6NA 1VLBA 1L6UA 1UGMA 3R8BA 4LJPB 5J17A 3RFZB 3T3OA 2X8XX 3DWGC 2Y3AA 4AS1A 3ECIA 3GZNB 2N0SB 1I4HA 2JX5A 1NYQA 4C4VB 5TR5A 5D3DA 2KACA 1WJ6A 2MLBA 1YX6B 4KX6B 1WX8A 5GXGB 3TIXA 2KJRA 2IJ0A 4K1RB 2KMCA 3DPDA 3EFCA 3P63A 2WXRA 2NR2A 3DBHI 3IAM1 2IZVB 4XYCA 4XX5A 3VTUA 2FIFA 3AEAB 3PS6A 2NMQA 1ZDVA 2C9WB 3RT3B 3Q3MC 4B6WA 2LI5A 2W9NA 4EUTA 2FBWB 1V1OA 4LTUA 3CMMB 2G4SA 2AQ3B 3AXCA 1YJ1A 4C00A 2D07B 1UWXA 1P3QU 2LD9A 4W9EA 2VZKB 2C7MB 3WAOA 2NPTB 4I6NB 3V6EB 4B0MA 1RFAA 2XEWA 2H88B 4RGTA 1MI0A 2GOWA 3T8MA 4YWGG 3TL5A 3A9JA 3VHTC 4B95A 2W82A 3N1ZC 2D11A 3K9OB 1T3QA 1SE4A 2E3TA 2FCQA 3QWZB 3AE7B 1V5OA 1F1HA 1XF5L 3H7PA 2OOBB 1D5ZC 4RGOS 4IM0A 4HROA 5KHOA 2FUHB 1HZ6A 2N4FA 3T9LA 1YQ4B 3GE8C 5AZFA 2C7NB 1S3SG 5EDSA 3DVGX 3ZTDA 3VXWA 2N1VA 3Q8EA 2A4ZA 4UDUC 1XEEA 1WJUA 3ML8A 3WAMA 2K8HA 4FULA 1R4MB 4KGSA 2KQ7A 1E8ZA 1UNSA 3L16A 3O13A 2BVCA 1E9MA 1UBIA 3X23A 1CQVA 5CHFA 2PVGC 5E6NA 3RPFC 3JSVA 3SD5A 1WR1A 1WSPA 3VUWA 3C0RB 4II3B 3I63C 3L4PA 2INCC 4ANVA 3N32A 2EMTA 3BVZA 2NCNA 5J18A 3IBEA 5DPWA 1VZ6A 4S0RA 2WNMA 2WU5B 4E74A 3NVWA 2MBOA 1EM7A 1E0ZA 3ZJTA 1Z5SB 1I4XA 3AEGB 2KN4A 1ZE3D 2G4DB 2KFKB 4N6EB 4GOCA 2BS4B 1MHXA 3AE2B 2TSSA 3TEZA 5EE9A 1ZPSA 1J0GA 1RYJA 4K3CA 2PIAA 1UZXB 1UELA 5FR3A 2JRIB 4XGAB 3V62A 1P9DU 3RUIB 1IBXA 2LVPA 2CU3A 2VZKD 3AULA 4MM3B 3HIZA 1RFKA 2IO2B 1ENFA 2FE8A 1VZ8A 4W9IA 2BGFA 4W9JA 2VRRB 4ZRKA 4KGRA 2D2QA 5HHDG 4B0EA 1IYFA 3URYA 1EU4A 1FEHA 3TBLD 3L08A 4GDLA 2LJ5A 1I4PA 2DZJA 3TMPB 2LUMA 3TEWA 1YIWA 2GMIC 4HKZE 1XQQA 3VTWA 4MGYE 1C3TA 3VQIA 3AU5A 4WJPA 3WCQA 2NVUI 1MVKA 3L13A 3FILB 1WJNA 4FJVB 4IUMB 1N6ZA 1SIJA 3W5VB 1K50A 4DXFA 4CHKA 4HXDA 4BOSC 4L2YA 2PW9A 1TY0A 4GN1A 4LNFA 1QKZA 3ZQ4A 5E6OA 3RNBC 3U52E 1M94A 2LRWA 3M62B 1F2RI 1FXTB 2UU7A 1MPEA 1L2NA 2JVCA 2H89B 2NPTA 4KV2A 4C80A 2K8BA 3QIJA 2M4NA 4LK0M 1XLQA 3Q8FA 1WI0A 2DYBA 4HPMB 3WANA 1FPYA 1YX5B 1E6EB 1SE2A 2KTRB 3ABVB 2KAJA 3BIID 2ZEQA 2KX0A 1HXYD 3PGEA 5H8YE 2GBRA 1GAQB 3BZDB 3DWMA 1V9JA 3UI3A 2G1EA 2K8CA 4NJ7A 3JW0X 2WXFA 1WXVA 5IOIA 4NY0A 4ITKA 4GDKA 2I1JA 1T0YA 2NBVB 1L0VB 2WXJA 3DVNU 4KIKB 3Q14C 3N1XC 2CHWA 1D3ZA 3PVLA 1FMAD 2N7JA 5E6JA 1YOVB 5AUKA 2KLGA 1L0XB 2KC1A 3NOBA 2DENB 2L00B 2PE6B 3B9JA 3PRMB 3ZNGC 1E90A 2J52A 1H8CA 4WJOA 2N9EB 4LDTB 2BYFA 2GBKA 2QSDA 4DBGA 4NJCA 3NRZA 1D4BA 2JQRB 1ROEA 3ZXRA 2LHDA 4WURA 1WZ3A 4DXAB 4W9KA 4P16A 1YN3A 2JZ3B 1HZ5A 1XD3B 1JRPA 4I6PA 2KWDA 3PZ7A 4JQWC 1YJIA 2CR5A 3KUCB 4NAMA 3W1YA 2IPKD 3ZO5B 3QK0A 4NQLB 2BS2B 1A5RA 4NPNA 1P7FA 3A1QB 2ZPYA 3NG0A 1DOYA 3QX1A 2LRUA 4MH8A 3U8ZA 4BZAA 4ICUA 1P98A 2PKOA 2GRIA 1ZXIA 3W5UB 3UF8A 4MGKE 4YSXB 4PS7A 2AWTA 3NS1A 3WALA 4P6VF 5G5GA 2I1KA 2CS4A 1TY2A 2HJ1A 4HDOA 4NJ6A 3DVGY 2DAFA 5BMHA 1VCBA 1PGBA 3MC8A 5AEKB 3CWIA 1EF1A 1SE9A 1QT9A 1FCCC 3AEEB 1UD7A 1I35A 4RF0A 1A70A 2OEDA 4W9LA 2QCZA 2KJ6A 2OJWA 4C7YA 2CHZA 2LZ6A 4LJOB 4XC2A 3CSFA 4US8A 4RF1A 1CK1A 4HJGE 2IO1B 4EE2A 2KKCA 1QOGA 4MDKE 1KOTA 2NS5A 1XCQL 1YMHE 4JLCA 2J0JA 1J19A 1UUPA 2LXAA 3TEXA 1BT0A 3N9YC 4AP4C 4BOZB 3V60A 2N9LA 2BW2A 3N3KB 1WY8A 4L1BA 4WAFA 3FILA 3B08A 2KVRA 4LDTD 1RLFA 2KO3A 3H7PB 2WYQA 3AI5A 2HD5B 4K3BA 5D2MB 2HE7A 4FBJB 2C60A 3R2IA 3I5JC 4K81A 2WLBA 3RYTA 5BYQA 4MEMA 1T0QC 4BVUC 4BBNF 4IW0A 4IM3A 1KJTA 2ZZPB 1IPGA 2FCSA 1YJJA 2G45B 1JWUD 2HDEA 1FNVA 3RMKC 3TUOA 4YTMB 4R3DA 3PTFC 1GPXA 3ENEA 1OEYA 4TUUA 5LXHA 2PTLA 3BYYB 2DX5B 3MC9A 3VRBB 2MCNB 2SEBD 4IG7B 2DHZA 3KYDD 1WYWB 2PPHA 2AL3A 4KSKC 3IT6B 4LNIA 5JZEB 3TEYA 2L83A 4A3OA 2W55A 4KZ0A 1ET6A 3GS2A 3PZ8A 1WF9A 2QMTA 1IGCA 2K3UA 2VH1A 3HRDD 2ZVOA 4TQ1A 1TS2A 3LJ3A 3QAQA 4RGMA 1K8RB 3H9DA 1JRUA 4W9GA 1WX9A 4TKNA 3U30A 2MBEA 3MC0B 4ANUA 2GLSA 1WGHA 3AM9A 1N61A 2FIDA 2V3PA 4RCOA 3PLUA 2B76B 5FKAC 4ZRIA 2AEHA 2Z8LA 2V3NA 3A1QA 2QIEB 4MT5A 2LVQA 4W9HA 3FAHA 4AJWA 4TQ0A 1V97A 5BYRA 2M0AA 2IY1B 3HUIA 2LMCA 4REZA 2WXPA 4GDLB 4LNKA 4KSLC 3MP9A 1ZOYB 3P1MA 4IKGA 2KXJA 4AUQC 1U4AA 1YN5A 4FHKA 3U4EG 2RDGA 3DCGA 3KWVA 1KFYB 2EMSA 3HK0A 5CHVC 3PRZA 1VZ7A 3M63B 4AJYB 2MSED 2D3BA 2ZVNA 3OJ3A 3LB8C 3PHXB 4NAWA 4NNJB 1WGDA 3NS8A 1L7YA 2XBBC 3AE6B 1WE6A 1QOFA 2KHWB 2QILA 4ZRPA 3BK2A 1E5WA 2REXA 2JYEA 1K53A 1TS5A 1C4PA 4QAYA 5G2NA 2L3ZA 2MH7A 2KVZA 2RPVA 4GXBA 2NTSA 1MJDA 2MA9B 3L10B 3BYTB 3BINA 1AW7A 4FN2A 3ALBA 1WXAA 3PZDA 1JWAD 2SAKA 2WXLA 2MJ3A 4IWOA 1TTNA 2LFIA 2QDFA 4YXDB 1FD6A 1FIQA 4YTPB 3DBLB 4KKIA 3AE3B 4A8XC 5D6JB 3IVFA 3Q2AC 2BWES 2Y5PA 4BAXA 2KJHB 1BXTA 2KT7A 3EUB2 4GDKB 4XE0A 4EFOA 3VVWB 1J7AA 1QOBA 3AMZA 4X57B 1PQSA 2FAZA 3APDA 2LGYA 3AECB 4MH0E 1ZXHA 4W9FA 5AZGA 4DDGD 1V6EA 2JF5A 1TKGA 3R7RA 2MW5A 4GGQA 2JSVX 2LGDA 3AE8B 4C56C 4W9DA 2JU6X 3P4SB 2KMAA 1WR6E 3PHWB 2DAJA 2KDMA 4YSZB 3UQBA 3DOWA 2LVOA 2K0PA 1FM0D 2M1MA 4JL9A 5FK9C 4KVGB 3IAS1 2G9HD 2DWQA 4GMVA 3ETRA 3U7DA 1VD2A 3DVNV 4II2B 1RM6C 5EE1A 3PPAA 1EWYC 3ZW3A 2R2OA 3AEFB 4L23A 3A9KB 5C3JB 1BMLC 4ZRQA 1OGWA 2MHJA 2WXGA 2D3GA 1TS3A 1TKEA 2DNFA 4OVVA 1WXSA 3SEBA 4ZOHC 4FLHA 4HPLB 1JROA 2ASQA 3U7ZA 1N60A 4N9F4 3AEBB 4FA6A 4K7UA 2RSUA 1RWSA 3C8YA 1UF0A 4P7IA 4ZYNA 1C4AA 1LXDA 2J4XA 2BQQA 3ZUNA 1X1MA 2RD0A 3ZXVA 4PYZA 3ONSA 1C78A 2IO3B 3GB1A 2EKEC 1GJZA 2KQ4X 3P2BA 3GZNI 2D3AA 4M0WA 2LXCA 3IT4B 4F1SA 3SU8X 3X0WA 1P0RA 1C9FA 4HKQA 4A9AA 1LGRA 4JE3B 4BKSA 5FR6A 3B2GA 5BMGA 4A6QA 3ZVVA 2IGGA 5E6PA 3QQ8B 4K7WA 2IY0B 1E8XA 2BYVE 2V4IB 3N20C 2PEAA 4GB9A 3A4SC 2L0TA 1J8CA 4LNOA 3CIRB 4US9A 4WIPA 2L8JA 2NTTA 3Q3FA 1SF0A 1SJHD 3UIPB 1PDXA 1Y56A 5DPTA 4M8MA 1QOAA 4KDIC 1ZP0B 2MEKA 1SB3C 1QLBB 3KW5B 2XN9C 2Z0EB 3NVZA 4F7ZA 5AUIA 3DBRB 1NDDA 3WA0A 4EOYA 5BYSA 2MJEA 3W2DA 2CJNA 2BTEA 4TMAB 5AZHA 1OTRB 3RNFC 2QJLA 2ZW1A 2YEPB 4E71A 2K6QA 1EF5A 2MP2A 5D3IB 2KFJA 1L5PA 2BKRB 3EHVA 1B9RA 2RR9A 2IBIB 1T0SC 3IFWB 2Z59B 4FADA 3I3TB 2HTME 4YTNB 4ARCA 1C79A 1D5MC 1JQ4A 2L05A 1I4GA 1T0RC 2WX0A 3BVGA 2UWQA 1VDVA 5JXVA 1C77A 2KNBA 1TZOA 3DBLI 1SE3A 1WXMA 2WS3B 4IC7B 1GB1A 1SEBD 3P4RB 5LXIB 1WJ4A 3PRPB 5D7GA 3KH0A 1I7HA 4PS3A 3N30A 2LGIA 2ZW0A 2MBQA 1OFFA 1V49A 4JGHB 3Q69A 3L0WB 4OZCA 3ZKJC
chains in the Genus database with same CATH topology
1H4RA 2C9WB 3RT3B 1EUVB 1SIFA 2C60A 5JHBA 4KDLB 4K81A 4XZ4A 3RYTA 4B6WA 2LI5A 2JT4B 2JXXA 2W9NA 2D10A 4EUTA 3MTNB 4MEMA 4BVUC 4AOFA 4BBNF 2KANA 3CMMB 1TBEA 5C23A 4IW0A 3V61A 4IM3A 1KJTA 3L17A 1UH6A 2G4SA 2ZZPB 1CMXB 2DYMA 2XK5A 1R4MI 1IPGA 2FCSA 2LWPA 2ZNVC 4FHJA 3H7SA 3RULA 2G45B 3AXCA 2J0KA 1YJ1A 3PTFC 2D07B 3QHTA 1P3QU 1YD8U 3ENEA 1OEYA 4TUUA 5LXHA 3ZTCA 2LD9A 4MGZE 4W9EA 2C7MB 3WAOA 2NPTB 4I6NB 2FNJB 3V6EB 3R3MA 3NY5A 1AARA 1RFAA 2DX5B 2XEWA 3WAPA 5L83A 1YQBA 4IM2A 2GOWA 3T8MA 4DHJB 1NI2A 3A9JA 4MSQB 3TL5A 2MCNB 4IG7B 2L7RA 3VHTC 3UGBB 2DHZA 4B95A 2KDFB 3KYDD 1WYWB 2PJHA 1Q5WB 2PPHA 2D11A 4EZJA 2AL3A 3K9OB 2K1FA 4KSKC 3A9KA 2FCQA 4DK5A 3V6CB 4B9KA 3QWZB 5JZEB 1V5OA 2IO0B 5G55A 4A3OA 4KZ0A 2N7EA 2PE9A 4HK2A 1NBFC 2LGXA 3ZIMA 3H7PA 2KOXA 1WF9A 2DZMA 2OOBB 3B1LX 1GG3A 2ZVOA 4IM0A 5KHOA 2C7HA 5DCNA 2FUHB 4TQ1A 3R66C 1EO6A 2N4FA 3LJ3A 3QAQA 1K8RB 3T9LA 4MJSB 3H9DA 4NAWB 1Y8RC 1JRUA 3RD2A 4W9GA 1WX9A 2BKFA 5AZFA 2C7NB 1S3SG 5EDSA 4TKNA 1WM2A 3U30A 3DVGX 2Y5BB 3PT2B 3ZTDA 3VXWA 1WX7A 2N1VA 4HCPB 2A4ZA 2MBEA 2MBBB 4ANUA 1WGHA 2FIDA 1WJUA 3ML8A 3IG3A 1E7VA 3WAMA 2K8HA 2O6VA 4FULA 3PLUA 2KQ7A 3CF6E 1E8ZA 4ZRIA 2AEHA 3L16A 4WWOA 2KC2A 2JWZA 1UBIA 3X23A 5L95C 2BPSA 3O65B 5CHFA 2FCNA 5E6NA 2O2VA 3A1QA 3JSVA 2BWFA 3PREA 3SD5A 2NBWB 2LVQA 1WR1A 2GBJA 3DQVA 4W9HA 4AJWA 3VUWA 4WAAA 3ZRCA 3KUDB 1WIAA 4TQ0A 3C0RB 4II3B 1G6JA 2IY1B 2N9XA 4ANVA 3N32A 2EMTA 2M17A 4G11A 4WWNA 4GDLB 3RCZA 1WE7A 3TJPA 4KSLC 3R7QA 2MWSB 2NCNA 4A20A 3B0AA 5J18A 3IBEA 3ZDTA 5DPWA 2KXJA 4AUQC 1U4AA 1V86A 1KM7A 3PV1A 4E74A 2MBOA 4FHKA 3ZNZB 3DCGA 4G0NB 1Z5SB 1Q0WB 2KD0A 2EMSA 4HVBA 3HK0A 5CHVC 2DYOA 4W9CA 1HE8A 3PRZA 3M63B 2G4DB 2KFKB 4AJYB 3A4RA 4GOCA 2MSED 2WDTB 3A33B 1J0GA 2ZVNA 3OJ3A 2RPQA 2KDBA 1UZXB 3M3JA 1GUAB 1UELA 3NZSA 3PHXB 3QC8B 4NAWA 1KLVA 4NNJB 1WGDA 2JRIB 3UINB 3V62A 2GBMA 1WFYA 3NS8A 1L7YA 1P9DU 2QHOA 2ZJDA 3RUIB 1Q1OA 2XBBC 2LVPA 4URKA 5HKHA 4RMAA 1WMHB 1WE6A 3AULA 5CTRC 1WM3A 2KHWB 3JYUA 4EKUA 4BKGA 4JGHB 3HIZA 2J0MA 1E5WA 2IO2B 2REXA 4GSWA 2B3AA 3ZDMC 2V3SA 2MBHA 1E7UA 4W9IA 5D94A 4ASWC 2BGFA 2V1YA 4W9JA 1E8WA 5G2NA 2L3ZA 3CSTA 2VRRB 1V81A 4ZRKA 2D2QA 2JY6A 3VDZA 4GXBA 1IYFA 2MA9B 3D32A 3L10B 4DWFA 1RRBA 3BINA 4RM8A 4G50A 3APFA 4FN2A 3TBLD 5DPRA 3ALBA 3L08A 1WXAA 3PZDA 3PSEB 2A5UA 3DDCB 4DHZB 2K39A 4GDLA 2LJ5A 2DZJA 4IWOA 1TTNA 3TMPB 3EFUA 1YIWA 2YLMA 2GMIC 1XQQA 2N1WA 5D6JB 2AYOB 3IVFA 3VTWA 3JVZX 2BWES 2KDIA 2OJRA 2JZZA 3HHMA 4MGYE 3VQIA 2CU1A 3AU5A 4WJPA 2KJHB 1C3TA 2KN5A 3L54A 4OVUA 3WIMA 4GDKB 4EFOA 2KFKA 2NBUA 2NVUI 1WGRA 2LUEA 3VVWB 1QZEA 3L13A 1WJNA 4FJVB 4IUMB 4X57B 1PQSA 2FAZA 3QARA 4CHKA 3APDA 4HXDA 4LCDE 2LGYA 2KWVB 1WRDB 4BOSC 4MH0E 1SGHA 2N7DA 2ZCBA 4W9FA 5AZGA 4DDGD 5LLIA 4GN1A 1V6EA 2JF5A 4GIVA 3R7RA 4MM3A 5E6OA 1ZW7A 2MW5A 5GMVA 4ZDVA 1Z2MA 1M94A 2LRWA 4GGQA 3M62B 4AWJA 3KYCD 2MRPA 4IWPA 1FXTB 2LGDA 3MJWA 4MSMB 1GNUA 4W9DA 3LDZE 2R2QA 2MQJA 3IHPC 1L2NA 2JVCA 4HJKA 3S2AA 1XT9B 2KMAA 1WR6E 2NPTA 3PHWB 4KV2A 3RZFA 2DAJA 2JUOA 2K8BA 4F8CB 3QIJA 3UQBA 2ZNVB 3DOWA 2LVOA 4M8NA 2G3QB 2M4NA 2M1MA 3OJ4B 4JL9A 1WI0A 2Z0DB 2DYBA 4HPMB 3K9PB 3WANA 1OQYA 1YX5B 2CHXA 4KVGB 5IAAC 2KTRB 4M0WB 3RZWC 2C5LC 2V4LA 2ZEQA 2KX0A 3HM6X 3PGEA 4EZLA 2ZPNA 2KWUB 1UBQA 1GC7A 4GMVA 1F9JA 2GBRA 3U7DA 1V9JA 1VD2A 4PYUA 3DVNV 4IWQA 4E3CA 3A9JB 4II2B 4WQOB 4DDID 4RM9A 3PPAA 4K7SA 2K8CA 3ZW3A 4NJ7A 2R2OA 3JW0X 4I6LB 3KUZA 3VTVA 1WXVA 4NY0A 3A9KB 2I1JA 1T0YA 4GDKA 1C1YB 3ZLZA 2CKHB 1OGWA 2NBVB 4MJSA 3DVNU 4KIKB 2WX1A 1E8YA 5IA7A 4WWPA 2WWZA 3VH4B 2J7QB 2D3GA 4YL8A 2CHWA 5JH5C 1D3ZA 3PVLA 1ZGUB 3NZUA 3VAWA 1TGZB 4OVVA 1WXSA 2KLGA 3BY4B 2KC1A 3M95A 4FLHA 3NOBA 2DENB 4HPLB 2L00B 2KZRA 2PE6B 5KHQA 2ASQA 2L0FA 3PRMB 3ZNGC 2M8SA 4CYEA 4CO7A 1E90A 1LFDA 3TCAA 3GOEA 1H8CA 2AL6A 2N9EB 1WGYA 4WJOA 4DHJD 4LDTB 1RAXA 2BYFA 2BYEA 4N9F4 2KTFA 5J2RA 2GBKA 4DBGA 4FA6A 1GC6A 4K7UA 3NHEB 2RSUA 2K25A 3Q3JA 4JIOU 1WZ3A 1S1QB 2JRHA 2ZCCA 3SDLC 4W9KA 4DXAB 4HCNB 2JZ3B 3VUYA 4ANXA 4P7IA 4ZYNA 3DBRI 1LXDA 1XD3B 4I6PA 3ZUNA 1X1MA 3QCAA 1OEYJ 2O6VB 4JQWC 2RD0A 1R4NI 2KX3A 2CR5A 3KUCB 1P1AA 3ONSA 1MG8A 4HWIB 4PYZA 3W1YA 3ZO5B 3QK0A 2MP2B 1V80A 2IO3B 4NQLB 1LQBA 2EKEC 2UYZB 5JHAA 1A5RA 4NPNA 1GJZA 2KQSA 3AU4A 1WH3A 2O2VB 3P2BA 3A1QB 3GZNI 3JSVB 2BF8B 5CX3A 2ZPYA 2KTRA 4PS8A 3QX1A 2LXCA 2LRUA 4F1SA 3SU8X 3X0WA 1P0RA 4G3XB 3U8ZA 4DHZE 3W1SA 2FCMA 1ISNA 1P98A 4ICUA 3W1SC 1LM8B 4ANWA 3UF8A 3MHSD 4MGKE 4BBNC 3SHQA 4PS7A 4BKSA 2AWTA 5FR6A 4KZCA 1WZ0A 3WALA 3H1UA 3OAWA 1V5TA 4GU2A 2DZIA 2I1KA 5E6PA 3ZVVA 2CS4A 1I42A 3VUXA 2KK8A 3QJZA 3QQ8B 1WGGA 1V2YA 5CHWA 2M0XA 4HDOA 4K7WA 2N9PC 4NJ6A 2IY0B 1E8XA 4NQKE 2BYVE 4GB9A 4KIKA 2PEAA 2JPHA 3DVGY 2DAFA 3A4SC 3EC8A 4ZRJA 2L0TA 1VCBA 2HJ8A 3ZRFA 1J8CA 3ML9A 2K6DB 5C1ZA 4J6IA 4BKTA 2L8JA 5AEKB 3Q3FA 1EF1A 1WMHA 2DZKA 3UIPB 1SE9A 4A3PA 3ZNHB 2GBNA 1I35A 5DPTA 1UD7A 4M8MA 3ZNID 4KDIC 5BO4B 4TV3A 4W9LA 2YVCA 4HLEA 4BFRA 3UQAA 3PLVA 2KJ6A 3KW5B 4EEWA 2Z0EB 3APCA 2CHZA 2LZ6A 4LJOB 2LASA 3H6NA 4F7ZA 1NDDA 3WA0A 4EOYA 4XC2A 1UGMA 4MGIE 2XK5B 3CSFA 4LJPB 5J17A 5AZHA 1OTRB 4E71A 2K6QA 4BKSD 3OLMD 3HM3A 1EF5A 2MP2A 3EECA 2IO1B 3ECIA 2KKCA 3UIOB 2KFJA 4MDKE 1KOTA 2NS5A 2BKRB 4JLCA 2J0JA 3EHVA 1J19A 2IYDB 2KWCA 2MX2A 2RR9A 2IBIB 2LXAA 3VH3B 1BT0A 3IFWB 2Z59B 4AP4C 5TR5A 4BOZB 3V60A 1WJ6A 4FADA 3I3TB 4FJYA 3N3KB 2MLBA 1YX6B 2KDEB 4WJNA 2L05A 1WX8A 3KVFB 4ICVA 3TIXA 2WX0A 1WY8A 4HDQA 2UWQA 4EZKA 2KJRA 3DPDA 2KMCA 3B08A 4K1RB 4MELA 2KVRA 2KNBA 4LDTD 3DBLI 1WXMA 4FJZA 4IC7B 1RLFA 2HTHA 2KO3A 2NR2A 3H7PB 2WYQA 1TZ1A 3QA8A 3DBHI 5LXIB 1WJ4A 2IZVB 2RGFA 3AI5A 3PRPB 5D7GA 4WJQA 2HD5B 3VFKA 1IP9A 2L76A 3DBSA 3KH0A 4XX5A 3VTUA 1ZKHA 2FIFA 4PS3A 5D2MB 3N30A 3PS6A 2HE7A 2MBQA 3L0WB 1V49A 2O6VD 5DPSA 2KLCA 3ZKJC 4FBJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H4R A;  2C9W B;  3RT3 B;  1EUV B;  1SIF A;  2C60 A;  5JHB A;  4KDL B;  4K81 A;  4XZ4 A;  3RYT A;  4B6W A;  2LI5 A;  2JT4 B;  2JXX A;  2W9N A;  2D10 A;  4EUT A;  3MTN B;  4MEM A;  4BVU C;  4AOF A;  4BBN F;  2KAN A;  3CMM B;  1TBE A;  5C23 A;  4IW0 A;  3V61 A;  4IM3 A;  1KJT A;  3L17 A;  1UH6 A;  2G4S A;  2ZZP B;  1CMX B;  2DYM A;  2XK5 A;  1R4M I;  1IPG A;  2FCS A;  2LWP A;  2ZNV C;  4FHJ A;  3H7S A;  3RUL A;  2G45 B;  3AXC A;  2J0K A;  1YJ1 A;  3PTF C;  2D07 B;  3QHT A;  1P3Q U;  1YD8 U;  3ENE A;  1OEY A;  4TUU A;  5LXH A;  3ZTC A;  2LD9 A;  4MGZ E;  4W9E A;  2C7M B;  3WAO A;  2NPT B;  4I6N B;  2FNJ B;  3V6E B;  3R3M A;  3NY5 A;  1AAR A;  1RFA A;  2DX5 B;  2XEW A;  3WAP A;  5L83 A;  1YQB A;  4IM2 A;  2GOW A;  3T8M A;  4DHJ B;  1NI2 A;  3A9J A;  4MSQ B;  3TL5 A;  2MCN B;  4IG7 B;  2L7R A;  3VHT C;  3UGB B;  2DHZ A;  4B95 A;  2KDF B;  3KYD D;  1WYW B;  2PJH A;  1Q5W B;  2PPH A;  2D11 A;  4EZJ A;  2AL3 A;  3K9O B;  2K1F A;  4KSK C;  3A9K A;  2FCQ A;  4DK5 A;  3V6C B;  4B9K A;  3QWZ B;  5JZE B;  1V5O A;  2IO0 B;  5G55 A;  4A3O A;  4KZ0 A;  2N7E A;  2PE9 A;  4HK2 A;  1NBF C;  2LGX A;  3ZIM A;  3H7P A;  2KOX A;  1WF9 A;  2DZM A;  2OOB B;  3B1L X;  1GG3 A;  2ZVO A;  4IM0 A;  5KHO A;  2C7H A;  5DCN A;  2FUH B;  4TQ1 A;  3R66 C;  1EO6 A;  2N4F A;  3LJ3 A;  3QAQ A;  1K8R B;  3T9L A;  4MJS B;  3H9D A;  4NAW B;  1Y8R C;  1JRU A;  3RD2 A;  4W9G A;  1WX9 A;  2BKF A;  5AZF A;  2C7N B;  1S3S G;  5EDS A;  4TKN A;  1WM2 A;  3U30 A;  3DVG X;  2Y5B B;  3PT2 B;  3ZTD A;  3VXW A;  1WX7 A;  2N1V A;  4HCP B;  2A4Z A;  2MBE A;  2MBB B;  4ANU A;  1WGH A;  2FID A;  1WJU A;  3ML8 A;  3IG3 A;  1E7V A;  3WAM A;  2K8H A;  2O6V A;  4FUL A;  3PLU A;  2KQ7 A;  3CF6 E;  1E8Z A;  4ZRI A;  2AEH A;  3L16 A;  4WWO A;  2KC2 A;  2JWZ A;  1UBI A;  3X23 A;  5L95 C;  2BPS A;  3O65 B;  5CHF A;  2FCN A;  5E6N A;  2O2V A;  3A1Q A;  3JSV A;  2BWF A;  3PRE A;  3SD5 A;  2NBW B;  2LVQ A;  1WR1 A;  2GBJ A;  3DQV A;  4W9H A;  4AJW A;  3VUW A;  4WAA A;  3ZRC A;  3KUD B;  1WIA A;  4TQ0 A;  3C0R B;  4II3 B;  1G6J A;  2IY1 B;  2N9X A;  4ANV A;  3N32 A;  2EMT A;  2M17 A;  4G11 A;  4WWN A;  4GDL B;  3RCZ A;  1WE7 A;  3TJP A;  4KSL C;  3R7Q A;  2MWS B;  2NCN A;  4A20 A;  3B0A A;  5J18 A;  3IBE A;  3ZDT A;  5DPW A;  2KXJ A;  4AUQ C;  1U4A A;  1V86 A;  1KM7 A;  3PV1 A;  4E74 A;  2MBO A;  4FHK A;  3ZNZ B;  3DCG A;  4G0N B;  1Z5S B;  1Q0W B;  2KD0 A;  2EMS A;  4HVB A;  3HK0 A;  5CHV C;  2DYO A;  4W9C A;  1HE8 A;  3PRZ A;  3M63 B;  2G4D B;  2KFK B;  4AJY B;  3A4R A;  4GOC A;  2MSE D;  2WDT B;  3A33 B;  1J0G A;  2ZVN A;  3OJ3 A;  2RPQ A;  2KDB A;  1UZX B;  3M3J A;  1GUA B;  1UEL A;  3NZS A;  3PHX B;  3QC8 B;  4NAW A;  1KLV A;  4NNJ B;  1WGD A;  2JRI B;  3UIN B;  3V62 A;  2GBM A;  1WFY A;  3NS8 A;  1L7Y A;  1P9D U;  2QHO A;  2ZJD A;  3RUI B;  1Q1O A;  2XBB C;  2LVP A;  4URK A;  5HKH A;  4RMA A;  1WMH B;  1WE6 A;  3AUL A;  5CTR C;  1WM3 A;  2KHW B;  3JYU A;  4EKU A;  4BKG A;  4JGH B;  3HIZ A;  2J0M A;  1E5W A;  2IO2 B;  2REX A;  4GSW A;  2B3A A;  3ZDM C;  2V3S A;  2MBH A;  1E7U A;  4W9I A;  5D94 A;  4ASW C;  2BGF A;  2V1Y A;  4W9J A;  1E8W A;  5G2N A;  2L3Z A;  3CST A;  2VRR B;  1V81 A;  4ZRK A;  2D2Q A;  2JY6 A;  3VDZ A;  4GXB A;  1IYF A;  2MA9 B;  3D32 A;  3L10 B;  4DWF A;  1RRB A;  3BIN A;  4RM8 A;  4G50 A;  3APF A;  4FN2 A;  3TBL D;  5DPR A;  3ALB A;  3L08 A;  1WXA A;  3PZD A;  3PSE B;  2A5U A;  3DDC B;  4DHZ B;  2K39 A;  4GDL A;  2LJ5 A;  2DZJ A;  4IWO A;  1TTN A;  3TMP B;  3EFU A;  1YIW A;  2YLM A;  2GMI C;  1XQQ A;  2N1W A;  5D6J B;  2AYO B;  3IVF A;  3VTW A;  3JVZ X;  2BWE S;  2KDI A;  2OJR A;  2JZZ A;  3HHM A;  4MGY E;  3VQI A;  2CU1 A;  3AU5 A;  4WJP A;  2KJH B;  1C3T A;  2KN5 A;  3L54 A;  4OVU A;  3WIM A;  4GDK B;  4EFO A;  2KFK A;  2NBU A;  2NVU I;  1WGR A;  2LUE A;  3VVW B;  1QZE A;  3L13 A;  1WJN A;  4FJV B;  4IUM B;  4X57 B;  1PQS A;  2FAZ A;  3QAR A;  4CHK A;  3APD A;  4HXD A;  4LCD E;  2LGY A;  2KWV B;  1WRD B;  4BOS C;  4MH0 E;  1SGH A;  2N7D A;  2ZCB A;  4W9F A;  5AZG A;  4DDG D;  5LLI A;  4GN1 A;  1V6E A;  2JF5 A;  4GIV A;  3R7R A;  4MM3 A;  5E6O A;  1ZW7 A;  2MW5 A;  5GMV A;  4ZDV A;  1Z2M A;  1M94 A;  2LRW A;  4GGQ A;  3M62 B;  4AWJ A;  3KYC D;  2MRP A;  4IWP A;  1FXT B;  2LGD A;  3MJW A;  4MSM B;  1GNU A;  4W9D A;  3LDZ E;  2R2Q A;  2MQJ A;  3IHP C;  1L2N A;  2JVC A;  4HJK A;  3S2A A;  1XT9 B;  2KMA A;  1WR6 E;  2NPT A;  3PHW B;  4KV2 A;  3RZF A;  2DAJ A;  2JUO A;  2K8B A;  4F8C B;  3QIJ A;  3UQB A;  2ZNV B;  3DOW A;  2LVO A;  4M8N A;  2G3Q B;  2M4N A;  2M1M A;  3OJ4 B;  4JL9 A;  1WI0 A;  2Z0D B;  2DYB A;  4HPM B;  3K9P B;  3WAN A;  1OQY A;  1YX5 B;  2CHX A;  4KVG B;  5IAA C;  2KTR B;  4M0W B;  3RZW C;  2C5L C;  2V4L A;  2ZEQ A;  2KX0 A;  3HM6 X;  3PGE A;  4EZL A;  2ZPN A;  2KWU B;  1UBQ A;  1GC7 A;  4GMV A;  1F9J A;  2GBR A;  3U7D A;  1V9J A;  1VD2 A;  4PYU A;  3DVN V;  4IWQ A;  4E3C A;  3A9J B;  4II2 B;  4WQO B;  4DDI D;  4RM9 A;  3PPA A;  4K7S A;  2K8C A;  3ZW3 A;  4NJ7 A;  2R2O A;  3JW0 X;  4I6L B;  3KUZ A;  3VTV A;  1WXV A;  4NY0 A;  3A9K B;  2I1J A;  1T0Y A;  4GDK A;  1C1Y B;  3ZLZ A;  2CKH B;  1OGW A;  2NBV B;  4MJS A;  3DVN U;  4KIK B;  2WX1 A;  1E8Y A;  5IA7 A;  4WWP A;  2WWZ A;  3VH4 B;  2J7Q B;  2D3G A;  4YL8 A;  2CHW A;  5JH5 C;  1D3Z A;  3PVL A;  1ZGU B;  3NZU A;  3VAW A;  1TGZ B;  4OVV A;  1WXS A;  2KLG A;  3BY4 B;  2KC1 A;  3M95 A;  4FLH A;  3NOB A;  2DEN B;  4HPL B;  2L00 B;  2KZR A;  2PE6 B;  5KHQ A;  2ASQ A;  2L0F A;  3PRM B;  3ZNG C;  2M8S A;  4CYE A;  4CO7 A;  1E90 A;  1LFD A;  3TCA A;  3GOE A;  1H8C A;  2AL6 A;  2N9E B;  1WGY A;  4WJO A;  4DHJ D;  4LDT B;  1RAX A;  2BYF A;  2BYE A;  4N9F 4;  2KTF A;  5J2R A;  2GBK A;  4DBG A;  4FA6 A;  1GC6 A;  4K7U A;  3NHE B;  2RSU A;  2K25 A;  3Q3J A;  4JIO U;  1WZ3 A;  1S1Q B;  2JRH A;  2ZCC A;  3SDL C;  4W9K A;  4DXA B;  4HCN B;  2JZ3 B;  3VUY A;  4ANX A;  4P7I A;  4ZYN A;  3DBR I;  1LXD A;  1XD3 B;  4I6P A;  3ZUN A;  1X1M A;  3QCA A;  1OEY J;  2O6V B;  4JQW C;  2RD0 A;  1R4N I;  2KX3 A;  2CR5 A;  3KUC B;  1P1A A;  3ONS A;  1MG8 A;  4HWI B;  4PYZ A;  3W1Y A;  3ZO5 B;  3QK0 A;  2MP2 B;  1V80 A;  2IO3 B;  4NQL B;  1LQB A;  2EKE C;  2UYZ B;  5JHA A;  1A5R A;  4NPN A;  1GJZ A;  2KQS A;  3AU4 A;  1WH3 A;  2O2V B;  3P2B A;  3A1Q B;  3GZN I;  3JSV B;  2BF8 B;  5CX3 A;  2ZPY A;  2KTR A;  4PS8 A;  3QX1 A;  2LXC A;  2LRU A;  4F1S A;  3SU8 X;  3X0W A;  1P0R A;  4G3X B;  3U8Z A;  4DHZ E;  3W1S A;  2FCM A;  1ISN A;  1P98 A;  4ICU A;  3W1S C;  1LM8 B;  4ANW A;  3UF8 A;  3MHS D;  4MGK E;  4BBN C;  3SHQ A;  4PS7 A;  4BKS A;  2AWT A;  5FR6 A;  4KZC A;  1WZ0 A;  3WAL A;  3H1U A;  3OAW A;  1V5T A;  4GU2 A;  2DZI A;  2I1K A;  5E6P A;  3ZVV A;  2CS4 A;  1I42 A;  3VUX A;  2KK8 A;  3QJZ A;  3QQ8 B;  1WGG A;  1V2Y A;  5CHW A;  2M0X A;  4HDO A;  4K7W A;  2N9P C;  4NJ6 A;  2IY0 B;  1E8X A;  4NQK E;  2BYV E;  4GB9 A;  4KIK A;  2PEA A;  2JPH A;  3DVG Y;  2DAF A;  3A4S C;  3EC8 A;  4ZRJ A;  2L0T A;  1VCB A;  2HJ8 A;  3ZRF A;  1J8C A;  3ML9 A;  2K6D B;  5C1Z A;  4J6I A;  4BKT A;  2L8J A;  5AEK B;  3Q3F A;  1EF1 A;  1WMH A;  2DZK A;  3UIP B;  1SE9 A;  4A3P A;  3ZNH B;  2GBN A;  1I35 A;  5DPT A;  1UD7 A;  4M8M A;  3ZNI D;  4KDI C;  5BO4 B;  4TV3 A;  4W9L A;  2YVC A;  4HLE A;  4BFR A;  3UQA A;  3PLV A;  2KJ6 A;  3KW5 B;  4EEW A;  2Z0E B;  3APC A;  2CHZ A;  2LZ6 A;  4LJO B;  2LAS A;  3H6N A;  4F7Z A;  1NDD A;  3WA0 A;  4EOY A;  4XC2 A;  1UGM A;  4MGI E;  2XK5 B;  3CSF A;  4LJP B;  5J17 A;  5AZH A;  1OTR B;  4E71 A;  2K6Q A;  4BKS D;  3OLM D;  3HM3 A;  1EF5 A;  2MP2 A;  3EEC A;  2IO1 B;  3ECI A;  2KKC A;  3UIO B;  2KFJ A;  4MDK E;  1KOT A;  2NS5 A;  2BKR B;  4JLC A;  2J0J A;  3EHV A;  1J19 A;  2IYD B;  2KWC A;  2MX2 A;  2RR9 A;  2IBI B;  2LXA A;  3VH3 B;  1BT0 A;  3IFW B;  2Z59 B;  4AP4 C;  5TR5 A;  4BOZ B;  3V60 A;  1WJ6 A;  4FAD A;  3I3T B;  4FJY A;  3N3K B;  2MLB A;  1YX6 B;  2KDE B;  4WJN A;  2L05 A;  1WX8 A;  3KVF B;  4ICV A;  3TIX A;  2WX0 A;  1WY8 A;  4HDQ A;  2UWQ A;  4EZK A;  2KJR A;  3DPD A;  2KMC A;  3B08 A;  4K1R B;  4MEL A;  2KVR A;  2KNB A;  4LDT D;  3DBL I;  1WXM A;  4FJZ A;  4IC7 B;  1RLF A;  2HTH A;  2KO3 A;  2NR2 A;  3H7P B;  2WYQ A;  1TZ1 A;  3QA8 A;  3DBH I;  5LXI B;  1WJ4 A;  2IZV B;  2RGF A;  3AI5 A;  3PRP B;  5D7G A;  4WJQ A;  2HD5 B;  3VFK A;  1IP9 A;  2L76 A;  3DBS A;  3KH0 A;  4XX5 A;  3VTU A;  1ZKH A;  2FIF A;  4PS3 A;  5D2M B;  3N30 A;  3PS6 A;  2HE7 A;  2MBQ A;  3L0W B;  1V49 A;  2O6V D;  5DPS A;  2KLC A;  3ZKJ C;  4FBJ B; 
#chains in the Genus database with same CATH topology
 1H4R A;  1FXA A;  2IGD A;  3Q8B A;  4JWU C;  3HVD A;  5JHB A;  4AQ7 A;  4XZ4 A;  4O1N A;  1XXG A;  2JT4 B;  3E9S A;  5HFY A;  2D10 A;  3MTN B;  2ONQ A;  2KAN A;  3ZJV A;  1TBE A;  4PT5 A;  5IO9 A;  1UH6 A;  1STE A;  2DYM A;  2XK5 A;  1R4M I;  2LWP A;  3RUL A;  2E6X A;  2J0K A;  2D5G A;  1QIL A;  3QHT A;  1YD8 U;  3EGR A;  3ZTC A;  1NI3 A;  1GB4 A;  3Q3O C;  2JWU A;  3NY5 A;  3WAP A;  5L83 A;  1I4R A;  4DHJ B;  4MSQ B;  2CJO A;  2L7R A;  2KDF B;  1HEZ E;  4P1B C;  1NEK B;  3A9K A;  3ZJU A;  4DK5 A;  3V6C B;  4LLG M;  5G55 A;  2N7E A;  4HK2 A;  2LGX A;  3ZIM A;  1NYR A;  2KOX A;  5T8I A;  3B1L X;  2C7H A;  1F0Z A;  3R66 C;  1EO6 A;  1C76 A;  4NAW B;  1Y8R C;  2WXH A;  5I4D A;  4C7Z A;  2PVO D;  3Q8C A;  2V0G A;  1WX7 A;  1T5X D;  2MBB B;  1KF6 B;  3IG3 A;  1WGK A;  3CF6 E;  2LEK A;  2KMM A;  4WWO A;  3OWE B;  1L4Z B;  1JAL A;  2BWF A;  3PRE A;  2NBW B;  1K52 A;  2ICI A;  2GBJ A;  3DQV A;  2JXT A;  2Q5W D;  1SBB B;  4WAA A;  2KYW A;  1CJE A;  3KUD B;  3ZRC A;  2R61 A;  2M17 A;  4WWN A;  1WE7 A;  3TJP A;  4A20 A;  3B0A A;  4XDD A;  3ZDT A;  1P7E A;  2J53 A;  3PV1 A;  1KM7 A;  1MG4 A;  1Q0W B;  2KD0 A;  3DHI C;  1PYW D;  3AV8 A;  2WDT B;  3A33 B;  1MHH E;  2BT6 A;  3NZS A;  3M3J A;  1GUA B;  4JWS C;  1KLV A;  1MFW A;  3UIN B;  2GBM A;  1WFY A;  2ZJD A;  1Q1O A;  4URK A;  5HKH A;  4RMA A;  4OW0 A;  1WM3 A;  1ACC A;  4ZYS A;  2J0M A;  4PK1 A;  4GSW A;  1N63 A;  3ZDM C;  2V3S A;  1E7U A;  2K5P A;  1KLG D;  3CST A;  2WGS A;  1XLO A;  2WP9 B;  2JY6 A;  3VDZ A;  3D32 A;  1RRB A;  4G50 A;  3APF A;  5DPR A;  1BUI C;  2A5U A;  2BS3 B;  3DDC B;  4DHZ B;  3Q3N C;  3EFU A;  4MAC A;  5C2T B;  2N1W A;  1FNW A;  3W9C B;  1V1P A;  3JVZ X;  2OJR A;  2JZZ A;  3HHM A;  2KN5 A;  4OVU A;  1TYG B;  1TT5 B;  3IXS A;  2NBU A;  4HPP A;  1WGR A;  2LUE A;  1M4V A;  1QZE A;  4D2K A;  5G5H A;  3TSS A;  1Q10 A;  1JCK B;  1SJE D;  1FFU A;  5H92 C;  2K22 A;  4S17 A;  2K9X A;  2KWV B;  1OQR A;  1SGH A;  2N7D A;  1JML A;  2Y5C A;  2ZCB A;  4M00 A;  3KLS X;  2GB1 A;  4GIV A;  4IDI A;  5GMV A;  3T3N A;  4USA A;  2N9K A;  3KYC D;  4HEA 1;  3SFD B;  3MJW A;  4MSM B;  3LDZ E;  2R2Q A;  3B2F A;  2ACZ B;  1IGD A;  1KH0 A;  2EEL A;  2JUO A;  2W3R A;  2ZNV B;  1JWB D;  1HQR D;  2XNA C;  3OJ4 B;  1OQY A;  1VJK A;  3BVM A;  2INP E;  4XWT A;  4M0W B;  2C5L C;  1FCL A;  2ZPN A;  1UBQ A;  1GC7 A;  1F9J A;  2LJI A;  1NVI D;  4E3C A;  4IWQ A;  4WQO B;  4DDI D;  4I6L B;  3VTV A;  3NJT A;  2PMV A;  4WH4 A;  1C1Y B;  2WX1 A;  1E8Y A;  3VH4 B;  5JH5 C;  1C4C A;  2AQ1 B;  3GP7 A;  3V05 A;  3BY4 B;  3M95 A;  3MJ5 A;  2KZR A;  5BMI A;  2BYT A;  1J7C A;  2WHI A;  4ARI A;  4CO7 A;  1LFD A;  3GOE A;  2AL6 A;  4N58 A;  1RAX A;  2KTF A;  5J2R A;  2WDR B;  3NHE B;  1EU3 A;  2K25 A;  3Q3J A;  1S1Q B;  2JRH A;  2ZCC A;  1B1Z A;  4ANX A;  1FFV A;  2JYT A;  3QCA A;  2O6V B;  2KX3 A;  1P1A A;  2DBY A;  2MP2 B;  1V80 A;  2UYZ B;  5JHA A;  1XO3 A;  1WH3 A;  2O2V B;  2RDB C;  5CX3 A;  4G3X B;  3DHH C;  4BBN C;  2W3S A;  4WWM A;  3H1U A;  4GU2 A;  1V5T A;  2DZI A;  4HRS A;  1V2Y A;  5CHW A;  2M0X A;  2N9P C;  2L32 A;  3MHZ A;  4NQK E;  1QF6 A;  4ZHP A;  5TSS A;  1WYG A;  4ZRJ A;  3ZRF A;  1JWS D;  2HJ8 A;  2K6D B;  3Q8A A;  5C1Z A;  1TKY A;  3BWU D;  2DZK A;  1J7B A;  3AE5 B;  2X38 A;  2GBN A;  4XWW A;  5BO4 B;  3UQA A;  1HTO A;  2YVC A;  4HLE A;  3AED B;  3PLV A;  2LGS A;  2W54 A;  1DOX A;  4EEW A;  1OQQ A;  3APC A;  1CZP A;  2WQY B;  3HVZ A;  2XK5 B;  4MGI E;  4BKS D;  3OLM D;  3HM3 A;  3EEC A;  2INN E;  3LYY A;  3UIO B;  1HA5 A;  2IYD B;  1DGJ A;  2KWC A;  2MX2 A;  3VH3 B;  3E56 A;  5EE3 A;  4FJY A;  2KDE B;  4WJN A;  1AYF A;  3LXF A;  3KVF B;  4ICV A;  4HDQ A;  4EZK A;  1V8C A;  4MEL A;  1KRH A;  1UWM A;  4FJZ A;  2HTH A;  1TZ1 A;  3QA8 A;  2RGF A;  4WJQ A;  4A90 A;  1JW9 D;  3VFK A;  1IP9 A;  2L76 A;  3DBS A;  1ZKH A;  2O6V D;  5DPS A;  2KLC A;  1XCT L;  2JZP A;  4OHJ A;  1EUV B;  1SIF A;  1DYQ A;  1L4D B;  4KDL B;  2JXX A;  3SR6 A;  4AOF A;  1VRA B;  1E7P B;  2J42 A;  4RGN A;  3I9V 1;  5C23 A;  3V61 A;  3L17 A;  1UGJ A;  1CMX B;  2ON8 A;  1T6B X;  4FHJ A;  2ZNV C;  3H7S A;  2WDV B;  1I4Q A;  4YT0 B;  4MGZ E;  2FNJ B;  3R3M A;  3FKY A;  1AAR A;  4NZL B;  3SFE B;  1YQB A;  4IM2 A;  4M01 A;  1NI2 A;  4C4V A;  1N5W A;  2QC8 A;  3UGB B;  4YSY B;  2PLP A;  1YNT E;  1WWT A;  2PJH A;  1Q5W B;  4EZJ A;  1KLU D;  2K1F A;  4A55 A;  4B9K A;  1D6E C;  2V9H A;  4Q2J A;  4RNA A;  2IO0 B;  1N5X A;  1L0Y B;  2PE9 A;  3RNG C;  1NBF C;  1XLN A;  2DZM A;  2IGH A;  1E10 A;  1GG3 A;  2L52 A;  3PO0 A;  3ZGZ A;  5DCN A;  2WXO A;  4RH6 A;  4MJS B;  3RD2 A;  2AQ2 B;  2BKF A;  2WXM A;  1F2R C;  2I2Y A;  1WM2 A;  3PT2 B;  2Y5B B;  4HCP B;  1GOZ A;  2DLB A;  1E7V A;  1R4N B;  2O6V A;  1YQ3 B;  2KC2 A;  2WXK A;  2JWZ A;  3AB5 A;  5L95 C;  3I57 A;  2BPS A;  3O65 B;  3BK1 A;  2FCN A;  2O2V A;  4FXC A;  1WIA A;  3NUH B;  1G6J A;  4JPS A;  2VH2 A;  2OHF A;  2QEJ C;  2N9X A;  4G11 A;  3RNC C;  3RCZ A;  3R7Q A;  2MWS B;  3N1Y C;  1SXT A;  1V86 A;  1V1P B;  3NVY A;  3ZNZ B;  4G0N B;  2WXI A;  4HVB A;  2DYO A;  4W9C A;  1HE8 A;  1ESF A;  3MFG A;  3A4R A;  3RI7 C;  1SSN A;  2LHE A;  1WRI A;  2YEP F;  5HG2 A;  1ZUD 2;  2RPQ A;  2KDB A;  3QC8 B;  3ZYY X;  3P4Q B;  1WXQ A;  5HI1 A;  1VR9 A;  4RFB A;  2QHO A;  1QQR A;  1WMH B;  5CTR C;  1JWM D;  3JYU A;  4EKU A;  4BKG A;  4GLS C;  3RN9 C;  4OVZ A;  2B3A A;  2MBH A;  5D94 A;  4ASW C;  3U2S C;  2V1Y A;  1E8W A;  1L6V A;  4ZHO A;  1V81 A;  1PFD A;  2M19 A;  2FUG 1;  1FRR A;  1ZDX A;  4DWF A;  4XDC A;  4RM8 A;  3AE4 B;  3C19 A;  3PSE B;  2K39 A;  1LO5 D;  4N59 A;  2BB5 A;  2YLM A;  2RMM A;  3EA6 A;  3H8H A;  4DXG A;  2AYO B;  3DBH B;  1FO4 A;  2KDI A;  5MPO A;  2D3C A;  2CU1 A;  5IN7 A;  3L54 A;  3WIM A;  2KFK A;  4KKJ A;  1ET9 A;  4TSS A;  3AE9 B;  3QAR A;  3KWL A;  4LCD E;  3FC4 A;  1WRD B;  4DQO C;  1FNU A;  5LLI A;  4MM3 A;  4ZDV A;  1ZW7 A;  1Z2M A;  5LNK 1;  2WXN A;  4AWJ A;  3J9C A;  2MRP A;  4IWP A;  4OZB A;  1GNU A;  3V3X A;  2MQJ A;  2L1A A;  3IHP C;  4HJK A;  3S2A A;  1XT9 B;  4J3O D;  3RZF A;  5IKC M;  3DHG C;  4F8C B;  4M8N A;  1FRD A;  2G3Q B;  3NVV A;  2Z0D B;  1IUE A;  3R2T A;  2IND C;  1F52 A;  1K51 A;  3K9P B;  1HTQ A;  1F77 A;  2CHX A;  5IAA C;  3P4P B;  5EE0 A;  1FXI A;  3RZW C;  2WDQ B;  3Q6B A;  2V4L A;  1TS4 A;  2MJD A;  3HM6 X;  4EZL A;  2KWU B;  1EWC A;  1XLP A;  4PYU A;  3AN1 A;  3A9J B;  3P42 A;  4RM9 A;  4K7S A;  3RNE C;  4IOI E;  5IP4 D;  3KUZ A;  1AWD A;  2AX5 A;  2WXQ A;  3NZ3 A;  3ZLZ A;  4H2A A;  2CKH B;  4MJS A;  5IA7 A;  4WWP A;  2WWZ A;  4KGT A;  3AH7 A;  2J7Q B;  3VR8 B;  4YL8 A;  1ZGU B;  3NZU A;  3VAW A;  1TGZ B;  2I38 A;  1DOI A;  1TJE A;  5KHQ A;  2BBC A;  2L0F A;  4OZA A;  2M8S A;  4CYE A;  3TCA A;  1WGY A;  4DHJ D;  2BYE A;  4WQM A;  3RNA C;  1GC6 A;  1KTK A;  4JIO U;  1PGX A;  3SDL C;  1NEN B;  4HCN B;  3VUY A;  3DBR I;  1OEY J;  1R4N I;  4HWI B;  1MG8 A;  2EKI A;  1LQB A;  3OG5 A;  2KQS A;  3AU4 A;  1N62 A;  3JSV B;  1D5X C;  2BF8 B;  2KTR A;  4PS8 A;  4DHZ E;  3W1S A;  2FCM A;  1ISN A;  1PUT A;  2M56 B;  3W1S C;  1R7S A;  1LM8 B;  4ANW A;  2IDY A;  3MHS D;  4JX1 C;  3SHQ A;  2WU2 B;  2BB6 A;  1WZ0 A;  4KZC A;  3OAW A;  4LNN A;  1I42 A;  3VUX A;  2KK8 A;  3AE1 B;  3QJZ A;  1WGG A;  3GE3 C;  1PGA A;  4ACF A;  4KIK A;  3VRA B;  2JPH A;  1YN4 A;  4P1C C;  3EC8 A;  2RDH A;  3ML9 A;  4J6I A;  3VR9 B;  4BKT A;  2GI9 A;  1WMH A;  3KQ4 A;  4A3P A;  3ZNH B;  4CQN A;  4M02 A;  3ZNI D;  4TV3 A;  4BFR A;  1AN8 A;  1TIF A;  1IBX B;  2LAS A;  3H6N A;  1VLB A;  1L6U A;  1UGM A;  3R8B A;  4LJP B;  5J17 A;  3RFZ B;  3T3O A;  2X8X X;  3DWG C;  2Y3A A;  4AS1 A;  3ECI A;  3GZN B;  2N0S B;  1I4H A;  2JX5 A;  1NYQ A;  4C4V B;  5TR5 A;  5D3D A;  2KAC A;  1WJ6 A;  2MLB A;  1YX6 B;  4KX6 B;  1WX8 A;  5GXG B;  3TIX A;  2KJR A;  2IJ0 A;  4K1R B;  2KMC A;  3DPD A;  3EFC A;  3P63 A;  2WXR A;  2NR2 A;  3DBH I;  3IAM 1;  2IZV B;  4XYC A;  4XX5 A;  3VTU A;  2FIF A;  3AEA B;  3PS6 A;  2NMQ A;  1ZDV A;  2C9W B;  3RT3 B;  3Q3M C;  4B6W A;  2LI5 A;  2W9N A;  4EUT A;  2FBW B;  1V1O A;  4LTU A;  3CMM B;  2G4S A;  2AQ3 B;  3AXC A;  1YJ1 A;  4C00 A;  2D07 B;  1UWX A;  1P3Q U;  2LD9 A;  4W9E A;  2VZK B;  2C7M B;  3WAO A;  2NPT B;  4I6N B;  3V6E B;  4B0M A;  1RFA A;  2XEW A;  2H88 B;  4RGT A;  1MI0 A;  2GOW A;  3T8M A;  4YWG G;  3TL5 A;  3A9J A;  3VHT C;  4B95 A;  2W82 A;  3N1Z C;  2D11 A;  3K9O B;  1T3Q A;  1SE4 A;  2E3T A;  2FCQ A;  3QWZ B;  3AE7 B;  1V5O A;  1F1H A;  1XF5 L;  3H7P A;  2OOB B;  1D5Z C;  4RGO S;  4IM0 A;  4HRO A;  5KHO A;  2FUH B;  1HZ6 A;  2N4F A;  3T9L A;  1YQ4 B;  3GE8 C;  5AZF A;  2C7N B;  1S3S G;  5EDS A;  3DVG X;  3ZTD A;  3VXW A;  2N1V A;  3Q8E A;  2A4Z A;  4UDU C;  1XEE A;  1WJU A;  3ML8 A;  3WAM A;  2K8H A;  4FUL A;  1R4M B;  4KGS A;  2KQ7 A;  1E8Z A;  1UNS A;  3L16 A;  3O13 A;  2BVC A;  1E9M A;  1UBI A;  3X23 A;  1CQV A;  5CHF A;  2PVG C;  5E6N A;  3RPF C;  3JSV A;  3SD5 A;  1WR1 A;  1WSP A;  3VUW A;  3C0R B;  4II3 B;  3I63 C;  3L4P A;  2INC C;  4ANV A;  3N32 A;  2EMT A;  3BVZ A;  2NCN A;  5J18 A;  3IBE A;  5DPW A;  1VZ6 A;  4S0R A;  2WNM A;  2WU5 B;  4E74 A;  3NVW A;  2MBO A;  1EM7 A;  1E0Z A;  3ZJT A;  1Z5S B;  1I4X A;  3AEG B;  2KN4 A;  1ZE3 D;  2G4D B;  2KFK B;  4N6E B;  4GOC A;  2BS4 B;  1MHX A;  3AE2 B;  2TSS A;  3TEZ A;  5EE9 A;  1ZPS A;  1J0G A;  1RYJ A;  4K3C A;  2PIA A;  1UZX B;  1UEL A;  5FR3 A;  2JRI B;  4XGA B;  3V62 A;  1P9D U;  3RUI B;  1IBX A;  2LVP A;  2CU3 A;  2VZK D;  3AUL A;  4MM3 B;  3HIZ A;  1RFK A;  2IO2 B;  1ENF A;  2FE8 A;  1VZ8 A;  4W9I A;  2BGF A;  4W9J A;  2VRR B;  4ZRK A;  4KGR A;  2D2Q A;  5HHD G;  4B0E A;  1IYF A;  3URY A;  1EU4 A;  1FEH A;  3TBL D;  3L08 A;  4GDL A;  2LJ5 A;  1I4P A;  2DZJ A;  3TMP B;  2LUM A;  3TEW A;  1YIW A;  2GMI C;  4HKZ E;  1XQQ A;  3VTW A;  4MGY E;  1C3T A;  3VQI A;  3AU5 A;  4WJP A;  3WCQ A;  2NVU I;  1MVK A;  3L13 A;  3FIL B;  1WJN A;  4FJV B;  4IUM B;  1N6Z A;  1SIJ A;  3W5V B;  1K50 A;  4DXF A;  4CHK A;  4HXD A;  4BOS C;  4L2Y A;  2PW9 A;  1TY0 A;  4GN1 A;  4LNF A;  1QKZ A;  3ZQ4 A;  5E6O A;  3RNB C;  3U52 E;  1M94 A;  2LRW A;  3M62 B;  1F2R I;  1FXT B;  2UU7 A;  1MPE A;  1L2N A;  2JVC A;  2H89 B;  2NPT A;  4KV2 A;  4C80 A;  2K8B A;  3QIJ A;  2M4N A;  4LK0 M;  1XLQ A;  3Q8F A;  1WI0 A;  2DYB A;  4HPM B;  3WAN A;  1FPY A;  1YX5 B;  1E6E B;  1SE2 A;  2KTR B;  3ABV B;  2KAJ A;  3BII D;  2ZEQ A;  2KX0 A;  1HXY D;  3PGE A;  5H8Y E;  2GBR A;  1GAQ B;  3BZD B;  3DWM A;  1V9J A;  3UI3 A;  2G1E A;  2K8C A;  4NJ7 A;  3JW0 X;  2WXF A;  1WXV A;  5IOI A;  4NY0 A;  4ITK A;  4GDK A;  2I1J A;  1T0Y A;  2NBV B;  1L0V B;  2WXJ A;  3DVN U;  4KIK B;  3Q14 C;  3N1X C;  2CHW A;  1D3Z A;  3PVL A;  1FMA D;  2N7J A;  5E6J A;  1YOV B;  5AUK A;  2KLG A;  1L0X B;  2KC1 A;  3NOB A;  2DEN B;  2L00 B;  2PE6 B;  3B9J A;  3PRM B;  3ZNG C;  1E90 A;  2J52 A;  1H8C A;  4WJO A;  2N9E B;  4LDT B;  2BYF A;  2GBK A;  2QSD A;  4DBG A;  4NJC A;  3NRZ A;  1D4B A;  2JQR B;  1ROE A;  3ZXR A;  2LHD A;  4WUR A;  1WZ3 A;  4DXA B;  4W9K A;  4P16 A;  1YN3 A;  2JZ3 B;  1HZ5 A;  1XD3 B;  1JRP A;  4I6P A;  2KWD A;  3PZ7 A;  4JQW C;  1YJI A;  2CR5 A;  3KUC B;  4NAM A;  3W1Y A;  2IPK D;  3ZO5 B;  3QK0 A;  4NQL B;  2BS2 B;  1A5R A;  4NPN A;  1P7F A;  3A1Q B;  2ZPY A;  3NG0 A;  1DOY A;  3QX1 A;  2LRU A;  4MH8 A;  3U8Z A;  4BZA A;  4ICU A;  1P98 A;  2PKO A;  2GRI A;  1ZXI A;  3W5U B;  3UF8 A;  4MGK E;  4YSX B;  4PS7 A;  2AWT A;  3NS1 A;  3WAL A;  4P6V F;  5G5G A;  2I1K A;  2CS4 A;  1TY2 A;  2HJ1 A;  4HDO A;  4NJ6 A;  3DVG Y;  2DAF A;  5BMH A;  1VCB A;  1PGB A;  3MC8 A;  5AEK B;  3CWI A;  1EF1 A;  1SE9 A;  1QT9 A;  1FCC C;  3AEE B;  1UD7 A;  1I35 A;  4RF0 A;  1A70 A;  2OED A;  4W9L A;  2QCZ A;  2KJ6 A;  2OJW A;  4C7Y A;  2CHZ A;  2LZ6 A;  4LJO B;  4XC2 A;  3CSF A;  4US8 A;  4RF1 A;  1CK1 A;  4HJG E;  2IO1 B;  4EE2 A;  2KKC A;  1QOG A;  4MDK E;  1KOT A;  2NS5 A;  1XCQ L;  1YMH E;  4JLC A;  2J0J A;  1J19 A;  1UUP A;  2LXA A;  3TEX A;  1BT0 A;  3N9Y C;  4AP4 C;  4BOZ B;  3V60 A;  2N9L A;  2BW2 A;  3N3K B;  1WY8 A;  4L1B A;  4WAF A;  3FIL A;  3B08 A;  2KVR A;  4LDT D;  1RLF A;  2KO3 A;  3H7P B;  2WYQ A;  3AI5 A;  2HD5 B;  4K3B A;  5D2M B;  2HE7 A;  4FBJ B;  2C60 A;  3R2I A;  3I5J C;  4K81 A;  2WLB A;  3RYT A;  5BYQ A;  4MEM A;  1T0Q C;  4BVU C;  4BBN F;  4IW0 A;  4IM3 A;  1KJT A;  2ZZP B;  1IPG A;  2FCS A;  1YJJ A;  2G45 B;  1JWU D;  2HDE A;  1FNV A;  3RMK C;  3TUO A;  4YTM B;  4R3D A;  3PTF C;  1GPX A;  3ENE A;  1OEY A;  4TUU A;  5LXH A;  2PTL A;  3BYY B;  2DX5 B;  3MC9 A;  3VRB B;  2MCN B;  2SEB D;  4IG7 B;  2DHZ A;  3KYD D;  1WYW B;  2PPH A;  2AL3 A;  4KSK C;  3IT6 B;  4LNI A;  5JZE B;  3TEY A;  2L83 A;  4A3O A;  2W55 A;  4KZ0 A;  1ET6 A;  3GS2 A;  3PZ8 A;  1WF9 A;  2QMT A;  1IGC A;  2K3U A;  2VH1 A;  3HRD D;  2ZVO A;  4TQ1 A;  1TS2 A;  3LJ3 A;  3QAQ A;  4RGM A;  1K8R B;  3H9D A;  1JRU A;  4W9G A;  1WX9 A;  4TKN A;  3U30 A;  2MBE A;  3MC0 B;  4ANU A;  2GLS A;  1WGH A;  3AM9 A;  1N61 A;  2FID A;  2V3P A;  4RCO A;  3PLU A;  2B76 B;  5FKA C;  4ZRI A;  2AEH A;  2Z8L A;  2V3N A;  3A1Q A;  2QIE B;  4MT5 A;  2LVQ A;  4W9H A;  3FAH A;  4AJW A;  4TQ0 A;  1V97 A;  5BYR A;  2M0A A;  2IY1 B;  3HUI A;  2LMC A;  4REZ A;  2WXP A;  4GDL B;  4LNK A;  4KSL C;  3MP9 A;  1ZOY B;  3P1M A;  4IKG A;  2KXJ A;  4AUQ C;  1U4A A;  1YN5 A;  4FHK A;  3U4E G;  2RDG A;  3DCG A;  3KWV A;  1KFY B;  2EMS A;  3HK0 A;  5CHV C;  3PRZ A;  1VZ7 A;  3M63 B;  4AJY B;  2MSE D;  2D3B A;  2ZVN A;  3OJ3 A;  3LB8 C;  3PHX B;  4NAW A;  4NNJ B;  1WGD A;  3NS8 A;  1L7Y A;  2XBB C;  3AE6 B;  1WE6 A;  1QOF A;  2KHW B;  2QIL A;  4ZRP A;  3BK2 A;  1E5W A;  2REX A;  2JYE A;  1K53 A;  1TS5 A;  1C4P A;  4QAY A;  5G2N A;  2L3Z A;  2MH7 A;  2KVZ A;  2RPV A;  4GXB A;  2NTS A;  1MJD A;  2MA9 B;  3L10 B;  3BYT B;  3BIN A;  1AW7 A;  4FN2 A;  3ALB A;  1WXA A;  3PZD A;  1JWA D;  2SAK A;  2WXL A;  2MJ3 A;  4IWO A;  1TTN A;  2LFI A;  2QDF A;  4YXD B;  1FD6 A;  1FIQ A;  4YTP B;  3DBL B;  4KKI A;  3AE3 B;  4A8X C;  5D6J B;  3IVF A;  3Q2A C;  2BWE S;  2Y5P A;  4BAX A;  2KJH B;  1BXT A;  2KT7 A;  3EUB 2;  4GDK B;  4XE0 A;  4EFO A;  3VVW B;  1J7A A;  1QOB A;  3AMZ A;  4X57 B;  1PQS A;  2FAZ A;  3APD A;  2LGY A;  3AEC B;  4MH0 E;  1ZXH A;  4W9F A;  5AZG A;  4DDG D;  1V6E A;  2JF5 A;  1TKG A;  3R7R A;  2MW5 A;  4GGQ A;  2JSV X;  2LGD A;  3AE8 B;  4C56 C;  4W9D A;  2JU6 X;  3P4S B;  2KMA A;  1WR6 E;  3PHW B;  2DAJ A;  2KDM A;  4YSZ B;  3UQB A;  3DOW A;  2LVO A;  2K0P A;  1FM0 D;  2M1M A;  4JL9 A;  5FK9 C;  4KVG B;  3IAS 1;  2G9H D;  2DWQ A;  4GMV A;  3ETR A;  3U7D A;  1VD2 A;  3DVN V;  4II2 B;  1RM6 C;  5EE1 A;  3PPA A;  1EWY C;  3ZW3 A;  2R2O A;  3AEF B;  4L23 A;  3A9K B;  5C3J B;  1BML C;  4ZRQ A;  1OGW A;  2MHJ A;  2WXG A;  2D3G A;  1TS3 A;  1TKE A;  2DNF A;  4OVV A;  1WXS A;  3SEB A;  4ZOH C;  4FLH A;  4HPL B;  1JRO A;  2ASQ A;  3U7Z A;  1N60 A;  4N9F 4;  3AEB B;  4FA6 A;  4K7U A;  2RSU A;  1RWS A;  3C8Y A;  1UF0 A;  4P7I A;  4ZYN A;  1C4A A;  1LXD A;  2J4X A;  2BQQ A;  3ZUN A;  1X1M A;  2RD0 A;  3ZXV A;  4PYZ A;  3ONS A;  1C78 A;  2IO3 B;  3GB1 A;  2EKE C;  1GJZ A;  2KQ4 X;  3P2B A;  3GZN I;  2D3A A;  4M0W A;  2LXC A;  3IT4 B;  4F1S A;  3SU8 X;  3X0W A;  1P0R A;  1C9F A;  4HKQ A;  4A9A A;  1LGR A;  4JE3 B;  4BKS A;  5FR6 A;  3B2G A;  5BMG A;  4A6Q A;  3ZVV A;  2IGG A;  5E6P A;  3QQ8 B;  4K7W A;  2IY0 B;  1E8X A;  2BYV E;  2V4I B;  3N20 C;  2PEA A;  4GB9 A;  3A4S C;  2L0T A;  1J8C A;  4LNO A;  3CIR B;  4US9 A;  4WIP A;  2L8J A;  2NTT A;  3Q3F A;  1SF0 A;  1SJH D;  3UIP B;  1PDX A;  1Y56 A;  5DPT A;  4M8M A;  1QOA A;  4KDI C;  1ZP0 B;  2MEK A;  1SB3 C;  1QLB B;  3KW5 B;  2XN9 C;  2Z0E B;  3NVZ A;  4F7Z A;  5AUI A;  3DBR B;  1NDD A;  3WA0 A;  4EOY A;  5BYS A;  2MJE A;  3W2D A;  2CJN A;  2BTE A;  4TMA B;  5AZH A;  1OTR B;  3RNF C;  2QJL A;  2ZW1 A;  2YEP B;  4E71 A;  2K6Q A;  1EF5 A;  2MP2 A;  5D3I B;  2KFJ A;  1L5P A;  2BKR B;  3EHV A;  1B9R A;  2RR9 A;  2IBI B;  1T0S C;  3IFW B;  2Z59 B;  4FAD A;  3I3T B;  2HTM E;  4YTN B;  4ARC A;  1C79 A;  1D5M C;  1JQ4 A;  2L05 A;  1I4G A;  1T0R C;  2WX0 A;  3BVG A;  2UWQ A;  1VDV A;  5JXV A;  1C77 A;  2KNB A;  1TZO A;  3DBL I;  1SE3 A;  1WXM A;  2WS3 B;  4IC7 B;  1GB1 A;  1SEB D;  3P4R B;  5LXI B;  1WJ4 A;  3PRP B;  5D7G A;  3KH0 A;  1I7H A;  4PS3 A;  3N30 A;  2LGI A;  2ZW0 A;  2MBQ A;  1OFF A;  1V49 A;  4JGH B;  3Q69 A;  3L0W B;  4OZC A;  3ZKJ C; 
#chains in the Genus database with same CATH homology
 1H4R A;  2C9W B;  3RT3 B;  1EUV B;  1SIF A;  2C60 A;  5JHB A;  4KDL B;  4K81 A;  4XZ4 A;  3RYT A;  4B6W A;  2LI5 A;  2JT4 B;  2JXX A;  2W9N A;  2D10 A;  4EUT A;  3MTN B;  4MEM A;  4BVU C;  4AOF A;  4BBN F;  2KAN A;  3CMM B;  1TBE A;  5C23 A;  4IW0 A;  3V61 A;  4IM3 A;  1KJT A;  3L17 A;  1UH6 A;  2G4S A;  2ZZP B;  1CMX B;  2DYM A;  2XK5 A;  1R4M I;  1IPG A;  2FCS A;  2LWP A;  2ZNV C;  4FHJ A;  3H7S A;  3RUL A;  2G45 B;  3AXC A;  2J0K A;  1YJ1 A;  3PTF C;  2D07 B;  3QHT A;  1P3Q U;  1YD8 U;  3ENE A;  1OEY A;  4TUU A;  5LXH A;  3ZTC A;  2LD9 A;  4MGZ E;  4W9E A;  2C7M B;  3WAO A;  2NPT B;  4I6N B;  2FNJ B;  3V6E B;  3R3M A;  3NY5 A;  1AAR A;  1RFA A;  2DX5 B;  2XEW A;  3WAP A;  5L83 A;  1YQB A;  4IM2 A;  2GOW A;  3T8M A;  4DHJ B;  1NI2 A;  3A9J A;  4MSQ B;  3TL5 A;  2MCN B;  4IG7 B;  2L7R A;  3VHT C;  3UGB B;  2DHZ A;  4B95 A;  2KDF B;  3KYD D;  1WYW B;  2PJH A;  1Q5W B;  2PPH A;  2D11 A;  4EZJ A;  2AL3 A;  3K9O B;  2K1F A;  4KSK C;  3A9K A;  2FCQ A;  4DK5 A;  3V6C B;  4B9K A;  3QWZ B;  5JZE B;  1V5O A;  2IO0 B;  5G55 A;  4A3O A;  4KZ0 A;  2N7E A;  2PE9 A;  4HK2 A;  1NBF C;  2LGX A;  3ZIM A;  3H7P A;  2KOX A;  1WF9 A;  2DZM A;  2OOB B;  3B1L X;  1GG3 A;  2ZVO A;  4IM0 A;  5KHO A;  2C7H A;  5DCN A;  2FUH B;  4TQ1 A;  3R66 C;  1EO6 A;  2N4F A;  3LJ3 A;  3QAQ A;  1K8R B;  3T9L A;  4MJS B;  3H9D A;  4NAW B;  1Y8R C;  1JRU A;  3RD2 A;  4W9G A;  1WX9 A;  2BKF A;  5AZF A;  2C7N B;  1S3S G;  5EDS A;  4TKN A;  1WM2 A;  3U30 A;  3DVG X;  2Y5B B;  3PT2 B;  3ZTD A;  3VXW A;  1WX7 A;  2N1V A;  4HCP B;  2A4Z A;  2MBE A;  2MBB B;  4ANU A;  1WGH A;  2FID A;  1WJU A;  3ML8 A;  3IG3 A;  1E7V A;  3WAM A;  2K8H A;  2O6V A;  4FUL A;  3PLU A;  2KQ7 A;  3CF6 E;  1E8Z A;  4ZRI A;  2AEH A;  3L16 A;  4WWO A;  2KC2 A;  2JWZ A;  1UBI A;  3X23 A;  5L95 C;  2BPS A;  3O65 B;  5CHF A;  2FCN A;  5E6N A;  2O2V A;  3A1Q A;  3JSV A;  2BWF A;  3PRE A;  3SD5 A;  2NBW B;  2LVQ A;  1WR1 A;  2GBJ A;  3DQV A;  4W9H A;  4AJW A;  3VUW A;  4WAA A;  3ZRC A;  3KUD B;  1WIA A;  4TQ0 A;  3C0R B;  4II3 B;  1G6J A;  2IY1 B;  2N9X A;  4ANV A;  3N32 A;  2EMT A;  2M17 A;  4G11 A;  4WWN A;  4GDL B;  3RCZ A;  1WE7 A;  3TJP A;  4KSL C;  3R7Q A;  2MWS B;  2NCN A;  4A20 A;  3B0A A;  5J18 A;  3IBE A;  3ZDT A;  5DPW A;  2KXJ A;  4AUQ C;  1U4A A;  1V86 A;  1KM7 A;  3PV1 A;  4E74 A;  2MBO A;  4FHK A;  3ZNZ B;  3DCG A;  4G0N B;  1Z5S B;  1Q0W B;  2KD0 A;  2EMS A;  4HVB A;  3HK0 A;  5CHV C;  2DYO A;  4W9C A;  1HE8 A;  3PRZ A;  3M63 B;  2G4D B;  2KFK B;  4AJY B;  3A4R A;  4GOC A;  2MSE D;  2WDT B;  3A33 B;  1J0G A;  2ZVN A;  3OJ3 A;  2RPQ A;  2KDB A;  1UZX B;  3M3J A;  1GUA B;  1UEL A;  3NZS A;  3PHX B;  3QC8 B;  4NAW A;  1KLV A;  4NNJ B;  1WGD A;  2JRI B;  3UIN B;  3V62 A;  2GBM A;  1WFY A;  3NS8 A;  1L7Y A;  1P9D U;  2QHO A;  2ZJD A;  3RUI B;  1Q1O A;  2XBB C;  2LVP A;  4URK A;  5HKH A;  4RMA A;  1WMH B;  1WE6 A;  3AUL A;  5CTR C;  1WM3 A;  2KHW B;  3JYU A;  4EKU A;  4BKG A;  4JGH B;  3HIZ A;  2J0M A;  1E5W A;  2IO2 B;  2REX A;  4GSW A;  2B3A A;  3ZDM C;  2V3S A;  2MBH A;  1E7U A;  4W9I A;  5D94 A;  4ASW C;  2BGF A;  2V1Y A;  4W9J A;  1E8W A;  5G2N A;  2L3Z A;  3CST A;  2VRR B;  1V81 A;  4ZRK A;  2D2Q A;  2JY6 A;  3VDZ A;  4GXB A;  1IYF A;  2MA9 B;  3D32 A;  3L10 B;  4DWF A;  1RRB A;  3BIN A;  4RM8 A;  4G50 A;  3APF A;  4FN2 A;  3TBL D;  5DPR A;  3ALB A;  3L08 A;  1WXA A;  3PZD A;  3PSE B;  2A5U A;  3DDC B;  4DHZ B;  2K39 A;  4GDL A;  2LJ5 A;  2DZJ A;  4IWO A;  1TTN A;  3TMP B;  3EFU A;  1YIW A;  2YLM A;  2GMI C;  1XQQ A;  2N1W A;  5D6J B;  2AYO B;  3IVF A;  3VTW A;  3JVZ X;  2BWE S;  2KDI A;  2OJR A;  2JZZ A;  3HHM A;  4MGY E;  3VQI A;  2CU1 A;  3AU5 A;  4WJP A;  2KJH B;  1C3T A;  2KN5 A;  3L54 A;  4OVU A;  3WIM A;  4GDK B;  4EFO A;  2KFK A;  2NBU A;  2NVU I;  1WGR A;  2LUE A;  3VVW B;  1QZE A;  3L13 A;  1WJN A;  4FJV B;  4IUM B;  4X57 B;  1PQS A;  2FAZ A;  3QAR A;  4CHK A;  3APD A;  4HXD A;  4LCD E;  2LGY A;  2KWV B;  1WRD B;  4BOS C;  4MH0 E;  1SGH A;  2N7D A;  2ZCB A;  4W9F A;  5AZG A;  4DDG D;  5LLI A;  4GN1 A;  1V6E A;  2JF5 A;  4GIV A;  3R7R A;  4MM3 A;  5E6O A;  1ZW7 A;  2MW5 A;  5GMV A;  4ZDV A;  1Z2M A;  1M94 A;  2LRW A;  4GGQ A;  3M62 B;  4AWJ A;  3KYC D;  2MRP A;  4IWP A;  1FXT B;  2LGD A;  3MJW A;  4MSM B;  1GNU A;  4W9D A;  3LDZ E;  2R2Q A;  2MQJ A;  3IHP C;  1L2N A;  2JVC A;  4HJK A;  3S2A A;  1XT9 B;  2KMA A;  1WR6 E;  2NPT A;  3PHW B;  4KV2 A;  3RZF A;  2DAJ A;  2JUO A;  2K8B A;  4F8C B;  3QIJ A;  3UQB A;  2ZNV B;  3DOW A;  2LVO A;  4M8N A;  2G3Q B;  2M4N A;  2M1M A;  3OJ4 B;  4JL9 A;  1WI0 A;  2Z0D B;  2DYB A;  4HPM B;  3K9P B;  3WAN A;  1OQY A;  1YX5 B;  2CHX A;  4KVG B;  5IAA C;  2KTR B;  4M0W B;  3RZW C;  2C5L C;  2V4L A;  2ZEQ A;  2KX0 A;  3HM6 X;  3PGE A;  4EZL A;  2ZPN A;  2KWU B;  1UBQ A;  1GC7 A;  4GMV A;  1F9J A;  2GBR A;  3U7D A;  1V9J A;  1VD2 A;  4PYU A;  3DVN V;  4IWQ A;  4E3C A;  3A9J B;  4II2 B;  4WQO B;  4DDI D;  4RM9 A;  3PPA A;  4K7S A;  2K8C A;  3ZW3 A;  4NJ7 A;  2R2O A;  3JW0 X;  4I6L B;  3KUZ A;  3VTV A;  1WXV A;  4NY0 A;  3A9K B;  2I1J A;  1T0Y A;  4GDK A;  1C1Y B;  3ZLZ A;  2CKH B;  1OGW A;  2NBV B;  4MJS A;  3DVN U;  4KIK B;  2WX1 A;  1E8Y A;  5IA7 A;  4WWP A;  2WWZ A;  3VH4 B;  2J7Q B;  2D3G A;  4YL8 A;  2CHW A;  5JH5 C;  1D3Z A;  3PVL A;  1ZGU B;  3NZU A;  3VAW A;  1TGZ B;  4OVV A;  1WXS A;  2KLG A;  3BY4 B;  2KC1 A;  3M95 A;  4FLH A;  3NOB A;  2DEN B;  4HPL B;  2L00 B;  2KZR A;  2PE6 B;  5KHQ A;  2ASQ A;  2L0F A;  3PRM B;  3ZNG C;  2M8S A;  4CYE A;  4CO7 A;  1E90 A;  1LFD A;  3TCA A;  3GOE A;  1H8C A;  2AL6 A;  2N9E B;  1WGY A;  4WJO A;  4DHJ D;  4LDT B;  1RAX A;  2BYF A;  2BYE A;  4N9F 4;  2KTF A;  5J2R A;  2GBK A;  4DBG A;  4FA6 A;  1GC6 A;  4K7U A;  3NHE B;  2RSU A;  2K25 A;  3Q3J A;  4JIO U;  1WZ3 A;  1S1Q B;  2JRH A;  2ZCC A;  3SDL C;  4W9K A;  4DXA B;  4HCN B;  2JZ3 B;  3VUY A;  4ANX A;  4P7I A;  4ZYN A;  3DBR I;  1LXD A;  1XD3 B;  4I6P A;  3ZUN A;  1X1M A;  3QCA A;  1OEY J;  2O6V B;  4JQW C;  2RD0 A;  1R4N I;  2KX3 A;  2CR5 A;  3KUC B;  1P1A A;  3ONS A;  1MG8 A;  4HWI B;  4PYZ A;  3W1Y A;  3ZO5 B;  3QK0 A;  2MP2 B;  1V80 A;  2IO3 B;  4NQL B;  1LQB A;  2EKE C;  2UYZ B;  5JHA A;  1A5R A;  4NPN A;  1GJZ A;  2KQS A;  3AU4 A;  1WH3 A;  2O2V B;  3P2B A;  3A1Q B;  3GZN I;  3JSV B;  2BF8 B;  5CX3 A;  2ZPY A;  2KTR A;  4PS8 A;  3QX1 A;  2LXC A;  2LRU A;  4F1S A;  3SU8 X;  3X0W A;  1P0R A;  4G3X B;  3U8Z A;  4DHZ E;  3W1S A;  2FCM A;  1ISN A;  1P98 A;  4ICU A;  3W1S C;  1LM8 B;  4ANW A;  3UF8 A;  3MHS D;  4MGK E;  4BBN C;  3SHQ A;  4PS7 A;  4BKS A;  2AWT A;  5FR6 A;  4KZC A;  1WZ0 A;  3WAL A;  3H1U A;  3OAW A;  1V5T A;  4GU2 A;  2DZI A;  2I1K A;  5E6P A;  3ZVV A;  2CS4 A;  1I42 A;  3VUX A;  2KK8 A;  3QJZ A;  3QQ8 B;  1WGG A;  1V2Y A;  5CHW A;  2M0X A;  4HDO A;  4K7W A;  2N9P C;  4NJ6 A;  2IY0 B;  1E8X A;  4NQK E;  2BYV E;  4GB9 A;  4KIK A;  2PEA A;  2JPH A;  3DVG Y;  2DAF A;  3A4S C;  3EC8 A;  4ZRJ A;  2L0T A;  1VCB A;  2HJ8 A;  3ZRF A;  1J8C A;  3ML9 A;  2K6D B;  5C1Z A;  4J6I A;  4BKT A;  2L8J A;  5AEK B;  3Q3F A;  1EF1 A;  1WMH A;  2DZK A;  3UIP B;  1SE9 A;  4A3P A;  3ZNH B;  2GBN A;  1I35 A;  5DPT A;  1UD7 A;  4M8M A;  3ZNI D;  4KDI C;  5BO4 B;  4TV3 A;  4W9L A;  2YVC A;  4HLE A;  4BFR A;  3UQA A;  3PLV A;  2KJ6 A;  3KW5 B;  4EEW A;  2Z0E B;  3APC A;  2CHZ A;  2LZ6 A;  4LJO B;  2LAS A;  3H6N A;  4F7Z A;  1NDD A;  3WA0 A;  4EOY A;  4XC2 A;  1UGM A;  4MGI E;  2XK5 B;  3CSF A;  4LJP B;  5J17 A;  5AZH A;  1OTR B;  4E71 A;  2K6Q A;  4BKS D;  3OLM D;  3HM3 A;  1EF5 A;  2MP2 A;  3EEC A;  2IO1 B;  3ECI A;  2KKC A;  3UIO B;  2KFJ A;  4MDK E;  1KOT A;  2NS5 A;  2BKR B;  4JLC A;  2J0J A;  3EHV A;  1J19 A;  2IYD B;  2KWC A;  2MX2 A;  2RR9 A;  2IBI B;  2LXA A;  3VH3 B;  1BT0 A;  3IFW B;  2Z59 B;  4AP4 C;  5TR5 A;  4BOZ B;  3V60 A;  1WJ6 A;  4FAD A;  3I3T B;  4FJY A;  3N3K B;  2MLB A;  1YX6 B;  2KDE B;  4WJN A;  2L05 A;  1WX8 A;  3KVF B;  4ICV A;  3TIX A;  2WX0 A;  1WY8 A;  4HDQ A;  2UWQ A;  4EZK A;  2KJR A;  3DPD A;  2KMC A;  3B08 A;  4K1R B;  4MEL A;  2KVR A;  2KNB A;  4LDT D;  3DBL I;  1WXM A;  4FJZ A;  4IC7 B;  1RLF A;  2HTH A;  2KO3 A;  2NR2 A;  3H7P B;  2WYQ A;  1TZ1 A;  3QA8 A;  3DBH I;  5LXI B;  1WJ4 A;  2IZV B;  2RGF A;  3AI5 A;  3PRP B;  5D7G A;  4WJQ A;  2HD5 B;  3VFK A;  1IP9 A;  2L76 A;  3DBS A;  3KH0 A;  4XX5 A;  3VTU A;  1ZKH A;  2FIF A;  4PS3 A;  5D2M B;  3N30 A;  3PS6 A;  2HE7 A;  2MBQ A;  3L0W B;  1V49 A;  2O6V D;  5DPS A;  2KLC A;  3ZKJ C;  4FBJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...