3DCGA

Crystal structure of the hiv vif bc-box in complex with human elonginb and elonginc
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
100
structure length
99
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADTFEALCIEPFSSPPELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor B polypeptide 2
publication title Structural insight into the human immunodeficiency virus Vif SOCS box and its role in human E3 ubiquitin ligase assembly
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/viral protein
total genus 25
structure length 99
sequence length 100
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3dcgA00
5LLIA 4HPLB 4GDLA 3NS8A 1BT0A 5E6NA 4LDTB 2KC1A 3QX1A 4KDIC 2LVPA 3L16A 3QA8A 2ZVNA 1OTRB 4IWQA 5CX3A 2DZJA 3UF8A 5CTRC 1AARA 1WR6E 4NPNA 3AULA 4IWOA 1SIFA 3ML9A 3IG3A 1WGGA 4G50A 2C60A 1WE6A 3M63B 4ANWA 4TUUA 1GNUA 3PT2B 5JZEB 3H1UA 4A3PA 2NCNA 1UH6A 3UQAA 4LCDE 2M8SA 2UWQA 2IBIB 2K8BA 3KUCB 1WR1A 4EEWA 2R2OA 5HKHA 4FADA 2BKFA 2KZRA 2DZIA 2KO3A 2LXCA 3DBLI 4JGHB 5D2MB 3PPAA 2C7MB 3UQBA 4EZKA 4F7ZA 3PLUA 2D10A 2V3SA 3ZTDA 4W9HA 4BBNF 2KVRA 3X23A 2DZKA 2FIDA 2W9NA 2JPHA 2KK8A 3RULA 2XK5B 4FJZA 2DENB 5DPWA 3EFUA 3VTWA 5E6PA 3SU8X 1LM8B 2ZNVC 1WFYA 2V4LA 4TQ1A 1LXDA 1IP9A 1WXMA 4AUQC 4KDLB 5AEKB 3TMPB 2WYQA 3VUYA 2XK5A 3NOBA 2O6VA 2Z0EB 4DDID 3DBSA 4MDKE 2G45B 2KJ6A 3A9KA 1L7YA 3KH0A 1Z2MA 3T8MA 3ZNID 2LI5A 1GG3A 2J7QB 4DHJB 4W9GA 3VQIA 1IPGA 2KJHB 2FCSA 2KX3A 3KW5B 3QHTA 3X0WA 4BVUC 3DPDA 4DBGA 3ZTCA 2JVCA 1YQBA 4YL8A 2GBKA 2MQJA 3LDZE 3JYUA 2MLBA 4BKTA 1WGRA 4WAAA 3ZO5B 5JH5C 5L83A 5LXHA 1R4NI 4B95A 1FXTB 1V9JA 2GBNA 4IG7B 3RCZA 3WAOA 4DHZE 1IYFA 2FCMA 1C1YB 4W9IA 3PTFC 1ZGUB 4JIOU 2LJ5A 1WI0A 3U7DA 1WZ3A 2DZMA 3DVNV 1XQQA 5AZHA 3A1QA 3APDA 3V60A 2M0XA 1GC7A 1WMHB 3GZNI 3R3MA 4GN1A 1P1AA 3DVNU 2MCNB 3V62A 1M94A 1WX9A 3R66C 2M1MA 3CMMB 4GMVA 2L8JA 3W1YA 2KX0A 2WX1A 1E8YA 1D3ZA 1UZXB 3UINB 1LQBA 4K1RB 3ZLZA 4HXDA 3C0RB 3BY4B 3R7QA 3HIZA 2D3GA 2LVOA 1X1MA 5AZGA 3ENEA 2KDIA 4HK2A 1C3TA 2NVUI 3ZNGC 2YVCA 2K8CA 2IO0B 4KV2A 1G6JA 1E90A 3DOWA 2UYZB 4RM9A 3QC8B 2ZZPB 3LJ3A 3PZDA 2JY6A 2DYMA 4B9KA 4MH0E 2ZPYA 2K8HA 3PVLA 2LD9A 3L13A 4GXBA 5C23A 4MGZE 3HM3A 4WJQA 2BF8B 4WWOA 3TIXA 3VHTC 4AP4C 3L0WB 4I6LB 3A9JB 3PRMB 3O65B 1WJ4A 3QQ8B 2HD5B 3ECIA 4PYUA 3EECA 4GDKB 1V81A 4HWIB 1E5WA 5J2RA 2MP2A 4G11A 4HDQA 2DAJA 3PLVA 4ASWC 1VCBA 4NJ6A 1E8ZA 3ZDMC 4AJWA 1J0GA 3I3TB 4GDKA 3TCAA 3APFA 3A4RA 1ZKHA 4ZDVA 2PEAA 1E8XA 1P0RA 2M4NA 2KTFA 1RAXA 3EHVA 2IY0B 2WWZA 4DXAB 1A5RA 2BKRB 3SHQA 2LGDA 5KHOA 1RFAA 1EUVB 1P98A 1V5TA 1WE7A 1H4RA 1NBFC 3PHXB 4II2B 1V6EA 1WGHA 5AZFA 1UBQA 2AL6A 4DHJD 1WY8A 1KJTA 4M8MA 3H7PB 2HJ8A 4WWPA 2D11A 2L05A 4WJNA 1WXVA 1OEYJ 2PPHA 4EFOA 1TTNA 4BBNC 3H7PA 5CHVC 4CHKA 2KN5A 4NAWB 1KLVA 2CKHB 1PQSA 3KVFB 2BYEA 3CF6E 1ISNA 4M0WB 1LFDA 1WX8A 3M62B 3QAQA 2LZ6A 4EOYA 4ANVA 3Q3JA 4NAWA 2D2QA 4HVBA 1V86A 3VH3B 1OEYA 2MSED 2J0MA 2O6VB 4FN2A 2Z59B 1WH3A 1UD7A 2HTHA 2KDEB 5E6OA 4W9LA 3KYDD 2GBMA 3PV1A 4F1SA 2V1YA 2Z0DB 3A9KB 3JVZX 2WX0A 2ZCBA 3IFWB 1H8CA 2DHZA 4RM8A 3DQVA 4WJOA 2O2VB 2JWZA 3B0AA 2LRUA 3TJPA 4ICUA 4PS3A 2GOWA 3U8ZA 2LRWA 4K7WA 5J17A 1SGHA 1YIWA 2FNJB 4N9F4 4BKSA 2JT4B 4DK5A 2KQSA 4X57B 2KD0A 2IO2B 2DX5B 2IO3B 2O2VA 4BFRA 4WQOB 1SE9A 3QIJA 5D6JB 1V80A 2BWFA 4FLHA 3QCAA 2ZEQA 3PREA 3NZUA 4NNJB 2G4SA 1QZEA 4GOCA 2LXAA 4BOZB 1J19A 4TV3A 2CR5A 2NBWB 3DCGA 3SD5A 2L76A 4NY0A 4E71A 1S3SG 2ASQA 2L0TA 3NHEB 1NI2A 4HLEA 1XT9B 3AI5A 1EO6A 3NZSA 2J0KA 2N4FA 3VFKA 1I35A 3A1QB 3EC8A 4MEMA 3QJZA 2MW5A 3PRZA 4GSWA 4KZCA 2LVQA 3R7RA 2JUOA 1CMXB 4ZRKA 3MTNB 3VTVA 4AWJA 3V6CB 4GGQA 2KDFB 4MGYE 2IY1B 2K39A 3IVFA 3OJ3A 4FHKA 4W9DA 1WYWB 3A4SC 2K6QA 1OQYA 1VD2A 2KWVB 5D7GA 3VVWB 3ML8A 3APCA 3WALA 2NPTA 4BOSC 1OGWA 4MGKE 3K9OB 1WJ6A 3L17A 3W1SC 3RZWC 4AOFA 2REXA 3WA0A 2VRRB 3N30A 2G4DB 5G2NA 1XD3B 4ANUA 4IWPA 1F9JA 2CS4A 4I6PA 3K9PB 2KANA 1GJZA 2L7RA 4PS7A 1E8WA 2Y5BB 2MRPA 3PSEB 3RT3B 1RLFA 2FIFA 2JZ3B 2KQ7A 3HHMA 4FJYA 4PS8A 3TBLD 2J0JA 2JZZA 3U30A 1TBEA 2GMIC 4K7UA 1Z5SB 2FUHB 3V61A 5G55A 2LASA 2KFJA 3M3JA 4FA6A 2IZVB 3AU5A 4IUMB 4MSMB 4LJOB 2MP2B 1MG8A 4IW0A 2IYDB 4PYZA 2JRHA 5D94A 1RRBA 3V6EB 1YX5B 3IHPC 1WXAA 3NY5A 4MJSA 3RD2A 2CU1A 3B1LX 1WGDA 4MM3A 1WJNA 2KMCA 2RD0A 2KKCA 4A3OA 4ZRJA 1EF5A 3ZDTA 2O6VD 2AL3A 2LWPA 4KIKB 4EZJA 5EDSA 5DCNA 2C7NB 4F8CB 1UBIA 5CHFA 3ZW3A 1HE8A 1GC6A 1WM2A 5GMVA 2XEWA 4KVGB 4BKSD 2HE7A 1E7UA 2KOXA 3VH4B 4KIKA 3GOEA 2N9XA 2PE9A 4XZ4A 2WDTB 1S1QB 3DDCB 1WZ0A 2FAZA 3PRPB 4LJPB 4IC7B 3ZUNA 2BPSA 2KLGA 2DYOA 2RSUA 1UELA 3ZRCA 1YX6B 2ZCCA 5JHBA 1TGZB 2N9EB 4RMAA 2OOBB 3VAWA 2K1FA 4B6WA 1WXSA 2DAFA 3OLMD 3DBRI 3WAPA 2ZPNA 1Q5WB 3N3KB 1WRDB 3QK0A 2MBOA 2MWSB 4XC2A 2MX2A 4DWFA 2L3ZA 3ONSA 3PGEA 4NQKE 4W9EA 2KC2A 1KOTA 5IA7A 2I1KA 2LUEA 2MBQA 3T9LA 1Q1OA 2FCNA 2N7EA 3MJWA 1GUAB 5DPTA 5LXIB 2ZJDA 3OAWA 2L0FA 5IAAC 1KM7A 2IO1B 4W9JA 1V49A 2KFKB 3UIPB 4URKA 2C9WB 3A33B 2EMTA 4KZ0A 4DHZB 4ANXA 4MSQB 3CSFA 4W9KA 1WGYA 2CHZA 4JLCA 2NS5A 4HCPB 2KFKA 2AWTA 1YD8U 3ALBA 2FCQA 3WAMA 4J6IA 3TL5A 1Y8RC 3D32A 2OJRA 1L2NA 2PJHA 4ICVA 2DYBA 4II3B 1ZW7A 2KJRA 1U4AA 2NBVB 3ZVVA 1P3QU 1EF1A 2ZNVB 3QWZB 3ZRFA 2RR9A 3L54A 4XX5A 5CHWA 3WIMA 4CO7A 4W9FA 4E74A 4K81A 2PE6B 4GB9A 3B08A 2K25A 5DPSA 2ZVOA 1I42A 4NJ7A 2KDBA 4E3CA 2MBEA 5KHQA 1UGMA 3L10B 4IM0A 5J18A 2BYFA 1JRUA 3H6NA 2KWCA 1NDDA 4EZLA 3IBEA 1WX7A 3UIOB 3VXWA 1T0YA 2N9PC 4ZYNA 2KHWB 4OVUA 2KLCA 2GBJA 2AEHA 2K6DB 2KXJA 4K7SA 3JSVB 4EUTA 3DVGX 1WF9A 2RGFA 5BO4B 2NPTB 4FHJA 3CSTA 2A4ZA 2KNBA 4HCNB 2NBUA 4HJKA 4KSLC 4KSKC 4HDOA 4A20A 2I1JA 3DBHI 1V5OA 1Q0WB 2JF5A 3JSVA 4OVVA 2BGFA 2A5UA 2CHXA 2RPQA 2EMSA 2C7HA 3ZNZB 4ZRIA 3ZKJC 1WJUA 3P2BA 4TKNA 2N1VA 4AJYB 4FULA 3SDLC 3M95A 2D07B 2MBHA 4NQLB 4BKGA 3HK0A 2M17A 3H9DA 3RYTA 3S2AA 1E7VA 2QHOA 2L00B 2G3QB 4JL9A 3ZIMA 3KUZA 3WANA 4JQWC 4EKUA 1YJ1A 3VDZA 4MGIE 1WMHA 2LGXA 2MBBB 3H7SA 2C5LC 2GBRA 5JHAA 4IM3A 4G3XB 4LDTD 4M8NA 2JRIB 3OJ4B 2N7DA 1J8CA 2LGYA 5FR6A 4MJSB 1K8RB 2NR2A 3PHWB 3W1SA 1V2YA 3AU4A 3QARA 3ZNHB 1TZ1A 2KWUB 1WM3A 3PS6A 3UGBB 3KUDB 5DPRA 3RUIB 4FJVB 2BWES 3VUWA 2XBBC 3L08A 4W9CA 3N32A 4CYEA 3AXCA 1P9DU 2EKEC 5TR5A 4FBJB 4WJPA 4TQ0A 2AYOB 4WWNA 3KYCD 4IM2A 4GIVA 2KTRB 1WIAA 3BINA 3VTUA 2N1WA 1R4MI 3Q3FA 4P7IA 4I6NB 3JW0X 4DDGD 4G0NB 5L95C 2CHWA 2BYVE 2KMAA 3HM6X 2R2QA 4GDLB 4GU2A 2MA9B 2KTRA 4MELA 5C1ZA 3A9JA 4HPMB 2B3AA 3MHSD 3RZFA 3DVGY 2YLMA 2JXXA 3VUXA
chains in the Genus database with same CATH superfamily
5LLIA 4GDLA 3H8HA 2WXIA 2ZVNA 4IKGA 3UF8A 1WR6E 4NPNA 3AULA 1TS5A 1MFWA 4IWOA 3E56A 2C60A 1WE6A 3M63B 1J7AA 1GNUA 3J9CA 4A3PA 2UWQA 1WR1A 4EEWA 2LXCA 2KO3A 3AE7B 1FCCC 3GB1A 1LO5D 4M0WA 4N58A 2XK5B 3EFUA 3VTWA 2IGDA 4TQ1A 2LGSA 1ZDVA 1N63A 4GLSC 2Z0EB 4DDID 1L7YA 1IPGA 4JPSA 1V1OA 1WSPA 3Q8AA 3ZTCA 1C4PA 3MHZA 4O1NA 3RNBC 1V9JA 4DHZE 1VZ7A 1QOFA 3PTFC 3U7DA 1XCTL 3DVNV 5IN7A 5AZHA 3APDA 1WMHB 3R3MA 5BYRA 3V62A 1YJIA 2K5PA 4WAFA 3R66C 2QJLA 2KX0A 2WX1A 1VZ8A 4TMAB 2W3SA 1D3ZA 2SEBD 1AW7A 3C0RB 1STEA 4NAMA 1TZOA 2KDIA 1UF0A 3ZNGC 2IO0B 1G6JA 1KTKA 3LJ3A 3PZDA 2DYMA 3DHHC 3NVWA 2ZPYA 3L13A 4GXBA 4JWSC 4WWOA 2BF8B 1F2RI 2LHDA 3PRMB 3O65B 4OZBA 1WJ4A 3EGRA 3ECIA 4PYUA 5H92C 4LNNA 3R2TA 3PLVA 2KVZA 1NVID 1J0GA 3TCAA 1ZKHA 2PEAA 4ZRQA 1D6EC 1GB1A 2W54A 2IY0B 2WWZA 1A5RA 2BKRB 5KHOA 1EUVB 1P98A 1V5TA 3B2FA 4K3BA 1H4RA 2I2YA 1PFDA 4DHJD 1WY8A 1Q10A 1TS3A 2ZW0A 3H7PB 4C4VB 1WXVA 2GLSA 2KN5A 1KLVA 3KWLA 2CKHB 3KVFB 3CF6E 2JYTA 4OZAA 1WX8A 3M62B 4HVBA 1V86A 4US9A 2INNE 2J0MA 3AM9A 1RM6C 3GE3C 4H2AA 2MJ3A 2Z59B 2KDEB 4W9LA 2GBMA 3URYA 2V1YA 2Z0DB 3A9KB 1H8CA 2DHZA 4WJOA 1L0YB 3B0AA 3TJPA 4PS3A 1YQ4B 2LRWA 4K7WA 1YIWA 2JT4B 4DK5A 4KGTA 2KD0A 2IO2B 2DX5B 2O2VA 3QIJA 5D6JB 1V80A 3DWGC 4FLHA 1DOYA 1FXAA 2VZKB 4TV3A 2CR5A 3Q69A 3TEZA 1S3SG 2KWDA 1C4AA 1OQRA 1XT9B 1HTOA 2N4FA 1I35A 3EC8A 1JRPA 2IPKD 4KZCA 2LVQA 3R7RA 2JUOA 4GGQA 3MFGA 2RPVA 3AEFB 2K6QA 3ML8A 1TIFA 2R61A 3L17A 5I4DA 2Z8LA 1XD3B 4IWPA 3K9PB 1L6VA 2PTLA 3NVYA 3GP7A 4A90A 1E8WA 3RT3B 1TYGB 3NRZA 2FIFA 1BUIC 3TBLD 2J0JA 2JZZA 3U30A 2GMIC 2FUHB 3MC0B 3AU5A 4IUMB 1PDXA 4IW0A 3L4PA 1MPEA 4S17A 4Q2JA 4A3OA 3FILB 4ZRJA 1HTQA 3RI7C 4MH8A 3BVGA 2KACA 2KOXA 1E7UA 2WXKA 3ZJVA 3SR6A 4KIKA 2WDTB 3C19A 3P4PB 1WZ0A 2FAZA 1PUTA 5EE1A 2BYTA 2X38A 4IC7B 3ZRCA 3B2GA 2ZCCA 2N9EB 2K1FA 3TEWA 2Y5CA 1C9FA 2PVOD 5AUKA 2MBOA 4XC2A 2MX2A 3UI3A 4DWFA 3TEYA 1TKYA 2KC2A 2JSVX 2EKIA 2LUEA 2MBQA 3T9LA 2N7EA 1GUAB 4S0RA 5DPTA 3N20C 2PW9A 2L0FA 2WNMA 1KM7A 2W82A 4DHZB 3FC4A 4ANXA 4W9KA 1SE3A 2BS3B 2CJOA 4YWGG 1I4PA 4IDIA 3D32A 2WGSA 1JWSD 4XYCA 1U4AA 1IGDA 4XX5A 5CHWA 4USAA 1TY2A 1T5XD 1NEKB 5DPSA 1QQRA 2ZVOA 4HKQA 1I42A 2LMCA 4YTPB 3L10B 5J18A 2BYFA 1JRUA 3UIOB 3VXWA 4XWTA 3BK1A 2KHWB 4OVUA 4EUTA 5BO4B 4YXDB 4FHJA 2NBUA 2SAKA 2I1JA 3GZNB 2RPQA 2EMSA 4ZRIA 4TKNA 2LHEA 4FULA 3SDLC 2D07B 4NQLB 4RF0A 3RNGC 4ITKA 3S2AA 3ZIMA 3WANA 4EKUA 4US8A 3AE6B 2E3TA 4LNFA 3W2DA 2LGXA 2MBBB 4CQNA 4G3XB 4LDTD 2JRIB 3OJ4B 5FR6A 2VH1A 1K8RB 3PHWB 3U2SC 1YQ3B 3Q6BA 3PS6A 4A55A 1DGJA 3KUDB 4DQOC 4YT0B 4FJVB 2WXOA 1N6ZA 2EKEC 4GIVA 2Y5PA 3ZJUA 3AECB 1MG4A 3JW0X 5L95C 2CHWA 4GDLB 3AEGB 2MA9B 4YTNB 2N9KA 3A9JA 3FAHA 3VUXA 1BT0A 4LDTB 2JQRB 2KC1A 2BBCA 2JYEA 5CX3A 3I63C 1AARA 2BB6A 3ML9A 3IG3A 2B76B 1WGGA 2MHJA 5BMGA 4TUUA 5JZEB 3W9CB 1EWCA 1UH6A 2IBIB 2R2OA 2BKFA 2DZIA 4JGHB 1HEZE 3PPAA 2NTTA 1HZ6A 2C7MB 2WU5B 3ZTDA 4W9HA 4BBNF 2KVRA 3X23A 2DZKA 2DWQA 2FIDA 4ACFA 2D3BA 2KK8A 1D4BA 4FJZA 2DENB 5DPWA 4LTUA 5E6PA 3SU8X 2V4LA 3TMPB 3VUYA 2E6XA 1I4HA 1JW9D 3KH0A 3T8MA 1JWUD 4OVZA 2J7QB 3N1ZC 2KJHB 2KX3A 1PGBA 3KW5B 1JQ4A 3DPDA 5BYQA 1J7CA 3JYUA 4BKTA 3ZO5B 3AE4B 1TKGA 1FXTB 2GBNA 3RCZA 5IO9A 2FCMA 2WLBA 3B9JA 3TSSA 1SE2A 2LUMA 2LJ5A 1AYFA 1WI0A 1RYJA 1V97A 3A1QA 2M0XA 4GN1A 3AMZA 3GZNI 1E10A 3P4SB 3DVNU 1M94A 1WX9A 2L8JA 3UINB 4K1RB 2D3AA 3BY4B 5BYSA 1C77A 3ENEA 1C3TA 5IKCM 3MC9A 4L1BA 1QT9A 4RFBA 2V9HA 2UYZB 4L23A 1F2RC 2JY6A 3VR8B 2K8HA 2INPE 4M00A 2EELA 4AP4C 2QIEB 1L6UA 4I6LB 2V3PA 1M4VA 3EECA 4C7ZA 4HDQA 2DAJA 4NJ6A 5BMIA 1E8ZA 3N1YC 3A4RA 1XO3A 3ABVB 2LGDA 3DBRB 3BZDB 1FRRA 3HUIA 4II2B 1V6EA 2AL6A 4WWPA 2D11A 2L05A 3AE9B 4LNKA 1TTNA 1LFDA 3LB8C 4LNIA 2LZ6A 4EOYA 4KGSA 4ANVA 1XF5L 2K0PA 3Q3JA 1HZ5A 4FXCA 3AEDB 5GXGB 3VH3B 2O6VB 1T0RC 1WH3A 4C80A 3KYDD 1FFUA 3IFWB 2KQ4X 4KX6B 2O2VB 2YEPB 3U8ZA 1P7FA 4ICUA 2GOWA 2ONQA 1SGHA 1N61A 2FNJB 5LNK1 1QOAA 4N9F4 3CIRB 4BAXA 1XLQA 1QOBA 2KQSA 4X57B 4WQOB 1SE9A 1WRIA 4KKJA 2ZEQA 4PT5A 4NNJB 1DOXA 2LXAA 2L76A 1NI3A 1C78A 3AH7A 4NY0A 1FFVA 2L0TA 3AI5A 2J0KA 3DBHB 4MEMA 3QJZA 3ZQ4A 5MPOA 1CMXB 1PYWD 1R4NB 4AS1A 3VTVA 3V6CB 3IVFA 4W9DA 1JWMD 2D5GA 3A4SC 1OQYA 2KWVB 3VVWB 1AWDA 3APCA 2BS2B 1OGWA 4MGKE 3K9OB 5BMHA 3NS1A 3W1SC 3Q8CA 2REXA 4AOFA 2VRRB 2QDFA 5HG2A 2G4DB 3LXFA 3P4RB 1F9JA 4I6PA 3R2IA 1GJZA 5FR3A 2KMMA 2L7RA 1MHXA 2Y5BB 3BYYB 2MRPA 3V05A 4PS8A 4C56C 2DNFA 1TBEA 1ENFA 3V61A 3LYYA 5G55A 2LASA 2KFJA 4FA6A 2IZVB 2FE8A 2MP2B 4PYZA 5IOIA 4ARCA 3IHPC 1WXAA 3AE2B 3RD2A 3B1LX 4HPPA 1WJNA 2AL3A 5EDSA 4KIKB 4WURA 1ZP0B 1HE8A 1GC6A 3ZJTA 2INDC 4KVGB 4BKSD 3BWUD 1EU3A 1ZXIA 1VJKA 1N62A 1ZPSA 4LJPB 3NZ3A 5IP4D 3DHIC 1MJDA 2MJEA 3ZUNA 2BT6A 2QSDA 2DYOA 2QCZA 2NMQA 3IXSA 1TGZB 2ICIA 2OOBB 4B6WA 3DBRI 3WAPA 2VZKD 2ZPNA 1FRDA 1GAQB 2RMMA 5IA7A 1Q1OA 5LXIB 4YSZB 2IO1B 4W9JA 3UIPB 4JWUC 2C9WB 4URKA 2CHZA 4JLCA 2AQ2B 2KFKA 2AWTA 1ACCA 1Y8RC 4ICVA 1A70A 1ZW7A 1UGJA 2JWUA 2KJRA 2NBVB 3ZVVA 3HVDA 1WXQA 1EF1A 2ZNVB 3ZRFA 2RR9A 2YEPF 4CO7A 4W9FA 4K81A 4GB9A 3B08A 4NJ7A 2J53A 3RN9C 2MBEA 5TSSA 3H6NA 3ZGZA 2KLCA 4XDDA 2GBJA 2AEHA 2IGGA 2KXJA 5HI1A 2BW2A 2NPTB 2KNBA 4HJKA 4KSLC 1SE4A 4HDOA 3DBHI 1V5OA 1Q0WB 1TS2A 2JF5A 3JSVA 2BGFA 4HEA1 2A5UA 4TSSA 2CHXA 3MP9A 3ZNZB 3SEBA 3P2BA 3M95A 3AB5A 1PGAA 4ZHPA 4BKGA 2M17A 5D3IB 3RYTA 1E7VA 2L00B 5G5HA 4EE2A 5HHDG 4B0EA 4LK0M 1K53A 2VH2A 1WMHA 1SB3C 3H7SA 4IM3A 4XGAB 4MJSB 3W1SA 1V2YA 4P16A 3ZNHB 1TZ1A 1UUPA 2KWUB 3W5UB 1I4XA 4C00A 1WM3A 2W55A 3Q14C 2WXHA 2PVGC 3RUIB 1XEEA 2WXNA 4W9CA 1B9RA 4CYEA 3AXCA 5TR5A 4LNOA 4FBJB 2AYOB 4IM2A 3BIID 3R8BA 4BZAA 3WCQA 2XNAC 4P7IA 4G0NB 2BYVE 2KTRA 4J3OD 1V8CA 2N7JA 2KYWA 1VZ6A 2RDBC 1BXTA 3SFEB 2OEDA 3QX1A 2LVPA 3QA8A 2DZJA 5CTRC 1PGXA 1SIFA 1EM7A 1YJJA 2KN4A 3PT2B 3H1UA 2AX5A 2NCNA 1CJEA 2K8BA 5HKHA 4FADA 4RGOS 1HQRD 1JALA 1F77A 2IDYA 2KT7A 3UQBA 3VR9B 4F7ZA 4AQ7A 1D5MC 3RULA 2G9HD 1DYQA 1LM8B 1WFYA 1V1PB 1LXDA 1IP9A 1WXMA 4AUQC 4KDLB 5AEKB 3NOBA 4B0MA 1FNVA 1ZXHA 3E9SA 2KJ6A 3A9KA 1Z2MA 1FPYA 3ZNID 1WGKA 1MI0A 3T3OA 4W9GA 3VQIA 3RPFC 3KQ4A 3QHTA 3X0WA 2GI9A 3AEBB 2JVCA 3DHGC 2MQJA 1WGRA 4WAAA 5JH5C 5L83A 5LXHA 4B95A 4XDCA 2V0GA 3WAOA 4IG7B 1IYFA 2L32A 4W9IA 1T3QA 2J52A 1T0QC 1D5ZC 1ZGUB 4NJCA 1XQQA 4HKZE 4NZLB 1C4CA 2MCNB 3SFDB 3RNAC 2KAJA 4HRSA 4GMVA 1NYRA 2M1MA 3CMMB 3W1YA 1E8YA 1UZXB 1LQBA 4HXDA 3HIZA 1X1MA 2MEKA 1K52A 2JU6X 2NVUI 2YVCA 1QF6A 4KV2A 3DOWA 4RM9A 1I4QA 3NG0A 3VRAB 1KFYB 1KRHA 4MH0E 3BK2A 2LD9A 4MGZE 4WJQA 3VHTC 4RCOA 3RNFC 2HJ1A 2DLBA 3QQ8B 2M0AA 1F0ZA 3BVMA 1E5WA 3OG5A 5J2RA 4G11A 4ASWC 4RGNA 1VCBA 3NVVA 1QILA 4GDKA 1LGRA 1R7SA 3APFA 4ZDVA 1IUEA 1E8XA 2PMVA 4DXAB 5AUIA 2WXRA 3W5VB 3FILA 2H88B 3SHQA 1F52A 1IGCA 1WE7A 1NBFC 3PHXB 1KJTA 1WYGA 2HJ8A 1N5WA 1NENB 4EFOA 4CHKA 2PKOA 4M0WB 3EFCA 1P7EA 1YN4A 3AN1A 4NAWA 2V3NA 2Q5WD 3KLSX 1OEYA 2MSED 1FNWA 4MT5A 2M19A 2N0SB 3AE8B 1UD7A 1T6BX 2WX0A 3PO0A 4RM8A 3DQVA 1FEHA 5J17A 1L4DB 3MC8A 3AEEB 4BFRA 2IO3B 3N9YC 1FXIA 3QCAA 2INCC 3P42A 3NZUA 2G4SA 1KH0A 2AQ1B 4BOZB 1DOIA 2NBWB 4E71A 2ASQA 3I9V1 2K9XA 1NI2A 3NZSA 1I4GA 4RGMA 2L1AA 3VFKA 2MW5A 4GSWA 1OFFA 2ON8A 2IY1B 3ETRA 3RNCC 3OJ3A 1WYWB 3MJ5A 1VD2A 5D7GA 4HROA 2G1EA 2LFIA 1WJ6A 3N30A 5G2NA 1XLPA 4ANUA 1KLUD 4PS7A 2WXFA 1F1HA 4WIPA 1RLFA 2KQ7A 1QKZA 1J7BA 3P1MA 1UWXA 2WXLA 1E7PB 2JRHA 3T3NA 1RRBA 2D3CA 1YX5B 1WGDA 4MM3A 1GPXA 2KMCA 2KKCA 3ZDTA 1KLGD 2O6VD 1JWAD 4EZJA 4ZYSA 5DCNA 2C7NB 4F8CB 2WXQA 1UBIA 3Q3MC 3ZW3A 1CZPA 1WM2A 5GMVA 2HE7A 5E6JA 3HVZA 3GOEA 2LGIA 2PE9A 3DDCB 3PRPB 4YSYB 2GB1A 2BPSA 2KLGA 1UELA 4KKIA 1FM0D 3OLMD 1RWSA 4RGTA 2BB5A 2L3ZA 3PGEA 4NQKE 4W9EA 1ET9A 2I1KA 3AE5B 3MJWA 2WS3B 2X8XX 5EE3A 1IBXA 3DBLB 3RNEC 5IAAC 4D2KA 1V49A 2KFKB 3A33B 2EMTA 4KZ0A 4A8XC 3CSFA 4HCPB 4QAYA 4PK1A 3ALBA 4J6IA 3TL5A 1JWBD 1GB4A 4II3B 2OJWA 3I57A 1P3QU 3QWZB 1JMLA 4E74A 2IJ0A 1YN5A 2K25A 4WWMA 1UWMA 1UNSA 1Y56A 1UGMA 4IM0A 4P1CC 2N9LA 2RDGA 1N60A 1YOVB 2JX5A 2N9PC 4ZYNA 2K6DB 3PZ8A 4K7SA 3JSVB 4A6QA 1WF9A 2RGFA 2LEKA 4HCNB 3Q3OC 1SEBD 4KGRA 3ZKJC 2N1VA 4K3CA 1TJEA 4N6EB 1E0ZA 2MBHA 3HK0A 1SF0A 2QHOA 1MHHE 4JQWC 4MGIE 1SXTA 2GBRA 1JCKB 2N7DA 1J8CA 2LGYA 3TEXA 1FD6A 3AU4A 4XE0A 3UGBB 2L83A 2J42A 5DPRA 3P63A 1C79A 2BWES 3VUWA 2XBBC 3L08A 4RNAA 2JXTA 4WJPA 1SJED 3EUB2 3AV8A 3KYCD 4WWNA 3U4EG 2KTRB 3U52E 3BINA 5C3JB 4ZHOA 5FKAC 4DDGD 4GU2A 2KMAA 3HM6X 1D5XC 3AE1B 3RZFA 3DVGY 1QOGA 4HPLB 3NS8A 2V4IB 5E6NA 4DXGA 4KDIC 4DXFA 3L16A 1L0XB 1OTRB 4IWQA 4M01A 3ZYYX 3NVZA 1L4ZB 3ZXVA 1L5PA 4G50A 4ANWA 4WH4A 3UQAA 4LCDE 2M8SA 3KUCB 5HFYA 4JX1C 2KZRA 3DBLI 2Y3AA 5D2MB 4EZKA 5T8IA 4MACA 3PLUA 2D10A 2V3SA 2WDVB 1EU4A 2IGHA 2W9NA 3DWMA 2JPHA 2FBWB 2ZNVC 2BVCA 2WYQA 3I5JC 2XK5A 2O6VA 1SBBB 3DBSA 4MDKE 2G45B 1VRAB 1XCQL 1GG3A 2LI5A 4DHJB 3V3XA 2FCSA 1AN8A 4BVUC 4DBGA 4P6VF 1YQBA 4YL8A 2GBKA 2WXMA 3LDZE 2MLBA 5EE0A 1R4NI 1C1YB 2JZPA 1HXYD 4JIOU 1WZ3A 2DZMA 3U7ZA 2FUG1 3V60A 1GC7A 1TS4A 1P1AA 2WXPA 3CWIA 2WDQB 4YSXB 3ZLZA 3R7QA 2D3GA 1VR9A 2LVOA 5AZGA 2BTEA 4HK2A 2WU2B 1ESFA 4L2YA 2K8CA 4HJGE 1TY0A 1E90A 3QC8B 2ZZPB 4B9KA 2QILA 3PVLA 5C23A 2OHFA 3HM3A 4M02A 1OQQA 3TIXA 3L0WB 3A9JB 2PLPA 2HD5B 4GDKB 1V81A 4HWIB 2MP2A 3VRBB 2AQ3B 3BVZA 4ZRPA 3ZDMC 4AJWA 2MJDA 3I3TB 4XWWA 3IAS1 3RFZB 1P0RA 2M4NA 2KTFA 1RAXA 3EHVA 2TSSA 1SIJA 3BYTB 3N1XC 1NYQA 3OWEB 1B1ZA 1RFAA 1WWTA 2HTME 1WGHA 5AZFA 1UBQA 4M8MA 3GE8C 3Q8BA 4WJNA 3FKYA 2CJNA 1I4RA 1OEYJ 2PPHA 4BBNC 3H7PA 5CHVC 4NAWB 4C4VA 1PQSA 2BYEA 1ZDXA 1ISNA 1E6EB 2DBYA 4N59A 3QAQA 2RDHA 2D2QA 3Q3NC 1MVKA 4FN2A 3AE3B 2HTHA 5E6OA 5H8YE 1SSNA 1YN3A 3PV1A 3Q8EA 4F1SA 3JVZX 2KDMA 2ZCBA 2JWZA 2LRUA 1C76A 4BKSA 3KWVA 2BWFA 3PREA 1ZUD2 1QZEA 1CQVA 4GOCA 1J19A 4UDUC 3SD5A 3DCGA 2NTSA 3NHEB 4HLEA 1EO6A 4ARIA 3A1QB 1XLOA 3PRZA 4ZRKA 3MTNB 4AWJA 2KDFB 4MGYE 2K39A 1GOZA 4FHKA 2GRIA 1HA5A 3IAM1 1FMAD 3WALA 2NPTA 4OW0A 4BOSC 4C7YA 1T0SC 3RZWC 3WA0A 2MH7A 3Q8FA 2CS4A 2I38A 2KANA 1FCLA 2WHIA 2ACZB 3PSEB 2XN9C 2JZ3B 3HHMA 2LJIA 4IOIE 2HDEA 4FJYA 3RMKC 1FNUA 4K7UA 1Z5SB 1BMLC 2WQYB 3M3JA 5JXVA 1FIQA 4MSMB 4LJOB 1MG8A 2IYDB 3P4QB 4MM3B 5D94A 2WDRB 1VLBA 3V6EB 3NY5A 1K51A 4OHJA 3IT4B 3TUOA 4MJSA 2CU1A 1R4MB 2RD0A 1EF5A 2LWPA 5CHFA 4JE3B 2XEWA 3VH4B 3IT6B 3Q2AC 3NJTA 2N9XA 4XZ4A 1S1QB 1ZE3D 3C8YA 2RSUA 5EE9A 1YX6B 3GS2A 5JHBA 1YNTE 4RMAA 3VAWA 1WXSA 2DAFA 1Q5WB 2K22A 3N3KB 4REZA 1WRDB 3QK0A 4YTMB 1JROA 2MWSB 2WP9B 2BQQA 1IBXB 3ONSA 1KOTA 1ZOYB 2FCNA 2ZJDA 3OAWA 5G5GA 4R3DA 2H89B 3AEAB 2QC8A 2QMTA 4MSQB 4A9AA 1WGYA 2NS5A 1YD8U 3O13A 2FCQA 3WAMA 1L2NA 2OJRA 1FO4A 2PJHA 2QEJC 2DYBA 1K50A 1XLNA 1TKEA 4RF1A 3L54A 3WIMA 1SJHD 2PE6B 3NUHB 1VDVA 2M56B 1CK1A 2KDBA 4E3CA 5KHQA 3HRDD 1V1PA 3PZ7A 2W3RA 2KWCA 1NDDA 4EZLA 2UU7A 3IBEA 1WX7A 2L52A 1T0YA 1RFKA 3DVGX 1EWYC 3CSTA 3ZXRA 2A4ZA 4KSKC 4A20A 4OVVA 1ROEA 2C7HA 1WJUA 1E9MA 4P1BC 4AJYB 4ZOHC 2PIAA 4OZCA 5FK9C 3H9DA 2G3QB 4JL9A 3KUZA 1YJ1A 3VDZA 1TT5B 2C5LC 2CU3A 5JHAA 4M8NA 1ET6A 2K3UA 1KF6B 2ZW1A 2NR2A 1N5XA 3QARA 4RH6A 2J4XA 5D3DA 4LLGM 1I7HA 1QLBB 3N32A 1P9DU 4TQ0A 5C2TB 1YMHE 1WIAA 3VTUA 1XXGA 2WXJA 2N1WA 1R4MI 3EA6A 3Q3FA 4I6NB 1L0VB 2WXGA 2R2QA 4MELA 5C1ZA 4WQMA 4HPMB 2B3AA 2BS4B 3MHSD 2YLMA 2JXXA
chains in the Genus database with same CATH topology
5LLIA 4HPLB 4GDLA 3NS8A 1BT0A 5E6NA 4LDTB 2KC1A 3QX1A 4KDIC 2LVPA 3L16A 3QA8A 2ZVNA 1OTRB 4IWQA 5CX3A 2DZJA 3UF8A 5CTRC 1AARA 1WR6E 4NPNA 3AULA 4IWOA 1SIFA 3ML9A 3IG3A 1WGGA 4G50A 2C60A 1WE6A 3M63B 4ANWA 4TUUA 1GNUA 3PT2B 5JZEB 3H1UA 4A3PA 2NCNA 1UH6A 3UQAA 4LCDE 2M8SA 2UWQA 2IBIB 2K8BA 3KUCB 1WR1A 4EEWA 2R2OA 5HKHA 4FADA 2BKFA 2KZRA 2DZIA 2KO3A 2LXCA 3DBLI 4JGHB 5D2MB 3PPAA 2C7MB 3UQBA 4EZKA 4F7ZA 3PLUA 2D10A 2V3SA 3ZTDA 4W9HA 4BBNF 2KVRA 3X23A 2DZKA 2FIDA 2W9NA 2JPHA 2KK8A 3RULA 2XK5B 4FJZA 2DENB 5DPWA 3EFUA 3VTWA 5E6PA 3SU8X 1LM8B 2ZNVC 1WFYA 2V4LA 4TQ1A 1LXDA 1IP9A 1WXMA 4AUQC 4KDLB 5AEKB 3TMPB 2WYQA 3VUYA 2XK5A 3NOBA 2O6VA 2Z0EB 4DDID 3DBSA 4MDKE 2G45B 2KJ6A 3A9KA 1L7YA 3KH0A 1Z2MA 3T8MA 3ZNID 2LI5A 1GG3A 2J7QB 4DHJB 4W9GA 3VQIA 1IPGA 2KJHB 2FCSA 2KX3A 3KW5B 3QHTA 3X0WA 4BVUC 3DPDA 4DBGA 3ZTCA 2JVCA 1YQBA 4YL8A 2GBKA 2MQJA 3LDZE 3JYUA 2MLBA 4BKTA 1WGRA 4WAAA 3ZO5B 5JH5C 5L83A 5LXHA 1R4NI 4B95A 1FXTB 1V9JA 2GBNA 4IG7B 3RCZA 3WAOA 4DHZE 1IYFA 2FCMA 1C1YB 4W9IA 3PTFC 1ZGUB 4JIOU 2LJ5A 1WI0A 3U7DA 1WZ3A 2DZMA 3DVNV 1XQQA 5AZHA 3A1QA 3APDA 3V60A 2M0XA 1GC7A 1WMHB 3GZNI 3R3MA 4GN1A 1P1AA 3DVNU 2MCNB 3V62A 1M94A 1WX9A 3R66C 2M1MA 3CMMB 4GMVA 2L8JA 3W1YA 2KX0A 2WX1A 1E8YA 1D3ZA 1UZXB 3UINB 1LQBA 4K1RB 3ZLZA 4HXDA 3C0RB 3BY4B 3R7QA 3HIZA 2D3GA 2LVOA 1X1MA 5AZGA 3ENEA 2KDIA 4HK2A 1C3TA 2NVUI 3ZNGC 2YVCA 2K8CA 2IO0B 4KV2A 1G6JA 1E90A 3DOWA 2UYZB 4RM9A 3QC8B 2ZZPB 3LJ3A 3PZDA 2JY6A 2DYMA 4B9KA 4MH0E 2ZPYA 2K8HA 3PVLA 2LD9A 3L13A 4GXBA 5C23A 4MGZE 3HM3A 4WJQA 2BF8B 4WWOA 3TIXA 3VHTC 4AP4C 3L0WB 4I6LB 3A9JB 3PRMB 3O65B 1WJ4A 3QQ8B 2HD5B 3ECIA 4PYUA 3EECA 4GDKB 1V81A 4HWIB 1E5WA 5J2RA 2MP2A 4G11A 4HDQA 2DAJA 3PLVA 4ASWC 1VCBA 4NJ6A 1E8ZA 3ZDMC 4AJWA 1J0GA 3I3TB 4GDKA 3TCAA 3APFA 3A4RA 1ZKHA 4ZDVA 2PEAA 1E8XA 1P0RA 2M4NA 2KTFA 1RAXA 3EHVA 2IY0B 2WWZA 4DXAB 1A5RA 2BKRB 3SHQA 2LGDA 5KHOA 1RFAA 1EUVB 1P98A 1V5TA 1WE7A 1H4RA 1NBFC 3PHXB 4II2B 1V6EA 1WGHA 5AZFA 1UBQA 2AL6A 4DHJD 1WY8A 1KJTA 4M8MA 3H7PB 2HJ8A 4WWPA 2D11A 2L05A 4WJNA 1WXVA 1OEYJ 2PPHA 4EFOA 1TTNA 4BBNC 3H7PA 5CHVC 4CHKA 2KN5A 4NAWB 1KLVA 2CKHB 1PQSA 3KVFB 2BYEA 3CF6E 1ISNA 4M0WB 1LFDA 1WX8A 3M62B 3QAQA 2LZ6A 4EOYA 4ANVA 3Q3JA 4NAWA 2D2QA 4HVBA 1V86A 3VH3B 1OEYA 2MSED 2J0MA 2O6VB 4FN2A 2Z59B 1WH3A 1UD7A 2HTHA 2KDEB 5E6OA 4W9LA 3KYDD 2GBMA 3PV1A 4F1SA 2V1YA 2Z0DB 3A9KB 3JVZX 2WX0A 2ZCBA 3IFWB 1H8CA 2DHZA 4RM8A 3DQVA 4WJOA 2O2VB 2JWZA 3B0AA 2LRUA 3TJPA 4ICUA 4PS3A 2GOWA 3U8ZA 2LRWA 4K7WA 5J17A 1SGHA 1YIWA 2FNJB 4N9F4 4BKSA 2JT4B 4DK5A 2KQSA 4X57B 2KD0A 2IO2B 2DX5B 2IO3B 2O2VA 4BFRA 4WQOB 1SE9A 3QIJA 5D6JB 1V80A 2BWFA 4FLHA 3QCAA 2ZEQA 3PREA 3NZUA 4NNJB 2G4SA 1QZEA 4GOCA 2LXAA 4BOZB 1J19A 4TV3A 2CR5A 2NBWB 3DCGA 3SD5A 2L76A 4NY0A 4E71A 1S3SG 2ASQA 2L0TA 3NHEB 1NI2A 4HLEA 1XT9B 3AI5A 1EO6A 3NZSA 2J0KA 2N4FA 3VFKA 1I35A 3A1QB 3EC8A 4MEMA 3QJZA 2MW5A 3PRZA 4GSWA 4KZCA 2LVQA 3R7RA 2JUOA 1CMXB 4ZRKA 3MTNB 3VTVA 4AWJA 3V6CB 4GGQA 2KDFB 4MGYE 2IY1B 2K39A 3IVFA 3OJ3A 4FHKA 4W9DA 1WYWB 3A4SC 2K6QA 1OQYA 1VD2A 2KWVB 5D7GA 3VVWB 3ML8A 3APCA 3WALA 2NPTA 4BOSC 1OGWA 4MGKE 3K9OB 1WJ6A 3L17A 3W1SC 3RZWC 4AOFA 2REXA 3WA0A 2VRRB 3N30A 2G4DB 5G2NA 1XD3B 4ANUA 4IWPA 1F9JA 2CS4A 4I6PA 3K9PB 2KANA 1GJZA 2L7RA 4PS7A 1E8WA 2Y5BB 2MRPA 3PSEB 3RT3B 1RLFA 2FIFA 2JZ3B 2KQ7A 3HHMA 4FJYA 4PS8A 3TBLD 2J0JA 2JZZA 3U30A 1TBEA 2GMIC 4K7UA 1Z5SB 2FUHB 3V61A 5G55A 2LASA 2KFJA 3M3JA 4FA6A 2IZVB 3AU5A 4IUMB 4MSMB 4LJOB 2MP2B 1MG8A 4IW0A 2IYDB 4PYZA 2JRHA 5D94A 1RRBA 3V6EB 1YX5B 3IHPC 1WXAA 3NY5A 4MJSA 3RD2A 2CU1A 3B1LX 1WGDA 4MM3A 1WJNA 2KMCA 2RD0A 2KKCA 4A3OA 4ZRJA 1EF5A 3ZDTA 2O6VD 2AL3A 2LWPA 4KIKB 4EZJA 5EDSA 5DCNA 2C7NB 4F8CB 1UBIA 5CHFA 3ZW3A 1HE8A 1GC6A 1WM2A 5GMVA 2XEWA 4KVGB 4BKSD 2HE7A 1E7UA 2KOXA 3VH4B 4KIKA 3GOEA 2N9XA 2PE9A 4XZ4A 2WDTB 1S1QB 3DDCB 1WZ0A 2FAZA 3PRPB 4LJPB 4IC7B 3ZUNA 2BPSA 2KLGA 2DYOA 2RSUA 1UELA 3ZRCA 1YX6B 2ZCCA 5JHBA 1TGZB 2N9EB 4RMAA 2OOBB 3VAWA 2K1FA 4B6WA 1WXSA 2DAFA 3OLMD 3DBRI 3WAPA 2ZPNA 1Q5WB 3N3KB 1WRDB 3QK0A 2MBOA 2MWSB 4XC2A 2MX2A 4DWFA 2L3ZA 3ONSA 3PGEA 4NQKE 4W9EA 2KC2A 1KOTA 5IA7A 2I1KA 2LUEA 2MBQA 3T9LA 1Q1OA 2FCNA 2N7EA 3MJWA 1GUAB 5DPTA 5LXIB 2ZJDA 3OAWA 2L0FA 5IAAC 1KM7A 2IO1B 4W9JA 1V49A 2KFKB 3UIPB 4URKA 2C9WB 3A33B 2EMTA 4KZ0A 4DHZB 4ANXA 4MSQB 3CSFA 4W9KA 1WGYA 2CHZA 4JLCA 2NS5A 4HCPB 2KFKA 2AWTA 1YD8U 3ALBA 2FCQA 3WAMA 4J6IA 3TL5A 1Y8RC 3D32A 2OJRA 1L2NA 2PJHA 4ICVA 2DYBA 4II3B 1ZW7A 2KJRA 1U4AA 2NBVB 3ZVVA 1P3QU 1EF1A 2ZNVB 3QWZB 3ZRFA 2RR9A 3L54A 4XX5A 5CHWA 3WIMA 4CO7A 4W9FA 4E74A 4K81A 2PE6B 4GB9A 3B08A 2K25A 5DPSA 2ZVOA 1I42A 4NJ7A 2KDBA 4E3CA 2MBEA 5KHQA 1UGMA 3L10B 4IM0A 5J18A 2BYFA 1JRUA 3H6NA 2KWCA 1NDDA 4EZLA 3IBEA 1WX7A 3UIOB 3VXWA 1T0YA 2N9PC 4ZYNA 2KHWB 4OVUA 2KLCA 2GBJA 2AEHA 2K6DB 2KXJA 4K7SA 3JSVB 4EUTA 3DVGX 1WF9A 2RGFA 5BO4B 2NPTB 4FHJA 3CSTA 2A4ZA 2KNBA 4HCNB 2NBUA 4HJKA 4KSLC 4KSKC 4HDOA 4A20A 2I1JA 3DBHI 1V5OA 1Q0WB 2JF5A 3JSVA 4OVVA 2BGFA 2A5UA 2CHXA 2RPQA 2EMSA 2C7HA 3ZNZB 4ZRIA 3ZKJC 1WJUA 3P2BA 4TKNA 2N1VA 4AJYB 4FULA 3SDLC 3M95A 2D07B 2MBHA 4NQLB 4BKGA 3HK0A 2M17A 3H9DA 3RYTA 3S2AA 1E7VA 2QHOA 2L00B 2G3QB 4JL9A 3ZIMA 3KUZA 3WANA 4JQWC 4EKUA 1YJ1A 3VDZA 4MGIE 1WMHA 2LGXA 2MBBB 3H7SA 2C5LC 2GBRA 5JHAA 4IM3A 4G3XB 4LDTD 4M8NA 2JRIB 3OJ4B 2N7DA 1J8CA 2LGYA 5FR6A 4MJSB 1K8RB 2NR2A 3PHWB 3W1SA 1V2YA 3AU4A 3QARA 3ZNHB 1TZ1A 2KWUB 1WM3A 3PS6A 3UGBB 3KUDB 5DPRA 3RUIB 4FJVB 2BWES 3VUWA 2XBBC 3L08A 4W9CA 3N32A 4CYEA 3AXCA 1P9DU 2EKEC 5TR5A 4FBJB 4WJPA 4TQ0A 2AYOB 4WWNA 3KYCD 4IM2A 4GIVA 2KTRB 1WIAA 3BINA 3VTUA 2N1WA 1R4MI 3Q3FA 4P7IA 4I6NB 3JW0X 4DDGD 4G0NB 5L95C 2CHWA 2BYVE 2KMAA 3HM6X 2R2QA 4GDLB 4GU2A 2MA9B 2KTRA 4MELA 5C1ZA 3A9JA 4HPMB 2B3AA 3MHSD 3RZFA 3DVGY 2YLMA 2JXXA 3VUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LLI A;  4HPL B;  4GDL A;  3NS8 A;  1BT0 A;  5E6N A;  4LDT B;  2KC1 A;  3QX1 A;  4KDI C;  2LVP A;  3L16 A;  3QA8 A;  2ZVN A;  1OTR B;  4IWQ A;  5CX3 A;  2DZJ A;  3UF8 A;  5CTR C;  1AAR A;  1WR6 E;  4NPN A;  3AUL A;  4IWO A;  1SIF A;  3ML9 A;  3IG3 A;  1WGG A;  4G50 A;  2C60 A;  1WE6 A;  3M63 B;  4ANW A;  4TUU A;  1GNU A;  3PT2 B;  5JZE B;  3H1U A;  4A3P A;  2NCN A;  1UH6 A;  3UQA A;  4LCD E;  2M8S A;  2UWQ A;  2IBI B;  2K8B A;  3KUC B;  1WR1 A;  4EEW A;  2R2O A;  5HKH A;  4FAD A;  2BKF A;  2KZR A;  2DZI A;  2KO3 A;  2LXC A;  3DBL I;  4JGH B;  5D2M B;  3PPA A;  2C7M B;  3UQB A;  4EZK A;  4F7Z A;  3PLU A;  2D10 A;  2V3S A;  3ZTD A;  4W9H A;  4BBN F;  2KVR A;  3X23 A;  2DZK A;  2FID A;  2W9N A;  2JPH A;  2KK8 A;  3RUL A;  2XK5 B;  4FJZ A;  2DEN B;  5DPW A;  3EFU A;  3VTW A;  5E6P A;  3SU8 X;  1LM8 B;  2ZNV C;  1WFY A;  2V4L A;  4TQ1 A;  1LXD A;  1IP9 A;  1WXM A;  4AUQ C;  4KDL B;  5AEK B;  3TMP B;  2WYQ A;  3VUY A;  2XK5 A;  3NOB A;  2O6V A;  2Z0E B;  4DDI D;  3DBS A;  4MDK E;  2G45 B;  2KJ6 A;  3A9K A;  1L7Y A;  3KH0 A;  1Z2M A;  3T8M A;  3ZNI D;  2LI5 A;  1GG3 A;  2J7Q B;  4DHJ B;  4W9G A;  3VQI A;  1IPG A;  2KJH B;  2FCS A;  2KX3 A;  3KW5 B;  3QHT A;  3X0W A;  4BVU C;  3DPD A;  4DBG A;  3ZTC A;  2JVC A;  1YQB A;  4YL8 A;  2GBK A;  2MQJ A;  3LDZ E;  3JYU A;  2MLB A;  4BKT A;  1WGR A;  4WAA A;  3ZO5 B;  5JH5 C;  5L83 A;  5LXH A;  1R4N I;  4B95 A;  1FXT B;  1V9J A;  2GBN A;  4IG7 B;  3RCZ A;  3WAO A;  4DHZ E;  1IYF A;  2FCM A;  1C1Y B;  4W9I A;  3PTF C;  1ZGU B;  4JIO U;  2LJ5 A;  1WI0 A;  3U7D A;  1WZ3 A;  2DZM A;  3DVN V;  1XQQ A;  5AZH A;  3A1Q A;  3APD A;  3V60 A;  2M0X A;  1GC7 A;  1WMH B;  3GZN I;  3R3M A;  4GN1 A;  1P1A A;  3DVN U;  2MCN B;  3V62 A;  1M94 A;  1WX9 A;  3R66 C;  2M1M A;  3CMM B;  4GMV A;  2L8J A;  3W1Y A;  2KX0 A;  2WX1 A;  1E8Y A;  1D3Z A;  1UZX B;  3UIN B;  1LQB A;  4K1R B;  3ZLZ A;  4HXD A;  3C0R B;  3BY4 B;  3R7Q A;  3HIZ A;  2D3G A;  2LVO A;  1X1M A;  5AZG A;  3ENE A;  2KDI A;  4HK2 A;  1C3T A;  2NVU I;  3ZNG C;  2YVC A;  2K8C A;  2IO0 B;  4KV2 A;  1G6J A;  1E90 A;  3DOW A;  2UYZ B;  4RM9 A;  3QC8 B;  2ZZP B;  3LJ3 A;  3PZD A;  2JY6 A;  2DYM A;  4B9K A;  4MH0 E;  2ZPY A;  2K8H A;  3PVL A;  2LD9 A;  3L13 A;  4GXB A;  5C23 A;  4MGZ E;  3HM3 A;  4WJQ A;  2BF8 B;  4WWO A;  3TIX A;  3VHT C;  4AP4 C;  3L0W B;  4I6L B;  3A9J B;  3PRM B;  3O65 B;  1WJ4 A;  3QQ8 B;  2HD5 B;  3ECI A;  4PYU A;  3EEC A;  4GDK B;  1V81 A;  4HWI B;  1E5W A;  5J2R A;  2MP2 A;  4G11 A;  4HDQ A;  2DAJ A;  3PLV A;  4ASW C;  1VCB A;  4NJ6 A;  1E8Z A;  3ZDM C;  4AJW A;  1J0G A;  3I3T B;  4GDK A;  3TCA A;  3APF A;  3A4R A;  1ZKH A;  4ZDV A;  2PEA A;  1E8X A;  1P0R A;  2M4N A;  2KTF A;  1RAX A;  3EHV A;  2IY0 B;  2WWZ A;  4DXA B;  1A5R A;  2BKR B;  3SHQ A;  2LGD A;  5KHO A;  1RFA A;  1EUV B;  1P98 A;  1V5T A;  1WE7 A;  1H4R A;  1NBF C;  3PHX B;  4II2 B;  1V6E A;  1WGH A;  5AZF A;  1UBQ A;  2AL6 A;  4DHJ D;  1WY8 A;  1KJT A;  4M8M A;  3H7P B;  2HJ8 A;  4WWP A;  2D11 A;  2L05 A;  4WJN A;  1WXV A;  1OEY J;  2PPH A;  4EFO A;  1TTN A;  4BBN C;  3H7P A;  5CHV C;  4CHK A;  2KN5 A;  4NAW B;  1KLV A;  2CKH B;  1PQS A;  3KVF B;  2BYE A;  3CF6 E;  1ISN A;  4M0W B;  1LFD A;  1WX8 A;  3M62 B;  3QAQ A;  2LZ6 A;  4EOY A;  4ANV A;  3Q3J A;  4NAW A;  2D2Q A;  4HVB A;  1V86 A;  3VH3 B;  1OEY A;  2MSE D;  2J0M A;  2O6V B;  4FN2 A;  2Z59 B;  1WH3 A;  1UD7 A;  2HTH A;  2KDE B;  5E6O A;  4W9L A;  3KYD D;  2GBM A;  3PV1 A;  4F1S A;  2V1Y A;  2Z0D B;  3A9K B;  3JVZ X;  2WX0 A;  2ZCB A;  3IFW B;  1H8C A;  2DHZ A;  4RM8 A;  3DQV A;  4WJO A;  2O2V B;  2JWZ A;  3B0A A;  2LRU A;  3TJP A;  4ICU A;  4PS3 A;  2GOW A;  3U8Z A;  2LRW A;  4K7W A;  5J17 A;  1SGH A;  1YIW A;  2FNJ B;  4N9F 4;  4BKS A;  2JT4 B;  4DK5 A;  2KQS A;  4X57 B;  2KD0 A;  2IO2 B;  2DX5 B;  2IO3 B;  2O2V A;  4BFR A;  4WQO B;  1SE9 A;  3QIJ A;  5D6J B;  1V80 A;  2BWF A;  4FLH A;  3QCA A;  2ZEQ A;  3PRE A;  3NZU A;  4NNJ B;  2G4S A;  1QZE A;  4GOC A;  2LXA A;  4BOZ B;  1J19 A;  4TV3 A;  2CR5 A;  2NBW B;  3DCG A;  3SD5 A;  2L76 A;  4NY0 A;  4E71 A;  1S3S G;  2ASQ A;  2L0T A;  3NHE B;  1NI2 A;  4HLE A;  1XT9 B;  3AI5 A;  1EO6 A;  3NZS A;  2J0K A;  2N4F A;  3VFK A;  1I35 A;  3A1Q B;  3EC8 A;  4MEM A;  3QJZ A;  2MW5 A;  3PRZ A;  4GSW A;  4KZC A;  2LVQ A;  3R7R A;  2JUO A;  1CMX B;  4ZRK A;  3MTN B;  3VTV A;  4AWJ A;  3V6C B;  4GGQ A;  2KDF B;  4MGY E;  2IY1 B;  2K39 A;  3IVF A;  3OJ3 A;  4FHK A;  4W9D A;  1WYW B;  3A4S C;  2K6Q A;  1OQY A;  1VD2 A;  2KWV B;  5D7G A;  3VVW B;  3ML8 A;  3APC A;  3WAL A;  2NPT A;  4BOS C;  1OGW A;  4MGK E;  3K9O B;  1WJ6 A;  3L17 A;  3W1S C;  3RZW C;  4AOF A;  2REX A;  3WA0 A;  2VRR B;  3N30 A;  2G4D B;  5G2N A;  1XD3 B;  4ANU A;  4IWP A;  1F9J A;  2CS4 A;  4I6P A;  3K9P B;  2KAN A;  1GJZ A;  2L7R A;  4PS7 A;  1E8W A;  2Y5B B;  2MRP A;  3PSE B;  3RT3 B;  1RLF A;  2FIF A;  2JZ3 B;  2KQ7 A;  3HHM A;  4FJY A;  4PS8 A;  3TBL D;  2J0J A;  2JZZ A;  3U30 A;  1TBE A;  2GMI C;  4K7U A;  1Z5S B;  2FUH B;  3V61 A;  5G55 A;  2LAS A;  2KFJ A;  3M3J A;  4FA6 A;  2IZV B;  3AU5 A;  4IUM B;  4MSM B;  4LJO B;  2MP2 B;  1MG8 A;  4IW0 A;  2IYD B;  4PYZ A;  2JRH A;  5D94 A;  1RRB A;  3V6E B;  1YX5 B;  3IHP C;  1WXA A;  3NY5 A;  4MJS A;  3RD2 A;  2CU1 A;  3B1L X;  1WGD A;  4MM3 A;  1WJN A;  2KMC A;  2RD0 A;  2KKC A;  4A3O A;  4ZRJ A;  1EF5 A;  3ZDT A;  2O6V D;  2AL3 A;  2LWP A;  4KIK B;  4EZJ A;  5EDS A;  5DCN A;  2C7N B;  4F8C B;  1UBI A;  5CHF A;  3ZW3 A;  1HE8 A;  1GC6 A;  1WM2 A;  5GMV A;  2XEW A;  4KVG B;  4BKS D;  2HE7 A;  1E7U A;  2KOX A;  3VH4 B;  4KIK A;  3GOE A;  2N9X A;  2PE9 A;  4XZ4 A;  2WDT B;  1S1Q B;  3DDC B;  1WZ0 A;  2FAZ A;  3PRP B;  4LJP B;  4IC7 B;  3ZUN A;  2BPS A;  2KLG A;  2DYO A;  2RSU A;  1UEL A;  3ZRC A;  1YX6 B;  2ZCC A;  5JHB A;  1TGZ B;  2N9E B;  4RMA A;  2OOB B;  3VAW A;  2K1F A;  4B6W A;  1WXS A;  2DAF A;  3OLM D;  3DBR I;  3WAP A;  2ZPN A;  1Q5W B;  3N3K B;  1WRD B;  3QK0 A;  2MBO A;  2MWS B;  4XC2 A;  2MX2 A;  4DWF A;  2L3Z A;  3ONS A;  3PGE A;  4NQK E;  4W9E A;  2KC2 A;  1KOT A;  5IA7 A;  2I1K A;  2LUE A;  2MBQ A;  3T9L A;  1Q1O A;  2FCN A;  2N7E A;  3MJW A;  1GUA B;  5DPT A;  5LXI B;  2ZJD A;  3OAW A;  2L0F A;  5IAA C;  1KM7 A;  2IO1 B;  4W9J A;  1V49 A;  2KFK B;  3UIP B;  4URK A;  2C9W B;  3A33 B;  2EMT A;  4KZ0 A;  4DHZ B;  4ANX A;  4MSQ B;  3CSF A;  4W9K A;  1WGY A;  2CHZ A;  4JLC A;  2NS5 A;  4HCP B;  2KFK A;  2AWT A;  1YD8 U;  3ALB A;  2FCQ A;  3WAM A;  4J6I A;  3TL5 A;  1Y8R C;  3D32 A;  2OJR A;  1L2N A;  2PJH A;  4ICV A;  2DYB A;  4II3 B;  1ZW7 A;  2KJR A;  1U4A A;  2NBV B;  3ZVV A;  1P3Q U;  1EF1 A;  2ZNV B;  3QWZ B;  3ZRF A;  2RR9 A;  3L54 A;  4XX5 A;  5CHW A;  3WIM A;  4CO7 A;  4W9F A;  4E74 A;  4K81 A;  2PE6 B;  4GB9 A;  3B08 A;  2K25 A;  5DPS A;  2ZVO A;  1I42 A;  4NJ7 A;  2KDB A;  4E3C A;  2MBE A;  5KHQ A;  1UGM A;  3L10 B;  4IM0 A;  5J18 A;  2BYF A;  1JRU A;  3H6N A;  2KWC A;  1NDD A;  4EZL A;  3IBE A;  1WX7 A;  3UIO B;  3VXW A;  1T0Y A;  2N9P C;  4ZYN A;  2KHW B;  4OVU A;  2KLC A;  2GBJ A;  2AEH A;  2K6D B;  2KXJ A;  4K7S A;  3JSV B;  4EUT A;  3DVG X;  1WF9 A;  2RGF A;  5BO4 B;  2NPT B;  4FHJ A;  3CST A;  2A4Z A;  2KNB A;  4HCN B;  2NBU A;  4HJK A;  4KSL C;  4KSK C;  4HDO A;  4A20 A;  2I1J A;  3DBH I;  1V5O A;  1Q0W B;  2JF5 A;  3JSV A;  4OVV A;  2BGF A;  2A5U A;  2CHX A;  2RPQ A;  2EMS A;  2C7H A;  3ZNZ B;  4ZRI A;  3ZKJ C;  1WJU A;  3P2B A;  4TKN A;  2N1V A;  4AJY B;  4FUL A;  3SDL C;  3M95 A;  2D07 B;  2MBH A;  4NQL B;  4BKG A;  3HK0 A;  2M17 A;  3H9D A;  3RYT A;  3S2A A;  1E7V A;  2QHO A;  2L00 B;  2G3Q B;  4JL9 A;  3ZIM A;  3KUZ A;  3WAN A;  4JQW C;  4EKU A;  1YJ1 A;  3VDZ A;  4MGI E;  1WMH A;  2LGX A;  2MBB B;  3H7S A;  2C5L C;  2GBR A;  5JHA A;  4IM3 A;  4G3X B;  4LDT D;  4M8N A;  2JRI B;  3OJ4 B;  2N7D A;  1J8C A;  2LGY A;  5FR6 A;  4MJS B;  1K8R B;  2NR2 A;  3PHW B;  3W1S A;  1V2Y A;  3AU4 A;  3QAR A;  3ZNH B;  1TZ1 A;  2KWU B;  1WM3 A;  3PS6 A;  3UGB B;  3KUD B;  5DPR A;  3RUI B;  4FJV B;  2BWE S;  3VUW A;  2XBB C;  3L08 A;  4W9C A;  3N32 A;  4CYE A;  3AXC A;  1P9D U;  2EKE C;  5TR5 A;  4FBJ B;  4WJP A;  4TQ0 A;  2AYO B;  4WWN A;  3KYC D;  4IM2 A;  4GIV A;  2KTR B;  1WIA A;  3BIN A;  3VTU A;  2N1W A;  1R4M I;  3Q3F A;  4P7I A;  4I6N B;  3JW0 X;  4DDG D;  4G0N B;  5L95 C;  2CHW A;  2BYV E;  2KMA A;  3HM6 X;  2R2Q A;  4GDL B;  4GU2 A;  2MA9 B;  2KTR A;  4MEL A;  5C1Z A;  3A9J A;  4HPM B;  2B3A A;  3MHS D;  3RZF A;  3DVG Y;  2YLM A;  2JXX A;  3VUX A; 
#chains in the Genus database with same CATH topology
 5LLI A;  4GDL A;  3H8H A;  2WXI A;  2ZVN A;  4IKG A;  3UF8 A;  1WR6 E;  4NPN A;  3AUL A;  1TS5 A;  1MFW A;  4IWO A;  3E56 A;  2C60 A;  1WE6 A;  3M63 B;  1J7A A;  1GNU A;  3J9C A;  4A3P A;  2UWQ A;  1WR1 A;  4EEW A;  2LXC A;  2KO3 A;  3AE7 B;  1FCC C;  3GB1 A;  1LO5 D;  4M0W A;  4N58 A;  2XK5 B;  3EFU A;  3VTW A;  2IGD A;  4TQ1 A;  2LGS A;  1ZDV A;  1N63 A;  4GLS C;  2Z0E B;  4DDI D;  1L7Y A;  1IPG A;  4JPS A;  1V1O A;  1WSP A;  3Q8A A;  3ZTC A;  1C4P A;  3MHZ A;  4O1N A;  3RNB C;  1V9J A;  4DHZ E;  1VZ7 A;  1QOF A;  3PTF C;  3U7D A;  1XCT L;  3DVN V;  5IN7 A;  5AZH A;  3APD A;  1WMH B;  3R3M A;  5BYR A;  3V62 A;  1YJI A;  2K5P A;  4WAF A;  3R66 C;  2QJL A;  2KX0 A;  2WX1 A;  1VZ8 A;  4TMA B;  2W3S A;  1D3Z A;  2SEB D;  1AW7 A;  3C0R B;  1STE A;  4NAM A;  1TZO A;  2KDI A;  1UF0 A;  3ZNG C;  2IO0 B;  1G6J A;  1KTK A;  3LJ3 A;  3PZD A;  2DYM A;  3DHH C;  3NVW A;  2ZPY A;  3L13 A;  4GXB A;  4JWS C;  4WWO A;  2BF8 B;  1F2R I;  2LHD A;  3PRM B;  3O65 B;  4OZB A;  1WJ4 A;  3EGR A;  3ECI A;  4PYU A;  5H92 C;  4LNN A;  3R2T A;  3PLV A;  2KVZ A;  1NVI D;  1J0G A;  3TCA A;  1ZKH A;  2PEA A;  4ZRQ A;  1D6E C;  1GB1 A;  2W54 A;  2IY0 B;  2WWZ A;  1A5R A;  2BKR B;  5KHO A;  1EUV B;  1P98 A;  1V5T A;  3B2F A;  4K3B A;  1H4R A;  2I2Y A;  1PFD A;  4DHJ D;  1WY8 A;  1Q10 A;  1TS3 A;  2ZW0 A;  3H7P B;  4C4V B;  1WXV A;  2GLS A;  2KN5 A;  1KLV A;  3KWL A;  2CKH B;  3KVF B;  3CF6 E;  2JYT A;  4OZA A;  1WX8 A;  3M62 B;  4HVB A;  1V86 A;  4US9 A;  2INN E;  2J0M A;  3AM9 A;  1RM6 C;  3GE3 C;  4H2A A;  2MJ3 A;  2Z59 B;  2KDE B;  4W9L A;  2GBM A;  3URY A;  2V1Y A;  2Z0D B;  3A9K B;  1H8C A;  2DHZ A;  4WJO A;  1L0Y B;  3B0A A;  3TJP A;  4PS3 A;  1YQ4 B;  2LRW A;  4K7W A;  1YIW A;  2JT4 B;  4DK5 A;  4KGT A;  2KD0 A;  2IO2 B;  2DX5 B;  2O2V A;  3QIJ A;  5D6J B;  1V80 A;  3DWG C;  4FLH A;  1DOY A;  1FXA A;  2VZK B;  4TV3 A;  2CR5 A;  3Q69 A;  3TEZ A;  1S3S G;  2KWD A;  1C4A A;  1OQR A;  1XT9 B;  1HTO A;  2N4F A;  1I35 A;  3EC8 A;  1JRP A;  2IPK D;  4KZC A;  2LVQ A;  3R7R A;  2JUO A;  4GGQ A;  3MFG A;  2RPV A;  3AEF B;  2K6Q A;  3ML8 A;  1TIF A;  2R61 A;  3L17 A;  5I4D A;  2Z8L A;  1XD3 B;  4IWP A;  3K9P B;  1L6V A;  2PTL A;  3NVY A;  3GP7 A;  4A90 A;  1E8W A;  3RT3 B;  1TYG B;  3NRZ A;  2FIF A;  1BUI C;  3TBL D;  2J0J A;  2JZZ A;  3U30 A;  2GMI C;  2FUH B;  3MC0 B;  3AU5 A;  4IUM B;  1PDX A;  4IW0 A;  3L4P A;  1MPE A;  4S17 A;  4Q2J A;  4A3O A;  3FIL B;  4ZRJ A;  1HTQ A;  3RI7 C;  4MH8 A;  3BVG A;  2KAC A;  2KOX A;  1E7U A;  2WXK A;  3ZJV A;  3SR6 A;  4KIK A;  2WDT B;  3C19 A;  3P4P B;  1WZ0 A;  2FAZ A;  1PUT A;  5EE1 A;  2BYT A;  2X38 A;  4IC7 B;  3ZRC A;  3B2G A;  2ZCC A;  2N9E B;  2K1F A;  3TEW A;  2Y5C A;  1C9F A;  2PVO D;  5AUK A;  2MBO A;  4XC2 A;  2MX2 A;  3UI3 A;  4DWF A;  3TEY A;  1TKY A;  2KC2 A;  2JSV X;  2EKI A;  2LUE A;  2MBQ A;  3T9L A;  2N7E A;  1GUA B;  4S0R A;  5DPT A;  3N20 C;  2PW9 A;  2L0F A;  2WNM A;  1KM7 A;  2W82 A;  4DHZ B;  3FC4 A;  4ANX A;  4W9K A;  1SE3 A;  2BS3 B;  2CJO A;  4YWG G;  1I4P A;  4IDI A;  3D32 A;  2WGS A;  1JWS D;  4XYC A;  1U4A A;  1IGD A;  4XX5 A;  5CHW A;  4USA A;  1TY2 A;  1T5X D;  1NEK B;  5DPS A;  1QQR A;  2ZVO A;  4HKQ A;  1I42 A;  2LMC A;  4YTP B;  3L10 B;  5J18 A;  2BYF A;  1JRU A;  3UIO B;  3VXW A;  4XWT A;  3BK1 A;  2KHW B;  4OVU A;  4EUT A;  5BO4 B;  4YXD B;  4FHJ A;  2NBU A;  2SAK A;  2I1J A;  3GZN B;  2RPQ A;  2EMS A;  4ZRI A;  4TKN A;  2LHE A;  4FUL A;  3SDL C;  2D07 B;  4NQL B;  4RF0 A;  3RNG C;  4ITK A;  3S2A A;  3ZIM A;  3WAN A;  4EKU A;  4US8 A;  3AE6 B;  2E3T A;  4LNF A;  3W2D A;  2LGX A;  2MBB B;  4CQN A;  4G3X B;  4LDT D;  2JRI B;  3OJ4 B;  5FR6 A;  2VH1 A;  1K8R B;  3PHW B;  3U2S C;  1YQ3 B;  3Q6B A;  3PS6 A;  4A55 A;  1DGJ A;  3KUD B;  4DQO C;  4YT0 B;  4FJV B;  2WXO A;  1N6Z A;  2EKE C;  4GIV A;  2Y5P A;  3ZJU A;  3AEC B;  1MG4 A;  3JW0 X;  5L95 C;  2CHW A;  4GDL B;  3AEG B;  2MA9 B;  4YTN B;  2N9K A;  3A9J A;  3FAH A;  3VUX A;  1BT0 A;  4LDT B;  2JQR B;  2KC1 A;  2BBC A;  2JYE A;  5CX3 A;  3I63 C;  1AAR A;  2BB6 A;  3ML9 A;  3IG3 A;  2B76 B;  1WGG A;  2MHJ A;  5BMG A;  4TUU A;  5JZE B;  3W9C B;  1EWC A;  1UH6 A;  2IBI B;  2R2O A;  2BKF A;  2DZI A;  4JGH B;  1HEZ E;  3PPA A;  2NTT A;  1HZ6 A;  2C7M B;  2WU5 B;  3ZTD A;  4W9H A;  4BBN F;  2KVR A;  3X23 A;  2DZK A;  2DWQ A;  2FID A;  4ACF A;  2D3B A;  2KK8 A;  1D4B A;  4FJZ A;  2DEN B;  5DPW A;  4LTU A;  5E6P A;  3SU8 X;  2V4L A;  3TMP B;  3VUY A;  2E6X A;  1I4H A;  1JW9 D;  3KH0 A;  3T8M A;  1JWU D;  4OVZ A;  2J7Q B;  3N1Z C;  2KJH B;  2KX3 A;  1PGB A;  3KW5 B;  1JQ4 A;  3DPD A;  5BYQ A;  1J7C A;  3JYU A;  4BKT A;  3ZO5 B;  3AE4 B;  1TKG A;  1FXT B;  2GBN A;  3RCZ A;  5IO9 A;  2FCM A;  2WLB A;  3B9J A;  3TSS A;  1SE2 A;  2LUM A;  2LJ5 A;  1AYF A;  1WI0 A;  1RYJ A;  1V97 A;  3A1Q A;  2M0X A;  4GN1 A;  3AMZ A;  3GZN I;  1E10 A;  3P4S B;  3DVN U;  1M94 A;  1WX9 A;  2L8J A;  3UIN B;  4K1R B;  2D3A A;  3BY4 B;  5BYS A;  1C77 A;  3ENE A;  1C3T A;  5IKC M;  3MC9 A;  4L1B A;  1QT9 A;  4RFB A;  2V9H A;  2UYZ B;  4L23 A;  1F2R C;  2JY6 A;  3VR8 B;  2K8H A;  2INP E;  4M00 A;  2EEL A;  4AP4 C;  2QIE B;  1L6U A;  4I6L B;  2V3P A;  1M4V A;  3EEC A;  4C7Z A;  4HDQ A;  2DAJ A;  4NJ6 A;  5BMI A;  1E8Z A;  3N1Y C;  3A4R A;  1XO3 A;  3ABV B;  2LGD A;  3DBR B;  3BZD B;  1FRR A;  3HUI A;  4II2 B;  1V6E A;  2AL6 A;  4WWP A;  2D11 A;  2L05 A;  3AE9 B;  4LNK A;  1TTN A;  1LFD A;  3LB8 C;  4LNI A;  2LZ6 A;  4EOY A;  4KGS A;  4ANV A;  1XF5 L;  2K0P A;  3Q3J A;  1HZ5 A;  4FXC A;  3AED B;  5GXG B;  3VH3 B;  2O6V B;  1T0R C;  1WH3 A;  4C80 A;  3KYD D;  1FFU A;  3IFW B;  2KQ4 X;  4KX6 B;  2O2V B;  2YEP B;  3U8Z A;  1P7F A;  4ICU A;  2GOW A;  2ONQ A;  1SGH A;  1N61 A;  2FNJ B;  5LNK 1;  1QOA A;  4N9F 4;  3CIR B;  4BAX A;  1XLQ A;  1QOB A;  2KQS A;  4X57 B;  4WQO B;  1SE9 A;  1WRI A;  4KKJ A;  2ZEQ A;  4PT5 A;  4NNJ B;  1DOX A;  2LXA A;  2L76 A;  1NI3 A;  1C78 A;  3AH7 A;  4NY0 A;  1FFV A;  2L0T A;  3AI5 A;  2J0K A;  3DBH B;  4MEM A;  3QJZ A;  3ZQ4 A;  5MPO A;  1CMX B;  1PYW D;  1R4N B;  4AS1 A;  3VTV A;  3V6C B;  3IVF A;  4W9D A;  1JWM D;  2D5G A;  3A4S C;  1OQY A;  2KWV B;  3VVW B;  1AWD A;  3APC A;  2BS2 B;  1OGW A;  4MGK E;  3K9O B;  5BMH A;  3NS1 A;  3W1S C;  3Q8C A;  2REX A;  4AOF A;  2VRR B;  2QDF A;  5HG2 A;  2G4D B;  3LXF A;  3P4R B;  1F9J A;  4I6P A;  3R2I A;  1GJZ A;  5FR3 A;  2KMM A;  2L7R A;  1MHX A;  2Y5B B;  3BYY B;  2MRP A;  3V05 A;  4PS8 A;  4C56 C;  2DNF A;  1TBE A;  1ENF A;  3V61 A;  3LYY A;  5G55 A;  2LAS A;  2KFJ A;  4FA6 A;  2IZV B;  2FE8 A;  2MP2 B;  4PYZ A;  5IOI A;  4ARC A;  3IHP C;  1WXA A;  3AE2 B;  3RD2 A;  3B1L X;  4HPP A;  1WJN A;  2AL3 A;  5EDS A;  4KIK B;  4WUR A;  1ZP0 B;  1HE8 A;  1GC6 A;  3ZJT A;  2IND C;  4KVG B;  4BKS D;  3BWU D;  1EU3 A;  1ZXI A;  1VJK A;  1N62 A;  1ZPS A;  4LJP B;  3NZ3 A;  5IP4 D;  3DHI C;  1MJD A;  2MJE A;  3ZUN A;  2BT6 A;  2QSD A;  2DYO A;  2QCZ A;  2NMQ A;  3IXS A;  1TGZ B;  2ICI A;  2OOB B;  4B6W A;  3DBR I;  3WAP A;  2VZK D;  2ZPN A;  1FRD A;  1GAQ B;  2RMM A;  5IA7 A;  1Q1O A;  5LXI B;  4YSZ B;  2IO1 B;  4W9J A;  3UIP B;  4JWU C;  2C9W B;  4URK A;  2CHZ A;  4JLC A;  2AQ2 B;  2KFK A;  2AWT A;  1ACC A;  1Y8R C;  4ICV A;  1A70 A;  1ZW7 A;  1UGJ A;  2JWU A;  2KJR A;  2NBV B;  3ZVV A;  3HVD A;  1WXQ A;  1EF1 A;  2ZNV B;  3ZRF A;  2RR9 A;  2YEP F;  4CO7 A;  4W9F A;  4K81 A;  4GB9 A;  3B08 A;  4NJ7 A;  2J53 A;  3RN9 C;  2MBE A;  5TSS A;  3H6N A;  3ZGZ A;  2KLC A;  4XDD A;  2GBJ A;  2AEH A;  2IGG A;  2KXJ A;  5HI1 A;  2BW2 A;  2NPT B;  2KNB A;  4HJK A;  4KSL C;  1SE4 A;  4HDO A;  3DBH I;  1V5O A;  1Q0W B;  1TS2 A;  2JF5 A;  3JSV A;  2BGF A;  4HEA 1;  2A5U A;  4TSS A;  2CHX A;  3MP9 A;  3ZNZ B;  3SEB A;  3P2B A;  3M95 A;  3AB5 A;  1PGA A;  4ZHP A;  4BKG A;  2M17 A;  5D3I B;  3RYT A;  1E7V A;  2L00 B;  5G5H A;  4EE2 A;  5HHD G;  4B0E A;  4LK0 M;  1K53 A;  2VH2 A;  1WMH A;  1SB3 C;  3H7S A;  4IM3 A;  4XGA B;  4MJS B;  3W1S A;  1V2Y A;  4P16 A;  3ZNH B;  1TZ1 A;  1UUP A;  2KWU B;  3W5U B;  1I4X A;  4C00 A;  1WM3 A;  2W55 A;  3Q14 C;  2WXH A;  2PVG C;  3RUI B;  1XEE A;  2WXN A;  4W9C A;  1B9R A;  4CYE A;  3AXC A;  5TR5 A;  4LNO A;  4FBJ B;  2AYO B;  4IM2 A;  3BII D;  3R8B A;  4BZA A;  3WCQ A;  2XNA C;  4P7I A;  4G0N B;  2BYV E;  2KTR A;  4J3O D;  1V8C A;  2N7J A;  2KYW A;  1VZ6 A;  2RDB C;  1BXT A;  3SFE B;  2OED A;  3QX1 A;  2LVP A;  3QA8 A;  2DZJ A;  5CTR C;  1PGX A;  1SIF A;  1EM7 A;  1YJJ A;  2KN4 A;  3PT2 B;  3H1U A;  2AX5 A;  2NCN A;  1CJE A;  2K8B A;  5HKH A;  4FAD A;  4RGO S;  1HQR D;  1JAL A;  1F77 A;  2IDY A;  2KT7 A;  3UQB A;  3VR9 B;  4F7Z A;  4AQ7 A;  1D5M C;  3RUL A;  2G9H D;  1DYQ A;  1LM8 B;  1WFY A;  1V1P B;  1LXD A;  1IP9 A;  1WXM A;  4AUQ C;  4KDL B;  5AEK B;  3NOB A;  4B0M A;  1FNV A;  1ZXH A;  3E9S A;  2KJ6 A;  3A9K A;  1Z2M A;  1FPY A;  3ZNI D;  1WGK A;  1MI0 A;  3T3O A;  4W9G A;  3VQI A;  3RPF C;  3KQ4 A;  3QHT A;  3X0W A;  2GI9 A;  3AEB B;  2JVC A;  3DHG C;  2MQJ A;  1WGR A;  4WAA A;  5JH5 C;  5L83 A;  5LXH A;  4B95 A;  4XDC A;  2V0G A;  3WAO A;  4IG7 B;  1IYF A;  2L32 A;  4W9I A;  1T3Q A;  2J52 A;  1T0Q C;  1D5Z C;  1ZGU B;  4NJC A;  1XQQ A;  4HKZ E;  4NZL B;  1C4C A;  2MCN B;  3SFD B;  3RNA C;  2KAJ A;  4HRS A;  4GMV A;  1NYR A;  2M1M A;  3CMM B;  3W1Y A;  1E8Y A;  1UZX B;  1LQB A;  4HXD A;  3HIZ A;  1X1M A;  2MEK A;  1K52 A;  2JU6 X;  2NVU I;  2YVC A;  1QF6 A;  4KV2 A;  3DOW A;  4RM9 A;  1I4Q A;  3NG0 A;  3VRA B;  1KFY B;  1KRH A;  4MH0 E;  3BK2 A;  2LD9 A;  4MGZ E;  4WJQ A;  3VHT C;  4RCO A;  3RNF C;  2HJ1 A;  2DLB A;  3QQ8 B;  2M0A A;  1F0Z A;  3BVM A;  1E5W A;  3OG5 A;  5J2R A;  4G11 A;  4ASW C;  4RGN A;  1VCB A;  3NVV A;  1QIL A;  4GDK A;  1LGR A;  1R7S A;  3APF A;  4ZDV A;  1IUE A;  1E8X A;  2PMV A;  4DXA B;  5AUI A;  2WXR A;  3W5V B;  3FIL A;  2H88 B;  3SHQ A;  1F52 A;  1IGC A;  1WE7 A;  1NBF C;  3PHX B;  1KJT A;  1WYG A;  2HJ8 A;  1N5W A;  1NEN B;  4EFO A;  4CHK A;  2PKO A;  4M0W B;  3EFC A;  1P7E A;  1YN4 A;  3AN1 A;  4NAW A;  2V3N A;  2Q5W D;  3KLS X;  1OEY A;  2MSE D;  1FNW A;  4MT5 A;  2M19 A;  2N0S B;  3AE8 B;  1UD7 A;  1T6B X;  2WX0 A;  3PO0 A;  4RM8 A;  3DQV A;  1FEH A;  5J17 A;  1L4D B;  3MC8 A;  3AEE B;  4BFR A;  2IO3 B;  3N9Y C;  1FXI A;  3QCA A;  2INC C;  3P42 A;  3NZU A;  2G4S A;  1KH0 A;  2AQ1 B;  4BOZ B;  1DOI A;  2NBW B;  4E71 A;  2ASQ A;  3I9V 1;  2K9X A;  1NI2 A;  3NZS A;  1I4G A;  4RGM A;  2L1A A;  3VFK A;  2MW5 A;  4GSW A;  1OFF A;  2ON8 A;  2IY1 B;  3ETR A;  3RNC C;  3OJ3 A;  1WYW B;  3MJ5 A;  1VD2 A;  5D7G A;  4HRO A;  2G1E A;  2LFI A;  1WJ6 A;  3N30 A;  5G2N A;  1XLP A;  4ANU A;  1KLU D;  4PS7 A;  2WXF A;  1F1H A;  4WIP A;  1RLF A;  2KQ7 A;  1QKZ A;  1J7B A;  3P1M A;  1UWX A;  2WXL A;  1E7P B;  2JRH A;  3T3N A;  1RRB A;  2D3C A;  1YX5 B;  1WGD A;  4MM3 A;  1GPX A;  2KMC A;  2KKC A;  3ZDT A;  1KLG D;  2O6V D;  1JWA D;  4EZJ A;  4ZYS A;  5DCN A;  2C7N B;  4F8C B;  2WXQ A;  1UBI A;  3Q3M C;  3ZW3 A;  1CZP A;  1WM2 A;  5GMV A;  2HE7 A;  5E6J A;  3HVZ A;  3GOE A;  2LGI A;  2PE9 A;  3DDC B;  3PRP B;  4YSY B;  2GB1 A;  2BPS A;  2KLG A;  1UEL A;  4KKI A;  1FM0 D;  3OLM D;  1RWS A;  4RGT A;  2BB5 A;  2L3Z A;  3PGE A;  4NQK E;  4W9E A;  1ET9 A;  2I1K A;  3AE5 B;  3MJW A;  2WS3 B;  2X8X X;  5EE3 A;  1IBX A;  3DBL B;  3RNE C;  5IAA C;  4D2K A;  1V49 A;  2KFK B;  3A33 B;  2EMT A;  4KZ0 A;  4A8X C;  3CSF A;  4HCP B;  4QAY A;  4PK1 A;  3ALB A;  4J6I A;  3TL5 A;  1JWB D;  1GB4 A;  4II3 B;  2OJW A;  3I57 A;  1P3Q U;  3QWZ B;  1JML A;  4E74 A;  2IJ0 A;  1YN5 A;  2K25 A;  4WWM A;  1UWM A;  1UNS A;  1Y56 A;  1UGM A;  4IM0 A;  4P1C C;  2N9L A;  2RDG A;  1N60 A;  1YOV B;  2JX5 A;  2N9P C;  4ZYN A;  2K6D B;  3PZ8 A;  4K7S A;  3JSV B;  4A6Q A;  1WF9 A;  2RGF A;  2LEK A;  4HCN B;  3Q3O C;  1SEB D;  4KGR A;  3ZKJ C;  2N1V A;  4K3C A;  1TJE A;  4N6E B;  1E0Z A;  2MBH A;  3HK0 A;  1SF0 A;  2QHO A;  1MHH E;  4JQW C;  4MGI E;  1SXT A;  2GBR A;  1JCK B;  2N7D A;  1J8C A;  2LGY A;  3TEX A;  1FD6 A;  3AU4 A;  4XE0 A;  3UGB B;  2L83 A;  2J42 A;  5DPR A;  3P63 A;  1C79 A;  2BWE S;  3VUW A;  2XBB C;  3L08 A;  4RNA A;  2JXT A;  4WJP A;  1SJE D;  3EUB 2;  3AV8 A;  3KYC D;  4WWN A;  3U4E G;  2KTR B;  3U52 E;  3BIN A;  5C3J B;  4ZHO A;  5FKA C;  4DDG D;  4GU2 A;  2KMA A;  3HM6 X;  1D5X C;  3AE1 B;  3RZF A;  3DVG Y;  1QOG A;  4HPL B;  3NS8 A;  2V4I B;  5E6N A;  4DXG A;  4KDI C;  4DXF A;  3L16 A;  1L0X B;  1OTR B;  4IWQ A;  4M01 A;  3ZYY X;  3NVZ A;  1L4Z B;  3ZXV A;  1L5P A;  4G50 A;  4ANW A;  4WH4 A;  3UQA A;  4LCD E;  2M8S A;  3KUC B;  5HFY A;  4JX1 C;  2KZR A;  3DBL I;  2Y3A A;  5D2M B;  4EZK A;  5T8I A;  4MAC A;  3PLU A;  2D10 A;  2V3S A;  2WDV B;  1EU4 A;  2IGH A;  2W9N A;  3DWM A;  2JPH A;  2FBW B;  2ZNV C;  2BVC A;  2WYQ A;  3I5J C;  2XK5 A;  2O6V A;  1SBB B;  3DBS A;  4MDK E;  2G45 B;  1VRA B;  1XCQ L;  1GG3 A;  2LI5 A;  4DHJ B;  3V3X A;  2FCS A;  1AN8 A;  4BVU C;  4DBG A;  4P6V F;  1YQB A;  4YL8 A;  2GBK A;  2WXM A;  3LDZ E;  2MLB A;  5EE0 A;  1R4N I;  1C1Y B;  2JZP A;  1HXY D;  4JIO U;  1WZ3 A;  2DZM A;  3U7Z A;  2FUG 1;  3V60 A;  1GC7 A;  1TS4 A;  1P1A A;  2WXP A;  3CWI A;  2WDQ B;  4YSX B;  3ZLZ A;  3R7Q A;  2D3G A;  1VR9 A;  2LVO A;  5AZG A;  2BTE A;  4HK2 A;  2WU2 B;  1ESF A;  4L2Y A;  2K8C A;  4HJG E;  1TY0 A;  1E90 A;  3QC8 B;  2ZZP B;  4B9K A;  2QIL A;  3PVL A;  5C23 A;  2OHF A;  3HM3 A;  4M02 A;  1OQQ A;  3TIX A;  3L0W B;  3A9J B;  2PLP A;  2HD5 B;  4GDK B;  1V81 A;  4HWI B;  2MP2 A;  3VRB B;  2AQ3 B;  3BVZ A;  4ZRP A;  3ZDM C;  4AJW A;  2MJD A;  3I3T B;  4XWW A;  3IAS 1;  3RFZ B;  1P0R A;  2M4N A;  2KTF A;  1RAX A;  3EHV A;  2TSS A;  1SIJ A;  3BYT B;  3N1X C;  1NYQ A;  3OWE B;  1B1Z A;  1RFA A;  1WWT A;  2HTM E;  1WGH A;  5AZF A;  1UBQ A;  4M8M A;  3GE8 C;  3Q8B A;  4WJN A;  3FKY A;  2CJN A;  1I4R A;  1OEY J;  2PPH A;  4BBN C;  3H7P A;  5CHV C;  4NAW B;  4C4V A;  1PQS A;  2BYE A;  1ZDX A;  1ISN A;  1E6E B;  2DBY A;  4N59 A;  3QAQ A;  2RDH A;  2D2Q A;  3Q3N C;  1MVK A;  4FN2 A;  3AE3 B;  2HTH A;  5E6O A;  5H8Y E;  1SSN A;  1YN3 A;  3PV1 A;  3Q8E A;  4F1S A;  3JVZ X;  2KDM A;  2ZCB A;  2JWZ A;  2LRU A;  1C76 A;  4BKS A;  3KWV A;  2BWF A;  3PRE A;  1ZUD 2;  1QZE A;  1CQV A;  4GOC A;  1J19 A;  4UDU C;  3SD5 A;  3DCG A;  2NTS A;  3NHE B;  4HLE A;  1EO6 A;  4ARI A;  3A1Q B;  1XLO A;  3PRZ A;  4ZRK A;  3MTN B;  4AWJ A;  2KDF B;  4MGY E;  2K39 A;  1GOZ A;  4FHK A;  2GRI A;  1HA5 A;  3IAM 1;  1FMA D;  3WAL A;  2NPT A;  4OW0 A;  4BOS C;  4C7Y A;  1T0S C;  3RZW C;  3WA0 A;  2MH7 A;  3Q8F A;  2CS4 A;  2I38 A;  2KAN A;  1FCL A;  2WHI A;  2ACZ B;  3PSE B;  2XN9 C;  2JZ3 B;  3HHM A;  2LJI A;  4IOI E;  2HDE A;  4FJY A;  3RMK C;  1FNU A;  4K7U A;  1Z5S B;  1BML C;  2WQY B;  3M3J A;  5JXV A;  1FIQ A;  4MSM B;  4LJO B;  1MG8 A;  2IYD B;  3P4Q B;  4MM3 B;  5D94 A;  2WDR B;  1VLB A;  3V6E B;  3NY5 A;  1K51 A;  4OHJ A;  3IT4 B;  3TUO A;  4MJS A;  2CU1 A;  1R4M B;  2RD0 A;  1EF5 A;  2LWP A;  5CHF A;  4JE3 B;  2XEW A;  3VH4 B;  3IT6 B;  3Q2A C;  3NJT A;  2N9X A;  4XZ4 A;  1S1Q B;  1ZE3 D;  3C8Y A;  2RSU A;  5EE9 A;  1YX6 B;  3GS2 A;  5JHB A;  1YNT E;  4RMA A;  3VAW A;  1WXS A;  2DAF A;  1Q5W B;  2K22 A;  3N3K B;  4REZ A;  1WRD B;  3QK0 A;  4YTM B;  1JRO A;  2MWS B;  2WP9 B;  2BQQ A;  1IBX B;  3ONS A;  1KOT A;  1ZOY B;  2FCN A;  2ZJD A;  3OAW A;  5G5G A;  4R3D A;  2H89 B;  3AEA B;  2QC8 A;  2QMT A;  4MSQ B;  4A9A A;  1WGY A;  2NS5 A;  1YD8 U;  3O13 A;  2FCQ A;  3WAM A;  1L2N A;  2OJR A;  1FO4 A;  2PJH A;  2QEJ C;  2DYB A;  1K50 A;  1XLN A;  1TKE A;  4RF1 A;  3L54 A;  3WIM A;  1SJH D;  2PE6 B;  3NUH B;  1VDV A;  2M56 B;  1CK1 A;  2KDB A;  4E3C A;  5KHQ A;  3HRD D;  1V1P A;  3PZ7 A;  2W3R A;  2KWC A;  1NDD A;  4EZL A;  2UU7 A;  3IBE A;  1WX7 A;  2L52 A;  1T0Y A;  1RFK A;  3DVG X;  1EWY C;  3CST A;  3ZXR A;  2A4Z A;  4KSK C;  4A20 A;  4OVV A;  1ROE A;  2C7H A;  1WJU A;  1E9M A;  4P1B C;  4AJY B;  4ZOH C;  2PIA A;  4OZC A;  5FK9 C;  3H9D A;  2G3Q B;  4JL9 A;  3KUZ A;  1YJ1 A;  3VDZ A;  1TT5 B;  2C5L C;  2CU3 A;  5JHA A;  4M8N A;  1ET6 A;  2K3U A;  1KF6 B;  2ZW1 A;  2NR2 A;  1N5X A;  3QAR A;  4RH6 A;  2J4X A;  5D3D A;  4LLG M;  1I7H A;  1QLB B;  3N32 A;  1P9D U;  4TQ0 A;  5C2T B;  1YMH E;  1WIA A;  3VTU A;  1XXG A;  2WXJ A;  2N1W A;  1R4M I;  3EA6 A;  3Q3F A;  4I6N B;  1L0V B;  2WXG A;  2R2Q A;  4MEL A;  5C1Z A;  4WQM A;  4HPM B;  2B3A A;  2BS4 B;  3MHS D;  2YLM A;  2JXX A; 
#chains in the Genus database with same CATH homology
 5LLI A;  4HPL B;  4GDL A;  3NS8 A;  1BT0 A;  5E6N A;  4LDT B;  2KC1 A;  3QX1 A;  4KDI C;  2LVP A;  3L16 A;  3QA8 A;  2ZVN A;  1OTR B;  4IWQ A;  5CX3 A;  2DZJ A;  3UF8 A;  5CTR C;  1AAR A;  1WR6 E;  4NPN A;  3AUL A;  4IWO A;  1SIF A;  3ML9 A;  3IG3 A;  1WGG A;  4G50 A;  2C60 A;  1WE6 A;  3M63 B;  4ANW A;  4TUU A;  1GNU A;  3PT2 B;  5JZE B;  3H1U A;  4A3P A;  2NCN A;  1UH6 A;  3UQA A;  4LCD E;  2M8S A;  2UWQ A;  2IBI B;  2K8B A;  3KUC B;  1WR1 A;  4EEW A;  2R2O A;  5HKH A;  4FAD A;  2BKF A;  2KZR A;  2DZI A;  2KO3 A;  2LXC A;  3DBL I;  4JGH B;  5D2M B;  3PPA A;  2C7M B;  3UQB A;  4EZK A;  4F7Z A;  3PLU A;  2D10 A;  2V3S A;  3ZTD A;  4W9H A;  4BBN F;  2KVR A;  3X23 A;  2DZK A;  2FID A;  2W9N A;  2JPH A;  2KK8 A;  3RUL A;  2XK5 B;  4FJZ A;  2DEN B;  5DPW A;  3EFU A;  3VTW A;  5E6P A;  3SU8 X;  1LM8 B;  2ZNV C;  1WFY A;  2V4L A;  4TQ1 A;  1LXD A;  1IP9 A;  1WXM A;  4AUQ C;  4KDL B;  5AEK B;  3TMP B;  2WYQ A;  3VUY A;  2XK5 A;  3NOB A;  2O6V A;  2Z0E B;  4DDI D;  3DBS A;  4MDK E;  2G45 B;  2KJ6 A;  3A9K A;  1L7Y A;  3KH0 A;  1Z2M A;  3T8M A;  3ZNI D;  2LI5 A;  1GG3 A;  2J7Q B;  4DHJ B;  4W9G A;  3VQI A;  1IPG A;  2KJH B;  2FCS A;  2KX3 A;  3KW5 B;  3QHT A;  3X0W A;  4BVU C;  3DPD A;  4DBG A;  3ZTC A;  2JVC A;  1YQB A;  4YL8 A;  2GBK A;  2MQJ A;  3LDZ E;  3JYU A;  2MLB A;  4BKT A;  1WGR A;  4WAA A;  3ZO5 B;  5JH5 C;  5L83 A;  5LXH A;  1R4N I;  4B95 A;  1FXT B;  1V9J A;  2GBN A;  4IG7 B;  3RCZ A;  3WAO A;  4DHZ E;  1IYF A;  2FCM A;  1C1Y B;  4W9I A;  3PTF C;  1ZGU B;  4JIO U;  2LJ5 A;  1WI0 A;  3U7D A;  1WZ3 A;  2DZM A;  3DVN V;  1XQQ A;  5AZH A;  3A1Q A;  3APD A;  3V60 A;  2M0X A;  1GC7 A;  1WMH B;  3GZN I;  3R3M A;  4GN1 A;  1P1A A;  3DVN U;  2MCN B;  3V62 A;  1M94 A;  1WX9 A;  3R66 C;  2M1M A;  3CMM B;  4GMV A;  2L8J A;  3W1Y A;  2KX0 A;  2WX1 A;  1E8Y A;  1D3Z A;  1UZX B;  3UIN B;  1LQB A;  4K1R B;  3ZLZ A;  4HXD A;  3C0R B;  3BY4 B;  3R7Q A;  3HIZ A;  2D3G A;  2LVO A;  1X1M A;  5AZG A;  3ENE A;  2KDI A;  4HK2 A;  1C3T A;  2NVU I;  3ZNG C;  2YVC A;  2K8C A;  2IO0 B;  4KV2 A;  1G6J A;  1E90 A;  3DOW A;  2UYZ B;  4RM9 A;  3QC8 B;  2ZZP B;  3LJ3 A;  3PZD A;  2JY6 A;  2DYM A;  4B9K A;  4MH0 E;  2ZPY A;  2K8H A;  3PVL A;  2LD9 A;  3L13 A;  4GXB A;  5C23 A;  4MGZ E;  3HM3 A;  4WJQ A;  2BF8 B;  4WWO A;  3TIX A;  3VHT C;  4AP4 C;  3L0W B;  4I6L B;  3A9J B;  3PRM B;  3O65 B;  1WJ4 A;  3QQ8 B;  2HD5 B;  3ECI A;  4PYU A;  3EEC A;  4GDK B;  1V81 A;  4HWI B;  1E5W A;  5J2R A;  2MP2 A;  4G11 A;  4HDQ A;  2DAJ A;  3PLV A;  4ASW C;  1VCB A;  4NJ6 A;  1E8Z A;  3ZDM C;  4AJW A;  1J0G A;  3I3T B;  4GDK A;  3TCA A;  3APF A;  3A4R A;  1ZKH A;  4ZDV A;  2PEA A;  1E8X A;  1P0R A;  2M4N A;  2KTF A;  1RAX A;  3EHV A;  2IY0 B;  2WWZ A;  4DXA B;  1A5R A;  2BKR B;  3SHQ A;  2LGD A;  5KHO A;  1RFA A;  1EUV B;  1P98 A;  1V5T A;  1WE7 A;  1H4R A;  1NBF C;  3PHX B;  4II2 B;  1V6E A;  1WGH A;  5AZF A;  1UBQ A;  2AL6 A;  4DHJ D;  1WY8 A;  1KJT A;  4M8M A;  3H7P B;  2HJ8 A;  4WWP A;  2D11 A;  2L05 A;  4WJN A;  1WXV A;  1OEY J;  2PPH A;  4EFO A;  1TTN A;  4BBN C;  3H7P A;  5CHV C;  4CHK A;  2KN5 A;  4NAW B;  1KLV A;  2CKH B;  1PQS A;  3KVF B;  2BYE A;  3CF6 E;  1ISN A;  4M0W B;  1LFD A;  1WX8 A;  3M62 B;  3QAQ A;  2LZ6 A;  4EOY A;  4ANV A;  3Q3J A;  4NAW A;  2D2Q A;  4HVB A;  1V86 A;  3VH3 B;  1OEY A;  2MSE D;  2J0M A;  2O6V B;  4FN2 A;  2Z59 B;  1WH3 A;  1UD7 A;  2HTH A;  2KDE B;  5E6O A;  4W9L A;  3KYD D;  2GBM A;  3PV1 A;  4F1S A;  2V1Y A;  2Z0D B;  3A9K B;  3JVZ X;  2WX0 A;  2ZCB A;  3IFW B;  1H8C A;  2DHZ A;  4RM8 A;  3DQV A;  4WJO A;  2O2V B;  2JWZ A;  3B0A A;  2LRU A;  3TJP A;  4ICU A;  4PS3 A;  2GOW A;  3U8Z A;  2LRW A;  4K7W A;  5J17 A;  1SGH A;  1YIW A;  2FNJ B;  4N9F 4;  4BKS A;  2JT4 B;  4DK5 A;  2KQS A;  4X57 B;  2KD0 A;  2IO2 B;  2DX5 B;  2IO3 B;  2O2V A;  4BFR A;  4WQO B;  1SE9 A;  3QIJ A;  5D6J B;  1V80 A;  2BWF A;  4FLH A;  3QCA A;  2ZEQ A;  3PRE A;  3NZU A;  4NNJ B;  2G4S A;  1QZE A;  4GOC A;  2LXA A;  4BOZ B;  1J19 A;  4TV3 A;  2CR5 A;  2NBW B;  3DCG A;  3SD5 A;  2L76 A;  4NY0 A;  4E71 A;  1S3S G;  2ASQ A;  2L0T A;  3NHE B;  1NI2 A;  4HLE A;  1XT9 B;  3AI5 A;  1EO6 A;  3NZS A;  2J0K A;  2N4F A;  3VFK A;  1I35 A;  3A1Q B;  3EC8 A;  4MEM A;  3QJZ A;  2MW5 A;  3PRZ A;  4GSW A;  4KZC A;  2LVQ A;  3R7R A;  2JUO A;  1CMX B;  4ZRK A;  3MTN B;  3VTV A;  4AWJ A;  3V6C B;  4GGQ A;  2KDF B;  4MGY E;  2IY1 B;  2K39 A;  3IVF A;  3OJ3 A;  4FHK A;  4W9D A;  1WYW B;  3A4S C;  2K6Q A;  1OQY A;  1VD2 A;  2KWV B;  5D7G A;  3VVW B;  3ML8 A;  3APC A;  3WAL A;  2NPT A;  4BOS C;  1OGW A;  4MGK E;  3K9O B;  1WJ6 A;  3L17 A;  3W1S C;  3RZW C;  4AOF A;  2REX A;  3WA0 A;  2VRR B;  3N30 A;  2G4D B;  5G2N A;  1XD3 B;  4ANU A;  4IWP A;  1F9J A;  2CS4 A;  4I6P A;  3K9P B;  2KAN A;  1GJZ A;  2L7R A;  4PS7 A;  1E8W A;  2Y5B B;  2MRP A;  3PSE B;  3RT3 B;  1RLF A;  2FIF A;  2JZ3 B;  2KQ7 A;  3HHM A;  4FJY A;  4PS8 A;  3TBL D;  2J0J A;  2JZZ A;  3U30 A;  1TBE A;  2GMI C;  4K7U A;  1Z5S B;  2FUH B;  3V61 A;  5G55 A;  2LAS A;  2KFJ A;  3M3J A;  4FA6 A;  2IZV B;  3AU5 A;  4IUM B;  4MSM B;  4LJO B;  2MP2 B;  1MG8 A;  4IW0 A;  2IYD B;  4PYZ A;  2JRH A;  5D94 A;  1RRB A;  3V6E B;  1YX5 B;  3IHP C;  1WXA A;  3NY5 A;  4MJS A;  3RD2 A;  2CU1 A;  3B1L X;  1WGD A;  4MM3 A;  1WJN A;  2KMC A;  2RD0 A;  2KKC A;  4A3O A;  4ZRJ A;  1EF5 A;  3ZDT A;  2O6V D;  2AL3 A;  2LWP A;  4KIK B;  4EZJ A;  5EDS A;  5DCN A;  2C7N B;  4F8C B;  1UBI A;  5CHF A;  3ZW3 A;  1HE8 A;  1GC6 A;  1WM2 A;  5GMV A;  2XEW A;  4KVG B;  4BKS D;  2HE7 A;  1E7U A;  2KOX A;  3VH4 B;  4KIK A;  3GOE A;  2N9X A;  2PE9 A;  4XZ4 A;  2WDT B;  1S1Q B;  3DDC B;  1WZ0 A;  2FAZ A;  3PRP B;  4LJP B;  4IC7 B;  3ZUN A;  2BPS A;  2KLG A;  2DYO A;  2RSU A;  1UEL A;  3ZRC A;  1YX6 B;  2ZCC A;  5JHB A;  1TGZ B;  2N9E B;  4RMA A;  2OOB B;  3VAW A;  2K1F A;  4B6W A;  1WXS A;  2DAF A;  3OLM D;  3DBR I;  3WAP A;  2ZPN A;  1Q5W B;  3N3K B;  1WRD B;  3QK0 A;  2MBO A;  2MWS B;  4XC2 A;  2MX2 A;  4DWF A;  2L3Z A;  3ONS A;  3PGE A;  4NQK E;  4W9E A;  2KC2 A;  1KOT A;  5IA7 A;  2I1K A;  2LUE A;  2MBQ A;  3T9L A;  1Q1O A;  2FCN A;  2N7E A;  3MJW A;  1GUA B;  5DPT A;  5LXI B;  2ZJD A;  3OAW A;  2L0F A;  5IAA C;  1KM7 A;  2IO1 B;  4W9J A;  1V49 A;  2KFK B;  3UIP B;  4URK A;  2C9W B;  3A33 B;  2EMT A;  4KZ0 A;  4DHZ B;  4ANX A;  4MSQ B;  3CSF A;  4W9K A;  1WGY A;  2CHZ A;  4JLC A;  2NS5 A;  4HCP B;  2KFK A;  2AWT A;  1YD8 U;  3ALB A;  2FCQ A;  3WAM A;  4J6I A;  3TL5 A;  1Y8R C;  3D32 A;  2OJR A;  1L2N A;  2PJH A;  4ICV A;  2DYB A;  4II3 B;  1ZW7 A;  2KJR A;  1U4A A;  2NBV B;  3ZVV A;  1P3Q U;  1EF1 A;  2ZNV B;  3QWZ B;  3ZRF A;  2RR9 A;  3L54 A;  4XX5 A;  5CHW A;  3WIM A;  4CO7 A;  4W9F A;  4E74 A;  4K81 A;  2PE6 B;  4GB9 A;  3B08 A;  2K25 A;  5DPS A;  2ZVO A;  1I42 A;  4NJ7 A;  2KDB A;  4E3C A;  2MBE A;  5KHQ A;  1UGM A;  3L10 B;  4IM0 A;  5J18 A;  2BYF A;  1JRU A;  3H6N A;  2KWC A;  1NDD A;  4EZL A;  3IBE A;  1WX7 A;  3UIO B;  3VXW A;  1T0Y A;  2N9P C;  4ZYN A;  2KHW B;  4OVU A;  2KLC A;  2GBJ A;  2AEH A;  2K6D B;  2KXJ A;  4K7S A;  3JSV B;  4EUT A;  3DVG X;  1WF9 A;  2RGF A;  5BO4 B;  2NPT B;  4FHJ A;  3CST A;  2A4Z A;  2KNB A;  4HCN B;  2NBU A;  4HJK A;  4KSL C;  4KSK C;  4HDO A;  4A20 A;  2I1J A;  3DBH I;  1V5O A;  1Q0W B;  2JF5 A;  3JSV A;  4OVV A;  2BGF A;  2A5U A;  2CHX A;  2RPQ A;  2EMS A;  2C7H A;  3ZNZ B;  4ZRI A;  3ZKJ C;  1WJU A;  3P2B A;  4TKN A;  2N1V A;  4AJY B;  4FUL A;  3SDL C;  3M95 A;  2D07 B;  2MBH A;  4NQL B;  4BKG A;  3HK0 A;  2M17 A;  3H9D A;  3RYT A;  3S2A A;  1E7V A;  2QHO A;  2L00 B;  2G3Q B;  4JL9 A;  3ZIM A;  3KUZ A;  3WAN A;  4JQW C;  4EKU A;  1YJ1 A;  3VDZ A;  4MGI E;  1WMH A;  2LGX A;  2MBB B;  3H7S A;  2C5L C;  2GBR A;  5JHA A;  4IM3 A;  4G3X B;  4LDT D;  4M8N A;  2JRI B;  3OJ4 B;  2N7D A;  1J8C A;  2LGY A;  5FR6 A;  4MJS B;  1K8R B;  2NR2 A;  3PHW B;  3W1S A;  1V2Y A;  3AU4 A;  3QAR A;  3ZNH B;  1TZ1 A;  2KWU B;  1WM3 A;  3PS6 A;  3UGB B;  3KUD B;  5DPR A;  3RUI B;  4FJV B;  2BWE S;  3VUW A;  2XBB C;  3L08 A;  4W9C A;  3N32 A;  4CYE A;  3AXC A;  1P9D U;  2EKE C;  5TR5 A;  4FBJ B;  4WJP A;  4TQ0 A;  2AYO B;  4WWN A;  3KYC D;  4IM2 A;  4GIV A;  2KTR B;  1WIA A;  3BIN A;  3VTU A;  2N1W A;  1R4M I;  3Q3F A;  4P7I A;  4I6N B;  3JW0 X;  4DDG D;  4G0N B;  5L95 C;  2CHW A;  2BYV E;  2KMA A;  3HM6 X;  2R2Q A;  4GDL B;  4GU2 A;  2MA9 B;  2KTR A;  4MEL A;  5C1Z A;  3A9J A;  4HPM B;  2B3A A;  3MHS D;  3RZF A;  3DVG Y;  2YLM A;  2JXX A;  3VUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...