3DCGA

Crystal structure of the hiv vif bc-box in complex with human elonginb and elonginc
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
100
structure length
99
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADTFEALCIEPFSSPPELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/viral protein
molecule keywords Transcription elongation factor B polypeptide 2
publication title Structural insight into the human immunodeficiency virus Vif SOCS box and its role in human E3 ubiquitin ligase assembly
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 99
sequence length 100
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3dcgA00
4NJ7A 1EF1A 5AZHA 4EEWA 3UQAA 1WX9A 1GJZA 3EFUA 1GG3A 4MGZE 2O6VB 4OVUA 2K1FA 4AJYB 4DHJB 3SDLC 1H4RA 1WF9A 3ZNZB 2YVCA 3NHEB 3ZLZA 4JQWC 5CTRC 4ZDVA 4IG7B 2O2VA 5E6OA 4ZRJA 2HTHA 4BOSC 2JXXA 2KC2A 2OJRA 3JVZX 5EDSA 3IG3A 2G4DB 3A4SC 4IM3A 2CR5A 2KTFA 2ZJDA 4RM8A 4HPLB 1VD2A 3TMPB 3KW5B 4IWPA 3U30A 4MGKE 2AL6A 5DPRA 3VUYA 4KZ0A 2FIFA 3ZDMC 2KFKA 3TJPA 3D32A 1WJNA 5AZGA 2CHZA 2GBRA 1LFDA 3PRZA 2BPSA 1NBFC 4F7ZA 3PHXB 4DWFA 2MQJA 1WGDA 2PE9A 3APDA 3PLVA 4HDQA 2BYVE 2RD0A 4RM9A 1KLVA 2N7DA 3PVLA 2CHXA 2KO3A 3MTNB 2O6VA 4RMAA 2NCNA 3VFKA 2L0FA 5IA7A 1Q1OA 2BWFA 4MJSB 2BGFA 4N9F4 4HPMB 1TGZB 2JY6A 4W9LA 1SGHA 3ENEA 2J7QB 2K6QA 4OVVA 4GIVA 3S2AA 4BKTA 2C5LC 4II3B 4ANXA 3DVNV 3L16A 3QX1A 4WWNA 5G2NA 3EC8A 3WIMA 2CHWA 2JZZA 4ANWA 1J0GA 2RGFA 4HVBA 4KVGB 1YD8U 5J17A 3LDZE 2N1VA 4BKSD 4WAAA 1WJ6A 3M62B 3OLMD 3VDZA 1WJ4A 2C9WB 3EHVA 2XBBC 1YX6B 2N9XA 3DPDA 3H7PA 2WWZA 2K8CA 2LVPA 4GDLB 5KHOA 1H8CA 4BKGA 2DZMA 2N4FA 3HIZA 3KYDD 4K1RB 3VTWA 4I6LB 4NNJB 3PRMB 2IY0B 4B9KA 1WGHA 2DZKA 3C0RB 4JLCA 1IP9A 2ZPYA 3CSTA 5D7GA 3RCZA 3QQ8B 1WJUA 1V5TA 3OAWA 4GU2A 3DBHI 3SU8X 1OQYA 3L10B 1V80A 4FJYA 2AL3A 1EO6A 3QHTA 2Y5BB 4EZLA 2FCMA 2V3SA 3KH0A 2NS5A 1KOTA 2KC1A 1T0YA 1OGWA 3X23A 1A5RA 3GZNI 4PYZA 1LQBA 2REXA 2KMAA 4GGQA 2V4LA 1P9DU 2MBQA 5E6NA 4HK2A 2FCQA 4GB9A 4B95A 4K81A 3BY4B 2KDBA 2BKRB 1V6EA 2BYEA 2WYQA 4FN2A 2FUHB 2LD9A 4GDLA 4I6PA 4NQLB 4IUMB 2KOXA 2A5UA 2ZPNA 2DAJA 2KQ7A 1S1QB 4TUUA 2L05A 5DCNA 4E3CA 2A4ZA 1UH6A 2JPHA 2KDFB 1Q5WB 3A4RA 4GMVA 2KN5A 1XD3B 4MSMB 2AEHA 1E7VA 3MHSD 3QWZB 2JUOA 3PGEA 2LRUA 5KHQA 1E8WA 4FHKA 3HM3A 2KD0A 3WA0A 2BYFA 2BWES 1MG8A 1WR1A 1VCBA 3VUWA 2Z0EB 1XT9B 1GNUA 1P0RA 2V1YA 4IWQA 3IFWB 1G6JA 4PYUA 1F9JA 1QZEA 2FCNA 1M94A 3SD5A 2BF8B 3JYUA 3WANA 3V61A 3X0WA 4MELA 4EUTA 1WZ3A 1LM8B 1WX8A 3DBLI 1WH3A 1YIWA 1R4MI 2MW5A 2PE6B 2RPQA 2LRWA 2MBOA 1X1MA 2LXCA 3N30A 4MGYE 3BINA 4W9DA 1WXAA 2I1KA 4URKA 1Q0WB 1V81A 3P2BA 2JT4B 4I6NB 1V5OA 1WXVA 2IO1B 2LGXA 3PREA 4FJVB 4KIKB 3VH3B 3T8MA 2KWUB 3VHTC 2KX0A 1R4NI 2DYBA 3GOEA 2C60A 4K7WA 2FNJB 1J19A 2IO0B 5CHWA 1ISNA 2MWSB 4BFRA 4ASWC 1ZKHA 4P7IA 1OEYJ 2KJHB 5E6PA 2HJ8A 2M0XA 3RZWC 2MCNB 3W1YA 2EMSA 1GUAB 2MLBA 3CSFA 4WWOA 4AP4C 4LDTB 3KYCD 4A3PA 1Z2MA 4GDKB 3K9OB 1NI2A 2LASA 2KTRB 1RRBA 2LUEA 1WXMA 2N9EB 3H7PB 3PLUA 4K7UA 1C3TA 1GC7A 3ZIMA 3CF6E 4E74A 2KVRA 3B0AA 3NS8A 2DAFA 2UWQA 4KIKA 2AWTA 2DZIA 2L7RA 4MM3A 1EF5A 2VRRB 5LLIA 4G50A 4W9IA 3KUZA 1UBIA 3A33B 3ML9A 1UBQA 2IO2B 4PS7A 4FA6A 2J0JA 1JRUA 4G0NB 2IYDB 2OOBB 3VVWB 2ZEQA 4KZCA 2K25A 3ZKJC 2KNBA 2WX0A 2KHWB 3CMMB 4JGHB 4BBNF 4EKUA 3EECA 3NZSA 5C23A 2G4SA 4NQKE 3VQIA 4DHZB 3JSVB 1TZ1A 1P1AA 1WGGA 4E71A 3QARA 5JHAA 3ZTDA 3VXWA 1YX5B 2B3AA 3HM6X 1OEYA 3L17A 5JH5C 2J0MA 2LWPA 4DK5A 1WM2A 4GOCA 1NDDA 2YLMA 4GDKA 4MGIE 2HD5B 4KSKC 3WAPA 1E5WA 2KTRA 4G11A 1WE6A 4KV2A 4WJPA 1LXDA 4X57B 4XC2A 3Q3FA 3UIOB 4DHZE 1C1YB 2GBMA 4F1SA 2G3QB 1L2NA 1V2YA 4WJNA 3QK0A 4ANUA 3AU5A 3DVGX 4DDGD 5AZFA 1KM7A 2Z59B 3KUDB 4MDKE 4ANVA 2ZCCA 3ZNID 1WRDB 4TQ1A 4M0WB 2M1MA 1WMHA 3ECIA 3H9DA 3W1SA 1ZGUB 3JSVA 2KLCA 3H1UA 4F8CB 5L83A 3V60A 4LJPB 5D6JB 3B08A 2JVCA 2EKEC 4AUQC 4G3XB 1AARA 2BKFA 5L95C 1KJTA 3AU4A 2KDEB 1P98A 1TTNA 2KFJA 2NBWB 1SIFA 4W9KA 2GBNA 5CHVC 4DXAB 1UD7A 5TR5A 5JZEB 5J2RA 2FIDA 3U8ZA 2MBEA 5DPWA 1FXTB 2WX1A 3H6NA 4IW0A 2KANA 3WAMA 2NBUA 4PS3A 5CHFA 2UYZB 4W9CA 2LZ6A 4GN1A 2JF5A 2D10A 3H7SA 4KDLB 3IBEA 4HLEA 4MEMA 3TL5A 4NPNA 2PPHA 3A9JB 2JRIB 1IYFA 2I1JA 2KKCA 3ZVVA 2KQSA 2JWZA 3HHMA 4EZKA 2L76A 1WM3A 2GOWA 4A20A 3VTVA 4EOYA 2ZNVB 2R2OA 1L7YA 3ZTCA 4BKSA 3V6EB 4LJOB 4MSQB 3V62A 1E8ZA 1RFAA 2RR9A 3L13A 4BOZB 1RLFA 3JW0X 3DVGY 2NVUI 2IBIB 4GSWA 4NAWA 3UF8A 1XQQA 3PPAA 3R7RA 1E8YA 2O6VD 1UELA 2D3GA 4IC7B 4DHJD 3APCA 4W9JA 4W9FA 3N3KB 3A1QA 2RSUA 3DQVA 1OTRB 2PJHA 3AI5A 4TQ0A 2MX2A 3IHPC 4EZJA 2DENB 2DZJA 2KJ6A 3AXCA 3L54A 1I42A 1WX7A 4WJQA 2FCSA 2L0TA 2W9NA 3A9JA 3PS6A 2MRPA 2WDTB 2ZNVC 4M8MA 2N7EA 1WI0A 1WY8A 4W9EA 3OJ4B 1TBEA 4NJ6A 2PEAA 2NR2A 3PSEB 3M95A 4GXBA 4NY0A 5C1ZA 4MH0E 3DOWA 2KK8A 3KUCB 2DYOA 2KLGA 3ML8A 1K8RB 2D11A 4IM0A 1I35A 2MBBB 3DBSA 3NZUA 4WJOA 1EUVB 1V49A 3TCAA 3A9KB 3RZFA 4AOFA 4FADA 1E8XA 4ZRIA 3RT3B 4ZRKA 2MSED 2JRHA 3MJWA 4M8NA 1YJ1A 4II2B 4K7SA 3ZUNA 4JIOU 2ZVNA 3ZRCA 2M8SA 5FR6A 2KX3A 1E90A 3PHWB 3QIJA 3R3MA 3I3TB 3O65B 4DBGA 5J18A 3QC8B 4B6WA 1Z5SB 3PRPB 3TBLD 2K6DB 4TV3A 1HE8A 3L08A 4AWJA 3ZNHB 1WMHB 2EMTA 3VH4B 3AULA 2ZVOA 2JZ3B 4HJKA 2D2QA 2ASQA 4W9GA 4XZ4A 5D2MB 4ICUA 2R2QA 5JHBA 2KMCA 5CX3A 1GC6A 5LXIB 5DPSA 2GMIC 4FBJB 5AEKB 4W9HA 1SE9A 3A9KA 4LCDE 3IVFA 3NY5A 3DCGA 1ZW7A 4JL9A 2LGDA 3RUIB 3K9PB 4HCPB 4AJWA 3ONSA 1WGYA 3RD2A 4YL8A 1BT0A 3Q3JA 4EFOA 2MBHA 5G55A 3R7QA 2MA9B 3VAWA 3PT2B 3W1SC 3WAOA 1RAXA 2KWVB 4BVUC 2C7NB 3PTFC 3PZDA 1UZXB 2IZVB 2NPTB 3V6CB 2XK5B 2M4NA 3QCAA 2K8BA 1S3SG 2IO3B 2NBVB 3HK0A 3M63B 2CKHB 2L3ZA 4DDID 2LI5A 2KWCA 2J0KA 3R66C 2K8HA 2KXJA 2AYOB 2XEWA 1PQSA 3QJZA 1UGMA 2LVQA 5IAAC 3UIPB 2LXAA 3T9LA 3ZNGC 5BO4B 3VUXA 4ZYNA 4NAWB 1WE7A 4A3OA 4CO7A 3KVFB 5DPTA 3WALA 2G45B 4KSLC 4MJSA 3L0WB 5GMVA 3DBRI 3A1QB 1J8CA 1V9JA 1Y8RC 4FLHA 2ZCBA 1WYWB 2Z0DB 3QA8A 3TIXA 1U4AA 3DVNU 2KJRA 3U7DA 1YQBA 3B1LX 3M3JA 3NOBA 4FULA 4BBNC 4FJZA 2MP2B 2N9PC 4HDOA 2IY1B 1WXSA 2NPTA 2GBJA 1WGRA 2CS4A 2XK5A 3VTUA 2GBKA 4J6IA 3ZRFA 1WFYA 3PV1A 2DYMA 3ZO5B 1E7UA 2M17A 4PS8A 4IWOA 1WZ0A 1WIAA 4WWPA 2DHZA 2DX5B 2L8JA 2LJ5A 1CMXB 3OJ3A 5LXHA 2FAZA 4XX5A 5D94A 4HXDA 4WQOB 2O2VB 3ALBA 4CHKA 2L00B 3QAQA 4HWIB 1D3ZA 2N1WA 2LVOA 1P3QU 3ZDTA 2C7MB 3UGBB 2CU1A 3ZW3A 3SHQA 2C7HA 4HCNB 2KZRA 5HKHA 2HE7A 2K39A 2MP2A 4CYEA 2D07B 2KFKB 3LJ3A 4ICVA 3RYTA 1V86A 4FHJA 4LDTD 4TKNA 3N32A 4IM2A 3DDCB 3UQBA 4KDIC 2LGYA 2QHOA 1WR6E 2ZZPB 3RULA 3UINB 2KDIA 3APFA 1IPGA
chains in the Genus database with same CATH superfamily
4NJ7A 1EF1A 5AZHA 1GJZA 1WX9A 1GG3A 2I38A 4MGZE 4A55A 1J7CA 1WF9A 2WXFA 3NHEB 5CTRC 4ZDVA 2JSVX 5EDSA 1YQ4B 4IM3A 2CR5A 2KTFA 4RM8A 3P4PB 2AL6A 5DPRA 1SJHD 2KFKA 1WJNA 1LFDA 3PRZA 1WWTA 4KKJA 3PHXB 2PE9A 1JROA 3PLVA 2NCNA 2N0SB 2BGFA 3AN1A 1BMLC 2J7QB 3MC0B 3QX1A 3W2DA 2CHWA 4ANWA 1J0GA 5H92C 3GS2A 1QQRA 1PYWD 4HVBA 2XN9C 3TEZA 3LDZE 4WAAA 3VDZA 4KGSA 2XBBC 3I63C 3H7PA 3EFCA 2LVPA 2DZMA 3KYDD 1E10A 1NENB 3C0RB 1NI3A 1V80A 2AL3A 4C80A 4RNAA 2WHIA 1PUTA 2FCMA 3KH0A 1KOTA 2KC1A 2QDFA 2QJLA 1LQBA 2V4LA 4B95A 1MI0A 3BY4B 2MJEA 2BYEA 1BUIC 1DOXA 4GDLA 4NQLB 3CWIA 2KQ7A 1AWDA 4E3CA 2JPHA 4GMVA 2INPE 4MSMB 1T0RC 1E8WA 3WA0A 1MG8A 1WR1A 1VCBA 2V1YA 1G6JA 1WYGA 2FCNA 2YEPB 3X0WA 5IKCM 3RNFC 2LRWA 1X1MA 3N30A 4MGYE 4URKA 1Q0WB 4I6NB 3P2BA 4KIKB 1V5OA 1WXVA 2IO1B 3VH3B 2LGSA 2DYBA 1J19A 5CHWA 1ISNA 1QOFA 4P7IA 2KJHB 1BXTA 4KGRA 3Q8FA 3RZWC 2CU3A 1NYRA 3BZDB 2I2YA 2Y3AA 3CSFA 4WWOA 3AE8B 4LDTB 4A3PA 4UDUC 1F52A 2WXQA 2UWQA 2AWTA 2L7RA 2G1EA 5LLIA 2R61A 1KFYB 3ML9A 2IO2B 1EM7A 2J0JA 4G0NB 2IYDB 2Q5WD 2K25A 1J7BA 4EKUA 3BYTB 1L4ZB 4JGHB 2QILA 1LO5D 3VQIA 4DHZB 1TZ1A 3QARA 1YJIA 1NDDA 4MGIE 5IOIA 1KH0A 3FKYA 1PDXA 1WE6A 2RPVA 4WJPA 4X57B 3Q3FA 3UIOB 4DHZE 1D6EC 1I4QA 3P63A 1V2YA 4XDDA 2WP9B 3QK0A 4ANUA 4DDGD 1TS3A 1QOBA 5AZFA 1QOAA 1KM7A 4MT5A 3KUDB 3ZNID 1D4BA 1WMHA 1TKEA 3ECIA 1OFFA 3W1SA 3H1UA 1MHHE 3KLSX 5MPOA 4LJPB 5D6JB 3B08A 2JVCA 1K50A 1GOZA 5BYQA 1KJTA 3AU4A 1P98A 2KFJA 1SIFA 4W9KA 2GBNA 4DXAB 2LMCA 3BIID 2FIDA 2MBEA 4IKGA 4PS3A 5TSSA 3TL5A 4NPNA 3Q14C 2JRIB 2I1JA 2LUMA 2JWZA 3HHMA 4EZKA 1L7YA 1SEBD 1CK1A 1VZ8A 1RLFA 3JW0X 2NVUI 2IBIB 4GSWA 1XQQA 3PPAA 3MC8A 1FM0D 2D3GA 3V3XA 1N62A 4DHJD 4W9JA 4W9FA 5D3DA 3N3KB 1JW9D 2E6XA 3AI5A 5G5HA 4XDCA 1DYQA 4EZJA 3AXCA 4MM3B 2L0TA 3A9JA 5LNK1 3FILB 1WI0A 1C79A 1WY8A 4RH6A 3OJ4B 1TBEA 2KDMA 4NJ6A 4ITKA 3W9CB 4GXBA 4MH0E 2DYOA 3ETRA 4TSSA 3BK2A 2MBBB 3DBSA 3DWGC 4ZRQA 3N1XC 1YJ1A 3EA6A 2MHJA 3ZRCA 2M8SA 4USAA 2J53A 2WXPA 3R3MA 2GRIA 1TKGA 3TBLD 1UUPA 1EWYC 4TV3A 3RNCC 3ZNHB 2EMTA 2LJIA 3VH4B 3AULA 3DBRB 2D2QA 2WXKA 5HFYA 2D3CA 2EKIA 4M02A 5LXIB 2HTME 2GMIC 5DPSA 3IVFA 4JL9A 5EE1A 3P4SB 1K51A 1XO3A 1WSPA 3C8YA 3ONSA 4YL8A 3E56A 4OZAA 3RNAC 2IZVB 4OZCA 2XK5B 2K8BA 3OG5A 2NBVB 3HK0A 1MG4A 1SJED 2KWCA 2K8HA 2AYOB 3UIPB 3ZNGC 3VUXA 1VZ7A 1AYFA 1WE7A 4NAWB 4A3OA 3NVVA 3TEWA 1F2RC 3A1QB 2D5GA 5EE3A 1XEEA 1WYWB 2Z0DB 5HHDG 2KJRA 3DHHC 1MVKA 3M3JA 3RNGC 4J3OD 1ZP0B 1FNWA 2NPTA 2GBJA 2CS4A 2IPKD 1SBBB 1FO4A 3ZO5B 1B9RA 4TMAB 1E7UA 2M17A 4IWOA 4LNIA 5HG2A 4LK0M 4YSZB 2IGHA 2LJ5A 2FAZA 2LFIA 4WQOB 2ICIA 2O2VB 4D2KA 3QAQA 4RF0A 1D3ZA 2W3SA 3ZDTA 2WNMA 3TEXA 2W3RA 2K39A 5IN7A 3UQBA 3DDCB 4KDIC 2KDIA 2WU5B 3HRDD 4OVUA 1TS5A 2UU7A 4AJYB 4A90A 3NVYA 1P7EA 1N60A 1ROEA 4WQMA 1B1ZA 5E6OA 2OJRA 2G4DB 2IJ0A 4S0RA 2NTTA 2PVOD 2ZJDA 3TMPB 1VD2A 4IWPA 3B9JA 3U30A 1Y56A 3DBHB 3D32A 3TJPA 2GBRA 3N1YC 2BPSA 3R2TA 4DWFA 4RGOS 2MQJA 4HDQA 4RM9A 1KLVA 2N7DA 2CHXA 2O6VA 1XXGA 2L0FA 1Q1OA 2BT6A 4HPMB 4W9LA 4ANXA 4II3B 3L16A 1VDVA 1UGJA 3P42A 3PZ7A 1KLUD 5FK9C 1L0YB 2DWQA 4LLGM 2WGSA 3Q3NC 1WJ6A 2BS2B 2RDHA 3M62B 3OLMD 1WJ4A 2C9WB 4IOIE 1YX6B 4OHJA 3MP9A 1EU4A 2K8CA 1H8CA 4I6LB 1C76A 2IY0B 4B9KA 2OJWA 2BS3B 1NVID 1V5TA 1OQYA 3L10B 4FJYA 2ON8A 4WH4A 3DBLB 4RF1A 3RN9C 2SAKA 1T0YA 4PYZA 2REXA 2KMAA 4GB9A 3SFEB 4K81A 1ZDVA 2QSDA 3BK1A 2INNE 1YN5A 2FUHB 4HKQA 4I6PA 1I7HA 3GB1A 3B2GA 3HVDA 2A5UA 2ZPNA 1WGKA 1UH6A 2KDFB 4PK1A 1V1PB 1Q5WB 4WIPA 3TUOA 2KN5A 1XD3B 2JUOA 4FHKA 4HROA 3HM3A 2BYFA 2BWES 2J4XA 3LB8C 3ZJVA 3VUWA 2VZKB 1XT9B 1P0RA 1T5XD 3IFWB 1FMAD 2WXNA 4IWQA 4LNOA 1F2RI 1F9JA 5AUKA 5C2TB 3WANA 3V61A 4MELA 1LM8B 1WH3A 1YIWA 1R4MI 2PE6B 2RPQA 3U4EG 1GAQB 3BINA 1WXAA 2JT4B 3PREA 5L83A 1VZ6A 4HEA1 3T8MA 3GOEA 2C60A 4K7WA 3KQ4A 4RCOA 3URYA 2MWSB 3P4RB 4ASWC 3ABVB 3W1YA 2K0PA 4JWUC 4AP4C 1ZOYB 2LASA 2KTRB 1RRBA 2QEJC 1GC7A 3ZIMA 3CF6E 2KVRA 3B0AA 3NS8A 2DAFA 4K3BA 4MM3A 1FEHA 1EF5A 1SIJA 2WXHA 4G50A 1UBIA 1UBQA 1L0VB 4FA6A 3AE9B 1JRUA 1V8CA 2ZEQA 1PFDA 1FRRA 2WX0A 2W55A 4BBNF 2N9LA 5C23A 2G4SA 4NQKE 1WGGA 3N9YC 4KX6B 2FUG1 4DK5A 4GDKA 2HD5B 3AE7B 2EELA 3WAPA 2SEBD 4KV2A 1C1YB 2GBMA 4ZHPA 4WJNA 4B0MA 3AU5A 2INCC 3RNBC 1WRDB 1R4MB 4M0WB 1QLBB 3PO0A 3Q6BA 4XYCA 2KMMA 3H9DA 3JSVA 4F8CB 2ACZB 2IDYA 4ZRPA 4DXFA 3AE5B 1JWSD 3Q8EA 2XNAC 1T3QA 2KDEB 4YTPB 1E9MA 5JZEB 1P7FA 5J2RA 3U8ZA 5DPWA 1FXTB 3H6NA 1MPEA 5CHFA 1L4DB 3I9V1 2UYZB 4W9CA 2JF5A 4KDLB 4HLEA 3C19A 3W5UB 2WXLA 1I4RA 3AEAB 3AV8A 5HI1A 3Q2AC 3NVZA 1HZ6A 4A20A 1C4CA 2ZNVB 3ZTCA 3VR8B 1E8ZA 2RR9A 4BOZB 4NAWA 3UF8A 2O6VD 2X38A 3A1QA 4TQ0A 2DENB 1V1OA 3L54A 3RPFC 2M0AA 2FCSA 2DBYA 2W9NA 1FNUA 2MRPA 4M8MA 2GLSA 4W9EA 2NR2A 5EE9A 3M95A 2KK8A 2PVGC 2B76B 2KLGA 1K8RB 2D11A 1I35A 3VR9B 4WJOA 1EUVB 4FADA 1E8XA 4ZRKA 2AX5A 2L32A 2JRHA 3MJWA 4M8NA 4II2B 2ZVNA 4OW0A 1IBXA 2JYEA 2KX3A 2WU2B 5J18A 3O65B 4ZHOA 2GB1A 1KTKA 1Z5SB 1JWUD 4ARCA 4EE2A 3H8HA 2QCZA 1QT9A 2R2QA 5CX3A 1ZDXA 5AEKB 1N6ZA 3A9KA 1JWMD 4GLSC 1CQVA 1ZW7A 1JCKB 1RYJA 2H89B 4L2YA 3RUIB 1LGRA 3K9PB 2KVZA 4HCPB 2RMMA 5BYRA 1WGYA 3VAWA 3W1SC 4BVUC 2C7NB 3PTFC 1ZXHA 1UZXB 1IGDA 2M4NA 2IO3B 2CKHB 2L3ZA 2JX5A 2J0KA 3QJZA 3BYYB 1UGMA 1JMLA 3T9LA 2G9HD 5BO4B 4ZYNA 4HJGE 1K52A 3KVFB 2KAJA 2G45B 2NMQA 3DBRI 2ZW1A 1J8CA 1V9JA 1ZPSA 3QA8A 4P1CC 3AEEB 3U7DA 4FULA 3U52E 4BBNC 4FJZA 4MACA 2MP2B 4HDOA 1KRHA 2L1AA 2IY1B 4KGTA 1WGRA 2DYMA 2IGDA 1T6BX 4QAYA 1TY2A 1WZ0A 5T8IA 1YOVB 1CMXB 4HXDA 4CHKA 5H8YE 3V05A 3ZJTA 2C7MB 3UGBB 2CU1A 1FXIA 2LGIA 5HKHA 2KZRA 3AE4B 4ICVA 2KFKB 3LJ3A 3N32A 1XLOA 2WLBA 2LGYA 3UINB 1WR6E 3APFA 1IPGA 5FKAC 3BVZA 4EEWA 3UQAA 1RM6C 3EFUA 2K1FA 4DHJB 3SDLC 1H4RA 1QKZA 3NZ3A 5I4DA 3ZLZA 4IG7B 4BZAA 2CJNA 4ZRJA 2HTHA 4RGTA 3JVZX 3A4SC 3E9SA 3WCQA 2BB6A 4MGKE 2FIFA 3ZDMC 3GP7A 2JU6X 2QMTA 5AZGA 2CHZA 1VRAB 1NBFC 3OWEB 4F7ZA 1WGDA 3APDA 4YT0B 2WS3B 4C7ZA 2RD0A 2DLBA 4ZYSA 3ZGZA 2KO3A 3MTNB 3GZNB 3VFKA 2TSSA 4N9F4 2KWDA 3ENEA 4OVVA 3S2AA 2C5LC 5G2NA 3EC8A 3WIMA 1L5PA 2JZZA 2JWUA 3BWUD 2N1VA 1FPYA 4CQNA 3Q69A 5KHOA 1HZ5A 4GDLB 4JPSA 4BKGA 2N4FA 4K1RB 4NNJB 1UWXA 1XLQA 2DZKA 2ZPYA 2V3NA 3QQ8B 1WJUA 3OAWA 4GU2A 3DBHI 4C56C 4LNKA 2V3SA 1ZE3D 2NS5A 1A70A 2FBWB 1OGWA 3X23A 1A5RA 1ET6A 4GGQA 1P9DU 5E6NA 1K53A 2FCQA 2GI9A 2KDBA 1V6EA 2WYQA 4FN2A 2DAJA 1S1QB 2A4ZA 3A4RA 1N61A 1HEZE 3MHSD 1SSNA 3QWZB 2LRUA 5KHQA 1CJEA 1T0QC 3AE3B 1L6UA 3GE8C 1GNUA 2BBCA 3ZQ4A 1I4XA 4PYUA 1QZEA 3SD5A 2BF8B 3JYUA 4EUTA 3DBLI 1WX8A 4HWIB 1VJKA 4JX1C 2MBOA 2LXCA 4W9DA 5BYSA 4YSYB 1TZOA 2I1KA 2LGXA 3VHTC 2KWUB 1KLGD 2FNJB 1TS4A 5BMIA 3AE1B 1ZKHA 2HDEA 2EMSA 1OQRA 3ZYYX 1ACCA 3L4PA 1EU3A 1GPXA 1Z2MA 4ACFA 1NI2A 2LUEA 2N9EB 3PLUA 1C3TA 2J52A 4E74A 2DNFA 2AQ2B 1YN3A 4KIKA 2PTLA 1QOGA 2JZPA 1VR9A 2VRRB 5G5GA 4AQ7A 2LEKA 2W54A 4W9IA 1MFWA 4NJCA 3A33B 2OOBB 3VVWB 4YTMB 3ZKJC 3EECA 1YJJA 1JALA 1P1AA 3AMZA 4E71A 5JHAA 4MH8A 3ZTDA 3VXWA 1YX5B 2B3AA 3NS1A 5JH5C 2J0MA 2LWPA 1WM2A 4GOCA 2YLMA 1D5ZC 4KSKC 2M19A 4A6QA 3NVWA 1LXDA 4XC2A 4Q2JA 4F1SA 1L2NA 2V4IB 4PT5A 3UI3A 3FAHA 4MDKE 4ANVA 2ZCCA 4TQ1A 1FFVA 2M1MA 2OEDA 3ZJUA 1ZGUB 2L52A 3V60A 4IDIA 3Q3MC 2EKEC 4AUQC 2K5PA 2N7JA 1AARA 3NJTA 2BKFA 3W5VB 1UD7A 1Q10A 4O1NA 3AM9A 3WAMA 3Q8CA 5IP4D 3IBEA 1UNSA 4MEMA 3Q8BA 2VZKD 2PPHA 3A9JB 1IYFA 2KQSA 2BVCA 4NAMA 1WM3A 4EOYA 2R2OA 3DWMA 4BKSA 1UF0A 3T3OA 2WXIA 3V62A 3L13A 3U2SC 1C4AA 3DVGY 1M4VA 1DGJA 4IC7B 3APCA 1N5WA 2RSUA 3IHPC 1F77A 4REZA 3I5JC 1WX7A 1J7AA 3IAS1 3PS6A 2WDTB 5BMHA 3IT4B 2N7EA 4RGMA 2PEAA 4S17A 3TSSA 4NY0A 4C00A 5C1ZA 3DOWA 2D3BA 3NZUA 1V49A 3TCAA 3RZFA 3AECB 3RT3B 4ZRIA 2D3AA 2CJOA 4K7SA 1NYQA 4XGAB 3IXSA 1RWSA 3ZUNA 4JIOU 1TS2A 4N59A 3TEYA 1GB1A 1E90A 3I3TB 4ZOHC 2JYTA 3PRPB 3FILA 3ZXVA 1HTQA 2JZ3B 4HJKA 5EE0A 2ASQA 1FFUA 5D2MB 4ICUA 3EUB2 2ZW0A 4C4VB 5E6JA 2BB5A 5JHBA 3I57A 1YNTE 1SE9A 3NY5A 1D5XC 2BTEA 2BYTA 4KKIA 1SE4A 1CZPA 2RDGA 4AJWA 1ENFA 3J9CA 2PKOA 4LTUA 5G55A 3WAOA 2MA9B 3PT2B 1RAXA 2KWVB 3PZDA 2NPTB 3V6CB 3QCAA 1C77A 3M63B 1SE3A 4DDID 4L23A 3R66C 2KXJA 2XEWA 2E3TA 5IAAC 2LHDA 3U7ZA 3DHGC 2MH7A 1AW7A 4HRSA 5DPTA 3WALA 4KSLC 3L0WB 5GMVA 5BMGA 4M00A 4P16A 3ZXRA 3DVNU 3SR6A 3NOBA 1FCLA 2HJ1A 1L6VA 2N9PC 1WXSA 2L83A 3MJ5A 2PIAA 2XK5A 2GBKA 4J6IA 3RNEC 2Z8LA 2RDBC 4OZBA 4WAFA 4WWPA 3N1ZC 1TY0A 1F0ZA 1ET9A 5D94A 1JQ4A 1SF0A 4XWWA 1JWAD 2L00B 2WDQB 1RFKA 1SB3C 2LVOA 5FR3A 3ZW3A 3SHQA 5D3IB 4FHJA 4LDTD 4IM2A 1XLNA 2QHOA 2ZZPB 1F1HA 1IGCA 2O6VB 1HTOA 2WQYB 1TIFA 3BVMA 3ZNZB 2Y5CA 2YVCA 1HA5A 4JQWC 1N63A 2O2VA 2QIEB 3N20C 4BOSC 2JXXA 2KC2A 1QILA 3IG3A 3AB5A 4HPLB 2V0GA 4US8A 3KW5B 3VUYA 4KZ0A 4YSXB 2BQQA 2BYVE 3PVLA 5GXGB 1YMHE 3AEGB 1E7PB 4RMAA 2OHFA 5IA7A 2IGGA 4A8XC 2BWFA 4XWTA 4MJSB 2K3UA 1TGZB 2JY6A 1SGHA 1E0ZA 2K6QA 4BKTA 4GIVA 1DOYA 3DVNV 4WWNA 2RGFA 3R8BA 4KVGB 1YD8U 2PW9A 5J17A 4BKSD 2VH1A 3EHVA 2V9HA 3AE6B 2N9XA 4YXDB 3DPDA 2WWZA 3VTWA 3HIZA 3PRMB 1WGHA 4JLCA 1IP9A 1JWBD 3CSTA 5D7GA 3RCZA 1E6EB 3SU8X 4AS1A 4DXGA 1EO6A 2WXRA 3QHTA 2Y5BB 4EZLA 4HPPA 1NEKB 3GZNI 3RI7C 2MBQA 2YEPF 4HK2A 1SE2A 2MJDA 2BKRB 2LD9A 4RGNA 4IUMB 2KOXA 1XCTL 2WXJA 4XE0A 4TUUA 2L05A 5DCNA 2AEHA 1E7VA 3PGEA 2KYWA 2KD0A 1I4HA 1XCQL 4N58A 2BW2A 2Z0EB 3MHZA 1OQQA 1TKYA 1M94A 3R2IA 2KT7A 2WDVB 1WZ3A 3SEBA 2MW5A 1GB4A 1V81A 4A9AA 2INDC 4FJVB 4P1BC 1V1PA 1C78A 2KX0A 1R4NI 1D5MC 2IO0B 2W82A 4BFRA 2K22A 1OEYJ 5E6PA 2HJ8A 4B0EA 2M0XA 2MCNB 2KQ4X 1GUAB 2MLBA 5AUIA 3NG0A 3KYCD 4GDKB 3K9OB 1WXMA 3H7PB 1N5XA 4K7UA 4H2AA 1STEA 2DZIA 4K3CA 3KUZA 3P1MA 4PS7A 4KZCA 2KNBA 3CMMB 1ZUD2 2KHWB 3HUIA 3PZ8A 3NZSA 2WDRB 1JRPA 3HVZA 3JSVB 1FD6A 4DQOC 3HM6X 1OEYA 2KN4A 3L17A 1E5WA 1V97A 2KTRA 4G11A 4US9A 1XLPA 1QF6A 2NTSA 2G3QB 1HXYD 1UWMA 3DVGX 4LNNA 3DHIC 2Z59B 2X8XX 5C3JB 1AN8A 1HQRD 1PGAA 4P6VF 2KLCA 1FNVA 1R4NB 4C4VA 2M56B 4G3XB 2JXTA 5L95C 1ZXIA 1TTNA 2NBWB 5CHVC 1XF5L 1L0XB 5TR5A 3NUHB 1YN4A 3MFGA 4RFBA 1WXQA 3RMKC 2WX1A 4IW0A 2KANA 1FCCC 2NBUA 1VLBA 2LZ6A 4GN1A 2D10A 3H7SA 4HKZE 3O13A 1I4PA 3IT6B 3KWVA 2ONQA 1TYGB 2KKCA 3ZVVA 3IAM1 4M0WA 2L76A 4M01A 2GOWA 3VTVA 1DOIA 3V6EB 4LJOB 4MSQB 1RFAA 3KWLA 1TJEA 3R7RA 1E8YA 1UELA 1YQ3B 3DQVA 1OTRB 2PJHA 2MX2A 2DZJA 2KJ6A 1I42A 2N9KA 1KF6B 1R7SA 4WJQA 1IBXB 3VRBB 3AE2B 1MJDA 2ZNVC 2J42A 4L1BA 3PSEB 3NRZA 3KUCB 3ML8A 4IM0A 3A9KB 4YTNB 4AOFA 3GE3C 2MSED 3SFDB 4JE3B 4N6EB 5JXVA 5FR6A 3PHWB 3QIJA 4DBGA 3AH7A 3QC8B 3EGRA 4B6WA 2BS4B 2K6DB 1HE8A 2AQ3B 3L08A 4AWJA 1WMHB 2QC8A 1PGXA 2ZVOA 1C9FA 4W9GA 4LNFA 4XZ4A 3Q3OC 3VRAB 2KMCA 4WWMA 1GC6A 2MEKA 3AEFB 4JWSC 4C7YA 4FBJB 2WXGA 4W9HA 4LCDE 3DCGA 2AQ1B 2LGDA 1PGBA 4BAXA 1FIQA 2PMVA 4NZLB 3RD2A 3T3NA 3AEDB 1BT0A 3Q3JA 4EFOA 2MBHA 3R7QA 2K9XA 4ARIA 1SXTA 3LYYA 2FE8A 1S3SG 3AEBB 2LI5A 2V3PA 1MHXA 3FC4A 1PQSA 2LVQA 2MJ3A 2VH2A 1TT5B 2LXAA 4CO7A 1FXAA 2WXMA 4MJSA 3LXFA 4OVZA 1Y8RC 4FLHA 4R3DA 2ZCBA 3TIXA 1U4AA 1T0SC 1YQBA 3B1LX 2Y5PA 4FXCA 1IUEA 3VTUA 3ZRFA 1WFYA 3PV1A 1EWCA 3B2FA 4PS8A 1ESFA 2JQRB 1WIAA 2DHZA 3Q8AA 2DX5B 2L8JA 3OJ3A 3BVGA 4XX5A 5LXHA 3ALBA 3CIRB 2N1WA 2KACA 1P3QU 1C4PA 1FRDA 3MC9A 4YWGG 2C7HA 4HCNB 2HE7A 2WXOA 1I4GA 2MP2A 4CYEA 2LHEA 2D07B 3RFZB 3RYTA 1V86A 4TKNA 2H88B 3RULA 3P4QB 4WURA 5IO9A 2PLPA 1WRIA
chains in the Genus database with same CATH topology
4NJ7A 1EF1A 5AZHA 4EEWA 3UQAA 1WX9A 1GJZA 3EFUA 1GG3A 4MGZE 2O6VB 4OVUA 2K1FA 4AJYB 4DHJB 3SDLC 1H4RA 1WF9A 3ZNZB 2YVCA 3NHEB 3ZLZA 4JQWC 5CTRC 4ZDVA 4IG7B 2O2VA 5E6OA 4ZRJA 2HTHA 4BOSC 2JXXA 2KC2A 2OJRA 3JVZX 5EDSA 3IG3A 2G4DB 3A4SC 4IM3A 2CR5A 2KTFA 2ZJDA 4RM8A 4HPLB 1VD2A 3TMPB 3KW5B 4IWPA 3U30A 4MGKE 2AL6A 5DPRA 3VUYA 4KZ0A 2FIFA 3ZDMC 2KFKA 3TJPA 3D32A 1WJNA 5AZGA 2CHZA 2GBRA 1LFDA 3PRZA 2BPSA 1NBFC 4F7ZA 3PHXB 4DWFA 2MQJA 1WGDA 2PE9A 3APDA 3PLVA 4HDQA 2BYVE 2RD0A 4RM9A 1KLVA 2N7DA 3PVLA 2CHXA 2KO3A 3MTNB 2O6VA 4RMAA 2NCNA 3VFKA 2L0FA 5IA7A 1Q1OA 2BWFA 4MJSB 2BGFA 4N9F4 4HPMB 1TGZB 2JY6A 4W9LA 1SGHA 3ENEA 2J7QB 2K6QA 4OVVA 4GIVA 3S2AA 4BKTA 2C5LC 4II3B 4ANXA 3DVNV 3L16A 3QX1A 4WWNA 5G2NA 3EC8A 3WIMA 2CHWA 2JZZA 4ANWA 1J0GA 2RGFA 4HVBA 4KVGB 1YD8U 5J17A 3LDZE 2N1VA 4BKSD 4WAAA 1WJ6A 3M62B 3OLMD 3VDZA 1WJ4A 2C9WB 3EHVA 2XBBC 1YX6B 2N9XA 3DPDA 3H7PA 2WWZA 2K8CA 2LVPA 4GDLB 5KHOA 1H8CA 4BKGA 2DZMA 2N4FA 3HIZA 3KYDD 4K1RB 3VTWA 4I6LB 4NNJB 3PRMB 2IY0B 4B9KA 1WGHA 2DZKA 3C0RB 4JLCA 1IP9A 2ZPYA 3CSTA 5D7GA 3RCZA 3QQ8B 1WJUA 1V5TA 3OAWA 4GU2A 3DBHI 3SU8X 1OQYA 3L10B 1V80A 4FJYA 2AL3A 1EO6A 3QHTA 2Y5BB 4EZLA 2FCMA 2V3SA 3KH0A 2NS5A 1KOTA 2KC1A 1T0YA 1OGWA 3X23A 1A5RA 3GZNI 4PYZA 1LQBA 2REXA 2KMAA 4GGQA 2V4LA 1P9DU 2MBQA 5E6NA 4HK2A 2FCQA 4GB9A 4B95A 4K81A 3BY4B 2KDBA 2BKRB 1V6EA 2BYEA 2WYQA 4FN2A 2FUHB 2LD9A 4GDLA 4I6PA 4NQLB 4IUMB 2KOXA 2A5UA 2ZPNA 2DAJA 2KQ7A 1S1QB 4TUUA 2L05A 5DCNA 4E3CA 2A4ZA 1UH6A 2JPHA 2KDFB 1Q5WB 3A4RA 4GMVA 2KN5A 1XD3B 4MSMB 2AEHA 1E7VA 3MHSD 3QWZB 2JUOA 3PGEA 2LRUA 5KHQA 1E8WA 4FHKA 3HM3A 2KD0A 3WA0A 2BYFA 2BWES 1MG8A 1WR1A 1VCBA 3VUWA 2Z0EB 1XT9B 1GNUA 1P0RA 2V1YA 4IWQA 3IFWB 1G6JA 4PYUA 1F9JA 1QZEA 2FCNA 1M94A 3SD5A 2BF8B 3JYUA 3WANA 3V61A 3X0WA 4MELA 4EUTA 1WZ3A 1LM8B 1WX8A 3DBLI 1WH3A 1YIWA 1R4MI 2MW5A 2PE6B 2RPQA 2LRWA 2MBOA 1X1MA 2LXCA 3N30A 4MGYE 3BINA 4W9DA 1WXAA 2I1KA 4URKA 1Q0WB 1V81A 3P2BA 2JT4B 4I6NB 1V5OA 1WXVA 2IO1B 2LGXA 3PREA 4FJVB 4KIKB 3VH3B 3T8MA 2KWUB 3VHTC 2KX0A 1R4NI 2DYBA 3GOEA 2C60A 4K7WA 2FNJB 1J19A 2IO0B 5CHWA 1ISNA 2MWSB 4BFRA 4ASWC 1ZKHA 4P7IA 1OEYJ 2KJHB 5E6PA 2HJ8A 2M0XA 3RZWC 2MCNB 3W1YA 2EMSA 1GUAB 2MLBA 3CSFA 4WWOA 4AP4C 4LDTB 3KYCD 4A3PA 1Z2MA 4GDKB 3K9OB 1NI2A 2LASA 2KTRB 1RRBA 2LUEA 1WXMA 2N9EB 3H7PB 3PLUA 4K7UA 1C3TA 1GC7A 3ZIMA 3CF6E 4E74A 2KVRA 3B0AA 3NS8A 2DAFA 2UWQA 4KIKA 2AWTA 2DZIA 2L7RA 4MM3A 1EF5A 2VRRB 5LLIA 4G50A 4W9IA 3KUZA 1UBIA 3A33B 3ML9A 1UBQA 2IO2B 4PS7A 4FA6A 2J0JA 1JRUA 4G0NB 2IYDB 2OOBB 3VVWB 2ZEQA 4KZCA 2K25A 3ZKJC 2KNBA 2WX0A 2KHWB 3CMMB 4JGHB 4BBNF 4EKUA 3EECA 3NZSA 5C23A 2G4SA 4NQKE 3VQIA 4DHZB 3JSVB 1TZ1A 1P1AA 1WGGA 4E71A 3QARA 5JHAA 3ZTDA 3VXWA 1YX5B 2B3AA 3HM6X 1OEYA 3L17A 5JH5C 2J0MA 2LWPA 4DK5A 1WM2A 4GOCA 1NDDA 2YLMA 4GDKA 4MGIE 2HD5B 4KSKC 3WAPA 1E5WA 2KTRA 4G11A 1WE6A 4KV2A 4WJPA 1LXDA 4X57B 4XC2A 3Q3FA 3UIOB 4DHZE 1C1YB 2GBMA 4F1SA 2G3QB 1L2NA 1V2YA 4WJNA 3QK0A 4ANUA 3AU5A 3DVGX 4DDGD 5AZFA 1KM7A 2Z59B 3KUDB 4MDKE 4ANVA 2ZCCA 3ZNID 1WRDB 4TQ1A 4M0WB 2M1MA 1WMHA 3ECIA 3H9DA 3W1SA 1ZGUB 3JSVA 2KLCA 3H1UA 4F8CB 5L83A 3V60A 4LJPB 5D6JB 3B08A 2JVCA 2EKEC 4AUQC 4G3XB 1AARA 2BKFA 5L95C 1KJTA 3AU4A 2KDEB 1P98A 1TTNA 2KFJA 2NBWB 1SIFA 4W9KA 2GBNA 5CHVC 4DXAB 1UD7A 5TR5A 5JZEB 5J2RA 2FIDA 3U8ZA 2MBEA 5DPWA 1FXTB 2WX1A 3H6NA 4IW0A 2KANA 3WAMA 2NBUA 4PS3A 5CHFA 2UYZB 4W9CA 2LZ6A 4GN1A 2JF5A 2D10A 3H7SA 4KDLB 3IBEA 4HLEA 4MEMA 3TL5A 4NPNA 2PPHA 3A9JB 2JRIB 1IYFA 2I1JA 2KKCA 3ZVVA 2KQSA 2JWZA 3HHMA 4EZKA 2L76A 1WM3A 2GOWA 4A20A 3VTVA 4EOYA 2ZNVB 2R2OA 1L7YA 3ZTCA 4BKSA 3V6EB 4LJOB 4MSQB 3V62A 1E8ZA 1RFAA 2RR9A 3L13A 4BOZB 1RLFA 3JW0X 3DVGY 2NVUI 2IBIB 4GSWA 4NAWA 3UF8A 1XQQA 3PPAA 3R7RA 1E8YA 2O6VD 1UELA 2D3GA 4IC7B 4DHJD 3APCA 4W9JA 4W9FA 3N3KB 3A1QA 2RSUA 3DQVA 1OTRB 2PJHA 3AI5A 4TQ0A 2MX2A 3IHPC 4EZJA 2DENB 2DZJA 2KJ6A 3AXCA 3L54A 1I42A 1WX7A 4WJQA 2FCSA 2L0TA 2W9NA 3A9JA 3PS6A 2MRPA 2WDTB 2ZNVC 4M8MA 2N7EA 1WI0A 1WY8A 4W9EA 3OJ4B 1TBEA 4NJ6A 2PEAA 2NR2A 3PSEB 3M95A 4GXBA 4NY0A 5C1ZA 4MH0E 3DOWA 2KK8A 3KUCB 2DYOA 2KLGA 3ML8A 1K8RB 2D11A 4IM0A 1I35A 2MBBB 3DBSA 3NZUA 4WJOA 1EUVB 1V49A 3TCAA 3A9KB 3RZFA 4AOFA 4FADA 1E8XA 4ZRIA 3RT3B 4ZRKA 2MSED 2JRHA 3MJWA 4M8NA 1YJ1A 4II2B 4K7SA 3ZUNA 4JIOU 2ZVNA 3ZRCA 2M8SA 5FR6A 2KX3A 1E90A 3PHWB 3QIJA 3R3MA 3I3TB 3O65B 4DBGA 5J18A 3QC8B 4B6WA 1Z5SB 3PRPB 3TBLD 2K6DB 4TV3A 1HE8A 3L08A 4AWJA 3ZNHB 1WMHB 2EMTA 3VH4B 3AULA 2ZVOA 2JZ3B 4HJKA 2D2QA 2ASQA 4W9GA 4XZ4A 5D2MB 4ICUA 2R2QA 5JHBA 2KMCA 5CX3A 1GC6A 5LXIB 5DPSA 2GMIC 4FBJB 5AEKB 4W9HA 1SE9A 3A9KA 4LCDE 3IVFA 3NY5A 3DCGA 1ZW7A 4JL9A 2LGDA 3RUIB 3K9PB 4HCPB 4AJWA 3ONSA 1WGYA 3RD2A 4YL8A 1BT0A 3Q3JA 4EFOA 2MBHA 5G55A 3R7QA 2MA9B 3VAWA 3PT2B 3W1SC 3WAOA 1RAXA 2KWVB 4BVUC 2C7NB 3PTFC 3PZDA 1UZXB 2IZVB 2NPTB 3V6CB 2XK5B 2M4NA 3QCAA 2K8BA 1S3SG 2IO3B 2NBVB 3HK0A 3M63B 2CKHB 2L3ZA 4DDID 2LI5A 2KWCA 2J0KA 3R66C 2K8HA 2KXJA 2AYOB 2XEWA 1PQSA 3QJZA 1UGMA 2LVQA 5IAAC 3UIPB 2LXAA 3T9LA 3ZNGC 5BO4B 3VUXA 4ZYNA 4NAWB 1WE7A 4A3OA 4CO7A 3KVFB 5DPTA 3WALA 2G45B 4KSLC 4MJSA 3L0WB 5GMVA 3DBRI 3A1QB 1J8CA 1V9JA 1Y8RC 4FLHA 2ZCBA 1WYWB 2Z0DB 3QA8A 3TIXA 1U4AA 3DVNU 2KJRA 3U7DA 1YQBA 3B1LX 3M3JA 3NOBA 4FULA 4BBNC 4FJZA 2MP2B 2N9PC 4HDOA 2IY1B 1WXSA 2NPTA 2GBJA 1WGRA 2CS4A 2XK5A 3VTUA 2GBKA 4J6IA 3ZRFA 1WFYA 3PV1A 2DYMA 3ZO5B 1E7UA 2M17A 4PS8A 4IWOA 1WZ0A 1WIAA 4WWPA 2DHZA 2DX5B 2L8JA 2LJ5A 1CMXB 3OJ3A 5LXHA 2FAZA 4XX5A 5D94A 4HXDA 4WQOB 2O2VB 3ALBA 4CHKA 2L00B 3QAQA 4HWIB 1D3ZA 2N1WA 2LVOA 1P3QU 3ZDTA 2C7MB 3UGBB 2CU1A 3ZW3A 3SHQA 2C7HA 4HCNB 2KZRA 5HKHA 2HE7A 2K39A 2MP2A 4CYEA 2D07B 2KFKB 3LJ3A 4ICVA 3RYTA 1V86A 4FHJA 4LDTD 4TKNA 3N32A 4IM2A 3DDCB 3UQBA 4KDIC 2LGYA 2QHOA 1WR6E 2ZZPB 3RULA 3UINB 2KDIA 3APFA 1IPGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NJ7 A;  1EF1 A;  5AZH A;  4EEW A;  3UQA A;  1WX9 A;  1GJZ A;  3EFU A;  1GG3 A;  4MGZ E;  2O6V B;  4OVU A;  2K1F A;  4AJY B;  4DHJ B;  3SDL C;  1H4R A;  1WF9 A;  3ZNZ B;  2YVC A;  3NHE B;  3ZLZ A;  4JQW C;  5CTR C;  4ZDV A;  4IG7 B;  2O2V A;  5E6O A;  4ZRJ A;  2HTH A;  4BOS C;  2JXX A;  2KC2 A;  2OJR A;  3JVZ X;  5EDS A;  3IG3 A;  2G4D B;  3A4S C;  4IM3 A;  2CR5 A;  2KTF A;  2ZJD A;  4RM8 A;  4HPL B;  1VD2 A;  3TMP B;  3KW5 B;  4IWP A;  3U30 A;  4MGK E;  2AL6 A;  5DPR A;  3VUY A;  4KZ0 A;  2FIF A;  3ZDM C;  2KFK A;  3TJP A;  3D32 A;  1WJN A;  5AZG A;  2CHZ A;  2GBR A;  1LFD A;  3PRZ A;  2BPS A;  1NBF C;  4F7Z A;  3PHX B;  4DWF A;  2MQJ A;  1WGD A;  2PE9 A;  3APD A;  3PLV A;  4HDQ A;  2BYV E;  2RD0 A;  4RM9 A;  1KLV A;  2N7D A;  3PVL A;  2CHX A;  2KO3 A;  3MTN B;  2O6V A;  4RMA A;  2NCN A;  3VFK A;  2L0F A;  5IA7 A;  1Q1O A;  2BWF A;  4MJS B;  2BGF A;  4N9F 4;  4HPM B;  1TGZ B;  2JY6 A;  4W9L A;  1SGH A;  3ENE A;  2J7Q B;  2K6Q A;  4OVV A;  4GIV A;  3S2A A;  4BKT A;  2C5L C;  4II3 B;  4ANX A;  3DVN V;  3L16 A;  3QX1 A;  4WWN A;  5G2N A;  3EC8 A;  3WIM A;  2CHW A;  2JZZ A;  4ANW A;  1J0G A;  2RGF A;  4HVB A;  4KVG B;  1YD8 U;  5J17 A;  3LDZ E;  2N1V A;  4BKS D;  4WAA A;  1WJ6 A;  3M62 B;  3OLM D;  3VDZ A;  1WJ4 A;  2C9W B;  3EHV A;  2XBB C;  1YX6 B;  2N9X A;  3DPD A;  3H7P A;  2WWZ A;  2K8C A;  2LVP A;  4GDL B;  5KHO A;  1H8C A;  4BKG A;  2DZM A;  2N4F A;  3HIZ A;  3KYD D;  4K1R B;  3VTW A;  4I6L B;  4NNJ B;  3PRM B;  2IY0 B;  4B9K A;  1WGH A;  2DZK A;  3C0R B;  4JLC A;  1IP9 A;  2ZPY A;  3CST A;  5D7G A;  3RCZ A;  3QQ8 B;  1WJU A;  1V5T A;  3OAW A;  4GU2 A;  3DBH I;  3SU8 X;  1OQY A;  3L10 B;  1V80 A;  4FJY A;  2AL3 A;  1EO6 A;  3QHT A;  2Y5B B;  4EZL A;  2FCM A;  2V3S A;  3KH0 A;  2NS5 A;  1KOT A;  2KC1 A;  1T0Y A;  1OGW A;  3X23 A;  1A5R A;  3GZN I;  4PYZ A;  1LQB A;  2REX A;  2KMA A;  4GGQ A;  2V4L A;  1P9D U;  2MBQ A;  5E6N A;  4HK2 A;  2FCQ A;  4GB9 A;  4B95 A;  4K81 A;  3BY4 B;  2KDB A;  2BKR B;  1V6E A;  2BYE A;  2WYQ A;  4FN2 A;  2FUH B;  2LD9 A;  4GDL A;  4I6P A;  4NQL B;  4IUM B;  2KOX A;  2A5U A;  2ZPN A;  2DAJ A;  2KQ7 A;  1S1Q B;  4TUU A;  2L05 A;  5DCN A;  4E3C A;  2A4Z A;  1UH6 A;  2JPH A;  2KDF B;  1Q5W B;  3A4R A;  4GMV A;  2KN5 A;  1XD3 B;  4MSM B;  2AEH A;  1E7V A;  3MHS D;  3QWZ B;  2JUO A;  3PGE A;  2LRU A;  5KHQ A;  1E8W A;  4FHK A;  3HM3 A;  2KD0 A;  3WA0 A;  2BYF A;  2BWE S;  1MG8 A;  1WR1 A;  1VCB A;  3VUW A;  2Z0E B;  1XT9 B;  1GNU A;  1P0R A;  2V1Y A;  4IWQ A;  3IFW B;  1G6J A;  4PYU A;  1F9J A;  1QZE A;  2FCN A;  1M94 A;  3SD5 A;  2BF8 B;  3JYU A;  3WAN A;  3V61 A;  3X0W A;  4MEL A;  4EUT A;  1WZ3 A;  1LM8 B;  1WX8 A;  3DBL I;  1WH3 A;  1YIW A;  1R4M I;  2MW5 A;  2PE6 B;  2RPQ A;  2LRW A;  2MBO A;  1X1M A;  2LXC A;  3N30 A;  4MGY E;  3BIN A;  4W9D A;  1WXA A;  2I1K A;  4URK A;  1Q0W B;  1V81 A;  3P2B A;  2JT4 B;  4I6N B;  1V5O A;  1WXV A;  2IO1 B;  2LGX A;  3PRE A;  4FJV B;  4KIK B;  3VH3 B;  3T8M A;  2KWU B;  3VHT C;  2KX0 A;  1R4N I;  2DYB A;  3GOE A;  2C60 A;  4K7W A;  2FNJ B;  1J19 A;  2IO0 B;  5CHW A;  1ISN A;  2MWS B;  4BFR A;  4ASW C;  1ZKH A;  4P7I A;  1OEY J;  2KJH B;  5E6P A;  2HJ8 A;  2M0X A;  3RZW C;  2MCN B;  3W1Y A;  2EMS A;  1GUA B;  2MLB A;  3CSF A;  4WWO A;  4AP4 C;  4LDT B;  3KYC D;  4A3P A;  1Z2M A;  4GDK B;  3K9O B;  1NI2 A;  2LAS A;  2KTR B;  1RRB A;  2LUE A;  1WXM A;  2N9E B;  3H7P B;  3PLU A;  4K7U A;  1C3T A;  1GC7 A;  3ZIM A;  3CF6 E;  4E74 A;  2KVR A;  3B0A A;  3NS8 A;  2DAF A;  2UWQ A;  4KIK A;  2AWT A;  2DZI A;  2L7R A;  4MM3 A;  1EF5 A;  2VRR B;  5LLI A;  4G50 A;  4W9I A;  3KUZ A;  1UBI A;  3A33 B;  3ML9 A;  1UBQ A;  2IO2 B;  4PS7 A;  4FA6 A;  2J0J A;  1JRU A;  4G0N B;  2IYD B;  2OOB B;  3VVW B;  2ZEQ A;  4KZC A;  2K25 A;  3ZKJ C;  2KNB A;  2WX0 A;  2KHW B;  3CMM B;  4JGH B;  4BBN F;  4EKU A;  3EEC A;  3NZS A;  5C23 A;  2G4S A;  4NQK E;  3VQI A;  4DHZ B;  3JSV B;  1TZ1 A;  1P1A A;  1WGG A;  4E71 A;  3QAR A;  5JHA A;  3ZTD A;  3VXW A;  1YX5 B;  2B3A A;  3HM6 X;  1OEY A;  3L17 A;  5JH5 C;  2J0M A;  2LWP A;  4DK5 A;  1WM2 A;  4GOC A;  1NDD A;  2YLM A;  4GDK A;  4MGI E;  2HD5 B;  4KSK C;  3WAP A;  1E5W A;  2KTR A;  4G11 A;  1WE6 A;  4KV2 A;  4WJP A;  1LXD A;  4X57 B;  4XC2 A;  3Q3F A;  3UIO B;  4DHZ E;  1C1Y B;  2GBM A;  4F1S A;  2G3Q B;  1L2N A;  1V2Y A;  4WJN A;  3QK0 A;  4ANU A;  3AU5 A;  3DVG X;  4DDG D;  5AZF A;  1KM7 A;  2Z59 B;  3KUD B;  4MDK E;  4ANV A;  2ZCC A;  3ZNI D;  1WRD B;  4TQ1 A;  4M0W B;  2M1M A;  1WMH A;  3ECI A;  3H9D A;  3W1S A;  1ZGU B;  3JSV A;  2KLC A;  3H1U A;  4F8C B;  5L83 A;  3V60 A;  4LJP B;  5D6J B;  3B08 A;  2JVC A;  2EKE C;  4AUQ C;  4G3X B;  1AAR A;  2BKF A;  5L95 C;  1KJT A;  3AU4 A;  2KDE B;  1P98 A;  1TTN A;  2KFJ A;  2NBW B;  1SIF A;  4W9K A;  2GBN A;  5CHV C;  4DXA B;  1UD7 A;  5TR5 A;  5JZE B;  5J2R A;  2FID A;  3U8Z A;  2MBE A;  5DPW A;  1FXT B;  2WX1 A;  3H6N A;  4IW0 A;  2KAN A;  3WAM A;  2NBU A;  4PS3 A;  5CHF A;  2UYZ B;  4W9C A;  2LZ6 A;  4GN1 A;  2JF5 A;  2D10 A;  3H7S A;  4KDL B;  3IBE A;  4HLE A;  4MEM A;  3TL5 A;  4NPN A;  2PPH A;  3A9J B;  2JRI B;  1IYF A;  2I1J A;  2KKC A;  3ZVV A;  2KQS A;  2JWZ A;  3HHM A;  4EZK A;  2L76 A;  1WM3 A;  2GOW A;  4A20 A;  3VTV A;  4EOY A;  2ZNV B;  2R2O A;  1L7Y A;  3ZTC A;  4BKS A;  3V6E B;  4LJO B;  4MSQ B;  3V62 A;  1E8Z A;  1RFA A;  2RR9 A;  3L13 A;  4BOZ B;  1RLF A;  3JW0 X;  3DVG Y;  2NVU I;  2IBI B;  4GSW A;  4NAW A;  3UF8 A;  1XQQ A;  3PPA A;  3R7R A;  1E8Y A;  2O6V D;  1UEL A;  2D3G A;  4IC7 B;  4DHJ D;  3APC A;  4W9J A;  4W9F A;  3N3K B;  3A1Q A;  2RSU A;  3DQV A;  1OTR B;  2PJH A;  3AI5 A;  4TQ0 A;  2MX2 A;  3IHP C;  4EZJ A;  2DEN B;  2DZJ A;  2KJ6 A;  3AXC A;  3L54 A;  1I42 A;  1WX7 A;  4WJQ A;  2FCS A;  2L0T A;  2W9N A;  3A9J A;  3PS6 A;  2MRP A;  2WDT B;  2ZNV C;  4M8M A;  2N7E A;  1WI0 A;  1WY8 A;  4W9E A;  3OJ4 B;  1TBE A;  4NJ6 A;  2PEA A;  2NR2 A;  3PSE B;  3M95 A;  4GXB A;  4NY0 A;  5C1Z A;  4MH0 E;  3DOW A;  2KK8 A;  3KUC B;  2DYO A;  2KLG A;  3ML8 A;  1K8R B;  2D11 A;  4IM0 A;  1I35 A;  2MBB B;  3DBS A;  3NZU A;  4WJO A;  1EUV B;  1V49 A;  3TCA A;  3A9K B;  3RZF A;  4AOF A;  4FAD A;  1E8X A;  4ZRI A;  3RT3 B;  4ZRK A;  2MSE D;  2JRH A;  3MJW A;  4M8N A;  1YJ1 A;  4II2 B;  4K7S A;  3ZUN A;  4JIO U;  2ZVN A;  3ZRC A;  2M8S A;  5FR6 A;  2KX3 A;  1E90 A;  3PHW B;  3QIJ A;  3R3M A;  3I3T B;  3O65 B;  4DBG A;  5J18 A;  3QC8 B;  4B6W A;  1Z5S B;  3PRP B;  3TBL D;  2K6D B;  4TV3 A;  1HE8 A;  3L08 A;  4AWJ A;  3ZNH B;  1WMH B;  2EMT A;  3VH4 B;  3AUL A;  2ZVO A;  2JZ3 B;  4HJK A;  2D2Q A;  2ASQ A;  4W9G A;  4XZ4 A;  5D2M B;  4ICU A;  2R2Q A;  5JHB A;  2KMC A;  5CX3 A;  1GC6 A;  5LXI B;  5DPS A;  2GMI C;  4FBJ B;  5AEK B;  4W9H A;  1SE9 A;  3A9K A;  4LCD E;  3IVF A;  3NY5 A;  3DCG A;  1ZW7 A;  4JL9 A;  2LGD A;  3RUI B;  3K9P B;  4HCP B;  4AJW A;  3ONS A;  1WGY A;  3RD2 A;  4YL8 A;  1BT0 A;  3Q3J A;  4EFO A;  2MBH A;  5G55 A;  3R7Q A;  2MA9 B;  3VAW A;  3PT2 B;  3W1S C;  3WAO A;  1RAX A;  2KWV B;  4BVU C;  2C7N B;  3PTF C;  3PZD A;  1UZX B;  2IZV B;  2NPT B;  3V6C B;  2XK5 B;  2M4N A;  3QCA A;  2K8B A;  1S3S G;  2IO3 B;  2NBV B;  3HK0 A;  3M63 B;  2CKH B;  2L3Z A;  4DDI D;  2LI5 A;  2KWC A;  2J0K A;  3R66 C;  2K8H A;  2KXJ A;  2AYO B;  2XEW A;  1PQS A;  3QJZ A;  1UGM A;  2LVQ A;  5IAA C;  3UIP B;  2LXA A;  3T9L A;  3ZNG C;  5BO4 B;  3VUX A;  4ZYN A;  4NAW B;  1WE7 A;  4A3O A;  4CO7 A;  3KVF B;  5DPT A;  3WAL A;  2G45 B;  4KSL C;  4MJS A;  3L0W B;  5GMV A;  3DBR I;  3A1Q B;  1J8C A;  1V9J A;  1Y8R C;  4FLH A;  2ZCB A;  1WYW B;  2Z0D B;  3QA8 A;  3TIX A;  1U4A A;  3DVN U;  2KJR A;  3U7D A;  1YQB A;  3B1L X;  3M3J A;  3NOB A;  4FUL A;  4BBN C;  4FJZ A;  2MP2 B;  2N9P C;  4HDO A;  2IY1 B;  1WXS A;  2NPT A;  2GBJ A;  1WGR A;  2CS4 A;  2XK5 A;  3VTU A;  2GBK A;  4J6I A;  3ZRF A;  1WFY A;  3PV1 A;  2DYM A;  3ZO5 B;  1E7U A;  2M17 A;  4PS8 A;  4IWO A;  1WZ0 A;  1WIA A;  4WWP A;  2DHZ A;  2DX5 B;  2L8J A;  2LJ5 A;  1CMX B;  3OJ3 A;  5LXH A;  2FAZ A;  4XX5 A;  5D94 A;  4HXD A;  4WQO B;  2O2V B;  3ALB A;  4CHK A;  2L00 B;  3QAQ A;  4HWI B;  1D3Z A;  2N1W A;  2LVO A;  1P3Q U;  3ZDT A;  2C7M B;  3UGB B;  2CU1 A;  3ZW3 A;  3SHQ A;  2C7H A;  4HCN B;  2KZR A;  5HKH A;  2HE7 A;  2K39 A;  2MP2 A;  4CYE A;  2D07 B;  2KFK B;  3LJ3 A;  4ICV A;  3RYT A;  1V86 A;  4FHJ A;  4LDT D;  4TKN A;  3N32 A;  4IM2 A;  3DDC B;  3UQB A;  4KDI C;  2LGY A;  2QHO A;  1WR6 E;  2ZZP B;  3RUL A;  3UIN B;  2KDI A;  3APF A;  1IPG A; 
#chains in the Genus database with same CATH topology
 4NJ7 A;  1EF1 A;  5AZH A;  1GJZ A;  1WX9 A;  1GG3 A;  2I38 A;  4MGZ E;  4A55 A;  1J7C A;  1WF9 A;  2WXF A;  3NHE B;  5CTR C;  4ZDV A;  2JSV X;  5EDS A;  1YQ4 B;  4IM3 A;  2CR5 A;  2KTF A;  4RM8 A;  3P4P B;  2AL6 A;  5DPR A;  1SJH D;  2KFK A;  1WJN A;  1LFD A;  3PRZ A;  1WWT A;  4KKJ A;  3PHX B;  2PE9 A;  1JRO A;  3PLV A;  2NCN A;  2N0S B;  2BGF A;  3AN1 A;  1BML C;  2J7Q B;  3MC0 B;  3QX1 A;  3W2D A;  2CHW A;  4ANW A;  1J0G A;  5H92 C;  3GS2 A;  1QQR A;  1PYW D;  4HVB A;  2XN9 C;  3TEZ A;  3LDZ E;  4WAA A;  3VDZ A;  4KGS A;  2XBB C;  3I63 C;  3H7P A;  3EFC A;  2LVP A;  2DZM A;  3KYD D;  1E10 A;  1NEN B;  3C0R B;  1NI3 A;  1V80 A;  2AL3 A;  4C80 A;  4RNA A;  2WHI A;  1PUT A;  2FCM A;  3KH0 A;  1KOT A;  2KC1 A;  2QDF A;  2QJL A;  1LQB A;  2V4L A;  4B95 A;  1MI0 A;  3BY4 B;  2MJE A;  2BYE A;  1BUI C;  1DOX A;  4GDL A;  4NQL B;  3CWI A;  2KQ7 A;  1AWD A;  4E3C A;  2JPH A;  4GMV A;  2INP E;  4MSM B;  1T0R C;  1E8W A;  3WA0 A;  1MG8 A;  1WR1 A;  1VCB A;  2V1Y A;  1G6J A;  1WYG A;  2FCN A;  2YEP B;  3X0W A;  5IKC M;  3RNF C;  2LRW A;  1X1M A;  3N30 A;  4MGY E;  4URK A;  1Q0W B;  4I6N B;  3P2B A;  4KIK B;  1V5O A;  1WXV A;  2IO1 B;  3VH3 B;  2LGS A;  2DYB A;  1J19 A;  5CHW A;  1ISN A;  1QOF A;  4P7I A;  2KJH B;  1BXT A;  4KGR A;  3Q8F A;  3RZW C;  2CU3 A;  1NYR A;  3BZD B;  2I2Y A;  2Y3A A;  3CSF A;  4WWO A;  3AE8 B;  4LDT B;  4A3P A;  4UDU C;  1F52 A;  2WXQ A;  2UWQ A;  2AWT A;  2L7R A;  2G1E A;  5LLI A;  2R61 A;  1KFY B;  3ML9 A;  2IO2 B;  1EM7 A;  2J0J A;  4G0N B;  2IYD B;  2Q5W D;  2K25 A;  1J7B A;  4EKU A;  3BYT B;  1L4Z B;  4JGH B;  2QIL A;  1LO5 D;  3VQI A;  4DHZ B;  1TZ1 A;  3QAR A;  1YJI A;  1NDD A;  4MGI E;  5IOI A;  1KH0 A;  3FKY A;  1PDX A;  1WE6 A;  2RPV A;  4WJP A;  4X57 B;  3Q3F A;  3UIO B;  4DHZ E;  1D6E C;  1I4Q A;  3P63 A;  1V2Y A;  4XDD A;  2WP9 B;  3QK0 A;  4ANU A;  4DDG D;  1TS3 A;  1QOB A;  5AZF A;  1QOA A;  1KM7 A;  4MT5 A;  3KUD B;  3ZNI D;  1D4B A;  1WMH A;  1TKE A;  3ECI A;  1OFF A;  3W1S A;  3H1U A;  1MHH E;  3KLS X;  5MPO A;  4LJP B;  5D6J B;  3B08 A;  2JVC A;  1K50 A;  1GOZ A;  5BYQ A;  1KJT A;  3AU4 A;  1P98 A;  2KFJ A;  1SIF A;  4W9K A;  2GBN A;  4DXA B;  2LMC A;  3BII D;  2FID A;  2MBE A;  4IKG A;  4PS3 A;  5TSS A;  3TL5 A;  4NPN A;  3Q14 C;  2JRI B;  2I1J A;  2LUM A;  2JWZ A;  3HHM A;  4EZK A;  1L7Y A;  1SEB D;  1CK1 A;  1VZ8 A;  1RLF A;  3JW0 X;  2NVU I;  2IBI B;  4GSW A;  1XQQ A;  3PPA A;  3MC8 A;  1FM0 D;  2D3G A;  3V3X A;  1N62 A;  4DHJ D;  4W9J A;  4W9F A;  5D3D A;  3N3K B;  1JW9 D;  2E6X A;  3AI5 A;  5G5H A;  4XDC A;  1DYQ A;  4EZJ A;  3AXC A;  4MM3 B;  2L0T A;  3A9J A;  5LNK 1;  3FIL B;  1WI0 A;  1C79 A;  1WY8 A;  4RH6 A;  3OJ4 B;  1TBE A;  2KDM A;  4NJ6 A;  4ITK A;  3W9C B;  4GXB A;  4MH0 E;  2DYO A;  3ETR A;  4TSS A;  3BK2 A;  2MBB B;  3DBS A;  3DWG C;  4ZRQ A;  3N1X C;  1YJ1 A;  3EA6 A;  2MHJ A;  3ZRC A;  2M8S A;  4USA A;  2J53 A;  2WXP A;  3R3M A;  2GRI A;  1TKG A;  3TBL D;  1UUP A;  1EWY C;  4TV3 A;  3RNC C;  3ZNH B;  2EMT A;  2LJI A;  3VH4 B;  3AUL A;  3DBR B;  2D2Q A;  2WXK A;  5HFY A;  2D3C A;  2EKI A;  4M02 A;  5LXI B;  2HTM E;  2GMI C;  5DPS A;  3IVF A;  4JL9 A;  5EE1 A;  3P4S B;  1K51 A;  1XO3 A;  1WSP A;  3C8Y A;  3ONS A;  4YL8 A;  3E56 A;  4OZA A;  3RNA C;  2IZV B;  4OZC A;  2XK5 B;  2K8B A;  3OG5 A;  2NBV B;  3HK0 A;  1MG4 A;  1SJE D;  2KWC A;  2K8H A;  2AYO B;  3UIP B;  3ZNG C;  3VUX A;  1VZ7 A;  1AYF A;  1WE7 A;  4NAW B;  4A3O A;  3NVV A;  3TEW A;  1F2R C;  3A1Q B;  2D5G A;  5EE3 A;  1XEE A;  1WYW B;  2Z0D B;  5HHD G;  2KJR A;  3DHH C;  1MVK A;  3M3J A;  3RNG C;  4J3O D;  1ZP0 B;  1FNW A;  2NPT A;  2GBJ A;  2CS4 A;  2IPK D;  1SBB B;  1FO4 A;  3ZO5 B;  1B9R A;  4TMA B;  1E7U A;  2M17 A;  4IWO A;  4LNI A;  5HG2 A;  4LK0 M;  4YSZ B;  2IGH A;  2LJ5 A;  2FAZ A;  2LFI A;  4WQO B;  2ICI A;  2O2V B;  4D2K A;  3QAQ A;  4RF0 A;  1D3Z A;  2W3S A;  3ZDT A;  2WNM A;  3TEX A;  2W3R A;  2K39 A;  5IN7 A;  3UQB A;  3DDC B;  4KDI C;  2KDI A;  2WU5 B;  3HRD D;  4OVU A;  1TS5 A;  2UU7 A;  4AJY B;  4A90 A;  3NVY A;  1P7E A;  1N60 A;  1ROE A;  4WQM A;  1B1Z A;  5E6O A;  2OJR A;  2G4D B;  2IJ0 A;  4S0R A;  2NTT A;  2PVO D;  2ZJD A;  3TMP B;  1VD2 A;  4IWP A;  3B9J A;  3U30 A;  1Y56 A;  3DBH B;  3D32 A;  3TJP A;  2GBR A;  3N1Y C;  2BPS A;  3R2T A;  4DWF A;  4RGO S;  2MQJ A;  4HDQ A;  4RM9 A;  1KLV A;  2N7D A;  2CHX A;  2O6V A;  1XXG A;  2L0F A;  1Q1O A;  2BT6 A;  4HPM B;  4W9L A;  4ANX A;  4II3 B;  3L16 A;  1VDV A;  1UGJ A;  3P42 A;  3PZ7 A;  1KLU D;  5FK9 C;  1L0Y B;  2DWQ A;  4LLG M;  2WGS A;  3Q3N C;  1WJ6 A;  2BS2 B;  2RDH A;  3M62 B;  3OLM D;  1WJ4 A;  2C9W B;  4IOI E;  1YX6 B;  4OHJ A;  3MP9 A;  1EU4 A;  2K8C A;  1H8C A;  4I6L B;  1C76 A;  2IY0 B;  4B9K A;  2OJW A;  2BS3 B;  1NVI D;  1V5T A;  1OQY A;  3L10 B;  4FJY A;  2ON8 A;  4WH4 A;  3DBL B;  4RF1 A;  3RN9 C;  2SAK A;  1T0Y A;  4PYZ A;  2REX A;  2KMA A;  4GB9 A;  3SFE B;  4K81 A;  1ZDV A;  2QSD A;  3BK1 A;  2INN E;  1YN5 A;  2FUH B;  4HKQ A;  4I6P A;  1I7H A;  3GB1 A;  3B2G A;  3HVD A;  2A5U A;  2ZPN A;  1WGK A;  1UH6 A;  2KDF B;  4PK1 A;  1V1P B;  1Q5W B;  4WIP A;  3TUO A;  2KN5 A;  1XD3 B;  2JUO A;  4FHK A;  4HRO A;  3HM3 A;  2BYF A;  2BWE S;  2J4X A;  3LB8 C;  3ZJV A;  3VUW A;  2VZK B;  1XT9 B;  1P0R A;  1T5X D;  3IFW B;  1FMA D;  2WXN A;  4IWQ A;  4LNO A;  1F2R I;  1F9J A;  5AUK A;  5C2T B;  3WAN A;  3V61 A;  4MEL A;  1LM8 B;  1WH3 A;  1YIW A;  1R4M I;  2PE6 B;  2RPQ A;  3U4E G;  1GAQ B;  3BIN A;  1WXA A;  2JT4 B;  3PRE A;  5L83 A;  1VZ6 A;  4HEA 1;  3T8M A;  3GOE A;  2C60 A;  4K7W A;  3KQ4 A;  4RCO A;  3URY A;  2MWS B;  3P4R B;  4ASW C;  3ABV B;  3W1Y A;  2K0P A;  4JWU C;  4AP4 C;  1ZOY B;  2LAS A;  2KTR B;  1RRB A;  2QEJ C;  1GC7 A;  3ZIM A;  3CF6 E;  2KVR A;  3B0A A;  3NS8 A;  2DAF A;  4K3B A;  4MM3 A;  1FEH A;  1EF5 A;  1SIJ A;  2WXH A;  4G50 A;  1UBI A;  1UBQ A;  1L0V B;  4FA6 A;  3AE9 B;  1JRU A;  1V8C A;  2ZEQ A;  1PFD A;  1FRR A;  2WX0 A;  2W55 A;  4BBN F;  2N9L A;  5C23 A;  2G4S A;  4NQK E;  1WGG A;  3N9Y C;  4KX6 B;  2FUG 1;  4DK5 A;  4GDK A;  2HD5 B;  3AE7 B;  2EEL A;  3WAP A;  2SEB D;  4KV2 A;  1C1Y B;  2GBM A;  4ZHP A;  4WJN A;  4B0M A;  3AU5 A;  2INC C;  3RNB C;  1WRD B;  1R4M B;  4M0W B;  1QLB B;  3PO0 A;  3Q6B A;  4XYC A;  2KMM A;  3H9D A;  3JSV A;  4F8C B;  2ACZ B;  2IDY A;  4ZRP A;  4DXF A;  3AE5 B;  1JWS D;  3Q8E A;  2XNA C;  1T3Q A;  2KDE B;  4YTP B;  1E9M A;  5JZE B;  1P7F A;  5J2R A;  3U8Z A;  5DPW A;  1FXT B;  3H6N A;  1MPE A;  5CHF A;  1L4D B;  3I9V 1;  2UYZ B;  4W9C A;  2JF5 A;  4KDL B;  4HLE A;  3C19 A;  3W5U B;  2WXL A;  1I4R A;  3AEA B;  3AV8 A;  5HI1 A;  3Q2A C;  3NVZ A;  1HZ6 A;  4A20 A;  1C4C A;  2ZNV B;  3ZTC A;  3VR8 B;  1E8Z A;  2RR9 A;  4BOZ B;  4NAW A;  3UF8 A;  2O6V D;  2X38 A;  3A1Q A;  4TQ0 A;  2DEN B;  1V1O A;  3L54 A;  3RPF C;  2M0A A;  2FCS A;  2DBY A;  2W9N A;  1FNU A;  2MRP A;  4M8M A;  2GLS A;  4W9E A;  2NR2 A;  5EE9 A;  3M95 A;  2KK8 A;  2PVG C;  2B76 B;  2KLG A;  1K8R B;  2D11 A;  1I35 A;  3VR9 B;  4WJO A;  1EUV B;  4FAD A;  1E8X A;  4ZRK A;  2AX5 A;  2L32 A;  2JRH A;  3MJW A;  4M8N A;  4II2 B;  2ZVN A;  4OW0 A;  1IBX A;  2JYE A;  2KX3 A;  2WU2 B;  5J18 A;  3O65 B;  4ZHO A;  2GB1 A;  1KTK A;  1Z5S B;  1JWU D;  4ARC A;  4EE2 A;  3H8H A;  2QCZ A;  1QT9 A;  2R2Q A;  5CX3 A;  1ZDX A;  5AEK B;  1N6Z A;  3A9K A;  1JWM D;  4GLS C;  1CQV A;  1ZW7 A;  1JCK B;  1RYJ A;  2H89 B;  4L2Y A;  3RUI B;  1LGR A;  3K9P B;  2KVZ A;  4HCP B;  2RMM A;  5BYR A;  1WGY A;  3VAW A;  3W1S C;  4BVU C;  2C7N B;  3PTF C;  1ZXH A;  1UZX B;  1IGD A;  2M4N A;  2IO3 B;  2CKH B;  2L3Z A;  2JX5 A;  2J0K A;  3QJZ A;  3BYY B;  1UGM A;  1JML A;  3T9L A;  2G9H D;  5BO4 B;  4ZYN A;  4HJG E;  1K52 A;  3KVF B;  2KAJ A;  2G45 B;  2NMQ A;  3DBR I;  2ZW1 A;  1J8C A;  1V9J A;  1ZPS A;  3QA8 A;  4P1C C;  3AEE B;  3U7D A;  4FUL A;  3U52 E;  4BBN C;  4FJZ A;  4MAC A;  2MP2 B;  4HDO A;  1KRH A;  2L1A A;  2IY1 B;  4KGT A;  1WGR A;  2DYM A;  2IGD A;  1T6B X;  4QAY A;  1TY2 A;  1WZ0 A;  5T8I A;  1YOV B;  1CMX B;  4HXD A;  4CHK A;  5H8Y E;  3V05 A;  3ZJT A;  2C7M B;  3UGB B;  2CU1 A;  1FXI A;  2LGI A;  5HKH A;  2KZR A;  3AE4 B;  4ICV A;  2KFK B;  3LJ3 A;  3N32 A;  1XLO A;  2WLB A;  2LGY A;  3UIN B;  1WR6 E;  3APF A;  1IPG A;  5FKA C;  3BVZ A;  4EEW A;  3UQA A;  1RM6 C;  3EFU A;  2K1F A;  4DHJ B;  3SDL C;  1H4R A;  1QKZ A;  3NZ3 A;  5I4D A;  3ZLZ A;  4IG7 B;  4BZA A;  2CJN A;  4ZRJ A;  2HTH A;  4RGT A;  3JVZ X;  3A4S C;  3E9S A;  3WCQ A;  2BB6 A;  4MGK E;  2FIF A;  3ZDM C;  3GP7 A;  2JU6 X;  2QMT A;  5AZG A;  2CHZ A;  1VRA B;  1NBF C;  3OWE B;  4F7Z A;  1WGD A;  3APD A;  4YT0 B;  2WS3 B;  4C7Z A;  2RD0 A;  2DLB A;  4ZYS A;  3ZGZ A;  2KO3 A;  3MTN B;  3GZN B;  3VFK A;  2TSS A;  4N9F 4;  2KWD A;  3ENE A;  4OVV A;  3S2A A;  2C5L C;  5G2N A;  3EC8 A;  3WIM A;  1L5P A;  2JZZ A;  2JWU A;  3BWU D;  2N1V A;  1FPY A;  4CQN A;  3Q69 A;  5KHO A;  1HZ5 A;  4GDL B;  4JPS A;  4BKG A;  2N4F A;  4K1R B;  4NNJ B;  1UWX A;  1XLQ A;  2DZK A;  2ZPY A;  2V3N A;  3QQ8 B;  1WJU A;  3OAW A;  4GU2 A;  3DBH I;  4C56 C;  4LNK A;  2V3S A;  1ZE3 D;  2NS5 A;  1A70 A;  2FBW B;  1OGW A;  3X23 A;  1A5R A;  1ET6 A;  4GGQ A;  1P9D U;  5E6N A;  1K53 A;  2FCQ A;  2GI9 A;  2KDB A;  1V6E A;  2WYQ A;  4FN2 A;  2DAJ A;  1S1Q B;  2A4Z A;  3A4R A;  1N61 A;  1HEZ E;  3MHS D;  1SSN A;  3QWZ B;  2LRU A;  5KHQ A;  1CJE A;  1T0Q C;  3AE3 B;  1L6U A;  3GE8 C;  1GNU A;  2BBC A;  3ZQ4 A;  1I4X A;  4PYU A;  1QZE A;  3SD5 A;  2BF8 B;  3JYU A;  4EUT A;  3DBL I;  1WX8 A;  4HWI B;  1VJK A;  4JX1 C;  2MBO A;  2LXC A;  4W9D A;  5BYS A;  4YSY B;  1TZO A;  2I1K A;  2LGX A;  3VHT C;  2KWU B;  1KLG D;  2FNJ B;  1TS4 A;  5BMI A;  3AE1 B;  1ZKH A;  2HDE A;  2EMS A;  1OQR A;  3ZYY X;  1ACC A;  3L4P A;  1EU3 A;  1GPX A;  1Z2M A;  4ACF A;  1NI2 A;  2LUE A;  2N9E B;  3PLU A;  1C3T A;  2J52 A;  4E74 A;  2DNF A;  2AQ2 B;  1YN3 A;  4KIK A;  2PTL A;  1QOG A;  2JZP A;  1VR9 A;  2VRR B;  5G5G A;  4AQ7 A;  2LEK A;  2W54 A;  4W9I A;  1MFW A;  4NJC A;  3A33 B;  2OOB B;  3VVW B;  4YTM B;  3ZKJ C;  3EEC A;  1YJJ A;  1JAL A;  1P1A A;  3AMZ A;  4E71 A;  5JHA A;  4MH8 A;  3ZTD A;  3VXW A;  1YX5 B;  2B3A A;  3NS1 A;  5JH5 C;  2J0M A;  2LWP A;  1WM2 A;  4GOC A;  2YLM A;  1D5Z C;  4KSK C;  2M19 A;  4A6Q A;  3NVW A;  1LXD A;  4XC2 A;  4Q2J A;  4F1S A;  1L2N A;  2V4I B;  4PT5 A;  3UI3 A;  3FAH A;  4MDK E;  4ANV A;  2ZCC A;  4TQ1 A;  1FFV A;  2M1M A;  2OED A;  3ZJU A;  1ZGU B;  2L52 A;  3V60 A;  4IDI A;  3Q3M C;  2EKE C;  4AUQ C;  2K5P A;  2N7J A;  1AAR A;  3NJT A;  2BKF A;  3W5V B;  1UD7 A;  1Q10 A;  4O1N A;  3AM9 A;  3WAM A;  3Q8C A;  5IP4 D;  3IBE A;  1UNS A;  4MEM A;  3Q8B A;  2VZK D;  2PPH A;  3A9J B;  1IYF A;  2KQS A;  2BVC A;  4NAM A;  1WM3 A;  4EOY A;  2R2O A;  3DWM A;  4BKS A;  1UF0 A;  3T3O A;  2WXI A;  3V62 A;  3L13 A;  3U2S C;  1C4A A;  3DVG Y;  1M4V A;  1DGJ A;  4IC7 B;  3APC A;  1N5W A;  2RSU A;  3IHP C;  1F77 A;  4REZ A;  3I5J C;  1WX7 A;  1J7A A;  3IAS 1;  3PS6 A;  2WDT B;  5BMH A;  3IT4 B;  2N7E A;  4RGM A;  2PEA A;  4S17 A;  3TSS A;  4NY0 A;  4C00 A;  5C1Z A;  3DOW A;  2D3B A;  3NZU A;  1V49 A;  3TCA A;  3RZF A;  3AEC B;  3RT3 B;  4ZRI A;  2D3A A;  2CJO A;  4K7S A;  1NYQ A;  4XGA B;  3IXS A;  1RWS A;  3ZUN A;  4JIO U;  1TS2 A;  4N59 A;  3TEY A;  1GB1 A;  1E90 A;  3I3T B;  4ZOH C;  2JYT A;  3PRP B;  3FIL A;  3ZXV A;  1HTQ A;  2JZ3 B;  4HJK A;  5EE0 A;  2ASQ A;  1FFU A;  5D2M B;  4ICU A;  3EUB 2;  2ZW0 A;  4C4V B;  5E6J A;  2BB5 A;  5JHB A;  3I57 A;  1YNT E;  1SE9 A;  3NY5 A;  1D5X C;  2BTE A;  2BYT A;  4KKI A;  1SE4 A;  1CZP A;  2RDG A;  4AJW A;  1ENF A;  3J9C A;  2PKO A;  4LTU A;  5G55 A;  3WAO A;  2MA9 B;  3PT2 B;  1RAX A;  2KWV B;  3PZD A;  2NPT B;  3V6C B;  3QCA A;  1C77 A;  3M63 B;  1SE3 A;  4DDI D;  4L23 A;  3R66 C;  2KXJ A;  2XEW A;  2E3T A;  5IAA C;  2LHD A;  3U7Z A;  3DHG C;  2MH7 A;  1AW7 A;  4HRS A;  5DPT A;  3WAL A;  4KSL C;  3L0W B;  5GMV A;  5BMG A;  4M00 A;  4P16 A;  3ZXR A;  3DVN U;  3SR6 A;  3NOB A;  1FCL A;  2HJ1 A;  1L6V A;  2N9P C;  1WXS A;  2L83 A;  3MJ5 A;  2PIA A;  2XK5 A;  2GBK A;  4J6I A;  3RNE C;  2Z8L A;  2RDB C;  4OZB A;  4WAF A;  4WWP A;  3N1Z C;  1TY0 A;  1F0Z A;  1ET9 A;  5D94 A;  1JQ4 A;  1SF0 A;  4XWW A;  1JWA D;  2L00 B;  2WDQ B;  1RFK A;  1SB3 C;  2LVO A;  5FR3 A;  3ZW3 A;  3SHQ A;  5D3I B;  4FHJ A;  4LDT D;  4IM2 A;  1XLN A;  2QHO A;  2ZZP B;  1F1H A;  1IGC A;  2O6V B;  1HTO A;  2WQY B;  1TIF A;  3BVM A;  3ZNZ B;  2Y5C A;  2YVC A;  1HA5 A;  4JQW C;  1N63 A;  2O2V A;  2QIE B;  3N20 C;  4BOS C;  2JXX A;  2KC2 A;  1QIL A;  3IG3 A;  3AB5 A;  4HPL B;  2V0G A;  4US8 A;  3KW5 B;  3VUY A;  4KZ0 A;  4YSX B;  2BQQ A;  2BYV E;  3PVL A;  5GXG B;  1YMH E;  3AEG B;  1E7P B;  4RMA A;  2OHF A;  5IA7 A;  2IGG A;  4A8X C;  2BWF A;  4XWT A;  4MJS B;  2K3U A;  1TGZ B;  2JY6 A;  1SGH A;  1E0Z A;  2K6Q A;  4BKT A;  4GIV A;  1DOY A;  3DVN V;  4WWN A;  2RGF A;  3R8B A;  4KVG B;  1YD8 U;  2PW9 A;  5J17 A;  4BKS D;  2VH1 A;  3EHV A;  2V9H A;  3AE6 B;  2N9X A;  4YXD B;  3DPD A;  2WWZ A;  3VTW A;  3HIZ A;  3PRM B;  1WGH A;  4JLC A;  1IP9 A;  1JWB D;  3CST A;  5D7G A;  3RCZ A;  1E6E B;  3SU8 X;  4AS1 A;  4DXG A;  1EO6 A;  2WXR A;  3QHT A;  2Y5B B;  4EZL A;  4HPP A;  1NEK B;  3GZN I;  3RI7 C;  2MBQ A;  2YEP F;  4HK2 A;  1SE2 A;  2MJD A;  2BKR B;  2LD9 A;  4RGN A;  4IUM B;  2KOX A;  1XCT L;  2WXJ A;  4XE0 A;  4TUU A;  2L05 A;  5DCN A;  2AEH A;  1E7V A;  3PGE A;  2KYW A;  2KD0 A;  1I4H A;  1XCQ L;  4N58 A;  2BW2 A;  2Z0E B;  3MHZ A;  1OQQ A;  1TKY A;  1M94 A;  3R2I A;  2KT7 A;  2WDV B;  1WZ3 A;  3SEB A;  2MW5 A;  1GB4 A;  1V81 A;  4A9A A;  2IND C;  4FJV B;  4P1B C;  1V1P A;  1C78 A;  2KX0 A;  1R4N I;  1D5M C;  2IO0 B;  2W82 A;  4BFR A;  2K22 A;  1OEY J;  5E6P A;  2HJ8 A;  4B0E A;  2M0X A;  2MCN B;  2KQ4 X;  1GUA B;  2MLB A;  5AUI A;  3NG0 A;  3KYC D;  4GDK B;  3K9O B;  1WXM A;  3H7P B;  1N5X A;  4K7U A;  4H2A A;  1STE A;  2DZI A;  4K3C A;  3KUZ A;  3P1M A;  4PS7 A;  4KZC A;  2KNB A;  3CMM B;  1ZUD 2;  2KHW B;  3HUI A;  3PZ8 A;  3NZS A;  2WDR B;  1JRP A;  3HVZ A;  3JSV B;  1FD6 A;  4DQO C;  3HM6 X;  1OEY A;  2KN4 A;  3L17 A;  1E5W A;  1V97 A;  2KTR A;  4G11 A;  4US9 A;  1XLP A;  1QF6 A;  2NTS A;  2G3Q B;  1HXY D;  1UWM A;  3DVG X;  4LNN A;  3DHI C;  2Z59 B;  2X8X X;  5C3J B;  1AN8 A;  1HQR D;  1PGA A;  4P6V F;  2KLC A;  1FNV A;  1R4N B;  4C4V A;  2M56 B;  4G3X B;  2JXT A;  5L95 C;  1ZXI A;  1TTN A;  2NBW B;  5CHV C;  1XF5 L;  1L0X B;  5TR5 A;  3NUH B;  1YN4 A;  3MFG A;  4RFB A;  1WXQ A;  3RMK C;  2WX1 A;  4IW0 A;  2KAN A;  1FCC C;  2NBU A;  1VLB A;  2LZ6 A;  4GN1 A;  2D10 A;  3H7S A;  4HKZ E;  3O13 A;  1I4P A;  3IT6 B;  3KWV A;  2ONQ A;  1TYG B;  2KKC A;  3ZVV A;  3IAM 1;  4M0W A;  2L76 A;  4M01 A;  2GOW A;  3VTV A;  1DOI A;  3V6E B;  4LJO B;  4MSQ B;  1RFA A;  3KWL A;  1TJE A;  3R7R A;  1E8Y A;  1UEL A;  1YQ3 B;  3DQV A;  1OTR B;  2PJH A;  2MX2 A;  2DZJ A;  2KJ6 A;  1I42 A;  2N9K A;  1KF6 B;  1R7S A;  4WJQ A;  1IBX B;  3VRB B;  3AE2 B;  1MJD A;  2ZNV C;  2J42 A;  4L1B A;  3PSE B;  3NRZ A;  3KUC B;  3ML8 A;  4IM0 A;  3A9K B;  4YTN B;  4AOF A;  3GE3 C;  2MSE D;  3SFD B;  4JE3 B;  4N6E B;  5JXV A;  5FR6 A;  3PHW B;  3QIJ A;  4DBG A;  3AH7 A;  3QC8 B;  3EGR A;  4B6W A;  2BS4 B;  2K6D B;  1HE8 A;  2AQ3 B;  3L08 A;  4AWJ A;  1WMH B;  2QC8 A;  1PGX A;  2ZVO A;  1C9F A;  4W9G A;  4LNF A;  4XZ4 A;  3Q3O C;  3VRA B;  2KMC A;  4WWM A;  1GC6 A;  2MEK A;  3AEF B;  4JWS C;  4C7Y A;  4FBJ B;  2WXG A;  4W9H A;  4LCD E;  3DCG A;  2AQ1 B;  2LGD A;  1PGB A;  4BAX A;  1FIQ A;  2PMV A;  4NZL B;  3RD2 A;  3T3N A;  3AED B;  1BT0 A;  3Q3J A;  4EFO A;  2MBH A;  3R7Q A;  2K9X A;  4ARI A;  1SXT A;  3LYY A;  2FE8 A;  1S3S G;  3AEB B;  2LI5 A;  2V3P A;  1MHX A;  3FC4 A;  1PQS A;  2LVQ A;  2MJ3 A;  2VH2 A;  1TT5 B;  2LXA A;  4CO7 A;  1FXA A;  2WXM A;  4MJS A;  3LXF A;  4OVZ A;  1Y8R C;  4FLH A;  4R3D A;  2ZCB A;  3TIX A;  1U4A A;  1T0S C;  1YQB A;  3B1L X;  2Y5P A;  4FXC A;  1IUE A;  3VTU A;  3ZRF A;  1WFY A;  3PV1 A;  1EWC A;  3B2F A;  4PS8 A;  1ESF A;  2JQR B;  1WIA A;  2DHZ A;  3Q8A A;  2DX5 B;  2L8J A;  3OJ3 A;  3BVG A;  4XX5 A;  5LXH A;  3ALB A;  3CIR B;  2N1W A;  2KAC A;  1P3Q U;  1C4P A;  1FRD A;  3MC9 A;  4YWG G;  2C7H A;  4HCN B;  2HE7 A;  2WXO A;  1I4G A;  2MP2 A;  4CYE A;  2LHE A;  2D07 B;  3RFZ B;  3RYT A;  1V86 A;  4TKN A;  2H88 B;  3RUL A;  3P4Q B;  4WUR A;  5IO9 A;  2PLP A;  1WRI A; 
#chains in the Genus database with same CATH homology
 4NJ7 A;  1EF1 A;  5AZH A;  4EEW A;  3UQA A;  1WX9 A;  1GJZ A;  3EFU A;  1GG3 A;  4MGZ E;  2O6V B;  4OVU A;  2K1F A;  4AJY B;  4DHJ B;  3SDL C;  1H4R A;  1WF9 A;  3ZNZ B;  2YVC A;  3NHE B;  3ZLZ A;  4JQW C;  5CTR C;  4ZDV A;  4IG7 B;  2O2V A;  5E6O A;  4ZRJ A;  2HTH A;  4BOS C;  2JXX A;  2KC2 A;  2OJR A;  3JVZ X;  5EDS A;  3IG3 A;  2G4D B;  3A4S C;  4IM3 A;  2CR5 A;  2KTF A;  2ZJD A;  4RM8 A;  4HPL B;  1VD2 A;  3TMP B;  3KW5 B;  4IWP A;  3U30 A;  4MGK E;  2AL6 A;  5DPR A;  3VUY A;  4KZ0 A;  2FIF A;  3ZDM C;  2KFK A;  3TJP A;  3D32 A;  1WJN A;  5AZG A;  2CHZ A;  2GBR A;  1LFD A;  3PRZ A;  2BPS A;  1NBF C;  4F7Z A;  3PHX B;  4DWF A;  2MQJ A;  1WGD A;  2PE9 A;  3APD A;  3PLV A;  4HDQ A;  2BYV E;  2RD0 A;  4RM9 A;  1KLV A;  2N7D A;  3PVL A;  2CHX A;  2KO3 A;  3MTN B;  2O6V A;  4RMA A;  2NCN A;  3VFK A;  2L0F A;  5IA7 A;  1Q1O A;  2BWF A;  4MJS B;  2BGF A;  4N9F 4;  4HPM B;  1TGZ B;  2JY6 A;  4W9L A;  1SGH A;  3ENE A;  2J7Q B;  2K6Q A;  4OVV A;  4GIV A;  3S2A A;  4BKT A;  2C5L C;  4II3 B;  4ANX A;  3DVN V;  3L16 A;  3QX1 A;  4WWN A;  5G2N A;  3EC8 A;  3WIM A;  2CHW A;  2JZZ A;  4ANW A;  1J0G A;  2RGF A;  4HVB A;  4KVG B;  1YD8 U;  5J17 A;  3LDZ E;  2N1V A;  4BKS D;  4WAA A;  1WJ6 A;  3M62 B;  3OLM D;  3VDZ A;  1WJ4 A;  2C9W B;  3EHV A;  2XBB C;  1YX6 B;  2N9X A;  3DPD A;  3H7P A;  2WWZ A;  2K8C A;  2LVP A;  4GDL B;  5KHO A;  1H8C A;  4BKG A;  2DZM A;  2N4F A;  3HIZ A;  3KYD D;  4K1R B;  3VTW A;  4I6L B;  4NNJ B;  3PRM B;  2IY0 B;  4B9K A;  1WGH A;  2DZK A;  3C0R B;  4JLC A;  1IP9 A;  2ZPY A;  3CST A;  5D7G A;  3RCZ A;  3QQ8 B;  1WJU A;  1V5T A;  3OAW A;  4GU2 A;  3DBH I;  3SU8 X;  1OQY A;  3L10 B;  1V80 A;  4FJY A;  2AL3 A;  1EO6 A;  3QHT A;  2Y5B B;  4EZL A;  2FCM A;  2V3S A;  3KH0 A;  2NS5 A;  1KOT A;  2KC1 A;  1T0Y A;  1OGW A;  3X23 A;  1A5R A;  3GZN I;  4PYZ A;  1LQB A;  2REX A;  2KMA A;  4GGQ A;  2V4L A;  1P9D U;  2MBQ A;  5E6N A;  4HK2 A;  2FCQ A;  4GB9 A;  4B95 A;  4K81 A;  3BY4 B;  2KDB A;  2BKR B;  1V6E A;  2BYE A;  2WYQ A;  4FN2 A;  2FUH B;  2LD9 A;  4GDL A;  4I6P A;  4NQL B;  4IUM B;  2KOX A;  2A5U A;  2ZPN A;  2DAJ A;  2KQ7 A;  1S1Q B;  4TUU A;  2L05 A;  5DCN A;  4E3C A;  2A4Z A;  1UH6 A;  2JPH A;  2KDF B;  1Q5W B;  3A4R A;  4GMV A;  2KN5 A;  1XD3 B;  4MSM B;  2AEH A;  1E7V A;  3MHS D;  3QWZ B;  2JUO A;  3PGE A;  2LRU A;  5KHQ A;  1E8W A;  4FHK A;  3HM3 A;  2KD0 A;  3WA0 A;  2BYF A;  2BWE S;  1MG8 A;  1WR1 A;  1VCB A;  3VUW A;  2Z0E B;  1XT9 B;  1GNU A;  1P0R A;  2V1Y A;  4IWQ A;  3IFW B;  1G6J A;  4PYU A;  1F9J A;  1QZE A;  2FCN A;  1M94 A;  3SD5 A;  2BF8 B;  3JYU A;  3WAN A;  3V61 A;  3X0W A;  4MEL A;  4EUT A;  1WZ3 A;  1LM8 B;  1WX8 A;  3DBL I;  1WH3 A;  1YIW A;  1R4M I;  2MW5 A;  2PE6 B;  2RPQ A;  2LRW A;  2MBO A;  1X1M A;  2LXC A;  3N30 A;  4MGY E;  3BIN A;  4W9D A;  1WXA A;  2I1K A;  4URK A;  1Q0W B;  1V81 A;  3P2B A;  2JT4 B;  4I6N B;  1V5O A;  1WXV A;  2IO1 B;  2LGX A;  3PRE A;  4FJV B;  4KIK B;  3VH3 B;  3T8M A;  2KWU B;  3VHT C;  2KX0 A;  1R4N I;  2DYB A;  3GOE A;  2C60 A;  4K7W A;  2FNJ B;  1J19 A;  2IO0 B;  5CHW A;  1ISN A;  2MWS B;  4BFR A;  4ASW C;  1ZKH A;  4P7I A;  1OEY J;  2KJH B;  5E6P A;  2HJ8 A;  2M0X A;  3RZW C;  2MCN B;  3W1Y A;  2EMS A;  1GUA B;  2MLB A;  3CSF A;  4WWO A;  4AP4 C;  4LDT B;  3KYC D;  4A3P A;  1Z2M A;  4GDK B;  3K9O B;  1NI2 A;  2LAS A;  2KTR B;  1RRB A;  2LUE A;  1WXM A;  2N9E B;  3H7P B;  3PLU A;  4K7U A;  1C3T A;  1GC7 A;  3ZIM A;  3CF6 E;  4E74 A;  2KVR A;  3B0A A;  3NS8 A;  2DAF A;  2UWQ A;  4KIK A;  2AWT A;  2DZI A;  2L7R A;  4MM3 A;  1EF5 A;  2VRR B;  5LLI A;  4G50 A;  4W9I A;  3KUZ A;  1UBI A;  3A33 B;  3ML9 A;  1UBQ A;  2IO2 B;  4PS7 A;  4FA6 A;  2J0J A;  1JRU A;  4G0N B;  2IYD B;  2OOB B;  3VVW B;  2ZEQ A;  4KZC A;  2K25 A;  3ZKJ C;  2KNB A;  2WX0 A;  2KHW B;  3CMM B;  4JGH B;  4BBN F;  4EKU A;  3EEC A;  3NZS A;  5C23 A;  2G4S A;  4NQK E;  3VQI A;  4DHZ B;  3JSV B;  1TZ1 A;  1P1A A;  1WGG A;  4E71 A;  3QAR A;  5JHA A;  3ZTD A;  3VXW A;  1YX5 B;  2B3A A;  3HM6 X;  1OEY A;  3L17 A;  5JH5 C;  2J0M A;  2LWP A;  4DK5 A;  1WM2 A;  4GOC A;  1NDD A;  2YLM A;  4GDK A;  4MGI E;  2HD5 B;  4KSK C;  3WAP A;  1E5W A;  2KTR A;  4G11 A;  1WE6 A;  4KV2 A;  4WJP A;  1LXD A;  4X57 B;  4XC2 A;  3Q3F A;  3UIO B;  4DHZ E;  1C1Y B;  2GBM A;  4F1S A;  2G3Q B;  1L2N A;  1V2Y A;  4WJN A;  3QK0 A;  4ANU A;  3AU5 A;  3DVG X;  4DDG D;  5AZF A;  1KM7 A;  2Z59 B;  3KUD B;  4MDK E;  4ANV A;  2ZCC A;  3ZNI D;  1WRD B;  4TQ1 A;  4M0W B;  2M1M A;  1WMH A;  3ECI A;  3H9D A;  3W1S A;  1ZGU B;  3JSV A;  2KLC A;  3H1U A;  4F8C B;  5L83 A;  3V60 A;  4LJP B;  5D6J B;  3B08 A;  2JVC A;  2EKE C;  4AUQ C;  4G3X B;  1AAR A;  2BKF A;  5L95 C;  1KJT A;  3AU4 A;  2KDE B;  1P98 A;  1TTN A;  2KFJ A;  2NBW B;  1SIF A;  4W9K A;  2GBN A;  5CHV C;  4DXA B;  1UD7 A;  5TR5 A;  5JZE B;  5J2R A;  2FID A;  3U8Z A;  2MBE A;  5DPW A;  1FXT B;  2WX1 A;  3H6N A;  4IW0 A;  2KAN A;  3WAM A;  2NBU A;  4PS3 A;  5CHF A;  2UYZ B;  4W9C A;  2LZ6 A;  4GN1 A;  2JF5 A;  2D10 A;  3H7S A;  4KDL B;  3IBE A;  4HLE A;  4MEM A;  3TL5 A;  4NPN A;  2PPH A;  3A9J B;  2JRI B;  1IYF A;  2I1J A;  2KKC A;  3ZVV A;  2KQS A;  2JWZ A;  3HHM A;  4EZK A;  2L76 A;  1WM3 A;  2GOW A;  4A20 A;  3VTV A;  4EOY A;  2ZNV B;  2R2O A;  1L7Y A;  3ZTC A;  4BKS A;  3V6E B;  4LJO B;  4MSQ B;  3V62 A;  1E8Z A;  1RFA A;  2RR9 A;  3L13 A;  4BOZ B;  1RLF A;  3JW0 X;  3DVG Y;  2NVU I;  2IBI B;  4GSW A;  4NAW A;  3UF8 A;  1XQQ A;  3PPA A;  3R7R A;  1E8Y A;  2O6V D;  1UEL A;  2D3G A;  4IC7 B;  4DHJ D;  3APC A;  4W9J A;  4W9F A;  3N3K B;  3A1Q A;  2RSU A;  3DQV A;  1OTR B;  2PJH A;  3AI5 A;  4TQ0 A;  2MX2 A;  3IHP C;  4EZJ A;  2DEN B;  2DZJ A;  2KJ6 A;  3AXC A;  3L54 A;  1I42 A;  1WX7 A;  4WJQ A;  2FCS A;  2L0T A;  2W9N A;  3A9J A;  3PS6 A;  2MRP A;  2WDT B;  2ZNV C;  4M8M A;  2N7E A;  1WI0 A;  1WY8 A;  4W9E A;  3OJ4 B;  1TBE A;  4NJ6 A;  2PEA A;  2NR2 A;  3PSE B;  3M95 A;  4GXB A;  4NY0 A;  5C1Z A;  4MH0 E;  3DOW A;  2KK8 A;  3KUC B;  2DYO A;  2KLG A;  3ML8 A;  1K8R B;  2D11 A;  4IM0 A;  1I35 A;  2MBB B;  3DBS A;  3NZU A;  4WJO A;  1EUV B;  1V49 A;  3TCA A;  3A9K B;  3RZF A;  4AOF A;  4FAD A;  1E8X A;  4ZRI A;  3RT3 B;  4ZRK A;  2MSE D;  2JRH A;  3MJW A;  4M8N A;  1YJ1 A;  4II2 B;  4K7S A;  3ZUN A;  4JIO U;  2ZVN A;  3ZRC A;  2M8S A;  5FR6 A;  2KX3 A;  1E90 A;  3PHW B;  3QIJ A;  3R3M A;  3I3T B;  3O65 B;  4DBG A;  5J18 A;  3QC8 B;  4B6W A;  1Z5S B;  3PRP B;  3TBL D;  2K6D B;  4TV3 A;  1HE8 A;  3L08 A;  4AWJ A;  3ZNH B;  1WMH B;  2EMT A;  3VH4 B;  3AUL A;  2ZVO A;  2JZ3 B;  4HJK A;  2D2Q A;  2ASQ A;  4W9G A;  4XZ4 A;  5D2M B;  4ICU A;  2R2Q A;  5JHB A;  2KMC A;  5CX3 A;  1GC6 A;  5LXI B;  5DPS A;  2GMI C;  4FBJ B;  5AEK B;  4W9H A;  1SE9 A;  3A9K A;  4LCD E;  3IVF A;  3NY5 A;  3DCG A;  1ZW7 A;  4JL9 A;  2LGD A;  3RUI B;  3K9P B;  4HCP B;  4AJW A;  3ONS A;  1WGY A;  3RD2 A;  4YL8 A;  1BT0 A;  3Q3J A;  4EFO A;  2MBH A;  5G55 A;  3R7Q A;  2MA9 B;  3VAW A;  3PT2 B;  3W1S C;  3WAO A;  1RAX A;  2KWV B;  4BVU C;  2C7N B;  3PTF C;  3PZD A;  1UZX B;  2IZV B;  2NPT B;  3V6C B;  2XK5 B;  2M4N A;  3QCA A;  2K8B A;  1S3S G;  2IO3 B;  2NBV B;  3HK0 A;  3M63 B;  2CKH B;  2L3Z A;  4DDI D;  2LI5 A;  2KWC A;  2J0K A;  3R66 C;  2K8H A;  2KXJ A;  2AYO B;  2XEW A;  1PQS A;  3QJZ A;  1UGM A;  2LVQ A;  5IAA C;  3UIP B;  2LXA A;  3T9L A;  3ZNG C;  5BO4 B;  3VUX A;  4ZYN A;  4NAW B;  1WE7 A;  4A3O A;  4CO7 A;  3KVF B;  5DPT A;  3WAL A;  2G45 B;  4KSL C;  4MJS A;  3L0W B;  5GMV A;  3DBR I;  3A1Q B;  1J8C A;  1V9J A;  1Y8R C;  4FLH A;  2ZCB A;  1WYW B;  2Z0D B;  3QA8 A;  3TIX A;  1U4A A;  3DVN U;  2KJR A;  3U7D A;  1YQB A;  3B1L X;  3M3J A;  3NOB A;  4FUL A;  4BBN C;  4FJZ A;  2MP2 B;  2N9P C;  4HDO A;  2IY1 B;  1WXS A;  2NPT A;  2GBJ A;  1WGR A;  2CS4 A;  2XK5 A;  3VTU A;  2GBK A;  4J6I A;  3ZRF A;  1WFY A;  3PV1 A;  2DYM A;  3ZO5 B;  1E7U A;  2M17 A;  4PS8 A;  4IWO A;  1WZ0 A;  1WIA A;  4WWP A;  2DHZ A;  2DX5 B;  2L8J A;  2LJ5 A;  1CMX B;  3OJ3 A;  5LXH A;  2FAZ A;  4XX5 A;  5D94 A;  4HXD A;  4WQO B;  2O2V B;  3ALB A;  4CHK A;  2L00 B;  3QAQ A;  4HWI B;  1D3Z A;  2N1W A;  2LVO A;  1P3Q U;  3ZDT A;  2C7M B;  3UGB B;  2CU1 A;  3ZW3 A;  3SHQ A;  2C7H A;  4HCN B;  2KZR A;  5HKH A;  2HE7 A;  2K39 A;  2MP2 A;  4CYE A;  2D07 B;  2KFK B;  3LJ3 A;  4ICV A;  3RYT A;  1V86 A;  4FHJ A;  4LDT D;  4TKN A;  3N32 A;  4IM2 A;  3DDC B;  3UQB A;  4KDI C;  2LGY A;  2QHO A;  1WR6 E;  2ZZP B;  3RUL A;  3UIN B;  2KDI A;  3APF A;  1IPG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...