2MJ3A

Backbone 1h, 13c, and 15n chemical shift assignments and structure of iron-sulfur cluster binding protein from ehrlichia chaffeensis
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
116
structure length
116
Chain Sequence
MPLITFISPDGSRKTYEAYDGETLLSLAHRNNVDLEGACEGSLACSTCHVIIDPSWYDIVEQHNEISDEENDMLDLAFGLTDTSRLGCQIILTKELDGLCVILPTETRNISFVKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron-sulfur cluster binding protein
publication title Backbone 1H, 13C, and 15N Chemical Shift Assignments and structure of Iron-sulfur cluster binding protein from Ehrlichia chaffeensis
rcsb
source organism Ehrlichia chaffeensis
molecule tags Metal binding protein
total genus 13
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2013-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2mj3A00
1SB3C 2PVOD 1RFKA 2Q5WD 3P4PB 4WQMA 4C80A 3AEFB 3FC4A 1RWSA 3FAHA 3VRBB 4ZHPA 1TKEA 2CJNA 1ROEA 1N61A 1B9RA 1PFDA 1DOYA 1QOFA 3P4SB 2M56B 1OQRA 1JRPA 3W9CB 1JQ4A 1FM0D 1NYRA 3AE3B 3NVWA 1E7PB 1GAQB 1N60A 1PDXA 1XLOA 1CZPA 1NEKB 2QJLA 3AE8B 1IUEA 1FRDA 2MH7A 1VJKA 1RYJA 3AE9B 5EE9A 5C3JB 1QOAA 1DGJA 3VR8B 4ZHOA 1FO4A 3HVZA 1JALA 1FMAD 3NVZA 1L0VB 2E3TA 2MJ3A 1L6UA 3B2GA 4A9AA 2KMMA 3AM9A 2PIAA 2WS3B 3NS1A 4YSYB 3AE1B 3HUIA 3CWIA 1L5PA 3AB5A 1ZUD2 1SIJA 1WYGA 2JQRB 4YTNB 1FXIA 1JWAD 4US9A 5C2TB 1TJEA 3BIID 1KF6B 1FIQA 4HROA 1XLNA 1KFYB 1L6VA 1QT9A 2AX5A 2BS3B 2L52A 3AE2B 4FXCA 1NVID 2FBWB 3AEGB 1CJEA 3P4RB 3AEDB 2WDVB 1QOGA 1DOXA 1DOIA 1I7HA 2MJEA 4YTMB 2WP9B 3AEAB 1FFVA 1N5WA 2DWQA 1PUTA 1VLBA 1A70A 1YQ4B 2W3RA 4YXDB 1TKYA 1RM6C 3AMZA 3PO0A 4US8A 1NENB 1N62A 3W5VB 2N0SB 3P4QB 1XLQA 1WRIA 1ZOYB 2L83A 4USAA 3LXFA 4ITKA 2K22A 1VDVA 4LTUA 4P6VF 5EE3A 2HTME 3AE5B 4JWSC 1N63A 1ZXIA 1V97A 1YJJA 1JW9D 2M19A 4IDIA 2H88B 1KRHA 2WDRB 3VRAB 1OFFA 3KWLA 1GPXA 5MPOA 1QF6A 1XLPA 2BS2B 1WWTA 2MJDA 3B9JA 3ETRA 3NRZA 1YJIA 4ZOHC 2OHFA 2W54A 4YT0B 4YTPB 5G5HA 5G5GA 1J7BA 4C7YA 5GXGB 1EWYC 1UWMA 2ACZB 1J7AA 3VR9B 1N5XA 1FRRA 2KAJA 5EE0A 2WDQB 3SR6A 4HRSA 2BT6A 2B76B 1SF0A 2G1EA 1QLBB 1T3QA 2WQYB 1E0ZA 2K9XA 4JX1C 5EE1A 1E6EB 1QOBA 4WWMA 5H92C 4C7ZA 1E10A 3AEEB 3P63A 1NI3A 3SFDB 2WU2B 1WGKA 4KX6B 3AN1A 3CIRB 4YSZB 2EKIA 1WXQA 1JWBD 2W55A 1R7SA 1V8CA 2PKOA 1FFUA 3AE4B 3LB8C 2WLBA 5AUKA 2K5PA 4N59A 1TYGB 3HRDD 1ZP0B 3AV8A 5AUIA 3WCQA 2PVGC 2H89B 4JWUC 3L4PA 3ABVB 2QIEB 4N58A 3NVYA 3RPFC 1OQQA 3W5UB 4YSXB 3ZYYX 3AH7A 1AYFA 1TKGA 1AWDA 2JX5A 2W3SA 5H8YE 3AE6B 1XO3A 3AECB 2CJOA 3EUB2 1J7CA 3B2FA 1FXAA 3AEBB 3AE7B 1F0ZA 3NVVA 1NYQA 2LEKA 4N6EB 3DWGC 2DBYA 1E9MA 2CU3A 3DWMA 3P1MA 1JROA 1YQ3B 3SFEB 2BS4B 2Y5CA 2WU5B
chains in the Genus database with same CATH superfamily
2BYTA 5JXVA 3P4SB 1OQRA 4WJNA 3C19A 1FM0D 1N60A 5DPTA 3NUHB 2A4ZA 1I42A 3RMKC 3SD5A 1L0VB 2L00B 3ZQ4A 1ZW7A 3N30A 2SEBD 4CYEA 3H7PB 4FBJB 1GB4A 3IG3A 3DVGY 4XYCA 2FIFA 2FCQA 1F9JA 4HROA 1QT9A 3QJZA 3R7QA 3AE2B 3EA6A 4DHJB 5JZEB 3QK0A 3SHQA 3VHTC 5BMGA 3T3OA 1QOGA 1D4BA 1EWCA 3KUCB 4WWPA 5FR6A 3MP9A 3Q6BA 4C4VB 3W5VB 1XLQA 4K3CA 4K3BA 2NTTA 1C4AA 2ZW1A 2V3SA 2O6VB 5MPOA 2AQ1B 5G5GA 2OHFA 3DVNU 4G0NB 1XCQL 1AN8A 2KTRA 3ZJVA 3DVNV 1WE7A 1WJ6A 4GIVA 3BZDB 2BYEA 5C1ZA 3T8MA 1YN5A 2VZKB 5H92C 3Q8CA 3SFDB 4TV3A 2DZJA 1UBIA 1TS2A 4PYZA 2J42A 1UF0A 2CS4A 2LXAA 3GB1A 1LXDA 3K9OB 2KJ6A 2IO2B 2BVCA 4RF1A 2KMAA 3AE7B 2C5LC 1JROA 1YQ3B 2XNAC 3W1YA 4P7IA 1C76A 4GOCA 4WJPA 3HK0A 3KW5B 3BYTB 2MSED 3FC4A 2BYFA 1VR9A 1IBXA 2YEPB 3UINB 1EUVB 2K8CA 3ZDMC 3PZDA 2WXMA 3ZTCA 3AE3B 3EC8A 3RZWC 4C00A 1F2RI 1QQRA 4M01A 3MJWA 4LNIA 1ZUD2 2N1WA 2LD9A 2RD0A 3WAMA 4DDID 3RYTA 1V5OA 4L1BA 1ACCA 1WFYA 2ZVOA 3DOWA 4MACA 1RFAA 1A70A 3TCAA 1J0GA 2PE6B 3FKYA 3ZTDA 3PZ7A 3RPFC 5E6PA 3M62B 5BYRA 4ARCA 2RDBC 1KRHA 3L0WB 3KLSX 1WY8A 3Q14C 2BS2B 2KLCA 4ZOHC 3ZDTA 3RCZA 3A9JB 2K6DB 5J2RA 4F8CB 4AJYB 4WIPA 4MDKE 5BYQA 3SR6A 2N4FA 4DK5A 4OZBA 1T3QA 2NMQA 4C7ZA 2JYTA 4W9GA 2LMCA 3RNAC 4DHJD 3MC8A 3ZYYX 2BB5A 1E7UA 2ON8A 2JXTA 4MELA 3QA8A 1F52A 3J9CA 4DQOC 2EMSA 2KQ7A 1WJUA 3HHMA 2Y5CA 2ZJDA 4RGNA 2KZRA 3A9KA 1IPGA 3P4PB 3VVWB 2CJNA 2O6VD 1YX5B 1QOFA 2ASQA 3M63B 1AARA 2M17A 1CZPA 1V9JA 2MQJA 3JW0X 4CQNA 4KVGB 2JYEA 1P7FA 2MP2A 2V3PA 4DXFA 2IBIB 4JE3B 4A55A 4GB9A 4GU2A 2ZCCA 2LWPA 3PHWB 1L5PA 4PYUA 2VZKD 1FXIA 4K7UA 1WZ0A 4PT5A 4JPSA 2XBBC 2HJ1A 1CJEA 1STEA 1WGHA 1XF5L 4LLGM 4KV2A 1TS5A 2MEKA 3AEAB 4CHKA 4MH8A 1N5WA 2BTEA 1PGBA 2W82A 3ONSA 3ZW3A 4AP4C 1RM6C 1YNTE 4US8A 3H7PA 2KJRA 1P0RA 4ITKA 5EE3A 2JZZA 1VZ6A 2RDGA 1V97A 2KWVB 2KDEB 3R2TA 5G5HA 3APDA 2YLMA 5GXGB 1HA5A 2WXIA 4FJYA 3R2IA 2FNJB 1EU4A 3EFCA 3QQ8B 4C4VA 4XWWA 1QOBA 3AEEB 1NI3A 2PPHA 3AE4B 2O6VA 1ET6A 3O13A 2OEDA 1TYGB 4WURA 4NJ7A 3ABVB 3IBEA 5CHVC 1KJTA 2G4SA 2MX2A 1VD2A 1JCKB 3AE6B 1XO3A 3RNFC 3NG0A 5J18A 1WIAA 1FXAA 1P7EA 3AEBB 2J52A 5I4DA 1NBFC 1T0QC 4XDCA 2NR2A 4EFOA 4G50A 4JLCA 3I3TB 1N61A 4C56C 3VTVA 2FUG1 4ASWC 4GDLB 1NEKB 1D3ZA 3ENEA 4BOSC 2IO0B 3HVZA 3E9SA 4KDIC 4I6NB 2BKRB 2PIAA 3L08A 4K1RB 4EE2A 1YD8U 3WIMA 3HUIA 3CWIA 3AB5A 2QMTA 1ISNA 4ACFA 2L52A 2FCMA 2M8SA 3UF8A 2J4XA 2D07B 3BK1A 1K8RB 3ZNZB 3U52E 4YTMB 3NZ3A 3ZXVA 3VAWA 2AQ2B 4ZRQA 3APCA 1T0YA 4FN2A 1WRIA 2N7EA 2HTME 1OEYJ 2E6XA 2GBMA 3NZSA 3UI3A 1V1OA 1WWTA 1UGJA 2KTFA 4PK1A 2KC1A 2ACZB 4KGRA 1TBEA 1JMLA 3U7DA 3OWEB 4ANUA 2KX0A 3M95A 2BT6A 3DHGC 4JX1C 4MGYE 2WU2B 1NDDA 1JWBD 2PKOA 4BBNC 3BVZA 2DZMA 4N59A 1WXMA 2M0AA 3KQ4A 1V6EA 3A9JA 4IW0A 2MBEA 3H6NA 4GGQA 2LJ5A 3H1UA 2Z59B 4IOIE 3SDLC 4K7WA 1E7VA 2OOBB 2PTLA 3BYYB 3DBHI 2KFKB 4A8XC 3GE8C 2KT7A 2B3AA 1BT0A 4BVUC 2ZPYA 1H8CA 1TIFA 3GZNI 2I1KA 1HE8A 4LCDE 5AZGA 2LRWA 4NJ6A 4ZRKA 1GC7A 1M4VA 2K6QA 4XC2A 1YN4A 2DENB 3RT3B 2DYOA 4EZKA 5HFYA 4JL9A 1C4PA 5JHBA 3PGEA 2MJEA 4A20A 3TIXA 4AS1A 2GOWA 3BVMA 3QCAA 2AL6A 3PT2B 5FK9C 1FNWA 1MHXA 4DWFA 2REXA 2HTHA 2YVCA 2IGHA 2UYZB 4RFBA 3VRAB 1OFFA 1GPXA 1XLPA 4LNKA 1J7AA 4AWJA 2WDQB 2G9HD 2KWCA 2MBQA 1EO6A 1SF0A 1Z5SB 4FLHA 5EE1A 1E6EB 1E10A 3QIJA 3L13A 4KX6B 3AN1A 3AU4A 4ZYNA 1IGDA 4RCOA 2G3QB 2K5PA 3AV8A 5LLIA 3KUZA 3MC9A 2ZNVC 3SU8X 4RMAA 4XE0A 1F77A 2ZVNA 4MEMA 2N1VA 4KKIA 4FJVB 4B0EA 4KIKB 2GLSA 2V4IB 3X23A 4W9HA 2XK5B 2L05A 1I35A 2WXJA 3DCGA 3DWMA 1RFKA 2K8HA 2INDC 3HVDA 2GBNA 2K8BA 1ROEA 3N1XC 2BKFA 2WXKA 1EM7A 4WAAA 2KMCA 3U7ZA 3AE8B 3I5JC 2GB1A 4E3CA 3AULA 1T0SC 3QAQA 4X57B 5D6JB 2L3ZA 4KKJA 4US9A 2ONQA 4BKSD 1MJDA 1Q5WB 4P16A 5J17A 4GDLA 1TS3A 3NOBA 3PREA 2DWQA 3VH4B 1WJNA 4IM0A 3R8BA 1JRUA 2BYVE 4TKNA 4S0RA 1NENB 2IGDA 3PZ8A 1E8WA 2Y5PA 2L0TA 3T3NA 5IAAC 2WDRB 2BF8B 1CMXB 2LVOA 1SE2A 2OJRA 2QHOA 4LNNA 5IA7A 3V62A 1S3SG 3HM6X 2KC2A 3TEXA 1E90A 3V60A 4K81A 4KSKC 2RGFA 3P63A 2PMVA 2JT4B 3CIRB 3RFZB 1YIWA 2W55A 1R7SA 3H7SA 2CR5A 4HCNB 1TY2A 3WCQA 2QIEB 3ZKJC 3IT4B 1LGRA 3L10B 1GC6A 3NS8A 2D11A 2LEKA 2KQ4X 1TT5B 1C3TA 1WXVA 1UBQA 1RWSA 4XGAB 4ICUA 4BKSA 2DZKA 2JVCA 3OJ3A 5LXIB 3VH3B 3V61A 3TJPA 2R61A 3A4RA 1GAQB 1PDXA 1V2YA 2GBRA 2E3TA 1PQSA 1WXAA 2IPKD 1IYFA 2D3GA 1WRDB 3RZFA 2KFKA 4HPLB 1WYWB 3NZUA 3APFA 1KF6B 3Q3OC 4TUUA 3MHSD 3L54A 1L2NA 1K50A 5BMIA 1GNUA 4KZ0A 3V05A 2KHWB 2LHEA 1FFVA 1BXTA 4I6LB 3ALBA 3OG5A 1TKYA 3PO0A 1ZOYB 3FILB 4PS7A 2JWUA 3JSVB 4IDIA 1YQBA 4D2KA 3RN9C 2KVRA 2KFJA 4ANVA 2WXLA 2Z0DB 1P98A 2PE9A 5BO4B 1ENFA 3I57A 1FEHA 3OAWA 2KDMA 3ZIMA 2N7DA 2LJIA 3W1SC 1WGGA 4GN1A 4TSSA 1WGKA 1EF5A 2WXRA 4Q2JA 2L1AA 5L95C 1FFUA 1WR1A 4W9KA 1RRBA 2JRIB 3W2DA 5JH5C 4W9CA 4GDKA 3AECB 1MHHE 3LDZE 4W9LA 1NYQA 2DBYA 2WXNA 1IP9A 2L7RA 3IHPC 4G3XB 2IO3B 3TUOA 1DOYA 5E6OA 2M56B 2L76A 5BYSA 1C4CA 3W9CB 1SE4A 1IUEA 3AE9B 4KIKA 4HPPA 3L16A 1ZGUB 1L6UA 3Q2AC 1TS4A 2XK5A 3IFWB 2W9NA 3DBSA 1WM3A 2RPVA 2WX1A 2ICIA 2WXFA 2JQRB 4YTNB 3BIID 3WA0A 2K25A 1L6VA 1R4MI 2C9WB 1E8XA 4IKGA 4RGOS 2FUHB 2INCC 1OGWA 1TGZB 3DBRI 4LDTB 1YX6B 5CTRC 3VTWA 3U8ZA 1RLFA 3DBLB 2ZPNA 3CSFA 3ZRFA 4M0WB 2R2OA 4YT0B 2K22A 2BBCA 2NBWB 5CHFA 1ZXIA 2M19A 1JW9D 1J19A 2G4DB 2NCNA 2H88B 3NY5A 1H4RA 2AQ3B 2KDFB 4O1NA 4CO7A 4A90A 3QWZB 3AU5A 2KNBA 3UQAA 1ESFA 2OJWA 3U4EG 3LJ3A 2MBHA 3N1ZC 2NVUI 3WAPA 3PRMB 1XT9B 3H9DA 3A1QB 1MG8A 2HE7A 2KWDA 1V86A 3RUIB 2H89B 2K3UA 3A33B 2UWQA 1R4NB 4DDGD 1LO5D 3AH7A 1MI0A 2KYWA 4IM3A 4W9JA 4RF0A 4L23A 2CHXA 4EEWA 4G11A 3I63C 4K7SA 2BS4B 1C78A 2K0PA 4ZHPA 3M3JA 2QEJC 1TKEA 2VH1A 2LGXA 5IP4D 1SJED 1UNSA 2KN4A 4EZJA 1KTKA 4GSWA 1L7YA 3L4PA 2JF5A 4L2YA 3Q8EA 1XXGA 4J3OD 1VJKA 2LASA 3NVZA 2C7HA 2FCNA 2JUOA 1FCLA 4NAMA 3AE1B 2N9LA 4AJWA 2V1YA 4XWTA 2JZ3B 3KYDD 1WGYA 1XCTL 4FXCA 2N7JA 2KOXA 3E56A 4JIOU 4HLEA 1WZ3A 4BBNF 4HDOA 1VLBA 4YL8A 5BMHA 4LJOB 2W3RA 4R3DA 4MH0E 2L83A 1GJZA 1VDVA 3VFKA 3R7RA 2FIDA 3BINA 4MJSB 4BKTA 1WE6A 3KWLA 2BQQA 1F2RC 3S2AA 4RM9A 1EF1A 1K51A 1EWYC 2GBKA 1SXTA 2JY6A 3PRZA 5IKCM 1K52A 2DYMA 2V3NA 3ZLZA 2PLPA 3FILA 4QAYA 3VUWA 1WXQA 2K1FA 3JSVA 1V8CA 1I4QA 5AUIA 1V1PB 3JYUA 2LXCA 1XQQA 3KYCD 4XX5A 2RDHA 4JGHB 4HKQA 2JX5A 4DHZB 1SE9A 5HHDG 4DHZE 1HZ6A 3NVVA 2GMIC 4IWQA 3AXCA 2I38A 1SB3C 2PVOD 3UQBA 4C80A 3ZO5B 3VRBB 3QC8B 3I9V1 4EUTA 2I1JA 3DQVA 3B08A 2L8JA 2MBOA 2QSDA 1RYJA 4ZHOA 1DGJA 2WX0A 4HKZE 3EGRA 1FO4A 1JALA 4FADA 4A6QA 3B2GA 4EZLA 4HXDA 1WR6E 2NTSA 4YSYB 2D10A 2V0GA 2AL3A 2BS3B 2ZZPB 1FXTB 3B0AA 3AEGB 2IZVB 2EMTA 1P3QU 1DOIA 1I7HA 4LNFA 2AYOB 4M00A 3Q3MC 3TSSA 5KHQA 4REZA 2XN9C 2D3BA 4W9EA 4TMAB 1L4ZB 4KDLB 4HVBA 2QCZA 1QF6A 5D3IB 3H8HA 1PGXA 1VRAB 4ANXA 1JQ4A 4YTPB 2GI9A 5IO9A 4B9KA 2K39A 4S17A 3DVGX 2B76B 2RPQA 4JQWC 1S1QB 3Q8AA 1E0ZA 4M0WA 3KH0A 1F1HA 2LUMA 4WWMA 2ZCBA 2KDBA 4YSZB 1UH6A 3D32A 4TQ1A 4BOZB 2WLBA 3TEWA 1ZE3D 2IYDB 4N58A 1OQQA 4YSXB 3KVFB 2CJOA 3TMPB 2JZPA 5TSSA 4AQ7A 1E8ZA 3B2FA 2L0FA 2LGIA 1OQYA 2BGFA 3DPDA 4FJZA 1OTRB 2Z8LA 2KVZA 1LFDA 3A1QA 1MFWA 2D3CA 2JXXA 4WWNA 3Q3NC 2DX5B 1FRDA 2J53A 3BVGA 1I4HA 2IDYA 3PV1A 1WI0A 2C60A 2KMMA 3ZXRA 4HPMB 2RSUA 4P1CC 1HTOA 3BK2A 1SIJA 1JWAD 4WH4A 3L17A 1I4GA 4DBGA 4DXAB 2CHZA 2ZNVB 1T0RC 2J0KA 2GRIA 1PGAA 2WDVB 3PHXB 1MVKA 1PUTA 1WX7A 2IO1B 1C9FA 4W9DA 3AMZA 1FD6A 3P4QB 1E5WA 1XEEA 4HK2A 2LI5A 4RNAA 4EOYA 1TZOA 1CK1A 2CU1A 5AZFA 4BKGA 2HDEA 2WHIA 1FNUA 3IAM1 2MWSB 3P2BA 3VR9B 1N5XA 2MCNB 1CQVA 1L4DB 3B1LX 3DHHC 2KO3A 1M94A 2LFIA 1HEZE 2WQYB 3TL5A 2KANA 2K9XA 3N3KB 2MBBB 3MHZA 4NQLB 4MJSA 1WM2A 3V6EB 2LGYA 4IC7B 1C79A 4ANWA 1B1ZA 3QHTA 3P42A 5H8YE 5JHAA 1D5ZC 3ZUNA 1ZXHA 2YEPF 4N6EB 3HIZA 2QILA 1R4NI 3URYA 2D2QA 5FR3A 2KX3A 4ZRIA 4WJOA 4M8NA 2D5GA 1V1PA 5T8IA 2SAKA 1NYRA 1U4AA 3EHVA 1E7PB 2QJLA 3HM3A 5EE9A 4W9IA 3RNGC 2MW5A 4WJQA 1C77A 4HCPB 4NJCA 1VZ7A 4EKUA 3TBLD 1TJEA 3RNEC 3ZRCA 3R66C 4NAWB 3C0RB 5KHOA 2M4NA 4YWGG 3AEDB 1KLUD 1E8YA 1GB1A 3ZNGC 1JWUD 1Q0WB 1A5RA 4UDUC 2KKCA 1P9DU 1YQ4B 4HDQA 2VH2A 4FHJA 4USAA 1WH3A 4LTUA 3RI7C 2A5UA 2DYBA 3DDCB 2KXJA 3EECA 3K9PB 3UIOB 4E74A 3B9JA 3IT6B 1V81A 3DBHB 5G2NA 1J7BA 3NJTA 2WGSA 2KQSA 2PJHA 2WXGA 2L32A 4IUMB 2KAJA 4LNOA 1FPYA 1I4PA 5DCNA 2IGGA 4HRSA 3GZNB 1G6JA 2G1EA 3GE3C 2D3AA 1YN3A 3VTUA 2JU6X 2KDIA 4ZRPA 4II2B 1YJ1A 3GOEA 2G45B 1IGCA 3UGBB 2ZW0A 2CHWA 4W9FA 2KK8A 3NVYA 2Z0EB 2MHJA 3ZGZA 4ARIA 5IOIA 1OEYA 3DWGC 3Q3FA 1E9MA 3P1MA 3MC0B 3TEYA 1VZ8A 2WU5B 3U30A 4WQMA 4ZDVA 3WANA 4LJPB 2LGDA 3ZJTA 2FCSA 1HQRD 1JRPA 4IG7B 5D7GA 1QKZA 3QARA 2BWES 1KLGD 4A9AA 3OLMD 4LK0M 3CSTA 1T6BX 1X1MA 1I4RA 1WXSA 1GUAB 2J0MA 4NY0A 1FIQA 1XLNA 3WAOA 2DAFA 3R3MA 5HI1A 3KWVA 1Q1OA 3ZNHB 1L0XB 4FULA 1FNVA 2X8XX 2WYQA 2V4LA 2DNFA 1KLVA 1KOTA 1I4XA 1DYQA 2LHDA 2N9KA 3PPAA 3PS6A 3AE5B 2LVPA 4F7ZA 3Q8BA 3ETRA 3NRZA 2Y3AA 2W54A 1SE3A 2WXHA 3VUXA 1Q10A 5EE0A 3CF6E 1ZKHA 4MGZE 2WDTB 2X38A 1LM8B 1WJ4A 5D3DA 5L83A 4N9F4 2BPSA 1UGMA 1UUPA 3HRDD 5EDSA 3PLUA 2JSVX 4IWPA 3RD2A 3VDZA 3TEZA 2WXQA 3GP7A 3IXSA 2J0JA 1V5TA 5E6NA 1MPEA 1AYFA 1TZ1A 1TKGA 2WWZA 2W3SA 1J8CA 4OZCA 3PSEB 3LYYA 4IM2A 5LNK1 3Q69A 5HG2A 3ZJUA 4AOFA 3IVFA 1QILA 3SFEB 3T9LA 2LVQA 4FA6A 3AEFB 3OJ4B 3FAHA 4A3PA 3V6CB 2O2VB 1YOVB 3AI5A 4HWIB 3VR8B 4M02A 1Y8RC 1YMHE 4OW0A 3AM9A 1BUIC 1JWSD 2WS3B 2INPE 1Y56A 4HEA1 1V80A 1QZEA 2VRRB 2R2QA 1WMHB 4AUQC 4NQKE 4GXBA 1SIFA 1WGRA 2FBWB 3CMMB 4PS8A 1LQBA 1DOXA 1TTNA 1PYWD 1Z2MA 2WP9B 4HJKA 3ZVVA 2DHZA 2NPTB 5IN7A 2XEWA 1HTQA 4B6WA 3VXWA 1MG4A 1N62A 3DHIC 1ZPSA 1RAXA 4RH6A 4JWSC 1YJJA 4MM3B 4MSMB 4NAWA 4M8MA 1YJIA 1P1AA 1N6ZA 1HZ5A 4RGMA 4FHKA 2KJHB 4BZAA 3BY4B 3N20C 4DXGA 1SSNA 4OVVA 3IAS1 2MA9B 2IJ0A 1KM7A 2HD5B 2IY0B 2RMMA 4II3B 1SBBB 2DZIA 4OVUA 4I6PA 2ZEQA 4KGTA 3EUB2 2IY1B 2JRHA 2J7QB 1SGHA 5D94A 2BWFA 3NHEB 3ZNID 4GLSC 4J6IA 5LXHA 2KWUB 1WX9A 4E71A 3NVWA 1K53A 1XLOA 5DPRA 4LDTD 1HXYD 2WXOA 2KLGA 2MJ3A 1V49A 3N1YC 2KN5A 1XD3B 3N32A 5G55A 4BAXA 4B95A 2V9HA 2Y5BB 4TQ0A 4ZYSA 1NVID 2INNE 3P4RB 3UIPB 2KTRB 1WGDA 4OZAA 4H2AA 3W1SA 4GMVA 1GG3A 3PVLA 4OHJA 4YXDB 4KZCA 3N9YC 1L0YB 4P6VF 1D5XC 1N63A 5CHWA 2LGSA 2MJDA 3ML8A 4C7YA 3PRPB 2MLBA 5AZHA 1UWMA 2NBUA 1FRRA 1WF9A 2EELA 3C8YA 2QDFA 4KGSA 4B0MA 4RGTA 3BWUD 3RNBC 2N9EB 5E6JA 4ZRJA 1AW7A 3Q8FA 1D6EC 2BW2A 1IBXB 2CKHB 1JWMD 2PVGC 4NPNA 2C7NB 1ZDXA 4JWUC 4WAFA 2N9PC 4NZLB 3MFGA 2PEAA 1R4MB 1EU3A 3V3XA 2JWZA 2WXPA 3DBRB 3U2SC 1ET9A 4MSQB 5HKHA 1F0ZA 1D5MC 1UWXA 2CU3A 3JVZX 2DLBA 1C1YB 2Q5WD 5D2MB 4XZ4A 4RM8A 2AEHA 1BMLC 1B9RA 1PFDA 1TY0A 2I2YA 3MTNB 3GS2A 4NNJB 3ECIA 1SJHD 4BFRA 5C3JB 2MH7A 4WQOB 1QOAA 1FMAD 2MRPA 5GMVA 1GOZA 3A4SC 5DPSA 3X0WA 4URKA 1SEBD 2LRUA 2QC8A 4IWOA 2NS5A 4HJGE 3NS1A 2KACA 1WYGA 5C23A 4MGIE 3KUDB 5C2TB 2UU7A 3RNCC 2GBJA 1KH0A 1UELA 1KFYB 2AX5A 2EKEC 4MGKE 4A3OA 2KD0A 2N9XA 2C7MB 4P1BC 4WWOA 3EFUA 3PLVA 2O2VA 2LZ6A 5TR5A 4GDKB 4MT5A 4OVZA 5CX3A 1T5XD 3WALA 1FCCC 2WNMA 3SEBA 2M1MA 2RR9A 4XDDA 2N0SB 3LXFA 3QX1A 2LUEA 2AWTA 1UD7A 3MJ5A 1WMHA 2FE8A 3VUYA 5AEKB 3VQIA 2NBVB 3PTFC 1VCBA 1NI2A 5DPWA 3Q3JA 2NPTA 1QLBB 2TSSA 3ML9A 1WSPA 3A9KB 2EKIA 2M0XA 2PW9A 3LB8C 4MM3A 3DBLI 5AUKA 2JPHA 1ZP0B 2FAZA 1ZDVA 4PS3A 4ICVA 1WX8A 3O65B 3W5UB 4F1SA 3RULA 1AWDA 2MP2B 4KSLC 1UZXB 1J7CA 2BB6A 2DAJA 5FKAC 2HJ8A
chains in the Genus database with same CATH topology
1C78A 4WQMA 2K0PA 4ZHPA 2BYTA 2QEJC 1TKEA 5JXVA 3P4SB 1SJED 3ZJTA 1OQRA 1UNSA 2KN4A 1HQRD 1JRPA 1FM0D 1KTKA 1N60A 3L4PA 5D7GA 4L2YA 3NUHB 3Q8EA 1XXGA 1QKZA 1VJKA 4J3OD 3NVZA 1L0VB 3ZQ4A 1KLGD 4A9AA 2SEBD 4LK0M 1FCLA 4NAMA 1GB4A 3AE1B 1T6BX 2N9LA 1M4VA 1I4RA 4XWTA 1YN4A 1FIQA 4HROA 1XLNA 1QT9A 1XCTL 3AE2B 3EA6A 4FXCA 5HI1A 2N7JA 2DYOA 5HFYA 1C4PA 3E56A 3KWVA 5BMGA 3T3OA 1QOGA 2MJEA 1D4BA 1EWCA 1L0XB 4AS1A 1FNVA 3BVMA 1VLBA 3MP9A 5BMHA 5FK9C 2W3RA 1FNWA 1MHXA 4R3DA 3W5VB 1I4XA 1XLQA 2L83A 1DYQA 2LHDA 1VDVA 2N9KA 2NTTA 2IGHA 1C4AA 3AE5B 2ZW1A 4RFBA 3VRAB 1OFFA 3KWLA 1GPXA 5MPOA 1XLPA 3Q8BA 1F2RC 2AQ1B 3ETRA 3NRZA 2Y3AA 5G5GA 2OHFA 2W54A 1SE3A 1K51A 2WXHA 1EWYC 1XCQL 1AN8A 1J7AA 1SXTA 3ZJVA 1Q10A 5EE0A 2WDQB 2G9HD 3BZDB 1K52A 2X38A 2DYMA 2V3NA 1SF0A 2PLPA 1YN5A 5EE1A 1E6EB 2VZKB 5D3DA 5H92C 3Q8CA 1E10A 3FILA 3SFDB 4KX6B 3AN1A 1WXQA 1V8CA 1IGDA 1TS2A 4RCOA 2K5PA 1I4QA 1UUPA 3HRDD 3AV8A 5AUIA 1V1PB 2J42A 3GB1A 2JSVX 3TEZA 2WXQA 4XE0A 1F77A 3GP7A 3IXSA 4KKIA 1MPEA 1AYFA 2RDHA 1TKGA 4B0EA 4HKQA 2JX5A 2W3SA 2V4IB 4OZCA 4RF1A 5HHDG 3LYYA 1HZ6A 5LNK1 3AE7B 3Q69A 3NVVA 5HG2A 3ZJUA 2WXJA 3DWMA 1JROA 1QILA 1YQ3B 2XNAC 3SFEB 1C76A 2I38A 1SB3C 2PVOD 1RFKA 3BYTB 4C80A 3AEFB 3FC4A 3FAHA 3HVDA 3VRBB 1VR9A 1IBXA 1ROEA 2YEPB 2WXKA 1EM7A 2WXMA 3I9V1 3U7ZA 3AE3B 3AE8B 2QSDA 1RYJA 2GB1A 1DGJA 4HKZE 3VR8B 3EGRA 4ZHOA 1JALA 1FO4A 1F2RI 4A6QA 1YMHE 1QQRA 3B2GA 4OW0A 3AM9A 1BUIC 1JWSD 2NTSA 2WS3B 4YSYB 2INPE 1Y56A 4HEA1 1ZUD2 2V0GA 4KKJA 4US9A 2ONQA 2BS3B 2FBWB 3AEGB 4P16A 4L1BA 1DOXA 1ACCA 1PYWD 1DOIA 1I7HA 1TS3A 2WP9B 2DWQA 4MACA 3TSSA 1A70A 4REZA 3R8BA 2XN9C 1NENB 1N62A 3PZ7A 2IGDA 3RPFC 3PZ8A 1ZPSA 4RH6A 5BYRA 2Y5PA 4JWSC 4ARCA 3T3NA 4TMAB 1L4ZB 1YJJA 2WDRB 1KRHA 4MM3B 3KLSX 1QF6A 5D3IB 2BS2B 3H8HA 1PGXA 1VRAB 1YJIA 4ZOHC 1JQ4A 4YTPB 1SE2A 2GI9A 1HZ5A 4RGMA 4WIPA 4DXGA 5BYQA 3SR6A 1SSNA 3TEXA 2B76B 3IAS1 4OZBA 3Q8AA 1T3QA 1E0ZA 4M0WA 2NMQA 4C7ZA 2LUMA 4WWMA 2JYTA 3P63A 2IJ0A 2PMVA 3CIRB 4YSZB 3RFZB 2LMCA 2W55A 1R7SA 2RMMA 4TQ1A 2WLBA 1SBBB 3TEWA 1TY2A 3WCQA 1ZE3D 2QIEB 4N58A 1OQQA 4YSXB 3ZYYX 2BB5A 2ON8A 2JXTA 4KGTA 3EUB2 3IT4B 2CJOA 2JZPA 5TSSA 4AQ7A 3B2FA 3J9CA 2LEKA 2KQ4X 2LGIA 4DQOC 2Y5CA 2Z8LA 4RGNA 3P4PB 1RWSA 2CJNA 4GLSC 1QOFA 2R61A 3NVWA 1GAQB 1K53A 1PDXA 1XLOA 1CZPA 1HXYD 2J53A 1FRDA 3BVGA 4CQNA 2JYEA 1I4HA 2IDYA 1P7FA 2V3PA 2WXOA 4DXFA 2E3TA 3U2SC 2MJ3A 2IPKD 2KMMA 4JE3B 4A55A 3BK2A 1L5PA 1SIJA 2VZKD 1FXIA 1JWAD 4WH4A 1KF6B 4PT5A 1I4GA 4JPSA 4TQ0A 4ZYSA 1NVID 2INNE 3P4RB 1CJEA 2GRIA 1PGAA 1STEA 1XF5L 2WDVB 1K50A 4LLGM 5BMIA 1TS5A 2MEKA 3V05A 4OZAA 3AEAB 2LHEA 1FFVA 1MVKA 1N5WA 4MH8A 1BXTA 1PUTA 2BTEA 1PGBA 2W82A 4H2AA 3W1SA 4OHJA 4YXDB 1C9FA 1TKYA 1RM6C 1YNTE 3AMZA 3PO0A 4US8A 3N9YC 1FD6A 3P4QB 1ZOYB 1XEEA 1L0YB 4ITKA 3FILB 4P6VF 5EE3A 4RNAA 1VZ6A 1D5XC 2RDGA 1N63A 2JWUA 1V97A 4IDIA 1TZOA 1CK1A 4D2KA 3R2TA 2MJDA 5G5HA 2HDEA 4C7YA 1FNUA 2WXLA 5GXGB 1UWMA 1HA5A 3IAM1 3VR9B 1N5XA 1FRRA 2WXIA 1CQVA 1L4DB 3R2IA 1EU4A 1ENFA 2EELA 3I57A 1FEHA 3C8YA 4KGSA 2KDMA 4B0MA 4RGTA 3BWUD 2LJIA 2LFIA 1HEZE 2WQYB 2K9XA 4XWWA 1QOBA 5E6JA 3AEEB 3MHZA 1AW7A 1NI3A 4TSSA 1WGKA 2WXRA 4Q2JA 2L1AA 1FFUA 3AE4B 1ET6A 3Q8FA 1D6EC 2BW2A 2OEDA 3O13A 1IBXB 1TYGB 1JWMD 2PVGC 3W2DA 4JWUC 1ZDXA 4WURA 4WAFA 3ABVB 1C79A 4NZLB 3MFGA 1B1ZA 1JCKB 3P42A 5H8YE 3AE6B 1XO3A 1EU3A 1MHHE 3AECB 3V3XA 2WXPA 1FXAA 1P7EA 3AEBB 1D5ZC 1ET9A 2J52A 1ZXHA 1NYQA 1D5MC 2YEPF 4N6EB 2DBYA 2WXNA 5I4DA 1F0ZA 1UWXA 2CU3A 2DLBA 2QILA 3URYA 4XDCA 2Q5WD 5FR3A 3TUOA 2D5GA 1BMLC 1N61A 1B9RA 1PFDA 4C56C 1DOYA 1V1PA 1TY0A 2FUG1 2M56B 2I2YA 5T8IA 2SAKA 5BYSA 3GS2A 1C4CA 3W9CB 1NYRA 4GDLB 1SJHD 1E7PB 2QJLA 1SE4A 1NEKB 5EE9A 1IUEA 5C3JB 2MH7A 3AE9B 1QOAA 3HVZA 1FMAD 3E9SA 1GOZA 1C77A 1L6UA 1TS4A 4NJCA 1SEBD 1VZ7A 2PIAA 4HJGE 4EE2A 3NS1A 2KACA 2RPVA 3CWIA 3HUIA 3AB5A 1WYGA 2ICIA 2WXFA 2JQRB 4YTNB 5C2TB 1TJEA 3BIID 2QMTA 1KH0A 1KFYB 1L6VA 2AX5A 2L52A 4NAWB 4IKGA 4RGOS 4YWGG 3AEDB 2J4XA 1KLUD 3BK1A 4GDKB 4MT5A 4OVZA 1GB1A 1JWUD 1T5XD 3U52E 4YTMB 3NZ3A 1FCCC 2WNMA 3SEBA 4UDUC 2AQ2B 4ZRQA 1YQ4B 4XDDA 2N0SB 4USAA 1WRIA 4YT0B 3LXFA 4LTUA 2K22A 2BBCA 2HTME 2E6XA 3MJ5A 1ZXIA 2M19A 3UI3A 1JW9D 1V1OA 2H88B 2FE8A 2AQ3B 4O1NA 1WWTA 3B9JA 1UGJA 3IT6B 1J7BA 3VQIA 2ACZB 4KGRA 1JMLA 4A90A 2WXGA 2L32A 3OWEB 2KAJA 1ESFA 1I4PA 2IGGA 3U4EG 4HRSA 2BT6A 2G1EA 1QLBB 2TSSA 4JX1C 1YN3A 1WSPA 2WU2B 2EKIA 1JWBD 2JU6X 2PKOA 2PW9A 3BVZA 3LB8C 4ZRPA 5AUKA 2KWDA 1IGCA 4N59A 2ZW0A 1ZP0B 2M0AA 2H89B 2K3UA 1ZDVA 3KQ4A 3NVYA 3W5UB 1LO5D 3AH7A 3ZGZA 1MI0A 1AWDA 4ARIA 4IOIE 4RF0A 4L23A 1J7CA 2BB6A 2PTLA 3DWGC 3BYYB 5FKAC 1E9MA 3P1MA 4A8XC 3MC0B 3TEYA 2BS4B 1VZ8A 2WU5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SB3 C;  2PVO D;  1RFK A;  2Q5W D;  3P4P B;  4WQM A;  4C80 A;  3AEF B;  3FC4 A;  1RWS A;  3FAH A;  3VRB B;  4ZHP A;  1TKE A;  2CJN A;  1ROE A;  1N61 A;  1B9R A;  1PFD A;  1DOY A;  1QOF A;  3P4S B;  2M56 B;  1OQR A;  1JRP A;  3W9C B;  1JQ4 A;  1FM0 D;  1NYR A;  3AE3 B;  3NVW A;  1E7P B;  1GAQ B;  1N60 A;  1PDX A;  1XLO A;  1CZP A;  1NEK B;  2QJL A;  3AE8 B;  1IUE A;  1FRD A;  2MH7 A;  1VJK A;  1RYJ A;  3AE9 B;  5EE9 A;  5C3J B;  1QOA A;  1DGJ A;  3VR8 B;  4ZHO A;  1FO4 A;  3HVZ A;  1JAL A;  1FMA D;  3NVZ A;  1L0V B;  2E3T A;  2MJ3 A;  1L6U A;  3B2G A;  4A9A A;  2KMM A;  3AM9 A;  2PIA A;  2WS3 B;  3NS1 A;  4YSY B;  3AE1 B;  3HUI A;  3CWI A;  1L5P A;  3AB5 A;  1ZUD 2;  1SIJ A;  1WYG A;  2JQR B;  4YTN B;  1FXI A;  1JWA D;  4US9 A;  5C2T B;  1TJE A;  3BII D;  1KF6 B;  1FIQ A;  4HRO A;  1XLN A;  1KFY B;  1L6V A;  1QT9 A;  2AX5 A;  2BS3 B;  2L52 A;  3AE2 B;  4FXC A;  1NVI D;  2FBW B;  3AEG B;  1CJE A;  3P4R B;  3AED B;  2WDV B;  1QOG A;  1DOX A;  1DOI A;  1I7H A;  2MJE A;  4YTM B;  2WP9 B;  3AEA B;  1FFV A;  1N5W A;  2DWQ A;  1PUT A;  1VLB A;  1A70 A;  1YQ4 B;  2W3R A;  4YXD B;  1TKY A;  1RM6 C;  3AMZ A;  3PO0 A;  4US8 A;  1NEN B;  1N62 A;  3W5V B;  2N0S B;  3P4Q B;  1XLQ A;  1WRI A;  1ZOY B;  2L83 A;  4USA A;  3LXF A;  4ITK A;  2K22 A;  1VDV A;  4LTU A;  4P6V F;  5EE3 A;  2HTM E;  3AE5 B;  4JWS C;  1N63 A;  1ZXI A;  1V97 A;  1YJJ A;  1JW9 D;  2M19 A;  4IDI A;  2H88 B;  1KRH A;  2WDR B;  3VRA B;  1OFF A;  3KWL A;  1GPX A;  5MPO A;  1QF6 A;  1XLP A;  2BS2 B;  1WWT A;  2MJD A;  3B9J A;  3ETR A;  3NRZ A;  1YJI A;  4ZOH C;  2OHF A;  2W54 A;  4YT0 B;  4YTP B;  5G5H A;  5G5G A;  1J7B A;  4C7Y A;  5GXG B;  1EWY C;  1UWM A;  2ACZ B;  1J7A A;  3VR9 B;  1N5X A;  1FRR A;  2KAJ A;  5EE0 A;  2WDQ B;  3SR6 A;  4HRS A;  2BT6 A;  2B76 B;  1SF0 A;  2G1E A;  1QLB B;  1T3Q A;  2WQY B;  1E0Z A;  2K9X A;  4JX1 C;  5EE1 A;  1E6E B;  1QOB A;  4WWM A;  5H92 C;  4C7Z A;  1E10 A;  3AEE B;  3P63 A;  1NI3 A;  3SFD B;  2WU2 B;  1WGK A;  4KX6 B;  3AN1 A;  3CIR B;  4YSZ B;  2EKI A;  1WXQ A;  1JWB D;  2W55 A;  1R7S A;  1V8C A;  2PKO A;  1FFU A;  3AE4 B;  3LB8 C;  2WLB A;  5AUK A;  2K5P A;  4N59 A;  1TYG B;  3HRD D;  1ZP0 B;  3AV8 A;  5AUI A;  3WCQ A;  2PVG C;  2H89 B;  4JWU C;  3L4P A;  3ABV B;  2QIE B;  4N58 A;  3NVY A;  3RPF C;  1OQQ A;  3W5U B;  4YSX B;  3ZYY X;  3AH7 A;  1AYF A;  1TKG A;  1AWD A;  2JX5 A;  2W3S A;  5H8Y E;  3AE6 B;  1XO3 A;  3AEC B;  2CJO A;  3EUB 2;  1J7C A;  3B2F A;  1FXA A;  3AEB B;  3AE7 B;  1F0Z A;  3NVV A;  1NYQ A;  2LEK A;  4N6E B;  3DWG C;  2DBY A;  1E9M A;  2CU3 A;  3DWM A;  3P1M A;  1JRO A;  1YQ3 B;  3SFE B;  2BS4 B;  2Y5C A;  2WU5 B; 
#chains in the Genus database with same CATH topology
 2BYT A;  5JXV A;  3P4S B;  1OQR A;  4WJN A;  3C19 A;  1FM0 D;  1N60 A;  5DPT A;  3NUH B;  2A4Z A;  1I42 A;  3RMK C;  3SD5 A;  1L0V B;  2L00 B;  3ZQ4 A;  1ZW7 A;  3N30 A;  2SEB D;  4CYE A;  3H7P B;  4FBJ B;  1GB4 A;  3IG3 A;  3DVG Y;  4XYC A;  2FIF A;  2FCQ A;  1F9J A;  4HRO A;  1QT9 A;  3QJZ A;  3R7Q A;  3AE2 B;  3EA6 A;  4DHJ B;  5JZE B;  3QK0 A;  3SHQ A;  3VHT C;  5BMG A;  3T3O A;  1QOG A;  1D4B A;  1EWC A;  3KUC B;  4WWP A;  5FR6 A;  3MP9 A;  3Q6B A;  4C4V B;  3W5V B;  1XLQ A;  4K3C A;  4K3B A;  2NTT A;  1C4A A;  2ZW1 A;  2V3S A;  2O6V B;  5MPO A;  2AQ1 B;  5G5G A;  2OHF A;  3DVN U;  4G0N B;  1XCQ L;  1AN8 A;  2KTR A;  3ZJV A;  3DVN V;  1WE7 A;  1WJ6 A;  4GIV A;  3BZD B;  2BYE A;  5C1Z A;  3T8M A;  1YN5 A;  2VZK B;  5H92 C;  3Q8C A;  3SFD B;  4TV3 A;  2DZJ A;  1UBI A;  1TS2 A;  4PYZ A;  2J42 A;  1UF0 A;  2CS4 A;  2LXA A;  3GB1 A;  1LXD A;  3K9O B;  2KJ6 A;  2IO2 B;  2BVC A;  4RF1 A;  2KMA A;  3AE7 B;  2C5L C;  1JRO A;  1YQ3 B;  2XNA C;  3W1Y A;  4P7I A;  1C76 A;  4GOC A;  4WJP A;  3HK0 A;  3KW5 B;  3BYT B;  2MSE D;  3FC4 A;  2BYF A;  1VR9 A;  1IBX A;  2YEP B;  3UIN B;  1EUV B;  2K8C A;  3ZDM C;  3PZD A;  2WXM A;  3ZTC A;  3AE3 B;  3EC8 A;  3RZW C;  4C00 A;  1F2R I;  1QQR A;  4M01 A;  3MJW A;  4LNI A;  1ZUD 2;  2N1W A;  2LD9 A;  2RD0 A;  3WAM A;  4DDI D;  3RYT A;  1V5O A;  4L1B A;  1ACC A;  1WFY A;  2ZVO A;  3DOW A;  4MAC A;  1RFA A;  1A70 A;  3TCA A;  1J0G A;  2PE6 B;  3FKY A;  3ZTD A;  3PZ7 A;  3RPF C;  5E6P A;  3M62 B;  5BYR A;  4ARC A;  2RDB C;  1KRH A;  3L0W B;  3KLS X;  1WY8 A;  3Q14 C;  2BS2 B;  2KLC A;  4ZOH C;  3ZDT A;  3RCZ A;  3A9J B;  2K6D B;  5J2R A;  4F8C B;  4AJY B;  4WIP A;  4MDK E;  5BYQ A;  3SR6 A;  2N4F A;  4DK5 A;  4OZB A;  1T3Q A;  2NMQ A;  4C7Z A;  2JYT A;  4W9G A;  2LMC A;  3RNA C;  4DHJ D;  3MC8 A;  3ZYY X;  2BB5 A;  1E7U A;  2ON8 A;  2JXT A;  4MEL A;  3QA8 A;  1F52 A;  3J9C A;  4DQO C;  2EMS A;  2KQ7 A;  1WJU A;  3HHM A;  2Y5C A;  2ZJD A;  4RGN A;  2KZR A;  3A9K A;  1IPG A;  3P4P B;  3VVW B;  2CJN A;  2O6V D;  1YX5 B;  1QOF A;  2ASQ A;  3M63 B;  1AAR A;  2M17 A;  1CZP A;  1V9J A;  2MQJ A;  3JW0 X;  4CQN A;  4KVG B;  2JYE A;  1P7F A;  2MP2 A;  2V3P A;  4DXF A;  2IBI B;  4JE3 B;  4A55 A;  4GB9 A;  4GU2 A;  2ZCC A;  2LWP A;  3PHW B;  1L5P A;  4PYU A;  2VZK D;  1FXI A;  4K7U A;  1WZ0 A;  4PT5 A;  4JPS A;  2XBB C;  2HJ1 A;  1CJE A;  1STE A;  1WGH A;  1XF5 L;  4LLG M;  4KV2 A;  1TS5 A;  2MEK A;  3AEA B;  4CHK A;  4MH8 A;  1N5W A;  2BTE A;  1PGB A;  2W82 A;  3ONS A;  3ZW3 A;  4AP4 C;  1RM6 C;  1YNT E;  4US8 A;  3H7P A;  2KJR A;  1P0R A;  4ITK A;  5EE3 A;  2JZZ A;  1VZ6 A;  2RDG A;  1V97 A;  2KWV B;  2KDE B;  3R2T A;  5G5H A;  3APD A;  2YLM A;  5GXG B;  1HA5 A;  2WXI A;  4FJY A;  3R2I A;  2FNJ B;  1EU4 A;  3EFC A;  3QQ8 B;  4C4V A;  4XWW A;  1QOB A;  3AEE B;  1NI3 A;  2PPH A;  3AE4 B;  2O6V A;  1ET6 A;  3O13 A;  2OED A;  1TYG B;  4WUR A;  4NJ7 A;  3ABV B;  3IBE A;  5CHV C;  1KJT A;  2G4S A;  2MX2 A;  1VD2 A;  1JCK B;  3AE6 B;  1XO3 A;  3RNF C;  3NG0 A;  5J18 A;  1WIA A;  1FXA A;  1P7E A;  3AEB B;  2J52 A;  5I4D A;  1NBF C;  1T0Q C;  4XDC A;  2NR2 A;  4EFO A;  4G50 A;  4JLC A;  3I3T B;  1N61 A;  4C56 C;  3VTV A;  2FUG 1;  4ASW C;  4GDL B;  1NEK B;  1D3Z A;  3ENE A;  4BOS C;  2IO0 B;  3HVZ A;  3E9S A;  4KDI C;  4I6N B;  2BKR B;  2PIA A;  3L08 A;  4K1R B;  4EE2 A;  1YD8 U;  3WIM A;  3HUI A;  3CWI A;  3AB5 A;  2QMT A;  1ISN A;  4ACF A;  2L52 A;  2FCM A;  2M8S A;  3UF8 A;  2J4X A;  2D07 B;  3BK1 A;  1K8R B;  3ZNZ B;  3U52 E;  4YTM B;  3NZ3 A;  3ZXV A;  3VAW A;  2AQ2 B;  4ZRQ A;  3APC A;  1T0Y A;  4FN2 A;  1WRI A;  2N7E A;  2HTM E;  1OEY J;  2E6X A;  2GBM A;  3NZS A;  3UI3 A;  1V1O A;  1WWT A;  1UGJ A;  2KTF A;  4PK1 A;  2KC1 A;  2ACZ B;  4KGR A;  1TBE A;  1JML A;  3U7D A;  3OWE B;  4ANU A;  2KX0 A;  3M95 A;  2BT6 A;  3DHG C;  4JX1 C;  4MGY E;  2WU2 B;  1NDD A;  1JWB D;  2PKO A;  4BBN C;  3BVZ A;  2DZM A;  4N59 A;  1WXM A;  2M0A A;  3KQ4 A;  1V6E A;  3A9J A;  4IW0 A;  2MBE A;  3H6N A;  4GGQ A;  2LJ5 A;  3H1U A;  2Z59 B;  4IOI E;  3SDL C;  4K7W A;  1E7V A;  2OOB B;  2PTL A;  3BYY B;  3DBH I;  2KFK B;  4A8X C;  3GE8 C;  2KT7 A;  2B3A A;  1BT0 A;  4BVU C;  2ZPY A;  1H8C A;  1TIF A;  3GZN I;  2I1K A;  1HE8 A;  4LCD E;  5AZG A;  2LRW A;  4NJ6 A;  4ZRK A;  1GC7 A;  1M4V A;  2K6Q A;  4XC2 A;  1YN4 A;  2DEN B;  3RT3 B;  2DYO A;  4EZK A;  5HFY A;  4JL9 A;  1C4P A;  5JHB A;  3PGE A;  2MJE A;  4A20 A;  3TIX A;  4AS1 A;  2GOW A;  3BVM A;  3QCA A;  2AL6 A;  3PT2 B;  5FK9 C;  1FNW A;  1MHX A;  4DWF A;  2REX A;  2HTH A;  2YVC A;  2IGH A;  2UYZ B;  4RFB A;  3VRA B;  1OFF A;  1GPX A;  1XLP A;  4LNK A;  1J7A A;  4AWJ A;  2WDQ B;  2G9H D;  2KWC A;  2MBQ A;  1EO6 A;  1SF0 A;  1Z5S B;  4FLH A;  5EE1 A;  1E6E B;  1E10 A;  3QIJ A;  3L13 A;  4KX6 B;  3AN1 A;  3AU4 A;  4ZYN A;  1IGD A;  4RCO A;  2G3Q B;  2K5P A;  3AV8 A;  5LLI A;  3KUZ A;  3MC9 A;  2ZNV C;  3SU8 X;  4RMA A;  4XE0 A;  1F77 A;  2ZVN A;  4MEM A;  2N1V A;  4KKI A;  4FJV B;  4B0E A;  4KIK B;  2GLS A;  2V4I B;  3X23 A;  4W9H A;  2XK5 B;  2L05 A;  1I35 A;  2WXJ A;  3DCG A;  3DWM A;  1RFK A;  2K8H A;  2IND C;  3HVD A;  2GBN A;  2K8B A;  1ROE A;  3N1X C;  2BKF A;  2WXK A;  1EM7 A;  4WAA A;  2KMC A;  3U7Z A;  3AE8 B;  3I5J C;  2GB1 A;  4E3C A;  3AUL A;  1T0S C;  3QAQ A;  4X57 B;  5D6J B;  2L3Z A;  4KKJ A;  4US9 A;  2ONQ A;  4BKS D;  1MJD A;  1Q5W B;  4P16 A;  5J17 A;  4GDL A;  1TS3 A;  3NOB A;  3PRE A;  2DWQ A;  3VH4 B;  1WJN A;  4IM0 A;  3R8B A;  1JRU A;  2BYV E;  4TKN A;  4S0R A;  1NEN B;  2IGD A;  3PZ8 A;  1E8W A;  2Y5P A;  2L0T A;  3T3N A;  5IAA C;  2WDR B;  2BF8 B;  1CMX B;  2LVO A;  1SE2 A;  2OJR A;  2QHO A;  4LNN A;  5IA7 A;  3V62 A;  1S3S G;  3HM6 X;  2KC2 A;  3TEX A;  1E90 A;  3V60 A;  4K81 A;  4KSK C;  2RGF A;  3P63 A;  2PMV A;  2JT4 B;  3CIR B;  3RFZ B;  1YIW A;  2W55 A;  1R7S A;  3H7S A;  2CR5 A;  4HCN B;  1TY2 A;  3WCQ A;  2QIE B;  3ZKJ C;  3IT4 B;  1LGR A;  3L10 B;  1GC6 A;  3NS8 A;  2D11 A;  2LEK A;  2KQ4 X;  1TT5 B;  1C3T A;  1WXV A;  1UBQ A;  1RWS A;  4XGA B;  4ICU A;  4BKS A;  2DZK A;  2JVC A;  3OJ3 A;  5LXI B;  3VH3 B;  3V61 A;  3TJP A;  2R61 A;  3A4R A;  1GAQ B;  1PDX A;  1V2Y A;  2GBR A;  2E3T A;  1PQS A;  1WXA A;  2IPK D;  1IYF A;  2D3G A;  1WRD B;  3RZF A;  2KFK A;  4HPL B;  1WYW B;  3NZU A;  3APF A;  1KF6 B;  3Q3O C;  4TUU A;  3MHS D;  3L54 A;  1L2N A;  1K50 A;  5BMI A;  1GNU A;  4KZ0 A;  3V05 A;  2KHW B;  2LHE A;  1FFV A;  1BXT A;  4I6L B;  3ALB A;  3OG5 A;  1TKY A;  3PO0 A;  1ZOY B;  3FIL B;  4PS7 A;  2JWU A;  3JSV B;  4IDI A;  1YQB A;  4D2K A;  3RN9 C;  2KVR A;  2KFJ A;  4ANV A;  2WXL A;  2Z0D B;  1P98 A;  2PE9 A;  5BO4 B;  1ENF A;  3I57 A;  1FEH A;  3OAW A;  2KDM A;  3ZIM A;  2N7D A;  2LJI A;  3W1S C;  1WGG A;  4GN1 A;  4TSS A;  1WGK A;  1EF5 A;  2WXR A;  4Q2J A;  2L1A A;  5L95 C;  1FFU A;  1WR1 A;  4W9K A;  1RRB A;  2JRI B;  3W2D A;  5JH5 C;  4W9C A;  4GDK A;  3AEC B;  1MHH E;  3LDZ E;  4W9L A;  1NYQ A;  2DBY A;  2WXN A;  1IP9 A;  2L7R A;  3IHP C;  4G3X B;  2IO3 B;  3TUO A;  1DOY A;  5E6O A;  2M56 B;  2L76 A;  5BYS A;  1C4C A;  3W9C B;  1SE4 A;  1IUE A;  3AE9 B;  4KIK A;  4HPP A;  3L16 A;  1ZGU B;  1L6U A;  3Q2A C;  1TS4 A;  2XK5 A;  3IFW B;  2W9N A;  3DBS A;  1WM3 A;  2RPV A;  2WX1 A;  2ICI A;  2WXF A;  2JQR B;  4YTN B;  3BII D;  3WA0 A;  2K25 A;  1L6V A;  1R4M I;  2C9W B;  1E8X A;  4IKG A;  4RGO S;  2FUH B;  2INC C;  1OGW A;  1TGZ B;  3DBR I;  4LDT B;  1YX6 B;  5CTR C;  3VTW A;  3U8Z A;  1RLF A;  3DBL B;  2ZPN A;  3CSF A;  3ZRF A;  4M0W B;  2R2O A;  4YT0 B;  2K22 A;  2BBC A;  2NBW B;  5CHF A;  1ZXI A;  2M19 A;  1JW9 D;  1J19 A;  2G4D B;  2NCN A;  2H88 B;  3NY5 A;  1H4R A;  2AQ3 B;  2KDF B;  4O1N A;  4CO7 A;  4A90 A;  3QWZ B;  3AU5 A;  2KNB A;  3UQA A;  1ESF A;  2OJW A;  3U4E G;  3LJ3 A;  2MBH A;  3N1Z C;  2NVU I;  3WAP A;  3PRM B;  1XT9 B;  3H9D A;  3A1Q B;  1MG8 A;  2HE7 A;  2KWD A;  1V86 A;  3RUI B;  2H89 B;  2K3U A;  3A33 B;  2UWQ A;  1R4N B;  4DDG D;  1LO5 D;  3AH7 A;  1MI0 A;  2KYW A;  4IM3 A;  4W9J A;  4RF0 A;  4L23 A;  2CHX A;  4EEW A;  4G11 A;  3I63 C;  4K7S A;  2BS4 B;  1C78 A;  2K0P A;  4ZHP A;  3M3J A;  2QEJ C;  1TKE A;  2VH1 A;  2LGX A;  5IP4 D;  1SJE D;  1UNS A;  2KN4 A;  4EZJ A;  1KTK A;  4GSW A;  1L7Y A;  3L4P A;  2JF5 A;  4L2Y A;  3Q8E A;  1XXG A;  4J3O D;  1VJK A;  2LAS A;  3NVZ A;  2C7H A;  2FCN A;  2JUO A;  1FCL A;  4NAM A;  3AE1 B;  2N9L A;  4AJW A;  2V1Y A;  4XWT A;  2JZ3 B;  3KYD D;  1WGY A;  1XCT L;  4FXC A;  2N7J A;  2KOX A;  3E56 A;  4JIO U;  4HLE A;  1WZ3 A;  4BBN F;  4HDO A;  1VLB A;  4YL8 A;  5BMH A;  4LJO B;  2W3R A;  4R3D A;  4MH0 E;  2L83 A;  1GJZ A;  1VDV A;  3VFK A;  3R7R A;  2FID A;  3BIN A;  4MJS B;  4BKT A;  1WE6 A;  3KWL A;  2BQQ A;  1F2R C;  3S2A A;  4RM9 A;  1EF1 A;  1K51 A;  1EWY C;  2GBK A;  1SXT A;  2JY6 A;  3PRZ A;  5IKC M;  1K52 A;  2DYM A;  2V3N A;  3ZLZ A;  2PLP A;  3FIL A;  4QAY A;  3VUW A;  1WXQ A;  2K1F A;  3JSV A;  1V8C A;  1I4Q A;  5AUI A;  1V1P B;  3JYU A;  2LXC A;  1XQQ A;  3KYC D;  4XX5 A;  2RDH A;  4JGH B;  4HKQ A;  2JX5 A;  4DHZ B;  1SE9 A;  5HHD G;  4DHZ E;  1HZ6 A;  3NVV A;  2GMI C;  4IWQ A;  3AXC A;  2I38 A;  1SB3 C;  2PVO D;  3UQB A;  4C80 A;  3ZO5 B;  3VRB B;  3QC8 B;  3I9V 1;  4EUT A;  2I1J A;  3DQV A;  3B08 A;  2L8J A;  2MBO A;  2QSD A;  1RYJ A;  4ZHO A;  1DGJ A;  2WX0 A;  4HKZ E;  3EGR A;  1FO4 A;  1JAL A;  4FAD A;  4A6Q A;  3B2G A;  4EZL A;  4HXD A;  1WR6 E;  2NTS A;  4YSY B;  2D10 A;  2V0G A;  2AL3 A;  2BS3 B;  2ZZP B;  1FXT B;  3B0A A;  3AEG B;  2IZV B;  2EMT A;  1P3Q U;  1DOI A;  1I7H A;  4LNF A;  2AYO B;  4M00 A;  3Q3M C;  3TSS A;  5KHQ A;  4REZ A;  2XN9 C;  2D3B A;  4W9E A;  4TMA B;  1L4Z B;  4KDL B;  4HVB A;  2QCZ A;  1QF6 A;  5D3I B;  3H8H A;  1PGX A;  1VRA B;  4ANX A;  1JQ4 A;  4YTP B;  2GI9 A;  5IO9 A;  4B9K A;  2K39 A;  4S17 A;  3DVG X;  2B76 B;  2RPQ A;  4JQW C;  1S1Q B;  3Q8A A;  1E0Z A;  4M0W A;  3KH0 A;  1F1H A;  2LUM A;  4WWM A;  2ZCB A;  2KDB A;  4YSZ B;  1UH6 A;  3D32 A;  4TQ1 A;  4BOZ B;  2WLB A;  3TEW A;  1ZE3 D;  2IYD B;  4N58 A;  1OQQ A;  4YSX B;  3KVF B;  2CJO A;  3TMP B;  2JZP A;  5TSS A;  4AQ7 A;  1E8Z A;  3B2F A;  2L0F A;  2LGI A;  1OQY A;  2BGF A;  3DPD A;  4FJZ A;  1OTR B;  2Z8L A;  2KVZ A;  1LFD A;  3A1Q A;  1MFW A;  2D3C A;  2JXX A;  4WWN A;  3Q3N C;  2DX5 B;  1FRD A;  2J53 A;  3BVG A;  1I4H A;  2IDY A;  3PV1 A;  1WI0 A;  2C60 A;  2KMM A;  3ZXR A;  4HPM B;  2RSU A;  4P1C C;  1HTO A;  3BK2 A;  1SIJ A;  1JWA D;  4WH4 A;  3L17 A;  1I4G A;  4DBG A;  4DXA B;  2CHZ A;  2ZNV B;  1T0R C;  2J0K A;  2GRI A;  1PGA A;  2WDV B;  3PHX B;  1MVK A;  1PUT A;  1WX7 A;  2IO1 B;  1C9F A;  4W9D A;  3AMZ A;  1FD6 A;  3P4Q B;  1E5W A;  1XEE A;  4HK2 A;  2LI5 A;  4RNA A;  4EOY A;  1TZO A;  1CK1 A;  2CU1 A;  5AZF A;  4BKG A;  2HDE A;  2WHI A;  1FNU A;  3IAM 1;  2MWS B;  3P2B A;  3VR9 B;  1N5X A;  2MCN B;  1CQV A;  1L4D B;  3B1L X;  3DHH C;  2KO3 A;  1M94 A;  2LFI A;  1HEZ E;  2WQY B;  3TL5 A;  2KAN A;  2K9X A;  3N3K B;  2MBB B;  3MHZ A;  4NQL B;  4MJS A;  1WM2 A;  3V6E B;  2LGY A;  4IC7 B;  1C79 A;  4ANW A;  1B1Z A;  3QHT A;  3P42 A;  5H8Y E;  5JHA A;  1D5Z C;  3ZUN A;  1ZXH A;  2YEP F;  4N6E B;  3HIZ A;  2QIL A;  1R4N I;  3URY A;  2D2Q A;  5FR3 A;  2KX3 A;  4ZRI A;  4WJO A;  4M8N A;  2D5G A;  1V1P A;  5T8I A;  2SAK A;  1NYR A;  1U4A A;  3EHV A;  1E7P B;  2QJL A;  3HM3 A;  5EE9 A;  4W9I A;  3RNG C;  2MW5 A;  4WJQ A;  1C77 A;  4HCP B;  4NJC A;  1VZ7 A;  4EKU A;  3TBL D;  1TJE A;  3RNE C;  3ZRC A;  3R66 C;  4NAW B;  3C0R B;  5KHO A;  2M4N A;  4YWG G;  3AED B;  1KLU D;  1E8Y A;  1GB1 A;  3ZNG C;  1JWU D;  1Q0W B;  1A5R A;  4UDU C;  2KKC A;  1P9D U;  1YQ4 B;  4HDQ A;  2VH2 A;  4FHJ A;  4USA A;  1WH3 A;  4LTU A;  3RI7 C;  2A5U A;  2DYB A;  3DDC B;  2KXJ A;  3EEC A;  3K9P B;  3UIO B;  4E74 A;  3B9J A;  3IT6 B;  1V81 A;  3DBH B;  5G2N A;  1J7B A;  3NJT A;  2WGS A;  2KQS A;  2PJH A;  2WXG A;  2L32 A;  4IUM B;  2KAJ A;  4LNO A;  1FPY A;  1I4P A;  5DCN A;  2IGG A;  4HRS A;  3GZN B;  1G6J A;  2G1E A;  3GE3 C;  2D3A A;  1YN3 A;  3VTU A;  2JU6 X;  2KDI A;  4ZRP A;  4II2 B;  1YJ1 A;  3GOE A;  2G45 B;  1IGC A;  3UGB B;  2ZW0 A;  2CHW A;  4W9F A;  2KK8 A;  3NVY A;  2Z0E B;  2MHJ A;  3ZGZ A;  4ARI A;  5IOI A;  1OEY A;  3DWG C;  3Q3F A;  1E9M A;  3P1M A;  3MC0 B;  3TEY A;  1VZ8 A;  2WU5 B;  3U30 A;  4WQM A;  4ZDV A;  3WAN A;  4LJP B;  2LGD A;  3ZJT A;  2FCS A;  1HQR D;  1JRP A;  4IG7 B;  5D7G A;  1QKZ A;  3QAR A;  2BWE S;  1KLG D;  4A9A A;  3OLM D;  4LK0 M;  3CST A;  1T6B X;  1X1M A;  1I4R A;  1WXS A;  1GUA B;  2J0M A;  4NY0 A;  1FIQ A;  1XLN A;  3WAO A;  2DAF A;  3R3M A;  5HI1 A;  3KWV A;  1Q1O A;  3ZNH B;  1L0X B;  4FUL A;  1FNV A;  2X8X X;  2WYQ A;  2V4L A;  2DNF A;  1KLV A;  1KOT A;  1I4X A;  1DYQ A;  2LHD A;  2N9K A;  3PPA A;  3PS6 A;  3AE5 B;  2LVP A;  4F7Z A;  3Q8B A;  3ETR A;  3NRZ A;  2Y3A A;  2W54 A;  1SE3 A;  2WXH A;  3VUX A;  1Q10 A;  5EE0 A;  3CF6 E;  1ZKH A;  4MGZ E;  2WDT B;  2X38 A;  1LM8 B;  1WJ4 A;  5D3D A;  5L83 A;  4N9F 4;  2BPS A;  1UGM A;  1UUP A;  3HRD D;  5EDS A;  3PLU A;  2JSV X;  4IWP A;  3RD2 A;  3VDZ A;  3TEZ A;  2WXQ A;  3GP7 A;  3IXS A;  2J0J A;  1V5T A;  5E6N A;  1MPE A;  1AYF A;  1TZ1 A;  1TKG A;  2WWZ A;  2W3S A;  1J8C A;  4OZC A;  3PSE B;  3LYY A;  4IM2 A;  5LNK 1;  3Q69 A;  5HG2 A;  3ZJU A;  4AOF A;  3IVF A;  1QIL A;  3SFE B;  3T9L A;  2LVQ A;  4FA6 A;  3AEF B;  3OJ4 B;  3FAH A;  4A3P A;  3V6C B;  2O2V B;  1YOV B;  3AI5 A;  4HWI B;  3VR8 B;  4M02 A;  1Y8R C;  1YMH E;  4OW0 A;  3AM9 A;  1BUI C;  1JWS D;  2WS3 B;  2INP E;  1Y56 A;  4HEA 1;  1V80 A;  1QZE A;  2VRR B;  2R2Q A;  1WMH B;  4AUQ C;  4NQK E;  4GXB A;  1SIF A;  1WGR A;  2FBW B;  3CMM B;  4PS8 A;  1LQB A;  1DOX A;  1TTN A;  1PYW D;  1Z2M A;  2WP9 B;  4HJK A;  3ZVV A;  2DHZ A;  2NPT B;  5IN7 A;  2XEW A;  1HTQ A;  4B6W A;  3VXW A;  1MG4 A;  1N62 A;  3DHI C;  1ZPS A;  1RAX A;  4RH6 A;  4JWS C;  1YJJ A;  4MM3 B;  4MSM B;  4NAW A;  4M8M A;  1YJI A;  1P1A A;  1N6Z A;  1HZ5 A;  4RGM A;  4FHK A;  2KJH B;  4BZA A;  3BY4 B;  3N20 C;  4DXG A;  1SSN A;  4OVV A;  3IAS 1;  2MA9 B;  2IJ0 A;  1KM7 A;  2HD5 B;  2IY0 B;  2RMM A;  4II3 B;  1SBB B;  2DZI A;  4OVU A;  4I6P A;  2ZEQ A;  4KGT A;  3EUB 2;  2IY1 B;  2JRH A;  2J7Q B;  1SGH A;  5D94 A;  2BWF A;  3NHE B;  3ZNI D;  4GLS C;  4J6I A;  5LXH A;  2KWU B;  1WX9 A;  4E71 A;  3NVW A;  1K53 A;  1XLO A;  5DPR A;  4LDT D;  1HXY D;  2WXO A;  2KLG A;  2MJ3 A;  1V49 A;  3N1Y C;  2KN5 A;  1XD3 B;  3N32 A;  5G55 A;  4BAX A;  4B95 A;  2V9H A;  2Y5B B;  4TQ0 A;  4ZYS A;  1NVI D;  2INN E;  3P4R B;  3UIP B;  2KTR B;  1WGD A;  4OZA A;  4H2A A;  3W1S A;  4GMV A;  1GG3 A;  3PVL A;  4OHJ A;  4YXD B;  4KZC A;  3N9Y C;  1L0Y B;  4P6V F;  1D5X C;  1N63 A;  5CHW A;  2LGS A;  2MJD A;  3ML8 A;  4C7Y A;  3PRP B;  2MLB A;  5AZH A;  1UWM A;  2NBU A;  1FRR A;  1WF9 A;  2EEL A;  3C8Y A;  2QDF A;  4KGS A;  4B0M A;  4RGT A;  3BWU D;  3RNB C;  2N9E B;  5E6J A;  4ZRJ A;  1AW7 A;  3Q8F A;  1D6E C;  2BW2 A;  1IBX B;  2CKH B;  1JWM D;  2PVG C;  4NPN A;  2C7N B;  1ZDX A;  4JWU C;  4WAF A;  2N9P C;  4NZL B;  3MFG A;  2PEA A;  1R4M B;  1EU3 A;  3V3X A;  2JWZ A;  2WXP A;  3DBR B;  3U2S C;  1ET9 A;  4MSQ B;  5HKH A;  1F0Z A;  1D5M C;  1UWX A;  2CU3 A;  3JVZ X;  2DLB A;  1C1Y B;  2Q5W D;  5D2M B;  4XZ4 A;  4RM8 A;  2AEH A;  1BML C;  1B9R A;  1PFD A;  1TY0 A;  2I2Y A;  3MTN B;  3GS2 A;  4NNJ B;  3ECI A;  1SJH D;  4BFR A;  5C3J B;  2MH7 A;  4WQO B;  1QOA A;  1FMA D;  2MRP A;  5GMV A;  1GOZ A;  3A4S C;  5DPS A;  3X0W A;  4URK A;  1SEB D;  2LRU A;  2QC8 A;  4IWO A;  2NS5 A;  4HJG E;  3NS1 A;  2KAC A;  1WYG A;  5C23 A;  4MGI E;  3KUD B;  5C2T B;  2UU7 A;  3RNC C;  2GBJ A;  1KH0 A;  1UEL A;  1KFY B;  2AX5 A;  2EKE C;  4MGK E;  4A3O A;  2KD0 A;  2N9X A;  2C7M B;  4P1B C;  4WWO A;  3EFU A;  3PLV A;  2O2V A;  2LZ6 A;  5TR5 A;  4GDK B;  4MT5 A;  4OVZ A;  5CX3 A;  1T5X D;  3WAL A;  1FCC C;  2WNM A;  3SEB A;  2M1M A;  2RR9 A;  4XDD A;  2N0S B;  3LXF A;  3QX1 A;  2LUE A;  2AWT A;  1UD7 A;  3MJ5 A;  1WMH A;  2FE8 A;  3VUY A;  5AEK B;  3VQI A;  2NBV B;  3PTF C;  1VCB A;  1NI2 A;  5DPW A;  3Q3J A;  2NPT A;  1QLB B;  2TSS A;  3ML9 A;  1WSP A;  3A9K B;  2EKI A;  2M0X A;  2PW9 A;  3LB8 C;  4MM3 A;  3DBL I;  5AUK A;  2JPH A;  1ZP0 B;  2FAZ A;  1ZDV A;  4PS3 A;  4ICV A;  1WX8 A;  3O65 B;  3W5U B;  4F1S A;  3RUL A;  1AWD A;  2MP2 B;  4KSL C;  1UZX B;  1J7C A;  2BB6 A;  2DAJ A;  5FKA C;  2HJ8 A; 
#chains in the Genus database with same CATH homology
 1C78 A;  4WQM A;  2K0P A;  4ZHP A;  2BYT A;  2QEJ C;  1TKE A;  5JXV A;  3P4S B;  1SJE D;  3ZJT A;  1OQR A;  1UNS A;  2KN4 A;  1HQR D;  1JRP A;  1FM0 D;  1KTK A;  1N60 A;  3L4P A;  5D7G A;  4L2Y A;  3NUH B;  3Q8E A;  1XXG A;  1QKZ A;  1VJK A;  4J3O D;  3NVZ A;  1L0V B;  3ZQ4 A;  1KLG D;  4A9A A;  2SEB D;  4LK0 M;  1FCL A;  4NAM A;  1GB4 A;  3AE1 B;  1T6B X;  2N9L A;  1M4V A;  1I4R A;  4XWT A;  1YN4 A;  1FIQ A;  4HRO A;  1XLN A;  1QT9 A;  1XCT L;  3AE2 B;  3EA6 A;  4FXC A;  5HI1 A;  2N7J A;  2DYO A;  5HFY A;  1C4P A;  3E56 A;  3KWV A;  5BMG A;  3T3O A;  1QOG A;  2MJE A;  1D4B A;  1EWC A;  1L0X B;  4AS1 A;  1FNV A;  3BVM A;  1VLB A;  3MP9 A;  5BMH A;  5FK9 C;  2W3R A;  1FNW A;  1MHX A;  4R3D A;  3W5V B;  1I4X A;  1XLQ A;  2L83 A;  1DYQ A;  2LHD A;  1VDV A;  2N9K A;  2NTT A;  2IGH A;  1C4A A;  3AE5 B;  2ZW1 A;  4RFB A;  3VRA B;  1OFF A;  3KWL A;  1GPX A;  5MPO A;  1XLP A;  3Q8B A;  1F2R C;  2AQ1 B;  3ETR A;  3NRZ A;  2Y3A A;  5G5G A;  2OHF A;  2W54 A;  1SE3 A;  1K51 A;  2WXH A;  1EWY C;  1XCQ L;  1AN8 A;  1J7A A;  1SXT A;  3ZJV A;  1Q10 A;  5EE0 A;  2WDQ B;  2G9H D;  3BZD B;  1K52 A;  2X38 A;  2DYM A;  2V3N A;  1SF0 A;  2PLP A;  1YN5 A;  5EE1 A;  1E6E B;  2VZK B;  5D3D A;  5H92 C;  3Q8C A;  1E10 A;  3FIL A;  3SFD B;  4KX6 B;  3AN1 A;  1WXQ A;  1V8C A;  1IGD A;  1TS2 A;  4RCO A;  2K5P A;  1I4Q A;  1UUP A;  3HRD D;  3AV8 A;  5AUI A;  1V1P B;  2J42 A;  3GB1 A;  2JSV X;  3TEZ A;  2WXQ A;  4XE0 A;  1F77 A;  3GP7 A;  3IXS A;  4KKI A;  1MPE A;  1AYF A;  2RDH A;  1TKG A;  4B0E A;  4HKQ A;  2JX5 A;  2W3S A;  2V4I B;  4OZC A;  4RF1 A;  5HHD G;  3LYY A;  1HZ6 A;  5LNK 1;  3AE7 B;  3Q69 A;  3NVV A;  5HG2 A;  3ZJU A;  2WXJ A;  3DWM A;  1JRO A;  1QIL A;  1YQ3 B;  2XNA C;  3SFE B;  1C76 A;  2I38 A;  1SB3 C;  2PVO D;  1RFK A;  3BYT B;  4C80 A;  3AEF B;  3FC4 A;  3FAH A;  3HVD A;  3VRB B;  1VR9 A;  1IBX A;  1ROE A;  2YEP B;  2WXK A;  1EM7 A;  2WXM A;  3I9V 1;  3U7Z A;  3AE3 B;  3AE8 B;  2QSD A;  1RYJ A;  2GB1 A;  1DGJ A;  4HKZ E;  3VR8 B;  3EGR A;  4ZHO A;  1JAL A;  1FO4 A;  1F2R I;  4A6Q A;  1YMH E;  1QQR A;  3B2G A;  4OW0 A;  3AM9 A;  1BUI C;  1JWS D;  2NTS A;  2WS3 B;  4YSY B;  2INP E;  1Y56 A;  4HEA 1;  1ZUD 2;  2V0G A;  4KKJ A;  4US9 A;  2ONQ A;  2BS3 B;  2FBW B;  3AEG B;  4P16 A;  4L1B A;  1DOX A;  1ACC A;  1PYW D;  1DOI A;  1I7H A;  1TS3 A;  2WP9 B;  2DWQ A;  4MAC A;  3TSS A;  1A70 A;  4REZ A;  3R8B A;  2XN9 C;  1NEN B;  1N62 A;  3PZ7 A;  2IGD A;  3RPF C;  3PZ8 A;  1ZPS A;  4RH6 A;  5BYR A;  2Y5P A;  4JWS C;  4ARC A;  3T3N A;  4TMA B;  1L4Z B;  1YJJ A;  2WDR B;  1KRH A;  4MM3 B;  3KLS X;  1QF6 A;  5D3I B;  2BS2 B;  3H8H A;  1PGX A;  1VRA B;  1YJI A;  4ZOH C;  1JQ4 A;  4YTP B;  1SE2 A;  2GI9 A;  1HZ5 A;  4RGM A;  4WIP A;  4DXG A;  5BYQ A;  3SR6 A;  1SSN A;  3TEX A;  2B76 B;  3IAS 1;  4OZB A;  3Q8A A;  1T3Q A;  1E0Z A;  4M0W A;  2NMQ A;  4C7Z A;  2LUM A;  4WWM A;  2JYT A;  3P63 A;  2IJ0 A;  2PMV A;  3CIR B;  4YSZ B;  3RFZ B;  2LMC A;  2W55 A;  1R7S A;  2RMM A;  4TQ1 A;  2WLB A;  1SBB B;  3TEW A;  1TY2 A;  3WCQ A;  1ZE3 D;  2QIE B;  4N58 A;  1OQQ A;  4YSX B;  3ZYY X;  2BB5 A;  2ON8 A;  2JXT A;  4KGT A;  3EUB 2;  3IT4 B;  2CJO A;  2JZP A;  5TSS A;  4AQ7 A;  3B2F A;  3J9C A;  2LEK A;  2KQ4 X;  2LGI A;  4DQO C;  2Y5C A;  2Z8L A;  4RGN A;  3P4P B;  1RWS A;  2CJN A;  4GLS C;  1QOF A;  2R61 A;  3NVW A;  1GAQ B;  1K53 A;  1PDX A;  1XLO A;  1CZP A;  1HXY D;  2J53 A;  1FRD A;  3BVG A;  4CQN A;  2JYE A;  1I4H A;  2IDY A;  1P7F A;  2V3P A;  2WXO A;  4DXF A;  2E3T A;  3U2S C;  2MJ3 A;  2IPK D;  2KMM A;  4JE3 B;  4A55 A;  3BK2 A;  1L5P A;  1SIJ A;  2VZK D;  1FXI A;  1JWA D;  4WH4 A;  1KF6 B;  4PT5 A;  1I4G A;  4JPS A;  4TQ0 A;  4ZYS A;  1NVI D;  2INN E;  3P4R B;  1CJE A;  2GRI A;  1PGA A;  1STE A;  1XF5 L;  2WDV B;  1K50 A;  4LLG M;  5BMI A;  1TS5 A;  2MEK A;  3V05 A;  4OZA A;  3AEA B;  2LHE A;  1FFV A;  1MVK A;  1N5W A;  4MH8 A;  1BXT A;  1PUT A;  2BTE A;  1PGB A;  2W82 A;  4H2A A;  3W1S A;  4OHJ A;  4YXD B;  1C9F A;  1TKY A;  1RM6 C;  1YNT E;  3AMZ A;  3PO0 A;  4US8 A;  3N9Y C;  1FD6 A;  3P4Q B;  1ZOY B;  1XEE A;  1L0Y B;  4ITK A;  3FIL B;  4P6V F;  5EE3 A;  4RNA A;  1VZ6 A;  1D5X C;  2RDG A;  1N63 A;  2JWU A;  1V97 A;  4IDI A;  1TZO A;  1CK1 A;  4D2K A;  3R2T A;  2MJD A;  5G5H A;  2HDE A;  4C7Y A;  1FNU A;  2WXL A;  5GXG B;  1UWM A;  1HA5 A;  3IAM 1;  3VR9 B;  1N5X A;  1FRR A;  2WXI A;  1CQV A;  1L4D B;  3R2I A;  1EU4 A;  1ENF A;  2EEL A;  3I57 A;  1FEH A;  3C8Y A;  4KGS A;  2KDM A;  4B0M A;  4RGT A;  3BWU D;  2LJI A;  2LFI A;  1HEZ E;  2WQY B;  2K9X A;  4XWW A;  1QOB A;  5E6J A;  3AEE B;  3MHZ A;  1AW7 A;  1NI3 A;  4TSS A;  1WGK A;  2WXR A;  4Q2J A;  2L1A A;  1FFU A;  3AE4 B;  1ET6 A;  3Q8F A;  1D6E C;  2BW2 A;  2OED A;  3O13 A;  1IBX B;  1TYG B;  1JWM D;  2PVG C;  3W2D A;  4JWU C;  1ZDX A;  4WUR A;  4WAF A;  3ABV B;  1C79 A;  4NZL B;  3MFG A;  1B1Z A;  1JCK B;  3P42 A;  5H8Y E;  3AE6 B;  1XO3 A;  1EU3 A;  1MHH E;  3AEC B;  3V3X A;  2WXP A;  1FXA A;  1P7E A;  3AEB B;  1D5Z C;  1ET9 A;  2J52 A;  1ZXH A;  1NYQ A;  1D5M C;  2YEP F;  4N6E B;  2DBY A;  2WXN A;  5I4D A;  1F0Z A;  1UWX A;  2CU3 A;  2DLB A;  2QIL A;  3URY A;  4XDC A;  2Q5W D;  5FR3 A;  3TUO A;  2D5G A;  1BML C;  1N61 A;  1B9R A;  1PFD A;  4C56 C;  1DOY A;  1V1P A;  1TY0 A;  2FUG 1;  2M56 B;  2I2Y A;  5T8I A;  2SAK A;  5BYS A;  3GS2 A;  1C4C A;  3W9C B;  1NYR A;  4GDL B;  1SJH D;  1E7P B;  2QJL A;  1SE4 A;  1NEK B;  5EE9 A;  1IUE A;  5C3J B;  2MH7 A;  3AE9 B;  1QOA A;  3HVZ A;  1FMA D;  3E9S A;  1GOZ A;  1C77 A;  1L6U A;  1TS4 A;  4NJC A;  1SEB D;  1VZ7 A;  2PIA A;  4HJG E;  4EE2 A;  3NS1 A;  2KAC A;  2RPV A;  3CWI A;  3HUI A;  3AB5 A;  1WYG A;  2ICI A;  2WXF A;  2JQR B;  4YTN B;  5C2T B;  1TJE A;  3BII D;  2QMT A;  1KH0 A;  1KFY B;  1L6V A;  2AX5 A;  2L52 A;  4NAW B;  4IKG A;  4RGO S;  4YWG G;  3AED B;  2J4X A;  1KLU D;  3BK1 A;  4GDK B;  4MT5 A;  4OVZ A;  1GB1 A;  1JWU D;  1T5X D;  3U52 E;  4YTM B;  3NZ3 A;  1FCC C;  2WNM A;  3SEB A;  4UDU C;  2AQ2 B;  4ZRQ A;  1YQ4 B;  4XDD A;  2N0S B;  4USA A;  1WRI A;  4YT0 B;  3LXF A;  4LTU A;  2K22 A;  2BBC A;  2HTM E;  2E6X A;  3MJ5 A;  1ZXI A;  2M19 A;  3UI3 A;  1JW9 D;  1V1O A;  2H88 B;  2FE8 A;  2AQ3 B;  4O1N A;  1WWT A;  3B9J A;  1UGJ A;  3IT6 B;  1J7B A;  3VQI A;  2ACZ B;  4KGR A;  1JML A;  4A90 A;  2WXG A;  2L32 A;  3OWE B;  2KAJ A;  1ESF A;  1I4P A;  2IGG A;  3U4E G;  4HRS A;  2BT6 A;  2G1E A;  1QLB B;  2TSS A;  4JX1 C;  1YN3 A;  1WSP A;  2WU2 B;  2EKI A;  1JWB D;  2JU6 X;  2PKO A;  2PW9 A;  3BVZ A;  3LB8 C;  4ZRP A;  5AUK A;  2KWD A;  1IGC A;  4N59 A;  2ZW0 A;  1ZP0 B;  2M0A A;  2H89 B;  2K3U A;  1ZDV A;  3KQ4 A;  3NVY A;  3W5U B;  1LO5 D;  3AH7 A;  3ZGZ A;  1MI0 A;  1AWD A;  4ARI A;  4IOI E;  4RF0 A;  4L23 A;  1J7C A;  2BB6 A;  2PTL A;  3DWG C;  3BYY B;  5FKA C;  1E9M A;  3P1M A;  4A8X C;  3MC0 B;  3TEY A;  2BS4 B;  1VZ8 A;  2WU5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...