2MJ3A

Backbone 1h, 13c, and 15n chemical shift assignments and structure of iron-sulfur cluster binding protein from ehrlichia chaffeensis
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
116
structure length
116
Chain Sequence
b'MPLITFISPDGSRKTYEAYDGETLLSLAHRNNVDLEGACEGSLACSTCHVIIDPSWYDIVEQHNEISDEENDMLDLAFGLTDTSRLGCQIILTKELDGLCVILPTETRNISFVKNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron-sulfur cluster binding protein
publication title Backbone 1H, 13C, and 15N Chemical Shift Assignments and structure of Iron-sulfur cluster binding protein from Ehrlichia chaffeensis
rcsb
source organism Ehrlichia chaffeensis
molecule tags Metal binding protein
total genus 13
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2013-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2mj3A00
1NI3A 1JALA 3AE4B 4HROA 4USAA 3NVYA 1FFVA 1JRPA 1PFDA 2W55A 3DWGC 1KFYB 2BS3B 2HTME 4C7ZA 3AEAB 1RYJA 2AX5A 1XO3A 5C2TB 4YXDB 1TKEA 2G1EA 2W3RA 4YSXB 3CWIA 3VR8B 2BT6A 2PKOA 4C7YA 1CZPA 4WQMA 1NEKB 3BIID 1V8CA 3LB8C 3P4SB 3W9CB 1L5PA 3P63A 1L6VA 3HVZA 2PVGC 1TJEA 3B9JA 3NS1A 4N58A 1PUTA 2H89B 4LTUA 3NVZA 1TYGB 3KWLA 3P4QB 5H92C 1V97A 2LEKA 3AE8B 3HRDD 1TKGA 1DOYA 2BS2B 2WDQB 2W54A 2BS4B 1N5XA 2FBWB 3AM9A 1PDXA 2CJNA 1SF0A 2W3SA 2WDVB 2MJDA 1OQQA 3FC4A 5C3JB 1RM6C 5MPOA 1N62A 1FXIA 2OHFA 4HRSA 1GPXA 2WS3B 1FFUA 3AE6B 4ITKA 3VRAB 1ZXIA 3NVVA 4ZOHC 2MH7A 2WU2B 1XLOA 3SFDB 2K9XA 1ROEA 4WWMA 1TKYA 2JQRB 1GAQB 1RFKA 4US9A 3AV8A 3P1MA 1I7HA 3NVWA 2E3TA 1OFFA 4N59A 2WDRB 1JWAD 3AB5A 1UWMA 3DWMA 5EE3A 1J7AA 1FM0D 1E9MA 1JROA 1YJJA 3LXFA 3P4RB 2ACZB 1NENB 1NYRA 3B2GA 1DOXA 1SB3C 1FRDA 1QOAA 1KF6B 1RWSA 2JX5A 1NVID 3PO0A 4YT0B 2Y5CA 1OQRA 3EUB2 4C80A 1N60A 4YSYB 1VLBA 1L0VB 1WGKA 2PIAA 1WRIA 3B2FA 4YSZB 1T3QA 5AUKA 3AEEB 2WQYB 2CJOA 3AE1B 5AUIA 4US8A 1WYGA 5G5GA 4JX1C 2DWQA 2WU5B 4JWUC 1YQ3B 2QJLA 4KX6B 1FO4A 2Q5WD 1R7SA 1FRRA 1FXAA 2K5PA 1JWBD 2MJEA 3AH7A 4P6VF 3VR9B 3W5UB 1N5WA 5GXGB 4ZHPA 3CIRB 2L52A 1J7BA 1JW9D 3VRBB 3AN1A 3AMZA 2N0SB 1KRHA 1ZUD2 1QOFA 3AEDB 1E6EB 1E0ZA 4YTPB 5EE1A 2WP9B 3AEFB 1A70A 1WWTA 3AE7B 1JQ4A 1CJEA 4YTMB 1QF6A 3ABVB 1AYFA 1N63A 1QOGA 2QIEB 4N6EB 3RPFC 2DBYA 3AE9B 1B9RA 1ZP0B 4YTNB 5H8YE 1QOBA 1VDVA 3HUIA 3AE2B 2M56B 3AE5B 5EE0A 3NRZA 5G5HA 2L83A 1XLQA 3AEGB 3SFEB 3W5VB 1J7CA 2KMMA 1IUEA 1YQ4B 1ZOYB 2B76B 1FMAD 1FIQA 1E7PB 3WCQA 2CU3A 3AECB 2M19A 3FAHA 5EE9A 4FXCA 3AEBB 2WLBA 3AE3B 2K22A 3L4PA 1WXQA 4A9AA 2EKIA 2H88B 1NYQA 4IDIA 2KAJA 1AWDA 2PVOD 3SR6A 3ZYYX 1XLPA 4ZHOA 1E10A 1SIJA 3P4PB 1F0ZA 1EWYC 1QT9A 3ETRA 1YJIA 4JWSC 1N61A 1L6UA 1DOIA 1QLBB 1DGJA 2MJ3A 1XLNA 1VJKA
chains in the Genus database with same CATH superfamily
2KK8A 3OAWA 3AE4B 2W55A 2HTME 2L0TA 5D3IB 1N6ZA 3P4SB 1L5PA 1P1AA 3O13A 1C9FA 2H89B 4IM2A 5DCNA 1TYGB 3P4QB 2HDEA 1Z2MA 1GNUA 1MJDA 2KDBA 4KIKA 4ANVA 1SE2A 2W54A 1C3TA 3AM9A 2KLCA 2R2QA 4F1SA 3B1LX 4EZJA 4HKQA 1MG4A 3KW5B 3ZKJC 1FXIA 2FNJB 4A8XC 3NVVA 1XLOA 1WJUA 3GB1A 1ROEA 2M4NA 1TKYA 1GAQB 3AV8A 3GS2A 3B08A 1KLUD 1K50A 1A5RA 1M94A 4NJ7A 2MBOA 2JX5A 4OZBA 4WIPA 1RFAA 1WJ4A 1J8CA 4OZCA 4P1CC 2LRWA 1R4MB 1IGCA 1HE8A 4YSZB 1T3QA 2AL3A 4WURA 2D07B 4JX1C 1YQ3B 2KXJA 3VH4B 4GOCA 1UD7A 2MJEA 2XK5B 3IVFA 2KKCA 4N9F4 2WDTB 4B9KA 2J42A 2KZRA 1ISNA 1E8WA 2KX3A 2GBJA 4M0WA 5EE1A 2FUHB 3IHPC 1WWTA 2LVOA 1WI0A 2KWCA 2FCMA 4BKGA 2RSUA 4WJPA 1PGAA 3NRZA 3CMMB 1R4MI 2ZNVC 2KMMA 4K7UA 2CU3A 3AECB 3FAHA 1WXQA 2H88B 1BT0A 4L23A 2JWUA 3SR6A 2BF8B 3Q8FA 2KX0A 2FCNA 3ZRCA 2LD9A 4RGMA 3ETRA 2EELA 4DDGD 1ET6A 3T9LA 3Q3MC 2HTHA 1R4NB 3NVYA 4B0MA 1C79A 2WGSA 4C56C 2K6DB 2NVUI 4IW0A 4I6LB 1V5TA 2O6VD 4HPLB 4R3DA 5D94A 3HVZA 4IKGA 4HDOA 1LO5D 3NOBA 2GOWA 2BYTA 2C7HA 2XEWA 3HRDD 3K9PB 2YVCA 1WY8A 3A4SC 2IO2B 1GPXA 3QARA 3QQ8B 4ITKA 4ZOHC 1R4NI 4C4VB 4NNJB 3RNEC 2E3TA 3W1SA 1SE3A 4WWOA 4YXDB 4IUMB 4RNAA 1D3ZA 2KTRB 3WAOA 1MHXA 2WX1A 1SBBB 3QAQA 2LJIA 2PIAA 3OJ3A 2GB1A 2RDGA 2TSSA 4AOFA 1RAXA 2LWPA 4J3OD 1F9JA 1FXAA 4NQLB 3WA0A 1KOTA 3L16A 2KTFA 1I4PA 1F77A 3TUOA 2ZPYA 2K8BA 2KVZA 1V5OA 2RPQA 4DDID 4N6EB 3RPFC 2INDC 4ICVA 4HPPA 2WXRA 4MEMA 1QOBA 3QCAA 4E71A 3UIOB 2KJRA 1P0RA 3SDLC 2WYQA 2WXIA 3ZNZB 3PRZA 4CQNA 4GDKA 3A33B 3R66C 3ZYYX 3S2AA 1L4DB 3V6EB 4DHJD 3R3MA 2FIDA 2BB6A 4GB9A 1JALA 2ZZPB 1JRPA 1KFYB 3ZTCA 4YSXB 1XF5L 2PKOA 3KQ4A 3RN9C 2IO0B 2ZPNA 1FNWA 3ONSA 1WR6E 3MJ5A 1SGHA 3MP9A 3R2IA 1J19A 4KZ0A 3R7QA 4BOSC 2IPKD 2Z8LA 1NI2A 2M1MA 2MJDA 1P7EA 3AE6B 4LNIA 1S1QB 3N32A 4M01A 2WXOA 3KYCD 1Z5SB 3ZJVA 1FNVA 3ZJTA 2Z0EB 2ACZB 1NENB 1Y8RC 1GJZA 1V81A 1FRDA 5TR5A 3RCZA 1N60A 3ENEA 3V05A 3RNFC 2XK5A 1MPEA 2UWQA 1YX6B 2GI9A 4JWUC 1FRRA 4GN1A 4P6VF 4NPNA 3CIRB 4MGYE 1JW9D 3IG3A 2MWSB 3AMZA 2D10A 1OGWA 4WWNA 1UGJA 2WXJA 3AEDB 1E6EB 1A70A 2MHJA 4GGQA 1CK1A 5H8YE 3AU4A 4KDLB 2CHZA 4DXAB 4XDDA 2BVCA 2X8XX 2CU1A 2WLBA 4PS7A 5E6JA 2KAJA 2KJHB 3P4PB 3R2TA 5JXVA 2FAZA 1N61A 3U7DA 3UGBB 3EFCA 1VJKA 4FULA 1E8YA 4JE3B 4W9CA 4OZAA 2K8CA 3NY5A 2V3PA 2KMAA 2JXTA 2BW2A 1ZPSA 2ZVNA 2PVGC 1YNTE 5FR6A 3NVZA 2M0AA 2NCNA 4ANXA 2KN5A 2C7MB 3L13A 2Y5BB 3Q2AC 2KMCA 2YLMA 4DK5A 5D6JB 4C4VA 1OQQA 1IYFA 2YEPB 5D7GA 2DAJA 1FCLA 4G0NB 3HK0A 1YQBA 5FK9C 2KTRA 1EUVB 4KKJA 5TSSA 4MGZE 2LGDA 5AZGA 2GRIA 1SB3C 4YT0B 4Q2JA 4HXDA 1GG3A 2SAKA 1I4GA 3RT3B 1ZXHA 3I3TB 2L05A 2Q5WD 4XDCA 4A90A 5LLIA 2I1JA 1MI0A 4DHZE 3WANA 2JSVX 2KQ4X 4WJNA 4XWWA 3ZTDA 4XC2A 1VZ8A 1JQ4A 1CJEA 1TY0A 3ZGZA 4AS1A 4HJGE 1IGDA 3PV1A 2MEKA 1VRAB 3AE5B 5EE0A 4ZYNA 3K9OB 3W5VB 4MJSB 1FMAD 2NTTA 5E6NA 2N4FA 2X38A 1PGBA 1F1HA 3PHXB 2KVRA 5GMVA 1WMHB 3APFA 4TMAB 1YN3A 2BS3B 4L2YA 4TQ1A 3TMPB 2JZPA 3BYYB 3BIID 4M8NA 4OVVA 2RMMA 1QQRA 2J53A 1EO6A 3QHTA 3AE8B 3R7RA 3E56A 2FBWB 2MA9B 1C76A 5C3JB 1V80A 1K53A 1WX8A 3DVNU 4IC7B 1V1PA 4LJOB 1WGHA 1WGDA 2AWTA 1IP9A 3BVGA 3W1YA 4WJOA 3P1MA 1I7HA 3I57A 3NVWA 1F2RI 1K51A 4L1BA 4PT5A 5DPTA 4WAFA 3VTWA 1UNSA 3WALA 4N59A 5E6OA 4A3OA 1ZDXA 1Q10A 2Y3AA 3PRPB 2JT4B 4D2KA 2JXXA 1L0VB 1IPGA 3DVGY 5CHFA 3BK1A 4FA6A 2DWQA 3NHEB 2AQ2B 1FXTB 4W9FA 4DBGA 2QMTA 5IAAC 4IOIE 2GLSA 1Q5WB 3C8YA 4ZRJA 1WXAA 2K8HA 2RPVA 5GXGB 4BBNC 1WR1A 3VRBB 3L54A 1VZ7A 1QOFA 3M95A 1KH0A 1SIFA 4GSWA 3A4RA 3PT2B 2QIEB 2YEPF 4ARCA 2QSDA 5KHOA 1BUIC 2QDFA 4M8MA 1E7PB 3LDZE 3WCQA 3BVZA 1YD8U 2EKIA 4OW0A 4XX5A 4MM3A 3TIXA 2W9NA 4A3PA 4EUTA 2MBEA 4FJYA 1HZ5A 1OEYJ 3DOWA 3DWGC 1BXTA 3M3JA 3PZ8A 1CZPA 4WQMA 1F2RC 4TV3A 2C5LC 4NJCA 2BBCA 1CQVA 3WAPA 1JCKB 1V97A 4P7IA 4E3CA 3I9V1 4TUUA 1N5XA 2IJ0A 3FILB 3RNGC 3APCA 3RZWC 4LLGM 1SEBD 4OVZA 2MBQA 3ZLZA 3DVGX 4WWMA 4M00A 2BQQA 1WGGA 3RI7C 3BK2A 3MJWA 1MFWA 5EE3A 2CKHB 4URKA 1E9MA 3LXFA 1DOXA 2JY6A 2WXLA 3ZO5B 3Q3NC 2LUEA 1I4RA 2WU5B 1MVKA 3DHGC 3VR9B 1V2YA 1J0GA 2INCC 3AN1A 3DHIC 1V49A 3OJ4B 2V4LA 3UI3A 1E0ZA 3SEBA 3AU5A 2MW5A 3KUDB 1KJTA 3VUXA 3PHWB 4G3XB 4MJSA 4MSMB 1I4QA 3U2SC 3PLVA 4NZLB 3WAMA 3V6CB 1AN8A 2VZKB 3H9DA 3ZW3A 1H8CA 2I38A 4KZCA 3DQVA 2IBIB 1WMHA 4JIOU 3SU8X 2UU7A 4ZHOA 2C9WB 1DOIA 1E7VA 1DGJA 1SE9A 1WM2A 2CHXA 1WSPA 3VUYA 2KFJA 1RLFA 1DYQA 2IZVB 3VUWA 1TS2A 3NJTA 2L32A 1NDDA 2OOBB 3B9JA 3NS1A 3VVWB 1G6JA 2DYOA 4LDTD 1VD2A 1WRDB 3ALBA 3T3NA 1TKGA 5HI1A 4A20A 4S17A 1GC6A 3TCAA 3FC4A 1L2NA 4RM8A 3JSVB 4BKTA 1SSNA 2WU2B 2M0XA 4RGTA 4W9IA 2ZW0A 2KLGA 2KC1A 3ZDTA 4K7WA 2XBBC 4RF0A 2WX0A 3JW0X 1TT5B 3CSTA 1B1ZA 1PYWD 4ZRQA 1YX5B 3RNAC 3PZDA 2AEHA 1GUAB 2LHDA 1Q1OA 3Q8AA 3Q69A 4RFBA 2K1FA 2KN4A 5CTRC 1GOZA 1UUPA 2LFIA 1AYFA 1N63A 1QOGA 1ZP0B 4XWTA 1VDVA 1MHHE 3MC8A 4FHKA 3AXCA 3AEGB 2WXGA 5JH5C 4PYZA 2J0MA 4KKIA 1UZXB 2K22A 2G4SA 5KHQA 1XD3B 4KGTA 5DPSA 2D3BA 2A5UA 3H7PB 4GXBA 4IWPA 2MJ3A 2J0JA 3PTFC 1GB4A 1NI3A 3QIJA 4GMVA 2BYVE 4C7ZA 4RF1A 3APDA 2K25A 2G1EA 4MGKE 4C7YA 1AARA 5CX3A 4H2AA 1YMHE 5EDSA 1YOVB 4LTUA 4YWGG 2PEAA 3FILA 3MC0B 2DZJA 3L08A 1PDXA 2KHWB 1LFDA 1N62A 2M17A 3H6NA 4ZRPA 2IGGA 3U30A 2REXA 3BWUD 2MSED 2IYDB 2J7QB 3UQAA 2J4XA 3KUZA 2KDMA 1UWMA 1DOYA 1J7AA 4JGHB 1OEYA 3TSSA 4MGIE 1RWSA 2Y5CA 3RMKC 2HE7A 1SJHD 3N1ZC 2KO3A 3T8MA 2O6VB 2CJOA 2WQYB 2QC8A 2KWUB 3IXSA 3SD5A 2CS4A 2MX2A 2GBKA 2RD0A 2JU6X 3UF8A 1EM7A 1EU3A 1V1PB 1J7BA 1V6EA 4GU2A 4BZAA 2OJRA 4FN2A 5LNK1 2MCNB 2PMVA 1M4VA 1B9RA 2DNFA 2BB5A 1WGRA 1KLGD 2M56B 5AZHA 1TY2A 4DQOC 2LJ5A 3SFEB 5BMIA 3EECA 3HVDA 3MHSD 1JMLA 2QILA 2KDEB 4NAMA 2LRUA 2INPE 1FD6A 3N9YC 4B0EA 3IT6B 3EGRA 1L7YA 4NQKE 4HROA 4O1NA 4QAYA 2M8SA 2R2OA 3B0AA 3O65B 3LB8C 4CYEA 2KD0A 2GBMA 1TJEA 3VHTC 1QZEA 4OHJA 3KWLA 4MSQB 3JSVA 2FIFA 4ZYSA 4K81A 2BS2B 1YIWA 2WXHA 4DXFA 1SF0A 4MM3B 1TS4A 4BKSA 3R8BA 1PGXA 2L7RA 5AZFA 1QILA 4AP4C 2IO3B 2E6XA 4US9A 2GBNA 2LGSA 4DHJB 2FE8A 3DDCB 2G9HD 1XXGA 3C0RB 1YJJA 5FR3A 4XYCA 3U7ZA 2KWDA 4KVGB 2ZJDA 3AEEB 5AUKA 3GOEA 2N1VA 3NZSA 2MRPA 1E7UA 3IT4B 5C1ZA 1I4HA 4NY0A 4WQOB 1UH6A 5JZEB 3WIMA 4KGRA 1WX7A 2JRIB 3ML9A 1EF5A 4RMAA 2KDFB 3ZIMA 1IBXB 1WZ0A 2CR5A 3VTUA 3AE9B 3DBRB 3QC8B 4HPMB 3TEYA 2J52A 3Q8CA 3V61A 3DBHB 1J7CA 4LNKA 4B95A 5BYSA 2B76B 2KQ7A 3EFUA 3ZVVA 3AI5A 3H8HA 1ZGUB 2DZMA 3AEBB 2WXQA 3H7PA 1ACCA 4IDIA 1TZOA 1E10A 2EMTA 4HJKA 3VDZA 3OLMD 3X0WA 1L6UA 3PREA 4LNFA 4MACA 2MBHA 3Q8EA 2J0KA 2FCQA 1AW7A 3W2DA 4GIVA 1E8ZA 3GP7A 2L3ZA 3RNBC 2SEBD 1XEEA 3VTVA 3DBRI 2WXMA 1TKEA 4FJZA 1TGZB 2WNMA 3ZNID 2BWES 2BKFA 3P63A 2MQJA 4PYUA 5H92C 3DHHC 2LEKA 1XT9B 4EE2A 1P7FA 2WDQB 4WWPA 5HFYA 4OVUA 3IAM1 2OHFA 2PLPA 4TKNA 2LGXA 4W9LA 1I4XA 4II2B 2K9XA 1JWAD 3RULA 1FM0D 3BYTB 2NBVB 2O6VA 2L8JA 1KF6B 1WJ6A 1HTQA 2BYFA 1WRIA 3H7SA 3AE1B 3NZUA 1JWUD 2INNE 3KH0A 1WH3A 4LNNA 2K5PA 3C19A 1E90A 2A4ZA 2VRRB 2ZEQA 1C78A 4BOZB 2NMQA 4FBJB 5T8IA 1C4CA 2WP9B 3AEFB 3MC9A 4YTNB 2RDHA 2HJ8A 2ASQA 4HLEA 2LVPA 3VXWA 5LXIB 2BPSA 4AWJA 2JUOA 2M19A 2KFKB 3BVMA 1I35A 2PVOD 5HKHA 1QT9A 1L0YB 2MP2B 2N9XA 1UF0A 3TEZA 1FFVA 4X57B 2WXFA 1E5WA 4W9JA 4KGSA 2VH2A 2W3RA 3DCGA 4ARIA 2ZVOA 1XQQA 2IY1B 3VH3B 1ZE3D 3HM3A 5E6PA 4W9GA 5IN7A 3RZFA 2MLBA 3V3XA 1C4PA 4BBNF 2WS3B 4GDLB 1YJ1A 3L10B 4G11A 1VCBA 2CHWA 2V9HA 2AQ1B 3ZJUA 2PTLA 1EU4A 3B2GA 5IP4D 3PO0A 2G45B 3QWZB 1OQRA 1VLBA 2GMIC 5AUIA 4YL8A 4US8A 1NBFC 4EEWA 1H4RA 1F52A 1TBEA 2QJLA 1EF1A 4C00A 1R7SA 5J17A 2PPHA 2ZCBA 2JPHA 4FLHA 1IBXA 2IO1B 2K0PA 5LXHA 3A1QB 1C1YB 1VR9A 4HKZE 3NS8A 2KQSA 1WGYA 2ON8A 4YTMB 3Q3OC 1QF6A 2RR9A 1RRBA 2DYBA 5L95C 5G5HA 4W9EA 4CHKA 3BY4B 3VQIA 2ZW1A 5AEKB 3EA6A 3QA8A 1Y56A 3AE3B 3L4PA 4A9AA 5I4DA 1C4AA 3L17A 2KC2A 3V62A 3MTNB 2BTEA 4XGAB 3NZ3A 1ZKHA 5G2NA 4J6IA 2W82A 2NTSA 3PVLA 1XLNA 3DVNV 2V4IB 2XNAC 4WJQA 1RYJA 2AX5A 4A55A 2QEJC 4JQWC 4JL9A 3PGEA 1P9DU 2IGHA 1NEKB 3W9CB 2DAFA 2LUMA 3MHZA 2KNBA 2LI5A 3N30A 2D2QA 2BS4B 3Q3JA 3W1SC 2CJNA 5MPOA 2LZ6A 1OTRB 2NBUA 1WJNA 3VRAB 1FFUA 2RGFA 3SFDB 4ZDVA 4DXGA 2AL6A 1OFFA 2WDRB 4EKUA 3DWMA 2LGYA 3P4RB 1WM3A 2JYEA 5DPRA 1K8RB 4FADA 1VZ6A 3UQBA 2ONQA 4NAWB 2EMSA 3Q14C 3B2FA 4HCNB 3D32A 2N9EB 1WYGA 3LYYA 2R61A 2Z0DB 5HHDG 3OWEB 1TS5A 1D5XC 2KJ6A 2L52A 1PQSA 2ZCCA 4AQ7A 2LMCA 4S0RA 4YTPB 3AE7B 4EOYA 2JVCA 3L0WB 3Q6BA 2DBYA 5DPWA 1ET9A 2D11A 3QK0A 1T0RC 2KFKA 1ZOYB 3SHQA 3KUCB 4NJ6A 3TEWA 1TZ1A 1UBQA 2L0FA 2NPTA 2O2VB 2MP2A 3DPDA 1NYQA 4BVUC 1AWDA 2WXPA 4K3BA 1F0ZA 2FUG1 4BAXA 4HVBA 1XCTL 1YJIA 5D3DA 4TQ0A 1QLBB 2N9KA 3A9KA 4MH8A 2JWZA 2IGDA 1UBIA 1XO3A 3EHVA 4TSSA 3EC8A 3CWIA 5BMHA 1LQBA 3DBSA 1L6VA 2FCSA 3HM6X 3RFZB 1WF9A 4KV2A 1TS3A 4KDIC 2WWZA 2IY0B 4I6PA 4GDLA 1RM6C 2N1WA 2HJ1A 4HWIB 1JWMD 3N1YC 4EZLA 4KSLC 4MDKE 2PE9A 2MH7A 4IG7B 1HA5A 3ZDMC 5D2MB 1LXDA 3TEXA 1V1OA 4EZKA 2K6QA 3ZXVA 1QOAA 1LM8B 3EUB2 4C80A 2KANA 1X1MA 2KYWA 3X23A 5G5GA 4P1BC 3A1QA 4P16A 1P98A 5J18A 4LDTB 3W5UB 1FCCC 4ZHPA 1D5MC 1QKZA 2V3SA 1ZUD2 1WXSA 2D3CA 1GC7A 3A9JB 4DWFA 4FJVB 4PK1A 4RGOS 5J2RA 1XLQA 2QHOA 5CHWA 3U4EG 4HEA1 1IUEA 2I1KA 3ZQ4A 5BMGA 2WXKA 1YN5A 1STEA 3CF6E 3GE3C 4ANWA 4E74A 1BMLC 5HG2A 3N3KB 3U8ZA 3HIZA 5C23A 2N7EA 2D3GA 3UINB 3GZNB 3DBLB 3JYUA 1K52A 2KACA 2V3NA 5BYQA 3NUHB 2KOXA 1Q0WB 3RNCC 1V86A 2DYMA 1JRUA 4USAA 3GE8C 2N7DA 2DHZA 3H1UA 3VR8B 2NR2A 3ZXRA 2LXAA 2KT7A 2G4DB 4W9KA 4K1RB 4RH6A 2L1AA 3PRMB 1WXVA 4II3B 1EWCA 2W3SA 2MBBB 2WDVB 3GZNI 3DBLI 2C7NB 1D5ZC 1T0YA 4HRSA 4RCOA 1HXYD 3UIPB 1RFKA 4NAWA 2BKRB 3RD2A 4WH4A 3AB5A 1JROA 1YN4A 2L00B 1UGMA 4LNOA 3QJZA 2PJHA 4BFRA 1HTOA 2C60A 1WGKA 2DLBA 4MT5A 3PLUA 5BO4B 4IM0A 1KM7A 1LGRA 3LJ3A 4G50A 4PS8A 1TIFA 4W9HA 2WXNA 1T0QC 2N0SB 3T3OA 3ML8A 2DZIA 2L76A 1E8XA 5JHAA 2I2YA 4HCPB 1D4BA 3ABVB 1ZDVA 1WFYA 4RM9A 1GB1A 3HUIA 2O2VA 2RDBC 1HQRD 1FIQA 5EE9A 3KLSX 4ZRKA 3PPAA 2LHEA 1XCQL 1WIAA 1D6EC 3I63C 2K39A 2JRHA 3PS6A 1KLVA 3IFWB 3ECIA 3TBLD 1MG8A 1PFDA 2JZZA 1UELA 4W9DA 3BZDB 4A6QA 3JVZX 1V8CA 1TTNA 3KWVA 3N1XC 3TJPA 3Q8BA 1WE6A 3VFKA 4KSKC 1KTKA 2BGFA 4M02A 3Q3FA 1FNUA 3PSEB 1FPYA 2UYZB 2KDIA 1WE7A 4KIKB 5IKCM 1ZXIA 2AYOB 4AUQC 2JQRB 3NG0A 2BWFA 4PS3A 3U52E 3I5JC 3DBHI 3KVFB 4IWOA 1V9JA 4AJYB 4GLSC 3KYDD 1T0SC 2DX5B 1NVID 2D3AA 3AULA 4ICUA 2HD5B 4DHZB 1SJED 2OJWA 1C77A 1FO4A 1ENFA 4ASWC 4MH0E 1N5WA 3J9CA 4REZA 3A9JA 5IO9A 4LK0M 1ESFA 4XZ4A 1WX9A 3BINA 1P3QU 4I6NB 3IAS1 2JZ3B 3M62B 4ANUA 4M0WB 2GBRA 1T6BX 2JF5A 2AQ3B 2IDYA 5CHVC 2LGIA 2BYEA 3V60A 3PZ7A 2Z59B 3IBEA 3FKYA 1SE4A 3QX1A 3N20C 3VAWA 2N7JA 1SIJA 1JWSD 1HZ6A 1EWYC 2D5GA 1L4ZB 3CSFA 4B6WA 1I42A 4JPSA 1L0XB 3ZUNA 3P2BA 3MFGA 2Y5PA 1HEZE 3AEAB 5C2TB 2NBWB 4AJWA 2BT6A 2OEDA 4N58A 1CMXB 1PUTA 1SXTA 2V1YA 2DZKA 2NS5A 4F7ZA 2WHIA 3E9SA 2V0GA 2JYTA 2LVQA 4IM3A 2NPTB 2VH1A 3ZNGC 2LXCA 3ZNHB 5BYRA 3M63B 3HHMA 3URYA 2G3QB 4CO7A 4HK2A 3A9KB 4K3CA 3RUIB 5FKAC 1WZ3A 2VZKD 3P42A 2EKEC 4EFOA 1UWXA 4FHJA 4UDUC 1NYRA 1WXMA 4YSYB 3TL5A 5IOIA 1WYWB 4LCDE 4HDQA 4KX6B 1JWBD 4ACFA 3AH7A 5G55A 4F8CB 4JLCA 3ZRFA 4RGNA 1KRHA 1S3SG 1T5XD 1OQYA 4IWQA 3OG5A 5JHBA 2KWVB 1U4AA 4K7SA 2PW9A 4WAAA 5L83A 2ZNVB 2QCZA 3AE2B 4XE0A 2L83A 1YQ4B 2N9PC 2ICIA 2B3AA 4ZRIA 2K3UA 2LASA 2XN9C 4FXCA 4MELA 2N9LA 5IA7A 1FEHA 1XLPA 1ZW7A 4LJPB 4BKSD 4GDKB 4JWSC 2PE6B 3RYTA 2DENB
chains in the Genus database with same CATH topology
4MH8A 3AE4B 4HROA 4TMAB 4O1NA 2W55A 1YN3A 2BS3B 2HTME 2IGDA 4L2YA 1XO3A 5D3IB 4TSSA 4TQ1A 5BMHA 3CWIA 2JZPA 3BYYB 3P4SB 3BIID 3LB8C 1L5PA 1L6VA 2RMMA 3O13A 1C9FA 1TJEA 1QQRA 2J53A 2H89B 4OHJA 1TYGB 3KWLA 3RFZB 3P4QB 2HDEA 1TS3A 3AE8B 4ZYSA 2BS2B 1SE2A 2W54A 3E56A 2FBWB 2WXHA 3AM9A 4DXFA 1SF0A 1C76A 5C3JB 1K53A 1RM6C 1TS4A 4MM3B 4HKQA 3R8BA 1PGXA 1FXIA 1V1PA 1JWMD 4A8XC 3NVVA 1QILA 3BVGA 2MH7A 1HA5A 1XLOA 3GB1A 1ROEA 2E6XA 1TKYA 1GAQB 4US9A 3AV8A 3GS2A 1I7HA 3I57A 3NVWA 1F2RI 1K51A 1KLUD 1K50A 2FE8A 2G9HD 4L1BA 1UNSA 1XXGA 4WAFA 4N59A 3TEXA 1V1OA 1YJJA 1ZDXA 5FR3A 1Q10A 2Y3AA 1QOAA 2JX5A 4OZBA 4WIPA 3EUB2 4D2KA 4C80A 3U7ZA 2KWDA 4OZCA 1L0VB 1IGCA 4YSZB 1T3QA 5AUKA 3AEEB 3BK1A 4WURA 5G5GA 4JX1C 2DWQA 3IT4B 2AQ2B 1YQ3B 1I4HA 2QMTA 4P16A 4IOIE 3C8YA 2MJEA 3W5UB 1FCCC 2RPVA 4KGRA 5GXGB 4ZHPA 1D5MC 1QKZA 2J42A 3VRBB 1ZUD2 1VZ7A 1QOFA 4M0WA 1KH0A 5EE1A 1IBXB 1WWTA 2QIEB 2YEPF 3AE9B 4ARCA 3TEYA 2J52A 2QSDA 1PGAA 1BUIC 3NRZA 4RGOS 3Q8CA 1XLQA 3U4EG 4HEA1 1J7CA 2KMMA 1IUEA 5BYSA 3ZQ4A 5BMGA 2B76B 2WXKA 1E7PB 1YN5A 3WCQA 1STEA 2CU3A 3AECB 3BVZA 3FAHA 3H8HA 3AEBB 1BMLC 1WXQA 2WXQA 5HG2A 2EKIA 2H88B 1ACCA 4IDIA 4OW0A 4L23A 2JWUA 3SR6A 3Q8FA 1TZOA 1E10A 4RGMA 3ETRA 2EELA 1K52A 1L6UA 2KACA 2V3NA 1ET6A 4MACA 5BYQA 3NUHB 1HZ5A 3Q8EA 1AW7A 3W2DA 2DYMA 4USAA 3NVYA 3GP7A 4B0MA 3DWGC 2SEBD 1XEEA 1C79A 4C56C 2WXMA 1TKEA 1BXTA 2WNMA 3PZ8A 3VR8B 1CZPA 4WQMA 1F2RC 4R3DA 3P63A 4NJCA 3HVZA 2BBCA 4IKGA 1CQVA 4RH6A 1LO5D 2L1AA 5H92C 1JCKB 1V97A 2LEKA 4EE2A 2BYTA 3HRDD 1P7FA 2WDQB 3I9V1 1EWCA 1N5XA 5HFYA 2W3SA 2WDVB 2IJ0A 3FILB 3IAM1 1D5ZC 4HRSA 2OHFA 2PLPA 4LLGM 1GPXA 1SEBD 4ITKA 4OVZA 4RCOA 1I4XA 1HXYD 4ZOHC 2K9XA 4WWMA 1RFKA 3BK2A 2E3TA 3W1SA 4WH4A 1SE3A 1JWAD 3AB5A 5EE3A 4YXDB 1FM0D 1JROA 1E9MA 3BYTB 1YN4A 3LXFA 4RNAA 4PT5A 1DOXA 1KF6B 1MHXA 1SBBB 2WXLA 1WGKA 2LJIA 2PIAA 1WRIA 2DLBA 2GB1A 4MT5A 3AE1B 2RDGA 2TSSA 1I4RA 1JWUD 2INNE 2WU5B 1MVKA 4J3OD 1FXAA 2K5PA 3VR9B 1I4PA 1F77A 1C78A 3TUOA 2WXNA 3AN1A 2N0SB 2NMQA 5T8IA 3T3OA 3UI3A 1E0ZA 3SEBA 1C4CA 2WP9B 3AEFB 2I2YA 1D4BA 3ABVB 4N6EB 1ZDVA 3RPFC 4YTNB 2WXRA 2RDHA 1QOBA 1I4QA 3U2SC 3HUIA 1GB1A 4NZLB 1AN8A 2VZKB 2WXIA 2I38A 1HQRD 1FIQA 5EE9A 2M19A 4CQNA 3KLSX 3BVMA 2PVOD 2LHEA 3ZYYX 1XCQL 4ZHOA 1D6EC 1L4DB 1QT9A 1L0YB 1DOIA 3TEZA 1DGJA 2BB6A 1JALA 1WSPA 1FFVA 1JRPA 1PFDA 1KFYB 2WXFA 1DYQA 1TS2A 4KGSA 2W3RA 4YSXB 4ARIA 3BZDB 1XF5L 4A6QA 2L32A 2PKOA 1V8CA 3KWVA 3KQ4A 3B9JA 3NS1A 3Q8BA 1FNWA 1ZE3D 3MJ5A 3MP9A 3R2IA 2DYOA 1KTKA 3T3NA 1TKGA 5HI1A 2IPKD 2Z8LA 1FNUA 3V3XA 2MJDA 3FC4A 1P7EA 1C4PA 2WS3B 3AE6B 1ZXIA 1SSNA 4GDLB 2WU2B 4RGTA 2JQRB 2WXOA 2ZW0A 3U52E 3ZJVA 2AQ1B 3ZJUA 1FNVA 2PTLA 3ZJTA 4GLSC 2ACZB 1NENB 4RF0A 1EU4A 3B2GA 1FRDA 1NVID 3PO0A 1OQRA 1N60A 3V05A 1VLBA 1B1ZA 1PYWD 5AUIA 4ZRQA 4US8A 1MPEA 1SJED 2GI9A 1C77A 4JWUC 1FO4A 2QJLA 1ENFA 1R7SA 1FRRA 4P6VF 1N5WA 3J9CA 3CIRB 1IBXA 4REZA 2LHDA 2K0PA 1JW9D 4LK0M 3Q8AA 3AMZA 1VR9A 1ESFA 3Q69A 4HKZE 4RFBA 1UGJA 2WXJA 3AEDB 1E6EB 2ON8A 2KN4A 3IAS1 1GOZA 1A70A 1UUPA 2LFIA 4YTMB 1QF6A 1AYFA 1CK1A 1N63A 1QOGA 1ZP0B 5H8YE 4XWTA 1VDVA 1T6BX 1MHHE 5G5HA 2AQ3B 2IDYA 3AEGB 2LGIA 3PZ7A 2WXGA 3VQIA 2ZW1A 4XDDA 3EA6A 4KKIA 1Y56A 2WLBA 3AE3B 2K22A 3L4PA 1SE4A 5E6JA 4A9AA 5I4DA 1C4AA 2KAJA 2N7JA 2BTEA 1SIJA 3NZ3A 3P4PB 4KGTA 1JWSD 1HZ6A 1EWYC 2D5GA 1L4ZB 3R2TA 5JXVA 2W82A 1N61A 2NTSA 2MJ3A 1XLNA 1VJKA 1L0XB 2V4IB 1GB4A 1NI3A 4JE3B 4OZAA 3MFGA 2XNAC 2Y5PA 1HEZE 4C7ZA 3AEAB 1RYJA 2AX5A 4RF1A 5C2TB 2V3PA 2G1EA 2JXTA 4A55A 2BW2A 1ZPSA 2QEJC 2BT6A 4C7YA 2IGHA 1NEKB 3W9CB 2OEDA 2LUMA 4H2AA 1YMHE 3MHZA 2PVGC 4N58A 1PUTA 1SXTA 1YNTE 4LTUA 3NVZA 4YWGG 3FILA 3E9SA 2M0AA 3MC0B 2V0GA 2JYTA 2BS4B 1PDXA 2CJNA 5BYRA 1OQQA 5MPOA 1N62A 4ZRPA 2YEPB 3URYA 2IGGA 5D7GA 3VRAB 1FFUA 1FCLA 3BWUD 3SFDB 4DXGA 5FKAC 5FK9C 4KKJA 2J4XA 1OFFA 2VZKD 5TSSA 2WDRB 2KDMA 3P42A 1UWMA 3DWMA 1DOYA 1J7AA 3P1MA 3P4RB 1UWXA 2JYEA 3TSSA 4UDUC 1NYRA 2GRIA 1SB3C 1VZ6A 1RWSA 2ONQA 4YT0B 4NAWB 4Q2JA 2Y5CA 4YSYB 1SJHD 3B2FA 2WQYB 2CJOA 1WYGA 3LYYA 2SAKA 1I4GA 3IXSA 2R61A 1ZXHA 5HHDG 4KX6B 3OWEB 2Q5WD 1TS5A 4XDCA 1D5XC 4A90A 1JWBD 3AH7A 2JU6X 1EM7A 1MI0A 2L52A 1EU3A 1V1PB 1J7BA 4AQ7A 2JSVX 4RGNA 2LMCA 2KQ4X 1KRHA 1T5XD 4XWWA 4YTPB 5LNK1 3AE7B 1VZ8A 1JQ4A 1CJEA 1TY0A 2PMVA 1M4VA 4AS1A 3ZGZA 1B9RA 2DBYA 2PW9A 1IGDA 4HJGE 2BB5A 1ET9A 3AE2B 4XE0A 1KLGD 2M56B 1VRAB 2MEKA 3AE5B 5EE0A 1TY2A 4DQOC 2L83A 3SFEB 3W5VB 5BMIA 1YQ4B 1ZOYB 2ICIA 3HVDA 1FMAD 1JMLA 3TEWA 2K3UA 2NTTA 2QILA 2XN9C 4FXCA 4NAMA 2X38A 1NYQA 2INPE 2N9LA 1AWDA 1FEHA 1FD6A 2WXPA 1PGBA 1XLPA 3N9YC 4B0EA 3IT6B 3EGRA 1F0ZA 2FUG1 4GDKB 1XCTL 1YJIA 4JWSC 5D3DA 4TQ0A 1QLBB 2N9KA 4JPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NI3 A;  1JAL A;  3AE4 B;  4HRO A;  4USA A;  3NVY A;  1FFV A;  1JRP A;  1PFD A;  2W55 A;  3DWG C;  1KFY B;  2BS3 B;  2HTM E;  4C7Z A;  3AEA B;  1RYJ A;  2AX5 A;  1XO3 A;  5C2T B;  4YXD B;  1TKE A;  2G1E A;  2W3R A;  4YSX B;  3CWI A;  3VR8 B;  2BT6 A;  2PKO A;  4C7Y A;  1CZP A;  4WQM A;  1NEK B;  3BII D;  1V8C A;  3LB8 C;  3P4S B;  3W9C B;  1L5P A;  3P63 A;  1L6V A;  3HVZ A;  2PVG C;  1TJE A;  3B9J A;  3NS1 A;  4N58 A;  1PUT A;  2H89 B;  4LTU A;  3NVZ A;  1TYG B;  3KWL A;  3P4Q B;  5H92 C;  1V97 A;  2LEK A;  3AE8 B;  3HRD D;  1TKG A;  1DOY A;  2BS2 B;  2WDQ B;  2W54 A;  2BS4 B;  1N5X A;  2FBW B;  3AM9 A;  1PDX A;  2CJN A;  1SF0 A;  2W3S A;  2WDV B;  2MJD A;  1OQQ A;  3FC4 A;  5C3J B;  1RM6 C;  5MPO A;  1N62 A;  1FXI A;  2OHF A;  4HRS A;  1GPX A;  2WS3 B;  1FFU A;  3AE6 B;  4ITK A;  3VRA B;  1ZXI A;  3NVV A;  4ZOH C;  2MH7 A;  2WU2 B;  1XLO A;  3SFD B;  2K9X A;  1ROE A;  4WWM A;  1TKY A;  2JQR B;  1GAQ B;  1RFK A;  4US9 A;  3AV8 A;  3P1M A;  1I7H A;  3NVW A;  2E3T A;  1OFF A;  4N59 A;  2WDR B;  1JWA D;  3AB5 A;  1UWM A;  3DWM A;  5EE3 A;  1J7A A;  1FM0 D;  1E9M A;  1JRO A;  1YJJ A;  3LXF A;  3P4R B;  2ACZ B;  1NEN B;  1NYR A;  3B2G A;  1DOX A;  1SB3 C;  1FRD A;  1QOA A;  1KF6 B;  1RWS A;  2JX5 A;  1NVI D;  3PO0 A;  4YT0 B;  2Y5C A;  1OQR A;  3EUB 2;  4C80 A;  1N60 A;  4YSY B;  1VLB A;  1L0V B;  1WGK A;  2PIA A;  1WRI A;  3B2F A;  4YSZ B;  1T3Q A;  5AUK A;  3AEE B;  2WQY B;  2CJO A;  3AE1 B;  5AUI A;  4US8 A;  1WYG A;  5G5G A;  4JX1 C;  2DWQ A;  2WU5 B;  4JWU C;  1YQ3 B;  2QJL A;  4KX6 B;  1FO4 A;  2Q5W D;  1R7S A;  1FRR A;  1FXA A;  2K5P A;  1JWB D;  2MJE A;  3AH7 A;  4P6V F;  3VR9 B;  3W5U B;  1N5W A;  5GXG B;  4ZHP A;  3CIR B;  2L52 A;  1J7B A;  1JW9 D;  3VRB B;  3AN1 A;  3AMZ A;  2N0S B;  1KRH A;  1ZUD 2;  1QOF A;  3AED B;  1E6E B;  1E0Z A;  4YTP B;  5EE1 A;  2WP9 B;  3AEF B;  1A70 A;  1WWT A;  3AE7 B;  1JQ4 A;  1CJE A;  4YTM B;  1QF6 A;  3ABV B;  1AYF A;  1N63 A;  1QOG A;  2QIE B;  4N6E B;  3RPF C;  2DBY A;  3AE9 B;  1B9R A;  1ZP0 B;  4YTN B;  5H8Y E;  1QOB A;  1VDV A;  3HUI A;  3AE2 B;  2M56 B;  3AE5 B;  5EE0 A;  3NRZ A;  5G5H A;  2L83 A;  1XLQ A;  3AEG B;  3SFE B;  3W5V B;  1J7C A;  2KMM A;  1IUE A;  1YQ4 B;  1ZOY B;  2B76 B;  1FMA D;  1FIQ A;  1E7P B;  3WCQ A;  2CU3 A;  3AEC B;  2M19 A;  3FAH A;  5EE9 A;  4FXC A;  3AEB B;  2WLB A;  3AE3 B;  2K22 A;  3L4P A;  1WXQ A;  4A9A A;  2EKI A;  2H88 B;  1NYQ A;  4IDI A;  2KAJ A;  1AWD A;  2PVO D;  3SR6 A;  3ZYY X;  1XLP A;  4ZHO A;  1E10 A;  1SIJ A;  3P4P B;  1F0Z A;  1EWY C;  1QT9 A;  3ETR A;  1YJI A;  4JWS C;  1N61 A;  1L6U A;  1DOI A;  1QLB B;  1DGJ A;  2MJ3 A;  1XLN A;  1VJK A; 
#chains in the Genus database with same CATH topology
 2KK8 A;  3OAW A;  3AE4 B;  2W55 A;  2HTM E;  2L0T A;  5D3I B;  1N6Z A;  3P4S B;  1L5P A;  1P1A A;  3O13 A;  1C9F A;  2H89 B;  4IM2 A;  5DCN A;  1TYG B;  3P4Q B;  2HDE A;  1Z2M A;  1GNU A;  1MJD A;  2KDB A;  4KIK A;  4ANV A;  1SE2 A;  2W54 A;  1C3T A;  3AM9 A;  2KLC A;  2R2Q A;  4F1S A;  3B1L X;  4EZJ A;  4HKQ A;  1MG4 A;  3KW5 B;  3ZKJ C;  1FXI A;  2FNJ B;  4A8X C;  3NVV A;  1XLO A;  1WJU A;  3GB1 A;  1ROE A;  2M4N A;  1TKY A;  1GAQ B;  3AV8 A;  3GS2 A;  3B08 A;  1KLU D;  1K50 A;  1A5R A;  1M94 A;  4NJ7 A;  2MBO A;  2JX5 A;  4OZB A;  4WIP A;  1RFA A;  1WJ4 A;  1J8C A;  4OZC A;  4P1C C;  2LRW A;  1R4M B;  1IGC A;  1HE8 A;  4YSZ B;  1T3Q A;  2AL3 A;  4WUR A;  2D07 B;  4JX1 C;  1YQ3 B;  2KXJ A;  3VH4 B;  4GOC A;  1UD7 A;  2MJE A;  2XK5 B;  3IVF A;  2KKC A;  4N9F 4;  2WDT B;  4B9K A;  2J42 A;  2KZR A;  1ISN A;  1E8W A;  2KX3 A;  2GBJ A;  4M0W A;  5EE1 A;  2FUH B;  3IHP C;  1WWT A;  2LVO A;  1WI0 A;  2KWC A;  2FCM A;  4BKG A;  2RSU A;  4WJP A;  1PGA A;  3NRZ A;  3CMM B;  1R4M I;  2ZNV C;  2KMM A;  4K7U A;  2CU3 A;  3AEC B;  3FAH A;  1WXQ A;  2H88 B;  1BT0 A;  4L23 A;  2JWU A;  3SR6 A;  2BF8 B;  3Q8F A;  2KX0 A;  2FCN A;  3ZRC A;  2LD9 A;  4RGM A;  3ETR A;  2EEL A;  4DDG D;  1ET6 A;  3T9L A;  3Q3M C;  2HTH A;  1R4N B;  3NVY A;  4B0M A;  1C79 A;  2WGS A;  4C56 C;  2K6D B;  2NVU I;  4IW0 A;  4I6L B;  1V5T A;  2O6V D;  4HPL B;  4R3D A;  5D94 A;  3HVZ A;  4IKG A;  4HDO A;  1LO5 D;  3NOB A;  2GOW A;  2BYT A;  2C7H A;  2XEW A;  3HRD D;  3K9P B;  2YVC A;  1WY8 A;  3A4S C;  2IO2 B;  1GPX A;  3QAR A;  3QQ8 B;  4ITK A;  4ZOH C;  1R4N I;  4C4V B;  4NNJ B;  3RNE C;  2E3T A;  3W1S A;  1SE3 A;  4WWO A;  4YXD B;  4IUM B;  4RNA A;  1D3Z A;  2KTR B;  3WAO A;  1MHX A;  2WX1 A;  1SBB B;  3QAQ A;  2LJI A;  2PIA A;  3OJ3 A;  2GB1 A;  2RDG A;  2TSS A;  4AOF A;  1RAX A;  2LWP A;  4J3O D;  1F9J A;  1FXA A;  4NQL B;  3WA0 A;  1KOT A;  3L16 A;  2KTF A;  1I4P A;  1F77 A;  3TUO A;  2ZPY A;  2K8B A;  2KVZ A;  1V5O A;  2RPQ A;  4DDI D;  4N6E B;  3RPF C;  2IND C;  4ICV A;  4HPP A;  2WXR A;  4MEM A;  1QOB A;  3QCA A;  4E71 A;  3UIO B;  2KJR A;  1P0R A;  3SDL C;  2WYQ A;  2WXI A;  3ZNZ B;  3PRZ A;  4CQN A;  4GDK A;  3A33 B;  3R66 C;  3ZYY X;  3S2A A;  1L4D B;  3V6E B;  4DHJ D;  3R3M A;  2FID A;  2BB6 A;  4GB9 A;  1JAL A;  2ZZP B;  1JRP A;  1KFY B;  3ZTC A;  4YSX B;  1XF5 L;  2PKO A;  3KQ4 A;  3RN9 C;  2IO0 B;  2ZPN A;  1FNW A;  3ONS A;  1WR6 E;  3MJ5 A;  1SGH A;  3MP9 A;  3R2I A;  1J19 A;  4KZ0 A;  3R7Q A;  4BOS C;  2IPK D;  2Z8L A;  1NI2 A;  2M1M A;  2MJD A;  1P7E A;  3AE6 B;  4LNI A;  1S1Q B;  3N32 A;  4M01 A;  2WXO A;  3KYC D;  1Z5S B;  3ZJV A;  1FNV A;  3ZJT A;  2Z0E B;  2ACZ B;  1NEN B;  1Y8R C;  1GJZ A;  1V81 A;  1FRD A;  5TR5 A;  3RCZ A;  1N60 A;  3ENE A;  3V05 A;  3RNF C;  2XK5 A;  1MPE A;  2UWQ A;  1YX6 B;  2GI9 A;  4JWU C;  1FRR A;  4GN1 A;  4P6V F;  4NPN A;  3CIR B;  4MGY E;  1JW9 D;  3IG3 A;  2MWS B;  3AMZ A;  2D10 A;  1OGW A;  4WWN A;  1UGJ A;  2WXJ A;  3AED B;  1E6E B;  1A70 A;  2MHJ A;  4GGQ A;  1CK1 A;  5H8Y E;  3AU4 A;  4KDL B;  2CHZ A;  4DXA B;  4XDD A;  2BVC A;  2X8X X;  2CU1 A;  2WLB A;  4PS7 A;  5E6J A;  2KAJ A;  2KJH B;  3P4P B;  3R2T A;  5JXV A;  2FAZ A;  1N61 A;  3U7D A;  3UGB B;  3EFC A;  1VJK A;  4FUL A;  1E8Y A;  4JE3 B;  4W9C A;  4OZA A;  2K8C A;  3NY5 A;  2V3P A;  2KMA A;  2JXT A;  2BW2 A;  1ZPS A;  2ZVN A;  2PVG C;  1YNT E;  5FR6 A;  3NVZ A;  2M0A A;  2NCN A;  4ANX A;  2KN5 A;  2C7M B;  3L13 A;  2Y5B B;  3Q2A C;  2KMC A;  2YLM A;  4DK5 A;  5D6J B;  4C4V A;  1OQQ A;  1IYF A;  2YEP B;  5D7G A;  2DAJ A;  1FCL A;  4G0N B;  3HK0 A;  1YQB A;  5FK9 C;  2KTR A;  1EUV B;  4KKJ A;  5TSS A;  4MGZ E;  2LGD A;  5AZG A;  2GRI A;  1SB3 C;  4YT0 B;  4Q2J A;  4HXD A;  1GG3 A;  2SAK A;  1I4G A;  3RT3 B;  1ZXH A;  3I3T B;  2L05 A;  2Q5W D;  4XDC A;  4A90 A;  5LLI A;  2I1J A;  1MI0 A;  4DHZ E;  3WAN A;  2JSV X;  2KQ4 X;  4WJN A;  4XWW A;  3ZTD A;  4XC2 A;  1VZ8 A;  1JQ4 A;  1CJE A;  1TY0 A;  3ZGZ A;  4AS1 A;  4HJG E;  1IGD A;  3PV1 A;  2MEK A;  1VRA B;  3AE5 B;  5EE0 A;  4ZYN A;  3K9O B;  3W5V B;  4MJS B;  1FMA D;  2NTT A;  5E6N A;  2N4F A;  2X38 A;  1PGB A;  1F1H A;  3PHX B;  2KVR A;  5GMV A;  1WMH B;  3APF A;  4TMA B;  1YN3 A;  2BS3 B;  4L2Y A;  4TQ1 A;  3TMP B;  2JZP A;  3BYY B;  3BII D;  4M8N A;  4OVV A;  2RMM A;  1QQR A;  2J53 A;  1EO6 A;  3QHT A;  3AE8 B;  3R7R A;  3E56 A;  2FBW B;  2MA9 B;  1C76 A;  5C3J B;  1V80 A;  1K53 A;  1WX8 A;  3DVN U;  4IC7 B;  1V1P A;  4LJO B;  1WGH A;  1WGD A;  2AWT A;  1IP9 A;  3BVG A;  3W1Y A;  4WJO A;  3P1M A;  1I7H A;  3I57 A;  3NVW A;  1F2R I;  1K51 A;  4L1B A;  4PT5 A;  5DPT A;  4WAF A;  3VTW A;  1UNS A;  3WAL A;  4N59 A;  5E6O A;  4A3O A;  1ZDX A;  1Q10 A;  2Y3A A;  3PRP B;  2JT4 B;  4D2K A;  2JXX A;  1L0V B;  1IPG A;  3DVG Y;  5CHF A;  3BK1 A;  4FA6 A;  2DWQ A;  3NHE B;  2AQ2 B;  1FXT B;  4W9F A;  4DBG A;  2QMT A;  5IAA C;  4IOI E;  2GLS A;  1Q5W B;  3C8Y A;  4ZRJ A;  1WXA A;  2K8H A;  2RPV A;  5GXG B;  4BBN C;  1WR1 A;  3VRB B;  3L54 A;  1VZ7 A;  1QOF A;  3M95 A;  1KH0 A;  1SIF A;  4GSW A;  3A4R A;  3PT2 B;  2QIE B;  2YEP F;  4ARC A;  2QSD A;  5KHO A;  1BUI C;  2QDF A;  4M8M A;  1E7P B;  3LDZ E;  3WCQ A;  3BVZ A;  1YD8 U;  2EKI A;  4OW0 A;  4XX5 A;  4MM3 A;  3TIX A;  2W9N A;  4A3P A;  4EUT A;  2MBE A;  4FJY A;  1HZ5 A;  1OEY J;  3DOW A;  3DWG C;  1BXT A;  3M3J A;  3PZ8 A;  1CZP A;  4WQM A;  1F2R C;  4TV3 A;  2C5L C;  4NJC A;  2BBC A;  1CQV A;  3WAP A;  1JCK B;  1V97 A;  4P7I A;  4E3C A;  3I9V 1;  4TUU A;  1N5X A;  2IJ0 A;  3FIL B;  3RNG C;  3APC A;  3RZW C;  4LLG M;  1SEB D;  4OVZ A;  2MBQ A;  3ZLZ A;  3DVG X;  4WWM A;  4M00 A;  2BQQ A;  1WGG A;  3RI7 C;  3BK2 A;  3MJW A;  1MFW A;  5EE3 A;  2CKH B;  4URK A;  1E9M A;  3LXF A;  1DOX A;  2JY6 A;  2WXL A;  3ZO5 B;  3Q3N C;  2LUE A;  1I4R A;  2WU5 B;  1MVK A;  3DHG C;  3VR9 B;  1V2Y A;  1J0G A;  2INC C;  3AN1 A;  3DHI C;  1V49 A;  3OJ4 B;  2V4L A;  3UI3 A;  1E0Z A;  3SEB A;  3AU5 A;  2MW5 A;  3KUD B;  1KJT A;  3VUX A;  3PHW B;  4G3X B;  4MJS A;  4MSM B;  1I4Q A;  3U2S C;  3PLV A;  4NZL B;  3WAM A;  3V6C B;  1AN8 A;  2VZK B;  3H9D A;  3ZW3 A;  1H8C A;  2I38 A;  4KZC A;  3DQV A;  2IBI B;  1WMH A;  4JIO U;  3SU8 X;  2UU7 A;  4ZHO A;  2C9W B;  1DOI A;  1E7V A;  1DGJ A;  1SE9 A;  1WM2 A;  2CHX A;  1WSP A;  3VUY A;  2KFJ A;  1RLF A;  1DYQ A;  2IZV B;  3VUW A;  1TS2 A;  3NJT A;  2L32 A;  1NDD A;  2OOB B;  3B9J A;  3NS1 A;  3VVW B;  1G6J A;  2DYO A;  4LDT D;  1VD2 A;  1WRD B;  3ALB A;  3T3N A;  1TKG A;  5HI1 A;  4A20 A;  4S17 A;  1GC6 A;  3TCA A;  3FC4 A;  1L2N A;  4RM8 A;  3JSV B;  4BKT A;  1SSN A;  2WU2 B;  2M0X A;  4RGT A;  4W9I A;  2ZW0 A;  2KLG A;  2KC1 A;  3ZDT A;  4K7W A;  2XBB C;  4RF0 A;  2WX0 A;  3JW0 X;  1TT5 B;  3CST A;  1B1Z A;  1PYW D;  4ZRQ A;  1YX5 B;  3RNA C;  3PZD A;  2AEH A;  1GUA B;  2LHD A;  1Q1O A;  3Q8A A;  3Q69 A;  4RFB A;  2K1F A;  2KN4 A;  5CTR C;  1GOZ A;  1UUP A;  2LFI A;  1AYF A;  1N63 A;  1QOG A;  1ZP0 B;  4XWT A;  1VDV A;  1MHH E;  3MC8 A;  4FHK A;  3AXC A;  3AEG B;  2WXG A;  5JH5 C;  4PYZ A;  2J0M A;  4KKI A;  1UZX B;  2K22 A;  2G4S A;  5KHQ A;  1XD3 B;  4KGT A;  5DPS A;  2D3B A;  2A5U A;  3H7P B;  4GXB A;  4IWP A;  2MJ3 A;  2J0J A;  3PTF C;  1GB4 A;  1NI3 A;  3QIJ A;  4GMV A;  2BYV E;  4C7Z A;  4RF1 A;  3APD A;  2K25 A;  2G1E A;  4MGK E;  4C7Y A;  1AAR A;  5CX3 A;  4H2A A;  1YMH E;  5EDS A;  1YOV B;  4LTU A;  4YWG G;  2PEA A;  3FIL A;  3MC0 B;  2DZJ A;  3L08 A;  1PDX A;  2KHW B;  1LFD A;  1N62 A;  2M17 A;  3H6N A;  4ZRP A;  2IGG A;  3U30 A;  2REX A;  3BWU D;  2MSE D;  2IYD B;  2J7Q B;  3UQA A;  2J4X A;  3KUZ A;  2KDM A;  1UWM A;  1DOY A;  1J7A A;  4JGH B;  1OEY A;  3TSS A;  4MGI E;  1RWS A;  2Y5C A;  3RMK C;  2HE7 A;  1SJH D;  3N1Z C;  2KO3 A;  3T8M A;  2O6V B;  2CJO A;  2WQY B;  2QC8 A;  2KWU B;  3IXS A;  3SD5 A;  2CS4 A;  2MX2 A;  2GBK A;  2RD0 A;  2JU6 X;  3UF8 A;  1EM7 A;  1EU3 A;  1V1P B;  1J7B A;  1V6E A;  4GU2 A;  4BZA A;  2OJR A;  4FN2 A;  5LNK 1;  2MCN B;  2PMV A;  1M4V A;  1B9R A;  2DNF A;  2BB5 A;  1WGR A;  1KLG D;  2M56 B;  5AZH A;  1TY2 A;  4DQO C;  2LJ5 A;  3SFE B;  5BMI A;  3EEC A;  3HVD A;  3MHS D;  1JML A;  2QIL A;  2KDE B;  4NAM A;  2LRU A;  2INP E;  1FD6 A;  3N9Y C;  4B0E A;  3IT6 B;  3EGR A;  1L7Y A;  4NQK E;  4HRO A;  4O1N A;  4QAY A;  2M8S A;  2R2O A;  3B0A A;  3O65 B;  3LB8 C;  4CYE A;  2KD0 A;  2GBM A;  1TJE A;  3VHT C;  1QZE A;  4OHJ A;  3KWL A;  4MSQ B;  3JSV A;  2FIF A;  4ZYS A;  4K81 A;  2BS2 B;  1YIW A;  2WXH A;  4DXF A;  1SF0 A;  4MM3 B;  1TS4 A;  4BKS A;  3R8B A;  1PGX A;  2L7R A;  5AZF A;  1QIL A;  4AP4 C;  2IO3 B;  2E6X A;  4US9 A;  2GBN A;  2LGS A;  4DHJ B;  2FE8 A;  3DDC B;  2G9H D;  1XXG A;  3C0R B;  1YJJ A;  5FR3 A;  4XYC A;  3U7Z A;  2KWD A;  4KVG B;  2ZJD A;  3AEE B;  5AUK A;  3GOE A;  2N1V A;  3NZS A;  2MRP A;  1E7U A;  3IT4 B;  5C1Z A;  1I4H A;  4NY0 A;  4WQO B;  1UH6 A;  5JZE B;  3WIM A;  4KGR A;  1WX7 A;  2JRI B;  3ML9 A;  1EF5 A;  4RMA A;  2KDF B;  3ZIM A;  1IBX B;  1WZ0 A;  2CR5 A;  3VTU A;  3AE9 B;  3DBR B;  3QC8 B;  4HPM B;  3TEY A;  2J52 A;  3Q8C A;  3V61 A;  3DBH B;  1J7C A;  4LNK A;  4B95 A;  5BYS A;  2B76 B;  2KQ7 A;  3EFU A;  3ZVV A;  3AI5 A;  3H8H A;  1ZGU B;  2DZM A;  3AEB B;  2WXQ A;  3H7P A;  1ACC A;  4IDI A;  1TZO A;  1E10 A;  2EMT A;  4HJK A;  3VDZ A;  3OLM D;  3X0W A;  1L6U A;  3PRE A;  4LNF A;  4MAC A;  2MBH A;  3Q8E A;  2J0K A;  2FCQ A;  1AW7 A;  3W2D A;  4GIV A;  1E8Z A;  3GP7 A;  2L3Z A;  3RNB C;  2SEB D;  1XEE A;  3VTV A;  3DBR I;  2WXM A;  1TKE A;  4FJZ A;  1TGZ B;  2WNM A;  3ZNI D;  2BWE S;  2BKF A;  3P63 A;  2MQJ A;  4PYU A;  5H92 C;  3DHH C;  2LEK A;  1XT9 B;  4EE2 A;  1P7F A;  2WDQ B;  4WWP A;  5HFY A;  4OVU A;  3IAM 1;  2OHF A;  2PLP A;  4TKN A;  2LGX A;  4W9L A;  1I4X A;  4II2 B;  2K9X A;  1JWA D;  3RUL A;  1FM0 D;  3BYT B;  2NBV B;  2O6V A;  2L8J A;  1KF6 B;  1WJ6 A;  1HTQ A;  2BYF A;  1WRI A;  3H7S A;  3AE1 B;  3NZU A;  1JWU D;  2INN E;  3KH0 A;  1WH3 A;  4LNN A;  2K5P A;  3C19 A;  1E90 A;  2A4Z A;  2VRR B;  2ZEQ A;  1C78 A;  4BOZ B;  2NMQ A;  4FBJ B;  5T8I A;  1C4C A;  2WP9 B;  3AEF B;  3MC9 A;  4YTN B;  2RDH A;  2HJ8 A;  2ASQ A;  4HLE A;  2LVP A;  3VXW A;  5LXI B;  2BPS A;  4AWJ A;  2JUO A;  2M19 A;  2KFK B;  3BVM A;  1I35 A;  2PVO D;  5HKH A;  1QT9 A;  1L0Y B;  2MP2 B;  2N9X A;  1UF0 A;  3TEZ A;  1FFV A;  4X57 B;  2WXF A;  1E5W A;  4W9J A;  4KGS A;  2VH2 A;  2W3R A;  3DCG A;  4ARI A;  2ZVO A;  1XQQ A;  2IY1 B;  3VH3 B;  1ZE3 D;  3HM3 A;  5E6P A;  4W9G A;  5IN7 A;  3RZF A;  2MLB A;  3V3X A;  1C4P A;  4BBN F;  2WS3 B;  4GDL B;  1YJ1 A;  3L10 B;  4G11 A;  1VCB A;  2CHW A;  2V9H A;  2AQ1 B;  3ZJU A;  2PTL A;  1EU4 A;  3B2G A;  5IP4 D;  3PO0 A;  2G45 B;  3QWZ B;  1OQR A;  1VLB A;  2GMI C;  5AUI A;  4YL8 A;  4US8 A;  1NBF C;  4EEW A;  1H4R A;  1F52 A;  1TBE A;  2QJL A;  1EF1 A;  4C00 A;  1R7S A;  5J17 A;  2PPH A;  2ZCB A;  2JPH A;  4FLH A;  1IBX A;  2IO1 B;  2K0P A;  5LXH A;  3A1Q B;  1C1Y B;  1VR9 A;  4HKZ E;  3NS8 A;  2KQS A;  1WGY A;  2ON8 A;  4YTM B;  3Q3O C;  1QF6 A;  2RR9 A;  1RRB A;  2DYB A;  5L95 C;  5G5H A;  4W9E A;  4CHK A;  3BY4 B;  3VQI A;  2ZW1 A;  5AEK B;  3EA6 A;  3QA8 A;  1Y56 A;  3AE3 B;  3L4P A;  4A9A A;  5I4D A;  1C4A A;  3L17 A;  2KC2 A;  3V62 A;  3MTN B;  2BTE A;  4XGA B;  3NZ3 A;  1ZKH A;  5G2N A;  4J6I A;  2W82 A;  2NTS A;  3PVL A;  1XLN A;  3DVN V;  2V4I B;  2XNA C;  4WJQ A;  1RYJ A;  2AX5 A;  4A55 A;  2QEJ C;  4JQW C;  4JL9 A;  3PGE A;  1P9D U;  2IGH A;  1NEK B;  3W9C B;  2DAF A;  2LUM A;  3MHZ A;  2KNB A;  2LI5 A;  3N30 A;  2D2Q A;  2BS4 B;  3Q3J A;  3W1S C;  2CJN A;  5MPO A;  2LZ6 A;  1OTR B;  2NBU A;  1WJN A;  3VRA B;  1FFU A;  2RGF A;  3SFD B;  4ZDV A;  4DXG A;  2AL6 A;  1OFF A;  2WDR B;  4EKU A;  3DWM A;  2LGY A;  3P4R B;  1WM3 A;  2JYE A;  5DPR A;  1K8R B;  4FAD A;  1VZ6 A;  3UQB A;  2ONQ A;  4NAW B;  2EMS A;  3Q14 C;  3B2F A;  4HCN B;  3D32 A;  2N9E B;  1WYG A;  3LYY A;  2R61 A;  2Z0D B;  5HHD G;  3OWE B;  1TS5 A;  1D5X C;  2KJ6 A;  2L52 A;  1PQS A;  2ZCC A;  4AQ7 A;  2LMC A;  4S0R A;  4YTP B;  3AE7 B;  4EOY A;  2JVC A;  3L0W B;  3Q6B A;  2DBY A;  5DPW A;  1ET9 A;  2D11 A;  3QK0 A;  1T0R C;  2KFK A;  1ZOY B;  3SHQ A;  3KUC B;  4NJ6 A;  3TEW A;  1TZ1 A;  1UBQ A;  2L0F A;  2NPT A;  2O2V B;  2MP2 A;  3DPD A;  1NYQ A;  4BVU C;  1AWD A;  2WXP A;  4K3B A;  1F0Z A;  2FUG 1;  4BAX A;  4HVB A;  1XCT L;  1YJI A;  5D3D A;  4TQ0 A;  1QLB B;  2N9K A;  3A9K A;  4MH8 A;  2JWZ A;  2IGD A;  1UBI A;  1XO3 A;  3EHV A;  4TSS A;  3EC8 A;  3CWI A;  5BMH A;  1LQB A;  3DBS A;  1L6V A;  2FCS A;  3HM6 X;  3RFZ B;  1WF9 A;  4KV2 A;  1TS3 A;  4KDI C;  2WWZ A;  2IY0 B;  4I6P A;  4GDL A;  1RM6 C;  2N1W A;  2HJ1 A;  4HWI B;  1JWM D;  3N1Y C;  4EZL A;  4KSL C;  4MDK E;  2PE9 A;  2MH7 A;  4IG7 B;  1HA5 A;  3ZDM C;  5D2M B;  1LXD A;  3TEX A;  1V1O A;  4EZK A;  2K6Q A;  3ZXV A;  1QOA A;  1LM8 B;  3EUB 2;  4C80 A;  2KAN A;  1X1M A;  2KYW A;  3X23 A;  5G5G A;  4P1B C;  3A1Q A;  4P16 A;  1P98 A;  5J18 A;  4LDT B;  3W5U B;  1FCC C;  4ZHP A;  1D5M C;  1QKZ A;  2V3S A;  1ZUD 2;  1WXS A;  2D3C A;  1GC7 A;  3A9J B;  4DWF A;  4FJV B;  4PK1 A;  4RGO S;  5J2R A;  1XLQ A;  2QHO A;  5CHW A;  3U4E G;  4HEA 1;  1IUE A;  2I1K A;  3ZQ4 A;  5BMG A;  2WXK A;  1YN5 A;  1STE A;  3CF6 E;  3GE3 C;  4ANW A;  4E74 A;  1BML C;  5HG2 A;  3N3K B;  3U8Z A;  3HIZ A;  5C23 A;  2N7E A;  2D3G A;  3UIN B;  3GZN B;  3DBL B;  3JYU A;  1K52 A;  2KAC A;  2V3N A;  5BYQ A;  3NUH B;  2KOX A;  1Q0W B;  3RNC C;  1V86 A;  2DYM A;  1JRU A;  4USA A;  3GE8 C;  2N7D A;  2DHZ A;  3H1U A;  3VR8 B;  2NR2 A;  3ZXR A;  2LXA A;  2KT7 A;  2G4D B;  4W9K A;  4K1R B;  4RH6 A;  2L1A A;  3PRM B;  1WXV A;  4II3 B;  1EWC A;  2W3S A;  2MBB B;  2WDV B;  3GZN I;  3DBL I;  2C7N B;  1D5Z C;  1T0Y A;  4HRS A;  4RCO A;  1HXY D;  3UIP B;  1RFK A;  4NAW A;  2BKR B;  3RD2 A;  4WH4 A;  3AB5 A;  1JRO A;  1YN4 A;  2L00 B;  1UGM A;  4LNO A;  3QJZ A;  2PJH A;  4BFR A;  1HTO A;  2C60 A;  1WGK A;  2DLB A;  4MT5 A;  3PLU A;  5BO4 B;  4IM0 A;  1KM7 A;  1LGR A;  3LJ3 A;  4G50 A;  4PS8 A;  1TIF A;  4W9H A;  2WXN A;  1T0Q C;  2N0S B;  3T3O A;  3ML8 A;  2DZI A;  2L76 A;  1E8X A;  5JHA A;  2I2Y A;  4HCP B;  1D4B A;  3ABV B;  1ZDV A;  1WFY A;  4RM9 A;  1GB1 A;  3HUI A;  2O2V A;  2RDB C;  1HQR D;  1FIQ A;  5EE9 A;  3KLS X;  4ZRK A;  3PPA A;  2LHE A;  1XCQ L;  1WIA A;  1D6E C;  3I63 C;  2K39 A;  2JRH A;  3PS6 A;  1KLV A;  3IFW B;  3ECI A;  3TBL D;  1MG8 A;  1PFD A;  2JZZ A;  1UEL A;  4W9D A;  3BZD B;  4A6Q A;  3JVZ X;  1V8C A;  1TTN A;  3KWV A;  3N1X C;  3TJP A;  3Q8B A;  1WE6 A;  3VFK A;  4KSK C;  1KTK A;  2BGF A;  4M02 A;  3Q3F A;  1FNU A;  3PSE B;  1FPY A;  2UYZ B;  2KDI A;  1WE7 A;  4KIK B;  5IKC M;  1ZXI A;  2AYO B;  4AUQ C;  2JQR B;  3NG0 A;  2BWF A;  4PS3 A;  3U52 E;  3I5J C;  3DBH I;  3KVF B;  4IWO A;  1V9J A;  4AJY B;  4GLS C;  3KYD D;  1T0S C;  2DX5 B;  1NVI D;  2D3A A;  3AUL A;  4ICU A;  2HD5 B;  4DHZ B;  1SJE D;  2OJW A;  1C77 A;  1FO4 A;  1ENF A;  4ASW C;  4MH0 E;  1N5W A;  3J9C A;  4REZ A;  3A9J A;  5IO9 A;  4LK0 M;  1ESF A;  4XZ4 A;  1WX9 A;  3BIN A;  1P3Q U;  4I6N B;  3IAS 1;  2JZ3 B;  3M62 B;  4ANU A;  4M0W B;  2GBR A;  1T6B X;  2JF5 A;  2AQ3 B;  2IDY A;  5CHV C;  2LGI A;  2BYE A;  3V60 A;  3PZ7 A;  2Z59 B;  3IBE A;  3FKY A;  1SE4 A;  3QX1 A;  3N20 C;  3VAW A;  2N7J A;  1SIJ A;  1JWS D;  1HZ6 A;  1EWY C;  2D5G A;  1L4Z B;  3CSF A;  4B6W A;  1I42 A;  4JPS A;  1L0X B;  3ZUN A;  3P2B A;  3MFG A;  2Y5P A;  1HEZ E;  3AEA B;  5C2T B;  2NBW B;  4AJW A;  2BT6 A;  2OED A;  4N58 A;  1CMX B;  1PUT A;  1SXT A;  2V1Y A;  2DZK A;  2NS5 A;  4F7Z A;  2WHI A;  3E9S A;  2V0G A;  2JYT A;  2LVQ A;  4IM3 A;  2NPT B;  2VH1 A;  3ZNG C;  2LXC A;  3ZNH B;  5BYR A;  3M63 B;  3HHM A;  3URY A;  2G3Q B;  4CO7 A;  4HK2 A;  3A9K B;  4K3C A;  3RUI B;  5FKA C;  1WZ3 A;  2VZK D;  3P42 A;  2EKE C;  4EFO A;  1UWX A;  4FHJ A;  4UDU C;  1NYR A;  1WXM A;  4YSY B;  3TL5 A;  5IOI A;  1WYW B;  4LCD E;  4HDQ A;  4KX6 B;  1JWB D;  4ACF A;  3AH7 A;  5G55 A;  4F8C B;  4JLC A;  3ZRF A;  4RGN A;  1KRH A;  1S3S G;  1T5X D;  1OQY A;  4IWQ A;  3OG5 A;  5JHB A;  2KWV B;  1U4A A;  4K7S A;  2PW9 A;  4WAA A;  5L83 A;  2ZNV B;  2QCZ A;  3AE2 B;  4XE0 A;  2L83 A;  1YQ4 B;  2N9P C;  2ICI A;  2B3A A;  4ZRI A;  2K3U A;  2LAS A;  2XN9 C;  4FXC A;  4MEL A;  2N9L A;  5IA7 A;  1FEH A;  1XLP A;  1ZW7 A;  4LJP B;  4BKS D;  4GDK B;  4JWS C;  2PE6 B;  3RYT A;  2DEN B; 
#chains in the Genus database with same CATH homology
 4MH8 A;  3AE4 B;  4HRO A;  4TMA B;  4O1N A;  2W55 A;  1YN3 A;  2BS3 B;  2HTM E;  2IGD A;  4L2Y A;  1XO3 A;  5D3I B;  4TSS A;  4TQ1 A;  5BMH A;  3CWI A;  2JZP A;  3BYY B;  3P4S B;  3BII D;  3LB8 C;  1L5P A;  1L6V A;  2RMM A;  3O13 A;  1C9F A;  1TJE A;  1QQR A;  2J53 A;  2H89 B;  4OHJ A;  1TYG B;  3KWL A;  3RFZ B;  3P4Q B;  2HDE A;  1TS3 A;  3AE8 B;  4ZYS A;  2BS2 B;  1SE2 A;  2W54 A;  3E56 A;  2FBW B;  2WXH A;  3AM9 A;  4DXF A;  1SF0 A;  1C76 A;  5C3J B;  1K53 A;  1RM6 C;  1TS4 A;  4MM3 B;  4HKQ A;  3R8B A;  1PGX A;  1FXI A;  1V1P A;  1JWM D;  4A8X C;  3NVV A;  1QIL A;  3BVG A;  2MH7 A;  1HA5 A;  1XLO A;  3GB1 A;  1ROE A;  2E6X A;  1TKY A;  1GAQ B;  4US9 A;  3AV8 A;  3GS2 A;  1I7H A;  3I57 A;  3NVW A;  1F2R I;  1K51 A;  1KLU D;  1K50 A;  2FE8 A;  2G9H D;  4L1B A;  1UNS A;  1XXG A;  4WAF A;  4N59 A;  3TEX A;  1V1O A;  1YJJ A;  1ZDX A;  5FR3 A;  1Q10 A;  2Y3A A;  1QOA A;  2JX5 A;  4OZB A;  4WIP A;  3EUB 2;  4D2K A;  4C80 A;  3U7Z A;  2KWD A;  4OZC A;  1L0V B;  1IGC A;  4YSZ B;  1T3Q A;  5AUK A;  3AEE B;  3BK1 A;  4WUR A;  5G5G A;  4JX1 C;  2DWQ A;  3IT4 B;  2AQ2 B;  1YQ3 B;  1I4H A;  2QMT A;  4P16 A;  4IOI E;  3C8Y A;  2MJE A;  3W5U B;  1FCC C;  2RPV A;  4KGR A;  5GXG B;  4ZHP A;  1D5M C;  1QKZ A;  2J42 A;  3VRB B;  1ZUD 2;  1VZ7 A;  1QOF A;  4M0W A;  1KH0 A;  5EE1 A;  1IBX B;  1WWT A;  2QIE B;  2YEP F;  3AE9 B;  4ARC A;  3TEY A;  2J52 A;  2QSD A;  1PGA A;  1BUI C;  3NRZ A;  4RGO S;  3Q8C A;  1XLQ A;  3U4E G;  4HEA 1;  1J7C A;  2KMM A;  1IUE A;  5BYS A;  3ZQ4 A;  5BMG A;  2B76 B;  2WXK A;  1E7P B;  1YN5 A;  3WCQ A;  1STE A;  2CU3 A;  3AEC B;  3BVZ A;  3FAH A;  3H8H A;  3AEB B;  1BML C;  1WXQ A;  2WXQ A;  5HG2 A;  2EKI A;  2H88 B;  1ACC A;  4IDI A;  4OW0 A;  4L23 A;  2JWU A;  3SR6 A;  3Q8F A;  1TZO A;  1E10 A;  4RGM A;  3ETR A;  2EEL A;  1K52 A;  1L6U A;  2KAC A;  2V3N A;  1ET6 A;  4MAC A;  5BYQ A;  3NUH B;  1HZ5 A;  3Q8E A;  1AW7 A;  3W2D A;  2DYM A;  4USA A;  3NVY A;  3GP7 A;  4B0M A;  3DWG C;  2SEB D;  1XEE A;  1C79 A;  4C56 C;  2WXM A;  1TKE A;  1BXT A;  2WNM A;  3PZ8 A;  3VR8 B;  1CZP A;  4WQM A;  1F2R C;  4R3D A;  3P63 A;  4NJC A;  3HVZ A;  2BBC A;  4IKG A;  1CQV A;  4RH6 A;  1LO5 D;  2L1A A;  5H92 C;  1JCK B;  1V97 A;  2LEK A;  4EE2 A;  2BYT A;  3HRD D;  1P7F A;  2WDQ B;  3I9V 1;  1EWC A;  1N5X A;  5HFY A;  2W3S A;  2WDV B;  2IJ0 A;  3FIL B;  3IAM 1;  1D5Z C;  4HRS A;  2OHF A;  2PLP A;  4LLG M;  1GPX A;  1SEB D;  4ITK A;  4OVZ A;  4RCO A;  1I4X A;  1HXY D;  4ZOH C;  2K9X A;  4WWM A;  1RFK A;  3BK2 A;  2E3T A;  3W1S A;  4WH4 A;  1SE3 A;  1JWA D;  3AB5 A;  5EE3 A;  4YXD B;  1FM0 D;  1JRO A;  1E9M A;  3BYT B;  1YN4 A;  3LXF A;  4RNA A;  4PT5 A;  1DOX A;  1KF6 B;  1MHX A;  1SBB B;  2WXL A;  1WGK A;  2LJI A;  2PIA A;  1WRI A;  2DLB A;  2GB1 A;  4MT5 A;  3AE1 B;  2RDG A;  2TSS A;  1I4R A;  1JWU D;  2INN E;  2WU5 B;  1MVK A;  4J3O D;  1FXA A;  2K5P A;  3VR9 B;  1I4P A;  1F77 A;  1C78 A;  3TUO A;  2WXN A;  3AN1 A;  2N0S B;  2NMQ A;  5T8I A;  3T3O A;  3UI3 A;  1E0Z A;  3SEB A;  1C4C A;  2WP9 B;  3AEF B;  2I2Y A;  1D4B A;  3ABV B;  4N6E B;  1ZDV A;  3RPF C;  4YTN B;  2WXR A;  2RDH A;  1QOB A;  1I4Q A;  3U2S C;  3HUI A;  1GB1 A;  4NZL B;  1AN8 A;  2VZK B;  2WXI A;  2I38 A;  1HQR D;  1FIQ A;  5EE9 A;  2M19 A;  4CQN A;  3KLS X;  3BVM A;  2PVO D;  2LHE A;  3ZYY X;  1XCQ L;  4ZHO A;  1D6E C;  1L4D B;  1QT9 A;  1L0Y B;  1DOI A;  3TEZ A;  1DGJ A;  2BB6 A;  1JAL A;  1WSP A;  1FFV A;  1JRP A;  1PFD A;  1KFY B;  2WXF A;  1DYQ A;  1TS2 A;  4KGS A;  2W3R A;  4YSX B;  4ARI A;  3BZD B;  1XF5 L;  4A6Q A;  2L32 A;  2PKO A;  1V8C A;  3KWV A;  3KQ4 A;  3B9J A;  3NS1 A;  3Q8B A;  1FNW A;  1ZE3 D;  3MJ5 A;  3MP9 A;  3R2I A;  2DYO A;  1KTK A;  3T3N A;  1TKG A;  5HI1 A;  2IPK D;  2Z8L A;  1FNU A;  3V3X A;  2MJD A;  3FC4 A;  1P7E A;  1C4P A;  2WS3 B;  3AE6 B;  1ZXI A;  1SSN A;  4GDL B;  2WU2 B;  4RGT A;  2JQR B;  2WXO A;  2ZW0 A;  3U52 E;  3ZJV A;  2AQ1 B;  3ZJU A;  1FNV A;  2PTL A;  3ZJT A;  4GLS C;  2ACZ B;  1NEN B;  4RF0 A;  1EU4 A;  3B2G A;  1FRD A;  1NVI D;  3PO0 A;  1OQR A;  1N60 A;  3V05 A;  1VLB A;  1B1Z A;  1PYW D;  5AUI A;  4ZRQ A;  4US8 A;  1MPE A;  1SJE D;  2GI9 A;  1C77 A;  4JWU C;  1FO4 A;  2QJL A;  1ENF A;  1R7S A;  1FRR A;  4P6V F;  1N5W A;  3J9C A;  3CIR B;  1IBX A;  4REZ A;  2LHD A;  2K0P A;  1JW9 D;  4LK0 M;  3Q8A A;  3AMZ A;  1VR9 A;  1ESF A;  3Q69 A;  4HKZ E;  4RFB A;  1UGJ A;  2WXJ A;  3AED B;  1E6E B;  2ON8 A;  2KN4 A;  3IAS 1;  1GOZ A;  1A70 A;  1UUP A;  2LFI A;  4YTM B;  1QF6 A;  1AYF A;  1CK1 A;  1N63 A;  1QOG A;  1ZP0 B;  5H8Y E;  4XWT A;  1VDV A;  1T6B X;  1MHH E;  5G5H A;  2AQ3 B;  2IDY A;  3AEG B;  2LGI A;  3PZ7 A;  2WXG A;  3VQI A;  2ZW1 A;  4XDD A;  3EA6 A;  4KKI A;  1Y56 A;  2WLB A;  3AE3 B;  2K22 A;  3L4P A;  1SE4 A;  5E6J A;  4A9A A;  5I4D A;  1C4A A;  2KAJ A;  2N7J A;  2BTE A;  1SIJ A;  3NZ3 A;  3P4P B;  4KGT A;  1JWS D;  1HZ6 A;  1EWY C;  2D5G A;  1L4Z B;  3R2T A;  5JXV A;  2W82 A;  1N61 A;  2NTS A;  2MJ3 A;  1XLN A;  1VJK A;  1L0X B;  2V4I B;  1GB4 A;  1NI3 A;  4JE3 B;  4OZA A;  3MFG A;  2XNA C;  2Y5P A;  1HEZ E;  4C7Z A;  3AEA B;  1RYJ A;  2AX5 A;  4RF1 A;  5C2T B;  2V3P A;  2G1E A;  2JXT A;  4A55 A;  2BW2 A;  1ZPS A;  2QEJ C;  2BT6 A;  4C7Y A;  2IGH A;  1NEK B;  3W9C B;  2OED A;  2LUM A;  4H2A A;  1YMH E;  3MHZ A;  2PVG C;  4N58 A;  1PUT A;  1SXT A;  1YNT E;  4LTU A;  3NVZ A;  4YWG G;  3FIL A;  3E9S A;  2M0A A;  3MC0 B;  2V0G A;  2JYT A;  2BS4 B;  1PDX A;  2CJN A;  5BYR A;  1OQQ A;  5MPO A;  1N62 A;  4ZRP A;  2YEP B;  3URY A;  2IGG A;  5D7G A;  3VRA B;  1FFU A;  1FCL A;  3BWU D;  3SFD B;  4DXG A;  5FKA C;  5FK9 C;  4KKJ A;  2J4X A;  1OFF A;  2VZK D;  5TSS A;  2WDR B;  2KDM A;  3P42 A;  1UWM A;  3DWM A;  1DOY A;  1J7A A;  3P1M A;  3P4R B;  1UWX A;  2JYE A;  3TSS A;  4UDU C;  1NYR A;  2GRI A;  1SB3 C;  1VZ6 A;  1RWS A;  2ONQ A;  4YT0 B;  4NAW B;  4Q2J A;  2Y5C A;  4YSY B;  1SJH D;  3B2F A;  2WQY B;  2CJO A;  1WYG A;  3LYY A;  2SAK A;  1I4G A;  3IXS A;  2R61 A;  1ZXH A;  5HHD G;  4KX6 B;  3OWE B;  2Q5W D;  1TS5 A;  4XDC A;  1D5X C;  4A90 A;  1JWB D;  3AH7 A;  2JU6 X;  1EM7 A;  1MI0 A;  2L52 A;  1EU3 A;  1V1P B;  1J7B A;  4AQ7 A;  2JSV X;  4RGN A;  2LMC A;  2KQ4 X;  1KRH A;  1T5X D;  4XWW A;  4YTP B;  5LNK 1;  3AE7 B;  1VZ8 A;  1JQ4 A;  1CJE A;  1TY0 A;  2PMV A;  1M4V A;  4AS1 A;  3ZGZ A;  1B9R A;  2DBY A;  2PW9 A;  1IGD A;  4HJG E;  2BB5 A;  1ET9 A;  3AE2 B;  4XE0 A;  1KLG D;  2M56 B;  1VRA B;  2MEK A;  3AE5 B;  5EE0 A;  1TY2 A;  4DQO C;  2L83 A;  3SFE B;  3W5V B;  5BMI A;  1YQ4 B;  1ZOY B;  2ICI A;  3HVD A;  1FMA D;  1JML A;  3TEW A;  2K3U A;  2NTT A;  2QIL A;  2XN9 C;  4FXC A;  4NAM A;  2X38 A;  1NYQ A;  2INP E;  2N9L A;  1AWD A;  1FEH A;  1FD6 A;  2WXP A;  1PGB A;  1XLP A;  3N9Y C;  4B0E A;  3IT6 B;  3EGR A;  1F0Z A;  2FUG 1;  4GDK B;  1XCT L;  1YJI A;  4JWS C;  5D3D A;  4TQ0 A;  1QLB B;  2N9K A;  4JPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...