2MJ3A

Backbone 1h, 13c, and 15n chemical shift assignments and structure of iron-sulfur cluster binding protein from ehrlichia chaffeensis
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
116
structure length
116
Chain Sequence
MPLITFISPDGSRKTYEAYDGETLLSLAHRNNVDLEGACEGSLACSTCHVIIDPSWYDIVEQHNEISDEENDMLDLAFGLTDTSRLGCQIILTKELDGLCVILPTETRNISFVKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Iron-sulfur cluster binding protein
publication title Backbone 1H, 13C, and 15N Chemical Shift Assignments and structure of Iron-sulfur cluster binding protein from Ehrlichia chaffeensis
rcsb
source organism Ehrlichia chaffeensis
total genus 13
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2013-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2mj3A00
1VJKA 1SIJA 2BS4B 4YTPB 1DOXA 2K5PA 2E3TA 1FRDA 2L52A 5EE1A 1PUTA 4C7ZA 4YSZB 2W3SA 3AEFB 3P63A 3AV8A 2W54A 4USAA 3AE9B 2OHFA 3FC4A 1R7SA 2WDVB 2CU3A 3W5UB 1ROEA 3SR6A 1FFVA 3B2GA 3BIID 2BS3B 1RM6C 2H89B 1TYGB 1J7CA 2ACZB 3ETRA 2PIAA 1AYFA 2QIEB 4HROA 5G5HA 1WRIA 1GPXA 1DOYA 1N61A 4YSXB 1L5PA 1E10A 1KFYB 1AWDA 2EKIA 1FFUA 1NENB 1QOAA 1EWYC 3ZYYX 1UWMA 1ZUD2 2WP9B 2PVGC 1SF0A 2B76B 2K22A 3AB5A 4JX1C 4WQMA 5EE9A 4N59A 1E6EB 3ABVB 3AE4B 1TKEA 1ZP0B 4ZHOA 5MPOA 3W9CB 2MJEA 1IUEA 1XLPA 4KX6B 2Y5CA 1N60A 1TKYA 4ZHPA 1OQRA 1YQ4B 1NI3A 2N0SB 3P4QB 1JRPA 1NYQA 4IDIA 2MH7A 3NS1A 1CZPA 1QOFA 1E0ZA 1L6VA 1WWTA 3SFEB 1TJEA 3L4PA 5H8YE 2WQYB 4C7YA 1FXAA 2CJOA 4US8A 1SB3C 4FXCA 1T3QA 1FRRA 3AH7A 1VLBA 2WDQB 1JALA 1QOGA 3DWGC 4US9A 3AM9A 1J7BA 3AEAB 3WCQA 3NRZA 3AEEB 1YJIA 4YSYB 2DBYA 1PFDA 2FBWB 2AX5A 2MJDA 2JQRB 1ZOYB 3AE6B 2WU5B 2PKOA 3AEGB 5AUKA 3AEBB 3KWLA 3PO0A 1KF6B 3DWMA 1JWAD 1WYGA 1B9RA 1QT9A 1RFKA 2WLBA 2WS3B 3NVVA 3P4PB 2HTME 2WDRB 1RYJA 5G5GA 2BS2B 2Q5WD 3B9JA 2G1EA 1NYRA 3NVZA 4JWUC 1XLNA 4WWMA 3B2FA 1JROA 1TKGA 1XLQA 1FIQA 1JWBD 2M56B 1E9MA 2DWQA 3AE1B 3AECB 2JX5A 3SFDB 3EUB2 3CIRB 1DGJA 1FO4A 1L0VB 3VR9B 3RPFC 1F0ZA 3VRBB 3VRAB 3AE2B 1QOBA 3HRDD 1I7HA 4JWSC 3LB8C 1KRHA 3W5VB 1RWSA 1OQQA 1OFFA 1L6UA 3AE5B 4P6VF 3FAHA 5C2TB 2LEKA 4N58A 2K9XA 1N5XA 1YJJA 1XLOA 5C3JB 1ZXIA 2L83A 2W3RA 1QLBB 4YTNB 1J7AA 1NVID 1FMAD 2W55A 3AMZA 3NVWA 1FXIA 1PDXA 1V8CA 1N5WA 1E7PB 1FM0D 1YQ3B 3VR8B 1XO3A 4C80A 1JW9D 2MJ3A 2M19A 1N63A 1QF6A 3HUIA 1A70A 2QJLA 5AUIA 1GAQB 1NEKB 3AE8B 4LTUA 4A9AA 1DOIA 5EE0A 1CJEA 2H88B 2BT6A 2KAJA 3AE7B 3AEDB 4YT0B 5GXGB 4YXDB 3P4SB 4ITKA 2WU2B 4YTMB 3LXFA 3AE3B 3NVYA 3CWIA 3P1MA 1WXQA 3AN1A 1WGKA 2KMMA 1JQ4A 1VDVA 4HRSA 5EE3A 5H92C 2PVOD 1V97A 3HVZA 4N6EB 2CJNA 4ZOHC 1N62A 3P4RB
chains in the Genus database with same CATH superfamily
3U7DA 5DCNA 2IYDB 4FBJB 2LRWA 2W54A 2WDVB 2D3GA 4RNAA 2LWPA 5LXIB 4QAYA 1N61A 4YSXB 5BYSA 1NENB 3PRMB 3TMPB 3ECIA 2IO3B 1E8YA 4AP4C 4WQMA 4F8CB 3N9YC 3L10B 2M0XA 2KOXA 2B3AA 1SE2A 4A6QA 4IM2A 2IY0B 1ZE3D 1JRPA 3B0AA 1E5WA 2LGDA 2EMSA 5BYRA 2J7QB 2WXOA 2KX0A 1FXAA 4US8A 4W9FA 1UD7A 4GLSC 4MACA 5D2MB 4F1SA 1JCKB 2PPHA 2LGYA 3O13A 1XLNA 3PREA 3PTFC 3QIJA 4WAAA 1LGRA 4IW0A 5CTRC 3CIRB 4K1RB 4WJNA 5AZHA 2Z0EB 2WXPA 1TBEA 2J0KA 3R7QA 1YMHE 2KTFA 2DZJA 1OQQA 3FAHA 2LEKA 4F7ZA 2G45B 2KZRA 3M3JA 4HK2A 3EA6A 3I63C 2KKCA 2IGDA 3HK0A 2NS5A 3ONSA 1A70A 2KWUB 5AUIA 4BKSA 1TT5B 1P9DU 1YOVB 3AE3B 2WXKA 2AQ2B 2EMTA 1VDVA 1MG4A 4ZOHC 1I4PA 2K25A 4M01A 3MTNB 1KJTA 2IBIB 3RYTA 1L2NA 3UGBB 2V3PA 1KLGD 5HI1A 2RGFA 3TJPA 4L1BA 1R7SA 3Q3NC 4DQOC 2FUG1 2JZZA 2L05A 3PZ8A 5JH5C 2KFKA 2ACZB 3H7PB 2AEHA 1R4NI 5BMHA 1L4DB 1WGDA 3D32A 3DBSA 1T6BX 1WXAA 2JVCA 4GMVA 1E6EB 1YNTE 2LZ6A 2IO2B 1QOFA 1YIWA 2LXCA 4E74A 3ZNID 4B6WA 1SB3C 1MI0A 1I4XA 1ISNA 3WCQA 4CO7A 4MSMB 5IKCM 1I4GA 3I57A 2J4XA 3DWMA 4HWIB 1JWSD 5GMVA 4ZYSA 1WF9A 1GB4A 1KH0A 3AI5A 4M8MA 1XLQA 4ZRQA 3UQAA 2JSVX 5T8IA 3VRBB 3Q3MC 3W5VB 2AWTA 1OFFA 1TS4A 5C2TB 2C60A 3L13A 4A55A 2XK5B 2W55A 2V3NA 2MHJA 3TBLD 1E7PB 1UELA 3VR8B 4S0RA 2QJLA 2BKFA 4ICUA 3Q8AA 4E71A 1NEKB 3L0WB 5D7GA 5EE0A 4AJWA 3AEDB 1D3ZA 3Q8EA 1GC6A 2ON8A 3JSVB 2NCNA 3PLVA 3V60A 4ANXA 2PVOD 3HVZA 3IT4B 4LCDE 2L52A 1V86A 3KW5B 3P63A 2BKRB 1C1YB 1RAXA 3Q3FA 3OG5A 3DVNV 1QOAA 1JWUD 2DZMA 2Y3AA 2WP9B 1TKEA 2FNJB 3H9DA 2L0FA 1SE9A 3R8BA 3Q8BA 5AEKB 1YX5B 1KLUD 1PGAA 1WMHA 4GDLB 5L95C 4ANWA 2JWUA 2ZZPB 2WXLA 4C7YA 4KSLC 2DHZA 1FXTB 2CJOA 3VTUA 2ZVNA 1T3QA 4WJQA 1WM2A 1WM3A 3AM9A 4OW0A 1J7BA 2LJIA 2KACA 5D94A 3HM6X 1WJUA 3AE6B 4K81A 2PKOA 3AEGB 3UF8A 2LRUA 2WX1A 3NVVA 3PZ7A 2QMTA 3PT2B 1OEYA 3CSTA 4TSSA 1VD2A 1WIAA 4EKUA 4KZ0A 2MBBB 3AE2B 3HRDD 4NPNA 4G11A 2IGHA 2GMIC 1ESFA 3RNBC 2V0GA 2L76A 3AMZA 4LJPB 1V9JA 4A90A 5J18A 4HDQA 5D3IB 2M19A 2ZW1A 4GN1A 2JZ3B 3AE7B 2CU1A 2KJRA 2KLCA 4EE2A 2LHDA 1SXTA 1FRDA 3AEFB 2K0PA 1QZEA 2C7MB 4EZLA 2D07B 4CYEA 3IAS1 4E3CA 4OZAA 4K7UA 3BIID 1R4MB 1J7CA 1OQYA 5LNK1 5G5HA 2INPE 2ZEQA 2WXRA 2PVGC 1TGZB 1SF0A 1AARA 3OLMD 4EOYA 4HPPA 4XZ4A 3SEBA 1VZ6A 1F52A 3V62A 3JSVA 3VHTC 2PE9A 4YL8A 4R3DA 3NS1A 3SD5A 4DHJB 3DPDA 1PQSA 1JALA 5JHAA 2DAFA 2LJ5A 4OZBA 2AX5A 2MJDA 3A4SC 2WU5B 1GUAB 2FIFA 3AEBB 1C4AA 1B9RA 3B9JA 2BYEA 4ZYNA 2KANA 3SU8X 2REXA 2R2QA 1DGJA 2G3QB 1L0VB 1FO4A 2J52A 3AE5B 3LJ3A 4N58A 2JU6X 1KM7A 1JMLA 1FMAD 3APFA 4URKA 3W1SC 3AU4A 5E6NA 1XO3A 4LTUA 3WIMA 2ZW0A 2KDMA 3ZDTA 5DPRA 4YTMB 2O6VD 3RMKC 3P1MA 4IUMB 3URYA 1WXMA 1P3QU 1JQ4A 3ZNGC 4IG7B 2CJNA 3A4RA 4KIKB 4YTPB 2JWZA 3ENEA 4AWJA 1ET9A 2MCNB 2FCQA 2VRRB 4NJ7A 1TYGB 4PT5A 1C9FA 3L17A 1ZKHA 5IAAC 1WRIA 1YQBA 3FKYA 1S1QB 2K6DB 3ZYYX 2MBQA 2DYOA 4TMAB 2L00B 1TS3A 1T5XD 2N9XA 1D5MC 4JLCA 1E7UA 2N4FA 1FNVA 2MH7A 4KDLB 1Q10A 3VUYA 2JT4B 3HVDA 2NPTB 3VUWA 2N9LA 4CQNA 3P2BA 2WDQB 3DWGC 3VQIA 2I1JA 4DDID 4G3XB 2INNE 4J6IA 2N7DA 3MHZA 1WFYA 3JW0X 2QEJC 4RF1A 5J17A 4KGTA 5DPSA 2G1EA 4J3OD 1SJHD 4P1BC 1Y8RC 3B2FA 3C8YA 1FIQA 4WH4A 3I9V1 1I7HA 2IDYA 1I4HA 2NBWB 4WWPA 1MVKA 3ZNHB 1N5XA 2L83A 1HTQA 1QLBB 1HE8A 2K8BA 4K3BA 1WY8A 1FXIA 4TUUA 4A3PA 1N6ZA 3IHPC 1FNUA 1TIFA 2LGXA 1DOIA 2G4DB 1FEHA 2KVZA 2JXXA 4DBGA 1MG8A 3QJZA 4ZDVA 5C23A 2O2VB 5H92C 3GP7A 4WIPA 3ZVVA 3QC8B 4M8NA 1CMXB 1OGWA 2CU3A 1XEEA 4Q2JA 3R7RA 5FKAC 4X57B 4HROA 2Y5BB 3APDA 4EZJA 5EE9A 1HZ5A 1XLPA 1GB1A 3MHSD 3N1ZC 1TKYA 1VRAB 4KIKA 3B08A 4ASWC 3ZW3A 1V1PB 3U8ZA 4P1CC 4FXCA 1L0YB 3C19A 1FRRA 3OJ4B 3UINB 4BKGA 3NZ3A 3H1UA 2OJWA 4LDTD 4NJ6A 4YWGG 4HLEA 4M0WB 3W1SA 3IXSA 3U30A 2Z0DB 4MGKE 2DZKA 4KGRA 2Q5WD 1JRUA 2ZPNA 1XQQA 4OVUA 3AE1B 5HG2A 4S17A 2W82A 3EUB2 3ZKJC 3ZTDA 4BBNF 5JXVA 2A4ZA 3A33B 2OOBB 1XF5L 2KDIA 2NPTA 5G2NA 1R4NB 1N5WA 1E90A 2MJ3A 1C78A 2E6XA 2L32A 5GXGB 3PHWB 3CWIA 4HPLB 3QCAA 4N6EB 2O6VA 3P4RB 2HJ8A 4ZRJA 3DBLB 5IN7A 1PUTA 2W3SA 4MT5A 3RI7C 4DHZE 3AV8A 1MJDA 2LMCA 3UIOB 2SAKA 3ZDMC 1RM6C 2H89B 2NVUI 1GNUA 2L7RA 1EUVB 3EECA 3PS6A 1WMHB 1U4AA 3W9CB 2KMAA 5D6JB 1WX7A 5BO4B 4ZHPA 1XCQL 2O2VA 2ZCBA 2LI5A 2K1FA 1FNWA 4NZLB 4OHJA 2CR5A 2WQYB 1V2YA 2JXTA 2KDEB 1I4QA 4FLHA 2BB5A 2EKEC 3A9JB 2KWVB 4HKQA 4KZCA 1MFWA 2LHEA 3V6EB 4FA6A 2MA9B 2NMQA 5AUKA 2DNFA 2DYMA 3KLSX 3KWLA 1WZ3A 3DVGY 3Q2AC 2GBJA 3PLUA 5G5GA 3DOWA 4RGOS 2GBNA 3RNGC 4RGTA 4WWMA 1VR9A 3DBLI 1C77A 1E9MA 4HVBA 1J19A 1V5TA 5LLIA 4C00A 2JY6A 3LB8C 4BBNC 2C7HA 2GBMA 4GB9A 1YJJA 1XLOA 1I42A 3TEXA 1V1PA 2LGSA 4TV3A 4WQOB 2ZJDA 2KDBA 2MSED 2WX0A 3AE8B 2LD9A 2PE6B 2AQ1B 1YX6B 1M4VA 4M0WA 4PK1A 3AN1A 2LVPA 4NY0A 2GBKA 5DPWA 2ZPYA 2PTLA 3H7SA 2N7EA 3PHXB 1MHXA 4C7ZA 1K53A 1WGRA 2KTRB 2PLPA 2BBCA 2RPVA 1P1AA 2ZNVC 4FULA 5BYQA 4BAXA 3DHHC 3AU5A 1IP9A 1ZUD2 1NI2A 1I35A 4HXDA 3R3MA 4IWOA 1ZDXA 3AE4B 4A8XC 3RNCC 2M1MA 3QQ8B 1N60A 2HTHA 4WJPA 2KT7A 2A5UA 3CSFA 2BPSA 1NYQA 3ZJTA 2R2OA 1GOZA 1NBFC 3L4PA 2BQQA 4JIOU 3DVGX 3PRZA 4PS8A 4HKZE 1YN5A 2MRPA 2OJRA 2ZNVB 1GC7A 1IYFA 2FBWB 4A3OA 3J9CA 3CF6E 1H8CA 4ZRPA 1HA5A 1JWAD 2WLBA 3P4PB 3Q8FA 2CKHB 3NVZA 2KO3A 3DHIC 2M56B 2L1AA 3MC8A 2JX5A 1OTRB 3NOBA 5TR5A 1T0RC 2WXGA 2MBEA 4JPSA 4GDKB 3RPFC 4FJYA 1K8RB 4JWSC 4DXAB 1FCCC 3X23A 1UF0A 2IY1B 3V05A 2C7NB 4YTNB 3GE3C 3DVNU 3VUXA 3A9JA 4FADA 1LM8B 2NR2A 5FR6A 1WXSA 2KDFB 4JL9A 4ANVA 3M63B 4ARIA 1J8CA 3Q69A 1WGKA 1WYWB 1IGDA 1Q1OA 3WAMA 3VAWA 2BS4B 3V3XA 2YEPF 2KC1A 1V49A 1KOTA 3ML9A 1T0QC 3AE9B 4FHJA 4TQ0A 3UIPB 4I6NB 1CK1A 1P7FA 4MM3B 3ML8A 5FK9C 2UU7A 2LUEA 2Y5PA 4HCNB 1EWYC 4HEA1 1UWMA 4GIVA 1P0RA 1SJED 2RDGA 3MC9A 2K22A 2VZKD 2BW2A 4H2AA 4EFOA 2V9HA 5MPOA 3ZRCA 3Q6BA 1V1OA 2N0SB 4IDIA 2L8JA 3IT6B 5E6PA 4IM3A 1L6VA 3TL5A 2GI9A 3K9OB 4N9F4 2NTSA 2KTRA 1KTKA 3IG3A 3GZNI 2XNAC 1V80A 1YJ1A 5KHQA 3L16A 1PFDA 3ZO5B 4DXFA 4XC2A 2DX5B 2LVOA 2HJ1A 2KQSA 3FILA 3WAPA 3LDZE 4P7IA 2N9EB 2GB1A 4RGNA 2QHOA 4WWOA 2D3BA 1JROA 1JWBD 3AECB 1D4BA 2DWQA 5EDSA 3QHTA 1K50A 4MH8A 4TQ1A 4O1NA 3W2DA 4IWPA 4BKTA 3VDZA 3Q14C 3NZSA 2DENB 2WXFA 1TS5A 1YD8U 2FAZA 5JHBA 3DDCB 3V6CB 4A9AA 1CJEA 4LNFA 3B1LX 4YT0B 2J0MA 2V1YA 5E6OA 2AL3A 4GU2A 3WAOA 2INCC 2ICIA 1SIJA 2KXJA 4LNOA 1UBQA 4YSZB 1C4CA 4G50A 3ZJVA 3TSSA 2RDBC 3ZNZB 2J0JA 4GDKA 4EEWA 1CQVA 4NAWB 4KDIC 1FCLA 1WSPA 4BOZB 1AWDA 2K3UA 2MBOA 1SGHA 4WAFA 4N59A 4ZHOA 4MGIE 3I3TB 3JVZX 2M0AA 2VH1A 3VTVA 5H8YE 4RGMA 2IO0B 3ALBA 3T3NA 2LUMA 5AZGA 2YEPB 4MM3A 3AEEB 1LFDA 4UDUC 3RD2A 1LQBA 2BYVE 3PO0A 3SHQA 1UZXB 5HKHA 2EELA 4OVVA 1IBXB 3QK0A 1WR6E 2CHXA 3KUZA 2D2QA 4GOCA 3EC8A 4HRSA 4LNKA 3SFDB 3E9SA 3IBEA 2KC2A 4NNJB 3N1YC 4IC7B 2BB6A 3M95A 3ZXRA 4HCPB 1ZXIA 3BK1A 2GRIA 2BYTA 3RFZB 2KFJA 3R2IA 2JYTA 2IGGA 1GAQB 4L23A 2JPHA 2WXJA 2BT6A 2O6VB 1K51A 1F2RC 2D3CA 3P4SB 4YXDB 3IFWB 3LXFA 1P7EA 2DYBA 2JZPA 2LGIA 3KQ4A 5CHVC 5TSSA 2I2YA 3BZDB 3GS2A 1BT0A 5AZFA 4FJVB 5IO9A 1HZ6A 4ANUA 2JRIB 2WXIA 2FCNA 4GXBA 3NZUA 2NBUA 2OHFA 4PS3A 2MWSB 3ZXVA 2RDHA 3RUIB 1WH3A 3APCA 4W9IA 2KYWA 4FHKA 1DOYA 3KUDB 3DQVA 1L5PA 4MJSA 2AQ3B 3AB5A 3Q3JA 1B1ZA 3DBRB 1WZ0A 2MJEA 3KYCD 1ZW7A 4NAMA 1YQ4B 1NI3A 4RM8A 3SFEB 2D10A 2WXHA 4JGHB 4RM9A 3AXCA 1UBIA 3BY4B 5HFYA 2I1KA 4NAWA 4PYZA 2M4NA 4AS1A 4XGAB 2VH2A 3ZTCA 4BOSC 2WYQA 1EU3A 1UUPA 3DBHI 3RNFC 2MP2B 2FUHB 3HM3A 2KHWB 2XEWA 1WGHA 2IJ0A 2RD0A 1F0ZA 1L7YA 2IO1B 3KWVA 2V4LA 1L6UA 4TKNA 4W9EA 2JRHA 1YN3A 1NVID 1PDXA 4ZRKA 1FM0D 4C80A 2MBHA 1N63A 2MQJA 2QC8A 3A9KA 1GG3A 1MHHE 2KAJA 2FCSA 2WNMA 3N3KB 1F2RI 3DBRI 2WU2B 5JZEB 4XWWA 1NDDA 2QCZA 2QDFA 4PYUA 4IM0A 1IBXA 2BTEA 2JUOA 4HDOA 1TZ1A 1V97A 4AJYB 4P16A 1SEBD 4A20A 2K5PA 1OEYJ 3PVLA 2KVRA 5IA7A 1XT9B 3B2GA 3KVFB 2PIAA 4KVGB 1E10A 5HHDG 1A5RA 4ARCA 4JX1C 2PJHA 4W9LA 4W9CA 4MDKE 3ABVB 1SSNA 3WALA 4ACFA 4AUQC 3ZUNA 3VFKA 3VH3B 1BUIC 3P4QB 1UH6A 2I38A 3PGEA 3QA8A 2KNBA 1E7VA 3PV1A 1LXDA 2KWDA 1FPYA 3GB1A 5L83A 4LDTB 1WJ6A 3AEAB 2G4SA 3NRZA 3U52E 4LLGM 2BGFA 4KKJA 2PMVA 2DBYA 2WHIA 1XD3B 1KF6B 1VCBA 2WS3B 3K9PB 4JWUC 4DHZB 1WGGA 1TKGA 3HHMA 2GOWA 4DWFA 1V81A 1E8XA 3EHVA 2HE7A 3TIXA 4L2YA 1ZDVA 3TEZA 4DK5A 1RFAA 2OEDA 2M8SA 1J7AA 1F1HA 1Q5WB 3MFGA 1V8CA 1YQ3B 3TEWA 3HUIA 2BWES 3NJTA 2YVCA 1WE7A 3TCAA 3P42A 4NJCA 1FD6A 2CHWA 3A1QA 1BXTA 3NVYA 1WXQA 2MP2A 3WANA 3VXWA 2RSUA 1ACCA 5EE3A 1WRDB 2X38A 1QF6A 4MELA 4II3B 1VJKA 5IOIA 3VH4B 2K6QA 3W5UB 3V61A 1ROEA 4W9KA 4XX5A 1EU4A 2BS3B 3ETRA 3Q8CA 2IZVB 2NTTA 2UWQA 2K39A 1SIFA 3NHEB 4ICVA 3RT3B 5CX3A 4LNIA 1PYWD 4KGSA 3BVMA 1ZP0B 4AQ7A 1WJNA 1Z2MA 4XWTA 1WJ4A 2TSSA 2Z59B 3QWZB 3DCGA 2AL6A 2FCMA 3QARA 1SE3A 3GOEA 4MH0E 3L08A 3KUCB 5CHFA 3FILB 1HEZE 1YJIA 3N32A 2IPKD 3BYYB 1TY0A 3U7ZA 1JWMD 2J53A 2N9KA 3ZIMA 1WYGA 3MJ5A 1ZXHA 4IKGA 3U2SC 3RNEC 1QILA 2N9PC 2LFIA 4B9KA 2MEKA 4D2KA 2GLSA 1QOBA 3ZRFA 1KRHA 3NG0A 5G55A 2K9XA 3BVGA 4REZA 3MP9A 3NY5A 3KH0A 4KKIA 2DZIA 3N20C 3H6NA 3RZFA 3PZDA 3C0RB 3RN9C 4RMAA 2CS4A 4JE3B 2FE8A 4II2B 2KMMA 1UGMA 4HJGE 5BMIA 2NBVB 1F9JA 1ZGUB 1E8WA 1G6JA 2C9WB 1L0XB 1WGYA 4NQKE 3FC4A 3E56A 5DPTA 1FFVA 3GZNB 2SEBD 1DYQA 2KMCA 1VZ7A 4AOFA 1WI0A 1GPXA 4C4VB 4MSQB 1FFUA 1IGCA 1QKZA 4WWNA 2FIDA 4K7WA 2JF5A 3H7PA 5J2RA 3L54A 4B0EA 2HDEA 1EF5A 2KD0A 2R61A 1H4RA 3QAQA 3DHGC 1OQRA 3U4EG 1UWXA 2KQ4X 2KLGA 4LJOB 2RPQA 1XXGA 2L3ZA 3EFUA 2G9HD 2HD5B 3AH7A 1VLBA 4DHJD 1HQRD 2ONQA 4KSKC 2WXMA 1HTOA 3ZJUA 1TTNA 3VVWB 4YSYB 4MGZE 1Z5SB 3CMMB 2V4IB 1QQRA 1T0SC 3PPAA 2JYEA 1QT9A 2J42A 3JYUA 2ZVOA 4DDGD 2XBBC 2WDRB 1RYJA 4FN2A 4GGQA 3OAWA 3ZLZA 5LXHA 3I5JC 3ZGZA 2GBRA 2PW9A 3AULA 4B95A 3VRAB 2D5GA 2N1VA 3LYYA 1WX9A 1RWSA 1EWCA 4G0NB 4P6VF 3KYDD 3EFCA 3MC0B 1IPGA 2KX3A 3IAM1 1JW9D 1TS2A 2BF8B 3EGRA 2H88B 1SBBB 2XK5A 4ITKA 2QSDA 1I4RA 2WWZA 3RZWC 5IP4D 3R2TA 1N62A 3T8MA 2E3TA 5EE1A 2MW5A 2DAJA 2MX2A 4MJSB 3TUOA 1S3SG 2RR9A 2QIEB 2CHZA 4XDDA 3QX1A 2EKIA 1Y56A 2VZKB 1HXYD 4WJOA 2KQ7A 2B76B 4MGYE 4W9GA 3RCZA 3TEYA 3BVZA 3UQBA 1MPEA 3VTWA 2KWCA 1D5XC 1CZPA 1E0ZA 1K52A 3W1YA 2K8CA 4K7SA 1EO6A 4LNNA 1ZPSA 4CHKA 4BVUC 3X0WA 4GDLA 4XDCA 5D3DA 5I4DA 2MLBA 1VZ8A 1C79A 2WXNA 2XN9C 1R4MI 4W9DA 1D6EC 2D3AA 2WGSA 2X8XX 2JQRB 4KV2A 4C4VA 5C1ZA 1RFKA 1P98A 2LVQA 2HTME 1WR1A 2C5LC 2BS2B 1V6EA 4HPMB 2KN4A 4XE0A 3UI3A 3OWEB 4MEMA 4RF0A 3VR9B 4OVZA 2INDC 3A9KB 5C3JB 4BKSD 3ZQ4A 1PGXA 3SDLC 2DLBA 2BWFA 1TZOA 3PSEB 3T3OA 1BMLC 3BYTB 3HIZA 2WXQA 4W9JA 1L4ZB 2BYFA 4GSWA 5BMGA 4XYCA 4I6PA 2KJ6A 2ZCCA 1STEA 1EF1A 1DOXA 1AW7A 3BWUD 1SE4A 3Q3OC 2K8HA 4IOIE 4USAA 4BZAA 4ZRIA 4FJZA 3SR6A 4B0MA 1C3TA 3N1XC 2KN5A 1AN8A 1AYFA 1C4PA 2UYZB 4C56C 1E8ZA 3WA0A 1KFYB 4I6LB 3DBHB 1J0GA 3O65B 1WE6A 4EUTA 3RULA 3S2AA 1C76A 2ASQA 3IVFA 1ET6A 1YN4A 4LK0M 1IUEA 4KX6B 2RMMA 4RH6A 4K3CA 2Y5CA 4BFRA 1UNSA 2N7JA 3GE8C 2QILA 3NUHB 4WURA 2Z8LA 1WWTA 1Q0WB 1TJEA 4RFBA 4M02A 1GJZA 4US9A 1QOGA 3R66C 1M94A 1XCTL 1LO5D 1D5ZC 2D11A 3T9LA 2LASA 2W9NA 1ZOYB 3MJWA 1RRBA 3NS8A 4M00A 2L0TA 1ENFA 1T0YA 4PS7A 2BVCA 3BINA 1NYRA 2V3SA 1WX8A 3RNAC 3BK2A 3PRPB 4JQWC 4DXGA 5KHOA 2M17A 1TY2A 2WDTB 1X1MA 1EM7A 1V5OA 4OZCA 2N1WA 4W9HA 2KFKB 2LXAA 3N30A 2W3RA 2PEAA 3NVWA 3A1QB 4IWQA 1WXVA 4RCOA 3H8HA 1F77A 1UGJA 1PGBA 2AYOB 4NQLB 3OJ3A 1RLFA 5CHWA 3M62B 5E6JA 5FR3A 2KJHB 1KLVA 2KK8A 2YLMA 4EZKA 4HJKA
chains in the Genus database with same CATH topology
1VJKA 2BS4B 4YTPB 2YEPF 3V3XA 2W54A 3AE9B 1ET9A 4TQ0A 2WDVB 3W5UB 1ROEA 1CK1A 1EU4A 1P7FA 2BS3B 4MM3B 4RNAA 1TYGB 4PT5A 5FK9C 3ETRA 3Q8CA 1C9FA 2NTTA 1WRIA 2Y5PA 1N61A 4YSXB 5BYSA 1NENB 1EWYC 4HEA1 3ZYYX 1UWMA 1SJED 2RDGA 4WQMA 2K22A 2VZKD 1PYWD 2BW2A 3BVMA 2DYOA 3N9YC 4H2AA 4KGSA 1ZP0B 5MPOA 4TMAB 4AQ7A 4XWTA 1TS3A 1T5XD 1D5MC 1V1OA 1SE2A 2TSSA 4A6QA 2N0SB 1ZE3D 1JRPA 4IDIA 1FNVA 2MH7A 1Q10A 3IT6B 1SE3A 1L6VA 5BYRA 3HVDA 2GI9A 2WXOA 1FXAA 4US8A 2N9LA 2NTSA 4CQNA 2WDQB 3DWGC 3VQIA 3FILB 1KTKA 1HEZE 2XNAC 1YJIA 2INNE 2IPKD 3BYYB 3MHZA 1PFDA 1TY0A 1JWMD 2J53A 3U7ZA 4DXFA 2N9KA 2QEJC 4GLSC 4RF1A 3FILA 4MACA 1WYGA 3MJ5A 1JCKB 1ZXHA 4IKGA 4KGTA 3U2SC 2G1EA 2GB1A 4J3OD 3O13A 1SJHD 1XLNA 4RGNA 3B2FA 1JROA 3C8YA 1FIQA 1JWBD 3AECB 2DWQA 4WH4A 1D4BA 1QILA 3CIRB 3I9V1 2LFIA 2MEKA 4D2KA 1K50A 2WXPA 4MH8A 1QOBA 1I7HA 1YMHE 2IDYA 4O1NA 4TQ1A 1KRHA 3W2DA 1I4HA 1OQQA 3FAHA 1MVKA 2LEKA 2K9XA 1N5XA 3BVGA 2L83A 3EA6A 4REZA 1QLBB 3MP9A 2IGDA 1FXIA 4KKIA 2WXFA 1TS5A 1A70A 5AUIA 1FNUA 4A9AA 1DOIA 1FEHA 1CJEA 4YT0B 3AE3B 4JE3B 2FE8A 2WXKA 2AQ2B 2KMMA 1VDVA 5H92C 2ICIA 1I4PA 3GP7A 4HJGE 4ZOHC 5BMIA 1SIJA 4YSZB 1C4CA 2V3PA 1KLGD 4WIPA 5HI1A 3ZJVA 1L0XB 4L1BA 3TSSA 3FC4A 1CQVA 1R7SA 3E56A 2CU3A 1XEEA 4DQOC 2FUG1 1FFVA 4NAWB 4Q2JA 2SEBD 3PZ8A 2ACZB 5FKAC 1DYQA 1FCLA 1VZ7A 1WSPA 4HROA 1GPXA 5BMHA 1AWDA 1L4DB 1FFUA 1IGCA 1QKZA 1T6BX 2K3UA 4WAFA 5EE9A 4N59A 1E6EB 4ZHOA 4B0EA 1HZ5A 1YNTE 1XLPA 2HDEA 1GB1A 2R61A 1TKYA 1OQRA 3U4EG 1VRAB 1UWXA 2KQ4X 2M0AA 1QOFA 1XXGA 2G9HD 4RGMA 5H8YE 3T3NA 2LUMA 1V1PB 1SB3C 4FXCA 1L0YB 1FRRA 2YEPB 1VLBA 1MI0A 1HQRD 1I4XA 2ONQA 3AH7A 3NZ3A 2WXMA 3WCQA 3AEEB 3ZJUA 4YSYB 1I4GA 2V4IB 4UDUC 4YWGG 1QQRA 3I57A 3W1SA 2J4XA 3DWMA 3PO0A 2JYEA 3IXSA 2EELA 1JWSD 1QT9A 2J42A 1IBXB 4KGRA 4ZYSA 2WDRB 1RYJA 2Q5WD 1GB4A 1KH0A 4HRSA 1XLQA 3AE1B 5HG2A 3SFDB 4ZRQA 3E9SA 2JSVX 2W82A 3EUB2 3ZGZA 5T8IA 2PW9A 5JXVA 2BB6A 3VRBB 3VRAB 2D5GA 3LYYA 3W5VB 1RWSA 1EWCA 1OFFA 4P6VF 1TS4A 5C2TB 1XF5L 4A55A 1ZXIA 3BK1A 2W55A 3MC0B 2V3NA 2GRIA 2BYTA 3RFZB 1N5WA 1E7PB 3R2IA 3IAM1 3VR8B 2JYTA 1JW9D 2MJ3A 1TS2A 1C78A 2QJLA 2IGGA 1GAQB 1NEKB 2E6XA 3EGRA 2L32A 3Q8AA 4L23A 2WXJA 5D7GA 2H88B 3AEDB 2BT6A 5EE0A 1K51A 1F2RC 1SBBB 5GXGB 4YXDB 3P4SB 4ITKA 2QSDA 3LXFA 1I4RA 2ON8A 3CWIA 1P7EA 3Q8EA 2JZPA 2LGIA 3KQ4A 3R2TA 5TSSA 2I2YA 3BZDB 2PVOD 3HVZA 4N6EB 3GS2A 1N62A 3P4RB 3IT4B 2E3TA 1HZ6A 5EE1A 2L52A 1PUTA 2W3SA 4MT5A 2WXIA 3P63A 3AV8A 2OHFA 2LMCA 2SAKA 3TUOA 1RM6C 2H89B 2RDHA 2QIEB 4XDDA 1DOYA 1L5PA 2EKIA 1QOAA 1Y56A 1JWUD 2VZKB 2Y3AA 2WP9B 1HXYD 2AQ3B 2B76B 3AB5A 1TKEA 1B1ZA 3W9CB 3TEYA 3R8BA 2MJEA 3BVZA 3Q8BA 4ZHPA 4NAMA 1KLUD 1PGAA 1MPEA 1NI3A 1YQ4B 1XCQL 4GDLB 1D5XC 1CZPA 1FNWA 1E0ZA 1K52A 4NZLB 4OHJA 3SFEB 2JWUA 2WXLA 2WQYB 1ZPSA 2WXHA 4C7YA 2JXTA 2CJOA 1I4QA 2BB5A 1T3QA 4XDCA 5D3DA 5I4DA 5HFYA 4HKQA 1VZ8A 1C79A 1J7BA 2WXNA 3AM9A 2XN9C 4OW0A 2LJIA 2KACA 2LHEA 1D6EC 4AS1A 2NMQA 2JQRB 3AE6B 2PKOA 3AEGB 5AUKA 1EU3A 1UUPA 2DYMA 3KLSX 3KWLA 1RFKA 3NVVA 2HTME 3PZ7A 5G5GA 4RGOS 2BS2B 2QMTA 4RGTA 4TSSA 2IJ0A 4WWMA 2KN4A 1VR9A 1C77A 1E9MA 4XE0A 3UI3A 3OWEB 4RF0A 3VR9B 1F0ZA 4OVZA 3AE2B 3HRDD 2IGHA 3LB8C 3KWVA 1L6UA 1YJJA 1ESFA 1XLOA 1YN3A 2V0GA 5C3JB 3TEXA 1V1PA 3ZQ4A 1PGXA 1NVID 2DLBA 3AMZA 1TZOA 1PDXA 1FM0D 3T3OA 4A90A 4C80A 5D3IB 2M19A 1N63A 1BMLC 3AE8B 2ZW1A 1MHHE 3BYTB 2KAJA 2WNMA 3AE7B 1F2RI 2AQ1B 2WXQA 2WU2B 4XWWA 1M4VA 1L4ZB 4M0WA 3AN1A 1IBXA 2BTEA 4EE2A 5BMGA 1V97A 2LHDA 2PTLA 4P16A 1SEBD 1STEA 1DOXA 1AW7A 1SXTA 1MHXA 1FRDA 1SE4A 2K5PA 3BWUD 4C7ZA 1K53A 3AEFB 2K0PA 4IOIE 4USAA 2PLPA 3IAS1 2BBCA 2RPVA 4OZAA 3B2GA 3SR6A 3BIID 4B0MA 1J7CA 5BYQA 2PIAA 1AN8A 1AYFA 1C4PA 5LNK1 5G5HA 4C56C 2INPE 1E10A 1KFYB 2WXRA 5HHDG 1ZUD2 2PVGC 4ARCA 1SF0A 1C76A 4JX1C 1ZDXA 3AE4B 3ABVB 4A8XC 1SSNA 3SEBA 1ET6A 1YN4A 4LK0M 1VZ6A 1IUEA 4KX6B 2RMMA 4RH6A 2Y5CA 1N60A 1BUIC 3P4QB 1NYQA 4R3DA 1UNSA 3NS1A 2I38A 3ZJTA 2N7JA 3NUHB 2QILA 4WURA 2Z8LA 1GOZA 1WWTA 1TJEA 3L4PA 4RFBA 2KWDA 3GB1A 4HKZE 1JALA 1QOGA 1YN5A 4US9A 1XCTL 3AEAB 1LO5D 1D5ZC 3NRZA 3U52E 4LLGM 4KKJA 2PMVA 2DBYA 2FBWB 4OZBA 2AX5A 2MJDA 3J9CA 1ZOYB 2WU5B 4ZRPA 1HA5A 3AEBB 1KF6B 1C4AA 1ENFA 1JWAD 1B9RA 2WLBA 2WS3B 3P4PB 3B9JA 3Q8FA 1NYRA 3NVZA 4JWUC 3BK2A 1TKGA 2M56B 2L1AA 4DXGA 2JX5A 1DGJA 2WXGA 1L0VB 4JPSA 1FO4A 4GDKB 3RPFC 2J52A 4L2YA 1TY2A 1ZDVA 4JWSC 1EM7A 4OZCA 1FCCC 3TEZA 3AE5B 4N58A 2JU6X 2OEDA 2W3RA 3V05A 4YTNB 1JMLA 1J7AA 3NVWA 1FMAD 3MFGA 1V8CA 1YQ3B 3TEWA 1XO3A 4RCOA 3H8HA 3HUIA 1F77A 4LTUA 1UGJA 1PGBA 2ZW0A 3P42A 4NJCA 2KDMA 4ARIA 1FD6A 1BXTA 4YTMB 3Q69A 3NVYA 3P1MA 1WXQA 5E6JA 3URYA 1WGKA 1JQ4A 1IGDA 1ACCA 5FR3A 5EE3A 2CJNA 2X38A 1QF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VJK A;  1SIJ A;  2BS4 B;  4YTP B;  1DOX A;  2K5P A;  2E3T A;  1FRD A;  2L52 A;  5EE1 A;  1PUT A;  4C7Z A;  4YSZ B;  2W3S A;  3AEF B;  3P63 A;  3AV8 A;  2W54 A;  4USA A;  3AE9 B;  2OHF A;  3FC4 A;  1R7S A;  2WDV B;  2CU3 A;  3W5U B;  1ROE A;  3SR6 A;  1FFV A;  3B2G A;  3BII D;  2BS3 B;  1RM6 C;  2H89 B;  1TYG B;  1J7C A;  2ACZ B;  3ETR A;  2PIA A;  1AYF A;  2QIE B;  4HRO A;  5G5H A;  1WRI A;  1GPX A;  1DOY A;  1N61 A;  4YSX B;  1L5P A;  1E10 A;  1KFY B;  1AWD A;  2EKI A;  1FFU A;  1NEN B;  1QOA A;  1EWY C;  3ZYY X;  1UWM A;  1ZUD 2;  2WP9 B;  2PVG C;  1SF0 A;  2B76 B;  2K22 A;  3AB5 A;  4JX1 C;  4WQM A;  5EE9 A;  4N59 A;  1E6E B;  3ABV B;  3AE4 B;  1TKE A;  1ZP0 B;  4ZHO A;  5MPO A;  3W9C B;  2MJE A;  1IUE A;  1XLP A;  4KX6 B;  2Y5C A;  1N60 A;  1TKY A;  4ZHP A;  1OQR A;  1YQ4 B;  1NI3 A;  2N0S B;  3P4Q B;  1JRP A;  1NYQ A;  4IDI A;  2MH7 A;  3NS1 A;  1CZP A;  1QOF A;  1E0Z A;  1L6V A;  1WWT A;  3SFE B;  1TJE A;  3L4P A;  5H8Y E;  2WQY B;  4C7Y A;  1FXA A;  2CJO A;  4US8 A;  1SB3 C;  4FXC A;  1T3Q A;  1FRR A;  3AH7 A;  1VLB A;  2WDQ B;  1JAL A;  1QOG A;  3DWG C;  4US9 A;  3AM9 A;  1J7B A;  3AEA B;  3WCQ A;  3NRZ A;  3AEE B;  1YJI A;  4YSY B;  2DBY A;  1PFD A;  2FBW B;  2AX5 A;  2MJD A;  2JQR B;  1ZOY B;  3AE6 B;  2WU5 B;  2PKO A;  3AEG B;  5AUK A;  3AEB B;  3KWL A;  3PO0 A;  1KF6 B;  3DWM A;  1JWA D;  1WYG A;  1B9R A;  1QT9 A;  1RFK A;  2WLB A;  2WS3 B;  3NVV A;  3P4P B;  2HTM E;  2WDR B;  1RYJ A;  5G5G A;  2BS2 B;  2Q5W D;  3B9J A;  2G1E A;  1NYR A;  3NVZ A;  4JWU C;  1XLN A;  4WWM A;  3B2F A;  1JRO A;  1TKG A;  1XLQ A;  1FIQ A;  1JWB D;  2M56 B;  1E9M A;  2DWQ A;  3AE1 B;  3AEC B;  2JX5 A;  3SFD B;  3EUB 2;  3CIR B;  1DGJ A;  1FO4 A;  1L0V B;  3VR9 B;  3RPF C;  1F0Z A;  3VRB B;  3VRA B;  3AE2 B;  1QOB A;  3HRD D;  1I7H A;  4JWS C;  3LB8 C;  1KRH A;  3W5V B;  1RWS A;  1OQQ A;  1OFF A;  1L6U A;  3AE5 B;  4P6V F;  3FAH A;  5C2T B;  2LEK A;  4N58 A;  2K9X A;  1N5X A;  1YJJ A;  1XLO A;  5C3J B;  1ZXI A;  2L83 A;  2W3R A;  1QLB B;  4YTN B;  1J7A A;  1NVI D;  1FMA D;  2W55 A;  3AMZ A;  3NVW A;  1FXI A;  1PDX A;  1V8C A;  1N5W A;  1E7P B;  1FM0 D;  1YQ3 B;  3VR8 B;  1XO3 A;  4C80 A;  1JW9 D;  2MJ3 A;  2M19 A;  1N63 A;  1QF6 A;  3HUI A;  1A70 A;  2QJL A;  5AUI A;  1GAQ B;  1NEK B;  3AE8 B;  4LTU A;  4A9A A;  1DOI A;  5EE0 A;  1CJE A;  2H88 B;  2BT6 A;  2KAJ A;  3AE7 B;  3AED B;  4YT0 B;  5GXG B;  4YXD B;  3P4S B;  4ITK A;  2WU2 B;  4YTM B;  3LXF A;  3AE3 B;  3NVY A;  3CWI A;  3P1M A;  1WXQ A;  3AN1 A;  1WGK A;  2KMM A;  1JQ4 A;  1VDV A;  4HRS A;  5EE3 A;  5H92 C;  2PVO D;  1V97 A;  3HVZ A;  4N6E B;  2CJN A;  4ZOH C;  1N62 A;  3P4R B; 
#chains in the Genus database with same CATH topology
 3U7D A;  5DCN A;  2IYD B;  4FBJ B;  2LRW A;  2W54 A;  2WDV B;  2D3G A;  4RNA A;  2LWP A;  5LXI B;  4QAY A;  1N61 A;  4YSX B;  5BYS A;  1NEN B;  3PRM B;  3TMP B;  3ECI A;  2IO3 B;  1E8Y A;  4AP4 C;  4WQM A;  4F8C B;  3N9Y C;  3L10 B;  2M0X A;  2KOX A;  2B3A A;  1SE2 A;  4A6Q A;  4IM2 A;  2IY0 B;  1ZE3 D;  1JRP A;  3B0A A;  1E5W A;  2LGD A;  2EMS A;  5BYR A;  2J7Q B;  2WXO A;  2KX0 A;  1FXA A;  4US8 A;  4W9F A;  1UD7 A;  4GLS C;  4MAC A;  5D2M B;  4F1S A;  1JCK B;  2PPH A;  2LGY A;  3O13 A;  1XLN A;  3PRE A;  3PTF C;  3QIJ A;  4WAA A;  1LGR A;  4IW0 A;  5CTR C;  3CIR B;  4K1R B;  4WJN A;  5AZH A;  2Z0E B;  2WXP A;  1TBE A;  2J0K A;  3R7Q A;  1YMH E;  2KTF A;  2DZJ A;  1OQQ A;  3FAH A;  2LEK A;  4F7Z A;  2G45 B;  2KZR A;  3M3J A;  4HK2 A;  3EA6 A;  3I63 C;  2KKC A;  2IGD A;  3HK0 A;  2NS5 A;  3ONS A;  1A70 A;  2KWU B;  5AUI A;  4BKS A;  1TT5 B;  1P9D U;  1YOV B;  3AE3 B;  2WXK A;  2AQ2 B;  2EMT A;  1VDV A;  1MG4 A;  4ZOH C;  1I4P A;  2K25 A;  4M01 A;  3MTN B;  1KJT A;  2IBI B;  3RYT A;  1L2N A;  3UGB B;  2V3P A;  1KLG D;  5HI1 A;  2RGF A;  3TJP A;  4L1B A;  1R7S A;  3Q3N C;  4DQO C;  2FUG 1;  2JZZ A;  2L05 A;  3PZ8 A;  5JH5 C;  2KFK A;  2ACZ B;  3H7P B;  2AEH A;  1R4N I;  5BMH A;  1L4D B;  1WGD A;  3D32 A;  3DBS A;  1T6B X;  1WXA A;  2JVC A;  4GMV A;  1E6E B;  1YNT E;  2LZ6 A;  2IO2 B;  1QOF A;  1YIW A;  2LXC A;  4E74 A;  3ZNI D;  4B6W A;  1SB3 C;  1MI0 A;  1I4X A;  1ISN A;  3WCQ A;  4CO7 A;  4MSM B;  5IKC M;  1I4G A;  3I57 A;  2J4X A;  3DWM A;  4HWI B;  1JWS D;  5GMV A;  4ZYS A;  1WF9 A;  1GB4 A;  1KH0 A;  3AI5 A;  4M8M A;  1XLQ A;  4ZRQ A;  3UQA A;  2JSV X;  5T8I A;  3VRB B;  3Q3M C;  3W5V B;  2AWT A;  1OFF A;  1TS4 A;  5C2T B;  2C60 A;  3L13 A;  4A55 A;  2XK5 B;  2W55 A;  2V3N A;  2MHJ A;  3TBL D;  1E7P B;  1UEL A;  3VR8 B;  4S0R A;  2QJL A;  2BKF A;  4ICU A;  3Q8A A;  4E71 A;  1NEK B;  3L0W B;  5D7G A;  5EE0 A;  4AJW A;  3AED B;  1D3Z A;  3Q8E A;  1GC6 A;  2ON8 A;  3JSV B;  2NCN A;  3PLV A;  3V60 A;  4ANX A;  2PVO D;  3HVZ A;  3IT4 B;  4LCD E;  2L52 A;  1V86 A;  3KW5 B;  3P63 A;  2BKR B;  1C1Y B;  1RAX A;  3Q3F A;  3OG5 A;  3DVN V;  1QOA A;  1JWU D;  2DZM A;  2Y3A A;  2WP9 B;  1TKE A;  2FNJ B;  3H9D A;  2L0F A;  1SE9 A;  3R8B A;  3Q8B A;  5AEK B;  1YX5 B;  1KLU D;  1PGA A;  1WMH A;  4GDL B;  5L95 C;  4ANW A;  2JWU A;  2ZZP B;  2WXL A;  4C7Y A;  4KSL C;  2DHZ A;  1FXT B;  2CJO A;  3VTU A;  2ZVN A;  1T3Q A;  4WJQ A;  1WM2 A;  1WM3 A;  3AM9 A;  4OW0 A;  1J7B A;  2LJI A;  2KAC A;  5D94 A;  3HM6 X;  1WJU A;  3AE6 B;  4K81 A;  2PKO A;  3AEG B;  3UF8 A;  2LRU A;  2WX1 A;  3NVV A;  3PZ7 A;  2QMT A;  3PT2 B;  1OEY A;  3CST A;  4TSS A;  1VD2 A;  1WIA A;  4EKU A;  4KZ0 A;  2MBB B;  3AE2 B;  3HRD D;  4NPN A;  4G11 A;  2IGH A;  2GMI C;  1ESF A;  3RNB C;  2V0G A;  2L76 A;  3AMZ A;  4LJP B;  1V9J A;  4A90 A;  5J18 A;  4HDQ A;  5D3I B;  2M19 A;  2ZW1 A;  4GN1 A;  2JZ3 B;  3AE7 B;  2CU1 A;  2KJR A;  2KLC A;  4EE2 A;  2LHD A;  1SXT A;  1FRD A;  3AEF B;  2K0P A;  1QZE A;  2C7M B;  4EZL A;  2D07 B;  4CYE A;  3IAS 1;  4E3C A;  4OZA A;  4K7U A;  3BII D;  1R4M B;  1J7C A;  1OQY A;  5LNK 1;  5G5H A;  2INP E;  2ZEQ A;  2WXR A;  2PVG C;  1TGZ B;  1SF0 A;  1AAR A;  3OLM D;  4EOY A;  4HPP A;  4XZ4 A;  3SEB A;  1VZ6 A;  1F52 A;  3V62 A;  3JSV A;  3VHT C;  2PE9 A;  4YL8 A;  4R3D A;  3NS1 A;  3SD5 A;  4DHJ B;  3DPD A;  1PQS A;  1JAL A;  5JHA A;  2DAF A;  2LJ5 A;  4OZB A;  2AX5 A;  2MJD A;  3A4S C;  2WU5 B;  1GUA B;  2FIF A;  3AEB B;  1C4A A;  1B9R A;  3B9J A;  2BYE A;  4ZYN A;  2KAN A;  3SU8 X;  2REX A;  2R2Q A;  1DGJ A;  2G3Q B;  1L0V B;  1FO4 A;  2J52 A;  3AE5 B;  3LJ3 A;  4N58 A;  2JU6 X;  1KM7 A;  1JML A;  1FMA D;  3APF A;  4URK A;  3W1S C;  3AU4 A;  5E6N A;  1XO3 A;  4LTU A;  3WIM A;  2ZW0 A;  2KDM A;  3ZDT A;  5DPR A;  4YTM B;  2O6V D;  3RMK C;  3P1M A;  4IUM B;  3URY A;  1WXM A;  1P3Q U;  1JQ4 A;  3ZNG C;  4IG7 B;  2CJN A;  3A4R A;  4KIK B;  4YTP B;  2JWZ A;  3ENE A;  4AWJ A;  1ET9 A;  2MCN B;  2FCQ A;  2VRR B;  4NJ7 A;  1TYG B;  4PT5 A;  1C9F A;  3L17 A;  1ZKH A;  5IAA C;  1WRI A;  1YQB A;  3FKY A;  1S1Q B;  2K6D B;  3ZYY X;  2MBQ A;  2DYO A;  4TMA B;  2L00 B;  1TS3 A;  1T5X D;  2N9X A;  1D5M C;  4JLC A;  1E7U A;  2N4F A;  1FNV A;  2MH7 A;  4KDL B;  1Q10 A;  3VUY A;  2JT4 B;  3HVD A;  2NPT B;  3VUW A;  2N9L A;  4CQN A;  3P2B A;  2WDQ B;  3DWG C;  3VQI A;  2I1J A;  4DDI D;  4G3X B;  2INN E;  4J6I A;  2N7D A;  3MHZ A;  1WFY A;  3JW0 X;  2QEJ C;  4RF1 A;  5J17 A;  4KGT A;  5DPS A;  2G1E A;  4J3O D;  1SJH D;  4P1B C;  1Y8R C;  3B2F A;  3C8Y A;  1FIQ A;  4WH4 A;  3I9V 1;  1I7H A;  2IDY A;  1I4H A;  2NBW B;  4WWP A;  1MVK A;  3ZNH B;  1N5X A;  2L83 A;  1HTQ A;  1QLB B;  1HE8 A;  2K8B A;  4K3B A;  1WY8 A;  1FXI A;  4TUU A;  4A3P A;  1N6Z A;  3IHP C;  1FNU A;  1TIF A;  2LGX A;  1DOI A;  2G4D B;  1FEH A;  2KVZ A;  2JXX A;  4DBG A;  1MG8 A;  3QJZ A;  4ZDV A;  5C23 A;  2O2V B;  5H92 C;  3GP7 A;  4WIP A;  3ZVV A;  3QC8 B;  4M8N A;  1CMX B;  1OGW A;  2CU3 A;  1XEE A;  4Q2J A;  3R7R A;  5FKA C;  4X57 B;  4HRO A;  2Y5B B;  3APD A;  4EZJ A;  5EE9 A;  1HZ5 A;  1XLP A;  1GB1 A;  3MHS D;  3N1Z C;  1TKY A;  1VRA B;  4KIK A;  3B08 A;  4ASW C;  3ZW3 A;  1V1P B;  3U8Z A;  4P1C C;  4FXC A;  1L0Y B;  3C19 A;  1FRR A;  3OJ4 B;  3UIN B;  4BKG A;  3NZ3 A;  3H1U A;  2OJW A;  4LDT D;  4NJ6 A;  4YWG G;  4HLE A;  4M0W B;  3W1S A;  3IXS A;  3U30 A;  2Z0D B;  4MGK E;  2DZK A;  4KGR A;  2Q5W D;  1JRU A;  2ZPN A;  1XQQ A;  4OVU A;  3AE1 B;  5HG2 A;  4S17 A;  2W82 A;  3EUB 2;  3ZKJ C;  3ZTD A;  4BBN F;  5JXV A;  2A4Z A;  3A33 B;  2OOB B;  1XF5 L;  2KDI A;  2NPT A;  5G2N A;  1R4N B;  1N5W A;  1E90 A;  2MJ3 A;  1C78 A;  2E6X A;  2L32 A;  5GXG B;  3PHW B;  3CWI A;  4HPL B;  3QCA A;  4N6E B;  2O6V A;  3P4R B;  2HJ8 A;  4ZRJ A;  3DBL B;  5IN7 A;  1PUT A;  2W3S A;  4MT5 A;  3RI7 C;  4DHZ E;  3AV8 A;  1MJD A;  2LMC A;  3UIO B;  2SAK A;  3ZDM C;  1RM6 C;  2H89 B;  2NVU I;  1GNU A;  2L7R A;  1EUV B;  3EEC A;  3PS6 A;  1WMH B;  1U4A A;  3W9C B;  2KMA A;  5D6J B;  1WX7 A;  5BO4 B;  4ZHP A;  1XCQ L;  2O2V A;  2ZCB A;  2LI5 A;  2K1F A;  1FNW A;  4NZL B;  4OHJ A;  2CR5 A;  2WQY B;  1V2Y A;  2JXT A;  2KDE B;  1I4Q A;  4FLH A;  2BB5 A;  2EKE C;  3A9J B;  2KWV B;  4HKQ A;  4KZC A;  1MFW A;  2LHE A;  3V6E B;  4FA6 A;  2MA9 B;  2NMQ A;  5AUK A;  2DNF A;  2DYM A;  3KLS X;  3KWL A;  1WZ3 A;  3DVG Y;  3Q2A C;  2GBJ A;  3PLU A;  5G5G A;  3DOW A;  4RGO S;  2GBN A;  3RNG C;  4RGT A;  4WWM A;  1VR9 A;  3DBL I;  1C77 A;  1E9M A;  4HVB A;  1J19 A;  1V5T A;  5LLI A;  4C00 A;  2JY6 A;  3LB8 C;  4BBN C;  2C7H A;  2GBM A;  4GB9 A;  1YJJ A;  1XLO A;  1I42 A;  3TEX A;  1V1P A;  2LGS A;  4TV3 A;  4WQO B;  2ZJD A;  2KDB A;  2MSE D;  2WX0 A;  3AE8 B;  2LD9 A;  2PE6 B;  2AQ1 B;  1YX6 B;  1M4V A;  4M0W A;  4PK1 A;  3AN1 A;  2LVP A;  4NY0 A;  2GBK A;  5DPW A;  2ZPY A;  2PTL A;  3H7S A;  2N7E A;  3PHX B;  1MHX A;  4C7Z A;  1K53 A;  1WGR A;  2KTR B;  2PLP A;  2BBC A;  2RPV A;  1P1A A;  2ZNV C;  4FUL A;  5BYQ A;  4BAX A;  3DHH C;  3AU5 A;  1IP9 A;  1ZUD 2;  1NI2 A;  1I35 A;  4HXD A;  3R3M A;  4IWO A;  1ZDX A;  3AE4 B;  4A8X C;  3RNC C;  2M1M A;  3QQ8 B;  1N60 A;  2HTH A;  4WJP A;  2KT7 A;  2A5U A;  3CSF A;  2BPS A;  1NYQ A;  3ZJT A;  2R2O A;  1GOZ A;  1NBF C;  3L4P A;  2BQQ A;  4JIO U;  3DVG X;  3PRZ A;  4PS8 A;  4HKZ E;  1YN5 A;  2MRP A;  2OJR A;  2ZNV B;  1GC7 A;  1IYF A;  2FBW B;  4A3O A;  3J9C A;  3CF6 E;  1H8C A;  4ZRP A;  1HA5 A;  1JWA D;  2WLB A;  3P4P B;  3Q8F A;  2CKH B;  3NVZ A;  2KO3 A;  3DHI C;  2M56 B;  2L1A A;  3MC8 A;  2JX5 A;  1OTR B;  3NOB A;  5TR5 A;  1T0R C;  2WXG A;  2MBE A;  4JPS A;  4GDK B;  3RPF C;  4FJY A;  1K8R B;  4JWS C;  4DXA B;  1FCC C;  3X23 A;  1UF0 A;  2IY1 B;  3V05 A;  2C7N B;  4YTN B;  3GE3 C;  3DVN U;  3VUX A;  3A9J A;  4FAD A;  1LM8 B;  2NR2 A;  5FR6 A;  1WXS A;  2KDF B;  4JL9 A;  4ANV A;  3M63 B;  4ARI A;  1J8C A;  3Q69 A;  1WGK A;  1WYW B;  1IGD A;  1Q1O A;  3WAM A;  3VAW A;  2BS4 B;  3V3X A;  2YEP F;  2KC1 A;  1V49 A;  1KOT A;  3ML9 A;  1T0Q C;  3AE9 B;  4FHJ A;  4TQ0 A;  3UIP B;  4I6N B;  1CK1 A;  1P7F A;  4MM3 B;  3ML8 A;  5FK9 C;  2UU7 A;  2LUE A;  2Y5P A;  4HCN B;  1EWY C;  4HEA 1;  1UWM A;  4GIV A;  1P0R A;  1SJE D;  2RDG A;  3MC9 A;  2K22 A;  2VZK D;  2BW2 A;  4H2A A;  4EFO A;  2V9H A;  5MPO A;  3ZRC A;  3Q6B A;  1V1O A;  2N0S B;  4IDI A;  2L8J A;  3IT6 B;  5E6P A;  4IM3 A;  1L6V A;  3TL5 A;  2GI9 A;  3K9O B;  4N9F 4;  2NTS A;  2KTR A;  1KTK A;  3IG3 A;  3GZN I;  2XNA C;  1V80 A;  1YJ1 A;  5KHQ A;  3L16 A;  1PFD A;  3ZO5 B;  4DXF A;  4XC2 A;  2DX5 B;  2LVO A;  2HJ1 A;  2KQS A;  3FIL A;  3WAP A;  3LDZ E;  4P7I A;  2N9E B;  2GB1 A;  4RGN A;  2QHO A;  4WWO A;  2D3B A;  1JRO A;  1JWB D;  3AEC B;  1D4B A;  2DWQ A;  5EDS A;  3QHT A;  1K50 A;  4MH8 A;  4TQ1 A;  4O1N A;  3W2D A;  4IWP A;  4BKT A;  3VDZ A;  3Q14 C;  3NZS A;  2DEN B;  2WXF A;  1TS5 A;  1YD8 U;  2FAZ A;  5JHB A;  3DDC B;  3V6C B;  4A9A A;  1CJE A;  4LNF A;  3B1L X;  4YT0 B;  2J0M A;  2V1Y A;  5E6O A;  2AL3 A;  4GU2 A;  3WAO A;  2INC C;  2ICI A;  1SIJ A;  2KXJ A;  4LNO A;  1UBQ A;  4YSZ B;  1C4C A;  4G50 A;  3ZJV A;  3TSS A;  2RDB C;  3ZNZ B;  2J0J A;  4GDK A;  4EEW A;  1CQV A;  4NAW B;  4KDI C;  1FCL A;  1WSP A;  4BOZ B;  1AWD A;  2K3U A;  2MBO A;  1SGH A;  4WAF A;  4N59 A;  4ZHO A;  4MGI E;  3I3T B;  3JVZ X;  2M0A A;  2VH1 A;  3VTV A;  5H8Y E;  4RGM A;  2IO0 B;  3ALB A;  3T3N A;  2LUM A;  5AZG A;  2YEP B;  4MM3 A;  3AEE B;  1LFD A;  4UDU C;  3RD2 A;  1LQB A;  2BYV E;  3PO0 A;  3SHQ A;  1UZX B;  5HKH A;  2EEL A;  4OVV A;  1IBX B;  3QK0 A;  1WR6 E;  2CHX A;  3KUZ A;  2D2Q A;  4GOC A;  3EC8 A;  4HRS A;  4LNK A;  3SFD B;  3E9S A;  3IBE A;  2KC2 A;  4NNJ B;  3N1Y C;  4IC7 B;  2BB6 A;  3M95 A;  3ZXR A;  4HCP B;  1ZXI A;  3BK1 A;  2GRI A;  2BYT A;  3RFZ B;  2KFJ A;  3R2I A;  2JYT A;  2IGG A;  1GAQ B;  4L23 A;  2JPH A;  2WXJ A;  2BT6 A;  2O6V B;  1K51 A;  1F2R C;  2D3C A;  3P4S B;  4YXD B;  3IFW B;  3LXF A;  1P7E A;  2DYB A;  2JZP A;  2LGI A;  3KQ4 A;  5CHV C;  5TSS A;  2I2Y A;  3BZD B;  3GS2 A;  1BT0 A;  5AZF A;  4FJV B;  5IO9 A;  1HZ6 A;  4ANU A;  2JRI B;  2WXI A;  2FCN A;  4GXB A;  3NZU A;  2NBU A;  2OHF A;  4PS3 A;  2MWS B;  3ZXV A;  2RDH A;  3RUI B;  1WH3 A;  3APC A;  4W9I A;  2KYW A;  4FHK A;  1DOY A;  3KUD B;  3DQV A;  1L5P A;  4MJS A;  2AQ3 B;  3AB5 A;  3Q3J A;  1B1Z A;  3DBR B;  1WZ0 A;  2MJE A;  3KYC D;  1ZW7 A;  4NAM A;  1YQ4 B;  1NI3 A;  4RM8 A;  3SFE B;  2D10 A;  2WXH A;  4JGH B;  4RM9 A;  3AXC A;  1UBI A;  3BY4 B;  5HFY A;  2I1K A;  4NAW A;  4PYZ A;  2M4N A;  4AS1 A;  4XGA B;  2VH2 A;  3ZTC A;  4BOS C;  2WYQ A;  1EU3 A;  1UUP A;  3DBH I;  3RNF C;  2MP2 B;  2FUH B;  3HM3 A;  2KHW B;  2XEW A;  1WGH A;  2IJ0 A;  2RD0 A;  1F0Z A;  1L7Y A;  2IO1 B;  3KWV A;  2V4L A;  1L6U A;  4TKN A;  4W9E A;  2JRH A;  1YN3 A;  1NVI D;  1PDX A;  4ZRK A;  1FM0 D;  4C80 A;  2MBH A;  1N63 A;  2MQJ A;  2QC8 A;  3A9K A;  1GG3 A;  1MHH E;  2KAJ A;  2FCS A;  2WNM A;  3N3K B;  1F2R I;  3DBR I;  2WU2 B;  5JZE B;  4XWW A;  1NDD A;  2QCZ A;  2QDF A;  4PYU A;  4IM0 A;  1IBX A;  2BTE A;  2JUO A;  4HDO A;  1TZ1 A;  1V97 A;  4AJY B;  4P16 A;  1SEB D;  4A20 A;  2K5P A;  1OEY J;  3PVL A;  2KVR A;  5IA7 A;  1XT9 B;  3B2G A;  3KVF B;  2PIA A;  4KVG B;  1E10 A;  5HHD G;  1A5R A;  4ARC A;  4JX1 C;  2PJH A;  4W9L A;  4W9C A;  4MDK E;  3ABV B;  1SSN A;  3WAL A;  4ACF A;  4AUQ C;  3ZUN A;  3VFK A;  3VH3 B;  1BUI C;  3P4Q B;  1UH6 A;  2I38 A;  3PGE A;  3QA8 A;  2KNB A;  1E7V A;  3PV1 A;  1LXD A;  2KWD A;  1FPY A;  3GB1 A;  5L83 A;  4LDT B;  1WJ6 A;  3AEA B;  2G4S A;  3NRZ A;  3U52 E;  4LLG M;  2BGF A;  4KKJ A;  2PMV A;  2DBY A;  2WHI A;  1XD3 B;  1KF6 B;  1VCB A;  2WS3 B;  3K9P B;  4JWU C;  4DHZ B;  1WGG A;  1TKG A;  3HHM A;  2GOW A;  4DWF A;  1V81 A;  1E8X A;  3EHV A;  2HE7 A;  3TIX A;  4L2Y A;  1ZDV A;  3TEZ A;  4DK5 A;  1RFA A;  2OED A;  2M8S A;  1J7A A;  1F1H A;  1Q5W B;  3MFG A;  1V8C A;  1YQ3 B;  3TEW A;  3HUI A;  2BWE S;  3NJT A;  2YVC A;  1WE7 A;  3TCA A;  3P42 A;  4NJC A;  1FD6 A;  2CHW A;  3A1Q A;  1BXT A;  3NVY A;  1WXQ A;  2MP2 A;  3WAN A;  3VXW A;  2RSU A;  1ACC A;  5EE3 A;  1WRD B;  2X38 A;  1QF6 A;  4MEL A;  4II3 B;  1VJK A;  5IOI A;  3VH4 B;  2K6Q A;  3W5U B;  3V61 A;  1ROE A;  4W9K A;  4XX5 A;  1EU4 A;  2BS3 B;  3ETR A;  3Q8C A;  2IZV B;  2NTT A;  2UWQ A;  2K39 A;  1SIF A;  3NHE B;  4ICV A;  3RT3 B;  5CX3 A;  4LNI A;  1PYW D;  4KGS A;  3BVM A;  1ZP0 B;  4AQ7 A;  1WJN A;  1Z2M A;  4XWT A;  1WJ4 A;  2TSS A;  2Z59 B;  3QWZ B;  3DCG A;  2AL6 A;  2FCM A;  3QAR A;  1SE3 A;  3GOE A;  4MH0 E;  3L08 A;  3KUC B;  5CHF A;  3FIL B;  1HEZ E;  1YJI A;  3N32 A;  2IPK D;  3BYY B;  1TY0 A;  3U7Z A;  1JWM D;  2J53 A;  2N9K A;  3ZIM A;  1WYG A;  3MJ5 A;  1ZXH A;  4IKG A;  3U2S C;  3RNE C;  1QIL A;  2N9P C;  2LFI A;  4B9K A;  2MEK A;  4D2K A;  2GLS A;  1QOB A;  3ZRF A;  1KRH A;  3NG0 A;  5G55 A;  2K9X A;  3BVG A;  4REZ A;  3MP9 A;  3NY5 A;  3KH0 A;  4KKI A;  2DZI A;  3N20 C;  3H6N A;  3RZF A;  3PZD A;  3C0R B;  3RN9 C;  4RMA A;  2CS4 A;  4JE3 B;  2FE8 A;  4II2 B;  2KMM A;  1UGM A;  4HJG E;  5BMI A;  2NBV B;  1F9J A;  1ZGU B;  1E8W A;  1G6J A;  2C9W B;  1L0X B;  1WGY A;  4NQK E;  3FC4 A;  3E56 A;  5DPT A;  1FFV A;  3GZN B;  2SEB D;  1DYQ A;  2KMC A;  1VZ7 A;  4AOF A;  1WI0 A;  1GPX A;  4C4V B;  4MSQ B;  1FFU A;  1IGC A;  1QKZ A;  4WWN A;  2FID A;  4K7W A;  2JF5 A;  3H7P A;  5J2R A;  3L54 A;  4B0E A;  2HDE A;  1EF5 A;  2KD0 A;  2R61 A;  1H4R A;  3QAQ A;  3DHG C;  1OQR A;  3U4E G;  1UWX A;  2KQ4 X;  2KLG A;  4LJO B;  2RPQ A;  1XXG A;  2L3Z A;  3EFU A;  2G9H D;  2HD5 B;  3AH7 A;  1VLB A;  4DHJ D;  1HQR D;  2ONQ A;  4KSK C;  2WXM A;  1HTO A;  3ZJU A;  1TTN A;  3VVW B;  4YSY B;  4MGZ E;  1Z5S B;  3CMM B;  2V4I B;  1QQR A;  1T0S C;  3PPA A;  2JYE A;  1QT9 A;  2J42 A;  3JYU A;  2ZVO A;  4DDG D;  2XBB C;  2WDR B;  1RYJ A;  4FN2 A;  4GGQ A;  3OAW A;  3ZLZ A;  5LXH A;  3I5J C;  3ZGZ A;  2GBR A;  2PW9 A;  3AUL A;  4B95 A;  3VRA B;  2D5G A;  2N1V A;  3LYY A;  1WX9 A;  1RWS A;  1EWC A;  4G0N B;  4P6V F;  3KYD D;  3EFC A;  3MC0 B;  1IPG A;  2KX3 A;  3IAM 1;  1JW9 D;  1TS2 A;  2BF8 B;  3EGR A;  2H88 B;  1SBB B;  2XK5 A;  4ITK A;  2QSD A;  1I4R A;  2WWZ A;  3RZW C;  5IP4 D;  3R2T A;  1N62 A;  3T8M A;  2E3T A;  5EE1 A;  2MW5 A;  2DAJ A;  2MX2 A;  4MJS B;  3TUO A;  1S3S G;  2RR9 A;  2QIE B;  2CHZ A;  4XDD A;  3QX1 A;  2EKI A;  1Y56 A;  2VZK B;  1HXY D;  4WJO A;  2KQ7 A;  2B76 B;  4MGY E;  4W9G A;  3RCZ A;  3TEY A;  3BVZ A;  3UQB A;  1MPE A;  3VTW A;  2KWC A;  1D5X C;  1CZP A;  1E0Z A;  1K52 A;  3W1Y A;  2K8C A;  4K7S A;  1EO6 A;  4LNN A;  1ZPS A;  4CHK A;  4BVU C;  3X0W A;  4GDL A;  4XDC A;  5D3D A;  5I4D A;  2MLB A;  1VZ8 A;  1C79 A;  2WXN A;  2XN9 C;  1R4M I;  4W9D A;  1D6E C;  2D3A A;  2WGS A;  2X8X X;  2JQR B;  4KV2 A;  4C4V A;  5C1Z A;  1RFK A;  1P98 A;  2LVQ A;  2HTM E;  1WR1 A;  2C5L C;  2BS2 B;  1V6E A;  4HPM B;  2KN4 A;  4XE0 A;  3UI3 A;  3OWE B;  4MEM A;  4RF0 A;  3VR9 B;  4OVZ A;  2IND C;  3A9K B;  5C3J B;  4BKS D;  3ZQ4 A;  1PGX A;  3SDL C;  2DLB A;  2BWF A;  1TZO A;  3PSE B;  3T3O A;  1BML C;  3BYT B;  3HIZ A;  2WXQ A;  4W9J A;  1L4Z B;  2BYF A;  4GSW A;  5BMG A;  4XYC A;  4I6P A;  2KJ6 A;  2ZCC A;  1STE A;  1EF1 A;  1DOX A;  1AW7 A;  3BWU D;  1SE4 A;  3Q3O C;  2K8H A;  4IOI E;  4USA A;  4BZA A;  4ZRI A;  4FJZ A;  3SR6 A;  4B0M A;  1C3T A;  3N1X C;  2KN5 A;  1AN8 A;  1AYF A;  1C4P A;  2UYZ B;  4C56 C;  1E8Z A;  3WA0 A;  1KFY B;  4I6L B;  3DBH B;  1J0G A;  3O65 B;  1WE6 A;  4EUT A;  3RUL A;  3S2A A;  1C76 A;  2ASQ A;  3IVF A;  1ET6 A;  1YN4 A;  4LK0 M;  1IUE A;  4KX6 B;  2RMM A;  4RH6 A;  4K3C A;  2Y5C A;  4BFR A;  1UNS A;  2N7J A;  3GE8 C;  2QIL A;  3NUH B;  4WUR A;  2Z8L A;  1WWT A;  1Q0W B;  1TJE A;  4RFB A;  4M02 A;  1GJZ A;  4US9 A;  1QOG A;  3R66 C;  1M94 A;  1XCT L;  1LO5 D;  1D5Z C;  2D11 A;  3T9L A;  2LAS A;  2W9N A;  1ZOY B;  3MJW A;  1RRB A;  3NS8 A;  4M00 A;  2L0T A;  1ENF A;  1T0Y A;  4PS7 A;  2BVC A;  3BIN A;  1NYR A;  2V3S A;  1WX8 A;  3RNA C;  3BK2 A;  3PRP B;  4JQW C;  4DXG A;  5KHO A;  2M17 A;  1TY2 A;  2WDT B;  1X1M A;  1EM7 A;  1V5O A;  4OZC A;  2N1W A;  4W9H A;  2KFK B;  2LXA A;  3N30 A;  2W3R A;  2PEA A;  3NVW A;  3A1Q B;  4IWQ A;  1WXV A;  4RCO A;  3H8H A;  1F77 A;  1UGJ A;  1PGB A;  2AYO B;  4NQL B;  3OJ3 A;  1RLF A;  5CHW A;  3M62 B;  5E6J A;  5FR3 A;  2KJH B;  1KLV A;  2KK8 A;  2YLM A;  4EZK A;  4HJK A; 
#chains in the Genus database with same CATH homology
 1VJK A;  2BS4 B;  4YTP B;  2YEP F;  3V3X A;  2W54 A;  3AE9 B;  1ET9 A;  4TQ0 A;  2WDV B;  3W5U B;  1ROE A;  1CK1 A;  1EU4 A;  1P7F A;  2BS3 B;  4MM3 B;  4RNA A;  1TYG B;  4PT5 A;  5FK9 C;  3ETR A;  3Q8C A;  1C9F A;  2NTT A;  1WRI A;  2Y5P A;  1N61 A;  4YSX B;  5BYS A;  1NEN B;  1EWY C;  4HEA 1;  3ZYY X;  1UWM A;  1SJE D;  2RDG A;  4WQM A;  2K22 A;  2VZK D;  1PYW D;  2BW2 A;  3BVM A;  2DYO A;  3N9Y C;  4H2A A;  4KGS A;  1ZP0 B;  5MPO A;  4TMA B;  4AQ7 A;  4XWT A;  1TS3 A;  1T5X D;  1D5M C;  1V1O A;  1SE2 A;  2TSS A;  4A6Q A;  2N0S B;  1ZE3 D;  1JRP A;  4IDI A;  1FNV A;  2MH7 A;  1Q10 A;  3IT6 B;  1SE3 A;  1L6V A;  5BYR A;  3HVD A;  2GI9 A;  2WXO A;  1FXA A;  4US8 A;  2N9L A;  2NTS A;  4CQN A;  2WDQ B;  3DWG C;  3VQI A;  3FIL B;  1KTK A;  1HEZ E;  2XNA C;  1YJI A;  2INN E;  2IPK D;  3BYY B;  3MHZ A;  1PFD A;  1TY0 A;  1JWM D;  2J53 A;  3U7Z A;  4DXF A;  2N9K A;  2QEJ C;  4GLS C;  4RF1 A;  3FIL A;  4MAC A;  1WYG A;  3MJ5 A;  1JCK B;  1ZXH A;  4IKG A;  4KGT A;  3U2S C;  2G1E A;  2GB1 A;  4J3O D;  3O13 A;  1SJH D;  1XLN A;  4RGN A;  3B2F A;  1JRO A;  3C8Y A;  1FIQ A;  1JWB D;  3AEC B;  2DWQ A;  4WH4 A;  1D4B A;  1QIL A;  3CIR B;  3I9V 1;  2LFI A;  2MEK A;  4D2K A;  1K50 A;  2WXP A;  4MH8 A;  1QOB A;  1I7H A;  1YMH E;  2IDY A;  4O1N A;  4TQ1 A;  1KRH A;  3W2D A;  1I4H A;  1OQQ A;  3FAH A;  1MVK A;  2LEK A;  2K9X A;  1N5X A;  3BVG A;  2L83 A;  3EA6 A;  4REZ A;  1QLB B;  3MP9 A;  2IGD A;  1FXI A;  4KKI A;  2WXF A;  1TS5 A;  1A70 A;  5AUI A;  1FNU A;  4A9A A;  1DOI A;  1FEH A;  1CJE A;  4YT0 B;  3AE3 B;  4JE3 B;  2FE8 A;  2WXK A;  2AQ2 B;  2KMM A;  1VDV A;  5H92 C;  2ICI A;  1I4P A;  3GP7 A;  4HJG E;  4ZOH C;  5BMI A;  1SIJ A;  4YSZ B;  1C4C A;  2V3P A;  1KLG D;  4WIP A;  5HI1 A;  3ZJV A;  1L0X B;  4L1B A;  3TSS A;  3FC4 A;  1CQV A;  1R7S A;  3E56 A;  2CU3 A;  1XEE A;  4DQO C;  2FUG 1;  1FFV A;  4NAW B;  4Q2J A;  2SEB D;  3PZ8 A;  2ACZ B;  5FKA C;  1DYQ A;  1FCL A;  1VZ7 A;  1WSP A;  4HRO A;  1GPX A;  5BMH A;  1AWD A;  1L4D B;  1FFU A;  1IGC A;  1QKZ A;  1T6B X;  2K3U A;  4WAF A;  5EE9 A;  4N59 A;  1E6E B;  4ZHO A;  4B0E A;  1HZ5 A;  1YNT E;  1XLP A;  2HDE A;  1GB1 A;  2R61 A;  1TKY A;  1OQR A;  3U4E G;  1VRA B;  1UWX A;  2KQ4 X;  2M0A A;  1QOF A;  1XXG A;  2G9H D;  4RGM A;  5H8Y E;  3T3N A;  2LUM A;  1V1P B;  1SB3 C;  4FXC A;  1L0Y B;  1FRR A;  2YEP B;  1VLB A;  1MI0 A;  1HQR D;  1I4X A;  2ONQ A;  3AH7 A;  3NZ3 A;  2WXM A;  3WCQ A;  3AEE B;  3ZJU A;  4YSY B;  1I4G A;  2V4I B;  4UDU C;  4YWG G;  1QQR A;  3I57 A;  3W1S A;  2J4X A;  3DWM A;  3PO0 A;  2JYE A;  3IXS A;  2EEL A;  1JWS D;  1QT9 A;  2J42 A;  1IBX B;  4KGR A;  4ZYS A;  2WDR B;  1RYJ A;  2Q5W D;  1GB4 A;  1KH0 A;  4HRS A;  1XLQ A;  3AE1 B;  5HG2 A;  3SFD B;  4ZRQ A;  3E9S A;  2JSV X;  2W82 A;  3EUB 2;  3ZGZ A;  5T8I A;  2PW9 A;  5JXV A;  2BB6 A;  3VRB B;  3VRA B;  2D5G A;  3LYY A;  3W5V B;  1RWS A;  1EWC A;  1OFF A;  4P6V F;  1TS4 A;  5C2T B;  1XF5 L;  4A55 A;  1ZXI A;  3BK1 A;  2W55 A;  3MC0 B;  2V3N A;  2GRI A;  2BYT A;  3RFZ B;  1N5W A;  1E7P B;  3R2I A;  3IAM 1;  3VR8 B;  2JYT A;  1JW9 D;  2MJ3 A;  1TS2 A;  1C78 A;  2QJL A;  2IGG A;  1GAQ B;  1NEK B;  2E6X A;  3EGR A;  2L32 A;  3Q8A A;  4L23 A;  2WXJ A;  5D7G A;  2H88 B;  3AED B;  2BT6 A;  5EE0 A;  1K51 A;  1F2R C;  1SBB B;  5GXG B;  4YXD B;  3P4S B;  4ITK A;  2QSD A;  3LXF A;  1I4R A;  2ON8 A;  3CWI A;  1P7E A;  3Q8E A;  2JZP A;  2LGI A;  3KQ4 A;  3R2T A;  5TSS A;  2I2Y A;  3BZD B;  2PVO D;  3HVZ A;  4N6E B;  3GS2 A;  1N62 A;  3P4R B;  3IT4 B;  2E3T A;  1HZ6 A;  5EE1 A;  2L52 A;  1PUT A;  2W3S A;  4MT5 A;  2WXI A;  3P63 A;  3AV8 A;  2OHF A;  2LMC A;  2SAK A;  3TUO A;  1RM6 C;  2H89 B;  2RDH A;  2QIE B;  4XDD A;  1DOY A;  1L5P A;  2EKI A;  1QOA A;  1Y56 A;  1JWU D;  2VZK B;  2Y3A A;  2WP9 B;  1HXY D;  2AQ3 B;  2B76 B;  3AB5 A;  1TKE A;  1B1Z A;  3W9C B;  3TEY A;  3R8B A;  2MJE A;  3BVZ A;  3Q8B A;  4ZHP A;  4NAM A;  1KLU D;  1PGA A;  1MPE A;  1NI3 A;  1YQ4 B;  1XCQ L;  4GDL B;  1D5X C;  1CZP A;  1FNW A;  1E0Z A;  1K52 A;  4NZL B;  4OHJ A;  3SFE B;  2JWU A;  2WXL A;  2WQY B;  1ZPS A;  2WXH A;  4C7Y A;  2JXT A;  2CJO A;  1I4Q A;  2BB5 A;  1T3Q A;  4XDC A;  5D3D A;  5I4D A;  5HFY A;  4HKQ A;  1VZ8 A;  1C79 A;  1J7B A;  2WXN A;  3AM9 A;  2XN9 C;  4OW0 A;  2LJI A;  2KAC A;  2LHE A;  1D6E C;  4AS1 A;  2NMQ A;  2JQR B;  3AE6 B;  2PKO A;  3AEG B;  5AUK A;  1EU3 A;  1UUP A;  2DYM A;  3KLS X;  3KWL A;  1RFK A;  3NVV A;  2HTM E;  3PZ7 A;  5G5G A;  4RGO S;  2BS2 B;  2QMT A;  4RGT A;  4TSS A;  2IJ0 A;  4WWM A;  2KN4 A;  1VR9 A;  1C77 A;  1E9M A;  4XE0 A;  3UI3 A;  3OWE B;  4RF0 A;  3VR9 B;  1F0Z A;  4OVZ A;  3AE2 B;  3HRD D;  2IGH A;  3LB8 C;  3KWV A;  1L6U A;  1YJJ A;  1ESF A;  1XLO A;  1YN3 A;  2V0G A;  5C3J B;  3TEX A;  1V1P A;  3ZQ4 A;  1PGX A;  1NVI D;  2DLB A;  3AMZ A;  1TZO A;  1PDX A;  1FM0 D;  3T3O A;  4A90 A;  4C80 A;  5D3I B;  2M19 A;  1N63 A;  1BML C;  3AE8 B;  2ZW1 A;  1MHH E;  3BYT B;  2KAJ A;  2WNM A;  3AE7 B;  1F2R I;  2AQ1 B;  2WXQ A;  2WU2 B;  4XWW A;  1M4V A;  1L4Z B;  4M0W A;  3AN1 A;  1IBX A;  2BTE A;  4EE2 A;  5BMG A;  1V97 A;  2LHD A;  2PTL A;  4P16 A;  1SEB D;  1STE A;  1DOX A;  1AW7 A;  1SXT A;  1MHX A;  1FRD A;  1SE4 A;  2K5P A;  3BWU D;  4C7Z A;  1K53 A;  3AEF B;  2K0P A;  4IOI E;  4USA A;  2PLP A;  3IAS 1;  2BBC A;  2RPV A;  4OZA A;  3B2G A;  3SR6 A;  3BII D;  4B0M A;  1J7C A;  5BYQ A;  2PIA A;  1AN8 A;  1AYF A;  1C4P A;  5LNK 1;  5G5H A;  4C56 C;  2INP E;  1E10 A;  1KFY B;  2WXR A;  5HHD G;  1ZUD 2;  2PVG C;  4ARC A;  1SF0 A;  1C76 A;  4JX1 C;  1ZDX A;  3AE4 B;  3ABV B;  4A8X C;  1SSN A;  3SEB A;  1ET6 A;  1YN4 A;  4LK0 M;  1VZ6 A;  1IUE A;  4KX6 B;  2RMM A;  4RH6 A;  2Y5C A;  1N60 A;  1BUI C;  3P4Q B;  1NYQ A;  4R3D A;  1UNS A;  3NS1 A;  2I38 A;  3ZJT A;  2N7J A;  3NUH B;  2QIL A;  4WUR A;  2Z8L A;  1GOZ A;  1WWT A;  1TJE A;  3L4P A;  4RFB A;  2KWD A;  3GB1 A;  4HKZ E;  1JAL A;  1QOG A;  1YN5 A;  4US9 A;  1XCT L;  3AEA B;  1LO5 D;  1D5Z C;  3NRZ A;  3U52 E;  4LLG M;  4KKJ A;  2PMV A;  2DBY A;  2FBW B;  4OZB A;  2AX5 A;  2MJD A;  3J9C A;  1ZOY B;  2WU5 B;  4ZRP A;  1HA5 A;  3AEB B;  1KF6 B;  1C4A A;  1ENF A;  1JWA D;  1B9R A;  2WLB A;  2WS3 B;  3P4P B;  3B9J A;  3Q8F A;  1NYR A;  3NVZ A;  4JWU C;  3BK2 A;  1TKG A;  2M56 B;  2L1A A;  4DXG A;  2JX5 A;  1DGJ A;  2WXG A;  1L0V B;  4JPS A;  1FO4 A;  4GDK B;  3RPF C;  2J52 A;  4L2Y A;  1TY2 A;  1ZDV A;  4JWS C;  1EM7 A;  4OZC A;  1FCC C;  3TEZ A;  3AE5 B;  4N58 A;  2JU6 X;  2OED A;  2W3R A;  3V05 A;  4YTN B;  1JML A;  1J7A A;  3NVW A;  1FMA D;  3MFG A;  1V8C A;  1YQ3 B;  3TEW A;  1XO3 A;  4RCO A;  3H8H A;  3HUI A;  1F77 A;  4LTU A;  1UGJ A;  1PGB A;  2ZW0 A;  3P42 A;  4NJC A;  2KDM A;  4ARI A;  1FD6 A;  1BXT A;  4YTM B;  3Q69 A;  3NVY A;  3P1M A;  1WXQ A;  5E6J A;  3URY A;  1WGK A;  1JQ4 A;  1IGD A;  1ACC A;  5FR3 A;  5EE3 A;  2CJN A;  2X38 A;  1QF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...