1WM2A

Crystal structure of human sumo-2 protein
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
78
structure length
78
Chain Sequence
TENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the human SUMO-2 protein at 1.6 A and 1.2 A resolution: implication on the functional differences of SUMO proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Ubiquitin-like protein SMT3B
total genus 19
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2004-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wm2A00
3VVWB 3JW0X 1WGGA 3T8MA 2KQSA 3NZSA 2RPQA 2D3GA 3AI5A 1WE6A 2ZNVC 1F9JA 3M63B 4F7ZA 2KDBA 4GDKA 2FCMA 4HDQA 4ICUA 4IG7B 4W9HA 4DHJB 2J7QB 2MP2A 4BBNC 2KMAA 4GU2A 2IBIB 3ML9A 5CX3A 3GZNI 1C3TA 1KLVA 1E7VA 2FCSA 1XT9B 4DWFA 3HHMA 2DHZA 2CKHB 4HPLB 4GSWA 5DCNA 2LVPA 3TBLD 3SU8X 1LXDA 3M62B 2PPHA 4NJ7A 4AP4C 3PRPB 3AXCA 4NY0A 4KDIC 1YD8U 4G11A 3OAWA 2KTRA 4WWNA 3VTUA 3PVLA 4IW0A 2KJHB 2BWFA 3DBLI 2KXJA 3JVZX 3ONSA 3M3JA 1S3SG 3H1UA 4KIKA 2C60A 1IP9A 3A1QB 3UQBA 1H4RA 3QA8A 3U7DA 3K9PB 2N4FA 2G4DB 2HJ8A 4FJYA 1KJTA 3ZRCA 4NNJB 3QAQA 4XX5A 2MSED 3IFWB 4WQOB 2KN5A 3QWZB 1V86A 2DX5B 4TQ0A 2MBQA 3CSFA 3JYUA 3N30A 3TJPA 3ZTCA 3KH0A 3BY4B 2FAZA 1GNUA 1WM3A 2KX0A 4NQKE 2LVQA 2MW5A 3Q3FA 5CHWA 2IO2B 4FULA 3ZUNA 1UGMA 1KM7A 2LXAA 5JHBA 2L05A 3QJZA 2MLBA 2O6VA 1P1AA 2Z59B 3BINA 2JUOA 1RAXA 3W1YA 4WJOA 3EFUA 5CTRC 3ZTDA 2R2QA 3A4RA 4ZRJA 2ZCBA 4M8MA 4DHJD 2KJRA 2KQ7A 4KZCA 3X0WA 4ANWA 2MBEA 1WR1A 2FCNA 3A9JA 2ZPYA 4JIOU 4B9KA 5DPSA 2GOWA 4MJSB 4GDLA 1G6JA 4IC7B 1Q0WB 1E90A 3PS6A 3L0WB 1LFDA 3LDZE 2LJ5A 5LLIA 1OGWA 3QK0A 3DOWA 4EKUA 4B95A 2GBNA 5L95C 3ECIA 3RCZA 2K25A 4G50A 3TIXA 4NPNA 2BYVE 2EMSA 2KTFA 4FHJA 1WRDB 2D10A 4RMAA 3M95A 4DXAB 1D3ZA 3U30A 4FADA 2D2QA 4KSLC 1Y8RC 3HM3A 1ZKHA 1SE9A 2L0TA 4KDLB 2FNJB 4MDKE 2Z0DB 3JSVB 3PHWB 2Z0EB 3P2BA 2HTHA 4A3PA 3ZIMA 2KLCA 1WMHA 3KUZA 4W9DA 4ANXA 1WJUA 4W9IA 2KNBA 1GC7A 3I3TB 2KO3A 1YIWA 3CSTA 5C23A 1WXAA 3ZW3A 5EDSA 5CHFA 1C1YB 4I6LB 2K6QA 1LM8B 1WJ4A 3L13A 3R7QA 5DPTA 4W9CA 3SHQA 3NY5A 1R4NI 3VFKA 2KOXA 2KFKB 1E8ZA 2IY0B 3WIMA 4W9JA 1E7UA 4K81A 4MGYE 3VXWA 2O2VB 4G0NB 2N9EB 4DDGD 2KWCA 1A5RA 1K8RB 3L16A 4LJOB 4ANUA 2EMTA 1UH6A 1TZ1A 2NPTA 2XK5A 5AEKB 2DAJA 4M8NA 2CHXA 4BFRA 3SD5A 4N9F4 5AZGA 2LWPA 2GMIC 3PHXB 4HCPB 4GGQA 3VUWA 3VAWA 2L00B 4RM8A 1TBEA 4XZ4A 4KVGB 3X23A 1JRUA 1V5TA 3VH3B 2G4SA 1GJZA 4AWJA 2UYZB 2B3AA 2KTRB 3IHPC 4HPMB 2NPTB 4ZRIA 1XD3B 3R66C 2ZNVB 3QARA 1VCBA 3MTNB 2ZVOA 2NBWB 5DPRA 2DZKA 1WGYA 3OJ4B 2KDEB 1SIFA 3V62A 4URKA 3WAPA 2KC1A 2KFJA 2PE6B 3N3KB 2XK5B 1J8CA 5C1ZA 2GBRA 3V61A 5GMVA 1Q5WB 3V6CB 1PQSA 1R4MI 1WR6E 4KSKC 5E6OA 1U4AA 2WYQA 4JGHB 2KLGA 3T9LA 3DPDA 3O65B 2YLMA 4LCDE 1YX5B 2KDIA 4ZYNA 5JH5C 1RLFA 4IM3A 3GOEA 3ALBA 2GBKA 1WM2A 4MSQB 3CF6E 3B1LX 4PS7A 1EO6A 4IWOA 2L3ZA 2O6VB 3AULA 1EF1A 3A9KA 4II2B 5JZEB 2JY6A 1GC6A 1CMXB 3EHVA 4WWPA 4BOSC 5J18A 2KWVB 2ZEQA 1UBIA 5FR6A 2M0XA 1NI2A 2AL6A 3QQ8B 3QX1A 3S2AA 2KC2A 3DVNV 2N1VA 1UD7A 1RFAA 2MCNB 4JL9A 3ZKJC 4BKSD 3A9JB 4FBJB 4TV3A 4MGZE 2OOBB 2BPSA 4GDLB 1E5WA 1V49A 2ZZPB 5J17A 4BVUC 2XEWA 4BKTA 2DYBA 2AL3A 4W9LA 4BKGA 4KZ0A 3AU4A 1WFYA 1V80A 4K1RB 2BYEA 1HE8A 2PEAA 3NS8A 2HD5B 3WA0A 2AEHA 2LRUA 2GBMA 2REXA 3H7PB 2JZZA 2AWTA 3EC8A 1YQBA 2EKEC 3VHTC 4EZLA 4K7UA 2PJHA 4GXBA 4CO7A 4DHZB 4LDTD 2K8CA 2K1FA 4DHZE 4K7SA 2K8HA 1WJNA 2C9WB 3AU5A 3HIZA 4ASWC 4CYEA 2DYMA 2RGFA 3VUXA 5HKHA 2J0MA 1WXVA 4HVBA 1WXSA 4PYUA 1EUVB 3D32A 2UWQA 2MX2A 4OVVA 1WX7A 1WY8A 4FJVB 4EZJA 5IA7A 1WGHA 2O2VA 2VRRB 2V3SA 4HLEA 1V81A 1UELA 2GBJA 2RSUA 3DVGX 3ZNHB 1V5OA 2W9NA 5TR5A 2C7NB 3RYTA 4AOFA 2A4ZA 4W9GA 3WALA 1WYWB 3A33B 4BBNF 2KK8A 4PS8A 4W9KA 3TMPB 1V9JA 1KOTA 2ZCCA 3QIJA 2I1KA 2MRPA 3UQAA 1P98A 3UIOB 2XBBC 1Q1OA 4OVUA 1X1MA 2YVCA 2BF8B 2WX0A 5L83A 4MELA 1WX8A 4IM0A 3UGBB 1WGDA 3NZUA 4HJKA 4WJPA 3K9OB 2JPHA 3PREA 4GIVA 2N7EA 2JF5A 3PV1A 1L7YA 1UZXB 1OTRB 1V6EA 3B0AA 4IWPA 4KV2A 2BKFA 3L17A 4NAWA 3KYDD 5G2NA 3DDCB 4ICVA 3LJ3A 3ZDTA 2DAFA 3DVGY 3DVNU 2LI5A 2KD0A 2CU1A 2LGDA 3Q3JA 1WX9A 3DQVA 4MH0E 4JLCA 4XC2A 2JVCA 2DZIA 3DBHI 2AYOB 3H7PA 3RZWC 2KJ6A 5CHVC 3VDZA 2BGFA 1ZGUB 5E6PA 3MJWA 3R3MA 3ZO5B 4KIKB 3VUYA 2KWUB 3W1SC 4DDID 1I35A 2NVUI 3N32A 1E8WA 3PLUA 4GOCA 3PTFC 2G3QB 2ZJDA 2D11A 2MQJA 3HM6X 4WJNA 4NJ6A 5LXHA 2LASA 4A3OA 5KHOA 3UIPB 4EOYA 4TUUA 1NBFC 1IPGA 4EEWA 2R2OA 3L08A 2LGYA 4IWQA 3VTWA 3RZFA 4MEMA 2D07B 1WIAA 2V4LA 2KVRA 1L2NA 2LRWA 3OJ3A 4WJQA 2LXCA 3WAMA 3H6NA 3KW5B 1S1QB 4WWOA 4HK2A 1TTNA 1IYFA 3V6EB 3KUDB 2WDTB 5D2MB 1J19A 2RR9A 3KVFB 4GN1A 4EZKA 3IG3A 2FIFA 3DCGA 1WMHB 4AJWA 3WANA 1AARA 4NQLB 2M1MA 1MG8A 4DBGA 1P3QU 5D6JB 2C7HA 3SDLC 3QCAA 4FN2A 4HXDA 2CHZA 3OLMD 4I6NB 4HCNB 1T0YA 2CS4A 4BOZB 3DBRI 3NHEB 2DENB 1E8YA 1ZW7A 4PS3A 2WWZA 4X57B 4GMVA 4F1SA 5E6NA 1P9DU 1QZEA 2LVOA 3KUCB 4J6IA 2LD9A 2IO1B 3A9KB 2IO0B 2MA9B 5G55A 4G3XB 2WX1A 4DK5A 2O6VD 1WE7A 2JXXA 2BWES 3APCA 2IY1B 1ISNA 4W9FA 5J2RA 2NS5A 2NR2A 1WZ3A 1LQBA 2DZMA 1SGHA 2NBVB 3RULA 2LZ6A 1EF5A 3H9DA 4AJYB 2J0JA 3L54A 3PSEB 4LJPB 3PZDA 2K6DB 1UBQA 2K8BA 4RM9A 2HE7A 5D7GA 5AZHA 4GDKB 3VQIA 4FA6A 5IAAC 3JSVA 1WI0A 1YX6B 2DYOA 2KX3A 4W9EA 2JRIB 3RD2A 1TGZB 3APFA 4IM2A 1XQQA 2I1JA 2OJRA 2DZJA 4K7WA 4ZRKA 5D94A 4E74A 1WXMA 2K39A 3HK0A 3R7RA 2ZPNA 3VH4B 1V2YA 2BKRB 4B6WA 4E71A 1OQYA 2IYDB 4PYZA 4EFOA 3ZNGC 2LGXA 2LUEA 2BYFA 2L8JA 2JRHA 3V60A 2N1WA 2M17A 4A20A 3ZRFA 2MBHA 3B08A 4LDTB 4MM3A 4MGKE 3PLVA 4FHKA 4BKSA 2JWZA 4MGIE 2MBOA 4WAAA 1YJ1A 2PE9A 1M94A 1Z2MA 3NOBA 3QC8B 3IBEA 1GG3A 4I6PA 2FIDA 2FUHB 3ENEA 5DPWA 3ZNZB 5AZFA 2G45B 2KZRA 4HDOA 2FCQA 3ML8A 1J0GA 3ZVVA 1OEYJ 3EECA 2NCNA 1RRBA 1FXTB 2MWSB 2N9PC 3QHTA 1WJ6A 4FLHA 2M4NA 4YL8A 3APDA 3H7SA 4ZDVA 2KMCA 4IUMB 4HWIB 3IVFA 3ZLZA 3KYCD 1OEYA 1Z5SB 2KHWB 4TKNA 4CHKA 3W1SA 3UINB 3VTVA 4M0WB 2ASQA 4ANVA 3ZNID 5JHAA 2KFKA 3L10B 3PT2B 1I42A 4II3B 1WGRA 5KHQA 3A1QA 3U8ZA 3RT3B 2A5UA 3TL5A 2V1YA 2L76A 3TCAA 2JZ3B 3ZDMC 2IZVB 1GUAB 2L7RA 1E8XA 2N9XA 3WAOA 3MHSD 3CMMB 3PPAA 1VD2A 3DBSA 1NDDA 4NAWB 1H8CA 3PRMB 4GB9A 3PRZA 4MSMB 4MJSA 1P0RA 3A4SC 3UF8A 4TQ1A 3RUIB 2Y5BB 5BO4B 2ZVNA 3PGEA 4P7IA 1WZ0A 2QHOA 5LXIB 2IO3B 2JT4B 2N7DA 4EUTA 2MP2B 2C5LC 2MBBB 2J0KA 2L0FA 2CHWA 4F8CB 3C0RB 4JQWC 4E3CA 2KANA 2KKCA 2KDFB 4FJZA 2RD0A 2CR5A 1BT0A 2C7MB 2NBUA 1WF9A 4AUQC 1WH3A 2M8SA
chains in the Genus database with same CATH superfamily
3BK1A 2JXTA 2KQSA 4W9HA 2FCMA 4ICUA 1SE4A 1LGRA 3PZ8A 2LUMA 1OQRA 2JYTA 1I4HA 3AH7A 3ML9A 5FK9C 4HKZE 1E7VA 3LB8C 3HHMA 4P1BC 2CKHB 2MJ3A 1F52A 1RYJA 1JWAD 3NVZA 3N1YC 3M62B 3AXCA 4KDIC 4WWNA 4FXCA 4KGRA 3PVLA 3DBLI 1S3SG 4N6EB 2C60A 3UQBA 2G4DB 4C4VA 3C19A 5AUKA 3IFWB 3QWZB 2DX5B 3CSFA 3ZTCA 3V05A 2INPE 3BWUD 1UF0A 4JWUC 1ZOYB 4NQKE 3NRZA 2LVQA 4JWSC 5BMGA 1C4PA 3CIRB 2LXAA 2WXIA 1PDXA 5H92C 4QAYA 2SEBD 1RAXA 1SJHD 2R2QA 1AW7A 4ZRJA 4M8MA 2LHDA 4KZCA 1MHXA 4ANWA 4JIOU 3Q3OC 5DPSA 4RH6A 4GDLA 4IC7B 1Q0WB 3L0WB 2G1EA 3LDZE 1SIJA 2LJ5A 2JQRB 3B2FA 3DOWA 3Q8FA 1JMLA 1B1ZA 2PTLA 4C80A 1QOAA 4KSLC 1Y8RC 1UWMA 3FKYA 4KDLB 2FNJB 1DYQA 3JSVB 3PHWB 2Z0EB 3ZIMA 1YN5A 1WMHA 4W9DA 4ANXA 3I3TB 2KO3A 3CSTA 1UUPA 1WXAA 4R3DA 1C1YB 4I6LB 1I4RA 5DPTA 4W9CA 3SHQA 3VFKA 2KOXA 5JXVA 4GLSC 3T3OA 2O2VB 4G0NB 4DDGD 4M8NA 1DGJA 5HI1A 2ONQA 4RM8A 2JZPA 3B9JA 3X23A 3TEXA 1OQQA 1XD3B 2BB5A 3QARA 2QILA 4HRSA 1VCBA 3MTNB 2INCC 1TS4A 1WGYA 3V62A 3WAPA 1XLNA 5C1ZA 4YT0B 4RGMA 1XLPA 2WYQA 1EU4A 3P4RB 4P6VF 4IM3A 5BYQA 1FM0D 1SB3C 1HA5A 1GB1A 2O6VB 2QJLA 2DBYA 1IUEA 1EF1A 4KKIA 1UBIA 2LFIA 2LMCA 3DVNV 1UD7A 1UWXA 2WXJA 3AEAB 1FXIA 2OOBB 1E5WA 1V49A 3P4PB 4KGSA 1T0SC 1C77A 1V80A 2HD5B 2LRUA 2JZZA 3EC8A 2GI9A 3TSSA 4K7UA 4M0WA 2TSSA 2K1FA 2K8CA 2ACZB 1WJNA 2RGFA 2RPVA 2J0MA 3BVMA 4HVBA 1YN3A 1EUVB 1TZOA 2WXMA 1E6EB 1XEEA 1WY8A 4EZJA 2O2VA 1SBBB 2LGIA 4AOFA 3WALA 1WYWB 3A33B 4PS8A 1ZDXA 3UQAA 1P98A 3UIOB 4OVUA 1L6VA 2BF8B 5L83A 4HKQA 4IM0A 3NZUA 1MVKA 3K9OB 2JPHA 4GIVA 3PV1A 1L7YA 4WH4A 1ACCA 3B0AA 4NAWA 2BKFA 3L17A 3DDCB 4ICVA 1MHHE 2LI5A 2AX5A 2LGDA 4XC2A 2JVCA 2WU5B 2DZIA 3DBHI 3H7PA 2BGFA 1ZGUB 5E6PA 3R3MA 4ITKA 4YXDB 4DDID 1C76A 3ABVB 3N32A 3PLUA 4GOCA 3PTFC 2D11A 4WJNA 4A3OA 1EM7A 4ZHOA 4EEWA 4ARCA 3P63A 4IWQA 1J7CA 4WJQA 3HVDA 4REZA 3WAMA 1S1QB 4HK2A 3V6EB 4XWWA 1J19A 3KVFB 3NZ3A 3P4QB 2FIFA 3TEZA 1FRDA 3AECB 4NQLB 3BVGA 3Q8AA 1CZPA 2C7HA 1NEKB 1R4NB 3SFDB 1E8YA 3I57A 3RNFC 2FBWB 3AEFB 2LVOA 3KUCB 5G55A 4DK5A 2O6VD 2JXXA 4W9FA 2NS5A 1FPYA 2VH2A 3RULA 1F77A 1EF5A 4A9AA 3AM9A 3L54A 3PSEB 1FRRA 1UBQA 2K8BA 2PLPA 2IPKD 2N0SB 3JSVA 2KX3A 1TY2A 3Q8EA 3Q69A 4ZRKA 2OJWA 1WXMA 2K39A 2ZPNA 4KX6B 2BS3B 1D4BA 3GP7A 2KT7A 2LUEA 2BYFA 2L8JA 4DQOC 4LTUA 1EWCA 1FMAD 4HEA1 4A8XC 4MM3A 3N9YC 2OEDA 4FHKA 3V3XA 1M94A 3QC8B 1VRAB 3MC0B 5BYSA 1FD6A 2G45B 1RFKA 1L0XB 2RDHA 2FCQA 1OEYJ 3EECA 3QHTA 2WGSA 3H7SA 4L23A 1OEYA 5E6JA 1Z5SB 2KHWB 4TKNA 3W1SA 3VTVA 2ASQA 4JE3B 3ZJUA 1HTOA 1XLOA 3W9CB 1I42A 3BIID 3OWEB 2V1YA 3TCAA 2W3SA 5H8YE 2PIAA 3PRMB 3R8BA 3Q3NC 4MJSA 2NTTA 4TQ1A 2ZVNA 4P7IA 2QHOA 1N61A 5LXIB 2WU2B 2XNAC 3AE3B 3AEBB 2C5LC 4C7ZA 3FILB 2CHWA 3E56A 5HFYA 1WXQA 2CR5A 2NBUA 1WH3A 1F2RC 4LLGM 2RPQA 4P16A 2ZNVC 3M63B 4F7ZA 2KDBA 4GDKA 4HDQA 2KMAA 4PT5A 1FXAA 3GZNI 1C3TA 2HDEA 2JU6X 2FCSA 4HPLB 3DHHC 4ACFA 3RNCC 3PRPB 3Q8BA 2WLBA 2KJHB 1SSNA 3AB5A 3ONSA 2EKIA 3M3JA 2SAKA 3H1UA 4KIKA 1H4RA 3U7DA 3K9PB 2E6XA 4WQMA 3ZRCA 1FCCC 4NNJB 2V3NA 2WXOA 3MFGA 4TQ0A 2V3PA 3DWMA 3RN9C 3KH0A 1GNUA 1WM3A 4A90A 3ZJTA 2M0AA 2KDMA 1YJIA 3ZUNA 1UGMA 5JHBA 3IT4B 1WRIA 3QJZA 4H2AA 4S17A 3DHGC 1XO3A 2JUOA 3EUB2 4WJOA 3ZTDA 3A4RA 1C78A 1N62A 1WR1A 2DLBA 1AN8A 2I2YA 3PS6A 1LFDA 1IGCA 1OGWA 4B95A 2GBNA 5L95C 3ECIA 3RCZA 2K25A 4G50A 2KTFA 4FHJA 4RMAA 3SR6A 1FNWA 4DXAB 1D3ZA 2D2QA 3HM3A 1SE9A 3P2BA 4WWMA 1WJUA 2KNBA 3TEYA 5EDSA 1WJ4A 2PKOA 1E8ZA 3WIMA 5BMHA 3AEGB 1I4GA 5EE0A 1A5RA 4J3OD 1UH6A 1TZ1A 1QOGA 2CHXA 5AZGA 1FFVA 3PHXB 1D5ZC 1VZ8A 3VUWA 3VAWA 3EA6A 1TBEA 1V5TA 1GJZA 1K50A 1TKEA 4AWJA 2L1AA 2W3RA 3R66C 2ZNVB 3BK2A 4HPPA 2ZVOA 5DPRA 2LHEA 3NG0A 2DZKA 3OJ4B 1FFUA 1TJEA 1SIFA 4URKA 2KFJA 2PE6B 1J8CA 2GBRA 1JQ4A 5GMVA 3BYTB 2DNFA 1PQSA 1PFDA 3DBHB 1NENB 3DPDA 3L4PA 2KDIA 1RLFA 3ALBA 4MSQB 2KAJA 2K22A 3IXSA 3URYA 4IWOA 3AULA 4OZBA 4II2B 4N59A 1E9MA 5J18A 3ZXRA 2ZEQA 5FR6A 1NI2A 2E3TA 4JL9A 1MG4A 2MJEA 4BKSD 3A9JB 3FAHA 1N63A 4TV3A 4MGZE 2X38A 4YTPB 1HTQA 2DYBA 2AL3A 2CJOA 4BKGA 2BYEA 2PEAA 3NS8A 3PZ7A 4TSSA 2REXA 3H7PB 5G5HA 3VHTC 2EKEC 4EZLA 1ESFA 4YTMB 4GXBA 4DHZE 2WXGA 3ZGZA 3AU5A 2L83A 2N7JA 1D5MC 4RFBA 3VUXA 5HKHA 5IO9A 1WXSA 1ZUD2 1VLBA 1FEHA 4OVVA 1WGHA 2V3SA 4HLEA 1V81A 4JPSA 1NVID 3OG5A 2A4ZA 4D2KA 4BBNF 4DXGA 2WDRB 3QIJA 4LK0M 1KLGD 2K0PA 2QC8A 2I38A 2KACA 1Q1OA 1X1MA 2WX0A 4BZAA 3UGBB 2D3CA 1WGDA 1GB4A 3PREA 2N7EA 1UZXB 1OTRB 2J52A 1E0ZA 3KYDD 2DAFA 3DVNU 4LNFA 2KD0A 3Q3JA 1WX9A 4JLCA 3I5JC 2AYOB 2WDQB 5CHVC 4C7YA 1K53A 1L4DB 3MJWA 3ZO5B 2HTME 4KIKB 2KN4A 2KWUB 3W1SC 4NAMA 3FC4A 2NVUI 2G3QB 1UNSA 3HM6X 1E10A 2LASA 5KHOA 1NBFC 3RZFA 2D07B 2V4LA 2KVRA 1WWTA 2LRWA 2GB1A 3OJ3A 3H6NA 4USAA 1Y56A 1TTNA 3KUDB 1KLUD 4EZKA 3GS2A 2OHFA 4YSZB 3DCGA 3WANA 1AARA 4ZHPA 1MG8A 1P3QU 5D6JB 3IAM1 2WNMA 2CHZA 2QDFA 4ZYSA 1QZEA 4J6IA 2LD9A 2PMVA 1C79A 1UGJA 2R61A 4G3XB 2BWES 5J2RA 2NR2A 1WZ3A 5I4DA 2LEKA 2LZ6A 4UDUC 4A6QA 2D3BA 3VQIA 3NVYA 5D7GA 2HE7A 5AZHA 5IAAC 4A55A 1WI0A 1YX6B 2J42A 1JWBD 2K3UA 1TGZB 1HZ6A 4IM2A 2I1JA 4K7WA 3NS1A 3VH4B 1DOIA 4XE0A 4B6WA 2WXHA 2HJ1A 4E71A 1OQYA 2LGXA 3HVZA 1ENFA 5HHDG 2N1WA 3Q6BA 3NJTA 4YWGG 3PLVA 4BKSA 2MBOA 2PE9A 3R2IA 5FR3A 1GG3A 2FIDA 1HQRD 1T0QC 1V1OA 1YOVB 1I4PA 3WCQA 1FXTB 2M4NA 1CJEA 1KF6B 4RF1A 3KYCD 3AE4B 2QSDA 1YQ3B 3UINB 1L0YB 5JHAA 2KFKA 2BBCA 3AE8B 1T6BX 2JZ3B 2IZVB 1GUAB 3WAOA 1VD2A 2QMTA 3DBSA 1H8CA 3PRZA 1P0RA 3A4SC 3UF8A 2BQQA 5BO4B 1I4QA 2K9XA 1WZ0A 4AS1A 2BT6A 1HEZE 2MBBB 2J0KA 4F8CB 2KANA 2KDFB 1BT0A 1FCLA 3U7ZA 2M8SA 3VVWB 3JW0X 2N9LA 1JWMD 1WGGA 1QF6A 3NZSA 2D3GA 3AI5A 4OZCA 1F9JA 2Y5CA 4IG7B 4DHJB 3RPFC 2J7QB 4GU2A 2IBIB 5CX3A 3ZYYX 5LNK1 1XT9B 4DWFA 2DHZA 4NJCA 1I7HA 4GSWA 3TBLD 2PPHA 4AP4C 4IOIE 1NI3A 4PK1A 1BXTA 4NY0A 1QQRA 3HRDD 3OAWA 4G11A 2RDGA 1QOFA 3VTUA 3DWGC 5BMIA 3QA8A 2N4FA 5MPOA 3QAQA 2KQ4X 1FIQA 4WQOB 2KN5A 3N30A 1VDVA 3BY4B 2WXFA 2MW5A 3Q3FA 2IO2B 4FULA 1KM7A 1GOZA 2MLBA 2O6VA 1P1AA 2Z59B 3BINA 1MFWA 3BZDB 3IAS1 2MHJA 1N5XA 3U2SC 2ZCBA 4MT5A 4DHJD 2KJRA 2MBEA 2IJ0A 2Y3AA 1JROA 2ZPYA 4B9KA 2GOWA 3TEWA 3HUIA 3RMKC 2W54A 1LO5D 4IDIA 1IBXA 4NPNA 1NYRA 2BYVE 4OVZA 4YTNB 2D10A 3M95A 4FADA 1YNTE 1ZKHA 2L0TA 3P42A 4CQNA 2NTSA 4A3PA 2KLCA 1GC7A 3I63C 5C23A 3ZJVA 1I4XA 3AE2B 3ZW3A 5CHFA 1YJJA 1LM8B 3L13A 1R4NI 2QEJC 4W9JA 3VXWA 1JWSD 2N9EB 4ARIA 2KWCA 1K8RB 3AE7B 4KGTA 4LJOB 5TSSA 2EMTA 5AEKB 3AEEB 1KFYB 4BFRA 3SD5A 4N9F4 2LWPA 4MM3B 2GMIC 4HCPB 3RI7C 2WXKA 2L00B 4XZ4A 2BYTA 4KVGB 1KRHA 1JRUA 3VH3B 2G4SA 1AYFA 2UYZB 1YMHE 2B3AA 2KTRB 4HPMB 2NPTB 4S0RA 5EE3A 1QLBB 2BS4B 1D6EC 2JSVX 2FUG1 2KDEB 4HROA 4AQ7A 1V1PA 3V61A 3W5VB 1PGXA 1R4MI 1WR6E 2INNE 1U4AA 4JGHB 1F0ZA 4L1BA 3O65B 4LCDE 4ZYNA 4LNNA 5JH5C 3CF6E 3B1LX 4PS7A 2WXRA 1EO6A 3DHIC 2L3ZA 5JZEB 3U52E 3RNBC 2JY6A 4WWPA 4BOSC 3RNAC 2AL6A 4EE2A 1MJDA 3FILA 2X8XX 3EFCA 2WS3B 2BPSA 3Q2AC 4GDLB 4OW0A 5J17A 2ZZPB 2XEWA 2J4XA 4KZ0A 1WFYA 4K1RB 4TMAB 4RGTA 2GBMA 5IOIA 2PJHA 3RFZB 1AWDA 1TKYA 2IGHA 4DHZB 4LDTD 2K8HA 2C9WB 4ASWC 1XF5L 2DYMA 1WXVA 2UWQA 2MX2A 2RMMA 1N6ZA 4LNKA 2Z8LA 2JWUA 2AQ1B 2EELA 1UELA 1V5OA 2W9NA 2C7NB 4W9GA 3B2GA 5BYRA 2ZCCA 1GAQB 4RNAA 1CQVA 2MRPA 2XBBC 1PUTA 1ROEA 1WX8A 3W2DA 1V6EA 1JW9D 4IWPA 4KV2A 5G2NA 4US9A 3LJ3A 4RGNA 3TUOA 1BUIC 3N1XC 4OZAA 1YQ4B 5G5GA 4MH0E 3MC9A 1SJED 3UI3A 2LJIA 4B0EA 3RZWC 1WYGA 3VDZA 3PO0A 4XDDA 5C3JB 3VUYA 1I35A 1V8CA 4LNIA 2MQJA 4TUUA 1IPGA 1T5XD 2R2OA 3L08A 3VTWA 4MEMA 4M02A 1L2NA 3KW5B 4WWOA 1IGDA 1R4MB 1IYFA 1KH0A 2KMMA 2WDTB 1J7BA 5D2MB 2JX5A 2RR9A 1VZ7A 3MC8A 4GN1A 1TY0A 1ZP0B 4AJWA 2M1MA 4DBGA 2BTEA 4I6NB 4BOZB 3DBRI 1VR9A 2KWDA 4PS3A 4X57B 5E6NA 3A9KB 2MA9B 2QIEB 3AN1A 2DZMA 1LQBA 1SGHA 2J53A 3R2TA 4AJYB 2WQYB 2J0JA 2WXQA 3O13A 4LJPB 2K6DB 4GDKB 2H89B 1SEBD 2PW9A 1WSPA 4W9EA 2JRIB 3RD2A 1DOXA 3E9SA 3APFA 1XQQA 1XCTL 5D94A 5HG2A 3HK0A 3R7RA 1FO4A 2BKRB 3ZNGC 3AV8A 3P4SB 2WXPA 2PVGC 1SF0A 4RGOS 4XWTA 3ZRFA 4LDTB 4RF0A 4MGIE 1FNUA 4WAAA 4I6PA 2FUHB 3ENEA 5DPWA 2GLSA 5AZFA 2KZRA 4HDOA 1J0GA 2WXNA 1SE2A 2NCNA 1RRBA 2MWSB 1ET6A 4YL8A 3APDA 2KMCA 3IVFA 2LGSA 4NZLB 3DBLB 3ETRA 1EU3A 4XYCA 1D5XC 4CHKA 1J7AA 2BVCA 4M0WB 4ANVA 3ZNID 1P7FA 3SEBA 3L10B 3LXFA 4II3B 5KHQA 1EWYC 2WXLA 3U8ZA 1STEA 3KLSX 2A5UA 3TL5A 4WIPA 2L76A 3ZDMC 5IP4D 2N9KA 2L7RA 1E8XA 3CMMB 4B0MA 3PPAA 4NAWB 1NDDA 1SXTA 3Q3MC 4GB9A 4MSMB 3CWIA 3RUIB 2Y5BB 3PGEA 2AQ2B 2IO3B 4EUTA 1XCQL 4JX1C 4JQWC 4E3CA 3VR8B 4FJZA 4ZOHC 3GB1A 4WAFA 1WF9A 4EFOA 1ET9A 3T8MA 2V9HA 2INDC 1WE6A 3RNGC 2IGGA 4C00A 2MP2A 4BBNC 4KKJA 1N5WA 1QOBA 3AE6B 1L0VB 1KLVA 1PGBA 3MHZA 5DCNA 2LVPA 4ZRPA 3SU8X 1LXDA 5EE1A 4NJ7A 2V0GA 2L32A 2WHIA 1TS5A 1YD8U 1HZ5A 2KTRA 3AMZA 1L6UA 3IT6B 4IW0A 1JRPA 2BWFA 2KXJA 3JVZX 1IP9A 3A1QB 4ZRQA 5AUIA 1HXYD 2HJ8A 4FJYA 2ON8A 1KJTA 4XX5A 2MSED 3GZNB 1V86A 2MBQA 3TJPA 3JYUA 3ZQ4A 2FAZA 4DXFA 2KX0A 4YSXB 5CHWA 1QT9A 2L05A 4C4VB 4L2YA 2VH1A 3BYYB 3W1YA 3EFUA 5CTRC 2DWQA 1QILA 4HJGE 2KQ7A 5C2TB 3X0WA 2FCNA 3A9JA 2BB6A 1ZPSA 1T3QA 1FNVA 4MJSB 1G6JA 5IKCM 1E90A 2H88B 5LLIA 2M19A 3QK0A 4EKUA 1E7PB 1KTKA 3TIXA 2EMSA 4XDCA 1WRDB 2WDVB 4US8A 3T3NA 3U30A 2IDYA 3VR9B 2UU7A 1L5PA 4Q2JA 4MDKE 2Z0DB 1TKGA 3J9CA 2HTHA 3KUZA 4W9IA 4O1NA 1YIWA 2YEPB 1ZDVA 3P1MA 2K6QA 3DBRB 3R7QA 2KYWA 5D3DA 3Q14C 3NY5A 3W5UB 2KFKB 2IY0B 1E7UA 4K81A 4MGYE 2Y5PA 1T0RC 2QCZA 3L16A 4ANUA 2XK5A 2BW2A 2NPTA 3MJ5A 2DAJA 2Q5WD 1OFFA 4GGQA 4MACA 3AE5B 1TT5B 3IHPC 2VZKB 4ZRIA 2NBWB 2FE8A 4K3CA 1TYGB 3VRAB 1TS3A 2KC1A 3N3KB 2XK5B 3KQ4A 1Q5WB 1DOYA 3V6CB 4KSKC 3EGRA 1Q10A 5E6OA 2KLGA 3T9LA 2CU3A 1R7SA 1JWUD 2YLMA 1YX5B 1JALA 2D3AA 3GOEA 2GBKA 1WM2A 1YN4A 4BAXA 3KWLA 5GXGB 5T8IA 3A9KA 4LNOA 3MP9A 1GC6A 1CMXB 2ICIA 3EHVA 2IGDA 2KWVB 2M56B 2M0XA 3QQ8B 3S2AA 3QX1A 2KC2A 2N1VA 4YSYB 1RFAA 2MCNB 3ZKJC 2RDBC 4M01A 4FBJB 1L4ZB 1JCKB 4BVUC 4BKTA 3C8YA 4W9LA 3AU4A 1HE8A 3WA0A 2AEHA 3U4EG 2AWTA 4IKGA 1YQBA 3GE3C 1VZ6A 2MH7A 4CO7A 1ZXIA 4K7SA 4CYEA 3HIZA 2K5PA 4PYUA 3D32A 1WX7A 4M00A 1C9FA 4FJVB 5IA7A 2VRRB 1M4VA 3NUHB 2GBJA 2RSUA 3DVGX 3ZNHB 5TR5A 1QKZA 3RYTA 5IN7A 3AE1B 1TIFA 2KK8A 1P7EA 3SFEB 1C4CA 3RNEC 4W9KA 3TMPB 1V9JA 2CJNA 1KOTA 2I1KA 4OHJA 1ZXHA 2KVZA 2YVCA 4MELA 1F2RI 1K52A 1V97A 4WJPA 4HJKA 2V4IB 1MPEA 2JF5A 3ZDTA 3DVGY 2CU1A 1MI0A 2YEPF 3NVVA 3DQVA 3H8HA 3KWVA 1SE3A 2KJ6A 1VJKA 4P1CC 2WP9B 1E8WA 2ZJDA 4MH8A 1NYQA 4NJ6A 4XGAB 5LXHA 3AE9B 3UIPB 4EOYA 3GE8C 2LGYA 1WIAA 2B76B 2LXCA 1XXGA 3IG3A 1WMHB 2MEKA 1K51A 3SDLC 3QCAA 4FN2A 4HXDA 3OLMD 1WGKA 4HCNB 1T0YA 2ZW1A 2CS4A 3NHEB 2DENB 4RCOA 1ZW7A 2WWZA 4GMVA 4F1SA 1P9DU 2IO1B 2IO0B 5EE9A 2WX1A 3N1ZC 1WE7A 3APCA 2IY1B 1ISNA 3AEDB 1RM6C 2NBVB 3H9DA 3PZDA 4RM9A 2XN9C 4C56C 4FA6A 1IBXB 2DYOA 3BVZA 2OJRA 1PGAA 2DZJA 1V1PB 3N20C 4E74A 5FKAC 1V2YA 1C4AA 2VZKD 2BS2B 2IYDB 4PYZA 2JRHA 3V60A 2M17A 4A20A 1ZE3D 2MBHA 3B08A 1XLQA 1TS2A 3Q8CA 1RWSA 4MGKE 2JWZA 1YJ1A 1Z2MA 2NMQA 3NOBA 3IBEA 1CK1A 3ZNZB 4WURA 2ZW0A 3ML8A 3ZVVA 2N9PC 4FLHA 1WJ6A 4ZDVA 2MJDA 3LYYA 5D3IB 4IUMB 4HWIB 1B9RA 3ZLZA 2W82A 2JYEA 3ZXVA 2L52A 2GRIA 2W55A 3PT2B 1WGRA 2AQ3B 2G9HD 3A1QA 3RT3B 1BMLC 2D5GA 1N60A 1A70A 2N9XA 3MHSD 1PYWD 1GPXA 3VRBB 4K3BA 2PVOD 3NVWA 2JT4B 2N7DA 2MP2B 3I9V1 4N58A 2L0FA 1F1HA 3C0RB 2KKCA 2RD0A 2C7MB 4AUQC
chains in the Genus database with same CATH topology
3VVWB 3JW0X 1WGGA 3T8MA 2KQSA 3NZSA 2RPQA 2D3GA 3AI5A 1WE6A 2ZNVC 1F9JA 3M63B 4F7ZA 2KDBA 4GDKA 2FCMA 4HDQA 4ICUA 4IG7B 4W9HA 4DHJB 2J7QB 2MP2A 4BBNC 2KMAA 4GU2A 2IBIB 3ML9A 5CX3A 3GZNI 1C3TA 1KLVA 1E7VA 2FCSA 1XT9B 4DWFA 3HHMA 2DHZA 2CKHB 4HPLB 4GSWA 5DCNA 2LVPA 3TBLD 3SU8X 1LXDA 3M62B 2PPHA 4NJ7A 4AP4C 3PRPB 3AXCA 4NY0A 4KDIC 1YD8U 4G11A 3OAWA 2KTRA 4WWNA 3VTUA 3PVLA 4IW0A 2KJHB 2BWFA 3DBLI 2KXJA 3JVZX 3ONSA 3M3JA 1S3SG 3H1UA 4KIKA 2C60A 1IP9A 3A1QB 3UQBA 1H4RA 3QA8A 3U7DA 3K9PB 2N4FA 2G4DB 2HJ8A 4FJYA 1KJTA 3ZRCA 4NNJB 3QAQA 4XX5A 2MSED 3IFWB 4WQOB 2KN5A 3QWZB 1V86A 2DX5B 4TQ0A 2MBQA 3CSFA 3JYUA 3N30A 3TJPA 3ZTCA 3KH0A 3BY4B 2FAZA 1GNUA 1WM3A 2KX0A 4NQKE 2LVQA 2MW5A 3Q3FA 5CHWA 2IO2B 4FULA 3ZUNA 1UGMA 1KM7A 2LXAA 5JHBA 2L05A 3QJZA 2MLBA 2O6VA 1P1AA 2Z59B 3BINA 2JUOA 1RAXA 3W1YA 4WJOA 3EFUA 5CTRC 3ZTDA 2R2QA 3A4RA 4ZRJA 2ZCBA 4M8MA 4DHJD 2KJRA 2KQ7A 4KZCA 3X0WA 4ANWA 2MBEA 1WR1A 2FCNA 3A9JA 2ZPYA 4JIOU 4B9KA 5DPSA 2GOWA 4MJSB 4GDLA 1G6JA 4IC7B 1Q0WB 1E90A 3PS6A 3L0WB 1LFDA 3LDZE 2LJ5A 5LLIA 1OGWA 3QK0A 3DOWA 4EKUA 4B95A 2GBNA 5L95C 3ECIA 3RCZA 2K25A 4G50A 3TIXA 4NPNA 2BYVE 2EMSA 2KTFA 4FHJA 1WRDB 2D10A 4RMAA 3M95A 4DXAB 1D3ZA 3U30A 4FADA 2D2QA 4KSLC 1Y8RC 3HM3A 1ZKHA 1SE9A 2L0TA 4KDLB 2FNJB 4MDKE 2Z0DB 3JSVB 3PHWB 2Z0EB 3P2BA 2HTHA 4A3PA 3ZIMA 2KLCA 1WMHA 3KUZA 4W9DA 4ANXA 1WJUA 4W9IA 2KNBA 1GC7A 3I3TB 2KO3A 1YIWA 3CSTA 5C23A 1WXAA 3ZW3A 5EDSA 5CHFA 1C1YB 4I6LB 2K6QA 1LM8B 1WJ4A 3L13A 3R7QA 5DPTA 4W9CA 3SHQA 3NY5A 1R4NI 3VFKA 2KOXA 2KFKB 1E8ZA 2IY0B 3WIMA 4W9JA 1E7UA 4K81A 4MGYE 3VXWA 2O2VB 4G0NB 2N9EB 4DDGD 2KWCA 1A5RA 1K8RB 3L16A 4LJOB 4ANUA 2EMTA 1UH6A 1TZ1A 2NPTA 2XK5A 5AEKB 2DAJA 4M8NA 2CHXA 4BFRA 3SD5A 4N9F4 5AZGA 2LWPA 2GMIC 3PHXB 4HCPB 4GGQA 3VUWA 3VAWA 2L00B 4RM8A 1TBEA 4XZ4A 4KVGB 3X23A 1JRUA 1V5TA 3VH3B 2G4SA 1GJZA 4AWJA 2UYZB 2B3AA 2KTRB 3IHPC 4HPMB 2NPTB 4ZRIA 1XD3B 3R66C 2ZNVB 3QARA 1VCBA 3MTNB 2ZVOA 2NBWB 5DPRA 2DZKA 1WGYA 3OJ4B 2KDEB 1SIFA 3V62A 4URKA 3WAPA 2KC1A 2KFJA 2PE6B 3N3KB 2XK5B 1J8CA 5C1ZA 2GBRA 3V61A 5GMVA 1Q5WB 3V6CB 1PQSA 1R4MI 1WR6E 4KSKC 5E6OA 1U4AA 2WYQA 4JGHB 2KLGA 3T9LA 3DPDA 3O65B 2YLMA 4LCDE 1YX5B 2KDIA 4ZYNA 5JH5C 1RLFA 4IM3A 3GOEA 3ALBA 2GBKA 1WM2A 4MSQB 3CF6E 3B1LX 4PS7A 1EO6A 4IWOA 2L3ZA 2O6VB 3AULA 1EF1A 3A9KA 4II2B 5JZEB 2JY6A 1GC6A 1CMXB 3EHVA 4WWPA 4BOSC 5J18A 2KWVB 2ZEQA 1UBIA 5FR6A 2M0XA 1NI2A 2AL6A 3QQ8B 3QX1A 3S2AA 2KC2A 3DVNV 2N1VA 1UD7A 1RFAA 2MCNB 4JL9A 3ZKJC 4BKSD 3A9JB 4FBJB 4TV3A 4MGZE 2OOBB 2BPSA 4GDLB 1E5WA 1V49A 2ZZPB 5J17A 4BVUC 2XEWA 4BKTA 2DYBA 2AL3A 4W9LA 4BKGA 4KZ0A 3AU4A 1WFYA 1V80A 4K1RB 2BYEA 1HE8A 2PEAA 3NS8A 2HD5B 3WA0A 2AEHA 2LRUA 2GBMA 2REXA 3H7PB 2JZZA 2AWTA 3EC8A 1YQBA 2EKEC 3VHTC 4EZLA 4K7UA 2PJHA 4GXBA 4CO7A 4DHZB 4LDTD 2K8CA 2K1FA 4DHZE 4K7SA 2K8HA 1WJNA 2C9WB 3AU5A 3HIZA 4ASWC 4CYEA 2DYMA 2RGFA 3VUXA 5HKHA 2J0MA 1WXVA 4HVBA 1WXSA 4PYUA 1EUVB 3D32A 2UWQA 2MX2A 4OVVA 1WX7A 1WY8A 4FJVB 4EZJA 5IA7A 1WGHA 2O2VA 2VRRB 2V3SA 4HLEA 1V81A 1UELA 2GBJA 2RSUA 3DVGX 3ZNHB 1V5OA 2W9NA 5TR5A 2C7NB 3RYTA 4AOFA 2A4ZA 4W9GA 3WALA 1WYWB 3A33B 4BBNF 2KK8A 4PS8A 4W9KA 3TMPB 1V9JA 1KOTA 2ZCCA 3QIJA 2I1KA 2MRPA 3UQAA 1P98A 3UIOB 2XBBC 1Q1OA 4OVUA 1X1MA 2YVCA 2BF8B 2WX0A 5L83A 4MELA 1WX8A 4IM0A 3UGBB 1WGDA 3NZUA 4HJKA 4WJPA 3K9OB 2JPHA 3PREA 4GIVA 2N7EA 2JF5A 3PV1A 1L7YA 1UZXB 1OTRB 1V6EA 3B0AA 4IWPA 4KV2A 2BKFA 3L17A 4NAWA 3KYDD 5G2NA 3DDCB 4ICVA 3LJ3A 3ZDTA 2DAFA 3DVGY 3DVNU 2LI5A 2KD0A 2CU1A 2LGDA 3Q3JA 1WX9A 3DQVA 4MH0E 4JLCA 4XC2A 2JVCA 2DZIA 3DBHI 2AYOB 3H7PA 3RZWC 2KJ6A 5CHVC 3VDZA 2BGFA 1ZGUB 5E6PA 3MJWA 3R3MA 3ZO5B 4KIKB 3VUYA 2KWUB 3W1SC 4DDID 1I35A 2NVUI 3N32A 1E8WA 3PLUA 4GOCA 3PTFC 2G3QB 2ZJDA 2D11A 2MQJA 3HM6X 4WJNA 4NJ6A 5LXHA 2LASA 4A3OA 5KHOA 3UIPB 4EOYA 4TUUA 1NBFC 1IPGA 4EEWA 2R2OA 3L08A 2LGYA 4IWQA 3VTWA 3RZFA 4MEMA 2D07B 1WIAA 2V4LA 2KVRA 1L2NA 2LRWA 3OJ3A 4WJQA 2LXCA 3WAMA 3H6NA 3KW5B 1S1QB 4WWOA 4HK2A 1TTNA 1IYFA 3V6EB 3KUDB 2WDTB 5D2MB 1J19A 2RR9A 3KVFB 4GN1A 4EZKA 3IG3A 2FIFA 3DCGA 1WMHB 4AJWA 3WANA 1AARA 4NQLB 2M1MA 1MG8A 4DBGA 1P3QU 5D6JB 2C7HA 3SDLC 3QCAA 4FN2A 4HXDA 2CHZA 3OLMD 4I6NB 4HCNB 1T0YA 2CS4A 4BOZB 3DBRI 3NHEB 2DENB 1E8YA 1ZW7A 4PS3A 2WWZA 4X57B 4GMVA 4F1SA 5E6NA 1P9DU 1QZEA 2LVOA 3KUCB 4J6IA 2LD9A 2IO1B 3A9KB 2IO0B 2MA9B 5G55A 4G3XB 2WX1A 4DK5A 2O6VD 1WE7A 2JXXA 2BWES 3APCA 2IY1B 1ISNA 4W9FA 5J2RA 2NS5A 2NR2A 1WZ3A 1LQBA 2DZMA 1SGHA 2NBVB 3RULA 2LZ6A 1EF5A 3H9DA 4AJYB 2J0JA 3L54A 3PSEB 4LJPB 3PZDA 2K6DB 1UBQA 2K8BA 4RM9A 2HE7A 5D7GA 5AZHA 4GDKB 3VQIA 4FA6A 5IAAC 3JSVA 1WI0A 1YX6B 2DYOA 2KX3A 4W9EA 2JRIB 3RD2A 1TGZB 3APFA 4IM2A 1XQQA 2I1JA 2OJRA 2DZJA 4K7WA 4ZRKA 5D94A 4E74A 1WXMA 2K39A 3HK0A 3R7RA 2ZPNA 3VH4B 1V2YA 2BKRB 4B6WA 4E71A 1OQYA 2IYDB 4PYZA 4EFOA 3ZNGC 2LGXA 2LUEA 2BYFA 2L8JA 2JRHA 3V60A 2N1WA 2M17A 4A20A 3ZRFA 2MBHA 3B08A 4LDTB 4MM3A 4MGKE 3PLVA 4FHKA 4BKSA 2JWZA 4MGIE 2MBOA 4WAAA 1YJ1A 2PE9A 1M94A 1Z2MA 3NOBA 3QC8B 3IBEA 1GG3A 4I6PA 2FIDA 2FUHB 3ENEA 5DPWA 3ZNZB 5AZFA 2G45B 2KZRA 4HDOA 2FCQA 3ML8A 1J0GA 3ZVVA 1OEYJ 3EECA 2NCNA 1RRBA 1FXTB 2MWSB 2N9PC 3QHTA 1WJ6A 4FLHA 2M4NA 4YL8A 3APDA 3H7SA 4ZDVA 2KMCA 4IUMB 4HWIB 3IVFA 3ZLZA 3KYCD 1OEYA 1Z5SB 2KHWB 4TKNA 4CHKA 3W1SA 3UINB 3VTVA 4M0WB 2ASQA 4ANVA 3ZNID 5JHAA 2KFKA 3L10B 3PT2B 1I42A 4II3B 1WGRA 5KHQA 3A1QA 3U8ZA 3RT3B 2A5UA 3TL5A 2V1YA 2L76A 3TCAA 2JZ3B 3ZDMC 2IZVB 1GUAB 2L7RA 1E8XA 2N9XA 3WAOA 3MHSD 3CMMB 3PPAA 1VD2A 3DBSA 1NDDA 4NAWB 1H8CA 3PRMB 4GB9A 3PRZA 4MSMB 4MJSA 1P0RA 3A4SC 3UF8A 4TQ1A 3RUIB 2Y5BB 5BO4B 2ZVNA 3PGEA 4P7IA 1WZ0A 2QHOA 5LXIB 2IO3B 2JT4B 2N7DA 4EUTA 2MP2B 2C5LC 2MBBB 2J0KA 2L0FA 2CHWA 4F8CB 3C0RB 4JQWC 4E3CA 2KANA 2KKCA 2KDFB 4FJZA 2RD0A 2CR5A 1BT0A 2C7MB 2NBUA 1WF9A 4AUQC 1WH3A 2M8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VVW B;  3JW0 X;  1WGG A;  3T8M A;  2KQS A;  3NZS A;  2RPQ A;  2D3G A;  3AI5 A;  1WE6 A;  2ZNV C;  1F9J A;  3M63 B;  4F7Z A;  2KDB A;  4GDK A;  2FCM A;  4HDQ A;  4ICU A;  4IG7 B;  4W9H A;  4DHJ B;  2J7Q B;  2MP2 A;  4BBN C;  2KMA A;  4GU2 A;  2IBI B;  3ML9 A;  5CX3 A;  3GZN I;  1C3T A;  1KLV A;  1E7V A;  2FCS A;  1XT9 B;  4DWF A;  3HHM A;  2DHZ A;  2CKH B;  4HPL B;  4GSW A;  5DCN A;  2LVP A;  3TBL D;  3SU8 X;  1LXD A;  3M62 B;  2PPH A;  4NJ7 A;  4AP4 C;  3PRP B;  3AXC A;  4NY0 A;  4KDI C;  1YD8 U;  4G11 A;  3OAW A;  2KTR A;  4WWN A;  3VTU A;  3PVL A;  4IW0 A;  2KJH B;  2BWF A;  3DBL I;  2KXJ A;  3JVZ X;  3ONS A;  3M3J A;  1S3S G;  3H1U A;  4KIK A;  2C60 A;  1IP9 A;  3A1Q B;  3UQB A;  1H4R A;  3QA8 A;  3U7D A;  3K9P B;  2N4F A;  2G4D B;  2HJ8 A;  4FJY A;  1KJT A;  3ZRC A;  4NNJ B;  3QAQ A;  4XX5 A;  2MSE D;  3IFW B;  4WQO B;  2KN5 A;  3QWZ B;  1V86 A;  2DX5 B;  4TQ0 A;  2MBQ A;  3CSF A;  3JYU A;  3N30 A;  3TJP A;  3ZTC A;  3KH0 A;  3BY4 B;  2FAZ A;  1GNU A;  1WM3 A;  2KX0 A;  4NQK E;  2LVQ A;  2MW5 A;  3Q3F A;  5CHW A;  2IO2 B;  4FUL A;  3ZUN A;  1UGM A;  1KM7 A;  2LXA A;  5JHB A;  2L05 A;  3QJZ A;  2MLB A;  2O6V A;  1P1A A;  2Z59 B;  3BIN A;  2JUO A;  1RAX A;  3W1Y A;  4WJO A;  3EFU A;  5CTR C;  3ZTD A;  2R2Q A;  3A4R A;  4ZRJ A;  2ZCB A;  4M8M A;  4DHJ D;  2KJR A;  2KQ7 A;  4KZC A;  3X0W A;  4ANW A;  2MBE A;  1WR1 A;  2FCN A;  3A9J A;  2ZPY A;  4JIO U;  4B9K A;  5DPS A;  2GOW A;  4MJS B;  4GDL A;  1G6J A;  4IC7 B;  1Q0W B;  1E90 A;  3PS6 A;  3L0W B;  1LFD A;  3LDZ E;  2LJ5 A;  5LLI A;  1OGW A;  3QK0 A;  3DOW A;  4EKU A;  4B95 A;  2GBN A;  5L95 C;  3ECI A;  3RCZ A;  2K25 A;  4G50 A;  3TIX A;  4NPN A;  2BYV E;  2EMS A;  2KTF A;  4FHJ A;  1WRD B;  2D10 A;  4RMA A;  3M95 A;  4DXA B;  1D3Z A;  3U30 A;  4FAD A;  2D2Q A;  4KSL C;  1Y8R C;  3HM3 A;  1ZKH A;  1SE9 A;  2L0T A;  4KDL B;  2FNJ B;  4MDK E;  2Z0D B;  3JSV B;  3PHW B;  2Z0E B;  3P2B A;  2HTH A;  4A3P A;  3ZIM A;  2KLC A;  1WMH A;  3KUZ A;  4W9D A;  4ANX A;  1WJU A;  4W9I A;  2KNB A;  1GC7 A;  3I3T B;  2KO3 A;  1YIW A;  3CST A;  5C23 A;  1WXA A;  3ZW3 A;  5EDS A;  5CHF A;  1C1Y B;  4I6L B;  2K6Q A;  1LM8 B;  1WJ4 A;  3L13 A;  3R7Q A;  5DPT A;  4W9C A;  3SHQ A;  3NY5 A;  1R4N I;  3VFK A;  2KOX A;  2KFK B;  1E8Z A;  2IY0 B;  3WIM A;  4W9J A;  1E7U A;  4K81 A;  4MGY E;  3VXW A;  2O2V B;  4G0N B;  2N9E B;  4DDG D;  2KWC A;  1A5R A;  1K8R B;  3L16 A;  4LJO B;  4ANU A;  2EMT A;  1UH6 A;  1TZ1 A;  2NPT A;  2XK5 A;  5AEK B;  2DAJ A;  4M8N A;  2CHX A;  4BFR A;  3SD5 A;  4N9F 4;  5AZG A;  2LWP A;  2GMI C;  3PHX B;  4HCP B;  4GGQ A;  3VUW A;  3VAW A;  2L00 B;  4RM8 A;  1TBE A;  4XZ4 A;  4KVG B;  3X23 A;  1JRU A;  1V5T A;  3VH3 B;  2G4S A;  1GJZ A;  4AWJ A;  2UYZ B;  2B3A A;  2KTR B;  3IHP C;  4HPM B;  2NPT B;  4ZRI A;  1XD3 B;  3R66 C;  2ZNV B;  3QAR A;  1VCB A;  3MTN B;  2ZVO A;  2NBW B;  5DPR A;  2DZK A;  1WGY A;  3OJ4 B;  2KDE B;  1SIF A;  3V62 A;  4URK A;  3WAP A;  2KC1 A;  2KFJ A;  2PE6 B;  3N3K B;  2XK5 B;  1J8C A;  5C1Z A;  2GBR A;  3V61 A;  5GMV A;  1Q5W B;  3V6C B;  1PQS A;  1R4M I;  1WR6 E;  4KSK C;  5E6O A;  1U4A A;  2WYQ A;  4JGH B;  2KLG A;  3T9L A;  3DPD A;  3O65 B;  2YLM A;  4LCD E;  1YX5 B;  2KDI A;  4ZYN A;  5JH5 C;  1RLF A;  4IM3 A;  3GOE A;  3ALB A;  2GBK A;  1WM2 A;  4MSQ B;  3CF6 E;  3B1L X;  4PS7 A;  1EO6 A;  4IWO A;  2L3Z A;  2O6V B;  3AUL A;  1EF1 A;  3A9K A;  4II2 B;  5JZE B;  2JY6 A;  1GC6 A;  1CMX B;  3EHV A;  4WWP A;  4BOS C;  5J18 A;  2KWV B;  2ZEQ A;  1UBI A;  5FR6 A;  2M0X A;  1NI2 A;  2AL6 A;  3QQ8 B;  3QX1 A;  3S2A A;  2KC2 A;  3DVN V;  2N1V A;  1UD7 A;  1RFA A;  2MCN B;  4JL9 A;  3ZKJ C;  4BKS D;  3A9J B;  4FBJ B;  4TV3 A;  4MGZ E;  2OOB B;  2BPS A;  4GDL B;  1E5W A;  1V49 A;  2ZZP B;  5J17 A;  4BVU C;  2XEW A;  4BKT A;  2DYB A;  2AL3 A;  4W9L A;  4BKG A;  4KZ0 A;  3AU4 A;  1WFY A;  1V80 A;  4K1R B;  2BYE A;  1HE8 A;  2PEA A;  3NS8 A;  2HD5 B;  3WA0 A;  2AEH A;  2LRU A;  2GBM A;  2REX A;  3H7P B;  2JZZ A;  2AWT A;  3EC8 A;  1YQB A;  2EKE C;  3VHT C;  4EZL A;  4K7U A;  2PJH A;  4GXB A;  4CO7 A;  4DHZ B;  4LDT D;  2K8C A;  2K1F A;  4DHZ E;  4K7S A;  2K8H A;  1WJN A;  2C9W B;  3AU5 A;  3HIZ A;  4ASW C;  4CYE A;  2DYM A;  2RGF A;  3VUX A;  5HKH A;  2J0M A;  1WXV A;  4HVB A;  1WXS A;  4PYU A;  1EUV B;  3D32 A;  2UWQ A;  2MX2 A;  4OVV A;  1WX7 A;  1WY8 A;  4FJV B;  4EZJ A;  5IA7 A;  1WGH A;  2O2V A;  2VRR B;  2V3S A;  4HLE A;  1V81 A;  1UEL A;  2GBJ A;  2RSU A;  3DVG X;  3ZNH B;  1V5O A;  2W9N A;  5TR5 A;  2C7N B;  3RYT A;  4AOF A;  2A4Z A;  4W9G A;  3WAL A;  1WYW B;  3A33 B;  4BBN F;  2KK8 A;  4PS8 A;  4W9K A;  3TMP B;  1V9J A;  1KOT A;  2ZCC A;  3QIJ A;  2I1K A;  2MRP A;  3UQA A;  1P98 A;  3UIO B;  2XBB C;  1Q1O A;  4OVU A;  1X1M A;  2YVC A;  2BF8 B;  2WX0 A;  5L83 A;  4MEL A;  1WX8 A;  4IM0 A;  3UGB B;  1WGD A;  3NZU A;  4HJK A;  4WJP A;  3K9O B;  2JPH A;  3PRE A;  4GIV A;  2N7E A;  2JF5 A;  3PV1 A;  1L7Y A;  1UZX B;  1OTR B;  1V6E A;  3B0A A;  4IWP A;  4KV2 A;  2BKF A;  3L17 A;  4NAW A;  3KYD D;  5G2N A;  3DDC B;  4ICV A;  3LJ3 A;  3ZDT A;  2DAF A;  3DVG Y;  3DVN U;  2LI5 A;  2KD0 A;  2CU1 A;  2LGD A;  3Q3J A;  1WX9 A;  3DQV A;  4MH0 E;  4JLC A;  4XC2 A;  2JVC A;  2DZI A;  3DBH I;  2AYO B;  3H7P A;  3RZW C;  2KJ6 A;  5CHV C;  3VDZ A;  2BGF A;  1ZGU B;  5E6P A;  3MJW A;  3R3M A;  3ZO5 B;  4KIK B;  3VUY A;  2KWU B;  3W1S C;  4DDI D;  1I35 A;  2NVU I;  3N32 A;  1E8W A;  3PLU A;  4GOC A;  3PTF C;  2G3Q B;  2ZJD A;  2D11 A;  2MQJ A;  3HM6 X;  4WJN A;  4NJ6 A;  5LXH A;  2LAS A;  4A3O A;  5KHO A;  3UIP B;  4EOY A;  4TUU A;  1NBF C;  1IPG A;  4EEW A;  2R2O A;  3L08 A;  2LGY A;  4IWQ A;  3VTW A;  3RZF A;  4MEM A;  2D07 B;  1WIA A;  2V4L A;  2KVR A;  1L2N A;  2LRW A;  3OJ3 A;  4WJQ A;  2LXC A;  3WAM A;  3H6N A;  3KW5 B;  1S1Q B;  4WWO A;  4HK2 A;  1TTN A;  1IYF A;  3V6E B;  3KUD B;  2WDT B;  5D2M B;  1J19 A;  2RR9 A;  3KVF B;  4GN1 A;  4EZK A;  3IG3 A;  2FIF A;  3DCG A;  1WMH B;  4AJW A;  3WAN A;  1AAR A;  4NQL B;  2M1M A;  1MG8 A;  4DBG A;  1P3Q U;  5D6J B;  2C7H A;  3SDL C;  3QCA A;  4FN2 A;  4HXD A;  2CHZ A;  3OLM D;  4I6N B;  4HCN B;  1T0Y A;  2CS4 A;  4BOZ B;  3DBR I;  3NHE B;  2DEN B;  1E8Y A;  1ZW7 A;  4PS3 A;  2WWZ A;  4X57 B;  4GMV A;  4F1S A;  5E6N A;  1P9D U;  1QZE A;  2LVO A;  3KUC B;  4J6I A;  2LD9 A;  2IO1 B;  3A9K B;  2IO0 B;  2MA9 B;  5G55 A;  4G3X B;  2WX1 A;  4DK5 A;  2O6V D;  1WE7 A;  2JXX A;  2BWE S;  3APC A;  2IY1 B;  1ISN A;  4W9F A;  5J2R A;  2NS5 A;  2NR2 A;  1WZ3 A;  1LQB A;  2DZM A;  1SGH A;  2NBV B;  3RUL A;  2LZ6 A;  1EF5 A;  3H9D A;  4AJY B;  2J0J A;  3L54 A;  3PSE B;  4LJP B;  3PZD A;  2K6D B;  1UBQ A;  2K8B A;  4RM9 A;  2HE7 A;  5D7G A;  5AZH A;  4GDK B;  3VQI A;  4FA6 A;  5IAA C;  3JSV A;  1WI0 A;  1YX6 B;  2DYO A;  2KX3 A;  4W9E A;  2JRI B;  3RD2 A;  1TGZ B;  3APF A;  4IM2 A;  1XQQ A;  2I1J A;  2OJR A;  2DZJ A;  4K7W A;  4ZRK A;  5D94 A;  4E74 A;  1WXM A;  2K39 A;  3HK0 A;  3R7R A;  2ZPN A;  3VH4 B;  1V2Y A;  2BKR B;  4B6W A;  4E71 A;  1OQY A;  2IYD B;  4PYZ A;  4EFO A;  3ZNG C;  2LGX A;  2LUE A;  2BYF A;  2L8J A;  2JRH A;  3V60 A;  2N1W A;  2M17 A;  4A20 A;  3ZRF A;  2MBH A;  3B08 A;  4LDT B;  4MM3 A;  4MGK E;  3PLV A;  4FHK A;  4BKS A;  2JWZ A;  4MGI E;  2MBO A;  4WAA A;  1YJ1 A;  2PE9 A;  1M94 A;  1Z2M A;  3NOB A;  3QC8 B;  3IBE A;  1GG3 A;  4I6P A;  2FID A;  2FUH B;  3ENE A;  5DPW A;  3ZNZ B;  5AZF A;  2G45 B;  2KZR A;  4HDO A;  2FCQ A;  3ML8 A;  1J0G A;  3ZVV A;  1OEY J;  3EEC A;  2NCN A;  1RRB A;  1FXT B;  2MWS B;  2N9P C;  3QHT A;  1WJ6 A;  4FLH A;  2M4N A;  4YL8 A;  3APD A;  3H7S A;  4ZDV A;  2KMC A;  4IUM B;  4HWI B;  3IVF A;  3ZLZ A;  3KYC D;  1OEY A;  1Z5S B;  2KHW B;  4TKN A;  4CHK A;  3W1S A;  3UIN B;  3VTV A;  4M0W B;  2ASQ A;  4ANV A;  3ZNI D;  5JHA A;  2KFK A;  3L10 B;  3PT2 B;  1I42 A;  4II3 B;  1WGR A;  5KHQ A;  3A1Q A;  3U8Z A;  3RT3 B;  2A5U A;  3TL5 A;  2V1Y A;  2L76 A;  3TCA A;  2JZ3 B;  3ZDM C;  2IZV B;  1GUA B;  2L7R A;  1E8X A;  2N9X A;  3WAO A;  3MHS D;  3CMM B;  3PPA A;  1VD2 A;  3DBS A;  1NDD A;  4NAW B;  1H8C A;  3PRM B;  4GB9 A;  3PRZ A;  4MSM B;  4MJS A;  1P0R A;  3A4S C;  3UF8 A;  4TQ1 A;  3RUI B;  2Y5B B;  5BO4 B;  2ZVN A;  3PGE A;  4P7I A;  1WZ0 A;  2QHO A;  5LXI B;  2IO3 B;  2JT4 B;  2N7D A;  4EUT A;  2MP2 B;  2C5L C;  2MBB B;  2J0K A;  2L0F A;  2CHW A;  4F8C B;  3C0R B;  4JQW C;  4E3C A;  2KAN A;  2KKC A;  2KDF B;  4FJZ A;  2RD0 A;  2CR5 A;  1BT0 A;  2C7M B;  2NBU A;  1WF9 A;  4AUQ C;  1WH3 A;  2M8S A; 
#chains in the Genus database with same CATH topology
 3BK1 A;  2JXT A;  2KQS A;  4W9H A;  2FCM A;  4ICU A;  1SE4 A;  1LGR A;  3PZ8 A;  2LUM A;  1OQR A;  2JYT A;  1I4H A;  3AH7 A;  3ML9 A;  5FK9 C;  4HKZ E;  1E7V A;  3LB8 C;  3HHM A;  4P1B C;  2CKH B;  2MJ3 A;  1F52 A;  1RYJ A;  1JWA D;  3NVZ A;  3N1Y C;  3M62 B;  3AXC A;  4KDI C;  4WWN A;  4FXC A;  4KGR A;  3PVL A;  3DBL I;  1S3S G;  4N6E B;  2C60 A;  3UQB A;  2G4D B;  4C4V A;  3C19 A;  5AUK A;  3IFW B;  3QWZ B;  2DX5 B;  3CSF A;  3ZTC A;  3V05 A;  2INP E;  3BWU D;  1UF0 A;  4JWU C;  1ZOY B;  4NQK E;  3NRZ A;  2LVQ A;  4JWS C;  5BMG A;  1C4P A;  3CIR B;  2LXA A;  2WXI A;  1PDX A;  5H92 C;  4QAY A;  2SEB D;  1RAX A;  1SJH D;  2R2Q A;  1AW7 A;  4ZRJ A;  4M8M A;  2LHD A;  4KZC A;  1MHX A;  4ANW A;  4JIO U;  3Q3O C;  5DPS A;  4RH6 A;  4GDL A;  4IC7 B;  1Q0W B;  3L0W B;  2G1E A;  3LDZ E;  1SIJ A;  2LJ5 A;  2JQR B;  3B2F A;  3DOW A;  3Q8F A;  1JML A;  1B1Z A;  2PTL A;  4C80 A;  1QOA A;  4KSL C;  1Y8R C;  1UWM A;  3FKY A;  4KDL B;  2FNJ B;  1DYQ A;  3JSV B;  3PHW B;  2Z0E B;  3ZIM A;  1YN5 A;  1WMH A;  4W9D A;  4ANX A;  3I3T B;  2KO3 A;  3CST A;  1UUP A;  1WXA A;  4R3D A;  1C1Y B;  4I6L B;  1I4R A;  5DPT A;  4W9C A;  3SHQ A;  3VFK A;  2KOX A;  5JXV A;  4GLS C;  3T3O A;  2O2V B;  4G0N B;  4DDG D;  4M8N A;  1DGJ A;  5HI1 A;  2ONQ A;  4RM8 A;  2JZP A;  3B9J A;  3X23 A;  3TEX A;  1OQQ A;  1XD3 B;  2BB5 A;  3QAR A;  2QIL A;  4HRS A;  1VCB A;  3MTN B;  2INC C;  1TS4 A;  1WGY A;  3V62 A;  3WAP A;  1XLN A;  5C1Z A;  4YT0 B;  4RGM A;  1XLP A;  2WYQ A;  1EU4 A;  3P4R B;  4P6V F;  4IM3 A;  5BYQ A;  1FM0 D;  1SB3 C;  1HA5 A;  1GB1 A;  2O6V B;  2QJL A;  2DBY A;  1IUE A;  1EF1 A;  4KKI A;  1UBI A;  2LFI A;  2LMC A;  3DVN V;  1UD7 A;  1UWX A;  2WXJ A;  3AEA B;  1FXI A;  2OOB B;  1E5W A;  1V49 A;  3P4P B;  4KGS A;  1T0S C;  1C77 A;  1V80 A;  2HD5 B;  2LRU A;  2JZZ A;  3EC8 A;  2GI9 A;  3TSS A;  4K7U A;  4M0W A;  2TSS A;  2K1F A;  2K8C A;  2ACZ B;  1WJN A;  2RGF A;  2RPV A;  2J0M A;  3BVM A;  4HVB A;  1YN3 A;  1EUV B;  1TZO A;  2WXM A;  1E6E B;  1XEE A;  1WY8 A;  4EZJ A;  2O2V A;  1SBB B;  2LGI A;  4AOF A;  3WAL A;  1WYW B;  3A33 B;  4PS8 A;  1ZDX A;  3UQA A;  1P98 A;  3UIO B;  4OVU A;  1L6V A;  2BF8 B;  5L83 A;  4HKQ A;  4IM0 A;  3NZU A;  1MVK A;  3K9O B;  2JPH A;  4GIV A;  3PV1 A;  1L7Y A;  4WH4 A;  1ACC A;  3B0A A;  4NAW A;  2BKF A;  3L17 A;  3DDC B;  4ICV A;  1MHH E;  2LI5 A;  2AX5 A;  2LGD A;  4XC2 A;  2JVC A;  2WU5 B;  2DZI A;  3DBH I;  3H7P A;  2BGF A;  1ZGU B;  5E6P A;  3R3M A;  4ITK A;  4YXD B;  4DDI D;  1C76 A;  3ABV B;  3N32 A;  3PLU A;  4GOC A;  3PTF C;  2D11 A;  4WJN A;  4A3O A;  1EM7 A;  4ZHO A;  4EEW A;  4ARC A;  3P63 A;  4IWQ A;  1J7C A;  4WJQ A;  3HVD A;  4REZ A;  3WAM A;  1S1Q B;  4HK2 A;  3V6E B;  4XWW A;  1J19 A;  3KVF B;  3NZ3 A;  3P4Q B;  2FIF A;  3TEZ A;  1FRD A;  3AEC B;  4NQL B;  3BVG A;  3Q8A A;  1CZP A;  2C7H A;  1NEK B;  1R4N B;  3SFD B;  1E8Y A;  3I57 A;  3RNF C;  2FBW B;  3AEF B;  2LVO A;  3KUC B;  5G55 A;  4DK5 A;  2O6V D;  2JXX A;  4W9F A;  2NS5 A;  1FPY A;  2VH2 A;  3RUL A;  1F77 A;  1EF5 A;  4A9A A;  3AM9 A;  3L54 A;  3PSE B;  1FRR A;  1UBQ A;  2K8B A;  2PLP A;  2IPK D;  2N0S B;  3JSV A;  2KX3 A;  1TY2 A;  3Q8E A;  3Q69 A;  4ZRK A;  2OJW A;  1WXM A;  2K39 A;  2ZPN A;  4KX6 B;  2BS3 B;  1D4B A;  3GP7 A;  2KT7 A;  2LUE A;  2BYF A;  2L8J A;  4DQO C;  4LTU A;  1EWC A;  1FMA D;  4HEA 1;  4A8X C;  4MM3 A;  3N9Y C;  2OED A;  4FHK A;  3V3X A;  1M94 A;  3QC8 B;  1VRA B;  3MC0 B;  5BYS A;  1FD6 A;  2G45 B;  1RFK A;  1L0X B;  2RDH A;  2FCQ A;  1OEY J;  3EEC A;  3QHT A;  2WGS A;  3H7S A;  4L23 A;  1OEY A;  5E6J A;  1Z5S B;  2KHW B;  4TKN A;  3W1S A;  3VTV A;  2ASQ A;  4JE3 B;  3ZJU A;  1HTO A;  1XLO A;  3W9C B;  1I42 A;  3BII D;  3OWE B;  2V1Y A;  3TCA A;  2W3S A;  5H8Y E;  2PIA A;  3PRM B;  3R8B A;  3Q3N C;  4MJS A;  2NTT A;  4TQ1 A;  2ZVN A;  4P7I A;  2QHO A;  1N61 A;  5LXI B;  2WU2 B;  2XNA C;  3AE3 B;  3AEB B;  2C5L C;  4C7Z A;  3FIL B;  2CHW A;  3E56 A;  5HFY A;  1WXQ A;  2CR5 A;  2NBU A;  1WH3 A;  1F2R C;  4LLG M;  2RPQ A;  4P16 A;  2ZNV C;  3M63 B;  4F7Z A;  2KDB A;  4GDK A;  4HDQ A;  2KMA A;  4PT5 A;  1FXA A;  3GZN I;  1C3T A;  2HDE A;  2JU6 X;  2FCS A;  4HPL B;  3DHH C;  4ACF A;  3RNC C;  3PRP B;  3Q8B A;  2WLB A;  2KJH B;  1SSN A;  3AB5 A;  3ONS A;  2EKI A;  3M3J A;  2SAK A;  3H1U A;  4KIK A;  1H4R A;  3U7D A;  3K9P B;  2E6X A;  4WQM A;  3ZRC A;  1FCC C;  4NNJ B;  2V3N A;  2WXO A;  3MFG A;  4TQ0 A;  2V3P A;  3DWM A;  3RN9 C;  3KH0 A;  1GNU A;  1WM3 A;  4A90 A;  3ZJT A;  2M0A A;  2KDM A;  1YJI A;  3ZUN A;  1UGM A;  5JHB A;  3IT4 B;  1WRI A;  3QJZ A;  4H2A A;  4S17 A;  3DHG C;  1XO3 A;  2JUO A;  3EUB 2;  4WJO A;  3ZTD A;  3A4R A;  1C78 A;  1N62 A;  1WR1 A;  2DLB A;  1AN8 A;  2I2Y A;  3PS6 A;  1LFD A;  1IGC A;  1OGW A;  4B95 A;  2GBN A;  5L95 C;  3ECI A;  3RCZ A;  2K25 A;  4G50 A;  2KTF A;  4FHJ A;  4RMA A;  3SR6 A;  1FNW A;  4DXA B;  1D3Z A;  2D2Q A;  3HM3 A;  1SE9 A;  3P2B A;  4WWM A;  1WJU A;  2KNB A;  3TEY A;  5EDS A;  1WJ4 A;  2PKO A;  1E8Z A;  3WIM A;  5BMH A;  3AEG B;  1I4G A;  5EE0 A;  1A5R A;  4J3O D;  1UH6 A;  1TZ1 A;  1QOG A;  2CHX A;  5AZG A;  1FFV A;  3PHX B;  1D5Z C;  1VZ8 A;  3VUW A;  3VAW A;  3EA6 A;  1TBE A;  1V5T A;  1GJZ A;  1K50 A;  1TKE A;  4AWJ A;  2L1A A;  2W3R A;  3R66 C;  2ZNV B;  3BK2 A;  4HPP A;  2ZVO A;  5DPR A;  2LHE A;  3NG0 A;  2DZK A;  3OJ4 B;  1FFU A;  1TJE A;  1SIF A;  4URK A;  2KFJ A;  2PE6 B;  1J8C A;  2GBR A;  1JQ4 A;  5GMV A;  3BYT B;  2DNF A;  1PQS A;  1PFD A;  3DBH B;  1NEN B;  3DPD A;  3L4P A;  2KDI A;  1RLF A;  3ALB A;  4MSQ B;  2KAJ A;  2K22 A;  3IXS A;  3URY A;  4IWO A;  3AUL A;  4OZB A;  4II2 B;  4N59 A;  1E9M A;  5J18 A;  3ZXR A;  2ZEQ A;  5FR6 A;  1NI2 A;  2E3T A;  4JL9 A;  1MG4 A;  2MJE A;  4BKS D;  3A9J B;  3FAH A;  1N63 A;  4TV3 A;  4MGZ E;  2X38 A;  4YTP B;  1HTQ A;  2DYB A;  2AL3 A;  2CJO A;  4BKG A;  2BYE A;  2PEA A;  3NS8 A;  3PZ7 A;  4TSS A;  2REX A;  3H7P B;  5G5H A;  3VHT C;  2EKE C;  4EZL A;  1ESF A;  4YTM B;  4GXB A;  4DHZ E;  2WXG A;  3ZGZ A;  3AU5 A;  2L83 A;  2N7J A;  1D5M C;  4RFB A;  3VUX A;  5HKH A;  5IO9 A;  1WXS A;  1ZUD 2;  1VLB A;  1FEH A;  4OVV A;  1WGH A;  2V3S A;  4HLE A;  1V81 A;  4JPS A;  1NVI D;  3OG5 A;  2A4Z A;  4D2K A;  4BBN F;  4DXG A;  2WDR B;  3QIJ A;  4LK0 M;  1KLG D;  2K0P A;  2QC8 A;  2I38 A;  2KAC A;  1Q1O A;  1X1M A;  2WX0 A;  4BZA A;  3UGB B;  2D3C A;  1WGD A;  1GB4 A;  3PRE A;  2N7E A;  1UZX B;  1OTR B;  2J52 A;  1E0Z A;  3KYD D;  2DAF A;  3DVN U;  4LNF A;  2KD0 A;  3Q3J A;  1WX9 A;  4JLC A;  3I5J C;  2AYO B;  2WDQ B;  5CHV C;  4C7Y A;  1K53 A;  1L4D B;  3MJW A;  3ZO5 B;  2HTM E;  4KIK B;  2KN4 A;  2KWU B;  3W1S C;  4NAM A;  3FC4 A;  2NVU I;  2G3Q B;  1UNS A;  3HM6 X;  1E10 A;  2LAS A;  5KHO A;  1NBF C;  3RZF A;  2D07 B;  2V4L A;  2KVR A;  1WWT A;  2LRW A;  2GB1 A;  3OJ3 A;  3H6N A;  4USA A;  1Y56 A;  1TTN A;  3KUD B;  1KLU D;  4EZK A;  3GS2 A;  2OHF A;  4YSZ B;  3DCG A;  3WAN A;  1AAR A;  4ZHP A;  1MG8 A;  1P3Q U;  5D6J B;  3IAM 1;  2WNM A;  2CHZ A;  2QDF A;  4ZYS A;  1QZE A;  4J6I A;  2LD9 A;  2PMV A;  1C79 A;  1UGJ A;  2R61 A;  4G3X B;  2BWE S;  5J2R A;  2NR2 A;  1WZ3 A;  5I4D A;  2LEK A;  2LZ6 A;  4UDU C;  4A6Q A;  2D3B A;  3VQI A;  3NVY A;  5D7G A;  2HE7 A;  5AZH A;  5IAA C;  4A55 A;  1WI0 A;  1YX6 B;  2J42 A;  1JWB D;  2K3U A;  1TGZ B;  1HZ6 A;  4IM2 A;  2I1J A;  4K7W A;  3NS1 A;  3VH4 B;  1DOI A;  4XE0 A;  4B6W A;  2WXH A;  2HJ1 A;  4E71 A;  1OQY A;  2LGX A;  3HVZ A;  1ENF A;  5HHD G;  2N1W A;  3Q6B A;  3NJT A;  4YWG G;  3PLV A;  4BKS A;  2MBO A;  2PE9 A;  3R2I A;  5FR3 A;  1GG3 A;  2FID A;  1HQR D;  1T0Q C;  1V1O A;  1YOV B;  1I4P A;  3WCQ A;  1FXT B;  2M4N A;  1CJE A;  1KF6 B;  4RF1 A;  3KYC D;  3AE4 B;  2QSD A;  1YQ3 B;  3UIN B;  1L0Y B;  5JHA A;  2KFK A;  2BBC A;  3AE8 B;  1T6B X;  2JZ3 B;  2IZV B;  1GUA B;  3WAO A;  1VD2 A;  2QMT A;  3DBS A;  1H8C A;  3PRZ A;  1P0R A;  3A4S C;  3UF8 A;  2BQQ A;  5BO4 B;  1I4Q A;  2K9X A;  1WZ0 A;  4AS1 A;  2BT6 A;  1HEZ E;  2MBB B;  2J0K A;  4F8C B;  2KAN A;  2KDF B;  1BT0 A;  1FCL A;  3U7Z A;  2M8S A;  3VVW B;  3JW0 X;  2N9L A;  1JWM D;  1WGG A;  1QF6 A;  3NZS A;  2D3G A;  3AI5 A;  4OZC A;  1F9J A;  2Y5C A;  4IG7 B;  4DHJ B;  3RPF C;  2J7Q B;  4GU2 A;  2IBI B;  5CX3 A;  3ZYY X;  5LNK 1;  1XT9 B;  4DWF A;  2DHZ A;  4NJC A;  1I7H A;  4GSW A;  3TBL D;  2PPH A;  4AP4 C;  4IOI E;  1NI3 A;  4PK1 A;  1BXT A;  4NY0 A;  1QQR A;  3HRD D;  3OAW A;  4G11 A;  2RDG A;  1QOF A;  3VTU A;  3DWG C;  5BMI A;  3QA8 A;  2N4F A;  5MPO A;  3QAQ A;  2KQ4 X;  1FIQ A;  4WQO B;  2KN5 A;  3N30 A;  1VDV A;  3BY4 B;  2WXF A;  2MW5 A;  3Q3F A;  2IO2 B;  4FUL A;  1KM7 A;  1GOZ A;  2MLB A;  2O6V A;  1P1A A;  2Z59 B;  3BIN A;  1MFW A;  3BZD B;  3IAS 1;  2MHJ A;  1N5X A;  3U2S C;  2ZCB A;  4MT5 A;  4DHJ D;  2KJR A;  2MBE A;  2IJ0 A;  2Y3A A;  1JRO A;  2ZPY A;  4B9K A;  2GOW A;  3TEW A;  3HUI A;  3RMK C;  2W54 A;  1LO5 D;  4IDI A;  1IBX A;  4NPN A;  1NYR A;  2BYV E;  4OVZ A;  4YTN B;  2D10 A;  3M95 A;  4FAD A;  1YNT E;  1ZKH A;  2L0T A;  3P42 A;  4CQN A;  2NTS A;  4A3P A;  2KLC A;  1GC7 A;  3I63 C;  5C23 A;  3ZJV A;  1I4X A;  3AE2 B;  3ZW3 A;  5CHF A;  1YJJ A;  1LM8 B;  3L13 A;  1R4N I;  2QEJ C;  4W9J A;  3VXW A;  1JWS D;  2N9E B;  4ARI A;  2KWC A;  1K8R B;  3AE7 B;  4KGT A;  4LJO B;  5TSS A;  2EMT A;  5AEK B;  3AEE B;  1KFY B;  4BFR A;  3SD5 A;  4N9F 4;  2LWP A;  4MM3 B;  2GMI C;  4HCP B;  3RI7 C;  2WXK A;  2L00 B;  4XZ4 A;  2BYT A;  4KVG B;  1KRH A;  1JRU A;  3VH3 B;  2G4S A;  1AYF A;  2UYZ B;  1YMH E;  2B3A A;  2KTR B;  4HPM B;  2NPT B;  4S0R A;  5EE3 A;  1QLB B;  2BS4 B;  1D6E C;  2JSV X;  2FUG 1;  2KDE B;  4HRO A;  4AQ7 A;  1V1P A;  3V61 A;  3W5V B;  1PGX A;  1R4M I;  1WR6 E;  2INN E;  1U4A A;  4JGH B;  1F0Z A;  4L1B A;  3O65 B;  4LCD E;  4ZYN A;  4LNN A;  5JH5 C;  3CF6 E;  3B1L X;  4PS7 A;  2WXR A;  1EO6 A;  3DHI C;  2L3Z A;  5JZE B;  3U52 E;  3RNB C;  2JY6 A;  4WWP A;  4BOS C;  3RNA C;  2AL6 A;  4EE2 A;  1MJD A;  3FIL A;  2X8X X;  3EFC A;  2WS3 B;  2BPS A;  3Q2A C;  4GDL B;  4OW0 A;  5J17 A;  2ZZP B;  2XEW A;  2J4X A;  4KZ0 A;  1WFY A;  4K1R B;  4TMA B;  4RGT A;  2GBM A;  5IOI A;  2PJH A;  3RFZ B;  1AWD A;  1TKY A;  2IGH A;  4DHZ B;  4LDT D;  2K8H A;  2C9W B;  4ASW C;  1XF5 L;  2DYM A;  1WXV A;  2UWQ A;  2MX2 A;  2RMM A;  1N6Z A;  4LNK A;  2Z8L A;  2JWU A;  2AQ1 B;  2EEL A;  1UEL A;  1V5O A;  2W9N A;  2C7N B;  4W9G A;  3B2G A;  5BYR A;  2ZCC A;  1GAQ B;  4RNA A;  1CQV A;  2MRP A;  2XBB C;  1PUT A;  1ROE A;  1WX8 A;  3W2D A;  1V6E A;  1JW9 D;  4IWP A;  4KV2 A;  5G2N A;  4US9 A;  3LJ3 A;  4RGN A;  3TUO A;  1BUI C;  3N1X C;  4OZA A;  1YQ4 B;  5G5G A;  4MH0 E;  3MC9 A;  1SJE D;  3UI3 A;  2LJI A;  4B0E A;  3RZW C;  1WYG A;  3VDZ A;  3PO0 A;  4XDD A;  5C3J B;  3VUY A;  1I35 A;  1V8C A;  4LNI A;  2MQJ A;  4TUU A;  1IPG A;  1T5X D;  2R2O A;  3L08 A;  3VTW A;  4MEM A;  4M02 A;  1L2N A;  3KW5 B;  4WWO A;  1IGD A;  1R4M B;  1IYF A;  1KH0 A;  2KMM A;  2WDT B;  1J7B A;  5D2M B;  2JX5 A;  2RR9 A;  1VZ7 A;  3MC8 A;  4GN1 A;  1TY0 A;  1ZP0 B;  4AJW A;  2M1M A;  4DBG A;  2BTE A;  4I6N B;  4BOZ B;  3DBR I;  1VR9 A;  2KWD A;  4PS3 A;  4X57 B;  5E6N A;  3A9K B;  2MA9 B;  2QIE B;  3AN1 A;  2DZM A;  1LQB A;  1SGH A;  2J53 A;  3R2T A;  4AJY B;  2WQY B;  2J0J A;  2WXQ A;  3O13 A;  4LJP B;  2K6D B;  4GDK B;  2H89 B;  1SEB D;  2PW9 A;  1WSP A;  4W9E A;  2JRI B;  3RD2 A;  1DOX A;  3E9S A;  3APF A;  1XQQ A;  1XCT L;  5D94 A;  5HG2 A;  3HK0 A;  3R7R A;  1FO4 A;  2BKR B;  3ZNG C;  3AV8 A;  3P4S B;  2WXP A;  2PVG C;  1SF0 A;  4RGO S;  4XWT A;  3ZRF A;  4LDT B;  4RF0 A;  4MGI E;  1FNU A;  4WAA A;  4I6P A;  2FUH B;  3ENE A;  5DPW A;  2GLS A;  5AZF A;  2KZR A;  4HDO A;  1J0G A;  2WXN A;  1SE2 A;  2NCN A;  1RRB A;  2MWS B;  1ET6 A;  4YL8 A;  3APD A;  2KMC A;  3IVF A;  2LGS A;  4NZL B;  3DBL B;  3ETR A;  1EU3 A;  4XYC A;  1D5X C;  4CHK A;  1J7A A;  2BVC A;  4M0W B;  4ANV A;  3ZNI D;  1P7F A;  3SEB A;  3L10 B;  3LXF A;  4II3 B;  5KHQ A;  1EWY C;  2WXL A;  3U8Z A;  1STE A;  3KLS X;  2A5U A;  3TL5 A;  4WIP A;  2L76 A;  3ZDM C;  5IP4 D;  2N9K A;  2L7R A;  1E8X A;  3CMM B;  4B0M A;  3PPA A;  4NAW B;  1NDD A;  1SXT A;  3Q3M C;  4GB9 A;  4MSM B;  3CWI A;  3RUI B;  2Y5B B;  3PGE A;  2AQ2 B;  2IO3 B;  4EUT A;  1XCQ L;  4JX1 C;  4JQW C;  4E3C A;  3VR8 B;  4FJZ A;  4ZOH C;  3GB1 A;  4WAF A;  1WF9 A;  4EFO A;  1ET9 A;  3T8M A;  2V9H A;  2IND C;  1WE6 A;  3RNG C;  2IGG A;  4C00 A;  2MP2 A;  4BBN C;  4KKJ A;  1N5W A;  1QOB A;  3AE6 B;  1L0V B;  1KLV A;  1PGB A;  3MHZ A;  5DCN A;  2LVP A;  4ZRP A;  3SU8 X;  1LXD A;  5EE1 A;  4NJ7 A;  2V0G A;  2L32 A;  2WHI A;  1TS5 A;  1YD8 U;  1HZ5 A;  2KTR A;  3AMZ A;  1L6U A;  3IT6 B;  4IW0 A;  1JRP A;  2BWF A;  2KXJ A;  3JVZ X;  1IP9 A;  3A1Q B;  4ZRQ A;  5AUI A;  1HXY D;  2HJ8 A;  4FJY A;  2ON8 A;  1KJT A;  4XX5 A;  2MSE D;  3GZN B;  1V86 A;  2MBQ A;  3TJP A;  3JYU A;  3ZQ4 A;  2FAZ A;  4DXF A;  2KX0 A;  4YSX B;  5CHW A;  1QT9 A;  2L05 A;  4C4V B;  4L2Y A;  2VH1 A;  3BYY B;  3W1Y A;  3EFU A;  5CTR C;  2DWQ A;  1QIL A;  4HJG E;  2KQ7 A;  5C2T B;  3X0W A;  2FCN A;  3A9J A;  2BB6 A;  1ZPS A;  1T3Q A;  1FNV A;  4MJS B;  1G6J A;  5IKC M;  1E90 A;  2H88 B;  5LLI A;  2M19 A;  3QK0 A;  4EKU A;  1E7P B;  1KTK A;  3TIX A;  2EMS A;  4XDC A;  1WRD B;  2WDV B;  4US8 A;  3T3N A;  3U30 A;  2IDY A;  3VR9 B;  2UU7 A;  1L5P A;  4Q2J A;  4MDK E;  2Z0D B;  1TKG A;  3J9C A;  2HTH A;  3KUZ A;  4W9I A;  4O1N A;  1YIW A;  2YEP B;  1ZDV A;  3P1M A;  2K6Q A;  3DBR B;  3R7Q A;  2KYW A;  5D3D A;  3Q14 C;  3NY5 A;  3W5U B;  2KFK B;  2IY0 B;  1E7U A;  4K81 A;  4MGY E;  2Y5P A;  1T0R C;  2QCZ A;  3L16 A;  4ANU A;  2XK5 A;  2BW2 A;  2NPT A;  3MJ5 A;  2DAJ A;  2Q5W D;  1OFF A;  4GGQ A;  4MAC A;  3AE5 B;  1TT5 B;  3IHP C;  2VZK B;  4ZRI A;  2NBW B;  2FE8 A;  4K3C A;  1TYG B;  3VRA B;  1TS3 A;  2KC1 A;  3N3K B;  2XK5 B;  3KQ4 A;  1Q5W B;  1DOY A;  3V6C B;  4KSK C;  3EGR A;  1Q10 A;  5E6O A;  2KLG A;  3T9L A;  2CU3 A;  1R7S A;  1JWU D;  2YLM A;  1YX5 B;  1JAL A;  2D3A A;  3GOE A;  2GBK A;  1WM2 A;  1YN4 A;  4BAX A;  3KWL A;  5GXG B;  5T8I A;  3A9K A;  4LNO A;  3MP9 A;  1GC6 A;  1CMX B;  2ICI A;  3EHV A;  2IGD A;  2KWV B;  2M56 B;  2M0X A;  3QQ8 B;  3S2A A;  3QX1 A;  2KC2 A;  2N1V A;  4YSY B;  1RFA A;  2MCN B;  3ZKJ C;  2RDB C;  4M01 A;  4FBJ B;  1L4Z B;  1JCK B;  4BVU C;  4BKT A;  3C8Y A;  4W9L A;  3AU4 A;  1HE8 A;  3WA0 A;  2AEH A;  3U4E G;  2AWT A;  4IKG A;  1YQB A;  3GE3 C;  1VZ6 A;  2MH7 A;  4CO7 A;  1ZXI A;  4K7S A;  4CYE A;  3HIZ A;  2K5P A;  4PYU A;  3D32 A;  1WX7 A;  4M00 A;  1C9F A;  4FJV B;  5IA7 A;  2VRR B;  1M4V A;  3NUH B;  2GBJ A;  2RSU A;  3DVG X;  3ZNH B;  5TR5 A;  1QKZ A;  3RYT A;  5IN7 A;  3AE1 B;  1TIF A;  2KK8 A;  1P7E A;  3SFE B;  1C4C A;  3RNE C;  4W9K A;  3TMP B;  1V9J A;  2CJN A;  1KOT A;  2I1K A;  4OHJ A;  1ZXH A;  2KVZ A;  2YVC A;  4MEL A;  1F2R I;  1K52 A;  1V97 A;  4WJP A;  4HJK A;  2V4I B;  1MPE A;  2JF5 A;  3ZDT A;  3DVG Y;  2CU1 A;  1MI0 A;  2YEP F;  3NVV A;  3DQV A;  3H8H A;  3KWV A;  1SE3 A;  2KJ6 A;  1VJK A;  4P1C C;  2WP9 B;  1E8W A;  2ZJD A;  4MH8 A;  1NYQ A;  4NJ6 A;  4XGA B;  5LXH A;  3AE9 B;  3UIP B;  4EOY A;  3GE8 C;  2LGY A;  1WIA A;  2B76 B;  2LXC A;  1XXG A;  3IG3 A;  1WMH B;  2MEK A;  1K51 A;  3SDL C;  3QCA A;  4FN2 A;  4HXD A;  3OLM D;  1WGK A;  4HCN B;  1T0Y A;  2ZW1 A;  2CS4 A;  3NHE B;  2DEN B;  4RCO A;  1ZW7 A;  2WWZ A;  4GMV A;  4F1S A;  1P9D U;  2IO1 B;  2IO0 B;  5EE9 A;  2WX1 A;  3N1Z C;  1WE7 A;  3APC A;  2IY1 B;  1ISN A;  3AED B;  1RM6 C;  2NBV B;  3H9D A;  3PZD A;  4RM9 A;  2XN9 C;  4C56 C;  4FA6 A;  1IBX B;  2DYO A;  3BVZ A;  2OJR A;  1PGA A;  2DZJ A;  1V1P B;  3N20 C;  4E74 A;  5FKA C;  1V2Y A;  1C4A A;  2VZK D;  2BS2 B;  2IYD B;  4PYZ A;  2JRH A;  3V60 A;  2M17 A;  4A20 A;  1ZE3 D;  2MBH A;  3B08 A;  1XLQ A;  1TS2 A;  3Q8C A;  1RWS A;  4MGK E;  2JWZ A;  1YJ1 A;  1Z2M A;  2NMQ A;  3NOB A;  3IBE A;  1CK1 A;  3ZNZ B;  4WUR A;  2ZW0 A;  3ML8 A;  3ZVV A;  2N9P C;  4FLH A;  1WJ6 A;  4ZDV A;  2MJD A;  3LYY A;  5D3I B;  4IUM B;  4HWI B;  1B9R A;  3ZLZ A;  2W82 A;  2JYE A;  3ZXV A;  2L52 A;  2GRI A;  2W55 A;  3PT2 B;  1WGR A;  2AQ3 B;  2G9H D;  3A1Q A;  3RT3 B;  1BML C;  2D5G A;  1N60 A;  1A70 A;  2N9X A;  3MHS D;  1PYW D;  1GPX A;  3VRB B;  4K3B A;  2PVO D;  3NVW A;  2JT4 B;  2N7D A;  2MP2 B;  3I9V 1;  4N58 A;  2L0F A;  1F1H A;  3C0R B;  2KKC A;  2RD0 A;  2C7M B;  4AUQ C; 
#chains in the Genus database with same CATH homology
 3VVW B;  3JW0 X;  1WGG A;  3T8M A;  2KQS A;  3NZS A;  2RPQ A;  2D3G A;  3AI5 A;  1WE6 A;  2ZNV C;  1F9J A;  3M63 B;  4F7Z A;  2KDB A;  4GDK A;  2FCM A;  4HDQ A;  4ICU A;  4IG7 B;  4W9H A;  4DHJ B;  2J7Q B;  2MP2 A;  4BBN C;  2KMA A;  4GU2 A;  2IBI B;  3ML9 A;  5CX3 A;  3GZN I;  1C3T A;  1KLV A;  1E7V A;  2FCS A;  1XT9 B;  4DWF A;  3HHM A;  2DHZ A;  2CKH B;  4HPL B;  4GSW A;  5DCN A;  2LVP A;  3TBL D;  3SU8 X;  1LXD A;  3M62 B;  2PPH A;  4NJ7 A;  4AP4 C;  3PRP B;  3AXC A;  4NY0 A;  4KDI C;  1YD8 U;  4G11 A;  3OAW A;  2KTR A;  4WWN A;  3VTU A;  3PVL A;  4IW0 A;  2KJH B;  2BWF A;  3DBL I;  2KXJ A;  3JVZ X;  3ONS A;  3M3J A;  1S3S G;  3H1U A;  4KIK A;  2C60 A;  1IP9 A;  3A1Q B;  3UQB A;  1H4R A;  3QA8 A;  3U7D A;  3K9P B;  2N4F A;  2G4D B;  2HJ8 A;  4FJY A;  1KJT A;  3ZRC A;  4NNJ B;  3QAQ A;  4XX5 A;  2MSE D;  3IFW B;  4WQO B;  2KN5 A;  3QWZ B;  1V86 A;  2DX5 B;  4TQ0 A;  2MBQ A;  3CSF A;  3JYU A;  3N30 A;  3TJP A;  3ZTC A;  3KH0 A;  3BY4 B;  2FAZ A;  1GNU A;  1WM3 A;  2KX0 A;  4NQK E;  2LVQ A;  2MW5 A;  3Q3F A;  5CHW A;  2IO2 B;  4FUL A;  3ZUN A;  1UGM A;  1KM7 A;  2LXA A;  5JHB A;  2L05 A;  3QJZ A;  2MLB A;  2O6V A;  1P1A A;  2Z59 B;  3BIN A;  2JUO A;  1RAX A;  3W1Y A;  4WJO A;  3EFU A;  5CTR C;  3ZTD A;  2R2Q A;  3A4R A;  4ZRJ A;  2ZCB A;  4M8M A;  4DHJ D;  2KJR A;  2KQ7 A;  4KZC A;  3X0W A;  4ANW A;  2MBE A;  1WR1 A;  2FCN A;  3A9J A;  2ZPY A;  4JIO U;  4B9K A;  5DPS A;  2GOW A;  4MJS B;  4GDL A;  1G6J A;  4IC7 B;  1Q0W B;  1E90 A;  3PS6 A;  3L0W B;  1LFD A;  3LDZ E;  2LJ5 A;  5LLI A;  1OGW A;  3QK0 A;  3DOW A;  4EKU A;  4B95 A;  2GBN A;  5L95 C;  3ECI A;  3RCZ A;  2K25 A;  4G50 A;  3TIX A;  4NPN A;  2BYV E;  2EMS A;  2KTF A;  4FHJ A;  1WRD B;  2D10 A;  4RMA A;  3M95 A;  4DXA B;  1D3Z A;  3U30 A;  4FAD A;  2D2Q A;  4KSL C;  1Y8R C;  3HM3 A;  1ZKH A;  1SE9 A;  2L0T A;  4KDL B;  2FNJ B;  4MDK E;  2Z0D B;  3JSV B;  3PHW B;  2Z0E B;  3P2B A;  2HTH A;  4A3P A;  3ZIM A;  2KLC A;  1WMH A;  3KUZ A;  4W9D A;  4ANX A;  1WJU A;  4W9I A;  2KNB A;  1GC7 A;  3I3T B;  2KO3 A;  1YIW A;  3CST A;  5C23 A;  1WXA A;  3ZW3 A;  5EDS A;  5CHF A;  1C1Y B;  4I6L B;  2K6Q A;  1LM8 B;  1WJ4 A;  3L13 A;  3R7Q A;  5DPT A;  4W9C A;  3SHQ A;  3NY5 A;  1R4N I;  3VFK A;  2KOX A;  2KFK B;  1E8Z A;  2IY0 B;  3WIM A;  4W9J A;  1E7U A;  4K81 A;  4MGY E;  3VXW A;  2O2V B;  4G0N B;  2N9E B;  4DDG D;  2KWC A;  1A5R A;  1K8R B;  3L16 A;  4LJO B;  4ANU A;  2EMT A;  1UH6 A;  1TZ1 A;  2NPT A;  2XK5 A;  5AEK B;  2DAJ A;  4M8N A;  2CHX A;  4BFR A;  3SD5 A;  4N9F 4;  5AZG A;  2LWP A;  2GMI C;  3PHX B;  4HCP B;  4GGQ A;  3VUW A;  3VAW A;  2L00 B;  4RM8 A;  1TBE A;  4XZ4 A;  4KVG B;  3X23 A;  1JRU A;  1V5T A;  3VH3 B;  2G4S A;  1GJZ A;  4AWJ A;  2UYZ B;  2B3A A;  2KTR B;  3IHP C;  4HPM B;  2NPT B;  4ZRI A;  1XD3 B;  3R66 C;  2ZNV B;  3QAR A;  1VCB A;  3MTN B;  2ZVO A;  2NBW B;  5DPR A;  2DZK A;  1WGY A;  3OJ4 B;  2KDE B;  1SIF A;  3V62 A;  4URK A;  3WAP A;  2KC1 A;  2KFJ A;  2PE6 B;  3N3K B;  2XK5 B;  1J8C A;  5C1Z A;  2GBR A;  3V61 A;  5GMV A;  1Q5W B;  3V6C B;  1PQS A;  1R4M I;  1WR6 E;  4KSK C;  5E6O A;  1U4A A;  2WYQ A;  4JGH B;  2KLG A;  3T9L A;  3DPD A;  3O65 B;  2YLM A;  4LCD E;  1YX5 B;  2KDI A;  4ZYN A;  5JH5 C;  1RLF A;  4IM3 A;  3GOE A;  3ALB A;  2GBK A;  1WM2 A;  4MSQ B;  3CF6 E;  3B1L X;  4PS7 A;  1EO6 A;  4IWO A;  2L3Z A;  2O6V B;  3AUL A;  1EF1 A;  3A9K A;  4II2 B;  5JZE B;  2JY6 A;  1GC6 A;  1CMX B;  3EHV A;  4WWP A;  4BOS C;  5J18 A;  2KWV B;  2ZEQ A;  1UBI A;  5FR6 A;  2M0X A;  1NI2 A;  2AL6 A;  3QQ8 B;  3QX1 A;  3S2A A;  2KC2 A;  3DVN V;  2N1V A;  1UD7 A;  1RFA A;  2MCN B;  4JL9 A;  3ZKJ C;  4BKS D;  3A9J B;  4FBJ B;  4TV3 A;  4MGZ E;  2OOB B;  2BPS A;  4GDL B;  1E5W A;  1V49 A;  2ZZP B;  5J17 A;  4BVU C;  2XEW A;  4BKT A;  2DYB A;  2AL3 A;  4W9L A;  4BKG A;  4KZ0 A;  3AU4 A;  1WFY A;  1V80 A;  4K1R B;  2BYE A;  1HE8 A;  2PEA A;  3NS8 A;  2HD5 B;  3WA0 A;  2AEH A;  2LRU A;  2GBM A;  2REX A;  3H7P B;  2JZZ A;  2AWT A;  3EC8 A;  1YQB A;  2EKE C;  3VHT C;  4EZL A;  4K7U A;  2PJH A;  4GXB A;  4CO7 A;  4DHZ B;  4LDT D;  2K8C A;  2K1F A;  4DHZ E;  4K7S A;  2K8H A;  1WJN A;  2C9W B;  3AU5 A;  3HIZ A;  4ASW C;  4CYE A;  2DYM A;  2RGF A;  3VUX A;  5HKH A;  2J0M A;  1WXV A;  4HVB A;  1WXS A;  4PYU A;  1EUV B;  3D32 A;  2UWQ A;  2MX2 A;  4OVV A;  1WX7 A;  1WY8 A;  4FJV B;  4EZJ A;  5IA7 A;  1WGH A;  2O2V A;  2VRR B;  2V3S A;  4HLE A;  1V81 A;  1UEL A;  2GBJ A;  2RSU A;  3DVG X;  3ZNH B;  1V5O A;  2W9N A;  5TR5 A;  2C7N B;  3RYT A;  4AOF A;  2A4Z A;  4W9G A;  3WAL A;  1WYW B;  3A33 B;  4BBN F;  2KK8 A;  4PS8 A;  4W9K A;  3TMP B;  1V9J A;  1KOT A;  2ZCC A;  3QIJ A;  2I1K A;  2MRP A;  3UQA A;  1P98 A;  3UIO B;  2XBB C;  1Q1O A;  4OVU A;  1X1M A;  2YVC A;  2BF8 B;  2WX0 A;  5L83 A;  4MEL A;  1WX8 A;  4IM0 A;  3UGB B;  1WGD A;  3NZU A;  4HJK A;  4WJP A;  3K9O B;  2JPH A;  3PRE A;  4GIV A;  2N7E A;  2JF5 A;  3PV1 A;  1L7Y A;  1UZX B;  1OTR B;  1V6E A;  3B0A A;  4IWP A;  4KV2 A;  2BKF A;  3L17 A;  4NAW A;  3KYD D;  5G2N A;  3DDC B;  4ICV A;  3LJ3 A;  3ZDT A;  2DAF A;  3DVG Y;  3DVN U;  2LI5 A;  2KD0 A;  2CU1 A;  2LGD A;  3Q3J A;  1WX9 A;  3DQV A;  4MH0 E;  4JLC A;  4XC2 A;  2JVC A;  2DZI A;  3DBH I;  2AYO B;  3H7P A;  3RZW C;  2KJ6 A;  5CHV C;  3VDZ A;  2BGF A;  1ZGU B;  5E6P A;  3MJW A;  3R3M A;  3ZO5 B;  4KIK B;  3VUY A;  2KWU B;  3W1S C;  4DDI D;  1I35 A;  2NVU I;  3N32 A;  1E8W A;  3PLU A;  4GOC A;  3PTF C;  2G3Q B;  2ZJD A;  2D11 A;  2MQJ A;  3HM6 X;  4WJN A;  4NJ6 A;  5LXH A;  2LAS A;  4A3O A;  5KHO A;  3UIP B;  4EOY A;  4TUU A;  1NBF C;  1IPG A;  4EEW A;  2R2O A;  3L08 A;  2LGY A;  4IWQ A;  3VTW A;  3RZF A;  4MEM A;  2D07 B;  1WIA A;  2V4L A;  2KVR A;  1L2N A;  2LRW A;  3OJ3 A;  4WJQ A;  2LXC A;  3WAM A;  3H6N A;  3KW5 B;  1S1Q B;  4WWO A;  4HK2 A;  1TTN A;  1IYF A;  3V6E B;  3KUD B;  2WDT B;  5D2M B;  1J19 A;  2RR9 A;  3KVF B;  4GN1 A;  4EZK A;  3IG3 A;  2FIF A;  3DCG A;  1WMH B;  4AJW A;  3WAN A;  1AAR A;  4NQL B;  2M1M A;  1MG8 A;  4DBG A;  1P3Q U;  5D6J B;  2C7H A;  3SDL C;  3QCA A;  4FN2 A;  4HXD A;  2CHZ A;  3OLM D;  4I6N B;  4HCN B;  1T0Y A;  2CS4 A;  4BOZ B;  3DBR I;  3NHE B;  2DEN B;  1E8Y A;  1ZW7 A;  4PS3 A;  2WWZ A;  4X57 B;  4GMV A;  4F1S A;  5E6N A;  1P9D U;  1QZE A;  2LVO A;  3KUC B;  4J6I A;  2LD9 A;  2IO1 B;  3A9K B;  2IO0 B;  2MA9 B;  5G55 A;  4G3X B;  2WX1 A;  4DK5 A;  2O6V D;  1WE7 A;  2JXX A;  2BWE S;  3APC A;  2IY1 B;  1ISN A;  4W9F A;  5J2R A;  2NS5 A;  2NR2 A;  1WZ3 A;  1LQB A;  2DZM A;  1SGH A;  2NBV B;  3RUL A;  2LZ6 A;  1EF5 A;  3H9D A;  4AJY B;  2J0J A;  3L54 A;  3PSE B;  4LJP B;  3PZD A;  2K6D B;  1UBQ A;  2K8B A;  4RM9 A;  2HE7 A;  5D7G A;  5AZH A;  4GDK B;  3VQI A;  4FA6 A;  5IAA C;  3JSV A;  1WI0 A;  1YX6 B;  2DYO A;  2KX3 A;  4W9E A;  2JRI B;  3RD2 A;  1TGZ B;  3APF A;  4IM2 A;  1XQQ A;  2I1J A;  2OJR A;  2DZJ A;  4K7W A;  4ZRK A;  5D94 A;  4E74 A;  1WXM A;  2K39 A;  3HK0 A;  3R7R A;  2ZPN A;  3VH4 B;  1V2Y A;  2BKR B;  4B6W A;  4E71 A;  1OQY A;  2IYD B;  4PYZ A;  4EFO A;  3ZNG C;  2LGX A;  2LUE A;  2BYF A;  2L8J A;  2JRH A;  3V60 A;  2N1W A;  2M17 A;  4A20 A;  3ZRF A;  2MBH A;  3B08 A;  4LDT B;  4MM3 A;  4MGK E;  3PLV A;  4FHK A;  4BKS A;  2JWZ A;  4MGI E;  2MBO A;  4WAA A;  1YJ1 A;  2PE9 A;  1M94 A;  1Z2M A;  3NOB A;  3QC8 B;  3IBE A;  1GG3 A;  4I6P A;  2FID A;  2FUH B;  3ENE A;  5DPW A;  3ZNZ B;  5AZF A;  2G45 B;  2KZR A;  4HDO A;  2FCQ A;  3ML8 A;  1J0G A;  3ZVV A;  1OEY J;  3EEC A;  2NCN A;  1RRB A;  1FXT B;  2MWS B;  2N9P C;  3QHT A;  1WJ6 A;  4FLH A;  2M4N A;  4YL8 A;  3APD A;  3H7S A;  4ZDV A;  2KMC A;  4IUM B;  4HWI B;  3IVF A;  3ZLZ A;  3KYC D;  1OEY A;  1Z5S B;  2KHW B;  4TKN A;  4CHK A;  3W1S A;  3UIN B;  3VTV A;  4M0W B;  2ASQ A;  4ANV A;  3ZNI D;  5JHA A;  2KFK A;  3L10 B;  3PT2 B;  1I42 A;  4II3 B;  1WGR A;  5KHQ A;  3A1Q A;  3U8Z A;  3RT3 B;  2A5U A;  3TL5 A;  2V1Y A;  2L76 A;  3TCA A;  2JZ3 B;  3ZDM C;  2IZV B;  1GUA B;  2L7R A;  1E8X A;  2N9X A;  3WAO A;  3MHS D;  3CMM B;  3PPA A;  1VD2 A;  3DBS A;  1NDD A;  4NAW B;  1H8C A;  3PRM B;  4GB9 A;  3PRZ A;  4MSM B;  4MJS A;  1P0R A;  3A4S C;  3UF8 A;  4TQ1 A;  3RUI B;  2Y5B B;  5BO4 B;  2ZVN A;  3PGE A;  4P7I A;  1WZ0 A;  2QHO A;  5LXI B;  2IO3 B;  2JT4 B;  2N7D A;  4EUT A;  2MP2 B;  2C5L C;  2MBB B;  2J0K A;  2L0F A;  2CHW A;  4F8C B;  3C0R B;  4JQW C;  4E3C A;  2KAN A;  2KKC A;  2KDF B;  4FJZ A;  2RD0 A;  2CR5 A;  1BT0 A;  2C7M B;  2NBU A;  1WF9 A;  4AUQ C;  1WH3 A;  2M8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...