1WM2A

Crystal structure of human sumo-2 protein
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
78
structure length
78
Chain Sequence
b'TENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein SMT3B
publication title Crystal structures of the human SUMO-2 protein at 1.6 A and 1.2 A resolution: implication on the functional differences of SUMO proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 19
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2004-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wm2A00
2LGYA 4F7ZA 1RAXA 4F1SA 4GDLB 3L0WB 4FJZA 5J18A 4WJNA 2PE6B 4K1RB 1LFDA 3AXCA 3IVFA 4X57B 3W1YA 3B1LX 1Q5WB 2KVRA 4ZDVA 2DYMA 2LXCA 3CSTA 3HM3A 2D10A 2KMAA 3UINB 1WRDB 1Z5SB 4EZKA 2M17A 2C60A 3L13A 4M8MA 4W9DA 3RD2A 2KFKB 4BFRA 2MBHA 3A1QA 4MGIE 1V80A 4JLCA 3AU5A 4GDKB 2FAZA 3WANA 1IPGA 3PVLA 3KVFB 4KV2A 2NR2A 3QWZB 4ANWA 2AWTA 2D2QA 2WX0A 2EMSA 3M3JA 5C1ZA 2HTHA 4K7WA 4NPNA 5JHAA 2DX5B 2K25A 2FNJB 3NY5A 2NBWB 2JY6A 2KJHB 5CX3A 3RULA 1V9JA 3V62A 2I1KA 3QQ8B 1OQYA 3KH0A 4MGKE 3T9LA 1WY8A 4J6IA 1C1YB 3A33B 3QC8B 2NCNA 1QZEA 1RLFA 2KX0A 3ECIA 4ICVA 2LVQA 2BF8B 2WX1A 1EF1A 3R66C 4GN1A 3PRMB 1OEYA 5LLIA 3S2AA 4E3CA 4JIOU 1MG8A 4WJOA 2KXJA 1GNUA 3VXWA 4WJPA 3EFUA 2NS5A 4GB9A 4BKGA 4KIKA 2XK5B 5FR6A 2LZ6A 4JQWC 4LDTB 4GMVA 1WJ6A 2CU1A 2L05A 3TCAA 4IWOA 4ZYNA 2RPQA 2W9NA 4GGQA 2QHOA 3JSVA 2C9WB 1S3SG 3OJ4B 1WM2A 5D2MB 2RD0A 3W1SA 4KDIC 4KSKC 4MM3A 4DHJB 1I35A 4EZJA 2K8HA 1IP9A 3U30A 2LRUA 3MTNB 2WWZA 5CHFA 2JZZA 1P3QU 3MHSD 3P2BA 3PS6A 1Q0WB 5D94A 3ZW3A 2L76A 4WWPA 1WXSA 1YIWA 2DAFA 4CO7A 5L83A 2UYZB 1T0YA 1WE6A 1UGMA 4GU2A 3TBLD 1R4NI 4LCDE 2KQ7A 3EHVA 2FCNA 4PS7A 5HKHA 3QA8A 4K7UA 4TUUA 2VRRB 3A9JA 1G6JA 4ZRIA 4KZCA 2DYBA 1LM8B 2MSED 1WR1A 3VH4B 1RFAA 2C7MB 3TL5A 4EZLA 1GJZA 2CS4A 2KC2A 2V4LA 3A1QB 4BBNC 3PLUA 2A4ZA 3DQVA 3M63B 1GG3A 1WH3A 4LJPB 2Y5BB 3RYTA 2IY1B 2K8BA 3R7RA 3VAWA 4HK2A 3ZUNA 4DDID 2LASA 3V6CB 2KWUB 2GOWA 3VUYA 1C3TA 2CHWA 5AZHA 2GBJA 5EDSA 3Q3FA 2D07B 5E6NA 1P9DU 3CMMB 3ZDMC 2KANA 2N9XA 4RM9A 3EECA 2JVCA 2KWVB 2XK5A 4II2B 3ZNZB 4IM2A 3WAPA 1P1AA 4DBGA 4PS3A 3UQAA 1WGYA 3ONSA 4MELA 4BKSD 2LJ5A 3DCGA 2BYFA 4DHZE 2V1YA 4K81A 2C5LC 4PS8A 4FADA 4HDOA 1V81A 5LXIB 3SD5A 2BPSA 1WXAA 4ICUA 4CYEA 1OGWA 2L7RA 2ZPYA 3B08A 4KIKB 2REXA 3VQIA 3NS8A 2L0TA 3NZSA 1CMXB 4MEMA 5CTRC 4MSQB 3ML8A 3DPDA 3ZTCA 3HM6X 5G2NA 1LXDA 3H7PA 2MRPA 1V5OA 3PV1A 3JSVB 3I3TB 2J0KA 2LVOA 1E7UA 1WXVA 2OOBB 1SGHA 2IZVB 3DVNV 1KJTA 2M1MA 3JW0X 4WWOA 1WGRA 2BYVE 3W1SC 3NZUA 3PGEA 2J0JA 3SDLC 1V86A 2NBUA 4FA6A 2K6QA 4DXAB 2FCSA 4FJYA 2MBBB 3UF8A 1UBIA 1TGZB 4BKTA 2MBQA 4W9KA 3ZLZA 1WZ3A 2FUHB 5JHBA 4I6NB 4M8NA 2CHXA 4NQLB 1YJ1A 2Z59B 3A9JB 3VUWA 1YX5B 3KUDB 2KDFB 3QCAA 2NBVB 1AARA 1S1QB 4HCNB 3BINA 4P7IA 1FXTB 1UH6A 1K8RB 1VD2A 2PEAA 2JXXA 4HWIB 4LDTD 1OTRB 2MQJA 1WJUA 4XZ4A 3PREA 3WAMA 1WI0A 1PQSA 3JVZX 2UWQA 3DBLI 2GBNA 4IW0A 1E90A 4GSWA 3N30A 2PPHA 3L10B 4ASWC 5D7GA 4IM0A 5TR5A 2KD0A 4A3PA 4FHKA 2N1VA 3ZRCA 3TIXA 4DHJD 2IO0B 1NDDA 2WDTB 4E71A 2DZMA 4KZ0A 2LWPA 2JT4B 2ZVNA 2D11A 3AULA 4FULA 1H4RA 2B3AA 4G3XB 3R3MA 4MJSA 2K1FA 2IY0B 1Q1OA 2KFJA 2ZCBA 3VHTC 1ISNA 4G50A 3OJ3A 3QJZA 4E74A 3LDZE 2O2VA 5C23A 4TQ0A 1GUAB 2MLBA 2FCMA 5GMVA 2ZNVB 4RMAA 2C7HA 2I1JA 2MP2A 3LJ3A 3WIMA 3OLMD 2DENB 4BOZB 3DVNU 3TJPA 1WYWB 4CHKA 3H7PB 3VTVA 2KC1A 4IM3A 2MCNB 2ZEQA 4M0WB 3L17A 3JYUA 2J0MA 2KO3A 1WZ0A 3VFKA 3UGBB 3SU8X 3MJWA 1WM3A 3U7DA 2ZPNA 5J17A 5LXHA 3PT2B 2L0FA 2O6VA 4EEWA 3ZRFA 4MGZE 1U4AA 3M62B 2DZKA 1WGDA 3IFWB 1LQBA 2KLGA 2RSUA 4N9F4 2ZVOA 1F9JA 3OAWA 4KVGB 1WE7A 1WX8A 2LI5A 3C0RB 2DAJA 1V49A 4FBJB 3NHEB 2YLMA 3Q3JA 3APFA 2G4SA 1WGHA 2WYQA 2N9EB 2XBBC 2ASQA 4NAWA 4WWNA 1XT9B 2PE9A 3KUZA 3APCA 4MGYE 1J0GA 4ANVA 4A20A 3HK0A 1ZKHA 2CHZA 2EMTA 4LJOB 2G4DB 2DYOA 4II3B 5DPSA 5E6OA 2N7DA 2MBOA 2KDEB 1YQBA 2KTRA 3KYCD 4FJVB 3CSFA 3UIOB 3UIPB 3A4RA 2V3SA 3PLVA 2KZRA 3ZNID 5IA7A 2Z0EB 3RCZA 3KW5B 4TV3A 4MSMB 4B9KA 1KLVA 2L00B 3U8ZA 2IO3B 1P0RA 3HHMA 4I6PA 2ZJDA 2A5UA 2XEWA 3PPAA 1J8CA 2JRIB 3RT3B 1GC6A 3BY4B 1E8ZA 5L95C 4NQKE 1D3ZA 2NPTB 2HE7A 2G3QB 4HCPB 4DHZB 1L2NA 2JUOA 2KQSA 4NJ6A 3KYDD 2N7EA 4MJSB 4AJWA 4DDGD 2G45B 2KTFA 1A5RA 4WJQA 1WJ4A 3ML9A 2BGFA 4TQ1A 3VTUA 1I42A 2O2VB 1TTNA 2M8SA 3RZWC 2KJ6A 2FIFA 4ZRJA 4K7SA 2MP2B 2AEHA 3PRPB 4NY0A 3TMPB 2EKEC 2BKRB 2JZ3B 3O65B 2MA9B 1KOTA 4BVUC 3PHWB 3DBRI 3A9KA 4IWQA 4FHJA 4GIVA 3DBSA 3PRZA 4W9EA 1Y8RC 2LXAA 3VTWA 3IHPC 1YX6B 4W9HA 2DHZA 3ALBA 3V60A 1NI2A 4URKA 3DVGX 3UQBA 1BT0A 1WR6E 2KDIA 4JL9A 3SHQA 4HXDA 2KKCA 2O6VB 3QHTA 1WMHB 3GZNI 4ANXA 2PJHA 2BYEA 2LGXA 2N4FA 1WJNA 4PYZA 3V61A 2IYDB 3DDCB 2KHWB 4FN2A 5KHOA 1L7YA 4OVUA 2L8JA 1V5TA 5CHVC 1M94A 2LGDA 2JWZA 3H7SA 3QX1A 3IG3A 1WGGA 2RR9A 5D6JB 4EFOA 2KX3A 4IG7B 4NAWB 2J7QB 1P98A 5CHWA 1ZGUB 2KLCA 2D3GA 4ANUA 2OJRA 3L16A 5JH5C 2JPHA 2MWSB 2NPTA 2HD5B 2KTRB 4A3OA 1NBFC 2AL6A 1ZW7A 2IBIB 4BBNF 2FCQA 3B0AA 5IAAC 3X23A 1E5WA 2DZIA 1XQQA 1WXMA 2KDBA 4W9JA 3T8MA 4WQOB 5AZFA 4HLEA 2MBEA 2MX2A 2ZZPB 1V6EA 3L08A 5J2RA 4TKNA 4EUTA 4RM8A 3VDZA 5G55A 4WAAA 4AJYB 4XC2A 4IWPA 2KOXA 1JRUA 1SIFA 2BKFA 3PZDA 4G0NB 3L54A 1Z2MA 3N3KB 5E6PA 1H8CA 4G11A 2NVUI 4BKSA 1VCBA 2ZNVC 1XD3B 3H1UA 4KSLC 5DPRA 4EOYA 2FIDA 3ZNGC 2HJ8A 2R2OA 3HIZA 2LVPA 4W9FA 3ZNHB 4DWFA 2LUEA 4HDQA 3ZIMA 4GDLA 4EKUA 3RUIB 1WX9A 3H6NA 4FLHA 4W9IA 2LRWA 5AEKB 2GBRA 3ZKJC 3QAQA 4HPLB 2CR5A 4DK5A 1IYFA 1WX7A 2LD9A 4HJKA 1WMHA 4HVBA 2BWES 4MDKE 4YL8A 1GC7A 5DPWA 1TZ1A 3PHXB 4OVVA 2KFKA 3WA0A 1UD7A 1UBQA 3A9KB 4MH0E 1E8YA 4GDKA 4W9LA 5DPTA 5JZEB 2KJRA 4W9CA 4GXBA 2KN5A 3EC8A 1EF5A 3PTFC 4PYUA 3ENEA 3QK0A 2JF5A 4AUQC 2N9PC 3DBHI 2KWCA 3DVGY 4XX5A 2K39A 2AL3A 3PSEB 3ZDTA 2L3ZA 2ZCCA 3APDA 3QARA 2IO2B 4JGHB 1HE8A 4AOFA 3K9OB 1X1MA 5KHQA 2AYOB 1WFYA 2YVCA 3AU4A 4NJ7A 1KM7A 5BO4B 4IUMB 4IC7B 2M4NA 1UELA 4AWJA 3A4SC 3KUCB 4HPMB 1TBEA 2Z0DB 2CKHB 2GBMA 1OEYJ 3H9DA 1E8WA 3QIJA 1E8XA 5DCNA 1RRBA 4BOSC 3RZFA 4GOCA 2KK8A 1EO6A 3R7QA 4I6LB 1EUVB 2M0XA 2KMCA 3ZVVA 1E7VA 3N32A 3ZO5B 3VUXA 2JRHA 1R4MI 1WIAA 2K6DB 3CF6E 4KDLB 2DZJA 1WF9A 3K9PB 2N1WA 3IBEA 4NNJB 3WALA 2R2QA 3M95A 3GOEA 3AI5A 1YD8U 3NOBA 3VVWB 2KNBA 3WAOA 4W9GA 1UZXB 2IO1B 1V2YA 3DOWA 2K8CA 4B95A 2C7NB 3D32A 2GMIC 3X0WA 2GBKA 1SE9A 2MW5A 4ZRKA 3V6EB 5AZGA 2O6VD 3VH3B 2RGFA 4F8CB 2BWFA 3ZTDA 4AP4C 4B6WA 1J19A
chains in the Genus database with same CATH superfamily
3ZXVA 2JX5A 4F1SA 3L0WB 1K50A 2BVCA 4X57B 2V4IB 2KVRA 3I63C 3CSTA 4RNAA 4EZKA 2WU2B 1FCCC 2WXNA 2FAZA 4ANWA 2NR2A 3B2FA 2WX0A 2QMTA 4WWMA 1EU3A 3KWVA 5C1ZA 4NPNA 3NY5A 2LUMA 1UWXA 2NBWB 1P7FA 2JY6A 3KWLA 3RN9C 2I1KA 2WU5B 1RLFA 1E10A 4ICVA 1T6BX 1L6UA 4GN1A 3RNFC 4NAMA 3BVZA 3PRMB 3MC0B 3VXWA 3OWEB 3EFUA 3BVMA 4GB9A 1PDXA 2XK5B 4TMAB 5FR6A 4JQWC 4GMVA 2GRIA 2W9NA 1JMLA 4UDUC 5FK9C 5LNK1 2WQYB 4KDIC 1QOBA 3MTNB 1FXIA 5CHFA 1P3QU 4HRSA 4DXGA 5D94A 3ZW3A 4BZAA 2DAFA 4LCDE 2KQ7A 1DYQA 4PS7A 4YT0B 1MJDA 4K7UA 4TUUA 4YSZB 3CWIA 4KZCA 2DYBA 2MSED 2DLBA 5IOIA 4WQMA 2CS4A 3PLUA 1F1HA 4KKJA 1GG3A 1WH3A 3ZUNA 2K8BA 2KWUB 1C3TA 5E6NA 3ZDMC 2G1EA 1K51A 3EECA 3ZNZB 4IM2A 2N9LA 3WAPA 1VZ8A 3PZ7A 2PKOA 1QF6A 1DOYA 1P1AA 2L1AA 3ONSA 1PGXA 4K81A 4HDOA 2K5PA 4ICUA 4K3CA 4CYEA 4KIKB 1SE2A 2L0TA 5CTRC 3DPDA 2D5GA 2QSDA 1R7SA 1KH0A 2OHFA 1VZ6A 4B0MA 1WXVA 1WWTA 1JCKB 3DVNV 1KJTA 2KYWA 3MFGA 3PGEA 1C4CA 3SR6A 2NBUA 2FCSA 3UF8A 1UBIA 4BKTA 2MBQA 1TYGB 2FUHB 3AEEB 2GB1A 4I6NB 1XLQA 4M8NA 1JALA 1YJ1A 4US8A 3KUDB 2NBVB 1D5MC 3BINA 1K8RB 1VD2A 2JXXA 3IAM1 4HWIB 3MHZA 4LDTD 1OTRB 1ROEA 1PQSA 1XLOA 3JVZX 2UWQA 1E90A 3NVYA 4GSWA 3N30A 4A3PA 1I4GA 3KQ4A 3TIXA 2RDBC 2DZMA 2LWPA 4FULA 3DWGC 1H4RA 1RM6C 2IGGA 4G3XB 4MJSA 2BW2A 3VHTC 1ISNA 1N6ZA 3OJ3A 2K9XA 1L4DB 4E74A 4RGTA 4HPPA 4A90A 4BOZB 3TJPA 1WYWB 3H7PB 2KC1A 3L17A 4ZHOA 2Y5PA 2J0MA 5LXHA 4B0EA 3IFWB 2WXQA 3OAWA 4KVGB 1SB3C 1YJIA 4YSXB 3Q8FA 4ZOHC 3BK1A 3NHEB 2YLMA 2G9HD 3Q3JA 1ZXIA 2G4SA 2JXTA 2XBBC 3U52E 3HK0A 1I7HA 2WDQB 5E6OA 2KDEB 1YQBA 1AYFA 2RPVA 3CSFA 2KZRA 3PO0A 1QOFA 2Z0EB 2IPKD 3KW5B 3BVGA 5FKAC 4MSMB 4B9KA 2L00B 2IO3B 2XEWA 3PPAA 3O13A 3URYA 2JRIB 3RT3B 1GC6A 3I5JC 2HE7A 4HCPB 2JUOA 2KQSA 4CQNA 4DDGD 4AJWA 1A5RA 4YTPB 4TQ1A 2O2VB 1TTNA 3RZWC 3B9JA 2MP2B 3TMPB 1OQRA 4NY0A 2EKEC 5BMGA 1N5WA 4IWQA 3WCQA 4LK0M 2INPE 1YX6B 4W9HA 3ALBA 4C7YA 1F2RC 4RGMA 3DVGX 3UQBA 4JL9A 2LGIA 2O6VB 1QT9A 1ZDXA 4QAYA 4HKZE 4PYZA 1QILA 3DDCB 3EA6A 4ITKA 2L8JA 5CHVC 3H7SA 3IAS1 1WGGA 3Q8EA 3ZJVA 1SE3A 4NAWB 3DBRB 1ZGUB 2D3GA 1CK1A 5JH5C 2JPHA 2MWSB 2NPTA 2WLBA 4A3OA 3IXSA 1ZW7A 4BBNF 2FCQA 3MP9A 2DZIA 1XQQA 1WXMA 4HEA1 1V6EA 3L08A 4EUTA 4XDDA 1E7PB 2FUG1 4C80A 2KOXA 2BKFA 3MC9A 4RGNA 1TS5A 2BBCA 2QIEB 2QEJC 1QLBB 4KSLC 3ZNGC 2R2OA 3HIZA 2LVPA 2WXLA 1D5XC 4HDQA 4WAFA 3ZIMA 4EKUA 4FLHA 2KQ4X 2R61A 5IO9A 2V3PA 1KFYB 2BB5A 4MDKE 2WDRB 1UBQA 2BS3B 5JZEB 4W9LA 2CJNA 2KJRA 3IT4B 1C79A 1EF5A 1FCLA 3QK0A 4AUQC 4KX6B 2K22A 2ZCCA 1HE8A 4AOFA 2UU7A 1X1MA 3AU4A 5BO4B 1KM7A 2LMCA 4IUMB 1SJED 1CJEA 1M4VA 1ENFA 1OEYJ 3H9DA 1RRBA 2L32A 1LO5D 2N0SB 1UNSA 3E9SA 3NVZA 1SXTA 3ZO5B 2K6DB 4KDLB 3IBEA 3WALA 3GOEA 3AI5A 1YD8U 1ZP0B 1UZXB 5D3DA 3DOWA 4B95A 2C7NB 5AZGA 2ACZB 1C4AA 3VH3B 1NVID 2BWFA 4AP4C 1J19A 3N9YC 1KTKA 1RAXA 1RYJA 4FJZA 4YSYB 4WJNA 2PE6B 3AXCA 3IVFA 2Z8LA 4YWGG 1Z5SB 1ZXHA 4W9DA 2KFKB 2KMMA 4JLCA 3VRAB 1D4BA 4C7ZA 4KV2A 3KVFB 2WXRA 2MHJA 2EMSA 4A6QA 2HTHA 4K7WA 2DX5B 1N60A 5CX3A 2KJHB 4JPSA 1XLNA 4YTNB 3V62A 1WSPA 4JWUC 2Y3AA 2NCNA 1QZEA 2KX0A 2L52A 3ECIA 4N59A 2BF8B 5EE0A 2WX1A 5T8IA 1CZPA 1J7AA 5LLIA 2MH7A 1MG8A 1GNUA 3ZJTA 4BKGA 2M56B 4KIKA 4ARCA 4LDTB 1RWSA 1WJ6A 4ZYNA 1S3SG 3OJ4B 1V8CA 4KSKC 3BWUD 5TSSA 1I35A 1P7EA 4C4VA 2LRUA 2INDC 2WWZA 3PS6A 1Q0WB 1WXSA 1YIWA 1KLGD 1UGMA 1ET6A 1MFWA 3EHVA 3QA8A 4ZRIA 3N1ZC 1VRAB 3VH4B 3TSSA 2C7MB 3TL5A 1GJZA 2V4LA 3A1QB 1N5XA 3DQVA 3M63B 2Y5BB 3RYTA 3VAWA 4DDID 2GOWA 3RFZB 3AEAB 5EDSA 4OZAA 1UF0A 3CMMB 4RM9A 1QKZA 2KWVB 2GLSA 4DBGA 4MELA 4BKSD 3DCGA 2BYFA 2WNMA 2C5LC 4LNOA 4FADA 5BYSA 2WXPA 3NG0A 3SD5A 2BPSA 1SSNA 5BMHA 4JE3B 3B08A 3VQIA 3NZSA 3ZTCA 1LXDA 3H7PA 2MRPA 3PV1A 3JSVB 3I3TB 3Q69A 2OJWA 1UWMA 3GE3C 4XWWA 2LVOA 1SGHA 1I4HA 4MM3B 3RPFC 4H2AA 3NZUA 4KGRA 1ESFA 2J0JA 3NS1A 3SDLC 1GB4A 1E0ZA 3ZXRA 2INNE 5IKCM 5JHBA 5MPOA 1FFVA 1YX5B 1IBXB 4TSSA 3Q8AA 1VR9A 1AARA 4HCNB 4ACFA 2PEAA 1AN8A 1I4QA 1N63A 3AE6B 1WJUA 4KGTA 3N1YC 4A55A 2KD0A 5BYRA 1QQRA 3TEZA 4E71A 2V0GA 2QJLA 2K1FA 2IY0B 2KFJA 2XNAC 2ZCBA 4G50A 4HROA 3AEGB 3BIID 1FEHA 2VZKD 5C23A 2O2VA 1GUAB 2FCMA 5GMVA 2ZNVB 3ZYYX 2MP2A 1E6EB 4KGSA 3DVNU 4PK1A 3BYTB 4US9A 3VTVA 2MCNB 1V1OA 1HEZE 4P16A 3UGBB 2ICIA 2ZPNA 3PT2B 2O6VA 2X38A 3SEBA 1LQBA 2RSUA 4JX1C 1WE7A 2LI5A 4DQOC 1IGDA 4FBJB 3PZ8A 1WGHA 2N9EB 2ASQA 4NAWA 4JWSC 1XT9B 2RMMA 2LFIA 1J0GA 1ZKHA 5DPSA 2G4DB 2DYOA 4RH6A 3A4RA 2V3SA 1KLVA 3ABVB 1FPYA 3U8ZA 5FR3A 2A5UA 3BY4B 1JWSD 4NQKE 1L2NA 3RNGC 1FNUA 3KYDD 5HHDG 1WJ4A 3AEDB 3ML9A 2BGFA 3P4RB 2AQ2B 1I42A 2FIFA 4ZRJA 2BTEA 2N7JA 3PRPB 2JZ3B 2BKRB 3O65B 2MA9B 4RCOA 4BVUC 1KOTA 3DBRI 3DBSA 4W9EA 2DHZA 1NI2A 1BT0A 1WR6E 2KDIA 3SHQA 1WMHB 3N20C 3AM9A 2NTSA 2J42A 5KHOA 1L7YA 1VJKA 4L1BA 2MJDA 1HQRD 1M94A 1L0VB 4EFOA 1GAQB 2AQ1B 5E6JA 1TS4A 2HD5B 2KTRB 1EWYC 2AL6A 2IBIB 5IAAC 1EU4A 1AWDA 2KDBA 2ZZPB 4RM8A 4N58A 4WAAA 4XC2A 1FD6A 2W3RA 4G0NB 2FBWB 3N3KB 1H8CA 1VCBA 5EE1A 1UUPA 4EOYA 5HFYA 2HJ8A 2HJ1A 3W2DA 3EUB2 3LXFA 2LUEA 1QOAA 3H6NA 3VRBB 4W9IA 2LRWA 2GBRA 3QAQA 2CR5A 4HVBA 1SEBD 1GC7A 5DPWA 1TZ1A 2WDVB 2KFKA 4LLGM 3A9KB 2ONQA 2JU6X 2PMVA 4W9CA 3PTFC 5IN7A 2N9PC 3NZ3A 2KWCA 3DVGY 3PSEB 1JROA 3ZDTA 1WGKA 5KHQA 3R2IA 4IC7B 2BQQA 2L83A 3Q8CA 4AWJA 3A4SC 4HPMB 2Z0DB 2ZW0A 1OQQA 2GBMA 2WXOA 1E8XA 2DNFA 2I38A 3RZFA 1EO6A 3R7QA 2W82A 4I6LB 2M0XA 1SJHD 3N32A 2JRHA 3DBHB 2WXGA 4NNJB 2R2QA 3M95A 4N6EB 1JQ4A 1L0YB 2IO1B 1V2YA 5EE9A 2WXHA 2XN9C 1SE9A 2MW5A 4XYCA 4ZRKA 2RGFA 3RNAC 3ZTDA 2KN4A 4F7ZA 1YJJA 5C3JB 2WXKA 5J18A 5H8YE 1LGRA 3L4PA 1LFDA 3NJTA 1Q5WB 1R4MB 2DYMA 1AW7A 2LXCA 3GE8C 4EE2A 2KMAA 3UINB 1WRDB 2Y5CA 2M17A 2C60A 3L13A 1ZDVA 3RD2A 4BFRA 4MGIE 3A1QA 1V80A 3AU5A 3P63A 2INCC 3WANA 1ET9A 3QWZB 1WRIA 2AWTA 3M3JA 5JHAA 1TY0A 2FNJB 2DWQA 1ZE3D 1V9JA 3QQ8B 1FRDA 4J6IA 4LNFA 2IGDA 5HI1A 3NUHB 1MI0A 2LVQA 1EF1A 1FXAA 1OEYA 4E3CA 1KF6B 3N1XC 4OZCA 4WJOA 3R8BA 2KDMA 1TJEA 2PW9A 3AH7A 1DGJA 2LZ6A 1YN4A 2CU1A 4OZBA 4ZYSA 4IWOA 4GGQA 2QHOA 3H8HA 1F0ZA 3JSVA 1WM2A 1XO3A 1C4PA 2RDHA 3W1SA 4MM3A 3FKYA 1C9FA 2K8HA 3U30A 2PLPA 1YOVB 1MHXA 3EFCA 3MHSD 3P2BA 1RFKA 1VDVA 1TT5B 4WWPA 4CO7A 4GLSC 1TKYA 1STEA 1T0YA 1WE6A 4XE0A 4GU2A 2VZKB 1JWBD 3TBLD 4L23A 1V1PB 3DHIC 2VRRB 1IBXA 2QILA 1WR1A 1YN5A 4EZLA 4BBNC 2KC2A 4RGOS 2A4ZA 1I4XA 3R7RA 1T5XD 2LASA 1GB1A 3VUYA 2CHWA 2J53A 1FRRA 5AZHA 2D07B 2JVCA 2XK5A 4II2B 3AE5B 4ZHPA 1R4NB 2CJOA 5AUKA 1TIFA 1WGYA 4R3DA 3AMZA 2LJ5A 4DHZE 3OG5A 2V1YA 1PFDA 3Q3OC 3NVVA 2VH2A 1WXAA 1OGWA 1PUTA 2ZPYA 3HUIA 3NS8A 1CMXB 4MSQB 3ML8A 3LB8C 5G2NA 1F77A 1N62A 4O1NA 3MC8A 1GOZA 2J0KA 2OOBB 5AUIA 1NEKB 2M1MA 1L6VA 4WWOA 2H89B 1WGRA 4OW0A 2BYVE 5BMIA 2LJIA 3W1SC 3VR8B 1TZOA 4ARIA 4FA6A 4DXAB 4IDIA 1TGZB 1PYWD 1J7CA 5I4DA 1WZ3A 4LNKA 2CHXA 4NQLB 1FFUA 2ZW1A 2Z59B 3A9JB 2KDFB 3QCAA 4FXCA 3AE4B 1S1QB 5BYQA 3E56A 1FXTB 1UH6A 4P7IA 4XWTA 2ON8A 4Q2JA 2IDYA 1XXGA 3WAMA 3PREA 1WI0A 1HXYD 3L10B 1YQ4B 2CU3A 2TSSA 4IM0A 1DOIA 4AS1A 1YMHE 2N1VA 4FHKA 4DHJD 2IO0B 2D11A 5H92C 1Q1OA 1FNVA 3QJZA 3NRZA 3LDZE 4P6VF 1ZUD2 2KACA 4RMAA 2I1JA 3LJ3A 3WIMA 3OLMD 1NENB 3TEYA 3DBLB 1VZ7A 2AQ3B 3AE9B 4IM3A 4M0WB 3B2GA 2KO3A 1WZ0A 4IKGA 3VFKA 3U7DA 2L0FA 4EEWA 4MGZE 1U4AA 2DZKA 1WGDA 2KLGA 4N9F4 1F9JA 1WX8A 1V49A 3IT6B 1D5ZC 1HTQA 2WYQA 2YEPB 4WWNA 3APCA 4MGYE 3AE7B 4A20A 2EMTA 2IGHA 2MBOA 2KTRA 3KYCD 3P1MA 3UIOB 3PLVA 1JWMD 5IA7A 2BT6A 2VH1A 4TV3A 1MPEA 4LTUA 3DWMA 3MJ5A 2ZJDA 4OHJA 1TKGA 4MACA 1YQ3B 4YXDB 5L95C 1D3ZA 2NPTB 1HA5A 2J52A 2X8XX 4K7SA 1TS2A 1FMAD 2AEHA 2JYTA 3A9KA 1N61A 4GIVA 3RNBC 3AEBB 3PRZA 1Y8RC 2LXAA 3IHPC 3Q3MC 3FAHA 2MJ3A 4XDCA 4BAXA 4HXDA 3QHTA 3T3OA 2PJHA 3AV8A 2LGXA 3DHHC 3V3XA 2KHWB 4FN2A 3GS2A 4OVUA 2M0AA 1V5TA 2LGDA 4IOIE 3QX1A 3IG3A 5D6JB 5HG2A 4P1CC 1XCTL 2J7QB 5IP4D 1P98A 5CHWA 4ANUA 2KLCA 2EELA 2RDGA 1GPXA 1C76A 3T8MA 4WQOB 2MBEA 3GZNB 3Q6BA 5G5HA 1HTOA 4M00A 1C77A 1NYQA 4TKNA 3VDZA 5J2RA 4IWPA 1JRUA 1SIFA 3L54A 5E6PA 4G11A 4BKSA 1XD3B 3H1UA 3EGRA 1F52A 3FILB 4W9FA 3ZNHB 1WX9A 3C8YA 5AEKB 2WXIA 3ZKJC 4HPLB 4ZRQA 2LD9A 3U2SC 1T0SC 4YL8A 3PHXB 3WA0A 1UD7A 4MH0E 1E8YA 3T3NA 3RNEC 2WXJA 3W9CB 2JF5A 2PVOD 3DBHI 4C00A 3TEXA 4XX5A 2AL3A 5EE3A 2L3ZA 3QARA 3K9OB 2JQRB 2YVCA 2D3BA 2HDEA 2M4NA 1UELA 1J7BA 3P4SB 3ZGZA 2CKHB 2QCZA 3QIJA 5DCNA 4BOSC 4GOCA 2KK8A 3I9V1 1OFFA 2KMCA 1E7VA 3HVZA 3HRDD 1XCQL 1R4MI 1UGJA 2JSVX 3SFDB 5JXVA 1WF9A 3K9PB 4HJGE 4J3OD 2I2YA 1NYRA 3VVWB 3WAOA 4W9GA 1L4ZB 1EWCA 2K8CA 2WXFA 3TEWA 3D32A 3KLSX 2GMIC 2PTLA 3X0WA 2LGSA 3U4EG 1TKEA 1BXTA 4B6WA 2LGYA 2FE8A 4GDLB 4L2YA 1MVKA 4ZRPA 3TUOA 4K1RB 1V1PA 3W1YA 3B1LX 1BMLC 1JWUD 1VLBA 4ZDVA 1IGCA 3HM3A 4C4VB 2D10A 1JWAD 3I57A 4M8MA 1KRHA 2MBHA 4RF0A 4GDKB 1IPGA 3PVLA 3U7ZA 2D2QA 3Q14C 2D3CA 1SE4A 4WIPA 2KWDA 2K25A 2JYEA 3RULA 1ZOYB 3HVDA 1OQYA 3KH0A 4MGKE 3T9LA 1WY8A 2M19A 1C1YB 2LEKA 2BS4B 3A33B 4S0RA 3QC8B 1FIQA 1T0RC 3AN1A 3GP7A 3R66C 3S2AA 4JIOU 3Q3NC 2KXJA 4AQ7A 4WJPA 2NS5A 2L05A 3TCAA 3ETRA 2RPQA 2C9WB 2WXMA 4C56C 3AECB 5D2MB 2RD0A 3ZJUA 4DHJB 4EZJA 1IP9A 2E6XA 3AE1B 2KT7A 2JZZA 1Q10A 4KKIA 1SIJA 2L76A 3GB1A 5L83A 2UYZB 1HZ6A 3Q8BA 1R4NI 3RI7C 2FCNA 5HKHA 3A9JA 1G6JA 1LM8B 1RFAA 1A70A 2MJEA 3BYYB 4LJPB 2IY1B 4HK2A 3V6CB 2GBJA 2DBYA 3Q3FA 1P9DU 2KANA 2N9XA 4USAA 3J9CA 3AB5A 4PS3A 3UQAA 4D2KA 1FNWA 4NZLB 3BK2A 4PS8A 2WGSA 1V81A 5LXIB 1TS3A 4LNIA 1F2RI 2L7RA 2REXA 1TY2A 4MEMA 2LHEA 1C78A 3HM6X 3AE3B 1V5OA 4M0WA 2W3SA 1T0QC 1E7UA 2IZVB 3JW0X 3CIRB 1IUEA 2H88B 3RNCC 1V86A 1HZ5A 2K6QA 2J4XA 4FJYA 2MBBB 1MG4A 4W9KA 3ZLZA 1JRPA 1ZPSA 4OVZA 3VUWA 3R2TA 5C2TB 3NVWA 2MQJA 4XZ4A 3DBLI 2GBNA 4IW0A 2PPHA 4ASWC 5D7GA 5TR5A 2YEPF 2W54A 3ZRCA 3FC4A 1D6EC 1NDDA 2WDTB 2WP9B 4KZ0A 2JT4B 2ZVNA 3AULA 3DHGC 2B3AA 2JWUA 3R3MA 1K53A 1E9MA 1XEEA 3W5VB 4TQ0A 2MLBA 4RFBA 2C7HA 1I4RA 2DENB 4NJCA 2NMQA 4CHKA 1DOXA 4XGAB 1NI3A 1QOGA 2ZEQA 3JYUA 3SU8X 3MJWA 1WM3A 3P42A 4S17A 1L5PA 5J17A 1EM7A 3ZRFA 2D3AA 3M62B 3V05A 4HKQA 2ZVOA 2V9HA 3C0RB 2DAJA 3SFEB 3APFA 2MEKA 1MHHE 4M01A 2PE9A 3KUZA 4ANVA 1KLUD 2CHZA 4LJOB 4II3B 2N7DA 4FJVB 3UIPB 1ACCA 2LHDA 3W5UB 3AEFB 3ZNID 2V3NA 4LNNA 3RCZA 2BB6A 1V97A 2SAKA 1P0RA 3HHMA 4I6PA 1J8CA 2KVZA 1B9RA 2K3UA 3P4PB 1E8ZA 2G3QB 4DHZB 1SBBB 3FILA 1Y56A 4NJ6A 2QC8A 4MJSB 2N7EA 2G45B 2KTFA 4WJQA 3VTUA 4PT5A 5D3IB 2M8SA 2EKIA 2KJ6A 4M02A 3LYYA 1XF5L 3PHWB 2N9KA 4FHJA 3VTWA 4WURA 5G5GA 3V60A 3BZDB 4URKA 2K0PA 2KKCA 3GZNI 4ANXA 3Q2AC 1CQVA 2BYEA 2N4FA 1WJNA 3V61A 2IYDB 2B76B 2JWZA 2BS2B 2WS3B 2RR9A 2KX3A 4IG7B 1FO4A 1PGAA 2OJRA 2PIAA 3L16A 1NBFC 1YN3A 1WYGA 3B0AA 3X23A 1FM0D 1E5WA 3VR9B 4W9JA 1SF0A 5AZFA 4HLEA 4WH4A 2MX2A 4MT5A 1K52A 5G55A 4AJYB 4RF1A 3PZDA 1Z2MA 2NVUI 2ZNVC 3AE8B 5DPRA 2W55A 4YTMB 2FIDA 4DWFA 4GDLA 2AX5A 3RUIB 3AE2B 3RMKC 4A8XC 2KAJA 4DK5A 1IYFA 1WX7A 4HJKA 1WMHA 2JZPA 2BWES 3C19A 2PVGC 4OVVA 1WXQA 2OEDA 2QDFA 4GDKA 5DPTA 1T3QA 4GXBA 2KN5A 2E3TA 2IJ0A 1XLPA 3EC8A 4PYUA 3ENEA 5GXGB 1B1ZA 4REZA 2K39A 2BYTA 4JGHB 3APDA 2IO2B 1I4PA 2AYOB 1WFYA 1BUIC 4K3BA 4NJ7A 1L0XB 2NTTA 1YNTE 2HTME 4P1BC 2Q5WD 3KUCB 3P4QB 1TBEA 1JW9D 4DXFA 1E8WA 3UI3A 2WHIA 1EUVB 3ZVVA 3VUXA 1WIAA 3CF6E 2DZJA 2N1WA 4A9AA 3NOBA 2SEBD 2KNBA 3ZQ4A 2GBKA 3V6EB 2GI9A 2O6VD 4F8CB 4MH8A 1PGBA
chains in the Genus database with same CATH topology
2LGYA 4F7ZA 1RAXA 4F1SA 4GDLB 3L0WB 4FJZA 5J18A 4WJNA 2PE6B 4K1RB 1LFDA 3AXCA 3IVFA 4X57B 3W1YA 3B1LX 1Q5WB 2KVRA 4ZDVA 2DYMA 2LXCA 3CSTA 3HM3A 2D10A 2KMAA 3UINB 1WRDB 1Z5SB 4EZKA 2M17A 2C60A 3L13A 4M8MA 4W9DA 3RD2A 2KFKB 4BFRA 2MBHA 3A1QA 4MGIE 1V80A 4JLCA 3AU5A 4GDKB 2FAZA 3WANA 1IPGA 3PVLA 3KVFB 4KV2A 2NR2A 3QWZB 4ANWA 2AWTA 2D2QA 2WX0A 2EMSA 3M3JA 5C1ZA 2HTHA 4K7WA 4NPNA 5JHAA 2DX5B 2K25A 2FNJB 3NY5A 2NBWB 2JY6A 2KJHB 5CX3A 3RULA 1V9JA 3V62A 2I1KA 3QQ8B 1OQYA 3KH0A 4MGKE 3T9LA 1WY8A 4J6IA 1C1YB 3A33B 3QC8B 2NCNA 1QZEA 1RLFA 2KX0A 3ECIA 4ICVA 2LVQA 2BF8B 2WX1A 1EF1A 3R66C 4GN1A 3PRMB 1OEYA 5LLIA 3S2AA 4E3CA 4JIOU 1MG8A 4WJOA 2KXJA 1GNUA 3VXWA 4WJPA 3EFUA 2NS5A 4GB9A 4BKGA 4KIKA 2XK5B 5FR6A 2LZ6A 4JQWC 4LDTB 4GMVA 1WJ6A 2CU1A 2L05A 3TCAA 4IWOA 4ZYNA 2RPQA 2W9NA 4GGQA 2QHOA 3JSVA 2C9WB 1S3SG 3OJ4B 1WM2A 5D2MB 2RD0A 3W1SA 4KDIC 4KSKC 4MM3A 4DHJB 1I35A 4EZJA 2K8HA 1IP9A 3U30A 2LRUA 3MTNB 2WWZA 5CHFA 2JZZA 1P3QU 3MHSD 3P2BA 3PS6A 1Q0WB 5D94A 3ZW3A 2L76A 4WWPA 1WXSA 1YIWA 2DAFA 4CO7A 5L83A 2UYZB 1T0YA 1WE6A 1UGMA 4GU2A 3TBLD 1R4NI 4LCDE 2KQ7A 3EHVA 2FCNA 4PS7A 5HKHA 3QA8A 4K7UA 4TUUA 2VRRB 3A9JA 1G6JA 4ZRIA 4KZCA 2DYBA 1LM8B 2MSED 1WR1A 3VH4B 1RFAA 2C7MB 3TL5A 4EZLA 1GJZA 2CS4A 2KC2A 2V4LA 3A1QB 4BBNC 3PLUA 2A4ZA 3DQVA 3M63B 1GG3A 1WH3A 4LJPB 2Y5BB 3RYTA 2IY1B 2K8BA 3R7RA 3VAWA 4HK2A 3ZUNA 4DDID 2LASA 3V6CB 2KWUB 2GOWA 3VUYA 1C3TA 2CHWA 5AZHA 2GBJA 5EDSA 3Q3FA 2D07B 5E6NA 1P9DU 3CMMB 3ZDMC 2KANA 2N9XA 4RM9A 3EECA 2JVCA 2KWVB 2XK5A 4II2B 3ZNZB 4IM2A 3WAPA 1P1AA 4DBGA 4PS3A 3UQAA 1WGYA 3ONSA 4MELA 4BKSD 2LJ5A 3DCGA 2BYFA 4DHZE 2V1YA 4K81A 2C5LC 4PS8A 4FADA 4HDOA 1V81A 5LXIB 3SD5A 2BPSA 1WXAA 4ICUA 4CYEA 1OGWA 2L7RA 2ZPYA 3B08A 4KIKB 2REXA 3VQIA 3NS8A 2L0TA 3NZSA 1CMXB 4MEMA 5CTRC 4MSQB 3ML8A 3DPDA 3ZTCA 3HM6X 5G2NA 1LXDA 3H7PA 2MRPA 1V5OA 3PV1A 3JSVB 3I3TB 2J0KA 2LVOA 1E7UA 1WXVA 2OOBB 1SGHA 2IZVB 3DVNV 1KJTA 2M1MA 3JW0X 4WWOA 1WGRA 2BYVE 3W1SC 3NZUA 3PGEA 2J0JA 3SDLC 1V86A 2NBUA 4FA6A 2K6QA 4DXAB 2FCSA 4FJYA 2MBBB 3UF8A 1UBIA 1TGZB 4BKTA 2MBQA 4W9KA 3ZLZA 1WZ3A 2FUHB 5JHBA 4I6NB 4M8NA 2CHXA 4NQLB 1YJ1A 2Z59B 3A9JB 3VUWA 1YX5B 3KUDB 2KDFB 3QCAA 2NBVB 1AARA 1S1QB 4HCNB 3BINA 4P7IA 1FXTB 1UH6A 1K8RB 1VD2A 2PEAA 2JXXA 4HWIB 4LDTD 1OTRB 2MQJA 1WJUA 4XZ4A 3PREA 3WAMA 1WI0A 1PQSA 3JVZX 2UWQA 3DBLI 2GBNA 4IW0A 1E90A 4GSWA 3N30A 2PPHA 3L10B 4ASWC 5D7GA 4IM0A 5TR5A 2KD0A 4A3PA 4FHKA 2N1VA 3ZRCA 3TIXA 4DHJD 2IO0B 1NDDA 2WDTB 4E71A 2DZMA 4KZ0A 2LWPA 2JT4B 2ZVNA 2D11A 3AULA 4FULA 1H4RA 2B3AA 4G3XB 3R3MA 4MJSA 2K1FA 2IY0B 1Q1OA 2KFJA 2ZCBA 3VHTC 1ISNA 4G50A 3OJ3A 3QJZA 4E74A 3LDZE 2O2VA 5C23A 4TQ0A 1GUAB 2MLBA 2FCMA 5GMVA 2ZNVB 4RMAA 2C7HA 2I1JA 2MP2A 3LJ3A 3WIMA 3OLMD 2DENB 4BOZB 3DVNU 3TJPA 1WYWB 4CHKA 3H7PB 3VTVA 2KC1A 4IM3A 2MCNB 2ZEQA 4M0WB 3L17A 3JYUA 2J0MA 2KO3A 1WZ0A 3VFKA 3UGBB 3SU8X 3MJWA 1WM3A 3U7DA 2ZPNA 5J17A 5LXHA 3PT2B 2L0FA 2O6VA 4EEWA 3ZRFA 4MGZE 1U4AA 3M62B 2DZKA 1WGDA 3IFWB 1LQBA 2KLGA 2RSUA 4N9F4 2ZVOA 1F9JA 3OAWA 4KVGB 1WE7A 1WX8A 2LI5A 3C0RB 2DAJA 1V49A 4FBJB 3NHEB 2YLMA 3Q3JA 3APFA 2G4SA 1WGHA 2WYQA 2N9EB 2XBBC 2ASQA 4NAWA 4WWNA 1XT9B 2PE9A 3KUZA 3APCA 4MGYE 1J0GA 4ANVA 4A20A 3HK0A 1ZKHA 2CHZA 2EMTA 4LJOB 2G4DB 2DYOA 4II3B 5DPSA 5E6OA 2N7DA 2MBOA 2KDEB 1YQBA 2KTRA 3KYCD 4FJVB 3CSFA 3UIOB 3UIPB 3A4RA 2V3SA 3PLVA 2KZRA 3ZNID 5IA7A 2Z0EB 3RCZA 3KW5B 4TV3A 4MSMB 4B9KA 1KLVA 2L00B 3U8ZA 2IO3B 1P0RA 3HHMA 4I6PA 2ZJDA 2A5UA 2XEWA 3PPAA 1J8CA 2JRIB 3RT3B 1GC6A 3BY4B 1E8ZA 5L95C 4NQKE 1D3ZA 2NPTB 2HE7A 2G3QB 4HCPB 4DHZB 1L2NA 2JUOA 2KQSA 4NJ6A 3KYDD 2N7EA 4MJSB 4AJWA 4DDGD 2G45B 2KTFA 1A5RA 4WJQA 1WJ4A 3ML9A 2BGFA 4TQ1A 3VTUA 1I42A 2O2VB 1TTNA 2M8SA 3RZWC 2KJ6A 2FIFA 4ZRJA 4K7SA 2MP2B 2AEHA 3PRPB 4NY0A 3TMPB 2EKEC 2BKRB 2JZ3B 3O65B 2MA9B 1KOTA 4BVUC 3PHWB 3DBRI 3A9KA 4IWQA 4FHJA 4GIVA 3DBSA 3PRZA 4W9EA 1Y8RC 2LXAA 3VTWA 3IHPC 1YX6B 4W9HA 2DHZA 3ALBA 3V60A 1NI2A 4URKA 3DVGX 3UQBA 1BT0A 1WR6E 2KDIA 4JL9A 3SHQA 4HXDA 2KKCA 2O6VB 3QHTA 1WMHB 3GZNI 4ANXA 2PJHA 2BYEA 2LGXA 2N4FA 1WJNA 4PYZA 3V61A 2IYDB 3DDCB 2KHWB 4FN2A 5KHOA 1L7YA 4OVUA 2L8JA 1V5TA 5CHVC 1M94A 2LGDA 2JWZA 3H7SA 3QX1A 3IG3A 1WGGA 2RR9A 5D6JB 4EFOA 2KX3A 4IG7B 4NAWB 2J7QB 1P98A 5CHWA 1ZGUB 2KLCA 2D3GA 4ANUA 2OJRA 3L16A 5JH5C 2JPHA 2MWSB 2NPTA 2HD5B 2KTRB 4A3OA 1NBFC 2AL6A 1ZW7A 2IBIB 4BBNF 2FCQA 3B0AA 5IAAC 3X23A 1E5WA 2DZIA 1XQQA 1WXMA 2KDBA 4W9JA 3T8MA 4WQOB 5AZFA 4HLEA 2MBEA 2MX2A 2ZZPB 1V6EA 3L08A 5J2RA 4TKNA 4EUTA 4RM8A 3VDZA 5G55A 4WAAA 4AJYB 4XC2A 4IWPA 2KOXA 1JRUA 1SIFA 2BKFA 3PZDA 4G0NB 3L54A 1Z2MA 3N3KB 5E6PA 1H8CA 4G11A 2NVUI 4BKSA 1VCBA 2ZNVC 1XD3B 3H1UA 4KSLC 5DPRA 4EOYA 2FIDA 3ZNGC 2HJ8A 2R2OA 3HIZA 2LVPA 4W9FA 3ZNHB 4DWFA 2LUEA 4HDQA 3ZIMA 4GDLA 4EKUA 3RUIB 1WX9A 3H6NA 4FLHA 4W9IA 2LRWA 5AEKB 2GBRA 3ZKJC 3QAQA 4HPLB 2CR5A 4DK5A 1IYFA 1WX7A 2LD9A 4HJKA 1WMHA 4HVBA 2BWES 4MDKE 4YL8A 1GC7A 5DPWA 1TZ1A 3PHXB 4OVVA 2KFKA 3WA0A 1UD7A 1UBQA 3A9KB 4MH0E 1E8YA 4GDKA 4W9LA 5DPTA 5JZEB 2KJRA 4W9CA 4GXBA 2KN5A 3EC8A 1EF5A 3PTFC 4PYUA 3ENEA 3QK0A 2JF5A 4AUQC 2N9PC 3DBHI 2KWCA 3DVGY 4XX5A 2K39A 2AL3A 3PSEB 3ZDTA 2L3ZA 2ZCCA 3APDA 3QARA 2IO2B 4JGHB 1HE8A 4AOFA 3K9OB 1X1MA 5KHQA 2AYOB 1WFYA 2YVCA 3AU4A 4NJ7A 1KM7A 5BO4B 4IUMB 4IC7B 2M4NA 1UELA 4AWJA 3A4SC 3KUCB 4HPMB 1TBEA 2Z0DB 2CKHB 2GBMA 1OEYJ 3H9DA 1E8WA 3QIJA 1E8XA 5DCNA 1RRBA 4BOSC 3RZFA 4GOCA 2KK8A 1EO6A 3R7QA 4I6LB 1EUVB 2M0XA 2KMCA 3ZVVA 1E7VA 3N32A 3ZO5B 3VUXA 2JRHA 1R4MI 1WIAA 2K6DB 3CF6E 4KDLB 2DZJA 1WF9A 3K9PB 2N1WA 3IBEA 4NNJB 3WALA 2R2QA 3M95A 3GOEA 3AI5A 1YD8U 3NOBA 3VVWB 2KNBA 3WAOA 4W9GA 1UZXB 2IO1B 1V2YA 3DOWA 2K8CA 4B95A 2C7NB 3D32A 2GMIC 3X0WA 2GBKA 1SE9A 2MW5A 4ZRKA 3V6EB 5AZGA 2O6VD 3VH3B 2RGFA 4F8CB 2BWFA 3ZTDA 4AP4C 4B6WA 1J19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LGY A;  4F7Z A;  1RAX A;  4F1S A;  4GDL B;  3L0W B;  4FJZ A;  5J18 A;  4WJN A;  2PE6 B;  4K1R B;  1LFD A;  3AXC A;  3IVF A;  4X57 B;  3W1Y A;  3B1L X;  1Q5W B;  2KVR A;  4ZDV A;  2DYM A;  2LXC A;  3CST A;  3HM3 A;  2D10 A;  2KMA A;  3UIN B;  1WRD B;  1Z5S B;  4EZK A;  2M17 A;  2C60 A;  3L13 A;  4M8M A;  4W9D A;  3RD2 A;  2KFK B;  4BFR A;  2MBH A;  3A1Q A;  4MGI E;  1V80 A;  4JLC A;  3AU5 A;  4GDK B;  2FAZ A;  3WAN A;  1IPG A;  3PVL A;  3KVF B;  4KV2 A;  2NR2 A;  3QWZ B;  4ANW A;  2AWT A;  2D2Q A;  2WX0 A;  2EMS A;  3M3J A;  5C1Z A;  2HTH A;  4K7W A;  4NPN A;  5JHA A;  2DX5 B;  2K25 A;  2FNJ B;  3NY5 A;  2NBW B;  2JY6 A;  2KJH B;  5CX3 A;  3RUL A;  1V9J A;  3V62 A;  2I1K A;  3QQ8 B;  1OQY A;  3KH0 A;  4MGK E;  3T9L A;  1WY8 A;  4J6I A;  1C1Y B;  3A33 B;  3QC8 B;  2NCN A;  1QZE A;  1RLF A;  2KX0 A;  3ECI A;  4ICV A;  2LVQ A;  2BF8 B;  2WX1 A;  1EF1 A;  3R66 C;  4GN1 A;  3PRM B;  1OEY A;  5LLI A;  3S2A A;  4E3C A;  4JIO U;  1MG8 A;  4WJO A;  2KXJ A;  1GNU A;  3VXW A;  4WJP A;  3EFU A;  2NS5 A;  4GB9 A;  4BKG A;  4KIK A;  2XK5 B;  5FR6 A;  2LZ6 A;  4JQW C;  4LDT B;  4GMV A;  1WJ6 A;  2CU1 A;  2L05 A;  3TCA A;  4IWO A;  4ZYN A;  2RPQ A;  2W9N A;  4GGQ A;  2QHO A;  3JSV A;  2C9W B;  1S3S G;  3OJ4 B;  1WM2 A;  5D2M B;  2RD0 A;  3W1S A;  4KDI C;  4KSK C;  4MM3 A;  4DHJ B;  1I35 A;  4EZJ A;  2K8H A;  1IP9 A;  3U30 A;  2LRU A;  3MTN B;  2WWZ A;  5CHF A;  2JZZ A;  1P3Q U;  3MHS D;  3P2B A;  3PS6 A;  1Q0W B;  5D94 A;  3ZW3 A;  2L76 A;  4WWP A;  1WXS A;  1YIW A;  2DAF A;  4CO7 A;  5L83 A;  2UYZ B;  1T0Y A;  1WE6 A;  1UGM A;  4GU2 A;  3TBL D;  1R4N I;  4LCD E;  2KQ7 A;  3EHV A;  2FCN A;  4PS7 A;  5HKH A;  3QA8 A;  4K7U A;  4TUU A;  2VRR B;  3A9J A;  1G6J A;  4ZRI A;  4KZC A;  2DYB A;  1LM8 B;  2MSE D;  1WR1 A;  3VH4 B;  1RFA A;  2C7M B;  3TL5 A;  4EZL A;  1GJZ A;  2CS4 A;  2KC2 A;  2V4L A;  3A1Q B;  4BBN C;  3PLU A;  2A4Z A;  3DQV A;  3M63 B;  1GG3 A;  1WH3 A;  4LJP B;  2Y5B B;  3RYT A;  2IY1 B;  2K8B A;  3R7R A;  3VAW A;  4HK2 A;  3ZUN A;  4DDI D;  2LAS A;  3V6C B;  2KWU B;  2GOW A;  3VUY A;  1C3T A;  2CHW A;  5AZH A;  2GBJ A;  5EDS A;  3Q3F A;  2D07 B;  5E6N A;  1P9D U;  3CMM B;  3ZDM C;  2KAN A;  2N9X A;  4RM9 A;  3EEC A;  2JVC A;  2KWV B;  2XK5 A;  4II2 B;  3ZNZ B;  4IM2 A;  3WAP A;  1P1A A;  4DBG A;  4PS3 A;  3UQA A;  1WGY A;  3ONS A;  4MEL A;  4BKS D;  2LJ5 A;  3DCG A;  2BYF A;  4DHZ E;  2V1Y A;  4K81 A;  2C5L C;  4PS8 A;  4FAD A;  4HDO A;  1V81 A;  5LXI B;  3SD5 A;  2BPS A;  1WXA A;  4ICU A;  4CYE A;  1OGW A;  2L7R A;  2ZPY A;  3B08 A;  4KIK B;  2REX A;  3VQI A;  3NS8 A;  2L0T A;  3NZS A;  1CMX B;  4MEM A;  5CTR C;  4MSQ B;  3ML8 A;  3DPD A;  3ZTC A;  3HM6 X;  5G2N A;  1LXD A;  3H7P A;  2MRP A;  1V5O A;  3PV1 A;  3JSV B;  3I3T B;  2J0K A;  2LVO A;  1E7U A;  1WXV A;  2OOB B;  1SGH A;  2IZV B;  3DVN V;  1KJT A;  2M1M A;  3JW0 X;  4WWO A;  1WGR A;  2BYV E;  3W1S C;  3NZU A;  3PGE A;  2J0J A;  3SDL C;  1V86 A;  2NBU A;  4FA6 A;  2K6Q A;  4DXA B;  2FCS A;  4FJY A;  2MBB B;  3UF8 A;  1UBI A;  1TGZ B;  4BKT A;  2MBQ A;  4W9K A;  3ZLZ A;  1WZ3 A;  2FUH B;  5JHB A;  4I6N B;  4M8N A;  2CHX A;  4NQL B;  1YJ1 A;  2Z59 B;  3A9J B;  3VUW A;  1YX5 B;  3KUD B;  2KDF B;  3QCA A;  2NBV B;  1AAR A;  1S1Q B;  4HCN B;  3BIN A;  4P7I A;  1FXT B;  1UH6 A;  1K8R B;  1VD2 A;  2PEA A;  2JXX A;  4HWI B;  4LDT D;  1OTR B;  2MQJ A;  1WJU A;  4XZ4 A;  3PRE A;  3WAM A;  1WI0 A;  1PQS A;  3JVZ X;  2UWQ A;  3DBL I;  2GBN A;  4IW0 A;  1E90 A;  4GSW A;  3N30 A;  2PPH A;  3L10 B;  4ASW C;  5D7G A;  4IM0 A;  5TR5 A;  2KD0 A;  4A3P A;  4FHK A;  2N1V A;  3ZRC A;  3TIX A;  4DHJ D;  2IO0 B;  1NDD A;  2WDT B;  4E71 A;  2DZM A;  4KZ0 A;  2LWP A;  2JT4 B;  2ZVN A;  2D11 A;  3AUL A;  4FUL A;  1H4R A;  2B3A A;  4G3X B;  3R3M A;  4MJS A;  2K1F A;  2IY0 B;  1Q1O A;  2KFJ A;  2ZCB A;  3VHT C;  1ISN A;  4G50 A;  3OJ3 A;  3QJZ A;  4E74 A;  3LDZ E;  2O2V A;  5C23 A;  4TQ0 A;  1GUA B;  2MLB A;  2FCM A;  5GMV A;  2ZNV B;  4RMA A;  2C7H A;  2I1J A;  2MP2 A;  3LJ3 A;  3WIM A;  3OLM D;  2DEN B;  4BOZ B;  3DVN U;  3TJP A;  1WYW B;  4CHK A;  3H7P B;  3VTV A;  2KC1 A;  4IM3 A;  2MCN B;  2ZEQ A;  4M0W B;  3L17 A;  3JYU A;  2J0M A;  2KO3 A;  1WZ0 A;  3VFK A;  3UGB B;  3SU8 X;  3MJW A;  1WM3 A;  3U7D A;  2ZPN A;  5J17 A;  5LXH A;  3PT2 B;  2L0F A;  2O6V A;  4EEW A;  3ZRF A;  4MGZ E;  1U4A A;  3M62 B;  2DZK A;  1WGD A;  3IFW B;  1LQB A;  2KLG A;  2RSU A;  4N9F 4;  2ZVO A;  1F9J A;  3OAW A;  4KVG B;  1WE7 A;  1WX8 A;  2LI5 A;  3C0R B;  2DAJ A;  1V49 A;  4FBJ B;  3NHE B;  2YLM A;  3Q3J A;  3APF A;  2G4S A;  1WGH A;  2WYQ A;  2N9E B;  2XBB C;  2ASQ A;  4NAW A;  4WWN A;  1XT9 B;  2PE9 A;  3KUZ A;  3APC A;  4MGY E;  1J0G A;  4ANV A;  4A20 A;  3HK0 A;  1ZKH A;  2CHZ A;  2EMT A;  4LJO B;  2G4D B;  2DYO A;  4II3 B;  5DPS A;  5E6O A;  2N7D A;  2MBO A;  2KDE B;  1YQB A;  2KTR A;  3KYC D;  4FJV B;  3CSF A;  3UIO B;  3UIP B;  3A4R A;  2V3S A;  3PLV A;  2KZR A;  3ZNI D;  5IA7 A;  2Z0E B;  3RCZ A;  3KW5 B;  4TV3 A;  4MSM B;  4B9K A;  1KLV A;  2L00 B;  3U8Z A;  2IO3 B;  1P0R A;  3HHM A;  4I6P A;  2ZJD A;  2A5U A;  2XEW A;  3PPA A;  1J8C A;  2JRI B;  3RT3 B;  1GC6 A;  3BY4 B;  1E8Z A;  5L95 C;  4NQK E;  1D3Z A;  2NPT B;  2HE7 A;  2G3Q B;  4HCP B;  4DHZ B;  1L2N A;  2JUO A;  2KQS A;  4NJ6 A;  3KYD D;  2N7E A;  4MJS B;  4AJW A;  4DDG D;  2G45 B;  2KTF A;  1A5R A;  4WJQ A;  1WJ4 A;  3ML9 A;  2BGF A;  4TQ1 A;  3VTU A;  1I42 A;  2O2V B;  1TTN A;  2M8S A;  3RZW C;  2KJ6 A;  2FIF A;  4ZRJ A;  4K7S A;  2MP2 B;  2AEH A;  3PRP B;  4NY0 A;  3TMP B;  2EKE C;  2BKR B;  2JZ3 B;  3O65 B;  2MA9 B;  1KOT A;  4BVU C;  3PHW B;  3DBR I;  3A9K A;  4IWQ A;  4FHJ A;  4GIV A;  3DBS A;  3PRZ A;  4W9E A;  1Y8R C;  2LXA A;  3VTW A;  3IHP C;  1YX6 B;  4W9H A;  2DHZ A;  3ALB A;  3V60 A;  1NI2 A;  4URK A;  3DVG X;  3UQB A;  1BT0 A;  1WR6 E;  2KDI A;  4JL9 A;  3SHQ A;  4HXD A;  2KKC A;  2O6V B;  3QHT A;  1WMH B;  3GZN I;  4ANX A;  2PJH A;  2BYE A;  2LGX A;  2N4F A;  1WJN A;  4PYZ A;  3V61 A;  2IYD B;  3DDC B;  2KHW B;  4FN2 A;  5KHO A;  1L7Y A;  4OVU A;  2L8J A;  1V5T A;  5CHV C;  1M94 A;  2LGD A;  2JWZ A;  3H7S A;  3QX1 A;  3IG3 A;  1WGG A;  2RR9 A;  5D6J B;  4EFO A;  2KX3 A;  4IG7 B;  4NAW B;  2J7Q B;  1P98 A;  5CHW A;  1ZGU B;  2KLC A;  2D3G A;  4ANU A;  2OJR A;  3L16 A;  5JH5 C;  2JPH A;  2MWS B;  2NPT A;  2HD5 B;  2KTR B;  4A3O A;  1NBF C;  2AL6 A;  1ZW7 A;  2IBI B;  4BBN F;  2FCQ A;  3B0A A;  5IAA C;  3X23 A;  1E5W A;  2DZI A;  1XQQ A;  1WXM A;  2KDB A;  4W9J A;  3T8M A;  4WQO B;  5AZF A;  4HLE A;  2MBE A;  2MX2 A;  2ZZP B;  1V6E A;  3L08 A;  5J2R A;  4TKN A;  4EUT A;  4RM8 A;  3VDZ A;  5G55 A;  4WAA A;  4AJY B;  4XC2 A;  4IWP A;  2KOX A;  1JRU A;  1SIF A;  2BKF A;  3PZD A;  4G0N B;  3L54 A;  1Z2M A;  3N3K B;  5E6P A;  1H8C A;  4G11 A;  2NVU I;  4BKS A;  1VCB A;  2ZNV C;  1XD3 B;  3H1U A;  4KSL C;  5DPR A;  4EOY A;  2FID A;  3ZNG C;  2HJ8 A;  2R2O A;  3HIZ A;  2LVP A;  4W9F A;  3ZNH B;  4DWF A;  2LUE A;  4HDQ A;  3ZIM A;  4GDL A;  4EKU A;  3RUI B;  1WX9 A;  3H6N A;  4FLH A;  4W9I A;  2LRW A;  5AEK B;  2GBR A;  3ZKJ C;  3QAQ A;  4HPL B;  2CR5 A;  4DK5 A;  1IYF A;  1WX7 A;  2LD9 A;  4HJK A;  1WMH A;  4HVB A;  2BWE S;  4MDK E;  4YL8 A;  1GC7 A;  5DPW A;  1TZ1 A;  3PHX B;  4OVV A;  2KFK A;  3WA0 A;  1UD7 A;  1UBQ A;  3A9K B;  4MH0 E;  1E8Y A;  4GDK A;  4W9L A;  5DPT A;  5JZE B;  2KJR A;  4W9C A;  4GXB A;  2KN5 A;  3EC8 A;  1EF5 A;  3PTF C;  4PYU A;  3ENE A;  3QK0 A;  2JF5 A;  4AUQ C;  2N9P C;  3DBH I;  2KWC A;  3DVG Y;  4XX5 A;  2K39 A;  2AL3 A;  3PSE B;  3ZDT A;  2L3Z A;  2ZCC A;  3APD A;  3QAR A;  2IO2 B;  4JGH B;  1HE8 A;  4AOF A;  3K9O B;  1X1M A;  5KHQ A;  2AYO B;  1WFY A;  2YVC A;  3AU4 A;  4NJ7 A;  1KM7 A;  5BO4 B;  4IUM B;  4IC7 B;  2M4N A;  1UEL A;  4AWJ A;  3A4S C;  3KUC B;  4HPM B;  1TBE A;  2Z0D B;  2CKH B;  2GBM A;  1OEY J;  3H9D A;  1E8W A;  3QIJ A;  1E8X A;  5DCN A;  1RRB A;  4BOS C;  3RZF A;  4GOC A;  2KK8 A;  1EO6 A;  3R7Q A;  4I6L B;  1EUV B;  2M0X A;  2KMC A;  3ZVV A;  1E7V A;  3N32 A;  3ZO5 B;  3VUX A;  2JRH A;  1R4M I;  1WIA A;  2K6D B;  3CF6 E;  4KDL B;  2DZJ A;  1WF9 A;  3K9P B;  2N1W A;  3IBE A;  4NNJ B;  3WAL A;  2R2Q A;  3M95 A;  3GOE A;  3AI5 A;  1YD8 U;  3NOB A;  3VVW B;  2KNB A;  3WAO A;  4W9G A;  1UZX B;  2IO1 B;  1V2Y A;  3DOW A;  2K8C A;  4B95 A;  2C7N B;  3D32 A;  2GMI C;  3X0W A;  2GBK A;  1SE9 A;  2MW5 A;  4ZRK A;  3V6E B;  5AZG A;  2O6V D;  3VH3 B;  2RGF A;  4F8C B;  2BWF A;  3ZTD A;  4AP4 C;  4B6W A;  1J19 A; 
#chains in the Genus database with same CATH topology
 3ZXV A;  2JX5 A;  4F1S A;  3L0W B;  1K50 A;  2BVC A;  4X57 B;  2V4I B;  2KVR A;  3I63 C;  3CST A;  4RNA A;  4EZK A;  2WU2 B;  1FCC C;  2WXN A;  2FAZ A;  4ANW A;  2NR2 A;  3B2F A;  2WX0 A;  2QMT A;  4WWM A;  1EU3 A;  3KWV A;  5C1Z A;  4NPN A;  3NY5 A;  2LUM A;  1UWX A;  2NBW B;  1P7F A;  2JY6 A;  3KWL A;  3RN9 C;  2I1K A;  2WU5 B;  1RLF A;  1E10 A;  4ICV A;  1T6B X;  1L6U A;  4GN1 A;  3RNF C;  4NAM A;  3BVZ A;  3PRM B;  3MC0 B;  3VXW A;  3OWE B;  3EFU A;  3BVM A;  4GB9 A;  1PDX A;  2XK5 B;  4TMA B;  5FR6 A;  4JQW C;  4GMV A;  2GRI A;  2W9N A;  1JML A;  4UDU C;  5FK9 C;  5LNK 1;  2WQY B;  4KDI C;  1QOB A;  3MTN B;  1FXI A;  5CHF A;  1P3Q U;  4HRS A;  4DXG A;  5D94 A;  3ZW3 A;  4BZA A;  2DAF A;  4LCD E;  2KQ7 A;  1DYQ A;  4PS7 A;  4YT0 B;  1MJD A;  4K7U A;  4TUU A;  4YSZ B;  3CWI A;  4KZC A;  2DYB A;  2MSE D;  2DLB A;  5IOI A;  4WQM A;  2CS4 A;  3PLU A;  1F1H A;  4KKJ A;  1GG3 A;  1WH3 A;  3ZUN A;  2K8B A;  2KWU B;  1C3T A;  5E6N A;  3ZDM C;  2G1E A;  1K51 A;  3EEC A;  3ZNZ B;  4IM2 A;  2N9L A;  3WAP A;  1VZ8 A;  3PZ7 A;  2PKO A;  1QF6 A;  1DOY A;  1P1A A;  2L1A A;  3ONS A;  1PGX A;  4K81 A;  4HDO A;  2K5P A;  4ICU A;  4K3C A;  4CYE A;  4KIK B;  1SE2 A;  2L0T A;  5CTR C;  3DPD A;  2D5G A;  2QSD A;  1R7S A;  1KH0 A;  2OHF A;  1VZ6 A;  4B0M A;  1WXV A;  1WWT A;  1JCK B;  3DVN V;  1KJT A;  2KYW A;  3MFG A;  3PGE A;  1C4C A;  3SR6 A;  2NBU A;  2FCS A;  3UF8 A;  1UBI A;  4BKT A;  2MBQ A;  1TYG B;  2FUH B;  3AEE B;  2GB1 A;  4I6N B;  1XLQ A;  4M8N A;  1JAL A;  1YJ1 A;  4US8 A;  3KUD B;  2NBV B;  1D5M C;  3BIN A;  1K8R B;  1VD2 A;  2JXX A;  3IAM 1;  4HWI B;  3MHZ A;  4LDT D;  1OTR B;  1ROE A;  1PQS A;  1XLO A;  3JVZ X;  2UWQ A;  1E90 A;  3NVY A;  4GSW A;  3N30 A;  4A3P A;  1I4G A;  3KQ4 A;  3TIX A;  2RDB C;  2DZM A;  2LWP A;  4FUL A;  3DWG C;  1H4R A;  1RM6 C;  2IGG A;  4G3X B;  4MJS A;  2BW2 A;  3VHT C;  1ISN A;  1N6Z A;  3OJ3 A;  2K9X A;  1L4D B;  4E74 A;  4RGT A;  4HPP A;  4A90 A;  4BOZ B;  3TJP A;  1WYW B;  3H7P B;  2KC1 A;  3L17 A;  4ZHO A;  2Y5P A;  2J0M A;  5LXH A;  4B0E A;  3IFW B;  2WXQ A;  3OAW A;  4KVG B;  1SB3 C;  1YJI A;  4YSX B;  3Q8F A;  4ZOH C;  3BK1 A;  3NHE B;  2YLM A;  2G9H D;  3Q3J A;  1ZXI A;  2G4S A;  2JXT A;  2XBB C;  3U52 E;  3HK0 A;  1I7H A;  2WDQ B;  5E6O A;  2KDE B;  1YQB A;  1AYF A;  2RPV A;  3CSF A;  2KZR A;  3PO0 A;  1QOF A;  2Z0E B;  2IPK D;  3KW5 B;  3BVG A;  5FKA C;  4MSM B;  4B9K A;  2L00 B;  2IO3 B;  2XEW A;  3PPA A;  3O13 A;  3URY A;  2JRI B;  3RT3 B;  1GC6 A;  3I5J C;  2HE7 A;  4HCP B;  2JUO A;  2KQS A;  4CQN A;  4DDG D;  4AJW A;  1A5R A;  4YTP B;  4TQ1 A;  2O2V B;  1TTN A;  3RZW C;  3B9J A;  2MP2 B;  3TMP B;  1OQR A;  4NY0 A;  2EKE C;  5BMG A;  1N5W A;  4IWQ A;  3WCQ A;  4LK0 M;  2INP E;  1YX6 B;  4W9H A;  3ALB A;  4C7Y A;  1F2R C;  4RGM A;  3DVG X;  3UQB A;  4JL9 A;  2LGI A;  2O6V B;  1QT9 A;  1ZDX A;  4QAY A;  4HKZ E;  4PYZ A;  1QIL A;  3DDC B;  3EA6 A;  4ITK A;  2L8J A;  5CHV C;  3H7S A;  3IAS 1;  1WGG A;  3Q8E A;  3ZJV A;  1SE3 A;  4NAW B;  3DBR B;  1ZGU B;  2D3G A;  1CK1 A;  5JH5 C;  2JPH A;  2MWS B;  2NPT A;  2WLB A;  4A3O A;  3IXS A;  1ZW7 A;  4BBN F;  2FCQ A;  3MP9 A;  2DZI A;  1XQQ A;  1WXM A;  4HEA 1;  1V6E A;  3L08 A;  4EUT A;  4XDD A;  1E7P B;  2FUG 1;  4C80 A;  2KOX A;  2BKF A;  3MC9 A;  4RGN A;  1TS5 A;  2BBC A;  2QIE B;  2QEJ C;  1QLB B;  4KSL C;  3ZNG C;  2R2O A;  3HIZ A;  2LVP A;  2WXL A;  1D5X C;  4HDQ A;  4WAF A;  3ZIM A;  4EKU A;  4FLH A;  2KQ4 X;  2R61 A;  5IO9 A;  2V3P A;  1KFY B;  2BB5 A;  4MDK E;  2WDR B;  1UBQ A;  2BS3 B;  5JZE B;  4W9L A;  2CJN A;  2KJR A;  3IT4 B;  1C79 A;  1EF5 A;  1FCL A;  3QK0 A;  4AUQ C;  4KX6 B;  2K22 A;  2ZCC A;  1HE8 A;  4AOF A;  2UU7 A;  1X1M A;  3AU4 A;  5BO4 B;  1KM7 A;  2LMC A;  4IUM B;  1SJE D;  1CJE A;  1M4V A;  1ENF A;  1OEY J;  3H9D A;  1RRB A;  2L32 A;  1LO5 D;  2N0S B;  1UNS A;  3E9S A;  3NVZ A;  1SXT A;  3ZO5 B;  2K6D B;  4KDL B;  3IBE A;  3WAL A;  3GOE A;  3AI5 A;  1YD8 U;  1ZP0 B;  1UZX B;  5D3D A;  3DOW A;  4B95 A;  2C7N B;  5AZG A;  2ACZ B;  1C4A A;  3VH3 B;  1NVI D;  2BWF A;  4AP4 C;  1J19 A;  3N9Y C;  1KTK A;  1RAX A;  1RYJ A;  4FJZ A;  4YSY B;  4WJN A;  2PE6 B;  3AXC A;  3IVF A;  2Z8L A;  4YWG G;  1Z5S B;  1ZXH A;  4W9D A;  2KFK B;  2KMM A;  4JLC A;  3VRA B;  1D4B A;  4C7Z A;  4KV2 A;  3KVF B;  2WXR A;  2MHJ A;  2EMS A;  4A6Q A;  2HTH A;  4K7W A;  2DX5 B;  1N60 A;  5CX3 A;  2KJH B;  4JPS A;  1XLN A;  4YTN B;  3V62 A;  1WSP A;  4JWU C;  2Y3A A;  2NCN A;  1QZE A;  2KX0 A;  2L52 A;  3ECI A;  4N59 A;  2BF8 B;  5EE0 A;  2WX1 A;  5T8I A;  1CZP A;  1J7A A;  5LLI A;  2MH7 A;  1MG8 A;  1GNU A;  3ZJT A;  4BKG A;  2M56 B;  4KIK A;  4ARC A;  4LDT B;  1RWS A;  1WJ6 A;  4ZYN A;  1S3S G;  3OJ4 B;  1V8C A;  4KSK C;  3BWU D;  5TSS A;  1I35 A;  1P7E A;  4C4V A;  2LRU A;  2IND C;  2WWZ A;  3PS6 A;  1Q0W B;  1WXS A;  1YIW A;  1KLG D;  1UGM A;  1ET6 A;  1MFW A;  3EHV A;  3QA8 A;  4ZRI A;  3N1Z C;  1VRA B;  3VH4 B;  3TSS A;  2C7M B;  3TL5 A;  1GJZ A;  2V4L A;  3A1Q B;  1N5X A;  3DQV A;  3M63 B;  2Y5B B;  3RYT A;  3VAW A;  4DDI D;  2GOW A;  3RFZ B;  3AEA B;  5EDS A;  4OZA A;  1UF0 A;  3CMM B;  4RM9 A;  1QKZ A;  2KWV B;  2GLS A;  4DBG A;  4MEL A;  4BKS D;  3DCG A;  2BYF A;  2WNM A;  2C5L C;  4LNO A;  4FAD A;  5BYS A;  2WXP A;  3NG0 A;  3SD5 A;  2BPS A;  1SSN A;  5BMH A;  4JE3 B;  3B08 A;  3VQI A;  3NZS A;  3ZTC A;  1LXD A;  3H7P A;  2MRP A;  3PV1 A;  3JSV B;  3I3T B;  3Q69 A;  2OJW A;  1UWM A;  3GE3 C;  4XWW A;  2LVO A;  1SGH A;  1I4H A;  4MM3 B;  3RPF C;  4H2A A;  3NZU A;  4KGR A;  1ESF A;  2J0J A;  3NS1 A;  3SDL C;  1GB4 A;  1E0Z A;  3ZXR A;  2INN E;  5IKC M;  5JHB A;  5MPO A;  1FFV A;  1YX5 B;  1IBX B;  4TSS A;  3Q8A A;  1VR9 A;  1AAR A;  4HCN B;  4ACF A;  2PEA A;  1AN8 A;  1I4Q A;  1N63 A;  3AE6 B;  1WJU A;  4KGT A;  3N1Y C;  4A55 A;  2KD0 A;  5BYR A;  1QQR A;  3TEZ A;  4E71 A;  2V0G A;  2QJL A;  2K1F A;  2IY0 B;  2KFJ A;  2XNA C;  2ZCB A;  4G50 A;  4HRO A;  3AEG B;  3BII D;  1FEH A;  2VZK D;  5C23 A;  2O2V A;  1GUA B;  2FCM A;  5GMV A;  2ZNV B;  3ZYY X;  2MP2 A;  1E6E B;  4KGS A;  3DVN U;  4PK1 A;  3BYT B;  4US9 A;  3VTV A;  2MCN B;  1V1O A;  1HEZ E;  4P16 A;  3UGB B;  2ICI A;  2ZPN A;  3PT2 B;  2O6V A;  2X38 A;  3SEB A;  1LQB A;  2RSU A;  4JX1 C;  1WE7 A;  2LI5 A;  4DQO C;  1IGD A;  4FBJ B;  3PZ8 A;  1WGH A;  2N9E B;  2ASQ A;  4NAW A;  4JWS C;  1XT9 B;  2RMM A;  2LFI A;  1J0G A;  1ZKH A;  5DPS A;  2G4D B;  2DYO A;  4RH6 A;  3A4R A;  2V3S A;  1KLV A;  3ABV B;  1FPY A;  3U8Z A;  5FR3 A;  2A5U A;  3BY4 B;  1JWS D;  4NQK E;  1L2N A;  3RNG C;  1FNU A;  3KYD D;  5HHD G;  1WJ4 A;  3AED B;  3ML9 A;  2BGF A;  3P4R B;  2AQ2 B;  1I42 A;  2FIF A;  4ZRJ A;  2BTE A;  2N7J A;  3PRP B;  2JZ3 B;  2BKR B;  3O65 B;  2MA9 B;  4RCO A;  4BVU C;  1KOT A;  3DBR I;  3DBS A;  4W9E A;  2DHZ A;  1NI2 A;  1BT0 A;  1WR6 E;  2KDI A;  3SHQ A;  1WMH B;  3N20 C;  3AM9 A;  2NTS A;  2J42 A;  5KHO A;  1L7Y A;  1VJK A;  4L1B A;  2MJD A;  1HQR D;  1M94 A;  1L0V B;  4EFO A;  1GAQ B;  2AQ1 B;  5E6J A;  1TS4 A;  2HD5 B;  2KTR B;  1EWY C;  2AL6 A;  2IBI B;  5IAA C;  1EU4 A;  1AWD A;  2KDB A;  2ZZP B;  4RM8 A;  4N58 A;  4WAA A;  4XC2 A;  1FD6 A;  2W3R A;  4G0N B;  2FBW B;  3N3K B;  1H8C A;  1VCB A;  5EE1 A;  1UUP A;  4EOY A;  5HFY A;  2HJ8 A;  2HJ1 A;  3W2D A;  3EUB 2;  3LXF A;  2LUE A;  1QOA A;  3H6N A;  3VRB B;  4W9I A;  2LRW A;  2GBR A;  3QAQ A;  2CR5 A;  4HVB A;  1SEB D;  1GC7 A;  5DPW A;  1TZ1 A;  2WDV B;  2KFK A;  4LLG M;  3A9K B;  2ONQ A;  2JU6 X;  2PMV A;  4W9C A;  3PTF C;  5IN7 A;  2N9P C;  3NZ3 A;  2KWC A;  3DVG Y;  3PSE B;  1JRO A;  3ZDT A;  1WGK A;  5KHQ A;  3R2I A;  4IC7 B;  2BQQ A;  2L83 A;  3Q8C A;  4AWJ A;  3A4S C;  4HPM B;  2Z0D B;  2ZW0 A;  1OQQ A;  2GBM A;  2WXO A;  1E8X A;  2DNF A;  2I38 A;  3RZF A;  1EO6 A;  3R7Q A;  2W82 A;  4I6L B;  2M0X A;  1SJH D;  3N32 A;  2JRH A;  3DBH B;  2WXG A;  4NNJ B;  2R2Q A;  3M95 A;  4N6E B;  1JQ4 A;  1L0Y B;  2IO1 B;  1V2Y A;  5EE9 A;  2WXH A;  2XN9 C;  1SE9 A;  2MW5 A;  4XYC A;  4ZRK A;  2RGF A;  3RNA C;  3ZTD A;  2KN4 A;  4F7Z A;  1YJJ A;  5C3J B;  2WXK A;  5J18 A;  5H8Y E;  1LGR A;  3L4P A;  1LFD A;  3NJT A;  1Q5W B;  1R4M B;  2DYM A;  1AW7 A;  2LXC A;  3GE8 C;  4EE2 A;  2KMA A;  3UIN B;  1WRD B;  2Y5C A;  2M17 A;  2C60 A;  3L13 A;  1ZDV A;  3RD2 A;  4BFR A;  4MGI E;  3A1Q A;  1V80 A;  3AU5 A;  3P63 A;  2INC C;  3WAN A;  1ET9 A;  3QWZ B;  1WRI A;  2AWT A;  3M3J A;  5JHA A;  1TY0 A;  2FNJ B;  2DWQ A;  1ZE3 D;  1V9J A;  3QQ8 B;  1FRD A;  4J6I A;  4LNF A;  2IGD A;  5HI1 A;  3NUH B;  1MI0 A;  2LVQ A;  1EF1 A;  1FXA A;  1OEY A;  4E3C A;  1KF6 B;  3N1X C;  4OZC A;  4WJO A;  3R8B A;  2KDM A;  1TJE A;  2PW9 A;  3AH7 A;  1DGJ A;  2LZ6 A;  1YN4 A;  2CU1 A;  4OZB A;  4ZYS A;  4IWO A;  4GGQ A;  2QHO A;  3H8H A;  1F0Z A;  3JSV A;  1WM2 A;  1XO3 A;  1C4P A;  2RDH A;  3W1S A;  4MM3 A;  3FKY A;  1C9F A;  2K8H A;  3U30 A;  2PLP A;  1YOV B;  1MHX A;  3EFC A;  3MHS D;  3P2B A;  1RFK A;  1VDV A;  1TT5 B;  4WWP A;  4CO7 A;  4GLS C;  1TKY A;  1STE A;  1T0Y A;  1WE6 A;  4XE0 A;  4GU2 A;  2VZK B;  1JWB D;  3TBL D;  4L23 A;  1V1P B;  3DHI C;  2VRR B;  1IBX A;  2QIL A;  1WR1 A;  1YN5 A;  4EZL A;  4BBN C;  2KC2 A;  4RGO S;  2A4Z A;  1I4X A;  3R7R A;  1T5X D;  2LAS A;  1GB1 A;  3VUY A;  2CHW A;  2J53 A;  1FRR A;  5AZH A;  2D07 B;  2JVC A;  2XK5 A;  4II2 B;  3AE5 B;  4ZHP A;  1R4N B;  2CJO A;  5AUK A;  1TIF A;  1WGY A;  4R3D A;  3AMZ A;  2LJ5 A;  4DHZ E;  3OG5 A;  2V1Y A;  1PFD A;  3Q3O C;  3NVV A;  2VH2 A;  1WXA A;  1OGW A;  1PUT A;  2ZPY A;  3HUI A;  3NS8 A;  1CMX B;  4MSQ B;  3ML8 A;  3LB8 C;  5G2N A;  1F77 A;  1N62 A;  4O1N A;  3MC8 A;  1GOZ A;  2J0K A;  2OOB B;  5AUI A;  1NEK B;  2M1M A;  1L6V A;  4WWO A;  2H89 B;  1WGR A;  4OW0 A;  2BYV E;  5BMI A;  2LJI A;  3W1S C;  3VR8 B;  1TZO A;  4ARI A;  4FA6 A;  4DXA B;  4IDI A;  1TGZ B;  1PYW D;  1J7C A;  5I4D A;  1WZ3 A;  4LNK A;  2CHX A;  4NQL B;  1FFU A;  2ZW1 A;  2Z59 B;  3A9J B;  2KDF B;  3QCA A;  4FXC A;  3AE4 B;  1S1Q B;  5BYQ A;  3E56 A;  1FXT B;  1UH6 A;  4P7I A;  4XWT A;  2ON8 A;  4Q2J A;  2IDY A;  1XXG A;  3WAM A;  3PRE A;  1WI0 A;  1HXY D;  3L10 B;  1YQ4 B;  2CU3 A;  2TSS A;  4IM0 A;  1DOI A;  4AS1 A;  1YMH E;  2N1V A;  4FHK A;  4DHJ D;  2IO0 B;  2D11 A;  5H92 C;  1Q1O A;  1FNV A;  3QJZ A;  3NRZ A;  3LDZ E;  4P6V F;  1ZUD 2;  2KAC A;  4RMA A;  2I1J A;  3LJ3 A;  3WIM A;  3OLM D;  1NEN B;  3TEY A;  3DBL B;  1VZ7 A;  2AQ3 B;  3AE9 B;  4IM3 A;  4M0W B;  3B2G A;  2KO3 A;  1WZ0 A;  4IKG A;  3VFK A;  3U7D A;  2L0F A;  4EEW A;  4MGZ E;  1U4A A;  2DZK A;  1WGD A;  2KLG A;  4N9F 4;  1F9J A;  1WX8 A;  1V49 A;  3IT6 B;  1D5Z C;  1HTQ A;  2WYQ A;  2YEP B;  4WWN A;  3APC A;  4MGY E;  3AE7 B;  4A20 A;  2EMT A;  2IGH A;  2MBO A;  2KTR A;  3KYC D;  3P1M A;  3UIO B;  3PLV A;  1JWM D;  5IA7 A;  2BT6 A;  2VH1 A;  4TV3 A;  1MPE A;  4LTU A;  3DWM A;  3MJ5 A;  2ZJD A;  4OHJ A;  1TKG A;  4MAC A;  1YQ3 B;  4YXD B;  5L95 C;  1D3Z A;  2NPT B;  1HA5 A;  2J52 A;  2X8X X;  4K7S A;  1TS2 A;  1FMA D;  2AEH A;  2JYT A;  3A9K A;  1N61 A;  4GIV A;  3RNB C;  3AEB B;  3PRZ A;  1Y8R C;  2LXA A;  3IHP C;  3Q3M C;  3FAH A;  2MJ3 A;  4XDC A;  4BAX A;  4HXD A;  3QHT A;  3T3O A;  2PJH A;  3AV8 A;  2LGX A;  3DHH C;  3V3X A;  2KHW B;  4FN2 A;  3GS2 A;  4OVU A;  2M0A A;  1V5T A;  2LGD A;  4IOI E;  3QX1 A;  3IG3 A;  5D6J B;  5HG2 A;  4P1C C;  1XCT L;  2J7Q B;  5IP4 D;  1P98 A;  5CHW A;  4ANU A;  2KLC A;  2EEL A;  2RDG A;  1GPX A;  1C76 A;  3T8M A;  4WQO B;  2MBE A;  3GZN B;  3Q6B A;  5G5H A;  1HTO A;  4M00 A;  1C77 A;  1NYQ A;  4TKN A;  3VDZ A;  5J2R A;  4IWP A;  1JRU A;  1SIF A;  3L54 A;  5E6P A;  4G11 A;  4BKS A;  1XD3 B;  3H1U A;  3EGR A;  1F52 A;  3FIL B;  4W9F A;  3ZNH B;  1WX9 A;  3C8Y A;  5AEK B;  2WXI A;  3ZKJ C;  4HPL B;  4ZRQ A;  2LD9 A;  3U2S C;  1T0S C;  4YL8 A;  3PHX B;  3WA0 A;  1UD7 A;  4MH0 E;  1E8Y A;  3T3N A;  3RNE C;  2WXJ A;  3W9C B;  2JF5 A;  2PVO D;  3DBH I;  4C00 A;  3TEX A;  4XX5 A;  2AL3 A;  5EE3 A;  2L3Z A;  3QAR A;  3K9O B;  2JQR B;  2YVC A;  2D3B A;  2HDE A;  2M4N A;  1UEL A;  1J7B A;  3P4S B;  3ZGZ A;  2CKH B;  2QCZ A;  3QIJ A;  5DCN A;  4BOS C;  4GOC A;  2KK8 A;  3I9V 1;  1OFF A;  2KMC A;  1E7V A;  3HVZ A;  3HRD D;  1XCQ L;  1R4M I;  1UGJ A;  2JSV X;  3SFD B;  5JXV A;  1WF9 A;  3K9P B;  4HJG E;  4J3O D;  2I2Y A;  1NYR A;  3VVW B;  3WAO A;  4W9G A;  1L4Z B;  1EWC A;  2K8C A;  2WXF A;  3TEW A;  3D32 A;  3KLS X;  2GMI C;  2PTL A;  3X0W A;  2LGS A;  3U4E G;  1TKE A;  1BXT A;  4B6W A;  2LGY A;  2FE8 A;  4GDL B;  4L2Y A;  1MVK A;  4ZRP A;  3TUO A;  4K1R B;  1V1P A;  3W1Y A;  3B1L X;  1BML C;  1JWU D;  1VLB A;  4ZDV A;  1IGC A;  3HM3 A;  4C4V B;  2D10 A;  1JWA D;  3I57 A;  4M8M A;  1KRH A;  2MBH A;  4RF0 A;  4GDK B;  1IPG A;  3PVL A;  3U7Z A;  2D2Q A;  3Q14 C;  2D3C A;  1SE4 A;  4WIP A;  2KWD A;  2K25 A;  2JYE A;  3RUL A;  1ZOY B;  3HVD A;  1OQY A;  3KH0 A;  4MGK E;  3T9L A;  1WY8 A;  2M19 A;  1C1Y B;  2LEK A;  2BS4 B;  3A33 B;  4S0R A;  3QC8 B;  1FIQ A;  1T0R C;  3AN1 A;  3GP7 A;  3R66 C;  3S2A A;  4JIO U;  3Q3N C;  2KXJ A;  4AQ7 A;  4WJP A;  2NS5 A;  2L05 A;  3TCA A;  3ETR A;  2RPQ A;  2C9W B;  2WXM A;  4C56 C;  3AEC B;  5D2M B;  2RD0 A;  3ZJU A;  4DHJ B;  4EZJ A;  1IP9 A;  2E6X A;  3AE1 B;  2KT7 A;  2JZZ A;  1Q10 A;  4KKI A;  1SIJ A;  2L76 A;  3GB1 A;  5L83 A;  2UYZ B;  1HZ6 A;  3Q8B A;  1R4N I;  3RI7 C;  2FCN A;  5HKH A;  3A9J A;  1G6J A;  1LM8 B;  1RFA A;  1A70 A;  2MJE A;  3BYY B;  4LJP B;  2IY1 B;  4HK2 A;  3V6C B;  2GBJ A;  2DBY A;  3Q3F A;  1P9D U;  2KAN A;  2N9X A;  4USA A;  3J9C A;  3AB5 A;  4PS3 A;  3UQA A;  4D2K A;  1FNW A;  4NZL B;  3BK2 A;  4PS8 A;  2WGS A;  1V81 A;  5LXI B;  1TS3 A;  4LNI A;  1F2R I;  2L7R A;  2REX A;  1TY2 A;  4MEM A;  2LHE A;  1C78 A;  3HM6 X;  3AE3 B;  1V5O A;  4M0W A;  2W3S A;  1T0Q C;  1E7U A;  2IZV B;  3JW0 X;  3CIR B;  1IUE A;  2H88 B;  3RNC C;  1V86 A;  1HZ5 A;  2K6Q A;  2J4X A;  4FJY A;  2MBB B;  1MG4 A;  4W9K A;  3ZLZ A;  1JRP A;  1ZPS A;  4OVZ A;  3VUW A;  3R2T A;  5C2T B;  3NVW A;  2MQJ A;  4XZ4 A;  3DBL I;  2GBN A;  4IW0 A;  2PPH A;  4ASW C;  5D7G A;  5TR5 A;  2YEP F;  2W54 A;  3ZRC A;  3FC4 A;  1D6E C;  1NDD A;  2WDT B;  2WP9 B;  4KZ0 A;  2JT4 B;  2ZVN A;  3AUL A;  3DHG C;  2B3A A;  2JWU A;  3R3M A;  1K53 A;  1E9M A;  1XEE A;  3W5V B;  4TQ0 A;  2MLB A;  4RFB A;  2C7H A;  1I4R A;  2DEN B;  4NJC A;  2NMQ A;  4CHK A;  1DOX A;  4XGA B;  1NI3 A;  1QOG A;  2ZEQ A;  3JYU A;  3SU8 X;  3MJW A;  1WM3 A;  3P42 A;  4S17 A;  1L5P A;  5J17 A;  1EM7 A;  3ZRF A;  2D3A A;  3M62 B;  3V05 A;  4HKQ A;  2ZVO A;  2V9H A;  3C0R B;  2DAJ A;  3SFE B;  3APF A;  2MEK A;  1MHH E;  4M01 A;  2PE9 A;  3KUZ A;  4ANV A;  1KLU D;  2CHZ A;  4LJO B;  4II3 B;  2N7D A;  4FJV B;  3UIP B;  1ACC A;  2LHD A;  3W5U B;  3AEF B;  3ZNI D;  2V3N A;  4LNN A;  3RCZ A;  2BB6 A;  1V97 A;  2SAK A;  1P0R A;  3HHM A;  4I6P A;  1J8C A;  2KVZ A;  1B9R A;  2K3U A;  3P4P B;  1E8Z A;  2G3Q B;  4DHZ B;  1SBB B;  3FIL A;  1Y56 A;  4NJ6 A;  2QC8 A;  4MJS B;  2N7E A;  2G45 B;  2KTF A;  4WJQ A;  3VTU A;  4PT5 A;  5D3I B;  2M8S A;  2EKI A;  2KJ6 A;  4M02 A;  3LYY A;  1XF5 L;  3PHW B;  2N9K A;  4FHJ A;  3VTW A;  4WUR A;  5G5G A;  3V60 A;  3BZD B;  4URK A;  2K0P A;  2KKC A;  3GZN I;  4ANX A;  3Q2A C;  1CQV A;  2BYE A;  2N4F A;  1WJN A;  3V61 A;  2IYD B;  2B76 B;  2JWZ A;  2BS2 B;  2WS3 B;  2RR9 A;  2KX3 A;  4IG7 B;  1FO4 A;  1PGA A;  2OJR A;  2PIA A;  3L16 A;  1NBF C;  1YN3 A;  1WYG A;  3B0A A;  3X23 A;  1FM0 D;  1E5W A;  3VR9 B;  4W9J A;  1SF0 A;  5AZF A;  4HLE A;  4WH4 A;  2MX2 A;  4MT5 A;  1K52 A;  5G55 A;  4AJY B;  4RF1 A;  3PZD A;  1Z2M A;  2NVU I;  2ZNV C;  3AE8 B;  5DPR A;  2W55 A;  4YTM B;  2FID A;  4DWF A;  4GDL A;  2AX5 A;  3RUI B;  3AE2 B;  3RMK C;  4A8X C;  2KAJ A;  4DK5 A;  1IYF A;  1WX7 A;  4HJK A;  1WMH A;  2JZP A;  2BWE S;  3C19 A;  2PVG C;  4OVV A;  1WXQ A;  2OED A;  2QDF A;  4GDK A;  5DPT A;  1T3Q A;  4GXB A;  2KN5 A;  2E3T A;  2IJ0 A;  1XLP A;  3EC8 A;  4PYU A;  3ENE A;  5GXG B;  1B1Z A;  4REZ A;  2K39 A;  2BYT A;  4JGH B;  3APD A;  2IO2 B;  1I4P A;  2AYO B;  1WFY A;  1BUI C;  4K3B A;  4NJ7 A;  1L0X B;  2NTT A;  1YNT E;  2HTM E;  4P1B C;  2Q5W D;  3KUC B;  3P4Q B;  1TBE A;  1JW9 D;  4DXF A;  1E8W A;  3UI3 A;  2WHI A;  1EUV B;  3ZVV A;  3VUX A;  1WIA A;  3CF6 E;  2DZJ A;  2N1W A;  4A9A A;  3NOB A;  2SEB D;  2KNB A;  3ZQ4 A;  2GBK A;  3V6E B;  2GI9 A;  2O6V D;  4F8C B;  4MH8 A;  1PGB A; 
#chains in the Genus database with same CATH homology
 2LGY A;  4F7Z A;  1RAX A;  4F1S A;  4GDL B;  3L0W B;  4FJZ A;  5J18 A;  4WJN A;  2PE6 B;  4K1R B;  1LFD A;  3AXC A;  3IVF A;  4X57 B;  3W1Y A;  3B1L X;  1Q5W B;  2KVR A;  4ZDV A;  2DYM A;  2LXC A;  3CST A;  3HM3 A;  2D10 A;  2KMA A;  3UIN B;  1WRD B;  1Z5S B;  4EZK A;  2M17 A;  2C60 A;  3L13 A;  4M8M A;  4W9D A;  3RD2 A;  2KFK B;  4BFR A;  2MBH A;  3A1Q A;  4MGI E;  1V80 A;  4JLC A;  3AU5 A;  4GDK B;  2FAZ A;  3WAN A;  1IPG A;  3PVL A;  3KVF B;  4KV2 A;  2NR2 A;  3QWZ B;  4ANW A;  2AWT A;  2D2Q A;  2WX0 A;  2EMS A;  3M3J A;  5C1Z A;  2HTH A;  4K7W A;  4NPN A;  5JHA A;  2DX5 B;  2K25 A;  2FNJ B;  3NY5 A;  2NBW B;  2JY6 A;  2KJH B;  5CX3 A;  3RUL A;  1V9J A;  3V62 A;  2I1K A;  3QQ8 B;  1OQY A;  3KH0 A;  4MGK E;  3T9L A;  1WY8 A;  4J6I A;  1C1Y B;  3A33 B;  3QC8 B;  2NCN A;  1QZE A;  1RLF A;  2KX0 A;  3ECI A;  4ICV A;  2LVQ A;  2BF8 B;  2WX1 A;  1EF1 A;  3R66 C;  4GN1 A;  3PRM B;  1OEY A;  5LLI A;  3S2A A;  4E3C A;  4JIO U;  1MG8 A;  4WJO A;  2KXJ A;  1GNU A;  3VXW A;  4WJP A;  3EFU A;  2NS5 A;  4GB9 A;  4BKG A;  4KIK A;  2XK5 B;  5FR6 A;  2LZ6 A;  4JQW C;  4LDT B;  4GMV A;  1WJ6 A;  2CU1 A;  2L05 A;  3TCA A;  4IWO A;  4ZYN A;  2RPQ A;  2W9N A;  4GGQ A;  2QHO A;  3JSV A;  2C9W B;  1S3S G;  3OJ4 B;  1WM2 A;  5D2M B;  2RD0 A;  3W1S A;  4KDI C;  4KSK C;  4MM3 A;  4DHJ B;  1I35 A;  4EZJ A;  2K8H A;  1IP9 A;  3U30 A;  2LRU A;  3MTN B;  2WWZ A;  5CHF A;  2JZZ A;  1P3Q U;  3MHS D;  3P2B A;  3PS6 A;  1Q0W B;  5D94 A;  3ZW3 A;  2L76 A;  4WWP A;  1WXS A;  1YIW A;  2DAF A;  4CO7 A;  5L83 A;  2UYZ B;  1T0Y A;  1WE6 A;  1UGM A;  4GU2 A;  3TBL D;  1R4N I;  4LCD E;  2KQ7 A;  3EHV A;  2FCN A;  4PS7 A;  5HKH A;  3QA8 A;  4K7U A;  4TUU A;  2VRR B;  3A9J A;  1G6J A;  4ZRI A;  4KZC A;  2DYB A;  1LM8 B;  2MSE D;  1WR1 A;  3VH4 B;  1RFA A;  2C7M B;  3TL5 A;  4EZL A;  1GJZ A;  2CS4 A;  2KC2 A;  2V4L A;  3A1Q B;  4BBN C;  3PLU A;  2A4Z A;  3DQV A;  3M63 B;  1GG3 A;  1WH3 A;  4LJP B;  2Y5B B;  3RYT A;  2IY1 B;  2K8B A;  3R7R A;  3VAW A;  4HK2 A;  3ZUN A;  4DDI D;  2LAS A;  3V6C B;  2KWU B;  2GOW A;  3VUY A;  1C3T A;  2CHW A;  5AZH A;  2GBJ A;  5EDS A;  3Q3F A;  2D07 B;  5E6N A;  1P9D U;  3CMM B;  3ZDM C;  2KAN A;  2N9X A;  4RM9 A;  3EEC A;  2JVC A;  2KWV B;  2XK5 A;  4II2 B;  3ZNZ B;  4IM2 A;  3WAP A;  1P1A A;  4DBG A;  4PS3 A;  3UQA A;  1WGY A;  3ONS A;  4MEL A;  4BKS D;  2LJ5 A;  3DCG A;  2BYF A;  4DHZ E;  2V1Y A;  4K81 A;  2C5L C;  4PS8 A;  4FAD A;  4HDO A;  1V81 A;  5LXI B;  3SD5 A;  2BPS A;  1WXA A;  4ICU A;  4CYE A;  1OGW A;  2L7R A;  2ZPY A;  3B08 A;  4KIK B;  2REX A;  3VQI A;  3NS8 A;  2L0T A;  3NZS A;  1CMX B;  4MEM A;  5CTR C;  4MSQ B;  3ML8 A;  3DPD A;  3ZTC A;  3HM6 X;  5G2N A;  1LXD A;  3H7P A;  2MRP A;  1V5O A;  3PV1 A;  3JSV B;  3I3T B;  2J0K A;  2LVO A;  1E7U A;  1WXV A;  2OOB B;  1SGH A;  2IZV B;  3DVN V;  1KJT A;  2M1M A;  3JW0 X;  4WWO A;  1WGR A;  2BYV E;  3W1S C;  3NZU A;  3PGE A;  2J0J A;  3SDL C;  1V86 A;  2NBU A;  4FA6 A;  2K6Q A;  4DXA B;  2FCS A;  4FJY A;  2MBB B;  3UF8 A;  1UBI A;  1TGZ B;  4BKT A;  2MBQ A;  4W9K A;  3ZLZ A;  1WZ3 A;  2FUH B;  5JHB A;  4I6N B;  4M8N A;  2CHX A;  4NQL B;  1YJ1 A;  2Z59 B;  3A9J B;  3VUW A;  1YX5 B;  3KUD B;  2KDF B;  3QCA A;  2NBV B;  1AAR A;  1S1Q B;  4HCN B;  3BIN A;  4P7I A;  1FXT B;  1UH6 A;  1K8R B;  1VD2 A;  2PEA A;  2JXX A;  4HWI B;  4LDT D;  1OTR B;  2MQJ A;  1WJU A;  4XZ4 A;  3PRE A;  3WAM A;  1WI0 A;  1PQS A;  3JVZ X;  2UWQ A;  3DBL I;  2GBN A;  4IW0 A;  1E90 A;  4GSW A;  3N30 A;  2PPH A;  3L10 B;  4ASW C;  5D7G A;  4IM0 A;  5TR5 A;  2KD0 A;  4A3P A;  4FHK A;  2N1V A;  3ZRC A;  3TIX A;  4DHJ D;  2IO0 B;  1NDD A;  2WDT B;  4E71 A;  2DZM A;  4KZ0 A;  2LWP A;  2JT4 B;  2ZVN A;  2D11 A;  3AUL A;  4FUL A;  1H4R A;  2B3A A;  4G3X B;  3R3M A;  4MJS A;  2K1F A;  2IY0 B;  1Q1O A;  2KFJ A;  2ZCB A;  3VHT C;  1ISN A;  4G50 A;  3OJ3 A;  3QJZ A;  4E74 A;  3LDZ E;  2O2V A;  5C23 A;  4TQ0 A;  1GUA B;  2MLB A;  2FCM A;  5GMV A;  2ZNV B;  4RMA A;  2C7H A;  2I1J A;  2MP2 A;  3LJ3 A;  3WIM A;  3OLM D;  2DEN B;  4BOZ B;  3DVN U;  3TJP A;  1WYW B;  4CHK A;  3H7P B;  3VTV A;  2KC1 A;  4IM3 A;  2MCN B;  2ZEQ A;  4M0W B;  3L17 A;  3JYU A;  2J0M A;  2KO3 A;  1WZ0 A;  3VFK A;  3UGB B;  3SU8 X;  3MJW A;  1WM3 A;  3U7D A;  2ZPN A;  5J17 A;  5LXH A;  3PT2 B;  2L0F A;  2O6V A;  4EEW A;  3ZRF A;  4MGZ E;  1U4A A;  3M62 B;  2DZK A;  1WGD A;  3IFW B;  1LQB A;  2KLG A;  2RSU A;  4N9F 4;  2ZVO A;  1F9J A;  3OAW A;  4KVG B;  1WE7 A;  1WX8 A;  2LI5 A;  3C0R B;  2DAJ A;  1V49 A;  4FBJ B;  3NHE B;  2YLM A;  3Q3J A;  3APF A;  2G4S A;  1WGH A;  2WYQ A;  2N9E B;  2XBB C;  2ASQ A;  4NAW A;  4WWN A;  1XT9 B;  2PE9 A;  3KUZ A;  3APC A;  4MGY E;  1J0G A;  4ANV A;  4A20 A;  3HK0 A;  1ZKH A;  2CHZ A;  2EMT A;  4LJO B;  2G4D B;  2DYO A;  4II3 B;  5DPS A;  5E6O A;  2N7D A;  2MBO A;  2KDE B;  1YQB A;  2KTR A;  3KYC D;  4FJV B;  3CSF A;  3UIO B;  3UIP B;  3A4R A;  2V3S A;  3PLV A;  2KZR A;  3ZNI D;  5IA7 A;  2Z0E B;  3RCZ A;  3KW5 B;  4TV3 A;  4MSM B;  4B9K A;  1KLV A;  2L00 B;  3U8Z A;  2IO3 B;  1P0R A;  3HHM A;  4I6P A;  2ZJD A;  2A5U A;  2XEW A;  3PPA A;  1J8C A;  2JRI B;  3RT3 B;  1GC6 A;  3BY4 B;  1E8Z A;  5L95 C;  4NQK E;  1D3Z A;  2NPT B;  2HE7 A;  2G3Q B;  4HCP B;  4DHZ B;  1L2N A;  2JUO A;  2KQS A;  4NJ6 A;  3KYD D;  2N7E A;  4MJS B;  4AJW A;  4DDG D;  2G45 B;  2KTF A;  1A5R A;  4WJQ A;  1WJ4 A;  3ML9 A;  2BGF A;  4TQ1 A;  3VTU A;  1I42 A;  2O2V B;  1TTN A;  2M8S A;  3RZW C;  2KJ6 A;  2FIF A;  4ZRJ A;  4K7S A;  2MP2 B;  2AEH A;  3PRP B;  4NY0 A;  3TMP B;  2EKE C;  2BKR B;  2JZ3 B;  3O65 B;  2MA9 B;  1KOT A;  4BVU C;  3PHW B;  3DBR I;  3A9K A;  4IWQ A;  4FHJ A;  4GIV A;  3DBS A;  3PRZ A;  4W9E A;  1Y8R C;  2LXA A;  3VTW A;  3IHP C;  1YX6 B;  4W9H A;  2DHZ A;  3ALB A;  3V60 A;  1NI2 A;  4URK A;  3DVG X;  3UQB A;  1BT0 A;  1WR6 E;  2KDI A;  4JL9 A;  3SHQ A;  4HXD A;  2KKC A;  2O6V B;  3QHT A;  1WMH B;  3GZN I;  4ANX A;  2PJH A;  2BYE A;  2LGX A;  2N4F A;  1WJN A;  4PYZ A;  3V61 A;  2IYD B;  3DDC B;  2KHW B;  4FN2 A;  5KHO A;  1L7Y A;  4OVU A;  2L8J A;  1V5T A;  5CHV C;  1M94 A;  2LGD A;  2JWZ A;  3H7S A;  3QX1 A;  3IG3 A;  1WGG A;  2RR9 A;  5D6J B;  4EFO A;  2KX3 A;  4IG7 B;  4NAW B;  2J7Q B;  1P98 A;  5CHW A;  1ZGU B;  2KLC A;  2D3G A;  4ANU A;  2OJR A;  3L16 A;  5JH5 C;  2JPH A;  2MWS B;  2NPT A;  2HD5 B;  2KTR B;  4A3O A;  1NBF C;  2AL6 A;  1ZW7 A;  2IBI B;  4BBN F;  2FCQ A;  3B0A A;  5IAA C;  3X23 A;  1E5W A;  2DZI A;  1XQQ A;  1WXM A;  2KDB A;  4W9J A;  3T8M A;  4WQO B;  5AZF A;  4HLE A;  2MBE A;  2MX2 A;  2ZZP B;  1V6E A;  3L08 A;  5J2R A;  4TKN A;  4EUT A;  4RM8 A;  3VDZ A;  5G55 A;  4WAA A;  4AJY B;  4XC2 A;  4IWP A;  2KOX A;  1JRU A;  1SIF A;  2BKF A;  3PZD A;  4G0N B;  3L54 A;  1Z2M A;  3N3K B;  5E6P A;  1H8C A;  4G11 A;  2NVU I;  4BKS A;  1VCB A;  2ZNV C;  1XD3 B;  3H1U A;  4KSL C;  5DPR A;  4EOY A;  2FID A;  3ZNG C;  2HJ8 A;  2R2O A;  3HIZ A;  2LVP A;  4W9F A;  3ZNH B;  4DWF A;  2LUE A;  4HDQ A;  3ZIM A;  4GDL A;  4EKU A;  3RUI B;  1WX9 A;  3H6N A;  4FLH A;  4W9I A;  2LRW A;  5AEK B;  2GBR A;  3ZKJ C;  3QAQ A;  4HPL B;  2CR5 A;  4DK5 A;  1IYF A;  1WX7 A;  2LD9 A;  4HJK A;  1WMH A;  4HVB A;  2BWE S;  4MDK E;  4YL8 A;  1GC7 A;  5DPW A;  1TZ1 A;  3PHX B;  4OVV A;  2KFK A;  3WA0 A;  1UD7 A;  1UBQ A;  3A9K B;  4MH0 E;  1E8Y A;  4GDK A;  4W9L A;  5DPT A;  5JZE B;  2KJR A;  4W9C A;  4GXB A;  2KN5 A;  3EC8 A;  1EF5 A;  3PTF C;  4PYU A;  3ENE A;  3QK0 A;  2JF5 A;  4AUQ C;  2N9P C;  3DBH I;  2KWC A;  3DVG Y;  4XX5 A;  2K39 A;  2AL3 A;  3PSE B;  3ZDT A;  2L3Z A;  2ZCC A;  3APD A;  3QAR A;  2IO2 B;  4JGH B;  1HE8 A;  4AOF A;  3K9O B;  1X1M A;  5KHQ A;  2AYO B;  1WFY A;  2YVC A;  3AU4 A;  4NJ7 A;  1KM7 A;  5BO4 B;  4IUM B;  4IC7 B;  2M4N A;  1UEL A;  4AWJ A;  3A4S C;  3KUC B;  4HPM B;  1TBE A;  2Z0D B;  2CKH B;  2GBM A;  1OEY J;  3H9D A;  1E8W A;  3QIJ A;  1E8X A;  5DCN A;  1RRB A;  4BOS C;  3RZF A;  4GOC A;  2KK8 A;  1EO6 A;  3R7Q A;  4I6L B;  1EUV B;  2M0X A;  2KMC A;  3ZVV A;  1E7V A;  3N32 A;  3ZO5 B;  3VUX A;  2JRH A;  1R4M I;  1WIA A;  2K6D B;  3CF6 E;  4KDL B;  2DZJ A;  1WF9 A;  3K9P B;  2N1W A;  3IBE A;  4NNJ B;  3WAL A;  2R2Q A;  3M95 A;  3GOE A;  3AI5 A;  1YD8 U;  3NOB A;  3VVW B;  2KNB A;  3WAO A;  4W9G A;  1UZX B;  2IO1 B;  1V2Y A;  3DOW A;  2K8C A;  4B95 A;  2C7N B;  3D32 A;  2GMI C;  3X0W A;  2GBK A;  1SE9 A;  2MW5 A;  4ZRK A;  3V6E B;  5AZG A;  2O6V D;  3VH3 B;  2RGF A;  4F8C B;  2BWF A;  3ZTD A;  4AP4 C;  4B6W A;  1J19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...