1WM2A

Crystal structure of human sumo-2 protein
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
78
structure length
78
Chain Sequence
TENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the human SUMO-2 protein at 1.6 A and 1.2 A resolution: implication on the functional differences of SUMO proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Ubiquitin-like protein SMT3B
total genus 19
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2004-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wm2A00
3NZUA 2MSED 2ZEQA 3EFUA 1P3QU 1SE9A 2KDEB 1E8WA 2RD0A 4WJNA 3KYCD 2R2OA 3DCGA 2DX5B 3WIMA 2KJRA 1EF5A 4ICUA 2G4SA 2AYOB 1ZKHA 4G50A 4P7IA 4WWPA 4TQ0A 2GBKA 2DZIA 3A4RA 3I3TB 3ZTCA 1A5RA 2O6VD 2KO3A 2Z0DB 5E6PA 3VUYA 2NBVB 2BGFA 3ZVVA 2NBWB 3PVLA 4AJYB 2REXA 4M8NA 3U8ZA 1E8ZA 1QZEA 2KLCA 2LXAA 3V62A 5L95C 2LD9A 3X0WA 3H7PB 3B1LX 2I1JA 1IYFA 2A5UA 5DCNA 1V5OA 1RAXA 4II2B 4GN1A 3SD5A 1OTRB 3ECIA 4IWQA 3GZNI 4CHKA 3CF6E 2KWCA 1GNUA 2MBEA 4MEMA 1E7UA 3V6EB 3ZNZB 1KOTA 3ZKJC 1LXDA 5AZFA 3WAMA 3A4SC 4W9IA 2DENB 2EKEC 3QWZB 3UIPB 4TUUA 4LJOB 1YIWA 3L08A 3CSTA 2NVUI 4XZ4A 1G6JA 1M94A 1TGZB 2J0JA 3N30A 2BWFA 4RM9A 3VH3B 1NI2A 4KDLB 3ZW3A 2D10A 1WRDB 2DYOA 3OJ4B 2GBJA 3Q3FA 4BBNC 1EO6A 3QAQA 1WH3A 1Q0WB 2KTRB 4JGHB 4WJPA 3RUIB 2MQJA 1WE6A 2K6DB 2N7EA 2RSUA 3PZDA 4II3B 4K7UA 5KHQA 4URKA 3A1QA 2N9PC 2L7RA 1NBFC 4EOYA 2NR2A 3QCAA 3PGEA 1E8YA 3UQBA 1V2YA 4HJKA 4FHJA 3SDLC 4W9CA 3UIOB 4HCNB 4AWJA 2G3QB 3RD2A 1E5WA 2BWES 4HVBA 1J0GA 3B08A 2Z0EB 1K8RB 2AEHA 3VQIA 4M0WB 4W9KA 4ZRJA 2LUEA 1WIAA 3PTFC 2WX0A 3ALBA 1XD3B 3JW0X 5DPSA 2K1FA 1Z2MA 1KLVA 1RRBA 3P2BA 4GXBA 5FR6A 4ASWC 4MGIE 1NDDA 1XQQA 1V6EA 5LLIA 2N1WA 1XT9B 3W1YA 4HXDA 2L05A 2JZ3B 5DPRA 2BYFA 4TV3A 4FLHA 3L17A 2C9WB 2KFKB 4E74A 3EECA 2MRPA 3A9JA 5HKHA 2ASQA 2HE7A 4I6NB 3VTUA 4IM0A 3ZO5B 1V9JA 4GIVA 2JXXA 4HPLB 2DZJA 1FXTB 3L16A 2M1MA 2PE9A 4BFRA 5L83A 1UBIA 4ANUA 2DZKA 2ZZPB 3HK0A 4NJ7A 3Q3JA 4AUQC 3NY5A 2ZVOA 2BYEA 4GOCA 2LI5A 1OEYA 1WXAA 5GMVA 2C5LC 3AU5A 4W9JA 3M62B 2JPHA 5JHAA 1S3SG 3KUZA 2BKRB 2IY0B 5LXHA 2BYVE 2LVOA 4GDKB 4EZKA 2M17A 1WXVA 2XEWA 2N9XA 2LZ6A 1I42A 1ISNA 2MBBB 1IP9A 3H6NA 4EFOA 3A1QB 3SHQA 1E7VA 2FCMA 1HE8A 4DHZB 1V80A 2R2QA 3PLUA 3PSEB 4XX5A 3H7SA 2LXCA 5JZEB 4HCPB 1RLFA 4KVGB 2O2VB 3S2AA 1TBEA 1X1MA 2KK8A 2WDTB 1P98A 2G4DB 2KQ7A 2Y5BB 1VD2A 3ENEA 4K1RB 4KV2A 2IO1B 3V6CB 1H8CA 4IWOA 4MSMB 4TKNA 4WJQA 2KN5A 4ZRIA 4MH0E 2LGYA 2N9EB 3DBLI 4DK5A 3APDA 5EDSA 3R3MA 4KIKB 2KLGA 2KHWB 4DXAB 2FUHB 3DQVA 1TTNA 2LASA 4PYZA 3WAPA 2HJ8A 4PYUA 2PPHA 3T9LA 3UINB 5J18A 5CHWA 1WYWB 2RR9A 2KC1A 2FIDA 2IZVB 2W9NA 2KQSA 5AZHA 1GC6A 4IUMB 5CHVC 4MM3A 5IA7A 1UD7A 3VTWA 3BY4B 4AP4C 4NY0A 4HDOA 3RZWC 1R4MI 5CHFA 2DYMA 4E3CA 2V3SA 5E6OA 1WZ0A 3DBSA 2PE6B 3RCZA 4EEWA 2MLBA 2GOWA 1IPGA 2KMAA 1Q1OA 2DYBA 2KWVB 4I6LB 2JT4B 1GG3A 3L54A 2ZPYA 3ZDMC 2KTFA 3QX1A 3QARA 3A9JB 4JL9A 3JSVB 2FCQA 4W9HA 3BINA 2M4NA 1WX7A 4ICVA 4MGYE 5G55A 4X57B 2XK5B 4I6PA 3X23A 1BT0A 5BO4B 2FIFA 2LRUA 2BPSA 1T0YA 4BOSC 3O65B 4LCDE 3HIZA 3A9KA 2JUOA 3KUDB 4M8MA 5CTRC 3TIXA 2GBNA 3WA0A 2EMTA 5AZGA 3OLMD 1D3ZA 2O6VA 3W1SC 4A3PA 1H4RA 3VAWA 5E6NA 1L2NA 1WGGA 1OEYJ 1ZW7A 2JRHA 2CHWA 4G0NB 2ZVNA 1OQYA 2J0KA 4EZLA 3W1SA 2KC2A 3RZFA 2ZCBA 1P0RA 2KTRA 2NS5A 2KOXA 2G45B 3RYTA 1WGRA 1WY8A 2OJRA 2AWTA 2L3ZA 2LVPA 1UZXB 3V60A 2D3GA 2J0MA 5IAAC 2ZJDA 4GDLB 2D11A 3NHEB 3QQ8B 1KJTA 3IHPC 4KZ0A 3LDZE 1V86A 2KWUB 1WGHA 3A33B 4PS7A 3QA8A 4WAAA 2K25A 2KXJA 2ZCCA 2C60A 3DPDA 3ML9A 1YX5B 2LJ5A 2K39A 2IO3B 2J7QB 2N7DA 2KD0A 2L8JA 3N32A 3UQAA 1WX8A 4J6IA 4E71A 2KDIA 4DDID 4NNJB 2NPTA 3ZRCA 3WALA 3L0WB 1YD8U 3AI5A 2KMCA 3ZDTA 2L76A 1V49A 2BKFA 4BKTA 3NOBA 4JIOU 1E8XA 3IFWB 4HK2A 1EF1A 3H7PA 3CMMB 5JH5C 1E90A 1MG8A 3PRPB 2PJHA 4IC7B 1YQBA 4RMAA 1LM8B 4GB9A 4HLEA 2FNJB 5KHOA 3RULA 4A20A 3JYUA 2UWQA 4FULA 4DHJB 3IBEA 2WYQA 2JWZA 2K6QA 3APCA 4CO7A 2D2QA 1C1YB 4GGQA 3ZNID 2MW5A 3TMPB 2L00B 4N9F4 3K9OB 2ZPNA 1R4NI 4HPMB 4KSKC 4MSQB 3QC8B 4BKGA 2LWPA 4MGKE 3OJ3A 5JHBA 2JZZA 2MWSB 4F1SA 4HDQA 3DDCB 1TZ1A 3B0AA 2MP2B 4FJVB 3NZSA 3KW5B 4NAWA 3U30A 3VFKA 5C1ZA 1CMXB 3PT2B 3ZIMA 4G11A 1RFAA 1WX9A 2MBOA 3HHMA 2XBBC 4MELA 2K8BA 4YL8A 1V5TA 2D07B 2KX0A 2ZNVC 3U7DA 1WM3A 3VH4B 1KM7A 3DVNV 4F7ZA 2JF5A 2MA9B 3M95A 2IO0B 3PREA 4WWOA 4FA6A 3PRZA 2PEAA 3DOWA 4NJ6A 4B95A 4BBNF 1S1QB 2JVCA 1C3TA 4EKUA 1WJUA 3L13A 4W9FA 2M8SA 2RGFA 3KVFB 3ZNGC 4FJYA 2O2VA 4W9GA 4EUTA 4BKSD 3R7QA 1OGWA 3M3JA 2GMIC 2LVQA 2L0TA 4FN2A 3VDZA 5J17A 1I35A 3R7RA 2JY6A 5LXIB 2MBHA 1F9JA 2WX1A 4BVUC 2K8HA 2CHXA 4IW0A 5D2MB 2DZMA 1WR1A 3K9PB 4NAWB 4W9DA 2FCNA 1WXMA 3PHXB 2DAJA 1VCBA 4GU2A 3UF8A 2KANA 4B9KA 1V81A 1U4AA 1LQBA 1WM2A 4K7WA 1ZGUB 4LDTB 3N3KB 2L0FA 2CKHB 5DPWA 2O6VB 3MHSD 3QHTA 3QK0A 2DAFA 4PS3A 5CX3A 4NQLB 4W9LA 2KFKA 1UH6A 2VRRB 2WWZA 2KZRA 4K7SA 4BOZB 1GJZA 2IO2B 2CR5A 3DVGX 3VVWB 3TCAA 4GDKA 3VXWA 1WE7A 3C0RB 1WZ3A 4IM2A 3L10B 2KFJA 3ONSA 4LJPB 2LGDA 4AOFA 4MJSB 3QJZA 4W9EA 3ZTDA 4NQKE 4XC2A 3APFA 2MP2A 4K81A 4IG7B 1GC7A 4AJWA 2ZNVB 1J8CA 2KNBA 3JSVA 4IM3A 4A3OA 4FBJB 2N1VA 4KZCA 4LDTD 2AL6A 1WGDA 4KSLC 3MJWA 2OOBB 4FJZA 1Y8RC 4TQ1A 3IG3A 3DVNU 1EUVB 3LJ3A 3OAWA 2C7NB 3H1UA 2B3AA 4GSWA 4CYEA 1WMHA 1UELA 3HM6X 2GBRA 4DHJD 2A4ZA 3PS6A 5D94A 2NPTB 2UYZB 3AULA 2CHZA 2LRWA 1YX6B 3D32A 2QHOA 1J19A 3H9DA 5D6JB 5G2NA 4ANWA 3PLVA 3VUWA 2KKCA 3R66C 1WFYA 4BKSA 4RM8A 3IVFA 1P1AA 2I1KA 4G3XB 1AARA 3SU8X 3UGBB 4PS8A 3VTVA 2EMSA 2AL3A 4ANVA 4KIKA 4DHZE 1P9DU 3EC8A 2KJ6A 3DBHI 3VUXA 3NS8A 5D7GA 2KJHB 3M63B 2JRIB 2Z59B 3TL5A 2NCNA 4FADA 3MTNB 4GDLA 5AEKB 1JRUA 2BF8B 1LFDA 2KVRA 4KDIC 4GMVA 2LGXA 4IWPA 2YLMA 4WWNA 1L7YA 1SGHA 1YJ1A 2C7MB 2GBMA 3ZUNA 5DPTA 2HD5B 2DHZA 3KYDD 4F8CB 3WANA 2CS4A 3ZNHB 4OVVA 2M0XA 3ZRFA 3TJPA 1Q5WB 2KDBA 5C23A 1UGMA 1WMHB 3A9KB 3PV1A 1SIFA 2MBQA 3KH0A 4ZDVA 4WJOA 5TR5A 3ML8A 4DBGA 2IYDB 4EZJA 3WAOA 4DDGD 1WR6E 2IBIB 2KX3A 2N4FA 4ZRKA 3GOEA 1WXSA 3AXCA 2V1YA 3ZLZA 2YVCA 2HTHA 2V4LA 1Z5SB 1GUAB 4HWIB 3T8MA 3VHTC 1WJ6A 2CU1A 4JLCA 3PPAA 2FAZA 1UBQA 2FCSA 3HM3A 4OVUA 1WF9A 3EHVA 2MCNB 1PQSA 2XK5A 3QIJA 3AU4A 3CSFA 2C7HA 4FHKA 3V61A 4MJSA 1WGYA 4JQWC 3KUCB 3RT3B 1WJNA 2KDFB 3PRMB 3TBLD 4DWFA 2K8CA 4B6WA 2NBUA 3DVGY 4MDKE 4MGZE 4ZYNA 4ANXA 2IY1B 3DBRI 3PHWB 4NPNA 1WJ4A 3JVZX 1WI0A 4WQOB 5J2RA 2MX2A 2RPQA
chains in the Genus database with same CATH superfamily
2RD0A 3DCGA 2NMQA 2AYOB 1JROA 2IPKD 2DZIA 1IBXB 1MHXA 2O6VD 2BGFA 2DBYA 3ZVVA 4AJYB 3FKYA 4M8NA 2AQ1B 2KLCA 5L95C 4RGMA 2LEKA 3TSSA 5DCNA 3LXFA 3KWVA 3Q2AC 4GN1A 4IWQA 4CHKA 3Q3OC 2KWCA 2JWUA 3ZNZB 4LNFA 3CWIA 5EE3A 4XZ4A 4ZHOA 2J42A 1KRHA 3CIRB 3VH3B 2D10A 2FBWB 3SR6A 4BZAA 3R2IA 1WE6A 4II3B 2K6DB 5KHQA 1V1PA 1QOGA 3AE1B 2RPVA 1N61A 1NBFC 1E8YA 3H8HA 3P4SB 3UQBA 4FHJA 3SDLC 3AE5B 3UIOB 3URYA 2G3QB 2BWES 2KACA 3B08A 2Z0EB 3BIID 4YXDB 2AEHA 3NUHB 4W9KA 2IJ0A 2W54A 3P2BA 4GXBA 2DLBA 4MGIE 5H8YE 1XT9B 1KH0A 4UDUC 4XGAB 5DPRA 3EECA 4YTNB 1C4AA 2I2YA 3PO0A 4HPLB 1RWSA 5L83A 2PE9A 1UBIA 4ANUA 3HK0A 3BK2A 4NJ7A 3NY5A 2WQYB 2ZVOA 4M01A 5FKAC 4ARCA 4KKIA 2C5LC 2LHDA 1KFYB 3M62B 2JPHA 2V4IB 3KUZA 5LXHA 2LVOA 4GDKB 2MBBB 1IP9A 3Q8CA 3A1QB 4LNKA 1HE8A 2R2QA 4HCPB 1RLFA 2O2VB 5HKHA 1TBEA 2KK8A 1D5XC 1L6VA 1SE2A 4KV2A 2IO1B 4ZOHC 4WJQA 4DQOC 4XWTA 4ZRIA 2LGYA 4KIKB 4DXAB 1SIJA 3Q14C 3R2TA 1C4CA 1YJJA 2KC1A 2W9NA 2TSSA 5AZHA 4Q2JA 3RNGC 5HFYA 4AP4C 3TEZA 4OZBA 1R4MI 2L52A 4E3CA 1MG4A 3RCZA 3LB8C 2DYBA 3RPFC 4JL9A 5TSSA 4ICVA 2M4NA 1WX7A 4MGYE 4X57B 5BO4B 4P6VF 2FIFA 3V05A 3LYYA 1RFKA 3A9KA 3KUDB 5CTRC 1YQ3B 2GBNA 5AZGA 1D3ZA 3N9YC 4P16A 5E6NA 4MM3B 1OEYJ 1ZW7A 3W5UB 4C7ZA 2CHWA 4G0NB 2B76B 3W1SA 2KC2A 3RZFA 1P0RA 1CJEA 4A9AA 2L3ZA 1UZXB 2D3GA 2ZJDA 2D11A 2LGSA 3NHEB 1KJTA 3IHPC 4KZ0A 1JWMD 3QA8A 4HROA 2KXJA 2K39A 4IKGA 2N7DA 3N32A 1N60A 4NNJB 3ZRCA 1ZDXA 1YD8U 2KT7A 1V49A 4JIOU 4OZCA 1MG8A 2PJHA 1AWDA 1JMLA 1LM8B 4HLEA 5KHOA 3IAM1 3JYUA 2UWQA 4KGRA 3AH7A 3TEXA 1TYGB 3RFZB 5H92C 5D3DA 3K9OB 2JXTA 3R8BA 1TS3A 4BKGA 3QC8B 3OJ3A 5JHBA 2JZZA 4HDQA 1TZ1A 2J4XA 3B0AA 2MP2B 3NZSA 3KW5B 1D6EC 1CMXB 3PT2B 1NYRA 1RFAA 3MC9A 1WX9A 2JYEA 3VR9B 4YSYB 2BS2B 3PREA 4WWOA 3PRZA 1E7PB 2PEAA 3AE6B 4BBNF 3DHGC 1V1PB 1C76A 2M8SA 2WU5B 4BKSD 1CQVA 1XLPA 3M3JA 2GMIC 2LVQA 2D3CA 2WXHA 1I35A 2LGIA 4CQNA 2V3NA 3TUOA 1F9JA 2K8HA 4GLSC 4W9DA 2K22A 1VCBA 2KANA 1C9FA 3B2GA 2CKHB 2L0FA 4PS3A 1T0QC 2J52A 1FFUA 3N1XC 2H88B 1VZ8A 1K51A 1TKGA 3VVWB 4FXCA 4IM2A 2KFJA 3MC0B 1C4PA 3APFA 3IT4B 2MP2A 4K81A 4YTPB 1SSNA 1SJED 1J8CA 5LNK1 3Q3NC 2BQQA 4LDTD 4OHJA 1WGDA 3MJWA 4TQ1A 3IG3A 1EUVB 4M0WA 4XDCA 2B3AA 2KDMA 1E10A 1WMHA 3OG5A 2PKOA 4OW0A 1DYQA 1ZUD2 2Y5CA 5HI1A 1WFYA 3UGBB 2GLSA 3VR8B 4ANVA 4KIKA 3EC8A 4C4VB 2KJHB 5MPOA 3TL5A 3EFCA 1YOVB 4WAFA 2BF8B 2KVRA 2LGXA 2NTSA 4IWPA 1HA5A 4N58A 2YLMA 3ZXVA 1YJ1A 2C7MB 3ZUNA 3KWLA 2MJEA 5HG2A 4OVVA 3IT6B 5C23A 2KDBA 1L0YB 1FEHA 2WS3B 2W3RA 2J53A 2IGGA 5TR5A 4EZJA 1WR6E 4ZRKA 5IO9A 3GOEA 1WXSA 1Z5SB 3AE3B 1F1HA 4YSXB 1SBBB 1WJ6A 4JLCA 3ETRA 3IXSA 3ZKJC 2FCSA 4H2AA 2MJDA 1J7BA 3V61A 3HUIA 5BMGA 1WJNA 1XLQA 2INNE 4ANXA 1PGXA 1FO4A 2WDRB 3JVZX 2MX2A 1WI0A 2ZEQA 3EFUA 1P3QU 4K3BA 4WJNA 2R2OA 3DWMA 3WIMA 1EF5A 1I4RA 2WP9B 4ICUA 1QQRA 3RMKC 1SE3A 2BB5A 4G50A 4P7IA 4WWPA 2GBKA 3A4RA 3I3TB 2Z0DB 2KO3A 1GB4A 2NTTA 3I5JC 2QCZA 2WLBA 4LLGM 2NBWB 3PVLA 1AW7A 1TY0A 1QZEA 3V62A 3X0WA 3H7PB 1VZ6A 2I1JA 3GB1A 1V5OA 4J3OD 1GNUA 2L83A 4MEMA 3AEFB 5AZFA 5IN7A 3A4SC 4W9IA 3UIPB 2KVZA 4TUUA 3Q69A 4C7YA 2BB6A 1G6JA 3ZXRA 3TEWA 4RM9A 2J0JA 2BWFA 2DYOA 4XWWA 3Q3FA 4BBNC 4WJPA 1Q0WB 3RUIB 3P4QB 2N7EA 5G5GA 3AB5A 4P1CC 2JQRB 1VRAB 2KWDA 2NR2A 3FAHA 4HJKA 4W9CA 1TT5B 3RD2A 1UGJA 1K8RB 3VQIA 2LUEA 2JYTA 2K1FA 5BYQA 3ZYYX 1KTKA 5G5HA 2BYFA 1DOYA 2N0SB 2C9WB 2V9HA 3P42A 2IGHA 4IM0A 2LJIA 3ZO5B 1V9JA 2SEBD 1HZ5A 4IOIE 2M1MA 4BFRA 1CK1A 2K5PA 3Q3JA 4AUQC 2YEPB 2LI5A 4LNOA 1WXAA 5GMVA 1ZXIA 1J7AA 3AU5A 4W9JA 5JHAA 1S3SG 4ZRQA 2BKRB 1N62A 2XEWA 1ISNA 1AYFA 4EFOA 3AEEB 2FCMA 2Z8LA 3N20C 1D5ZC 3H7SA 3NVYA 1FNWA 2WDTB 2KQ7A 1F2RC 1C78A 1H8CA 2E3TA 1J7CA 2KN5A 4MH0E 3APDA 4DXGA 3R3MA 2KHWB 1TTNA 1JQ4A 3P4RB 2PPHA 3UINB 3U4EG 1WYWB 1VDVA 1I4PA 4IUMB 5IA7A 1FMAD 1CZPA 4NY0A 4HDOA 1GPXA 5CHFA 2DYMA 4NJCA 1HTQA 2FUG1 3B9JA 2MLBA 2GB1A 4BAXA 2JT4B 2ZPYA 3QX1A 1E9MA 3JSVB 1L4ZB 2FCQA 3BINA 4I6PA 1BT0A 3SEBA 2VH2A 3ABVB 1TZOA 2BPSA 1T0YA 4BOSC 3HIZA 2JUOA 4ZYSA 4C4VA 4YWGG 3WA0A 1FM0D 1EWCA 3IAS1 4A3PA 2LFIA 1WGGA 1ZPSA 2JRHA 1STEA 2K0PA 2ZVNA 4RF0A 2J0KA 4EZLA 2NS5A 2G45B 4YT0B 1WGRA 3AE9B 3NJTA 2OJRA 2GRIA 4GDLB 3LDZE 1V86A 1TS4A 1I4XA 2ZCCA 1YX5B 2LJ5A 3Q8EA 2IO3B 2J7QB 3B2FA 2L8JA 3UQAA 1WX8A 4E71A 2KDIA 1LO5D 3WALA 3L0WB 2L76A 2VH1A 4BKTA 3IFWB 1T3QA 3HVZA 1E90A 3PRPB 1L5PA 3Q8AA 4GB9A 1N5WA 4FULA 4US9A 2D3AA 2SAKA 4JWSC 1C1YB 2INPE 3TMPB 1FCLA 4HPMB 4MSQB 3C19A 2LWPA 4MT5A 4IDIA 1MHHE 2WDVB 4MH8A 3U30A 1A70A 4NAWA 4ACFA 5C1ZA 3ZIMA 2WXMA 1PUTA 1WYGA 3GS2A 3ZJUA 4YL8A 1F52A 2KX0A 4YSZB 2BS3B 3VH4B 1KM7A 2JF5A 2MA9B 3RN9C 3DOWA 4NJ6A 4KGTA 4B95A 2JVCA 5JXVA 4EKUA 3L13A 1P7EA 3ZNGC 2HDEA 3R7QA 1OGWA 4L1BA 3R7RA 5LXIB 3V3XA 2WX1A 1L0VB 1OQQA 5D2MB 4L2YA 3K9PB 3PHXB 2LMCA 3UF8A 1V81A 1U4AA 1L6UA 1LQBA 4K7WA 1ZGUB 3KLSX 4LDTB 3N3KB 1GAQB 3QHTA 4NQLB 4AQ7A 2VRRB 1ZOYB 4C00A 3TCAA 4GDKA 2WXNA 5IOIA 3VXWA 4ARIA 2LGDA 3ZTDA 1OQRA 4NQKE 4XC2A 4IG7B 1GC7A 2OHFA 1UUPA 3AE7B 3JSVA 2RDBC 2IDYA 2L32A 4OVZA 2AL6A 4KSLC 2OOBB 5D3IB 3OAWA 3LJ3A 1QOAA 3HM6X 1B9RA 5D94A 2UYZB 1FXIA 1FCCC 3AULA 4RNAA 2CHZA 3BK1A 3D32A 5D6JB 5G2NA 1YN4A 2I1KA 3SU8X 4PS8A 2WXGA 2EMSA 2WXJA 2BBCA 3VRAB 4DHZE 2KJ6A 2G1EA 2Z59B 2NCNA 4FADA 4GDLA 5AEKB 1V8CA 4WWNA 1SGHA 2GBMA 1HXYD 5DPTA 1JALA 2HD5B 2DHZA 3KYDD 4F8CB 2BW2A 3WANA 2CJNA 1PFDA 1Q5WB 1WMHB 2VZKD 3A9KB 2MBQA 2KAJA 1WXQA 4DBGA 2IYDB 2W82A 1NYQA 2KX3A 2YVCA 2HTHA 1GUAB 3VHTC 4HEA1 1VZ7A 2OEDA 4OVUA 1WF9A 2MCNB 3AU4A 2C7HA 2QDFA 2DWQA 2N9LA 1WGYA 4JQWC 2WXFA 5FK9C 4DWFA 2NBUA 4MGZE 2IY1B 4RH6A 1ET6A 2KDEB 1PYWD 3KYCD 2DX5B 2KJRA 2QIEB 3BVGA 1MJDA 4ZRPA 1FXAA 2KN4A 1ZKHA 3Q8FA 2MHJA 2N9KA 3AN1A 3ZTCA 1A5RA 5E6PA 3VUYA 2NBVB 3PZ8A 2M0AA 3U8ZA 1E8ZA 3B1LX 3NS1A 4II2B 2INDC 3SD5A 3ECIA 3GZNI 2WHIA 2MBEA 1T5XD 1LXDA 3WAMA 4A8XC 1QF6A 1R7SA 3QWZB 4LJOB 3ZJVA 3CSTA 2NVUI 2LUMA 2GI9A 1M94A 1TGZB 3N30A 5C3JB 1SB3C 4KDLB 3ZW3A 1WRDB 3P4PB 2GBJA 2E6XA 1UWMA 4AS1A 2KQ4X 2WNMA 1E0ZA 4HKQA 3NRZA 3GE8C 2RSUA 4URKA 3A1QA 2N9PC 2L7RA 4EOYA 3QCAA 2V0GA 1SXTA 4HJGE 1HQRD 1D5MC 2HJ1A 2W3SA 1E5WA 1J0GA 4HPPA 2Y3AA 4M0WB 1ET9A 1NI3A 1MPEA 1WIAA 1TY2A 2WX0A 3ALBA 1XD3B 3JW0X 1Z2MA 1KLVA 1RRBA 4ASWC 2BT6A 1NDDA 2N1WA 3W9CB 2JZ3B 2PVGC 4TV3A 3L17A 4E74A 5BMIA 2MRPA 2CJOA 2HE7A 4I6NB 3VTUA 2BTEA 2JXXA 2DZJA 3BWUD 4RFBA 4LK0M 3NVWA 1FNVA 1YN5A 1K50A 2PVOD 1HZ6A 4GOCA 1OEYA 3C8YA 1R4NB 2BYVE 2WXLA 1I42A 2EELA 4RGTA 2ACZB 3SHQA 1B1ZA 4DHZB 4XX5A 3PSEB 1ENFA 1R4MB 1X1MA 2G4DB 4K1RB 4TKNA 3AE2B 3DBLI 4QAYA 5EDSA 2FUHB 5T8IA 3W2DA 4PYZA 3WAPA 4PYUA 2INCC 2RR9A 2FIDA 2IZVB 1I4HA 2JSVX 4S0RA 1ROEA 1UD7A 3VTWA 3BY4B 4ITKA 2PMVA 1EWYC 4NZLB 4EEWA 1IPGA 4K3CA 1Q1OA 4TMAB 4M00A 1GG3A 4XE0A 4C80A 3QARA 1GB1A 1XEEA 4W9HA 2QMTA 3T3OA 3E9SA 3HVDA 1C77A 1SF0A 3TEYA 4LCDE 4KX6B 2K3UA 1KF6B 2EMTA 3OLMD 1SE4A 2O6VA 3RI7C 3W1SC 1H4RA 3VAWA 1JWBD 1F77A 1OQYA 2JU6X 2JZPA 2ZCBA 3P1MA 3RYTA 4A6QA 2AWTA 1QILA 2J0MA 4RGOS 3QQ8B 1WWTA 2RDHA 4PS7A 5EE9A 2K25A 2C60A 3DPDA 3ML9A 5FR3A 2ICIA 1YN3A 3AECB 1ZP0B 2PTLA 3DHIC 1JW9D 2NPTA 3BZDB 3ZDTA 3ZJTA 2BKFA 3RNCC 3NOBA 1UF0A 4HK2A 1EF1A 3H7PA 3CMMB 2MH7A 5JH5C 4KGSA 2XN9C 1YJIA 3RULA 4A20A 2BVCA 2N7JA 4DHJB 1ACCA 5BMHA 3IBEA 2WYQA 2JWZA 3APCA 4CO7A 4GGQA 3ZNID 2MW5A 3FILA 4N9F4 1SJHD 1R4NI 1Y56A 2M56B 2D3BA 4WH4A 4HKZE 2MWSB 4F1SA 1PDXA 2WDQB 3DDCB 4PK1A 4REZA 3AEDB 1OFFA 4MELA 4RF1A 2K8BA 3N1YC 1T6BX 1WM3A 2AQ3B 3DHHC 5C2TB 2X8XX 3DVNV 4F7ZA 2IO0B 1NENB 4FA6A 1WGKA 1S1QB 1WJUA 5GXGB 4W9FA 1WRIA 3NG0A 4A55A 2RGFA 3AE4B 3AEGB 3KVFB 3RNBC 4FJYA 2L1AA 3SFDB 4B0MA 4W9GA 1XCQL 2BYTA 2L0TA 1LGRA 3I57A 5J17A 3BYYB 2MBHA 3AEAB 4BVUC 3BVMA 2CHXA 4IW0A 4NAWB 1WR1A 4GU2A 1WXMA 2DAJA 1C79A 1ESFA 3RNFC 1WM2A 1BXTA 5DPWA 2DAFA 2XNAC 5CX3A 4W9LA 2KZRA 4BOZB 4D2KA 3RNAC 3ZGZA 3C0RB 3L10B 4LJPB 3BVZA 3AMZA 4AOFA 4MJSB 3QJZA 4W9EA 1DOIA 1L4DB 4L23A 4WURA 4PT5A 2KNBA 4FBJB 3EA6A 2N1VA 4FJZA 5IKCM 1Y8RC 4S17A 4CYEA 1UELA 4DHJD 2A4ZA 3PS6A 2M19A 1NEKB 2LRWA 2QHOA 3H9DA 3U2SC 1TIFA 2KKCA 3R66C 1N5XA 4RM8A 3IVFA 1P1AA 4C56C 2Y5PA 2AL3A 1P9DU 1UWXA 5D7GA 5EE1A 3U7ZA 2JRIB 3MTNB 1LFDA 3O13A 4XYCA 5AUKA 4R3DA 1HTOA 2H89B 2IGDA 4JE3B 2CS4A 1FD6A 2M0XA 1BUIC 1JWUD 4ZDVA 3PV1A 2PIAA 3ML8A 1IBXA 3WAOA 1ZDVA 2N4FA 4WQMA 1V1OA 2Q5WD 1XF5L 3AM9A 2V1YA 2OJWA 1FRRA 1EU3A 3I63C 2CU1A 3PPAA 3HM3A 1UBQA 3EHVA 1PQSA 3QIJA 3CSFA 3DBRB 4FHKA 3UI3A 4MJSA 3PRMB 3TBLD 2D5GA 1K53A 2K8CA 2WXOA 3PHWB 4WQOB 4M02A 5J2RA 3NZUA 2MSED 1SE9A 3MC8A 1E8WA 3ZQ4A 2AQ2B 4JWUC 1NVID 1M4VA 2G4SA 2DNFA 3J9CA 4TQ0A 1YNTE 4O1NA 1GOZA 1FPYA 2REXA 4A90A 2LXAA 1HEZE 1VR9A 2LD9A 1IYFA 2I38A 2A5UA 3P63A 1RAXA 1OTRB 3MFGA 3CF6E 1E7UA 3V6EB 1KOTA 2KYWA 1DOXA 2DENB 2EKEC 1YIWA 3L08A 2MEKA 1XLOA 2W55A 4N6EB 1NI2A 3OJ4B 1EO6A 3QAQA 1WH3A 2KTRB 4JGHB 4MACA 2MQJA 3PZDA 1YQ4B 4K7UA 3MJ5A 2YEPF 4USAA 3PGEA 1V2YA 1BMLC 4HCNB 4AWJA 4HVBA 4WWMA 4XDDA 4ZRJA 3PTFC 5DPSA 2PLPA 4WIPA 5FR6A 2X38A 1XQQA 1V6EA 5LLIA 3W1YA 4HXDA 2L05A 1N63A 1RM6C 3EUB2 1XXGA 4FLHA 1ZXHA 2KFKB 1L0XB 3E56A 3A9JA 2ASQA 4GIVA 3L4PA 1I4QA 1FXTB 3L16A 1TKYA 1XO3A 2ON8A 1K52A 2UU7A 2DZKA 2ZZPB 5IP4D 2BYEA 2MJ3A 2EKIA 1EM7A 2ONQA 2IY0B 4EZKA 1SEBD 2M17A 1WXVA 2N9XA 2LZ6A 3H6NA 1E7VA 3GE3C 1V80A 3PLUA 1E6EB 5JZEB 2LXCA 4KVGB 3S2AA 1QT9A 1P98A 2Y5BB 3T3NA 1VD2A 3ENEA 3V6CB 4IWOA 4MSMB 3SFEB 1KLUD 2N9EB 4DK5A 1D4BA 2KLGA 3DQVA 2ZW1A 2LASA 2HJ8A 3T9LA 3I9V1 3DBLB 5J18A 3GZNB 2BS4B 5CHWA 1QKZA 3U52E 1XLNA 1FFVA 2KQSA 1GC6A 5CHVC 4MM3A 3AE8B 3OWEB 1V97A 1Q10A 3RZWC 2V3SA 5E6OA 1I4GA 1WZ0A 1MVKA 3DBSA 2PE6B 2GOWA 2KMAA 2KWVB 4I6LB 4ZHPA 3L54A 2G9HD 3ZDMC 2KTFA 3A9JB 3Q3MC 1TJEA 5G55A 2XK5B 2K9XA 3X23A 4US8A 2LRUA 3Q6BA 2V3PA 3O65B 4M8MA 3TIXA 1T0SC 1L2NA 1JCKB 5EE0A 1JWSD 5E6JA 2KTRA 2KOXA 1WY8A 4TSSA 2LVPA 1I7HA 3NVVA 3V60A 5IAAC 2LHEA 2KWUB 1WGHA 3A33B 4WAAA 4JPSA 4HRSA 1XCTL 4N59A 2QC8A 2KD0A 4J6IA 5I4DA 4DDID 2R61A 1UNSA 3AI5A 2KMCA 1TS5A 2WXKA 1PGAA 3FILB 1MFWA 4YTMB 1E8XA 2WGSA 2QSDA 4DXFA 4RMAA 4IC7B 1YQBA 2FNJB 2QILA 2WU2B 2QJLA 4RGNA 3AV8A 1T0RC 1AN8A 2K6QA 1YMHE 2D2QA 4OZAA 2L00B 3GP7A 1WSPA 2ZPNA 4KSKC 1MI0A 4MGKE 3KQ4A 4FJVB 3VFKA 4G11A 3HHMA 2MBOA 3WCQA 2XBBC 1V5TA 2JX5A 2D07B 1KLGD 2ZNVC 3U7DA 1IGCA 3M95A 3HRDD 4LTUA 1ZE3D 1C3TA 1FNUA 3RNEC 2O2VA 4EUTA 2FE8A 4FN2A 3VDZA 5AUIA 2JY6A 5BYSA 1N6ZA 5BYRA 2DZMA 2FCNA 4B9KA 3N1ZC 1PGBA 3DWGC 2O6VB 3MHSD 3QK0A 2KFKA 3FC4A 1UH6A 2WXPA 2WWZA 4K7SA 1GJZA 2IO2B 2CR5A 2RDGA 3DVGX 2AX5A 1IGDA 1WE7A 1DGJA 3MP9A 1WZ3A 2KMMA 3ONSA 1TKEA 4AJWA 3MHZA 1F2RI 1FIQA 1VJKA 2ZNVB 4A3OA 4IM3A 4KZCA 1QOFA 1TS2A 2WXIA 3DVNU 2C7NB 3H1UA 4GSWA 2GBRA 2NPTB 1YX6B 1J19A 4ANWA 1IUEA 3PLVA 3DBHB 3VUWA 4LNIA 4BKSA 4G3XB 1AARA 3VTVA 1P7FA 2WXQA 2QEJC 3DBHI 3VUXA 3NS8A 2RMMA 3M63B 2PW9A 1JRUA 4KDIC 4GMVA 1EU4A 1FRDA 1VLBA 1L7YA 3NVZA 2VZKB 4RCOA 3Q8BA 3W5VB 3ZNHB 2HTME 3BYTB 1JWAD 3ZRFA 3TJPA 1QOBA 1UGMA 1SIFA 3KH0A 4WJOA 1QLBB 5HHDG 4B0EA 4DDGD 2IBIB 1RYJA 3AXCA 3ZLZA 3VRBB 2V4LA 4JX1C 4P1BC 4HWIB 3T8MA 2ZW0A 3EGRA 3PZ7A 2FAZA 2XK5A 3AEBB 2WXRA 4NAMA 4EE2A 3KUCB 3RT3B 2KDFB 4LNNA 1JRPA 4B6WA 3DVGY 4MDKE 4ZYNA 1F0ZA 3DBRI 4NPNA 1WJ4A 2CU3A 4KKJA 3NZ3A 2RPQA
chains in the Genus database with same CATH topology
3NZUA 2MSED 2ZEQA 3EFUA 1P3QU 1SE9A 2KDEB 1E8WA 2RD0A 4WJNA 3KYCD 2R2OA 3DCGA 2DX5B 3WIMA 2KJRA 1EF5A 4ICUA 2G4SA 2AYOB 1ZKHA 4G50A 4P7IA 4WWPA 4TQ0A 2GBKA 2DZIA 3A4RA 3I3TB 3ZTCA 1A5RA 2O6VD 2KO3A 2Z0DB 5E6PA 3VUYA 2NBVB 2BGFA 3ZVVA 2NBWB 3PVLA 4AJYB 2REXA 4M8NA 3U8ZA 1E8ZA 1QZEA 2KLCA 2LXAA 3V62A 5L95C 2LD9A 3X0WA 3H7PB 3B1LX 2I1JA 1IYFA 2A5UA 5DCNA 1V5OA 1RAXA 4II2B 4GN1A 3SD5A 1OTRB 3ECIA 4IWQA 3GZNI 4CHKA 3CF6E 2KWCA 1GNUA 2MBEA 4MEMA 1E7UA 3V6EB 3ZNZB 1KOTA 3ZKJC 1LXDA 5AZFA 3WAMA 3A4SC 4W9IA 2DENB 2EKEC 3QWZB 3UIPB 4TUUA 4LJOB 1YIWA 3L08A 3CSTA 2NVUI 4XZ4A 1G6JA 1M94A 1TGZB 2J0JA 3N30A 2BWFA 4RM9A 3VH3B 1NI2A 4KDLB 3ZW3A 2D10A 1WRDB 2DYOA 3OJ4B 2GBJA 3Q3FA 4BBNC 1EO6A 3QAQA 1WH3A 1Q0WB 2KTRB 4JGHB 4WJPA 3RUIB 2MQJA 1WE6A 2K6DB 2N7EA 2RSUA 3PZDA 4II3B 4K7UA 5KHQA 4URKA 3A1QA 2N9PC 2L7RA 1NBFC 4EOYA 2NR2A 3QCAA 3PGEA 1E8YA 3UQBA 1V2YA 4HJKA 4FHJA 3SDLC 4W9CA 3UIOB 4HCNB 4AWJA 2G3QB 3RD2A 1E5WA 2BWES 4HVBA 1J0GA 3B08A 2Z0EB 1K8RB 2AEHA 3VQIA 4M0WB 4W9KA 4ZRJA 2LUEA 1WIAA 3PTFC 2WX0A 3ALBA 1XD3B 3JW0X 5DPSA 2K1FA 1Z2MA 1KLVA 1RRBA 3P2BA 4GXBA 5FR6A 4ASWC 4MGIE 1NDDA 1XQQA 1V6EA 5LLIA 2N1WA 1XT9B 3W1YA 4HXDA 2L05A 2JZ3B 5DPRA 2BYFA 4TV3A 4FLHA 3L17A 2C9WB 2KFKB 4E74A 3EECA 2MRPA 3A9JA 5HKHA 2ASQA 2HE7A 4I6NB 3VTUA 4IM0A 3ZO5B 1V9JA 4GIVA 2JXXA 4HPLB 2DZJA 1FXTB 3L16A 2M1MA 2PE9A 4BFRA 5L83A 1UBIA 4ANUA 2DZKA 2ZZPB 3HK0A 4NJ7A 3Q3JA 4AUQC 3NY5A 2ZVOA 2BYEA 4GOCA 2LI5A 1OEYA 1WXAA 5GMVA 2C5LC 3AU5A 4W9JA 3M62B 2JPHA 5JHAA 1S3SG 3KUZA 2BKRB 2IY0B 5LXHA 2BYVE 2LVOA 4GDKB 4EZKA 2M17A 1WXVA 2XEWA 2N9XA 2LZ6A 1I42A 1ISNA 2MBBB 1IP9A 3H6NA 4EFOA 3A1QB 3SHQA 1E7VA 2FCMA 1HE8A 4DHZB 1V80A 2R2QA 3PLUA 3PSEB 4XX5A 3H7SA 2LXCA 5JZEB 4HCPB 1RLFA 4KVGB 2O2VB 3S2AA 1TBEA 1X1MA 2KK8A 2WDTB 1P98A 2G4DB 2KQ7A 2Y5BB 1VD2A 3ENEA 4K1RB 4KV2A 2IO1B 3V6CB 1H8CA 4IWOA 4MSMB 4TKNA 4WJQA 2KN5A 4ZRIA 4MH0E 2LGYA 2N9EB 3DBLI 4DK5A 3APDA 5EDSA 3R3MA 4KIKB 2KLGA 2KHWB 4DXAB 2FUHB 3DQVA 1TTNA 2LASA 4PYZA 3WAPA 2HJ8A 4PYUA 2PPHA 3T9LA 3UINB 5J18A 5CHWA 1WYWB 2RR9A 2KC1A 2FIDA 2IZVB 2W9NA 2KQSA 5AZHA 1GC6A 4IUMB 5CHVC 4MM3A 5IA7A 1UD7A 3VTWA 3BY4B 4AP4C 4NY0A 4HDOA 3RZWC 1R4MI 5CHFA 2DYMA 4E3CA 2V3SA 5E6OA 1WZ0A 3DBSA 2PE6B 3RCZA 4EEWA 2MLBA 2GOWA 1IPGA 2KMAA 1Q1OA 2DYBA 2KWVB 4I6LB 2JT4B 1GG3A 3L54A 2ZPYA 3ZDMC 2KTFA 3QX1A 3QARA 3A9JB 4JL9A 3JSVB 2FCQA 4W9HA 3BINA 2M4NA 1WX7A 4ICVA 4MGYE 5G55A 4X57B 2XK5B 4I6PA 3X23A 1BT0A 5BO4B 2FIFA 2LRUA 2BPSA 1T0YA 4BOSC 3O65B 4LCDE 3HIZA 3A9KA 2JUOA 3KUDB 4M8MA 5CTRC 3TIXA 2GBNA 3WA0A 2EMTA 5AZGA 3OLMD 1D3ZA 2O6VA 3W1SC 4A3PA 1H4RA 3VAWA 5E6NA 1L2NA 1WGGA 1OEYJ 1ZW7A 2JRHA 2CHWA 4G0NB 2ZVNA 1OQYA 2J0KA 4EZLA 3W1SA 2KC2A 3RZFA 2ZCBA 1P0RA 2KTRA 2NS5A 2KOXA 2G45B 3RYTA 1WGRA 1WY8A 2OJRA 2AWTA 2L3ZA 2LVPA 1UZXB 3V60A 2D3GA 2J0MA 5IAAC 2ZJDA 4GDLB 2D11A 3NHEB 3QQ8B 1KJTA 3IHPC 4KZ0A 3LDZE 1V86A 2KWUB 1WGHA 3A33B 4PS7A 3QA8A 4WAAA 2K25A 2KXJA 2ZCCA 2C60A 3DPDA 3ML9A 1YX5B 2LJ5A 2K39A 2IO3B 2J7QB 2N7DA 2KD0A 2L8JA 3N32A 3UQAA 1WX8A 4J6IA 4E71A 2KDIA 4DDID 4NNJB 2NPTA 3ZRCA 3WALA 3L0WB 1YD8U 3AI5A 2KMCA 3ZDTA 2L76A 1V49A 2BKFA 4BKTA 3NOBA 4JIOU 1E8XA 3IFWB 4HK2A 1EF1A 3H7PA 3CMMB 5JH5C 1E90A 1MG8A 3PRPB 2PJHA 4IC7B 1YQBA 4RMAA 1LM8B 4GB9A 4HLEA 2FNJB 5KHOA 3RULA 4A20A 3JYUA 2UWQA 4FULA 4DHJB 3IBEA 2WYQA 2JWZA 2K6QA 3APCA 4CO7A 2D2QA 1C1YB 4GGQA 3ZNID 2MW5A 3TMPB 2L00B 4N9F4 3K9OB 2ZPNA 1R4NI 4HPMB 4KSKC 4MSQB 3QC8B 4BKGA 2LWPA 4MGKE 3OJ3A 5JHBA 2JZZA 2MWSB 4F1SA 4HDQA 3DDCB 1TZ1A 3B0AA 2MP2B 4FJVB 3NZSA 3KW5B 4NAWA 3U30A 3VFKA 5C1ZA 1CMXB 3PT2B 3ZIMA 4G11A 1RFAA 1WX9A 2MBOA 3HHMA 2XBBC 4MELA 2K8BA 4YL8A 1V5TA 2D07B 2KX0A 2ZNVC 3U7DA 1WM3A 3VH4B 1KM7A 3DVNV 4F7ZA 2JF5A 2MA9B 3M95A 2IO0B 3PREA 4WWOA 4FA6A 3PRZA 2PEAA 3DOWA 4NJ6A 4B95A 4BBNF 1S1QB 2JVCA 1C3TA 4EKUA 1WJUA 3L13A 4W9FA 2M8SA 2RGFA 3KVFB 3ZNGC 4FJYA 2O2VA 4W9GA 4EUTA 4BKSD 3R7QA 1OGWA 3M3JA 2GMIC 2LVQA 2L0TA 4FN2A 3VDZA 5J17A 1I35A 3R7RA 2JY6A 5LXIB 2MBHA 1F9JA 2WX1A 4BVUC 2K8HA 2CHXA 4IW0A 5D2MB 2DZMA 1WR1A 3K9PB 4NAWB 4W9DA 2FCNA 1WXMA 3PHXB 2DAJA 1VCBA 4GU2A 3UF8A 2KANA 4B9KA 1V81A 1U4AA 1LQBA 1WM2A 4K7WA 1ZGUB 4LDTB 3N3KB 2L0FA 2CKHB 5DPWA 2O6VB 3MHSD 3QHTA 3QK0A 2DAFA 4PS3A 5CX3A 4NQLB 4W9LA 2KFKA 1UH6A 2VRRB 2WWZA 2KZRA 4K7SA 4BOZB 1GJZA 2IO2B 2CR5A 3DVGX 3VVWB 3TCAA 4GDKA 3VXWA 1WE7A 3C0RB 1WZ3A 4IM2A 3L10B 2KFJA 3ONSA 4LJPB 2LGDA 4AOFA 4MJSB 3QJZA 4W9EA 3ZTDA 4NQKE 4XC2A 3APFA 2MP2A 4K81A 4IG7B 1GC7A 4AJWA 2ZNVB 1J8CA 2KNBA 3JSVA 4IM3A 4A3OA 4FBJB 2N1VA 4KZCA 4LDTD 2AL6A 1WGDA 4KSLC 3MJWA 2OOBB 4FJZA 1Y8RC 4TQ1A 3IG3A 3DVNU 1EUVB 3LJ3A 3OAWA 2C7NB 3H1UA 2B3AA 4GSWA 4CYEA 1WMHA 1UELA 3HM6X 2GBRA 4DHJD 2A4ZA 3PS6A 5D94A 2NPTB 2UYZB 3AULA 2CHZA 2LRWA 1YX6B 3D32A 2QHOA 1J19A 3H9DA 5D6JB 5G2NA 4ANWA 3PLVA 3VUWA 2KKCA 3R66C 1WFYA 4BKSA 4RM8A 3IVFA 1P1AA 2I1KA 4G3XB 1AARA 3SU8X 3UGBB 4PS8A 3VTVA 2EMSA 2AL3A 4ANVA 4KIKA 4DHZE 1P9DU 3EC8A 2KJ6A 3DBHI 3VUXA 3NS8A 5D7GA 2KJHB 3M63B 2JRIB 2Z59B 3TL5A 2NCNA 4FADA 3MTNB 4GDLA 5AEKB 1JRUA 2BF8B 1LFDA 2KVRA 4KDIC 4GMVA 2LGXA 4IWPA 2YLMA 4WWNA 1L7YA 1SGHA 1YJ1A 2C7MB 2GBMA 3ZUNA 5DPTA 2HD5B 2DHZA 3KYDD 4F8CB 3WANA 2CS4A 3ZNHB 4OVVA 2M0XA 3ZRFA 3TJPA 1Q5WB 2KDBA 5C23A 1UGMA 1WMHB 3A9KB 3PV1A 1SIFA 2MBQA 3KH0A 4ZDVA 4WJOA 5TR5A 3ML8A 4DBGA 2IYDB 4EZJA 3WAOA 4DDGD 1WR6E 2IBIB 2KX3A 2N4FA 4ZRKA 3GOEA 1WXSA 3AXCA 2V1YA 3ZLZA 2YVCA 2HTHA 2V4LA 1Z5SB 1GUAB 4HWIB 3T8MA 3VHTC 1WJ6A 2CU1A 4JLCA 3PPAA 2FAZA 1UBQA 2FCSA 3HM3A 4OVUA 1WF9A 3EHVA 2MCNB 1PQSA 2XK5A 3QIJA 3AU4A 3CSFA 2C7HA 4FHKA 3V61A 4MJSA 1WGYA 4JQWC 3KUCB 3RT3B 1WJNA 2KDFB 3PRMB 3TBLD 4DWFA 2K8CA 4B6WA 2NBUA 3DVGY 4MDKE 4MGZE 4ZYNA 4ANXA 2IY1B 3DBRI 3PHWB 4NPNA 1WJ4A 3JVZX 1WI0A 4WQOB 5J2RA 2MX2A 2RPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NZU A;  2MSE D;  2ZEQ A;  3EFU A;  1P3Q U;  1SE9 A;  2KDE B;  1E8W A;  2RD0 A;  4WJN A;  3KYC D;  2R2O A;  3DCG A;  2DX5 B;  3WIM A;  2KJR A;  1EF5 A;  4ICU A;  2G4S A;  2AYO B;  1ZKH A;  4G50 A;  4P7I A;  4WWP A;  4TQ0 A;  2GBK A;  2DZI A;  3A4R A;  3I3T B;  3ZTC A;  1A5R A;  2O6V D;  2KO3 A;  2Z0D B;  5E6P A;  3VUY A;  2NBV B;  2BGF A;  3ZVV A;  2NBW B;  3PVL A;  4AJY B;  2REX A;  4M8N A;  3U8Z A;  1E8Z A;  1QZE A;  2KLC A;  2LXA A;  3V62 A;  5L95 C;  2LD9 A;  3X0W A;  3H7P B;  3B1L X;  2I1J A;  1IYF A;  2A5U A;  5DCN A;  1V5O A;  1RAX A;  4II2 B;  4GN1 A;  3SD5 A;  1OTR B;  3ECI A;  4IWQ A;  3GZN I;  4CHK A;  3CF6 E;  2KWC A;  1GNU A;  2MBE A;  4MEM A;  1E7U A;  3V6E B;  3ZNZ B;  1KOT A;  3ZKJ C;  1LXD A;  5AZF A;  3WAM A;  3A4S C;  4W9I A;  2DEN B;  2EKE C;  3QWZ B;  3UIP B;  4TUU A;  4LJO B;  1YIW A;  3L08 A;  3CST A;  2NVU I;  4XZ4 A;  1G6J A;  1M94 A;  1TGZ B;  2J0J A;  3N30 A;  2BWF A;  4RM9 A;  3VH3 B;  1NI2 A;  4KDL B;  3ZW3 A;  2D10 A;  1WRD B;  2DYO A;  3OJ4 B;  2GBJ A;  3Q3F A;  4BBN C;  1EO6 A;  3QAQ A;  1WH3 A;  1Q0W B;  2KTR B;  4JGH B;  4WJP A;  3RUI B;  2MQJ A;  1WE6 A;  2K6D B;  2N7E A;  2RSU A;  3PZD A;  4II3 B;  4K7U A;  5KHQ A;  4URK A;  3A1Q A;  2N9P C;  2L7R A;  1NBF C;  4EOY A;  2NR2 A;  3QCA A;  3PGE A;  1E8Y A;  3UQB A;  1V2Y A;  4HJK A;  4FHJ A;  3SDL C;  4W9C A;  3UIO B;  4HCN B;  4AWJ A;  2G3Q B;  3RD2 A;  1E5W A;  2BWE S;  4HVB A;  1J0G A;  3B08 A;  2Z0E B;  1K8R B;  2AEH A;  3VQI A;  4M0W B;  4W9K A;  4ZRJ A;  2LUE A;  1WIA A;  3PTF C;  2WX0 A;  3ALB A;  1XD3 B;  3JW0 X;  5DPS A;  2K1F A;  1Z2M A;  1KLV A;  1RRB A;  3P2B A;  4GXB A;  5FR6 A;  4ASW C;  4MGI E;  1NDD A;  1XQQ A;  1V6E A;  5LLI A;  2N1W A;  1XT9 B;  3W1Y A;  4HXD A;  2L05 A;  2JZ3 B;  5DPR A;  2BYF A;  4TV3 A;  4FLH A;  3L17 A;  2C9W B;  2KFK B;  4E74 A;  3EEC A;  2MRP A;  3A9J A;  5HKH A;  2ASQ A;  2HE7 A;  4I6N B;  3VTU A;  4IM0 A;  3ZO5 B;  1V9J A;  4GIV A;  2JXX A;  4HPL B;  2DZJ A;  1FXT B;  3L16 A;  2M1M A;  2PE9 A;  4BFR A;  5L83 A;  1UBI A;  4ANU A;  2DZK A;  2ZZP B;  3HK0 A;  4NJ7 A;  3Q3J A;  4AUQ C;  3NY5 A;  2ZVO A;  2BYE A;  4GOC A;  2LI5 A;  1OEY A;  1WXA A;  5GMV A;  2C5L C;  3AU5 A;  4W9J A;  3M62 B;  2JPH A;  5JHA A;  1S3S G;  3KUZ A;  2BKR B;  2IY0 B;  5LXH A;  2BYV E;  2LVO A;  4GDK B;  4EZK A;  2M17 A;  1WXV A;  2XEW A;  2N9X A;  2LZ6 A;  1I42 A;  1ISN A;  2MBB B;  1IP9 A;  3H6N A;  4EFO A;  3A1Q B;  3SHQ A;  1E7V A;  2FCM A;  1HE8 A;  4DHZ B;  1V80 A;  2R2Q A;  3PLU A;  3PSE B;  4XX5 A;  3H7S A;  2LXC A;  5JZE B;  4HCP B;  1RLF A;  4KVG B;  2O2V B;  3S2A A;  1TBE A;  1X1M A;  2KK8 A;  2WDT B;  1P98 A;  2G4D B;  2KQ7 A;  2Y5B B;  1VD2 A;  3ENE A;  4K1R B;  4KV2 A;  2IO1 B;  3V6C B;  1H8C A;  4IWO A;  4MSM B;  4TKN A;  4WJQ A;  2KN5 A;  4ZRI A;  4MH0 E;  2LGY A;  2N9E B;  3DBL I;  4DK5 A;  3APD A;  5EDS A;  3R3M A;  4KIK B;  2KLG A;  2KHW B;  4DXA B;  2FUH B;  3DQV A;  1TTN A;  2LAS A;  4PYZ A;  3WAP A;  2HJ8 A;  4PYU A;  2PPH A;  3T9L A;  3UIN B;  5J18 A;  5CHW A;  1WYW B;  2RR9 A;  2KC1 A;  2FID A;  2IZV B;  2W9N A;  2KQS A;  5AZH A;  1GC6 A;  4IUM B;  5CHV C;  4MM3 A;  5IA7 A;  1UD7 A;  3VTW A;  3BY4 B;  4AP4 C;  4NY0 A;  4HDO A;  3RZW C;  1R4M I;  5CHF A;  2DYM A;  4E3C A;  2V3S A;  5E6O A;  1WZ0 A;  3DBS A;  2PE6 B;  3RCZ A;  4EEW A;  2MLB A;  2GOW A;  1IPG A;  2KMA A;  1Q1O A;  2DYB A;  2KWV B;  4I6L B;  2JT4 B;  1GG3 A;  3L54 A;  2ZPY A;  3ZDM C;  2KTF A;  3QX1 A;  3QAR A;  3A9J B;  4JL9 A;  3JSV B;  2FCQ A;  4W9H A;  3BIN A;  2M4N A;  1WX7 A;  4ICV A;  4MGY E;  5G55 A;  4X57 B;  2XK5 B;  4I6P A;  3X23 A;  1BT0 A;  5BO4 B;  2FIF A;  2LRU A;  2BPS A;  1T0Y A;  4BOS C;  3O65 B;  4LCD E;  3HIZ A;  3A9K A;  2JUO A;  3KUD B;  4M8M A;  5CTR C;  3TIX A;  2GBN A;  3WA0 A;  2EMT A;  5AZG A;  3OLM D;  1D3Z A;  2O6V A;  3W1S C;  4A3P A;  1H4R A;  3VAW A;  5E6N A;  1L2N A;  1WGG A;  1OEY J;  1ZW7 A;  2JRH A;  2CHW A;  4G0N B;  2ZVN A;  1OQY A;  2J0K A;  4EZL A;  3W1S A;  2KC2 A;  3RZF A;  2ZCB A;  1P0R A;  2KTR A;  2NS5 A;  2KOX A;  2G45 B;  3RYT A;  1WGR A;  1WY8 A;  2OJR A;  2AWT A;  2L3Z A;  2LVP A;  1UZX B;  3V60 A;  2D3G A;  2J0M A;  5IAA C;  2ZJD A;  4GDL B;  2D11 A;  3NHE B;  3QQ8 B;  1KJT A;  3IHP C;  4KZ0 A;  3LDZ E;  1V86 A;  2KWU B;  1WGH A;  3A33 B;  4PS7 A;  3QA8 A;  4WAA A;  2K25 A;  2KXJ A;  2ZCC A;  2C60 A;  3DPD A;  3ML9 A;  1YX5 B;  2LJ5 A;  2K39 A;  2IO3 B;  2J7Q B;  2N7D A;  2KD0 A;  2L8J A;  3N32 A;  3UQA A;  1WX8 A;  4J6I A;  4E71 A;  2KDI A;  4DDI D;  4NNJ B;  2NPT A;  3ZRC A;  3WAL A;  3L0W B;  1YD8 U;  3AI5 A;  2KMC A;  3ZDT A;  2L76 A;  1V49 A;  2BKF A;  4BKT A;  3NOB A;  4JIO U;  1E8X A;  3IFW B;  4HK2 A;  1EF1 A;  3H7P A;  3CMM B;  5JH5 C;  1E90 A;  1MG8 A;  3PRP B;  2PJH A;  4IC7 B;  1YQB A;  4RMA A;  1LM8 B;  4GB9 A;  4HLE A;  2FNJ B;  5KHO A;  3RUL A;  4A20 A;  3JYU A;  2UWQ A;  4FUL A;  4DHJ B;  3IBE A;  2WYQ A;  2JWZ A;  2K6Q A;  3APC A;  4CO7 A;  2D2Q A;  1C1Y B;  4GGQ A;  3ZNI D;  2MW5 A;  3TMP B;  2L00 B;  4N9F 4;  3K9O B;  2ZPN A;  1R4N I;  4HPM B;  4KSK C;  4MSQ B;  3QC8 B;  4BKG A;  2LWP A;  4MGK E;  3OJ3 A;  5JHB A;  2JZZ A;  2MWS B;  4F1S A;  4HDQ A;  3DDC B;  1TZ1 A;  3B0A A;  2MP2 B;  4FJV B;  3NZS A;  3KW5 B;  4NAW A;  3U30 A;  3VFK A;  5C1Z A;  1CMX B;  3PT2 B;  3ZIM A;  4G11 A;  1RFA A;  1WX9 A;  2MBO A;  3HHM A;  2XBB C;  4MEL A;  2K8B A;  4YL8 A;  1V5T A;  2D07 B;  2KX0 A;  2ZNV C;  3U7D A;  1WM3 A;  3VH4 B;  1KM7 A;  3DVN V;  4F7Z A;  2JF5 A;  2MA9 B;  3M95 A;  2IO0 B;  3PRE A;  4WWO A;  4FA6 A;  3PRZ A;  2PEA A;  3DOW A;  4NJ6 A;  4B95 A;  4BBN F;  1S1Q B;  2JVC A;  1C3T A;  4EKU A;  1WJU A;  3L13 A;  4W9F A;  2M8S A;  2RGF A;  3KVF B;  3ZNG C;  4FJY A;  2O2V A;  4W9G A;  4EUT A;  4BKS D;  3R7Q A;  1OGW A;  3M3J A;  2GMI C;  2LVQ A;  2L0T A;  4FN2 A;  3VDZ A;  5J17 A;  1I35 A;  3R7R A;  2JY6 A;  5LXI B;  2MBH A;  1F9J A;  2WX1 A;  4BVU C;  2K8H A;  2CHX A;  4IW0 A;  5D2M B;  2DZM A;  1WR1 A;  3K9P B;  4NAW B;  4W9D A;  2FCN A;  1WXM A;  3PHX B;  2DAJ A;  1VCB A;  4GU2 A;  3UF8 A;  2KAN A;  4B9K A;  1V81 A;  1U4A A;  1LQB A;  1WM2 A;  4K7W A;  1ZGU B;  4LDT B;  3N3K B;  2L0F A;  2CKH B;  5DPW A;  2O6V B;  3MHS D;  3QHT A;  3QK0 A;  2DAF A;  4PS3 A;  5CX3 A;  4NQL B;  4W9L A;  2KFK A;  1UH6 A;  2VRR B;  2WWZ A;  2KZR A;  4K7S A;  4BOZ B;  1GJZ A;  2IO2 B;  2CR5 A;  3DVG X;  3VVW B;  3TCA A;  4GDK A;  3VXW A;  1WE7 A;  3C0R B;  1WZ3 A;  4IM2 A;  3L10 B;  2KFJ A;  3ONS A;  4LJP B;  2LGD A;  4AOF A;  4MJS B;  3QJZ A;  4W9E A;  3ZTD A;  4NQK E;  4XC2 A;  3APF A;  2MP2 A;  4K81 A;  4IG7 B;  1GC7 A;  4AJW A;  2ZNV B;  1J8C A;  2KNB A;  3JSV A;  4IM3 A;  4A3O A;  4FBJ B;  2N1V A;  4KZC A;  4LDT D;  2AL6 A;  1WGD A;  4KSL C;  3MJW A;  2OOB B;  4FJZ A;  1Y8R C;  4TQ1 A;  3IG3 A;  3DVN U;  1EUV B;  3LJ3 A;  3OAW A;  2C7N B;  3H1U A;  2B3A A;  4GSW A;  4CYE A;  1WMH A;  1UEL A;  3HM6 X;  2GBR A;  4DHJ D;  2A4Z A;  3PS6 A;  5D94 A;  2NPT B;  2UYZ B;  3AUL A;  2CHZ A;  2LRW A;  1YX6 B;  3D32 A;  2QHO A;  1J19 A;  3H9D A;  5D6J B;  5G2N A;  4ANW A;  3PLV A;  3VUW A;  2KKC A;  3R66 C;  1WFY A;  4BKS A;  4RM8 A;  3IVF A;  1P1A A;  2I1K A;  4G3X B;  1AAR A;  3SU8 X;  3UGB B;  4PS8 A;  3VTV A;  2EMS A;  2AL3 A;  4ANV A;  4KIK A;  4DHZ E;  1P9D U;  3EC8 A;  2KJ6 A;  3DBH I;  3VUX A;  3NS8 A;  5D7G A;  2KJH B;  3M63 B;  2JRI B;  2Z59 B;  3TL5 A;  2NCN A;  4FAD A;  3MTN B;  4GDL A;  5AEK B;  1JRU A;  2BF8 B;  1LFD A;  2KVR A;  4KDI C;  4GMV A;  2LGX A;  4IWP A;  2YLM A;  4WWN A;  1L7Y A;  1SGH A;  1YJ1 A;  2C7M B;  2GBM A;  3ZUN A;  5DPT A;  2HD5 B;  2DHZ A;  3KYD D;  4F8C B;  3WAN A;  2CS4 A;  3ZNH B;  4OVV A;  2M0X A;  3ZRF A;  3TJP A;  1Q5W B;  2KDB A;  5C23 A;  1UGM A;  1WMH B;  3A9K B;  3PV1 A;  1SIF A;  2MBQ A;  3KH0 A;  4ZDV A;  4WJO A;  5TR5 A;  3ML8 A;  4DBG A;  2IYD B;  4EZJ A;  3WAO A;  4DDG D;  1WR6 E;  2IBI B;  2KX3 A;  2N4F A;  4ZRK A;  3GOE A;  1WXS A;  3AXC A;  2V1Y A;  3ZLZ A;  2YVC A;  2HTH A;  2V4L A;  1Z5S B;  1GUA B;  4HWI B;  3T8M A;  3VHT C;  1WJ6 A;  2CU1 A;  4JLC A;  3PPA A;  2FAZ A;  1UBQ A;  2FCS A;  3HM3 A;  4OVU A;  1WF9 A;  3EHV A;  2MCN B;  1PQS A;  2XK5 A;  3QIJ A;  3AU4 A;  3CSF A;  2C7H A;  4FHK A;  3V61 A;  4MJS A;  1WGY A;  4JQW C;  3KUC B;  3RT3 B;  1WJN A;  2KDF B;  3PRM B;  3TBL D;  4DWF A;  2K8C A;  4B6W A;  2NBU A;  3DVG Y;  4MDK E;  4MGZ E;  4ZYN A;  4ANX A;  2IY1 B;  3DBR I;  3PHW B;  4NPN A;  1WJ4 A;  3JVZ X;  1WI0 A;  4WQO B;  5J2R A;  2MX2 A;  2RPQ A; 
#chains in the Genus database with same CATH topology
 2RD0 A;  3DCG A;  2NMQ A;  2AYO B;  1JRO A;  2IPK D;  2DZI A;  1IBX B;  1MHX A;  2O6V D;  2BGF A;  2DBY A;  3ZVV A;  4AJY B;  3FKY A;  4M8N A;  2AQ1 B;  2KLC A;  5L95 C;  4RGM A;  2LEK A;  3TSS A;  5DCN A;  3LXF A;  3KWV A;  3Q2A C;  4GN1 A;  4IWQ A;  4CHK A;  3Q3O C;  2KWC A;  2JWU A;  3ZNZ B;  4LNF A;  3CWI A;  5EE3 A;  4XZ4 A;  4ZHO A;  2J42 A;  1KRH A;  3CIR B;  3VH3 B;  2D10 A;  2FBW B;  3SR6 A;  4BZA A;  3R2I A;  1WE6 A;  4II3 B;  2K6D B;  5KHQ A;  1V1P A;  1QOG A;  3AE1 B;  2RPV A;  1N61 A;  1NBF C;  1E8Y A;  3H8H A;  3P4S B;  3UQB A;  4FHJ A;  3SDL C;  3AE5 B;  3UIO B;  3URY A;  2G3Q B;  2BWE S;  2KAC A;  3B08 A;  2Z0E B;  3BII D;  4YXD B;  2AEH A;  3NUH B;  4W9K A;  2IJ0 A;  2W54 A;  3P2B A;  4GXB A;  2DLB A;  4MGI E;  5H8Y E;  1XT9 B;  1KH0 A;  4UDU C;  4XGA B;  5DPR A;  3EEC A;  4YTN B;  1C4A A;  2I2Y A;  3PO0 A;  4HPL B;  1RWS A;  5L83 A;  2PE9 A;  1UBI A;  4ANU A;  3HK0 A;  3BK2 A;  4NJ7 A;  3NY5 A;  2WQY B;  2ZVO A;  4M01 A;  5FKA C;  4ARC A;  4KKI A;  2C5L C;  2LHD A;  1KFY B;  3M62 B;  2JPH A;  2V4I B;  3KUZ A;  5LXH A;  2LVO A;  4GDK B;  2MBB B;  1IP9 A;  3Q8C A;  3A1Q B;  4LNK A;  1HE8 A;  2R2Q A;  4HCP B;  1RLF A;  2O2V B;  5HKH A;  1TBE A;  2KK8 A;  1D5X C;  1L6V A;  1SE2 A;  4KV2 A;  2IO1 B;  4ZOH C;  4WJQ A;  4DQO C;  4XWT A;  4ZRI A;  2LGY A;  4KIK B;  4DXA B;  1SIJ A;  3Q14 C;  3R2T A;  1C4C A;  1YJJ A;  2KC1 A;  2W9N A;  2TSS A;  5AZH A;  4Q2J A;  3RNG C;  5HFY A;  4AP4 C;  3TEZ A;  4OZB A;  1R4M I;  2L52 A;  4E3C A;  1MG4 A;  3RCZ A;  3LB8 C;  2DYB A;  3RPF C;  4JL9 A;  5TSS A;  4ICV A;  2M4N A;  1WX7 A;  4MGY E;  4X57 B;  5BO4 B;  4P6V F;  2FIF A;  3V05 A;  3LYY A;  1RFK A;  3A9K A;  3KUD B;  5CTR C;  1YQ3 B;  2GBN A;  5AZG A;  1D3Z A;  3N9Y C;  4P16 A;  5E6N A;  4MM3 B;  1OEY J;  1ZW7 A;  3W5U B;  4C7Z A;  2CHW A;  4G0N B;  2B76 B;  3W1S A;  2KC2 A;  3RZF A;  1P0R A;  1CJE A;  4A9A A;  2L3Z A;  1UZX B;  2D3G A;  2ZJD A;  2D11 A;  2LGS A;  3NHE B;  1KJT A;  3IHP C;  4KZ0 A;  1JWM D;  3QA8 A;  4HRO A;  2KXJ A;  2K39 A;  4IKG A;  2N7D A;  3N32 A;  1N60 A;  4NNJ B;  3ZRC A;  1ZDX A;  1YD8 U;  2KT7 A;  1V49 A;  4JIO U;  4OZC A;  1MG8 A;  2PJH A;  1AWD A;  1JML A;  1LM8 B;  4HLE A;  5KHO A;  3IAM 1;  3JYU A;  2UWQ A;  4KGR A;  3AH7 A;  3TEX A;  1TYG B;  3RFZ B;  5H92 C;  5D3D A;  3K9O B;  2JXT A;  3R8B A;  1TS3 A;  4BKG A;  3QC8 B;  3OJ3 A;  5JHB A;  2JZZ A;  4HDQ A;  1TZ1 A;  2J4X A;  3B0A A;  2MP2 B;  3NZS A;  3KW5 B;  1D6E C;  1CMX B;  3PT2 B;  1NYR A;  1RFA A;  3MC9 A;  1WX9 A;  2JYE A;  3VR9 B;  4YSY B;  2BS2 B;  3PRE A;  4WWO A;  3PRZ A;  1E7P B;  2PEA A;  3AE6 B;  4BBN F;  3DHG C;  1V1P B;  1C76 A;  2M8S A;  2WU5 B;  4BKS D;  1CQV A;  1XLP A;  3M3J A;  2GMI C;  2LVQ A;  2D3C A;  2WXH A;  1I35 A;  2LGI A;  4CQN A;  2V3N A;  3TUO A;  1F9J A;  2K8H A;  4GLS C;  4W9D A;  2K22 A;  1VCB A;  2KAN A;  1C9F A;  3B2G A;  2CKH B;  2L0F A;  4PS3 A;  1T0Q C;  2J52 A;  1FFU A;  3N1X C;  2H88 B;  1VZ8 A;  1K51 A;  1TKG A;  3VVW B;  4FXC A;  4IM2 A;  2KFJ A;  3MC0 B;  1C4P A;  3APF A;  3IT4 B;  2MP2 A;  4K81 A;  4YTP B;  1SSN A;  1SJE D;  1J8C A;  5LNK 1;  3Q3N C;  2BQQ A;  4LDT D;  4OHJ A;  1WGD A;  3MJW A;  4TQ1 A;  3IG3 A;  1EUV B;  4M0W A;  4XDC A;  2B3A A;  2KDM A;  1E10 A;  1WMH A;  3OG5 A;  2PKO A;  4OW0 A;  1DYQ A;  1ZUD 2;  2Y5C A;  5HI1 A;  1WFY A;  3UGB B;  2GLS A;  3VR8 B;  4ANV A;  4KIK A;  3EC8 A;  4C4V B;  2KJH B;  5MPO A;  3TL5 A;  3EFC A;  1YOV B;  4WAF A;  2BF8 B;  2KVR A;  2LGX A;  2NTS A;  4IWP A;  1HA5 A;  4N58 A;  2YLM A;  3ZXV A;  1YJ1 A;  2C7M B;  3ZUN A;  3KWL A;  2MJE A;  5HG2 A;  4OVV A;  3IT6 B;  5C23 A;  2KDB A;  1L0Y B;  1FEH A;  2WS3 B;  2W3R A;  2J53 A;  2IGG A;  5TR5 A;  4EZJ A;  1WR6 E;  4ZRK A;  5IO9 A;  3GOE A;  1WXS A;  1Z5S B;  3AE3 B;  1F1H A;  4YSX B;  1SBB B;  1WJ6 A;  4JLC A;  3ETR A;  3IXS A;  3ZKJ C;  2FCS A;  4H2A A;  2MJD A;  1J7B A;  3V61 A;  3HUI A;  5BMG A;  1WJN A;  1XLQ A;  2INN E;  4ANX A;  1PGX A;  1FO4 A;  2WDR B;  3JVZ X;  2MX2 A;  1WI0 A;  2ZEQ A;  3EFU A;  1P3Q U;  4K3B A;  4WJN A;  2R2O A;  3DWM A;  3WIM A;  1EF5 A;  1I4R A;  2WP9 B;  4ICU A;  1QQR A;  3RMK C;  1SE3 A;  2BB5 A;  4G50 A;  4P7I A;  4WWP A;  2GBK A;  3A4R A;  3I3T B;  2Z0D B;  2KO3 A;  1GB4 A;  2NTT A;  3I5J C;  2QCZ A;  2WLB A;  4LLG M;  2NBW B;  3PVL A;  1AW7 A;  1TY0 A;  1QZE A;  3V62 A;  3X0W A;  3H7P B;  1VZ6 A;  2I1J A;  3GB1 A;  1V5O A;  4J3O D;  1GNU A;  2L83 A;  4MEM A;  3AEF B;  5AZF A;  5IN7 A;  3A4S C;  4W9I A;  3UIP B;  2KVZ A;  4TUU A;  3Q69 A;  4C7Y A;  2BB6 A;  1G6J A;  3ZXR A;  3TEW A;  4RM9 A;  2J0J A;  2BWF A;  2DYO A;  4XWW A;  3Q3F A;  4BBN C;  4WJP A;  1Q0W B;  3RUI B;  3P4Q B;  2N7E A;  5G5G A;  3AB5 A;  4P1C C;  2JQR B;  1VRA B;  2KWD A;  2NR2 A;  3FAH A;  4HJK A;  4W9C A;  1TT5 B;  3RD2 A;  1UGJ A;  1K8R B;  3VQI A;  2LUE A;  2JYT A;  2K1F A;  5BYQ A;  3ZYY X;  1KTK A;  5G5H A;  2BYF A;  1DOY A;  2N0S B;  2C9W B;  2V9H A;  3P42 A;  2IGH A;  4IM0 A;  2LJI A;  3ZO5 B;  1V9J A;  2SEB D;  1HZ5 A;  4IOI E;  2M1M A;  4BFR A;  1CK1 A;  2K5P A;  3Q3J A;  4AUQ C;  2YEP B;  2LI5 A;  4LNO A;  1WXA A;  5GMV A;  1ZXI A;  1J7A A;  3AU5 A;  4W9J A;  5JHA A;  1S3S G;  4ZRQ A;  2BKR B;  1N62 A;  2XEW A;  1ISN A;  1AYF A;  4EFO A;  3AEE B;  2FCM A;  2Z8L A;  3N20 C;  1D5Z C;  3H7S A;  3NVY A;  1FNW A;  2WDT B;  2KQ7 A;  1F2R C;  1C78 A;  1H8C A;  2E3T A;  1J7C A;  2KN5 A;  4MH0 E;  3APD A;  4DXG A;  3R3M A;  2KHW B;  1TTN A;  1JQ4 A;  3P4R B;  2PPH A;  3UIN B;  3U4E G;  1WYW B;  1VDV A;  1I4P A;  4IUM B;  5IA7 A;  1FMA D;  1CZP A;  4NY0 A;  4HDO A;  1GPX A;  5CHF A;  2DYM A;  4NJC A;  1HTQ A;  2FUG 1;  3B9J A;  2MLB A;  2GB1 A;  4BAX A;  2JT4 B;  2ZPY A;  3QX1 A;  1E9M A;  3JSV B;  1L4Z B;  2FCQ A;  3BIN A;  4I6P A;  1BT0 A;  3SEB A;  2VH2 A;  3ABV B;  1TZO A;  2BPS A;  1T0Y A;  4BOS C;  3HIZ A;  2JUO A;  4ZYS A;  4C4V A;  4YWG G;  3WA0 A;  1FM0 D;  1EWC A;  3IAS 1;  4A3P A;  2LFI A;  1WGG A;  1ZPS A;  2JRH A;  1STE A;  2K0P A;  2ZVN A;  4RF0 A;  2J0K A;  4EZL A;  2NS5 A;  2G45 B;  4YT0 B;  1WGR A;  3AE9 B;  3NJT A;  2OJR A;  2GRI A;  4GDL B;  3LDZ E;  1V86 A;  1TS4 A;  1I4X A;  2ZCC A;  1YX5 B;  2LJ5 A;  3Q8E A;  2IO3 B;  2J7Q B;  3B2F A;  2L8J A;  3UQA A;  1WX8 A;  4E71 A;  2KDI A;  1LO5 D;  3WAL A;  3L0W B;  2L76 A;  2VH1 A;  4BKT A;  3IFW B;  1T3Q A;  3HVZ A;  1E90 A;  3PRP B;  1L5P A;  3Q8A A;  4GB9 A;  1N5W A;  4FUL A;  4US9 A;  2D3A A;  2SAK A;  4JWS C;  1C1Y B;  2INP E;  3TMP B;  1FCL A;  4HPM B;  4MSQ B;  3C19 A;  2LWP A;  4MT5 A;  4IDI A;  1MHH E;  2WDV B;  4MH8 A;  3U30 A;  1A70 A;  4NAW A;  4ACF A;  5C1Z A;  3ZIM A;  2WXM A;  1PUT A;  1WYG A;  3GS2 A;  3ZJU A;  4YL8 A;  1F52 A;  2KX0 A;  4YSZ B;  2BS3 B;  3VH4 B;  1KM7 A;  2JF5 A;  2MA9 B;  3RN9 C;  3DOW A;  4NJ6 A;  4KGT A;  4B95 A;  2JVC A;  5JXV A;  4EKU A;  3L13 A;  1P7E A;  3ZNG C;  2HDE A;  3R7Q A;  1OGW A;  4L1B A;  3R7R A;  5LXI B;  3V3X A;  2WX1 A;  1L0V B;  1OQQ A;  5D2M B;  4L2Y A;  3K9P B;  3PHX B;  2LMC A;  3UF8 A;  1V81 A;  1U4A A;  1L6U A;  1LQB A;  4K7W A;  1ZGU B;  3KLS X;  4LDT B;  3N3K B;  1GAQ B;  3QHT A;  4NQL B;  4AQ7 A;  2VRR B;  1ZOY B;  4C00 A;  3TCA A;  4GDK A;  2WXN A;  5IOI A;  3VXW A;  4ARI A;  2LGD A;  3ZTD A;  1OQR A;  4NQK E;  4XC2 A;  4IG7 B;  1GC7 A;  2OHF A;  1UUP A;  3AE7 B;  3JSV A;  2RDB C;  2IDY A;  2L32 A;  4OVZ A;  2AL6 A;  4KSL C;  2OOB B;  5D3I B;  3OAW A;  3LJ3 A;  1QOA A;  3HM6 X;  1B9R A;  5D94 A;  2UYZ B;  1FXI A;  1FCC C;  3AUL A;  4RNA A;  2CHZ A;  3BK1 A;  3D32 A;  5D6J B;  5G2N A;  1YN4 A;  2I1K A;  3SU8 X;  4PS8 A;  2WXG A;  2EMS A;  2WXJ A;  2BBC A;  3VRA B;  4DHZ E;  2KJ6 A;  2G1E A;  2Z59 B;  2NCN A;  4FAD A;  4GDL A;  5AEK B;  1V8C A;  4WWN A;  1SGH A;  2GBM A;  1HXY D;  5DPT A;  1JAL A;  2HD5 B;  2DHZ A;  3KYD D;  4F8C B;  2BW2 A;  3WAN A;  2CJN A;  1PFD A;  1Q5W B;  1WMH B;  2VZK D;  3A9K B;  2MBQ A;  2KAJ A;  1WXQ A;  4DBG A;  2IYD B;  2W82 A;  1NYQ A;  2KX3 A;  2YVC A;  2HTH A;  1GUA B;  3VHT C;  4HEA 1;  1VZ7 A;  2OED A;  4OVU A;  1WF9 A;  2MCN B;  3AU4 A;  2C7H A;  2QDF A;  2DWQ A;  2N9L A;  1WGY A;  4JQW C;  2WXF A;  5FK9 C;  4DWF A;  2NBU A;  4MGZ E;  2IY1 B;  4RH6 A;  1ET6 A;  2KDE B;  1PYW D;  3KYC D;  2DX5 B;  2KJR A;  2QIE B;  3BVG A;  1MJD A;  4ZRP A;  1FXA A;  2KN4 A;  1ZKH A;  3Q8F A;  2MHJ A;  2N9K A;  3AN1 A;  3ZTC A;  1A5R A;  5E6P A;  3VUY A;  2NBV B;  3PZ8 A;  2M0A A;  3U8Z A;  1E8Z A;  3B1L X;  3NS1 A;  4II2 B;  2IND C;  3SD5 A;  3ECI A;  3GZN I;  2WHI A;  2MBE A;  1T5X D;  1LXD A;  3WAM A;  4A8X C;  1QF6 A;  1R7S A;  3QWZ B;  4LJO B;  3ZJV A;  3CST A;  2NVU I;  2LUM A;  2GI9 A;  1M94 A;  1TGZ B;  3N30 A;  5C3J B;  1SB3 C;  4KDL B;  3ZW3 A;  1WRD B;  3P4P B;  2GBJ A;  2E6X A;  1UWM A;  4AS1 A;  2KQ4 X;  2WNM A;  1E0Z A;  4HKQ A;  3NRZ A;  3GE8 C;  2RSU A;  4URK A;  3A1Q A;  2N9P C;  2L7R A;  4EOY A;  3QCA A;  2V0G A;  1SXT A;  4HJG E;  1HQR D;  1D5M C;  2HJ1 A;  2W3S A;  1E5W A;  1J0G A;  4HPP A;  2Y3A A;  4M0W B;  1ET9 A;  1NI3 A;  1MPE A;  1WIA A;  1TY2 A;  2WX0 A;  3ALB A;  1XD3 B;  3JW0 X;  1Z2M A;  1KLV A;  1RRB A;  4ASW C;  2BT6 A;  1NDD A;  2N1W A;  3W9C B;  2JZ3 B;  2PVG C;  4TV3 A;  3L17 A;  4E74 A;  5BMI A;  2MRP A;  2CJO A;  2HE7 A;  4I6N B;  3VTU A;  2BTE A;  2JXX A;  2DZJ A;  3BWU D;  4RFB A;  4LK0 M;  3NVW A;  1FNV A;  1YN5 A;  1K50 A;  2PVO D;  1HZ6 A;  4GOC A;  1OEY A;  3C8Y A;  1R4N B;  2BYV E;  2WXL A;  1I42 A;  2EEL A;  4RGT A;  2ACZ B;  3SHQ A;  1B1Z A;  4DHZ B;  4XX5 A;  3PSE B;  1ENF A;  1R4M B;  1X1M A;  2G4D B;  4K1R B;  4TKN A;  3AE2 B;  3DBL I;  4QAY A;  5EDS A;  2FUH B;  5T8I A;  3W2D A;  4PYZ A;  3WAP A;  4PYU A;  2INC C;  2RR9 A;  2FID A;  2IZV B;  1I4H A;  2JSV X;  4S0R A;  1ROE A;  1UD7 A;  3VTW A;  3BY4 B;  4ITK A;  2PMV A;  1EWY C;  4NZL B;  4EEW A;  1IPG A;  4K3C A;  1Q1O A;  4TMA B;  4M00 A;  1GG3 A;  4XE0 A;  4C80 A;  3QAR A;  1GB1 A;  1XEE A;  4W9H A;  2QMT A;  3T3O A;  3E9S A;  3HVD A;  1C77 A;  1SF0 A;  3TEY A;  4LCD E;  4KX6 B;  2K3U A;  1KF6 B;  2EMT A;  3OLM D;  1SE4 A;  2O6V A;  3RI7 C;  3W1S C;  1H4R A;  3VAW A;  1JWB D;  1F77 A;  1OQY A;  2JU6 X;  2JZP A;  2ZCB A;  3P1M A;  3RYT A;  4A6Q A;  2AWT A;  1QIL A;  2J0M A;  4RGO S;  3QQ8 B;  1WWT A;  2RDH A;  4PS7 A;  5EE9 A;  2K25 A;  2C60 A;  3DPD A;  3ML9 A;  5FR3 A;  2ICI A;  1YN3 A;  3AEC B;  1ZP0 B;  2PTL A;  3DHI C;  1JW9 D;  2NPT A;  3BZD B;  3ZDT A;  3ZJT A;  2BKF A;  3RNC C;  3NOB A;  1UF0 A;  4HK2 A;  1EF1 A;  3H7P A;  3CMM B;  2MH7 A;  5JH5 C;  4KGS A;  2XN9 C;  1YJI A;  3RUL A;  4A20 A;  2BVC A;  2N7J A;  4DHJ B;  1ACC A;  5BMH A;  3IBE A;  2WYQ A;  2JWZ A;  3APC A;  4CO7 A;  4GGQ A;  3ZNI D;  2MW5 A;  3FIL A;  4N9F 4;  1SJH D;  1R4N I;  1Y56 A;  2M56 B;  2D3B A;  4WH4 A;  4HKZ E;  2MWS B;  4F1S A;  1PDX A;  2WDQ B;  3DDC B;  4PK1 A;  4REZ A;  3AED B;  1OFF A;  4MEL A;  4RF1 A;  2K8B A;  3N1Y C;  1T6B X;  1WM3 A;  2AQ3 B;  3DHH C;  5C2T B;  2X8X X;  3DVN V;  4F7Z A;  2IO0 B;  1NEN B;  4FA6 A;  1WGK A;  1S1Q B;  1WJU A;  5GXG B;  4W9F A;  1WRI A;  3NG0 A;  4A55 A;  2RGF A;  3AE4 B;  3AEG B;  3KVF B;  3RNB C;  4FJY A;  2L1A A;  3SFD B;  4B0M A;  4W9G A;  1XCQ L;  2BYT A;  2L0T A;  1LGR A;  3I57 A;  5J17 A;  3BYY B;  2MBH A;  3AEA B;  4BVU C;  3BVM A;  2CHX A;  4IW0 A;  4NAW B;  1WR1 A;  4GU2 A;  1WXM A;  2DAJ A;  1C79 A;  1ESF A;  3RNF C;  1WM2 A;  1BXT A;  5DPW A;  2DAF A;  2XNA C;  5CX3 A;  4W9L A;  2KZR A;  4BOZ B;  4D2K A;  3RNA C;  3ZGZ A;  3C0R B;  3L10 B;  4LJP B;  3BVZ A;  3AMZ A;  4AOF A;  4MJS B;  3QJZ A;  4W9E A;  1DOI A;  1L4D B;  4L23 A;  4WUR A;  4PT5 A;  2KNB A;  4FBJ B;  3EA6 A;  2N1V A;  4FJZ A;  5IKC M;  1Y8R C;  4S17 A;  4CYE A;  1UEL A;  4DHJ D;  2A4Z A;  3PS6 A;  2M19 A;  1NEK B;  2LRW A;  2QHO A;  3H9D A;  3U2S C;  1TIF A;  2KKC A;  3R66 C;  1N5X A;  4RM8 A;  3IVF A;  1P1A A;  4C56 C;  2Y5P A;  2AL3 A;  1P9D U;  1UWX A;  5D7G A;  5EE1 A;  3U7Z A;  2JRI B;  3MTN B;  1LFD A;  3O13 A;  4XYC A;  5AUK A;  4R3D A;  1HTO A;  2H89 B;  2IGD A;  4JE3 B;  2CS4 A;  1FD6 A;  2M0X A;  1BUI C;  1JWU D;  4ZDV A;  3PV1 A;  2PIA A;  3ML8 A;  1IBX A;  3WAO A;  1ZDV A;  2N4F A;  4WQM A;  1V1O A;  2Q5W D;  1XF5 L;  3AM9 A;  2V1Y A;  2OJW A;  1FRR A;  1EU3 A;  3I63 C;  2CU1 A;  3PPA A;  3HM3 A;  1UBQ A;  3EHV A;  1PQS A;  3QIJ A;  3CSF A;  3DBR B;  4FHK A;  3UI3 A;  4MJS A;  3PRM B;  3TBL D;  2D5G A;  1K53 A;  2K8C A;  2WXO A;  3PHW B;  4WQO B;  4M02 A;  5J2R A;  3NZU A;  2MSE D;  1SE9 A;  3MC8 A;  1E8W A;  3ZQ4 A;  2AQ2 B;  4JWU C;  1NVI D;  1M4V A;  2G4S A;  2DNF A;  3J9C A;  4TQ0 A;  1YNT E;  4O1N A;  1GOZ A;  1FPY A;  2REX A;  4A90 A;  2LXA A;  1HEZ E;  1VR9 A;  2LD9 A;  1IYF A;  2I38 A;  2A5U A;  3P63 A;  1RAX A;  1OTR B;  3MFG A;  3CF6 E;  1E7U A;  3V6E B;  1KOT A;  2KYW A;  1DOX A;  2DEN B;  2EKE C;  1YIW A;  3L08 A;  2MEK A;  1XLO A;  2W55 A;  4N6E B;  1NI2 A;  3OJ4 B;  1EO6 A;  3QAQ A;  1WH3 A;  2KTR B;  4JGH B;  4MAC A;  2MQJ A;  3PZD A;  1YQ4 B;  4K7U A;  3MJ5 A;  2YEP F;  4USA A;  3PGE A;  1V2Y A;  1BML C;  4HCN B;  4AWJ A;  4HVB A;  4WWM A;  4XDD A;  4ZRJ A;  3PTF C;  5DPS A;  2PLP A;  4WIP A;  5FR6 A;  2X38 A;  1XQQ A;  1V6E A;  5LLI A;  3W1Y A;  4HXD A;  2L05 A;  1N63 A;  1RM6 C;  3EUB 2;  1XXG A;  4FLH A;  1ZXH A;  2KFK B;  1L0X B;  3E56 A;  3A9J A;  2ASQ A;  4GIV A;  3L4P A;  1I4Q A;  1FXT B;  3L16 A;  1TKY A;  1XO3 A;  2ON8 A;  1K52 A;  2UU7 A;  2DZK A;  2ZZP B;  5IP4 D;  2BYE A;  2MJ3 A;  2EKI A;  1EM7 A;  2ONQ A;  2IY0 B;  4EZK A;  1SEB D;  2M17 A;  1WXV A;  2N9X A;  2LZ6 A;  3H6N A;  1E7V A;  3GE3 C;  1V80 A;  3PLU A;  1E6E B;  5JZE B;  2LXC A;  4KVG B;  3S2A A;  1QT9 A;  1P98 A;  2Y5B B;  3T3N A;  1VD2 A;  3ENE A;  3V6C B;  4IWO A;  4MSM B;  3SFE B;  1KLU D;  2N9E B;  4DK5 A;  1D4B A;  2KLG A;  3DQV A;  2ZW1 A;  2LAS A;  2HJ8 A;  3T9L A;  3I9V 1;  3DBL B;  5J18 A;  3GZN B;  2BS4 B;  5CHW A;  1QKZ A;  3U52 E;  1XLN A;  1FFV A;  2KQS A;  1GC6 A;  5CHV C;  4MM3 A;  3AE8 B;  3OWE B;  1V97 A;  1Q10 A;  3RZW C;  2V3S A;  5E6O A;  1I4G A;  1WZ0 A;  1MVK A;  3DBS A;  2PE6 B;  2GOW A;  2KMA A;  2KWV B;  4I6L B;  4ZHP A;  3L54 A;  2G9H D;  3ZDM C;  2KTF A;  3A9J B;  3Q3M C;  1TJE A;  5G55 A;  2XK5 B;  2K9X A;  3X23 A;  4US8 A;  2LRU A;  3Q6B A;  2V3P A;  3O65 B;  4M8M A;  3TIX A;  1T0S C;  1L2N A;  1JCK B;  5EE0 A;  1JWS D;  5E6J A;  2KTR A;  2KOX A;  1WY8 A;  4TSS A;  2LVP A;  1I7H A;  3NVV A;  3V60 A;  5IAA C;  2LHE A;  2KWU B;  1WGH A;  3A33 B;  4WAA A;  4JPS A;  4HRS A;  1XCT L;  4N59 A;  2QC8 A;  2KD0 A;  4J6I A;  5I4D A;  4DDI D;  2R61 A;  1UNS A;  3AI5 A;  2KMC A;  1TS5 A;  2WXK A;  1PGA A;  3FIL B;  1MFW A;  4YTM B;  1E8X A;  2WGS A;  2QSD A;  4DXF A;  4RMA A;  4IC7 B;  1YQB A;  2FNJ B;  2QIL A;  2WU2 B;  2QJL A;  4RGN A;  3AV8 A;  1T0R C;  1AN8 A;  2K6Q A;  1YMH E;  2D2Q A;  4OZA A;  2L00 B;  3GP7 A;  1WSP A;  2ZPN A;  4KSK C;  1MI0 A;  4MGK E;  3KQ4 A;  4FJV B;  3VFK A;  4G11 A;  3HHM A;  2MBO A;  3WCQ A;  2XBB C;  1V5T A;  2JX5 A;  2D07 B;  1KLG D;  2ZNV C;  3U7D A;  1IGC A;  3M95 A;  3HRD D;  4LTU A;  1ZE3 D;  1C3T A;  1FNU A;  3RNE C;  2O2V A;  4EUT A;  2FE8 A;  4FN2 A;  3VDZ A;  5AUI A;  2JY6 A;  5BYS A;  1N6Z A;  5BYR A;  2DZM A;  2FCN A;  4B9K A;  3N1Z C;  1PGB A;  3DWG C;  2O6V B;  3MHS D;  3QK0 A;  2KFK A;  3FC4 A;  1UH6 A;  2WXP A;  2WWZ A;  4K7S A;  1GJZ A;  2IO2 B;  2CR5 A;  2RDG A;  3DVG X;  2AX5 A;  1IGD A;  1WE7 A;  1DGJ A;  3MP9 A;  1WZ3 A;  2KMM A;  3ONS A;  1TKE A;  4AJW A;  3MHZ A;  1F2R I;  1FIQ A;  1VJK A;  2ZNV B;  4A3O A;  4IM3 A;  4KZC A;  1QOF A;  1TS2 A;  2WXI A;  3DVN U;  2C7N B;  3H1U A;  4GSW A;  2GBR A;  2NPT B;  1YX6 B;  1J19 A;  4ANW A;  1IUE A;  3PLV A;  3DBH B;  3VUW A;  4LNI A;  4BKS A;  4G3X B;  1AAR A;  3VTV A;  1P7F A;  2WXQ A;  2QEJ C;  3DBH I;  3VUX A;  3NS8 A;  2RMM A;  3M63 B;  2PW9 A;  1JRU A;  4KDI C;  4GMV A;  1EU4 A;  1FRD A;  1VLB A;  1L7Y A;  3NVZ A;  2VZK B;  4RCO A;  3Q8B A;  3W5V B;  3ZNH B;  2HTM E;  3BYT B;  1JWA D;  3ZRF A;  3TJP A;  1QOB A;  1UGM A;  1SIF A;  3KH0 A;  4WJO A;  1QLB B;  5HHD G;  4B0E A;  4DDG D;  2IBI B;  1RYJ A;  3AXC A;  3ZLZ A;  3VRB B;  2V4L A;  4JX1 C;  4P1B C;  4HWI B;  3T8M A;  2ZW0 A;  3EGR A;  3PZ7 A;  2FAZ A;  2XK5 A;  3AEB B;  2WXR A;  4NAM A;  4EE2 A;  3KUC B;  3RT3 B;  2KDF B;  4LNN A;  1JRP A;  4B6W A;  3DVG Y;  4MDK E;  4ZYN A;  1F0Z A;  3DBR I;  4NPN A;  1WJ4 A;  2CU3 A;  4KKJ A;  3NZ3 A;  2RPQ A; 
#chains in the Genus database with same CATH homology
 3NZU A;  2MSE D;  2ZEQ A;  3EFU A;  1P3Q U;  1SE9 A;  2KDE B;  1E8W A;  2RD0 A;  4WJN A;  3KYC D;  2R2O A;  3DCG A;  2DX5 B;  3WIM A;  2KJR A;  1EF5 A;  4ICU A;  2G4S A;  2AYO B;  1ZKH A;  4G50 A;  4P7I A;  4WWP A;  4TQ0 A;  2GBK A;  2DZI A;  3A4R A;  3I3T B;  3ZTC A;  1A5R A;  2O6V D;  2KO3 A;  2Z0D B;  5E6P A;  3VUY A;  2NBV B;  2BGF A;  3ZVV A;  2NBW B;  3PVL A;  4AJY B;  2REX A;  4M8N A;  3U8Z A;  1E8Z A;  1QZE A;  2KLC A;  2LXA A;  3V62 A;  5L95 C;  2LD9 A;  3X0W A;  3H7P B;  3B1L X;  2I1J A;  1IYF A;  2A5U A;  5DCN A;  1V5O A;  1RAX A;  4II2 B;  4GN1 A;  3SD5 A;  1OTR B;  3ECI A;  4IWQ A;  3GZN I;  4CHK A;  3CF6 E;  2KWC A;  1GNU A;  2MBE A;  4MEM A;  1E7U A;  3V6E B;  3ZNZ B;  1KOT A;  3ZKJ C;  1LXD A;  5AZF A;  3WAM A;  3A4S C;  4W9I A;  2DEN B;  2EKE C;  3QWZ B;  3UIP B;  4TUU A;  4LJO B;  1YIW A;  3L08 A;  3CST A;  2NVU I;  4XZ4 A;  1G6J A;  1M94 A;  1TGZ B;  2J0J A;  3N30 A;  2BWF A;  4RM9 A;  3VH3 B;  1NI2 A;  4KDL B;  3ZW3 A;  2D10 A;  1WRD B;  2DYO A;  3OJ4 B;  2GBJ A;  3Q3F A;  4BBN C;  1EO6 A;  3QAQ A;  1WH3 A;  1Q0W B;  2KTR B;  4JGH B;  4WJP A;  3RUI B;  2MQJ A;  1WE6 A;  2K6D B;  2N7E A;  2RSU A;  3PZD A;  4II3 B;  4K7U A;  5KHQ A;  4URK A;  3A1Q A;  2N9P C;  2L7R A;  1NBF C;  4EOY A;  2NR2 A;  3QCA A;  3PGE A;  1E8Y A;  3UQB A;  1V2Y A;  4HJK A;  4FHJ A;  3SDL C;  4W9C A;  3UIO B;  4HCN B;  4AWJ A;  2G3Q B;  3RD2 A;  1E5W A;  2BWE S;  4HVB A;  1J0G A;  3B08 A;  2Z0E B;  1K8R B;  2AEH A;  3VQI A;  4M0W B;  4W9K A;  4ZRJ A;  2LUE A;  1WIA A;  3PTF C;  2WX0 A;  3ALB A;  1XD3 B;  3JW0 X;  5DPS A;  2K1F A;  1Z2M A;  1KLV A;  1RRB A;  3P2B A;  4GXB A;  5FR6 A;  4ASW C;  4MGI E;  1NDD A;  1XQQ A;  1V6E A;  5LLI A;  2N1W A;  1XT9 B;  3W1Y A;  4HXD A;  2L05 A;  2JZ3 B;  5DPR A;  2BYF A;  4TV3 A;  4FLH A;  3L17 A;  2C9W B;  2KFK B;  4E74 A;  3EEC A;  2MRP A;  3A9J A;  5HKH A;  2ASQ A;  2HE7 A;  4I6N B;  3VTU A;  4IM0 A;  3ZO5 B;  1V9J A;  4GIV A;  2JXX A;  4HPL B;  2DZJ A;  1FXT B;  3L16 A;  2M1M A;  2PE9 A;  4BFR A;  5L83 A;  1UBI A;  4ANU A;  2DZK A;  2ZZP B;  3HK0 A;  4NJ7 A;  3Q3J A;  4AUQ C;  3NY5 A;  2ZVO A;  2BYE A;  4GOC A;  2LI5 A;  1OEY A;  1WXA A;  5GMV A;  2C5L C;  3AU5 A;  4W9J A;  3M62 B;  2JPH A;  5JHA A;  1S3S G;  3KUZ A;  2BKR B;  2IY0 B;  5LXH A;  2BYV E;  2LVO A;  4GDK B;  4EZK A;  2M17 A;  1WXV A;  2XEW A;  2N9X A;  2LZ6 A;  1I42 A;  1ISN A;  2MBB B;  1IP9 A;  3H6N A;  4EFO A;  3A1Q B;  3SHQ A;  1E7V A;  2FCM A;  1HE8 A;  4DHZ B;  1V80 A;  2R2Q A;  3PLU A;  3PSE B;  4XX5 A;  3H7S A;  2LXC A;  5JZE B;  4HCP B;  1RLF A;  4KVG B;  2O2V B;  3S2A A;  1TBE A;  1X1M A;  2KK8 A;  2WDT B;  1P98 A;  2G4D B;  2KQ7 A;  2Y5B B;  1VD2 A;  3ENE A;  4K1R B;  4KV2 A;  2IO1 B;  3V6C B;  1H8C A;  4IWO A;  4MSM B;  4TKN A;  4WJQ A;  2KN5 A;  4ZRI A;  4MH0 E;  2LGY A;  2N9E B;  3DBL I;  4DK5 A;  3APD A;  5EDS A;  3R3M A;  4KIK B;  2KLG A;  2KHW B;  4DXA B;  2FUH B;  3DQV A;  1TTN A;  2LAS A;  4PYZ A;  3WAP A;  2HJ8 A;  4PYU A;  2PPH A;  3T9L A;  3UIN B;  5J18 A;  5CHW A;  1WYW B;  2RR9 A;  2KC1 A;  2FID A;  2IZV B;  2W9N A;  2KQS A;  5AZH A;  1GC6 A;  4IUM B;  5CHV C;  4MM3 A;  5IA7 A;  1UD7 A;  3VTW A;  3BY4 B;  4AP4 C;  4NY0 A;  4HDO A;  3RZW C;  1R4M I;  5CHF A;  2DYM A;  4E3C A;  2V3S A;  5E6O A;  1WZ0 A;  3DBS A;  2PE6 B;  3RCZ A;  4EEW A;  2MLB A;  2GOW A;  1IPG A;  2KMA A;  1Q1O A;  2DYB A;  2KWV B;  4I6L B;  2JT4 B;  1GG3 A;  3L54 A;  2ZPY A;  3ZDM C;  2KTF A;  3QX1 A;  3QAR A;  3A9J B;  4JL9 A;  3JSV B;  2FCQ A;  4W9H A;  3BIN A;  2M4N A;  1WX7 A;  4ICV A;  4MGY E;  5G55 A;  4X57 B;  2XK5 B;  4I6P A;  3X23 A;  1BT0 A;  5BO4 B;  2FIF A;  2LRU A;  2BPS A;  1T0Y A;  4BOS C;  3O65 B;  4LCD E;  3HIZ A;  3A9K A;  2JUO A;  3KUD B;  4M8M A;  5CTR C;  3TIX A;  2GBN A;  3WA0 A;  2EMT A;  5AZG A;  3OLM D;  1D3Z A;  2O6V A;  3W1S C;  4A3P A;  1H4R A;  3VAW A;  5E6N A;  1L2N A;  1WGG A;  1OEY J;  1ZW7 A;  2JRH A;  2CHW A;  4G0N B;  2ZVN A;  1OQY A;  2J0K A;  4EZL A;  3W1S A;  2KC2 A;  3RZF A;  2ZCB A;  1P0R A;  2KTR A;  2NS5 A;  2KOX A;  2G45 B;  3RYT A;  1WGR A;  1WY8 A;  2OJR A;  2AWT A;  2L3Z A;  2LVP A;  1UZX B;  3V60 A;  2D3G A;  2J0M A;  5IAA C;  2ZJD A;  4GDL B;  2D11 A;  3NHE B;  3QQ8 B;  1KJT A;  3IHP C;  4KZ0 A;  3LDZ E;  1V86 A;  2KWU B;  1WGH A;  3A33 B;  4PS7 A;  3QA8 A;  4WAA A;  2K25 A;  2KXJ A;  2ZCC A;  2C60 A;  3DPD A;  3ML9 A;  1YX5 B;  2LJ5 A;  2K39 A;  2IO3 B;  2J7Q B;  2N7D A;  2KD0 A;  2L8J A;  3N32 A;  3UQA A;  1WX8 A;  4J6I A;  4E71 A;  2KDI A;  4DDI D;  4NNJ B;  2NPT A;  3ZRC A;  3WAL A;  3L0W B;  1YD8 U;  3AI5 A;  2KMC A;  3ZDT A;  2L76 A;  1V49 A;  2BKF A;  4BKT A;  3NOB A;  4JIO U;  1E8X A;  3IFW B;  4HK2 A;  1EF1 A;  3H7P A;  3CMM B;  5JH5 C;  1E90 A;  1MG8 A;  3PRP B;  2PJH A;  4IC7 B;  1YQB A;  4RMA A;  1LM8 B;  4GB9 A;  4HLE A;  2FNJ B;  5KHO A;  3RUL A;  4A20 A;  3JYU A;  2UWQ A;  4FUL A;  4DHJ B;  3IBE A;  2WYQ A;  2JWZ A;  2K6Q A;  3APC A;  4CO7 A;  2D2Q A;  1C1Y B;  4GGQ A;  3ZNI D;  2MW5 A;  3TMP B;  2L00 B;  4N9F 4;  3K9O B;  2ZPN A;  1R4N I;  4HPM B;  4KSK C;  4MSQ B;  3QC8 B;  4BKG A;  2LWP A;  4MGK E;  3OJ3 A;  5JHB A;  2JZZ A;  2MWS B;  4F1S A;  4HDQ A;  3DDC B;  1TZ1 A;  3B0A A;  2MP2 B;  4FJV B;  3NZS A;  3KW5 B;  4NAW A;  3U30 A;  3VFK A;  5C1Z A;  1CMX B;  3PT2 B;  3ZIM A;  4G11 A;  1RFA A;  1WX9 A;  2MBO A;  3HHM A;  2XBB C;  4MEL A;  2K8B A;  4YL8 A;  1V5T A;  2D07 B;  2KX0 A;  2ZNV C;  3U7D A;  1WM3 A;  3VH4 B;  1KM7 A;  3DVN V;  4F7Z A;  2JF5 A;  2MA9 B;  3M95 A;  2IO0 B;  3PRE A;  4WWO A;  4FA6 A;  3PRZ A;  2PEA A;  3DOW A;  4NJ6 A;  4B95 A;  4BBN F;  1S1Q B;  2JVC A;  1C3T A;  4EKU A;  1WJU A;  3L13 A;  4W9F A;  2M8S A;  2RGF A;  3KVF B;  3ZNG C;  4FJY A;  2O2V A;  4W9G A;  4EUT A;  4BKS D;  3R7Q A;  1OGW A;  3M3J A;  2GMI C;  2LVQ A;  2L0T A;  4FN2 A;  3VDZ A;  5J17 A;  1I35 A;  3R7R A;  2JY6 A;  5LXI B;  2MBH A;  1F9J A;  2WX1 A;  4BVU C;  2K8H A;  2CHX A;  4IW0 A;  5D2M B;  2DZM A;  1WR1 A;  3K9P B;  4NAW B;  4W9D A;  2FCN A;  1WXM A;  3PHX B;  2DAJ A;  1VCB A;  4GU2 A;  3UF8 A;  2KAN A;  4B9K A;  1V81 A;  1U4A A;  1LQB A;  1WM2 A;  4K7W A;  1ZGU B;  4LDT B;  3N3K B;  2L0F A;  2CKH B;  5DPW A;  2O6V B;  3MHS D;  3QHT A;  3QK0 A;  2DAF A;  4PS3 A;  5CX3 A;  4NQL B;  4W9L A;  2KFK A;  1UH6 A;  2VRR B;  2WWZ A;  2KZR A;  4K7S A;  4BOZ B;  1GJZ A;  2IO2 B;  2CR5 A;  3DVG X;  3VVW B;  3TCA A;  4GDK A;  3VXW A;  1WE7 A;  3C0R B;  1WZ3 A;  4IM2 A;  3L10 B;  2KFJ A;  3ONS A;  4LJP B;  2LGD A;  4AOF A;  4MJS B;  3QJZ A;  4W9E A;  3ZTD A;  4NQK E;  4XC2 A;  3APF A;  2MP2 A;  4K81 A;  4IG7 B;  1GC7 A;  4AJW A;  2ZNV B;  1J8C A;  2KNB A;  3JSV A;  4IM3 A;  4A3O A;  4FBJ B;  2N1V A;  4KZC A;  4LDT D;  2AL6 A;  1WGD A;  4KSL C;  3MJW A;  2OOB B;  4FJZ A;  1Y8R C;  4TQ1 A;  3IG3 A;  3DVN U;  1EUV B;  3LJ3 A;  3OAW A;  2C7N B;  3H1U A;  2B3A A;  4GSW A;  4CYE A;  1WMH A;  1UEL A;  3HM6 X;  2GBR A;  4DHJ D;  2A4Z A;  3PS6 A;  5D94 A;  2NPT B;  2UYZ B;  3AUL A;  2CHZ A;  2LRW A;  1YX6 B;  3D32 A;  2QHO A;  1J19 A;  3H9D A;  5D6J B;  5G2N A;  4ANW A;  3PLV A;  3VUW A;  2KKC A;  3R66 C;  1WFY A;  4BKS A;  4RM8 A;  3IVF A;  1P1A A;  2I1K A;  4G3X B;  1AAR A;  3SU8 X;  3UGB B;  4PS8 A;  3VTV A;  2EMS A;  2AL3 A;  4ANV A;  4KIK A;  4DHZ E;  1P9D U;  3EC8 A;  2KJ6 A;  3DBH I;  3VUX A;  3NS8 A;  5D7G A;  2KJH B;  3M63 B;  2JRI B;  2Z59 B;  3TL5 A;  2NCN A;  4FAD A;  3MTN B;  4GDL A;  5AEK B;  1JRU A;  2BF8 B;  1LFD A;  2KVR A;  4KDI C;  4GMV A;  2LGX A;  4IWP A;  2YLM A;  4WWN A;  1L7Y A;  1SGH A;  1YJ1 A;  2C7M B;  2GBM A;  3ZUN A;  5DPT A;  2HD5 B;  2DHZ A;  3KYD D;  4F8C B;  3WAN A;  2CS4 A;  3ZNH B;  4OVV A;  2M0X A;  3ZRF A;  3TJP A;  1Q5W B;  2KDB A;  5C23 A;  1UGM A;  1WMH B;  3A9K B;  3PV1 A;  1SIF A;  2MBQ A;  3KH0 A;  4ZDV A;  4WJO A;  5TR5 A;  3ML8 A;  4DBG A;  2IYD B;  4EZJ A;  3WAO A;  4DDG D;  1WR6 E;  2IBI B;  2KX3 A;  2N4F A;  4ZRK A;  3GOE A;  1WXS A;  3AXC A;  2V1Y A;  3ZLZ A;  2YVC A;  2HTH A;  2V4L A;  1Z5S B;  1GUA B;  4HWI B;  3T8M A;  3VHT C;  1WJ6 A;  2CU1 A;  4JLC A;  3PPA A;  2FAZ A;  1UBQ A;  2FCS A;  3HM3 A;  4OVU A;  1WF9 A;  3EHV A;  2MCN B;  1PQS A;  2XK5 A;  3QIJ A;  3AU4 A;  3CSF A;  2C7H A;  4FHK A;  3V61 A;  4MJS A;  1WGY A;  4JQW C;  3KUC B;  3RT3 B;  1WJN A;  2KDF B;  3PRM B;  3TBL D;  4DWF A;  2K8C A;  4B6W A;  2NBU A;  3DVG Y;  4MDK E;  4MGZ E;  4ZYN A;  4ANX A;  2IY1 B;  3DBR I;  3PHW B;  4NPN A;  1WJ4 A;  3JVZ X;  1WI0 A;  4WQO B;  5J2R A;  2MX2 A;  2RPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...