1WM2A

Crystal structure of human sumo-2 protein
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
78
structure length
78
Chain Sequence
TENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Ubiquitin-like protein SMT3B
publication title Crystal structures of the human SUMO-2 protein at 1.6 A and 1.2 A resolution: implication on the functional differences of SUMO proteins
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2004-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wm2A00
2CKHB 2KX3A 1ZGUB 4ZRJA 3VAWA 2IO1B 1XD3B 2K8HA 4MGKE 2KD0A 4GU2A 1V86A 2IZVB 4ICUA 2JZ3B 3UIOB 3ZLZA 2KKCA 4IG7B 4W9JA 2NPTA 3JVZX 1YJ1A 3NS8A 4KV2A 1GJZA 3K9PB 3A1QA 5IAAC 4OVVA 1R4MI 3PVLA 1WGDA 2KX0A 5FR6A 3VVWB 4B95A 3DPDA 2ZVNA 2XK5A 1SIFA 2LJ5A 3ZO5B 3RULA 2KQSA 1SE9A 4DBGA 2CHZA 3IHPC 1L7YA 4AP4C 3D32A 2O2VA 2MBQA 2JY6A 1WRDB 3AULA 3I3TB 1V9JA 2D3GA 3RZWC 4MSMB 4W9GA 4URKA 2ZNVC 5DPWA 4DDID 2KTFA 2GOWA 2ZEQA 5G55A 3QJZA 3A9JA 2HTHA 1WJUA 2CR5A 4HWIB 5CTRC 1WM2A 1WX9A 3H1UA 4K7WA 4P7IA 3L13A 2FIFA 5DCNA 3TBLD 4KDIC 1V5TA 1I35A 1GC6A 3S2AA 2HJ8A 4IC7B 1TGZB 1KLVA 2BYFA 1E5WA 3ZDMC 1NI2A 3A9KB 4ANVA 3R7QA 1PQSA 4HCPB 4M8MA 4W9DA 3SHQA 4PS8A 2KTRA 3V6CB 4WWNA 3A4SC 1WX8A 2HD5B 2LXCA 3DBLI 4JLCA 1OEYJ 2BYEA 1NBFC 4IM2A 2KZRA 3V6EB 2G3QB 3JSVB 4HVBA 4ZRIA 3DVNV 4ZYNA 2KFJA 2J0JA 2K1FA 2PE9A 3HK0A 2BGFA 2MBBB 4GOCA 2FNJB 2KFKB 4W9KA 2L0FA 1P98A 2KVRA 1WIAA 1RRBA 5JHBA 2K8CA 2CHXA 4KZCA 4TQ1A 4ZRKA 3H7PB 2ZPNA 2M17A 2MBOA 4W9EA 2L8JA 1WJ6A 3HM3A 1EF5A 2BYVE 3HHMA 4GDKA 4E3CA 4MSQB 1S3SG 4G50A 4GDLB 2J0MA 3RT3B 2KQ7A 4X57B 4M0WB 1MG8A 2C7HA 4HDQA 4DWFA 2KK8A 5AZGA 4PYUA 3L16A 2VRRB 3DQVA 4IW0A 3V60A 2R2OA 3QC8B 5IA7A 2DAJA 2IO0B 5GMVA 2DZJA 3PSEB 3WANA 3EECA 2C9WB 3M95A 2FCNA 3OJ3A 1HE8A 1TZ1A 3NOBA 1WZ0A 3ZTDA 3GZNI 2N9EB 4NJ7A 3PRPB 2BWFA 2L3ZA 1WMHA 1WYWB 4HXDA 4WJNA 2KLCA 5D6JB 1IYFA 4KIKB 3KYCD 1E90A 3QWZB 4TQ0A 1H4RA 2ASQA 2JRHA 1V2YA 1F9JA 4G11A 4HCNB 3RYTA 4FBJB 3VTUA 5J2RA 2AEHA 1C3TA 2FCMA 3UIPB 2QHOA 2LI5A 3QIJA 2AWTA 2WX0A 5HKHA 3NHEB 2MP2A 2DHZA 2LVQA 3AI5A 3DBHI 3PT2B 4JQWC 4NAWA 2LGYA 2WDTB 3KUCB 4EZJA 1IPGA 3NZUA 2IY1B 2JXXA 3DBSA 3MHSD 2N9XA 2IO3B 2NVUI 1VCBA 3VUXA 4F7ZA 4CHKA 3PV1A 4LCDE 3TCAA 2RPQA 1LQBA 4FHJA 3KUDB 2ZPYA 3W1YA 1NDDA 2CS4A 4MEMA 4RM8A 4CO7A 1WI0A 3DVNU 3ZNID 4EOYA 5CHFA 3OAWA 1VD2A 1RLFA 4IUMB 4A3PA 2C7MB 1KOTA 2L76A 4KZ0A 5AEKB 2MRPA 4WJOA 3X0WA 2PPHA 4EUTA 2IBIB 3JW0X 3VHTC 3L10B 2NCNA 2XK5B 3W1SA 2ZNVB 4B6WA 3B1LX 2KJHB 1J8CA 3ZNZB 3NZSA 1AARA 3DBRI 3K9OB 4JGHB 2DYBA 4W9HA 3IFWB 4OVUA 3ZNHB 1UGMA 5L95C 4KDLB 2JT4B 3UGBB 2Z0EB 2Z0DB 4G3XB 3EC8A 2O2VB 3CSFA 3QK0A 4LJOB 3ZUNA 2JRIB 1KM7A 2M4NA 2MSED 3V61A 4BKTA 4WQOB 2GBNA 3L17A 5J18A 5D94A 5JHAA 5EDSA 4HPMB 1YQBA 2M1MA 5E6OA 1UELA 2O6VB 4PYZA 3SU8X 5LXIB 1WF9A 2G45B 4LJPB 3L54A 3LDZE 2DZMA 2J7QB 4MJSB 3MJWA 1YX5B 2GBJA 4BFRA 2AL3A 4KVGB 2KDBA 2KO3A 3UINB 2MBEA 3O65B 1E8WA 2ZJDA 2KXJA 1OQYA 2BWES 2FCSA 3VTWA 3VDZA 1UD7A 2FCQA 1Q0WB 1C1YB 1WGYA 4WWPA 4NQKE 1J0GA 2D10A 3DVGY 4MH0E 1G6JA 2M0XA 4A20A 4ANUA 4MM3A 2V4LA 3TJPA 2K39A 4XX5A 4YL8A 1WJ4A 3VH4B 3DOWA 4HLEA 2LASA 3BINA 3PLVA 1R4NI 2GBMA 2JVCA 3CMMB 4MGIE 4I6PA 1IP9A 3QQ8B 2OOBB 3CF6E 4TUUA 1ZW7A 2L00B 3N32A 2PE6B 3PRZA 1UBIA 3QARA 2YLMA 2L05A 4AOFA 1CMXB 2NR2A 1E7VA 4GSWA 1WR1A 4FJZA 3APCA 3ML9A 4WJPA 4MDKE 4GMVA 4N9F4 1P9DU 1OGWA 5LLIA 2KMAA 3DVGX 4ANXA 4CYEA 3ECIA 2N1VA 3U8ZA 3APDA 5DPTA 2LUEA 2N1WA 3JSVA 3QX1A 5D2MB 1I42A 1WXSA 2BKFA 5G2NA 3AXCA 2KFKA 3P2BA 2D11A 1E8XA 2KHWB 2NBUA 4KSLC 1WFYA 3DCGA 2MW5A 4I6LB 1WE7A 3H7PA 2C5LC 3OJ4B 4MGYE 3ZIMA 3ZVVA 4DK5A 3HM6X 3ZRFA 1U4AA 1X1MA 3SDLC 2WYQA 4TKNA 5TR5A 2CU1A 4ANWA 3VTVA 3RCZA 4EZLA 4NQLB 1LM8B 4WWOA 1WJNA 2O6VD 1RAXA 1WZ3A 2IYDB 3JYUA 5L83A 1GUAB 2GBKA 2WX1A 3KH0A 5J17A 1WH3A 2KDFB 3A4RA 1WGGA 1WMHB 1WE6A 4K7UA 5LXHA 4JIOU 1V81A 1RFAA 3IG3A 4F8CB 2G4SA 4NY0A 3IVFA 4FULA 3PRMB 4E74A 3T8MA 4HDOA 2DYMA 2Z59B 1WGHA 2LRWA 2ZZPB 2LRUA 1P0RA 2DYOA 2Y5BB 4IWOA 3KW5B 4FHKA 3QHTA 5CHWA 2LD9A 3IBEA 3VUYA 2MP2B 3WAOA 1UZXB 2BF8B 3RD2A 2NBWB 4BOZB 1EF1A 1WY8A 5C23A 1GNUA 1FXTB 2AL6A 4FLHA 3TL5A 3M3JA 3H7SA 4GIVA 5KHOA 3PTFC 4MELA 3PHWB 1M94A 2NPTB 1ZKHA 1V5OA 2KWUB 2G4DB 3VXWA 4XC2A 3A1QB 2PJHA 3ZDTA 2MWSB 1XT9B 4J6IA 3VH3B 5E6PA 2LGDA 4RM9A 3V62A 2L7RA 4GN1A 4I6NB 5D7GA 1V49A 1XQQA 2KNBA 1OTRB 3PLUA 1K8RB 3UF8A 4EKUA 1E7UA 1WM3A 2FUHB 3X23A 2KLGA 4FN2A 4BVUC 2MBHA 2K8BA 1GG3A 1T0YA 2REXA 4W9FA 2I1KA 1LXDA 4FJVB 4BOSC 2DENB 2GBRA 3ALBA 4WAAA 2JUOA 4BKGA 5JZEB 4NNJB 2MA9B 1L2NA 4IWQA 2GMIC 4ZDVA 5DPRA 4AJYB 5E6NA 2YVCA 1V80A 3N3KB 4MGZE 3WA0A 3W1SC 2DX5B 2DAFA 2DZIA 3A9JB 3ZRCA 2BPSA 2R2QA 2MX2A 3EHVA 3WALA 2N7EA 5CHVC 3KUZA 1EUVB 3TIXA 3AU5A 4LDTB 3R7RA 1LFDA 2NS5A 1TBEA 3APFA 3L0WB 3PPAA 4ICVA 3NY5A 1YIWA 2V1YA 3R3MA 3T9LA 3UQBA 4BKSD 1EO6A 2LXAA 2NBVB 2V3SA 4NPNA 4PS3A 3KYDD 4G0NB 5BO4B 2RR9A 2KDIA 3H6NA 1BT0A 3ZW3A 2KJRA 2KWVB 5AZHA 4BBNC 2LGXA 4W9IA 2C7NB 3WIMA 4DHJB 2O6VA 3PHXB 1Z5SB 2D07B 2KTRB 4MJSA 2EMTA 4M8NA 3ML8A 4II3B 2JZZA 3L08A 4NJ6A 2LWPA 2PEAA 2IO2B 5DPSA 4DXAB 3B0AA 3HIZA 4RMAA 3EFUA 2JPHA 1V6EA 3A9KA 2N7DA 2OJRA 4B9KA 1UH6A 2ZCBA 4IM3A 4K81A 1S1QB 1YD8U 4HJKA 2UYZB 2CHWA 2KC1A 3U30A 4EZKA 1Q5WB 2RGFA 3DDCB 3PREA 4K7SA 4GXBA 3ENEA 4W9LA 1WX7A 1WGRA 2EKEC 2B3AA 3AU4A 3GOEA 3R66C 4GB9A 4FJYA 4IM0A 3H9DA 3UQAA 2K6QA 4II2B 4GDKB 4AWJA 3RUIB 3KVFB 4W9CA 2MQJA 2AYOB 2RD0A 3M62B 2DZKA 2A4ZA 4WJQA 3BY4B 2XBBC 4E71A 2EMSA 2WWZA 3TMPB 1H8CA 3QA8A 1A5RA 4EFOA 3VUWA 4F1SA 1TTNA 1OEYA 2KJ6A 2K6DB 3WAPA 5CX3A 1P1AA 1YX6B 2L0TA 3ZNGC 3LJ3A 1SGHA 4GDLA 1E8YA 2N4FA 2N9PC 1Q1OA 3MTNB 3QCAA 2LVPA 2KOXA 4ASWC 2JF5A 2XEWA 5KHQA 2A5UA 2MCNB 1Y8RC 2UWQA 3A33B 1WXVA 2RSUA 3B08A 3M63B 4LDTD 2J0KA 1ISNA 3QAQA 2I1JA 2LZ6A 4K1RB 4KSKC 4PS7A 3OLMD 4A3OA 2HE7A 4DHZE 2KMCA 4HK2A 2W9NA 3ZTCA 2KANA 2JWZA 2KN5A 1D3ZA 4IWPA 1Z2MA 2LVOA 4DHJD 4TV3A 1JRUA 3PGEA 4XZ4A 4HPLB 3ONSA 2KWCA 4NAWB 1P3QU 1WXAA 4AJWA 4FADA 2K25A 2IY0B 1E8ZA 1UBQA 2KDEB 2MLBA 4EEWA 4FA6A 4KIKA 3VFKA 4DDGD 3RZFA 2M8SA 3N30A 1WXMA 5C1ZA 2ZVOA 2FIDA 2FAZA 3Q3JA 3PS6A 4GGQA 2ZCCA 4BKSA 1QZEA 2KC2A 2D2QA 1WR6E 3PZDA 3U7DA 3ZKJC 3VQIA 4AUQC 1KJTA 2BKRB 3C0RB 4JL9A 3SD5A 5AZFA 3WAMA 3Q3FA 1GC7A 4BBNF 5JH5C 4DHZB 3CSTA 1J19A 2C60A
chains in the Genus database with same CATH superfamily
1VZ7A 1XD3B 3C8YA 1QOGA 3IT6B 3ZLZA 3UIOB 3GZNB 3IT4B 2KKCA 2NPTA 3NS8A 3ZXRA 2J53A 3MFGA 1TIFA 1TYGB 1R4MI 4NJCA 1T0QC 3AEFB 2ZVNA 1JWBD 3TEWA 2WXQA 4Q2JA 2QMTA 2V3PA 1KH0A 2O2VA 4C56C 1WRDB 5AUIA 1SSNA 3AE2B 3RZWC 2IGDA 4W9GA 4ARIA 1NENB 4MM3B 2KTFA 2GOWA 2ZEQA 5G55A 1WJUA 2CR5A 5EE1A 3H1UA 4XGAB 3TBLD 4ZRQA 2HJ8A 1IGDA 2LGIA 3ZDMC 1PQSA 4HCPB 4S0RA 3DBRB 1WX8A 4JLCA 4YSXB 1OEYJ 2KZRA 4HVBA 3BVGA 2J52A 2WXIA 2J0JA 2PE9A 1GPXA 2BGFA 2MBBB 2KFKB 4W9KA 2KVRA 4L23A 3CIRB 1L4DB 2YEPF 3AE6B 4O1NA 1EF5A 4E3CA 1S3SG 2OHFA 2J0MA 1BMLC 2KQ7A 1XLQA 4X57B 1MG8A 2C7HA 4DWFA 4JE3B 2KK8A 4PYUA 2VRRB 3DQVA 1R4NB 1VZ6A 3V60A 5IA7A 3Q2AC 3MC0B 3SFDB 2IO0B 2L1AA 3WANA 2C9WB 3M95A 3P63A 3GZNI 4OZCA 1V1PA 4WJNA 3V3XA 3MJ5A 3QWZB 2JZPA 3RYTA 3EGRA 4A9AA 3HRDD 3QIJA 2WX0A 2DHZA 1E6EB 3DBHI 3NVWA 4NAWA 4XDCA 5H8YE 1L4ZB 2IDYA 1IPGA 4JWUC 1TS2A 2NVUI 4LNOA 4LCDE 4R3DA 3TCAA 2RPQA 4C7YA 3W1YA 2ZPYA 4TMAB 4RM8A 4CO7A 5BYSA 3ZNID 3OAWA 1VD2A 1RLFA 4IUMB 1JALA 2MRPA 2EELA 2X38A 1V1OA 2PPHA 2NTSA 3JW0X 3L10B 2XK5B 2ZNVB 4RNAA 2N7JA 4YSYB 3AV8A 1L0VB 4C00A 1AARA 3DBRI 1SXTA 4W9HA 2DYBA 3Q3NC 4KDLB 4G3XB 1D6EC 5J18A 3LYYA 5EDSA 2BB6A 2M1MA 1UELA 3SU8X 3OWEB 3L54A 2DZMA 1YX5B 2GBJA 4KVGB 1AW7A 2MBEA 1GOZA 2ZJDA 4WWPA 3ZJUA 1RYJA 2VH2A 4J3OD 1MFWA 2M0XA 4YXDB 2V3NA 1B1ZA 1WJ4A 1SJHD 2JQRB 4HLEA 3PLVA 1R4NI 2JVCA 2OOBB 3CF6E 1PGBA 4AOFA 3ML9A 1P9DU 1UWXA 2KMAA 4CYEA 3JSVA 3QX1A 4LNKA 2BKFA 5G2NA 1HZ5A 2ACZB 2W54A 3Q8CA 2NBUA 3GE3C 2GI9A 2AQ1B 3H7PA 3OJ4B 3P4SB 2J42A 1U4AA 1X1MA 4RCOA 1OFFA 4EZLA 1LM8B 2W3SA 3JYUA 5L83A 2EKIA 5J17A 3A4RA 1CZPA 1VR9A 1WMHB 1WE6A 4K7UA 1EU4A 2G4SA 1JW9D 1YN3A 2K5PA 4KGTA 1WGHA 2ZZPB 1UF0A 2Y5BB 2Y5CA 2I2YA 5CHWA 2LD9A 2WXJA 1WRIA 2MP2B 3WAOA 4C7ZA 2ON8A 2ZW0A 2Q5WD 3DWGC 1I4GA 1FXTB 1C76A 3M3JA 3H7SA 1F0ZA 5KHOA 4LLGM 3PHWB 1FNWA 3RNFC 2NPTB 1V5OA 2MWSB 1XT9B 4J6IA 2FBWB 1V8CA 5IO9A 5D7GA 1ZP0B 1V49A 1K8RB 4EKUA 4LK0M 4WIPA 1CQVA 2DENB 2GBRA 3ALBA 5EE9A 1PFDA 1DOYA 2JUOA 4KKJA 2AX5A 1FFUA 1L2NA 4IWQA 2GMIC 1FFVA 4ZDVA 4AJYB 2BW2A 5E6NA 3W1SC 2DX5B 3RNAC 2DAFA 4TSSA 2R2QA 2MX2A 2PTLA 3PZ8A 3AU5A 3Q8EA 2NS5A 4ICVA 3NY5A 4ZHPA 3T9LA 3ZW3A 3SR6A 4OHJA 2LGXA 4W9IA 2O6VA 4BAXA 4LNNA 4MJSA 2LFIA 2XN9C 3UI3A 1DYQA 3NVYA 4M8NA 2JZZA 4AS1A 5I4DA 1T3QA 5DPSA 2JX5A 3EFUA 4IM3A 1S1QB 2KC1A 4EZKA 2RGFA 3DDCB 1AYFA 3ENEA 4W9LA 3R66C 4DXFA 4IM0A 3H9DA 2K6QA 2DLBA 3KVFB 2MQJA 3AE1B 3M62B 1JRPA 2A4ZA 3VR8B 3Q3MC 1C4AA 3GP7A 4E71A 1H8CA 3QA8A 1BUIC 3WAPA 4A90A 1P1AA 2OEDA 4YTNB 2L0TA 4RGNA 4B0MA 2BS4B 2WXMA 3QCAA 1Q1OA 2BT6A 2BVCA 4IOIE 1UUPA 5FK9C 2MCNB 3B08A 2G1EA 1NYRA 3QAQA 4PS7A 5BMGA 1SBBB 2KN5A 1K53A 1Z2MA 2NMQA 1IUEA 4DHJD 3PGEA 4P1CC 4NAWB 4AJWA 1GAQB 3VFKA 3N30A 1WXMA 4XDDA 3E56A 2L32A 3Q3JA 3KQ4A 2WXGA 2ZCCA 3TUOA 4BKSA 1STEA 1WR6E 3PZDA 2MJEA 2WLBA 3U7DA 3ZKJC 1I4PA 1I4QA 1T5XD 3CSTA 1J19A 1ZGUB 4MGKE 1I4HA 4HPPA 4ICUA 2WXFA 3K9PB 1P7EA 1F2RI 3N9YC 1ESFA 4OVVA 2KX0A 3VVWB 5FR6A 2D3AA 1GB4A 2JYTA 1YN5A 1L6VA 2XK5A 1SIFA 1ZXIA 2LJ5A 3ZO5B 3RULA 4DBGA 2CHZA 3IHPC 1SE4A 3D32A 1FO4A 2MBQA 3Q69A 3TEZA 3AULA 3I3TB 3PZ7A 2D3GA 4WWMA 4URKA 2ZNVC 5DPWA 5EE3A 3H8HA 5CTRC 3ABVB 2WGSA 2DWQA 1I35A 3NUHB 3S2AA 4IC7B 2BYFA 1KLUD 1E5WA 1NI2A 5HI1A 4W9DA 1KF6B 4PS8A 2LXCA 2BYEA 2PLPA 2RPVA 4IM2A 4M02A 3E9SA 3JSVB 4JWSC 3V6EB 4ZRIA 4ZYNA 4GOCA 4H2AA 1WIAA 1RRBA 3HVZA 2QSDA 2K8CA 4TQ1A 4ZRKA 2RDHA 3H7PB 2B76B 1I4XA 2M17A 1RFKA 2KWDA 4RGTA 1JMLA 3N20C 1E10A 3T3NA 1D5XC 4G50A 4GDLB 1YOVB 4HDQA 2LHDA 1P7FA 4P1BC 2AQ3B 5G5GA 3R8BA 2R2OA 2DAJA 3AH7A 5GMVA 2DZJA 3PSEB 2YEPB 1WZ0A 4NJ7A 3PRPB 1WMHA 1WYWB 4HXDA 5D6JB 1IYFA 1E90A 4TQ0A 1H4RA 2JRHA 4G11A 5J2RA 2FCMA 2QHOA 2AWTA 1I4RA 5HKHA 2MP2A 2IJ0A 2LGYA 3I57A 3NZUA 1N5XA 3VUXA 3URYA 4CHKA 1PYWD 3KWLA 5BMIA 4FHJA 3KUDB 2KQ4X 1NDDA 1TY2A 3U2SC 4EOYA 4NZLB 2C7MB 1CK1A 1L0YB 2PKOA 4KZ0A 2CJNA 2KYWA 4WJOA 3X0WA 3RI7C 4B6WA 2KJHB 3DBHB 3ZNZB 4JGHB 2BB5A 3ZNHB 3EC8A 1E7PB 3BK1A 5JHAA 3U7ZA 3AEDB 2O6VB 2G45B 2PW9A 1C4CA 4LJPB 4MJSB 4BFRA 2Y3AA 2AL3A 4AQ7A 3O65B 1OQYA 3VDZA 1WGYA 3NVVA 2KVZA 4NQKE 2V4IB 2KDMA 2WHIA 5IP4D 4ANUA 2WXHA 4XX5A 1UNSA 5FR3A 2LASA 4ZYSA 3AEGB 4I6PA 1ACCA 4XWWA 3R2IA 4ACFA 2L00B 5C2TB 3QARA 5EE0A 1CMXB 1E7VA 3Q6BA 4WJPA 1F77A 2TSSA 4GMVA 4ANXA 1F2RC 3APDA 3BYYB 2LUEA 1N62A 1I42A 3AEEB 3AXCA 3P1MA 2LGSA 3P2BA 5T8IA 2KHWB 1WFYA 2KMMA 5AUKA 2GLSA 1WE7A 1FEHA 2C5LC 4A6QA 3MC9A 2INCC 3ZIMA 3RN9C 4DK5A 3DHHC 2WYQA 4TKNA 3RNCC 4ANWA 3RCZA 5BYQA 1WJNA 1WZ3A 2GBKA 2WX1A 3KH0A 1WH3A 2KDFB 1V81A 1N5WA 2WXLA 4NY0A 1PGAA 4FULA 2D3CA 2V9HA 4PK1A 1XXGA 5BMHA 3KW5B 3VUYA 1UZXB 1HA5A 2BF8B 4WQMA 1QILA 4N6EB 3RD2A 1EF1A 1WY8A 5C23A 4MELA 1JWMD 1ZKHA 3VXWA 2G4DB 3Q14C 4XC2A 2MJDA 2PJHA 1T0RC 5E6PA 2L7RA 4I6NB 1XQQA 3PLUA 1E7UA 1WM3A 1LXDA 2W82A 1K50A 4US9A 5JZEB 2WQYB 4ITKA 4XE0A 1NEKB 2JYEA 2WXPA 3VRBB 4YWGG 2WP9B 3TEXA 2YVCA 2Z8LA 2WDVB 2DZIA 3MC8A 3ZRCA 2BPSA 3W5UB 4C4VA 4LNFA 3R7RA 4LDTB 3APFA 3L0WB 2V1YA 3R3MA 1QF6A 1EO6A 2NBVB 4NPNA 3KYDD 2RR9A 1BT0A 5AZHA 1VLBA 3PHXB 1Z5SB 2D07B 2INPE 2K3UA 3BVMA 3EUB2 3ML8A 2G9HD 3AB5A 4NJ6A 2IO2B 4DXAB 3HIZA 2JPHA 3SEBA 2NTTA 4B9KA 1UH6A 2ZCBA 1YD8U 2PIAA 1L0XB 3P4QB 2UYZB 2CHWA 2V0GA 4GB9A 3AU4A 3I9V1 1Q10A 4PT5A 3UQAA 1R7SA 4AWJA 1FM0D 4W9CA 2AYOB 4RFBA 1QOAA 4F1SA 1TTNA 2K6DB 4XYCA 1YX6B 1XCQL 1MJDA 2QCZA 3LJ3A 4GDLA 1Y56A 4LTUA 2VZKB 2N4FA 5IOIA 4ASWC 2KOXA 5KHQA 2A5UA 1Y8RC 2UWQA 3M63B 2ZW1A 1FCCC 1ISNA 3VRAB 2I1JA 4KSKC 3OLMD 2KMCA 3ZTCA 3BK2A 4YT0B 1D5ZC 3AE8B 1K51A 3ZQ4A 2BS2B 4HPLB 2KWCA 1WXAA 2N9LA 2KT7A 2MLBA 4FA6A 5C1ZA 3ETRA 1OQQA 2FIDA 1EWYC 1NYQA 5AZFA 4BBNF 2C60A 2CKHB 3VAWA 1E9MA 1PUTA 2IO1B 2K8HA 2IZVB 3T3OA 1HEZE 2BS3B 2JZ3B 4IG7B 3JVZX 1TZOA 4KV2A 1GJZA 3VR9B 3A1QA 2BYTA 1WGDA 1SE3A 4B95A 3DPDA 3P4PB 5HFYA 2KQSA 1SE9A 2LUMA 2JSVX 1N63A 1YNTE 1L7YA 1YQ3B 2I38A 1V9JA 3U52E 2BTEA 4MSMB 4DDID 2Y5PA 2D3BA 1WX9A 2FIFA 4KDIC 2WS3B 1FRDA 1GC6A 4HRSA 4P6VF 1KLVA 4ANVA 3A9KB 3R7QA 3SHQA 2UU7A 4WWNA 3IAM1 4N59A 2HD5B 2L83A 3AMZA 2G3QB 2QIEB 1J7BA 3CWIA 3HVDA 3IAS1 3I63C 1E0ZA 2KFJA 4WH4A 2K1FA 3HK0A 2FNJB 1DGJA 1C4PA 1F52A 1ZXHA 2CHXA 1DOIA 4KZCA 1XLPA 1QOFA 1WJ6A 3EA6A 4KKIA 3AN1A 4UDUC 1DOXA 3BVZA 3RT3B 1UGJA 2WXKA 5AZGA 3BYTB 2FCNA 3OJ3A 1WXQA 4IDIA 1HE8A 1TZ1A 3NOBA 3ZTDA 2N9EB 2L3ZA 2MH7A 1KTKA 2KLCA 4REZA 2WDQB 4KGSA 1ZDVA 1ZPSA 2ASQA 1V2YA 3Q8FA 3RMKC 1F9JA 3N1YC 2JXTA 1C3TA 3UIPB 1B9RA 2LI5A 1HTOA 3NHEB 3PT2B 3AI5A 2LVQA 3DHIC 3KUCB 4EZJA 3B9JA 2JXXA 1TT5B 2N9XA 1VCBA 4F7ZA 3PV1A 2RDGA 1LQBA 3AE7B 2WU5B 2CS4A 1ET9A 1WI0A 4A3PA 1KOTA 5AEKB 3AE3B 2HDEA 2IBIB 2N0SB 1J7AA 2NCNA 1TS3A 3GE8C 4HROA 2FE8A 2QJLA 3NZSA 5HG2A 4C4VB 2PVGC 4P16A 1MVKA 3IFWB 4JPSA 4OVUA 5L95C 2AQ2B 2JT4B 3UGBB 1CJEA 3QK0A 3CSFA 3ZUNA 3V61A 2M4NA 2MSED 4BKTA 4L2YA 2GBNA 2N9KA 4HPMB 5E6OA 1TY0A 2GB1A 2VH1A 1WF9A 3NG0A 5LXIB 3LDZE 1AN8A 3MJWA 2KO3A 2BWES 2FCSA 1C1YB 2DNFA 1J0GA 2D10A 3B2FA 3DVGY 4MH0E 2E3TA 1G6JA 1HZ6A 1N61A 2V4LA 2K39A 2SEBD 2H89B 4YL8A 4LNIA 4BZAA 3BINA 4IKGA 1WWTA 4C80A 1TS4A 2M56B 4MGIE 4WURA 1QLBB 1ZW7A 3N32A 1UBIA 2FUG1 2YLMA 2L05A 2NR2A 4GSWA 1WR1A 1RM6C 4FJZA 4MDKE 4WAFA 1JROA 4K3CA 1OGWA 4N9F4 3DVGX 2HJ1A 2ONQA 5DPTA 1IBXA 2INNE 3L4PA 2D11A 4KSLC 3DCGA 2BBCA 4MGYE 2OJWA 3ZVVA 3ZRFA 3SDLC 4OVZA 5TR5A 3DHGC 4NQLB 3RNGC 2O6VD 2IYDB 4A8XC 4M0WA 3KLSX 1EU3A 3BWUD 4JIOU 1RFAA 1FNUA 4F8CB 3ZYYX 4S17A 2ICIA 4HDOA 1KLGD 2LRWA 2DYOA 4IWOA 4FHKA 1EM7A 3QHTA 4HJGE 2PMVA 1V97A 2NBWB 4BOZB 3GB1A 3AEBB 4FLHA 4GIVA 1RWSA 2JU6X 1ZUD2 1M94A 4A55A 3A1QB 3ZDTA 2LHEA 3VH3B 1J7CA 1XLOA 2LGDA 4KGRA 4GN1A 2KNBA 5BYRA 1OTRB 3ZGZA 5D3IB 2FUHB 1TJEA 2KLGA 4FN2A 2MJ3A 2I1KA 1YN4A 4BOSC 2K0PA 3EFCA 1TKEA 4BKGA 4NNJB 5DPRA 1XEEA 4HEA1 4HKZE 1V80A 2DBYA 3N3KB 3NJTA 4EE2A 4US8A 4XWTA 2LMCA 3TIXA 1ZDXA 1EUVB 2KACA 1TBEA 3PPAA 2KN4A 1YIWA 4BKSD 2LXAA 4PS3A 4G0NB 2KDIA 2KWVB 3WIMA 1HQRD 3W9CB 1IGCA 1SB3C 3AE4B 3L08A 2HTME 1JWAD 4RMAA 3A9KA 2N7DA 2OJRA 1MG4A 4K81A 4HJKA 3P4RB 1Q5WB 4K7SA 4GXBA 1WX7A 3GOEA 1XCTL 4FJYA 4II2B 5E6JA 2RD0A 2JWUA 1UWMA 3BY4B 2EMSA 4USAA 1KFYB 1TKGA 1VZ8A 2KJ6A 3AM9A 3ZNGC 3FKYA 4DQOC 1E8YA 1VDVA 2XEWA 3DBLB 3A33B 4LDTD 2RSUA 2J0KA 4K1RB 4A3OA 2HE7A 4DHZE 4HK2A 2JWZA 1D3ZA 4IWPA 2LVOA 1FNVA 1P3QU 2QILA 2K25A 2IY0B 3SFEB 2KDEB 1C79A 2M8SA 5C3JB 2MEKA 4N58A 2FAZA 4GGQA 1I7HA 2KC2A 5JXVA 2INDC 1FIQA 3VQIA 4AUQC 2BKRB 1YMHE 3Q3FA 1GC7A 3Q8BA 3AEAB 2KX3A 2IGHA 4ZRJA 2KD0A 1LO5D 4GU2A 1V86A 1XO3A 4W9JA 1YJ1A 4OZAA 2WXNA 5IAAC 1NVID 3PVLA 1WSPA 2RDBC 1KRHA 3N1XC 3TSSA 2VZKD 1XLNA 3WCQA 3RNEC 4AP4C 1C77A 3ZXVA 2JY6A 1SIJA 3RNBC 3J9CA 2L52A 1ROEA 3NS1A 3QJZA 3A9JA 2HTHA 1GB1A 4HWIB 1WM2A 4K7WA 4P7IA 3L13A 4K3BA 5DCNA 1V5TA 1FXAA 1JQ4A 1QKZA 4RF1A 1TGZB 3ZJVA 1NI3A 2QDFA 3Q3OC 1YJJA 4M8MA 2KTRA 3V6CB 2GRIA 3A4SC 3DBLI 1IBXB 1JWSD 1NBFC 3DVNV 4QAYA 2K22A 2L0FA 1P98A 5JHBA 2E6XA 1HTQA 2PVOD 2ZPNA 2MBOA 4W9EA 2L8JA 1FPYA 3HM3A 2BYVE 3HHMA 4GDKA 4MSQB 2WU2B 4M0WB 1D4BA 3L16A 4IW0A 1SE2A 3B2GA 3QC8B 3EECA 2WDRB 3GS2A 4RH6A 3FILB 2BWFA 5H92C 4KIKB 3KYCD 2MHJA 2WXRA 4HCNB 4FBJB 3VTUA 1WYGA 2AEHA 5IN7A 1MHXA 1N60A 4JQWC 2WDTB 4CQNA 4RGOS 3AE5B 2IY1B 3DBSA 3MHSD 2IO3B 1F1HA 3O13A 4L1BA 4MEMA 4KX6B 3DVNU 5CHFA 5D3DA 1L5PA 1MI0A 1ENFA 2L76A 4EUTA 3VHTC 3W1SA 3B1LX 1J8CA 4NAMA 3K9OB 1WGKA 4ZOHC 1UGMA 2M19A 2Z0EB 2Z0DB 4LJOB 2O2VB 2JRIB 1KM7A 4WQOB 3L17A 5D94A 1YQBA 4PYZA 4ZHOA 2BQQA 2J7QB 2KDBA 1FMAD 3UINB 3V05A 1E8WA 5FKAC 2KXJA 1C78A 4MT5A 3VTWA 1UD7A 2FCQA 1Q0WB 2WNMA 3IXSA 4A20A 3DWMA 4MM3A 1QQRA 3TJPA 5TSSA 3VH4B 3DOWA 1AWDA 4GLSC 2GBMA 3CMMB 1IP9A 4DXGA 3QQ8B 4TUUA 1MHHE 2PE6B 3PRZA 1D5MC 4YTPB 3APCA 1LGRA 2X8XX 5LLIA 4YSZB 1BXTA 3ECIA 1K52A 3LXFA 2N1VA 4RF0A 3U8ZA 2N1WA 1MPEA 4HKQA 5D2MB 5IKCM 1WXSA 4FXCA 2KFKA 4OZBA 1SJED 1E8XA 2QEJC 1FD6A 2MW5A 4I6LB 1VJKA 3HM6X 1XF5L 2CU1A 3VTVA 4WWOA 1RAXA 1FXIA 1GUAB 1V1PB 1WGGA 3FC4A 1A70A 3NRZA 4OW0A 5LXHA 3IG3A 3IVFA 3PRMB 4E74A 3T8MA 1ZE3D 2DYMA 2Z59B 3LB8C 3BIID 3FAHA 2LRUA 1P0RA 3R2TA 2J4XA 3IBEA 2SAKA 3Q8AA 2R61A 2KAJA 3HUIA 3ZJTA 1GNUA 2AL6A 5HHDG 3TL5A 3PTFC 1YJIA 2IPKD 1QOBA 1TS5A 2WXOA 3OG5A 1TKYA 2M0AA 2KWUB 5MPOA 4RM9A 3V62A 2H88B 3UF8A 2RMMA 3X23A 4BVUC 2MBHA 1GG3A 2K8BA 1M4VA 3BZDB 1T0YA 1T0SC 2QC8A 2REXA 4FJVB 4W9FA 4WAAA 3NVZA 3RPFC 1N6ZA 2MA9B 4D2KA 2LJIA 1L6UA 4MACA 1JCKB 1T6BX 4MGZE 3WA0A 2IGGA 3MP9A 3A9JB 3W2DA 3EHVA 3WALA 2N7EA 5CHVC 3KUZA 1LFDA 1OQRA 3UQBA 5BO4B 2V3SA 3TEYA 3H6NA 2KJRA 4BBNC 1EWCA 2C7NB 4DHJB 2KTRB 1SF0A 2EMTA 3NZ3A 4II3B 4MH8A 1R4MB 2LWPA 2PEAA 3B0AA 2LEKA 1V6EA 1FCLA 3U30A 5GXGB 3PREA 1C9FA 2EKEC 1WGRA 2B3AA 1FRRA 4GDKB 3RUIB 1HXYD 1YQ4B 1SEBD 4RGMA 2DZKA 4WJQA 2XBBC 2CU3A 2WWZA 3AE9B 3MHZA 3P42A 3TMPB 4EFOA 1A5RA 3VUWA 4YTMB 1JWUD 1OEYA 2K9XA 4ZRPA 5CX3A 2D5GA 4M00A 3PO0A 2W3RA 2W55A 2CJOA 1SGHA 2N9PC 3MTNB 1QT9A 2LVPA 1PDXA 2JF5A 4ARCA 5G5HA 1WXVA 3AECB 3W5VB 1VRAB 2XNAC 2LZ6A 3RFZB 3C19A 4B0EA 2W9NA 3N1ZC 2KANA 1PGXA 4TV3A 1JRUA 4XZ4A 3ONSA 4JX1C 3FILA 4FADA 1E8ZA 1UBQA 4EEWA 3U4EG 4KIKA 4DDGD 3RZFA 2ZVOA 3PS6A 1ET6A 1QZEA 3KWVA 2D2QA 1ZOYB 1KJTA 3C0RB 3I5JC 4JL9A 3SD5A 5LNK1 3WAMA 4M01A 5JH5C 4DHZB
chains in the Genus database with same CATH topology
2CKHB 2KX3A 1ZGUB 4ZRJA 3VAWA 2IO1B 1XD3B 2K8HA 4MGKE 2KD0A 4GU2A 1V86A 2IZVB 4ICUA 2JZ3B 3UIOB 3ZLZA 2KKCA 4IG7B 4W9JA 2NPTA 3JVZX 1YJ1A 3NS8A 4KV2A 1GJZA 3K9PB 3A1QA 5IAAC 4OVVA 1R4MI 3PVLA 1WGDA 2KX0A 5FR6A 3VVWB 4B95A 3DPDA 2ZVNA 2XK5A 1SIFA 2LJ5A 3ZO5B 3RULA 2KQSA 1SE9A 4DBGA 2CHZA 3IHPC 1L7YA 4AP4C 3D32A 2O2VA 2MBQA 2JY6A 1WRDB 3AULA 3I3TB 1V9JA 2D3GA 3RZWC 4MSMB 4W9GA 4URKA 2ZNVC 5DPWA 4DDID 2KTFA 2GOWA 2ZEQA 5G55A 3QJZA 3A9JA 2HTHA 1WJUA 2CR5A 4HWIB 5CTRC 1WM2A 1WX9A 3H1UA 4K7WA 4P7IA 3L13A 2FIFA 5DCNA 3TBLD 4KDIC 1V5TA 1I35A 1GC6A 3S2AA 2HJ8A 4IC7B 1TGZB 1KLVA 2BYFA 1E5WA 3ZDMC 1NI2A 3A9KB 4ANVA 3R7QA 1PQSA 4HCPB 4M8MA 4W9DA 3SHQA 4PS8A 2KTRA 3V6CB 4WWNA 3A4SC 1WX8A 2HD5B 2LXCA 3DBLI 4JLCA 1OEYJ 2BYEA 1NBFC 4IM2A 2KZRA 3V6EB 2G3QB 3JSVB 4HVBA 4ZRIA 3DVNV 4ZYNA 2KFJA 2J0JA 2K1FA 2PE9A 3HK0A 2BGFA 2MBBB 4GOCA 2FNJB 2KFKB 4W9KA 2L0FA 1P98A 2KVRA 1WIAA 1RRBA 5JHBA 2K8CA 2CHXA 4KZCA 4TQ1A 4ZRKA 3H7PB 2ZPNA 2M17A 2MBOA 4W9EA 2L8JA 1WJ6A 3HM3A 1EF5A 2BYVE 3HHMA 4GDKA 4E3CA 4MSQB 1S3SG 4G50A 4GDLB 2J0MA 3RT3B 2KQ7A 4X57B 4M0WB 1MG8A 2C7HA 4HDQA 4DWFA 2KK8A 5AZGA 4PYUA 3L16A 2VRRB 3DQVA 4IW0A 3V60A 2R2OA 3QC8B 5IA7A 2DAJA 2IO0B 5GMVA 2DZJA 3PSEB 3WANA 3EECA 2C9WB 3M95A 2FCNA 3OJ3A 1HE8A 1TZ1A 3NOBA 1WZ0A 3ZTDA 3GZNI 2N9EB 4NJ7A 3PRPB 2BWFA 2L3ZA 1WMHA 1WYWB 4HXDA 4WJNA 2KLCA 5D6JB 1IYFA 4KIKB 3KYCD 1E90A 3QWZB 4TQ0A 1H4RA 2ASQA 2JRHA 1V2YA 1F9JA 4G11A 4HCNB 3RYTA 4FBJB 3VTUA 5J2RA 2AEHA 1C3TA 2FCMA 3UIPB 2QHOA 2LI5A 3QIJA 2AWTA 2WX0A 5HKHA 3NHEB 2MP2A 2DHZA 2LVQA 3AI5A 3DBHI 3PT2B 4JQWC 4NAWA 2LGYA 2WDTB 3KUCB 4EZJA 1IPGA 3NZUA 2IY1B 2JXXA 3DBSA 3MHSD 2N9XA 2IO3B 2NVUI 1VCBA 3VUXA 4F7ZA 4CHKA 3PV1A 4LCDE 3TCAA 2RPQA 1LQBA 4FHJA 3KUDB 2ZPYA 3W1YA 1NDDA 2CS4A 4MEMA 4RM8A 4CO7A 1WI0A 3DVNU 3ZNID 4EOYA 5CHFA 3OAWA 1VD2A 1RLFA 4IUMB 4A3PA 2C7MB 1KOTA 2L76A 4KZ0A 5AEKB 2MRPA 4WJOA 3X0WA 2PPHA 4EUTA 2IBIB 3JW0X 3VHTC 3L10B 2NCNA 2XK5B 3W1SA 2ZNVB 4B6WA 3B1LX 2KJHB 1J8CA 3ZNZB 3NZSA 1AARA 3DBRI 3K9OB 4JGHB 2DYBA 4W9HA 3IFWB 4OVUA 3ZNHB 1UGMA 5L95C 4KDLB 2JT4B 3UGBB 2Z0EB 2Z0DB 4G3XB 3EC8A 2O2VB 3CSFA 3QK0A 4LJOB 3ZUNA 2JRIB 1KM7A 2M4NA 2MSED 3V61A 4BKTA 4WQOB 2GBNA 3L17A 5J18A 5D94A 5JHAA 5EDSA 4HPMB 1YQBA 2M1MA 5E6OA 1UELA 2O6VB 4PYZA 3SU8X 5LXIB 1WF9A 2G45B 4LJPB 3L54A 3LDZE 2DZMA 2J7QB 4MJSB 3MJWA 1YX5B 2GBJA 4BFRA 2AL3A 4KVGB 2KDBA 2KO3A 3UINB 2MBEA 3O65B 1E8WA 2ZJDA 2KXJA 1OQYA 2BWES 2FCSA 3VTWA 3VDZA 1UD7A 2FCQA 1Q0WB 1C1YB 1WGYA 4WWPA 4NQKE 1J0GA 2D10A 3DVGY 4MH0E 1G6JA 2M0XA 4A20A 4ANUA 4MM3A 2V4LA 3TJPA 2K39A 4XX5A 4YL8A 1WJ4A 3VH4B 3DOWA 4HLEA 2LASA 3BINA 3PLVA 1R4NI 2GBMA 2JVCA 3CMMB 4MGIE 4I6PA 1IP9A 3QQ8B 2OOBB 3CF6E 4TUUA 1ZW7A 2L00B 3N32A 2PE6B 3PRZA 1UBIA 3QARA 2YLMA 2L05A 4AOFA 1CMXB 2NR2A 1E7VA 4GSWA 1WR1A 4FJZA 3APCA 3ML9A 4WJPA 4MDKE 4GMVA 4N9F4 1P9DU 1OGWA 5LLIA 2KMAA 3DVGX 4ANXA 4CYEA 3ECIA 2N1VA 3U8ZA 3APDA 5DPTA 2LUEA 2N1WA 3JSVA 3QX1A 5D2MB 1I42A 1WXSA 2BKFA 5G2NA 3AXCA 2KFKA 3P2BA 2D11A 1E8XA 2KHWB 2NBUA 4KSLC 1WFYA 3DCGA 2MW5A 4I6LB 1WE7A 3H7PA 2C5LC 3OJ4B 4MGYE 3ZIMA 3ZVVA 4DK5A 3HM6X 3ZRFA 1U4AA 1X1MA 3SDLC 2WYQA 4TKNA 5TR5A 2CU1A 4ANWA 3VTVA 3RCZA 4EZLA 4NQLB 1LM8B 4WWOA 1WJNA 2O6VD 1RAXA 1WZ3A 2IYDB 3JYUA 5L83A 1GUAB 2GBKA 2WX1A 3KH0A 5J17A 1WH3A 2KDFB 3A4RA 1WGGA 1WMHB 1WE6A 4K7UA 5LXHA 4JIOU 1V81A 1RFAA 3IG3A 4F8CB 2G4SA 4NY0A 3IVFA 4FULA 3PRMB 4E74A 3T8MA 4HDOA 2DYMA 2Z59B 1WGHA 2LRWA 2ZZPB 2LRUA 1P0RA 2DYOA 2Y5BB 4IWOA 3KW5B 4FHKA 3QHTA 5CHWA 2LD9A 3IBEA 3VUYA 2MP2B 3WAOA 1UZXB 2BF8B 3RD2A 2NBWB 4BOZB 1EF1A 1WY8A 5C23A 1GNUA 1FXTB 2AL6A 4FLHA 3TL5A 3M3JA 3H7SA 4GIVA 5KHOA 3PTFC 4MELA 3PHWB 1M94A 2NPTB 1ZKHA 1V5OA 2KWUB 2G4DB 3VXWA 4XC2A 3A1QB 2PJHA 3ZDTA 2MWSB 1XT9B 4J6IA 3VH3B 5E6PA 2LGDA 4RM9A 3V62A 2L7RA 4GN1A 4I6NB 5D7GA 1V49A 1XQQA 2KNBA 1OTRB 3PLUA 1K8RB 3UF8A 4EKUA 1E7UA 1WM3A 2FUHB 3X23A 2KLGA 4FN2A 4BVUC 2MBHA 2K8BA 1GG3A 1T0YA 2REXA 4W9FA 2I1KA 1LXDA 4FJVB 4BOSC 2DENB 2GBRA 3ALBA 4WAAA 2JUOA 4BKGA 5JZEB 4NNJB 2MA9B 1L2NA 4IWQA 2GMIC 4ZDVA 5DPRA 4AJYB 5E6NA 2YVCA 1V80A 3N3KB 4MGZE 3WA0A 3W1SC 2DX5B 2DAFA 2DZIA 3A9JB 3ZRCA 2BPSA 2R2QA 2MX2A 3EHVA 3WALA 2N7EA 5CHVC 3KUZA 1EUVB 3TIXA 3AU5A 4LDTB 3R7RA 1LFDA 2NS5A 1TBEA 3APFA 3L0WB 3PPAA 4ICVA 3NY5A 1YIWA 2V1YA 3R3MA 3T9LA 3UQBA 4BKSD 1EO6A 2LXAA 2NBVB 2V3SA 4NPNA 4PS3A 3KYDD 4G0NB 5BO4B 2RR9A 2KDIA 3H6NA 1BT0A 3ZW3A 2KJRA 2KWVB 5AZHA 4BBNC 2LGXA 4W9IA 2C7NB 3WIMA 4DHJB 2O6VA 3PHXB 1Z5SB 2D07B 2KTRB 4MJSA 2EMTA 4M8NA 3ML8A 4II3B 2JZZA 3L08A 4NJ6A 2LWPA 2PEAA 2IO2B 5DPSA 4DXAB 3B0AA 3HIZA 4RMAA 3EFUA 2JPHA 1V6EA 3A9KA 2N7DA 2OJRA 4B9KA 1UH6A 2ZCBA 4IM3A 4K81A 1S1QB 1YD8U 4HJKA 2UYZB 2CHWA 2KC1A 3U30A 4EZKA 1Q5WB 2RGFA 3DDCB 3PREA 4K7SA 4GXBA 3ENEA 4W9LA 1WX7A 1WGRA 2EKEC 2B3AA 3AU4A 3GOEA 3R66C 4GB9A 4FJYA 4IM0A 3H9DA 3UQAA 2K6QA 4II2B 4GDKB 4AWJA 3RUIB 3KVFB 4W9CA 2MQJA 2AYOB 2RD0A 3M62B 2DZKA 2A4ZA 4WJQA 3BY4B 2XBBC 4E71A 2EMSA 2WWZA 3TMPB 1H8CA 3QA8A 1A5RA 4EFOA 3VUWA 4F1SA 1TTNA 1OEYA 2KJ6A 2K6DB 3WAPA 5CX3A 1P1AA 1YX6B 2L0TA 3ZNGC 3LJ3A 1SGHA 4GDLA 1E8YA 2N4FA 2N9PC 1Q1OA 3MTNB 3QCAA 2LVPA 2KOXA 4ASWC 2JF5A 2XEWA 5KHQA 2A5UA 2MCNB 1Y8RC 2UWQA 3A33B 1WXVA 2RSUA 3B08A 3M63B 4LDTD 2J0KA 1ISNA 3QAQA 2I1JA 2LZ6A 4K1RB 4KSKC 4PS7A 3OLMD 4A3OA 2HE7A 4DHZE 2KMCA 4HK2A 2W9NA 3ZTCA 2KANA 2JWZA 2KN5A 1D3ZA 4IWPA 1Z2MA 2LVOA 4DHJD 4TV3A 1JRUA 3PGEA 4XZ4A 4HPLB 3ONSA 2KWCA 4NAWB 1P3QU 1WXAA 4AJWA 4FADA 2K25A 2IY0B 1E8ZA 1UBQA 2KDEB 2MLBA 4EEWA 4FA6A 4KIKA 3VFKA 4DDGD 3RZFA 2M8SA 3N30A 1WXMA 5C1ZA 2ZVOA 2FIDA 2FAZA 3Q3JA 3PS6A 4GGQA 2ZCCA 4BKSA 1QZEA 2KC2A 2D2QA 1WR6E 3PZDA 3U7DA 3ZKJC 3VQIA 4AUQC 1KJTA 2BKRB 3C0RB 4JL9A 3SD5A 5AZFA 3WAMA 3Q3FA 1GC7A 4BBNF 5JH5C 4DHZB 3CSTA 1J19A 2C60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CKH B;  2KX3 A;  1ZGU B;  4ZRJ A;  3VAW A;  2IO1 B;  1XD3 B;  2K8H A;  4MGK E;  2KD0 A;  4GU2 A;  1V86 A;  2IZV B;  4ICU A;  2JZ3 B;  3UIO B;  3ZLZ A;  2KKC A;  4IG7 B;  4W9J A;  2NPT A;  3JVZ X;  1YJ1 A;  3NS8 A;  4KV2 A;  1GJZ A;  3K9P B;  3A1Q A;  5IAA C;  4OVV A;  1R4M I;  3PVL A;  1WGD A;  2KX0 A;  5FR6 A;  3VVW B;  4B95 A;  3DPD A;  2ZVN A;  2XK5 A;  1SIF A;  2LJ5 A;  3ZO5 B;  3RUL A;  2KQS A;  1SE9 A;  4DBG A;  2CHZ A;  3IHP C;  1L7Y A;  4AP4 C;  3D32 A;  2O2V A;  2MBQ A;  2JY6 A;  1WRD B;  3AUL A;  3I3T B;  1V9J A;  2D3G A;  3RZW C;  4MSM B;  4W9G A;  4URK A;  2ZNV C;  5DPW A;  4DDI D;  2KTF A;  2GOW A;  2ZEQ A;  5G55 A;  3QJZ A;  3A9J A;  2HTH A;  1WJU A;  2CR5 A;  4HWI B;  5CTR C;  1WM2 A;  1WX9 A;  3H1U A;  4K7W A;  4P7I A;  3L13 A;  2FIF A;  5DCN A;  3TBL D;  4KDI C;  1V5T A;  1I35 A;  1GC6 A;  3S2A A;  2HJ8 A;  4IC7 B;  1TGZ B;  1KLV A;  2BYF A;  1E5W A;  3ZDM C;  1NI2 A;  3A9K B;  4ANV A;  3R7Q A;  1PQS A;  4HCP B;  4M8M A;  4W9D A;  3SHQ A;  4PS8 A;  2KTR A;  3V6C B;  4WWN A;  3A4S C;  1WX8 A;  2HD5 B;  2LXC A;  3DBL I;  4JLC A;  1OEY J;  2BYE A;  1NBF C;  4IM2 A;  2KZR A;  3V6E B;  2G3Q B;  3JSV B;  4HVB A;  4ZRI A;  3DVN V;  4ZYN A;  2KFJ A;  2J0J A;  2K1F A;  2PE9 A;  3HK0 A;  2BGF A;  2MBB B;  4GOC A;  2FNJ B;  2KFK B;  4W9K A;  2L0F A;  1P98 A;  2KVR A;  1WIA A;  1RRB A;  5JHB A;  2K8C A;  2CHX A;  4KZC A;  4TQ1 A;  4ZRK A;  3H7P B;  2ZPN A;  2M17 A;  2MBO A;  4W9E A;  2L8J A;  1WJ6 A;  3HM3 A;  1EF5 A;  2BYV E;  3HHM A;  4GDK A;  4E3C A;  4MSQ B;  1S3S G;  4G50 A;  4GDL B;  2J0M A;  3RT3 B;  2KQ7 A;  4X57 B;  4M0W B;  1MG8 A;  2C7H A;  4HDQ A;  4DWF A;  2KK8 A;  5AZG A;  4PYU A;  3L16 A;  2VRR B;  3DQV A;  4IW0 A;  3V60 A;  2R2O A;  3QC8 B;  5IA7 A;  2DAJ A;  2IO0 B;  5GMV A;  2DZJ A;  3PSE B;  3WAN A;  3EEC A;  2C9W B;  3M95 A;  2FCN A;  3OJ3 A;  1HE8 A;  1TZ1 A;  3NOB A;  1WZ0 A;  3ZTD A;  3GZN I;  2N9E B;  4NJ7 A;  3PRP B;  2BWF A;  2L3Z A;  1WMH A;  1WYW B;  4HXD A;  4WJN A;  2KLC A;  5D6J B;  1IYF A;  4KIK B;  3KYC D;  1E90 A;  3QWZ B;  4TQ0 A;  1H4R A;  2ASQ A;  2JRH A;  1V2Y A;  1F9J A;  4G11 A;  4HCN B;  3RYT A;  4FBJ B;  3VTU A;  5J2R A;  2AEH A;  1C3T A;  2FCM A;  3UIP B;  2QHO A;  2LI5 A;  3QIJ A;  2AWT A;  2WX0 A;  5HKH A;  3NHE B;  2MP2 A;  2DHZ A;  2LVQ A;  3AI5 A;  3DBH I;  3PT2 B;  4JQW C;  4NAW A;  2LGY A;  2WDT B;  3KUC B;  4EZJ A;  1IPG A;  3NZU A;  2IY1 B;  2JXX A;  3DBS A;  3MHS D;  2N9X A;  2IO3 B;  2NVU I;  1VCB A;  3VUX A;  4F7Z A;  4CHK A;  3PV1 A;  4LCD E;  3TCA A;  2RPQ A;  1LQB A;  4FHJ A;  3KUD B;  2ZPY A;  3W1Y A;  1NDD A;  2CS4 A;  4MEM A;  4RM8 A;  4CO7 A;  1WI0 A;  3DVN U;  3ZNI D;  4EOY A;  5CHF A;  3OAW A;  1VD2 A;  1RLF A;  4IUM B;  4A3P A;  2C7M B;  1KOT A;  2L76 A;  4KZ0 A;  5AEK B;  2MRP A;  4WJO A;  3X0W A;  2PPH A;  4EUT A;  2IBI B;  3JW0 X;  3VHT C;  3L10 B;  2NCN A;  2XK5 B;  3W1S A;  2ZNV B;  4B6W A;  3B1L X;  2KJH B;  1J8C A;  3ZNZ B;  3NZS A;  1AAR A;  3DBR I;  3K9O B;  4JGH B;  2DYB A;  4W9H A;  3IFW B;  4OVU A;  3ZNH B;  1UGM A;  5L95 C;  4KDL B;  2JT4 B;  3UGB B;  2Z0E B;  2Z0D B;  4G3X B;  3EC8 A;  2O2V B;  3CSF A;  3QK0 A;  4LJO B;  3ZUN A;  2JRI B;  1KM7 A;  2M4N A;  2MSE D;  3V61 A;  4BKT A;  4WQO B;  2GBN A;  3L17 A;  5J18 A;  5D94 A;  5JHA A;  5EDS A;  4HPM B;  1YQB A;  2M1M A;  5E6O A;  1UEL A;  2O6V B;  4PYZ A;  3SU8 X;  5LXI B;  1WF9 A;  2G45 B;  4LJP B;  3L54 A;  3LDZ E;  2DZM A;  2J7Q B;  4MJS B;  3MJW A;  1YX5 B;  2GBJ A;  4BFR A;  2AL3 A;  4KVG B;  2KDB A;  2KO3 A;  3UIN B;  2MBE A;  3O65 B;  1E8W A;  2ZJD A;  2KXJ A;  1OQY A;  2BWE S;  2FCS A;  3VTW A;  3VDZ A;  1UD7 A;  2FCQ A;  1Q0W B;  1C1Y B;  1WGY A;  4WWP A;  4NQK E;  1J0G A;  2D10 A;  3DVG Y;  4MH0 E;  1G6J A;  2M0X A;  4A20 A;  4ANU A;  4MM3 A;  2V4L A;  3TJP A;  2K39 A;  4XX5 A;  4YL8 A;  1WJ4 A;  3VH4 B;  3DOW A;  4HLE A;  2LAS A;  3BIN A;  3PLV A;  1R4N I;  2GBM A;  2JVC A;  3CMM B;  4MGI E;  4I6P A;  1IP9 A;  3QQ8 B;  2OOB B;  3CF6 E;  4TUU A;  1ZW7 A;  2L00 B;  3N32 A;  2PE6 B;  3PRZ A;  1UBI A;  3QAR A;  2YLM A;  2L05 A;  4AOF A;  1CMX B;  2NR2 A;  1E7V A;  4GSW A;  1WR1 A;  4FJZ A;  3APC A;  3ML9 A;  4WJP A;  4MDK E;  4GMV A;  4N9F 4;  1P9D U;  1OGW A;  5LLI A;  2KMA A;  3DVG X;  4ANX A;  4CYE A;  3ECI A;  2N1V A;  3U8Z A;  3APD A;  5DPT A;  2LUE A;  2N1W A;  3JSV A;  3QX1 A;  5D2M B;  1I42 A;  1WXS A;  2BKF A;  5G2N A;  3AXC A;  2KFK A;  3P2B A;  2D11 A;  1E8X A;  2KHW B;  2NBU A;  4KSL C;  1WFY A;  3DCG A;  2MW5 A;  4I6L B;  1WE7 A;  3H7P A;  2C5L C;  3OJ4 B;  4MGY E;  3ZIM A;  3ZVV A;  4DK5 A;  3HM6 X;  3ZRF A;  1U4A A;  1X1M A;  3SDL C;  2WYQ A;  4TKN A;  5TR5 A;  2CU1 A;  4ANW A;  3VTV A;  3RCZ A;  4EZL A;  4NQL B;  1LM8 B;  4WWO A;  1WJN A;  2O6V D;  1RAX A;  1WZ3 A;  2IYD B;  3JYU A;  5L83 A;  1GUA B;  2GBK A;  2WX1 A;  3KH0 A;  5J17 A;  1WH3 A;  2KDF B;  3A4R A;  1WGG A;  1WMH B;  1WE6 A;  4K7U A;  5LXH A;  4JIO U;  1V81 A;  1RFA A;  3IG3 A;  4F8C B;  2G4S A;  4NY0 A;  3IVF A;  4FUL A;  3PRM B;  4E74 A;  3T8M A;  4HDO A;  2DYM A;  2Z59 B;  1WGH A;  2LRW A;  2ZZP B;  2LRU A;  1P0R A;  2DYO A;  2Y5B B;  4IWO A;  3KW5 B;  4FHK A;  3QHT A;  5CHW A;  2LD9 A;  3IBE A;  3VUY A;  2MP2 B;  3WAO A;  1UZX B;  2BF8 B;  3RD2 A;  2NBW B;  4BOZ B;  1EF1 A;  1WY8 A;  5C23 A;  1GNU A;  1FXT B;  2AL6 A;  4FLH A;  3TL5 A;  3M3J A;  3H7S A;  4GIV A;  5KHO A;  3PTF C;  4MEL A;  3PHW B;  1M94 A;  2NPT B;  1ZKH A;  1V5O A;  2KWU B;  2G4D B;  3VXW A;  4XC2 A;  3A1Q B;  2PJH A;  3ZDT A;  2MWS B;  1XT9 B;  4J6I A;  3VH3 B;  5E6P A;  2LGD A;  4RM9 A;  3V62 A;  2L7R A;  4GN1 A;  4I6N B;  5D7G A;  1V49 A;  1XQQ A;  2KNB A;  1OTR B;  3PLU A;  1K8R B;  3UF8 A;  4EKU A;  1E7U A;  1WM3 A;  2FUH B;  3X23 A;  2KLG A;  4FN2 A;  4BVU C;  2MBH A;  2K8B A;  1GG3 A;  1T0Y A;  2REX A;  4W9F A;  2I1K A;  1LXD A;  4FJV B;  4BOS C;  2DEN B;  2GBR A;  3ALB A;  4WAA A;  2JUO A;  4BKG A;  5JZE B;  4NNJ B;  2MA9 B;  1L2N A;  4IWQ A;  2GMI C;  4ZDV A;  5DPR A;  4AJY B;  5E6N A;  2YVC A;  1V80 A;  3N3K B;  4MGZ E;  3WA0 A;  3W1S C;  2DX5 B;  2DAF A;  2DZI A;  3A9J B;  3ZRC A;  2BPS A;  2R2Q A;  2MX2 A;  3EHV A;  3WAL A;  2N7E A;  5CHV C;  3KUZ A;  1EUV B;  3TIX A;  3AU5 A;  4LDT B;  3R7R A;  1LFD A;  2NS5 A;  1TBE A;  3APF A;  3L0W B;  3PPA A;  4ICV A;  3NY5 A;  1YIW A;  2V1Y A;  3R3M A;  3T9L A;  3UQB A;  4BKS D;  1EO6 A;  2LXA A;  2NBV B;  2V3S A;  4NPN A;  4PS3 A;  3KYD D;  4G0N B;  5BO4 B;  2RR9 A;  2KDI A;  3H6N A;  1BT0 A;  3ZW3 A;  2KJR A;  2KWV B;  5AZH A;  4BBN C;  2LGX A;  4W9I A;  2C7N B;  3WIM A;  4DHJ B;  2O6V A;  3PHX B;  1Z5S B;  2D07 B;  2KTR B;  4MJS A;  2EMT A;  4M8N A;  3ML8 A;  4II3 B;  2JZZ A;  3L08 A;  4NJ6 A;  2LWP A;  2PEA A;  2IO2 B;  5DPS A;  4DXA B;  3B0A A;  3HIZ A;  4RMA A;  3EFU A;  2JPH A;  1V6E A;  3A9K A;  2N7D A;  2OJR A;  4B9K A;  1UH6 A;  2ZCB A;  4IM3 A;  4K81 A;  1S1Q B;  1YD8 U;  4HJK A;  2UYZ B;  2CHW A;  2KC1 A;  3U30 A;  4EZK A;  1Q5W B;  2RGF A;  3DDC B;  3PRE A;  4K7S A;  4GXB A;  3ENE A;  4W9L A;  1WX7 A;  1WGR A;  2EKE C;  2B3A A;  3AU4 A;  3GOE A;  3R66 C;  4GB9 A;  4FJY A;  4IM0 A;  3H9D A;  3UQA A;  2K6Q A;  4II2 B;  4GDK B;  4AWJ A;  3RUI B;  3KVF B;  4W9C A;  2MQJ A;  2AYO B;  2RD0 A;  3M62 B;  2DZK A;  2A4Z A;  4WJQ A;  3BY4 B;  2XBB C;  4E71 A;  2EMS A;  2WWZ A;  3TMP B;  1H8C A;  3QA8 A;  1A5R A;  4EFO A;  3VUW A;  4F1S A;  1TTN A;  1OEY A;  2KJ6 A;  2K6D B;  3WAP A;  5CX3 A;  1P1A A;  1YX6 B;  2L0T A;  3ZNG C;  3LJ3 A;  1SGH A;  4GDL A;  1E8Y A;  2N4F A;  2N9P C;  1Q1O A;  3MTN B;  3QCA A;  2LVP A;  2KOX A;  4ASW C;  2JF5 A;  2XEW A;  5KHQ A;  2A5U A;  2MCN B;  1Y8R C;  2UWQ A;  3A33 B;  1WXV A;  2RSU A;  3B08 A;  3M63 B;  4LDT D;  2J0K A;  1ISN A;  3QAQ A;  2I1J A;  2LZ6 A;  4K1R B;  4KSK C;  4PS7 A;  3OLM D;  4A3O A;  2HE7 A;  4DHZ E;  2KMC A;  4HK2 A;  2W9N A;  3ZTC A;  2KAN A;  2JWZ A;  2KN5 A;  1D3Z A;  4IWP A;  1Z2M A;  2LVO A;  4DHJ D;  4TV3 A;  1JRU A;  3PGE A;  4XZ4 A;  4HPL B;  3ONS A;  2KWC A;  4NAW B;  1P3Q U;  1WXA A;  4AJW A;  4FAD A;  2K25 A;  2IY0 B;  1E8Z A;  1UBQ A;  2KDE B;  2MLB A;  4EEW A;  4FA6 A;  4KIK A;  3VFK A;  4DDG D;  3RZF A;  2M8S A;  3N30 A;  1WXM A;  5C1Z A;  2ZVO A;  2FID A;  2FAZ A;  3Q3J A;  3PS6 A;  4GGQ A;  2ZCC A;  4BKS A;  1QZE A;  2KC2 A;  2D2Q A;  1WR6 E;  3PZD A;  3U7D A;  3ZKJ C;  3VQI A;  4AUQ C;  1KJT A;  2BKR B;  3C0R B;  4JL9 A;  3SD5 A;  5AZF A;  3WAM A;  3Q3F A;  1GC7 A;  4BBN F;  5JH5 C;  4DHZ B;  3CST A;  1J19 A;  2C60 A; 
#chains in the Genus database with same CATH topology
 1VZ7 A;  1XD3 B;  3C8Y A;  1QOG A;  3IT6 B;  3ZLZ A;  3UIO B;  3GZN B;  3IT4 B;  2KKC A;  2NPT A;  3NS8 A;  3ZXR A;  2J53 A;  3MFG A;  1TIF A;  1TYG B;  1R4M I;  4NJC A;  1T0Q C;  3AEF B;  2ZVN A;  1JWB D;  3TEW A;  2WXQ A;  4Q2J A;  2QMT A;  2V3P A;  1KH0 A;  2O2V A;  4C56 C;  1WRD B;  5AUI A;  1SSN A;  3AE2 B;  3RZW C;  2IGD A;  4W9G A;  4ARI A;  1NEN B;  4MM3 B;  2KTF A;  2GOW A;  2ZEQ A;  5G55 A;  1WJU A;  2CR5 A;  5EE1 A;  3H1U A;  4XGA B;  3TBL D;  4ZRQ A;  2HJ8 A;  1IGD A;  2LGI A;  3ZDM C;  1PQS A;  4HCP B;  4S0R A;  3DBR B;  1WX8 A;  4JLC A;  4YSX B;  1OEY J;  2KZR A;  4HVB A;  3BVG A;  2J52 A;  2WXI A;  2J0J A;  2PE9 A;  1GPX A;  2BGF A;  2MBB B;  2KFK B;  4W9K A;  2KVR A;  4L23 A;  3CIR B;  1L4D B;  2YEP F;  3AE6 B;  4O1N A;  1EF5 A;  4E3C A;  1S3S G;  2OHF A;  2J0M A;  1BML C;  2KQ7 A;  1XLQ A;  4X57 B;  1MG8 A;  2C7H A;  4DWF A;  4JE3 B;  2KK8 A;  4PYU A;  2VRR B;  3DQV A;  1R4N B;  1VZ6 A;  3V60 A;  5IA7 A;  3Q2A C;  3MC0 B;  3SFD B;  2IO0 B;  2L1A A;  3WAN A;  2C9W B;  3M95 A;  3P63 A;  3GZN I;  4OZC A;  1V1P A;  4WJN A;  3V3X A;  3MJ5 A;  3QWZ B;  2JZP A;  3RYT A;  3EGR A;  4A9A A;  3HRD D;  3QIJ A;  2WX0 A;  2DHZ A;  1E6E B;  3DBH I;  3NVW A;  4NAW A;  4XDC A;  5H8Y E;  1L4Z B;  2IDY A;  1IPG A;  4JWU C;  1TS2 A;  2NVU I;  4LNO A;  4LCD E;  4R3D A;  3TCA A;  2RPQ A;  4C7Y A;  3W1Y A;  2ZPY A;  4TMA B;  4RM8 A;  4CO7 A;  5BYS A;  3ZNI D;  3OAW A;  1VD2 A;  1RLF A;  4IUM B;  1JAL A;  2MRP A;  2EEL A;  2X38 A;  1V1O A;  2PPH A;  2NTS A;  3JW0 X;  3L10 B;  2XK5 B;  2ZNV B;  4RNA A;  2N7J A;  4YSY B;  3AV8 A;  1L0V B;  4C00 A;  1AAR A;  3DBR I;  1SXT A;  4W9H A;  2DYB A;  3Q3N C;  4KDL B;  4G3X B;  1D6E C;  5J18 A;  3LYY A;  5EDS A;  2BB6 A;  2M1M A;  1UEL A;  3SU8 X;  3OWE B;  3L54 A;  2DZM A;  1YX5 B;  2GBJ A;  4KVG B;  1AW7 A;  2MBE A;  1GOZ A;  2ZJD A;  4WWP A;  3ZJU A;  1RYJ A;  2VH2 A;  4J3O D;  1MFW A;  2M0X A;  4YXD B;  2V3N A;  1B1Z A;  1WJ4 A;  1SJH D;  2JQR B;  4HLE A;  3PLV A;  1R4N I;  2JVC A;  2OOB B;  3CF6 E;  1PGB A;  4AOF A;  3ML9 A;  1P9D U;  1UWX A;  2KMA A;  4CYE A;  3JSV A;  3QX1 A;  4LNK A;  2BKF A;  5G2N A;  1HZ5 A;  2ACZ B;  2W54 A;  3Q8C A;  2NBU A;  3GE3 C;  2GI9 A;  2AQ1 B;  3H7P A;  3OJ4 B;  3P4S B;  2J42 A;  1U4A A;  1X1M A;  4RCO A;  1OFF A;  4EZL A;  1LM8 B;  2W3S A;  3JYU A;  5L83 A;  2EKI A;  5J17 A;  3A4R A;  1CZP A;  1VR9 A;  1WMH B;  1WE6 A;  4K7U A;  1EU4 A;  2G4S A;  1JW9 D;  1YN3 A;  2K5P A;  4KGT A;  1WGH A;  2ZZP B;  1UF0 A;  2Y5B B;  2Y5C A;  2I2Y A;  5CHW A;  2LD9 A;  2WXJ A;  1WRI A;  2MP2 B;  3WAO A;  4C7Z A;  2ON8 A;  2ZW0 A;  2Q5W D;  3DWG C;  1I4G A;  1FXT B;  1C76 A;  3M3J A;  3H7S A;  1F0Z A;  5KHO A;  4LLG M;  3PHW B;  1FNW A;  3RNF C;  2NPT B;  1V5O A;  2MWS B;  1XT9 B;  4J6I A;  2FBW B;  1V8C A;  5IO9 A;  5D7G A;  1ZP0 B;  1V49 A;  1K8R B;  4EKU A;  4LK0 M;  4WIP A;  1CQV A;  2DEN B;  2GBR A;  3ALB A;  5EE9 A;  1PFD A;  1DOY A;  2JUO A;  4KKJ A;  2AX5 A;  1FFU A;  1L2N A;  4IWQ A;  2GMI C;  1FFV A;  4ZDV A;  4AJY B;  2BW2 A;  5E6N A;  3W1S C;  2DX5 B;  3RNA C;  2DAF A;  4TSS A;  2R2Q A;  2MX2 A;  2PTL A;  3PZ8 A;  3AU5 A;  3Q8E A;  2NS5 A;  4ICV A;  3NY5 A;  4ZHP A;  3T9L A;  3ZW3 A;  3SR6 A;  4OHJ A;  2LGX A;  4W9I A;  2O6V A;  4BAX A;  4LNN A;  4MJS A;  2LFI A;  2XN9 C;  3UI3 A;  1DYQ A;  3NVY A;  4M8N A;  2JZZ A;  4AS1 A;  5I4D A;  1T3Q A;  5DPS A;  2JX5 A;  3EFU A;  4IM3 A;  1S1Q B;  2KC1 A;  4EZK A;  2RGF A;  3DDC B;  1AYF A;  3ENE A;  4W9L A;  3R66 C;  4DXF A;  4IM0 A;  3H9D A;  2K6Q A;  2DLB A;  3KVF B;  2MQJ A;  3AE1 B;  3M62 B;  1JRP A;  2A4Z A;  3VR8 B;  3Q3M C;  1C4A A;  3GP7 A;  4E71 A;  1H8C A;  3QA8 A;  1BUI C;  3WAP A;  4A90 A;  1P1A A;  2OED A;  4YTN B;  2L0T A;  4RGN A;  4B0M A;  2BS4 B;  2WXM A;  3QCA A;  1Q1O A;  2BT6 A;  2BVC A;  4IOI E;  1UUP A;  5FK9 C;  2MCN B;  3B08 A;  2G1E A;  1NYR A;  3QAQ A;  4PS7 A;  5BMG A;  1SBB B;  2KN5 A;  1K53 A;  1Z2M A;  2NMQ A;  1IUE A;  4DHJ D;  3PGE A;  4P1C C;  4NAW B;  4AJW A;  1GAQ B;  3VFK A;  3N30 A;  1WXM A;  4XDD A;  3E56 A;  2L32 A;  3Q3J A;  3KQ4 A;  2WXG A;  2ZCC A;  3TUO A;  4BKS A;  1STE A;  1WR6 E;  3PZD A;  2MJE A;  2WLB A;  3U7D A;  3ZKJ C;  1I4P A;  1I4Q A;  1T5X D;  3CST A;  1J19 A;  1ZGU B;  4MGK E;  1I4H A;  4HPP A;  4ICU A;  2WXF A;  3K9P B;  1P7E A;  1F2R I;  3N9Y C;  1ESF A;  4OVV A;  2KX0 A;  3VVW B;  5FR6 A;  2D3A A;  1GB4 A;  2JYT A;  1YN5 A;  1L6V A;  2XK5 A;  1SIF A;  1ZXI A;  2LJ5 A;  3ZO5 B;  3RUL A;  4DBG A;  2CHZ A;  3IHP C;  1SE4 A;  3D32 A;  1FO4 A;  2MBQ A;  3Q69 A;  3TEZ A;  3AUL A;  3I3T B;  3PZ7 A;  2D3G A;  4WWM A;  4URK A;  2ZNV C;  5DPW A;  5EE3 A;  3H8H A;  5CTR C;  3ABV B;  2WGS A;  2DWQ A;  1I35 A;  3NUH B;  3S2A A;  4IC7 B;  2BYF A;  1KLU D;  1E5W A;  1NI2 A;  5HI1 A;  4W9D A;  1KF6 B;  4PS8 A;  2LXC A;  2BYE A;  2PLP A;  2RPV A;  4IM2 A;  4M02 A;  3E9S A;  3JSV B;  4JWS C;  3V6E B;  4ZRI A;  4ZYN A;  4GOC A;  4H2A A;  1WIA A;  1RRB A;  3HVZ A;  2QSD A;  2K8C A;  4TQ1 A;  4ZRK A;  2RDH A;  3H7P B;  2B76 B;  1I4X A;  2M17 A;  1RFK A;  2KWD A;  4RGT A;  1JML A;  3N20 C;  1E10 A;  3T3N A;  1D5X C;  4G50 A;  4GDL B;  1YOV B;  4HDQ A;  2LHD A;  1P7F A;  4P1B C;  2AQ3 B;  5G5G A;  3R8B A;  2R2O A;  2DAJ A;  3AH7 A;  5GMV A;  2DZJ A;  3PSE B;  2YEP B;  1WZ0 A;  4NJ7 A;  3PRP B;  1WMH A;  1WYW B;  4HXD A;  5D6J B;  1IYF A;  1E90 A;  4TQ0 A;  1H4R A;  2JRH A;  4G11 A;  5J2R A;  2FCM A;  2QHO A;  2AWT A;  1I4R A;  5HKH A;  2MP2 A;  2IJ0 A;  2LGY A;  3I57 A;  3NZU A;  1N5X A;  3VUX A;  3URY A;  4CHK A;  1PYW D;  3KWL A;  5BMI A;  4FHJ A;  3KUD B;  2KQ4 X;  1NDD A;  1TY2 A;  3U2S C;  4EOY A;  4NZL B;  2C7M B;  1CK1 A;  1L0Y B;  2PKO A;  4KZ0 A;  2CJN A;  2KYW A;  4WJO A;  3X0W A;  3RI7 C;  4B6W A;  2KJH B;  3DBH B;  3ZNZ B;  4JGH B;  2BB5 A;  3ZNH B;  3EC8 A;  1E7P B;  3BK1 A;  5JHA A;  3U7Z A;  3AED B;  2O6V B;  2G45 B;  2PW9 A;  1C4C A;  4LJP B;  4MJS B;  4BFR A;  2Y3A A;  2AL3 A;  4AQ7 A;  3O65 B;  1OQY A;  3VDZ A;  1WGY A;  3NVV A;  2KVZ A;  4NQK E;  2V4I B;  2KDM A;  2WHI A;  5IP4 D;  4ANU A;  2WXH A;  4XX5 A;  1UNS A;  5FR3 A;  2LAS A;  4ZYS A;  3AEG B;  4I6P A;  1ACC A;  4XWW A;  3R2I A;  4ACF A;  2L00 B;  5C2T B;  3QAR A;  5EE0 A;  1CMX B;  1E7V A;  3Q6B A;  4WJP A;  1F77 A;  2TSS A;  4GMV A;  4ANX A;  1F2R C;  3APD A;  3BYY B;  2LUE A;  1N62 A;  1I42 A;  3AEE B;  3AXC A;  3P1M A;  2LGS A;  3P2B A;  5T8I A;  2KHW B;  1WFY A;  2KMM A;  5AUK A;  2GLS A;  1WE7 A;  1FEH A;  2C5L C;  4A6Q A;  3MC9 A;  2INC C;  3ZIM A;  3RN9 C;  4DK5 A;  3DHH C;  2WYQ A;  4TKN A;  3RNC C;  4ANW A;  3RCZ A;  5BYQ A;  1WJN A;  1WZ3 A;  2GBK A;  2WX1 A;  3KH0 A;  1WH3 A;  2KDF B;  1V81 A;  1N5W A;  2WXL A;  4NY0 A;  1PGA A;  4FUL A;  2D3C A;  2V9H A;  4PK1 A;  1XXG A;  5BMH A;  3KW5 B;  3VUY A;  1UZX B;  1HA5 A;  2BF8 B;  4WQM A;  1QIL A;  4N6E B;  3RD2 A;  1EF1 A;  1WY8 A;  5C23 A;  4MEL A;  1JWM D;  1ZKH A;  3VXW A;  2G4D B;  3Q14 C;  4XC2 A;  2MJD A;  2PJH A;  1T0R C;  5E6P A;  2L7R A;  4I6N B;  1XQQ A;  3PLU A;  1E7U A;  1WM3 A;  1LXD A;  2W82 A;  1K50 A;  4US9 A;  5JZE B;  2WQY B;  4ITK A;  4XE0 A;  1NEK B;  2JYE A;  2WXP A;  3VRB B;  4YWG G;  2WP9 B;  3TEX A;  2YVC A;  2Z8L A;  2WDV B;  2DZI A;  3MC8 A;  3ZRC A;  2BPS A;  3W5U B;  4C4V A;  4LNF A;  3R7R A;  4LDT B;  3APF A;  3L0W B;  2V1Y A;  3R3M A;  1QF6 A;  1EO6 A;  2NBV B;  4NPN A;  3KYD D;  2RR9 A;  1BT0 A;  5AZH A;  1VLB A;  3PHX B;  1Z5S B;  2D07 B;  2INP E;  2K3U A;  3BVM A;  3EUB 2;  3ML8 A;  2G9H D;  3AB5 A;  4NJ6 A;  2IO2 B;  4DXA B;  3HIZ A;  2JPH A;  3SEB A;  2NTT A;  4B9K A;  1UH6 A;  2ZCB A;  1YD8 U;  2PIA A;  1L0X B;  3P4Q B;  2UYZ B;  2CHW A;  2V0G A;  4GB9 A;  3AU4 A;  3I9V 1;  1Q10 A;  4PT5 A;  3UQA A;  1R7S A;  4AWJ A;  1FM0 D;  4W9C A;  2AYO B;  4RFB A;  1QOA A;  4F1S A;  1TTN A;  2K6D B;  4XYC A;  1YX6 B;  1XCQ L;  1MJD A;  2QCZ A;  3LJ3 A;  4GDL A;  1Y56 A;  4LTU A;  2VZK B;  2N4F A;  5IOI A;  4ASW C;  2KOX A;  5KHQ A;  2A5U A;  1Y8R C;  2UWQ A;  3M63 B;  2ZW1 A;  1FCC C;  1ISN A;  3VRA B;  2I1J A;  4KSK C;  3OLM D;  2KMC A;  3ZTC A;  3BK2 A;  4YT0 B;  1D5Z C;  3AE8 B;  1K51 A;  3ZQ4 A;  2BS2 B;  4HPL B;  2KWC A;  1WXA A;  2N9L A;  2KT7 A;  2MLB A;  4FA6 A;  5C1Z A;  3ETR A;  1OQQ A;  2FID A;  1EWY C;  1NYQ A;  5AZF A;  4BBN F;  2C60 A;  2CKH B;  3VAW A;  1E9M A;  1PUT A;  2IO1 B;  2K8H A;  2IZV B;  3T3O A;  1HEZ E;  2BS3 B;  2JZ3 B;  4IG7 B;  3JVZ X;  1TZO A;  4KV2 A;  1GJZ A;  3VR9 B;  3A1Q A;  2BYT A;  1WGD A;  1SE3 A;  4B95 A;  3DPD A;  3P4P B;  5HFY A;  2KQS A;  1SE9 A;  2LUM A;  2JSV X;  1N63 A;  1YNT E;  1L7Y A;  1YQ3 B;  2I38 A;  1V9J A;  3U52 E;  2BTE A;  4MSM B;  4DDI D;  2Y5P A;  2D3B A;  1WX9 A;  2FIF A;  4KDI C;  2WS3 B;  1FRD A;  1GC6 A;  4HRS A;  4P6V F;  1KLV A;  4ANV A;  3A9K B;  3R7Q A;  3SHQ A;  2UU7 A;  4WWN A;  3IAM 1;  4N59 A;  2HD5 B;  2L83 A;  3AMZ A;  2G3Q B;  2QIE B;  1J7B A;  3CWI A;  3HVD A;  3IAS 1;  3I63 C;  1E0Z A;  2KFJ A;  4WH4 A;  2K1F A;  3HK0 A;  2FNJ B;  1DGJ A;  1C4P A;  1F52 A;  1ZXH A;  2CHX A;  1DOI A;  4KZC A;  1XLP A;  1QOF A;  1WJ6 A;  3EA6 A;  4KKI A;  3AN1 A;  4UDU C;  1DOX A;  3BVZ A;  3RT3 B;  1UGJ A;  2WXK A;  5AZG A;  3BYT B;  2FCN A;  3OJ3 A;  1WXQ A;  4IDI A;  1HE8 A;  1TZ1 A;  3NOB A;  3ZTD A;  2N9E B;  2L3Z A;  2MH7 A;  1KTK A;  2KLC A;  4REZ A;  2WDQ B;  4KGS A;  1ZDV A;  1ZPS A;  2ASQ A;  1V2Y A;  3Q8F A;  3RMK C;  1F9J A;  3N1Y C;  2JXT A;  1C3T A;  3UIP B;  1B9R A;  2LI5 A;  1HTO A;  3NHE B;  3PT2 B;  3AI5 A;  2LVQ A;  3DHI C;  3KUC B;  4EZJ A;  3B9J A;  2JXX A;  1TT5 B;  2N9X A;  1VCB A;  4F7Z A;  3PV1 A;  2RDG A;  1LQB A;  3AE7 B;  2WU5 B;  2CS4 A;  1ET9 A;  1WI0 A;  4A3P A;  1KOT A;  5AEK B;  3AE3 B;  2HDE A;  2IBI B;  2N0S B;  1J7A A;  2NCN A;  1TS3 A;  3GE8 C;  4HRO A;  2FE8 A;  2QJL A;  3NZS A;  5HG2 A;  4C4V B;  2PVG C;  4P16 A;  1MVK A;  3IFW B;  4JPS A;  4OVU A;  5L95 C;  2AQ2 B;  2JT4 B;  3UGB B;  1CJE A;  3QK0 A;  3CSF A;  3ZUN A;  3V61 A;  2M4N A;  2MSE D;  4BKT A;  4L2Y A;  2GBN A;  2N9K A;  4HPM B;  5E6O A;  1TY0 A;  2GB1 A;  2VH1 A;  1WF9 A;  3NG0 A;  5LXI B;  3LDZ E;  1AN8 A;  3MJW A;  2KO3 A;  2BWE S;  2FCS A;  1C1Y B;  2DNF A;  1J0G A;  2D10 A;  3B2F A;  3DVG Y;  4MH0 E;  2E3T A;  1G6J A;  1HZ6 A;  1N61 A;  2V4L A;  2K39 A;  2SEB D;  2H89 B;  4YL8 A;  4LNI A;  4BZA A;  3BIN A;  4IKG A;  1WWT A;  4C80 A;  1TS4 A;  2M56 B;  4MGI E;  4WUR A;  1QLB B;  1ZW7 A;  3N32 A;  1UBI A;  2FUG 1;  2YLM A;  2L05 A;  2NR2 A;  4GSW A;  1WR1 A;  1RM6 C;  4FJZ A;  4MDK E;  4WAF A;  1JRO A;  4K3C A;  1OGW A;  4N9F 4;  3DVG X;  2HJ1 A;  2ONQ A;  5DPT A;  1IBX A;  2INN E;  3L4P A;  2D11 A;  4KSL C;  3DCG A;  2BBC A;  4MGY E;  2OJW A;  3ZVV A;  3ZRF A;  3SDL C;  4OVZ A;  5TR5 A;  3DHG C;  4NQL B;  3RNG C;  2O6V D;  2IYD B;  4A8X C;  4M0W A;  3KLS X;  1EU3 A;  3BWU D;  4JIO U;  1RFA A;  1FNU A;  4F8C B;  3ZYY X;  4S17 A;  2ICI A;  4HDO A;  1KLG D;  2LRW A;  2DYO A;  4IWO A;  4FHK A;  1EM7 A;  3QHT A;  4HJG E;  2PMV A;  1V97 A;  2NBW B;  4BOZ B;  3GB1 A;  3AEB B;  4FLH A;  4GIV A;  1RWS A;  2JU6 X;  1ZUD 2;  1M94 A;  4A55 A;  3A1Q B;  3ZDT A;  2LHE A;  3VH3 B;  1J7C A;  1XLO A;  2LGD A;  4KGR A;  4GN1 A;  2KNB A;  5BYR A;  1OTR B;  3ZGZ A;  5D3I B;  2FUH B;  1TJE A;  2KLG A;  4FN2 A;  2MJ3 A;  2I1K A;  1YN4 A;  4BOS C;  2K0P A;  3EFC A;  1TKE A;  4BKG A;  4NNJ B;  5DPR A;  1XEE A;  4HEA 1;  4HKZ E;  1V80 A;  2DBY A;  3N3K B;  3NJT A;  4EE2 A;  4US8 A;  4XWT A;  2LMC A;  3TIX A;  1ZDX A;  1EUV B;  2KAC A;  1TBE A;  3PPA A;  2KN4 A;  1YIW A;  4BKS D;  2LXA A;  4PS3 A;  4G0N B;  2KDI A;  2KWV B;  3WIM A;  1HQR D;  3W9C B;  1IGC A;  1SB3 C;  3AE4 B;  3L08 A;  2HTM E;  1JWA D;  4RMA A;  3A9K A;  2N7D A;  2OJR A;  1MG4 A;  4K81 A;  4HJK A;  3P4R B;  1Q5W B;  4K7S A;  4GXB A;  1WX7 A;  3GOE A;  1XCT L;  4FJY A;  4II2 B;  5E6J A;  2RD0 A;  2JWU A;  1UWM A;  3BY4 B;  2EMS A;  4USA A;  1KFY B;  1TKG A;  1VZ8 A;  2KJ6 A;  3AM9 A;  3ZNG C;  3FKY A;  4DQO C;  1E8Y A;  1VDV A;  2XEW A;  3DBL B;  3A33 B;  4LDT D;  2RSU A;  2J0K A;  4K1R B;  4A3O A;  2HE7 A;  4DHZ E;  4HK2 A;  2JWZ A;  1D3Z A;  4IWP A;  2LVO A;  1FNV A;  1P3Q U;  2QIL A;  2K25 A;  2IY0 B;  3SFE B;  2KDE B;  1C79 A;  2M8S A;  5C3J B;  2MEK A;  4N58 A;  2FAZ A;  4GGQ A;  1I7H A;  2KC2 A;  5JXV A;  2IND C;  1FIQ A;  3VQI A;  4AUQ C;  2BKR B;  1YMH E;  3Q3F A;  1GC7 A;  3Q8B A;  3AEA B;  2KX3 A;  2IGH A;  4ZRJ A;  2KD0 A;  1LO5 D;  4GU2 A;  1V86 A;  1XO3 A;  4W9J A;  1YJ1 A;  4OZA A;  2WXN A;  5IAA C;  1NVI D;  3PVL A;  1WSP A;  2RDB C;  1KRH A;  3N1X C;  3TSS A;  2VZK D;  1XLN A;  3WCQ A;  3RNE C;  4AP4 C;  1C77 A;  3ZXV A;  2JY6 A;  1SIJ A;  3RNB C;  3J9C A;  2L52 A;  1ROE A;  3NS1 A;  3QJZ A;  3A9J A;  2HTH A;  1GB1 A;  4HWI B;  1WM2 A;  4K7W A;  4P7I A;  3L13 A;  4K3B A;  5DCN A;  1V5T A;  1FXA A;  1JQ4 A;  1QKZ A;  4RF1 A;  1TGZ B;  3ZJV A;  1NI3 A;  2QDF A;  3Q3O C;  1YJJ A;  4M8M A;  2KTR A;  3V6C B;  2GRI A;  3A4S C;  3DBL I;  1IBX B;  1JWS D;  1NBF C;  3DVN V;  4QAY A;  2K22 A;  2L0F A;  1P98 A;  5JHB A;  2E6X A;  1HTQ A;  2PVO D;  2ZPN A;  2MBO A;  4W9E A;  2L8J A;  1FPY A;  3HM3 A;  2BYV E;  3HHM A;  4GDK A;  4MSQ B;  2WU2 B;  4M0W B;  1D4B A;  3L16 A;  4IW0 A;  1SE2 A;  3B2G A;  3QC8 B;  3EEC A;  2WDR B;  3GS2 A;  4RH6 A;  3FIL B;  2BWF A;  5H92 C;  4KIK B;  3KYC D;  2MHJ A;  2WXR A;  4HCN B;  4FBJ B;  3VTU A;  1WYG A;  2AEH A;  5IN7 A;  1MHX A;  1N60 A;  4JQW C;  2WDT B;  4CQN A;  4RGO S;  3AE5 B;  2IY1 B;  3DBS A;  3MHS D;  2IO3 B;  1F1H A;  3O13 A;  4L1B A;  4MEM A;  4KX6 B;  3DVN U;  5CHF A;  5D3D A;  1L5P A;  1MI0 A;  1ENF A;  2L76 A;  4EUT A;  3VHT C;  3W1S A;  3B1L X;  1J8C A;  4NAM A;  3K9O B;  1WGK A;  4ZOH C;  1UGM A;  2M19 A;  2Z0E B;  2Z0D B;  4LJO B;  2O2V B;  2JRI B;  1KM7 A;  4WQO B;  3L17 A;  5D94 A;  1YQB A;  4PYZ A;  4ZHO A;  2BQQ A;  2J7Q B;  2KDB A;  1FMA D;  3UIN B;  3V05 A;  1E8W A;  5FKA C;  2KXJ A;  1C78 A;  4MT5 A;  3VTW A;  1UD7 A;  2FCQ A;  1Q0W B;  2WNM A;  3IXS A;  4A20 A;  3DWM A;  4MM3 A;  1QQR A;  3TJP A;  5TSS A;  3VH4 B;  3DOW A;  1AWD A;  4GLS C;  2GBM A;  3CMM B;  1IP9 A;  4DXG A;  3QQ8 B;  4TUU A;  1MHH E;  2PE6 B;  3PRZ A;  1D5M C;  4YTP B;  3APC A;  1LGR A;  2X8X X;  5LLI A;  4YSZ B;  1BXT A;  3ECI A;  1K52 A;  3LXF A;  2N1V A;  4RF0 A;  3U8Z A;  2N1W A;  1MPE A;  4HKQ A;  5D2M B;  5IKC M;  1WXS A;  4FXC A;  2KFK A;  4OZB A;  1SJE D;  1E8X A;  2QEJ C;  1FD6 A;  2MW5 A;  4I6L B;  1VJK A;  3HM6 X;  1XF5 L;  2CU1 A;  3VTV A;  4WWO A;  1RAX A;  1FXI A;  1GUA B;  1V1P B;  1WGG A;  3FC4 A;  1A70 A;  3NRZ A;  4OW0 A;  5LXH A;  3IG3 A;  3IVF A;  3PRM B;  4E74 A;  3T8M A;  1ZE3 D;  2DYM A;  2Z59 B;  3LB8 C;  3BII D;  3FAH A;  2LRU A;  1P0R A;  3R2T A;  2J4X A;  3IBE A;  2SAK A;  3Q8A A;  2R61 A;  2KAJ A;  3HUI A;  3ZJT A;  1GNU A;  2AL6 A;  5HHD G;  3TL5 A;  3PTF C;  1YJI A;  2IPK D;  1QOB A;  1TS5 A;  2WXO A;  3OG5 A;  1TKY A;  2M0A A;  2KWU B;  5MPO A;  4RM9 A;  3V62 A;  2H88 B;  3UF8 A;  2RMM A;  3X23 A;  4BVU C;  2MBH A;  1GG3 A;  2K8B A;  1M4V A;  3BZD B;  1T0Y A;  1T0S C;  2QC8 A;  2REX A;  4FJV B;  4W9F A;  4WAA A;  3NVZ A;  3RPF C;  1N6Z A;  2MA9 B;  4D2K A;  2LJI A;  1L6U A;  4MAC A;  1JCK B;  1T6B X;  4MGZ E;  3WA0 A;  2IGG A;  3MP9 A;  3A9J B;  3W2D A;  3EHV A;  3WAL A;  2N7E A;  5CHV C;  3KUZ A;  1LFD A;  1OQR A;  3UQB A;  5BO4 B;  2V3S A;  3TEY A;  3H6N A;  2KJR A;  4BBN C;  1EWC A;  2C7N B;  4DHJ B;  2KTR B;  1SF0 A;  2EMT A;  3NZ3 A;  4II3 B;  4MH8 A;  1R4M B;  2LWP A;  2PEA A;  3B0A A;  2LEK A;  1V6E A;  1FCL A;  3U30 A;  5GXG B;  3PRE A;  1C9F A;  2EKE C;  1WGR A;  2B3A A;  1FRR A;  4GDK B;  3RUI B;  1HXY D;  1YQ4 B;  1SEB D;  4RGM A;  2DZK A;  4WJQ A;  2XBB C;  2CU3 A;  2WWZ A;  3AE9 B;  3MHZ A;  3P42 A;  3TMP B;  4EFO A;  1A5R A;  3VUW A;  4YTM B;  1JWU D;  1OEY A;  2K9X A;  4ZRP A;  5CX3 A;  2D5G A;  4M00 A;  3PO0 A;  2W3R A;  2W55 A;  2CJO A;  1SGH A;  2N9P C;  3MTN B;  1QT9 A;  2LVP A;  1PDX A;  2JF5 A;  4ARC A;  5G5H A;  1WXV A;  3AEC B;  3W5V B;  1VRA B;  2XNA C;  2LZ6 A;  3RFZ B;  3C19 A;  4B0E A;  2W9N A;  3N1Z C;  2KAN A;  1PGX A;  4TV3 A;  1JRU A;  4XZ4 A;  3ONS A;  4JX1 C;  3FIL A;  4FAD A;  1E8Z A;  1UBQ A;  4EEW A;  3U4E G;  4KIK A;  4DDG D;  3RZF A;  2ZVO A;  3PS6 A;  1ET6 A;  1QZE A;  3KWV A;  2D2Q A;  1ZOY B;  1KJT A;  3C0R B;  3I5J C;  4JL9 A;  3SD5 A;  5LNK 1;  3WAM A;  4M01 A;  5JH5 C;  4DHZ B; 
#chains in the Genus database with same CATH homology
 2CKH B;  2KX3 A;  1ZGU B;  4ZRJ A;  3VAW A;  2IO1 B;  1XD3 B;  2K8H A;  4MGK E;  2KD0 A;  4GU2 A;  1V86 A;  2IZV B;  4ICU A;  2JZ3 B;  3UIO B;  3ZLZ A;  2KKC A;  4IG7 B;  4W9J A;  2NPT A;  3JVZ X;  1YJ1 A;  3NS8 A;  4KV2 A;  1GJZ A;  3K9P B;  3A1Q A;  5IAA C;  4OVV A;  1R4M I;  3PVL A;  1WGD A;  2KX0 A;  5FR6 A;  3VVW B;  4B95 A;  3DPD A;  2ZVN A;  2XK5 A;  1SIF A;  2LJ5 A;  3ZO5 B;  3RUL A;  2KQS A;  1SE9 A;  4DBG A;  2CHZ A;  3IHP C;  1L7Y A;  4AP4 C;  3D32 A;  2O2V A;  2MBQ A;  2JY6 A;  1WRD B;  3AUL A;  3I3T B;  1V9J A;  2D3G A;  3RZW C;  4MSM B;  4W9G A;  4URK A;  2ZNV C;  5DPW A;  4DDI D;  2KTF A;  2GOW A;  2ZEQ A;  5G55 A;  3QJZ A;  3A9J A;  2HTH A;  1WJU A;  2CR5 A;  4HWI B;  5CTR C;  1WM2 A;  1WX9 A;  3H1U A;  4K7W A;  4P7I A;  3L13 A;  2FIF A;  5DCN A;  3TBL D;  4KDI C;  1V5T A;  1I35 A;  1GC6 A;  3S2A A;  2HJ8 A;  4IC7 B;  1TGZ B;  1KLV A;  2BYF A;  1E5W A;  3ZDM C;  1NI2 A;  3A9K B;  4ANV A;  3R7Q A;  1PQS A;  4HCP B;  4M8M A;  4W9D A;  3SHQ A;  4PS8 A;  2KTR A;  3V6C B;  4WWN A;  3A4S C;  1WX8 A;  2HD5 B;  2LXC A;  3DBL I;  4JLC A;  1OEY J;  2BYE A;  1NBF C;  4IM2 A;  2KZR A;  3V6E B;  2G3Q B;  3JSV B;  4HVB A;  4ZRI A;  3DVN V;  4ZYN A;  2KFJ A;  2J0J A;  2K1F A;  2PE9 A;  3HK0 A;  2BGF A;  2MBB B;  4GOC A;  2FNJ B;  2KFK B;  4W9K A;  2L0F A;  1P98 A;  2KVR A;  1WIA A;  1RRB A;  5JHB A;  2K8C A;  2CHX A;  4KZC A;  4TQ1 A;  4ZRK A;  3H7P B;  2ZPN A;  2M17 A;  2MBO A;  4W9E A;  2L8J A;  1WJ6 A;  3HM3 A;  1EF5 A;  2BYV E;  3HHM A;  4GDK A;  4E3C A;  4MSQ B;  1S3S G;  4G50 A;  4GDL B;  2J0M A;  3RT3 B;  2KQ7 A;  4X57 B;  4M0W B;  1MG8 A;  2C7H A;  4HDQ A;  4DWF A;  2KK8 A;  5AZG A;  4PYU A;  3L16 A;  2VRR B;  3DQV A;  4IW0 A;  3V60 A;  2R2O A;  3QC8 B;  5IA7 A;  2DAJ A;  2IO0 B;  5GMV A;  2DZJ A;  3PSE B;  3WAN A;  3EEC A;  2C9W B;  3M95 A;  2FCN A;  3OJ3 A;  1HE8 A;  1TZ1 A;  3NOB A;  1WZ0 A;  3ZTD A;  3GZN I;  2N9E B;  4NJ7 A;  3PRP B;  2BWF A;  2L3Z A;  1WMH A;  1WYW B;  4HXD A;  4WJN A;  2KLC A;  5D6J B;  1IYF A;  4KIK B;  3KYC D;  1E90 A;  3QWZ B;  4TQ0 A;  1H4R A;  2ASQ A;  2JRH A;  1V2Y A;  1F9J A;  4G11 A;  4HCN B;  3RYT A;  4FBJ B;  3VTU A;  5J2R A;  2AEH A;  1C3T A;  2FCM A;  3UIP B;  2QHO A;  2LI5 A;  3QIJ A;  2AWT A;  2WX0 A;  5HKH A;  3NHE B;  2MP2 A;  2DHZ A;  2LVQ A;  3AI5 A;  3DBH I;  3PT2 B;  4JQW C;  4NAW A;  2LGY A;  2WDT B;  3KUC B;  4EZJ A;  1IPG A;  3NZU A;  2IY1 B;  2JXX A;  3DBS A;  3MHS D;  2N9X A;  2IO3 B;  2NVU I;  1VCB A;  3VUX A;  4F7Z A;  4CHK A;  3PV1 A;  4LCD E;  3TCA A;  2RPQ A;  1LQB A;  4FHJ A;  3KUD B;  2ZPY A;  3W1Y A;  1NDD A;  2CS4 A;  4MEM A;  4RM8 A;  4CO7 A;  1WI0 A;  3DVN U;  3ZNI D;  4EOY A;  5CHF A;  3OAW A;  1VD2 A;  1RLF A;  4IUM B;  4A3P A;  2C7M B;  1KOT A;  2L76 A;  4KZ0 A;  5AEK B;  2MRP A;  4WJO A;  3X0W A;  2PPH A;  4EUT A;  2IBI B;  3JW0 X;  3VHT C;  3L10 B;  2NCN A;  2XK5 B;  3W1S A;  2ZNV B;  4B6W A;  3B1L X;  2KJH B;  1J8C A;  3ZNZ B;  3NZS A;  1AAR A;  3DBR I;  3K9O B;  4JGH B;  2DYB A;  4W9H A;  3IFW B;  4OVU A;  3ZNH B;  1UGM A;  5L95 C;  4KDL B;  2JT4 B;  3UGB B;  2Z0E B;  2Z0D B;  4G3X B;  3EC8 A;  2O2V B;  3CSF A;  3QK0 A;  4LJO B;  3ZUN A;  2JRI B;  1KM7 A;  2M4N A;  2MSE D;  3V61 A;  4BKT A;  4WQO B;  2GBN A;  3L17 A;  5J18 A;  5D94 A;  5JHA A;  5EDS A;  4HPM B;  1YQB A;  2M1M A;  5E6O A;  1UEL A;  2O6V B;  4PYZ A;  3SU8 X;  5LXI B;  1WF9 A;  2G45 B;  4LJP B;  3L54 A;  3LDZ E;  2DZM A;  2J7Q B;  4MJS B;  3MJW A;  1YX5 B;  2GBJ A;  4BFR A;  2AL3 A;  4KVG B;  2KDB A;  2KO3 A;  3UIN B;  2MBE A;  3O65 B;  1E8W A;  2ZJD A;  2KXJ A;  1OQY A;  2BWE S;  2FCS A;  3VTW A;  3VDZ A;  1UD7 A;  2FCQ A;  1Q0W B;  1C1Y B;  1WGY A;  4WWP A;  4NQK E;  1J0G A;  2D10 A;  3DVG Y;  4MH0 E;  1G6J A;  2M0X A;  4A20 A;  4ANU A;  4MM3 A;  2V4L A;  3TJP A;  2K39 A;  4XX5 A;  4YL8 A;  1WJ4 A;  3VH4 B;  3DOW A;  4HLE A;  2LAS A;  3BIN A;  3PLV A;  1R4N I;  2GBM A;  2JVC A;  3CMM B;  4MGI E;  4I6P A;  1IP9 A;  3QQ8 B;  2OOB B;  3CF6 E;  4TUU A;  1ZW7 A;  2L00 B;  3N32 A;  2PE6 B;  3PRZ A;  1UBI A;  3QAR A;  2YLM A;  2L05 A;  4AOF A;  1CMX B;  2NR2 A;  1E7V A;  4GSW A;  1WR1 A;  4FJZ A;  3APC A;  3ML9 A;  4WJP A;  4MDK E;  4GMV A;  4N9F 4;  1P9D U;  1OGW A;  5LLI A;  2KMA A;  3DVG X;  4ANX A;  4CYE A;  3ECI A;  2N1V A;  3U8Z A;  3APD A;  5DPT A;  2LUE A;  2N1W A;  3JSV A;  3QX1 A;  5D2M B;  1I42 A;  1WXS A;  2BKF A;  5G2N A;  3AXC A;  2KFK A;  3P2B A;  2D11 A;  1E8X A;  2KHW B;  2NBU A;  4KSL C;  1WFY A;  3DCG A;  2MW5 A;  4I6L B;  1WE7 A;  3H7P A;  2C5L C;  3OJ4 B;  4MGY E;  3ZIM A;  3ZVV A;  4DK5 A;  3HM6 X;  3ZRF A;  1U4A A;  1X1M A;  3SDL C;  2WYQ A;  4TKN A;  5TR5 A;  2CU1 A;  4ANW A;  3VTV A;  3RCZ A;  4EZL A;  4NQL B;  1LM8 B;  4WWO A;  1WJN A;  2O6V D;  1RAX A;  1WZ3 A;  2IYD B;  3JYU A;  5L83 A;  1GUA B;  2GBK A;  2WX1 A;  3KH0 A;  5J17 A;  1WH3 A;  2KDF B;  3A4R A;  1WGG A;  1WMH B;  1WE6 A;  4K7U A;  5LXH A;  4JIO U;  1V81 A;  1RFA A;  3IG3 A;  4F8C B;  2G4S A;  4NY0 A;  3IVF A;  4FUL A;  3PRM B;  4E74 A;  3T8M A;  4HDO A;  2DYM A;  2Z59 B;  1WGH A;  2LRW A;  2ZZP B;  2LRU A;  1P0R A;  2DYO A;  2Y5B B;  4IWO A;  3KW5 B;  4FHK A;  3QHT A;  5CHW A;  2LD9 A;  3IBE A;  3VUY A;  2MP2 B;  3WAO A;  1UZX B;  2BF8 B;  3RD2 A;  2NBW B;  4BOZ B;  1EF1 A;  1WY8 A;  5C23 A;  1GNU A;  1FXT B;  2AL6 A;  4FLH A;  3TL5 A;  3M3J A;  3H7S A;  4GIV A;  5KHO A;  3PTF C;  4MEL A;  3PHW B;  1M94 A;  2NPT B;  1ZKH A;  1V5O A;  2KWU B;  2G4D B;  3VXW A;  4XC2 A;  3A1Q B;  2PJH A;  3ZDT A;  2MWS B;  1XT9 B;  4J6I A;  3VH3 B;  5E6P A;  2LGD A;  4RM9 A;  3V62 A;  2L7R A;  4GN1 A;  4I6N B;  5D7G A;  1V49 A;  1XQQ A;  2KNB A;  1OTR B;  3PLU A;  1K8R B;  3UF8 A;  4EKU A;  1E7U A;  1WM3 A;  2FUH B;  3X23 A;  2KLG A;  4FN2 A;  4BVU C;  2MBH A;  2K8B A;  1GG3 A;  1T0Y A;  2REX A;  4W9F A;  2I1K A;  1LXD A;  4FJV B;  4BOS C;  2DEN B;  2GBR A;  3ALB A;  4WAA A;  2JUO A;  4BKG A;  5JZE B;  4NNJ B;  2MA9 B;  1L2N A;  4IWQ A;  2GMI C;  4ZDV A;  5DPR A;  4AJY B;  5E6N A;  2YVC A;  1V80 A;  3N3K B;  4MGZ E;  3WA0 A;  3W1S C;  2DX5 B;  2DAF A;  2DZI A;  3A9J B;  3ZRC A;  2BPS A;  2R2Q A;  2MX2 A;  3EHV A;  3WAL A;  2N7E A;  5CHV C;  3KUZ A;  1EUV B;  3TIX A;  3AU5 A;  4LDT B;  3R7R A;  1LFD A;  2NS5 A;  1TBE A;  3APF A;  3L0W B;  3PPA A;  4ICV A;  3NY5 A;  1YIW A;  2V1Y A;  3R3M A;  3T9L A;  3UQB A;  4BKS D;  1EO6 A;  2LXA A;  2NBV B;  2V3S A;  4NPN A;  4PS3 A;  3KYD D;  4G0N B;  5BO4 B;  2RR9 A;  2KDI A;  3H6N A;  1BT0 A;  3ZW3 A;  2KJR A;  2KWV B;  5AZH A;  4BBN C;  2LGX A;  4W9I A;  2C7N B;  3WIM A;  4DHJ B;  2O6V A;  3PHX B;  1Z5S B;  2D07 B;  2KTR B;  4MJS A;  2EMT A;  4M8N A;  3ML8 A;  4II3 B;  2JZZ A;  3L08 A;  4NJ6 A;  2LWP A;  2PEA A;  2IO2 B;  5DPS A;  4DXA B;  3B0A A;  3HIZ A;  4RMA A;  3EFU A;  2JPH A;  1V6E A;  3A9K A;  2N7D A;  2OJR A;  4B9K A;  1UH6 A;  2ZCB A;  4IM3 A;  4K81 A;  1S1Q B;  1YD8 U;  4HJK A;  2UYZ B;  2CHW A;  2KC1 A;  3U30 A;  4EZK A;  1Q5W B;  2RGF A;  3DDC B;  3PRE A;  4K7S A;  4GXB A;  3ENE A;  4W9L A;  1WX7 A;  1WGR A;  2EKE C;  2B3A A;  3AU4 A;  3GOE A;  3R66 C;  4GB9 A;  4FJY A;  4IM0 A;  3H9D A;  3UQA A;  2K6Q A;  4II2 B;  4GDK B;  4AWJ A;  3RUI B;  3KVF B;  4W9C A;  2MQJ A;  2AYO B;  2RD0 A;  3M62 B;  2DZK A;  2A4Z A;  4WJQ A;  3BY4 B;  2XBB C;  4E71 A;  2EMS A;  2WWZ A;  3TMP B;  1H8C A;  3QA8 A;  1A5R A;  4EFO A;  3VUW A;  4F1S A;  1TTN A;  1OEY A;  2KJ6 A;  2K6D B;  3WAP A;  5CX3 A;  1P1A A;  1YX6 B;  2L0T A;  3ZNG C;  3LJ3 A;  1SGH A;  4GDL A;  1E8Y A;  2N4F A;  2N9P C;  1Q1O A;  3MTN B;  3QCA A;  2LVP A;  2KOX A;  4ASW C;  2JF5 A;  2XEW A;  5KHQ A;  2A5U A;  2MCN B;  1Y8R C;  2UWQ A;  3A33 B;  1WXV A;  2RSU A;  3B08 A;  3M63 B;  4LDT D;  2J0K A;  1ISN A;  3QAQ A;  2I1J A;  2LZ6 A;  4K1R B;  4KSK C;  4PS7 A;  3OLM D;  4A3O A;  2HE7 A;  4DHZ E;  2KMC A;  4HK2 A;  2W9N A;  3ZTC A;  2KAN A;  2JWZ A;  2KN5 A;  1D3Z A;  4IWP A;  1Z2M A;  2LVO A;  4DHJ D;  4TV3 A;  1JRU A;  3PGE A;  4XZ4 A;  4HPL B;  3ONS A;  2KWC A;  4NAW B;  1P3Q U;  1WXA A;  4AJW A;  4FAD A;  2K25 A;  2IY0 B;  1E8Z A;  1UBQ A;  2KDE B;  2MLB A;  4EEW A;  4FA6 A;  4KIK A;  3VFK A;  4DDG D;  3RZF A;  2M8S A;  3N30 A;  1WXM A;  5C1Z A;  2ZVO A;  2FID A;  2FAZ A;  3Q3J A;  3PS6 A;  4GGQ A;  2ZCC A;  4BKS A;  1QZE A;  2KC2 A;  2D2Q A;  1WR6 E;  3PZD A;  3U7D A;  3ZKJ C;  3VQI A;  4AUQ C;  1KJT A;  2BKR B;  3C0R B;  4JL9 A;  3SD5 A;  5AZF A;  3WAM A;  3Q3F A;  1GC7 A;  4BBN F;  5JH5 C;  4DHZ B;  3CST A;  1J19 A;  2C60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...