1WM2A

Crystal structure of human sumo-2 protein
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
78
structure length
78
Chain Sequence
TENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein SMT3B
publication title Crystal structures of the human SUMO-2 protein at 1.6 A and 1.2 A resolution: implication on the functional differences of SUMO proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 19
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2004-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wm2A00
4I6NB 1YJ1A 2ZNVB 3R7QA 1VD2A 4XZ4A 2BF8B 2JUOA 3NZSA 3KUDB 2LRWA 1GUAB 2KC1A 3A1QA 2LVQA 2JY6A 3QA8A 2I1JA 4IUMB 3APFA 3LDZE 2FUHB 3V6CB 2GMIC 4F8CB 1L2NA 4ASWC 4GSWA 2M17A 4F7ZA 2BWES 3VUYA 4AP4C 1CMXB 2FCMA 5D94A 2BPSA 1H4RA 1WZ3A 3WAMA 1IYFA 2VRRB 4HJKA 3UINB 4ANVA 4BBNF 4ANUA 1I35A 3ZNID 1LXDA 2D2QA 1NBFC 1GG3A 4JLCA 1WRDB 2V3SA 3PPAA 4FJZA 4DXAB 2D11A 2KFKB 2A5UA 2JZZA 2LJ5A 3WALA 3ZLZA 2MP2A 4EOYA 1E8XA 3DBLI 4WJQA 2MBOA 5CHWA 3A4RA 3NHEB 4HDQA 2O2VB 1TGZB 3AU5A 1UBIA 2M4NA 4II3B 1UZXB 3QIJA 1OTRB 5CHVC 4B95A 3WANA 4NQLB 4FULA 4CHKA 2N9PC 2JRHA 3L54A 3RD2A 2N9XA 4PYUA 2ZJDA 4AJYB 5DCNA 2MWSB 2KANA 2G4SA 3U30A 3N30A 4FJVB 2KFJA 3V62A 1WXMA 2N1WA 4DDID 1FXTB 1YX5B 2RR9A 3JW0X 4ICVA 3KYCD 1WGYA 3TIXA 4BVUC 2OOBB 2KKCA 2LVOA 1UELA 1E7VA 2LGYA 3PRZA 4LJPB 4BKGA 2DZIA 2Z59B 3JYUA 2XEWA 2REXA 1WGDA 1WM2A 2MX2A 3GZNI 1E8WA 2KTRA 2DYMA 5G2NA 1E5WA 3A9JB 1A5RA 3OLMD 2KK8A 1R4NI 3ZTDA 2L00B 4ANXA 3C0RB 2EKEC 2UWQA 2ZEQA 1RLFA 5BO4B 3R66C 3L13A 2NVUI 1WJ4A 4KZCA 2KC2A 1V49A 2KQSA 4JQWC 2I1KA 1V2YA 2O6VD 1NDDA 2ZVNA 2MBEA 3L0WB 5AZGA 1WE6A 3MJWA 3N3KB 3IFWB 3RUIB 3VQIA 2MBBB 1KOTA 1SE9A 2DENB 2GBMA 2IY1B 2KLGA 1WH3A 2KZRA 3HIZA 3PLVA 3PV1A 4MSMB 2CHWA 1J19A 1WMHA 3DBRI 4G0NB 3A4SC 4E71A 2KOXA 2MCNB 4MJSB 4TKNA 2KN5A 3KW5B 1WY8A 2O6VA 3BY4B 5IA7A 1C3TA 4WQOB 1IP9A 3AI5A 4AOFA 4CO7A 4LJOB 4NJ6A 2DAFA 1TTNA 2DAJA 2EMTA 4IW0A 5TR5A 2ZPYA 4HPMB 4AUQC 5J2RA 2BYEA 3QHTA 2LRUA 1KJTA 2XBBC 3EHVA 4HPLB 2IO3B 2J7QB 3OJ3A 4MSQB 1V5TA 4EKUA 2KDEB 3TJPA 2JF5A 3HM6X 4TV3A 3AXCA 3DVGY 3ZTCA 3PHXB 4IG7B 5FR6A 4KDLB 2D3GA 2JXXA 4NAWA 1SGHA 2MBHA 2IO1B 2HD5B 4MDKE 2PJHA 2JPHA 3VHTC 4K81A 3VVWB 4GOCA 2L8JA 4KSKC 3KUCB 2QHOA 4XC2A 2PEAA 4KDIC 1RRBA 4PS7A 2C7MB 4GDKB 2KJ6A 2M1MA 1SIFA 5DPWA 1OGWA 1JRUA 3WA0A 3ZNZB 1UGMA 1U4AA 3QQ8B 4EFOA 4NPNA 2C7HA 3M3JA 4II2B 3UIPB 2GBKA 3R3MA 3H1UA 4FBJB 3QK0A 1EUVB 3PS6A 2KMAA 5J18A 4HCPB 3DVGX 4GDLA 3ZDMC 3U8ZA 4URKA 1X1MA 4FJYA 4MH0E 3CF6E 4KIKA 4W9KA 2N7DA 5AEKB 1V9JA 2N4FA 4FLHA 3V61A 4AJWA 2RGFA 3A9KA 3DVNU 1P0RA 1LQBA 4B6WA 3IG3A 3UQBA 1Z5SB 4M8MA 2NPTA 3L16A 3QCAA 4YL8A 5E6NA 4W9LA 3TCAA 2ZPNA 2MLBA 4GB9A 1KLVA 1P3QU 2XK5A 1NI2A 2ZNVC 3A1QB 3H9DA 3ENEA 3HHMA 3ZRCA 4GGQA 4IM2A 4IM3A 2KO3A 2K39A 2HJ8A 3VTWA 2N7EA 4GN1A 4TUUA 3B0AA 2CHZA 2NBVB 4G3XB 1OEYJ 3CSTA 5LXHA 3HK0A 4NJ7A 3PRMB 4JIOU 4NNJB 4MGIE 4BOSC 4LCDE 2UYZB 2ZCCA 5KHOA 3K9OB 5EDSA 1WJ6A 2DHZA 2KLCA 5LLIA 3UF8A 2BGFA 2KHWB 3DVNV 4IWPA 3B08A 4W9DA 1VCBA 2MP2B 4MEMA 2L05A 4ZRKA 1E7UA 1UH6A 3DDCB 2FAZA 5L95C 3DOWA 4DK5A 4GIVA 3EFUA 4W9HA 3M63B 3TMPB 4HXDA 1V80A 4N9F4 2C5LC 3A33B 2KWVB 1Q5WB 3CMMB 3Q3JA 3QAQA 2K25A 2KX0A 4RM8A 3RZFA 4BFRA 3JSVA 3ZNHB 2DYOA 3H7PA 2MSED 3W1SC 2GBJA 4B9KA 2C60A 2PE6B 2IO2B 2N1VA 4LDTD 2G3QB 2AEHA 2FCQA 2FCNA 2KTRB 4A20A 3HM3A 2B3AA 4FHJA 4I6LB 4MGKE 2GBNA 2JRIB 3X0WA 2LASA 3ALBA 1IPGA 2K6QA 2L0FA 5G55A 1J8CA 1WX7A 2FNJB 3AU4A 2J0MA 1S3SG 2KX3A 3SDLC 3VH4B 4FADA 4IWQA 4KSLC 4MM3A 4ANWA 4BKSD 3V60A 3X23A 2AL3A 1Z2MA 3LJ3A 2W9NA 4WWNA 2K6DB 3V6EB 3VUXA 1EO6A 3KVFB 2BYFA 4JL9A 4KV2A 4K7UA 3PVLA 2CHXA 3PREA 2WDTB 2MA9B 3ZO5B 1ZKHA 4MGZE 2WX1A 2BKRB 5JZEB 3OJ4B 2IZVB 2KWUB 2OJRA 1Q1OA 2Y5BB 2O6VB 4BKSA 2L3ZA 3QJZA 2C9WB 4DHJB 4NY0A 1WJNA 5CX3A 2ZCBA 1EF1A 1EF5A 5KHQA 3KYDD 3O65B 2HTHA 4FN2A 2JWZA 4EEWA 1V86A 1KM7A 3CSFA 1MG8A 3NS8A 5D7GA 1GC7A 4GMVA 4DBGA 4GU2A 1L7YA 2L76A 3APDA 3ZIMA 5GMVA 3AULA 2G45B 2K8BA 3ML9A 5D2MB 3ZVVA 2BYVE 2NBUA 1PQSA 3MTNB 2Z0DB 4PS3A 4XX5A 4P7IA 4W9FA 5JHAA 4BBNC 4OVUA 3DCGA 2G4DB 1WX8A 3RT3B 4HVBA 4NAWB 1RAXA 1D3ZA 2CU1A 1XT9B 2LZ6A 2K1FA 1WXSA 4IM0A 5JHBA 1WI0A 3KH0A 3ML8A 3JVZX 3ONSA 2J0JA 4I6PA 1P98A 2CR5A 5LXIB 2LUEA 4BOZB 1GJZA 2KWCA 4RMAA 4RM9A 4W9CA 1E8YA 1WYWB 3VXWA 5L83A 2KNBA 2LXAA 1TZ1A 4G50A 2FIFA 3UIOB 4GDLB 2DZKA 4KIKB 4W9GA 2LWPA 2IYDB 4NQKE 4EZLA 3EC8A 2N9EB 4A3OA 3ZDTA 3PTFC 2RD0A 4X57B 4EUTA 3IVFA 1HE8A 2MRPA 2IBIB 3A9KB 3QWZB 1YIWA 1UD7A 3DBHI 3EECA 3L08A 4J6IA 4W9JA 3TBLD 4CYEA 3NOBA 2NPTB 2KFKA 3SD5A 1E8ZA 3ZUNA 3KUZA 4W9IA 4WJOA 3SU8X 5HKHA 2CKHB 2KDFB 4OVVA 2WYQA 5E6PA 3BINA 3W1YA 1T0YA 2O2VA 2XK5B 3S2AA 1WF9A 1WJUA 1WX9A 2LGXA 3NY5A 4K1RB 3P2BA 5C1ZA 3WAOA 2IY0B 3L17A 4HDOA 3ZRFA 4MGYE 1BT0A 3SHQA 2IO0B 1RFAA 4FHKA 3W1SA 5JH5C 2FCSA 4WJPA 1C1YB 5D6JB 1QZEA 2LI5A 3RCZA 4AWJA 3NZUA 4W9EA 1TBEA 3OAWA 1S1QB 1ZW7A 4WWPA 4ICUA 1WM3A 1YX6B 2YVCA 3ECIA 4BKTA 4DHZE 5DPTA 2A4ZA 1R4MI 2C7NB 1YQBA 4GXBA 1P1AA 5E6OA 3D32A 4EZKA 4K7WA 2M0XA 3A9JA 2NCNA 3DQVA 2Z0EB 5AZHA 3ZW3A 2BKFA 2RPQA 2DZMA 2KXJA 2NR2A 3PRPB 4DHZB 4FA6A 1Y8RC 2KVRA 4M8NA 4E74A 4F1SA 3L10B 2YLMA 1V6EA 3IHPC 1H8CA 4ZYNA 2HE7A 2ZVOA 3WAPA 4HLEA 3RULA 3PZDA 3JSVB 3PGEA 2CS4A 4DWFA 3H7PB 3VH3B 1WXVA 2DZJA 1XD3B 2MBQA 4JGHB 4ZRIA 2LXCA 2MQJA 1OEYA 4MJSA 1M94A 2M8SA 4IC7B 3UGBB 3QARA 4EZJA 5J17A 4K7SA 3QX1A 1WFYA 2LVPA 1GNUA 3VFKA 1OQYA 2PPHA 4KZ0A 2GOWA 3APCA 4PYZA 4DHJD 3TL5A 4WJNA 2DYBA 3T8MA 4KVGB 3PLUA 1WMHB 1WE7A 1WGGA 2ZZPB 3DBSA 2L0TA 2J0KA 5CHFA 1XQQA 3ZNGC 1YD8U 5DPSA 2KMCA 2V4LA 3K9PB 3VUWA 3RZWC 2AL6A 3N32A 4LDTB 2K8CA 4ZRJA 4TQ1A 5IAAC 2KJHB 2GBRA 3PT2B 2AYOB 1V81A 2BWFA 1J0GA 2D10A 5AZFA 2DX5B 1G6JA 4G11A 3WIMA 1UBQA 2JZ3B 1AARA 2R2QA 1F9JA 2JT4B 2L7RA 1K8RB 2AWTA 2KDBA 5DPRA 5C23A 3R7RA 3VDZA 3GOEA 1P9DU 2FIDA 2MW5A 4E3CA 3VAWA 2NS5A 1WGRA 1WXAA 1E90A 1Q0WB 3U7DA 2ASQA 4DDGD 2EMSA 3H7SA 4GDKA 3PHWB 3RYTA 3IBEA 2WWZA 1WGHA 4HWIB 2KD0A 2KQ7A 4M0WB 3ZKJC 4A3PA 3UQAA 2WX0A 4IWOA 1GC6A 5CTRC 2LGDA 2R2OA 3MHSD 4WWOA 1ZGUB 1WR1A 2V1YA 3M62B 2D07B 1LFDA 3T9LA 4HCNB 3M95A 3QC8B 2NBWB 3I3TB 3VTVA 1I42A 3Q3FA 2LD9A 1WIAA 3VTUA 3PSEB 3DPDA 1WZ0A 2KTFA 4HK2A 4PS8A 1ISNA 1V5OA 1WR6E 2PE9A 2KJRA 2KDIA 1LM8B 4TQ0A 2JVCA 3B1LX 2K8HA 3H6NA 4MELA 4WAAA 4ZDVA 2RSUA
chains in the Genus database with same CATH superfamily
1YJ1A 4IDIA 1GUAB 3DHHC 1OQRA 2LFIA 3PZ7A 2QMTA 3QA8A 2I1JA 4IUMB 1CQVA 3APFA 4F8CB 3V6CB 1I4QA 2M17A 1TZOA 3BVGA 2E3TA 3UI3A 1H4RA 1IUEA 1WZ3A 3WAMA 1C9FA 2VRRB 4BBNF 1FNVA 1LXDA 1N62A 4JLCA 2JWUA 2DNFA 2JZZA 3IXSA 4WIPA 2WXQA 4HKZE 4D2KA 1Y56A 3DBLI 5CHWA 4GLSC 1UBIA 1UZXB 3WANA 4S0RA 2MWSB 3N30A 3V62A 3E9SA 4DDID 1F52A 1FXTB 2IJ0A 1IBXA 1WWTA 4TMAB 4BVUC 2OHFA 2OOBB 2KKCA 3TEWA 2LGYA 1ZP0B 3PRZA 4ZRPA 2BS2B 2MX2A 3GZNI 3N9YC 4USAA 3DHGC 1A5RA 2I38A 3ZTDA 3LB8C 4ANXA 5BYSA 1HZ6A 3AE3B 1FMAD 2UWQA 1RLFA 3L13A 4RF0A 4KZCA 1V49A 2KN4A 1XXGA 5AZGA 3ABVB 4ZRQA 2KDMA 1SE4A 3N3KB 3RUIB 1KOTA 4RF1A 2KZRA 3PLVA 2CHWA 3DBRI 2KOXA 2MCNB 4KGTA 1WY8A 2O6VA 2RDBC 2W3RA 3BY4B 4QAYA 1ZOYB 2DAJA 2DLBA 4YTMB 1KJTA 2WXRA 2J7QB 3EUB2 2KDEB 5I4DA 4YTPB 4N6EB 3DVGY 1ZDXA 2WXOA 5IKCM 2MJEA 4C4VA 2KWDA 4KSKC 4XC2A 4PS7A 2M1MA 2H88B 3QQ8B 2D3CA 1N63A 4II2B 2AX5A 4FBJB 1WSPA 1EUVB 3PS6A 2K0PA 3C19A 2XN9C 1X1MA 2EELA 4KIKA 2MJ3A 4AQ7A 1D4BA 1V9JA 5G5GA 3A9KA 2GLSA 1P0RA 4LK0M 1UGJA 3L16A 4YSZB 3W2DA 5E6NA 3TCAA 1VJKA 1P3QU 3A1QB 1L0YB 3ZXRA 3P1MA 4DXGA 3B0AA 1D6EC 3MHZA 4NNJB 3P4RB 2UYZB 2Q5WD 2N0SB 5AUKA 2DHZA 2J52A 3UF8A 4IWPA 4P6VF 3VRBB 2LMCA 2R61A 2IGGA 2NTTA 4MEMA 2L05A 4ZRKA 3DDCB 3DOWA 3FILB 3EFUA 4W9HA 3NVZA 4YWGG 2NMQA 2KACA 2C5LC 2AQ1B 2KX0A 4BFRA 2H89B 3JSVA 3I57A 1PGAA 1MHXA 4CQNA 2GBJA 4B9KA 2PE6B 2K3UA 2V9HA 2PVGC 1SF0A 2G3QB 2AEHA 2FCNA 4A20A 4ZHOA 4MGKE 2GBNA 1T0RC 3AE2B 2JRIB 3AEEB 4WURA 3Q3OC 4XDCA 2J0MA 4WWMA 3VH4B 4KSLC 4MM3A 4A90A 3V60A 4Q2JA 3LJ3A 4OW0A 2K6DB 2W82A 3RNEC 3ZQ4A 4ARCA 2CHXA 3PREA 3ZGZA 4MGZE 2WX1A 1UUPA 1V1PA 4RGMA 1CZPA 1FNUA 4DHJB 4NY0A 2ZCBA 1EF1A 4OZCA 2JWZA 1KM7A 3CSFA 4DBGA 3APDA 3DBLB 2K8BA 5D2MB 1YJJA 5BMGA 3MTNB 4XX5A 1YQ3B 4P7IA 2AQ2B 1QOAA 3DCGA 1JWMD 2G4DB 1RAXA 2KQ4X 4C7YA 3ML8A 2AQ3B 1TYGB 4A8XC 1PGXA 1CK1A 1P98A 5LXIB 1GJZA 1XCQL 1DOXA 4P1CC 3GZNB 4W9CA 1UF0A 1V97A 5L83A 1TZ1A 2JQRB 4G50A 2GB1A 3NG0A 1A70A 2FIFA 3MC8A 2CJOA 3WCQA 1IGCA 3IT6B 2PLPA 4W9GA 2IYDB 3EC8A 4A3OA 3PTFC 4JWSC 2IBIB 3DWMA 2RDHA 2K9XA 4CYEA 4J6IA 4A6QA 2CU3A 3SD5A 4N59A 3ZUNA 4W9IA 2CKHB 2KDFB 3DBRB 2WYQA 4OVVA 5LNK1 5E6PA 1T0YA 1FIQA 3P2BA 3RNFC 3ZRFA 1KFYB 3SHQA 3HUIA 3W1SA 1RFKA 1K53A 1C78A 1QZEA 4LTUA 2WDQB 4ICUA 1WM3A 3R2IA 2YVCA 3ECIA 4DHZE 4GXBA 3D32A 4EZKA 2M0XA 3A9JA 2NCNA 2Y5CA 3DQVA 2Z0EB 2IGDA 2QSDA 3ZW3A 4NJCA 4FA6A 4E74A 3L10B 2YLMA 1PDXA 4ZYNA 2ZVOA 3VR8B 3RULA 3PZDA 3PGEA 2CS4A 1B9RA 3H7PB 2ZW0A 2MBQA 4MJSA 1M94A 4IOIE 4K7SA 3QX1A 1WFYA 1GNUA 4LNIA 1OQYA 3APCA 3P4QB 1WMHB 2L0TA 2J0KA 2WU5B 5CHFA 5BMIA 4ZRJA 2JYEA 2KJHB 2AYOB 2D10A 1UBQA 2R2QA 1AARA 1P9DU 2FIDA 4XGAB 2MW5A 4E3CA 3U7DA 4DDGD 2N7JA 3FC4A 3AEFB 3IBEA 4NAMA 1ESFA 2KD0A 1NYRA 4A3PA 3AE8B 4LNNA 4IWOA 2LGDA 1E9MA 1FFUA 2V1YA 3M95A 3QC8B 3I3TB 1SEBD 3P4SB 3PSEB 4PS8A 1V5OA 3AE6B 2D5GA 2KDIA 1L4ZB 4YSXB 1YQ4B 2M0AA 2MHJA 2ZNVB 2BF8B 2JUOA 3Q14C 2KC1A 1FPYA 1KH0A 1STEA 3MC0B 3Q2AC 3VUYA 1CMXB 1FO4A 2PW9A 2X38A 4R3DA 4ANUA 4HJKA 1N61A 1F2RI 1NBFC 2IGHA 1WRDB 2V3SA 3ZLZA 3WALA 2MP2A 5HI1A 2BS4B 1P7EA 4WJQA 1JMLA 1J7BA 2O2VB 3AU5A 1OTRB 5CHVC 4B95A 3MP9A 5E6JA 3IAS1 2V4IB 4FULA 4CHKA 3RD2A 3Q8AA 4RGOS 5DCNA 1J7AA 4FJVB 2KFJA 1WXMA 2N1WA 3KYCD 3TIXA 2LVOA 2KT7A 4LJPB 2DZIA 2MH7A 2REXA 3BK1A 1E8WA 2KTRA 2KAJA 5G2NA 1GAQB 2KK8A 4IKGA 1TKGA 4OZAA 2ZEQA 5BO4B 3R66C 4N58A 4JQWC 2I1KA 1V2YA 3ZJVA 1NDDA 2MBEA 1WE6A 3MJWA 1RYJA 1VZ8A 1SE9A 1T0SC 1JQ4A 3PV1A 1J19A 2E6XA 4E71A 2WU2B 2LEKA 2YEPF 4JX1C 5IA7A 1SJED 2PIAA 4LJOB 5TR5A 4HPMB 1M4VA 2BYEA 4L1BA 3MC9A 1VDVA 1DGJA 4RGNA 2I2YA 3RPFC 3HM6X 1KF6B 1SJHD 4KDLB 2WS3B 4ZOHC 3AH7A 2L83A 2TSSA 2HD5B 4K81A 4LNOA 2L8JA 2QHOA 3SEBA 1R7SA 2C7MB 1JCKB 3Q8EA 4GDKB 2KJ6A 1I4XA 1FEHA 1OGWA 1UGMA 4EFOA 1GB1A 3UIPB 3ZJTA 3QK0A 4HCPB 3DVGX 4GDLA 3AECB 2BBCA 4FJYA 3CF6E 5G5HA 1TT5B 5AEKB 2N4FA 3V61A 4AJWA 1JALA 1LQBA 3IG3A 1LGRA 2NPTA 1YN4A 3Q8BA 5FR3A 1EWYC 4YL8A 4DQOC 4GB9A 2RDGA 2XK5A 2ZNVC 3H9DA 3ENEA 3EA6A 4GGQA 2V3NA 2K39A 3AE9B 2HJ8A 2ICIA 2JZPA 4GN1A 1AWDA 2G9HD 3CSTA 2BT6A 1VZ6A 2KMMA 2ZCCA 3NRZA 5EDSA 2BGFA 3DVNV 3AEBB 1N5XA 4LLGM 2QILA 5BMHA 1E7UA 1UH6A 4S17A 5L95C 4DK5A 3TEZA 1LO5D 4PK1A 4C80A 3AEDB 1MHHE 3A33B 1Q5WB 3AE7B 3Q3JA 3QAQA 1MG4A 1GOZA 1IBXB 4RH6A 4BAXA 4FXCA 4AS1A 1ET6A 4ACFA 2B3AA 1ZUD2 4H2AA 3ALBA 1IPGA 2K6QA 5G55A 2INCC 2FNJB 2KX3A 2JX5A 3SDLC 4FADA 4IWQA 4ANWA 1L6UA 1Z2MA 2BTEA 1EO6A 4JL9A 3PVLA 1XLOA 2BKRB 5JZEB 2IZVB 2KWUB 2BYTA 2Y5BB 2O6VB 4BKSA 4EE2A 2C9WB 1SIJA 3CIRB 1WJNA 5KHQA 5MPOA 3KYDD 3O65B 4FN2A 2PTLA 2Z8LA 4HROA 4UDUC 2WXKA 5D7GA 4GMVA 3DHIC 1L7YA 5D3IB 3N20C 1E0ZA 2WXFA 3AULA 4PS3A 1PQSA 2BQQA 5JHAA 1WX8A 3HVZA 1N5WA 3I9V1 1AW7A 1C4AA 3VR9B 2K1FA 1WXSA 1WI0A 2FBWB 3KH0A 4C4VB 1I7HA 2K5PA 4I6PA 2JYTA 4OZBA 2KWCA 1UNSA 1C4PA 4RMAA 5HFYA 1E8YA 3VXWA 1HTOA 2DZKA 4KIKB 1VLBA 2LWPA 2N9EB 3ZXVA 2RD0A 4X57B 3A9KB 2MRPA 3QWZB 3DBHI 1XLNA 2JXTA 2KFKA 5HKHA 1HZ5A 3W1YA 1WJUA 2LGXA 4HJGE 4MT5A 5C1ZA 3WAOA 3L17A 1SBBB 1RFAA 3NVYA 4WJPA 1C1YB 5D6JB 2LI5A 4AWJA 5JXVA 3NZUA 4W9EA 5T8IA 1ZW7A 3SFEB 1YX6B 3RNGC 4YSYB 4B0MA 1P1AA 1K51A 2BB6A 4K7WA 1XEEA 1ENFA 1MI0A 1I4GA 4TSSA 3N1ZC 3PRPB 1TS3A 3DWGC 1Y8RC 4M8NA 1D5ZC 3BVMA 3WAPA 3JSVB 3RFZB 1XD3B 4JGHB 4ZRIA 2WXMA 2LXCA 3O13A 1D5MC 3BYTB 3QARA 2LVPA 2PPHA 2GOWA 3KQ4A 1I4HA 4WJNA 2DYBA 3TL5A 1PYWD 3PLUA 1WE7A 3ZNGC 1YD8U 2V4LA 3Q6BA 1I4RA 3W9CB 4LDTB 1GB4A 4TQ1A 4MM3B 1MJDA 1F77A 5AZFA 2DX5B 1V1OA 2JZ3B 4K3BA 1F9JA 2WXJA 2AWTA 5C23A 5DPRA 3GOEA 4HEA1 2WXHA 1V1PB 1WGRA 1BMLC 1Q0WB 4B0EA 2ASQA 3PHWB 4HWIB 2KQ7A 3UQAA 2WX0A 4C00A 1F2RC 4WWOA 1ZGUB 2QCZA 1Q10A 3T3NA 3VTVA 3DPDA 4HK2A 3E56A 1ISNA 1WR6E 2PE9A 2FUG1 1ZPSA 4WAAA 3H6NA 2M19A 3P4PB 2RSUA 4I6NB 3RMKC 3R7QA 1SE3A 1VD2A 4XZ4A 3NZSA 2LVQA 2JY6A 1FFVA 2JU6X 4HRSA 2CJNA 2FUHB 1L2NA 3NZ3A 4F7ZA 2BWES 3BYYB 2J53A 4AP4C 5D94A 2FCMA 4A9AA 4KGSA 1IYFA 3UINB 4ANVA 1I35A 1FD6A 1QILA 2D2QA 3PPAA 3VRAB 4DXAB 4MH8A 4REZA 2N9KA 4EOYA 1V8CA 3AM9A 4XWWA 1KLUD 1JWBD 2N9PC 2JRHA 3L54A 2GI9A 2ZJDA 1F0ZA 3LYYA 4AJYB 2WP9B 3U30A 1SSNA 2RR9A 3JW0X 4ICVA 1WGYA 2WQYB 1WYGA 3Q3NC 1WGKA 2Z59B 3JYUA 2XEWA 1OFFA 3AMZA 2NTSA 3BVZA 2DYMA 1ZXIA 1E5WA 3A9JB 2WLBA 3OLMD 5EE9A 2L00B 3I63C 2MJDA 2KC2A 2LUMA 2KQSA 1NENB 2O6VD 1UWMA 3IFWB 3VQIA 4P16A 3HIZA 1AYFA 2GBMA 2KLGA 2SEBD 1WMHA 3AB5A 4A55A 4MJSB 2BS3B 4TKNA 2KN5A 1ZDVA 2OJWA 1FXAA 4WQOB 1IP9A 4AOFA 4CO7A 4JWUC 4NJ6A 4IW0A 3DBHB 4AUQC 2LRUA 2RMMA 2XBBC 4L23A 3EHVA 3OJ3A 3GS2A 4EKUA 2JF5A 3CWIA 3ZTCA 3PHXB 2M56B 5FR6A 3FAHA 1WRIA 1QT9A 4NAWA 1EU4A 2GRIA 2MBHA 1XO3A 3EFCA 5EE1A 3MJ5A 4MDKE 2JPHA 3VHTC 1L6VA 3VVWB 1XLPA 3I5JC 3KUCB 2QIEB 2HDEA 2DWQA 2IDYA 1FCCC 1SIFA 3AEAB 3WA0A 3ZNZB 1U4AA 4NPNA 1OQQA 3R3MA 3H1UA 1FXIA 2B76B 5H92C 2X8XX 2KMAA 5J18A 4MH0E 1L0XB 1KLGD 1JW9D 2N7DA 2RGFA 1JWSD 3DVNU 4RCOA 2SAKA 4B6WA 4M8MA 3ZJUA 5IOIA 3QCAA 1KLVA 2V0GA 1QOFA 1J7CA 4IM2A 4IM3A 2KO3A 3AE1B 2CHZA 2NBVB 4C7ZA 2EKIA 4G3XB 1QOGA 1OEYJ 3HK0A 4NJ7A 3PRMB 4M02A 4MGIE 2WNMA 4LCDE 3SFDB 2ACZB 5KHOA 3K9OB 4DXFA 2KHWB 1E7PB 3B08A 2INNE 4W9DA 1VCBA 2MP2B 3B2GA 1HEZE 1C79A 2WGSA 3TMPB 4RFBA 3CMMB 4RM8A 3RZFA 1VZ7A 2DYOA 2MSED 3W1SC 4KKIA 2LHDA 2C60A 1P7FA 4LDTD 1TY2A 2KTRB 4FHJA 3RNCC 2UU7A 2L0FA 3AU4A 1S3SG 1EU3A 2W55A 3X23A 3VUXA 4WWNA 2WDTB 1ZKHA 1K50A 3OJ4B 5AUIA 3U52E 1Q1OA 1CJEA 1K52A 3QJZA 2W54A 2PKOA 1EF5A 4M0WA 3NJTA 1V86A 1MG8A 4LNKA 5HHDG 4GU2A 3LXFA 2L76A 3ZIMA 2L32A 2G45B 4ZHPA 3ML9A 2QDFA 3UQBA 2NBUA 1JROA 1JRPA 2Z0DB 3RNBC 4W9FA 1EM7A 4OVUA 4RGTA 4HVBA 2XNAC 2CU1A 1XT9B 4IM0A 5JHBA 3B9JA 3ONSA 2J0JA 1YN5A 3R8BA 2LGSA 4BOZB 2W3SA 4C56C 4RM9A 2WDRB 3IAM1 1L0VB 1WYWB 2JSVX 4L2YA 2LXAA 2WXIA 4YTNB 2KYWA 1TS2A 2IPKD 1PUTA 3UIOB 1ZXHA 4XE0A 4GDLB 5HG2A 1N6ZA 5EE0A 3ZDTA 3ZYYX 1YIWA 3EECA 3TBLD 3L08A 4W9JA 2NPTB 1E8ZA 4WJOA 3P42A 5GXGB 1KTKA 1YJIA 3ETRA 3T3OA 2XK5B 1WF9A 4KKJA 1FRRA 4HDOA 1AN8A 4MGYE 4FHKA 2K22A 3RCZA 5C2TB 3U7ZA 1TBEA 1TIFA 3OAWA 1HQRD 4BKTA 5DPTA 2A4ZA 1R4MI 2C7NB 1YQBA 4RNAA 2WXLA 4ZYSA 3NS1A 5AZHA 1T0QC 2BKFA 2KXJA 2NR2A 4DHZB 1DOYA 1T5XD 1DOIA 1V6EA 3IHPC 4WQMA 1H8CA 4HLEA 1ZE3D 1WXVA 1YMHE 2WDVB 3HVDA 2MQJA 1OEYA 2M8SA 4EZJA 2VH1A 5J17A 5IO9A 1TKYA 4PYZA 1WGGA 1ROEA 1KRHA 2ZZPB 3DBSA 4HKQA 3K9PB 2K8CA 5IAAC 3PT2B 2BVCA 1V81A 2VZKB 2BWFA 1G6JA 4G11A 3WIMA 2JT4B 2L7RA 3BIID 3VDZA 3R7RA 1QQRA 4J3OD 1QOBA 1EWCA 2ON8A 3VAWA 4US9A 1E90A 3RYTA 1C76A 3AN1A 2Y5PA 1QKZA 4KX6B 2G1EA 3MHSD 2D07B 1LFDA 4HCNB 1T3QA 2LD9A 1SB3C 2LHEA 4M01A 4ZDVA 3Q69A 1C77A 3AEGB 4K3CA 3KUDB 2LRWA 3A1QA 4M00A 1F1HA 4YT0B 3LDZE 2GMIC 4ASWC 4GSWA 1PGBA 3PO0A 4XWTA 2BPSA 2VH2A 3ZNID 4WAFA 2QJLA 1GG3A 4FJZA 2D11A 2KFKB 2A5UA 2LJ5A 2PMVA 1E8XA 2MBOA 2YEPB 3A4RA 3NHEB 4HDQA 3FILA 5FK9C 1TGZB 4II3B 2M4NA 3QIJA 5BYQA 4NQLB 3W5VB 2L1AA 2FE8A 2N9XA 4PYUA 1RM6C 2KANA 2G4SA 1UWXA 3TUOA 1JWAD 1YX5B 1UELA 1E7VA 4BKGA 1WGDA 1WM2A 1VR9A 2ZW1A 4P1BC 3KWVA 1R4NI 1TJEA 3C0RB 2EKEC 4ARIA 1ACCA 3GE3C 2NVUI 1WJ4A 3NVWA 4YXDB 1E6EB 2ZVNA 4ITKA 3AV8A 3L0WB 1QLBB 1E10A 2MBBB 3H8HA 2INPE 2IY1B 2DENB 1WH3A 1WXQA 4MSMB 4G0NB 3A4SC 2OEDA 3OWEB 3KW5B 3Q8FA 3KLSX 1C3TA 2J42A 2QEJC 3AI5A 2WHIA 2DAFA 1TTNA 3BK2A 2EMTA 5J2RA 2ZPYA 3QHTA 4HPLB 2IO3B 4MSQB 1V5TA 3TJPA 4TV3A 4PT5A 1I4PA 3AXCA 1QF6A 4IG7B 2QC8A 4US8A 2D3GA 2JXXA 1SGHA 2IO1B 1HTQA 2PJHA 1XCTL 4GOCA 3NUHB 2PEAA 4KDIC 4XYCA 1RRBA 1PFDA 1T6BX 5DPWA 3AE5B 1JRUA 1R4MB 3HRDD 2C7HA 3M3JA 2GBKA 1TY0A 2PVOD 4LNFA 3ZDMC 3U8ZA 4URKA 3N1XC 3RNAC 4W9KA 4FLHA 1Z5SB 3TEXA 1HA5A 5H8YE 4W9LA 2ZPNA 2MLBA 1NI2A 1MVKA 3HHMA 3ZRCA 4HPPA 2HJ1A 3VTWA 2N7EA 4TUUA 1D5XC 1RWSA 5LXHA 1JWUD 2RPVA 4JIOU 4BOSC 4MACA 2J4XA 1WJ6A 2KLCA 5LLIA 1B1ZA 2FAZA 4GIVA 3M63B 4HXDA 3V3XA 3URYA 4O1NA 4JE3B 1V80A 1XLQA 4N9F4 2KWVB 3RI7C 5BYRA 2K25A 3ZNHB 3H7PA 1N60A 2IO2B 2N1VA 2FCQA 3U2SC 3HM3A 2VZKD 4I6LB 1HXYD 3X0WA 2LASA 4NZLB 1J8CA 1WX7A 3FKYA 3IT4B 1TKEA 2LJIA 4BKSD 2AL3A 3RN9C 2W9NA 3V6EB 3J9CA 3KVFB 5D3DA 2BYFA 4KV2A 4K7UA 4OHJA 2MA9B 3ZO5B 3BWUD 5FKAC 2OJRA 4WH4A 2L3ZA 3C8YA 1GPXA 1BUIC 5CX3A 2HTHA 4EEWA 2WXGA 3NS8A 1GC7A 1NYQA 1L4DB 3N1YC 1NEKB 5GMVA 3ZVVA 2BYVE 4BBNC 3RT3B 4NAWB 1D3ZA 2LZ6A 1BXTA 4JPSA 3JVZX 2Y3AA 3SR6A 2CR5A 2LUEA 1IGDA 1L5PA 5IP4D 1FCLA 4XDDA 2KNBA 3V05A 1R4NB 2LGIA 5IN7A 1YN3A 4NQKE 4EZLA 2INDC 4EUTA 3IVFA 1HE8A 3AE4B 1DYQA 1UD7A 3NOBA 1FNWA 3KUZA 3SU8X 3BINA 2DBYA 1FRDA 2O2VA 3S2AA 1WX9A 3NY5A 1YNTE 4K1RB 3PZ8A 2IY0B 1BT0A 2IO0B 1TS4A 2FCSA 3TSSA 5JH5C 3KWLA 1S1QB 3L4PA 4WWPA 2KVZA 1C4CA 5E6OA 2L52A 1NI3A 3GE8C 3OG5A 5EE3A 2RPQA 2DZMA 2BW2A 2KVRA 4F1SA 2HE7A 1TS5A 1SE2A 3BZDB 2D3BA 3VH3B 4DWFA 1YOVB 4KGRA 2DZJA 2ONQA 3R2TA 1MFWA 4IC7B 3UGBB 3VFKA 2WXPA 4KZ0A 5C3JB 2MEKA 4DHJD 3T8MA 4KVGB 1VRAB 1XQQA 5DPSA 2KMCA 3VUWA 2N9LA 1MPEA 3RZWC 2AL6A 3N32A 3P63A 1SXTA 3W5UB 2BB5A 2D3AA 2GBRA 3GP7A 1J0GA 3Q8CA 3Q3MC 3GB1A 1K8RB 2KDBA 1FM0D 1ET9A 2NS5A 1WXAA 5TSSA 4BZAA 3NVVA 3U4EG 1NVID 2EMSA 3H7SA 4GDKA 2WWZA 1WGHA 3ZKJC 3EGRA 4M0WB 1GC6A 5CTRC 2R2OA 2WXNA 1WR1A 3M62B 3T9LA 3TEYA 2NBWB 1I42A 3Q3FA 1WIAA 4OVZA 3VTUA 1WZ0A 2KTFA 1XF5L 2HTME 2KJRA 1LM8B 3B2FA 4TQ0A 2JVCA 3B1LX 2K8HA 2V3PA 4MELA 3MFGA
chains in the Genus database with same CATH topology
4I6NB 1YJ1A 2ZNVB 3R7QA 1VD2A 4XZ4A 2BF8B 2JUOA 3NZSA 3KUDB 2LRWA 1GUAB 2KC1A 3A1QA 2LVQA 2JY6A 3QA8A 2I1JA 4IUMB 3APFA 3LDZE 2FUHB 3V6CB 2GMIC 4F8CB 1L2NA 4ASWC 4GSWA 2M17A 4F7ZA 2BWES 3VUYA 4AP4C 1CMXB 2FCMA 5D94A 2BPSA 1H4RA 1WZ3A 3WAMA 1IYFA 2VRRB 4HJKA 3UINB 4ANVA 4BBNF 4ANUA 1I35A 3ZNID 1LXDA 2D2QA 1NBFC 1GG3A 4JLCA 1WRDB 2V3SA 3PPAA 4FJZA 4DXAB 2D11A 2KFKB 2A5UA 2JZZA 2LJ5A 3WALA 3ZLZA 2MP2A 4EOYA 1E8XA 3DBLI 4WJQA 2MBOA 5CHWA 3A4RA 3NHEB 4HDQA 2O2VB 1TGZB 3AU5A 1UBIA 2M4NA 4II3B 1UZXB 3QIJA 1OTRB 5CHVC 4B95A 3WANA 4NQLB 4FULA 4CHKA 2N9PC 2JRHA 3L54A 3RD2A 2N9XA 4PYUA 2ZJDA 4AJYB 5DCNA 2MWSB 2KANA 2G4SA 3U30A 3N30A 4FJVB 2KFJA 3V62A 1WXMA 2N1WA 4DDID 1FXTB 1YX5B 2RR9A 3JW0X 4ICVA 3KYCD 1WGYA 3TIXA 4BVUC 2OOBB 2KKCA 2LVOA 1UELA 1E7VA 2LGYA 3PRZA 4LJPB 4BKGA 2DZIA 2Z59B 3JYUA 2XEWA 2REXA 1WGDA 1WM2A 2MX2A 3GZNI 1E8WA 2KTRA 2DYMA 5G2NA 1E5WA 3A9JB 1A5RA 3OLMD 2KK8A 1R4NI 3ZTDA 2L00B 4ANXA 3C0RB 2EKEC 2UWQA 2ZEQA 1RLFA 5BO4B 3R66C 3L13A 2NVUI 1WJ4A 4KZCA 2KC2A 1V49A 2KQSA 4JQWC 2I1KA 1V2YA 2O6VD 1NDDA 2ZVNA 2MBEA 3L0WB 5AZGA 1WE6A 3MJWA 3N3KB 3IFWB 3RUIB 3VQIA 2MBBB 1KOTA 1SE9A 2DENB 2GBMA 2IY1B 2KLGA 1WH3A 2KZRA 3HIZA 3PLVA 3PV1A 4MSMB 2CHWA 1J19A 1WMHA 3DBRI 4G0NB 3A4SC 4E71A 2KOXA 2MCNB 4MJSB 4TKNA 2KN5A 3KW5B 1WY8A 2O6VA 3BY4B 5IA7A 1C3TA 4WQOB 1IP9A 3AI5A 4AOFA 4CO7A 4LJOB 4NJ6A 2DAFA 1TTNA 2DAJA 2EMTA 4IW0A 5TR5A 2ZPYA 4HPMB 4AUQC 5J2RA 2BYEA 3QHTA 2LRUA 1KJTA 2XBBC 3EHVA 4HPLB 2IO3B 2J7QB 3OJ3A 4MSQB 1V5TA 4EKUA 2KDEB 3TJPA 2JF5A 3HM6X 4TV3A 3AXCA 3DVGY 3ZTCA 3PHXB 4IG7B 5FR6A 4KDLB 2D3GA 2JXXA 4NAWA 1SGHA 2MBHA 2IO1B 2HD5B 4MDKE 2PJHA 2JPHA 3VHTC 4K81A 3VVWB 4GOCA 2L8JA 4KSKC 3KUCB 2QHOA 4XC2A 2PEAA 4KDIC 1RRBA 4PS7A 2C7MB 4GDKB 2KJ6A 2M1MA 1SIFA 5DPWA 1OGWA 1JRUA 3WA0A 3ZNZB 1UGMA 1U4AA 3QQ8B 4EFOA 4NPNA 2C7HA 3M3JA 4II2B 3UIPB 2GBKA 3R3MA 3H1UA 4FBJB 3QK0A 1EUVB 3PS6A 2KMAA 5J18A 4HCPB 3DVGX 4GDLA 3ZDMC 3U8ZA 4URKA 1X1MA 4FJYA 4MH0E 3CF6E 4KIKA 4W9KA 2N7DA 5AEKB 1V9JA 2N4FA 4FLHA 3V61A 4AJWA 2RGFA 3A9KA 3DVNU 1P0RA 1LQBA 4B6WA 3IG3A 3UQBA 1Z5SB 4M8MA 2NPTA 3L16A 3QCAA 4YL8A 5E6NA 4W9LA 3TCAA 2ZPNA 2MLBA 4GB9A 1KLVA 1P3QU 2XK5A 1NI2A 2ZNVC 3A1QB 3H9DA 3ENEA 3HHMA 3ZRCA 4GGQA 4IM2A 4IM3A 2KO3A 2K39A 2HJ8A 3VTWA 2N7EA 4GN1A 4TUUA 3B0AA 2CHZA 2NBVB 4G3XB 1OEYJ 3CSTA 5LXHA 3HK0A 4NJ7A 3PRMB 4JIOU 4NNJB 4MGIE 4BOSC 4LCDE 2UYZB 2ZCCA 5KHOA 3K9OB 5EDSA 1WJ6A 2DHZA 2KLCA 5LLIA 3UF8A 2BGFA 2KHWB 3DVNV 4IWPA 3B08A 4W9DA 1VCBA 2MP2B 4MEMA 2L05A 4ZRKA 1E7UA 1UH6A 3DDCB 2FAZA 5L95C 3DOWA 4DK5A 4GIVA 3EFUA 4W9HA 3M63B 3TMPB 4HXDA 1V80A 4N9F4 2C5LC 3A33B 2KWVB 1Q5WB 3CMMB 3Q3JA 3QAQA 2K25A 2KX0A 4RM8A 3RZFA 4BFRA 3JSVA 3ZNHB 2DYOA 3H7PA 2MSED 3W1SC 2GBJA 4B9KA 2C60A 2PE6B 2IO2B 2N1VA 4LDTD 2G3QB 2AEHA 2FCQA 2FCNA 2KTRB 4A20A 3HM3A 2B3AA 4FHJA 4I6LB 4MGKE 2GBNA 2JRIB 3X0WA 2LASA 3ALBA 1IPGA 2K6QA 2L0FA 5G55A 1J8CA 1WX7A 2FNJB 3AU4A 2J0MA 1S3SG 2KX3A 3SDLC 3VH4B 4FADA 4IWQA 4KSLC 4MM3A 4ANWA 4BKSD 3V60A 3X23A 2AL3A 1Z2MA 3LJ3A 2W9NA 4WWNA 2K6DB 3V6EB 3VUXA 1EO6A 3KVFB 2BYFA 4JL9A 4KV2A 4K7UA 3PVLA 2CHXA 3PREA 2WDTB 2MA9B 3ZO5B 1ZKHA 4MGZE 2WX1A 2BKRB 5JZEB 3OJ4B 2IZVB 2KWUB 2OJRA 1Q1OA 2Y5BB 2O6VB 4BKSA 2L3ZA 3QJZA 2C9WB 4DHJB 4NY0A 1WJNA 5CX3A 2ZCBA 1EF1A 1EF5A 5KHQA 3KYDD 3O65B 2HTHA 4FN2A 2JWZA 4EEWA 1V86A 1KM7A 3CSFA 1MG8A 3NS8A 5D7GA 1GC7A 4GMVA 4DBGA 4GU2A 1L7YA 2L76A 3APDA 3ZIMA 5GMVA 3AULA 2G45B 2K8BA 3ML9A 5D2MB 3ZVVA 2BYVE 2NBUA 1PQSA 3MTNB 2Z0DB 4PS3A 4XX5A 4P7IA 4W9FA 5JHAA 4BBNC 4OVUA 3DCGA 2G4DB 1WX8A 3RT3B 4HVBA 4NAWB 1RAXA 1D3ZA 2CU1A 1XT9B 2LZ6A 2K1FA 1WXSA 4IM0A 5JHBA 1WI0A 3KH0A 3ML8A 3JVZX 3ONSA 2J0JA 4I6PA 1P98A 2CR5A 5LXIB 2LUEA 4BOZB 1GJZA 2KWCA 4RMAA 4RM9A 4W9CA 1E8YA 1WYWB 3VXWA 5L83A 2KNBA 2LXAA 1TZ1A 4G50A 2FIFA 3UIOB 4GDLB 2DZKA 4KIKB 4W9GA 2LWPA 2IYDB 4NQKE 4EZLA 3EC8A 2N9EB 4A3OA 3ZDTA 3PTFC 2RD0A 4X57B 4EUTA 3IVFA 1HE8A 2MRPA 2IBIB 3A9KB 3QWZB 1YIWA 1UD7A 3DBHI 3EECA 3L08A 4J6IA 4W9JA 3TBLD 4CYEA 3NOBA 2NPTB 2KFKA 3SD5A 1E8ZA 3ZUNA 3KUZA 4W9IA 4WJOA 3SU8X 5HKHA 2CKHB 2KDFB 4OVVA 2WYQA 5E6PA 3BINA 3W1YA 1T0YA 2O2VA 2XK5B 3S2AA 1WF9A 1WJUA 1WX9A 2LGXA 3NY5A 4K1RB 3P2BA 5C1ZA 3WAOA 2IY0B 3L17A 4HDOA 3ZRFA 4MGYE 1BT0A 3SHQA 2IO0B 1RFAA 4FHKA 3W1SA 5JH5C 2FCSA 4WJPA 1C1YB 5D6JB 1QZEA 2LI5A 3RCZA 4AWJA 3NZUA 4W9EA 1TBEA 3OAWA 1S1QB 1ZW7A 4WWPA 4ICUA 1WM3A 1YX6B 2YVCA 3ECIA 4BKTA 4DHZE 5DPTA 2A4ZA 1R4MI 2C7NB 1YQBA 4GXBA 1P1AA 5E6OA 3D32A 4EZKA 4K7WA 2M0XA 3A9JA 2NCNA 3DQVA 2Z0EB 5AZHA 3ZW3A 2BKFA 2RPQA 2DZMA 2KXJA 2NR2A 3PRPB 4DHZB 4FA6A 1Y8RC 2KVRA 4M8NA 4E74A 4F1SA 3L10B 2YLMA 1V6EA 3IHPC 1H8CA 4ZYNA 2HE7A 2ZVOA 3WAPA 4HLEA 3RULA 3PZDA 3JSVB 3PGEA 2CS4A 4DWFA 3H7PB 3VH3B 1WXVA 2DZJA 1XD3B 2MBQA 4JGHB 4ZRIA 2LXCA 2MQJA 1OEYA 4MJSA 1M94A 2M8SA 4IC7B 3UGBB 3QARA 4EZJA 5J17A 4K7SA 3QX1A 1WFYA 2LVPA 1GNUA 3VFKA 1OQYA 2PPHA 4KZ0A 2GOWA 3APCA 4PYZA 4DHJD 3TL5A 4WJNA 2DYBA 3T8MA 4KVGB 3PLUA 1WMHB 1WE7A 1WGGA 2ZZPB 3DBSA 2L0TA 2J0KA 5CHFA 1XQQA 3ZNGC 1YD8U 5DPSA 2KMCA 2V4LA 3K9PB 3VUWA 3RZWC 2AL6A 3N32A 4LDTB 2K8CA 4ZRJA 4TQ1A 5IAAC 2KJHB 2GBRA 3PT2B 2AYOB 1V81A 2BWFA 1J0GA 2D10A 5AZFA 2DX5B 1G6JA 4G11A 3WIMA 1UBQA 2JZ3B 1AARA 2R2QA 1F9JA 2JT4B 2L7RA 1K8RB 2AWTA 2KDBA 5DPRA 5C23A 3R7RA 3VDZA 3GOEA 1P9DU 2FIDA 2MW5A 4E3CA 3VAWA 2NS5A 1WGRA 1WXAA 1E90A 1Q0WB 3U7DA 2ASQA 4DDGD 2EMSA 3H7SA 4GDKA 3PHWB 3RYTA 3IBEA 2WWZA 1WGHA 4HWIB 2KD0A 2KQ7A 4M0WB 3ZKJC 4A3PA 3UQAA 2WX0A 4IWOA 1GC6A 5CTRC 2LGDA 2R2OA 3MHSD 4WWOA 1ZGUB 1WR1A 2V1YA 3M62B 2D07B 1LFDA 3T9LA 4HCNB 3M95A 3QC8B 2NBWB 3I3TB 3VTVA 1I42A 3Q3FA 2LD9A 1WIAA 3VTUA 3PSEB 3DPDA 1WZ0A 2KTFA 4HK2A 4PS8A 1ISNA 1V5OA 1WR6E 2PE9A 2KJRA 2KDIA 1LM8B 4TQ0A 2JVCA 3B1LX 2K8HA 3H6NA 4MELA 4WAAA 4ZDVA 2RSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I6N B;  1YJ1 A;  2ZNV B;  3R7Q A;  1VD2 A;  4XZ4 A;  2BF8 B;  2JUO A;  3NZS A;  3KUD B;  2LRW A;  1GUA B;  2KC1 A;  3A1Q A;  2LVQ A;  2JY6 A;  3QA8 A;  2I1J A;  4IUM B;  3APF A;  3LDZ E;  2FUH B;  3V6C B;  2GMI C;  4F8C B;  1L2N A;  4ASW C;  4GSW A;  2M17 A;  4F7Z A;  2BWE S;  3VUY A;  4AP4 C;  1CMX B;  2FCM A;  5D94 A;  2BPS A;  1H4R A;  1WZ3 A;  3WAM A;  1IYF A;  2VRR B;  4HJK A;  3UIN B;  4ANV A;  4BBN F;  4ANU A;  1I35 A;  3ZNI D;  1LXD A;  2D2Q A;  1NBF C;  1GG3 A;  4JLC A;  1WRD B;  2V3S A;  3PPA A;  4FJZ A;  4DXA B;  2D11 A;  2KFK B;  2A5U A;  2JZZ A;  2LJ5 A;  3WAL A;  3ZLZ A;  2MP2 A;  4EOY A;  1E8X A;  3DBL I;  4WJQ A;  2MBO A;  5CHW A;  3A4R A;  3NHE B;  4HDQ A;  2O2V B;  1TGZ B;  3AU5 A;  1UBI A;  2M4N A;  4II3 B;  1UZX B;  3QIJ A;  1OTR B;  5CHV C;  4B95 A;  3WAN A;  4NQL B;  4FUL A;  4CHK A;  2N9P C;  2JRH A;  3L54 A;  3RD2 A;  2N9X A;  4PYU A;  2ZJD A;  4AJY B;  5DCN A;  2MWS B;  2KAN A;  2G4S A;  3U30 A;  3N30 A;  4FJV B;  2KFJ A;  3V62 A;  1WXM A;  2N1W A;  4DDI D;  1FXT B;  1YX5 B;  2RR9 A;  3JW0 X;  4ICV A;  3KYC D;  1WGY A;  3TIX A;  4BVU C;  2OOB B;  2KKC A;  2LVO A;  1UEL A;  1E7V A;  2LGY A;  3PRZ A;  4LJP B;  4BKG A;  2DZI A;  2Z59 B;  3JYU A;  2XEW A;  2REX A;  1WGD A;  1WM2 A;  2MX2 A;  3GZN I;  1E8W A;  2KTR A;  2DYM A;  5G2N A;  1E5W A;  3A9J B;  1A5R A;  3OLM D;  2KK8 A;  1R4N I;  3ZTD A;  2L00 B;  4ANX A;  3C0R B;  2EKE C;  2UWQ A;  2ZEQ A;  1RLF A;  5BO4 B;  3R66 C;  3L13 A;  2NVU I;  1WJ4 A;  4KZC A;  2KC2 A;  1V49 A;  2KQS A;  4JQW C;  2I1K A;  1V2Y A;  2O6V D;  1NDD A;  2ZVN A;  2MBE A;  3L0W B;  5AZG A;  1WE6 A;  3MJW A;  3N3K B;  3IFW B;  3RUI B;  3VQI A;  2MBB B;  1KOT A;  1SE9 A;  2DEN B;  2GBM A;  2IY1 B;  2KLG A;  1WH3 A;  2KZR A;  3HIZ A;  3PLV A;  3PV1 A;  4MSM B;  2CHW A;  1J19 A;  1WMH A;  3DBR I;  4G0N B;  3A4S C;  4E71 A;  2KOX A;  2MCN B;  4MJS B;  4TKN A;  2KN5 A;  3KW5 B;  1WY8 A;  2O6V A;  3BY4 B;  5IA7 A;  1C3T A;  4WQO B;  1IP9 A;  3AI5 A;  4AOF A;  4CO7 A;  4LJO B;  4NJ6 A;  2DAF A;  1TTN A;  2DAJ A;  2EMT A;  4IW0 A;  5TR5 A;  2ZPY A;  4HPM B;  4AUQ C;  5J2R A;  2BYE A;  3QHT A;  2LRU A;  1KJT A;  2XBB C;  3EHV A;  4HPL B;  2IO3 B;  2J7Q B;  3OJ3 A;  4MSQ B;  1V5T A;  4EKU A;  2KDE B;  3TJP A;  2JF5 A;  3HM6 X;  4TV3 A;  3AXC A;  3DVG Y;  3ZTC A;  3PHX B;  4IG7 B;  5FR6 A;  4KDL B;  2D3G A;  2JXX A;  4NAW A;  1SGH A;  2MBH A;  2IO1 B;  2HD5 B;  4MDK E;  2PJH A;  2JPH A;  3VHT C;  4K81 A;  3VVW B;  4GOC A;  2L8J A;  4KSK C;  3KUC B;  2QHO A;  4XC2 A;  2PEA A;  4KDI C;  1RRB A;  4PS7 A;  2C7M B;  4GDK B;  2KJ6 A;  2M1M A;  1SIF A;  5DPW A;  1OGW A;  1JRU A;  3WA0 A;  3ZNZ B;  1UGM A;  1U4A A;  3QQ8 B;  4EFO A;  4NPN A;  2C7H A;  3M3J A;  4II2 B;  3UIP B;  2GBK A;  3R3M A;  3H1U A;  4FBJ B;  3QK0 A;  1EUV B;  3PS6 A;  2KMA A;  5J18 A;  4HCP B;  3DVG X;  4GDL A;  3ZDM C;  3U8Z A;  4URK A;  1X1M A;  4FJY A;  4MH0 E;  3CF6 E;  4KIK A;  4W9K A;  2N7D A;  5AEK B;  1V9J A;  2N4F A;  4FLH A;  3V61 A;  4AJW A;  2RGF A;  3A9K A;  3DVN U;  1P0R A;  1LQB A;  4B6W A;  3IG3 A;  3UQB A;  1Z5S B;  4M8M A;  2NPT A;  3L16 A;  3QCA A;  4YL8 A;  5E6N A;  4W9L A;  3TCA A;  2ZPN A;  2MLB A;  4GB9 A;  1KLV A;  1P3Q U;  2XK5 A;  1NI2 A;  2ZNV C;  3A1Q B;  3H9D A;  3ENE A;  3HHM A;  3ZRC A;  4GGQ A;  4IM2 A;  4IM3 A;  2KO3 A;  2K39 A;  2HJ8 A;  3VTW A;  2N7E A;  4GN1 A;  4TUU A;  3B0A A;  2CHZ A;  2NBV B;  4G3X B;  1OEY J;  3CST A;  5LXH A;  3HK0 A;  4NJ7 A;  3PRM B;  4JIO U;  4NNJ B;  4MGI E;  4BOS C;  4LCD E;  2UYZ B;  2ZCC A;  5KHO A;  3K9O B;  5EDS A;  1WJ6 A;  2DHZ A;  2KLC A;  5LLI A;  3UF8 A;  2BGF A;  2KHW B;  3DVN V;  4IWP A;  3B08 A;  4W9D A;  1VCB A;  2MP2 B;  4MEM A;  2L05 A;  4ZRK A;  1E7U A;  1UH6 A;  3DDC B;  2FAZ A;  5L95 C;  3DOW A;  4DK5 A;  4GIV A;  3EFU A;  4W9H A;  3M63 B;  3TMP B;  4HXD A;  1V80 A;  4N9F 4;  2C5L C;  3A33 B;  2KWV B;  1Q5W B;  3CMM B;  3Q3J A;  3QAQ A;  2K25 A;  2KX0 A;  4RM8 A;  3RZF A;  4BFR A;  3JSV A;  3ZNH B;  2DYO A;  3H7P A;  2MSE D;  3W1S C;  2GBJ A;  4B9K A;  2C60 A;  2PE6 B;  2IO2 B;  2N1V A;  4LDT D;  2G3Q B;  2AEH A;  2FCQ A;  2FCN A;  2KTR B;  4A20 A;  3HM3 A;  2B3A A;  4FHJ A;  4I6L B;  4MGK E;  2GBN A;  2JRI B;  3X0W A;  2LAS A;  3ALB A;  1IPG A;  2K6Q A;  2L0F A;  5G55 A;  1J8C A;  1WX7 A;  2FNJ B;  3AU4 A;  2J0M A;  1S3S G;  2KX3 A;  3SDL C;  3VH4 B;  4FAD A;  4IWQ A;  4KSL C;  4MM3 A;  4ANW A;  4BKS D;  3V60 A;  3X23 A;  2AL3 A;  1Z2M A;  3LJ3 A;  2W9N A;  4WWN A;  2K6D B;  3V6E B;  3VUX A;  1EO6 A;  3KVF B;  2BYF A;  4JL9 A;  4KV2 A;  4K7U A;  3PVL A;  2CHX A;  3PRE A;  2WDT B;  2MA9 B;  3ZO5 B;  1ZKH A;  4MGZ E;  2WX1 A;  2BKR B;  5JZE B;  3OJ4 B;  2IZV B;  2KWU B;  2OJR A;  1Q1O A;  2Y5B B;  2O6V B;  4BKS A;  2L3Z A;  3QJZ A;  2C9W B;  4DHJ B;  4NY0 A;  1WJN A;  5CX3 A;  2ZCB A;  1EF1 A;  1EF5 A;  5KHQ A;  3KYD D;  3O65 B;  2HTH A;  4FN2 A;  2JWZ A;  4EEW A;  1V86 A;  1KM7 A;  3CSF A;  1MG8 A;  3NS8 A;  5D7G A;  1GC7 A;  4GMV A;  4DBG A;  4GU2 A;  1L7Y A;  2L76 A;  3APD A;  3ZIM A;  5GMV A;  3AUL A;  2G45 B;  2K8B A;  3ML9 A;  5D2M B;  3ZVV A;  2BYV E;  2NBU A;  1PQS A;  3MTN B;  2Z0D B;  4PS3 A;  4XX5 A;  4P7I A;  4W9F A;  5JHA A;  4BBN C;  4OVU A;  3DCG A;  2G4D B;  1WX8 A;  3RT3 B;  4HVB A;  4NAW B;  1RAX A;  1D3Z A;  2CU1 A;  1XT9 B;  2LZ6 A;  2K1F A;  1WXS A;  4IM0 A;  5JHB A;  1WI0 A;  3KH0 A;  3ML8 A;  3JVZ X;  3ONS A;  2J0J A;  4I6P A;  1P98 A;  2CR5 A;  5LXI B;  2LUE A;  4BOZ B;  1GJZ A;  2KWC A;  4RMA A;  4RM9 A;  4W9C A;  1E8Y A;  1WYW B;  3VXW A;  5L83 A;  2KNB A;  2LXA A;  1TZ1 A;  4G50 A;  2FIF A;  3UIO B;  4GDL B;  2DZK A;  4KIK B;  4W9G A;  2LWP A;  2IYD B;  4NQK E;  4EZL A;  3EC8 A;  2N9E B;  4A3O A;  3ZDT A;  3PTF C;  2RD0 A;  4X57 B;  4EUT A;  3IVF A;  1HE8 A;  2MRP A;  2IBI B;  3A9K B;  3QWZ B;  1YIW A;  1UD7 A;  3DBH I;  3EEC A;  3L08 A;  4J6I A;  4W9J A;  3TBL D;  4CYE A;  3NOB A;  2NPT B;  2KFK A;  3SD5 A;  1E8Z A;  3ZUN A;  3KUZ A;  4W9I A;  4WJO A;  3SU8 X;  5HKH A;  2CKH B;  2KDF B;  4OVV A;  2WYQ A;  5E6P A;  3BIN A;  3W1Y A;  1T0Y A;  2O2V A;  2XK5 B;  3S2A A;  1WF9 A;  1WJU A;  1WX9 A;  2LGX A;  3NY5 A;  4K1R B;  3P2B A;  5C1Z A;  3WAO A;  2IY0 B;  3L17 A;  4HDO A;  3ZRF A;  4MGY E;  1BT0 A;  3SHQ A;  2IO0 B;  1RFA A;  4FHK A;  3W1S A;  5JH5 C;  2FCS A;  4WJP A;  1C1Y B;  5D6J B;  1QZE A;  2LI5 A;  3RCZ A;  4AWJ A;  3NZU A;  4W9E A;  1TBE A;  3OAW A;  1S1Q B;  1ZW7 A;  4WWP A;  4ICU A;  1WM3 A;  1YX6 B;  2YVC A;  3ECI A;  4BKT A;  4DHZ E;  5DPT A;  2A4Z A;  1R4M I;  2C7N B;  1YQB A;  4GXB A;  1P1A A;  5E6O A;  3D32 A;  4EZK A;  4K7W A;  2M0X A;  3A9J A;  2NCN A;  3DQV A;  2Z0E B;  5AZH A;  3ZW3 A;  2BKF A;  2RPQ A;  2DZM A;  2KXJ A;  2NR2 A;  3PRP B;  4DHZ B;  4FA6 A;  1Y8R C;  2KVR A;  4M8N A;  4E74 A;  4F1S A;  3L10 B;  2YLM A;  1V6E A;  3IHP C;  1H8C A;  4ZYN A;  2HE7 A;  2ZVO A;  3WAP A;  4HLE A;  3RUL A;  3PZD A;  3JSV B;  3PGE A;  2CS4 A;  4DWF A;  3H7P B;  3VH3 B;  1WXV A;  2DZJ A;  1XD3 B;  2MBQ A;  4JGH B;  4ZRI A;  2LXC A;  2MQJ A;  1OEY A;  4MJS A;  1M94 A;  2M8S A;  4IC7 B;  3UGB B;  3QAR A;  4EZJ A;  5J17 A;  4K7S A;  3QX1 A;  1WFY A;  2LVP A;  1GNU A;  3VFK A;  1OQY A;  2PPH A;  4KZ0 A;  2GOW A;  3APC A;  4PYZ A;  4DHJ D;  3TL5 A;  4WJN A;  2DYB A;  3T8M A;  4KVG B;  3PLU A;  1WMH B;  1WE7 A;  1WGG A;  2ZZP B;  3DBS A;  2L0T A;  2J0K A;  5CHF A;  1XQQ A;  3ZNG C;  1YD8 U;  5DPS A;  2KMC A;  2V4L A;  3K9P B;  3VUW A;  3RZW C;  2AL6 A;  3N32 A;  4LDT B;  2K8C A;  4ZRJ A;  4TQ1 A;  5IAA C;  2KJH B;  2GBR A;  3PT2 B;  2AYO B;  1V81 A;  2BWF A;  1J0G A;  2D10 A;  5AZF A;  2DX5 B;  1G6J A;  4G11 A;  3WIM A;  1UBQ A;  2JZ3 B;  1AAR A;  2R2Q A;  1F9J A;  2JT4 B;  2L7R A;  1K8R B;  2AWT A;  2KDB A;  5DPR A;  5C23 A;  3R7R A;  3VDZ A;  3GOE A;  1P9D U;  2FID A;  2MW5 A;  4E3C A;  3VAW A;  2NS5 A;  1WGR A;  1WXA A;  1E90 A;  1Q0W B;  3U7D A;  2ASQ A;  4DDG D;  2EMS A;  3H7S A;  4GDK A;  3PHW B;  3RYT A;  3IBE A;  2WWZ A;  1WGH A;  4HWI B;  2KD0 A;  2KQ7 A;  4M0W B;  3ZKJ C;  4A3P A;  3UQA A;  2WX0 A;  4IWO A;  1GC6 A;  5CTR C;  2LGD A;  2R2O A;  3MHS D;  4WWO A;  1ZGU B;  1WR1 A;  2V1Y A;  3M62 B;  2D07 B;  1LFD A;  3T9L A;  4HCN B;  3M95 A;  3QC8 B;  2NBW B;  3I3T B;  3VTV A;  1I42 A;  3Q3F A;  2LD9 A;  1WIA A;  3VTU A;  3PSE B;  3DPD A;  1WZ0 A;  2KTF A;  4HK2 A;  4PS8 A;  1ISN A;  1V5O A;  1WR6 E;  2PE9 A;  2KJR A;  2KDI A;  1LM8 B;  4TQ0 A;  2JVC A;  3B1L X;  2K8H A;  3H6N A;  4MEL A;  4WAA A;  4ZDV A;  2RSU A; 
#chains in the Genus database with same CATH topology
 1YJ1 A;  4IDI A;  1GUA B;  3DHH C;  1OQR A;  2LFI A;  3PZ7 A;  2QMT A;  3QA8 A;  2I1J A;  4IUM B;  1CQV A;  3APF A;  4F8C B;  3V6C B;  1I4Q A;  2M17 A;  1TZO A;  3BVG A;  2E3T A;  3UI3 A;  1H4R A;  1IUE A;  1WZ3 A;  3WAM A;  1C9F A;  2VRR B;  4BBN F;  1FNV A;  1LXD A;  1N62 A;  4JLC A;  2JWU A;  2DNF A;  2JZZ A;  3IXS A;  4WIP A;  2WXQ A;  4HKZ E;  4D2K A;  1Y56 A;  3DBL I;  5CHW A;  4GLS C;  1UBI A;  1UZX B;  3WAN A;  4S0R A;  2MWS B;  3N30 A;  3V62 A;  3E9S A;  4DDI D;  1F52 A;  1FXT B;  2IJ0 A;  1IBX A;  1WWT A;  4TMA B;  4BVU C;  2OHF A;  2OOB B;  2KKC A;  3TEW A;  2LGY A;  1ZP0 B;  3PRZ A;  4ZRP A;  2BS2 B;  2MX2 A;  3GZN I;  3N9Y C;  4USA A;  3DHG C;  1A5R A;  2I38 A;  3ZTD A;  3LB8 C;  4ANX A;  5BYS A;  1HZ6 A;  3AE3 B;  1FMA D;  2UWQ A;  1RLF A;  3L13 A;  4RF0 A;  4KZC A;  1V49 A;  2KN4 A;  1XXG A;  5AZG A;  3ABV B;  4ZRQ A;  2KDM A;  1SE4 A;  3N3K B;  3RUI B;  1KOT A;  4RF1 A;  2KZR A;  3PLV A;  2CHW A;  3DBR I;  2KOX A;  2MCN B;  4KGT A;  1WY8 A;  2O6V A;  2RDB C;  2W3R A;  3BY4 B;  4QAY A;  1ZOY B;  2DAJ A;  2DLB A;  4YTM B;  1KJT A;  2WXR A;  2J7Q B;  3EUB 2;  2KDE B;  5I4D A;  4YTP B;  4N6E B;  3DVG Y;  1ZDX A;  2WXO A;  5IKC M;  2MJE A;  4C4V A;  2KWD A;  4KSK C;  4XC2 A;  4PS7 A;  2M1M A;  2H88 B;  3QQ8 B;  2D3C A;  1N63 A;  4II2 B;  2AX5 A;  4FBJ B;  1WSP A;  1EUV B;  3PS6 A;  2K0P A;  3C19 A;  2XN9 C;  1X1M A;  2EEL A;  4KIK A;  2MJ3 A;  4AQ7 A;  1D4B A;  1V9J A;  5G5G A;  3A9K A;  2GLS A;  1P0R A;  4LK0 M;  1UGJ A;  3L16 A;  4YSZ B;  3W2D A;  5E6N A;  3TCA A;  1VJK A;  1P3Q U;  3A1Q B;  1L0Y B;  3ZXR A;  3P1M A;  4DXG A;  3B0A A;  1D6E C;  3MHZ A;  4NNJ B;  3P4R B;  2UYZ B;  2Q5W D;  2N0S B;  5AUK A;  2DHZ A;  2J52 A;  3UF8 A;  4IWP A;  4P6V F;  3VRB B;  2LMC A;  2R61 A;  2IGG A;  2NTT A;  4MEM A;  2L05 A;  4ZRK A;  3DDC B;  3DOW A;  3FIL B;  3EFU A;  4W9H A;  3NVZ A;  4YWG G;  2NMQ A;  2KAC A;  2C5L C;  2AQ1 B;  2KX0 A;  4BFR A;  2H89 B;  3JSV A;  3I57 A;  1PGA A;  1MHX A;  4CQN A;  2GBJ A;  4B9K A;  2PE6 B;  2K3U A;  2V9H A;  2PVG C;  1SF0 A;  2G3Q B;  2AEH A;  2FCN A;  4A20 A;  4ZHO A;  4MGK E;  2GBN A;  1T0R C;  3AE2 B;  2JRI B;  3AEE B;  4WUR A;  3Q3O C;  4XDC A;  2J0M A;  4WWM A;  3VH4 B;  4KSL C;  4MM3 A;  4A90 A;  3V60 A;  4Q2J A;  3LJ3 A;  4OW0 A;  2K6D B;  2W82 A;  3RNE C;  3ZQ4 A;  4ARC A;  2CHX A;  3PRE A;  3ZGZ A;  4MGZ E;  2WX1 A;  1UUP A;  1V1P A;  4RGM A;  1CZP A;  1FNU A;  4DHJ B;  4NY0 A;  2ZCB A;  1EF1 A;  4OZC A;  2JWZ A;  1KM7 A;  3CSF A;  4DBG A;  3APD A;  3DBL B;  2K8B A;  5D2M B;  1YJJ A;  5BMG A;  3MTN B;  4XX5 A;  1YQ3 B;  4P7I A;  2AQ2 B;  1QOA A;  3DCG A;  1JWM D;  2G4D B;  1RAX A;  2KQ4 X;  4C7Y A;  3ML8 A;  2AQ3 B;  1TYG B;  4A8X C;  1PGX A;  1CK1 A;  1P98 A;  5LXI B;  1GJZ A;  1XCQ L;  1DOX A;  4P1C C;  3GZN B;  4W9C A;  1UF0 A;  1V97 A;  5L83 A;  1TZ1 A;  2JQR B;  4G50 A;  2GB1 A;  3NG0 A;  1A70 A;  2FIF A;  3MC8 A;  2CJO A;  3WCQ A;  1IGC A;  3IT6 B;  2PLP A;  4W9G A;  2IYD B;  3EC8 A;  4A3O A;  3PTF C;  4JWS C;  2IBI B;  3DWM A;  2RDH A;  2K9X A;  4CYE A;  4J6I A;  4A6Q A;  2CU3 A;  3SD5 A;  4N59 A;  3ZUN A;  4W9I A;  2CKH B;  2KDF B;  3DBR B;  2WYQ A;  4OVV A;  5LNK 1;  5E6P A;  1T0Y A;  1FIQ A;  3P2B A;  3RNF C;  3ZRF A;  1KFY B;  3SHQ A;  3HUI A;  3W1S A;  1RFK A;  1K53 A;  1C78 A;  1QZE A;  4LTU A;  2WDQ B;  4ICU A;  1WM3 A;  3R2I A;  2YVC A;  3ECI A;  4DHZ E;  4GXB A;  3D32 A;  4EZK A;  2M0X A;  3A9J A;  2NCN A;  2Y5C A;  3DQV A;  2Z0E B;  2IGD A;  2QSD A;  3ZW3 A;  4NJC A;  4FA6 A;  4E74 A;  3L10 B;  2YLM A;  1PDX A;  4ZYN A;  2ZVO A;  3VR8 B;  3RUL A;  3PZD A;  3PGE A;  2CS4 A;  1B9R A;  3H7P B;  2ZW0 A;  2MBQ A;  4MJS A;  1M94 A;  4IOI E;  4K7S A;  3QX1 A;  1WFY A;  1GNU A;  4LNI A;  1OQY A;  3APC A;  3P4Q B;  1WMH B;  2L0T A;  2J0K A;  2WU5 B;  5CHF A;  5BMI A;  4ZRJ A;  2JYE A;  2KJH B;  2AYO B;  2D10 A;  1UBQ A;  2R2Q A;  1AAR A;  1P9D U;  2FID A;  4XGA B;  2MW5 A;  4E3C A;  3U7D A;  4DDG D;  2N7J A;  3FC4 A;  3AEF B;  3IBE A;  4NAM A;  1ESF A;  2KD0 A;  1NYR A;  4A3P A;  3AE8 B;  4LNN A;  4IWO A;  2LGD A;  1E9M A;  1FFU A;  2V1Y A;  3M95 A;  3QC8 B;  3I3T B;  1SEB D;  3P4S B;  3PSE B;  4PS8 A;  1V5O A;  3AE6 B;  2D5G A;  2KDI A;  1L4Z B;  4YSX B;  1YQ4 B;  2M0A A;  2MHJ A;  2ZNV B;  2BF8 B;  2JUO A;  3Q14 C;  2KC1 A;  1FPY A;  1KH0 A;  1STE A;  3MC0 B;  3Q2A C;  3VUY A;  1CMX B;  1FO4 A;  2PW9 A;  2X38 A;  4R3D A;  4ANU A;  4HJK A;  1N61 A;  1F2R I;  1NBF C;  2IGH A;  1WRD B;  2V3S A;  3ZLZ A;  3WAL A;  2MP2 A;  5HI1 A;  2BS4 B;  1P7E A;  4WJQ A;  1JML A;  1J7B A;  2O2V B;  3AU5 A;  1OTR B;  5CHV C;  4B95 A;  3MP9 A;  5E6J A;  3IAS 1;  2V4I B;  4FUL A;  4CHK A;  3RD2 A;  3Q8A A;  4RGO S;  5DCN A;  1J7A A;  4FJV B;  2KFJ A;  1WXM A;  2N1W A;  3KYC D;  3TIX A;  2LVO A;  2KT7 A;  4LJP B;  2DZI A;  2MH7 A;  2REX A;  3BK1 A;  1E8W A;  2KTR A;  2KAJ A;  5G2N A;  1GAQ B;  2KK8 A;  4IKG A;  1TKG A;  4OZA A;  2ZEQ A;  5BO4 B;  3R66 C;  4N58 A;  4JQW C;  2I1K A;  1V2Y A;  3ZJV A;  1NDD A;  2MBE A;  1WE6 A;  3MJW A;  1RYJ A;  1VZ8 A;  1SE9 A;  1T0S C;  1JQ4 A;  3PV1 A;  1J19 A;  2E6X A;  4E71 A;  2WU2 B;  2LEK A;  2YEP F;  4JX1 C;  5IA7 A;  1SJE D;  2PIA A;  4LJO B;  5TR5 A;  4HPM B;  1M4V A;  2BYE A;  4L1B A;  3MC9 A;  1VDV A;  1DGJ A;  4RGN A;  2I2Y A;  3RPF C;  3HM6 X;  1KF6 B;  1SJH D;  4KDL B;  2WS3 B;  4ZOH C;  3AH7 A;  2L83 A;  2TSS A;  2HD5 B;  4K81 A;  4LNO A;  2L8J A;  2QHO A;  3SEB A;  1R7S A;  2C7M B;  1JCK B;  3Q8E A;  4GDK B;  2KJ6 A;  1I4X A;  1FEH A;  1OGW A;  1UGM A;  4EFO A;  1GB1 A;  3UIP B;  3ZJT A;  3QK0 A;  4HCP B;  3DVG X;  4GDL A;  3AEC B;  2BBC A;  4FJY A;  3CF6 E;  5G5H A;  1TT5 B;  5AEK B;  2N4F A;  3V61 A;  4AJW A;  1JAL A;  1LQB A;  3IG3 A;  1LGR A;  2NPT A;  1YN4 A;  3Q8B A;  5FR3 A;  1EWY C;  4YL8 A;  4DQO C;  4GB9 A;  2RDG A;  2XK5 A;  2ZNV C;  3H9D A;  3ENE A;  3EA6 A;  4GGQ A;  2V3N A;  2K39 A;  3AE9 B;  2HJ8 A;  2ICI A;  2JZP A;  4GN1 A;  1AWD A;  2G9H D;  3CST A;  2BT6 A;  1VZ6 A;  2KMM A;  2ZCC A;  3NRZ A;  5EDS A;  2BGF A;  3DVN V;  3AEB B;  1N5X A;  4LLG M;  2QIL A;  5BMH A;  1E7U A;  1UH6 A;  4S17 A;  5L95 C;  4DK5 A;  3TEZ A;  1LO5 D;  4PK1 A;  4C80 A;  3AED B;  1MHH E;  3A33 B;  1Q5W B;  3AE7 B;  3Q3J A;  3QAQ A;  1MG4 A;  1GOZ A;  1IBX B;  4RH6 A;  4BAX A;  4FXC A;  4AS1 A;  1ET6 A;  4ACF A;  2B3A A;  1ZUD 2;  4H2A A;  3ALB A;  1IPG A;  2K6Q A;  5G55 A;  2INC C;  2FNJ B;  2KX3 A;  2JX5 A;  3SDL C;  4FAD A;  4IWQ A;  4ANW A;  1L6U A;  1Z2M A;  2BTE A;  1EO6 A;  4JL9 A;  3PVL A;  1XLO A;  2BKR B;  5JZE B;  2IZV B;  2KWU B;  2BYT A;  2Y5B B;  2O6V B;  4BKS A;  4EE2 A;  2C9W B;  1SIJ A;  3CIR B;  1WJN A;  5KHQ A;  5MPO A;  3KYD D;  3O65 B;  4FN2 A;  2PTL A;  2Z8L A;  4HRO A;  4UDU C;  2WXK A;  5D7G A;  4GMV A;  3DHI C;  1L7Y A;  5D3I B;  3N20 C;  1E0Z A;  2WXF A;  3AUL A;  4PS3 A;  1PQS A;  2BQQ A;  5JHA A;  1WX8 A;  3HVZ A;  1N5W A;  3I9V 1;  1AW7 A;  1C4A A;  3VR9 B;  2K1F A;  1WXS A;  1WI0 A;  2FBW B;  3KH0 A;  4C4V B;  1I7H A;  2K5P A;  4I6P A;  2JYT A;  4OZB A;  2KWC A;  1UNS A;  1C4P A;  4RMA A;  5HFY A;  1E8Y A;  3VXW A;  1HTO A;  2DZK A;  4KIK B;  1VLB A;  2LWP A;  2N9E B;  3ZXV A;  2RD0 A;  4X57 B;  3A9K B;  2MRP A;  3QWZ B;  3DBH I;  1XLN A;  2JXT A;  2KFK A;  5HKH A;  1HZ5 A;  3W1Y A;  1WJU A;  2LGX A;  4HJG E;  4MT5 A;  5C1Z A;  3WAO A;  3L17 A;  1SBB B;  1RFA A;  3NVY A;  4WJP A;  1C1Y B;  5D6J B;  2LI5 A;  4AWJ A;  5JXV A;  3NZU A;  4W9E A;  5T8I A;  1ZW7 A;  3SFE B;  1YX6 B;  3RNG C;  4YSY B;  4B0M A;  1P1A A;  1K51 A;  2BB6 A;  4K7W A;  1XEE A;  1ENF A;  1MI0 A;  1I4G A;  4TSS A;  3N1Z C;  3PRP B;  1TS3 A;  3DWG C;  1Y8R C;  4M8N A;  1D5Z C;  3BVM A;  3WAP A;  3JSV B;  3RFZ B;  1XD3 B;  4JGH B;  4ZRI A;  2WXM A;  2LXC A;  3O13 A;  1D5M C;  3BYT B;  3QAR A;  2LVP A;  2PPH A;  2GOW A;  3KQ4 A;  1I4H A;  4WJN A;  2DYB A;  3TL5 A;  1PYW D;  3PLU A;  1WE7 A;  3ZNG C;  1YD8 U;  2V4L A;  3Q6B A;  1I4R A;  3W9C B;  4LDT B;  1GB4 A;  4TQ1 A;  4MM3 B;  1MJD A;  1F77 A;  5AZF A;  2DX5 B;  1V1O A;  2JZ3 B;  4K3B A;  1F9J A;  2WXJ A;  2AWT A;  5C23 A;  5DPR A;  3GOE A;  4HEA 1;  2WXH A;  1V1P B;  1WGR A;  1BML C;  1Q0W B;  4B0E A;  2ASQ A;  3PHW B;  4HWI B;  2KQ7 A;  3UQA A;  2WX0 A;  4C00 A;  1F2R C;  4WWO A;  1ZGU B;  2QCZ A;  1Q10 A;  3T3N A;  3VTV A;  3DPD A;  4HK2 A;  3E56 A;  1ISN A;  1WR6 E;  2PE9 A;  2FUG 1;  1ZPS A;  4WAA A;  3H6N A;  2M19 A;  3P4P B;  2RSU A;  4I6N B;  3RMK C;  3R7Q A;  1SE3 A;  1VD2 A;  4XZ4 A;  3NZS A;  2LVQ A;  2JY6 A;  1FFV A;  2JU6 X;  4HRS A;  2CJN A;  2FUH B;  1L2N A;  3NZ3 A;  4F7Z A;  2BWE S;  3BYY B;  2J53 A;  4AP4 C;  5D94 A;  2FCM A;  4A9A A;  4KGS A;  1IYF A;  3UIN B;  4ANV A;  1I35 A;  1FD6 A;  1QIL A;  2D2Q A;  3PPA A;  3VRA B;  4DXA B;  4MH8 A;  4REZ A;  2N9K A;  4EOY A;  1V8C A;  3AM9 A;  4XWW A;  1KLU D;  1JWB D;  2N9P C;  2JRH A;  3L54 A;  2GI9 A;  2ZJD A;  1F0Z A;  3LYY A;  4AJY B;  2WP9 B;  3U30 A;  1SSN A;  2RR9 A;  3JW0 X;  4ICV A;  1WGY A;  2WQY B;  1WYG A;  3Q3N C;  1WGK A;  2Z59 B;  3JYU A;  2XEW A;  1OFF A;  3AMZ A;  2NTS A;  3BVZ A;  2DYM A;  1ZXI A;  1E5W A;  3A9J B;  2WLB A;  3OLM D;  5EE9 A;  2L00 B;  3I63 C;  2MJD A;  2KC2 A;  2LUM A;  2KQS A;  1NEN B;  2O6V D;  1UWM A;  3IFW B;  3VQI A;  4P16 A;  3HIZ A;  1AYF A;  2GBM A;  2KLG A;  2SEB D;  1WMH A;  3AB5 A;  4A55 A;  4MJS B;  2BS3 B;  4TKN A;  2KN5 A;  1ZDV A;  2OJW A;  1FXA A;  4WQO B;  1IP9 A;  4AOF A;  4CO7 A;  4JWU C;  4NJ6 A;  4IW0 A;  3DBH B;  4AUQ C;  2LRU A;  2RMM A;  2XBB C;  4L23 A;  3EHV A;  3OJ3 A;  3GS2 A;  4EKU A;  2JF5 A;  3CWI A;  3ZTC A;  3PHX B;  2M56 B;  5FR6 A;  3FAH A;  1WRI A;  1QT9 A;  4NAW A;  1EU4 A;  2GRI A;  2MBH A;  1XO3 A;  3EFC A;  5EE1 A;  3MJ5 A;  4MDK E;  2JPH A;  3VHT C;  1L6V A;  3VVW B;  1XLP A;  3I5J C;  3KUC B;  2QIE B;  2HDE A;  2DWQ A;  2IDY A;  1FCC C;  1SIF A;  3AEA B;  3WA0 A;  3ZNZ B;  1U4A A;  4NPN A;  1OQQ A;  3R3M A;  3H1U A;  1FXI A;  2B76 B;  5H92 C;  2X8X X;  2KMA A;  5J18 A;  4MH0 E;  1L0X B;  1KLG D;  1JW9 D;  2N7D A;  2RGF A;  1JWS D;  3DVN U;  4RCO A;  2SAK A;  4B6W A;  4M8M A;  3ZJU A;  5IOI A;  3QCA A;  1KLV A;  2V0G A;  1QOF A;  1J7C A;  4IM2 A;  4IM3 A;  2KO3 A;  3AE1 B;  2CHZ A;  2NBV B;  4C7Z A;  2EKI A;  4G3X B;  1QOG A;  1OEY J;  3HK0 A;  4NJ7 A;  3PRM B;  4M02 A;  4MGI E;  2WNM A;  4LCD E;  3SFD B;  2ACZ B;  5KHO A;  3K9O B;  4DXF A;  2KHW B;  1E7P B;  3B08 A;  2INN E;  4W9D A;  1VCB A;  2MP2 B;  3B2G A;  1HEZ E;  1C79 A;  2WGS A;  3TMP B;  4RFB A;  3CMM B;  4RM8 A;  3RZF A;  1VZ7 A;  2DYO A;  2MSE D;  3W1S C;  4KKI A;  2LHD A;  2C60 A;  1P7F A;  4LDT D;  1TY2 A;  2KTR B;  4FHJ A;  3RNC C;  2UU7 A;  2L0F A;  3AU4 A;  1S3S G;  1EU3 A;  2W55 A;  3X23 A;  3VUX A;  4WWN A;  2WDT B;  1ZKH A;  1K50 A;  3OJ4 B;  5AUI A;  3U52 E;  1Q1O A;  1CJE A;  1K52 A;  3QJZ A;  2W54 A;  2PKO A;  1EF5 A;  4M0W A;  3NJT A;  1V86 A;  1MG8 A;  4LNK A;  5HHD G;  4GU2 A;  3LXF A;  2L76 A;  3ZIM A;  2L32 A;  2G45 B;  4ZHP A;  3ML9 A;  2QDF A;  3UQB A;  2NBU A;  1JRO A;  1JRP A;  2Z0D B;  3RNB C;  4W9F A;  1EM7 A;  4OVU A;  4RGT A;  4HVB A;  2XNA C;  2CU1 A;  1XT9 B;  4IM0 A;  5JHB A;  3B9J A;  3ONS A;  2J0J A;  1YN5 A;  3R8B A;  2LGS A;  4BOZ B;  2W3S A;  4C56 C;  4RM9 A;  2WDR B;  3IAM 1;  1L0V B;  1WYW B;  2JSV X;  4L2Y A;  2LXA A;  2WXI A;  4YTN B;  2KYW A;  1TS2 A;  2IPK D;  1PUT A;  3UIO B;  1ZXH A;  4XE0 A;  4GDL B;  5HG2 A;  1N6Z A;  5EE0 A;  3ZDT A;  3ZYY X;  1YIW A;  3EEC A;  3TBL D;  3L08 A;  4W9J A;  2NPT B;  1E8Z A;  4WJO A;  3P42 A;  5GXG B;  1KTK A;  1YJI A;  3ETR A;  3T3O A;  2XK5 B;  1WF9 A;  4KKJ A;  1FRR A;  4HDO A;  1AN8 A;  4MGY E;  4FHK A;  2K22 A;  3RCZ A;  5C2T B;  3U7Z A;  1TBE A;  1TIF A;  3OAW A;  1HQR D;  4BKT A;  5DPT A;  2A4Z A;  1R4M I;  2C7N B;  1YQB A;  4RNA A;  2WXL A;  4ZYS A;  3NS1 A;  5AZH A;  1T0Q C;  2BKF A;  2KXJ A;  2NR2 A;  4DHZ B;  1DOY A;  1T5X D;  1DOI A;  1V6E A;  3IHP C;  4WQM A;  1H8C A;  4HLE A;  1ZE3 D;  1WXV A;  1YMH E;  2WDV B;  3HVD A;  2MQJ A;  1OEY A;  2M8S A;  4EZJ A;  2VH1 A;  5J17 A;  5IO9 A;  1TKY A;  4PYZ A;  1WGG A;  1ROE A;  1KRH A;  2ZZP B;  3DBS A;  4HKQ A;  3K9P B;  2K8C A;  5IAA C;  3PT2 B;  2BVC A;  1V81 A;  2VZK B;  2BWF A;  1G6J A;  4G11 A;  3WIM A;  2JT4 B;  2L7R A;  3BII D;  3VDZ A;  3R7R A;  1QQR A;  4J3O D;  1QOB A;  1EWC A;  2ON8 A;  3VAW A;  4US9 A;  1E90 A;  3RYT A;  1C76 A;  3AN1 A;  2Y5P A;  1QKZ A;  4KX6 B;  2G1E A;  3MHS D;  2D07 B;  1LFD A;  4HCN B;  1T3Q A;  2LD9 A;  1SB3 C;  2LHE A;  4M01 A;  4ZDV A;  3Q69 A;  1C77 A;  3AEG B;  4K3C A;  3KUD B;  2LRW A;  3A1Q A;  4M00 A;  1F1H A;  4YT0 B;  3LDZ E;  2GMI C;  4ASW C;  4GSW A;  1PGB A;  3PO0 A;  4XWT A;  2BPS A;  2VH2 A;  3ZNI D;  4WAF A;  2QJL A;  1GG3 A;  4FJZ A;  2D11 A;  2KFK B;  2A5U A;  2LJ5 A;  2PMV A;  1E8X A;  2MBO A;  2YEP B;  3A4R A;  3NHE B;  4HDQ A;  3FIL A;  5FK9 C;  1TGZ B;  4II3 B;  2M4N A;  3QIJ A;  5BYQ A;  4NQL B;  3W5V B;  2L1A A;  2FE8 A;  2N9X A;  4PYU A;  1RM6 C;  2KAN A;  2G4S A;  1UWX A;  3TUO A;  1JWA D;  1YX5 B;  1UEL A;  1E7V A;  4BKG A;  1WGD A;  1WM2 A;  1VR9 A;  2ZW1 A;  4P1B C;  3KWV A;  1R4N I;  1TJE A;  3C0R B;  2EKE C;  4ARI A;  1ACC A;  3GE3 C;  2NVU I;  1WJ4 A;  3NVW A;  4YXD B;  1E6E B;  2ZVN A;  4ITK A;  3AV8 A;  3L0W B;  1QLB B;  1E10 A;  2MBB B;  3H8H A;  2INP E;  2IY1 B;  2DEN B;  1WH3 A;  1WXQ A;  4MSM B;  4G0N B;  3A4S C;  2OED A;  3OWE B;  3KW5 B;  3Q8F A;  3KLS X;  1C3T A;  2J42 A;  2QEJ C;  3AI5 A;  2WHI A;  2DAF A;  1TTN A;  3BK2 A;  2EMT A;  5J2R A;  2ZPY A;  3QHT A;  4HPL B;  2IO3 B;  4MSQ B;  1V5T A;  3TJP A;  4TV3 A;  4PT5 A;  1I4P A;  3AXC A;  1QF6 A;  4IG7 B;  2QC8 A;  4US8 A;  2D3G A;  2JXX A;  1SGH A;  2IO1 B;  1HTQ A;  2PJH A;  1XCT L;  4GOC A;  3NUH B;  2PEA A;  4KDI C;  4XYC A;  1RRB A;  1PFD A;  1T6B X;  5DPW A;  3AE5 B;  1JRU A;  1R4M B;  3HRD D;  2C7H A;  3M3J A;  2GBK A;  1TY0 A;  2PVO D;  4LNF A;  3ZDM C;  3U8Z A;  4URK A;  3N1X C;  3RNA C;  4W9K A;  4FLH A;  1Z5S B;  3TEX A;  1HA5 A;  5H8Y E;  4W9L A;  2ZPN A;  2MLB A;  1NI2 A;  1MVK A;  3HHM A;  3ZRC A;  4HPP A;  2HJ1 A;  3VTW A;  2N7E A;  4TUU A;  1D5X C;  1RWS A;  5LXH A;  1JWU D;  2RPV A;  4JIO U;  4BOS C;  4MAC A;  2J4X A;  1WJ6 A;  2KLC A;  5LLI A;  1B1Z A;  2FAZ A;  4GIV A;  3M63 B;  4HXD A;  3V3X A;  3URY A;  4O1N A;  4JE3 B;  1V80 A;  1XLQ A;  4N9F 4;  2KWV B;  3RI7 C;  5BYR A;  2K25 A;  3ZNH B;  3H7P A;  1N60 A;  2IO2 B;  2N1V A;  2FCQ A;  3U2S C;  3HM3 A;  2VZK D;  4I6L B;  1HXY D;  3X0W A;  2LAS A;  4NZL B;  1J8C A;  1WX7 A;  3FKY A;  3IT4 B;  1TKE A;  2LJI A;  4BKS D;  2AL3 A;  3RN9 C;  2W9N A;  3V6E B;  3J9C A;  3KVF B;  5D3D A;  2BYF A;  4KV2 A;  4K7U A;  4OHJ A;  2MA9 B;  3ZO5 B;  3BWU D;  5FKA C;  2OJR A;  4WH4 A;  2L3Z A;  3C8Y A;  1GPX A;  1BUI C;  5CX3 A;  2HTH A;  4EEW A;  2WXG A;  3NS8 A;  1GC7 A;  1NYQ A;  1L4D B;  3N1Y C;  1NEK B;  5GMV A;  3ZVV A;  2BYV E;  4BBN C;  3RT3 B;  4NAW B;  1D3Z A;  2LZ6 A;  1BXT A;  4JPS A;  3JVZ X;  2Y3A A;  3SR6 A;  2CR5 A;  2LUE A;  1IGD A;  1L5P A;  5IP4 D;  1FCL A;  4XDD A;  2KNB A;  3V05 A;  1R4N B;  2LGI A;  5IN7 A;  1YN3 A;  4NQK E;  4EZL A;  2IND C;  4EUT A;  3IVF A;  1HE8 A;  3AE4 B;  1DYQ A;  1UD7 A;  3NOB A;  1FNW A;  3KUZ A;  3SU8 X;  3BIN A;  2DBY A;  1FRD A;  2O2V A;  3S2A A;  1WX9 A;  3NY5 A;  1YNT E;  4K1R B;  3PZ8 A;  2IY0 B;  1BT0 A;  2IO0 B;  1TS4 A;  2FCS A;  3TSS A;  5JH5 C;  3KWL A;  1S1Q B;  3L4P A;  4WWP A;  2KVZ A;  1C4C A;  5E6O A;  2L52 A;  1NI3 A;  3GE8 C;  3OG5 A;  5EE3 A;  2RPQ A;  2DZM A;  2BW2 A;  2KVR A;  4F1S A;  2HE7 A;  1TS5 A;  1SE2 A;  3BZD B;  2D3B A;  3VH3 B;  4DWF A;  1YOV B;  4KGR A;  2DZJ A;  2ONQ A;  3R2T A;  1MFW A;  4IC7 B;  3UGB B;  3VFK A;  2WXP A;  4KZ0 A;  5C3J B;  2MEK A;  4DHJ D;  3T8M A;  4KVG B;  1VRA B;  1XQQ A;  5DPS A;  2KMC A;  3VUW A;  2N9L A;  1MPE A;  3RZW C;  2AL6 A;  3N32 A;  3P63 A;  1SXT A;  3W5U B;  2BB5 A;  2D3A A;  2GBR A;  3GP7 A;  1J0G A;  3Q8C A;  3Q3M C;  3GB1 A;  1K8R B;  2KDB A;  1FM0 D;  1ET9 A;  2NS5 A;  1WXA A;  5TSS A;  4BZA A;  3NVV A;  3U4E G;  1NVI D;  2EMS A;  3H7S A;  4GDK A;  2WWZ A;  1WGH A;  3ZKJ C;  3EGR A;  4M0W B;  1GC6 A;  5CTR C;  2R2O A;  2WXN A;  1WR1 A;  3M62 B;  3T9L A;  3TEY A;  2NBW B;  1I42 A;  3Q3F A;  1WIA A;  4OVZ A;  3VTU A;  1WZ0 A;  2KTF A;  1XF5 L;  2HTM E;  2KJR A;  1LM8 B;  3B2F A;  4TQ0 A;  2JVC A;  3B1L X;  2K8H A;  2V3P A;  4MEL A;  3MFG A; 
#chains in the Genus database with same CATH homology
 4I6N B;  1YJ1 A;  2ZNV B;  3R7Q A;  1VD2 A;  4XZ4 A;  2BF8 B;  2JUO A;  3NZS A;  3KUD B;  2LRW A;  1GUA B;  2KC1 A;  3A1Q A;  2LVQ A;  2JY6 A;  3QA8 A;  2I1J A;  4IUM B;  3APF A;  3LDZ E;  2FUH B;  3V6C B;  2GMI C;  4F8C B;  1L2N A;  4ASW C;  4GSW A;  2M17 A;  4F7Z A;  2BWE S;  3VUY A;  4AP4 C;  1CMX B;  2FCM A;  5D94 A;  2BPS A;  1H4R A;  1WZ3 A;  3WAM A;  1IYF A;  2VRR B;  4HJK A;  3UIN B;  4ANV A;  4BBN F;  4ANU A;  1I35 A;  3ZNI D;  1LXD A;  2D2Q A;  1NBF C;  1GG3 A;  4JLC A;  1WRD B;  2V3S A;  3PPA A;  4FJZ A;  4DXA B;  2D11 A;  2KFK B;  2A5U A;  2JZZ A;  2LJ5 A;  3WAL A;  3ZLZ A;  2MP2 A;  4EOY A;  1E8X A;  3DBL I;  4WJQ A;  2MBO A;  5CHW A;  3A4R A;  3NHE B;  4HDQ A;  2O2V B;  1TGZ B;  3AU5 A;  1UBI A;  2M4N A;  4II3 B;  1UZX B;  3QIJ A;  1OTR B;  5CHV C;  4B95 A;  3WAN A;  4NQL B;  4FUL A;  4CHK A;  2N9P C;  2JRH A;  3L54 A;  3RD2 A;  2N9X A;  4PYU A;  2ZJD A;  4AJY B;  5DCN A;  2MWS B;  2KAN A;  2G4S A;  3U30 A;  3N30 A;  4FJV B;  2KFJ A;  3V62 A;  1WXM A;  2N1W A;  4DDI D;  1FXT B;  1YX5 B;  2RR9 A;  3JW0 X;  4ICV A;  3KYC D;  1WGY A;  3TIX A;  4BVU C;  2OOB B;  2KKC A;  2LVO A;  1UEL A;  1E7V A;  2LGY A;  3PRZ A;  4LJP B;  4BKG A;  2DZI A;  2Z59 B;  3JYU A;  2XEW A;  2REX A;  1WGD A;  1WM2 A;  2MX2 A;  3GZN I;  1E8W A;  2KTR A;  2DYM A;  5G2N A;  1E5W A;  3A9J B;  1A5R A;  3OLM D;  2KK8 A;  1R4N I;  3ZTD A;  2L00 B;  4ANX A;  3C0R B;  2EKE C;  2UWQ A;  2ZEQ A;  1RLF A;  5BO4 B;  3R66 C;  3L13 A;  2NVU I;  1WJ4 A;  4KZC A;  2KC2 A;  1V49 A;  2KQS A;  4JQW C;  2I1K A;  1V2Y A;  2O6V D;  1NDD A;  2ZVN A;  2MBE A;  3L0W B;  5AZG A;  1WE6 A;  3MJW A;  3N3K B;  3IFW B;  3RUI B;  3VQI A;  2MBB B;  1KOT A;  1SE9 A;  2DEN B;  2GBM A;  2IY1 B;  2KLG A;  1WH3 A;  2KZR A;  3HIZ A;  3PLV A;  3PV1 A;  4MSM B;  2CHW A;  1J19 A;  1WMH A;  3DBR I;  4G0N B;  3A4S C;  4E71 A;  2KOX A;  2MCN B;  4MJS B;  4TKN A;  2KN5 A;  3KW5 B;  1WY8 A;  2O6V A;  3BY4 B;  5IA7 A;  1C3T A;  4WQO B;  1IP9 A;  3AI5 A;  4AOF A;  4CO7 A;  4LJO B;  4NJ6 A;  2DAF A;  1TTN A;  2DAJ A;  2EMT A;  4IW0 A;  5TR5 A;  2ZPY A;  4HPM B;  4AUQ C;  5J2R A;  2BYE A;  3QHT A;  2LRU A;  1KJT A;  2XBB C;  3EHV A;  4HPL B;  2IO3 B;  2J7Q B;  3OJ3 A;  4MSQ B;  1V5T A;  4EKU A;  2KDE B;  3TJP A;  2JF5 A;  3HM6 X;  4TV3 A;  3AXC A;  3DVG Y;  3ZTC A;  3PHX B;  4IG7 B;  5FR6 A;  4KDL B;  2D3G A;  2JXX A;  4NAW A;  1SGH A;  2MBH A;  2IO1 B;  2HD5 B;  4MDK E;  2PJH A;  2JPH A;  3VHT C;  4K81 A;  3VVW B;  4GOC A;  2L8J A;  4KSK C;  3KUC B;  2QHO A;  4XC2 A;  2PEA A;  4KDI C;  1RRB A;  4PS7 A;  2C7M B;  4GDK B;  2KJ6 A;  2M1M A;  1SIF A;  5DPW A;  1OGW A;  1JRU A;  3WA0 A;  3ZNZ B;  1UGM A;  1U4A A;  3QQ8 B;  4EFO A;  4NPN A;  2C7H A;  3M3J A;  4II2 B;  3UIP B;  2GBK A;  3R3M A;  3H1U A;  4FBJ B;  3QK0 A;  1EUV B;  3PS6 A;  2KMA A;  5J18 A;  4HCP B;  3DVG X;  4GDL A;  3ZDM C;  3U8Z A;  4URK A;  1X1M A;  4FJY A;  4MH0 E;  3CF6 E;  4KIK A;  4W9K A;  2N7D A;  5AEK B;  1V9J A;  2N4F A;  4FLH A;  3V61 A;  4AJW A;  2RGF A;  3A9K A;  3DVN U;  1P0R A;  1LQB A;  4B6W A;  3IG3 A;  3UQB A;  1Z5S B;  4M8M A;  2NPT A;  3L16 A;  3QCA A;  4YL8 A;  5E6N A;  4W9L A;  3TCA A;  2ZPN A;  2MLB A;  4GB9 A;  1KLV A;  1P3Q U;  2XK5 A;  1NI2 A;  2ZNV C;  3A1Q B;  3H9D A;  3ENE A;  3HHM A;  3ZRC A;  4GGQ A;  4IM2 A;  4IM3 A;  2KO3 A;  2K39 A;  2HJ8 A;  3VTW A;  2N7E A;  4GN1 A;  4TUU A;  3B0A A;  2CHZ A;  2NBV B;  4G3X B;  1OEY J;  3CST A;  5LXH A;  3HK0 A;  4NJ7 A;  3PRM B;  4JIO U;  4NNJ B;  4MGI E;  4BOS C;  4LCD E;  2UYZ B;  2ZCC A;  5KHO A;  3K9O B;  5EDS A;  1WJ6 A;  2DHZ A;  2KLC A;  5LLI A;  3UF8 A;  2BGF A;  2KHW B;  3DVN V;  4IWP A;  3B08 A;  4W9D A;  1VCB A;  2MP2 B;  4MEM A;  2L05 A;  4ZRK A;  1E7U A;  1UH6 A;  3DDC B;  2FAZ A;  5L95 C;  3DOW A;  4DK5 A;  4GIV A;  3EFU A;  4W9H A;  3M63 B;  3TMP B;  4HXD A;  1V80 A;  4N9F 4;  2C5L C;  3A33 B;  2KWV B;  1Q5W B;  3CMM B;  3Q3J A;  3QAQ A;  2K25 A;  2KX0 A;  4RM8 A;  3RZF A;  4BFR A;  3JSV A;  3ZNH B;  2DYO A;  3H7P A;  2MSE D;  3W1S C;  2GBJ A;  4B9K A;  2C60 A;  2PE6 B;  2IO2 B;  2N1V A;  4LDT D;  2G3Q B;  2AEH A;  2FCQ A;  2FCN A;  2KTR B;  4A20 A;  3HM3 A;  2B3A A;  4FHJ A;  4I6L B;  4MGK E;  2GBN A;  2JRI B;  3X0W A;  2LAS A;  3ALB A;  1IPG A;  2K6Q A;  2L0F A;  5G55 A;  1J8C A;  1WX7 A;  2FNJ B;  3AU4 A;  2J0M A;  1S3S G;  2KX3 A;  3SDL C;  3VH4 B;  4FAD A;  4IWQ A;  4KSL C;  4MM3 A;  4ANW A;  4BKS D;  3V60 A;  3X23 A;  2AL3 A;  1Z2M A;  3LJ3 A;  2W9N A;  4WWN A;  2K6D B;  3V6E B;  3VUX A;  1EO6 A;  3KVF B;  2BYF A;  4JL9 A;  4KV2 A;  4K7U A;  3PVL A;  2CHX A;  3PRE A;  2WDT B;  2MA9 B;  3ZO5 B;  1ZKH A;  4MGZ E;  2WX1 A;  2BKR B;  5JZE B;  3OJ4 B;  2IZV B;  2KWU B;  2OJR A;  1Q1O A;  2Y5B B;  2O6V B;  4BKS A;  2L3Z A;  3QJZ A;  2C9W B;  4DHJ B;  4NY0 A;  1WJN A;  5CX3 A;  2ZCB A;  1EF1 A;  1EF5 A;  5KHQ A;  3KYD D;  3O65 B;  2HTH A;  4FN2 A;  2JWZ A;  4EEW A;  1V86 A;  1KM7 A;  3CSF A;  1MG8 A;  3NS8 A;  5D7G A;  1GC7 A;  4GMV A;  4DBG A;  4GU2 A;  1L7Y A;  2L76 A;  3APD A;  3ZIM A;  5GMV A;  3AUL A;  2G45 B;  2K8B A;  3ML9 A;  5D2M B;  3ZVV A;  2BYV E;  2NBU A;  1PQS A;  3MTN B;  2Z0D B;  4PS3 A;  4XX5 A;  4P7I A;  4W9F A;  5JHA A;  4BBN C;  4OVU A;  3DCG A;  2G4D B;  1WX8 A;  3RT3 B;  4HVB A;  4NAW B;  1RAX A;  1D3Z A;  2CU1 A;  1XT9 B;  2LZ6 A;  2K1F A;  1WXS A;  4IM0 A;  5JHB A;  1WI0 A;  3KH0 A;  3ML8 A;  3JVZ X;  3ONS A;  2J0J A;  4I6P A;  1P98 A;  2CR5 A;  5LXI B;  2LUE A;  4BOZ B;  1GJZ A;  2KWC A;  4RMA A;  4RM9 A;  4W9C A;  1E8Y A;  1WYW B;  3VXW A;  5L83 A;  2KNB A;  2LXA A;  1TZ1 A;  4G50 A;  2FIF A;  3UIO B;  4GDL B;  2DZK A;  4KIK B;  4W9G A;  2LWP A;  2IYD B;  4NQK E;  4EZL A;  3EC8 A;  2N9E B;  4A3O A;  3ZDT A;  3PTF C;  2RD0 A;  4X57 B;  4EUT A;  3IVF A;  1HE8 A;  2MRP A;  2IBI B;  3A9K B;  3QWZ B;  1YIW A;  1UD7 A;  3DBH I;  3EEC A;  3L08 A;  4J6I A;  4W9J A;  3TBL D;  4CYE A;  3NOB A;  2NPT B;  2KFK A;  3SD5 A;  1E8Z A;  3ZUN A;  3KUZ A;  4W9I A;  4WJO A;  3SU8 X;  5HKH A;  2CKH B;  2KDF B;  4OVV A;  2WYQ A;  5E6P A;  3BIN A;  3W1Y A;  1T0Y A;  2O2V A;  2XK5 B;  3S2A A;  1WF9 A;  1WJU A;  1WX9 A;  2LGX A;  3NY5 A;  4K1R B;  3P2B A;  5C1Z A;  3WAO A;  2IY0 B;  3L17 A;  4HDO A;  3ZRF A;  4MGY E;  1BT0 A;  3SHQ A;  2IO0 B;  1RFA A;  4FHK A;  3W1S A;  5JH5 C;  2FCS A;  4WJP A;  1C1Y B;  5D6J B;  1QZE A;  2LI5 A;  3RCZ A;  4AWJ A;  3NZU A;  4W9E A;  1TBE A;  3OAW A;  1S1Q B;  1ZW7 A;  4WWP A;  4ICU A;  1WM3 A;  1YX6 B;  2YVC A;  3ECI A;  4BKT A;  4DHZ E;  5DPT A;  2A4Z A;  1R4M I;  2C7N B;  1YQB A;  4GXB A;  1P1A A;  5E6O A;  3D32 A;  4EZK A;  4K7W A;  2M0X A;  3A9J A;  2NCN A;  3DQV A;  2Z0E B;  5AZH A;  3ZW3 A;  2BKF A;  2RPQ A;  2DZM A;  2KXJ A;  2NR2 A;  3PRP B;  4DHZ B;  4FA6 A;  1Y8R C;  2KVR A;  4M8N A;  4E74 A;  4F1S A;  3L10 B;  2YLM A;  1V6E A;  3IHP C;  1H8C A;  4ZYN A;  2HE7 A;  2ZVO A;  3WAP A;  4HLE A;  3RUL A;  3PZD A;  3JSV B;  3PGE A;  2CS4 A;  4DWF A;  3H7P B;  3VH3 B;  1WXV A;  2DZJ A;  1XD3 B;  2MBQ A;  4JGH B;  4ZRI A;  2LXC A;  2MQJ A;  1OEY A;  4MJS A;  1M94 A;  2M8S A;  4IC7 B;  3UGB B;  3QAR A;  4EZJ A;  5J17 A;  4K7S A;  3QX1 A;  1WFY A;  2LVP A;  1GNU A;  3VFK A;  1OQY A;  2PPH A;  4KZ0 A;  2GOW A;  3APC A;  4PYZ A;  4DHJ D;  3TL5 A;  4WJN A;  2DYB A;  3T8M A;  4KVG B;  3PLU A;  1WMH B;  1WE7 A;  1WGG A;  2ZZP B;  3DBS A;  2L0T A;  2J0K A;  5CHF A;  1XQQ A;  3ZNG C;  1YD8 U;  5DPS A;  2KMC A;  2V4L A;  3K9P B;  3VUW A;  3RZW C;  2AL6 A;  3N32 A;  4LDT B;  2K8C A;  4ZRJ A;  4TQ1 A;  5IAA C;  2KJH B;  2GBR A;  3PT2 B;  2AYO B;  1V81 A;  2BWF A;  1J0G A;  2D10 A;  5AZF A;  2DX5 B;  1G6J A;  4G11 A;  3WIM A;  1UBQ A;  2JZ3 B;  1AAR A;  2R2Q A;  1F9J A;  2JT4 B;  2L7R A;  1K8R B;  2AWT A;  2KDB A;  5DPR A;  5C23 A;  3R7R A;  3VDZ A;  3GOE A;  1P9D U;  2FID A;  2MW5 A;  4E3C A;  3VAW A;  2NS5 A;  1WGR A;  1WXA A;  1E90 A;  1Q0W B;  3U7D A;  2ASQ A;  4DDG D;  2EMS A;  3H7S A;  4GDK A;  3PHW B;  3RYT A;  3IBE A;  2WWZ A;  1WGH A;  4HWI B;  2KD0 A;  2KQ7 A;  4M0W B;  3ZKJ C;  4A3P A;  3UQA A;  2WX0 A;  4IWO A;  1GC6 A;  5CTR C;  2LGD A;  2R2O A;  3MHS D;  4WWO A;  1ZGU B;  1WR1 A;  2V1Y A;  3M62 B;  2D07 B;  1LFD A;  3T9L A;  4HCN B;  3M95 A;  3QC8 B;  2NBW B;  3I3T B;  3VTV A;  1I42 A;  3Q3F A;  2LD9 A;  1WIA A;  3VTU A;  3PSE B;  3DPD A;  1WZ0 A;  2KTF A;  4HK2 A;  4PS8 A;  1ISN A;  1V5O A;  1WR6 E;  2PE9 A;  2KJR A;  2KDI A;  1LM8 B;  4TQ0 A;  2JVC A;  3B1L X;  2K8H A;  3H6N A;  4MEL A;  4WAA A;  4ZDV A;  2RSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...