4OZBA

Backbone modifications in the protein gb1 helix: beta-acpc24, beta-3-lys28, beta-3-lys31, beta-acpc35
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
56
structure length
52
Chain Sequence
DTYKLILNGKTLKGETTTEAVDATAEVFQYADNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords Streptococcal Protein GB1 Backbone Modified Variant: beta-AC
publication title Folding Thermodynamics of Protein-Like Oligomers with Heterogeneous Backbones.
pubmed doi rcsb
total genus 13
structure length 52
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4ozbA00
4IKGA 2LHDA 2LUMA 2ONQA 4HKZE 3FILB 2QSDA 1JMLA 2IGDA 2QMTA 2J52A 5BMHA 1MI0A 3V3XA 2KDMA 4OZBA 2N9LA 4WH4A 2LGIA 5HHDG 2ZW0A 2GB1A 2I2YA 1PGXA 1IBXA 1XF5L 1MHXA 2JWUA 1QKZA 2KN4A 2IGGA 2PW9A 2LHEA 2N7JA 5HI1A 1YNTE 2ON8A 1IGDA 2PLPA 1MVKA 1PGBA 1P7FA 2KWDA 1PGAA 1IBXB 1UWXA 2GI9A 2ZW1A 1F2RI 4MACA 1HZ6A 1FCLA 4D2KA 1KH0A 1YMHE 2I38A 1GB4A 5HG2A 4KGTA 1XCQL 4HJGE 2J53A 3UI3A 1C9FA 1HZ5A 1FCCC 5BMGA 1HEZE 5JXVA 1K52A 2RMMA 1IGCA 1ZXHA 2K0PA 2PTLA 4OZAA 1MHHE 2N9KA 2KQ4X 4KGSA 2NMQA 3GB1A 2IGHA 2JXTA 1FD6A 1P7EA 1K53A 4GLSC 2OEDA 2EELA 2JZPA 1EM7A 5HFYA 4KGRA 1K51A 2RPVA 1XCTL 1MPEA 3MP9A 4IOIE 1Q10A 5BMIA 1GB1A 1K50A 2JSVX 4OZCA 2KACA 3FILA 1D4BA 1F2RC 2JU6X
chains in the Genus database with same CATH superfamily
1ACCA 4S17A 2WLBA 4KIKB 2KFKB 1TBEA 3AECB 3BY4B 4M0WB 2L00B 4A6QA 4W9HA 2VH2A 1LM8B 1SIFA 3QA8A 3JSVA 3DBHI 3JYUA 3A4SC 1IBXA 2WXGA 2LJIA 4NJ7A 4N59A 2K22A 2O2VB 4CHKA 2KT7A 4HLEA 1ZXIA 3R2TA 1ZOYB 4FLHA 4C4VA 3NVYA 4LCDE 4MSQB 2K8CA 3AU4A 1TIFA 2AX5A 3D32A 4ARIA 4EUTA 2BS4B 2ZCBA 1E7UA 3QX1A 3PHXB 4HJGE 4YT0B 4ZRJA 1FFUA 2RDGA 2RGFA 2MLBA 1HEZE 1XLOA 1JW9D 2BYEA 2PTLA 3O65B 1WJUA 3AEFB 3AEAB 4KV2A 1C79A 2KO3A 1XT9B 2GBNA 4KGSA 2KANA 4KKJA 3MJ5A 3VRBB 1E90A 3V6CB 3ZRCA 2K5PA 2GBJA 4W9IA 4WQOB 2EELA 4R3DA 2IDYA 1WRDB 2ZEQA 1HA5A 4PS7A 3PLUA 2RR9A 2GRIA 4RCOA 2KDBA 4MM3A 4WQMA 4YL8A 2WDVB 1EWYC 3B2GA 2TSSA 3AE3B 2KHWB 3U4EG 4M0WA 3ZLZA 4I6LB 4XWTA 1CK1A 5AZFA 2JU6X 4KDIC 2OOBB 3VXWA 1UELA 1FNUA 1ISNA 4NQLB 3PHWB 2MW5A 4ZHOA 2L7RA 2I2YA 4MH8A 4C56C 2KN4A 3AE4B 1ET6A 2AYOB 4K3CA 4M02A 3W1SA 2YVCA 3VR9B 4PT5A 2KDEB 2HTHA 2MJ3A 3AE2B 2D3AA 1TS4A 1QQRA 3GZNI 1WJNA 2WDRB 2M19A 5JH5C 3RFZB 1GB4A 4AWJA 4REZA 2K3UA 3I9V1 5FK9C 2LRWA 3V05A 2LFIA 1XLPA 1P1AA 4IM2A 2OJWA 2W54A 4EZLA 3B0AA 3OJ4B 1S3SG 3RI7C 3AN1A 1NI2A 2WXKA 4OVZA 1E9MA 2X38A 4LLGM 4AJWA 4K7WA 1QOFA 2D2QA 4K81A 1K53A 2HTME 3IBEA 3M62B 4MH0E 1RFKA 2RPVA 5CX3A 5EDSA 1JROA 1VZ6A 2BB5A 2N9EB 1WE6A 2MBEA 2IY1B 2NS5A 1STEA 1SGHA 1K8RB 3TSSA 2M4NA 5GXGB 2KKCA 2PVOD 2E6XA 2GBMA 1QOBA 4GDKB 1WWTA 3ZJUA 2RDHA 3IFWB 2J52A 4BKTA 3RT3B 1WSPA 4PS8A 4NNJB 4II2B 2M8SA 4ANVA 1L4ZB 2RDBC 3RUIB 4GSWA 4ZDVA 4BOZB 4PK1A 3MC8A 3M63B 4YSZB 4CQNA 2O6VD 3BK2A 1NYRA 3GE8C 4GIVA 1F77A 3BVMA 1TS5A 4M00A 1R4NI 1GUAB 3WCQA 3RN9C 2BYFA 1UWXA 2MBHA 2GI9A 1J7BA 2KX3A 4ASWC 2JF5A 4L23A 2KAJA 2QILA 1AARA 3Q14C 2XEWA 5EE0A 2WQYB 1FMAD 5DPWA 1SJED 4NZLB 2MEKA 2EMTA 1ZUD2 4DHZE 3NVZA 3ZIMA 1IGCA 3TCAA 1JRUA 4XX5A 2R2QA 1V6EA 4LTUA 1EUVB 1VRAB 2C7MB 2KQ4X 2NMQA 1L2NA 2C9WB 2Z8LA 2GMIC 3PZDA 3K9OB 1MJDA 2DYOA 1QOAA 3VAWA 2CKHB 2OEDA 3DVGX 3RNGC 1LXDA 2NCNA 4WIPA 2MBBB 1WXAA 3RD2A 4FBJB 3LXFA 2J42A 4BBNC 1L6VA 3QARA 3OLMD 2KNBA 3IAM1 2PVGC 1J8CA 2KOXA 3GE3C 3M3JA 2GLSA 2MH7A 4DDID 2KACA 2DZIA 2HDEA 2G1EA 1F0ZA 3UQBA 1JALA 1JQ4A 1UH6A 1TJEA 3QC8B 2M1MA 4NJCA 4P7IA 1IYFA 1PQSA 2ZVNA 5BYSA 3DQVA 3TBLD 2KC1A 4BKGA 1PDXA 3FKYA 3MC9A 5GMVA 5D2MB 1PGXA 1E8ZA 2E3TA 1TKGA 1SIJA 2K25A 3WANA 1A5RA 2IY0B 2UWQA 2KVZA 2N7EA 4C7ZA 4W9FA 2DYMA 4OVVA 1P3QU 5DPTA 3MFGA 2D10A 5EE3A 3N30A 3APDA 3A4RA 4P1BC 3I3TB 1N61A 3UI3A 4FULA 2RMMA 2LZ6A 3Q8EA 1AN8A 3W1SC 4ZRKA 4ZYNA 4HXDA 2JYTA 3ABVB 1T5XD 1ZW7A 2NPTB 1WXMA 2A4ZA 1BT0A 3RNCC 1RWSA 5D3IB 2AL6A 1IUEA 2QCZA 3NS8A 2ZPYA 1Q0WB 4K1RB 4C7YA 2WU5B 1R4MI 3APFA 4GLSC 2L83A 3Q3MC 1EM7A 2N0SB 2JUOA 3ECIA 1TZOA 3ZTCA 2PJHA 1XCTL 4USAA 3AMZA 3TUOA 2JYEA 1GOZA 3WAOA 1Q10A 2D07B 5L83A 3BYTB 2Y5CA 5J18A 5BYRA 1L0YB 2DZJA 3VTWA 1J7CA 3X23A 2B3AA 1VLBA 4JWSC 3A9KA 2DZMA 2C5LC 1YQBA 3WALA 4A20A 4RH6A 3V6EB 1GPXA 2G9HD 3UF8A 5G5GA 3KQ4A 3ZXVA 4LJPB 3TEZA 4FJZA 1LFDA 1B1ZA 4A8XC 2C7NB 1SF0A 3B2FA 1MG8A 2WXLA 3AE5B 1YNTE 2Z59B 4BKSA 1BUIC 3ZUNA 2K1FA 3QK0A 2J0MA 1QILA 2V3PA 1Q1OA 1HTQA 3Q69A 2ZW1A 4MACA 2KQ7A 4FJVB 1V86A 3ZJTA 3Q3NC 1RRBA 5C23A 3Q3OC 4G3XB 4LJOB 4DXFA 2NPTA 3ALBA 1SE9A 1FNWA 1XCQL 2BQQA 2PPHA 2W3SA 2L3ZA 4IM3A 1P98A 3H7SA 5I4DA 2KWVB 4F1SA 3L4PA 4W9KA 4G0NB 3PSEB 3EC8A 3BVZA 4AQ7A 2BF8B 2CU3A 2XK5B 2MJEA 3I5JC 1T0YA 4JL9A 4M8NA 4C4VB 1N63A 1WZ0A 3Q3JA 3LYYA 5D7GA 3RPFC 1UZXB 4YSYB 3PS6A 1HE8A 2BW2A 2DX5B 1I4RA 2NBUA 2BS3B 2W9NA 4AP4C 1D3ZA 3L10B 1GC6A 4ICUA 3AXCA 3SR6A 2IO1B 3AM9A 3ZJVA 3MC0B 5E6OA 3PO0A 3PGEA 4JX1C 5JZEB 4II3B 1QF6A 3KYDD 2NTSA 4NPNA 3V62A 1YX5B 2G4SA 3P1MA 3T9LA 5LNK1 3SD5A 3VTUA 1T0QC 3R7RA 3N20C 1NEKB 3PREA 1IGDA 4CYEA 2G4DB 1PGBA 2KQSA 3ML9A 3TIXA 3AH7A 3CWIA 3CF6E 1FXIA 2KC2A 1XQQA 2CHXA 1WX7A 1KH0A 1U4AA 3KVFB 4W9LA 2LVQA 1N6ZA 3VQIA 2LGYA 4DXAB 1R7SA 2ZNVC 3QHTA 3E9SA 2WX1A 1Y8RC 2XK5A 1FCCC 4WWNA 3DBLI 1SEBD 5IP4D 1N60A 2LGDA 3NOBA 4FA6A 1ZXHA 3P63A 4BAXA 3Q8BA 1SE2A 3B1LX 1VD2A 3IHPC 4JIOU 2AL3A 3BINA 4K7SA 2KMAA 3TEXA 2ICIA 4DHJB 2FE8A 1WX9A 1PFDA 4MT5A 1MPEA 4WJPA 3MJWA 4C00A 3OAWA 1WR6E 4BZAA 1XXGA 1L7YA 3RZFA 2FAZA 2HJ1A 2JSVX 2BYVE 2K6DB 1FXAA 2L05A 3WAPA 1WR1A 3EFCA 2INNE 4G50A 2JPHA 2L1AA 2AQ3B 2IPKD 4YXDB 2CR5A 4E3CA 2KZRA 2VZKB 4IKGA 1IPGA 2VRRB 4DQOC 1NVID 2OHFA 2AQ1B 3Q3FA 2QMTA 3L54A 1ZDVA 4P6VF 3AEEB 1XEEA 3P42A 2GB1A 1I4HA 2JRHA 1HQRD 1LQBA 3DPDA 5LLIA 5E6JA 3R2IA 3AI5A 4ICVA 1QLBB 4G11A 4K3BA 2JXXA 1T3QA 1J0GA 2QEJC 1E5WA 3U8ZA 3TMPB 2MA9B 3VUXA 1RFAA 4LNFA 1WGGA 2J4XA 2J53A 4US8A 3N1ZC 1OGWA 2IO2B 2WXQA 3DBHB 3T3OA 5TR5A 2C60A 3ENEA 3B9JA 3PPAA 4IC7B 3NY5A 2WS3B 1A70A 3U2SC 1C1YB 2N9KA 2MJDA 1DYQA 2LVPA 2KVRA 2VH1A 2GBRA 4GDLB 1WYWB 1V81A 3GB1A 3P4PB 2C7HA 4DXGA 1YD8U 1V8CA 2FNJB 3KUCB 4N9F4 2BB6A 1V80A 1L0VB 2BKRB 2KLCA 5IN7A 3NZSA 2JX5A 1UD7A 4EOYA 4MGIE 1XLQA 3H1UA 2PEAA 4LNOA 4EFOA 3ZNGC 3PTFC 2NBWB 3ZO5B 1WZ3A 4RGNA 4GB9A 1V1OA 1WJ4A 3LB8C 1WYGA 2YEPF 3X0WA 2LHDA 3BYYB 3RNBC 1JMLA 4M8MA 3P4RB 2G3QB 1NYQA 2LUEA 4HK2A 1G6JA 3NRZA 2N7DA 4ANUA 3S2AA 2H89B 3URYA 3DVNU 1FEHA 2AEHA 1N5WA 1MHXA 1XF5L 1FFVA 1V97A 4W9GA 3NZ3A 1WXVA 2V4LA 3DBRI 1NDDA 1V2YA 1P7FA 3NVWA 3Q8FA 2J0KA 1ZPSA 2N4FA 3VFKA 4RMAA 1SSNA 4ARCA 1I4PA 1YMHE 1X1MA 4MJSB 2I38A 5H8YE 3R8BA 1H4RA 3KW5B 2KXJA 3T8MA 1UGMA 4XDDA 1F52A 4O1NA 2FCNA 4GDLA 4FHKA 5G55A 3AEBB 3ZYYX 2ZNVB 1I4GA 2W82A 1VZ7A 5IOIA 2J0JA 4GOCA 2LEKA 1L4DB 1S1QB 2M0XA 4DDGD 2K9XA 5C3JB 3SU8X 1P7EA 4JLCA 1J7AA 2L32A 1RYJA 3GZNB 2BWFA 4HKQA 5KHQA 3A1QB 4B9KA 1P0RA 2ZZPB 4MGYE 2INCC 4BBNF 2QDFA 2WYQA 3NS1A 4LDTB 4L2YA 5CHVC 3R66C 2DENB 2LXCA 4F8CB 5BMIA 3PVLA 4WJQA 1FNVA 2AWTA 2AQ2B 2QHOA 1RM6C 3T3NA 4AUQC 1JWSD 1Y56A 1AW7A 1JWBD 5J2RA 4P1CC 2KWCA 2H88B 3ZDMC 1J19A 1UGJA 2SAKA 3U7DA 1TT5B 3GOEA 2JZ3B 2V3NA 1Z5SB 1QKZA 1XD3B 1SXTA 2IGGA 3MHZA 2FCQA 2ON8A 3KYCD 4JQWC 4NAMA 2KMCA 1ZDXA 3U7ZA 3WAMA 4MJSA 3ZNHB 1LGRA 3VVWB 1YQ3B 2HE7A 1TYGB 4W9DA 3EGRA 3NZUA 3A9KB 3NHEB 2J7QB 4IG7B 1Z2MA 4X57B 1SE3A 1QT9A 4US9A 2W55A 1NENB 1WXQA 1TKEA 2V3SA 4RGMA 1WI0A 1E7VA 2RSUA 4AJYB 2L8JA 4MDKE 2DBYA 3JVZX 3VDZA 1XLNA 2KMMA 3HVDA 1CMXB 3A1QA 4WURA 1GC7A 1Q5WB 2BPSA 3H8HA 1KM7A 4A55A 4HVBA 2IGHA 2OJRA 1FD6A 4LK0M 4A90A 2PE9A 3OG5A 3IG3A 2M17A 2JZPA 5LXHA 1C76A 1ZE3D 3AE7B 4XC2A 4OVUA 3ZGZA 2SEBD 4W9JA 2PMVA 1KRHA 2CJNA 2KTRA 3N1YC 1NBFC 2IZVB 1VZ8A 2LWPA 1DOIA 3NUHB 1F2RC 1TGZB 4RFBA 2FCMA 2KK8A 1TTNA 1WJ6A 5C1ZA 1UBIA 3FC4A 2NVUI 4B6WA 2LUMA 4Q2JA 3W5VB 2WXFA 2FUG1 5LXIB 1ET9A 1I35A 4LDTD 5FKAC 4XYCA 4XZ4A 4HJKA 3V3XA 5C2TB 4DWFA 1OEYA 1YX6B 3TL5A 1I4XA 2ASQA 2WNMA 1WGKA 1HTOA 3RZWC 4A3PA 3UQAA 4E71A 1JRPA 1YIWA 2HD5B 2V9HA 4IUMB 3IXSA 4IWOA 4IW0A 3APCA 2MCNB 4TUUA 4KVGB 3IT4B 4RF1A 1KTKA 1V9JA 2WXJA 2EKIA 1FPYA 2L52A 3P4QB 4OHJA 1OFFA 4HPPA 5IA7A 3UINB 4GMVA 1YOVB 2RPQA 2K0PA 1C4PA 4FXCA 2JQRB 1RAXA 3GP7A 1L0XB 3N1XC 3BVGA 4NQKE 3ML8A 3HK0A 1WF9A 5KHOA 1WGRA 5HFYA 3AE1B 4ANWA 2L0FA 1M94A 5AZGA 4BKSD 2K8BA 2NR2A 4L1BA 3PRMB 1L6UA 1H8CA 1UNSA 1TS3A 4NAWB 4HKZE 3FILB 2BTEA 2IGDA 4MGZE 3AE8B 4YTPB 3SFDB 1R4MB 2V0GA 3Q6BA 1D5XC 4FADA 2EKEC 2GOWA 4KSKC 4EZJA 2LGIA 2BKFA 2YLMA 2INPE 1KFYB 3L08A 3SFEB 4H2AA 3EECA 1P9DU 5AUKA 4BVUC 4HDOA 2KDFB 1OQYA 3AE9B 2EMSA 1C3TA 3RNAC 1D5ZC 2WP9B 2D11A 4FHJA 4NJ6A 2D3BA 5T8IA 1FCLA 1V1PB 4D2KA 3NVVA 5H92C 3AEGB 1YQ4B 2WXHA 4J3OD 4WAAA 2BWES 3PT2B 3EUB2 2X8XX 2I1JA 3P4SB 3VTVA 2BVCA 4ITKA 3RYTA 5BMGA 3DVGY 1N5XA 4YSXB 1WGDA 3KUZA 5BO4B 4OZAA 4E74A 1PYWD 2WXOA 3AV8A 2HJ8A 1EF1A 2NBVB 1EU4A 3AEDB 4N6EB 1FRRA 4HPMB 1TS2A 1GJZA 2IYDB 3VH4B 3DHIC 2DAFA 4ZHPA 2K6QA 5JHAA 3VHTC 2PIAA 3NJTA 1ROEA 3I57A 3QQ8B 4EKUA 3C19A 2XNAC 3MP9A 1ZP0B 3UGBB 3CIRB 3HIZA 4KZCA 3ZXRA 1V49A 1GB1A 1JWMD 4NAWA 4WWPA 2XBBC 3FILA 1JWAD 1PUTA 3A33B 2DWQA 4MEMA 3ZKJC 3HHMA 3V60A 1QZEA 3BK1A 2Y5BB 1GNUA 1OEYJ 1EU3A 2ZCCA 3VUWA 4GXBA 1T6BX 2KFJA 2KYWA 1MI0A 1LO5D 4W9CA 1VJKA 4S0RA 3ZQ4A 2L0TA 4FJYA 5HHDG 1KJTA 4TMAB 4LNIA 2KJ6A 1IP9A 3WA0A 1V1PA 1DGJA 1T0RC 1MVKA 2MSED 1GG3A 4MELA 4WAFA 2NTTA 4KKIA 2W3RA 3DOWA 1TY2A 4RNAA 3HM3A 3PZ8A 3L13A 3E56A 3H6NA 5HKHA 2LXAA 2ZPNA 5G2NA 1E8WA 4EZKA 1HZ5A 2N9PC 2PE6B 5JXVA 1K52A 2PKOA 4PYUA 1MHHE 1KOTA 4KIKA 2WDTB 2KFKA 2K8HA 5FR3A 2FIFA 4IWQA 2DLBA 3DCGA 2KJRA 2N1VA 3HVZA 3GS2A 2O6VB 2RD0A 2Z0DB 4URKA 5E6PA 1YN4A 2IBIB 2O2VA 4TSSA 3LJ3A 1CQVA 3DBLB 5EE1A 3R3MA 1CJEA 1WGHA 3UIOB 3W9CB 2V1YA 2MBQA 2FUHB 4I6PA 1ZKHA 1BMLC 1SE4A 3DHGC 2FIDA 5BMHA 3HUIA 4OZBA 3TEWA 3KH0A 1WRIA 3IT6B 4WH4A 1WH3A 1N62A 1AYFA 1UWMA 4EEWA 4EE2A 2G45B 3CSFA 3PZ7A 2N7JA 3J9CA 4XWWA 1FM0D 4DHJD 2IO3B 2KLGA 1E7PB 5MPOA 5EE9A 2KWDA 3MHSD 1OQQA 3Q2AC 2DZKA 3AB5A 4HROA 3ETRA 4YTNB 3V61A 2LMCA 3AULA 2UU7A 1WX8A 4RM9A 2Y5PA 2KJHB 2VZKD 3QIJA 1QOGA 2WXMA 3QCAA 3ZTDA 3ZVVA 1F1HA 5CTRC 2MWSB 3QAQA 3AU5A 2MX2A 2O6VA 4B95A 3O13A 3CMMB 1YJJA 5AZHA 1RLFA 2KN5A 3B08A 2CHWA 4KSLC 5JHBA 3DWMA 4F7ZA 3M95A 4M01A 4TKNA 1BXTA 2LGXA 1L5PA 2WXPA 2Y3AA 1DOYA 1HXYD 2DNFA 1ZGUB 4IOIE 3R7QA 4TV3A 3JW0X 2M0AA 1EF5A 4OZCA 4LNKA 1D4BA 2R61A 2A5UA 4KX6B 1E0ZA 2MHJA 4YTMB 2MQJA 2WU2B 4B0MA 1KLUD 3HM6X 2ZJDA 3L16A 2KWUB 3W1YA 3DDCB 4GGQA 3EFUA 2LD9A 1FRDA 1I4QA 2KDIA 2M56B 2I1KA 2INDC 3QWZB 1KLGD 2MRPA 3RMKC 1YJ1A 5HI1A 1WMHB 3ZRFA 1DOXA 2KTRB 3PRZA 4ZOHC 3ONSA 1V5OA 2WWZA 4BFRA 2LGSA 1PGAA 4I6NB 1FXTB 1XO3A 4ZRQA 2JVCA 3AE6B 2LI5A 1MFWA 4YWGG 4WJOA 1WY8A 4XDCA 1UUPA 2LJ5A 2LASA 1UF0A 2ACZB 2WXIA 3A9JB 4OW0A 3PV1A 4GDKA 4HRSA 1KF6B 3U52E 3DBRB 3MTNB 3N32A 3TJPA 3KWVA 1WE7A 2L76A 1OQRA 3DHHC 4MGKE 1TZ1A 2QIEB 3DWGC 4CO7A 1SJHD 3VR8B 3RULA 5CHFA 1NI3A 3P2BA 1VDVA 3Q8AA 3L17A 4K7UA 3VUYA 2CJOA 1C4CA 2BT6A 1CZPA 1K50A 3KWLA 3VH3B 4JE3B 5IAAC 1V5TA 2IJ0A 4QAYA 2KX0A 5E6NA 1EWCA 4HCNB 1R4NB 4HPLB 2V4IB 4IWPA 2ZVOA 3L0WB 2KTFA 5J17A 1WXSA 2B76B 2ONQA 3H7PB 1KLVA 1WM3A 4UDUC 4AS1A 3ZNZB 1F9JA 4B0EA 2FBWB 3DBSA 4PS3A 2KD0A 1WMHA 2D5GA 2WX0A 2N9LA 2JZZA 1FO4A 4LNNA 2BS2B 1T0SC 2JWUA 2LVOA 2PW9A 2QJLA 2LHEA 1ESFA 3CSTA 3PLVA 4P16A 4WJNA 4NY0A 2PLPA 4AOFA 2WGSA 4ZYSA 2LRUA 2FCSA 5DPRA 3SEBA 4W9EA 5L95C 4RM8A 2BBCA 1I7HA 1HZ6A 1TKYA 3A9JA 4N58A 1E6EB 1C4AA 5HG2A 5D6JB 3IVFA 4KGTA 3N3KB 1E10A 4DBGA 2QC8A 3EA6A 2GBKA 1UBQA 2JRIB 4GN1A 5IO9A 4ACFA 2Q5WD 4HEA1 3NG0A 3RNEC 4ANXA 4HCPB 5BYQA 1YJIA 5CHWA 3SHQA 5DPSA 4ZRIA 3VRAB 4FN2A 5IKCM 4BOSC 5D3DA 2UYZB 4RGOS 1WGYA 3KLSX 4KZ0A 4KDLB 2JXTA 1JCKB 2WDQB 2K39A 3BWUD 1I42A 4KGRA 1K51A 3N9YC 2N9XA 1JWUD 4A3OA 1WM2A 2YEPB 1SB3C 1MG4A 1WFYA 4XGAB 4A9AA 2MP2B 4RF0A 2DHZA 1E8YA 3H7PA 3W5UB 5AUIA 2CHZA 3K9PB 3FAHA 4HWIB 4WWOA 1YN5A 1B9RA 4JPSA 4C80A 4IM0A 4JGHB 2QSDA 4MSMB 2DAJA 1TY0A 3ZDTA 2Z0EB 2KDMA 1ENFA 4DK5A 3RNFC 5TSSA 3TEYA 3BIID 2BYTA 2JWZA 3RCZA 2ZW0A 3I63C 1M4VA 4HDQA 1YN3A 2D3GA 3BZDB 4DHZB 2CS4A 3HRDD 1AWDA 1C77A 5FR6A 3OWEB 1GAQB 3UIPB 1D5MC 4JWUC 3OJ3A 2BGFA 3JSVB 2DYBA 4GU2A 2JT4B 2N1WA 3DVNV 1IBXB 3W2DA 1F2RI 3EHVA 5G5HA 4TQ0A 2WXRA 1SBBB 3H9DA 1FIQA 3C8YA 4TQ1A 2MBOA 1C9FA 1WIAA 4XE0A 4IDIA 2D3CA 2R2OA 3KUDB 4RGTA 1C78A 2REXA 3C0RB 1VCBA 2WXNA 2IO0B 5AEKB 2WHIA 1VR9A 2MP2A 4J6IA 4WWMA 1D6EC 3U30A 3ZNID 3QJZA 3PRPB 1EO6A 5DCNA 3SDLC 4PYZA 3LDZE 2XN9C 3ZW3A 1E8XA 4MM3B 4ZRPA 2CU1A 3WIMA 5D94A 3IAS1 1OTRB 2JY6A 3Q8CA
chains in the Genus database with same CATH topology
1ACCA 2WLBA 2H88B 1BMLC 1SE4A 1UGJA 4RH6A 3AECB 2SAKA 5BMHA 3HUIA 1GPXA 4OZBA 3TEWA 1WRIA 2G9HD 5G5GA 4A6QA 3KQ4A 3IT6B 4WH4A 3TEZA 1N62A 1B1ZA 1AYFA 1UWMA 2V3NA 4A8XC 4EE2A 1SF0A 3B2FA 1IBXA 2WXGA 2LJIA 1QKZA 2WXLA 2IGGA 1SXTA 3PZ7A 4N59A 2K22A 2N7JA 3MHZA 3AE5B 1YNTE 2ON8A 3J9CA 4XWWA 4NAMA 1BUIC 1FM0D 1ZDXA 1ZXIA 3U7ZA 1E7PB 5MPOA 5EE9A 1QILA 2KWDA 3R2TA 1ZOYB 2V3PA 1OQQA 3NVYA 1YQ3B 3Q69A 3AB5A 4HROA 2ZW1A 1TYGB 3ETRA 4YTNB 4MACA 2LMCA 3EGRA 3ZJTA 2AX5A 4ARIA 2Y5PA 1SE3A 1QT9A 2BS4B 4US9A 4DXFA 2W55A 1FNWA 1XCQL 1NENB 1WXQA 4HJGE 1TKEA 4YT0B 2W3SA 1FFUA 2RDGA 2VZKD 4RGMA 1QOGA 2WXMA 1HEZE 1XLOA 1JW9D 2DBYA 2PTLA 5I4DA 3AEFB 1XLNA 3L4PA 3AEAB 2KMMA 3HVDA 3O13A 1C79A 3BVZA 4AQ7A 4WURA 2CU3A 4KGSA 1YJJA 2MJEA 4KKJA 3H8HA 3MJ5A 4A55A 3VRBB 2IGHA 1FD6A 4LK0M 4A90A 2K5PA 1N63A 2EELA 3DWMA 4R3DA 2IDYA 2JZPA 1C76A 1ZE3D 3LYYA 1BXTA 5D7GA 3RPFC 1HA5A 1L5PA 3AE7B 2WXPA 2Y3AA 4YSYB 2GRIA 1DOYA 4RCOA 1HXYD 3ZGZA 2BW2A 4WQMA 1I4RA 2BS3B 2SEBD 4IOIE 2PMVA 1KRHA 2CJNA 2WDVB 1EWYC 2M0AA 2TSSA 3AE3B 3B2GA 3SR6A 4OZCA 1VZ8A 1D4BA 2R61A 1DOIA 3NUHB 1F2RC 4KX6B 4RFBA 1E0ZA 3U4EG 4M0WA 4YTMB 3AM9A 2WU2B 4XWTA 3FC4A 1CK1A 4B0MA 1KLUD 3ZJVA 2JU6X 3MC0B 2LUMA 4Q2JA 3W5VB 2WXFA 2FUG1 1ET9A 3PO0A 5FKAC 4JX1C 1QF6A 3V3XA 2NTSA 5C2TB 1FNUA 3P1MA 1I4XA 1FRDA 1I4QA 2M56B 2WNMA 5LNK1 4ZHOA 1WGKA 2I2YA 4MH8A 1KLGD 4C56C 1NEKB 2KN4A 3AE4B 1ET6A 5HI1A 1JRPA 1IGDA 3W1SA 1DOXA 1PGBA 3VR9B 4ZOHC 4PT5A 3AH7A 1PGAA 3CWIA 3IXSA 1FXIA 2MJ3A 3AE2B 1XO3A 1TS4A 1QQRA 1KH0A 2WDRB 4ZRQA 3AE6B 2M19A 3VQIA 3RFZB 1GB4A 4REZA 4YWGG 3IT4B 2K3UA 4XDCA 1UUPA 3I9V1 4RF1A 5FK9C 3V05A 2LFIA 1R7SA 1XLPA 1KTKA 3E9SA 2WXJA 2EKIA 1FCCC 1SEBD 2ACZB 2L52A 1N60A 3P4QB 4OHJA 1OFFA 2W54A 2WXIA 4OW0A 1ZXHA 2K0PA 3P63A 4HRSA 1KF6B 1C4PA 3AN1A 2JQRB 4FXCA 3Q8BA 3U52E 1SE2A 3GP7A 1L0XB 2WXKA 4OVZA 1E9MA 3KWVA 2X38A 3BVGA 1OQRA 4LLGM 1QOFA 1K53A 2HTME 2QIEB 3DWGC 1SJHD 3VR8B 3TEXA 2ICIA 1RFKA 5HFYA 2FE8A 2RPVA 1PFDA 4MT5A 1JROA 1VZ6A 3AE1B 1MPEA 1NI3A 2BB5A 1VDVA 3Q8AA 2CJOA 1C4CA 2BT6A 1CZPA 1XXGA 1K50A 3KWLA 2JSVX 1STEA 4JE3B 3TSSA 1FXAA 2IJ0A 5GXGB 2PVOD 2E6XA 2INNE 1EWCA 1QOBA 2V4IB 4L1BA 2L1AA 2AQ3B 4GDKB 2IPKD 4YXDB 1L6UA 1WWTA 3ZJUA 1UNSA 2VZKB 4IKGA 1TS3A 4NAWB 2B76B 2ONQA 4HKZE 4DQOC 1NVID 2RDHA 3FILB 4UDUC 4AS1A 2BTEA 2OHFA 2AQ1B 2IGDA 4B0EA 2QMTA 2J52A 2FBWB 3AE8B 4YTPB 3SFDB 2V0GA 1D5XC 1WSPA 2D5GA 1ZDVA 2N9LA 1FO4A 2LGIA 4P6VF 1L4ZB 3AEEB 1XEEA 3P42A 2GB1A 1I4HA 1HQRD 2BS2B 2JWUA 2INPE 2PW9A 2QJLA 1KFYB 2LHEA 4YSZB 1ESFA 4CQNA 5E6JA 3R2IA 4P16A 3BK2A 1NYRA 2PLPA 1QLBB 1F77A 3SFEB 4ZYSA 4H2AA 5AUKA 1T3QA 3BVMA 3SEBA 2QEJC 1TS5A 3AE9B 3WCQA 1D5ZC 2WP9B 1UWXA 2GI9A 1J7BA 2BBCA 1I7HA 5T8IA 1HZ6A 1TKYA 4L23A 2KAJA 1FCLA 1V1PB 4D2KA 3NVVA 5H92C 3AEGB 2QILA 1YQ4B 5EE0A 2WQYB 1FMAD 2WXHA 4N58A 4J3OD 1E6EB 1C4AA 1SJED 2J4XA 5HG2A 4NZLB 4KGTA 3EUB2 2MEKA 2J53A 3P4SB 4US8A 1ZUD2 4ITKA 1E10A 3EA6A 5BMGA 1N5XA 2WXQA 4YSXB 2Q5WD 3NVZA 4HEA1 3T3OA 1IGCA 4OZAA 3B9JA 5BYQA 1YJIA 1PYWD 2WS3B 1A70A 2WXOA 3U2SC 3AV8A 2N9KA 3VRAB 2MJDA 5D3DA 4LTUA 1DYQA 1VRAB 2KQ4X 4RGOS 1EU4A 3AEDB 2NMQA 4N6EB 1FRRA 4GDLB 3KLSX 2Z8LA 1TS2A 3GB1A 2JXTA 3P4PB 2DYOA 1QOAA 4DXGA 1JCKB 1V8CA 4ZHPA 2OEDA 2WDQB 4WIPA 2PIAA 3BWUD 2BB6A 4KGRA 1K51A 1ROEA 3N9YC 3LXFA 1JWUD 2J42A 1L0VB 1L6VA 3I57A 2YEPB 2XNAC 3IAM1 3MP9A 1ZP0B 3CIRB 1SB3C 2PVGC 2JX5A 1GB1A 1JWMD 2MH7A 4A9AA 4RF0A 3W5UB 2KACA 3FILA 1XLQA 5AUIA 1JWAD 2HDEA 2G1EA 1PUTA 1F0ZA 2DWQA 1JALA 3FAHA 1JQ4A 1YN5A 1B9RA 4RGNA 1TJEA 1V1OA 3LB8C 4JPSA 4NJCA 1WYGA 2YEPF 4C80A 3BK1A 2LHDA 3BYYB 1EU3A 2QSDA 1JMLA 1TY0A 3P4RB 1T6BX 1NYQA 5BYSA 1MI0A 1LO5D 2KDMA 1ENFA 3NRZA 1PDXA 1VJKA 5TSSA 3TEYA 3BIID 3ZQ4A 2H89B 3URYA 2BYTA 5HHDG 2ZW0A 1FEHA 1PGXA 1M4VA 1N5WA 1MHXA 1XF5L 2E3TA 1FFVA 1YN3A 4TMAB 3BZDB 1TKGA 1SIJA 1V97A 3NZ3A 3HRDD 1AWDA 1C77A 1V1PA 3OWEB 1GAQB 1D5MC 1DGJA 4JWUC 1MVKA 1P7FA 4WAFA 3NVWA 4C7ZA 3Q8FA 2NTTA 1ZPSA 2DYMA 1IBXB 1SSNA 4KKIA 4ARCA 3W2DA 1I4PA 2W3RA 1F2RI 3MFGA 5G5HA 1YMHE 5EE3A 4TQ0A 1TY2A 2WXRA 4RNAA 3PZ8A 2I38A 1SBBB 3E56A 5H8YE 3R8BA 1FIQA 3C8YA 1N61A 4TQ1A 3UI3A 1C9FA 1HZ5A 4XDDA 4O1NA 4XE0A 5JXVA 1K52A 2RMMA 4IDIA 3Q8EA 3AEBB 3ZYYX 1AN8A 2PKOA 1MHHE 1I4GA 2JYTA 2W82A 3ABVB 1T5XD 1VZ7A 4RGTA 1C78A 5FR3A 2LEKA 1L4DB 2DLBA 1RWSA 5D3IB 1IUEA 2K9XA 3HVZA 2WXNA 5C3JB 4C7YA 2WU5B 1P7EA 4GLSC 1VR9A 3GS2A 4WWMA 1D6EC 1J7AA 2L32A 2L83A 1EM7A 1RYJA 2N0SB 4HKQA 1TZOA 1XCTL 4USAA 3AMZA 1YN4A 3NS1A 3TUOA 2JYEA 4L2YA 1GOZA 1Q10A 4TSSA 5BMIA 3BYTB 1FNVA 2AQ2B 2Y5CA 1RM6C 1CQVA 5BYRA 2XN9C 5EE1A 3T3NA 1CJEA 1L0YB 1JWSD 1J7CA 1Y56A 3W9CB 1VLBA 4MM3B 1AW7A 1JWBD 4JWSC 4ZRPA 3IAS1 3Q8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IKG A;  2LHD A;  2LUM A;  2ONQ A;  4HKZ E;  3FIL B;  2QSD A;  1JML A;  2IGD A;  2QMT A;  2J52 A;  5BMH A;  1MI0 A;  3V3X A;  2KDM A;  4OZB A;  2N9L A;  4WH4 A;  2LGI A;  5HHD G;  2ZW0 A;  2GB1 A;  2I2Y A;  1PGX A;  1IBX A;  1XF5 L;  1MHX A;  2JWU A;  1QKZ A;  2KN4 A;  2IGG A;  2PW9 A;  2LHE A;  2N7J A;  5HI1 A;  1YNT E;  2ON8 A;  1IGD A;  2PLP A;  1MVK A;  1PGB A;  1P7F A;  2KWD A;  1PGA A;  1IBX B;  1UWX A;  2GI9 A;  2ZW1 A;  1F2R I;  4MAC A;  1HZ6 A;  1FCL A;  4D2K A;  1KH0 A;  1YMH E;  2I38 A;  1GB4 A;  5HG2 A;  4KGT A;  1XCQ L;  4HJG E;  2J53 A;  3UI3 A;  1C9F A;  1HZ5 A;  1FCC C;  5BMG A;  1HEZ E;  5JXV A;  1K52 A;  2RMM A;  1IGC A;  1ZXH A;  2K0P A;  2PTL A;  4OZA A;  1MHH E;  2N9K A;  2KQ4 X;  4KGS A;  2NMQ A;  3GB1 A;  2IGH A;  2JXT A;  1FD6 A;  1P7E A;  1K53 A;  4GLS C;  2OED A;  2EEL A;  2JZP A;  1EM7 A;  5HFY A;  4KGR A;  1K51 A;  2RPV A;  1XCT L;  1MPE A;  3MP9 A;  4IOI E;  1Q10 A;  5BMI A;  1GB1 A;  1K50 A;  2JSV X;  4OZC A;  2KAC A;  3FIL A;  1D4B A;  1F2R C;  2JU6 X; 
#chains in the Genus database with same CATH topology
 1ACC A;  4S17 A;  2WLB A;  4KIK B;  2KFK B;  1TBE A;  3AEC B;  3BY4 B;  4M0W B;  2L00 B;  4A6Q A;  4W9H A;  2VH2 A;  1LM8 B;  1SIF A;  3QA8 A;  3JSV A;  3DBH I;  3JYU A;  3A4S C;  1IBX A;  2WXG A;  2LJI A;  4NJ7 A;  4N59 A;  2K22 A;  2O2V B;  4CHK A;  2KT7 A;  4HLE A;  1ZXI A;  3R2T A;  1ZOY B;  4FLH A;  4C4V A;  3NVY A;  4LCD E;  4MSQ B;  2K8C A;  3AU4 A;  1TIF A;  2AX5 A;  3D32 A;  4ARI A;  4EUT A;  2BS4 B;  2ZCB A;  1E7U A;  3QX1 A;  3PHX B;  4HJG E;  4YT0 B;  4ZRJ A;  1FFU A;  2RDG A;  2RGF A;  2MLB A;  1HEZ E;  1XLO A;  1JW9 D;  2BYE A;  2PTL A;  3O65 B;  1WJU A;  3AEF B;  3AEA B;  4KV2 A;  1C79 A;  2KO3 A;  1XT9 B;  2GBN A;  4KGS A;  2KAN A;  4KKJ A;  3MJ5 A;  3VRB B;  1E90 A;  3V6C B;  3ZRC A;  2K5P A;  2GBJ A;  4W9I A;  4WQO B;  2EEL A;  4R3D A;  2IDY A;  1WRD B;  2ZEQ A;  1HA5 A;  4PS7 A;  3PLU A;  2RR9 A;  2GRI A;  4RCO A;  2KDB A;  4MM3 A;  4WQM A;  4YL8 A;  2WDV B;  1EWY C;  3B2G A;  2TSS A;  3AE3 B;  2KHW B;  3U4E G;  4M0W A;  3ZLZ A;  4I6L B;  4XWT A;  1CK1 A;  5AZF A;  2JU6 X;  4KDI C;  2OOB B;  3VXW A;  1UEL A;  1FNU A;  1ISN A;  4NQL B;  3PHW B;  2MW5 A;  4ZHO A;  2L7R A;  2I2Y A;  4MH8 A;  4C56 C;  2KN4 A;  3AE4 B;  1ET6 A;  2AYO B;  4K3C A;  4M02 A;  3W1S A;  2YVC A;  3VR9 B;  4PT5 A;  2KDE B;  2HTH A;  2MJ3 A;  3AE2 B;  2D3A A;  1TS4 A;  1QQR A;  3GZN I;  1WJN A;  2WDR B;  2M19 A;  5JH5 C;  3RFZ B;  1GB4 A;  4AWJ A;  4REZ A;  2K3U A;  3I9V 1;  5FK9 C;  2LRW A;  3V05 A;  2LFI A;  1XLP A;  1P1A A;  4IM2 A;  2OJW A;  2W54 A;  4EZL A;  3B0A A;  3OJ4 B;  1S3S G;  3RI7 C;  3AN1 A;  1NI2 A;  2WXK A;  4OVZ A;  1E9M A;  2X38 A;  4LLG M;  4AJW A;  4K7W A;  1QOF A;  2D2Q A;  4K81 A;  1K53 A;  2HTM E;  3IBE A;  3M62 B;  4MH0 E;  1RFK A;  2RPV A;  5CX3 A;  5EDS A;  1JRO A;  1VZ6 A;  2BB5 A;  2N9E B;  1WE6 A;  2MBE A;  2IY1 B;  2NS5 A;  1STE A;  1SGH A;  1K8R B;  3TSS A;  2M4N A;  5GXG B;  2KKC A;  2PVO D;  2E6X A;  2GBM A;  1QOB A;  4GDK B;  1WWT A;  3ZJU A;  2RDH A;  3IFW B;  2J52 A;  4BKT A;  3RT3 B;  1WSP A;  4PS8 A;  4NNJ B;  4II2 B;  2M8S A;  4ANV A;  1L4Z B;  2RDB C;  3RUI B;  4GSW A;  4ZDV A;  4BOZ B;  4PK1 A;  3MC8 A;  3M63 B;  4YSZ B;  4CQN A;  2O6V D;  3BK2 A;  1NYR A;  3GE8 C;  4GIV A;  1F77 A;  3BVM A;  1TS5 A;  4M00 A;  1R4N I;  1GUA B;  3WCQ A;  3RN9 C;  2BYF A;  1UWX A;  2MBH A;  2GI9 A;  1J7B A;  2KX3 A;  4ASW C;  2JF5 A;  4L23 A;  2KAJ A;  2QIL A;  1AAR A;  3Q14 C;  2XEW A;  5EE0 A;  2WQY B;  1FMA D;  5DPW A;  1SJE D;  4NZL B;  2MEK A;  2EMT A;  1ZUD 2;  4DHZ E;  3NVZ A;  3ZIM A;  1IGC A;  3TCA A;  1JRU A;  4XX5 A;  2R2Q A;  1V6E A;  4LTU A;  1EUV B;  1VRA B;  2C7M B;  2KQ4 X;  2NMQ A;  1L2N A;  2C9W B;  2Z8L A;  2GMI C;  3PZD A;  3K9O B;  1MJD A;  2DYO A;  1QOA A;  3VAW A;  2CKH B;  2OED A;  3DVG X;  3RNG C;  1LXD A;  2NCN A;  4WIP A;  2MBB B;  1WXA A;  3RD2 A;  4FBJ B;  3LXF A;  2J42 A;  4BBN C;  1L6V A;  3QAR A;  3OLM D;  2KNB A;  3IAM 1;  2PVG C;  1J8C A;  2KOX A;  3GE3 C;  3M3J A;  2GLS A;  2MH7 A;  4DDI D;  2KAC A;  2DZI A;  2HDE A;  2G1E A;  1F0Z A;  3UQB A;  1JAL A;  1JQ4 A;  1UH6 A;  1TJE A;  3QC8 B;  2M1M A;  4NJC A;  4P7I A;  1IYF A;  1PQS A;  2ZVN A;  5BYS A;  3DQV A;  3TBL D;  2KC1 A;  4BKG A;  1PDX A;  3FKY A;  3MC9 A;  5GMV A;  5D2M B;  1PGX A;  1E8Z A;  2E3T A;  1TKG A;  1SIJ A;  2K25 A;  3WAN A;  1A5R A;  2IY0 B;  2UWQ A;  2KVZ A;  2N7E A;  4C7Z A;  4W9F A;  2DYM A;  4OVV A;  1P3Q U;  5DPT A;  3MFG A;  2D10 A;  5EE3 A;  3N30 A;  3APD A;  3A4R A;  4P1B C;  3I3T B;  1N61 A;  3UI3 A;  4FUL A;  2RMM A;  2LZ6 A;  3Q8E A;  1AN8 A;  3W1S C;  4ZRK A;  4ZYN A;  4HXD A;  2JYT A;  3ABV B;  1T5X D;  1ZW7 A;  2NPT B;  1WXM A;  2A4Z A;  1BT0 A;  3RNC C;  1RWS A;  5D3I B;  2AL6 A;  1IUE A;  2QCZ A;  3NS8 A;  2ZPY A;  1Q0W B;  4K1R B;  4C7Y A;  2WU5 B;  1R4M I;  3APF A;  4GLS C;  2L83 A;  3Q3M C;  1EM7 A;  2N0S B;  2JUO A;  3ECI A;  1TZO A;  3ZTC A;  2PJH A;  1XCT L;  4USA A;  3AMZ A;  3TUO A;  2JYE A;  1GOZ A;  3WAO A;  1Q10 A;  2D07 B;  5L83 A;  3BYT B;  2Y5C A;  5J18 A;  5BYR A;  1L0Y B;  2DZJ A;  3VTW A;  1J7C A;  3X23 A;  2B3A A;  1VLB A;  4JWS C;  3A9K A;  2DZM A;  2C5L C;  1YQB A;  3WAL A;  4A20 A;  4RH6 A;  3V6E B;  1GPX A;  2G9H D;  3UF8 A;  5G5G A;  3KQ4 A;  3ZXV A;  4LJP B;  3TEZ A;  4FJZ A;  1LFD A;  1B1Z A;  4A8X C;  2C7N B;  1SF0 A;  3B2F A;  1MG8 A;  2WXL A;  3AE5 B;  1YNT E;  2Z59 B;  4BKS A;  1BUI C;  3ZUN A;  2K1F A;  3QK0 A;  2J0M A;  1QIL A;  2V3P A;  1Q1O A;  1HTQ A;  3Q69 A;  2ZW1 A;  4MAC A;  2KQ7 A;  4FJV B;  1V86 A;  3ZJT A;  3Q3N C;  1RRB A;  5C23 A;  3Q3O C;  4G3X B;  4LJO B;  4DXF A;  2NPT A;  3ALB A;  1SE9 A;  1FNW A;  1XCQ L;  2BQQ A;  2PPH A;  2W3S A;  2L3Z A;  4IM3 A;  1P98 A;  3H7S A;  5I4D A;  2KWV B;  4F1S A;  3L4P A;  4W9K A;  4G0N B;  3PSE B;  3EC8 A;  3BVZ A;  4AQ7 A;  2BF8 B;  2CU3 A;  2XK5 B;  2MJE A;  3I5J C;  1T0Y A;  4JL9 A;  4M8N A;  4C4V B;  1N63 A;  1WZ0 A;  3Q3J A;  3LYY A;  5D7G A;  3RPF C;  1UZX B;  4YSY B;  3PS6 A;  1HE8 A;  2BW2 A;  2DX5 B;  1I4R A;  2NBU A;  2BS3 B;  2W9N A;  4AP4 C;  1D3Z A;  3L10 B;  1GC6 A;  4ICU A;  3AXC A;  3SR6 A;  2IO1 B;  3AM9 A;  3ZJV A;  3MC0 B;  5E6O A;  3PO0 A;  3PGE A;  4JX1 C;  5JZE B;  4II3 B;  1QF6 A;  3KYD D;  2NTS A;  4NPN A;  3V62 A;  1YX5 B;  2G4S A;  3P1M A;  3T9L A;  5LNK 1;  3SD5 A;  3VTU A;  1T0Q C;  3R7R A;  3N20 C;  1NEK B;  3PRE A;  1IGD A;  4CYE A;  2G4D B;  1PGB A;  2KQS A;  3ML9 A;  3TIX A;  3AH7 A;  3CWI A;  3CF6 E;  1FXI A;  2KC2 A;  1XQQ A;  2CHX A;  1WX7 A;  1KH0 A;  1U4A A;  3KVF B;  4W9L A;  2LVQ A;  1N6Z A;  3VQI A;  2LGY A;  4DXA B;  1R7S A;  2ZNV C;  3QHT A;  3E9S A;  2WX1 A;  1Y8R C;  2XK5 A;  1FCC C;  4WWN A;  3DBL I;  1SEB D;  5IP4 D;  1N60 A;  2LGD A;  3NOB A;  4FA6 A;  1ZXH A;  3P63 A;  4BAX A;  3Q8B A;  1SE2 A;  3B1L X;  1VD2 A;  3IHP C;  4JIO U;  2AL3 A;  3BIN A;  4K7S A;  2KMA A;  3TEX A;  2ICI A;  4DHJ B;  2FE8 A;  1WX9 A;  1PFD A;  4MT5 A;  1MPE A;  4WJP A;  3MJW A;  4C00 A;  3OAW A;  1WR6 E;  4BZA A;  1XXG A;  1L7Y A;  3RZF A;  2FAZ A;  2HJ1 A;  2JSV X;  2BYV E;  2K6D B;  1FXA A;  2L05 A;  3WAP A;  1WR1 A;  3EFC A;  2INN E;  4G50 A;  2JPH A;  2L1A A;  2AQ3 B;  2IPK D;  4YXD B;  2CR5 A;  4E3C A;  2KZR A;  2VZK B;  4IKG A;  1IPG A;  2VRR B;  4DQO C;  1NVI D;  2OHF A;  2AQ1 B;  3Q3F A;  2QMT A;  3L54 A;  1ZDV A;  4P6V F;  3AEE B;  1XEE A;  3P42 A;  2GB1 A;  1I4H A;  2JRH A;  1HQR D;  1LQB A;  3DPD A;  5LLI A;  5E6J A;  3R2I A;  3AI5 A;  4ICV A;  1QLB B;  4G11 A;  4K3B A;  2JXX A;  1T3Q A;  1J0G A;  2QEJ C;  1E5W A;  3U8Z A;  3TMP B;  2MA9 B;  3VUX A;  1RFA A;  4LNF A;  1WGG A;  2J4X A;  2J53 A;  4US8 A;  3N1Z C;  1OGW A;  2IO2 B;  2WXQ A;  3DBH B;  3T3O A;  5TR5 A;  2C60 A;  3ENE A;  3B9J A;  3PPA A;  4IC7 B;  3NY5 A;  2WS3 B;  1A70 A;  3U2S C;  1C1Y B;  2N9K A;  2MJD A;  1DYQ A;  2LVP A;  2KVR A;  2VH1 A;  2GBR A;  4GDL B;  1WYW B;  1V81 A;  3GB1 A;  3P4P B;  2C7H A;  4DXG A;  1YD8 U;  1V8C A;  2FNJ B;  3KUC B;  4N9F 4;  2BB6 A;  1V80 A;  1L0V B;  2BKR B;  2KLC A;  5IN7 A;  3NZS A;  2JX5 A;  1UD7 A;  4EOY A;  4MGI E;  1XLQ A;  3H1U A;  2PEA A;  4LNO A;  4EFO A;  3ZNG C;  3PTF C;  2NBW B;  3ZO5 B;  1WZ3 A;  4RGN A;  4GB9 A;  1V1O A;  1WJ4 A;  3LB8 C;  1WYG A;  2YEP F;  3X0W A;  2LHD A;  3BYY B;  3RNB C;  1JML A;  4M8M A;  3P4R B;  2G3Q B;  1NYQ A;  2LUE A;  4HK2 A;  1G6J A;  3NRZ A;  2N7D A;  4ANU A;  3S2A A;  2H89 B;  3URY A;  3DVN U;  1FEH A;  2AEH A;  1N5W A;  1MHX A;  1XF5 L;  1FFV A;  1V97 A;  4W9G A;  3NZ3 A;  1WXV A;  2V4L A;  3DBR I;  1NDD A;  1V2Y A;  1P7F A;  3NVW A;  3Q8F A;  2J0K A;  1ZPS A;  2N4F A;  3VFK A;  4RMA A;  1SSN A;  4ARC A;  1I4P A;  1YMH E;  1X1M A;  4MJS B;  2I38 A;  5H8Y E;  3R8B A;  1H4R A;  3KW5 B;  2KXJ A;  3T8M A;  1UGM A;  4XDD A;  1F52 A;  4O1N A;  2FCN A;  4GDL A;  4FHK A;  5G55 A;  3AEB B;  3ZYY X;  2ZNV B;  1I4G A;  2W82 A;  1VZ7 A;  5IOI A;  2J0J A;  4GOC A;  2LEK A;  1L4D B;  1S1Q B;  2M0X A;  4DDG D;  2K9X A;  5C3J B;  3SU8 X;  1P7E A;  4JLC A;  1J7A A;  2L32 A;  1RYJ A;  3GZN B;  2BWF A;  4HKQ A;  5KHQ A;  3A1Q B;  4B9K A;  1P0R A;  2ZZP B;  4MGY E;  2INC C;  4BBN F;  2QDF A;  2WYQ A;  3NS1 A;  4LDT B;  4L2Y A;  5CHV C;  3R66 C;  2DEN B;  2LXC A;  4F8C B;  5BMI A;  3PVL A;  4WJQ A;  1FNV A;  2AWT A;  2AQ2 B;  2QHO A;  1RM6 C;  3T3N A;  4AUQ C;  1JWS D;  1Y56 A;  1AW7 A;  1JWB D;  5J2R A;  4P1C C;  2KWC A;  2H88 B;  3ZDM C;  1J19 A;  1UGJ A;  2SAK A;  3U7D A;  1TT5 B;  3GOE A;  2JZ3 B;  2V3N A;  1Z5S B;  1QKZ A;  1XD3 B;  1SXT A;  2IGG A;  3MHZ A;  2FCQ A;  2ON8 A;  3KYC D;  4JQW C;  4NAM A;  2KMC A;  1ZDX A;  3U7Z A;  3WAM A;  4MJS A;  3ZNH B;  1LGR A;  3VVW B;  1YQ3 B;  2HE7 A;  1TYG B;  4W9D A;  3EGR A;  3NZU A;  3A9K B;  3NHE B;  2J7Q B;  4IG7 B;  1Z2M A;  4X57 B;  1SE3 A;  1QT9 A;  4US9 A;  2W55 A;  1NEN B;  1WXQ A;  1TKE A;  2V3S A;  4RGM A;  1WI0 A;  1E7V A;  2RSU A;  4AJY B;  2L8J A;  4MDK E;  2DBY A;  3JVZ X;  3VDZ A;  1XLN A;  2KMM A;  3HVD A;  1CMX B;  3A1Q A;  4WUR A;  1GC7 A;  1Q5W B;  2BPS A;  3H8H A;  1KM7 A;  4A55 A;  4HVB A;  2IGH A;  2OJR A;  1FD6 A;  4LK0 M;  4A90 A;  2PE9 A;  3OG5 A;  3IG3 A;  2M17 A;  2JZP A;  5LXH A;  1C76 A;  1ZE3 D;  3AE7 B;  4XC2 A;  4OVU A;  3ZGZ A;  2SEB D;  4W9J A;  2PMV A;  1KRH A;  2CJN A;  2KTR A;  3N1Y C;  1NBF C;  2IZV B;  1VZ8 A;  2LWP A;  1DOI A;  3NUH B;  1F2R C;  1TGZ B;  4RFB A;  2FCM A;  2KK8 A;  1TTN A;  1WJ6 A;  5C1Z A;  1UBI A;  3FC4 A;  2NVU I;  4B6W A;  2LUM A;  4Q2J A;  3W5V B;  2WXF A;  2FUG 1;  5LXI B;  1ET9 A;  1I35 A;  4LDT D;  5FKA C;  4XYC A;  4XZ4 A;  4HJK A;  3V3X A;  5C2T B;  4DWF A;  1OEY A;  1YX6 B;  3TL5 A;  1I4X A;  2ASQ A;  2WNM A;  1WGK A;  1HTO A;  3RZW C;  4A3P A;  3UQA A;  4E71 A;  1JRP A;  1YIW A;  2HD5 B;  2V9H A;  4IUM B;  3IXS A;  4IWO A;  4IW0 A;  3APC A;  2MCN B;  4TUU A;  4KVG B;  3IT4 B;  4RF1 A;  1KTK A;  1V9J A;  2WXJ A;  2EKI A;  1FPY A;  2L52 A;  3P4Q B;  4OHJ A;  1OFF A;  4HPP A;  5IA7 A;  3UIN B;  4GMV A;  1YOV B;  2RPQ A;  2K0P A;  1C4P A;  4FXC A;  2JQR B;  1RAX A;  3GP7 A;  1L0X B;  3N1X C;  3BVG A;  4NQK E;  3ML8 A;  3HK0 A;  1WF9 A;  5KHO A;  1WGR A;  5HFY A;  3AE1 B;  4ANW A;  2L0F A;  1M94 A;  5AZG A;  4BKS D;  2K8B A;  2NR2 A;  4L1B A;  3PRM B;  1L6U A;  1H8C A;  1UNS A;  1TS3 A;  4NAW B;  4HKZ E;  3FIL B;  2BTE A;  2IGD A;  4MGZ E;  3AE8 B;  4YTP B;  3SFD B;  1R4M B;  2V0G A;  3Q6B A;  1D5X C;  4FAD A;  2EKE C;  2GOW A;  4KSK C;  4EZJ A;  2LGI A;  2BKF A;  2YLM A;  2INP E;  1KFY B;  3L08 A;  3SFE B;  4H2A A;  3EEC A;  1P9D U;  5AUK A;  4BVU C;  4HDO A;  2KDF B;  1OQY A;  3AE9 B;  2EMS A;  1C3T A;  3RNA C;  1D5Z C;  2WP9 B;  2D11 A;  4FHJ A;  4NJ6 A;  2D3B A;  5T8I A;  1FCL A;  1V1P B;  4D2K A;  3NVV A;  5H92 C;  3AEG B;  1YQ4 B;  2WXH A;  4J3O D;  4WAA A;  2BWE S;  3PT2 B;  3EUB 2;  2X8X X;  2I1J A;  3P4S B;  3VTV A;  2BVC A;  4ITK A;  3RYT A;  5BMG A;  3DVG Y;  1N5X A;  4YSX B;  1WGD A;  3KUZ A;  5BO4 B;  4OZA A;  4E74 A;  1PYW D;  2WXO A;  3AV8 A;  2HJ8 A;  1EF1 A;  2NBV B;  1EU4 A;  3AED B;  4N6E B;  1FRR A;  4HPM B;  1TS2 A;  1GJZ A;  2IYD B;  3VH4 B;  3DHI C;  2DAF A;  4ZHP A;  2K6Q A;  5JHA A;  3VHT C;  2PIA A;  3NJT A;  1ROE A;  3I57 A;  3QQ8 B;  4EKU A;  3C19 A;  2XNA C;  3MP9 A;  1ZP0 B;  3UGB B;  3CIR B;  3HIZ A;  4KZC A;  3ZXR A;  1V49 A;  1GB1 A;  1JWM D;  4NAW A;  4WWP A;  2XBB C;  3FIL A;  1JWA D;  1PUT A;  3A33 B;  2DWQ A;  4MEM A;  3ZKJ C;  3HHM A;  3V60 A;  1QZE A;  3BK1 A;  2Y5B B;  1GNU A;  1OEY J;  1EU3 A;  2ZCC A;  3VUW A;  4GXB A;  1T6B X;  2KFJ A;  2KYW A;  1MI0 A;  1LO5 D;  4W9C A;  1VJK A;  4S0R A;  3ZQ4 A;  2L0T A;  4FJY A;  5HHD G;  1KJT A;  4TMA B;  4LNI A;  2KJ6 A;  1IP9 A;  3WA0 A;  1V1P A;  1DGJ A;  1T0R C;  1MVK A;  2MSE D;  1GG3 A;  4MEL A;  4WAF A;  2NTT A;  4KKI A;  2W3R A;  3DOW A;  1TY2 A;  4RNA A;  3HM3 A;  3PZ8 A;  3L13 A;  3E56 A;  3H6N A;  5HKH A;  2LXA A;  2ZPN A;  5G2N A;  1E8W A;  4EZK A;  1HZ5 A;  2N9P C;  2PE6 B;  5JXV A;  1K52 A;  2PKO A;  4PYU A;  1MHH E;  1KOT A;  4KIK A;  2WDT B;  2KFK A;  2K8H A;  5FR3 A;  2FIF A;  4IWQ A;  2DLB A;  3DCG A;  2KJR A;  2N1V A;  3HVZ A;  3GS2 A;  2O6V B;  2RD0 A;  2Z0D B;  4URK A;  5E6P A;  1YN4 A;  2IBI B;  2O2V A;  4TSS A;  3LJ3 A;  1CQV A;  3DBL B;  5EE1 A;  3R3M A;  1CJE A;  1WGH A;  3UIO B;  3W9C B;  2V1Y A;  2MBQ A;  2FUH B;  4I6P A;  1ZKH A;  1BML C;  1SE4 A;  3DHG C;  2FID A;  5BMH A;  3HUI A;  4OZB A;  3TEW A;  3KH0 A;  1WRI A;  3IT6 B;  4WH4 A;  1WH3 A;  1N62 A;  1AYF A;  1UWM A;  4EEW A;  4EE2 A;  2G45 B;  3CSF A;  3PZ7 A;  2N7J A;  3J9C A;  4XWW A;  1FM0 D;  4DHJ D;  2IO3 B;  2KLG A;  1E7P B;  5MPO A;  5EE9 A;  2KWD A;  3MHS D;  1OQQ A;  3Q2A C;  2DZK A;  3AB5 A;  4HRO A;  3ETR A;  4YTN B;  3V61 A;  2LMC A;  3AUL A;  2UU7 A;  1WX8 A;  4RM9 A;  2Y5P A;  2KJH B;  2VZK D;  3QIJ A;  1QOG A;  2WXM A;  3QCA A;  3ZTD A;  3ZVV A;  1F1H A;  5CTR C;  2MWS B;  3QAQ A;  3AU5 A;  2MX2 A;  2O6V A;  4B95 A;  3O13 A;  3CMM B;  1YJJ A;  5AZH A;  1RLF A;  2KN5 A;  3B08 A;  2CHW A;  4KSL C;  5JHB A;  3DWM A;  4F7Z A;  3M95 A;  4M01 A;  4TKN A;  1BXT A;  2LGX A;  1L5P A;  2WXP A;  2Y3A A;  1DOY A;  1HXY D;  2DNF A;  1ZGU B;  4IOI E;  3R7Q A;  4TV3 A;  3JW0 X;  2M0A A;  1EF5 A;  4OZC A;  4LNK A;  1D4B A;  2R61 A;  2A5U A;  4KX6 B;  1E0Z A;  2MHJ A;  4YTM B;  2MQJ A;  2WU2 B;  4B0M A;  1KLU D;  3HM6 X;  2ZJD A;  3L16 A;  2KWU B;  3W1Y A;  3DDC B;  4GGQ A;  3EFU A;  2LD9 A;  1FRD A;  1I4Q A;  2KDI A;  2M56 B;  2I1K A;  2IND C;  3QWZ B;  1KLG D;  2MRP A;  3RMK C;  1YJ1 A;  5HI1 A;  1WMH B;  3ZRF A;  1DOX A;  2KTR B;  3PRZ A;  4ZOH C;  3ONS A;  1V5O A;  2WWZ A;  4BFR A;  2LGS A;  1PGA A;  4I6N B;  1FXT B;  1XO3 A;  4ZRQ A;  2JVC A;  3AE6 B;  2LI5 A;  1MFW A;  4YWG G;  4WJO A;  1WY8 A;  4XDC A;  1UUP A;  2LJ5 A;  2LAS A;  1UF0 A;  2ACZ B;  2WXI A;  3A9J B;  4OW0 A;  3PV1 A;  4GDK A;  4HRS A;  1KF6 B;  3U52 E;  3DBR B;  3MTN B;  3N32 A;  3TJP A;  3KWV A;  1WE7 A;  2L76 A;  1OQR A;  3DHH C;  4MGK E;  1TZ1 A;  2QIE B;  3DWG C;  4CO7 A;  1SJH D;  3VR8 B;  3RUL A;  5CHF A;  1NI3 A;  3P2B A;  1VDV A;  3Q8A A;  3L17 A;  4K7U A;  3VUY A;  2CJO A;  1C4C A;  2BT6 A;  1CZP A;  1K50 A;  3KWL A;  3VH3 B;  4JE3 B;  5IAA C;  1V5T A;  2IJ0 A;  4QAY A;  2KX0 A;  5E6N A;  1EWC A;  4HCN B;  1R4N B;  4HPL B;  2V4I B;  4IWP A;  2ZVO A;  3L0W B;  2KTF A;  5J17 A;  1WXS A;  2B76 B;  2ONQ A;  3H7P B;  1KLV A;  1WM3 A;  4UDU C;  4AS1 A;  3ZNZ B;  1F9J A;  4B0E A;  2FBW B;  3DBS A;  4PS3 A;  2KD0 A;  1WMH A;  2D5G A;  2WX0 A;  2N9L A;  2JZZ A;  1FO4 A;  4LNN A;  2BS2 B;  1T0S C;  2JWU A;  2LVO A;  2PW9 A;  2QJL A;  2LHE A;  1ESF A;  3CST A;  3PLV A;  4P16 A;  4WJN A;  4NY0 A;  2PLP A;  4AOF A;  2WGS A;  4ZYS A;  2LRU A;  2FCS A;  5DPR A;  3SEB A;  4W9E A;  5L95 C;  4RM8 A;  2BBC A;  1I7H A;  1HZ6 A;  1TKY A;  3A9J A;  4N58 A;  1E6E B;  1C4A A;  5HG2 A;  5D6J B;  3IVF A;  4KGT A;  3N3K B;  1E10 A;  4DBG A;  2QC8 A;  3EA6 A;  2GBK A;  1UBQ A;  2JRI B;  4GN1 A;  5IO9 A;  4ACF A;  2Q5W D;  4HEA 1;  3NG0 A;  3RNE C;  4ANX A;  4HCP B;  5BYQ A;  1YJI A;  5CHW A;  3SHQ A;  5DPS A;  4ZRI A;  3VRA B;  4FN2 A;  5IKC M;  4BOS C;  5D3D A;  2UYZ B;  4RGO S;  1WGY A;  3KLS X;  4KZ0 A;  4KDL B;  2JXT A;  1JCK B;  2WDQ B;  2K39 A;  3BWU D;  1I42 A;  4KGR A;  1K51 A;  3N9Y C;  2N9X A;  1JWU D;  4A3O A;  1WM2 A;  2YEP B;  1SB3 C;  1MG4 A;  1WFY A;  4XGA B;  4A9A A;  2MP2 B;  4RF0 A;  2DHZ A;  1E8Y A;  3H7P A;  3W5U B;  5AUI A;  2CHZ A;  3K9P B;  3FAH A;  4HWI B;  4WWO A;  1YN5 A;  1B9R A;  4JPS A;  4C80 A;  4IM0 A;  4JGH B;  2QSD A;  4MSM B;  2DAJ A;  1TY0 A;  3ZDT A;  2Z0E B;  2KDM A;  1ENF A;  4DK5 A;  3RNF C;  5TSS A;  3TEY A;  3BII D;  2BYT A;  2JWZ A;  3RCZ A;  2ZW0 A;  3I63 C;  1M4V A;  4HDQ A;  1YN3 A;  2D3G A;  3BZD B;  4DHZ B;  2CS4 A;  3HRD D;  1AWD A;  1C77 A;  5FR6 A;  3OWE B;  1GAQ B;  3UIP B;  1D5M C;  4JWU C;  3OJ3 A;  2BGF A;  3JSV B;  2DYB A;  4GU2 A;  2JT4 B;  2N1W A;  3DVN V;  1IBX B;  3W2D A;  1F2R I;  3EHV A;  5G5H A;  4TQ0 A;  2WXR A;  1SBB B;  3H9D A;  1FIQ A;  3C8Y A;  4TQ1 A;  2MBO A;  1C9F A;  1WIA A;  4XE0 A;  4IDI A;  2D3C A;  2R2O A;  3KUD B;  4RGT A;  1C78 A;  2REX A;  3C0R B;  1VCB A;  2WXN A;  2IO0 B;  5AEK B;  2WHI A;  1VR9 A;  2MP2 A;  4J6I A;  4WWM A;  1D6E C;  3U30 A;  3ZNI D;  3QJZ A;  3PRP B;  1EO6 A;  5DCN A;  3SDL C;  4PYZ A;  3LDZ E;  2XN9 C;  3ZW3 A;  1E8X A;  4MM3 B;  4ZRP A;  2CU1 A;  3WIM A;  5D94 A;  3IAS 1;  1OTR B;  2JY6 A;  3Q8C A; 
#chains in the Genus database with same CATH homology
 1ACC A;  2WLB A;  2H88 B;  1BML C;  1SE4 A;  1UGJ A;  4RH6 A;  3AEC B;  2SAK A;  5BMH A;  3HUI A;  1GPX A;  4OZB A;  3TEW A;  1WRI A;  2G9H D;  5G5G A;  4A6Q A;  3KQ4 A;  3IT6 B;  4WH4 A;  3TEZ A;  1N62 A;  1B1Z A;  1AYF A;  1UWM A;  2V3N A;  4A8X C;  4EE2 A;  1SF0 A;  3B2F A;  1IBX A;  2WXG A;  2LJI A;  1QKZ A;  2WXL A;  2IGG A;  1SXT A;  3PZ7 A;  4N59 A;  2K22 A;  2N7J A;  3MHZ A;  3AE5 B;  1YNT E;  2ON8 A;  3J9C A;  4XWW A;  4NAM A;  1BUI C;  1FM0 D;  1ZDX A;  1ZXI A;  3U7Z A;  1E7P B;  5MPO A;  5EE9 A;  1QIL A;  2KWD A;  3R2T A;  1ZOY B;  2V3P A;  1OQQ A;  3NVY A;  1YQ3 B;  3Q69 A;  3AB5 A;  4HRO A;  2ZW1 A;  1TYG B;  3ETR A;  4YTN B;  4MAC A;  2LMC A;  3EGR A;  3ZJT A;  2AX5 A;  4ARI A;  2Y5P A;  1SE3 A;  1QT9 A;  2BS4 B;  4US9 A;  4DXF A;  2W55 A;  1FNW A;  1XCQ L;  1NEN B;  1WXQ A;  4HJG E;  1TKE A;  4YT0 B;  2W3S A;  1FFU A;  2RDG A;  2VZK D;  4RGM A;  1QOG A;  2WXM A;  1HEZ E;  1XLO A;  1JW9 D;  2DBY A;  2PTL A;  5I4D A;  3AEF B;  1XLN A;  3L4P A;  3AEA B;  2KMM A;  3HVD A;  3O13 A;  1C79 A;  3BVZ A;  4AQ7 A;  4WUR A;  2CU3 A;  4KGS A;  1YJJ A;  2MJE A;  4KKJ A;  3H8H A;  3MJ5 A;  4A55 A;  3VRB B;  2IGH A;  1FD6 A;  4LK0 M;  4A90 A;  2K5P A;  1N63 A;  2EEL A;  3DWM A;  4R3D A;  2IDY A;  2JZP A;  1C76 A;  1ZE3 D;  3LYY A;  1BXT A;  5D7G A;  3RPF C;  1HA5 A;  1L5P A;  3AE7 B;  2WXP A;  2Y3A A;  4YSY B;  2GRI A;  1DOY A;  4RCO A;  1HXY D;  3ZGZ A;  2BW2 A;  4WQM A;  1I4R A;  2BS3 B;  2SEB D;  4IOI E;  2PMV A;  1KRH A;  2CJN A;  2WDV B;  1EWY C;  2M0A A;  2TSS A;  3AE3 B;  3B2G A;  3SR6 A;  4OZC A;  1VZ8 A;  1D4B A;  2R61 A;  1DOI A;  3NUH B;  1F2R C;  4KX6 B;  4RFB A;  1E0Z A;  3U4E G;  4M0W A;  4YTM B;  3AM9 A;  2WU2 B;  4XWT A;  3FC4 A;  1CK1 A;  4B0M A;  1KLU D;  3ZJV A;  2JU6 X;  3MC0 B;  2LUM A;  4Q2J A;  3W5V B;  2WXF A;  2FUG 1;  1ET9 A;  3PO0 A;  5FKA C;  4JX1 C;  1QF6 A;  3V3X A;  2NTS A;  5C2T B;  1FNU A;  3P1M A;  1I4X A;  1FRD A;  1I4Q A;  2M56 B;  2WNM A;  5LNK 1;  4ZHO A;  1WGK A;  2I2Y A;  4MH8 A;  1KLG D;  4C56 C;  1NEK B;  2KN4 A;  3AE4 B;  1ET6 A;  5HI1 A;  1JRP A;  1IGD A;  3W1S A;  1DOX A;  1PGB A;  3VR9 B;  4ZOH C;  4PT5 A;  3AH7 A;  1PGA A;  3CWI A;  3IXS A;  1FXI A;  2MJ3 A;  3AE2 B;  1XO3 A;  1TS4 A;  1QQR A;  1KH0 A;  2WDR B;  4ZRQ A;  3AE6 B;  2M19 A;  3VQI A;  3RFZ B;  1GB4 A;  4REZ A;  4YWG G;  3IT4 B;  2K3U A;  4XDC A;  1UUP A;  3I9V 1;  4RF1 A;  5FK9 C;  3V05 A;  2LFI A;  1R7S A;  1XLP A;  1KTK A;  3E9S A;  2WXJ A;  2EKI A;  1FCC C;  1SEB D;  2ACZ B;  2L52 A;  1N60 A;  3P4Q B;  4OHJ A;  1OFF A;  2W54 A;  2WXI A;  4OW0 A;  1ZXH A;  2K0P A;  3P63 A;  4HRS A;  1KF6 B;  1C4P A;  3AN1 A;  2JQR B;  4FXC A;  3Q8B A;  3U52 E;  1SE2 A;  3GP7 A;  1L0X B;  2WXK A;  4OVZ A;  1E9M A;  3KWV A;  2X38 A;  3BVG A;  1OQR A;  4LLG M;  1QOF A;  1K53 A;  2HTM E;  2QIE B;  3DWG C;  1SJH D;  3VR8 B;  3TEX A;  2ICI A;  1RFK A;  5HFY A;  2FE8 A;  2RPV A;  1PFD A;  4MT5 A;  1JRO A;  1VZ6 A;  3AE1 B;  1MPE A;  1NI3 A;  2BB5 A;  1VDV A;  3Q8A A;  2CJO A;  1C4C A;  2BT6 A;  1CZP A;  1XXG A;  1K50 A;  3KWL A;  2JSV X;  1STE A;  4JE3 B;  3TSS A;  1FXA A;  2IJ0 A;  5GXG B;  2PVO D;  2E6X A;  2INN E;  1EWC A;  1QOB A;  2V4I B;  4L1B A;  2L1A A;  2AQ3 B;  4GDK B;  2IPK D;  4YXD B;  1L6U A;  1WWT A;  3ZJU A;  1UNS A;  2VZK B;  4IKG A;  1TS3 A;  4NAW B;  2B76 B;  2ONQ A;  4HKZ E;  4DQO C;  1NVI D;  2RDH A;  3FIL B;  4UDU C;  4AS1 A;  2BTE A;  2OHF A;  2AQ1 B;  2IGD A;  4B0E A;  2QMT A;  2J52 A;  2FBW B;  3AE8 B;  4YTP B;  3SFD B;  2V0G A;  1D5X C;  1WSP A;  2D5G A;  1ZDV A;  2N9L A;  1FO4 A;  2LGI A;  4P6V F;  1L4Z B;  3AEE B;  1XEE A;  3P42 A;  2GB1 A;  1I4H A;  1HQR D;  2BS2 B;  2JWU A;  2INP E;  2PW9 A;  2QJL A;  1KFY B;  2LHE A;  4YSZ B;  1ESF A;  4CQN A;  5E6J A;  3R2I A;  4P16 A;  3BK2 A;  1NYR A;  2PLP A;  1QLB B;  1F77 A;  3SFE B;  4ZYS A;  4H2A A;  5AUK A;  1T3Q A;  3BVM A;  3SEB A;  2QEJ C;  1TS5 A;  3AE9 B;  3WCQ A;  1D5Z C;  2WP9 B;  1UWX A;  2GI9 A;  1J7B A;  2BBC A;  1I7H A;  5T8I A;  1HZ6 A;  1TKY A;  4L23 A;  2KAJ A;  1FCL A;  1V1P B;  4D2K A;  3NVV A;  5H92 C;  3AEG B;  2QIL A;  1YQ4 B;  5EE0 A;  2WQY B;  1FMA D;  2WXH A;  4N58 A;  4J3O D;  1E6E B;  1C4A A;  1SJE D;  2J4X A;  5HG2 A;  4NZL B;  4KGT A;  3EUB 2;  2MEK A;  2J53 A;  3P4S B;  4US8 A;  1ZUD 2;  4ITK A;  1E10 A;  3EA6 A;  5BMG A;  1N5X A;  2WXQ A;  4YSX B;  2Q5W D;  3NVZ A;  4HEA 1;  3T3O A;  1IGC A;  4OZA A;  3B9J A;  5BYQ A;  1YJI A;  1PYW D;  2WS3 B;  1A70 A;  2WXO A;  3U2S C;  3AV8 A;  2N9K A;  3VRA B;  2MJD A;  5D3D A;  4LTU A;  1DYQ A;  1VRA B;  2KQ4 X;  4RGO S;  1EU4 A;  3AED B;  2NMQ A;  4N6E B;  1FRR A;  4GDL B;  3KLS X;  2Z8L A;  1TS2 A;  3GB1 A;  2JXT A;  3P4P B;  2DYO A;  1QOA A;  4DXG A;  1JCK B;  1V8C A;  4ZHP A;  2OED A;  2WDQ B;  4WIP A;  2PIA A;  3BWU D;  2BB6 A;  4KGR A;  1K51 A;  1ROE A;  3N9Y C;  3LXF A;  1JWU D;  2J42 A;  1L0V B;  1L6V A;  3I57 A;  2YEP B;  2XNA C;  3IAM 1;  3MP9 A;  1ZP0 B;  3CIR B;  1SB3 C;  2PVG C;  2JX5 A;  1GB1 A;  1JWM D;  2MH7 A;  4A9A A;  4RF0 A;  3W5U B;  2KAC A;  3FIL A;  1XLQ A;  5AUI A;  1JWA D;  2HDE A;  2G1E A;  1PUT A;  1F0Z A;  2DWQ A;  1JAL A;  3FAH A;  1JQ4 A;  1YN5 A;  1B9R A;  4RGN A;  1TJE A;  1V1O A;  3LB8 C;  4JPS A;  4NJC A;  1WYG A;  2YEP F;  4C80 A;  3BK1 A;  2LHD A;  3BYY B;  1EU3 A;  2QSD A;  1JML A;  1TY0 A;  3P4R B;  1T6B X;  1NYQ A;  5BYS A;  1MI0 A;  1LO5 D;  2KDM A;  1ENF A;  3NRZ A;  1PDX A;  1VJK A;  5TSS A;  3TEY A;  3BII D;  3ZQ4 A;  2H89 B;  3URY A;  2BYT A;  5HHD G;  2ZW0 A;  1FEH A;  1PGX A;  1M4V A;  1N5W A;  1MHX A;  1XF5 L;  2E3T A;  1FFV A;  1YN3 A;  4TMA B;  3BZD B;  1TKG A;  1SIJ A;  1V97 A;  3NZ3 A;  3HRD D;  1AWD A;  1C77 A;  1V1P A;  3OWE B;  1GAQ B;  1D5M C;  1DGJ A;  4JWU C;  1MVK A;  1P7F A;  4WAF A;  3NVW A;  4C7Z A;  3Q8F A;  2NTT A;  1ZPS A;  2DYM A;  1IBX B;  1SSN A;  4KKI A;  4ARC A;  3W2D A;  1I4P A;  2W3R A;  1F2R I;  3MFG A;  5G5H A;  1YMH E;  5EE3 A;  4TQ0 A;  1TY2 A;  2WXR A;  4RNA A;  3PZ8 A;  2I38 A;  1SBB B;  3E56 A;  5H8Y E;  3R8B A;  1FIQ A;  3C8Y A;  1N61 A;  4TQ1 A;  3UI3 A;  1C9F A;  1HZ5 A;  4XDD A;  4O1N A;  4XE0 A;  5JXV A;  1K52 A;  2RMM A;  4IDI A;  3Q8E A;  3AEB B;  3ZYY X;  1AN8 A;  2PKO A;  1MHH E;  1I4G A;  2JYT A;  2W82 A;  3ABV B;  1T5X D;  1VZ7 A;  4RGT A;  1C78 A;  5FR3 A;  2LEK A;  1L4D B;  2DLB A;  1RWS A;  5D3I B;  1IUE A;  2K9X A;  3HVZ A;  2WXN A;  5C3J B;  4C7Y A;  2WU5 B;  1P7E A;  4GLS C;  1VR9 A;  3GS2 A;  4WWM A;  1D6E C;  1J7A A;  2L32 A;  2L83 A;  1EM7 A;  1RYJ A;  2N0S B;  4HKQ A;  1TZO A;  1XCT L;  4USA A;  3AMZ A;  1YN4 A;  3NS1 A;  3TUO A;  2JYE A;  4L2Y A;  1GOZ A;  1Q10 A;  4TSS A;  5BMI A;  3BYT B;  1FNV A;  2AQ2 B;  2Y5C A;  1RM6 C;  1CQV A;  5BYR A;  2XN9 C;  5EE1 A;  3T3N A;  1CJE A;  1L0Y B;  1JWS D;  1J7C A;  1Y56 A;  3W9C B;  1VLB A;  4MM3 B;  1AW7 A;  1JWB D;  4JWS C;  4ZRP A;  3IAS 1;  3Q8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...