4OZBA

Backbone modifications in the protein gb1 helix: beta-acpc24, beta-3-lys28, beta-3-lys31, beta-acpc35
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
56
structure length
52
Chain Sequence
DTYKLILNGKTLKGETTTEAVDATAEVFQYADNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptococcal Protein GB1 Backbone Modified Variant: beta-AC
publication title Folding Thermodynamics of Protein-Like Oligomers with Heterogeneous Backbones.
pubmed doi rcsb
molecule tags De novo protein
total genus 13
structure length 52
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4ozbA00
1P7FA 2GB1A 5HHDG 1FCLA 2QMTA 2PW9A 1C9FA 2N9LA 2JXTA 2LUMA 4OZCA 2N9KA 4GLSC 1P7EA 5JXVA 1HZ5A 1PGAA 1QKZA 4WH4A 1ZXHA 2J53A 4OZAA 2RPVA 2ON8A 3UI3A 2KQ4X 2N7JA 2EELA 1YNTE 2JSVX 4HKZE 1JMLA 2J52A 1K52A 1GB1A 2JU6X 2KACA 2PLPA 1D4BA 1KH0A 4HJGE 1Q10A 4D2KA 1MHHE 1IBXB 4IKGA 2IGDA 1FD6A 2RMMA 4KGRA 1XCTL 2K0PA 5HI1A 4OZBA 1K53A 1FCCC 2LHEA 5BMHA 1K50A 1MPEA 2NMQA 3MP9A 1HZ6A 3FILB 1IBXA 2IGHA 2I2YA 1XCQL 2JWUA 1YMHE 2ZW1A 1HEZE 5HG2A 1F2RI 1IGDA 2I38A 2LHDA 4KGSA 2QSDA 2KDMA 1F2RC 2ONQA 2GI9A 1XF5L 2JZPA 1MVKA 1PGBA 1PGXA 5BMGA 5BMIA 4MACA 1MI0A 3FILA 2IGGA 1UWXA 1EM7A 2ZW0A 3GB1A 2KWDA 1K51A 4KGTA 3V3XA 2KN4A 1IGCA 4IOIE 5HFYA 1MHXA 2PTLA 2LGIA 1GB4A 2OEDA
chains in the Genus database with same CATH superfamily
2BYFA 1FCLA 1GOZA 2KD0A 4NJ7A 4RF0A 1KRHA 4FJVB 4OVZA 4OZCA 1E0ZA 1YQ4B 5FK9C 2G45B 4DXGA 2KMMA 2M4NA 1I4QA 3IVFA 4XDCA 4C00A 1KLVA 3ZRCA 1WGHA 5D3DA 2J52A 3R8BA 3PRMB 2WYQA 1HXYD 2BS3B 1WGDA 2G1EA 1C4AA 4OHJA 2MBEA 3AE3B 1QILA 1IBXB 2RGFA 3PT2B 2L1AA 2G3QB 1YX5B 1VDVA 3HVDA 4REZA 4XX5A 4BKSA 3TJPA 2R2QA 3I9V1 3ZKJC 1FNUA 3U30A 2FAZA 1L6UA 4HK2A 2IO3B 2MQJA 5EE3A 2NMQA 3EUB2 3MP9A 2WNMA 3DOWA 4RCOA 2O2VB 4MGYE 4QAYA 2V3SA 3X0WA 3A9JA 1WGGA 3HM3A 1HTOA 2FIFA 4BAXA 4URKA 5DPWA 3L13A 4XDDA 1DGJA 2KAJA 3V60A 2BQQA 4WQOB 2FUHB 1MI0A 4AS1A 3R2TA 2ZVOA 1FMAD 5CTRC 3VAWA 1XLPA 3QCAA 4IOIE 3IFWB 4BZAA 2LGIA 1EWCA 4CYEA 2KQ7A 1BMLC 1N5WA 2IY0B 1C76A 1PYWD 1TS4A 1EUVB 4HKQA 3Q3OC 4EKUA 2XN9C 3IXSA 4NPNA 2ZNVB 1V80A 1C9FA 1OEYJ 2AQ1B 2I1KA 1E6EB 3I3TB 3SR6A 3MC9A 1P7EA 3RYTA 4W9LA 2MCNB 4YWGG 1TJEA 3AU4A 3UGBB 2SAKA 1P98A 2D10A 1UGMA 2CHZA 2FNJB 1E5WA 2PVOD 2J0KA 1WXSA 4C4VB 2DZKA 1Q10A 4G50A 2KK8A 3DHHC 1V97A 2WDQB 1X1MA 4KGRA 4JIOU 1XQQA 4WWNA 2M17A 4W9FA 2L3ZA 4OZBA 2RR9A 3ML9A 3C0RB 1FM0D 2LZ6A 4HVBA 2BWES 1WIAA 2TSSA 5CHWA 3AEEB 3W5UB 2BKFA 1BUIC 1ESFA 2QSDA 3GE8C 2PIAA 2GMIC 4W9DA 3RCZA 4P1CC 2M0AA 3L17A 2GBKA 3VQIA 1P1AA 5IA7A 2IGGA 2WXIA 1DYQA 1K51A 2WHIA 3SFDB 2Y5CA 1WE6A 1VJKA 2V4LA 2A4ZA 3EHVA 3A4SC 3PLVA 2WXOA 3NRZA 2N1WA 1D5MC 3PV1A 1WY8A 1AARA 2W3RA 5BYSA 2NR2A 2YEPF 1V1PB 1SBBB 5JXVA 4XE0A 1XLQA 1WGKA 3KVFB 1OQYA 4FXCA 5EE1A 1Z2MA 3MJ5A 2VH2A 2D3CA 3ZYYX 2Z0DB 1GB1A 1WFYA 3N3KB 2CS4A 1SXTA 3P63A 3GOEA 2KC1A 5TSSA 4TUUA 3Q8AA 4IKGA 2WXPA 2LEKA 3QIJA 4YSXB 1E7VA 5E6PA 2XNAC 4UDUC 4DBGA 4C56C 4PYZA 5D7GA 2J4XA 3UQAA 4I6PA 3KW5B 5D94A 1PQSA 3ZLZA 2NTTA 1K50A 3H7PB 1MG4A 2JWZA 2RDGA 1FPYA 1JRPA 1GAQB 3GE3C 2WXQA 2K6QA 3A9KA 2L00B 1J7BA 2CJNA 2MRPA 3I5JC 4F8CB 3VDZA 2R61A 3HRDD 2HTME 2MJ3A 1F2RC 2ZZPB 4KVGB 4JX1C 3VXWA 1PGXA 1N61A 4HPMB 2BKRB 1JWMD 3BINA 2V9HA 2DLBA 2C7NB 4DWFA 3GZNI 3P4QB 2WXFA 2G9HD 4YTMB 1ZE3D 4TQ0A 4HDOA 1QOBA 2LJIA 2N9EB 4FLHA 1WZ3A 2JXTA 4WWMA 1ZXIA 1C78A 5H92C 2V3PA 4N58A 1SIJA 4AUQC 4P16A 2KANA 3Q6BA 1FNWA 3EGRA 2DYMA 1TY0A 2J53A 2KVRA 3UQBA 1ZP0B 3AU5A 4MDKE 2BVCA 1R4NI 1WGRA 1FFUA 1TBEA 4KDIC 1VD2A 4M0WB 5L83A 1WE7A 1C77A 1T3QA 1H8CA 3C8YA 3AE4B 2KACA 2MBHA 5JZEB 2FCMA 3IAM1 4ITKA 1WJ6A 1UBIA 4S17A 1MHHE 1TZ1A 4W9JA 3H7SA 3HVZA 5HI1A 2BW2A 1TS2A 3ZJVA 2BYEA 4KZCA 1B1ZA 2L7RA 5D3IB 3OLMD 1HZ6A 4G3XB 3NY5A 3V05A 2N9XA 4L1BA 2WXNA 4X57B 1SB3C 1T0RC 3EECA 1Y8RC 2LGDA 4GDKA 1E7PB 1AW7A 2ZNVC 4HJKA 1ZDXA 3M62B 2PJHA 4ACFA 5AZGA 4K1RB 1VLBA 3P4RB 4OVVA 3VFKA 4TV3A 3DWGC 3APFA 4JQWC 2DAJA 2KOXA 1WM2A 3VH3B 3VHTC 2ZPNA 3TL5A 4EZLA 5HHDG 2HTHA 4GDLA 2WXGA 2QHOA 3NVZA 1RFKA 2XBBC 1WI0A 2EKEC 1T6BX 4KIKA 3JW0X 4GLSC 3RNFC 2KQSA 4C7YA 1OTRB 2NPTB 2CR5A 1AWDA 1P0RA 1QOFA 5JHBA 1EWYC 5FR6A 2LVQA 4IM0A 4WJNA 3MHZA 2ZCBA 2KFKA 3QHTA 1VRAB 4NAWA 1JWBD 1WXMA 2JUOA 4W9GA 3PZ7A 2BB6A 2FUG1 2PKOA 4JPSA 4PS3A 2MBOA 2WDVB 4BOSC 1EO6A 1YQBA 2E6XA 1XD3B 1D3ZA 1TTNA 3ABVB 1NYRA 2JYTA 3L54A 2ICIA 1WMHA 3PRZA 4YXDB 2MP2A 3SHQA 1C4PA 4DQOC 2JZ3B 3TEZA 2WU2B 3ZIMA 3NS1A 2H89B 2ZW1A 2LVOA 2Z8LA 4DXAB 1WZ0A 1ET9A 2WLBA 2KC2A 4TKNA 1EU4A 4HDQA 2KDIA 2PPHA 4MGIE 3CMMB 3AEBB 2MW5A 5JH5C 5E6OA 3TUOA 1L6VA 2ZVNA 4G11A 2ASQA 2BF8B 3GZNB 2GRIA 1DOIA 2JRIB 1F77A 1MFWA 2IYDB 3A1QA 2AQ3B 1E7UA 1V2YA 4EZKA 3AEDB 2W3SA 4K3BA 4NAMA 4XZ4A 1V86A 2KTRA 4ANUA 4MGZE 4A9AA 2M19A 3HM6X 4E3CA 1R4NB 3PTFC 4DHJB 4ANXA 1YNTE 3MHSD 2JSVX 2KX0A 3U2SC 2WDRB 5KHOA 4ICVA 3EFUA 2EKIA 1XLOA 4FA6A 4ZRQA 2NS5A 4GMVA 1FXIA 3X23A 5G55A 5DCNA 1OEYA 4HEA1 2NBWB 3A9JB 5LLIA 2RSUA 3Q2AC 4W9CA 4ZRJA 3AULA 2LGXA 3LXFA 2KVZA 1P3QU 5G2NA 5DPRA 3Q3NC 3O65B 1NBFC 2DZMA 1VZ7A 3OAWA 1KTKA 2G4SA 4KGSA 1D6EC 4M02A 1UF0A 1A5RA 4GXBA 1WM3A 3AH7A 3N9YC 1MVKA 1C1YB 2AX5A 3FILA 1JW9D 2JZZA 2HJ8A 2INDC 2KWDA 1J7AA 2M0XA 4YSYB 3FKYA 2GBRA 5GMVA 4A55A 2VRRB 1WXVA 2L83A 3DWMA 2K8BA 2AWTA 2BYVE 1L4DB 2VH1A 4HCPB 2ZPYA 2D2QA 2UU7A 3ZDTA 1CJEA 3CSTA 3Q3FA 2B76B 1VR9A 1ZXHA 1V5OA 1NI3A 1WRIA 2NTSA 1M4VA 2MLBA 2CJOA 4I6NB 1FIQA 3EFCA 3RMKC 2OHFA 1TS3A 2O6VB 3KH0A 1N6ZA 2PEAA 1I4PA 3VTWA 1WSPA 2K8CA 1LO5D 2NBUA 4BOZB 2UYZB 2D07B 1XT9B 2MJEA 2N0SB 1FNVA 2DWQA 3E9SA 4DDID 3PO0A 3AE6B 3AE1B 1FRRA 1XCTL 4J3OD 1SJHD 1WX7A 1G6JA 2KJHB 2CHWA 3UIPB 1QLBB 2E3TA 3FAHA 3Q69A 3VVWB 1VZ6A 3A4RA 2IGHA 4TMAB 1YMHE 4PS7A 2CU3A 5HG2A 3URYA 2LHDA 4LNOA 3NZUA 3QQ8B 3B08A 1JALA 4LK0M 4IM2A 2IO1B 3TEYA 5CHFA 1ENFA 1GPXA 3SD5A 5J17A 2AL3A 1T5XD 3RI7C 3BK2A 1LXDA 3JVZX 1ZPSA 2HE7A 3NZ3A 4ZRIA 3VUXA 3DVGY 3AV8A 4ZHOA 2CKHB 3QAQA 5IO9A 1KLGD 2IO2B 4BBNC 2WX0A 2XK5B 2KJ6A 2MHJA 2W55A 1H4RA 1WH3A 2FCQA 3AXCA 2MBQA 3PSEB 2Z59B 1D5ZC 1ZUD2 4KV2A 1QKZA 4MEMA 4WH4A 3TEXA 1V8CA 2DYBA 2WXRA 4MH8A 2LGYA 4FJZA 1L7YA 3ONSA 1FRDA 4RNAA 1K52A 2DAFA 4M8MA 3M3JA 4A8XC 4C4VA 1TKGA 4IUMB 2LASA 3AM9A 1TKYA 1HQRD 2IO0B 2CHXA 3APDA 2RDHA 1IUEA 2J7QB 1GUAB 1SJED 3B9JA 1LM8B 4CO7A 4D2KA 3QX1A 3OG5A 3HIZA 4KDLB 1TZOA 3DBSA 4WIPA 3ZXRA 3WAMA 1K53A 1RLFA 5C23A 4W9IA 3PS6A 3E56A 4MJSB 5D2MB 4KX6B 1XCQL 2JWUA 1SSNA 4EOYA 3NVYA 3WCQA 2JYEA 2I38A 3UF8A 1QOAA 3ZXVA 2PE9A 4WJOA 4ZYNA 5E6NA 4DXFA 1WXAA 4GN1A 4RH6A 2MBBB 5DPTA 4K7WA 3R7QA 1N63A 1KLUD 3P2BA 4ZHPA 2ZW0A 3OJ3A 4IWQA 4W9HA 1JQ4A 4USAA 3AEGB 2Y5BB 1IGCA 3D32A 4EFOA 1I35A 5AZFA 3Q8FA 3W2DA 3PGEA 3PPAA 2N1VA 4EZJA 1XLNA 4MGKE 3KWVA 2WDTB 3QK0A 2KTFA 4J6IA 4R3DA 3JSVA 1YIWA 4DHZB 2MSED 3R3MA 1SGHA 1T0SC 2WXLA 4B0MA 1I42A 4NJ6A 4DDGD 2JT4B 2N9KA 5AZHA 3BYYB 3B2GA 2HDEA 4K81A 2KHWB 3AE2B 5KHQA 5C1ZA 5D6JB 3MC8A 3ETRA 2LD9A 2QILA 4B95A 3DPDA 1RYJA 2YLMA 3ZGZA 4MELA 2EMTA 2BB5A 5G5GA 1UH6A 1JMLA 3MJWA 1F9JA 2EMSA 1KF6B 3KYCD 2L32A 4BKSD 1D4BA 3ZJUA 4OVUA 3NHEB 4II2B 1LGRA 5C3JB 3U8ZA 1R4MI 4B9KA 4XWWA 4HRSA 3CIRB 3PZDA 3NJTA 5BYQA 1Q5WB 2LUEA 2IBIB 4GDKB 3L16A 4LJOB 2L8JA 2INCC 2K25A 5E6JA 3IT4B 4BKGA 4ANVA 1Z5SB 4RGTA 1E8XA 2FE8A 3N32A 4JE3B 3VH4B 3H6NA 1YQ3B 1F2RI 4LNFA 1IGDA 2K6DB 4IDIA 2M8SA 1I4RA 4WWOA 3V61A 4BFRA 4GDLB 3AECB 1AN8A 5G5HA 1ET6A 2KWCA 4KIKB 2L76A 2V4IB 2KN5A 2GLSA 2J42A 2KN4A 3APCA 2BBCA 1MG8A 5T8IA 1ZGUB 3M95A 1GNUA 3C19A 5H8YE 2GB1A 1F1HA 3ZDMC 2KZRA 3WA0A 2DX5B 4P7IA 1E10A 3PRPB 2LUMA 1D5XC 1KOTA 2KFKB 4H2AA 3DVNU 3RNAC 3DDCB 4NAWB 3IBEA 3R2IA 1I4HA 4E71A 3A33B 4MT5A 2RPVA 2KLGA 4F1SA 2V3NA 1V6EA 4HLEA 2EELA 4ZYSA 1SE2A 1YJIA 1J8CA 4B0EA 1UGJA 4EE2A 4IM3A 2KXJA 4FBJB 1WMHB 1YX6B 2YVCA 3QC8B 3AI5A 2PLPA 2O6VD 3SEBA 2MP2B 1F52A 1HTQA 1RFAA 3K9PB 1OFFA 2SEBD 2C7MB 3IHPC 4GSWA 1LFDA 4GIVA 4LDTB 2K0PA 2WXJA 4MM3A 4K7SA 2C9WB 3PLUA 3I63C 2N7DA 4ZRPA 4HPPA 4JWUC 2BTEA 1TYGB 1VZ8A 3N1XC 3NG0A 2FCSA 2BS4B 2JVCA 2NVUI 2QEJC 2KWVB 1FXAA 4YSZB 3RNCC 3QARA 3TIXA 3N1YC 1V81A 3TBLD 3ZO5B 3A1QB 1WWTA 3DBHI 3RNEC 1NDDA 4KGTA 1WR6E 1GB4A 2G4DB 2K5PA 1FXTB 5CX3A 2YEPB 3RZWC 4HCNB 2C7HA 1CMXB 5L95C 2JY6A 1BXTA 4PYUA 5AEKB 2J0MA 3ZNID 3AEFB 4MSQB 1V5TA 3U4EG 2WX1A 2GBJA 3GS2A 2N7JA 2WQYB 4RGMA 4HKZE 2FBWB 3RD2A 3DVNV 3VUWA 1C3TA 1EF1A 3ZUNA 3CWIA 2MWSB 2AYOB 1V1OA 2AQ2B 2MEKA 2Y3AA 1Y56A 4LNNA 1WRDB 3Q14C 5CHVC 1HA5A 5LXIB 2KKCA 2WXHA 4FHKA 3P1MA 1RAXA 4GU2A 3L10B 3AN1A 3TMPB 3QWZB 4PT5A 1WJ4A 1FO4A 1PFDA 2OOBB 4RFBA 2NBVB 3ML8A 3WANA 1JCKB 5TR5A 1L0YB 3FILB 3VTUA 3RULA 2Z0EB 2I2YA 4WJQA 1WF9A 2KFJA 1IPGA 1E8WA 1HEZE 3UIOB 3ALBA 4K7UA 4XYCA 2DZIA 3P42A 2DZJA 1PGBA 4RF1A 2KO3A 3CF6E 2L52A 2K9XA 2OJWA 1ZW7A 2D3BA 2KT7A 4PS8A 1OQQA 2LXAA 3NVVA 3DCGA 3FC4A 4FJYA 1FEHA 5HFYA 3VR8B 2BS2B 4N9F4 3RUIB 3KWLA 1SF0A 1L4ZB 5MPOA 1QF6A 2PW9A 5J2RA 5AUIA 1SEBD 4IW0A 3RPFC 4WWPA 3U7DA 4KSLC 2X8XX 2CU1A 3BVGA 4I6LB 2K22A 3WALA 2JQRB 1KJTA 4O1NA 3RT3B 2DYOA 3W1SC 1V49A 1RWSA 2RDBC 1UZXB 1CQVA 5IN7A 1XXGA 1SE4A 4JGHB 1XO3A 4C7ZA 3VR9B 5IAAC 1LQBA 3AE7B 3BY4B 5FKAC 5IOIA 1KH0A 4HJGE 2DBYA 2GOWA 2W54A 2LGSA 3N30A 2KJRA 5DPSA 4NZLB 4HXDA 4A6QA 3LJ3A 4BKTA 2H88B 2IGDA 3Q8BA 3L4PA 1I7HA 2L05A 1Q0WB 3J9CA 4E74A 1TS5A 1B9RA 3PVLA 2AL6A 3AE9B 4XGAB 3BVMA 5C2TB 4AOFA 1ZKHA 4XWTA 1JWSD 1IBXA 4II3B 3VRBB 4FN2A 3Q3JA 2K1FA 2BWFA 4KKIA 2HD5B 2QJLA 2WP9B 1CK1A 3KUCB 2V1YA 1STEA 4ZOHC 3P4PB 3H1UA 3HUIA 1EU3A 3R66C 2LFIA 3T9LA 5BMIA 2O2VA 2NCNA 3QA8A 2ZJDA 3GB1A 4F7ZA 4IWOA 2FCNA 3H9DA 1TGZB 3DBHB 3AEAB 2JPHA 1E9MA 1NYQA 1ZDVA 3V62A 4ANWA 3I57A 4FHJA 5EE0A 3RFZB 4HPLB 3KUZA 4RGOS 5IKCM 3TEWA 2GBNA 3BZDB 1V9JA 4HROA 3N20C 5EDSA 2QCZA 4IC7B 1YN5A 2WXMA 1C4CA 3WAOA 4OZAA 3DBRI 2IDYA 3W9CB 2K39A 2N4FA 2KDFB 1KM7A 2LMCA 3RNBC 4DK5A 3NZSA 2O6VA 3VRAB 4HWIB 2MH7A 2D5GA 3AE5B 4WAAA 2JU6X 1J19A 4LNIA 2X38A 2KMAA 2VZKB 3RZFA 2C5LC 4BBNF 4A20A 3GP7A 4S0RA 3WIMA 1YN4A 4LTUA 2MJDA 3DHGC 2L0FA 2D3AA 4M00A 1E8YA 3NVWA 3DHIC 3MC0B 3IT6B 2LHEA 4LDTD 2LWPA 2PMVA 1J7CA 4IG7B 3SFEB 1JROA 5FR3A 1QT9A 2Q5WD 3ZVVA 2A5UA 3UINB 3ZJTA 2DHZA 1HE8A 2BT6A 1PDXA 4LCDE 2WU5B 2KDMA 2ZCCA 2V0GA 2GI9A 3A9KB 3KYDD 3L0WB 1XF5L 3JSVB 1YD8U 2ZEQA 2DNFA 5BMGA 1NVID 5GXGB 1UUPA 2LVPA 2JRHA 1A70A 1RM6C 4P6VF 3B1LX 2XK5A 1SE9A 3MTNB 4RM8A 3W5VB 2KLCA 1GC6A 3ZW3A 1WJNA 2Y5PA 2JX5A 4AJWA 1OQRA 4L2YA 1GC7A 1I4XA 2KNBA 3DBLI 3B0AA 4YT0B 1SIFA 4FADA 1HZ5A 4KKJA 3KLSX 1PGAA 1AYFA 4PK1A 4EEWA 4LJPB 1I4GA 3LDZE 2LXCA 3PHXB 1VCBA 2KX3A 1JRUA 3AE8B 1V1PA 4TSSA 1IP9A 1DOXA 2WS3B 1ZOYB 3BK1A 1CZPA 1T0QC 4US8A 4LLGM 2MX2A 4W9KA 1WGYA 3Q8CA 5HKHA 3RNGC 4ASWC 5BO4B 4MJSA 1YJ1A 4CHKA 1YOVB 1SE3A 3OWEB 1NI2A 5BMHA 1QQRA 2RPQA 1M94A 1QOGA 2WWZA 2WXKA 4DHJD 4MSMB 4WQMA 4C80A 3BIID 3N1ZC 3W1YA 2INNE 4WJPA 2BGFA 1UD7A 1N5XA 4DHZE 2REXA 1XEEA 2M56B 1YJJA 1Q1OA 3M63B 4YTPB 3ECIA 3IG3A 2JZPA 3U7ZA 3H7PA 5LXHA 3ENEA 3Q8EA 4GB9A 4NJCA 3S2AA 4WAFA 4A3PA 4RGNA 1MHXA 3HHMA 1NENB 2FIDA 3ZNGC 1ACCA 3Q3MC 4XC2A 3EC8A 4BVUC 1P7FA 1E90A 3AB5A 1UNSA 1KFYB 3ZTDA 3TSSA 1MJDA 2W9NA 4AQ7A 3KQ4A 5J18A 4NY0A 3BYTB 2JF5A 3T3OA 2KMCA 5BYRA 4NQKE 2D3GA 1L0XB 1TIFA 3L08A 3PZ8A 3PHWB 3ZRFA 2IY1B 1WXQA 3ZTCA 2MA9B 4AJYB 3UI3A 1YN3A 2KQ4X 3NUHB 1J0GA 1S1QB 3DBRB 2QIEB 4YTNB 2N7EA 2I1JA 5LNK1 1JWUD 1PUTA 4A90A 3V6EB 3H8HA 3SDLC 4MM3B 3TCAA 2IZVB 4L23A 3K9OB 3W1SA 2LJ5A 2PVGC 2QDFA 4OW0A 2OJRA 4RMAA 1BT0A 4M0WA 4Q2JA 1WYWB 1L0VB 2IPKD 3O13A 3OJ4B 4A3OA 1TT5B 4M01A 4AP4C 2R2OA 3WAPA 1WX9A 3EA6A 4GOCA 3IAS1 3BVZA 3BWUD 2JXXA 3P4SB 4ARCA 3NS8A 2QC8A 1UBQA 1MPEA 4JWSC 1NEKB 3LYYA 1R7SA 4RM9A 1N62A 4N6EB 4W9EA 3KUDB 3RN9C 2KYWA 2KWUB 1C79A 4JL9A 2GBMA 2RD0A 3SU8X 1N60A 4AWJA 5I4DA 3VTVA 4MACA 3DVGX 1ISNA 1TKEA 4US9A 1GJZA 3PREA 1EF5A 1WR1A 1K8RB 2L0TA 5AUKA 2PTLA 2B3AA 2IJ0A 2J0JA 2N9PC 2OEDA 2INPE 4IWPA 2WGSA 4JLCA 2QMTA 4ZDVA 4YL8A 4N59A 2KDEB 1WYGA 2N9LA 4KZ0A 2ACZB 2M1MA 3CSFA 4P1BC 4KSKC 1UWMA 3B2FA 3DBLB 1F0ZA 4G0NB 1L2NA 1RRBA 2ON8A 1T0YA 1OGWA 2KTRB 3MFGA 2KDBA 1ROEA 4ICUA 1UELA 4ZRKA 3ZNZB 1L5PA 1U4AA 2BPSA 4K3CA 4CQNA 2NPTA 1QZEA 2LRUA 5JHAA 1WJUA 2VZKD 2PE6B 3VUYA 1GG3A 4EUTA 2W82A 1E8ZA 1TY2A 1JWAD 1FD6A 1P9DU 2RMMA 3T3NA 2UWQA 1DOYA 2K3UA 1FCCC 3JYUA 3DQVA 2AEHA 4GGQA 3QJZA 3AMZA 4NNJB 3U52E 4MH0E 4ARIA 1S3SG 2K8HA 3NOBA 3LB8C 4LNKA 3R7RA 1R4MB 2ONQA 2LI5A 2BYTA 2D11A 4WURA 1WX8A 2HJ1A 1IYFA 3ZQ4A 5IP4D 3V6CB 1UWXA 1EM7A 2XEWA 4TQ1A 1FFVA 4NQLB 4B6WA 3V3XA 4M8NA 4FULA 2DENB 3HK0A 2LRWA 2C60A 5EE9A 3T8MA 3ZNHB
chains in the Genus database with same CATH topology
3I57A 4R3DA 5EE0A 5HHDG 3RFZB 1FCLA 1GOZA 2WXGA 3NVZA 1RFKA 2WXLA 1T6BX 4RF0A 4RGOS 4B0MA 1KRHA 3TEWA 3BZDB 4OVZA 4OZCA 2N9KA 4GLSC 4HROA 3BYYB 3B2GA 2HDEA 1E0ZA 4C7YA 1YQ4B 3AE2B 5FK9C 4DXGA 1YN5A 2KMMA 2WXMA 1C4CA 1AWDA 1QOFA 4OZAA 3ETRA 1EWYC 1I4QA 4XDCA 2IDYA 3W9CB 2QILA 2LMCA 1RYJA 3ZGZA 3VRAB 2BB5A 5G5GA 1JMLA 2MH7A 3MHZA 5D3DA 2D5GA 3AE5B 2J52A 2JU6X 1VRAB 3R8BA 2X38A 1KF6B 1HXYD 2BS3B 2VZKB 2L32A 1JWBD 1D4BA 3ZJUA 2G1EA 1C4AA 4OHJA 3AE3B 3GP7A 3PZ7A 2BB6A 2FUG1 2PKOA 4JPSA 1QILA 1YN4A 1IBXB 5C3JB 2WDVB 2L1AA 4LTUA 2E6XA 2MJDA 3ABVB 1VDVA 3HVDA 4REZA 1NYRA 2JYTA 4XWWA 4HRSA 2ICIA 3CIRB 3I9V1 5BYQA 3NVWA 3MC0B 4GDKB 3IT6B 1FNUA 2LHEA 4YXDB 1L6UA 2PMVA 1J7CA 5EE3A 1JROA 2NMQA 3EUB2 3IT4B 2WNMA 3MP9A 5E6JA 3SFEB 5FR3A 1C4PA 4RCOA 4DQOC 4RGTA 1QT9A 3TEZA 2WU2B 2Q5WD 2FE8A 3NS1A 2H89B 4JE3B 3ZJTA 2BT6A 2ZW1A 1PDXA 1YQ3B 1F2RI 1IGDA 2Z8LA 4IDIA 2WU5B 1I4RA 2KDMA 4XDDA 2V0GA 2GI9A 1ET9A 2WLBA 1DGJA 2KAJA 1XF5L 1EU4A 4GDLB 3AECB 1AN8A 1NVID 5G5HA 5BMGA 1ET6A 1MI0A 5GXGB 1UUPA 4AS1A 3R2TA 1FMAD 1XLPA 2V4IB 3AEBB 1A70A 2J42A 1RM6C 3TUOA 2KN4A 4IOIE 1L6VA 4P6VF 2BBCA 1EWCA 2LGIA 5T8IA 1BMLC 1N5WA 1C76A 1PYWD 1TS4A 4HKQA 2GRIA 1DOIA 5H8YE 2XN9C 3IXSA 3W5VB 2GB1A 1F77A 1C9FA 2Y5PA 1E10A 2JX5A 1OQRA 2AQ3B 2AQ1B 2LUMA 4L2YA 1E6EB 3AEDB 2W3SA 1I4XA 1D5XC 3SR6A 4H2AA 1P7EA 4NAMA 4NAWB 4YT0B 3R2IA 1I4HA 1HZ5A 4KKJA 3KLSX 1PGAA 4YWGG 1AYFA 4MT5A 1TJEA 2RPVA 2V3NA 2SAKA 4A9AA 2M19A 2EELA 1I4GA 4ZYSA 1SE2A 1YJIA 1YNTE 2JSVX 4B0EA 1UGJA 3U2SC 4EE2A 2WDRB 3AE8B 1V1PA 2PVOD 2EKIA 1XLOA 4TSSA 4ZRQA 2PLPA 1FXIA 3SEBA 2WS3B 1Q10A 1DOXA 1ZOYB 3BK1A 1V97A 1OFFA 2SEBD 4HEA1 1CZPA 4US8A 4LLGM 2WDQB 3Q8CA 4KGRA 2K0PA 2WXJA 1SE3A 3OWEB 4OZBA 5BMHA 1QQRA 1FM0D 1QOGA 2WXKA 3LXFA 4ZRPA 4JWUC 4WQMA 4C80A 3BIID 1TYGB 2BTEA 1VZ8A 2INNE 2TSSA 2BS4B 1VZ7A 1KTKA 3AEEB 3W5UB 2QEJC 1FXAA 1BUIC 1N5XA 4KGSA 1ESFA 2QSDA 4YSZB 1XEEA 2M56B 1YJJA 1D6EC 2PIAA 4YTPB 3AH7A 3N9YC 2JZPA 2M0AA 3U7ZA 3VQIA 1MVKA 2AX5A 3FILA 2IGGA 2WXIA 1JW9D 3Q8EA 1DYQA 1WWTA 4NJCA 2KWDA 1K51A 1J7AA 3SFDB 4KGTA 2Y5CA 4WAFA 4YSYB 1VJKA 4RGNA 1MHXA 1NENB 4A55A 1GB4A 1ACCA 2K5PA 1P7FA 2L83A 2YEPB 3AB5A 1UNSA 2WXOA 1KFYB 3DWMA 3NRZA 3TSSA 1D5MC 4AQ7A 3KQ4A 3BYTB 1BXTA 2W3RA 3T3OA 1L4DB 5BYRA 5BYSA 1L0XB 3PZ8A 2YEPF 1CJEA 1V1PB 1SBBB 5JXVA 1WXQA 4XE0A 1XLQA 1WGKA 2B76B 3AEFB 1VR9A 1ZXHA 1NI3A 1WRIA 2NTSA 3U4EG 3UI3A 1YN3A 2KQ4X 1M4VA 3NUHB 3GS2A 4FXCA 2CJOA 2N7JA 2WQYB 2QIEB 5EE1A 3MJ5A 4RGMA 4YTNB 4HKZE 1FIQA 2FBWB 5LNK1 3ZYYX 1JWUD 1PUTA 2OHFA 4A90A 1GB1A 1TS3A 3CWIA 3H8HA 4MM3B 1I4PA 2Y3AA 1V1OA 2AQ2B 1WSPA 2MEKA 1SXTA 1LO5D 3P63A 4L23A 1Y56A 3W1SA 2PVGC 2MJEA 5TSSA 4OW0A 1HA5A 2N0SB 1FNVA 4M0WA 2WXHA 2DWQA 3E9SA 3P1MA 3O13A 1L0VB 2IPKD 2WXPA 3AE6B 2LEKA 3PO0A 3Q8AA 4IKGA 3AN1A 3AE1B 4YSXB 4PT5A 1FO4A 1FRRA 1XCTL 1PFDA 4J3OD 1SJHD 2XNAC 4RFBA 4UDUC 4C56C 3EA6A 2J4XA 5D7GA 3IAS1 3BVZA 3BWUD 3P4SB 4ARCA 1QLBB 2E3TA 2NTTA 1K50A 1MPEA 1JCKB 4JWSC 3FAHA 3Q69A 1VZ6A 1NEKB 2RDGA 1L0YB 1JRPA 1GAQB 3FILB 3LYYA 2IGHA 3KWVA 2WXQA 2I2YA 4TMAB 1R7SA 1YMHE 2CU3A 1HEZE 5HG2A 1N62A 3URYA 4N6EB 2LHDA 1J7BA 2CJNA 2R61A 1JALA 2HTME 3HRDD 2MJ3A 4LK0M 1F2RC 3TEYA 1ENFA 1C79A 4JX1C 3P42A 1N60A 5I4DA 1GPXA 1N61A 1PGBA 1PGXA 4RF1A 1JWMD 4MACA 2DLBA 2L52A 2K9XA 1TKEA 1T5XD 4US9A 1OQQA 3BK2A 3NVVA 3FC4A 1FEHA 5HFYA 5AUKA 3VR8B 2PTLA 1ZPSA 2BS2B 3NZ3A 2IJ0A 3P4QB 2WXFA 2G9HD 3AV8A 3KWLA 4ZHOA 1SF0A 1ZE3D 1KLGD 1L4ZB 4TQ0A 2OEDA 4YTMB 2INPE 1QOBA 5MPOA 2LJIA 2QMTA 1QF6A 2PW9A 4N59A 5AUIA 1WYGA 1SEBD 2W55A 3RPFC 2N9LA 2JXTA 4WWMA 1ZXIA 1C78A 2ACZB 5H92C 2V3PA 4N58A 1SIJA 1UWMA 3B2FA 1F0ZA 4P16A 1D5ZC 3BVGA 1FNWA 3EGRA 1ZUD2 2K22A 1QKZA 2DYMA 1TY0A 2JQRB 2J53A 4WH4A 3TEXA 1V8CA 1ZP0B 2WXRA 4O1NA 4MH8A 2DYOA 2ON8A 1FFUA 3MFGA 1RWSA 1ROEA 1C77A 1CQVA 1XXGA 1FRDA 1SE4A 1T3QA 1L5PA 4RNAA 1K52A 1XO3A 3C8YA 4CQNA 3AE4B 3VR9B 4A8XC 4C7ZA 1TKGA 3AM9A 1TKYA 1HQRD 2KACA 2RDHA 1IUEA 3AE7B 3IAM1 5FKAC 1KH0A 4HJGE 2DBYA 1SJED 4ITKA 2W54A 3B9JA 2VZKD 4D2KA 4NZLB 1MHHE 4A6QA 2H88B 2IGDA 2W82A 3Q8BA 3L4PA 1TY2A 1JWAD 1I7HA 1FD6A 2RMMA 1TZOA 4WIPA 3HVZA 3J9CA 5HI1A 3T3NA 2BW2A 1TS5A 1DOYA 1B9RA 1TS2A 1K53A 2K3UA 3ZJVA 1FCCC 3AE9B 1B1ZA 3BVMA 5C2TB 3E56A 5D3IB 1HZ6A 3AMZA 4XWTA 1JWSD 1IBXA 3VRBB 4KX6B 1XCQL 3U52E 3V05A 2JWUA 1SSNA 4KKIA 4L1BA 4ARIA 3NVYA 2QJLA 2JYEA 2I38A 3WCQA 2WP9B 2WXNA 3LB8C 1QOAA 1CK1A 1SB3C 4Q2JA 1STEA 4ZOHC 2ONQA 3P4PB 1E7PB 4DXFA 2BYTA 1AW7A 3HUIA 4RH6A 4WURA 1EU3A 1ZDXA 1N63A 3ZQ4A 1KLUD 2LFIA 5BMIA 1UWXA 1EM7A 4ZHPA 4TQ1A 2ZW0A 3GB1A 1VLBA 3P4RB 1FFVA 3DWGC 1JQ4A 4USAA 3AEGB 3V3XA 3AEAB 1IGCA 3Q8FA 3W2DA 1E9MA 5EE9A 1XLNA 1NYQA 1ZDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P7F A;  2GB1 A;  5HHD G;  1FCL A;  2QMT A;  2PW9 A;  1C9F A;  2N9L A;  2JXT A;  2LUM A;  4OZC A;  2N9K A;  4GLS C;  1P7E A;  5JXV A;  1HZ5 A;  1PGA A;  1QKZ A;  4WH4 A;  1ZXH A;  2J53 A;  4OZA A;  2RPV A;  2ON8 A;  3UI3 A;  2KQ4 X;  2N7J A;  2EEL A;  1YNT E;  2JSV X;  4HKZ E;  1JML A;  2J52 A;  1K52 A;  1GB1 A;  2JU6 X;  2KAC A;  2PLP A;  1D4B A;  1KH0 A;  4HJG E;  1Q10 A;  4D2K A;  1MHH E;  1IBX B;  4IKG A;  2IGD A;  1FD6 A;  2RMM A;  4KGR A;  1XCT L;  2K0P A;  5HI1 A;  4OZB A;  1K53 A;  1FCC C;  2LHE A;  5BMH A;  1K50 A;  1MPE A;  2NMQ A;  3MP9 A;  1HZ6 A;  3FIL B;  1IBX A;  2IGH A;  2I2Y A;  1XCQ L;  2JWU A;  1YMH E;  2ZW1 A;  1HEZ E;  5HG2 A;  1F2R I;  1IGD A;  2I38 A;  2LHD A;  4KGS A;  2QSD A;  2KDM A;  1F2R C;  2ONQ A;  2GI9 A;  1XF5 L;  2JZP A;  1MVK A;  1PGB A;  1PGX A;  5BMG A;  5BMI A;  4MAC A;  1MI0 A;  3FIL A;  2IGG A;  1UWX A;  1EM7 A;  2ZW0 A;  3GB1 A;  2KWD A;  1K51 A;  4KGT A;  3V3X A;  2KN4 A;  1IGC A;  4IOI E;  5HFY A;  1MHX A;  2PTL A;  2LGI A;  1GB4 A;  2OED A; 
#chains in the Genus database with same CATH topology
 2BYF A;  1FCL A;  1GOZ A;  2KD0 A;  4NJ7 A;  4RF0 A;  1KRH A;  4FJV B;  4OVZ A;  4OZC A;  1E0Z A;  1YQ4 B;  5FK9 C;  2G45 B;  4DXG A;  2KMM A;  2M4N A;  1I4Q A;  3IVF A;  4XDC A;  4C00 A;  1KLV A;  3ZRC A;  1WGH A;  5D3D A;  2J52 A;  3R8B A;  3PRM B;  2WYQ A;  1HXY D;  2BS3 B;  1WGD A;  2G1E A;  1C4A A;  4OHJ A;  2MBE A;  3AE3 B;  1QIL A;  1IBX B;  2RGF A;  3PT2 B;  2L1A A;  2G3Q B;  1YX5 B;  1VDV A;  3HVD A;  4REZ A;  4XX5 A;  4BKS A;  3TJP A;  2R2Q A;  3I9V 1;  3ZKJ C;  1FNU A;  3U30 A;  2FAZ A;  1L6U A;  4HK2 A;  2IO3 B;  2MQJ A;  5EE3 A;  2NMQ A;  3EUB 2;  3MP9 A;  2WNM A;  3DOW A;  4RCO A;  2O2V B;  4MGY E;  4QAY A;  2V3S A;  3X0W A;  3A9J A;  1WGG A;  3HM3 A;  1HTO A;  2FIF A;  4BAX A;  4URK A;  5DPW A;  3L13 A;  4XDD A;  1DGJ A;  2KAJ A;  3V60 A;  2BQQ A;  4WQO B;  2FUH B;  1MI0 A;  4AS1 A;  3R2T A;  2ZVO A;  1FMA D;  5CTR C;  3VAW A;  1XLP A;  3QCA A;  4IOI E;  3IFW B;  4BZA A;  2LGI A;  1EWC A;  4CYE A;  2KQ7 A;  1BML C;  1N5W A;  2IY0 B;  1C76 A;  1PYW D;  1TS4 A;  1EUV B;  4HKQ A;  3Q3O C;  4EKU A;  2XN9 C;  3IXS A;  4NPN A;  2ZNV B;  1V80 A;  1C9F A;  1OEY J;  2AQ1 B;  2I1K A;  1E6E B;  3I3T B;  3SR6 A;  3MC9 A;  1P7E A;  3RYT A;  4W9L A;  2MCN B;  4YWG G;  1TJE A;  3AU4 A;  3UGB B;  2SAK A;  1P98 A;  2D10 A;  1UGM A;  2CHZ A;  2FNJ B;  1E5W A;  2PVO D;  2J0K A;  1WXS A;  4C4V B;  2DZK A;  1Q10 A;  4G50 A;  2KK8 A;  3DHH C;  1V97 A;  2WDQ B;  1X1M A;  4KGR A;  4JIO U;  1XQQ A;  4WWN A;  2M17 A;  4W9F A;  2L3Z A;  4OZB A;  2RR9 A;  3ML9 A;  3C0R B;  1FM0 D;  2LZ6 A;  4HVB A;  2BWE S;  1WIA A;  2TSS A;  5CHW A;  3AEE B;  3W5U B;  2BKF A;  1BUI C;  1ESF A;  2QSD A;  3GE8 C;  2PIA A;  2GMI C;  4W9D A;  3RCZ A;  4P1C C;  2M0A A;  3L17 A;  2GBK A;  3VQI A;  1P1A A;  5IA7 A;  2IGG A;  2WXI A;  1DYQ A;  1K51 A;  2WHI A;  3SFD B;  2Y5C A;  1WE6 A;  1VJK A;  2V4L A;  2A4Z A;  3EHV A;  3A4S C;  3PLV A;  2WXO A;  3NRZ A;  2N1W A;  1D5M C;  3PV1 A;  1WY8 A;  1AAR A;  2W3R A;  5BYS A;  2NR2 A;  2YEP F;  1V1P B;  1SBB B;  5JXV A;  4XE0 A;  1XLQ A;  1WGK A;  3KVF B;  1OQY A;  4FXC A;  5EE1 A;  1Z2M A;  3MJ5 A;  2VH2 A;  2D3C A;  3ZYY X;  2Z0D B;  1GB1 A;  1WFY A;  3N3K B;  2CS4 A;  1SXT A;  3P63 A;  3GOE A;  2KC1 A;  5TSS A;  4TUU A;  3Q8A A;  4IKG A;  2WXP A;  2LEK A;  3QIJ A;  4YSX B;  1E7V A;  5E6P A;  2XNA C;  4UDU C;  4DBG A;  4C56 C;  4PYZ A;  5D7G A;  2J4X A;  3UQA A;  4I6P A;  3KW5 B;  5D94 A;  1PQS A;  3ZLZ A;  2NTT A;  1K50 A;  3H7P B;  1MG4 A;  2JWZ A;  2RDG A;  1FPY A;  1JRP A;  1GAQ B;  3GE3 C;  2WXQ A;  2K6Q A;  3A9K A;  2L00 B;  1J7B A;  2CJN A;  2MRP A;  3I5J C;  4F8C B;  3VDZ A;  2R61 A;  3HRD D;  2HTM E;  2MJ3 A;  1F2R C;  2ZZP B;  4KVG B;  4JX1 C;  3VXW A;  1PGX A;  1N61 A;  4HPM B;  2BKR B;  1JWM D;  3BIN A;  2V9H A;  2DLB A;  2C7N B;  4DWF A;  3GZN I;  3P4Q B;  2WXF A;  2G9H D;  4YTM B;  1ZE3 D;  4TQ0 A;  4HDO A;  1QOB A;  2LJI A;  2N9E B;  4FLH A;  1WZ3 A;  2JXT A;  4WWM A;  1ZXI A;  1C78 A;  5H92 C;  2V3P A;  4N58 A;  1SIJ A;  4AUQ C;  4P16 A;  2KAN A;  3Q6B A;  1FNW A;  3EGR A;  2DYM A;  1TY0 A;  2J53 A;  2KVR A;  3UQB A;  1ZP0 B;  3AU5 A;  4MDK E;  2BVC A;  1R4N I;  1WGR A;  1FFU A;  1TBE A;  4KDI C;  1VD2 A;  4M0W B;  5L83 A;  1WE7 A;  1C77 A;  1T3Q A;  1H8C A;  3C8Y A;  3AE4 B;  2KAC A;  2MBH A;  5JZE B;  2FCM A;  3IAM 1;  4ITK A;  1WJ6 A;  1UBI A;  4S17 A;  1MHH E;  1TZ1 A;  4W9J A;  3H7S A;  3HVZ A;  5HI1 A;  2BW2 A;  1TS2 A;  3ZJV A;  2BYE A;  4KZC A;  1B1Z A;  2L7R A;  5D3I B;  3OLM D;  1HZ6 A;  4G3X B;  3NY5 A;  3V05 A;  2N9X A;  4L1B A;  2WXN A;  4X57 B;  1SB3 C;  1T0R C;  3EEC A;  1Y8R C;  2LGD A;  4GDK A;  1E7P B;  1AW7 A;  2ZNV C;  4HJK A;  1ZDX A;  3M62 B;  2PJH A;  4ACF A;  5AZG A;  4K1R B;  1VLB A;  3P4R B;  4OVV A;  3VFK A;  4TV3 A;  3DWG C;  3APF A;  4JQW C;  2DAJ A;  2KOX A;  1WM2 A;  3VH3 B;  3VHT C;  2ZPN A;  3TL5 A;  4EZL A;  5HHD G;  2HTH A;  4GDL A;  2WXG A;  2QHO A;  3NVZ A;  1RFK A;  2XBB C;  1WI0 A;  2EKE C;  1T6B X;  4KIK A;  3JW0 X;  4GLS C;  3RNF C;  2KQS A;  4C7Y A;  1OTR B;  2NPT B;  2CR5 A;  1AWD A;  1P0R A;  1QOF A;  5JHB A;  1EWY C;  5FR6 A;  2LVQ A;  4IM0 A;  4WJN A;  3MHZ A;  2ZCB A;  2KFK A;  3QHT A;  1VRA B;  4NAW A;  1JWB D;  1WXM A;  2JUO A;  4W9G A;  3PZ7 A;  2BB6 A;  2FUG 1;  2PKO A;  4JPS A;  4PS3 A;  2MBO A;  2WDV B;  4BOS C;  1EO6 A;  1YQB A;  2E6X A;  1XD3 B;  1D3Z A;  1TTN A;  3ABV B;  1NYR A;  2JYT A;  3L54 A;  2ICI A;  1WMH A;  3PRZ A;  4YXD B;  2MP2 A;  3SHQ A;  1C4P A;  4DQO C;  2JZ3 B;  3TEZ A;  2WU2 B;  3ZIM A;  3NS1 A;  2H89 B;  2ZW1 A;  2LVO A;  2Z8L A;  4DXA B;  1WZ0 A;  1ET9 A;  2WLB A;  2KC2 A;  4TKN A;  1EU4 A;  4HDQ A;  2KDI A;  2PPH A;  4MGI E;  3CMM B;  3AEB B;  2MW5 A;  5JH5 C;  5E6O A;  3TUO A;  1L6V A;  2ZVN A;  4G11 A;  2ASQ A;  2BF8 B;  3GZN B;  2GRI A;  1DOI A;  2JRI B;  1F77 A;  1MFW A;  2IYD B;  3A1Q A;  2AQ3 B;  1E7U A;  1V2Y A;  4EZK A;  3AED B;  2W3S A;  4K3B A;  4NAM A;  4XZ4 A;  1V86 A;  2KTR A;  4ANU A;  4MGZ E;  4A9A A;  2M19 A;  3HM6 X;  4E3C A;  1R4N B;  3PTF C;  4DHJ B;  4ANX A;  1YNT E;  3MHS D;  2JSV X;  2KX0 A;  3U2S C;  2WDR B;  5KHO A;  4ICV A;  3EFU A;  2EKI A;  1XLO A;  4FA6 A;  4ZRQ A;  2NS5 A;  4GMV A;  1FXI A;  3X23 A;  5G55 A;  5DCN A;  1OEY A;  4HEA 1;  2NBW B;  3A9J B;  5LLI A;  2RSU A;  3Q2A C;  4W9C A;  4ZRJ A;  3AUL A;  2LGX A;  3LXF A;  2KVZ A;  1P3Q U;  5G2N A;  5DPR A;  3Q3N C;  3O65 B;  1NBF C;  2DZM A;  1VZ7 A;  3OAW A;  1KTK A;  2G4S A;  4KGS A;  1D6E C;  4M02 A;  1UF0 A;  1A5R A;  4GXB A;  1WM3 A;  3AH7 A;  3N9Y C;  1MVK A;  1C1Y B;  2AX5 A;  3FIL A;  1JW9 D;  2JZZ A;  2HJ8 A;  2IND C;  2KWD A;  1J7A A;  2M0X A;  4YSY B;  3FKY A;  2GBR A;  5GMV A;  4A55 A;  2VRR B;  1WXV A;  2L83 A;  3DWM A;  2K8B A;  2AWT A;  2BYV E;  1L4D B;  2VH1 A;  4HCP B;  2ZPY A;  2D2Q A;  2UU7 A;  3ZDT A;  1CJE A;  3CST A;  3Q3F A;  2B76 B;  1VR9 A;  1ZXH A;  1V5O A;  1NI3 A;  1WRI A;  2NTS A;  1M4V A;  2MLB A;  2CJO A;  4I6N B;  1FIQ A;  3EFC A;  3RMK C;  2OHF A;  1TS3 A;  2O6V B;  3KH0 A;  1N6Z A;  2PEA A;  1I4P A;  3VTW A;  1WSP A;  2K8C A;  1LO5 D;  2NBU A;  4BOZ B;  2UYZ B;  2D07 B;  1XT9 B;  2MJE A;  2N0S B;  1FNV A;  2DWQ A;  3E9S A;  4DDI D;  3PO0 A;  3AE6 B;  3AE1 B;  1FRR A;  1XCT L;  4J3O D;  1SJH D;  1WX7 A;  1G6J A;  2KJH B;  2CHW A;  3UIP B;  1QLB B;  2E3T A;  3FAH A;  3Q69 A;  3VVW B;  1VZ6 A;  3A4R A;  2IGH A;  4TMA B;  1YMH E;  4PS7 A;  2CU3 A;  5HG2 A;  3URY A;  2LHD A;  4LNO A;  3NZU A;  3QQ8 B;  3B08 A;  1JAL A;  4LK0 M;  4IM2 A;  2IO1 B;  3TEY A;  5CHF A;  1ENF A;  1GPX A;  3SD5 A;  5J17 A;  2AL3 A;  1T5X D;  3RI7 C;  3BK2 A;  1LXD A;  3JVZ X;  1ZPS A;  2HE7 A;  3NZ3 A;  4ZRI A;  3VUX A;  3DVG Y;  3AV8 A;  4ZHO A;  2CKH B;  3QAQ A;  5IO9 A;  1KLG D;  2IO2 B;  4BBN C;  2WX0 A;  2XK5 B;  2KJ6 A;  2MHJ A;  2W55 A;  1H4R A;  1WH3 A;  2FCQ A;  3AXC A;  2MBQ A;  3PSE B;  2Z59 B;  1D5Z C;  1ZUD 2;  4KV2 A;  1QKZ A;  4MEM A;  4WH4 A;  3TEX A;  1V8C A;  2DYB A;  2WXR A;  4MH8 A;  2LGY A;  4FJZ A;  1L7Y A;  3ONS A;  1FRD A;  4RNA A;  1K52 A;  2DAF A;  4M8M A;  3M3J A;  4A8X C;  4C4V A;  1TKG A;  4IUM B;  2LAS A;  3AM9 A;  1TKY A;  1HQR D;  2IO0 B;  2CHX A;  3APD A;  2RDH A;  1IUE A;  2J7Q B;  1GUA B;  1SJE D;  3B9J A;  1LM8 B;  4CO7 A;  4D2K A;  3QX1 A;  3OG5 A;  3HIZ A;  4KDL B;  1TZO A;  3DBS A;  4WIP A;  3ZXR A;  3WAM A;  1K53 A;  1RLF A;  5C23 A;  4W9I A;  3PS6 A;  3E56 A;  4MJS B;  5D2M B;  4KX6 B;  1XCQ L;  2JWU A;  1SSN A;  4EOY A;  3NVY A;  3WCQ A;  2JYE A;  2I38 A;  3UF8 A;  1QOA A;  3ZXV A;  2PE9 A;  4WJO A;  4ZYN A;  5E6N A;  4DXF A;  1WXA A;  4GN1 A;  4RH6 A;  2MBB B;  5DPT A;  4K7W A;  3R7Q A;  1N63 A;  1KLU D;  3P2B A;  4ZHP A;  2ZW0 A;  3OJ3 A;  4IWQ A;  4W9H A;  1JQ4 A;  4USA A;  3AEG B;  2Y5B B;  1IGC A;  3D32 A;  4EFO A;  1I35 A;  5AZF A;  3Q8F A;  3W2D A;  3PGE A;  3PPA A;  2N1V A;  4EZJ A;  1XLN A;  4MGK E;  3KWV A;  2WDT B;  3QK0 A;  2KTF A;  4J6I A;  4R3D A;  3JSV A;  1YIW A;  4DHZ B;  2MSE D;  3R3M A;  1SGH A;  1T0S C;  2WXL A;  4B0M A;  1I42 A;  4NJ6 A;  4DDG D;  2JT4 B;  2N9K A;  5AZH A;  3BYY B;  3B2G A;  2HDE A;  4K81 A;  2KHW B;  3AE2 B;  5KHQ A;  5C1Z A;  5D6J B;  3MC8 A;  3ETR A;  2LD9 A;  2QIL A;  4B95 A;  3DPD A;  1RYJ A;  2YLM A;  3ZGZ A;  4MEL A;  2EMT A;  2BB5 A;  5G5G A;  1UH6 A;  1JML A;  3MJW A;  1F9J A;  2EMS A;  1KF6 B;  3KYC D;  2L32 A;  4BKS D;  1D4B A;  3ZJU A;  4OVU A;  3NHE B;  4II2 B;  1LGR A;  5C3J B;  3U8Z A;  1R4M I;  4B9K A;  4XWW A;  4HRS A;  3CIR B;  3PZD A;  3NJT A;  5BYQ A;  1Q5W B;  2LUE A;  2IBI B;  4GDK B;  3L16 A;  4LJO B;  2L8J A;  2INC C;  2K25 A;  5E6J A;  3IT4 B;  4BKG A;  4ANV A;  1Z5S B;  4RGT A;  1E8X A;  2FE8 A;  3N32 A;  4JE3 B;  3VH4 B;  3H6N A;  1YQ3 B;  1F2R I;  4LNF A;  1IGD A;  2K6D B;  4IDI A;  2M8S A;  1I4R A;  4WWO A;  3V61 A;  4BFR A;  4GDL B;  3AEC B;  1AN8 A;  5G5H A;  1ET6 A;  2KWC A;  4KIK B;  2L76 A;  2V4I B;  2KN5 A;  2GLS A;  2J42 A;  2KN4 A;  3APC A;  2BBC A;  1MG8 A;  5T8I A;  1ZGU B;  3M95 A;  1GNU A;  3C19 A;  5H8Y E;  2GB1 A;  1F1H A;  3ZDM C;  2KZR A;  3WA0 A;  2DX5 B;  4P7I A;  1E10 A;  3PRP B;  2LUM A;  1D5X C;  1KOT A;  2KFK B;  4H2A A;  3DVN U;  3RNA C;  3DDC B;  4NAW B;  3IBE A;  3R2I A;  1I4H A;  4E71 A;  3A33 B;  4MT5 A;  2RPV A;  2KLG A;  4F1S A;  2V3N A;  1V6E A;  4HLE A;  2EEL A;  4ZYS A;  1SE2 A;  1YJI A;  1J8C A;  4B0E A;  1UGJ A;  4EE2 A;  4IM3 A;  2KXJ A;  4FBJ B;  1WMH B;  1YX6 B;  2YVC A;  3QC8 B;  3AI5 A;  2PLP A;  2O6V D;  3SEB A;  2MP2 B;  1F52 A;  1HTQ A;  1RFA A;  3K9P B;  1OFF A;  2SEB D;  2C7M B;  3IHP C;  4GSW A;  1LFD A;  4GIV A;  4LDT B;  2K0P A;  2WXJ A;  4MM3 A;  4K7S A;  2C9W B;  3PLU A;  3I63 C;  2N7D A;  4ZRP A;  4HPP A;  4JWU C;  2BTE A;  1TYG B;  1VZ8 A;  3N1X C;  3NG0 A;  2FCS A;  2BS4 B;  2JVC A;  2NVU I;  2QEJ C;  2KWV B;  1FXA A;  4YSZ B;  3RNC C;  3QAR A;  3TIX A;  3N1Y C;  1V81 A;  3TBL D;  3ZO5 B;  3A1Q B;  1WWT A;  3DBH I;  3RNE C;  1NDD A;  4KGT A;  1WR6 E;  1GB4 A;  2G4D B;  2K5P A;  1FXT B;  5CX3 A;  2YEP B;  3RZW C;  4HCN B;  2C7H A;  1CMX B;  5L95 C;  2JY6 A;  1BXT A;  4PYU A;  5AEK B;  2J0M A;  3ZNI D;  3AEF B;  4MSQ B;  1V5T A;  3U4E G;  2WX1 A;  2GBJ A;  3GS2 A;  2N7J A;  2WQY B;  4RGM A;  4HKZ E;  2FBW B;  3RD2 A;  3DVN V;  3VUW A;  1C3T A;  1EF1 A;  3ZUN A;  3CWI A;  2MWS B;  2AYO B;  1V1O A;  2AQ2 B;  2MEK A;  2Y3A A;  1Y56 A;  4LNN A;  1WRD B;  3Q14 C;  5CHV C;  1HA5 A;  5LXI B;  2KKC A;  2WXH A;  4FHK A;  3P1M A;  1RAX A;  4GU2 A;  3L10 B;  3AN1 A;  3TMP B;  3QWZ B;  4PT5 A;  1WJ4 A;  1FO4 A;  1PFD A;  2OOB B;  4RFB A;  2NBV B;  3ML8 A;  3WAN A;  1JCK B;  5TR5 A;  1L0Y B;  3FIL B;  3VTU A;  3RUL A;  2Z0E B;  2I2Y A;  4WJQ A;  1WF9 A;  2KFJ A;  1IPG A;  1E8W A;  1HEZ E;  3UIO B;  3ALB A;  4K7U A;  4XYC A;  2DZI A;  3P42 A;  2DZJ A;  1PGB A;  4RF1 A;  2KO3 A;  3CF6 E;  2L52 A;  2K9X A;  2OJW A;  1ZW7 A;  2D3B A;  2KT7 A;  4PS8 A;  1OQQ A;  2LXA A;  3NVV A;  3DCG A;  3FC4 A;  4FJY A;  1FEH A;  5HFY A;  3VR8 B;  2BS2 B;  4N9F 4;  3RUI B;  3KWL A;  1SF0 A;  1L4Z B;  5MPO A;  1QF6 A;  2PW9 A;  5J2R A;  5AUI A;  1SEB D;  4IW0 A;  3RPF C;  4WWP A;  3U7D A;  4KSL C;  2X8X X;  2CU1 A;  3BVG A;  4I6L B;  2K22 A;  3WAL A;  2JQR B;  1KJT A;  4O1N A;  3RT3 B;  2DYO A;  3W1S C;  1V49 A;  1RWS A;  2RDB C;  1UZX B;  1CQV A;  5IN7 A;  1XXG A;  1SE4 A;  4JGH B;  1XO3 A;  4C7Z A;  3VR9 B;  5IAA C;  1LQB A;  3AE7 B;  3BY4 B;  5FKA C;  5IOI A;  1KH0 A;  4HJG E;  2DBY A;  2GOW A;  2W54 A;  2LGS A;  3N30 A;  2KJR A;  5DPS A;  4NZL B;  4HXD A;  4A6Q A;  3LJ3 A;  4BKT A;  2H88 B;  2IGD A;  3Q8B A;  3L4P A;  1I7H A;  2L05 A;  1Q0W B;  3J9C A;  4E74 A;  1TS5 A;  1B9R A;  3PVL A;  2AL6 A;  3AE9 B;  4XGA B;  3BVM A;  5C2T B;  4AOF A;  1ZKH A;  4XWT A;  1JWS D;  1IBX A;  4II3 B;  3VRB B;  4FN2 A;  3Q3J A;  2K1F A;  2BWF A;  4KKI A;  2HD5 B;  2QJL A;  2WP9 B;  1CK1 A;  3KUC B;  2V1Y A;  1STE A;  4ZOH C;  3P4P B;  3H1U A;  3HUI A;  1EU3 A;  3R66 C;  2LFI A;  3T9L A;  5BMI A;  2O2V A;  2NCN A;  3QA8 A;  2ZJD A;  3GB1 A;  4F7Z A;  4IWO A;  2FCN A;  3H9D A;  1TGZ B;  3DBH B;  3AEA B;  2JPH A;  1E9M A;  1NYQ A;  1ZDV A;  3V62 A;  4ANW A;  3I57 A;  4FHJ A;  5EE0 A;  3RFZ B;  4HPL B;  3KUZ A;  4RGO S;  5IKC M;  3TEW A;  2GBN A;  3BZD B;  1V9J A;  4HRO A;  3N20 C;  5EDS A;  2QCZ A;  4IC7 B;  1YN5 A;  2WXM A;  1C4C A;  3WAO A;  4OZA A;  3DBR I;  2IDY A;  3W9C B;  2K39 A;  2N4F A;  2KDF B;  1KM7 A;  2LMC A;  3RNB C;  4DK5 A;  3NZS A;  2O6V A;  3VRA B;  4HWI B;  2MH7 A;  2D5G A;  3AE5 B;  4WAA A;  2JU6 X;  1J19 A;  4LNI A;  2X38 A;  2KMA A;  2VZK B;  3RZF A;  2C5L C;  4BBN F;  4A20 A;  3GP7 A;  4S0R A;  3WIM A;  1YN4 A;  4LTU A;  2MJD A;  3DHG C;  2L0F A;  2D3A A;  4M00 A;  1E8Y A;  3NVW A;  3DHI C;  3MC0 B;  3IT6 B;  2LHE A;  4LDT D;  2LWP A;  2PMV A;  1J7C A;  4IG7 B;  3SFE B;  1JRO A;  5FR3 A;  1QT9 A;  2Q5W D;  3ZVV A;  2A5U A;  3UIN B;  3ZJT A;  2DHZ A;  1HE8 A;  2BT6 A;  1PDX A;  4LCD E;  2WU5 B;  2KDM A;  2ZCC A;  2V0G A;  2GI9 A;  3A9K B;  3KYD D;  3L0W B;  1XF5 L;  3JSV B;  1YD8 U;  2ZEQ A;  2DNF A;  5BMG A;  1NVI D;  5GXG B;  1UUP A;  2LVP A;  2JRH A;  1A70 A;  1RM6 C;  4P6V F;  3B1L X;  2XK5 A;  1SE9 A;  3MTN B;  4RM8 A;  3W5V B;  2KLC A;  1GC6 A;  3ZW3 A;  1WJN A;  2Y5P A;  2JX5 A;  4AJW A;  1OQR A;  4L2Y A;  1GC7 A;  1I4X A;  2KNB A;  3DBL I;  3B0A A;  4YT0 B;  1SIF A;  4FAD A;  1HZ5 A;  4KKJ A;  3KLS X;  1PGA A;  1AYF A;  4PK1 A;  4EEW A;  4LJP B;  1I4G A;  3LDZ E;  2LXC A;  3PHX B;  1VCB A;  2KX3 A;  1JRU A;  3AE8 B;  1V1P A;  4TSS A;  1IP9 A;  1DOX A;  2WS3 B;  1ZOY B;  3BK1 A;  1CZP A;  1T0Q C;  4US8 A;  4LLG M;  2MX2 A;  4W9K A;  1WGY A;  3Q8C A;  5HKH A;  3RNG C;  4ASW C;  5BO4 B;  4MJS A;  1YJ1 A;  4CHK A;  1YOV B;  1SE3 A;  3OWE B;  1NI2 A;  5BMH A;  1QQR A;  2RPQ A;  1M94 A;  1QOG A;  2WWZ A;  2WXK A;  4DHJ D;  4MSM B;  4WQM A;  4C80 A;  3BII D;  3N1Z C;  3W1Y A;  2INN E;  4WJP A;  2BGF A;  1UD7 A;  1N5X A;  4DHZ E;  2REX A;  1XEE A;  2M56 B;  1YJJ A;  1Q1O A;  3M63 B;  4YTP B;  3ECI A;  3IG3 A;  2JZP A;  3U7Z A;  3H7P A;  5LXH A;  3ENE A;  3Q8E A;  4GB9 A;  4NJC A;  3S2A A;  4WAF A;  4A3P A;  4RGN A;  1MHX A;  3HHM A;  1NEN B;  2FID A;  3ZNG C;  1ACC A;  3Q3M C;  4XC2 A;  3EC8 A;  4BVU C;  1P7F A;  1E90 A;  3AB5 A;  1UNS A;  1KFY B;  3ZTD A;  3TSS A;  1MJD A;  2W9N A;  4AQ7 A;  3KQ4 A;  5J18 A;  4NY0 A;  3BYT B;  2JF5 A;  3T3O A;  2KMC A;  5BYR A;  4NQK E;  2D3G A;  1L0X B;  1TIF A;  3L08 A;  3PZ8 A;  3PHW B;  3ZRF A;  2IY1 B;  1WXQ A;  3ZTC A;  2MA9 B;  4AJY B;  3UI3 A;  1YN3 A;  2KQ4 X;  3NUH B;  1J0G A;  1S1Q B;  3DBR B;  2QIE B;  4YTN B;  2N7E A;  2I1J A;  5LNK 1;  1JWU D;  1PUT A;  4A90 A;  3V6E B;  3H8H A;  3SDL C;  4MM3 B;  3TCA A;  2IZV B;  4L23 A;  3K9O B;  3W1S A;  2LJ5 A;  2PVG C;  2QDF A;  4OW0 A;  2OJR A;  4RMA A;  1BT0 A;  4M0W A;  4Q2J A;  1WYW B;  1L0V B;  2IPK D;  3O13 A;  3OJ4 B;  4A3O A;  1TT5 B;  4M01 A;  4AP4 C;  2R2O A;  3WAP A;  1WX9 A;  3EA6 A;  4GOC A;  3IAS 1;  3BVZ A;  3BWU D;  2JXX A;  3P4S B;  4ARC A;  3NS8 A;  2QC8 A;  1UBQ A;  1MPE A;  4JWS C;  1NEK B;  3LYY A;  1R7S A;  4RM9 A;  1N62 A;  4N6E B;  4W9E A;  3KUD B;  3RN9 C;  2KYW A;  2KWU B;  1C79 A;  4JL9 A;  2GBM A;  2RD0 A;  3SU8 X;  1N60 A;  4AWJ A;  5I4D A;  3VTV A;  4MAC A;  3DVG X;  1ISN A;  1TKE A;  4US9 A;  1GJZ A;  3PRE A;  1EF5 A;  1WR1 A;  1K8R B;  2L0T A;  5AUK A;  2PTL A;  2B3A A;  2IJ0 A;  2J0J A;  2N9P C;  2OED A;  2INP E;  4IWP A;  2WGS A;  4JLC A;  2QMT A;  4ZDV A;  4YL8 A;  4N59 A;  2KDE B;  1WYG A;  2N9L A;  4KZ0 A;  2ACZ B;  2M1M A;  3CSF A;  4P1B C;  4KSK C;  1UWM A;  3B2F A;  3DBL B;  1F0Z A;  4G0N B;  1L2N A;  1RRB A;  2ON8 A;  1T0Y A;  1OGW A;  2KTR B;  3MFG A;  2KDB A;  1ROE A;  4ICU A;  1UEL A;  4ZRK A;  3ZNZ B;  1L5P A;  1U4A A;  2BPS A;  4K3C A;  4CQN A;  2NPT A;  1QZE A;  2LRU A;  5JHA A;  1WJU A;  2VZK D;  2PE6 B;  3VUY A;  1GG3 A;  4EUT A;  2W82 A;  1E8Z A;  1TY2 A;  1JWA D;  1FD6 A;  1P9D U;  2RMM A;  3T3N A;  2UWQ A;  1DOY A;  2K3U A;  1FCC C;  3JYU A;  3DQV A;  2AEH A;  4GGQ A;  3QJZ A;  3AMZ A;  4NNJ B;  3U52 E;  4MH0 E;  4ARI A;  1S3S G;  2K8H A;  3NOB A;  3LB8 C;  4LNK A;  3R7R A;  1R4M B;  2ONQ A;  2LI5 A;  2BYT A;  2D11 A;  4WUR A;  1WX8 A;  2HJ1 A;  1IYF A;  3ZQ4 A;  5IP4 D;  3V6C B;  1UWX A;  1EM7 A;  2XEW A;  4TQ1 A;  1FFV A;  4NQL B;  4B6W A;  3V3X A;  4M8N A;  4FUL A;  2DEN B;  3HK0 A;  2LRW A;  2C60 A;  5EE9 A;  3T8M A;  3ZNH B; 
#chains in the Genus database with same CATH homology
 3I57 A;  4R3D A;  5EE0 A;  5HHD G;  3RFZ B;  1FCL A;  1GOZ A;  2WXG A;  3NVZ A;  1RFK A;  2WXL A;  1T6B X;  4RF0 A;  4RGO S;  4B0M A;  1KRH A;  3TEW A;  3BZD B;  4OVZ A;  4OZC A;  2N9K A;  4GLS C;  4HRO A;  3BYY B;  3B2G A;  2HDE A;  1E0Z A;  4C7Y A;  1YQ4 B;  3AE2 B;  5FK9 C;  4DXG A;  1YN5 A;  2KMM A;  2WXM A;  1C4C A;  1AWD A;  1QOF A;  4OZA A;  3ETR A;  1EWY C;  1I4Q A;  4XDC A;  2IDY A;  3W9C B;  2QIL A;  2LMC A;  1RYJ A;  3ZGZ A;  3VRA B;  2BB5 A;  5G5G A;  1JML A;  2MH7 A;  3MHZ A;  5D3D A;  2D5G A;  3AE5 B;  2J52 A;  2JU6 X;  1VRA B;  3R8B A;  2X38 A;  1KF6 B;  1HXY D;  2BS3 B;  2VZK B;  2L32 A;  1JWB D;  1D4B A;  3ZJU A;  2G1E A;  1C4A A;  4OHJ A;  3AE3 B;  3GP7 A;  3PZ7 A;  2BB6 A;  2FUG 1;  2PKO A;  4JPS A;  1QIL A;  1YN4 A;  1IBX B;  5C3J B;  2WDV B;  2L1A A;  4LTU A;  2E6X A;  2MJD A;  3ABV B;  1VDV A;  3HVD A;  4REZ A;  1NYR A;  2JYT A;  4XWW A;  4HRS A;  2ICI A;  3CIR B;  3I9V 1;  5BYQ A;  3NVW A;  3MC0 B;  4GDK B;  3IT6 B;  1FNU A;  2LHE A;  4YXD B;  1L6U A;  2PMV A;  1J7C A;  5EE3 A;  1JRO A;  2NMQ A;  3EUB 2;  3IT4 B;  2WNM A;  3MP9 A;  5E6J A;  3SFE B;  5FR3 A;  1C4P A;  4RCO A;  4DQO C;  4RGT A;  1QT9 A;  3TEZ A;  2WU2 B;  2Q5W D;  2FE8 A;  3NS1 A;  2H89 B;  4JE3 B;  3ZJT A;  2BT6 A;  2ZW1 A;  1PDX A;  1YQ3 B;  1F2R I;  1IGD A;  2Z8L A;  4IDI A;  2WU5 B;  1I4R A;  2KDM A;  4XDD A;  2V0G A;  2GI9 A;  1ET9 A;  2WLB A;  1DGJ A;  2KAJ A;  1XF5 L;  1EU4 A;  4GDL B;  3AEC B;  1AN8 A;  1NVI D;  5G5H A;  5BMG A;  1ET6 A;  1MI0 A;  5GXG B;  1UUP A;  4AS1 A;  3R2T A;  1FMA D;  1XLP A;  2V4I B;  3AEB B;  1A70 A;  2J42 A;  1RM6 C;  3TUO A;  2KN4 A;  4IOI E;  1L6V A;  4P6V F;  2BBC A;  1EWC A;  2LGI A;  5T8I A;  1BML C;  1N5W A;  1C76 A;  1PYW D;  1TS4 A;  4HKQ A;  2GRI A;  1DOI A;  5H8Y E;  2XN9 C;  3IXS A;  3W5V B;  2GB1 A;  1F77 A;  1C9F A;  2Y5P A;  1E10 A;  2JX5 A;  1OQR A;  2AQ3 B;  2AQ1 B;  2LUM A;  4L2Y A;  1E6E B;  3AED B;  2W3S A;  1I4X A;  1D5X C;  3SR6 A;  4H2A A;  1P7E A;  4NAM A;  4NAW B;  4YT0 B;  3R2I A;  1I4H A;  1HZ5 A;  4KKJ A;  3KLS X;  1PGA A;  4YWG G;  1AYF A;  4MT5 A;  1TJE A;  2RPV A;  2V3N A;  2SAK A;  4A9A A;  2M19 A;  2EEL A;  1I4G A;  4ZYS A;  1SE2 A;  1YJI A;  1YNT E;  2JSV X;  4B0E A;  1UGJ A;  3U2S C;  4EE2 A;  2WDR B;  3AE8 B;  1V1P A;  2PVO D;  2EKI A;  1XLO A;  4TSS A;  4ZRQ A;  2PLP A;  1FXI A;  3SEB A;  2WS3 B;  1Q10 A;  1DOX A;  1ZOY B;  3BK1 A;  1V97 A;  1OFF A;  2SEB D;  4HEA 1;  1CZP A;  4US8 A;  4LLG M;  2WDQ B;  3Q8C A;  4KGR A;  2K0P A;  2WXJ A;  1SE3 A;  3OWE B;  4OZB A;  5BMH A;  1QQR A;  1FM0 D;  1QOG A;  2WXK A;  3LXF A;  4ZRP A;  4JWU C;  4WQM A;  4C80 A;  3BII D;  1TYG B;  2BTE A;  1VZ8 A;  2INN E;  2TSS A;  2BS4 B;  1VZ7 A;  1KTK A;  3AEE B;  3W5U B;  2QEJ C;  1FXA A;  1BUI C;  1N5X A;  4KGS A;  1ESF A;  2QSD A;  4YSZ B;  1XEE A;  2M56 B;  1YJJ A;  1D6E C;  2PIA A;  4YTP B;  3AH7 A;  3N9Y C;  2JZP A;  2M0A A;  3U7Z A;  3VQI A;  1MVK A;  2AX5 A;  3FIL A;  2IGG A;  2WXI A;  1JW9 D;  3Q8E A;  1DYQ A;  1WWT A;  4NJC A;  2KWD A;  1K51 A;  1J7A A;  3SFD B;  4KGT A;  2Y5C A;  4WAF A;  4YSY B;  1VJK A;  4RGN A;  1MHX A;  1NEN B;  4A55 A;  1GB4 A;  1ACC A;  2K5P A;  1P7F A;  2L83 A;  2YEP B;  3AB5 A;  1UNS A;  2WXO A;  1KFY B;  3DWM A;  3NRZ A;  3TSS A;  1D5M C;  4AQ7 A;  3KQ4 A;  3BYT B;  1BXT A;  2W3R A;  3T3O A;  1L4D B;  5BYR A;  5BYS A;  1L0X B;  3PZ8 A;  2YEP F;  1CJE A;  1V1P B;  1SBB B;  5JXV A;  1WXQ A;  4XE0 A;  1XLQ A;  1WGK A;  2B76 B;  3AEF B;  1VR9 A;  1ZXH A;  1NI3 A;  1WRI A;  2NTS A;  3U4E G;  3UI3 A;  1YN3 A;  2KQ4 X;  1M4V A;  3NUH B;  3GS2 A;  4FXC A;  2CJO A;  2N7J A;  2WQY B;  2QIE B;  5EE1 A;  3MJ5 A;  4RGM A;  4YTN B;  4HKZ E;  1FIQ A;  2FBW B;  5LNK 1;  3ZYY X;  1JWU D;  1PUT A;  2OHF A;  4A90 A;  1GB1 A;  1TS3 A;  3CWI A;  3H8H A;  4MM3 B;  1I4P A;  2Y3A A;  1V1O A;  2AQ2 B;  1WSP A;  2MEK A;  1SXT A;  1LO5 D;  3P63 A;  4L23 A;  1Y56 A;  3W1S A;  2PVG C;  2MJE A;  5TSS A;  4OW0 A;  1HA5 A;  2N0S B;  1FNV A;  4M0W A;  2WXH A;  2DWQ A;  3E9S A;  3P1M A;  3O13 A;  1L0V B;  2IPK D;  2WXP A;  3AE6 B;  2LEK A;  3PO0 A;  3Q8A A;  4IKG A;  3AN1 A;  3AE1 B;  4YSX B;  4PT5 A;  1FO4 A;  1FRR A;  1XCT L;  1PFD A;  4J3O D;  1SJH D;  2XNA C;  4RFB A;  4UDU C;  4C56 C;  3EA6 A;  2J4X A;  5D7G A;  3IAS 1;  3BVZ A;  3BWU D;  3P4S B;  4ARC A;  1QLB B;  2E3T A;  2NTT A;  1K50 A;  1MPE A;  1JCK B;  4JWS C;  3FAH A;  3Q69 A;  1VZ6 A;  1NEK B;  2RDG A;  1L0Y B;  1JRP A;  1GAQ B;  3FIL B;  3LYY A;  2IGH A;  3KWV A;  2WXQ A;  2I2Y A;  4TMA B;  1R7S A;  1YMH E;  2CU3 A;  1HEZ E;  5HG2 A;  1N62 A;  3URY A;  4N6E B;  2LHD A;  1J7B A;  2CJN A;  2R61 A;  1JAL A;  2HTM E;  3HRD D;  2MJ3 A;  4LK0 M;  1F2R C;  3TEY A;  1ENF A;  1C79 A;  4JX1 C;  3P42 A;  1N60 A;  5I4D A;  1GPX A;  1N61 A;  1PGB A;  1PGX A;  4RF1 A;  1JWM D;  4MAC A;  2DLB A;  2L52 A;  2K9X A;  1TKE A;  1T5X D;  4US9 A;  1OQQ A;  3BK2 A;  3NVV A;  3FC4 A;  1FEH A;  5HFY A;  5AUK A;  3VR8 B;  2PTL A;  1ZPS A;  2BS2 B;  3NZ3 A;  2IJ0 A;  3P4Q B;  2WXF A;  2G9H D;  3AV8 A;  3KWL A;  4ZHO A;  1SF0 A;  1ZE3 D;  1KLG D;  1L4Z B;  4TQ0 A;  2OED A;  4YTM B;  2INP E;  1QOB A;  5MPO A;  2LJI A;  2QMT A;  1QF6 A;  2PW9 A;  4N59 A;  5AUI A;  1WYG A;  1SEB D;  2W55 A;  3RPF C;  2N9L A;  2JXT A;  4WWM A;  1ZXI A;  1C78 A;  2ACZ B;  5H92 C;  2V3P A;  4N58 A;  1SIJ A;  1UWM A;  3B2F A;  1F0Z A;  4P16 A;  1D5Z C;  3BVG A;  1FNW A;  3EGR A;  1ZUD 2;  2K22 A;  1QKZ A;  2DYM A;  1TY0 A;  2JQR B;  2J53 A;  4WH4 A;  3TEX A;  1V8C A;  1ZP0 B;  2WXR A;  4O1N A;  4MH8 A;  2DYO A;  2ON8 A;  1FFU A;  3MFG A;  1RWS A;  1ROE A;  1C77 A;  1CQV A;  1XXG A;  1FRD A;  1SE4 A;  1T3Q A;  1L5P A;  4RNA A;  1K52 A;  1XO3 A;  3C8Y A;  4CQN A;  3AE4 B;  3VR9 B;  4A8X C;  4C7Z A;  1TKG A;  3AM9 A;  1TKY A;  1HQR D;  2KAC A;  2RDH A;  1IUE A;  3AE7 B;  3IAM 1;  5FKA C;  1KH0 A;  4HJG E;  2DBY A;  1SJE D;  4ITK A;  2W54 A;  3B9J A;  2VZK D;  4D2K A;  4NZL B;  1MHH E;  4A6Q A;  2H88 B;  2IGD A;  2W82 A;  3Q8B A;  3L4P A;  1TY2 A;  1JWA D;  1I7H A;  1FD6 A;  2RMM A;  1TZO A;  4WIP A;  3HVZ A;  3J9C A;  5HI1 A;  3T3N A;  2BW2 A;  1TS5 A;  1DOY A;  1B9R A;  1TS2 A;  1K53 A;  2K3U A;  3ZJV A;  1FCC C;  3AE9 B;  1B1Z A;  3BVM A;  5C2T B;  3E56 A;  5D3I B;  1HZ6 A;  3AMZ A;  4XWT A;  1JWS D;  1IBX A;  3VRB B;  4KX6 B;  1XCQ L;  3U52 E;  3V05 A;  2JWU A;  1SSN A;  4KKI A;  4L1B A;  4ARI A;  3NVY A;  2QJL A;  2JYE A;  2I38 A;  3WCQ A;  2WP9 B;  2WXN A;  3LB8 C;  1QOA A;  1CK1 A;  1SB3 C;  4Q2J A;  1STE A;  4ZOH C;  2ONQ A;  3P4P B;  1E7P B;  4DXF A;  2BYT A;  1AW7 A;  3HUI A;  4RH6 A;  4WUR A;  1EU3 A;  1ZDX A;  1N63 A;  3ZQ4 A;  1KLU D;  2LFI A;  5BMI A;  1UWX A;  1EM7 A;  4ZHP A;  4TQ1 A;  2ZW0 A;  3GB1 A;  1VLB A;  3P4R B;  1FFV A;  3DWG C;  1JQ4 A;  4USA A;  3AEG B;  3V3X A;  3AEA B;  1IGC A;  3Q8F A;  3W2D A;  1E9M A;  5EE9 A;  1XLN A;  1NYQ A;  1ZDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...