1YMHE

Anti-hcv fab 19d9d6 complexed with protein l (ppl) mutant a66w
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
b'KEEVTIKVNLIFADGKIQTAEFKGTFEEATAEAYRYADLLAKVNGEYTWDLEDGGNHMNIKFAGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 16D9D6, light chain
publication title Comparison of the crystallization and crystal packing of two Fab single-site mutant protein L complexes.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
total genus 15
structure length 65
sequence length 65
chains with identical sequence F
ec nomenclature
pdb deposition date 2005-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ymhE00
2N9KA 2KQ4X 1EM7A 2JZPA 1XF5L 1F2RI 1MHXA 5BMHA 2LUMA 4KGRA 5JXVA 2LGIA 2KACA 1XCTL 1P7EA 3V3XA 1D4BA 1YMHE 1K51A 1MVKA 4OZBA 1GB1A 1F2RC 4KGSA 1IGDA 2PTLA 1HZ5A 1XCQL 2ZW1A 2QMTA 2NMQA 2N9LA 2J53A 1MHHE 5HG2A 1QKZA 2JU6X 1C9FA 1K53A 4D2KA 2JXTA 1K52A 1PGXA 2RMMA 2RPVA 2KWDA 1HEZE 3FILB 1KH0A 4MACA 2GI9A 5BMIA 2I38A 1YNTE 1IBXA 2OEDA 1ZXHA 2ZW0A 4OZAA 1HZ6A 2JSVX 1FD6A 2N7JA 5HFYA 1FCLA 1FCCC 2PW9A 2QSDA 2IGHA 1IGCA 1MI0A 2J52A 1P7FA 4IKGA 2KDMA 3MP9A 4KGTA 4WH4A 2PLPA 2LHDA 1IBXB 2IGGA 1K50A 4IOIE 2EELA 1GB4A 4GLSC 1PGAA 2ON8A 2K0PA 4OZCA 3UI3A 2IGDA 5HI1A 2GB1A 2JWUA 3FILA 3GB1A 1MPEA 1Q10A 4HJGE 4HKZE 1UWXA 2LHEA 1PGBA 2ONQA 5BMGA 1JMLA 2KN4A 2I2YA 5HHDG
chains in the Genus database with same CATH superfamily
3JYUA 1TS4A 5FKAC 4B9KA 2JT4B 4WIPA 2LUMA 2PE6B 3B0AA 3SFEB 5IP4D 2K8HA 4MDKE 4WQMA 2VRRB 2MEKA 1WGRA 3A1QA 1R4MB 1XCQL 3IHPC 4EUTA 3T3NA 2WU2B 3RCZA 2KO3A 3P4SB 1WJNA 4B0EA 4JPSA 2EKIA 2N9LA 2KFJA 4MELA 1YOVB 4NJ6A 3TMPB 4DXFA 2KQ7A 2HJ8A 3VUXA 2LMCA 1VLBA 3HM6X 1ZOYB 1WJUA 1QF6A 3DCGA 3UIOB 3VHTC 1HEZE 2FCSA 4A3OA 4LLGM 1YNTE 4NAWB 2D10A 3P42A 4IG7B 2OEDA 4S17A 2QILA 1E6EB 3ETRA 2KC1A 3IXSA 4K1RB 2L76A 5HFYA 4MM3B 2L32A 3NRZA 1DOXA 1FCLA 3RZWC 1F77A 3I57A 2N7EA 2WYQA 3PO0A 4AQ7A 3H7SA 2WWZA 3PGEA 3UINB 3R2TA 1P98A 1MI0A 5D7GA 1C78A 1F9JA 1WMHA 1N60A 2G4SA 4ANXA 2JVCA 2Z0DB 2ASQA 1IUEA 3OJ3A 1ZE3D 2KVRA 2C60A 1D5ZC 2FUHB 2DNFA 2KNBA 3NVWA 1D5XC 4KX6B 2BYEA 2WDRB 3EFUA 3P63A 4WJQA 1GUAB 3DQVA 1KM7A 2L8JA 3OAWA 5LNK1 2JY6A 1P0RA 2NVUI 2M8SA 1VCBA 1L4DB 1UBIA 1MJDA 2L05A 2KN4A 3GS2A 5BMGA 3SFDB 2GOWA 3BYTB 3EECA 2CU1A 3HM3A 2CHZA 2KFKB 4WAAA 3V3XA 2N1VA 2WLBA 2UYZB 2WP9B 5JHBA 4IW0A 3I5JC 1HZ5A 1ZDXA 3PHXB 1WM2A 3MFGA 3AEAB 3H1UA 2J53A 2WXMA 1E7VA 1GC6A 3ZXRA 1N62A 2EMSA 3VVWB 3DVGX 2Y5BB 1K53A 1BUIC 1CJEA 4YSXB 3H7PB 5H92C 5J2RA 3ZO5B 4TV3A 1ZGUB 4JWSC 3Q8BA 2SEBD 1FNUA 2BS4B 3HUIA 3AE2B 1JRPA 1QOGA 3CWIA 3ZQ4A 3Q8EA 3JSVA 1QOAA 2FCQA 5C3JB 1JWAD 4B0MA 3KW5B 1VDVA 1SGHA 3PHWB 1V49A 1Q1OA 4HRSA 2JRHA 2D3AA 3M63B 2V4LA 1PDXA 4KKIA 4B6WA 1RFKA 3ML8A 2BT6A 5LXIB 3DVNV 1GAQB 4JQWC 4DXGA 1CQVA 2KC2A 2J0JA 5G5HA 4O1NA 1WX7A 4DHJD 5CX3A 3R8BA 2N9EB 3PT2B 2MX2A 2QDFA 1JCKB 3QK0A 2KX0A 2L52A 3KWVA 3W1SA 1NYRA 2WX0A 4I6LB 5AZGA 4TQ1A 4LJPB 4LNOA 2N9KA 2REXA 4WQOB 1Q0WB 5DCNA 5LLIA 1P7EA 4JLCA 4DHZB 1PFDA 4HLEA 3WIMA 2WXQA 2V9HA 4NAWA 4P16A 3ZGZA 5IKCM 4DBGA 1EWCA 1DOIA 1IPGA 3TL5A 4MM3A 2KTRA 3MC9A 2D3GA 3MJ5A 3RI7C 3OWEB 3OLMD 4DQOC 1VJKA 3AE3B 2Z0EB 3AEFB 4P1CC 1E8XA 2LEKA 1NBFC 2JWZA 3ZTDA 3IAM1 3FILB 2GI9A 3CMMB 1UD7A 5BMIA 4PS3A 2VZKB 1JWUD 3N30A 4GDKA 3Q8AA 5G5GA 4RGNA 1OQQA 4TMAB 3N20C 2YEPF 3ZUNA 1R4NB 2LXCA 3AB5A 2W9NA 4LTUA 2HE7A 5BYSA 1SE9A 3RNGC 1L5PA 1LXDA 3MP9A 4CYEA 4MGKE 4EE2A 2QEJC 2K3UA 2KHWB 2KYWA 3A4RA 1ZPSA 2AYOB 3AXCA 2ZNVB 2INCC 3R7QA 3AEGB 2CS4A 3CF6E 3VDZA 3GP7A 4G3XB 3QC8B 4YTNB 1NYQA 4DHZE 4JE3B 3IG3A 1UZXB 2NBUA 4HPMB 1TS3A 5BMHA 1AN8A 3DBLI 1GNUA 1ZKHA 2K1FA 3DBRB 2OOBB 2FAZA 3AE5B 1YIWA 2XK5B 2ZW1A 4JGHB 1ISNA 2KJ6A 3P4QB 2J0KA 2BQQA 1RWSA 2ZNVC 1J19A 3L08A 2ZJDA 4I6NB 4CHKA 4C7YA 4YTPB 4TSSA 1BMLC 2YLMA 1JALA 2DBYA 4GMVA 3ONSA 2AQ3B 4RFBA 1BXTA 3HVDA 3FKYA 2PW9A 4NPNA 1LGRA 1C76A 3UIPB 2LUEA 1S3SG 2YEPB 2KQSA 4IKGA 4IM3A 1WX8A 3A1QB 2HJ1A 1ET6A 4XZ4A 4ZRKA 3SHQA 1R7SA 1QILA 5GMVA 3ABVB 3RYTA 2K0PA 2DZJA 2MW5A 1XEEA 1QQRA 2L3ZA 3HRDD 1TTNA 1I7HA 1MPEA 3L4PA 3VXWA 1WZ3A 3ALBA 3C19A 2JRIB 5H8YE 3B2FA 2M0XA 2INDC 2NTTA 2G45B 3PRMB 1FXIA 1P9DU 4KKJA 2E3TA 2I1KA 2DWQA 2DAJA 4N59A 4JWUC 2KMAA 1UH6A 1WMHB 2KK8A 1NEKB 3S2AA 4C56C 1L0XB 3E9SA 5J17A 1LFDA 4IM2A 2BGFA 1L7YA 3FC4A 3VR9B 2BKFA 1NVID 4XWWA 1SSNA 3KH0A 2GBRA 3QWZB 1HTOA 1MG8A 1EUVB 1EF1A 3Q6BA 1X1MA 4F1SA 3L0WB 1FO4A 1STEA 3QHTA 2MH7A 2KANA 4MEMA 4WWPA 2QCZA 2N9PC 4MH0E 1TKEA 1LO5D 2PIAA 2MBHA 2DHZA 2J42A 2D5GA 2JZZA 2N0SB 4FN2A 3N1ZC 2PMVA 2EMTA 1EWYC 2G4DB 3P2BA 1JWBD 3ZJTA 1WI0A 1P7FA 3VRBB 2KDMA 4L23A 3QIJA 4A90A 1D3ZA 4KGTA 1F0ZA 2OJWA 2AL3A 2IGGA 2KLCA 2V3SA 2KT7A 1C4AA 1FM0D 1FXAA 1YX5B 3APFA 2DYMA 1WRIA 2IDYA 4NAMA 4LJOB 2IGDA 3RNEC 4ASWC 3ZNGC 4GIVA 4DHJB 5EE9A 4HJGE 1AYFA 1V97A 4HPPA 3X0WA 2BVCA 2ZZPB 3Q3JA 3NVZA 2KQ4X 3RNBC 2WXIA 1L6VA 3JSVB 4JIOU 3D32A 4KGRA 1KRHA 4HJKA 2JYTA 2CKHB 3NG0A 5EE0A 3DVNU 3N3KB 3WALA 5TSSA 4WWNA 2KXJA 1SE2A 1L2NA 2LRWA 2DENB 1WGKA 3W2DA 2JYEA 2V4IB 1TY2A 1ZW7A 3ZW3A 2GLSA 3N1YC 4A55A 3HHMA 1ESFA 1WGGA 2KX3A 3P1MA 2KN5A 2ZPNA 4NJCA 3RN9C 3AN1A 2R61A 4NNJB 4N9F4 2LGYA 5CHVC 2WS3B 1XLQA 2ZCBA 2IPKD 4BOZB 3V6CB 5IN7A 1XLNA 2RPQA 2N7JA 2V0GA 1WXSA 3ZIMA 3PSEB 4L2YA 1FCCC 5I4DA 2R2OA 1C4CA 5IOIA 4IWQA 3T9LA 3AE9B 1K8RB 2KOXA 1UWMA 2FE8A 5CHFA 5C2TB 4DK5A 2MP2A 2L00B 1PQSA 4N58A 4WH4A 4ICVA 1V1OA 3SU8X 4ANWA 3BZDB 4E74A 4C7ZA 3GZNI 2KTRB 3UQBA 2MBQA 2AQ1B 1OQRA 1RRBA 4W9CA 3PTFC 4BKSA 4K3BA 1WR1A 3WAOA 1S1QB 2LASA 4EEWA 3LYYA 3Q2AC 1WF9A 4HKZE 1WX9A 3W1SC 1UWXA 3GE8C 1PGBA 4KSKC 3PLUA 1KF6B 3JVZX 2MBOA 1V1PA 4ZRIA 5D3DA 3U4EG 4GDKB 1E7PB 4YTMB 2C7MB 3BK1A 4MGYE 4WJNA 1E8WA 1DYQA 1JW9D 1WRDB 2LGSA 1J7CA 4M8NA 5GXGB 2G3QB 3BYYB 1T0QC 4FJVB 1WJ4A 2MBEA 2HTHA 1MHHE 1BT0A 2RDGA 1SJED 2IO3B 1Z2MA 4WJOA 4IC7B 4BKSD 3QAQA 4EZKA 2WXRA 3IT6B 4ZDVA 3ZXVA 3MC0B 2WXJA 3TJPA 4A9AA 5FK9C 1KH0A 2M19A 4MACA 4EZLA 2BW2A 3EUB2 1V80A 3KYCD 2RD0A 4HROA 1YQ4B 2PVGC 3Q8FA 1ZXHA 2JSVX 2WXHA 3AE6B 2IJ0A 3BWUD 2PE9A 2WDTB 4BOSC 2O6VD 1WWTA 3AH7A 4PK1A 4KSLC 2H89B 1PUTA 5D6JB 3IFWB 2WNMA 4W9LA 2BB6A 3R3MA 1GOZA 4II2B 4ZRPA 4RGTA 1VZ6A 2FCNA 5DPWA 5E6NA 1YX6B 4P6VF 2XNAC 4AJWA 1IYFA 2V3PA 1UGJA 4WJPA 1Q10A 2CJNA 4HDQA 1R4NI 1TZOA 3H8HA 2DYOA 4KDIC 3P4PB 3TUOA 1NI2A 4Q2JA 3B2GA 4MJSB 1KJTA 3V05A 3QJZA 2AEHA 2D11A 1GJZA 4HVBA 1P1AA 4FJZA 2X38A 3VUYA 2K9XA 2Q5WD 5G2NA 1OEYA 5JZEB 2A5UA 3AM9A 2GBJA 2RGFA 2VH1A 3PZDA 4KGSA 3NZ3A 3WAPA 4W9FA 4K81A 1V2YA 1T0YA 3N1XC 3U7ZA 1FPYA 5BYQA 2BWES 5HG2A 2G1EA 1FFUA 1JRUA 2MJDA 1CK1A 2Y3AA 1J0GA 5E6PA 4K3CA 1I35A 1QT9A 2FNJB 2LXAA 2WDQB 3VTUA 3AV8A 4LNFA 2WGSA 3DHIC 3QQ8B 3DBRI 1ACCA 3T3OA 4KIKB 1TY0A 3VRAB 1XLOA 1XLPA 4OZAA 1HZ6A 3M95A 1Q5WB 4FHKA 1YN4A 1YQ3B 3P4RB 3NZSA 2QSDA 3KUDB 2M0AA 1UBQA 3VTVA 4XGAB 2WXLA 5BYRA 5E6OA 2PKOA 1WXMA 1HTQA 2WXNA 4P7IA 1KLGD 1UF0A 1KLUD 1QZEA 4GLSC 1SE4A 4OZCA 1T6BX 1E9MA 3NUHB 1RLFA 5DPRA 4FLHA 3VFKA 5TR5A 2LVQA 3FAHA 2MHJA 2MSED 3Q8CA 3RPFC 4RF1A 4NQLB 1TS2A 1T5XD 1AW7A 4FHJA 5JXVA 2HD5B 1OGWA 5G55A 2W54A 3BIID 4W9KA 2K8BA 3EC8A 4OVUA 1SB3C 1QOFA 1J7BA 4MGIE 4TKNA 2IBIB 2XEWA 1TJEA 1N63A 4ZYNA 3AEEB 3VQIA 2CU3A 1WXQA 4HCNB 1C9FA 4LCDE 2W82A 3TEZA 4D2KA 5IA7A 3RMKC 2K25A 1NDDA 3LXFA 2WHIA 1CZPA 3V6EB 5C1ZA 4XDDA 2K8CA 1WY8A 4W9EA 2MLBA 2TSSA 2I38A 1FMAD 3DBHI 3U30A 1G6JA 2LFIA 3L10B 1GG3A 5L95C 1FD6A 5L83A 3AE8B 1VZ7A 2J7QB 3ZDMC 4XYCA 1UGMA 4BBNF 1C3TA 1E7UA 3QCAA 3ENEA 4PYZA 2KWVB 1IGCA 4F7ZA 3BK2A 2NCNA 1TYGB 5D2MB 4ZOHC 2KD0A 3Q3MC 4MJSA 2N9XA 2LVOA 2CJOA 4JX1C 1MFWA 3A9KA 2KKCA 3ML9A 2HDEA 2ON8A 2Y5CA 1UNSA 2WXOA 5HI1A 4AP4C 2JWUA 2G9HD 2K22A 3TCAA 3T8MA 3NVYA 4DDGD 4W9DA 1XT9B 2C7NB 1JMLA 1LM8B 4PS8A 1TS5A 1SJHD 1EO6A 1T0SC 2D2QA 3DHGC 4K7WA 3VH3B 5FR3A 3NY5A 2ZVOA 1J7AA 1D4BA 3N9YC 3RT3B 2L7RA 2C5LC 3HK0A 4BKTA 1C79A 1KTKA 4MGZE 2QMTA 2MP2B 4KIKA 4LDTD 3M3JA 4KVGB 1B9RA 3PRZA 4YSYB 4CQNA 5HKHA 1F1HA 4TQ0A 3MJWA 3NZUA 2OHFA 3OJ4B 1WGHA 2FBWB 2MBBB 4WWMA 3AULA 3V61A 4MH8A 3W5VB 4A20A 1WYGA 5AZFA 2V3NA 1Y56A 1WGDA 1ET9A 4ANVA 3MC8A 4HDOA 2QHOA 4C4VA 3IAS1 1TGZB 2PVOD 2BYVE 2GBNA 1V1PB 3W1YA 1ZXIA 2IGHA 3AEDB 4W9HA 2J52A 3ZKJC 3CSTA 4R3DA 4UDUC 2QC8A 2ZVNA 1NI3A 2ACZB 1IBXB 2NPTB 3Q3OC 1R4MI 1I42A 1VD2A 2AWTA 1HXYD 3A9JA 2KWUB 1DOYA 5KHQA 3ZNID 3L17A 2MCNB 2N7DA 1XO3A 4YWGG 2DAFA 1ZUD2 2IZVB 1E0ZA 4AWJA 1QLBB 2NBVB 4ITKA 2WXKA 1UUPA 3QARA 4M0WA 5HHDG 4AOFA 3AI5A 1H4RA 2JZPA 2K5PA 3DWMA 4BZAA 3ZRFA 4FBJB 4RF0A 4HCPB 3NS1A 4FXCA 1A70A 3CIRB 4BBNC 2W3SA 2LGDA 3ZLZA 2MJEA 4OZBA 1NENB 3C0RB 4B95A 2YVCA 2FCMA 4HWIB 4II3B 1H8CA 5EE1A 2RDBC 3Q3FA 3AE4B 2PEAA 2HTME 3HVZA 3ZTCA 3M62B 3NJTA 4E71A 3VR8B 4RGMA 4HK2A 1SE3A 2KDIA 4EZJA 1XXGA 2N4FA 1IP9A 3TEXA 4GB9A 4KZCA 2Y5PA 2WXGA 1TZ1A 5JHAA 2WXPA 5AUKA 3NHEB 1I4GA 2K39A 3V60A 2CHXA 2CHWA 3ZJVA 1OFFA 3IT4B 3PPAA 1WZ0A 1A5RA 1EU3A 4ICUA 4PYUA 1I4RA 4IM0A 4XC2A 2NTSA 2W55A 3IBEA 1ENFA 2K6QA 2ZCCA 4ZRQA 1VRAB 3R2IA 2FIFA 3TEWA 1N5XA 4W9JA 2ZEQA 2M56B 4BAXA 4YT0B 4K7UA 2BYFA 1VR9A 1WE6A 2MA9B 2J4XA 4DXAB 2JPHA 2DZKA 3GB1A 1JQ4A 1M4VA 1SIFA 4J3OD 1ZDVA 2ONQA 3KUZA 4IDIA 2KJHB 4W9GA 5KHOA 2RSUA 1RM6C 3J9CA 1WIAA 1T0RC 1KLVA 1I4PA 2DLBA 4CO7A 1P3QU 2E6XA 1F2RC 2MQJA 4LNKA 5D3IB 1E8ZA 1V9JA 3K9PB 4I6PA 3VTWA 5JH5C 3I63C 1WM3A 4L1BA 1UELA 4M00A 3RNAC 3AEBB 3EA6A 3Q14C 4XE0A 2M17A 2BB5A 1K52A 3N32A 1JWSD 3I3TB 3ZRCA 1N5WA 4TUUA 2JZ3B 2KWDA 1L4ZB 1TKYA 2INNE 1IBXA 2NPTA 4GSWA 1L0YB 3DVGY 1YJ1A 4YL8A 2O6VA 2M4NA 3X23A 3ZJUA 2ZW0A 3U52E 3BVZA 4GDLA 3DOWA 4US8A 1FFVA 2L0FA 4HXDA 3SD5A 1SIJA 2BS2B 4BVUC 1N61A 3NVVA 4H2AA 5J18A 1YN5A 3VAWA 4J6IA 1GPXA 2AX5A 1ROEA 2PJHA 4EFOA 2EKEC 2PLPA 2LHDA 3B1LX 2IY1B 3MHZA 1GC7A 1K50A 1LQBA 2FUG1 3KYDD 3W5UB 4ZHOA 2O2VA 1M94A 2GB1A 2BKRB 2WU5B 5EDSA 2KTFA 2BPSA 3KQ4A 2KWCA 2V1YA 2D3CA 4FA6A 4FADA 3R66C 3LDZE 3TEYA 2NR2A 2BS3B 1XF5L 2R2QA 1Y8RC 2JF5A 2ZPYA 4NJ7A 1WH3A 1CMXB 2IO1B 2LGIA 1E10A 2H88B 3E56A 3PLVA 4ANUA 1YMHE 4GOCA 3DWGC 1WR6E 2C7HA 4AUQC 2PTLA 4MT5A 1TBEA 3GZNB 4DDID 2NMQA 2RDHA 4S0RA 4YXDB 3MTNB 1QKZA 1JROA 2JU6X 1SXTA 1V5OA 2L83A 1E90A 4N6EB 3A9KB 2FIDA 4LDTB 2LWPA 1TKGA 2DZIA 4RH6A 1F52A 2OJRA 2JXTA 4G0NB 2RPVA 2KJRA 2UU7A 1EU4A 2PPHA 1C77A 3VH4B 4GN1A 2XN9C 4G11A 3TBLD 2D3BA 1TIFA 3UQAA 2DZMA 2LJIA 2BF8B 3OG5A 1YJIA 2IO2B 5CTRC 4RGOS 5IO9A 3WCQA 4IUMB 4ACFA 3KLSX 4BKGA 4G50A 1E8YA 4A8XC 1V86A 2A4ZA 2BWFA 4NQKE 2LVPA 3L54A 2LRUA 3RULA 1WSPA 3A33B 2EELA 2VH2A 4M8MA 3AU5A 1J8CA 1OEYJ 3Q69A 3AU4A 4XX5A 1HQRD 1E5WA 1XD3B 2KZRA 3DBSA 4HEA1 4US9A 2UWQA 4M01A 1WGYA 3AECB 2QJLA 4C4VB 4LK0M 3ZNHB 4HPLB 3GOEA 3AMZA 1I4QA 3K9OB 3QA8A 1SBBB 2IY0B 1GB1A 4PS7A 5AZHA 5AEKB 3PVLA 2KAJA 2Z59B 2WQYB 1V81A 4XWTA 1HE8A 3RD2A 4PT5A 3TIXA 1WXVA 2LZ6A 1V8CA 3H9DA 4GU2A 2W3RA 3A9JB 1PGXA 4OHJA 1SF0A 4AS1A 4WURA 1U4AA 3NOBA 4ZHPA 1D6EC 3Q3NC 2KDFB 1MG4A 3ZYYX 1L0VB 2I1JA 3APDA 4A6QA 2GBMA 2QIEB 2BBCA 4M0WB 1ZP0B 4OW0A 2KFKA 3ZVVA 4GGQA 3AE7B 4KDLB 2B76B 4ARCA 4OVZA 3PREA 1RFAA 4IWPA 4BFRA 5EE3A 1N6ZA 4KZ0A 1I4XA 3I9V1 3WAMA 3GE3C 4GXBA 3KUCB 3H6NA 2N1WA 4ZRJA 1PYWD 1GB4A 4KV2A 4XDCA 3H7PA 4USAA 1AARA 4HKQA 2GBKA 1FEHA 2LGXA 2WDVB 2M1MA 5FR6A 3LB8C 1YJJA 2WX1A 4A3PA 3MHSD 1V6EA 2CR5A 3PV1A 2JX5A 3APCA 5LXHA 2I2YA 2LI5A 4WAFA 2JUOA 1EM7A 5CHWA 3B08A 1FNVA 2ICIA 3BVMA 2BTEA 3V62A 1XCTL 4C80A 1SEBD 4RMAA 2B3AA 4NY0A 2GRIA 1IGDA 4OVVA 3LJ3A 2KLGA 1FRRA 3SDLC 3QX1A 2LJ5A 3L16A 1T3QA 4AJYB 4C00A 3RZFA 2MRPA 2JQRB 3U8ZA 2X8XX 4RM8A 2AL6A 4ARIA 3PZ7A 4ZYSA 3DPDA 4IWOA 1FRDA 2RMMA 1QOBA 2SAKA 2MJ3A 4MSMB 1YD8U 3TSSA 1L6UA 1EF5A 2C9WB 3PS6A 4LNNA 2KMCA 4M02A 2KMMA 1WFYA 2KDBA 2L1AA 4QAYA 3HIZA 3SEBA 4FULA 3U2SC 3WANA 1XQQA 4E3CA 2KDEB 4EOYA 2RR9A 2GMIC 3DBLB 2IO0B 1WJ6A 3RNCC 2J0MA 4MSQB 1PGAA 4RM9A 2NS5A 3DHHC 4RCOA 2DYBA 3RFZB 3B9JA 1VZ8A 3FILA 3DBHB 3JW0X 2MWSB 3A4SC 3NS8A 4P1BC 1C4PA 5MPOA 2LHEA 1D5MC 1TT5B 3KWLA 3CSFA 1C1YB 1DGJA 3R7RA 3L13A 2DX5B 1JWMD 1WXAA 3ECIA 4FJYA 3RNFC 2O6VB 1RAXA 1F2RI 1MHXA 4GDLB 2KACA 4K7SA 4REZA 4LNIA 4WWOA 1V5TA 3W9CB 2JXXA 1K51A 1MVKA 4F8CB 3VUWA 4W9IA 3BVGA 4X57B 3KVFB 2INPE 1HA5A 1Z5SB 3EGRA 1OTRB 1WE7A 4URKA 5E6JA 3C8YA 2IYDB 2NBWB 2Z8LA 2O2VB 2VZKD 3EHVA 3ZDTA 3ZNZB 1YQBA 1B1ZA 3O13A 2LD9A 3PZ8A 4JL9A 1FNWA 4YSZB 2KVZA 3O65B 3EFCA 1I4HA 5T8IA 5BO4B 3URYA 1RYJA 4RNAA 4NZLB 1WYWB 5D94A 2XK5A 3U7DA 3IVFA 1KOTA 1YN3A 1FIQA 3BY4B 1OQYA 5DPTA 4DWFA 3AE1B 5DPSA 5IAAC 2BYTA 5AUIA 2L0TA 4IOIE 3WA0A 2WXFA 4EKUA 5C23A 3UGBB 3UF8A 3UI3A 3DDCB 2XBBC 2AQ2B 3SR6A 2D07B 2K6DB 3BINA 3RUIB 3PRPB 1FXTB 1AWDA 1KFYB
chains in the Genus database with same CATH topology
4RF1A 1TS4A 5FKAC 2BS3B 1TS2A 1XF5L 5H8YE 3B2FA 1T5XD 1AW7A 4WIPA 2LUMA 5JXVA 2NTTA 2LGIA 1E10A 2H88B 1FXIA 3E56A 4KKJA 3SFEB 1YMHE 2E3TA 4WQMA 2MEKA 2W54A 3DWGC 3BIID 2DWQA 2PTLA 4N59A 4MT5A 1SB3C 1XCQL 3T3NA 4JWUC 1QOFA 2WU2B 1J7BA 3P4SB 1NEKB 4B0EA 4JPSA 4C56C 2NMQA 1L0XB 2EKIA 2N9LA 2RDHA 3E9SA 4YXDB 1TJEA 1N63A 3VQIA 1QKZA 3AEEB 1JROA 3FC4A 4DXFA 3VR9B 2JU6X 2CU3A 1SXTA 1WXQA 2L83A 1C9FA 4N6EB 1NVID 2LMCA 2W82A 4XWWA 3TEZA 4D2KA 1SSNA 1VLBA 1TKGA 4RH6A 2JXTA 1ZOYB 3LXFA 1CZPA 1QF6A 2RPVA 4XDDA 1HEZE 1EU4A 1FO4A 2TSSA 1STEA 1C77A 2I38A 4LLGM 1YNTE 2MH7A 2XN9C 4NAWB 1FMAD 3P42A 2OEDA 1TKEA 2LFIA 1E6EB 2QILA 1LO5D 3ETRA 2PIAA 3IXSA 1FD6A 2J42A 2LJIA 5HFYA 2D5GA 2L32A 3AE8B 4MM3B 3NRZA 1DOXA 1VZ7A 1FCLA 1YJIA 2N0SB 1F77A 4RGOS 3WCQA 3I57A 3PO0A 2PMVA 4AQ7A 1EWYC 1IGCA 3R2TA 3BK2A 3KLSX 1JWBD 1MI0A 5D7GA 3ZJTA 1P7FA 4A8XC 1TYGB 3VRBB 2KDMA 1C78A 4L23A 1N60A 4ZOHC 4A90A 4KGTA 1F0ZA 1WSPA 1IUEA 1ZE3D 2IGGA 2CJOA 2EELA 1D5ZC 4JX1C 1C4AA 1FM0D 1FXAA 2HDEA 2DYMA 1WRIA 2IDYA 2ON8A 3NVWA 3Q69A 1D5XC 4KX6B 4NAMA 2Y5CA 1UNSA 2WDRB 2IGDA 2WXOA 3P63A 5HI1A 2JWUA 1HQRD 2G9HD 2K22A 3NVYA 5LNK1 5EE9A 4HJGE 1AYFA 1V97A 4HEA1 4US9A 1L4DB 5BMGA 1JMLA 2KN4A 3GS2A 3SFDB 1TS5A 1SJHD 3AECB 3NVZA 3BYTB 2QJLA 2KQ4X 2WXIA 1L6VA 4LK0M 4KGRA 3AMZA 1KRHA 5FR3A 1J7AA 1I4QA 3V3XA 1D4BA 1SBBB 3N9YC 2JYTA 2WLBA 1GB1A 1C79A 2WP9B 1KTKA 5EE0A 2KAJA 1HZ5A 1ZDXA 5TSSA 2QMTA 2WQYB 3MFGA 4XWTA 3AEAB 1B9RA 1SE2A 4YSYB 4CQNA 4PT5A 2J53A 4TQ0A 2WXMA 1WGKA 3W2DA 2JYEA 1N62A 1V8CA 2V4IB 2OHFA 1K53A 1TY2A 1BUIC 1CJEA 2W3RA 4YSXB 2FBWB 4WWMA 4A55A 1ESFA 1PGXA 4OHJA 5H92C 4MH8A 3P1MA 1SF0A 3W5VB 4AS1A 4WURA 1WYGA 4ZHPA 4JWSC 1D6EC 4NJCA 3AN1A 3Q8BA 2R61A 3ZYYX 1L0VB 2SEBD 1FNUA 1Y56A 2BS4B 2V3NA 4A6QA 2WS3B 3HUIA 1ET9A 1XLQA 2IPKD 3AE2B 1JRPA 1QOGA 2QIEB 3CWIA 3ZQ4A 2BBCA 3Q8EA 1XLNA 1ZP0B 4OW0A 2N7JA 1QOAA 2V0GA 5C3JB 3IAS1 1JWAD 4B0MA 4L2YA 2PVOD 3AE7B 1VDVA 1V1PB 1FCCC 2B76B 5I4DA 4ARCA 4OVZA 1ZXIA 2IGHA 1C4CA 4HRSA 3AEDB 3AE9B 2J52A 5EE3A 1UWMA 2FE8A 5C2TB 1PDXA 4KKIA 4N58A 4R3DA 4UDUC 1RFKA 4WH4A 1I4XA 3I9V1 2BT6A 1V1OA 1NI3A 2ACZB 1IBXB 1GAQB 4DXGA 1CQVA 3BZDB 5G5HA 1PYWD 4O1NA 4C7ZA 1GB4A 1HXYD 4XDCA 3R8BA 4USAA 1DOYA 4HKQA 2AQ1B 1OQRA 1FEHA 2WDVB 3LB8C 1YJJA 1XO3A 3LYYA 4YWGG 1ZUD2 1JCKB 1E0ZA 4HKZE 1UWXA 2JX5A 2L52A 1PGBA 3KWVA 3W1SA 1QLBB 2I2YA 4WAFA 4ITKA 1NYRA 2WXKA 1UUPA 4M0WA 4TQ1A 5HHDG 2N9KA 1EM7A 2JZPA 1KF6B 2K5PA 1V1PA 3DWMA 5D3DA 4RF0A 3U4EG 3NS1A 4GDKB 3BVMA 1FNVA 1E7PB 2ICIA 1A70A 3CIRB 4FXCA 4YTMB 2W3SA 1XCTL 4C80A 1P7EA 3BK1A 2MJEA 1DYQA 1PFDA 1SEBD 4OZBA 1JW9D 5GXGB 1J7CA 1NENB 2GRIA 1IGDA 2WXQA 3BYYB 1FRRA 4P16A 3ZGZA 5EE1A 2BTEA 3AE4B 1T3QA 2HTME 1EWCA 3HVZA 1DOIA 1MHHE 2JQRB 2RDGA 1SJED 3VR8B 4RGMA 3MJ5A 3OWEB 4ARIA 2WXRA 1SE3A 3PZ7A 4ZYSA 1XXGA 3TEXA 4DQOC 1VJKA 3AE3B 1FRDA 2RMMA 1QOBA 2Y5PA 2SAKA 2WXGA 3AEFB 2LEKA 3IT6B 2MJ3A 3MC0B 2WXJA 3IAM1 4A9AA 3FILB 5FK9C 2WXPA 1KH0A 3TSSA 2M19A 4MACA 2GI9A 5BMIA 5AUKA 1L6UA 2BW2A 2VZKB 3EUB2 1I4GA 4HROA 1YQ4B 1JWUD 2PVGC 3Q8FA 1ZXHA 2JSVX 2WXHA 2KMMA 3AE6B 3Q8AA 2IJ0A 5G5GA 3ZJVA 4RGNA 1OFFA 3BWUD 3IT4B 1OQQA 1EU3A 4TMAB 2L1AA 2YEPF 3SEBA 1I4RA 3AB5A 2NTSA 4LTUA 2W55A 3U2SC 5BYSA 1ENFA 1WWTA 1L5PA 3AH7A 3MP9A 4ZRQA 2H89B 1VRAB 3R2IA 1PUTA 2WNMA 3TEWA 1N5XA 2BB6A 1GOZA 4ZRPA 4EE2A 2QEJC 2K3UA 2M56B 4RGTA 1PGAA 1VZ6A 4YT0B 4P6VF 1ZPSA 2XNAC 4RCOA 3RFZB 3B9JA 1VR9A 1VZ8A 2V3PA 2J4XA 1UGJA 3FILA 3GB1A 1JQ4A 1Q10A 3AEGB 1M4VA 3GP7A 1C4PA 4J3OD 5MPOA 1ZDVA 2CJNA 2LHEA 1D5MC 3KWLA 2ONQA 1DGJA 4IDIA 1TZOA 3H8HA 1JWMD 4YTNB 2DYOA 1NYQA 3P4PB 3TUOA 4JE3B 4Q2JA 3B2GA 3V05A 1F2RI 1TS3A 1MHXA 5BMHA 1RM6C 1AN8A 3J9CA 2KACA 4GDLB 1I4PA 2X38A 4REZA 2DLBA 3W9CB 2K9XA 2Q5WD 1K51A 1MVKA 2E6XA 3AM9A 1F2RC 4KGSA 3BVGA 3AE5B 3NZ3A 5D3IB 2ZW1A 2INPE 3U7ZA 5BYQA 1HA5A 4L1BA 5HG2A 3EGRA 3P4QB 2G1EA 1RWSA 3AEBB 1FFUA 3EA6A 2MJDA 1CK1A 4XE0A 5E6JA 2Y3AA 3C8YA 2BB5A 1K52A 2Z8LA 1QT9A 1JWSD 2WDQB 2VZKD 4C7YA 1N5WA 4YTPB 4TSSA 2KWDA 1BMLC 1L4ZB 1TKYA 3AV8A 1JALA 1B1ZA 2DBYA 2INNE 1IBXA 3O13A 1ACCA 1L0YB 3T3OA 1TY0A 3PZ8A 1FNWA 3VRAB 2AQ3B 1XLOA 1XLPA 3ZJUA 2ZW0A 4OZAA 1BXTA 1HZ6A 3HVDA 4RFBA 3U52E 3BVZA 4YSZB 5T8IA 1I4HA 4US8A 1YN4A 1FFVA 1YQ3B 3P4RB 1SIJA 2PW9A 2BS2B 1RYJA 1N61A 2QSDA 2M0AA 4RNAA 3URYA 4NZLB 3NVVA 4H2AA 1C76A 2YEPB 1YN5A 4IKGA 2WXLA 5BYRA 1YN3A 2PKOA 1FIQA 2WXNA 1GPXA 1KLGD 2AX5A 1ROEA 3AE1B 1ET6A 2PLPA 2BYTA 5AUIA 2LHDA 3MHZA 1K50A 1R7SA 4IOIE 2WXFA 1KLUD 1QILA 2FUG1 3W5UB 3ABVB 4GLSC 4ZHOA 2K0PA 1SE4A 4OZCA 1T6BX 3UI3A 1E9MA 3NUHB 1XEEA 2GB1A 2WU5B 1QQRA 2AQ2B 3SR6A 3HRDD 1I7HA 1MPEA 3KQ4A 3FAHA 3L4PA 1AWDA 1KFYB 3Q8CA 3TEYA 3RPFC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N9K A;  2KQ4 X;  1EM7 A;  2JZP A;  1XF5 L;  1F2R I;  1MHX A;  5BMH A;  2LUM A;  4KGR A;  5JXV A;  2LGI A;  2KAC A;  1XCT L;  1P7E A;  3V3X A;  1D4B A;  1YMH E;  1K51 A;  1MVK A;  4OZB A;  1GB1 A;  1F2R C;  4KGS A;  1IGD A;  2PTL A;  1HZ5 A;  1XCQ L;  2ZW1 A;  2QMT A;  2NMQ A;  2N9L A;  2J53 A;  1MHH E;  5HG2 A;  1QKZ A;  2JU6 X;  1C9F A;  1K53 A;  4D2K A;  2JXT A;  1K52 A;  1PGX A;  2RMM A;  2RPV A;  2KWD A;  1HEZ E;  3FIL B;  1KH0 A;  4MAC A;  2GI9 A;  5BMI A;  2I38 A;  1YNT E;  1IBX A;  2OED A;  1ZXH A;  2ZW0 A;  4OZA A;  1HZ6 A;  2JSV X;  1FD6 A;  2N7J A;  5HFY A;  1FCL A;  1FCC C;  2PW9 A;  2QSD A;  2IGH A;  1IGC A;  1MI0 A;  2J52 A;  1P7F A;  4IKG A;  2KDM A;  3MP9 A;  4KGT A;  4WH4 A;  2PLP A;  2LHD A;  1IBX B;  2IGG A;  1K50 A;  4IOI E;  2EEL A;  1GB4 A;  4GLS C;  1PGA A;  2ON8 A;  2K0P A;  4OZC A;  3UI3 A;  2IGD A;  5HI1 A;  2GB1 A;  2JWU A;  3FIL A;  3GB1 A;  1MPE A;  1Q10 A;  4HJG E;  4HKZ E;  1UWX A;  2LHE A;  1PGB A;  2ONQ A;  5BMG A;  1JML A;  2KN4 A;  2I2Y A;  5HHD G; 
#chains in the Genus database with same CATH topology
 3JYU A;  1TS4 A;  5FKA C;  4B9K A;  2JT4 B;  4WIP A;  2LUM A;  2PE6 B;  3B0A A;  3SFE B;  5IP4 D;  2K8H A;  4MDK E;  4WQM A;  2VRR B;  2MEK A;  1WGR A;  3A1Q A;  1R4M B;  1XCQ L;  3IHP C;  4EUT A;  3T3N A;  2WU2 B;  3RCZ A;  2KO3 A;  3P4S B;  1WJN A;  4B0E A;  4JPS A;  2EKI A;  2N9L A;  2KFJ A;  4MEL A;  1YOV B;  4NJ6 A;  3TMP B;  4DXF A;  2KQ7 A;  2HJ8 A;  3VUX A;  2LMC A;  1VLB A;  3HM6 X;  1ZOY B;  1WJU A;  1QF6 A;  3DCG A;  3UIO B;  3VHT C;  1HEZ E;  2FCS A;  4A3O A;  4LLG M;  1YNT E;  4NAW B;  2D10 A;  3P42 A;  4IG7 B;  2OED A;  4S17 A;  2QIL A;  1E6E B;  3ETR A;  2KC1 A;  3IXS A;  4K1R B;  2L76 A;  5HFY A;  4MM3 B;  2L32 A;  3NRZ A;  1DOX A;  1FCL A;  3RZW C;  1F77 A;  3I57 A;  2N7E A;  2WYQ A;  3PO0 A;  4AQ7 A;  3H7S A;  2WWZ A;  3PGE A;  3UIN B;  3R2T A;  1P98 A;  1MI0 A;  5D7G A;  1C78 A;  1F9J A;  1WMH A;  1N60 A;  2G4S A;  4ANX A;  2JVC A;  2Z0D B;  2ASQ A;  1IUE A;  3OJ3 A;  1ZE3 D;  2KVR A;  2C60 A;  1D5Z C;  2FUH B;  2DNF A;  2KNB A;  3NVW A;  1D5X C;  4KX6 B;  2BYE A;  2WDR B;  3EFU A;  3P63 A;  4WJQ A;  1GUA B;  3DQV A;  1KM7 A;  2L8J A;  3OAW A;  5LNK 1;  2JY6 A;  1P0R A;  2NVU I;  2M8S A;  1VCB A;  1L4D B;  1UBI A;  1MJD A;  2L05 A;  2KN4 A;  3GS2 A;  5BMG A;  3SFD B;  2GOW A;  3BYT B;  3EEC A;  2CU1 A;  3HM3 A;  2CHZ A;  2KFK B;  4WAA A;  3V3X A;  2N1V A;  2WLB A;  2UYZ B;  2WP9 B;  5JHB A;  4IW0 A;  3I5J C;  1HZ5 A;  1ZDX A;  3PHX B;  1WM2 A;  3MFG A;  3AEA B;  3H1U A;  2J53 A;  2WXM A;  1E7V A;  1GC6 A;  3ZXR A;  1N62 A;  2EMS A;  3VVW B;  3DVG X;  2Y5B B;  1K53 A;  1BUI C;  1CJE A;  4YSX B;  3H7P B;  5H92 C;  5J2R A;  3ZO5 B;  4TV3 A;  1ZGU B;  4JWS C;  3Q8B A;  2SEB D;  1FNU A;  2BS4 B;  3HUI A;  3AE2 B;  1JRP A;  1QOG A;  3CWI A;  3ZQ4 A;  3Q8E A;  3JSV A;  1QOA A;  2FCQ A;  5C3J B;  1JWA D;  4B0M A;  3KW5 B;  1VDV A;  1SGH A;  3PHW B;  1V49 A;  1Q1O A;  4HRS A;  2JRH A;  2D3A A;  3M63 B;  2V4L A;  1PDX A;  4KKI A;  4B6W A;  1RFK A;  3ML8 A;  2BT6 A;  5LXI B;  3DVN V;  1GAQ B;  4JQW C;  4DXG A;  1CQV A;  2KC2 A;  2J0J A;  5G5H A;  4O1N A;  1WX7 A;  4DHJ D;  5CX3 A;  3R8B A;  2N9E B;  3PT2 B;  2MX2 A;  2QDF A;  1JCK B;  3QK0 A;  2KX0 A;  2L52 A;  3KWV A;  3W1S A;  1NYR A;  2WX0 A;  4I6L B;  5AZG A;  4TQ1 A;  4LJP B;  4LNO A;  2N9K A;  2REX A;  4WQO B;  1Q0W B;  5DCN A;  5LLI A;  1P7E A;  4JLC A;  4DHZ B;  1PFD A;  4HLE A;  3WIM A;  2WXQ A;  2V9H A;  4NAW A;  4P16 A;  3ZGZ A;  5IKC M;  4DBG A;  1EWC A;  1DOI A;  1IPG A;  3TL5 A;  4MM3 A;  2KTR A;  3MC9 A;  2D3G A;  3MJ5 A;  3RI7 C;  3OWE B;  3OLM D;  4DQO C;  1VJK A;  3AE3 B;  2Z0E B;  3AEF B;  4P1C C;  1E8X A;  2LEK A;  1NBF C;  2JWZ A;  3ZTD A;  3IAM 1;  3FIL B;  2GI9 A;  3CMM B;  1UD7 A;  5BMI A;  4PS3 A;  2VZK B;  1JWU D;  3N30 A;  4GDK A;  3Q8A A;  5G5G A;  4RGN A;  1OQQ A;  4TMA B;  3N20 C;  2YEP F;  3ZUN A;  1R4N B;  2LXC A;  3AB5 A;  2W9N A;  4LTU A;  2HE7 A;  5BYS A;  1SE9 A;  3RNG C;  1L5P A;  1LXD A;  3MP9 A;  4CYE A;  4MGK E;  4EE2 A;  2QEJ C;  2K3U A;  2KHW B;  2KYW A;  3A4R A;  1ZPS A;  2AYO B;  3AXC A;  2ZNV B;  2INC C;  3R7Q A;  3AEG B;  2CS4 A;  3CF6 E;  3VDZ A;  3GP7 A;  4G3X B;  3QC8 B;  4YTN B;  1NYQ A;  4DHZ E;  4JE3 B;  3IG3 A;  1UZX B;  2NBU A;  4HPM B;  1TS3 A;  5BMH A;  1AN8 A;  3DBL I;  1GNU A;  1ZKH A;  2K1F A;  3DBR B;  2OOB B;  2FAZ A;  3AE5 B;  1YIW A;  2XK5 B;  2ZW1 A;  4JGH B;  1ISN A;  2KJ6 A;  3P4Q B;  2J0K A;  2BQQ A;  1RWS A;  2ZNV C;  1J19 A;  3L08 A;  2ZJD A;  4I6N B;  4CHK A;  4C7Y A;  4YTP B;  4TSS A;  1BML C;  2YLM A;  1JAL A;  2DBY A;  4GMV A;  3ONS A;  2AQ3 B;  4RFB A;  1BXT A;  3HVD A;  3FKY A;  2PW9 A;  4NPN A;  1LGR A;  1C76 A;  3UIP B;  2LUE A;  1S3S G;  2YEP B;  2KQS A;  4IKG A;  4IM3 A;  1WX8 A;  3A1Q B;  2HJ1 A;  1ET6 A;  4XZ4 A;  4ZRK A;  3SHQ A;  1R7S A;  1QIL A;  5GMV A;  3ABV B;  3RYT A;  2K0P A;  2DZJ A;  2MW5 A;  1XEE A;  1QQR A;  2L3Z A;  3HRD D;  1TTN A;  1I7H A;  1MPE A;  3L4P A;  3VXW A;  1WZ3 A;  3ALB A;  3C19 A;  2JRI B;  5H8Y E;  3B2F A;  2M0X A;  2IND C;  2NTT A;  2G45 B;  3PRM B;  1FXI A;  1P9D U;  4KKJ A;  2E3T A;  2I1K A;  2DWQ A;  2DAJ A;  4N59 A;  4JWU C;  2KMA A;  1UH6 A;  1WMH B;  2KK8 A;  1NEK B;  3S2A A;  4C56 C;  1L0X B;  3E9S A;  5J17 A;  1LFD A;  4IM2 A;  2BGF A;  1L7Y A;  3FC4 A;  3VR9 B;  2BKF A;  1NVI D;  4XWW A;  1SSN A;  3KH0 A;  2GBR A;  3QWZ B;  1HTO A;  1MG8 A;  1EUV B;  1EF1 A;  3Q6B A;  1X1M A;  4F1S A;  3L0W B;  1FO4 A;  1STE A;  3QHT A;  2MH7 A;  2KAN A;  4MEM A;  4WWP A;  2QCZ A;  2N9P C;  4MH0 E;  1TKE A;  1LO5 D;  2PIA A;  2MBH A;  2DHZ A;  2J42 A;  2D5G A;  2JZZ A;  2N0S B;  4FN2 A;  3N1Z C;  2PMV A;  2EMT A;  1EWY C;  2G4D B;  3P2B A;  1JWB D;  3ZJT A;  1WI0 A;  1P7F A;  3VRB B;  2KDM A;  4L23 A;  3QIJ A;  4A90 A;  1D3Z A;  4KGT A;  1F0Z A;  2OJW A;  2AL3 A;  2IGG A;  2KLC A;  2V3S A;  2KT7 A;  1C4A A;  1FM0 D;  1FXA A;  1YX5 B;  3APF A;  2DYM A;  1WRI A;  2IDY A;  4NAM A;  4LJO B;  2IGD A;  3RNE C;  4ASW C;  3ZNG C;  4GIV A;  4DHJ B;  5EE9 A;  4HJG E;  1AYF A;  1V97 A;  4HPP A;  3X0W A;  2BVC A;  2ZZP B;  3Q3J A;  3NVZ A;  2KQ4 X;  3RNB C;  2WXI A;  1L6V A;  3JSV B;  4JIO U;  3D32 A;  4KGR A;  1KRH A;  4HJK A;  2JYT A;  2CKH B;  3NG0 A;  5EE0 A;  3DVN U;  3N3K B;  3WAL A;  5TSS A;  4WWN A;  2KXJ A;  1SE2 A;  1L2N A;  2LRW A;  2DEN B;  1WGK A;  3W2D A;  2JYE A;  2V4I B;  1TY2 A;  1ZW7 A;  3ZW3 A;  2GLS A;  3N1Y C;  4A55 A;  3HHM A;  1ESF A;  1WGG A;  2KX3 A;  3P1M A;  2KN5 A;  2ZPN A;  4NJC A;  3RN9 C;  3AN1 A;  2R61 A;  4NNJ B;  4N9F 4;  2LGY A;  5CHV C;  2WS3 B;  1XLQ A;  2ZCB A;  2IPK D;  4BOZ B;  3V6C B;  5IN7 A;  1XLN A;  2RPQ A;  2N7J A;  2V0G A;  1WXS A;  3ZIM A;  3PSE B;  4L2Y A;  1FCC C;  5I4D A;  2R2O A;  1C4C A;  5IOI A;  4IWQ A;  3T9L A;  3AE9 B;  1K8R B;  2KOX A;  1UWM A;  2FE8 A;  5CHF A;  5C2T B;  4DK5 A;  2MP2 A;  2L00 B;  1PQS A;  4N58 A;  4WH4 A;  4ICV A;  1V1O A;  3SU8 X;  4ANW A;  3BZD B;  4E74 A;  4C7Z A;  3GZN I;  2KTR B;  3UQB A;  2MBQ A;  2AQ1 B;  1OQR A;  1RRB A;  4W9C A;  3PTF C;  4BKS A;  4K3B A;  1WR1 A;  3WAO A;  1S1Q B;  2LAS A;  4EEW A;  3LYY A;  3Q2A C;  1WF9 A;  4HKZ E;  1WX9 A;  3W1S C;  1UWX A;  3GE8 C;  1PGB A;  4KSK C;  3PLU A;  1KF6 B;  3JVZ X;  2MBO A;  1V1P A;  4ZRI A;  5D3D A;  3U4E G;  4GDK B;  1E7P B;  4YTM B;  2C7M B;  3BK1 A;  4MGY E;  4WJN A;  1E8W A;  1DYQ A;  1JW9 D;  1WRD B;  2LGS A;  1J7C A;  4M8N A;  5GXG B;  2G3Q B;  3BYY B;  1T0Q C;  4FJV B;  1WJ4 A;  2MBE A;  2HTH A;  1MHH E;  1BT0 A;  2RDG A;  1SJE D;  2IO3 B;  1Z2M A;  4WJO A;  4IC7 B;  4BKS D;  3QAQ A;  4EZK A;  2WXR A;  3IT6 B;  4ZDV A;  3ZXV A;  3MC0 B;  2WXJ A;  3TJP A;  4A9A A;  5FK9 C;  1KH0 A;  2M19 A;  4MAC A;  4EZL A;  2BW2 A;  3EUB 2;  1V80 A;  3KYC D;  2RD0 A;  4HRO A;  1YQ4 B;  2PVG C;  3Q8F A;  1ZXH A;  2JSV X;  2WXH A;  3AE6 B;  2IJ0 A;  3BWU D;  2PE9 A;  2WDT B;  4BOS C;  2O6V D;  1WWT A;  3AH7 A;  4PK1 A;  4KSL C;  2H89 B;  1PUT A;  5D6J B;  3IFW B;  2WNM A;  4W9L A;  2BB6 A;  3R3M A;  1GOZ A;  4II2 B;  4ZRP A;  4RGT A;  1VZ6 A;  2FCN A;  5DPW A;  5E6N A;  1YX6 B;  4P6V F;  2XNA C;  4AJW A;  1IYF A;  2V3P A;  1UGJ A;  4WJP A;  1Q10 A;  2CJN A;  4HDQ A;  1R4N I;  1TZO A;  3H8H A;  2DYO A;  4KDI C;  3P4P B;  3TUO A;  1NI2 A;  4Q2J A;  3B2G A;  4MJS B;  1KJT A;  3V05 A;  3QJZ A;  2AEH A;  2D11 A;  1GJZ A;  4HVB A;  1P1A A;  4FJZ A;  2X38 A;  3VUY A;  2K9X A;  2Q5W D;  5G2N A;  1OEY A;  5JZE B;  2A5U A;  3AM9 A;  2GBJ A;  2RGF A;  2VH1 A;  3PZD A;  4KGS A;  3NZ3 A;  3WAP A;  4W9F A;  4K81 A;  1V2Y A;  1T0Y A;  3N1X C;  3U7Z A;  1FPY A;  5BYQ A;  2BWE S;  5HG2 A;  2G1E A;  1FFU A;  1JRU A;  2MJD A;  1CK1 A;  2Y3A A;  1J0G A;  5E6P A;  4K3C A;  1I35 A;  1QT9 A;  2FNJ B;  2LXA A;  2WDQ B;  3VTU A;  3AV8 A;  4LNF A;  2WGS A;  3DHI C;  3QQ8 B;  3DBR I;  1ACC A;  3T3O A;  4KIK B;  1TY0 A;  3VRA B;  1XLO A;  1XLP A;  4OZA A;  1HZ6 A;  3M95 A;  1Q5W B;  4FHK A;  1YN4 A;  1YQ3 B;  3P4R B;  3NZS A;  2QSD A;  3KUD B;  2M0A A;  1UBQ A;  3VTV A;  4XGA B;  2WXL A;  5BYR A;  5E6O A;  2PKO A;  1WXM A;  1HTQ A;  2WXN A;  4P7I A;  1KLG D;  1UF0 A;  1KLU D;  1QZE A;  4GLS C;  1SE4 A;  4OZC A;  1T6B X;  1E9M A;  3NUH B;  1RLF A;  5DPR A;  4FLH A;  3VFK A;  5TR5 A;  2LVQ A;  3FAH A;  2MHJ A;  2MSE D;  3Q8C A;  3RPF C;  4RF1 A;  4NQL B;  1TS2 A;  1T5X D;  1AW7 A;  4FHJ A;  5JXV A;  2HD5 B;  1OGW A;  5G55 A;  2W54 A;  3BII D;  4W9K A;  2K8B A;  3EC8 A;  4OVU A;  1SB3 C;  1QOF A;  1J7B A;  4MGI E;  4TKN A;  2IBI B;  2XEW A;  1TJE A;  1N63 A;  4ZYN A;  3AEE B;  3VQI A;  2CU3 A;  1WXQ A;  4HCN B;  1C9F A;  4LCD E;  2W82 A;  3TEZ A;  4D2K A;  5IA7 A;  3RMK C;  2K25 A;  1NDD A;  3LXF A;  2WHI A;  1CZP A;  3V6E B;  5C1Z A;  4XDD A;  2K8C A;  1WY8 A;  4W9E A;  2MLB A;  2TSS A;  2I38 A;  1FMA D;  3DBH I;  3U30 A;  1G6J A;  2LFI A;  3L10 B;  1GG3 A;  5L95 C;  1FD6 A;  5L83 A;  3AE8 B;  1VZ7 A;  2J7Q B;  3ZDM C;  4XYC A;  1UGM A;  4BBN F;  1C3T A;  1E7U A;  3QCA A;  3ENE A;  4PYZ A;  2KWV B;  1IGC A;  4F7Z A;  3BK2 A;  2NCN A;  1TYG B;  5D2M B;  4ZOH C;  2KD0 A;  3Q3M C;  4MJS A;  2N9X A;  2LVO A;  2CJO A;  4JX1 C;  1MFW A;  3A9K A;  2KKC A;  3ML9 A;  2HDE A;  2ON8 A;  2Y5C A;  1UNS A;  2WXO A;  5HI1 A;  4AP4 C;  2JWU A;  2G9H D;  2K22 A;  3TCA A;  3T8M A;  3NVY A;  4DDG D;  4W9D A;  1XT9 B;  2C7N B;  1JML A;  1LM8 B;  4PS8 A;  1TS5 A;  1SJH D;  1EO6 A;  1T0S C;  2D2Q A;  3DHG C;  4K7W A;  3VH3 B;  5FR3 A;  3NY5 A;  2ZVO A;  1J7A A;  1D4B A;  3N9Y C;  3RT3 B;  2L7R A;  2C5L C;  3HK0 A;  4BKT A;  1C79 A;  1KTK A;  4MGZ E;  2QMT A;  2MP2 B;  4KIK A;  4LDT D;  3M3J A;  4KVG B;  1B9R A;  3PRZ A;  4YSY B;  4CQN A;  5HKH A;  1F1H A;  4TQ0 A;  3MJW A;  3NZU A;  2OHF A;  3OJ4 B;  1WGH A;  2FBW B;  2MBB B;  4WWM A;  3AUL A;  3V61 A;  4MH8 A;  3W5V B;  4A20 A;  1WYG A;  5AZF A;  2V3N A;  1Y56 A;  1WGD A;  1ET9 A;  4ANV A;  3MC8 A;  4HDO A;  2QHO A;  4C4V A;  3IAS 1;  1TGZ B;  2PVO D;  2BYV E;  2GBN A;  1V1P B;  3W1Y A;  1ZXI A;  2IGH A;  3AED B;  4W9H A;  2J52 A;  3ZKJ C;  3CST A;  4R3D A;  4UDU C;  2QC8 A;  2ZVN A;  1NI3 A;  2ACZ B;  1IBX B;  2NPT B;  3Q3O C;  1R4M I;  1I42 A;  1VD2 A;  2AWT A;  1HXY D;  3A9J A;  2KWU B;  1DOY A;  5KHQ A;  3ZNI D;  3L17 A;  2MCN B;  2N7D A;  1XO3 A;  4YWG G;  2DAF A;  1ZUD 2;  2IZV B;  1E0Z A;  4AWJ A;  1QLB B;  2NBV B;  4ITK A;  2WXK A;  1UUP A;  3QAR A;  4M0W A;  5HHD G;  4AOF A;  3AI5 A;  1H4R A;  2JZP A;  2K5P A;  3DWM A;  4BZA A;  3ZRF A;  4FBJ B;  4RF0 A;  4HCP B;  3NS1 A;  4FXC A;  1A70 A;  3CIR B;  4BBN C;  2W3S A;  2LGD A;  3ZLZ A;  2MJE A;  4OZB A;  1NEN B;  3C0R B;  4B95 A;  2YVC A;  2FCM A;  4HWI B;  4II3 B;  1H8C A;  5EE1 A;  2RDB C;  3Q3F A;  3AE4 B;  2PEA A;  2HTM E;  3HVZ A;  3ZTC A;  3M62 B;  3NJT A;  4E71 A;  3VR8 B;  4RGM A;  4HK2 A;  1SE3 A;  2KDI A;  4EZJ A;  1XXG A;  2N4F A;  1IP9 A;  3TEX A;  4GB9 A;  4KZC A;  2Y5P A;  2WXG A;  1TZ1 A;  5JHA A;  2WXP A;  5AUK A;  3NHE B;  1I4G A;  2K39 A;  3V60 A;  2CHX A;  2CHW A;  3ZJV A;  1OFF A;  3IT4 B;  3PPA A;  1WZ0 A;  1A5R A;  1EU3 A;  4ICU A;  4PYU A;  1I4R A;  4IM0 A;  4XC2 A;  2NTS A;  2W55 A;  3IBE A;  1ENF A;  2K6Q A;  2ZCC A;  4ZRQ A;  1VRA B;  3R2I A;  2FIF A;  3TEW A;  1N5X A;  4W9J A;  2ZEQ A;  2M56 B;  4BAX A;  4YT0 B;  4K7U A;  2BYF A;  1VR9 A;  1WE6 A;  2MA9 B;  2J4X A;  4DXA B;  2JPH A;  2DZK A;  3GB1 A;  1JQ4 A;  1M4V A;  1SIF A;  4J3O D;  1ZDV A;  2ONQ A;  3KUZ A;  4IDI A;  2KJH B;  4W9G A;  5KHO A;  2RSU A;  1RM6 C;  3J9C A;  1WIA A;  1T0R C;  1KLV A;  1I4P A;  2DLB A;  4CO7 A;  1P3Q U;  2E6X A;  1F2R C;  2MQJ A;  4LNK A;  5D3I B;  1E8Z A;  1V9J A;  3K9P B;  4I6P A;  3VTW A;  5JH5 C;  3I63 C;  1WM3 A;  4L1B A;  1UEL A;  4M00 A;  3RNA C;  3AEB B;  3EA6 A;  3Q14 C;  4XE0 A;  2M17 A;  2BB5 A;  1K52 A;  3N32 A;  1JWS D;  3I3T B;  3ZRC A;  1N5W A;  4TUU A;  2JZ3 B;  2KWD A;  1L4Z B;  1TKY A;  2INN E;  1IBX A;  2NPT A;  4GSW A;  1L0Y B;  3DVG Y;  1YJ1 A;  4YL8 A;  2O6V A;  2M4N A;  3X23 A;  3ZJU A;  2ZW0 A;  3U52 E;  3BVZ A;  4GDL A;  3DOW A;  4US8 A;  1FFV A;  2L0F A;  4HXD A;  3SD5 A;  1SIJ A;  2BS2 B;  4BVU C;  1N61 A;  3NVV A;  4H2A A;  5J18 A;  1YN5 A;  3VAW A;  4J6I A;  1GPX A;  2AX5 A;  1ROE A;  2PJH A;  4EFO A;  2EKE C;  2PLP A;  2LHD A;  3B1L X;  2IY1 B;  3MHZ A;  1GC7 A;  1K50 A;  1LQB A;  2FUG 1;  3KYD D;  3W5U B;  4ZHO A;  2O2V A;  1M94 A;  2GB1 A;  2BKR B;  2WU5 B;  5EDS A;  2KTF A;  2BPS A;  3KQ4 A;  2KWC A;  2V1Y A;  2D3C A;  4FA6 A;  4FAD A;  3R66 C;  3LDZ E;  3TEY A;  2NR2 A;  2BS3 B;  1XF5 L;  2R2Q A;  1Y8R C;  2JF5 A;  2ZPY A;  4NJ7 A;  1WH3 A;  1CMX B;  2IO1 B;  2LGI A;  1E10 A;  2H88 B;  3E56 A;  3PLV A;  4ANU A;  1YMH E;  4GOC A;  3DWG C;  1WR6 E;  2C7H A;  4AUQ C;  2PTL A;  4MT5 A;  1TBE A;  3GZN B;  4DDI D;  2NMQ A;  2RDH A;  4S0R A;  4YXD B;  3MTN B;  1QKZ A;  1JRO A;  2JU6 X;  1SXT A;  1V5O A;  2L83 A;  1E90 A;  4N6E B;  3A9K B;  2FID A;  4LDT B;  2LWP A;  1TKG A;  2DZI A;  4RH6 A;  1F52 A;  2OJR A;  2JXT A;  4G0N B;  2RPV A;  2KJR A;  2UU7 A;  1EU4 A;  2PPH A;  1C77 A;  3VH4 B;  4GN1 A;  2XN9 C;  4G11 A;  3TBL D;  2D3B A;  1TIF A;  3UQA A;  2DZM A;  2LJI A;  2BF8 B;  3OG5 A;  1YJI A;  2IO2 B;  5CTR C;  4RGO S;  5IO9 A;  3WCQ A;  4IUM B;  4ACF A;  3KLS X;  4BKG A;  4G50 A;  1E8Y A;  4A8X C;  1V86 A;  2A4Z A;  2BWF A;  4NQK E;  2LVP A;  3L54 A;  2LRU A;  3RUL A;  1WSP A;  3A33 B;  2EEL A;  2VH2 A;  4M8M A;  3AU5 A;  1J8C A;  1OEY J;  3Q69 A;  3AU4 A;  4XX5 A;  1HQR D;  1E5W A;  1XD3 B;  2KZR A;  3DBS A;  4HEA 1;  4US9 A;  2UWQ A;  4M01 A;  1WGY A;  3AEC B;  2QJL A;  4C4V B;  4LK0 M;  3ZNH B;  4HPL B;  3GOE A;  3AMZ A;  1I4Q A;  3K9O B;  3QA8 A;  1SBB B;  2IY0 B;  1GB1 A;  4PS7 A;  5AZH A;  5AEK B;  3PVL A;  2KAJ A;  2Z59 B;  2WQY B;  1V81 A;  4XWT A;  1HE8 A;  3RD2 A;  4PT5 A;  3TIX A;  1WXV A;  2LZ6 A;  1V8C A;  3H9D A;  4GU2 A;  2W3R A;  3A9J B;  1PGX A;  4OHJ A;  1SF0 A;  4AS1 A;  4WUR A;  1U4A A;  3NOB A;  4ZHP A;  1D6E C;  3Q3N C;  2KDF B;  1MG4 A;  3ZYY X;  1L0V B;  2I1J A;  3APD A;  4A6Q A;  2GBM A;  2QIE B;  2BBC A;  4M0W B;  1ZP0 B;  4OW0 A;  2KFK A;  3ZVV A;  4GGQ A;  3AE7 B;  4KDL B;  2B76 B;  4ARC A;  4OVZ A;  3PRE A;  1RFA A;  4IWP A;  4BFR A;  5EE3 A;  1N6Z A;  4KZ0 A;  1I4X A;  3I9V 1;  3WAM A;  3GE3 C;  4GXB A;  3KUC B;  3H6N A;  2N1W A;  4ZRJ A;  1PYW D;  1GB4 A;  4KV2 A;  4XDC A;  3H7P A;  4USA A;  1AAR A;  4HKQ A;  2GBK A;  1FEH A;  2LGX A;  2WDV B;  2M1M A;  5FR6 A;  3LB8 C;  1YJJ A;  2WX1 A;  4A3P A;  3MHS D;  1V6E A;  2CR5 A;  3PV1 A;  2JX5 A;  3APC A;  5LXH A;  2I2Y A;  2LI5 A;  4WAF A;  2JUO A;  1EM7 A;  5CHW A;  3B08 A;  1FNV A;  2ICI A;  3BVM A;  2BTE A;  3V62 A;  1XCT L;  4C80 A;  1SEB D;  4RMA A;  2B3A A;  4NY0 A;  2GRI A;  1IGD A;  4OVV A;  3LJ3 A;  2KLG A;  1FRR A;  3SDL C;  3QX1 A;  2LJ5 A;  3L16 A;  1T3Q A;  4AJY B;  4C00 A;  3RZF A;  2MRP A;  2JQR B;  3U8Z A;  2X8X X;  4RM8 A;  2AL6 A;  4ARI A;  3PZ7 A;  4ZYS A;  3DPD A;  4IWO A;  1FRD A;  2RMM A;  1QOB A;  2SAK A;  2MJ3 A;  4MSM B;  1YD8 U;  3TSS A;  1L6U A;  1EF5 A;  2C9W B;  3PS6 A;  4LNN A;  2KMC A;  4M02 A;  2KMM A;  1WFY A;  2KDB A;  2L1A A;  4QAY A;  3HIZ A;  3SEB A;  4FUL A;  3U2S C;  3WAN A;  1XQQ A;  4E3C A;  2KDE B;  4EOY A;  2RR9 A;  2GMI C;  3DBL B;  2IO0 B;  1WJ6 A;  3RNC C;  2J0M A;  4MSQ B;  1PGA A;  4RM9 A;  2NS5 A;  3DHH C;  4RCO A;  2DYB A;  3RFZ B;  3B9J A;  1VZ8 A;  3FIL A;  3DBH B;  3JW0 X;  2MWS B;  3A4S C;  3NS8 A;  4P1B C;  1C4P A;  5MPO A;  2LHE A;  1D5M C;  1TT5 B;  3KWL A;  3CSF A;  1C1Y B;  1DGJ A;  3R7R A;  3L13 A;  2DX5 B;  1JWM D;  1WXA A;  3ECI A;  4FJY A;  3RNF C;  2O6V B;  1RAX A;  1F2R I;  1MHX A;  4GDL B;  2KAC A;  4K7S A;  4REZ A;  4LNI A;  4WWO A;  1V5T A;  3W9C B;  2JXX A;  1K51 A;  1MVK A;  4F8C B;  3VUW A;  4W9I A;  3BVG A;  4X57 B;  3KVF B;  2INP E;  1HA5 A;  1Z5S B;  3EGR A;  1OTR B;  1WE7 A;  4URK A;  5E6J A;  3C8Y A;  2IYD B;  2NBW B;  2Z8L A;  2O2V B;  2VZK D;  3EHV A;  3ZDT A;  3ZNZ B;  1YQB A;  1B1Z A;  3O13 A;  2LD9 A;  3PZ8 A;  4JL9 A;  1FNW A;  4YSZ B;  2KVZ A;  3O65 B;  3EFC A;  1I4H A;  5T8I A;  5BO4 B;  3URY A;  1RYJ A;  4RNA A;  4NZL B;  1WYW B;  5D94 A;  2XK5 A;  3U7D A;  3IVF A;  1KOT A;  1YN3 A;  1FIQ A;  3BY4 B;  1OQY A;  5DPT A;  4DWF A;  3AE1 B;  5DPS A;  5IAA C;  2BYT A;  5AUI A;  2L0T A;  4IOI E;  3WA0 A;  2WXF A;  4EKU A;  5C23 A;  3UGB B;  3UF8 A;  3UI3 A;  3DDC B;  2XBB C;  2AQ2 B;  3SR6 A;  2D07 B;  2K6D B;  3BIN A;  3RUI B;  3PRP B;  1FXT B;  1AWD A;  1KFY B; 
#chains in the Genus database with same CATH homology
 4RF1 A;  1TS4 A;  5FKA C;  2BS3 B;  1TS2 A;  1XF5 L;  5H8Y E;  3B2F A;  1T5X D;  1AW7 A;  4WIP A;  2LUM A;  5JXV A;  2NTT A;  2LGI A;  1E10 A;  2H88 B;  1FXI A;  3E56 A;  4KKJ A;  3SFE B;  1YMH E;  2E3T A;  4WQM A;  2MEK A;  2W54 A;  3DWG C;  3BII D;  2DWQ A;  2PTL A;  4N59 A;  4MT5 A;  1SB3 C;  1XCQ L;  3T3N A;  4JWU C;  1QOF A;  2WU2 B;  1J7B A;  3P4S B;  1NEK B;  4B0E A;  4JPS A;  4C56 C;  2NMQ A;  1L0X B;  2EKI A;  2N9L A;  2RDH A;  3E9S A;  4YXD B;  1TJE A;  1N63 A;  3VQI A;  1QKZ A;  3AEE B;  1JRO A;  3FC4 A;  4DXF A;  3VR9 B;  2JU6 X;  2CU3 A;  1SXT A;  1WXQ A;  2L83 A;  1C9F A;  4N6E B;  1NVI D;  2LMC A;  2W82 A;  4XWW A;  3TEZ A;  4D2K A;  1SSN A;  1VLB A;  1TKG A;  4RH6 A;  2JXT A;  1ZOY B;  3LXF A;  1CZP A;  1QF6 A;  2RPV A;  4XDD A;  1HEZ E;  1EU4 A;  1FO4 A;  2TSS A;  1STE A;  1C77 A;  2I38 A;  4LLG M;  1YNT E;  2MH7 A;  2XN9 C;  4NAW B;  1FMA D;  3P42 A;  2OED A;  1TKE A;  2LFI A;  1E6E B;  2QIL A;  1LO5 D;  3ETR A;  2PIA A;  3IXS A;  1FD6 A;  2J42 A;  2LJI A;  5HFY A;  2D5G A;  2L32 A;  3AE8 B;  4MM3 B;  3NRZ A;  1DOX A;  1VZ7 A;  1FCL A;  1YJI A;  2N0S B;  1F77 A;  4RGO S;  3WCQ A;  3I57 A;  3PO0 A;  2PMV A;  4AQ7 A;  1EWY C;  1IGC A;  3R2T A;  3BK2 A;  3KLS X;  1JWB D;  1MI0 A;  5D7G A;  3ZJT A;  1P7F A;  4A8X C;  1TYG B;  3VRB B;  2KDM A;  1C78 A;  4L23 A;  1N60 A;  4ZOH C;  4A90 A;  4KGT A;  1F0Z A;  1WSP A;  1IUE A;  1ZE3 D;  2IGG A;  2CJO A;  2EEL A;  1D5Z C;  4JX1 C;  1C4A A;  1FM0 D;  1FXA A;  2HDE A;  2DYM A;  1WRI A;  2IDY A;  2ON8 A;  3NVW A;  3Q69 A;  1D5X C;  4KX6 B;  4NAM A;  2Y5C A;  1UNS A;  2WDR B;  2IGD A;  2WXO A;  3P63 A;  5HI1 A;  2JWU A;  1HQR D;  2G9H D;  2K22 A;  3NVY A;  5LNK 1;  5EE9 A;  4HJG E;  1AYF A;  1V97 A;  4HEA 1;  4US9 A;  1L4D B;  5BMG A;  1JML A;  2KN4 A;  3GS2 A;  3SFD B;  1TS5 A;  1SJH D;  3AEC B;  3NVZ A;  3BYT B;  2QJL A;  2KQ4 X;  2WXI A;  1L6V A;  4LK0 M;  4KGR A;  3AMZ A;  1KRH A;  5FR3 A;  1J7A A;  1I4Q A;  3V3X A;  1D4B A;  1SBB B;  3N9Y C;  2JYT A;  2WLB A;  1GB1 A;  1C79 A;  2WP9 B;  1KTK A;  5EE0 A;  2KAJ A;  1HZ5 A;  1ZDX A;  5TSS A;  2QMT A;  2WQY B;  3MFG A;  4XWT A;  3AEA B;  1B9R A;  1SE2 A;  4YSY B;  4CQN A;  4PT5 A;  2J53 A;  4TQ0 A;  2WXM A;  1WGK A;  3W2D A;  2JYE A;  1N62 A;  1V8C A;  2V4I B;  2OHF A;  1K53 A;  1TY2 A;  1BUI C;  1CJE A;  2W3R A;  4YSX B;  2FBW B;  4WWM A;  4A55 A;  1ESF A;  1PGX A;  4OHJ A;  5H92 C;  4MH8 A;  3P1M A;  1SF0 A;  3W5V B;  4AS1 A;  4WUR A;  1WYG A;  4ZHP A;  4JWS C;  1D6E C;  4NJC A;  3AN1 A;  3Q8B A;  2R61 A;  3ZYY X;  1L0V B;  2SEB D;  1FNU A;  1Y56 A;  2BS4 B;  2V3N A;  4A6Q A;  2WS3 B;  3HUI A;  1ET9 A;  1XLQ A;  2IPK D;  3AE2 B;  1JRP A;  1QOG A;  2QIE B;  3CWI A;  3ZQ4 A;  2BBC A;  3Q8E A;  1XLN A;  1ZP0 B;  4OW0 A;  2N7J A;  1QOA A;  2V0G A;  5C3J B;  3IAS 1;  1JWA D;  4B0M A;  4L2Y A;  2PVO D;  3AE7 B;  1VDV A;  1V1P B;  1FCC C;  2B76 B;  5I4D A;  4ARC A;  4OVZ A;  1ZXI A;  2IGH A;  1C4C A;  4HRS A;  3AED B;  3AE9 B;  2J52 A;  5EE3 A;  1UWM A;  2FE8 A;  5C2T B;  1PDX A;  4KKI A;  4N58 A;  4R3D A;  4UDU C;  1RFK A;  4WH4 A;  1I4X A;  3I9V 1;  2BT6 A;  1V1O A;  1NI3 A;  2ACZ B;  1IBX B;  1GAQ B;  4DXG A;  1CQV A;  3BZD B;  5G5H A;  1PYW D;  4O1N A;  4C7Z A;  1GB4 A;  1HXY D;  4XDC A;  3R8B A;  4USA A;  1DOY A;  4HKQ A;  2AQ1 B;  1OQR A;  1FEH A;  2WDV B;  3LB8 C;  1YJJ A;  1XO3 A;  3LYY A;  4YWG G;  1ZUD 2;  1JCK B;  1E0Z A;  4HKZ E;  1UWX A;  2JX5 A;  2L52 A;  1PGB A;  3KWV A;  3W1S A;  1QLB B;  2I2Y A;  4WAF A;  4ITK A;  1NYR A;  2WXK A;  1UUP A;  4M0W A;  4TQ1 A;  5HHD G;  2N9K A;  1EM7 A;  2JZP A;  1KF6 B;  2K5P A;  1V1P A;  3DWM A;  5D3D A;  4RF0 A;  3U4E G;  3NS1 A;  4GDK B;  3BVM A;  1FNV A;  1E7P B;  2ICI A;  1A70 A;  3CIR B;  4FXC A;  4YTM B;  2W3S A;  1XCT L;  4C80 A;  1P7E A;  3BK1 A;  2MJE A;  1DYQ A;  1PFD A;  1SEB D;  4OZB A;  1JW9 D;  5GXG B;  1J7C A;  1NEN B;  2GRI A;  1IGD A;  2WXQ A;  3BYY B;  1FRR A;  4P16 A;  3ZGZ A;  5EE1 A;  2BTE A;  3AE4 B;  1T3Q A;  2HTM E;  1EWC A;  3HVZ A;  1DOI A;  1MHH E;  2JQR B;  2RDG A;  1SJE D;  3VR8 B;  4RGM A;  3MJ5 A;  3OWE B;  4ARI A;  2WXR A;  1SE3 A;  3PZ7 A;  4ZYS A;  1XXG A;  3TEX A;  4DQO C;  1VJK A;  3AE3 B;  1FRD A;  2RMM A;  1QOB A;  2Y5P A;  2SAK A;  2WXG A;  3AEF B;  2LEK A;  3IT6 B;  2MJ3 A;  3MC0 B;  2WXJ A;  3IAM 1;  4A9A A;  3FIL B;  5FK9 C;  2WXP A;  1KH0 A;  3TSS A;  2M19 A;  4MAC A;  2GI9 A;  5BMI A;  5AUK A;  1L6U A;  2BW2 A;  2VZK B;  3EUB 2;  1I4G A;  4HRO A;  1YQ4 B;  1JWU D;  2PVG C;  3Q8F A;  1ZXH A;  2JSV X;  2WXH A;  2KMM A;  3AE6 B;  3Q8A A;  2IJ0 A;  5G5G A;  3ZJV A;  4RGN A;  1OFF A;  3BWU D;  3IT4 B;  1OQQ A;  1EU3 A;  4TMA B;  2L1A A;  2YEP F;  3SEB A;  1I4R A;  3AB5 A;  2NTS A;  4LTU A;  2W55 A;  3U2S C;  5BYS A;  1ENF A;  1WWT A;  1L5P A;  3AH7 A;  3MP9 A;  4ZRQ A;  2H89 B;  1VRA B;  3R2I A;  1PUT A;  2WNM A;  3TEW A;  1N5X A;  2BB6 A;  1GOZ A;  4ZRP A;  4EE2 A;  2QEJ C;  2K3U A;  2M56 B;  4RGT A;  1PGA A;  1VZ6 A;  4YT0 B;  4P6V F;  1ZPS A;  2XNA C;  4RCO A;  3RFZ B;  3B9J A;  1VR9 A;  1VZ8 A;  2V3P A;  2J4X A;  1UGJ A;  3FIL A;  3GB1 A;  1JQ4 A;  1Q10 A;  3AEG B;  1M4V A;  3GP7 A;  1C4P A;  4J3O D;  5MPO A;  1ZDV A;  2CJN A;  2LHE A;  1D5M C;  3KWL A;  2ONQ A;  1DGJ A;  4IDI A;  1TZO A;  3H8H A;  1JWM D;  4YTN B;  2DYO A;  1NYQ A;  3P4P B;  3TUO A;  4JE3 B;  4Q2J A;  3B2G A;  3V05 A;  1F2R I;  1TS3 A;  1MHX A;  5BMH A;  1RM6 C;  1AN8 A;  3J9C A;  2KAC A;  4GDL B;  1I4P A;  2X38 A;  4REZ A;  2DLB A;  3W9C B;  2K9X A;  2Q5W D;  1K51 A;  1MVK A;  2E6X A;  3AM9 A;  1F2R C;  4KGS A;  3BVG A;  3AE5 B;  3NZ3 A;  5D3I B;  2ZW1 A;  2INP E;  3U7Z A;  5BYQ A;  1HA5 A;  4L1B A;  5HG2 A;  3EGR A;  3P4Q B;  2G1E A;  1RWS A;  3AEB B;  1FFU A;  3EA6 A;  2MJD A;  1CK1 A;  4XE0 A;  5E6J A;  2Y3A A;  3C8Y A;  2BB5 A;  1K52 A;  2Z8L A;  1QT9 A;  1JWS D;  2WDQ B;  2VZK D;  4C7Y A;  1N5W A;  4YTP B;  4TSS A;  2KWD A;  1BML C;  1L4Z B;  1TKY A;  3AV8 A;  1JAL A;  1B1Z A;  2DBY A;  2INN E;  1IBX A;  3O13 A;  1ACC A;  1L0Y B;  3T3O A;  1TY0 A;  3PZ8 A;  1FNW A;  3VRA B;  2AQ3 B;  1XLO A;  1XLP A;  3ZJU A;  2ZW0 A;  4OZA A;  1BXT A;  1HZ6 A;  3HVD A;  4RFB A;  3U52 E;  3BVZ A;  4YSZ B;  5T8I A;  1I4H A;  4US8 A;  1YN4 A;  1FFV A;  1YQ3 B;  3P4R B;  1SIJ A;  2PW9 A;  2BS2 B;  1RYJ A;  1N61 A;  2QSD A;  2M0A A;  4RNA A;  3URY A;  4NZL B;  3NVV A;  4H2A A;  1C76 A;  2YEP B;  1YN5 A;  4IKG A;  2WXL A;  5BYR A;  1YN3 A;  2PKO A;  1FIQ A;  2WXN A;  1GPX A;  1KLG D;  2AX5 A;  1ROE A;  3AE1 B;  1ET6 A;  2PLP A;  2BYT A;  5AUI A;  2LHD A;  3MHZ A;  1K50 A;  1R7S A;  4IOI E;  2WXF A;  1KLU D;  1QIL A;  2FUG 1;  3W5U B;  3ABV B;  4GLS C;  4ZHO A;  2K0P A;  1SE4 A;  4OZC A;  1T6B X;  3UI3 A;  1E9M A;  3NUH B;  1XEE A;  2GB1 A;  2WU5 B;  1QQR A;  2AQ2 B;  3SR6 A;  3HRD D;  1I7H A;  1MPE A;  3KQ4 A;  3FAH A;  3L4P A;  1AWD A;  1KFY B;  3Q8C A;  3TEY A;  3RPF C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...