1YMHE

Anti-hcv fab 19d9d6 complexed with protein l (ppl) mutant a66w
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
KEEVTIKVNLIFADGKIQTAEFKGTFEEATAEAYRYADLLAKVNGEYTWDLEDGGNHMNIKFAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 16D9D6, light chain
publication title Comparison of the crystallization and crystal packing of two Fab single-site mutant protein L complexes.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
total genus 15
structure length 65
sequence length 65
chains with identical sequence F
ec nomenclature
pdb deposition date 2005-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ymhE00
1IBXA 1ZXHA 1FD6A 5BMIA 1MHXA 2J52A 2ZW0A 2LGIA 1YMHE 2PLPA 1HEZE 5HHDG 2JZPA 5JXVA 2OEDA 2ZW1A 4IOIE 2GB1A 1PGAA 2I38A 4D2KA 5BMHA 1EM7A 2IGHA 2RPVA 4HKZE 1YNTE 2I2YA 3MP9A 1IGCA 1QKZA 2JU6X 2PTLA 1XCTL 1PGBA 3V3XA 4HJGE 4KGSA 1P7FA 3GB1A 3FILB 1K52A 1FCLA 2RMMA 1UWXA 2N9KA 4WH4A 2N7JA 2LHDA 2LUMA 2ONQA 2QSDA 5HFYA 1K51A 2K0PA 3UI3A 5BMGA 1K53A 4GLSC 1GB1A 1D4BA 1FCCC 1F2RI 4OZAA 3FILA 5HI1A 2QMTA 2KQ4X 2IGGA 4KGRA 1XF5L 2KN4A 1GB4A 2NMQA 2JXTA 1IGDA 2PW9A 4IKGA 2KACA 1HZ5A 1HZ6A 2LHEA 1C9FA 2KWDA 1P7EA 1Q10A 2JSVX 1PGXA 2KDMA 4OZCA 5HG2A 1XCQL 2GI9A 4OZBA 1MVKA 2IGDA 1IBXB 1MHHE 1F2RC 2J53A 4KGTA 1MI0A 2EELA 1KH0A 2JWUA 2N9LA 4MACA 1K50A 1MPEA 2ON8A 1JMLA
chains in the Genus database with same CATH superfamily
3PSEB 2AQ3B 3UINB 3VTWA 4MT5A 4XDDA 2OOBB 1QOFA 2K8BA 2KN5A 1UF0A 2CJNA 2DAJA 2JPHA 4ZHOA 3DBLB 4DHZE 1L0VB 1WJ6A 3RNBC 1G6JA 4GDLB 4D2KA 1FM0D 1L2NA 4BZAA 3APFA 4WJNA 4KV2A 4MEMA 5GMVA 4WWMA 4BVUC 1J8CA 1ISNA 2JF5A 1WXVA 1QOBA 3AEDB 2VH2A 3R8BA 4HCPB 2Q5WD 1V5TA 3EGRA 2LHDA 4EEWA 1SIFA 1GB1A 2N7DA 4M0WA 5AZGA 1WJ4A 5LNK1 2IO3B 4A8XC 1XLPA 1H4RA 1MG4A 3V60A 5G5HA 1AARA 4KGRA 4A9AA 2B3AA 2O2VB 2O6VB 1D5ZC 1IGDA 2RDGA 4P6VF 1HZ6A 2D2QA 5DPWA 1JQ4A 5HG2A 2AEHA 1WFYA 4OVZA 1UGJA 2FCQA 1HQRD 1CJEA 3RT3B 4RMAA 1V97A 3QA8A 4KGTA 2LGSA 2GBRA 2PE6B 2D11A 2W3SA 3ZXVA 1H8CA 1YJJA 2INPE 3KUCB 3R2IA 2N9LA 1KLUD 4PT5A 3DVGY 2BTEA 2ON8A 3PREA 2AL3A 3AE4B 2WXIA 1TKEA 2LGXA 1ZDXA 3WAPA 5BMIA 1FFVA 2XEWA 3AE8B 2NR2A 3HK0A 3LXFA 1HEZE 2CU1A 4MGKE 4ANWA 2ACZB 2JZPA 4P7IA 2PMVA 1L0XB 4ZRIA 3QARA 4B0EA 2DYOA 2KTRB 2JY6A 3EA6A 2KJHB 4HKZE 3NS1A 2HJ1A 4LNNA 1ACCA 1LQBA 4BKSD 5LXHA 1N63A 4HWIB 4JIOU 1ENFA 4W9DA 2JX5A 3L4PA 1EF5A 2KHWB 3SR6A 2GBKA 1QZEA 2K0PA 2X38A 1R7SA 3S2AA 1K53A 1AN8A 1JCKB 2ZVNA 1AWDA 2WYQA 3Q8BA 4KKJA 4YTPB 3RD2A 2DYMA 2XK5B 1WY8A 3ZNGC 4DHJB 2FUG1 4LLGM 4DHZB 5E6OA 2LI5A 3BYYB 4ITKA 2DBYA 2QC8A 1B1ZA 4RGNA 1OEYA 2KVRA 3JVZX 2JSVX 4A3OA 4NNJB 2AYOB 1XCQL 4E74A 3IG3A 3FAHA 2MEKA 4GSWA 3BYTB 3ZJUA 3CIRB 3RNCC 4PYUA 3EHVA 3H1UA 1Z2MA 4OHJA 4AUQC 2JWUA 1T0YA 4MJSA 1C4CA 1P1AA 1YN4A 5L95C 1V5OA 1VLBA 2NTSA 3RYTA 4J6IA 2LWPA 1L5PA 3TMPB 1IBXA 4GU2A 1N62A 5AEKB 1TY0A 1WMHA 1OQRA 2BPSA 3OWEB 3N30A 5H8YE 3TEYA 4LCDE 2LASA 5LLIA 3W1YA 2FIDA 1WWTA 1WGGA 3WALA 1VRAB 5KHQA 1WXSA 2WDTB 1S3SG 4ICVA 4BBNC 3U4EG 3K9OB 2KWVB 3L16A 1WRIA 2PTLA 1GOZA 3VUYA 5IO9A 1FPYA 2WDQB 4L23A 4NJ7A 3FILB 3DVNV 4ZHPA 1TZOA 2ZZPB 5L83A 1PYWD 2KC2A 2N7JA 3MC0B 3SDLC 2WHIA 2WNMA 3A9KA 4FULA 1QLBB 3QJZA 3ZQ4A 3H9DA 4II3B 3HM3A 2L7RA 1CQVA 2K22A 3ONSA 5MPOA 3NVVA 2QMTA 1OQYA 2IGGA 4URKA 3R7QA 2WDRB 4WWOA 2MBBB 2KN4A 2QILA 2Z0EB 1GB4A 5EE0A 2LVOA 5G2NA 2J0MA 3VXWA 4WAAA 3HRDD 1HZ5A 4KKIA 1UBIA 2ZJDA 2KDMA 3PT2B 4N9F4 3AN1A 2GI9A 4LJOB 3WCQA 2DNFA 3ZKJC 4TKNA 3PV1A 4IM2A 1T3QA 3VUXA 4NJ6A 1JWUD 1WR1A 3OJ4B 2J0KA 4RGTA 5D7GA 5GXGB 4LDTB 3VR9B 4M8NA 1TYGB 1FD6A 1EWYC 1GC7A 3FC4A 4YTMB 4RF1A 1FEHA 2DHZA 4EOYA 5JXVA 2PE9A 3AH7A 5CTRC 2NVUI 1WXMA 4RNAA 2BS3B 4FN2A 3MJ5A 3WIMA 1E7VA 1DOIA 5H92C 2WXFA 3TIXA 1TGZB 2JYEA 2M0AA 1UD7A 2N9XA 4XZ4A 2BBCA 4AJWA 1YN3A 2JVCA 3MHZA 2C5LC 3A33B 5DPRA 1SGHA 4P1BC 4RF0A 1BXTA 4BKGA 2LVPA 3U7DA 3NG0A 2JQRB 1I4GA 2L00B 4B95A 2KFKB 1UZXB 3ZNZB 2KTFA 3B2GA 2BF8B 1WJUA 4MGIE 1N61A 3FKYA 2N7EA 2JXTA 1I7HA 1J0GA 2V9HA 5EE9A 4HDQA 2KACA 4I6PA 4YL8A 1UWMA 2PVOD 1YQ4B 3QQ8B 3GOEA 3JSVB 4XX5A 1KLVA 2IGDA 1WXQA 2LJ5A 4TV3A 4F1SA 4PK1A 2L52A 3SHQA 3IFWB 2MJEA 4ARCA 1FIQA 3VR8B 3DOWA 1R4MI 2ZCBA 2KANA 4HPLB 2CS4A 3E56A 5C2TB 1WX8A 4ASWC 2GMIC 3PLUA 3AV8A 5E6JA 2KFKA 4K1RB 2INNE 5CX3A 2Z8LA 3QHTA 2L76A 3R3MA 3R66C 4FHJA 4KVGB 2LGIA 1XO3A 2IBIB 1GG3A 3PS6A 2LXCA 4HK2A 2RSUA 1ZP0B 2WXOA 2I38A 1V8CA 3BWUD 3EFUA 4HPMB 2CHZA 3MC8A 3OG5A 5IP4D 3KLSX 5KHOA 1WE7A 2G4SA 3VUWA 4L2YA 2IPKD 1YNTE 3B1LX 3T9LA 1IYFA 3BY4B 3AM9A 2HD5B 1LGRA 1TBEA 2NPTA 1M4VA 2V4IB 3WANA 3DHGC 2DZIA 3RMKC 1PDXA 2N1WA 3QX1A 4YT0B 4MSQB 3RNGC 2WWZA 4C7YA 1RFKA 2G45B 1EWCA 2D3CA 3KUDB 4AWJA 1TS5A 1SEBD 4IG7B 3RI7C 2NBUA 4WURA 3U52E 2R2QA 2QJLA 4HXDA 2LVQA 3KW5B 4EE2A 1ZXIA 2LHEA 2AL6A 2UWQA 2WXNA 2TSSA 1VD2A 3AE9B 3TL5A 1DOXA 3HM6X 4DBGA 2MHJA 1Y56A 2MSED 4C4VB 3DVGX 1SE4A 3SU8X 3J9CA 1GAQB 1XD3B 3PO0A 3ML9A 5EE3A 4CQNA 3AEFB 2KAJA 3AB5A 1ZXHA 2CHWA 3R2TA 2WP9B 2JT4B 4GMVA 5E6NA 2OJWA 3N3KB 1WYWB 4ZYSA 3X0WA 3ZDMC 2MH7A 5AZFA 4LNFA 1PGAA 3L13A 1EF1A 1TTNA 5D3IB 2Y5BB 1S1QB 3P2BA 1EM7A 1RAXA 4IM3A 3PZ7A 4MH0E 4JE3B 3KYCD 3H7PA 1EU3A 4R3DA 2L83A 4GOCA 4M0WB 4N58A 4BBNF 4C4VA 2DLBA 1P7FA 5AUKA 4WJQA 4TQ0A 4W9GA 1FCLA 2MW5A 3JYUA 1RWSA 1VZ8A 1LM8B 1WZ3A 2HTHA 3PRZA 3DPDA 1D4BA 2MCNB 2DWQA 2K6QA 1YX5B 1CMXB 3IT4B 1GUAB 3P4RB 3VFKA 2WXPA 3QWZB 2WU2B 2KK8A 2RDHA 2PW9A 2FCMA 2GOWA 1SBBB 3IHPC 1OTRB 3OLMD 3AEEB 1PGXA 3DWMA 4FJZA 1PUTA 2L0TA 3ML8A 1YD8U 3B2FA 2MJ3A 1I42A 2KJRA 4NAWA 1WIAA 2OHFA 3UQBA 2WLBA 1EU4A 1R4NI 3HUIA 4RM9A 2LGYA 1C1YB 1YQ3B 2WXRA 3NZUA 2KDFB 3BK2A 2E3TA 2J52A 1XEEA 3BINA 4FJVB 2GRIA 4BKSA 3UQAA 1V1OA 1C4PA 1WGKA 4LJPB 4C56C 2KNBA 2GB1A 2KQ7A 3W5VB 4S17A 5BMHA 2ICIA 2LRWA 1N6ZA 2K8HA 3CSTA 1HTOA 4FA6A 2JU6X 3U30A 3A4RA 3E9SA 4N59A 2I1JA 3BK1A 3AE1B 3N9YC 4DXFA 3L17A 4WWPA 3Q2AC 2JRIB 1SF0A 2V4LA 3JW0X 2QSDA 5FR6A 1DYQA 1ESFA 1DOYA 1L6UA 1V81A 1XLOA 4W9EA 2M1MA 1BUIC 1E8XA 3VQIA 1IP9A 1WYGA 4XDCA 5HI1A 1RFAA 4IDIA 2BB6A 4F7ZA 3BVZA 2QHOA 3MJWA 3U8ZA 2LGDA 4WQMA 1P98A 2K6DB 1CZPA 4S0RA 4DWFA 2G1EA 1I4XA 2LD9A 3APCA 1Q0WB 3P42A 2SEBD 1JALA 3AU5A 2BWFA 2KWDA 1P7EA 4MJSB 1TT5B 5I4DA 4HJKA 5EDSA 4USAA 2KFJA 1IPGA 1NEKB 1IBXB 4DXGA 1LXDA 1WMHB 2INCC 4L1BA 2K9XA 4YSYB 4NAMA 3SFEB 2HE7A 2D5GA 3VDZA 1ET6A 2IYDB 4ARIA 3QCAA 4BKTA 2ZVOA 2O6VD 3ZW3A 2M19A 5C3JB 2KQSA 5G55A 2PLPA 2YEPB 3ZYYX 1C76A 1V1PA 1WZ0A 2NTTA 1ZPSA 2JWZA 2KDEB 2VZKB 2G3QB 1ZUD2 2WX0A 1N5XA 2IDYA 2C7NB 4M00A 5D94A 5DPSA 4E71A 1YOVB 2BGFA 2KX3A 2ASQA 3A9KB 4OVVA 1T5XD 2JZ3B 1NYRA 3M95A 2RMMA 3N1XC 4ANXA 3PZ8A 2W55A 5IAAC 2V3PA 2Z59B 4I6LB 4WJOA 3DBRB 3P4SB 1WE6A 4JGHB 2LZ6A 3HVDA 1N60A 2WQYB 3B08A 3C19A 1F2RI 3Q6BA 4YXDB 5D2MB 3Q3OC 5BO4B 2DAFA 2PVGC 3UIOB 3PPAA 1SJED 3DCGA 3ZDTA 2MP2A 3HHMA 3TEZA 3NVYA 3ZJVA 2W3RA 1FXAA 4OZCA 1C77A 1F9JA 3PZDA 3BIID 2M0XA 3PTFC 4P16A 3M63B 3Q69A 3DVNU 2DYBA 4II2B 4O1NA 3LDZE 5JHAA 1T6BX 4HEA1 4NPNA 3KQ4A 4MACA 3ZO5B 1L0YB 1FMAD 1JWAD 4DHJD 3X23A 4MDKE 1I4HA 1E6EB 4A90A 4NY0A 3MC9A 3RNEC 3OJ3A 4AP4C 4B0MA 4WQOB 1TKYA 3RUIB 3MHSD 3O65B 4GGQA 1J7CA 2YVCA 4IWQA 1WGHA 4B6WA 3T8MA 1R4MB 2M4NA 2G9HD 2KJ6A 1IGCA 1IUEA 4XWTA 3TUOA 1PGBA 1VJKA 1UH6A 1PQSA 1YIWA 1VZ6A 2YLMA 3ZXRA 3TJPA 3T3NA 1C3TA 3A9JA 1ZDVA 3VVWB 3L54A 1KTKA 2EMTA 3AMZA 2G4DB 3AEGB 2N1VA 2QDFA 2RD0A 4GLSC 2LRUA 1X1MA 3Q3MC 4YSXB 1UUPA 3IBEA 2K5PA 3ABVB 3H8HA 4XGAB 1XLQA 4X57B 2LXAA 2MBOA 4JPSA 4N6EB 4FHKA 2K25A 2A4ZA 1MVKA 5IA7A 3QC8B 3NVWA 3PLVA 4CYEA 3EFCA 2AQ2B 3Q8CA 2PPHA 3I3TB 5EE1A 2MQJA 3RZWC 1U4AA 2Y3AA 3GZNB 1HTQA 4LK0M 2PEAA 2DX5B 4LTUA 1DGJA 3Q8AA 4K3CA 1JMLA 3EUB2 2KXJA 2ZPYA 1WRDB 4ANUA 2JYTA 3RFZB 4REZA 2NPTB 4XC2A 4W9JA 3RN9C 4IUMB 4YWGG 3RULA 1N5WA 3I63C 1L6VA 4MELA 1OGWA 2D3BA 4RCOA 4US8A 4BOZB 3D32A 2RPVA 2I2YA 3MP9A 2KKCA 2J0JA 1QOAA 2BYEA 1WGDA 4DDGD 2BKFA 1VZ7A 4GDKA 3P1MA 3DHIC 4A55A 4AOFA 4C80A 3URYA 2KMCA 1JWSD 4LDTD 4WH4A 3BZDB 5AUIA 4KDLB 4K3BA 1E7UA 1K51A 4NJCA 4WIPA 5BMGA 2GLSA 3ZVVA 2FUHB 2RPQA 4TUUA 1LO5D 2H88B 2KQ4X 2L05A 2PJHA 4IWOA 3PHWB 3UGBB 3QAQA 3V61A 1LFDA 1HXYD 1EUVB 3DDCB 3I57A 4KX6B 1JRUA 4IKGA 4P1CC 1FXTB 3H7SA 4ZYNA 1HA5A 4IC7B 1C79A 4RM8A 5AZHA 2MLBA 2V3NA 3U2SC 2Z0DB 1KH0A 2IZVB 5CHFA 3LYYA 1SE9A 1E90A 3I9V1 5DCNA 4EKUA 4AS1A 1V49A 1KF6B 4MGYE 3QK0A 2XN9C 5T8IA 3GP7A 4ZOHC 1MHXA 1UNSA 1P0RA 2WGSA 3NZ3A 4KIKA 3H7PB 4NQKE 4F8CB 2XBBC 1SIJA 1VCBA 2NBWB 2HTME 4JWUC 3WA0A 3EECA 2JRHA 4HKQA 2OJRA 2MWSB 3AECB 1TZ1A 1FRDA 2D10A 5BYRA 2E6XA 3VAWA 1R4NB 1F77A 3PGEA 1XCTL 2WXKA 3L10B 5HKHA 2GBJA 2BYFA 4HJGE 4KGSA 3RZFA 3GB1A 4ZRQA 1K52A 1GJZA 4PS3A 4A3PA 4W9CA 1FRRA 3ENEA 3L08A 4M02A 1I4RA 5IKCM 3AE7B 1MG8A 4K7UA 1E7PB 3DBSA 1AW7A 1T0RC 3VTUA 4MM3A 5G5GA 3KH0A 3W1SA 1E10A 4PYZA 3GS2A 1QT9A 3AE6B 1XLNA 1WGYA 4IM0A 4HROA 3DWGC 2MBHA 5TR5A 2R61A 2MBEA 4NAWB 1NENB 5J2RA 2C7MB 1JW9D 2UYZB 5IOIA 1J7BA 5D3DA 5D6JB 1MHHE 2K1FA 1V86A 3ETRA 3NZSA 1QILA 4EZKA 4XE0A 2IO1B 2L32A 4WAFA 4UDUC 2MBQA 4EZLA 2BYTA 2I1KA 2NS5A 2BS2B 4JL9A 5CHWA 2WU5B 3CF6E 3PVLA 4RH6A 1NI3A 2FE8A 2CHXA 2XNAC 1E0ZA 1XT9B 3BVGA 2Y5CA 3ZNID 4HDOA 1L4ZB 1UELA 4B9KA 3RCZA 3LB8C 3ZTCA 1STEA 3DBHI 1ET9A 3TSSA 2M17A 1TS3A 1D5MC 4LNOA 1P9DU 3P63A 1XQQA 4GN1A 2HJ8A 4ICUA 1XXGA 3A1QB 5DPTA 4GDLA 1QOGA 1BMLC 4RGMA 3IXSA 1SJHD 3M62B 4NZLB 1E5WA 5HFYA 4FXCA 3N32A 3C8YA 4KZ0A 1F0ZA 3Q3NC 2L8JA 1V9JA 2IJ0A 1ZW7A 2J42A 2W54A 4RGOS 2BVCA 2KZRA 2KVZA 4BFRA 1YJ1A 1WM3A 1XF5L 2ZPNA 4FLHA 4ANVA 1NDDA 2MX2A 3V05A 3N20C 2RR9A 2BB5A 1RM6C 3N1ZC 1WX7A 3O13A 1V6EA 3ZIMA 3ECIA 1FFUA 2KMMA 5J17A 4FBJB 2N4FA 2IY0B 4G0NB 3A1QA 1ZE3D 4WWNA 2O2VA 2O6VA 2WDVB 2KDBA 1MJDA 3WAOA 2D3GA 2GBMA 3TEXA 3A4SC 1ZKHA 3RPFC 3DBLI 5E6PA 1JWBD 3Q14C 1QQRA 4C00A 2WXJA 1FNWA 1Z5SB 1V1PB 1TJEA 3AU4A 3W2DA 4ZDVA 2BKRB 2M8SA 3PHXB 2L1AA 2J4XA 4C7ZA 1E8ZA 1TKGA 1V80A 4LNKA 2ZW0A 3DQVA 3V62A 1YJIA 1KM7A 1VDVA 2R2OA 2MJDA 1C4AA 2ZW1A 1JROA 2DZJA 3RNAC 1WSPA 3NY5A 3NUHB 1SE3A 2QEJC 2CU3A 2QCZA 1CK1A 1E8WA 1GC6A 2KC1A 4EFOA 2BYVE 3V3XA 2C60A 3R7RA 2KTRA 4GB9A 5FR3A 3GE8C 1KJTA 4US9A 2N9KA 2MP2B 2ONQA 2PIAA 3UI3A 3Q3JA 1Q5WB 2C7HA 3B9JA 2N9PC 2DZMA 3PRPB 4FADA 2MA9B 1NYQA 4PS7A 1SB3C 3T3OA 3KWLA 3AEBB 1GNUA 4JLCA 1E8YA 1YQBA 3IVFA 3NRZA 3B0AA 2NMQA 4HCNB 2K3UA 3M3JA 1TIFA 1FXIA 1A5RA 4IW0A 3PRMB 2W9NA 2KYWA 2K39A 3EC8A 1NVID 2FNJB 1NI2A 2BQQA 2XK5A 2FCSA 4PS8A 1WM2A 3AXCA 1BT0A 4DK5A 1WF9A 4G3XB 2GBNA 3ZUNA 2KOXA 2UU7A 1UBQA 2K8CA 5TSSA 4GXBA 5FKAC 3V6EB 4YTNB 2DENB 2BWES 2V3SA 2KDIA 2ZNVC 4G11A 2FBWB 3UIPB 2WS3B 2JZZA 4I6NB 3W5UB 3GE3C 3ZRCA 3H6NA 3V6CB 1KLGD 5HHDG 4TSSA 4DDID 1OQQA 3ZLZA 2ZEQA 5CHVC 2NBVB 1ROEA 3A9JB 1ZOYB 2AQ1B 2B76B 1WI0A 1B9RA 2REXA 2H89B 3P4PB 1MFWA 2AWTA 4JWSC 1GPXA 3U7ZA 2LFIA 4K7SA 2LEKA 4IWPA 1V2YA 1SSNA 2Y5PA 1JRPA 2V0GA 2LUMA 3QIJA 4AJYB 3NOBA 5FK9C 4ZRKA 3FILA 1T0QC 2V1YA 2WXQA 4M01A 3BVMA 3TCAA 4GIVA 2VZKD 4K81A 2FIFA 4KSLC 1D3ZA 1M94A 2RDBC 2AX5A 2WXLA 4MGZE 4XYCA 1C9FA 5IN7A 1Q10A 4HRSA 1JWMD 1F1HA 2EKIA 3W9CB 1RRBA 2EMSA 1WH3A 2KLGA 3AE2B 1FNUA 2SAKA 3DBRI 2WX1A 3KWVA 4M8MA 3AULA 2VRRB 2N9EB 4KDIC 4A6QA 4WJPA 2CJOA 2NCNA 1D6EC 1K50A 3LJ3A 1E9MA 4HPPA 2KLCA 1I4QA 3TEWA 1FO4A 1WXAA 3C0RB 4HVBA 4W9KA 4JQWC 3N1YC 2CKHB 3W1SC 4GDKB 4IOIE 1SE2A 2D07B 2INDC 2KWUB 2YEPF 1YN5A 2EKEC 2HDEA 3NVZA 4MH8A 1RYJA 2ZNVB 3MTNB 1D5XC 3I5JC 5JHBA 3P4QB 1ZGUB 3UF8A 2W82A 2L0FA 1TY2A 3ALBA 3AE3B 1PFDA 1TS2A 1UWXA 4QAYA 3OAWA 1J19A 3SFDB 1HE8A 2D3AA 3HVZA 2ZCCA 1SXTA 2A5UA 1FCCC 2WXMA 4BOSC 3IAM1 3Q8FA 5BYSA 2KO3A 4CHKA 1KFYB 3WAMA 2BW2A 4OW0A 1A70A 4TQ1A 1I4PA 4W9HA 2PKOA 4MSMB 2KMAA 2BT6A 2N0SB 2JUOA 3KUZA 1AYFA 4ZRPA 3NHEB 4J3OD 4K7WA 4EUTA 2M56B 3SEBA 1MI0A 2EELA 4KIKB 3AI5A 3VRAB 2X8XX 4FJYA 1OFFA 4ACFA 2C9WB 1C78A 3HIZA 4YSZB 4W9FA 1OEYJ 3JSVA 2FAZA 1J7AA 3ZRFA 1EO6A 2RGFA 4XWWA 3Q8EA 1I35A 3ZTDA 2WXHA 4G50A 3APDA 1YMHE 4AQ7A 2KD0A 4LNIA 3SD5A 4HLEA 4NQLB 4CO7A 1QF6A 5C23A 4KZCA 2OEDA 2KX0A 2MRPA 3IAS1 5J18A 3IT6B 5LXIB 2IGHA 4TMAB 2L3ZA 4A20A 1QKZA 1L7YA 1WR6E 1WJNA 2DZKA 3GZNI 3VH3B 1K8RB 3NS8A 4MM3B 3VTVA 3CMMB 2FCNA 2IO0B 5JH5C 2BS4B 4ZRJA 1VR9A 3L0WB 3ZJTA 1KOTA 1KRHA 4H2AA 2KT7A 4DQOC 3DBHB 3CWIA 2IO2B 4OZAA 4DXAB 2CR5A 3MFGA 1UGMA 2KWCA 3VHTC 2QIEB 5C1ZA 2JXXA 4W9IA 3KYDD 2IY1B 4E3CA 3ZGZA 4EZJA 2LMCA 1Y8RC 2LJIA 4OVUA 4BAXA 1L4DB 2LUEA 1WGRA 1T0SC 2VH1A 3AE5B 3AEAB 4OZBA 3Q3FA 3KVFB 4JX1C 3TBLD 5BYQA 4Q2JA 3NJTA 2J7QB 3VH4B 3VRBB 1FNVA 1F2RC 4KSKC 2J53A 1YX6B 1NBFC 3DHHC 3RNFC 3K9PB 5JZEB 1TS4A 4RFBA 1Q1OA 1P3QU 1RLFA 4W9LA 1MPEA 1WX9A 3ZNHB 1F52A 2WXGA 3CSFA
chains in the Genus database with same CATH topology
1JWAD 2INNE 2L1AA 2J4XA 2Z8LA 2AQ3B 4C7ZA 1TKGA 1I4HA 4MT5A 4XDDA 2ZW0A 2LGIA 1QOFA 1XO3A 1E6EB 4A90A 2CJNA 1YJIA 4ZHOA 1VDVA 2MJDA 1C4AA 2ZW1A 4B0MA 1ZP0B 2WXOA 1JROA 2I38A 1L0VB 1TKYA 1V8CA 3BWUD 1WSPA 4GDLB 3NUHB 1J7CA 4D2KA 1FM0D 3KLSX 1SE3A 2QEJC 4L2YA 2IPKD 1YNTE 2G9HD 2CU3A 4WWMA 3AM9A 1IGCA 1IUEA 1CK1A 4XWTA 3TUOA 1PGBA 1VJKA 1QOBA 1M4VA 2V4IB 3AEDB 3V3XA 3R8BA 2Q5WD 1VZ6A 5FR3A 3T3NA 3EGRA 1PDXA 4US9A 1ZDVA 2N9KA 2LHDA 4YT0B 2ONQA 1KTKA 2PIAA 3AMZA 3UI3A 3AEGB 4GLSC 4C7YA 1GB1A 3B9JA 4M0WA 4YSXB 1RFKA 5LNK1 1EWCA 4A8XC 1UUPA 1TS5A 1XLPA 1SEBD 1NYQA 5G5HA 1SB3C 4KGRA 4A9AA 3T3OA 3KWLA 3AEBB 4WURA 3U52E 2K5PA 3ABVB 3H8HA 1XLQA 2QJLA 3NRZA 1D5ZC 2NMQA 1IGDA 2K3UA 2RDGA 1FXIA 4JPSA 4EE2A 4P6VF 1ZXIA 4N6EB 1HZ6A 2LHEA 2WXNA 2TSSA 1JQ4A 5HG2A 1NVID 4OVZA 1UGJA 3AE9B 1HQRD 1MVKA 1CJEA 3NVWA 1DOXA 1V97A 2AQ2B 3Q8CA 4KGTA 1Y56A 5EE1A 2W3SA 1YJJA 1SE4A 2INPE 2Y3AA 5TSSA 3R2IA 4LK0M 2N9LA 5FKAC 1KLUD 3J9CA 4PT5A 1GAQB 3PO0A 2ON8A 4LTUA 1DGJA 4YTNB 5EE3A 3Q8AA 4CQNA 2BTEA 1JMLA 3AEFB 3AE4B 2KAJA 1TKEA 2WXIA 3AB5A 3EUB2 1ZXHA 2FBWB 2WS3B 1ZDXA 5BMIA 2JYTA 3R2TA 1FFVA 3W5UB 2WP9B 3AE8B 3RFZB 3LXFA 4REZA 1HEZE 1KLGD 5HHDG 4ZYSA 2ACZB 2JZPA 4TSSA 2PMVA 4YWGG 1N5WA 2MH7A 1L0XB 1OQQA 1PGAA 4B0EA 2DYOA 1L6VA 4RCOA 4US8A 5D3IB 1ROEA 1EM7A 2RPVA 3EA6A 4HKZE 3PZ7A 2I2YA 1ZOYB 3NS1A 4JE3B 2AQ1B 2B76B 3MP9A 1EU3A 4R3DA 1ACCA 2L83A 1QOAA 1B9RA 4N58A 1N63A 2H89B 3P4PB 2DLBA 1VZ7A 1P7FA 3P1MA 1ENFA 4JWSC 5AUKA 1GPXA 4A55A 4TQ0A 2JX5A 3U7ZA 2LFIA 4C80A 1FCLA 3L4PA 2LEKA 3URYA 1JWSD 1RWSA 1SSNA 2Y5PA 1JRPA 3SR6A 2V0GA 4WH4A 3BZDB 2LUMA 5AUIA 1VZ8A 1K51A 2K0PA 2X38A 1R7SA 4NJCA 4WIPA 5BMGA 1K53A 1AN8A 1JCKB 5FK9C 1AWDA 1D4BA 2DWQA 3Q8BA 3FILA 2WXQA 3IT4B 1LO5D 2H88B 4KKJA 4YTPB 3BVMA 2DYMA 2KQ4X 3P4RB 2WXPA 2VZKD 2FUG1 2WU2B 1HXYD 4LLGM 2RDHA 3I57A 4KX6B 2PW9A 4IKGA 2AX5A 3BYYB 4ITKA 1SBBB 2DBYA 4RGNA 1B1ZA 2WXLA 1C9FA 3AEEB 1Q10A 2JSVX 1PGXA 3DWMA 1XCQL 4HRSA 1PUTA 1JWMD 2EKIA 3FAHA 1HA5A 2MEKA 3W9CB 3B2FA 1C79A 2MJ3A 3BYTB 3ZJUA 3CIRB 3AE2B 1FNUA 2SAKA 2V3NA 3U2SC 2OHFA 1KH0A 3KWVA 2WLBA 4OHJA 2JWUA 4A6QA 1C4CA 2CJOA 1EU4A 1D6EC 1YN4A 1K50A 1VLBA 3HUIA 3LYYA 2NTSA 1E9MA 3I9V1 1YQ3B 1L5PA 2WXRA 4AS1A 1IBXA 1I4QA 1KF6B 1N62A 3TEWA 3BK2A 1FO4A 2E3TA 2XN9C 5T8IA 3GP7A 4ZOHC 1MHXA 1UNSA 1TY0A 2J52A 1XEEA 3NZ3A 1OQRA 2GRIA 3OWEB 5H8YE 3TEYA 1V1OA 1SIJA 1C4PA 1WGKA 2HTME 4JWUC 1WWTA 4C56C 4GDKB 4IOIE 2GB1A 1VRAB 1SE2A 2YEPF 3W5VB 1YN5A 5BMHA 2HDEA 3NVZA 4MH8A 2ICIA 4HKQA 3AECB 1FRDA 5BYRA 1RYJA 2E6XA 3U4EG 3W2DA 1F77A 2JU6X 1WRIA 2PTLA 1GOZA 1XCTL 1D5XC 3E9SA 4N59A 3P4QB 2WXKA 3BK1A 2WDQB 4L23A 4HJGE 3AE1B 4KGSA 2W82A 3N9YC 3GB1A 4ZRQA 4DXFA 1TY2A 3FILB 1K52A 3AE3B 1PFDA 1TS2A 4ZHPA 1TZOA 1UWXA 3SFDB 1SF0A 1PYWD 3HVZA 2N7JA 2QSDA 1FRRA 3MC0B 1DYQA 2WNMA 1ESFA 1QLBB 1I4RA 1L6UA 1SXTA 3ZQ4A 3AE7B 1DOYA 1XLOA 1FCCC 2WXMA 1E7PB 1AW7A 1BUIC 1CQVA 2K22A 3VQIA 5MPOA 1WYGA 5G5GA 3IAM1 3NVVA 3Q8FA 4XDCA 5HI1A 2QMTA 5BYSA 4IDIA 2BB6A 3W1SA 2IGGA 1E10A 3GS2A 3BVZA 1QT9A 3AE6B 2WDRB 1KFYB 1XLNA 2KN4A 2QILA 4WQMA 4HROA 1CZPA 2BW2A 3DWGC 1GB4A 4OW0A 2G1EA 1I4XA 5EE0A 2R61A 1A70A 4NAWB 4TQ1A 1I4PA 3HRDD 2PKOA 3P42A 1HZ5A 1NENB 2BT6A 1JALA 2SEBD 4KKIA 2KWDA 1P7EA 2N0SB 2KDMA 5I4DA 3AN1A 2GI9A 4USAA 1JW9D 1AYFA 3WCQA 4ZRPA 1NEKB 1IBXB 1J7BA 4J3OD 4DXGA 5D3DA 1MHHE 2M56B 3SEBA 1MI0A 4L1BA 1T3QA 2K9XA 3ETRA 2EELA 1JWUD 4YSYB 4NAMA 3VRAB 1QILA 3SFEB 4XE0A 2D5GA 1OFFA 1ET6A 2L32A 4RGTA 4WAFA 4UDUC 1C78A 5D7GA 4YSZB 1J7AA 2BYTA 4ARIA 5GXGB 3VR9B 4XWWA 1TYGB 2BS2B 3Q8EA 1FD6A 2WU5B 2WXHA 1EWYC 4RH6A 3FC4A 4YTMB 1YMHE 4AQ7A 1NI3A 2FE8A 2M19A 5C3JB 2XNAC 1E0ZA 4RF1A 1FEHA 2PLPA 2YEPB 3BVGA 3ZYYX 1C76A 2Y5CA 1V1PA 1QF6A 5JXVA 2NTTA 1L4ZB 1ZPSA 2OEDA 3AH7A 3LB8C 2VZKB 3IAS1 1STEA 1ET9A 1ZUD2 3IT6B 3TSSA 1N5XA 2IDYA 2IGHA 4TMAB 4RNAA 2BS3B 1TS3A 1D5MC 3MJ5A 3P63A 1DOIA 1QKZA 5H92C 2WXFA 2JYEA 1T5XD 2M0AA 1XXGA 1NYRA 4MM3B 2BBCA 1QOGA 1BMLC 4RGMA 2RMMA 1YN3A 2BS4B 3IXSA 1VR9A 3MHZA 1SJHD 2W55A 3PZ8A 3ZJTA 4NZLB 2V3PA 5HFYA 4RF0A 1KRHA 3P4SB 4H2AA 4FXCA 1BXTA 3HVDA 1N60A 2WQYB 4DQOC 1F2RI 3CWIA 4OZAA 2JQRB 4YXDB 3C8YA 1I4GA 1F0ZA 2PVGC 3MFGA 2IJ0A 2J42A 2QIEB 2W54A 4RGOS 3B2GA 1SJED 1XF5L 3ZGZA 1N61A 3TEZA 2LMCA 3NVYA 3V05A 2JXTA 1I7HA 2LJIA 5EE9A 1L4DB 2BB5A 3ZJVA 2W3RA 1FXAA 1RM6C 2KACA 3O13A 3AE5B 1FFUA 4OZCA 1C77A 2KMMA 3AEAB 3BIID 1UWMA 2PVOD 1YQ4B 4OZBA 1ZE3D 2WDVB 2IGDA 1WXQA 4JX1C 4P16A 5BYQA 4Q2JA 3VRBB 1FNVA 1F2RC 3Q69A 3RPFC 3TEXA 2J53A 1JWBD 2L52A 1QQRA 4O1NA 2MJEA 4ARCA 1FIQA 1T6BX 3VR8B 2WXJA 4HEA1 1TS4A 1FNWA 3KQ4A 1V1PB 1TJEA 4MACA 4RFBA 1L0YB 3E56A 5C2TB 1MPEA 1FMAD 2WXGA 3AV8A 5E6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBX A;  1ZXH A;  1FD6 A;  5BMI A;  1MHX A;  2J52 A;  2ZW0 A;  2LGI A;  1YMH E;  2PLP A;  1HEZ E;  5HHD G;  2JZP A;  5JXV A;  2OED A;  2ZW1 A;  4IOI E;  2GB1 A;  1PGA A;  2I38 A;  4D2K A;  5BMH A;  1EM7 A;  2IGH A;  2RPV A;  4HKZ E;  1YNT E;  2I2Y A;  3MP9 A;  1IGC A;  1QKZ A;  2JU6 X;  2PTL A;  1XCT L;  1PGB A;  3V3X A;  4HJG E;  4KGS A;  1P7F A;  3GB1 A;  3FIL B;  1K52 A;  1FCL A;  2RMM A;  1UWX A;  2N9K A;  4WH4 A;  2N7J A;  2LHD A;  2LUM A;  2ONQ A;  2QSD A;  5HFY A;  1K51 A;  2K0P A;  3UI3 A;  5BMG A;  1K53 A;  4GLS C;  1GB1 A;  1D4B A;  1FCC C;  1F2R I;  4OZA A;  3FIL A;  5HI1 A;  2QMT A;  2KQ4 X;  2IGG A;  4KGR A;  1XF5 L;  2KN4 A;  1GB4 A;  2NMQ A;  2JXT A;  1IGD A;  2PW9 A;  4IKG A;  2KAC A;  1HZ5 A;  1HZ6 A;  2LHE A;  1C9F A;  2KWD A;  1P7E A;  1Q10 A;  2JSV X;  1PGX A;  2KDM A;  4OZC A;  5HG2 A;  1XCQ L;  2GI9 A;  4OZB A;  1MVK A;  2IGD A;  1IBX B;  1MHH E;  1F2R C;  2J53 A;  4KGT A;  1MI0 A;  2EEL A;  1KH0 A;  2JWU A;  2N9L A;  4MAC A;  1K50 A;  1MPE A;  2ON8 A;  1JML A; 
#chains in the Genus database with same CATH topology
 3PSE B;  2AQ3 B;  3UIN B;  3VTW A;  4MT5 A;  4XDD A;  2OOB B;  1QOF A;  2K8B A;  2KN5 A;  1UF0 A;  2CJN A;  2DAJ A;  2JPH A;  4ZHO A;  3DBL B;  4DHZ E;  1L0V B;  1WJ6 A;  3RNB C;  1G6J A;  4GDL B;  4D2K A;  1FM0 D;  1L2N A;  4BZA A;  3APF A;  4WJN A;  4KV2 A;  4MEM A;  5GMV A;  4WWM A;  4BVU C;  1J8C A;  1ISN A;  2JF5 A;  1WXV A;  1QOB A;  3AED B;  2VH2 A;  3R8B A;  4HCP B;  2Q5W D;  1V5T A;  3EGR A;  2LHD A;  4EEW A;  1SIF A;  1GB1 A;  2N7D A;  4M0W A;  5AZG A;  1WJ4 A;  5LNK 1;  2IO3 B;  4A8X C;  1XLP A;  1H4R A;  1MG4 A;  3V60 A;  5G5H A;  1AAR A;  4KGR A;  4A9A A;  2B3A A;  2O2V B;  2O6V B;  1D5Z C;  1IGD A;  2RDG A;  4P6V F;  1HZ6 A;  2D2Q A;  5DPW A;  1JQ4 A;  5HG2 A;  2AEH A;  1WFY A;  4OVZ A;  1UGJ A;  2FCQ A;  1HQR D;  1CJE A;  3RT3 B;  4RMA A;  1V97 A;  3QA8 A;  4KGT A;  2LGS A;  2GBR A;  2PE6 B;  2D11 A;  2W3S A;  3ZXV A;  1H8C A;  1YJJ A;  2INP E;  3KUC B;  3R2I A;  2N9L A;  1KLU D;  4PT5 A;  3DVG Y;  2BTE A;  2ON8 A;  3PRE A;  2AL3 A;  3AE4 B;  2WXI A;  1TKE A;  2LGX A;  1ZDX A;  3WAP A;  5BMI A;  1FFV A;  2XEW A;  3AE8 B;  2NR2 A;  3HK0 A;  3LXF A;  1HEZ E;  2CU1 A;  4MGK E;  4ANW A;  2ACZ B;  2JZP A;  4P7I A;  2PMV A;  1L0X B;  4ZRI A;  3QAR A;  4B0E A;  2DYO A;  2KTR B;  2JY6 A;  3EA6 A;  2KJH B;  4HKZ E;  3NS1 A;  2HJ1 A;  4LNN A;  1ACC A;  1LQB A;  4BKS D;  5LXH A;  1N63 A;  4HWI B;  4JIO U;  1ENF A;  4W9D A;  2JX5 A;  3L4P A;  1EF5 A;  2KHW B;  3SR6 A;  2GBK A;  1QZE A;  2K0P A;  2X38 A;  1R7S A;  3S2A A;  1K53 A;  1AN8 A;  1JCK B;  2ZVN A;  1AWD A;  2WYQ A;  3Q8B A;  4KKJ A;  4YTP B;  3RD2 A;  2DYM A;  2XK5 B;  1WY8 A;  3ZNG C;  4DHJ B;  2FUG 1;  4LLG M;  4DHZ B;  5E6O A;  2LI5 A;  3BYY B;  4ITK A;  2DBY A;  2QC8 A;  1B1Z A;  4RGN A;  1OEY A;  2KVR A;  3JVZ X;  2JSV X;  4A3O A;  4NNJ B;  2AYO B;  1XCQ L;  4E74 A;  3IG3 A;  3FAH A;  2MEK A;  4GSW A;  3BYT B;  3ZJU A;  3CIR B;  3RNC C;  4PYU A;  3EHV A;  3H1U A;  1Z2M A;  4OHJ A;  4AUQ C;  2JWU A;  1T0Y A;  4MJS A;  1C4C A;  1P1A A;  1YN4 A;  5L95 C;  1V5O A;  1VLB A;  2NTS A;  3RYT A;  4J6I A;  2LWP A;  1L5P A;  3TMP B;  1IBX A;  4GU2 A;  1N62 A;  5AEK B;  1TY0 A;  1WMH A;  1OQR A;  2BPS A;  3OWE B;  3N30 A;  5H8Y E;  3TEY A;  4LCD E;  2LAS A;  5LLI A;  3W1Y A;  2FID A;  1WWT A;  1WGG A;  3WAL A;  1VRA B;  5KHQ A;  1WXS A;  2WDT B;  1S3S G;  4ICV A;  4BBN C;  3U4E G;  3K9O B;  2KWV B;  3L16 A;  1WRI A;  2PTL A;  1GOZ A;  3VUY A;  5IO9 A;  1FPY A;  2WDQ B;  4L23 A;  4NJ7 A;  3FIL B;  3DVN V;  4ZHP A;  1TZO A;  2ZZP B;  5L83 A;  1PYW D;  2KC2 A;  2N7J A;  3MC0 B;  3SDL C;  2WHI A;  2WNM A;  3A9K A;  4FUL A;  1QLB B;  3QJZ A;  3ZQ4 A;  3H9D A;  4II3 B;  3HM3 A;  2L7R A;  1CQV A;  2K22 A;  3ONS A;  5MPO A;  3NVV A;  2QMT A;  1OQY A;  2IGG A;  4URK A;  3R7Q A;  2WDR B;  4WWO A;  2MBB B;  2KN4 A;  2QIL A;  2Z0E B;  1GB4 A;  5EE0 A;  2LVO A;  5G2N A;  2J0M A;  3VXW A;  4WAA A;  3HRD D;  1HZ5 A;  4KKI A;  1UBI A;  2ZJD A;  2KDM A;  3PT2 B;  4N9F 4;  3AN1 A;  2GI9 A;  4LJO B;  3WCQ A;  2DNF A;  3ZKJ C;  4TKN A;  3PV1 A;  4IM2 A;  1T3Q A;  3VUX A;  4NJ6 A;  1JWU D;  1WR1 A;  3OJ4 B;  2J0K A;  4RGT A;  5D7G A;  5GXG B;  4LDT B;  3VR9 B;  4M8N A;  1TYG B;  1FD6 A;  1EWY C;  1GC7 A;  3FC4 A;  4YTM B;  4RF1 A;  1FEH A;  2DHZ A;  4EOY A;  5JXV A;  2PE9 A;  3AH7 A;  5CTR C;  2NVU I;  1WXM A;  4RNA A;  2BS3 B;  4FN2 A;  3MJ5 A;  3WIM A;  1E7V A;  1DOI A;  5H92 C;  2WXF A;  3TIX A;  1TGZ B;  2JYE A;  2M0A A;  1UD7 A;  2N9X A;  4XZ4 A;  2BBC A;  4AJW A;  1YN3 A;  2JVC A;  3MHZ A;  2C5L C;  3A33 B;  5DPR A;  1SGH A;  4P1B C;  4RF0 A;  1BXT A;  4BKG A;  2LVP A;  3U7D A;  3NG0 A;  2JQR B;  1I4G A;  2L00 B;  4B95 A;  2KFK B;  1UZX B;  3ZNZ B;  2KTF A;  3B2G A;  2BF8 B;  1WJU A;  4MGI E;  1N61 A;  3FKY A;  2N7E A;  2JXT A;  1I7H A;  1J0G A;  2V9H A;  5EE9 A;  4HDQ A;  2KAC A;  4I6P A;  4YL8 A;  1UWM A;  2PVO D;  1YQ4 B;  3QQ8 B;  3GOE A;  3JSV B;  4XX5 A;  1KLV A;  2IGD A;  1WXQ A;  2LJ5 A;  4TV3 A;  4F1S A;  4PK1 A;  2L52 A;  3SHQ A;  3IFW B;  2MJE A;  4ARC A;  1FIQ A;  3VR8 B;  3DOW A;  1R4M I;  2ZCB A;  2KAN A;  4HPL B;  2CS4 A;  3E56 A;  5C2T B;  1WX8 A;  4ASW C;  2GMI C;  3PLU A;  3AV8 A;  5E6J A;  2KFK A;  4K1R B;  2INN E;  5CX3 A;  2Z8L A;  3QHT A;  2L76 A;  3R3M A;  3R66 C;  4FHJ A;  4KVG B;  2LGI A;  1XO3 A;  2IBI B;  1GG3 A;  3PS6 A;  2LXC A;  4HK2 A;  2RSU A;  1ZP0 B;  2WXO A;  2I38 A;  1V8C A;  3BWU D;  3EFU A;  4HPM B;  2CHZ A;  3MC8 A;  3OG5 A;  5IP4 D;  3KLS X;  5KHO A;  1WE7 A;  2G4S A;  3VUW A;  4L2Y A;  2IPK D;  1YNT E;  3B1L X;  3T9L A;  1IYF A;  3BY4 B;  3AM9 A;  2HD5 B;  1LGR A;  1TBE A;  2NPT A;  1M4V A;  2V4I B;  3WAN A;  3DHG C;  2DZI A;  3RMK C;  1PDX A;  2N1W A;  3QX1 A;  4YT0 B;  4MSQ B;  3RNG C;  2WWZ A;  4C7Y A;  1RFK A;  2G45 B;  1EWC A;  2D3C A;  3KUD B;  4AWJ A;  1TS5 A;  1SEB D;  4IG7 B;  3RI7 C;  2NBU A;  4WUR A;  3U52 E;  2R2Q A;  2QJL A;  4HXD A;  2LVQ A;  3KW5 B;  4EE2 A;  1ZXI A;  2LHE A;  2AL6 A;  2UWQ A;  2WXN A;  2TSS A;  1VD2 A;  3AE9 B;  3TL5 A;  1DOX A;  3HM6 X;  4DBG A;  2MHJ A;  1Y56 A;  2MSE D;  4C4V B;  3DVG X;  1SE4 A;  3SU8 X;  3J9C A;  1GAQ B;  1XD3 B;  3PO0 A;  3ML9 A;  5EE3 A;  4CQN A;  3AEF B;  2KAJ A;  3AB5 A;  1ZXH A;  2CHW A;  3R2T A;  2WP9 B;  2JT4 B;  4GMV A;  5E6N A;  2OJW A;  3N3K B;  1WYW B;  4ZYS A;  3X0W A;  3ZDM C;  2MH7 A;  5AZF A;  4LNF A;  1PGA A;  3L13 A;  1EF1 A;  1TTN A;  5D3I B;  2Y5B B;  1S1Q B;  3P2B A;  1EM7 A;  1RAX A;  4IM3 A;  3PZ7 A;  4MH0 E;  4JE3 B;  3KYC D;  3H7P A;  1EU3 A;  4R3D A;  2L83 A;  4GOC A;  4M0W B;  4N58 A;  4BBN F;  4C4V A;  2DLB A;  1P7F A;  5AUK A;  4WJQ A;  4TQ0 A;  4W9G A;  1FCL A;  2MW5 A;  3JYU A;  1RWS A;  1VZ8 A;  1LM8 B;  1WZ3 A;  2HTH A;  3PRZ A;  3DPD A;  1D4B A;  2MCN B;  2DWQ A;  2K6Q A;  1YX5 B;  1CMX B;  3IT4 B;  1GUA B;  3P4R B;  3VFK A;  2WXP A;  3QWZ B;  2WU2 B;  2KK8 A;  2RDH A;  2PW9 A;  2FCM A;  2GOW A;  1SBB B;  3IHP C;  1OTR B;  3OLM D;  3AEE B;  1PGX A;  3DWM A;  4FJZ A;  1PUT A;  2L0T A;  3ML8 A;  1YD8 U;  3B2F A;  2MJ3 A;  1I42 A;  2KJR A;  4NAW A;  1WIA A;  2OHF A;  3UQB A;  2WLB A;  1EU4 A;  1R4N I;  3HUI A;  4RM9 A;  2LGY A;  1C1Y B;  1YQ3 B;  2WXR A;  3NZU A;  2KDF B;  3BK2 A;  2E3T A;  2J52 A;  1XEE A;  3BIN A;  4FJV B;  2GRI A;  4BKS A;  3UQA A;  1V1O A;  1C4P A;  1WGK A;  4LJP B;  4C56 C;  2KNB A;  2GB1 A;  2KQ7 A;  3W5V B;  4S17 A;  5BMH A;  2ICI A;  2LRW A;  1N6Z A;  2K8H A;  3CST A;  1HTO A;  4FA6 A;  2JU6 X;  3U30 A;  3A4R A;  3E9S A;  4N59 A;  2I1J A;  3BK1 A;  3AE1 B;  3N9Y C;  4DXF A;  3L17 A;  4WWP A;  3Q2A C;  2JRI B;  1SF0 A;  2V4L A;  3JW0 X;  2QSD A;  5FR6 A;  1DYQ A;  1ESF A;  1DOY A;  1L6U A;  1V81 A;  1XLO A;  4W9E A;  2M1M A;  1BUI C;  1E8X A;  3VQI A;  1IP9 A;  1WYG A;  4XDC A;  5HI1 A;  1RFA A;  4IDI A;  2BB6 A;  4F7Z A;  3BVZ A;  2QHO A;  3MJW A;  3U8Z A;  2LGD A;  4WQM A;  1P98 A;  2K6D B;  1CZP A;  4S0R A;  4DWF A;  2G1E A;  1I4X A;  2LD9 A;  3APC A;  1Q0W B;  3P42 A;  2SEB D;  1JAL A;  3AU5 A;  2BWF A;  2KWD A;  1P7E A;  4MJS B;  1TT5 B;  5I4D A;  4HJK A;  5EDS A;  4USA A;  2KFJ A;  1IPG A;  1NEK B;  1IBX B;  4DXG A;  1LXD A;  1WMH B;  2INC C;  4L1B A;  2K9X A;  4YSY B;  4NAM A;  3SFE B;  2HE7 A;  2D5G A;  3VDZ A;  1ET6 A;  2IYD B;  4ARI A;  3QCA A;  4BKT A;  2ZVO A;  2O6V D;  3ZW3 A;  2M19 A;  5C3J B;  2KQS A;  5G55 A;  2PLP A;  2YEP B;  3ZYY X;  1C76 A;  1V1P A;  1WZ0 A;  2NTT A;  1ZPS A;  2JWZ A;  2KDE B;  2VZK B;  2G3Q B;  1ZUD 2;  2WX0 A;  1N5X A;  2IDY A;  2C7N B;  4M00 A;  5D94 A;  5DPS A;  4E71 A;  1YOV B;  2BGF A;  2KX3 A;  2ASQ A;  3A9K B;  4OVV A;  1T5X D;  2JZ3 B;  1NYR A;  3M95 A;  2RMM A;  3N1X C;  4ANX A;  3PZ8 A;  2W55 A;  5IAA C;  2V3P A;  2Z59 B;  4I6L B;  4WJO A;  3DBR B;  3P4S B;  1WE6 A;  4JGH B;  2LZ6 A;  3HVD A;  1N60 A;  2WQY B;  3B08 A;  3C19 A;  1F2R I;  3Q6B A;  4YXD B;  5D2M B;  3Q3O C;  5BO4 B;  2DAF A;  2PVG C;  3UIO B;  3PPA A;  1SJE D;  3DCG A;  3ZDT A;  2MP2 A;  3HHM A;  3TEZ A;  3NVY A;  3ZJV A;  2W3R A;  1FXA A;  4OZC A;  1C77 A;  1F9J A;  3PZD A;  3BII D;  2M0X A;  3PTF C;  4P16 A;  3M63 B;  3Q69 A;  3DVN U;  2DYB A;  4II2 B;  4O1N A;  3LDZ E;  5JHA A;  1T6B X;  4HEA 1;  4NPN A;  3KQ4 A;  4MAC A;  3ZO5 B;  1L0Y B;  1FMA D;  1JWA D;  4DHJ D;  3X23 A;  4MDK E;  1I4H A;  1E6E B;  4A90 A;  4NY0 A;  3MC9 A;  3RNE C;  3OJ3 A;  4AP4 C;  4B0M A;  4WQO B;  1TKY A;  3RUI B;  3MHS D;  3O65 B;  4GGQ A;  1J7C A;  2YVC A;  4IWQ A;  1WGH A;  4B6W A;  3T8M A;  1R4M B;  2M4N A;  2G9H D;  2KJ6 A;  1IGC A;  1IUE A;  4XWT A;  3TUO A;  1PGB A;  1VJK A;  1UH6 A;  1PQS A;  1YIW A;  1VZ6 A;  2YLM A;  3ZXR A;  3TJP A;  3T3N A;  1C3T A;  3A9J A;  1ZDV A;  3VVW B;  3L54 A;  1KTK A;  2EMT A;  3AMZ A;  2G4D B;  3AEG B;  2N1V A;  2QDF A;  2RD0 A;  4GLS C;  2LRU A;  1X1M A;  3Q3M C;  4YSX B;  1UUP A;  3IBE A;  2K5P A;  3ABV B;  3H8H A;  4XGA B;  1XLQ A;  4X57 B;  2LXA A;  2MBO A;  4JPS A;  4N6E B;  4FHK A;  2K25 A;  2A4Z A;  1MVK A;  5IA7 A;  3QC8 B;  3NVW A;  3PLV A;  4CYE A;  3EFC A;  2AQ2 B;  3Q8C A;  2PPH A;  3I3T B;  5EE1 A;  2MQJ A;  3RZW C;  1U4A A;  2Y3A A;  3GZN B;  1HTQ A;  4LK0 M;  2PEA A;  2DX5 B;  4LTU A;  1DGJ A;  3Q8A A;  4K3C A;  1JML A;  3EUB 2;  2KXJ A;  2ZPY A;  1WRD B;  4ANU A;  2JYT A;  3RFZ B;  4REZ A;  2NPT B;  4XC2 A;  4W9J A;  3RN9 C;  4IUM B;  4YWG G;  3RUL A;  1N5W A;  3I63 C;  1L6V A;  4MEL A;  1OGW A;  2D3B A;  4RCO A;  4US8 A;  4BOZ B;  3D32 A;  2RPV A;  2I2Y A;  3MP9 A;  2KKC A;  2J0J A;  1QOA A;  2BYE A;  1WGD A;  4DDG D;  2BKF A;  1VZ7 A;  4GDK A;  3P1M A;  3DHI C;  4A55 A;  4AOF A;  4C80 A;  3URY A;  2KMC A;  1JWS D;  4LDT D;  4WH4 A;  3BZD B;  5AUI A;  4KDL B;  4K3B A;  1E7U A;  1K51 A;  4NJC A;  4WIP A;  5BMG A;  2GLS A;  3ZVV A;  2FUH B;  2RPQ A;  4TUU A;  1LO5 D;  2H88 B;  2KQ4 X;  2L05 A;  2PJH A;  4IWO A;  3PHW B;  3UGB B;  3QAQ A;  3V61 A;  1LFD A;  1HXY D;  1EUV B;  3DDC B;  3I57 A;  4KX6 B;  1JRU A;  4IKG A;  4P1C C;  1FXT B;  3H7S A;  4ZYN A;  1HA5 A;  4IC7 B;  1C79 A;  4RM8 A;  5AZH A;  2MLB A;  2V3N A;  3U2S C;  2Z0D B;  1KH0 A;  2IZV B;  5CHF A;  3LYY A;  1SE9 A;  1E90 A;  3I9V 1;  5DCN A;  4EKU A;  4AS1 A;  1V49 A;  1KF6 B;  4MGY E;  3QK0 A;  2XN9 C;  5T8I A;  3GP7 A;  4ZOH C;  1MHX A;  1UNS A;  1P0R A;  2WGS A;  3NZ3 A;  4KIK A;  3H7P B;  4NQK E;  4F8C B;  2XBB C;  1SIJ A;  1VCB A;  2NBW B;  2HTM E;  4JWU C;  3WA0 A;  3EEC A;  2JRH A;  4HKQ A;  2OJR A;  2MWS B;  3AEC B;  1TZ1 A;  1FRD A;  2D10 A;  5BYR A;  2E6X A;  3VAW A;  1R4N B;  1F77 A;  3PGE A;  1XCT L;  2WXK A;  3L10 B;  5HKH A;  2GBJ A;  2BYF A;  4HJG E;  4KGS A;  3RZF A;  3GB1 A;  4ZRQ A;  1K52 A;  1GJZ A;  4PS3 A;  4A3P A;  4W9C A;  1FRR A;  3ENE A;  3L08 A;  4M02 A;  1I4R A;  5IKC M;  3AE7 B;  1MG8 A;  4K7U A;  1E7P B;  3DBS A;  1AW7 A;  1T0R C;  3VTU A;  4MM3 A;  5G5G A;  3KH0 A;  3W1S A;  1E10 A;  4PYZ A;  3GS2 A;  1QT9 A;  3AE6 B;  1XLN A;  1WGY A;  4IM0 A;  4HRO A;  3DWG C;  2MBH A;  5TR5 A;  2R61 A;  2MBE A;  4NAW B;  1NEN B;  5J2R A;  2C7M B;  1JW9 D;  2UYZ B;  5IOI A;  1J7B A;  5D3D A;  5D6J B;  1MHH E;  2K1F A;  1V86 A;  3ETR A;  3NZS A;  1QIL A;  4EZK A;  4XE0 A;  2IO1 B;  2L32 A;  4WAF A;  4UDU C;  2MBQ A;  4EZL A;  2BYT A;  2I1K A;  2NS5 A;  2BS2 B;  4JL9 A;  5CHW A;  2WU5 B;  3CF6 E;  3PVL A;  4RH6 A;  1NI3 A;  2FE8 A;  2CHX A;  2XNA C;  1E0Z A;  1XT9 B;  3BVG A;  2Y5C A;  3ZNI D;  4HDO A;  1L4Z B;  1UEL A;  4B9K A;  3RCZ A;  3LB8 C;  3ZTC A;  1STE A;  3DBH I;  1ET9 A;  3TSS A;  2M17 A;  1TS3 A;  1D5M C;  4LNO A;  1P9D U;  3P63 A;  1XQQ A;  4GN1 A;  2HJ8 A;  4ICU A;  1XXG A;  3A1Q B;  5DPT A;  4GDL A;  1QOG A;  1BML C;  4RGM A;  3IXS A;  1SJH D;  3M62 B;  4NZL B;  1E5W A;  5HFY A;  4FXC A;  3N32 A;  3C8Y A;  4KZ0 A;  1F0Z A;  3Q3N C;  2L8J A;  1V9J A;  2IJ0 A;  1ZW7 A;  2J42 A;  2W54 A;  4RGO S;  2BVC A;  2KZR A;  2KVZ A;  4BFR A;  1YJ1 A;  1WM3 A;  1XF5 L;  2ZPN A;  4FLH A;  4ANV A;  1NDD A;  2MX2 A;  3V05 A;  3N20 C;  2RR9 A;  2BB5 A;  1RM6 C;  3N1Z C;  1WX7 A;  3O13 A;  1V6E A;  3ZIM A;  3ECI A;  1FFU A;  2KMM A;  5J17 A;  4FBJ B;  2N4F A;  2IY0 B;  4G0N B;  3A1Q A;  1ZE3 D;  4WWN A;  2O2V A;  2O6V A;  2WDV B;  2KDB A;  1MJD A;  3WAO A;  2D3G A;  2GBM A;  3TEX A;  3A4S C;  1ZKH A;  3RPF C;  3DBL I;  5E6P A;  1JWB D;  3Q14 C;  1QQR A;  4C00 A;  2WXJ A;  1FNW A;  1Z5S B;  1V1P B;  1TJE A;  3AU4 A;  3W2D A;  4ZDV A;  2BKR B;  2M8S A;  3PHX B;  2L1A A;  2J4X A;  4C7Z A;  1E8Z A;  1TKG A;  1V80 A;  4LNK A;  2ZW0 A;  3DQV A;  3V62 A;  1YJI A;  1KM7 A;  1VDV A;  2R2O A;  2MJD A;  1C4A A;  2ZW1 A;  1JRO A;  2DZJ A;  3RNA C;  1WSP A;  3NY5 A;  3NUH B;  1SE3 A;  2QEJ C;  2CU3 A;  2QCZ A;  1CK1 A;  1E8W A;  1GC6 A;  2KC1 A;  4EFO A;  2BYV E;  3V3X A;  2C60 A;  3R7R A;  2KTR A;  4GB9 A;  5FR3 A;  3GE8 C;  1KJT A;  4US9 A;  2N9K A;  2MP2 B;  2ONQ A;  2PIA A;  3UI3 A;  3Q3J A;  1Q5W B;  2C7H A;  3B9J A;  2N9P C;  2DZM A;  3PRP B;  4FAD A;  2MA9 B;  1NYQ A;  4PS7 A;  1SB3 C;  3T3O A;  3KWL A;  3AEB B;  1GNU A;  4JLC A;  1E8Y A;  1YQB A;  3IVF A;  3NRZ A;  3B0A A;  2NMQ A;  4HCN B;  2K3U A;  3M3J A;  1TIF A;  1FXI A;  1A5R A;  4IW0 A;  3PRM B;  2W9N A;  2KYW A;  2K39 A;  3EC8 A;  1NVI D;  2FNJ B;  1NI2 A;  2BQQ A;  2XK5 A;  2FCS A;  4PS8 A;  1WM2 A;  3AXC A;  1BT0 A;  4DK5 A;  1WF9 A;  4G3X B;  2GBN A;  3ZUN A;  2KOX A;  2UU7 A;  1UBQ A;  2K8C A;  5TSS A;  4GXB A;  5FKA C;  3V6E B;  4YTN B;  2DEN B;  2BWE S;  2V3S A;  2KDI A;  2ZNV C;  4G11 A;  2FBW B;  3UIP B;  2WS3 B;  2JZZ A;  4I6N B;  3W5U B;  3GE3 C;  3ZRC A;  3H6N A;  3V6C B;  1KLG D;  5HHD G;  4TSS A;  4DDI D;  1OQQ A;  3ZLZ A;  2ZEQ A;  5CHV C;  2NBV B;  1ROE A;  3A9J B;  1ZOY B;  2AQ1 B;  2B76 B;  1WI0 A;  1B9R A;  2REX A;  2H89 B;  3P4P B;  1MFW A;  2AWT A;  4JWS C;  1GPX A;  3U7Z A;  2LFI A;  4K7S A;  2LEK A;  4IWP A;  1V2Y A;  1SSN A;  2Y5P A;  1JRP A;  2V0G A;  2LUM A;  3QIJ A;  4AJY B;  3NOB A;  5FK9 C;  4ZRK A;  3FIL A;  1T0Q C;  2V1Y A;  2WXQ A;  4M01 A;  3BVM A;  3TCA A;  4GIV A;  2VZK D;  4K81 A;  2FIF A;  4KSL C;  1D3Z A;  1M94 A;  2RDB C;  2AX5 A;  2WXL A;  4MGZ E;  4XYC A;  1C9F A;  5IN7 A;  1Q10 A;  4HRS A;  1JWM D;  1F1H A;  2EKI A;  3W9C B;  1RRB A;  2EMS A;  1WH3 A;  2KLG A;  3AE2 B;  1FNU A;  2SAK A;  3DBR I;  2WX1 A;  3KWV A;  4M8M A;  3AUL A;  2VRR B;  2N9E B;  4KDI C;  4A6Q A;  4WJP A;  2CJO A;  2NCN A;  1D6E C;  1K50 A;  3LJ3 A;  1E9M A;  4HPP A;  2KLC A;  1I4Q A;  3TEW A;  1FO4 A;  1WXA A;  3C0R B;  4HVB A;  4W9K A;  4JQW C;  3N1Y C;  2CKH B;  3W1S C;  4GDK B;  4IOI E;  1SE2 A;  2D07 B;  2IND C;  2KWU B;  2YEP F;  1YN5 A;  2EKE C;  2HDE A;  3NVZ A;  4MH8 A;  1RYJ A;  2ZNV B;  3MTN B;  1D5X C;  3I5J C;  5JHB A;  3P4Q B;  1ZGU B;  3UF8 A;  2W82 A;  2L0F A;  1TY2 A;  3ALB A;  3AE3 B;  1PFD A;  1TS2 A;  1UWX A;  4QAY A;  3OAW A;  1J19 A;  3SFD B;  1HE8 A;  2D3A A;  3HVZ A;  2ZCC A;  1SXT A;  2A5U A;  1FCC C;  2WXM A;  4BOS C;  3IAM 1;  3Q8F A;  5BYS A;  2KO3 A;  4CHK A;  1KFY B;  3WAM A;  2BW2 A;  4OW0 A;  1A70 A;  4TQ1 A;  1I4P A;  4W9H A;  2PKO A;  4MSM B;  2KMA A;  2BT6 A;  2N0S B;  2JUO A;  3KUZ A;  1AYF A;  4ZRP A;  3NHE B;  4J3O D;  4K7W A;  4EUT A;  2M56 B;  3SEB A;  1MI0 A;  2EEL A;  4KIK B;  3AI5 A;  3VRA B;  2X8X X;  4FJY A;  1OFF A;  4ACF A;  2C9W B;  1C78 A;  3HIZ A;  4YSZ B;  4W9F A;  1OEY J;  3JSV A;  2FAZ A;  1J7A A;  3ZRF A;  1EO6 A;  2RGF A;  4XWW A;  3Q8E A;  1I35 A;  3ZTD A;  2WXH A;  4G50 A;  3APD A;  1YMH E;  4AQ7 A;  2KD0 A;  4LNI A;  3SD5 A;  4HLE A;  4NQL B;  4CO7 A;  1QF6 A;  5C23 A;  4KZC A;  2OED A;  2KX0 A;  2MRP A;  3IAS 1;  5J18 A;  3IT6 B;  5LXI B;  2IGH A;  4TMA B;  2L3Z A;  4A20 A;  1QKZ A;  1L7Y A;  1WR6 E;  1WJN A;  2DZK A;  3GZN I;  3VH3 B;  1K8R B;  3NS8 A;  4MM3 B;  3VTV A;  3CMM B;  2FCN A;  2IO0 B;  5JH5 C;  2BS4 B;  4ZRJ A;  1VR9 A;  3L0W B;  3ZJT A;  1KOT A;  1KRH A;  4H2A A;  2KT7 A;  4DQO C;  3DBH B;  3CWI A;  2IO2 B;  4OZA A;  4DXA B;  2CR5 A;  3MFG A;  1UGM A;  2KWC A;  3VHT C;  2QIE B;  5C1Z A;  2JXX A;  4W9I A;  3KYD D;  2IY1 B;  4E3C A;  3ZGZ A;  4EZJ A;  2LMC A;  1Y8R C;  2LJI A;  4OVU A;  4BAX A;  1L4D B;  2LUE A;  1WGR A;  1T0S C;  2VH1 A;  3AE5 B;  3AEA B;  4OZB A;  3Q3F A;  3KVF B;  4JX1 C;  3TBL D;  5BYQ A;  4Q2J A;  3NJT A;  2J7Q B;  3VH4 B;  3VRB B;  1FNV A;  1F2R C;  4KSK C;  2J53 A;  1YX6 B;  1NBF C;  3DHH C;  3RNF C;  3K9P B;  5JZE B;  1TS4 A;  4RFB A;  1Q1O A;  1P3Q U;  1RLF A;  4W9L A;  1MPE A;  1WX9 A;  3ZNH B;  1F52 A;  2WXG A;  3CSF A; 
#chains in the Genus database with same CATH homology
 1JWA D;  2INN E;  2L1A A;  2J4X A;  2Z8L A;  2AQ3 B;  4C7Z A;  1TKG A;  1I4H A;  4MT5 A;  4XDD A;  2ZW0 A;  2LGI A;  1QOF A;  1XO3 A;  1E6E B;  4A90 A;  2CJN A;  1YJI A;  4ZHO A;  1VDV A;  2MJD A;  1C4A A;  2ZW1 A;  4B0M A;  1ZP0 B;  2WXO A;  1JRO A;  2I38 A;  1L0V B;  1TKY A;  1V8C A;  3BWU D;  1WSP A;  4GDL B;  3NUH B;  1J7C A;  4D2K A;  1FM0 D;  3KLS X;  1SE3 A;  2QEJ C;  4L2Y A;  2IPK D;  1YNT E;  2G9H D;  2CU3 A;  4WWM A;  3AM9 A;  1IGC A;  1IUE A;  1CK1 A;  4XWT A;  3TUO A;  1PGB A;  1VJK A;  1QOB A;  1M4V A;  2V4I B;  3AED B;  3V3X A;  3R8B A;  2Q5W D;  1VZ6 A;  5FR3 A;  3T3N A;  3EGR A;  1PDX A;  4US9 A;  1ZDV A;  2N9K A;  2LHD A;  4YT0 B;  2ONQ A;  1KTK A;  2PIA A;  3AMZ A;  3UI3 A;  3AEG B;  4GLS C;  4C7Y A;  1GB1 A;  3B9J A;  4M0W A;  4YSX B;  1RFK A;  5LNK 1;  1EWC A;  4A8X C;  1UUP A;  1TS5 A;  1XLP A;  1SEB D;  1NYQ A;  5G5H A;  1SB3 C;  4KGR A;  4A9A A;  3T3O A;  3KWL A;  3AEB B;  4WUR A;  3U52 E;  2K5P A;  3ABV B;  3H8H A;  1XLQ A;  2QJL A;  3NRZ A;  1D5Z C;  2NMQ A;  1IGD A;  2K3U A;  2RDG A;  1FXI A;  4JPS A;  4EE2 A;  4P6V F;  1ZXI A;  4N6E B;  1HZ6 A;  2LHE A;  2WXN A;  2TSS A;  1JQ4 A;  5HG2 A;  1NVI D;  4OVZ A;  1UGJ A;  3AE9 B;  1HQR D;  1MVK A;  1CJE A;  3NVW A;  1DOX A;  1V97 A;  2AQ2 B;  3Q8C A;  4KGT A;  1Y56 A;  5EE1 A;  2W3S A;  1YJJ A;  1SE4 A;  2INP E;  2Y3A A;  5TSS A;  3R2I A;  4LK0 M;  2N9L A;  5FKA C;  1KLU D;  3J9C A;  4PT5 A;  1GAQ B;  3PO0 A;  2ON8 A;  4LTU A;  1DGJ A;  4YTN B;  5EE3 A;  3Q8A A;  4CQN A;  2BTE A;  1JML A;  3AEF B;  3AE4 B;  2KAJ A;  1TKE A;  2WXI A;  3AB5 A;  3EUB 2;  1ZXH A;  2FBW B;  2WS3 B;  1ZDX A;  5BMI A;  2JYT A;  3R2T A;  1FFV A;  3W5U B;  2WP9 B;  3AE8 B;  3RFZ B;  3LXF A;  4REZ A;  1HEZ E;  1KLG D;  5HHD G;  4ZYS A;  2ACZ B;  2JZP A;  4TSS A;  2PMV A;  4YWG G;  1N5W A;  2MH7 A;  1L0X B;  1OQQ A;  1PGA A;  4B0E A;  2DYO A;  1L6V A;  4RCO A;  4US8 A;  5D3I B;  1ROE A;  1EM7 A;  2RPV A;  3EA6 A;  4HKZ E;  3PZ7 A;  2I2Y A;  1ZOY B;  3NS1 A;  4JE3 B;  2AQ1 B;  2B76 B;  3MP9 A;  1EU3 A;  4R3D A;  1ACC A;  2L83 A;  1QOA A;  1B9R A;  4N58 A;  1N63 A;  2H89 B;  3P4P B;  2DLB A;  1VZ7 A;  1P7F A;  3P1M A;  1ENF A;  4JWS C;  5AUK A;  1GPX A;  4A55 A;  4TQ0 A;  2JX5 A;  3U7Z A;  2LFI A;  4C80 A;  1FCL A;  3L4P A;  2LEK A;  3URY A;  1JWS D;  1RWS A;  1SSN A;  2Y5P A;  1JRP A;  3SR6 A;  2V0G A;  4WH4 A;  3BZD B;  2LUM A;  5AUI A;  1VZ8 A;  1K51 A;  2K0P A;  2X38 A;  1R7S A;  4NJC A;  4WIP A;  5BMG A;  1K53 A;  1AN8 A;  1JCK B;  5FK9 C;  1AWD A;  1D4B A;  2DWQ A;  3Q8B A;  3FIL A;  2WXQ A;  3IT4 B;  1LO5 D;  2H88 B;  4KKJ A;  4YTP B;  3BVM A;  2DYM A;  2KQ4 X;  3P4R B;  2WXP A;  2VZK D;  2FUG 1;  2WU2 B;  1HXY D;  4LLG M;  2RDH A;  3I57 A;  4KX6 B;  2PW9 A;  4IKG A;  2AX5 A;  3BYY B;  4ITK A;  1SBB B;  2DBY A;  4RGN A;  1B1Z A;  2WXL A;  1C9F A;  3AEE B;  1Q10 A;  2JSV X;  1PGX A;  3DWM A;  1XCQ L;  4HRS A;  1PUT A;  1JWM D;  2EKI A;  3FAH A;  1HA5 A;  2MEK A;  3W9C B;  3B2F A;  1C79 A;  2MJ3 A;  3BYT B;  3ZJU A;  3CIR B;  3AE2 B;  1FNU A;  2SAK A;  2V3N A;  3U2S C;  2OHF A;  1KH0 A;  3KWV A;  2WLB A;  4OHJ A;  2JWU A;  4A6Q A;  1C4C A;  2CJO A;  1EU4 A;  1D6E C;  1YN4 A;  1K50 A;  1VLB A;  3HUI A;  3LYY A;  2NTS A;  1E9M A;  3I9V 1;  1YQ3 B;  1L5P A;  2WXR A;  4AS1 A;  1IBX A;  1I4Q A;  1KF6 B;  1N62 A;  3TEW A;  3BK2 A;  1FO4 A;  2E3T A;  2XN9 C;  5T8I A;  3GP7 A;  4ZOH C;  1MHX A;  1UNS A;  1TY0 A;  2J52 A;  1XEE A;  3NZ3 A;  1OQR A;  2GRI A;  3OWE B;  5H8Y E;  3TEY A;  1V1O A;  1SIJ A;  1C4P A;  1WGK A;  2HTM E;  4JWU C;  1WWT A;  4C56 C;  4GDK B;  4IOI E;  2GB1 A;  1VRA B;  1SE2 A;  2YEP F;  3W5V B;  1YN5 A;  5BMH A;  2HDE A;  3NVZ A;  4MH8 A;  2ICI A;  4HKQ A;  3AEC B;  1FRD A;  5BYR A;  1RYJ A;  2E6X A;  3U4E G;  3W2D A;  1F77 A;  2JU6 X;  1WRI A;  2PTL A;  1GOZ A;  1XCT L;  1D5X C;  3E9S A;  4N59 A;  3P4Q B;  2WXK A;  3BK1 A;  2WDQ B;  4L23 A;  4HJG E;  3AE1 B;  4KGS A;  2W82 A;  3N9Y C;  3GB1 A;  4ZRQ A;  4DXF A;  1TY2 A;  3FIL B;  1K52 A;  3AE3 B;  1PFD A;  1TS2 A;  4ZHP A;  1TZO A;  1UWX A;  3SFD B;  1SF0 A;  1PYW D;  3HVZ A;  2N7J A;  2QSD A;  1FRR A;  3MC0 B;  1DYQ A;  2WNM A;  1ESF A;  1QLB B;  1I4R A;  1L6U A;  1SXT A;  3ZQ4 A;  3AE7 B;  1DOY A;  1XLO A;  1FCC C;  2WXM A;  1E7P B;  1AW7 A;  1BUI C;  1CQV A;  2K22 A;  3VQI A;  5MPO A;  1WYG A;  5G5G A;  3IAM 1;  3NVV A;  3Q8F A;  4XDC A;  5HI1 A;  2QMT A;  5BYS A;  4IDI A;  2BB6 A;  3W1S A;  2IGG A;  1E10 A;  3GS2 A;  3BVZ A;  1QT9 A;  3AE6 B;  2WDR B;  1KFY B;  1XLN A;  2KN4 A;  2QIL A;  4WQM A;  4HRO A;  1CZP A;  2BW2 A;  3DWG C;  1GB4 A;  4OW0 A;  2G1E A;  1I4X A;  5EE0 A;  2R61 A;  1A70 A;  4NAW B;  4TQ1 A;  1I4P A;  3HRD D;  2PKO A;  3P42 A;  1HZ5 A;  1NEN B;  2BT6 A;  1JAL A;  2SEB D;  4KKI A;  2KWD A;  1P7E A;  2N0S B;  2KDM A;  5I4D A;  3AN1 A;  2GI9 A;  4USA A;  1JW9 D;  1AYF A;  3WCQ A;  4ZRP A;  1NEK B;  1IBX B;  1J7B A;  4J3O D;  4DXG A;  5D3D A;  1MHH E;  2M56 B;  3SEB A;  1MI0 A;  4L1B A;  1T3Q A;  2K9X A;  3ETR A;  2EEL A;  1JWU D;  4YSY B;  4NAM A;  3VRA B;  1QIL A;  3SFE B;  4XE0 A;  2D5G A;  1OFF A;  1ET6 A;  2L32 A;  4RGT A;  4WAF A;  4UDU C;  1C78 A;  5D7G A;  4YSZ B;  1J7A A;  2BYT A;  4ARI A;  5GXG B;  3VR9 B;  4XWW A;  1TYG B;  2BS2 B;  3Q8E A;  1FD6 A;  2WU5 B;  2WXH A;  1EWY C;  4RH6 A;  3FC4 A;  4YTM B;  1YMH E;  4AQ7 A;  1NI3 A;  2FE8 A;  2M19 A;  5C3J B;  2XNA C;  1E0Z A;  4RF1 A;  1FEH A;  2PLP A;  2YEP B;  3BVG A;  3ZYY X;  1C76 A;  2Y5C A;  1V1P A;  1QF6 A;  5JXV A;  2NTT A;  1L4Z B;  1ZPS A;  2OED A;  3AH7 A;  3LB8 C;  2VZK B;  3IAS 1;  1STE A;  1ET9 A;  1ZUD 2;  3IT6 B;  3TSS A;  1N5X A;  2IDY A;  2IGH A;  4TMA B;  4RNA A;  2BS3 B;  1TS3 A;  1D5M C;  3MJ5 A;  3P63 A;  1DOI A;  1QKZ A;  5H92 C;  2WXF A;  2JYE A;  1T5X D;  2M0A A;  1XXG A;  1NYR A;  4MM3 B;  2BBC A;  1QOG A;  1BML C;  4RGM A;  2RMM A;  1YN3 A;  2BS4 B;  3IXS A;  1VR9 A;  3MHZ A;  1SJH D;  2W55 A;  3PZ8 A;  3ZJT A;  4NZL B;  2V3P A;  5HFY A;  4RF0 A;  1KRH A;  3P4S B;  4H2A A;  4FXC A;  1BXT A;  3HVD A;  1N60 A;  2WQY B;  4DQO C;  1F2R I;  3CWI A;  4OZA A;  2JQR B;  4YXD B;  3C8Y A;  1I4G A;  1F0Z A;  2PVG C;  3MFG A;  2IJ0 A;  2J42 A;  2QIE B;  2W54 A;  4RGO S;  3B2G A;  1SJE D;  1XF5 L;  3ZGZ A;  1N61 A;  3TEZ A;  2LMC A;  3NVY A;  3V05 A;  2JXT A;  1I7H A;  2LJI A;  5EE9 A;  1L4D B;  2BB5 A;  3ZJV A;  2W3R A;  1FXA A;  1RM6 C;  2KAC A;  3O13 A;  3AE5 B;  1FFU A;  4OZC A;  1C77 A;  2KMM A;  3AEA B;  3BII D;  1UWM A;  2PVO D;  1YQ4 B;  4OZB A;  1ZE3 D;  2WDV B;  2IGD A;  1WXQ A;  4JX1 C;  4P16 A;  5BYQ A;  4Q2J A;  3VRB B;  1FNV A;  1F2R C;  3Q69 A;  3RPF C;  3TEX A;  2J53 A;  1JWB D;  2L52 A;  1QQR A;  4O1N A;  2MJE A;  4ARC A;  1FIQ A;  1T6B X;  3VR8 B;  2WXJ A;  4HEA 1;  1TS4 A;  1FNW A;  3KQ4 A;  1V1P B;  1TJE A;  4MAC A;  4RFB A;  1L0Y B;  3E56 A;  5C2T B;  1MPE A;  1FMA D;  2WXG A;  3AV8 A;  5E6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...