1YMHE

Anti-hcv fab 19d9d6 complexed with protein l (ppl) mutant a66w
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
KEEVTIKVNLIFADGKIQTAEFKGTFEEATAEAYRYADLLAKVNGEYTWDLEDGGNHMNIKFAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparison of the crystallization and crystal packing of two Fab single-site mutant protein L complexes.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
molecule keywords Fab 16D9D6, light chain
total genus 15
structure length 65
sequence length 65
chains with identical sequence F
ec nomenclature
pdb deposition date 2005-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ymhE00
5HFYA 1UWXA 2J52A 1IGCA 2GB1A 1P7FA 2NMQA 1IGDA 1Q10A 2KDMA 2N9LA 2ONQA 1YMHE 2KQ4X 2QSDA 4GLSC 4HJGE 3UI3A 4WH4A 2IGGA 5JXVA 1EM7A 1C9FA 2I2YA 4KGTA 2GI9A 2N9KA 1HZ5A 3FILB 3MP9A 1F2RI 1F2RC 1P7EA 1K52A 1D4BA 2N7JA 4OZBA 2J53A 5BMHA 1XCQL 2JXTA 2JU6X 1IBXA 1HZ6A 2JZPA 5BMGA 2OEDA 1PGAA 4IOIE 2IGDA 1FD6A 1FCLA 4OZCA 1QKZA 1YNTE 2PTLA 3FILA 1HEZE 1FCCC 1K53A 4KGSA 1XCTL 2JSVX 2LHEA 1XF5L 2EELA 4KGRA 2KWDA 1MVKA 2QMTA 4OZAA 2PLPA 1PGXA 2KACA 2I38A 1GB1A 1MHXA 1ZXHA 2K0PA 2LHDA 1MHHE 4IKGA 2ON8A 4D2KA 2JWUA 5HI1A 1JMLA 2RPVA 2ZW0A 2IGHA 4HKZE 1PGBA 5HG2A 5HHDG 4MACA 2RMMA 5BMIA 2LGIA 2PW9A 2ZW1A 2KN4A 1IBXB 1MPEA 1K50A 1K51A 1KH0A 3V3XA 1MI0A 3GB1A 1GB4A 2LUMA
chains in the Genus database with same CATH superfamily
4OVZA 4W9FA 2JZZA 3DPDA 4TSSA 4ZYSA 1I4HA 2RDHA 5LXHA 1WJUA 5GMVA 4LTUA 1YOVB 2QHOA 2JT4B 3A1QB 2O2VA 3L17A 3APFA 4WH4A 2WHIA 3UGBB 3RI7C 2IGGA 2FE8A 2WDTB 2ZCCA 2IO1B 2BBCA 5IAAC 4N58A 2PIAA 3TMPB 5LLIA 2HDEA 1XLQA 3Q2AC 4KDLB 4IM0A 1YQ4B 2BGFA 2Y5BB 1D5MC 4AQ7A 3M62B 2QIEB 3L16A 2WXNA 4GOCA 3RNGC 3E9SA 1BT0A 2EMSA 2D10A 3NJTA 5G2NA 4BAXA 1GUAB 3PO0A 4DDID 1HEZE 4M8NA 4RGTA 2KDEB 1WXAA 4GMVA 4KGRA 2MQJA 4YSYB 3K9PB 4NAWB 1L2NA 2WXQA 1QOAA 3CF6E 4S0RA 1SJED 3A1QA 2L7RA 3PV1A 4BBNF 4C4VB 4MT5A 2BVCA 2K9XA 3JSVA 4F7ZA 2JPHA 2LGDA 4GGQA 3VRAB 4AWJA 3M95A 2L8JA 2RDBC 1M94A 3AI5A 2KTFA 1YJIA 4YWGG 2KN5A 1K51A 2LMCA 2KFJA 3UQBA 1IGCA 3SEBA 1WI0A 2KDMA 4KZ0A 1UZXB 1XO3A 2BYEA 3WALA 4YTNB 2MEKA 3Q3FA 1WZ3A 2KT7A 1A70A 3GZNI 3Q3JA 3L54A 3BYTB 5D7GA 2CHWA 4XWWA 1CMXB 3M3JA 4RH6A 4TV3A 4AUQC 5CTRC 1G6JA 2YVCA 3IAM1 3N9YC 4C00A 3TEWA 3RNAC 1UNSA 4HPMB 2BQQA 4XDCA 1FXTB 3DVNV 1TS5A 1E90A 1Q0WB 3ZIMA 5T8IA 4NJCA 3E56A 1WJNA 4OZCA 3ZUNA 2J4XA 3KUCB 3VH3B 1FCCC 2E3TA 1E8ZA 3PSEB 1A5RA 3RYTA 2PLPA 2KACA 4KVGB 4DDGD 3C19A 2JF5A 2DENB 3B0AA 3ZNGC 1KOTA 2OJWA 1ZXHA 2KDFB 3R7RA 3AE2B 2MA9B 2V3PA 4AP4C 2XEWA 1ENFA 1WX8A 4TQ0A 5E6JA 2C5LC 3RNBC 2MP2B 1L7YA 3PHXB 1EWCA 2RGFA 3FC4A 1MFWA 2D11A 2L32A 5DPTA 3ZVVA 4W9IA 2ASQA 3GB1A 3NS8A 3EUB2 3APCA 1YX5B 2KVZA 2GB1A 4DBGA 4YT0B 1Q5WB 1P7FA 1KFYB 4BKTA 2NS5A 2K8BA 3LXFA 4TUUA 4DXFA 3D32A 2GBKA 3ALBA 1SEBD 4NQLB 2KYWA 2DBYA 3QA8A 2KK8A 2GI9A 4IG7B 1X1MA 2N9KA 2KMAA 2O6VD 3PVLA 1JWBD 4W9CA 2UYZB 3TSSA 1HZ5A 1YN4A 1TIFA 2CJNA 1J7BA 4XYCA 4M0WA 3VH4B 1EF1A 4W9LA 1T0SC 4RM8A 1SGHA 4DHZE 4XWTA 4FXCA 3IAS1 2WXRA 1HA5A 4RGOS 2FUHB 4EZJA 2ZJDA 4YL8A 1FEHA 2PVGC 2QC8A 1L0XB 1VCBA 3BVMA 4K7UA 3DBRB 4XE0A 3MHSD 3R2TA 1VZ7A 4ZRQA 1T0RC 1FFUA 5KHQA 1UGJA 4W9DA 2MH7A 2NPTA 2BB5A 3JVZX 1HE8A 4CYEA 1YJJA 1L0YB 3BWUD 1C79A 2MBOA 1GB1A 2KKCA 3MTNB 4P6VF 3AE7B 5FR3A 4USAA 4MJSB 1P1AA 1V2YA 2ON8A 3B2FA 4S17A 3VUWA 1YN5A 3KWVA 3ZNHB 4G11A 1AWDA 3P4PB 2ZW1A 2LGYA 4GIVA 1UWMA 2LUMA 1WGDA 2WXJA 4BOSC 1TGZB 2DZKA 1SB3C 2XNAC 1C78A 1TZ1A 3V61A 3CWIA 1SE4A 3SDLC 1GG3A 1M4VA 1JRUA 1VRAB 2KQ4X 3MJWA 2IO3B 3H9DA 4URKA 4BZAA 3H1UA 2B76B 2K22A 3OWEB 2IPKD 3N1YC 4MM3B 2M8SA 2LJ5A 4A8XC 3MC9A 3OJ4B 4Q2JA 2BT6A 3KW5B 1F77A 2KOXA 2JXTA 1IBXA 1UGMA 2M17A 4WQMA 4PT5A 3LDZE 2XK5B 4LDTD 2MWSB 2NTTA 2KXJA 3ABVB 2D3AA 4X57B 5H92C 4G0NB 2BS4B 3H7SA 3Q8AA 3KWLA 4ICVA 4ZRKA 1FPYA 4ARCA 4JIOU 2LASA 2MSED 1FIQA 4JWUC 3H8HA 2BYVE 2KTRA 4WIPA 3NVWA 1V80A 4WWPA 3DOWA 2BKFA 3AEDB 4N59A 3AEEB 4R3DA 4LK0M 1DYQA 4C80A 4B95A 1TS2A 3W1SC 1XEEA 3BY4B 3V6EB 1KH0A 5L95C 3L08A 2V1YA 3Q8BA 2X38A 1IYFA 3AECB 1VZ8A 3N3KB 3GOEA 1P3QU 1JALA 2M19A 3ZDMC 2J7QB 3N30A 1NYQA 4W9HA 3W5VB 1T6BX 3NS1A 3UIPB 3A9KB 2BTEA 1OGWA 1PDXA 2LEKA 1WGKA 3DDCB 5E6PA 1WYWB 1UF0A 5BYQA 5IKCM 1CK1A 2RDGA 3ECIA 1WMHB 4NAMA 2LGXA 4E3CA 4QAYA 4WJQA 3ZRFA 3QX1A 3OAWA 5J2RA 1WGRA 2KC2A 1TKYA 3PHWB 4EUTA 3ZQ4A 1NDDA 3FAHA 1PGAA 1FD6A 4NY0A 2KC1A 2KZRA 1TTNA 2DAJA 2PTLA 4OVVA 2INCC 4RFBA 1JW9D 2JRIB 1ZDVA 2O6VA 2KWVB 1FFVA 4CQNA 3TL5A 4J6IA 2QMTA 2Z0EB 4LLGM 2G4SA 4G3XB 3B2GA 1LQBA 1KM7A 3AE4B 4ARIA 4MGIE 2FCSA 5AZHA 3NZUA 1WXMA 2KWCA 2KX0A 1F52A 2MBEA 1SXTA 3Q8CA 1FM0D 3P1MA 3A4SC 2IDYA 1V5TA 3RCZA 3AH7A 2FUG1 1KLVA 5AZFA 4MELA 1FXIA 4F1SA 1C4AA 1IBXB 4EKUA 3A33B 2DZMA 4ZRJA 4KKIA 1V8CA 4AJYB 2KJ6A 3VQIA 2CKHB 5AUIA 1FNVA 2DAFA 3RNFC 1YX6B 2ZVNA 3HVDA 1BUIC 3TEXA 1WR6E 5IN7A 1K8RB 4K1RB 1JRPA 2L0FA 3DBLB 2K8CA 4HLEA 2N1WA 4EOYA 4MEMA 3AULA 1D3ZA 1WJ4A 2GOWA 5FR6A 4KGTA 1WGGA 2N7DA 2JY6A 4KSKC 2UWQA 1Y8RC 4AS1A 2PJHA 3BZDB 4OZBA 1ZXIA 1WXVA 3VTWA 3WIMA 3B1LX 3ONSA 2W55A 3DCGA 2OEDA 1UBIA 4PS7A 3BYYB 4P1BC 2N4FA 4AOFA 1SBBB 4E71A 3JSVB 1K53A 1EU4A 4LNIA 2WLBA 1WX7A 1NI3A 1V81A 5GXGB 1JWSD 4ACFA 4DHJD 5D3DA 4KKJA 4XGAB 4MDKE 1WM3A 3DBHB 2L00B 2WS3B 3S2AA 1QOFA 1V1PA 4OVUA 4FULA 2Z0DB 3WAPA 4HJKA 3SFDB 1FNWA 1YN3A 4IKGA 2WX1A 2ZPYA 3ZXVA 4KDIC 2JYEA 4LJPB 4TQ1A 1ZW7A 3GP7A 2RMMA 4FJVB 5BMIA 1OFFA 2MJEA 4HCPB 4PYZA 3R66C 2SAKA 3VFKA 5EE0A 2IY1B 3T8MA 2INDC 3JYUA 2AX5A 1GC7A 2H89B 4WJOA 1TYGB 1YMHE 2L76A 1ZKHA 4XZ4A 2VRRB 4PS3A 3APDA 2KMCA 4BKSA 3PLUA 2PEAA 3Q6BA 1R4MI 1WXSA 2LI5A 1LM8B 3J9CA 2VH1A 3LB8C 2KFKB 1KF6B 2HD5B 2REXA 5MPOA 4NNJB 2FCMA 5KHOA 3A9JB 4M00A 1PUTA 4RGMA 2DYOA 3H7PB 1E9MA 2ZEQA 4IOIE 1WGYA 3ZTCA 3SHQA 3PREA 2BWFA 3PZ8A 3PGEA 3IBEA 1DOXA 4IC7B 1XF5L 2WQYB 4M02A 2QEJC 3MFGA 3TBLD 5DPWA 1MJDA 4RCOA 4WWOA 2FCQA 4DXAB 4BBNC 2LZ6A 4EFOA 2N9EB 3C8YA 1EO6A 4K81A 2V0GA 5BYSA 3QJZA 3I5JC 2N1VA 2AYOB 5JHAA 2MRPA 2IGHA 2AL3A 4GU2A 4US9A 5FKAC 3PLVA 1L6VA 3MJ5A 5G55A 1B9RA 4BOZB 5J18A 2DHZA 3KLSX 3WA0A 2J52A 2MW5A 2NBUA 1HTQA 2EMTA 1Q10A 1EF5A 2K3UA 2ONQA 2NBWB 5L83A 5DPRA 2KWUB 3FKYA 4ANUA 4ZYNA 2C7NB 3I63C 1LXDA 4XC2A 4LNFA 3ETRA 4HWIB 1JWUD 2CS4A 2M0AA 3NHEB 2KX3A 3UI3A 3DHGC 2WXFA 3HUIA 3SU8X 5C23A 3T3NA 4W9EA 3U7ZA 1T3QA 4JX1C 1B1ZA 4P7IA 4I6PA 3HM3A 1Z2MA 2DNFA 1WY8A 4KV2A 3W2DA 1P98A 5AUKA 1EUVB 2KNBA 1QOBA 2CR5A 1E5WA 2D3BA 1I4GA 4GB9A 3W5UB 3Q69A 3CSFA 2FIFA 3SFEB 4ANVA 2JRHA 3VR9B 4MH8A 3PZDA 3UINB 5DCNA 1ROEA 3FILA 3QQ8B 4KGSA 2K25A 4KZCA 3ZKJC 4C4VA 1MVKA 1S3SG 4OZAA 2KJRA 4NZLB 1EU3A 3UQAA 1YJ1A 1V9JA 4JPSA 1ZE3D 1E7PB 1Q1OA 2D5GA 4US8A 1WE7A 1RFKA 4BVUC 2E6XA 1I4QA 2RPVA 4LCDE 2VZKD 3PZ7A 1V6EA 1N61A 3HM6X 2CHZA 3NUHB 1MPEA 2G3QB 4MGZE 2BWES 4HROA 5G5HA 2C9WB 4PYUA 1LFDA 4HCNB 1RYJA 2AEHA 3OG5A 4W9KA 2KD0A 2ZCBA 3AEBB 1WMHA 1MG4A 4WQOB 3U8ZA 1LGRA 2CU1A 4LJOB 2N9PC 1JCKB 1UBQA 1SE3A 2I1JA 1E6EB 2RR9A 3KQ4A 1D5ZC 4A9AA 2IO2B 4EEWA 2MJ3A 5EE9A 1TY2A 1Z5SB 3HK0A 2WU5B 2BYTA 2A5UA 2JXXA 1WGHA 2YEPB 2OJRA 1NVID 3GS2A 2J42A 1OQRA 2MLBA 2JX5A 2WX0A 3N1XC 1D5XC 4II3B 1TZOA 4MGYE 5HKHA 1FCLA 2DYMA 4M0WB 4WAAA 3AE5B 1PQSA 2RSUA 3ZNID 2HJ8A 3DQVA 2NTSA 4F8CB 4ITKA 1V97A 4REZA 4IWPA 4BKGA 4HRSA 2ZPNA 1TKGA 4JQWC 3GE8C 3QCAA 2DYBA 2W54A 3EHVA 1QOGA 2JWUA 1JMLA 2WXLA 2ZW0A 4EZKA 2D2QA 2INPE 4RF0A 3P2BA 2GRIA 3A9KA 2L0TA 1Y56A 3RUIB 2PW9A 3ZXRA 2V3SA 2N9XA 3A9JA 2ICIA 2K6QA 2V4IB 2NBVB 4ZHPA 2UU7A 4RF1A 1V1OA 1ZP0B 3N20C 2KFKA 3VR8B 1TKEA 1SIFA 1ET9A 2FBWB 2MX2A 4C56C 1WE6A 4DXGA 1IP9A 3UF8A 4GDLA 1L4DB 4DHJB 2NR2A 2GMIC 1EM7A 2HJ1A 3AXCA 3ZRCA 4IUMB 3FILB 3RNCC 1T0QC 5JHBA 5TSSA 2RPQA 4W9JA 3MC8A 1E0ZA 1NENB 2KDIA 1XCQL 4NQKE 1T5XD 4ICUA 2JZPA 2WXHA 3AE1B 5BMGA 3BVGA 4ZRIA 2IGDA 5IP4D 2M0XA 1XT9B 4UDUC 1QKZA 4J3OD 4TKNA 2JWZA 2XBBC 3KUDB 3VUYA 4JWSC 3PRMB 2K8HA 2J0JA 3P4SB 4MGKE 3PRPB 3U4EG 2Y5PA 3NG0A 1FRRA 2WXMA 2L05A 1RAXA 2KDBA 3URYA 2G1EA 4YTPB 2ZZPB 5EE1A 1KLUD 3EGRA 1E8YA 4D2KA 3EC8A 2WXGA 2I1KA 1TJEA 5HHDG 5G5GA 2KHWB 3ZGZA 4EE2A 4FHKA 2BKRB 2WXIA 2HE7A 1MI0A 2BF8B 5CHWA 4WWNA 1ZDXA 3LYYA 3VTVA 1PYWD 1QLBB 3KYCD 4P1CC 3ZDTA 1SIJA 2FAZA 3GZNB 1GNUA 2IO0B 2N9LA 4ZDVA 3KYDD 3RMKC 3SD5A 3ZO5B 4I6NB 3H6NA 4LNNA 2R2OA 1DOIA 5D3IB 4GLSC 3W1YA 3AV8A 3DWMA 2KQ7A 4HDQA 3HRDD 3R2IA 1QZEA 3X23A 3ZW3A 2W3RA 3NVZA 1N5WA 1WIAA 3PS6A 1F2RC 1ACCA 4RMAA 2X8XX 5BYRA 3WANA 1OEYA 4YTMB 1WRDB 1S1QB 4NAWA 1H4RA 1TBEA 3H7PA 3AE9B 1C77A 2CHXA 4FN2A 1R4NB 3L10B 4FADA 3O65B 1DOYA 3V62A 4WWMA 3AB5A 2C7MB 2XN9C 1XCTL 1YD8U 3HHMA 2D3CA 3QIJA 1VZ6A 4KIKA 1TT5B 2EELA 2KWDA 1IUEA 2D07B 1SF0A 1J8CA 1RWSA 3VVWB 1FNUA 1NEKB 2LVOA 2WXKA 3K9OB 1RFAA 2DLBA 2LHDA 5JZEB 2QCZA 3PRZA 4RM9A 4OW0A 2MJDA 1SE9A 1FO4A 1E7UA 1ZGUB 2GBMA 2Q5WD 1J0GA 4WURA 2JUOA 2R2QA 5IOIA 2KMMA 1D6EC 3AU4A 4IWQA 3KUZA 1NBFC 2IY0B 5HFYA 3TCAA 3TUOA 1HQRD 2W9NA 2LVQA 1E8XA 4N6EB 2ZNVB 3A4RA 2MP2A 2NMQA 3B08A 3X0WA 2OHFA 4B0MA 3V6CB 3R3MA 1BXTA 3PTFC 1HTOA 3VHTC 4A55A 1V1PB 4B9KA 3TEYA 3T3OA 3L4PA 2Z8LA 3AN1A 5BO4B 4LNKA 2PMVA 2K5PA 3OJ3A 4BKSD 1J7AA 1WM2A 2SEBD 1OQYA 3UIOB 3Q8FA 2IJ0A 2LRWA 1F2RI 2C7HA 1FRDA 1P7EA 1K52A 2N7JA 2L1AA 3AE6B 4JL9A 1UUPA 4B0EA 2KAJA 5BMHA 1R4MB 5IA7A 5E6NA 2JU6X 2M1MA 3BVZA 4DK5A 3NOBA 1NYRA 1SSNA 3ZJUA 3BIID 4OHJA 4ASWC 3IXSA 3AEGB 3I57A 4MSMB 3ENEA 5EE3A 4XX5A 5CX3A 1MG8A 3DBHI 4L23A 1P9DU 3RNEC 2JSVX 4NPNA 3ZNZB 2XK5A 3BK1A 1PGXA 3M63B 1ESFA 2MHJA 2LRUA 3QC8B 4P16A 2LJIA 1FMAD 1WR1A 2BYFA 1AN8A 2MBQA 1ET6A 1E8WA 4PS8A 4L1BA 1U4AA 2KN4A 3EFUA 1XLNA 4MH0E 4LDTB 4AJWA 3AE3B 1UWXA 4JLCA 3IFWB 1XLOA 2IYDB 4A3PA 1IGDA 1YQBA 4E74A 2FCNA 2WWZA 1WRIA 3NVYA 1AARA 1SE2A 1WF9A 4GDLB 4IM2A 2NCNA 3AMZA 2W82A 5CHVC 3SR6A 4ZHOA 4NJ7A 4FJZA 1JROA 2VZKB 3HVZA 3ZJTA 3RFZB 1WX9A 2IZVB 1V49A 4GDKA 1C9FA 2K1FA 1I4RA 1SJHD 3RZFA 4II2B 3CMMB 1VR9A 2JQRB 3Q3NC 1F0ZA 1AYFA 1LO5D 3VUXA 1UELA 1H8CA 1D4BA 3PT2B 3CSTA 5LXIB 3EA6A 2MBHA 5C2TB 3RN9C 3W9CB 1C76A 3V60A 4YXDB 1T0YA 2L83A 1FXAA 3MC0B 5C1ZA 2O2VB 2IBIB 1QF6A 3VRBB 2KJHB 4M8MA 1C1YB 2Y5CA 4JE3B 1I4PA 3V05A 2WXPA 3DBRI 1XD3B 1VLBA 4HK2A 3TEZA 2V9HA 4EZLA 3OLMD 5AZGA 3KVFB 2OOBB 1KJTA 4N9F4 3LJ3A 3AEFB 2DX5B 2KQSA 3AU5A 3MHZA 3VAWA 5HI1A 2KVRA 5H8YE 1STEA 1PFDA 4M01A 3I3TB 2R61A 4HKZE 2PE9A 2AQ3B 4ANWA 2BS2B 4MACA 1VDVA 1WXQA 4MSQB 5J17A 2KLGA 3U52E 3ZLZA 1C4PA 2INNE 1ZUD2 3DVNU 2J0MA 3WAMA 3QK0A 2Z59B 3P42A 2ACZB 4TMAB 1V86A 2Y3AA 3JW0X 2DZJA 3AEAB 3P4QB 4RGNA 1J7CA 1N5XA 3DVGY 1YIWA 3TIXA 1WWTA 1CQVA 2L3ZA 3P4RB 3NY5A 1L0VB 5C3JB 2HTHA 2WU2B 1JWMD 4FA6A 3QHTA 3R8BA 1C3TA 2M4NA 1OEYJ 4KIKB 2ZNVC 4NJ6A 5D2MB 4DQOC 2L52A 1N60A 2LXCA 1C4CA 2KTRB 2LGSA 1CJEA 1UD7A 3RD2A 3W1SA 2BB6A 2AQ2B 2LVPA 2FIDA 1JWAD 2JVCA 4CHKA 2WYQA 4HPPA 3RZWC 4DWFA 4PK1A 1GPXA 4GXBA 2RD0A 3N32A 1E7VA 2V3NA 4O1NA 1L5PA 3WCQA 4A6QA 1GJZA 2DWQA 1TS4A 1GAQB 4IW0A 2LHEA 4XDDA 2GBNA 2BS3B 1HXYD 4K3CA 4MJSA 3ZYYX 4YSZB 1WH3A 2WXOA 4G50A 1KRHA 1QILA 5CHFA 1QT9A 1RRBA 2DZIA 2G45B 2VH2A 3VDZA 4K3BA 3ZTDA 4LNOA 2PKOA 2K0PA 2AQ1B 3NZ3A 3KH0A 1XXGA 2GBJA 1I4XA 4IM3A 3DHHC 2JZ3B 1PGBA 5FK9C 2LXAA 3BINA 1ZPSA 3NVVA 2MCNB 4FHJA 2V4LA 1XLPA 1K50A 3V3XA 4KX6B 1V5OA 2QILA 2D3GA 2K39A 1IPGA 2WNMA 4BFRA 2WGSA 3CIRB 1XQQA 2FNJB 3HIZA 3IT6B 4ZOHC 4FLHA 4MM3A 2QSDA 5D6JB 4HJGE 2AWTA 1ZOYB 3ML8A 1GC6A 1F9JA 1NI2A 3QARA 2PPHA 3QWZB 3RT3B 5JXVA 1N62A 3ML9A 1RM6C 3TJPA 1ISNA 2I2YA 2K6DB 1UH6A 1WSPA 3MP9A 4HPLB 4A90A 3P63A 2N0SB 4FJYA 2MBBB 4ANXA 2J53A 3IG3A 3U30A 1TY0A 3QAQA 3GE3C 1KTKA 3L0WB 4HVBA 1L4ZB 3NZSA 3AE8B 2G4DB 3IVFA 3AM9A 1EWYC 3U2SC 2M56B 4ZRPA 3RPFC 1WZ0A 5DPSA 1F1HA 3PPAA 2LFIA 3DWGC 5JH5C 2WDQB 3ZJVA 1TS3A 1WJ6A 5TR5A 4GN1A 2PE6B 2ZVOA 4GSWA 3Q14C 2BPSA 3I9V1 2LWPA 2WP9B 2B3AA 3DBSA 3Q8EA 2C60A 1RLFA 1WYGA 1MHHE 4DHZB 3EECA 2G9HD 1R7SA 2KO3A 2W3SA 2H88B 3T9LA 2GLSA 4K7SA 2EKEC 3DVGX 2LGIA 1VJKA 1BMLC 2LUEA 1N6ZA 1L6UA 1KLGD 1CZPA 1GB4A 1P0RA 2CJOA 2WDVB 2KANA 4C7YA 3Q3MC 4IDIA 3BK2A 2QJLA 1DGJA 2KLCA 4WJNA 2TSSA 3EFCA 3C0RB 4H2AA 1WFYA 2WDRB 4IWOA 4W9GA 4RNAA 5E6OA 3DHIC 4A3OA 1YQ3B 4YSXB 1I42A 4L2YA 2GBRA 1I7HA 2NVUI 1JQ4A 3N1ZC 1J19A 1QQRA 3WAOA 1I35A 3L13A 2EKIA 2PVOD 2A4ZA 2CU3A 4A20A 5LNK1 3IHPC 5D94A 4K7WA 2LD9A 1HZ6A 1OTRB 1AW7A 3IT4B 3U7DA 3RULA 5IO9A 2QDFA 4HXDA 1YNTE 1N63A 5AEKB 2HTME 4JGHB 3Q3OC 4CO7A 4HEA1 2YEPF 5I4DA 2J0KA 4HDOA 4I6LB 1GOZA 3O13A 2I38A 4WAFA 4FBJB 4GDKB 5EDSA 1R4NI 4KSLC 1VD2A 1MHXA 1OQQA 4HKQA 2NPTB 4WJPA 3VXWA 4C7ZA 2AL6A 3R7QA 2BW2A 2O6VB 2YLMA 3B9JA 4B6WA 5HG2A 3VTUA 2JYTA 1E10A 3DBLI 2N7EA 3NRZA
chains in the Genus database with same CATH topology
4OVZA 3AE3B 1UWXA 3Q8BA 1RYJA 1XLOA 2X38A 3AECB 1VZ8A 1IGDA 4TSSA 4ZYSA 1I4HA 2RDHA 1WRIA 3NVYA 1JALA 3AEBB 2M19A 1SE2A 4GDLB 1NYQA 4LTUA 3W5VB 1T6BX 1JCKB 3NS1A 3AMZA 2W82A 3SR6A 2BTEA 1SE3A 1PDXA 4ZHOA 2LEKA 1WGKA 1JROA 1E6EB 2VZKB 3HVZA 4WH4A 3ZJTA 3RFZB 5BYQA 3KQ4A 1CK1A 1D5ZC 2IGGA 4A9AA 2FE8A 2RDGA 2MJ3A 5EE9A 1C9FA 1TY2A 1I4RA 1SJHD 2WU5B 2BYTA 1VR9A 2JQRB 2BBCA 1F0ZA 4NAMA 1AYFA 1LO5D 4N58A 2PIAA 2HDEA 1XLQA 1D4BA 2YEPB 1NVID 1TKYA 3EA6A 3GS2A 2J42A 1YQ4B 1OQRA 3ZQ4A 2JX5A 1D5MC 1D5XC 4AQ7A 5C2TB 2QIEB 3FAHA 1PGAA 2WXNA 3W9CB 1FD6A 1TZOA 1FCLA 1C76A 4YXDB 2DYMA 3E9SA 2L83A 3AE5B 1FXAA 3PO0A 3MC0B 2PTLA 1HEZE 4RFBA 1JW9D 4RGTA 2NTSA 1QF6A 1ZDVA 3VRBB 1FFVA 4ITKA 1V97A 4REZA 4CQNA 4KGRA 4HRSA 2QMTA 4YSYB 4NAWB 1TKGA 2Y5CA 4JE3B 1I4PA 4LLGM 3V05A 2WXQA 1QOAA 2WXPA 3B2GA 1VLBA 1SJED 3TEZA 3AE4B 4ARIA 2W54A 3U2SC 1QOGA 4MT5A 2K9XA 1SXTA 3Q8CA 3AEFB 3MHZA 1FM0D 2JWUA 5HI1A 1JMLA 2WXLA 2ZW0A 2INPE 3P1MA 5H8YE 3VRAB 1STEA 1PFDA 4RF0A 2R61A 4HKZE 2IDYA 2AQ3B 2BS2B 2GRIA 4MACA 1Y56A 3AH7A 2FUG1 1VDVA 1WXQA 2PW9A 1FXIA 1C4AA 1YJIA 1IBXB 4YWGG 3U52E 1C4PA 1K51A 2LMCA 2INNE 1ZUD2 2ICIA 2V4IB 4KKIA 3P42A 4ZHPA 2ACZB 4RF1A 1IGCA 3SEBA 4TMAB 1V8CA 2Y3AA 1V1OA 1ZP0B 3VQIA 3AEAB 3P4QB 4RGNA 5AUIA 1FNVA 2KDMA 1J7CA 3HVDA 1BUIC 1TKEA 3VR8B 1XO3A 1N5XA 1WWTA 3TEXA 1CQVA 4YTNB 3P4RB 2MEKA 1L0VB 1JRPA 5C3JB 1A70A 1ET9A 2FBWB 2WU2B 1JWMD 4C56C 3R8BA 5G5HA 4DXGA 3BYTB 5D7GA 1L4DB 4DQOC 4XWWA 1EM7A 2L52A 4KGTA 1N60A 1C4CA 4RH6A 1CJEA 3FILB 3W1SA 5TSSA 4AS1A 2BB6A 3BZDB 3IAM1 2AQ2B 3N9YC 4OZBA 3TEWA 1ZXIA 1E0ZA 1NENB 1UNSA 1JWAD 1XCQL 1T5XD 2JZPA 2WXHA 4XDCA 3AE1B 1GPXA 2W55A 1TS5A 5BMGA 3BVGA 5T8IA 2OEDA 4NJCA 3E56A 2IGDA 2V3NA 4OZCA 3BYYB 4UDUC 4O1NA 1QKZA 4J3OD 1L5PA 1SBBB 2J4XA 3WCQA 4A6QA 2DWQA 1FCCC 2E3TA 1TS4A 1K53A 1GAQB 4JWSC 1EU4A 2LHEA 4XDDA 2WLBA 2BS3B 1HXYD 1NI3A 3ZYYX 2PLPA 3P4SB 4YSZB 2WXOA 3U4EG 1KRHA 5GXGB 2Y5PA 1QILA 1JWSD 1FRRA 1QT9A 2KACA 5D3DA 4KKJA 2WXMA 2WS3B 1QOFA 1V1PA 1ZXHA 2PKOA 2K0PA 3URYA 2AQ1B 2G1EA 4YTPB 3NZ3A 5EE1A 1XXGA 3AE2B 3SFDB 1KLUD 2V3PA 1FNWA 1YN3A 4IKGA 3EGRA 4D2KA 1ENFA 4TQ0A 1I4XA 2WXGA 5E6JA 1TJEA 1PGBA 2JYEA 4TQ1A 5HHDG 3GP7A 1EWCA 2RMMA 5FK9C 5G5GA 5BMIA 1OFFA 2MJEA 3FC4A 3ZGZA 1ZPSA 3NVVA 4EE2A 2L32A 1XLPA 1K50A 2WXIA 2SAKA 3V3XA 1MI0A 4KX6B 3GB1A 1ZDXA 2QILA 3LYYA 5EE0A 3EUB2 2GB1A 4YT0B 1PYWD 2WNMA 1P7FA 1QLBB 2AX5A 1KFYB 1SIJA 2N9LA 2H89B 3CIRB 1TYGB 1YMHE 3LXFA 3IT6B 4ZOHC 4DXFA 1SEBD 1DOIA 2QSDA 5D3IB 4GLSC 4HJGE 1ZOYB 3AV8A 3DWMA 3J9CA 3LB8C 5JXVA 1N62A 3HRDD 3R2IA 1RM6C 2DBYA 1KF6B 2I2YA 2GI9A 2W3RA 5MPOA 2N9KA 1JWBD 3NVZA 3TSSA 1HZ5A 1YN4A 1WSPA 1N5WA 3MP9A 4A90A 2CJNA 1J7BA 3P63A 1F2RC 1ACCA 2N0SB 5BYRA 4M0WA 1PUTA 4RGMA 2DYOA 2J53A 4YTMB 4XWTA 1TY0A 4FXCA 3IAS1 2WXRA 1HA5A 4RGOS 3AE9B 1E9MA 1KTKA 1C77A 1FEHA 2PVGC 1L4ZB 4IOIE 1L0XB 3AE8B 3BVMA 4XE0A 3AM9A 1DOYA 1EWYC 3PZ8A 3R2TA 1VZ7A 2M56B 3AB5A 4WWMA 2XN9C 4ZRPA 4ZRQA 1FFUA 3RPFC 1DOXA 1UGJA 1XCTL 2LFIA 2MH7A 3DWGC 1VZ6A 2BB5A 1XF5L 2WDQB 2WQYB 2EELA 2KWDA 1TS3A 3ZJVA 1IUEA 2QEJC 3MFGA 1SF0A 1RWSA 4RCOA 1FNUA 1YJJA 3I9V1 1L0YB 1NEKB 2WP9B 2WXKA 3BWUD 1C79A 1GB1A 3Q8EA 4P6VF 3AE7B 2DLBA 2LHDA 5FR3A 1WYGA 1MHHE 4USAA 3C8YA 4OW0A 2G9HD 1R7SA 2MJDA 2ON8A 3B2FA 1FO4A 2V0GA 5BYSA 1YN5A 2W3SA 2H88B 3KWVA 2Q5WD 2IGHA 4US9A 5FKAC 4WURA 1L6VA 1AWDA 2LGIA 1VJKA 1BMLC 2ZW1A 3MJ5A 3P4PB 2KMMA 1B9RA 1D6EC 1L6UA 1UWMA 1KLGD 1CZPA 2LUMA 5HFYA 1GB4A 3KLSX 2CJOA 2WDVB 3TUOA 4C7YA 2J52A 1HQRD 3BK2A 4IDIA 2WXJA 4N6EB 2QJLA 1DGJA 2NMQA 1SB3C 2TSSA 1Q10A 2XNAC 2OHFA 1C78A 4B0MA 4H2AA 2K3UA 2ONQA 2WDRB 3CWIA 1SE4A 1BXTA 1M4VA 1VRAB 4RNAA 4A55A 2KQ4X 1V1PB 3ETRA 1YQ3B 3TEYA 3T3OA 4YSXB 1JWUD 3L4PA 2M0AA 2Z8LA 3UI3A 3AN1A 2WXFA 4L2YA 3HUIA 2B76B 3T3NA 1I7HA 2K22A 2PMVA 2K5PA 3U7ZA 1JQ4A 1T3QA 4JX1C 1J7AA 3OWEB 1B1ZA 2IPKD 2SEBD 1QQRA 3Q8FA 4MM3B 2IJ0A 1F2RI 2EKIA 2PVOD 2CU3A 3W2DA 1FRDA 1P7EA 1K52A 4A8XC 2N7JA 2L1AA 5AUKA 3AE6B 4Q2JA 2BT6A 1UUPA 1F77A 2KAJA 4B0EA 5BMHA 5LNK1 1QOBA 2JXTA 2JU6X 1IBXA 1HZ6A 3BVZA 4WQMA 1NYRA 1AW7A 1I4GA 3IT4B 1SSNA 3ZJUA 3BIID 4OHJA 3W5UB 3IXSA 3AEGB 4PT5A 3Q69A 3I57A 3SFEB 3VR9B 4MH8A 2NTTA 5EE3A 1YNTE 1N63A 3ABVB 1ROEA 3FILA 2HTME 4L23A 4KGSA 5H92C 2JSVX 2BS4B 3Q8AA 4HEA1 2YEPF 3KWLA 1MVKA 4OZAA 5I4DA 4ARCA 4NZLB 3BK1A 1EU3A 1PGXA 1FIQA 1GOZA 3O13A 2I38A 4JWUC 4WAFA 4JPSA 4GDKB 1ZE3D 3H8HA 1E7PB 1MHXA 1OQQA 4US8A 2D5GA 4HKQA 4WIPA 1ESFA 3NVWA 1RFKA 2LJIA 4P16A 4C7ZA 1FMAD 3AEDB 4N59A 2E6XA 1I4QA 2BW2A 2RPVA 3AEEB 3B9JA 2VZKD 1AN8A 3PZ7A 4R3DA 5HG2A 4LK0M 1DYQA 1ET6A 4C80A 1N61A 1TS2A 2JYTA 1E10A 4L1BA 2KN4A 1XEEA 3NUHB 1MPEA 1KH0A 3NRZA 1XLNA 4HROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HFY A;  1UWX A;  2J52 A;  1IGC A;  2GB1 A;  1P7F A;  2NMQ A;  1IGD A;  1Q10 A;  2KDM A;  2N9L A;  2ONQ A;  1YMH E;  2KQ4 X;  2QSD A;  4GLS C;  4HJG E;  3UI3 A;  4WH4 A;  2IGG A;  5JXV A;  1EM7 A;  1C9F A;  2I2Y A;  4KGT A;  2GI9 A;  2N9K A;  1HZ5 A;  3FIL B;  3MP9 A;  1F2R I;  1F2R C;  1P7E A;  1K52 A;  1D4B A;  2N7J A;  4OZB A;  2J53 A;  5BMH A;  1XCQ L;  2JXT A;  2JU6 X;  1IBX A;  1HZ6 A;  2JZP A;  5BMG A;  2OED A;  1PGA A;  4IOI E;  2IGD A;  1FD6 A;  1FCL A;  4OZC A;  1QKZ A;  1YNT E;  2PTL A;  3FIL A;  1HEZ E;  1FCC C;  1K53 A;  4KGS A;  1XCT L;  2JSV X;  2LHE A;  1XF5 L;  2EEL A;  4KGR A;  2KWD A;  1MVK A;  2QMT A;  4OZA A;  2PLP A;  1PGX A;  2KAC A;  2I38 A;  1GB1 A;  1MHX A;  1ZXH A;  2K0P A;  2LHD A;  1MHH E;  4IKG A;  2ON8 A;  4D2K A;  2JWU A;  5HI1 A;  1JML A;  2RPV A;  2ZW0 A;  2IGH A;  4HKZ E;  1PGB A;  5HG2 A;  5HHD G;  4MAC A;  2RMM A;  5BMI A;  2LGI A;  2PW9 A;  2ZW1 A;  2KN4 A;  1IBX B;  1MPE A;  1K50 A;  1K51 A;  1KH0 A;  3V3X A;  1MI0 A;  3GB1 A;  1GB4 A;  2LUM A; 
#chains in the Genus database with same CATH topology
 4OVZ A;  4W9F A;  2JZZ A;  3DPD A;  4TSS A;  4ZYS A;  1I4H A;  2RDH A;  5LXH A;  1WJU A;  5GMV A;  4LTU A;  1YOV B;  2QHO A;  2JT4 B;  3A1Q B;  2O2V A;  3L17 A;  3APF A;  4WH4 A;  2WHI A;  3UGB B;  3RI7 C;  2IGG A;  2FE8 A;  2WDT B;  2ZCC A;  2IO1 B;  2BBC A;  5IAA C;  4N58 A;  2PIA A;  3TMP B;  5LLI A;  2HDE A;  1XLQ A;  3Q2A C;  4KDL B;  4IM0 A;  1YQ4 B;  2BGF A;  2Y5B B;  1D5M C;  4AQ7 A;  3M62 B;  2QIE B;  3L16 A;  2WXN A;  4GOC A;  3RNG C;  3E9S A;  1BT0 A;  2EMS A;  2D10 A;  3NJT A;  5G2N A;  4BAX A;  1GUA B;  3PO0 A;  4DDI D;  1HEZ E;  4M8N A;  4RGT A;  2KDE B;  1WXA A;  4GMV A;  4KGR A;  2MQJ A;  4YSY B;  3K9P B;  4NAW B;  1L2N A;  2WXQ A;  1QOA A;  3CF6 E;  4S0R A;  1SJE D;  3A1Q A;  2L7R A;  3PV1 A;  4BBN F;  4C4V B;  4MT5 A;  2BVC A;  2K9X A;  3JSV A;  4F7Z A;  2JPH A;  2LGD A;  4GGQ A;  3VRA B;  4AWJ A;  3M95 A;  2L8J A;  2RDB C;  1M94 A;  3AI5 A;  2KTF A;  1YJI A;  4YWG G;  2KN5 A;  1K51 A;  2LMC A;  2KFJ A;  3UQB A;  1IGC A;  3SEB A;  1WI0 A;  2KDM A;  4KZ0 A;  1UZX B;  1XO3 A;  2BYE A;  3WAL A;  4YTN B;  2MEK A;  3Q3F A;  1WZ3 A;  2KT7 A;  1A70 A;  3GZN I;  3Q3J A;  3L54 A;  3BYT B;  5D7G A;  2CHW A;  4XWW A;  1CMX B;  3M3J A;  4RH6 A;  4TV3 A;  4AUQ C;  5CTR C;  1G6J A;  2YVC A;  3IAM 1;  3N9Y C;  4C00 A;  3TEW A;  3RNA C;  1UNS A;  4HPM B;  2BQQ A;  4XDC A;  1FXT B;  3DVN V;  1TS5 A;  1E90 A;  1Q0W B;  3ZIM A;  5T8I A;  4NJC A;  3E56 A;  1WJN A;  4OZC A;  3ZUN A;  2J4X A;  3KUC B;  3VH3 B;  1FCC C;  2E3T A;  1E8Z A;  3PSE B;  1A5R A;  3RYT A;  2PLP A;  2KAC A;  4KVG B;  4DDG D;  3C19 A;  2JF5 A;  2DEN B;  3B0A A;  3ZNG C;  1KOT A;  2OJW A;  1ZXH A;  2KDF B;  3R7R A;  3AE2 B;  2MA9 B;  2V3P A;  4AP4 C;  2XEW A;  1ENF A;  1WX8 A;  4TQ0 A;  5E6J A;  2C5L C;  3RNB C;  2MP2 B;  1L7Y A;  3PHX B;  1EWC A;  2RGF A;  3FC4 A;  1MFW A;  2D11 A;  2L32 A;  5DPT A;  3ZVV A;  4W9I A;  2ASQ A;  3GB1 A;  3NS8 A;  3EUB 2;  3APC A;  1YX5 B;  2KVZ A;  2GB1 A;  4DBG A;  4YT0 B;  1Q5W B;  1P7F A;  1KFY B;  4BKT A;  2NS5 A;  2K8B A;  3LXF A;  4TUU A;  4DXF A;  3D32 A;  2GBK A;  3ALB A;  1SEB D;  4NQL B;  2KYW A;  2DBY A;  3QA8 A;  2KK8 A;  2GI9 A;  4IG7 B;  1X1M A;  2N9K A;  2KMA A;  2O6V D;  3PVL A;  1JWB D;  4W9C A;  2UYZ B;  3TSS A;  1HZ5 A;  1YN4 A;  1TIF A;  2CJN A;  1J7B A;  4XYC A;  4M0W A;  3VH4 B;  1EF1 A;  4W9L A;  1T0S C;  4RM8 A;  1SGH A;  4DHZ E;  4XWT A;  4FXC A;  3IAS 1;  2WXR A;  1HA5 A;  4RGO S;  2FUH B;  4EZJ A;  2ZJD A;  4YL8 A;  1FEH A;  2PVG C;  2QC8 A;  1L0X B;  1VCB A;  3BVM A;  4K7U A;  3DBR B;  4XE0 A;  3MHS D;  3R2T A;  1VZ7 A;  4ZRQ A;  1T0R C;  1FFU A;  5KHQ A;  1UGJ A;  4W9D A;  2MH7 A;  2NPT A;  2BB5 A;  3JVZ X;  1HE8 A;  4CYE A;  1YJJ A;  1L0Y B;  3BWU D;  1C79 A;  2MBO A;  1GB1 A;  2KKC A;  3MTN B;  4P6V F;  3AE7 B;  5FR3 A;  4USA A;  4MJS B;  1P1A A;  1V2Y A;  2ON8 A;  3B2F A;  4S17 A;  3VUW A;  1YN5 A;  3KWV A;  3ZNH B;  4G11 A;  1AWD A;  3P4P B;  2ZW1 A;  2LGY A;  4GIV A;  1UWM A;  2LUM A;  1WGD A;  2WXJ A;  4BOS C;  1TGZ B;  2DZK A;  1SB3 C;  2XNA C;  1C78 A;  1TZ1 A;  3V61 A;  3CWI A;  1SE4 A;  3SDL C;  1GG3 A;  1M4V A;  1JRU A;  1VRA B;  2KQ4 X;  3MJW A;  2IO3 B;  3H9D A;  4URK A;  4BZA A;  3H1U A;  2B76 B;  2K22 A;  3OWE B;  2IPK D;  3N1Y C;  4MM3 B;  2M8S A;  2LJ5 A;  4A8X C;  3MC9 A;  3OJ4 B;  4Q2J A;  2BT6 A;  3KW5 B;  1F77 A;  2KOX A;  2JXT A;  1IBX A;  1UGM A;  2M17 A;  4WQM A;  4PT5 A;  3LDZ E;  2XK5 B;  4LDT D;  2MWS B;  2NTT A;  2KXJ A;  3ABV B;  2D3A A;  4X57 B;  5H92 C;  4G0N B;  2BS4 B;  3H7S A;  3Q8A A;  3KWL A;  4ICV A;  4ZRK A;  1FPY A;  4ARC A;  4JIO U;  2LAS A;  2MSE D;  1FIQ A;  4JWU C;  3H8H A;  2BYV E;  2KTR A;  4WIP A;  3NVW A;  1V80 A;  4WWP A;  3DOW A;  2BKF A;  3AED B;  4N59 A;  3AEE B;  4R3D A;  4LK0 M;  1DYQ A;  4C80 A;  4B95 A;  1TS2 A;  3W1S C;  1XEE A;  3BY4 B;  3V6E B;  1KH0 A;  5L95 C;  3L08 A;  2V1Y A;  3Q8B A;  2X38 A;  1IYF A;  3AEC B;  1VZ8 A;  3N3K B;  3GOE A;  1P3Q U;  1JAL A;  2M19 A;  3ZDM C;  2J7Q B;  3N30 A;  1NYQ A;  4W9H A;  3W5V B;  1T6B X;  3NS1 A;  3UIP B;  3A9K B;  2BTE A;  1OGW A;  1PDX A;  2LEK A;  1WGK A;  3DDC B;  5E6P A;  1WYW B;  1UF0 A;  5BYQ A;  5IKC M;  1CK1 A;  2RDG A;  3ECI A;  1WMH B;  4NAM A;  2LGX A;  4E3C A;  4QAY A;  4WJQ A;  3ZRF A;  3QX1 A;  3OAW A;  5J2R A;  1WGR A;  2KC2 A;  1TKY A;  3PHW B;  4EUT A;  3ZQ4 A;  1NDD A;  3FAH A;  1PGA A;  1FD6 A;  4NY0 A;  2KC1 A;  2KZR A;  1TTN A;  2DAJ A;  2PTL A;  4OVV A;  2INC C;  4RFB A;  1JW9 D;  2JRI B;  1ZDV A;  2O6V A;  2KWV B;  1FFV A;  4CQN A;  3TL5 A;  4J6I A;  2QMT A;  2Z0E B;  4LLG M;  2G4S A;  4G3X B;  3B2G A;  1LQB A;  1KM7 A;  3AE4 B;  4ARI A;  4MGI E;  2FCS A;  5AZH A;  3NZU A;  1WXM A;  2KWC A;  2KX0 A;  1F52 A;  2MBE A;  1SXT A;  3Q8C A;  1FM0 D;  3P1M A;  3A4S C;  2IDY A;  1V5T A;  3RCZ A;  3AH7 A;  2FUG 1;  1KLV A;  5AZF A;  4MEL A;  1FXI A;  4F1S A;  1C4A A;  1IBX B;  4EKU A;  3A33 B;  2DZM A;  4ZRJ A;  4KKI A;  1V8C A;  4AJY B;  2KJ6 A;  3VQI A;  2CKH B;  5AUI A;  1FNV A;  2DAF A;  3RNF C;  1YX6 B;  2ZVN A;  3HVD A;  1BUI C;  3TEX A;  1WR6 E;  5IN7 A;  1K8R B;  4K1R B;  1JRP A;  2L0F A;  3DBL B;  2K8C A;  4HLE A;  2N1W A;  4EOY A;  4MEM A;  3AUL A;  1D3Z A;  1WJ4 A;  2GOW A;  5FR6 A;  4KGT A;  1WGG A;  2N7D A;  2JY6 A;  4KSK C;  2UWQ A;  1Y8R C;  4AS1 A;  2PJH A;  3BZD B;  4OZB A;  1ZXI A;  1WXV A;  3VTW A;  3WIM A;  3B1L X;  3ONS A;  2W55 A;  3DCG A;  2OED A;  1UBI A;  4PS7 A;  3BYY B;  4P1B C;  2N4F A;  4AOF A;  1SBB B;  4E71 A;  3JSV B;  1K53 A;  1EU4 A;  4LNI A;  2WLB A;  1WX7 A;  1NI3 A;  1V81 A;  5GXG B;  1JWS D;  4ACF A;  4DHJ D;  5D3D A;  4KKJ A;  4XGA B;  4MDK E;  1WM3 A;  3DBH B;  2L00 B;  2WS3 B;  3S2A A;  1QOF A;  1V1P A;  4OVU A;  4FUL A;  2Z0D B;  3WAP A;  4HJK A;  3SFD B;  1FNW A;  1YN3 A;  4IKG A;  2WX1 A;  2ZPY A;  3ZXV A;  4KDI C;  2JYE A;  4LJP B;  4TQ1 A;  1ZW7 A;  3GP7 A;  2RMM A;  4FJV B;  5BMI A;  1OFF A;  2MJE A;  4HCP B;  4PYZ A;  3R66 C;  2SAK A;  3VFK A;  5EE0 A;  2IY1 B;  3T8M A;  2IND C;  3JYU A;  2AX5 A;  1GC7 A;  2H89 B;  4WJO A;  1TYG B;  1YMH E;  2L76 A;  1ZKH A;  4XZ4 A;  2VRR B;  4PS3 A;  3APD A;  2KMC A;  4BKS A;  3PLU A;  2PEA A;  3Q6B A;  1R4M I;  1WXS A;  2LI5 A;  1LM8 B;  3J9C A;  2VH1 A;  3LB8 C;  2KFK B;  1KF6 B;  2HD5 B;  2REX A;  5MPO A;  4NNJ B;  2FCM A;  5KHO A;  3A9J B;  4M00 A;  1PUT A;  4RGM A;  2DYO A;  3H7P B;  1E9M A;  2ZEQ A;  4IOI E;  1WGY A;  3ZTC A;  3SHQ A;  3PRE A;  2BWF A;  3PZ8 A;  3PGE A;  3IBE A;  1DOX A;  4IC7 B;  1XF5 L;  2WQY B;  4M02 A;  2QEJ C;  3MFG A;  3TBL D;  5DPW A;  1MJD A;  4RCO A;  4WWO A;  2FCQ A;  4DXA B;  4BBN C;  2LZ6 A;  4EFO A;  2N9E B;  3C8Y A;  1EO6 A;  4K81 A;  2V0G A;  5BYS A;  3QJZ A;  3I5J C;  2N1V A;  2AYO B;  5JHA A;  2MRP A;  2IGH A;  2AL3 A;  4GU2 A;  4US9 A;  5FKA C;  3PLV A;  1L6V A;  3MJ5 A;  5G55 A;  1B9R A;  4BOZ B;  5J18 A;  2DHZ A;  3KLS X;  3WA0 A;  2J52 A;  2MW5 A;  2NBU A;  1HTQ A;  2EMT A;  1Q10 A;  1EF5 A;  2K3U A;  2ONQ A;  2NBW B;  5L83 A;  5DPR A;  2KWU B;  3FKY A;  4ANU A;  4ZYN A;  2C7N B;  3I63 C;  1LXD A;  4XC2 A;  4LNF A;  3ETR A;  4HWI B;  1JWU D;  2CS4 A;  2M0A A;  3NHE B;  2KX3 A;  3UI3 A;  3DHG C;  2WXF A;  3HUI A;  3SU8 X;  5C23 A;  3T3N A;  4W9E A;  3U7Z A;  1T3Q A;  4JX1 C;  1B1Z A;  4P7I A;  4I6P A;  3HM3 A;  1Z2M A;  2DNF A;  1WY8 A;  4KV2 A;  3W2D A;  1P98 A;  5AUK A;  1EUV B;  2KNB A;  1QOB A;  2CR5 A;  1E5W A;  2D3B A;  1I4G A;  4GB9 A;  3W5U B;  3Q69 A;  3CSF A;  2FIF A;  3SFE B;  4ANV A;  2JRH A;  3VR9 B;  4MH8 A;  3PZD A;  3UIN B;  5DCN A;  1ROE A;  3FIL A;  3QQ8 B;  4KGS A;  2K25 A;  4KZC A;  3ZKJ C;  4C4V A;  1MVK A;  1S3S G;  4OZA A;  2KJR A;  4NZL B;  1EU3 A;  3UQA A;  1YJ1 A;  1V9J A;  4JPS A;  1ZE3 D;  1E7P B;  1Q1O A;  2D5G A;  4US8 A;  1WE7 A;  1RFK A;  4BVU C;  2E6X A;  1I4Q A;  2RPV A;  4LCD E;  2VZK D;  3PZ7 A;  1V6E A;  1N61 A;  3HM6 X;  2CHZ A;  3NUH B;  1MPE A;  2G3Q B;  4MGZ E;  2BWE S;  4HRO A;  5G5H A;  2C9W B;  4PYU A;  1LFD A;  4HCN B;  1RYJ A;  2AEH A;  3OG5 A;  4W9K A;  2KD0 A;  2ZCB A;  3AEB B;  1WMH A;  1MG4 A;  4WQO B;  3U8Z A;  1LGR A;  2CU1 A;  4LJO B;  2N9P C;  1JCK B;  1UBQ A;  1SE3 A;  2I1J A;  1E6E B;  2RR9 A;  3KQ4 A;  1D5Z C;  4A9A A;  2IO2 B;  4EEW A;  2MJ3 A;  5EE9 A;  1TY2 A;  1Z5S B;  3HK0 A;  2WU5 B;  2BYT A;  2A5U A;  2JXX A;  1WGH A;  2YEP B;  2OJR A;  1NVI D;  3GS2 A;  2J42 A;  1OQR A;  2MLB A;  2JX5 A;  2WX0 A;  3N1X C;  1D5X C;  4II3 B;  1TZO A;  4MGY E;  5HKH A;  1FCL A;  2DYM A;  4M0W B;  4WAA A;  3AE5 B;  1PQS A;  2RSU A;  3ZNI D;  2HJ8 A;  3DQV A;  2NTS A;  4F8C B;  4ITK A;  1V97 A;  4REZ A;  4IWP A;  4BKG A;  4HRS A;  2ZPN A;  1TKG A;  4JQW C;  3GE8 C;  3QCA A;  2DYB A;  2W54 A;  3EHV A;  1QOG A;  2JWU A;  1JML A;  2WXL A;  2ZW0 A;  4EZK A;  2D2Q A;  2INP E;  4RF0 A;  3P2B A;  2GRI A;  3A9K A;  2L0T A;  1Y56 A;  3RUI B;  2PW9 A;  3ZXR A;  2V3S A;  2N9X A;  3A9J A;  2ICI A;  2K6Q A;  2V4I B;  2NBV B;  4ZHP A;  2UU7 A;  4RF1 A;  1V1O A;  1ZP0 B;  3N20 C;  2KFK A;  3VR8 B;  1TKE A;  1SIF A;  1ET9 A;  2FBW B;  2MX2 A;  4C56 C;  1WE6 A;  4DXG A;  1IP9 A;  3UF8 A;  4GDL A;  1L4D B;  4DHJ B;  2NR2 A;  2GMI C;  1EM7 A;  2HJ1 A;  3AXC A;  3ZRC A;  4IUM B;  3FIL B;  3RNC C;  1T0Q C;  5JHB A;  5TSS A;  2RPQ A;  4W9J A;  3MC8 A;  1E0Z A;  1NEN B;  2KDI A;  1XCQ L;  4NQK E;  1T5X D;  4ICU A;  2JZP A;  2WXH A;  3AE1 B;  5BMG A;  3BVG A;  4ZRI A;  2IGD A;  5IP4 D;  2M0X A;  1XT9 B;  4UDU C;  1QKZ A;  4J3O D;  4TKN A;  2JWZ A;  2XBB C;  3KUD B;  3VUY A;  4JWS C;  3PRM B;  2K8H A;  2J0J A;  3P4S B;  4MGK E;  3PRP B;  3U4E G;  2Y5P A;  3NG0 A;  1FRR A;  2WXM A;  2L05 A;  1RAX A;  2KDB A;  3URY A;  2G1E A;  4YTP B;  2ZZP B;  5EE1 A;  1KLU D;  3EGR A;  1E8Y A;  4D2K A;  3EC8 A;  2WXG A;  2I1K A;  1TJE A;  5HHD G;  5G5G A;  2KHW B;  3ZGZ A;  4EE2 A;  4FHK A;  2BKR B;  2WXI A;  2HE7 A;  1MI0 A;  2BF8 B;  5CHW A;  4WWN A;  1ZDX A;  3LYY A;  3VTV A;  1PYW D;  1QLB B;  3KYC D;  4P1C C;  3ZDT A;  1SIJ A;  2FAZ A;  3GZN B;  1GNU A;  2IO0 B;  2N9L A;  4ZDV A;  3KYD D;  3RMK C;  3SD5 A;  3ZO5 B;  4I6N B;  3H6N A;  4LNN A;  2R2O A;  1DOI A;  5D3I B;  4GLS C;  3W1Y A;  3AV8 A;  3DWM A;  2KQ7 A;  4HDQ A;  3HRD D;  3R2I A;  1QZE A;  3X23 A;  3ZW3 A;  2W3R A;  3NVZ A;  1N5W A;  1WIA A;  3PS6 A;  1F2R C;  1ACC A;  4RMA A;  2X8X X;  5BYR A;  3WAN A;  1OEY A;  4YTM B;  1WRD B;  1S1Q B;  4NAW A;  1H4R A;  1TBE A;  3H7P A;  3AE9 B;  1C77 A;  2CHX A;  4FN2 A;  1R4N B;  3L10 B;  4FAD A;  3O65 B;  1DOY A;  3V62 A;  4WWM A;  3AB5 A;  2C7M B;  2XN9 C;  1XCT L;  1YD8 U;  3HHM A;  2D3C A;  3QIJ A;  1VZ6 A;  4KIK A;  1TT5 B;  2EEL A;  2KWD A;  1IUE A;  2D07 B;  1SF0 A;  1J8C A;  1RWS A;  3VVW B;  1FNU A;  1NEK B;  2LVO A;  2WXK A;  3K9O B;  1RFA A;  2DLB A;  2LHD A;  5JZE B;  2QCZ A;  3PRZ A;  4RM9 A;  4OW0 A;  2MJD A;  1SE9 A;  1FO4 A;  1E7U A;  1ZGU B;  2GBM A;  2Q5W D;  1J0G A;  4WUR A;  2JUO A;  2R2Q A;  5IOI A;  2KMM A;  1D6E C;  3AU4 A;  4IWQ A;  3KUZ A;  1NBF C;  2IY0 B;  5HFY A;  3TCA A;  3TUO A;  1HQR D;  2W9N A;  2LVQ A;  1E8X A;  4N6E B;  2ZNV B;  3A4R A;  2MP2 A;  2NMQ A;  3B08 A;  3X0W A;  2OHF A;  4B0M A;  3V6C B;  3R3M A;  1BXT A;  3PTF C;  1HTO A;  3VHT C;  4A55 A;  1V1P B;  4B9K A;  3TEY A;  3T3O A;  3L4P A;  2Z8L A;  3AN1 A;  5BO4 B;  4LNK A;  2PMV A;  2K5P A;  3OJ3 A;  4BKS D;  1J7A A;  1WM2 A;  2SEB D;  1OQY A;  3UIO B;  3Q8F A;  2IJ0 A;  2LRW A;  1F2R I;  2C7H A;  1FRD A;  1P7E A;  1K52 A;  2N7J A;  2L1A A;  3AE6 B;  4JL9 A;  1UUP A;  4B0E A;  2KAJ A;  5BMH A;  1R4M B;  5IA7 A;  5E6N A;  2JU6 X;  2M1M A;  3BVZ A;  4DK5 A;  3NOB A;  1NYR A;  1SSN A;  3ZJU A;  3BII D;  4OHJ A;  4ASW C;  3IXS A;  3AEG B;  3I57 A;  4MSM B;  3ENE A;  5EE3 A;  4XX5 A;  5CX3 A;  1MG8 A;  3DBH I;  4L23 A;  1P9D U;  3RNE C;  2JSV X;  4NPN A;  3ZNZ B;  2XK5 A;  3BK1 A;  1PGX A;  3M63 B;  1ESF A;  2MHJ A;  2LRU A;  3QC8 B;  4P16 A;  2LJI A;  1FMA D;  1WR1 A;  2BYF A;  1AN8 A;  2MBQ A;  1ET6 A;  1E8W A;  4PS8 A;  4L1B A;  1U4A A;  2KN4 A;  3EFU A;  1XLN A;  4MH0 E;  4LDT B;  4AJW A;  3AE3 B;  1UWX A;  4JLC A;  3IFW B;  1XLO A;  2IYD B;  4A3P A;  1IGD A;  1YQB A;  4E74 A;  2FCN A;  2WWZ A;  1WRI A;  3NVY A;  1AAR A;  1SE2 A;  1WF9 A;  4GDL B;  4IM2 A;  2NCN A;  3AMZ A;  2W82 A;  5CHV C;  3SR6 A;  4ZHO A;  4NJ7 A;  4FJZ A;  1JRO A;  2VZK B;  3HVZ A;  3ZJT A;  3RFZ B;  1WX9 A;  2IZV B;  1V49 A;  4GDK A;  1C9F A;  2K1F A;  1I4R A;  1SJH D;  3RZF A;  4II2 B;  3CMM B;  1VR9 A;  2JQR B;  3Q3N C;  1F0Z A;  1AYF A;  1LO5 D;  3VUX A;  1UEL A;  1H8C A;  1D4B A;  3PT2 B;  3CST A;  5LXI B;  3EA6 A;  2MBH A;  5C2T B;  3RN9 C;  3W9C B;  1C76 A;  3V60 A;  4YXD B;  1T0Y A;  2L83 A;  1FXA A;  3MC0 B;  5C1Z A;  2O2V B;  2IBI B;  1QF6 A;  3VRB B;  2KJH B;  4M8M A;  1C1Y B;  2Y5C A;  4JE3 B;  1I4P A;  3V05 A;  2WXP A;  3DBR I;  1XD3 B;  1VLB A;  4HK2 A;  3TEZ A;  2V9H A;  4EZL A;  3OLM D;  5AZG A;  3KVF B;  2OOB B;  1KJT A;  4N9F 4;  3LJ3 A;  3AEF B;  2DX5 B;  2KQS A;  3AU5 A;  3MHZ A;  3VAW A;  5HI1 A;  2KVR A;  5H8Y E;  1STE A;  1PFD A;  4M01 A;  3I3T B;  2R61 A;  4HKZ E;  2PE9 A;  2AQ3 B;  4ANW A;  2BS2 B;  4MAC A;  1VDV A;  1WXQ A;  4MSQ B;  5J17 A;  2KLG A;  3U52 E;  3ZLZ A;  1C4P A;  2INN E;  1ZUD 2;  3DVN U;  2J0M A;  3WAM A;  3QK0 A;  2Z59 B;  3P42 A;  2ACZ B;  4TMA B;  1V86 A;  2Y3A A;  3JW0 X;  2DZJ A;  3AEA B;  3P4Q B;  4RGN A;  1J7C A;  1N5X A;  3DVG Y;  1YIW A;  3TIX A;  1WWT A;  1CQV A;  2L3Z A;  3P4R B;  3NY5 A;  1L0V B;  5C3J B;  2HTH A;  2WU2 B;  1JWM D;  4FA6 A;  3QHT A;  3R8B A;  1C3T A;  2M4N A;  1OEY J;  4KIK B;  2ZNV C;  4NJ6 A;  5D2M B;  4DQO C;  2L52 A;  1N60 A;  2LXC A;  1C4C A;  2KTR B;  2LGS A;  1CJE A;  1UD7 A;  3RD2 A;  3W1S A;  2BB6 A;  2AQ2 B;  2LVP A;  2FID A;  1JWA D;  2JVC A;  4CHK A;  2WYQ A;  4HPP A;  3RZW C;  4DWF A;  4PK1 A;  1GPX A;  4GXB A;  2RD0 A;  3N32 A;  1E7V A;  2V3N A;  4O1N A;  1L5P A;  3WCQ A;  4A6Q A;  1GJZ A;  2DWQ A;  1TS4 A;  1GAQ B;  4IW0 A;  2LHE A;  4XDD A;  2GBN A;  2BS3 B;  1HXY D;  4K3C A;  4MJS A;  3ZYY X;  4YSZ B;  1WH3 A;  2WXO A;  4G50 A;  1KRH A;  1QIL A;  5CHF A;  1QT9 A;  1RRB A;  2DZI A;  2G45 B;  2VH2 A;  3VDZ A;  4K3B A;  3ZTD A;  4LNO A;  2PKO A;  2K0P A;  2AQ1 B;  3NZ3 A;  3KH0 A;  1XXG A;  2GBJ A;  1I4X A;  4IM3 A;  3DHH C;  2JZ3 B;  1PGB A;  5FK9 C;  2LXA A;  3BIN A;  1ZPS A;  3NVV A;  2MCN B;  4FHJ A;  2V4L A;  1XLP A;  1K50 A;  3V3X A;  4KX6 B;  1V5O A;  2QIL A;  2D3G A;  2K39 A;  1IPG A;  2WNM A;  4BFR A;  2WGS A;  3CIR B;  1XQQ A;  2FNJ B;  3HIZ A;  3IT6 B;  4ZOH C;  4FLH A;  4MM3 A;  2QSD A;  5D6J B;  4HJG E;  2AWT A;  1ZOY B;  3ML8 A;  1GC6 A;  1F9J A;  1NI2 A;  3QAR A;  2PPH A;  3QWZ B;  3RT3 B;  5JXV A;  1N62 A;  3ML9 A;  1RM6 C;  3TJP A;  1ISN A;  2I2Y A;  2K6D B;  1UH6 A;  1WSP A;  3MP9 A;  4HPL B;  4A90 A;  3P63 A;  2N0S B;  4FJY A;  2MBB B;  4ANX A;  2J53 A;  3IG3 A;  3U30 A;  1TY0 A;  3QAQ A;  3GE3 C;  1KTK A;  3L0W B;  4HVB A;  1L4Z B;  3NZS A;  3AE8 B;  2G4D B;  3IVF A;  3AM9 A;  1EWY C;  3U2S C;  2M56 B;  4ZRP A;  3RPF C;  1WZ0 A;  5DPS A;  1F1H A;  3PPA A;  2LFI A;  3DWG C;  5JH5 C;  2WDQ B;  3ZJV A;  1TS3 A;  1WJ6 A;  5TR5 A;  4GN1 A;  2PE6 B;  2ZVO A;  4GSW A;  3Q14 C;  2BPS A;  3I9V 1;  2LWP A;  2WP9 B;  2B3A A;  3DBS A;  3Q8E A;  2C60 A;  1RLF A;  1WYG A;  1MHH E;  4DHZ B;  3EEC A;  2G9H D;  1R7S A;  2KO3 A;  2W3S A;  2H88 B;  3T9L A;  2GLS A;  4K7S A;  2EKE C;  3DVG X;  2LGI A;  1VJK A;  1BML C;  2LUE A;  1N6Z A;  1L6U A;  1KLG D;  1CZP A;  1GB4 A;  1P0R A;  2CJO A;  2WDV B;  2KAN A;  4C7Y A;  3Q3M C;  4IDI A;  3BK2 A;  2QJL A;  1DGJ A;  2KLC A;  4WJN A;  2TSS A;  3EFC A;  3C0R B;  4H2A A;  1WFY A;  2WDR B;  4IWO A;  4W9G A;  4RNA A;  5E6O A;  3DHI C;  4A3O A;  1YQ3 B;  4YSX B;  1I42 A;  4L2Y A;  2GBR A;  1I7H A;  2NVU I;  1JQ4 A;  3N1Z C;  1J19 A;  1QQR A;  3WAO A;  1I35 A;  3L13 A;  2EKI A;  2PVO D;  2A4Z A;  2CU3 A;  4A20 A;  5LNK 1;  3IHP C;  5D94 A;  4K7W A;  2LD9 A;  1HZ6 A;  1OTR B;  1AW7 A;  3IT4 B;  3U7D A;  3RUL A;  5IO9 A;  2QDF A;  4HXD A;  1YNT E;  1N63 A;  5AEK B;  2HTM E;  4JGH B;  3Q3O C;  4CO7 A;  4HEA 1;  2YEP F;  5I4D A;  2J0K A;  4HDO A;  4I6L B;  1GOZ A;  3O13 A;  2I38 A;  4WAF A;  4FBJ B;  4GDK B;  5EDS A;  1R4N I;  4KSL C;  1VD2 A;  1MHX A;  1OQQ A;  4HKQ A;  2NPT B;  4WJP A;  3VXW A;  4C7Z A;  2AL6 A;  3R7Q A;  2BW2 A;  2O6V B;  2YLM A;  3B9J A;  4B6W A;  5HG2 A;  3VTU A;  2JYT A;  1E10 A;  3DBL I;  2N7E A;  3NRZ A; 
#chains in the Genus database with same CATH homology
 4OVZ A;  3AE3 B;  1UWX A;  3Q8B A;  1RYJ A;  1XLO A;  2X38 A;  3AEC B;  1VZ8 A;  1IGD A;  4TSS A;  4ZYS A;  1I4H A;  2RDH A;  1WRI A;  3NVY A;  1JAL A;  3AEB B;  2M19 A;  1SE2 A;  4GDL B;  1NYQ A;  4LTU A;  3W5V B;  1T6B X;  1JCK B;  3NS1 A;  3AMZ A;  2W82 A;  3SR6 A;  2BTE A;  1SE3 A;  1PDX A;  4ZHO A;  2LEK A;  1WGK A;  1JRO A;  1E6E B;  2VZK B;  3HVZ A;  4WH4 A;  3ZJT A;  3RFZ B;  5BYQ A;  3KQ4 A;  1CK1 A;  1D5Z C;  2IGG A;  4A9A A;  2FE8 A;  2RDG A;  2MJ3 A;  5EE9 A;  1C9F A;  1TY2 A;  1I4R A;  1SJH D;  2WU5 B;  2BYT A;  1VR9 A;  2JQR B;  2BBC A;  1F0Z A;  4NAM A;  1AYF A;  1LO5 D;  4N58 A;  2PIA A;  2HDE A;  1XLQ A;  1D4B A;  2YEP B;  1NVI D;  1TKY A;  3EA6 A;  3GS2 A;  2J42 A;  1YQ4 B;  1OQR A;  3ZQ4 A;  2JX5 A;  1D5M C;  1D5X C;  4AQ7 A;  5C2T B;  2QIE B;  3FAH A;  1PGA A;  2WXN A;  3W9C B;  1FD6 A;  1TZO A;  1FCL A;  1C76 A;  4YXD B;  2DYM A;  3E9S A;  2L83 A;  3AE5 B;  1FXA A;  3PO0 A;  3MC0 B;  2PTL A;  1HEZ E;  4RFB A;  1JW9 D;  4RGT A;  2NTS A;  1QF6 A;  1ZDV A;  3VRB B;  1FFV A;  4ITK A;  1V97 A;  4REZ A;  4CQN A;  4KGR A;  4HRS A;  2QMT A;  4YSY B;  4NAW B;  1TKG A;  2Y5C A;  4JE3 B;  1I4P A;  4LLG M;  3V05 A;  2WXQ A;  1QOA A;  2WXP A;  3B2G A;  1VLB A;  1SJE D;  3TEZ A;  3AE4 B;  4ARI A;  2W54 A;  3U2S C;  1QOG A;  4MT5 A;  2K9X A;  1SXT A;  3Q8C A;  3AEF B;  3MHZ A;  1FM0 D;  2JWU A;  5HI1 A;  1JML A;  2WXL A;  2ZW0 A;  2INP E;  3P1M A;  5H8Y E;  3VRA B;  1STE A;  1PFD A;  4RF0 A;  2R61 A;  4HKZ E;  2IDY A;  2AQ3 B;  2BS2 B;  2GRI A;  4MAC A;  1Y56 A;  3AH7 A;  2FUG 1;  1VDV A;  1WXQ A;  2PW9 A;  1FXI A;  1C4A A;  1YJI A;  1IBX B;  4YWG G;  3U52 E;  1C4P A;  1K51 A;  2LMC A;  2INN E;  1ZUD 2;  2ICI A;  2V4I B;  4KKI A;  3P42 A;  4ZHP A;  2ACZ B;  4RF1 A;  1IGC A;  3SEB A;  4TMA B;  1V8C A;  2Y3A A;  1V1O A;  1ZP0 B;  3VQI A;  3AEA B;  3P4Q B;  4RGN A;  5AUI A;  1FNV A;  2KDM A;  1J7C A;  3HVD A;  1BUI C;  1TKE A;  3VR8 B;  1XO3 A;  1N5X A;  1WWT A;  3TEX A;  1CQV A;  4YTN B;  3P4R B;  2MEK A;  1L0V B;  1JRP A;  5C3J B;  1A70 A;  1ET9 A;  2FBW B;  2WU2 B;  1JWM D;  4C56 C;  3R8B A;  5G5H A;  4DXG A;  3BYT B;  5D7G A;  1L4D B;  4DQO C;  4XWW A;  1EM7 A;  2L52 A;  4KGT A;  1N60 A;  1C4C A;  4RH6 A;  1CJE A;  3FIL B;  3W1S A;  5TSS A;  4AS1 A;  2BB6 A;  3BZD B;  3IAM 1;  2AQ2 B;  3N9Y C;  4OZB A;  3TEW A;  1ZXI A;  1E0Z A;  1NEN B;  1UNS A;  1JWA D;  1XCQ L;  1T5X D;  2JZP A;  2WXH A;  4XDC A;  3AE1 B;  1GPX A;  2W55 A;  1TS5 A;  5BMG A;  3BVG A;  5T8I A;  2OED A;  4NJC A;  3E56 A;  2IGD A;  2V3N A;  4OZC A;  3BYY B;  4UDU C;  4O1N A;  1QKZ A;  4J3O D;  1L5P A;  1SBB B;  2J4X A;  3WCQ A;  4A6Q A;  2DWQ A;  1FCC C;  2E3T A;  1TS4 A;  1K53 A;  1GAQ B;  4JWS C;  1EU4 A;  2LHE A;  4XDD A;  2WLB A;  2BS3 B;  1HXY D;  1NI3 A;  3ZYY X;  2PLP A;  3P4S B;  4YSZ B;  2WXO A;  3U4E G;  1KRH A;  5GXG B;  2Y5P A;  1QIL A;  1JWS D;  1FRR A;  1QT9 A;  2KAC A;  5D3D A;  4KKJ A;  2WXM A;  2WS3 B;  1QOF A;  1V1P A;  1ZXH A;  2PKO A;  2K0P A;  3URY A;  2AQ1 B;  2G1E A;  4YTP B;  3NZ3 A;  5EE1 A;  1XXG A;  3AE2 B;  3SFD B;  1KLU D;  2V3P A;  1FNW A;  1YN3 A;  4IKG A;  3EGR A;  4D2K A;  1ENF A;  4TQ0 A;  1I4X A;  2WXG A;  5E6J A;  1TJE A;  1PGB A;  2JYE A;  4TQ1 A;  5HHD G;  3GP7 A;  1EWC A;  2RMM A;  5FK9 C;  5G5G A;  5BMI A;  1OFF A;  2MJE A;  3FC4 A;  3ZGZ A;  1ZPS A;  3NVV A;  4EE2 A;  2L32 A;  1XLP A;  1K50 A;  2WXI A;  2SAK A;  3V3X A;  1MI0 A;  4KX6 B;  3GB1 A;  1ZDX A;  2QIL A;  3LYY A;  5EE0 A;  3EUB 2;  2GB1 A;  4YT0 B;  1PYW D;  2WNM A;  1P7F A;  1QLB B;  2AX5 A;  1KFY B;  1SIJ A;  2N9L A;  2H89 B;  3CIR B;  1TYG B;  1YMH E;  3LXF A;  3IT6 B;  4ZOH C;  4DXF A;  1SEB D;  1DOI A;  2QSD A;  5D3I B;  4GLS C;  4HJG E;  1ZOY B;  3AV8 A;  3DWM A;  3J9C A;  3LB8 C;  5JXV A;  1N62 A;  3HRD D;  3R2I A;  1RM6 C;  2DBY A;  1KF6 B;  2I2Y A;  2GI9 A;  2W3R A;  5MPO A;  2N9K A;  1JWB D;  3NVZ A;  3TSS A;  1HZ5 A;  1YN4 A;  1WSP A;  1N5W A;  3MP9 A;  4A90 A;  2CJN A;  1J7B A;  3P63 A;  1F2R C;  1ACC A;  2N0S B;  5BYR A;  4M0W A;  1PUT A;  4RGM A;  2DYO A;  2J53 A;  4YTM B;  4XWT A;  1TY0 A;  4FXC A;  3IAS 1;  2WXR A;  1HA5 A;  4RGO S;  3AE9 B;  1E9M A;  1KTK A;  1C77 A;  1FEH A;  2PVG C;  1L4Z B;  4IOI E;  1L0X B;  3AE8 B;  3BVM A;  4XE0 A;  3AM9 A;  1DOY A;  1EWY C;  3PZ8 A;  3R2T A;  1VZ7 A;  2M56 B;  3AB5 A;  4WWM A;  2XN9 C;  4ZRP A;  4ZRQ A;  1FFU A;  3RPF C;  1DOX A;  1UGJ A;  1XCT L;  2LFI A;  2MH7 A;  3DWG C;  1VZ6 A;  2BB5 A;  1XF5 L;  2WDQ B;  2WQY B;  2EEL A;  2KWD A;  1TS3 A;  3ZJV A;  1IUE A;  2QEJ C;  3MFG A;  1SF0 A;  1RWS A;  4RCO A;  1FNU A;  1YJJ A;  3I9V 1;  1L0Y B;  1NEK B;  2WP9 B;  2WXK A;  3BWU D;  1C79 A;  1GB1 A;  3Q8E A;  4P6V F;  3AE7 B;  2DLB A;  2LHD A;  5FR3 A;  1WYG A;  1MHH E;  4USA A;  3C8Y A;  4OW0 A;  2G9H D;  1R7S A;  2MJD A;  2ON8 A;  3B2F A;  1FO4 A;  2V0G A;  5BYS A;  1YN5 A;  2W3S A;  2H88 B;  3KWV A;  2Q5W D;  2IGH A;  4US9 A;  5FKA C;  4WUR A;  1L6V A;  1AWD A;  2LGI A;  1VJK A;  1BML C;  2ZW1 A;  3MJ5 A;  3P4P B;  2KMM A;  1B9R A;  1D6E C;  1L6U A;  1UWM A;  1KLG D;  1CZP A;  2LUM A;  5HFY A;  1GB4 A;  3KLS X;  2CJO A;  2WDV B;  3TUO A;  4C7Y A;  2J52 A;  1HQR D;  3BK2 A;  4IDI A;  2WXJ A;  4N6E B;  2QJL A;  1DGJ A;  2NMQ A;  1SB3 C;  2TSS A;  1Q10 A;  2XNA C;  2OHF A;  1C78 A;  4B0M A;  4H2A A;  2K3U A;  2ONQ A;  2WDR B;  3CWI A;  1SE4 A;  1BXT A;  1M4V A;  1VRA B;  4RNA A;  4A55 A;  2KQ4 X;  1V1P B;  3ETR A;  1YQ3 B;  3TEY A;  3T3O A;  4YSX B;  1JWU D;  3L4P A;  2M0A A;  2Z8L A;  3UI3 A;  3AN1 A;  2WXF A;  4L2Y A;  3HUI A;  2B76 B;  3T3N A;  1I7H A;  2K22 A;  2PMV A;  2K5P A;  3U7Z A;  1JQ4 A;  1T3Q A;  4JX1 C;  1J7A A;  3OWE B;  1B1Z A;  2IPK D;  2SEB D;  1QQR A;  3Q8F A;  4MM3 B;  2IJ0 A;  1F2R I;  2EKI A;  2PVO D;  2CU3 A;  3W2D A;  1FRD A;  1P7E A;  1K52 A;  4A8X C;  2N7J A;  2L1A A;  5AUK A;  3AE6 B;  4Q2J A;  2BT6 A;  1UUP A;  1F77 A;  2KAJ A;  4B0E A;  5BMH A;  5LNK 1;  1QOB A;  2JXT A;  2JU6 X;  1IBX A;  1HZ6 A;  3BVZ A;  4WQM A;  1NYR A;  1AW7 A;  1I4G A;  3IT4 B;  1SSN A;  3ZJU A;  3BII D;  4OHJ A;  3W5U B;  3IXS A;  3AEG B;  4PT5 A;  3Q69 A;  3I57 A;  3SFE B;  3VR9 B;  4MH8 A;  2NTT A;  5EE3 A;  1YNT E;  1N63 A;  3ABV B;  1ROE A;  3FIL A;  2HTM E;  4L23 A;  4KGS A;  5H92 C;  2JSV X;  2BS4 B;  3Q8A A;  4HEA 1;  2YEP F;  3KWL A;  1MVK A;  4OZA A;  5I4D A;  4ARC A;  4NZL B;  3BK1 A;  1EU3 A;  1PGX A;  1FIQ A;  1GOZ A;  3O13 A;  2I38 A;  4JWU C;  4WAF A;  4JPS A;  4GDK B;  1ZE3 D;  3H8H A;  1E7P B;  1MHX A;  1OQQ A;  4US8 A;  2D5G A;  4HKQ A;  4WIP A;  1ESF A;  3NVW A;  1RFK A;  2LJI A;  4P16 A;  4C7Z A;  1FMA D;  3AED B;  4N59 A;  2E6X A;  1I4Q A;  2BW2 A;  2RPV A;  3AEE B;  3B9J A;  2VZK D;  1AN8 A;  3PZ7 A;  4R3D A;  5HG2 A;  4LK0 M;  1DYQ A;  1ET6 A;  4C80 A;  1N61 A;  1TS2 A;  2JYT A;  1E10 A;  4L1B A;  2KN4 A;  1XEE A;  3NUH B;  1MPE A;  1KH0 A;  3NRZ A;  1XLN A;  4HRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...