1YMHE

Anti-hcv fab 19d9d6 complexed with protein l (ppl) mutant a66w
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
KEEVTIKVNLIFADGKIQTAEFKGTFEEATAEAYRYADLLAKVNGEYTWDLEDGGNHMNIKFAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab 16D9D6, light chain
publication title Comparison of the crystallization and crystal packing of two Fab single-site mutant protein L complexes.
pubmed doi rcsb
source organism Finegoldia magna
total genus 15
structure length 65
sequence length 65
chains with identical sequence F
ec nomenclature
pdb deposition date 2005-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ymhE00
2QSDA 1EM7A 2KDMA 4D2KA 2I2YA 2KQ4X 5HI1A 4MACA 1YMHE 2ON8A 1P7EA 2PW9A 2JXTA 1UWXA 1K50A 5BMGA 1MHHE 1PGBA 1YNTE 5HG2A 5HFYA 2ONQA 4KGSA 2JSVX 3FILB 1Q10A 2ZW1A 2IGDA 3FILA 1K53A 1MHXA 2LHDA 1FCLA 2KWDA 2RMMA 5JXVA 5BMHA 2KACA 1XCTL 2EELA 1XF5L 2GB1A 1IGCA 2OEDA 1FCCC 1HEZE 1MI0A 4HKZE 4OZCA 1K52A 3MP9A 2LUMA 2N9KA 1JMLA 1F2RC 2N9LA 2JZPA 1MPEA 1KH0A 1GB1A 1PGAA 3UI3A 2K0PA 2ZW0A 2J52A 1XCQL 2IGGA 4KGTA 1D4BA 1P7FA 2JU6X 1K51A 1IBXB 1MVKA 1GB4A 4WH4A 1ZXHA 4OZBA 2IGHA 2PLPA 4HJGE 1FD6A 1F2RI 2KN4A 4KGRA 1IGDA 3GB1A 2JWUA 4OZAA 1PGXA 5HHDG 4IOIE 2QMTA 2LGIA 2PTLA 4GLSC 5BMIA 4IKGA 2NMQA 1HZ6A 2RPVA 2I38A 2LHEA 1QKZA 2GI9A 2N7JA 1HZ5A 1C9FA 3V3XA 2J53A 1IBXA
chains in the Genus database with same CATH superfamily
1BT0A 3ZGZA 4ZRIA 2L00B 4ANWA 5T8IA 4MGZE 5EE3A 3Q3NC 4GOCA 4YTNB 1I4HA 2OJRA 1L6VA 4KGSA 1YQ4B 2N9XA 1TKEA 2WXPA 3FILA 3V62A 3Q8EA 2VZKB 4G0NB 4K7WA 4YSYB 2BS3B 3N3KB 1IPGA 2KLGA 3CSTA 2W82A 4KSKC 1XCTL 1XLQA 2RDBC 4JLCA 4H2AA 4FA6A 3V61A 1YN3A 1ZXIA 1MG8A 1HEZE 3N32A 4II2B 2KDEB 3ZNHB 2LGSA 2MWSB 4J6IA 4GSWA 1F1HA 2G4DB 4ARCA 2O2VB 2JZPA 3ALBA 4KDLB 2GRIA 1WYGA 3P1MA 5EDSA 2K0PA 3U8ZA 3GE3C 3ETRA 2WX1A 3DBLI 4OW0A 1X1MA 1YD8U 1PDXA 1V80A 5BYQA 4XX5A 2MBOA 1CMXB 4WURA 2JPHA 3UQBA 2NR2A 4W9FA 2DENB 1KOTA 1YQBA 2LD9A 3PHXB 1SEBD 4RM8A 3D32A 4KGRA 1FFUA 2DAJA 2W3RA 4ZHOA 3DBLB 5MPOA 4IM2A 5CHFA 1PGXA 2G4SA 2NVUI 3AE4B 2X38A 5CX3A 4BOSC 1T5XD 4USAA 2LHEA 5KHQA 1F77A 1JRUA 3DBRB 2KKCA 4K7UA 1GAQB 3TEWA 3VAWA 2KT7A 3A1QB 4IM3A 5HI1A 1TS5A 1GC6A 3RULA 2C5LC 3HRDD 1JWMD 1NYQA 4HEA1 3VRAB 3VFKA 1YOVB 4GU2A 3UIPB 2G3QB 5D94A 4W9GA 2LFIA 3A33B 1VR9A 4L1BA 3B2FA 1B1ZA 4MM3A 2MA9B 3Q3FA 3AXCA 4YXDB 1V86A 2EKIA 2KWDA 3AE1B 1FRDA 4ACFA 3BYYB 3HIZA 2SEBD 2KMCA 3U30A 3NZSA 2SAKA 4RM9A 5AUIA 4OVUA 2ZVNA 2MCNB 1LM8B 5AZFA 3EUB2 3KWVA 3MC0B 2J4XA 1YN5A 1AYFA 2K8HA 5I4DA 2KWUB 1PYWD 4NQLB 4RFBA 4ZRQA 2L7RA 3DCGA 1D4BA 3EECA 4WAAA 4ITKA 4YTPB 2DBYA 2JVCA 1K8RB 3TMPB 4DXGA 4YL8A 2E3TA 1VJKA 1SIFA 1SE2A 1ZDVA 1N5XA 2KWVB 3ZNID 4LNFA 1RWSA 4XDCA 3PLVA 1NYRA 3T3NA 1WRDB 3ZXRA 1ET6A 1R4NI 2AX5A 2M19A 2IJ0A 3NOBA 2Z0EB 2KTFA 1UH6A 4BOZB 2ON8A 1SE9A 1PUTA 4HK2A 5BMGA 4CO7A 1MHHE 2WU5B 5HFYA 3ECIA 2ONQA 5D7GA 4LNIA 3GZNI 1XLOA 1IUEA 3C19A 4AP4C 1FCLA 3PZ8A 1D6EC 1UF0A 2QC8A 3L4PA 1N62A 4XYCA 3ZRFA 3AMZA 2LVQA 3VUYA 1IGCA 3KH0A 2C7HA 1NI2A 5E6JA 3N1YC 2NTSA 4ZOHC 1XXGA 4M00A 2IO3B 1JROA 3PS6A 2AQ1B 1YX6B 4US8A 3MHZA 3PPAA 2N1VA 3BIID 2O2VA 4KSLC 3RPFC 4A20A 2BYFA 4XE0A 2WXFA 4PS7A 3SFEB 1S1QB 3B08A 3ZDMC 3NVYA 4C80A 4YT0B 1SBBB 4ANVA 1NEKB 3M95A 1OGWA 2L3ZA 4Q2JA 2KDFB 4L2YA 2KDBA 4XZ4A 1FNVA 1ZXHA 2D11A 5CHVC 2REXA 2ZCCA 2JQRB 3VH4B 3ZVVA 4KX6B 4RGMA 4CYEA 2ZEQA 3UINB 3IXSA 2A5UA 3C8YA 4LCDE 1QKZA 2LASA 4W9EA 4REZA 4XWWA 2L83A 2XK5B 2KK8A 3ZJVA 4JGHB 5H92C 3DWGC 2M56B 1SE3A 2R2QA 2KAJA 1VZ8A 1KTKA 4W9KA 4K81A 2PVGC 3HUIA 2R61A 1FPYA 2KFKA 2ZW1A 1E6EB 1Z5SB 3L16A 3PHWB 4BBNF 1LGRA 3TBLD 3X0WA 3MHSD 4B6WA 3QAQA 1OQQA 1EF1A 4RGOS 2W9NA 2PE9A 1UWMA 2DX5B 4EZJA 2KJ6A 3NJTA 4FXCA 4URKA 3AI5A 2ICIA 1WR6E 3ZNGC 2HTME 2BS2B 5LXHA 4LNNA 3TCAA 4KDIC 2M17A 4KIKB 3R7RA 4RH6A 4NJ6A 3BZDB 1WYWB 1ZOYB 3VDZA 2LGYA 1ACCA 3VHTC 1H4RA 4HCPB 1TT5B 3TL5A 5DPTA 3NY5A 2KC2A 4J3OD 1GG3A 1TKYA 2XN9C 1AW7A 3FC4A 4DXAB 1AARA 1R4MB 2LXAA 1FEHA 2BB5A 2RDGA 2PIAA 3DBHI 1LXDA 1J7BA 2K22A 3ABVB 1B9RA 3VXWA 3J9CA 3RD2A 3R2IA 1YX5B 2N7DA 2DZKA 2L05A 3ZTCA 3PRPB 4XDDA 3JYUA 3DBHB 1FO4A 4N58A 1T6BX 4B95A 2DZMA 4DBGA 4FJYA 1E8YA 2Z0DB 2ZCBA 4EKUA 2VH2A 4TQ0A 3MJ5A 1DOXA 3BK1A 4WQOB 5IA7A 1V97A 5JXVA 5BMHA 1YIWA 2EELA 4DK5A 2GB1A 1GOZA 1E8XA 2JWZA 2RSUA 3AEFB 4E71A 4WIPA 2LMCA 4R3DA 1C79A 1E8ZA 1K52A 3RI7C 4C4VB 3CF6E 2LJ5A 3W1SA 1RLFA 1SF0A 2OJWA 2BKFA 3H8HA 1CK1A 3U4EG 2NS5A 3UGBB 1QOAA 3DHIC 1XCQL 3APCA 2ZNVC 3DWMA 2LJIA 1KRHA 3DOWA 4BKTA 3ZLZA 1S3SG 3M62B 3QX1A 4FULA 4IWPA 2BWFA 3OJ3A 3Q3OC 4G11A 4DHZE 2WDRB 2PKOA 3AV8A 2WXLA 4M02A 5D2MB 1DGJA 2C60A 3RUIB 1IGDA 4PYZA 3P4RB 3KW5B 2WLBA 1WFYA 4HVBA 2HDEA 3QA8A 4EZKA 2LGIA 5BMIA 2LUEA 1HTQA 4TQ1A 2MQJA 2V1YA 2HD5B 2WXJA 2LZ6A 1V9JA 3AEDB 2BT6A 1XLNA 2BF8B 4A3PA 1Z2MA 1UBQA 1EWCA 2FNJB 3PZ7A 3MC9A 4TMAB 1XEEA 4HDQA 2XK5A 3A9JB 1I4GA 4YWGG 3DHHC 1N63A 1CJEA 1P7EA 4OVVA 1TZ1A 3BK2A 3T3OA 4C56C 2WQYB 3EFCA 1PGBA 3CSFA 1EU3A 3JSVB 2LWPA 2MJDA 3HVZA 1V5TA 1Q10A 3Q3JA 2IGDA 4XC2A 1MHXA 4IW0A 3KUDB 2PJHA 2V3PA 4TKNA 2AWTA 3TJPA 2LEKA 2C7NB 4LLGM 2AYOB 1SJHD 2WGSA 1YJ1A 3IFWB 4OZCA 2LUMA 1RYJA 2KANA 3CIRB 1L7YA 1QLBB 3EC8A 4ZHPA 3JVZX 1RM6C 4PYUA 2KX0A 1WZ0A 1F52A 4KIKA 4AWJA 2UYZB 4K7SA 2DWQA 4ARIA 2QHOA 1AN8A 2ACZB 4A8XC 2IY1B 1T3QA 1L2NA 2NPTB 3H7SA 3E9SA 1J19A 1JCKB 3NS8A 4ANXA 3PREA 3EGRA 4LK0M 4RNAA 3WCQA 2Y5BB 1TKGA 2K1FA 5E6OA 2JYTA 2GBNA 5IKCM 4I6LB 1KM7A 3PGEA 3RNFC 2B3AA 1ZP0B 2IYDB 4UDUC 5IAAC 4HROA 2LVPA 4NAWB 2WWZA 4ZRJA 2XEWA 4A55A 2BVCA 3W5VB 3V6CB 2MP2B 1FXTB 3URYA 3L08A 4S17A 2QJLA 2WX0A 2IZVB 3AEBB 5G2NA 1WMHA 2FIFA 4JPSA 2L52A 1ISNA 1C9FA 1A70A 3V3XA 4DDID 3RNCC 3DBRI 2BYEA 2MEKA 3Q8BA 4D2KA 2KMMA 2WXQA 2I2YA 2D3AA 4IM0A 1G6JA 1MJDA 1WY8A 5G55A 1I35A 4TUUA 3OLMD 3BVMA 1TIFA 2L0FA 2KWCA 2JSVX 3LJ3A 4W9IA 3U7ZA 2AQ2B 2YEPB 1Q5WB 4X57B 1KLUD 2XNAC 5G5GA 4AJWA 1WF9A 1YJJA 2RD0A 2X8XX 1VRAB 2H89B 4F1SA 2CU3A 2D2QA 4WJNA 4NNJB 3H7PA 1LFDA 2ZJDA 3OJ4B 3U2SC 2V0GA 4BKSD 3CWIA 2BS4B 5LNK1 1E7UA 3R3MA 2GBMA 4GGQA 4II3B 5AUKA 4PK1A 1TGZB 2WHIA 3W9CB 1WGKA 4LJPB 2LRUA 3QHTA 1VCBA 4OZBA 1BXTA 1N5WA 3DQVA 4M8NA 2PLPA 1ZKHA 2FCQA 4P1BC 2DYBA 2VH1A 4NQKE 3VR9B 1OQYA 3VH3B 2KHWB 2QEJC 1MG4A 4GLSC 2ZNVB 2HTHA 2L8JA 3KUZA 1UNSA 4MH8A 4M0WA 4GDLA 1SIJA 2CHXA 2JT4B 2INPE 2WDTB 2NBVB 1C4PA 3ML9A 3HVDA 1EM7A 2GMIC 3KQ4A 4HLEA 2YEPF 2KQ4X 2GOWA 1WJ6A 1YMHE 3A9JA 4IC7B 2PW9A 3WAOA 4ANUA 5BO4B 1UGMA 3KLSX 1H8CA 3L54A 4IG7B 4MEMA 1I4XA 2CR5A 1QOFA 1WGGA 5IP4D 3BINA 1V1PB 1AWDA 4N59A 1QOBA 4IUMB 3HM3A 2L76A 1C78A 2ASQA 1I4QA 1XO3A 1F0ZA 4AUQC 4NPNA 1E8WA 3TEXA 1OEYA 4WQMA 5AZHA 3IBEA 3RNEC 3KWLA 3VTWA 4RF1A 2N9LA 4MJSB 2KOXA 1XD3B 4HPPA 3IAM1 1PGAA 4HXDA 1NBFC 1JWUD 2O6VD 3APDA 4ZRPA 1TS3A 2JX5A 4TSSA 4CQNA 4HDOA 1VDVA 3HK0A 3TEZA 1WZ3A 1A5RA 2MBHA 1WWTA 2NPTA 1JW9D 2JY6A 4PT5A 2B76B 4RMAA 1TJEA 1L0YB 3V60A 5GXGB 2WXHA 2KN4A 3KUCB 2CHWA 4P7IA 1E10A 1WJUA 3HHMA 2JWUA 3DVNU 5HHDG 1JWAD 4B9KA 3HM6X 2MP2A 2KQ7A 1UBIA 1DOIA 4FADA 5DPRA 4ASWC 3AE2B 2K3UA 1QT9A 1FFVA 2KDMA 2K6DB 3V05A 3ZQ4A 2J0KA 4GXBA 1WM3A 2UWQA 3EHVA 4MH0E 3U52E 2QCZA 1UELA 1PFDA 2Z59B 1WX7A 2D3CA 3RMKC 5E6NA 3VQIA 2DNFA 1P1AA 2W54A 2K25A 3NVZA 4DHZB 2WP9B 1HXYD 4WJOA 4G3XB 2DYOA 2NBWB 2WXGA 4MSQB 5J2RA 3APFA 1I7HA 3WAMA 4BAXA 3M63B 3B1LX 2KZRA 1D5MC 2MBQA 4RF0A 3OAWA 3A1QA 4GDKB 1MI0A 2K8CA 2KX3A 2AEHA 1FRRA 1ET9A 2Y5CA 4FN2A 4AOFA 1Y8RC 1RRBA 2ZPYA 2N9KA 3R66C 1F2RC 1FIQA 1QQRA 1JWSD 3NRZA 5DPSA 3X23A 1I4RA 1V5OA 1T0QC 4PS8A 3AU5A 4JIOU 1ZUD2 3QIJA 5FR3A 2WNMA 5FR6A 3RNAC 1UD7A 3MFGA 3GP7A 2DZIA 4B0MA 4C7ZA 3H6NA 2HE7A 1P3QU 3EFUA 3I9V1 5BYSA 1OTRB 1EUVB 1IBXB 2L1AA 3WAPA 3VTUA 4KZCA 3V6EB 4BVUC 3QCAA 1M94A 2IGHA 1R4MI 3A4SC 3H1UA 1ZPSA 4WWPA 3AE3B 3MJWA 5HKHA 4OZAA 2IO2B 3IT6B 4K1RB 1V1OA 3LYYA 3KVFB 1QF6A 1U4AA 2NMQA 4AS1A 1HZ6A 2CU1A 4WJPA 3AE5B 4KV2A 2WDQB 2J0JA 2D10A 1XT9B 3OG5A 2CS4A 2ZZPB 3SDLC 1E7PB 2W3SA 3AH7A 1E5WA 2Y3AA 3NHEB 3AEGB 1OFFA 4W9CA 3Q69A 2LGXA 2VRRB 3Q3MC 2MBBB 1XQQA 1YNTE 3R8BA 3I3TB 2JYEA 1WIAA 2PMVA 1V1PA 3QK0A 2LHDA 3RT3B 5D6JB 5H8YE 2JUOA 1C3TA 4LDTD 2FUG1 4A9AA 4YTMB 1E90A 5EE9A 3NZ3A 4W9DA 2M0AA 3S2AA 2K6QA 2PPHA 5C1ZA 2N9PC 1IP9A 4HWIB 5FKAC 4MGKE 4MJSA 4KVGB 2N4FA 4NJ7A 4DHJD 3K9OB 2IO0B 4GN1A 2NBUA 2IGGA 2BKRB 1V8CA 5FK9C 4KGTA 2J0MA 1VZ6A 1UUPA 4E74A 2WXOA 1J0GA 2R2OA 2DAFA 3QJZA 4A6QA 2PE6B 2WU2B 5D3DA 2TSSA 4E3CA 1WRIA 3SFDB 3UF8A 2EMSA 3H9DA 1WGDA 4MGIE 1F9JA 3AE7B 4NAMA 3NUHB 4KZ0A 2GLSA 1WXAA 4M01A 3FKYA 4P6VF 2I1JA 3VTVA 1DYQA 4M8MA 2K9XA 1JRPA 3ZXVA 4IWQA 2UU7A 2QSDA 2FCMA 5L83A 2KTRB 3QWZB 3L13A 1SGHA 2MJ3A 4EE2A 4ICUA 5DPWA 3DVNV 5J17A 3PVLA 3ZUNA 2MJEA 3QARA 5HG2A 1TBEA 3U7DA 3WALA 2BWES 4W9JA 2FCSA 1L4ZB 1TS4A 2FAZA 2AL3A 2M4NA 4WWMA 5TSSA 2V3NA 5GMVA 3PLUA 1PQSA 1TY2A 2D3BA 3ZYYX 1OQRA 4F7ZA 1C4AA 2BW2A 5JHAA 4FHJA 3P4SB 3MTNB 4HPMB 3L0WB 1JMLA 3ZRCA 2WXKA 3GOEA 4DXFA 1KH0A 4LNKA 5J18A 2D07B 4I6PA 1E9MA 3UI3A 2EKEC 2Z8LA 2KVRA 1WXSA 4DWFA 2FBWB 4OHJA 3IT4B 2JU6X 2GBKA 2PEAA 2PVOD 2LI5A 2K5PA 3ZKJC 5LXIB 3NVWA 4HJGE 2MX2A 4MELA 1RAXA 1LQBA 1HTOA 2LRWA 2QMTA 2NCNA 3W1SC 1SJED 2BYVE 4L23A 2N7JA 4BBNC 2KN5A 1HZ5A 2LVOA 2V9HA 3AB5A 2J53A 2E6XA 2V3SA 3AECB 2IPKD 2VZKD 3VVWB 3LXFA 3PRMB 3NS1A 3LB8C 1VLBA 3N1ZC 1UWXA 2V4LA 4P1CC 3ONSA 4RGNA 1GC7A 3A9KB 4HRSA 1L0XB 3AE9B 2MH7A 5G5HA 4BFRA 3WA0A 3SHQA 3VR8B 2QILA 2Y5PA 1CQVA 2KACA 4P16A 1ZDXA 1JWBD 2BPSA 4WAFA 3M3JA 3RFZB 3NG0A 1EF5A 1T0SC 5JZEB 1TYGB 5C3JB 2KFJA 2LGDA 2C7MB 1L4DB 3N30A 2MLBA 3EA6A 4ZYNA 4CHKA 2N0SB 1GNUA 5AEKB 2KDIA 1P98A 2KVZA 4RCOA 3VUXA 3DPDA 3RNGC 3I5JC 1ZE3D 4MGYE 1SB3C 3PO0A 4C4VA 1D5XC 2IY0B 2KQSA 1LO5D 2GBJA 2NTTA 1KF6B 3ML8A 1T0YA 1ESFA 2BGFA 3IG3A 2OHFA 2KYWA 4FHKA 3BY4B 1WE6A 1J7CA 3OWEB 2WXIA 2KFKB 1IYFA 4NZLB 3CMMB 3AE6B 1E0ZA 1C77A 2KTRA 2W55A 2DLBA 4IDIA 4JE3B 1NVID 2QDFA 1EU4A 1HA5A 5AZGA 2YVCA 4JQWC 2CJNA 5JH5C 2INNE 1C76A 1YN4A 3AN1A 3ZW3A 3O65B 2J7QB 3NVVA 4S0RA 1WM2A 1XF5L 2DZJA 2H88B 2I1KA 2KO3A 4FJZA 2RR9A 1WXMA 4I6NB 4MSMB 1NENB 3ZJTA 2DHZA 3MP9A 1GPXA 1UGJA 3R2TA 2FCNA 4HCNB 3JSVA 1GUAB 4BKGA 3C0RB 1MPEA 3PT2B 4JL9A 1GB1A 5E6PA 5LLIA 2JZ3B 1RFAA 2MSED 3VUWA 4O1NA 3AULA 3BVGA 3BWUD 2ZW0A 2JZZA 3Q8CA 2OOBB 3RN9C 1BUIC 1QOGA 4GMVA 4EZLA 1FMAD 4TV3A 4XGAB 4WWOA 3BVZA 4HKQA 4HPLB 4G50A 1HE8A 1GB4A 4MDKE 3ZTDA 2O6VB 2ZVOA 3I63C 1ENFA 1VD2A 2M1MA 1FNUA 2IO1B 4B0EA 3KYCD 1JQ4A 4GB9A 2G1EA 2JXXA 3RZWC 2HJ8A 2RPVA 2I38A 5EE1A 2RGFA 2G9HD 3UQAA 1L6UA 4ZDVA 4WJQA 1R4NB 2MRPA 2BB6A 1GJZA 2KLCA 2CKHB 4NAWA 2QIEB 3Q2AC 1WI0A 1OEYJ 2JXTA 3N9YC 1K50A 1NDDA 3AEEB 2HJ1A 2K39A 1SSNA 3Q8FA 1RFKA 2L0TA 1C4CA 3GZNB 3A9KA 1J7AA 1P9DU 1XLPA 2IDYA 2G45B 2WXMA 4YSZB 1I4PA 2AQ3B 4W9LA 1FCCC 4PS3A 2INDC 2BTEA 4WWNA 1WE7A 4LJOB 1M4VA 2MW5A 2A4ZA 1E7VA 4MT5A 1WGRA 3R7QA 3PZDA 2JRIB 3T9LA 2J52A 1C1YB 3P2BA 3MC8A 2RPQA 3P42A 1TTNA 4KKJA 1L0VB 1P7FA 1UZXB 3E56A 1KFYB 1V81A 1K51A 2D5GA 4RGTA 4DDGD 1MVKA 3O13A 3IHPC 3AE8B 4WH4A 2BYTA 2WDVB 3AEAB 4A90A 4KKIA 2FUHB 3RNBC 1VZ7A 3ZO5B 4BKSA 1EO6A 3N1XC 2KD0A 1FM0D 1FNWA 2WYQA 1V49A 2LXCA 3GB1A 4IOIE 4ICVA 2PTLA 1V6EA 2WXRA 3Q6BA 4JWSC 1SXTA 1QZEA 2N7EA 5L95C 1YQ3B 1WXQA 2KNBA 3B9JA 4A3OA 2N9EB 2BBCA 4EEWA 1N60A 1T0RC 3TEYA 2IBIB 3NZUA 2KJRA 3RYTA 3GS2A 1CZPA 4BZAA 4FJVB 4EFOA 1ROEA 3N20C 1WH3A 2CHZA 1TY0A 4N9F4 1NI3A 1WSPA 3FILB 3LDZE 4EUTA 5D3IB 1EWYC 3TSSA 3IAS1 2EMTA 2L32A 5C23A 3BYTB 2RMMA 2ZPNA 3P63A 4GIVA 3GE8C 4US9A 4ZRKA 1V2YA 3TUOA 4HKZE 3PRZA 2KMAA 3TIXA 1WGHA 1MFWA 3KYDD 4C00A 3K9PB 5KHOA 4LDTB 3W5UB 3Q8AA 4W9HA 1JALA 3ZIMA 2FE8A 3DVGX 1WMHB 1I42A 4AQ7A 5IOIA 1Q0WB 1HQRD 2INCC 5IO9A 5EE0A 2JRHA 3JW0X 3PV1A 4DHJB 4ZYSA 1WR1A 4XWTA 2O6VA 4IWOA 1YJIA 2KC1A 3DHGC 1D3ZA 2CJOA 3DBSA 5C2TB 4IKGA 1Q1OA 3UIOB 3RZFA 2WXNA 2GI9A 3L17A 4FBJB 4NY0A 4C7YA 1SE4A 3AM9A 2GBRA 2J42A 2N1WA 5TR5A 3L10B 3W1YA 2V4IB 2DYMA 4MACA 1WJ4A 3WANA 1WGYA 1J8CA 2RDHA 3B2GA 3QC8B 2AL6A 3QQ8B 2D3GA 1KLGD 3ZNZB 4DQOC 4K3BA 3H7PB 1ZW7A 3DDCB 3ZDTA 3SD5A 4MM3B 1STEA 3A4RA 4OVZA 4JWUC 1R7SA 1TS2A 1K53A 4N6EB 3ZJUA 4YSXB 2OEDA 1WJNA 2BQQA 3ENEA 1KLVA 2WS3B 2Q5WD 1FXAA 2XBBC 3AU4A 1N61A 2KXJA 3VRBB 3PTFC 3Q14C 3T8MA 1ZGUB 5BYRA 5DCNA 2MHJA 3P4QB 3IVFA 1P0RA 3W2DA 1DOYA 1FXIA 4NJCA 2M0XA 4JX1C 1TZOA 3DVGY 2K8BA 4LTUA 1WXVA 4AJYB 4QAYA 4M0WB 4GDLB 5CTRC 3SU8X 4GDKA 3B0AA 2FIDA 5JHBA 1QILA 3SEBA 1KJTA 2YLMA 1FD6A 1F2RI 1N6ZA 2M8SA 1WX9A 2JF5A 4F8CB 1L5PA 1D5ZC 4EOYA 4LNOA 4FLHA 5IN7A 3FAHA 3P4PB 3SR6A 3WIMA 1WX8A 2C9WB 2KJHB 4K3CA 3I57A 1Y56A 5CHWA 3PSEB 1IBXA 1BMLC 2MBEA 4HJKA 3RCZA
chains in the Genus database with same CATH topology
2KDMA 1C77A 3V05A 3ZGZA 2W55A 4XDDA 3ZQ4A 2DLBA 4IDIA 1FO4A 4JE3B 3U52E 1NVID 4N58A 5T8IA 1PFDA 1T6BX 3VQIA 1EU4A 1HA5A 5EE3A 4YTNB 2W54A 1I4HA 2CJNA 4TQ0A 2INNE 3NVZA 3MJ5A 1L6VA 1DOXA 3BK1A 4KGSA 2WP9B 1YQ4B 1C76A 1YN4A 1HXYD 3AN1A 2DYOA 1TKEA 2WXPA 2WXGA 3FILA 3Q8EA 2VZKB 1I7HA 4YSYB 2BS3B 1V97A 3NVVA 5JXVA 2W82A 5BMHA 1XCTL 1XLQA 2EELA 1XF5L 1D5MC 2H88B 2GB1A 4H2AA 4RF0A 1GOZA 1YN3A 3AEFB 1ZXIA 4WIPA 2LMCA 4R3DA 1NENB 1HEZE 1MI0A 1C79A 4GDKB 3ZJTA 1FRRA 1K52A 1ET9A 3MP9A 2Y5CA 1GPXA 1UGJA 3R2TA 4ARCA 2N9KA 3W1SA 1F2RC 1FIQA 1QQRA 1JWSD 2JZPA 3NRZA 1I4RA 1SF0A 1MPEA 2GRIA 1GB1A 1WYGA 3H8HA 1ZUD2 1CK1A 3P1MA 5FR3A 4O1NA 2WNMA 3U4EG 3BVGA 2K0PA 1QOAA 2ZW0A 3BWUD 1XCQL 3ETRA 3MFGA 4OW0A 3GP7A 3Q8CA 3DWMA 2LJIA 1KRHA 4B0MA 4C7ZA 1BUIC 1QOGA 1PDXA 5BYQA 3I9V1 5BYSA 1FMAD 4WURA 1IBXB 3BVZA 2L1AA 4HKQA 1GB4A 2WDRB 2PKOA 3AV8A 2WXLA 2IGHA 1DGJA 1SEBD 1ENFA 4KGRA 1FFUA 1FNUA 2W3RA 1ZPSA 1IGDA 3AE3B 3P4RB 4ZHOA 2WLBA 5MPOA 4OZAA 1PGXA 2HDEA 3IT6B 4B0EA 1V1OA 3LYYA 2LGIA 5BMIA 3AE4B 1JQ4A 1QF6A 2G1EA 2NMQA 4TQ1A 2X38A 4AS1A 1HZ6A 5EE1A 2RPVA 2I38A 1T5XD 4USAA 2LHEA 2WXJA 2G9HD 1F77A 3AEDB 2BT6A 1XLNA 3AE5B 2WDQB 1L6UA 1EWCA 3PZ7A 1GAQB 3TEWA 4TMAB 1XEEA 5HI1A 1E7PB 1TS5A 2BB6A 2W3SA 1I4GA 4YWGG 2QIEB 3HRDD 1N63A 1CJEA 1P7EA 3AH7A 1JWMD 2JXTA 3N9YC 2Y3AA 3BK2A 3T3OA 3AEGB 1K50A 1OFFA 1NYQA 4C56C 2WQYB 3Q69A 1PGBA 3AEEB 4HEA1 1EU3A 3VRAB 1YNTE 3R8BA 1SSNA 2MJDA 3HVZA 3Q8FA 1RFKA 1C4CA 2JYEA 2LFIA 1J7AA 1Q10A 1VR9A 4L1BA 2IGDA 3B2FA 1B1ZA 2PMVA 1V1PA 1XLPA 4YXDB 1MHXA 2LHDA 2IDYA 2EKIA 2KWDA 3AE1B 5H8YE 1FRDA 2WXMA 4YSZB 3BYYB 2V3PA 2LEKA 1I4PA 2SEBD 2AQ3B 2FUG1 1FCCC 4LLGM 4A9AA 4YTMB 2SAKA 1SJHD 5EE9A 4OZCA 3NZ3A 2BTEA 2LUMA 2M0AA 5AUIA 1RYJA 3CIRB 1QLBB 3EUB2 4ZHPA 1M4VA 5FKAC 1RM6C 3KWVA 3MC0B 2J4XA 4MT5A 1YN5A 1AYFA 5I4DA 2J52A 2DWQA 4ARIA 1AN8A 2IGGA 1PYWD 3P42A 2ACZB 4RFBA 1V8CA 4A8XC 1T3QA 4ZRQA 5FK9C 4KGTA 4KKJA 1VZ6A 1UUPA 1D4BA 3E9SA 1L0VB 1P7FA 3E56A 1JCKB 4LK0M 3EGRA 1KFYB 4RNAA 2D5GA 1K51A 2WXOA 4ITKA 4RGTA 1TKGA 4YTPB 2JYTA 2DBYA 1MVKA 3O13A 4DXGA 4A6QA 3AE8B 4WH4A 2WU2B 2E3TA 2BYTA 5D3DA 2TSSA 2WDVB 3AEAB 4KKIA 1WRIA 1ZP0B 4A90A 4UDUC 3SFDB 1VZ7A 1VJKA 4HROA 4NAWB 1FM0D 1SE2A 1FNWA 1ZDVA 4A55A 3W5VB 3GB1A 1N5XA 3AE7B 4NAMA 3NUHB 4IOIE 3URYA 2PTLA 2QJLA 2WXRA 4P6VF 4JWSC 1RWSA 3AEBB 1SXTA 1DYQA 4JPSA 4XDCA 2K9XA 2L52A 1JRPA 1NYRA 3T3NA 1C9FA 1A70A 3V3XA 1YQ3B 1WXQA 2QSDA 1ET6A 3B9JA 2MEKA 3Q8BA 4D2KA 2KMMA 2AX5A 2M19A 2IJ0A 2WXQA 2I2YA 2MJ3A 2BBCA 4EE2A 1N60A 3TEYA 2ON8A 1PUTA 3GS2A 1CZPA 5BMGA 1MHHE 1ROEA 2WU5B 3BVMA 2MJEA 5HG2A 5HFYA 1TY0A 2ONQA 5D7GA 2JSVX 1NI3A 1WSPA 3FILB 5D3IB 1XLOA 1EWYC 1L4ZB 1TS4A 1IUEA 3TSSA 3IAS1 4WWMA 5TSSA 1FCLA 2V3NA 3PZ8A 2L32A 1D6EC 3BYTB 3L4PA 1N62A 2RMMA 2AQ2B 2YEPB 3P63A 3U7ZA 3AMZA 1IGCA 1KLUD 2XNAC 5G5GA 4US9A 1TY2A 3ZYYX 1YJJA 1OQRA 3TUOA 5E6JA 1C4AA 4HKZE 2NTSA 4ZOHC 1XXGA 1VRAB 2BW2A 2H89B 3P4SB 1JROA 2CU3A 2AQ1B 1JMLA 2WXKA 4US8A 3MHZA 4DXFA 1KH0A 3BIID 3RPFC 1E9MA 4XE0A 2WXFA 3Q8AA 3U2SC 3W5UB 3UI3A 2V0GA 3SFEB 2Z8LA 3CWIA 1JALA 2BS4B 5LNK1 3NVYA 2FE8A 4C80A 2FBWB 4YT0B 4OHJA 1SBBB 1NEKB 5AUKA 3IT4B 2JU6X 4AQ7A 4Q2JA 3W9CB 4L2YA 1HQRD 1WGKA 2PVOD 5EE0A 1FNVA 2K5PA 1ZXHA 4OZBA 1BXTA 1N5WA 2PLPA 4ZYSA 3NVWA 4HJGE 2JQRB 4XWTA 1YJIA 4KX6B 4RGMA 3VR9B 2CJOA 2QMTA 5C2TB 2QEJC 4GLSC 4IKGA 1SJED 3IXSA 3C8YA 1UNSA 4MH8A 2WXNA 4M0WA 1QKZA 2GI9A 4L23A 2N7JA 1SIJA 1HZ5A 4REZA 2INPE 3AB5A 2J53A 4C7YA 2E6XA 4XWWA 1C4PA 1SE4A 3AM9A 3WCQA 2L83A 2J42A 3HVDA 1EM7A 3KQ4A 2YEPF 3ZJVA 3AECB 5H92C 2KQ4X 2V4IB 2DYMA 2IPKD 4MACA 2VZKD 3LXFA 1YMHE 3DWGC 3NS1A 2M56B 3LB8C 2PW9A 1SE3A 1VLBA 2RDHA 3B2GA 1UWXA 2KAJA 3KLSX 1VZ8A 1KTKA 1KLGD 2PVGC 3HUIA 4DQOC 1I4XA 1QOFA 4RGNA 4HRSA 2R61A 4MM3B 1L0XB 1STEA 1V1PB 3AE9B 2MH7A 1AWDA 4JWUC 2ZW1A 1E6EB 1R7SA 4N59A 1TS2A 4OVZA 1K53A 5G5HA 1QOBA 4N6EB 3VR8B 1OQQA 4RGOS 2QILA 2Y5PA 1CQVA 2KACA 1C78A 1E0ZA 4P16A 1UWMA 3ZJUA 4YSXB 2OEDA 1I4QA 1XO3A 1ZDXA 1F0ZA 1JWBD 4WAFA 4FXCA 3TEXA 2ICIA 3RFZB 4WQMA 2WS3B 2HTME 2Q5WD 1FXAA 2BS2B 3KWLA 4RF1A 1N61A 2N9LA 1TYGB 3VRBB 5C3JB 4RH6A 5BYRA 3BZDB 3IAM1 1PGAA 1ZOYB 3P4QB 3W2DA 1DOYA 1FXIA 1L4DB 4NJCA 4JX1C 1TZOA 3EA6A 1JWUD 4ZRPA 2N0SB 4LTUA 1TS3A 2JX5A 4TSSA 1ACCA 4CQNA 4RCOA 1VDVA 4GDLB 3TEZA 1ZE3D 1WWTA 1JW9D 4PT5A 1QILA 3SEBA 1SB3C 4J3OD 1TKYA 2B76B 2XN9C 1AW7A 3FC4A 3PO0A 1TJEA 1D5XC 1L0YB 1LO5D 2NTTA 1KF6B 5GXGB 2WXHA 1FD6A 1F2RI 2KN4A 1FEHA 2BB5A 2RDGA 2PIAA 1ESFA 1E10A 1L5PA 1D5ZC 2JWUA 5HHDG 2OHFA 1JWAD 1J7BA 3FAHA 1J7CA 2K22A 3OWEB 3P4PB 3SR6A 3ABVB 1B9RA 2WXIA 1DOIA 3I57A 3J9CA 1Y56A 3R2IA 3AE2B 4NZLB 1IBXA 2K3UA 1BMLC 1QT9A 3AE6B 1FFVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QSD A;  1EM7 A;  2KDM A;  4D2K A;  2I2Y A;  2KQ4 X;  5HI1 A;  4MAC A;  1YMH E;  2ON8 A;  1P7E A;  2PW9 A;  2JXT A;  1UWX A;  1K50 A;  5BMG A;  1MHH E;  1PGB A;  1YNT E;  5HG2 A;  5HFY A;  2ONQ A;  4KGS A;  2JSV X;  3FIL B;  1Q10 A;  2ZW1 A;  2IGD A;  3FIL A;  1K53 A;  1MHX A;  2LHD A;  1FCL A;  2KWD A;  2RMM A;  5JXV A;  5BMH A;  2KAC A;  1XCT L;  2EEL A;  1XF5 L;  2GB1 A;  1IGC A;  2OED A;  1FCC C;  1HEZ E;  1MI0 A;  4HKZ E;  4OZC A;  1K52 A;  3MP9 A;  2LUM A;  2N9K A;  1JML A;  1F2R C;  2N9L A;  2JZP A;  1MPE A;  1KH0 A;  1GB1 A;  1PGA A;  3UI3 A;  2K0P A;  2ZW0 A;  2J52 A;  1XCQ L;  2IGG A;  4KGT A;  1D4B A;  1P7F A;  2JU6 X;  1K51 A;  1IBX B;  1MVK A;  1GB4 A;  4WH4 A;  1ZXH A;  4OZB A;  2IGH A;  2PLP A;  4HJG E;  1FD6 A;  1F2R I;  2KN4 A;  4KGR A;  1IGD A;  3GB1 A;  2JWU A;  4OZA A;  1PGX A;  5HHD G;  4IOI E;  2QMT A;  2LGI A;  2PTL A;  4GLS C;  5BMI A;  4IKG A;  2NMQ A;  1HZ6 A;  2RPV A;  2I38 A;  2LHE A;  1QKZ A;  2GI9 A;  2N7J A;  1HZ5 A;  1C9F A;  3V3X A;  2J53 A;  1IBX A; 
#chains in the Genus database with same CATH topology
 1BT0 A;  3ZGZ A;  4ZRI A;  2L00 B;  4ANW A;  5T8I A;  4MGZ E;  5EE3 A;  3Q3N C;  4GOC A;  4YTN B;  1I4H A;  2OJR A;  1L6V A;  4KGS A;  1YQ4 B;  2N9X A;  1TKE A;  2WXP A;  3FIL A;  3V62 A;  3Q8E A;  2VZK B;  4G0N B;  4K7W A;  4YSY B;  2BS3 B;  3N3K B;  1IPG A;  2KLG A;  3CST A;  2W82 A;  4KSK C;  1XCT L;  1XLQ A;  2RDB C;  4JLC A;  4H2A A;  4FA6 A;  3V61 A;  1YN3 A;  1ZXI A;  1MG8 A;  1HEZ E;  3N32 A;  4II2 B;  2KDE B;  3ZNH B;  2LGS A;  2MWS B;  4J6I A;  4GSW A;  1F1H A;  2G4D B;  4ARC A;  2O2V B;  2JZP A;  3ALB A;  4KDL B;  2GRI A;  1WYG A;  3P1M A;  5EDS A;  2K0P A;  3U8Z A;  3GE3 C;  3ETR A;  2WX1 A;  3DBL I;  4OW0 A;  1X1M A;  1YD8 U;  1PDX A;  1V80 A;  5BYQ A;  4XX5 A;  2MBO A;  1CMX B;  4WUR A;  2JPH A;  3UQB A;  2NR2 A;  4W9F A;  2DEN B;  1KOT A;  1YQB A;  2LD9 A;  3PHX B;  1SEB D;  4RM8 A;  3D32 A;  4KGR A;  1FFU A;  2DAJ A;  2W3R A;  4ZHO A;  3DBL B;  5MPO A;  4IM2 A;  5CHF A;  1PGX A;  2G4S A;  2NVU I;  3AE4 B;  2X38 A;  5CX3 A;  4BOS C;  1T5X D;  4USA A;  2LHE A;  5KHQ A;  1F77 A;  1JRU A;  3DBR B;  2KKC A;  4K7U A;  1GAQ B;  3TEW A;  3VAW A;  2KT7 A;  3A1Q B;  4IM3 A;  5HI1 A;  1TS5 A;  1GC6 A;  3RUL A;  2C5L C;  3HRD D;  1JWM D;  1NYQ A;  4HEA 1;  3VRA B;  3VFK A;  1YOV B;  4GU2 A;  3UIP B;  2G3Q B;  5D94 A;  4W9G A;  2LFI A;  3A33 B;  1VR9 A;  4L1B A;  3B2F A;  1B1Z A;  4MM3 A;  2MA9 B;  3Q3F A;  3AXC A;  4YXD B;  1V86 A;  2EKI A;  2KWD A;  3AE1 B;  1FRD A;  4ACF A;  3BYY B;  3HIZ A;  2SEB D;  2KMC A;  3U30 A;  3NZS A;  2SAK A;  4RM9 A;  5AUI A;  4OVU A;  2ZVN A;  2MCN B;  1LM8 B;  5AZF A;  3EUB 2;  3KWV A;  3MC0 B;  2J4X A;  1YN5 A;  1AYF A;  2K8H A;  5I4D A;  2KWU B;  1PYW D;  4NQL B;  4RFB A;  4ZRQ A;  2L7R A;  3DCG A;  1D4B A;  3EEC A;  4WAA A;  4ITK A;  4YTP B;  2DBY A;  2JVC A;  1K8R B;  3TMP B;  4DXG A;  4YL8 A;  2E3T A;  1VJK A;  1SIF A;  1SE2 A;  1ZDV A;  1N5X A;  2KWV B;  3ZNI D;  4LNF A;  1RWS A;  4XDC A;  3PLV A;  1NYR A;  3T3N A;  1WRD B;  3ZXR A;  1ET6 A;  1R4N I;  2AX5 A;  2M19 A;  2IJ0 A;  3NOB A;  2Z0E B;  2KTF A;  1UH6 A;  4BOZ B;  2ON8 A;  1SE9 A;  1PUT A;  4HK2 A;  5BMG A;  4CO7 A;  1MHH E;  2WU5 B;  5HFY A;  3ECI A;  2ONQ A;  5D7G A;  4LNI A;  3GZN I;  1XLO A;  1IUE A;  3C19 A;  4AP4 C;  1FCL A;  3PZ8 A;  1D6E C;  1UF0 A;  2QC8 A;  3L4P A;  1N62 A;  4XYC A;  3ZRF A;  3AMZ A;  2LVQ A;  3VUY A;  1IGC A;  3KH0 A;  2C7H A;  1NI2 A;  5E6J A;  3N1Y C;  2NTS A;  4ZOH C;  1XXG A;  4M00 A;  2IO3 B;  1JRO A;  3PS6 A;  2AQ1 B;  1YX6 B;  4US8 A;  3MHZ A;  3PPA A;  2N1V A;  3BII D;  2O2V A;  4KSL C;  3RPF C;  4A20 A;  2BYF A;  4XE0 A;  2WXF A;  4PS7 A;  3SFE B;  1S1Q B;  3B08 A;  3ZDM C;  3NVY A;  4C80 A;  4YT0 B;  1SBB B;  4ANV A;  1NEK B;  3M95 A;  1OGW A;  2L3Z A;  4Q2J A;  2KDF B;  4L2Y A;  2KDB A;  4XZ4 A;  1FNV A;  1ZXH A;  2D11 A;  5CHV C;  2REX A;  2ZCC A;  2JQR B;  3VH4 B;  3ZVV A;  4KX6 B;  4RGM A;  4CYE A;  2ZEQ A;  3UIN B;  3IXS A;  2A5U A;  3C8Y A;  4LCD E;  1QKZ A;  2LAS A;  4W9E A;  4REZ A;  4XWW A;  2L83 A;  2XK5 B;  2KK8 A;  3ZJV A;  4JGH B;  5H92 C;  3DWG C;  2M56 B;  1SE3 A;  2R2Q A;  2KAJ A;  1VZ8 A;  1KTK A;  4W9K A;  4K81 A;  2PVG C;  3HUI A;  2R61 A;  1FPY A;  2KFK A;  2ZW1 A;  1E6E B;  1Z5S B;  3L16 A;  3PHW B;  4BBN F;  1LGR A;  3TBL D;  3X0W A;  3MHS D;  4B6W A;  3QAQ A;  1OQQ A;  1EF1 A;  4RGO S;  2W9N A;  2PE9 A;  1UWM A;  2DX5 B;  4EZJ A;  2KJ6 A;  3NJT A;  4FXC A;  4URK A;  3AI5 A;  2ICI A;  1WR6 E;  3ZNG C;  2HTM E;  2BS2 B;  5LXH A;  4LNN A;  3TCA A;  4KDI C;  2M17 A;  4KIK B;  3R7R A;  4RH6 A;  4NJ6 A;  3BZD B;  1WYW B;  1ZOY B;  3VDZ A;  2LGY A;  1ACC A;  3VHT C;  1H4R A;  4HCP B;  1TT5 B;  3TL5 A;  5DPT A;  3NY5 A;  2KC2 A;  4J3O D;  1GG3 A;  1TKY A;  2XN9 C;  1AW7 A;  3FC4 A;  4DXA B;  1AAR A;  1R4M B;  2LXA A;  1FEH A;  2BB5 A;  2RDG A;  2PIA A;  3DBH I;  1LXD A;  1J7B A;  2K22 A;  3ABV B;  1B9R A;  3VXW A;  3J9C A;  3RD2 A;  3R2I A;  1YX5 B;  2N7D A;  2DZK A;  2L05 A;  3ZTC A;  3PRP B;  4XDD A;  3JYU A;  3DBH B;  1FO4 A;  4N58 A;  1T6B X;  4B95 A;  2DZM A;  4DBG A;  4FJY A;  1E8Y A;  2Z0D B;  2ZCB A;  4EKU A;  2VH2 A;  4TQ0 A;  3MJ5 A;  1DOX A;  3BK1 A;  4WQO B;  5IA7 A;  1V97 A;  5JXV A;  5BMH A;  1YIW A;  2EEL A;  4DK5 A;  2GB1 A;  1GOZ A;  1E8X A;  2JWZ A;  2RSU A;  3AEF B;  4E71 A;  4WIP A;  2LMC A;  4R3D A;  1C79 A;  1E8Z A;  1K52 A;  3RI7 C;  4C4V B;  3CF6 E;  2LJ5 A;  3W1S A;  1RLF A;  1SF0 A;  2OJW A;  2BKF A;  3H8H A;  1CK1 A;  3U4E G;  2NS5 A;  3UGB B;  1QOA A;  3DHI C;  1XCQ L;  3APC A;  2ZNV C;  3DWM A;  2LJI A;  1KRH A;  3DOW A;  4BKT A;  3ZLZ A;  1S3S G;  3M62 B;  3QX1 A;  4FUL A;  4IWP A;  2BWF A;  3OJ3 A;  3Q3O C;  4G11 A;  4DHZ E;  2WDR B;  2PKO A;  3AV8 A;  2WXL A;  4M02 A;  5D2M B;  1DGJ A;  2C60 A;  3RUI B;  1IGD A;  4PYZ A;  3P4R B;  3KW5 B;  2WLB A;  1WFY A;  4HVB A;  2HDE A;  3QA8 A;  4EZK A;  2LGI A;  5BMI A;  2LUE A;  1HTQ A;  4TQ1 A;  2MQJ A;  2V1Y A;  2HD5 B;  2WXJ A;  2LZ6 A;  1V9J A;  3AED B;  2BT6 A;  1XLN A;  2BF8 B;  4A3P A;  1Z2M A;  1UBQ A;  1EWC A;  2FNJ B;  3PZ7 A;  3MC9 A;  4TMA B;  1XEE A;  4HDQ A;  2XK5 A;  3A9J B;  1I4G A;  4YWG G;  3DHH C;  1N63 A;  1CJE A;  1P7E A;  4OVV A;  1TZ1 A;  3BK2 A;  3T3O A;  4C56 C;  2WQY B;  3EFC A;  1PGB A;  3CSF A;  1EU3 A;  3JSV B;  2LWP A;  2MJD A;  3HVZ A;  1V5T A;  1Q10 A;  3Q3J A;  2IGD A;  4XC2 A;  1MHX A;  4IW0 A;  3KUD B;  2PJH A;  2V3P A;  4TKN A;  2AWT A;  3TJP A;  2LEK A;  2C7N B;  4LLG M;  2AYO B;  1SJH D;  2WGS A;  1YJ1 A;  3IFW B;  4OZC A;  2LUM A;  1RYJ A;  2KAN A;  3CIR B;  1L7Y A;  1QLB B;  3EC8 A;  4ZHP A;  3JVZ X;  1RM6 C;  4PYU A;  2KX0 A;  1WZ0 A;  1F52 A;  4KIK A;  4AWJ A;  2UYZ B;  4K7S A;  2DWQ A;  4ARI A;  2QHO A;  1AN8 A;  2ACZ B;  4A8X C;  2IY1 B;  1T3Q A;  1L2N A;  2NPT B;  3H7S A;  3E9S A;  1J19 A;  1JCK B;  3NS8 A;  4ANX A;  3PRE A;  3EGR A;  4LK0 M;  4RNA A;  3WCQ A;  2Y5B B;  1TKG A;  2K1F A;  5E6O A;  2JYT A;  2GBN A;  5IKC M;  4I6L B;  1KM7 A;  3PGE A;  3RNF C;  2B3A A;  1ZP0 B;  2IYD B;  4UDU C;  5IAA C;  4HRO A;  2LVP A;  4NAW B;  2WWZ A;  4ZRJ A;  2XEW A;  4A55 A;  2BVC A;  3W5V B;  3V6C B;  2MP2 B;  1FXT B;  3URY A;  3L08 A;  4S17 A;  2QJL A;  2WX0 A;  2IZV B;  3AEB B;  5G2N A;  1WMH A;  2FIF A;  4JPS A;  2L52 A;  1ISN A;  1C9F A;  1A70 A;  3V3X A;  4DDI D;  3RNC C;  3DBR I;  2BYE A;  2MEK A;  3Q8B A;  4D2K A;  2KMM A;  2WXQ A;  2I2Y A;  2D3A A;  4IM0 A;  1G6J A;  1MJD A;  1WY8 A;  5G55 A;  1I35 A;  4TUU A;  3OLM D;  3BVM A;  1TIF A;  2L0F A;  2KWC A;  2JSV X;  3LJ3 A;  4W9I A;  3U7Z A;  2AQ2 B;  2YEP B;  1Q5W B;  4X57 B;  1KLU D;  2XNA C;  5G5G A;  4AJW A;  1WF9 A;  1YJJ A;  2RD0 A;  2X8X X;  1VRA B;  2H89 B;  4F1S A;  2CU3 A;  2D2Q A;  4WJN A;  4NNJ B;  3H7P A;  1LFD A;  2ZJD A;  3OJ4 B;  3U2S C;  2V0G A;  4BKS D;  3CWI A;  2BS4 B;  5LNK 1;  1E7U A;  3R3M A;  2GBM A;  4GGQ A;  4II3 B;  5AUK A;  4PK1 A;  1TGZ B;  2WHI A;  3W9C B;  1WGK A;  4LJP B;  2LRU A;  3QHT A;  1VCB A;  4OZB A;  1BXT A;  1N5W A;  3DQV A;  4M8N A;  2PLP A;  1ZKH A;  2FCQ A;  4P1B C;  2DYB A;  2VH1 A;  4NQK E;  3VR9 B;  1OQY A;  3VH3 B;  2KHW B;  2QEJ C;  1MG4 A;  4GLS C;  2ZNV B;  2HTH A;  2L8J A;  3KUZ A;  1UNS A;  4MH8 A;  4M0W A;  4GDL A;  1SIJ A;  2CHX A;  2JT4 B;  2INP E;  2WDT B;  2NBV B;  1C4P A;  3ML9 A;  3HVD A;  1EM7 A;  2GMI C;  3KQ4 A;  4HLE A;  2YEP F;  2KQ4 X;  2GOW A;  1WJ6 A;  1YMH E;  3A9J A;  4IC7 B;  2PW9 A;  3WAO A;  4ANU A;  5BO4 B;  1UGM A;  3KLS X;  1H8C A;  3L54 A;  4IG7 B;  4MEM A;  1I4X A;  2CR5 A;  1QOF A;  1WGG A;  5IP4 D;  3BIN A;  1V1P B;  1AWD A;  4N59 A;  1QOB A;  4IUM B;  3HM3 A;  2L76 A;  1C78 A;  2ASQ A;  1I4Q A;  1XO3 A;  1F0Z A;  4AUQ C;  4NPN A;  1E8W A;  3TEX A;  1OEY A;  4WQM A;  5AZH A;  3IBE A;  3RNE C;  3KWL A;  3VTW A;  4RF1 A;  2N9L A;  4MJS B;  2KOX A;  1XD3 B;  4HPP A;  3IAM 1;  1PGA A;  4HXD A;  1NBF C;  1JWU D;  2O6V D;  3APD A;  4ZRP A;  1TS3 A;  2JX5 A;  4TSS A;  4CQN A;  4HDO A;  1VDV A;  3HK0 A;  3TEZ A;  1WZ3 A;  1A5R A;  2MBH A;  1WWT A;  2NPT A;  1JW9 D;  2JY6 A;  4PT5 A;  2B76 B;  4RMA A;  1TJE A;  1L0Y B;  3V60 A;  5GXG B;  2WXH A;  2KN4 A;  3KUC B;  2CHW A;  4P7I A;  1E10 A;  1WJU A;  3HHM A;  2JWU A;  3DVN U;  5HHD G;  1JWA D;  4B9K A;  3HM6 X;  2MP2 A;  2KQ7 A;  1UBI A;  1DOI A;  4FAD A;  5DPR A;  4ASW C;  3AE2 B;  2K3U A;  1QT9 A;  1FFV A;  2KDM A;  2K6D B;  3V05 A;  3ZQ4 A;  2J0K A;  4GXB A;  1WM3 A;  2UWQ A;  3EHV A;  4MH0 E;  3U52 E;  2QCZ A;  1UEL A;  1PFD A;  2Z59 B;  1WX7 A;  2D3C A;  3RMK C;  5E6N A;  3VQI A;  2DNF A;  1P1A A;  2W54 A;  2K25 A;  3NVZ A;  4DHZ B;  2WP9 B;  1HXY D;  4WJO A;  4G3X B;  2DYO A;  2NBW B;  2WXG A;  4MSQ B;  5J2R A;  3APF A;  1I7H A;  3WAM A;  4BAX A;  3M63 B;  3B1L X;  2KZR A;  1D5M C;  2MBQ A;  4RF0 A;  3OAW A;  3A1Q A;  4GDK B;  1MI0 A;  2K8C A;  2KX3 A;  2AEH A;  1FRR A;  1ET9 A;  2Y5C A;  4FN2 A;  4AOF A;  1Y8R C;  1RRB A;  2ZPY A;  2N9K A;  3R66 C;  1F2R C;  1FIQ A;  1QQR A;  1JWS D;  3NRZ A;  5DPS A;  3X23 A;  1I4R A;  1V5O A;  1T0Q C;  4PS8 A;  3AU5 A;  4JIO U;  1ZUD 2;  3QIJ A;  5FR3 A;  2WNM A;  5FR6 A;  3RNA C;  1UD7 A;  3MFG A;  3GP7 A;  2DZI A;  4B0M A;  4C7Z A;  3H6N A;  2HE7 A;  1P3Q U;  3EFU A;  3I9V 1;  5BYS A;  1OTR B;  1EUV B;  1IBX B;  2L1A A;  3WAP A;  3VTU A;  4KZC A;  3V6E B;  4BVU C;  3QCA A;  1M94 A;  2IGH A;  1R4M I;  3A4S C;  3H1U A;  1ZPS A;  4WWP A;  3AE3 B;  3MJW A;  5HKH A;  4OZA A;  2IO2 B;  3IT6 B;  4K1R B;  1V1O A;  3LYY A;  3KVF B;  1QF6 A;  1U4A A;  2NMQ A;  4AS1 A;  1HZ6 A;  2CU1 A;  4WJP A;  3AE5 B;  4KV2 A;  2WDQ B;  2J0J A;  2D10 A;  1XT9 B;  3OG5 A;  2CS4 A;  2ZZP B;  3SDL C;  1E7P B;  2W3S A;  3AH7 A;  1E5W A;  2Y3A A;  3NHE B;  3AEG B;  1OFF A;  4W9C A;  3Q69 A;  2LGX A;  2VRR B;  3Q3M C;  2MBB B;  1XQQ A;  1YNT E;  3R8B A;  3I3T B;  2JYE A;  1WIA A;  2PMV A;  1V1P A;  3QK0 A;  2LHD A;  3RT3 B;  5D6J B;  5H8Y E;  2JUO A;  1C3T A;  4LDT D;  2FUG 1;  4A9A A;  4YTM B;  1E90 A;  5EE9 A;  3NZ3 A;  4W9D A;  2M0A A;  3S2A A;  2K6Q A;  2PPH A;  5C1Z A;  2N9P C;  1IP9 A;  4HWI B;  5FKA C;  4MGK E;  4MJS A;  4KVG B;  2N4F A;  4NJ7 A;  4DHJ D;  3K9O B;  2IO0 B;  4GN1 A;  2NBU A;  2IGG A;  2BKR B;  1V8C A;  5FK9 C;  4KGT A;  2J0M A;  1VZ6 A;  1UUP A;  4E74 A;  2WXO A;  1J0G A;  2R2O A;  2DAF A;  3QJZ A;  4A6Q A;  2PE6 B;  2WU2 B;  5D3D A;  2TSS A;  4E3C A;  1WRI A;  3SFD B;  3UF8 A;  2EMS A;  3H9D A;  1WGD A;  4MGI E;  1F9J A;  3AE7 B;  4NAM A;  3NUH B;  4KZ0 A;  2GLS A;  1WXA A;  4M01 A;  3FKY A;  4P6V F;  2I1J A;  3VTV A;  1DYQ A;  4M8M A;  2K9X A;  1JRP A;  3ZXV A;  4IWQ A;  2UU7 A;  2QSD A;  2FCM A;  5L83 A;  2KTR B;  3QWZ B;  3L13 A;  1SGH A;  2MJ3 A;  4EE2 A;  4ICU A;  5DPW A;  3DVN V;  5J17 A;  3PVL A;  3ZUN A;  2MJE A;  3QAR A;  5HG2 A;  1TBE A;  3U7D A;  3WAL A;  2BWE S;  4W9J A;  2FCS A;  1L4Z B;  1TS4 A;  2FAZ A;  2AL3 A;  2M4N A;  4WWM A;  5TSS A;  2V3N A;  5GMV A;  3PLU A;  1PQS A;  1TY2 A;  2D3B A;  3ZYY X;  1OQR A;  4F7Z A;  1C4A A;  2BW2 A;  5JHA A;  4FHJ A;  3P4S B;  3MTN B;  4HPM B;  3L0W B;  1JML A;  3ZRC A;  2WXK A;  3GOE A;  4DXF A;  1KH0 A;  4LNK A;  5J18 A;  2D07 B;  4I6P A;  1E9M A;  3UI3 A;  2EKE C;  2Z8L A;  2KVR A;  1WXS A;  4DWF A;  2FBW B;  4OHJ A;  3IT4 B;  2JU6 X;  2GBK A;  2PEA A;  2PVO D;  2LI5 A;  2K5P A;  3ZKJ C;  5LXI B;  3NVW A;  4HJG E;  2MX2 A;  4MEL A;  1RAX A;  1LQB A;  1HTO A;  2LRW A;  2QMT A;  2NCN A;  3W1S C;  1SJE D;  2BYV E;  4L23 A;  2N7J A;  4BBN C;  2KN5 A;  1HZ5 A;  2LVO A;  2V9H A;  3AB5 A;  2J53 A;  2E6X A;  2V3S A;  3AEC B;  2IPK D;  2VZK D;  3VVW B;  3LXF A;  3PRM B;  3NS1 A;  3LB8 C;  1VLB A;  3N1Z C;  1UWX A;  2V4L A;  4P1C C;  3ONS A;  4RGN A;  1GC7 A;  3A9K B;  4HRS A;  1L0X B;  3AE9 B;  2MH7 A;  5G5H A;  4BFR A;  3WA0 A;  3SHQ A;  3VR8 B;  2QIL A;  2Y5P A;  1CQV A;  2KAC A;  4P16 A;  1ZDX A;  1JWB D;  2BPS A;  4WAF A;  3M3J A;  3RFZ B;  3NG0 A;  1EF5 A;  1T0S C;  5JZE B;  1TYG B;  5C3J B;  2KFJ A;  2LGD A;  2C7M B;  1L4D B;  3N30 A;  2MLB A;  3EA6 A;  4ZYN A;  4CHK A;  2N0S B;  1GNU A;  5AEK B;  2KDI A;  1P98 A;  2KVZ A;  4RCO A;  3VUX A;  3DPD A;  3RNG C;  3I5J C;  1ZE3 D;  4MGY E;  1SB3 C;  3PO0 A;  4C4V A;  1D5X C;  2IY0 B;  2KQS A;  1LO5 D;  2GBJ A;  2NTT A;  1KF6 B;  3ML8 A;  1T0Y A;  1ESF A;  2BGF A;  3IG3 A;  2OHF A;  2KYW A;  4FHK A;  3BY4 B;  1WE6 A;  1J7C A;  3OWE B;  2WXI A;  2KFK B;  1IYF A;  4NZL B;  3CMM B;  3AE6 B;  1E0Z A;  1C77 A;  2KTR A;  2W55 A;  2DLB A;  4IDI A;  4JE3 B;  1NVI D;  2QDF A;  1EU4 A;  1HA5 A;  5AZG A;  2YVC A;  4JQW C;  2CJN A;  5JH5 C;  2INN E;  1C76 A;  1YN4 A;  3AN1 A;  3ZW3 A;  3O65 B;  2J7Q B;  3NVV A;  4S0R A;  1WM2 A;  1XF5 L;  2DZJ A;  2H88 B;  2I1K A;  2KO3 A;  4FJZ A;  2RR9 A;  1WXM A;  4I6N B;  4MSM B;  1NEN B;  3ZJT A;  2DHZ A;  3MP9 A;  1GPX A;  1UGJ A;  3R2T A;  2FCN A;  4HCN B;  3JSV A;  1GUA B;  4BKG A;  3C0R B;  1MPE A;  3PT2 B;  4JL9 A;  1GB1 A;  5E6P A;  5LLI A;  2JZ3 B;  1RFA A;  2MSE D;  3VUW A;  4O1N A;  3AUL A;  3BVG A;  3BWU D;  2ZW0 A;  2JZZ A;  3Q8C A;  2OOB B;  3RN9 C;  1BUI C;  1QOG A;  4GMV A;  4EZL A;  1FMA D;  4TV3 A;  4XGA B;  4WWO A;  3BVZ A;  4HKQ A;  4HPL B;  4G50 A;  1HE8 A;  1GB4 A;  4MDK E;  3ZTD A;  2O6V B;  2ZVO A;  3I63 C;  1ENF A;  1VD2 A;  2M1M A;  1FNU A;  2IO1 B;  4B0E A;  3KYC D;  1JQ4 A;  4GB9 A;  2G1E A;  2JXX A;  3RZW C;  2HJ8 A;  2RPV A;  2I38 A;  5EE1 A;  2RGF A;  2G9H D;  3UQA A;  1L6U A;  4ZDV A;  4WJQ A;  1R4N B;  2MRP A;  2BB6 A;  1GJZ A;  2KLC A;  2CKH B;  4NAW A;  2QIE B;  3Q2A C;  1WI0 A;  1OEY J;  2JXT A;  3N9Y C;  1K50 A;  1NDD A;  3AEE B;  2HJ1 A;  2K39 A;  1SSN A;  3Q8F A;  1RFK A;  2L0T A;  1C4C A;  3GZN B;  3A9K A;  1J7A A;  1P9D U;  1XLP A;  2IDY A;  2G45 B;  2WXM A;  4YSZ B;  1I4P A;  2AQ3 B;  4W9L A;  1FCC C;  4PS3 A;  2IND C;  2BTE A;  4WWN A;  1WE7 A;  4LJO B;  1M4V A;  2MW5 A;  2A4Z A;  1E7V A;  4MT5 A;  1WGR A;  3R7Q A;  3PZD A;  2JRI B;  3T9L A;  2J52 A;  1C1Y B;  3P2B A;  3MC8 A;  2RPQ A;  3P42 A;  1TTN A;  4KKJ A;  1L0V B;  1P7F A;  1UZX B;  3E56 A;  1KFY B;  1V81 A;  1K51 A;  2D5G A;  4RGT A;  4DDG D;  1MVK A;  3O13 A;  3IHP C;  3AE8 B;  4WH4 A;  2BYT A;  2WDV B;  3AEA B;  4A90 A;  4KKI A;  2FUH B;  3RNB C;  1VZ7 A;  3ZO5 B;  4BKS A;  1EO6 A;  3N1X C;  2KD0 A;  1FM0 D;  1FNW A;  2WYQ A;  1V49 A;  2LXC A;  3GB1 A;  4IOI E;  4ICV A;  2PTL A;  1V6E A;  2WXR A;  3Q6B A;  4JWS C;  1SXT A;  1QZE A;  2N7E A;  5L95 C;  1YQ3 B;  1WXQ A;  2KNB A;  3B9J A;  4A3O A;  2N9E B;  2BBC A;  4EEW A;  1N60 A;  1T0R C;  3TEY A;  2IBI B;  3NZU A;  2KJR A;  3RYT A;  3GS2 A;  1CZP A;  4BZA A;  4FJV B;  4EFO A;  1ROE A;  3N20 C;  1WH3 A;  2CHZ A;  1TY0 A;  4N9F 4;  1NI3 A;  1WSP A;  3FIL B;  3LDZ E;  4EUT A;  5D3I B;  1EWY C;  3TSS A;  3IAS 1;  2EMT A;  2L32 A;  5C23 A;  3BYT B;  2RMM A;  2ZPN A;  3P63 A;  4GIV A;  3GE8 C;  4US9 A;  4ZRK A;  1V2Y A;  3TUO A;  4HKZ E;  3PRZ A;  2KMA A;  3TIX A;  1WGH A;  1MFW A;  3KYD D;  4C00 A;  3K9P B;  5KHO A;  4LDT B;  3W5U B;  3Q8A A;  4W9H A;  1JAL A;  3ZIM A;  2FE8 A;  3DVG X;  1WMH B;  1I42 A;  4AQ7 A;  5IOI A;  1Q0W B;  1HQR D;  2INC C;  5IO9 A;  5EE0 A;  2JRH A;  3JW0 X;  3PV1 A;  4DHJ B;  4ZYS A;  1WR1 A;  4XWT A;  2O6V A;  4IWO A;  1YJI A;  2KC1 A;  3DHG C;  1D3Z A;  2CJO A;  3DBS A;  5C2T B;  4IKG A;  1Q1O A;  3UIO B;  3RZF A;  2WXN A;  2GI9 A;  3L17 A;  4FBJ B;  4NY0 A;  4C7Y A;  1SE4 A;  3AM9 A;  2GBR A;  2J42 A;  2N1W A;  5TR5 A;  3L10 B;  3W1Y A;  2V4I B;  2DYM A;  4MAC A;  1WJ4 A;  3WAN A;  1WGY A;  1J8C A;  2RDH A;  3B2G A;  3QC8 B;  2AL6 A;  3QQ8 B;  2D3G A;  1KLG D;  3ZNZ B;  4DQO C;  4K3B A;  3H7P B;  1ZW7 A;  3DDC B;  3ZDT A;  3SD5 A;  4MM3 B;  1STE A;  3A4R A;  4OVZ A;  4JWU C;  1R7S A;  1TS2 A;  1K53 A;  4N6E B;  3ZJU A;  4YSX B;  2OED A;  1WJN A;  2BQQ A;  3ENE A;  1KLV A;  2WS3 B;  2Q5W D;  1FXA A;  2XBB C;  3AU4 A;  1N61 A;  2KXJ A;  3VRB B;  3PTF C;  3Q14 C;  3T8M A;  1ZGU B;  5BYR A;  5DCN A;  2MHJ A;  3P4Q B;  3IVF A;  1P0R A;  3W2D A;  1DOY A;  1FXI A;  4NJC A;  2M0X A;  4JX1 C;  1TZO A;  3DVG Y;  2K8B A;  4LTU A;  1WXV A;  4AJY B;  4QAY A;  4M0W B;  4GDL B;  5CTR C;  3SU8 X;  4GDK A;  3B0A A;  2FID A;  5JHB A;  1QIL A;  3SEB A;  1KJT A;  2YLM A;  1FD6 A;  1F2R I;  1N6Z A;  2M8S A;  1WX9 A;  2JF5 A;  4F8C B;  1L5P A;  1D5Z C;  4EOY A;  4LNO A;  4FLH A;  5IN7 A;  3FAH A;  3P4P B;  3SR6 A;  3WIM A;  1WX8 A;  2C9W B;  2KJH B;  4K3C A;  3I57 A;  1Y56 A;  5CHW A;  3PSE B;  1IBX A;  1BML C;  2MBE A;  4HJK A;  3RCZ A; 
#chains in the Genus database with same CATH homology
 2KDM A;  1C77 A;  3V05 A;  3ZGZ A;  2W55 A;  4XDD A;  3ZQ4 A;  2DLB A;  4IDI A;  1FO4 A;  4JE3 B;  3U52 E;  1NVI D;  4N58 A;  5T8I A;  1PFD A;  1T6B X;  3VQI A;  1EU4 A;  1HA5 A;  5EE3 A;  4YTN B;  2W54 A;  1I4H A;  2CJN A;  4TQ0 A;  2INN E;  3NVZ A;  3MJ5 A;  1L6V A;  1DOX A;  3BK1 A;  4KGS A;  2WP9 B;  1YQ4 B;  1C76 A;  1YN4 A;  1HXY D;  3AN1 A;  2DYO A;  1TKE A;  2WXP A;  2WXG A;  3FIL A;  3Q8E A;  2VZK B;  1I7H A;  4YSY B;  2BS3 B;  1V97 A;  3NVV A;  5JXV A;  2W82 A;  5BMH A;  1XCT L;  1XLQ A;  2EEL A;  1XF5 L;  1D5M C;  2H88 B;  2GB1 A;  4H2A A;  4RF0 A;  1GOZ A;  1YN3 A;  3AEF B;  1ZXI A;  4WIP A;  2LMC A;  4R3D A;  1NEN B;  1HEZ E;  1MI0 A;  1C79 A;  4GDK B;  3ZJT A;  1FRR A;  1K52 A;  1ET9 A;  3MP9 A;  2Y5C A;  1GPX A;  1UGJ A;  3R2T A;  4ARC A;  2N9K A;  3W1S A;  1F2R C;  1FIQ A;  1QQR A;  1JWS D;  2JZP A;  3NRZ A;  1I4R A;  1SF0 A;  1MPE A;  2GRI A;  1GB1 A;  1WYG A;  3H8H A;  1ZUD 2;  1CK1 A;  3P1M A;  5FR3 A;  4O1N A;  2WNM A;  3U4E G;  3BVG A;  2K0P A;  1QOA A;  2ZW0 A;  3BWU D;  1XCQ L;  3ETR A;  3MFG A;  4OW0 A;  3GP7 A;  3Q8C A;  3DWM A;  2LJI A;  1KRH A;  4B0M A;  4C7Z A;  1BUI C;  1QOG A;  1PDX A;  5BYQ A;  3I9V 1;  5BYS A;  1FMA D;  4WUR A;  1IBX B;  3BVZ A;  2L1A A;  4HKQ A;  1GB4 A;  2WDR B;  2PKO A;  3AV8 A;  2WXL A;  2IGH A;  1DGJ A;  1SEB D;  1ENF A;  4KGR A;  1FFU A;  1FNU A;  2W3R A;  1ZPS A;  1IGD A;  3AE3 B;  3P4R B;  4ZHO A;  2WLB A;  5MPO A;  4OZA A;  1PGX A;  2HDE A;  3IT6 B;  4B0E A;  1V1O A;  3LYY A;  2LGI A;  5BMI A;  3AE4 B;  1JQ4 A;  1QF6 A;  2G1E A;  2NMQ A;  4TQ1 A;  2X38 A;  4AS1 A;  1HZ6 A;  5EE1 A;  2RPV A;  2I38 A;  1T5X D;  4USA A;  2LHE A;  2WXJ A;  2G9H D;  1F77 A;  3AED B;  2BT6 A;  1XLN A;  3AE5 B;  2WDQ B;  1L6U A;  1EWC A;  3PZ7 A;  1GAQ B;  3TEW A;  4TMA B;  1XEE A;  5HI1 A;  1E7P B;  1TS5 A;  2BB6 A;  2W3S A;  1I4G A;  4YWG G;  2QIE B;  3HRD D;  1N63 A;  1CJE A;  1P7E A;  3AH7 A;  1JWM D;  2JXT A;  3N9Y C;  2Y3A A;  3BK2 A;  3T3O A;  3AEG B;  1K50 A;  1OFF A;  1NYQ A;  4C56 C;  2WQY B;  3Q69 A;  1PGB A;  3AEE B;  4HEA 1;  1EU3 A;  3VRA B;  1YNT E;  3R8B A;  1SSN A;  2MJD A;  3HVZ A;  3Q8F A;  1RFK A;  1C4C A;  2JYE A;  2LFI A;  1J7A A;  1Q10 A;  1VR9 A;  4L1B A;  2IGD A;  3B2F A;  1B1Z A;  2PMV A;  1V1P A;  1XLP A;  4YXD B;  1MHX A;  2LHD A;  2IDY A;  2EKI A;  2KWD A;  3AE1 B;  5H8Y E;  1FRD A;  2WXM A;  4YSZ B;  3BYY B;  2V3P A;  2LEK A;  1I4P A;  2SEB D;  2AQ3 B;  2FUG 1;  1FCC C;  4LLG M;  4A9A A;  4YTM B;  2SAK A;  1SJH D;  5EE9 A;  4OZC A;  3NZ3 A;  2BTE A;  2LUM A;  2M0A A;  5AUI A;  1RYJ A;  3CIR B;  1QLB B;  3EUB 2;  4ZHP A;  1M4V A;  5FKA C;  1RM6 C;  3KWV A;  3MC0 B;  2J4X A;  4MT5 A;  1YN5 A;  1AYF A;  5I4D A;  2J52 A;  2DWQ A;  4ARI A;  1AN8 A;  2IGG A;  1PYW D;  3P42 A;  2ACZ B;  4RFB A;  1V8C A;  4A8X C;  1T3Q A;  4ZRQ A;  5FK9 C;  4KGT A;  4KKJ A;  1VZ6 A;  1UUP A;  1D4B A;  3E9S A;  1L0V B;  1P7F A;  3E56 A;  1JCK B;  4LK0 M;  3EGR A;  1KFY B;  4RNA A;  2D5G A;  1K51 A;  2WXO A;  4ITK A;  4RGT A;  1TKG A;  4YTP B;  2JYT A;  2DBY A;  1MVK A;  3O13 A;  4DXG A;  4A6Q A;  3AE8 B;  4WH4 A;  2WU2 B;  2E3T A;  2BYT A;  5D3D A;  2TSS A;  2WDV B;  3AEA B;  4KKI A;  1WRI A;  1ZP0 B;  4A90 A;  4UDU C;  3SFD B;  1VZ7 A;  1VJK A;  4HRO A;  4NAW B;  1FM0 D;  1SE2 A;  1FNW A;  1ZDV A;  4A55 A;  3W5V B;  3GB1 A;  1N5X A;  3AE7 B;  4NAM A;  3NUH B;  4IOI E;  3URY A;  2PTL A;  2QJL A;  2WXR A;  4P6V F;  4JWS C;  1RWS A;  3AEB B;  1SXT A;  1DYQ A;  4JPS A;  4XDC A;  2K9X A;  2L52 A;  1JRP A;  1NYR A;  3T3N A;  1C9F A;  1A70 A;  3V3X A;  1YQ3 B;  1WXQ A;  2QSD A;  1ET6 A;  3B9J A;  2MEK A;  3Q8B A;  4D2K A;  2KMM A;  2AX5 A;  2M19 A;  2IJ0 A;  2WXQ A;  2I2Y A;  2MJ3 A;  2BBC A;  4EE2 A;  1N60 A;  3TEY A;  2ON8 A;  1PUT A;  3GS2 A;  1CZP A;  5BMG A;  1MHH E;  1ROE A;  2WU5 B;  3BVM A;  2MJE A;  5HG2 A;  5HFY A;  1TY0 A;  2ONQ A;  5D7G A;  2JSV X;  1NI3 A;  1WSP A;  3FIL B;  5D3I B;  1XLO A;  1EWY C;  1L4Z B;  1TS4 A;  1IUE A;  3TSS A;  3IAS 1;  4WWM A;  5TSS A;  1FCL A;  2V3N A;  3PZ8 A;  2L32 A;  1D6E C;  3BYT B;  3L4P A;  1N62 A;  2RMM A;  2AQ2 B;  2YEP B;  3P63 A;  3U7Z A;  3AMZ A;  1IGC A;  1KLU D;  2XNA C;  5G5G A;  4US9 A;  1TY2 A;  3ZYY X;  1YJJ A;  1OQR A;  3TUO A;  5E6J A;  1C4A A;  4HKZ E;  2NTS A;  4ZOH C;  1XXG A;  1VRA B;  2BW2 A;  2H89 B;  3P4S B;  1JRO A;  2CU3 A;  2AQ1 B;  1JML A;  2WXK A;  4US8 A;  3MHZ A;  4DXF A;  1KH0 A;  3BII D;  3RPF C;  1E9M A;  4XE0 A;  2WXF A;  3Q8A A;  3U2S C;  3W5U B;  3UI3 A;  2V0G A;  3SFE B;  2Z8L A;  3CWI A;  1JAL A;  2BS4 B;  5LNK 1;  3NVY A;  2FE8 A;  4C80 A;  2FBW B;  4YT0 B;  4OHJ A;  1SBB B;  1NEK B;  5AUK A;  3IT4 B;  2JU6 X;  4AQ7 A;  4Q2J A;  3W9C B;  4L2Y A;  1HQR D;  1WGK A;  2PVO D;  5EE0 A;  1FNV A;  2K5P A;  1ZXH A;  4OZB A;  1BXT A;  1N5W A;  2PLP A;  4ZYS A;  3NVW A;  4HJG E;  2JQR B;  4XWT A;  1YJI A;  4KX6 B;  4RGM A;  3VR9 B;  2CJO A;  2QMT A;  5C2T B;  2QEJ C;  4GLS C;  4IKG A;  1SJE D;  3IXS A;  3C8Y A;  1UNS A;  4MH8 A;  2WXN A;  4M0W A;  1QKZ A;  2GI9 A;  4L23 A;  2N7J A;  1SIJ A;  1HZ5 A;  4REZ A;  2INP E;  3AB5 A;  2J53 A;  4C7Y A;  2E6X A;  4XWW A;  1C4P A;  1SE4 A;  3AM9 A;  3WCQ A;  2L83 A;  2J42 A;  3HVD A;  1EM7 A;  3KQ4 A;  2YEP F;  3ZJV A;  3AEC B;  5H92 C;  2KQ4 X;  2V4I B;  2DYM A;  2IPK D;  4MAC A;  2VZK D;  3LXF A;  1YMH E;  3DWG C;  3NS1 A;  2M56 B;  3LB8 C;  2PW9 A;  1SE3 A;  1VLB A;  2RDH A;  3B2G A;  1UWX A;  2KAJ A;  3KLS X;  1VZ8 A;  1KTK A;  1KLG D;  2PVG C;  3HUI A;  4DQO C;  1I4X A;  1QOF A;  4RGN A;  4HRS A;  2R61 A;  4MM3 B;  1L0X B;  1STE A;  1V1P B;  3AE9 B;  2MH7 A;  1AWD A;  4JWU C;  2ZW1 A;  1E6E B;  1R7S A;  4N59 A;  1TS2 A;  4OVZ A;  1K53 A;  5G5H A;  1QOB A;  4N6E B;  3VR8 B;  1OQQ A;  4RGO S;  2QIL A;  2Y5P A;  1CQV A;  2KAC A;  1C78 A;  1E0Z A;  4P16 A;  1UWM A;  3ZJU A;  4YSX B;  2OED A;  1I4Q A;  1XO3 A;  1ZDX A;  1F0Z A;  1JWB D;  4WAF A;  4FXC A;  3TEX A;  2ICI A;  3RFZ B;  4WQM A;  2WS3 B;  2HTM E;  2Q5W D;  1FXA A;  2BS2 B;  3KWL A;  4RF1 A;  1N61 A;  2N9L A;  1TYG B;  3VRB B;  5C3J B;  4RH6 A;  5BYR A;  3BZD B;  3IAM 1;  1PGA A;  1ZOY B;  3P4Q B;  3W2D A;  1DOY A;  1FXI A;  1L4D B;  4NJC A;  4JX1 C;  1TZO A;  3EA6 A;  1JWU D;  4ZRP A;  2N0S B;  4LTU A;  1TS3 A;  2JX5 A;  4TSS A;  1ACC A;  4CQN A;  4RCO A;  1VDV A;  4GDL B;  3TEZ A;  1ZE3 D;  1WWT A;  1JW9 D;  4PT5 A;  1QIL A;  3SEB A;  1SB3 C;  4J3O D;  1TKY A;  2B76 B;  2XN9 C;  1AW7 A;  3FC4 A;  3PO0 A;  1TJE A;  1D5X C;  1L0Y B;  1LO5 D;  2NTT A;  1KF6 B;  5GXG B;  2WXH A;  1FD6 A;  1F2R I;  2KN4 A;  1FEH A;  2BB5 A;  2RDG A;  2PIA A;  1ESF A;  1E10 A;  1L5P A;  1D5Z C;  2JWU A;  5HHD G;  2OHF A;  1JWA D;  1J7B A;  3FAH A;  1J7C A;  2K22 A;  3OWE B;  3P4P B;  3SR6 A;  3ABV B;  1B9R A;  2WXI A;  1DOI A;  3I57 A;  3J9C A;  1Y56 A;  3R2I A;  3AE2 B;  4NZL B;  1IBX A;  2K3U A;  1BML C;  1QT9 A;  3AE6 B;  1FFV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...