1DOXA

1h and 15n sequential assignment, secondary structure and tertiary fold of [2fe-2s] ferredoxin from synechocystis sp. pcc 6803
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
96
structure length
96
Chain Sequence
b'ASYTVKLITPDGESSIECSDDTYILDAAEEAGLDLPYSCRAGACSTCAGKITAGSVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCTIETHKEEDLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN [2FE-2S]
publication title 1H and 15N NMR sequential assignment, secondary structure, and tertiary fold of [2Fe-2S] ferredoxin from Synechocystis sp. PCC 6803.
pubmed doi rcsb
molecule tags Electron transport
total genus 12
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 1995-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1doxA00
3WCQA 1XLPA 3NS1A 1YJJA 3AECB 2WQYB 4HROA 1EWYC 2W3RA 5EE3A 2W3SA 2W54A 1NENB 2WU5B 1B9RA 1VLBA 1SF0A 3ETRA 1L6VA 3HUIA 1AWDA 2E3TA 4WWMA 1PDXA 1YJIA 3AE2B 3AE6B 1N5WA 3B2FA 3ZYYX 1E9MA 2W55A 3NVWA 4ZHPA 4IDIA 2Q5WD 4HRSA 1L6UA 1UWMA 3HVZA 1NI3A 1N60A 1DOIA 5AUKA 3AEEB 1XLNA 2QJLA 1XLOA 1N5XA 2L83A 4LTUA 1QOGA 1FM0D 2M56B 5GXGB 1T3QA 1QLBB 1N61A 1J7BA 3AE5B 2EKIA 4C80A 2JX5A 3NVYA 1WXQA 4YSXB 3W9CB 3SR6A 2CJNA 2WDVB 1I7HA 3AE1B 3AM9A 5EE0A 5G5HA 4US8A 3AE3B 2PVGC 4YSZB 2G1EA 1FFVA 1CJEA 1RWSA 4YXDB 4JWUC 1E10A 1XO3A 1A70A 2MJ3A 2AX5A 1KRHA 1WWTA 1ZXIA 3CWIA 3LB8C 3P1MA 1F0ZA 1L5PA 2BS2B 1NYRA 1R7SA 3KWLA 1FRDA 2K9XA 2BT6A 1ZUD2 1VDVA 3ABVB 3AV8A 1FMAD 2HTME 1WYGA 4C7ZA 1E0ZA 2PIAA 3AE7B 3CIRB 1JROA 3EUB2 3NVZA 3RPFC 1TYGB 2DWQA 1L0VB 1TKGA 2OHFA 3AEFB 1OQRA 2MJDA 4WQMA 1JALA 1GAQB 3PO0A 4C7YA 1NVID 1NYQA 1PFDA 3W5UB 1SIJA 3HRDD 4FXCA 1NEKB 2PKOA 3P63A 2BS4B 1RM6C 1VJKA 3AEBB 5EE1A 1DOXA 2CU3A 2WLBA 1RYJA 4N59A 3VRBB 2K22A 3AN1A 3NVVA 1N63A 2KMMA 3W5VB 1QOFA 1TJEA 1XLQA 3SFEB 1WGKA 3FAHA 1E7PB 1GPXA 2KAJA 1OFFA 3AEDB 2H89B 2WP9B 1OQQA 4YT0B 1J7CA 2QIEB 2MJEA 1QT9A 2DBYA 2WU2B 1ZOYB 1J7AA 1V8CA 1FRRA 1SB3C 1TKEA 2H88B 2JQRB 2L52A 5EE9A 1KF6B 2MH7A 2WS3B 4P6VF 1E6EB 1FFUA 3FC4A 3VR8B 2Y5CA 4YTMB 5C2TB 4JWSC 1FIQA 1N62A 3AB5A 5G5GA 3P4QB 5C3JB 3DWGC 2PVOD 1JW9D 5H8YE 1DGJA 4YSYB 1WRIA 1JRPA 3LXFA 4KX6B 4ZOHC 1QOBA 3AH7A 1FO4A 1CZPA 1JQ4A 2FBWB 1AYFA 2M19A 2WDRB 4YTPB 2CJOA 3SFDB 1QF6A 5H92C 2LEKA 1RFKA 3P4RB 1KFYB 1YQ3B 2BS3B 3P4PB 4ITKA 3VRAB 2N0SB 4N6EB 3AE4B 1TKYA 3AE8B 1FXIA 3AE9B 2WDQB 3AEGB 1ZP0B 3L4PA 3BIID 2B76B 4JX1C 4US9A 4N58A 5AUIA 1YQ4B 3VR9B 1DOYA 1JWBD 2ACZB 3AEAB 3B2GA 3NRZA 3DWMA 5MPOA 1IUEA 1V97A 1QOAA 4YTNB 4A9AA 1JWAD 1ROEA 1PUTA 4ZHOA 2K5PA 4USAA 3P4SB 1FXAA 3B9JA 3AMZA
chains in the Genus database with same CATH superfamily
4RH6A 4XC2A 5KHQA 4IOIE 2W55A 3ZO5B 5IP4D 1TTNA 3AU4A 4JQWC 5DPWA 3OG5A 2LVQA 4G3XB 3B1LX 4JIOU 3RN9C 3O65B 2JUOA 4GGQA 2MJ3A 1UWXA 4G50A 1NYRA 2C9WB 4NY0A 4C7ZA 1MPEA 1ESFA 3Q8AA 1IYFA 1OQRA 4LDTB 5BMHA 4F7ZA 4DHJD 2QMTA 1YJ1A 4J6IA 1P0RA 3EA6A 4M0WB 3U30A 2ZW1A 4W9IA 4LJPB 5BYRA 4KKIA 1OQQA 1JRUA 2QIEB 1VR9A 5IN7A 3R2IA 1FIQA 2AEHA 4GOCA 2MLBA 2LVPA 4ARCA 3RZFA 4WWNA 4HK2A 3PS6A 4E74A 2NBWB 4YTPB 3AE8B 1FXIA 2Y5BB 3C19A 3FILB 3AEGB 4AQ7A 4LNKA 1I4RA 5HG2A 4WJOA 3NOBA 3PHWB 3M95A 4DDID 2CU1A 3P4SB 1E7VA 4XWTA 2QSDA 4EEWA 1JMLA 5EE3A 5LNK1 1NENB 2WU5B 3N1XC 4IUMB 2WXLA 3WIMA 2KDIA 3UIOB 4ZHPA 2D3BA 4ARIA 2BBCA 2WXQA 2L83A 4KIKB 1K8RB 2AQ1B 2IO3B 2L1AA 3ZXVA 3AM9A 3ZVVA 2D11A 1P9DU 1CJEA 2V4LA 1KRHA 3TSSA 3LB8C 2JRIB 4F1SA 3KWLA 3Q3MC 3DHIC 1UELA 3AV8A 3TEZA 2JZZA 3ML8A 4ZYSA 1TKGA 2GI9A 2N1WA 3EFUA 4KZCA 1FCCC 4AWJA 1V9JA 2LJ5A 2R2QA 4GMVA 3RNFC 2KK8A 4B0MA 1E8YA 2K8CA 2KFKA 2NBUA 2LI5A 3RT3B 2E6XA 2KJHB 1WE7A 4GXBA 1LM8B 3FAHA 1YX6B 3VUWA 2RDGA 1GPXA 2WXKA 4OVZA 3EFCA 1TGZB 4EOYA 1WMHA 3MJ5A 1E10A 4RM9A 3VR8B 2WS3B 5FR6A 3AB5A 4OHJA 5G5GA 4LJOB 3VUYA 5JXVA 3U8ZA 4A3PA 4MJSB 5AZGA 1JQ4A 2FBWB 1YX5B 5H92C 4AS1A 2W82A 2AQ2B 2N0SB 1XCQL 2Z0DB 5HHDG 3WAOA 2M17A 2DZMA 3Q14C 2R61A 4FA6A 3IT6B 1CMXB 4I6LB 4UDUC 1WGYA 4M00A 1EU4A 2M8SA 2IGHA 4GDKB 5DPSA 4MGZE 2D10A 1WI0A 2C60A 1YJJA 1WX7A 3DBLI 4HROA 3V05A 1WX8A 2C7NB 4FJYA 3ZYYX 3SU8X 4L1BA 1MHXA 5AUKA 2KVRA 3TL5A 3GS2A 2J0JA 2CJNA 4ZRKA 1I7HA 1Y56A 4OVVA 3AE3B 3QCAA 1FFVA 2WDTB 1XO3A 1FPYA 3P1MA 4EFOA 2CR5A 3PV1A 1EO6A 1BUIC 3GE3C 1C77A 1Q0WB 1PGBA 1HE8A 3A9KB 3M3JA 2IPKD 1TY2A 1M94A 1I4XA 1WSPA 4WQMA 2KDMA 4B0EA 1GB1A 5BYQA 4C7YA 3L0WB 1PFDA 4FXCA 1I4QA 3H7PB 2LRWA 3C0RB 4N59A 1RYJA 1N63A 4MH8A 2XNAC 1WJNA 3L16A 2KO3A 2KAJA 3AEDB 2ZW0A 2Z59B 1M4VA 2JZPA 2DBYA 2FNJB 4AJWA 1MVKA 2H88B 3ZIMA 3BK2A 4E3CA 2MH7A 3R8BA 2ZNVB 2QILA 4WJNA 2PVOD 1J19A 2MCNB 2A5UA 2NTSA 2O6VB 1N6ZA 1C1YB 2W9NA 4OW0A 2KKCA 1L4DB 2N9XA 3AE9B 1TBEA 4BKTA 3Q8BA 1JWBD 2KQ4X 3PZDA 3RYTA 3KQ4A 2L0FA 1HEZE 2KX3A 2L0TA 4IWPA 1BT0A 4K1RB 1WE6A 2N4FA 3U7DA 3OJ3A 1RFAA 2I1JA 4CO7A 2BPSA 4IDIA 2DZJA 4W9JA 2JZ3B 4IWQA 3NG0A 5E6NA 4PT5A 3TIXA 2JWZA 2BKRB 1HQRD 2NPTA 3VDZA 3MJWA 3BVMA 4MT5A 4YWGG 1WGHA 1ZKHA 4JWUC 2AX5A 2CHXA 4RGNA 4K81A 2K9XA 3EECA 3EHVA 3KYCD 4S0RA 4WJPA 2LGSA 2DZIA 4NJ7A 1UGJA 3UINB 3A1QA 3LJ3A 3JSVB 4F8CB 1K50A 3U7ZA 1Q10A 3DBRI 1SSNA 1V49A 1XLQA 2D3GA 1QT9A 1ET9A 1WX9A 2MBEA 3FC4A 4JWSC 2KTRB 3DVGX 4YSYB 5TSSA 5E6JA 3VTVA 5FR3A 1I4PA 2BWFA 4ZRJA 3IAS1 1QF6A 4MSMB 4ITKA 2MBHA 4OZBA 2K6DB 4PYUA 1YMHE 1ZW7A 1TKYA 1YD8U 2I1KA 1WZ0A 3DCGA 4TSSA 1TZOA 1IGDA 2BGFA 2HD5B 3IXSA 3UF8A 3A9JB 1I42A 2N9EB 3NJTA 3CF6E 1P1AA 2DYBA 2TSSA 1FXTB 5CHVC 3ONSA 1ZDVA 4HPLB 1YJIA 1UF0A 2KLGA 4K7SA 2KN4A 1EF5A 4K7WA 2PLPA 1WXAA 2EKIA 1GOZA 3PZ7A 2JX5A 4WURA 2Y3AA 4M01A 2HTHA 1E5WA 4IW0A 2FAZA 2N9KA 1V81A 1F1HA 1I4GA 1ZXIA 3CWIA 3TEXA 4ACFA 4TUUA 2KD0A 1VDVA 2I38A 1PYWD 1P7FA 1F77A 2UU7A 2ICIA 2BB6A 4ASWC 4FLHA 4WQOB 4TMAB 3NZUA 1WF9A 1OQYA 4J3OD 2FCSA 1OEYA 4W9LA 2GBJA 1F2RC 3AN1A 4PS7A 3K9OB 3L17A 1D4BA 4K3CA 4LK0M 2KHWB 1OFFA 4GN1A 3L54A 4MEMA 4LNIA 4URKA 4W9DA 2B3AA 4TQ0A 5D94A 5G55A 2UWQA 2K1FA 3R7QA 4GDLA 5HKHA 5C1ZA 3T9LA 3ZJVA 3L13A 2LJIA 4ZOHC 2M0XA 4FJVB 3X0WA 1AN8A 1R4MB 1IBXA 3R7RA 5I4DA 2LEKA 3OAWA 3ZLZA 1A5RA 1WJ6A 1KLGD 2IY0B 3ZQ4A 5IO9A 2L7RA 1P98A 2Z0EB 2WQYB 4RNAA 1KH0A 2KDBA 2KWCA 4XE0A 4TQ1A 4MACA 1PGXA 2HDEA 4GB9A 2D3CA 1UNSA 4IKGA 3JYUA 2Q5WD 3IG3A 4BFRA 3HVZA 3Q3FA 1MJDA 4ANUA 2REXA 3OLMD 3AE5B 3M62B 1K53A 3Q3OC 2L05A 3IFWB 4EE2A 2OJRA 2PE9A 2IGGA 1V5OA 1FRDA 4MSQB 3DHHC 3VXWA 1C3TA 1FMAD 2BKFA 1NDDA 1WR6E 2N1VA 2RGFA 1TYGB 2DWQA 3RNGC 3PRPB 5JH5C 1BMLC 3WALA 3MC0B 4AOFA 4WAFA 2R2OA 2CU3A 4IM3A 3RMKC 2JF5A 2PTLA 1UD7A 1QOFA 2D07B 1Z2MA 3JW0X 4P1BC 1L7YA 2WXMA 4YT0B 2H89B 2BF8B 3I63C 4X57B 1VZ8A 1TKEA 3HK0A 3EC8A 1S1QB 2LUMA 4HXDA 4LNFA 5C2TB 5C3JB 4ZRQA 3DWGC 1LXDA 2IYDB 1YIWA 3NY5A 4GU2A 3ZUNA 1X1MA 1JWUD 4GIVA 2LXAA 3QK0A 5J18A 3KVFB 1D5MC 3PPAA 3WAMA 2N9PC 3L4PA 4N58A 3L10B 5AZHA 3W1YA 3NRZA 1FXAA 3QJZA 3T3NA 3Q8FA 1P3QU 4RF1A 5AZFA 3HUIA 3TUOA 2IO2B 4BOZB 3AE2B 4NNJB 2KVZA 1FD6A 4PK1A 4GSWA 2CS4A 3Q3NC 4KKJA 1N5XA 1WJUA 1UUPA 4DDGD 1XF5L 3U4EG 1WGRA 5CHFA 1UBIA 2BQQA 2G1EA 3NUHB 3N9YC 2NBVB 1A70A 2GBRA 2M4NA 3ZRCA 3DVGY 2YEPB 1RRBA 2BT6A 2KACA 4OZAA 1SIFA 3SEBA 4BBNF 3J9CA 3TJPA 4WH4A 4L2YA 3BINA 2WX1A 4LNOA 5DCNA 1WXVA 2MEKA 3MTNB 4XDDA 1TS3A 2JRHA 2KFKB 2MA9B 2MWSB 1IGCA 4MM3A 1RAXA 3Q69A 3SD5A 1WGKA 2L00B 1S3SG 1L0XB 1J7CA 1OGWA 4ANXA 2EELA 2DHZA 2GBNA 1K52A 1SE9A 2DZKA 1GUAB 4MELA 2NR2A 2ZEQA 2VRRB 4KDIC 3ZGZA 2WXIA 4AUQC 2VZKD 1ZPSA 3DQVA 2LVOA 2SAKA 2IO0B 2WNMA 3UIPB 3VQIA 4US9A 4JX1C 3SHQA 2J7QB 2KWUB 2INCC 2PJHA 4DXFA 1IUEA 4C4VB 2XEWA 2JXTA 2OJWA 1AARA 2J4XA 2CKHB 4RGOS 4TV3A 2W54A 4HDOA 1PGAA 1B1ZA 1HA5A 1L0YB 1WXMA 5D2MB 1V2YA 1Z5SB 1PDXA 1N5WA 4KGSA 3RCZA 1UGMA 4W9EA 3I57A 2ZZPB 3JVZX 1G6JA 5DPTA 2GMIC 4ANWA 2C7HA 1YOVB 3QAQA 2J42A 4EZLA 2KC1A 1TS2A 3WA0A 1XD3B 1L5PA 3RNCC 1VZ6A 4HDQA 5L83A 1ZUD2 4BVUC 1WYGA 3DOWA 2JT4B 2IJ0A 1L0VB 2NMQA 1TY0A 4HJGE 1FNVA 1WY8A 4HWIB 4ZRPA 2K0PA 4RCOA 3RZWC 3R3MA 2PW9A 4L23A 4MJSA 4LNNA 1EUVB 1JWSD 2MP2A 3V61A 1V1PA 3R66C 2KDFB 2LGDA 2G4SA 1OTRB 1ZXHA 3Q8EA 3OWEB 2LGYA 2V3PA 2WX0A 4C00A 2KJRA 5EE9A 4P6VF 4A90A 3APDA 4YTMB 4JGHB 1LQBA 3RULA 4K3BA 2JPHA 4W9HA 3H9DA 2V3SA 1U4AA 3VHTC 1JRPA 2K3UA 4HVBA 1I4HA 2WDRB 2BB5A 1D3ZA 3P4RB 1GC7A 4WJQA 4M02A 4EKUA 1MG4A 4N6EB 4KVGB 1SJED 4DHJB 4P16A 2IY1B 2KTFA 1YQ4B 2QDFA 2ON8A 2K6QA 3APFA 4M8NA 2ZPYA 4TKNA 4R3DA 5MPOA 2ZVNA 2KFJA 2WGSA 3FKYA 3PLVA 3VUXA 1XEEA 3I9V1 4B95A 2J0KA 5CTRC 2JYTA 3CSTA 1HTOA 4WWMA 1RLFA 3A9KA 4KDLB 3CMMB 4W9GA 1DOIA 2MBQA 2IGDA 1QKZA 3H7PA 4HCNB 2NPTB 3W9CB 5IOIA 2WDVB 3HIZA 2NS5A 4G0NB 3H8HA 4WWOA 3GP7A 3ENEA 2NCNA 2DX5B 3A4RA 1KM7A 3H1UA 3EUB2 4G11A 3ZW3A 1VZ7A 3AEFB 2RD0A 1C78A 1Y8RC 5JHBA 3HRDD 3UI3A 2WLBA 3I3TB 2YEPF 2X38A 2RPQA 4IM2A 2HE7A 3KUCB 1HXYD 2GBMA 2G9HD 3Q8CA 2RDHA 1VCBA 1BXTA 4I6NB 1J7AA 1FRRA 4ICVA 2HJ1A 2L52A 3QARA 4NAMA 1E6EB 1FFUA 1STEA 2DYMA 4FADA 2C7MB 1JW9D 2UYZB 3N1YC 2GB1A 1QOBA 2FE8A 3AH7A 3QC8B 1R4MI 1FNWA 3GOEA 1RFKA 4HJKA 3U2SC 4DBGA 1XXGA 1L2NA 4B9KA 2ZJDA 4LDTD 2LASA 4BKGA 1WGGA 1GJZA 1YNTE 5D3DA 1FNUA 3AECB 2INDC 1B9RA 2KT7A 2X8XX 1SF0A 3ETRA 1AWDA 3TBLD 3B2FA 2Y5PA 2JXXA 2XK5A 3B0AA 4A20A 1NI3A 2FIDA 3DBHB 5CHWA 2XBBC 1C76A 1FM0D 1TS5A 4C80A 2O2VA 1WXQA 4YSXB 4NAWB 3PGEA 3Q3JA 2LXCA 2IO1B 4GLSC 5J2RA 2HTME 3HM6X 2AL3A 3T8MA 3N32A 4PS3A 1E90A 2KTRA 3O13A 3NZSA 3PTFC 1KLUD 1VJKA 3GE8C 4DK5A 3KUDB 5D3IB 4IWOA 4H2AA 2MBOA 3SFEB 3RI7C 1JCKB 4II3B 1E7PB 2I2YA 1Q1OA 1MI0A 2ZCBA 1KOTA 1D5XC 1TZ1A 1ZOYB 4FN2A 3TCAA 2PPHA 3ZNGC 2DNFA 1N62A 4GDLB 3P4QB 1DGJA 3BYYB 5JHAA 3DPDA 3MFGA 4WWPA 1IP9A 4EZJA 2DYOA 2N7DA 1FO4A 1WH3A 2CJOA 3SFDB 1IBXB 4BZAA 1HTQA 1WM2A 4M8MA 3P4PB 1GG3A 2PEAA 4WAAA 1ZP0B 4DXAB 3C8YA 1SXTA 1DOYA 2BYFA 2JY6A 4RF0A 1SJHD 3V3XA 1ZGUB 2K5PA 2G3QB 4ZRIA 2EMSA 4KSLC 2FUG1 2FCNA 2VH2A 3NZ3A 3KW5B 3H6NA 1GB4A 2LD9A 1V6EA 1JWMD 1L6UA 3RNEC 4OVUA 1UWMA 1XCTL 2L3ZA 1UH6A 4LTUA 1V80A 5GXGB 1T3QA 2V3NA 5IAAC 4US8A 4LCDE 4HPPA 1F9JA 3UQBA 4PYZA 3KWVA 2AL6A 4CQNA 1F0ZA 2JU6X 3MP9A 3Q6BA 4XWWA 3ABVB 4I6PA 2PIAA 1PQSA 3NVZA 3PHXB 4WIPA 2ONQA 1JALA 3LYYA 2EMTA 2N7JA 3N1ZC 4MDKE 4ANVA 5EE1A 2PKOA 2KMAA 2K22A 2IBIB 3QA8A 2LUEA 3ZDMC 2XN9C 1NI2A 4W9FA 3E9SA 3AULA 2Y5CA 3KYDD 2D5GA 3I5JC 4A8XC 2WHIA 3TEYA 1DYQA 5IKCM 1FEHA 1WRIA 5BO4B 2L8JA 2OEDA 1J0GA 1K51A 1WRDB 1T0RC 3DVNU 3HHMA 2WXPA 3VRAB 2D2QA 4HEA1 4IC7B 5FKAC 2JSVX 2AQ3B 5AUIA 2V9HA 4C56C 3GB1A 3V6CB 2QHOA 4A9AA 1QOAA 1ROEA 1PUTA 2BW2A 3BK1A 5C23A 4REZA 2J53A 3KH0A 2W3SA 2BYEA 4Q2JA 3N20C 4II2B 2L32A 5GMVA 3RD2A 2INNE 1E9MA 1FCLA 3AI5A 4RM8A 2LGIA 3AEEB 3QX1A 1XLOA 3V6EB 2VH1A 2D3AA 3SR6A 1LGRA 2KYWA 4HKQA 2KC2A 3N3KB 1AW7A 4YSZB 2K8HA 3ECIA 1WWTA 2BS2B 1R7SA 2V1YA 2PE6B 5T8IA 2O6VD 1E0ZA 3AE7B 2KMCA 2MJDA 4JLCA 5LLIA 5EDSA 1KLVA 3H7SA 2KXJA 1SIJA 1NEKB 4MGYE 3AEBB 4KGTA 4BKSA 4W9CA 1ISNA 4DXGA 5J17A 4MM3B 2K39A 2NVUI 3AXCA 3BVZA 4M0WA 3QWZB 3KLSX 4EUTA 4YL8A 2DENB 2AYOB 2KQSA 1WIAA 3PLUA 3A33B 3ZDTA 1V8CA 4XZ4A 1VRAB 2PMVA 5H8YE 3P2BA 3VH4B 1SEBD 3MC8A 1TIFA 3ZRFA 1MFWA 1WR1A 1SBBB 1EU3A 1XQQA 1YQ3B 2BS3B 2ZCCA 2WDQB 3FILA 2RSUA 1C4AA 3WAPA 1WMHB 3B08A 2BTEA 2LWPA 2WWZA 3VTUA 3VAWA 2M0AA 3ZNZB 3UGBB 3B9JA 1EM7A 3PRZA 4JL9A 1XLPA 1EWYC 2FCQA 3DHGC 3DVNV 3A4SC 4XX5A 2E3TA 5TR5A 3TMPB 2MSED 4DHZE 1SE4A 3IT4B 2KOXA 2C5LC 1XLNA 2KDEB 4KIKA 2RDBC 1WGDA 2JVCA 4DHZB 3AE1B 1UBQA 1ZDXA 4NQLB 2WXNA 3IAM1 1T0YA 4MH0E 2CHZA 1C79A 3IBEA 2RMMA 5KHOA 2Z8LA 3QHTA 4A6QA 2WXFA 3P63A 3NS8A 3OJ4B 4PS8A 3R2TA 2DAFA 2KMMA 4NQKE 2MP2B 1TJEA 2QEJC 1Q5WB 1D6EC 1ENFA 1V1PB 3DBSA 3ZTDA 3PT2B 2WU2B 4A3OA 3ZXRA 1GC6A 4DQOC 4C4VA 4FJZA 2MHJA 4QAYA 2WXRA 3V62A 4JE3B 1KJTA 2WYQA 2INPE 4NPNA 2CHWA 2GRIA 1KFYB 3VH3B 1CQVA 4FULA 3QIJA 4W9KA 2B76B 1WJ4A 1SGHA 3DWMA 3VTWA 1JWAD 1HZ6A 4GDKA 2DAJA 3MHSD 2JYEA 4AP4C 1L6VA 3K9PB 3QQ8B 3AE6B 3NVWA 4DWFA 4HRSA 3MC9A 3DBHI 3KUZA 1N60A 2QJLA 2JWUA 3GZNI 4CYEA 1QOGA 5JZEB 2G45B 3SDLC 1SE2A 4ICUA 4ZHOA 2MRPA 1LFDA 3DDCB 4HPMB 1C4PA 2WXGA 1QQRA 4KV2A 3ZKJC 1YN4A 2BYTA 2N9LA 1TT5B 3RUIB 1E8WA 3ML9A 2MX2A 4KGRA 5L95C 3CIRB 4RGMA 3IHPC 3PREA 4NJ6A 2OHFA 4K7UA 1GNUA 2ZNVC 3BY4B 3D32A 2IDYA 1IPGA 1NYQA 1V86A 2BS4B 1DOXA 4ZDVA 1V5TA 2FUHB 3RFZB 3ZJUA 3T3OA 2MW5A 1YN3A 2LHEA 3ZJTA 2WP9B 1MG8A 4JPSA 2LZ6A 5D7GA 1F52A 1C9FA 5BMIA 3A1QB 1F2RI 2RR9A 4KX6B 5LXIB 3M63B 2LMCA 1AYFA 2O6VA 3IVFA 4OZCA 2M1MA 5E6PA 3AE4B 1P7EA 4FBJB 1L4ZB 3BIID 2SEBD 3CSFA 3VR9B 1EWCA 2J0MA 1I35A 4XGAB 1QILA 1V97A 4YTNB 4USAA 3VVWB 2WXOA 2KANA 1ET6A 5DPRA 2HJ8A 2W3RA 3DBLB 5HI1A 2BYVE 3N30A 4ZYNA 4RGTA 1R4NI 2AWTA 2MQJA 1SE3A 2J52A 2K8BA 2XK5B 2LGXA 4IG7B 1OEYJ 2KNBA 2G4DB 1N61A 1J7BA 2V0GA 2O2VB 3RNBC 2A4ZA 5EE0A 3TEWA 2VZKB 2KWVB 1KTKA 2K25A 5G5HA 1TS4A 1WYWB 2WXJA 4YXDB 4NJCA 2KX0A 4BKSD 3BYTB 1WXSA 1JROA 5CX3A 1YQBA 4HLEA 1HZ5A 2FIFA 2IZVB 4P1CC 3W5UB 3LDZE 3Q2AC 3GZNB 1RM6C 3JSVA 3PRMB 3VRBB 3W5VB 1J8CA 1YN5A 5HFYA 4A55A 1XT9B 1E8XA 5FK9C 3UQAA 3V60A 2GBKA 3MHZA 2WXHA 3ZNID 2FCMA 5BMGA 3W2DA 1KF6B 3PSEB 3HM3A 5BYSA 4BOSC 1C4CA 1NBFC 4HCPB 1CZPA 3WANA 4D2KA 2M19A 4FHKA 3BWUD 2QC8A 4BBNC 4B6WA 2RPVA 5AEKB 1WFYA 4KSKC 3AEAB 2ACZB 3APCA 3B2GA 4O1NA 2BVCA 2YLMA 4S17A 4BAXA 3A9JA 2L76A 4NAWA 1WZ3A 4XDCA 3WCQA 3NS1A 2KZRA 4P7IA 1VLBA 3AU5A 3VFKA 5G2NA 5IA7A 3HVDA 4N9F4 1ZE3D 4EZKA 2KQ7A 4MGIE 1WM3A 1T0QC 1QZEA 2KJ6A 1EF1A 4LLGM 2M56B 1VD2A 1QLBB 4CHKA 3NVYA 1E8ZA 2NTTA 2KWDA 2PVGC 5E6OA 2KLCA 5D6JB 1RWSA 4AJYB 2GOWA 2YVCA 3ZNHB 2LHDA 1CK1A 3P42A 3RPFC 1R4NB 3S2AA 1GAQB 1T0SC 3PO0A 1NVID 4RFBA 1ACCA 3EGRA 3E56A 3U52E 2QCZA 3NVVA 3L08A 1E7UA 3DBRB 3PZ8A 3PVLA 2OOBB 2EKEC 4E71A 2DLBA 3RNAC 4IM0A 2MJEA 3X23A 1UZXB 2JQRB 1D5ZC 1SB3C 3URYA 4HKZE 3W1SC 3ALBA 1T5XD 3ZTCA 4XYCA 2GLSA 3LXFA 2MBBB 3NHEB 4MGKE 1T6BX 2N7EA 4NZLB 5LXHA 2LRUA 1H8CA 3BZDB 2ZPNA 4FHJA 2LFIA 2KN5A 1H4RA 1V1OA 2ZVOA 3BVGA 1MHHE 2V4IB 4KZ0A 2ASQA 4RMAA 2BWES 3W1SA 1LO5D 3AMZA
chains in the Genus database with same CATH topology
1XLPA 3I9V1 4RH6A 2TSSA 1EWYC 2JYTA 2E3TA 4WWMA 1ZDVA 1YJIA 4IOIE 2W55A 1SE4A 3IT4B 1DOIA 2KN4A 1XLNA 2IGDA 1QKZA 2PLPA 2EKIA 1GOZA 3PZ7A 2JX5A 4WURA 2Y3AA 3W9CB 2WDVB 3AE1B 3H8HA 3GP7A 2N9KA 1ZDXA 1I4GA 2WXNA 2MJ3A 1UWXA 1ZXIA 3CWIA 3TEXA 3IAM1 1NYRA 1VDVA 2I38A 4C7ZA 1PYWD 1P7FA 1F77A 3EUB2 1MPEA 2ICIA 2BB6A 1C79A 1ESFA 3Q8AA 2RMMA 1VZ7A 1OQRA 3AEFB 5BMHA 4TMAB 1C78A 2Z8LA 4J3OD 2QMTA 4A6QA 2WXFA 3HRDD 3UI3A 3P63A 2WLBA 3R2TA 1F2RC 3AN1A 2KMMA 3EA6A 2YEPF 2X38A 1D4BA 1TJEA 2QEJC 1D6EC 1ENFA 1V1PB 4LK0M 2ZW1A 5BYRA 4KKIA 1OFFA 1OQQA 1HXYD 2G9HD 2QIEB 2WU2B 3Q8CA 1VR9A 2RDHA 1BXTA 4TQ0A 1J7AA 1FRRA 3R2IA 2L52A 4NAMA 1E6EB 1FFUA 1STEA 4DQOC 2DYMA 1FIQA 2WXRA 4ARCA 1JW9D 4JE3B 2INPE 3ZJVA 2GB1A 2LJIA 1QOBA 2FE8A 3AH7A 4ZOHC 1FNWA 4YTPB 1AN8A 1IBXA 5I4DA 2GRIA 2LEKA 1RFKA 1KFYB 3U2SC 1XXGA 3AE8B 1CQVA 1FXIA 3FILB 1KLGD 3AEGB 4AQ7A 2B76B 3ZQ4A 1I4RA 3DWMA 5HG2A 1JWAD 1HZ6A 3P4SB 1YNTE 5D3DA 1FNUA 4XWTA 2QSDA 3AECB 1JMLA 2JYEA 2WQYB 4RNAA 5EE3A 1KH0A 5LNK1 1NENB 2WU5B 1B9RA 1SF0A 3ETRA 1L6VA 2WXLA 1AWDA 4TQ1A 4MACA 1PGXA 2HDEA 4XE0A 3B2FA 3AE6B 1UNSA 2Y5PA 3NVWA 4ZHPA 4IKGA 2Q5WD 4HRSA 3HVZA 4ARIA 1NI3A 1N60A 2BBCA 2QJLA 2WXQA 2JWUA 2L83A 1C76A 1QOGA 1FM0D 2AQ1B 3AE5B 1TS5A 4C80A 1K53A 1SE2A 1WXQA 2L1AA 4YSXB 4ZHOA 3AM9A 4NAWB 1C4PA 2WXGA 4EE2A 1CJEA 2IGGA 1QQRA 1KRHA 3TSSA 3LB8C 3KWLA 1YN4A 1FRDA 2BYTA 2N9LA 4GLSC 3AV8A 1FMAD 2HTME 4KGRA 3TEZA 4ZYSA 3CIRB 4RGMA 1TYGB 2DWQA 1TKGA 2OHFA 2GI9A 1BMLC 2IDYA 1NYQA 1FCCC 3MC0B 3O13A 1GPXA 1KLUD 1VJKA 2BS4B 4B0MA 1DOXA 4WAFA 2CU3A 5D3IB 2PTLA 2E6XA 1QOFA 3RFZB 4H2AA 3ZJUA 2WXMA 3T3OA 3SFEB 1JCKB 3FAHA 1E7PB 1YN3A 2LHEA 2RDGA 2WXKA 4OVZA 4YT0B 2H89B 1MI0A 2WP9B 2I2YA 1D5XC 4JPSA 1VZ8A 1ZOYB 3MJ5A 1TKEA 1E10A 3VR8B 2WS3B 2LUMA 5D7GA 5C2TB 1N62A 3AB5A 4GDLB 4OHJA 3P4QB 5G5GA 5C3JB 4ZRQA 1C9FA 3DWGC 5BMIA 1DGJA 5JXVA 3BYYB 3MFGA 2DYOA 1F2RI 4KX6B 1JWUD 1FO4A 1JQ4A 2LMCA 2FBWB 1AYFA 2CJOA 4OZCA 3SFDB 1IBXB 5H92C 4AS1A 2W82A 3P4PB 1D5MC 2AQ2B 2N0SB 1XCQL 3AE4B 5HHDG 1P7EA 1ZP0B 3L4PA 2R61A 1L4ZB 3BIID 2SEBD 3C8YA 3IT6B 1EWCA 1SXTA 4N58A 4UDUC 3VR9B 1DOYA 4RF0A 1SJHD 1QILA 3NRZA 1EU4A 1V97A 4YTNB 2IGHA 3V3XA 4GDKB 2K5PA 4USAA 1FXAA 2FUG1 3T3NA 2WXOA 1ET6A 1YJJA 4HROA 3Q8FA 3V05A 2W3RA 3NZ3A 4RF1A 5HI1A 3HUIA 3TUOA 4RGTA 3AE2B 1GB4A 3ZYYX 1SE3A 2J52A 1JWMD 4L1BA 1FD6A 1L6UA 1UWMA 1MHXA 5AUKA 1XCTL 4KKJA 1N5XA 4LTUA 5GXGB 1T3QA 1N61A 1J7BA 3GS2A 1UUPA 2V0GA 2V3NA 2CJNA 1I7HA 5EE0A 1XF5L 2VZKB 3TEWA 1KTKA 1Y56A 5G5HA 3U4EG 1TS4A 4US8A 3AE3B 3NUHB 2G1EA 1FFVA 2WXJA 3N9YC 4YXDB 1XO3A 4NJCA 3KWVA 1A70A 4CQNA 1F0ZA 2JU6X 2YEPB 3BYTB 3MP9A 3P1MA 4XWWA 2BT6A 2KACA 4OZAA 3ABVB 1BUIC 2PIAA 1C77A 1JROA 3NVZA 1PGBA 3SEBA 2IPKD 1TY2A 3J9CA 1HZ5A 1I4XA 1WSPA 4WIPA 4WH4A 2KDMA 2ONQA 4L2YA 4WQMA 1JALA 4B0EA 1GB1A 5BYQA 3LYYA 4C7YA 2N7JA 1PFDA 3W5UB 2MEKA 4FXCA 4XDDA 1I4QA 2PKOA 5EE1A 1RM6C 1TS3A 1RYJA 4N59A 3VRBB 2K22A 1N63A 3W5VB 4MH8A 2XNAC 1IGCA 3Q69A 1YN5A 5HFYA 1WGKA 4A55A 2KAJA 3AEDB 2ZW0A 5FK9C 1L0XB 1M4VA 2JZPA 1J7CA 2XN9C 2DBYA 3MHZA 2EELA 1MVKA 2WXHA 2H88B 3BK2A 5BMGA 3W2DA 1KF6B 2MH7A 3R8BA 3E9SA 2Y5CA 2QILA 1K52A 2D5GA 4A8XC 2PVOD 5BYSA 3TEYA 1DYQA 3ZGZA 2WXIA 1FEHA 1C4CA 1WRIA 2NTSA 2VZKD 1CZPA 1ZPSA 4D2KA 2OEDA 1K51A 2M19A 2SAKA 4OW0A 3ZJTA 3BWUD 1L4DB 2WXPA 3VRAB 4HEA1 5FKAC 2WNMA 2JSVX 3AE9B 2AQ3B 2RPVA 3VQIA 5AUIA 4US9A 4JX1C 3Q8BA 1JWBD 2ACZB 3AEAB 3GB1A 4C56C 3B2GA 2KQ4X 4O1NA 4DXFA 1IUEA 4A9AA 1QOAA 1ROEA 3KQ4A 1PUTA 2BW2A 1HEZE 2JXTA 3BK1A 4XDCA 3WCQA 2J4XA 3NS1A 4REZA 2J53A 4RGOS 2W3SA 2W54A 4Q2JA 1PGAA 1B1ZA 1HA5A 1VLBA 1L0YB 2L32A 1PDXA 1N5WA 2INNE 3HVDA 4KGSA 1E9MA 1ZE3D 3I57A 4IDIA 1FCLA 2LGIA 3AEEB 4LLGM 1XLOA 2M56B 1QLBB 4PT5A 2J42A 3NVYA 1HQRD 3SR6A 2NTTA 4HKQA 3BVMA 2KWDA 2PVGC 1AW7A 4YSZB 4MT5A 4YWGG 1RWSA 4JWUC 1TS2A 2AX5A 1WWTA 2LHDA 4RGNA 1L5PA 2BS2B 1R7SA 1VZ6A 1CK1A 2K9XA 1ZUD2 5T8IA 3P42A 1WYGA 1E0ZA 3RPFC 3AE7B 2IJ0A 1L0VB 2MJDA 2NMQA 1GAQB 3PO0A 1NVID 4RFBA 1TY0A 1ACCA 1FNVA 1UGJA 1SIJA 3E56A 3EGRA 1NEKB 4HJGE 3U52E 3AEBB 4KGTA 4ZRPA 2K0PA 4RCOA 4DXGA 3NVVA 2PW9A 4L23A 1K50A 3U7ZA 1Q10A 4MM3B 1JWSD 3BVZA 1SSNA 4M0WA 1XLQA 3PZ8A 3KLSX 1V1PA 1ZXHA 2DLBA 3Q8EA 3OWEB 2MJEA 2V3PA 1QT9A 2JQRB 1D5ZC 1SB3C 1V8CA 5EE9A 3URYA 1ET9A 4P6VF 3FC4A 4A90A 4YTMB 4HKZE 1VRAB 4JWSC 1T5XD 2PMVA 5H8YE 4YSYB 5TSSA 5E6JA 1SEBD 5FR3A 1I4PA 1JRPA 2K3UA 3LXFA 1T6BX 4NZLB 1I4HA 2WDRB 3IAS1 2BB5A 1QF6A 1SBBB 3P4RB 1EU3A 1YQ3B 2BS3B 4ITKA 3BZDB 4OZBA 3B9JA 4N6EB 1YMHE 1SJED 1TKYA 2WDQB 3FILA 4P16A 1C4AA 1YQ4B 2ON8A 2LFIA 4TSSA 1V1OA 2BTEA 3BVGA 1TZOA 4R3DA 1MHHE 1IGDA 5MPOA 2V4IB 3IXSA 2M0AA 3W1SA 1LO5D 1XEEA 1EM7A 3AMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WCQ A;  1XLP A;  3NS1 A;  1YJJ A;  3AEC B;  2WQY B;  4HRO A;  1EWY C;  2W3R A;  5EE3 A;  2W3S A;  2W54 A;  1NEN B;  2WU5 B;  1B9R A;  1VLB A;  1SF0 A;  3ETR A;  1L6V A;  3HUI A;  1AWD A;  2E3T A;  4WWM A;  1PDX A;  1YJI A;  3AE2 B;  3AE6 B;  1N5W A;  3B2F A;  3ZYY X;  1E9M A;  2W55 A;  3NVW A;  4ZHP A;  4IDI A;  2Q5W D;  4HRS A;  1L6U A;  1UWM A;  3HVZ A;  1NI3 A;  1N60 A;  1DOI A;  5AUK A;  3AEE B;  1XLN A;  2QJL A;  1XLO A;  1N5X A;  2L83 A;  4LTU A;  1QOG A;  1FM0 D;  2M56 B;  5GXG B;  1T3Q A;  1QLB B;  1N61 A;  1J7B A;  3AE5 B;  2EKI A;  4C80 A;  2JX5 A;  3NVY A;  1WXQ A;  4YSX B;  3W9C B;  3SR6 A;  2CJN A;  2WDV B;  1I7H A;  3AE1 B;  3AM9 A;  5EE0 A;  5G5H A;  4US8 A;  3AE3 B;  2PVG C;  4YSZ B;  2G1E A;  1FFV A;  1CJE A;  1RWS A;  4YXD B;  4JWU C;  1E10 A;  1XO3 A;  1A70 A;  2MJ3 A;  2AX5 A;  1KRH A;  1WWT A;  1ZXI A;  3CWI A;  3LB8 C;  3P1M A;  1F0Z A;  1L5P A;  2BS2 B;  1NYR A;  1R7S A;  3KWL A;  1FRD A;  2K9X A;  2BT6 A;  1ZUD 2;  1VDV A;  3ABV B;  3AV8 A;  1FMA D;  2HTM E;  1WYG A;  4C7Z A;  1E0Z A;  2PIA A;  3AE7 B;  3CIR B;  1JRO A;  3EUB 2;  3NVZ A;  3RPF C;  1TYG B;  2DWQ A;  1L0V B;  1TKG A;  2OHF A;  3AEF B;  1OQR A;  2MJD A;  4WQM A;  1JAL A;  1GAQ B;  3PO0 A;  4C7Y A;  1NVI D;  1NYQ A;  1PFD A;  3W5U B;  1SIJ A;  3HRD D;  4FXC A;  1NEK B;  2PKO A;  3P63 A;  2BS4 B;  1RM6 C;  1VJK A;  3AEB B;  5EE1 A;  1DOX A;  2CU3 A;  2WLB A;  1RYJ A;  4N59 A;  3VRB B;  2K22 A;  3AN1 A;  3NVV A;  1N63 A;  2KMM A;  3W5V B;  1QOF A;  1TJE A;  1XLQ A;  3SFE B;  1WGK A;  3FAH A;  1E7P B;  1GPX A;  2KAJ A;  1OFF A;  3AED B;  2H89 B;  2WP9 B;  1OQQ A;  4YT0 B;  1J7C A;  2QIE B;  2MJE A;  1QT9 A;  2DBY A;  2WU2 B;  1ZOY B;  1J7A A;  1V8C A;  1FRR A;  1SB3 C;  1TKE A;  2H88 B;  2JQR B;  2L52 A;  5EE9 A;  1KF6 B;  2MH7 A;  2WS3 B;  4P6V F;  1E6E B;  1FFU A;  3FC4 A;  3VR8 B;  2Y5C A;  4YTM B;  5C2T B;  4JWS C;  1FIQ A;  1N62 A;  3AB5 A;  5G5G A;  3P4Q B;  5C3J B;  3DWG C;  2PVO D;  1JW9 D;  5H8Y E;  1DGJ A;  4YSY B;  1WRI A;  1JRP A;  3LXF A;  4KX6 B;  4ZOH C;  1QOB A;  3AH7 A;  1FO4 A;  1CZP A;  1JQ4 A;  2FBW B;  1AYF A;  2M19 A;  2WDR B;  4YTP B;  2CJO A;  3SFD B;  1QF6 A;  5H92 C;  2LEK A;  1RFK A;  3P4R B;  1KFY B;  1YQ3 B;  2BS3 B;  3P4P B;  4ITK A;  3VRA B;  2N0S B;  4N6E B;  3AE4 B;  1TKY A;  3AE8 B;  1FXI A;  3AE9 B;  2WDQ B;  3AEG B;  1ZP0 B;  3L4P A;  3BII D;  2B76 B;  4JX1 C;  4US9 A;  4N58 A;  5AUI A;  1YQ4 B;  3VR9 B;  1DOY A;  1JWB D;  2ACZ B;  3AEA B;  3B2G A;  3NRZ A;  3DWM A;  5MPO A;  1IUE A;  1V97 A;  1QOA A;  4YTN B;  4A9A A;  1JWA D;  1ROE A;  1PUT A;  4ZHO A;  2K5P A;  4USA A;  3P4S B;  1FXA A;  3B9J A;  3AMZ A; 
#chains in the Genus database with same CATH topology
 4RH6 A;  4XC2 A;  5KHQ A;  4IOI E;  2W55 A;  3ZO5 B;  5IP4 D;  1TTN A;  3AU4 A;  4JQW C;  5DPW A;  3OG5 A;  2LVQ A;  4G3X B;  3B1L X;  4JIO U;  3RN9 C;  3O65 B;  2JUO A;  4GGQ A;  2MJ3 A;  1UWX A;  4G50 A;  1NYR A;  2C9W B;  4NY0 A;  4C7Z A;  1MPE A;  1ESF A;  3Q8A A;  1IYF A;  1OQR A;  4LDT B;  5BMH A;  4F7Z A;  4DHJ D;  2QMT A;  1YJ1 A;  4J6I A;  1P0R A;  3EA6 A;  4M0W B;  3U30 A;  2ZW1 A;  4W9I A;  4LJP B;  5BYR A;  4KKI A;  1OQQ A;  1JRU A;  2QIE B;  1VR9 A;  5IN7 A;  3R2I A;  1FIQ A;  2AEH A;  4GOC A;  2MLB A;  2LVP A;  4ARC A;  3RZF A;  4WWN A;  4HK2 A;  3PS6 A;  4E74 A;  2NBW B;  4YTP B;  3AE8 B;  1FXI A;  2Y5B B;  3C19 A;  3FIL B;  3AEG B;  4AQ7 A;  4LNK A;  1I4R A;  5HG2 A;  4WJO A;  3NOB A;  3PHW B;  3M95 A;  4DDI D;  2CU1 A;  3P4S B;  1E7V A;  4XWT A;  2QSD A;  4EEW A;  1JML A;  5EE3 A;  5LNK 1;  1NEN B;  2WU5 B;  3N1X C;  4IUM B;  2WXL A;  3WIM A;  2KDI A;  3UIO B;  4ZHP A;  2D3B A;  4ARI A;  2BBC A;  2WXQ A;  2L83 A;  4KIK B;  1K8R B;  2AQ1 B;  2IO3 B;  2L1A A;  3ZXV A;  3AM9 A;  3ZVV A;  2D11 A;  1P9D U;  1CJE A;  2V4L A;  1KRH A;  3TSS A;  3LB8 C;  2JRI B;  4F1S A;  3KWL A;  3Q3M C;  3DHI C;  1UEL A;  3AV8 A;  3TEZ A;  2JZZ A;  3ML8 A;  4ZYS A;  1TKG A;  2GI9 A;  2N1W A;  3EFU A;  4KZC A;  1FCC C;  4AWJ A;  1V9J A;  2LJ5 A;  2R2Q A;  4GMV A;  3RNF C;  2KK8 A;  4B0M A;  1E8Y A;  2K8C A;  2KFK A;  2NBU A;  2LI5 A;  3RT3 B;  2E6X A;  2KJH B;  1WE7 A;  4GXB A;  1LM8 B;  3FAH A;  1YX6 B;  3VUW A;  2RDG A;  1GPX A;  2WXK A;  4OVZ A;  3EFC A;  1TGZ B;  4EOY A;  1WMH A;  3MJ5 A;  1E10 A;  4RM9 A;  3VR8 B;  2WS3 B;  5FR6 A;  3AB5 A;  4OHJ A;  5G5G A;  4LJO B;  3VUY A;  5JXV A;  3U8Z A;  4A3P A;  4MJS B;  5AZG A;  1JQ4 A;  2FBW B;  1YX5 B;  5H92 C;  4AS1 A;  2W82 A;  2AQ2 B;  2N0S B;  1XCQ L;  2Z0D B;  5HHD G;  3WAO A;  2M17 A;  2DZM A;  3Q14 C;  2R61 A;  4FA6 A;  3IT6 B;  1CMX B;  4I6L B;  4UDU C;  1WGY A;  4M00 A;  1EU4 A;  2M8S A;  2IGH A;  4GDK B;  5DPS A;  4MGZ E;  2D10 A;  1WI0 A;  2C60 A;  1YJJ A;  1WX7 A;  3DBL I;  4HRO A;  3V05 A;  1WX8 A;  2C7N B;  4FJY A;  3ZYY X;  3SU8 X;  4L1B A;  1MHX A;  5AUK A;  2KVR A;  3TL5 A;  3GS2 A;  2J0J A;  2CJN A;  4ZRK A;  1I7H A;  1Y56 A;  4OVV A;  3AE3 B;  3QCA A;  1FFV A;  2WDT B;  1XO3 A;  1FPY A;  3P1M A;  4EFO A;  2CR5 A;  3PV1 A;  1EO6 A;  1BUI C;  3GE3 C;  1C77 A;  1Q0W B;  1PGB A;  1HE8 A;  3A9K B;  3M3J A;  2IPK D;  1TY2 A;  1M94 A;  1I4X A;  1WSP A;  4WQM A;  2KDM A;  4B0E A;  1GB1 A;  5BYQ A;  4C7Y A;  3L0W B;  1PFD A;  4FXC A;  1I4Q A;  3H7P B;  2LRW A;  3C0R B;  4N59 A;  1RYJ A;  1N63 A;  4MH8 A;  2XNA C;  1WJN A;  3L16 A;  2KO3 A;  2KAJ A;  3AED B;  2ZW0 A;  2Z59 B;  1M4V A;  2JZP A;  2DBY A;  2FNJ B;  4AJW A;  1MVK A;  2H88 B;  3ZIM A;  3BK2 A;  4E3C A;  2MH7 A;  3R8B A;  2ZNV B;  2QIL A;  4WJN A;  2PVO D;  1J19 A;  2MCN B;  2A5U A;  2NTS A;  2O6V B;  1N6Z A;  1C1Y B;  2W9N A;  4OW0 A;  2KKC A;  1L4D B;  2N9X A;  3AE9 B;  1TBE A;  4BKT A;  3Q8B A;  1JWB D;  2KQ4 X;  3PZD A;  3RYT A;  3KQ4 A;  2L0F A;  1HEZ E;  2KX3 A;  2L0T A;  4IWP A;  1BT0 A;  4K1R B;  1WE6 A;  2N4F A;  3U7D A;  3OJ3 A;  1RFA A;  2I1J A;  4CO7 A;  2BPS A;  4IDI A;  2DZJ A;  4W9J A;  2JZ3 B;  4IWQ A;  3NG0 A;  5E6N A;  4PT5 A;  3TIX A;  2JWZ A;  2BKR B;  1HQR D;  2NPT A;  3VDZ A;  3MJW A;  3BVM A;  4MT5 A;  4YWG G;  1WGH A;  1ZKH A;  4JWU C;  2AX5 A;  2CHX A;  4RGN A;  4K81 A;  2K9X A;  3EEC A;  3EHV A;  3KYC D;  4S0R A;  4WJP A;  2LGS A;  2DZI A;  4NJ7 A;  1UGJ A;  3UIN B;  3A1Q A;  3LJ3 A;  3JSV B;  4F8C B;  1K50 A;  3U7Z A;  1Q10 A;  3DBR I;  1SSN A;  1V49 A;  1XLQ A;  2D3G A;  1QT9 A;  1ET9 A;  1WX9 A;  2MBE A;  3FC4 A;  4JWS C;  2KTR B;  3DVG X;  4YSY B;  5TSS A;  5E6J A;  3VTV A;  5FR3 A;  1I4P A;  2BWF A;  4ZRJ A;  3IAS 1;  1QF6 A;  4MSM B;  4ITK A;  2MBH A;  4OZB A;  2K6D B;  4PYU A;  1YMH E;  1ZW7 A;  1TKY A;  1YD8 U;  2I1K A;  1WZ0 A;  3DCG A;  4TSS A;  1TZO A;  1IGD A;  2BGF A;  2HD5 B;  3IXS A;  3UF8 A;  3A9J B;  1I42 A;  2N9E B;  3NJT A;  3CF6 E;  1P1A A;  2DYB A;  2TSS A;  1FXT B;  5CHV C;  3ONS A;  1ZDV A;  4HPL B;  1YJI A;  1UF0 A;  2KLG A;  4K7S A;  2KN4 A;  1EF5 A;  4K7W A;  2PLP A;  1WXA A;  2EKI A;  1GOZ A;  3PZ7 A;  2JX5 A;  4WUR A;  2Y3A A;  4M01 A;  2HTH A;  1E5W A;  4IW0 A;  2FAZ A;  2N9K A;  1V81 A;  1F1H A;  1I4G A;  1ZXI A;  3CWI A;  3TEX A;  4ACF A;  4TUU A;  2KD0 A;  1VDV A;  2I38 A;  1PYW D;  1P7F A;  1F77 A;  2UU7 A;  2ICI A;  2BB6 A;  4ASW C;  4FLH A;  4WQO B;  4TMA B;  3NZU A;  1WF9 A;  1OQY A;  4J3O D;  2FCS A;  1OEY A;  4W9L A;  2GBJ A;  1F2R C;  3AN1 A;  4PS7 A;  3K9O B;  3L17 A;  1D4B A;  4K3C A;  4LK0 M;  2KHW B;  1OFF A;  4GN1 A;  3L54 A;  4MEM A;  4LNI A;  4URK A;  4W9D A;  2B3A A;  4TQ0 A;  5D94 A;  5G55 A;  2UWQ A;  2K1F A;  3R7Q A;  4GDL A;  5HKH A;  5C1Z A;  3T9L A;  3ZJV A;  3L13 A;  2LJI A;  4ZOH C;  2M0X A;  4FJV B;  3X0W A;  1AN8 A;  1R4M B;  1IBX A;  3R7R A;  5I4D A;  2LEK A;  3OAW A;  3ZLZ A;  1A5R A;  1WJ6 A;  1KLG D;  2IY0 B;  3ZQ4 A;  5IO9 A;  2L7R A;  1P98 A;  2Z0E B;  2WQY B;  4RNA A;  1KH0 A;  2KDB A;  2KWC A;  4XE0 A;  4TQ1 A;  4MAC A;  1PGX A;  2HDE A;  4GB9 A;  2D3C A;  1UNS A;  4IKG A;  3JYU A;  2Q5W D;  3IG3 A;  4BFR A;  3HVZ A;  3Q3F A;  1MJD A;  4ANU A;  2REX A;  3OLM D;  3AE5 B;  3M62 B;  1K53 A;  3Q3O C;  2L05 A;  3IFW B;  4EE2 A;  2OJR A;  2PE9 A;  2IGG A;  1V5O A;  1FRD A;  4MSQ B;  3DHH C;  3VXW A;  1C3T A;  1FMA D;  2BKF A;  1NDD A;  1WR6 E;  2N1V A;  2RGF A;  1TYG B;  2DWQ A;  3RNG C;  3PRP B;  5JH5 C;  1BML C;  3WAL A;  3MC0 B;  4AOF A;  4WAF A;  2R2O A;  2CU3 A;  4IM3 A;  3RMK C;  2JF5 A;  2PTL A;  1UD7 A;  1QOF A;  2D07 B;  1Z2M A;  3JW0 X;  4P1B C;  1L7Y A;  2WXM A;  4YT0 B;  2H89 B;  2BF8 B;  3I63 C;  4X57 B;  1VZ8 A;  1TKE A;  3HK0 A;  3EC8 A;  1S1Q B;  2LUM A;  4HXD A;  4LNF A;  5C2T B;  5C3J B;  4ZRQ A;  3DWG C;  1LXD A;  2IYD B;  1YIW A;  3NY5 A;  4GU2 A;  3ZUN A;  1X1M A;  1JWU D;  4GIV A;  2LXA A;  3QK0 A;  5J18 A;  3KVF B;  1D5M C;  3PPA A;  3WAM A;  2N9P C;  3L4P A;  4N58 A;  3L10 B;  5AZH A;  3W1Y A;  3NRZ A;  1FXA A;  3QJZ A;  3T3N A;  3Q8F A;  1P3Q U;  4RF1 A;  5AZF A;  3HUI A;  3TUO A;  2IO2 B;  4BOZ B;  3AE2 B;  4NNJ B;  2KVZ A;  1FD6 A;  4PK1 A;  4GSW A;  2CS4 A;  3Q3N C;  4KKJ A;  1N5X A;  1WJU A;  1UUP A;  4DDG D;  1XF5 L;  3U4E G;  1WGR A;  5CHF A;  1UBI A;  2BQQ A;  2G1E A;  3NUH B;  3N9Y C;  2NBV B;  1A70 A;  2GBR A;  2M4N A;  3ZRC A;  3DVG Y;  2YEP B;  1RRB A;  2BT6 A;  2KAC A;  4OZA A;  1SIF A;  3SEB A;  4BBN F;  3J9C A;  3TJP A;  4WH4 A;  4L2Y A;  3BIN A;  2WX1 A;  4LNO A;  5DCN A;  1WXV A;  2MEK A;  3MTN B;  4XDD A;  1TS3 A;  2JRH A;  2KFK B;  2MA9 B;  2MWS B;  1IGC A;  4MM3 A;  1RAX A;  3Q69 A;  3SD5 A;  1WGK A;  2L00 B;  1S3S G;  1L0X B;  1J7C A;  1OGW A;  4ANX A;  2EEL A;  2DHZ A;  2GBN A;  1K52 A;  1SE9 A;  2DZK A;  1GUA B;  4MEL A;  2NR2 A;  2ZEQ A;  2VRR B;  4KDI C;  3ZGZ A;  2WXI A;  4AUQ C;  2VZK D;  1ZPS A;  3DQV A;  2LVO A;  2SAK A;  2IO0 B;  2WNM A;  3UIP B;  3VQI A;  4US9 A;  4JX1 C;  3SHQ A;  2J7Q B;  2KWU B;  2INC C;  2PJH A;  4DXF A;  1IUE A;  4C4V B;  2XEW A;  2JXT A;  2OJW A;  1AAR A;  2J4X A;  2CKH B;  4RGO S;  4TV3 A;  2W54 A;  4HDO A;  1PGA A;  1B1Z A;  1HA5 A;  1L0Y B;  1WXM A;  5D2M B;  1V2Y A;  1Z5S B;  1PDX A;  1N5W A;  4KGS A;  3RCZ A;  1UGM A;  4W9E A;  3I57 A;  2ZZP B;  3JVZ X;  1G6J A;  5DPT A;  2GMI C;  4ANW A;  2C7H A;  1YOV B;  3QAQ A;  2J42 A;  4EZL A;  2KC1 A;  1TS2 A;  3WA0 A;  1XD3 B;  1L5P A;  3RNC C;  1VZ6 A;  4HDQ A;  5L83 A;  1ZUD 2;  4BVU C;  1WYG A;  3DOW A;  2JT4 B;  2IJ0 A;  1L0V B;  2NMQ A;  1TY0 A;  4HJG E;  1FNV A;  1WY8 A;  4HWI B;  4ZRP A;  2K0P A;  4RCO A;  3RZW C;  3R3M A;  2PW9 A;  4L23 A;  4MJS A;  4LNN A;  1EUV B;  1JWS D;  2MP2 A;  3V61 A;  1V1P A;  3R66 C;  2KDF B;  2LGD A;  2G4S A;  1OTR B;  1ZXH A;  3Q8E A;  3OWE B;  2LGY A;  2V3P A;  2WX0 A;  4C00 A;  2KJR A;  5EE9 A;  4P6V F;  4A90 A;  3APD A;  4YTM B;  4JGH B;  1LQB A;  3RUL A;  4K3B A;  2JPH A;  4W9H A;  3H9D A;  2V3S A;  1U4A A;  3VHT C;  1JRP A;  2K3U A;  4HVB A;  1I4H A;  2WDR B;  2BB5 A;  1D3Z A;  3P4R B;  1GC7 A;  4WJQ A;  4M02 A;  4EKU A;  1MG4 A;  4N6E B;  4KVG B;  1SJE D;  4DHJ B;  4P16 A;  2IY1 B;  2KTF A;  1YQ4 B;  2QDF A;  2ON8 A;  2K6Q A;  3APF A;  4M8N A;  2ZPY A;  4TKN A;  4R3D A;  5MPO A;  2ZVN A;  2KFJ A;  2WGS A;  3FKY A;  3PLV A;  3VUX A;  1XEE A;  3I9V 1;  4B95 A;  2J0K A;  5CTR C;  2JYT A;  3CST A;  1HTO A;  4WWM A;  1RLF A;  3A9K A;  4KDL B;  3CMM B;  4W9G A;  1DOI A;  2MBQ A;  2IGD A;  1QKZ A;  3H7P A;  4HCN B;  2NPT B;  3W9C B;  5IOI A;  2WDV B;  3HIZ A;  2NS5 A;  4G0N B;  3H8H A;  4WWO A;  3GP7 A;  3ENE A;  2NCN A;  2DX5 B;  3A4R A;  1KM7 A;  3H1U A;  3EUB 2;  4G11 A;  3ZW3 A;  1VZ7 A;  3AEF B;  2RD0 A;  1C78 A;  1Y8R C;  5JHB A;  3HRD D;  3UI3 A;  2WLB A;  3I3T B;  2YEP F;  2X38 A;  2RPQ A;  4IM2 A;  2HE7 A;  3KUC B;  1HXY D;  2GBM A;  2G9H D;  3Q8C A;  2RDH A;  1VCB A;  1BXT A;  4I6N B;  1J7A A;  1FRR A;  4ICV A;  2HJ1 A;  2L52 A;  3QAR A;  4NAM A;  1E6E B;  1FFU A;  1STE A;  2DYM A;  4FAD A;  2C7M B;  1JW9 D;  2UYZ B;  3N1Y C;  2GB1 A;  1QOB A;  2FE8 A;  3AH7 A;  3QC8 B;  1R4M I;  1FNW A;  3GOE A;  1RFK A;  4HJK A;  3U2S C;  4DBG A;  1XXG A;  1L2N A;  4B9K A;  2ZJD A;  4LDT D;  2LAS A;  4BKG A;  1WGG A;  1GJZ A;  1YNT E;  5D3D A;  1FNU A;  3AEC B;  2IND C;  1B9R A;  2KT7 A;  2X8X X;  1SF0 A;  3ETR A;  1AWD A;  3TBL D;  3B2F A;  2Y5P A;  2JXX A;  2XK5 A;  3B0A A;  4A20 A;  1NI3 A;  2FID A;  3DBH B;  5CHW A;  2XBB C;  1C76 A;  1FM0 D;  1TS5 A;  4C80 A;  2O2V A;  1WXQ A;  4YSX B;  4NAW B;  3PGE A;  3Q3J A;  2LXC A;  2IO1 B;  4GLS C;  5J2R A;  2HTM E;  3HM6 X;  2AL3 A;  3T8M A;  3N32 A;  4PS3 A;  1E90 A;  2KTR A;  3O13 A;  3NZS A;  3PTF C;  1KLU D;  1VJK A;  3GE8 C;  4DK5 A;  3KUD B;  5D3I B;  4IWO A;  4H2A A;  2MBO A;  3SFE B;  3RI7 C;  1JCK B;  4II3 B;  1E7P B;  2I2Y A;  1Q1O A;  1MI0 A;  2ZCB A;  1KOT A;  1D5X C;  1TZ1 A;  1ZOY B;  4FN2 A;  3TCA A;  2PPH A;  3ZNG C;  2DNF A;  1N62 A;  4GDL B;  3P4Q B;  1DGJ A;  3BYY B;  5JHA A;  3DPD A;  3MFG A;  4WWP A;  1IP9 A;  4EZJ A;  2DYO A;  2N7D A;  1FO4 A;  1WH3 A;  2CJO A;  3SFD B;  1IBX B;  4BZA A;  1HTQ A;  1WM2 A;  4M8M A;  3P4P B;  1GG3 A;  2PEA A;  4WAA A;  1ZP0 B;  4DXA B;  3C8Y A;  1SXT A;  1DOY A;  2BYF A;  2JY6 A;  4RF0 A;  1SJH D;  3V3X A;  1ZGU B;  2K5P A;  2G3Q B;  4ZRI A;  2EMS A;  4KSL C;  2FUG 1;  2FCN A;  2VH2 A;  3NZ3 A;  3KW5 B;  3H6N A;  1GB4 A;  2LD9 A;  1V6E A;  1JWM D;  1L6U A;  3RNE C;  4OVU A;  1UWM A;  1XCT L;  2L3Z A;  1UH6 A;  4LTU A;  1V80 A;  5GXG B;  1T3Q A;  2V3N A;  5IAA C;  4US8 A;  4LCD E;  4HPP A;  1F9J A;  3UQB A;  4PYZ A;  3KWV A;  2AL6 A;  4CQN A;  1F0Z A;  2JU6 X;  3MP9 A;  3Q6B A;  4XWW A;  3ABV B;  4I6P A;  2PIA A;  1PQS A;  3NVZ A;  3PHX B;  4WIP A;  2ONQ A;  1JAL A;  3LYY A;  2EMT A;  2N7J A;  3N1Z C;  4MDK E;  4ANV A;  5EE1 A;  2PKO A;  2KMA A;  2K22 A;  2IBI B;  3QA8 A;  2LUE A;  3ZDM C;  2XN9 C;  1NI2 A;  4W9F A;  3E9S A;  3AUL A;  2Y5C A;  3KYD D;  2D5G A;  3I5J C;  4A8X C;  2WHI A;  3TEY A;  1DYQ A;  5IKC M;  1FEH A;  1WRI A;  5BO4 B;  2L8J A;  2OED A;  1J0G A;  1K51 A;  1WRD B;  1T0R C;  3DVN U;  3HHM A;  2WXP A;  3VRA B;  2D2Q A;  4HEA 1;  4IC7 B;  5FKA C;  2JSV X;  2AQ3 B;  5AUI A;  2V9H A;  4C56 C;  3GB1 A;  3V6C B;  2QHO A;  4A9A A;  1QOA A;  1ROE A;  1PUT A;  2BW2 A;  3BK1 A;  5C23 A;  4REZ A;  2J53 A;  3KH0 A;  2W3S A;  2BYE A;  4Q2J A;  3N20 C;  4II2 B;  2L32 A;  5GMV A;  3RD2 A;  2INN E;  1E9M A;  1FCL A;  3AI5 A;  4RM8 A;  2LGI A;  3AEE B;  3QX1 A;  1XLO A;  3V6E B;  2VH1 A;  2D3A A;  3SR6 A;  1LGR A;  2KYW A;  4HKQ A;  2KC2 A;  3N3K B;  1AW7 A;  4YSZ B;  2K8H A;  3ECI A;  1WWT A;  2BS2 B;  1R7S A;  2V1Y A;  2PE6 B;  5T8I A;  2O6V D;  1E0Z A;  3AE7 B;  2KMC A;  2MJD A;  4JLC A;  5LLI A;  5EDS A;  1KLV A;  3H7S A;  2KXJ A;  1SIJ A;  1NEK B;  4MGY E;  3AEB B;  4KGT A;  4BKS A;  4W9C A;  1ISN A;  4DXG A;  5J17 A;  4MM3 B;  2K39 A;  2NVU I;  3AXC A;  3BVZ A;  4M0W A;  3QWZ B;  3KLS X;  4EUT A;  4YL8 A;  2DEN B;  2AYO B;  2KQS A;  1WIA A;  3PLU A;  3A33 B;  3ZDT A;  1V8C A;  4XZ4 A;  1VRA B;  2PMV A;  5H8Y E;  3P2B A;  3VH4 B;  1SEB D;  3MC8 A;  1TIF A;  3ZRF A;  1MFW A;  1WR1 A;  1SBB B;  1EU3 A;  1XQQ A;  1YQ3 B;  2BS3 B;  2ZCC A;  2WDQ B;  3FIL A;  2RSU A;  1C4A A;  3WAP A;  1WMH B;  3B08 A;  2BTE A;  2LWP A;  2WWZ A;  3VTU A;  3VAW A;  2M0A A;  3ZNZ B;  3UGB B;  3B9J A;  1EM7 A;  3PRZ A;  4JL9 A;  1XLP A;  1EWY C;  2FCQ A;  3DHG C;  3DVN V;  3A4S C;  4XX5 A;  2E3T A;  5TR5 A;  3TMP B;  2MSE D;  4DHZ E;  1SE4 A;  3IT4 B;  2KOX A;  2C5L C;  1XLN A;  2KDE B;  4KIK A;  2RDB C;  1WGD A;  2JVC A;  4DHZ B;  3AE1 B;  1UBQ A;  1ZDX A;  4NQL B;  2WXN A;  3IAM 1;  1T0Y A;  4MH0 E;  2CHZ A;  1C79 A;  3IBE A;  2RMM A;  5KHO A;  2Z8L A;  3QHT A;  4A6Q A;  2WXF A;  3P63 A;  3NS8 A;  3OJ4 B;  4PS8 A;  3R2T A;  2DAF A;  2KMM A;  4NQK E;  2MP2 B;  1TJE A;  2QEJ C;  1Q5W B;  1D6E C;  1ENF A;  1V1P B;  3DBS A;  3ZTD A;  3PT2 B;  2WU2 B;  4A3O A;  3ZXR A;  1GC6 A;  4DQO C;  4C4V A;  4FJZ A;  2MHJ A;  4QAY A;  2WXR A;  3V62 A;  4JE3 B;  1KJT A;  2WYQ A;  2INP E;  4NPN A;  2CHW A;  2GRI A;  1KFY B;  3VH3 B;  1CQV A;  4FUL A;  3QIJ A;  4W9K A;  2B76 B;  1WJ4 A;  1SGH A;  3DWM A;  3VTW A;  1JWA D;  1HZ6 A;  4GDK A;  2DAJ A;  3MHS D;  2JYE A;  4AP4 C;  1L6V A;  3K9P B;  3QQ8 B;  3AE6 B;  3NVW A;  4DWF A;  4HRS A;  3MC9 A;  3DBH I;  3KUZ A;  1N60 A;  2QJL A;  2JWU A;  3GZN I;  4CYE A;  1QOG A;  5JZE B;  2G45 B;  3SDL C;  1SE2 A;  4ICU A;  4ZHO A;  2MRP A;  1LFD A;  3DDC B;  4HPM B;  1C4P A;  2WXG A;  1QQR A;  4KV2 A;  3ZKJ C;  1YN4 A;  2BYT A;  2N9L A;  1TT5 B;  3RUI B;  1E8W A;  3ML9 A;  2MX2 A;  4KGR A;  5L95 C;  3CIR B;  4RGM A;  3IHP C;  3PRE A;  4NJ6 A;  2OHF A;  4K7U A;  1GNU A;  2ZNV C;  3BY4 B;  3D32 A;  2IDY A;  1IPG A;  1NYQ A;  1V86 A;  2BS4 B;  1DOX A;  4ZDV A;  1V5T A;  2FUH B;  3RFZ B;  3ZJU A;  3T3O A;  2MW5 A;  1YN3 A;  2LHE A;  3ZJT A;  2WP9 B;  1MG8 A;  4JPS A;  2LZ6 A;  5D7G A;  1F52 A;  1C9F A;  5BMI A;  3A1Q B;  1F2R I;  2RR9 A;  4KX6 B;  5LXI B;  3M63 B;  2LMC A;  1AYF A;  2O6V A;  3IVF A;  4OZC A;  2M1M A;  5E6P A;  3AE4 B;  1P7E A;  4FBJ B;  1L4Z B;  3BII D;  2SEB D;  3CSF A;  3VR9 B;  1EWC A;  2J0M A;  1I35 A;  4XGA B;  1QIL A;  1V97 A;  4YTN B;  4USA A;  3VVW B;  2WXO A;  2KAN A;  1ET6 A;  5DPR A;  2HJ8 A;  2W3R A;  3DBL B;  5HI1 A;  2BYV E;  3N30 A;  4ZYN A;  4RGT A;  1R4N I;  2AWT A;  2MQJ A;  1SE3 A;  2J52 A;  2K8B A;  2XK5 B;  2LGX A;  4IG7 B;  1OEY J;  2KNB A;  2G4D B;  1N61 A;  1J7B A;  2V0G A;  2O2V B;  3RNB C;  2A4Z A;  5EE0 A;  3TEW A;  2VZK B;  2KWV B;  1KTK A;  2K25 A;  5G5H A;  1TS4 A;  1WYW B;  2WXJ A;  4YXD B;  4NJC A;  2KX0 A;  4BKS D;  3BYT B;  1WXS A;  1JRO A;  5CX3 A;  1YQB A;  4HLE A;  1HZ5 A;  2FIF A;  2IZV B;  4P1C C;  3W5U B;  3LDZ E;  3Q2A C;  3GZN B;  1RM6 C;  3JSV A;  3PRM B;  3VRB B;  3W5V B;  1J8C A;  1YN5 A;  5HFY A;  4A55 A;  1XT9 B;  1E8X A;  5FK9 C;  3UQA A;  3V60 A;  2GBK A;  3MHZ A;  2WXH A;  3ZNI D;  2FCM A;  5BMG A;  3W2D A;  1KF6 B;  3PSE B;  3HM3 A;  5BYS A;  4BOS C;  1C4C A;  1NBF C;  4HCP B;  1CZP A;  3WAN A;  4D2K A;  2M19 A;  4FHK A;  3BWU D;  2QC8 A;  4BBN C;  4B6W A;  2RPV A;  5AEK B;  1WFY A;  4KSK C;  3AEA B;  2ACZ B;  3APC A;  3B2G A;  4O1N A;  2BVC A;  2YLM A;  4S17 A;  4BAX A;  3A9J A;  2L76 A;  4NAW A;  1WZ3 A;  4XDC A;  3WCQ A;  3NS1 A;  2KZR A;  4P7I A;  1VLB A;  3AU5 A;  3VFK A;  5G2N A;  5IA7 A;  3HVD A;  4N9F 4;  1ZE3 D;  4EZK A;  2KQ7 A;  4MGI E;  1WM3 A;  1T0Q C;  1QZE A;  2KJ6 A;  1EF1 A;  4LLG M;  2M56 B;  1VD2 A;  1QLB B;  4CHK A;  3NVY A;  1E8Z A;  2NTT A;  2KWD A;  2PVG C;  5E6O A;  2KLC A;  5D6J B;  1RWS A;  4AJY B;  2GOW A;  2YVC A;  3ZNH B;  2LHD A;  1CK1 A;  3P42 A;  3RPF C;  1R4N B;  3S2A A;  1GAQ B;  1T0S C;  3PO0 A;  1NVI D;  4RFB A;  1ACC A;  3EGR A;  3E56 A;  3U52 E;  2QCZ A;  3NVV A;  3L08 A;  1E7U A;  3DBR B;  3PZ8 A;  3PVL A;  2OOB B;  2EKE C;  4E71 A;  2DLB A;  3RNA C;  4IM0 A;  2MJE A;  3X23 A;  1UZX B;  2JQR B;  1D5Z C;  1SB3 C;  3URY A;  4HKZ E;  3W1S C;  3ALB A;  1T5X D;  3ZTC A;  4XYC A;  2GLS A;  3LXF A;  2MBB B;  3NHE B;  4MGK E;  1T6B X;  2N7E A;  4NZL B;  5LXH A;  2LRU A;  1H8C A;  3BZD B;  2ZPN A;  4FHJ A;  2LFI A;  2KN5 A;  1H4R A;  1V1O A;  2ZVO A;  3BVG A;  1MHH E;  2V4I B;  4KZ0 A;  2ASQ A;  4RMA A;  2BWE S;  3W1S A;  1LO5 D;  3AMZ A; 
#chains in the Genus database with same CATH homology
 1XLP A;  3I9V 1;  4RH6 A;  2TSS A;  1EWY C;  2JYT A;  2E3T A;  4WWM A;  1ZDV A;  1YJI A;  4IOI E;  2W55 A;  1SE4 A;  3IT4 B;  1DOI A;  2KN4 A;  1XLN A;  2IGD A;  1QKZ A;  2PLP A;  2EKI A;  1GOZ A;  3PZ7 A;  2JX5 A;  4WUR A;  2Y3A A;  3W9C B;  2WDV B;  3AE1 B;  3H8H A;  3GP7 A;  2N9K A;  1ZDX A;  1I4G A;  2WXN A;  2MJ3 A;  1UWX A;  1ZXI A;  3CWI A;  3TEX A;  3IAM 1;  1NYR A;  1VDV A;  2I38 A;  4C7Z A;  1PYW D;  1P7F A;  1F77 A;  3EUB 2;  1MPE A;  2ICI A;  2BB6 A;  1C79 A;  1ESF A;  3Q8A A;  2RMM A;  1VZ7 A;  1OQR A;  3AEF B;  5BMH A;  4TMA B;  1C78 A;  2Z8L A;  4J3O D;  2QMT A;  4A6Q A;  2WXF A;  3HRD D;  3UI3 A;  3P63 A;  2WLB A;  3R2T A;  1F2R C;  3AN1 A;  2KMM A;  3EA6 A;  2YEP F;  2X38 A;  1D4B A;  1TJE A;  2QEJ C;  1D6E C;  1ENF A;  1V1P B;  4LK0 M;  2ZW1 A;  5BYR A;  4KKI A;  1OFF A;  1OQQ A;  1HXY D;  2G9H D;  2QIE B;  2WU2 B;  3Q8C A;  1VR9 A;  2RDH A;  1BXT A;  4TQ0 A;  1J7A A;  1FRR A;  3R2I A;  2L52 A;  4NAM A;  1E6E B;  1FFU A;  1STE A;  4DQO C;  2DYM A;  1FIQ A;  2WXR A;  4ARC A;  1JW9 D;  4JE3 B;  2INP E;  3ZJV A;  2GB1 A;  2LJI A;  1QOB A;  2FE8 A;  3AH7 A;  4ZOH C;  1FNW A;  4YTP B;  1AN8 A;  1IBX A;  5I4D A;  2GRI A;  2LEK A;  1RFK A;  1KFY B;  3U2S C;  1XXG A;  3AE8 B;  1CQV A;  1FXI A;  3FIL B;  1KLG D;  3AEG B;  4AQ7 A;  2B76 B;  3ZQ4 A;  1I4R A;  3DWM A;  5HG2 A;  1JWA D;  1HZ6 A;  3P4S B;  1YNT E;  5D3D A;  1FNU A;  4XWT A;  2QSD A;  3AEC B;  1JML A;  2JYE A;  2WQY B;  4RNA A;  5EE3 A;  1KH0 A;  5LNK 1;  1NEN B;  2WU5 B;  1B9R A;  1SF0 A;  3ETR A;  1L6V A;  2WXL A;  1AWD A;  4TQ1 A;  4MAC A;  1PGX A;  2HDE A;  4XE0 A;  3B2F A;  3AE6 B;  1UNS A;  2Y5P A;  3NVW A;  4ZHP A;  4IKG A;  2Q5W D;  4HRS A;  3HVZ A;  4ARI A;  1NI3 A;  1N60 A;  2BBC A;  2QJL A;  2WXQ A;  2JWU A;  2L83 A;  1C76 A;  1QOG A;  1FM0 D;  2AQ1 B;  3AE5 B;  1TS5 A;  4C80 A;  1K53 A;  1SE2 A;  1WXQ A;  2L1A A;  4YSX B;  4ZHO A;  3AM9 A;  4NAW B;  1C4P A;  2WXG A;  4EE2 A;  1CJE A;  2IGG A;  1QQR A;  1KRH A;  3TSS A;  3LB8 C;  3KWL A;  1YN4 A;  1FRD A;  2BYT A;  2N9L A;  4GLS C;  3AV8 A;  1FMA D;  2HTM E;  4KGR A;  3TEZ A;  4ZYS A;  3CIR B;  4RGM A;  1TYG B;  2DWQ A;  1TKG A;  2OHF A;  2GI9 A;  1BML C;  2IDY A;  1NYQ A;  1FCC C;  3MC0 B;  3O13 A;  1GPX A;  1KLU D;  1VJK A;  2BS4 B;  4B0M A;  1DOX A;  4WAF A;  2CU3 A;  5D3I B;  2PTL A;  2E6X A;  1QOF A;  3RFZ B;  4H2A A;  3ZJU A;  2WXM A;  3T3O A;  3SFE B;  1JCK B;  3FAH A;  1E7P B;  1YN3 A;  2LHE A;  2RDG A;  2WXK A;  4OVZ A;  4YT0 B;  2H89 B;  1MI0 A;  2WP9 B;  2I2Y A;  1D5X C;  4JPS A;  1VZ8 A;  1ZOY B;  3MJ5 A;  1TKE A;  1E10 A;  3VR8 B;  2WS3 B;  2LUM A;  5D7G A;  5C2T B;  1N62 A;  3AB5 A;  4GDL B;  4OHJ A;  3P4Q B;  5G5G A;  5C3J B;  4ZRQ A;  1C9F A;  3DWG C;  5BMI A;  1DGJ A;  5JXV A;  3BYY B;  3MFG A;  2DYO A;  1F2R I;  4KX6 B;  1JWU D;  1FO4 A;  1JQ4 A;  2LMC A;  2FBW B;  1AYF A;  2CJO A;  4OZC A;  3SFD B;  1IBX B;  5H92 C;  4AS1 A;  2W82 A;  3P4P B;  1D5M C;  2AQ2 B;  2N0S B;  1XCQ L;  3AE4 B;  5HHD G;  1P7E A;  1ZP0 B;  3L4P A;  2R61 A;  1L4Z B;  3BII D;  2SEB D;  3C8Y A;  3IT6 B;  1EWC A;  1SXT A;  4N58 A;  4UDU C;  3VR9 B;  1DOY A;  4RF0 A;  1SJH D;  1QIL A;  3NRZ A;  1EU4 A;  1V97 A;  4YTN B;  2IGH A;  3V3X A;  4GDK B;  2K5P A;  4USA A;  1FXA A;  2FUG 1;  3T3N A;  2WXO A;  1ET6 A;  1YJJ A;  4HRO A;  3Q8F A;  3V05 A;  2W3R A;  3NZ3 A;  4RF1 A;  5HI1 A;  3HUI A;  3TUO A;  4RGT A;  3AE2 B;  1GB4 A;  3ZYY X;  1SE3 A;  2J52 A;  1JWM D;  4L1B A;  1FD6 A;  1L6U A;  1UWM A;  1MHX A;  5AUK A;  1XCT L;  4KKJ A;  1N5X A;  4LTU A;  5GXG B;  1T3Q A;  1N61 A;  1J7B A;  3GS2 A;  1UUP A;  2V0G A;  2V3N A;  2CJN A;  1I7H A;  5EE0 A;  1XF5 L;  2VZK B;  3TEW A;  1KTK A;  1Y56 A;  5G5H A;  3U4E G;  1TS4 A;  4US8 A;  3AE3 B;  3NUH B;  2G1E A;  1FFV A;  2WXJ A;  3N9Y C;  4YXD B;  1XO3 A;  4NJC A;  3KWV A;  1A70 A;  4CQN A;  1F0Z A;  2JU6 X;  2YEP B;  3BYT B;  3MP9 A;  3P1M A;  4XWW A;  2BT6 A;  2KAC A;  4OZA A;  3ABV B;  1BUI C;  2PIA A;  1C77 A;  1JRO A;  3NVZ A;  1PGB A;  3SEB A;  2IPK D;  1TY2 A;  3J9C A;  1HZ5 A;  1I4X A;  1WSP A;  4WIP A;  4WH4 A;  2KDM A;  2ONQ A;  4L2Y A;  4WQM A;  1JAL A;  4B0E A;  1GB1 A;  5BYQ A;  3LYY A;  4C7Y A;  2N7J A;  1PFD A;  3W5U B;  2MEK A;  4FXC A;  4XDD A;  1I4Q A;  2PKO A;  5EE1 A;  1RM6 C;  1TS3 A;  1RYJ A;  4N59 A;  3VRB B;  2K22 A;  1N63 A;  3W5V B;  4MH8 A;  2XNA C;  1IGC A;  3Q69 A;  1YN5 A;  5HFY A;  1WGK A;  4A55 A;  2KAJ A;  3AED B;  2ZW0 A;  5FK9 C;  1L0X B;  1M4V A;  2JZP A;  1J7C A;  2XN9 C;  2DBY A;  3MHZ A;  2EEL A;  1MVK A;  2WXH A;  2H88 B;  3BK2 A;  5BMG A;  3W2D A;  1KF6 B;  2MH7 A;  3R8B A;  3E9S A;  2Y5C A;  2QIL A;  1K52 A;  2D5G A;  4A8X C;  2PVO D;  5BYS A;  3TEY A;  1DYQ A;  3ZGZ A;  2WXI A;  1FEH A;  1C4C A;  1WRI A;  2NTS A;  2VZK D;  1CZP A;  1ZPS A;  4D2K A;  2OED A;  1K51 A;  2M19 A;  2SAK A;  4OW0 A;  3ZJT A;  3BWU D;  1L4D B;  2WXP A;  3VRA B;  4HEA 1;  5FKA C;  2WNM A;  2JSV X;  3AE9 B;  2AQ3 B;  2RPV A;  3VQI A;  5AUI A;  4US9 A;  4JX1 C;  3Q8B A;  1JWB D;  2ACZ B;  3AEA B;  3GB1 A;  4C56 C;  3B2G A;  2KQ4 X;  4O1N A;  4DXF A;  1IUE A;  4A9A A;  1QOA A;  1ROE A;  3KQ4 A;  1PUT A;  2BW2 A;  1HEZ E;  2JXT A;  3BK1 A;  4XDC A;  3WCQ A;  2J4X A;  3NS1 A;  4REZ A;  2J53 A;  4RGO S;  2W3S A;  2W54 A;  4Q2J A;  1PGA A;  1B1Z A;  1HA5 A;  1VLB A;  1L0Y B;  2L32 A;  1PDX A;  1N5W A;  2INN E;  3HVD A;  4KGS A;  1E9M A;  1ZE3 D;  3I57 A;  4IDI A;  1FCL A;  2LGI A;  3AEE B;  4LLG M;  1XLO A;  2M56 B;  1QLB B;  4PT5 A;  2J42 A;  3NVY A;  1HQR D;  3SR6 A;  2NTT A;  4HKQ A;  3BVM A;  2KWD A;  2PVG C;  1AW7 A;  4YSZ B;  4MT5 A;  4YWG G;  1RWS A;  4JWU C;  1TS2 A;  2AX5 A;  1WWT A;  2LHD A;  4RGN A;  1L5P A;  2BS2 B;  1R7S A;  1VZ6 A;  1CK1 A;  2K9X A;  1ZUD 2;  5T8I A;  3P42 A;  1WYG A;  1E0Z A;  3RPF C;  3AE7 B;  2IJ0 A;  1L0V B;  2MJD A;  2NMQ A;  1GAQ B;  3PO0 A;  1NVI D;  4RFB A;  1TY0 A;  1ACC A;  1FNV A;  1UGJ A;  1SIJ A;  3E56 A;  3EGR A;  1NEK B;  4HJG E;  3U52 E;  3AEB B;  4KGT A;  4ZRP A;  2K0P A;  4RCO A;  4DXG A;  3NVV A;  2PW9 A;  4L23 A;  1K50 A;  3U7Z A;  1Q10 A;  4MM3 B;  1JWS D;  3BVZ A;  1SSN A;  4M0W A;  1XLQ A;  3PZ8 A;  3KLS X;  1V1P A;  1ZXH A;  2DLB A;  3Q8E A;  3OWE B;  2MJE A;  2V3P A;  1QT9 A;  2JQR B;  1D5Z C;  1SB3 C;  1V8C A;  5EE9 A;  3URY A;  1ET9 A;  4P6V F;  3FC4 A;  4A90 A;  4YTM B;  4HKZ E;  1VRA B;  4JWS C;  1T5X D;  2PMV A;  5H8Y E;  4YSY B;  5TSS A;  5E6J A;  1SEB D;  5FR3 A;  1I4P A;  1JRP A;  2K3U A;  3LXF A;  1T6B X;  4NZL B;  1I4H A;  2WDR B;  3IAS 1;  2BB5 A;  1QF6 A;  1SBB B;  3P4R B;  1EU3 A;  1YQ3 B;  2BS3 B;  4ITK A;  3BZD B;  4OZB A;  3B9J A;  4N6E B;  1YMH E;  1SJE D;  1TKY A;  2WDQ B;  3FIL A;  4P16 A;  1C4A A;  1YQ4 B;  2ON8 A;  2LFI A;  4TSS A;  1V1O A;  2BTE A;  3BVG A;  1TZO A;  4R3D A;  1MHH E;  1IGD A;  5MPO A;  2V4I B;  3IXS A;  2M0A A;  3W1S A;  1LO5 D;  1XEE A;  1EM7 A;  3AMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...