1DOXA

1h and 15n sequential assignment, secondary structure and tertiary fold of [2fe-2s] ferredoxin from synechocystis sp. pcc 6803
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
96
structure length
96
Chain Sequence
ASYTVKLITPDGESSIECSDDTYILDAAEEAGLDLPYSCRAGACSTCAGKITAGSVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCTIETHKEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN [2FE-2S]
publication title 1H and 15N NMR sequential assignment, secondary structure, and tertiary fold of [2Fe-2S] ferredoxin from Synechocystis sp. PCC 6803.
pubmed doi rcsb
molecule tags Electron transport
total genus 12
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 1995-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1doxA00
1VDVA 1YJJA 2OHFA 1XLOA 2EKIA 2WP9B 1R7SA 1GAQB 1QOGA 3BIID 4N6EB 1QF6A 2BT6A 1L6UA 3AEAB 1KFYB 5AUIA 1JWBD 4C80A 4YT0B 1AWDA 3P4SB 2PVGC 1WWTA 3AEBB 1T3QA 3SR6A 3EUB2 1N5WA 1TYGB 4FXCA 4YSZB 1ROEA 2M56B 2JQRB 3P4QB 3AE4B 5H8YE 1FO4A 1JROA 1VLBA 2HTME 2QJLA 3NS1A 2H89B 1NENB 3FAHA 1E9MA 2G1EA 4N59A 1N62A 1JWAD 1RFKA 2WDRB 2CJNA 3NRZA 4WQMA 1N5XA 1ZP0B 1ZXIA 4IDIA 2LEKA 4US9A 2K9XA 3VRAB 1F0ZA 1XLNA 1B9RA 2W54A 1OQQA 1N63A 1QOBA 5AUKA 1FIQA 3B2FA 1E0ZA 5G5HA 4JWSC 5C2TB 4YSYB 4JX1C 4P6VF 1NYQA 2Q5WD 2JX5A 1L0VB 2PVOD 2DWQA 3AE5B 4YTNB 4ZHOA 1A70A 1JW9D 2KMMA 1VJKA 1RWSA 2ACZB 3PO0A 2W55A 3AE1B 4N58A 4WWMA 1L6VA 1CJEA 3AE6B 3W5UB 2PIAA 3VR8B 1CZPA 1SF0A 1JRPA 1SB3C 1J7BA 2L52A 1ZOYB 4C7YA 3AEDB 4YSXB 4US8A 1XO3A 2QIEB 3AEGB 5GXGB 3P4PB 1E6EB 1WGKA 3CWIA 2MJDA 3LB8C 3VR9B 1JQ4A 3NVVA 3RPFC 1TKYA 4HRSA 1N60A 2MJ3A 1QLBB 3AV8A 3W9CB 1JALA 1AYFA 1PDXA 2WU5B 3ZYYX 1RM6C 3HVZA 2AX5A 1FFUA 1ZUD2 4KX6B 3L4PA 1TKGA 1J7CA 2W3RA 1QT9A 3AB5A 5EE3A 3SFDB 5MPOA 3DWGC 2DBYA 2BS2B 2CJOA 3KWLA 3P63A 2MJEA 1IUEA 2CU3A 2WDQB 5EE1A 1V97A 1FXAA 3P1MA 3VRBB 1E7PB 1SIJA 2BS3B 1EWYC 5EE9A 1KF6B 1NI3A 1UWMA 2W3SA 4USAA 1J7AA 3AE2B 3NVZA 2MH7A 3AEEB 1TKEA 1E10A 4JWUC 3AECB 2E3TA 1OFFA 1DGJA 3FC4A 3HRDD 3AMZA 3ABVB 1XLQA 2BS4B 1WYGA 2L83A 2K5PA 3HUIA 3B9JA 3W5VB 1NYRA 2N0SB 3B2GA 4HROA 2WU2B 2WDVB 5C3JB 1DOXA 1WRIA 3CIRB 1YQ3B 4ZOHC 1DOYA 3SFEB 4C7ZA 2Y5CA 4A9AA 4LTUA 4ITKA 2WQYB 2KAJA 4ZHPA 1RYJA 2B76B 2M19A 3NVYA 3DWMA 4YTMB 1GPXA 1OQRA 3ETRA 2K22A 1QOAA 5H92C 1YJIA 3LXFA 3WCQA 1NVID 1KRHA 1PFDA 1V8CA 1TJEA 3AM9A 1N61A 1FM0D 1WXQA 1FXIA 1L5PA 1QOFA 3AE8B 3AEFB 3NVWA 2FBWB 3AE7B 3AN1A 1NEKB 1I7HA 1FFVA 1PUTA 2WLBA 3AH7A 3P4RB 1FRRA 4YXDB 2H88B 1FRDA 5G5GA 4YTPB 5EE0A 1YQ4B 2PKOA 2WS3B 1XLPA 1FMAD 1DOIA 3AE9B 3AE3B
chains in the Genus database with same CATH superfamily
4N6EB 2R2OA 3V6CB 1LM8B 2BF8B 3N9YC 1D6EC 5CHFA 5AZGA 1N5WA 4DDGD 2GMIC 1HXYD 3Q8CA 2K1FA 3RFZB 4EOYA 3FAHA 4K7WA 4FADA 3Q3OC 1RFKA 1VCBA 1JCKB 2OOBB 4F8CB 3Q69A 3T8MA 3RNEC 2KLGA 3DDCB 5AUKA 2RGFA 2MWSB 2INCC 4YSYB 1XF5L 3RT3B 1IBXA 2FUHB 3Q8EA 3ZRCA 1C4PA 2WXQA 3IHPC 2KHWB 1MJDA 3JYUA 3LJ3A 4DBGA 1HQRD 1CZPA 1K51A 3NS8A 3BYTB 3HM6X 1XO3A 5IOIA 1ZKHA 1TT5B 2KFKA 1JQ4A 2WXPA 2D5GA 4HRSA 3UGBB 4DXAB 1P7EA 3I63C 3N1ZC 2JYTA 1DOXA 1OGWA 3ZJUA 3R2IA 3WAPA 1FCCC 2AQ3B 3P42A 2MRPA 2E3TA 1OFFA 1D5XC 1WYGA 2L83A 4LNNA 4J3OD 2KDEB 2XK5A 2K8HA 3PZDA 4L23A 1WI0A 4ITKA 1YJ1A 2A5UA 2NCNA 2K3UA 2ZVNA 2WX1A 4GU2A 2KDMA 2WYQA 4ANWA 1QOFA 3WALA 1E8YA 4MACA 2I1KA 4XDCA 4B6WA 3VAWA 3OJ3A 4NAWB 5GMVA 5AUIA 1A5RA 3JSVA 3DHHC 1P3QU 3TSSA 4BOZB 1Q1OA 2FCNA 2CU1A 5JH5C 3MC9A 1FO4A 1TZOA 4C4VA 2KXJA 4GGQA 3R7RA 1FD6A 1LQBA 3ZIMA 5BMIA 3DPDA 4WQMA 3OLMD 1YX6B 2IO2B 4IWPA 3HHMA 3RD2A 3R3MA 4NAMA 5CTRC 2JZZA 2NBUA 5G5HA 2L76A 4P6VF 4P7IA 4YTNB 2KMAA 4NNJB 1RWSA 2BKRB 1C4CA 4MDKE 3IFWB 2KK8A 2L52A 1L4ZB 4I6LB 4DWFA 1FNWA 4XZ4A 3ZKJC 1N60A 1R4MI 2X38A 1WXSA 1AYFA 3HVZA 1CQVA 2AX5A 1FFUA 4E3CA 5MPOA 1ZDVA 2BS2B 2ASQA 1IUEA 2HJ1A 4II2B 1UWMA 3H7PA 5DPRA 5E6PA 1SXTA 1WFYA 4IWQA 2DAJA 4NQKE 5BMGA 2PLPA 3X23A 3Q8FA 4W9LA 4ANVA 2WDVB 3APCA 2BVCA 2GOWA 2YVCA 4AUQC 4IM3A 2PPHA 2D11A 2HTHA 5LLIA 3ZJTA 1T0YA 3NVYA 1C4AA 4IM0A 4NJCA 3HK0A 1FXTB 1D5MC 2R61A 1KH0A 3ZNGC 4KDLB 4HWIB 2V4LA 4GSWA 1YQ4B 1FNVA 4RGNA 4HJKA 3GZNB 1YJJA 4MGZE 2QEJC 2AL6A 2BT6A 2SAKA 3W1SA 1IPGA 3NY5A 3H7SA 3B1LX 2KC2A 2M8SA 4FXCA 3P2BA 2KN5A 1EM7A 3QHTA 2LFIA 2LXAA 1I4QA 3Q3NC 1WXVA 3TMPB 3DBHB 2XNAC 4JPSA 2KO3A 3TCAA 3IXSA 4TMAB 4LDTD 3PO0A 3CSFA 2MA9B 5FKAC 2KANA 2BW2A 3H6NA 2N9XA 3JSVB 4JQWC 3GP7A 3H9DA 2WGSA 3DVNV 1EF5A 3W9CB 2QHOA 2L3ZA 1P1AA 3MP9A 2YEPB 2KACA 2ZCCA 4BOSC 3AB5A 1QT9A 5EE3A 3VTWA 2MJEA 3N3KB 2KWVB 3PZ8A 3R2TA 1G6JA 3L13A 4M00A 2FE8A 2BS4B 3A9KB 1SEBD 2KFJA 4ACFA 1NYRA 3B2GA 2IY0B 2GBRA 4FA6A 4RMAA 2V3SA 4D2KA 2BB5A 4HJGE 2K39A 4ASWC 1OQYA 2B76B 2DENB 2DX5B 1UGMA 1V8CA 1KLVA 1V1PA 1FXIA 3AEFB 3N30A 1WH3A 1NEKB 2IZVB 4OVUA 2J52A 1OTRB 3T3NA 2PKOA 1FPYA 1F77A 3PHWB 3I57A 3BIID 3MHSD 3ZO5B 4FN2A 2XBBC 2NPTA 1UELA 1Y56A 4HDQA 2J42A 4TUUA 4YWGG 4OZBA 3SR6A 1WZ0A 4HCPB 3DBLB 3Q8AA 2JUOA 3QCAA 3V62A 2CJNA 1SBBB 1YD8U 3U7ZA 3RUIB 4HCNB 5E6NA 1Y8RC 1FIQA 3B2FA 4JL9A 4M02A 4GN1A 4JX1C 2QMTA 3UF8A 2ZPNA 2KDIA 4WH4A 3R7QA 4S17A 4Q2JA 4A3OA 1WM3A 2MW5A 4WJOA 1UGJA 1E6EB 4W9GA 2N7EA 4WAFA 2D3GA 3QX1A 2B3AA 2WU5B 3ZXRA 4KVGB 2A4ZA 1JWMD 2W3SA 3AEEB 2PJHA 4MJSB 3FC4A 2ZVOA 4OVVA 1ZXHA 2AQ2B 1Q5WB 3URYA 3Q3MC 2X8XX 1RFAA 2VH1A 3OAWA 1C1YB 4TKNA 2FIFA 4URKA 4DHJD 1UH6A 4O1NA 3MJWA 4G0NB 3AE7B 4PS7A 2H88B 5G5GA 1L4DB 3QC8B 2LGDA 4BKGA 1UD7A 2DBYA 2OHFA 2WP9B 3B08A 1QOGA 1QF6A 4BKSA 2O6VB 2UU7A 3RI7C 3NUHB 4ICVA 2BTEA 3TL5A 4EZKA 2JVCA 3L17A 3NS1A 2D07B 4RNAA 2KLCA 4WIPA 1C3TA 1J0GA 2LRWA 4GLSC 1E7VA 2NBWB 3FILB 3CMMB 4CQNA 1J19A 4E71A 3NZ3A 3TIXA 4BKSD 3JW0X 3AE5B 1VJKA 1S1QB 2LMCA 1WGRA 2V9HA 1WX9A 2D3AA 4A6QA 4HKQA 3P4PB 4GB9A 1QLBB 4OVZA 2BKFA 4FJVB 1V49A 5L83A 2CU3A 1XEEA 2BYFA 3EC8A 4QAYA 3JVZX 4GOCA 5J17A 3A33B 2K5PA 3W5VB 2CHWA 1UBIA 3ZXVA 1K52A 3ML9A 4OW0A 2KVZA 2KJHB 3T9LA 4XX5A 2M19A 1QOAA 4LNFA 1PFDA 1FM0D 4NAWA 2JF5A 5CHWA 5I4DA 3AN1A 2WLBA 5JHBA 2KX0A 1YIWA 4YXDB 4CHKA 2K8BA 2BYTA 3BY4B 2M1MA 4YTPB 2DNFA 1WE6A 1GAQB 4HXDA 3QK0A 2WXJA 4YT0B 3DHIC 4W9JA 3MHZA 4MGYE 3AEBB 1T3QA 4G3XB 2MX2A 2L8JA 1TYGB 3IT6B 1WRDB 2CHXA 2H89B 4C00A 1NENB 5BYRA 1WE7A 2JXTA 2OEDA 3VRAB 2LD9A 1XLNA 1ET9A 1WJ6A 5IAAC 2KC1A 1WJNA 2FCMA 1KLUD 1E0ZA 5AZHA 4EUTA 4PK1A 2JWUA 2J0JA 4XWTA 1NYQA 2Q5WD 3L54A 2TSSA 1JW9D 4EFOA 5D3IB 4RF1A 3TEXA 2RPVA 5D3DA 2KZRA 3TEWA 1ENFA 2IY1B 2J7QB 4FJZA 2I38A 3Q2AC 4KKJA 1PDXA 2W82A 4IUMB 4TSSA 3KUDB 1AN8A 3RULA 1JWUD 3K9PB 4ZYSA 3H1UA 3DVNU 4LJOB 2KQ7A 1ZPSA 4HK2A 2WDQB 3MTNB 3J9CA 3M3JA 2BS3B 2MBEA 4DHZE 2LRUA 1E10A 3AMZA 1XLQA 1KTKA 2AWTA 1WXMA 4W9HA 2V0GA 2JRHA 3ZNID 5TSSA 1MVKA 2BGFA 1DOYA 4A9AA 3MC0B 2KAJA 1LGRA 1TS4A 4KV2A 1GPXA 2I1JA 4G50A 3ETRA 4W9KA 3ONSA 2L32A 4AJWA 1VRAB 2ZPYA 3DQVA 2BWES 3P4RB 1VZ8A 3QARA 2D10A 4B95A 2LI5A 3L0WB 3V6EB 2N1VA 1L6UA 2N9EB 1KFYB 3UIOB 3PREA 3P4SB 1YX5B 2WXGA 2LUMA 3EUB2 4ARIA 2JWZA 3VTVA 1UBQA 1WJ4A 2ZNVB 3W2DA 2HTME 4A20A 3ZNHB 1QZEA 3PPAA 4BFRA 4TQ1A 2N9KA 3L16A 4K1RB 2M4NA 2WHIA 3TBLD 1QOBA 2NVUI 4JWSC 2INDC 1HTQA 2NTTA 2PVOD 3NZUA 4KGSA 1A70A 2KMMA 5G55A 4N58A 4FHJA 3W5UB 1WX7A 3VTUA 1NI2A 4P1BC 3AEDB 1H4RA 2KTFA 3RPFC 4DXGA 3QWZB 2AEHA 2KNBA 4IG7B 2W3RA 1EU4A 1E7UA 3A9KA 2INNE 2CJOA 2N7DA 3RZWC 1GC6A 3BZDB 1C76A 3UIPB 2VZKB 3NVZA 2IYDB 1WGHA 2RDBC 3AU4A 2M0XA 3H8HA 4HDOA 3BK2A 1UF0A 1LO5D 2FIDA 1YNTE 3MC8A 1NDDA 2KWDA 3U8ZA 2NBVB 4ARCA 4BVUC 2UWQA 2K0PA 3ZDMC 2ZW1A 4RM9A 1RLFA 1N61A 1E90A 1WXQA 2BQQA 3A9JB 1IYFA 1FRRA 3W1SC 3AU5A 1FMAD 2Z0DB 2K6QA 2FUG1 4MM3B 4RGOS 4WJQA 2RDGA 3DBRI 4S0RA 1NBFC 1C9FA 1AWDA 1U4AA 2AYOB 2Z59B 3WIMA 1LFDA 2JY6A 3RNBC 2C60A 5KHOA 4MGKE 2DYMA 1WX8A 3DVGY 1ET6A 4WURA 4W9EA 1ZP0B 2WXLA 2D3BA 4UDUC 3TJPA 1F0ZA 2JYEA 2LGIA 4WQOB 1T0SC 4NY0A 1VD2A 1TZ1A 2KWCA 2XEWA 5C2TB 3DVGX 4KKIA 2JX5A 1V86A 2IGDA 4FLHA 1SF0A 2D2QA 2BPSA 4I6PA 1YOVB 1X1MA 4II3B 3A4SC 3U7DA 4ZRJA 3ZYYX 3ZDTA 4MJSA 3MJ5A 4W9FA 2J0KA 5IP4D 2VH2A 5EE1A 3P1MA 3VXWA 3RNGC 2LASA 3RYTA 4AS1A 2GBMA 1NI3A 4B0EA 2WDTB 3AE2B 2KQ4X 4JLCA 4IM2A 3AECB 4R3DA 4RF0A 2PMVA 3WAMA 2JT4B 3NJTA 3HUIA 1GNUA 1GB4A 4YL8A 1E8XA 2OJWA 3BVMA 2G9HD 4KGRA 4LTUA 1KLGD 1WGDA 1F1HA 1WR1A 4PT5A 3ENEA 2GI9A 1YJIA 1T0RC 1TJEA 2BB6A 2O6VA 4HPMB 4PYUA 4BAXA 3SD5A 1PGBA 2VRRB 4K3CA 1WGGA 3AE9B 4KDIC 4US9A 4ZDVA 3BK1A 5E6OA 2REXA 4AJYB 1F2RC 4DK5A 4FULA 2L0FA 4DHZB 1ACCA 3N1YC 1XD3B 3FILA 1ROEA 3L10B 3ML8A 1MI0A 2O6VD 1J8CA 2RMMA 1I42A 1N5XA 3UQBA 4ICUA 3M95A 4BBNC 4ZRIA 3KLSX 5G2NA 1R4NI 1YN5A 2K25A 1F2RI 3CF6E 2IO3B 3PVLA 1JMLA 1WZ3A 2L00B 1P9DU 2PIAA 1TIFA 3A1QB 3VR8B 1JRPA 1WIAA 1TY2A 1T6BX 1WM2A 5DPTA 4DQOC 1WGKA 2Z8LA 4LCDE 1EWCA 5HG2A 1R4MB 4F1SA 3DOWA 2FNJB 1ZUD2 2AL3A 3P63A 1PYWD 3VH3B 3PRPB 1ZE3D 1N6ZA 2GBJA 5JHAA 3LYYA 3APDA 4ZRPA 3PLUA 3HRDD 2QC8A 1V9JA 3FKYA 1ZGUB 2LVQA 2L05A 5C3JB 1WRIA 2GB1A 3SFEB 3KYDD 3PT2B 2G4DB 1OQRA 1IP9A 1I35A 2KTRB 3U52E 1NVID 4M01A 3AM9A 4M0WB 2V1YA 3ZNZB 4JIOU 1L5PA 3N1XC 2ZCBA 2NR2A 4HEA1 4WWNA 2W9NA 2KOXA 4HVBA 2LJIA 2O2VB 4IC7B 1DOIA 2D3CA 1VDVA 3VUXA 2KKCA 4C80A 1QQRA 1TY0A 1M94A 1MG4A 2JU6X 2WXKA 1FNUA 4YSZB 4IKGA 3P4QB 1HE8A 1JROA 1VLBA 3BWUD 1ISNA 3I5JC 5KHQA 3EA6A 4CYEA 2XN9C 2MBOA 3VHTC 2W54A 2ZJDA 3DHGC 3O65B 3EGRA 4RFBA 2WXMA 2QILA 5J2RA 2J53A 1CJEA 5AEKB 1SE9A 3AXCA 1ZOYB 4YSXB 1L0YB 2ZZPB 2WXOA 2I2YA 3IT4B 3NVVA 1SJED 3TUOA 3R8BA 1T5XD 1XT9B 4BBNF 1XQQA 2BYEA 4EZLA 4KX6B 4L1BA 1C78A 3NOBA 2MEKA 4DDID 1GG3A 3Q3JA 4AQ7A 1FXAA 1QKZA 1J7AA 1HA5A 3EECA 1BMLC 1C77A 4JWUC 3UINB 1FEHA 4AOFA 1P7FA 2L1AA 2MLBA 4ZOHC 2PEAA 2QCZA 2J0MA 4EEWA 4W9CA 1TGZB 4MSMB 1SGHA 1TS2A 3MFGA 4NQLB 3BVGA 1UUPA 5BO4B 3AE8B 3I3TB 2FBWB 1FFVA 1GUAB 2JRIB 2KYWA 4GIVA 2IDYA 1TS5A 4WAAA 3GS2A 2UYZB 4NZLB 2LZ6A 3N32A 3VUWA 3VUYA 2IO1B 2L7RA 2C5LC 3PRMB 2Z0EB 1RAXA 2K9XA 2WNMA 1OQQA 3HIZA 3SEBA 2DYOA 4RCOA 3APFA 2N4FA 3Q3FA 2YLMA 2MCNB 1L0VB 3Q6BA 4RM8A 1MPEA 3AI5A 3NZSA 3NG0A 2E6XA 4MH0E 4A90A 1OEYA 4L2YA 4GDLB 1SSNA 1IGDA 3AV8A 2CKHB 4IWOA 1Q0WB 3HM3A 2FAZA 1RM6C 3D32A 3L4PA 3KWLA 2RR9A 1L7YA 3VRBB 1BUIC 1L0XB 5EE9A 1KF6B 2ZW0A 1UWXA 5DPSA 4X57B 3QA8A 1TKEA 2KVRA 1YN4A 2QDFA 4OZCA 5J18A 3B9JA 4HKZE 2IO0B 1VZ6A 2N0SB 2LHDA 5HKHA 2LUEA 1TS3A 3BINA 3EFUA 2VZKD 2MSED 2WQYB 2C7HA 3A9JA 3PGEA 2WXHA 5H92C 2KWUB 5CX3A 1PGAA 4MM3A 2WXRA 3QQ8B 3NHEB 2KN4A 3IAM1 1HZ6A 1WMHB 4MT5A 3HVDA 2FCQA 5FR3A 5EE0A 2WXFA 1AARA 5FR6A 3GZNI 4YTMB 1SE3A 2Y5PA 4B9KA 2OJRA 1R7SA 3I9V1 1I4PA 2C7MB 3AEAB 1JWBD 2WXNA 4FHKA 3W1YA 1KM7A 1SIFA 1QILA 2RPQA 3ZGZA 3K9OB 3EHVA 4M8NA 1B1ZA 2EKEC 2G1EA 3KH0A 4N59A 3ZVVA 4LNKA 3M62B 2LEKA 2NMQA 1F52A 2GRIA 3ZLZA 1AW7A 2RDHA 1VZ7A 5DPWA 4GDKB 1IGCA 3DBHI 1HTOA 4P1CC 3T3OA 3UI3A 2KJ6A 4JE3B 5TR5A 2PE6B 4ANUA 5LXIB 4WWMA 3OG5A 3ZJVA 4WWOA 1I4RA 3VH4B 1E8ZA 2DAFA 4C7YA 4US8A 2LGSA 4A8XC 3VDZA 4RH6A 3RNFC 5IKCM 1S3SG 1TKGA 2LGXA 3SDLC 1JRUA 3DWGC 1VR9A 1WYWB 2GBNA 2KX3A 3PLVA 1I4XA 2RSUA 3DBSA 2IGGA 2G3QB 3DCGA 3VFKA 1DGJA 3E56A 2N9PC 1MHXA 2LVOA 1YQ3B 5JXVA 3AULA 2ZEQA 4XYCA 2LXCA 2JSVX 2WXIA 1MHHE 5DCNA 1M4VA 1WR6E 4TV3A 1PUTA 3Q8BA 1YQBA 2MBHA 3ALBA 4KIKB 3GE8C 1XLOA 2EKIA 2RD0A 2ONQA 2LGYA 2J4XA 2PVGC 5D2MB 1WWTA 4NJ7A 2ON8A 1PQSA 1V5TA 2JXXA 2LJ5A 3OWEB 4WJPA 3DBLI 3LDZE 1E9MA 3PZ7A 1CMXB 1N62A 4K81A 2DHZA 4DXFA 2M17A 2IPKD 5AZFA 3WAOA 3O13A 2MBQA 3A1QA 2KJRA 1I4GA 3WA0A 4XE0A 4ZHOA 2DWQA 3PS6A 3ZUNA 4OZAA 5HHDG 5CHVC 4K7UA 1V80A 1IBXB 3AEGB 2QIEB 2AQ1B 2Y5BB 5D6JB 1TKYA 4XC2A 1JALA 3N20C 4ZRQA 2IBIB 2YEPF 2KFKB 2MBBB 4HPLB 1EF1A 1SE4A 3V05A 3KVFB 1FCLA 3SU8X 3M63B 2KTRA 4FBJB 1UNSA 2R2QA 4HROA 5BYSA 1GB1A 3GE3C 3B0AA 3KUZA 4HPPA 4M0WA 4N9F4 4EZJA 1CK1A 3SHQA 1PGXA 2K22A 2O2VA 2XK5B 3PTFC 1I7HA 5EDSA 4C56C 2LVPA 4KSKC 2L0TA 2HD5B 3V60A 2WS3B 5D7GA 3BYYB 3QJZA 4MEMA 2DZMA 1K53A 1LXDA 2C9WB 2SEBD 5HFYA 2GBKA 2HDEA 1K50A 5LXHA 2M0AA 1JWSD 3GOEA 2M56B 4LJPB 2JQRB 5H8YE 4LLGM 2IGHA 1JWAD 1ZXIA 4IDIA 4F7ZA 5E6JA 4KZ0A 5HI1A 3S2AA 1EU3A 1MFWA 1KJTA 2KD0A 1ZW7A 4C4VB 4RGTA 4W9IA 4MELA 3TEYA 1XCTL 3IVFA 4MGIE 1K8RB 2MP2A 3AE6B 4MSQB 2MQJA 4REZA 3X0WA 1P0RA 3ZQ4A 5T8IA 1E5WA 3LB8C 3TEZA 4WJNA 4FJYA 4GMVA 4BZAA 3SFDB 1HEZE 1EO6A 1F9JA 2KDFB 1WF9A 2KDBA 5BMHA 1EUVB 1WGYA 1STEA 1V2YA 3IAS1 3ZRFA 3ZTCA 2CR5A 5BYQA 2C7NB 5JZEB 4OHJA 3V3XA 2HJ8A 1OEYJ 2WU2B 4H2AA 4EKUA 3H7PB 2LWPA 4LK0M 3PSEB 4BKTA 5LNK1 4C7ZA 4NPNA 1RYJA 1GJZA 4XWWA 4GXBA 1E8WA 2BWFA 3L08A 4JGHB 3GB1A 5C1ZA 4K7SA 2IJ0A 2PTLA 3AH7A 2V4IB 1YN3A 1FRDA 2EMTA 4KSLC 1RRBA 3DBRB 3R66C 4E74A 3KQ4A 3KWVA 2DZKA 1GC7A 4J6IA 1WXAA 2INPE 2ICIA 3AE4B 5C23A 2GLSA 1XCQL 2WDRB 3NRZA 4LDTB 1UZXB 2G45B 3RNAC 1N63A 1I4HA 2V3NA 1V81A 1Z2MA 4GDLA 2CHZA 2ACZB 4A55A 3AE1B 1BXTA 2MHJA 4MH8A 5IA7A 1J7BA 4LNOA 1T0QC 5GXGB 4K3BA 3CWIA 2MJDA 2DLBA 4LNIA 2G4SA 2WX0A 3C0RB 3E9SA 1L2NA 1D4BA 1V97A 4I6NB 4PS8A 1E7PB 1SIJA 3A4RA 1EWYC 1YMHE 3ZTDA 4USAA 1GOZA 3PV1A 3RMKC 3EFCA 2HE7A 4NJ6A 3RN9C 2CS4A 2Y3AA 2MP2B 3IBEA 3OJ4B 2JZ3B 1DYQA 1WMHA 4IW0A 3DWMA 2BBCA 4XDDA 5IN7A 3LXFA 3WCQA 2EELA 4HLEA 3ECIA 4EE2A 3NVWA 1TBEA 2ZNVC 1TTNA 1V1OA 1SE2A 1D5ZC 1MG8A 4W9DA 3RZFA 1WSPA 3BVZA 4A3PA 3AE3B 1V1PB 3PHXB 5FK9C 1WY8A 2QSDA 2LHEA 4GDKA 3VQIA 2QJLA 4ZYNA 1Z5SB 2KMCA 2NPTB 4B0MA 2WWZA 2N7JA 3KYCD 3U2SC 2KQSA 2N1WA 4G11A 5L95C 1B9RA 3C19A 2V3PA 3IG3A 2EMSA 3WANA 1R4NB 1SJHD 1KOTA 3VVWB 2NS5A 1HZ5A 4TQ0A 2DYBA 2W55A 1BT0A 1L6VA 1P98A 4IOIE 4P16A 1V6EA 3Q14C 4RGMA 1SB3C 2DZIA 4PS3A 1Q10A 2JZPA 3PRZA 4PYZA 3VR9B 5D94A 3U30A 3ZW3A 2KT7A 2MJ3A 1ZDXA 4AP4C 3QAQA 5IO9A 4XGAB 1J7CA 2K6DB 4KZCA 4ZRKA 2N9LA 1H8CA 3C8YA 3U4EG 2MH7A 2PE9A 3ABVB 4ANXA 4DHJB 2NTSA 1ESFA 3CIRB 3V61A 1WJUA 2Y5CA 3KUCB 3KW5B 4AWJA 4WWPA 3RCZA 4ZHPA 1XXGA 1C79A 2DZJA 1KRHA 3RNCC 2K8CA 1V5OA 4KGTA 4KIKA 1D3ZA 2PW9A 4M8MA 4CO7A 2BYVE 2FCSA 3CSTA 3UQAA 1XLPA 3QIJA 2JPHA
chains in the Genus database with same CATH topology
2OHFA 2WP9B 1XLOA 2EKIA 4N6EB 1QOGA 2ONQA 1QF6A 3BK1A 1F2RC 1D6EC 2J4XA 3N9YC 2PVGC 1WWTA 3NUHB 2BTEA 2ON8A 1N5WA 1ACCA 3FILA 1ROEA 3OWEB 3RFZB 1HXYD 3Q8CA 3NS1A 3FAHA 4RNAA 1E9MA 1MI0A 3PZ7A 1N62A 1RFKA 1JCKB 2RMMA 4WIPA 1N5XA 3Q69A 4DXFA 4GLSC 2IPKD 3FILB 3KLSX 3O13A 5AUKA 1I4GA 4CQNA 1YN5A 3NZ3A 1F2RI 4XE0A 4YSYB 1XF5L 1IBXA 4ZHOA 1JMLA 2DWQA 3AE5B 3Q8EA 4OZAA 1VJKA 1C4PA 5HHDG 2LMCA 2WXQA 2PIAA 3VR8B 1HQRD 1CZPA 1JRPA 1K51A 1TY2A 1T6BX 4A6QA 4HKQA 3BYTB 1IBXB 1XO3A 2QIEB 3AEGB 4DQOC 2AQ1B 3P4PB 1WGKA 2Z8LA 1JQ4A 2WXPA 1EWCA 2D5GA 5HG2A 1TKYA 4HRSA 1QLBB 4OVZA 1JALA 1P7EA 1ZUD2 2JYTA 1DOXA 4ZRQA 2YEPF 3ZJUA 3R2IA 3P63A 2CU3A 1FCCC 1XEEA 2AQ3B 3P42A 1PYWD 1ZE3D 1SE4A 3LYYA 3V05A 4ZRPA 1FCLA 2E3TA 1OFFA 3HRDD 1D5XC 1WYGA 2L83A 2K5PA 3W5VB 1UNSA 4HROA 4J3OD 5BYSA 1K52A 5C3JB 1GB1A 1WRIA 2GB1A 4M0WA 4OW0A 4L23A 3SFEB 1CK1A 4ITKA 1PGXA 2M19A 2K3UA 1OQRA 2K22A 1QOAA 3U52E 1NVID 2KDMA 1PFDA 3AM9A 1FM0D 1L5PA 1QOFA 5I4DA 3AN1A 4HEA1 1I7HA 2WLBA 4C56C 4YXDB 4MACA 4XDCA 2LJIA 4YTPB 2BYTA 2WS3B 5D7GA 3BYYB 1DOIA 1VDVA 1K53A 4NAWB 1GAQB 2SEBD 5HFYA 2HDEA 2WXJA 5AUIA 1K50A 4C80A 4YT0B 1QQRA 1TY0A 3MHZA 2M0AA 3TSSA 2JU6X 1T3QA 1FNUA 1JWSD 2WXKA 3AEBB 1TYGB 4YSZB 4IKGA 2M56B 1FO4A 1TZOA 2JQRB 3P4QB 5H8YE 1FD6A 3IT6B 1JROA 1VLBA 3BWUD 2H89B 1NENB 4LLGM 2IGHA 5BMIA 1JWAD 4WQMA 1ZXIA 4IDIA 5BYRA 2JXTA 2OEDA 3EA6A 5E6JA 5HI1A 3VRAB 2XN9C 1EU3A 1XLNA 1ET9A 2W54A 4NAMA 4RGTA 1KLUD 1E0ZA 3EGRA 5G5HA 4RFBA 2WXMA 3TEYA 1XCTL 2JWUA 4P6VF 4XWTA 1NYQA 2QILA 2Q5WD 4YTNB 2TSSA 1JW9D 2J53A 5D3IB 1RWSA 4RF1A 3TEXA 2RPVA 5D3DA 1CJEA 3AE6B 1C4CA 4REZA 2L52A 1L4ZB 3ZQ4A 1ZOYB 5T8IA 4YSXB 1ENFA 1FNWA 1L0YB 3TEWA 2WXOA 2I2YA 3IT4B 3LB8C 3NVVA 1SJED 2I38A 3TUOA 3TEZA 1N60A 2X38A 3R8BA 1T5XD 1AYFA 1PDXA 2W82A 4KKJA 4TSSA 3HVZA 1AN8A 1CQVA 1JWUD 2AX5A 1FFUA 4ZYSA 4KX6B 5MPOA 4L1BA 1C78A 1ZDVA 2MEKA 3SFDB 2BS2B 1HEZE 1ZPSA 1IUEA 2WDQB 4AQ7A 1FXAA 3J9CA 2BS3B 5BMHA 1QKZA 1UWMA 1J7AA 1HA5A 1STEA 1SXTA 3IAS1 1BMLC 1C77A 1E10A 4JWUC 5BYQA 3AMZA 5BMGA 1XLQA 1FEHA 4OHJA 2PLPA 3V3XA 1KTKA 3Q8FA 1P7FA 2L1AA 2WDVB 2WU2B 4H2AA 2V0GA 4LK0M 4ZOHC 5TSSA 1MVKA 5LNK1 1DOYA 4C7ZA 4A9AA 3MC0B 2KAJA 3ZJTA 1RYJA 1TS4A 3NVYA 1C4AA 1GPXA 4XWWA 3ETRA 1TS2A 3MFGA 4NJCA 3BVGA 1UUPA 1D5MC 2L32A 2R61A 1KH0A 3GB1A 1VRAB 3AE8B 2IJ0A 2FBWB 2PTLA 1FFVA 3P4RB 1VZ8A 3AH7A 2V4IB 1YN3A 1FRDA 1YQ4B 1FNVA 4RGNA 2IDYA 1TS5A 1YJJA 3GS2A 2QEJC 4NZLB 2BT6A 1L6UA 2SAKA 3W1SA 1KFYB 3KQ4A 3KWVA 3P4SB 2WXGA 2LUMA 3EUB2 4ARIA 4FXCA 2INPE 2ICIA 3AE4B 3W2DA 2HTME 1EM7A 2LFIA 1XCQL 2WDRB 3NRZA 1I4QA 4TQ1A 2N9KA 2K9XA 2WNMA 1OQQA 1N63A 1I4HA 1QOBA 2XNAC 2V3NA 4JPSA 3SEBA 2DYOA 4RCOA 3IXSA 4JWSC 2NTTA 1L0VB 2PVOD 4TMAB 4KGSA 1A70A 2KMMA 3PO0A 2ACZB 1MPEA 3AE1B 1BXTA 4N58A 4A55A 3W5UB 5FKAC 2E6XA 2BW2A 4MH8A 4A90A 1J7BA 3AEDB 5GXGB 3CWIA 2MJDA 4L2YA 4GDLB 1SSNA 3RPFC 3GP7A 4DXGA 1IGDA 3AV8A 3W9CB 3MP9A 1RM6C 2DLBA 2YEPB 2KACA 3L4PA 3AB5A 2W3RA 1QT9A 1EU4A 5EE3A 2INNE 2CJOA 3KWLA 2MJEA 3E9SA 1D4BA 3BZDB 1V97A 1C76A 3VRBB 1BUIC 1E7PB 1SIJA 1EWYC 1L0XB 3PZ8A 1KF6B 1YMHE 2VZKB 2ZW0A 3R2TA 5EE9A 1UWXA 1GOZA 3NVZA 4USAA 1TKEA 1YN4A 3H8HA 2FE8A 3BK2A 2BS4B 1SEBD 4OZCA 1LO5D 2Y3AA 1VZ6A 3B9JA 4HKZE 1NYRA 2N0SB 3B2GA 2LHDA 1YNTE 1TS3A 2KWDA 2VZKD 4ARCA 4D2KA 1DYQA 2WQYB 2BB5A 4HJGE 2K0PA 2WXHA 2B76B 3DWMA 2BBCA 4XDDA 5H92C 3LXFA 2ZW1A 3WCQA 1V8CA 2EELA 1PGAA 1N61A 4EE2A 1V1PA 1FXIA 1WXQA 2WXRA 3AEFB 3NVWA 1V1OA 1NEKB 1SE2A 1HZ6A 1D5ZC 2KN4A 3IAM1 4MT5A 2J52A 3HVDA 1FRRA 5FR3A 5EE0A 3T3NA 2PKOA 2WXFA 1F77A 1WSPA 3BVZA 1FMAD 3I57A 2FUG1 3AE3B 1SE3A 3BIID 2Y5PA 4MM3B 4RGOS 4YTMB 1V1PB 1R7SA 3I9V1 1I4PA 2RDGA 3AEAB 5FK9C 1C9FA 1JWBD 1Y56A 2WXNA 1AWDA 2J42A 2QSDA 1QILA 4YWGG 4OZBA 3SR6A 3ZGZA 2LHEA 2DYMA 3VQIA 2QJLA 3Q8AA 1B1ZA 2G1EA 4N59A 4B0MA 1ET6A 4WURA 2CJNA 1ZP0B 2N7JA 2WXLA 2LEKA 2NMQA 1SBBB 4US9A 2GRIA 3U2SC 1AW7A 3U7ZA 4UDUC 2RDHA 1VZ7A 1F0ZA 2JYEA 1B9RA 2LGIA 2V3PA 4GDKB 1IGCA 1FIQA 3B2FA 1SJHD 5C2TB 4JX1C 4KKIA 2QMTA 3T3OA 2JX5A 3UI3A 1HZ5A 4JE3B 4WH4A 4TQ0A 4Q2JA 2W55A 4WWMA 1L6VA 4IOIE 2IGDA 4P16A 3ZJVA 1I4RA 1SF0A 4RGMA 1SB3C 1Q10A 1UGJA 2JZPA 4C7YA 4US8A 1E6EB 3VR9B 4A8XC 2MJ3A 4WAFA 1ZDXA 4RH6A 3ZYYX 2WU5B 1TKGA 1J7CA 3MJ5A 3DWGC 1VR9A 2N9LA 1JWMD 5EE1A 3P1MA 3C8YA 4AS1A 1I4XA 1NI3A 2W3SA 3U4EG 4B0EA 3AE2B 2IGGA 2MH7A 2KQ4X 3AEEB 3AECB 4R3DA 1DGJA 3FC4A 3ABVB 3E56A 4RF0A 2PMVA 1GB4A 3HUIA 2NTSA 1ZXHA 2AQ2B 1ESFA 1MHXA 3URYA 3CIRB 1YQ3B 5JXVA 3BVMA 2G9HD 4KGRA 2Y5CA 4LTUA 1KLGD 4PT5A 4ZHPA 1XXGA 2JSVX 2WXIA 2GI9A 1C79A 1YJIA 1MHHE 1KRHA 4O1NA 4KGTA 1TJEA 2PW9A 1M4VA 2BB6A 3AE7B 1PUTA 3Q8BA 2H88B 5G5GA 1L4DB 1PGBA 1XLPA 2DBYA 3AE9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VDV A;  1YJJ A;  2OHF A;  1XLO A;  2EKI A;  2WP9 B;  1R7S A;  1GAQ B;  1QOG A;  3BII D;  4N6E B;  1QF6 A;  2BT6 A;  1L6U A;  3AEA B;  1KFY B;  5AUI A;  1JWB D;  4C80 A;  4YT0 B;  1AWD A;  3P4S B;  2PVG C;  1WWT A;  3AEB B;  1T3Q A;  3SR6 A;  3EUB 2;  1N5W A;  1TYG B;  4FXC A;  4YSZ B;  1ROE A;  2M56 B;  2JQR B;  3P4Q B;  3AE4 B;  5H8Y E;  1FO4 A;  1JRO A;  1VLB A;  2HTM E;  2QJL A;  3NS1 A;  2H89 B;  1NEN B;  3FAH A;  1E9M A;  2G1E A;  4N59 A;  1N62 A;  1JWA D;  1RFK A;  2WDR B;  2CJN A;  3NRZ A;  4WQM A;  1N5X A;  1ZP0 B;  1ZXI A;  4IDI A;  2LEK A;  4US9 A;  2K9X A;  3VRA B;  1F0Z A;  1XLN A;  1B9R A;  2W54 A;  1OQQ A;  1N63 A;  1QOB A;  5AUK A;  1FIQ A;  3B2F A;  1E0Z A;  5G5H A;  4JWS C;  5C2T B;  4YSY B;  4JX1 C;  4P6V F;  1NYQ A;  2Q5W D;  2JX5 A;  1L0V B;  2PVO D;  2DWQ A;  3AE5 B;  4YTN B;  4ZHO A;  1A70 A;  1JW9 D;  2KMM A;  1VJK A;  1RWS A;  2ACZ B;  3PO0 A;  2W55 A;  3AE1 B;  4N58 A;  4WWM A;  1L6V A;  1CJE A;  3AE6 B;  3W5U B;  2PIA A;  3VR8 B;  1CZP A;  1SF0 A;  1JRP A;  1SB3 C;  1J7B A;  2L52 A;  1ZOY B;  4C7Y A;  3AED B;  4YSX B;  4US8 A;  1XO3 A;  2QIE B;  3AEG B;  5GXG B;  3P4P B;  1E6E B;  1WGK A;  3CWI A;  2MJD A;  3LB8 C;  3VR9 B;  1JQ4 A;  3NVV A;  3RPF C;  1TKY A;  4HRS A;  1N60 A;  2MJ3 A;  1QLB B;  3AV8 A;  3W9C B;  1JAL A;  1AYF A;  1PDX A;  2WU5 B;  3ZYY X;  1RM6 C;  3HVZ A;  2AX5 A;  1FFU A;  1ZUD 2;  4KX6 B;  3L4P A;  1TKG A;  1J7C A;  2W3R A;  1QT9 A;  3AB5 A;  5EE3 A;  3SFD B;  5MPO A;  3DWG C;  2DBY A;  2BS2 B;  2CJO A;  3KWL A;  3P63 A;  2MJE A;  1IUE A;  2CU3 A;  2WDQ B;  5EE1 A;  1V97 A;  1FXA A;  3P1M A;  3VRB B;  1E7P B;  1SIJ A;  2BS3 B;  1EWY C;  5EE9 A;  1KF6 B;  1NI3 A;  1UWM A;  2W3S A;  4USA A;  1J7A A;  3AE2 B;  3NVZ A;  2MH7 A;  3AEE B;  1TKE A;  1E10 A;  4JWU C;  3AEC B;  2E3T A;  1OFF A;  1DGJ A;  3FC4 A;  3HRD D;  3AMZ A;  3ABV B;  1XLQ A;  2BS4 B;  1WYG A;  2L83 A;  2K5P A;  3HUI A;  3B9J A;  3W5V B;  1NYR A;  2N0S B;  3B2G A;  4HRO A;  2WU2 B;  2WDV B;  5C3J B;  1DOX A;  1WRI A;  3CIR B;  1YQ3 B;  4ZOH C;  1DOY A;  3SFE B;  4C7Z A;  2Y5C A;  4A9A A;  4LTU A;  4ITK A;  2WQY B;  2KAJ A;  4ZHP A;  1RYJ A;  2B76 B;  2M19 A;  3NVY A;  3DWM A;  4YTM B;  1GPX A;  1OQR A;  3ETR A;  2K22 A;  1QOA A;  5H92 C;  1YJI A;  3LXF A;  3WCQ A;  1NVI D;  1KRH A;  1PFD A;  1V8C A;  1TJE A;  3AM9 A;  1N61 A;  1FM0 D;  1WXQ A;  1FXI A;  1L5P A;  1QOF A;  3AE8 B;  3AEF B;  3NVW A;  2FBW B;  3AE7 B;  3AN1 A;  1NEK B;  1I7H A;  1FFV A;  1PUT A;  2WLB A;  3AH7 A;  3P4R B;  1FRR A;  4YXD B;  2H88 B;  1FRD A;  5G5G A;  4YTP B;  5EE0 A;  1YQ4 B;  2PKO A;  2WS3 B;  1XLP A;  1FMA D;  1DOI A;  3AE9 B;  3AE3 B; 
#chains in the Genus database with same CATH topology
 4N6E B;  2R2O A;  3V6C B;  1LM8 B;  2BF8 B;  3N9Y C;  1D6E C;  5CHF A;  5AZG A;  1N5W A;  4DDG D;  2GMI C;  1HXY D;  3Q8C A;  2K1F A;  3RFZ B;  4EOY A;  3FAH A;  4K7W A;  4FAD A;  3Q3O C;  1RFK A;  1VCB A;  1JCK B;  2OOB B;  4F8C B;  3Q69 A;  3T8M A;  3RNE C;  2KLG A;  3DDC B;  5AUK A;  2RGF A;  2MWS B;  2INC C;  4YSY B;  1XF5 L;  3RT3 B;  1IBX A;  2FUH B;  3Q8E A;  3ZRC A;  1C4P A;  2WXQ A;  3IHP C;  2KHW B;  1MJD A;  3JYU A;  3LJ3 A;  4DBG A;  1HQR D;  1CZP A;  1K51 A;  3NS8 A;  3BYT B;  3HM6 X;  1XO3 A;  5IOI A;  1ZKH A;  1TT5 B;  2KFK A;  1JQ4 A;  2WXP A;  2D5G A;  4HRS A;  3UGB B;  4DXA B;  1P7E A;  3I63 C;  3N1Z C;  2JYT A;  1DOX A;  1OGW A;  3ZJU A;  3R2I A;  3WAP A;  1FCC C;  2AQ3 B;  3P42 A;  2MRP A;  2E3T A;  1OFF A;  1D5X C;  1WYG A;  2L83 A;  4LNN A;  4J3O D;  2KDE B;  2XK5 A;  2K8H A;  3PZD A;  4L23 A;  1WI0 A;  4ITK A;  1YJ1 A;  2A5U A;  2NCN A;  2K3U A;  2ZVN A;  2WX1 A;  4GU2 A;  2KDM A;  2WYQ A;  4ANW A;  1QOF A;  3WAL A;  1E8Y A;  4MAC A;  2I1K A;  4XDC A;  4B6W A;  3VAW A;  3OJ3 A;  4NAW B;  5GMV A;  5AUI A;  1A5R A;  3JSV A;  3DHH C;  1P3Q U;  3TSS A;  4BOZ B;  1Q1O A;  2FCN A;  2CU1 A;  5JH5 C;  3MC9 A;  1FO4 A;  1TZO A;  4C4V A;  2KXJ A;  4GGQ A;  3R7R A;  1FD6 A;  1LQB A;  3ZIM A;  5BMI A;  3DPD A;  4WQM A;  3OLM D;  1YX6 B;  2IO2 B;  4IWP A;  3HHM A;  3RD2 A;  3R3M A;  4NAM A;  5CTR C;  2JZZ A;  2NBU A;  5G5H A;  2L76 A;  4P6V F;  4P7I A;  4YTN B;  2KMA A;  4NNJ B;  1RWS A;  2BKR B;  1C4C A;  4MDK E;  3IFW B;  2KK8 A;  2L52 A;  1L4Z B;  4I6L B;  4DWF A;  1FNW A;  4XZ4 A;  3ZKJ C;  1N60 A;  1R4M I;  2X38 A;  1WXS A;  1AYF A;  3HVZ A;  1CQV A;  2AX5 A;  1FFU A;  4E3C A;  5MPO A;  1ZDV A;  2BS2 B;  2ASQ A;  1IUE A;  2HJ1 A;  4II2 B;  1UWM A;  3H7P A;  5DPR A;  5E6P A;  1SXT A;  1WFY A;  4IWQ A;  2DAJ A;  4NQK E;  5BMG A;  2PLP A;  3X23 A;  3Q8F A;  4W9L A;  4ANV A;  2WDV B;  3APC A;  2BVC A;  2GOW A;  2YVC A;  4AUQ C;  4IM3 A;  2PPH A;  2D11 A;  2HTH A;  5LLI A;  3ZJT A;  1T0Y A;  3NVY A;  1C4A A;  4IM0 A;  4NJC A;  3HK0 A;  1FXT B;  1D5M C;  2R61 A;  1KH0 A;  3ZNG C;  4KDL B;  4HWI B;  2V4L A;  4GSW A;  1YQ4 B;  1FNV A;  4RGN A;  4HJK A;  3GZN B;  1YJJ A;  4MGZ E;  2QEJ C;  2AL6 A;  2BT6 A;  2SAK A;  3W1S A;  1IPG A;  3NY5 A;  3H7S A;  3B1L X;  2KC2 A;  2M8S A;  4FXC A;  3P2B A;  2KN5 A;  1EM7 A;  3QHT A;  2LFI A;  2LXA A;  1I4Q A;  3Q3N C;  1WXV A;  3TMP B;  3DBH B;  2XNA C;  4JPS A;  2KO3 A;  3TCA A;  3IXS A;  4TMA B;  4LDT D;  3PO0 A;  3CSF A;  2MA9 B;  5FKA C;  2KAN A;  2BW2 A;  3H6N A;  2N9X A;  3JSV B;  4JQW C;  3GP7 A;  3H9D A;  2WGS A;  3DVN V;  1EF5 A;  3W9C B;  2QHO A;  2L3Z A;  1P1A A;  3MP9 A;  2YEP B;  2KAC A;  2ZCC A;  4BOS C;  3AB5 A;  1QT9 A;  5EE3 A;  3VTW A;  2MJE A;  3N3K B;  2KWV B;  3PZ8 A;  3R2T A;  1G6J A;  3L13 A;  4M00 A;  2FE8 A;  2BS4 B;  3A9K B;  1SEB D;  2KFJ A;  4ACF A;  1NYR A;  3B2G A;  2IY0 B;  2GBR A;  4FA6 A;  4RMA A;  2V3S A;  4D2K A;  2BB5 A;  4HJG E;  2K39 A;  4ASW C;  1OQY A;  2B76 B;  2DEN B;  2DX5 B;  1UGM A;  1V8C A;  1KLV A;  1V1P A;  1FXI A;  3AEF B;  3N30 A;  1WH3 A;  1NEK B;  2IZV B;  4OVU A;  2J52 A;  1OTR B;  3T3N A;  2PKO A;  1FPY A;  1F77 A;  3PHW B;  3I57 A;  3BII D;  3MHS D;  3ZO5 B;  4FN2 A;  2XBB C;  2NPT A;  1UEL A;  1Y56 A;  4HDQ A;  2J42 A;  4TUU A;  4YWG G;  4OZB A;  3SR6 A;  1WZ0 A;  4HCP B;  3DBL B;  3Q8A A;  2JUO A;  3QCA A;  3V62 A;  2CJN A;  1SBB B;  1YD8 U;  3U7Z A;  3RUI B;  4HCN B;  5E6N A;  1Y8R C;  1FIQ A;  3B2F A;  4JL9 A;  4M02 A;  4GN1 A;  4JX1 C;  2QMT A;  3UF8 A;  2ZPN A;  2KDI A;  4WH4 A;  3R7Q A;  4S17 A;  4Q2J A;  4A3O A;  1WM3 A;  2MW5 A;  4WJO A;  1UGJ A;  1E6E B;  4W9G A;  2N7E A;  4WAF A;  2D3G A;  3QX1 A;  2B3A A;  2WU5 B;  3ZXR A;  4KVG B;  2A4Z A;  1JWM D;  2W3S A;  3AEE B;  2PJH A;  4MJS B;  3FC4 A;  2ZVO A;  4OVV A;  1ZXH A;  2AQ2 B;  1Q5W B;  3URY A;  3Q3M C;  2X8X X;  1RFA A;  2VH1 A;  3OAW A;  1C1Y B;  4TKN A;  2FIF A;  4URK A;  4DHJ D;  1UH6 A;  4O1N A;  3MJW A;  4G0N B;  3AE7 B;  4PS7 A;  2H88 B;  5G5G A;  1L4D B;  3QC8 B;  2LGD A;  4BKG A;  1UD7 A;  2DBY A;  2OHF A;  2WP9 B;  3B08 A;  1QOG A;  1QF6 A;  4BKS A;  2O6V B;  2UU7 A;  3RI7 C;  3NUH B;  4ICV A;  2BTE A;  3TL5 A;  4EZK A;  2JVC A;  3L17 A;  3NS1 A;  2D07 B;  4RNA A;  2KLC A;  4WIP A;  1C3T A;  1J0G A;  2LRW A;  4GLS C;  1E7V A;  2NBW B;  3FIL B;  3CMM B;  4CQN A;  1J19 A;  4E71 A;  3NZ3 A;  3TIX A;  4BKS D;  3JW0 X;  3AE5 B;  1VJK A;  1S1Q B;  2LMC A;  1WGR A;  2V9H A;  1WX9 A;  2D3A A;  4A6Q A;  4HKQ A;  3P4P B;  4GB9 A;  1QLB B;  4OVZ A;  2BKF A;  4FJV B;  1V49 A;  5L83 A;  2CU3 A;  1XEE A;  2BYF A;  3EC8 A;  4QAY A;  3JVZ X;  4GOC A;  5J17 A;  3A33 B;  2K5P A;  3W5V B;  2CHW A;  1UBI A;  3ZXV A;  1K52 A;  3ML9 A;  4OW0 A;  2KVZ A;  2KJH B;  3T9L A;  4XX5 A;  2M19 A;  1QOA A;  4LNF A;  1PFD A;  1FM0 D;  4NAW A;  2JF5 A;  5CHW A;  5I4D A;  3AN1 A;  2WLB A;  5JHB A;  2KX0 A;  1YIW A;  4YXD B;  4CHK A;  2K8B A;  2BYT A;  3BY4 B;  2M1M A;  4YTP B;  2DNF A;  1WE6 A;  1GAQ B;  4HXD A;  3QK0 A;  2WXJ A;  4YT0 B;  3DHI C;  4W9J A;  3MHZ A;  4MGY E;  3AEB B;  1T3Q A;  4G3X B;  2MX2 A;  2L8J A;  1TYG B;  3IT6 B;  1WRD B;  2CHX A;  2H89 B;  4C00 A;  1NEN B;  5BYR A;  1WE7 A;  2JXT A;  2OED A;  3VRA B;  2LD9 A;  1XLN A;  1ET9 A;  1WJ6 A;  5IAA C;  2KC1 A;  1WJN A;  2FCM A;  1KLU D;  1E0Z A;  5AZH A;  4EUT A;  4PK1 A;  2JWU A;  2J0J A;  4XWT A;  1NYQ A;  2Q5W D;  3L54 A;  2TSS A;  1JW9 D;  4EFO A;  5D3I B;  4RF1 A;  3TEX A;  2RPV A;  5D3D A;  2KZR A;  3TEW A;  1ENF A;  2IY1 B;  2J7Q B;  4FJZ A;  2I38 A;  3Q2A C;  4KKJ A;  1PDX A;  2W82 A;  4IUM B;  4TSS A;  3KUD B;  1AN8 A;  3RUL A;  1JWU D;  3K9P B;  4ZYS A;  3H1U A;  3DVN U;  4LJO B;  2KQ7 A;  1ZPS A;  4HK2 A;  2WDQ B;  3MTN B;  3J9C A;  3M3J A;  2BS3 B;  2MBE A;  4DHZ E;  2LRU A;  1E10 A;  3AMZ A;  1XLQ A;  1KTK A;  2AWT A;  1WXM A;  4W9H A;  2V0G A;  2JRH A;  3ZNI D;  5TSS A;  1MVK A;  2BGF A;  1DOY A;  4A9A A;  3MC0 B;  2KAJ A;  1LGR A;  1TS4 A;  4KV2 A;  1GPX A;  2I1J A;  4G50 A;  3ETR A;  4W9K A;  3ONS A;  2L32 A;  4AJW A;  1VRA B;  2ZPY A;  3DQV A;  2BWE S;  3P4R B;  1VZ8 A;  3QAR A;  2D10 A;  4B95 A;  2LI5 A;  3L0W B;  3V6E B;  2N1V A;  1L6U A;  2N9E B;  1KFY B;  3UIO B;  3PRE A;  3P4S B;  1YX5 B;  2WXG A;  2LUM A;  3EUB 2;  4ARI A;  2JWZ A;  3VTV A;  1UBQ A;  1WJ4 A;  2ZNV B;  3W2D A;  2HTM E;  4A20 A;  3ZNH B;  1QZE A;  3PPA A;  4BFR A;  4TQ1 A;  2N9K A;  3L16 A;  4K1R B;  2M4N A;  2WHI A;  3TBL D;  1QOB A;  2NVU I;  4JWS C;  2IND C;  1HTQ A;  2NTT A;  2PVO D;  3NZU A;  4KGS A;  1A70 A;  2KMM A;  5G55 A;  4N58 A;  4FHJ A;  3W5U B;  1WX7 A;  3VTU A;  1NI2 A;  4P1B C;  3AED B;  1H4R A;  2KTF A;  3RPF C;  4DXG A;  3QWZ B;  2AEH A;  2KNB A;  4IG7 B;  2W3R A;  1EU4 A;  1E7U A;  3A9K A;  2INN E;  2CJO A;  2N7D A;  3RZW C;  1GC6 A;  3BZD B;  1C76 A;  3UIP B;  2VZK B;  3NVZ A;  2IYD B;  1WGH A;  2RDB C;  3AU4 A;  2M0X A;  3H8H A;  4HDO A;  3BK2 A;  1UF0 A;  1LO5 D;  2FID A;  1YNT E;  3MC8 A;  1NDD A;  2KWD A;  3U8Z A;  2NBV B;  4ARC A;  4BVU C;  2UWQ A;  2K0P A;  3ZDM C;  2ZW1 A;  4RM9 A;  1RLF A;  1N61 A;  1E90 A;  1WXQ A;  2BQQ A;  3A9J B;  1IYF A;  1FRR A;  3W1S C;  3AU5 A;  1FMA D;  2Z0D B;  2K6Q A;  2FUG 1;  4MM3 B;  4RGO S;  4WJQ A;  2RDG A;  3DBR I;  4S0R A;  1NBF C;  1C9F A;  1AWD A;  1U4A A;  2AYO B;  2Z59 B;  3WIM A;  1LFD A;  2JY6 A;  3RNB C;  2C60 A;  5KHO A;  4MGK E;  2DYM A;  1WX8 A;  3DVG Y;  1ET6 A;  4WUR A;  4W9E A;  1ZP0 B;  2WXL A;  2D3B A;  4UDU C;  3TJP A;  1F0Z A;  2JYE A;  2LGI A;  4WQO B;  1T0S C;  4NY0 A;  1VD2 A;  1TZ1 A;  2KWC A;  2XEW A;  5C2T B;  3DVG X;  4KKI A;  2JX5 A;  1V86 A;  2IGD A;  4FLH A;  1SF0 A;  2D2Q A;  2BPS A;  4I6P A;  1YOV B;  1X1M A;  4II3 B;  3A4S C;  3U7D A;  4ZRJ A;  3ZYY X;  3ZDT A;  4MJS A;  3MJ5 A;  4W9F A;  2J0K A;  5IP4 D;  2VH2 A;  5EE1 A;  3P1M A;  3VXW A;  3RNG C;  2LAS A;  3RYT A;  4AS1 A;  2GBM A;  1NI3 A;  4B0E A;  2WDT B;  3AE2 B;  2KQ4 X;  4JLC A;  4IM2 A;  3AEC B;  4R3D A;  4RF0 A;  2PMV A;  3WAM A;  2JT4 B;  3NJT A;  3HUI A;  1GNU A;  1GB4 A;  4YL8 A;  1E8X A;  2OJW A;  3BVM A;  2G9H D;  4KGR A;  4LTU A;  1KLG D;  1WGD A;  1F1H A;  1WR1 A;  4PT5 A;  3ENE A;  2GI9 A;  1YJI A;  1T0R C;  1TJE A;  2BB6 A;  2O6V A;  4HPM B;  4PYU A;  4BAX A;  3SD5 A;  1PGB A;  2VRR B;  4K3C A;  1WGG A;  3AE9 B;  4KDI C;  4US9 A;  4ZDV A;  3BK1 A;  5E6O A;  2REX A;  4AJY B;  1F2R C;  4DK5 A;  4FUL A;  2L0F A;  4DHZ B;  1ACC A;  3N1Y C;  1XD3 B;  3FIL A;  1ROE A;  3L10 B;  3ML8 A;  1MI0 A;  2O6V D;  1J8C A;  2RMM A;  1I42 A;  1N5X A;  3UQB A;  4ICU A;  3M95 A;  4BBN C;  4ZRI A;  3KLS X;  5G2N A;  1R4N I;  1YN5 A;  2K25 A;  1F2R I;  3CF6 E;  2IO3 B;  3PVL A;  1JML A;  1WZ3 A;  2L00 B;  1P9D U;  2PIA A;  1TIF A;  3A1Q B;  3VR8 B;  1JRP A;  1WIA A;  1TY2 A;  1T6B X;  1WM2 A;  5DPT A;  4DQO C;  1WGK A;  2Z8L A;  4LCD E;  1EWC A;  5HG2 A;  1R4M B;  4F1S A;  3DOW A;  2FNJ B;  1ZUD 2;  2AL3 A;  3P63 A;  1PYW D;  3VH3 B;  3PRP B;  1ZE3 D;  1N6Z A;  2GBJ A;  5JHA A;  3LYY A;  3APD A;  4ZRP A;  3PLU A;  3HRD D;  2QC8 A;  1V9J A;  3FKY A;  1ZGU B;  2LVQ A;  2L05 A;  5C3J B;  1WRI A;  2GB1 A;  3SFE B;  3KYD D;  3PT2 B;  2G4D B;  1OQR A;  1IP9 A;  1I35 A;  2KTR B;  3U52 E;  1NVI D;  4M01 A;  3AM9 A;  4M0W B;  2V1Y A;  3ZNZ B;  4JIO U;  1L5P A;  3N1X C;  2ZCB A;  2NR2 A;  4HEA 1;  4WWN A;  2W9N A;  2KOX A;  4HVB A;  2LJI A;  2O2V B;  4IC7 B;  1DOI A;  2D3C A;  1VDV A;  3VUX A;  2KKC A;  4C80 A;  1QQR A;  1TY0 A;  1M94 A;  1MG4 A;  2JU6 X;  2WXK A;  1FNU A;  4YSZ B;  4IKG A;  3P4Q B;  1HE8 A;  1JRO A;  1VLB A;  3BWU D;  1ISN A;  3I5J C;  5KHQ A;  3EA6 A;  4CYE A;  2XN9 C;  2MBO A;  3VHT C;  2W54 A;  2ZJD A;  3DHG C;  3O65 B;  3EGR A;  4RFB A;  2WXM A;  2QIL A;  5J2R A;  2J53 A;  1CJE A;  5AEK B;  1SE9 A;  3AXC A;  1ZOY B;  4YSX B;  1L0Y B;  2ZZP B;  2WXO A;  2I2Y A;  3IT4 B;  3NVV A;  1SJE D;  3TUO A;  3R8B A;  1T5X D;  1XT9 B;  4BBN F;  1XQQ A;  2BYE A;  4EZL A;  4KX6 B;  4L1B A;  1C78 A;  3NOB A;  2MEK A;  4DDI D;  1GG3 A;  3Q3J A;  4AQ7 A;  1FXA A;  1QKZ A;  1J7A A;  1HA5 A;  3EEC A;  1BML C;  1C77 A;  4JWU C;  3UIN B;  1FEH A;  4AOF A;  1P7F A;  2L1A A;  2MLB A;  4ZOH C;  2PEA A;  2QCZ A;  2J0M A;  4EEW A;  4W9C A;  1TGZ B;  4MSM B;  1SGH A;  1TS2 A;  3MFG A;  4NQL B;  3BVG A;  1UUP A;  5BO4 B;  3AE8 B;  3I3T B;  2FBW B;  1FFV A;  1GUA B;  2JRI B;  2KYW A;  4GIV A;  2IDY A;  1TS5 A;  4WAA A;  3GS2 A;  2UYZ B;  4NZL B;  2LZ6 A;  3N32 A;  3VUW A;  3VUY A;  2IO1 B;  2L7R A;  2C5L C;  3PRM B;  2Z0E B;  1RAX A;  2K9X A;  2WNM A;  1OQQ A;  3HIZ A;  3SEB A;  2DYO A;  4RCO A;  3APF A;  2N4F A;  3Q3F A;  2YLM A;  2MCN B;  1L0V B;  3Q6B A;  4RM8 A;  1MPE A;  3AI5 A;  3NZS A;  3NG0 A;  2E6X A;  4MH0 E;  4A90 A;  1OEY A;  4L2Y A;  4GDL B;  1SSN A;  1IGD A;  3AV8 A;  2CKH B;  4IWO A;  1Q0W B;  3HM3 A;  2FAZ A;  1RM6 C;  3D32 A;  3L4P A;  3KWL A;  2RR9 A;  1L7Y A;  3VRB B;  1BUI C;  1L0X B;  5EE9 A;  1KF6 B;  2ZW0 A;  1UWX A;  5DPS A;  4X57 B;  3QA8 A;  1TKE A;  2KVR A;  1YN4 A;  2QDF A;  4OZC A;  5J18 A;  3B9J A;  4HKZ E;  2IO0 B;  1VZ6 A;  2N0S B;  2LHD A;  5HKH A;  2LUE A;  1TS3 A;  3BIN A;  3EFU A;  2VZK D;  2MSE D;  2WQY B;  2C7H A;  3A9J A;  3PGE A;  2WXH A;  5H92 C;  2KWU B;  5CX3 A;  1PGA A;  4MM3 A;  2WXR A;  3QQ8 B;  3NHE B;  2KN4 A;  3IAM 1;  1HZ6 A;  1WMH B;  4MT5 A;  3HVD A;  2FCQ A;  5FR3 A;  5EE0 A;  2WXF A;  1AAR A;  5FR6 A;  3GZN I;  4YTM B;  1SE3 A;  2Y5P A;  4B9K A;  2OJR A;  1R7S A;  3I9V 1;  1I4P A;  2C7M B;  3AEA B;  1JWB D;  2WXN A;  4FHK A;  3W1Y A;  1KM7 A;  1SIF A;  1QIL A;  2RPQ A;  3ZGZ A;  3K9O B;  3EHV A;  4M8N A;  1B1Z A;  2EKE C;  2G1E A;  3KH0 A;  4N59 A;  3ZVV A;  4LNK A;  3M62 B;  2LEK A;  2NMQ A;  1F52 A;  2GRI A;  3ZLZ A;  1AW7 A;  2RDH A;  1VZ7 A;  5DPW A;  4GDK B;  1IGC A;  3DBH I;  1HTO A;  4P1C C;  3T3O A;  3UI3 A;  2KJ6 A;  4JE3 B;  5TR5 A;  2PE6 B;  4ANU A;  5LXI B;  4WWM A;  3OG5 A;  3ZJV A;  4WWO A;  1I4R A;  3VH4 B;  1E8Z A;  2DAF A;  4C7Y A;  4US8 A;  2LGS A;  4A8X C;  3VDZ A;  4RH6 A;  3RNF C;  5IKC M;  1S3S G;  1TKG A;  2LGX A;  3SDL C;  1JRU A;  3DWG C;  1VR9 A;  1WYW B;  2GBN A;  2KX3 A;  3PLV A;  1I4X A;  2RSU A;  3DBS A;  2IGG A;  2G3Q B;  3DCG A;  3VFK A;  1DGJ A;  3E56 A;  2N9P C;  1MHX A;  2LVO A;  1YQ3 B;  5JXV A;  3AUL A;  2ZEQ A;  4XYC A;  2LXC A;  2JSV X;  2WXI A;  1MHH E;  5DCN A;  1M4V A;  1WR6 E;  4TV3 A;  1PUT A;  3Q8B A;  1YQB A;  2MBH A;  3ALB A;  4KIK B;  3GE8 C;  1XLO A;  2EKI A;  2RD0 A;  2ONQ A;  2LGY A;  2J4X A;  2PVG C;  5D2M B;  1WWT A;  4NJ7 A;  2ON8 A;  1PQS A;  1V5T A;  2JXX A;  2LJ5 A;  3OWE B;  4WJP A;  3DBL I;  3LDZ E;  1E9M A;  3PZ7 A;  1CMX B;  1N62 A;  4K81 A;  2DHZ A;  4DXF A;  2M17 A;  2IPK D;  5AZF A;  3WAO A;  3O13 A;  2MBQ A;  3A1Q A;  2KJR A;  1I4G A;  3WA0 A;  4XE0 A;  4ZHO A;  2DWQ A;  3PS6 A;  3ZUN A;  4OZA A;  5HHD G;  5CHV C;  4K7U A;  1V80 A;  1IBX B;  3AEG B;  2QIE B;  2AQ1 B;  2Y5B B;  5D6J B;  1TKY A;  4XC2 A;  1JAL A;  3N20 C;  4ZRQ A;  2IBI B;  2YEP F;  2KFK B;  2MBB B;  4HPL B;  1EF1 A;  1SE4 A;  3V05 A;  3KVF B;  1FCL A;  3SU8 X;  3M63 B;  2KTR A;  4FBJ B;  1UNS A;  2R2Q A;  4HRO A;  5BYS A;  1GB1 A;  3GE3 C;  3B0A A;  3KUZ A;  4HPP A;  4M0W A;  4N9F 4;  4EZJ A;  1CK1 A;  3SHQ A;  1PGX A;  2K22 A;  2O2V A;  2XK5 B;  3PTF C;  1I7H A;  5EDS A;  4C56 C;  2LVP A;  4KSK C;  2L0T A;  2HD5 B;  3V60 A;  2WS3 B;  5D7G A;  3BYY B;  3QJZ A;  4MEM A;  2DZM A;  1K53 A;  1LXD A;  2C9W B;  2SEB D;  5HFY A;  2GBK A;  2HDE A;  1K50 A;  5LXH A;  2M0A A;  1JWS D;  3GOE A;  2M56 B;  4LJP B;  2JQR B;  5H8Y E;  4LLG M;  2IGH A;  1JWA D;  1ZXI A;  4IDI A;  4F7Z A;  5E6J A;  4KZ0 A;  5HI1 A;  3S2A A;  1EU3 A;  1MFW A;  1KJT A;  2KD0 A;  1ZW7 A;  4C4V B;  4RGT A;  4W9I A;  4MEL A;  3TEY A;  1XCT L;  3IVF A;  4MGI E;  1K8R B;  2MP2 A;  3AE6 B;  4MSQ B;  2MQJ A;  4REZ A;  3X0W A;  1P0R A;  3ZQ4 A;  5T8I A;  1E5W A;  3LB8 C;  3TEZ A;  4WJN A;  4FJY A;  4GMV A;  4BZA A;  3SFD B;  1HEZ E;  1EO6 A;  1F9J A;  2KDF B;  1WF9 A;  2KDB A;  5BMH A;  1EUV B;  1WGY A;  1STE A;  1V2Y A;  3IAS 1;  3ZRF A;  3ZTC A;  2CR5 A;  5BYQ A;  2C7N B;  5JZE B;  4OHJ A;  3V3X A;  2HJ8 A;  1OEY J;  2WU2 B;  4H2A A;  4EKU A;  3H7P B;  2LWP A;  4LK0 M;  3PSE B;  4BKT A;  5LNK 1;  4C7Z A;  4NPN A;  1RYJ A;  1GJZ A;  4XWW A;  4GXB A;  1E8W A;  2BWF A;  3L08 A;  4JGH B;  3GB1 A;  5C1Z A;  4K7S A;  2IJ0 A;  2PTL A;  3AH7 A;  2V4I B;  1YN3 A;  1FRD A;  2EMT A;  4KSL C;  1RRB A;  3DBR B;  3R66 C;  4E74 A;  3KQ4 A;  3KWV A;  2DZK A;  1GC7 A;  4J6I A;  1WXA A;  2INP E;  2ICI A;  3AE4 B;  5C23 A;  2GLS A;  1XCQ L;  2WDR B;  3NRZ A;  4LDT B;  1UZX B;  2G45 B;  3RNA C;  1N63 A;  1I4H A;  2V3N A;  1V81 A;  1Z2M A;  4GDL A;  2CHZ A;  2ACZ B;  4A55 A;  3AE1 B;  1BXT A;  2MHJ A;  4MH8 A;  5IA7 A;  1J7B A;  4LNO A;  1T0Q C;  5GXG B;  4K3B A;  3CWI A;  2MJD A;  2DLB A;  4LNI A;  2G4S A;  2WX0 A;  3C0R B;  3E9S A;  1L2N A;  1D4B A;  1V97 A;  4I6N B;  4PS8 A;  1E7P B;  1SIJ A;  3A4R A;  1EWY C;  1YMH E;  3ZTD A;  4USA A;  1GOZ A;  3PV1 A;  3RMK C;  3EFC A;  2HE7 A;  4NJ6 A;  3RN9 C;  2CS4 A;  2Y3A A;  2MP2 B;  3IBE A;  3OJ4 B;  2JZ3 B;  1DYQ A;  1WMH A;  4IW0 A;  3DWM A;  2BBC A;  4XDD A;  5IN7 A;  3LXF A;  3WCQ A;  2EEL A;  4HLE A;  3ECI A;  4EE2 A;  3NVW A;  1TBE A;  2ZNV C;  1TTN A;  1V1O A;  1SE2 A;  1D5Z C;  1MG8 A;  4W9D A;  3RZF A;  1WSP A;  3BVZ A;  4A3P A;  3AE3 B;  1V1P B;  3PHX B;  5FK9 C;  1WY8 A;  2QSD A;  2LHE A;  4GDK A;  3VQI A;  2QJL A;  4ZYN A;  1Z5S B;  2KMC A;  2NPT B;  4B0M A;  2WWZ A;  2N7J A;  3KYC D;  3U2S C;  2KQS A;  2N1W A;  4G11 A;  5L95 C;  1B9R A;  3C19 A;  2V3P A;  3IG3 A;  2EMS A;  3WAN A;  1R4N B;  1SJH D;  1KOT A;  3VVW B;  2NS5 A;  1HZ5 A;  4TQ0 A;  2DYB A;  2W55 A;  1BT0 A;  1L6V A;  1P98 A;  4IOI E;  4P16 A;  1V6E A;  3Q14 C;  4RGM A;  1SB3 C;  2DZI A;  4PS3 A;  1Q10 A;  2JZP A;  3PRZ A;  4PYZ A;  3VR9 B;  5D94 A;  3U30 A;  3ZW3 A;  2KT7 A;  2MJ3 A;  1ZDX A;  4AP4 C;  3QAQ A;  5IO9 A;  4XGA B;  1J7C A;  2K6D B;  4KZC A;  4ZRK A;  2N9L A;  1H8C A;  3C8Y A;  3U4E G;  2MH7 A;  2PE9 A;  3ABV B;  4ANX A;  4DHJ B;  2NTS A;  1ESF A;  3CIR B;  3V61 A;  1WJU A;  2Y5C A;  3KUC B;  3KW5 B;  4AWJ A;  4WWP A;  3RCZ A;  4ZHP A;  1XXG A;  1C79 A;  2DZJ A;  1KRH A;  3RNC C;  2K8C A;  1V5O A;  4KGT A;  4KIK A;  1D3Z A;  2PW9 A;  4M8M A;  4CO7 A;  2BYV E;  2FCS A;  3CST A;  3UQA A;  1XLP A;  3QIJ A;  2JPH A; 
#chains in the Genus database with same CATH homology
 2OHF A;  2WP9 B;  1XLO A;  2EKI A;  4N6E B;  1QOG A;  2ONQ A;  1QF6 A;  3BK1 A;  1F2R C;  1D6E C;  2J4X A;  3N9Y C;  2PVG C;  1WWT A;  3NUH B;  2BTE A;  2ON8 A;  1N5W A;  1ACC A;  3FIL A;  1ROE A;  3OWE B;  3RFZ B;  1HXY D;  3Q8C A;  3NS1 A;  3FAH A;  4RNA A;  1E9M A;  1MI0 A;  3PZ7 A;  1N62 A;  1RFK A;  1JCK B;  2RMM A;  4WIP A;  1N5X A;  3Q69 A;  4DXF A;  4GLS C;  2IPK D;  3FIL B;  3KLS X;  3O13 A;  5AUK A;  1I4G A;  4CQN A;  1YN5 A;  3NZ3 A;  1F2R I;  4XE0 A;  4YSY B;  1XF5 L;  1IBX A;  4ZHO A;  1JML A;  2DWQ A;  3AE5 B;  3Q8E A;  4OZA A;  1VJK A;  1C4P A;  5HHD G;  2LMC A;  2WXQ A;  2PIA A;  3VR8 B;  1HQR D;  1CZP A;  1JRP A;  1K51 A;  1TY2 A;  1T6B X;  4A6Q A;  4HKQ A;  3BYT B;  1IBX B;  1XO3 A;  2QIE B;  3AEG B;  4DQO C;  2AQ1 B;  3P4P B;  1WGK A;  2Z8L A;  1JQ4 A;  2WXP A;  1EWC A;  2D5G A;  5HG2 A;  1TKY A;  4HRS A;  1QLB B;  4OVZ A;  1JAL A;  1P7E A;  1ZUD 2;  2JYT A;  1DOX A;  4ZRQ A;  2YEP F;  3ZJU A;  3R2I A;  3P63 A;  2CU3 A;  1FCC C;  1XEE A;  2AQ3 B;  3P42 A;  1PYW D;  1ZE3 D;  1SE4 A;  3LYY A;  3V05 A;  4ZRP A;  1FCL A;  2E3T A;  1OFF A;  3HRD D;  1D5X C;  1WYG A;  2L83 A;  2K5P A;  3W5V B;  1UNS A;  4HRO A;  4J3O D;  5BYS A;  1K52 A;  5C3J B;  1GB1 A;  1WRI A;  2GB1 A;  4M0W A;  4OW0 A;  4L23 A;  3SFE B;  1CK1 A;  4ITK A;  1PGX A;  2M19 A;  2K3U A;  1OQR A;  2K22 A;  1QOA A;  3U52 E;  1NVI D;  2KDM A;  1PFD A;  3AM9 A;  1FM0 D;  1L5P A;  1QOF A;  5I4D A;  3AN1 A;  4HEA 1;  1I7H A;  2WLB A;  4C56 C;  4YXD B;  4MAC A;  4XDC A;  2LJI A;  4YTP B;  2BYT A;  2WS3 B;  5D7G A;  3BYY B;  1DOI A;  1VDV A;  1K53 A;  4NAW B;  1GAQ B;  2SEB D;  5HFY A;  2HDE A;  2WXJ A;  5AUI A;  1K50 A;  4C80 A;  4YT0 B;  1QQR A;  1TY0 A;  3MHZ A;  2M0A A;  3TSS A;  2JU6 X;  1T3Q A;  1FNU A;  1JWS D;  2WXK A;  3AEB B;  1TYG B;  4YSZ B;  4IKG A;  2M56 B;  1FO4 A;  1TZO A;  2JQR B;  3P4Q B;  5H8Y E;  1FD6 A;  3IT6 B;  1JRO A;  1VLB A;  3BWU D;  2H89 B;  1NEN B;  4LLG M;  2IGH A;  5BMI A;  1JWA D;  4WQM A;  1ZXI A;  4IDI A;  5BYR A;  2JXT A;  2OED A;  3EA6 A;  5E6J A;  5HI1 A;  3VRA B;  2XN9 C;  1EU3 A;  1XLN A;  1ET9 A;  2W54 A;  4NAM A;  4RGT A;  1KLU D;  1E0Z A;  3EGR A;  5G5H A;  4RFB A;  2WXM A;  3TEY A;  1XCT L;  2JWU A;  4P6V F;  4XWT A;  1NYQ A;  2QIL A;  2Q5W D;  4YTN B;  2TSS A;  1JW9 D;  2J53 A;  5D3I B;  1RWS A;  4RF1 A;  3TEX A;  2RPV A;  5D3D A;  1CJE A;  3AE6 B;  1C4C A;  4REZ A;  2L52 A;  1L4Z B;  3ZQ4 A;  1ZOY B;  5T8I A;  4YSX B;  1ENF A;  1FNW A;  1L0Y B;  3TEW A;  2WXO A;  2I2Y A;  3IT4 B;  3LB8 C;  3NVV A;  1SJE D;  2I38 A;  3TUO A;  3TEZ A;  1N60 A;  2X38 A;  3R8B A;  1T5X D;  1AYF A;  1PDX A;  2W82 A;  4KKJ A;  4TSS A;  3HVZ A;  1AN8 A;  1CQV A;  1JWU D;  2AX5 A;  1FFU A;  4ZYS A;  4KX6 B;  5MPO A;  4L1B A;  1C78 A;  1ZDV A;  2MEK A;  3SFD B;  2BS2 B;  1HEZ E;  1ZPS A;  1IUE A;  2WDQ B;  4AQ7 A;  1FXA A;  3J9C A;  2BS3 B;  5BMH A;  1QKZ A;  1UWM A;  1J7A A;  1HA5 A;  1STE A;  1SXT A;  3IAS 1;  1BML C;  1C77 A;  1E10 A;  4JWU C;  5BYQ A;  3AMZ A;  5BMG A;  1XLQ A;  1FEH A;  4OHJ A;  2PLP A;  3V3X A;  1KTK A;  3Q8F A;  1P7F A;  2L1A A;  2WDV B;  2WU2 B;  4H2A A;  2V0G A;  4LK0 M;  4ZOH C;  5TSS A;  1MVK A;  5LNK 1;  1DOY A;  4C7Z A;  4A9A A;  3MC0 B;  2KAJ A;  3ZJT A;  1RYJ A;  1TS4 A;  3NVY A;  1C4A A;  1GPX A;  4XWW A;  3ETR A;  1TS2 A;  3MFG A;  4NJC A;  3BVG A;  1UUP A;  1D5M C;  2L32 A;  2R61 A;  1KH0 A;  3GB1 A;  1VRA B;  3AE8 B;  2IJ0 A;  2FBW B;  2PTL A;  1FFV A;  3P4R B;  1VZ8 A;  3AH7 A;  2V4I B;  1YN3 A;  1FRD A;  1YQ4 B;  1FNV A;  4RGN A;  2IDY A;  1TS5 A;  1YJJ A;  3GS2 A;  2QEJ C;  4NZL B;  2BT6 A;  1L6U A;  2SAK A;  3W1S A;  1KFY B;  3KQ4 A;  3KWV A;  3P4S B;  2WXG A;  2LUM A;  3EUB 2;  4ARI A;  4FXC A;  2INP E;  2ICI A;  3AE4 B;  3W2D A;  2HTM E;  1EM7 A;  2LFI A;  1XCQ L;  2WDR B;  3NRZ A;  1I4Q A;  4TQ1 A;  2N9K A;  2K9X A;  2WNM A;  1OQQ A;  1N63 A;  1I4H A;  1QOB A;  2XNA C;  2V3N A;  4JPS A;  3SEB A;  2DYO A;  4RCO A;  3IXS A;  4JWS C;  2NTT A;  1L0V B;  2PVO D;  4TMA B;  4KGS A;  1A70 A;  2KMM A;  3PO0 A;  2ACZ B;  1MPE A;  3AE1 B;  1BXT A;  4N58 A;  4A55 A;  3W5U B;  5FKA C;  2E6X A;  2BW2 A;  4MH8 A;  4A90 A;  1J7B A;  3AED B;  5GXG B;  3CWI A;  2MJD A;  4L2Y A;  4GDL B;  1SSN A;  3RPF C;  3GP7 A;  4DXG A;  1IGD A;  3AV8 A;  3W9C B;  3MP9 A;  1RM6 C;  2DLB A;  2YEP B;  2KAC A;  3L4P A;  3AB5 A;  2W3R A;  1QT9 A;  1EU4 A;  5EE3 A;  2INN E;  2CJO A;  3KWL A;  2MJE A;  3E9S A;  1D4B A;  3BZD B;  1V97 A;  1C76 A;  3VRB B;  1BUI C;  1E7P B;  1SIJ A;  1EWY C;  1L0X B;  3PZ8 A;  1KF6 B;  1YMH E;  2VZK B;  2ZW0 A;  3R2T A;  5EE9 A;  1UWX A;  1GOZ A;  3NVZ A;  4USA A;  1TKE A;  1YN4 A;  3H8H A;  2FE8 A;  3BK2 A;  2BS4 B;  1SEB D;  4OZC A;  1LO5 D;  2Y3A A;  1VZ6 A;  3B9J A;  4HKZ E;  1NYR A;  2N0S B;  3B2G A;  2LHD A;  1YNT E;  1TS3 A;  2KWD A;  2VZK D;  4ARC A;  4D2K A;  1DYQ A;  2WQY B;  2BB5 A;  4HJG E;  2K0P A;  2WXH A;  2B76 B;  3DWM A;  2BBC A;  4XDD A;  5H92 C;  3LXF A;  2ZW1 A;  3WCQ A;  1V8C A;  2EEL A;  1PGA A;  1N61 A;  4EE2 A;  1V1P A;  1FXI A;  1WXQ A;  2WXR A;  3AEF B;  3NVW A;  1V1O A;  1NEK B;  1SE2 A;  1HZ6 A;  1D5Z C;  2KN4 A;  3IAM 1;  4MT5 A;  2J52 A;  3HVD A;  1FRR A;  5FR3 A;  5EE0 A;  3T3N A;  2PKO A;  2WXF A;  1F77 A;  1WSP A;  3BVZ A;  1FMA D;  3I57 A;  2FUG 1;  3AE3 B;  1SE3 A;  3BII D;  2Y5P A;  4MM3 B;  4RGO S;  4YTM B;  1V1P B;  1R7S A;  3I9V 1;  1I4P A;  2RDG A;  3AEA B;  5FK9 C;  1C9F A;  1JWB D;  1Y56 A;  2WXN A;  1AWD A;  2J42 A;  2QSD A;  1QIL A;  4YWG G;  4OZB A;  3SR6 A;  3ZGZ A;  2LHE A;  2DYM A;  3VQI A;  2QJL A;  3Q8A A;  1B1Z A;  2G1E A;  4N59 A;  4B0M A;  1ET6 A;  4WUR A;  2CJN A;  1ZP0 B;  2N7J A;  2WXL A;  2LEK A;  2NMQ A;  1SBB B;  4US9 A;  2GRI A;  3U2S C;  1AW7 A;  3U7Z A;  4UDU C;  2RDH A;  1VZ7 A;  1F0Z A;  2JYE A;  1B9R A;  2LGI A;  2V3P A;  4GDK B;  1IGC A;  1FIQ A;  3B2F A;  1SJH D;  5C2T B;  4JX1 C;  4KKI A;  2QMT A;  3T3O A;  2JX5 A;  3UI3 A;  1HZ5 A;  4JE3 B;  4WH4 A;  4TQ0 A;  4Q2J A;  2W55 A;  4WWM A;  1L6V A;  4IOI E;  2IGD A;  4P16 A;  3ZJV A;  1I4R A;  1SF0 A;  4RGM A;  1SB3 C;  1Q10 A;  1UGJ A;  2JZP A;  4C7Y A;  4US8 A;  1E6E B;  3VR9 B;  4A8X C;  2MJ3 A;  4WAF A;  1ZDX A;  4RH6 A;  3ZYY X;  2WU5 B;  1TKG A;  1J7C A;  3MJ5 A;  3DWG C;  1VR9 A;  2N9L A;  1JWM D;  5EE1 A;  3P1M A;  3C8Y A;  4AS1 A;  1I4X A;  1NI3 A;  2W3S A;  3U4E G;  4B0E A;  3AE2 B;  2IGG A;  2MH7 A;  2KQ4 X;  3AEE B;  3AEC B;  4R3D A;  1DGJ A;  3FC4 A;  3ABV B;  3E56 A;  4RF0 A;  2PMV A;  1GB4 A;  3HUI A;  2NTS A;  1ZXH A;  2AQ2 B;  1ESF A;  1MHX A;  3URY A;  3CIR B;  1YQ3 B;  5JXV A;  3BVM A;  2G9H D;  4KGR A;  2Y5C A;  4LTU A;  1KLG D;  4PT5 A;  4ZHP A;  1XXG A;  2JSV X;  2WXI A;  2GI9 A;  1C79 A;  1YJI A;  1MHH E;  1KRH A;  4O1N A;  4KGT A;  1TJE A;  2PW9 A;  1M4V A;  2BB6 A;  3AE7 B;  1PUT A;  3Q8B A;  2H88 B;  5G5G A;  1L4D B;  1PGB A;  1XLP A;  2DBY A;  3AE9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...