1DOXA

1h and 15n sequential assignment, secondary structure and tertiary fold of [2fe-2s] ferredoxin from synechocystis sp. pcc 6803
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
96
structure length
96
Chain Sequence
ASYTVKLITPDGESSIECSDDTYILDAAEEAGLDLPYSCRAGACSTCAGKITAGSVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCTIETHKEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FERREDOXIN [2FE-2S]
publication title 1H and 15N NMR sequential assignment, secondary structure, and tertiary fold of [2Fe-2S] ferredoxin from Synechocystis sp. PCC 6803.
pubmed doi rcsb
total genus 12
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 1995-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1doxA00
4IDIA 2E3TA 1E0ZA 4C80A 1FXAA 1FFUA 2CJNA 5EE3A 3FAHA 3AE6B 1JROA 2JQRB 2WU5B 3AEGB 1E10A 1RFKA 1WWTA 4JX1C 3DWGC 3AMZA 1JW9D 3AV8A 1L6UA 1N60A 1JRPA 1FO4A 2Q5WD 1E7PB 3AE4B 1FXIA 3AE5B 1RM6C 3AEEB 3NVWA 4HRSA 3W5UB 2BT6A 3AE2B 4JWSC 4USAA 1L6VA 1ZXIA 2MJDA 5EE0A 2BS4B 3SFEB 1L5PA 1V8CA 1YQ4B 1T3QA 2L83A 2HTME 1ZUD2 3B2FA 3P4RB 1TYGB 5AUIA 1N61A 3VR8B 1N5WA 1QOBA 3VR9B 1AYFA 1VJKA 1R7SA 1CJEA 4YSXB 3AEBB 3DWMA 4ZOHC 1YQ3B 1GPXA 1A70A 1XLQA 1XLNA 1ZP0B 2DBYA 3EUB2 4ITKA 4N59A 1N63A 1XLPA 5C2TB 2PVGC 3P4SB 4WWMA 1TKYA 4C7YA 4YT0B 1NYQA 1KFYB 1PFDA 4US9A 1JALA 4N6EB 3W5VB 3B2GA 1JQ4A 1SF0A 1NI3A 5AUKA 1NEKB 3HRDD 2WDRB 2KMMA 4ZHPA 3KWLA 3P63A 4YSZB 1QF6A 2WLBA 3VRAB 4C7ZA 3AEDB 2QJLA 2G1EA 3BIID 3ETRA 4WQMA 1RWSA 2JX5A 2L52A 1IUEA 1JWBD 2MJEA 2W54A 1FRRA 1GAQB 3AE3B 1DOIA 1WRIA 1WGKA 1WYGA 3L4PA 5MPOA 1B9RA 3ABVB 3W9CB 3P1MA 2H89B 1N62A 4US8A 2K9XA 1NYRA 1F0ZA 1OFFA 1FMAD 1TKEA 2W3SA 5EE9A 2EKIA 1UWMA 1QOFA 1QT9A 1OQQA 3PO0A 3AE8B 4YXDB 2PKOA 3NS1A 1E9MA 1FRDA 1NVID 2K5PA 3AE7B 3AEFB 2K22A 3B9JA 3VRBB 4YTMB 2Y5CA 2WU2B 4P6VF 4KX6B 5C3JB 2WP9B 1SIJA 5EE1A 5H92C 1YJJA 1QOGA 3AM9A 1QLBB 1TJEA 2M56B 3FC4A 1XO3A 3SR6A 4YTPB 1KF6B 1DGJA 2PVOD 4LTUA 5G5GA 1PUTA 2M19A 3CWIA 3ZYYX 1DOYA 3P4PB 2ACZB 3RPFC 2W55A 2WDVB 1N5XA 2W3RA 2CJOA 2MJ3A 5G5HA 4FXCA 3AN1A 2PIAA 2OHFA 2QIEB 1WXQA 3LXFA 1XLOA 3HUIA 1OQRA 1KRHA 1ZOYB 2WS3B 2LEKA 3NRZA 3P4QB 1FIQA 1PDXA 3AE1B 2CU3A 1RYJA 3CIRB 4HROA 5H8YE 1CZPA 2AX5A 1FFVA 4A9AA 1TKGA 1NENB 3WCQA 2DWQA 1AWDA 1E6EB 4JWUC 1J7BA 2N0SB 3HVZA 1J7CA 4ZHOA 3LB8C 2BS3B 3AE9B 3AH7A 4N58A 2BS2B 3AEAB 2MH7A 5GXGB 2FBWB 2WQYB 1J7AA 1V97A 3AECB 2WDQB 1L0VB 1I7HA 3AB5A 4YSYB 1QOAA 1VDVA 1FM0D 1JWAD 1ROEA 1YJIA 2H88B 3NVYA 4YTNB 2KAJA 1VLBA 1SB3C 1DOXA 3NVVA 3NVZA 2B76B 3SFDB 1EWYC
chains in the Genus database with same CATH superfamily
4IDIA 1WZ3A 4B95A 1C4PA 5EE3A 2PW9A 2XNAC 2L0FA 5I4DA 3KYDD 3IXSA 4WJPA 1JRPA 2LD9A 2RSUA 3NHEB 4HRSA 1L6VA 4GIVA 2N9LA 2WDTB 3TBLD 2BBCA 1C79A 3WAMA 4IWOA 1PQSA 1N61A 3LDZE 3Q3MC 2KO3A 3DWMA 2KMAA 5HHDG 4HPLB 2RPQA 1XLQA 4IM0A 1HE8A 4ANXA 4DXFA 4M0WB 1IBXA 3PZ7A 3O13A 3I9V1 3T8MA 2INCC 3ECIA 2RGFA 3FKYA 5E6OA 2N9EB 3VXWA 2D10A 3N1XC 2L52A 2MJEA 2UU7A 3GB1A 3SHQA 2K9XA 2KTRB 3JVZX 3PO0A 4M02A 3ZXRA 4WH4A 3B9JA 2NBWB 2K8CA 2DYMA 2GOWA 4M0WA 3TEXA 3IAS1 5AZGA 1RLFA 1Q5WB 4EZJA 4BOZB 2FIFA 4B0MA 1B1ZA 4MJSB 3AN1A 4TUUA 2IY1B 3NRZA 3RNBC 3BYTB 3N1YC 1TKGA 3B0AA 2GBJA 2B3AA 4JL9A 1L0XB 4WAFA 2GBRA 2QC8A 2MQJA 3AH7A 1GG3A 4WJOA 2R2OA 2WXNA 3NVYA 1TS4A 3A9JB 4DDID 4ANWA 2MBEA 4MELA 4C80A 1FFUA 2MLBA 2WXQA 4B0EA 1E10A 4II2B 2PEAA 3AU5A 4MJSA 2LWPA 2LGDA 1IPGA 4I6LB 1BXTA 2KHWB 1L4DB 2FIDA 1ZXIA 3TJPA 2HTHA 2G45B 2RPVA 4MSMB 3UIOB 5AEKB 4S0RA 3RZFA 1VJKA 4YSXB 1K52A 1R4NB 2IGGA 5DPTA 1ACCA 2R61A 2RD0A 2V4LA 3EUB2 4ITKA 3A9JA 1XLPA 2D3AA 4ZRIA 2A5UA 2V3NA 2K8HA 4RGOS 4MH0E 4PS8A 2SAKA 3VRAB 3AEDB 1ET9A 2JXXA 2LGIA 3WALA 4PS3A 2IO0B 2MBBB 1KLVA 2JYEA 4W9HA 3DVGY 4YTMB 3R7RA 3PT2B 4IM2A 3KYCD 2ZEQA 5LXIB 4WURA 1DGJA 1ZGUB 1FNWA 4WWNA 1GB1A 2BWFA 2AQ3B 3HM3A 2YLMA 1TTNA 1V86A 1V9JA 1QQRA 3EFUA 1E8ZA 2CHZA 4ARIA 3TEZA 5H8YE 2ZW1A 3QK0A 2AX5A 3C8YA 2MX2A 3VUYA 1J7BA 2DLBA 1J7CA 2K1FA 4GDKB 1J7AA 2JU6X 4TQ0A 1ROEA 4DHZB 3VHTC 4IOIE 1WMHB 3U4EG 4DHJD 3UQAA 4K3CA 3K9PB 1JWSD 1FXAA 3IFWB 3N30A 2CJNA 1XT9B 1C4AA 3NVWA 1WX9A 3JSVB 2KDFB 4RF1A 3L13A 2R2QA 1L7YA 2JY6A 4J3OD 1A5RA 2SEBD 1CJEA 4AOFA 2NBUA 3LYYA 3L17A 1STEA 4OZCA 3RYTA 2KOXA 5IKCM 3ZNID 3PTFC 3UF8A 2LFIA 1SGHA 2WXJA 4LK0M 5IAAC 4GLSC 1E8YA 3HRDD 3P63A 3ZDTA 2V4IB 3HVDA 4MT5A 1IUEA 3JSVA 2NTSA 1S3SG 5EDSA 2ZVNA 3DBLB 2ZCBA 2NPTA 2MWSB 4OZBA 3RNGC 5T8IA 4FJVB 1SXTA 2L76A 4N9F4 1TGZB 2LXAA 2C7HA 2NR2A 5CHFA 2ACZB 1GB4A 2WDVB 2KDBA 4GMVA 2C5LC 3VVWB 3APCA 4O1NA 4OVZA 4HROA 1HTOA 5D7GA 1I4HA 1WIAA 1WM2A 5DPSA 1SE3A 1SBBB 1OTRB 2FUG1 3A9KB 1P7FA 1D5XC 1VZ6A 2N9KA 2M8SA 3Q2AC 3T9LA 1WGRA 2Y5PA 4OZAA 1P0RA 2E3TA 3ZW3A 1QZEA 2DZKA 2KC2A 4MGIE 2M17A 2N7EA 1C77A 2KX3A 2AWTA 1RM6C 4USAA 4TQ1A 3PHWB 2OOBB 1L5PA 4FADA 1KLGD 3OLMD 2HTME 2J52A 1DYQA 1WGGA 3BINA 4XWTA 4H2AA 3A9KA 3TCAA 1Q1OA 2DBYA 5BO4B 3ZRCA 2DAJA 2FNJB 1TKYA 4ZDVA 5FR3A 3DBRB 4E71A 5HKHA 2I1KA 5J18A 1D4BA 2QJLA 3BVMA 4ARCA 4KV2A 3HHMA 3M62B 3L4PA 3PRZA 1B9RA 1WYGA 3MFGA 3OG5A 2BVCA 3H1UA 4GDLB 4EKUA 1V1PA 4US8A 1Q0WB 3VQIA 2PKOA 4AJWA 1FRDA 2IGHA 3QWZB 1SIJA 1QLBB 1TJEA 1C3TA 3SR6A 2LXCA 2IYDB 3Q8CA 1OEYJ 4HJKA 3ZIMA 2D11A 3NZ3A 3PRMB 4LNNA 2BKRB 3GP7A 2ZW0A 3AE1B 3I57A 4KSLC 4MEMA 4KGSA 5C23A 3L54A 1XXGA 2K0PA 2JT4B 2V9HA 1K8RB 4N58A 4ZRJA 3BVZA 2BS2B 3Q6BA 4NQLB 2JYTA 3L0WB 2XK5B 2VZKD 4MGKE 1QILA 5DCNA 3TUOA 2PPHA 4LDTB 4F1SA 3ZO5B 1RFKA 1WWTA 4C4VA 4A6QA 2KVRA 4A8XC 1HTQA 4HCPB 4L2YA 1HEZE 5E6JA 1UD7A 2ZJDA 3SFEB 1Q10A 1YQ4B 2FCMA 2G4SA 5JZEB 4IG7B 3QCAA 3IHPC 4PYUA 2WGSA 1D6EC 2GB1A 1KJTA 1N63A 2MBOA 5C2TB 1FCCC 3W1YA 4J6IA 3A33B 2J0MA 2G3QB 4MM3A 5JH5C 5AUKA 4ZHPA 1I4PA 1TY0A 4KKIA 1CQVA 4JE3B 3ETRA 2ONQA 3IT6B 2H89B 4CHKA 2D2QA 2EKIA 2MCNB 3Q8AA 4K7WA 1NVID 1VR9A 1I4RA 3VRBB 4XGAB 2DENB 3KUZA 2DNFA 4KX6B 3APDA 2KC1A 2JF5A 3EHVA 3FC4A 2JUOA 2DZJA 1WY8A 2M19A 3ZYYX 3Q3JA 2IJ0A 2VRRB 4F8CB 3GZNI 2PIAA 4OVVA 2AQ1B 3NZUA 3IG3A 1OQYA 3HUIA 1D5ZC 4WQOB 1UGMA 3DQVA 4PS7A 3QARA 2GRIA 4XC2A 3V3XA 2AEHA 3WIMA 5KHQA 1WH3A 4A3OA 1ZKHA 4NNJB 5DPRA 2ZCCA 3R66C 1WXSA 1EWYC 3FILA 2NTTA 2HJ8A 4BKTA 2KWDA 4HWIB 1JW9D 2QDFA 4JGHB 1FXIA 4RFBA 2L8JA 3TEWA 1WYWB 1TY2A 2NVUI 1T3QA 3P4RB 2G4DB 2RDGA 2J42A 1ZPSA 2V1YA 2BPSA 4ZOHC 4K7UA 1A70A 1ZP0B 2K6DB 2O6VB 2PVGC 4RGMA 1JQ4A 2WXLA 4N6EB 1SIFA 1F2RI 3OAWA 2OEDA 4HPMB 4I6NB 4W9FA 3V05A 5JXVA 3ABVB 3SEBA 3ZJTA 3PZ8A 1WR1A 1E90A 1NYRA 2KQSA 5AZHA 3U7ZA 3EFCA 3AE8B 3Q3OC 3VTWA 4P1CC 1P1AA 1GNUA 1BT0A 2N9PC 2O6VA 1QOGA 1HXYD 4YTPB 2WXIA 4WJQA 4EFOA 1DOYA 3PREA 1Y56A 2J7QB 1WJUA 3CMMB 3L08A 2QIEB 4EZLA 3A4RA 1P98A 3ZTCA 4B9KA 3UGBB 3IT4B 4AQ7A 3EGRA 2KN5A 1UZXB 4JPSA 3X0WA 4JWUC 1XCTL 4ZHOA 2IO2B 2K8BA 2FUHB 3OJ4B 4YSYB 3AB5A 4YTNB 3U8ZA 2BWES 2KK8A 3SDLC 1YJJA 1HQRD 3MJ5A 3V6CB 4KDIC 4M8NA 2JQRB 3AEGB 1UWXA 1V2YA 3AULA 2M0XA 3VH3B 2MHJA 3AE5B 3UI3A 3EA6A 1P9DU 3SU8X 2KTRA 2LVPA 2MJDA 2GBKA 2BW2A 4ANUA 2I2YA 1WR6E 3B2FA 1YN3A 4RM9A 3VTUA 3H9DA 1GOZA 5E6PA 3HIZA 1GUAB 3TMPB 4IWQA 2L0TA 2PMVA 3KVFB 3HK0A 4RMAA 2KJRA 2KFKB 1ESFA 4QAYA 2C7MB 2J4XA 1WRIA 3OJ3A 2ON8A 2KJHB 3R3MA 4K7SA 5D3IB 1QOFA 1OQQA 4ICUA 4JIOU 3Q8BA 2Y5CA 3RT3B 3UQBA 3PZDA 1WJ6A 2DX5B 3A1QB 2JRHA 2KDEB 4FLHA 4REZA 2FCSA 1KM7A 1LM8B 3RPFC 2W55A 1LQBA 5IN7A 2KFKA 2KX0A 4IM3A 4W9EA 5FK9C 1EO6A 1OQRA 1AN8A 1CMXB 3PHXB 3QIJA 2PE6B 2CHXA 4HDQA 4K1RB 2V0GA 2N4FA 4EUTA 3GE3C 5D2MB 3ZUNA 4FHKA 2QEJC 4NAWB 1T5XD 1ZXHA 2C9WB 1Y8RC 3NG0A 3A1QA 1C9FA 2WX1A 4DK5A 2JZZA 1F1HA 1E0ZA 1NDDA 1V81A 2WXRA 3QX1A 2M4NA 1N6ZA 4P16A 1XCQL 3M95A 4KKJA 3AV8A 2K25A 3E9SA 2FAZA 3W5UB 1SJED 2KTFA 1WJ4A 4ASWC 2CKHB 2NBVB 1V8CA 3M3JA 5CHVC 2KKCA 1TS3A 2K6QA 4OW0A 2QHOA 1WFYA 1QOBA 2N9XA 1YIWA 1MG8A 4B6WA 2C7NB 4DBGA 4HPPA 4N59A 5IP4D 1MI0A 2CU1A 1RAXA 4US9A 2KVZA 3ONSA 1CK1A 3KWLA 1QF6A 2WXKA 2Z0DB 4P1BC 4A20A 1YX5B 4AWJA 2W54A 1DOXA 1WGKA 2LHEA 1H8CA 4GDKA 4MDKE 2Z59B 4YXDB 2K5PA 1KOTA 1YN4A 3CSTA 3S2AA 1WMHA 4TV3A 1LGRA 1YX6B 2FCNA 4LJPB 3VDZA 2M56B 2BQQA 2TSSA 1I42A 3RNCC 4FBJB 3AXCA 2DYOA 4RNAA 5HG2A 3EECA 2WWZA 4WJNA 5LLIA 2WS3B 3ZNHB 2PJHA 5BYSA 2N1VA 1PDXA 3CIRB 4A9AA 3N32A 2KYWA 1KLUD 3HVZA 1YJ1A 1S1QB 3PRPB 1V97A 2LVQA 3NJTA 4HXDA 4G11A 2C60A 5BYRA 4LNIA 2KD0A 3DBSA 4FJZA 4EZKA 1VLBA 1KH0A 1WRDB 4CO7A 3RUIB 5TSSA 2LHDA 2CHWA 2WU5B 1R4MI 4JX1C 3TEYA 3DVGX 4CYEA 3DVNU 3RNAC 3PS6A 1FD6A 3VH4B 2KACA 3VUXA 2YVCA 1V1OA 2LUMA 1E7VA 2YEPB 1K51A 2AQ2B 3NS8A 2O2VB 2EKEC 2WXFA 3VUWA 1TBEA 3W1SA 3P4SB 3NOBA 1L2NA 4YT0B 3GZNB 1I4GA 2KDIA 5HFYA 3V62A 4W9CA 2QSDA 1EUVB 4HEA1 5MPOA 1KTKA 3P1MA 3Q8FA 3R2IA 4WAAA 3DCGA 4DXAB 3ML8A 4GSWA 2Y3AA 1EM7A 3AE7B 5J2RA 2WX0A 1UGJA 1VZ7A 4KVGB 5C3JB 5IOIA 1M4VA 1WX8A 5H92C 3ZQ4A 4BVUC 5BMIA 5TR5A 1YD8U 1KF6B 1YN5A 4LTUA 4W9JA 1PUTA 2L05A 2BYTA 5G5HA 5LNK1 2KZRA 1ZE3D 4ACFA 1KRHA 3KUCB 2LEKA 4L23A 2MA9B 2KQ4X 4ZRKA 1XQQA 2ZPYA 1WSPA 2FBWB 2BB6A 4FN2A 4TSSA 2ASQA 3U2SC 4GOCA 4BKGA 2BTEA 1TS5A 1V5OA 1F77A 2B76B 3U7DA 2BYFA 1Z5SB 3MP9A 3DBHI 3MHZA 4RCOA 3JW0X 4XDDA 1C78A 4GDLA 1E7PB 1MHHE 1SE4A 2WHIA 5G2NA 5EE0A 4ZRQA 1T0YA 3E56A 3WAPA 3AU4A 3URYA 1YOVB 4ZYSA 4W9LA 1WJNA 2UYZB 5IA7A 2CR5A 5L95C 4YWGG 3Q69A 4C7YA 2INPE 1UBIA 4R3DA 2KXJA 1SF0A 2IPKD 4JQWC 3I63C 4LDTD 4KIKB 2DHZA 3RZWC 1V5TA 2KNBA 4RM8A 2BYEA 2JX5A 3ZGZA 3QJZA 1WF9A 1DOIA 2M0AA 1F0ZA 1UWMA 2XK5A 3NS1A 3BVGA 3H7SA 3RCZA 4DHZE 3U30A 2BYVE 1ISNA 4P6VF 2K3UA 3R2TA 4BKSA 1WGYA 5D3DA 1P3QU 4LNFA 3ML9A 3DBLI 3P4PB 4ZYNA 2W82A 4HJGE 4LNOA 2GMIC 3PPAA 1EF1A 2D07B 4DQOC 1V49A 1WXAA 2WYQA 2WNMA 4KZCA 4P7IA 2KWUB 1E6EB 4NJCA 3H6NA 3X23A 5BMHA 1EU3A 2LRUA 1JWAD 3Q8EA 2HE7A 3W1SC 1YMHE 4GB9A 4NJ6A 2KDMA 3T3OA 1FNVA 5GMVA 3BY4B 3ENEA 3DHIC 3PV1A 1VRAB 2E6XA 1FO4A 3PSEB 4KSKC 4NAMA 2BT6A 4JWSC 3MJWA 1XF5L 1GPXA 3RN9C 1FPYA 1JCKB 1ZDXA 2IGDA 3TL5A 1TT5B 2LJ5A 3K9OB 4MACA 5CTRC 5IO9A 4XWWA 4BOSC 4EE2A 4YSZB 1UUPA 2WLBA 1M94A 1GAQB 3DOWA 1FNUA 3V61A 3W9CB 1UF0A 3L16A 1E5WA 3RULA 3MHSD 3VFKA 2MSED 1QT9A 2L32A 1J8CA 4M8MA 2IO1B 1Z2MA 2WP9B 2GBNA 2O6VD 2IZVB 4RGTA 4KGRA 1MFWA 4OHJA 3RFZB 2N7DA 3ZLZA 2ZVOA 1IBXB 3BYYB 2EELA 3W2DA 2WXHA 1C4CA 2ICIA 1XLOA 2FE8A 2LGSA 4M00A 2RR9A 1RYJA 4I6PA 2KWCA 2KLCA 2INDC 5E6NA 1UBQA 2RDBC 2XN9C 1F2RC 4FHJA 2NMQA 2KAJA 1J0GA 2PE9A 4JLCA 2LGYA 1RRBA 4K81A 2LASA 1T0QC 3BK1A 3FAHA 1WX7A 2IBIB 3ZJVA 2L7RA 3MTNB 1L6UA 1N60A 1IGCA 3NZSA 1GC7A 2LRWA 3AE2B 3HM6X 3N20C 2RMMA 4A90A 1T6BX 1BUIC 3PGEA 2HD5B 4W9GA 4FULA 1NBFC 3A4SC 5DPWA 1EU4A 5G5GA 4HKQA 4BBNF 3IAM1 3QAQA 1IP9A 4URKA 4LLGM 1HA5A 2J0KA 2WDRB 2YEPF 4C7ZA 1JMLA 2G1EA 3ZKJC 3KW5B 4NPNA 1QKZA 3BWUD 3AI5A 1UH6A 3MC0B 4BAXA 2WXMA 1FMAD 1L4ZB 2W3SA 3PLVA 2IY0B 1UNSA 4C56C 4II3B 3AEFB 2K22A 4HK2A 2DZMA 2WU2B 1SSNA 2N1WA 3IBEA 4PT5A 4AJYB 1X1MA 1R4MB 4G3XB 2KN4A 3QHTA 3N9YC 3H7PB 1EF5A 3VTVA 2VH1A 1TS2A 1YNTE 5JHAA 1YQBA 4K3BA 5G55A 2LMCA 1ZOYB 2L00B 2LI5A 3BZDB 3P4QB 2CU3A 3RNFC 3TSSA 1CZPA 3C0RB 2NCNA 2AL3A 3D32A 3AE9B 3AEAB 3ZDMC 1MJDA 2BGFA 4XZ4A 2WDQB 3GS2A 4ZRPA 4CQNA 2I1JA 2IO3B 1FM0D 1YJIA 3C19A 1T0SC 2JRIB 1F52A 3DVNV 1P7EA 2GI9A 3SD5A 4S17A 3H7PA 3RNEC 2OJRA 3DWGC 2GBMA 4MGZE 4XE0A 3AEEB 1LXDA 1SE9A 2K39A 2KMCA 4WIPA 2J53A 3CSFA 1E8WA 3OWEB 1ZUD2 1WXMA 3VR8B 1N5WA 1RFAA 3O65B 4GGQA 4G0NB 4A3PA 1FCLA 1NI2A 4WWMA 2X38A 1PFDA 1JALA 2QCZA 3B2GA 2CS4A 4MGYE 1NI3A 4GU2A 1WE7A 4L1BA 4XDCA 2EMTA 3NUHB 1C1YB 3LJ3A 3BIID 2MBHA 2AL6A 4XX5A 4AS1A 4EOYA 1MVKA 2LJIA 1N62A 4NAWA 1XEEA 5EE9A 4BFRA 5J17A 4AUQC 1L0YB 4LNKA 4NJ7A 1AW7A 1E9MA 2RDHA 2WXOA 4TKNA 3ZNGC 2HDEA 3DBHB 4RGNA 4DHJB 3AM9A 3WANA 5FR6A 2EMSA 1C76A 5HI1A 2REXA 1N5XA 4GXBA 4M01A 4RF0A 4IC7B 1I4QA 1MG4A 3KLSX 1PYWD 1J19A 1OEYA 1WZ0A 2X8XX 2VH2A 2L3ZA 2LUEA 2N0SB 4MH8A 4LCDE 3MC8A 5GXGB 5L83A 2KLGA 1QOAA 4FJYA 2NPTB 4AP4C 2OJWA 2JWUA 3AE6B 4GN1A 3AMZA 3GOEA 2BKFA 1VZ8A 3AE4B 4DWFA 1PGAA 1BMLC 2PTLA 4IKGA 2FCQA 1U4AA 3KQ4A 4F7ZA 3RMKC 3Q14C 3VR9B 2D5GA 1AYFA 4MSQB 3R7QA 2MRPA 4ANVA 1SJHD 3QA8A 2XBBC 4KDLB 2JXTA 1K53A 3W5VB 1GJZA 3EC8A 5AZFA 3KUDB 1I4XA 2JWZA 2KANA 2KT7A 3PVLA 1JWMD 2WXGA 4WQMA 3CF6E 1FRRA 1PGBA 2D3GA 5LXHA 1TKEA 1ZDVA 1LFDA 3TIXA 5EE1A 3B1LX 2ZNVB 1R4NI 2KQ7A 2INNE 3CWIA 2LZ6A 3UIPB 3N1ZC 3H8HA 2MJ3A 5D94A 2MEKA 1WXQA 1D3ZA 3ZJUA 2DYBA 5CX3A 3RI7C 3ZTDA 1FFVA 1NENB 2O2VA 1FXTB 4OVUA 1V1PB 3APFA 3DHHC 1I7HA 3ALBA 1JRUA 1XD3B 2BB5A 3DPDA 1WGHA 2WXPA 3SFDB 4D2KA 3Q3NC 2M1MA 2I38A 4HCNB 1SEBD 1V6EA 1FEHA 1E7UA 2QMTA 3P42A 2DAFA 5BMGA 1VCBA 4HDOA 2LVOA 3R8BA 4W9IA 1IYFA 2PLPA 1PGXA 5D6JB 1R7SA 4FA6A 4LJOB 5JHBA 3I3TB 4G50A 1MPEA 1ENFA 1HZ5A 1NYQA 4XYCA 1KFYB 1ET6A 3ZVVA 2KMMA 4NY0A 2ZZPB 4Q2JA 3DDCB 2V3PA 4ICVA 4WWOA 4UDUC 4C4VB 4X57B 3I5JC 2L1AA 2MBQA 4TMAB 2A4ZA 2JZ3B 2LGXA 2UWQA 3ZXVA 3V6EB 3DHGC 3QQ8B 4E3CA 1K50A 2VZKB 2NS5A 3MC9A 3IVFA 3M63B 3KWVA 4BKSD 4DDGD 2JPHA 1T0RC 2PVOD 3B08A 3KH0A 3WAOA 4C00A 3QC8B 4HKZE 2CJOA 4FXCA 1VD2A 4MM3B 2OHFA 3LXFA 1TIFA 4PK1A 3T3NA 1FIQA 2V3SA 2KJ6A 3VAWA 4IW0A 3N3KB 1V80A 4RH6A 4NZLB 2MW5A 2BS3B 4KGTA 1ZW7A 2QILA 2D3BA 3WA0A 2GLSA 2HJ1A 1AARA 2N7JA 1WM3A 4IWPA 2H88B 1SB3C 4DXGA 3NVVA 2WQYB 4KIKA 2KFJA 2BF8B 5C1ZA 4HVBA 1JROA 1WE6A 2G9HD 2J0JA 2Q5WD 2KWVB 2W9NA 1IGDA 2Z0EB 2BS4B 2L83A 5KHOA 3J9CA 2JSVX 2JVCA 3V60A 1TYGB 5AUIA 4W9KA 2DZIA 2XEWA 3AEBB 1YQ3B 1XLNA 3GE8C 1F9JA 4IUMB 1OGWA 2ZPNA 1TZOA 1D5MC 1LO5D 1NEKB 4BBNC 1JWUD 3Q3FA 3RD2A 1WXVA 3P2BA 2Y5BB 3FILB 1RWSA 3BK2A 1JWBD 1WI0A 3AE3B 4BZAA 2D3CA 1G6JA 4NQKE 4WWPA 1OFFA 3PLUA 3UINB 5CHWA 1TZ1A 1E8XA 4PYZA 5BYQA 2ZNVC 2IDYA 3ZRFA 1XO3A 1HZ6A 2Z8LA 3U52E 3L10B 4EEWA 2MP2B 1MHXA 2W3RA 1WGDA 4A55A 1UELA 4E74A 4HLEA 3ZNZB 1GC6A 3JYUA 4W9DA 1H4RA 4KZ0A 3DBRI 1SE2A 5FKAC 3WCQA 4YL8A 2DWQA 1AWDA 3NY5A 3LB8C 2MH7A 3AECB 2JZPA 1L0VB 1VDVA 1I35A 1EWCA 2AYOB 3NVZA 2MP2A
chains in the Genus database with same CATH topology
4IDIA 1C4PA 5EE3A 2PW9A 2XNAC 5I4DA 2WU5B 1RFKA 1WWTA 3IXSA 4JX1C 3DWGC 3TEYA 4A6QA 1JRPA 4XE0A 3AEEB 4A8XC 4HRSA 4L2YA 1FD6A 1HEZE 1L6VA 5E6JA 4WIPA 2KACA 2J53A 2N9LA 3SFEB 1Q10A 1YQ4B 1V1OA 2LUMA 3OWEB 1ZUD2 1C79A 2BBCA 1N61A 2YEPB 3VR8B 1N5WA 1K51A 2AQ2B 3DWMA 2WXFA 5HHDG 1XLQA 1FCLA 1D6EC 2GB1A 1N63A 5C2TB 4DXFA 1IBXA 3PZ7A 1FCCC 3P4SB 3W1SA 3O13A 4WWMA 2X38A 4YT0B 3I9V1 1PFDA 1JALA 1I4GA 3B2GA 1NI3A 5AUKA 4ZHPA 4L1BA 4XDCA 5HFYA 1I4PA 1TY0A 4KKIA 1CQVA 3NUHB 4JE3B 2QSDA 3BIID 3ETRA 2L52A 2MJEA 2ONQA 4AS1A 3IT6B 4HEA1 5MPOA 1MVKA 1KTKA 3GB1A 3P1MA 2H89B 2LJIA 1N62A 3Q8FA 3R2IA 2K9XA 1XEEA 5EE9A 2EKIA 1L0YB 2Y3AA 3PO0A 3Q8AA 1AW7A 1E9MA 1EM7A 1NVID 1VR9A 2RDHA 1I4RA 2WXOA 3AE7B 3B9JA 4WH4A 3VRBB 2HDEA 1UGJA 2DYMA 1VZ7A 4KX6B 5C3JB 4RGNA 1M4VA 5H92C 3ZQ4A 4M0WA 3AM9A 3FC4A 3TEXA 5BMIA 3IAS1 1C76A 1KF6B 1YN5A 4LTUA 5HI1A 1PUTA 2M19A 3ZYYX 4B0MA 2IJ0A 2BYTA 1N5XA 5G5HA 1B1ZA 4RF0A 5LNK1 3AN1A 2PIAA 1I4QA 2AQ1B 3KLSX 1ZE3D 1PYWD 3HUIA 1D5ZC 1KRHA 2LEKA 4L23A 3NRZA 3BYTB 1TKGA 2GRIA 1L0XB 2KQ4X 2N0SB 4MH8A 4WAFA 3V3XA 3AH7A 1WSPA 5GXGB 2FBWB 2BB6A 4TSSA 3U2SC 1QOAA 2WXNA 3NVYA 2BTEA 1TS4A 1TS5A 1F77A 2B76B 1EWYC 3FILA 2JWUA 4C80A 2NTTA 1FFUA 3MP9A 3MHZA 2WXQA 3AE6B 4RCOA 4B0EA 1E10A 3AMZA 2KWDA 1JW9D 4XDDA 1C78A 1VZ8A 1E7PB 3AE4B 1FXIA 1PGAA 1MHHE 4RFBA 1BMLC 1BXTA 1SE4A 2PTLA 3TEWA 1L4DB 1TY2A 1ZXIA 5EE0A 4IKGA 4ZRQA 3KQ4A 1T3QA 2RPVA 3E56A 3P4RB 3URYA 4ZYSA 2RDGA 2J42A 3VR9B 2D5GA 1AYFA 1VJKA 4YSXB 1ZPSA 1K52A 2IGGA 4ZOHC 1ACCA 2R61A 1A70A 1ZP0B 3EUB2 4ITKA 1XLPA 4YWGG 1SJHD 2PVGC 3Q69A 4C7YA 2INPE 2JXTA 2V3NA 4RGMA 1K53A 2WXLA 4N6EB 4R3DA 3W5VB 1JQ4A 1SF0A 2IPKD 1F2RI 4RGOS 2OEDA 2SAKA 3VRAB 3AEDB 1I4XA 1ET9A 2WXGA 1JWMD 4WQMA 2LGIA 2JX5A 3ZGZA 1FRRA 3V05A 5JXVA 1DOIA 1PGBA 2M0AA 3ABVB 3SEBA 3ZJTA 3PZ8A 1F0ZA 1NYRA 1TKEA 1ZDVA 2JYEA 3U7ZA 1UWMA 3AE8B 3NS1A 3BVGA 4YTMB 4P6VF 2K3UA 3R2TA 5EE1A 5D3DA 1QOGA 1HXYD 4YTPB 2WXIA 2INNE 4WURA 1DGJA 3CWIA 1DOYA 1Y56A 3P4PB 1FNWA 3H8HA 1GB1A 2W82A 2AQ3B 2MJ3A 4HJGE 2MEKA 1WXQA 2QIEB 3ZJUA 1QQRA 4DQOC 4AQ7A 3IT4B 4ARIA 3EGRA 5H8YE 2WNMA 2ZW1A 2AX5A 3TEZA 1FFVA 3C8YA 1NENB 4JPSA 1E6EB 4JWUC 1J7BA 4NJCA 2DLBA 1XCTL 1J7CA 4ZHOA 1V1PB 4GDKB 1J7AA 2JU6X 5BMHA 4YSYB 1EU3A 1I7HA 3AB5A 4TQ0A 1JWAD 1ROEA 4YTNB 3Q8EA 2BB5A 4IOIE 1YMHE 3U4EG 2WXPA 3SFDB 1YJJA 1HQRD 4D2KA 2KDMA 3MJ5A 1JWSD 1FXAA 2I38A 2CJNA 3T3OA 1SEBD 2JQRB 1FNVA 3AEGB 1UWXA 1FEHA 2QMTA 1VRAB 2E6XA 1C4AA 3AE5B 3UI3A 1FO4A 3NVWA 3P42A 3EA6A 4NAMA 2BT6A 4JWSC 5BMGA 2MJDA 2BW2A 4RF1A 2I2YA 3R8BA 3B2FA 1YN3A 2PLPA 4J3OD 1PGXA 1R7SA 1CJEA 2LHDA 2SEBD 1XF5L 3LYYA 1GPXA 1STEA 4OZCA 1GOZA 1JCKB 1MPEA 1ENFA 1ZDXA 2IGDA 1HZ5A 2LFIA 1NYQA 1KFYB 2WXJA 4LK0M 1ET6A 4MACA 4GLSC 2PMVA 3HRDD 4XWWA 2KMMA 4EE2A 4Q2JA 3P63A 4YSZB 1UUPA 2WLBA 1ESFA 2V4IB 2V3PA 3HVDA 4MT5A 1IUEA 4UDUC 2J4XA 1GAQB 1WRIA 2NTSA 2ON8A 1FNUA 3W9CB 2L1AA 5D3IB 4TMAB 1QOFA 1QT9A 1OQQA 2L32A 3Q8BA 2Y5CA 1K50A 2VZKB 4OZBA 2WP9B 5T8IA 1SXTA 3KWVA 4RGTA 4KGRA 4REZA 4OHJA 3RFZB 2PVOD 1IBXB 3BYYB 2EELA 2ACZB 3W2DA 2WXHA 3RPFC 1C4CA 2W55A 4HKZE 2WDVB 1GB4A 2CJOA 4FXCA 4MM3B 2ICIA 2OHFA 3LXFA 5FK9C 1XLOA 2FE8A 3T3NA 1OQRA 1AN8A 4O1NA 1FIQA 4OVZA 4HROA 1RYJA 2V0GA 5D7GA 1I4HA 1SE3A 4RH6A 2QEJC 1SBBB 4NZLB 2BS3B 2FUG1 4KGTA 1P7FA 1D5XC 1VZ6A 2N9KA 2QILA 2XN9C 1T5XD 4NAWB 1ZXHA 2N7JA 2Y5PA 1F2RC 2H88B 2NMQA 2KAJA 1SB3C 4OZAA 4DXGA 1C9FA 3NVVA 2WQYB 2E3TA 1E0ZA 2WXRA 3BK1A 3FAHA 1JROA 4P16A 1XCQL 3ZJVA 4KKJA 2G9HD 3AV8A 1L6UA 1N60A 1C77A 1IGCA 3E9SA 2Q5WD 1RM6C 3W5UB 1SJED 3AE2B 4USAA 1IGDA 4TQ1A 2BS4B 2RMMA 1L5PA 1V8CA 2L83A 3J9CA 4A90A 1KLGD 2JSVX 2HTME 1T6BX 1TS3A 2J52A 1BUIC 1DYQA 1TYGB 4OW0A 5AUIA 4XWTA 4H2AA 1QOBA 3AEBB 1YQ3B 1EU4A 1XLNA 5G5GA 4N59A 2DBYA 4HKQA 1MI0A 3IAM1 1TKYA 5FR3A 4US9A 1CK1A 4LLGM 1TZOA 1HA5A 1D5MC 1LO5D 1NEKB 2WDRB 1JWUD 3KWLA 1QF6A 2YEPF 2WXKA 4C7ZA 3FILB 1D4BA 2QJLA 1JMLA 3BVMA 2G1EA 4ARCA 1RWSA 2W54A 3BK2A 1JWBD 1QKZA 3AE3B 3BWUD 3L4PA 1DOXA 1B9RA 1WYGA 1WGKA 2LHEA 3MFGA 4GDLB 3MC0B 1V1PA 4US8A 1OFFA 1FMAD 1L4ZB 2W3SA 2WXMA 3VQIA 1UNSA 4C56C 4YXDB 2PKOA 1FRDA 2IGHA 2K5PA 3AEFB 2K22A 1YN4A 2WU2B 1SSNA 1SIJA 5BYQA 4PT5A 2IDYA 1QLBB 1TJEA 2M56B 1XO3A 1HZ6A 3SR6A 2Z8LA 3U52E 3Q8CA 2KN4A 2TSSA 3N9YC 2DYOA 1MHXA 1TS2A 1YNTE 2W3RA 4RNAA 4A55A 5HG2A 3NZ3A 2LMCA 1ZOYB 2WS3B 3BZDB 3GP7A 3P4QB 5BYSA 2ZW0A 1PDXA 3AE1B 2CU3A 3CIRB 3I57A 1SE2A 4KGSA 5FKAC 3TSSA 1CZPA 4A9AA 1XXGA 3WCQA 2K0PA 2DWQA 1AWDA 1KLUD 3HVZA 3LB8C 4N58A 3AE9B 3BVZA 2BS2B 3AEAB 2MH7A 1V97A 2JZPA 2WDQB 3AECB 3GS2A 1L0VB 4ZRPA 4CQNA 5BYRA 2JYTA 1VDVA 1FM0D 1YJIA 2VZKD 1VLBA 1KH0A 1QILA 3TUOA 1EWCA 3NVZA 5TSSA 1P7EA 2GI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IDI A;  2E3T A;  1E0Z A;  4C80 A;  1FXA A;  1FFU A;  2CJN A;  5EE3 A;  3FAH A;  3AE6 B;  1JRO A;  2JQR B;  2WU5 B;  3AEG B;  1E10 A;  1RFK A;  1WWT A;  4JX1 C;  3DWG C;  3AMZ A;  1JW9 D;  3AV8 A;  1L6U A;  1N60 A;  1JRP A;  1FO4 A;  2Q5W D;  1E7P B;  3AE4 B;  1FXI A;  3AE5 B;  1RM6 C;  3AEE B;  3NVW A;  4HRS A;  3W5U B;  2BT6 A;  3AE2 B;  4JWS C;  4USA A;  1L6V A;  1ZXI A;  2MJD A;  5EE0 A;  2BS4 B;  3SFE B;  1L5P A;  1V8C A;  1YQ4 B;  1T3Q A;  2L83 A;  2HTM E;  1ZUD 2;  3B2F A;  3P4R B;  1TYG B;  5AUI A;  1N61 A;  3VR8 B;  1N5W A;  1QOB A;  3VR9 B;  1AYF A;  1VJK A;  1R7S A;  1CJE A;  4YSX B;  3AEB B;  3DWM A;  4ZOH C;  1YQ3 B;  1GPX A;  1A70 A;  1XLQ A;  1XLN A;  1ZP0 B;  2DBY A;  3EUB 2;  4ITK A;  4N59 A;  1N63 A;  1XLP A;  5C2T B;  2PVG C;  3P4S B;  4WWM A;  1TKY A;  4C7Y A;  4YT0 B;  1NYQ A;  1KFY B;  1PFD A;  4US9 A;  1JAL A;  4N6E B;  3W5V B;  3B2G A;  1JQ4 A;  1SF0 A;  1NI3 A;  5AUK A;  1NEK B;  3HRD D;  2WDR B;  2KMM A;  4ZHP A;  3KWL A;  3P63 A;  4YSZ B;  1QF6 A;  2WLB A;  3VRA B;  4C7Z A;  3AED B;  2QJL A;  2G1E A;  3BII D;  3ETR A;  4WQM A;  1RWS A;  2JX5 A;  2L52 A;  1IUE A;  1JWB D;  2MJE A;  2W54 A;  1FRR A;  1GAQ B;  3AE3 B;  1DOI A;  1WRI A;  1WGK A;  1WYG A;  3L4P A;  5MPO A;  1B9R A;  3ABV B;  3W9C B;  3P1M A;  2H89 B;  1N62 A;  4US8 A;  2K9X A;  1NYR A;  1F0Z A;  1OFF A;  1FMA D;  1TKE A;  2W3S A;  5EE9 A;  2EKI A;  1UWM A;  1QOF A;  1QT9 A;  1OQQ A;  3PO0 A;  3AE8 B;  4YXD B;  2PKO A;  3NS1 A;  1E9M A;  1FRD A;  1NVI D;  2K5P A;  3AE7 B;  3AEF B;  2K22 A;  3B9J A;  3VRB B;  4YTM B;  2Y5C A;  2WU2 B;  4P6V F;  4KX6 B;  5C3J B;  2WP9 B;  1SIJ A;  5EE1 A;  5H92 C;  1YJJ A;  1QOG A;  3AM9 A;  1QLB B;  1TJE A;  2M56 B;  3FC4 A;  1XO3 A;  3SR6 A;  4YTP B;  1KF6 B;  1DGJ A;  2PVO D;  4LTU A;  5G5G A;  1PUT A;  2M19 A;  3CWI A;  3ZYY X;  1DOY A;  3P4P B;  2ACZ B;  3RPF C;  2W55 A;  2WDV B;  1N5X A;  2W3R A;  2CJO A;  2MJ3 A;  5G5H A;  4FXC A;  3AN1 A;  2PIA A;  2OHF A;  2QIE B;  1WXQ A;  3LXF A;  1XLO A;  3HUI A;  1OQR A;  1KRH A;  1ZOY B;  2WS3 B;  2LEK A;  3NRZ A;  3P4Q B;  1FIQ A;  1PDX A;  3AE1 B;  2CU3 A;  1RYJ A;  3CIR B;  4HRO A;  5H8Y E;  1CZP A;  2AX5 A;  1FFV A;  4A9A A;  1TKG A;  1NEN B;  3WCQ A;  2DWQ A;  1AWD A;  1E6E B;  4JWU C;  1J7B A;  2N0S B;  3HVZ A;  1J7C A;  4ZHO A;  3LB8 C;  2BS3 B;  3AE9 B;  3AH7 A;  4N58 A;  2BS2 B;  3AEA B;  2MH7 A;  5GXG B;  2FBW B;  2WQY B;  1J7A A;  1V97 A;  3AEC B;  2WDQ B;  1L0V B;  1I7H A;  3AB5 A;  4YSY B;  1QOA A;  1VDV A;  1FM0 D;  1JWA D;  1ROE A;  1YJI A;  2H88 B;  3NVY A;  4YTN B;  2KAJ A;  1VLB A;  1SB3 C;  1DOX A;  3NVV A;  3NVZ A;  2B76 B;  3SFD B;  1EWY C; 
#chains in the Genus database with same CATH topology
 4IDI A;  1WZ3 A;  4B95 A;  1C4P A;  5EE3 A;  2PW9 A;  2XNA C;  2L0F A;  5I4D A;  3KYD D;  3IXS A;  4WJP A;  1JRP A;  2LD9 A;  2RSU A;  3NHE B;  4HRS A;  1L6V A;  4GIV A;  2N9L A;  2WDT B;  3TBL D;  2BBC A;  1C79 A;  3WAM A;  4IWO A;  1PQS A;  1N61 A;  3LDZ E;  3Q3M C;  2KO3 A;  3DWM A;  2KMA A;  5HHD G;  4HPL B;  2RPQ A;  1XLQ A;  4IM0 A;  1HE8 A;  4ANX A;  4DXF A;  4M0W B;  1IBX A;  3PZ7 A;  3O13 A;  3I9V 1;  3T8M A;  2INC C;  3ECI A;  2RGF A;  3FKY A;  5E6O A;  2N9E B;  3VXW A;  2D10 A;  3N1X C;  2L52 A;  2MJE A;  2UU7 A;  3GB1 A;  3SHQ A;  2K9X A;  2KTR B;  3JVZ X;  3PO0 A;  4M02 A;  3ZXR A;  4WH4 A;  3B9J A;  2NBW B;  2K8C A;  2DYM A;  2GOW A;  4M0W A;  3TEX A;  3IAS 1;  5AZG A;  1RLF A;  1Q5W B;  4EZJ A;  4BOZ B;  2FIF A;  4B0M A;  1B1Z A;  4MJS B;  3AN1 A;  4TUU A;  2IY1 B;  3NRZ A;  3RNB C;  3BYT B;  3N1Y C;  1TKG A;  3B0A A;  2GBJ A;  2B3A A;  4JL9 A;  1L0X B;  4WAF A;  2GBR A;  2QC8 A;  2MQJ A;  3AH7 A;  1GG3 A;  4WJO A;  2R2O A;  2WXN A;  3NVY A;  1TS4 A;  3A9J B;  4DDI D;  4ANW A;  2MBE A;  4MEL A;  4C80 A;  1FFU A;  2MLB A;  2WXQ A;  4B0E A;  1E10 A;  4II2 B;  2PEA A;  3AU5 A;  4MJS A;  2LWP A;  2LGD A;  1IPG A;  4I6L B;  1BXT A;  2KHW B;  1L4D B;  2FID A;  1ZXI A;  3TJP A;  2HTH A;  2G45 B;  2RPV A;  4MSM B;  3UIO B;  5AEK B;  4S0R A;  3RZF A;  1VJK A;  4YSX B;  1K52 A;  1R4N B;  2IGG A;  5DPT A;  1ACC A;  2R61 A;  2RD0 A;  2V4L A;  3EUB 2;  4ITK A;  3A9J A;  1XLP A;  2D3A A;  4ZRI A;  2A5U A;  2V3N A;  2K8H A;  4RGO S;  4MH0 E;  4PS8 A;  2SAK A;  3VRA B;  3AED B;  1ET9 A;  2JXX A;  2LGI A;  3WAL A;  4PS3 A;  2IO0 B;  2MBB B;  1KLV A;  2JYE A;  4W9H A;  3DVG Y;  4YTM B;  3R7R A;  3PT2 B;  4IM2 A;  3KYC D;  2ZEQ A;  5LXI B;  4WUR A;  1DGJ A;  1ZGU B;  1FNW A;  4WWN A;  1GB1 A;  2BWF A;  2AQ3 B;  3HM3 A;  2YLM A;  1TTN A;  1V86 A;  1V9J A;  1QQR A;  3EFU A;  1E8Z A;  2CHZ A;  4ARI A;  3TEZ A;  5H8Y E;  2ZW1 A;  3QK0 A;  2AX5 A;  3C8Y A;  2MX2 A;  3VUY A;  1J7B A;  2DLB A;  1J7C A;  2K1F A;  4GDK B;  1J7A A;  2JU6 X;  4TQ0 A;  1ROE A;  4DHZ B;  3VHT C;  4IOI E;  1WMH B;  3U4E G;  4DHJ D;  3UQA A;  4K3C A;  3K9P B;  1JWS D;  1FXA A;  3IFW B;  3N30 A;  2CJN A;  1XT9 B;  1C4A A;  3NVW A;  1WX9 A;  3JSV B;  2KDF B;  4RF1 A;  3L13 A;  2R2Q A;  1L7Y A;  2JY6 A;  4J3O D;  1A5R A;  2SEB D;  1CJE A;  4AOF A;  2NBU A;  3LYY A;  3L17 A;  1STE A;  4OZC A;  3RYT A;  2KOX A;  5IKC M;  3ZNI D;  3PTF C;  3UF8 A;  2LFI A;  1SGH A;  2WXJ A;  4LK0 M;  5IAA C;  4GLS C;  1E8Y A;  3HRD D;  3P63 A;  3ZDT A;  2V4I B;  3HVD A;  4MT5 A;  1IUE A;  3JSV A;  2NTS A;  1S3S G;  5EDS A;  2ZVN A;  3DBL B;  2ZCB A;  2NPT A;  2MWS B;  4OZB A;  3RNG C;  5T8I A;  4FJV B;  1SXT A;  2L76 A;  4N9F 4;  1TGZ B;  2LXA A;  2C7H A;  2NR2 A;  5CHF A;  2ACZ B;  1GB4 A;  2WDV B;  2KDB A;  4GMV A;  2C5L C;  3VVW B;  3APC A;  4O1N A;  4OVZ A;  4HRO A;  1HTO A;  5D7G A;  1I4H A;  1WIA A;  1WM2 A;  5DPS A;  1SE3 A;  1SBB B;  1OTR B;  2FUG 1;  3A9K B;  1P7F A;  1D5X C;  1VZ6 A;  2N9K A;  2M8S A;  3Q2A C;  3T9L A;  1WGR A;  2Y5P A;  4OZA A;  1P0R A;  2E3T A;  3ZW3 A;  1QZE A;  2DZK A;  2KC2 A;  4MGI E;  2M17 A;  2N7E A;  1C77 A;  2KX3 A;  2AWT A;  1RM6 C;  4USA A;  4TQ1 A;  3PHW B;  2OOB B;  1L5P A;  4FAD A;  1KLG D;  3OLM D;  2HTM E;  2J52 A;  1DYQ A;  1WGG A;  3BIN A;  4XWT A;  4H2A A;  3A9K A;  3TCA A;  1Q1O A;  2DBY A;  5BO4 B;  3ZRC A;  2DAJ A;  2FNJ B;  1TKY A;  4ZDV A;  5FR3 A;  3DBR B;  4E71 A;  5HKH A;  2I1K A;  5J18 A;  1D4B A;  2QJL A;  3BVM A;  4ARC A;  4KV2 A;  3HHM A;  3M62 B;  3L4P A;  3PRZ A;  1B9R A;  1WYG A;  3MFG A;  3OG5 A;  2BVC A;  3H1U A;  4GDL B;  4EKU A;  1V1P A;  4US8 A;  1Q0W B;  3VQI A;  2PKO A;  4AJW A;  1FRD A;  2IGH A;  3QWZ B;  1SIJ A;  1QLB B;  1TJE A;  1C3T A;  3SR6 A;  2LXC A;  2IYD B;  3Q8C A;  1OEY J;  4HJK A;  3ZIM A;  2D11 A;  3NZ3 A;  3PRM B;  4LNN A;  2BKR B;  3GP7 A;  2ZW0 A;  3AE1 B;  3I57 A;  4KSL C;  4MEM A;  4KGS A;  5C23 A;  3L54 A;  1XXG A;  2K0P A;  2JT4 B;  2V9H A;  1K8R B;  4N58 A;  4ZRJ A;  3BVZ A;  2BS2 B;  3Q6B A;  4NQL B;  2JYT A;  3L0W B;  2XK5 B;  2VZK D;  4MGK E;  1QIL A;  5DCN A;  3TUO A;  2PPH A;  4LDT B;  4F1S A;  3ZO5 B;  1RFK A;  1WWT A;  4C4V A;  4A6Q A;  2KVR A;  4A8X C;  1HTQ A;  4HCP B;  4L2Y A;  1HEZ E;  5E6J A;  1UD7 A;  2ZJD A;  3SFE B;  1Q10 A;  1YQ4 B;  2FCM A;  2G4S A;  5JZE B;  4IG7 B;  3QCA A;  3IHP C;  4PYU A;  2WGS A;  1D6E C;  2GB1 A;  1KJT A;  1N63 A;  2MBO A;  5C2T B;  1FCC C;  3W1Y A;  4J6I A;  3A33 B;  2J0M A;  2G3Q B;  4MM3 A;  5JH5 C;  5AUK A;  4ZHP A;  1I4P A;  1TY0 A;  4KKI A;  1CQV A;  4JE3 B;  3ETR A;  2ONQ A;  3IT6 B;  2H89 B;  4CHK A;  2D2Q A;  2EKI A;  2MCN B;  3Q8A A;  4K7W A;  1NVI D;  1VR9 A;  1I4R A;  3VRB B;  4XGA B;  2DEN B;  3KUZ A;  2DNF A;  4KX6 B;  3APD A;  2KC1 A;  2JF5 A;  3EHV A;  3FC4 A;  2JUO A;  2DZJ A;  1WY8 A;  2M19 A;  3ZYY X;  3Q3J A;  2IJ0 A;  2VRR B;  4F8C B;  3GZN I;  2PIA A;  4OVV A;  2AQ1 B;  3NZU A;  3IG3 A;  1OQY A;  3HUI A;  1D5Z C;  4WQO B;  1UGM A;  3DQV A;  4PS7 A;  3QAR A;  2GRI A;  4XC2 A;  3V3X A;  2AEH A;  3WIM A;  5KHQ A;  1WH3 A;  4A3O A;  1ZKH A;  4NNJ B;  5DPR A;  2ZCC A;  3R66 C;  1WXS A;  1EWY C;  3FIL A;  2NTT A;  2HJ8 A;  4BKT A;  2KWD A;  4HWI B;  1JW9 D;  2QDF A;  4JGH B;  1FXI A;  4RFB A;  2L8J A;  3TEW A;  1WYW B;  1TY2 A;  2NVU I;  1T3Q A;  3P4R B;  2G4D B;  2RDG A;  2J42 A;  1ZPS A;  2V1Y A;  2BPS A;  4ZOH C;  4K7U A;  1A70 A;  1ZP0 B;  2K6D B;  2O6V B;  2PVG C;  4RGM A;  1JQ4 A;  2WXL A;  4N6E B;  1SIF A;  1F2R I;  3OAW A;  2OED A;  4HPM B;  4I6N B;  4W9F A;  3V05 A;  5JXV A;  3ABV B;  3SEB A;  3ZJT A;  3PZ8 A;  1WR1 A;  1E90 A;  1NYR A;  2KQS A;  5AZH A;  3U7Z A;  3EFC A;  3AE8 B;  3Q3O C;  3VTW A;  4P1C C;  1P1A A;  1GNU A;  1BT0 A;  2N9P C;  2O6V A;  1QOG A;  1HXY D;  4YTP B;  2WXI A;  4WJQ A;  4EFO A;  1DOY A;  3PRE A;  1Y56 A;  2J7Q B;  1WJU A;  3CMM B;  3L08 A;  2QIE B;  4EZL A;  3A4R A;  1P98 A;  3ZTC A;  4B9K A;  3UGB B;  3IT4 B;  4AQ7 A;  3EGR A;  2KN5 A;  1UZX B;  4JPS A;  3X0W A;  4JWU C;  1XCT L;  4ZHO A;  2IO2 B;  2K8B A;  2FUH B;  3OJ4 B;  4YSY B;  3AB5 A;  4YTN B;  3U8Z A;  2BWE S;  2KK8 A;  3SDL C;  1YJJ A;  1HQR D;  3MJ5 A;  3V6C B;  4KDI C;  4M8N A;  2JQR B;  3AEG B;  1UWX A;  1V2Y A;  3AUL A;  2M0X A;  3VH3 B;  2MHJ A;  3AE5 B;  3UI3 A;  3EA6 A;  1P9D U;  3SU8 X;  2KTR A;  2LVP A;  2MJD A;  2GBK A;  2BW2 A;  4ANU A;  2I2Y A;  1WR6 E;  3B2F A;  1YN3 A;  4RM9 A;  3VTU A;  3H9D A;  1GOZ A;  5E6P A;  3HIZ A;  1GUA B;  3TMP B;  4IWQ A;  2L0T A;  2PMV A;  3KVF B;  3HK0 A;  4RMA A;  2KJR A;  2KFK B;  1ESF A;  4QAY A;  2C7M B;  2J4X A;  1WRI A;  3OJ3 A;  2ON8 A;  2KJH B;  3R3M A;  4K7S A;  5D3I B;  1QOF A;  1OQQ A;  4ICU A;  4JIO U;  3Q8B A;  2Y5C A;  3RT3 B;  3UQB A;  3PZD A;  1WJ6 A;  2DX5 B;  3A1Q B;  2JRH A;  2KDE B;  4FLH A;  4REZ A;  2FCS A;  1KM7 A;  1LM8 B;  3RPF C;  2W55 A;  1LQB A;  5IN7 A;  2KFK A;  2KX0 A;  4IM3 A;  4W9E A;  5FK9 C;  1EO6 A;  1OQR A;  1AN8 A;  1CMX B;  3PHX B;  3QIJ A;  2PE6 B;  2CHX A;  4HDQ A;  4K1R B;  2V0G A;  2N4F A;  4EUT A;  3GE3 C;  5D2M B;  3ZUN A;  4FHK A;  2QEJ C;  4NAW B;  1T5X D;  1ZXH A;  2C9W B;  1Y8R C;  3NG0 A;  3A1Q A;  1C9F A;  2WX1 A;  4DK5 A;  2JZZ A;  1F1H A;  1E0Z A;  1NDD A;  1V81 A;  2WXR A;  3QX1 A;  2M4N A;  1N6Z A;  4P16 A;  1XCQ L;  3M95 A;  4KKJ A;  3AV8 A;  2K25 A;  3E9S A;  2FAZ A;  3W5U B;  1SJE D;  2KTF A;  1WJ4 A;  4ASW C;  2CKH B;  2NBV B;  1V8C A;  3M3J A;  5CHV C;  2KKC A;  1TS3 A;  2K6Q A;  4OW0 A;  2QHO A;  1WFY A;  1QOB A;  2N9X A;  1YIW A;  1MG8 A;  4B6W A;  2C7N B;  4DBG A;  4HPP A;  4N59 A;  5IP4 D;  1MI0 A;  2CU1 A;  1RAX A;  4US9 A;  2KVZ A;  3ONS A;  1CK1 A;  3KWL A;  1QF6 A;  2WXK A;  2Z0D B;  4P1B C;  4A20 A;  1YX5 B;  4AWJ A;  2W54 A;  1DOX A;  1WGK A;  2LHE A;  1H8C A;  4GDK A;  4MDK E;  2Z59 B;  4YXD B;  2K5P A;  1KOT A;  1YN4 A;  3CST A;  3S2A A;  1WMH A;  4TV3 A;  1LGR A;  1YX6 B;  2FCN A;  4LJP B;  3VDZ A;  2M56 B;  2BQQ A;  2TSS A;  1I42 A;  3RNC C;  4FBJ B;  3AXC A;  2DYO A;  4RNA A;  5HG2 A;  3EEC A;  2WWZ A;  4WJN A;  5LLI A;  2WS3 B;  3ZNH B;  2PJH A;  5BYS A;  2N1V A;  1PDX A;  3CIR B;  4A9A A;  3N32 A;  2KYW A;  1KLU D;  3HVZ A;  1YJ1 A;  1S1Q B;  3PRP B;  1V97 A;  2LVQ A;  3NJT A;  4HXD A;  4G11 A;  2C60 A;  5BYR A;  4LNI A;  2KD0 A;  3DBS A;  4FJZ A;  4EZK A;  1VLB A;  1KH0 A;  1WRD B;  4CO7 A;  3RUI B;  5TSS A;  2LHD A;  2CHW A;  2WU5 B;  1R4M I;  4JX1 C;  3TEY A;  3DVG X;  4CYE A;  3DVN U;  3RNA C;  3PS6 A;  1FD6 A;  3VH4 B;  2KAC A;  3VUX A;  2YVC A;  1V1O A;  2LUM A;  1E7V A;  2YEP B;  1K51 A;  2AQ2 B;  3NS8 A;  2O2V B;  2EKE C;  2WXF A;  3VUW A;  1TBE A;  3W1S A;  3P4S B;  3NOB A;  1L2N A;  4YT0 B;  3GZN B;  1I4G A;  2KDI A;  5HFY A;  3V62 A;  4W9C A;  2QSD A;  1EUV B;  4HEA 1;  5MPO A;  1KTK A;  3P1M A;  3Q8F A;  3R2I A;  4WAA A;  3DCG A;  4DXA B;  3ML8 A;  4GSW A;  2Y3A A;  1EM7 A;  3AE7 B;  5J2R A;  2WX0 A;  1UGJ A;  1VZ7 A;  4KVG B;  5C3J B;  5IOI A;  1M4V A;  1WX8 A;  5H92 C;  3ZQ4 A;  4BVU C;  5BMI A;  5TR5 A;  1YD8 U;  1KF6 B;  1YN5 A;  4LTU A;  4W9J A;  1PUT A;  2L05 A;  2BYT A;  5G5H A;  5LNK 1;  2KZR A;  1ZE3 D;  4ACF A;  1KRH A;  3KUC B;  2LEK A;  4L23 A;  2MA9 B;  2KQ4 X;  4ZRK A;  1XQQ A;  2ZPY A;  1WSP A;  2FBW B;  2BB6 A;  4FN2 A;  4TSS A;  2ASQ A;  3U2S C;  4GOC A;  4BKG A;  2BTE A;  1TS5 A;  1V5O A;  1F77 A;  2B76 B;  3U7D A;  2BYF A;  1Z5S B;  3MP9 A;  3DBH I;  3MHZ A;  4RCO A;  3JW0 X;  4XDD A;  1C78 A;  4GDL A;  1E7P B;  1MHH E;  1SE4 A;  2WHI A;  5G2N A;  5EE0 A;  4ZRQ A;  1T0Y A;  3E56 A;  3WAP A;  3AU4 A;  3URY A;  1YOV B;  4ZYS A;  4W9L A;  1WJN A;  2UYZ B;  5IA7 A;  2CR5 A;  5L95 C;  4YWG G;  3Q69 A;  4C7Y A;  2INP E;  1UBI A;  4R3D A;  2KXJ A;  1SF0 A;  2IPK D;  4JQW C;  3I63 C;  4LDT D;  4KIK B;  2DHZ A;  3RZW C;  1V5T A;  2KNB A;  4RM8 A;  2BYE A;  2JX5 A;  3ZGZ A;  3QJZ A;  1WF9 A;  1DOI A;  2M0A A;  1F0Z A;  1UWM A;  2XK5 A;  3NS1 A;  3BVG A;  3H7S A;  3RCZ A;  4DHZ E;  3U30 A;  2BYV E;  1ISN A;  4P6V F;  2K3U A;  3R2T A;  4BKS A;  1WGY A;  5D3D A;  1P3Q U;  4LNF A;  3ML9 A;  3DBL I;  3P4P B;  4ZYN A;  2W82 A;  4HJG E;  4LNO A;  2GMI C;  3PPA A;  1EF1 A;  2D07 B;  4DQO C;  1V49 A;  1WXA A;  2WYQ A;  2WNM A;  4KZC A;  4P7I A;  2KWU B;  1E6E B;  4NJC A;  3H6N A;  3X23 A;  5BMH A;  1EU3 A;  2LRU A;  1JWA D;  3Q8E A;  2HE7 A;  3W1S C;  1YMH E;  4GB9 A;  4NJ6 A;  2KDM A;  3T3O A;  1FNV A;  5GMV A;  3BY4 B;  3ENE A;  3DHI C;  3PV1 A;  1VRA B;  2E6X A;  1FO4 A;  3PSE B;  4KSK C;  4NAM A;  2BT6 A;  4JWS C;  3MJW A;  1XF5 L;  1GPX A;  3RN9 C;  1FPY A;  1JCK B;  1ZDX A;  2IGD A;  3TL5 A;  1TT5 B;  2LJ5 A;  3K9O B;  4MAC A;  5CTR C;  5IO9 A;  4XWW A;  4BOS C;  4EE2 A;  4YSZ B;  1UUP A;  2WLB A;  1M94 A;  1GAQ B;  3DOW A;  1FNU A;  3V61 A;  3W9C B;  1UF0 A;  3L16 A;  1E5W A;  3RUL A;  3MHS D;  3VFK A;  2MSE D;  1QT9 A;  2L32 A;  1J8C A;  4M8M A;  2IO1 B;  1Z2M A;  2WP9 B;  2GBN A;  2O6V D;  2IZV B;  4RGT A;  4KGR A;  1MFW A;  4OHJ A;  3RFZ B;  2N7D A;  3ZLZ A;  2ZVO A;  1IBX B;  3BYY B;  2EEL A;  3W2D A;  2WXH A;  1C4C A;  2ICI A;  1XLO A;  2FE8 A;  2LGS A;  4M00 A;  2RR9 A;  1RYJ A;  4I6P A;  2KWC A;  2KLC A;  2IND C;  5E6N A;  1UBQ A;  2RDB C;  2XN9 C;  1F2R C;  4FHJ A;  2NMQ A;  2KAJ A;  1J0G A;  2PE9 A;  4JLC A;  2LGY A;  1RRB A;  4K81 A;  2LAS A;  1T0Q C;  3BK1 A;  3FAH A;  1WX7 A;  2IBI B;  3ZJV A;  2L7R A;  3MTN B;  1L6U A;  1N60 A;  1IGC A;  3NZS A;  1GC7 A;  2LRW A;  3AE2 B;  3HM6 X;  3N20 C;  2RMM A;  4A90 A;  1T6B X;  1BUI C;  3PGE A;  2HD5 B;  4W9G A;  4FUL A;  1NBF C;  3A4S C;  5DPW A;  1EU4 A;  5G5G A;  4HKQ A;  4BBN F;  3IAM 1;  3QAQ A;  1IP9 A;  4URK A;  4LLG M;  1HA5 A;  2J0K A;  2WDR B;  2YEP F;  4C7Z A;  1JML A;  2G1E A;  3ZKJ C;  3KW5 B;  4NPN A;  1QKZ A;  3BWU D;  3AI5 A;  1UH6 A;  3MC0 B;  4BAX A;  2WXM A;  1FMA D;  1L4Z B;  2W3S A;  3PLV A;  2IY0 B;  1UNS A;  4C56 C;  4II3 B;  3AEF B;  2K22 A;  4HK2 A;  2DZM A;  2WU2 B;  1SSN A;  2N1W A;  3IBE A;  4PT5 A;  4AJY B;  1X1M A;  1R4M B;  4G3X B;  2KN4 A;  3QHT A;  3N9Y C;  3H7P B;  1EF5 A;  3VTV A;  2VH1 A;  1TS2 A;  1YNT E;  5JHA A;  1YQB A;  4K3B A;  5G55 A;  2LMC A;  1ZOY B;  2L00 B;  2LI5 A;  3BZD B;  3P4Q B;  2CU3 A;  3RNF C;  3TSS A;  1CZP A;  3C0R B;  2NCN A;  2AL3 A;  3D32 A;  3AE9 B;  3AEA B;  3ZDM C;  1MJD A;  2BGF A;  4XZ4 A;  2WDQ B;  3GS2 A;  4ZRP A;  4CQN A;  2I1J A;  2IO3 B;  1FM0 D;  1YJI A;  3C19 A;  1T0S C;  2JRI B;  1F52 A;  3DVN V;  1P7E A;  2GI9 A;  3SD5 A;  4S17 A;  3H7P A;  3RNE C;  2OJR A;  3DWG C;  2GBM A;  4MGZ E;  4XE0 A;  3AEE B;  1LXD A;  1SE9 A;  2K39 A;  2KMC A;  4WIP A;  2J53 A;  3CSF A;  1E8W A;  3OWE B;  1ZUD 2;  1WXM A;  3VR8 B;  1N5W A;  1RFA A;  3O65 B;  4GGQ A;  4G0N B;  4A3P A;  1FCL A;  1NI2 A;  4WWM A;  2X38 A;  1PFD A;  1JAL A;  2QCZ A;  3B2G A;  2CS4 A;  4MGY E;  1NI3 A;  4GU2 A;  1WE7 A;  4L1B A;  4XDC A;  2EMT A;  3NUH B;  1C1Y B;  3LJ3 A;  3BII D;  2MBH A;  2AL6 A;  4XX5 A;  4AS1 A;  4EOY A;  1MVK A;  2LJI A;  1N62 A;  4NAW A;  1XEE A;  5EE9 A;  4BFR A;  5J17 A;  4AUQ C;  1L0Y B;  4LNK A;  4NJ7 A;  1AW7 A;  1E9M A;  2RDH A;  2WXO A;  4TKN A;  3ZNG C;  2HDE A;  3DBH B;  4RGN A;  4DHJ B;  3AM9 A;  3WAN A;  5FR6 A;  2EMS A;  1C76 A;  5HI1 A;  2REX A;  1N5X A;  4GXB A;  4M01 A;  4RF0 A;  4IC7 B;  1I4Q A;  1MG4 A;  3KLS X;  1PYW D;  1J19 A;  1OEY A;  1WZ0 A;  2X8X X;  2VH2 A;  2L3Z A;  2LUE A;  2N0S B;  4MH8 A;  4LCD E;  3MC8 A;  5GXG B;  5L83 A;  2KLG A;  1QOA A;  4FJY A;  2NPT B;  4AP4 C;  2OJW A;  2JWU A;  3AE6 B;  4GN1 A;  3AMZ A;  3GOE A;  2BKF A;  1VZ8 A;  3AE4 B;  4DWF A;  1PGA A;  1BML C;  2PTL A;  4IKG A;  2FCQ A;  1U4A A;  3KQ4 A;  4F7Z A;  3RMK C;  3Q14 C;  3VR9 B;  2D5G A;  1AYF A;  4MSQ B;  3R7Q A;  2MRP A;  4ANV A;  1SJH D;  3QA8 A;  2XBB C;  4KDL B;  2JXT A;  1K53 A;  3W5V B;  1GJZ A;  3EC8 A;  5AZF A;  3KUD B;  1I4X A;  2JWZ A;  2KAN A;  2KT7 A;  3PVL A;  1JWM D;  2WXG A;  4WQM A;  3CF6 E;  1FRR A;  1PGB A;  2D3G A;  5LXH A;  1TKE A;  1ZDV A;  1LFD A;  3TIX A;  5EE1 A;  3B1L X;  2ZNV B;  1R4N I;  2KQ7 A;  2INN E;  3CWI A;  2LZ6 A;  3UIP B;  3N1Z C;  3H8H A;  2MJ3 A;  5D94 A;  2MEK A;  1WXQ A;  1D3Z A;  3ZJU A;  2DYB A;  5CX3 A;  3RI7 C;  3ZTD A;  1FFV A;  1NEN B;  2O2V A;  1FXT B;  4OVU A;  1V1P B;  3APF A;  3DHH C;  1I7H A;  3ALB A;  1JRU A;  1XD3 B;  2BB5 A;  3DPD A;  1WGH A;  2WXP A;  3SFD B;  4D2K A;  3Q3N C;  2M1M A;  2I38 A;  4HCN B;  1SEB D;  1V6E A;  1FEH A;  1E7U A;  2QMT A;  3P42 A;  2DAF A;  5BMG A;  1VCB A;  4HDO A;  2LVO A;  3R8B A;  4W9I A;  1IYF A;  2PLP A;  1PGX A;  5D6J B;  1R7S A;  4FA6 A;  4LJO B;  5JHB A;  3I3T B;  4G50 A;  1MPE A;  1ENF A;  1HZ5 A;  1NYQ A;  4XYC A;  1KFY B;  1ET6 A;  3ZVV A;  2KMM A;  4NY0 A;  2ZZP B;  4Q2J A;  3DDC B;  2V3P A;  4ICV A;  4WWO A;  4UDU C;  4C4V B;  4X57 B;  3I5J C;  2L1A A;  2MBQ A;  4TMA B;  2A4Z A;  2JZ3 B;  2LGX A;  2UWQ A;  3ZXV A;  3V6E B;  3DHG C;  3QQ8 B;  4E3C A;  1K50 A;  2VZK B;  2NS5 A;  3MC9 A;  3IVF A;  3M63 B;  3KWV A;  4BKS D;  4DDG D;  2JPH A;  1T0R C;  2PVO D;  3B08 A;  3KH0 A;  3WAO A;  4C00 A;  3QC8 B;  4HKZ E;  2CJO A;  4FXC A;  1VD2 A;  4MM3 B;  2OHF A;  3LXF A;  1TIF A;  4PK1 A;  3T3N A;  1FIQ A;  2V3S A;  2KJ6 A;  3VAW A;  4IW0 A;  3N3K B;  1V80 A;  4RH6 A;  4NZL B;  2MW5 A;  2BS3 B;  4KGT A;  1ZW7 A;  2QIL A;  2D3B A;  3WA0 A;  2GLS A;  2HJ1 A;  1AAR A;  2N7J A;  1WM3 A;  4IWP A;  2H88 B;  1SB3 C;  4DXG A;  3NVV A;  2WQY B;  4KIK A;  2KFJ A;  2BF8 B;  5C1Z A;  4HVB A;  1JRO A;  1WE6 A;  2G9H D;  2J0J A;  2Q5W D;  2KWV B;  2W9N A;  1IGD A;  2Z0E B;  2BS4 B;  2L83 A;  5KHO A;  3J9C A;  2JSV X;  2JVC A;  3V60 A;  1TYG B;  5AUI A;  4W9K A;  2DZI A;  2XEW A;  3AEB B;  1YQ3 B;  1XLN A;  3GE8 C;  1F9J A;  4IUM B;  1OGW A;  2ZPN A;  1TZO A;  1D5M C;  1LO5 D;  1NEK B;  4BBN C;  1JWU D;  3Q3F A;  3RD2 A;  1WXV A;  3P2B A;  2Y5B B;  3FIL B;  1RWS A;  3BK2 A;  1JWB D;  1WI0 A;  3AE3 B;  4BZA A;  2D3C A;  1G6J A;  4NQK E;  4WWP A;  1OFF A;  3PLU A;  3UIN B;  5CHW A;  1TZ1 A;  1E8X A;  4PYZ A;  5BYQ A;  2ZNV C;  2IDY A;  3ZRF A;  1XO3 A;  1HZ6 A;  2Z8L A;  3U52 E;  3L10 B;  4EEW A;  2MP2 B;  1MHX A;  2W3R A;  1WGD A;  4A55 A;  1UEL A;  4E74 A;  4HLE A;  3ZNZ B;  1GC6 A;  3JYU A;  4W9D A;  1H4R A;  4KZ0 A;  3DBR I;  1SE2 A;  5FKA C;  3WCQ A;  4YL8 A;  2DWQ A;  1AWD A;  3NY5 A;  3LB8 C;  2MH7 A;  3AEC B;  2JZP A;  1L0V B;  1VDV A;  1I35 A;  1EWC A;  2AYO B;  3NVZ A;  2MP2 A; 
#chains in the Genus database with same CATH homology
 4IDI A;  1C4P A;  5EE3 A;  2PW9 A;  2XNA C;  5I4D A;  2WU5 B;  1RFK A;  1WWT A;  3IXS A;  4JX1 C;  3DWG C;  3TEY A;  4A6Q A;  1JRP A;  4XE0 A;  3AEE B;  4A8X C;  4HRS A;  4L2Y A;  1FD6 A;  1HEZ E;  1L6V A;  5E6J A;  4WIP A;  2KAC A;  2J53 A;  2N9L A;  3SFE B;  1Q10 A;  1YQ4 B;  1V1O A;  2LUM A;  3OWE B;  1ZUD 2;  1C79 A;  2BBC A;  1N61 A;  2YEP B;  3VR8 B;  1N5W A;  1K51 A;  2AQ2 B;  3DWM A;  2WXF A;  5HHD G;  1XLQ A;  1FCL A;  1D6E C;  2GB1 A;  1N63 A;  5C2T B;  4DXF A;  1IBX A;  3PZ7 A;  1FCC C;  3P4S B;  3W1S A;  3O13 A;  4WWM A;  2X38 A;  4YT0 B;  3I9V 1;  1PFD A;  1JAL A;  1I4G A;  3B2G A;  1NI3 A;  5AUK A;  4ZHP A;  4L1B A;  4XDC A;  5HFY A;  1I4P A;  1TY0 A;  4KKI A;  1CQV A;  3NUH B;  4JE3 B;  2QSD A;  3BII D;  3ETR A;  2L52 A;  2MJE A;  2ONQ A;  4AS1 A;  3IT6 B;  4HEA 1;  5MPO A;  1MVK A;  1KTK A;  3GB1 A;  3P1M A;  2H89 B;  2LJI A;  1N62 A;  3Q8F A;  3R2I A;  2K9X A;  1XEE A;  5EE9 A;  2EKI A;  1L0Y B;  2Y3A A;  3PO0 A;  3Q8A A;  1AW7 A;  1E9M A;  1EM7 A;  1NVI D;  1VR9 A;  2RDH A;  1I4R A;  2WXO A;  3AE7 B;  3B9J A;  4WH4 A;  3VRB B;  2HDE A;  1UGJ A;  2DYM A;  1VZ7 A;  4KX6 B;  5C3J B;  4RGN A;  1M4V A;  5H92 C;  3ZQ4 A;  4M0W A;  3AM9 A;  3FC4 A;  3TEX A;  5BMI A;  3IAS 1;  1C76 A;  1KF6 B;  1YN5 A;  4LTU A;  5HI1 A;  1PUT A;  2M19 A;  3ZYY X;  4B0M A;  2IJ0 A;  2BYT A;  1N5X A;  5G5H A;  1B1Z A;  4RF0 A;  5LNK 1;  3AN1 A;  2PIA A;  1I4Q A;  2AQ1 B;  3KLS X;  1ZE3 D;  1PYW D;  3HUI A;  1D5Z C;  1KRH A;  2LEK A;  4L23 A;  3NRZ A;  3BYT B;  1TKG A;  2GRI A;  1L0X B;  2KQ4 X;  2N0S B;  4MH8 A;  4WAF A;  3V3X A;  3AH7 A;  1WSP A;  5GXG B;  2FBW B;  2BB6 A;  4TSS A;  3U2S C;  1QOA A;  2WXN A;  3NVY A;  2BTE A;  1TS4 A;  1TS5 A;  1F77 A;  2B76 B;  1EWY C;  3FIL A;  2JWU A;  4C80 A;  2NTT A;  1FFU A;  3MP9 A;  3MHZ A;  2WXQ A;  3AE6 B;  4RCO A;  4B0E A;  1E10 A;  3AMZ A;  2KWD A;  1JW9 D;  4XDD A;  1C78 A;  1VZ8 A;  1E7P B;  3AE4 B;  1FXI A;  1PGA A;  1MHH E;  4RFB A;  1BML C;  1BXT A;  1SE4 A;  2PTL A;  3TEW A;  1L4D B;  1TY2 A;  1ZXI A;  5EE0 A;  4IKG A;  4ZRQ A;  3KQ4 A;  1T3Q A;  2RPV A;  3E56 A;  3P4R B;  3URY A;  4ZYS A;  2RDG A;  2J42 A;  3VR9 B;  2D5G A;  1AYF A;  1VJK A;  4YSX B;  1ZPS A;  1K52 A;  2IGG A;  4ZOH C;  1ACC A;  2R61 A;  1A70 A;  1ZP0 B;  3EUB 2;  4ITK A;  1XLP A;  4YWG G;  1SJH D;  2PVG C;  3Q69 A;  4C7Y A;  2INP E;  2JXT A;  2V3N A;  4RGM A;  1K53 A;  2WXL A;  4N6E B;  4R3D A;  3W5V B;  1JQ4 A;  1SF0 A;  2IPK D;  1F2R I;  4RGO S;  2OED A;  2SAK A;  3VRA B;  3AED B;  1I4X A;  1ET9 A;  2WXG A;  1JWM D;  4WQM A;  2LGI A;  2JX5 A;  3ZGZ A;  1FRR A;  3V05 A;  5JXV A;  1DOI A;  1PGB A;  2M0A A;  3ABV B;  3SEB A;  3ZJT A;  3PZ8 A;  1F0Z A;  1NYR A;  1TKE A;  1ZDV A;  2JYE A;  3U7Z A;  1UWM A;  3AE8 B;  3NS1 A;  3BVG A;  4YTM B;  4P6V F;  2K3U A;  3R2T A;  5EE1 A;  5D3D A;  1QOG A;  1HXY D;  4YTP B;  2WXI A;  2INN E;  4WUR A;  1DGJ A;  3CWI A;  1DOY A;  1Y56 A;  3P4P B;  1FNW A;  3H8H A;  1GB1 A;  2W82 A;  2AQ3 B;  2MJ3 A;  4HJG E;  2MEK A;  1WXQ A;  2QIE B;  3ZJU A;  1QQR A;  4DQO C;  4AQ7 A;  3IT4 B;  4ARI A;  3EGR A;  5H8Y E;  2WNM A;  2ZW1 A;  2AX5 A;  3TEZ A;  1FFV A;  3C8Y A;  1NEN B;  4JPS A;  1E6E B;  4JWU C;  1J7B A;  4NJC A;  2DLB A;  1XCT L;  1J7C A;  4ZHO A;  1V1P B;  4GDK B;  1J7A A;  2JU6 X;  5BMH A;  4YSY B;  1EU3 A;  1I7H A;  3AB5 A;  4TQ0 A;  1JWA D;  1ROE A;  4YTN B;  3Q8E A;  2BB5 A;  4IOI E;  1YMH E;  3U4E G;  2WXP A;  3SFD B;  1YJJ A;  1HQR D;  4D2K A;  2KDM A;  3MJ5 A;  1JWS D;  1FXA A;  2I38 A;  2CJN A;  3T3O A;  1SEB D;  2JQR B;  1FNV A;  3AEG B;  1UWX A;  1FEH A;  2QMT A;  1VRA B;  2E6X A;  1C4A A;  3AE5 B;  3UI3 A;  1FO4 A;  3NVW A;  3P42 A;  3EA6 A;  4NAM A;  2BT6 A;  4JWS C;  5BMG A;  2MJD A;  2BW2 A;  4RF1 A;  2I2Y A;  3R8B A;  3B2F A;  1YN3 A;  2PLP A;  4J3O D;  1PGX A;  1R7S A;  1CJE A;  2LHD A;  2SEB D;  1XF5 L;  3LYY A;  1GPX A;  1STE A;  4OZC A;  1GOZ A;  1JCK B;  1MPE A;  1ENF A;  1ZDX A;  2IGD A;  1HZ5 A;  2LFI A;  1NYQ A;  1KFY B;  2WXJ A;  4LK0 M;  1ET6 A;  4MAC A;  4GLS C;  2PMV A;  3HRD D;  4XWW A;  2KMM A;  4EE2 A;  4Q2J A;  3P63 A;  4YSZ B;  1UUP A;  2WLB A;  1ESF A;  2V4I B;  2V3P A;  3HVD A;  4MT5 A;  1IUE A;  4UDU C;  2J4X A;  1GAQ B;  1WRI A;  2NTS A;  2ON8 A;  1FNU A;  3W9C B;  2L1A A;  5D3I B;  4TMA B;  1QOF A;  1QT9 A;  1OQQ A;  2L32 A;  3Q8B A;  2Y5C A;  1K50 A;  2VZK B;  4OZB A;  2WP9 B;  5T8I A;  1SXT A;  3KWV A;  4RGT A;  4KGR A;  4REZ A;  4OHJ A;  3RFZ B;  2PVO D;  1IBX B;  3BYY B;  2EEL A;  2ACZ B;  3W2D A;  2WXH A;  3RPF C;  1C4C A;  2W55 A;  4HKZ E;  2WDV B;  1GB4 A;  2CJO A;  4FXC A;  4MM3 B;  2ICI A;  2OHF A;  3LXF A;  5FK9 C;  1XLO A;  2FE8 A;  3T3N A;  1OQR A;  1AN8 A;  4O1N A;  1FIQ A;  4OVZ A;  4HRO A;  1RYJ A;  2V0G A;  5D7G A;  1I4H A;  1SE3 A;  4RH6 A;  2QEJ C;  1SBB B;  4NZL B;  2BS3 B;  2FUG 1;  4KGT A;  1P7F A;  1D5X C;  1VZ6 A;  2N9K A;  2QIL A;  2XN9 C;  1T5X D;  4NAW B;  1ZXH A;  2N7J A;  2Y5P A;  1F2R C;  2H88 B;  2NMQ A;  2KAJ A;  1SB3 C;  4OZA A;  4DXG A;  1C9F A;  3NVV A;  2WQY B;  2E3T A;  1E0Z A;  2WXR A;  3BK1 A;  3FAH A;  1JRO A;  4P16 A;  1XCQ L;  3ZJV A;  4KKJ A;  2G9H D;  3AV8 A;  1L6U A;  1N60 A;  1C77 A;  1IGC A;  3E9S A;  2Q5W D;  1RM6 C;  3W5U B;  1SJE D;  3AE2 B;  4USA A;  1IGD A;  4TQ1 A;  2BS4 B;  2RMM A;  1L5P A;  1V8C A;  2L83 A;  3J9C A;  4A90 A;  1KLG D;  2JSV X;  2HTM E;  1T6B X;  1TS3 A;  2J52 A;  1BUI C;  1DYQ A;  1TYG B;  4OW0 A;  5AUI A;  4XWT A;  4H2A A;  1QOB A;  3AEB B;  1YQ3 B;  1EU4 A;  1XLN A;  5G5G A;  4N59 A;  2DBY A;  4HKQ A;  1MI0 A;  3IAM 1;  1TKY A;  5FR3 A;  4US9 A;  1CK1 A;  4LLG M;  1TZO A;  1HA5 A;  1D5M C;  1LO5 D;  1NEK B;  2WDR B;  1JWU D;  3KWL A;  1QF6 A;  2YEP F;  2WXK A;  4C7Z A;  3FIL B;  1D4B A;  2QJL A;  1JML A;  3BVM A;  2G1E A;  4ARC A;  1RWS A;  2W54 A;  3BK2 A;  1JWB D;  1QKZ A;  3AE3 B;  3BWU D;  3L4P A;  1DOX A;  1B9R A;  1WYG A;  1WGK A;  2LHE A;  3MFG A;  4GDL B;  3MC0 B;  1V1P A;  4US8 A;  1OFF A;  1FMA D;  1L4Z B;  2W3S A;  2WXM A;  3VQI A;  1UNS A;  4C56 C;  4YXD B;  2PKO A;  1FRD A;  2IGH A;  2K5P A;  3AEF B;  2K22 A;  1YN4 A;  2WU2 B;  1SSN A;  1SIJ A;  5BYQ A;  4PT5 A;  2IDY A;  1QLB B;  1TJE A;  2M56 B;  1XO3 A;  1HZ6 A;  3SR6 A;  2Z8L A;  3U52 E;  3Q8C A;  2KN4 A;  2TSS A;  3N9Y C;  2DYO A;  1MHX A;  1TS2 A;  1YNT E;  2W3R A;  4RNA A;  4A55 A;  5HG2 A;  3NZ3 A;  2LMC A;  1ZOY B;  2WS3 B;  3BZD B;  3GP7 A;  3P4Q B;  5BYS A;  2ZW0 A;  1PDX A;  3AE1 B;  2CU3 A;  3CIR B;  3I57 A;  1SE2 A;  4KGS A;  5FKA C;  3TSS A;  1CZP A;  4A9A A;  1XXG A;  3WCQ A;  2K0P A;  2DWQ A;  1AWD A;  1KLU D;  3HVZ A;  3LB8 C;  4N58 A;  3AE9 B;  3BVZ A;  2BS2 B;  3AEA B;  2MH7 A;  1V97 A;  2JZP A;  2WDQ B;  3AEC B;  3GS2 A;  1L0V B;  4ZRP A;  4CQN A;  5BYR A;  2JYT A;  1VDV A;  1FM0 D;  1YJI A;  2VZK D;  1VLB A;  1KH0 A;  1QIL A;  3TUO A;  1EWC A;  3NVZ A;  5TSS A;  1P7E A;  2GI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...