1DOXA

1h and 15n sequential assignment, secondary structure and tertiary fold of [2fe-2s] ferredoxin from synechocystis sp. pcc 6803
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
96
structure length
96
Chain Sequence
ASYTVKLITPDGESSIECSDDTYILDAAEEAGLDLPYSCRAGACSTCAGKITAGSVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCTIETHKEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1H and 15N NMR sequential assignment, secondary structure, and tertiary fold of [2Fe-2S] ferredoxin from Synechocystis sp. PCC 6803.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords FERREDOXIN [2FE-2S]
total genus 12
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 1995-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1doxA00
1JWBD 4ZOHC 1FMAD 1TYGB 3B2GA 3B2FA 3AE2B 3AE5B 5MPOA 2MJ3A 3NVZA 2L83A 2WDQB 1ZUD2 1QLBB 1FM0D 1OQRA 1J7CA 3VRAB 1JQ4A 2QIEB 4C7ZA 4YSZB 1A70A 3NS1A 3VR9B 1N60A 2BS4B 2W3SA 3DWGC 3HVZA 2CU3A 3DWMA 2WU5B 3SFDB 2M56B 3AE4B 1I7HA 3NVYA 2WU2B 3P4RB 1IUEA 3AEFB 3AEAB 1L6VA 1QF6A 3NVWA 4US9A 1FXIA 1KRHA 4C80A 1FFUA 1E9MA 2DWQA 3AECB 1FRDA 2AX5A 1GAQB 1QOGA 1ZOYB 3EUB2 4ZHPA 1TKEA 5G5GA 2WDRB 1V8CA 2L52A 1N63A 1GPXA 3SFEB 2QJLA 5C2TB 3VR8B 1WWTA 5GXGB 1J7AA 1VDVA 4HRSA 4YSYB 3W9CB 1N61A 1NYRA 1DOIA 1PDXA 1VJKA 3B9JA 1CJEA 2BT6A 2H88B 1AWDA 3AE8B 1DGJA 4YTPB 1SIJA 2CJNA 3FAHA 1J7BA 3KWLA 4ZHOA 2ACZB 3AEEB 2W54A 4N58A 2EKIA 4WQMA 3HRDD 2JQRB 3AV8A 2WQYB 2K9XA 1FRRA 2HTME 1V97A 1AYFA 1E6EB 2KMMA 2WLBA 1EWYC 3WCQA 1E0ZA 1QOBA 2MJDA 3CIRB 2MH7A 1YQ4B 1OFFA 3ZYYX 2MJEA 5H92C 2OHFA 1FO4A 1UWMA 1YJIA 4P6VF 5EE9A 2KAJA 3AMZA 4C7YA 2WP9B 3P4SB 1JRPA 1VLBA 3AM9A 1YQ3B 1B9RA 1JW9D 1DOYA 4FXCA 2FBWB 1YJJA 2CJOA 1E10A 2PKOA 3AE9B 4A9AA 1FIQA 3AB5A 1RFKA 2Q5WD 3BIID 2M19A 3FC4A 4YXDB 1XLOA 3P1MA 1NEKB 4USAA 4YTNB 4JX1C 1KFYB 1JROA 1JWAD 3AE6B 4N6EB 2W55A 2H89B 4N59A 1PUTA 1PFDA 1N5XA 1L5PA 3AEGB 1NI3A 1QOFA 3AE3B 1ROEA 4US8A 2N0SB 1FFVA 2G1EA 2WS3B 3NVVA 3AEDB 4JWUC 3RPFC 1N62A 3W5UB 5EE3A 1DOXA 1ZP0B 3AE1B 4HROA 1TJEA 4KX6B 3P4QB 4YTMB 3CWIA 3AE7B 1KF6B 1SB3C 5AUKA 1CZPA 2E3TA 1TKGA 1WGKA 3NRZA 3P63A 3VRBB 4IDIA 2PVGC 4JWSC 2PIAA 4YT0B 3AN1A 2K5PA 2DBYA 3W5VB 1RM6C 1F0ZA 2LEKA 1NYQA 1T3QA 3PO0A 2PVOD 3AEBB 4YSXB 3ETRA 4LTUA 1ZXIA 2WDVB 5H8YE 5C3JB 1XLNA 1QOAA 3L4PA 1NVID 1RYJA 4ITKA 5AUIA 1XLPA 1L0VB 1SF0A 3ABVB 2Y5CA 3SR6A 1E7PB 2B76B 3HUIA 1WXQA 1L6UA 1R7SA 2JX5A 3AH7A 1RWSA 1TKYA 1OQQA 3P4PB 1N5WA 5EE1A 1FXAA 1XO3A 1WYGA 1JALA 1WRIA 1XLQA 2BS3B 3LXFA 4WWMA 1NENB 5EE0A 2W3RA 3LB8C 1QT9A 2BS2B 5G5HA 2K22A
chains in the Genus database with same CATH superfamily
1YN5A 3U4EG 4PS8A 5L83A 3AE2B 4ZRQA 2GBRA 2ZCBA 4PYUA 3DBHB 4F8CB 3VRAB 1Q5WB 2Y5PA 3SHQA 1EM7A 2WU2B 3P4RB 4A3PA 2ZW0A 3R7QA 4FJVB 3KYCD 3NVWA 3NHEB 1HTQA 2WXPA 1FFUA 1PQSA 3AECB 3ZJVA 2WXKA 1K53A 3MC0B 3ZKJC 3L17A 3AEEB 3VDZA 4OZAA 2ZCCA 1HTOA 3GS2A 4ICVA 4FXCA 2FBWB 4KV2A 2KDBA 1ZKHA 3APDA 1EUVB 4NNJB 3LJ3A 2NPTA 5LXIB 1PFDA 4MACA 4BFRA 1XXGA 1NI3A 3AEGB 4PS3A 4CHKA 3IAM1 3NZUA 1MFWA 4JWUC 1I42A 2TSSA 5DPTA 3ZUNA 3CWIA 3RNBC 2C9WB 4GU2A 3U7ZA 4QAYA 3TCAA 1XEEA 3EFCA 3MJWA 2BVCA 2MBQA 2JRHA 3ZRFA 3NZ3A 1T3QA 4LTUA 3MHZA 5C3JB 4L23A 3SU8X 1HZ5A 3QJZA 5AUIA 3NJTA 4W9HA 1SF0A 2KXJA 4WWPA 4NQLB 2LFIA 4ZYNA 3JSVB 3CMMB 2ZPYA 2XK5A 3H6NA 3PT2B 5MPOA 4OZCA 2QHOA 2K3UA 5E6JA 5E6PA 3RN9C 2L83A 4EKUA 1WX8A 2MA9B 1CK1A 2HJ1A 1OTRB 5AZGA 4PYZA 1P1AA 3EECA 3SDLC 1IBXA 2WU5B 2JZZA 4ARIA 5KHOA 3TUOA 1IUEA 1XT9B 2RMMA 3RMKC 4US9A 1FXIA 2KYWA 1GOZA 2X38A 4AUQC 3H1UA 4NY0A 5DPSA 2M4NA 4PK1A 1VDVA 3QARA 5DPRA 3B0AA 3I3TB 1EF5A 4M00A 1ZDVA 1WE6A 1M4VA 2WXFA 4ANWA 1NDDA 2FUHB 3VUWA 4XWWA 4P6VF 2RDHA 2L3ZA 1K50A 5E6NA 2ZNVC 2FCSA 1YNTE 4MELA 1VZ6A 4FBJB 4OHJA 3BVGA 1FXTB 3IAS1 3P1MA 4ZRKA 4EZJA 2N1VA 2PJHA 2KKCA 2CKHB 2WNMA 2NVUI 3P4QB 1VCBA 1RFAA 2J42A 5AUKA 3K9OB 1XD3B 4JLCA 5CHVC 2DBYA 1JWMD 3URYA 2PVOD 4KKIA 4LNOA 4WAFA 2MBOA 2JYTA 3L08A 3M62B 5BYQA 1B1ZA 1L6UA 3C0RB 2NBVB 2BPSA 1OQQA 2G3QB 1XO3A 2PW9A 4A8XC 2D3AA 3N1ZC 2K22A 3I9V1 3IHPC 1F52A 1SBBB 2KFKB 4B95A 2D2QA 1TS5A 2QIEB 2Z0EB 1YMHE 5JHAA 1C3TA 2INPE 2JU6X 1AW7A 3NY5A 1GC7A 3NVYA 3O65B 3UIOB 2DX5B 4P1CC 2J0MA 1L6VA 1GC6A 4K7WA 3WAMA 1E9MA 1E7VA 2K1FA 2LHDA 4J6IA 3A9JB 2ZJDA 2QJLA 2PE6B 2LMCA 4S17A 2LRUA 4ICUA 3Q8FA 1SIJA 2ACZB 3DPDA 2BYVE 1D5ZC 3CIRB 5BMGA 3PZ8A 1NI2A 1WJ4A 3MP9A 4DHJB 3A1QB 1DYQA 3QX1A 1WF9A 3ZTCA 4BKSD 4R3DA 2WP9B 2ZEQA 4GSWA 3VTVA 2DHZA 1YN3A 3S2AA 3AB5A 1G6JA 2V4IB 4MM3B 4N6EB 2N7EA 2GBMA 2JWUA 2KVZA 2M0XA 3RNFC 5J2RA 4JGHB 1FFVA 1JWUD 4IWQA 2LD9A 3BWUD 4EZKA 2V9HA 3RZWC 4BKSA 1L4DB 3V3XA 2AQ2B 3PO0A 2WXMA 1V49A 3MHSD 3VQIA 4HLEA 1LQBA 3HUIA 5KHQA 3R2TA 3QK0A 3ZLZA 4P7IA 3BYTB 1P7FA 1XLQA 2ZPNA 2W3RA 1T0YA 2WXHA 2KO3A 1FMAD 1TYGB 3MC9A 3B2GA 2WXLA 5AZFA 3EC8A 3PHXB 3DBRB 1FNVA 4C7ZA 1KLGD 1L0YB 4LNIA 1C4CA 3DWGC 4E74A 1E8XA 4W9JA 2GMIC 1Q0WB 1GB4A 2NMQA 2Y5BB 3KH0A 2L52A 4GLSC 3A1QA 5HKHA 3HHMA 3RD2A 1NYRA 2EELA 3V61A 3B9JA 3RNCC 3L13A 3HRDD 4HPLB 4MJSA 2FE8A 3ZYYX 2BF8B 2PPHA 2JF5A 4KKJA 1FNWA 1K8RB 3OJ3A 2KLGA 2REXA 5BMHA 1XLOA 2WDTB 1KFYB 3APFA 2ZZPB 1FPYA 4KGSA 3ZIMA 3A4RA 1ROEA 2AYOB 4GOCA 2MBBB 2KFJA 2KTRB 1PYWD 4NZLB 1OQYA 2PIAA 3DHGC 2KTRA 1WH3A 1SEBD 2LHEA 4ANUA 2MCNB 1UD7A 3W1YA 4ASWC 1GNUA 2IO3B 2JX5A 1C79A 4GDLA 4RGMA 4RFBA 4KSKC 3PLUA 1WY8A 4WWMA 2KDFB 3PHWB 3TL5A 3QIJA 2ON8A 5GMVA 1UGJA 3N1XC 5JZEB 1J7CA 1STEA 1QQRA 4LJOB 2K39A 3PZDA 2L76A 2LGDA 4XX5A 2C5LC 2Z8LA 4BBNC 4A20A 1P7EA 2PMVA 4ANVA 5IO9A 1FRDA 3WA0A 3ALBA 1HEZE 2HTHA 3NOBA 2LRWA 2YEPB 2W9NA 4MH8A 4G3XB 4M8MA 1DOIA 1L7YA 3HM6X 2MWSB 3KW5B 3D32A 2JQRB 2BYTA 1YX5B 2K9XA 2RR9A 4MGIE 3VTWA 2OJWA 1ZDXA 4TQ1A 2MJDA 5JHBA 1OFFA 1FCLA 2RDBC 1ZW7A 3VVWB 1UBQA 2KJ6A 2LI5A 5DCNA 4XC2A 3P4SB 1I4HA 3N32A 1PGAA 2KJRA 3Q8AA 1TBEA 1WGYA 3BVZA 1KOTA 3DVGY 3GZNI 5CHFA 3BIID 2J7QB 4RMAA 3WAOA 2IBIB 3ZDTA 3MJ5A 5BMIA 5BYSA 2K8CA 2SAKA 2XBBC 1IGCA 2RSUA 3WIMA 2MRPA 4HROA 4KX6B 5IN7A 5D2MB 2PVGC 3UIPB 3BYYB 3W5VB 2JSVX 2DAFA 3RFZB 1T0RC 2KN5A 1L0VB 3IVFA 3ABVB 4ZRJA 2VZKB 2G9HD 1UNSA 1VZ8A 2XN9C 1WRIA 3OWEB 4EEWA 1LM8B 4NJ6A 5G5HA 1RLFA 1C1YB 1SGHA 1F9JA 1MJDA 1E8ZA 2BKRB 1TIFA 3Q3JA 4IM2A 4YSZB 2KVRA 3IG3A 2UWQA 3W2DA 1MHHE 3Q8BA 2AL6A 3AEAB 3C19A 2MW5A 5LXHA 4HCPB 2DWQA 4HPPA 2PTLA 2WGSA 1LGRA 4HK2A 3PREA 1C4AA 3Q3OC 4KZCA 4KIKB 4OVVA 3VHTC 4WWNA 1CJEA 4RGTA 4XDDA 3KWLA 1N6ZA 1VD2A 1ACCA 4BKGA 4MGYE 2KMCA 1FRRA 1V97A 3EGRA 3BY4B 5CTRC 2VH1A 1QOBA 2LGSA 2MH7A 1Z2MA 1D6EC 3QC8B 3WALA 2MBEA 1JRPA 4TUUA 1MI0A 3QAQA 2CJOA 3R7RA 4ZRPA 2PKOA 2DZMA 2FAZA 4K81A 1MHXA 2JUOA 2MBHA 3CSFA 3JW0X 3M95A 1QOFA 3B08A 3VH4B 2X8XX 3ZQ4A 1N62A 4ZRIA 3W5UB 4EFOA 3VFKA 3AXCA 3QHTA 2YLMA 5C1ZA 2HDEA 1WGDA 4CQNA 1UZXB 4WQOB 4YWGG 3DVNV 3UI3A 1D5XC 2BQQA 2I2YA 2IYDB 1MVKA 1I35A 3FILA 2LUMA 4L2YA 1V1PB 3OJ4B 3NG0A 2NS5A 4RM9A 5EE0A 1WJ6A 3N20C 2AEHA 2KX3A 4RF1A 2OJRA 2WYQA 4KSLC 1LO5D 2D3BA 3I57A 3AE5B 2HE7A 2LVOA 2N9KA 1JQ4A 3VR9B 1T0QC 2DNFA 1N60A 2BS4B 5FKAC 2CU3A 1J19A 2J4XA 2M56B 3AE4B 1I7HA 2MLBA 5HG2A 4BAXA 2N9EB 1UF0A 4RF0A 1KH0A 2I1JA 3LYYA 1SE4A 1V8CA 4M0WB 4L1BA 2L8JA 1Y8RC 5GXGB 2GRIA 2Y3AA 2M8SA 3W9CB 1VJKA 2WXNA 2D10A 3AE8B 4NJ7A 2JT4B 1WI0A 2LUEA 2ZVNA 1TZOA 2WQYB 1HZ6A 2KTFA 3CF6E 3C8YA 1WX9A 1XF5L 1C4PA 3M3JA 2RGFA 4FULA 4WIPA 1UH6A 4OZBA 2I38A 1J8CA 2AWTA 1ESFA 2LVPA 3DBSA 1GUAB 3BK1A 4LNFA 1RFKA 2R2QA 1NEKB 2JY6A 4JX1C 2XNAC 3P2BA 3A33B 4A6QA 3K9PB 4N59A 1WYWB 2G4DB 3MFGA 4FLHA 4US8A 2K6QA 4GDKA 2LZ6A 2IO2B 4IDIA 3V60A 4RGOS 5EDSA 2L0TA 4FA6A 1YN4A 4F1SA 3TMPB 2K25A 2DZJA 1H4RA 3JYUA 3TIXA 4H2AA 4RM8A 2WDVB 2GBKA 5AZHA 1XLPA 2PLPA 2J53A 1RWSA 2M0AA 3Q14C 4JPSA 5EE1A 2BS3B 1RAXA 4BKTA 2CU1A 4II3B 4K1RB 2YEPF 1VR9A 2QMTA 1UBIA 4AJYB 1EF1A 3NVZA 3Q8CA 1OQRA 1AARA 1E7UA 4C00A 2L05A 4OVUA 2N9LA 1V81A 4E3CA 4IKGA 3H7PB 2PE9A 3GE8C 1E8WA 4C80A 5HI1A 2G4SA 2D3GA 5TR5A 3VXWA 4DDGD 1L2NA 2WDRB 3VAWA 3I5JC 2KC2A 1WXMA 2KDMA 3A9JA 1QZEA 2WXOA 1X1MA 4O1NA 4ZDVA 1IYFA 3H7PA 3BINA 1WR6E 4DXFA 3T3NA 2W54A 4N58A 2EKIA 4AWJA 3R66C 4E71A 4XZ4A 1AYFA 3PVLA 1YJ1A 3QA8A 4WJQA 5H92C 2D11A 4LCDE 3B1LX 3KQ4A 2KJHB 4MEMA 1JCKB 4FHKA 2ZNVB 4B0EA 4JIOU 3ZTDA 1L5PA 3T3OA 2N0SB 1DOXA 1ZP0B 1BXTA 3AE1B 1KF6B 1SB3C 2FIDA 5FR3A 2IZVB 4HKQA 4FN2A 1P98A 4I6NB 2LGIA 4YSXB 4IOIE 1ZXHA 1V1PA 4IWPA 3WAPA 1AN8A 4W9DA 1OEYJ 4EZLA 2FCNA 4AQ7A 3UQAA 2UU7A 2DZIA 3DDCB 1ZGUB 1C9FA 1J0GA 1IGDA 1JWBD 2K0PA 5E6OA 2V0GA 4URKA 5HHDG 2KN4A 2BGFA 4TQ0A 1BT0A 1A70A 2D5GA 4ACFA 1D5MC 4A3OA 2FCMA 3AEFB 4AOFA 2AX5A 1QOGA 3EUB2 5G55A 2JWZA 1TKEA 3A9KB 1GPXA 3A4SC 3N30A 2WX1A 1HE8A 4XDCA 5C23A 3GE3C 2NTTA 4RGNA 4HRSA 4YSYB 1S1QB 3KLSX 2BT6A 2DYOA 2WXGA 3QWZB 4FJYA 4HWIB 1I4RA 5AEKB 5J18A 1UWMA 2DYMA 3HM3A 3HK0A 2MP2A 2DAJA 4N9F4 3AMZA 3X23A 1WJUA 1B9RA 1DOYA 3IXSA 2Q5WD 2AQ1B 2M19A 4YXDB 4BVUC 5L95C 2GB1A 2GOWA 4USAA 3U2SC 1GB1A 1P0RA 2I1KA 2N7JA 3FKYA 4IG7B 4GGQA 2BKFA 3MC8A 5LLIA 2E3TA 3AN1A 4KGTA 5D7GA 1T5XD 5H8YE 1K52A 2KC1A 2OEDA 2OOBB 1RYJA 4IWOA 4GB9A 4D2KA 3PV1A 4KVGB 1N5WA 1KLUD 2WHIA 3QQ8B 3Q3MC 1IPGA 3O13A 2K6DB 3B2FA 3TSSA 1WXAA 1TT5B 2WDQB 5I4DA 2NR2A 4ARCA 4GN1A 4MT5A 1EO6A 2ASQA 4K7UA 2BBCA 5IA7A 2WX0A 2LXCA 1WZ3A 2V3PA 2Z59B 1WIAA 3LDZE 1BUIC 4HEA1 1GAQB 4M8NA 3PPAA 2EMTA 4DWFA 3PRPB 2BB6A 3Q69A 2BYFA 1N61A 4LDTD 2JXTA 4C4VA 3KUZA 3Q3NC 1DGJA 4F7ZA 2IGDA 3DOWA 4EOYA 3ZNID 1TY2A 1F77A 1GG3A 2OHFA 1WXSA 5G2NA 3KUCB 1YJIA 1TS3A 4G50A 1C78A 5EE9A 4WJNA 1UGMA 1WM2A 2CHWA 1YJJA 1V80A 2ZW1A 1WZ0A 1NBFC 5HFYA 2QDFA 4JQWC 4WURA 2KX0A 3V6EB 3PGEA 4W9FA 1TGZB 1N5XA 1ISNA 3AE3B 4II2B 3ZJUA 4B9KA 2WS3B 3FILB 2G45B 2KOXA 1I4QA 1YQBA 2B3AA 3VRBB 1WGKA 3P63A 4CO7A 1UELA 3OG5A 4KDLB 2IPKD 1I4XA 4M01A 3ETRA 1ZXIA 1KM7A 3ZDMC 2JZ3B 4P1BC 4AS1A 3AI5A 4HXDA 3BK2A 1K51A 2KANA 2JZPA 1ET6A 1V5OA 1KLVA 1SE2A 1OGWA 1EWCA 3HIZA 4HJGE 4XGAB 3I63C 3DHIC 3RT3B 4DK5A 4AJWA 2C60A 4J3OD 3W1SA 3NS1A 2W3SA 4GDKB 4TSSA 2IDYA 5D94A 3KYDD 2GLSA 1V5TA 2C7MB 1KRHA 2WXIA 1QILA 2NTSA 4KIKA 3VR8B 3ZXVA 2VH2A 3DBHI 2BTEA 4S0RA 3PRMB 3TEXA 1YD8U 4MJSB 4KZ0A 4DBGA 2LXAA 1WXVA 2QSDA 4GMVA 3ZO5B 2KDIA 2D07B 2LWPA 4K3BA 4MGKE 2DYBA 2MJEA 3MTNB 5DPWA 2KFKA 2RPVA 2K8HA 1SJED 2KAJA 3JVZX 4HKZE 1EU4A 1JW9D 1ENFA 3ZRCA 3L16A 5J17A 3IFWB 4A9AA 2QILA 2VZKD 3PS6A 2H89B 3RI7C 2J52A 3E56A 4OW0A 4FHJA 3U7DA 5CHWA 1D4BA 2INDC 1WE7A 3EFUA 1WM3A 4PS7A 4DHZE 1P9DU 4NAWB 1F1HA 1NVID 1M94A 4GDLB 3RCZA 4RH6A 3ONSA 1R4MI 4NAWA 3WANA 4BBNF 2C7HA 3VTUA 2KQSA 2NBWB 3RNAC 3LB8C 1HXYD 1MPEA 3VUYA 1QT9A 4UDUC 3DQVA 5IP4D 1MG4A 4DDID 4K7SA 4IM3A 4MH0E 1WMHB 2KMAA 1KTKA 1D3ZA 1SE9A 2RPQA 3HVZA 3AU5A 1TZ1A 3DWMA 2AQ3B 2V1YA 1KJTA 2KK8A 1V9JA 2JYEA 3OAWA 4EE2A 1ZOYB 3DCGA 2L00B 1FEHA 2L7RA 3R2IA 2H88B 1AWDA 2AL3A 1J7BA 3DBLB 2CHZA 2WXJA 2HTME 4HVBA 2KMMA 3BVMA 4KGRA 3WCQA 1U4AA 1FNUA 4MSQB 3L0WB 3TEWA 4TV3A 4GIVA 5FK9C 1L4ZB 1VLBA 1FD6A 1SXTA 3RNEC 2LJ5A 3H8HA 3L10B 4PT5A 2BW2A 4WAAA 1ZPSA 4CYEA 1JROA 4MGZE 3AE6B 2Z0DB 3Q8EA 1SSNA 4WJPA 3N9YC 1VRAB 4BZAA 3W1SC 4MM3A 3SEBA 3RULA 1CMXB 1CZPA 1V1OA 1PGXA 4AP4C 2K5PA 1E5WA 1HQRD 3PTFC 3NUHB 3ZNGC 1WX7A 2R2OA 3N1YC 4ITKA 4W9IA 1Z5SB 2B76B 1R4MB 3NZSA 4I6LB 1HA5A 3P4PB 1JALA 2CHXA 1H8CA 5BO4B 2XK5B 2KWCA 2IJ0A 2NBUA 3ZXRA 2MP2B 2HJ8A 2IY0B 3RNGC 2JXXA 4HDQA 3PLVA 3TJPA 1R4NI 2INCC 1T0SC 4ANXA 1SE3A 1JRUA 2LGYA 5JH5C 5T8IA 3UQBA 4EUTA 4X57B 5C2TB 4IM0A 1WWTA 2FIFA 2M17A 3PZ7A 3V62A 2BYEA 4YTPB 4ZHOA 1WSPA 4WQMA 3AV8A 2XEWA 1ET9A 2ICIA 1EWYC 1TY0A 1FO4A 2MX2A 4W9EA 3DBLI 1E90A 2KQ4X 2N4FA 4A90A 2GI9A 4HJKA 2QEJC 2D3CA 2E6XA 1TTNA 1Q1OA 3VH3B 3DVGX 3EA6A 4ZYSA 4WJOA 1A5RA 3T9LA 4LNNA 3NVVA 1RRBA 3U8ZA 4XWTA 2V3NA 3TEZA 4P16A 5FR6A 1FCCC 4TMAB 2IGGA 4B6WA 4IC7B 1TS2A 4LNKA 5JXVA 1WGHA 1R7SA 3AH7A 2INNE 1SJHD 1WJNA 1FXAA 3DVNU 1C76A 2JVCA 2DZKA 2CS4A 2MJ3A 4REZA 2J0JA 3M63B 3X0WA 4XYCA 1R4NB 1F2RI 4M02A 2CR5A 2NPTB 3PSEB 4GXBA 1C77A 2ZVOA 3CSTA 5TSSA 2N9PC 3GB1A 4ZHPA 2ONQA 5CX3A 1N63A 5D6JB 3SFEB 2KDEB 3Q3FA 4DHZB 3IT4B 1Q10A 3A9KA 3GZNB 3T8MA 4MDKE 4W9LA 3TEYA 3ZJTA 5IAAC 3E9SA 4NAMA 1E6EB 2FNJB 4LJPB 2KNBA 1XCQL 1E0ZA 2LGXA 1XCTL 2GBJA 1YQ4B 3ZGZA 2MHJA 2N1WA 4XE0A 1T6BX 4LK0M 2V4LA 3AM9A 2A5UA 2BWFA 1JWSD 3FC4A 2EKEC 4A55A 2W55A 2O6VD 2W82A 2IO0B 1PUTA 3J9CA 3GOEA 1VZ7A 3AU4A 1IBXB 3RPFC 3AEDB 1TJEA 1WMHA 2RD0A 1Y56A 5IOIA 2PEAA 4JL9A 1CQVA 3KVFB 4DXGA 2LEKA 3L4PA 2YVCA 3ZW3A 2Y5CA 3IT6B 4WH4A 1E7PB 2O6VA 2RDGA 4BOZB 1TKYA 3H9DA 3DBRI 4K3CA 3LXFA 1LFDA 3UGBB 2L32A 3ENEA 4TKNA 3UINB 3PRZA 4B0MA 4I6PA 4NJCA 1FM0D 2KQ7A 4HDOA 1V6EA 4C56C 4RNAA 2IY1B 2EMSA 1P3QU 3ZNZB 3BZDB 3V05A 1MG8A 3QCAA 3ZNHB 4WWOA 1QF6A 2M1MA 2L0FA 4FADA 1OEYA 1WRDB 5G5GA 2BB5A 4MSMB 1XQQA 1J7AA 4HPMB 3AULA 1PDXA 3N3KB 2LASA 2V3SA 3Q6BA 2CJNA 3FAHA 2WWZA 3RZFA 1I4PA 2KWDA 5D3DA 3L54A 3DHHC 2R61A 1EU3A 4JE3B 3R3MA 3HVDA 2KZRA 1BMLC 4DXAB 2NCNA 3TBLD 4NQKE 2WXQA 3AE9B 2KHWB 3ZVVA 2LVQA 3APCA 1JWAD 5D3IB 1IP9A 2VRRB 4Q2JA 2G1EA 1WFYA 4M0WA 3KUDB 1TKGA 2O2VB 3V6CB 3EHVA 4JWSC 4YT0B 4W9GA 5LNK1 4W9KA 1F0ZA 2JRIB 2WXRA 2O2VA 4G11A 4G0NB 2LJIA 1QOAA 3R8BA 1WR1A 3SR6A 1WXQA 2GBNA 3U30A 1YX6B 1V2YA 3U52E 1NENB 1YOVB 2BS2B 4C4VB 4ZOHC 1F2RC 2C7NB 1ZUD2 1QLBB 1UUPA 4BOSC 1UWXA 2J0KA 3GP7A 3SFDB 2IGHA 3UF8A 2KWVB 1ZE3D 4RCOA 3NS8A 2SEBD 2A4ZA 3H7SA 3ECIA 2DENB 1PGBA 4DQOC 3IBEA 2QCZA 4YL8A 3Q2AC 3P42A 4IUMB 2UYZB 2L1AA 2FUG1 1JMLA 1YIWA 2IO1B 1WGRA 2WLBA 1WGGA 3RUIB 1V86A 2KT7A 2KD0A 4C7YA 4NPNA 1YQ3B 4DHJD 2HD5B 1E10A 4LLGM 3VUXA 1FIQA 2JPHA 1SIFA 3ML8A 4YTNB 3SD5A 5IKCM 1GJZA 2MQJA 5EE3A 2FCQA 4YTMB 4W9CA 3AE7B 4FJZA 3NRZA 3ML9A 2KLCA 1TS4A 1RM6C 1NYQA 1L0XB 3AEBB 1S3SG 1XLNA 2N7DA 2K8BA 3JSVA 2KWUB 2QC8A 2O6VB 1QKZA 4IW0A 3RYTA 3KWVA 1I4GA 5BYRA 2N9XA 3OLMD 2BWES 1E8YA 2MEKA 4KDIC 1WYGA 2MSED 4OVZA 4HCNB 2DLBA 2KACA 1LXDA 4LDTB
chains in the Genus database with same CATH topology
1YN5A 1JWBD 2K0PA 2V0GA 3U4EG 5HHDG 3AE2B 4ZRQA 2ON8A 2KN4A 1UGJA 4TQ0A 3VRAB 1J7CA 1STEA 1QQRA 1A70A 2Y5PA 2D5GA 1D5MC 1EM7A 2Z8LA 2WU2B 3P4RB 3AEFB 1P7EA 2ZW0A 2PMVA 1SE3A 3NVWA 2WXPA 1FFUA 3AECB 1FRDA 2AX5A 1QOGA 3EUB2 5T8IA 1TKEA 1HEZE 3ZJVA 1GPXA 2YEPB 4MH8A 2WXKA 4XDCA 5C2TB 1WWTA 2NTTA 1K53A 4RGNA 4HRSA 4YSYB 1DOIA 3MC0B 3KLSX 2BT6A 2DYOA 3PZ7A 4YTPB 4ZHOA 1WSPA 3AEEB 2WXGA 4WQMA 2JQRB 3AV8A 2BYTA 2K9XA 4OZAA 1ET9A 1ZDXA 2ICIA 1I4RA 1EWYC 1TY0A 4TQ1A 2MJDA 1OFFA 1FCLA 1FO4A 1UWMA 2DYMA 2KQ4X 3AMZA 3P4SB 4A90A 1I4HA 3GS2A 1PGAA 2GI9A 1B9RA 1DOYA 4FXCA 2FBWB 3Q8AA 3BVZA 3IXSA 2QEJC 2Q5WD 3BIID 2AQ1B 2M19A 4YXDB 2E6XA 2GB1A 4USAA 3U2SC 3EA6A 4ZYSA 1GB1A 3MJ5A 1PFDA 4MACA 5BMIA 1XXGA 1NI3A 3AEGB 5BYSA 2N7JA 2SAKA 3IAM1 3NVVA 4JWUC 1IGCA 2TSSA 4HROA 4KX6B 3CWIA 4XWTA 2E3TA 3U7ZA 2V3NA 1XEEA 3TEZA 2PVGC 3AN1A 3BYYB 4P16A 3W5VB 2JSVX 1FCCC 4TMAB 3NZ3A 4KGTA 2IGGA 1T3QA 1T5XD 5D7GA 4LTUA 3RFZB 3MHZA 5H8YE 5C3JB 1K52A 2OEDA 4L23A 1RYJA 1HZ5A 5AUIA 1TS2A 1L0VB 1SF0A 3ABVB 5JXVA 4D2KA 2VZKB 1R7SA 2G9HD 3AH7A 2INNE 1SJHD 2LFIA 1N5WA 1UNSA 1VZ8A 1FXAA 2XN9C 1KLUD 1WRIA 3OWEB 1C76A 5G5HA 3O13A 3B2FA 3TSSA 5MPOA 4OZCA 2K3UA 5E6JA 2MJ3A 2L83A 2WDQB 4REZA 5I4DA 1CK1A 4YSZB 4ARCA 4MT5A 2BBCA 1IBXA 2WU5B 1F2RI 3W2DA 1MHHE 4ARIA 3Q8BA 1IUEA 3TUOA 3AEAB 2V3PA 1C77A 2RMMA 4US9A 1BUIC 1FXIA 5TSSA 3GB1A 1GOZA 2DWQA 4HEA1 1GAQB 2PTLA 2X38A 4ZHPA 2ONQA 1N63A 3SFEB 1C4AA 2BB6A 3IT4B 3Q69A 1Q10A 1VDVA 1N61A 2JXTA 1CJEA 1DGJA 4RGTA 3KWLA 4XDDA 3TEYA 3ZJTA 1ACCA 2IGDA 1FRRA 1V97A 3E9SA 4NAMA 1ZDVA 1E6EB 3EGRA 1TY2A 1XCQL 1E0ZA 1QOBA 1XCTL 2MH7A 1F77A 1YQ4B 3ZGZA 1M4VA 2WXFA 2OHFA 1D6EC 4XE0A 1YJIA 1TS3A 1T6BX 4XWWA 1C78A 4LK0M 4P6VF 5EE9A 2RDHA 1K50A 1JRPA 3AM9A 1MI0A 1YJJA 2CJOA 4ZRPA 1YNTE 1VZ6A 2PKOA 2ZW1A 1JWSD 3FC4A 4OHJA 3BVGA 3IAS1 3P1MA 4A55A 1MHXA 5HFYA 4WURA 2W55A 2W82A 1PUTA 1N5XA 3J9CA 1QOFA 2WNMA 3AE3B 1VZ7A 3ZJUA 1IBXB 2WS3B 3RPFC 3FILB 3AEDB 3ZQ4A 1N62A 3W5UB 1I4QA 1TJEA 3P4QB 2J42A 5AUKA 3VRBB 1WGKA 2HDEA 1Y56A 3P63A 2DBYA 1I4XA 2IPKD 4CQNA 1JWMD 1CQVA 3URYA 4DXGA 2LEKA 4YWGG 2PVOD 3ETRA 3UI3A 1ZXIA 4KKIA 4WAFA 3L4PA 1D5XC 2JYTA 2I2YA 5BYQA 4AS1A 1MVKA 2Y5CA 3FILA 3IT6B 2LUMA 1E7PB 4WH4A 1B1ZA 1L6UA 2RDGA 4L2YA 1TKYA 1OQQA 1V1PB 3BK2A 1K51A 1XO3A 2PW9A 5EE0A 3LXFA 4A8XC 4RF1A 2JZPA 1ET6A 1LO5D 2K22A 1SE2A 3I9V1 2L32A 1EWCA 1SBBB 3AE5B 3I57A 4HJGE 4B0MA 1TS5A 4NJCA 1FM0D 2N9KA 1JQ4A 2QIEB 4J3OD 3W1SA 4C56C 4RNAA 1YMHE 3NS1A 3VR9B 1N60A 2BS4B 2W3SA 4GDKB 5FKAC 2CU3A 4TSSA 2INPE 2IDYA 2JU6X 1AW7A 3BZDB 2J4XA 2M56B 3AE4B 1I7HA 3NVYA 3V05A 5HG2A 1L6VA 4RF0A 1QF6A 1KH0A 1KRHA 2WXIA 1E9MA 3LYYA 1SE4A 2LHDA 1QILA 5G5GA 1V8CA 2NTSA 2BB5A 4L1BA 2QJLA 3VR8B 5GXGB 2LMCA 2GRIA 2BTEA 1J7AA 2Y3AA 3W9CB 1PDXA 1VJKA 2WXNA 3AE8B 3TEXA 3Q8FA 1SIJA 2CJNA 3FAHA 2ACZB 1I4PA 2QSDA 2KWDA 1TZOA 2WQYB 1D5ZC 5D3DA 1HZ6A 3C8YA 1XF5L 1C4PA 2R61A 1EU3A 3CIRB 5BMGA 3PZ8A 4JE3B 3MP9A 2MJEA 1DYQA 2RPVA 3HVDA 4R3DA 4WIPA 1SJED 2I38A 1BMLC 2KAJA 4HKZE 2WP9B 1EU4A 4OZBA 1ESFA 1JW9D 1ENFA 3BK1A 1YN3A 2WXQA 3AE9B 4A9AA 3AB5A 1RFKA 2QILA 1NEKB 2VZKD 4JX1C 2XNAC 1JWAD 2V4IB 4MM3B 4N6EB 4A6QA 5D3IB 2H89B 2JWUA 4N59A 3MFGA 4US8A 4Q2JA 1FFVA 2J52A 1JWUD 2G1EA 3BWUD 3E56A 4M0WA 4OW0A 1TKGA 4IDIA 4JWSC 4YT0B 1D4BA 1L4DB 4RGOS 3V3XA 5LNK1 1F0ZA 1YN4A 2AQ2B 2WXRA 3PO0A 4H2AA 2WDVB 2LJIA 1QOAA 4NAWB 1NVID 3R8BA 2WXMA 1XLPA 2PLPA 3VQIA 4GDLB 3SR6A 3HUIA 2J53A 1WXQA 3R2TA 4RH6A 1RWSA 2M0AA 4JPSA 5EE1A 3BYTB 1P7FA 2BS3B 1XLQA 3U52E 1NENB 2W3RA 3LB8C 1HXYD 1MPEA 1QT9A 2BS2B 2WXHA 4UDUC 2YEPF 1VR9A 4ZOHC 1FMAD 1TYGB 3B2GA 2QMTA 2WXLA 1F2RC 3NVZA 3Q8CA 1ZUD2 1QLBB 1OQRA 1UUPA 1FNVA 1UWXA 4C7ZA 1KLGD 1L0YB 1KTKA 3GP7A 1C4CA 3DWGC 2N9LA 3HVZA 3DWMA 3SFDB 2IGHA 2AQ3B 4IKGA 1ZE3D 4RCOA 1GB4A 2SEBD 2NMQA 2JYEA 4C80A 4EE2A 5HI1A 1ZOYB 1PGBA 2WDRB 2L52A 4GLSC 4DQOC 1FEHA 2KDMA 1NYRA 2EELA 3B9JA 2WXOA 3P42A 3R2IA 2H88B 4O1NA 1AWDA 1J7BA 2L1AA 2FUG1 4DXFA 1JMLA 2W54A 2EKIA 4N58A 3T3NA 2WXJA 3HRDD 2HTME 1AYFA 2KMMA 3BVMA 2WLBA 4KGRA 3WCQA 2FE8A 3ZYYX 5H92C 1FNUA 3TEWA 3KQ4A 4KKJA 1FNWA 4C7YA 5FK9C 1L4ZB 1VLBA 1YQ3B 1FD6A 1SXTA 3H8HA 1E10A 1JCKB 4LLGM 1FIQA 4PT5A 2BW2A 5BMHA 1XLOA 4YTNB 1ZPSA 4B0EA 1KFYB 1JROA 3AE6B 3Q8EA 1SSNA 1L5PA 3N9YC 4KGSA 3T3OA 1ROEA 1VRAB 2N0SB 1DOXA 5EE3A 1ZP0B 1BXTA 3AE1B 3SEBA 4YTMB 3AE7B 1KF6B 1SB3C 1PYWD 1CZPA 4NZLB 3NRZA 5FR3A 1V1OA 4HKQA 1PGXA 2PIAA 2K5PA 1TS4A 1RM6C 1HQRD 1NYQA 2LGIA 3NUHB 1L0XB 3AEBB 4YSXB 1SEBD 2LHEA 4IOIE 1XLNA 1ZXHA 1V1PA 4ITKA 1QKZA 1AN8A 2B76B 3KWVA 1I4GA 2JX5A 5BYRA 1C79A 1HA5A 3P4PB 4AQ7A 4RGMA 2MEKA 4RFBA 1WYGA 1JALA 4OVZA 4WWMA 2DLBA 1C9FA 2KACA 1IGDA 2IJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JWB D;  4ZOH C;  1FMA D;  1TYG B;  3B2G A;  3B2F A;  3AE2 B;  3AE5 B;  5MPO A;  2MJ3 A;  3NVZ A;  2L83 A;  2WDQ B;  1ZUD 2;  1QLB B;  1FM0 D;  1OQR A;  1J7C A;  3VRA B;  1JQ4 A;  2QIE B;  4C7Z A;  4YSZ B;  1A70 A;  3NS1 A;  3VR9 B;  1N60 A;  2BS4 B;  2W3S A;  3DWG C;  3HVZ A;  2CU3 A;  3DWM A;  2WU5 B;  3SFD B;  2M56 B;  3AE4 B;  1I7H A;  3NVY A;  2WU2 B;  3P4R B;  1IUE A;  3AEF B;  3AEA B;  1L6V A;  1QF6 A;  3NVW A;  4US9 A;  1FXI A;  1KRH A;  4C80 A;  1FFU A;  1E9M A;  2DWQ A;  3AEC B;  1FRD A;  2AX5 A;  1GAQ B;  1QOG A;  1ZOY B;  3EUB 2;  4ZHP A;  1TKE A;  5G5G A;  2WDR B;  1V8C A;  2L52 A;  1N63 A;  1GPX A;  3SFE B;  2QJL A;  5C2T B;  3VR8 B;  1WWT A;  5GXG B;  1J7A A;  1VDV A;  4HRS A;  4YSY B;  3W9C B;  1N61 A;  1NYR A;  1DOI A;  1PDX A;  1VJK A;  3B9J A;  1CJE A;  2BT6 A;  2H88 B;  1AWD A;  3AE8 B;  1DGJ A;  4YTP B;  1SIJ A;  2CJN A;  3FAH A;  1J7B A;  3KWL A;  4ZHO A;  2ACZ B;  3AEE B;  2W54 A;  4N58 A;  2EKI A;  4WQM A;  3HRD D;  2JQR B;  3AV8 A;  2WQY B;  2K9X A;  1FRR A;  2HTM E;  1V97 A;  1AYF A;  1E6E B;  2KMM A;  2WLB A;  1EWY C;  3WCQ A;  1E0Z A;  1QOB A;  2MJD A;  3CIR B;  2MH7 A;  1YQ4 B;  1OFF A;  3ZYY X;  2MJE A;  5H92 C;  2OHF A;  1FO4 A;  1UWM A;  1YJI A;  4P6V F;  5EE9 A;  2KAJ A;  3AMZ A;  4C7Y A;  2WP9 B;  3P4S B;  1JRP A;  1VLB A;  3AM9 A;  1YQ3 B;  1B9R A;  1JW9 D;  1DOY A;  4FXC A;  2FBW B;  1YJJ A;  2CJO A;  1E10 A;  2PKO A;  3AE9 B;  4A9A A;  1FIQ A;  3AB5 A;  1RFK A;  2Q5W D;  3BII D;  2M19 A;  3FC4 A;  4YXD B;  1XLO A;  3P1M A;  1NEK B;  4USA A;  4YTN B;  4JX1 C;  1KFY B;  1JRO A;  1JWA D;  3AE6 B;  4N6E B;  2W55 A;  2H89 B;  4N59 A;  1PUT A;  1PFD A;  1N5X A;  1L5P A;  3AEG B;  1NI3 A;  1QOF A;  3AE3 B;  1ROE A;  4US8 A;  2N0S B;  1FFV A;  2G1E A;  2WS3 B;  3NVV A;  3AED B;  4JWU C;  3RPF C;  1N62 A;  3W5U B;  5EE3 A;  1DOX A;  1ZP0 B;  3AE1 B;  4HRO A;  1TJE A;  4KX6 B;  3P4Q B;  4YTM B;  3CWI A;  3AE7 B;  1KF6 B;  1SB3 C;  5AUK A;  1CZP A;  2E3T A;  1TKG A;  1WGK A;  3NRZ A;  3P63 A;  3VRB B;  4IDI A;  2PVG C;  4JWS C;  2PIA A;  4YT0 B;  3AN1 A;  2K5P A;  2DBY A;  3W5V B;  1RM6 C;  1F0Z A;  2LEK A;  1NYQ A;  1T3Q A;  3PO0 A;  2PVO D;  3AEB B;  4YSX B;  3ETR A;  4LTU A;  1ZXI A;  2WDV B;  5H8Y E;  5C3J B;  1XLN A;  1QOA A;  3L4P A;  1NVI D;  1RYJ A;  4ITK A;  5AUI A;  1XLP A;  1L0V B;  1SF0 A;  3ABV B;  2Y5C A;  3SR6 A;  1E7P B;  2B76 B;  3HUI A;  1WXQ A;  1L6U A;  1R7S A;  2JX5 A;  3AH7 A;  1RWS A;  1TKY A;  1OQQ A;  3P4P B;  1N5W A;  5EE1 A;  1FXA A;  1XO3 A;  1WYG A;  1JAL A;  1WRI A;  1XLQ A;  2BS3 B;  3LXF A;  4WWM A;  1NEN B;  5EE0 A;  2W3R A;  3LB8 C;  1QT9 A;  2BS2 B;  5G5H A;  2K22 A; 
#chains in the Genus database with same CATH topology
 1YN5 A;  3U4E G;  4PS8 A;  5L83 A;  3AE2 B;  4ZRQ A;  2GBR A;  2ZCB A;  4PYU A;  3DBH B;  4F8C B;  3VRA B;  1Q5W B;  2Y5P A;  3SHQ A;  1EM7 A;  2WU2 B;  3P4R B;  4A3P A;  2ZW0 A;  3R7Q A;  4FJV B;  3KYC D;  3NVW A;  3NHE B;  1HTQ A;  2WXP A;  1FFU A;  1PQS A;  3AEC B;  3ZJV A;  2WXK A;  1K53 A;  3MC0 B;  3ZKJ C;  3L17 A;  3AEE B;  3VDZ A;  4OZA A;  2ZCC A;  1HTO A;  3GS2 A;  4ICV A;  4FXC A;  2FBW B;  4KV2 A;  2KDB A;  1ZKH A;  3APD A;  1EUV B;  4NNJ B;  3LJ3 A;  2NPT A;  5LXI B;  1PFD A;  4MAC A;  4BFR A;  1XXG A;  1NI3 A;  3AEG B;  4PS3 A;  4CHK A;  3IAM 1;  3NZU A;  1MFW A;  4JWU C;  1I42 A;  2TSS A;  5DPT A;  3ZUN A;  3CWI A;  3RNB C;  2C9W B;  4GU2 A;  3U7Z A;  4QAY A;  3TCA A;  1XEE A;  3EFC A;  3MJW A;  2BVC A;  2MBQ A;  2JRH A;  3ZRF A;  3NZ3 A;  1T3Q A;  4LTU A;  3MHZ A;  5C3J B;  4L23 A;  3SU8 X;  1HZ5 A;  3QJZ A;  5AUI A;  3NJT A;  4W9H A;  1SF0 A;  2KXJ A;  4WWP A;  4NQL B;  2LFI A;  4ZYN A;  3JSV B;  3CMM B;  2ZPY A;  2XK5 A;  3H6N A;  3PT2 B;  5MPO A;  4OZC A;  2QHO A;  2K3U A;  5E6J A;  5E6P A;  3RN9 C;  2L83 A;  4EKU A;  1WX8 A;  2MA9 B;  1CK1 A;  2HJ1 A;  1OTR B;  5AZG A;  4PYZ A;  1P1A A;  3EEC A;  3SDL C;  1IBX A;  2WU5 B;  2JZZ A;  4ARI A;  5KHO A;  3TUO A;  1IUE A;  1XT9 B;  2RMM A;  3RMK C;  4US9 A;  1FXI A;  2KYW A;  1GOZ A;  2X38 A;  4AUQ C;  3H1U A;  4NY0 A;  5DPS A;  2M4N A;  4PK1 A;  1VDV A;  3QAR A;  5DPR A;  3B0A A;  3I3T B;  1EF5 A;  4M00 A;  1ZDV A;  1WE6 A;  1M4V A;  2WXF A;  4ANW A;  1NDD A;  2FUH B;  3VUW A;  4XWW A;  4P6V F;  2RDH A;  2L3Z A;  1K50 A;  5E6N A;  2ZNV C;  2FCS A;  1YNT E;  4MEL A;  1VZ6 A;  4FBJ B;  4OHJ A;  3BVG A;  1FXT B;  3IAS 1;  3P1M A;  4ZRK A;  4EZJ A;  2N1V A;  2PJH A;  2KKC A;  2CKH B;  2WNM A;  2NVU I;  3P4Q B;  1VCB A;  1RFA A;  2J42 A;  5AUK A;  3K9O B;  1XD3 B;  4JLC A;  5CHV C;  2DBY A;  1JWM D;  3URY A;  2PVO D;  4KKI A;  4LNO A;  4WAF A;  2MBO A;  2JYT A;  3L08 A;  3M62 B;  5BYQ A;  1B1Z A;  1L6U A;  3C0R B;  2NBV B;  2BPS A;  1OQQ A;  2G3Q B;  1XO3 A;  2PW9 A;  4A8X C;  2D3A A;  3N1Z C;  2K22 A;  3I9V 1;  3IHP C;  1F52 A;  1SBB B;  2KFK B;  4B95 A;  2D2Q A;  1TS5 A;  2QIE B;  2Z0E B;  1YMH E;  5JHA A;  1C3T A;  2INP E;  2JU6 X;  1AW7 A;  3NY5 A;  1GC7 A;  3NVY A;  3O65 B;  3UIO B;  2DX5 B;  4P1C C;  2J0M A;  1L6V A;  1GC6 A;  4K7W A;  3WAM A;  1E9M A;  1E7V A;  2K1F A;  2LHD A;  4J6I A;  3A9J B;  2ZJD A;  2QJL A;  2PE6 B;  2LMC A;  4S17 A;  2LRU A;  4ICU A;  3Q8F A;  1SIJ A;  2ACZ B;  3DPD A;  2BYV E;  1D5Z C;  3CIR B;  5BMG A;  3PZ8 A;  1NI2 A;  1WJ4 A;  3MP9 A;  4DHJ B;  3A1Q B;  1DYQ A;  3QX1 A;  1WF9 A;  3ZTC A;  4BKS D;  4R3D A;  2WP9 B;  2ZEQ A;  4GSW A;  3VTV A;  2DHZ A;  1YN3 A;  3S2A A;  3AB5 A;  1G6J A;  2V4I B;  4MM3 B;  4N6E B;  2N7E A;  2GBM A;  2JWU A;  2KVZ A;  2M0X A;  3RNF C;  5J2R A;  4JGH B;  1FFV A;  1JWU D;  4IWQ A;  2LD9 A;  3BWU D;  4EZK A;  2V9H A;  3RZW C;  4BKS A;  1L4D B;  3V3X A;  2AQ2 B;  3PO0 A;  2WXM A;  1V49 A;  3MHS D;  3VQI A;  4HLE A;  1LQB A;  3HUI A;  5KHQ A;  3R2T A;  3QK0 A;  3ZLZ A;  4P7I A;  3BYT B;  1P7F A;  1XLQ A;  2ZPN A;  2W3R A;  1T0Y A;  2WXH A;  2KO3 A;  1FMA D;  1TYG B;  3MC9 A;  3B2G A;  2WXL A;  5AZF A;  3EC8 A;  3PHX B;  3DBR B;  1FNV A;  4C7Z A;  1KLG D;  1L0Y B;  4LNI A;  1C4C A;  3DWG C;  4E74 A;  1E8X A;  4W9J A;  2GMI C;  1Q0W B;  1GB4 A;  2NMQ A;  2Y5B B;  3KH0 A;  2L52 A;  4GLS C;  3A1Q A;  5HKH A;  3HHM A;  3RD2 A;  1NYR A;  2EEL A;  3V61 A;  3B9J A;  3RNC C;  3L13 A;  3HRD D;  4HPL B;  4MJS A;  2FE8 A;  3ZYY X;  2BF8 B;  2PPH A;  2JF5 A;  4KKJ A;  1FNW A;  1K8R B;  3OJ3 A;  2KLG A;  2REX A;  5BMH A;  1XLO A;  2WDT B;  1KFY B;  3APF A;  2ZZP B;  1FPY A;  4KGS A;  3ZIM A;  3A4R A;  1ROE A;  2AYO B;  4GOC A;  2MBB B;  2KFJ A;  2KTR B;  1PYW D;  4NZL B;  1OQY A;  2PIA A;  3DHG C;  2KTR A;  1WH3 A;  1SEB D;  2LHE A;  4ANU A;  2MCN B;  1UD7 A;  3W1Y A;  4ASW C;  1GNU A;  2IO3 B;  2JX5 A;  1C79 A;  4GDL A;  4RGM A;  4RFB A;  4KSK C;  3PLU A;  1WY8 A;  4WWM A;  2KDF B;  3PHW B;  3TL5 A;  3QIJ A;  2ON8 A;  5GMV A;  1UGJ A;  3N1X C;  5JZE B;  1J7C A;  1STE A;  1QQR A;  4LJO B;  2K39 A;  3PZD A;  2L76 A;  2LGD A;  4XX5 A;  2C5L C;  2Z8L A;  4BBN C;  4A20 A;  1P7E A;  2PMV A;  4ANV A;  5IO9 A;  1FRD A;  3WA0 A;  3ALB A;  1HEZ E;  2HTH A;  3NOB A;  2LRW A;  2YEP B;  2W9N A;  4MH8 A;  4G3X B;  4M8M A;  1DOI A;  1L7Y A;  3HM6 X;  2MWS B;  3KW5 B;  3D32 A;  2JQR B;  2BYT A;  1YX5 B;  2K9X A;  2RR9 A;  4MGI E;  3VTW A;  2OJW A;  1ZDX A;  4TQ1 A;  2MJD A;  5JHB A;  1OFF A;  1FCL A;  2RDB C;  1ZW7 A;  3VVW B;  1UBQ A;  2KJ6 A;  2LI5 A;  5DCN A;  4XC2 A;  3P4S B;  1I4H A;  3N32 A;  1PGA A;  2KJR A;  3Q8A A;  1TBE A;  1WGY A;  3BVZ A;  1KOT A;  3DVG Y;  3GZN I;  5CHF A;  3BII D;  2J7Q B;  4RMA A;  3WAO A;  2IBI B;  3ZDT A;  3MJ5 A;  5BMI A;  5BYS A;  2K8C A;  2SAK A;  2XBB C;  1IGC A;  2RSU A;  3WIM A;  2MRP A;  4HRO A;  4KX6 B;  5IN7 A;  5D2M B;  2PVG C;  3UIP B;  3BYY B;  3W5V B;  2JSV X;  2DAF A;  3RFZ B;  1T0R C;  2KN5 A;  1L0V B;  3IVF A;  3ABV B;  4ZRJ A;  2VZK B;  2G9H D;  1UNS A;  1VZ8 A;  2XN9 C;  1WRI A;  3OWE B;  4EEW A;  1LM8 B;  4NJ6 A;  5G5H A;  1RLF A;  1C1Y B;  1SGH A;  1F9J A;  1MJD A;  1E8Z A;  2BKR B;  1TIF A;  3Q3J A;  4IM2 A;  4YSZ B;  2KVR A;  3IG3 A;  2UWQ A;  3W2D A;  1MHH E;  3Q8B A;  2AL6 A;  3AEA B;  3C19 A;  2MW5 A;  5LXH A;  4HCP B;  2DWQ A;  4HPP A;  2PTL A;  2WGS A;  1LGR A;  4HK2 A;  3PRE A;  1C4A A;  3Q3O C;  4KZC A;  4KIK B;  4OVV A;  3VHT C;  4WWN A;  1CJE A;  4RGT A;  4XDD A;  3KWL A;  1N6Z A;  1VD2 A;  1ACC A;  4BKG A;  4MGY E;  2KMC A;  1FRR A;  1V97 A;  3EGR A;  3BY4 B;  5CTR C;  2VH1 A;  1QOB A;  2LGS A;  2MH7 A;  1Z2M A;  1D6E C;  3QC8 B;  3WAL A;  2MBE A;  1JRP A;  4TUU A;  1MI0 A;  3QAQ A;  2CJO A;  3R7R A;  4ZRP A;  2PKO A;  2DZM A;  2FAZ A;  4K81 A;  1MHX A;  2JUO A;  2MBH A;  3CSF A;  3JW0 X;  3M95 A;  1QOF A;  3B08 A;  3VH4 B;  2X8X X;  3ZQ4 A;  1N62 A;  4ZRI A;  3W5U B;  4EFO A;  3VFK A;  3AXC A;  3QHT A;  2YLM A;  5C1Z A;  2HDE A;  1WGD A;  4CQN A;  1UZX B;  4WQO B;  4YWG G;  3DVN V;  3UI3 A;  1D5X C;  2BQQ A;  2I2Y A;  2IYD B;  1MVK A;  1I35 A;  3FIL A;  2LUM A;  4L2Y A;  1V1P B;  3OJ4 B;  3NG0 A;  2NS5 A;  4RM9 A;  5EE0 A;  1WJ6 A;  3N20 C;  2AEH A;  2KX3 A;  4RF1 A;  2OJR A;  2WYQ A;  4KSL C;  1LO5 D;  2D3B A;  3I57 A;  3AE5 B;  2HE7 A;  2LVO A;  2N9K A;  1JQ4 A;  3VR9 B;  1T0Q C;  2DNF A;  1N60 A;  2BS4 B;  5FKA C;  2CU3 A;  1J19 A;  2J4X A;  2M56 B;  3AE4 B;  1I7H A;  2MLB A;  5HG2 A;  4BAX A;  2N9E B;  1UF0 A;  4RF0 A;  1KH0 A;  2I1J A;  3LYY A;  1SE4 A;  1V8C A;  4M0W B;  4L1B A;  2L8J A;  1Y8R C;  5GXG B;  2GRI A;  2Y3A A;  2M8S A;  3W9C B;  1VJK A;  2WXN A;  2D10 A;  3AE8 B;  4NJ7 A;  2JT4 B;  1WI0 A;  2LUE A;  2ZVN A;  1TZO A;  2WQY B;  1HZ6 A;  2KTF A;  3CF6 E;  3C8Y A;  1WX9 A;  1XF5 L;  1C4P A;  3M3J A;  2RGF A;  4FUL A;  4WIP A;  1UH6 A;  4OZB A;  2I38 A;  1J8C A;  2AWT A;  1ESF A;  2LVP A;  3DBS A;  1GUA B;  3BK1 A;  4LNF A;  1RFK A;  2R2Q A;  1NEK B;  2JY6 A;  4JX1 C;  2XNA C;  3P2B A;  3A33 B;  4A6Q A;  3K9P B;  4N59 A;  1WYW B;  2G4D B;  3MFG A;  4FLH A;  4US8 A;  2K6Q A;  4GDK A;  2LZ6 A;  2IO2 B;  4IDI A;  3V60 A;  4RGO S;  5EDS A;  2L0T A;  4FA6 A;  1YN4 A;  4F1S A;  3TMP B;  2K25 A;  2DZJ A;  1H4R A;  3JYU A;  3TIX A;  4H2A A;  4RM8 A;  2WDV B;  2GBK A;  5AZH A;  1XLP A;  2PLP A;  2J53 A;  1RWS A;  2M0A A;  3Q14 C;  4JPS A;  5EE1 A;  2BS3 B;  1RAX A;  4BKT A;  2CU1 A;  4II3 B;  4K1R B;  2YEP F;  1VR9 A;  2QMT A;  1UBI A;  4AJY B;  1EF1 A;  3NVZ A;  3Q8C A;  1OQR A;  1AAR A;  1E7U A;  4C00 A;  2L05 A;  4OVU A;  2N9L A;  1V81 A;  4E3C A;  4IKG A;  3H7P B;  2PE9 A;  3GE8 C;  1E8W A;  4C80 A;  5HI1 A;  2G4S A;  2D3G A;  5TR5 A;  3VXW A;  4DDG D;  1L2N A;  2WDR B;  3VAW A;  3I5J C;  2KC2 A;  1WXM A;  2KDM A;  3A9J A;  1QZE A;  2WXO A;  1X1M A;  4O1N A;  4ZDV A;  1IYF A;  3H7P A;  3BIN A;  1WR6 E;  4DXF A;  3T3N A;  2W54 A;  4N58 A;  2EKI A;  4AWJ A;  3R66 C;  4E71 A;  4XZ4 A;  1AYF A;  3PVL A;  1YJ1 A;  3QA8 A;  4WJQ A;  5H92 C;  2D11 A;  4LCD E;  3B1L X;  3KQ4 A;  2KJH B;  4MEM A;  1JCK B;  4FHK A;  2ZNV B;  4B0E A;  4JIO U;  3ZTD A;  1L5P A;  3T3O A;  2N0S B;  1DOX A;  1ZP0 B;  1BXT A;  3AE1 B;  1KF6 B;  1SB3 C;  2FID A;  5FR3 A;  2IZV B;  4HKQ A;  4FN2 A;  1P98 A;  4I6N B;  2LGI A;  4YSX B;  4IOI E;  1ZXH A;  1V1P A;  4IWP A;  3WAP A;  1AN8 A;  4W9D A;  1OEY J;  4EZL A;  2FCN A;  4AQ7 A;  3UQA A;  2UU7 A;  2DZI A;  3DDC B;  1ZGU B;  1C9F A;  1J0G A;  1IGD A;  1JWB D;  2K0P A;  5E6O A;  2V0G A;  4URK A;  5HHD G;  2KN4 A;  2BGF A;  4TQ0 A;  1BT0 A;  1A70 A;  2D5G A;  4ACF A;  1D5M C;  4A3O A;  2FCM A;  3AEF B;  4AOF A;  2AX5 A;  1QOG A;  3EUB 2;  5G55 A;  2JWZ A;  1TKE A;  3A9K B;  1GPX A;  3A4S C;  3N30 A;  2WX1 A;  1HE8 A;  4XDC A;  5C23 A;  3GE3 C;  2NTT A;  4RGN A;  4HRS A;  4YSY B;  1S1Q B;  3KLS X;  2BT6 A;  2DYO A;  2WXG A;  3QWZ B;  4FJY A;  4HWI B;  1I4R A;  5AEK B;  5J18 A;  1UWM A;  2DYM A;  3HM3 A;  3HK0 A;  2MP2 A;  2DAJ A;  4N9F 4;  3AMZ A;  3X23 A;  1WJU A;  1B9R A;  1DOY A;  3IXS A;  2Q5W D;  2AQ1 B;  2M19 A;  4YXD B;  4BVU C;  5L95 C;  2GB1 A;  2GOW A;  4USA A;  3U2S C;  1GB1 A;  1P0R A;  2I1K A;  2N7J A;  3FKY A;  4IG7 B;  4GGQ A;  2BKF A;  3MC8 A;  5LLI A;  2E3T A;  3AN1 A;  4KGT A;  5D7G A;  1T5X D;  5H8Y E;  1K52 A;  2KC1 A;  2OED A;  2OOB B;  1RYJ A;  4IWO A;  4GB9 A;  4D2K A;  3PV1 A;  4KVG B;  1N5W A;  1KLU D;  2WHI A;  3QQ8 B;  3Q3M C;  1IPG A;  3O13 A;  2K6D B;  3B2F A;  3TSS A;  1WXA A;  1TT5 B;  2WDQ B;  5I4D A;  2NR2 A;  4ARC A;  4GN1 A;  4MT5 A;  1EO6 A;  2ASQ A;  4K7U A;  2BBC A;  5IA7 A;  2WX0 A;  2LXC A;  1WZ3 A;  2V3P A;  2Z59 B;  1WIA A;  3LDZ E;  1BUI C;  4HEA 1;  1GAQ B;  4M8N A;  3PPA A;  2EMT A;  4DWF A;  3PRP B;  2BB6 A;  3Q69 A;  2BYF A;  1N61 A;  4LDT D;  2JXT A;  4C4V A;  3KUZ A;  3Q3N C;  1DGJ A;  4F7Z A;  2IGD A;  3DOW A;  4EOY A;  3ZNI D;  1TY2 A;  1F77 A;  1GG3 A;  2OHF A;  1WXS A;  5G2N A;  3KUC B;  1YJI A;  1TS3 A;  4G50 A;  1C78 A;  5EE9 A;  4WJN A;  1UGM A;  1WM2 A;  2CHW A;  1YJJ A;  1V80 A;  2ZW1 A;  1WZ0 A;  1NBF C;  5HFY A;  2QDF A;  4JQW C;  4WUR A;  2KX0 A;  3V6E B;  3PGE A;  4W9F A;  1TGZ B;  1N5X A;  1ISN A;  3AE3 B;  4II2 B;  3ZJU A;  4B9K A;  2WS3 B;  3FIL B;  2G45 B;  2KOX A;  1I4Q A;  1YQB A;  2B3A A;  3VRB B;  1WGK A;  3P63 A;  4CO7 A;  1UEL A;  3OG5 A;  4KDL B;  2IPK D;  1I4X A;  4M01 A;  3ETR A;  1ZXI A;  1KM7 A;  3ZDM C;  2JZ3 B;  4P1B C;  4AS1 A;  3AI5 A;  4HXD A;  3BK2 A;  1K51 A;  2KAN A;  2JZP A;  1ET6 A;  1V5O A;  1KLV A;  1SE2 A;  1OGW A;  1EWC A;  3HIZ A;  4HJG E;  4XGA B;  3I63 C;  3DHI C;  3RT3 B;  4DK5 A;  4AJW A;  2C60 A;  4J3O D;  3W1S A;  3NS1 A;  2W3S A;  4GDK B;  4TSS A;  2IDY A;  5D94 A;  3KYD D;  2GLS A;  1V5T A;  2C7M B;  1KRH A;  2WXI A;  1QIL A;  2NTS A;  4KIK A;  3VR8 B;  3ZXV A;  2VH2 A;  3DBH I;  2BTE A;  4S0R A;  3PRM B;  3TEX A;  1YD8 U;  4MJS B;  4KZ0 A;  4DBG A;  2LXA A;  1WXV A;  2QSD A;  4GMV A;  3ZO5 B;  2KDI A;  2D07 B;  2LWP A;  4K3B A;  4MGK E;  2DYB A;  2MJE A;  3MTN B;  5DPW A;  2KFK A;  2RPV A;  2K8H A;  1SJE D;  2KAJ A;  3JVZ X;  4HKZ E;  1EU4 A;  1JW9 D;  1ENF A;  3ZRC A;  3L16 A;  5J17 A;  3IFW B;  4A9A A;  2QIL A;  2VZK D;  3PS6 A;  2H89 B;  3RI7 C;  2J52 A;  3E56 A;  4OW0 A;  4FHJ A;  3U7D A;  5CHW A;  1D4B A;  2IND C;  1WE7 A;  3EFU A;  1WM3 A;  4PS7 A;  4DHZ E;  1P9D U;  4NAW B;  1F1H A;  1NVI D;  1M94 A;  4GDL B;  3RCZ A;  4RH6 A;  3ONS A;  1R4M I;  4NAW A;  3WAN A;  4BBN F;  2C7H A;  3VTU A;  2KQS A;  2NBW B;  3RNA C;  3LB8 C;  1HXY D;  1MPE A;  3VUY A;  1QT9 A;  4UDU C;  3DQV A;  5IP4 D;  1MG4 A;  4DDI D;  4K7S A;  4IM3 A;  4MH0 E;  1WMH B;  2KMA A;  1KTK A;  1D3Z A;  1SE9 A;  2RPQ A;  3HVZ A;  3AU5 A;  1TZ1 A;  3DWM A;  2AQ3 B;  2V1Y A;  1KJT A;  2KK8 A;  1V9J A;  2JYE A;  3OAW A;  4EE2 A;  1ZOY B;  3DCG A;  2L00 B;  1FEH A;  2L7R A;  3R2I A;  2H88 B;  1AWD A;  2AL3 A;  1J7B A;  3DBL B;  2CHZ A;  2WXJ A;  2HTM E;  4HVB A;  2KMM A;  3BVM A;  4KGR A;  3WCQ A;  1U4A A;  1FNU A;  4MSQ B;  3L0W B;  3TEW A;  4TV3 A;  4GIV A;  5FK9 C;  1L4Z B;  1VLB A;  1FD6 A;  1SXT A;  3RNE C;  2LJ5 A;  3H8H A;  3L10 B;  4PT5 A;  2BW2 A;  4WAA A;  1ZPS A;  4CYE A;  1JRO A;  4MGZ E;  3AE6 B;  2Z0D B;  3Q8E A;  1SSN A;  4WJP A;  3N9Y C;  1VRA B;  4BZA A;  3W1S C;  4MM3 A;  3SEB A;  3RUL A;  1CMX B;  1CZP A;  1V1O A;  1PGX A;  4AP4 C;  2K5P A;  1E5W A;  1HQR D;  3PTF C;  3NUH B;  3ZNG C;  1WX7 A;  2R2O A;  3N1Y C;  4ITK A;  4W9I A;  1Z5S B;  2B76 B;  1R4M B;  3NZS A;  4I6L B;  1HA5 A;  3P4P B;  1JAL A;  2CHX A;  1H8C A;  5BO4 B;  2XK5 B;  2KWC A;  2IJ0 A;  2NBU A;  3ZXR A;  2MP2 B;  2HJ8 A;  2IY0 B;  3RNG C;  2JXX A;  4HDQ A;  3PLV A;  3TJP A;  1R4N I;  2INC C;  1T0S C;  4ANX A;  1SE3 A;  1JRU A;  2LGY A;  5JH5 C;  5T8I A;  3UQB A;  4EUT A;  4X57 B;  5C2T B;  4IM0 A;  1WWT A;  2FIF A;  2M17 A;  3PZ7 A;  3V62 A;  2BYE A;  4YTP B;  4ZHO A;  1WSP A;  4WQM A;  3AV8 A;  2XEW A;  1ET9 A;  2ICI A;  1EWY C;  1TY0 A;  1FO4 A;  2MX2 A;  4W9E A;  3DBL I;  1E90 A;  2KQ4 X;  2N4F A;  4A90 A;  2GI9 A;  4HJK A;  2QEJ C;  2D3C A;  2E6X A;  1TTN A;  1Q1O A;  3VH3 B;  3DVG X;  3EA6 A;  4ZYS A;  4WJO A;  1A5R A;  3T9L A;  4LNN A;  3NVV A;  1RRB A;  3U8Z A;  4XWT A;  2V3N A;  3TEZ A;  4P16 A;  5FR6 A;  1FCC C;  4TMA B;  2IGG A;  4B6W A;  4IC7 B;  1TS2 A;  4LNK A;  5JXV A;  1WGH A;  1R7S A;  3AH7 A;  2INN E;  1SJH D;  1WJN A;  1FXA A;  3DVN U;  1C76 A;  2JVC A;  2DZK A;  2CS4 A;  2MJ3 A;  4REZ A;  2J0J A;  3M63 B;  3X0W A;  4XYC A;  1R4N B;  1F2R I;  4M02 A;  2CR5 A;  2NPT B;  3PSE B;  4GXB A;  1C77 A;  2ZVO A;  3CST A;  5TSS A;  2N9P C;  3GB1 A;  4ZHP A;  2ONQ A;  5CX3 A;  1N63 A;  5D6J B;  3SFE B;  2KDE B;  3Q3F A;  4DHZ B;  3IT4 B;  1Q10 A;  3A9K A;  3GZN B;  3T8M A;  4MDK E;  4W9L A;  3TEY A;  3ZJT A;  5IAA C;  3E9S A;  4NAM A;  1E6E B;  2FNJ B;  4LJP B;  2KNB A;  1XCQ L;  1E0Z A;  2LGX A;  1XCT L;  2GBJ A;  1YQ4 B;  3ZGZ A;  2MHJ A;  2N1W A;  4XE0 A;  1T6B X;  4LK0 M;  2V4L A;  3AM9 A;  2A5U A;  2BWF A;  1JWS D;  3FC4 A;  2EKE C;  4A55 A;  2W55 A;  2O6V D;  2W82 A;  2IO0 B;  1PUT A;  3J9C A;  3GOE A;  1VZ7 A;  3AU4 A;  1IBX B;  3RPF C;  3AED B;  1TJE A;  1WMH A;  2RD0 A;  1Y56 A;  5IOI A;  2PEA A;  4JL9 A;  1CQV A;  3KVF B;  4DXG A;  2LEK A;  3L4P A;  2YVC A;  3ZW3 A;  2Y5C A;  3IT6 B;  4WH4 A;  1E7P B;  2O6V A;  2RDG A;  4BOZ B;  1TKY A;  3H9D A;  3DBR I;  4K3C A;  3LXF A;  1LFD A;  3UGB B;  2L32 A;  3ENE A;  4TKN A;  3UIN B;  3PRZ A;  4B0M A;  4I6P A;  4NJC A;  1FM0 D;  2KQ7 A;  4HDO A;  1V6E A;  4C56 C;  4RNA A;  2IY1 B;  2EMS A;  1P3Q U;  3ZNZ B;  3BZD B;  3V05 A;  1MG8 A;  3QCA A;  3ZNH B;  4WWO A;  1QF6 A;  2M1M A;  2L0F A;  4FAD A;  1OEY A;  1WRD B;  5G5G A;  2BB5 A;  4MSM B;  1XQQ A;  1J7A A;  4HPM B;  3AUL A;  1PDX A;  3N3K B;  2LAS A;  2V3S A;  3Q6B A;  2CJN A;  3FAH A;  2WWZ A;  3RZF A;  1I4P A;  2KWD A;  5D3D A;  3L54 A;  3DHH C;  2R61 A;  1EU3 A;  4JE3 B;  3R3M A;  3HVD A;  2KZR A;  1BML C;  4DXA B;  2NCN A;  3TBL D;  4NQK E;  2WXQ A;  3AE9 B;  2KHW B;  3ZVV A;  2LVQ A;  3APC A;  1JWA D;  5D3I B;  1IP9 A;  2VRR B;  4Q2J A;  2G1E A;  1WFY A;  4M0W A;  3KUD B;  1TKG A;  2O2V B;  3V6C B;  3EHV A;  4JWS C;  4YT0 B;  4W9G A;  5LNK 1;  4W9K A;  1F0Z A;  2JRI B;  2WXR A;  2O2V A;  4G11 A;  4G0N B;  2LJI A;  1QOA A;  3R8B A;  1WR1 A;  3SR6 A;  1WXQ A;  2GBN A;  3U30 A;  1YX6 B;  1V2Y A;  3U52 E;  1NEN B;  1YOV B;  2BS2 B;  4C4V B;  4ZOH C;  1F2R C;  2C7N B;  1ZUD 2;  1QLB B;  1UUP A;  4BOS C;  1UWX A;  2J0K A;  3GP7 A;  3SFD B;  2IGH A;  3UF8 A;  2KWV B;  1ZE3 D;  4RCO A;  3NS8 A;  2SEB D;  2A4Z A;  3H7S A;  3ECI A;  2DEN B;  1PGB A;  4DQO C;  3IBE A;  2QCZ A;  4YL8 A;  3Q2A C;  3P42 A;  4IUM B;  2UYZ B;  2L1A A;  2FUG 1;  1JML A;  1YIW A;  2IO1 B;  1WGR A;  2WLB A;  1WGG A;  3RUI B;  1V86 A;  2KT7 A;  2KD0 A;  4C7Y A;  4NPN A;  1YQ3 B;  4DHJ D;  2HD5 B;  1E10 A;  4LLG M;  3VUX A;  1FIQ A;  2JPH A;  1SIF A;  3ML8 A;  4YTN B;  3SD5 A;  5IKC M;  1GJZ A;  2MQJ A;  5EE3 A;  2FCQ A;  4YTM B;  4W9C A;  3AE7 B;  4FJZ A;  3NRZ A;  3ML9 A;  2KLC A;  1TS4 A;  1RM6 C;  1NYQ A;  1L0X B;  3AEB B;  1S3S G;  1XLN A;  2N7D A;  2K8B A;  3JSV A;  2KWU B;  2QC8 A;  2O6V B;  1QKZ A;  4IW0 A;  3RYT A;  3KWV A;  1I4G A;  5BYR A;  2N9X A;  3OLM D;  2BWE S;  1E8Y A;  2MEK A;  4KDI C;  1WYG A;  2MSE D;  4OVZ A;  4HCN B;  2DLB A;  2KAC A;  1LXD A;  4LDT B; 
#chains in the Genus database with same CATH homology
 1YN5 A;  1JWB D;  2K0P A;  2V0G A;  3U4E G;  5HHD G;  3AE2 B;  4ZRQ A;  2ON8 A;  2KN4 A;  1UGJ A;  4TQ0 A;  3VRA B;  1J7C A;  1STE A;  1QQR A;  1A70 A;  2Y5P A;  2D5G A;  1D5M C;  1EM7 A;  2Z8L A;  2WU2 B;  3P4R B;  3AEF B;  1P7E A;  2ZW0 A;  2PMV A;  1SE3 A;  3NVW A;  2WXP A;  1FFU A;  3AEC B;  1FRD A;  2AX5 A;  1QOG A;  3EUB 2;  5T8I A;  1TKE A;  1HEZ E;  3ZJV A;  1GPX A;  2YEP B;  4MH8 A;  2WXK A;  4XDC A;  5C2T B;  1WWT A;  2NTT A;  1K53 A;  4RGN A;  4HRS A;  4YSY B;  1DOI A;  3MC0 B;  3KLS X;  2BT6 A;  2DYO A;  3PZ7 A;  4YTP B;  4ZHO A;  1WSP A;  3AEE B;  2WXG A;  4WQM A;  2JQR B;  3AV8 A;  2BYT A;  2K9X A;  4OZA A;  1ET9 A;  1ZDX A;  2ICI A;  1I4R A;  1EWY C;  1TY0 A;  4TQ1 A;  2MJD A;  1OFF A;  1FCL A;  1FO4 A;  1UWM A;  2DYM A;  2KQ4 X;  3AMZ A;  3P4S B;  4A90 A;  1I4H A;  3GS2 A;  1PGA A;  2GI9 A;  1B9R A;  1DOY A;  4FXC A;  2FBW B;  3Q8A A;  3BVZ A;  3IXS A;  2QEJ C;  2Q5W D;  3BII D;  2AQ1 B;  2M19 A;  4YXD B;  2E6X A;  2GB1 A;  4USA A;  3U2S C;  3EA6 A;  4ZYS A;  1GB1 A;  3MJ5 A;  1PFD A;  4MAC A;  5BMI A;  1XXG A;  1NI3 A;  3AEG B;  5BYS A;  2N7J A;  2SAK A;  3IAM 1;  3NVV A;  4JWU C;  1IGC A;  2TSS A;  4HRO A;  4KX6 B;  3CWI A;  4XWT A;  2E3T A;  3U7Z A;  2V3N A;  1XEE A;  3TEZ A;  2PVG C;  3AN1 A;  3BYY B;  4P16 A;  3W5V B;  2JSV X;  1FCC C;  4TMA B;  3NZ3 A;  4KGT A;  2IGG A;  1T3Q A;  1T5X D;  5D7G A;  4LTU A;  3RFZ B;  3MHZ A;  5H8Y E;  5C3J B;  1K52 A;  2OED A;  4L23 A;  1RYJ A;  1HZ5 A;  5AUI A;  1TS2 A;  1L0V B;  1SF0 A;  3ABV B;  5JXV A;  4D2K A;  2VZK B;  1R7S A;  2G9H D;  3AH7 A;  2INN E;  1SJH D;  2LFI A;  1N5W A;  1UNS A;  1VZ8 A;  1FXA A;  2XN9 C;  1KLU D;  1WRI A;  3OWE B;  1C76 A;  5G5H A;  3O13 A;  3B2F A;  3TSS A;  5MPO A;  4OZC A;  2K3U A;  5E6J A;  2MJ3 A;  2L83 A;  2WDQ B;  4REZ A;  5I4D A;  1CK1 A;  4YSZ B;  4ARC A;  4MT5 A;  2BBC A;  1IBX A;  2WU5 B;  1F2R I;  3W2D A;  1MHH E;  4ARI A;  3Q8B A;  1IUE A;  3TUO A;  3AEA B;  2V3P A;  1C77 A;  2RMM A;  4US9 A;  1BUI C;  1FXI A;  5TSS A;  3GB1 A;  1GOZ A;  2DWQ A;  4HEA 1;  1GAQ B;  2PTL A;  2X38 A;  4ZHP A;  2ONQ A;  1N63 A;  3SFE B;  1C4A A;  2BB6 A;  3IT4 B;  3Q69 A;  1Q10 A;  1VDV A;  1N61 A;  2JXT A;  1CJE A;  1DGJ A;  4RGT A;  3KWL A;  4XDD A;  3TEY A;  3ZJT A;  1ACC A;  2IGD A;  1FRR A;  1V97 A;  3E9S A;  4NAM A;  1ZDV A;  1E6E B;  3EGR A;  1TY2 A;  1XCQ L;  1E0Z A;  1QOB A;  1XCT L;  2MH7 A;  1F77 A;  1YQ4 B;  3ZGZ A;  1M4V A;  2WXF A;  2OHF A;  1D6E C;  4XE0 A;  1YJI A;  1TS3 A;  1T6B X;  4XWW A;  1C78 A;  4LK0 M;  4P6V F;  5EE9 A;  2RDH A;  1K50 A;  1JRP A;  3AM9 A;  1MI0 A;  1YJJ A;  2CJO A;  4ZRP A;  1YNT E;  1VZ6 A;  2PKO A;  2ZW1 A;  1JWS D;  3FC4 A;  4OHJ A;  3BVG A;  3IAS 1;  3P1M A;  4A55 A;  1MHX A;  5HFY A;  4WUR A;  2W55 A;  2W82 A;  1PUT A;  1N5X A;  3J9C A;  1QOF A;  2WNM A;  3AE3 B;  1VZ7 A;  3ZJU A;  1IBX B;  2WS3 B;  3RPF C;  3FIL B;  3AED B;  3ZQ4 A;  1N62 A;  3W5U B;  1I4Q A;  1TJE A;  3P4Q B;  2J42 A;  5AUK A;  3VRB B;  1WGK A;  2HDE A;  1Y56 A;  3P63 A;  2DBY A;  1I4X A;  2IPK D;  4CQN A;  1JWM D;  1CQV A;  3URY A;  4DXG A;  2LEK A;  4YWG G;  2PVO D;  3ETR A;  3UI3 A;  1ZXI A;  4KKI A;  4WAF A;  3L4P A;  1D5X C;  2JYT A;  2I2Y A;  5BYQ A;  4AS1 A;  1MVK A;  2Y5C A;  3FIL A;  3IT6 B;  2LUM A;  1E7P B;  4WH4 A;  1B1Z A;  1L6U A;  2RDG A;  4L2Y A;  1TKY A;  1OQQ A;  1V1P B;  3BK2 A;  1K51 A;  1XO3 A;  2PW9 A;  5EE0 A;  3LXF A;  4A8X C;  4RF1 A;  2JZP A;  1ET6 A;  1LO5 D;  2K22 A;  1SE2 A;  3I9V 1;  2L32 A;  1EWC A;  1SBB B;  3AE5 B;  3I57 A;  4HJG E;  4B0M A;  1TS5 A;  4NJC A;  1FM0 D;  2N9K A;  1JQ4 A;  2QIE B;  4J3O D;  3W1S A;  4C56 C;  4RNA A;  1YMH E;  3NS1 A;  3VR9 B;  1N60 A;  2BS4 B;  2W3S A;  4GDK B;  5FKA C;  2CU3 A;  4TSS A;  2INP E;  2IDY A;  2JU6 X;  1AW7 A;  3BZD B;  2J4X A;  2M56 B;  3AE4 B;  1I7H A;  3NVY A;  3V05 A;  5HG2 A;  1L6V A;  4RF0 A;  1QF6 A;  1KH0 A;  1KRH A;  2WXI A;  1E9M A;  3LYY A;  1SE4 A;  2LHD A;  1QIL A;  5G5G A;  1V8C A;  2NTS A;  2BB5 A;  4L1B A;  2QJL A;  3VR8 B;  5GXG B;  2LMC A;  2GRI A;  2BTE A;  1J7A A;  2Y3A A;  3W9C B;  1PDX A;  1VJK A;  2WXN A;  3AE8 B;  3TEX A;  3Q8F A;  1SIJ A;  2CJN A;  3FAH A;  2ACZ B;  1I4P A;  2QSD A;  2KWD A;  1TZO A;  2WQY B;  1D5Z C;  5D3D A;  1HZ6 A;  3C8Y A;  1XF5 L;  1C4P A;  2R61 A;  1EU3 A;  3CIR B;  5BMG A;  3PZ8 A;  4JE3 B;  3MP9 A;  2MJE A;  1DYQ A;  2RPV A;  3HVD A;  4R3D A;  4WIP A;  1SJE D;  2I38 A;  1BML C;  2KAJ A;  4HKZ E;  2WP9 B;  1EU4 A;  4OZB A;  1ESF A;  1JW9 D;  1ENF A;  3BK1 A;  1YN3 A;  2WXQ A;  3AE9 B;  4A9A A;  3AB5 A;  1RFK A;  2QIL A;  1NEK B;  2VZK D;  4JX1 C;  2XNA C;  1JWA D;  2V4I B;  4MM3 B;  4N6E B;  4A6Q A;  5D3I B;  2H89 B;  2JWU A;  4N59 A;  3MFG A;  4US8 A;  4Q2J A;  1FFV A;  2J52 A;  1JWU D;  2G1E A;  3BWU D;  3E56 A;  4M0W A;  4OW0 A;  1TKG A;  4IDI A;  4JWS C;  4YT0 B;  1D4B A;  1L4D B;  4RGO S;  3V3X A;  5LNK 1;  1F0Z A;  1YN4 A;  2AQ2 B;  2WXR A;  3PO0 A;  4H2A A;  2WDV B;  2LJI A;  1QOA A;  4NAW B;  1NVI D;  3R8B A;  2WXM A;  1XLP A;  2PLP A;  3VQI A;  4GDL B;  3SR6 A;  3HUI A;  2J53 A;  1WXQ A;  3R2T A;  4RH6 A;  1RWS A;  2M0A A;  4JPS A;  5EE1 A;  3BYT B;  1P7F A;  2BS3 B;  1XLQ A;  3U52 E;  1NEN B;  2W3R A;  3LB8 C;  1HXY D;  1MPE A;  1QT9 A;  2BS2 B;  2WXH A;  4UDU C;  2YEP F;  1VR9 A;  4ZOH C;  1FMA D;  1TYG B;  3B2G A;  2QMT A;  2WXL A;  1F2R C;  3NVZ A;  3Q8C A;  1ZUD 2;  1QLB B;  1OQR A;  1UUP A;  1FNV A;  1UWX A;  4C7Z A;  1KLG D;  1L0Y B;  1KTK A;  3GP7 A;  1C4C A;  3DWG C;  2N9L A;  3HVZ A;  3DWM A;  3SFD B;  2IGH A;  2AQ3 B;  4IKG A;  1ZE3 D;  4RCO A;  1GB4 A;  2SEB D;  2NMQ A;  2JYE A;  4C80 A;  4EE2 A;  5HI1 A;  1ZOY B;  1PGB A;  2WDR B;  2L52 A;  4GLS C;  4DQO C;  1FEH A;  2KDM A;  1NYR A;  2EEL A;  3B9J A;  2WXO A;  3P42 A;  3R2I A;  2H88 B;  4O1N A;  1AWD A;  1J7B A;  2L1A A;  2FUG 1;  4DXF A;  1JML A;  2W54 A;  2EKI A;  4N58 A;  3T3N A;  2WXJ A;  3HRD D;  2HTM E;  1AYF A;  2KMM A;  3BVM A;  2WLB A;  4KGR A;  3WCQ A;  2FE8 A;  3ZYY X;  5H92 C;  1FNU A;  3TEW A;  3KQ4 A;  4KKJ A;  1FNW A;  4C7Y A;  5FK9 C;  1L4Z B;  1VLB A;  1YQ3 B;  1FD6 A;  1SXT A;  3H8H A;  1E10 A;  1JCK B;  4LLG M;  1FIQ A;  4PT5 A;  2BW2 A;  5BMH A;  1XLO A;  4YTN B;  1ZPS A;  4B0E A;  1KFY B;  1JRO A;  3AE6 B;  3Q8E A;  1SSN A;  1L5P A;  3N9Y C;  4KGS A;  3T3O A;  1ROE A;  1VRA B;  2N0S B;  1DOX A;  5EE3 A;  1ZP0 B;  1BXT A;  3AE1 B;  3SEB A;  4YTM B;  3AE7 B;  1KF6 B;  1SB3 C;  1PYW D;  1CZP A;  4NZL B;  3NRZ A;  5FR3 A;  1V1O A;  4HKQ A;  1PGX A;  2PIA A;  2K5P A;  1TS4 A;  1RM6 C;  1HQR D;  1NYQ A;  2LGI A;  3NUH B;  1L0X B;  3AEB B;  4YSX B;  1SEB D;  2LHE A;  4IOI E;  1XLN A;  1ZXH A;  1V1P A;  4ITK A;  1QKZ A;  1AN8 A;  2B76 B;  3KWV A;  1I4G A;  2JX5 A;  5BYR A;  1C79 A;  1HA5 A;  3P4P B;  4AQ7 A;  4RGM A;  2MEK A;  4RFB A;  1WYG A;  1JAL A;  4OVZ A;  4WWM A;  2DLB A;  1C9F A;  2KAC A;  1IGD A;  2IJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...