4QAYA

Crystal structure of tama potra domains
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
260
structure length
248
Chain Sequence
NVRLQVEGLSGQLEKNVRAQLSTIEPDRRFRARVDDAIREGLKALGYYQPTIEFDLRPPPKKGRQVLIAKVTPGVPVLIGGTDVVLRGGARTDKDYLKLLDTRPAIGTVLNQGDYENFKKSLTSIALRKGYFDSEFTKAQLGIALGLHKAFWDIDYNSGERYRFGHVTFEGSQIRDEYLQNLVPFKEGDEYESKDLAELNRRLSATGWFNSVVVAPQFDKARETKVLPLTGVVSPRTEGYSTDVGPRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Translocation and assembly module TamA
publication title Recognition of autotransporter passenger domains by the TAM complex
rcsb
source organism Human gut metagenome
total genus 80
structure length 248
sequence length 260
ec nomenclature
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07244 POTRA Surface antigen variable number repeat
A PF17243 POTRA_TamA_1 POTRA domain TamA domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 4qayA03
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 4qayA02
2V9HA 2QDFA 4K3BA 4C00A 2VH1A 4QAYA 3EFCA 4XGAB 3OG5A 2QCZA 3MC9A 4BZAA 4C4VA 4PK1A 2MHJA 2X8XX 3MC8A 3Q6BA 3NJTA 2VH2A 4K3CA 4C4VB
chains in the Genus database with same CATH superfamily
2EELA 3Q2AC 3NS8A 4RFBA 3Q14C 5D2MB 2BYEA 2IO0B 2LGXA 1ET9A 4XZ4A 1KLGD 4OHJA 4PYZA 4F1SA 4AJYB 3IBEA 4TUUA 4PK1A 1DOYA 1YOVB 2KDMA 1YQ3B 2BWES 2KMCA 2LWPA 1T0RC 4IW0A 3PSEB 5IA7A 1FRRA 1AW7A 2ZCCA 1R4MI 3V3XA 3JW0X 2O2VB 2BT6A 3BVGA 3QA8A 1YN5A 2N9PC 2AWTA 1YQ4B 3L10B 4EZLA 2MBOA 3N1ZC 4LNIA 3RZFA 2PLPA 4TQ1A 1TJEA 2JUOA 3KVFB 4FULA 2WU5B 1SE9A 1RFKA 3X23A 2EKEC 4N6EB 1V1OA 3BINA 4MELA 2MJDA 5AEKB 5LLIA 4GOCA 3GP7A 3DDCB 2PE9A 2I2YA 2B3AA 2J42A 2LVPA 4BZAA 4YTPB 4EZKA 1Z2MA 1C77A 4URKA 2RMMA 5G5GA 2KTFA 3Q8FA 1SXTA 3ABVB 2FNJB 1DOXA 1ZXIA 2J4XA 2KQ7A 3Q3OC 4WWOA 1E8WA 4G50A 2PVGC 2M1MA 1E90A 2KWVB 4GLSC 3VH3B 2QIEB 3A9JB 1L0YB 2GLSA 1B9RA 4BKSD 1ENFA 3QQ8B 1V49A 2D3GA 1E0ZA 2MLBA 4FHJA 1S3SG 2C7NB 2M0AA 1V2YA 4US9A 3AEAB 3IT4B 2M56B 1WFYA 1Q10A 4C4VA 2N1VA 2ICIA 3DBHB 2MHJA 1VRAB 3AE6B 3WAPA 4EOYA 2LHDA 4LJOB 4JE3B 2KDIA 4FJZA 3NOBA 2DENB 4LJPB 2E6XA 2MBEA 4ZRQA 3AXCA 2CHWA 2WYQA 5IN7A 3SEBA 2MA9B 3WALA 2O6VA 2RGFA 3PS6A 5IAAC 2KMAA 3LB8C 2IBIB 2WXJA 3P1MA 3NRZA 1L6VA 1WGGA 3OJ4B 2WQYB 4NY0A 3BK1A 2VH2A 4HK2A 2HE7A 2LGSA 3NUHB 2LMCA 1LQBA 1F52A 3BVMA 5CHWA 3W2DA 4E3CA 2XNAC 1ZDVA 4DHZE 1CJEA 2PKOA 4TSSA 5DPWA 2BVCA 4A3PA 1V8CA 5KHQA 1NVID 4DQOC 2QC8A 2K39A 1QOAA 1EUVB 4MGIE 4CQNA 2BS4B 2FBWB 2WS3B 2WNMA 5BYQA 2DZIA 4EZJA 2NBWB 4D2KA 1TTNA 2WDRB 2OEDA 1I7HA 1FMAD 3TEWA 2V3PA 5L95C 1UWXA 4MGZE 4BBNF 3VDZA 3LYYA 4RM8A 5D3DA 1WWTA 3QAQA 3MTNB 1L5PA 1SEBD 4AOFA 2AQ1B 4L1BA 4TQ0A 2MJEA 2KKCA 5AZFA 4FXCA 2M0XA 1UELA 1R4NI 3RULA 2J52A 3PVLA 1KLVA 3ZNZB 4DXGA 4XX5A 2HD5B 1WJNA 4FLHA 3NVWA 2WXNA 3KQ4A 4HJGE 5CTRC 2PW9A 2LD9A 4MSQB 4EKUA 1UWMA 1I35A 3GZNI 4USAA 4IUMB 1UH6A 4NJ7A 2GI9A 2W9NA 1WSPA 3X0WA 1VZ6A 1SIFA 4ZOHC 5JHAA 3ZXRA 2C60A 1QLBB 1FD6A 3M63B 1WM2A 2UU7A 1J0GA 1VD2A 3I5JC 1WXAA 4B95A 2MWSB 4II2B 2OJRA 5JH5C 4ZYNA 4XWTA 3TSSA 2FCMA 2AQ2B 2LI5A 2LUEA 3R3MA 3UGBB 2PVOD 4B9KA 1ZGUB 5CHVC 2W55A 1FM0D 3DOWA 1MHHE 5BMIA 1H8CA 3P4SB 1YN3A 2LRUA 3TCAA 3HUIA 3R2TA 5D6JB 4LK0M 4NNJB 2ZPNA 2K8BA 4AQ7A 4RM9A 3LJ3A 4MM3A 5EDSA 2IY1B 1Q1OA 3H6NA 3L0WB 1P1AA 4PS3A 4HKZE 3AU4A 2BPSA 1NYRA 1OEYA 2ZVNA 3C8YA 2WWZA 3JYUA 5IOIA 4ANVA 3K9PB 3B9JA 3VUYA 4LNOA 4N59A 3AE2B 4LNFA 4C56C 2GBKA 4XDDA 2J0KA 4MH8A 1UGJA 1T5XD 1AN8A 4P16A 3M95A 2O6VD 1HZ6A 4YTNB 5CX3A 1P7EA 3TUOA 2XN9C 1FO4A 1GAQB 1PGBA 3ONSA 4W9HA 2AYOB 3K9OB 2DHZA 4WH4A 3UF8A 3I63C 3ZKJC 3RNAC 1KOTA 3KWVA 1XD3B 2UYZB 1UBIA 4DHJD 3N20C 3A1QB 3RN9C 3L16A 4II3B 1Q0WB 1HA5A 2V3SA 1J8CA 2Z8LA 3FC4A 4C7YA 1LXDA 4M0WB 2D3BA 3VUWA 2BYTA 2K25A 4LCDE 3PZ8A 2DAJA 4EEWA 3M62B 3WANA 4YXDB 5LXHA 3M3JA 3AEFB 1PDXA 2KTRA 2LGDA 2NR2A 2CU3A 3ZRFA 3AM9A 4PT5A 4K81A 5KHOA 1KJTA 3ENEA 4W9CA 1K52A 2HTME 2JXXA 2WLBA 3TL5A 1N63A 5AZGA 2N9EB 3AEEB 2WX0A 1WX7A 3L4PA 3O65B 5L83A 2O6VB 1XT9B 2V3NA 3QK0A 3WCQA 2K5PA 2LGYA 2JZZA 2D11A 1EF5A 3URYA 1ZXHA 4PS7A 1MFWA 2RPVA 3A4RA 1XCQL 3W1SC 4ANUA 1P9DU 1PGXA 4W9KA 2LXAA 2WXHA 3NVZA 3Q8AA 4WWPA 5J18A 1V86A 4GXBA 2C5LC 3UQAA 4KDIC 2GBMA 3PRPB 3QJZA 4KSKC 3PPAA 4DXFA 4MJSA 5DPRA 3NS1A 4WJPA 2PPHA 5EE1A 1F2RC 1MG4A 3R7RA 2LVQA 3AI5A 4BAXA 2K22A 3MP9A 2L32A 5DPTA 4W9GA 2NVUI 2NBUA 4LDTD 2NMQA 4P1BC 4ZRIA 4WJQA 2JPHA 3H9DA 1FCCC 1K8RB 4S0RA 4P1CC 3TEYA 2ONQA 2ZPYA 4W9JA 2QSDA 3PLUA 3DPDA 3KH0A 5D94A 3R2IA 1SE3A 1XLOA 4WIPA 5HG2A 3DBRB 3LXFA 4XWWA 4KGTA 2LZ6A 4JX1C 3ECIA 4NAMA 1V81A 2KJ6A 5EE3A 1C79A 4BBNC 3IG3A 1E8YA 4HXDA 3RI7C 3T8MA 3VFKA 3OG5A 1XCTL 4XYCA 2MBHA 1AARA 4MEMA 3RYTA 2K1FA 1SJED 2C7MB 2IGHA 3TJPA 1J7AA 4E74A 3RNCC 2VRRB 4IM3A 2QMTA 4EFOA 4OW0A 1F2RI 3PHXB 4IG7B 1XLNA 1ZP0B 2ACZB 4WQMA 2MCNB 4ZHPA 4LDTB 5D7GA 1RM6C 2MEKA 1FNVA 1WGYA 1CMXB 4OZAA 3A33B 4N9F4 1JMLA 3AE3B 3ZGZA 2IO2B 1YN4A 2JU6X 1FFUA 4G11A 1P98A 3H7SA 2Y5PA 4ICUA 4W9EA 1ZPSA 1UZXB 3GOEA 5HKHA 1MVKA 2KJRA 2Y5CA 4DK5A 2KN4A 5E6PA 4C80A 3NJTA 1OQYA 3HHMA 2YLMA 3NZSA 4YWGG 4PYUA 3MHSD 4P6VF 3GB1A 3W5VB 4S17A 3TEZA 1T0QC 2ZCBA 1UBQA 4AJWA 4I6LB 1ZUD2 1MHXA 2MBQA 4CHKA 3H8HA 2KVZA 4TMAB 4HPMB 3ZQ4A 1D5ZC 1DGJA 1OFFA 3PTFC 4ITKA 3KUCB 4PS8A 2YEPB 2LASA 3ZUNA 4M8MA 3P42A 2WDTB 3V6EB 2A4ZA 4JGHB 3Q8BA 4GB9A 3V05A 3BY4B 3NG0A 1SBBB 2BYFA 5AZHA 4ICVA 1WRIA 4KGRA 2JYEA 3Q3FA 1C78A 2B76B 4JIOU 4WJOA 3EFUA 4MSMB 2KX3A 3E9SA 3EGRA 5IP4D 1IPGA 3ZIMA 3PRMB 3FILA 3RFZB 2KQSA 4HDQA 2BBCA 2XBBC 1TBEA 4W9LA 4ARCA 2DYMA 1EF1A 2LXCA 2BW2A 2WXQA 2D3CA 3ZNGC 5J2RA 3Q8CA 4RF0A 3DHIC 2N7JA 1UD7A 3SFEB 2JVCA 2KTRB 1WX9A 2LVOA 1AWDA 2JY6A 3AE8B 3IFWB 3L17A 1GG3A 2G45B 4MGKE 4DDGD 4ZDVA 3GE8C 4I6NB 1I42A 1DOIA 2KDEB 5TSSA 3VXWA 1HE8A 1YX6B 1P7FA 2W3RA 1WH3A 2XK5A 4L2YA 3QX1A 1GNUA 1QOBA 2FCNA 2KK8A 2IJ0A 1GB4A 3JVZX 4HRSA 2HTHA 3R66C 3V60A 4BOZB 1VLBA 2SAKA 3HM3A 2KFKA 5AUIA 3MFGA 2KACA 1TY2A 4YTMB 2LGIA 2KN5A 3JSVA 1QF6A 2DZKA 3AEBB 5E6OA 2D5GA 2EMTA 4WAFA 4GSWA 5AUKA 3I57A 2ZW0A 1IYFA 2JZPA 4WJNA 3EA6A 1M4VA 2WXOA 3RZWC 5EE9A 3PT2B 2KWDA 1TZ1A 4MJSB 3D32A 4B0MA 1WR1A 4GDKB 4RGOS 1F9JA 2DWQA 2K6DB 5CHFA 4KV2A 3ZDMC 2ZZPB 2NBVB 3ZW3A 3AECB 4OZBA 1Q5WB 1I4QA 3L08A 3VRBB 4HVBA 3W1SA 2JQRB 2DZMA 1ZW7A 1V1PA 1SB3C 1IUEA 3DBHI 2DZJA 4A3OA 3C19A 2W3SA 2BB6A 1JRUA 3ML9A 1KTKA 3LDZE 2MW5A 3Q3NC 1XLPA 2WXPA 1EU4A 2I1KA 3VHTC 3ZNID 1WJ4A 1J7BA 1FXAA 2I38A 1HXYD 4IOIE 3ZO5B 4B6WA 1GJZA 3EFCA 2MBBB 1J19A 1F0ZA 2KVRA 1K51A 2DLBA 3IAM1 3RT3B 1XLQA 3U8ZA 5T8IA 5I4DA 1SF0A 1PYWD 2DYBA 1HQRD 3GE3C 3S2AA 3HRDD 2NPTB 2KMMA 1WMHA 3APDA 4KKJA 4MACA 2IO1B 3O13A 4XC2A 5FKAC 1YNTE 1M94A 2MJ3A 2CKHB 4A55A 3QC8B 2CJNA 4M00A 1CQVA 1R7SA 1NYQA 1WM3A 4QAYA 3FAHA 1EWYC 3ML8A 1GC6A 2YVCA 2CHXA 2J0MA 2KYWA 2WXRA 2EMSA 3AULA 2SEBD 4HEA1 1VR9A 1TS3A 2ON8A 1JWSD 3VTWA 2QDFA 3EECA 4LNKA 1OEYJ 1T0YA 1ZDXA 4F8CB 2KZRA 2GBJA 2YEPF 2W82A 1FPYA 3VRAB 1WE7A 3BVZA 2MH7A 1K53A 1YJ1A 4HDOA 2QJLA 1N62A 4X57B 4LNNA 4BFRA 2FUHB 2L8JA 3MJWA 1YJJA 1MPEA 3NZUA 4HWIB 1OTRB 2JXTA 3UQBA 2O2VA 2AQ3B 4CYEA 5HI1A 2OHFA 2R61A 3ZVVA 3APFA 2FIFA 3AH7A 4JPSA 4FJVB 4FN2A 4W9FA 2KAJA 1E8XA 3KYDD 4A90A 4HPLB 1C4CA 2KWCA 2AX5A 1V5TA 3FILB 4US8A 2L76A 2LJ5A 1LFDA 1WXMA 4GIVA 4E71A 4ARIA 4NJCA 4J6IA 2KHWB 3VAWA 2KC1A 4GDLA 4IM0A 3MHZA 3MJ5A 4W9IA 1C76A 1I4RA 3RPFC 2AEHA 4A8XC 5GXGB 3VH4B 1L2NA 3U52E 1J7CA 4H2AA 5EE0A 4A9AA 4O1NA 1C3TA 1I4XA 1D3ZA 3AN1A 5IO9A 3NVYA 2XK5B 4C4VB 2MQJA 4ZRJA 5LXIB 3PO0A 3EUB2 2Z59B 1FIQA 2I1JA 3RNGC 3WAOA 1OQRA 3A9JA 3DVNU 3BYYB 2WHIA 4BVUC 1V5OA 4RF1A 4AS1A 2J53A 3L13A 1P0RA 1NEKB 4IC7B 4UDUC 3B08A 1KF6B 3CSTA 1TZOA 2CU1A 1VZ7A 1FCLA 2FCQA 4JLCA 3JSVB 3A9KA 1Y8RC 2QHOA 3WIMA 2RD0A 1E6EB 3Q3MC 1RAXA 1V97A 1D5XC 4HCNB 4JWUC 4DHJB 4XE0A 5DPSA 1QOGA 2X8XX 2L00B 1SGHA 2DBYA 3KUDB 2BS3B 3VVWB 3VTUA 4EE2A 3GS2A 4W9DA 3BWUD 1JQ4A 2KLGA 2KLCA 1LO5D 1BXTA 3UIOB 3ZYYX 1FXIA 2JRIB 2PE6B 4K1RB 1SE4A 4NJ6A 4FHKA 1FNUA 1KLUD 3HIZA 1A70A 2L7RA 3TEXA 2KXJA 3RNFC 3H7PA 4KVGB 2KDFB 3U30A 3W1YA 2FUG1 1HTOA 4M01A 1GUAB 2KD0A 1WZ3A 1QQRA 1HZ5A 2MRPA 2WXMA 2J7QB 2KOXA 1B1ZA 1F77A 3OAWA 3I9V1 3ZDTA 1UGMA 3AE4B 2IY0B 4KIKA 3PGEA 1Z5SB 2IPKD 3P63A 3R8BA 3DCGA 2X38A 4KX6B 4K7UA 1CK1A 1D6EC 4KKIA 1RLFA 3KW5B 2K3UA 3KWLA 2XEWA 4KZ0A 4NQKE 4P7IA 1PFDA 1PGAA 3ZLZA 5H92C 4WWNA 3DWMA 2BWFA 1RFAA 1QT9A 2WXLA 4LTUA 4YT0B 2V0GA 1TS4A 2V4IB 1H4RA 5BMGA 2IGGA 2GBRA 3EHVA 4J3OD 4ZHOA 1C4AA 3ZJUA 1T6BX 1GOZA 1MG8A 3OLMD 2C9WB 2R2QA 2LJIA 3BIID 4AP4C 4WAAA 3W5UB 3DBRI 3N1XC 4RH6A 2KANA 4NZLB 1WIAA 3N9YC 1ISNA 2HJ1A 4IWPA 1BUIC 3DHHC 1S1QB 2RDHA 5FK9C 3VUXA 1JWMD 1RRBA 4LLGM 2LFIA 4MM3B 1KH0A 3CSFA 1WXSA 2UWQA 3QCAA 2E3TA 3P4QB 3DVGY 4BKGA 3DQVA 1C4PA 2WX1A 2KX0A 1WXVA 2JT4B 3TBLD 4K3BA 1NENB 1XF5L 1WZ0A 1T0SC 1OGWA 4BOSC 5BYRA 4HROA 2WXIA 5BYSA 3N3KB 2KWUB 3HM6X 1N5WA 2PEAA 1NDDA 3ZRCA 1PQSA 2WDVB 1EU3A 2PJHA 1NBFC 2BYVE 2IZVB 3T3OA 1BT0A 2V9HA 2CJOA 3BK2A 3PV1A 2N7EA 2Q5WD 2Z0DB 4WQOB 1WJUA 4JQWC 4FADA 1FEHA 4GDLB 3Q8EA 1QILA 1WGHA 3ZJTA 1FRDA 1WJ6A 2JWUA 1NI2A 3DVGX 1E7VA 4MGYE 2JX5A 2K9XA 3U7DA 5BMHA 2AL6A 4MH0E 2GRIA 2JYTA 4G3XB 1UNSA 2FAZA 1L4ZB 3A1QA 2LUMA 1IGCA 2QCZA 1ROEA 1CZPA 1N61A 3DHGC 4M0WA 3APCA 3QHTA 3SDLC 3P2BA 3HVZA 2M19A 2Y5BB 4NAWA 5D3IB 2CR5A 1JALA 3AE7B 4NPNA 1JCKB 4RGTA 4RCOA 3VR8B 5E6NA 1D4BA 3R7QA 2N4FA 1N60A 1QZEA 2VZKD 3H1UA 3A9KB 2K8HA 2M4NA 2QEJC 1D5MC 3B2GA 2L3ZA 2WXKA 4K7SA 1XXGA 1TS5A 1IBXA 1WGKA 2NTSA 2G3QB 4R3DA 4WWMA 3ZTDA 1I4PA 3CMMB 3AMZA 2IYDB 2N7DA 3SR6A 3B1LX 5E6JA 1TGZB 3NZ3A 2MP2A 2V4LA 1JRPA 1TKGA 3MC0B 1E8ZA 2DAFA 5C1ZA 2BTEA 2FIDA 2ASQA 4DXAB 5JZEB 1JWBD 2LHEA 3U7ZA 2LEKA 1V80A 2IGDA 1YD8U 4K7WA 3UI3A 3IAS1 3QIJA 1E9MA 2A5UA 1WY8A 5C23A 2CHZA 4AWJA 4EUTA 2HDEA 3RD2A 1SE2A 1R4NB 1TKEA 4MT5A 1L0XB 3A4SC 3U4EG 2BGFA 3H7PB 1MJDA 1L4DB 2BKFA 1UUPA 2N0SB 3IHPC 4RGMA 1C1YB 1X1MA 2J0JA 2NCNA 2QILA 2JRHA 2V1YA 3Q6BA 5JXVA 1PUTA 1YMHE 4YSXB 2VZKB 3GZNB 2KC2A 1VCBA 3BZDB 2D2QA 4JL9A 1SSNA 3E56A 4DBGA 2D3AA 4KIKB 1LM8B 1TYGB 4BKTA 3RCZA 2ZNVC 2ZW1A 1BMLC 4I6PA 4IDIA 3SD5A 1V6EA 5H8YE 1WE6A 2CS4A 2ZNVB 2Y3AA 2BKRB 2L0TA 1FNWA 1XO3A 5LNK1 3CIRB 5HHDG 2INCC 1KFYB 3T3NA 4ZYSA 2WXFA 1E7PB 4M02A 3V62A 3NVVA 4N58A 3WA0A 4ANWA 3ZXVA 4RMAA 4IWQA 1STEA 1T3QA 2L1AA 2MX2A 4KGSA 2W54A 5IKCM 3WAMA 5FR6A 3HVDA 1YJIA 3NY5A 4YSYB 3KUZA 3CWIA 3DWGC 1UF0A 1K50A 4F7ZA 3AB5A 1WF9A 1DYQA 3U2SC 3PREA 4FJYA 3P4RB 3IVFA 5C3JB 1YQBA 3FKYA 2JF5A 3NHEB 1F1HA 3AE9B 2ZJDA 4DDID 3RUIB 2BQQA 2D10A 1QOFA 4JWSC 2AL3A 2KQ4X 4HLEA 3BYTB 2G4DB 2RSUA 3CF6E 3KLSX 3MC8A 3KYCD 4WURA 1ZKHA 2WU2B 4RNAA 2DX5B 4M8NA 1NI3A 3PLVA 1HTQA 2LRWA 1SIJA 3SFDB 2OOBB 2N9KA 4RGNA 1KM7A 2N9LA 1VDVA 3B0AA 1WRDB 2L0FA 2L83A 2FCSA 1I4HA 3PZ7A 1WI0A 2INDC 1YX5B 4KZCA 1U4AA 2KJHB 4XGAB 4ASWC 2L52A 2TSSA 1RWSA 3AU5A 4OZCA 5FR3A 1SJHD 1XQQA 3N1YC 3QARA 3ETRA 4Q2JA 3TIXA 4MDKE 1L7YA 4GGQA 2GOWA 4FA6A 2L05A 4IWOA 3IXSA 3P4PB 4GMVA 1Y56A 1XEEA 2PTLA 2PIAA 2BS2B 2RDGA 1HEZE 4OVZA 2H88B 2NTTA 3W9CB 3AEDB 3RNBC 2ZEQA 2N1WA 1IGDA 3DBLB 3SU8X 2INPE 4YL8A 3ZTCA 4TV3A 4OVVA 1YIWA 5GMVA 3ALBA 1GB1A 5TR5A 3B2FA 3C0RB 1GC7A 3VQIA 1L0VB 1OQQA 1JW9D 2R2OA 2N9XA 2RPQA 4NAWB 1I4GA 5JHBA 1A5RA 2Z0EB 3RNEC 4G0NB 2G4SA 2KDBA 1V9JA 2KFKB 1FFVA 1IBXB 4DWFA 1JROA 1IP9A 2GB1A 2ZVOA 2MP2B 3Q3JA 1WGRA 3AV8A 3N30A 2KO3A 1VJKA 4KDLB 3VTVA 2KNBA 1WX8A 1E7UA 1G6JA 4CO7A 2IO3B 2H89B 1KRHA 1EO6A 1ZE3D 1VZ8A 3DBLI 1EWCA 4OVUA 4C00A 2G1EA 5BO4B 4YSZB 1C9FA 5HFYA 3AE5B 1V1PB 2HJ8A 4GDKA 1WXQA 4A20A 2EKIA 3IT6B 4DHZB 1TKYA 2WDQB 4BKSA 3OJ3A 1LGRA 2GBNA 4KSLC 1L6UA 2IDYA 3PHWB 2GMIC 4HJKA 3QWZB 3N32A 5G55A 2MSED 3TMPB 4FBJB 2BF8B 3ZNHB 1ESFA 1EM7A 1E5WA 3SHQA 2RDBC 5MPOA 3DVNV 4A6QA 2JSVX 1ACCA 1TY0A 3AE1B 1FXTB 2VH1A 2INNE 4TKNA 3OWEB 2K0PA 2K8CA 3I3TB 2C7HA 3J9CA 1TIFA 2M8SA 1P3QU 4ZRPA 2JZ3B 4IKGA 1GPXA 2RR9A 3PRZA 3DBSA 1TT5B 4HPPA 1WMHB 4B0EA 3UINB 4REZA 3PZDA 5DCNA 3VR9B 5J17A 1QKZA 2BB5A 4ACFA 5G5HA 3ZJVA 2DNFA 3L54A 2KT7A 3EC8A 4AUQC 1JWAD 1TS2A 1R4MB 4GU2A 2M17A 1JWUD 5G2NA 4HKQA 1ZOYB 2NS5A 3MC9A 3V6CB 2REXA 3HK0A 2WXGA 4C7ZA 2NPTA 3V61A 1RYJA 3UIPB 3RMKC 4GN1A 3Q69A 4IM2A 1E10A 2D07B 2FE8A 5C2TB 4L23A 2K6QA 2KFJA 2G9HD 4NQLB 2DYOA 1MI0A 3T9LA 1WYGA 1AYFA 1WR6E 2WP9B 1WGDA 2JWZA 2WGSA 1N5XA 3AEGB 4XDCA 1WYWB 4ANXA 1ET6A 2PMVA 4HCPB 4K3CA 2OJWA 1N6ZA 4ZRKA
chains in the Genus database with same CATH topology
2V9HA 2QDFA 4K3BA 4C00A 2VH1A 4QAYA 3EFCA 4XGAB 3OG5A 2QCZA 3MC9A 4BZAA 4C4VA 4PK1A 2MHJA 2X8XX 3MC8A 3Q6BA 3NJTA 2VH2A 4K3CA 4C4VB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V9H A;  2QDF A;  4K3B A;  4C00 A;  2VH1 A;  4QAY A;  3EFC A;  4XGA B;  3OG5 A;  2QCZ A;  3MC9 A;  4BZA A;  4C4V A;  4PK1 A;  2MHJ A;  2X8X X;  3MC8 A;  3Q6B A;  3NJT A;  2VH2 A;  4K3C A;  4C4V B; 
#chains in the Genus database with same CATH topology
 2EEL A;  3Q2A C;  3NS8 A;  4RFB A;  3Q14 C;  5D2M B;  2BYE A;  2IO0 B;  2LGX A;  1ET9 A;  4XZ4 A;  1KLG D;  4OHJ A;  4PYZ A;  4F1S A;  4AJY B;  3IBE A;  4TUU A;  4PK1 A;  1DOY A;  1YOV B;  2KDM A;  1YQ3 B;  2BWE S;  2KMC A;  2LWP A;  1T0R C;  4IW0 A;  3PSE B;  5IA7 A;  1FRR A;  1AW7 A;  2ZCC A;  1R4M I;  3V3X A;  3JW0 X;  2O2V B;  2BT6 A;  3BVG A;  3QA8 A;  1YN5 A;  2N9P C;  2AWT A;  1YQ4 B;  3L10 B;  4EZL A;  2MBO A;  3N1Z C;  4LNI A;  3RZF A;  2PLP A;  4TQ1 A;  1TJE A;  2JUO A;  3KVF B;  4FUL A;  2WU5 B;  1SE9 A;  1RFK A;  3X23 A;  2EKE C;  4N6E B;  1V1O A;  3BIN A;  4MEL A;  2MJD A;  5AEK B;  5LLI A;  4GOC A;  3GP7 A;  3DDC B;  2PE9 A;  2I2Y A;  2B3A A;  2J42 A;  2LVP A;  4BZA A;  4YTP B;  4EZK A;  1Z2M A;  1C77 A;  4URK A;  2RMM A;  5G5G A;  2KTF A;  3Q8F A;  1SXT A;  3ABV B;  2FNJ B;  1DOX A;  1ZXI A;  2J4X A;  2KQ7 A;  3Q3O C;  4WWO A;  1E8W A;  4G50 A;  2PVG C;  2M1M A;  1E90 A;  2KWV B;  4GLS C;  3VH3 B;  2QIE B;  3A9J B;  1L0Y B;  2GLS A;  1B9R A;  4BKS D;  1ENF A;  3QQ8 B;  1V49 A;  2D3G A;  1E0Z A;  2MLB A;  4FHJ A;  1S3S G;  2C7N B;  2M0A A;  1V2Y A;  4US9 A;  3AEA B;  3IT4 B;  2M56 B;  1WFY A;  1Q10 A;  4C4V A;  2N1V A;  2ICI A;  3DBH B;  2MHJ A;  1VRA B;  3AE6 B;  3WAP A;  4EOY A;  2LHD A;  4LJO B;  4JE3 B;  2KDI A;  4FJZ A;  3NOB A;  2DEN B;  4LJP B;  2E6X A;  2MBE A;  4ZRQ A;  3AXC A;  2CHW A;  2WYQ A;  5IN7 A;  3SEB A;  2MA9 B;  3WAL A;  2O6V A;  2RGF A;  3PS6 A;  5IAA C;  2KMA A;  3LB8 C;  2IBI B;  2WXJ A;  3P1M A;  3NRZ A;  1L6V A;  1WGG A;  3OJ4 B;  2WQY B;  4NY0 A;  3BK1 A;  2VH2 A;  4HK2 A;  2HE7 A;  2LGS A;  3NUH B;  2LMC A;  1LQB A;  1F52 A;  3BVM A;  5CHW A;  3W2D A;  4E3C A;  2XNA C;  1ZDV A;  4DHZ E;  1CJE A;  2PKO A;  4TSS A;  5DPW A;  2BVC A;  4A3P A;  1V8C A;  5KHQ A;  1NVI D;  4DQO C;  2QC8 A;  2K39 A;  1QOA A;  1EUV B;  4MGI E;  4CQN A;  2BS4 B;  2FBW B;  2WS3 B;  2WNM A;  5BYQ A;  2DZI A;  4EZJ A;  2NBW B;  4D2K A;  1TTN A;  2WDR B;  2OED A;  1I7H A;  1FMA D;  3TEW A;  2V3P A;  5L95 C;  1UWX A;  4MGZ E;  4BBN F;  3VDZ A;  3LYY A;  4RM8 A;  5D3D A;  1WWT A;  3QAQ A;  3MTN B;  1L5P A;  1SEB D;  4AOF A;  2AQ1 B;  4L1B A;  4TQ0 A;  2MJE A;  2KKC A;  5AZF A;  4FXC A;  2M0X A;  1UEL A;  1R4N I;  3RUL A;  2J52 A;  3PVL A;  1KLV A;  3ZNZ B;  4DXG A;  4XX5 A;  2HD5 B;  1WJN A;  4FLH A;  3NVW A;  2WXN A;  3KQ4 A;  4HJG E;  5CTR C;  2PW9 A;  2LD9 A;  4MSQ B;  4EKU A;  1UWM A;  1I35 A;  3GZN I;  4USA A;  4IUM B;  1UH6 A;  4NJ7 A;  2GI9 A;  2W9N A;  1WSP A;  3X0W A;  1VZ6 A;  1SIF A;  4ZOH C;  5JHA A;  3ZXR A;  2C60 A;  1QLB B;  1FD6 A;  3M63 B;  1WM2 A;  2UU7 A;  1J0G A;  1VD2 A;  3I5J C;  1WXA A;  4B95 A;  2MWS B;  4II2 B;  2OJR A;  5JH5 C;  4ZYN A;  4XWT A;  3TSS A;  2FCM A;  2AQ2 B;  2LI5 A;  2LUE A;  3R3M A;  3UGB B;  2PVO D;  4B9K A;  1ZGU B;  5CHV C;  2W55 A;  1FM0 D;  3DOW A;  1MHH E;  5BMI A;  1H8C A;  3P4S B;  1YN3 A;  2LRU A;  3TCA A;  3HUI A;  3R2T A;  5D6J B;  4LK0 M;  4NNJ B;  2ZPN A;  2K8B A;  4AQ7 A;  4RM9 A;  3LJ3 A;  4MM3 A;  5EDS A;  2IY1 B;  1Q1O A;  3H6N A;  3L0W B;  1P1A A;  4PS3 A;  4HKZ E;  3AU4 A;  2BPS A;  1NYR A;  1OEY A;  2ZVN A;  3C8Y A;  2WWZ A;  3JYU A;  5IOI A;  4ANV A;  3K9P B;  3B9J A;  3VUY A;  4LNO A;  4N59 A;  3AE2 B;  4LNF A;  4C56 C;  2GBK A;  4XDD A;  2J0K A;  4MH8 A;  1UGJ A;  1T5X D;  1AN8 A;  4P16 A;  3M95 A;  2O6V D;  1HZ6 A;  4YTN B;  5CX3 A;  1P7E A;  3TUO A;  2XN9 C;  1FO4 A;  1GAQ B;  1PGB A;  3ONS A;  4W9H A;  2AYO B;  3K9O B;  2DHZ A;  4WH4 A;  3UF8 A;  3I63 C;  3ZKJ C;  3RNA C;  1KOT A;  3KWV A;  1XD3 B;  2UYZ B;  1UBI A;  4DHJ D;  3N20 C;  3A1Q B;  3RN9 C;  3L16 A;  4II3 B;  1Q0W B;  1HA5 A;  2V3S A;  1J8C A;  2Z8L A;  3FC4 A;  4C7Y A;  1LXD A;  4M0W B;  2D3B A;  3VUW A;  2BYT A;  2K25 A;  4LCD E;  3PZ8 A;  2DAJ A;  4EEW A;  3M62 B;  3WAN A;  4YXD B;  5LXH A;  3M3J A;  3AEF B;  1PDX A;  2KTR A;  2LGD A;  2NR2 A;  2CU3 A;  3ZRF A;  3AM9 A;  4PT5 A;  4K81 A;  5KHO A;  1KJT A;  3ENE A;  4W9C A;  1K52 A;  2HTM E;  2JXX A;  2WLB A;  3TL5 A;  1N63 A;  5AZG A;  2N9E B;  3AEE B;  2WX0 A;  1WX7 A;  3L4P A;  3O65 B;  5L83 A;  2O6V B;  1XT9 B;  2V3N A;  3QK0 A;  3WCQ A;  2K5P A;  2LGY A;  2JZZ A;  2D11 A;  1EF5 A;  3URY A;  1ZXH A;  4PS7 A;  1MFW A;  2RPV A;  3A4R A;  1XCQ L;  3W1S C;  4ANU A;  1P9D U;  1PGX A;  4W9K A;  2LXA A;  2WXH A;  3NVZ A;  3Q8A A;  4WWP A;  5J18 A;  1V86 A;  4GXB A;  2C5L C;  3UQA A;  4KDI C;  2GBM A;  3PRP B;  3QJZ A;  4KSK C;  3PPA A;  4DXF A;  4MJS A;  5DPR A;  3NS1 A;  4WJP A;  2PPH A;  5EE1 A;  1F2R C;  1MG4 A;  3R7R A;  2LVQ A;  3AI5 A;  4BAX A;  2K22 A;  3MP9 A;  2L32 A;  5DPT A;  4W9G A;  2NVU I;  2NBU A;  4LDT D;  2NMQ A;  4P1B C;  4ZRI A;  4WJQ A;  2JPH A;  3H9D A;  1FCC C;  1K8R B;  4S0R A;  4P1C C;  3TEY A;  2ONQ A;  2ZPY A;  4W9J A;  2QSD A;  3PLU A;  3DPD A;  3KH0 A;  5D94 A;  3R2I A;  1SE3 A;  1XLO A;  4WIP A;  5HG2 A;  3DBR B;  3LXF A;  4XWW A;  4KGT A;  2LZ6 A;  4JX1 C;  3ECI A;  4NAM A;  1V81 A;  2KJ6 A;  5EE3 A;  1C79 A;  4BBN C;  3IG3 A;  1E8Y A;  4HXD A;  3RI7 C;  3T8M A;  3VFK A;  3OG5 A;  1XCT L;  4XYC A;  2MBH A;  1AAR A;  4MEM A;  3RYT A;  2K1F A;  1SJE D;  2C7M B;  2IGH A;  3TJP A;  1J7A A;  4E74 A;  3RNC C;  2VRR B;  4IM3 A;  2QMT A;  4EFO A;  4OW0 A;  1F2R I;  3PHX B;  4IG7 B;  1XLN A;  1ZP0 B;  2ACZ B;  4WQM A;  2MCN B;  4ZHP A;  4LDT B;  5D7G A;  1RM6 C;  2MEK A;  1FNV A;  1WGY A;  1CMX B;  4OZA A;  3A33 B;  4N9F 4;  1JML A;  3AE3 B;  3ZGZ A;  2IO2 B;  1YN4 A;  2JU6 X;  1FFU A;  4G11 A;  1P98 A;  3H7S A;  2Y5P A;  4ICU A;  4W9E A;  1ZPS A;  1UZX B;  3GOE A;  5HKH A;  1MVK A;  2KJR A;  2Y5C A;  4DK5 A;  2KN4 A;  5E6P A;  4C80 A;  3NJT A;  1OQY A;  3HHM A;  2YLM A;  3NZS A;  4YWG G;  4PYU A;  3MHS D;  4P6V F;  3GB1 A;  3W5V B;  4S17 A;  3TEZ A;  1T0Q C;  2ZCB A;  1UBQ A;  4AJW A;  4I6L B;  1ZUD 2;  1MHX A;  2MBQ A;  4CHK A;  3H8H A;  2KVZ A;  4TMA B;  4HPM B;  3ZQ4 A;  1D5Z C;  1DGJ A;  1OFF A;  3PTF C;  4ITK A;  3KUC B;  4PS8 A;  2YEP B;  2LAS A;  3ZUN A;  4M8M A;  3P42 A;  2WDT B;  3V6E B;  2A4Z A;  4JGH B;  3Q8B A;  4GB9 A;  3V05 A;  3BY4 B;  3NG0 A;  1SBB B;  2BYF A;  5AZH A;  4ICV A;  1WRI A;  4KGR A;  2JYE A;  3Q3F A;  1C78 A;  2B76 B;  4JIO U;  4WJO A;  3EFU A;  4MSM B;  2KX3 A;  3E9S A;  3EGR A;  5IP4 D;  1IPG A;  3ZIM A;  3PRM B;  3FIL A;  3RFZ B;  2KQS A;  4HDQ A;  2BBC A;  2XBB C;  1TBE A;  4W9L A;  4ARC A;  2DYM A;  1EF1 A;  2LXC A;  2BW2 A;  2WXQ A;  2D3C A;  3ZNG C;  5J2R A;  3Q8C A;  4RF0 A;  3DHI C;  2N7J A;  1UD7 A;  3SFE B;  2JVC A;  2KTR B;  1WX9 A;  2LVO A;  1AWD A;  2JY6 A;  3AE8 B;  3IFW B;  3L17 A;  1GG3 A;  2G45 B;  4MGK E;  4DDG D;  4ZDV A;  3GE8 C;  4I6N B;  1I42 A;  1DOI A;  2KDE B;  5TSS A;  3VXW A;  1HE8 A;  1YX6 B;  1P7F A;  2W3R A;  1WH3 A;  2XK5 A;  4L2Y A;  3QX1 A;  1GNU A;  1QOB A;  2FCN A;  2KK8 A;  2IJ0 A;  1GB4 A;  3JVZ X;  4HRS A;  2HTH A;  3R66 C;  3V60 A;  4BOZ B;  1VLB A;  2SAK A;  3HM3 A;  2KFK A;  5AUI A;  3MFG A;  2KAC A;  1TY2 A;  4YTM B;  2LGI A;  2KN5 A;  3JSV A;  1QF6 A;  2DZK A;  3AEB B;  5E6O A;  2D5G A;  2EMT A;  4WAF A;  4GSW A;  5AUK A;  3I57 A;  2ZW0 A;  1IYF A;  2JZP A;  4WJN A;  3EA6 A;  1M4V A;  2WXO A;  3RZW C;  5EE9 A;  3PT2 B;  2KWD A;  1TZ1 A;  4MJS B;  3D32 A;  4B0M A;  1WR1 A;  4GDK B;  4RGO S;  1F9J A;  2DWQ A;  2K6D B;  5CHF A;  4KV2 A;  3ZDM C;  2ZZP B;  2NBV B;  3ZW3 A;  3AEC B;  4OZB A;  1Q5W B;  1I4Q A;  3L08 A;  3VRB B;  4HVB A;  3W1S A;  2JQR B;  2DZM A;  1ZW7 A;  1V1P A;  1SB3 C;  1IUE A;  3DBH I;  2DZJ A;  4A3O A;  3C19 A;  2W3S A;  2BB6 A;  1JRU A;  3ML9 A;  1KTK A;  3LDZ E;  2MW5 A;  3Q3N C;  1XLP A;  2WXP A;  1EU4 A;  2I1K A;  3VHT C;  3ZNI D;  1WJ4 A;  1J7B A;  1FXA A;  2I38 A;  1HXY D;  4IOI E;  3ZO5 B;  4B6W A;  1GJZ A;  3EFC A;  2MBB B;  1J19 A;  1F0Z A;  2KVR A;  1K51 A;  2DLB A;  3IAM 1;  3RT3 B;  1XLQ A;  3U8Z A;  5T8I A;  5I4D A;  1SF0 A;  1PYW D;  2DYB A;  1HQR D;  3GE3 C;  3S2A A;  3HRD D;  2NPT B;  2KMM A;  1WMH A;  3APD A;  4KKJ A;  4MAC A;  2IO1 B;  3O13 A;  4XC2 A;  5FKA C;  1YNT E;  1M94 A;  2MJ3 A;  2CKH B;  4A55 A;  3QC8 B;  2CJN A;  4M00 A;  1CQV A;  1R7S A;  1NYQ A;  1WM3 A;  4QAY A;  3FAH A;  1EWY C;  3ML8 A;  1GC6 A;  2YVC A;  2CHX A;  2J0M A;  2KYW A;  2WXR A;  2EMS A;  3AUL A;  2SEB D;  4HEA 1;  1VR9 A;  1TS3 A;  2ON8 A;  1JWS D;  3VTW A;  2QDF A;  3EEC A;  4LNK A;  1OEY J;  1T0Y A;  1ZDX A;  4F8C B;  2KZR A;  2GBJ A;  2YEP F;  2W82 A;  1FPY A;  3VRA B;  1WE7 A;  3BVZ A;  2MH7 A;  1K53 A;  1YJ1 A;  4HDO A;  2QJL A;  1N62 A;  4X57 B;  4LNN A;  4BFR A;  2FUH B;  2L8J A;  3MJW A;  1YJJ A;  1MPE A;  3NZU A;  4HWI B;  1OTR B;  2JXT A;  3UQB A;  2O2V A;  2AQ3 B;  4CYE A;  5HI1 A;  2OHF A;  2R61 A;  3ZVV A;  3APF A;  2FIF A;  3AH7 A;  4JPS A;  4FJV B;  4FN2 A;  4W9F A;  2KAJ A;  1E8X A;  3KYD D;  4A90 A;  4HPL B;  1C4C A;  2KWC A;  2AX5 A;  1V5T A;  3FIL B;  4US8 A;  2L76 A;  2LJ5 A;  1LFD A;  1WXM A;  4GIV A;  4E71 A;  4ARI A;  4NJC A;  4J6I A;  2KHW B;  3VAW A;  2KC1 A;  4GDL A;  4IM0 A;  3MHZ A;  3MJ5 A;  4W9I A;  1C76 A;  1I4R A;  3RPF C;  2AEH A;  4A8X C;  5GXG B;  3VH4 B;  1L2N A;  3U52 E;  1J7C A;  4H2A A;  5EE0 A;  4A9A A;  4O1N A;  1C3T A;  1I4X A;  1D3Z A;  3AN1 A;  5IO9 A;  3NVY A;  2XK5 B;  4C4V B;  2MQJ A;  4ZRJ A;  5LXI B;  3PO0 A;  3EUB 2;  2Z59 B;  1FIQ A;  2I1J A;  3RNG C;  3WAO A;  1OQR A;  3A9J A;  3DVN U;  3BYY B;  2WHI A;  4BVU C;  1V5O A;  4RF1 A;  4AS1 A;  2J53 A;  3L13 A;  1P0R A;  1NEK B;  4IC7 B;  4UDU C;  3B08 A;  1KF6 B;  3CST A;  1TZO A;  2CU1 A;  1VZ7 A;  1FCL A;  2FCQ A;  4JLC A;  3JSV B;  3A9K A;  1Y8R C;  2QHO A;  3WIM A;  2RD0 A;  1E6E B;  3Q3M C;  1RAX A;  1V97 A;  1D5X C;  4HCN B;  4JWU C;  4DHJ B;  4XE0 A;  5DPS A;  1QOG A;  2X8X X;  2L00 B;  1SGH A;  2DBY A;  3KUD B;  2BS3 B;  3VVW B;  3VTU A;  4EE2 A;  3GS2 A;  4W9D A;  3BWU D;  1JQ4 A;  2KLG A;  2KLC A;  1LO5 D;  1BXT A;  3UIO B;  3ZYY X;  1FXI A;  2JRI B;  2PE6 B;  4K1R B;  1SE4 A;  4NJ6 A;  4FHK A;  1FNU A;  1KLU D;  3HIZ A;  1A70 A;  2L7R A;  3TEX A;  2KXJ A;  3RNF C;  3H7P A;  4KVG B;  2KDF B;  3U30 A;  3W1Y A;  2FUG 1;  1HTO A;  4M01 A;  1GUA B;  2KD0 A;  1WZ3 A;  1QQR A;  1HZ5 A;  2MRP A;  2WXM A;  2J7Q B;  2KOX A;  1B1Z A;  1F77 A;  3OAW A;  3I9V 1;  3ZDT A;  1UGM A;  3AE4 B;  2IY0 B;  4KIK A;  3PGE A;  1Z5S B;  2IPK D;  3P63 A;  3R8B A;  3DCG A;  2X38 A;  4KX6 B;  4K7U A;  1CK1 A;  1D6E C;  4KKI A;  1RLF A;  3KW5 B;  2K3U A;  3KWL A;  2XEW A;  4KZ0 A;  4NQK E;  4P7I A;  1PFD A;  1PGA A;  3ZLZ A;  5H92 C;  4WWN A;  3DWM A;  2BWF A;  1RFA A;  1QT9 A;  2WXL A;  4LTU A;  4YT0 B;  2V0G A;  1TS4 A;  2V4I B;  1H4R A;  5BMG A;  2IGG A;  2GBR A;  3EHV A;  4J3O D;  4ZHO A;  1C4A A;  3ZJU A;  1T6B X;  1GOZ A;  1MG8 A;  3OLM D;  2C9W B;  2R2Q A;  2LJI A;  3BII D;  4AP4 C;  4WAA A;  3W5U B;  3DBR I;  3N1X C;  4RH6 A;  2KAN A;  4NZL B;  1WIA A;  3N9Y C;  1ISN A;  2HJ1 A;  4IWP A;  1BUI C;  3DHH C;  1S1Q B;  2RDH A;  5FK9 C;  3VUX A;  1JWM D;  1RRB A;  4LLG M;  2LFI A;  4MM3 B;  1KH0 A;  3CSF A;  1WXS A;  2UWQ A;  3QCA A;  2E3T A;  3P4Q B;  3DVG Y;  4BKG A;  3DQV A;  1C4P A;  2WX1 A;  2KX0 A;  1WXV A;  2JT4 B;  3TBL D;  4K3B A;  1NEN B;  1XF5 L;  1WZ0 A;  1T0S C;  1OGW A;  4BOS C;  5BYR A;  4HRO A;  2WXI A;  5BYS A;  3N3K B;  2KWU B;  3HM6 X;  1N5W A;  2PEA A;  1NDD A;  3ZRC A;  1PQS A;  2WDV B;  1EU3 A;  2PJH A;  1NBF C;  2BYV E;  2IZV B;  3T3O A;  1BT0 A;  2V9H A;  2CJO A;  3BK2 A;  3PV1 A;  2N7E A;  2Q5W D;  2Z0D B;  4WQO B;  1WJU A;  4JQW C;  4FAD A;  1FEH A;  4GDL B;  3Q8E A;  1QIL A;  1WGH A;  3ZJT A;  1FRD A;  1WJ6 A;  2JWU A;  1NI2 A;  3DVG X;  1E7V A;  4MGY E;  2JX5 A;  2K9X A;  3U7D A;  5BMH A;  2AL6 A;  4MH0 E;  2GRI A;  2JYT A;  4G3X B;  1UNS A;  2FAZ A;  1L4Z B;  3A1Q A;  2LUM A;  1IGC A;  2QCZ A;  1ROE A;  1CZP A;  1N61 A;  3DHG C;  4M0W A;  3APC A;  3QHT A;  3SDL C;  3P2B A;  3HVZ A;  2M19 A;  2Y5B B;  4NAW A;  5D3I B;  2CR5 A;  1JAL A;  3AE7 B;  4NPN A;  1JCK B;  4RGT A;  4RCO A;  3VR8 B;  5E6N A;  1D4B A;  3R7Q A;  2N4F A;  1N60 A;  1QZE A;  2VZK D;  3H1U A;  3A9K B;  2K8H A;  2M4N A;  2QEJ C;  1D5M C;  3B2G A;  2L3Z A;  2WXK A;  4K7S A;  1XXG A;  1TS5 A;  1IBX A;  1WGK A;  2NTS A;  2G3Q B;  4R3D A;  4WWM A;  3ZTD A;  1I4P A;  3CMM B;  3AMZ A;  2IYD B;  2N7D A;  3SR6 A;  3B1L X;  5E6J A;  1TGZ B;  3NZ3 A;  2MP2 A;  2V4L A;  1JRP A;  1TKG A;  3MC0 B;  1E8Z A;  2DAF A;  5C1Z A;  2BTE A;  2FID A;  2ASQ A;  4DXA B;  5JZE B;  1JWB D;  2LHE A;  3U7Z A;  2LEK A;  1V80 A;  2IGD A;  1YD8 U;  4K7W A;  3UI3 A;  3IAS 1;  3QIJ A;  1E9M A;  2A5U A;  1WY8 A;  5C23 A;  2CHZ A;  4AWJ A;  4EUT A;  2HDE A;  3RD2 A;  1SE2 A;  1R4N B;  1TKE A;  4MT5 A;  1L0X B;  3A4S C;  3U4E G;  2BGF A;  3H7P B;  1MJD A;  1L4D B;  2BKF A;  1UUP A;  2N0S B;  3IHP C;  4RGM A;  1C1Y B;  1X1M A;  2J0J A;  2NCN A;  2QIL A;  2JRH A;  2V1Y A;  3Q6B A;  5JXV A;  1PUT A;  1YMH E;  4YSX B;  2VZK B;  3GZN B;  2KC2 A;  1VCB A;  3BZD B;  2D2Q A;  4JL9 A;  1SSN A;  3E56 A;  4DBG A;  2D3A A;  4KIK B;  1LM8 B;  1TYG B;  4BKT A;  3RCZ A;  2ZNV C;  2ZW1 A;  1BML C;  4I6P A;  4IDI A;  3SD5 A;  1V6E A;  5H8Y E;  1WE6 A;  2CS4 A;  2ZNV B;  2Y3A A;  2BKR B;  2L0T A;  1FNW A;  1XO3 A;  5LNK 1;  3CIR B;  5HHD G;  2INC C;  1KFY B;  3T3N A;  4ZYS A;  2WXF A;  1E7P B;  4M02 A;  3V62 A;  3NVV A;  4N58 A;  3WA0 A;  4ANW A;  3ZXV A;  4RMA A;  4IWQ A;  1STE A;  1T3Q A;  2L1A A;  2MX2 A;  4KGS A;  2W54 A;  5IKC M;  3WAM A;  5FR6 A;  3HVD A;  1YJI A;  3NY5 A;  4YSY B;  3KUZ A;  3CWI A;  3DWG C;  1UF0 A;  1K50 A;  4F7Z A;  3AB5 A;  1WF9 A;  1DYQ A;  3U2S C;  3PRE A;  4FJY A;  3P4R B;  3IVF A;  5C3J B;  1YQB A;  3FKY A;  2JF5 A;  3NHE B;  1F1H A;  3AE9 B;  2ZJD A;  4DDI D;  3RUI B;  2BQQ A;  2D10 A;  1QOF A;  4JWS C;  2AL3 A;  2KQ4 X;  4HLE A;  3BYT B;  2G4D B;  2RSU A;  3CF6 E;  3KLS X;  3MC8 A;  3KYC D;  4WUR A;  1ZKH A;  2WU2 B;  4RNA A;  2DX5 B;  4M8N A;  1NI3 A;  3PLV A;  1HTQ A;  2LRW A;  1SIJ A;  3SFD B;  2OOB B;  2N9K A;  4RGN A;  1KM7 A;  2N9L A;  1VDV A;  3B0A A;  1WRD B;  2L0F A;  2L83 A;  2FCS A;  1I4H A;  3PZ7 A;  1WI0 A;  2IND C;  1YX5 B;  4KZC A;  1U4A A;  2KJH B;  4XGA B;  4ASW C;  2L52 A;  2TSS A;  1RWS A;  3AU5 A;  4OZC A;  5FR3 A;  1SJH D;  1XQQ A;  3N1Y C;  3QAR A;  3ETR A;  4Q2J A;  3TIX A;  4MDK E;  1L7Y A;  4GGQ A;  2GOW A;  4FA6 A;  2L05 A;  4IWO A;  3IXS A;  3P4P B;  4GMV A;  1Y56 A;  1XEE A;  2PTL A;  2PIA A;  2BS2 B;  2RDG A;  1HEZ E;  4OVZ A;  2H88 B;  2NTT A;  3W9C B;  3AED B;  3RNB C;  2ZEQ A;  2N1W A;  1IGD A;  3DBL B;  3SU8 X;  2INP E;  4YL8 A;  3ZTC A;  4TV3 A;  4OVV A;  1YIW A;  5GMV A;  3ALB A;  1GB1 A;  5TR5 A;  3B2F A;  3C0R B;  1GC7 A;  3VQI A;  1L0V B;  1OQQ A;  1JW9 D;  2R2O A;  2N9X A;  2RPQ A;  4NAW B;  1I4G A;  5JHB A;  1A5R A;  2Z0E B;  3RNE C;  4G0N B;  2G4S A;  2KDB A;  1V9J A;  2KFK B;  1FFV A;  1IBX B;  4DWF A;  1JRO A;  1IP9 A;  2GB1 A;  2ZVO A;  2MP2 B;  3Q3J A;  1WGR A;  3AV8 A;  3N30 A;  2KO3 A;  1VJK A;  4KDL B;  3VTV A;  2KNB A;  1WX8 A;  1E7U A;  1G6J A;  4CO7 A;  2IO3 B;  2H89 B;  1KRH A;  1EO6 A;  1ZE3 D;  1VZ8 A;  3DBL I;  1EWC A;  4OVU A;  4C00 A;  2G1E A;  5BO4 B;  4YSZ B;  1C9F A;  5HFY A;  3AE5 B;  1V1P B;  2HJ8 A;  4GDK A;  1WXQ A;  4A20 A;  2EKI A;  3IT6 B;  4DHZ B;  1TKY A;  2WDQ B;  4BKS A;  3OJ3 A;  1LGR A;  2GBN A;  4KSL C;  1L6U A;  2IDY A;  3PHW B;  2GMI C;  4HJK A;  3QWZ B;  3N32 A;  5G55 A;  2MSE D;  3TMP B;  4FBJ B;  2BF8 B;  3ZNH B;  1ESF A;  1EM7 A;  1E5W A;  3SHQ A;  2RDB C;  5MPO A;  3DVN V;  4A6Q A;  2JSV X;  1ACC A;  1TY0 A;  3AE1 B;  1FXT B;  2VH1 A;  2INN E;  4TKN A;  3OWE B;  2K0P A;  2K8C A;  3I3T B;  2C7H A;  3J9C A;  1TIF A;  2M8S A;  1P3Q U;  4ZRP A;  2JZ3 B;  4IKG A;  1GPX A;  2RR9 A;  3PRZ A;  3DBS A;  1TT5 B;  4HPP A;  1WMH B;  4B0E A;  3UIN B;  4REZ A;  3PZD A;  5DCN A;  3VR9 B;  5J17 A;  1QKZ A;  2BB5 A;  4ACF A;  5G5H A;  3ZJV A;  2DNF A;  3L54 A;  2KT7 A;  3EC8 A;  4AUQ C;  1JWA D;  1TS2 A;  1R4M B;  4GU2 A;  2M17 A;  1JWU D;  5G2N A;  4HKQ A;  1ZOY B;  2NS5 A;  3MC9 A;  3V6C B;  2REX A;  3HK0 A;  2WXG A;  4C7Z A;  2NPT A;  3V61 A;  1RYJ A;  3UIP B;  3RMK C;  4GN1 A;  3Q69 A;  4IM2 A;  1E10 A;  2D07 B;  2FE8 A;  5C2T B;  4L23 A;  2K6Q A;  2KFJ A;  2G9H D;  4NQL B;  2DYO A;  1MI0 A;  3T9L A;  1WYG A;  1AYF A;  1WR6 E;  2WP9 B;  1WGD A;  2JWZ A;  2WGS A;  1N5X A;  3AEG B;  4XDC A;  1WYW B;  4ANX A;  1ET6 A;  2PMV A;  4HCP B;  4K3C A;  2OJW A;  1N6Z A;  4ZRK A; 
#chains in the Genus database with same CATH homology
 2V9H A;  2QDF A;  4K3B A;  4C00 A;  2VH1 A;  4QAY A;  3EFC A;  4XGA B;  3OG5 A;  2QCZ A;  3MC9 A;  4BZA A;  4C4V A;  4PK1 A;  2MHJ A;  2X8X X;  3MC8 A;  3Q6B A;  3NJT A;  2VH2 A;  4K3C A;  4C4V B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...