4QAYA

Crystal structure of tama potra domains
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
260
structure length
248
Chain Sequence
b'NVRLQVEGLSGQLEKNVRAQLSTIEPDRRFRARVDDAIREGLKALGYYQPTIEFDLRPPPKKGRQVLIAKVTPGVPVLIGGTDVVLRGGARTDKDYLKLLDTRPAIGTVLNQGDYENFKKSLTSIALRKGYFDSEFTKAQLGIALGLHKAFWDIDYNSGERYRFGHVTFEGSQIRDEYLQNLVPFKEGDEYESKDLAELNRRLSATGWFNSVVVAPQFDKARETKVLPLTGVVSPRTEGYSTDVGPRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translocation and assembly module TamA
publication title Recognition of autotransporter passenger domains by the TAM complex
rcsb
source organism Human gut metagenome
molecule tags Transport protein
total genus 80
structure length 248
sequence length 260
ec nomenclature
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07244 POTRA Surface antigen variable number repeat
A PF17243 POTRA_TamA_1 POTRA domain TamA domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 4qayA03
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 4qayA02
2QDFA 2V9HA 2VH2A 3MC9A 2X8XX 3EFCA 4K3CA 4PK1A 4C00A 2VH1A 4C4VA 4K3BA 3MC8A 3Q6BA 3OG5A 4XGAB 4QAYA 3NJTA 2QCZA 2MHJA 4C4VB 4BZAA
chains in the Genus database with same CATH superfamily
3U52E 5LXIB 1EF5A 3ETRA 1QOGA 5BMIA 3U2SC 2WXMA 3EECA 2K6QA 3ZNHB 3ZKJC 3VTUA 4ZRJA 3W2DA 4EE2A 4WQMA 1A5RA 3QK0A 2D3GA 2D3AA 2G3QB 3EA6A 4US8A 1L0VB 4M8MA 1YNTE 2INCC 1YQBA 4KGSA 5GXGB 5HFYA 1E10A 1DYQA 3DHIC 4FHJA 1OQRA 3UINB 3SR6A 2MBOA 1IUEA 3IBEA 2K9XA 3PSEB 3BVMA 4MGZE 2KO3A 2FAZA 1LM8B 3IT6B 2N9XA 1QOBA 1XCTL 3ZDMC 5JXVA 3DHHC 1F77A 4NAMA 3DVGX 3P4RB 4GLSC 2KACA 2ZEQA 3PRPB 4ZRKA 1F9JA 3NVYA 4HCPB 4W9CA 5EE1A 1BUIC 2BT6A 2DZMA 2WDTB 2WP9B 4HVBA 4HXDA 1P7FA 3N1ZC 1VZ6A 3OAWA 4KIKB 5MPOA 3MTNB 1K8RB 4DQOC 1C4AA 3GP7A 3K9PB 1ZXIA 4KZ0A 1WXSA 4KIKA 4EOYA 4JQWC 2DBYA 3V62A 4D2KA 5EE0A 1IBXA 2WYQA 2JWZA 2LJ5A 3DVGY 3MHSD 3NS8A 1E7UA 1TGZB 4IOIE 4M8NA 4KSLC 1E7VA 2IJ0A 4XE0A 5IN7A 3DBRB 4YT0B 1V9JA 1K53A 2JZPA 2I1KA 1WZ3A 3NHEB 2QIEB 4K7UA 4DBGA 2M0XA 2LZ6A 1BT0A 2MQJA 4B0MA 2H88B 2LFIA 2PMVA 2FNJB 3RN9C 3AE5B 1WJUA 3PZDA 2QJLA 2MBEA 1B1ZA 3AE6B 1UBQA 1TTNA 4MT5A 5DPRA 3ZRFA 2C7MB 2KT7A 2JYTA 3WA0A 3WALA 4AP4C 2JQRB 2MJ3A 2W55A 1VRAB 2VZKD 4YTNB 4K7WA 5IP4D 4ZHPA 3ENEA 4ZYNA 2KDFB 3APCA 3NUHB 3QQ8B 4FULA 2KHWB 4G11A 3SFEB 2G4DB 1KRHA 2NVUI 3OLMD 3H9DA 3R8BA 4B0EA 2MEKA 3IT4B 2WQYB 4RGMA 1SE9A 1WH3A 1FNVA 2IGHA 1FD6A 1PYWD 4ICUA 4KVGB 2AX5A 2VH1A 2KLCA 3CF6E 3GZNB 2B76B 4URKA 4IG7B 5AZHA 3I57A 2LASA 1YQ3B 1R4MB 4TSSA 1YOVB 3VAWA 1RM6C 2QILA 2Z0EB 2L8JA 1J8CA 2WWZA 5BYQA 2I38A 4MACA 3HM6X 3ZW3A 1YJIA 4IKGA 3WIMA 3BY4B 3NRZA 1DOIA 1QILA 1BXTA 4ASWC 3OJ4B 1PGXA 2LGIA 4OVVA 2E6XA 2GOWA 4TMAB 2L7RA 3QJZA 2NPTA 3TJPA 3U8ZA 4PS3A 2GBMA 3AV8A 1E5WA 1XLOA 3AE7B 3UGBB 3AEGB 2FIDA 2AEHA 4IM0A 3QHTA 5IOIA 3BVGA 3DBLI 1MFWA 2EMSA 2NBUA 3SEBA 2FIFA 2JXTA 4YWGG 4YSXB 2K8CA 1GAQB 3LXFA 3KWVA 5J18A 4N6EB 2GMIC 4NJ7A 1MHXA 2XNAC 4YTPB 2WDQB 1NENB 3V61A 2LRUA 2Q5WD 2M1MA 2N7JA 1ZKHA 3CMMB 4W9GA 3AE1B 1EWYC 4KZCA 3V6EB 2N1WA 2L32A 2BBCA 1QT9A 3KUZA 4MGKE 4HROA 4F8CB 1OFFA 4BKTA 2HJ1A 3ML9A 4GOCA 3R7QA 3H7PB 4PYUA 1IPGA 1E8YA 2AQ2B 1TY2A 3L10B 3DWMA 5HKHA 1G6JA 3JW0X 1WGDA 4JL9A 1JALA 2LGDA 4C4VB 2NBWB 1D5MC 3H7PA 3ZJUA 3DOWA 2N7EA 3DQVA 4NJCA 4B9KA 3L17A 3WAPA 1QZEA 1JRPA 4A20A 2Y5BB 2MP2A 2KDEB 2KQ7A 3ONSA 2KK8A 4GB9A 4N9F4 1F1HA 1UZXB 4C4VA 1XT9B 5T8IA 3V05A 5CHVC 5E6JA 2JXXA 3NG0A 1SE2A 1BMLC 4LK0M 3AE8B 4DHZB 3NY5A 4QAYA 2RPVA 4W9DA 3M95A 1P1AA 1KJTA 2XN9C 2WHIA 1YD8U 2CR5A 3FILB 2BS3B 1N60A 4K3CA 3QX1A 3I3TB 2UU7A 1WI0A 1WM3A 3NVWA 2WXHA 1V86A 3FILA 1ESFA 5TR5A 4IWOA 1WSPA 1D6EC 2J52A 4BZAA 1WFYA 3ECIA 1FEHA 3RD2A 2KZRA 2JU6X 1WM2A 3TBLD 1CJEA 4HWIB 3TEZA 1C79A 1V5TA 3VVWB 4DDID 2LD9A 1XCQL 2CHWA 1I42A 4FA6A 3BK2A 5HG2A 2D5GA 3VHTC 2INDC 4K81A 3X0WA 2PE9A 1OQYA 3R3MA 3QWZB 3KQ4A 1RWSA 2WU5B 1TZ1A 1R4NB 1PDXA 3A1QA 4A55A 3RNBC 4WURA 1FRRA 1T5XD 3Q6BA 2CHXA 2WLBA 4JE3B 2C9WB 4A90A 1WX9A 3IXSA 2J53A 1E9MA 2OJWA 2E3TA 2K8HA 3VXWA 2JWUA 3ZDTA 3IFWB 2CU1A 5I4DA 4RMAA 4TUUA 2OHFA 3TEWA 4HK2A 1WXMA 2KXJA 4LJOB 2WXRA 5LXHA 2W54A 3H7SA 4AS1A 2KN5A 4DK5A 3V3XA 3R2IA 1SE4A 2J0JA 1ZOYB 2CS4A 3IAS1 3CIRB 3PO0A 2IO1B 3P63A 4IDIA 2IZVB 4MJSB 3RCZA 2V9HA 2VH2A 3NVVA 1SF0A 2DWQA 2HE7A 4EZLA 4L2YA 1VCBA 4TKNA 2R61A 4MJSA 2M19A 1IGDA 3A4RA 1E7PB 1WGHA 4M01A 3QAQA 5G2NA 2M0AA 2K0PA 2FCQA 1I4PA 4LDTD 1FFUA 1OQQA 4N59A 4P16A 2I2YA 1VZ7A 2JRHA 4OW0A 2I1JA 2ASQA 4AJWA 4OHJA 1WJ4A 3C0RB 1FO4A 1T0SC 3AE2B 2BS4B 2O6VD 1E6EB 2WXIA 5FK9C 4DDGD 2L76A 1TZOA 2QCZA 4F7ZA 4K7SA 3ZXRA 1Q1OA 3DBHB 1K50A 2LVPA 2L52A 4WWOA 3PLVA 1YN5A 4MSMB 4WH4A 4AUQC 1X1MA 3WAMA 2CJOA 1QQRA 3N1YC 3VRBB 2WX1A 3SFDB 5AUKA 3U7DA 2MX2A 2BTEA 1MPEA 2KC2A 3NZ3A 1J7AA 1F2RI 4WJNA 3VTVA 3EC8A 2AL6A 2KDBA 2M4NA 3P42A 1KF6B 2N9KA 4MH8A 4KV2A 2WGSA 4OVZA 5D94A 1D3ZA 2KYWA 1GJZA 1HZ5A 2J0MA 4DWFA 2JZ3B 1KTKA 4JX1C 1PGBA 1UGMA 5C3JB 1V6EA 2CJNA 1P3QU 2V4LA 4W9EA 4GXBA 3PRMB 2RDGA 3PS6A 4I6PA 5D2MB 1ZPSA 1VR9A 2ZNVB 1J7BA 4RFBA 2INNE 2LGSA 4OZAA 3AECB 3PGEA 3ZRCA 3BINA 2G45B 2K5PA 1Y8RC 2EMTA 2JY6A 1YN3A 3KUDB 3QCAA 1JROA 3Q8AA 3ZQ4A 3I63C 2DX5B 2DLBA 2LXCA 3P4PB 4EEWA 4I6NB 2L00B 3HVZA 2Z0DB 1OGWA 3V60A 4RGNA 1AARA 3DBSA 2IYDB 2K8BA 3B0AA 1WF9A 1AN8A 1L4ZB 1WX8A 1J0GA 4BKSD 4FHKA 4GDKA 3NVZA 3X23A 4HDOA 2RPQA 3DWGC 4KX6B 1FCLA 1FXTB 4KDLB 1IBXB 4NQKE 4AJYB 3FC4A 2IY0B 1YJ1A 4ANVA 3A9JB 1J7CA 1WYWB 1C4CA 1CZPA 3HK0A 3VR8B 4P7IA 2BYVE 3BWUD 4TV3A 1TIFA 4YSYB 3A9JA 4IW0A 2M17A 2PE6B 3BYTB 2BKFA 1JW9D 1WR1A 2PIAA 2B3AA 3LYYA 4DXGA 4HPLB 3E9SA 3GE8C 4YSZB 1C9FA 1L0XB 1YX6B 1AW7A 3RNCC 3PVLA 3KH0A 4E3CA 3P4SB 2V3PA 1TBEA 2AQ1B 5BYRA 5D6JB 1ZGUB 2LVQA 1SE3A 1N5XA 4USAA 3PPAA 4BFRA 1I4QA 2GBJA 2ACZB 4LLGM 1KLUD 2KFJA 1TKGA 1WX7A 4RCOA 1A70A 2BB5A 2Y5CA 4ITKA 3WANA 5G5GA 1MHHE 3M63B 1MG8A 4G3XB 1HEZE 1UF0A 1K51A 2L05A 2K1FA 2Z8LA 4MGIE 4KGTA 2IGDA 1XF5L 1EUVB 1V8CA 4FJVB 4S0RA 1LQBA 2N9LA 3AEFB 2KJRA 1NBFC 3QC8B 3SHQA 2W3SA 4GGQA 4LTUA 3UF8A 1QOAA 5DPSA 1UBIA 3OWEB 2RD0A 5EDSA 4OZBA 2WXKA 2L83A 4MELA 1NVID 4JGHB 1V2YA 1KLVA 5J17A 4LNNA 3AH7A 2JZZA 4PK1A 3OJ3A 2IGGA 2Y3AA 2JSVX 3T9LA 1NI2A 4CQNA 2AL3A 2L3ZA 4XWTA 3SU8X 3CSTA 2JUOA 2MWSB 2PEAA 2ZCBA 2RR9A 3P1MA 2MBQA 3FAHA 1UGJA 4M00A 5EE3A 3VUYA 1FPYA 2BKRB 2UYZB 2R2OA 3AI5A 4RF1A 2PJHA 1AWDA 4REZA 2O2VB 1L6VA 3VFKA 2NPTB 2YVCA 2MA9B 3L4PA 3ZNID 1PUTA 2N0SB 1YQ4B 2O2VA 1TKEA 3RULA 2VZKB 3HIZA 3W5VB 1L4DB 2KNBA 4O1NA 4EKUA 1EF1A 5G55A 1L0YB 2DYOA 2KWDA 1ROEA 3N30A 4TQ1A 4ZHOA 1F2RC 4ZRIA 1N6ZA 5HI1A 1TS5A 2NBVB 2ICIA 1OEYA 2IDYA 3IHPC 3L0WB 1Q5WB 1FXIA 1KLGD 1QOFA 4XC2A 4JWUC 1C4PA 1NDDA 2KWVB 3AU4A 3C8YA 2A5UA 4XGAB 1ZDXA 2YEPF 3Q3FA 1U4AA 2OEDA 4N58A 1WIAA 3C19A 2QMTA 5CTRC 3BZDB 4GMVA 3ZYYX 2BS2B 3N9YC 1PQSA 2EKIA 2KJHB 3IAM1 4P1CC 5C23A 2KTRA 2MRPA 3N32A 2K3UA 2FUHB 4W9HA 2MP2B 3V6CB 3KWLA 2EKEC 2MHJA 3R7RA 1UELA 1E8ZA 3JSVB 1JWUD 2D11A 3A9KB 2SEBD 4HRSA 4NZLB 4CHKA 1F52A 1P0RA 2MH7A 3M62B 2MSED 3JSVA 1SGHA 2RDBC 3GOEA 1SEBD 3EHVA 3BK1A 5LNK1 3A9KA 1ZE3D 1E8XA 2M8SA 1TYGB 3TSSA 3B1LX 1OTRB 2JPHA 1I4GA 1WGRA 1I4HA 1WXAA 3RFZB 3VQIA 3LB8C 1T0QC 1GPXA 1N62A 3Q14C 1KFYB 4M0WB 1GC6A 2C7NB 4WIPA 4HKQA 4J3OD 1WE7A 4OZCA 3U7ZA 4I6LB 1PFDA 2HTHA 1P98A 1D5XC 3PZ7A 1KM7A 4IM2A 4M0WA 3ZNGC 3PRZA 3R66C 3RNFC 3ZVVA 3ABVB 2WU2B 2KDMA 5JHBA 2LGYA 1TKYA 2NR2A 1YMHE 3B2GA 1HXYD 2IO0B 1SBBB 3RI7C 4R3DA 4PYZA 3AXCA 2PKOA 2BYFA 1EU4A 1JCKB 1XEEA 1IP9A 5JHAA 5IO9A 2NCNA 2PTLA 1SIJA 3A1QB 3RMKC 3DBRI 5BMGA 2REXA 4MSQB 4UDUC 3S2AA 2EELA 5D3DA 1T0YA 2JT4B 2NTTA 3E56A 2DZJA 1L2NA 3TUOA 3BIID 3HHMA 3VR9B 2QC8A 1WGKA 1HTQA 1LGRA 4L23A 3QARA 2DHZA 4WWPA 4HPMB 2KANA 2GRIA 4DHZE 3RNAC 2WDVB 2OOBB 2CKHB 3A33B 4DHJB 1Q0WB 4P1BC 2FBWB 4CO7A 4BOSC 4IWQA 4LNFA 1DGJA 2LUMA 3TIXA 4HLEA 3AEBB 3H1UA 4WJPA 4PS8A 4XDDA 2LRWA 2XBBC 1JWSD 1EM7A 3O13A 4RGOS 4HJGE 2KMCA 3RNEC 2V3SA 1ZW7A 4II2B 1VD2A 2ZZPB 1JMLA 1RFAA 3EFCA 3MP9A 5FR3A 4EZKA 3AEAB 1ACCA 3B2FA 2W3RA 2KMMA 4DXFA 1FNWA 1E0ZA 2LGXA 3APFA 4C80A 2J0KA 1YX5B 1ZXHA 2HDEA 3RT3B 3U30A 4MM3B 1SJHD 3DVNU 4L1BA 3GZNI 2V4IB 4ZDVA 4LNKA 2XK5A 3HUIA 4MM3A 1R4MI 4E74A 3T3NA 5CHFA 3VUWA 3W1SC 2LXAA 4GDLB 1M94A 1EWCA 2G9HD 2MLBA 4GSWA 3ZLZA 5BMHA 2BF8B 4X57B 1IYFA 3DPDA 3WCQA 4ZYSA 2D3CA 5IA7A 3AEEB 1I35A 4GDLA 1JQ4A 5BO4B 2DYBA 1L7YA 2CHZA 3W1SA 4KGRA 3P4QB 1H8CA 2LHEA 2KLGA 3VH4B 4A6QA 4XWWA 3AE3B 4XX5A 4GIVA 4XYCA 1L5PA 1WJNA 2C60A 2BVCA 3Q3OC 3U4EG 4NQLB 1T3QA 2V3NA 3M3JA 5BYSA 2WDRB 2IO2B 3TEYA 2G4SA 2X8XX 3ZUNA 3L08A 1L6UA 3DHGC 2KFKB 1STEA 1KOTA 1TY0A 2KDIA 2ZCCA 2K6DB 3PHWB 3OG5A 1CK1A 1D5ZC 2NS5A 1MJDA 1J19A 3IVFA 3Q8BA 2KFKA 2GLSA 2N4FA 3WAOA 3DBLB 3CWIA 2JF5A 4EFOA 5AUIA 5FKAC 4BAXA 5L83A 3MC0B 3W9CB 2Z59B 2O6VB 2WX0A 3AULA 2AQ3B 3SD5A 5IAAC 1ISNA 5J2RA 3MFGA 2FE8A 4ZOHC 4W9KA 1LO5D 2WNMA 1N63A 2O6VA 4M02A 2QEJC 3EUB2 2KD0A 3MC9A 2AWTA 4JLCA 2IBIB 3KW5B 2HTME 4HCNB 1ENFA 1XLNA 3Q8CA 4ARIA 1ET9A 4KDIC 1ZP0B 5FR6A 2DZIA 4Q2JA 1I7HA 4FXCA 3AE4B 2N1VA 2M56B 4GDKB 3ZNZB 2PW9A 1WE6A 3AE9B 2CU3A 4RM8A 2IPKD 3Q3JA 3Q3NC 1E8WA 1V1OA 4ICVA 3HM3A 1FFVA 2K22A 2DAFA 5JZEB 2LWPA 1SXTA 1N5WA 4NPNA 1SJED 1UNSA 4J6IA 2OJRA 2FUG1 4JPSA 2KKCA 3Q8EA 2UWQA 2BYEA 3T3OA 4HKZE 4E71A 3ZJTA 3MC8A 2XEWA 3L16A 1XD3B 1Y56A 4RF0A 1SIFA 3I9V1 1V49A 1YJJA 1R7SA 1CMXB 3QA8A 2LHDA 3ZTCA 1PGAA 2LI5A 1GB4A 4NJ6A 2NTSA 1UWMA 1I4XA 3NS1A 2JYEA 1NI3A 1Q10A 1LXDA 3N3KB 2INPE 2FCSA 2FCNA 4XDCA 1R4NI 2FCMA 2WXJA 3RYTA 3RNGC 4RGTA 3VUXA 4IUMB 3NZSA 2DAJA 2WXPA 4W9JA 2BQQA 2L0FA 3VTWA 3ZJVA 4ARCA 4HDQA 4RM9A 2LEKA 3EGRA 4JWSC 3NJTA 4ANUA 5DPWA 3APDA 1V80A 4HJKA 4BKSA 2BWES 3UQAA 1FIQA 2GB1A 2W82A 1C1YB 1LFDA 2C5LC 2KX0A 3HRDD 2ZW1A 3ALBA 1JWAD 5L95C 3L13A 1SSNA 2KN4A 1QKZA 4TQ0A 1I4RA 5KHQA 1AYFA 2G1EA 3PV1A 1GOZA 1UUPA 2ON8A 2JRIB 1EU3A 3FKYA 2D2QA 3J9CA 2IO3B 3H8HA 4HEA1 3K9OB 1VJKA 5E6OA 3KVFB 4KSKC 4IC7B 4P6VF 1HA5A 4LJPB 1S3SG 1P9DU 4BBNF 2MBHA 3IG3A 4C7YA 2RMMA 4BKGA 2QHOA 1VZ8A 2WXQA 4AOFA 1FCCC 3LDZE 4C00A 5C2TB 1WY8A 2RDHA 3PZ8A 5KHOA 2GI9A 2KC1A 3ZXVA 2WXLA 2L1AA 3CSFA 3DBHI 1JWMD 2V0GA 3T8MA 1DOXA 2W9NA 5D7GA 1WGGA 2JX5A 4XZ4A 3MHZA 1P7EA 4LNIA 4II3B 4BOZB 4RH6A 1S1QB 4DXAB 4A3PA 2LUEA 2N9EB 1WWTA 2TSSA 1H4RA 2KQ4X 4FADA 4PS7A 2MW5A 3Q69A 4G50A 4YTMB 1N61A 4US9A 4MEMA 2IY1B 2J42A 4A9AA 3GB1A 1HZ6A 3UIOB 2LJIA 2PLPA 5E6NA 5AZGA 4ZRPA 3URYA 1C77A 3PTFC 1GNUA 3RPFC 5CX3A 2LVOA 1NYRA 1SB3C 4B6WA 2ZVOA 5IKCM 2HD5B 2C7HA 5G5HA 4GN1A 3AN1A 2KTRB 3VH3B 4GU2A 2KMAA 2DYMA 1YIWA 3JYUA 3GE3C 4LCDE 2JVCA 3W1YA 5HHDG 1WYGA 3Q2AC 4FN2A 5DPTA 1XQQA 2DNFA 3TCAA 1RYJA 3L54A 2ONQA 4ZRQA 1EO6A 3EFUA 2BW2A 1RLFA 2ZW0A 2R2QA 1WZ0A 2MCNB 4WJOA 4FJZA 1GB1A 3UI3A 4ACFA 2H89B 3B08A 2KWUB 2BWFA 5D3IB 1RRBA 3N20C 1XLQA 2DENB 2KVZA 4ANXA 4H2AA 3LJ3A 4A3OA 1V97A 1FMAD 3PREA 5C1ZA 3TL5A 2K39A 1UWXA 3KUCB 4FLHA 4CYEA 4EZJA 3PHXB 5LLIA 4LNOA 1DOYA 1UD7A 2KQSA 1WGYA 3KLSX 4DHJD 3D32A 2WXGA 4HPPA 4WAFA 1D4BA 3AM9A 1UH6A 4BVUC 4BBNC 1WJ6A 2KVRA 2DZKA 2ZPNA 2HJ8A 1GG3A 4YL8A 4AQ7A 3ZO5B 1GUAB 5AZFA 1WRDB 3A4SC 4WQOB 4W9IA 4IM3A 3ZTDA 4W9LA 2D3BA 4B95A 2ZVNA 1VDVA 4G0NB 3DVNV 2PVGC 3MJWA 3MJ5A 1JRUA 4K1RB 1XO3A 4WWMA 1T6BX 1NYQA 4K3BA 3RZFA 4W9FA 1TS2A 2QSDA 3PT2B 1K52A 1VLBA 3BVZA 1JWBD 2KAJA 2NMQA 3AEDB 4NAWB 3Q8FA 1GC7A 2WXFA 4C7ZA 1V1PB 1IGCA 5DCNA 3VDZA 4IWPA 4NAWA 2BYTA 3RUIB 1QF6A 4WAAA 4C56C 5H8YE 4MH0E 1ZDVA 2GBKA 4FJYA 1WXVA 1V1PA 5TSSA 2SAKA 2BB6A 1HQRD 4MGYE 4FBJB 1RAXA 2ZPYA 3KYCD 4WWNA 2D07B 2VRRB 2WS3B 2YEPB 5GMVA 4ANWA 3O65B 3KYDD 5E6PA 1FXAA 2PPHA 4JIOU 4NY0A 1XLPA 2A4ZA 3GS2A 1MVKA 3Q3MC 2RSUA 2K25A 3VRAB 1F0ZA 3I5JC 1WXQA 1C3TA 2WXOA 1TT5B 2MJEA 2PVOD 4A8XC 1T0RC 2XK5B 3DCGA 5EE9A 3ML8A 1B9RA 3JVZX 2GBNA 1Z5SB 2N7DA 4AWJA 1TS4A 4F1SA 3ZIMA 5JH5C 3N1XC 2KWCA 2J7QB 3BYYB 1Z2MA 1ET6A 2KX3A 1HTOA 2RGFA 4MDKE 3TMPB 3TEXA 2V1YA 4NNJB 4KKIA 3B9JA 1V5OA 3AU5A 1MI0A 3UIPB 3ZGZA 1MG4A 3QIJA 1WRIA 3UQBA 2Y5PA 1XXGA 3SDLC 1FNUA 1OEYJ 4EUTA 1ZUD2 2BGFA 1HE8A 2X38A 1NEKB 4RNAA 5CHWA 1RFKA 4YXDB 1C78A 2J4XA 1TJEA 3PLUA 4WJQA 2MJDA 2LMCA 3DDCB 1FRDA 1QLBB 5H92C 1KH0A 3AMZA 2KJ6A 2BPSA 1C76A 1FM0D 1TS3A 2L0TA 3W5UB 1YN4A 3P2BA 1V81A 3H6NA 1M4VA 2QDFA 3HVDA 4LDTB 2D10A 2N9PC 3NOBA 2GBRA 3NZUA 3R2TA 1WR6E 2ZJDA 4KKJA 3RZWC 1WMHB 5AEKB 1E90A 2KTFA 2MBBB 2WXNA 2AYOB 2KOXA 4OVUA 2YLMA 4S17A 1CQVA 1WMHA 3AB5A 2ZNVC 4PT5A
chains in the Genus database with same CATH topology
2QDFA 2V9HA 2VH2A 3MC9A 2X8XX 3EFCA 4K3CA 4PK1A 4C00A 2VH1A 4C4VA 4K3BA 3MC8A 3Q6BA 3OG5A 4XGAB 4QAYA 3NJTA 2QCZA 2MHJA 4C4VB 4BZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QDF A;  2V9H A;  2VH2 A;  3MC9 A;  2X8X X;  3EFC A;  4K3C A;  4PK1 A;  4C00 A;  2VH1 A;  4C4V A;  4K3B A;  3MC8 A;  3Q6B A;  3OG5 A;  4XGA B;  4QAY A;  3NJT A;  2QCZ A;  2MHJ A;  4C4V B;  4BZA A; 
#chains in the Genus database with same CATH topology
 3U52 E;  5LXI B;  1EF5 A;  3ETR A;  1QOG A;  5BMI A;  3U2S C;  2WXM A;  3EEC A;  2K6Q A;  3ZNH B;  3ZKJ C;  3VTU A;  4ZRJ A;  3W2D A;  4EE2 A;  4WQM A;  1A5R A;  3QK0 A;  2D3G A;  2D3A A;  2G3Q B;  3EA6 A;  4US8 A;  1L0V B;  4M8M A;  1YNT E;  2INC C;  1YQB A;  4KGS A;  5GXG B;  5HFY A;  1E10 A;  1DYQ A;  3DHI C;  4FHJ A;  1OQR A;  3UIN B;  3SR6 A;  2MBO A;  1IUE A;  3IBE A;  2K9X A;  3PSE B;  3BVM A;  4MGZ E;  2KO3 A;  2FAZ A;  1LM8 B;  3IT6 B;  2N9X A;  1QOB A;  1XCT L;  3ZDM C;  5JXV A;  3DHH C;  1F77 A;  4NAM A;  3DVG X;  3P4R B;  4GLS C;  2KAC A;  2ZEQ A;  3PRP B;  4ZRK A;  1F9J A;  3NVY A;  4HCP B;  4W9C A;  5EE1 A;  1BUI C;  2BT6 A;  2DZM A;  2WDT B;  2WP9 B;  4HVB A;  4HXD A;  1P7F A;  3N1Z C;  1VZ6 A;  3OAW A;  4KIK B;  5MPO A;  3MTN B;  1K8R B;  4DQO C;  1C4A A;  3GP7 A;  3K9P B;  1ZXI A;  4KZ0 A;  1WXS A;  4KIK A;  4EOY A;  4JQW C;  2DBY A;  3V62 A;  4D2K A;  5EE0 A;  1IBX A;  2WYQ A;  2JWZ A;  2LJ5 A;  3DVG Y;  3MHS D;  3NS8 A;  1E7U A;  1TGZ B;  4IOI E;  4M8N A;  4KSL C;  1E7V A;  2IJ0 A;  4XE0 A;  5IN7 A;  3DBR B;  4YT0 B;  1V9J A;  1K53 A;  2JZP A;  2I1K A;  1WZ3 A;  3NHE B;  2QIE B;  4K7U A;  4DBG A;  2M0X A;  2LZ6 A;  1BT0 A;  2MQJ A;  4B0M A;  2H88 B;  2LFI A;  2PMV A;  2FNJ B;  3RN9 C;  3AE5 B;  1WJU A;  3PZD A;  2QJL A;  2MBE A;  1B1Z A;  3AE6 B;  1UBQ A;  1TTN A;  4MT5 A;  5DPR A;  3ZRF A;  2C7M B;  2KT7 A;  2JYT A;  3WA0 A;  3WAL A;  4AP4 C;  2JQR B;  2MJ3 A;  2W55 A;  1VRA B;  2VZK D;  4YTN B;  4K7W A;  5IP4 D;  4ZHP A;  3ENE A;  4ZYN A;  2KDF B;  3APC A;  3NUH B;  3QQ8 B;  4FUL A;  2KHW B;  4G11 A;  3SFE B;  2G4D B;  1KRH A;  2NVU I;  3OLM D;  3H9D A;  3R8B A;  4B0E A;  2MEK A;  3IT4 B;  2WQY B;  4RGM A;  1SE9 A;  1WH3 A;  1FNV A;  2IGH A;  1FD6 A;  1PYW D;  4ICU A;  4KVG B;  2AX5 A;  2VH1 A;  2KLC A;  3CF6 E;  3GZN B;  2B76 B;  4URK A;  4IG7 B;  5AZH A;  3I57 A;  2LAS A;  1YQ3 B;  1R4M B;  4TSS A;  1YOV B;  3VAW A;  1RM6 C;  2QIL A;  2Z0E B;  2L8J A;  1J8C A;  2WWZ A;  5BYQ A;  2I38 A;  4MAC A;  3HM6 X;  3ZW3 A;  1YJI A;  4IKG A;  3WIM A;  3BY4 B;  3NRZ A;  1DOI A;  1QIL A;  1BXT A;  4ASW C;  3OJ4 B;  1PGX A;  2LGI A;  4OVV A;  2E6X A;  2GOW A;  4TMA B;  2L7R A;  3QJZ A;  2NPT A;  3TJP A;  3U8Z A;  4PS3 A;  2GBM A;  3AV8 A;  1E5W A;  1XLO A;  3AE7 B;  3UGB B;  3AEG B;  2FID A;  2AEH A;  4IM0 A;  3QHT A;  5IOI A;  3BVG A;  3DBL I;  1MFW A;  2EMS A;  2NBU A;  3SEB A;  2FIF A;  2JXT A;  4YWG G;  4YSX B;  2K8C A;  1GAQ B;  3LXF A;  3KWV A;  5J18 A;  4N6E B;  2GMI C;  4NJ7 A;  1MHX A;  2XNA C;  4YTP B;  2WDQ B;  1NEN B;  3V61 A;  2LRU A;  2Q5W D;  2M1M A;  2N7J A;  1ZKH A;  3CMM B;  4W9G A;  3AE1 B;  1EWY C;  4KZC A;  3V6E B;  2N1W A;  2L32 A;  2BBC A;  1QT9 A;  3KUZ A;  4MGK E;  4HRO A;  4F8C B;  1OFF A;  4BKT A;  2HJ1 A;  3ML9 A;  4GOC A;  3R7Q A;  3H7P B;  4PYU A;  1IPG A;  1E8Y A;  2AQ2 B;  1TY2 A;  3L10 B;  3DWM A;  5HKH A;  1G6J A;  3JW0 X;  1WGD A;  4JL9 A;  1JAL A;  2LGD A;  4C4V B;  2NBW B;  1D5M C;  3H7P A;  3ZJU A;  3DOW A;  2N7E A;  3DQV A;  4NJC A;  4B9K A;  3L17 A;  3WAP A;  1QZE A;  1JRP A;  4A20 A;  2Y5B B;  2MP2 A;  2KDE B;  2KQ7 A;  3ONS A;  2KK8 A;  4GB9 A;  4N9F 4;  1F1H A;  1UZX B;  4C4V A;  1XT9 B;  5T8I A;  3V05 A;  5CHV C;  5E6J A;  2JXX A;  3NG0 A;  1SE2 A;  1BML C;  4LK0 M;  3AE8 B;  4DHZ B;  3NY5 A;  4QAY A;  2RPV A;  4W9D A;  3M95 A;  1P1A A;  1KJT A;  2XN9 C;  2WHI A;  1YD8 U;  2CR5 A;  3FIL B;  2BS3 B;  1N60 A;  4K3C A;  3QX1 A;  3I3T B;  2UU7 A;  1WI0 A;  1WM3 A;  3NVW A;  2WXH A;  1V86 A;  3FIL A;  1ESF A;  5TR5 A;  4IWO A;  1WSP A;  1D6E C;  2J52 A;  4BZA A;  1WFY A;  3ECI A;  1FEH A;  3RD2 A;  2KZR A;  2JU6 X;  1WM2 A;  3TBL D;  1CJE A;  4HWI B;  3TEZ A;  1C79 A;  1V5T A;  3VVW B;  4DDI D;  2LD9 A;  1XCQ L;  2CHW A;  1I42 A;  4FA6 A;  3BK2 A;  5HG2 A;  2D5G A;  3VHT C;  2IND C;  4K81 A;  3X0W A;  2PE9 A;  1OQY A;  3R3M A;  3QWZ B;  3KQ4 A;  1RWS A;  2WU5 B;  1TZ1 A;  1R4N B;  1PDX A;  3A1Q A;  4A55 A;  3RNB C;  4WUR A;  1FRR A;  1T5X D;  3Q6B A;  2CHX A;  2WLB A;  4JE3 B;  2C9W B;  4A90 A;  1WX9 A;  3IXS A;  2J53 A;  1E9M A;  2OJW A;  2E3T A;  2K8H A;  3VXW A;  2JWU A;  3ZDT A;  3IFW B;  2CU1 A;  5I4D A;  4RMA A;  4TUU A;  2OHF A;  3TEW A;  4HK2 A;  1WXM A;  2KXJ A;  4LJO B;  2WXR A;  5LXH A;  2W54 A;  3H7S A;  4AS1 A;  2KN5 A;  4DK5 A;  3V3X A;  3R2I A;  1SE4 A;  2J0J A;  1ZOY B;  2CS4 A;  3IAS 1;  3CIR B;  3PO0 A;  2IO1 B;  3P63 A;  4IDI A;  2IZV B;  4MJS B;  3RCZ A;  2V9H A;  2VH2 A;  3NVV A;  1SF0 A;  2DWQ A;  2HE7 A;  4EZL A;  4L2Y A;  1VCB A;  4TKN A;  2R61 A;  4MJS A;  2M19 A;  1IGD A;  3A4R A;  1E7P B;  1WGH A;  4M01 A;  3QAQ A;  5G2N A;  2M0A A;  2K0P A;  2FCQ A;  1I4P A;  4LDT D;  1FFU A;  1OQQ A;  4N59 A;  4P16 A;  2I2Y A;  1VZ7 A;  2JRH A;  4OW0 A;  2I1J A;  2ASQ A;  4AJW A;  4OHJ A;  1WJ4 A;  3C0R B;  1FO4 A;  1T0S C;  3AE2 B;  2BS4 B;  2O6V D;  1E6E B;  2WXI A;  5FK9 C;  4DDG D;  2L76 A;  1TZO A;  2QCZ A;  4F7Z A;  4K7S A;  3ZXR A;  1Q1O A;  3DBH B;  1K50 A;  2LVP A;  2L52 A;  4WWO A;  3PLV A;  1YN5 A;  4MSM B;  4WH4 A;  4AUQ C;  1X1M A;  3WAM A;  2CJO A;  1QQR A;  3N1Y C;  3VRB B;  2WX1 A;  3SFD B;  5AUK A;  3U7D A;  2MX2 A;  2BTE A;  1MPE A;  2KC2 A;  3NZ3 A;  1J7A A;  1F2R I;  4WJN A;  3VTV A;  3EC8 A;  2AL6 A;  2KDB A;  2M4N A;  3P42 A;  1KF6 B;  2N9K A;  4MH8 A;  4KV2 A;  2WGS A;  4OVZ A;  5D94 A;  1D3Z A;  2KYW A;  1GJZ A;  1HZ5 A;  2J0M A;  4DWF A;  2JZ3 B;  1KTK A;  4JX1 C;  1PGB A;  1UGM A;  5C3J B;  1V6E A;  2CJN A;  1P3Q U;  2V4L A;  4W9E A;  4GXB A;  3PRM B;  2RDG A;  3PS6 A;  4I6P A;  5D2M B;  1ZPS A;  1VR9 A;  2ZNV B;  1J7B A;  4RFB A;  2INN E;  2LGS A;  4OZA A;  3AEC B;  3PGE A;  3ZRC A;  3BIN A;  2G45 B;  2K5P A;  1Y8R C;  2EMT A;  2JY6 A;  1YN3 A;  3KUD B;  3QCA A;  1JRO A;  3Q8A A;  3ZQ4 A;  3I63 C;  2DX5 B;  2DLB A;  2LXC A;  3P4P B;  4EEW A;  4I6N B;  2L00 B;  3HVZ A;  2Z0D B;  1OGW A;  3V60 A;  4RGN A;  1AAR A;  3DBS A;  2IYD B;  2K8B A;  3B0A A;  1WF9 A;  1AN8 A;  1L4Z B;  1WX8 A;  1J0G A;  4BKS D;  4FHK A;  4GDK A;  3NVZ A;  3X23 A;  4HDO A;  2RPQ A;  3DWG C;  4KX6 B;  1FCL A;  1FXT B;  4KDL B;  1IBX B;  4NQK E;  4AJY B;  3FC4 A;  2IY0 B;  1YJ1 A;  4ANV A;  3A9J B;  1J7C A;  1WYW B;  1C4C A;  1CZP A;  3HK0 A;  3VR8 B;  4P7I A;  2BYV E;  3BWU D;  4TV3 A;  1TIF A;  4YSY B;  3A9J A;  4IW0 A;  2M17 A;  2PE6 B;  3BYT B;  2BKF A;  1JW9 D;  1WR1 A;  2PIA A;  2B3A A;  3LYY A;  4DXG A;  4HPL B;  3E9S A;  3GE8 C;  4YSZ B;  1C9F A;  1L0X B;  1YX6 B;  1AW7 A;  3RNC C;  3PVL A;  3KH0 A;  4E3C A;  3P4S B;  2V3P A;  1TBE A;  2AQ1 B;  5BYR A;  5D6J B;  1ZGU B;  2LVQ A;  1SE3 A;  1N5X A;  4USA A;  3PPA A;  4BFR A;  1I4Q A;  2GBJ A;  2ACZ B;  4LLG M;  1KLU D;  2KFJ A;  1TKG A;  1WX7 A;  4RCO A;  1A70 A;  2BB5 A;  2Y5C A;  4ITK A;  3WAN A;  5G5G A;  1MHH E;  3M63 B;  1MG8 A;  4G3X B;  1HEZ E;  1UF0 A;  1K51 A;  2L05 A;  2K1F A;  2Z8L A;  4MGI E;  4KGT A;  2IGD A;  1XF5 L;  1EUV B;  1V8C A;  4FJV B;  4S0R A;  1LQB A;  2N9L A;  3AEF B;  2KJR A;  1NBF C;  3QC8 B;  3SHQ A;  2W3S A;  4GGQ A;  4LTU A;  3UF8 A;  1QOA A;  5DPS A;  1UBI A;  3OWE B;  2RD0 A;  5EDS A;  4OZB A;  2WXK A;  2L83 A;  4MEL A;  1NVI D;  4JGH B;  1V2Y A;  1KLV A;  5J17 A;  4LNN A;  3AH7 A;  2JZZ A;  4PK1 A;  3OJ3 A;  2IGG A;  2Y3A A;  2JSV X;  3T9L A;  1NI2 A;  4CQN A;  2AL3 A;  2L3Z A;  4XWT A;  3SU8 X;  3CST A;  2JUO A;  2MWS B;  2PEA A;  2ZCB A;  2RR9 A;  3P1M A;  2MBQ A;  3FAH A;  1UGJ A;  4M00 A;  5EE3 A;  3VUY A;  1FPY A;  2BKR B;  2UYZ B;  2R2O A;  3AI5 A;  4RF1 A;  2PJH A;  1AWD A;  4REZ A;  2O2V B;  1L6V A;  3VFK A;  2NPT B;  2YVC A;  2MA9 B;  3L4P A;  3ZNI D;  1PUT A;  2N0S B;  1YQ4 B;  2O2V A;  1TKE A;  3RUL A;  2VZK B;  3HIZ A;  3W5V B;  1L4D B;  2KNB A;  4O1N A;  4EKU A;  1EF1 A;  5G55 A;  1L0Y B;  2DYO A;  2KWD A;  1ROE A;  3N30 A;  4TQ1 A;  4ZHO A;  1F2R C;  4ZRI A;  1N6Z A;  5HI1 A;  1TS5 A;  2NBV B;  2ICI A;  1OEY A;  2IDY A;  3IHP C;  3L0W B;  1Q5W B;  1FXI A;  1KLG D;  1QOF A;  4XC2 A;  4JWU C;  1C4P A;  1NDD A;  2KWV B;  3AU4 A;  3C8Y A;  2A5U A;  4XGA B;  1ZDX A;  2YEP F;  3Q3F A;  1U4A A;  2OED A;  4N58 A;  1WIA A;  3C19 A;  2QMT A;  5CTR C;  3BZD B;  4GMV A;  3ZYY X;  2BS2 B;  3N9Y C;  1PQS A;  2EKI A;  2KJH B;  3IAM 1;  4P1C C;  5C23 A;  2KTR A;  2MRP A;  3N32 A;  2K3U A;  2FUH B;  4W9H A;  2MP2 B;  3V6C B;  3KWL A;  2EKE C;  2MHJ A;  3R7R A;  1UEL A;  1E8Z A;  3JSV B;  1JWU D;  2D11 A;  3A9K B;  2SEB D;  4HRS A;  4NZL B;  4CHK A;  1F52 A;  1P0R A;  2MH7 A;  3M62 B;  2MSE D;  3JSV A;  1SGH A;  2RDB C;  3GOE A;  1SEB D;  3EHV A;  3BK1 A;  5LNK 1;  3A9K A;  1ZE3 D;  1E8X A;  2M8S A;  1TYG B;  3TSS A;  3B1L X;  1OTR B;  2JPH A;  1I4G A;  1WGR A;  1I4H A;  1WXA A;  3RFZ B;  3VQI A;  3LB8 C;  1T0Q C;  1GPX A;  1N62 A;  3Q14 C;  1KFY B;  4M0W B;  1GC6 A;  2C7N B;  4WIP A;  4HKQ A;  4J3O D;  1WE7 A;  4OZC A;  3U7Z A;  4I6L B;  1PFD A;  2HTH A;  1P98 A;  1D5X C;  3PZ7 A;  1KM7 A;  4IM2 A;  4M0W A;  3ZNG C;  3PRZ A;  3R66 C;  3RNF C;  3ZVV A;  3ABV B;  2WU2 B;  2KDM A;  5JHB A;  2LGY A;  1TKY A;  2NR2 A;  1YMH E;  3B2G A;  1HXY D;  2IO0 B;  1SBB B;  3RI7 C;  4R3D A;  4PYZ A;  3AXC A;  2PKO A;  2BYF A;  1EU4 A;  1JCK B;  1XEE A;  1IP9 A;  5JHA A;  5IO9 A;  2NCN A;  2PTL A;  1SIJ A;  3A1Q B;  3RMK C;  3DBR I;  5BMG A;  2REX A;  4MSQ B;  4UDU C;  3S2A A;  2EEL A;  5D3D A;  1T0Y A;  2JT4 B;  2NTT A;  3E56 A;  2DZJ A;  1L2N A;  3TUO A;  3BII D;  3HHM A;  3VR9 B;  2QC8 A;  1WGK A;  1HTQ A;  1LGR A;  4L23 A;  3QAR A;  2DHZ A;  4WWP A;  4HPM B;  2KAN A;  2GRI A;  4DHZ E;  3RNA C;  2WDV B;  2OOB B;  2CKH B;  3A33 B;  4DHJ B;  1Q0W B;  4P1B C;  2FBW B;  4CO7 A;  4BOS C;  4IWQ A;  4LNF A;  1DGJ A;  2LUM A;  3TIX A;  4HLE A;  3AEB B;  3H1U A;  4WJP A;  4PS8 A;  4XDD A;  2LRW A;  2XBB C;  1JWS D;  1EM7 A;  3O13 A;  4RGO S;  4HJG E;  2KMC A;  3RNE C;  2V3S A;  1ZW7 A;  4II2 B;  1VD2 A;  2ZZP B;  1JML A;  1RFA A;  3EFC A;  3MP9 A;  5FR3 A;  4EZK A;  3AEA B;  1ACC A;  3B2F A;  2W3R A;  2KMM A;  4DXF A;  1FNW A;  1E0Z A;  2LGX A;  3APF A;  4C80 A;  2J0K A;  1YX5 B;  1ZXH A;  2HDE A;  3RT3 B;  3U30 A;  4MM3 B;  1SJH D;  3DVN U;  4L1B A;  3GZN I;  2V4I B;  4ZDV A;  4LNK A;  2XK5 A;  3HUI A;  4MM3 A;  1R4M I;  4E74 A;  3T3N A;  5CHF A;  3VUW A;  3W1S C;  2LXA A;  4GDL B;  1M94 A;  1EWC A;  2G9H D;  2MLB A;  4GSW A;  3ZLZ A;  5BMH A;  2BF8 B;  4X57 B;  1IYF A;  3DPD A;  3WCQ A;  4ZYS A;  2D3C A;  5IA7 A;  3AEE B;  1I35 A;  4GDL A;  1JQ4 A;  5BO4 B;  2DYB A;  1L7Y A;  2CHZ A;  3W1S A;  4KGR A;  3P4Q B;  1H8C A;  2LHE A;  2KLG A;  3VH4 B;  4A6Q A;  4XWW A;  3AE3 B;  4XX5 A;  4GIV A;  4XYC A;  1L5P A;  1WJN A;  2C60 A;  2BVC A;  3Q3O C;  3U4E G;  4NQL B;  1T3Q A;  2V3N A;  3M3J A;  5BYS A;  2WDR B;  2IO2 B;  3TEY A;  2G4S A;  2X8X X;  3ZUN A;  3L08 A;  1L6U A;  3DHG C;  2KFK B;  1STE A;  1KOT A;  1TY0 A;  2KDI A;  2ZCC A;  2K6D B;  3PHW B;  3OG5 A;  1CK1 A;  1D5Z C;  2NS5 A;  1MJD A;  1J19 A;  3IVF A;  3Q8B A;  2KFK A;  2GLS A;  2N4F A;  3WAO A;  3DBL B;  3CWI A;  2JF5 A;  4EFO A;  5AUI A;  5FKA C;  4BAX A;  5L83 A;  3MC0 B;  3W9C B;  2Z59 B;  2O6V B;  2WX0 A;  3AUL A;  2AQ3 B;  3SD5 A;  5IAA C;  1ISN A;  5J2R A;  3MFG A;  2FE8 A;  4ZOH C;  4W9K A;  1LO5 D;  2WNM A;  1N63 A;  2O6V A;  4M02 A;  2QEJ C;  3EUB 2;  2KD0 A;  3MC9 A;  2AWT A;  4JLC A;  2IBI B;  3KW5 B;  2HTM E;  4HCN B;  1ENF A;  1XLN A;  3Q8C A;  4ARI A;  1ET9 A;  4KDI C;  1ZP0 B;  5FR6 A;  2DZI A;  4Q2J A;  1I7H A;  4FXC A;  3AE4 B;  2N1V A;  2M56 B;  4GDK B;  3ZNZ B;  2PW9 A;  1WE6 A;  3AE9 B;  2CU3 A;  4RM8 A;  2IPK D;  3Q3J A;  3Q3N C;  1E8W A;  1V1O A;  4ICV A;  3HM3 A;  1FFV A;  2K22 A;  2DAF A;  5JZE B;  2LWP A;  1SXT A;  1N5W A;  4NPN A;  1SJE D;  1UNS A;  4J6I A;  2OJR A;  2FUG 1;  4JPS A;  2KKC A;  3Q8E A;  2UWQ A;  2BYE A;  3T3O A;  4HKZ E;  4E71 A;  3ZJT A;  3MC8 A;  2XEW A;  3L16 A;  1XD3 B;  1Y56 A;  4RF0 A;  1SIF A;  3I9V 1;  1V49 A;  1YJJ A;  1R7S A;  1CMX B;  3QA8 A;  2LHD A;  3ZTC A;  1PGA A;  2LI5 A;  1GB4 A;  4NJ6 A;  2NTS A;  1UWM A;  1I4X A;  3NS1 A;  2JYE A;  1NI3 A;  1Q10 A;  1LXD A;  3N3K B;  2INP E;  2FCS A;  2FCN A;  4XDC A;  1R4N I;  2FCM A;  2WXJ A;  3RYT A;  3RNG C;  4RGT A;  3VUX A;  4IUM B;  3NZS A;  2DAJ A;  2WXP A;  4W9J A;  2BQQ A;  2L0F A;  3VTW A;  3ZJV A;  4ARC A;  4HDQ A;  4RM9 A;  2LEK A;  3EGR A;  4JWS C;  3NJT A;  4ANU A;  5DPW A;  3APD A;  1V80 A;  4HJK A;  4BKS A;  2BWE S;  3UQA A;  1FIQ A;  2GB1 A;  2W82 A;  1C1Y B;  1LFD A;  2C5L C;  2KX0 A;  3HRD D;  2ZW1 A;  3ALB A;  1JWA D;  5L95 C;  3L13 A;  1SSN A;  2KN4 A;  1QKZ A;  4TQ0 A;  1I4R A;  5KHQ A;  1AYF A;  2G1E A;  3PV1 A;  1GOZ A;  1UUP A;  2ON8 A;  2JRI B;  1EU3 A;  3FKY A;  2D2Q A;  3J9C A;  2IO3 B;  3H8H A;  4HEA 1;  3K9O B;  1VJK A;  5E6O A;  3KVF B;  4KSK C;  4IC7 B;  4P6V F;  1HA5 A;  4LJP B;  1S3S G;  1P9D U;  4BBN F;  2MBH A;  3IG3 A;  4C7Y A;  2RMM A;  4BKG A;  2QHO A;  1VZ8 A;  2WXQ A;  4AOF A;  1FCC C;  3LDZ E;  4C00 A;  5C2T B;  1WY8 A;  2RDH A;  3PZ8 A;  5KHO A;  2GI9 A;  2KC1 A;  3ZXV A;  2WXL A;  2L1A A;  3CSF A;  3DBH I;  1JWM D;  2V0G A;  3T8M A;  1DOX A;  2W9N A;  5D7G A;  1WGG A;  2JX5 A;  4XZ4 A;  3MHZ A;  1P7E A;  4LNI A;  4II3 B;  4BOZ B;  4RH6 A;  1S1Q B;  4DXA B;  4A3P A;  2LUE A;  2N9E B;  1WWT A;  2TSS A;  1H4R A;  2KQ4 X;  4FAD A;  4PS7 A;  2MW5 A;  3Q69 A;  4G50 A;  4YTM B;  1N61 A;  4US9 A;  4MEM A;  2IY1 B;  2J42 A;  4A9A A;  3GB1 A;  1HZ6 A;  3UIO B;  2LJI A;  2PLP A;  5E6N A;  5AZG A;  4ZRP A;  3URY A;  1C77 A;  3PTF C;  1GNU A;  3RPF C;  5CX3 A;  2LVO A;  1NYR A;  1SB3 C;  4B6W A;  2ZVO A;  5IKC M;  2HD5 B;  2C7H A;  5G5H A;  4GN1 A;  3AN1 A;  2KTR B;  3VH3 B;  4GU2 A;  2KMA A;  2DYM A;  1YIW A;  3JYU A;  3GE3 C;  4LCD E;  2JVC A;  3W1Y A;  5HHD G;  1WYG A;  3Q2A C;  4FN2 A;  5DPT A;  1XQQ A;  2DNF A;  3TCA A;  1RYJ A;  3L54 A;  2ONQ A;  4ZRQ A;  1EO6 A;  3EFU A;  2BW2 A;  1RLF A;  2ZW0 A;  2R2Q A;  1WZ0 A;  2MCN B;  4WJO A;  4FJZ A;  1GB1 A;  3UI3 A;  4ACF A;  2H89 B;  3B08 A;  2KWU B;  2BWF A;  5D3I B;  1RRB A;  3N20 C;  1XLQ A;  2DEN B;  2KVZ A;  4ANX A;  4H2A A;  3LJ3 A;  4A3O A;  1V97 A;  1FMA D;  3PRE A;  5C1Z A;  3TL5 A;  2K39 A;  1UWX A;  3KUC B;  4FLH A;  4CYE A;  4EZJ A;  3PHX B;  5LLI A;  4LNO A;  1DOY A;  1UD7 A;  2KQS A;  1WGY A;  3KLS X;  4DHJ D;  3D32 A;  2WXG A;  4HPP A;  4WAF A;  1D4B A;  3AM9 A;  1UH6 A;  4BVU C;  4BBN C;  1WJ6 A;  2KVR A;  2DZK A;  2ZPN A;  2HJ8 A;  1GG3 A;  4YL8 A;  4AQ7 A;  3ZO5 B;  1GUA B;  5AZF A;  1WRD B;  3A4S C;  4WQO B;  4W9I A;  4IM3 A;  3ZTD A;  4W9L A;  2D3B A;  4B95 A;  2ZVN A;  1VDV A;  4G0N B;  3DVN V;  2PVG C;  3MJW A;  3MJ5 A;  1JRU A;  4K1R B;  1XO3 A;  4WWM A;  1T6B X;  1NYQ A;  4K3B A;  3RZF A;  4W9F A;  1TS2 A;  2QSD A;  3PT2 B;  1K52 A;  1VLB A;  3BVZ A;  1JWB D;  2KAJ A;  2NMQ A;  3AED B;  4NAW B;  3Q8F A;  1GC7 A;  2WXF A;  4C7Z A;  1V1P B;  1IGC A;  5DCN A;  3VDZ A;  4IWP A;  4NAW A;  2BYT A;  3RUI B;  1QF6 A;  4WAA A;  4C56 C;  5H8Y E;  4MH0 E;  1ZDV A;  2GBK A;  4FJY A;  1WXV A;  1V1P A;  5TSS A;  2SAK A;  2BB6 A;  1HQR D;  4MGY E;  4FBJ B;  1RAX A;  2ZPY A;  3KYC D;  4WWN A;  2D07 B;  2VRR B;  2WS3 B;  2YEP B;  5GMV A;  4ANW A;  3O65 B;  3KYD D;  5E6P A;  1FXA A;  2PPH A;  4JIO U;  4NY0 A;  1XLP A;  2A4Z A;  3GS2 A;  1MVK A;  3Q3M C;  2RSU A;  2K25 A;  3VRA B;  1F0Z A;  3I5J C;  1WXQ A;  1C3T A;  2WXO A;  1TT5 B;  2MJE A;  2PVO D;  4A8X C;  1T0R C;  2XK5 B;  3DCG A;  5EE9 A;  3ML8 A;  1B9R A;  3JVZ X;  2GBN A;  1Z5S B;  2N7D A;  4AWJ A;  1TS4 A;  4F1S A;  3ZIM A;  5JH5 C;  3N1X C;  2KWC A;  2J7Q B;  3BYY B;  1Z2M A;  1ET6 A;  2KX3 A;  1HTO A;  2RGF A;  4MDK E;  3TMP B;  3TEX A;  2V1Y A;  4NNJ B;  4KKI A;  3B9J A;  1V5O A;  3AU5 A;  1MI0 A;  3UIP B;  3ZGZ A;  1MG4 A;  3QIJ A;  1WRI A;  3UQB A;  2Y5P A;  1XXG A;  3SDL C;  1FNU A;  1OEY J;  4EUT A;  1ZUD 2;  2BGF A;  1HE8 A;  2X38 A;  1NEK B;  4RNA A;  5CHW A;  1RFK A;  4YXD B;  1C78 A;  2J4X A;  1TJE A;  3PLU A;  4WJQ A;  2MJD A;  2LMC A;  3DDC B;  1FRD A;  1QLB B;  5H92 C;  1KH0 A;  3AMZ A;  2KJ6 A;  2BPS A;  1C76 A;  1FM0 D;  1TS3 A;  2L0T A;  3W5U B;  1YN4 A;  3P2B A;  1V81 A;  3H6N A;  1M4V A;  2QDF A;  3HVD A;  4LDT B;  2D10 A;  2N9P C;  3NOB A;  2GBR A;  3NZU A;  3R2T A;  1WR6 E;  2ZJD A;  4KKJ A;  3RZW C;  1WMH B;  5AEK B;  1E90 A;  2KTF A;  2MBB B;  2WXN A;  2AYO B;  2KOX A;  4OVU A;  2YLM A;  4S17 A;  1CQV A;  1WMH A;  3AB5 A;  2ZNV C;  4PT5 A; 
#chains in the Genus database with same CATH homology
 2QDF A;  2V9H A;  2VH2 A;  3MC9 A;  2X8X X;  3EFC A;  4K3C A;  4PK1 A;  4C00 A;  2VH1 A;  4C4V A;  4K3B A;  3MC8 A;  3Q6B A;  3OG5 A;  4XGA B;  4QAY A;  3NJT A;  2QCZ A;  2MHJ A;  4C4V B;  4BZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...