1A70A

Spinach ferredoxin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
97
structure length
97
Chain Sequence
b'AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN
publication title Structure of the mutant E92K of [2Fe-2S] ferredoxin I from Spinacia oleracea at 1.7 A resolution.
pubmed doi rcsb
source organism Spinacia oleracea
molecule tags Iron-sulfur protein
total genus 22
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 1998-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1a70A00
2K9XA 1DOYA 1J7BA 4N6EB 1RM6C 3AEAB 5EE3A 3VR9B 1JROA 2WDVB 3HUIA 3RPFC 1JRPA 1QF6A 1WYGA 5C2TB 3VRAB 2CJNA 1TKGA 2BS3B 4N59A 1FIQA 1YQ3B 1E6EB 3FC4A 1SF0A 3PO0A 5H8YE 1JW9D 2B76B 1FFVA 2WDRB 3AE1B 1V97A 3AEGB 4WQMA 1E9MA 1NENB 1ZUD2 2QIEB 3ABVB 3AMZA 4WWMA 1RYJA 3AE5B 1IUEA 4YXDB 1E10A 3B2GA 1J7CA 1KF6B 4JWUC 5C3JB 2H89B 1YJJA 1DOIA 1VDVA 2Q5WD 1WXQA 2L83A 2WS3B 1OQQA 1WRIA 1YJIA 4ITKA 2W54A 2MJEA 1N5XA 1FMAD 4JWSC 1ZOYB 2W3SA 3AE6B 1QLBB 1SB3C 2CU3A 3NRZA 3W9CB 1XLQA 1QOGA 2WP9B 1DGJA 3NVZA 1L0VB 1J7AA 1RFKA 2AX5A 2WU2B 1ROEA 4ZHPA 1OQRA 1TKEA 1B9RA 2DWQA 1FM0D 1PDXA 1QOAA 3AEEB 4YSYB 4C7YA 1DOXA 3DWGC 1JWAD 1ZXIA 4P6VF 4YTNB 1V8CA 1FXAA 3P4SB 1N62A 2LEKA 4YSXB 1F0ZA 1XLPA 5AUKA 1QT9A 2MJ3A 3AE9B 3DWMA 1FO4A 4YTMB 3CWIA 3AE4B 3B9JA 4YT0B 1L6VA 1NI3A 4FXCA 1JQ4A 3BIID 2ACZB 2L52A 2E3TA 1CJEA 3P1MA 4US9A 1T3QA 2WU5B 3AB5A 3AN1A 2M19A 3P63A 2HTME 1WGKA 3SFDB 1VJKA 2EKIA 4HRSA 3AH7A 3SR6A 3AEFB 2K5PA 3AE3B 1TKYA 1E0ZA 3P4RB 3ZYYX 3AE7B 1L5PA 1JALA 1NVID 2BS4B 4C80A 1VLBA 4ZOHC 2K22A 5EE0A 1UWMA 1I7HA 1GPXA 1SIJA 1AWDA 1RWSA 1TYGB 3AECB 2KAJA 3NVVA 5MPOA 1JWBD 5EE9A 4KX6B 1FRDA 3NS1A 2MH7A 3EUB2 4N58A 1KRHA 3HVZA 4LTUA 4USAA 3AEDB 2WLBA 2PIAA 1XLNA 5AUIA 1EWYC 1KFYB 1TJEA 3VR8B 4YTPB 2PKOA 3AM9A 2DBYA 2CJOA 2QJLA 3KWLA 1YQ4B 3SFEB 1NEKB 2M56B 1XO3A 2JX5A 4ZHOA 1A70A 3AE8B 5GXGB 1PUTA 1ZP0B 2JQRB 1GAQB 5EE1A 2Y5CA 5G5HA 5H92C 2MJDA 3HRDD 2OHFA 4US8A 1N63A 3ETRA 2BT6A 2H88B 3B2FA 4HROA 3L4PA 3NVYA 2PVGC 3LB8C 2BS2B 1NYRA 2KMMA 1NYQA 1QOBA 5G5GA 3AEBB 4JX1C 4A9AA 3CIRB 3WCQA 1FFUA 3W5UB 1CZPA 1R7SA 3AE2B 1OFFA 1XLOA 2N0SB 2FBWB 1N60A 2W3RA 3FAHA 3LXFA 1QOFA 1FXIA 3P4QB 1WWTA 2WDQB 2PVOD 2WQYB 1E7PB 1PFDA 4YSZB 3P4PB 3W5VB 1N61A 3VRBB 1L6UA 1FRRA 4IDIA 1N5WA 3AV8A 3NVWA 1AYFA 4C7ZA 2W55A 2G1EA
chains in the Genus database with same CATH superfamily
2K9XA 1E90A 1R4MI 1WR1A 1UD7A 3RPFC 1XT9B 1LGRA 2NS5A 2W9NA 4LK0M 4MGZE 1UBIA 3FC4A 3A9JA 2V3SA 1V97A 5BYSA 1HXYD 4GLSC 4W9HA 1WX8A 1ET6A 3CMMB 1QKZA 3NJTA 3URYA 3B08A 3IHPC 2W54A 4XWTA 1T5XD 3PT2B 4JWSC 1EM7A 1KM7A 4ZRJA 3JYUA 2AL3A 3A9JB 4XZ4A 4EUTA 1L7YA 1ZDXA 1FCCC 2J7QB 4OZCA 5BO4B 3UI3A 1C1YB 1FXAA 2KC2A 1XLPA 1F0ZA 3ZXVA 2BF8B 2XK5A 1QT9A 1WM3A 2MJ3A 3W1SA 2GOWA 2JVCA 2I2YA 4I6LB 3R2TA 3WANA 2L52A 3RNCC 2ASQA 1ACCA 2K25A 1TKYA 2FUG1 3PZDA 4BAXA 1TGZB 3T8MA 4PT5A 3NVVA 1SJHD 3RN9C 3ZO5B 1JWBD 2JYTA 2XK5B 3ZW3A 3BVZA 1KRHA 4USAA 1UELA 3WA0A 4L2YA 2NPTA 3C8YA 2MRPA 2KNBA 2KT7A 3BYTB 1ZP0B 5BMGA 5BYQA 1VCBA 3B2FA 2J4XA 3SEBA 2IO3B 1XLOA 1MPEA 2NPTB 2AL6A 2GLSA 4JIOU 2IO0B 3QAQA 2WNMA 1A5RA 1IGDA 1WGRA 1SBBB 2G1EA 2N9EB 2WXFA 3VR9B 1WYGA 3EHVA 1TKGA 3OLMD 1FIQA 5FR3A 2BYFA 1JW9D 2ZCCA 2EMTA 4YXDB 2Y5PA 3OG5A 3U52E 2KHWB 1WXQA 4ZDVA 1OEYA 2GI9A 3M62B 2DZKA 2BQQA 3PVLA 3MJ5A 4DXFA 3FILA 4LCDE 4HVBA 2LGDA 5JXVA 4CYEA 1F9JA 4RGMA 1ROEA 4IM2A 4GXBA 1FM0D 1OTRB 1OQYA 4BVUC 3PRMB 2KLGA 3TBLD 4ZRPA 3FILB 3RCZA 3AN1A 2R61A 1P7EA 1VJKA 1AN8A 1I7HA 1M4VA 4WQOB 5BMIA 1J8CA 2KOXA 4KSKC 2C60A 2I1JA 4RH6A 4B95A 1VD2A 1VZ8A 1IGCA 2JX5A 2V0GA 1JRUA 3VUWA 2N1VA 4FLHA 1I35A 2DYBA 3V05A 4AJWA 3L54A 4REZA 2BGFA 1X1MA 2YEPB 2LFIA 3WAPA 4M02A 2RDHA 3FAHA 3LXFA 2OJRA 4ASWC 1PFDA 1M94A 4PS8A 3Q6BA 2KANA 3KYCD 2LUEA 3HUIA 3IT6B 4WQMA 2BWFA 1E10A 1IUEA 1TZOA 2KYWA 3AU4A 1VDVA 3QHTA 4ZRKA 3UGBB 4ITKA 4KGRA 2QC8A 5HKHA 1I4HA 2AQ2B 4K7WA 3MP9A 3TUOA 4AOFA 3NRZA 4FJZA 2GRIA 2WP9B 4ZHPA 2DWQA 1QOAA 4YSYB 4DDID 4XDCA 2WXPA 2R2OA 4LLGM 4YTNB 3EGRA 5LNK1 2QEJC 3L0WB 1N62A 1SE2A 3GP7A 4G50A 2VH2A 2GBKA 4XE0A 3DBRB 1FO4A 1WM2A 3Q3JA 1L6VA 1JQ4A 2E3TA 1B1ZA 4CHKA 4MH0E 2INDC 5HHDG 1SIJA 4IG7B 3VH3B 1E8ZA 1XCTL 4RMAA 4WURA 1XLNA 3IXSA 2CHWA 2K8BA 3KYDD 1KFYB 2D3BA 3NY5A 4EEWA 2QCZA 4M8NA 1C77A 4AS1A 3M95A 1SEBD 2DHZA 1WYWB 1N63A 2LJ5A 1P9DU 2IZVB 5G5GA 4L23A 3CIRB 3WCQA 4HJKA 4FHKA 1K8RB 3QARA 3AE2B 3PRPB 1V5TA 4RM9A 1FXIA 3AI5A 1FEHA 2VZKB 3ZKJC 1RFAA 3Q8BA 1N5WA 3AV8A 4WIPA 2W55A 2WXNA 2HJ8A 5G55A 1DOYA 5EE3A 1ZPSA 2JY6A 1ZGUB 3N20C 2D10A 1YX6B 2YLMA 1YQ3B 2MLBA 1C4AA 1YJ1A 5H8YE 3AEGB 5G2NA 4JL9A 1CK1A 1J7CA 3L16A 1E8WA 4L1BA 4BZAA 2PJHA 4C4VA 4XYCA 1FMAD 2LRWA 2HD5B 1KH0A 2WX0A 2CU3A 4WJPA 3N3KB 1B9RA 2KXJA 2N7JA 2XBBC 1DOXA 2V3PA 2KC1A 3P4SB 4NQLB 4C4VB 3B9JA 4FXCA 4HPLB 4W9GA 3AB5A 1K50A 2LZ6A 1S3SG 2JZZA 2V1YA 1JALA 5KHQA 1VLBA 1V86A 4BFRA 3KQ4A 3O65B 3EFUA 2IGHA 4LDTD 3RMKC 2EKEC 2MH7A 1HEZE 3NHEB 4N58A 4OZBA 3VR8B 2N7EA 1I42A 1ET9A 2NTSA 2OOBB 1C79A 4NZLB 3PHXB 2PE6B 4YL8A 2OHFA 2RDBC 2GBJA 4F8CB 3VTVA 2LASA 3JSVA 1XEEA 1GC6A 3E56A 3AEBB 4AWJA 2X38A 3W5UB 3VUXA 1L4DB 3ZDMC 1WWTA 3K9OB 3IVFA 2QILA 2ZPNA 3QQ8B 3JSVB 1LFDA 3BY4B 4MSMB 4A3OA 2AQ1B 1EU4A 4ICVA 3R3MA 5D3DA 1KLGD 4TQ1A 1TT5B 1QZEA 2DAJA 5FK9C 2BYTA 2L83A 5HFYA 3R8BA 1GG3A 2CS4A 3ENEA 2MJEA 4OW0A 1HZ6A 2C9WB 2MSED 2MCNB 4ARIA 4ICUA 1OQRA 3Q2AC 1WH3A 4CO7A 2JZ3B 4AJYB 4P16A 3VVWB 2ZJDA 4II2B 4NPNA 2ICIA 3ZLZA 1TS2A 3DWMA 3QJZA 2KDEB 3SHQA 1GB1A 4NJ7A 2BYVE 2L8JA 2CKHB 1T3QA 3SFDB 3TEYA 1BXTA 2K5PA 3ZYYX 2KZRA 2KTRA 4TKNA 5MPOA 1WGGA 1L2NA 5L83A 2LGXA 1IYFA 5CTRC 3AE8B 2G45B 5H92C 3KW5B 2KTRB 4AQ7A 4HROA 3NVYA 2BWES 1NYQA 4LJOB 4X57B 1CQVA 2PE9A 2JYEA 3D32A 1R7SA 2MWSB 1L4ZB 2JRIB 2N0SB 1N60A 1T0YA 4PYUA 2JPHA 3DVGY 1YD8U 1ISNA 3W5VB 1D3ZA 4XC2A 2FCSA 2WXRA 4HWIB 3VH4B 3MC0B 2YVCA 4LNFA 1SF0A 3PO0A 2B76B 2WDRB 3ZIMA 2R2QA 1EWCA 3WAMA 1E9MA 4AUQC 1RYJA 2FCQA 1JWMD 5C3JB 2Q5WD 4JE3B 2MHJA 1MHXA 1TIFA 3RNGC 3N32A 3PLVA 3PS6A 5IAAC 1UGJA 3DDCB 4OVUA 3V60A 1D5MC 2KDMA 1TZ1A 3CSTA 2CHXA 1MG8A 4YSXB 2UYZB 2V4LA 4YT0B 4C56C 1NI3A 1ZE3D 2PMVA 4WAFA 3P1MA 3KH0A 5I4DA 4US9A 1V81A 4BKSD 2LGSA 1E0ZA 3OJ4B 2KTFA 2G9HD 1LO5D 2JT4B 2RDGA 3AECB 1R4MB 2Y5BB 1TY2A 2KWDA 3HVZA 3BYYB 2WLBA 4GSWA 3LDZE 3PRZA 4W9FA 2QJLA 1YQ4B 2MBHA 3V6EB 2WWZA 5CHFA 1IBXA 2JRHA 5T8IA 3SDLC 2PTLA 3ZNZB 1YNTE 2HE7A 2ZVNA 1HQRD 1KLVA 1FFUA 3HK0A 4IWOA 4K3CA 3A9KA 2BVCA 2KMAA 1L0XB 3V62A 3JW0X 2QDFA 2L05A 2PVOD 1E7PB 2LI5A 3A4RA 4YSZB 5JHBA 1WY8A 1IBXB 4ACFA 4C7ZA 1C4PA 4GIVA 5AZHA 1WXMA 4ZRQA 2WXIA 1DYQA 4I6NB 3A9KB 4TV3A 2M0AA 3DBHI 3L17A 3A1QA 4YTPB 2UU7A 1ZXHA 3BINA 3PREA 1F2RI 5L95C 3Q8EA 2XEWA 3KVFB 3ZDTA 2SEBD 3O13A 4MELA 5D94A 4A20A 1YJIA 5DPWA 3MHSD 3VAWA 4LJPB 3UQBA 2KD0A 5CHVC 4GB9A 1ZOYB 5HG2A 2LHEA 3AE6B 1SB3C 3W9CB 1E5WA 4OVZA 3A1QB 2WU2B 4HCPB 2REXA 4K81A 3EECA 4W9DA 1YMHE 4S17A 2D3GA 5DCNA 2V9HA 4J6IA 3R7QA 4NJCA 1P1AA 3AE4B 5D3IB 3C19A 4DHZB 3Q3OC 2N9XA 3IAS1 2N1WA 2WXGA 3AE3B 1S1QB 2N7DA 3UIPB 1UWMA 3B1LX 3EUB2 1VR9A 2KN4A 4RFBA 2PIAA 2WXOA 1RRBA 2NBVB 2KO3A 2RD0A 2JWZA 2MX2A 1LXDA 1XXGA 4G3XB 1UUPA 3X0WA 5HI1A 4IWQA 4E71A 4K7UA 4IW0A 4DBGA 2LGIA 2I1KA 5E6PA 2A5UA 4HDOA 1WXAA 4RGTA 2LVQA 4OZAA 2INPE 3N1YC 2LUMA 2IDYA 2KVZA 3I5JC 4DDGD 4LNIA 4EZJA 4KIKA 2C5LC 1R4NI 2C7MB 2O2VA 3PLUA 3VRAB 1WF9A 2CJNA 4W9LA 1E6EB 1WX9A 4GU2A 3LYYA 5LXIB 3KUCB 3R66C 3EA6A 4WWMA 3AE5B 2LVPA 4ANUA 1KF6B 5CX3A 1DOIA 1OQQA 3PSEB 1WRIA 4WWNA 3HM6X 2C7NB 2L0TA 4KIKB 2O2VB 1N5XA 2KX3A 2O6VA 2LMCA 2DAFA 1V49A 3QCAA 3RZFA 2KDBA 4FADA 3NZUA 1V1OA 3Q69A 3W1YA 4BOZB 4P6VF 3TJPA 2LEKA 2KN5A 4MM3A 4URKA 5C1ZA 4XGAB 2O6VB 3BIID 4MH8A 4WWPA 3RNAC 3WIMA 1CJEA 2ZEQA 4LDTB 3P63A 3AH7A 1P98A 3AXCA 2G4DB 1UZXB 1ESFA 4IWPA 4GN1A 3H1UA 4QAYA 2VH1A 3NS1A 4I6PA 5IA7A 2NTTA 4MM3B 1MHHE 2KX0A 4BOSC 2FCNA 4TQ0A 5TR5A 2PEAA 1EF1A 5GXGB 1WJNA 2JQRB 2PW9A 1MG4A 3NUHB 2L7RA 1F1HA 5GMVA 4US8A 3QIJA 2H88B 1JMLA 3PTFC 1GB4A 2WX1A 4BBNC 1V6EA 3IAM1 2IY1B 1F2RC 3B0AA 4IUMB 4WJQA 2W3RA 2K3UA 3SU8X 3U2SC 3OAWA 3NVWA 2IBIB 1AYFA 4R3DA 1RM6C 3V61A 3NS8A 3DHIC 1K51A 4NJ6A 1WMHA 1TS3A 4KKJA 2L0FA 2DZIA 5IN7A 4M8MA 3AMZA 3ABVB 2DNFA 1YJJA 1Y8RC 2JXTA 2RMMA 2L76A 4II3B 4DK5A 5IO9A 1P0RA 4FN2A 1WMHB 4C00A 4KVGB 1PGAA 4WWOA 2K0PA 5CHWA 1DGJA 3Q8CA 1L0VB 2FIFA 2RPVA 1SJED 3KUZA 5DPTA 3PV1A 1FNUA 2E6XA 3L10B 4HDQA 2AEHA 4B0EA 1GUAB 2AQ3B 1C3TA 4MGKE 2GBRA 3RYTA 5BMHA 2WDTB 3QC8B 2CR5A 4HJGE 2M19A 2GMIC 2Z8LA 3DBLI 3P4RB 4FA6A 2W82A 1EF5A 3AE7B 2WXQA 4RF1A 4F1SA 1E7UA 2INNE 2Z0DB 3ZQ4A 2X8XX 2OJWA 1EWYC 3ONSA 1TJEA 3VDZA 2BB6A 2JUOA 1BUIC 2NBUA 2D2QA 4PS7A 2M56B 4NAWA 3APDA 1PUTA 5IKCM 4A3PA 1NDDA 3SD5A 4B9KA 3DQVA 4JGHB 1C76A 4N9F4 2KFJA 4ZHOA 3CSFA 5IOIA 3VHTC 1P3QU 1WR6E 2M17A 4XDDA 3DHHC 1TY0A 4WJNA 2WDQB 4NAWB 1G6JA 2QHOA 4IDIA 4WAAA 4DHZE 3T9LA 1J7BA 1SXTA 1QF6A 2N4FA 2HJ1A 1JWUD 4N59A 1UH6A 3DBSA 4TUUA 1IPGA 1MI0A 2WXMA 1N6ZA 3T3NA 4HEA1 2KVRA 3B2GA 3MJWA 3ZRFA 1JCKB 3X23A 2DZJA 4EZLA 4KGSA 4BKSA 1C9FA 4DQOC 2JWUA 3OJ3A 1JWSD 3RFZB 4AP4C 1AARA 4Q2JA 3RNBC 4B0MA 1T0SC 4JLCA 4K1RB 3IG3A 1RFKA 3GOEA 1TKEA 4FJYA 1PDXA 1I4XA 1JWAD 2D07B 4HPMB 5AUKA 3N1XC 3MC8A 4OVVA 5J2RA 2M4NA 2WGSA 1J0GA 1J19A 2DYMA 2YEPF 3FKYA 1YN3A 2PLPA 2J0JA 4MGIE 5DPRA 4EKUA 3E9SA 2V4IB 3ZNID 5EE9A 3V3XA 1EO6A 3AEDB 4P7IA 4RCOA 5AUIA 3IT4B 1C78A 4A90A 3SFEB 2A4ZA 2RSUA 3DVNV 4RF0A 3ETRA 4K3BA 5E6NA 5TSSA 1GOZA 3ALBA 4G0NB 1TS4A 3VQIA 3J9CA 3P4QB 3VXWA 3ZNGC 3I3TB 3R2IA 3LJ3A 3H9DA 2KMMA 2KWVB 4N6EB 2JZPA 1JROA 4NQKE 1FPYA 1WIAA 3GB1A 1K53A 1Y56A 4FULA 4IC7B 1XCQL 2INCC 2M8SA 1HA5A 3IFWB 2MP2A 1V80A 1F77A 4RGNA 4NAMA 3VTWA 1SE4A 2IY0B 3RT3B 2EMSA 1WGDA 4HPPA 1EU3A 2DLBA 1XF5L 2N9LA 2MP2B 2ON8A 2Z0EB 1IP9A 1PGBA 1STEA 1PYWD 2CU1A 2EKIA 3AEFB 3VUYA 3I63C 5AZFA 2BYEA 2NMQA 1AWDA 2OEDA 1LM8B 2FUHB 4F7ZA 2XN9C 2J42A 2MBEA 3H8HA 3M63B 1FNVA 2CJOA 1VRAB 2BB5A 1XO3A 2MJDA 3ZVVA 1UNSA 5IP4D 3N9YC 3S2AA 1NYRA 1QOBA 4JPSA 4HKQA 1WZ0A 3UQAA 2D11A 1CZPA 4DXAB 2FE8A 4K7SA 4GMVA 2QSDA 3NG0A 3HM3A 1E8YA 2FNJB 2KJRA 4ZYSA 4IM0A 2XNAC 3NOBA 1YN4A 1N61A 3TL5A 4MACA 3RI7C 4W9CA 2ZNVC 2BKRB 5D7GA 4ANVA 2D3AA 1WJ6A 4ARCA 3AEAB 2JXXA 2RGFA 2WDVB 2K8HA 3APFA 1I4PA 4NNJB 1Z2MA 4JQWC 3AE1B 1NENB 1T0QC 4FBJB 2ZW1A 1T6BX 2D5GA 2WS3B 3KLSX 2Z59B 3AULA 4A55A 2HTHA 5LXHA 1QLBB 2AWTA 2MQJA 2K6DB 4D2KA 1HTQA 3ZTDA 3PHWB 4IOIE 3DWGC 3QA8A 4MDKE 1GJZA 2CHZA 2KFKA 4MSQB 3AE9B 3CWIA 4GDKA 1I4QA 2WXLA 1WGKA 5KHOA 3IBEA 2RPQA 4J3OD 4DHJD 1NVID 3Q14C 2K6QA 3MTNB 2LVOA 4TMAB 2KFKB 3DVGX 3PZ7A 2BPSA 3DBHB 4M01A 2DBYA 4GDKB 2GBNA 3KWLA 2FAZA 1HTOA 1QILA 2IGGA 2WYQA 1NEKB 3U7ZA 3TEZA 3PPAA 3KWVA 3Q3MC 3C0RB 5JZEB 1OEYJ 1P7FA 1RLFA 2PVGC 4MJSA 3DCGA 2J0KA 1ENFA 1UGMA 3TEXA 2MEKA 1FXTB 4W9EA 4GGQA 4LNOA 3P4PB 3Q3FA 3RZWC 3M3JA 4NY0A 2KQSA 1WGYA 4MJSB 2BTEA 3HHMA 1OGWA 1YN5A 4GOCA 2KJ6A 4MEMA 1WXSA 1FNWA 1WE7A 3ZTCA 1MFWA 2KLCA 1WJUA 2IGDA 2I38A 1YIWA 4KDIC 1I4GA 3AU5A 3DPDA 3GE8C 2BBCA 2L1AA 2KWCA 3NZSA 3QX1A 5JH5C 2W3SA 3ZRCA 2UWQA 4KDLB 3NVZA 1XQQA 3PZ8A 2D3CA 4C7YA 4LNNA 2MA9B 2KKCA 3BVGA 3U8ZA 5AZGA 5DPSA 4PK1A 2WHIA 3TIXA 3P2BA 3UIOB 4TSSA 3MFGA 4HLEA 4ZYNA 4GDLA 4ZOHC 3L08A 1RWSA 3MHZA 1PQSA 5BYRA 1R4NB 1H4RA 2PPHA 3ZJTA 2C7HA 2PKOA 3WALA 4PS3A 5EE1A 4EE2A 3QWZB 4GDLB 3DHGC 2JF5A 3L4PA 3W1SC 3I57A 4B6WA 2BKFA 4XWWA 3DBRI 2MBOA 3ML9A 3QK0A 3BZDB 4EFOA 4RGOS 1K52A 1L6UA 1FRRA 4OHJA 4RM8A 5J17A 3Q8FA 4KZ0A 3NZ3A 3RD2A 4RNAA 5C2TB 4G11A 4MT5A 3ZJUA 2SAKA 4KGTA 2M1MA 3VRBB 1NBFC 1ZUD2 1D6EC 2QIEB 2AYOB 2MW5A 3Q3NC 3W2DA 1XD3B 4JWUC 4DXGA 2DYOA 1KJTA 2HDEA 1AW7A 3HVDA 2L32A 3HIZA 2N9KA 1Q1OA 1HE8A 2IJ0A 2KDFB 5LLIA 4KV2A 3U7DA 1ZKHA 2ZVOA 2LD9A 1J7AA 1I4RA 1WRDB 1WZ3A 1UBQA 4FJVB 4P1CC 3GS2A 1D5ZC 2QMTA 4P1BC 2IPKD 2KWUB 2ONQA 3A33B 5D2MB 4LNKA 2L00B 3RULA 2L3ZA 2MBBB 2K8CA 2KDIA 3PGEA 4E74A 4HRSA 4HCNB 5EDSA 4HXDA 3H6NA 3TSSA 2K1FA 1GPXA 3WAOA 1TYGB 2KAJA 1EUVB 1FCLA 2KK8A 4KX6B 1WJ4A 3ZXRA 1WGHA 3N1ZC 3AM9A 3A4SC 1GC7A 2ZZPB 1CMXB 3MC9A 1A70A 4E3CA 2V3NA 1GAQB 2MBQA 3LB8C 4BKGA 1SSNA 4A9AA 2LRUA 4WH4A 4EOYA 2KACA 1OFFA 2FBWB 4EZKA 2M0XA 2JSVX 1Q0WB 4KZCA 1SGHA 1HZ5A 1D4BA 2GB1A 2ZPYA 2WQYB 2LGYA 2VRRB 3U4EG 5C23A 3ZGZA 3UF8A 1SIFA 1JRPA 2BS3B 4S0RA 4XX5A 4BBNF 3DBLB 1F52A 1FFVA 2BW2A 3H7SA 4ANXA 3ML8A 1TTNA 2H89B 3TEWA 2LXAA 5J18A 2NBWB 3BK1A 3TMPB 1YOVB 2DENB 2NCNA 4KSLC 2LXCA 3ECIA 3GZNI 3OWEB 3EC8A 4ZRIA 4W9IA 1UWXA 2O6VD 4M00A 4W9KA 3EFCA 1D5XC 5FKAC 1YX5B 3AEEB 1YQBA 3ZNHB 2B3AA 1V8CA 4IM3A 1MVKA 3BVMA 3JVZX 2WXJA 1BT0A 2WU5B 2HTME 1GNUA 3SR6A 1L5PA 2BS4B 2LJIA 1VZ6A 3BWUD 5EE0A 3GZNB 1V5OA 1WSPA 2EELA 1FRDA 4W9JA 2J52A 5D6JB 4LTUA 2J53A 1KLUD 2JU6X 2GBMA 2Y5CA 5G5HA 1Q10A 3GE3C 2N9PC 3H7PA 2BT6A 3RNEC 2KQ7A 1WE6A 1SE3A 4KKIA 4IKGA 1LQBA 4ANWA 2ZNVB 4O1NA 5AEKB 1WFYA 1UF0A 4YWGG 1TBEA 4UDUC 1V2YA 2FIDA 2RR9A 4HK2A 1WI0A 3R7RA 3V6CB 1WXVA 3U30A 4DWFA 3H7PB 1T0RC 3KUDB 5FR6A 2VZKD 2ZW0A 2TSSA 3Q8AA 1QQRA 2FCMA 1ZW7A 2G4SA 3CF6E 5E6OA 3K9PB 1SE9A 2J0MA 4CQNA 2WXHA 4BKTA 3T3OA 2DZMA 4WJOA 1ZDVA 4M0WA 1PGXA 1H8CA 1E7VA 4H2AA 2KQ4X 2IYDB 3ZUNA 1RAXA 1U4AA 2IO1B 4FHJA 1XLQA 1QOGA 2AX5A 4A6QA 1V9JA 2WXKA 5E6JA 2G3QB 1L0YB 1ZXIA 2LWPA 3DOWA 3VTUA 1WX7A 4YTMB 4DHJB 3N30A 4M0WB 2ACZB 3TCAA 1BMLC 1KTKA 1MJDA 2DX5B 1C4CA 3BK2A 2KJHB 3DVNU 4C80A 2K22A 4PYZA 1V1PA 3I9V1 3UINB 3ZJVA 2NVUI 5JHAA 1FD6A 1VZ7A 3VFKA 2IO2B 2NR2A 3HRDD 2ZCBA 3P42A 3APCA 2BS2B 1V1PB 4JX1C 3RUIB 3RNFC 1Q5WB 4A8XC 1Z5SB 1NI2A 3L13A 1KOTA 2KMCA 1QOFA 2LHDA 2K39A 1TS5A 4MGYE 1E8XA 4HKZE 2Y3AA
chains in the Genus database with same CATH topology
2K9XA 2BTEA 1RM6C 3RPFC 1YN5A 1K51A 2AQ1B 4LK0M 1EU4A 1TS3A 4KKJA 3FC4A 5D3DA 1FNWA 1KLGD 1V97A 5BYSA 4TQ1A 3AMZA 1HXYD 4GLSC 3ABVB 1ET6A 2IGDA 5FK9C 1QKZA 1YJJA 2I38A 3URYA 2BYTA 2L83A 5HFYA 1I4GA 2JXTA 3R8BA 2RMMA 2W54A 2MJEA 4XWTA 1T5XD 2BBCA 1EM7A 4JWSC 4OW0A 2L1AA 2W3SA 1HZ6A 1PGAA 2K0PA 1DGJA 3NVZA 3Q8CA 1L0VB 2RPVA 4ARIA 1SJED 1ZDXA 3PZ8A 1FCCC 1OQRA 1FNUA 4OZCA 2E6XA 4C7YA 4P16A 3BVGA 3UI3A 4B0EA 2AQ3B 1FXAA 2ICIA 1F0ZA 1XLPA 1TS2A 1QT9A 2MJ3A 3DWMA 1GB1A 5BMHA 3W1SA 2I2YA 3R2TA 2L52A 4TSSA 1T3QA 4HJGE 2M19A 2Z8LA 3MFGA 3SFDB 3TEYA 1ACCA 1BXTA 2K5PA 1TKYA 3P4RB 3ZYYX 2W82A 3AE7B 2FUG1 2WXQA 4ZOHC 4RF1A 1RWSA 5MPOA 4PT5A 3NVVA 1SJHD 3MHZA 5BYRA 1JWBD 2JYTA 2INNE 3BVZA 1KRHA 3ZQ4A 3ZJTA 4USAA 4L2YA 1EWYC 1TJEA 3C8YA 2PKOA 2BB6A 1BUIC 3BYTB 2M56B 3AE8B 1PUTA 1ZP0B 5BMGA 5EE1A 5H92C 4EE2A 4GDLB 5BYQA 4AQ7A 3B2FA 4HROA 3L4PA 1C76A 3NVYA 4ZHOA 2J4XA 3I57A 3SEBA 1NYQA 4XWWA 1CQVA 2JYEA 4XDDA 1R7SA 1XLOA 1L4ZB 2N0SB 3BZDB 1N60A 1MPEA 1TY0A 2WDQB 4NAWB 4RGOS 2WNMA 3W5VB 1IGDA 1K52A 1L6UA 1FRRA 1SBBB 4IDIA 4OHJA 3Q8FA 2G1EA 3NZ3A 1J7BA 2WXFA 1SXTA 3VR9B 1QF6A 4RNAA 1JWUD 2WXRA 1WYGA 5C2TB 1TKGA 3MC0B 4N59A 1FIQA 5FR3A 4MT5A 3ZJUA 2SAKA 1SF0A 3PO0A 1MI0A 1JW9D 2B76B 2WDRB 4KGTA 1EWCA 1E9MA 1ZUD2 2QIEB 1D6EC 3VRBB 2WXMA 1RYJA 3T3NA 4HEA1 4YXDB 3B2GA 1JWMD 2Y5PA 1JCKB 3W2DA 4JWUC 5C3JB 3U52E 2Q5WD 4JE3B 4DXGA 1WXQA 4R3DA 2GI9A 2DYOA 4KGSA 1MHXA 2HDEA 3HVDA 1AW7A 1C9FA 2L32A 4DQOC 2JWUA 3MJ5A 2N9KA 1JWSD 4DXFA 3RFZB 3FILA 2IJ0A 4Q2JA 4B0MA 1UGJA 5JXVA 1J7AA 1RFKA 4RGMA 1ROEA 1D5MC 1TKEA 1I4RA 2KDMA 1FM0D 1I4XA 1PDXA 1JWAD 4YSXB 3GS2A 1D5ZC 2QMTA 5AUKA 2IPKD 2ONQA 4YT0B 4ZRPA 3FILB 4C56C 1NI3A 1ZE3D 2PMVA 4WAFA 3P1MA 5I4DA 4US9A 3AN1A 2R61A 1P7EA 2DYMA 1VJKA 4HRSA 1AN8A 2YEPF 1YN3A 1E0ZA 3TSSA 2PLPA 2G9HD 1LO5D 1I7HA 1M4VA 2RDGA 3E9SA 1GPXA 1TYGB 2V4IB 3AECB 2KAJA 5BMIA 1FCLA 5EE9A 4KX6B 3V3XA 1TY2A 2KWDA 3HVZA 3AEDB 2WLBA 3BYYB 4RCOA 4RH6A 5AUIA 1VZ8A 3AM9A 3IT4B 1C78A 4A90A 1IGCA 2QJLA 1YQ4B 3SFEB 2JX5A 1A70A 2V3NA 2V0GA 1GAQB 1IBXA 5T8IA 4RF0A 3ETRA 5TSSA 2PTLA 3V05A 1YNTE 3LB8C 1GOZA 1HQRD 1SSNA 4A9AA 4REZA 1FFUA 2YEPB 4WH4A 1TS4A 2KACA 2LFIA 1OFFA 2FBWB 3VQIA 2RDHA 3FAHA 2JSVX 3J9CA 3LXFA 1L0XB 3P4QB 1HZ5A 1D4BA 2GB1A 2PVOD 2WQYB 1E7PB 1PFDA 4YSZB 1IBXB 3R2IA 3U4EG 4C7ZA 1C4PA 2KMMA 4N6EB 3ZGZA 2JZPA 1JROA 3HUIA 4ZRQA 1JRPA 2WXIA 1DYQA 3GB1A 2BS3B 3IT6B 1K53A 2M0AA 1Y56A 2BW2A 1FFVA 4YTPB 1ZXHA 4WQMA 1XCQL 1E10A 1IUEA 1F2RI 1TZOA 1HA5A 3Q8EA 2H89B 1VDVA 2SEBD 3TEWA 3O13A 3BK1A 1YJIA 1F77A 4RGNA 4ITKA 4KGRA 4NAMA 1I4HA 2AQ2B 3OWEB 3MP9A 1ZOYB 5HG2A 3TUOA 2LHEA 3AE6B 1SE4A 3NRZA 1SB3C 3W9CB 1UWXA 2GRIA 2WP9B 4OVZA 2WU2B 4ZHPA 1D5XC 5FKAC 2DWQA 1QOAA 3AEEB 4YSYB 4XDCA 1YMHE 1EU3A 2DLBA 1XF5L 2WXPA 4LLGM 1V8CA 3EGRA 1MVKA 2N9LA 4YTNB 2QEJC 5LNK1 1N62A 1SE2A 3BVMA 2ON8A 3GP7A 1PGBA 4XE0A 1FO4A 1STEA 4NJCA 2WXJA 3AE4B 1L6VA 1PYWD 5D3IB 1JQ4A 2E3TA 2WU5B 2HTME 2EKIA 3SR6A 1B1ZA 3AEFB 3IAS1 2WXGA 3AE3B 1L5PA 2BS4B 2LJIA 1VZ6A 3BWUD 5EE0A 1UWMA 2NMQA 5HHDG 1SIJA 1AWDA 2OEDA 1WSPA 2EELA 1FRDA 2XN9C 2J42A 3EUB2 1VR9A 2J52A 2KN4A 3H8HA 4RFBA 1XCTL 4LTUA 2J53A 4WURA 2PIAA 1XLNA 1KLUD 2WXOA 3IXSA 1KFYB 1FNVA 2CJOA 1VRAB 2BB5A 2JU6X 1XO3A 1C77A 4AS1A 1SEBD 2Y5CA 5G5HA 1Q10A 2MJDA 1N63A 2BT6A 1XXGA 1UNSA 3N9YC 1UUPA 1NYRA 5G5GA 1SE3A 1QOBA 4JPSA 4KKIA 4L23A 3CIRB 4IKGA 3WCQA 4HKQA 1CZPA 5HI1A 2FE8A 3AE2B 4O1NA 2QSDA 2LGIA 4YWGG 1FXIA 4ZYSA 4UDUC 2XNAC 1FEHA 2VZKB 1YN4A 4RGTA 1N61A 4MACA 3Q8BA 4OZAA 2INPE 1N5WA 3AV8A 2LUMA 2IDYA 4WIPA 5D7GA 2W55A 2WXNA 4ARCA 1DOYA 5EE3A 3AEAB 1ZPSA 2WDVB 2VZKD 2ZW0A 2TSSA 2CJNA 3Q8AA 3VRAB 1I4PA 1YQ3B 1E6EB 1QQRA 1C4AA 3LYYA 5H8YE 3AE1B 3AEGB 1NENB 3EA6A 4WWMA 1CK1A 3AE5B 1J7CA 1KF6B 4CQNA 2ZW1A 1T6BX 2D5GA 2WXHA 1DOIA 2WS3B 4L1BA 1OQQA 3T3OA 1WRIA 3KLSX 1N5XA 1FMAD 1ZDVA 4M0WA 1PGXA 4H2AA 2KQ4X 1KH0A 2LMCA 4A55A 1QLBB 2CU3A 1XLQA 1QOGA 2AX5A 4A6QA 2WXKA 4D2KA 1B9RA 5E6JA 1L0YB 1V1OA 3Q69A 4IOIE 2N7JA 3DWGC 1DOXA 1ZXIA 2V3PA 4P6VF 3P4SB 2LEKA 3AE9B 4YTMB 3CWIA 3B9JA 4FXCA 3BIID 4MH8A 2ACZB 1CJEA 3AB5A 1I4QA 3P63A 1K50A 1WGKA 2WXLA 1BMLC 1KTKA 3AH7A 4J3OD 1C4CA 3BK2A 1ESFA 4C80A 1JALA 1NVID 1VLBA 2K22A 1V1PA 3KQ4A 2IGHA 4TMAB 3NS1A 2MH7A 1HEZE 2NTTA 3I9V1 4MM3B 4N58A 1MHHE 3PZ7A 3ZJVA 4TQ0A 4OZBA 3VR8B 2DBYA 1VZ7A 4GDKB 1FD6A 3KWLA 1ET9A 2IGGA 1QILA 2NTSA 1NEKB 1C79A 3U7ZA 4NZLB 5GXGB 3TEZA 2JQRB 2PW9A 3KWVA 3NUHB 3HRDD 2OHFA 4US8A 1P7FA 3P42A 2H88B 1JMLA 2PVGC 2BS2B 1XEEA 3E56A 1V1PB 1GB4A 3AEBB 4JX1C 1ENFA 2X38A 3W5UB 3TEXA 4A8XC 2MEKA 3IAM1 1F2RC 2W3RA 1L4DB 1QOFA 1WWTA 2LHDA 2QILA 1TS5A 2K3UA 3P4PB 3U2SC 4HKZE 3NVWA 1AYFA 2Y3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9X A;  1DOY A;  1J7B A;  4N6E B;  1RM6 C;  3AEA B;  5EE3 A;  3VR9 B;  1JRO A;  2WDV B;  3HUI A;  3RPF C;  1JRP A;  1QF6 A;  1WYG A;  5C2T B;  3VRA B;  2CJN A;  1TKG A;  2BS3 B;  4N59 A;  1FIQ A;  1YQ3 B;  1E6E B;  3FC4 A;  1SF0 A;  3PO0 A;  5H8Y E;  1JW9 D;  2B76 B;  1FFV A;  2WDR B;  3AE1 B;  1V97 A;  3AEG B;  4WQM A;  1E9M A;  1NEN B;  1ZUD 2;  2QIE B;  3ABV B;  3AMZ A;  4WWM A;  1RYJ A;  3AE5 B;  1IUE A;  4YXD B;  1E10 A;  3B2G A;  1J7C A;  1KF6 B;  4JWU C;  5C3J B;  2H89 B;  1YJJ A;  1DOI A;  1VDV A;  2Q5W D;  1WXQ A;  2L83 A;  2WS3 B;  1OQQ A;  1WRI A;  1YJI A;  4ITK A;  2W54 A;  2MJE A;  1N5X A;  1FMA D;  4JWS C;  1ZOY B;  2W3S A;  3AE6 B;  1QLB B;  1SB3 C;  2CU3 A;  3NRZ A;  3W9C B;  1XLQ A;  1QOG A;  2WP9 B;  1DGJ A;  3NVZ A;  1L0V B;  1J7A A;  1RFK A;  2AX5 A;  2WU2 B;  1ROE A;  4ZHP A;  1OQR A;  1TKE A;  1B9R A;  2DWQ A;  1FM0 D;  1PDX A;  1QOA A;  3AEE B;  4YSY B;  4C7Y A;  1DOX A;  3DWG C;  1JWA D;  1ZXI A;  4P6V F;  4YTN B;  1V8C A;  1FXA A;  3P4S B;  1N62 A;  2LEK A;  4YSX B;  1F0Z A;  1XLP A;  5AUK A;  1QT9 A;  2MJ3 A;  3AE9 B;  3DWM A;  1FO4 A;  4YTM B;  3CWI A;  3AE4 B;  3B9J A;  4YT0 B;  1L6V A;  1NI3 A;  4FXC A;  1JQ4 A;  3BII D;  2ACZ B;  2L52 A;  2E3T A;  1CJE A;  3P1M A;  4US9 A;  1T3Q A;  2WU5 B;  3AB5 A;  3AN1 A;  2M19 A;  3P63 A;  2HTM E;  1WGK A;  3SFD B;  1VJK A;  2EKI A;  4HRS A;  3AH7 A;  3SR6 A;  3AEF B;  2K5P A;  3AE3 B;  1TKY A;  1E0Z A;  3P4R B;  3ZYY X;  3AE7 B;  1L5P A;  1JAL A;  1NVI D;  2BS4 B;  4C80 A;  1VLB A;  4ZOH C;  2K22 A;  5EE0 A;  1UWM A;  1I7H A;  1GPX A;  1SIJ A;  1AWD A;  1RWS A;  1TYG B;  3AEC B;  2KAJ A;  3NVV A;  5MPO A;  1JWB D;  5EE9 A;  4KX6 B;  1FRD A;  3NS1 A;  2MH7 A;  3EUB 2;  4N58 A;  1KRH A;  3HVZ A;  4LTU A;  4USA A;  3AED B;  2WLB A;  2PIA A;  1XLN A;  5AUI A;  1EWY C;  1KFY B;  1TJE A;  3VR8 B;  4YTP B;  2PKO A;  3AM9 A;  2DBY A;  2CJO A;  2QJL A;  3KWL A;  1YQ4 B;  3SFE B;  1NEK B;  2M56 B;  1XO3 A;  2JX5 A;  4ZHO A;  1A70 A;  3AE8 B;  5GXG B;  1PUT A;  1ZP0 B;  2JQR B;  1GAQ B;  5EE1 A;  2Y5C A;  5G5H A;  5H92 C;  2MJD A;  3HRD D;  2OHF A;  4US8 A;  1N63 A;  3ETR A;  2BT6 A;  2H88 B;  3B2F A;  4HRO A;  3L4P A;  3NVY A;  2PVG C;  3LB8 C;  2BS2 B;  1NYR A;  2KMM A;  1NYQ A;  1QOB A;  5G5G A;  3AEB B;  4JX1 C;  4A9A A;  3CIR B;  3WCQ A;  1FFU A;  3W5U B;  1CZP A;  1R7S A;  3AE2 B;  1OFF A;  1XLO A;  2N0S B;  2FBW B;  1N60 A;  2W3R A;  3FAH A;  3LXF A;  1QOF A;  1FXI A;  3P4Q B;  1WWT A;  2WDQ B;  2PVO D;  2WQY B;  1E7P B;  1PFD A;  4YSZ B;  3P4P B;  3W5V B;  1N61 A;  3VRB B;  1L6U A;  1FRR A;  4IDI A;  1N5W A;  3AV8 A;  3NVW A;  1AYF A;  4C7Z A;  2W55 A;  2G1E A; 
#chains in the Genus database with same CATH topology
 2K9X A;  1E90 A;  1R4M I;  1WR1 A;  1UD7 A;  3RPF C;  1XT9 B;  1LGR A;  2NS5 A;  2W9N A;  4LK0 M;  4MGZ E;  1UBI A;  3FC4 A;  3A9J A;  2V3S A;  1V97 A;  5BYS A;  1HXY D;  4GLS C;  4W9H A;  1WX8 A;  1ET6 A;  3CMM B;  1QKZ A;  3NJT A;  3URY A;  3B08 A;  3IHP C;  2W54 A;  4XWT A;  1T5X D;  3PT2 B;  4JWS C;  1EM7 A;  1KM7 A;  4ZRJ A;  3JYU A;  2AL3 A;  3A9J B;  4XZ4 A;  4EUT A;  1L7Y A;  1ZDX A;  1FCC C;  2J7Q B;  4OZC A;  5BO4 B;  3UI3 A;  1C1Y B;  1FXA A;  2KC2 A;  1XLP A;  1F0Z A;  3ZXV A;  2BF8 B;  2XK5 A;  1QT9 A;  1WM3 A;  2MJ3 A;  3W1S A;  2GOW A;  2JVC A;  2I2Y A;  4I6L B;  3R2T A;  3WAN A;  2L52 A;  3RNC C;  2ASQ A;  1ACC A;  2K25 A;  1TKY A;  2FUG 1;  3PZD A;  4BAX A;  1TGZ B;  3T8M A;  4PT5 A;  3NVV A;  1SJH D;  3RN9 C;  3ZO5 B;  1JWB D;  2JYT A;  2XK5 B;  3ZW3 A;  3BVZ A;  1KRH A;  4USA A;  1UEL A;  3WA0 A;  4L2Y A;  2NPT A;  3C8Y A;  2MRP A;  2KNB A;  2KT7 A;  3BYT B;  1ZP0 B;  5BMG A;  5BYQ A;  1VCB A;  3B2F A;  2J4X A;  3SEB A;  2IO3 B;  1XLO A;  1MPE A;  2NPT B;  2AL6 A;  2GLS A;  4JIO U;  2IO0 B;  3QAQ A;  2WNM A;  1A5R A;  1IGD A;  1WGR A;  1SBB B;  2G1E A;  2N9E B;  2WXF A;  3VR9 B;  1WYG A;  3EHV A;  1TKG A;  3OLM D;  1FIQ A;  5FR3 A;  2BYF A;  1JW9 D;  2ZCC A;  2EMT A;  4YXD B;  2Y5P A;  3OG5 A;  3U52 E;  2KHW B;  1WXQ A;  4ZDV A;  1OEY A;  2GI9 A;  3M62 B;  2DZK A;  2BQQ A;  3PVL A;  3MJ5 A;  4DXF A;  3FIL A;  4LCD E;  4HVB A;  2LGD A;  5JXV A;  4CYE A;  1F9J A;  4RGM A;  1ROE A;  4IM2 A;  4GXB A;  1FM0 D;  1OTR B;  1OQY A;  4BVU C;  3PRM B;  2KLG A;  3TBL D;  4ZRP A;  3FIL B;  3RCZ A;  3AN1 A;  2R61 A;  1P7E A;  1VJK A;  1AN8 A;  1I7H A;  1M4V A;  4WQO B;  5BMI A;  1J8C A;  2KOX A;  4KSK C;  2C60 A;  2I1J A;  4RH6 A;  4B95 A;  1VD2 A;  1VZ8 A;  1IGC A;  2JX5 A;  2V0G A;  1JRU A;  3VUW A;  2N1V A;  4FLH A;  1I35 A;  2DYB A;  3V05 A;  4AJW A;  3L54 A;  4REZ A;  2BGF A;  1X1M A;  2YEP B;  2LFI A;  3WAP A;  4M02 A;  2RDH A;  3FAH A;  3LXF A;  2OJR A;  4ASW C;  1PFD A;  1M94 A;  4PS8 A;  3Q6B A;  2KAN A;  3KYC D;  2LUE A;  3HUI A;  3IT6 B;  4WQM A;  2BWF A;  1E10 A;  1IUE A;  1TZO A;  2KYW A;  3AU4 A;  1VDV A;  3QHT A;  4ZRK A;  3UGB B;  4ITK A;  4KGR A;  2QC8 A;  5HKH A;  1I4H A;  2AQ2 B;  4K7W A;  3MP9 A;  3TUO A;  4AOF A;  3NRZ A;  4FJZ A;  2GRI A;  2WP9 B;  4ZHP A;  2DWQ A;  1QOA A;  4YSY B;  4DDI D;  4XDC A;  2WXP A;  2R2O A;  4LLG M;  4YTN B;  3EGR A;  5LNK 1;  2QEJ C;  3L0W B;  1N62 A;  1SE2 A;  3GP7 A;  4G50 A;  2VH2 A;  2GBK A;  4XE0 A;  3DBR B;  1FO4 A;  1WM2 A;  3Q3J A;  1L6V A;  1JQ4 A;  2E3T A;  1B1Z A;  4CHK A;  4MH0 E;  2IND C;  5HHD G;  1SIJ A;  4IG7 B;  3VH3 B;  1E8Z A;  1XCT L;  4RMA A;  4WUR A;  1XLN A;  3IXS A;  2CHW A;  2K8B A;  3KYD D;  1KFY B;  2D3B A;  3NY5 A;  4EEW A;  2QCZ A;  4M8N A;  1C77 A;  4AS1 A;  3M95 A;  1SEB D;  2DHZ A;  1WYW B;  1N63 A;  2LJ5 A;  1P9D U;  2IZV B;  5G5G A;  4L23 A;  3CIR B;  3WCQ A;  4HJK A;  4FHK A;  1K8R B;  3QAR A;  3AE2 B;  3PRP B;  1V5T A;  4RM9 A;  1FXI A;  3AI5 A;  1FEH A;  2VZK B;  3ZKJ C;  1RFA A;  3Q8B A;  1N5W A;  3AV8 A;  4WIP A;  2W55 A;  2WXN A;  2HJ8 A;  5G55 A;  1DOY A;  5EE3 A;  1ZPS A;  2JY6 A;  1ZGU B;  3N20 C;  2D10 A;  1YX6 B;  2YLM A;  1YQ3 B;  2MLB A;  1C4A A;  1YJ1 A;  5H8Y E;  3AEG B;  5G2N A;  4JL9 A;  1CK1 A;  1J7C A;  3L16 A;  1E8W A;  4L1B A;  4BZA A;  2PJH A;  4C4V A;  4XYC A;  1FMA D;  2LRW A;  2HD5 B;  1KH0 A;  2WX0 A;  2CU3 A;  4WJP A;  3N3K B;  1B9R A;  2KXJ A;  2N7J A;  2XBB C;  1DOX A;  2V3P A;  2KC1 A;  3P4S B;  4NQL B;  4C4V B;  3B9J A;  4FXC A;  4HPL B;  4W9G A;  3AB5 A;  1K50 A;  2LZ6 A;  1S3S G;  2JZZ A;  2V1Y A;  1JAL A;  5KHQ A;  1VLB A;  1V86 A;  4BFR A;  3KQ4 A;  3O65 B;  3EFU A;  2IGH A;  4LDT D;  3RMK C;  2EKE C;  2MH7 A;  1HEZ E;  3NHE B;  4N58 A;  4OZB A;  3VR8 B;  2N7E A;  1I42 A;  1ET9 A;  2NTS A;  2OOB B;  1C79 A;  4NZL B;  3PHX B;  2PE6 B;  4YL8 A;  2OHF A;  2RDB C;  2GBJ A;  4F8C B;  3VTV A;  2LAS A;  3JSV A;  1XEE A;  1GC6 A;  3E56 A;  3AEB B;  4AWJ A;  2X38 A;  3W5U B;  3VUX A;  1L4D B;  3ZDM C;  1WWT A;  3K9O B;  3IVF A;  2QIL A;  2ZPN A;  3QQ8 B;  3JSV B;  1LFD A;  3BY4 B;  4MSM B;  4A3O A;  2AQ1 B;  1EU4 A;  4ICV A;  3R3M A;  5D3D A;  1KLG D;  4TQ1 A;  1TT5 B;  1QZE A;  2DAJ A;  5FK9 C;  2BYT A;  2L83 A;  5HFY A;  3R8B A;  1GG3 A;  2CS4 A;  3ENE A;  2MJE A;  4OW0 A;  1HZ6 A;  2C9W B;  2MSE D;  2MCN B;  4ARI A;  4ICU A;  1OQR A;  3Q2A C;  1WH3 A;  4CO7 A;  2JZ3 B;  4AJY B;  4P16 A;  3VVW B;  2ZJD A;  4II2 B;  4NPN A;  2ICI A;  3ZLZ A;  1TS2 A;  3DWM A;  3QJZ A;  2KDE B;  3SHQ A;  1GB1 A;  4NJ7 A;  2BYV E;  2L8J A;  2CKH B;  1T3Q A;  3SFD B;  3TEY A;  1BXT A;  2K5P A;  3ZYY X;  2KZR A;  2KTR A;  4TKN A;  5MPO A;  1WGG A;  1L2N A;  5L83 A;  2LGX A;  1IYF A;  5CTR C;  3AE8 B;  2G45 B;  5H92 C;  3KW5 B;  2KTR B;  4AQ7 A;  4HRO A;  3NVY A;  2BWE S;  1NYQ A;  4LJO B;  4X57 B;  1CQV A;  2PE9 A;  2JYE A;  3D32 A;  1R7S A;  2MWS B;  1L4Z B;  2JRI B;  2N0S B;  1N60 A;  1T0Y A;  4PYU A;  2JPH A;  3DVG Y;  1YD8 U;  1ISN A;  3W5V B;  1D3Z A;  4XC2 A;  2FCS A;  2WXR A;  4HWI B;  3VH4 B;  3MC0 B;  2YVC A;  4LNF A;  1SF0 A;  3PO0 A;  2B76 B;  2WDR B;  3ZIM A;  2R2Q A;  1EWC A;  3WAM A;  1E9M A;  4AUQ C;  1RYJ A;  2FCQ A;  1JWM D;  5C3J B;  2Q5W D;  4JE3 B;  2MHJ A;  1MHX A;  1TIF A;  3RNG C;  3N32 A;  3PLV A;  3PS6 A;  5IAA C;  1UGJ A;  3DDC B;  4OVU A;  3V60 A;  1D5M C;  2KDM A;  1TZ1 A;  3CST A;  2CHX A;  1MG8 A;  4YSX B;  2UYZ B;  2V4L A;  4YT0 B;  4C56 C;  1NI3 A;  1ZE3 D;  2PMV A;  4WAF A;  3P1M A;  3KH0 A;  5I4D A;  4US9 A;  1V81 A;  4BKS D;  2LGS A;  1E0Z A;  3OJ4 B;  2KTF A;  2G9H D;  1LO5 D;  2JT4 B;  2RDG A;  3AEC B;  1R4M B;  2Y5B B;  1TY2 A;  2KWD A;  3HVZ A;  3BYY B;  2WLB A;  4GSW A;  3LDZ E;  3PRZ A;  4W9F A;  2QJL A;  1YQ4 B;  2MBH A;  3V6E B;  2WWZ A;  5CHF A;  1IBX A;  2JRH A;  5T8I A;  3SDL C;  2PTL A;  3ZNZ B;  1YNT E;  2HE7 A;  2ZVN A;  1HQR D;  1KLV A;  1FFU A;  3HK0 A;  4IWO A;  4K3C A;  3A9K A;  2BVC A;  2KMA A;  1L0X B;  3V62 A;  3JW0 X;  2QDF A;  2L05 A;  2PVO D;  1E7P B;  2LI5 A;  3A4R A;  4YSZ B;  5JHB A;  1WY8 A;  1IBX B;  4ACF A;  4C7Z A;  1C4P A;  4GIV A;  5AZH A;  1WXM A;  4ZRQ A;  2WXI A;  1DYQ A;  4I6N B;  3A9K B;  4TV3 A;  2M0A A;  3DBH I;  3L17 A;  3A1Q A;  4YTP B;  2UU7 A;  1ZXH A;  3BIN A;  3PRE A;  1F2R I;  5L95 C;  3Q8E A;  2XEW A;  3KVF B;  3ZDT A;  2SEB D;  3O13 A;  4MEL A;  5D94 A;  4A20 A;  1YJI A;  5DPW A;  3MHS D;  3VAW A;  4LJP B;  3UQB A;  2KD0 A;  5CHV C;  4GB9 A;  1ZOY B;  5HG2 A;  2LHE A;  3AE6 B;  1SB3 C;  3W9C B;  1E5W A;  4OVZ A;  3A1Q B;  2WU2 B;  4HCP B;  2REX A;  4K81 A;  3EEC A;  4W9D A;  1YMH E;  4S17 A;  2D3G A;  5DCN A;  2V9H A;  4J6I A;  3R7Q A;  4NJC A;  1P1A A;  3AE4 B;  5D3I B;  3C19 A;  4DHZ B;  3Q3O C;  2N9X A;  3IAS 1;  2N1W A;  2WXG A;  3AE3 B;  1S1Q B;  2N7D A;  3UIP B;  1UWM A;  3B1L X;  3EUB 2;  1VR9 A;  2KN4 A;  4RFB A;  2PIA A;  2WXO A;  1RRB A;  2NBV B;  2KO3 A;  2RD0 A;  2JWZ A;  2MX2 A;  1LXD A;  1XXG A;  4G3X B;  1UUP A;  3X0W A;  5HI1 A;  4IWQ A;  4E71 A;  4K7U A;  4IW0 A;  4DBG A;  2LGI A;  2I1K A;  5E6P A;  2A5U A;  4HDO A;  1WXA A;  4RGT A;  2LVQ A;  4OZA A;  2INP E;  3N1Y C;  2LUM A;  2IDY A;  2KVZ A;  3I5J C;  4DDG D;  4LNI A;  4EZJ A;  4KIK A;  2C5L C;  1R4N I;  2C7M B;  2O2V A;  3PLU A;  3VRA B;  1WF9 A;  2CJN A;  4W9L A;  1E6E B;  1WX9 A;  4GU2 A;  3LYY A;  5LXI B;  3KUC B;  3R66 C;  3EA6 A;  4WWM A;  3AE5 B;  2LVP A;  4ANU A;  1KF6 B;  5CX3 A;  1DOI A;  1OQQ A;  3PSE B;  1WRI A;  4WWN A;  3HM6 X;  2C7N B;  2L0T A;  4KIK B;  2O2V B;  1N5X A;  2KX3 A;  2O6V A;  2LMC A;  2DAF A;  1V49 A;  3QCA A;  3RZF A;  2KDB A;  4FAD A;  3NZU A;  1V1O A;  3Q69 A;  3W1Y A;  4BOZ B;  4P6V F;  3TJP A;  2LEK A;  2KN5 A;  4MM3 A;  4URK A;  5C1Z A;  4XGA B;  2O6V B;  3BII D;  4MH8 A;  4WWP A;  3RNA C;  3WIM A;  1CJE A;  2ZEQ A;  4LDT B;  3P63 A;  3AH7 A;  1P98 A;  3AXC A;  2G4D B;  1UZX B;  1ESF A;  4IWP A;  4GN1 A;  3H1U A;  4QAY A;  2VH1 A;  3NS1 A;  4I6P A;  5IA7 A;  2NTT A;  4MM3 B;  1MHH E;  2KX0 A;  4BOS C;  2FCN A;  4TQ0 A;  5TR5 A;  2PEA A;  1EF1 A;  5GXG B;  1WJN A;  2JQR B;  2PW9 A;  1MG4 A;  3NUH B;  2L7R A;  1F1H A;  5GMV A;  4US8 A;  3QIJ A;  2H88 B;  1JML A;  3PTF C;  1GB4 A;  2WX1 A;  4BBN C;  1V6E A;  3IAM 1;  2IY1 B;  1F2R C;  3B0A A;  4IUM B;  4WJQ A;  2W3R A;  2K3U A;  3SU8 X;  3U2S C;  3OAW A;  3NVW A;  2IBI B;  1AYF A;  4R3D A;  1RM6 C;  3V61 A;  3NS8 A;  3DHI C;  1K51 A;  4NJ6 A;  1WMH A;  1TS3 A;  4KKJ A;  2L0F A;  2DZI A;  5IN7 A;  4M8M A;  3AMZ A;  3ABV B;  2DNF A;  1YJJ A;  1Y8R C;  2JXT A;  2RMM A;  2L76 A;  4II3 B;  4DK5 A;  5IO9 A;  1P0R A;  4FN2 A;  1WMH B;  4C00 A;  4KVG B;  1PGA A;  4WWO A;  2K0P A;  5CHW A;  1DGJ A;  3Q8C A;  1L0V B;  2FIF A;  2RPV A;  1SJE D;  3KUZ A;  5DPT A;  3PV1 A;  1FNU A;  2E6X A;  3L10 B;  4HDQ A;  2AEH A;  4B0E A;  1GUA B;  2AQ3 B;  1C3T A;  4MGK E;  2GBR A;  3RYT A;  5BMH A;  2WDT B;  3QC8 B;  2CR5 A;  4HJG E;  2M19 A;  2GMI C;  2Z8L A;  3DBL I;  3P4R B;  4FA6 A;  2W82 A;  1EF5 A;  3AE7 B;  2WXQ A;  4RF1 A;  4F1S A;  1E7U A;  2INN E;  2Z0D B;  3ZQ4 A;  2X8X X;  2OJW A;  1EWY C;  3ONS A;  1TJE A;  3VDZ A;  2BB6 A;  2JUO A;  1BUI C;  2NBU A;  2D2Q A;  4PS7 A;  2M56 B;  4NAW A;  3APD A;  1PUT A;  5IKC M;  4A3P A;  1NDD A;  3SD5 A;  4B9K A;  3DQV A;  4JGH B;  1C76 A;  4N9F 4;  2KFJ A;  4ZHO A;  3CSF A;  5IOI A;  3VHT C;  1P3Q U;  1WR6 E;  2M17 A;  4XDD A;  3DHH C;  1TY0 A;  4WJN A;  2WDQ B;  4NAW B;  1G6J A;  2QHO A;  4IDI A;  4WAA A;  4DHZ E;  3T9L A;  1J7B A;  1SXT A;  1QF6 A;  2N4F A;  2HJ1 A;  1JWU D;  4N59 A;  1UH6 A;  3DBS A;  4TUU A;  1IPG A;  1MI0 A;  2WXM A;  1N6Z A;  3T3N A;  4HEA 1;  2KVR A;  3B2G A;  3MJW A;  3ZRF A;  1JCK B;  3X23 A;  2DZJ A;  4EZL A;  4KGS A;  4BKS A;  1C9F A;  4DQO C;  2JWU A;  3OJ3 A;  1JWS D;  3RFZ B;  4AP4 C;  1AAR A;  4Q2J A;  3RNB C;  4B0M A;  1T0S C;  4JLC A;  4K1R B;  3IG3 A;  1RFK A;  3GOE A;  1TKE A;  4FJY A;  1PDX A;  1I4X A;  1JWA D;  2D07 B;  4HPM B;  5AUK A;  3N1X C;  3MC8 A;  4OVV A;  5J2R A;  2M4N A;  2WGS A;  1J0G A;  1J19 A;  2DYM A;  2YEP F;  3FKY A;  1YN3 A;  2PLP A;  2J0J A;  4MGI E;  5DPR A;  4EKU A;  3E9S A;  2V4I B;  3ZNI D;  5EE9 A;  3V3X A;  1EO6 A;  3AED B;  4P7I A;  4RCO A;  5AUI A;  3IT4 B;  1C78 A;  4A90 A;  3SFE B;  2A4Z A;  2RSU A;  3DVN V;  4RF0 A;  3ETR A;  4K3B A;  5E6N A;  5TSS A;  1GOZ A;  3ALB A;  4G0N B;  1TS4 A;  3VQI A;  3J9C A;  3P4Q B;  3VXW A;  3ZNG C;  3I3T B;  3R2I A;  3LJ3 A;  3H9D A;  2KMM A;  2KWV B;  4N6E B;  2JZP A;  1JRO A;  4NQK E;  1FPY A;  1WIA A;  3GB1 A;  1K53 A;  1Y56 A;  4FUL A;  4IC7 B;  1XCQ L;  2INC C;  2M8S A;  1HA5 A;  3IFW B;  2MP2 A;  1V80 A;  1F77 A;  4RGN A;  4NAM A;  3VTW A;  1SE4 A;  2IY0 B;  3RT3 B;  2EMS A;  1WGD A;  4HPP A;  1EU3 A;  2DLB A;  1XF5 L;  2N9L A;  2MP2 B;  2ON8 A;  2Z0E B;  1IP9 A;  1PGB A;  1STE A;  1PYW D;  2CU1 A;  2EKI A;  3AEF B;  3VUY A;  3I63 C;  5AZF A;  2BYE A;  2NMQ A;  1AWD A;  2OED A;  1LM8 B;  2FUH B;  4F7Z A;  2XN9 C;  2J42 A;  2MBE A;  3H8H A;  3M63 B;  1FNV A;  2CJO A;  1VRA B;  2BB5 A;  1XO3 A;  2MJD A;  3ZVV A;  1UNS A;  5IP4 D;  3N9Y C;  3S2A A;  1NYR A;  1QOB A;  4JPS A;  4HKQ A;  1WZ0 A;  3UQA A;  2D11 A;  1CZP A;  4DXA B;  2FE8 A;  4K7S A;  4GMV A;  2QSD A;  3NG0 A;  3HM3 A;  1E8Y A;  2FNJ B;  2KJR A;  4ZYS A;  4IM0 A;  2XNA C;  3NOB A;  1YN4 A;  1N61 A;  3TL5 A;  4MAC A;  3RI7 C;  4W9C A;  2ZNV C;  2BKR B;  5D7G A;  4ANV A;  2D3A A;  1WJ6 A;  4ARC A;  3AEA B;  2JXX A;  2RGF A;  2WDV B;  2K8H A;  3APF A;  1I4P A;  4NNJ B;  1Z2M A;  4JQW C;  3AE1 B;  1NEN B;  1T0Q C;  4FBJ B;  2ZW1 A;  1T6B X;  2D5G A;  2WS3 B;  3KLS X;  2Z59 B;  3AUL A;  4A55 A;  2HTH A;  5LXH A;  1QLB B;  2AWT A;  2MQJ A;  2K6D B;  4D2K A;  1HTQ A;  3ZTD A;  3PHW B;  4IOI E;  3DWG C;  3QA8 A;  4MDK E;  1GJZ A;  2CHZ A;  2KFK A;  4MSQ B;  3AE9 B;  3CWI A;  4GDK A;  1I4Q A;  2WXL A;  1WGK A;  5KHO A;  3IBE A;  2RPQ A;  4J3O D;  4DHJ D;  1NVI D;  3Q14 C;  2K6Q A;  3MTN B;  2LVO A;  4TMA B;  2KFK B;  3DVG X;  3PZ7 A;  2BPS A;  3DBH B;  4M01 A;  2DBY A;  4GDK B;  2GBN A;  3KWL A;  2FAZ A;  1HTO A;  1QIL A;  2IGG A;  2WYQ A;  1NEK B;  3U7Z A;  3TEZ A;  3PPA A;  3KWV A;  3Q3M C;  3C0R B;  5JZE B;  1OEY J;  1P7F A;  1RLF A;  2PVG C;  4MJS A;  3DCG A;  2J0K A;  1ENF A;  1UGM A;  3TEX A;  2MEK A;  1FXT B;  4W9E A;  4GGQ A;  4LNO A;  3P4P B;  3Q3F A;  3RZW C;  3M3J A;  4NY0 A;  2KQS A;  1WGY A;  4MJS B;  2BTE A;  3HHM A;  1OGW A;  1YN5 A;  4GOC A;  2KJ6 A;  4MEM A;  1WXS A;  1FNW A;  1WE7 A;  3ZTC A;  1MFW A;  2KLC A;  1WJU A;  2IGD A;  2I38 A;  1YIW A;  4KDI C;  1I4G A;  3AU5 A;  3DPD A;  3GE8 C;  2BBC A;  2L1A A;  2KWC A;  3NZS A;  3QX1 A;  5JH5 C;  2W3S A;  3ZRC A;  2UWQ A;  4KDL B;  3NVZ A;  1XQQ A;  3PZ8 A;  2D3C A;  4C7Y A;  4LNN A;  2MA9 B;  2KKC A;  3BVG A;  3U8Z A;  5AZG A;  5DPS A;  4PK1 A;  2WHI A;  3TIX A;  3P2B A;  3UIO B;  4TSS A;  3MFG A;  4HLE A;  4ZYN A;  4GDL A;  4ZOH C;  3L08 A;  1RWS A;  3MHZ A;  1PQS A;  5BYR A;  1R4N B;  1H4R A;  2PPH A;  3ZJT A;  2C7H A;  2PKO A;  3WAL A;  4PS3 A;  5EE1 A;  4EE2 A;  3QWZ B;  4GDL B;  3DHG C;  2JF5 A;  3L4P A;  3W1S C;  3I57 A;  4B6W A;  2BKF A;  4XWW A;  3DBR I;  2MBO A;  3ML9 A;  3QK0 A;  3BZD B;  4EFO A;  4RGO S;  1K52 A;  1L6U A;  1FRR A;  4OHJ A;  4RM8 A;  5J17 A;  3Q8F A;  4KZ0 A;  3NZ3 A;  3RD2 A;  4RNA A;  5C2T B;  4G11 A;  4MT5 A;  3ZJU A;  2SAK A;  4KGT A;  2M1M A;  3VRB B;  1NBF C;  1ZUD 2;  1D6E C;  2QIE B;  2AYO B;  2MW5 A;  3Q3N C;  3W2D A;  1XD3 B;  4JWU C;  4DXG A;  2DYO A;  1KJT A;  2HDE A;  1AW7 A;  3HVD A;  2L32 A;  3HIZ A;  2N9K A;  1Q1O A;  1HE8 A;  2IJ0 A;  2KDF B;  5LLI A;  4KV2 A;  3U7D A;  1ZKH A;  2ZVO A;  2LD9 A;  1J7A A;  1I4R A;  1WRD B;  1WZ3 A;  1UBQ A;  4FJV B;  4P1C C;  3GS2 A;  1D5Z C;  2QMT A;  4P1B C;  2IPK D;  2KWU B;  2ONQ A;  3A33 B;  5D2M B;  4LNK A;  2L00 B;  3RUL A;  2L3Z A;  2MBB B;  2K8C A;  2KDI A;  3PGE A;  4E74 A;  4HRS A;  4HCN B;  5EDS A;  4HXD A;  3H6N A;  3TSS A;  2K1F A;  1GPX A;  3WAO A;  1TYG B;  2KAJ A;  1EUV B;  1FCL A;  2KK8 A;  4KX6 B;  1WJ4 A;  3ZXR A;  1WGH A;  3N1Z C;  3AM9 A;  3A4S C;  1GC7 A;  2ZZP B;  1CMX B;  3MC9 A;  1A70 A;  4E3C A;  2V3N A;  1GAQ B;  2MBQ A;  3LB8 C;  4BKG A;  1SSN A;  4A9A A;  2LRU A;  4WH4 A;  4EOY A;  2KAC A;  1OFF A;  2FBW B;  4EZK A;  2M0X A;  2JSV X;  1Q0W B;  4KZC A;  1SGH A;  1HZ5 A;  1D4B A;  2GB1 A;  2ZPY A;  2WQY B;  2LGY A;  2VRR B;  3U4E G;  5C23 A;  3ZGZ A;  3UF8 A;  1SIF A;  1JRP A;  2BS3 B;  4S0R A;  4XX5 A;  4BBN F;  3DBL B;  1F52 A;  1FFV A;  2BW2 A;  3H7S A;  4ANX A;  3ML8 A;  1TTN A;  2H89 B;  3TEW A;  2LXA A;  5J18 A;  2NBW B;  3BK1 A;  3TMP B;  1YOV B;  2DEN B;  2NCN A;  4KSL C;  2LXC A;  3ECI A;  3GZN I;  3OWE B;  3EC8 A;  4ZRI A;  4W9I A;  1UWX A;  2O6V D;  4M00 A;  4W9K A;  3EFC A;  1D5X C;  5FKA C;  1YX5 B;  3AEE B;  1YQB A;  3ZNH B;  2B3A A;  1V8C A;  4IM3 A;  1MVK A;  3BVM A;  3JVZ X;  2WXJ A;  1BT0 A;  2WU5 B;  2HTM E;  1GNU A;  3SR6 A;  1L5P A;  2BS4 B;  2LJI A;  1VZ6 A;  3BWU D;  5EE0 A;  3GZN B;  1V5O A;  1WSP A;  2EEL A;  1FRD A;  4W9J A;  2J52 A;  5D6J B;  4LTU A;  2J53 A;  1KLU D;  2JU6 X;  2GBM A;  2Y5C A;  5G5H A;  1Q10 A;  3GE3 C;  2N9P C;  3H7P A;  2BT6 A;  3RNE C;  2KQ7 A;  1WE6 A;  1SE3 A;  4KKI A;  4IKG A;  1LQB A;  4ANW A;  2ZNV B;  4O1N A;  5AEK B;  1WFY A;  1UF0 A;  4YWG G;  1TBE A;  4UDU C;  1V2Y A;  2FID A;  2RR9 A;  4HK2 A;  1WI0 A;  3R7R A;  3V6C B;  1WXV A;  3U30 A;  4DWF A;  3H7P B;  1T0R C;  3KUD B;  5FR6 A;  2VZK D;  2ZW0 A;  2TSS A;  3Q8A A;  1QQR A;  2FCM A;  1ZW7 A;  2G4S A;  3CF6 E;  5E6O A;  3K9P B;  1SE9 A;  2J0M A;  4CQN A;  2WXH A;  4BKT A;  3T3O A;  2DZM A;  4WJO A;  1ZDV A;  4M0W A;  1PGX A;  1H8C A;  1E7V A;  4H2A A;  2KQ4 X;  2IYD B;  3ZUN A;  1RAX A;  1U4A A;  2IO1 B;  4FHJ A;  1XLQ A;  1QOG A;  2AX5 A;  4A6Q A;  1V9J A;  2WXK A;  5E6J A;  2G3Q B;  1L0Y B;  1ZXI A;  2LWP A;  3DOW A;  3VTU A;  1WX7 A;  4YTM B;  4DHJ B;  3N30 A;  4M0W B;  2ACZ B;  3TCA A;  1BML C;  1KTK A;  1MJD A;  2DX5 B;  1C4C A;  3BK2 A;  2KJH B;  3DVN U;  4C80 A;  2K22 A;  4PYZ A;  1V1P A;  3I9V 1;  3UIN B;  3ZJV A;  2NVU I;  5JHA A;  1FD6 A;  1VZ7 A;  3VFK A;  2IO2 B;  2NR2 A;  3HRD D;  2ZCB A;  3P42 A;  3APC A;  2BS2 B;  1V1P B;  4JX1 C;  3RUI B;  3RNF C;  1Q5W B;  4A8X C;  1Z5S B;  1NI2 A;  3L13 A;  1KOT A;  2KMC A;  1QOF A;  2LHD A;  2K39 A;  1TS5 A;  4MGY E;  1E8X A;  4HKZ E;  2Y3A A; 
#chains in the Genus database with same CATH homology
 2K9X A;  2BTE A;  1RM6 C;  3RPF C;  1YN5 A;  1K51 A;  2AQ1 B;  4LK0 M;  1EU4 A;  1TS3 A;  4KKJ A;  3FC4 A;  5D3D A;  1FNW A;  1KLG D;  1V97 A;  5BYS A;  4TQ1 A;  3AMZ A;  1HXY D;  4GLS C;  3ABV B;  1ET6 A;  2IGD A;  5FK9 C;  1QKZ A;  1YJJ A;  2I38 A;  3URY A;  2BYT A;  2L83 A;  5HFY A;  1I4G A;  2JXT A;  3R8B A;  2RMM A;  2W54 A;  2MJE A;  4XWT A;  1T5X D;  2BBC A;  1EM7 A;  4JWS C;  4OW0 A;  2L1A A;  2W3S A;  1HZ6 A;  1PGA A;  2K0P A;  1DGJ A;  3NVZ A;  3Q8C A;  1L0V B;  2RPV A;  4ARI A;  1SJE D;  1ZDX A;  3PZ8 A;  1FCC C;  1OQR A;  1FNU A;  4OZC A;  2E6X A;  4C7Y A;  4P16 A;  3BVG A;  3UI3 A;  4B0E A;  2AQ3 B;  1FXA A;  2ICI A;  1F0Z A;  1XLP A;  1TS2 A;  1QT9 A;  2MJ3 A;  3DWM A;  1GB1 A;  5BMH A;  3W1S A;  2I2Y A;  3R2T A;  2L52 A;  4TSS A;  1T3Q A;  4HJG E;  2M19 A;  2Z8L A;  3MFG A;  3SFD B;  3TEY A;  1ACC A;  1BXT A;  2K5P A;  1TKY A;  3P4R B;  3ZYY X;  2W82 A;  3AE7 B;  2FUG 1;  2WXQ A;  4ZOH C;  4RF1 A;  1RWS A;  5MPO A;  4PT5 A;  3NVV A;  1SJH D;  3MHZ A;  5BYR A;  1JWB D;  2JYT A;  2INN E;  3BVZ A;  1KRH A;  3ZQ4 A;  3ZJT A;  4USA A;  4L2Y A;  1EWY C;  1TJE A;  3C8Y A;  2PKO A;  2BB6 A;  1BUI C;  3BYT B;  2M56 B;  3AE8 B;  1PUT A;  1ZP0 B;  5BMG A;  5EE1 A;  5H92 C;  4EE2 A;  4GDL B;  5BYQ A;  4AQ7 A;  3B2F A;  4HRO A;  3L4P A;  1C76 A;  3NVY A;  4ZHO A;  2J4X A;  3I57 A;  3SEB A;  1NYQ A;  4XWW A;  1CQV A;  2JYE A;  4XDD A;  1R7S A;  1XLO A;  1L4Z B;  2N0S B;  3BZD B;  1N60 A;  1MPE A;  1TY0 A;  2WDQ B;  4NAW B;  4RGO S;  2WNM A;  3W5V B;  1IGD A;  1K52 A;  1L6U A;  1FRR A;  1SBB B;  4IDI A;  4OHJ A;  3Q8F A;  2G1E A;  3NZ3 A;  1J7B A;  2WXF A;  1SXT A;  3VR9 B;  1QF6 A;  4RNA A;  1JWU D;  2WXR A;  1WYG A;  5C2T B;  1TKG A;  3MC0 B;  4N59 A;  1FIQ A;  5FR3 A;  4MT5 A;  3ZJU A;  2SAK A;  1SF0 A;  3PO0 A;  1MI0 A;  1JW9 D;  2B76 B;  2WDR B;  4KGT A;  1EWC A;  1E9M A;  1ZUD 2;  2QIE B;  1D6E C;  3VRB B;  2WXM A;  1RYJ A;  3T3N A;  4HEA 1;  4YXD B;  3B2G A;  1JWM D;  2Y5P A;  1JCK B;  3W2D A;  4JWU C;  5C3J B;  3U52 E;  2Q5W D;  4JE3 B;  4DXG A;  1WXQ A;  4R3D A;  2GI9 A;  2DYO A;  4KGS A;  1MHX A;  2HDE A;  3HVD A;  1AW7 A;  1C9F A;  2L32 A;  4DQO C;  2JWU A;  3MJ5 A;  2N9K A;  1JWS D;  4DXF A;  3RFZ B;  3FIL A;  2IJ0 A;  4Q2J A;  4B0M A;  1UGJ A;  5JXV A;  1J7A A;  1RFK A;  4RGM A;  1ROE A;  1D5M C;  1TKE A;  1I4R A;  2KDM A;  1FM0 D;  1I4X A;  1PDX A;  1JWA D;  4YSX B;  3GS2 A;  1D5Z C;  2QMT A;  5AUK A;  2IPK D;  2ONQ A;  4YT0 B;  4ZRP A;  3FIL B;  4C56 C;  1NI3 A;  1ZE3 D;  2PMV A;  4WAF A;  3P1M A;  5I4D A;  4US9 A;  3AN1 A;  2R61 A;  1P7E A;  2DYM A;  1VJK A;  4HRS A;  1AN8 A;  2YEP F;  1YN3 A;  1E0Z A;  3TSS A;  2PLP A;  2G9H D;  1LO5 D;  1I7H A;  1M4V A;  2RDG A;  3E9S A;  1GPX A;  1TYG B;  2V4I B;  3AEC B;  2KAJ A;  5BMI A;  1FCL A;  5EE9 A;  4KX6 B;  3V3X A;  1TY2 A;  2KWD A;  3HVZ A;  3AED B;  2WLB A;  3BYY B;  4RCO A;  4RH6 A;  5AUI A;  1VZ8 A;  3AM9 A;  3IT4 B;  1C78 A;  4A90 A;  1IGC A;  2QJL A;  1YQ4 B;  3SFE B;  2JX5 A;  1A70 A;  2V3N A;  2V0G A;  1GAQ B;  1IBX A;  5T8I A;  4RF0 A;  3ETR A;  5TSS A;  2PTL A;  3V05 A;  1YNT E;  3LB8 C;  1GOZ A;  1HQR D;  1SSN A;  4A9A A;  4REZ A;  1FFU A;  2YEP B;  4WH4 A;  1TS4 A;  2KAC A;  2LFI A;  1OFF A;  2FBW B;  3VQI A;  2RDH A;  3FAH A;  2JSV X;  3J9C A;  3LXF A;  1L0X B;  3P4Q B;  1HZ5 A;  1D4B A;  2GB1 A;  2PVO D;  2WQY B;  1E7P B;  1PFD A;  4YSZ B;  1IBX B;  3R2I A;  3U4E G;  4C7Z A;  1C4P A;  2KMM A;  4N6E B;  3ZGZ A;  2JZP A;  1JRO A;  3HUI A;  4ZRQ A;  1JRP A;  2WXI A;  1DYQ A;  3GB1 A;  2BS3 B;  3IT6 B;  1K53 A;  2M0A A;  1Y56 A;  2BW2 A;  1FFV A;  4YTP B;  1ZXH A;  4WQM A;  1XCQ L;  1E10 A;  1IUE A;  1F2R I;  1TZO A;  1HA5 A;  3Q8E A;  2H89 B;  1VDV A;  2SEB D;  3TEW A;  3O13 A;  3BK1 A;  1YJI A;  1F77 A;  4RGN A;  4ITK A;  4KGR A;  4NAM A;  1I4H A;  2AQ2 B;  3OWE B;  3MP9 A;  1ZOY B;  5HG2 A;  3TUO A;  2LHE A;  3AE6 B;  1SE4 A;  3NRZ A;  1SB3 C;  3W9C B;  1UWX A;  2GRI A;  2WP9 B;  4OVZ A;  2WU2 B;  4ZHP A;  1D5X C;  5FKA C;  2DWQ A;  1QOA A;  3AEE B;  4YSY B;  4XDC A;  1YMH E;  1EU3 A;  2DLB A;  1XF5 L;  2WXP A;  4LLG M;  1V8C A;  3EGR A;  1MVK A;  2N9L A;  4YTN B;  2QEJ C;  5LNK 1;  1N62 A;  1SE2 A;  3BVM A;  2ON8 A;  3GP7 A;  1PGB A;  4XE0 A;  1FO4 A;  1STE A;  4NJC A;  2WXJ A;  3AE4 B;  1L6V A;  1PYW D;  5D3I B;  1JQ4 A;  2E3T A;  2WU5 B;  2HTM E;  2EKI A;  3SR6 A;  1B1Z A;  3AEF B;  3IAS 1;  2WXG A;  3AE3 B;  1L5P A;  2BS4 B;  2LJI A;  1VZ6 A;  3BWU D;  5EE0 A;  1UWM A;  2NMQ A;  5HHD G;  1SIJ A;  1AWD A;  2OED A;  1WSP A;  2EEL A;  1FRD A;  2XN9 C;  2J42 A;  3EUB 2;  1VR9 A;  2J52 A;  2KN4 A;  3H8H A;  4RFB A;  1XCT L;  4LTU A;  2J53 A;  4WUR A;  2PIA A;  1XLN A;  1KLU D;  2WXO A;  3IXS A;  1KFY B;  1FNV A;  2CJO A;  1VRA B;  2BB5 A;  2JU6 X;  1XO3 A;  1C77 A;  4AS1 A;  1SEB D;  2Y5C A;  5G5H A;  1Q10 A;  2MJD A;  1N63 A;  2BT6 A;  1XXG A;  1UNS A;  3N9Y C;  1UUP A;  1NYR A;  5G5G A;  1SE3 A;  1QOB A;  4JPS A;  4KKI A;  4L23 A;  3CIR B;  4IKG A;  3WCQ A;  4HKQ A;  1CZP A;  5HI1 A;  2FE8 A;  3AE2 B;  4O1N A;  2QSD A;  2LGI A;  4YWG G;  1FXI A;  4ZYS A;  4UDU C;  2XNA C;  1FEH A;  2VZK B;  1YN4 A;  4RGT A;  1N61 A;  4MAC A;  3Q8B A;  4OZA A;  2INP E;  1N5W A;  3AV8 A;  2LUM A;  2IDY A;  4WIP A;  5D7G A;  2W55 A;  2WXN A;  4ARC A;  1DOY A;  5EE3 A;  3AEA B;  1ZPS A;  2WDV B;  2VZK D;  2ZW0 A;  2TSS A;  2CJN A;  3Q8A A;  3VRA B;  1I4P A;  1YQ3 B;  1E6E B;  1QQR A;  1C4A A;  3LYY A;  5H8Y E;  3AE1 B;  3AEG B;  1NEN B;  3EA6 A;  4WWM A;  1CK1 A;  3AE5 B;  1J7C A;  1KF6 B;  4CQN A;  2ZW1 A;  1T6B X;  2D5G A;  2WXH A;  1DOI A;  2WS3 B;  4L1B A;  1OQQ A;  3T3O A;  1WRI A;  3KLS X;  1N5X A;  1FMA D;  1ZDV A;  4M0W A;  1PGX A;  4H2A A;  2KQ4 X;  1KH0 A;  2LMC A;  4A55 A;  1QLB B;  2CU3 A;  1XLQ A;  1QOG A;  2AX5 A;  4A6Q A;  2WXK A;  4D2K A;  1B9R A;  5E6J A;  1L0Y B;  1V1O A;  3Q69 A;  4IOI E;  2N7J A;  3DWG C;  1DOX A;  1ZXI A;  2V3P A;  4P6V F;  3P4S B;  2LEK A;  3AE9 B;  4YTM B;  3CWI A;  3B9J A;  4FXC A;  3BII D;  4MH8 A;  2ACZ B;  1CJE A;  3AB5 A;  1I4Q A;  3P63 A;  1K50 A;  1WGK A;  2WXL A;  1BML C;  1KTK A;  3AH7 A;  4J3O D;  1C4C A;  3BK2 A;  1ESF A;  4C80 A;  1JAL A;  1NVI D;  1VLB A;  2K22 A;  1V1P A;  3KQ4 A;  2IGH A;  4TMA B;  3NS1 A;  2MH7 A;  1HEZ E;  2NTT A;  3I9V 1;  4MM3 B;  4N58 A;  1MHH E;  3PZ7 A;  3ZJV A;  4TQ0 A;  4OZB A;  3VR8 B;  2DBY A;  1VZ7 A;  4GDK B;  1FD6 A;  3KWL A;  1ET9 A;  2IGG A;  1QIL A;  2NTS A;  1NEK B;  1C79 A;  3U7Z A;  4NZL B;  5GXG B;  3TEZ A;  2JQR B;  2PW9 A;  3KWV A;  3NUH B;  3HRD D;  2OHF A;  4US8 A;  1P7F A;  3P42 A;  2H88 B;  1JML A;  2PVG C;  2BS2 B;  1XEE A;  3E56 A;  1V1P B;  1GB4 A;  3AEB B;  4JX1 C;  1ENF A;  2X38 A;  3W5U B;  3TEX A;  4A8X C;  2MEK A;  3IAM 1;  1F2R C;  2W3R A;  1L4D B;  1QOF A;  1WWT A;  2LHD A;  2QIL A;  1TS5 A;  2K3U A;  3P4P B;  3U2S C;  4HKZ E;  3NVW A;  1AYF A;  2Y3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...