1A70A

Spinach ferredoxin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
97
structure length
97
Chain Sequence
AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN
publication title Structure of the mutant E92K of [2Fe-2S] ferredoxin I from Spinacia oleracea at 1.7 A resolution.
pubmed doi rcsb
source organism Spinacia oleracea
molecule tags Iron-sulfur protein
total genus 22
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 1998-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1a70A00
4JWUC 3AEDB 4ZOHC 1QOFA 1VJKA 1YJIA 2WU2B 3NS1A 1XLOA 3VR8B 1YJJA 4YTMB 1SIJA 2WDRB 1CJEA 2W55A 2BT6A 1N62A 3AMZA 1RWSA 4WWMA 3AE7B 1KRHA 1JALA 4YSXB 1V8CA 2PVGC 3AE8B 2KAJA 4WQMA 2WDQB 1XLQA 3NRZA 1JRPA 1L6VA 2QIEB 3AE4B 1JWBD 1L6UA 1ZP0B 1QLBB 2JX5A 3FAHA 4HRSA 3PO0A 1L0VB 2N0SB 1YQ4B 3B9JA 2WS3B 2MJEA 2WQYB 1ROEA 1KFYB 1XLPA 2H88B 2CU3A 2FBWB 3AV8A 3VRBB 2AX5A 1TYGB 1PUTA 1VDVA 1FM0D 1WYGA 3AE9B 3AEAB 3NVZA 4YT0B 1DOIA 1OFFA 1RM6C 2E3TA 1N60A 3NVWA 4A9AA 4YXDB 1FXIA 2EKIA 1ZXIA 2M19A 1CZPA 2W54A 4US9A 2PKOA 4C7YA 4ITKA 5EE3A 1WXQA 3NVYA 1TKYA 1AYFA 1TJEA 1RFKA 2W3SA 5G5GA 1DGJA 5AUIA 2WLBA 2BS4B 3P4RB 5H8YE 4YSYB 4C7ZA 1FRDA 2MH7A 4N59A 1UWMA 1VLBA 2Y5CA 3LB8C 3VR9B 3WCQA 3AE3B 1JQ4A 1PFDA 2QJLA 5AUKA 1ZOYB 3B2FA 3AM9A 3DWMA 2CJNA 1EWYC 5G5HA 1DOXA 3AB5A 4N6EB 1N61A 3AEEB 4ZHOA 3SFEB 3KWLA 2KMMA 3P63A 1OQRA 1NENB 4N58A 2BS2B 3AECB 2ACZB 2G1EA 3P1MA 3AE1B 4USAA 3SR6A 4YSZB 1TKEA 3RPFC 1WWTA 2BS3B 3W9CB 2W3RA 1NEKB 3AN1A 3EUB2 1QT9A 3DWGC 2PVOD 1F0ZA 4YTNB 2LEKA 3LXFA 1PDXA 1NYQA 1QF6A 1NVID 2M56B 1FFVA 1E0ZA 1J7AA 3ZYYX 1DOYA 2OHFA 2Q5WD 3P4SB 3SFDB 1QOAA 1JW9D 1WRIA 4FXCA 2WU5B 4P6VF 4ZHPA 1N5WA 4C80A 1A70A 4KX6B 5MPOA 1KF6B 1ZUD2 1IUEA 2K22A 5H92C 3CWIA 1T3QA 1E6EB 2JQRB 1FIQA 2MJ3A 3ABVB 3FC4A 1GAQB 4YTPB 4JX1C 3AE5B 5EE0A 2H89B 1I7HA 1XO3A 1NYRA 1J7CA 2L83A 2WP9B 3AH7A 3BIID 3NVVA 1FO4A 1FMAD 1OQQA 4LTUA 2MJDA 3CIRB 3L4PA 3W5UB 1AWDA 1FFUA 1JROA 1QOBA 2CJOA 2K5PA 3AEBB 4IDIA 1JWAD 1RYJA 5GXGB 4US8A 1GPXA 2K9XA 2PIAA 3P4PB 3AEFB 4HROA 1J7BA 2L52A 1FXAA 1SB3C 1QOGA 1N5XA 5EE9A 1N63A 3AE6B 3HVZA 1FRRA 1L5PA 2B76B 3B2GA 3W5VB 2HTME 4JWSC 1E9MA 1TKGA 1E7PB 1SF0A 1XLNA 3HRDD 3HUIA 2WDVB 3VRAB 1R7SA 5C2TB 1B9RA 1E10A 1V97A 3P4QB 2DWQA 3AEGB 1YQ3B 2DBYA 1NI3A 3AE2B 3ETRA 5C3JB 5EE1A 1WGKA
chains in the Genus database with same CATH superfamily
4XX5A 3SD5A 2G9HD 2NS5A 3ZGZA 2WYQA 1E90A 3NZSA 2PE6B 2KWVB 2PVGC 3DBLI 2C7HA 4LNKA 2Z59B 1CQVA 2UYZB 3RFZB 4ARIA 1WJ4A 3HVDA 2Y5PA 2ONQA 3HIZA 2ZPYA 4HPLB 3NZUA 3E56A 5TSSA 2AL3A 2BWES 3B9JA 4OZBA 2WS3B 2H88B 1WGRA 1KH0A 3W5VB 3AE9B 1VDVA 3HK0A 4IWPA 3L13A 3M63B 3RNBC 2LGSA 5G5GA 2NBUA 4G50A 3R7QA 5HKHA 2JUOA 3KWVA 4L2YA 2DX5B 1PFDA 2QJLA 1ZOYB 3OWEB 3QQ8B 4MDKE 2FIFA 2WXHA 2MEKA 4GMVA 2ZVOA 4RGTA 1LXDA 3AN1A 2DENB 2KO3A 1NVID 2D11A 4WJQA 2PPHA 4OZAA 1WY8A 1KM7A 1H4RA 3KYDD 1WH3A 1KF6B 5LXHA 2GBNA 2L32A 1H8CA 1L0XB 1SSNA 2MSED 4YTPB 3PRMB 2WP9B 4ZRIA 3L0WB 2IDYA 3K9OB 4ICVA 4ZRKA 4US8A 3QHTA 5CHWA 3T3NA 2L52A 4A3OA 2MBQA 3MFGA 4PT5A 4X57B 5CTRC 1K53A 2G45B 2I1JA 4EZJA 5AZGA 2JWUA 1V97A 4RM9A 1ZPSA 3Q3OC 2KK8A 3AEDB 3IT6B 2FE8A 5GMVA 1YJJA 3BWUD 1CMXB 2FCQA 4WWNA 3PREA 4P16A 1JWMD 1BT0A 3NS8A 4MACA 4HPPA 2V4LA 1D5XC 3VVWB 4B6WA 2CU3A 2N1VA 3SHQA 1PGAA 5LXIB 2VH1A 4YXDB 1JRUA 1BXTA 1WZ0A 3W2DA 4FLHA 3VH4B 1TJEA 1FPYA 2JSVX 4HKZE 5CX3A 3LB8C 3PHXB 3AM9A 4IOIE 3DWMA 1EWYC 1FXTB 5IKCM 1HE8A 5IN7A 1OQRA 1YX5B 2LUEA 4FADA 5E6PA 3SR6A 4YSZB 4OVUA 1F0ZA 2KWDA 2LEKA 1JCKB 1E0ZA 1J7AA 2HDEA 4MGIE 3T9LA 1ET9A 5LNK1 4WJNA 1I4PA 2LJIA 3VHTC 2D3GA 1K51A 2JQRB 4F1SA 4PK1A 4AQ7A 4WURA 3L4PA 4J3OD 5FKAC 4WAAA 4G11A 3KUZA 1FCLA 3HRDD 2KMAA 3HUIA 2L0FA 1WXMA 1ZW7A 4RMAA 2DBYA 3PPAA 4OZCA 4JGHB 4ZOHC 4K7SA 1QOFA 4P7IA 3DBRB 1GUAB 3I3TB 3ZO5B 1I4GA 2C7NB 2JVCA 3NY5A 2QEJC 1V8CA 3AE8B 1GB4A 4E71A 4W9JA 3AE4B 1V81A 5FR6A 3QCAA 5JHAA 2JYEA 1IBXA 5AZFA 2LZ6A 3Q3MC 3IHPC 4P1BC 3AV8A 1F9JA 3VTVA 3U8ZA 4BFRA 4LCDE 2N9KA 4A9AA 2Z0DB 1M94A 2GLSA 2WXIA 1KLVA 3PVLA 3HM3A 2AYOB 2QC8A 1P7EA 2ZEQA 4W9HA 3IFWB 1UBIA 1DOXA 2KFKA 4KSLC 2MWSB 4KKIA 2I1KA 3DCGA 2BS3B 3EUB2 3V3XA 1FNVA 2KC1A 3SU8X 2IO2B 2M0AA 2L7RA 2QILA 2R2OA 1N5WA 2LGDA 2JZ3B 4RH6A 2K0PA 1UGMA 1ZUD2 1FNUA 1WFYA 1C77A 3KW5B 1J8CA 4E3CA 4ACFA 3APFA 4EOYA 1E8YA 1ZDXA 2KHWB 1FFUA 1Q10A 2K5PA 2J4XA 1GB1A 2K9XA 2D3CA 3UIOB 3TJPA 1SB3C 3CMMB 3BY4B 1E9MA 2ZCCA 1E7PB 2LGYA 4XWWA 4HPMB 2LWPA 1WX9A 2NTTA 1U4AA 3NS1A 4KGSA 4OHJA 1SIJA 2PJHA 2KJ6A 3AMZA 2K3UA 1XQQA 1IBXB 2KAJA 4W9FA 1LM8B 4MH0E 2K1FA 5D94A 4DWFA 2O6VD 1ZP0B 2MLBA 1L0VB 4B95A 2KJRA 3VQIA 3M3JA 1PUTA 4FA6A 4JL9A 4YT0B 3Q6BA 3CSTA 5BMIA 2O6VA 2PKOA 3ZRFA 3S2AA 3C8YA 1JQ4A 2D10A 1V2YA 3UQAA 4IC7B 2K8BA 5FK9C 4NQKE 3KWLA 3MC8A 1TKEA 3DDCB 4TQ0A 1TS2A 2KDIA 2ZW0A 4L23A 1TS3A 4LJOB 4CHKA 2RGFA 4NQLB 2LHDA 2KDEB 2HJ8A 1UH6A 1KTKA 2WWZA 3ZW3A 3ZNHB 2MJ3A 4JE3B 2DAFA 2MW5A 2DZMA 2L83A 2NTSA 4IDIA 2V3SA 3RT3B 1J7BA 1F52A 1N5XA 3N3KB 5EE9A 1WXSA 2L3ZA 1ZGUB 4ANVA 1NI2A 3ML8A 4W9IA 2RD0A 4EEWA 5JXVA 3RNEC 1AARA 3L08A 5G2NA 3ETRA 1E7UA 3I9V1 3E9SA 2BQQA 3DBRI 1WGKA 3J9CA 4EKUA 4AJWA 2AEHA 3IG3A 3WALA 3RUIB 1Q0WB 4F8CB 3RNCC 2DNFA 4C00A 4AUQC 2GBJA 1XLQA 3NRZA 3B0AA 4NPNA 4LNNA 3PZ7A 2N0SB 2J0JA 3PTFC 1TS5A 3VUXA 4DXAB 2JZPA 5T8IA 2O6VB 1WGYA 4XYCA 2CHXA 2JY6A 2RDHA 4LDTD 3L10B 4KIKA 2IJ0A 4NZLB 2EKIA 4GGQA 3N1YC 1T5XD 4C7ZA 2WLBA 1L4ZB 3MJ5A 4TMAB 3Q14C 1QILA 1KJTA 2MBOA 4YL8A 3WAPA 4DDGD 3OJ4B 4DK5A 2KX0A 3RCZA 1WJ6A 3DVGX 4GSWA 3KUDB 4HWIB 3MHSD 2ZZPB 2KT7A 2JT4B 3UGBB 3AU5A 2Z8LA 2RPVA 1MFWA 1GNUA 3A9KA 1E6EB 2OJRA 1C9FA 1Q5WB 2WNMA 3QJZA 1J7CA 3Q8FA 4XWTA 2CHWA 3P42A 4TKNA 4IWOA 1VZ6A 2M4NA 2INPE 1VCBA 1WE7A 3M95A 3ZDTA 3APDA 1XXGA 1SF0A 5EE1A 3K9PB 1VZ7A 2JXXA 3OJ3A 3P2BA 2JXTA 2AQ1B 2KKCA 1PGBA 4XC2A 1WGGA 4KKJA 2QIEB 4LJPB 2NVUI 5BYRA 1UZXB 4KIKB 4DHZE 2GBKA 2V1YA 1KFYB 1KLUD 2N9EB 2JZZA 1V1OA 3GB1A 2C9WB 4MGYE 3L54A 2ASQA 5EE3A 4LDTB 3BINA 2BB5A 3LJ3A 4N59A 3GP7A 3IAS1 3AE3B 3UINB 1MG8A 1OGWA 2ZNVB 1P98A 3Q3JA 2RPQA 3P63A 2JF5A 1C76A 4M00A 2ACZB 3AE1B 3CF6E 3DWGC 3RNAC 2NCNA 2TSSA 1V86A 1PDXA 4S0RA 3A9KB 3IBEA 2LVPA 4GOCA 2D07B 2M17A 2WXMA 2K6DB 4WWOA 3SFDB 1QOAA 1SEBD 3L17A 4B0EA 2QCZA 4FHKA 4HKQA 3ABVB 3MHZA 1EWCA 4KGRA 4TSSA 2V4IB 3W5UB 3WAOA 1IPGA 1JWUD 2BTEA 2MBEA 2KMCA 4O1NA 4GB9A 4A8XC 2V9HA 3VXWA 4BZAA 4HLEA 2HTME 2J7QB 1B9RA 4N9F4 1WJUA 1GOZA 1D4BA 5C3JB 3SDLC 3QX1A 3MC0B 2IO3B 2KQSA 2M0XA 2WXQA 3KQ4A 3X0WA 2WDRB 2J0KA 5D7GA 1WR1A 1T0YA 3GE8C 3MC9A 1L6VA 1B1ZA 3BK2A 3EHVA 1C79A 2D3AA 1MHXA 3LYYA 4W9EA 5KHQA 1WMHA 1ROEA 2J42A 2X8XX 3URYA 1VD2A 1ENFA 1WYGA 1TYGB 2HE7A 4GU2A 1N60A 2E6XA 1IGDA 4C7YA 1TGZB 4BVUC 4F7ZA 1ZXHA 4KDIC 1S3SG 3AULA 2G4SA 3AXCA 1L7YA 3AEEB 4ZHOA 3DHGC 1JMLA 1V49A 1YD8U 3QAQA 4E74A 3Q3NC 1HXYD 4K1RB 5DPRA 1FEHA 1QT9A 3ENEA 2G4DB 2M56B 1PYWD 1WX8A 1ACCA 5CHVC 1EF5A 2EELA 3N1XC 2RMMA 2KDMA 2B3AA 4RF1A 2KJHB 4W9GA 5JZEB 4KX6B 2V3PA 2LGXA 2L1AA 4IUMB 3KYCD 1IUEA 2VRRB 4HVBA 2H89B 3AH7A 2VH2A 1WYWB 4LNIA 1K52A 4HDOA 4PS7A 3QIJA 2CJOA 2WHIA 3RD2A 3N30A 1GPXA 2IO1B 1E8XA 2GBMA 3TMPB 4PS3A 2WXPA 1S1QB 1SE9A 2GI9A 4MJSA 1NI3A 1V5OA 4GDKA 2LXCA 2EMSA 4A3PA 2MHJA 1I4HA 2W55A 3OAWA 3TL5A 5L83A 3ZQ4A 1GG3A 2OOBB 3IT4B 3BK1A 1WMHB 3PZDA 2KACA 3EA6A 2OJWA 1L6UA 2LVQA 5TR5A 1T0RC 4AJYB 1EF1A 2XN9C 2BYTA 2XBBC 2LMCA 5BMHA 4ICUA 2BVCA 3V6EB 3UQBA 1QKZA 1Z2MA 3H7PA 2BYVE 4B9KA 4II3B 1P3QU 3OG5A 1RFKA 1DGJA 3MTNB 2DYOA 1UWMA 5I4DA 3A4SC 3Q3FA 2WXGA 2GB1A 4WJOA 3PGEA 4GN1A 3SFEB 3DBSA 2KMMA 2XNAC 4DDID 1D5MC 3V05A 1BUIC 3BVMA 1ESFA 1QF6A 1HTOA 5LLIA 3ZYYX 1FNWA 2WXNA 3N32A 2Q5WD 2ZNVC 4CO7A 1GJZA 3R3MA 1JW9D 1WRIA 1A70A 3UF8A 5MPOA 2LGIA 2FUG1 4WH4A 3PLUA 3IXSA 3R2IA 3UI3A 2K25A 1Z5SB 3FC4A 2MX2A 2W82A 1T0SC 2KQ7A 1D5ZC 2C5LC 2LXAA 3TEYA 1OEYA 4IW0A 2EMTA 1RYJA 2J53A 2G3QB 2WX0A 1ZDVA 3QARA 4MJSB 1TTNA 4KV2A 2KD0A 1WR6E 3HVZA 2ZCBA 4GDKB 4W9CA 2WGSA 4II2B 4EE2A 3IAM1 2HD5B 2BF8B 3GS2A 4OVZA 4ZYNA 4EZLA 1TZ1A 2PLPA 3EGRA 1FCCC 3DVNU 5KHOA 3NHEB 1WSPA 3H8HA 3C19A 3N20C 2JPHA 2SEBD 2UWQA 3FAHA 5HI1A 2INCC 3PO0A 3H7PB 3B1LX 2EKEC 3RZWC 3U52E 1WF9A 4RF0A 1PQSA 2DZKA 1ZXIA 2JYTA 2DAJA 1WM3A 3VR9B 4GDLA 3EFUA 2W9NA 2IZVB 3PHWB 2CJNA 1XF5L 1T0QC 4MELA 3GZNB 4OVVA 4MM3A 2N7JA 4IM0A 4LNFA 2L00B 5IP4D 2MP2A 2KFKB 5D3DA 3M62B 1SE3A 2NPTA 3P4SB 3I5JC 4FXCA 2IY1B 3IVFA 4FJZA 4K81A 2INDC 1WZ3A 5H92C 2KNBA 1ISNA 3ML9A 2BW2A 3NVVA 1DYQA 4EZKA 1FMAD 2RSUA 4RCOA 2PW9A 1SE4A 2FIDA 5DPTA 3P4PB 3HHMA 3ZJVA 4JIOU 3AE6B 2B76B 4TV3A 3ZLZA 1I35A 4L1BA 3VRAB 5C2TB 3WA0A 4ANUA 4BOSC 4GXBA 4P1CC 4JWUC 2A4ZA 5HG2A 1CK1A 2JWZA 2KX3A 1MI0A 1N62A 3TIXA 4A6QA 2ICIA 1UF0A 3B08A 1UBQA 3I63C 4DBGA 2MA9B 3U30A 2LD9A 2REXA 2KDBA 4TUUA 2AX5A 5DCNA 3ZXVA 4WWPA 1DOIA 1P0RA 2CHZA 2LUMA 4GDLB 1FXIA 2M19A 2CR5A 2FNJB 2W54A 4ITKA 1TKYA 2WDTB 2DZIA 4BBNF 1QQRA 4AWJA 4MM3B 3AB5A 4ASWC 4GLSC 1N61A 3ZNZB 3ZVVA 1STEA 2MP2B 4NJ7A 1WWTA 1UWXA 1NEKB 2NPTB 1ET6A 4YTNB 2BKRB 3BYYB 3Q8BA 4DXFA 1DOYA 4HJKA 4MEMA 2PMVA 1RFAA 2IPKD 2K22A 2MQJA 4ANXA 4HCPB 3TUOA 1NYRA 1YN3A 1YX6B 3EFCA 1QOBA 1JROA 2IO0B 3VH3B 3MP9A 1JWAD 1K50A 2K8HA 5AEKB 4ARCA 2DYMA 5E6NA 3RMKC 1HZ6A 2BYEA 3B2GA 2K39A 4RGOS 3TEWA 1TKGA 1SIFA 5J17A 1G6JA 3GE3C 1HA5A 4I6LB 3ZRCA 1F77A 4FJVB 1VJKA 1YJIA 1EO6A 3VR8B 5FR3A 4BAXA 2X38A 2RDGA 3R8BA 5D3IB 4B0MA 2KWCA 3AE7B 2CS4A 4K3BA 4XE0A 4WQMA 2K8CA 3APCA 2BPSA 3JW0X 3KVFB 2IGDA 4R3DA 2L0TA 2LI5A 1VZ8A 4W9LA 1T6BX 2WXOA 5D2MB 1M4VA 4H2AA 3VRBB 4LNOA 1RM6C 2CKHB 2E3TA 2A5UA 1F2RI 4K3CA 3PT2B 2LVOA 1HEZE 2AWTA 2QDFA 1IP9A 3RULA 2MRPA 1R4MB 1YIWA 5H8YE 2AQ3B 1VLBA 4NAWA 1C1YB 5EDSA 2QMTA 3X23A 4RFBA 2N9LA 3GZNI 4A90A 2GRIA 3ZNGC 2BS2B 4AOFA 3AECB 2M8SA 2INNE 3BVZA 1SJHD 3T8MA 1F2RC 4WAFA 4FN2A 3H7SA 2YEPF 3JYUA 3VTUA 1C4CA 2PE9A 4D2KA 4P6VF 2WU5B 2NR2A 3AE5B 1I7HA 2J0MA 3N1ZC 4M8NA 5J18A 3CIRB 1C78A 4IKGA 4BKTA 5D6JB 2PIAA 3FILA 2DYBA 3W1SA 1A5RA 1J19A 1OEYJ 2KLCA 3RNGC 3RNFC 1Y56A 1XLNA 3LDZE 4IWQA 3KUCB 2FCSA 4WQOB 3A1QA 2M1MA 1E7VA 3EC8A 2WU2B 4PYUA 2KFJA 1ZKHA 1I4RA 1RWSA 1JALA 2I2YA 5HHDG 1P1AA 1X1MA 4ZDVA 2LRUA 1WJNA 1QLBB 2HJ1A 1TY0A 4FBJB 2BYFA 1HTQA 1ZE3D 2DHZA 2MBHA 3ECIA 5BMGA 1OFFA 3VTWA 4NAWB 1C4AA 1GC7A 4KVGB 4NNJB 2W3SA 5AZHA 5J2RA 5AUIA 3H6NA 1YOVB 4IG7B 2MH7A 3Q2AC 2C60A 3B2FA 5G5HA 2RDBC 2KTFA 4PS8A 4KGTA 2G1EA 5CHFA 3P1MA 4USAA 4I6PA 3VUYA 3PSEB 3W9CB 1WXAA 2DZJA 1UNSA 4LLGM 3R66C 3A4RA 1P7FA 3BZDB 2ZPNA 4IM2A 4NY0A 1WXVA 2NBWB 2GMIC 3FILB 1V6EA 1HZ5A 4MGZE 5DPSA 4XZ4A 1AWDA 1YQBA 2AL6A 1SXTA 3H9DA 3ZJUA 1WX7A 4HROA 3TBLD 2KOXA 1N63A 2KN5A 1FRRA 3OLMD 3A1QB 2ON8A 4J6IA 1R7SA 2V3NA 3PLVA 4PYZA 2N7DA 4XGAB 1V1PA 2AQ2B 4URKA 1UD7A 5JHBA 3DVGY 3SEBA 1EU4A 1CJEA 4S17A 2JRHA 3KLSX 1JRPA 1TBEA 3DHHC 4HCNB 4DHZB 1LQBA 2MBBB 5IAAC 3DVNV 2WQYB 3DBHB 1IGCA 3BVGA 2FBWB 5C23A 2MCNB 2QHOA 2ZVNA 4WIPA 1RLFA 4BOZB 1R4MI 1WXQA 4G0NB 1TT5B 3N9YC 4FHJA 4YSYB 2L76A 2V0GA 5AUKA 1L0YB 1E8ZA 4IM3A 3Q8AA 3R7RA 3V61A 1FD6A 3RYTA 2RR9A 3ZXRA 4DQOC 1N6ZA 2NMQA 1P9DU 4NAMA 1K8RB 2D5GA 2WXFA 3VUWA 3O65B 3ZKJC 4HDQA 2GBRA 4CYEA 1WIAA 2R61A 3CWIA 2I38A 1C4PA 2BB6A 1FO4A 2YLMA 1SE2A 5GXGB 4MSMB 5C1ZA 4M0WA 2BWFA 2N1WA 1FXAA 1KLGD 1V1PB 1R4NB 5G55A 3CSFA 3KH0A 1E10A 1XD3B 3P4QB 3WAMA 3AEGB 4BKGA 3DQVA 1XCTL 3RN9C 3ZJTA 3U7ZA 4DXGA 4YTMB 3JSVA 4JQWC 1I42A 3L16A 3Q8CA 1MHHE 5IO9A 3NG0A 1VRAB 1KRHA 4YSXB 3R2TA 1GC6A 4HEA1 4TQ1A 5L95C 1MVKA 1E8WA 1VR9A 3ZTCA 1SBBB 3BYTB 3ZUNA 2GOWA 4AP4C 2D2QA 2QSDA 2Y3AA 3VAWA 3NVWA 3ZNID 4C56C 3PRZA 1I4XA 1BMLC 4US9A 2FCMA 3WIMA 1QZEA 2FCNA 4KDLB 2N7EA 2KVZA 4W9KA 1AN8A 3WCQA 3ZDMC 2JRIB 1WM2A 4N6EB 2C7MB 2IGGA 1NENB 4N58A 4MT5A 1XT9B 1LO5D 2SAKA 3RPFC 2Y5BB 2N9PC 2KVRA 1UELA 4HXDA 3LXFA 1NYQA 2OHFA 1WGDA 1V5TA 4ZHPA 2L8JA 4C4VA 1T3QA 1FIQA 2KTRA 3BIID 1XO3A 4M0WB 2IY0B 3V62A 2K6QA 3Q69A 1WRDB 2KN4A 2OEDA 3NZ3A 5BYSA 2ZJDA 3U7DA 2XK5A 2KZRA 3O13A 3DPDA 4ZRPA 1MJDA 1SGHA 1WI0A 2FAZA 2LRWA 2BBCA 1UUPA 4EFOA 1AW7A 4ZYSA 4EUTA 4OW0A 1F1HA 2WDVB 1IYFA 1NBFC 2XEWA 5JH5C 1WGHA 3JSVB 3EECA 2LHEA 2JU6X 3A9JA 3PZ8A 3W1SC 2LJ5A 3JVZX 4RGMA 1E5WA 1YMHE 1NDDA 3NOBA 1XLOA 2IBIB 3NJTA 3RZFA 2J52A 3TEZA 2KANA 2BT6A 1I4QA 4MGKE 4K7WA 4LK0M 2WDQB 1MG4A 3DBLB 4M02A 2PEAA 1JWBD 2JX5A 1Q1OA 1LFDA 3PV1A 3DBHI 3WANA 2MJEA 3U4EG 3TCAA 3W1YA 1XCQL 3ONSA 1XLPA 2WXRA 2D3BA 2ZW1A 1YN5A 3AEAB 1FM0D 4FULA 5E6JA 2HTHA 2CU1A 3U2SC 1V9JA 4AS1A 3NVYA 1AYFA 3V60A 2BS4B 3P4RB 2YEPB 1TY2A 4XDCA 1FRDA 2Z0EB 1OTRB 2Y5CA 3TEXA 1TS4A 1RRBA 3QA8A 3PS6A 4FJYA 3QC8B 5BYQA 2KLGA 2WX1A 4KZCA 1C3TA 4HJGE 1EM7A 2PVOD 3A33B 3ZIMA 1D3ZA 3FKYA 4C4VB 2O2VA 4REZA 1FFVA 2KWUB 2KTRB 2WXLA 4C80A 4W9DA 3C0RB 4DHJD 2N4FA 2WXJA 2VZKD 1GAQB 4JPSA 1SJED 4JX1C 2XK5B 3T3OA 4M01A 4WJPA 1OQQA 4QAYA 2MJDA 3AEBB 1YNTE 4M8MA 1TZOA 4RM8A 1RAXA 3Q8EA 1V80A 5IA7A 1R4NI 3V6CB 3A9JB 1J0GA 2KQ4X 4JWSC 1YJ1A 4GIVA 2LASA 3HM6X 3UIPB 4KSKC 2DWQA 3AE2B 4NJCA 1OQYA 3ALBA 4RNAA 4UDUC 4WWMA 4CQNA 3GOEA 4KZ0A 2UU7A 4HRSA 1YQ4B 1JWSD 3VDZA 5IOIA 2R2QA 1Y8RC 3NVZA 3PRPB 3I57A 2N9XA 3DHIC 3AU4A 4MH8A 2NBVB 1CZPA 1EU3A 2PTLA 3DOWA 1LGRA 4BBNC 5DPWA 3NUHB 2KYWA 5E6OA 2BKFA 2BGFA 1PGXA 2WXKA 2O2VB 3VFKA 3ZTDA 3MJWA 4A55A 5BO4B 2FUHB 4G3XB 2W3RA 4BKSD 4NJ6A 4XDDA 3AI5A 4HK2A 1D6EC 1UGJA 3H1UA 4ANWA 4RGNA 2IYDB 1WE6A 4Q2JA 4A20A 4MSQB 4ZRQA 4ZRJA 1XEEA 2KC2A 3RI7C 5EE0A 4BKSA 5HFYA 4YWGG 1KOTA 1YN4A 4LTUA 4DHJB 2IGHA 2VZKB 2KXJA 3D32A 2DLBA 3AEFB 3QWZB 1MPEA 1QOGA 1L2NA 1L5PA 2KDFB 2YVCA 1L4DB 3QK0A 4I6NB 1HQRD 4K7UA 2LFIA 1EUVB 1TIFA 2L05A 4JLCA 1YQ3B 3TSSA
chains in the Genus database with same CATH topology
4OVZA 2G9HD 2AQ2B 3SEBA 2PLPA 3ZGZA 3EGRA 1FCCC 1EU4A 1CJEA 3KLSX 1WSPA 2PVGC 3H8HA 1XLQA 1CQVA 3NRZA 3RFZB 2SEBD 1JRPA 4ARIA 3FAHA 5HI1A 3HVDA 2Y5PA 3PZ7A 2ONQA 3PO0A 2N0SB 5TSSA 3E56A 3B9JA 4OZBA 2WS3B 1TS5A 2WQYB 1IGCA 3BVGA 2JZPA 2H88B 5T8IA 1KH0A 2FBWB 3W5VB 2RDHA 3AE9B 3U52E 1VDVA 4RF0A 2IJ0A 4NZLB 4WIPA 2EKIA 1ZXIA 2JYTA 1T5XD 1WXQA 5G5GA 4C7ZA 3N9YC 2WLBA 1L4ZB 3MJ5A 4YSYB 3VR9B 3KWVA 4L2YA 4TMAB 1QILA 2V0GA 1PFDA 2QJLA 5AUKA 1ZOYB 3OWEB 1L0YB 2CJNA 3Q8AA 1XF5L 1FD6A 4DQOC 2N7JA 2WXHA 2MEKA 2NMQA 4RGTA 3AN1A 4NAMA 2WXFA 2D5GA 1NVID 2Z8LA 5D3DA 2RPVA 1SE3A 3P4SB 4FXCA 4OZAA 2R61A 1KF6B 2L32A 5H92C 3CWIA 1E6EB 1L0XB 1C9FA 1SSNA 2I38A 4YTPB 1C4PA 2BB6A 2BW2A 2WNMA 2WP9B 1J7CA 3NVVA 1FO4A 3Q8FA 1DYQA 4XWTA 1FMAD 2IDYA 3P42A 4RCOA 1VZ6A 2PW9A 1SE4A 2INPE 4US8A 1SE2A 5GXGB 3T3NA 4M0WA 3P4PB 2L52A 1FXAA 1KLGD 3ZJVA 3AE6B 1V1PB 1XXGA 2B76B 3MFGA 4PT5A 1SF0A 4L1BA 1K53A 3VRAB 5C2TB 2JWUA 1E10A 1V97A 3P4QB 3AEGB 1ZPSA 5EE1A 4JWUC 3AEDB 1XCTL 3IT6B 2FE8A 3ZJTA 1VZ7A 1CK1A 1YJJA 3BWUD 5HG2A 3U7ZA 4DXGA 4YTMB 1MI0A 1MHHE 1N62A 3Q8CA 1VRAB 1KRHA 2JXTA 4YSXB 3R2TA 2AQ1B 1PGBA 4HEA1 4TQ1A 4KKJA 1MVKA 2ICIA 4A6QA 1VR9A 4P16A 1SBBB 2QIEB 1JWMD 5BYRA 3BYTB 4MACA 2QSDA 2Y3AA 1D5XC 1KFYB 1KLUD 2CU3A 2AX5A 1DOIA 1V1OA 3GB1A 3NVWA 1PGAA 2LUMA 4YXDB 4GDLB 4C56C 1FXIA 2M19A 1BXTA 1I4XA 1BMLC 2W54A 4US9A 4ITKA 5EE3A 3W2DA 1TKYA 1TJEA 2JSVX 1QQRA 2BB5A 4HKZE 4N59A 1AN8A 3WCQA 3GP7A 3IAS1 3LB8C 3AE3B 4MM3B 3AM9A 4IOIE 3DWMA 1EWYC 3AB5A 4N6EB 4GLSC 1N61A 2IGGA 3P63A 1OQRA 1NENB 4N58A 1C76A 4MT5A 2ACZB 1STEA 3AE1B 1LO5D 3SR6A 4YSZB 2SAKA 3RPFC 1WWTA 1UWXA 1NEKB 1ET6A 3DWGC 1F0ZA 4YTNB 2TSSA 2KWDA 2LEKA 3LXFA 1PDXA 1NYQA 3BYYB 3Q8BA 1JCKB 1E0ZA 1J7AA 2HDEA 4DXFA 1DOYA 2OHFA 2WXMA 3SFDB 2PMVA 1QOAA 1SEBD 1ET9A 4ZHPA 5LNK1 4B0EA 2IPKD 1I4PA 2LJIA 1K51A 4HKQA 2K22A 1T3QA 2JQRB 3ABVB 1FIQA 3MHZA 1EWCA 3BIID 1XO3A 1NYRA 3TUOA 1YN3A 3Q69A 4KGRA 4AQ7A 4WURA 2KN4A 4TSSA 2V4IB 2OEDA 3L4PA 1QOBA 1JROA 3NZ3A 3W5UB 5BYSA 1JWUD 1JWAD 3MP9A 1K50A 4J3OD 3O13A 2BTEA 4ZRPA 4ARCA 2DYMA 5FKAC 4O1NA 2BBCA 1UUPA 4A8XC 1HZ6A 1AW7A 3B2GA 4ZYSA 2HTME 4RGOS 3TEWA 1FCLA 1TKGA 3HRDD 4OW0A 3HUIA 2WDVB 1B9RA 1GOZA 2LHEA 2JU6X 3PZ8A 2DBYA 1D4BA 5C3JB 1HA5A 3MC0B 4OZCA 1F77A 4RGMA 1YMHE 4ZOHC 1QOFA 1VJKA 1YJIA 3VR8B 5FR3A 1XLOA 2WXQA 3KQ4A 2X38A 2WDRB 2J52A 2RDGA 3R8BA 2BT6A 3TEZA 1I4QA 5D3IB 4B0MA 1I4GA 3AE7B 2QEJC 5D7GA 1V8CA 3AE8B 1GB4A 4LK0M 3J9CA 4WQMA 4XE0A 2WDQB 1L6VA 3AE4B 1JWBD 2JX5A 2IGDA 4R3DA 1B1ZA 3BK2A 1C79A 2JYEA 1IBXA 3LYYA 1MHXA 1VZ8A 1T6BX 2WXOA 2MJEA 3U4EG 1M4VA 1ROEA 2J42A 4H2AA 3URYA 1XCQL 1XLPA 2WXRA 3AV8A 2ZW1A 1ENFA 3VRBB 1WYGA 1TYGB 1YN5A 3AEAB 1FM0D 5E6JA 2N9KA 1RM6C 2E3TA 1N60A 4A9AA 1F2RI 2E6XA 1HEZE 1IGDA 2WXIA 3U2SC 4C7YA 4AS1A 3NVYA 1AYFA 1ZXHA 2BS4B 3P4RB 2YEPB 1TY2A 4XDCA 5H8YE 1FRDA 1P7EA 2AQ3B 1VLBA 2Y5CA 2QMTA 4RFBA 1DOXA 3TEXA 2N9LA 1TS4A 3AEEB 4ZHOA 4A90A 2GRIA 1JMLA 4KKIA 2BS2B 3AECB 5BYQA 3BVZA 2INNE 1SJHD 1HXYD 2BS3B 1F2RC 4HJGE 4WAFA 3EUB2 1FEHA 1EM7A 1QT9A 2PVOD 3V3XA 1FNVA 2YEPF 2M56B 1PYWD 4REZA 1ACCA 1FFVA 1C4CA 2EELA 2RMMA 2KDMA 4D2KA 4P6VF 2M0AA 4RF1A 2QILA 2WU5B 2WXLA 1N5WA 4C80A 4RH6A 4KX6B 2V3PA 2K0PA 2L1AA 1ZUD2 1IUEA 1FNUA 2WXJA 2VZKD 1GAQB 4JPSA 1C77A 1SJED 3AE5B 4JX1C 3T3OA 2H89B 1I7HA 3AH7A 1OQQA 1K52A 2MJDA 1ZDXA 3CIRB 1C78A 1YNTE 1FFUA 2K5PA 1Q10A 2CJOA 2J4XA 3AEBB 1TZOA 4IKGA 1GB1A 1GPXA 2K9XA 2PIAA 3FILA 3Q8EA 3W1SA 1SB3C 2KQ4X 1Y56A 4JWSC 1E9MA 1E7PB 2WXPA 1XLNA 4XWWA 2GI9A 2NTTA 2DWQA 3AE2B 1NI3A 4NJCA 3NS1A 2WU2B 4KGSA 4OHJA 1I4HA 1SIJA 2W55A 4RNAA 3AMZA 1I4RA 4UDUC 1RWSA 4WWMA 1JALA 2K3UA 4CQNA 2I2YA 5HHDG 1IBXB 3ZQ4A 2KAJA 3IT4B 3BK1A 2KACA 3EA6A 1ZP0B 1L6UA 1QLBB 4HRSA 1TY0A 1L0VB 2XN9C 1YQ4B 1JWSD 2BYTA 2LMCA 5BMHA 1ZE3D 3VQIA 3NVZA 1PUTA 3I57A 4YT0B 5BMGA 1OFFA 4MH8A 4NAWB 1C4AA 1QKZA 5BMIA 1CZPA 2PKOA 1EU3A 2PTLA 1RFKA 2W3SA 1DGJA 5AUIA 2DYOA 3C8YA 2MH7A 1UWMA 3NUHB 1JQ4A 3B2FA 5G5HA 5I4DA 2WXGA 2GB1A 5FK9C 3SFEB 3KWLA 2KMMA 1PGXA 4KGTA 2WXKA 2G1EA 3P1MA 2XNAC 4A55A 4USAA 1D5MC 1TKEA 3V05A 3W9CB 1BUIC 4TQ0A 2W3RA 3BVMA 1ESFA 1TS2A 1UNSA 2ZW0A 4LLGM 4XDDA 4L23A 1QF6A 1TS3A 1D6EC 1UGJA 3ZYYX 2LHDA 1FNWA 4RGNA 2WXNA 1KTKA 2Q5WD 1JW9D 1WRIA 1P7FA 3BZDB 4Q2JA 4ZRQA 1A70A 5MPOA 2LGIA 2FUG1 4WH4A 3IXSA 3R2IA 3UI3A 2MJ3A 3FC4A 4JE3B 1XEEA 5EE0A 2W82A 2L83A 3FILB 2NTSA 5HFYA 4YWGG 1YN4A 1HZ5A 1D5ZC 4LTUA 3TEYA 2IGHA 1AWDA 4IDIA 2VZKB 1RYJA 2J53A 1SXTA 2DLBA 3ZJUA 1ZDVA 3AEFB 4HROA 1J7BA 1N5XA 1MPEA 1QOGA 5EE9A 1N63A 3HVZA 1FRRA 1L5PA 1L4DB 2ON8A 4GDKB 1HQRD 1R7SA 2LFIA 2V3NA 5JXVA 4EE2A 3IAM1 1YQ3B 3ETRA 3I9V1 3TSSA 1V1PA 3E9SA 1WGKA 3GS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JWU C;  3AED B;  4ZOH C;  1QOF A;  1VJK A;  1YJI A;  2WU2 B;  3NS1 A;  1XLO A;  3VR8 B;  1YJJ A;  4YTM B;  1SIJ A;  2WDR B;  1CJE A;  2W55 A;  2BT6 A;  1N62 A;  3AMZ A;  1RWS A;  4WWM A;  3AE7 B;  1KRH A;  1JAL A;  4YSX B;  1V8C A;  2PVG C;  3AE8 B;  2KAJ A;  4WQM A;  2WDQ B;  1XLQ A;  3NRZ A;  1JRP A;  1L6V A;  2QIE B;  3AE4 B;  1JWB D;  1L6U A;  1ZP0 B;  1QLB B;  2JX5 A;  3FAH A;  4HRS A;  3PO0 A;  1L0V B;  2N0S B;  1YQ4 B;  3B9J A;  2WS3 B;  2MJE A;  2WQY B;  1ROE A;  1KFY B;  1XLP A;  2H88 B;  2CU3 A;  2FBW B;  3AV8 A;  3VRB B;  2AX5 A;  1TYG B;  1PUT A;  1VDV A;  1FM0 D;  1WYG A;  3AE9 B;  3AEA B;  3NVZ A;  4YT0 B;  1DOI A;  1OFF A;  1RM6 C;  2E3T A;  1N60 A;  3NVW A;  4A9A A;  4YXD B;  1FXI A;  2EKI A;  1ZXI A;  2M19 A;  1CZP A;  2W54 A;  4US9 A;  2PKO A;  4C7Y A;  4ITK A;  5EE3 A;  1WXQ A;  3NVY A;  1TKY A;  1AYF A;  1TJE A;  1RFK A;  2W3S A;  5G5G A;  1DGJ A;  5AUI A;  2WLB A;  2BS4 B;  3P4R B;  5H8Y E;  4YSY B;  4C7Z A;  1FRD A;  2MH7 A;  4N59 A;  1UWM A;  1VLB A;  2Y5C A;  3LB8 C;  3VR9 B;  3WCQ A;  3AE3 B;  1JQ4 A;  1PFD A;  2QJL A;  5AUK A;  1ZOY B;  3B2F A;  3AM9 A;  3DWM A;  2CJN A;  1EWY C;  5G5H A;  1DOX A;  3AB5 A;  4N6E B;  1N61 A;  3AEE B;  4ZHO A;  3SFE B;  3KWL A;  2KMM A;  3P63 A;  1OQR A;  1NEN B;  4N58 A;  2BS2 B;  3AEC B;  2ACZ B;  2G1E A;  3P1M A;  3AE1 B;  4USA A;  3SR6 A;  4YSZ B;  1TKE A;  3RPF C;  1WWT A;  2BS3 B;  3W9C B;  2W3R A;  1NEK B;  3AN1 A;  3EUB 2;  1QT9 A;  3DWG C;  2PVO D;  1F0Z A;  4YTN B;  2LEK A;  3LXF A;  1PDX A;  1NYQ A;  1QF6 A;  1NVI D;  2M56 B;  1FFV A;  1E0Z A;  1J7A A;  3ZYY X;  1DOY A;  2OHF A;  2Q5W D;  3P4S B;  3SFD B;  1QOA A;  1JW9 D;  1WRI A;  4FXC A;  2WU5 B;  4P6V F;  4ZHP A;  1N5W A;  4C80 A;  1A70 A;  4KX6 B;  5MPO A;  1KF6 B;  1ZUD 2;  1IUE A;  2K22 A;  5H92 C;  3CWI A;  1T3Q A;  1E6E B;  2JQR B;  1FIQ A;  2MJ3 A;  3ABV B;  3FC4 A;  1GAQ B;  4YTP B;  4JX1 C;  3AE5 B;  5EE0 A;  2H89 B;  1I7H A;  1XO3 A;  1NYR A;  1J7C A;  2L83 A;  2WP9 B;  3AH7 A;  3BII D;  3NVV A;  1FO4 A;  1FMA D;  1OQQ A;  4LTU A;  2MJD A;  3CIR B;  3L4P A;  3W5U B;  1AWD A;  1FFU A;  1JRO A;  1QOB A;  2CJO A;  2K5P A;  3AEB B;  4IDI A;  1JWA D;  1RYJ A;  5GXG B;  4US8 A;  1GPX A;  2K9X A;  2PIA A;  3P4P B;  3AEF B;  4HRO A;  1J7B A;  2L52 A;  1FXA A;  1SB3 C;  1QOG A;  1N5X A;  5EE9 A;  1N63 A;  3AE6 B;  3HVZ A;  1FRR A;  1L5P A;  2B76 B;  3B2G A;  3W5V B;  2HTM E;  4JWS C;  1E9M A;  1TKG A;  1E7P B;  1SF0 A;  1XLN A;  3HRD D;  3HUI A;  2WDV B;  3VRA B;  1R7S A;  5C2T B;  1B9R A;  1E10 A;  1V97 A;  3P4Q B;  2DWQ A;  3AEG B;  1YQ3 B;  2DBY A;  1NI3 A;  3AE2 B;  3ETR A;  5C3J B;  5EE1 A;  1WGK A; 
#chains in the Genus database with same CATH topology
 4XX5 A;  3SD5 A;  2G9H D;  2NS5 A;  3ZGZ A;  2WYQ A;  1E90 A;  3NZS A;  2PE6 B;  2KWV B;  2PVG C;  3DBL I;  2C7H A;  4LNK A;  2Z59 B;  1CQV A;  2UYZ B;  3RFZ B;  4ARI A;  1WJ4 A;  3HVD A;  2Y5P A;  2ONQ A;  3HIZ A;  2ZPY A;  4HPL B;  3NZU A;  3E56 A;  5TSS A;  2AL3 A;  2BWE S;  3B9J A;  4OZB A;  2WS3 B;  2H88 B;  1WGR A;  1KH0 A;  3W5V B;  3AE9 B;  1VDV A;  3HK0 A;  4IWP A;  3L13 A;  3M63 B;  3RNB C;  2LGS A;  5G5G A;  2NBU A;  4G50 A;  3R7Q A;  5HKH A;  2JUO A;  3KWV A;  4L2Y A;  2DX5 B;  1PFD A;  2QJL A;  1ZOY B;  3OWE B;  3QQ8 B;  4MDK E;  2FIF A;  2WXH A;  2MEK A;  4GMV A;  2ZVO A;  4RGT A;  1LXD A;  3AN1 A;  2DEN B;  2KO3 A;  1NVI D;  2D11 A;  4WJQ A;  2PPH A;  4OZA A;  1WY8 A;  1KM7 A;  1H4R A;  3KYD D;  1WH3 A;  1KF6 B;  5LXH A;  2GBN A;  2L32 A;  1H8C A;  1L0X B;  1SSN A;  2MSE D;  4YTP B;  3PRM B;  2WP9 B;  4ZRI A;  3L0W B;  2IDY A;  3K9O B;  4ICV A;  4ZRK A;  4US8 A;  3QHT A;  5CHW A;  3T3N A;  2L52 A;  4A3O A;  2MBQ A;  3MFG A;  4PT5 A;  4X57 B;  5CTR C;  1K53 A;  2G45 B;  2I1J A;  4EZJ A;  5AZG A;  2JWU A;  1V97 A;  4RM9 A;  1ZPS A;  3Q3O C;  2KK8 A;  3AED B;  3IT6 B;  2FE8 A;  5GMV A;  1YJJ A;  3BWU D;  1CMX B;  2FCQ A;  4WWN A;  3PRE A;  4P16 A;  1JWM D;  1BT0 A;  3NS8 A;  4MAC A;  4HPP A;  2V4L A;  1D5X C;  3VVW B;  4B6W A;  2CU3 A;  2N1V A;  3SHQ A;  1PGA A;  5LXI B;  2VH1 A;  4YXD B;  1JRU A;  1BXT A;  1WZ0 A;  3W2D A;  4FLH A;  3VH4 B;  1TJE A;  1FPY A;  2JSV X;  4HKZ E;  5CX3 A;  3LB8 C;  3PHX B;  3AM9 A;  4IOI E;  3DWM A;  1EWY C;  1FXT B;  5IKC M;  1HE8 A;  5IN7 A;  1OQR A;  1YX5 B;  2LUE A;  4FAD A;  5E6P A;  3SR6 A;  4YSZ B;  4OVU A;  1F0Z A;  2KWD A;  2LEK A;  1JCK B;  1E0Z A;  1J7A A;  2HDE A;  4MGI E;  3T9L A;  1ET9 A;  5LNK 1;  4WJN A;  1I4P A;  2LJI A;  3VHT C;  2D3G A;  1K51 A;  2JQR B;  4F1S A;  4PK1 A;  4AQ7 A;  4WUR A;  3L4P A;  4J3O D;  5FKA C;  4WAA A;  4G11 A;  3KUZ A;  1FCL A;  3HRD D;  2KMA A;  3HUI A;  2L0F A;  1WXM A;  1ZW7 A;  4RMA A;  2DBY A;  3PPA A;  4OZC A;  4JGH B;  4ZOH C;  4K7S A;  1QOF A;  4P7I A;  3DBR B;  1GUA B;  3I3T B;  3ZO5 B;  1I4G A;  2C7N B;  2JVC A;  3NY5 A;  2QEJ C;  1V8C A;  3AE8 B;  1GB4 A;  4E71 A;  4W9J A;  3AE4 B;  1V81 A;  5FR6 A;  3QCA A;  5JHA A;  2JYE A;  1IBX A;  5AZF A;  2LZ6 A;  3Q3M C;  3IHP C;  4P1B C;  3AV8 A;  1F9J A;  3VTV A;  3U8Z A;  4BFR A;  4LCD E;  2N9K A;  4A9A A;  2Z0D B;  1M94 A;  2GLS A;  2WXI A;  1KLV A;  3PVL A;  3HM3 A;  2AYO B;  2QC8 A;  1P7E A;  2ZEQ A;  4W9H A;  3IFW B;  1UBI A;  1DOX A;  2KFK A;  4KSL C;  2MWS B;  4KKI A;  2I1K A;  3DCG A;  2BS3 B;  3EUB 2;  3V3X A;  1FNV A;  2KC1 A;  3SU8 X;  2IO2 B;  2M0A A;  2L7R A;  2QIL A;  2R2O A;  1N5W A;  2LGD A;  2JZ3 B;  4RH6 A;  2K0P A;  1UGM A;  1ZUD 2;  1FNU A;  1WFY A;  1C77 A;  3KW5 B;  1J8C A;  4E3C A;  4ACF A;  3APF A;  4EOY A;  1E8Y A;  1ZDX A;  2KHW B;  1FFU A;  1Q10 A;  2K5P A;  2J4X A;  1GB1 A;  2K9X A;  2D3C A;  3UIO B;  3TJP A;  1SB3 C;  3CMM B;  3BY4 B;  1E9M A;  2ZCC A;  1E7P B;  2LGY A;  4XWW A;  4HPM B;  2LWP A;  1WX9 A;  2NTT A;  1U4A A;  3NS1 A;  4KGS A;  4OHJ A;  1SIJ A;  2PJH A;  2KJ6 A;  3AMZ A;  2K3U A;  1XQQ A;  1IBX B;  2KAJ A;  4W9F A;  1LM8 B;  4MH0 E;  2K1F A;  5D94 A;  4DWF A;  2O6V D;  1ZP0 B;  2MLB A;  1L0V B;  4B95 A;  2KJR A;  3VQI A;  3M3J A;  1PUT A;  4FA6 A;  4JL9 A;  4YT0 B;  3Q6B A;  3CST A;  5BMI A;  2O6V A;  2PKO A;  3ZRF A;  3S2A A;  3C8Y A;  1JQ4 A;  2D10 A;  1V2Y A;  3UQA A;  4IC7 B;  2K8B A;  5FK9 C;  4NQK E;  3KWL A;  3MC8 A;  1TKE A;  3DDC B;  4TQ0 A;  1TS2 A;  2KDI A;  2ZW0 A;  4L23 A;  1TS3 A;  4LJO B;  4CHK A;  2RGF A;  4NQL B;  2LHD A;  2KDE B;  2HJ8 A;  1UH6 A;  1KTK A;  2WWZ A;  3ZW3 A;  3ZNH B;  2MJ3 A;  4JE3 B;  2DAF A;  2MW5 A;  2DZM A;  2L83 A;  2NTS A;  4IDI A;  2V3S A;  3RT3 B;  1J7B A;  1F52 A;  1N5X A;  3N3K B;  5EE9 A;  1WXS A;  2L3Z A;  1ZGU B;  4ANV A;  1NI2 A;  3ML8 A;  4W9I A;  2RD0 A;  4EEW A;  5JXV A;  3RNE C;  1AAR A;  3L08 A;  5G2N A;  3ETR A;  1E7U A;  3I9V 1;  3E9S A;  2BQQ A;  3DBR I;  1WGK A;  3J9C A;  4EKU A;  4AJW A;  2AEH A;  3IG3 A;  3WAL A;  3RUI B;  1Q0W B;  4F8C B;  3RNC C;  2DNF A;  4C00 A;  4AUQ C;  2GBJ A;  1XLQ A;  3NRZ A;  3B0A A;  4NPN A;  4LNN A;  3PZ7 A;  2N0S B;  2J0J A;  3PTF C;  1TS5 A;  3VUX A;  4DXA B;  2JZP A;  5T8I A;  2O6V B;  1WGY A;  4XYC A;  2CHX A;  2JY6 A;  2RDH A;  4LDT D;  3L10 B;  4KIK A;  2IJ0 A;  4NZL B;  2EKI A;  4GGQ A;  3N1Y C;  1T5X D;  4C7Z A;  2WLB A;  1L4Z B;  3MJ5 A;  4TMA B;  3Q14 C;  1QIL A;  1KJT A;  2MBO A;  4YL8 A;  3WAP A;  4DDG D;  3OJ4 B;  4DK5 A;  2KX0 A;  3RCZ A;  1WJ6 A;  3DVG X;  4GSW A;  3KUD B;  4HWI B;  3MHS D;  2ZZP B;  2KT7 A;  2JT4 B;  3UGB B;  3AU5 A;  2Z8L A;  2RPV A;  1MFW A;  1GNU A;  3A9K A;  1E6E B;  2OJR A;  1C9F A;  1Q5W B;  2WNM A;  3QJZ A;  1J7C A;  3Q8F A;  4XWT A;  2CHW A;  3P42 A;  4TKN A;  4IWO A;  1VZ6 A;  2M4N A;  2INP E;  1VCB A;  1WE7 A;  3M95 A;  3ZDT A;  3APD A;  1XXG A;  1SF0 A;  5EE1 A;  3K9P B;  1VZ7 A;  2JXX A;  3OJ3 A;  3P2B A;  2JXT A;  2AQ1 B;  2KKC A;  1PGB A;  4XC2 A;  1WGG A;  4KKJ A;  2QIE B;  4LJP B;  2NVU I;  5BYR A;  1UZX B;  4KIK B;  4DHZ E;  2GBK A;  2V1Y A;  1KFY B;  1KLU D;  2N9E B;  2JZZ A;  1V1O A;  3GB1 A;  2C9W B;  4MGY E;  3L54 A;  2ASQ A;  5EE3 A;  4LDT B;  3BIN A;  2BB5 A;  3LJ3 A;  4N59 A;  3GP7 A;  3IAS 1;  3AE3 B;  3UIN B;  1MG8 A;  1OGW A;  2ZNV B;  1P98 A;  3Q3J A;  2RPQ A;  3P63 A;  2JF5 A;  1C76 A;  4M00 A;  2ACZ B;  3AE1 B;  3CF6 E;  3DWG C;  3RNA C;  2NCN A;  2TSS A;  1V86 A;  1PDX A;  4S0R A;  3A9K B;  3IBE A;  2LVP A;  4GOC A;  2D07 B;  2M17 A;  2WXM A;  2K6D B;  4WWO A;  3SFD B;  1QOA A;  1SEB D;  3L17 A;  4B0E A;  2QCZ A;  4FHK A;  4HKQ A;  3ABV B;  3MHZ A;  1EWC A;  4KGR A;  4TSS A;  2V4I B;  3W5U B;  3WAO A;  1IPG A;  1JWU D;  2BTE A;  2MBE A;  2KMC A;  4O1N A;  4GB9 A;  4A8X C;  2V9H A;  3VXW A;  4BZA A;  4HLE A;  2HTM E;  2J7Q B;  1B9R A;  4N9F 4;  1WJU A;  1GOZ A;  1D4B A;  5C3J B;  3SDL C;  3QX1 A;  3MC0 B;  2IO3 B;  2KQS A;  2M0X A;  2WXQ A;  3KQ4 A;  3X0W A;  2WDR B;  2J0K A;  5D7G A;  1WR1 A;  1T0Y A;  3GE8 C;  3MC9 A;  1L6V A;  1B1Z A;  3BK2 A;  3EHV A;  1C79 A;  2D3A A;  1MHX A;  3LYY A;  4W9E A;  5KHQ A;  1WMH A;  1ROE A;  2J42 A;  2X8X X;  3URY A;  1VD2 A;  1ENF A;  1WYG A;  1TYG B;  2HE7 A;  4GU2 A;  1N60 A;  2E6X A;  1IGD A;  4C7Y A;  1TGZ B;  4BVU C;  4F7Z A;  1ZXH A;  4KDI C;  1S3S G;  3AUL A;  2G4S A;  3AXC A;  1L7Y A;  3AEE B;  4ZHO A;  3DHG C;  1JML A;  1V49 A;  1YD8 U;  3QAQ A;  4E74 A;  3Q3N C;  1HXY D;  4K1R B;  5DPR A;  1FEH A;  1QT9 A;  3ENE A;  2G4D B;  2M56 B;  1PYW D;  1WX8 A;  1ACC A;  5CHV C;  1EF5 A;  2EEL A;  3N1X C;  2RMM A;  2KDM A;  2B3A A;  4RF1 A;  2KJH B;  4W9G A;  5JZE B;  4KX6 B;  2V3P A;  2LGX A;  2L1A A;  4IUM B;  3KYC D;  1IUE A;  2VRR B;  4HVB A;  2H89 B;  3AH7 A;  2VH2 A;  1WYW B;  4LNI A;  1K52 A;  4HDO A;  4PS7 A;  3QIJ A;  2CJO A;  2WHI A;  3RD2 A;  3N30 A;  1GPX A;  2IO1 B;  1E8X A;  2GBM A;  3TMP B;  4PS3 A;  2WXP A;  1S1Q B;  1SE9 A;  2GI9 A;  4MJS A;  1NI3 A;  1V5O A;  4GDK A;  2LXC A;  2EMS A;  4A3P A;  2MHJ A;  1I4H A;  2W55 A;  3OAW A;  3TL5 A;  5L83 A;  3ZQ4 A;  1GG3 A;  2OOB B;  3IT4 B;  3BK1 A;  1WMH B;  3PZD A;  2KAC A;  3EA6 A;  2OJW A;  1L6U A;  2LVQ A;  5TR5 A;  1T0R C;  4AJY B;  1EF1 A;  2XN9 C;  2BYT A;  2XBB C;  2LMC A;  5BMH A;  4ICU A;  2BVC A;  3V6E B;  3UQB A;  1QKZ A;  1Z2M A;  3H7P A;  2BYV E;  4B9K A;  4II3 B;  1P3Q U;  3OG5 A;  1RFK A;  1DGJ A;  3MTN B;  2DYO A;  1UWM A;  5I4D A;  3A4S C;  3Q3F A;  2WXG A;  2GB1 A;  4WJO A;  3PGE A;  4GN1 A;  3SFE B;  3DBS A;  2KMM A;  2XNA C;  4DDI D;  1D5M C;  3V05 A;  1BUI C;  3BVM A;  1ESF A;  1QF6 A;  1HTO A;  5LLI A;  3ZYY X;  1FNW A;  2WXN A;  3N32 A;  2Q5W D;  2ZNV C;  4CO7 A;  1GJZ A;  3R3M A;  1JW9 D;  1WRI A;  1A70 A;  3UF8 A;  5MPO A;  2LGI A;  2FUG 1;  4WH4 A;  3PLU A;  3IXS A;  3R2I A;  3UI3 A;  2K25 A;  1Z5S B;  3FC4 A;  2MX2 A;  2W82 A;  1T0S C;  2KQ7 A;  1D5Z C;  2C5L C;  2LXA A;  3TEY A;  1OEY A;  4IW0 A;  2EMT A;  1RYJ A;  2J53 A;  2G3Q B;  2WX0 A;  1ZDV A;  3QAR A;  4MJS B;  1TTN A;  4KV2 A;  2KD0 A;  1WR6 E;  3HVZ A;  2ZCB A;  4GDK B;  4W9C A;  2WGS A;  4II2 B;  4EE2 A;  3IAM 1;  2HD5 B;  2BF8 B;  3GS2 A;  4OVZ A;  4ZYN A;  4EZL A;  1TZ1 A;  2PLP A;  3EGR A;  1FCC C;  3DVN U;  5KHO A;  3NHE B;  1WSP A;  3H8H A;  3C19 A;  3N20 C;  2JPH A;  2SEB D;  2UWQ A;  3FAH A;  5HI1 A;  2INC C;  3PO0 A;  3H7P B;  3B1L X;  2EKE C;  3RZW C;  3U52 E;  1WF9 A;  4RF0 A;  1PQS A;  2DZK A;  1ZXI A;  2JYT A;  2DAJ A;  1WM3 A;  3VR9 B;  4GDL A;  3EFU A;  2W9N A;  2IZV B;  3PHW B;  2CJN A;  1XF5 L;  1T0Q C;  4MEL A;  3GZN B;  4OVV A;  4MM3 A;  2N7J A;  4IM0 A;  4LNF A;  2L00 B;  5IP4 D;  2MP2 A;  2KFK B;  5D3D A;  3M62 B;  1SE3 A;  2NPT A;  3P4S B;  3I5J C;  4FXC A;  2IY1 B;  3IVF A;  4FJZ A;  4K81 A;  2IND C;  1WZ3 A;  5H92 C;  2KNB A;  1ISN A;  3ML9 A;  2BW2 A;  3NVV A;  1DYQ A;  4EZK A;  1FMA D;  2RSU A;  4RCO A;  2PW9 A;  1SE4 A;  2FID A;  5DPT A;  3P4P B;  3HHM A;  3ZJV A;  4JIO U;  3AE6 B;  2B76 B;  4TV3 A;  3ZLZ A;  1I35 A;  4L1B A;  3VRA B;  5C2T B;  3WA0 A;  4ANU A;  4BOS C;  4GXB A;  4P1C C;  4JWU C;  2A4Z A;  5HG2 A;  1CK1 A;  2JWZ A;  2KX3 A;  1MI0 A;  1N62 A;  3TIX A;  4A6Q A;  2ICI A;  1UF0 A;  3B08 A;  1UBQ A;  3I63 C;  4DBG A;  2MA9 B;  3U30 A;  2LD9 A;  2REX A;  2KDB A;  4TUU A;  2AX5 A;  5DCN A;  3ZXV A;  4WWP A;  1DOI A;  1P0R A;  2CHZ A;  2LUM A;  4GDL B;  1FXI A;  2M19 A;  2CR5 A;  2FNJ B;  2W54 A;  4ITK A;  1TKY A;  2WDT B;  2DZI A;  4BBN F;  1QQR A;  4AWJ A;  4MM3 B;  3AB5 A;  4ASW C;  4GLS C;  1N61 A;  3ZNZ B;  3ZVV A;  1STE A;  2MP2 B;  4NJ7 A;  1WWT A;  1UWX A;  1NEK B;  2NPT B;  1ET6 A;  4YTN B;  2BKR B;  3BYY B;  3Q8B A;  4DXF A;  1DOY A;  4HJK A;  4MEM A;  2PMV A;  1RFA A;  2IPK D;  2K22 A;  2MQJ A;  4ANX A;  4HCP B;  3TUO A;  1NYR A;  1YN3 A;  1YX6 B;  3EFC A;  1QOB A;  1JRO A;  2IO0 B;  3VH3 B;  3MP9 A;  1JWA D;  1K50 A;  2K8H A;  5AEK B;  4ARC A;  2DYM A;  5E6N A;  3RMK C;  1HZ6 A;  2BYE A;  3B2G A;  2K39 A;  4RGO S;  3TEW A;  1TKG A;  1SIF A;  5J17 A;  1G6J A;  3GE3 C;  1HA5 A;  4I6L B;  3ZRC A;  1F77 A;  4FJV B;  1VJK A;  1YJI A;  1EO6 A;  3VR8 B;  5FR3 A;  4BAX A;  2X38 A;  2RDG A;  3R8B A;  5D3I B;  4B0M A;  2KWC A;  3AE7 B;  2CS4 A;  4K3B A;  4XE0 A;  4WQM A;  2K8C A;  3APC A;  2BPS A;  3JW0 X;  3KVF B;  2IGD A;  4R3D A;  2L0T A;  2LI5 A;  1VZ8 A;  4W9L A;  1T6B X;  2WXO A;  5D2M B;  1M4V A;  4H2A A;  3VRB B;  4LNO A;  1RM6 C;  2CKH B;  2E3T A;  2A5U A;  1F2R I;  4K3C A;  3PT2 B;  2LVO A;  1HEZ E;  2AWT A;  2QDF A;  1IP9 A;  3RUL A;  2MRP A;  1R4M B;  1YIW A;  5H8Y E;  2AQ3 B;  1VLB A;  4NAW A;  1C1Y B;  5EDS A;  2QMT A;  3X23 A;  4RFB A;  2N9L A;  3GZN I;  4A90 A;  2GRI A;  3ZNG C;  2BS2 B;  4AOF A;  3AEC B;  2M8S A;  2INN E;  3BVZ A;  1SJH D;  3T8M A;  1F2R C;  4WAF A;  4FN2 A;  3H7S A;  2YEP F;  3JYU A;  3VTU A;  1C4C A;  2PE9 A;  4D2K A;  4P6V F;  2WU5 B;  2NR2 A;  3AE5 B;  1I7H A;  2J0M A;  3N1Z C;  4M8N A;  5J18 A;  3CIR B;  1C78 A;  4IKG A;  4BKT A;  5D6J B;  2PIA A;  3FIL A;  2DYB A;  3W1S A;  1A5R A;  1J19 A;  1OEY J;  2KLC A;  3RNG C;  3RNF C;  1Y56 A;  1XLN A;  3LDZ E;  4IWQ A;  3KUC B;  2FCS A;  4WQO B;  3A1Q A;  2M1M A;  1E7V A;  3EC8 A;  2WU2 B;  4PYU A;  2KFJ A;  1ZKH A;  1I4R A;  1RWS A;  1JAL A;  2I2Y A;  5HHD G;  1P1A A;  1X1M A;  4ZDV A;  2LRU A;  1WJN A;  1QLB B;  2HJ1 A;  1TY0 A;  4FBJ B;  2BYF A;  1HTQ A;  1ZE3 D;  2DHZ A;  2MBH A;  3ECI A;  5BMG A;  1OFF A;  3VTW A;  4NAW B;  1C4A A;  1GC7 A;  4KVG B;  4NNJ B;  2W3S A;  5AZH A;  5J2R A;  5AUI A;  3H6N A;  1YOV B;  4IG7 B;  2MH7 A;  3Q2A C;  2C60 A;  3B2F A;  5G5H A;  2RDB C;  2KTF A;  4PS8 A;  4KGT A;  2G1E A;  5CHF A;  3P1M A;  4USA A;  4I6P A;  3VUY A;  3PSE B;  3W9C B;  1WXA A;  2DZJ A;  1UNS A;  4LLG M;  3R66 C;  3A4R A;  1P7F A;  3BZD B;  2ZPN A;  4IM2 A;  4NY0 A;  1WXV A;  2NBW B;  2GMI C;  3FIL B;  1V6E A;  1HZ5 A;  4MGZ E;  5DPS A;  4XZ4 A;  1AWD A;  1YQB A;  2AL6 A;  1SXT A;  3H9D A;  3ZJU A;  1WX7 A;  4HRO A;  3TBL D;  2KOX A;  1N63 A;  2KN5 A;  1FRR A;  3OLM D;  3A1Q B;  2ON8 A;  4J6I A;  1R7S A;  2V3N A;  3PLV A;  4PYZ A;  2N7D A;  4XGA B;  1V1P A;  2AQ2 B;  4URK A;  1UD7 A;  5JHB A;  3DVG Y;  3SEB A;  1EU4 A;  1CJE A;  4S17 A;  2JRH A;  3KLS X;  1JRP A;  1TBE A;  3DHH C;  4HCN B;  4DHZ B;  1LQB A;  2MBB B;  5IAA C;  3DVN V;  2WQY B;  3DBH B;  1IGC A;  3BVG A;  2FBW B;  5C23 A;  2MCN B;  2QHO A;  2ZVN A;  4WIP A;  1RLF A;  4BOZ B;  1R4M I;  1WXQ A;  4G0N B;  1TT5 B;  3N9Y C;  4FHJ A;  4YSY B;  2L76 A;  2V0G A;  5AUK A;  1L0Y B;  1E8Z A;  4IM3 A;  3Q8A A;  3R7R A;  3V61 A;  1FD6 A;  3RYT A;  2RR9 A;  3ZXR A;  4DQO C;  1N6Z A;  2NMQ A;  1P9D U;  4NAM A;  1K8R B;  2D5G A;  2WXF A;  3VUW A;  3O65 B;  3ZKJ C;  4HDQ A;  2GBR A;  4CYE A;  1WIA A;  2R61 A;  3CWI A;  2I38 A;  1C4P A;  2BB6 A;  1FO4 A;  2YLM A;  1SE2 A;  5GXG B;  4MSM B;  5C1Z A;  4M0W A;  2BWF A;  2N1W A;  1FXA A;  1KLG D;  1V1P B;  1R4N B;  5G55 A;  3CSF A;  3KH0 A;  1E10 A;  1XD3 B;  3P4Q B;  3WAM A;  3AEG B;  4BKG A;  3DQV A;  1XCT L;  3RN9 C;  3ZJT A;  3U7Z A;  4DXG A;  4YTM B;  3JSV A;  4JQW C;  1I42 A;  3L16 A;  3Q8C A;  1MHH E;  5IO9 A;  3NG0 A;  1VRA B;  1KRH A;  4YSX B;  3R2T A;  1GC6 A;  4HEA 1;  4TQ1 A;  5L95 C;  1MVK A;  1E8W A;  1VR9 A;  3ZTC A;  1SBB B;  3BYT B;  3ZUN A;  2GOW A;  4AP4 C;  2D2Q A;  2QSD A;  2Y3A A;  3VAW A;  3NVW A;  3ZNI D;  4C56 C;  3PRZ A;  1I4X A;  1BML C;  4US9 A;  2FCM A;  3WIM A;  1QZE A;  2FCN A;  4KDL B;  2N7E A;  2KVZ A;  4W9K A;  1AN8 A;  3WCQ A;  3ZDM C;  2JRI B;  1WM2 A;  4N6E B;  2C7M B;  2IGG A;  1NEN B;  4N58 A;  4MT5 A;  1XT9 B;  1LO5 D;  2SAK A;  3RPF C;  2Y5B B;  2N9P C;  2KVR A;  1UEL A;  4HXD A;  3LXF A;  1NYQ A;  2OHF A;  1WGD A;  1V5T A;  4ZHP A;  2L8J A;  4C4V A;  1T3Q A;  1FIQ A;  2KTR A;  3BII D;  1XO3 A;  4M0W B;  2IY0 B;  3V62 A;  2K6Q A;  3Q69 A;  1WRD B;  2KN4 A;  2OED A;  3NZ3 A;  5BYS A;  2ZJD A;  3U7D A;  2XK5 A;  2KZR A;  3O13 A;  3DPD A;  4ZRP A;  1MJD A;  1SGH A;  1WI0 A;  2FAZ A;  2LRW A;  2BBC A;  1UUP A;  4EFO A;  1AW7 A;  4ZYS A;  4EUT A;  4OW0 A;  1F1H A;  2WDV B;  1IYF A;  1NBF C;  2XEW A;  5JH5 C;  1WGH A;  3JSV B;  3EEC A;  2LHE A;  2JU6 X;  3A9J A;  3PZ8 A;  3W1S C;  2LJ5 A;  3JVZ X;  4RGM A;  1E5W A;  1YMH E;  1NDD A;  3NOB A;  1XLO A;  2IBI B;  3NJT A;  3RZF A;  2J52 A;  3TEZ A;  2KAN A;  2BT6 A;  1I4Q A;  4MGK E;  4K7W A;  4LK0 M;  2WDQ B;  1MG4 A;  3DBL B;  4M02 A;  2PEA A;  1JWB D;  2JX5 A;  1Q1O A;  1LFD A;  3PV1 A;  3DBH I;  3WAN A;  2MJE A;  3U4E G;  3TCA A;  3W1Y A;  1XCQ L;  3ONS A;  1XLP A;  2WXR A;  2D3B A;  2ZW1 A;  1YN5 A;  3AEA B;  1FM0 D;  4FUL A;  5E6J A;  2HTH A;  2CU1 A;  3U2S C;  1V9J A;  4AS1 A;  3NVY A;  1AYF A;  3V60 A;  2BS4 B;  3P4R B;  2YEP B;  1TY2 A;  4XDC A;  1FRD A;  2Z0E B;  1OTR B;  2Y5C A;  3TEX A;  1TS4 A;  1RRB A;  3QA8 A;  3PS6 A;  4FJY A;  3QC8 B;  5BYQ A;  2KLG A;  2WX1 A;  4KZC A;  1C3T A;  4HJG E;  1EM7 A;  2PVO D;  3A33 B;  3ZIM A;  1D3Z A;  3FKY A;  4C4V B;  2O2V A;  4REZ A;  1FFV A;  2KWU B;  2KTR B;  2WXL A;  4C80 A;  4W9D A;  3C0R B;  4DHJ D;  2N4F A;  2WXJ A;  2VZK D;  1GAQ B;  4JPS A;  1SJE D;  4JX1 C;  2XK5 B;  3T3O A;  4M01 A;  4WJP A;  1OQQ A;  4QAY A;  2MJD A;  3AEB B;  1YNT E;  4M8M A;  1TZO A;  4RM8 A;  1RAX A;  3Q8E A;  1V80 A;  5IA7 A;  1R4N I;  3V6C B;  3A9J B;  1J0G A;  2KQ4 X;  4JWS C;  1YJ1 A;  4GIV A;  2LAS A;  3HM6 X;  3UIP B;  4KSK C;  2DWQ A;  3AE2 B;  4NJC A;  1OQY A;  3ALB A;  4RNA A;  4UDU C;  4WWM A;  4CQN A;  3GOE A;  4KZ0 A;  2UU7 A;  4HRS A;  1YQ4 B;  1JWS D;  3VDZ A;  5IOI A;  2R2Q A;  1Y8R C;  3NVZ A;  3PRP B;  3I57 A;  2N9X A;  3DHI C;  3AU4 A;  4MH8 A;  2NBV B;  1CZP A;  1EU3 A;  2PTL A;  3DOW A;  1LGR A;  4BBN C;  5DPW A;  3NUH B;  2KYW A;  5E6O A;  2BKF A;  2BGF A;  1PGX A;  2WXK A;  2O2V B;  3VFK A;  3ZTD A;  3MJW A;  4A55 A;  5BO4 B;  2FUH B;  4G3X B;  2W3R A;  4BKS D;  4NJ6 A;  4XDD A;  3AI5 A;  4HK2 A;  1D6E C;  1UGJ A;  3H1U A;  4ANW A;  4RGN A;  2IYD B;  1WE6 A;  4Q2J A;  4A20 A;  4MSQ B;  4ZRQ A;  4ZRJ A;  1XEE A;  2KC2 A;  3RI7 C;  5EE0 A;  4BKS A;  5HFY A;  4YWG G;  1KOT A;  1YN4 A;  4LTU A;  4DHJ B;  2IGH A;  2VZK B;  2KXJ A;  3D32 A;  2DLB A;  3AEF B;  3QWZ B;  1MPE A;  1QOG A;  1L2N A;  1L5P A;  2KDF B;  2YVC A;  1L4D B;  3QK0 A;  4I6N B;  1HQR D;  4K7U A;  2LFI A;  1EUV B;  1TIF A;  2L05 A;  4JLC A;  1YQ3 B;  3TSS A; 
#chains in the Genus database with same CATH homology
 4OVZ A;  2G9H D;  2AQ2 B;  3SEB A;  2PLP A;  3ZGZ A;  3EGR A;  1FCC C;  1EU4 A;  1CJE A;  3KLS X;  1WSP A;  2PVG C;  3H8H A;  1XLQ A;  1CQV A;  3NRZ A;  3RFZ B;  2SEB D;  1JRP A;  4ARI A;  3FAH A;  5HI1 A;  3HVD A;  2Y5P A;  3PZ7 A;  2ONQ A;  3PO0 A;  2N0S B;  5TSS A;  3E56 A;  3B9J A;  4OZB A;  2WS3 B;  1TS5 A;  2WQY B;  1IGC A;  3BVG A;  2JZP A;  2H88 B;  5T8I A;  1KH0 A;  2FBW B;  3W5V B;  2RDH A;  3AE9 B;  3U52 E;  1VDV A;  4RF0 A;  2IJ0 A;  4NZL B;  4WIP A;  2EKI A;  1ZXI A;  2JYT A;  1T5X D;  1WXQ A;  5G5G A;  4C7Z A;  3N9Y C;  2WLB A;  1L4Z B;  3MJ5 A;  4YSY B;  3VR9 B;  3KWV A;  4L2Y A;  4TMA B;  1QIL A;  2V0G A;  1PFD A;  2QJL A;  5AUK A;  1ZOY B;  3OWE B;  1L0Y B;  2CJN A;  3Q8A A;  1XF5 L;  1FD6 A;  4DQO C;  2N7J A;  2WXH A;  2MEK A;  2NMQ A;  4RGT A;  3AN1 A;  4NAM A;  2WXF A;  2D5G A;  1NVI D;  2Z8L A;  5D3D A;  2RPV A;  1SE3 A;  3P4S B;  4FXC A;  4OZA A;  2R61 A;  1KF6 B;  2L32 A;  5H92 C;  3CWI A;  1E6E B;  1L0X B;  1C9F A;  1SSN A;  2I38 A;  4YTP B;  1C4P A;  2BB6 A;  2BW2 A;  2WNM A;  2WP9 B;  1J7C A;  3NVV A;  1FO4 A;  3Q8F A;  1DYQ A;  4XWT A;  1FMA D;  2IDY A;  3P42 A;  4RCO A;  1VZ6 A;  2PW9 A;  1SE4 A;  2INP E;  4US8 A;  1SE2 A;  5GXG B;  3T3N A;  4M0W A;  3P4P B;  2L52 A;  1FXA A;  1KLG D;  3ZJV A;  3AE6 B;  1V1P B;  1XXG A;  2B76 B;  3MFG A;  4PT5 A;  1SF0 A;  4L1B A;  1K53 A;  3VRA B;  5C2T B;  2JWU A;  1E10 A;  1V97 A;  3P4Q B;  3AEG B;  1ZPS A;  5EE1 A;  4JWU C;  3AED B;  1XCT L;  3IT6 B;  2FE8 A;  3ZJT A;  1VZ7 A;  1CK1 A;  1YJJ A;  3BWU D;  5HG2 A;  3U7Z A;  4DXG A;  4YTM B;  1MI0 A;  1MHH E;  1N62 A;  3Q8C A;  1VRA B;  1KRH A;  2JXT A;  4YSX B;  3R2T A;  2AQ1 B;  1PGB A;  4HEA 1;  4TQ1 A;  4KKJ A;  1MVK A;  2ICI A;  4A6Q A;  1VR9 A;  4P16 A;  1SBB B;  2QIE B;  1JWM D;  5BYR A;  3BYT B;  4MAC A;  2QSD A;  2Y3A A;  1D5X C;  1KFY B;  1KLU D;  2CU3 A;  2AX5 A;  1DOI A;  1V1O A;  3GB1 A;  3NVW A;  1PGA A;  2LUM A;  4YXD B;  4GDL B;  4C56 C;  1FXI A;  2M19 A;  1BXT A;  1I4X A;  1BML C;  2W54 A;  4US9 A;  4ITK A;  5EE3 A;  3W2D A;  1TKY A;  1TJE A;  2JSV X;  1QQR A;  2BB5 A;  4HKZ E;  4N59 A;  1AN8 A;  3WCQ A;  3GP7 A;  3IAS 1;  3LB8 C;  3AE3 B;  4MM3 B;  3AM9 A;  4IOI E;  3DWM A;  1EWY C;  3AB5 A;  4N6E B;  4GLS C;  1N61 A;  2IGG A;  3P63 A;  1OQR A;  1NEN B;  4N58 A;  1C76 A;  4MT5 A;  2ACZ B;  1STE A;  3AE1 B;  1LO5 D;  3SR6 A;  4YSZ B;  2SAK A;  3RPF C;  1WWT A;  1UWX A;  1NEK B;  1ET6 A;  3DWG C;  1F0Z A;  4YTN B;  2TSS A;  2KWD A;  2LEK A;  3LXF A;  1PDX A;  1NYQ A;  3BYY B;  3Q8B A;  1JCK B;  1E0Z A;  1J7A A;  2HDE A;  4DXF A;  1DOY A;  2OHF A;  2WXM A;  3SFD B;  2PMV A;  1QOA A;  1SEB D;  1ET9 A;  4ZHP A;  5LNK 1;  4B0E A;  2IPK D;  1I4P A;  2LJI A;  1K51 A;  4HKQ A;  2K22 A;  1T3Q A;  2JQR B;  3ABV B;  1FIQ A;  3MHZ A;  1EWC A;  3BII D;  1XO3 A;  1NYR A;  3TUO A;  1YN3 A;  3Q69 A;  4KGR A;  4AQ7 A;  4WUR A;  2KN4 A;  4TSS A;  2V4I B;  2OED A;  3L4P A;  1QOB A;  1JRO A;  3NZ3 A;  3W5U B;  5BYS A;  1JWU D;  1JWA D;  3MP9 A;  1K50 A;  4J3O D;  3O13 A;  2BTE A;  4ZRP A;  4ARC A;  2DYM A;  5FKA C;  4O1N A;  2BBC A;  1UUP A;  4A8X C;  1HZ6 A;  1AW7 A;  3B2G A;  4ZYS A;  2HTM E;  4RGO S;  3TEW A;  1FCL A;  1TKG A;  3HRD D;  4OW0 A;  3HUI A;  2WDV B;  1B9R A;  1GOZ A;  2LHE A;  2JU6 X;  3PZ8 A;  2DBY A;  1D4B A;  5C3J B;  1HA5 A;  3MC0 B;  4OZC A;  1F77 A;  4RGM A;  1YMH E;  4ZOH C;  1QOF A;  1VJK A;  1YJI A;  3VR8 B;  5FR3 A;  1XLO A;  2WXQ A;  3KQ4 A;  2X38 A;  2WDR B;  2J52 A;  2RDG A;  3R8B A;  2BT6 A;  3TEZ A;  1I4Q A;  5D3I B;  4B0M A;  1I4G A;  3AE7 B;  2QEJ C;  5D7G A;  1V8C A;  3AE8 B;  1GB4 A;  4LK0 M;  3J9C A;  4WQM A;  4XE0 A;  2WDQ B;  1L6V A;  3AE4 B;  1JWB D;  2JX5 A;  2IGD A;  4R3D A;  1B1Z A;  3BK2 A;  1C79 A;  2JYE A;  1IBX A;  3LYY A;  1MHX A;  1VZ8 A;  1T6B X;  2WXO A;  2MJE A;  3U4E G;  1M4V A;  1ROE A;  2J42 A;  4H2A A;  3URY A;  1XCQ L;  1XLP A;  2WXR A;  3AV8 A;  2ZW1 A;  1ENF A;  3VRB B;  1WYG A;  1TYG B;  1YN5 A;  3AEA B;  1FM0 D;  5E6J A;  2N9K A;  1RM6 C;  2E3T A;  1N60 A;  4A9A A;  1F2R I;  2E6X A;  1HEZ E;  1IGD A;  2WXI A;  3U2S C;  4C7Y A;  4AS1 A;  3NVY A;  1AYF A;  1ZXH A;  2BS4 B;  3P4R B;  2YEP B;  1TY2 A;  4XDC A;  5H8Y E;  1FRD A;  1P7E A;  2AQ3 B;  1VLB A;  2Y5C A;  2QMT A;  4RFB A;  1DOX A;  3TEX A;  2N9L A;  1TS4 A;  3AEE B;  4ZHO A;  4A90 A;  2GRI A;  1JML A;  4KKI A;  2BS2 B;  3AEC B;  5BYQ A;  3BVZ A;  2INN E;  1SJH D;  1HXY D;  2BS3 B;  1F2R C;  4HJG E;  4WAF A;  3EUB 2;  1FEH A;  1EM7 A;  1QT9 A;  2PVO D;  3V3X A;  1FNV A;  2YEP F;  2M56 B;  1PYW D;  4REZ A;  1ACC A;  1FFV A;  1C4C A;  2EEL A;  2RMM A;  2KDM A;  4D2K A;  4P6V F;  2M0A A;  4RF1 A;  2QIL A;  2WU5 B;  2WXL A;  1N5W A;  4C80 A;  4RH6 A;  4KX6 B;  2V3P A;  2K0P A;  2L1A A;  1ZUD 2;  1IUE A;  1FNU A;  2WXJ A;  2VZK D;  1GAQ B;  4JPS A;  1C77 A;  1SJE D;  3AE5 B;  4JX1 C;  3T3O A;  2H89 B;  1I7H A;  3AH7 A;  1OQQ A;  1K52 A;  2MJD A;  1ZDX A;  3CIR B;  1C78 A;  1YNT E;  1FFU A;  2K5P A;  1Q10 A;  2CJO A;  2J4X A;  3AEB B;  1TZO A;  4IKG A;  1GB1 A;  1GPX A;  2K9X A;  2PIA A;  3FIL A;  3Q8E A;  3W1S A;  1SB3 C;  2KQ4 X;  1Y56 A;  4JWS C;  1E9M A;  1E7P B;  2WXP A;  1XLN A;  4XWW A;  2GI9 A;  2NTT A;  2DWQ A;  3AE2 B;  1NI3 A;  4NJC A;  3NS1 A;  2WU2 B;  4KGS A;  4OHJ A;  1I4H A;  1SIJ A;  2W55 A;  4RNA A;  3AMZ A;  1I4R A;  4UDU C;  1RWS A;  4WWM A;  1JAL A;  2K3U A;  4CQN A;  2I2Y A;  5HHD G;  1IBX B;  3ZQ4 A;  2KAJ A;  3IT4 B;  3BK1 A;  2KAC A;  3EA6 A;  1ZP0 B;  1L6U A;  1QLB B;  4HRS A;  1TY0 A;  1L0V B;  2XN9 C;  1YQ4 B;  1JWS D;  2BYT A;  2LMC A;  5BMH A;  1ZE3 D;  3VQI A;  3NVZ A;  1PUT A;  3I57 A;  4YT0 B;  5BMG A;  1OFF A;  4MH8 A;  4NAW B;  1C4A A;  1QKZ A;  5BMI A;  1CZP A;  2PKO A;  1EU3 A;  2PTL A;  1RFK A;  2W3S A;  1DGJ A;  5AUI A;  2DYO A;  3C8Y A;  2MH7 A;  1UWM A;  3NUH B;  1JQ4 A;  3B2F A;  5G5H A;  5I4D A;  2WXG A;  2GB1 A;  5FK9 C;  3SFE B;  3KWL A;  2KMM A;  1PGX A;  4KGT A;  2WXK A;  2G1E A;  3P1M A;  2XNA C;  4A55 A;  4USA A;  1D5M C;  1TKE A;  3V05 A;  3W9C B;  1BUI C;  4TQ0 A;  2W3R A;  3BVM A;  1ESF A;  1TS2 A;  1UNS A;  2ZW0 A;  4LLG M;  4XDD A;  4L23 A;  1QF6 A;  1TS3 A;  1D6E C;  1UGJ A;  3ZYY X;  2LHD A;  1FNW A;  4RGN A;  2WXN A;  1KTK A;  2Q5W D;  1JW9 D;  1WRI A;  1P7F A;  3BZD B;  4Q2J A;  4ZRQ A;  1A70 A;  5MPO A;  2LGI A;  2FUG 1;  4WH4 A;  3IXS A;  3R2I A;  3UI3 A;  2MJ3 A;  3FC4 A;  4JE3 B;  1XEE A;  5EE0 A;  2W82 A;  2L83 A;  3FIL B;  2NTS A;  5HFY A;  4YWG G;  1YN4 A;  1HZ5 A;  1D5Z C;  4LTU A;  3TEY A;  2IGH A;  1AWD A;  4IDI A;  2VZK B;  1RYJ A;  2J53 A;  1SXT A;  2DLB A;  3ZJU A;  1ZDV A;  3AEF B;  4HRO A;  1J7B A;  1N5X A;  1MPE A;  1QOG A;  5EE9 A;  1N63 A;  3HVZ A;  1FRR A;  1L5P A;  1L4D B;  2ON8 A;  4GDK B;  1HQR D;  1R7S A;  2LFI A;  2V3N A;  5JXV A;  4EE2 A;  3IAM 1;  1YQ3 B;  3ETR A;  3I9V 1;  3TSS A;  1V1P A;  3E9S A;  1WGK A;  3GS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...