1A70A

Spinach ferredoxin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
97
structure length
97
Chain Sequence
b'AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN
publication title Structure of the mutant E92K of [2Fe-2S] ferredoxin I from Spinacia oleracea at 1.7 A resolution.
pubmed doi rcsb
source organism Spinacia oleracea
molecule tags Iron-sulfur protein
total genus 22
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 1998-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1a70A00
1FXAA 2L52A 4ITKA 3VR8B 2MJDA 1SIJA 5C2TB 1KRHA 3AE3B 1QLBB 3L4PA 1PFDA 1NVID 2PVOD 4JWUC 1WWTA 2FBWB 1WYGA 4ZHPA 2N0SB 1JROA 1R7SA 3B9JA 2E3TA 1ZXIA 1CJEA 2K22A 4YSXB 1QOGA 1N5WA 1E10A 1E0ZA 2LEKA 1I7HA 1ROEA 1DOIA 1RFKA 1TKGA 2WLBA 3DWGC 4HROA 2WDVB 4LTUA 3NS1A 3AE6B 1NI3A 1OFFA 4JX1C 3AE2B 1JALA 3P4QB 1KF6B 2KAJA 2PKOA 2WS3B 3AEDB 4HRSA 1JQ4A 3SFDB 3RPFC 2MJ3A 3NVVA 3HRDD 3AE9B 1OQRA 1F0ZA 1OQQA 1N61A 1B9RA 1TKEA 1J7CA 1UWMA 1XLPA 1GAQB 2WQYB 5H8YE 1QOBA 3FAHA 1L6UA 1IUEA 2BS4B 3AEBB 3P4SB 5AUKA 1DOXA 1L5PA 1AWDA 1FFVA 2QJLA 2L83A 1XLOA 3NRZA 3VRBB 3AB5A 1GPXA 1RWSA 3FC4A 3LB8C 1A70A 3P1MA 2EKIA 2W3RA 4YSZB 3CIRB 1VDVA 1JWAD 4USAA 2HTME 2M19A 1TYGB 2Q5WD 4ZOHC 1JW9D 5EE9A 1NENB 5G5GA 1QT9A 2PVGC 1PUTA 1AYFA 1FXIA 1TJEA 3B2FA 3WCQA 5EE3A 2DBYA 2W55A 3P4PB 4WQMA 4YT0B 4YSYB 4FXCA 1L6VA 1ZUD2 3AEFB 2K9XA 3ABVB 3AEAB 1T3QA 2MH7A 1VJKA 2H89B 1YQ4B 1N5XA 3AE1B 5C3JB 3AMZA 4C7YA 3AEGB 4YTNB 2JX5A 4KX6B 1YJIA 1NYQA 2QIEB 1N60A 2Y5CA 1N62A 2DWQA 1VLBA 1FM0D 1ZOYB 2M56B 2MJEA 4WWMA 3VR9B 3AE4B 2G1EA 3W5VB 1KFYB 2AX5A 3AEEB 5MPOA 2PIAA 1E6EB 1QF6A 5H92C 4JWSC 5GXGB 1E7PB 3BIID 4N6EB 3W5UB 1V97A 3DWMA 2WP9B 3P4RB 1XO3A 2OHFA 1FIQA 2CJOA 1XLQA 2BS2B 2CU3A 2W54A 1YQ3B 1FFUA 3SFEB 2BT6A 3VRAB 3NVWA 1E9MA 1CZPA 5AUIA 3AE7B 3ZYYX 2B76B 1JWBD 1SB3C 2BS3B 1L0VB 2WDQB 4IDIA 5G5HA 2H88B 3W9CB 4N58A 3AN1A 4C80A 2CJNA 3KWLA 4YTMB 1FO4A 3NVZA 2WDRB 1TKYA 3ETRA 2WU2B 1WGKA 3AE8B 3CWIA 4US8A 4ZHOA 1FRDA 1QOFA 4YXDB 1SF0A 3AE5B 1FRRA 1ZP0B 1XLNA 1FMAD 1JRPA 4N59A 1NYRA 3AH7A 2W3SA 3B2GA 3SR6A 3EUB2 1QOAA 2WU5B 1V8CA 3AECB 3AV8A 3NVYA 1EWYC 1RM6C 1WRIA 4US9A 4C7ZA 1YJJA 2ACZB 1N63A 2K5PA 1J7AA 3HUIA 2JQRB 3LXFA 4YTPB 1DOYA 4A9AA 4P6VF 3HVZA 5EE1A 3P63A 3AM9A 1PDXA 1RYJA 1DGJA 1WXQA 3PO0A 5EE0A 1NEKB 2KMMA 1J7BA
chains in the Genus database with same CATH superfamily
4XDCA 1SXTA 5C2TB 4H2AA 1NVID 2MHJA 2V3SA 4DXAB 3AU4A 2C7HA 2D2QA 2TSSA 1RFKA 3DWGC 3L10B 4MJSB 5LXIB 3BVMA 3RPFC 1EUVB 2V3PA 2ZCBA 3E56A 4ARIA 1MVKA 4WWNA 2L8JA 4ARCA 4UDUC 3EA6A 3O65B 3W1YA 4ZRQA 2JPHA 1FXIA 1TJEA 2RDHA 3P4PB 2ZZPB 4RF1A 1L6VA 4NQLB 3R2TA 2KKCA 3APFA 3PT2B 2NBVB 3L13A 5BYSA 3ZGZA 1WH3A 5DPTA 1N60A 1RLFA 1VRAB 3C0RB 4W9DA 4K1RB 3VUYA 3QHTA 2LXCA 1ZXHA 2J0MA 2QSDA 3APDA 2NBUA 4GU2A 2OHFA 2V9HA 3PLUA 2KMAA 3I5JC 4TKNA 4K81A 1I4XA 3QARA 4TMAB 1YQBA 1V1PB 2L00B 3IHPC 3V62A 1QOFA 2GLSA 2MEKA 2J0JA 2VH1A 2XEWA 4K3CA 5LXHA 2Z59B 3B2GA 3NJTA 1E8WA 1V8CA 2DZKA 4BOSC 1YJ1A 5TR5A 3A9JB 1TZ1A 1HA5A 1C4PA 3BVZA 3TUOA 4FHKA 1YN5A 1KLGD 2HJ1A 3ZRFA 1TGZB 1E7UA 2LUMA 5EE0A 1NEKB 1FXAA 2KACA 2NR2A 2N1WA 1YX5B 2BBCA 1PFDA 3HK0A 3UI3A 2WDTB 2ZNVB 1V80A 1TKGA 1WMHB 3VRAB 2Z0DB 1I4HA 2K25A 4OW0A 4ZDVA 1WRDB 3MJ5A 3RN9C 1VR9A 2MP2A 2QEJC 5IO9A 1QOBA 4XZ4A 2PPHA 1IUEA 2KFJA 2V3NA 1FFVA 1FNWA 1XLOA 4YSZB 3FILA 4ICUA 4JE3B 5G5GA 2IYDB 4OVZA 2HJ8A 3BZDB 4ANUA 1DYQA 1VZ6A 1Z5SB 4KSLC 1Z2MA 3DBRB 1UH6A 3AMZA 2OJWA 1XEEA 2FCSA 5L83A 1WX8A 2M17A 4L1BA 3RI7C 4WJOA 4ZRKA 4AS1A 4TV3A 4P1CC 1FIQA 3N32A 4DQOC 3RULA 2G45B 2PE6B 4AP4C 1KM7A 4PS3A 1MFWA 3QC8B 1SB3C 2GBMA 1L4ZB 4PS7A 2N9XA 3Q3NC 2KWDA 1V5TA 1C79A 4ZYSA 4NNJB 2WYQA 3CF6E 4BKGA 3A1QA 2IBIB 2GBJA 3EUB2 2QHOA 4JL9A 3AULA 3VH3B 1PGAA 3HUIA 1LGRA 2J4XA 1GUAB 4A9AA 3P63A 2ZW1A 1WXQA 4RGTA 1E7VA 3ZIMA 3R7RA 1IPGA 1GOZA 4RCOA 2PVOD 4ZHPA 4C4VA 2IZVB 3DVNU 1N5WA 2DHZA 4RMAA 2LEKA 1ROEA 4B0MA 2PTLA 5FKAC 4JX1C 4M8NA 5FR3A 4PT5A 2WS3B 4LJPB 3UF8A 3NVVA 4P16A 1B9RA 2KANA 3NHEB 2JRHA 5IKCM 2KVRA 1DOXA 3R66C 1WSPA 4OHJA 2KYWA 2EKIA 4IM0A 3L16A 2HTME 1S1QB 1WI0A 4OVVA 2DBYA 4XWTA 1FNVA 1TS4A 1P0RA 4YSYB 1SGHA 2IGGA 2R2QA 3ZJUA 3Q14C 1VJKA 1ZW7A 1HTOA 2KHWB 5GMVA 2K6QA 3QA8A 1WXMA 4KZ0A 3KUCB 2RDGA 2MJEA 1V5OA 1TY2A 3RZFA 2AX5A 4EUTA 4JWSC 2ZVNA 2JSVX 3P4RB 2ZVOA 1XT9B 1XLQA 2K8HA 2WXMA 3UGBB 2D3BA 4IKGA 4DXFA 1JWMD 3H9DA 4WWPA 2WDQB 1L0VB 2ASQA 2K0PA 3ZNZB 3AE8B 4A90A 4EZLA 3R3MA 1ZE3D 4W9KA 3PGEA 1LM8B 3AV8A 1TT5B 3DBSA 2AWTA 3HVZA 4PK1A 3UIPB 4ITKA 3W1SC 3GZNB 2WWZA 1J7BA 5BO4B 4YWGG 4MSMB 3RNFC 4MEMA 4KIKA 1F9JA 2AQ3B 4KSKC 4A6QA 1JROA 2JWZA 2QDFA 2MX2A 3TJPA 2K22A 4RFBA 1I7HA 2Y5BB 2KX3A 2LVPA 2G4SA 3AE2B 4KGSA 2D10A 1BT0A 3N20C 4XE0A 4KGTA 4IG7B 1GC7A 1OQQA 4MSQB 3HHMA 1ET6A 2LD9A 3IT4B 3WIMA 2GRIA 4XX5A 4LCDE 3P1MA 3KYCD 4G50A 1EO6A 1HZ6A 1E8XA 1X1MA 2M19A 2M1MA 1L2NA 4NPNA 1D5MC 3MHZA 4GDKA 2AL3A 2SEBD 1UD7A 3EFCA 3NZ3A 1NYQA 1NBFC 2X8XX 1ZOYB 1BXTA 1FEHA 2JYTA 3DDCB 1TZOA 5FK9C 2RPVA 3WAMA 3WA0A 4JPSA 3NZUA 1SIFA 3VUWA 2WXLA 5LNK1 2NCNA 4DXGA 2YEPB 1JQ4A 4M00A 3PRZA 4HKQA 3Q8EA 1TKYA 3CWIA 4A3PA 2V4IB 3Q8CA 3SU8X 2KD0A 2WXIA 4N59A 3IXSA 2KDMA 5BMHA 1ZDVA 4YTPB 3H7PA 4K7SA 1V2YA 5DPSA 2KTRA 3AXCA 4FHJA 4E74A 2CKHB 3JSVB 2RMMA 2QC8A 3NOBA 2VH2A 1I4QA 1V81A 2GB1A 4MGKE 1K52A 4M0WB 3L08A 1UUPA 4EKUA 2LHEA 1KF6B 3RYTA 3SFDB 4M02A 4GLSC 4LNIA 3T9LA 1OQRA 2G4DB 4KV2A 1T0SC 2K8BA 3V3XA 2EMTA 1WZ3A 4WWOA 2AYOB 2W3RA 2JU6X 1V86A 1SBBB 3NS8A 1PQSA 1WR6E 3ONSA 5EE9A 1WY8A 3BY4B 4EOYA 4F1SA 2O2VB 3NZSA 1WXVA 2MWSB 3H1UA 3AEAB 5D3IB 2MH7A 1ET9A 3Q8AA 1YQ4B 2XBBC 3RMKC 4A20A 1YJIA 4WWMA 4J3OD 2G1EA 4ZRPA 5GXGB 3W5UB 1MJDA 2BWES 4I6PA 2DAJA 3PV1A 4WJNA 2LRUA 1Q0WB 2BT6A 1IBXB 3W9CB 5G5HA 1AN8A 1TS5A 4GIVA 2WU2B 1GC6A 4NJ7A 4G0NB 4W9EA 1ZP0B 1XLNA 1ENFA 2BPSA 3OJ3A 1C3TA 1EU3A 4DDGD 1YJJA 1YNTE 2JZ3B 4P1BC 4JGHB 1JMLA 1SJHD 1LQBA 1MG8A 4ZRJA 2WHIA 4I6NB 2NMQA 4ANVA 2E3TA 3X0WA 1QOGA 3DQVA 5I4DA 4NJCA 4IWQA 3TEZA 4AQ7A 4MH8A 2A4ZA 3O13A 3AE9B 2EMSA 2G9HD 2J7QB 2BTEA 1J0GA 3AEBB 2JRIB 4MM3B 2Z0EB 4LDTD 4M01A 1JWAD 4ZOHC 2DLBA 1WX7A 1AARA 3V6CB 4QAYA 1CMXB 2FIFA 3P2BA 3AI5A 2KJ6A 3ZNGC 1H4RA 3WAPA 1XQQA 3ABVB 1N6ZA 3U4EG 1J19A 3I9V1 4CYEA 2INDC 3UIOB 1ZPSA 1P7EA 3QWZB 1T0YA 4LDTB 1E6EB 3QIJA 4MACA 1EM7A 4O1NA 4E3CA 4N6EB 2L76A 5C1ZA 2XK5B 1G6JA 3DBHB 2BGFA 4G11A 1HXYD 2CU3A 2W54A 5BYRA 2CU1A 4I6LB 3Q69A 3ZYYX 5KHQA 1I4PA 1MPEA 1TS2A 1YN3A 2AL6A 1F2RI 1T0RC 1S3SG 5BMIA 1RM6C 1WRIA 3H6NA 2ACZB 4CHKA 5CX3A 4NAWB 5HG2A 3AM9A 1DGJA 3TIXA 5AZHA 1E5WA 4HJKA 3PS6A 1GB1A 3ZO5B 1HTQA 3VH4B 2HE7A 3JVZX 3B9JA 2O6VD 2L05A 2G3QB 3TMPB 1RFAA 4ZRIA 4NY0A 2KJRA 4K7UA 1WIAA 4W9CA 3GOEA 3VUXA 2UWQA 1IP9A 1HQRD 1UZXB 1VZ7A 4LNOA 4LK0M 3ZQ4A 2AEHA 1AWDA 1KH0A 1LXDA 2L83A 2LFIA 3MC0B 1A70A 4WJPA 3WALA 1TYGB 2O6VB 2ICIA 4WQMA 3RNGC 1K50A 2FCMA 3S2AA 1ZUD2 2K9XA 3X23A 2J0KA 1D6EC 3ZTCA 5E6JA 2H89B 2N9KA 3DCGA 5G2NA 4HDQA 3GP7A 4A55A 2I1KA 1WF9A 1QF6A 3K9PB 4AUQC 4IOIE 1E7PB 2YVCA 4HCPB 4EZJA 2WNMA 4ANWA 2WP9B 3NG0A 2IJ0A 4LNNA 5AEKB 1P98A 4HXDA 1OQYA 3IAM1 1CZPA 2X38A 2B76B 3RT3B 3TEWA 5E6OA 2KN5A 2CHXA 1WGKA 3SDLC 1WX9A 3N1XC 2N4FA 1L4DB 3GE8C 1P3QU 3IFWB 4TQ1A 1FD6A 1UGJA 2KXJA 1EWYC 1ZKHA 1V6EA 4L23A 1RRBA 1IGDA 2LRWA 2L52A 3VR8B 3P42A 4EZKA 1TY0A 3M95A 3WANA 2N0SB 3OAWA 2L0FA 2NPTB 2WXRA 3NS1A 4IWPA 2FNJB 2YEPF 4MGYE 4TQ0A 4CQNA 2WXGA 4AJWA 2LHDA 3GB1A 1J7CA 1D5ZC 2UU7A 1GAQB 2JZZA 2WQYB 1E8YA 1F2RC 2DZIA 2IGHA 3V60A 4IWOA 4WAAA 3VRBB 1SEBD 1KJTA 5IOIA 3VTWA 5CHVC 1STEA 2PVGC 1AYFA 3B2FA 1V49A 2WXQA 2CHWA 3WCQA 2EELA 1PGBA 1ACCA 3AEFB 1T3QA 1VLBA 2REXA 3AE4B 4S17A 3PZ8A 4GOCA 1WGRA 2KLGA 1C1YB 4HJGE 2JY6A 1ESFA 1GJZA 5G55A 2IPKD 3V61A 1E9MA 3Q8FA 2M4NA 2I38A 1H8CA 1UBQA 4DHZB 1UBIA 3AH7A 3VQIA 3LJ3A 3OWEB 4DDID 3HM3A 3LXFA 3KLSX 2FUHB 3MP9A 2MP2B 1D5XC 5DCNA 1WM2A 3JSVA 1XCQL 1SIJA 5IA7A 4KZCA 1QLBB 3KUDB 5C23A 1C76A 4M0WA 3PHWB 2KMCA 2R61A 1E0ZA 3MC9A 1DOIA 4IM3A 3OG5A 4PYUA 3AE6B 1OFFA 3P4QB 2PLPA 2KAJA 3KQ4A 1WYWB 1Y8RC 3HRDD 2WXPA 3DPDA 1N61A 1UWMA 2N9PC 3C8YA 3R2IA 1UNSA 3DBLI 3M3JA 4BKSD 2LJIA 1R4NI 3PRMB 3QK0A 2O2VA 3RNEC 4WH4A 1P7FA 4ICVA 4WAFA 1R4MI 1OEYJ 3AE1B 2ON8A 3AEGB 1WM3A 3PRPB 2ZEQA 3WAOA 3ZW3A 4KX6B 3N9YC 3APCA 2Y5CA 4HWIB 3ZDTA 3EFUA 3JYUA 4L2YA 1MHHE 3VR9B 3ZDMC 2LJ5A 5H92C 3KYDD 1KTKA 2J52A 1F77A 2KTFA 4GMVA 2LGIA 2KFKA 2MLBA 3T3NA 3RNBC 2D3AA 5JH5C 3Q3JA 3DVGY 1T6BX 2BS2B 1QKZA 1YD8U 2M0XA 1FFUA 3SFEB 2C7NB 3TBLD 3TL5A 2BQQA 1V9JA 5AUIA 4ASWC 1JWBD 4DHJD 4BVUC 2GMIC 4F8CB 2RDBC 3ETRA 4HVBA 3RNAC 3I3TB 2RPQA 3ZNHB 1C77A 2OEDA 1FMAD 2FCQA 3EGRA 3ZNID 1F1HA 4GDLA 1M4VA 2JUOA 4DHJB 1WE6A 1WGYA 2BB6A 2MJDA 1KRHA 3LDZE 1WYGA 2Y5PA 4P7IA 3UQBA 5AZGA 3HVDA 3I63C 2INCC 5DPRA 1XD3B 5JHBA 1SE4A 3Q3MC 2IGDA 2KO3A 2N9EB 2LGDA 1BUIC 2LGSA 2QCZA 1UGMA 3NY5A 5CTRC 3IG3A 1HE8A 3LB8C 3Q6BA 2BWFA 2HD5B 2NS5A 3SHQA 5JXVA 3CMMB 2HTHA 4YT0B 1TS3A 4MJSA 1UELA 2Z8LA 1FPYA 4J6IA 2DNFA 2L32A 4DHZE 2IDYA 2WXNA 3HIZA 2GI9A 1E8ZA 2WXFA 2DWQA 2MBEA 2IY0B 1BMLC 1Q1OA 3QQ8B 4C00A 2XK5A 1SJED 2GBRA 2M0AA 4DBGA 5D2MB 1YQ3B 1YMHE 3NVWA 4A3OA 1SE3A 3QAQA 3DBLB 3AN1A 4OVUA 2WXOA 1WE7A 3DHIC 2ZPNA 3KW5B 2WX0A 4MDKE 4ZHOA 2JF5A 1MG4A 1P9DU 4US9A 1P1AA 3KH0A 5HKHA 3RFZB 4NAWA 3V05A 3ZXVA 1OEYA 4M8MA 3BYTB 2YLMA 4HDOA 3Q2AC 4RH6A 1V1PA 3MTNB 3L4PA 1CQVA 5HI1A 2WLBA 3A9JA 5TSSA 3ZXRA 1FXTB 4GDKB 4XDDA 5D6JB 2M8SA 2MBBB 3FAHA 3PSEB 4EFOA 2C60A 5E6PA 2J53A 5AUKA 1GPXA 3QX1A 3FC4A 3EHVA 2KJHB 5J17A 2VZKD 3RCZA 3ZKJC 1XXGA 5D7GA 1WMHA 3Q3OC 3L0WB 3PREA 4RGNA 2V0GA 3U52E 1NI2A 5JHAA 3URYA 4EE2A 1M94A 1XF5L 2KX0A 4HK2A 5L95C 2PMVA 1B1ZA 1WJUA 2VZKB 1FCLA 2KC1A 4NQKE 5D94A 1YX6B 3NUHB 1RAXA 5JZEB 4BZAA 3PTFC 4YL8A 4IDIA 3A9KB 4Q2JA 2L0TA 3DBRI 4N58A 1WGHA 4W9FA 1FO4A 1YIWA 2D5GA 1NDDA 4DK5A 1PGXA 2FUG1 2N7DA 4R3DA 2K1FA 2RD0A 1LFDA 1A5RA 4AJYB 2KNBA 3VVWB 3VFKA 2KDFB 2N9LA 3KWVA 4RM8A 2W9NA 4W9LA 1ZGUB 3MJWA 1WWTA 2LVOA 3PHXB 1MI0A 2NPTA 2LXAA 4BKTA 2QILA 3BVGA 4N9F4 2NBWB 4IC7B 1VZ8A 2MW5A 1UWXA 3PZDA 1ISNA 2JXTA 4PS8A 2JXXA 4FBJB 4XWWA 2WX1A 5J18A 1L6UA 2BS4B 3EC8A 2AQ1B 2DZJA 1WJ4A 4K3BA 2W82A 4DWFA 2LI5A 4USAA 2NVUI 4FJZA 2I1JA 2KDIA 3KVFB 4BAXA 2BYFA 3B08A 4A8XC 2K8CA 3DVNV 2ZW0A 4HKZE 1I42A 2L7RA 4MGIE 2R2OA 2Y3AA 5J2RA 1N5XA 3IBEA 5C3JB 2VRRB 3VHTC 2FE8A 2JX5A 1EF1A 2MRPA 1N62A 2M56B 2KQ7A 1KFYB 1ZDXA 2LWPA 4OZBA 1VD2A 2INPE 2PJHA 4JQWC 3DWMA 1Q5WB 1XCTL 1XO3A 5IAAC 4MELA 4KDIC 4BBNC 2I2YA 4B0EA 3PVLA 4AOFA 2BS3B 1GB4A 3SEBA 4RNAA 4B95A 4WIPA 4WJQA 2GOWA 4HPLB 3AU5A 2IO1B 2KWCA 1FRRA 2ZNVC 2WGSA 1I4GA 3IAS1 4C56C 1GG3A 1VCBA 3NVYA 1J7AA 3TEXA 4HEA1 2BVCA 3UQAA 2BB5A 1PDXA 3BK2A 3U30A 4WURA 3GS2A 2KOXA 2FBWB 4G3XB 2SAKA 1E10A 1I35A 2WDVB 1WZ0A 4ANXA 1JALA 3DHGC 4B6WA 2JZPA 1XLPA 1GNUA 2LVQA 2N7JA 2ZCCA 2RSUA 3W1SA 2FIDA 1RWSA 3GZNI 1KLUD 3K9OB 3PPAA 1PUTA 2LGXA 3ML8A 3RZWC 1QQRA 2DAFA 5EE3A 2W55A 4EEWA 2QMTA 3N30A 4LLGM 2D07B 4HLEA 2MCNB 3A4SC 2AQ2B 4CO7A 4E71A 4C7YA 2KQ4X 2DENB 4WQOB 2QIEB 5D3DA 2FCNA 1C9FA 4BKSA 1SE9A 3U8ZA 3ALBA 1L7YA 3JW0X 2KDBA 4JLCA 2NTTA 4W9IA 2BYEA 1L0XB 3CSFA 2BF8B 4XYCA 2MBOA 2N1VA 4C80A 2CJNA 1I4RA 1V1OA 4B9KA 4YXDB 1SF0A 1HZ5A 2DYOA 5BYQA 2OOBB 3A33B 3MC8A 3MFGA 3SR6A 1QOAA 4LJOB 4MH0E 4MGZE 2JQRB 3Q3FA 2OJRA 3KUZA 3H7SA 2LASA 4P6VF 3Q8BA 2JYEA 2ZPYA 4IM2A 3EECA 4NZLB 5BMGA 4JIOU 2CS4A 2E6XA 1C4AA 2N7EA 3U7ZA 4JWUC 2BKFA 3BK1A 1K53A 1R7SA 2C9WB 1ZXIA 1CJEA 2KVZA 3C19A 4TUUA 4YSXB 4HROA 4LTUA 3OLMD 2PKOA 2MJ3A 2WXJA 2INNE 2ONQA 1LO5D 4S0RA 5H8YE 3DHHC 4PYZA 4ZYNA 3PLVA 4GSWA 3NRZA 2QJLA 2K3UA 3QCAA 2ZJDA 3BYYB 3FILB 2L3ZA 4FN2A 2KLCA 1JW9D 1QT9A 1CK1A 4HPMB 1TTNA 5DPWA 2IO2B 3UINB 3QJZA 4K7WA 2KWVB 4FLHA 1WGGA 4RM9A 1YOVB 3ECIA 2KK8A 1OGWA 5FR6A 4TSSA 2BYVE 5T8IA 5MPOA 2PIAA 2D3CA 2CR5A 1JWSD 2GBNA 1UF0A 2NTSA 3T8MA 2V1YA 3M63B 4RF0A 3ZUNA 4II3B 4URKA 3M62B 5CHFA 4II2B 1KLVA 4XGAB 4KKJA 2H88B 3KWLA 4FJYA 1TIFA 4US8A 1MHXA 1FRDA 3VAWA 3A1QB 3VXWA 1JRPA 3IVFA 3J9CA 2W3SA 2WU5B 4GGQA 1Y56A 2L1AA 3U2SC 4W9JA 2KC2A 1IBXA 3PO0A 3N3KB 2KMMA 1WJ6A 1WJNA 5HFYA 3AE3B 1F52A 2KDEB 3ZRCA 5E6NA 1D3ZA 2WXKA 4C4VB 3RUIB 3TCAA 2DYMA 1NI3A 2MBHA 1EF5A 3AEDB 1SE2A 1QILA 2UYZB 3ZJVA 2JWUA 1F0ZA 1JCKB 4W9HA 2EKEC 2JVCA 3P4SB 3ML9A 1JRUA 2XNAC 1L5PA 4KKIA 1TBEA 3GE3C 2K39A 1K8RB 1VDVA 1C78A 2LZ6A 4FULA 2Q5WD 1IGCA 3E9SA 1NENB 4XC2A 4AWJA 4REZA 3ENEA 4ACFA 4GXBA 3A4RA 3CSTA 1JWUD 1YN4A 4YTNB 1FCCC 3FKYA 4MM3A 3L54A 1FM0D 2JT4B 4X57B 2KN4A 3TEYA 3W5VB 3AEEB 2A5UA 3VTUA 1EWCA 4W9GA 1AW7A 3N1YC 1D4BA 2C5LC 3BIID 2BKRB 1PYWD 3H8HA 2DZMA 3T3OA 2KWUB 3LYYA 4MT5A 1SSNA 3U7DA 4FADA 3A9KA 2J42A 5AZFA 4YTMB 2LUEA 3NVZA 5CHWA 5IN7A 4GN1A 2MSED 4HCNB 1EU4A 1HEZE 4BFRA 5LLIA 3HM6X 3AECB 2C7MB 2PE9A 4C7ZA 3ZLZA 1L0YB 1WR1A 1DOYA 2KZRA 1C4CA 2PW9A 2D3GA 3DBHI 4F7ZA 4OZAA 3B0AA 1Q10A 1R4NB 4OZCA 5EDSA 3BWUD 4KIKB 2D11A 2IY1B 2KT7A 2K6DB 2CHZA 3MHSD 1R4MB 1WXAA 3V6EB 4BBNF 3DVGX 4HRSA 1J8CA 1TKEA 2FAZA 4KDLB 1WFYA 2B3AA 4FJVB 3VTVA 3AB5A 5HHDG 2LGYA 4LNKA 2IO0B 3CIRB 2DYBA 2IO3B 3SD5A 2RGFA 3DOWA 2KFKB 4IW0A 3ZTDA 1OTRB 2BYTA 2HDEA 4KGRA 3ZJTA 4NJ6A 2MQJA 5KHOA 1KOTA 2WXHA 3W2DA 1E90A 3RD2A 2GBKA 3B1LX 1FNUA 2BW2A 3R8BA 1V97A 3OJ4B 2O6VA 1WXSA 2CJOA 4RGMA 2DX5B 4IUMB 4GDLB 4FA6A 3N1ZC 3L17A 5IP4D 3AE7B 1IYFA 4HPPA 4LNFA 2MA9B 3BINA 2WDRB 2KQSA 3TSSA 1QZEA 4RGOS 3R7QA 3AE5B 1U4AA 2MBQA 1NYRA 2RR9A 1T0QC 2LMCA 1N63A 2K5PA 2XN9C 3RNCC 3VDZA 1T5XD 3PZ7A 1K51A 3I57A 2PEAA 5EE1A 3H7PB 3ZVVA 4D2KA 3D32A 1RYJA 1WGDA 4GB9A 2KTRB 2V4LA 3IT6B 4BOZB 4FXCA 4KVGB 4NAMA
chains in the Genus database with same CATH topology
4XDCA 3ZQ4A 2RMMA 1SXTA 1XCQL 1SIJA 3GS2A 4WURA 5C2TB 4H2AA 1QLBB 1NVID 1I4QA 2GB1A 2FBWB 1C76A 2SAKA 4M0WA 1K52A 2R61A 1E10A 1E0ZA 1UUPA 2TSSA 1DOIA 1RFKA 3DWGC 2WDVB 3AE6B 1OFFA 2LHEA 1JALA 3P4QB 1KF6B 2KAJA 2PLPA 3BVMA 3KQ4A 2JZPA 3SFDB 4GLSC 3RPFC 3HRDD 1OQRA 2V3PA 2WXPA 1N61A 3E56A 1XLPA 1UWMA 2N7JA 4ARIA 1MVKA 3V3XA 4ARCA 4UDUC 3C8YA 3R2IA 3W1SA 3EA6A 1UNSA 1RWSA 2W3RA 1KLUD 2JU6X 1SBBB 2LJIA 5EE9A 4ZRQA 1PUTA 1FXIA 1TJEA 4WH4A 1P7FA 1QQRA 5EE3A 2RDHA 2W55A 3P4PB 4WAFA 1DOXA 2QMTA 4RF1A 1L6VA 4LLGM 3R2TA 3AEAB 5D3IB 2MH7A 1ET9A 2AQ2B 3Q8AA 1YQ4B 3AE1B 2ON8A 2KQ4X 4C7YA 5BYSA 3AEGB 3ZGZA 4KX6B 3N9YC 1YJIA 2QIEB 5D3DA 1N60A 1VRAB 2Y5CA 4L2YA 4WWMA 1MHHE 4J3OD 3VR9B 2G1EA 4ZRPA 1C9FA 1ZXHA 5H92C 5GXGB 1KTKA 2J52A 2QSDA 3W5UB 1F77A 2LGIA 3T3NA 2OHFA 1T6BX 2NTTA 2BS2B 1L0XB 1QKZA 1FFUA 3SFEB 2BT6A 5AUIA 1IBXB 1JWBD 3W9CB 5G5HA 4C80A 1AN8A 2CJNA 1TS5A 1I4XA 4TMAB 3ETRA 2WU2B 1I4RA 1V1PB 1V1OA 1QOFA 4YXDB 1SF0A 2MEKA 1HZ5A 2DYOA 1ZP0B 1XLNA 1C77A 1ENFA 2OEDA 1FMAD 5BYQA 3MFGA 3SR6A 3B2GA 1QOAA 1V8CA 1EU3A 3EGRA 1YJJA 1YNTE 1HA5A 1C4PA 2JQRB 3BVZA 3TUOA 1YN5A 1KLGD 1M4VA 4P6VF 3Q8BA 2JYEA 1JMLA 1SJHD 2LUMA 5EE0A 1NEKB 1FXAA 2KACA 2BB6A 4NZLB 2MJDA 5BMGA 1KRHA 2BBCA 2E6XA 3U7ZA 1C4AA 1PFDA 2NMQA 4JWUC 3BK1A 1WYGA 1K53A 1R7SA 2Y5PA 2E3TA 1ZXIA 1CJEA 4YSXB 1QOGA 3UI3A 3HVDA 1TKGA 4HROA 4LTUA 3VRAB 5I4DA 4NJCA 1I4HA 4OW0A 3TEZA 4AQ7A 2PKOA 4MH8A 1SE4A 2MJ3A 2WXJA 3AE9B 2INNE 1VR9A 2ONQA 3MJ5A 3O13A 1LO5D 2QEJC 2IGDA 2G9HD 2BTEA 5H8YE 1QOBA 1IUEA 1BUIC 3AEBB 4MM3B 2V3NA 1FFVA 2QJLA 3NRZA 1FNWA 1XLOA 2K3UA 3LB8C 4YSZB 3FILA 3BYYB 1JWAD 3FILB 4JE3B 4ZOHC 2DLBA 1JW9D 5G5GA 1QT9A 1CK1A 4OVZA 3BZDB 1DYQA 1VZ6A 5JXVA 4YT0B 1TS3A 2Z8LA 3ABVB 3U4EG 2L32A 3AMZA 3I9V1 1XEEA 2IDYA 2WXNA 1ZPSA 2GI9A 2WXFA 1P7EA 2DWQA 4L1BA 4TSSA 1BMLC 5T8IA 5MPOA 2PIAA 1E6EB 4MACA 1EM7A 4O1NA 4N6EB 1JWSD 4AS1A 2NTSA 4RF0A 1FIQA 1SJED 4DQOC 2M0AA 1HXYD 2CU3A 2W54A 5BYRA 1YQ3B 1YMHE 3NVWA 4KKJA 3Q69A 3ZYYX 1SB3C 1SE3A 2H88B 1L4ZB 3AN1A 1I4PA 2KWDA 1MPEA 1TS2A 1C79A 1YN3A 2WXOA 3KWLA 4ZYSA 4US8A 1MHXA 4ZHOA 1FRDA 1F2RI 1JRPA 3J9CA 2W3SA 3EUB2 5BMIA 2WU5B 1RM6C 4US9A 1WRIA 2ACZB 1PGAA 1Y56A 2J4XA 3HUIA 2L1AA 3U2SC 3RFZB 4NAWB 5HG2A 3V05A 4A9AA 3P63A 2ZW1A 3BYTB 3AM9A 1IBXA 1DGJA 1WXQA 3PO0A 4RGTA 2KMMA 4RH6A 1GB1A 5HFYA 1V1PA 3AE3B 1GOZA 4RCOA 3L4PA 2PVOD 1CQVA 4ZHPA 2WXKA 3B9JA 5HI1A 1N5WA 2LEKA 1ROEA 2DYMA 2WLBA 2PTLA 4B0MA 5FKAC 1NI3A 4JX1C 5TSSA 5FR3A 4PT5A 3AEDB 2WS3B 1SE2A 1QILA 4GDKB 3NVVA 4XDDA 3ZJVA 4P16A 2JWUA 1B9RA 1F0ZA 1JCKB 1HQRD 3FAHA 3P4SB 1VZ7A 4LK0M 2J53A 2XNAC 1L5PA 1AWDA 4KKIA 1KH0A 2L83A 2LFIA 5AUKA 1WSPA 1GPXA 3MC0B 3FC4A 1A70A 4OHJA 2EKIA 1VDVA 1C78A 2HTME 2Q5WD 1IGCA 1TYGB 2VZKD 3E9SA 1NENB 1XXGA 5D7GA 4REZA 2DBYA 2ICIA 4XWTA 4WQMA 1FNVA 1TS4A 1K50A 4RGNA 4YSYB 1ZUD2 2IGGA 2V0GA 2K9XA 3ZJUA 3U52E 1D6EC 1VJKA 5E6JA 2H89B 1JWUD 2N9KA 1YN4A 4YTNB 1FCCC 3URYA 2RDGA 4EE2A 2MJEA 3GP7A 1FM0D 4A55A 1XF5L 2KN4A 3TEYA 1TY2A 3W5VB 2AX5A 3AEEB 2PMVA 1QF6A 1EWCA 1B1ZA 4JWSC 1AW7A 1D4BA 2VZKB 4IOIE 1E7PB 3BIID 1FCLA 1PYWD 3H8HA 2WNMA 2JSVX 2WP9B 3P4RB 3T3OA 2IJ0A 3LYYA 4MT5A 1XLQA 3NUHB 2WXMA 1SSNA 4IKGA 4DXFA 3IAM1 1JWMD 1CZPA 2X38A 2B76B 2WDQB 1L0VB 2J42A 4IDIA 4Q2JA 3TEWA 4N58A 4YTMB 1FO4A 3NVZA 2K0PA 1WGKA 2D5GA 3AE8B 4A90A 1L4DB 1ZE3D 4TQ1A 1FD6A 1EU4A 1HEZE 1UGJA 1PGXA 3AECB 3AV8A 2FUG1 1EWYC 4R3DA 4C7ZA 4L23A 1L0YB 1DOYA 1C4CA 3HVZA 2PW9A 1IGDA 4ITKA 4OZAA 1J7BA 2L52A 3VR8B 1Q10A 2N9LA 3KWVA 4YWGG 3P42A 4OZCA 3BWUD 1TY0A 2AQ3B 4A6QA 1WWTA 2N0SB 1JROA 1MI0A 2K22A 2QILA 2WXRA 4RFBA 3BVGA 1I7HA 1VZ8A 3NS1A 3AE2B 1UWXA 2YEPF 4KGSA 4TQ0A 2JXTA 4HRSA 4CQNA 4XE0A 2WXGA 4KGTA 4XWWA 1OQQA 2LHDA 1TKEA 1J7CA 1D5ZC 3GB1A 1GAQB 1ET6A 2WQYB 1L6UA 1F2RC 3IT4B 2BS4B 2IGHA 2GRIA 2AQ1B 3VRBB 1SEBD 3AB5A 2W82A 5HHDG 3P1MA 3CIRB 1HZ6A 4USAA 2M19A 1STEA 2PVGC 1AYFA 3B2FA 2WXQA 3WCQA 2EELA 1D5MC 4A8XC 2BYTA 2HDEA 2ZW0A 1PGBA 4HKZE 3MHZA 1ACCA 3AEFB 1T3QA 2Y3AA 4KGRA 2SEBD 3ZJTA 1N5XA 5C3JB 3NZ3A 2FE8A 2JX5A 2WXHA 3W2DA 1NYQA 1N62A 1VLBA 1ZOYB 2M56B 1BXTA 3AE4B 3PZ8A 1KFYB 1FNUA 1ZDXA 4OZBA 1FEHA 2JYTA 2INPE 1TZOA 2BW2A 4HJGE 5FK9C 2RPVA 3R8BA 1V97A 3DWMA 1ESFA 1XCTL 1XO3A 4JPSA 2CJOA 2IPKD 4RGMA 2I2YA 2WXLA 5LNK1 4GDLB 4B0EA 4DXGA 2YEPB 1E9MA 1JQ4A 3AE7B 2BS3B 3Q8FA 1GB4A 2I38A 3SEBA 4RNAA 4HKQA 2WDRB 1TKYA 3Q8EA 4WIPA 3TSSA 3CWIA 4RGOS 2V4IB 3Q8CA 3AE5B 1FRRA 1I4GA 3IAS1 2WXIA 4N59A 1NYRA 3AH7A 4C56C 3VQIA 3NVYA 2LMCA 3IXSA 3OWEB 2KDMA 1N63A 2K5PA 1J7AA 3TEXA 2XN9C 5BMHA 1T5XD 1ZDVA 3PZ7A 4HEA1 3LXFA 3KLSX 4YTPB 3MP9A 1K51A 3I57A 5EE1A 2BB5A 4D2KA 1PDXA 1RYJA 1D5XC 3IT6B 4FXCA 3BK2A 4NAMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FXA A;  2L52 A;  4ITK A;  3VR8 B;  2MJD A;  1SIJ A;  5C2T B;  1KRH A;  3AE3 B;  1QLB B;  3L4P A;  1PFD A;  1NVI D;  2PVO D;  4JWU C;  1WWT A;  2FBW B;  1WYG A;  4ZHP A;  2N0S B;  1JRO A;  1R7S A;  3B9J A;  2E3T A;  1ZXI A;  1CJE A;  2K22 A;  4YSX B;  1QOG A;  1N5W A;  1E10 A;  1E0Z A;  2LEK A;  1I7H A;  1ROE A;  1DOI A;  1RFK A;  1TKG A;  2WLB A;  3DWG C;  4HRO A;  2WDV B;  4LTU A;  3NS1 A;  3AE6 B;  1NI3 A;  1OFF A;  4JX1 C;  3AE2 B;  1JAL A;  3P4Q B;  1KF6 B;  2KAJ A;  2PKO A;  2WS3 B;  3AED B;  4HRS A;  1JQ4 A;  3SFD B;  3RPF C;  2MJ3 A;  3NVV A;  3HRD D;  3AE9 B;  1OQR A;  1F0Z A;  1OQQ A;  1N61 A;  1B9R A;  1TKE A;  1J7C A;  1UWM A;  1XLP A;  1GAQ B;  2WQY B;  5H8Y E;  1QOB A;  3FAH A;  1L6U A;  1IUE A;  2BS4 B;  3AEB B;  3P4S B;  5AUK A;  1DOX A;  1L5P A;  1AWD A;  1FFV A;  2QJL A;  2L83 A;  1XLO A;  3NRZ A;  3VRB B;  3AB5 A;  1GPX A;  1RWS A;  3FC4 A;  3LB8 C;  1A70 A;  3P1M A;  2EKI A;  2W3R A;  4YSZ B;  3CIR B;  1VDV A;  1JWA D;  4USA A;  2HTM E;  2M19 A;  1TYG B;  2Q5W D;  4ZOH C;  1JW9 D;  5EE9 A;  1NEN B;  5G5G A;  1QT9 A;  2PVG C;  1PUT A;  1AYF A;  1FXI A;  1TJE A;  3B2F A;  3WCQ A;  5EE3 A;  2DBY A;  2W55 A;  3P4P B;  4WQM A;  4YT0 B;  4YSY B;  4FXC A;  1L6V A;  1ZUD 2;  3AEF B;  2K9X A;  3ABV B;  3AEA B;  1T3Q A;  2MH7 A;  1VJK A;  2H89 B;  1YQ4 B;  1N5X A;  3AE1 B;  5C3J B;  3AMZ A;  4C7Y A;  3AEG B;  4YTN B;  2JX5 A;  4KX6 B;  1YJI A;  1NYQ A;  2QIE B;  1N60 A;  2Y5C A;  1N62 A;  2DWQ A;  1VLB A;  1FM0 D;  1ZOY B;  2M56 B;  2MJE A;  4WWM A;  3VR9 B;  3AE4 B;  2G1E A;  3W5V B;  1KFY B;  2AX5 A;  3AEE B;  5MPO A;  2PIA A;  1E6E B;  1QF6 A;  5H92 C;  4JWS C;  5GXG B;  1E7P B;  3BII D;  4N6E B;  3W5U B;  1V97 A;  3DWM A;  2WP9 B;  3P4R B;  1XO3 A;  2OHF A;  1FIQ A;  2CJO A;  1XLQ A;  2BS2 B;  2CU3 A;  2W54 A;  1YQ3 B;  1FFU A;  3SFE B;  2BT6 A;  3VRA B;  3NVW A;  1E9M A;  1CZP A;  5AUI A;  3AE7 B;  3ZYY X;  2B76 B;  1JWB D;  1SB3 C;  2BS3 B;  1L0V B;  2WDQ B;  4IDI A;  5G5H A;  2H88 B;  3W9C B;  4N58 A;  3AN1 A;  4C80 A;  2CJN A;  3KWL A;  4YTM B;  1FO4 A;  3NVZ A;  2WDR B;  1TKY A;  3ETR A;  2WU2 B;  1WGK A;  3AE8 B;  3CWI A;  4US8 A;  4ZHO A;  1FRD A;  1QOF A;  4YXD B;  1SF0 A;  3AE5 B;  1FRR A;  1ZP0 B;  1XLN A;  1FMA D;  1JRP A;  4N59 A;  1NYR A;  3AH7 A;  2W3S A;  3B2G A;  3SR6 A;  3EUB 2;  1QOA A;  2WU5 B;  1V8C A;  3AEC B;  3AV8 A;  3NVY A;  1EWY C;  1RM6 C;  1WRI A;  4US9 A;  4C7Z A;  1YJJ A;  2ACZ B;  1N63 A;  2K5P A;  1J7A A;  3HUI A;  2JQR B;  3LXF A;  4YTP B;  1DOY A;  4A9A A;  4P6V F;  3HVZ A;  5EE1 A;  3P63 A;  3AM9 A;  1PDX A;  1RYJ A;  1DGJ A;  1WXQ A;  3PO0 A;  5EE0 A;  1NEK B;  2KMM A;  1J7B A; 
#chains in the Genus database with same CATH topology
 4XDC A;  1SXT A;  5C2T B;  4H2A A;  1NVI D;  2MHJ A;  2V3S A;  4DXA B;  3AU4 A;  2C7H A;  2D2Q A;  2TSS A;  1RFK A;  3DWG C;  3L10 B;  4MJS B;  5LXI B;  3BVM A;  3RPF C;  1EUV B;  2V3P A;  2ZCB A;  3E56 A;  4ARI A;  1MVK A;  4WWN A;  2L8J A;  4ARC A;  4UDU C;  3EA6 A;  3O65 B;  3W1Y A;  4ZRQ A;  2JPH A;  1FXI A;  1TJE A;  2RDH A;  3P4P B;  2ZZP B;  4RF1 A;  1L6V A;  4NQL B;  3R2T A;  2KKC A;  3APF A;  3PT2 B;  2NBV B;  3L13 A;  5BYS A;  3ZGZ A;  1WH3 A;  5DPT A;  1N60 A;  1RLF A;  1VRA B;  3C0R B;  4W9D A;  4K1R B;  3VUY A;  3QHT A;  2LXC A;  1ZXH A;  2J0M A;  2QSD A;  3APD A;  2NBU A;  4GU2 A;  2OHF A;  2V9H A;  3PLU A;  2KMA A;  3I5J C;  4TKN A;  4K81 A;  1I4X A;  3QAR A;  4TMA B;  1YQB A;  1V1P B;  2L00 B;  3IHP C;  3V62 A;  1QOF A;  2GLS A;  2MEK A;  2J0J A;  2VH1 A;  2XEW A;  4K3C A;  5LXH A;  2Z59 B;  3B2G A;  3NJT A;  1E8W A;  1V8C A;  2DZK A;  4BOS C;  1YJ1 A;  5TR5 A;  3A9J B;  1TZ1 A;  1HA5 A;  1C4P A;  3BVZ A;  3TUO A;  4FHK A;  1YN5 A;  1KLG D;  2HJ1 A;  3ZRF A;  1TGZ B;  1E7U A;  2LUM A;  5EE0 A;  1NEK B;  1FXA A;  2KAC A;  2NR2 A;  2N1W A;  1YX5 B;  2BBC A;  1PFD A;  3HK0 A;  3UI3 A;  2WDT B;  2ZNV B;  1V80 A;  1TKG A;  1WMH B;  3VRA B;  2Z0D B;  1I4H A;  2K25 A;  4OW0 A;  4ZDV A;  1WRD B;  3MJ5 A;  3RN9 C;  1VR9 A;  2MP2 A;  2QEJ C;  5IO9 A;  1QOB A;  4XZ4 A;  2PPH A;  1IUE A;  2KFJ A;  2V3N A;  1FFV A;  1FNW A;  1XLO A;  4YSZ B;  3FIL A;  4ICU A;  4JE3 B;  5G5G A;  2IYD B;  4OVZ A;  2HJ8 A;  3BZD B;  4ANU A;  1DYQ A;  1VZ6 A;  1Z5S B;  4KSL C;  1Z2M A;  3DBR B;  1UH6 A;  3AMZ A;  2OJW A;  1XEE A;  2FCS A;  5L83 A;  1WX8 A;  2M17 A;  4L1B A;  3RI7 C;  4WJO A;  4ZRK A;  4AS1 A;  4TV3 A;  4P1C C;  1FIQ A;  3N32 A;  4DQO C;  3RUL A;  2G45 B;  2PE6 B;  4AP4 C;  1KM7 A;  4PS3 A;  1MFW A;  3QC8 B;  1SB3 C;  2GBM A;  1L4Z B;  4PS7 A;  2N9X A;  3Q3N C;  2KWD A;  1V5T A;  1C79 A;  4ZYS A;  4NNJ B;  2WYQ A;  3CF6 E;  4BKG A;  3A1Q A;  2IBI B;  2GBJ A;  3EUB 2;  2QHO A;  4JL9 A;  3AUL A;  3VH3 B;  1PGA A;  3HUI A;  1LGR A;  2J4X A;  1GUA B;  4A9A A;  3P63 A;  2ZW1 A;  1WXQ A;  4RGT A;  1E7V A;  3ZIM A;  3R7R A;  1IPG A;  1GOZ A;  4RCO A;  2PVO D;  4ZHP A;  4C4V A;  2IZV B;  3DVN U;  1N5W A;  2DHZ A;  4RMA A;  2LEK A;  1ROE A;  4B0M A;  2PTL A;  5FKA C;  4JX1 C;  4M8N A;  5FR3 A;  4PT5 A;  2WS3 B;  4LJP B;  3UF8 A;  3NVV A;  4P16 A;  1B9R A;  2KAN A;  3NHE B;  2JRH A;  5IKC M;  2KVR A;  1DOX A;  3R66 C;  1WSP A;  4OHJ A;  2KYW A;  2EKI A;  4IM0 A;  3L16 A;  2HTM E;  1S1Q B;  1WI0 A;  4OVV A;  2DBY A;  4XWT A;  1FNV A;  1TS4 A;  1P0R A;  4YSY B;  1SGH A;  2IGG A;  2R2Q A;  3ZJU A;  3Q14 C;  1VJK A;  1ZW7 A;  1HTO A;  2KHW B;  5GMV A;  2K6Q A;  3QA8 A;  1WXM A;  4KZ0 A;  3KUC B;  2RDG A;  2MJE A;  1V5O A;  1TY2 A;  3RZF A;  2AX5 A;  4EUT A;  4JWS C;  2ZVN A;  2JSV X;  3P4R B;  2ZVO A;  1XT9 B;  1XLQ A;  2K8H A;  2WXM A;  3UGB B;  2D3B A;  4IKG A;  4DXF A;  1JWM D;  3H9D A;  4WWP A;  2WDQ B;  1L0V B;  2ASQ A;  2K0P A;  3ZNZ B;  3AE8 B;  4A90 A;  4EZL A;  3R3M A;  1ZE3 D;  4W9K A;  3PGE A;  1LM8 B;  3AV8 A;  1TT5 B;  3DBS A;  2AWT A;  3HVZ A;  4PK1 A;  3UIP B;  4ITK A;  3W1S C;  3GZN B;  2WWZ A;  1J7B A;  5BO4 B;  4YWG G;  4MSM B;  3RNF C;  4MEM A;  4KIK A;  1F9J A;  2AQ3 B;  4KSK C;  4A6Q A;  1JRO A;  2JWZ A;  2QDF A;  2MX2 A;  3TJP A;  2K22 A;  4RFB A;  1I7H A;  2Y5B B;  2KX3 A;  2LVP A;  2G4S A;  3AE2 B;  4KGS A;  2D10 A;  1BT0 A;  3N20 C;  4XE0 A;  4KGT A;  4IG7 B;  1GC7 A;  1OQQ A;  4MSQ B;  3HHM A;  1ET6 A;  2LD9 A;  3IT4 B;  3WIM A;  2GRI A;  4XX5 A;  4LCD E;  3P1M A;  3KYC D;  4G50 A;  1EO6 A;  1HZ6 A;  1E8X A;  1X1M A;  2M19 A;  2M1M A;  1L2N A;  4NPN A;  1D5M C;  3MHZ A;  4GDK A;  2AL3 A;  2SEB D;  1UD7 A;  3EFC A;  3NZ3 A;  1NYQ A;  1NBF C;  2X8X X;  1ZOY B;  1BXT A;  1FEH A;  2JYT A;  3DDC B;  1TZO A;  5FK9 C;  2RPV A;  3WAM A;  3WA0 A;  4JPS A;  3NZU A;  1SIF A;  3VUW A;  2WXL A;  5LNK 1;  2NCN A;  4DXG A;  2YEP B;  1JQ4 A;  4M00 A;  3PRZ A;  4HKQ A;  3Q8E A;  1TKY A;  3CWI A;  4A3P A;  2V4I B;  3Q8C A;  3SU8 X;  2KD0 A;  2WXI A;  4N59 A;  3IXS A;  2KDM A;  5BMH A;  1ZDV A;  4YTP B;  3H7P A;  4K7S A;  1V2Y A;  5DPS A;  2KTR A;  3AXC A;  4FHJ A;  4E74 A;  2CKH B;  3JSV B;  2RMM A;  2QC8 A;  3NOB A;  2VH2 A;  1I4Q A;  1V81 A;  2GB1 A;  4MGK E;  1K52 A;  4M0W B;  3L08 A;  1UUP A;  4EKU A;  2LHE A;  1KF6 B;  3RYT A;  3SFD B;  4M02 A;  4GLS C;  4LNI A;  3T9L A;  1OQR A;  2G4D B;  4KV2 A;  1T0S C;  2K8B A;  3V3X A;  2EMT A;  1WZ3 A;  4WWO A;  2AYO B;  2W3R A;  2JU6 X;  1V86 A;  1SBB B;  3NS8 A;  1PQS A;  1WR6 E;  3ONS A;  5EE9 A;  1WY8 A;  3BY4 B;  4EOY A;  4F1S A;  2O2V B;  3NZS A;  1WXV A;  2MWS B;  3H1U A;  3AEA B;  5D3I B;  2MH7 A;  1ET9 A;  3Q8A A;  1YQ4 B;  2XBB C;  3RMK C;  4A20 A;  1YJI A;  4WWM A;  4J3O D;  2G1E A;  4ZRP A;  5GXG B;  3W5U B;  1MJD A;  2BWE S;  4I6P A;  2DAJ A;  3PV1 A;  4WJN A;  2LRU A;  1Q0W B;  2BT6 A;  1IBX B;  3W9C B;  5G5H A;  1AN8 A;  1TS5 A;  4GIV A;  2WU2 B;  1GC6 A;  4NJ7 A;  4G0N B;  4W9E A;  1ZP0 B;  1XLN A;  1ENF A;  2BPS A;  3OJ3 A;  1C3T A;  1EU3 A;  4DDG D;  1YJJ A;  1YNT E;  2JZ3 B;  4P1B C;  4JGH B;  1JML A;  1SJH D;  1LQB A;  1MG8 A;  4ZRJ A;  2WHI A;  4I6N B;  2NMQ A;  4ANV A;  2E3T A;  3X0W A;  1QOG A;  3DQV A;  5I4D A;  4NJC A;  4IWQ A;  3TEZ A;  4AQ7 A;  4MH8 A;  2A4Z A;  3O13 A;  3AE9 B;  2EMS A;  2G9H D;  2J7Q B;  2BTE A;  1J0G A;  3AEB B;  2JRI B;  4MM3 B;  2Z0E B;  4LDT D;  4M01 A;  1JWA D;  4ZOH C;  2DLB A;  1WX7 A;  1AAR A;  3V6C B;  4QAY A;  1CMX B;  2FIF A;  3P2B A;  3AI5 A;  2KJ6 A;  3ZNG C;  1H4R A;  3WAP A;  1XQQ A;  3ABV B;  1N6Z A;  3U4E G;  1J19 A;  3I9V 1;  4CYE A;  2IND C;  3UIO B;  1ZPS A;  1P7E A;  3QWZ B;  1T0Y A;  4LDT B;  1E6E B;  3QIJ A;  4MAC A;  1EM7 A;  4O1N A;  4E3C A;  4N6E B;  2L76 A;  5C1Z A;  2XK5 B;  1G6J A;  3DBH B;  2BGF A;  4G11 A;  1HXY D;  2CU3 A;  2W54 A;  5BYR A;  2CU1 A;  4I6L B;  3Q69 A;  3ZYY X;  5KHQ A;  1I4P A;  1MPE A;  1TS2 A;  1YN3 A;  2AL6 A;  1F2R I;  1T0R C;  1S3S G;  5BMI A;  1RM6 C;  1WRI A;  3H6N A;  2ACZ B;  4CHK A;  5CX3 A;  4NAW B;  5HG2 A;  3AM9 A;  1DGJ A;  3TIX A;  5AZH A;  1E5W A;  4HJK A;  3PS6 A;  1GB1 A;  3ZO5 B;  1HTQ A;  3VH4 B;  2HE7 A;  3JVZ X;  3B9J A;  2O6V D;  2L05 A;  2G3Q B;  3TMP B;  1RFA A;  4ZRI A;  4NY0 A;  2KJR A;  4K7U A;  1WIA A;  4W9C A;  3GOE A;  3VUX A;  2UWQ A;  1IP9 A;  1HQR D;  1UZX B;  1VZ7 A;  4LNO A;  4LK0 M;  3ZQ4 A;  2AEH A;  1AWD A;  1KH0 A;  1LXD A;  2L83 A;  2LFI A;  3MC0 B;  1A70 A;  4WJP A;  3WAL A;  1TYG B;  2O6V B;  2ICI A;  4WQM A;  3RNG C;  1K50 A;  2FCM A;  3S2A A;  1ZUD 2;  2K9X A;  3X23 A;  2J0K A;  1D6E C;  3ZTC A;  5E6J A;  2H89 B;  2N9K A;  3DCG A;  5G2N A;  4HDQ A;  3GP7 A;  4A55 A;  2I1K A;  1WF9 A;  1QF6 A;  3K9P B;  4AUQ C;  4IOI E;  1E7P B;  2YVC A;  4HCP B;  4EZJ A;  2WNM A;  4ANW A;  2WP9 B;  3NG0 A;  2IJ0 A;  4LNN A;  5AEK B;  1P98 A;  4HXD A;  1OQY A;  3IAM 1;  1CZP A;  2X38 A;  2B76 B;  3RT3 B;  3TEW A;  5E6O A;  2KN5 A;  2CHX A;  1WGK A;  3SDL C;  1WX9 A;  3N1X C;  2N4F A;  1L4D B;  3GE8 C;  1P3Q U;  3IFW B;  4TQ1 A;  1FD6 A;  1UGJ A;  2KXJ A;  1EWY C;  1ZKH A;  1V6E A;  4L23 A;  1RRB A;  1IGD A;  2LRW A;  2L52 A;  3VR8 B;  3P42 A;  4EZK A;  1TY0 A;  3M95 A;  3WAN A;  2N0S B;  3OAW A;  2L0F A;  2NPT B;  2WXR A;  3NS1 A;  4IWP A;  2FNJ B;  2YEP F;  4MGY E;  4TQ0 A;  4CQN A;  2WXG A;  4AJW A;  2LHD A;  3GB1 A;  1J7C A;  1D5Z C;  2UU7 A;  1GAQ B;  2JZZ A;  2WQY B;  1E8Y A;  1F2R C;  2DZI A;  2IGH A;  3V60 A;  4IWO A;  4WAA A;  3VRB B;  1SEB D;  1KJT A;  5IOI A;  3VTW A;  5CHV C;  1STE A;  2PVG C;  1AYF A;  3B2F A;  1V49 A;  2WXQ A;  2CHW A;  3WCQ A;  2EEL A;  1PGB A;  1ACC A;  3AEF B;  1T3Q A;  1VLB A;  2REX A;  3AE4 B;  4S17 A;  3PZ8 A;  4GOC A;  1WGR A;  2KLG A;  1C1Y B;  4HJG E;  2JY6 A;  1ESF A;  1GJZ A;  5G55 A;  2IPK D;  3V61 A;  1E9M A;  3Q8F A;  2M4N A;  2I38 A;  1H8C A;  1UBQ A;  4DHZ B;  1UBI A;  3AH7 A;  3VQI A;  3LJ3 A;  3OWE B;  4DDI D;  3HM3 A;  3LXF A;  3KLS X;  2FUH B;  3MP9 A;  2MP2 B;  1D5X C;  5DCN A;  1WM2 A;  3JSV A;  1XCQ L;  1SIJ A;  5IA7 A;  4KZC A;  1QLB B;  3KUD B;  5C23 A;  1C76 A;  4M0W A;  3PHW B;  2KMC A;  2R61 A;  1E0Z A;  3MC9 A;  1DOI A;  4IM3 A;  3OG5 A;  4PYU A;  3AE6 B;  1OFF A;  3P4Q B;  2PLP A;  2KAJ A;  3KQ4 A;  1WYW B;  1Y8R C;  3HRD D;  2WXP A;  3DPD A;  1N61 A;  1UWM A;  2N9P C;  3C8Y A;  3R2I A;  1UNS A;  3DBL I;  3M3J A;  4BKS D;  2LJI A;  1R4N I;  3PRM B;  3QK0 A;  2O2V A;  3RNE C;  4WH4 A;  1P7F A;  4ICV A;  4WAF A;  1R4M I;  1OEY J;  3AE1 B;  2ON8 A;  3AEG B;  1WM3 A;  3PRP B;  2ZEQ A;  3WAO A;  3ZW3 A;  4KX6 B;  3N9Y C;  3APC A;  2Y5C A;  4HWI B;  3ZDT A;  3EFU A;  3JYU A;  4L2Y A;  1MHH E;  3VR9 B;  3ZDM C;  2LJ5 A;  5H92 C;  3KYD D;  1KTK A;  2J52 A;  1F77 A;  2KTF A;  4GMV A;  2LGI A;  2KFK A;  2MLB A;  3T3N A;  3RNB C;  2D3A A;  5JH5 C;  3Q3J A;  3DVG Y;  1T6B X;  2BS2 B;  1QKZ A;  1YD8 U;  2M0X A;  1FFU A;  3SFE B;  2C7N B;  3TBL D;  3TL5 A;  2BQQ A;  1V9J A;  5AUI A;  4ASW C;  1JWB D;  4DHJ D;  4BVU C;  2GMI C;  4F8C B;  2RDB C;  3ETR A;  4HVB A;  3RNA C;  3I3T B;  2RPQ A;  3ZNH B;  1C77 A;  2OED A;  1FMA D;  2FCQ A;  3EGR A;  3ZNI D;  1F1H A;  4GDL A;  1M4V A;  2JUO A;  4DHJ B;  1WE6 A;  1WGY A;  2BB6 A;  2MJD A;  1KRH A;  3LDZ E;  1WYG A;  2Y5P A;  4P7I A;  3UQB A;  5AZG A;  3HVD A;  3I63 C;  2INC C;  5DPR A;  1XD3 B;  5JHB A;  1SE4 A;  3Q3M C;  2IGD A;  2KO3 A;  2N9E B;  2LGD A;  1BUI C;  2LGS A;  2QCZ A;  1UGM A;  3NY5 A;  5CTR C;  3IG3 A;  1HE8 A;  3LB8 C;  3Q6B A;  2BWF A;  2HD5 B;  2NS5 A;  3SHQ A;  5JXV A;  3CMM B;  2HTH A;  4YT0 B;  1TS3 A;  4MJS A;  1UEL A;  2Z8L A;  1FPY A;  4J6I A;  2DNF A;  2L32 A;  4DHZ E;  2IDY A;  2WXN A;  3HIZ A;  2GI9 A;  1E8Z A;  2WXF A;  2DWQ A;  2MBE A;  2IY0 B;  1BML C;  1Q1O A;  3QQ8 B;  4C00 A;  2XK5 A;  1SJE D;  2GBR A;  2M0A A;  4DBG A;  5D2M B;  1YQ3 B;  1YMH E;  3NVW A;  4A3O A;  1SE3 A;  3QAQ A;  3DBL B;  3AN1 A;  4OVU A;  2WXO A;  1WE7 A;  3DHI C;  2ZPN A;  3KW5 B;  2WX0 A;  4MDK E;  4ZHO A;  2JF5 A;  1MG4 A;  1P9D U;  4US9 A;  1P1A A;  3KH0 A;  5HKH A;  3RFZ B;  4NAW A;  3V05 A;  3ZXV A;  1OEY A;  4M8M A;  3BYT B;  2YLM A;  4HDO A;  3Q2A C;  4RH6 A;  1V1P A;  3MTN B;  3L4P A;  1CQV A;  5HI1 A;  2WLB A;  3A9J A;  5TSS A;  3ZXR A;  1FXT B;  4GDK B;  4XDD A;  5D6J B;  2M8S A;  2MBB B;  3FAH A;  3PSE B;  4EFO A;  2C60 A;  5E6P A;  2J53 A;  5AUK A;  1GPX A;  3QX1 A;  3FC4 A;  3EHV A;  2KJH B;  5J17 A;  2VZK D;  3RCZ A;  3ZKJ C;  1XXG A;  5D7G A;  1WMH A;  3Q3O C;  3L0W B;  3PRE A;  4RGN A;  2V0G A;  3U52 E;  1NI2 A;  5JHA A;  3URY A;  4EE2 A;  1M94 A;  1XF5 L;  2KX0 A;  4HK2 A;  5L95 C;  2PMV A;  1B1Z A;  1WJU A;  2VZK B;  1FCL A;  2KC1 A;  4NQK E;  5D94 A;  1YX6 B;  3NUH B;  1RAX A;  5JZE B;  4BZA A;  3PTF C;  4YL8 A;  4IDI A;  3A9K B;  4Q2J A;  2L0T A;  3DBR I;  4N58 A;  1WGH A;  4W9F A;  1FO4 A;  1YIW A;  2D5G A;  1NDD A;  4DK5 A;  1PGX A;  2FUG 1;  2N7D A;  4R3D A;  2K1F A;  2RD0 A;  1LFD A;  1A5R A;  4AJY B;  2KNB A;  3VVW B;  3VFK A;  2KDF B;  2N9L A;  3KWV A;  4RM8 A;  2W9N A;  4W9L A;  1ZGU B;  3MJW A;  1WWT A;  2LVO A;  3PHX B;  1MI0 A;  2NPT A;  2LXA A;  4BKT A;  2QIL A;  3BVG A;  4N9F 4;  2NBW B;  4IC7 B;  1VZ8 A;  2MW5 A;  1UWX A;  3PZD A;  1ISN A;  2JXT A;  4PS8 A;  2JXX A;  4FBJ B;  4XWW A;  2WX1 A;  5J18 A;  1L6U A;  2BS4 B;  3EC8 A;  2AQ1 B;  2DZJ A;  1WJ4 A;  4K3B A;  2W82 A;  4DWF A;  2LI5 A;  4USA A;  2NVU I;  4FJZ A;  2I1J A;  2KDI A;  3KVF B;  4BAX A;  2BYF A;  3B08 A;  4A8X C;  2K8C A;  3DVN V;  2ZW0 A;  4HKZ E;  1I42 A;  2L7R A;  4MGI E;  2R2O A;  2Y3A A;  5J2R A;  1N5X A;  3IBE A;  5C3J B;  2VRR B;  3VHT C;  2FE8 A;  2JX5 A;  1EF1 A;  2MRP A;  1N62 A;  2M56 B;  2KQ7 A;  1KFY B;  1ZDX A;  2LWP A;  4OZB A;  1VD2 A;  2INP E;  2PJH A;  4JQW C;  3DWM A;  1Q5W B;  1XCT L;  1XO3 A;  5IAA C;  4MEL A;  4KDI C;  4BBN C;  2I2Y A;  4B0E A;  3PVL A;  4AOF A;  2BS3 B;  1GB4 A;  3SEB A;  4RNA A;  4B95 A;  4WIP A;  4WJQ A;  2GOW A;  4HPL B;  3AU5 A;  2IO1 B;  2KWC A;  1FRR A;  2ZNV C;  2WGS A;  1I4G A;  3IAS 1;  4C56 C;  1GG3 A;  1VCB A;  3NVY A;  1J7A A;  3TEX A;  4HEA 1;  2BVC A;  3UQA A;  2BB5 A;  1PDX A;  3BK2 A;  3U30 A;  4WUR A;  3GS2 A;  2KOX A;  2FBW B;  4G3X B;  2SAK A;  1E10 A;  1I35 A;  2WDV B;  1WZ0 A;  4ANX A;  1JAL A;  3DHG C;  4B6W A;  2JZP A;  1XLP A;  1GNU A;  2LVQ A;  2N7J A;  2ZCC A;  2RSU A;  3W1S A;  2FID A;  1RWS A;  3GZN I;  1KLU D;  3K9O B;  3PPA A;  1PUT A;  2LGX A;  3ML8 A;  3RZW C;  1QQR A;  2DAF A;  5EE3 A;  2W55 A;  4EEW A;  2QMT A;  3N30 A;  4LLG M;  2D07 B;  4HLE A;  2MCN B;  3A4S C;  2AQ2 B;  4CO7 A;  4E71 A;  4C7Y A;  2KQ4 X;  2DEN B;  4WQO B;  2QIE B;  5D3D A;  2FCN A;  1C9F A;  4BKS A;  1SE9 A;  3U8Z A;  3ALB A;  1L7Y A;  3JW0 X;  2KDB A;  4JLC A;  2NTT A;  4W9I A;  2BYE A;  1L0X B;  3CSF A;  2BF8 B;  4XYC A;  2MBO A;  2N1V A;  4C80 A;  2CJN A;  1I4R A;  1V1O A;  4B9K A;  4YXD B;  1SF0 A;  1HZ5 A;  2DYO A;  5BYQ A;  2OOB B;  3A33 B;  3MC8 A;  3MFG A;  3SR6 A;  1QOA A;  4LJO B;  4MH0 E;  4MGZ E;  2JQR B;  3Q3F A;  2OJR A;  3KUZ A;  3H7S A;  2LAS A;  4P6V F;  3Q8B A;  2JYE A;  2ZPY A;  4IM2 A;  3EEC A;  4NZL B;  5BMG A;  4JIO U;  2CS4 A;  2E6X A;  1C4A A;  2N7E A;  3U7Z A;  4JWU C;  2BKF A;  3BK1 A;  1K53 A;  1R7S A;  2C9W B;  1ZXI A;  1CJE A;  2KVZ A;  3C19 A;  4TUU A;  4YSX B;  4HRO A;  4LTU A;  3OLM D;  2PKO A;  2MJ3 A;  2WXJ A;  2INN E;  2ONQ A;  1LO5 D;  4S0R A;  5H8Y E;  3DHH C;  4PYZ A;  4ZYN A;  3PLV A;  4GSW A;  3NRZ A;  2QJL A;  2K3U A;  3QCA A;  2ZJD A;  3BYY B;  3FIL B;  2L3Z A;  4FN2 A;  2KLC A;  1JW9 D;  1QT9 A;  1CK1 A;  4HPM B;  1TTN A;  5DPW A;  2IO2 B;  3UIN B;  3QJZ A;  4K7W A;  2KWV B;  4FLH A;  1WGG A;  4RM9 A;  1YOV B;  3ECI A;  2KK8 A;  1OGW A;  5FR6 A;  4TSS A;  2BYV E;  5T8I A;  5MPO A;  2PIA A;  2D3C A;  2CR5 A;  1JWS D;  2GBN A;  1UF0 A;  2NTS A;  3T8M A;  2V1Y A;  3M63 B;  4RF0 A;  3ZUN A;  4II3 B;  4URK A;  3M62 B;  5CHF A;  4II2 B;  1KLV A;  4XGA B;  4KKJ A;  2H88 B;  3KWL A;  4FJY A;  1TIF A;  4US8 A;  1MHX A;  1FRD A;  3VAW A;  3A1Q B;  3VXW A;  1JRP A;  3IVF A;  3J9C A;  2W3S A;  2WU5 B;  4GGQ A;  1Y56 A;  2L1A A;  3U2S C;  4W9J A;  2KC2 A;  1IBX A;  3PO0 A;  3N3K B;  2KMM A;  1WJ6 A;  1WJN A;  5HFY A;  3AE3 B;  1F52 A;  2KDE B;  3ZRC A;  5E6N A;  1D3Z A;  2WXK A;  4C4V B;  3RUI B;  3TCA A;  2DYM A;  1NI3 A;  2MBH A;  1EF5 A;  3AED B;  1SE2 A;  1QIL A;  2UYZ B;  3ZJV A;  2JWU A;  1F0Z A;  1JCK B;  4W9H A;  2EKE C;  2JVC A;  3P4S B;  3ML9 A;  1JRU A;  2XNA C;  1L5P A;  4KKI A;  1TBE A;  3GE3 C;  2K39 A;  1K8R B;  1VDV A;  1C78 A;  2LZ6 A;  4FUL A;  2Q5W D;  1IGC A;  3E9S A;  1NEN B;  4XC2 A;  4AWJ A;  4REZ A;  3ENE A;  4ACF A;  4GXB A;  3A4R A;  3CST A;  1JWU D;  1YN4 A;  4YTN B;  1FCC C;  3FKY A;  4MM3 A;  3L54 A;  1FM0 D;  2JT4 B;  4X57 B;  2KN4 A;  3TEY A;  3W5V B;  3AEE B;  2A5U A;  3VTU A;  1EWC A;  4W9G A;  1AW7 A;  3N1Y C;  1D4B A;  2C5L C;  3BII D;  2BKR B;  1PYW D;  3H8H A;  2DZM A;  3T3O A;  2KWU B;  3LYY A;  4MT5 A;  1SSN A;  3U7D A;  4FAD A;  3A9K A;  2J42 A;  5AZF A;  4YTM B;  2LUE A;  3NVZ A;  5CHW A;  5IN7 A;  4GN1 A;  2MSE D;  4HCN B;  1EU4 A;  1HEZ E;  4BFR A;  5LLI A;  3HM6 X;  3AEC B;  2C7M B;  2PE9 A;  4C7Z A;  3ZLZ A;  1L0Y B;  1WR1 A;  1DOY A;  2KZR A;  1C4C A;  2PW9 A;  2D3G A;  3DBH I;  4F7Z A;  4OZA A;  3B0A A;  1Q10 A;  1R4N B;  4OZC A;  5EDS A;  3BWU D;  4KIK B;  2D11 A;  2IY1 B;  2KT7 A;  2K6D B;  2CHZ A;  3MHS D;  1R4M B;  1WXA A;  3V6E B;  4BBN F;  3DVG X;  4HRS A;  1J8C A;  1TKE A;  2FAZ A;  4KDL B;  1WFY A;  2B3A A;  4FJV B;  3VTV A;  3AB5 A;  5HHD G;  2LGY A;  4LNK A;  2IO0 B;  3CIR B;  2DYB A;  2IO3 B;  3SD5 A;  2RGF A;  3DOW A;  2KFK B;  4IW0 A;  3ZTD A;  1OTR B;  2BYT A;  2HDE A;  4KGR A;  3ZJT A;  4NJ6 A;  2MQJ A;  5KHO A;  1KOT A;  2WXH A;  3W2D A;  1E90 A;  3RD2 A;  2GBK A;  3B1L X;  1FNU A;  2BW2 A;  3R8B A;  1V97 A;  3OJ4 B;  2O6V A;  1WXS A;  2CJO A;  4RGM A;  2DX5 B;  4IUM B;  4GDL B;  4FA6 A;  3N1Z C;  3L17 A;  5IP4 D;  3AE7 B;  1IYF A;  4HPP A;  4LNF A;  2MA9 B;  3BIN A;  2WDR B;  2KQS A;  3TSS A;  1QZE A;  4RGO S;  3R7Q A;  3AE5 B;  1U4A A;  2MBQ A;  1NYR A;  2RR9 A;  1T0Q C;  2LMC A;  1N63 A;  2K5P A;  2XN9 C;  3RNC C;  3VDZ A;  1T5X D;  3PZ7 A;  1K51 A;  3I57 A;  2PEA A;  5EE1 A;  3H7P B;  3ZVV A;  4D2K A;  3D32 A;  1RYJ A;  1WGD A;  4GB9 A;  2KTR B;  2V4L A;  3IT6 B;  4BOZ B;  4FXC A;  4KVG B;  4NAM A; 
#chains in the Genus database with same CATH homology
 4XDC A;  3ZQ4 A;  2RMM A;  1SXT A;  1XCQ L;  1SIJ A;  3GS2 A;  4WUR A;  5C2T B;  4H2A A;  1QLB B;  1NVI D;  1I4Q A;  2GB1 A;  2FBW B;  1C76 A;  2SAK A;  4M0W A;  1K52 A;  2R61 A;  1E10 A;  1E0Z A;  1UUP A;  2TSS A;  1DOI A;  1RFK A;  3DWG C;  2WDV B;  3AE6 B;  1OFF A;  2LHE A;  1JAL A;  3P4Q B;  1KF6 B;  2KAJ A;  2PLP A;  3BVM A;  3KQ4 A;  2JZP A;  3SFD B;  4GLS C;  3RPF C;  3HRD D;  1OQR A;  2V3P A;  2WXP A;  1N61 A;  3E56 A;  1XLP A;  1UWM A;  2N7J A;  4ARI A;  1MVK A;  3V3X A;  4ARC A;  4UDU C;  3C8Y A;  3R2I A;  3W1S A;  3EA6 A;  1UNS A;  1RWS A;  2W3R A;  1KLU D;  2JU6 X;  1SBB B;  2LJI A;  5EE9 A;  4ZRQ A;  1PUT A;  1FXI A;  1TJE A;  4WH4 A;  1P7F A;  1QQR A;  5EE3 A;  2RDH A;  2W55 A;  3P4P B;  4WAF A;  1DOX A;  2QMT A;  4RF1 A;  1L6V A;  4LLG M;  3R2T A;  3AEA B;  5D3I B;  2MH7 A;  1ET9 A;  2AQ2 B;  3Q8A A;  1YQ4 B;  3AE1 B;  2ON8 A;  2KQ4 X;  4C7Y A;  5BYS A;  3AEG B;  3ZGZ A;  4KX6 B;  3N9Y C;  1YJI A;  2QIE B;  5D3D A;  1N60 A;  1VRA B;  2Y5C A;  4L2Y A;  4WWM A;  1MHH E;  4J3O D;  3VR9 B;  2G1E A;  4ZRP A;  1C9F A;  1ZXH A;  5H92 C;  5GXG B;  1KTK A;  2J52 A;  2QSD A;  3W5U B;  1F77 A;  2LGI A;  3T3N A;  2OHF A;  1T6B X;  2NTT A;  2BS2 B;  1L0X B;  1QKZ A;  1FFU A;  3SFE B;  2BT6 A;  5AUI A;  1IBX B;  1JWB D;  3W9C B;  5G5H A;  4C80 A;  1AN8 A;  2CJN A;  1TS5 A;  1I4X A;  4TMA B;  3ETR A;  2WU2 B;  1I4R A;  1V1P B;  1V1O A;  1QOF A;  4YXD B;  1SF0 A;  2MEK A;  1HZ5 A;  2DYO A;  1ZP0 B;  1XLN A;  1C77 A;  1ENF A;  2OED A;  1FMA D;  5BYQ A;  3MFG A;  3SR6 A;  3B2G A;  1QOA A;  1V8C A;  1EU3 A;  3EGR A;  1YJJ A;  1YNT E;  1HA5 A;  1C4P A;  2JQR B;  3BVZ A;  3TUO A;  1YN5 A;  1KLG D;  1M4V A;  4P6V F;  3Q8B A;  2JYE A;  1JML A;  1SJH D;  2LUM A;  5EE0 A;  1NEK B;  1FXA A;  2KAC A;  2BB6 A;  4NZL B;  2MJD A;  5BMG A;  1KRH A;  2BBC A;  2E6X A;  3U7Z A;  1C4A A;  1PFD A;  2NMQ A;  4JWU C;  3BK1 A;  1WYG A;  1K53 A;  1R7S A;  2Y5P A;  2E3T A;  1ZXI A;  1CJE A;  4YSX B;  1QOG A;  3UI3 A;  3HVD A;  1TKG A;  4HRO A;  4LTU A;  3VRA B;  5I4D A;  4NJC A;  1I4H A;  4OW0 A;  3TEZ A;  4AQ7 A;  2PKO A;  4MH8 A;  1SE4 A;  2MJ3 A;  2WXJ A;  3AE9 B;  2INN E;  1VR9 A;  2ONQ A;  3MJ5 A;  3O13 A;  1LO5 D;  2QEJ C;  2IGD A;  2G9H D;  2BTE A;  5H8Y E;  1QOB A;  1IUE A;  1BUI C;  3AEB B;  4MM3 B;  2V3N A;  1FFV A;  2QJL A;  3NRZ A;  1FNW A;  1XLO A;  2K3U A;  3LB8 C;  4YSZ B;  3FIL A;  3BYY B;  1JWA D;  3FIL B;  4JE3 B;  4ZOH C;  2DLB A;  1JW9 D;  5G5G A;  1QT9 A;  1CK1 A;  4OVZ A;  3BZD B;  1DYQ A;  1VZ6 A;  5JXV A;  4YT0 B;  1TS3 A;  2Z8L A;  3ABV B;  3U4E G;  2L32 A;  3AMZ A;  3I9V 1;  1XEE A;  2IDY A;  2WXN A;  1ZPS A;  2GI9 A;  2WXF A;  1P7E A;  2DWQ A;  4L1B A;  4TSS A;  1BML C;  5T8I A;  5MPO A;  2PIA A;  1E6E B;  4MAC A;  1EM7 A;  4O1N A;  4N6E B;  1JWS D;  4AS1 A;  2NTS A;  4RF0 A;  1FIQ A;  1SJE D;  4DQO C;  2M0A A;  1HXY D;  2CU3 A;  2W54 A;  5BYR A;  1YQ3 B;  1YMH E;  3NVW A;  4KKJ A;  3Q69 A;  3ZYY X;  1SB3 C;  1SE3 A;  2H88 B;  1L4Z B;  3AN1 A;  1I4P A;  2KWD A;  1MPE A;  1TS2 A;  1C79 A;  1YN3 A;  2WXO A;  3KWL A;  4ZYS A;  4US8 A;  1MHX A;  4ZHO A;  1FRD A;  1F2R I;  1JRP A;  3J9C A;  2W3S A;  3EUB 2;  5BMI A;  2WU5 B;  1RM6 C;  4US9 A;  1WRI A;  2ACZ B;  1PGA A;  1Y56 A;  2J4X A;  3HUI A;  2L1A A;  3U2S C;  3RFZ B;  4NAW B;  5HG2 A;  3V05 A;  4A9A A;  3P63 A;  2ZW1 A;  3BYT B;  3AM9 A;  1IBX A;  1DGJ A;  1WXQ A;  3PO0 A;  4RGT A;  2KMM A;  4RH6 A;  1GB1 A;  5HFY A;  1V1P A;  3AE3 B;  1GOZ A;  4RCO A;  3L4P A;  2PVO D;  1CQV A;  4ZHP A;  2WXK A;  3B9J A;  5HI1 A;  1N5W A;  2LEK A;  1ROE A;  2DYM A;  2WLB A;  2PTL A;  4B0M A;  5FKA C;  1NI3 A;  4JX1 C;  5TSS A;  5FR3 A;  4PT5 A;  3AED B;  2WS3 B;  1SE2 A;  1QIL A;  4GDK B;  3NVV A;  4XDD A;  3ZJV A;  4P16 A;  2JWU A;  1B9R A;  1F0Z A;  1JCK B;  1HQR D;  3FAH A;  3P4S B;  1VZ7 A;  4LK0 M;  2J53 A;  2XNA C;  1L5P A;  1AWD A;  4KKI A;  1KH0 A;  2L83 A;  2LFI A;  5AUK A;  1WSP A;  1GPX A;  3MC0 B;  3FC4 A;  1A70 A;  4OHJ A;  2EKI A;  1VDV A;  1C78 A;  2HTM E;  2Q5W D;  1IGC A;  1TYG B;  2VZK D;  3E9S A;  1NEN B;  1XXG A;  5D7G A;  4REZ A;  2DBY A;  2ICI A;  4XWT A;  4WQM A;  1FNV A;  1TS4 A;  1K50 A;  4RGN A;  4YSY B;  1ZUD 2;  2IGG A;  2V0G A;  2K9X A;  3ZJU A;  3U52 E;  1D6E C;  1VJK A;  5E6J A;  2H89 B;  1JWU D;  2N9K A;  1YN4 A;  4YTN B;  1FCC C;  3URY A;  2RDG A;  4EE2 A;  2MJE A;  3GP7 A;  1FM0 D;  4A55 A;  1XF5 L;  2KN4 A;  3TEY A;  1TY2 A;  3W5V B;  2AX5 A;  3AEE B;  2PMV A;  1QF6 A;  1EWC A;  1B1Z A;  4JWS C;  1AW7 A;  1D4B A;  2VZK B;  4IOI E;  1E7P B;  3BII D;  1FCL A;  1PYW D;  3H8H A;  2WNM A;  2JSV X;  2WP9 B;  3P4R B;  3T3O A;  2IJ0 A;  3LYY A;  4MT5 A;  1XLQ A;  3NUH B;  2WXM A;  1SSN A;  4IKG A;  4DXF A;  3IAM 1;  1JWM D;  1CZP A;  2X38 A;  2B76 B;  2WDQ B;  1L0V B;  2J42 A;  4IDI A;  4Q2J A;  3TEW A;  4N58 A;  4YTM B;  1FO4 A;  3NVZ A;  2K0P A;  1WGK A;  2D5G A;  3AE8 B;  4A90 A;  1L4D B;  1ZE3 D;  4TQ1 A;  1FD6 A;  1EU4 A;  1HEZ E;  1UGJ A;  1PGX A;  3AEC B;  3AV8 A;  2FUG 1;  1EWY C;  4R3D A;  4C7Z A;  4L23 A;  1L0Y B;  1DOY A;  1C4C A;  3HVZ A;  2PW9 A;  1IGD A;  4ITK A;  4OZA A;  1J7B A;  2L52 A;  3VR8 B;  1Q10 A;  2N9L A;  3KWV A;  4YWG G;  3P42 A;  4OZC A;  3BWU D;  1TY0 A;  2AQ3 B;  4A6Q A;  1WWT A;  2N0S B;  1JRO A;  1MI0 A;  2K22 A;  2QIL A;  2WXR A;  4RFB A;  3BVG A;  1I7H A;  1VZ8 A;  3NS1 A;  3AE2 B;  1UWX A;  2YEP F;  4KGS A;  4TQ0 A;  2JXT A;  4HRS A;  4CQN A;  4XE0 A;  2WXG A;  4KGT A;  4XWW A;  1OQQ A;  2LHD A;  1TKE A;  1J7C A;  1D5Z C;  3GB1 A;  1GAQ B;  1ET6 A;  2WQY B;  1L6U A;  1F2R C;  3IT4 B;  2BS4 B;  2IGH A;  2GRI A;  2AQ1 B;  3VRB B;  1SEB D;  3AB5 A;  2W82 A;  5HHD G;  3P1M A;  3CIR B;  1HZ6 A;  4USA A;  2M19 A;  1STE A;  2PVG C;  1AYF A;  3B2F A;  2WXQ A;  3WCQ A;  2EEL A;  1D5M C;  4A8X C;  2BYT A;  2HDE A;  2ZW0 A;  1PGB A;  4HKZ E;  3MHZ A;  1ACC A;  3AEF B;  1T3Q A;  2Y3A A;  4KGR A;  2SEB D;  3ZJT A;  1N5X A;  5C3J B;  3NZ3 A;  2FE8 A;  2JX5 A;  2WXH A;  3W2D A;  1NYQ A;  1N62 A;  1VLB A;  1ZOY B;  2M56 B;  1BXT A;  3AE4 B;  3PZ8 A;  1KFY B;  1FNU A;  1ZDX A;  4OZB A;  1FEH A;  2JYT A;  2INP E;  1TZO A;  2BW2 A;  4HJG E;  5FK9 C;  2RPV A;  3R8B A;  1V97 A;  3DWM A;  1ESF A;  1XCT L;  1XO3 A;  4JPS A;  2CJO A;  2IPK D;  4RGM A;  2I2Y A;  2WXL A;  5LNK 1;  4GDL B;  4B0E A;  4DXG A;  2YEP B;  1E9M A;  1JQ4 A;  3AE7 B;  2BS3 B;  3Q8F A;  1GB4 A;  2I38 A;  3SEB A;  4RNA A;  4HKQ A;  2WDR B;  1TKY A;  3Q8E A;  4WIP A;  3TSS A;  3CWI A;  4RGO S;  2V4I B;  3Q8C A;  3AE5 B;  1FRR A;  1I4G A;  3IAS 1;  2WXI A;  4N59 A;  1NYR A;  3AH7 A;  4C56 C;  3VQI A;  3NVY A;  2LMC A;  3IXS A;  3OWE B;  2KDM A;  1N63 A;  2K5P A;  1J7A A;  3TEX A;  2XN9 C;  5BMH A;  1T5X D;  1ZDV A;  3PZ7 A;  4HEA 1;  3LXF A;  3KLS X;  4YTP B;  3MP9 A;  1K51 A;  3I57 A;  5EE1 A;  2BB5 A;  4D2K A;  1PDX A;  1RYJ A;  1D5X C;  3IT6 B;  4FXC A;  3BK2 A;  4NAM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...