1A70A

Spinach ferredoxin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
97
structure length
97
Chain Sequence
AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Iron-sulfur protein
molecule keywords FERREDOXIN
publication title Structure of the mutant E92K of [2Fe-2S] ferredoxin I from Spinacia oleracea at 1.7 A resolution.
pubmed doi rcsb
source organism Spinacia oleracea
total genus 22
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 1998-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1a70A00
2M56B 2ACZB 2Q5WD 3HVZA 4A9AA 5EE3A 1JROA 1JW9D 1V8CA 1WYGA 2JX5A 1QOGA 2MJEA 1AYFA 2W3RA 2CJNA 1RFKA 1QF6A 4P6VF 1NI3A 3DWGC 1TKEA 5AUIA 2WU5B 1XLOA 2Y5CA 2CJOA 2M19A 3FAHA 1RYJA 2BS2B 3NVYA 5MPOA 1NYRA 2BS3B 2QJLA 3ETRA 2PVGC 3VRAB 2K22A 3ZYYX 4YSXB 1TKGA 2WDQB 1ZXIA 2PIAA 3AEEB 3AEAB 1QOBA 1PUTA 1XLQA 2N0SB 1E6EB 1V97A 2OHFA 1VJKA 4WQMA 1WWTA 3P1MA 3NRZA 3PO0A 2L83A 1R7SA 1RM6C 3AE3B 4IDIA 3SR6A 1QT9A 1OFFA 2PKOA 3AH7A 4KX6B 1NEKB 3AE5B 1QLBB 1N5XA 1SIJA 1L6UA 3VRBB 1JWBD 2WU2B 1JQ4A 3NVZA 2MJ3A 1FM0D 1CJEA 1KF6B 1JALA 1N61A 1NVID 1E9MA 3AEFB 2LEKA 2QIEB 3LXFA 4YTNB 3B2FA 3KWLA 1FRDA 3SFEB 2B76B 1T3QA 2FBWB 2WP9B 3P63A 5H92C 1SB3C 1F0ZA 1QOAA 1B9RA 1ZOYB 1VLBA 3AEBB 3CIRB 2K9XA 3NVWA 2H89B 5C3JB 3AECB 1ROEA 1J7AA 2E3TA 4JWUC 3B2GA 4YT0B 2EKIA 3AM9A 1N60A 2G1EA 1FXIA 5H8YE 1TKYA 1TJEA 2WDRB 3VR8B 4C7ZA 4US8A 1QOFA 1YJIA 1N62A 1FRRA 1L0VB 1PFDA 4ZOHC 3ABVB 4YXDB 4YTMB 1DOYA 1WGKA 3AB5A 3AE7B 3AN1A 4N59A 4YSYB 2WDVB 1FFVA 2BS4B 1J7CA 1XLNA 1ZUD2 2WQYB 1JWAD 3RPFC 1L5PA 2BT6A 1TYGB 2AX5A 4YTPB 1RWSA 1N5WA 1YQ3B 3AV8A 4USAA 1IUEA 1YJJA 4YSZB 3HUIA 2W3SA 4ZHOA 1JRPA 3B9JA 2DWQA 3P4PB 1UWMA 3HRDD 3CWIA 3DWMA 1E0ZA 2L52A 3VR9B 3AEGB 1YQ4B 3P4QB 3FC4A 5G5GA 3EUB2 2PVOD 4FXCA 1PDXA 2K5PA 3AEDB 3AE6B 1OQQA 4ITKA 1SF0A 4US9A 3SFDB 1WXQA 3AE8B 3LB8C 1DOIA 1J7BA 1OQRA 1FFUA 4N58A 1CZPA 4N6EB 2KAJA 5AUKA 4C80A 1VDVA 5EE1A 3W9CB 1FXAA 3NS1A 3AMZA 4HROA 3P4SB 1L6VA 3W5UB 1KFYB 3NVVA 1GAQB 5EE9A 2HTME 3AE9B 4LTUA 4C7YA 1NENB 2H88B 3AE4B 1FMAD 4WWMA 2KMMA 1DGJA 2CU3A 2DBYA 4JX1C 5C2TB 3P4RB 5GXGB 2W55A 1FO4A 1XLPA 1EWYC 1FIQA 1KRHA 2JQRB 2MH7A 3W5VB 1WRIA 1ZP0B 3WCQA 4ZHPA 1GPXA 3AE2B 1E10A 1I7HA 2WLBA 1E7PB 1AWDA 3L4PA 2MJDA 1A70A 5EE0A 4JWSC 5G5HA 2W54A 3AE1B 4HRSA 2WS3B 3BIID 1NYQA 1XO3A 1N63A 1DOXA
chains in the Genus database with same CATH superfamily
4HJKA 2JX5A 2RD0A 2HTHA 4TQ0A 1VZ8A 1RFKA 1SXTA 1BMLC 2KMAA 3V05A 4BBNC 5MPOA 2R61A 1RAXA 3Q8CA 2IO1B 3IT6B 1X1MA 2D11A 1E6EB 2OHFA 3Q8FA 3UGBB 1RLFA 3N1YC 4IDIA 4PYZA 2J0JA 3DVGX 2ZW0A 3APCA 1R4MB 1IGDA 1ZE3D 1YD8U 4IC7B 4ZDVA 1ET9A 3KW5B 3GE3C 1NI2A 3VTWA 1WH3A 3AM9A 1YOVB 3L16A 4EUTA 5H8YE 3QARA 3A1QA 3KWVA 2BB6A 4TV3A 2FE8A 1UZXB 1MJDA 1FFVA 2L7RA 1J7CA 2CHZA 1VZ6A 4F8CB 5DPSA 2MWSB 4K7UA 4KV2A 4MJSB 1WMHB 5BYQA 4F7ZA 2GBNA 3FC4A 2GBKA 3AXCA 4K7WA 4BKTA 1MI0A 1WZ3A 3X0WA 3DBHI 1V80A 2CU1A 3W1SC 1Z5SB 2LXCA 4WIPA 3TEWA 2DHZA 1BXTA 2K39A 1GPXA 3I9V1 1WJ6A 4BAXA 3AE2B 1I4PA 4NJ6A 1A70A 2FCQA 2N9PC 5KHOA 3NS8A 4KGTA 2ACZB 2I1JA 5EE3A 2WXMA 3W1SA 2Y5CA 2CJOA 3Q2AC 1BT0A 1P1AA 4YSXB 4F1SA 1QKZA 3AEEB 1WR6E 3RYTA 2MBBB 3MP9A 3PO0A 3LDZE 2NBWB 2FCNA 3KVFB 3MFGA 2ZCCA 1SE9A 1TGZB 4RH6A 1FRDA 5CX3A 3T8MA 4G11A 1ESFA 2LRUA 1VLBA 2NVUI 2WXJA 2YEPB 2LVQA 3MC0B 2LVOA 4DHJD 4LDTB 3EECA 1MHHE 4PS3A 2MBOA 2IYDB 1WGGA 1JWAD 3GB1A 2IGHA 3ZRCA 3C8YA 1ET6A 1YQ3B 2PW9A 2ZNVB 2M17A 1UWMA 4FULA 3CWIA 1E0ZA 1WJ4A 2KQ7A 2IDYA 4A3OA 1BUIC 1GC6A 2KAJA 3NOBA 4HROA 3L54A 4CYEA 2D3BA 2I38A 2XN9C 2N7JA 3MHSD 1XLPA 1WRIA 2JYEA 4WJQA 3RULA 1C4CA 3GP7A 4G3XB 3L13A 2JF5A 3DVNV 5T8IA 2KX3A 4ACFA 2PE6B 1YJ1A 2HD5B 2LRWA 1QF6A 4MELA 5AUIA 5J18A 1ZW7A 4G0NB 1EUVB 4EOYA 1I4HA 4W9HA 2PVGC 3TEZA 3AULA 3A9JA 4W9IA 3DHHC 1XLQA 1V97A 2D3GA 4N9F4 3NRZA 3TEXA 5AEKB 1SE4A 1OFFA 1Q1OA 3HIZA 1Q5WB 2WU2B 3FILA 2LJIA 1WR1A 3HVDA 5BMHA 5IKCM 3C19A 3RNBC 3MTNB 3SFEB 3ZJUA 1H8CA 1ZGUB 3RNEC 1ZOYB 4HKQA 3IG3A 2R2OA 2DZKA 5GMVA 4P1CC 2J42A 4C7ZA 2WDRB 1GG3A 1K52A 2DENB 4S0RA 1L4DB 2N7DA 1N62A 4PK1A 1JCKB 2WQYB 1ZUD2 3ALBA 1UD7A 3H7SA 2QSDA 1SJHD 3ECIA 1R4MI 4AJWA 4ICUA 4K3BA 4RNAA 3TSSA 5CHFA 5G5GA 1PDXA 3ZDTA 4M01A 3LB8C 1DOIA 1T6BX 1D6EC 2CR5A 2LMCA 3NS1A 3AMZA 2BWFA 1HZ5A 3UF8A 1KH0A 4PS8A 1J0GA 5HI1A 3ZTCA 2KMMA 3KYCD 2M0XA 3N30A 2JU6X 3NZSA 4NZLB 1WJUA 4CHKA 4TQ1A 5HKHA 1T5XD 4FJZA 3ZGZA 3A4RA 2DAJA 4LNOA 2B3AA 4BBNF 1JW9D 1QOGA 4A6QA 2CJNA 4P7IA 4L1BA 3BK1A 1YN4A 2BS3B 2NBVB 1E8YA 2JRIB 4AUQC 2JT4B 2KDBA 2KHWB 4S17A 2XK5A 1RM6C 2RR9A 2C7HA 3NG0A 3ZUNA 3VDZA 1VRAB 1WF9A 2KDFB 1XEEA 2KDEB 4GDLA 3C0RB 4GIVA 1E8ZA 3BZDB 2Y3AA 4P16A 2AYOB 2K1FA 2A4ZA 1V1OA 5BO4B 2JUOA 3CIRB 5HHDG 3BINA 3P2BA 5C3JB 1ROEA 1WFYA 2NBUA 3OAWA 2NCNA 3H1UA 2N9LA 3V60A 4OVZA 2IZVB 1GB4A 2LHDA 1L0VB 5J17A 1Q10A 3ZVVA 1XLNA 2MEKA 3LJ3A 1IBXB 3T3OA 4A8XC 2O2VA 3AV8A 4BFRA 2L0FA 3TL5A 4RF1A 4OZBA 3M63B 3RCZA 1FNUA 4I6PA 3SFDB 2KACA 5AUKA 3VTUA 4ANUA 4MGZE 1B9RA 1L6VA 2V3SA 2V0GA 3APDA 4P1BC 4LTUA 3IFWB 2VZKD 1N6ZA 2MBEA 3NZUA 5E6PA 3BVZA 4NPNA 2ICIA 3W5VB 4JL9A 1OTRB 1GNUA 1WY8A 4REZA 3AE1B 2M0AA 1NYQA 1YN5A 2M56B 4B0MA 3R7RA 4WAAA 2KYWA 3IVFA 2K8CA 1KLUD 4ZRQA 2MCNB 4W9FA 5KHQA 3U52E 4B0EA 3N20C 3IXSA 2J0MA 3KUZA 1SEBD 1PGBA 2N1VA 1TY2A 2KC1A 4YWGG 1E5WA 2ZW1A 1EF5A 3P63A 5FKAC 2GLSA 1FXTB 2WXQA 4KZ0A 3V6EB 2G45B 2QCZA 1UWXA 4YT0B 3B2GA 1SGHA 3ML8A 2V1YA 3Q3JA 1F52A 1WM2A 3AE7B 4N59A 2J0KA 2KT7A 3QK0A 4MJSA 1WMHA 3ZJTA 5LNK1 2NS5A 4IW0A 2ON8A 3M95A 4YTPB 2XK5B 4HKZE 2GMIC 2J4XA 2JRHA 4I6LB 3MJ5A 2UYZB 2PEAA 1FFUA 2IO3B 4KIKB 1C9FA 2L1AA 5D7GA 3UI3A 4IWPA 5D94A 3U8ZA 5EE9A 1FCLA 2JXTA 1DGJA 1C3TA 4W9EA 1UGJA 2G9HD 2MH7A 4MSQB 2LGXA 5FR3A 4WWNA 1E7PB 2LASA 2AEHA 1IGCA 4JWSC 3IT4B 1JMLA 1V2YA 3PVLA 4OVUA 4PYUA 4IG7B 3HVZA 4ANWA 2W3RA 5BYRA 3TCAA 3DWGC 2MRPA 4M00A 1UBIA 2X8XX 1ZDVA 2V3NA 2WDQB 3Q69A 2A5UA 4W9CA 4NY0A 3OJ4B 1F2RC 3BWUD 3AE5B 4XE0A 3NJTA 2AL6A 2LWPA 4WJPA 1G6JA 1JQ4A 1CJEA 5IAAC 2INDC 1WYWB 3UINB 3NHEB 2B76B 1F0ZA 2WP9B 1C78A 1AARA 1I35A 2BB5A 3AEBB 4GU2A 4NJ7A 3EA6A 2N1WA 3TBLD 2IY0B 3H6NA 1PFDA 4ZOHC 3ABVB 3AN1A 1P9DU 2BS4B 3ZO5B 3RN9C 1L5PA 2KWDA 1TYGB 3NZ3A 2WXOA 1VCBA 4JGHB 2JWZA 1HEZE 4ZHOA 1JRPA 1K50A 2M1MA 3HRDD 1V9JA 4URKA 2KK8A 1TT5B 1J7BA 1ISNA 4LLGM 1PYWD 3ZJVA 4DXGA 2LUMA 5DCNA 3ZNZB 2KN5A 4WWMA 4DDGD 3WALA 1IPGA 2W55A 1FIQA 1KRHA 3WCQA 1WXAA 2WLBA 2KTRA 5C1ZA 4EE2A 5IOIA 1JROA 2CS4A 4EKUA 2WNMA 3FAHA 1P0RA 3ETRA 3IHPC 1WI0A 1TZOA 2KLCA 2LXAA 2QDFA 4TUUA 2JY6A 4WQMA 3P1MA 2WXLA 4O1NA 4HPLB 3Q14C 1HTOA 2DYMA 1P7EA 3Q3MC 3AEFB 3R8BA 3M3JA 3KWLA 4HEA1 5BMIA 1LGRA 4BKSA 1F9JA 4FHKA 4BKGA 2ZEQA 3QC8B 1KLVA 4JWUC 1D5XC 5D3IB 2EKIA 1N60A 2G1EA 1TTNA 2J52A 4US8A 1H4RA 1YJIA 4B95A 3CSFA 2QC8A 3Q8EA 4DHJB 1QZEA 4ANXA 2ZPYA 2BKFA 3OG5A 4A90A 1YQBA 4IM3A 3EC8A 3WAMA 3Q3NC 4ITKA 4LNIA 2WXPA 1QILA 5I4DA 2BKRB 2FAZA 1T0QC 1I4GA 3N9YC 2BYTA 1D5MC 3J9CA 4JQWC 1KJTA 4NAMA 3T3NA 2DNFA 2KLGA 4CQNA 1VZ7A 4XDDA 1J8CA 4WQOB 2KDIA 1SE3A 3UQBA 5EE0A 2KNBA 4GLSC 4A55A 1C4PA 2WS3B 1GJZA 2O6VD 2INNE 3GE8C 2PMVA 4MSMB 1SSNA 3IAS1 2MJEA 2JZZA 1WE7A 1AYFA 2WU5B 1ZKHA 4AQ7A 3VTVA 2L05A 1RYJA 3O65B 3NVYA 3VFKA 1ACCA 4H2AA 3VRAB 2FIDA 3VVWB 2HE7A 2N0SB 4K81A 2PJHA 2KFJA 2GRIA 1UGMA 4DHZE 2LUEA 2RPVA 3NVZA 4QAYA 5CHVC 3V62A 4YTNB 4XWWA 1FD6A 2KTRB 4II3B 3UQAA 3ZNID 2VH2A 4RFBA 3GS2A 5DPRA 2WXHA 5LLIA 5FK9C 3WA0A 2L8JA 1IBXA 1S1QB 5L95C 3VR8B 1TKYA 1TIFA 3I5JC 5HFYA 3I57A 1V49A 1C76A 1U4AA 3AI5A 1WGKA 2MP2A 3B08A 4WWPA 1WXMA 2Z0EB 2MLBA 4TSSA 2I2YA 4YSZB 1KTKA 3HUIA 5LXHA 4C4VB 2N9EB 3NUHB 1WX9A 3QIJA 2VRRB 3E56A 1T0RC 2FCMA 1MG8A 4N6EB 5BMGA 3PLVA 3KYDD 4FJVB 2LHEA 2LVPA 1KFYB 3AE9B 2BYVE 3PT2B 2KX0A 1FMAD 1VR9A 2MSED 2EKEC 2ZZPB 4ZHPA 2ZPNA 3S2AA 3P42A 4MGIE 1V5OA 2BQQA 3CMMB 2W54A 2M8SA 4BZAA 1XO3A 1EO6A 3U7DA 3KQ4A 2OEDA 2MHJA 3TIXA 4KVGB 3DPDA 2BVCA 2WXRA 1WX8A 3SU8X 1NYRA 2MX2A 4KSKC 1D5ZC 4XDCA 4K1RB 1XT9B 2JSVX 4OW0A 1T0SC 1I4QA 3ZNGC 2L0TA 3R66C 1TS3A 3VAWA 2NMQA 2RDHA 3N32A 2Z8LA 1NVID 3KUDB 2QIEB 1GUAB 5D2MB 2MA9B 3T9LA 1JWMD 1UNSA 1QOAA 4GB9A 4EZJA 4KGSA 1WGHA 3O13A 2H89B 3N3KB 4MDKE 4JIOU 1HE8A 1YX6B 3ONSA 2KFKB 2NPTB 4HPPA 3V61A 4RM8A 2FCSA 4KZCA 3URYA 1V6EA 1V5TA 1QQRA 1LO5D 4NNJB 2BWES 1YIWA 4IKGA 1J19A 4MEMA 1C79A 4MM3B 2Z0DB 4KIKA 4KDLB 3RNCC 1EU4A 3AEGB 4J3OD 2J53A 4MH8A 1I42A 5DPTA 1Q0WB 3QQ8B 2V3PA 1WZ0A 2I1KA 3NVVA 3JW0X 1GAQB 3KLSX 3ZW3A 1P7FA 4M8NA 2JVCA 3P4RB 3L10B 4ZYNA 2K8HA 2VZKB 1FNVA 2MP2B 2JPHA 3DDCB 2KWCA 1XCQL 3A4SC 4HRSA 2KN4A 1V1PB 2DAFA 3OJ3A 4MGYE 2LGYA 4DBGA 1WYGA 3N1XC 2KWVB 4NQLB 1VD2A 4NQKE 1TKGA 1CMXB 4ZRKA 3ZKJC 4K3CA 2C7NB 2L83A 2WXIA 1FEHA 4XX5A 3UIPB 5AZHA 1QLBB 3RFZB 1L6UA 4AWJA 3VRBB 2WXGA 1JWBD 1WE6A 4W9LA 2M4NA 1JALA 4HVBA 2ZVNA 4KKJA 3LXFA 2DX5B 1PGXA 2W82A 3Q3FA 2RPQA 2FNJB 3PS6A 1SJED 1WSPA 2N7EA 2ASQA 2AQ1B 2LZ6A 3B0AA 1E7UA 2DYOA 3ZRFA 4BVUC 1Y8RC 1S3SG 4IUMB 1HQRD 2AX5A 3ZQ4A 1WGRA 4USAA 2AWTA 4XGAB 3ZXVA 1WRDB 1EF1A 2LD9A 2OOBB 2L52A 5IA7A 3H9DA 1SBBB 1YQ4B 2KXJA 3QJZA 3R7QA 4MT5A 4FXCA 2K5PA 3PRZA 1NBFC 1WXQA 3AE8B 2BF8B 2KOXA 1VDVA 1FXAA 3P4SB 2WGSA 2ZCBA 4WWOA 2KJRA 2REXA 4LNNA 2G4SA 4W9DA 2CU3A 2JQRB 3I3TB 1KM7A 1ZP0B 1KLGD 2L00B 3K9OB 4MACA 3U4EG 1GOZA 2J7QB 1XF5L 1M94A 2JZ3B 2XBBC 5G5HA 2NR2A 3MC8A 4JE3B 4RGMA 3ZLZA 1N63A 4GN1A 2K6DB 2GOWA 3BYYB 3RZFA 1HTQA 2K25A 4P6VF 2G3QB 2Y5PA 4A3PA 3Q6BA 2BS2B 2FUHB 2PIAA 1WIAA 2WX1A 4RF0A 2V4LA 1WWTA 3PHWB 3PLUA 1QT9A 3PZDA 1NEKB 2QMTA 4DWFA 4GMVA 4FADA 1OGWA 1E90A 1KF6B 3QA8A 4WJNA 5HG2A 2SAKA 3B2FA 2K3UA 3SHQA 2FBWB 1SB3C 1YMHE 4GDKB 3K9PB 1K53A 2K9XA 3NVWA 2GBRA 2YVCA 1XCTL 2X38A 3EHVA 2LI5A 3JVZX 1SIFA 2C5LC 2LFIA 1P98A 4HK2A 2ZNVC 2WXNA 2LJ5A 1C1YB 1WJNA 3QHTA 2L3ZA 1LXDA 2W3SA 3B9JA 2O6VA 4II2B 2JWUA 2PPHA 5CTRC 3DBRI 3P4QB 2IPKD 5BYSA 3HM3A 3PPAA 4US9A 4ICVA 3R2IA 3GOEA 4TKNA 3WIMA 4LCDE 1JWUD 4TMAB 2MBQA 2JZPA 3RNGC 4AOFA 4IM0A 4RMAA 1OEYA 1UF0A 2G4DB 3AE4B 5C2TB 2QILA 1FO4A 3HHMA 4FLHA 3N1ZC 3JSVB 3SD5A 2ZVOA 2W9NA 2BGFA 3I63C 3A9KA 4GOCA 5C23A 3VQIA 2CKHB 4PT5A 2BYEA 3B1LX 3RZWC 3ZNHB 2M19A 1OQYA 1STEA 2RDGA 3HM6X 4HPMB 2KKCA 4DQOC 3QX1A 1GB1A 2NTSA 2BTEA 2D10A 2WX0A 1SIJA 5E6NA 1AN8A 1D4BA 1FM0D 2D3AA 2KJHB 2RSUA 2BW2A 2HJ8A 4LJOB 4ZRPA 3L08A 2VH1A 4E71A 2FUG1 1F1HA 2V4IB 1YX5B 4IM2A 1UELA 4ANVA 1L2NA 1XD3B 3AECB 1TS2A 1J7AA 4GSWA 3V3XA 2WXKA 5E6OA 3DHIC 4DDID 4GXBA 1DOYA 4HCNB 4C4VA 3AB5A 3SEBA 5EDSA 2DYBA 3D32A 4RM9A 2K0PA 2KZRA 4HXDA 5JHAA 2WDTB 3P4PB 2DZIA 3PV1A 3MC9A 4M0WB 3PGEA 2CHXA 1SF0A 4D2KA 1OQRA 3RI7C 1T0YA 3CF6E 2GBJA 2HTME 3GZNI 2DZJA 4RGNA 4XZ4A 4B6WA 1DYQA 1I4RA 3ZDMC 3DBLB 1XQQA 2MJDA 1WX7A 1WGDA 5AZFA 1UUPA 1JWSD 3PRMB 3AU4A 2KQ4X 2K6QA 2D2QA 2MQJA 4KSLC 1NI3A 2O6VB 2PLPA 3VUYA 1GC7A 4FN2A 2KVZA 3TUOA 1ZXIA 4IWQA 4NAWA 1KOTA 2IO2B 1SE2A 5D6JB 2PKOA 3AH7A 4KX6B 4W9KA 2XEWA 5LXIB 2MW5A 1XXGA 2MJ3A 3L17A 1PGAA 2IBIB 2KFKA 3W1YA 3W2DA 1HXYD 4E74A 2NPTA 2L76A 5H92C 4IWOA 1UH6A 2CHWA 3RNAC 3ENEA 1F77A 1TS5A 1LM8B 1B1ZA 4LDTD 2DLBA 3A9KB 1YN3A 1TJEA 1I4XA 3UIOB 1Z2MA 2QHOA 2GBMA 4MM3A 2UWQA 3OWEB 1IYFA 4YTMB 3ZTDA 4B9KA 2N4FA 3RUIB 1IP9A 3VH3B 1WXVA 3RPFC 5D3DA 1P3QU 1K8RB 2KJ6A 2BBCA 2ONQA 3TEYA 3PSEB 4RGOS 4ASWC 3A1QB 2Z59B 1IUEA 5G55A 2DWQA 3OLMD 2YLMA 5IP4D 4W9JA 3DCGA 3VXWA 2UU7A 3AEDB 3BK2A 5EE1A 2PTLA 2C7MB 1C4AA 1FCCC 1V86A 1R4NB 1V1PA 2XNAC 1E7VA 4RGTA 3DQVA 4XC2A 5JHBA 2GB1A 1NDDA 2C60A 1E10A 1I7HA 4AP4C 1AWDA 1L0XB 1K51A 3QWZB 1V81A 4HDQA 4A9AA 2HJ1A 1RFAA 4KKIA 2C9WB 2JXXA 1TKEA 3MJWA 2WWZA 4PS7A 1TY0A 3DVGY 4KDIC 2QJLA 2N9KA 4HLEA 3RT3B 2WXFA 4EZKA 5L83A 1MPEA 2YEPF 4OHJA 2AL3A 4OZAA 3Q8AA 4FHJA 2EELA 2R2QA 3IAM1 3IBEA 1TZ1A 4BOSC 1N61A 4EEWA 3EGRA 1ENFA 3DBSA 3PHXB 4UDUC 1E8XA 4BKSD 5TR5A 1FXIA 3R3MA 4X57B 4L2YA 4DHZB 4YXDB 5J2RA 4YSYB 3QAQA 3PRPB 2AQ3B 3BYTB 4NAWB 3DBRB 4YL8A 4WURA 2MBHA 4HDOA 3H7PA 1N5WA 1YJJA 4WH4A 2KDMA 4E3CA 3DWMA 4XYCA 3TJPA 4NJCA 5IO9A 3JYUA 1TS4A 1L7YA 4HJGE 5JXVA 3QCAA 4FA6A 3VUWA 4JLCA 2H88B 2BPSA 3E9SA 2DBYA 3PZ8A 4JX1C 4C56C 2LGSA 4JPSA 1EU3A 4R3DA 2OJWA 5JZEB 1YNTE 3PZ7A 4BOZB 1L4ZB 5AZGA 1L0YB 4DK5A 4ZRIA 3BIID 5JH5C 1JRUA 1ZXHA 3ML9A 3WANA 5DPWA 1V8CA 3APFA 3ZIMA 1MFWA 4C00A 1C77A 4DXAB 2IY1B 4GGQA 5TSSA 3U7ZA 1OEYJ 4XWTA 3AEAB 4AS1A 1PUTA 2Y5BB 1VJKA 2RMMA 3X23A 1RRBA 2EMSA 1R7SA 2AQ2B 3RMKC 2OJRA 4Q2JA 1N5XA 3NY5A 3DHGC 4GDKA 3LYYA 2KVRA 3A9JB 2KD0A 2IGGA 3DBLI 2LEKA 3V6CB 4OVVA 3CSTA 4CO7A 1HZ6A 3FKYA 4HWIB 3DBHB 2KWUB 3H8HA 3FILB 3RNFC 2JYTA 4LNKA 2K8BA 5FR6A 2SEBD 2KQSA 5CHWA 3PREA 1QOFA 4WAFA 3KUCB 1Y56A 2WDVB 2QEJC 4KGRA 4ARCA 4AJYB 3BVMA 1RWSA 2IGDA 2D5GA 3U30A 3KH0A 4MGKE 3A33B 3GZNB 4LNFA 1WM3A 2RDBC 2PVOD 1OQQA 4MH0E 1F2RI 1CK1A 1ZPSA 4N58A 3Q3OC 2KMCA 4G50A 3DOWA 1WXSA 4RCOA 4ZRJA 2RGFA 3HK0A 3JSVA 3Q8BA 5GXGB 2IJ0A 2BYFA 1LQBA 3U2SC 3R2TA 1AW7A 2WYQA 3L4PA 2INCC 3VHTC 2KTFA 2WHIA 1EM7A 1DOXA 3H7PB 2Q5WD 1PQSA 1XLOA 2EMTA 1A5RA 2V9HA 4M8MA 3WAPA 2K22A 3ZYYX 1QOBA 2E6XA 4HCPB 4EFOA 1R4NI 3AE3B 3SR6A 2FIFA 3DVNU 1MVKA 3SDLC 4LJPB 1WGYA 2D3CA 2ZJDA 1E9MA 4OZCA 1LFDA 3AU5A 3BY4B 4EZLA 2LGDA 4J6IA 1T3QA 3EFCA 4I6NB 4LK0M 3VUXA 2D07B 4GDLB 2IO0B 1HA5A 3PTFC 2E3TA 2GI9A 2HDEA 4ZYSA 1FPYA 1FRRA 2TSSA 2KO3A 1TBEA 3BVGA 4M0WA 2BT6A 3TMPB 2KANA 2L32A 5E6JA 3RD2A 3VH4B 4A20A 4ARIA 1UBQA 2PE9A 2NTTA 3VR9B 3WAOA 1EWCA 4DXFA 1M4VA 1E8WA 3EUB2 1ZDXA 3AE6B 2LGIA 1CQVA 2O2VB 4C80A 1CZPA 3W9CB 3L0WB 2KC2A 1MHXA 3W5UB 1MG4A 4FJYA 5IN7A 4C7YA 1NENB 2INPE 2DZMA 4FBJB 4L23A 3ZXRA 4M02A 3EFUA 4IOIE 1D3ZA 3M62B 4WJOA 1EWYC 5G2NA 2N9XA 3MHZA 4K7SA 1FNWA 4W9GA
chains in the Genus database with same CATH topology
2M56B 4B0MA 2KQ4X 3KQ4A 2OEDA 2JX5A 4TQ0A 1VZ8A 1RFKA 1NI3A 1SXTA 2WXRA 1BMLC 2PLPA 4ZRQA 1KLUD 3V05A 2R61A 5MPOA 1NYRA 1D5ZC 3Q8CA 4XDCA 3TUOA 1ZXIA 3IT6B 1E6EB 2OHFA 3U52E 4B0EA 3Q8FA 1SE2A 4IDIA 2JSVX 4OW0A 2PKOA 3AH7A 3IXSA 4KX6B 1SEBD 2ZW0A 1I4QA 1PGBA 1XXGA 1IGDA 2MJ3A 1ZE3D 1TS3A 1TY2A 2NMQA 2RDHA 4YWGG 2Z8LA 1NVID 2ZW1A 2QIEB 1PGAA 3W2DA 1HXYD 1ET9A 3P63A 5FKAC 5H92C 1JWMD 2WXQA 1UNSA 1QOAA 4KGSA 1F77A 1TS5A 1B1ZA 3O13A 2H89B 1UWXA 2DLBA 1YN3A 4YT0B 3B2GA 3AM9A 5H8YE 1TJEA 1I4XA 3KWVA 2BB6A 3OWEB 2FE8A 4YTMB 3URYA 3AE7B 4N59A 1QQRA 3ZJTA 1FFVA 1J7CA 1LO5D 5LNK1 3RPFC 5D3DA 1VZ6A 2ON8A 2BBCA 2ONQA 4IKGA 4YTPB 3TEYA 4RGOS 1C79A 4MM3B 4HKZE 1IUEA 2J4XA 2DWQA 1EU4A 3MJ5A 3AEGB 5BYQA 3FC4A 4J3OD 2J53A 3AEDB 4MH8A 1MI0A 1FFUA 3BK2A 5EE1A 2PTLA 1C9FA 2L1AA 5D7GA 3UI3A 1C4AA 2V3PA 3NVVA 3TEWA 1GAQB 4WIPA 1FCCC 5EE9A 3KLSX 1FCLA 1BXTA 2JXTA 1P7FA 1DGJA 1V1PA 2XNAC 1UGJA 3P4RB 2G9HD 2MH7A 4RGTA 1GPXA 2GB1A 3I9V1 2VZKB 5FR3A 3AE2B 1I4PA 1E10A 1I7HA 1FNVA 1AWDA 1E7PB 1L0XB 1A70A 1IGCA 4JWSC 3IT4B 1JMLA 1K51A 1XCQL 4HRSA 2KN4A 1V1PB 4KGTA 2ACZB 3HVZA 4A9AA 5EE3A 1WYGA 4KKIA 2WXMA 2W3RA 3W1SA 5BYRA 3DWGC 1TKEA 2Y5CA 2CJOA 1TY0A 1ZDVA 2V3NA 2QJLA 4YSXB 2N9KA 1TKGA 1QKZA 2WDQB 3Q69A 3AEEB 2WXFA 3MP9A 3PO0A 2L83A 2WXIA 1F2RC 1FEHA 3BWUD 1MPEA 2YEPF 4OHJA 4OZAA 3AE5B 4XE0A 1QLBB 3Q8AA 3RFZB 1L6UA 3MFGA 3VRBB 2WXGA 2EELA 1JWBD 3IAM1 1JQ4A 1CJEA 1JALA 1N61A 4KKJA 3LXFA 4RH6A 1FRDA 2B76B 1F0ZA 2WP9B 1PGXA 2W82A 1C78A 3EGRA 1ESFA 1VLBA 1ENFA 2BB5A 3AEBB 3EA6A 4UDUC 2WXJA 2YEPB 3MC0B 1SJED 1FXIA 1WSPA 2AQ1B 1MHHE 4L2YA 4YXDB 1PFDA 4ZOHC 2DYOA 3ABVB 3AN1A 4YSYB 2BS4B 2AQ3B 3BYTB 4NAWB 1JWAD 3GB1A 1HQRD 1L5PA 2KWDA 4WURA 1TYGB 2IGHA 2AX5A 3NZ3A 3ZQ4A 2WXOA 3C8YA 1N5WA 1ET6A 1YQ3B 4USAA 1YJJA 2PW9A 1HEZE 4WH4A 2KDMA 4ZHOA 1JRPA 1K50A 1UWMA 3HRDD 3CWIA 3DWMA 1E0ZA 2L52A 1SBBB 1YQ4B 4MT5A 4FXCA 2K5PA 4NJCA 2IDYA 1WXQA 3AE8B 1TS4A 1BUIC 1J7BA 4HJGE 2KAJA 5JXVA 1VDVA 1FXAA 4HROA 3P4SB 4LLGM 1PYWD 3ZJVA 4DXGA 2I38A 2LUMA 2H88B 4WWMA 2CU3A 2XN9C 3E9SA 2N7JA 2DBYA 3PZ8A 4JX1C 4C56C 2W55A 4JPSA 1XLPA 1EU3A 2JQRB 1FIQA 1KRHA 3WCQA 1WRIA 1ZP0B 2JYEA 1KLGD 4MACA 4R3DA 3U4EG 1YNTE 3PZ7A 2WLBA 1L4ZB 1C4CA 1GOZA 3GP7A 1XF5L 1L0YB 5G5HA 4JE3B 4RGMA 3BIID 1N63A 5T8IA 1ZXHA 4EE2A 1JROA 3BYYB 1V8CA 1QF6A 4P6VF 5AUIA 2WNMA 1C77A 2Y5PA 3FAHA 2BS2B 1I4HA 5TSSA 3ETRA 2PVGC 3U7ZA 3TEZA 4XWTA 2PIAA 3AEAB 4AS1A 1PUTA 1TZOA 1XLQA 4RF0A 1V97A 1VJKA 2RMMA 1WWTA 3P1MA 4WQMA 3NRZA 3TEXA 2WXLA 1R7SA 2AQ2B 4O1NA 1SE4A 1QT9A 1OFFA 4Q2JA 1NEKB 1N5XA 2QMTA 2WU2B 3LYYA 3FILA 2LJIA 1KF6B 3HVDA 2DYMA 1P7EA 5BMHA 2IGGA 3AEFB 3R8BA 2LEKA 5HG2A 2SAKA 3B2FA 2K3UA 3KWLA 4HEA1 3SFEB 5BMIA 3ZJUA 2FBWB 1HZ6A 1SB3C 1YMHE 1ZOYB 4HKQA 4GDKB 3H8HA 3FILB 1K53A 2JYTA 2K9XA 3NVWA 4JWUC 1D5XC 1XCTL 2SEBD 2EKIA 5D3IB 1N60A 2G1EA 2J42A 2J52A 2X38A 4C7ZA 2WDRB 4US8A 1K52A 2LFIA 1QOFA 1YJIA 1L4DB 4WAFA 1N62A 2WXNA 3Q8EA 1Y56A 2WDVB 2QEJC 1JCKB 2WQYB 1ZUD2 4KGRA 4ARCA 3BVMA 1RWSA 2IGDA 2QSDA 2D5GA 1SJHD 4A90A 2W3SA 3B9JA 4RNAA 2JWUA 3TSSA 3P4QB 5G5GA 2PVOD 2IPKD 1PDXA 5BYSA 1OQQA 4ITKA 4US9A 1F2RI 3R2IA 1CK1A 1ZPSA 3LB8C 1DOIA 1D6EC 1T6BX 4N58A 2WXPA 1QILA 2LMCA 5I4DA 3NS1A 3AMZA 1JWUD 1HZ5A 1I4GA 3N9YC 1KH0A 4TMAB 2BYTA 2JZPA 1D5MC 4RCOA 3J9CA 5HI1A 3AE4B 2KMMA 3Q8BA 4NAMA 5C2TB 2JU6X 3T3NA 2QILA 5GXGB 4NZLB 1FO4A 2IJ0A 4CQNA 1VZ7A 4XDDA 4TQ1A 3U2SC 1T5XD 3R2TA 1AW7A 1SE3A 3L4PA 3ZGZA 5EE0A 4A55A 4GLSC 1EM7A 1C4PA 2WS3B 1DOXA 2INNE 2Q5WD 2PMVA 1JW9D 1SSNA 3IAS1 2MJEA 1QOGA 1AYFA 4A6QA 2CJNA 3VQIA 4PT5A 2WU5B 1XLOA 2M19A 4L1BA 3BK1A 1YN4A 4AQ7A 1RYJA 3NVYA 1STEA 2RDGA 1ACCA 2BS3B 4H2AA 3VRAB 2K22A 3ZYYX 1QOBA 4DQOC 2N0SB 2E6XA 1GB1A 2NTSA 2BTEA 1RM6C 3AE3B 3SR6A 2GRIA 2RPVA 1SIJA 1VRAB 1AN8A 3NVZA 1D4BA 1FM0D 1XEEA 1MVKA 2BW2A 3BZDB 2Y3AA 4P16A 1E9MA 4YTNB 4OZCA 4ZRPA 4XWWA 1FD6A 1T3QA 2FUG1 1V1OA 4RFBA 3GS2A 4LK0M 2WXHA 2V4IB 3CIRB 5FK9C 5HHDG 5C3JB 4GDLB 3AECB 1HA5A 1ROEA 1TS2A 1J7AA 2E3TA 1IBXA 3V3XA 2GI9A 2HDEA 2WXKA 3VR8B 1TKYA 5HFYA 2N9LA 3I57A 4OVZA 4ZYSA 1GB4A 2LHDA 1C76A 1FRRA 1L0VB 2TSSA 1DOYA 1Q10A 1WGKA 3AB5A 3SEBA 1XLNA 3BVGA 4M0WA 2MEKA 1IBXB 3T3OA 2BT6A 4A8XC 2L32A 4TSSA 3AV8A 5E6JA 2K0PA 2I2YA 4YSZB 1KTKA 3HUIA 4ARIA 3P4PB 2NTTA 3NUHB 4RF1A 3VR9B 1EWCA 4DXFA 4OZBA 1M4VA 3EUB2 1FNUA 1ZDXA 3AE6B 1SF0A 1CQVA 2KACA 2LGIA 3E56A 3SFDB 4D2KA 5AUKA 1OQRA 4C80A 1CZPA 4N6EB 1B9RA 5BMGA 3W9CB 2LHEA 1L6VA 1MHXA 3W5UB 1KFYB 2V0GA 2HTME 3AE9B 4LTUA 4C7YA 1NENB 2INPE 1FMAD 4L23A 2VZKD 1VR9A 4RGNA 4IOIE 3BVZA 2ICIA 1DYQA 1EWYC 3W5VB 4ZHPA 3P42A 1I4RA 3MHZA 2MJDA 1FNWA 1UUPA 4REZA 2W54A 1JWSD 3AE1B 2M0AA 1NYQA 1XO3A 1YN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M56 B;  2ACZ B;  2Q5W D;  3HVZ A;  4A9A A;  5EE3 A;  1JRO A;  1JW9 D;  1V8C A;  1WYG A;  2JX5 A;  1QOG A;  2MJE A;  1AYF A;  2W3R A;  2CJN A;  1RFK A;  1QF6 A;  4P6V F;  1NI3 A;  3DWG C;  1TKE A;  5AUI A;  2WU5 B;  1XLO A;  2Y5C A;  2CJO A;  2M19 A;  3FAH A;  1RYJ A;  2BS2 B;  3NVY A;  5MPO A;  1NYR A;  2BS3 B;  2QJL A;  3ETR A;  2PVG C;  3VRA B;  2K22 A;  3ZYY X;  4YSX B;  1TKG A;  2WDQ B;  1ZXI A;  2PIA A;  3AEE B;  3AEA B;  1QOB A;  1PUT A;  1XLQ A;  2N0S B;  1E6E B;  1V97 A;  2OHF A;  1VJK A;  4WQM A;  1WWT A;  3P1M A;  3NRZ A;  3PO0 A;  2L83 A;  1R7S A;  1RM6 C;  3AE3 B;  4IDI A;  3SR6 A;  1QT9 A;  1OFF A;  2PKO A;  3AH7 A;  4KX6 B;  1NEK B;  3AE5 B;  1QLB B;  1N5X A;  1SIJ A;  1L6U A;  3VRB B;  1JWB D;  2WU2 B;  1JQ4 A;  3NVZ A;  2MJ3 A;  1FM0 D;  1CJE A;  1KF6 B;  1JAL A;  1N61 A;  1NVI D;  1E9M A;  3AEF B;  2LEK A;  2QIE B;  3LXF A;  4YTN B;  3B2F A;  3KWL A;  1FRD A;  3SFE B;  2B76 B;  1T3Q A;  2FBW B;  2WP9 B;  3P63 A;  5H92 C;  1SB3 C;  1F0Z A;  1QOA A;  1B9R A;  1ZOY B;  1VLB A;  3AEB B;  3CIR B;  2K9X A;  3NVW A;  2H89 B;  5C3J B;  3AEC B;  1ROE A;  1J7A A;  2E3T A;  4JWU C;  3B2G A;  4YT0 B;  2EKI A;  3AM9 A;  1N60 A;  2G1E A;  1FXI A;  5H8Y E;  1TKY A;  1TJE A;  2WDR B;  3VR8 B;  4C7Z A;  4US8 A;  1QOF A;  1YJI A;  1N62 A;  1FRR A;  1L0V B;  1PFD A;  4ZOH C;  3ABV B;  4YXD B;  4YTM B;  1DOY A;  1WGK A;  3AB5 A;  3AE7 B;  3AN1 A;  4N59 A;  4YSY B;  2WDV B;  1FFV A;  2BS4 B;  1J7C A;  1XLN A;  1ZUD 2;  2WQY B;  1JWA D;  3RPF C;  1L5P A;  2BT6 A;  1TYG B;  2AX5 A;  4YTP B;  1RWS A;  1N5W A;  1YQ3 B;  3AV8 A;  4USA A;  1IUE A;  1YJJ A;  4YSZ B;  3HUI A;  2W3S A;  4ZHO A;  1JRP A;  3B9J A;  2DWQ A;  3P4P B;  1UWM A;  3HRD D;  3CWI A;  3DWM A;  1E0Z A;  2L52 A;  3VR9 B;  3AEG B;  1YQ4 B;  3P4Q B;  3FC4 A;  5G5G A;  3EUB 2;  2PVO D;  4FXC A;  1PDX A;  2K5P A;  3AED B;  3AE6 B;  1OQQ A;  4ITK A;  1SF0 A;  4US9 A;  3SFD B;  1WXQ A;  3AE8 B;  3LB8 C;  1DOI A;  1J7B A;  1OQR A;  1FFU A;  4N58 A;  1CZP A;  4N6E B;  2KAJ A;  5AUK A;  4C80 A;  1VDV A;  5EE1 A;  3W9C B;  1FXA A;  3NS1 A;  3AMZ A;  4HRO A;  3P4S B;  1L6V A;  3W5U B;  1KFY B;  3NVV A;  1GAQ B;  5EE9 A;  2HTM E;  3AE9 B;  4LTU A;  4C7Y A;  1NEN B;  2H88 B;  3AE4 B;  1FMA D;  4WWM A;  2KMM A;  1DGJ A;  2CU3 A;  2DBY A;  4JX1 C;  5C2T B;  3P4R B;  5GXG B;  2W55 A;  1FO4 A;  1XLP A;  1EWY C;  1FIQ A;  1KRH A;  2JQR B;  2MH7 A;  3W5V B;  1WRI A;  1ZP0 B;  3WCQ A;  4ZHP A;  1GPX A;  3AE2 B;  1E10 A;  1I7H A;  2WLB A;  1E7P B;  1AWD A;  3L4P A;  2MJD A;  1A70 A;  5EE0 A;  4JWS C;  5G5H A;  2W54 A;  3AE1 B;  4HRS A;  2WS3 B;  3BII D;  1NYQ A;  1XO3 A;  1N63 A;  1DOX A; 
#chains in the Genus database with same CATH topology
 4HJK A;  2JX5 A;  2RD0 A;  2HTH A;  4TQ0 A;  1VZ8 A;  1RFK A;  1SXT A;  1BML C;  2KMA A;  3V05 A;  4BBN C;  5MPO A;  2R61 A;  1RAX A;  3Q8C A;  2IO1 B;  3IT6 B;  1X1M A;  2D11 A;  1E6E B;  2OHF A;  3Q8F A;  3UGB B;  1RLF A;  3N1Y C;  4IDI A;  4PYZ A;  2J0J A;  3DVG X;  2ZW0 A;  3APC A;  1R4M B;  1IGD A;  1ZE3 D;  1YD8 U;  4IC7 B;  4ZDV A;  1ET9 A;  3KW5 B;  3GE3 C;  1NI2 A;  3VTW A;  1WH3 A;  3AM9 A;  1YOV B;  3L16 A;  4EUT A;  5H8Y E;  3QAR A;  3A1Q A;  3KWV A;  2BB6 A;  4TV3 A;  2FE8 A;  1UZX B;  1MJD A;  1FFV A;  2L7R A;  1J7C A;  2CHZ A;  1VZ6 A;  4F8C B;  5DPS A;  2MWS B;  4K7U A;  4KV2 A;  4MJS B;  1WMH B;  5BYQ A;  4F7Z A;  2GBN A;  3FC4 A;  2GBK A;  3AXC A;  4K7W A;  4BKT A;  1MI0 A;  1WZ3 A;  3X0W A;  3DBH I;  1V80 A;  2CU1 A;  3W1S C;  1Z5S B;  2LXC A;  4WIP A;  3TEW A;  2DHZ A;  1BXT A;  2K39 A;  1GPX A;  3I9V 1;  1WJ6 A;  4BAX A;  3AE2 B;  1I4P A;  4NJ6 A;  1A70 A;  2FCQ A;  2N9P C;  5KHO A;  3NS8 A;  4KGT A;  2ACZ B;  2I1J A;  5EE3 A;  2WXM A;  3W1S A;  2Y5C A;  2CJO A;  3Q2A C;  1BT0 A;  1P1A A;  4YSX B;  4F1S A;  1QKZ A;  3AEE B;  1WR6 E;  3RYT A;  2MBB B;  3MP9 A;  3PO0 A;  3LDZ E;  2NBW B;  2FCN A;  3KVF B;  3MFG A;  2ZCC A;  1SE9 A;  1TGZ B;  4RH6 A;  1FRD A;  5CX3 A;  3T8M A;  4G11 A;  1ESF A;  2LRU A;  1VLB A;  2NVU I;  2WXJ A;  2YEP B;  2LVQ A;  3MC0 B;  2LVO A;  4DHJ D;  4LDT B;  3EEC A;  1MHH E;  4PS3 A;  2MBO A;  2IYD B;  1WGG A;  1JWA D;  3GB1 A;  2IGH A;  3ZRC A;  3C8Y A;  1ET6 A;  1YQ3 B;  2PW9 A;  2ZNV B;  2M17 A;  1UWM A;  4FUL A;  3CWI A;  1E0Z A;  1WJ4 A;  2KQ7 A;  2IDY A;  4A3O A;  1BUI C;  1GC6 A;  2KAJ A;  3NOB A;  4HRO A;  3L54 A;  4CYE A;  2D3B A;  2I38 A;  2XN9 C;  2N7J A;  3MHS D;  1XLP A;  1WRI A;  2JYE A;  4WJQ A;  3RUL A;  1C4C A;  3GP7 A;  4G3X B;  3L13 A;  2JF5 A;  3DVN V;  5T8I A;  2KX3 A;  4ACF A;  2PE6 B;  1YJ1 A;  2HD5 B;  2LRW A;  1QF6 A;  4MEL A;  5AUI A;  5J18 A;  1ZW7 A;  4G0N B;  1EUV B;  4EOY A;  1I4H A;  4W9H A;  2PVG C;  3TEZ A;  3AUL A;  3A9J A;  4W9I A;  3DHH C;  1XLQ A;  1V97 A;  2D3G A;  4N9F 4;  3NRZ A;  3TEX A;  5AEK B;  1SE4 A;  1OFF A;  1Q1O A;  3HIZ A;  1Q5W B;  2WU2 B;  3FIL A;  2LJI A;  1WR1 A;  3HVD A;  5BMH A;  5IKC M;  3C19 A;  3RNB C;  3MTN B;  3SFE B;  3ZJU A;  1H8C A;  1ZGU B;  3RNE C;  1ZOY B;  4HKQ A;  3IG3 A;  2R2O A;  2DZK A;  5GMV A;  4P1C C;  2J42 A;  4C7Z A;  2WDR B;  1GG3 A;  1K52 A;  2DEN B;  4S0R A;  1L4D B;  2N7D A;  1N62 A;  4PK1 A;  1JCK B;  2WQY B;  1ZUD 2;  3ALB A;  1UD7 A;  3H7S A;  2QSD A;  1SJH D;  3ECI A;  1R4M I;  4AJW A;  4ICU A;  4K3B A;  4RNA A;  3TSS A;  5CHF A;  5G5G A;  1PDX A;  3ZDT A;  4M01 A;  3LB8 C;  1DOI A;  1T6B X;  1D6E C;  2CR5 A;  2LMC A;  3NS1 A;  3AMZ A;  2BWF A;  1HZ5 A;  3UF8 A;  1KH0 A;  4PS8 A;  1J0G A;  5HI1 A;  3ZTC A;  2KMM A;  3KYC D;  2M0X A;  3N30 A;  2JU6 X;  3NZS A;  4NZL B;  1WJU A;  4CHK A;  4TQ1 A;  5HKH A;  1T5X D;  4FJZ A;  3ZGZ A;  3A4R A;  2DAJ A;  4LNO A;  2B3A A;  4BBN F;  1JW9 D;  1QOG A;  4A6Q A;  2CJN A;  4P7I A;  4L1B A;  3BK1 A;  1YN4 A;  2BS3 B;  2NBV B;  1E8Y A;  2JRI B;  4AUQ C;  2JT4 B;  2KDB A;  2KHW B;  4S17 A;  2XK5 A;  1RM6 C;  2RR9 A;  2C7H A;  3NG0 A;  3ZUN A;  3VDZ A;  1VRA B;  1WF9 A;  2KDF B;  1XEE A;  2KDE B;  4GDL A;  3C0R B;  4GIV A;  1E8Z A;  3BZD B;  2Y3A A;  4P16 A;  2AYO B;  2K1F A;  2A4Z A;  1V1O A;  5BO4 B;  2JUO A;  3CIR B;  5HHD G;  3BIN A;  3P2B A;  5C3J B;  1ROE A;  1WFY A;  2NBU A;  3OAW A;  2NCN A;  3H1U A;  2N9L A;  3V60 A;  4OVZ A;  2IZV B;  1GB4 A;  2LHD A;  1L0V B;  5J17 A;  1Q10 A;  3ZVV A;  1XLN A;  2MEK A;  3LJ3 A;  1IBX B;  3T3O A;  4A8X C;  2O2V A;  3AV8 A;  4BFR A;  2L0F A;  3TL5 A;  4RF1 A;  4OZB A;  3M63 B;  3RCZ A;  1FNU A;  4I6P A;  3SFD B;  2KAC A;  5AUK A;  3VTU A;  4ANU A;  4MGZ E;  1B9R A;  1L6V A;  2V3S A;  2V0G A;  3APD A;  4P1B C;  4LTU A;  3IFW B;  2VZK D;  1N6Z A;  2MBE A;  3NZU A;  5E6P A;  3BVZ A;  4NPN A;  2ICI A;  3W5V B;  4JL9 A;  1OTR B;  1GNU A;  1WY8 A;  4REZ A;  3AE1 B;  2M0A A;  1NYQ A;  1YN5 A;  2M56 B;  4B0M A;  3R7R A;  4WAA A;  2KYW A;  3IVF A;  2K8C A;  1KLU D;  4ZRQ A;  2MCN B;  4W9F A;  5KHQ A;  3U52 E;  4B0E A;  3N20 C;  3IXS A;  2J0M A;  3KUZ A;  1SEB D;  1PGB A;  2N1V A;  1TY2 A;  2KC1 A;  4YWG G;  1E5W A;  2ZW1 A;  1EF5 A;  3P63 A;  5FKA C;  2GLS A;  1FXT B;  2WXQ A;  4KZ0 A;  3V6E B;  2G45 B;  2QCZ A;  1UWX A;  4YT0 B;  3B2G A;  1SGH A;  3ML8 A;  2V1Y A;  3Q3J A;  1F52 A;  1WM2 A;  3AE7 B;  4N59 A;  2J0K A;  2KT7 A;  3QK0 A;  4MJS A;  1WMH A;  3ZJT A;  5LNK 1;  2NS5 A;  4IW0 A;  2ON8 A;  3M95 A;  4YTP B;  2XK5 B;  4HKZ E;  2GMI C;  2J4X A;  2JRH A;  4I6L B;  3MJ5 A;  2UYZ B;  2PEA A;  1FFU A;  2IO3 B;  4KIK B;  1C9F A;  2L1A A;  5D7G A;  3UI3 A;  4IWP A;  5D94 A;  3U8Z A;  5EE9 A;  1FCL A;  2JXT A;  1DGJ A;  1C3T A;  4W9E A;  1UGJ A;  2G9H D;  2MH7 A;  4MSQ B;  2LGX A;  5FR3 A;  4WWN A;  1E7P B;  2LAS A;  2AEH A;  1IGC A;  4JWS C;  3IT4 B;  1JML A;  1V2Y A;  3PVL A;  4OVU A;  4PYU A;  4IG7 B;  3HVZ A;  4ANW A;  2W3R A;  5BYR A;  3TCA A;  3DWG C;  2MRP A;  4M00 A;  1UBI A;  2X8X X;  1ZDV A;  2V3N A;  2WDQ B;  3Q69 A;  2A5U A;  4W9C A;  4NY0 A;  3OJ4 B;  1F2R C;  3BWU D;  3AE5 B;  4XE0 A;  3NJT A;  2AL6 A;  2LWP A;  4WJP A;  1G6J A;  1JQ4 A;  1CJE A;  5IAA C;  2IND C;  1WYW B;  3UIN B;  3NHE B;  2B76 B;  1F0Z A;  2WP9 B;  1C78 A;  1AAR A;  1I35 A;  2BB5 A;  3AEB B;  4GU2 A;  4NJ7 A;  3EA6 A;  2N1W A;  3TBL D;  2IY0 B;  3H6N A;  1PFD A;  4ZOH C;  3ABV B;  3AN1 A;  1P9D U;  2BS4 B;  3ZO5 B;  3RN9 C;  1L5P A;  2KWD A;  1TYG B;  3NZ3 A;  2WXO A;  1VCB A;  4JGH B;  2JWZ A;  1HEZ E;  4ZHO A;  1JRP A;  1K50 A;  2M1M A;  3HRD D;  1V9J A;  4URK A;  2KK8 A;  1TT5 B;  1J7B A;  1ISN A;  4LLG M;  1PYW D;  3ZJV A;  4DXG A;  2LUM A;  5DCN A;  3ZNZ B;  2KN5 A;  4WWM A;  4DDG D;  3WAL A;  1IPG A;  2W55 A;  1FIQ A;  1KRH A;  3WCQ A;  1WXA A;  2WLB A;  2KTR A;  5C1Z A;  4EE2 A;  5IOI A;  1JRO A;  2CS4 A;  4EKU A;  2WNM A;  3FAH A;  1P0R A;  3ETR A;  3IHP C;  1WI0 A;  1TZO A;  2KLC A;  2LXA A;  2QDF A;  4TUU A;  2JY6 A;  4WQM A;  3P1M A;  2WXL A;  4O1N A;  4HPL B;  3Q14 C;  1HTO A;  2DYM A;  1P7E A;  3Q3M C;  3AEF B;  3R8B A;  3M3J A;  3KWL A;  4HEA 1;  5BMI A;  1LGR A;  4BKS A;  1F9J A;  4FHK A;  4BKG A;  2ZEQ A;  3QC8 B;  1KLV A;  4JWU C;  1D5X C;  5D3I B;  2EKI A;  1N60 A;  2G1E A;  1TTN A;  2J52 A;  4US8 A;  1H4R A;  1YJI A;  4B95 A;  3CSF A;  2QC8 A;  3Q8E A;  4DHJ B;  1QZE A;  4ANX A;  2ZPY A;  2BKF A;  3OG5 A;  4A90 A;  1YQB A;  4IM3 A;  3EC8 A;  3WAM A;  3Q3N C;  4ITK A;  4LNI A;  2WXP A;  1QIL A;  5I4D A;  2BKR B;  2FAZ A;  1T0Q C;  1I4G A;  3N9Y C;  2BYT A;  1D5M C;  3J9C A;  4JQW C;  1KJT A;  4NAM A;  3T3N A;  2DNF A;  2KLG A;  4CQN A;  1VZ7 A;  4XDD A;  1J8C A;  4WQO B;  2KDI A;  1SE3 A;  3UQB A;  5EE0 A;  2KNB A;  4GLS C;  4A55 A;  1C4P A;  2WS3 B;  1GJZ A;  2O6V D;  2INN E;  3GE8 C;  2PMV A;  4MSM B;  1SSN A;  3IAS 1;  2MJE A;  2JZZ A;  1WE7 A;  1AYF A;  2WU5 B;  1ZKH A;  4AQ7 A;  3VTV A;  2L05 A;  1RYJ A;  3O65 B;  3NVY A;  3VFK A;  1ACC A;  4H2A A;  3VRA B;  2FID A;  3VVW B;  2HE7 A;  2N0S B;  4K81 A;  2PJH A;  2KFJ A;  2GRI A;  1UGM A;  4DHZ E;  2LUE A;  2RPV A;  3NVZ A;  4QAY A;  5CHV C;  3V62 A;  4YTN B;  4XWW A;  1FD6 A;  2KTR B;  4II3 B;  3UQA A;  3ZNI D;  2VH2 A;  4RFB A;  3GS2 A;  5DPR A;  2WXH A;  5LLI A;  5FK9 C;  3WA0 A;  2L8J A;  1IBX A;  1S1Q B;  5L95 C;  3VR8 B;  1TKY A;  1TIF A;  3I5J C;  5HFY A;  3I57 A;  1V49 A;  1C76 A;  1U4A A;  3AI5 A;  1WGK A;  2MP2 A;  3B08 A;  4WWP A;  1WXM A;  2Z0E B;  2MLB A;  4TSS A;  2I2Y A;  4YSZ B;  1KTK A;  3HUI A;  5LXH A;  4C4V B;  2N9E B;  3NUH B;  1WX9 A;  3QIJ A;  2VRR B;  3E56 A;  1T0R C;  2FCM A;  1MG8 A;  4N6E B;  5BMG A;  3PLV A;  3KYD D;  4FJV B;  2LHE A;  2LVP A;  1KFY B;  3AE9 B;  2BYV E;  3PT2 B;  2KX0 A;  1FMA D;  1VR9 A;  2MSE D;  2EKE C;  2ZZP B;  4ZHP A;  2ZPN A;  3S2A A;  3P42 A;  4MGI E;  1V5O A;  2BQQ A;  3CMM B;  2W54 A;  2M8S A;  4BZA A;  1XO3 A;  1EO6 A;  3U7D A;  3KQ4 A;  2OED A;  2MHJ A;  3TIX A;  4KVG B;  3DPD A;  2BVC A;  2WXR A;  1WX8 A;  3SU8 X;  1NYR A;  2MX2 A;  4KSK C;  1D5Z C;  4XDC A;  4K1R B;  1XT9 B;  2JSV X;  4OW0 A;  1T0S C;  1I4Q A;  3ZNG C;  2L0T A;  3R66 C;  1TS3 A;  3VAW A;  2NMQ A;  2RDH A;  3N32 A;  2Z8L A;  1NVI D;  3KUD B;  2QIE B;  1GUA B;  5D2M B;  2MA9 B;  3T9L A;  1JWM D;  1UNS A;  1QOA A;  4GB9 A;  4EZJ A;  4KGS A;  1WGH A;  3O13 A;  2H89 B;  3N3K B;  4MDK E;  4JIO U;  1HE8 A;  1YX6 B;  3ONS A;  2KFK B;  2NPT B;  4HPP A;  3V61 A;  4RM8 A;  2FCS A;  4KZC A;  3URY A;  1V6E A;  1V5T A;  1QQR A;  1LO5 D;  4NNJ B;  2BWE S;  1YIW A;  4IKG A;  1J19 A;  4MEM A;  1C79 A;  4MM3 B;  2Z0D B;  4KIK A;  4KDL B;  3RNC C;  1EU4 A;  3AEG B;  4J3O D;  2J53 A;  4MH8 A;  1I42 A;  5DPT A;  1Q0W B;  3QQ8 B;  2V3P A;  1WZ0 A;  2I1K A;  3NVV A;  3JW0 X;  1GAQ B;  3KLS X;  3ZW3 A;  1P7F A;  4M8N A;  2JVC A;  3P4R B;  3L10 B;  4ZYN A;  2K8H A;  2VZK B;  1FNV A;  2MP2 B;  2JPH A;  3DDC B;  2KWC A;  1XCQ L;  3A4S C;  4HRS A;  2KN4 A;  1V1P B;  2DAF A;  3OJ3 A;  4MGY E;  2LGY A;  4DBG A;  1WYG A;  3N1X C;  2KWV B;  4NQL B;  1VD2 A;  4NQK E;  1TKG A;  1CMX B;  4ZRK A;  3ZKJ C;  4K3C A;  2C7N B;  2L83 A;  2WXI A;  1FEH A;  4XX5 A;  3UIP B;  5AZH A;  1QLB B;  3RFZ B;  1L6U A;  4AWJ A;  3VRB B;  2WXG A;  1JWB D;  1WE6 A;  4W9L A;  2M4N A;  1JAL A;  4HVB A;  2ZVN A;  4KKJ A;  3LXF A;  2DX5 B;  1PGX A;  2W82 A;  3Q3F A;  2RPQ A;  2FNJ B;  3PS6 A;  1SJE D;  1WSP A;  2N7E A;  2ASQ A;  2AQ1 B;  2LZ6 A;  3B0A A;  1E7U A;  2DYO A;  3ZRF A;  4BVU C;  1Y8R C;  1S3S G;  4IUM B;  1HQR D;  2AX5 A;  3ZQ4 A;  1WGR A;  4USA A;  2AWT A;  4XGA B;  3ZXV A;  1WRD B;  1EF1 A;  2LD9 A;  2OOB B;  2L52 A;  5IA7 A;  3H9D A;  1SBB B;  1YQ4 B;  2KXJ A;  3QJZ A;  3R7Q A;  4MT5 A;  4FXC A;  2K5P A;  3PRZ A;  1NBF C;  1WXQ A;  3AE8 B;  2BF8 B;  2KOX A;  1VDV A;  1FXA A;  3P4S B;  2WGS A;  2ZCB A;  4WWO A;  2KJR A;  2REX A;  4LNN A;  2G4S A;  4W9D A;  2CU3 A;  2JQR B;  3I3T B;  1KM7 A;  1ZP0 B;  1KLG D;  2L00 B;  3K9O B;  4MAC A;  3U4E G;  1GOZ A;  2J7Q B;  1XF5 L;  1M94 A;  2JZ3 B;  2XBB C;  5G5H A;  2NR2 A;  3MC8 A;  4JE3 B;  4RGM A;  3ZLZ A;  1N63 A;  4GN1 A;  2K6D B;  2GOW A;  3BYY B;  3RZF A;  1HTQ A;  2K25 A;  4P6V F;  2G3Q B;  2Y5P A;  4A3P A;  3Q6B A;  2BS2 B;  2FUH B;  2PIA A;  1WIA A;  2WX1 A;  4RF0 A;  2V4L A;  1WWT A;  3PHW B;  3PLU A;  1QT9 A;  3PZD A;  1NEK B;  2QMT A;  4DWF A;  4GMV A;  4FAD A;  1OGW A;  1E90 A;  1KF6 B;  3QA8 A;  4WJN A;  5HG2 A;  2SAK A;  3B2F A;  2K3U A;  3SHQ A;  2FBW B;  1SB3 C;  1YMH E;  4GDK B;  3K9P B;  1K53 A;  2K9X A;  3NVW A;  2GBR A;  2YVC A;  1XCT L;  2X38 A;  3EHV A;  2LI5 A;  3JVZ X;  1SIF A;  2C5L C;  2LFI A;  1P98 A;  4HK2 A;  2ZNV C;  2WXN A;  2LJ5 A;  1C1Y B;  1WJN A;  3QHT A;  2L3Z A;  1LXD A;  2W3S A;  3B9J A;  2O6V A;  4II2 B;  2JWU A;  2PPH A;  5CTR C;  3DBR I;  3P4Q B;  2IPK D;  5BYS A;  3HM3 A;  3PPA A;  4US9 A;  4ICV A;  3R2I A;  3GOE A;  4TKN A;  3WIM A;  4LCD E;  1JWU D;  4TMA B;  2MBQ A;  2JZP A;  3RNG C;  4AOF A;  4IM0 A;  4RMA A;  1OEY A;  1UF0 A;  2G4D B;  3AE4 B;  5C2T B;  2QIL A;  1FO4 A;  3HHM A;  4FLH A;  3N1Z C;  3JSV B;  3SD5 A;  2ZVO A;  2W9N A;  2BGF A;  3I63 C;  3A9K A;  4GOC A;  5C23 A;  3VQI A;  2CKH B;  4PT5 A;  2BYE A;  3B1L X;  3RZW C;  3ZNH B;  2M19 A;  1OQY A;  1STE A;  2RDG A;  3HM6 X;  4HPM B;  2KKC A;  4DQO C;  3QX1 A;  1GB1 A;  2NTS A;  2BTE A;  2D10 A;  2WX0 A;  1SIJ A;  5E6N A;  1AN8 A;  1D4B A;  1FM0 D;  2D3A A;  2KJH B;  2RSU A;  2BW2 A;  2HJ8 A;  4LJO B;  4ZRP A;  3L08 A;  2VH1 A;  4E71 A;  2FUG 1;  1F1H A;  2V4I B;  1YX5 B;  4IM2 A;  1UEL A;  4ANV A;  1L2N A;  1XD3 B;  3AEC B;  1TS2 A;  1J7A A;  4GSW A;  3V3X A;  2WXK A;  5E6O A;  3DHI C;  4DDI D;  4GXB A;  1DOY A;  4HCN B;  4C4V A;  3AB5 A;  3SEB A;  5EDS A;  2DYB A;  3D32 A;  4RM9 A;  2K0P A;  2KZR A;  4HXD A;  5JHA A;  2WDT B;  3P4P B;  2DZI A;  3PV1 A;  3MC9 A;  4M0W B;  3PGE A;  2CHX A;  1SF0 A;  4D2K A;  1OQR A;  3RI7 C;  1T0Y A;  3CF6 E;  2GBJ A;  2HTM E;  3GZN I;  2DZJ A;  4RGN A;  4XZ4 A;  4B6W A;  1DYQ A;  1I4R A;  3ZDM C;  3DBL B;  1XQQ A;  2MJD A;  1WX7 A;  1WGD A;  5AZF A;  1UUP A;  1JWS D;  3PRM B;  3AU4 A;  2KQ4 X;  2K6Q A;  2D2Q A;  2MQJ A;  4KSL C;  1NI3 A;  2O6V B;  2PLP A;  3VUY A;  1GC7 A;  4FN2 A;  2KVZ A;  3TUO A;  1ZXI A;  4IWQ A;  4NAW A;  1KOT A;  2IO2 B;  1SE2 A;  5D6J B;  2PKO A;  3AH7 A;  4KX6 B;  4W9K A;  2XEW A;  5LXI B;  2MW5 A;  1XXG A;  2MJ3 A;  3L17 A;  1PGA A;  2IBI B;  2KFK A;  3W1Y A;  3W2D A;  1HXY D;  4E74 A;  2NPT A;  2L76 A;  5H92 C;  4IWO A;  1UH6 A;  2CHW A;  3RNA C;  3ENE A;  1F77 A;  1TS5 A;  1LM8 B;  1B1Z A;  4LDT D;  2DLB A;  3A9K B;  1YN3 A;  1TJE A;  1I4X A;  3UIO B;  1Z2M A;  2QHO A;  2GBM A;  4MM3 A;  2UWQ A;  3OWE B;  1IYF A;  4YTM B;  3ZTD A;  4B9K A;  2N4F A;  3RUI B;  1IP9 A;  3VH3 B;  1WXV A;  3RPF C;  5D3D A;  1P3Q U;  1K8R B;  2KJ6 A;  2BBC A;  2ONQ A;  3TEY A;  3PSE B;  4RGO S;  4ASW C;  3A1Q B;  2Z59 B;  1IUE A;  5G55 A;  2DWQ A;  3OLM D;  2YLM A;  5IP4 D;  4W9J A;  3DCG A;  3VXW A;  2UU7 A;  3AED B;  3BK2 A;  5EE1 A;  2PTL A;  2C7M B;  1C4A A;  1FCC C;  1V86 A;  1R4N B;  1V1P A;  2XNA C;  1E7V A;  4RGT A;  3DQV A;  4XC2 A;  5JHB A;  2GB1 A;  1NDD A;  2C60 A;  1E10 A;  1I7H A;  4AP4 C;  1AWD A;  1L0X B;  1K51 A;  3QWZ B;  1V81 A;  4HDQ A;  4A9A A;  2HJ1 A;  1RFA A;  4KKI A;  2C9W B;  2JXX A;  1TKE A;  3MJW A;  2WWZ A;  4PS7 A;  1TY0 A;  3DVG Y;  4KDI C;  2QJL A;  2N9K A;  4HLE A;  3RT3 B;  2WXF A;  4EZK A;  5L83 A;  1MPE A;  2YEP F;  4OHJ A;  2AL3 A;  4OZA A;  3Q8A A;  4FHJ A;  2EEL A;  2R2Q A;  3IAM 1;  3IBE A;  1TZ1 A;  4BOS C;  1N61 A;  4EEW A;  3EGR A;  1ENF A;  3DBS A;  3PHX B;  4UDU C;  1E8X A;  4BKS D;  5TR5 A;  1FXI A;  3R3M A;  4X57 B;  4L2Y A;  4DHZ B;  4YXD B;  5J2R A;  4YSY B;  3QAQ A;  3PRP B;  2AQ3 B;  3BYT B;  4NAW B;  3DBR B;  4YL8 A;  4WUR A;  2MBH A;  4HDO A;  3H7P A;  1N5W A;  1YJJ A;  4WH4 A;  2KDM A;  4E3C A;  3DWM A;  4XYC A;  3TJP A;  4NJC A;  5IO9 A;  3JYU A;  1TS4 A;  1L7Y A;  4HJG E;  5JXV A;  3QCA A;  4FA6 A;  3VUW A;  4JLC A;  2H88 B;  2BPS A;  3E9S A;  2DBY A;  3PZ8 A;  4JX1 C;  4C56 C;  2LGS A;  4JPS A;  1EU3 A;  4R3D A;  2OJW A;  5JZE B;  1YNT E;  3PZ7 A;  4BOZ B;  1L4Z B;  5AZG A;  1L0Y B;  4DK5 A;  4ZRI A;  3BII D;  5JH5 C;  1JRU A;  1ZXH A;  3ML9 A;  3WAN A;  5DPW A;  1V8C A;  3APF A;  3ZIM A;  1MFW A;  4C00 A;  1C77 A;  4DXA B;  2IY1 B;  4GGQ A;  5TSS A;  3U7Z A;  1OEY J;  4XWT A;  3AEA B;  4AS1 A;  1PUT A;  2Y5B B;  1VJK A;  2RMM A;  3X23 A;  1RRB A;  2EMS A;  1R7S A;  2AQ2 B;  3RMK C;  2OJR A;  4Q2J A;  1N5X A;  3NY5 A;  3DHG C;  4GDK A;  3LYY A;  2KVR A;  3A9J B;  2KD0 A;  2IGG A;  3DBL I;  2LEK A;  3V6C B;  4OVV A;  3CST A;  4CO7 A;  1HZ6 A;  3FKY A;  4HWI B;  3DBH B;  2KWU B;  3H8H A;  3FIL B;  3RNF C;  2JYT A;  4LNK A;  2K8B A;  5FR6 A;  2SEB D;  2KQS A;  5CHW A;  3PRE A;  1QOF A;  4WAF A;  3KUC B;  1Y56 A;  2WDV B;  2QEJ C;  4KGR A;  4ARC A;  4AJY B;  3BVM A;  1RWS A;  2IGD A;  2D5G A;  3U30 A;  3KH0 A;  4MGK E;  3A33 B;  3GZN B;  4LNF A;  1WM3 A;  2RDB C;  2PVO D;  1OQQ A;  4MH0 E;  1F2R I;  1CK1 A;  1ZPS A;  4N58 A;  3Q3O C;  2KMC A;  4G50 A;  3DOW A;  1WXS A;  4RCO A;  4ZRJ A;  2RGF A;  3HK0 A;  3JSV A;  3Q8B A;  5GXG B;  2IJ0 A;  2BYF A;  1LQB A;  3U2S C;  3R2T A;  1AW7 A;  2WYQ A;  3L4P A;  2INC C;  3VHT C;  2KTF A;  2WHI A;  1EM7 A;  1DOX A;  3H7P B;  2Q5W D;  1PQS A;  1XLO A;  2EMT A;  1A5R A;  2V9H A;  4M8M A;  3WAP A;  2K22 A;  3ZYY X;  1QOB A;  2E6X A;  4HCP B;  4EFO A;  1R4N I;  3AE3 B;  3SR6 A;  2FIF A;  3DVN U;  1MVK A;  3SDL C;  4LJP B;  1WGY A;  2D3C A;  2ZJD A;  1E9M A;  4OZC A;  1LFD A;  3AU5 A;  3BY4 B;  4EZL A;  2LGD A;  4J6I A;  1T3Q A;  3EFC A;  4I6N B;  4LK0 M;  3VUX A;  2D07 B;  4GDL B;  2IO0 B;  1HA5 A;  3PTF C;  2E3T A;  2GI9 A;  2HDE A;  4ZYS A;  1FPY A;  1FRR A;  2TSS A;  2KO3 A;  1TBE A;  3BVG A;  4M0W A;  2BT6 A;  3TMP B;  2KAN A;  2L32 A;  5E6J A;  3RD2 A;  3VH4 B;  4A20 A;  4ARI A;  1UBQ A;  2PE9 A;  2NTT A;  3VR9 B;  3WAO A;  1EWC A;  4DXF A;  1M4V A;  1E8W A;  3EUB 2;  1ZDX A;  3AE6 B;  2LGI A;  1CQV A;  2O2V B;  4C80 A;  1CZP A;  3W9C B;  3L0W B;  2KC2 A;  1MHX A;  3W5U B;  1MG4 A;  4FJY A;  5IN7 A;  4C7Y A;  1NEN B;  2INP E;  2DZM A;  4FBJ B;  4L23 A;  3ZXR A;  4M02 A;  3EFU A;  4IOI E;  1D3Z A;  3M62 B;  4WJO A;  1EWY C;  5G2N A;  2N9X A;  3MHZ A;  4K7S A;  1FNW A;  4W9G A; 
#chains in the Genus database with same CATH homology
 2M56 B;  4B0M A;  2KQ4 X;  3KQ4 A;  2OED A;  2JX5 A;  4TQ0 A;  1VZ8 A;  1RFK A;  1NI3 A;  1SXT A;  2WXR A;  1BML C;  2PLP A;  4ZRQ A;  1KLU D;  3V05 A;  2R61 A;  5MPO A;  1NYR A;  1D5Z C;  3Q8C A;  4XDC A;  3TUO A;  1ZXI A;  3IT6 B;  1E6E B;  2OHF A;  3U52 E;  4B0E A;  3Q8F A;  1SE2 A;  4IDI A;  2JSV X;  4OW0 A;  2PKO A;  3AH7 A;  3IXS A;  4KX6 B;  1SEB D;  2ZW0 A;  1I4Q A;  1PGB A;  1XXG A;  1IGD A;  2MJ3 A;  1ZE3 D;  1TS3 A;  1TY2 A;  2NMQ A;  2RDH A;  4YWG G;  2Z8L A;  1NVI D;  2ZW1 A;  2QIE B;  1PGA A;  3W2D A;  1HXY D;  1ET9 A;  3P63 A;  5FKA C;  5H92 C;  1JWM D;  2WXQ A;  1UNS A;  1QOA A;  4KGS A;  1F77 A;  1TS5 A;  1B1Z A;  3O13 A;  2H89 B;  1UWX A;  2DLB A;  1YN3 A;  4YT0 B;  3B2G A;  3AM9 A;  5H8Y E;  1TJE A;  1I4X A;  3KWV A;  2BB6 A;  3OWE B;  2FE8 A;  4YTM B;  3URY A;  3AE7 B;  4N59 A;  1QQR A;  3ZJT A;  1FFV A;  1J7C A;  1LO5 D;  5LNK 1;  3RPF C;  5D3D A;  1VZ6 A;  2ON8 A;  2BBC A;  2ONQ A;  4IKG A;  4YTP B;  3TEY A;  4RGO S;  1C79 A;  4MM3 B;  4HKZ E;  1IUE A;  2J4X A;  2DWQ A;  1EU4 A;  3MJ5 A;  3AEG B;  5BYQ A;  3FC4 A;  4J3O D;  2J53 A;  3AED B;  4MH8 A;  1MI0 A;  1FFU A;  3BK2 A;  5EE1 A;  2PTL A;  1C9F A;  2L1A A;  5D7G A;  3UI3 A;  1C4A A;  2V3P A;  3NVV A;  3TEW A;  1GAQ B;  4WIP A;  1FCC C;  5EE9 A;  3KLS X;  1FCL A;  1BXT A;  2JXT A;  1P7F A;  1DGJ A;  1V1P A;  2XNA C;  1UGJ A;  3P4R B;  2G9H D;  2MH7 A;  4RGT A;  1GPX A;  2GB1 A;  3I9V 1;  2VZK B;  5FR3 A;  3AE2 B;  1I4P A;  1E10 A;  1I7H A;  1FNV A;  1AWD A;  1E7P B;  1L0X B;  1A70 A;  1IGC A;  4JWS C;  3IT4 B;  1JML A;  1K51 A;  1XCQ L;  4HRS A;  2KN4 A;  1V1P B;  4KGT A;  2ACZ B;  3HVZ A;  4A9A A;  5EE3 A;  1WYG A;  4KKI A;  2WXM A;  2W3R A;  3W1S A;  5BYR A;  3DWG C;  1TKE A;  2Y5C A;  2CJO A;  1TY0 A;  1ZDV A;  2V3N A;  2QJL A;  4YSX B;  2N9K A;  1TKG A;  1QKZ A;  2WDQ B;  3Q69 A;  3AEE B;  2WXF A;  3MP9 A;  3PO0 A;  2L83 A;  2WXI A;  1F2R C;  1FEH A;  3BWU D;  1MPE A;  2YEP F;  4OHJ A;  4OZA A;  3AE5 B;  4XE0 A;  1QLB B;  3Q8A A;  3RFZ B;  1L6U A;  3MFG A;  3VRB B;  2WXG A;  2EEL A;  1JWB D;  3IAM 1;  1JQ4 A;  1CJE A;  1JAL A;  1N61 A;  4KKJ A;  3LXF A;  4RH6 A;  1FRD A;  2B76 B;  1F0Z A;  2WP9 B;  1PGX A;  2W82 A;  1C78 A;  3EGR A;  1ESF A;  1VLB A;  1ENF A;  2BB5 A;  3AEB B;  3EA6 A;  4UDU C;  2WXJ A;  2YEP B;  3MC0 B;  1SJE D;  1FXI A;  1WSP A;  2AQ1 B;  1MHH E;  4L2Y A;  4YXD B;  1PFD A;  4ZOH C;  2DYO A;  3ABV B;  3AN1 A;  4YSY B;  2BS4 B;  2AQ3 B;  3BYT B;  4NAW B;  1JWA D;  3GB1 A;  1HQR D;  1L5P A;  2KWD A;  4WUR A;  1TYG B;  2IGH A;  2AX5 A;  3NZ3 A;  3ZQ4 A;  2WXO A;  3C8Y A;  1N5W A;  1ET6 A;  1YQ3 B;  4USA A;  1YJJ A;  2PW9 A;  1HEZ E;  4WH4 A;  2KDM A;  4ZHO A;  1JRP A;  1K50 A;  1UWM A;  3HRD D;  3CWI A;  3DWM A;  1E0Z A;  2L52 A;  1SBB B;  1YQ4 B;  4MT5 A;  4FXC A;  2K5P A;  4NJC A;  2IDY A;  1WXQ A;  3AE8 B;  1TS4 A;  1BUI C;  1J7B A;  4HJG E;  2KAJ A;  5JXV A;  1VDV A;  1FXA A;  4HRO A;  3P4S B;  4LLG M;  1PYW D;  3ZJV A;  4DXG A;  2I38 A;  2LUM A;  2H88 B;  4WWM A;  2CU3 A;  2XN9 C;  3E9S A;  2N7J A;  2DBY A;  3PZ8 A;  4JX1 C;  4C56 C;  2W55 A;  4JPS A;  1XLP A;  1EU3 A;  2JQR B;  1FIQ A;  1KRH A;  3WCQ A;  1WRI A;  1ZP0 B;  2JYE A;  1KLG D;  4MAC A;  4R3D A;  3U4E G;  1YNT E;  3PZ7 A;  2WLB A;  1L4Z B;  1C4C A;  1GOZ A;  3GP7 A;  1XF5 L;  1L0Y B;  5G5H A;  4JE3 B;  4RGM A;  3BII D;  1N63 A;  5T8I A;  1ZXH A;  4EE2 A;  1JRO A;  3BYY B;  1V8C A;  1QF6 A;  4P6V F;  5AUI A;  2WNM A;  1C77 A;  2Y5P A;  3FAH A;  2BS2 B;  1I4H A;  5TSS A;  3ETR A;  2PVG C;  3U7Z A;  3TEZ A;  4XWT A;  2PIA A;  3AEA B;  4AS1 A;  1PUT A;  1TZO A;  1XLQ A;  4RF0 A;  1V97 A;  1VJK A;  2RMM A;  1WWT A;  3P1M A;  4WQM A;  3NRZ A;  3TEX A;  2WXL A;  1R7S A;  2AQ2 B;  4O1N A;  1SE4 A;  1QT9 A;  1OFF A;  4Q2J A;  1NEK B;  1N5X A;  2QMT A;  2WU2 B;  3LYY A;  3FIL A;  2LJI A;  1KF6 B;  3HVD A;  2DYM A;  1P7E A;  5BMH A;  2IGG A;  3AEF B;  3R8B A;  2LEK A;  5HG2 A;  2SAK A;  3B2F A;  2K3U A;  3KWL A;  4HEA 1;  3SFE B;  5BMI A;  3ZJU A;  2FBW B;  1HZ6 A;  1SB3 C;  1YMH E;  1ZOY B;  4HKQ A;  4GDK B;  3H8H A;  3FIL B;  1K53 A;  2JYT A;  2K9X A;  3NVW A;  4JWU C;  1D5X C;  1XCT L;  2SEB D;  2EKI A;  5D3I B;  1N60 A;  2G1E A;  2J42 A;  2J52 A;  2X38 A;  4C7Z A;  2WDR B;  4US8 A;  1K52 A;  2LFI A;  1QOF A;  1YJI A;  1L4D B;  4WAF A;  1N62 A;  2WXN A;  3Q8E A;  1Y56 A;  2WDV B;  2QEJ C;  1JCK B;  2WQY B;  1ZUD 2;  4KGR A;  4ARC A;  3BVM A;  1RWS A;  2IGD A;  2QSD A;  2D5G A;  1SJH D;  4A90 A;  2W3S A;  3B9J A;  4RNA A;  2JWU A;  3TSS A;  3P4Q B;  5G5G A;  2PVO D;  2IPK D;  1PDX A;  5BYS A;  1OQQ A;  4ITK A;  4US9 A;  1F2R I;  3R2I A;  1CK1 A;  1ZPS A;  3LB8 C;  1DOI A;  1D6E C;  1T6B X;  4N58 A;  2WXP A;  1QIL A;  2LMC A;  5I4D A;  3NS1 A;  3AMZ A;  1JWU D;  1HZ5 A;  1I4G A;  3N9Y C;  1KH0 A;  4TMA B;  2BYT A;  2JZP A;  1D5M C;  4RCO A;  3J9C A;  5HI1 A;  3AE4 B;  2KMM A;  3Q8B A;  4NAM A;  5C2T B;  2JU6 X;  3T3N A;  2QIL A;  5GXG B;  4NZL B;  1FO4 A;  2IJ0 A;  4CQN A;  1VZ7 A;  4XDD A;  4TQ1 A;  3U2S C;  1T5X D;  3R2T A;  1AW7 A;  1SE3 A;  3L4P A;  3ZGZ A;  5EE0 A;  4A55 A;  4GLS C;  1EM7 A;  1C4P A;  2WS3 B;  1DOX A;  2INN E;  2Q5W D;  2PMV A;  1JW9 D;  1SSN A;  3IAS 1;  2MJE A;  1QOG A;  1AYF A;  4A6Q A;  2CJN A;  3VQI A;  4PT5 A;  2WU5 B;  1XLO A;  2M19 A;  4L1B A;  3BK1 A;  1YN4 A;  4AQ7 A;  1RYJ A;  3NVY A;  1STE A;  2RDG A;  1ACC A;  2BS3 B;  4H2A A;  3VRA B;  2K22 A;  3ZYY X;  1QOB A;  4DQO C;  2N0S B;  2E6X A;  1GB1 A;  2NTS A;  2BTE A;  1RM6 C;  3AE3 B;  3SR6 A;  2GRI A;  2RPV A;  1SIJ A;  1VRA B;  1AN8 A;  3NVZ A;  1D4B A;  1FM0 D;  1XEE A;  1MVK A;  2BW2 A;  3BZD B;  2Y3A A;  4P16 A;  1E9M A;  4YTN B;  4OZC A;  4ZRP A;  4XWW A;  1FD6 A;  1T3Q A;  2FUG 1;  1V1O A;  4RFB A;  3GS2 A;  4LK0 M;  2WXH A;  2V4I B;  3CIR B;  5FK9 C;  5HHD G;  5C3J B;  4GDL B;  3AEC B;  1HA5 A;  1ROE A;  1TS2 A;  1J7A A;  2E3T A;  1IBX A;  3V3X A;  2GI9 A;  2HDE A;  2WXK A;  3VR8 B;  1TKY A;  5HFY A;  2N9L A;  3I57 A;  4OVZ A;  4ZYS A;  1GB4 A;  2LHD A;  1C76 A;  1FRR A;  1L0V B;  2TSS A;  1DOY A;  1Q10 A;  1WGK A;  3AB5 A;  3SEB A;  1XLN A;  3BVG A;  4M0W A;  2MEK A;  1IBX B;  3T3O A;  2BT6 A;  4A8X C;  2L32 A;  4TSS A;  3AV8 A;  5E6J A;  2K0P A;  2I2Y A;  4YSZ B;  1KTK A;  3HUI A;  4ARI A;  3P4P B;  2NTT A;  3NUH B;  4RF1 A;  3VR9 B;  1EWC A;  4DXF A;  4OZB A;  1M4V A;  3EUB 2;  1FNU A;  1ZDX A;  3AE6 B;  1SF0 A;  1CQV A;  2KAC A;  2LGI A;  3E56 A;  3SFD B;  4D2K A;  5AUK A;  1OQR A;  4C80 A;  1CZP A;  4N6E B;  1B9R A;  5BMG A;  3W9C B;  2LHE A;  1L6V A;  1MHX A;  3W5U B;  1KFY B;  2V0G A;  2HTM E;  3AE9 B;  4LTU A;  4C7Y A;  1NEN B;  2INP E;  1FMA D;  4L23 A;  2VZK D;  1VR9 A;  4RGN A;  4IOI E;  3BVZ A;  2ICI A;  1DYQ A;  1EWY C;  3W5V B;  4ZHP A;  3P42 A;  1I4R A;  3MHZ A;  2MJD A;  1FNW A;  1UUP A;  4REZ A;  2W54 A;  1JWS D;  3AE1 B;  2M0A A;  1NYQ A;  1XO3 A;  1YN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...