2K6QA

Lc3 p62 complex structure
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
121
structure length
121
Chain Sequence
b'SMPSEKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESERDEDGFLYMVYASQETFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Microtubule-associated proteins 1A/1B light chain 3B
publication title Structural basis of target recognition by ATG8/LC3 during selective autophagy
rcsb
source organism Rattus norvegicus
molecule tags Apoptosis inhibitor/apoptosis
total genus 20
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2008-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2k6qA00
1I35A 4MM3A 4XC2A 2LJ5A 4HK2A 2DZJA 4NQLB 4II2B 3BY4B 4IM2A 3ALBA 3AULA 4A3OA 2KZRA 2Y5BB 2KDBA 4K7UA 3ZNGC 2KFKA 4PYUA 2J0KA 4W9JA 1E90A 4RMAA 2HD5B 1Q0WB 3NS8A 3ECIA 1H8CA 2C7NB 2LD9A 3ZKJC 4EKUA 1E8XA 2EKEC 2JRIB 3W1YA 3RYTA 2KDFB 3BINA 1WGGA 3MJWA 4URKA 1WRDB 2RR9A 2LZ6A 3QAQA 1LM8B 2ZNVB 1KOTA 2IY1B 1L2NA 2EMTA 4GB9A 2K8HA 1L7YA 2J7QB 2J0JA 2JRHA 2O6VA 2GBMA 3DQVA 3ZDMC 1WR1A 4EZJA 1EO6A 3UGBB 5AEKB 1IPGA 4TUUA 2ZVOA 2IO1B 4IM0A 2VRRB 3A4SC 3PLVA 2L05A 4BKGA 4LCDE 4GN1A 2V1YA 5BO4B 2KANA 5CHFA 5CHVC 2LGYA 4HPLB 2YVCA 1UZXB 1UELA 5CHWA 2D3GA 3KH0A 2K1FA 4M0WB 4NNJB 2A5UA 2K6DB 5IA7A 2KHWB 2PE6B 3ZTCA 3A33B 1XD3B 2GMIC 3V6CB 3VUXA 3ONSA 4DWFA 2GOWA 2KJRA 3R7QA 3M3JA 4WWPA 2KC2A 1OTRB 1C1YB 2CHZA 2JXXA 2ASQA 2KN5A 4K7SA 1ZKHA 2MBQA 4W9EA 2GBKA 1WXVA 4KIKB 5FR6A 5JH5C 4EZLA 3L0WB 1WF9A 3DPDA 4LJOB 5TR5A 3ZDTA 1V5TA 3VTUA 2LI5A 1EF5A 3ZNHB 4BOZB 3N32A 1WFYA 2ZVNA 3ZW3A 4DXAB 4MELA 1I42A 3AI5A 3HHMA 3CMMB 2L00B 3U7DA 1WGRA 4CYEA 3QHTA 3PHWB 4ICVA 4GIVA 4F8CB 3PRZA 4W9IA 5IAAC 4ASWC 2IO3B 4MSMB 4JGHB 3V6EB 1JRUA 4MGYE 2KTRB 4IWPA 4KDIC 2R2OA 2BF8B 4WQOB 4DHJB 2KC1A 4OVVA 2FCNA 2G4SA 3WAPA 5D7GA 4GMVA 2KKCA 1QZEA 1V86A 1E7UA 3QIJA 2KNBA 2MBOA 1WX7A 1WXSA 4F1SA 1UBQA 3ZUNA 4NJ6A 2L8JA 2DYOA 3PV1A 1Q5WB 2KTRA 3U8ZA 3ZIMA 4DBGA 4JLCA 3APFA 1WJNA 1X1MA 2LASA 4DHJD 2ZCBA 3PSEB 4J6IA 1D3ZA 1TTNA 2KDEB 3TJPA 2KVRA 4AJWA 1WGDA 3UF8A 1LFDA 2KLCA 2CHXA 2RD0A 3TMPB 3PVLA 3NOBA 4MEMA 4WJOA 5EDSA 2NBVB 3X23A 3APDA 1WM3A 1UGMA 4XX5A 4K81A 2LVQA 2PE9A 1Z5SB 3GOEA 2PJHA 1GNUA 4HCPB 2KLGA 3V62A 2HE7A 3VUWA 2KWCA 3NZSA 2O2VB 3H9DA 4IWQA 2ZNVC 3A9JB 3QK0A 4MH0E 4MGIE 4BBNC 1ZGUB 2JVCA 1SGHA 1WJ4A 3CSTA 3WA0A 3UIOB 2DAJA 1E8ZA 3H7PA 1WXMA 2KWUB 3ZLZA 3QA8A 4NQKE 4HVBA 4W9HA 1S3SG 3ENEA 4B95A 2C60A 1MG8A 2O2VA 4W9CA 3SDLC 2MBHA 4BFRA 2FCQA 5G55A 4ANWA 2MSED 5CTRC 3UQAA 3DBHI 2ZZPB 2MA9B 2REXA 3JW0X 2UYZB 3O65B 2MBEA 3DBRI 4HCNB 1RFAA 2DZMA 3AU4A 3TIXA 2K39A 4II3B 1BT0A 1P98A 3GZNI 4F7ZA 3QCAA 5DPSA 4FA6A 2BKRB 1GUAB 3KVFB 2MCNB 4I6NB 4BKTA 4EUTA 2C9WB 2PPHA 2N9EB 2L7RA 3CF6E 3L17A 1V6EA 3U30A 2WDTB 4GDLB 4HPMB 2KO3A 4AUQC 1WGHA 2W9NA 2LWPA 1IP9A 4FJZA 4MJSB 2IY0B 1WMHB 4DDGD 2CR5A 4EEWA 3JVZX 3L10B 5G2NA 1V80A 4AOFA 3RUIB 3RULA 3VAWA 3QQ8B 5C23A 2I1KA 2XK5B 4ZRJA 3NZUA 3L16A 2C7HA 1R4NI 3KUCB 2EMSA 2KX3A 2V4LA 2G4DB 1WE7A 3IVFA 1SIFA 4TQ1A 3L54A 3QWZB 2K6QA 4GDKB 2NPTB 3X0WA 2A4ZA 3MHSD 2DYBA 5AZGA 4FN2A 2M0XA 2XK5A 3ZRFA 3ML8A 3R66C 1V5OA 1J8CA 5JHBA 5HKHA 2JZ3B 3SU8X 1YX6B 2AWTA 3M63B 1M94A 5DPWA 3I3TB 4GU2A 4P7IA 4TV3A 2NPTA 2OJRA 3JYUA 2NBUA 3R3MA 3RZFA 4HDQA 3OAWA 4IUMB 5LLIA 1WI0A 4FBJB 3KW5B 4KIKA 2RPQA 2KK8A 3CSFA 4KSKC 5C1ZA 2L76A 4JIOU 3H7SA 4IG7B 2AL3A 1KJTA 2LUEA 4B6WA 2ZPYA 3VUYA 4FLHA 3L13A 4EZKA 1H4RA 3ZRCA 5AZFA 4M8MA 5DCNA 1WZ0A 2AL6A 3VXWA 3ZVVA 2BGFA 1AARA 1Q1OA 1Z2MA 3K9PB 3OJ4B 3S2AA 5JZEB 2BWFA 1WE6A 4B9KA 3ZNZB 2FUHB 1SE9A 2G45B 2B3AA 1CMXB 3PGEA 2BYEA 2IBIB 4W9FA 2L0FA 3DVGY 4G50A 2FCSA 4AWJA 3VTWA 1KLVA 1YIWA 3UQBA 2GBJA 1V49A 1K8RB 5E6OA 2LVOA 3QARA 2D11A 3TCAA 4E3CA 3NHEB 2KJ6A 3PTFC 1WH3A 2PEAA 2CKHB 3IBEA 1RRBA 2KJHB 4FHJA 4FHKA 4IW0A 2MBBB 2MRPA 3DBSA 4PS8A 5J17A 3VDZA 2Z0DB 2N1VA 4LJPB 1ISNA 1UBIA 3UIPB 2KMCA 2DHZA 3D32A 2JUOA 3VVWB 1J19A 2RSUA 3P2BA 2KQ7A 5D6JB 1EUVB 5E6NA 3RD2A 3A1QB 3KYDD 4W9LA 4GXBA 3L08A 2FIFA 2DENB 3PT2B 1OEYA 2N7EA 5GMVA 1WJ6A 2K8BA 3WIMA 1TGZB 2LVPA 2Z0EB 3MTNB 3RZWC 3VH3B 2D2QA 3DBLI 1P9DU 2KD0A 3PS6A 5KHOA 1G6JA 1E7VA 1T0YA 1WXAA 2CU1A 2KDIA 2WWZA 3A9JA 3M62B 3DDCB 3DVNU 3Q3JA 3KUDB 3KUZA 1GC6A 2KWVB 2LGDA 4KDLB 4KSLC 2M1MA 1C3TA 3HK0A 1R4MI 2HTHA 4K7WA 4GGQA 4HDOA 1V81A 2K8CA 3V61A 3EECA 3IHPC 2KXJA 2V3SA 2WYQA 3OLMD 3ZNID 4WWNA 2N9PC 2WX1A 1TZ1A 3DCGA 4WJQA 3SD5A 3T8MA 4MGZE 4X57B 3WAMA 4BKSD 1GC7A 3DVNV 1P1AA 1WYWB 2D07B 4FJVB 4HXDA 2BKFA 4IC7B 3B1LX 3K9OB 4TQ0A 5LXIB 5DPTA 1WM2A 4EOYA 3PRPB 2IZVB 3VHTC 2L3ZA 1F9JA 2FIDA 4ZYNA 2LRUA 3WAOA 4FADA 1WGYA 1ZW7A 2NVUI 1VCBA 2O6VB 2KX0A 1LXDA 2AEHA 4ZRKA 3RT3B 3PHXB 3VH4B 2NCNA 4KVGB 4K1RB 4IWOA 3TL5A 4GDLA 3EFUA 2NS5A 2QHOA 2OOBB 4M8NA 3W1SA 4DK5A 4G0NB 5JHAA 1A5RA 4ZDVA 1E8WA 2MP2B 1XQQA 3HM3A 2CHWA 4MJSA 2O6VD 2JY6A 3V60A 3B08A 2MWSB 4KV2A 1WMHA 2FNJB 3QC8B 2IYDB 3R7RA 3QJZA 3PZDA 5D94A 3AXCA 1WJUA 2C7MB 3H1UA 2MLBA 3IFWB 5D2MB 3IG3A 2C5LC 2RGFA 5LXHA 1V9JA 5CX3A 4FJYA 4RM9A 1WX8A 2MP2A 1UH6A 5J18A 1RLFA 1P3QU 4N9F4 1LQBA 2ZCCA 4EFOA 4NPNA 4GOCA 2XBBC 2LXCA 4GDKA 4I6PA 1WIAA 2DZIA 2XEWA 1YJ1A 3AU5A 2BWES 2L0TA 3PRMB 3PREA 2M4NA 4W9KA 4BOSC 2WX0A 1KM7A 2M17A 3OJ3A 4PS7A 3EC8A 5AZHA 4NAWB 4TKNA 3ML9A 4LDTB 2DYMA 2J0MA 2KOXA 3A4RA 4ICUA 4BVUC 3ZO5B 2K25A 2YLMA 4WWOA 4YL8A 4ANUA 4MDKE 4DHZB 4PS3A 2FAZA 2BYFA 2NBWB 4JQWC 2LRWA 4WJNA 2N9XA 4KZCA 3N30A 2NR2A 4E74A 1XT9B 4A3PA 4LDTD 2I1JA 1RAXA 4NAWA 3RCZA 2CS4A 2KTFA 1YQBA 1FXTB 2MQJA 3APCA 2LGXA 3TBLD 1Y8RC 3C0RB 3VQIA 4AJYB 2JT4B 1OEYJ 2GBNA 3HM6X 3JSVB 2HJ8A 2GBRA 1NI2A 2ZPNA 1WX9A 2N1WA 1IYFA 3DVGX 1HE8A 4BBNF 3A9KB 1NDDA 2DX5B 4DHZE 3WALA 1EF1A 2IO2B 3VTVA 1WZ3A 2G3QB 2JWZA 4DDID 4HWIB 3HIZA 5KHQA 1YD8U 3JSVA 3Q3FA 2BPSA 4G3XB 2FCMA 3W1SC 2Z59B 3UINB 1WY8A 5L83A 2KQSA 2MX2A 1E5WA 3A9KA 1E8YA 1GJZA 3QX1A 2JPHA 5L95C 3PLUA 3SHQA 2ZEQA 1S1QB 5E6PA 1V2YA 2DZKA 4AP4C 4W9DA 4KZ0A 1NBFC 3N3KB 3KYCD 3EHVA 1U4AA 2LXAA 4WJPA 3DOWA 2KFJA 3H7PB 3PPAA 3B0AA 4RM8A 1OGWA 4W9GA 2KMAA 1GG3A 2JF5A 2N7DA 4PYZA 4ANVA 2M8SA 4I6LB 2N4FA 3LDZE 4NY0A 1J0GA 1TBEA 4E71A 2BYVE 3A1QA 2R2QA 3T9LA 4GSWA 4MGKE 2ZJDA 3LJ3A 5J2RA 4CHKA 3WANA 4HLEA 4WAAA 1UD7A 4MSQB 4NJ7A 3ZTDA 4OVUA 1OQYA 1PQSA 4XZ4A 1WR6E 4JL9A 1P0RA 3VFKA 4CO7A 2KFKB 2AYOB 2DAFA 1YX5B 3NY5A 4FULA 4ZRIA 1VD2A 3H6NA 4BKSA 2MW5A 3M95A 2D10A 4A20A 2JZZA 4HJKA 4ANXA 5DPRA 2UWQA 4G11A 4IM3A 2IO0B
chains in the Genus database with same CATH superfamily
1I35A 4MM3A 2LJ5A 2DZJA 3ZXRA 3HRDD 3BY4B 3ALBA 1BMLC 1QOGA 4K7UA 2M56B 1KH0A 1Q0WB 4FXCA 2BQQA 3W1YA 3RYTA 1WGGA 2LZ6A 3QAQA 1LM8B 2ZNVB 4EZJA 2GBMA 3DQVA 3AE5B 4BKGA 4L2YA 4GN1A 2V1YA 4D2KA 2W3SA 1UELA 1EU4A 4M0WB 1IGCA 5IA7A 2PE6B 2PMVA 2RDBC 4DWFA 2SEBD 2KC2A 3AMZA 2MBQA 4KIKB 5FR6A 3FKYA 5JH5C 4M0WA 1WF9A 4YSYB 1V5TA 1FRDA 1N60A 3ZJTA 2ZVNA 3B9JA 4MELA 1I42A 3FC4A 3I5JC 1I4XA 3CMMB 2L00B 3U7DA 5G5HA 1CQVA 1NYQA 2LHDA 4W9IA 4JGHB 1FD6A 4IWPA 2BF8B 2QJLA 1QF6A 4OVVA 4GMVA 3QIJA 1QQRA 5AUKA 3V05A 3HUIA 1WXSA 3RNCC 4F1SA 3ZUNA 4NJ6A 2L8JA 1J7AA 4S0RA 3ZIMA 1TS4A 2J53A 1AN8A 2LASA 1D3ZA 1TTNA 4AJWA 2GI9A 4MEMA 5EDSA 2NBVB 4HKZE 5D3DA 3H9DA 3P1MA 5HG2A 4XWTA 3H7PA 2KAJA 1WXMA 4RFBA 2KWUB 1TIFA 2K0PA 1S3SG 1VZ8A 4OW0A 1HXYD 4W9CA 4B0EA 4BFRA 4NJCA 2MSED 3UQAA 2D3BA 1TZOA 4HCNB 1RFAA 1BT0A 1P98A 4F7ZA 1ESFA 1GUAB 3KVFB 4LTUA 2K3UA 2L7RA 3U30A 4HPMB 2KO3A 3NVVA 4GLSC 1IP9A 4B0MA 4EEWA 3MC8A 5G2NA 3RULA 3QQ8B 4ZRJA 3R2TA 1ZOYB 2EMSA 2KX3A 3AE7B 1L6VA 4TQ1A 1XO3A 1T3QA 2V4IB 2DYBA 4FN2A 3C8YA 3GB1A 1J8CA 5JHBA 5HKHA 5H8YE 1TY2A 3SU8X 1SEBD 3M63B 2OJRA 3JYUA 1PFDA 5LLIA 1FXAA 1ZP0B 2MJ3A 2ICIA 3SEBA 2RPQA 4KSKC 5C1ZA 2L76A 4WH4A 1CK1A 1KJTA 2LUEA 4B6WA 2B76B 3VUYA 1Q10A 3ZRCA 5AZFA 1WZ0A 3MHZA 4YT0B 2BGFA 4N58A 1AARA 4HEA1 2WU2B 5JZEB 2BWFA 1JWMD 4WIPA 3PGEA 2BYEA 2IBIB 3U52E 1M4VA 4RGNA 4G50A 2WXRA 2FCSA 1KRHA 2D11A 2J4XA 3NHEB 4NAMA 2AQ2B 1TS2A 2MRPA 5J17A 2PW9A 3HVZA 3Q8BA 2Z8LA 1UBIA 1TS5A 2DHZA 2JUOA 4Q2JA 5D6JB 5EE0A 2KDMA 3BYTB 5BMHA 2DENB 3PT2B 4M00A 2N7EA 1WJ6A 3MC0B 1TGZB 1NENB 3DVNU 2Q5WD 2KWVB 2M1MA 2GLSA 1TT5B 1B9RA 2RMMA 4GGQA 1V81A 2BS3B 1FNWA 2WYQA 3TEXA 2JU6X 3ZNID 1TS3A 2E6XA 2WX1A 3T8MA 1SF0A 5FK9C 2D07B 3Q3MC 3Q8AA 5LXIB 2WXLA 4ZRPA 3VHTC 1PGBA 1F9JA 1WGYA 1VCBA 1XXGA 2ZW0A 4IWOA 3TL5A 2WXJA 5JHAA 4DK5A 1A5RA 2QC8A 3HM3A 4MJSA 2O6VD 3V60A 4AS1A 1XLNA 3EFCA 3GE8C 2MEKA 2LMCA 1WJUA 3H1UA 1I7HA 2MLBA 5D2MB 1VZ6A 1QT9A 1RLFA 4N9F4 1LQBA 2LGSA 4NPNA 2XBBC 2DZIA 2MHJA 1YJ1A 3AU5A 2BWES 2L0TA 3PREA 1FFUA 4BOSC 1FCCC 3EC8A 4NAWB 4TKNA 2IJ0A 1RYJA 4DHZB 3FILB 3ETRA 1PGAA 1N5XA 4USAA 4LDTD 2N0SB 1RAXA 4NAWA 2KTFA 1YQBA 2MQJA 4KGTA 1QLBB 4AJYB 1I4RA 3FILA 1OEYJ 2HJ8A 2GBRA 3P4RB 1EF1A 3VTVA 1WZ3A 5T8IA 4DQOC 2G3QB 3N9YC 3IAM1 3AE3B 2WS3B 2Z59B 4K3BA 2KQSA 3Q8FA 1E8YA 1L5PA 3BVMA 2QDFA 5L95C 4K3CA 2ZEQA 1WYGA 4W9DA 4KZ0A 5G5GA 3N3KB 1HTQA 4RM8A 3PPAA 3B0AA 5FR3A 2JF5A 2N7DA 1MHXA 2W54A 3LDZE 2W55A 1VR9A 1AYFA 1L0YB 4KX6B 2VZKD 4WAAA 3NVZA 2D3AA 1L0VB 1WR6E 1EWCA 4HKQA 4OZBA 2Y3AA 3VFKA 2KFKB 3W9CB 1V1OA 1YX5B 3H6NA 1JQ4A 1YQ3B 1YN3A 4XC2A 4UDUC 4HK2A 4NQLB 4II2B 4O1NA 1ACCA 2KFKA 4RMAA 3FAHA 2WXNA 1GB1A 2NTSA 1WSPA 5I4DA 1T0QC 2C7NB 3ZKJC 3NVYA 2G9HD 1WRDB 1L2NA 2EMTA 2J7QB 3ZDMC 1WR1A 3UGBB 2ZVOA 1TKEA 2KN4A 2LEKA 1ZDVA 2KT7A 5CHVC 2LGYA 2L1AA 2IPKD 2YVCA 4US9A 3EA6A 3KH0A 2D5GA 2KJRA 3M3JA 2KMMA 2JXXA 2ASQA 1ZKHA 4W9EA 2TSSA 1MPEA 4EZLA 3ZDTA 2QIEB 2LI5A 4KKIA 4XGAB 3N32A 1B1ZA 1FNVA 3AI5A 4CYEA 1BXTA 4ICVA 4XWWA 2IO3B 4MGYE 2KTRB 2R2OA 1R4MB 4WQOB 1MHHE 2FCNA 2INCC 3Q3OC 5D7GA 2KKCA 1V86A 2KNBA 3AE1B 4RF0A 2OEDA 1UBQA 1NEKB 3V3XA 5AUIA 2KTRA 3APFA 3MJ5A 1WJNA 1X1MA 3PSEB 1TKGA 2KVRA 1WGDA 3UF8A 2AQ1B 2CHXA 2RD0A 4WJOA 4P1BC 1RM6C 3APDA 1UGMA 4IKGA 4XX5A 2LVQA 2PE9A 1Z5SB 2BYTA 2PJHA 4HCPB 3SFDB 1V1PB 4R3DA 4ZRQA 2KWCA 3NZSA 2O2VB 4YWGG 2JZPA 2K5PA 2BBCA 2CU3A 2W3RA 2JYTA 3UIOB 3CWIA 3ENEA 4B95A 2O2VA 3SDLC 4NZLB 1PUTA 5G55A 5CTRC 3U2SC 4US8A 1PDXA 1UWMA 2MA9B 2FUG1 3JW0X 2UYZB 3W5UB 1YN4A 1DGJA 2DZMA 3TIXA 2QEJC 5DPSA 3RN9C 2PIAA 1I4GA 2WXGA 4JX1C 1WGHA 2RDGA 2WGSA 1P7EA 1F77A 3NRZA 1QOAA 4ARCA 5BMIA 4AOFA 2PVGC 3BYYB 1D5ZC 4C56C 3KWLA 3DWGC 2ON8A 3B2FA 2C7HA 3KUCB 2V4LA 3L54A 3ZGZA 2N7JA 4GDKB 2MJDA 1J7CA 4IOIE 3W2DA 2KWDA 2QMTA 3R66C 2JZ3B 3AEGB 3AV8A 2BS2B 5DPWA 3I3TB 2IGGA 4TV3A 1C4CA 3GE3C 3NVWA 3RZFA 2OJWA 4KIKA 3P4QB 2KACA 4JIOU 2ACZB 2AL3A 1C77A 3IT4B 2WXMA 5DCNA 3VXWA 1Q1OA 1WE6A 2B3AA 4W9FA 1STEA 1SIJA 2L0FA 1FM0D 2ZW1A 3DVGY 1OQQA 3H8HA 1KLVA 2QILA 4TMAB 3NJTA 5BYRA 1K8RB 5E6OA 1YOVB 4M02A 3TCAA 2KJ6A 2IDYA 2HTME 1WH3A 1KFYB 4IW0A 3DBSA 2Z0DB 2KMCA 3D32A 2BVCA 5J18A 3RD2A 2KQ7A 4EE2A 3A1QB 2KQ4X 4W9LA 3RNGC 2K8BA 4WWMA 4YSZB 4JWSC 3RZWC 3U4EG 1D6EC 2JQRB 3PS6A 1I4HA 2INDC 4A90A 2KDIA 4LK0M 3M62B 3R8BA 3KUDB 2LGDA 1VJKA 1BUIC 1C3TA 3AN1A 1DOYA 4HDOA 1GAQB 2K8CA 3V61A 1ZDXA 2KXJA 1SB3C 2N9PC 4WJQA 1JROA 3AE9B 4MGZE 4X57B 3DVNV 2I38A 4HXDA 4ZHOA 2X8XX 3U7ZA 4PK1A 4C00A 1V8CA 4EOYA 4JWUC 3DHIC 3PRPB 2IZVB 2L3ZA 1QKZA 2FIDA 2LRUA 1L4ZB 4FADA 1ZW7A 2NVUI 2O6VB 1JMLA 1JRPA 3BIID 4XYCA 4ZDVA 2DBYA 1PYWD 2JY6A 2MWSB 4KV2A 1C78A 3R7RA 1R7SA 1N63A 2C7MB 2C5LC 1V9JA 1XCQL 1RWSA 4FJYA 5HI1A 1DYQA 3BK1A 1UH6A 1P3QU 4YTPB 2G1EA 4EFOA 3IAS1 3Q69A 1EM7A 1QOFA 1Y56A 1KM7A 1L0XB 1WXQA 2QCZA 4LDTB 2J0MA 2KOXA 4C7YA 2YLMA 4WWOA 4YL8A 4ANUA 2IGHA 2BYFA 3B2GA 3N30A 4E74A 1XT9B 3LB8C 3RCZA 3T3OA 1FIQA 3APCA 2JXTA 1E0ZA 2XNAC 2L32A 4ZHPA 1K53A 2JT4B 4BZAA 3VR8B 1NI2A 3AEBB 3P42A 4P16A 4BBNF 3A9KB 4OVZA 3AE6B 3Q3NC 3GZNB 4HWIB 5KHQA 1K51A 2H89B 3CIRB 4G3XB 1SJED 2FCMA 3W1SC 3A9KA 3QX1A 3C19A 1XEEA 5E6PA 5JXVA 1V2YA 2DZKA 1FMAD 2VH1A 2FBWB 2VZKB 3EHVA 2KFJA 3BWUD 1OGWA 2SAKA 1GG3A 3VRAB 4PYZA 4I6LB 4NY0A 4XDDA 1ET9A 1MJDA 2BYVE 1DOIA 4MGKE 2ZJDA 1KF6B 3WANA 2M19A 1UD7A 1ZXHA 4MSQB 4NJ7A 1GB4A 1FEHA 1SXTA 4OVUA 1PQSA 4XZ4A 1ET6A 2MH7A 1P0RA 2JYEA 4BKSA 3M95A 2D10A 4A20A 1IGDA 4HJKA 2Y5PA 2AQ3B 4ANXA 4RF1A 4G11A 4IM3A 3QWZB 2IO0B 1XCTL 4TSSA 1F1HA 3BK2A 3DHHC 4A3OA 2KZRA 2Y5BB 2KDBA 3P4PB 4PYUA 2HD5B 2I2YA 3NS8A 4L23A 4ZOHC 3ECIA 2JWUA 4EKUA 1E8XA 4H2AA 3BINA 4URKA 3MJWA 2IY1B 4GB9A 1L7YA 2J0JA 3AEFB 1EO6A 3AE2B 2IO1B 4IM0A 3PLVA 2WHIA 5CHFA 5EE9A 4RH6A 1D4BA 5CHWA 5E6JA 4AQ7A 2D3GA 4NNJB 2A5UA 1AWDA 2K6DB 3ZTCA 1XD3B 2GMIC 2GOWA 3R7QA 4WWPA 1C1YB 4K7SA 2M0AA 1WXVA 3P4SB 1UNSA 3L0WB 5C2TB 3DPDA 4LJOB 5TR5A 5EE3A 3VTUA 4BOZB 3ZW3A 2KYWA 4DXAB 3HHMA 1WGRA 3QHTA 3PHWB 3DBLB 4GIVA 3RFZB 5IAAC 2INNE 4MSMB 1JRUA 4YTMB 2G4SA 1E7UA 2DNFA 4WAFA 3PV1A 1Q5WB 4JLCA 4DHJD 4J6IA 2KDEB 1P7FA 3TJPA 1LFDA 1NVID 3TMPB 2PKOA 3PVLA 3X23A 4A9AA 4RGMA 2J42A 2AX5A 1GNUA 2HE7A 3VUWA 4IWQA 1N5WA 3A9JB 3QK0A 1TJEA 1R4NB 1SGHA 3E56A 1E8ZA 4HVBA 2C60A 4JPSA 1MG8A 2L52A 2MBHA 3SR6A 2FE8A 3Q8CA 4L1BA 2DWQA 2REXA 1T0SC 2BB6A 1HTOA 4II3B 2BKRB 4REZA 4I6NB 4BKTA 3CF6E 1NI3A 4MACA 4HPPA 1V6EA 2WDTB 4GDLB 4AUQC 1N61A 2LWPA 3TEWA 1JWBD 2IY0B 1WMHB 4DDGD 1V80A 2WXHA 1XLOA 1YJIA 2EKIA 5C23A 2XK5B 1R4NI 3AM9A 2G4DB 1WE7A 1OQRA 3IVFA 3WCQA 1SIFA 1IBXB 5HHDG 3AEDB 2XN9C 1K52A 1WWTA 3MHSD 5AZGA 4RCOA 1L6UA 2XK5A 3ZRFA 3ML8A 2E3TA 1V5OA 2AWTA 1KLGD 1M94A 2WDVB 2KVZA 3ZJVA 4GU2A 3HVDA 3R3MA 3OAWA 1JW9D 4IUMB 4FBJB 4KKJA 3KW5B 1KTKA 1C4AA 3CSFA 2D3CA 2PLPA 2RDHA 2ZPYA 4FLHA 3GP7A 1H4RA 2JSVX 2VH2A 3IT6B 4M8MA 2AL6A 4YTNB 3ZVVA 1K50A 3K9PB 5H92C 3OJ4B 3S2AA 3ZNZB 1SE9A 1YQ4B 4N6EB 5HFYA 3OG5A 2L83A 4P6VF 2WXPA 3UQBA 1C9FA 2GBJA 1V49A 1TYGB 3PZ7A 3QARA 2WQYB 1E10A 2PEAA 1UF0A 1A70A 3IBEA 4YSXB 4A55A 2N9LA 4PT5A 1IUEA 1ISNA 2HJ1A 4ANVA 1UGJA 2RSUA 1EUVB 3BZDB 1JALA 3KYDD 3Q6BA 4GXBA 3L08A 2FIFA 1V1PA 5IP4D 3WIMA 3MTNB 2WDQB 3VH3B 1C76A 1ZPSA 1WXAA 3N1YC 4M01A 2WXIA 5BYQA 1N6ZA 2CJOA 3KUZA 4KSLC 4KDLB 1AW7A 1R4MI 1YN5A 4C7ZA 2W82A 3IHPC 2V3SA 1T5XD 1HA5A 4WWNA 1TZ1A 1VDVA 1FCLA 2YEPF 2CJNA 2X38A 3I63C 3RNAC 1F2RI 1WYWB 3NG0A 2BKFA 4JE3B 4IC7B 3B1LX 4WURA 4TQ0A 1J7BA 1WM2A 3TEYA 2MJEA 3T3NA 1V97A 3WAOA 3BVZA 3GS2A 1LXDA 3RPFC 3VRBB 2AEHA 4ZRKA 3RT3B 3PHXB 2GB1A 4P1CC 4KVGB 4K1RB 3EFUA 3W1SA 2OOBB 4M8NA 3Q2AC 1E8WA 2HDEA 3B08A 1TKYA 2FNJB 3DHGC 1QILA 3QJZA 5D94A 2RGFA 5CX3A 4RM9A 3I57A 1MVKA 2LXCA 4GDKA 2XEWA 4W9KA 1SE2A 2WX0A 4PS7A 4QAYA 3RNEC 3ML9A 3AEEB 2DYMA 4ICUA 2LFIA 4MDKE 4JQWC 4WJNA 2LRWA 3RI7C 3UI3A 2N9XA 3RMKC 4OHJA 2I1JA 4KGRA 2LGXA 3TBLD 1QOBA 1Y8RC 3C0RB 4J3OD 1I4QA 1WX9A 1IYFA 3DVGX 2NTTA 1NDDA 2DX5B 4YXDB 4DHZE 3WALA 1SE4A 2IO2B 4DDID 3HIZA 1JWSD 2GRIA 3N1ZC 3UINB 1WY8A 5L83A 2MX2A 1E5WA 4WQMA 1ROEA 1VRAB 1LO5D 1FPYA 3ZXVA 3O13A 3KYCD 1U4AA 5C3JB 3DOWA 3H7PB 1JWUD 2H88B 4W9GA 2KMAA 2INPE 2M8SA 2N4FA 1XLQA 1J0GA 1TBEA 2BT6A 3A1QA 2R2QA 4S17A 4CHKA 4HLEA 3ZTDA 1GPXA 4CO7A 2AYOB 4FULA 2DAFA 3NY5A 4OZAA 4DXFA 5DPRA 2PVOD 1TY0A 3BVGA 5IO9A 2WXFA 4IM2A 3AULA 4HROA 3ZNGC 2J0KA 1EU3A 4W9JA 4RGOS 1E90A 2Y5CA 1H8CA 2LD9A 2EKEC 2JRIB 2JX5A 2KDFB 2RR9A 2R61A 2WXOA 1KOTA 2K8HA 2O6VA 2JRHA 3ABVB 5AEKB 1IPGA 1F2RC 4TUUA 1UWXA 2VRRB 3A4SC 2L05A 4LCDE 2LGIA 5BO4B 2KANA 4LNNA 3IXSA 5TSSA 4HPLB 1EWYC 1UZXB 4A6QA 2K22A 2K1FA 1I4PA 2KHWB 1HQRD 3A33B 3V6CB 3VUXA 3ONSA 3TUOA 4LNIA 1OTRB 2CHZA 2KN5A 1UUPA 2GBKA 5EE1A 1E9MA 3SFEB 2BTEA 3ZNHB 1EF5A 1WFYA 2LHEA 2WDRB 2LUMA 4F8CB 3PRZA 4ASWC 3V6EB 4KDIC 3AEAB 3DBHB 1FNUA 2BS4B 2KC1A 4DHJB 1F52A 5GXGB 3WAPA 1XLPA 1QZEA 3DBRB 3EGRA 2MBOA 1WX7A 2DYOA 3U8ZA 4DBGA 2NMQA 5IKCM 2ZCBA 3R2IA 2KLCA 3NOBA 1WM3A 1ZXIA 4K81A 3GOEA 2QSDA 2K9XA 2KLGA 2LJIA 3V62A 4BAXA 1DOXA 2ZNVC 3EUB2 4MH0E 4MGIE 4BBNC 1ZGUB 2JVCA 1WJ4A 3VR9B 3CSTA 3WA0A 3N20C 2DAJA 5IOIA 3ZLZA 3QA8A 3TEZA 4NQKE 1FXIA 2V3PA 4W9HA 3E9SA 2FCQA 3P63A 4ANWA 2WXQA 2BB5A 3DBHI 2ZZPB 3O65B 2MBEA 3LXFA 3DBRI 3AU4A 2K39A 3GZNI 4FA6A 3QCAA 1LGRA 2MCNB 2V3NA 2BW2A 4EUTA 2C9WB 2PPHA 2N9EB 3L17A 1YNTE 3RNFC 2W9NA 3MFGA 3URYA 1MFWA 4MT5A 4FJZA 4MJSB 2CR5A 2WLBA 3JVZX 3L10B 3RUIB 1KLUD 1C79A 1JWAD 3VAWA 1HZ5A 2I1KA 3ZYYX 3NZUA 3L16A 1JCKB 5IN7A 2K6QA 2NPTB 3X0WA 1ENFA 2A4ZA 5FKAC 2N9KA 1F0ZA 2M0XA 3ZQ4A 1FO4A 1YX6B 1MI0A 2WNMA 3DWMA 3I9V1 1YJJA 4ITKA 4P7IA 5BMGA 2NPTA 2NBUA 4OZCA 1E7PB 4ARIA 3PZ8A 4HDQA 3PO0A 1WI0A 4N59A 2KK8A 3H7SA 4IG7B 2UU7A 3L13A 4EZKA 1CZPA 3W5VB 4A8XC 4C80A 1Z2MA 4B9KA 2FUHB 2G45B 1CMXB 2YEPB 1ZUD2 2DLBA 4AWJA 3VTWA 1YIWA 2LVOA 4E3CA 1ZE3D 3PTFC 4ACFA 2EELA 3OWEB 3NZ3A 2CKHB 1RRBA 2KJHB 4FHJA 4FHKA 1SE3A 2MBBB 4PS8A 3VDZA 2N1VA 4LJPB 3UIPB 3VVWB 1J19A 5E6NA 3P2BA 3KWVA 1OEYA 5GMVA 2LVPA 2Z0EB 2J52A 3NS1A 4IDIA 2D2QA 3DBLI 1P9DU 2KD0A 5KHOA 1G6JA 1E7VA 1T0YA 2CU1A 2WWZA 3A9JA 3DDCB 3Q3JA 3AECB 1GC6A 1CJEA 3HK0A 2HTHA 1NYRA 4K7WA 3Q8EA 1MG4A 3EECA 3OLMD 3WAMA 1T0RC 3DCGA 3SD5A 4BKSD 1YMHE 1GC7A 1P1AA 4FJVB 3K9OB 5DPTA 3ZJUA 4LNOA 2RPVA 1D5MC 4ZYNA 2V9HA 1HEZE 2KX0A 2PTLA 3VH4B 2NCNA 4GDLA 1PGXA 2NS5A 2QHOA 2V0GA 3TSSA 4G0NB 2WU5B 2MP2B 1XQQA 1FRRA 2CHWA 1WMHA 3QC8B 2IYDB 3PZDA 5MPOA 3AXCA 3IFWB 1C4PA 3IG3A 5LXHA 1WX8A 1SBBB 4DXGA 2MP2A 1HZ6A 4RNAA 2ZCCA 4C4VB 4GOCA 1IBXA 4I6PA 3KQ4A 1WIAA 3PRMB 2M4NA 3L4PA 1WRIA 2WP9B 3KLSX 5LNK1 2M17A 2WXKA 3OJ3A 5AZHA 3LYYA 3A4RA 5BYSA 4BVUC 3ZO5B 4KGSA 4MH8A 2K25A 4C4VA 4PS3A 2FAZA 2NBWB 4KZCA 2NR2A 4A3PA 4LNFA 1FFVA 2CS4A 3AE8B 1FXTB 3VQIA 3AE4B 3N1XC 3MP9A 3HM6X 2GBNA 3JSVB 2IGDA 2ZPNA 2N1WA 1HE8A 1VZ7A 4LNKA 4HJGE 1L4DB 2ONQA 2JWZA 3AB5A 1YD8U 3JSVA 3Q3FA 3NUHB 2BPSA 1RFKA 4XE0A 1GJZA 3J9CA 2JPHA 1XF5L 5D3IB 3PLUA 3SHQA 1S1QB 4AP4C 1NBFC 2LXAA 4WJPA 1SJHD 4HRSA 1VLBA 4LLGM 4XDCA 4E71A 4RGTA 1SSNA 3T9LA 4GSWA 3LJ3A 5J2RA 4MM3B 1WGKA 3Q14C 4CQNA 1E6EB 1OQYA 2OHFA 1N62A 3AH7A 1T6BX 4JL9A 4ZYSA 1D5XC 4ZRIA 3RNBC 1VD2A 1OFFA 2MW5A 3MC9A 2JZZA 1GOZA 2UWQA
chains in the Genus database with same CATH topology
1I35A 4MM3A 4XC2A 2LJ5A 4HK2A 2DZJA 4NQLB 4II2B 3BY4B 4IM2A 3ALBA 3AULA 4A3OA 2KZRA 2Y5BB 2KDBA 4K7UA 3ZNGC 2KFKA 4PYUA 2J0KA 4W9JA 1E90A 4RMAA 2HD5B 1Q0WB 3NS8A 3ECIA 1H8CA 2C7NB 2LD9A 3ZKJC 4EKUA 1E8XA 2EKEC 2JRIB 3W1YA 3RYTA 2KDFB 3BINA 1WGGA 3MJWA 4URKA 1WRDB 2RR9A 2LZ6A 3QAQA 1LM8B 2ZNVB 1KOTA 2IY1B 1L2NA 2EMTA 4GB9A 2K8HA 1L7YA 2J7QB 2J0JA 2JRHA 2O6VA 2GBMA 3DQVA 3ZDMC 1WR1A 4EZJA 1EO6A 3UGBB 5AEKB 1IPGA 4TUUA 2ZVOA 2IO1B 4IM0A 2VRRB 3A4SC 3PLVA 2L05A 4BKGA 4LCDE 4GN1A 2V1YA 5BO4B 2KANA 5CHFA 5CHVC 2LGYA 4HPLB 2YVCA 1UZXB 1UELA 5CHWA 2D3GA 3KH0A 2K1FA 4M0WB 4NNJB 2A5UA 2K6DB 5IA7A 2KHWB 2PE6B 3ZTCA 3A33B 1XD3B 2GMIC 3V6CB 3VUXA 3ONSA 4DWFA 2GOWA 2KJRA 3R7QA 3M3JA 4WWPA 2KC2A 1OTRB 1C1YB 2CHZA 2JXXA 2ASQA 2KN5A 4K7SA 1ZKHA 2MBQA 4W9EA 2GBKA 1WXVA 4KIKB 5FR6A 5JH5C 4EZLA 3L0WB 1WF9A 3DPDA 4LJOB 5TR5A 3ZDTA 1V5TA 3VTUA 2LI5A 1EF5A 3ZNHB 4BOZB 3N32A 1WFYA 2ZVNA 3ZW3A 4DXAB 4MELA 1I42A 3AI5A 3HHMA 3CMMB 2L00B 3U7DA 1WGRA 4CYEA 3QHTA 3PHWB 4ICVA 4GIVA 4F8CB 3PRZA 4W9IA 5IAAC 4ASWC 2IO3B 4MSMB 4JGHB 3V6EB 1JRUA 4MGYE 2KTRB 4IWPA 4KDIC 2R2OA 2BF8B 4WQOB 4DHJB 2KC1A 4OVVA 2FCNA 2G4SA 3WAPA 5D7GA 4GMVA 2KKCA 1QZEA 1V86A 1E7UA 3QIJA 2KNBA 2MBOA 1WX7A 1WXSA 4F1SA 1UBQA 3ZUNA 4NJ6A 2L8JA 2DYOA 3PV1A 1Q5WB 2KTRA 3U8ZA 3ZIMA 4DBGA 4JLCA 3APFA 1WJNA 1X1MA 2LASA 4DHJD 2ZCBA 3PSEB 4J6IA 1D3ZA 1TTNA 2KDEB 3TJPA 2KVRA 4AJWA 1WGDA 3UF8A 1LFDA 2KLCA 2CHXA 2RD0A 3TMPB 3PVLA 3NOBA 4MEMA 4WJOA 5EDSA 2NBVB 3X23A 3APDA 1WM3A 1UGMA 4XX5A 4K81A 2LVQA 2PE9A 1Z5SB 3GOEA 2PJHA 1GNUA 4HCPB 2KLGA 3V62A 2HE7A 3VUWA 2KWCA 3NZSA 2O2VB 3H9DA 4IWQA 2ZNVC 3A9JB 3QK0A 4MH0E 4MGIE 4BBNC 1ZGUB 2JVCA 1SGHA 1WJ4A 3CSTA 3WA0A 3UIOB 2DAJA 1E8ZA 3H7PA 1WXMA 2KWUB 3ZLZA 3QA8A 4NQKE 4HVBA 4W9HA 1S3SG 3ENEA 4B95A 2C60A 1MG8A 2O2VA 4W9CA 3SDLC 2MBHA 4BFRA 2FCQA 5G55A 4ANWA 2MSED 5CTRC 3UQAA 3DBHI 2ZZPB 2MA9B 2REXA 3JW0X 2UYZB 3O65B 2MBEA 3DBRI 4HCNB 1RFAA 2DZMA 3AU4A 3TIXA 2K39A 4II3B 1BT0A 1P98A 3GZNI 4F7ZA 3QCAA 5DPSA 4FA6A 2BKRB 1GUAB 3KVFB 2MCNB 4I6NB 4BKTA 4EUTA 2C9WB 2PPHA 2N9EB 2L7RA 3CF6E 3L17A 1V6EA 3U30A 2WDTB 4GDLB 4HPMB 2KO3A 4AUQC 1WGHA 2W9NA 2LWPA 1IP9A 4FJZA 4MJSB 2IY0B 1WMHB 4DDGD 2CR5A 4EEWA 3JVZX 3L10B 5G2NA 1V80A 4AOFA 3RUIB 3RULA 3VAWA 3QQ8B 5C23A 2I1KA 2XK5B 4ZRJA 3NZUA 3L16A 2C7HA 1R4NI 3KUCB 2EMSA 2KX3A 2V4LA 2G4DB 1WE7A 3IVFA 1SIFA 4TQ1A 3L54A 3QWZB 2K6QA 4GDKB 2NPTB 3X0WA 2A4ZA 3MHSD 2DYBA 5AZGA 4FN2A 2M0XA 2XK5A 3ZRFA 3ML8A 3R66C 1V5OA 1J8CA 5JHBA 5HKHA 2JZ3B 3SU8X 1YX6B 2AWTA 3M63B 1M94A 5DPWA 3I3TB 4GU2A 4P7IA 4TV3A 2NPTA 2OJRA 3JYUA 2NBUA 3R3MA 3RZFA 4HDQA 3OAWA 4IUMB 5LLIA 1WI0A 4FBJB 3KW5B 4KIKA 2RPQA 2KK8A 3CSFA 4KSKC 5C1ZA 2L76A 4JIOU 3H7SA 4IG7B 2AL3A 1KJTA 2LUEA 4B6WA 2ZPYA 3VUYA 4FLHA 3L13A 4EZKA 1H4RA 3ZRCA 5AZFA 4M8MA 5DCNA 1WZ0A 2AL6A 3VXWA 3ZVVA 2BGFA 1AARA 1Q1OA 1Z2MA 3K9PB 3OJ4B 3S2AA 5JZEB 2BWFA 1WE6A 4B9KA 3ZNZB 2FUHB 1SE9A 2G45B 2B3AA 1CMXB 3PGEA 2BYEA 2IBIB 4W9FA 2L0FA 3DVGY 4G50A 2FCSA 4AWJA 3VTWA 1KLVA 1YIWA 3UQBA 2GBJA 1V49A 1K8RB 5E6OA 2LVOA 3QARA 2D11A 3TCAA 4E3CA 3NHEB 2KJ6A 3PTFC 1WH3A 2PEAA 2CKHB 3IBEA 1RRBA 2KJHB 4FHJA 4FHKA 4IW0A 2MBBB 2MRPA 3DBSA 4PS8A 5J17A 3VDZA 2Z0DB 2N1VA 4LJPB 1ISNA 1UBIA 3UIPB 2KMCA 2DHZA 3D32A 2JUOA 3VVWB 1J19A 2RSUA 3P2BA 2KQ7A 5D6JB 1EUVB 5E6NA 3RD2A 3A1QB 3KYDD 4W9LA 4GXBA 3L08A 2FIFA 2DENB 3PT2B 1OEYA 2N7EA 5GMVA 1WJ6A 2K8BA 3WIMA 1TGZB 2LVPA 2Z0EB 3MTNB 3RZWC 3VH3B 2D2QA 3DBLI 1P9DU 2KD0A 3PS6A 5KHOA 1G6JA 1E7VA 1T0YA 1WXAA 2CU1A 2KDIA 2WWZA 3A9JA 3M62B 3DDCB 3DVNU 3Q3JA 3KUDB 3KUZA 1GC6A 2KWVB 2LGDA 4KDLB 4KSLC 2M1MA 1C3TA 3HK0A 1R4MI 2HTHA 4K7WA 4GGQA 4HDOA 1V81A 2K8CA 3V61A 3EECA 3IHPC 2KXJA 2V3SA 2WYQA 3OLMD 3ZNID 4WWNA 2N9PC 2WX1A 1TZ1A 3DCGA 4WJQA 3SD5A 3T8MA 4MGZE 4X57B 3WAMA 4BKSD 1GC7A 3DVNV 1P1AA 1WYWB 2D07B 4FJVB 4HXDA 2BKFA 4IC7B 3B1LX 3K9OB 4TQ0A 5LXIB 5DPTA 1WM2A 4EOYA 3PRPB 2IZVB 3VHTC 2L3ZA 1F9JA 2FIDA 4ZYNA 2LRUA 3WAOA 4FADA 1WGYA 1ZW7A 2NVUI 1VCBA 2O6VB 2KX0A 1LXDA 2AEHA 4ZRKA 3RT3B 3PHXB 3VH4B 2NCNA 4KVGB 4K1RB 4IWOA 3TL5A 4GDLA 3EFUA 2NS5A 2QHOA 2OOBB 4M8NA 3W1SA 4DK5A 4G0NB 5JHAA 1A5RA 4ZDVA 1E8WA 2MP2B 1XQQA 3HM3A 2CHWA 4MJSA 2O6VD 2JY6A 3V60A 3B08A 2MWSB 4KV2A 1WMHA 2FNJB 3QC8B 2IYDB 3R7RA 3QJZA 3PZDA 5D94A 3AXCA 1WJUA 2C7MB 3H1UA 2MLBA 3IFWB 5D2MB 3IG3A 2C5LC 2RGFA 5LXHA 1V9JA 5CX3A 4FJYA 4RM9A 1WX8A 2MP2A 1UH6A 5J18A 1RLFA 1P3QU 4N9F4 1LQBA 2ZCCA 4EFOA 4NPNA 4GOCA 2XBBC 2LXCA 4GDKA 4I6PA 1WIAA 2DZIA 2XEWA 1YJ1A 3AU5A 2BWES 2L0TA 3PRMB 3PREA 2M4NA 4W9KA 4BOSC 2WX0A 1KM7A 2M17A 3OJ3A 4PS7A 3EC8A 5AZHA 4NAWB 4TKNA 3ML9A 4LDTB 2DYMA 2J0MA 2KOXA 3A4RA 4ICUA 4BVUC 3ZO5B 2K25A 2YLMA 4WWOA 4YL8A 4ANUA 4MDKE 4DHZB 4PS3A 2FAZA 2BYFA 2NBWB 4JQWC 2LRWA 4WJNA 2N9XA 4KZCA 3N30A 2NR2A 4E74A 1XT9B 4A3PA 4LDTD 2I1JA 1RAXA 4NAWA 3RCZA 2CS4A 2KTFA 1YQBA 1FXTB 2MQJA 3APCA 2LGXA 3TBLD 1Y8RC 3C0RB 3VQIA 4AJYB 2JT4B 1OEYJ 2GBNA 3HM6X 3JSVB 2HJ8A 2GBRA 1NI2A 2ZPNA 1WX9A 2N1WA 1IYFA 3DVGX 1HE8A 4BBNF 3A9KB 1NDDA 2DX5B 4DHZE 3WALA 1EF1A 2IO2B 3VTVA 1WZ3A 2G3QB 2JWZA 4DDID 4HWIB 3HIZA 5KHQA 1YD8U 3JSVA 3Q3FA 2BPSA 4G3XB 2FCMA 3W1SC 2Z59B 3UINB 1WY8A 5L83A 2KQSA 2MX2A 1E5WA 3A9KA 1E8YA 1GJZA 3QX1A 2JPHA 5L95C 3PLUA 3SHQA 2ZEQA 1S1QB 5E6PA 1V2YA 2DZKA 4AP4C 4W9DA 4KZ0A 1NBFC 3N3KB 3KYCD 3EHVA 1U4AA 2LXAA 4WJPA 3DOWA 2KFJA 3H7PB 3PPAA 3B0AA 4RM8A 1OGWA 4W9GA 2KMAA 1GG3A 2JF5A 2N7DA 4PYZA 4ANVA 2M8SA 4I6LB 2N4FA 3LDZE 4NY0A 1J0GA 1TBEA 4E71A 2BYVE 3A1QA 2R2QA 3T9LA 4GSWA 4MGKE 2ZJDA 3LJ3A 5J2RA 4CHKA 3WANA 4HLEA 4WAAA 1UD7A 4MSQB 4NJ7A 3ZTDA 4OVUA 1OQYA 1PQSA 4XZ4A 1WR6E 4JL9A 1P0RA 3VFKA 4CO7A 2KFKB 2AYOB 2DAFA 1YX5B 3NY5A 4FULA 4ZRIA 1VD2A 3H6NA 4BKSA 2MW5A 3M95A 2D10A 4A20A 2JZZA 4HJKA 4ANXA 5DPRA 2UWQA 4G11A 4IM3A 2IO0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I35 A;  4MM3 A;  4XC2 A;  2LJ5 A;  4HK2 A;  2DZJ A;  4NQL B;  4II2 B;  3BY4 B;  4IM2 A;  3ALB A;  3AUL A;  4A3O A;  2KZR A;  2Y5B B;  2KDB A;  4K7U A;  3ZNG C;  2KFK A;  4PYU A;  2J0K A;  4W9J A;  1E90 A;  4RMA A;  2HD5 B;  1Q0W B;  3NS8 A;  3ECI A;  1H8C A;  2C7N B;  2LD9 A;  3ZKJ C;  4EKU A;  1E8X A;  2EKE C;  2JRI B;  3W1Y A;  3RYT A;  2KDF B;  3BIN A;  1WGG A;  3MJW A;  4URK A;  1WRD B;  2RR9 A;  2LZ6 A;  3QAQ A;  1LM8 B;  2ZNV B;  1KOT A;  2IY1 B;  1L2N A;  2EMT A;  4GB9 A;  2K8H A;  1L7Y A;  2J7Q B;  2J0J A;  2JRH A;  2O6V A;  2GBM A;  3DQV A;  3ZDM C;  1WR1 A;  4EZJ A;  1EO6 A;  3UGB B;  5AEK B;  1IPG A;  4TUU A;  2ZVO A;  2IO1 B;  4IM0 A;  2VRR B;  3A4S C;  3PLV A;  2L05 A;  4BKG A;  4LCD E;  4GN1 A;  2V1Y A;  5BO4 B;  2KAN A;  5CHF A;  5CHV C;  2LGY A;  4HPL B;  2YVC A;  1UZX B;  1UEL A;  5CHW A;  2D3G A;  3KH0 A;  2K1F A;  4M0W B;  4NNJ B;  2A5U A;  2K6D B;  5IA7 A;  2KHW B;  2PE6 B;  3ZTC A;  3A33 B;  1XD3 B;  2GMI C;  3V6C B;  3VUX A;  3ONS A;  4DWF A;  2GOW A;  2KJR A;  3R7Q A;  3M3J A;  4WWP A;  2KC2 A;  1OTR B;  1C1Y B;  2CHZ A;  2JXX A;  2ASQ A;  2KN5 A;  4K7S A;  1ZKH A;  2MBQ A;  4W9E A;  2GBK A;  1WXV A;  4KIK B;  5FR6 A;  5JH5 C;  4EZL A;  3L0W B;  1WF9 A;  3DPD A;  4LJO B;  5TR5 A;  3ZDT A;  1V5T A;  3VTU A;  2LI5 A;  1EF5 A;  3ZNH B;  4BOZ B;  3N32 A;  1WFY A;  2ZVN A;  3ZW3 A;  4DXA B;  4MEL A;  1I42 A;  3AI5 A;  3HHM A;  3CMM B;  2L00 B;  3U7D A;  1WGR A;  4CYE A;  3QHT A;  3PHW B;  4ICV A;  4GIV A;  4F8C B;  3PRZ A;  4W9I A;  5IAA C;  4ASW C;  2IO3 B;  4MSM B;  4JGH B;  3V6E B;  1JRU A;  4MGY E;  2KTR B;  4IWP A;  4KDI C;  2R2O A;  2BF8 B;  4WQO B;  4DHJ B;  2KC1 A;  4OVV A;  2FCN A;  2G4S A;  3WAP A;  5D7G A;  4GMV A;  2KKC A;  1QZE A;  1V86 A;  1E7U A;  3QIJ A;  2KNB A;  2MBO A;  1WX7 A;  1WXS A;  4F1S A;  1UBQ A;  3ZUN A;  4NJ6 A;  2L8J A;  2DYO A;  3PV1 A;  1Q5W B;  2KTR A;  3U8Z A;  3ZIM A;  4DBG A;  4JLC A;  3APF A;  1WJN A;  1X1M A;  2LAS A;  4DHJ D;  2ZCB A;  3PSE B;  4J6I A;  1D3Z A;  1TTN A;  2KDE B;  3TJP A;  2KVR A;  4AJW A;  1WGD A;  3UF8 A;  1LFD A;  2KLC A;  2CHX A;  2RD0 A;  3TMP B;  3PVL A;  3NOB A;  4MEM A;  4WJO A;  5EDS A;  2NBV B;  3X23 A;  3APD A;  1WM3 A;  1UGM A;  4XX5 A;  4K81 A;  2LVQ A;  2PE9 A;  1Z5S B;  3GOE A;  2PJH A;  1GNU A;  4HCP B;  2KLG A;  3V62 A;  2HE7 A;  3VUW A;  2KWC A;  3NZS A;  2O2V B;  3H9D A;  4IWQ A;  2ZNV C;  3A9J B;  3QK0 A;  4MH0 E;  4MGI E;  4BBN C;  1ZGU B;  2JVC A;  1SGH A;  1WJ4 A;  3CST A;  3WA0 A;  3UIO B;  2DAJ A;  1E8Z A;  3H7P A;  1WXM A;  2KWU B;  3ZLZ A;  3QA8 A;  4NQK E;  4HVB A;  4W9H A;  1S3S G;  3ENE A;  4B95 A;  2C60 A;  1MG8 A;  2O2V A;  4W9C A;  3SDL C;  2MBH A;  4BFR A;  2FCQ A;  5G55 A;  4ANW A;  2MSE D;  5CTR C;  3UQA A;  3DBH I;  2ZZP B;  2MA9 B;  2REX A;  3JW0 X;  2UYZ B;  3O65 B;  2MBE A;  3DBR I;  4HCN B;  1RFA A;  2DZM A;  3AU4 A;  3TIX A;  2K39 A;  4II3 B;  1BT0 A;  1P98 A;  3GZN I;  4F7Z A;  3QCA A;  5DPS A;  4FA6 A;  2BKR B;  1GUA B;  3KVF B;  2MCN B;  4I6N B;  4BKT A;  4EUT A;  2C9W B;  2PPH A;  2N9E B;  2L7R A;  3CF6 E;  3L17 A;  1V6E A;  3U30 A;  2WDT B;  4GDL B;  4HPM B;  2KO3 A;  4AUQ C;  1WGH A;  2W9N A;  2LWP A;  1IP9 A;  4FJZ A;  4MJS B;  2IY0 B;  1WMH B;  4DDG D;  2CR5 A;  4EEW A;  3JVZ X;  3L10 B;  5G2N A;  1V80 A;  4AOF A;  3RUI B;  3RUL A;  3VAW A;  3QQ8 B;  5C23 A;  2I1K A;  2XK5 B;  4ZRJ A;  3NZU A;  3L16 A;  2C7H A;  1R4N I;  3KUC B;  2EMS A;  2KX3 A;  2V4L A;  2G4D B;  1WE7 A;  3IVF A;  1SIF A;  4TQ1 A;  3L54 A;  3QWZ B;  2K6Q A;  4GDK B;  2NPT B;  3X0W A;  2A4Z A;  3MHS D;  2DYB A;  5AZG A;  4FN2 A;  2M0X A;  2XK5 A;  3ZRF A;  3ML8 A;  3R66 C;  1V5O A;  1J8C A;  5JHB A;  5HKH A;  2JZ3 B;  3SU8 X;  1YX6 B;  2AWT A;  3M63 B;  1M94 A;  5DPW A;  3I3T B;  4GU2 A;  4P7I A;  4TV3 A;  2NPT A;  2OJR A;  3JYU A;  2NBU A;  3R3M A;  3RZF A;  4HDQ A;  3OAW A;  4IUM B;  5LLI A;  1WI0 A;  4FBJ B;  3KW5 B;  4KIK A;  2RPQ A;  2KK8 A;  3CSF A;  4KSK C;  5C1Z A;  2L76 A;  4JIO U;  3H7S A;  4IG7 B;  2AL3 A;  1KJT A;  2LUE A;  4B6W A;  2ZPY A;  3VUY A;  4FLH A;  3L13 A;  4EZK A;  1H4R A;  3ZRC A;  5AZF A;  4M8M A;  5DCN A;  1WZ0 A;  2AL6 A;  3VXW A;  3ZVV A;  2BGF A;  1AAR A;  1Q1O A;  1Z2M A;  3K9P B;  3OJ4 B;  3S2A A;  5JZE B;  2BWF A;  1WE6 A;  4B9K A;  3ZNZ B;  2FUH B;  1SE9 A;  2G45 B;  2B3A A;  1CMX B;  3PGE A;  2BYE A;  2IBI B;  4W9F A;  2L0F A;  3DVG Y;  4G50 A;  2FCS A;  4AWJ A;  3VTW A;  1KLV A;  1YIW A;  3UQB A;  2GBJ A;  1V49 A;  1K8R B;  5E6O A;  2LVO A;  3QAR A;  2D11 A;  3TCA A;  4E3C A;  3NHE B;  2KJ6 A;  3PTF C;  1WH3 A;  2PEA A;  2CKH B;  3IBE A;  1RRB A;  2KJH B;  4FHJ A;  4FHK A;  4IW0 A;  2MBB B;  2MRP A;  3DBS A;  4PS8 A;  5J17 A;  3VDZ A;  2Z0D B;  2N1V A;  4LJP B;  1ISN A;  1UBI A;  3UIP B;  2KMC A;  2DHZ A;  3D32 A;  2JUO A;  3VVW B;  1J19 A;  2RSU A;  3P2B A;  2KQ7 A;  5D6J B;  1EUV B;  5E6N A;  3RD2 A;  3A1Q B;  3KYD D;  4W9L A;  4GXB A;  3L08 A;  2FIF A;  2DEN B;  3PT2 B;  1OEY A;  2N7E A;  5GMV A;  1WJ6 A;  2K8B A;  3WIM A;  1TGZ B;  2LVP A;  2Z0E B;  3MTN B;  3RZW C;  3VH3 B;  2D2Q A;  3DBL I;  1P9D U;  2KD0 A;  3PS6 A;  5KHO A;  1G6J A;  1E7V A;  1T0Y A;  1WXA A;  2CU1 A;  2KDI A;  2WWZ A;  3A9J A;  3M62 B;  3DDC B;  3DVN U;  3Q3J A;  3KUD B;  3KUZ A;  1GC6 A;  2KWV B;  2LGD A;  4KDL B;  4KSL C;  2M1M A;  1C3T A;  3HK0 A;  1R4M I;  2HTH A;  4K7W A;  4GGQ A;  4HDO A;  1V81 A;  2K8C A;  3V61 A;  3EEC A;  3IHP C;  2KXJ A;  2V3S A;  2WYQ A;  3OLM D;  3ZNI D;  4WWN A;  2N9P C;  2WX1 A;  1TZ1 A;  3DCG A;  4WJQ A;  3SD5 A;  3T8M A;  4MGZ E;  4X57 B;  3WAM A;  4BKS D;  1GC7 A;  3DVN V;  1P1A A;  1WYW B;  2D07 B;  4FJV B;  4HXD A;  2BKF A;  4IC7 B;  3B1L X;  3K9O B;  4TQ0 A;  5LXI B;  5DPT A;  1WM2 A;  4EOY A;  3PRP B;  2IZV B;  3VHT C;  2L3Z A;  1F9J A;  2FID A;  4ZYN A;  2LRU A;  3WAO A;  4FAD A;  1WGY A;  1ZW7 A;  2NVU I;  1VCB A;  2O6V B;  2KX0 A;  1LXD A;  2AEH A;  4ZRK A;  3RT3 B;  3PHX B;  3VH4 B;  2NCN A;  4KVG B;  4K1R B;  4IWO A;  3TL5 A;  4GDL A;  3EFU A;  2NS5 A;  2QHO A;  2OOB B;  4M8N A;  3W1S A;  4DK5 A;  4G0N B;  5JHA A;  1A5R A;  4ZDV A;  1E8W A;  2MP2 B;  1XQQ A;  3HM3 A;  2CHW A;  4MJS A;  2O6V D;  2JY6 A;  3V60 A;  3B08 A;  2MWS B;  4KV2 A;  1WMH A;  2FNJ B;  3QC8 B;  2IYD B;  3R7R A;  3QJZ A;  3PZD A;  5D94 A;  3AXC A;  1WJU A;  2C7M B;  3H1U A;  2MLB A;  3IFW B;  5D2M B;  3IG3 A;  2C5L C;  2RGF A;  5LXH A;  1V9J A;  5CX3 A;  4FJY A;  4RM9 A;  1WX8 A;  2MP2 A;  1UH6 A;  5J18 A;  1RLF A;  1P3Q U;  4N9F 4;  1LQB A;  2ZCC A;  4EFO A;  4NPN A;  4GOC A;  2XBB C;  2LXC A;  4GDK A;  4I6P A;  1WIA A;  2DZI A;  2XEW A;  1YJ1 A;  3AU5 A;  2BWE S;  2L0T A;  3PRM B;  3PRE A;  2M4N A;  4W9K A;  4BOS C;  2WX0 A;  1KM7 A;  2M17 A;  3OJ3 A;  4PS7 A;  3EC8 A;  5AZH A;  4NAW B;  4TKN A;  3ML9 A;  4LDT B;  2DYM A;  2J0M A;  2KOX A;  3A4R A;  4ICU A;  4BVU C;  3ZO5 B;  2K25 A;  2YLM A;  4WWO A;  4YL8 A;  4ANU A;  4MDK E;  4DHZ B;  4PS3 A;  2FAZ A;  2BYF A;  2NBW B;  4JQW C;  2LRW A;  4WJN A;  2N9X A;  4KZC A;  3N30 A;  2NR2 A;  4E74 A;  1XT9 B;  4A3P A;  4LDT D;  2I1J A;  1RAX A;  4NAW A;  3RCZ A;  2CS4 A;  2KTF A;  1YQB A;  1FXT B;  2MQJ A;  3APC A;  2LGX A;  3TBL D;  1Y8R C;  3C0R B;  3VQI A;  4AJY B;  2JT4 B;  1OEY J;  2GBN A;  3HM6 X;  3JSV B;  2HJ8 A;  2GBR A;  1NI2 A;  2ZPN A;  1WX9 A;  2N1W A;  1IYF A;  3DVG X;  1HE8 A;  4BBN F;  3A9K B;  1NDD A;  2DX5 B;  4DHZ E;  3WAL A;  1EF1 A;  2IO2 B;  3VTV A;  1WZ3 A;  2G3Q B;  2JWZ A;  4DDI D;  4HWI B;  3HIZ A;  5KHQ A;  1YD8 U;  3JSV A;  3Q3F A;  2BPS A;  4G3X B;  2FCM A;  3W1S C;  2Z59 B;  3UIN B;  1WY8 A;  5L83 A;  2KQS A;  2MX2 A;  1E5W A;  3A9K A;  1E8Y A;  1GJZ A;  3QX1 A;  2JPH A;  5L95 C;  3PLU A;  3SHQ A;  2ZEQ A;  1S1Q B;  5E6P A;  1V2Y A;  2DZK A;  4AP4 C;  4W9D A;  4KZ0 A;  1NBF C;  3N3K B;  3KYC D;  3EHV A;  1U4A A;  2LXA A;  4WJP A;  3DOW A;  2KFJ A;  3H7P B;  3PPA A;  3B0A A;  4RM8 A;  1OGW A;  4W9G A;  2KMA A;  1GG3 A;  2JF5 A;  2N7D A;  4PYZ A;  4ANV A;  2M8S A;  4I6L B;  2N4F A;  3LDZ E;  4NY0 A;  1J0G A;  1TBE A;  4E71 A;  2BYV E;  3A1Q A;  2R2Q A;  3T9L A;  4GSW A;  4MGK E;  2ZJD A;  3LJ3 A;  5J2R A;  4CHK A;  3WAN A;  4HLE A;  4WAA A;  1UD7 A;  4MSQ B;  4NJ7 A;  3ZTD A;  4OVU A;  1OQY A;  1PQS A;  4XZ4 A;  1WR6 E;  4JL9 A;  1P0R A;  3VFK A;  4CO7 A;  2KFK B;  2AYO B;  2DAF A;  1YX5 B;  3NY5 A;  4FUL A;  4ZRI A;  1VD2 A;  3H6N A;  4BKS A;  2MW5 A;  3M95 A;  2D10 A;  4A20 A;  2JZZ A;  4HJK A;  4ANX A;  5DPR A;  2UWQ A;  4G11 A;  4IM3 A;  2IO0 B; 
#chains in the Genus database with same CATH topology
 1I35 A;  4MM3 A;  2LJ5 A;  2DZJ A;  3ZXR A;  3HRD D;  3BY4 B;  3ALB A;  1BML C;  1QOG A;  4K7U A;  2M56 B;  1KH0 A;  1Q0W B;  4FXC A;  2BQQ A;  3W1Y A;  3RYT A;  1WGG A;  2LZ6 A;  3QAQ A;  1LM8 B;  2ZNV B;  4EZJ A;  2GBM A;  3DQV A;  3AE5 B;  4BKG A;  4L2Y A;  4GN1 A;  2V1Y A;  4D2K A;  2W3S A;  1UEL A;  1EU4 A;  4M0W B;  1IGC A;  5IA7 A;  2PE6 B;  2PMV A;  2RDB C;  4DWF A;  2SEB D;  2KC2 A;  3AMZ A;  2MBQ A;  4KIK B;  5FR6 A;  3FKY A;  5JH5 C;  4M0W A;  1WF9 A;  4YSY B;  1V5T A;  1FRD A;  1N60 A;  3ZJT A;  2ZVN A;  3B9J A;  4MEL A;  1I42 A;  3FC4 A;  3I5J C;  1I4X A;  3CMM B;  2L00 B;  3U7D A;  5G5H A;  1CQV A;  1NYQ A;  2LHD A;  4W9I A;  4JGH B;  1FD6 A;  4IWP A;  2BF8 B;  2QJL A;  1QF6 A;  4OVV A;  4GMV A;  3QIJ A;  1QQR A;  5AUK A;  3V05 A;  3HUI A;  1WXS A;  3RNC C;  4F1S A;  3ZUN A;  4NJ6 A;  2L8J A;  1J7A A;  4S0R A;  3ZIM A;  1TS4 A;  2J53 A;  1AN8 A;  2LAS A;  1D3Z A;  1TTN A;  4AJW A;  2GI9 A;  4MEM A;  5EDS A;  2NBV B;  4HKZ E;  5D3D A;  3H9D A;  3P1M A;  5HG2 A;  4XWT A;  3H7P A;  2KAJ A;  1WXM A;  4RFB A;  2KWU B;  1TIF A;  2K0P A;  1S3S G;  1VZ8 A;  4OW0 A;  1HXY D;  4W9C A;  4B0E A;  4BFR A;  4NJC A;  2MSE D;  3UQA A;  2D3B A;  1TZO A;  4HCN B;  1RFA A;  1BT0 A;  1P98 A;  4F7Z A;  1ESF A;  1GUA B;  3KVF B;  4LTU A;  2K3U A;  2L7R A;  3U30 A;  4HPM B;  2KO3 A;  3NVV A;  4GLS C;  1IP9 A;  4B0M A;  4EEW A;  3MC8 A;  5G2N A;  3RUL A;  3QQ8 B;  4ZRJ A;  3R2T A;  1ZOY B;  2EMS A;  2KX3 A;  3AE7 B;  1L6V A;  4TQ1 A;  1XO3 A;  1T3Q A;  2V4I B;  2DYB A;  4FN2 A;  3C8Y A;  3GB1 A;  1J8C A;  5JHB A;  5HKH A;  5H8Y E;  1TY2 A;  3SU8 X;  1SEB D;  3M63 B;  2OJR A;  3JYU A;  1PFD A;  5LLI A;  1FXA A;  1ZP0 B;  2MJ3 A;  2ICI A;  3SEB A;  2RPQ A;  4KSK C;  5C1Z A;  2L76 A;  4WH4 A;  1CK1 A;  1KJT A;  2LUE A;  4B6W A;  2B76 B;  3VUY A;  1Q10 A;  3ZRC A;  5AZF A;  1WZ0 A;  3MHZ A;  4YT0 B;  2BGF A;  4N58 A;  1AAR A;  4HEA 1;  2WU2 B;  5JZE B;  2BWF A;  1JWM D;  4WIP A;  3PGE A;  2BYE A;  2IBI B;  3U52 E;  1M4V A;  4RGN A;  4G50 A;  2WXR A;  2FCS A;  1KRH A;  2D11 A;  2J4X A;  3NHE B;  4NAM A;  2AQ2 B;  1TS2 A;  2MRP A;  5J17 A;  2PW9 A;  3HVZ A;  3Q8B A;  2Z8L A;  1UBI A;  1TS5 A;  2DHZ A;  2JUO A;  4Q2J A;  5D6J B;  5EE0 A;  2KDM A;  3BYT B;  5BMH A;  2DEN B;  3PT2 B;  4M00 A;  2N7E A;  1WJ6 A;  3MC0 B;  1TGZ B;  1NEN B;  3DVN U;  2Q5W D;  2KWV B;  2M1M A;  2GLS A;  1TT5 B;  1B9R A;  2RMM A;  4GGQ A;  1V81 A;  2BS3 B;  1FNW A;  2WYQ A;  3TEX A;  2JU6 X;  3ZNI D;  1TS3 A;  2E6X A;  2WX1 A;  3T8M A;  1SF0 A;  5FK9 C;  2D07 B;  3Q3M C;  3Q8A A;  5LXI B;  2WXL A;  4ZRP A;  3VHT C;  1PGB A;  1F9J A;  1WGY A;  1VCB A;  1XXG A;  2ZW0 A;  4IWO A;  3TL5 A;  2WXJ A;  5JHA A;  4DK5 A;  1A5R A;  2QC8 A;  3HM3 A;  4MJS A;  2O6V D;  3V60 A;  4AS1 A;  1XLN A;  3EFC A;  3GE8 C;  2MEK A;  2LMC A;  1WJU A;  3H1U A;  1I7H A;  2MLB A;  5D2M B;  1VZ6 A;  1QT9 A;  1RLF A;  4N9F 4;  1LQB A;  2LGS A;  4NPN A;  2XBB C;  2DZI A;  2MHJ A;  1YJ1 A;  3AU5 A;  2BWE S;  2L0T A;  3PRE A;  1FFU A;  4BOS C;  1FCC C;  3EC8 A;  4NAW B;  4TKN A;  2IJ0 A;  1RYJ A;  4DHZ B;  3FIL B;  3ETR A;  1PGA A;  1N5X A;  4USA A;  4LDT D;  2N0S B;  1RAX A;  4NAW A;  2KTF A;  1YQB A;  2MQJ A;  4KGT A;  1QLB B;  4AJY B;  1I4R A;  3FIL A;  1OEY J;  2HJ8 A;  2GBR A;  3P4R B;  1EF1 A;  3VTV A;  1WZ3 A;  5T8I A;  4DQO C;  2G3Q B;  3N9Y C;  3IAM 1;  3AE3 B;  2WS3 B;  2Z59 B;  4K3B A;  2KQS A;  3Q8F A;  1E8Y A;  1L5P A;  3BVM A;  2QDF A;  5L95 C;  4K3C A;  2ZEQ A;  1WYG A;  4W9D A;  4KZ0 A;  5G5G A;  3N3K B;  1HTQ A;  4RM8 A;  3PPA A;  3B0A A;  5FR3 A;  2JF5 A;  2N7D A;  1MHX A;  2W54 A;  3LDZ E;  2W55 A;  1VR9 A;  1AYF A;  1L0Y B;  4KX6 B;  2VZK D;  4WAA A;  3NVZ A;  2D3A A;  1L0V B;  1WR6 E;  1EWC A;  4HKQ A;  4OZB A;  2Y3A A;  3VFK A;  2KFK B;  3W9C B;  1V1O A;  1YX5 B;  3H6N A;  1JQ4 A;  1YQ3 B;  1YN3 A;  4XC2 A;  4UDU C;  4HK2 A;  4NQL B;  4II2 B;  4O1N A;  1ACC A;  2KFK A;  4RMA A;  3FAH A;  2WXN A;  1GB1 A;  2NTS A;  1WSP A;  5I4D A;  1T0Q C;  2C7N B;  3ZKJ C;  3NVY A;  2G9H D;  1WRD B;  1L2N A;  2EMT A;  2J7Q B;  3ZDM C;  1WR1 A;  3UGB B;  2ZVO A;  1TKE A;  2KN4 A;  2LEK A;  1ZDV A;  2KT7 A;  5CHV C;  2LGY A;  2L1A A;  2IPK D;  2YVC A;  4US9 A;  3EA6 A;  3KH0 A;  2D5G A;  2KJR A;  3M3J A;  2KMM A;  2JXX A;  2ASQ A;  1ZKH A;  4W9E A;  2TSS A;  1MPE A;  4EZL A;  3ZDT A;  2QIE B;  2LI5 A;  4KKI A;  4XGA B;  3N32 A;  1B1Z A;  1FNV A;  3AI5 A;  4CYE A;  1BXT A;  4ICV A;  4XWW A;  2IO3 B;  4MGY E;  2KTR B;  2R2O A;  1R4M B;  4WQO B;  1MHH E;  2FCN A;  2INC C;  3Q3O C;  5D7G A;  2KKC A;  1V86 A;  2KNB A;  3AE1 B;  4RF0 A;  2OED A;  1UBQ A;  1NEK B;  3V3X A;  5AUI A;  2KTR A;  3APF A;  3MJ5 A;  1WJN A;  1X1M A;  3PSE B;  1TKG A;  2KVR A;  1WGD A;  3UF8 A;  2AQ1 B;  2CHX A;  2RD0 A;  4WJO A;  4P1B C;  1RM6 C;  3APD A;  1UGM A;  4IKG A;  4XX5 A;  2LVQ A;  2PE9 A;  1Z5S B;  2BYT A;  2PJH A;  4HCP B;  3SFD B;  1V1P B;  4R3D A;  4ZRQ A;  2KWC A;  3NZS A;  2O2V B;  4YWG G;  2JZP A;  2K5P A;  2BBC A;  2CU3 A;  2W3R A;  2JYT A;  3UIO B;  3CWI A;  3ENE A;  4B95 A;  2O2V A;  3SDL C;  4NZL B;  1PUT A;  5G55 A;  5CTR C;  3U2S C;  4US8 A;  1PDX A;  1UWM A;  2MA9 B;  2FUG 1;  3JW0 X;  2UYZ B;  3W5U B;  1YN4 A;  1DGJ A;  2DZM A;  3TIX A;  2QEJ C;  5DPS A;  3RN9 C;  2PIA A;  1I4G A;  2WXG A;  4JX1 C;  1WGH A;  2RDG A;  2WGS A;  1P7E A;  1F77 A;  3NRZ A;  1QOA A;  4ARC A;  5BMI A;  4AOF A;  2PVG C;  3BYY B;  1D5Z C;  4C56 C;  3KWL A;  3DWG C;  2ON8 A;  3B2F A;  2C7H A;  3KUC B;  2V4L A;  3L54 A;  3ZGZ A;  2N7J A;  4GDK B;  2MJD A;  1J7C A;  4IOI E;  3W2D A;  2KWD A;  2QMT A;  3R66 C;  2JZ3 B;  3AEG B;  3AV8 A;  2BS2 B;  5DPW A;  3I3T B;  2IGG A;  4TV3 A;  1C4C A;  3GE3 C;  3NVW A;  3RZF A;  2OJW A;  4KIK A;  3P4Q B;  2KAC A;  4JIO U;  2ACZ B;  2AL3 A;  1C77 A;  3IT4 B;  2WXM A;  5DCN A;  3VXW A;  1Q1O A;  1WE6 A;  2B3A A;  4W9F A;  1STE A;  1SIJ A;  2L0F A;  1FM0 D;  2ZW1 A;  3DVG Y;  1OQQ A;  3H8H A;  1KLV A;  2QIL A;  4TMA B;  3NJT A;  5BYR A;  1K8R B;  5E6O A;  1YOV B;  4M02 A;  3TCA A;  2KJ6 A;  2IDY A;  2HTM E;  1WH3 A;  1KFY B;  4IW0 A;  3DBS A;  2Z0D B;  2KMC A;  3D32 A;  2BVC A;  5J18 A;  3RD2 A;  2KQ7 A;  4EE2 A;  3A1Q B;  2KQ4 X;  4W9L A;  3RNG C;  2K8B A;  4WWM A;  4YSZ B;  4JWS C;  3RZW C;  3U4E G;  1D6E C;  2JQR B;  3PS6 A;  1I4H A;  2IND C;  4A90 A;  2KDI A;  4LK0 M;  3M62 B;  3R8B A;  3KUD B;  2LGD A;  1VJK A;  1BUI C;  1C3T A;  3AN1 A;  1DOY A;  4HDO A;  1GAQ B;  2K8C A;  3V61 A;  1ZDX A;  2KXJ A;  1SB3 C;  2N9P C;  4WJQ A;  1JRO A;  3AE9 B;  4MGZ E;  4X57 B;  3DVN V;  2I38 A;  4HXD A;  4ZHO A;  2X8X X;  3U7Z A;  4PK1 A;  4C00 A;  1V8C A;  4EOY A;  4JWU C;  3DHI C;  3PRP B;  2IZV B;  2L3Z A;  1QKZ A;  2FID A;  2LRU A;  1L4Z B;  4FAD A;  1ZW7 A;  2NVU I;  2O6V B;  1JML A;  1JRP A;  3BII D;  4XYC A;  4ZDV A;  2DBY A;  1PYW D;  2JY6 A;  2MWS B;  4KV2 A;  1C78 A;  3R7R A;  1R7S A;  1N63 A;  2C7M B;  2C5L C;  1V9J A;  1XCQ L;  1RWS A;  4FJY A;  5HI1 A;  1DYQ A;  3BK1 A;  1UH6 A;  1P3Q U;  4YTP B;  2G1E A;  4EFO A;  3IAS 1;  3Q69 A;  1EM7 A;  1QOF A;  1Y56 A;  1KM7 A;  1L0X B;  1WXQ A;  2QCZ A;  4LDT B;  2J0M A;  2KOX A;  4C7Y A;  2YLM A;  4WWO A;  4YL8 A;  4ANU A;  2IGH A;  2BYF A;  3B2G A;  3N30 A;  4E74 A;  1XT9 B;  3LB8 C;  3RCZ A;  3T3O A;  1FIQ A;  3APC A;  2JXT A;  1E0Z A;  2XNA C;  2L32 A;  4ZHP A;  1K53 A;  2JT4 B;  4BZA A;  3VR8 B;  1NI2 A;  3AEB B;  3P42 A;  4P16 A;  4BBN F;  3A9K B;  4OVZ A;  3AE6 B;  3Q3N C;  3GZN B;  4HWI B;  5KHQ A;  1K51 A;  2H89 B;  3CIR B;  4G3X B;  1SJE D;  2FCM A;  3W1S C;  3A9K A;  3QX1 A;  3C19 A;  1XEE A;  5E6P A;  5JXV A;  1V2Y A;  2DZK A;  1FMA D;  2VH1 A;  2FBW B;  2VZK B;  3EHV A;  2KFJ A;  3BWU D;  1OGW A;  2SAK A;  1GG3 A;  3VRA B;  4PYZ A;  4I6L B;  4NY0 A;  4XDD A;  1ET9 A;  1MJD A;  2BYV E;  1DOI A;  4MGK E;  2ZJD A;  1KF6 B;  3WAN A;  2M19 A;  1UD7 A;  1ZXH A;  4MSQ B;  4NJ7 A;  1GB4 A;  1FEH A;  1SXT A;  4OVU A;  1PQS A;  4XZ4 A;  1ET6 A;  2MH7 A;  1P0R A;  2JYE A;  4BKS A;  3M95 A;  2D10 A;  4A20 A;  1IGD A;  4HJK A;  2Y5P A;  2AQ3 B;  4ANX A;  4RF1 A;  4G11 A;  4IM3 A;  3QWZ B;  2IO0 B;  1XCT L;  4TSS A;  1F1H A;  3BK2 A;  3DHH C;  4A3O A;  2KZR A;  2Y5B B;  2KDB A;  3P4P B;  4PYU A;  2HD5 B;  2I2Y A;  3NS8 A;  4L23 A;  4ZOH C;  3ECI A;  2JWU A;  4EKU A;  1E8X A;  4H2A A;  3BIN A;  4URK A;  3MJW A;  2IY1 B;  4GB9 A;  1L7Y A;  2J0J A;  3AEF B;  1EO6 A;  3AE2 B;  2IO1 B;  4IM0 A;  3PLV A;  2WHI A;  5CHF A;  5EE9 A;  4RH6 A;  1D4B A;  5CHW A;  5E6J A;  4AQ7 A;  2D3G A;  4NNJ B;  2A5U A;  1AWD A;  2K6D B;  3ZTC A;  1XD3 B;  2GMI C;  2GOW A;  3R7Q A;  4WWP A;  1C1Y B;  4K7S A;  2M0A A;  1WXV A;  3P4S B;  1UNS A;  3L0W B;  5C2T B;  3DPD A;  4LJO B;  5TR5 A;  5EE3 A;  3VTU A;  4BOZ B;  3ZW3 A;  2KYW A;  4DXA B;  3HHM A;  1WGR A;  3QHT A;  3PHW B;  3DBL B;  4GIV A;  3RFZ B;  5IAA C;  2INN E;  4MSM B;  1JRU A;  4YTM B;  2G4S A;  1E7U A;  2DNF A;  4WAF A;  3PV1 A;  1Q5W B;  4JLC A;  4DHJ D;  4J6I A;  2KDE B;  1P7F A;  3TJP A;  1LFD A;  1NVI D;  3TMP B;  2PKO A;  3PVL A;  3X23 A;  4A9A A;  4RGM A;  2J42 A;  2AX5 A;  1GNU A;  2HE7 A;  3VUW A;  4IWQ A;  1N5W A;  3A9J B;  3QK0 A;  1TJE A;  1R4N B;  1SGH A;  3E56 A;  1E8Z A;  4HVB A;  2C60 A;  4JPS A;  1MG8 A;  2L52 A;  2MBH A;  3SR6 A;  2FE8 A;  3Q8C A;  4L1B A;  2DWQ A;  2REX A;  1T0S C;  2BB6 A;  1HTO A;  4II3 B;  2BKR B;  4REZ A;  4I6N B;  4BKT A;  3CF6 E;  1NI3 A;  4MAC A;  4HPP A;  1V6E A;  2WDT B;  4GDL B;  4AUQ C;  1N61 A;  2LWP A;  3TEW A;  1JWB D;  2IY0 B;  1WMH B;  4DDG D;  1V80 A;  2WXH A;  1XLO A;  1YJI A;  2EKI A;  5C23 A;  2XK5 B;  1R4N I;  3AM9 A;  2G4D B;  1WE7 A;  1OQR A;  3IVF A;  3WCQ A;  1SIF A;  1IBX B;  5HHD G;  3AED B;  2XN9 C;  1K52 A;  1WWT A;  3MHS D;  5AZG A;  4RCO A;  1L6U A;  2XK5 A;  3ZRF A;  3ML8 A;  2E3T A;  1V5O A;  2AWT A;  1KLG D;  1M94 A;  2WDV B;  2KVZ A;  3ZJV A;  4GU2 A;  3HVD A;  3R3M A;  3OAW A;  1JW9 D;  4IUM B;  4FBJ B;  4KKJ A;  3KW5 B;  1KTK A;  1C4A A;  3CSF A;  2D3C A;  2PLP A;  2RDH A;  2ZPY A;  4FLH A;  3GP7 A;  1H4R A;  2JSV X;  2VH2 A;  3IT6 B;  4M8M A;  2AL6 A;  4YTN B;  3ZVV A;  1K50 A;  3K9P B;  5H92 C;  3OJ4 B;  3S2A A;  3ZNZ B;  1SE9 A;  1YQ4 B;  4N6E B;  5HFY A;  3OG5 A;  2L83 A;  4P6V F;  2WXP A;  3UQB A;  1C9F A;  2GBJ A;  1V49 A;  1TYG B;  3PZ7 A;  3QAR A;  2WQY B;  1E10 A;  2PEA A;  1UF0 A;  1A70 A;  3IBE A;  4YSX B;  4A55 A;  2N9L A;  4PT5 A;  1IUE A;  1ISN A;  2HJ1 A;  4ANV A;  1UGJ A;  2RSU A;  1EUV B;  3BZD B;  1JAL A;  3KYD D;  3Q6B A;  4GXB A;  3L08 A;  2FIF A;  1V1P A;  5IP4 D;  3WIM A;  3MTN B;  2WDQ B;  3VH3 B;  1C76 A;  1ZPS A;  1WXA A;  3N1Y C;  4M01 A;  2WXI A;  5BYQ A;  1N6Z A;  2CJO A;  3KUZ A;  4KSL C;  4KDL B;  1AW7 A;  1R4M I;  1YN5 A;  4C7Z A;  2W82 A;  3IHP C;  2V3S A;  1T5X D;  1HA5 A;  4WWN A;  1TZ1 A;  1VDV A;  1FCL A;  2YEP F;  2CJN A;  2X38 A;  3I63 C;  3RNA C;  1F2R I;  1WYW B;  3NG0 A;  2BKF A;  4JE3 B;  4IC7 B;  3B1L X;  4WUR A;  4TQ0 A;  1J7B A;  1WM2 A;  3TEY A;  2MJE A;  3T3N A;  1V97 A;  3WAO A;  3BVZ A;  3GS2 A;  1LXD A;  3RPF C;  3VRB B;  2AEH A;  4ZRK A;  3RT3 B;  3PHX B;  2GB1 A;  4P1C C;  4KVG B;  4K1R B;  3EFU A;  3W1S A;  2OOB B;  4M8N A;  3Q2A C;  1E8W A;  2HDE A;  3B08 A;  1TKY A;  2FNJ B;  3DHG C;  1QIL A;  3QJZ A;  5D94 A;  2RGF A;  5CX3 A;  4RM9 A;  3I57 A;  1MVK A;  2LXC A;  4GDK A;  2XEW A;  4W9K A;  1SE2 A;  2WX0 A;  4PS7 A;  4QAY A;  3RNE C;  3ML9 A;  3AEE B;  2DYM A;  4ICU A;  2LFI A;  4MDK E;  4JQW C;  4WJN A;  2LRW A;  3RI7 C;  3UI3 A;  2N9X A;  3RMK C;  4OHJ A;  2I1J A;  4KGR A;  2LGX A;  3TBL D;  1QOB A;  1Y8R C;  3C0R B;  4J3O D;  1I4Q A;  1WX9 A;  1IYF A;  3DVG X;  2NTT A;  1NDD A;  2DX5 B;  4YXD B;  4DHZ E;  3WAL A;  1SE4 A;  2IO2 B;  4DDI D;  3HIZ A;  1JWS D;  2GRI A;  3N1Z C;  3UIN B;  1WY8 A;  5L83 A;  2MX2 A;  1E5W A;  4WQM A;  1ROE A;  1VRA B;  1LO5 D;  1FPY A;  3ZXV A;  3O13 A;  3KYC D;  1U4A A;  5C3J B;  3DOW A;  3H7P B;  1JWU D;  2H88 B;  4W9G A;  2KMA A;  2INP E;  2M8S A;  2N4F A;  1XLQ A;  1J0G A;  1TBE A;  2BT6 A;  3A1Q A;  2R2Q A;  4S17 A;  4CHK A;  4HLE A;  3ZTD A;  1GPX A;  4CO7 A;  2AYO B;  4FUL A;  2DAF A;  3NY5 A;  4OZA A;  4DXF A;  5DPR A;  2PVO D;  1TY0 A;  3BVG A;  5IO9 A;  2WXF A;  4IM2 A;  3AUL A;  4HRO A;  3ZNG C;  2J0K A;  1EU3 A;  4W9J A;  4RGO S;  1E90 A;  2Y5C A;  1H8C A;  2LD9 A;  2EKE C;  2JRI B;  2JX5 A;  2KDF B;  2RR9 A;  2R61 A;  2WXO A;  1KOT A;  2K8H A;  2O6V A;  2JRH A;  3ABV B;  5AEK B;  1IPG A;  1F2R C;  4TUU A;  1UWX A;  2VRR B;  3A4S C;  2L05 A;  4LCD E;  2LGI A;  5BO4 B;  2KAN A;  4LNN A;  3IXS A;  5TSS A;  4HPL B;  1EWY C;  1UZX B;  4A6Q A;  2K22 A;  2K1F A;  1I4P A;  2KHW B;  1HQR D;  3A33 B;  3V6C B;  3VUX A;  3ONS A;  3TUO A;  4LNI A;  1OTR B;  2CHZ A;  2KN5 A;  1UUP A;  2GBK A;  5EE1 A;  1E9M A;  3SFE B;  2BTE A;  3ZNH B;  1EF5 A;  1WFY A;  2LHE A;  2WDR B;  2LUM A;  4F8C B;  3PRZ A;  4ASW C;  3V6E B;  4KDI C;  3AEA B;  3DBH B;  1FNU A;  2BS4 B;  2KC1 A;  4DHJ B;  1F52 A;  5GXG B;  3WAP A;  1XLP A;  1QZE A;  3DBR B;  3EGR A;  2MBO A;  1WX7 A;  2DYO A;  3U8Z A;  4DBG A;  2NMQ A;  5IKC M;  2ZCB A;  3R2I A;  2KLC A;  3NOB A;  1WM3 A;  1ZXI A;  4K81 A;  3GOE A;  2QSD A;  2K9X A;  2KLG A;  2LJI A;  3V62 A;  4BAX A;  1DOX A;  2ZNV C;  3EUB 2;  4MH0 E;  4MGI E;  4BBN C;  1ZGU B;  2JVC A;  1WJ4 A;  3VR9 B;  3CST A;  3WA0 A;  3N20 C;  2DAJ A;  5IOI A;  3ZLZ A;  3QA8 A;  3TEZ A;  4NQK E;  1FXI A;  2V3P A;  4W9H A;  3E9S A;  2FCQ A;  3P63 A;  4ANW A;  2WXQ A;  2BB5 A;  3DBH I;  2ZZP B;  3O65 B;  2MBE A;  3LXF A;  3DBR I;  3AU4 A;  2K39 A;  3GZN I;  4FA6 A;  3QCA A;  1LGR A;  2MCN B;  2V3N A;  2BW2 A;  4EUT A;  2C9W B;  2PPH A;  2N9E B;  3L17 A;  1YNT E;  3RNF C;  2W9N A;  3MFG A;  3URY A;  1MFW A;  4MT5 A;  4FJZ A;  4MJS B;  2CR5 A;  2WLB A;  3JVZ X;  3L10 B;  3RUI B;  1KLU D;  1C79 A;  1JWA D;  3VAW A;  1HZ5 A;  2I1K A;  3ZYY X;  3NZU A;  3L16 A;  1JCK B;  5IN7 A;  2K6Q A;  2NPT B;  3X0W A;  1ENF A;  2A4Z A;  5FKA C;  2N9K A;  1F0Z A;  2M0X A;  3ZQ4 A;  1FO4 A;  1YX6 B;  1MI0 A;  2WNM A;  3DWM A;  3I9V 1;  1YJJ A;  4ITK A;  4P7I A;  5BMG A;  2NPT A;  2NBU A;  4OZC A;  1E7P B;  4ARI A;  3PZ8 A;  4HDQ A;  3PO0 A;  1WI0 A;  4N59 A;  2KK8 A;  3H7S A;  4IG7 B;  2UU7 A;  3L13 A;  4EZK A;  1CZP A;  3W5V B;  4A8X C;  4C80 A;  1Z2M A;  4B9K A;  2FUH B;  2G45 B;  1CMX B;  2YEP B;  1ZUD 2;  2DLB A;  4AWJ A;  3VTW A;  1YIW A;  2LVO A;  4E3C A;  1ZE3 D;  3PTF C;  4ACF A;  2EEL A;  3OWE B;  3NZ3 A;  2CKH B;  1RRB A;  2KJH B;  4FHJ A;  4FHK A;  1SE3 A;  2MBB B;  4PS8 A;  3VDZ A;  2N1V A;  4LJP B;  3UIP B;  3VVW B;  1J19 A;  5E6N A;  3P2B A;  3KWV A;  1OEY A;  5GMV A;  2LVP A;  2Z0E B;  2J52 A;  3NS1 A;  4IDI A;  2D2Q A;  3DBL I;  1P9D U;  2KD0 A;  5KHO A;  1G6J A;  1E7V A;  1T0Y A;  2CU1 A;  2WWZ A;  3A9J A;  3DDC B;  3Q3J A;  3AEC B;  1GC6 A;  1CJE A;  3HK0 A;  2HTH A;  1NYR A;  4K7W A;  3Q8E A;  1MG4 A;  3EEC A;  3OLM D;  3WAM A;  1T0R C;  3DCG A;  3SD5 A;  4BKS D;  1YMH E;  1GC7 A;  1P1A A;  4FJV B;  3K9O B;  5DPT A;  3ZJU A;  4LNO A;  2RPV A;  1D5M C;  4ZYN A;  2V9H A;  1HEZ E;  2KX0 A;  2PTL A;  3VH4 B;  2NCN A;  4GDL A;  1PGX A;  2NS5 A;  2QHO A;  2V0G A;  3TSS A;  4G0N B;  2WU5 B;  2MP2 B;  1XQQ A;  1FRR A;  2CHW A;  1WMH A;  3QC8 B;  2IYD B;  3PZD A;  5MPO A;  3AXC A;  3IFW B;  1C4P A;  3IG3 A;  5LXH A;  1WX8 A;  1SBB B;  4DXG A;  2MP2 A;  1HZ6 A;  4RNA A;  2ZCC A;  4C4V B;  4GOC A;  1IBX A;  4I6P A;  3KQ4 A;  1WIA A;  3PRM B;  2M4N A;  3L4P A;  1WRI A;  2WP9 B;  3KLS X;  5LNK 1;  2M17 A;  2WXK A;  3OJ3 A;  5AZH A;  3LYY A;  3A4R A;  5BYS A;  4BVU C;  3ZO5 B;  4KGS A;  4MH8 A;  2K25 A;  4C4V A;  4PS3 A;  2FAZ A;  2NBW B;  4KZC A;  2NR2 A;  4A3P A;  4LNF A;  1FFV A;  2CS4 A;  3AE8 B;  1FXT B;  3VQI A;  3AE4 B;  3N1X C;  3MP9 A;  3HM6 X;  2GBN A;  3JSV B;  2IGD A;  2ZPN A;  2N1W A;  1HE8 A;  1VZ7 A;  4LNK A;  4HJG E;  1L4D B;  2ONQ A;  2JWZ A;  3AB5 A;  1YD8 U;  3JSV A;  3Q3F A;  3NUH B;  2BPS A;  1RFK A;  4XE0 A;  1GJZ A;  3J9C A;  2JPH A;  1XF5 L;  5D3I B;  3PLU A;  3SHQ A;  1S1Q B;  4AP4 C;  1NBF C;  2LXA A;  4WJP A;  1SJH D;  4HRS A;  1VLB A;  4LLG M;  4XDC A;  4E71 A;  4RGT A;  1SSN A;  3T9L A;  4GSW A;  3LJ3 A;  5J2R A;  4MM3 B;  1WGK A;  3Q14 C;  4CQN A;  1E6E B;  1OQY A;  2OHF A;  1N62 A;  3AH7 A;  1T6B X;  4JL9 A;  4ZYS A;  1D5X C;  4ZRI A;  3RNB C;  1VD2 A;  1OFF A;  2MW5 A;  3MC9 A;  2JZZ A;  1GOZ A;  2UWQ A; 
#chains in the Genus database with same CATH homology
 1I35 A;  4MM3 A;  4XC2 A;  2LJ5 A;  4HK2 A;  2DZJ A;  4NQL B;  4II2 B;  3BY4 B;  4IM2 A;  3ALB A;  3AUL A;  4A3O A;  2KZR A;  2Y5B B;  2KDB A;  4K7U A;  3ZNG C;  2KFK A;  4PYU A;  2J0K A;  4W9J A;  1E90 A;  4RMA A;  2HD5 B;  1Q0W B;  3NS8 A;  3ECI A;  1H8C A;  2C7N B;  2LD9 A;  3ZKJ C;  4EKU A;  1E8X A;  2EKE C;  2JRI B;  3W1Y A;  3RYT A;  2KDF B;  3BIN A;  1WGG A;  3MJW A;  4URK A;  1WRD B;  2RR9 A;  2LZ6 A;  3QAQ A;  1LM8 B;  2ZNV B;  1KOT A;  2IY1 B;  1L2N A;  2EMT A;  4GB9 A;  2K8H A;  1L7Y A;  2J7Q B;  2J0J A;  2JRH A;  2O6V A;  2GBM A;  3DQV A;  3ZDM C;  1WR1 A;  4EZJ A;  1EO6 A;  3UGB B;  5AEK B;  1IPG A;  4TUU A;  2ZVO A;  2IO1 B;  4IM0 A;  2VRR B;  3A4S C;  3PLV A;  2L05 A;  4BKG A;  4LCD E;  4GN1 A;  2V1Y A;  5BO4 B;  2KAN A;  5CHF A;  5CHV C;  2LGY A;  4HPL B;  2YVC A;  1UZX B;  1UEL A;  5CHW A;  2D3G A;  3KH0 A;  2K1F A;  4M0W B;  4NNJ B;  2A5U A;  2K6D B;  5IA7 A;  2KHW B;  2PE6 B;  3ZTC A;  3A33 B;  1XD3 B;  2GMI C;  3V6C B;  3VUX A;  3ONS A;  4DWF A;  2GOW A;  2KJR A;  3R7Q A;  3M3J A;  4WWP A;  2KC2 A;  1OTR B;  1C1Y B;  2CHZ A;  2JXX A;  2ASQ A;  2KN5 A;  4K7S A;  1ZKH A;  2MBQ A;  4W9E A;  2GBK A;  1WXV A;  4KIK B;  5FR6 A;  5JH5 C;  4EZL A;  3L0W B;  1WF9 A;  3DPD A;  4LJO B;  5TR5 A;  3ZDT A;  1V5T A;  3VTU A;  2LI5 A;  1EF5 A;  3ZNH B;  4BOZ B;  3N32 A;  1WFY A;  2ZVN A;  3ZW3 A;  4DXA B;  4MEL A;  1I42 A;  3AI5 A;  3HHM A;  3CMM B;  2L00 B;  3U7D A;  1WGR A;  4CYE A;  3QHT A;  3PHW B;  4ICV A;  4GIV A;  4F8C B;  3PRZ A;  4W9I A;  5IAA C;  4ASW C;  2IO3 B;  4MSM B;  4JGH B;  3V6E B;  1JRU A;  4MGY E;  2KTR B;  4IWP A;  4KDI C;  2R2O A;  2BF8 B;  4WQO B;  4DHJ B;  2KC1 A;  4OVV A;  2FCN A;  2G4S A;  3WAP A;  5D7G A;  4GMV A;  2KKC A;  1QZE A;  1V86 A;  1E7U A;  3QIJ A;  2KNB A;  2MBO A;  1WX7 A;  1WXS A;  4F1S A;  1UBQ A;  3ZUN A;  4NJ6 A;  2L8J A;  2DYO A;  3PV1 A;  1Q5W B;  2KTR A;  3U8Z A;  3ZIM A;  4DBG A;  4JLC A;  3APF A;  1WJN A;  1X1M A;  2LAS A;  4DHJ D;  2ZCB A;  3PSE B;  4J6I A;  1D3Z A;  1TTN A;  2KDE B;  3TJP A;  2KVR A;  4AJW A;  1WGD A;  3UF8 A;  1LFD A;  2KLC A;  2CHX A;  2RD0 A;  3TMP B;  3PVL A;  3NOB A;  4MEM A;  4WJO A;  5EDS A;  2NBV B;  3X23 A;  3APD A;  1WM3 A;  1UGM A;  4XX5 A;  4K81 A;  2LVQ A;  2PE9 A;  1Z5S B;  3GOE A;  2PJH A;  1GNU A;  4HCP B;  2KLG A;  3V62 A;  2HE7 A;  3VUW A;  2KWC A;  3NZS A;  2O2V B;  3H9D A;  4IWQ A;  2ZNV C;  3A9J B;  3QK0 A;  4MH0 E;  4MGI E;  4BBN C;  1ZGU B;  2JVC A;  1SGH A;  1WJ4 A;  3CST A;  3WA0 A;  3UIO B;  2DAJ A;  1E8Z A;  3H7P A;  1WXM A;  2KWU B;  3ZLZ A;  3QA8 A;  4NQK E;  4HVB A;  4W9H A;  1S3S G;  3ENE A;  4B95 A;  2C60 A;  1MG8 A;  2O2V A;  4W9C A;  3SDL C;  2MBH A;  4BFR A;  2FCQ A;  5G55 A;  4ANW A;  2MSE D;  5CTR C;  3UQA A;  3DBH I;  2ZZP B;  2MA9 B;  2REX A;  3JW0 X;  2UYZ B;  3O65 B;  2MBE A;  3DBR I;  4HCN B;  1RFA A;  2DZM A;  3AU4 A;  3TIX A;  2K39 A;  4II3 B;  1BT0 A;  1P98 A;  3GZN I;  4F7Z A;  3QCA A;  5DPS A;  4FA6 A;  2BKR B;  1GUA B;  3KVF B;  2MCN B;  4I6N B;  4BKT A;  4EUT A;  2C9W B;  2PPH A;  2N9E B;  2L7R A;  3CF6 E;  3L17 A;  1V6E A;  3U30 A;  2WDT B;  4GDL B;  4HPM B;  2KO3 A;  4AUQ C;  1WGH A;  2W9N A;  2LWP A;  1IP9 A;  4FJZ A;  4MJS B;  2IY0 B;  1WMH B;  4DDG D;  2CR5 A;  4EEW A;  3JVZ X;  3L10 B;  5G2N A;  1V80 A;  4AOF A;  3RUI B;  3RUL A;  3VAW A;  3QQ8 B;  5C23 A;  2I1K A;  2XK5 B;  4ZRJ A;  3NZU A;  3L16 A;  2C7H A;  1R4N I;  3KUC B;  2EMS A;  2KX3 A;  2V4L A;  2G4D B;  1WE7 A;  3IVF A;  1SIF A;  4TQ1 A;  3L54 A;  3QWZ B;  2K6Q A;  4GDK B;  2NPT B;  3X0W A;  2A4Z A;  3MHS D;  2DYB A;  5AZG A;  4FN2 A;  2M0X A;  2XK5 A;  3ZRF A;  3ML8 A;  3R66 C;  1V5O A;  1J8C A;  5JHB A;  5HKH A;  2JZ3 B;  3SU8 X;  1YX6 B;  2AWT A;  3M63 B;  1M94 A;  5DPW A;  3I3T B;  4GU2 A;  4P7I A;  4TV3 A;  2NPT A;  2OJR A;  3JYU A;  2NBU A;  3R3M A;  3RZF A;  4HDQ A;  3OAW A;  4IUM B;  5LLI A;  1WI0 A;  4FBJ B;  3KW5 B;  4KIK A;  2RPQ A;  2KK8 A;  3CSF A;  4KSK C;  5C1Z A;  2L76 A;  4JIO U;  3H7S A;  4IG7 B;  2AL3 A;  1KJT A;  2LUE A;  4B6W A;  2ZPY A;  3VUY A;  4FLH A;  3L13 A;  4EZK A;  1H4R A;  3ZRC A;  5AZF A;  4M8M A;  5DCN A;  1WZ0 A;  2AL6 A;  3VXW A;  3ZVV A;  2BGF A;  1AAR A;  1Q1O A;  1Z2M A;  3K9P B;  3OJ4 B;  3S2A A;  5JZE B;  2BWF A;  1WE6 A;  4B9K A;  3ZNZ B;  2FUH B;  1SE9 A;  2G45 B;  2B3A A;  1CMX B;  3PGE A;  2BYE A;  2IBI B;  4W9F A;  2L0F A;  3DVG Y;  4G50 A;  2FCS A;  4AWJ A;  3VTW A;  1KLV A;  1YIW A;  3UQB A;  2GBJ A;  1V49 A;  1K8R B;  5E6O A;  2LVO A;  3QAR A;  2D11 A;  3TCA A;  4E3C A;  3NHE B;  2KJ6 A;  3PTF C;  1WH3 A;  2PEA A;  2CKH B;  3IBE A;  1RRB A;  2KJH B;  4FHJ A;  4FHK A;  4IW0 A;  2MBB B;  2MRP A;  3DBS A;  4PS8 A;  5J17 A;  3VDZ A;  2Z0D B;  2N1V A;  4LJP B;  1ISN A;  1UBI A;  3UIP B;  2KMC A;  2DHZ A;  3D32 A;  2JUO A;  3VVW B;  1J19 A;  2RSU A;  3P2B A;  2KQ7 A;  5D6J B;  1EUV B;  5E6N A;  3RD2 A;  3A1Q B;  3KYD D;  4W9L A;  4GXB A;  3L08 A;  2FIF A;  2DEN B;  3PT2 B;  1OEY A;  2N7E A;  5GMV A;  1WJ6 A;  2K8B A;  3WIM A;  1TGZ B;  2LVP A;  2Z0E B;  3MTN B;  3RZW C;  3VH3 B;  2D2Q A;  3DBL I;  1P9D U;  2KD0 A;  3PS6 A;  5KHO A;  1G6J A;  1E7V A;  1T0Y A;  1WXA A;  2CU1 A;  2KDI A;  2WWZ A;  3A9J A;  3M62 B;  3DDC B;  3DVN U;  3Q3J A;  3KUD B;  3KUZ A;  1GC6 A;  2KWV B;  2LGD A;  4KDL B;  4KSL C;  2M1M A;  1C3T A;  3HK0 A;  1R4M I;  2HTH A;  4K7W A;  4GGQ A;  4HDO A;  1V81 A;  2K8C A;  3V61 A;  3EEC A;  3IHP C;  2KXJ A;  2V3S A;  2WYQ A;  3OLM D;  3ZNI D;  4WWN A;  2N9P C;  2WX1 A;  1TZ1 A;  3DCG A;  4WJQ A;  3SD5 A;  3T8M A;  4MGZ E;  4X57 B;  3WAM A;  4BKS D;  1GC7 A;  3DVN V;  1P1A A;  1WYW B;  2D07 B;  4FJV B;  4HXD A;  2BKF A;  4IC7 B;  3B1L X;  3K9O B;  4TQ0 A;  5LXI B;  5DPT A;  1WM2 A;  4EOY A;  3PRP B;  2IZV B;  3VHT C;  2L3Z A;  1F9J A;  2FID A;  4ZYN A;  2LRU A;  3WAO A;  4FAD A;  1WGY A;  1ZW7 A;  2NVU I;  1VCB A;  2O6V B;  2KX0 A;  1LXD A;  2AEH A;  4ZRK A;  3RT3 B;  3PHX B;  3VH4 B;  2NCN A;  4KVG B;  4K1R B;  4IWO A;  3TL5 A;  4GDL A;  3EFU A;  2NS5 A;  2QHO A;  2OOB B;  4M8N A;  3W1S A;  4DK5 A;  4G0N B;  5JHA A;  1A5R A;  4ZDV A;  1E8W A;  2MP2 B;  1XQQ A;  3HM3 A;  2CHW A;  4MJS A;  2O6V D;  2JY6 A;  3V60 A;  3B08 A;  2MWS B;  4KV2 A;  1WMH A;  2FNJ B;  3QC8 B;  2IYD B;  3R7R A;  3QJZ A;  3PZD A;  5D94 A;  3AXC A;  1WJU A;  2C7M B;  3H1U A;  2MLB A;  3IFW B;  5D2M B;  3IG3 A;  2C5L C;  2RGF A;  5LXH A;  1V9J A;  5CX3 A;  4FJY A;  4RM9 A;  1WX8 A;  2MP2 A;  1UH6 A;  5J18 A;  1RLF A;  1P3Q U;  4N9F 4;  1LQB A;  2ZCC A;  4EFO A;  4NPN A;  4GOC A;  2XBB C;  2LXC A;  4GDK A;  4I6P A;  1WIA A;  2DZI A;  2XEW A;  1YJ1 A;  3AU5 A;  2BWE S;  2L0T A;  3PRM B;  3PRE A;  2M4N A;  4W9K A;  4BOS C;  2WX0 A;  1KM7 A;  2M17 A;  3OJ3 A;  4PS7 A;  3EC8 A;  5AZH A;  4NAW B;  4TKN A;  3ML9 A;  4LDT B;  2DYM A;  2J0M A;  2KOX A;  3A4R A;  4ICU A;  4BVU C;  3ZO5 B;  2K25 A;  2YLM A;  4WWO A;  4YL8 A;  4ANU A;  4MDK E;  4DHZ B;  4PS3 A;  2FAZ A;  2BYF A;  2NBW B;  4JQW C;  2LRW A;  4WJN A;  2N9X A;  4KZC A;  3N30 A;  2NR2 A;  4E74 A;  1XT9 B;  4A3P A;  4LDT D;  2I1J A;  1RAX A;  4NAW A;  3RCZ A;  2CS4 A;  2KTF A;  1YQB A;  1FXT B;  2MQJ A;  3APC A;  2LGX A;  3TBL D;  1Y8R C;  3C0R B;  3VQI A;  4AJY B;  2JT4 B;  1OEY J;  2GBN A;  3HM6 X;  3JSV B;  2HJ8 A;  2GBR A;  1NI2 A;  2ZPN A;  1WX9 A;  2N1W A;  1IYF A;  3DVG X;  1HE8 A;  4BBN F;  3A9K B;  1NDD A;  2DX5 B;  4DHZ E;  3WAL A;  1EF1 A;  2IO2 B;  3VTV A;  1WZ3 A;  2G3Q B;  2JWZ A;  4DDI D;  4HWI B;  3HIZ A;  5KHQ A;  1YD8 U;  3JSV A;  3Q3F A;  2BPS A;  4G3X B;  2FCM A;  3W1S C;  2Z59 B;  3UIN B;  1WY8 A;  5L83 A;  2KQS A;  2MX2 A;  1E5W A;  3A9K A;  1E8Y A;  1GJZ A;  3QX1 A;  2JPH A;  5L95 C;  3PLU A;  3SHQ A;  2ZEQ A;  1S1Q B;  5E6P A;  1V2Y A;  2DZK A;  4AP4 C;  4W9D A;  4KZ0 A;  1NBF C;  3N3K B;  3KYC D;  3EHV A;  1U4A A;  2LXA A;  4WJP A;  3DOW A;  2KFJ A;  3H7P B;  3PPA A;  3B0A A;  4RM8 A;  1OGW A;  4W9G A;  2KMA A;  1GG3 A;  2JF5 A;  2N7D A;  4PYZ A;  4ANV A;  2M8S A;  4I6L B;  2N4F A;  3LDZ E;  4NY0 A;  1J0G A;  1TBE A;  4E71 A;  2BYV E;  3A1Q A;  2R2Q A;  3T9L A;  4GSW A;  4MGK E;  2ZJD A;  3LJ3 A;  5J2R A;  4CHK A;  3WAN A;  4HLE A;  4WAA A;  1UD7 A;  4MSQ B;  4NJ7 A;  3ZTD A;  4OVU A;  1OQY A;  1PQS A;  4XZ4 A;  1WR6 E;  4JL9 A;  1P0R A;  3VFK A;  4CO7 A;  2KFK B;  2AYO B;  2DAF A;  1YX5 B;  3NY5 A;  4FUL A;  4ZRI A;  1VD2 A;  3H6N A;  4BKS A;  2MW5 A;  3M95 A;  2D10 A;  4A20 A;  2JZZ A;  4HJK A;  4ANX A;  5DPR A;  2UWQ A;  4G11 A;  4IM3 A;  2IO0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...