2K6QA

Lc3 p62 complex structure
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
121
structure length
121
Chain Sequence
SMPSEKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESERDEDGFLYMVYASQETFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis inhibitor/apoptosis
molecule keywords Microtubule-associated proteins 1A/1B light chain 3B
publication title Structural basis of target recognition by ATG8/LC3 during selective autophagy
rcsb
source organism Rattus norvegicus
total genus 20
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2008-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2k6qA00
2O6VD 3ZNID 2LD9A 1EUVB 4FJZA 4TQ0A 2PPHA 3ZVVA 2KN5A 1T0YA 2KWVB 4NQLB 4WAAA 4BOZB 4LDTB 3PPAA 2O2VB 5D7GA 2M0XA 1TZ1A 1RLFA 4W9HA 5G55A 4KDIC 5JHAA 3UGBB 2MBQA 3OLMD 2GBNA 3RCZA 4GN1A 3UINB 4K7SA 2L0TA 3K9OB 2D3GA 1WI0A 3L08A 1V86A 1K8RB 4DDID 3V6EB 1KLVA 4KV2A 3N3KB 4BKSD 2LWPA 4MH0E 1EF5A 2FUHB 4FBJB 1H8CA 4OVVA 3IVFA 3PT2B 4PS8A 4AJYB 2Y5BB 2J0MA 4FULA 1LFDA 2WX1A 3RZWC 3ZDTA 4AP4C 1P1AA 2HTHA 3DBLI 4YL8A 4DHJB 2A4ZA 2WX0A 4GB9A 4DHZE 5LLIA 4NJ7A 5AZHA 4LDTD 3GOEA 3KUZA 1JRUA 1A5RA 3HIZA 2MWSB 3VTUA 2L05A 1WE6A 1J0GA 4MGKE 4XC2A 4JL9A 1RRBA 2MCNB 1IPGA 2N1WA 3DPDA 3PSEB 1Z2MA 5J18A 1PQSA 1ZGUB 2MBEA 2QHOA 4KSLC 3KUDB 1TGZB 5IAAC 4EUTA 3P2BA 3BY4B 4JIOU 4A3PA 4W9KA 2KQSA 3AI5A 4ANXA 1WX7A 2M1MA 1UH6A 1S1QB 2OOBB 2KO3A 1GG3A 3R3MA 4HVBA 2N1VA 4NAWA 3QARA 5TR5A 1WH3A 4DHJD 2RPQA 2DZKA 1GNUA 1OGWA 2KHWB 3ZIMA 4BFRA 1FXTB 3VUWA 2KLCA 3WAOA 4B9KA 4ZRIA 2NBVB 2NS5A 3ZNZB 4HDQA 3RUIB 2KWUB 2L76A 3A33B 2IO2B 3O65B 3ZUNA 4F8CB 1WX9A 3KUCB 4K7UA 2VRRB 5DPRA 3PS6A 3ZRCA 2DAFA 3M95A 4BOSC 3NY5A 3LJ3A 2G4SA 1E8YA 5AEKB 2BYVE 2K8CA 4FA6A 3QAQA 4HLEA 4JGHB 2WYQA 2Z0DB 2IY0B 2ZEQA 4MDKE 3A9KB 2JY6A 2D10A 1YX6B 3DVNU 4RM8A 1WXSA 1X1MA 3KYCD 1WY8A 2IO0B 2GBJA 3Q3JA 3QIJA 4KIKB 1IP9A 3PHWB 2NPTB 4ICUA 3TMPB 3B08A 4MGZE 2J0JA 3K9PB 4MEMA 5D6JB 4PYZA 2FCQA 3U7DA 3CSTA 4EZLA 4IW0A 1LM8B 2LRUA 2ZZPB 3H9DA 3IFWB 1WGDA 3PZDA 3X0WA 3NS8A 1WFYA 1WJ6A 2ZCBA 2GBKA 5CX3A 3VFKA 4WQOB 2KC1A 4MJSB 2HE7A 2KTFA 4IWPA 2MW5A 3VVWB 4W9EA 4KZCA 1P98A 4W9GA 2CR5A 4BBNC 2CU1A 3SHQA 4BKGA 2RGFA 2NBUA 3ENEA 2N9PC 2XK5A 2LZ6A 3APDA 2KFKA 2C5LC 2KLGA 2V4LA 2YVCA 2KFJA 2DYOA 4GDKA 1YD8U 1WMHA 2R2QA 2KTRA 3NOBA 4FLHA 4K1RB 2ZPNA 5CHWA 2KOXA 3APCA 2K8BA 2LXCA 2C60A 2ZVOA 1Q5WB 3JSVA 4FHKA 1WXAA 2BYEA 2KDIA 2KDBA 3SD5A 1MG8A 4M8NA 1YX5B 2LVPA 4DK5A 2G4DB 1QZEA 4TQ1A 4W9FA 2PE9A 3X23A 2EKEC 3U30A 2IZVB 3T9LA 1H4RA 2L3ZA 2W9NA 3VUXA 2N9XA 2K6DB 3ALBA 3H1UA 5E6OA 4DBGA 2ZPYA 3QQ8B 3SDLC 2KNBA 5G2NA 2BKFA 1V5TA 5L83A 2KZRA 5DPTA 4II3B 4TV3A 3KW5B 4K81A 1EO6A 2KANA 1UBIA 1P3QU 1WRDB 3B0AA 3GZNI 3VH3B 3L16A 2EMTA 4HPLB 1WJUA 4ZRKA 1GJZA 2KQ7A 2KVRA 5KHOA 5JH5C 1R4MI 2N7DA 4HDOA 4W9CA 2O6VA 3ZRFA 4LJPB 2B3AA 2JZ3B 2MBOA 2Z0EB 4B95A 2JF5A 3ZDMC 3RT3B 2MBHA 2LASA 5C23A 3KYDD 3TBLD 1UBQA 4FJVB 4MSQB 1AARA 3V60A 2MQJA 4NQKE 3N30A 4HWIB 2M8SA 1CMXB 2YLMA 1V6EA 2CS4A 2JVCA 4EFOA 3NZSA 4ASWC 2DYBA 2HJ8A 1V81A 1HE8A 3A9JA 2DX5B 4BKTA 4JQWC 1IYFA 3AU4A 2BF8B 3DCGA 2RD0A 3PRZA 1WZ3A 3EFUA 3VAWA 1NDDA 4BKSA 2MRPA 1GC7A 2J7QB 3SU8X 1L7YA 2K8HA 2FCSA 3D32A 2FAZA 4IUMB 2D11A 2MBBB 3UQBA 4IG7B 2LRWA 2L00B 4GXBA 4EZKA 1P9DU 1WX8A 4GGQA 4ANVA 1NI2A 3PGEA 3LDZE 2MP2A 4AUQC 4E74A 2FIFA 4CHKA 4URKA 2DAJA 3L17A 3ZNHB 1E8WA 2KKCA 4I6PA 2JXXA 4RMAA 2LUEA 1WGYA 4PS7A 3JYUA 2I1JA 1GUAB 5LXIB 3VQIA 3UQAA 2KJRA 2ZVNA 3PLVA 2GOWA 4HK2A 4AOFA 3L10B 1WE7A 3DBSA 4W9LA 2IY1B 3R7RA 2ASQA 3H6NA 1TBEA 2XK5B 3VUYA 3ECIA 3I3TB 4CO7A 2KFKB 2KX3A 4MGYE 3RULA 1P0RA 1WGHA 3A4SC 3DVNV 2NVUI 4E3CA 4HJKA 4IM2A 2N9EB 1WMHB 2ZNVC 2KTRB 3OJ3A 2GMIC 1RAXA 2D07B 3ML8A 3JSVB 3HM6X 4A3OA 2DYMA 2JRHA 3L54A 2G45B 4GDLB 4ZRJA 3JW0X 1WYWB 1SIFA 1Q1OA 4J6IA 2Z59B 2M4NA 3B1LX 3QCAA 3IHPC 5DPSA 2RR9A 3ZLZA 1V80A 1WGGA 2CHZA 2PEAA 1L2NA 2KMAA 1U4AA 3PLUA 3IBEA 2DZIA 1WXMA 2ZNVB 2CKHB 3M62B 3PRMB 3QJZA 4GSWA 3V61A 4DXAB 1WZ0A 2XEWA 1Q0WB 2I1KA 3M63B 2CHXA 1Y8RC 4TKNA 4X57B 4WWPA 4RM9A 2C7MB 4N9F4 3ZKJC 1UD7A 5D94A 2JUOA 3VDZA 4OVUA 4F7ZA 5DCNA 3QWZB 3PVLA 3ZNGC 3BINA 4FADA 4WJNA 1KOTA 1XQQA 2O6VB 2R2OA 1YIWA 2PJHA 3DBRI 4FJYA 4KDLB 3OAWA 1VCBA 1ZKHA 1R4NI 3OJ4B 4GMVA 2D2QA 2MLBA 4IWQA 1UZXB 4E71A 3H7PA 1I35A 1GC6A 3PHXB 4WJOA 2BWFA 4XZ4A 4BBNF 2BWES 3HHMA 4DHZB 3A9JB 5AZFA 2DZJA 2KWCA 3ML9A 3JVZX 2KMCA 3Q3FA 5JZEB 4M0WB 3UIOB 1V5OA 3PRPB 5GMVA 3WANA 2LXAA 3WA0A 3AU5A 1J19A 2AYOB 3PREA 2K39A 3TIXA 4I6NB 5JHBA 3NHEB 3RD2A 1UELA 4MELA 2NPTA 1OQYA 2AEHA 5E6PA 3TJPA 4I6LB 1NBFC 4IM0A 4LCDE 2L0FA 4DWFA 2K25A 3R7QA 2PE6B 1S3SG 4KSKC 4AWJA 4XX5A 5AZGA 4NAWB 3AULA 2BKRB 4JLCA 2MP2B 5BO4B 3RZFA 3QC8B 1C3TA 2IBIB 3C0RB 4IM3A 2L8JA 3S2AA 1WJNA 3VH4B 1WM3A 4EOYA 4MJSA 2M17A 3MTNB 1V9JA 2ZJDA 3DDCB 2IO1B 3U8ZA 3DVGX 2XBBC 4ANWA 3IG3A 1E7UA 3VXWA 2K6QA 3HK0A 2REXA 2KC2A 1RFAA 2WDTB 3A1QA 4ANUA 5EDSA 1J8CA 5LXHA 3AXCA 2G3QB 5IA7A 4M8MA 3EHVA 4KZ0A 2GBRA 3TCAA 3L0WB 4HCPB 4NPNA 4WJQA 5J2RA 2DZMA 4CYEA 5KHQA 4W9IA 4WWNA 2MSED 2WWZA 2RSUA 3CMMB 3VTVA 4NY0A 1VD2A 1XD3B 2FCNA 1I42A 1Z5SB 1OTRB 3UF8A 2LVQA 4MM3A 5CHVC 4A20A 3DOWA 2K1FA 3ZTCA 1ISNA 2CHWA 1XT9B 3VTWA 3PTFC 2O2VA 3A4RA 1KM7A 2UWQA 2UYZB 2OJRA 2A5UA 2LGDA 1OEYA 4GIVA 2MX2A 3W1SA 4PS3A 1LXDA 4BVUC 4LJOB 4DDGD 3WAMA 2NR2A 4EZJA 1UGMA 2HD5B 3ONSA 4WWOA 2IO3B 1WR1A 3WIMA 3ZO5B 2KD0A 3KVFB 2LGYA 3W1YA 3TL5A 3UIPB 1KJTA 2KDFB 5HKHA 1WM2A 4HCNB 1TTNA 3L13A 5CTRC 2BPSA 4MSMB 4AJWA 2KDEB 1C1YB 4G0NB 1WF9A 4GDKB 2DHZA 2FNJB 4IC7B 2AL3A 2EMSA 2V1YA 1YJ1A 3MHSD 4P7IA 2JZZA 5J17A 1F9JA 4NJ6A 3QX1A 3QA8A 4IWOA 3CF6E 1WJ4A 4B6WA 3RYTA 3KH0A 2BYFA 4EEWA 3EC8A 3H7PB 1WXVA 2NBWB 4II2B 3EECA 5DPWA 2LGXA 1YQBA 5E6NA 3DVGY 1BT0A 5CHFA 3WALA 4ZDVA 1D3ZA 2LJ5A 3VHTC 3PV1A 1E90A 1SE9A 2MA9B 2NCNA 2AL6A 3N32A 1V2YA 1E8ZA 2KJHB 3NZUA 4NNJB 2FCMA 1EF1A 2AWTA 2BGFA 3ZW3A 1WIAA 1LQBA 2LI5A 1OEYJ 4G3XB 3V6CB 4EKUA 1ZW7A 4FHJA 2C7HA 3DQVA 2KJ6A 2L7RA 3MJWA 2N7EA 4TUUA 4HPMB 2ZCCA 3V62A 2JPHA 3ZTDA 5FR6A 2V3SA 2KXJA 2GBMA 3APFA 2LVOA 4ICVA 2JWZA 3M3JA 3H7SA 3QK0A 2J0KA 4G11A 4KVGB 4GOCA 3DBHI 1WGRA 1M94A 4GU2A 1E5WA 3HM3A 3QHTA 2JT4B 4PYUA 4F1SA 4WJPA 1E7VA 2C9WB 2JRIB 1SGHA 2FIDA 3WAPA 4W9JA 3A1QB 2C7NB 5D2MB 1WR6E 2IYDB 2DENB 3CSFA 4G50A 5L95C 4FN2A 3A9KA 3R66C 3T8MA 4ZYNA 1V49A 2KK8A 4KIKA 2N4FA 2KX0A 5C1ZA 1G6JA 4W9DA 3W1SC 4HXDA 1E8XA 4MGIE 4GDLA 4K7WA
chains in the Genus database with same CATH superfamily
2O6VD 2BW2A 4TQ0A 3ZVVA 4NQLB 4WAAA 4BOZB 4LDTB 3PPAA 5D7GA 1TZ1A 5G55A 2Z8LA 5JHAA 1K52A 3OLMD 3RCZA 1D4BA 5EE0A 3RNBC 2D3CA 1WI0A 3V6EB 1KLVA 2LWPA 4MH0E 4FBJB 3PT2B 4PS8A 1ZPSA 3RZWC 5LNK1 2UU7A 4ZRQA 3Q8BA 4DHZE 2IPKD 4LDTD 3VR9B 4JL9A 2KT7A 1IPGA 1WXQA 1Z2MA 3EFCA 1PQSA 1ZGUB 3GZNB 2L52A 4KSLC 3KUDB 4Q2JA 5BMGA 4JIOU 1P7EA 3BY4B 4A3PA 1YNTE 2M1MA 5H8YE 3R3MA 4XYCA 3N1ZC 3QARA 1V1OA 1JW9D 1OGWA 3ZIMA 2BVCA 4BFRA 2KLCA 4B9KA 1OQQA 1JWMD 3ZNZB 2XNAC 4HDQA 1HZ6A 4F8CB 2OEDA 5DPRA 2DAFA 3NY5A 2PKOA 3QAQA 1XF5L 2JY6A 1YX6B 4RM8A 1WY8A 2IO0B 3Q3JA 1QOAA 3PHWB 1L6VA 4ICUA 5BYQA 4MGZE 2WXPA 1TZOA 2RPVA 4PYZA 2FCQA 2KDMA 3U7DA 4XDDA 3CSTA 4LLGM 3W5UB 1WGDA 1WFYA 2ZCBA 2GBKA 5CX3A 3AEEB 4KZCA 4ZRPA 2CR5A 5G5HA 2CU1A 2RGFA 1UWMA 1L0VB 1YQ4B 2LZ6A 4JX1C 4C4VB 1F52A 2YVCA 1YD8U 2R2QA 5CHWA 3APCA 4P6VF 4RGTA 2MHJA 4BZAA 1V1PB 5BYRA 2KDIA 3SD5A 1T0QC 1MFWA 2PE9A 1FNUA 1SSNA 3AE9B 1I4PA 2W9NA 3VUXA 3H1UA 2ZPYA 4B0EA 3SDLC 5G2NA 4XWWA 1PDXA 4II3B 2BTEA 4K81A 3DWMA 1P3QU 3B0AA 3V3XA 3VH3B 4HPLB 1GJZA 1WJUA 4ZRKA 5C2TB 2KQ7A 5KHOA 1RM6C 4W9CA 3ZRFA 4LJPB 1FEHA 3BIID 1UBQA 4MSQB 4RGMA 1QOGA 1NENB 1JRPA 2YLMA 2WQYB 2DYBA 1V81A 4LNOA 2KWDA 2DX5B 3DCGA 3ZXRA 2DBYA 3VAWA 2OHFA 1GC7A 1L7YA 2I38A 2FCSA 3Q3MC 3D32A 4IUMB 1HTQA 4HEA1 2D11A 3BK2A 4JPSA 2WXOA 4GGQA 4AUQC 4E74A 2V3NA 4CHKA 4URKA 1ZDXA 4I6PA 1OFFA 2LUEA 1I4GA 3JYUA 4PS7A 2K22A 1IGDA 1UNSA 2HDEA 2ON8A 4HK2A 2R61A 1C4AA 3L10B 4JWUC 3H6NA 2XK5B 3VUYA 2W82A 5C3JB 2KX3A 1P0RA 1WGHA 1FRRA 2KTRB 2XN9C 4AQ7A 2JRHA 2QJLA 2INDC 2LMCA 2M4NA 3B1LX 3QCAA 3ZLZA 3MP9A 4HRSA 2PEAA 1F77A 5BMHA 2KMAA 2M19A 1WXMA 2ZNVB 4B0MA 2G1EA 2CHXA 1J7CA 4RM9A 2C7MB 2JYEA 5D94A 3AE2B 1J7BA 2JUOA 1Y56A 4WWMA 3W2DA 4CQNA 3I57A 4ZHOA 4MT5A 3PVLA 3BINA 1XQQA 3T3OA 5IOIA 3OJ4B 1R4NI 4YTNB 2MLBA 3PZ8A 1DYQA 3PHXB 3Q8EA 4BAXA 4BBNF 3Q8FA 1TKGA 3Q3FA 2L32A 1KFYB 3WA0A 3PREA 3TIXA 5JHBA 3RMKC 3IAM1 1KTKA 2NPTA 1R7SA 1TJEA 2GB1A 4I6LB 2K25A 3BYTB 4PT5A 3P4SB 4KSKC 5FKAC 3NVWA 1C3TA 5BO4B 2BKRB 3BWUD 2MP2B 2L1AA 4IM3A 4MJSA 3MTNB 4ARIA 2QMTA 3P42A 1FPYA 2XBBC 3TEYA 1F2RC 2W54A 3A1QA 2WDTB 1E9MA 3E9SA 1RYJA 4HCPB 2WWZA 3HVDA 4AS1A 3J9CA 1I42A 1Z5SB 3DOWA 1N61A 4HJGE 1XT9B 3VTWA 1FNWA 2NMQA 3A4RA 2UWQA 3W5VB 2IGGA 4PS3A 1LXDA 4BVUC 2QILA 2HD5B 3ONSA 1L5PA 3ZO5B 3WIMA 3KVFB 2BB5A 3TL5A 2KDFB 3ZYYX 1WM2A 3U4EG 3N20C 4G0NB 1C1YB 4IC7B 2EMSA 2EKIA 2V1YA 1YJ1A 4P7IA 3QA8A 2LGSA 3AE8B 4B6WA 2BYFA 1I4RA 3H7PB 1WXVA 2NBWB 2JWUA 4II2B 3AB5A 2LJ5A 5TSSA 2NCNA 1EU3A 1V2YA 4NNJB 2FCMA 1OQRA 2AWTA 2BGFA 2PW9A 3FILB 3V6CB 1QT9A 4EKUA 3DQVA 2IGDA 3OWEB 2E6XA 4TUUA 3C8YA 2JPHA 3ZTDA 2KXJA 2GBMA 4IKGA 3MC8A 4KVGB 3AE6B 1WYGA 4M01A 3DBHI 4KGRA 3QHTA 2JYTA 2C7NB 3CSFA 2QIEB 4ZYNA 4XDCA 2N4FA 1HA5A 2ZW0A 2MJ3A 4GDLA 3SFEB 2W3RA 1EUVB 4FJZA 3V05A 2KN5A 2CJOA 2O2VB 3AH7A 4W9HA 4A8XC 4OW0A 2GBNA 3UINB 4K7SA 5HG2A 1K8RB 3N3KB 3AEAB 1EF5A 3IVFA 2Y5BB 4AP4C 1LFDA 2HTHA 4YL8A 2WX0A 4GB9A 5LLIA 1AWDA 4PK1A 3HIZA 2MWSB 1NEKB 2L05A 4XC2A 3TEWA 1RRBA 3EGRA 2N1WA 1VDVA 3DPDA 1PGXA 3KLSX 1E0ZA 2QHOA 1TGZB 1XO3A 2TSSA 2KQSA 2H88B 4W9KA 4ANXA 1UH6A 1S1QB 2KO3A 4C00A 4NAWA 3CIRB 1YN3A 1WH3A 4XE0A 4USAA 2RPQA 1GNUA 2KHWB 4US9A 1XLPA 3DHIC 1VZ6A 1N63A 4ZOHC 3A33B 5HI1A 2QSDA 2VRRB 3M95A 3LJ3A 2JZPA 4FA6A 2PVOD 2WYQA 2Z0DB 2IY0B 3A9KB 3DVNU 2QDFA 2GBJA 1P7FA 3IT6B 2NPTB 3ZXVA 3B08A 1ZE3D 3K9PB 1C4CA 3U52E 4YWGG 1XXGA 1QOBA 3H9DA 3X0WA 4WQOB 2KC1A 4MJSB 2ICIA 4W9EA 1FNVA 4BBNC 2YEPF 3P4RB 2L83A 2NBUA 2XK5A 4RF0A 3RNFC 1TS2A 5FR3A 2RDGA 2KTRA 3NOBA 4KKIA 2ZPNA 4JWSC 2K8BA 4N58A 1LGRA 2LXCA 2C60A 2ZVOA 4FHKA 2BYEA 1XLQA 1MG8A 1YX5B 4DK5A 1QZEA 3X23A 3NUHB 2IZVB 1SE4A 1FFUA 1MVKA 4NAMA 3T9LA 3KWLA 1ENFA 4KX6B 2N9XA 2K6DB 3QQ8B 2KNBA 3AV8A 2MEKA 2BKFA 2CJNA 1BMLC 2KANA 5D3IB 2EMTA 1FCLA 4LNKA 2B3AA 2MBOA 1R4NB 3ZDMC 4M02A 3RT3B 2MBHA 4YSZB 2LASA 3KYDD 3TBLD 3FC4A 3DWGC 1WSPA 1FD6A 2CS4A 2JVCA 3AE4B 1IYFA 3AU4A 2BF8B 3P63A 2N0SB 4BKSA 2MRPA 4RNAA 3RNGC 1ACCA 1TKEA 3SEBA 1FIQA 1NVID 1F1HA 3T3NA 1VRAB 4EZKA 1P9DU 2K9XA 4ANVA 1NI2A 2MP2A 1CK1A 5MPOA 2DAJA 3ZNHB 2KKCA 1WGYA 1HXYD 2I1JA 1D6EC 1JCKB 2ZVNA 4TSSA 2WHIA 4AOFA 1PGBA 1WE7A 3DBSA 2ASQA 3ECIA 3I3TB 2KFKB 3DVNV 4E3CA 1SEBD 1E6EB 1WMHB 2V4IB 5AUIA 3ML8A 3ZQ4A 3JSVB 3HM6X 3MC0B 2ACZB 4GDLB 1WYWB 3W9CB 2VH1A 2Z59B 5DPSA 1IGCA 1V80A 1WGGA 1L2NA 1U4AA 3PLUA 3IBEA 2DZIA 3M62B 4CYEA 4DXAB 4GSWA 1WZ0A 1YJJA 2XEWA 1E7PB 2I1KA 4N9F4 3ZKJC 1UD7A 3N1XC 3VDZA 4XGAB 4OVUA 5DCNA 1C78A 2R2OA 2PJHA 4IDIA 1XCTL 2DLBA 4FJYA 4KDLB 3I5JC 3CWIA 3I63C 1MJDA 3H7PA 2BYTA 1GC6A 2GI9A 2BWFA 2V9HA 3HHMA 3A9JB 2DZJA 2KWCA 3ML9A 4M00A 2Y5CA 2KMCA 3JVZX 3RI7C 5JZEB 5GMVA 1MHHE 1C79A 4I6NB 3FILA 2PVGC 5GXGB 1T0RC 4LCDE 3GB1A 4YSYB 2K5PA 2L0FA 1JWSD 1C9FA 3R7QA 1S3SG 4XX5A 1IUEA 4NAWB 3AULA 4JLCA 2JU6X 1YOVB 3R8BA 3S2AA 3VH4B 1WM3A 3DBHB 1XEEA 1V9JA 3DDCB 3ZJTA 2D3AA 3U8ZA 3IG3A 3VXWA 3Q8CA 2WNMA 4LNIA 2REXA 3EUB2 2PTLA 1J8CA 3AXCA 5IA7A 3RPFC 4KZ0A 3L0WB 4WJQA 2X38A 4W9IA 4WWNA 1ROEA 3CMMB 4NY0A 1QOFA 1XD3B 2FCNA 4P16A 1ZDVA 1OTRB 3UF8A 2LVQA 4C7ZA 5CHVC 4A20A 3PTFC 2O2VA 5H92C 2OJRA 3R2TA 4KGSA 1KLUD 3W1SA 4HKQA 3WAMA 1UGMA 2V0GA 1UGJA 4WWOA 1WR1A 2LGYA 3UIPB 1KJTA 3E56A 3L13A 3AM9A 4AJWA 2AL3A 3MHSD 2JZZA 4IWOA 1PGAA 2K3UA 5CHFA 4DQOC 4ZDVA 1D3ZA 2G9HD 1EM7A 1RFKA 3GS2A 2AL6A 2KJHB 1SJHD 1EF1A 1WIAA 1LQBA 1OEYJ 1ET9A 5EE1A 4QAYA 1TYGB 4FHJA 4HPMB 2V3SA 3Q6BA 2JWZA 3H7SA 4GOCA 1E5WA 3HM3A 4PYUA 2JT4B 3NJTA 4WJPA 1E7VA 2C9WB 2FIDA 2BS4B 4W9JA 1WR6E 2IYDB 4G50A 4FN2A 3A9KA 3R66C 4S17A 3T8MA 5EE3A 1V49A 2PLPA 2AQ2B 1SE2A 2E3TA 4HXDA 1E8XA 1STEA 4O1NA 3UI3A 1ZUD2 4MM3B 1DOYA 3B9JA 4D2KA 2NTSA 1M4VA 2KWVB 3PO0A 2WXHA 1SF0A 2QCZA 1RLFA 2M56B 2WS3B 3UGBB 2MBQA 2IJ0A 4GN1A 5T8IA 3AEBB 3K9OB 2WXRA 1VR9A 4HKZE 4BKSD 4MH8A 4WURA 1VLBA 2WU5B 2K0PA 1PUTA 4ITKA 2WX1A 1P1AA 2A4ZA 2W55A 4L1BA 5E6JA 1QQRA 3GOEA 3KUZA 1JRUA 1EWCA 4N6EB 1A5RA 4L2YA 3VTUA 1WE6A 4MGKE 4XWTA 4M0WA 1L0YB 2VZKB 5J18A 4WH4A 2I2YA 3FKYA 2MJEA 4EUTA 3P2BA 1WX7A 2OOBB 3EA6A 1I7HA 1GG3A 1T5XD 4TMAB 1T0SC 2RDBC 3RUIB 1K51A 2BS2B 1WX9A 3KUCB 4K7UA 1D5ZC 3ZRCA 4BOSC 1QKZA 2VZKD 1TS5A 1BUIC 4YXDB 5AEKB 2K8CA 1TS3A 4JGHB 4MACA 4MDKE 4GLSC 1UF0A 1X1MA 3KYCD 3QIJA 2WXMA 5I4DA 3TMPB 2WXLA 4MEMA 4OZBA 5D6JB 2J53A 4EZLA 2LRUA 3NS8A 1WJ6A 1TIFA 3VFKA 2HE7A 2KTFA 4IWPA 2MW5A 1P98A 4W9GA 2BS3B 4N59A 3SHQA 4BKGA 3Q3NC 2Y5PA 3ENEA 3APDA 2KFKA 2C5LC 2V4LA 2WXFA 1PFDA 2KFJA 2Q5WD 4GDKA 1FCCC 1WMHA 5BYSA 1TT5B 1BXTA 1CJEA 4A90A 1V97A 1L6UA 1WWTA 3JSVA 4A55A 4RCOA 1MHXA 2KDBA 4RH6A 2G4DB 4TQ1A 4W9FA 2EKEC 1QF6A 5E6OA 3GE8C 1FRDA 1V5TA 3VRBB 3VRAB 5L83A 1GAQB 1QLBB 5DPTA 2AX5A 4TV3A 1FFVA 1EO6A 3MJ5A 5JXVA 2N7DA 2KVZA 2W3SA 3MC9A 3KWVA 2Z0EB 3NRZA 2JF5A 1SIJA 1AARA 2MQJA 4JE3B 3MFGA 2GLSA 3NZSA 2HJ8A 3A9JA 4BKTA 4JQWC 1JALA 3RNEC 2J7QB 2K8HA 2MBBB 3UQBA 4RFBA 1FMAD 2L00B 4GXBA 2RMMA 1WX8A 3LDZE 1N6ZA 2V3PA 3L17A 1XCQL 4RMAA 2FUG1 1GUAB 5LXIB 3VQIA 2KJRA 3PLVA 1SE3A 2PMVA 1TS4A 3TSSA 1TBEA 1PYWD 4MGYE 3A4SC 2NVUI 4HJKA 4IM2A 2ZNVC 3OJ3A 2VH2A 2GMIC 4K3BA 1FO4A 1CZPA 2G45B 4ZRJA 1SIFA 2CHZA 4KKJA 4P1BC 3PRMB 3V61A 2CKHB 3U2SC 1Q0WB 2WGSA 2WXNA 4TKNA 4X57B 1TY2A 2MJDA 3QWZB 3ZNGC 4FADA 5HHDG 1LO5D 4WJNA 1KOTA 2O6VB 1YIWA 3AE7B 3OAWA 3P4QB 3GP7A 1VCBA 1ZKHA 2D2QA 1VZ8A 1I35A 4WJOA 1HEZE 4DHZB 5AZFA 1J7AA 1IBXA 4M0WB 2FE8A 3PRPB 3WANA 2LXAA 2WP9B 3AU5A 2K39A 3BVMA 2JSVX 4MELA 1OQYA 3IXSA 5E6PA 2LJIA 1DGJA 1NBFC 2PIAA 4IM0A 4DWFA 2PE6B 1FXIA 4AWJA 4IOIE 5AZGA 4YT0B 3Q3OC 3RZFA 1N5WA 1L4DB 3C0RB 1JQ4A 2L8JA 4EOYA 1WJNA 3DVGX 1I4XA 1E7UA 2K6QA 3HK0A 5EDSA 5LXHA 3U7ZA 2G3QB 3H8HA 4FXCA 4M8MA 3EHVA 4R3DA 3TCAA 3WCQA 4NPNA 2DZMA 4LK0M 3B2GA 4OZAA 3BVGA 2RSUA 4LNNA 3VTVA 1VD2A 1AW7A 4MM3A 1A70A 2K1FA 1ISNA 2CHWA 3DHGC 1KM7A 2H89B 4YSXB 2CU3A 4DDGD 2JXTA 2NR2A 4EZJA 1R4MB 2BQQA 2KD0A 1NYRA 5HKHA 4HCNB 1TTNA 5CTRC 4MSMB 3RNAC 2KDEB 4GDKB 4LNFA 5J17A 3QX1A 3CF6E 2ZW1A 4NJCA 3SFDB 5DPWA 2LGXA 5E6NA 1BT0A 2WDVB 2KYWA 1E90A 2MA9B 1YJIA 4RF1A 1E8ZA 1V8CA 3ZW3A 1D5MC 2JX5A 2LI5A 3AE1B 2WU2B 1ZW7A 4HROA 4YTPB 3MJWA 2ZCCA 3ZJUA 5FR6A 2N9KA 5IP4D 3APFA 4YTMB 2LVOA 4ICVA 5HFYA 1ZOYB 3AE5B 3M3JA 3QK0A 4G11A 4L23A 3MHZA 1WGRA 1NYQA 4F1SA 5EE9A 5D2MB 2DENB 2OJWA 2EELA 2X8XX 4C80A 1FXAA 3ABVB 1G6JA 4W9DA 3W1SC 2B76B 4MGIE 2KACA 3GE3C 1SB3C 3ZNID 2LD9A 1T3QA 1KH0A 2PPHA 3O13A 1T0YA 2KMMA 2WDRB 2M0XA 3NVYA 5BMIA 2WXJA 4KDIC 2L0TA 4S0RA 4C56C 2D3GA 3L08A 1YN4A 1V86A 4DDID 4KV2A 3DBRB 1DOXA 2FUHB 1H8CA 4OVVA 4AJYB 4FULA 2J0MA 3NG0A 3ZDTA 3DBLI 4DHJB 4NJ7A 2RDHA 5AZHA 3Q8AA 1J0GA 4C7YA 3Q14C 2MCNB 3PSEB 1Q10A 4P1CC 1JWAD 2NTTA 3HRDD 1XLOA 2MBEA 1ZXIA 1RWSA 5IAAC 2INPE 1YN5A 3AI5A 2J4XA 1I4QA 1ET6A 4HVBA 2N1VA 1WRIA 1SJED 3HUIA 5TR5A 4DHJD 4US8A 2DZKA 3VR8B 3DHHC 1GB1A 1FXTB 3VUWA 1C4PA 3WAOA 4ZRIA 2NBVB 2NS5A 1EWYC 2KWUB 1MG4A 2L76A 2IO2B 3O65B 3ZUNA 2FBWB 2WXQA 3PS6A 2G4SA 1E8YA 2BYVE 1YMHE 4HLEA 1IBXB 2ZEQA 2LEKA 2D10A 2N7JA 1WXSA 1F0ZA 4KIKB 1IP9A 4DXFA 5G5GA 3AN1A 2J0JA 1UUPA 2ONQA 4LTUA 1L0XB 4IW0A 1LM8B 1C76A 3BK1A 2ZZPB 3IFWB 4J3OD 3PZDA 1FM0D 4EE2A 2IDYA 2QEJC 3VVWB 1ZXHA 2KN4A 1XLNA 1AYFA 1N5XA 4WAFA 4UDUC 2N9PC 3AECB 2KLGA 2DYOA 4REZA 4FLHA 4K1RB 2KOXA 1Q5WB 3ZGZA 1WXAA 4M8NA 3ETRA 2LVPA 3B2FA 1HZ5A 3U30A 2LUMA 1F2RI 1H4RA 2L3ZA 2SAKA 4DBGA 3ALBA 1JROA 5AUKA 2DNFA 2KZRA 3KW5B 1UBIA 1WRDB 3GZNI 3L16A 1B1ZA 2KVRA 5JH5C 2AQ1B 2LHEA 1R4MI 2N9LA 2BBCA 4HDOA 2O6VA 2JZ3B 4B95A 3TEXA 5C23A 2KAJA 3LYYA 4FJVB 2SEBD 3V60A 4NQKE 3N30A 4HWIB 1QILA 2INNE 1CMXB 2M8SA 1V6EA 4EFOA 1GB4A 4ASWC 1HE8A 1JWUD 1ZP0B 2RD0A 1WZ3A 3EFUA 3PRZA 1NDDA 3URYA 3N1YC 3SU8X 1K50A 4DXGA 3BYYB 2FAZA 3OG5A 1EU4A 4IG7B 2LRWA 2MH7A 3PGEA 5IN7A 2FIFA 1E8WA 3NZ3A 2JXXA 1SBBB 1MPEA 3UQAA 2M0AA 2GOWA 2J42A 2GRIA 4W9LA 2IY1B 4OHJA 3R7RA 4CO7A 3RULA 1VJKA 5IKCM 2N9EB 2WXIA 1RAXA 2D07B 4RGNA 4A3OA 3RN9C 2DYMA 4NZLB 3L54A 3JW0X 1Q1OA 4J6IA 5IO9A 3IHPC 2RR9A 3Q2AC 4HPPA 4K3CA 1GPXA 4KGTA 1D5XC 3QJZA 3M63B 3NS1A 1Y8RC 3KQ4A 4WWPA 1T6BX 2WXKA 3P1MA 3L4PA 4ZYSA 4F7ZA 2BB6A 2DWQA 3BVZA 1HQRD 3DBRI 4GMVA 4IWQA 2D3BA 3HVZA 2KQ4X 1UZXB 1VZ7A 4RGOS 4E71A 1ESFA 3AMZA 4XZ4A 2BWES 3RFZB 1GOZA 3AEGB 1C77A 3UIOB 1V5OA 1KLGD 4OZCA 1J19A 2AYOB 2INCC 3ZJVA 3NHEB 1SXTA 3RD2A 1UELA 2AQ3B 2AEHA 3TJPA 3AEFB 4OVZA 1TY0A 3QC8B 2IBIB 2M17A 3R2IA 4A6QA 2ZJDA 3P4PB 4A9AA 2IO1B 1N62A 4ANWA 2D5GA 3I9V1 3RNCC 1I4HA 2KC2A 1RFAA 4ANUA 4C4VA 2LGIA 2GBRA 1UWXA 5J2RA 3TEZA 5KHQA 1K53A 1V1PA 2MSED 3C19A 5D3DA 1L4ZB 3NVZA 3ZTCA 4WQMA 2LHDA 2UYZB 2A5UA 2LGDA 1OEYA 3LXFA 4GIVA 3IT4B 3AE3B 2HTME 2MX2A 2Y3AA 4LJOB 1KF6B 1YQ3B 4ACFA 2IO3B 2JQRB 3W1YA 3BZDB 3IAS1 3AEDB 2BPSA 1WF9A 3DBLB 2DHZA 2FNJB 3LB8C 1N60A 2WDQB 2LFIA 1F9JA 4NJ6A 1HTOA 4ZHPA 2BT6A 1WJ4A 3RYTA 3KH0A 4EEWA 3EC8A 1AN8A 3EECA 1YQBA 1B9RA 3DVGY 1WGKA 3WALA 3VHTC 3PV1A 1KRHA 1CQVA 1SE9A 3N32A 3NZUA 2WXGA 2QC8A 5FK9C 3PZ7A 3N9YC 4G3XB 1MI0A 1NI3A 2WLBA 2C7HA 2KJ6A 2L7RA 2N7EA 3Q69A 3V62A 3TUOA 2YEPB 1TKYA 3FAHA 1E10A 3NVVA 2J0KA 2J52A 1M94A 4GU2A 4H2AA 2JRIB 3SR6A 4WIPA 1SGHA 3WAPA 3A1QB 1DOIA 5L95C 1JWBD 1JMLA 2KK8A 4KIKA 4ARCA 2HJ1A 2KX0A 5C1ZA 2IGHA 4K7WA
chains in the Genus database with same CATH topology
2O6VD 3ZNID 2LD9A 1EUVB 4FJZA 4TQ0A 2PPHA 3ZVVA 2KN5A 1T0YA 2KWVB 4NQLB 4WAAA 4BOZB 4LDTB 3PPAA 2O2VB 5D7GA 2M0XA 1TZ1A 1RLFA 4W9HA 5G55A 4KDIC 5JHAA 3UGBB 2MBQA 3OLMD 2GBNA 3RCZA 4GN1A 3UINB 4K7SA 2L0TA 3K9OB 2D3GA 1WI0A 3L08A 1V86A 1K8RB 4DDID 3V6EB 1KLVA 4KV2A 3N3KB 4BKSD 2LWPA 4MH0E 1EF5A 2FUHB 4FBJB 1H8CA 4OVVA 3IVFA 3PT2B 4PS8A 4AJYB 2Y5BB 2J0MA 4FULA 1LFDA 2WX1A 3RZWC 3ZDTA 4AP4C 1P1AA 2HTHA 3DBLI 4YL8A 4DHJB 2A4ZA 2WX0A 4GB9A 4DHZE 5LLIA 4NJ7A 5AZHA 4LDTD 3GOEA 3KUZA 1JRUA 1A5RA 3HIZA 2MWSB 3VTUA 2L05A 1WE6A 1J0GA 4MGKE 4XC2A 4JL9A 1RRBA 2MCNB 1IPGA 2N1WA 3DPDA 3PSEB 1Z2MA 5J18A 1PQSA 1ZGUB 2MBEA 2QHOA 4KSLC 3KUDB 1TGZB 5IAAC 4EUTA 3P2BA 3BY4B 4JIOU 4A3PA 4W9KA 2KQSA 3AI5A 4ANXA 1WX7A 2M1MA 1UH6A 1S1QB 2OOBB 2KO3A 1GG3A 3R3MA 4HVBA 2N1VA 4NAWA 3QARA 5TR5A 1WH3A 4DHJD 2RPQA 2DZKA 1GNUA 1OGWA 2KHWB 3ZIMA 4BFRA 1FXTB 3VUWA 2KLCA 3WAOA 4B9KA 4ZRIA 2NBVB 2NS5A 3ZNZB 4HDQA 3RUIB 2KWUB 2L76A 3A33B 2IO2B 3O65B 3ZUNA 4F8CB 1WX9A 3KUCB 4K7UA 2VRRB 5DPRA 3PS6A 3ZRCA 2DAFA 3M95A 4BOSC 3NY5A 3LJ3A 2G4SA 1E8YA 5AEKB 2BYVE 2K8CA 4FA6A 3QAQA 4HLEA 4JGHB 2WYQA 2Z0DB 2IY0B 2ZEQA 4MDKE 3A9KB 2JY6A 2D10A 1YX6B 3DVNU 4RM8A 1WXSA 1X1MA 3KYCD 1WY8A 2IO0B 2GBJA 3Q3JA 3QIJA 4KIKB 1IP9A 3PHWB 2NPTB 4ICUA 3TMPB 3B08A 4MGZE 2J0JA 3K9PB 4MEMA 5D6JB 4PYZA 2FCQA 3U7DA 3CSTA 4EZLA 4IW0A 1LM8B 2LRUA 2ZZPB 3H9DA 3IFWB 1WGDA 3PZDA 3X0WA 3NS8A 1WFYA 1WJ6A 2ZCBA 2GBKA 5CX3A 3VFKA 4WQOB 2KC1A 4MJSB 2HE7A 2KTFA 4IWPA 2MW5A 3VVWB 4W9EA 4KZCA 1P98A 4W9GA 2CR5A 4BBNC 2CU1A 3SHQA 4BKGA 2RGFA 2NBUA 3ENEA 2N9PC 2XK5A 2LZ6A 3APDA 2KFKA 2C5LC 2KLGA 2V4LA 2YVCA 2KFJA 2DYOA 4GDKA 1YD8U 1WMHA 2R2QA 2KTRA 3NOBA 4FLHA 4K1RB 2ZPNA 5CHWA 2KOXA 3APCA 2K8BA 2LXCA 2C60A 2ZVOA 1Q5WB 3JSVA 4FHKA 1WXAA 2BYEA 2KDIA 2KDBA 3SD5A 1MG8A 4M8NA 1YX5B 2LVPA 4DK5A 2G4DB 1QZEA 4TQ1A 4W9FA 2PE9A 3X23A 2EKEC 3U30A 2IZVB 3T9LA 1H4RA 2L3ZA 2W9NA 3VUXA 2N9XA 2K6DB 3ALBA 3H1UA 5E6OA 4DBGA 2ZPYA 3QQ8B 3SDLC 2KNBA 5G2NA 2BKFA 1V5TA 5L83A 2KZRA 5DPTA 4II3B 4TV3A 3KW5B 4K81A 1EO6A 2KANA 1UBIA 1P3QU 1WRDB 3B0AA 3GZNI 3VH3B 3L16A 2EMTA 4HPLB 1WJUA 4ZRKA 1GJZA 2KQ7A 2KVRA 5KHOA 5JH5C 1R4MI 2N7DA 4HDOA 4W9CA 2O6VA 3ZRFA 4LJPB 2B3AA 2JZ3B 2MBOA 2Z0EB 4B95A 2JF5A 3ZDMC 3RT3B 2MBHA 2LASA 5C23A 3KYDD 3TBLD 1UBQA 4FJVB 4MSQB 1AARA 3V60A 2MQJA 4NQKE 3N30A 4HWIB 2M8SA 1CMXB 2YLMA 1V6EA 2CS4A 2JVCA 4EFOA 3NZSA 4ASWC 2DYBA 2HJ8A 1V81A 1HE8A 3A9JA 2DX5B 4BKTA 4JQWC 1IYFA 3AU4A 2BF8B 3DCGA 2RD0A 3PRZA 1WZ3A 3EFUA 3VAWA 1NDDA 4BKSA 2MRPA 1GC7A 2J7QB 3SU8X 1L7YA 2K8HA 2FCSA 3D32A 2FAZA 4IUMB 2D11A 2MBBB 3UQBA 4IG7B 2LRWA 2L00B 4GXBA 4EZKA 1P9DU 1WX8A 4GGQA 4ANVA 1NI2A 3PGEA 3LDZE 2MP2A 4AUQC 4E74A 2FIFA 4CHKA 4URKA 2DAJA 3L17A 3ZNHB 1E8WA 2KKCA 4I6PA 2JXXA 4RMAA 2LUEA 1WGYA 4PS7A 3JYUA 2I1JA 1GUAB 5LXIB 3VQIA 3UQAA 2KJRA 2ZVNA 3PLVA 2GOWA 4HK2A 4AOFA 3L10B 1WE7A 3DBSA 4W9LA 2IY1B 3R7RA 2ASQA 3H6NA 1TBEA 2XK5B 3VUYA 3ECIA 3I3TB 4CO7A 2KFKB 2KX3A 4MGYE 3RULA 1P0RA 1WGHA 3A4SC 3DVNV 2NVUI 4E3CA 4HJKA 4IM2A 2N9EB 1WMHB 2ZNVC 2KTRB 3OJ3A 2GMIC 1RAXA 2D07B 3ML8A 3JSVB 3HM6X 4A3OA 2DYMA 2JRHA 3L54A 2G45B 4GDLB 4ZRJA 3JW0X 1WYWB 1SIFA 1Q1OA 4J6IA 2Z59B 2M4NA 3B1LX 3QCAA 3IHPC 5DPSA 2RR9A 3ZLZA 1V80A 1WGGA 2CHZA 2PEAA 1L2NA 2KMAA 1U4AA 3PLUA 3IBEA 2DZIA 1WXMA 2ZNVB 2CKHB 3M62B 3PRMB 3QJZA 4GSWA 3V61A 4DXAB 1WZ0A 2XEWA 1Q0WB 2I1KA 3M63B 2CHXA 1Y8RC 4TKNA 4X57B 4WWPA 4RM9A 2C7MB 4N9F4 3ZKJC 1UD7A 5D94A 2JUOA 3VDZA 4OVUA 4F7ZA 5DCNA 3QWZB 3PVLA 3ZNGC 3BINA 4FADA 4WJNA 1KOTA 1XQQA 2O6VB 2R2OA 1YIWA 2PJHA 3DBRI 4FJYA 4KDLB 3OAWA 1VCBA 1ZKHA 1R4NI 3OJ4B 4GMVA 2D2QA 2MLBA 4IWQA 1UZXB 4E71A 3H7PA 1I35A 1GC6A 3PHXB 4WJOA 2BWFA 4XZ4A 4BBNF 2BWES 3HHMA 4DHZB 3A9JB 5AZFA 2DZJA 2KWCA 3ML9A 3JVZX 2KMCA 3Q3FA 5JZEB 4M0WB 3UIOB 1V5OA 3PRPB 5GMVA 3WANA 2LXAA 3WA0A 3AU5A 1J19A 2AYOB 3PREA 2K39A 3TIXA 4I6NB 5JHBA 3NHEB 3RD2A 1UELA 4MELA 2NPTA 1OQYA 2AEHA 5E6PA 3TJPA 4I6LB 1NBFC 4IM0A 4LCDE 2L0FA 4DWFA 2K25A 3R7QA 2PE6B 1S3SG 4KSKC 4AWJA 4XX5A 5AZGA 4NAWB 3AULA 2BKRB 4JLCA 2MP2B 5BO4B 3RZFA 3QC8B 1C3TA 2IBIB 3C0RB 4IM3A 2L8JA 3S2AA 1WJNA 3VH4B 1WM3A 4EOYA 4MJSA 2M17A 3MTNB 1V9JA 2ZJDA 3DDCB 2IO1B 3U8ZA 3DVGX 2XBBC 4ANWA 3IG3A 1E7UA 3VXWA 2K6QA 3HK0A 2REXA 2KC2A 1RFAA 2WDTB 3A1QA 4ANUA 5EDSA 1J8CA 5LXHA 3AXCA 2G3QB 5IA7A 4M8MA 3EHVA 4KZ0A 2GBRA 3TCAA 3L0WB 4HCPB 4NPNA 4WJQA 5J2RA 2DZMA 4CYEA 5KHQA 4W9IA 4WWNA 2MSED 2WWZA 2RSUA 3CMMB 3VTVA 4NY0A 1VD2A 1XD3B 2FCNA 1I42A 1Z5SB 1OTRB 3UF8A 2LVQA 4MM3A 5CHVC 4A20A 3DOWA 2K1FA 3ZTCA 1ISNA 2CHWA 1XT9B 3VTWA 3PTFC 2O2VA 3A4RA 1KM7A 2UWQA 2UYZB 2OJRA 2A5UA 2LGDA 1OEYA 4GIVA 2MX2A 3W1SA 4PS3A 1LXDA 4BVUC 4LJOB 4DDGD 3WAMA 2NR2A 4EZJA 1UGMA 2HD5B 3ONSA 4WWOA 2IO3B 1WR1A 3WIMA 3ZO5B 2KD0A 3KVFB 2LGYA 3W1YA 3TL5A 3UIPB 1KJTA 2KDFB 5HKHA 1WM2A 4HCNB 1TTNA 3L13A 5CTRC 2BPSA 4MSMB 4AJWA 2KDEB 1C1YB 4G0NB 1WF9A 4GDKB 2DHZA 2FNJB 4IC7B 2AL3A 2EMSA 2V1YA 1YJ1A 3MHSD 4P7IA 2JZZA 5J17A 1F9JA 4NJ6A 3QX1A 3QA8A 4IWOA 3CF6E 1WJ4A 4B6WA 3RYTA 3KH0A 2BYFA 4EEWA 3EC8A 3H7PB 1WXVA 2NBWB 4II2B 3EECA 5DPWA 2LGXA 1YQBA 5E6NA 3DVGY 1BT0A 5CHFA 3WALA 4ZDVA 1D3ZA 2LJ5A 3VHTC 3PV1A 1E90A 1SE9A 2MA9B 2NCNA 2AL6A 3N32A 1V2YA 1E8ZA 2KJHB 3NZUA 4NNJB 2FCMA 1EF1A 2AWTA 2BGFA 3ZW3A 1WIAA 1LQBA 2LI5A 1OEYJ 4G3XB 3V6CB 4EKUA 1ZW7A 4FHJA 2C7HA 3DQVA 2KJ6A 2L7RA 3MJWA 2N7EA 4TUUA 4HPMB 2ZCCA 3V62A 2JPHA 3ZTDA 5FR6A 2V3SA 2KXJA 2GBMA 3APFA 2LVOA 4ICVA 2JWZA 3M3JA 3H7SA 3QK0A 2J0KA 4G11A 4KVGB 4GOCA 3DBHI 1WGRA 1M94A 4GU2A 1E5WA 3HM3A 3QHTA 2JT4B 4PYUA 4F1SA 4WJPA 1E7VA 2C9WB 2JRIB 1SGHA 2FIDA 3WAPA 4W9JA 3A1QB 2C7NB 5D2MB 1WR6E 2IYDB 2DENB 3CSFA 4G50A 5L95C 4FN2A 3A9KA 3R66C 3T8MA 4ZYNA 1V49A 2KK8A 4KIKA 2N4FA 2KX0A 5C1ZA 1G6JA 4W9DA 3W1SC 4HXDA 1E8XA 4MGIE 4GDLA 4K7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O6V D;  3ZNI D;  2LD9 A;  1EUV B;  4FJZ A;  4TQ0 A;  2PPH A;  3ZVV A;  2KN5 A;  1T0Y A;  2KWV B;  4NQL B;  4WAA A;  4BOZ B;  4LDT B;  3PPA A;  2O2V B;  5D7G A;  2M0X A;  1TZ1 A;  1RLF A;  4W9H A;  5G55 A;  4KDI C;  5JHA A;  3UGB B;  2MBQ A;  3OLM D;  2GBN A;  3RCZ A;  4GN1 A;  3UIN B;  4K7S A;  2L0T A;  3K9O B;  2D3G A;  1WI0 A;  3L08 A;  1V86 A;  1K8R B;  4DDI D;  3V6E B;  1KLV A;  4KV2 A;  3N3K B;  4BKS D;  2LWP A;  4MH0 E;  1EF5 A;  2FUH B;  4FBJ B;  1H8C A;  4OVV A;  3IVF A;  3PT2 B;  4PS8 A;  4AJY B;  2Y5B B;  2J0M A;  4FUL A;  1LFD A;  2WX1 A;  3RZW C;  3ZDT A;  4AP4 C;  1P1A A;  2HTH A;  3DBL I;  4YL8 A;  4DHJ B;  2A4Z A;  2WX0 A;  4GB9 A;  4DHZ E;  5LLI A;  4NJ7 A;  5AZH A;  4LDT D;  3GOE A;  3KUZ A;  1JRU A;  1A5R A;  3HIZ A;  2MWS B;  3VTU A;  2L05 A;  1WE6 A;  1J0G A;  4MGK E;  4XC2 A;  4JL9 A;  1RRB A;  2MCN B;  1IPG A;  2N1W A;  3DPD A;  3PSE B;  1Z2M A;  5J18 A;  1PQS A;  1ZGU B;  2MBE A;  2QHO A;  4KSL C;  3KUD B;  1TGZ B;  5IAA C;  4EUT A;  3P2B A;  3BY4 B;  4JIO U;  4A3P A;  4W9K A;  2KQS A;  3AI5 A;  4ANX A;  1WX7 A;  2M1M A;  1UH6 A;  1S1Q B;  2OOB B;  2KO3 A;  1GG3 A;  3R3M A;  4HVB A;  2N1V A;  4NAW A;  3QAR A;  5TR5 A;  1WH3 A;  4DHJ D;  2RPQ A;  2DZK A;  1GNU A;  1OGW A;  2KHW B;  3ZIM A;  4BFR A;  1FXT B;  3VUW A;  2KLC A;  3WAO A;  4B9K A;  4ZRI A;  2NBV B;  2NS5 A;  3ZNZ B;  4HDQ A;  3RUI B;  2KWU B;  2L76 A;  3A33 B;  2IO2 B;  3O65 B;  3ZUN A;  4F8C B;  1WX9 A;  3KUC B;  4K7U A;  2VRR B;  5DPR A;  3PS6 A;  3ZRC A;  2DAF A;  3M95 A;  4BOS C;  3NY5 A;  3LJ3 A;  2G4S A;  1E8Y A;  5AEK B;  2BYV E;  2K8C A;  4FA6 A;  3QAQ A;  4HLE A;  4JGH B;  2WYQ A;  2Z0D B;  2IY0 B;  2ZEQ A;  4MDK E;  3A9K B;  2JY6 A;  2D10 A;  1YX6 B;  3DVN U;  4RM8 A;  1WXS A;  1X1M A;  3KYC D;  1WY8 A;  2IO0 B;  2GBJ A;  3Q3J A;  3QIJ A;  4KIK B;  1IP9 A;  3PHW B;  2NPT B;  4ICU A;  3TMP B;  3B08 A;  4MGZ E;  2J0J A;  3K9P B;  4MEM A;  5D6J B;  4PYZ A;  2FCQ A;  3U7D A;  3CST A;  4EZL A;  4IW0 A;  1LM8 B;  2LRU A;  2ZZP B;  3H9D A;  3IFW B;  1WGD A;  3PZD A;  3X0W A;  3NS8 A;  1WFY A;  1WJ6 A;  2ZCB A;  2GBK A;  5CX3 A;  3VFK A;  4WQO B;  2KC1 A;  4MJS B;  2HE7 A;  2KTF A;  4IWP A;  2MW5 A;  3VVW B;  4W9E A;  4KZC A;  1P98 A;  4W9G A;  2CR5 A;  4BBN C;  2CU1 A;  3SHQ A;  4BKG A;  2RGF A;  2NBU A;  3ENE A;  2N9P C;  2XK5 A;  2LZ6 A;  3APD A;  2KFK A;  2C5L C;  2KLG A;  2V4L A;  2YVC A;  2KFJ A;  2DYO A;  4GDK A;  1YD8 U;  1WMH A;  2R2Q A;  2KTR A;  3NOB A;  4FLH A;  4K1R B;  2ZPN A;  5CHW A;  2KOX A;  3APC A;  2K8B A;  2LXC A;  2C60 A;  2ZVO A;  1Q5W B;  3JSV A;  4FHK A;  1WXA A;  2BYE A;  2KDI A;  2KDB A;  3SD5 A;  1MG8 A;  4M8N A;  1YX5 B;  2LVP A;  4DK5 A;  2G4D B;  1QZE A;  4TQ1 A;  4W9F A;  2PE9 A;  3X23 A;  2EKE C;  3U30 A;  2IZV B;  3T9L A;  1H4R A;  2L3Z A;  2W9N A;  3VUX A;  2N9X A;  2K6D B;  3ALB A;  3H1U A;  5E6O A;  4DBG A;  2ZPY A;  3QQ8 B;  3SDL C;  2KNB A;  5G2N A;  2BKF A;  1V5T A;  5L83 A;  2KZR A;  5DPT A;  4II3 B;  4TV3 A;  3KW5 B;  4K81 A;  1EO6 A;  2KAN A;  1UBI A;  1P3Q U;  1WRD B;  3B0A A;  3GZN I;  3VH3 B;  3L16 A;  2EMT A;  4HPL B;  1WJU A;  4ZRK A;  1GJZ A;  2KQ7 A;  2KVR A;  5KHO A;  5JH5 C;  1R4M I;  2N7D A;  4HDO A;  4W9C A;  2O6V A;  3ZRF A;  4LJP B;  2B3A A;  2JZ3 B;  2MBO A;  2Z0E B;  4B95 A;  2JF5 A;  3ZDM C;  3RT3 B;  2MBH A;  2LAS A;  5C23 A;  3KYD D;  3TBL D;  1UBQ A;  4FJV B;  4MSQ B;  1AAR A;  3V60 A;  2MQJ A;  4NQK E;  3N30 A;  4HWI B;  2M8S A;  1CMX B;  2YLM A;  1V6E A;  2CS4 A;  2JVC A;  4EFO A;  3NZS A;  4ASW C;  2DYB A;  2HJ8 A;  1V81 A;  1HE8 A;  3A9J A;  2DX5 B;  4BKT A;  4JQW C;  1IYF A;  3AU4 A;  2BF8 B;  3DCG A;  2RD0 A;  3PRZ A;  1WZ3 A;  3EFU A;  3VAW A;  1NDD A;  4BKS A;  2MRP A;  1GC7 A;  2J7Q B;  3SU8 X;  1L7Y A;  2K8H A;  2FCS A;  3D32 A;  2FAZ A;  4IUM B;  2D11 A;  2MBB B;  3UQB A;  4IG7 B;  2LRW A;  2L00 B;  4GXB A;  4EZK A;  1P9D U;  1WX8 A;  4GGQ A;  4ANV A;  1NI2 A;  3PGE A;  3LDZ E;  2MP2 A;  4AUQ C;  4E74 A;  2FIF A;  4CHK A;  4URK A;  2DAJ A;  3L17 A;  3ZNH B;  1E8W A;  2KKC A;  4I6P A;  2JXX A;  4RMA A;  2LUE A;  1WGY A;  4PS7 A;  3JYU A;  2I1J A;  1GUA B;  5LXI B;  3VQI A;  3UQA A;  2KJR A;  2ZVN A;  3PLV A;  2GOW A;  4HK2 A;  4AOF A;  3L10 B;  1WE7 A;  3DBS A;  4W9L A;  2IY1 B;  3R7R A;  2ASQ A;  3H6N A;  1TBE A;  2XK5 B;  3VUY A;  3ECI A;  3I3T B;  4CO7 A;  2KFK B;  2KX3 A;  4MGY E;  3RUL A;  1P0R A;  1WGH A;  3A4S C;  3DVN V;  2NVU I;  4E3C A;  4HJK A;  4IM2 A;  2N9E B;  1WMH B;  2ZNV C;  2KTR B;  3OJ3 A;  2GMI C;  1RAX A;  2D07 B;  3ML8 A;  3JSV B;  3HM6 X;  4A3O A;  2DYM A;  2JRH A;  3L54 A;  2G45 B;  4GDL B;  4ZRJ A;  3JW0 X;  1WYW B;  1SIF A;  1Q1O A;  4J6I A;  2Z59 B;  2M4N A;  3B1L X;  3QCA A;  3IHP C;  5DPS A;  2RR9 A;  3ZLZ A;  1V80 A;  1WGG A;  2CHZ A;  2PEA A;  1L2N A;  2KMA A;  1U4A A;  3PLU A;  3IBE A;  2DZI A;  1WXM A;  2ZNV B;  2CKH B;  3M62 B;  3PRM B;  3QJZ A;  4GSW A;  3V61 A;  4DXA B;  1WZ0 A;  2XEW A;  1Q0W B;  2I1K A;  3M63 B;  2CHX A;  1Y8R C;  4TKN A;  4X57 B;  4WWP A;  4RM9 A;  2C7M B;  4N9F 4;  3ZKJ C;  1UD7 A;  5D94 A;  2JUO A;  3VDZ A;  4OVU A;  4F7Z A;  5DCN A;  3QWZ B;  3PVL A;  3ZNG C;  3BIN A;  4FAD A;  4WJN A;  1KOT A;  1XQQ A;  2O6V B;  2R2O A;  1YIW A;  2PJH A;  3DBR I;  4FJY A;  4KDL B;  3OAW A;  1VCB A;  1ZKH A;  1R4N I;  3OJ4 B;  4GMV A;  2D2Q A;  2MLB A;  4IWQ A;  1UZX B;  4E71 A;  3H7P A;  1I35 A;  1GC6 A;  3PHX B;  4WJO A;  2BWF A;  4XZ4 A;  4BBN F;  2BWE S;  3HHM A;  4DHZ B;  3A9J B;  5AZF A;  2DZJ A;  2KWC A;  3ML9 A;  3JVZ X;  2KMC A;  3Q3F A;  5JZE B;  4M0W B;  3UIO B;  1V5O A;  3PRP B;  5GMV A;  3WAN A;  2LXA A;  3WA0 A;  3AU5 A;  1J19 A;  2AYO B;  3PRE A;  2K39 A;  3TIX A;  4I6N B;  5JHB A;  3NHE B;  3RD2 A;  1UEL A;  4MEL A;  2NPT A;  1OQY A;  2AEH A;  5E6P A;  3TJP A;  4I6L B;  1NBF C;  4IM0 A;  4LCD E;  2L0F A;  4DWF A;  2K25 A;  3R7Q A;  2PE6 B;  1S3S G;  4KSK C;  4AWJ A;  4XX5 A;  5AZG A;  4NAW B;  3AUL A;  2BKR B;  4JLC A;  2MP2 B;  5BO4 B;  3RZF A;  3QC8 B;  1C3T A;  2IBI B;  3C0R B;  4IM3 A;  2L8J A;  3S2A A;  1WJN A;  3VH4 B;  1WM3 A;  4EOY A;  4MJS A;  2M17 A;  3MTN B;  1V9J A;  2ZJD A;  3DDC B;  2IO1 B;  3U8Z A;  3DVG X;  2XBB C;  4ANW A;  3IG3 A;  1E7U A;  3VXW A;  2K6Q A;  3HK0 A;  2REX A;  2KC2 A;  1RFA A;  2WDT B;  3A1Q A;  4ANU A;  5EDS A;  1J8C A;  5LXH A;  3AXC A;  2G3Q B;  5IA7 A;  4M8M A;  3EHV A;  4KZ0 A;  2GBR A;  3TCA A;  3L0W B;  4HCP B;  4NPN A;  4WJQ A;  5J2R A;  2DZM A;  4CYE A;  5KHQ A;  4W9I A;  4WWN A;  2MSE D;  2WWZ A;  2RSU A;  3CMM B;  3VTV A;  4NY0 A;  1VD2 A;  1XD3 B;  2FCN A;  1I42 A;  1Z5S B;  1OTR B;  3UF8 A;  2LVQ A;  4MM3 A;  5CHV C;  4A20 A;  3DOW A;  2K1F A;  3ZTC A;  1ISN A;  2CHW A;  1XT9 B;  3VTW A;  3PTF C;  2O2V A;  3A4R A;  1KM7 A;  2UWQ A;  2UYZ B;  2OJR A;  2A5U A;  2LGD A;  1OEY A;  4GIV A;  2MX2 A;  3W1S A;  4PS3 A;  1LXD A;  4BVU C;  4LJO B;  4DDG D;  3WAM A;  2NR2 A;  4EZJ A;  1UGM A;  2HD5 B;  3ONS A;  4WWO A;  2IO3 B;  1WR1 A;  3WIM A;  3ZO5 B;  2KD0 A;  3KVF B;  2LGY A;  3W1Y A;  3TL5 A;  3UIP B;  1KJT A;  2KDF B;  5HKH A;  1WM2 A;  4HCN B;  1TTN A;  3L13 A;  5CTR C;  2BPS A;  4MSM B;  4AJW A;  2KDE B;  1C1Y B;  4G0N B;  1WF9 A;  4GDK B;  2DHZ A;  2FNJ B;  4IC7 B;  2AL3 A;  2EMS A;  2V1Y A;  1YJ1 A;  3MHS D;  4P7I A;  2JZZ A;  5J17 A;  1F9J A;  4NJ6 A;  3QX1 A;  3QA8 A;  4IWO A;  3CF6 E;  1WJ4 A;  4B6W A;  3RYT A;  3KH0 A;  2BYF A;  4EEW A;  3EC8 A;  3H7P B;  1WXV A;  2NBW B;  4II2 B;  3EEC A;  5DPW A;  2LGX A;  1YQB A;  5E6N A;  3DVG Y;  1BT0 A;  5CHF A;  3WAL A;  4ZDV A;  1D3Z A;  2LJ5 A;  3VHT C;  3PV1 A;  1E90 A;  1SE9 A;  2MA9 B;  2NCN A;  2AL6 A;  3N32 A;  1V2Y A;  1E8Z A;  2KJH B;  3NZU A;  4NNJ B;  2FCM A;  1EF1 A;  2AWT A;  2BGF A;  3ZW3 A;  1WIA A;  1LQB A;  2LI5 A;  1OEY J;  4G3X B;  3V6C B;  4EKU A;  1ZW7 A;  4FHJ A;  2C7H A;  3DQV A;  2KJ6 A;  2L7R A;  3MJW A;  2N7E A;  4TUU A;  4HPM B;  2ZCC A;  3V62 A;  2JPH A;  3ZTD A;  5FR6 A;  2V3S A;  2KXJ A;  2GBM A;  3APF A;  2LVO A;  4ICV A;  2JWZ A;  3M3J A;  3H7S A;  3QK0 A;  2J0K A;  4G11 A;  4KVG B;  4GOC A;  3DBH I;  1WGR A;  1M94 A;  4GU2 A;  1E5W A;  3HM3 A;  3QHT A;  2JT4 B;  4PYU A;  4F1S A;  4WJP A;  1E7V A;  2C9W B;  2JRI B;  1SGH A;  2FID A;  3WAP A;  4W9J A;  3A1Q B;  2C7N B;  5D2M B;  1WR6 E;  2IYD B;  2DEN B;  3CSF A;  4G50 A;  5L95 C;  4FN2 A;  3A9K A;  3R66 C;  3T8M A;  4ZYN A;  1V49 A;  2KK8 A;  4KIK A;  2N4F A;  2KX0 A;  5C1Z A;  1G6J A;  4W9D A;  3W1S C;  4HXD A;  1E8X A;  4MGI E;  4GDL A;  4K7W A; 
#chains in the Genus database with same CATH topology
 2O6V D;  2BW2 A;  4TQ0 A;  3ZVV A;  4NQL B;  4WAA A;  4BOZ B;  4LDT B;  3PPA A;  5D7G A;  1TZ1 A;  5G55 A;  2Z8L A;  5JHA A;  1K52 A;  3OLM D;  3RCZ A;  1D4B A;  5EE0 A;  3RNB C;  2D3C A;  1WI0 A;  3V6E B;  1KLV A;  2LWP A;  4MH0 E;  4FBJ B;  3PT2 B;  4PS8 A;  1ZPS A;  3RZW C;  5LNK 1;  2UU7 A;  4ZRQ A;  3Q8B A;  4DHZ E;  2IPK D;  4LDT D;  3VR9 B;  4JL9 A;  2KT7 A;  1IPG A;  1WXQ A;  1Z2M A;  3EFC A;  1PQS A;  1ZGU B;  3GZN B;  2L52 A;  4KSL C;  3KUD B;  4Q2J A;  5BMG A;  4JIO U;  1P7E A;  3BY4 B;  4A3P A;  1YNT E;  2M1M A;  5H8Y E;  3R3M A;  4XYC A;  3N1Z C;  3QAR A;  1V1O A;  1JW9 D;  1OGW A;  3ZIM A;  2BVC A;  4BFR A;  2KLC A;  4B9K A;  1OQQ A;  1JWM D;  3ZNZ B;  2XNA C;  4HDQ A;  1HZ6 A;  4F8C B;  2OED A;  5DPR A;  2DAF A;  3NY5 A;  2PKO A;  3QAQ A;  1XF5 L;  2JY6 A;  1YX6 B;  4RM8 A;  1WY8 A;  2IO0 B;  3Q3J A;  1QOA A;  3PHW B;  1L6V A;  4ICU A;  5BYQ A;  4MGZ E;  2WXP A;  1TZO A;  2RPV A;  4PYZ A;  2FCQ A;  2KDM A;  3U7D A;  4XDD A;  3CST A;  4LLG M;  3W5U B;  1WGD A;  1WFY A;  2ZCB A;  2GBK A;  5CX3 A;  3AEE B;  4KZC A;  4ZRP A;  2CR5 A;  5G5H A;  2CU1 A;  2RGF A;  1UWM A;  1L0V B;  1YQ4 B;  2LZ6 A;  4JX1 C;  4C4V B;  1F52 A;  2YVC A;  1YD8 U;  2R2Q A;  5CHW A;  3APC A;  4P6V F;  4RGT A;  2MHJ A;  4BZA A;  1V1P B;  5BYR A;  2KDI A;  3SD5 A;  1T0Q C;  1MFW A;  2PE9 A;  1FNU A;  1SSN A;  3AE9 B;  1I4P A;  2W9N A;  3VUX A;  3H1U A;  2ZPY A;  4B0E A;  3SDL C;  5G2N A;  4XWW A;  1PDX A;  4II3 B;  2BTE A;  4K81 A;  3DWM A;  1P3Q U;  3B0A A;  3V3X A;  3VH3 B;  4HPL B;  1GJZ A;  1WJU A;  4ZRK A;  5C2T B;  2KQ7 A;  5KHO A;  1RM6 C;  4W9C A;  3ZRF A;  4LJP B;  1FEH A;  3BII D;  1UBQ A;  4MSQ B;  4RGM A;  1QOG A;  1NEN B;  1JRP A;  2YLM A;  2WQY B;  2DYB A;  1V81 A;  4LNO A;  2KWD A;  2DX5 B;  3DCG A;  3ZXR A;  2DBY A;  3VAW A;  2OHF A;  1GC7 A;  1L7Y A;  2I38 A;  2FCS A;  3Q3M C;  3D32 A;  4IUM B;  1HTQ A;  4HEA 1;  2D11 A;  3BK2 A;  4JPS A;  2WXO A;  4GGQ A;  4AUQ C;  4E74 A;  2V3N A;  4CHK A;  4URK A;  1ZDX A;  4I6P A;  1OFF A;  2LUE A;  1I4G A;  3JYU A;  4PS7 A;  2K22 A;  1IGD A;  1UNS A;  2HDE A;  2ON8 A;  4HK2 A;  2R61 A;  1C4A A;  3L10 B;  4JWU C;  3H6N A;  2XK5 B;  3VUY A;  2W82 A;  5C3J B;  2KX3 A;  1P0R A;  1WGH A;  1FRR A;  2KTR B;  2XN9 C;  4AQ7 A;  2JRH A;  2QJL A;  2IND C;  2LMC A;  2M4N A;  3B1L X;  3QCA A;  3ZLZ A;  3MP9 A;  4HRS A;  2PEA A;  1F77 A;  5BMH A;  2KMA A;  2M19 A;  1WXM A;  2ZNV B;  4B0M A;  2G1E A;  2CHX A;  1J7C A;  4RM9 A;  2C7M B;  2JYE A;  5D94 A;  3AE2 B;  1J7B A;  2JUO A;  1Y56 A;  4WWM A;  3W2D A;  4CQN A;  3I57 A;  4ZHO A;  4MT5 A;  3PVL A;  3BIN A;  1XQQ A;  3T3O A;  5IOI A;  3OJ4 B;  1R4N I;  4YTN B;  2MLB A;  3PZ8 A;  1DYQ A;  3PHX B;  3Q8E A;  4BAX A;  4BBN F;  3Q8F A;  1TKG A;  3Q3F A;  2L32 A;  1KFY B;  3WA0 A;  3PRE A;  3TIX A;  5JHB A;  3RMK C;  3IAM 1;  1KTK A;  2NPT A;  1R7S A;  1TJE A;  2GB1 A;  4I6L B;  2K25 A;  3BYT B;  4PT5 A;  3P4S B;  4KSK C;  5FKA C;  3NVW A;  1C3T A;  5BO4 B;  2BKR B;  3BWU D;  2MP2 B;  2L1A A;  4IM3 A;  4MJS A;  3MTN B;  4ARI A;  2QMT A;  3P42 A;  1FPY A;  2XBB C;  3TEY A;  1F2R C;  2W54 A;  3A1Q A;  2WDT B;  1E9M A;  3E9S A;  1RYJ A;  4HCP B;  2WWZ A;  3HVD A;  4AS1 A;  3J9C A;  1I42 A;  1Z5S B;  3DOW A;  1N61 A;  4HJG E;  1XT9 B;  3VTW A;  1FNW A;  2NMQ A;  3A4R A;  2UWQ A;  3W5V B;  2IGG A;  4PS3 A;  1LXD A;  4BVU C;  2QIL A;  2HD5 B;  3ONS A;  1L5P A;  3ZO5 B;  3WIM A;  3KVF B;  2BB5 A;  3TL5 A;  2KDF B;  3ZYY X;  1WM2 A;  3U4E G;  3N20 C;  4G0N B;  1C1Y B;  4IC7 B;  2EMS A;  2EKI A;  2V1Y A;  1YJ1 A;  4P7I A;  3QA8 A;  2LGS A;  3AE8 B;  4B6W A;  2BYF A;  1I4R A;  3H7P B;  1WXV A;  2NBW B;  2JWU A;  4II2 B;  3AB5 A;  2LJ5 A;  5TSS A;  2NCN A;  1EU3 A;  1V2Y A;  4NNJ B;  2FCM A;  1OQR A;  2AWT A;  2BGF A;  2PW9 A;  3FIL B;  3V6C B;  1QT9 A;  4EKU A;  3DQV A;  2IGD A;  3OWE B;  2E6X A;  4TUU A;  3C8Y A;  2JPH A;  3ZTD A;  2KXJ A;  2GBM A;  4IKG A;  3MC8 A;  4KVG B;  3AE6 B;  1WYG A;  4M01 A;  3DBH I;  4KGR A;  3QHT A;  2JYT A;  2C7N B;  3CSF A;  2QIE B;  4ZYN A;  4XDC A;  2N4F A;  1HA5 A;  2ZW0 A;  2MJ3 A;  4GDL A;  3SFE B;  2W3R A;  1EUV B;  4FJZ A;  3V05 A;  2KN5 A;  2CJO A;  2O2V B;  3AH7 A;  4W9H A;  4A8X C;  4OW0 A;  2GBN A;  3UIN B;  4K7S A;  5HG2 A;  1K8R B;  3N3K B;  3AEA B;  1EF5 A;  3IVF A;  2Y5B B;  4AP4 C;  1LFD A;  2HTH A;  4YL8 A;  2WX0 A;  4GB9 A;  5LLI A;  1AWD A;  4PK1 A;  3HIZ A;  2MWS B;  1NEK B;  2L05 A;  4XC2 A;  3TEW A;  1RRB A;  3EGR A;  2N1W A;  1VDV A;  3DPD A;  1PGX A;  3KLS X;  1E0Z A;  2QHO A;  1TGZ B;  1XO3 A;  2TSS A;  2KQS A;  2H88 B;  4W9K A;  4ANX A;  1UH6 A;  1S1Q B;  2KO3 A;  4C00 A;  4NAW A;  3CIR B;  1YN3 A;  1WH3 A;  4XE0 A;  4USA A;  2RPQ A;  1GNU A;  2KHW B;  4US9 A;  1XLP A;  3DHI C;  1VZ6 A;  1N63 A;  4ZOH C;  3A33 B;  5HI1 A;  2QSD A;  2VRR B;  3M95 A;  3LJ3 A;  2JZP A;  4FA6 A;  2PVO D;  2WYQ A;  2Z0D B;  2IY0 B;  3A9K B;  3DVN U;  2QDF A;  2GBJ A;  1P7F A;  3IT6 B;  2NPT B;  3ZXV A;  3B08 A;  1ZE3 D;  3K9P B;  1C4C A;  3U52 E;  4YWG G;  1XXG A;  1QOB A;  3H9D A;  3X0W A;  4WQO B;  2KC1 A;  4MJS B;  2ICI A;  4W9E A;  1FNV A;  4BBN C;  2YEP F;  3P4R B;  2L83 A;  2NBU A;  2XK5 A;  4RF0 A;  3RNF C;  1TS2 A;  5FR3 A;  2RDG A;  2KTR A;  3NOB A;  4KKI A;  2ZPN A;  4JWS C;  2K8B A;  4N58 A;  1LGR A;  2LXC A;  2C60 A;  2ZVO A;  4FHK A;  2BYE A;  1XLQ A;  1MG8 A;  1YX5 B;  4DK5 A;  1QZE A;  3X23 A;  3NUH B;  2IZV B;  1SE4 A;  1FFU A;  1MVK A;  4NAM A;  3T9L A;  3KWL A;  1ENF A;  4KX6 B;  2N9X A;  2K6D B;  3QQ8 B;  2KNB A;  3AV8 A;  2MEK A;  2BKF A;  2CJN A;  1BML C;  2KAN A;  5D3I B;  2EMT A;  1FCL A;  4LNK A;  2B3A A;  2MBO A;  1R4N B;  3ZDM C;  4M02 A;  3RT3 B;  2MBH A;  4YSZ B;  2LAS A;  3KYD D;  3TBL D;  3FC4 A;  3DWG C;  1WSP A;  1FD6 A;  2CS4 A;  2JVC A;  3AE4 B;  1IYF A;  3AU4 A;  2BF8 B;  3P63 A;  2N0S B;  4BKS A;  2MRP A;  4RNA A;  3RNG C;  1ACC A;  1TKE A;  3SEB A;  1FIQ A;  1NVI D;  1F1H A;  3T3N A;  1VRA B;  4EZK A;  1P9D U;  2K9X A;  4ANV A;  1NI2 A;  2MP2 A;  1CK1 A;  5MPO A;  2DAJ A;  3ZNH B;  2KKC A;  1WGY A;  1HXY D;  2I1J A;  1D6E C;  1JCK B;  2ZVN A;  4TSS A;  2WHI A;  4AOF A;  1PGB A;  1WE7 A;  3DBS A;  2ASQ A;  3ECI A;  3I3T B;  2KFK B;  3DVN V;  4E3C A;  1SEB D;  1E6E B;  1WMH B;  2V4I B;  5AUI A;  3ML8 A;  3ZQ4 A;  3JSV B;  3HM6 X;  3MC0 B;  2ACZ B;  4GDL B;  1WYW B;  3W9C B;  2VH1 A;  2Z59 B;  5DPS A;  1IGC A;  1V80 A;  1WGG A;  1L2N A;  1U4A A;  3PLU A;  3IBE A;  2DZI A;  3M62 B;  4CYE A;  4DXA B;  4GSW A;  1WZ0 A;  1YJJ A;  2XEW A;  1E7P B;  2I1K A;  4N9F 4;  3ZKJ C;  1UD7 A;  3N1X C;  3VDZ A;  4XGA B;  4OVU A;  5DCN A;  1C78 A;  2R2O A;  2PJH A;  4IDI A;  1XCT L;  2DLB A;  4FJY A;  4KDL B;  3I5J C;  3CWI A;  3I63 C;  1MJD A;  3H7P A;  2BYT A;  1GC6 A;  2GI9 A;  2BWF A;  2V9H A;  3HHM A;  3A9J B;  2DZJ A;  2KWC A;  3ML9 A;  4M00 A;  2Y5C A;  2KMC A;  3JVZ X;  3RI7 C;  5JZE B;  5GMV A;  1MHH E;  1C79 A;  4I6N B;  3FIL A;  2PVG C;  5GXG B;  1T0R C;  4LCD E;  3GB1 A;  4YSY B;  2K5P A;  2L0F A;  1JWS D;  1C9F A;  3R7Q A;  1S3S G;  4XX5 A;  1IUE A;  4NAW B;  3AUL A;  4JLC A;  2JU6 X;  1YOV B;  3R8B A;  3S2A A;  3VH4 B;  1WM3 A;  3DBH B;  1XEE A;  1V9J A;  3DDC B;  3ZJT A;  2D3A A;  3U8Z A;  3IG3 A;  3VXW A;  3Q8C A;  2WNM A;  4LNI A;  2REX A;  3EUB 2;  2PTL A;  1J8C A;  3AXC A;  5IA7 A;  3RPF C;  4KZ0 A;  3L0W B;  4WJQ A;  2X38 A;  4W9I A;  4WWN A;  1ROE A;  3CMM B;  4NY0 A;  1QOF A;  1XD3 B;  2FCN A;  4P16 A;  1ZDV A;  1OTR B;  3UF8 A;  2LVQ A;  4C7Z A;  5CHV C;  4A20 A;  3PTF C;  2O2V A;  5H92 C;  2OJR A;  3R2T A;  4KGS A;  1KLU D;  3W1S A;  4HKQ A;  3WAM A;  1UGM A;  2V0G A;  1UGJ A;  4WWO A;  1WR1 A;  2LGY A;  3UIP B;  1KJT A;  3E56 A;  3L13 A;  3AM9 A;  4AJW A;  2AL3 A;  3MHS D;  2JZZ A;  4IWO A;  1PGA A;  2K3U A;  5CHF A;  4DQO C;  4ZDV A;  1D3Z A;  2G9H D;  1EM7 A;  1RFK A;  3GS2 A;  2AL6 A;  2KJH B;  1SJH D;  1EF1 A;  1WIA A;  1LQB A;  1OEY J;  1ET9 A;  5EE1 A;  4QAY A;  1TYG B;  4FHJ A;  4HPM B;  2V3S A;  3Q6B A;  2JWZ A;  3H7S A;  4GOC A;  1E5W A;  3HM3 A;  4PYU A;  2JT4 B;  3NJT A;  4WJP A;  1E7V A;  2C9W B;  2FID A;  2BS4 B;  4W9J A;  1WR6 E;  2IYD B;  4G50 A;  4FN2 A;  3A9K A;  3R66 C;  4S17 A;  3T8M A;  5EE3 A;  1V49 A;  2PLP A;  2AQ2 B;  1SE2 A;  2E3T A;  4HXD A;  1E8X A;  1STE A;  4O1N A;  3UI3 A;  1ZUD 2;  4MM3 B;  1DOY A;  3B9J A;  4D2K A;  2NTS A;  1M4V A;  2KWV B;  3PO0 A;  2WXH A;  1SF0 A;  2QCZ A;  1RLF A;  2M56 B;  2WS3 B;  3UGB B;  2MBQ A;  2IJ0 A;  4GN1 A;  5T8I A;  3AEB B;  3K9O B;  2WXR A;  1VR9 A;  4HKZ E;  4BKS D;  4MH8 A;  4WUR A;  1VLB A;  2WU5 B;  2K0P A;  1PUT A;  4ITK A;  2WX1 A;  1P1A A;  2A4Z A;  2W55 A;  4L1B A;  5E6J A;  1QQR A;  3GOE A;  3KUZ A;  1JRU A;  1EWC A;  4N6E B;  1A5R A;  4L2Y A;  3VTU A;  1WE6 A;  4MGK E;  4XWT A;  4M0W A;  1L0Y B;  2VZK B;  5J18 A;  4WH4 A;  2I2Y A;  3FKY A;  2MJE A;  4EUT A;  3P2B A;  1WX7 A;  2OOB B;  3EA6 A;  1I7H A;  1GG3 A;  1T5X D;  4TMA B;  1T0S C;  2RDB C;  3RUI B;  1K51 A;  2BS2 B;  1WX9 A;  3KUC B;  4K7U A;  1D5Z C;  3ZRC A;  4BOS C;  1QKZ A;  2VZK D;  1TS5 A;  1BUI C;  4YXD B;  5AEK B;  2K8C A;  1TS3 A;  4JGH B;  4MAC A;  4MDK E;  4GLS C;  1UF0 A;  1X1M A;  3KYC D;  3QIJ A;  2WXM A;  5I4D A;  3TMP B;  2WXL A;  4MEM A;  4OZB A;  5D6J B;  2J53 A;  4EZL A;  2LRU A;  3NS8 A;  1WJ6 A;  1TIF A;  3VFK A;  2HE7 A;  2KTF A;  4IWP A;  2MW5 A;  1P98 A;  4W9G A;  2BS3 B;  4N59 A;  3SHQ A;  4BKG A;  3Q3N C;  2Y5P A;  3ENE A;  3APD A;  2KFK A;  2C5L C;  2V4L A;  2WXF A;  1PFD A;  2KFJ A;  2Q5W D;  4GDK A;  1FCC C;  1WMH A;  5BYS A;  1TT5 B;  1BXT A;  1CJE A;  4A90 A;  1V97 A;  1L6U A;  1WWT A;  3JSV A;  4A55 A;  4RCO A;  1MHX A;  2KDB A;  4RH6 A;  2G4D B;  4TQ1 A;  4W9F A;  2EKE C;  1QF6 A;  5E6O A;  3GE8 C;  1FRD A;  1V5T A;  3VRB B;  3VRA B;  5L83 A;  1GAQ B;  1QLB B;  5DPT A;  2AX5 A;  4TV3 A;  1FFV A;  1EO6 A;  3MJ5 A;  5JXV A;  2N7D A;  2KVZ A;  2W3S A;  3MC9 A;  3KWV A;  2Z0E B;  3NRZ A;  2JF5 A;  1SIJ A;  1AAR A;  2MQJ A;  4JE3 B;  3MFG A;  2GLS A;  3NZS A;  2HJ8 A;  3A9J A;  4BKT A;  4JQW C;  1JAL A;  3RNE C;  2J7Q B;  2K8H A;  2MBB B;  3UQB A;  4RFB A;  1FMA D;  2L00 B;  4GXB A;  2RMM A;  1WX8 A;  3LDZ E;  1N6Z A;  2V3P A;  3L17 A;  1XCQ L;  4RMA A;  2FUG 1;  1GUA B;  5LXI B;  3VQI A;  2KJR A;  3PLV A;  1SE3 A;  2PMV A;  1TS4 A;  3TSS A;  1TBE A;  1PYW D;  4MGY E;  3A4S C;  2NVU I;  4HJK A;  4IM2 A;  2ZNV C;  3OJ3 A;  2VH2 A;  2GMI C;  4K3B A;  1FO4 A;  1CZP A;  2G45 B;  4ZRJ A;  1SIF A;  2CHZ A;  4KKJ A;  4P1B C;  3PRM B;  3V61 A;  2CKH B;  3U2S C;  1Q0W B;  2WGS A;  2WXN A;  4TKN A;  4X57 B;  1TY2 A;  2MJD A;  3QWZ B;  3ZNG C;  4FAD A;  5HHD G;  1LO5 D;  4WJN A;  1KOT A;  2O6V B;  1YIW A;  3AE7 B;  3OAW A;  3P4Q B;  3GP7 A;  1VCB A;  1ZKH A;  2D2Q A;  1VZ8 A;  1I35 A;  4WJO A;  1HEZ E;  4DHZ B;  5AZF A;  1J7A A;  1IBX A;  4M0W B;  2FE8 A;  3PRP B;  3WAN A;  2LXA A;  2WP9 B;  3AU5 A;  2K39 A;  3BVM A;  2JSV X;  4MEL A;  1OQY A;  3IXS A;  5E6P A;  2LJI A;  1DGJ A;  1NBF C;  2PIA A;  4IM0 A;  4DWF A;  2PE6 B;  1FXI A;  4AWJ A;  4IOI E;  5AZG A;  4YT0 B;  3Q3O C;  3RZF A;  1N5W A;  1L4D B;  3C0R B;  1JQ4 A;  2L8J A;  4EOY A;  1WJN A;  3DVG X;  1I4X A;  1E7U A;  2K6Q A;  3HK0 A;  5EDS A;  5LXH A;  3U7Z A;  2G3Q B;  3H8H A;  4FXC A;  4M8M A;  3EHV A;  4R3D A;  3TCA A;  3WCQ A;  4NPN A;  2DZM A;  4LK0 M;  3B2G A;  4OZA A;  3BVG A;  2RSU A;  4LNN A;  3VTV A;  1VD2 A;  1AW7 A;  4MM3 A;  1A70 A;  2K1F A;  1ISN A;  2CHW A;  3DHG C;  1KM7 A;  2H89 B;  4YSX B;  2CU3 A;  4DDG D;  2JXT A;  2NR2 A;  4EZJ A;  1R4M B;  2BQQ A;  2KD0 A;  1NYR A;  5HKH A;  4HCN B;  1TTN A;  5CTR C;  4MSM B;  3RNA C;  2KDE B;  4GDK B;  4LNF A;  5J17 A;  3QX1 A;  3CF6 E;  2ZW1 A;  4NJC A;  3SFD B;  5DPW A;  2LGX A;  5E6N A;  1BT0 A;  2WDV B;  2KYW A;  1E90 A;  2MA9 B;  1YJI A;  4RF1 A;  1E8Z A;  1V8C A;  3ZW3 A;  1D5M C;  2JX5 A;  2LI5 A;  3AE1 B;  2WU2 B;  1ZW7 A;  4HRO A;  4YTP B;  3MJW A;  2ZCC A;  3ZJU A;  5FR6 A;  2N9K A;  5IP4 D;  3APF A;  4YTM B;  2LVO A;  4ICV A;  5HFY A;  1ZOY B;  3AE5 B;  3M3J A;  3QK0 A;  4G11 A;  4L23 A;  3MHZ A;  1WGR A;  1NYQ A;  4F1S A;  5EE9 A;  5D2M B;  2DEN B;  2OJW A;  2EEL A;  2X8X X;  4C80 A;  1FXA A;  3ABV B;  1G6J A;  4W9D A;  3W1S C;  2B76 B;  4MGI E;  2KAC A;  3GE3 C;  1SB3 C;  3ZNI D;  2LD9 A;  1T3Q A;  1KH0 A;  2PPH A;  3O13 A;  1T0Y A;  2KMM A;  2WDR B;  2M0X A;  3NVY A;  5BMI A;  2WXJ A;  4KDI C;  2L0T A;  4S0R A;  4C56 C;  2D3G A;  3L08 A;  1YN4 A;  1V86 A;  4DDI D;  4KV2 A;  3DBR B;  1DOX A;  2FUH B;  1H8C A;  4OVV A;  4AJY B;  4FUL A;  2J0M A;  3NG0 A;  3ZDT A;  3DBL I;  4DHJ B;  4NJ7 A;  2RDH A;  5AZH A;  3Q8A A;  1J0G A;  4C7Y A;  3Q14 C;  2MCN B;  3PSE B;  1Q10 A;  4P1C C;  1JWA D;  2NTT A;  3HRD D;  1XLO A;  2MBE A;  1ZXI A;  1RWS A;  5IAA C;  2INP E;  1YN5 A;  3AI5 A;  2J4X A;  1I4Q A;  1ET6 A;  4HVB A;  2N1V A;  1WRI A;  1SJE D;  3HUI A;  5TR5 A;  4DHJ D;  4US8 A;  2DZK A;  3VR8 B;  3DHH C;  1GB1 A;  1FXT B;  3VUW A;  1C4P A;  3WAO A;  4ZRI A;  2NBV B;  2NS5 A;  1EWY C;  2KWU B;  1MG4 A;  2L76 A;  2IO2 B;  3O65 B;  3ZUN A;  2FBW B;  2WXQ A;  3PS6 A;  2G4S A;  1E8Y A;  2BYV E;  1YMH E;  4HLE A;  1IBX B;  2ZEQ A;  2LEK A;  2D10 A;  2N7J A;  1WXS A;  1F0Z A;  4KIK B;  1IP9 A;  4DXF A;  5G5G A;  3AN1 A;  2J0J A;  1UUP A;  2ONQ A;  4LTU A;  1L0X B;  4IW0 A;  1LM8 B;  1C76 A;  3BK1 A;  2ZZP B;  3IFW B;  4J3O D;  3PZD A;  1FM0 D;  4EE2 A;  2IDY A;  2QEJ C;  3VVW B;  1ZXH A;  2KN4 A;  1XLN A;  1AYF A;  1N5X A;  4WAF A;  4UDU C;  2N9P C;  3AEC B;  2KLG A;  2DYO A;  4REZ A;  4FLH A;  4K1R B;  2KOX A;  1Q5W B;  3ZGZ A;  1WXA A;  4M8N A;  3ETR A;  2LVP A;  3B2F A;  1HZ5 A;  3U30 A;  2LUM A;  1F2R I;  1H4R A;  2L3Z A;  2SAK A;  4DBG A;  3ALB A;  1JRO A;  5AUK A;  2DNF A;  2KZR A;  3KW5 B;  1UBI A;  1WRD B;  3GZN I;  3L16 A;  1B1Z A;  2KVR A;  5JH5 C;  2AQ1 B;  2LHE A;  1R4M I;  2N9L A;  2BBC A;  4HDO A;  2O6V A;  2JZ3 B;  4B95 A;  3TEX A;  5C23 A;  2KAJ A;  3LYY A;  4FJV B;  2SEB D;  3V60 A;  4NQK E;  3N30 A;  4HWI B;  1QIL A;  2INN E;  1CMX B;  2M8S A;  1V6E A;  4EFO A;  1GB4 A;  4ASW C;  1HE8 A;  1JWU D;  1ZP0 B;  2RD0 A;  1WZ3 A;  3EFU A;  3PRZ A;  1NDD A;  3URY A;  3N1Y C;  3SU8 X;  1K50 A;  4DXG A;  3BYY B;  2FAZ A;  3OG5 A;  1EU4 A;  4IG7 B;  2LRW A;  2MH7 A;  3PGE A;  5IN7 A;  2FIF A;  1E8W A;  3NZ3 A;  2JXX A;  1SBB B;  1MPE A;  3UQA A;  2M0A A;  2GOW A;  2J42 A;  2GRI A;  4W9L A;  2IY1 B;  4OHJ A;  3R7R A;  4CO7 A;  3RUL A;  1VJK A;  5IKC M;  2N9E B;  2WXI A;  1RAX A;  2D07 B;  4RGN A;  4A3O A;  3RN9 C;  2DYM A;  4NZL B;  3L54 A;  3JW0 X;  1Q1O A;  4J6I A;  5IO9 A;  3IHP C;  2RR9 A;  3Q2A C;  4HPP A;  4K3C A;  1GPX A;  4KGT A;  1D5X C;  3QJZ A;  3M63 B;  3NS1 A;  1Y8R C;  3KQ4 A;  4WWP A;  1T6B X;  2WXK A;  3P1M A;  3L4P A;  4ZYS A;  4F7Z A;  2BB6 A;  2DWQ A;  3BVZ A;  1HQR D;  3DBR I;  4GMV A;  4IWQ A;  2D3B A;  3HVZ A;  2KQ4 X;  1UZX B;  1VZ7 A;  4RGO S;  4E71 A;  1ESF A;  3AMZ A;  4XZ4 A;  2BWE S;  3RFZ B;  1GOZ A;  3AEG B;  1C77 A;  3UIO B;  1V5O A;  1KLG D;  4OZC A;  1J19 A;  2AYO B;  2INC C;  3ZJV A;  3NHE B;  1SXT A;  3RD2 A;  1UEL A;  2AQ3 B;  2AEH A;  3TJP A;  3AEF B;  4OVZ A;  1TY0 A;  3QC8 B;  2IBI B;  2M17 A;  3R2I A;  4A6Q A;  2ZJD A;  3P4P B;  4A9A A;  2IO1 B;  1N62 A;  4ANW A;  2D5G A;  3I9V 1;  3RNC C;  1I4H A;  2KC2 A;  1RFA A;  4ANU A;  4C4V A;  2LGI A;  2GBR A;  1UWX A;  5J2R A;  3TEZ A;  5KHQ A;  1K53 A;  1V1P A;  2MSE D;  3C19 A;  5D3D A;  1L4Z B;  3NVZ A;  3ZTC A;  4WQM A;  2LHD A;  2UYZ B;  2A5U A;  2LGD A;  1OEY A;  3LXF A;  4GIV A;  3IT4 B;  3AE3 B;  2HTM E;  2MX2 A;  2Y3A A;  4LJO B;  1KF6 B;  1YQ3 B;  4ACF A;  2IO3 B;  2JQR B;  3W1Y A;  3BZD B;  3IAS 1;  3AED B;  2BPS A;  1WF9 A;  3DBL B;  2DHZ A;  2FNJ B;  3LB8 C;  1N60 A;  2WDQ B;  2LFI A;  1F9J A;  4NJ6 A;  1HTO A;  4ZHP A;  2BT6 A;  1WJ4 A;  3RYT A;  3KH0 A;  4EEW A;  3EC8 A;  1AN8 A;  3EEC A;  1YQB A;  1B9R A;  3DVG Y;  1WGK A;  3WAL A;  3VHT C;  3PV1 A;  1KRH A;  1CQV A;  1SE9 A;  3N32 A;  3NZU A;  2WXG A;  2QC8 A;  5FK9 C;  3PZ7 A;  3N9Y C;  4G3X B;  1MI0 A;  1NI3 A;  2WLB A;  2C7H A;  2KJ6 A;  2L7R A;  2N7E A;  3Q69 A;  3V62 A;  3TUO A;  2YEP B;  1TKY A;  3FAH A;  1E10 A;  3NVV A;  2J0K A;  2J52 A;  1M94 A;  4GU2 A;  4H2A A;  2JRI B;  3SR6 A;  4WIP A;  1SGH A;  3WAP A;  3A1Q B;  1DOI A;  5L95 C;  1JWB D;  1JML A;  2KK8 A;  4KIK A;  4ARC A;  2HJ1 A;  2KX0 A;  5C1Z A;  2IGH A;  4K7W A; 
#chains in the Genus database with same CATH homology
 2O6V D;  3ZNI D;  2LD9 A;  1EUV B;  4FJZ A;  4TQ0 A;  2PPH A;  3ZVV A;  2KN5 A;  1T0Y A;  2KWV B;  4NQL B;  4WAA A;  4BOZ B;  4LDT B;  3PPA A;  2O2V B;  5D7G A;  2M0X A;  1TZ1 A;  1RLF A;  4W9H A;  5G55 A;  4KDI C;  5JHA A;  3UGB B;  2MBQ A;  3OLM D;  2GBN A;  3RCZ A;  4GN1 A;  3UIN B;  4K7S A;  2L0T A;  3K9O B;  2D3G A;  1WI0 A;  3L08 A;  1V86 A;  1K8R B;  4DDI D;  3V6E B;  1KLV A;  4KV2 A;  3N3K B;  4BKS D;  2LWP A;  4MH0 E;  1EF5 A;  2FUH B;  4FBJ B;  1H8C A;  4OVV A;  3IVF A;  3PT2 B;  4PS8 A;  4AJY B;  2Y5B B;  2J0M A;  4FUL A;  1LFD A;  2WX1 A;  3RZW C;  3ZDT A;  4AP4 C;  1P1A A;  2HTH A;  3DBL I;  4YL8 A;  4DHJ B;  2A4Z A;  2WX0 A;  4GB9 A;  4DHZ E;  5LLI A;  4NJ7 A;  5AZH A;  4LDT D;  3GOE A;  3KUZ A;  1JRU A;  1A5R A;  3HIZ A;  2MWS B;  3VTU A;  2L05 A;  1WE6 A;  1J0G A;  4MGK E;  4XC2 A;  4JL9 A;  1RRB A;  2MCN B;  1IPG A;  2N1W A;  3DPD A;  3PSE B;  1Z2M A;  5J18 A;  1PQS A;  1ZGU B;  2MBE A;  2QHO A;  4KSL C;  3KUD B;  1TGZ B;  5IAA C;  4EUT A;  3P2B A;  3BY4 B;  4JIO U;  4A3P A;  4W9K A;  2KQS A;  3AI5 A;  4ANX A;  1WX7 A;  2M1M A;  1UH6 A;  1S1Q B;  2OOB B;  2KO3 A;  1GG3 A;  3R3M A;  4HVB A;  2N1V A;  4NAW A;  3QAR A;  5TR5 A;  1WH3 A;  4DHJ D;  2RPQ A;  2DZK A;  1GNU A;  1OGW A;  2KHW B;  3ZIM A;  4BFR A;  1FXT B;  3VUW A;  2KLC A;  3WAO A;  4B9K A;  4ZRI A;  2NBV B;  2NS5 A;  3ZNZ B;  4HDQ A;  3RUI B;  2KWU B;  2L76 A;  3A33 B;  2IO2 B;  3O65 B;  3ZUN A;  4F8C B;  1WX9 A;  3KUC B;  4K7U A;  2VRR B;  5DPR A;  3PS6 A;  3ZRC A;  2DAF A;  3M95 A;  4BOS C;  3NY5 A;  3LJ3 A;  2G4S A;  1E8Y A;  5AEK B;  2BYV E;  2K8C A;  4FA6 A;  3QAQ A;  4HLE A;  4JGH B;  2WYQ A;  2Z0D B;  2IY0 B;  2ZEQ A;  4MDK E;  3A9K B;  2JY6 A;  2D10 A;  1YX6 B;  3DVN U;  4RM8 A;  1WXS A;  1X1M A;  3KYC D;  1WY8 A;  2IO0 B;  2GBJ A;  3Q3J A;  3QIJ A;  4KIK B;  1IP9 A;  3PHW B;  2NPT B;  4ICU A;  3TMP B;  3B08 A;  4MGZ E;  2J0J A;  3K9P B;  4MEM A;  5D6J B;  4PYZ A;  2FCQ A;  3U7D A;  3CST A;  4EZL A;  4IW0 A;  1LM8 B;  2LRU A;  2ZZP B;  3H9D A;  3IFW B;  1WGD A;  3PZD A;  3X0W A;  3NS8 A;  1WFY A;  1WJ6 A;  2ZCB A;  2GBK A;  5CX3 A;  3VFK A;  4WQO B;  2KC1 A;  4MJS B;  2HE7 A;  2KTF A;  4IWP A;  2MW5 A;  3VVW B;  4W9E A;  4KZC A;  1P98 A;  4W9G A;  2CR5 A;  4BBN C;  2CU1 A;  3SHQ A;  4BKG A;  2RGF A;  2NBU A;  3ENE A;  2N9P C;  2XK5 A;  2LZ6 A;  3APD A;  2KFK A;  2C5L C;  2KLG A;  2V4L A;  2YVC A;  2KFJ A;  2DYO A;  4GDK A;  1YD8 U;  1WMH A;  2R2Q A;  2KTR A;  3NOB A;  4FLH A;  4K1R B;  2ZPN A;  5CHW A;  2KOX A;  3APC A;  2K8B A;  2LXC A;  2C60 A;  2ZVO A;  1Q5W B;  3JSV A;  4FHK A;  1WXA A;  2BYE A;  2KDI A;  2KDB A;  3SD5 A;  1MG8 A;  4M8N A;  1YX5 B;  2LVP A;  4DK5 A;  2G4D B;  1QZE A;  4TQ1 A;  4W9F A;  2PE9 A;  3X23 A;  2EKE C;  3U30 A;  2IZV B;  3T9L A;  1H4R A;  2L3Z A;  2W9N A;  3VUX A;  2N9X A;  2K6D B;  3ALB A;  3H1U A;  5E6O A;  4DBG A;  2ZPY A;  3QQ8 B;  3SDL C;  2KNB A;  5G2N A;  2BKF A;  1V5T A;  5L83 A;  2KZR A;  5DPT A;  4II3 B;  4TV3 A;  3KW5 B;  4K81 A;  1EO6 A;  2KAN A;  1UBI A;  1P3Q U;  1WRD B;  3B0A A;  3GZN I;  3VH3 B;  3L16 A;  2EMT A;  4HPL B;  1WJU A;  4ZRK A;  1GJZ A;  2KQ7 A;  2KVR A;  5KHO A;  5JH5 C;  1R4M I;  2N7D A;  4HDO A;  4W9C A;  2O6V A;  3ZRF A;  4LJP B;  2B3A A;  2JZ3 B;  2MBO A;  2Z0E B;  4B95 A;  2JF5 A;  3ZDM C;  3RT3 B;  2MBH A;  2LAS A;  5C23 A;  3KYD D;  3TBL D;  1UBQ A;  4FJV B;  4MSQ B;  1AAR A;  3V60 A;  2MQJ A;  4NQK E;  3N30 A;  4HWI B;  2M8S A;  1CMX B;  2YLM A;  1V6E A;  2CS4 A;  2JVC A;  4EFO A;  3NZS A;  4ASW C;  2DYB A;  2HJ8 A;  1V81 A;  1HE8 A;  3A9J A;  2DX5 B;  4BKT A;  4JQW C;  1IYF A;  3AU4 A;  2BF8 B;  3DCG A;  2RD0 A;  3PRZ A;  1WZ3 A;  3EFU A;  3VAW A;  1NDD A;  4BKS A;  2MRP A;  1GC7 A;  2J7Q B;  3SU8 X;  1L7Y A;  2K8H A;  2FCS A;  3D32 A;  2FAZ A;  4IUM B;  2D11 A;  2MBB B;  3UQB A;  4IG7 B;  2LRW A;  2L00 B;  4GXB A;  4EZK A;  1P9D U;  1WX8 A;  4GGQ A;  4ANV A;  1NI2 A;  3PGE A;  3LDZ E;  2MP2 A;  4AUQ C;  4E74 A;  2FIF A;  4CHK A;  4URK A;  2DAJ A;  3L17 A;  3ZNH B;  1E8W A;  2KKC A;  4I6P A;  2JXX A;  4RMA A;  2LUE A;  1WGY A;  4PS7 A;  3JYU A;  2I1J A;  1GUA B;  5LXI B;  3VQI A;  3UQA A;  2KJR A;  2ZVN A;  3PLV A;  2GOW A;  4HK2 A;  4AOF A;  3L10 B;  1WE7 A;  3DBS A;  4W9L A;  2IY1 B;  3R7R A;  2ASQ A;  3H6N A;  1TBE A;  2XK5 B;  3VUY A;  3ECI A;  3I3T B;  4CO7 A;  2KFK B;  2KX3 A;  4MGY E;  3RUL A;  1P0R A;  1WGH A;  3A4S C;  3DVN V;  2NVU I;  4E3C A;  4HJK A;  4IM2 A;  2N9E B;  1WMH B;  2ZNV C;  2KTR B;  3OJ3 A;  2GMI C;  1RAX A;  2D07 B;  3ML8 A;  3JSV B;  3HM6 X;  4A3O A;  2DYM A;  2JRH A;  3L54 A;  2G45 B;  4GDL B;  4ZRJ A;  3JW0 X;  1WYW B;  1SIF A;  1Q1O A;  4J6I A;  2Z59 B;  2M4N A;  3B1L X;  3QCA A;  3IHP C;  5DPS A;  2RR9 A;  3ZLZ A;  1V80 A;  1WGG A;  2CHZ A;  2PEA A;  1L2N A;  2KMA A;  1U4A A;  3PLU A;  3IBE A;  2DZI A;  1WXM A;  2ZNV B;  2CKH B;  3M62 B;  3PRM B;  3QJZ A;  4GSW A;  3V61 A;  4DXA B;  1WZ0 A;  2XEW A;  1Q0W B;  2I1K A;  3M63 B;  2CHX A;  1Y8R C;  4TKN A;  4X57 B;  4WWP A;  4RM9 A;  2C7M B;  4N9F 4;  3ZKJ C;  1UD7 A;  5D94 A;  2JUO A;  3VDZ A;  4OVU A;  4F7Z A;  5DCN A;  3QWZ B;  3PVL A;  3ZNG C;  3BIN A;  4FAD A;  4WJN A;  1KOT A;  1XQQ A;  2O6V B;  2R2O A;  1YIW A;  2PJH A;  3DBR I;  4FJY A;  4KDL B;  3OAW A;  1VCB A;  1ZKH A;  1R4N I;  3OJ4 B;  4GMV A;  2D2Q A;  2MLB A;  4IWQ A;  1UZX B;  4E71 A;  3H7P A;  1I35 A;  1GC6 A;  3PHX B;  4WJO A;  2BWF A;  4XZ4 A;  4BBN F;  2BWE S;  3HHM A;  4DHZ B;  3A9J B;  5AZF A;  2DZJ A;  2KWC A;  3ML9 A;  3JVZ X;  2KMC A;  3Q3F A;  5JZE B;  4M0W B;  3UIO B;  1V5O A;  3PRP B;  5GMV A;  3WAN A;  2LXA A;  3WA0 A;  3AU5 A;  1J19 A;  2AYO B;  3PRE A;  2K39 A;  3TIX A;  4I6N B;  5JHB A;  3NHE B;  3RD2 A;  1UEL A;  4MEL A;  2NPT A;  1OQY A;  2AEH A;  5E6P A;  3TJP A;  4I6L B;  1NBF C;  4IM0 A;  4LCD E;  2L0F A;  4DWF A;  2K25 A;  3R7Q A;  2PE6 B;  1S3S G;  4KSK C;  4AWJ A;  4XX5 A;  5AZG A;  4NAW B;  3AUL A;  2BKR B;  4JLC A;  2MP2 B;  5BO4 B;  3RZF A;  3QC8 B;  1C3T A;  2IBI B;  3C0R B;  4IM3 A;  2L8J A;  3S2A A;  1WJN A;  3VH4 B;  1WM3 A;  4EOY A;  4MJS A;  2M17 A;  3MTN B;  1V9J A;  2ZJD A;  3DDC B;  2IO1 B;  3U8Z A;  3DVG X;  2XBB C;  4ANW A;  3IG3 A;  1E7U A;  3VXW A;  2K6Q A;  3HK0 A;  2REX A;  2KC2 A;  1RFA A;  2WDT B;  3A1Q A;  4ANU A;  5EDS A;  1J8C A;  5LXH A;  3AXC A;  2G3Q B;  5IA7 A;  4M8M A;  3EHV A;  4KZ0 A;  2GBR A;  3TCA A;  3L0W B;  4HCP B;  4NPN A;  4WJQ A;  5J2R A;  2DZM A;  4CYE A;  5KHQ A;  4W9I A;  4WWN A;  2MSE D;  2WWZ A;  2RSU A;  3CMM B;  3VTV A;  4NY0 A;  1VD2 A;  1XD3 B;  2FCN A;  1I42 A;  1Z5S B;  1OTR B;  3UF8 A;  2LVQ A;  4MM3 A;  5CHV C;  4A20 A;  3DOW A;  2K1F A;  3ZTC A;  1ISN A;  2CHW A;  1XT9 B;  3VTW A;  3PTF C;  2O2V A;  3A4R A;  1KM7 A;  2UWQ A;  2UYZ B;  2OJR A;  2A5U A;  2LGD A;  1OEY A;  4GIV A;  2MX2 A;  3W1S A;  4PS3 A;  1LXD A;  4BVU C;  4LJO B;  4DDG D;  3WAM A;  2NR2 A;  4EZJ A;  1UGM A;  2HD5 B;  3ONS A;  4WWO A;  2IO3 B;  1WR1 A;  3WIM A;  3ZO5 B;  2KD0 A;  3KVF B;  2LGY A;  3W1Y A;  3TL5 A;  3UIP B;  1KJT A;  2KDF B;  5HKH A;  1WM2 A;  4HCN B;  1TTN A;  3L13 A;  5CTR C;  2BPS A;  4MSM B;  4AJW A;  2KDE B;  1C1Y B;  4G0N B;  1WF9 A;  4GDK B;  2DHZ A;  2FNJ B;  4IC7 B;  2AL3 A;  2EMS A;  2V1Y A;  1YJ1 A;  3MHS D;  4P7I A;  2JZZ A;  5J17 A;  1F9J A;  4NJ6 A;  3QX1 A;  3QA8 A;  4IWO A;  3CF6 E;  1WJ4 A;  4B6W A;  3RYT A;  3KH0 A;  2BYF A;  4EEW A;  3EC8 A;  3H7P B;  1WXV A;  2NBW B;  4II2 B;  3EEC A;  5DPW A;  2LGX A;  1YQB A;  5E6N A;  3DVG Y;  1BT0 A;  5CHF A;  3WAL A;  4ZDV A;  1D3Z A;  2LJ5 A;  3VHT C;  3PV1 A;  1E90 A;  1SE9 A;  2MA9 B;  2NCN A;  2AL6 A;  3N32 A;  1V2Y A;  1E8Z A;  2KJH B;  3NZU A;  4NNJ B;  2FCM A;  1EF1 A;  2AWT A;  2BGF A;  3ZW3 A;  1WIA A;  1LQB A;  2LI5 A;  1OEY J;  4G3X B;  3V6C B;  4EKU A;  1ZW7 A;  4FHJ A;  2C7H A;  3DQV A;  2KJ6 A;  2L7R A;  3MJW A;  2N7E A;  4TUU A;  4HPM B;  2ZCC A;  3V62 A;  2JPH A;  3ZTD A;  5FR6 A;  2V3S A;  2KXJ A;  2GBM A;  3APF A;  2LVO A;  4ICV A;  2JWZ A;  3M3J A;  3H7S A;  3QK0 A;  2J0K A;  4G11 A;  4KVG B;  4GOC A;  3DBH I;  1WGR A;  1M94 A;  4GU2 A;  1E5W A;  3HM3 A;  3QHT A;  2JT4 B;  4PYU A;  4F1S A;  4WJP A;  1E7V A;  2C9W B;  2JRI B;  1SGH A;  2FID A;  3WAP A;  4W9J A;  3A1Q B;  2C7N B;  5D2M B;  1WR6 E;  2IYD B;  2DEN B;  3CSF A;  4G50 A;  5L95 C;  4FN2 A;  3A9K A;  3R66 C;  3T8M A;  4ZYN A;  1V49 A;  2KK8 A;  4KIK A;  2N4F A;  2KX0 A;  5C1Z A;  1G6J A;  4W9D A;  3W1S C;  4HXD A;  1E8X A;  4MGI E;  4GDL A;  4K7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...