2K6QA

Lc3 p62 complex structure
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
121
structure length
121
Chain Sequence
SMPSEKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESERDEDGFLYMVYASQETFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Microtubule-associated proteins 1A/1B light chain 3B
publication title Structural basis of target recognition by ATG8/LC3 during selective autophagy
rcsb
source organism Rattus norvegicus
molecule tags Apoptosis inhibitor/apoptosis
total genus 20
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2008-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2k6qA00
4G0NB 1UBQA 4FLHA 2XK5B 4DBGA 5TR5A 3V60A 1IPGA 2GOWA 3PZDA 3QQ8B 2UWQA 4HWIB 4URKA 3NY5A 1OGWA 2GBNA 2O6VA 3DOWA 2D10A 2KWCA 3A1QA 4A20A 4ASWC 2KZRA 3NZSA 4MSMB 2NBWB 3ECIA 3M95A 2LJ5A 1X1MA 1WZ0A 2XK5A 3L0WB 1P98A 4ANVA 1WM2A 2M0XA 1E5WA 5JZEB 2PJHA 1NBFC 2I1JA 2IYDB 3TL5A 1WX8A 2N9EB 3L17A 4M0WB 2BGFA 2KOXA 1F9JA 3RZWC 2YVCA 3R66C 1GC7A 4MDKE 4HLEA 4MH0E 1EF1A 3OJ4B 2C9WB 4DHZE 1OQYA 4NY0A 4AJYB 3ALBA 4DDID 4EUTA 1JRUA 4KIKA 4F7ZA 4DK5A 4EOYA 5BO4B 1KM7A 3UQAA 3RUIB 1UZXB 2K1FA 2L05A 2L0FA 2LD9A 3SU8X 1KOTA 4FJZA 1RLFA 5J17A 3PT2B 2L3ZA 3H9DA 1WJUA 4W9LA 3L54A 2V4LA 4NJ6A 4RMAA 1WXVA 1Y8RC 2BKRB 3VTWA 3WA0A 4KVGB 2N7EA 2PPHA 2W9NA 2NCNA 5AZFA 4BBNC 1WGGA 3KUZA 4GDLB 2HE7A 4IM2A 1R4NI 4NNJB 4JGHB 4PYZA 3UF8A 1BT0A 3TBLD 4BFRA 3ZLZA 3PRMB 5DPWA 3N3KB 4JL9A 3U7DA 3VAWA 4DDGD 4EZJA 2KJHB 4WAAA 4BOZB 2DYOA 2G4DB 3NZUA 4IUMB 4NAWA 2ZPYA 3APDA 1YX5B 2ZCCA 3V61A 1VCBA 2CHZA 3QWZB 3EC8A 3VH3B 4MJSA 1V2YA 4A3PA 1OEYA 4GGQA 4ANWA 3AI5A 4LJOB 3V6CB 4I6LB 2JRHA 3IHPC 3ZUNA 4WQOB 2J0JA 5DPTA 5IAAC 2JVCA 3GZNI 3IVFA 3RZFA 1V5TA 3Q3FA 3ZTDA 2KHWB 4CHKA 2KWVB 4JLCA 1OEYJ 1GUAB 3PVLA 4G3XB 1WH3A 1PQSA 1WX9A 1YJ1A 3QJZA 2NBUA 1OTRB 2BPSA 4W9CA 1S1QB 2RR9A 1WR1A 2FNJB 3IFWB 4BKSD 2PEAA 2IO1B 3DCGA 4MM3A 2FCNA 2O2VB 3KYDD 5E6PA 2A4ZA 2LGYA 4FJVB 3ZTCA 2ZNVB 1TZ1A 4KSLC 4EKUA 3SDLC 2ZPNA 2WYQA 4YL8A 3T8MA 5CX3A 2MBOA 3IG3A 3LDZE 2D2QA 4WWOA 2G3QB 2K39A 3TCAA 2KLCA 5CTRC 5D6JB 3P2BA 4ICVA 4W9EA 2O2VA 2KX3A 3CSFA 4OVUA 2Z59B 4K7UA 1Z2MA 2YLMA 1L7YA 5D94A 5C1ZA 3QARA 5GMVA 1P0RA 3KW5B 2DZKA 3QK0A 3M62B 2LWPA 2B3AA 1WGRA 4PS7A 1KLVA 3B1LX 3PREA 3U30A 4IWQA 4G50A 2M8SA 2I1KA 3QA8A 3U8ZA 1Z5SB 4DWFA 4HJKA 4FBJB 1K8RB 2CR5A 3V6EB 3QHTA 3N30A 3AXCA 2KD0A 4IG7B 1YX6B 4ZDVA 3JVZX 2UYZB 1RRBA 2MSED 1ISNA 4ANXA 3GOEA 1LQBA 4PS3A 3DBSA 1TGZB 2LGDA 1TBEA 2NS5A 3L10B 5J18A 3V62A 2BF8B 2HD5B 4II2B 3VQIA 2DYMA 3QCAA 3N32A 1Q1OA 5E6OA 4AOFA 3CSTA 1XT9B 2JRIB 5L95C 4X57B 1P9DU 1WGDA 2MA9B 4IWOA 4G11A 2CS4A 3R7RA 4B9KA 2NR2A 2JT4B 2L00B 2ZNVC 2FCQA 2KKCA 3H7PA 2FIDA 2CKHB 3VFKA 2CU1A 2NVUI 2IO2B 1J8CA 4KIKB 5KHQA 3QX1A 4TQ1A 2C7MB 3DVGX 2IY1B 4DXAB 1EF5A 2JUOA 2ZVNA 4BVUC 1HE8A 2JXXA 2XBBC 4GMVA 4TV3A 1RAXA 1WXAA 2DX5B 2D11A 1WGHA 2MBBB 1GG3A 3WAPA 3JSVB 2KVRA 4NJ7A 4WJNA 2M17A 1LFDA 1U4AA 1V49A 2RPQA 2RD0A 3KH0A 4HCPB 2OJRA 5D2MB 2IO0B 3SHQA 4FJYA 4J6IA 2G45B 2ZEQA 3PRZA 4MEMA 3KUCB 4I6NB 3VUWA 4KDIC 2PE6B 1WXSA 3JSVA 1E8WA 4NAWB 1AARA 3PHXB 1WJNA 2IZVB 3TJPA 3VHTC 3VVWB 4IWPA 3EECA 4DHZB 1XD3B 4BKGA 4CO7A 4MJSB 3VH4B 2GBKA 2K8HA 1ZKHA 2BYVE 2KC2A 2WDTB 3DVNU 3ONSA 5AEKB 2GBRA 3K9PB 4DHJD 2J0MA 4DHJB 3OAWA 4W9KA 5DPSA 2KC1A 4PYUA 4F1SA 3K9OB 2LXAA 4WJQA 3ZNID 2C60A 4M8NA 2LRUA 2Z0DB 3RD2A 2L0TA 1E90A 3ENEA 2MW5A 3QIJA 3M63B 3A33B 2A5UA 2EMTA 2K6DB 4JIOU 1C3TA 4KZCA 3SD5A 3VTUA 3ZRFA 2JY6A 4W9FA 3NOBA 4P7IA 4A3OA 3M3JA 5DCNA 1Q5WB 2J0KA 2AYOB 2L76A 4E74A 2AEHA 1T0YA 4ICUA 2EMSA 4FA6A 2DHZA 3APFA 2PE9A 3ZDMC 4EZKA 2MBEA 1E8XA 1WMHB 3APCA 3KVFB 2V1YA 4MELA 3WIMA 4RM9A 5FR6A 4FADA 3DDCB 4M8MA 4HPMB 2KK8A 1UGMA 3VTVA 4EEWA 4MSQB 2D3GA 1UELA 2LVQA 1IYFA 3ZO5B 1MG8A 2KNBA 3ZRCA 1WMHA 3NS8A 4W9DA 4HDOA 1UD7A 2GBJA 3PPAA 4OVVA 2BWES 1WE6A 2KMAA 2MQJA 2HJ8A 4W9GA 2MP2B 2KFKB 2C7NB 2DZIA 4LDTD 2CHWA 4LDTB 3X0WA 2KQ7A 3HIZA 3CMMB 2LASA 1SE9A 5IA7A 4WWNA 1E7UA 4XX5A 2DENB 2KJRA 2ZJDA 5JHBA 1SGHA 2MP2A 2KFKA 3AU4A 2LZ6A 4ZRJA 2L8JA 4CYEA 4K7WA 2BYEA 5G55A 3PSEB 2NBVB 4MGKE 3UQBA 4W9HA 3WAMA 1V9JA 2BKFA 2KXJA 3VUXA 5LXHA 4WWPA 2MX2A 1WIAA 1R4MI 1WRDB 1LM8B 1H4RA 2GMIC 4AP4C 3JYUA 3UINB 4TUUA 3KYCD 4K1RB 3PS6A 4IM3A 1QZEA 3H7PB 2XEWA 4RM8A 1GC6A 3PV1A 2KDBA 3ZKJC 4K7SA 3JW0X 2JZZA 4BOSC 5HKHA 1WX7A 3DQVA 1E7VA 3S2AA 2MBQA 3RULA 2IBIB 1NI2A 3WANA 1ZW7A 4TQ0A 2FIFA 4EZLA 5JH5C 3A4RA 2KX0A 3L16A 2J7QB 2JF5A 5CHWA 1L2NA 2RGFA 2KJ6A 5CHFA 2N7DA 3DBRI 1ZGUB 2ASQA 3BINA 4AJWA 1V80A 2L7RA 4E71A 5LLIA 2JPHA 2LRWA 4BBNF 5KHOA 5AZGA 3H7SA 4NQLB 2N1VA 1FXTB 1NDDA 5D7GA 4KZ0A 2KFJA 2MLBA 1WGYA 1WJ4A 1WXMA 1YQBA 4ZRKA 4NPNA 3L13A 3PLVA 4GXBA 4HVBA 3C0RB 3BY4B 2ZCBA 2WX1A 1Q0WB 2QHOA 4I6PA 2KTRB 4FULA 2M4NA 5LXIB 1V86A 3VDZA 2KN5A 3Q3JA 4WJPA 3TMPB 2AWTA 3A4SC 1YD8U 3ML9A 4AWJA 3EFUA 3R3MA 4JQWC 1KJTA 3DVGY 4LCDE 2RSUA 2LUEA 3O65B 4BKTA 3HHMA 2HTHA 3VXWA 5J2RA 2KTRA 2G4SA 2LVPA 1WM3A 2DAJA 2N9PC 4TKNA 4HK2A 3H1UA 2FAZA 2JZ3B 3D32A 1G6JA 2Y5BB 3UGBB 1P1AA 3HM6X 2K8CA 2WWZA 5DPRA 2Z0EB 2KTFA 1UH6A 1E8YA 1UBIA 3I3TB 3PTFC 3QAQA 2BYFA 4IM0A 3ZW3A 2ZZPB 1EUVB 2R2QA 2K6QA 1WYWB 2C7HA 4ZRIA 4MGZE 1P3QU 4GOCA 4B6WA 2LXCA 2LGXA 1WF9A 4W9IA 1C1YB 4ANUA 1WY8A 3VUYA 1VD2A 3MTNB 3W1SA 3ZIMA 2MWSB 2K8BA 2VRRB 3A9KB 5L83A 2DAFA 4XZ4A 4AUQC 3MJWA 4GDLA 2NPTB 4KDLB 5E6NA 3T9LA 3DVNV 4HPLB 4FHKA 5JHAA 1H8CA 4F8CB 4MGIE 2KO3A 3AULA 1GNUA 4K81A 4PS8A 2N1WA 4WJOA 4GSWA 5CHVC 4LJPB 4IC7B 3DPDA 3A9KA 3DBLI 4IW0A 3OLMD 4FHJA 2M1MA 2NPTA 5C23A 3UIPB 2WX0A 3HK0A 1WR6E 4GU2A 4EFOA 3ZVVA 2DZMA 3W1YA 1J0GA 3A9JB 2MBHA 3ZNGC 3KUDB 3TIXA 2N4FA 4II3B 2KDEB 2JWZA 3NHEB 3PRPB 3RCZA 3X23A 2LI5A 1WJ6A 4W9JA 1CMXB 2AL3A 2AL6A 3LJ3A 4NQKE 1WI0A 4KSKC 3RT3B 3WALA 4MGYE 2FCMA 2D07B 3PLUA 2FCSA 3R7QA 1E8ZA 3L08A 3CF6E 3OJ3A 3A9JA 3RYTA 2IY0B 1A5RA 3DBHI 3W1SC 1V81A 3EHVA 1WZ3A 3ZDTA 3B0AA 1M94A 3MHSD 3IBEA 2DZJA 2ZVOA 2V3SA 2MRPA 2KLGA 2KDFB 2KWUB 2N9XA 3HM3A 1YIWA 2K25A 2GBMA 2C5LC 4GDKB 4GIVA 4KV2A 3ZNHB 1RFAA 3PHWB 4GN1A 2MCNB 2KMCA 4BKSA 5EDSA 3PGEA 2KDIA 1WE7A 3ZNZB 4E3CA 1J19A 3AU5A 4HCNB 3WAOA 4GDKA 1WFYA 4HDQA 2FUHB 4B95A 2EKEC 5G2NA 1SIFA 2LVOA 4XC2A 1LXDA 2BWFA 1S3SG 3B08A 3H6NA 3ML8A 4FN2A 5AZHA 1I35A 4GB9A 1IP9A 2CHXA 2IO3B 4ZYNA 2KQSA 2O6VD 1V6EA 2O6VB 2KANA 2R2OA 2REXA 4N9F4 1I42A 1V5OA 2DYBA 1EO6A 2OOBB 3A1QB 3QC8B 3UIOB 1XQQA 1D3ZA 4HXDA 1GJZA 1TTNA
chains in the Genus database with same CATH superfamily
4M01A 1UBQA 2WXGA 2WXJA 2XK5B 1IPGA 3PZDA 2INDC 3AE2B 2FBWB 3NY5A 2QSDA 1OGWA 2O6VA 3AE4B 1LGRA 1L5PA 3NZSA 3M95A 1X1MA 3L0WB 2LHDA 3E56A 3MHZA 5JZEB 1NBFC 2I1JA 2RDGA 4R3DA 4M0WB 2BB6A 1R4NB 3VR9B 1FRDA 1ZXHA 4DHZE 4HKZE 1WSPA 4NY0A 4AJYB 4DDID 4P1CC 2IDYA 1J7CA 2K1FA 1C78A 2L05A 4P6VF 1KOTA 2K22A 5C2TB 2L3ZA 3H9DA 4W9LA 3L54A 2V4LA 1WXVA 2BKRB 4KVGB 2W9NA 4GLSC 1QOBA 3KUZA 2HE7A 1R4NI 4ZOHC 3MC8A 1ESFA 3TBLD 3PRMB 2WXNA 3N3KB 4JL9A 3U7DA 1FEHA 1V1OA 3VAWA 3ABVB 4BOZB 5TSSA 2DYOA 3NZUA 4IUMB 5LNK1 3QWZB 3VH3B 4MJSA 4LJOB 4XYCA 3V6CB 3AEEB 2J0JA 5DPTA 3IAM1 2NMQA 3VRBB 3Q3FA 4CHKA 2K3UA 1GUAB 3PVLA 2JYEA 3RNFC 1KH0A 1L6UA 1OTRB 4ZYSA 1XLQA 2I38A 2RR9A 3BIID 2PTLA 1A70A 1JROA 2MEKA 4YT0B 1GB4A 1N61A 2JX5A 2ZPNA 2WYQA 3T8MA 4MH8A 1FM0D 2D2QA 2ON8A 2KLCA 3FC4A 2O2VA 2Z59B 2YLMA 2K9XA 5D94A 3KLSX 2GB1A 1KLVA 1PUTA 4G50A 3U8ZA 2WU5B 2YEPB 1K8RB 2CR5A 3V6EB 4HEA1 3N30A 3B9JA 2KD0A 1JWBD 2G9HD 3Q3NC 1RRBA 2MSED 3R2IA 4KGRA 2LGDA 2NS5A 3L10B 3ZJVA 1QOGA 4TMAB 3N32A 5E6OA 1VZ6A 1XT9B 2RMMA 2MA9B 4IWOA 4YTPB 2CS4A 3R7RA 4B9KA 4WIPA 2FCQA 2CKHB 2NVUI 3ZJTA 4USAA 5KHQA 4TQ1A 4DXAB 4WWMA 2JUOA 4BVUC 2M19A 2XBBC 5FR3A 2IPKD 1WGHA 2MBBB 3JSVB 4NJ7A 1U4AA 4XWWA 3KH0A 2OJRA 3GS2A 2IO0B 2TSSA 2G45B 1F52A 4I6NB 3DWMA 3W2DA 2ZW1A 1EM7A 3VHTC 1WJNA 2IZVB 3TJPA 3FAHA 4IWPA 1D6EC 4MJSB 2MJ3A 2GBKA 1ZKHA 3DVNU 3ONSA 5IOIA 1TT5B 2DNFA 2W3RA 4DHJB 1XEEA 3OAWA 3RFZB 4N6EB 2Z0DB 2LUMA 1KTKA 3QIJA 2KACA 4KKIA 2XNAC 2EMTA 2DBYA 3ZRFA 5HHDG 1E0ZA 1QLBB 3LXFA 3ZDMC 2PE9A 2MBEA 3NVWA 3KVFB 4MELA 3WIMA 3DDCB 5AUKA 1IBXB 3VTVA 4MSQB 1WXQA 1IYFA 1Q10A 2L1AA 2KNBA 3EGRA 4W9DA 2AQ2B 1I4RA 4HDOA 2GBJA 1R4MB 2BWES 2HJ8A 1VLBA 2WHIA 1FFUA 4P1BC 2DZIA 1C76A 1SE9A 3FILA 2CU3A 1SGHA 2MP2A 3URYA 4CQNA 5I4DA 1N5XA 3UQBA 4W9HA 3WAMA 1FMAD 1KLGD 1R4MI 1LM8B 1RFKA 2G1EA 4AP4C 3JYUA 3UINB 4PT5A 4H2AA 2BB5A 1C79A 2KDBA 1D5ZC 5HKHA 3P63A 1JWUD 3S2AA 2D3CA 1JCKB 3WANA 1I4PA 4JE3B 3A4RA 5JH5C 2KX0A 5H92C 1VJKA 5CHFA 2N7DA 2L7RA 1EWYC 1FXTB 1NDDA 2MLBA 3AE3B 1WGYA 1WJ4A 3L13A 4RGNA 4GXBA 1MHHE 4I6PA 1C4PA 1L0YB 2FE8A 2KN5A 3ML9A 3R3MA 1MJDA 5EE1A 3AM9A 2HTME 2HTHA 5EE0A 3SR6A 1JWSD 4TKNA 3D32A 1G6JA 2Y5BB 2K8CA 2WWZA 5DPRA 3BZDB 2KTFA 1UH6A 4RNAA 1EU4A 1EWCA 3NS1A 4C80A 3P1MA 3DHIC 2LGSA 3R8BA 2PMVA 1IGDA 4GOCA 1JQ4A 4W9IA 1C1YB 3V3XA 4A6QA 3NVYA 2DAFA 4XZ4A 3W5UB 4KDLB 5E6NA 3DVNV 4HPLB 5JHAA 4S0RA 2KO3A 4WJOA 5CHVC 4D2KA 4LJPB 3FILB 3A9KA 3DBLI 1WR6E 1SB3C 2MBHA 3ZNGC 4YTNB 4C00A 1MHXA 2KDEB 1TKGA 3ETRA 1PGXA 1QQRA 3LJ3A 1K51A 1WI0A 2N7JA 2FCMA 1A5RA 3CF6E 1V97A 1K52A 3ZDTA 3IBEA 2DZJA 2V3SA 4P16A 4XDCA 4ITKA 1ZE3D 2N9XA 4KV2A 3ZNHB 2GBMA 1FRRA 3Q6BA 2MCNB 2DWQA 5EDSA 2QMTA 3N1XC 5BMIA 1PFDA 3RNCC 5HFYA 4HCNB 1WFYA 2MJEA 4XC2A 2BWFA 4FN2A 3HUIA 2KQSA 1KLUD 2R2OA 1V5OA 2J42A 1TTNA 1KFYB 1SBBB 2LHEA 2UWQA 3QQ8B 4N58A 2GBNA 2VH2A 2KWCA 4A20A 2AQ3B 4MSMB 2LJ5A 2XK5A 1WZ0A 1P98A 2M0XA 1E5WA 2LMCA 3IXSA 3NZ3A 1WX8A 3L17A 2KOXA 2YVCA 3TEWA 4MDKE 2JWUA 2N0SB 4MH0E 3OJ4B 4JWUC 3ALBA 4M0WA 3ZGZA 3BYTB 4KIKA 1UGJA 4F7ZA 1TKEA 1KM7A 2L0FA 3SU8X 4FJZA 2IGHA 4NJ6A 3GZNB 3WA0A 5AZFA 4BBNC 1ENFA 4NNJB 3UF8A 2UU7A 1BT0A 4XWTA 3ZLZA 1PDXA 2KDMA 3APDA 1SSNA 2ZCCA 2JZPA 3EC8A 4N59A 3FKYA 1TY2A 4GGQA 4ANWA 2ICIA 5EE9A 2JRHA 5T8IA 3KWLA 3GZNI 1C77A 3RNAC 1FCLA 1TY0A 4MM3B 4JLCA 4O1NA 1ZXIA 5BYRA 1PQSA 1YJ1A 3QJZA 1I4XA 2NBUA 1TIFA 2PKOA 2OEDA 3RMKC 3KYDD 3ZTCA 4FJVB 1QKZA 4KSLC 5E6JA 1XLOA 5CX3A 1BMLC 2MH7A 3ZXRA 2K39A 4W9EA 3BVMA 2KX3A 3CSFA 3AH7A 5FKAC 3KW5B 2DZKA 1K53A 4LK0M 4PS7A 1ZDVA 4IWQA 3U30A 3QA8A 2WXPA 4HJKA 2WU2B 2IGGA 4ZDVA 4IG7B 1YX6B 4PK1A 3JVZX 2KWDA 4ANXA 4ZHOA 2KQ4X 3GE8C 2LGIA 3I63C 3VQIA 2DYMA 4AOFA 3CSTA 2WXHA 4X57B 1YJIA 1YN3A 1DOIA 2L32A 4UDUC 2NR2A 2JT4B 4DXGA 2ZNVC 2FIDA 2CU1A 4KIKB 3QX1A 1FNUA 2IY1B 3TEXA 4US8A 1HE8A 1RAXA 1WXAA 2D11A 3AE5B 1HTOA 3WAPA 2EELA 2KVRA 2RD0A 4OZCA 2ZEQA 4MEMA 3VUWA 1BUIC 1T6BX 3JSVA 4NAMA 1E8WA 2WGSA 2ONQA 2SAKA 5IKCM 3PHXB 5G5HA 3VVWB 1FXIA 4CO7A 2K8HA 2WDTB 2KC2A 5AEKB 4DHJD 4W9KA 2KC1A 4F1SA 3K9OB 2H89B 4M8NA 3RD2A 2L0TA 3U2SC 3M63B 3A33B 2A5UA 3VTUA 3PZ8A 2JY6A 4P7IA 3M3JA 1Q5WB 2H88B 1HQRD 2L76A 1TS3A 2AEHA 4KGSA 4FADA 5FR6A 4OVZA 4M8MA 4HPMB 3DBHB 2W54A 4EEWA 1UELA 2LVQA 1MG8A 3E9SA 1UF0A 3P4RB 3V05A 4J3OD 4OVVA 1IBXA 1F1HA 2MQJA 2KFKB 2CHWA 2D5GA 5IA7A 4RGMA 2DENB 2KJRA 3LB8C 3AU4A 4ZRPA 1T0RC 2LZ6A 4ZRJA 2L8JA 2BYEA 4KKJA 1T0QC 3PSEB 4MGKE 5LXHA 2JSVX 1XXGA 2J4XA 4WWPA 2MX2A 1WIAA 1CZPA 3TSSA 5MPOA 2DLBA 4YSXB 4WH4A 4K1RB 3PS6A 5HI1A 1SIJA 3RNGC 3PV1A 2JZZA 2J53A 1E7VA 1T5XD 5GXGB 2MBQA 3RULA 2IBIB 1YQ4B 1NI2A 4EZLA 2J7QB 2JF5A 5CHWA 1L2NA 2IJ0A 2ASQA 4ARIA 4E71A 2JPHA 1F77A 1C9FA 4KZ0A 2KFJA 4BZAA 1WXMA 1YQBA 3O13A 4ZRKA 3ZJUA 3PLVA 4HVBA 3BY4B 1Q0WB 4WAFA 1V86A 2JYTA 4WURA 3ZQ4A 1KJTA 2RSUA 2LUEA 3O65B 3SFDB 3NJTA 2D3BA 4C7ZA 1OFFA 2RPVA 1QOAA 2G4SA 2LVPA 2JZ3B 3AEDB 4A8XC 1XLNA 3AEFB 3PZ7A 4US9A 1L0XB 3PTFC 4IM0A 3ZW3A 2ZZPB 3Q8AA 1N5WA 4ARCA 2B76B 2R2QA 1TS4A 2ACZB 4B6WA 3GP7A 1WF9A 1VD2A 4HROA 3MTNB 1R7SA 3ZIMA 2VRRB 5L83A 4AUQC 2GI9A 4GDLA 3MC0B 3I57A 3AULA 3U52E 2WDQB 4GSWA 2XN9C 1HEZE 3DHHC 4IC7B 3DPDA 3OLMD 3UIPB 3TEZA 2WX0A 4KGTA 3NHEB 4FXCA 1KRHA 1WJ6A 3WALA 2QJLA 2M0AA 2D07B 2WLBA 3R7QA 2IY0B 2BS3B 3W1SC 1V81A 1WZ3A 3B0AA 2ZVOA 2W55A 2KLGA 2KWUB 3HM3A 1YIWA 2KMCA 4BKSA 1WE7A 1QILA 3AV8A 4E3CA 3AU5A 1SE2A 1E6EB 1L4DB 4HDQA 1SIFA 2LVOA 1BXTA 1LXDA 5AZHA 4ZYNA 1V6EA 2KANA 3A1QB 2OOBB 3VRAB 1OQRA 2YEPF 4HXDA 4G0NB 4DBGA 5TR5A 3V60A 2QIEB 4HWIB 3Q69A 3DOWA 2PIAA 4YTMB 4ASWC 1N60A 2NBWB 3ECIA 3AEGB 1WM2A 3TL5A 2N9EB 4LNFA 2WXOA 3I5JC 3RZWC 3C8YA 3R66C 4HLEA 1UUPA 2E6XA 1EF1A 2Y3AA 2C9WB 1I4QA 1MG4A 1E10A 3TUOA 1JRUA 2M56B 5D3DA 4EOYA 3RUIB 5HG2A 4MACA 3UI3A 4LNIA 5J17A 3PT2B 1WJUA 4RMAA 4IKGA 3VTWA 2V9HA 1ZUD2 3BVGA 4GDLB 4IM2A 4JGHB 4PYZA 4BFRA 2LEKA 3IAS1 3RNBC 3BK2A 3HVZA 2KJHB 2G4DB 3ZXVA 3V61A 2CHZA 4A3PA 1V2YA 3W5VB 1OEYA 4ACFA 2V4IB 3R2TA 2QDFA 2MHJA 4EE2A 4ZRQA 3IVFA 3RZFA 2KHWB 2KWVB 2PVOD 3MP9A 1NVID 1WX9A 2PVGC 4JPSA 3TEYA 1FO4A 2BPSA 4W9CA 2V0GA 1F2RC 1FCCC 1YMHE 1B9RA 2FNJB 4NJCA 2PEAA 3DCGA 4MM3A 5E6PA 3T3NA 4REZA 2ZNVB 1TZ1A 4EKUA 2MBOA 3IG3A 1GAQB 5CTRC 3P2BA 3HVDA 4ICVA 3BK1A 5IN7A 1L7YA 1IGCA 4LNKA 5C1ZA 2KN4A 3QARA 1SJHD 3QK0A 2W82A 2X38A 3M62B 2LWPA 2INNE 2I1KA 4DWFA 4WQMA 3Q14C 3DBRB 3QHTA 4B0EA 1ISNA 4PS3A 1LQBA 1ET9A 1TGZB 1ZDXA 1TBEA 3V62A 2NTTA 4IDIA 2HD5B 4II2B 3QCAA 1UWXA 2WXQA 2JRIB 1JRPA 4Q2JA 3NVZA 1WRIA 1WGDA 4TSSA 4RF1A 1VR9A 3H7PA 3AN1A 1D5XC 2VH1A 3C19A 3DVGX 1EF5A 2ZVNA 1JMLA 4TV3A 4RH6A 2DX5B 2WDRB 2KAJA 1SXTA 3N1YC 2W3SA 4WJNA 1TZOA 1ZPSA 1LFDA 1V49A 4HCPB 3NG0A 3SHQA 4J6IA 4M02A 1YN5A 1UNSA 3PRZA 3KUCB 1NENB 2PE6B 1NYQA 1WWTA 5H8YE 1CQVA 2HJ1A 3NVVA 4DHZB 2Y5CA 3EECA 4BKGA 2EKIA 2BYVE 2GBRA 3RN9C 5DPSA 3P42A 4PYUA 1QF6A 1NEKB 2C60A 2IGDA 2INCC 1E90A 2MW5A 2K6DB 1C3TA 4A3OA 5DCNA 2GLSA 2GRIA 2AYOB 4E74A 4ICUA 1T0YA 2EMSA 2R61A 1E8XA 1WMHB 4OZAA 3IT4B 2KK8A 1L6VA 2D3GA 1XO3A 4RFBA 4YWGG 3ZO5B 2NTSA 3HRDD 3ZRCA 3NS8A 1GOZA 4LNNA 4W9GA 1TS5A 2C7NB 4LDTB 2KQ7A 4YSZB 3CMMB 1AW7A 2LASA 1JWMD 5JHBA 2WXFA 2ZJDA 3AE9B 3AE7B 1VDVA 4OZBA 2KFKA 4KX6B 1TKYA 1CJEA 2V3PA 5IO9A 3MJ5A 1AN8A 3U4EG 4CYEA 3N20C 4K7WA 5G55A 2RDHA 1V9JA 1C4CA 3OWEB 4IM3A 1QZEA 3H7PB 4RM8A 1KF6B 3Q2AC 3ZKJC 4K7SA 3JW0X 4BOSC 1FPYA 1WX7A 3MC9A 1T0SC 2WP9B 1RYJA 2RGFA 4HKQA 3B2FA 1ZGUB 2LRWA 2CJOA 2VZKB 5AZGA 1HTQA 4NQLB 2N1VA 5D7GA 3N1ZC 4NPNA 3C0RB 1SEBD 2BQQA 1VZ8A 2WXKA 3GB1A 2QHOA 2KTRB 2QC8A 2M4NA 5LXIB 2INPE 3Q3JA 4WJPA 3MFGA 3TMPB 3A4SC 1YD8U 4HRSA 3DWGC 3EFUA 4JQWC 4LCDE 1M4VA 2MJDA 4BKTA 3LYYA 2QCZA 3HHMA 4LNOA 2N9PC 1WM3A 2DAJA 1N6ZA 1P1AA 3AEBB 3H8HA 2Z0EB 2LFIA 2RDBC 1SJED 1VZ7A 3GE3C 1UBIA 2KMMA 1EUVB 2BS2B 2K6QA 4ZRIA 4MGZE 1P3QU 4M00A 4C4VB 2LXCA 3SEBA 4ANUA 4K3BA 2MWSB 4S17A 4A9AA 1PGAA 1L4ZB 2NPTB 1OQQA 1H8CA 1JALA 4JWSC 4MGIE 5D3IB 1GNUA 3RNEC 4IW0A 2WDVB 4FHJA 5C23A 2M1MA 1FD6A 3ZVVA 3T3OA 1J0GA 3A9JB 2BTEA 3WCQA 3AEAB 5BMHA 3TIXA 2N4FA 4II3B 2JWZA 1D5MC 4AQ7A 3RCZA 1CMXB 2AL6A 3Q8BA 1NYRA 4MGYE 1ET6A 3PLUA 3RYTA 1E8ZA 4OW0A 3DBHI 5BYQA 1XCQL 3AB5A 3EHVA 2V3NA 4XE0A 5G5GA 2QILA 2KDFB 4GDKB 2OHFA 2K25A 2C5LC 1TYGB 1UWMA 1RFAA 2L52A 3PHWB 3Q3MC 4GN1A 1EU3A 3EFCA 1IUEA 1J19A 5EE3A 4YXDB 2FUHB 4B95A 2EKEC 5G2NA 1MPEA 3ML8A 1QOFA 4GB9A 1I35A 1IP9A 2CHXA 2O6VB 4N9F4 2DYBA 1FNWA 1PGBA 2AX5A 4FLHA 2GOWA 2BS4B 4URKA 1RM6C 2D10A 3A1QA 1JW9D 3NUHB 2BBCA 2KZRA 5AUIA 4ANVA 2SEBD 3EA6A 1C4AA 2PJHA 2IYDB 4RCOA 4IOIE 2BGFA 1F9JA 2WQYB 2FUG1 1GC7A 3J9CA 5FK9C 1OQYA 3B2GA 4EUTA 3L4PA 1YNTE 4DK5A 5BO4B 3UQAA 1UZXB 2LD9A 2D3AA 1RLFA 1SE4A 1K50A 1Y8RC 1I4HA 2N7EA 2PPHA 2NCNA 1WGGA 4QAYA 5DPWA 1DYQA 2N9LA 1I4GA 4DDGD 4EZJA 1E7PB 4WAAA 4NAWA 2ZPYA 1YX5B 1VCBA 1WGKA 3AMZA 1HA5A 3AI5A 1P7FA 1F2RI 4I6LB 3IHPC 3ZUNA 4WQOB 5IAAC 1B1ZA 2JVCA 4C56C 1SE3A 1V5TA 2BVCA 3ZTDA 1RWSA 4XGAB 1OEYJ 1NI3A 4G3XB 1WH3A 4L23A 1V1PA 4HPPA 1S1QB 3VR8B 1WR1A 1V8CA 2Y5PA 1DOYA 3IFWB 4BKSD 1VRAB 2IO1B 2FCNA 4BAXA 2O2VB 2A4ZA 2LGYA 3SDLC 4YL8A 3LDZE 1PYWD 4WWOA 2G3QB 3TCAA 5D6JB 1HXYD 3ZYYX 4OVUA 3IT6B 4K7UA 1Z2MA 1I7HA 4L2YA 5GMVA 1P0RA 1FFVA 2B3AA 1WGRA 3B1LX 2BW2A 3PREA 4K3CA 2M8SA 1Z5SB 2N9KA 4FBJB 3P4QB 3AXCA 1GPXA 2UYZB 1F0ZA 3GOEA 3DBSA 5J18A 2BF8B 1Q1OA 1YOVB 5L95C 1P9DU 1P7EA 4G11A 2L00B 2KKCA 4JX1C 3VFKA 1AYFA 2IO2B 4OHJA 1J8CA 2CJNA 1L0VB 2C7MB 4YSYB 4AS1A 3Q8FA 2JXXA 3P4PB 4GMVA 3W9CB 1GG3A 1E9MA 5JXVA 2M17A 4LTUA 2RPQA 2BT6A 3BVZA 5D2MB 4LLGM 3AECB 4FJYA 4DQOC 1ROEA 4KDIC 2BYTA 1WXSA 4NAWB 1AARA 1SF0A 3BWUD 1XF5L 1XD3B 1FIQA 3VH4B 1JWAD 2L83A 3K9PB 3KWVA 4DXFA 1LO5D 1TJEA 2J0MA 3AE1B 1WYGA 3P4SB 1TS2A 2LXAA 2JXTA 1AWDA 4WJQA 3ZNID 3N9YC 4A55A 1XCTL 2LRUA 3DBLB 3ENEA 3RPFC 1YQ3B 4JIOU 4KZCA 3SD5A 4W9FA 3NOBA 1V1PB 1ACCA 2J0KA 4FA6A 3RI7C 3U7ZA 2DHZA 3APFA 4EZKA 1ZOYB 3APCA 2V1YA 4RM9A 1UGMA 2WNMA 1GB1A 1WMHA 1N62A 2J52A 4RF0A 1UD7A 3PPAA 1WE6A 2KMAA 3AE6B 1D4BA 2MP2B 4RGTA 1FXAA 4LDTD 1J7BA 3X0WA 3HIZA 2K5PA 3CWIA 4WWNA 1E7UA 4XX5A 2I2YA 2QEJC 2Q5WD 2NBVB 4MT5A 2BKFA 2KXJA 3VUXA 1WRDB 4XDDA 1H4RA 2GMIC 4B0MA 4TUUA 3KYCD 1DOXA 2XEWA 1GC6A 2KT7A 2E3TA 2PLPA 1Y56A 3DQVA 1N63A 4TQ0A 1ZW7A 2FIFA 4NZLB 3L16A 2JU6X 2KJ6A 1MI0A 1ZP0B 3DBRI 4AJWA 3BINA 1V80A 5LLIA 3AE8B 2VZKD 4BBNF 5KHOA 4HJGE 3H7SA 2KYWA 3EUB2 3BYYB 2ZCBA 1MFWA 3CIRB 2WX1A 4FULA 3VDZA 5IP4D 1STEA 2AWTA 4AWJA 3DVGY 2KVZA 3VXWA 5J2RA 2WXIA 1MVKA 2KTRA 4HK2A 3H1UA 2FAZA 3UGBB 3HM6X 1HZ6A 1YN4A 2WXLA 1E8YA 3I3TB 3QAQA 2BYFA 3KQ4A 1YJJA 1WYWB 2C7HA 2LGXA 1WY8A 3Q8EA 3VUYA 3W1SA 2LJIA 2WXMA 2K8BA 3A9KB 3MJWA 3T9LA 5BYSA 2Z8LA 4FHKA 2HDEA 2WS3B 4C4VA 4F8CB 4K81A 1DGJA 4PS8A 2N1WA 5BMGA 4A90A 3SFEB 2NPTA 3HK0A 1HZ5A 4GU2A 4EFOA 2PW9A 2DZMA 3W1YA 3KUDB 3OG5A 1CK1A 3PRPB 3X23A 2LI5A 2K0PA 4W9JA 2AL3A 4NQKE 3RT3B 4KSKC 2FCSA 3L08A 3OJ3A 3A9JA 3Q3OC 1M94A 3MHSD 1T3QA 2ZW0A 5C3JB 2AQ1B 2MRPA 3DHGC 1XLPA 4GIVA 2JQRB 3I9V1 3PGEA 2KDIA 3ZNZB 4L1BA 2OJWA 4RGOS 1FNVA 3WAOA 4GDKA 3PO0A 1S3SG 2X8XX 3B08A 3H6NA 3Q8CA 4C7YA 2IO3B 4ZHPA 2O6VD 1I42A 3NRZA 2REXA 1EO6A 3QC8B 1J7AA 3UIOB 1XQQA 1D3ZA 2WXRA 1QT9A 1GJZA
chains in the Genus database with same CATH topology
4G0NB 1UBQA 4FLHA 2XK5B 4DBGA 5TR5A 3V60A 1IPGA 2GOWA 3PZDA 3QQ8B 2UWQA 4HWIB 4URKA 3NY5A 1OGWA 2GBNA 2O6VA 3DOWA 2D10A 2KWCA 3A1QA 4A20A 4ASWC 2KZRA 3NZSA 4MSMB 2NBWB 3ECIA 3M95A 2LJ5A 1X1MA 1WZ0A 2XK5A 3L0WB 1P98A 4ANVA 1WM2A 2M0XA 1E5WA 5JZEB 2PJHA 1NBFC 2I1JA 2IYDB 3TL5A 1WX8A 2N9EB 3L17A 4M0WB 2BGFA 2KOXA 1F9JA 3RZWC 2YVCA 3R66C 1GC7A 4MDKE 4HLEA 4MH0E 1EF1A 3OJ4B 2C9WB 4DHZE 1OQYA 4NY0A 4AJYB 3ALBA 4DDID 4EUTA 1JRUA 4KIKA 4F7ZA 4DK5A 4EOYA 5BO4B 1KM7A 3UQAA 3RUIB 1UZXB 2K1FA 2L05A 2L0FA 2LD9A 3SU8X 1KOTA 4FJZA 1RLFA 5J17A 3PT2B 2L3ZA 3H9DA 1WJUA 4W9LA 3L54A 2V4LA 4NJ6A 4RMAA 1WXVA 1Y8RC 2BKRB 3VTWA 3WA0A 4KVGB 2N7EA 2PPHA 2W9NA 2NCNA 5AZFA 4BBNC 1WGGA 3KUZA 4GDLB 2HE7A 4IM2A 1R4NI 4NNJB 4JGHB 4PYZA 3UF8A 1BT0A 3TBLD 4BFRA 3ZLZA 3PRMB 5DPWA 3N3KB 4JL9A 3U7DA 3VAWA 4DDGD 4EZJA 2KJHB 4WAAA 4BOZB 2DYOA 2G4DB 3NZUA 4IUMB 4NAWA 2ZPYA 3APDA 1YX5B 2ZCCA 3V61A 1VCBA 2CHZA 3QWZB 3EC8A 3VH3B 4MJSA 1V2YA 4A3PA 1OEYA 4GGQA 4ANWA 3AI5A 4LJOB 3V6CB 4I6LB 2JRHA 3IHPC 3ZUNA 4WQOB 2J0JA 5DPTA 5IAAC 2JVCA 3GZNI 3IVFA 3RZFA 1V5TA 3Q3FA 3ZTDA 2KHWB 4CHKA 2KWVB 4JLCA 1OEYJ 1GUAB 3PVLA 4G3XB 1WH3A 1PQSA 1WX9A 1YJ1A 3QJZA 2NBUA 1OTRB 2BPSA 4W9CA 1S1QB 2RR9A 1WR1A 2FNJB 3IFWB 4BKSD 2PEAA 2IO1B 3DCGA 4MM3A 2FCNA 2O2VB 3KYDD 5E6PA 2A4ZA 2LGYA 4FJVB 3ZTCA 2ZNVB 1TZ1A 4KSLC 4EKUA 3SDLC 2ZPNA 2WYQA 4YL8A 3T8MA 5CX3A 2MBOA 3IG3A 3LDZE 2D2QA 4WWOA 2G3QB 2K39A 3TCAA 2KLCA 5CTRC 5D6JB 3P2BA 4ICVA 4W9EA 2O2VA 2KX3A 3CSFA 4OVUA 2Z59B 4K7UA 1Z2MA 2YLMA 1L7YA 5D94A 5C1ZA 3QARA 5GMVA 1P0RA 3KW5B 2DZKA 3QK0A 3M62B 2LWPA 2B3AA 1WGRA 4PS7A 1KLVA 3B1LX 3PREA 3U30A 4IWQA 4G50A 2M8SA 2I1KA 3QA8A 3U8ZA 1Z5SB 4DWFA 4HJKA 4FBJB 1K8RB 2CR5A 3V6EB 3QHTA 3N30A 3AXCA 2KD0A 4IG7B 1YX6B 4ZDVA 3JVZX 2UYZB 1RRBA 2MSED 1ISNA 4ANXA 3GOEA 1LQBA 4PS3A 3DBSA 1TGZB 2LGDA 1TBEA 2NS5A 3L10B 5J18A 3V62A 2BF8B 2HD5B 4II2B 3VQIA 2DYMA 3QCAA 3N32A 1Q1OA 5E6OA 4AOFA 3CSTA 1XT9B 2JRIB 5L95C 4X57B 1P9DU 1WGDA 2MA9B 4IWOA 4G11A 2CS4A 3R7RA 4B9KA 2NR2A 2JT4B 2L00B 2ZNVC 2FCQA 2KKCA 3H7PA 2FIDA 2CKHB 3VFKA 2CU1A 2NVUI 2IO2B 1J8CA 4KIKB 5KHQA 3QX1A 4TQ1A 2C7MB 3DVGX 2IY1B 4DXAB 1EF5A 2JUOA 2ZVNA 4BVUC 1HE8A 2JXXA 2XBBC 4GMVA 4TV3A 1RAXA 1WXAA 2DX5B 2D11A 1WGHA 2MBBB 1GG3A 3WAPA 3JSVB 2KVRA 4NJ7A 4WJNA 2M17A 1LFDA 1U4AA 1V49A 2RPQA 2RD0A 3KH0A 4HCPB 2OJRA 5D2MB 2IO0B 3SHQA 4FJYA 4J6IA 2G45B 2ZEQA 3PRZA 4MEMA 3KUCB 4I6NB 3VUWA 4KDIC 2PE6B 1WXSA 3JSVA 1E8WA 4NAWB 1AARA 3PHXB 1WJNA 2IZVB 3TJPA 3VHTC 3VVWB 4IWPA 3EECA 4DHZB 1XD3B 4BKGA 4CO7A 4MJSB 3VH4B 2GBKA 2K8HA 1ZKHA 2BYVE 2KC2A 2WDTB 3DVNU 3ONSA 5AEKB 2GBRA 3K9PB 4DHJD 2J0MA 4DHJB 3OAWA 4W9KA 5DPSA 2KC1A 4PYUA 4F1SA 3K9OB 2LXAA 4WJQA 3ZNID 2C60A 4M8NA 2LRUA 2Z0DB 3RD2A 2L0TA 1E90A 3ENEA 2MW5A 3QIJA 3M63B 3A33B 2A5UA 2EMTA 2K6DB 4JIOU 1C3TA 4KZCA 3SD5A 3VTUA 3ZRFA 2JY6A 4W9FA 3NOBA 4P7IA 4A3OA 3M3JA 5DCNA 1Q5WB 2J0KA 2AYOB 2L76A 4E74A 2AEHA 1T0YA 4ICUA 2EMSA 4FA6A 2DHZA 3APFA 2PE9A 3ZDMC 4EZKA 2MBEA 1E8XA 1WMHB 3APCA 3KVFB 2V1YA 4MELA 3WIMA 4RM9A 5FR6A 4FADA 3DDCB 4M8MA 4HPMB 2KK8A 1UGMA 3VTVA 4EEWA 4MSQB 2D3GA 1UELA 2LVQA 1IYFA 3ZO5B 1MG8A 2KNBA 3ZRCA 1WMHA 3NS8A 4W9DA 4HDOA 1UD7A 2GBJA 3PPAA 4OVVA 2BWES 1WE6A 2KMAA 2MQJA 2HJ8A 4W9GA 2MP2B 2KFKB 2C7NB 2DZIA 4LDTD 2CHWA 4LDTB 3X0WA 2KQ7A 3HIZA 3CMMB 2LASA 1SE9A 5IA7A 4WWNA 1E7UA 4XX5A 2DENB 2KJRA 2ZJDA 5JHBA 1SGHA 2MP2A 2KFKA 3AU4A 2LZ6A 4ZRJA 2L8JA 4CYEA 4K7WA 2BYEA 5G55A 3PSEB 2NBVB 4MGKE 3UQBA 4W9HA 3WAMA 1V9JA 2BKFA 2KXJA 3VUXA 5LXHA 4WWPA 2MX2A 1WIAA 1R4MI 1WRDB 1LM8B 1H4RA 2GMIC 4AP4C 3JYUA 3UINB 4TUUA 3KYCD 4K1RB 3PS6A 4IM3A 1QZEA 3H7PB 2XEWA 4RM8A 1GC6A 3PV1A 2KDBA 3ZKJC 4K7SA 3JW0X 2JZZA 4BOSC 5HKHA 1WX7A 3DQVA 1E7VA 3S2AA 2MBQA 3RULA 2IBIB 1NI2A 3WANA 1ZW7A 4TQ0A 2FIFA 4EZLA 5JH5C 3A4RA 2KX0A 3L16A 2J7QB 2JF5A 5CHWA 1L2NA 2RGFA 2KJ6A 5CHFA 2N7DA 3DBRI 1ZGUB 2ASQA 3BINA 4AJWA 1V80A 2L7RA 4E71A 5LLIA 2JPHA 2LRWA 4BBNF 5KHOA 5AZGA 3H7SA 4NQLB 2N1VA 1FXTB 1NDDA 5D7GA 4KZ0A 2KFJA 2MLBA 1WGYA 1WJ4A 1WXMA 1YQBA 4ZRKA 4NPNA 3L13A 3PLVA 4GXBA 4HVBA 3C0RB 3BY4B 2ZCBA 2WX1A 1Q0WB 2QHOA 4I6PA 2KTRB 4FULA 2M4NA 5LXIB 1V86A 3VDZA 2KN5A 3Q3JA 4WJPA 3TMPB 2AWTA 3A4SC 1YD8U 3ML9A 4AWJA 3EFUA 3R3MA 4JQWC 1KJTA 3DVGY 4LCDE 2RSUA 2LUEA 3O65B 4BKTA 3HHMA 2HTHA 3VXWA 5J2RA 2KTRA 2G4SA 2LVPA 1WM3A 2DAJA 2N9PC 4TKNA 4HK2A 3H1UA 2FAZA 2JZ3B 3D32A 1G6JA 2Y5BB 3UGBB 1P1AA 3HM6X 2K8CA 2WWZA 5DPRA 2Z0EB 2KTFA 1UH6A 1E8YA 1UBIA 3I3TB 3PTFC 3QAQA 2BYFA 4IM0A 3ZW3A 2ZZPB 1EUVB 2R2QA 2K6QA 1WYWB 2C7HA 4ZRIA 4MGZE 1P3QU 4GOCA 4B6WA 2LXCA 2LGXA 1WF9A 4W9IA 1C1YB 4ANUA 1WY8A 3VUYA 1VD2A 3MTNB 3W1SA 3ZIMA 2MWSB 2K8BA 2VRRB 3A9KB 5L83A 2DAFA 4XZ4A 4AUQC 3MJWA 4GDLA 2NPTB 4KDLB 5E6NA 3T9LA 3DVNV 4HPLB 4FHKA 5JHAA 1H8CA 4F8CB 4MGIE 2KO3A 3AULA 1GNUA 4K81A 4PS8A 2N1WA 4WJOA 4GSWA 5CHVC 4LJPB 4IC7B 3DPDA 3A9KA 3DBLI 4IW0A 3OLMD 4FHJA 2M1MA 2NPTA 5C23A 3UIPB 2WX0A 3HK0A 1WR6E 4GU2A 4EFOA 3ZVVA 2DZMA 3W1YA 1J0GA 3A9JB 2MBHA 3ZNGC 3KUDB 3TIXA 2N4FA 4II3B 2KDEB 2JWZA 3NHEB 3PRPB 3RCZA 3X23A 2LI5A 1WJ6A 4W9JA 1CMXB 2AL3A 2AL6A 3LJ3A 4NQKE 1WI0A 4KSKC 3RT3B 3WALA 4MGYE 2FCMA 2D07B 3PLUA 2FCSA 3R7QA 1E8ZA 3L08A 3CF6E 3OJ3A 3A9JA 3RYTA 2IY0B 1A5RA 3DBHI 3W1SC 1V81A 3EHVA 1WZ3A 3ZDTA 3B0AA 1M94A 3MHSD 3IBEA 2DZJA 2ZVOA 2V3SA 2MRPA 2KLGA 2KDFB 2KWUB 2N9XA 3HM3A 1YIWA 2K25A 2GBMA 2C5LC 4GDKB 4GIVA 4KV2A 3ZNHB 1RFAA 3PHWB 4GN1A 2MCNB 2KMCA 4BKSA 5EDSA 3PGEA 2KDIA 1WE7A 3ZNZB 4E3CA 1J19A 3AU5A 4HCNB 3WAOA 4GDKA 1WFYA 4HDQA 2FUHB 4B95A 2EKEC 5G2NA 1SIFA 2LVOA 4XC2A 1LXDA 2BWFA 1S3SG 3B08A 3H6NA 3ML8A 4FN2A 5AZHA 1I35A 4GB9A 1IP9A 2CHXA 2IO3B 4ZYNA 2KQSA 2O6VD 1V6EA 2O6VB 2KANA 2R2OA 2REXA 4N9F4 1I42A 1V5OA 2DYBA 1EO6A 2OOBB 3A1QB 3QC8B 3UIOB 1XQQA 1D3ZA 4HXDA 1GJZA 1TTNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G0N B;  1UBQ A;  4FLH A;  2XK5 B;  4DBG A;  5TR5 A;  3V60 A;  1IPG A;  2GOW A;  3PZD A;  3QQ8 B;  2UWQ A;  4HWI B;  4URK A;  3NY5 A;  1OGW A;  2GBN A;  2O6V A;  3DOW A;  2D10 A;  2KWC A;  3A1Q A;  4A20 A;  4ASW C;  2KZR A;  3NZS A;  4MSM B;  2NBW B;  3ECI A;  3M95 A;  2LJ5 A;  1X1M A;  1WZ0 A;  2XK5 A;  3L0W B;  1P98 A;  4ANV A;  1WM2 A;  2M0X A;  1E5W A;  5JZE B;  2PJH A;  1NBF C;  2I1J A;  2IYD B;  3TL5 A;  1WX8 A;  2N9E B;  3L17 A;  4M0W B;  2BGF A;  2KOX A;  1F9J A;  3RZW C;  2YVC A;  3R66 C;  1GC7 A;  4MDK E;  4HLE A;  4MH0 E;  1EF1 A;  3OJ4 B;  2C9W B;  4DHZ E;  1OQY A;  4NY0 A;  4AJY B;  3ALB A;  4DDI D;  4EUT A;  1JRU A;  4KIK A;  4F7Z A;  4DK5 A;  4EOY A;  5BO4 B;  1KM7 A;  3UQA A;  3RUI B;  1UZX B;  2K1F A;  2L05 A;  2L0F A;  2LD9 A;  3SU8 X;  1KOT A;  4FJZ A;  1RLF A;  5J17 A;  3PT2 B;  2L3Z A;  3H9D A;  1WJU A;  4W9L A;  3L54 A;  2V4L A;  4NJ6 A;  4RMA A;  1WXV A;  1Y8R C;  2BKR B;  3VTW A;  3WA0 A;  4KVG B;  2N7E A;  2PPH A;  2W9N A;  2NCN A;  5AZF A;  4BBN C;  1WGG A;  3KUZ A;  4GDL B;  2HE7 A;  4IM2 A;  1R4N I;  4NNJ B;  4JGH B;  4PYZ A;  3UF8 A;  1BT0 A;  3TBL D;  4BFR A;  3ZLZ A;  3PRM B;  5DPW A;  3N3K B;  4JL9 A;  3U7D A;  3VAW A;  4DDG D;  4EZJ A;  2KJH B;  4WAA A;  4BOZ B;  2DYO A;  2G4D B;  3NZU A;  4IUM B;  4NAW A;  2ZPY A;  3APD A;  1YX5 B;  2ZCC A;  3V61 A;  1VCB A;  2CHZ A;  3QWZ B;  3EC8 A;  3VH3 B;  4MJS A;  1V2Y A;  4A3P A;  1OEY A;  4GGQ A;  4ANW A;  3AI5 A;  4LJO B;  3V6C B;  4I6L B;  2JRH A;  3IHP C;  3ZUN A;  4WQO B;  2J0J A;  5DPT A;  5IAA C;  2JVC A;  3GZN I;  3IVF A;  3RZF A;  1V5T A;  3Q3F A;  3ZTD A;  2KHW B;  4CHK A;  2KWV B;  4JLC A;  1OEY J;  1GUA B;  3PVL A;  4G3X B;  1WH3 A;  1PQS A;  1WX9 A;  1YJ1 A;  3QJZ A;  2NBU A;  1OTR B;  2BPS A;  4W9C A;  1S1Q B;  2RR9 A;  1WR1 A;  2FNJ B;  3IFW B;  4BKS D;  2PEA A;  2IO1 B;  3DCG A;  4MM3 A;  2FCN A;  2O2V B;  3KYD D;  5E6P A;  2A4Z A;  2LGY A;  4FJV B;  3ZTC A;  2ZNV B;  1TZ1 A;  4KSL C;  4EKU A;  3SDL C;  2ZPN A;  2WYQ A;  4YL8 A;  3T8M A;  5CX3 A;  2MBO A;  3IG3 A;  3LDZ E;  2D2Q A;  4WWO A;  2G3Q B;  2K39 A;  3TCA A;  2KLC A;  5CTR C;  5D6J B;  3P2B A;  4ICV A;  4W9E A;  2O2V A;  2KX3 A;  3CSF A;  4OVU A;  2Z59 B;  4K7U A;  1Z2M A;  2YLM A;  1L7Y A;  5D94 A;  5C1Z A;  3QAR A;  5GMV A;  1P0R A;  3KW5 B;  2DZK A;  3QK0 A;  3M62 B;  2LWP A;  2B3A A;  1WGR A;  4PS7 A;  1KLV A;  3B1L X;  3PRE A;  3U30 A;  4IWQ A;  4G50 A;  2M8S A;  2I1K A;  3QA8 A;  3U8Z A;  1Z5S B;  4DWF A;  4HJK A;  4FBJ B;  1K8R B;  2CR5 A;  3V6E B;  3QHT A;  3N30 A;  3AXC A;  2KD0 A;  4IG7 B;  1YX6 B;  4ZDV A;  3JVZ X;  2UYZ B;  1RRB A;  2MSE D;  1ISN A;  4ANX A;  3GOE A;  1LQB A;  4PS3 A;  3DBS A;  1TGZ B;  2LGD A;  1TBE A;  2NS5 A;  3L10 B;  5J18 A;  3V62 A;  2BF8 B;  2HD5 B;  4II2 B;  3VQI A;  2DYM A;  3QCA A;  3N32 A;  1Q1O A;  5E6O A;  4AOF A;  3CST A;  1XT9 B;  2JRI B;  5L95 C;  4X57 B;  1P9D U;  1WGD A;  2MA9 B;  4IWO A;  4G11 A;  2CS4 A;  3R7R A;  4B9K A;  2NR2 A;  2JT4 B;  2L00 B;  2ZNV C;  2FCQ A;  2KKC A;  3H7P A;  2FID A;  2CKH B;  3VFK A;  2CU1 A;  2NVU I;  2IO2 B;  1J8C A;  4KIK B;  5KHQ A;  3QX1 A;  4TQ1 A;  2C7M B;  3DVG X;  2IY1 B;  4DXA B;  1EF5 A;  2JUO A;  2ZVN A;  4BVU C;  1HE8 A;  2JXX A;  2XBB C;  4GMV A;  4TV3 A;  1RAX A;  1WXA A;  2DX5 B;  2D11 A;  1WGH A;  2MBB B;  1GG3 A;  3WAP A;  3JSV B;  2KVR A;  4NJ7 A;  4WJN A;  2M17 A;  1LFD A;  1U4A A;  1V49 A;  2RPQ A;  2RD0 A;  3KH0 A;  4HCP B;  2OJR A;  5D2M B;  2IO0 B;  3SHQ A;  4FJY A;  4J6I A;  2G45 B;  2ZEQ A;  3PRZ A;  4MEM A;  3KUC B;  4I6N B;  3VUW A;  4KDI C;  2PE6 B;  1WXS A;  3JSV A;  1E8W A;  4NAW B;  1AAR A;  3PHX B;  1WJN A;  2IZV B;  3TJP A;  3VHT C;  3VVW B;  4IWP A;  3EEC A;  4DHZ B;  1XD3 B;  4BKG A;  4CO7 A;  4MJS B;  3VH4 B;  2GBK A;  2K8H A;  1ZKH A;  2BYV E;  2KC2 A;  2WDT B;  3DVN U;  3ONS A;  5AEK B;  2GBR A;  3K9P B;  4DHJ D;  2J0M A;  4DHJ B;  3OAW A;  4W9K A;  5DPS A;  2KC1 A;  4PYU A;  4F1S A;  3K9O B;  2LXA A;  4WJQ A;  3ZNI D;  2C60 A;  4M8N A;  2LRU A;  2Z0D B;  3RD2 A;  2L0T A;  1E90 A;  3ENE A;  2MW5 A;  3QIJ A;  3M63 B;  3A33 B;  2A5U A;  2EMT A;  2K6D B;  4JIO U;  1C3T A;  4KZC A;  3SD5 A;  3VTU A;  3ZRF A;  2JY6 A;  4W9F A;  3NOB A;  4P7I A;  4A3O A;  3M3J A;  5DCN A;  1Q5W B;  2J0K A;  2AYO B;  2L76 A;  4E74 A;  2AEH A;  1T0Y A;  4ICU A;  2EMS A;  4FA6 A;  2DHZ A;  3APF A;  2PE9 A;  3ZDM C;  4EZK A;  2MBE A;  1E8X A;  1WMH B;  3APC A;  3KVF B;  2V1Y A;  4MEL A;  3WIM A;  4RM9 A;  5FR6 A;  4FAD A;  3DDC B;  4M8M A;  4HPM B;  2KK8 A;  1UGM A;  3VTV A;  4EEW A;  4MSQ B;  2D3G A;  1UEL A;  2LVQ A;  1IYF A;  3ZO5 B;  1MG8 A;  2KNB A;  3ZRC A;  1WMH A;  3NS8 A;  4W9D A;  4HDO A;  1UD7 A;  2GBJ A;  3PPA A;  4OVV A;  2BWE S;  1WE6 A;  2KMA A;  2MQJ A;  2HJ8 A;  4W9G A;  2MP2 B;  2KFK B;  2C7N B;  2DZI A;  4LDT D;  2CHW A;  4LDT B;  3X0W A;  2KQ7 A;  3HIZ A;  3CMM B;  2LAS A;  1SE9 A;  5IA7 A;  4WWN A;  1E7U A;  4XX5 A;  2DEN B;  2KJR A;  2ZJD A;  5JHB A;  1SGH A;  2MP2 A;  2KFK A;  3AU4 A;  2LZ6 A;  4ZRJ A;  2L8J A;  4CYE A;  4K7W A;  2BYE A;  5G55 A;  3PSE B;  2NBV B;  4MGK E;  3UQB A;  4W9H A;  3WAM A;  1V9J A;  2BKF A;  2KXJ A;  3VUX A;  5LXH A;  4WWP A;  2MX2 A;  1WIA A;  1R4M I;  1WRD B;  1LM8 B;  1H4R A;  2GMI C;  4AP4 C;  3JYU A;  3UIN B;  4TUU A;  3KYC D;  4K1R B;  3PS6 A;  4IM3 A;  1QZE A;  3H7P B;  2XEW A;  4RM8 A;  1GC6 A;  3PV1 A;  2KDB A;  3ZKJ C;  4K7S A;  3JW0 X;  2JZZ A;  4BOS C;  5HKH A;  1WX7 A;  3DQV A;  1E7V A;  3S2A A;  2MBQ A;  3RUL A;  2IBI B;  1NI2 A;  3WAN A;  1ZW7 A;  4TQ0 A;  2FIF A;  4EZL A;  5JH5 C;  3A4R A;  2KX0 A;  3L16 A;  2J7Q B;  2JF5 A;  5CHW A;  1L2N A;  2RGF A;  2KJ6 A;  5CHF A;  2N7D A;  3DBR I;  1ZGU B;  2ASQ A;  3BIN A;  4AJW A;  1V80 A;  2L7R A;  4E71 A;  5LLI A;  2JPH A;  2LRW A;  4BBN F;  5KHO A;  5AZG A;  3H7S A;  4NQL B;  2N1V A;  1FXT B;  1NDD A;  5D7G A;  4KZ0 A;  2KFJ A;  2MLB A;  1WGY A;  1WJ4 A;  1WXM A;  1YQB A;  4ZRK A;  4NPN A;  3L13 A;  3PLV A;  4GXB A;  4HVB A;  3C0R B;  3BY4 B;  2ZCB A;  2WX1 A;  1Q0W B;  2QHO A;  4I6P A;  2KTR B;  4FUL A;  2M4N A;  5LXI B;  1V86 A;  3VDZ A;  2KN5 A;  3Q3J A;  4WJP A;  3TMP B;  2AWT A;  3A4S C;  1YD8 U;  3ML9 A;  4AWJ A;  3EFU A;  3R3M A;  4JQW C;  1KJT A;  3DVG Y;  4LCD E;  2RSU A;  2LUE A;  3O65 B;  4BKT A;  3HHM A;  2HTH A;  3VXW A;  5J2R A;  2KTR A;  2G4S A;  2LVP A;  1WM3 A;  2DAJ A;  2N9P C;  4TKN A;  4HK2 A;  3H1U A;  2FAZ A;  2JZ3 B;  3D32 A;  1G6J A;  2Y5B B;  3UGB B;  1P1A A;  3HM6 X;  2K8C A;  2WWZ A;  5DPR A;  2Z0E B;  2KTF A;  1UH6 A;  1E8Y A;  1UBI A;  3I3T B;  3PTF C;  3QAQ A;  2BYF A;  4IM0 A;  3ZW3 A;  2ZZP B;  1EUV B;  2R2Q A;  2K6Q A;  1WYW B;  2C7H A;  4ZRI A;  4MGZ E;  1P3Q U;  4GOC A;  4B6W A;  2LXC A;  2LGX A;  1WF9 A;  4W9I A;  1C1Y B;  4ANU A;  1WY8 A;  3VUY A;  1VD2 A;  3MTN B;  3W1S A;  3ZIM A;  2MWS B;  2K8B A;  2VRR B;  3A9K B;  5L83 A;  2DAF A;  4XZ4 A;  4AUQ C;  3MJW A;  4GDL A;  2NPT B;  4KDL B;  5E6N A;  3T9L A;  3DVN V;  4HPL B;  4FHK A;  5JHA A;  1H8C A;  4F8C B;  4MGI E;  2KO3 A;  3AUL A;  1GNU A;  4K81 A;  4PS8 A;  2N1W A;  4WJO A;  4GSW A;  5CHV C;  4LJP B;  4IC7 B;  3DPD A;  3A9K A;  3DBL I;  4IW0 A;  3OLM D;  4FHJ A;  2M1M A;  2NPT A;  5C23 A;  3UIP B;  2WX0 A;  3HK0 A;  1WR6 E;  4GU2 A;  4EFO A;  3ZVV A;  2DZM A;  3W1Y A;  1J0G A;  3A9J B;  2MBH A;  3ZNG C;  3KUD B;  3TIX A;  2N4F A;  4II3 B;  2KDE B;  2JWZ A;  3NHE B;  3PRP B;  3RCZ A;  3X23 A;  2LI5 A;  1WJ6 A;  4W9J A;  1CMX B;  2AL3 A;  2AL6 A;  3LJ3 A;  4NQK E;  1WI0 A;  4KSK C;  3RT3 B;  3WAL A;  4MGY E;  2FCM A;  2D07 B;  3PLU A;  2FCS A;  3R7Q A;  1E8Z A;  3L08 A;  3CF6 E;  3OJ3 A;  3A9J A;  3RYT A;  2IY0 B;  1A5R A;  3DBH I;  3W1S C;  1V81 A;  3EHV A;  1WZ3 A;  3ZDT A;  3B0A A;  1M94 A;  3MHS D;  3IBE A;  2DZJ A;  2ZVO A;  2V3S A;  2MRP A;  2KLG A;  2KDF B;  2KWU B;  2N9X A;  3HM3 A;  1YIW A;  2K25 A;  2GBM A;  2C5L C;  4GDK B;  4GIV A;  4KV2 A;  3ZNH B;  1RFA A;  3PHW B;  4GN1 A;  2MCN B;  2KMC A;  4BKS A;  5EDS A;  3PGE A;  2KDI A;  1WE7 A;  3ZNZ B;  4E3C A;  1J19 A;  3AU5 A;  4HCN B;  3WAO A;  4GDK A;  1WFY A;  4HDQ A;  2FUH B;  4B95 A;  2EKE C;  5G2N A;  1SIF A;  2LVO A;  4XC2 A;  1LXD A;  2BWF A;  1S3S G;  3B08 A;  3H6N A;  3ML8 A;  4FN2 A;  5AZH A;  1I35 A;  4GB9 A;  1IP9 A;  2CHX A;  2IO3 B;  4ZYN A;  2KQS A;  2O6V D;  1V6E A;  2O6V B;  2KAN A;  2R2O A;  2REX A;  4N9F 4;  1I42 A;  1V5O A;  2DYB A;  1EO6 A;  2OOB B;  3A1Q B;  3QC8 B;  3UIO B;  1XQQ A;  1D3Z A;  4HXD A;  1GJZ A;  1TTN A; 
#chains in the Genus database with same CATH topology
 4M01 A;  1UBQ A;  2WXG A;  2WXJ A;  2XK5 B;  1IPG A;  3PZD A;  2IND C;  3AE2 B;  2FBW B;  3NY5 A;  2QSD A;  1OGW A;  2O6V A;  3AE4 B;  1LGR A;  1L5P A;  3NZS A;  3M95 A;  1X1M A;  3L0W B;  2LHD A;  3E56 A;  3MHZ A;  5JZE B;  1NBF C;  2I1J A;  2RDG A;  4R3D A;  4M0W B;  2BB6 A;  1R4N B;  3VR9 B;  1FRD A;  1ZXH A;  4DHZ E;  4HKZ E;  1WSP A;  4NY0 A;  4AJY B;  4DDI D;  4P1C C;  2IDY A;  1J7C A;  2K1F A;  1C78 A;  2L05 A;  4P6V F;  1KOT A;  2K22 A;  5C2T B;  2L3Z A;  3H9D A;  4W9L A;  3L54 A;  2V4L A;  1WXV A;  2BKR B;  4KVG B;  2W9N A;  4GLS C;  1QOB A;  3KUZ A;  2HE7 A;  1R4N I;  4ZOH C;  3MC8 A;  1ESF A;  3TBL D;  3PRM B;  2WXN A;  3N3K B;  4JL9 A;  3U7D A;  1FEH A;  1V1O A;  3VAW A;  3ABV B;  4BOZ B;  5TSS A;  2DYO A;  3NZU A;  4IUM B;  5LNK 1;  3QWZ B;  3VH3 B;  4MJS A;  4LJO B;  4XYC A;  3V6C B;  3AEE B;  2J0J A;  5DPT A;  3IAM 1;  2NMQ A;  3VRB B;  3Q3F A;  4CHK A;  2K3U A;  1GUA B;  3PVL A;  2JYE A;  3RNF C;  1KH0 A;  1L6U A;  1OTR B;  4ZYS A;  1XLQ A;  2I38 A;  2RR9 A;  3BII D;  2PTL A;  1A70 A;  1JRO A;  2MEK A;  4YT0 B;  1GB4 A;  1N61 A;  2JX5 A;  2ZPN A;  2WYQ A;  3T8M A;  4MH8 A;  1FM0 D;  2D2Q A;  2ON8 A;  2KLC A;  3FC4 A;  2O2V A;  2Z59 B;  2YLM A;  2K9X A;  5D94 A;  3KLS X;  2GB1 A;  1KLV A;  1PUT A;  4G50 A;  3U8Z A;  2WU5 B;  2YEP B;  1K8R B;  2CR5 A;  3V6E B;  4HEA 1;  3N30 A;  3B9J A;  2KD0 A;  1JWB D;  2G9H D;  3Q3N C;  1RRB A;  2MSE D;  3R2I A;  4KGR A;  2LGD A;  2NS5 A;  3L10 B;  3ZJV A;  1QOG A;  4TMA B;  3N32 A;  5E6O A;  1VZ6 A;  1XT9 B;  2RMM A;  2MA9 B;  4IWO A;  4YTP B;  2CS4 A;  3R7R A;  4B9K A;  4WIP A;  2FCQ A;  2CKH B;  2NVU I;  3ZJT A;  4USA A;  5KHQ A;  4TQ1 A;  4DXA B;  4WWM A;  2JUO A;  4BVU C;  2M19 A;  2XBB C;  5FR3 A;  2IPK D;  1WGH A;  2MBB B;  3JSV B;  4NJ7 A;  1U4A A;  4XWW A;  3KH0 A;  2OJR A;  3GS2 A;  2IO0 B;  2TSS A;  2G45 B;  1F52 A;  4I6N B;  3DWM A;  3W2D A;  2ZW1 A;  1EM7 A;  3VHT C;  1WJN A;  2IZV B;  3TJP A;  3FAH A;  4IWP A;  1D6E C;  4MJS B;  2MJ3 A;  2GBK A;  1ZKH A;  3DVN U;  3ONS A;  5IOI A;  1TT5 B;  2DNF A;  2W3R A;  4DHJ B;  1XEE A;  3OAW A;  3RFZ B;  4N6E B;  2Z0D B;  2LUM A;  1KTK A;  3QIJ A;  2KAC A;  4KKI A;  2XNA C;  2EMT A;  2DBY A;  3ZRF A;  5HHD G;  1E0Z A;  1QLB B;  3LXF A;  3ZDM C;  2PE9 A;  2MBE A;  3NVW A;  3KVF B;  4MEL A;  3WIM A;  3DDC B;  5AUK A;  1IBX B;  3VTV A;  4MSQ B;  1WXQ A;  1IYF A;  1Q10 A;  2L1A A;  2KNB A;  3EGR A;  4W9D A;  2AQ2 B;  1I4R A;  4HDO A;  2GBJ A;  1R4M B;  2BWE S;  2HJ8 A;  1VLB A;  2WHI A;  1FFU A;  4P1B C;  2DZI A;  1C76 A;  1SE9 A;  3FIL A;  2CU3 A;  1SGH A;  2MP2 A;  3URY A;  4CQN A;  5I4D A;  1N5X A;  3UQB A;  4W9H A;  3WAM A;  1FMA D;  1KLG D;  1R4M I;  1LM8 B;  1RFK A;  2G1E A;  4AP4 C;  3JYU A;  3UIN B;  4PT5 A;  4H2A A;  2BB5 A;  1C79 A;  2KDB A;  1D5Z C;  5HKH A;  3P63 A;  1JWU D;  3S2A A;  2D3C A;  1JCK B;  3WAN A;  1I4P A;  4JE3 B;  3A4R A;  5JH5 C;  2KX0 A;  5H92 C;  1VJK A;  5CHF A;  2N7D A;  2L7R A;  1EWY C;  1FXT B;  1NDD A;  2MLB A;  3AE3 B;  1WGY A;  1WJ4 A;  3L13 A;  4RGN A;  4GXB A;  1MHH E;  4I6P A;  1C4P A;  1L0Y B;  2FE8 A;  2KN5 A;  3ML9 A;  3R3M A;  1MJD A;  5EE1 A;  3AM9 A;  2HTM E;  2HTH A;  5EE0 A;  3SR6 A;  1JWS D;  4TKN A;  3D32 A;  1G6J A;  2Y5B B;  2K8C A;  2WWZ A;  5DPR A;  3BZD B;  2KTF A;  1UH6 A;  4RNA A;  1EU4 A;  1EWC A;  3NS1 A;  4C80 A;  3P1M A;  3DHI C;  2LGS A;  3R8B A;  2PMV A;  1IGD A;  4GOC A;  1JQ4 A;  4W9I A;  1C1Y B;  3V3X A;  4A6Q A;  3NVY A;  2DAF A;  4XZ4 A;  3W5U B;  4KDL B;  5E6N A;  3DVN V;  4HPL B;  5JHA A;  4S0R A;  2KO3 A;  4WJO A;  5CHV C;  4D2K A;  4LJP B;  3FIL B;  3A9K A;  3DBL I;  1WR6 E;  1SB3 C;  2MBH A;  3ZNG C;  4YTN B;  4C00 A;  1MHX A;  2KDE B;  1TKG A;  3ETR A;  1PGX A;  1QQR A;  3LJ3 A;  1K51 A;  1WI0 A;  2N7J A;  2FCM A;  1A5R A;  3CF6 E;  1V97 A;  1K52 A;  3ZDT A;  3IBE A;  2DZJ A;  2V3S A;  4P16 A;  4XDC A;  4ITK A;  1ZE3 D;  2N9X A;  4KV2 A;  3ZNH B;  2GBM A;  1FRR A;  3Q6B A;  2MCN B;  2DWQ A;  5EDS A;  2QMT A;  3N1X C;  5BMI A;  1PFD A;  3RNC C;  5HFY A;  4HCN B;  1WFY A;  2MJE A;  4XC2 A;  2BWF A;  4FN2 A;  3HUI A;  2KQS A;  1KLU D;  2R2O A;  1V5O A;  2J42 A;  1TTN A;  1KFY B;  1SBB B;  2LHE A;  2UWQ A;  3QQ8 B;  4N58 A;  2GBN A;  2VH2 A;  2KWC A;  4A20 A;  2AQ3 B;  4MSM B;  2LJ5 A;  2XK5 A;  1WZ0 A;  1P98 A;  2M0X A;  1E5W A;  2LMC A;  3IXS A;  3NZ3 A;  1WX8 A;  3L17 A;  2KOX A;  2YVC A;  3TEW A;  4MDK E;  2JWU A;  2N0S B;  4MH0 E;  3OJ4 B;  4JWU C;  3ALB A;  4M0W A;  3ZGZ A;  3BYT B;  4KIK A;  1UGJ A;  4F7Z A;  1TKE A;  1KM7 A;  2L0F A;  3SU8 X;  4FJZ A;  2IGH A;  4NJ6 A;  3GZN B;  3WA0 A;  5AZF A;  4BBN C;  1ENF A;  4NNJ B;  3UF8 A;  2UU7 A;  1BT0 A;  4XWT A;  3ZLZ A;  1PDX A;  2KDM A;  3APD A;  1SSN A;  2ZCC A;  2JZP A;  3EC8 A;  4N59 A;  3FKY A;  1TY2 A;  4GGQ A;  4ANW A;  2ICI A;  5EE9 A;  2JRH A;  5T8I A;  3KWL A;  3GZN I;  1C77 A;  3RNA C;  1FCL A;  1TY0 A;  4MM3 B;  4JLC A;  4O1N A;  1ZXI A;  5BYR A;  1PQS A;  1YJ1 A;  3QJZ A;  1I4X A;  2NBU A;  1TIF A;  2PKO A;  2OED A;  3RMK C;  3KYD D;  3ZTC A;  4FJV B;  1QKZ A;  4KSL C;  5E6J A;  1XLO A;  5CX3 A;  1BML C;  2MH7 A;  3ZXR A;  2K39 A;  4W9E A;  3BVM A;  2KX3 A;  3CSF A;  3AH7 A;  5FKA C;  3KW5 B;  2DZK A;  1K53 A;  4LK0 M;  4PS7 A;  1ZDV A;  4IWQ A;  3U30 A;  3QA8 A;  2WXP A;  4HJK A;  2WU2 B;  2IGG A;  4ZDV A;  4IG7 B;  1YX6 B;  4PK1 A;  3JVZ X;  2KWD A;  4ANX A;  4ZHO A;  2KQ4 X;  3GE8 C;  2LGI A;  3I63 C;  3VQI A;  2DYM A;  4AOF A;  3CST A;  2WXH A;  4X57 B;  1YJI A;  1YN3 A;  1DOI A;  2L32 A;  4UDU C;  2NR2 A;  2JT4 B;  4DXG A;  2ZNV C;  2FID A;  2CU1 A;  4KIK B;  3QX1 A;  1FNU A;  2IY1 B;  3TEX A;  4US8 A;  1HE8 A;  1RAX A;  1WXA A;  2D11 A;  3AE5 B;  1HTO A;  3WAP A;  2EEL A;  2KVR A;  2RD0 A;  4OZC A;  2ZEQ A;  4MEM A;  3VUW A;  1BUI C;  1T6B X;  3JSV A;  4NAM A;  1E8W A;  2WGS A;  2ONQ A;  2SAK A;  5IKC M;  3PHX B;  5G5H A;  3VVW B;  1FXI A;  4CO7 A;  2K8H A;  2WDT B;  2KC2 A;  5AEK B;  4DHJ D;  4W9K A;  2KC1 A;  4F1S A;  3K9O B;  2H89 B;  4M8N A;  3RD2 A;  2L0T A;  3U2S C;  3M63 B;  3A33 B;  2A5U A;  3VTU A;  3PZ8 A;  2JY6 A;  4P7I A;  3M3J A;  1Q5W B;  2H88 B;  1HQR D;  2L76 A;  1TS3 A;  2AEH A;  4KGS A;  4FAD A;  5FR6 A;  4OVZ A;  4M8M A;  4HPM B;  3DBH B;  2W54 A;  4EEW A;  1UEL A;  2LVQ A;  1MG8 A;  3E9S A;  1UF0 A;  3P4R B;  3V05 A;  4J3O D;  4OVV A;  1IBX A;  1F1H A;  2MQJ A;  2KFK B;  2CHW A;  2D5G A;  5IA7 A;  4RGM A;  2DEN B;  2KJR A;  3LB8 C;  3AU4 A;  4ZRP A;  1T0R C;  2LZ6 A;  4ZRJ A;  2L8J A;  2BYE A;  4KKJ A;  1T0Q C;  3PSE B;  4MGK E;  5LXH A;  2JSV X;  1XXG A;  2J4X A;  4WWP A;  2MX2 A;  1WIA A;  1CZP A;  3TSS A;  5MPO A;  2DLB A;  4YSX B;  4WH4 A;  4K1R B;  3PS6 A;  5HI1 A;  1SIJ A;  3RNG C;  3PV1 A;  2JZZ A;  2J53 A;  1E7V A;  1T5X D;  5GXG B;  2MBQ A;  3RUL A;  2IBI B;  1YQ4 B;  1NI2 A;  4EZL A;  2J7Q B;  2JF5 A;  5CHW A;  1L2N A;  2IJ0 A;  2ASQ A;  4ARI A;  4E71 A;  2JPH A;  1F77 A;  1C9F A;  4KZ0 A;  2KFJ A;  4BZA A;  1WXM A;  1YQB A;  3O13 A;  4ZRK A;  3ZJU A;  3PLV A;  4HVB A;  3BY4 B;  1Q0W B;  4WAF A;  1V86 A;  2JYT A;  4WUR A;  3ZQ4 A;  1KJT A;  2RSU A;  2LUE A;  3O65 B;  3SFD B;  3NJT A;  2D3B A;  4C7Z A;  1OFF A;  2RPV A;  1QOA A;  2G4S A;  2LVP A;  2JZ3 B;  3AED B;  4A8X C;  1XLN A;  3AEF B;  3PZ7 A;  4US9 A;  1L0X B;  3PTF C;  4IM0 A;  3ZW3 A;  2ZZP B;  3Q8A A;  1N5W A;  4ARC A;  2B76 B;  2R2Q A;  1TS4 A;  2ACZ B;  4B6W A;  3GP7 A;  1WF9 A;  1VD2 A;  4HRO A;  3MTN B;  1R7S A;  3ZIM A;  2VRR B;  5L83 A;  4AUQ C;  2GI9 A;  4GDL A;  3MC0 B;  3I57 A;  3AUL A;  3U52 E;  2WDQ B;  4GSW A;  2XN9 C;  1HEZ E;  3DHH C;  4IC7 B;  3DPD A;  3OLM D;  3UIP B;  3TEZ A;  2WX0 A;  4KGT A;  3NHE B;  4FXC A;  1KRH A;  1WJ6 A;  3WAL A;  2QJL A;  2M0A A;  2D07 B;  2WLB A;  3R7Q A;  2IY0 B;  2BS3 B;  3W1S C;  1V81 A;  1WZ3 A;  3B0A A;  2ZVO A;  2W55 A;  2KLG A;  2KWU B;  3HM3 A;  1YIW A;  2KMC A;  4BKS A;  1WE7 A;  1QIL A;  3AV8 A;  4E3C A;  3AU5 A;  1SE2 A;  1E6E B;  1L4D B;  4HDQ A;  1SIF A;  2LVO A;  1BXT A;  1LXD A;  5AZH A;  4ZYN A;  1V6E A;  2KAN A;  3A1Q B;  2OOB B;  3VRA B;  1OQR A;  2YEP F;  4HXD A;  4G0N B;  4DBG A;  5TR5 A;  3V60 A;  2QIE B;  4HWI B;  3Q69 A;  3DOW A;  2PIA A;  4YTM B;  4ASW C;  1N60 A;  2NBW B;  3ECI A;  3AEG B;  1WM2 A;  3TL5 A;  2N9E B;  4LNF A;  2WXO A;  3I5J C;  3RZW C;  3C8Y A;  3R66 C;  4HLE A;  1UUP A;  2E6X A;  1EF1 A;  2Y3A A;  2C9W B;  1I4Q A;  1MG4 A;  1E10 A;  3TUO A;  1JRU A;  2M56 B;  5D3D A;  4EOY A;  3RUI B;  5HG2 A;  4MAC A;  3UI3 A;  4LNI A;  5J17 A;  3PT2 B;  1WJU A;  4RMA A;  4IKG A;  3VTW A;  2V9H A;  1ZUD 2;  3BVG A;  4GDL B;  4IM2 A;  4JGH B;  4PYZ A;  4BFR A;  2LEK A;  3IAS 1;  3RNB C;  3BK2 A;  3HVZ A;  2KJH B;  2G4D B;  3ZXV A;  3V61 A;  2CHZ A;  4A3P A;  1V2Y A;  3W5V B;  1OEY A;  4ACF A;  2V4I B;  3R2T A;  2QDF A;  2MHJ A;  4EE2 A;  4ZRQ A;  3IVF A;  3RZF A;  2KHW B;  2KWV B;  2PVO D;  3MP9 A;  1NVI D;  1WX9 A;  2PVG C;  4JPS A;  3TEY A;  1FO4 A;  2BPS A;  4W9C A;  2V0G A;  1F2R C;  1FCC C;  1YMH E;  1B9R A;  2FNJ B;  4NJC A;  2PEA A;  3DCG A;  4MM3 A;  5E6P A;  3T3N A;  4REZ A;  2ZNV B;  1TZ1 A;  4EKU A;  2MBO A;  3IG3 A;  1GAQ B;  5CTR C;  3P2B A;  3HVD A;  4ICV A;  3BK1 A;  5IN7 A;  1L7Y A;  1IGC A;  4LNK A;  5C1Z A;  2KN4 A;  3QAR A;  1SJH D;  3QK0 A;  2W82 A;  2X38 A;  3M62 B;  2LWP A;  2INN E;  2I1K A;  4DWF A;  4WQM A;  3Q14 C;  3DBR B;  3QHT A;  4B0E A;  1ISN A;  4PS3 A;  1LQB A;  1ET9 A;  1TGZ B;  1ZDX A;  1TBE A;  3V62 A;  2NTT A;  4IDI A;  2HD5 B;  4II2 B;  3QCA A;  1UWX A;  2WXQ A;  2JRI B;  1JRP A;  4Q2J A;  3NVZ A;  1WRI A;  1WGD A;  4TSS A;  4RF1 A;  1VR9 A;  3H7P A;  3AN1 A;  1D5X C;  2VH1 A;  3C19 A;  3DVG X;  1EF5 A;  2ZVN A;  1JML A;  4TV3 A;  4RH6 A;  2DX5 B;  2WDR B;  2KAJ A;  1SXT A;  3N1Y C;  2W3S A;  4WJN A;  1TZO A;  1ZPS A;  1LFD A;  1V49 A;  4HCP B;  3NG0 A;  3SHQ A;  4J6I A;  4M02 A;  1YN5 A;  1UNS A;  3PRZ A;  3KUC B;  1NEN B;  2PE6 B;  1NYQ A;  1WWT A;  5H8Y E;  1CQV A;  2HJ1 A;  3NVV A;  4DHZ B;  2Y5C A;  3EEC A;  4BKG A;  2EKI A;  2BYV E;  2GBR A;  3RN9 C;  5DPS A;  3P42 A;  4PYU A;  1QF6 A;  1NEK B;  2C60 A;  2IGD A;  2INC C;  1E90 A;  2MW5 A;  2K6D B;  1C3T A;  4A3O A;  5DCN A;  2GLS A;  2GRI A;  2AYO B;  4E74 A;  4ICU A;  1T0Y A;  2EMS A;  2R61 A;  1E8X A;  1WMH B;  4OZA A;  3IT4 B;  2KK8 A;  1L6V A;  2D3G A;  1XO3 A;  4RFB A;  4YWG G;  3ZO5 B;  2NTS A;  3HRD D;  3ZRC A;  3NS8 A;  1GOZ A;  4LNN A;  4W9G A;  1TS5 A;  2C7N B;  4LDT B;  2KQ7 A;  4YSZ B;  3CMM B;  1AW7 A;  2LAS A;  1JWM D;  5JHB A;  2WXF A;  2ZJD A;  3AE9 B;  3AE7 B;  1VDV A;  4OZB A;  2KFK A;  4KX6 B;  1TKY A;  1CJE A;  2V3P A;  5IO9 A;  3MJ5 A;  1AN8 A;  3U4E G;  4CYE A;  3N20 C;  4K7W A;  5G55 A;  2RDH A;  1V9J A;  1C4C A;  3OWE B;  4IM3 A;  1QZE A;  3H7P B;  4RM8 A;  1KF6 B;  3Q2A C;  3ZKJ C;  4K7S A;  3JW0 X;  4BOS C;  1FPY A;  1WX7 A;  3MC9 A;  1T0S C;  2WP9 B;  1RYJ A;  2RGF A;  4HKQ A;  3B2F A;  1ZGU B;  2LRW A;  2CJO A;  2VZK B;  5AZG A;  1HTQ A;  4NQL B;  2N1V A;  5D7G A;  3N1Z C;  4NPN A;  3C0R B;  1SEB D;  2BQQ A;  1VZ8 A;  2WXK A;  3GB1 A;  2QHO A;  2KTR B;  2QC8 A;  2M4N A;  5LXI B;  2INP E;  3Q3J A;  4WJP A;  3MFG A;  3TMP B;  3A4S C;  1YD8 U;  4HRS A;  3DWG C;  3EFU A;  4JQW C;  4LCD E;  1M4V A;  2MJD A;  4BKT A;  3LYY A;  2QCZ A;  3HHM A;  4LNO A;  2N9P C;  1WM3 A;  2DAJ A;  1N6Z A;  1P1A A;  3AEB B;  3H8H A;  2Z0E B;  2LFI A;  2RDB C;  1SJE D;  1VZ7 A;  3GE3 C;  1UBI A;  2KMM A;  1EUV B;  2BS2 B;  2K6Q A;  4ZRI A;  4MGZ E;  1P3Q U;  4M00 A;  4C4V B;  2LXC A;  3SEB A;  4ANU A;  4K3B A;  2MWS B;  4S17 A;  4A9A A;  1PGA A;  1L4Z B;  2NPT B;  1OQQ A;  1H8C A;  1JAL A;  4JWS C;  4MGI E;  5D3I B;  1GNU A;  3RNE C;  4IW0 A;  2WDV B;  4FHJ A;  5C23 A;  2M1M A;  1FD6 A;  3ZVV A;  3T3O A;  1J0G A;  3A9J B;  2BTE A;  3WCQ A;  3AEA B;  5BMH A;  3TIX A;  2N4F A;  4II3 B;  2JWZ A;  1D5M C;  4AQ7 A;  3RCZ A;  1CMX B;  2AL6 A;  3Q8B A;  1NYR A;  4MGY E;  1ET6 A;  3PLU A;  3RYT A;  1E8Z A;  4OW0 A;  3DBH I;  5BYQ A;  1XCQ L;  3AB5 A;  3EHV A;  2V3N A;  4XE0 A;  5G5G A;  2QIL A;  2KDF B;  4GDK B;  2OHF A;  2K25 A;  2C5L C;  1TYG B;  1UWM A;  1RFA A;  2L52 A;  3PHW B;  3Q3M C;  4GN1 A;  1EU3 A;  3EFC A;  1IUE A;  1J19 A;  5EE3 A;  4YXD B;  2FUH B;  4B95 A;  2EKE C;  5G2N A;  1MPE A;  3ML8 A;  1QOF A;  4GB9 A;  1I35 A;  1IP9 A;  2CHX A;  2O6V B;  4N9F 4;  2DYB A;  1FNW A;  1PGB A;  2AX5 A;  4FLH A;  2GOW A;  2BS4 B;  4URK A;  1RM6 C;  2D10 A;  3A1Q A;  1JW9 D;  3NUH B;  2BBC A;  2KZR A;  5AUI A;  4ANV A;  2SEB D;  3EA6 A;  1C4A A;  2PJH A;  2IYD B;  4RCO A;  4IOI E;  2BGF A;  1F9J A;  2WQY B;  2FUG 1;  1GC7 A;  3J9C A;  5FK9 C;  1OQY A;  3B2G A;  4EUT A;  3L4P A;  1YNT E;  4DK5 A;  5BO4 B;  3UQA A;  1UZX B;  2LD9 A;  2D3A A;  1RLF A;  1SE4 A;  1K50 A;  1Y8R C;  1I4H A;  2N7E A;  2PPH A;  2NCN A;  1WGG A;  4QAY A;  5DPW A;  1DYQ A;  2N9L A;  1I4G A;  4DDG D;  4EZJ A;  1E7P B;  4WAA A;  4NAW A;  2ZPY A;  1YX5 B;  1VCB A;  1WGK A;  3AMZ A;  1HA5 A;  3AI5 A;  1P7F A;  1F2R I;  4I6L B;  3IHP C;  3ZUN A;  4WQO B;  5IAA C;  1B1Z A;  2JVC A;  4C56 C;  1SE3 A;  1V5T A;  2BVC A;  3ZTD A;  1RWS A;  4XGA B;  1OEY J;  1NI3 A;  4G3X B;  1WH3 A;  4L23 A;  1V1P A;  4HPP A;  1S1Q B;  3VR8 B;  1WR1 A;  1V8C A;  2Y5P A;  1DOY A;  3IFW B;  4BKS D;  1VRA B;  2IO1 B;  2FCN A;  4BAX A;  2O2V B;  2A4Z A;  2LGY A;  3SDL C;  4YL8 A;  3LDZ E;  1PYW D;  4WWO A;  2G3Q B;  3TCA A;  5D6J B;  1HXY D;  3ZYY X;  4OVU A;  3IT6 B;  4K7U A;  1Z2M A;  1I7H A;  4L2Y A;  5GMV A;  1P0R A;  1FFV A;  2B3A A;  1WGR A;  3B1L X;  2BW2 A;  3PRE A;  4K3C A;  2M8S A;  1Z5S B;  2N9K A;  4FBJ B;  3P4Q B;  3AXC A;  1GPX A;  2UYZ B;  1F0Z A;  3GOE A;  3DBS A;  5J18 A;  2BF8 B;  1Q1O A;  1YOV B;  5L95 C;  1P9D U;  1P7E A;  4G11 A;  2L00 B;  2KKC A;  4JX1 C;  3VFK A;  1AYF A;  2IO2 B;  4OHJ A;  1J8C A;  2CJN A;  1L0V B;  2C7M B;  4YSY B;  4AS1 A;  3Q8F A;  2JXX A;  3P4P B;  4GMV A;  3W9C B;  1GG3 A;  1E9M A;  5JXV A;  2M17 A;  4LTU A;  2RPQ A;  2BT6 A;  3BVZ A;  5D2M B;  4LLG M;  3AEC B;  4FJY A;  4DQO C;  1ROE A;  4KDI C;  2BYT A;  1WXS A;  4NAW B;  1AAR A;  1SF0 A;  3BWU D;  1XF5 L;  1XD3 B;  1FIQ A;  3VH4 B;  1JWA D;  2L83 A;  3K9P B;  3KWV A;  4DXF A;  1LO5 D;  1TJE A;  2J0M A;  3AE1 B;  1WYG A;  3P4S B;  1TS2 A;  2LXA A;  2JXT A;  1AWD A;  4WJQ A;  3ZNI D;  3N9Y C;  4A55 A;  1XCT L;  2LRU A;  3DBL B;  3ENE A;  3RPF C;  1YQ3 B;  4JIO U;  4KZC A;  3SD5 A;  4W9F A;  3NOB A;  1V1P B;  1ACC A;  2J0K A;  4FA6 A;  3RI7 C;  3U7Z A;  2DHZ A;  3APF A;  4EZK A;  1ZOY B;  3APC A;  2V1Y A;  4RM9 A;  1UGM A;  2WNM A;  1GB1 A;  1WMH A;  1N62 A;  2J52 A;  4RF0 A;  1UD7 A;  3PPA A;  1WE6 A;  2KMA A;  3AE6 B;  1D4B A;  2MP2 B;  4RGT A;  1FXA A;  4LDT D;  1J7B A;  3X0W A;  3HIZ A;  2K5P A;  3CWI A;  4WWN A;  1E7U A;  4XX5 A;  2I2Y A;  2QEJ C;  2Q5W D;  2NBV B;  4MT5 A;  2BKF A;  2KXJ A;  3VUX A;  1WRD B;  4XDD A;  1H4R A;  2GMI C;  4B0M A;  4TUU A;  3KYC D;  1DOX A;  2XEW A;  1GC6 A;  2KT7 A;  2E3T A;  2PLP A;  1Y56 A;  3DQV A;  1N63 A;  4TQ0 A;  1ZW7 A;  2FIF A;  4NZL B;  3L16 A;  2JU6 X;  2KJ6 A;  1MI0 A;  1ZP0 B;  3DBR I;  4AJW A;  3BIN A;  1V80 A;  5LLI A;  3AE8 B;  2VZK D;  4BBN F;  5KHO A;  4HJG E;  3H7S A;  2KYW A;  3EUB 2;  3BYY B;  2ZCB A;  1MFW A;  3CIR B;  2WX1 A;  4FUL A;  3VDZ A;  5IP4 D;  1STE A;  2AWT A;  4AWJ A;  3DVG Y;  2KVZ A;  3VXW A;  5J2R A;  2WXI A;  1MVK A;  2KTR A;  4HK2 A;  3H1U A;  2FAZ A;  3UGB B;  3HM6 X;  1HZ6 A;  1YN4 A;  2WXL A;  1E8Y A;  3I3T B;  3QAQ A;  2BYF A;  3KQ4 A;  1YJJ A;  1WYW B;  2C7H A;  2LGX A;  1WY8 A;  3Q8E A;  3VUY A;  3W1S A;  2LJI A;  2WXM A;  2K8B A;  3A9K B;  3MJW A;  3T9L A;  5BYS A;  2Z8L A;  4FHK A;  2HDE A;  2WS3 B;  4C4V A;  4F8C B;  4K81 A;  1DGJ A;  4PS8 A;  2N1W A;  5BMG A;  4A90 A;  3SFE B;  2NPT A;  3HK0 A;  1HZ5 A;  4GU2 A;  4EFO A;  2PW9 A;  2DZM A;  3W1Y A;  3KUD B;  3OG5 A;  1CK1 A;  3PRP B;  3X23 A;  2LI5 A;  2K0P A;  4W9J A;  2AL3 A;  4NQK E;  3RT3 B;  4KSK C;  2FCS A;  3L08 A;  3OJ3 A;  3A9J A;  3Q3O C;  1M94 A;  3MHS D;  1T3Q A;  2ZW0 A;  5C3J B;  2AQ1 B;  2MRP A;  3DHG C;  1XLP A;  4GIV A;  2JQR B;  3I9V 1;  3PGE A;  2KDI A;  3ZNZ B;  4L1B A;  2OJW A;  4RGO S;  1FNV A;  3WAO A;  4GDK A;  3PO0 A;  1S3S G;  2X8X X;  3B08 A;  3H6N A;  3Q8C A;  4C7Y A;  2IO3 B;  4ZHP A;  2O6V D;  1I42 A;  3NRZ A;  2REX A;  1EO6 A;  3QC8 B;  1J7A A;  3UIO B;  1XQQ A;  1D3Z A;  2WXR A;  1QT9 A;  1GJZ A; 
#chains in the Genus database with same CATH homology
 4G0N B;  1UBQ A;  4FLH A;  2XK5 B;  4DBG A;  5TR5 A;  3V60 A;  1IPG A;  2GOW A;  3PZD A;  3QQ8 B;  2UWQ A;  4HWI B;  4URK A;  3NY5 A;  1OGW A;  2GBN A;  2O6V A;  3DOW A;  2D10 A;  2KWC A;  3A1Q A;  4A20 A;  4ASW C;  2KZR A;  3NZS A;  4MSM B;  2NBW B;  3ECI A;  3M95 A;  2LJ5 A;  1X1M A;  1WZ0 A;  2XK5 A;  3L0W B;  1P98 A;  4ANV A;  1WM2 A;  2M0X A;  1E5W A;  5JZE B;  2PJH A;  1NBF C;  2I1J A;  2IYD B;  3TL5 A;  1WX8 A;  2N9E B;  3L17 A;  4M0W B;  2BGF A;  2KOX A;  1F9J A;  3RZW C;  2YVC A;  3R66 C;  1GC7 A;  4MDK E;  4HLE A;  4MH0 E;  1EF1 A;  3OJ4 B;  2C9W B;  4DHZ E;  1OQY A;  4NY0 A;  4AJY B;  3ALB A;  4DDI D;  4EUT A;  1JRU A;  4KIK A;  4F7Z A;  4DK5 A;  4EOY A;  5BO4 B;  1KM7 A;  3UQA A;  3RUI B;  1UZX B;  2K1F A;  2L05 A;  2L0F A;  2LD9 A;  3SU8 X;  1KOT A;  4FJZ A;  1RLF A;  5J17 A;  3PT2 B;  2L3Z A;  3H9D A;  1WJU A;  4W9L A;  3L54 A;  2V4L A;  4NJ6 A;  4RMA A;  1WXV A;  1Y8R C;  2BKR B;  3VTW A;  3WA0 A;  4KVG B;  2N7E A;  2PPH A;  2W9N A;  2NCN A;  5AZF A;  4BBN C;  1WGG A;  3KUZ A;  4GDL B;  2HE7 A;  4IM2 A;  1R4N I;  4NNJ B;  4JGH B;  4PYZ A;  3UF8 A;  1BT0 A;  3TBL D;  4BFR A;  3ZLZ A;  3PRM B;  5DPW A;  3N3K B;  4JL9 A;  3U7D A;  3VAW A;  4DDG D;  4EZJ A;  2KJH B;  4WAA A;  4BOZ B;  2DYO A;  2G4D B;  3NZU A;  4IUM B;  4NAW A;  2ZPY A;  3APD A;  1YX5 B;  2ZCC A;  3V61 A;  1VCB A;  2CHZ A;  3QWZ B;  3EC8 A;  3VH3 B;  4MJS A;  1V2Y A;  4A3P A;  1OEY A;  4GGQ A;  4ANW A;  3AI5 A;  4LJO B;  3V6C B;  4I6L B;  2JRH A;  3IHP C;  3ZUN A;  4WQO B;  2J0J A;  5DPT A;  5IAA C;  2JVC A;  3GZN I;  3IVF A;  3RZF A;  1V5T A;  3Q3F A;  3ZTD A;  2KHW B;  4CHK A;  2KWV B;  4JLC A;  1OEY J;  1GUA B;  3PVL A;  4G3X B;  1WH3 A;  1PQS A;  1WX9 A;  1YJ1 A;  3QJZ A;  2NBU A;  1OTR B;  2BPS A;  4W9C A;  1S1Q B;  2RR9 A;  1WR1 A;  2FNJ B;  3IFW B;  4BKS D;  2PEA A;  2IO1 B;  3DCG A;  4MM3 A;  2FCN A;  2O2V B;  3KYD D;  5E6P A;  2A4Z A;  2LGY A;  4FJV B;  3ZTC A;  2ZNV B;  1TZ1 A;  4KSL C;  4EKU A;  3SDL C;  2ZPN A;  2WYQ A;  4YL8 A;  3T8M A;  5CX3 A;  2MBO A;  3IG3 A;  3LDZ E;  2D2Q A;  4WWO A;  2G3Q B;  2K39 A;  3TCA A;  2KLC A;  5CTR C;  5D6J B;  3P2B A;  4ICV A;  4W9E A;  2O2V A;  2KX3 A;  3CSF A;  4OVU A;  2Z59 B;  4K7U A;  1Z2M A;  2YLM A;  1L7Y A;  5D94 A;  5C1Z A;  3QAR A;  5GMV A;  1P0R A;  3KW5 B;  2DZK A;  3QK0 A;  3M62 B;  2LWP A;  2B3A A;  1WGR A;  4PS7 A;  1KLV A;  3B1L X;  3PRE A;  3U30 A;  4IWQ A;  4G50 A;  2M8S A;  2I1K A;  3QA8 A;  3U8Z A;  1Z5S B;  4DWF A;  4HJK A;  4FBJ B;  1K8R B;  2CR5 A;  3V6E B;  3QHT A;  3N30 A;  3AXC A;  2KD0 A;  4IG7 B;  1YX6 B;  4ZDV A;  3JVZ X;  2UYZ B;  1RRB A;  2MSE D;  1ISN A;  4ANX A;  3GOE A;  1LQB A;  4PS3 A;  3DBS A;  1TGZ B;  2LGD A;  1TBE A;  2NS5 A;  3L10 B;  5J18 A;  3V62 A;  2BF8 B;  2HD5 B;  4II2 B;  3VQI A;  2DYM A;  3QCA A;  3N32 A;  1Q1O A;  5E6O A;  4AOF A;  3CST A;  1XT9 B;  2JRI B;  5L95 C;  4X57 B;  1P9D U;  1WGD A;  2MA9 B;  4IWO A;  4G11 A;  2CS4 A;  3R7R A;  4B9K A;  2NR2 A;  2JT4 B;  2L00 B;  2ZNV C;  2FCQ A;  2KKC A;  3H7P A;  2FID A;  2CKH B;  3VFK A;  2CU1 A;  2NVU I;  2IO2 B;  1J8C A;  4KIK B;  5KHQ A;  3QX1 A;  4TQ1 A;  2C7M B;  3DVG X;  2IY1 B;  4DXA B;  1EF5 A;  2JUO A;  2ZVN A;  4BVU C;  1HE8 A;  2JXX A;  2XBB C;  4GMV A;  4TV3 A;  1RAX A;  1WXA A;  2DX5 B;  2D11 A;  1WGH A;  2MBB B;  1GG3 A;  3WAP A;  3JSV B;  2KVR A;  4NJ7 A;  4WJN A;  2M17 A;  1LFD A;  1U4A A;  1V49 A;  2RPQ A;  2RD0 A;  3KH0 A;  4HCP B;  2OJR A;  5D2M B;  2IO0 B;  3SHQ A;  4FJY A;  4J6I A;  2G45 B;  2ZEQ A;  3PRZ A;  4MEM A;  3KUC B;  4I6N B;  3VUW A;  4KDI C;  2PE6 B;  1WXS A;  3JSV A;  1E8W A;  4NAW B;  1AAR A;  3PHX B;  1WJN A;  2IZV B;  3TJP A;  3VHT C;  3VVW B;  4IWP A;  3EEC A;  4DHZ B;  1XD3 B;  4BKG A;  4CO7 A;  4MJS B;  3VH4 B;  2GBK A;  2K8H A;  1ZKH A;  2BYV E;  2KC2 A;  2WDT B;  3DVN U;  3ONS A;  5AEK B;  2GBR A;  3K9P B;  4DHJ D;  2J0M A;  4DHJ B;  3OAW A;  4W9K A;  5DPS A;  2KC1 A;  4PYU A;  4F1S A;  3K9O B;  2LXA A;  4WJQ A;  3ZNI D;  2C60 A;  4M8N A;  2LRU A;  2Z0D B;  3RD2 A;  2L0T A;  1E90 A;  3ENE A;  2MW5 A;  3QIJ A;  3M63 B;  3A33 B;  2A5U A;  2EMT A;  2K6D B;  4JIO U;  1C3T A;  4KZC A;  3SD5 A;  3VTU A;  3ZRF A;  2JY6 A;  4W9F A;  3NOB A;  4P7I A;  4A3O A;  3M3J A;  5DCN A;  1Q5W B;  2J0K A;  2AYO B;  2L76 A;  4E74 A;  2AEH A;  1T0Y A;  4ICU A;  2EMS A;  4FA6 A;  2DHZ A;  3APF A;  2PE9 A;  3ZDM C;  4EZK A;  2MBE A;  1E8X A;  1WMH B;  3APC A;  3KVF B;  2V1Y A;  4MEL A;  3WIM A;  4RM9 A;  5FR6 A;  4FAD A;  3DDC B;  4M8M A;  4HPM B;  2KK8 A;  1UGM A;  3VTV A;  4EEW A;  4MSQ B;  2D3G A;  1UEL A;  2LVQ A;  1IYF A;  3ZO5 B;  1MG8 A;  2KNB A;  3ZRC A;  1WMH A;  3NS8 A;  4W9D A;  4HDO A;  1UD7 A;  2GBJ A;  3PPA A;  4OVV A;  2BWE S;  1WE6 A;  2KMA A;  2MQJ A;  2HJ8 A;  4W9G A;  2MP2 B;  2KFK B;  2C7N B;  2DZI A;  4LDT D;  2CHW A;  4LDT B;  3X0W A;  2KQ7 A;  3HIZ A;  3CMM B;  2LAS A;  1SE9 A;  5IA7 A;  4WWN A;  1E7U A;  4XX5 A;  2DEN B;  2KJR A;  2ZJD A;  5JHB A;  1SGH A;  2MP2 A;  2KFK A;  3AU4 A;  2LZ6 A;  4ZRJ A;  2L8J A;  4CYE A;  4K7W A;  2BYE A;  5G55 A;  3PSE B;  2NBV B;  4MGK E;  3UQB A;  4W9H A;  3WAM A;  1V9J A;  2BKF A;  2KXJ A;  3VUX A;  5LXH A;  4WWP A;  2MX2 A;  1WIA A;  1R4M I;  1WRD B;  1LM8 B;  1H4R A;  2GMI C;  4AP4 C;  3JYU A;  3UIN B;  4TUU A;  3KYC D;  4K1R B;  3PS6 A;  4IM3 A;  1QZE A;  3H7P B;  2XEW A;  4RM8 A;  1GC6 A;  3PV1 A;  2KDB A;  3ZKJ C;  4K7S A;  3JW0 X;  2JZZ A;  4BOS C;  5HKH A;  1WX7 A;  3DQV A;  1E7V A;  3S2A A;  2MBQ A;  3RUL A;  2IBI B;  1NI2 A;  3WAN A;  1ZW7 A;  4TQ0 A;  2FIF A;  4EZL A;  5JH5 C;  3A4R A;  2KX0 A;  3L16 A;  2J7Q B;  2JF5 A;  5CHW A;  1L2N A;  2RGF A;  2KJ6 A;  5CHF A;  2N7D A;  3DBR I;  1ZGU B;  2ASQ A;  3BIN A;  4AJW A;  1V80 A;  2L7R A;  4E71 A;  5LLI A;  2JPH A;  2LRW A;  4BBN F;  5KHO A;  5AZG A;  3H7S A;  4NQL B;  2N1V A;  1FXT B;  1NDD A;  5D7G A;  4KZ0 A;  2KFJ A;  2MLB A;  1WGY A;  1WJ4 A;  1WXM A;  1YQB A;  4ZRK A;  4NPN A;  3L13 A;  3PLV A;  4GXB A;  4HVB A;  3C0R B;  3BY4 B;  2ZCB A;  2WX1 A;  1Q0W B;  2QHO A;  4I6P A;  2KTR B;  4FUL A;  2M4N A;  5LXI B;  1V86 A;  3VDZ A;  2KN5 A;  3Q3J A;  4WJP A;  3TMP B;  2AWT A;  3A4S C;  1YD8 U;  3ML9 A;  4AWJ A;  3EFU A;  3R3M A;  4JQW C;  1KJT A;  3DVG Y;  4LCD E;  2RSU A;  2LUE A;  3O65 B;  4BKT A;  3HHM A;  2HTH A;  3VXW A;  5J2R A;  2KTR A;  2G4S A;  2LVP A;  1WM3 A;  2DAJ A;  2N9P C;  4TKN A;  4HK2 A;  3H1U A;  2FAZ A;  2JZ3 B;  3D32 A;  1G6J A;  2Y5B B;  3UGB B;  1P1A A;  3HM6 X;  2K8C A;  2WWZ A;  5DPR A;  2Z0E B;  2KTF A;  1UH6 A;  1E8Y A;  1UBI A;  3I3T B;  3PTF C;  3QAQ A;  2BYF A;  4IM0 A;  3ZW3 A;  2ZZP B;  1EUV B;  2R2Q A;  2K6Q A;  1WYW B;  2C7H A;  4ZRI A;  4MGZ E;  1P3Q U;  4GOC A;  4B6W A;  2LXC A;  2LGX A;  1WF9 A;  4W9I A;  1C1Y B;  4ANU A;  1WY8 A;  3VUY A;  1VD2 A;  3MTN B;  3W1S A;  3ZIM A;  2MWS B;  2K8B A;  2VRR B;  3A9K B;  5L83 A;  2DAF A;  4XZ4 A;  4AUQ C;  3MJW A;  4GDL A;  2NPT B;  4KDL B;  5E6N A;  3T9L A;  3DVN V;  4HPL B;  4FHK A;  5JHA A;  1H8C A;  4F8C B;  4MGI E;  2KO3 A;  3AUL A;  1GNU A;  4K81 A;  4PS8 A;  2N1W A;  4WJO A;  4GSW A;  5CHV C;  4LJP B;  4IC7 B;  3DPD A;  3A9K A;  3DBL I;  4IW0 A;  3OLM D;  4FHJ A;  2M1M A;  2NPT A;  5C23 A;  3UIP B;  2WX0 A;  3HK0 A;  1WR6 E;  4GU2 A;  4EFO A;  3ZVV A;  2DZM A;  3W1Y A;  1J0G A;  3A9J B;  2MBH A;  3ZNG C;  3KUD B;  3TIX A;  2N4F A;  4II3 B;  2KDE B;  2JWZ A;  3NHE B;  3PRP B;  3RCZ A;  3X23 A;  2LI5 A;  1WJ6 A;  4W9J A;  1CMX B;  2AL3 A;  2AL6 A;  3LJ3 A;  4NQK E;  1WI0 A;  4KSK C;  3RT3 B;  3WAL A;  4MGY E;  2FCM A;  2D07 B;  3PLU A;  2FCS A;  3R7Q A;  1E8Z A;  3L08 A;  3CF6 E;  3OJ3 A;  3A9J A;  3RYT A;  2IY0 B;  1A5R A;  3DBH I;  3W1S C;  1V81 A;  3EHV A;  1WZ3 A;  3ZDT A;  3B0A A;  1M94 A;  3MHS D;  3IBE A;  2DZJ A;  2ZVO A;  2V3S A;  2MRP A;  2KLG A;  2KDF B;  2KWU B;  2N9X A;  3HM3 A;  1YIW A;  2K25 A;  2GBM A;  2C5L C;  4GDK B;  4GIV A;  4KV2 A;  3ZNH B;  1RFA A;  3PHW B;  4GN1 A;  2MCN B;  2KMC A;  4BKS A;  5EDS A;  3PGE A;  2KDI A;  1WE7 A;  3ZNZ B;  4E3C A;  1J19 A;  3AU5 A;  4HCN B;  3WAO A;  4GDK A;  1WFY A;  4HDQ A;  2FUH B;  4B95 A;  2EKE C;  5G2N A;  1SIF A;  2LVO A;  4XC2 A;  1LXD A;  2BWF A;  1S3S G;  3B08 A;  3H6N A;  3ML8 A;  4FN2 A;  5AZH A;  1I35 A;  4GB9 A;  1IP9 A;  2CHX A;  2IO3 B;  4ZYN A;  2KQS A;  2O6V D;  1V6E A;  2O6V B;  2KAN A;  2R2O A;  2REX A;  4N9F 4;  1I42 A;  1V5O A;  2DYB A;  1EO6 A;  2OOB B;  3A1Q B;  3QC8 B;  3UIO B;  1XQQ A;  1D3Z A;  4HXD A;  1GJZ A;  1TTN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...