2K6QA

Lc3 p62 complex structure
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
121
structure length
121
Chain Sequence
b'SMPSEKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESERDEDGFLYMVYASQETFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Microtubule-associated proteins 1A/1B light chain 3B
publication title Structural basis of target recognition by ATG8/LC3 during selective autophagy
rcsb
source organism Rattus norvegicus
molecule tags Apoptosis inhibitor/apoptosis
total genus 20
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2008-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2k6qA00
2C60A 2Z0DB 3JSVA 1V9JA 4J6IA 3ZVVA 2GBKA 4FHJA 2IO0B 3R3MA 4HXDA 4JLCA 1V5TA 2CR5A 4DDID 1XT9B 3ZNZB 1YX6B 2NBWB 4TKNA 3RT3B 3VH3B 4EOYA 2KLCA 4JL9A 4K7SA 2MSED 4HCPB 1BT0A 5EDSA 3EFUA 1EO6A 2IO2B 1WGGA 4WWNA 2DYBA 2ZCCA 1WRDB 4W9KA 3H1UA 2G3QB 2K39A 2MBQA 1WX8A 3L0WB 2LZ6A 1OEYJ 4E3CA 1OQYA 4PS8A 4PS7A 3PHXB 3WANA 2LVQA 4K7WA 1LM8B 4FBJB 1H4RA 3NHEB 4GU2A 1WGRA 2VRRB 1AARA 2KMAA 2BYFA 4CHKA 2JUOA 4FJYA 1WJ6A 2ZJDA 1V5OA 2LJ5A 4HPLB 1UH6A 3MTNB 3D32A 5LLIA 3T8MA 3WIMA 3L08A 1H8CA 1WGHA 2NR2A 3ML9A 3DVGX 3PS6A 2V1YA 2K6DB 2MQJA 4GIVA 2JF5A 2BKFA 2ZVOA 1EF5A 1P3QU 2OJRA 4BKTA 2KDEB 3ALBA 2AL6A 4FJVB 4MGZE 4WJNA 4F1SA 4HK2A 2N1VA 3R7RA 3W1YA 4LJPB 2HE7A 4DHJB 4ANUA 4TQ1A 4ASWC 1EF1A 3X0WA 2G45B 2NS5A 3K9OB 3ZDTA 2KFKA 4NQLB 1RAXA 4NAWB 4A3OA 2DHZA 3TCAA 3UF8A 1P0RA 3N32A 3NOBA 2UWQA 3GOEA 2BPSA 3PGEA 3MHSD 2XK5B 3H6NA 3NZSA 3CSTA 1GG3A 2K8BA 3DVNU 4LDTB 4EKUA 2DYMA 3EECA 2G4DB 2JZ3B 2ZPYA 2LRWA 3B0AA 4P7IA 2L7RA 3L16A 2KFJA 2HTHA 4MGYE 5D6JB 2KTRA 3O65B 4ZRKA 3NZUA 1T0YA 4M0WB 1FXTB 3KUDB 2BYEA 3AU4A 1WYWB 4ICVA 2O2VB 4OVVA 1L2NA 1I35A 5J2RA 1WY8A 5BO4B 2WDTB 1E7UA 3KYDD 4HWIB 3ZW3A 4IW0A 4CYEA 5AZGA 4G3XB 2ZPNA 1WIAA 4AWJA 2BGFA 2LGXA 3KVFB 4AJWA 4II3B 3NS8A 3APCA 2GBMA 4TV3A 1SE9A 4WJOA 2NCNA 3WALA 4DHZE 2O6VB 2C7HA 2OOBB 3Q3FA 1KM7A 2LI5A 3TJPA 3DPDA 2MBOA 4WJQA 4JGHB 1V80A 4IWPA 2KJ6A 3A9KA 1GUAB 2C9WB 2M17A 1E8XA 5AEKB 1VD2A 2A4ZA 3QIJA 3WA0A 4HLEA 3AXCA 3BINA 3CMMB 3L17A 1TTNA 1WXMA 2LVPA 3DDCB 2BYVE 2DZKA 1IP9A 3TIXA 4TUUA 4B6WA 3U7DA 1UELA 1VCBA 3H9DA 2FCNA 1WE6A 4LCDE 4MELA 3VVWB 3WAOA 3APDA 4AP4C 1IYFA 2N9PC 2M0XA 3SHQA 2IO1B 2BWFA 1JRUA 4ZDVA 5JZEB 1E90A 1OEYA 2D3GA 1ZGUB 2AYOB 2LVOA 1XQQA 2KK8A 3ECIA 3VTWA 5IA7A 4XX5A 4DHJD 4ZYNA 2HJ8A 1WMHB 4MJSB 3LDZE 1Y8RC 2C5LC 2WX0A 1ISNA 3IG3A 2EMTA 1UBIA 2MBEA 1WJ4A 3QC8B 4K81A 4N9F4 3DVGY 3EC8A 5DPRA 4WAAA 3QWZB 4NNJB 2JPHA 2IO3B 1J8CA 5DPTA 3A33B 4W9DA 4LDTD 1WR1A 2R2QA 5E6NA 5L95C 2L0TA 3HHMA 2KWVB 3QHTA 5JHAA 4IWQA 4AOFA 3TBLD 2RGFA 4DK5A 4GDLB 1CMXB 2CHXA 5LXIB 2IZVB 4M8NA 3OAWA 3QJZA 3APFA 2V3SA 4MM3A 3A1QB 2CU1A 3PTFC 1WX7A 4PYZA 4XC2A 2KO3A 1WI0A 3ZTCA 1M94A 1Q1OA 4KIKA 1Z5SB 4W9FA 2KDFB 2MCNB 1V2YA 3W1SC 4MGIE 3WAMA 3VDZA 2ZNVB 3VTVA 2JWZA 2O6VD 4NAWA 4IM0A 2LRUA 1SGHA 4BBNC 2WYQA 2DENB 1GJZA 4I6PA 2KC2A 3B1LX 2J0KA 2DAFA 2KJHB 2MLBA 2XK5A 3QCAA 4G11A 1YX5B 4DDGD 1J0GA 4BVUC 4KZCA 2MBBB 4WWPA 5FR6A 4GN1A 4KIKB 2J0MA 5LXHA 2I1JA 1OTRB 2LASA 2MBHA 2FIFA 2FUHB 4ICUA 3IFWB 3OJ4B 4HJKA 3HM6X 2ZCBA 1WF9A 2MP2B 4RM8A 3SD5A 2O2VA 3QAQA 4FULA 4K7UA 2RR9A 2CHWA 1V49A 2DYOA 2L05A 3DQVA 1P1AA 2LXAA 4GDKB 3A9JB 1PQSA 3IVFA 2CHZA 2N7EA 4FLHA 2KD0A 4GSWA 2ZVNA 4IWOA 4W9IA 4GOCA 2D11A 3RD2A 2K6QA 3X23A 3M95A 3SDLC 3VHTC 4MSMB 4KSKC 1YIWA 3A4RA 4W9HA 2I1KA 3PHWB 2O6VA 3TMPB 5JH5C 2N9EB 1WGYA 1LFDA 1WGDA 3V6CB 4HCNB 3N30A 2DZJA 5J17A 3W1SA 1V81A 1R4NI 3QARA 3T9LA 4F7ZA 2KX0A 2KKCA 5JHBA 2YVCA 4BOZB 3V62A 2KQ7A 1C3TA 2GOWA 2FAZA 3DBLI 1V86A 3ZNHB 3AU5A 4M8MA 4II2B 2RPQA 5E6OA 2DX5B 4HDQA 3A4SC 2FNJB 2NPTB 4IM3A 2JXXA 2KWCA 4XZ4A 1GC7A 1Z2MA 2Z0EB 2ZNVC 1WZ3A 2K8HA 3RZWC 2IY1B 3PV1A 2KVRA 2L8JA 1LXDA 4IUMB 4KZ0A 3UINB 2KZRA 3PVLA 1P98A 5D2MB 1WMHA 2JRHA 4MDKE 2KDBA 3DOWA 2FIDA 4MJSA 5CHVC 3QQ8B 1E8WA 3JW0X 3ZDMC 3VUXA 1TBEA 4A20A 1WXSA 4NY0A 1YJ1A 3AULA 4NPNA 4W9CA 4W9LA 2MX2A 2IY0B 3KYCD 4E71A 3JYUA 2AWTA 4TQ0A 2ASQA 1L7YA 3I3TB 2L76A 4RMAA 2ZZPB 1E5WA 4A3PA 4ANXA 4BBNF 3WAPA 4FN2A 3ML8A 3PPAA 3PRPB 4URKA 2Y5BB 5G2NA 4EUTA 3B08A 3CF6E 1J19A 2K1FA 3CSFA 3HK0A 4BOSC 3R66C 2KNBA 1WJNA 3H7PB 3ONSA 4GDLA 5D94A 5C23A 3BY4B 3VXWA 2KOXA 3GZNI 2GBJA 4FHKA 1Q5WB 1YD8U 2KANA 5D7GA 4DHZB 1V6EA 1LQBA 3A1QA 1E8YA 1SIFA 2JZZA 4W9JA 2A5UA 5IAAC 3ZNGC 2L00B 3KUCB 3QA8A 2KDIA 3DBSA 1E8ZA 3PLVA 3QX1A 4NQKE 3RZFA 3UQAA 1WM2A 2PE9A 4KVGB 1WXAA 3U30A 4KV2A 2LD9A 1UZXB 2WWZA 4PS3A 1GNUA 2MA9B 1RFAA 4ZRIA 2IYDB 1NDDA 4YL8A 2AEHA 2D10A 3KUZA 3M3JA 4DBGA 1IPGA 5KHQA 3ZLZA 1KLVA 2LGDA 3DVNV 4HPMB 2GBRA 4HDOA 5J18A 2KXJA 3V61A 3NY5A 1TGZB 1WX9A 2WX1A 2Z59B 2R2OA 4GMVA 3QK0A 4BKSA 3ZNID 3DBRI 2GMIC 2N1WA 2JT4B 3KW5B 3Q3JA 4BFRA 3KH0A 2JVCA 3ZKJC 2XBBC 2MP2A 3ZRCA 2DAJA 1KJTA 3JSVB 1K8RB 3ENEA 1NI2A 4RM9A 1F9JA 4GDKA 1E7VA 3JVZX 3HIZA 4W9EA 3A9JA 4G50A 3PT2B 3S2AA 2W9NA 4FA6A 3LJ3A 1UBQA 2KWUB 2LGYA 1UD7A 4GB9A 1WFYA 2JY6A 2BWES 3DCGA 3MJWA 3IBEA 2N9XA 4EEWA 4F8CB 2MW5A 3V6EB 2CKHB 1MG8A 2FCMA 1WM3A 4MEMA 2GBNA 4JQWC 2PE6B 4I6LB 2L0FA 4EZKA 2NBVB 2XEWA 2MWSB 1I42A 4X57B 3C0RB 2DZMA 2MRPA 3L10B 3U8ZA 2J7QB 4B9KA 2V4LA 4FADA 1ZKHA 4AJYB 4I6NB 5L83A 1R4MI 1TZ1A 1GC6A 1X1MA 2KQSA 3ZO5B 2ZEQA 4WJPA 2RSUA 3RULA 4HVBA 3V60A 5AZFA 3ZRFA 4FJZA 2BKRB 2BF8B 1G6JA 5HKHA 1QZEA 2G4SA 2LWPA 2NPTA 2LUEA 3HM3A 1UGMA 2FCSA 3H7SA 3IHPC 3P2BA 2RD0A 3M62B 3RUIB 3AI5A 2DZIA 2M4NA 3TL5A 3PRMB 1Q0WB 4JIOU 3SU8X 1U4AA 4IC7B 5TR5A 2N7DA 1YQBA 2KFKB 5CHFA 4EZLA 2C7NB 2J0JA 3DBHI 1HE8A 2EMSA 4G0NB 4DWFA 3PZDA 3UGBB 5CX3A 2QHOA 4PYUA 3PLUA 2KMCA 5GMVA 4GGQA 3RCZA 5DPSA 4ZRJA 4IG7B 3RYTA 3L54A 4MGKE 2AL3A 1RLFA 2YLMA 3VQIA 3UIOB 4EFOA 3VUWA 1WE7A 1OGWA 3VAWA 3ZTDA 3VTUA 1WJUA 4NJ7A 2KX3A 2KTRB 4IM2A 4W9GA 2B3AA 3L13A 2KC1A 4WWOA 5E6PA 1WXVA 2PJHA 3H7PA 1WZ0A 4EZJA 5CHWA 5DPWA 4GXBA 4ANWA 1ZW7A 2C7MB 2KHWB 4K1RB 1A5RA 2IBIB 2D07B 3VFKA 3ZIMA 2PEAA 3OLMD 2LXCA 3OJ3A 3PSEB 1D3ZA 2HD5B 4AUQC 2KN5A 2PPHA 3M63B 1WH3A 3ZUNA 2KLGA 4KSLC 4BKSD 5G55A 4MSQB 2K25A 1S3SG 5AZHA 1XD3B 2M8SA 2JRIB 5DCNA 2K8CA 5CTRC 1RRBA 4KDLB 4NJ6A 2KJRA 4B95A 3EHVA 4CO7A 4DXAB 4MH0E 3PREA 3VUYA 2N4FA 1KOTA 4OVUA 3A9KB 4KDIC 2KTFA 1C1YB 5C1ZA 2NVUI 2FCQA 3N3KB 2UYZB 3R7QA 2NBUA 2L3ZA 2EKEC 3PRZA 5KHOA 3VH4B 1S1QB 1P9DU 4E74A 4BKGA 4ANVA 4WQOB 2M1MA 3UQBA 4LJOB 1EUVB 1NBFC 2D2QA 1WR6E 2CS4A 3K9PB 2REXA 3UIPB
chains in the Genus database with same CATH superfamily
2Z0DB 2FUG1 2IO0B 2NBWB 2BB6A 3RT3B 3AM9A 3RPFC 4K7SA 3IXSA 3DHHC 2INCC 2IO2B 2DYBA 4YSZB 2W54A 3H1UA 1XLPA 2INPE 3OWEB 3WANA 1LM8B 1SE2A 1NI3A 4C4VB 1WJ6A 5LLIA 2LJ5A 1UH6A 3D32A 5EE1A 1QLBB 1NENB 2KDEB 3ALBA 1T3QA 2N1VA 4DHJB 4TQ1A 4ASWC 3X0WA 1RAXA 5AUKA 1VZ6A 2DHZA 3ZQ4A 1P0RA 2IGDA 3NOBA 2UWQA 2BPSA 3PGEA 2XK5B 3H6NA 2K8BA 3DVNU 4KX6B 3EECA 4YT0B 2JZ3B 2ZPYA 3B0AA 2L7RA 2QJLA 5D6JB 1UUPA 1FXTB 2BYEA 2WXQA 1L2NA 1JRPA 5BO4B 5I4DA 1E7UA 4HWIB 4RF0A 1JCKB 5AZGA 4G3XB 2BGFA 3AEFB 1L0XB 3H8HA 2NCNA 2O6VB 2OOBB 2X38A 3DPDA 4IWPA 3UI3A 3TEWA 1VD2A 3QIJA 2E6XA 3BINA 3CMMB 2BYVE 2DZKA 2WGSA 3U7DA 1QT9A 4MELA 3SHQA 2M0XA 3MC8A 4ZDVA 1E90A 1OEYA 2LVOA 3IAS1 3VTWA 1MFWA 2RDHA 1HZ6A 2WX0A 2C5LC 2YEPF 1ISNA 3MC9A 3IG3A 1WJ4A 1I4HA 4N9F4 5DPRA 4ZHPA 1NEKB 3SR6A 4NNJB 2PVGC 3AE5B 4LDTD 1MHHE 1JALA 1TS2A 3QHTA 3ABVB 5EE0A 2N9LA 4REZA 4WAFA 2CHXA 3QJZA 3ZXVA 2V3SA 4MM3A 1VRAB 1ZE3D 4K3CA 4ZRPA 1HTOA 1STEA 2I2YA 1Q1OA 4KIKA 2L32A 1V2YA 2LRUA 2WYQA 2DENB 4I6PA 3B1LX 4LNIA 2MEKA 4G11A 1RM6C 1YX5B 3BYTB 4BVUC 1WWTA 5FR6A 2I1JA 1OTRB 2LASA 5BYQA 2G1EA 4HJGE 2J53A 4N59A 4HJKA 1PYWD 1E6EB 1SE3A 1WF9A 1HXYD 2O2VA 4RH6A 1UF0A 1XLNA 1C9FA 3A9JB 1FRRA 4GSWA 2D11A 3VR9B 3BZDB 1T5XD 3VHTC 1JWBD 2DBYA 1WGYA 1LFDA 1PGBA 3TSSA 4HCNB 1R4NI 4YWGG 3T9LA 4F7ZA 5JHBA 1E7PB 2B76B 1VZ8A 2KQ7A 1C3TA 2WNMA 2I38A 1E9MA 4IM3A 2WU5B 3RZWC 2KVRA 2L8JA 3RNEC 2KZRA 3PVLA 1P98A 2KDBA 4MJSA 1MVKA 2FIDA 3ZGZA 5CHVC 1E8WA 1TT5B 1ZDVA 4M00A 2K9XA 4E71A 1FO4A 2H88B 1MPEA 1JQ4A 1ET9A 1KLGD 4A3PA 4ANXA 3WAPA 2INDC 4FN2A 3PPAA 1QKZA 5G2NA 3B08A 5TSSA 1XLQA 4LNOA 4MT5A 5D3DA 3R66C 4ITKA 2DWQA 1Q5WB 5D7GA 1SJHD 1QQRA 1V6EA 3A1QA 2JZZA 3ZNGC 1WGKA 3P4RB 3KUCB 2J52A 2VZKD 2PE9A 4KVGB 1WXAA 5H8YE 3U30A 1GAQB 1NDDA 1IUEA 1L0YB 2K0PA 4HDOA 4A55A 2KXJA 3V61A 1TGZB 2WX1A 1LGRA 4GMVA 4BKSA 3DBRI 2JT4B 3KW5B 4BFRA 2MP2A 4RM9A 3BYYB 3PT2B 3P42A 3S2AA 2W9NA 3LJ3A 3HRDD 2LGYA 1UD7A 1WFYA 2BWES 5E6JA 2K3UA 1DOXA 2MW5A 3Q3OC 3IT4B 2GBNA 3MP9A 4QAYA 1I42A 2GB1A 4B9KA 3U8ZA 4KGSA 4C80A 1ZKHA 5L83A 1R4MI 1C4CA 1CJEA 3ZRFA 2BF8B 1TS4A 1QZEA 2NPTA 3PZ7A 3N1YC 3H7SA 3IHPC 4C7ZA 1C78A 3M62B 4RFBA 1AYFA 3Q6BA 3V3XA 3TL5A 4JIOU 2QCZA 4IC7B 2QMTA 4EZLA 4XWTA 1YN3A 3DBHI 2KYWA 3PZDA 2QHOA 4PYUA 4O1NA 2WXLA 1F2RC 1OQRA 3VAWA 3VTUA 3RNFC 1WXVA 2JYEA 2WXIA 4GLSC 2WLBA 2IBIB 2D07B 3VFKA 4US9A 1F77A 2PEAA 1D3ZA 2PPHA 5BYSA 2KLGA 2MHJA 1L6UA 2YEPB 4NJ6A 2KJRA 4WQMA 2KACA 1IGDA 2L3ZA 1YN5A 3AMZA 2M1MA 1VJKA 1EUVB 2QC8A 2Y3AA 1ROEA 2MH7A 2C60A 3UIPB 3ZVVA 1YMHE 2GBKA 4FHJA 1IGCA 1BMLC 4TMAB 4YTMB 1V5TA 2GLSA 4TKNA 4EOYA 4AQ7A 1VDVA 1CQVA 1FFUA 2JWUA 2K5PA 2MSED 4HCPB 5EDSA 2HTME 1QOBA 4WWNA 2ZCCA 4RNAA 5IP4D 2BS3B 1FRDA 4E3CA 2LZ6A 3Q8BA 1OQYA 4PS8A 1TY0A 4PS7A 3PHXB 2RDGA 1PFDA 4K7WA 2MJEA 4FBJB 1H4RA 4A6QA 3AEDB 4CHKA 2BYFA 4FJYA 2ZJDA 1V5OA 1TIFA 3SFEB 3MTNB 4KKIA 1JROA 2MQJA 4GIVA 1V1PA 2JF5A 4MM3B 4L1BA 4RGNA 1P3QU 2M56B 4FJVB 4MGZE 3W1YA 2HE7A 2Z8LA 2NS5A 2ICIA 3ZDTA 1SXTA 3MHSD 4C56C 4C7YA 3C19A 3L16A 2KFJA 2LHDA 2QILA 3NZUA 1V1OA 1MI0A 1WYWB 2VH1A 2O2VB 4OVVA 5J2RA 1WY8A 2IJ0A 3U52E 2WDTB 3ZW3A 3N1ZC 1L4ZB 3EGRA 4AWJA 3MC0B 3KVFB 3GE3C 4II3B 3APCA 2GBMA 1SE9A 4WJOA 3WALA 3TJPA 2LI5A 5BYRA 4JX1C 4JGHB 1I4RA 1HA5A 1GUAB 2M17A 1E10A 4P6VF 3WA0A 1KFYB 3AXCA 1D4BA 3AB5A 4LK0M 2OJWA 1UELA 1VCBA 3WAOA 2FCNA 4LCDE 1IYFA 2N9PC 3Q14C 1ZGUB 4HKQA 4XX5A 4DHJD 2KQ4X 4MJSB 2G9HD 4P1BC 5G5GA 3B2FA 1AN8A 2EMTA 1FFVA 1UBIA 1BUIC 4MACA 1C76A 4WAAA 2Q5WD 2KT7A 1WR1A 5L95C 2L0TA 3Q8FA 4LNKA 1JWUD 5JHAA 3EA6A 2RGFA 1CMXB 3OAWA 3A1QB 2CU1A 3RMKC 1WI0A 4W9FA 2MCNB 1KRHA 3W1SC 2ZNVB 3VTVA 2BS4B 1LO5D 2JWZA 2O6VD 4NAWA 4USAA 2ON8A 1R4NB 1SGHA 1GJZA 5HFYA 2KC2A 4ARCA 2DAFA 2AX5A 2WXNA 1J0GA 2WDRB 4S17A 1ET6A 1XCTL 5BMIA 2MBBB 2J0MA 1FCCC 5LXHA 1TZOA 2FIFA 2FUHB 3J9CA 3P63A 2MP2B 4FULA 4LLGM 2RR9A 2LXAA 3IVFA 2N0SB 3LB8C 2ZVNA 4GOCA 4IKGA 4MSMB 4C00A 2QSDA 5FKAC 4W9HA 1BXTA 4XDCA 2N9EB 3DWMA 4ARIA 3N30A 4K3BA 4US8A 2KX0A 2NMQA 2BYTA 1SF0A 3V62A 2NTSA 2FAZA 4B0EA 3AU5A 5IO9A 3T3NA 3DHIC 2BTEA 1IBXA 1SE4A 1A70A 2QEJC 2DX5B 3CIRB 2NPTB 1YJIA 4XZ4A 2Z0EB 1WZ3A 2K8HA 2LUMA 3PV1A 4IUMB 3UINB 1WMHA 5HHDG 1PGAA 3QQ8B 2L83A 3AEAB 1TBEA 4NY0A 2D3AA 1YNTE 5C2TB 4NPNA 4W9CA 1DOYA 3KYCD 2LMCA 1FCLA 1I4PA 2OEDA 4TQ0A 3I3TB 1TS5A 1I7HA 4BBNF 2Y5BB 2K1FA 3W5UB 4GDLA 2KNBA 5C23A 3VXWA 3BY4B 3GZNI 2W3RA 4FHKA 3U2SC 3GS2A 4OHJA 1SIFA 4W9JA 1C77A 5IAAC 3QA8A 3PLVA 3QX1A 2L1AA 2IGHA 4KV2A 3N1XC 1V8CA 4PS3A 1GNUA 4ZRIA 1ZPSA 3W2DA 3ZLZA 1KLVA 3Q8EA 4HPMB 1F0ZA 2GBRA 2LGIA 4IDIA 1D5ZC 2D3BA 2GMIC 1HEZE 3BWUD 4KGRA 1K8RB 1NI2A 1F9JA 1XCQL 3HIZA 4G50A 2J4XA 3DBLB 4FA6A 3AE3B 3DBHB 3MJWA 4YXDB 3P4QB 1OQQA 2RDBC 4ACFA 1MG8A 5JXVA 4JQWC 2PE6B 5IN7A 2JU6X 2FE8A 2L0FA 4M02A 5G5HA 2NBVB 2SEBD 2MWSB 4X57B 2E3TA 4WURA 4AJYB 3O13A 2V4IB 2KQSA 3ZO5B 4WH4A 2KDMA 4EE2A 4HVBA 5AZFA 4FJZA 1G6JA 5HKHA 2G4SA 2V0GA 4N6EB 2WXPA 1PUTA 1V1PB 3P2BA 2RMMA 2RD0A 3AI5A 1TJEA 3AE9B 3PRMB 1FD6A 3NVVA 1YQBA 3EFCA 5CHFA 4G0NB 4FXCA 3RCZA 5DPSA 1CK1A 3RYTA 3L54A 5H92C 1FNUA 4J3OD 4EFOA 2YLMA 2PVOD 3VUWA 1WE7A 1OGWA 1B1ZA 4NJ7A 4W9GA 1MJDA 2B3AA 4WWOA 2KC1A 5E6PA 3HVDA 3H7PA 3SFDB 1KF6B 3FILA 4GXBA 1ZW7A 4ANWA 1GB4A 3ZIMA 3PSEB 4S0RA 2KN5A 2LHEA 3ZXRA 2BB5A 2M8SA 2K8CA 5CTRC 1RRBA 4B95A 4DXAB 3NVZA 1EU4A 2NVUI 2X8XX 3W5VB 3R7QA 3PRZA 3VH4B 1P9DU 4E74A 4BKGA 1NBFC 2D2QA 1RWSA 3K9PB 1V9JA 4J6IA 3Q8CA 3ZNZB 1YX6B 2JYTA 4JL9A 4KGTA 1XLOA 1BT0A 1XF5L 3U4EG 1TYGB 3EFUA 4R3DA 1EO6A 1WGGA 4P16A 1WRDB 1NYQA 3RI7C 2MBQA 3Q8AA 1VR9A 2WXHA 4OZAA 2LFIA 4GU2A 2PW9A 2VRRB 3Q3NC 1FM0D 1AARA 2KMAA 2JUOA 5IKCM 3T8MA 3WIMA 1H8CA 2NR2A 4L23A 3ML9A 2KAJA 3DVGX 2K6DB 1L6VA 2OJRA 1I4GA 3R7RA 4RGOS 1C79A 4ANUA 1EF1A 2JSVX 4NQLB 4NAWB 2LEKA 2HJ1A 4AS1A 2ACZB 3GOEA 2WHIA 1ACCA 3FAHA 4EKUA 2DYMA 2LRWA 4MGYE 1T0YA 4YSXB 4ICVA 3NVWA 1I35A 1R7SA 3KYDD 1UWMA 1WRIA 4IW0A 3NVYA 4CYEA 2KVZA 2R61A 2ZPNA 1TS3A 2MJ3A 1WIAA 3RNBC 3E56A 3E9SA 4AJWA 4TV3A 4DHZE 1E0ZA 2MBOA 1V80A 2XN9C 3AV8A 2KJ6A 3ZJVA 2C9WB 1E8XA 2J42A 3P4SB 2A4ZA 4RGMA 1NYRA 3VR8B 1SBBB 2PIAA 2LVPA 4YTPB 3DDCB 1PGXA 1IBXB 5EE3A 3APDA 2BWFA 1SSNA 1JRUA 5JZEB 2AYOB 1HTQA 1XQQA 2KK8A 3ECIA 3U7ZA 5IA7A 4ZYNA 1WMHB 1C4PA 2MBEA 4K81A 3DVGY 1I4XA 3QWZB 3LYYA 1J8CA 3A33B 1YQ3B 1UNSA 5E6NA 1KTKA 1NVID 1N6ZA 3HHMA 2M19A 2IGGA 1SJED 4IOIE 3TBLD 4GDLB 4NAMA 1ESFA 3BIID 5LXIB 2IZVB 2LGSA 4M8NA 2IPKD 3APFA 5FR3A 2GI9A 1P7EA 4PYZA 2KO3A 3PZ8A 2PLPA 1M94A 3AE2B 4XWWA 2KDFB 1N5WA 3WAMA 4RF1A 3TUOA 1ZOYB 4HRSA 4JE3B 3FC4A 2J0KA 2KJHB 3MJ5A 4KZCA 1EM7A 1QOAA 4KIKB 1SIJA 1FIQA 4TSSA 2MBHA 1FMAD 3IFWB 1J7CA 2BS2B 4M0WA 3HM6X 1EU3A 4RM8A 4K7UA 3DQVA 2DYOA 1PQSA 4FLHA 4IWOA 2KD0A 4W9IA 1FXIA 2TSSA 4KSKC 2WQYB 3PHWB 2JX5A 2D5GA 3V6CB 1WGDA 2DZJA 5J17A 3HVZA 3QARA 4LTUA 2YVCA 2WXFA 1V86A 3ZNHB 4M8MA 3AE8B 1ZDXA 3AEEB 3A4SC 1T6BX 2QDFA 2MJDA 2ZNVC 2IY1B 1ZP0B 4KZ0A 1DOIA 2AQ2B 2JRHA 4MDKE 3GP7A 3DOWA 3RNAC 2WXJA 2XNAC 2BQQA 3JW0X 3VUXA 1GOZA 1WXSA 1YJ1A 3JYUA 2V3NA 2AWTA 2ASQA 3N20C 4RMAA 1L4DB 2ZZPB 1E5WA 4URKA 3ML8A 3PRPB 4EUTA 1J19A 3HK0A 4B0MA 4N58A 4BOSC 1N62A 5D94A 1WJNA 2KMMA 3H7PB 3FILB 2KOXA 2GBJA 2KANA 4DHZB 3I5JC 2A5UA 2L00B 5AUIA 2KDIA 3DBSA 1WM2A 1T0RC 2WWZA 3WCQA 2MA9B 4ZOHC 1RFAA 2IYDB 2INNE 5BMHA 2AEHA 2D10A 3KUZA 4DBGA 1V97A 3T3OA 1FEHA 1IPGA 3I9V1 5KHQA 1J7AA 5J18A 2PMVA 2R2OA 2K22A 1SB3C 3ZNID 2ZW1A 3Q3JA 3KH0A 3ZKJC 2XBBC 5T8IA 1F1HA 3ENEA 4RGTA 4GDKA 3JVZX 4W9EA 4YSYB 3ZYYX 1VLBA 1FNWA 1TKYA 4GB9A 1YN4A 2JXTA 3DCGA 1RFKA 2N9XA 1N61A 5EE9A 3V6EB 5D3IB 2CKHB 1WM3A 4MEMA 1T0QC 4I6LB 4EZKA 3C0RB 2DZMA 1F52A 3EUB2 2J7QB 2V4LA 4FADA 4I6NB 1TZ1A 1GC6A 1JWMD 1X1MA 2ZEQA 4WJPA 1K50A 3RULA 1M4VA 3NS1A 1HZ5A 1JWAD 3TEZA 4P1CC 1UGMA 2V9HA 1F2RI 2ZW0A 2M4NA 2AQ3B 4OVZA 3SU8X 2EKIA 4A9AA 3GB1A 2N7DA 1UGJA 2J0JA 4DWFA 3RNGC 5CX3A 3W9CB 5GMVA 2KMCA 2JQRB 4GGQA 2VH2A 2AQ1B 4MGKE 4XYCA 2CU3A 3VQIA 3UIOB 2LJIA 3MHZA 1GPXA 3RFZB 3KWLA 3ZTDA 2OHFA 1WJUA 4IM2A 3L13A 2PJHA 4EZJA 1EWYC 2C7MB 2KHWB 1A5RA 2WXMA 1GB1A 3ZJTA 3OLMD 2LXCA 3DBRB 3OJ3A 2WP9B 1PDXA 2HD5B 3M63B 4HKZE 4MSQB 1FPYA 1S3SG 1D6EC 1XD3B 2JRIB 1MHXA 4KDLB 4XE0A 4CO7A 1N5XA 4MH0E 3PREA 2N4FA 1KOTA 2WS3B 4KDIC 2KTFA 5C1ZA 1XXGA 3N9YC 2UYZB 2WDVB 1WYGA 2EKEC 5KHOA 4ANVA 3UQBA 2W82A 3NG0A 1K53A 3AE6B 2REXA 3JSVA 4HXDA 3R3MA 1WXQA 4JLCA 1R4MB 2CR5A 4DDID 1XT9B 3VH3B 2KLCA 4RCOA 2BBCA 4W9KA 4ZHOA 2G3QB 2K39A 1WX8A 3L0WB 1OEYJ 2LVQA 3NHEB 2CJNA 3AE4B 1WGRA 1SEBD 4LNNA 4HPLB 2Y5CA 3L08A 1WGHA 2IDYA 3PS6A 2UU7A 2V1YA 2BKFA 2ZVOA 3LXFA 1EF5A 3AEGB 2N7JA 4BKTA 2AL6A 4PT5A 4WJNA 4F1SA 4HK2A 4LJPB 1TKGA 2KN4A 1HQRD 3KLSX 4XDDA 2G45B 3K9OB 4Q2JA 2KFKA 1I4QA 4A3OA 4YTNB 3TCAA 3UF8A 3N32A 1YOVB 3NZ3A 4DQOC 3BVGA 3I57A 3NZSA 3AE7B 3CSTA 1GG3A 4LDTB 1QOGA 1WSPA 2BT6A 2G4DB 3BVZA 4P7IA 2HTHA 2KTRA 3O65B 4ZRKA 4M0WB 3KUDB 1DGJA 3AU4A 2JZPA 2W3SA 3R8BA 2LGXA 3NS8A 3AECB 2C7HA 3Q3FA 1KM7A 5LNK1 3ZJUA 3R2TA 3V05A 3VRBB 4JWSC 4WJQA 3GE8C 3AE1B 3A9KA 3OG5A 1N63A 1K51A 2NTTA 3CWIA 3Q69A 5AEKB 1CZPA 4D2KA 1EWCA 1MG4A 4HLEA 3L17A 1TTNA 1WXMA 2DNFA 1IP9A 3TIXA 3DWGC 4TUUA 4B6WA 2M0AA 3H9DA 1WE6A 3VVWB 4AP4C 4LNFA 2IO1B 3URYA 1AW7A 2D3GA 2WU2B 2HJ8A 1QF6A 3IT6B 3LDZE 1Y8RC 4HEA1 3RNCC 3Q2AC 3QC8B 3EC8A 1L0VB 4DXFA 3Q3MC 2JPHA 2IO3B 5DPTA 4W9DA 1B9RA 4H2AA 2R2QA 3TEYA 1L5PA 2KWVB 4UDUC 4C4VA 3PO0A 4BZAA 4IWQA 1ENFA 4AOFA 3SEBA 4DK5A 4WIPA 3P1MA 2HDEA 1FNVA 3MFGA 4XGAB 3PTFC 1WX7A 4XC2A 2QIEB 3ZTCA 1Z5SB 4MGIE 3VDZA 1Y56A 2H89B 4IM0A 4BBNC 5GXGB 2KWDA 2V3PA 3QCAA 2MLBA 2XK5A 2EELA 1RYJA 4DDGD 4WWPA 2SAKA 4GN1A 3FKYA 5BMGA 2N9KA 4ICUA 3OJ4B 3DHGC 2ZCBA 3SD5A 1P7FA 3QAQA 2CHWA 1V49A 2L05A 1P1AA 4GDKB 2CHZA 2N7EA 3TEXA 1XEEA 1AWDA 2D3CA 3RD2A 2K6QA 2VZKB 3X23A 4PK1A 3M95A 3SDLC 1YQ4B 1YIWA 1DYQA 3A4RA 3I63C 3TMPB 2I1KA 4OW0A 2O6VA 5JH5C 3BK2A 2ONQA 3W1SA 5IOIA 1V81A 2KKCA 4BOZB 3NRZA 2RPVA 2GOWA 3KQ4A 3DBLI 4II2B 2RPQA 5E6OA 4HDQA 2FNJB 2WDQB 2JXXA 2KWCA 1GC7A 1Z2MA 1C4AA 3AH7A 2BW2A 1TY2A 1JW9D 1LXDA 2BVCA 2L52A 1VZ7A 1QOFA 2FBWB 5D2MB 1XO3A 3ZDMC 2DLBA 4A20A 2WXOA 4KKJA 4JPSA 3AULA 1ZXIA 4W9LA 2MX2A 2IY0B 4HROA 1KH0A 1L7YA 2L76A 2W55A 4BAXA 3AN1A 2WXRA 3CF6E 3L4PA 3P4PB 3CSFA 3ONSA 3NJTA 1YD8U 1N60A 1LQBA 3C8YA 1E8YA 3IAM1 1E8ZA 4NQKE 3RZFA 3UQAA 4HPPA 4OZBA 2LD9A 1UZXB 4A90A 3BK1A 1YJJA 4YL8A 3M3JA 4NZLB 3B2GA 2LGDA 3DVNV 2PTLA 1KLUD 3NY5A 1WX9A 2Z59B 3BVMA 3QK0A 2N1WA 2JVCA 3ZRCA 1TKEA 2DAJA 1KJTA 2CJOA 3JSVB 5FK9C 1E7VA 3A9JA 4MH8A 1UBQA 2KWUB 2JY6A 5MPOA 3IBEA 4EEWA 4F8CB 5HI1A 1JMLA 2FCMA 1Q10A 5HG2A 3KWVA 2XEWA 4L2YA 2MRPA 3L10B 1JWSD 2RSUA 3V60A 3VRAB 2WXKA 2BKRB 1UWXA 3R2IA 2LWPA 2LUEA 4OZCA 3HM3A 2FCSA 3HUIA 1ZXHA 3RUIB 2DZIA 4M01A 1Q0WB 3GZNB 1U4AA 5TR5A 2KFKB 3RN9C 2C7NB 4ZYSA 3AEBB 4CQNA 1HE8A 2EMSA 3UGBB 2PKOA 3PLUA 5C3JB 4ZRJA 4A8XC 4IG7B 1OFFA 2AL3A 1RLFA 1K52A 3ETRA 1J7BA 2KX3A 2KTRB 1QILA 1WZ0A 5CHWA 5DPWA 1D5XC 4DXGA 4K1RB 4JWUC 2GRIA 3NUHB 4AUQC 1WH3A 3ZUNA 4BKSD 1FXAA 3B9JA 4KSLC 5G55A 2K25A 5AZHA 5DCNA 1T0SC 2Y5PA 3EHVA 3VUYA 4OVUA 3A9KB 1C1YB 2FCQA 3N3KB 4ZRQA 2NBUA 1ZUD2 4WWMA 1S1QB 4WQOB 4NJCA 4LJOB 2WXGA 1WR6E 1D5MC 2CS4A
chains in the Genus database with same CATH topology
2C60A 2Z0DB 3JSVA 1V9JA 4J6IA 3ZVVA 2GBKA 4FHJA 2IO0B 3R3MA 4HXDA 4JLCA 1V5TA 2CR5A 4DDID 1XT9B 3ZNZB 1YX6B 2NBWB 4TKNA 3RT3B 3VH3B 4EOYA 2KLCA 4JL9A 4K7SA 2MSED 4HCPB 1BT0A 5EDSA 3EFUA 1EO6A 2IO2B 1WGGA 4WWNA 2DYBA 2ZCCA 1WRDB 4W9KA 3H1UA 2G3QB 2K39A 2MBQA 1WX8A 3L0WB 2LZ6A 1OEYJ 4E3CA 1OQYA 4PS8A 4PS7A 3PHXB 3WANA 2LVQA 4K7WA 1LM8B 4FBJB 1H4RA 3NHEB 4GU2A 1WGRA 2VRRB 1AARA 2KMAA 2BYFA 4CHKA 2JUOA 4FJYA 1WJ6A 2ZJDA 1V5OA 2LJ5A 4HPLB 1UH6A 3MTNB 3D32A 5LLIA 3T8MA 3WIMA 3L08A 1H8CA 1WGHA 2NR2A 3ML9A 3DVGX 3PS6A 2V1YA 2K6DB 2MQJA 4GIVA 2JF5A 2BKFA 2ZVOA 1EF5A 1P3QU 2OJRA 4BKTA 2KDEB 3ALBA 2AL6A 4FJVB 4MGZE 4WJNA 4F1SA 4HK2A 2N1VA 3R7RA 3W1YA 4LJPB 2HE7A 4DHJB 4ANUA 4TQ1A 4ASWC 1EF1A 3X0WA 2G45B 2NS5A 3K9OB 3ZDTA 2KFKA 4NQLB 1RAXA 4NAWB 4A3OA 2DHZA 3TCAA 3UF8A 1P0RA 3N32A 3NOBA 2UWQA 3GOEA 2BPSA 3PGEA 3MHSD 2XK5B 3H6NA 3NZSA 3CSTA 1GG3A 2K8BA 3DVNU 4LDTB 4EKUA 2DYMA 3EECA 2G4DB 2JZ3B 2ZPYA 2LRWA 3B0AA 4P7IA 2L7RA 3L16A 2KFJA 2HTHA 4MGYE 5D6JB 2KTRA 3O65B 4ZRKA 3NZUA 1T0YA 4M0WB 1FXTB 3KUDB 2BYEA 3AU4A 1WYWB 4ICVA 2O2VB 4OVVA 1L2NA 1I35A 5J2RA 1WY8A 5BO4B 2WDTB 1E7UA 3KYDD 4HWIB 3ZW3A 4IW0A 4CYEA 5AZGA 4G3XB 2ZPNA 1WIAA 4AWJA 2BGFA 2LGXA 3KVFB 4AJWA 4II3B 3NS8A 3APCA 2GBMA 4TV3A 1SE9A 4WJOA 2NCNA 3WALA 4DHZE 2O6VB 2C7HA 2OOBB 3Q3FA 1KM7A 2LI5A 3TJPA 3DPDA 2MBOA 4WJQA 4JGHB 1V80A 4IWPA 2KJ6A 3A9KA 1GUAB 2C9WB 2M17A 1E8XA 5AEKB 1VD2A 2A4ZA 3QIJA 3WA0A 4HLEA 3AXCA 3BINA 3CMMB 3L17A 1TTNA 1WXMA 2LVPA 3DDCB 2BYVE 2DZKA 1IP9A 3TIXA 4TUUA 4B6WA 3U7DA 1UELA 1VCBA 3H9DA 2FCNA 1WE6A 4LCDE 4MELA 3VVWB 3WAOA 3APDA 4AP4C 1IYFA 2N9PC 2M0XA 3SHQA 2IO1B 2BWFA 1JRUA 4ZDVA 5JZEB 1E90A 1OEYA 2D3GA 1ZGUB 2AYOB 2LVOA 1XQQA 2KK8A 3ECIA 3VTWA 5IA7A 4XX5A 4DHJD 4ZYNA 2HJ8A 1WMHB 4MJSB 3LDZE 1Y8RC 2C5LC 2WX0A 1ISNA 3IG3A 2EMTA 1UBIA 2MBEA 1WJ4A 3QC8B 4K81A 4N9F4 3DVGY 3EC8A 5DPRA 4WAAA 3QWZB 4NNJB 2JPHA 2IO3B 1J8CA 5DPTA 3A33B 4W9DA 4LDTD 1WR1A 2R2QA 5E6NA 5L95C 2L0TA 3HHMA 2KWVB 3QHTA 5JHAA 4IWQA 4AOFA 3TBLD 2RGFA 4DK5A 4GDLB 1CMXB 2CHXA 5LXIB 2IZVB 4M8NA 3OAWA 3QJZA 3APFA 2V3SA 4MM3A 3A1QB 2CU1A 3PTFC 1WX7A 4PYZA 4XC2A 2KO3A 1WI0A 3ZTCA 1M94A 1Q1OA 4KIKA 1Z5SB 4W9FA 2KDFB 2MCNB 1V2YA 3W1SC 4MGIE 3WAMA 3VDZA 2ZNVB 3VTVA 2JWZA 2O6VD 4NAWA 4IM0A 2LRUA 1SGHA 4BBNC 2WYQA 2DENB 1GJZA 4I6PA 2KC2A 3B1LX 2J0KA 2DAFA 2KJHB 2MLBA 2XK5A 3QCAA 4G11A 1YX5B 4DDGD 1J0GA 4BVUC 4KZCA 2MBBB 4WWPA 5FR6A 4GN1A 4KIKB 2J0MA 5LXHA 2I1JA 1OTRB 2LASA 2MBHA 2FIFA 2FUHB 4ICUA 3IFWB 3OJ4B 4HJKA 3HM6X 2ZCBA 1WF9A 2MP2B 4RM8A 3SD5A 2O2VA 3QAQA 4FULA 4K7UA 2RR9A 2CHWA 1V49A 2DYOA 2L05A 3DQVA 1P1AA 2LXAA 4GDKB 3A9JB 1PQSA 3IVFA 2CHZA 2N7EA 4FLHA 2KD0A 4GSWA 2ZVNA 4IWOA 4W9IA 4GOCA 2D11A 3RD2A 2K6QA 3X23A 3M95A 3SDLC 3VHTC 4MSMB 4KSKC 1YIWA 3A4RA 4W9HA 2I1KA 3PHWB 2O6VA 3TMPB 5JH5C 2N9EB 1WGYA 1LFDA 1WGDA 3V6CB 4HCNB 3N30A 2DZJA 5J17A 3W1SA 1V81A 1R4NI 3QARA 3T9LA 4F7ZA 2KX0A 2KKCA 5JHBA 2YVCA 4BOZB 3V62A 2KQ7A 1C3TA 2GOWA 2FAZA 3DBLI 1V86A 3ZNHB 3AU5A 4M8MA 4II2B 2RPQA 5E6OA 2DX5B 4HDQA 3A4SC 2FNJB 2NPTB 4IM3A 2JXXA 2KWCA 4XZ4A 1GC7A 1Z2MA 2Z0EB 2ZNVC 1WZ3A 2K8HA 3RZWC 2IY1B 3PV1A 2KVRA 2L8JA 1LXDA 4IUMB 4KZ0A 3UINB 2KZRA 3PVLA 1P98A 5D2MB 1WMHA 2JRHA 4MDKE 2KDBA 3DOWA 2FIDA 4MJSA 5CHVC 3QQ8B 1E8WA 3JW0X 3ZDMC 3VUXA 1TBEA 4A20A 1WXSA 4NY0A 1YJ1A 3AULA 4NPNA 4W9CA 4W9LA 2MX2A 2IY0B 3KYCD 4E71A 3JYUA 2AWTA 4TQ0A 2ASQA 1L7YA 3I3TB 2L76A 4RMAA 2ZZPB 1E5WA 4A3PA 4ANXA 4BBNF 3WAPA 4FN2A 3ML8A 3PPAA 3PRPB 4URKA 2Y5BB 5G2NA 4EUTA 3B08A 3CF6E 1J19A 2K1FA 3CSFA 3HK0A 4BOSC 3R66C 2KNBA 1WJNA 3H7PB 3ONSA 4GDLA 5D94A 5C23A 3BY4B 3VXWA 2KOXA 3GZNI 2GBJA 4FHKA 1Q5WB 1YD8U 2KANA 5D7GA 4DHZB 1V6EA 1LQBA 3A1QA 1E8YA 1SIFA 2JZZA 4W9JA 2A5UA 5IAAC 3ZNGC 2L00B 3KUCB 3QA8A 2KDIA 3DBSA 1E8ZA 3PLVA 3QX1A 4NQKE 3RZFA 3UQAA 1WM2A 2PE9A 4KVGB 1WXAA 3U30A 4KV2A 2LD9A 1UZXB 2WWZA 4PS3A 1GNUA 2MA9B 1RFAA 4ZRIA 2IYDB 1NDDA 4YL8A 2AEHA 2D10A 3KUZA 3M3JA 4DBGA 1IPGA 5KHQA 3ZLZA 1KLVA 2LGDA 3DVNV 4HPMB 2GBRA 4HDOA 5J18A 2KXJA 3V61A 3NY5A 1TGZB 1WX9A 2WX1A 2Z59B 2R2OA 4GMVA 3QK0A 4BKSA 3ZNID 3DBRI 2GMIC 2N1WA 2JT4B 3KW5B 3Q3JA 4BFRA 3KH0A 2JVCA 3ZKJC 2XBBC 2MP2A 3ZRCA 2DAJA 1KJTA 3JSVB 1K8RB 3ENEA 1NI2A 4RM9A 1F9JA 4GDKA 1E7VA 3JVZX 3HIZA 4W9EA 3A9JA 4G50A 3PT2B 3S2AA 2W9NA 4FA6A 3LJ3A 1UBQA 2KWUB 2LGYA 1UD7A 4GB9A 1WFYA 2JY6A 2BWES 3DCGA 3MJWA 3IBEA 2N9XA 4EEWA 4F8CB 2MW5A 3V6EB 2CKHB 1MG8A 2FCMA 1WM3A 4MEMA 2GBNA 4JQWC 2PE6B 4I6LB 2L0FA 4EZKA 2NBVB 2XEWA 2MWSB 1I42A 4X57B 3C0RB 2DZMA 2MRPA 3L10B 3U8ZA 2J7QB 4B9KA 2V4LA 4FADA 1ZKHA 4AJYB 4I6NB 5L83A 1R4MI 1TZ1A 1GC6A 1X1MA 2KQSA 3ZO5B 2ZEQA 4WJPA 2RSUA 3RULA 4HVBA 3V60A 5AZFA 3ZRFA 4FJZA 2BKRB 2BF8B 1G6JA 5HKHA 1QZEA 2G4SA 2LWPA 2NPTA 2LUEA 3HM3A 1UGMA 2FCSA 3H7SA 3IHPC 3P2BA 2RD0A 3M62B 3RUIB 3AI5A 2DZIA 2M4NA 3TL5A 3PRMB 1Q0WB 4JIOU 3SU8X 1U4AA 4IC7B 5TR5A 2N7DA 1YQBA 2KFKB 5CHFA 4EZLA 2C7NB 2J0JA 3DBHI 1HE8A 2EMSA 4G0NB 4DWFA 3PZDA 3UGBB 5CX3A 2QHOA 4PYUA 3PLUA 2KMCA 5GMVA 4GGQA 3RCZA 5DPSA 4ZRJA 4IG7B 3RYTA 3L54A 4MGKE 2AL3A 1RLFA 2YLMA 3VQIA 3UIOB 4EFOA 3VUWA 1WE7A 1OGWA 3VAWA 3ZTDA 3VTUA 1WJUA 4NJ7A 2KX3A 2KTRB 4IM2A 4W9GA 2B3AA 3L13A 2KC1A 4WWOA 5E6PA 1WXVA 2PJHA 3H7PA 1WZ0A 4EZJA 5CHWA 5DPWA 4GXBA 4ANWA 1ZW7A 2C7MB 2KHWB 4K1RB 1A5RA 2IBIB 2D07B 3VFKA 3ZIMA 2PEAA 3OLMD 2LXCA 3OJ3A 3PSEB 1D3ZA 2HD5B 4AUQC 2KN5A 2PPHA 3M63B 1WH3A 3ZUNA 2KLGA 4KSLC 4BKSD 5G55A 4MSQB 2K25A 1S3SG 5AZHA 1XD3B 2M8SA 2JRIB 5DCNA 2K8CA 5CTRC 1RRBA 4KDLB 4NJ6A 2KJRA 4B95A 3EHVA 4CO7A 4DXAB 4MH0E 3PREA 3VUYA 2N4FA 1KOTA 4OVUA 3A9KB 4KDIC 2KTFA 1C1YB 5C1ZA 2NVUI 2FCQA 3N3KB 2UYZB 3R7QA 2NBUA 2L3ZA 2EKEC 3PRZA 5KHOA 3VH4B 1S1QB 1P9DU 4E74A 4BKGA 4ANVA 4WQOB 2M1MA 3UQBA 4LJOB 1EUVB 1NBFC 2D2QA 1WR6E 2CS4A 3K9PB 2REXA 3UIPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C60 A;  2Z0D B;  3JSV A;  1V9J A;  4J6I A;  3ZVV A;  2GBK A;  4FHJ A;  2IO0 B;  3R3M A;  4HXD A;  4JLC A;  1V5T A;  2CR5 A;  4DDI D;  1XT9 B;  3ZNZ B;  1YX6 B;  2NBW B;  4TKN A;  3RT3 B;  3VH3 B;  4EOY A;  2KLC A;  4JL9 A;  4K7S A;  2MSE D;  4HCP B;  1BT0 A;  5EDS A;  3EFU A;  1EO6 A;  2IO2 B;  1WGG A;  4WWN A;  2DYB A;  2ZCC A;  1WRD B;  4W9K A;  3H1U A;  2G3Q B;  2K39 A;  2MBQ A;  1WX8 A;  3L0W B;  2LZ6 A;  1OEY J;  4E3C A;  1OQY A;  4PS8 A;  4PS7 A;  3PHX B;  3WAN A;  2LVQ A;  4K7W A;  1LM8 B;  4FBJ B;  1H4R A;  3NHE B;  4GU2 A;  1WGR A;  2VRR B;  1AAR A;  2KMA A;  2BYF A;  4CHK A;  2JUO A;  4FJY A;  1WJ6 A;  2ZJD A;  1V5O A;  2LJ5 A;  4HPL B;  1UH6 A;  3MTN B;  3D32 A;  5LLI A;  3T8M A;  3WIM A;  3L08 A;  1H8C A;  1WGH A;  2NR2 A;  3ML9 A;  3DVG X;  3PS6 A;  2V1Y A;  2K6D B;  2MQJ A;  4GIV A;  2JF5 A;  2BKF A;  2ZVO A;  1EF5 A;  1P3Q U;  2OJR A;  4BKT A;  2KDE B;  3ALB A;  2AL6 A;  4FJV B;  4MGZ E;  4WJN A;  4F1S A;  4HK2 A;  2N1V A;  3R7R A;  3W1Y A;  4LJP B;  2HE7 A;  4DHJ B;  4ANU A;  4TQ1 A;  4ASW C;  1EF1 A;  3X0W A;  2G45 B;  2NS5 A;  3K9O B;  3ZDT A;  2KFK A;  4NQL B;  1RAX A;  4NAW B;  4A3O A;  2DHZ A;  3TCA A;  3UF8 A;  1P0R A;  3N32 A;  3NOB A;  2UWQ A;  3GOE A;  2BPS A;  3PGE A;  3MHS D;  2XK5 B;  3H6N A;  3NZS A;  3CST A;  1GG3 A;  2K8B A;  3DVN U;  4LDT B;  4EKU A;  2DYM A;  3EEC A;  2G4D B;  2JZ3 B;  2ZPY A;  2LRW A;  3B0A A;  4P7I A;  2L7R A;  3L16 A;  2KFJ A;  2HTH A;  4MGY E;  5D6J B;  2KTR A;  3O65 B;  4ZRK A;  3NZU A;  1T0Y A;  4M0W B;  1FXT B;  3KUD B;  2BYE A;  3AU4 A;  1WYW B;  4ICV A;  2O2V B;  4OVV A;  1L2N A;  1I35 A;  5J2R A;  1WY8 A;  5BO4 B;  2WDT B;  1E7U A;  3KYD D;  4HWI B;  3ZW3 A;  4IW0 A;  4CYE A;  5AZG A;  4G3X B;  2ZPN A;  1WIA A;  4AWJ A;  2BGF A;  2LGX A;  3KVF B;  4AJW A;  4II3 B;  3NS8 A;  3APC A;  2GBM A;  4TV3 A;  1SE9 A;  4WJO A;  2NCN A;  3WAL A;  4DHZ E;  2O6V B;  2C7H A;  2OOB B;  3Q3F A;  1KM7 A;  2LI5 A;  3TJP A;  3DPD A;  2MBO A;  4WJQ A;  4JGH B;  1V80 A;  4IWP A;  2KJ6 A;  3A9K A;  1GUA B;  2C9W B;  2M17 A;  1E8X A;  5AEK B;  1VD2 A;  2A4Z A;  3QIJ A;  3WA0 A;  4HLE A;  3AXC A;  3BIN A;  3CMM B;  3L17 A;  1TTN A;  1WXM A;  2LVP A;  3DDC B;  2BYV E;  2DZK A;  1IP9 A;  3TIX A;  4TUU A;  4B6W A;  3U7D A;  1UEL A;  1VCB A;  3H9D A;  2FCN A;  1WE6 A;  4LCD E;  4MEL A;  3VVW B;  3WAO A;  3APD A;  4AP4 C;  1IYF A;  2N9P C;  2M0X A;  3SHQ A;  2IO1 B;  2BWF A;  1JRU A;  4ZDV A;  5JZE B;  1E90 A;  1OEY A;  2D3G A;  1ZGU B;  2AYO B;  2LVO A;  1XQQ A;  2KK8 A;  3ECI A;  3VTW A;  5IA7 A;  4XX5 A;  4DHJ D;  4ZYN A;  2HJ8 A;  1WMH B;  4MJS B;  3LDZ E;  1Y8R C;  2C5L C;  2WX0 A;  1ISN A;  3IG3 A;  2EMT A;  1UBI A;  2MBE A;  1WJ4 A;  3QC8 B;  4K81 A;  4N9F 4;  3DVG Y;  3EC8 A;  5DPR A;  4WAA A;  3QWZ B;  4NNJ B;  2JPH A;  2IO3 B;  1J8C A;  5DPT A;  3A33 B;  4W9D A;  4LDT D;  1WR1 A;  2R2Q A;  5E6N A;  5L95 C;  2L0T A;  3HHM A;  2KWV B;  3QHT A;  5JHA A;  4IWQ A;  4AOF A;  3TBL D;  2RGF A;  4DK5 A;  4GDL B;  1CMX B;  2CHX A;  5LXI B;  2IZV B;  4M8N A;  3OAW A;  3QJZ A;  3APF A;  2V3S A;  4MM3 A;  3A1Q B;  2CU1 A;  3PTF C;  1WX7 A;  4PYZ A;  4XC2 A;  2KO3 A;  1WI0 A;  3ZTC A;  1M94 A;  1Q1O A;  4KIK A;  1Z5S B;  4W9F A;  2KDF B;  2MCN B;  1V2Y A;  3W1S C;  4MGI E;  3WAM A;  3VDZ A;  2ZNV B;  3VTV A;  2JWZ A;  2O6V D;  4NAW A;  4IM0 A;  2LRU A;  1SGH A;  4BBN C;  2WYQ A;  2DEN B;  1GJZ A;  4I6P A;  2KC2 A;  3B1L X;  2J0K A;  2DAF A;  2KJH B;  2MLB A;  2XK5 A;  3QCA A;  4G11 A;  1YX5 B;  4DDG D;  1J0G A;  4BVU C;  4KZC A;  2MBB B;  4WWP A;  5FR6 A;  4GN1 A;  4KIK B;  2J0M A;  5LXH A;  2I1J A;  1OTR B;  2LAS A;  2MBH A;  2FIF A;  2FUH B;  4ICU A;  3IFW B;  3OJ4 B;  4HJK A;  3HM6 X;  2ZCB A;  1WF9 A;  2MP2 B;  4RM8 A;  3SD5 A;  2O2V A;  3QAQ A;  4FUL A;  4K7U A;  2RR9 A;  2CHW A;  1V49 A;  2DYO A;  2L05 A;  3DQV A;  1P1A A;  2LXA A;  4GDK B;  3A9J B;  1PQS A;  3IVF A;  2CHZ A;  2N7E A;  4FLH A;  2KD0 A;  4GSW A;  2ZVN A;  4IWO A;  4W9I A;  4GOC A;  2D11 A;  3RD2 A;  2K6Q A;  3X23 A;  3M95 A;  3SDL C;  3VHT C;  4MSM B;  4KSK C;  1YIW A;  3A4R A;  4W9H A;  2I1K A;  3PHW B;  2O6V A;  3TMP B;  5JH5 C;  2N9E B;  1WGY A;  1LFD A;  1WGD A;  3V6C B;  4HCN B;  3N30 A;  2DZJ A;  5J17 A;  3W1S A;  1V81 A;  1R4N I;  3QAR A;  3T9L A;  4F7Z A;  2KX0 A;  2KKC A;  5JHB A;  2YVC A;  4BOZ B;  3V62 A;  2KQ7 A;  1C3T A;  2GOW A;  2FAZ A;  3DBL I;  1V86 A;  3ZNH B;  3AU5 A;  4M8M A;  4II2 B;  2RPQ A;  5E6O A;  2DX5 B;  4HDQ A;  3A4S C;  2FNJ B;  2NPT B;  4IM3 A;  2JXX A;  2KWC A;  4XZ4 A;  1GC7 A;  1Z2M A;  2Z0E B;  2ZNV C;  1WZ3 A;  2K8H A;  3RZW C;  2IY1 B;  3PV1 A;  2KVR A;  2L8J A;  1LXD A;  4IUM B;  4KZ0 A;  3UIN B;  2KZR A;  3PVL A;  1P98 A;  5D2M B;  1WMH A;  2JRH A;  4MDK E;  2KDB A;  3DOW A;  2FID A;  4MJS A;  5CHV C;  3QQ8 B;  1E8W A;  3JW0 X;  3ZDM C;  3VUX A;  1TBE A;  4A20 A;  1WXS A;  4NY0 A;  1YJ1 A;  3AUL A;  4NPN A;  4W9C A;  4W9L A;  2MX2 A;  2IY0 B;  3KYC D;  4E71 A;  3JYU A;  2AWT A;  4TQ0 A;  2ASQ A;  1L7Y A;  3I3T B;  2L76 A;  4RMA A;  2ZZP B;  1E5W A;  4A3P A;  4ANX A;  4BBN F;  3WAP A;  4FN2 A;  3ML8 A;  3PPA A;  3PRP B;  4URK A;  2Y5B B;  5G2N A;  4EUT A;  3B08 A;  3CF6 E;  1J19 A;  2K1F A;  3CSF A;  3HK0 A;  4BOS C;  3R66 C;  2KNB A;  1WJN A;  3H7P B;  3ONS A;  4GDL A;  5D94 A;  5C23 A;  3BY4 B;  3VXW A;  2KOX A;  3GZN I;  2GBJ A;  4FHK A;  1Q5W B;  1YD8 U;  2KAN A;  5D7G A;  4DHZ B;  1V6E A;  1LQB A;  3A1Q A;  1E8Y A;  1SIF A;  2JZZ A;  4W9J A;  2A5U A;  5IAA C;  3ZNG C;  2L00 B;  3KUC B;  3QA8 A;  2KDI A;  3DBS A;  1E8Z A;  3PLV A;  3QX1 A;  4NQK E;  3RZF A;  3UQA A;  1WM2 A;  2PE9 A;  4KVG B;  1WXA A;  3U30 A;  4KV2 A;  2LD9 A;  1UZX B;  2WWZ A;  4PS3 A;  1GNU A;  2MA9 B;  1RFA A;  4ZRI A;  2IYD B;  1NDD A;  4YL8 A;  2AEH A;  2D10 A;  3KUZ A;  3M3J A;  4DBG A;  1IPG A;  5KHQ A;  3ZLZ A;  1KLV A;  2LGD A;  3DVN V;  4HPM B;  2GBR A;  4HDO A;  5J18 A;  2KXJ A;  3V61 A;  3NY5 A;  1TGZ B;  1WX9 A;  2WX1 A;  2Z59 B;  2R2O A;  4GMV A;  3QK0 A;  4BKS A;  3ZNI D;  3DBR I;  2GMI C;  2N1W A;  2JT4 B;  3KW5 B;  3Q3J A;  4BFR A;  3KH0 A;  2JVC A;  3ZKJ C;  2XBB C;  2MP2 A;  3ZRC A;  2DAJ A;  1KJT A;  3JSV B;  1K8R B;  3ENE A;  1NI2 A;  4RM9 A;  1F9J A;  4GDK A;  1E7V A;  3JVZ X;  3HIZ A;  4W9E A;  3A9J A;  4G50 A;  3PT2 B;  3S2A A;  2W9N A;  4FA6 A;  3LJ3 A;  1UBQ A;  2KWU B;  2LGY A;  1UD7 A;  4GB9 A;  1WFY A;  2JY6 A;  2BWE S;  3DCG A;  3MJW A;  3IBE A;  2N9X A;  4EEW A;  4F8C B;  2MW5 A;  3V6E B;  2CKH B;  1MG8 A;  2FCM A;  1WM3 A;  4MEM A;  2GBN A;  4JQW C;  2PE6 B;  4I6L B;  2L0F A;  4EZK A;  2NBV B;  2XEW A;  2MWS B;  1I42 A;  4X57 B;  3C0R B;  2DZM A;  2MRP A;  3L10 B;  3U8Z A;  2J7Q B;  4B9K A;  2V4L A;  4FAD A;  1ZKH A;  4AJY B;  4I6N B;  5L83 A;  1R4M I;  1TZ1 A;  1GC6 A;  1X1M A;  2KQS A;  3ZO5 B;  2ZEQ A;  4WJP A;  2RSU A;  3RUL A;  4HVB A;  3V60 A;  5AZF A;  3ZRF A;  4FJZ A;  2BKR B;  2BF8 B;  1G6J A;  5HKH A;  1QZE A;  2G4S A;  2LWP A;  2NPT A;  2LUE A;  3HM3 A;  1UGM A;  2FCS A;  3H7S A;  3IHP C;  3P2B A;  2RD0 A;  3M62 B;  3RUI B;  3AI5 A;  2DZI A;  2M4N A;  3TL5 A;  3PRM B;  1Q0W B;  4JIO U;  3SU8 X;  1U4A A;  4IC7 B;  5TR5 A;  2N7D A;  1YQB A;  2KFK B;  5CHF A;  4EZL A;  2C7N B;  2J0J A;  3DBH I;  1HE8 A;  2EMS A;  4G0N B;  4DWF A;  3PZD A;  3UGB B;  5CX3 A;  2QHO A;  4PYU A;  3PLU A;  2KMC A;  5GMV A;  4GGQ A;  3RCZ A;  5DPS A;  4ZRJ A;  4IG7 B;  3RYT A;  3L54 A;  4MGK E;  2AL3 A;  1RLF A;  2YLM A;  3VQI A;  3UIO B;  4EFO A;  3VUW A;  1WE7 A;  1OGW A;  3VAW A;  3ZTD A;  3VTU A;  1WJU A;  4NJ7 A;  2KX3 A;  2KTR B;  4IM2 A;  4W9G A;  2B3A A;  3L13 A;  2KC1 A;  4WWO A;  5E6P A;  1WXV A;  2PJH A;  3H7P A;  1WZ0 A;  4EZJ A;  5CHW A;  5DPW A;  4GXB A;  4ANW A;  1ZW7 A;  2C7M B;  2KHW B;  4K1R B;  1A5R A;  2IBI B;  2D07 B;  3VFK A;  3ZIM A;  2PEA A;  3OLM D;  2LXC A;  3OJ3 A;  3PSE B;  1D3Z A;  2HD5 B;  4AUQ C;  2KN5 A;  2PPH A;  3M63 B;  1WH3 A;  3ZUN A;  2KLG A;  4KSL C;  4BKS D;  5G55 A;  4MSQ B;  2K25 A;  1S3S G;  5AZH A;  1XD3 B;  2M8S A;  2JRI B;  5DCN A;  2K8C A;  5CTR C;  1RRB A;  4KDL B;  4NJ6 A;  2KJR A;  4B95 A;  3EHV A;  4CO7 A;  4DXA B;  4MH0 E;  3PRE A;  3VUY A;  2N4F A;  1KOT A;  4OVU A;  3A9K B;  4KDI C;  2KTF A;  1C1Y B;  5C1Z A;  2NVU I;  2FCQ A;  3N3K B;  2UYZ B;  3R7Q A;  2NBU A;  2L3Z A;  2EKE C;  3PRZ A;  5KHO A;  3VH4 B;  1S1Q B;  1P9D U;  4E74 A;  4BKG A;  4ANV A;  4WQO B;  2M1M A;  3UQB A;  4LJO B;  1EUV B;  1NBF C;  2D2Q A;  1WR6 E;  2CS4 A;  3K9P B;  2REX A;  3UIP B; 
#chains in the Genus database with same CATH topology
 2Z0D B;  2FUG 1;  2IO0 B;  2NBW B;  2BB6 A;  3RT3 B;  3AM9 A;  3RPF C;  4K7S A;  3IXS A;  3DHH C;  2INC C;  2IO2 B;  2DYB A;  4YSZ B;  2W54 A;  3H1U A;  1XLP A;  2INP E;  3OWE B;  3WAN A;  1LM8 B;  1SE2 A;  1NI3 A;  4C4V B;  1WJ6 A;  5LLI A;  2LJ5 A;  1UH6 A;  3D32 A;  5EE1 A;  1QLB B;  1NEN B;  2KDE B;  3ALB A;  1T3Q A;  2N1V A;  4DHJ B;  4TQ1 A;  4ASW C;  3X0W A;  1RAX A;  5AUK A;  1VZ6 A;  2DHZ A;  3ZQ4 A;  1P0R A;  2IGD A;  3NOB A;  2UWQ A;  2BPS A;  3PGE A;  2XK5 B;  3H6N A;  2K8B A;  3DVN U;  4KX6 B;  3EEC A;  4YT0 B;  2JZ3 B;  2ZPY A;  3B0A A;  2L7R A;  2QJL A;  5D6J B;  1UUP A;  1FXT B;  2BYE A;  2WXQ A;  1L2N A;  1JRP A;  5BO4 B;  5I4D A;  1E7U A;  4HWI B;  4RF0 A;  1JCK B;  5AZG A;  4G3X B;  2BGF A;  3AEF B;  1L0X B;  3H8H A;  2NCN A;  2O6V B;  2OOB B;  2X38 A;  3DPD A;  4IWP A;  3UI3 A;  3TEW A;  1VD2 A;  3QIJ A;  2E6X A;  3BIN A;  3CMM B;  2BYV E;  2DZK A;  2WGS A;  3U7D A;  1QT9 A;  4MEL A;  3SHQ A;  2M0X A;  3MC8 A;  4ZDV A;  1E90 A;  1OEY A;  2LVO A;  3IAS 1;  3VTW A;  1MFW A;  2RDH A;  1HZ6 A;  2WX0 A;  2C5L C;  2YEP F;  1ISN A;  3MC9 A;  3IG3 A;  1WJ4 A;  1I4H A;  4N9F 4;  5DPR A;  4ZHP A;  1NEK B;  3SR6 A;  4NNJ B;  2PVG C;  3AE5 B;  4LDT D;  1MHH E;  1JAL A;  1TS2 A;  3QHT A;  3ABV B;  5EE0 A;  2N9L A;  4REZ A;  4WAF A;  2CHX A;  3QJZ A;  3ZXV A;  2V3S A;  4MM3 A;  1VRA B;  1ZE3 D;  4K3C A;  4ZRP A;  1HTO A;  1STE A;  2I2Y A;  1Q1O A;  4KIK A;  2L32 A;  1V2Y A;  2LRU A;  2WYQ A;  2DEN B;  4I6P A;  3B1L X;  4LNI A;  2MEK A;  4G11 A;  1RM6 C;  1YX5 B;  3BYT B;  4BVU C;  1WWT A;  5FR6 A;  2I1J A;  1OTR B;  2LAS A;  5BYQ A;  2G1E A;  4HJG E;  2J53 A;  4N59 A;  4HJK A;  1PYW D;  1E6E B;  1SE3 A;  1WF9 A;  1HXY D;  2O2V A;  4RH6 A;  1UF0 A;  1XLN A;  1C9F A;  3A9J B;  1FRR A;  4GSW A;  2D11 A;  3VR9 B;  3BZD B;  1T5X D;  3VHT C;  1JWB D;  2DBY A;  1WGY A;  1LFD A;  1PGB A;  3TSS A;  4HCN B;  1R4N I;  4YWG G;  3T9L A;  4F7Z A;  5JHB A;  1E7P B;  2B76 B;  1VZ8 A;  2KQ7 A;  1C3T A;  2WNM A;  2I38 A;  1E9M A;  4IM3 A;  2WU5 B;  3RZW C;  2KVR A;  2L8J A;  3RNE C;  2KZR A;  3PVL A;  1P98 A;  2KDB A;  4MJS A;  1MVK A;  2FID A;  3ZGZ A;  5CHV C;  1E8W A;  1TT5 B;  1ZDV A;  4M00 A;  2K9X A;  4E71 A;  1FO4 A;  2H88 B;  1MPE A;  1JQ4 A;  1ET9 A;  1KLG D;  4A3P A;  4ANX A;  3WAP A;  2IND C;  4FN2 A;  3PPA A;  1QKZ A;  5G2N A;  3B08 A;  5TSS A;  1XLQ A;  4LNO A;  4MT5 A;  5D3D A;  3R66 C;  4ITK A;  2DWQ A;  1Q5W B;  5D7G A;  1SJH D;  1QQR A;  1V6E A;  3A1Q A;  2JZZ A;  3ZNG C;  1WGK A;  3P4R B;  3KUC B;  2J52 A;  2VZK D;  2PE9 A;  4KVG B;  1WXA A;  5H8Y E;  3U30 A;  1GAQ B;  1NDD A;  1IUE A;  1L0Y B;  2K0P A;  4HDO A;  4A55 A;  2KXJ A;  3V61 A;  1TGZ B;  2WX1 A;  1LGR A;  4GMV A;  4BKS A;  3DBR I;  2JT4 B;  3KW5 B;  4BFR A;  2MP2 A;  4RM9 A;  3BYY B;  3PT2 B;  3P42 A;  3S2A A;  2W9N A;  3LJ3 A;  3HRD D;  2LGY A;  1UD7 A;  1WFY A;  2BWE S;  5E6J A;  2K3U A;  1DOX A;  2MW5 A;  3Q3O C;  3IT4 B;  2GBN A;  3MP9 A;  4QAY A;  1I42 A;  2GB1 A;  4B9K A;  3U8Z A;  4KGS A;  4C80 A;  1ZKH A;  5L83 A;  1R4M I;  1C4C A;  1CJE A;  3ZRF A;  2BF8 B;  1TS4 A;  1QZE A;  2NPT A;  3PZ7 A;  3N1Y C;  3H7S A;  3IHP C;  4C7Z A;  1C78 A;  3M62 B;  4RFB A;  1AYF A;  3Q6B A;  3V3X A;  3TL5 A;  4JIO U;  2QCZ A;  4IC7 B;  2QMT A;  4EZL A;  4XWT A;  1YN3 A;  3DBH I;  2KYW A;  3PZD A;  2QHO A;  4PYU A;  4O1N A;  2WXL A;  1F2R C;  1OQR A;  3VAW A;  3VTU A;  3RNF C;  1WXV A;  2JYE A;  2WXI A;  4GLS C;  2WLB A;  2IBI B;  2D07 B;  3VFK A;  4US9 A;  1F77 A;  2PEA A;  1D3Z A;  2PPH A;  5BYS A;  2KLG A;  2MHJ A;  1L6U A;  2YEP B;  4NJ6 A;  2KJR A;  4WQM A;  2KAC A;  1IGD A;  2L3Z A;  1YN5 A;  3AMZ A;  2M1M A;  1VJK A;  1EUV B;  2QC8 A;  2Y3A A;  1ROE A;  2MH7 A;  2C60 A;  3UIP B;  3ZVV A;  1YMH E;  2GBK A;  4FHJ A;  1IGC A;  1BML C;  4TMA B;  4YTM B;  1V5T A;  2GLS A;  4TKN A;  4EOY A;  4AQ7 A;  1VDV A;  1CQV A;  1FFU A;  2JWU A;  2K5P A;  2MSE D;  4HCP B;  5EDS A;  2HTM E;  1QOB A;  4WWN A;  2ZCC A;  4RNA A;  5IP4 D;  2BS3 B;  1FRD A;  4E3C A;  2LZ6 A;  3Q8B A;  1OQY A;  4PS8 A;  1TY0 A;  4PS7 A;  3PHX B;  2RDG A;  1PFD A;  4K7W A;  2MJE A;  4FBJ B;  1H4R A;  4A6Q A;  3AED B;  4CHK A;  2BYF A;  4FJY A;  2ZJD A;  1V5O A;  1TIF A;  3SFE B;  3MTN B;  4KKI A;  1JRO A;  2MQJ A;  4GIV A;  1V1P A;  2JF5 A;  4MM3 B;  4L1B A;  4RGN A;  1P3Q U;  2M56 B;  4FJV B;  4MGZ E;  3W1Y A;  2HE7 A;  2Z8L A;  2NS5 A;  2ICI A;  3ZDT A;  1SXT A;  3MHS D;  4C56 C;  4C7Y A;  3C19 A;  3L16 A;  2KFJ A;  2LHD A;  2QIL A;  3NZU A;  1V1O A;  1MI0 A;  1WYW B;  2VH1 A;  2O2V B;  4OVV A;  5J2R A;  1WY8 A;  2IJ0 A;  3U52 E;  2WDT B;  3ZW3 A;  3N1Z C;  1L4Z B;  3EGR A;  4AWJ A;  3MC0 B;  3KVF B;  3GE3 C;  4II3 B;  3APC A;  2GBM A;  1SE9 A;  4WJO A;  3WAL A;  3TJP A;  2LI5 A;  5BYR A;  4JX1 C;  4JGH B;  1I4R A;  1HA5 A;  1GUA B;  2M17 A;  1E10 A;  4P6V F;  3WA0 A;  1KFY B;  3AXC A;  1D4B A;  3AB5 A;  4LK0 M;  2OJW A;  1UEL A;  1VCB A;  3WAO A;  2FCN A;  4LCD E;  1IYF A;  2N9P C;  3Q14 C;  1ZGU B;  4HKQ A;  4XX5 A;  4DHJ D;  2KQ4 X;  4MJS B;  2G9H D;  4P1B C;  5G5G A;  3B2F A;  1AN8 A;  2EMT A;  1FFV A;  1UBI A;  1BUI C;  4MAC A;  1C76 A;  4WAA A;  2Q5W D;  2KT7 A;  1WR1 A;  5L95 C;  2L0T A;  3Q8F A;  4LNK A;  1JWU D;  5JHA A;  3EA6 A;  2RGF A;  1CMX B;  3OAW A;  3A1Q B;  2CU1 A;  3RMK C;  1WI0 A;  4W9F A;  2MCN B;  1KRH A;  3W1S C;  2ZNV B;  3VTV A;  2BS4 B;  1LO5 D;  2JWZ A;  2O6V D;  4NAW A;  4USA A;  2ON8 A;  1R4N B;  1SGH A;  1GJZ A;  5HFY A;  2KC2 A;  4ARC A;  2DAF A;  2AX5 A;  2WXN A;  1J0G A;  2WDR B;  4S17 A;  1ET6 A;  1XCT L;  5BMI A;  2MBB B;  2J0M A;  1FCC C;  5LXH A;  1TZO A;  2FIF A;  2FUH B;  3J9C A;  3P63 A;  2MP2 B;  4FUL A;  4LLG M;  2RR9 A;  2LXA A;  3IVF A;  2N0S B;  3LB8 C;  2ZVN A;  4GOC A;  4IKG A;  4MSM B;  4C00 A;  2QSD A;  5FKA C;  4W9H A;  1BXT A;  4XDC A;  2N9E B;  3DWM A;  4ARI A;  3N30 A;  4K3B A;  4US8 A;  2KX0 A;  2NMQ A;  2BYT A;  1SF0 A;  3V62 A;  2NTS A;  2FAZ A;  4B0E A;  3AU5 A;  5IO9 A;  3T3N A;  3DHI C;  2BTE A;  1IBX A;  1SE4 A;  1A70 A;  2QEJ C;  2DX5 B;  3CIR B;  2NPT B;  1YJI A;  4XZ4 A;  2Z0E B;  1WZ3 A;  2K8H A;  2LUM A;  3PV1 A;  4IUM B;  3UIN B;  1WMH A;  5HHD G;  1PGA A;  3QQ8 B;  2L83 A;  3AEA B;  1TBE A;  4NY0 A;  2D3A A;  1YNT E;  5C2T B;  4NPN A;  4W9C A;  1DOY A;  3KYC D;  2LMC A;  1FCL A;  1I4P A;  2OED A;  4TQ0 A;  3I3T B;  1TS5 A;  1I7H A;  4BBN F;  2Y5B B;  2K1F A;  3W5U B;  4GDL A;  2KNB A;  5C23 A;  3VXW A;  3BY4 B;  3GZN I;  2W3R A;  4FHK A;  3U2S C;  3GS2 A;  4OHJ A;  1SIF A;  4W9J A;  1C77 A;  5IAA C;  3QA8 A;  3PLV A;  3QX1 A;  2L1A A;  2IGH A;  4KV2 A;  3N1X C;  1V8C A;  4PS3 A;  1GNU A;  4ZRI A;  1ZPS A;  3W2D A;  3ZLZ A;  1KLV A;  3Q8E A;  4HPM B;  1F0Z A;  2GBR A;  2LGI A;  4IDI A;  1D5Z C;  2D3B A;  2GMI C;  1HEZ E;  3BWU D;  4KGR A;  1K8R B;  1NI2 A;  1F9J A;  1XCQ L;  3HIZ A;  4G50 A;  2J4X A;  3DBL B;  4FA6 A;  3AE3 B;  3DBH B;  3MJW A;  4YXD B;  3P4Q B;  1OQQ A;  2RDB C;  4ACF A;  1MG8 A;  5JXV A;  4JQW C;  2PE6 B;  5IN7 A;  2JU6 X;  2FE8 A;  2L0F A;  4M02 A;  5G5H A;  2NBV B;  2SEB D;  2MWS B;  4X57 B;  2E3T A;  4WUR A;  4AJY B;  3O13 A;  2V4I B;  2KQS A;  3ZO5 B;  4WH4 A;  2KDM A;  4EE2 A;  4HVB A;  5AZF A;  4FJZ A;  1G6J A;  5HKH A;  2G4S A;  2V0G A;  4N6E B;  2WXP A;  1PUT A;  1V1P B;  3P2B A;  2RMM A;  2RD0 A;  3AI5 A;  1TJE A;  3AE9 B;  3PRM B;  1FD6 A;  3NVV A;  1YQB A;  3EFC A;  5CHF A;  4G0N B;  4FXC A;  3RCZ A;  5DPS A;  1CK1 A;  3RYT A;  3L54 A;  5H92 C;  1FNU A;  4J3O D;  4EFO A;  2YLM A;  2PVO D;  3VUW A;  1WE7 A;  1OGW A;  1B1Z A;  4NJ7 A;  4W9G A;  1MJD A;  2B3A A;  4WWO A;  2KC1 A;  5E6P A;  3HVD A;  3H7P A;  3SFD B;  1KF6 B;  3FIL A;  4GXB A;  1ZW7 A;  4ANW A;  1GB4 A;  3ZIM A;  3PSE B;  4S0R A;  2KN5 A;  2LHE A;  3ZXR A;  2BB5 A;  2M8S A;  2K8C A;  5CTR C;  1RRB A;  4B95 A;  4DXA B;  3NVZ A;  1EU4 A;  2NVU I;  2X8X X;  3W5V B;  3R7Q A;  3PRZ A;  3VH4 B;  1P9D U;  4E74 A;  4BKG A;  1NBF C;  2D2Q A;  1RWS A;  3K9P B;  1V9J A;  4J6I A;  3Q8C A;  3ZNZ B;  1YX6 B;  2JYT A;  4JL9 A;  4KGT A;  1XLO A;  1BT0 A;  1XF5 L;  3U4E G;  1TYG B;  3EFU A;  4R3D A;  1EO6 A;  1WGG A;  4P16 A;  1WRD B;  1NYQ A;  3RI7 C;  2MBQ A;  3Q8A A;  1VR9 A;  2WXH A;  4OZA A;  2LFI A;  4GU2 A;  2PW9 A;  2VRR B;  3Q3N C;  1FM0 D;  1AAR A;  2KMA A;  2JUO A;  5IKC M;  3T8M A;  3WIM A;  1H8C A;  2NR2 A;  4L23 A;  3ML9 A;  2KAJ A;  3DVG X;  2K6D B;  1L6V A;  2OJR A;  1I4G A;  3R7R A;  4RGO S;  1C79 A;  4ANU A;  1EF1 A;  2JSV X;  4NQL B;  4NAW B;  2LEK A;  2HJ1 A;  4AS1 A;  2ACZ B;  3GOE A;  2WHI A;  1ACC A;  3FAH A;  4EKU A;  2DYM A;  2LRW A;  4MGY E;  1T0Y A;  4YSX B;  4ICV A;  3NVW A;  1I35 A;  1R7S A;  3KYD D;  1UWM A;  1WRI A;  4IW0 A;  3NVY A;  4CYE A;  2KVZ A;  2R61 A;  2ZPN A;  1TS3 A;  2MJ3 A;  1WIA A;  3RNB C;  3E56 A;  3E9S A;  4AJW A;  4TV3 A;  4DHZ E;  1E0Z A;  2MBO A;  1V80 A;  2XN9 C;  3AV8 A;  2KJ6 A;  3ZJV A;  2C9W B;  1E8X A;  2J42 A;  3P4S B;  2A4Z A;  4RGM A;  1NYR A;  3VR8 B;  1SBB B;  2PIA A;  2LVP A;  4YTP B;  3DDC B;  1PGX A;  1IBX B;  5EE3 A;  3APD A;  2BWF A;  1SSN A;  1JRU A;  5JZE B;  2AYO B;  1HTQ A;  1XQQ A;  2KK8 A;  3ECI A;  3U7Z A;  5IA7 A;  4ZYN A;  1WMH B;  1C4P A;  2MBE A;  4K81 A;  3DVG Y;  1I4X A;  3QWZ B;  3LYY A;  1J8C A;  3A33 B;  1YQ3 B;  1UNS A;  5E6N A;  1KTK A;  1NVI D;  1N6Z A;  3HHM A;  2M19 A;  2IGG A;  1SJE D;  4IOI E;  3TBL D;  4GDL B;  4NAM A;  1ESF A;  3BII D;  5LXI B;  2IZV B;  2LGS A;  4M8N A;  2IPK D;  3APF A;  5FR3 A;  2GI9 A;  1P7E A;  4PYZ A;  2KO3 A;  3PZ8 A;  2PLP A;  1M94 A;  3AE2 B;  4XWW A;  2KDF B;  1N5W A;  3WAM A;  4RF1 A;  3TUO A;  1ZOY B;  4HRS A;  4JE3 B;  3FC4 A;  2J0K A;  2KJH B;  3MJ5 A;  4KZC A;  1EM7 A;  1QOA A;  4KIK B;  1SIJ A;  1FIQ A;  4TSS A;  2MBH A;  1FMA D;  3IFW B;  1J7C A;  2BS2 B;  4M0W A;  3HM6 X;  1EU3 A;  4RM8 A;  4K7U A;  3DQV A;  2DYO A;  1PQS A;  4FLH A;  4IWO A;  2KD0 A;  4W9I A;  1FXI A;  2TSS A;  4KSK C;  2WQY B;  3PHW B;  2JX5 A;  2D5G A;  3V6C B;  1WGD A;  2DZJ A;  5J17 A;  3HVZ A;  3QAR A;  4LTU A;  2YVC A;  2WXF A;  1V86 A;  3ZNH B;  4M8M A;  3AE8 B;  1ZDX A;  3AEE B;  3A4S C;  1T6B X;  2QDF A;  2MJD A;  2ZNV C;  2IY1 B;  1ZP0 B;  4KZ0 A;  1DOI A;  2AQ2 B;  2JRH A;  4MDK E;  3GP7 A;  3DOW A;  3RNA C;  2WXJ A;  2XNA C;  2BQQ A;  3JW0 X;  3VUX A;  1GOZ A;  1WXS A;  1YJ1 A;  3JYU A;  2V3N A;  2AWT A;  2ASQ A;  3N20 C;  4RMA A;  1L4D B;  2ZZP B;  1E5W A;  4URK A;  3ML8 A;  3PRP B;  4EUT A;  1J19 A;  3HK0 A;  4B0M A;  4N58 A;  4BOS C;  1N62 A;  5D94 A;  1WJN A;  2KMM A;  3H7P B;  3FIL B;  2KOX A;  2GBJ A;  2KAN A;  4DHZ B;  3I5J C;  2A5U A;  2L00 B;  5AUI A;  2KDI A;  3DBS A;  1WM2 A;  1T0R C;  2WWZ A;  3WCQ A;  2MA9 B;  4ZOH C;  1RFA A;  2IYD B;  2INN E;  5BMH A;  2AEH A;  2D10 A;  3KUZ A;  4DBG A;  1V97 A;  3T3O A;  1FEH A;  1IPG A;  3I9V 1;  5KHQ A;  1J7A A;  5J18 A;  2PMV A;  2R2O A;  2K22 A;  1SB3 C;  3ZNI D;  2ZW1 A;  3Q3J A;  3KH0 A;  3ZKJ C;  2XBB C;  5T8I A;  1F1H A;  3ENE A;  4RGT A;  4GDK A;  3JVZ X;  4W9E A;  4YSY B;  3ZYY X;  1VLB A;  1FNW A;  1TKY A;  4GB9 A;  1YN4 A;  2JXT A;  3DCG A;  1RFK A;  2N9X A;  1N61 A;  5EE9 A;  3V6E B;  5D3I B;  2CKH B;  1WM3 A;  4MEM A;  1T0Q C;  4I6L B;  4EZK A;  3C0R B;  2DZM A;  1F52 A;  3EUB 2;  2J7Q B;  2V4L A;  4FAD A;  4I6N B;  1TZ1 A;  1GC6 A;  1JWM D;  1X1M A;  2ZEQ A;  4WJP A;  1K50 A;  3RUL A;  1M4V A;  3NS1 A;  1HZ5 A;  1JWA D;  3TEZ A;  4P1C C;  1UGM A;  2V9H A;  1F2R I;  2ZW0 A;  2M4N A;  2AQ3 B;  4OVZ A;  3SU8 X;  2EKI A;  4A9A A;  3GB1 A;  2N7D A;  1UGJ A;  2J0J A;  4DWF A;  3RNG C;  5CX3 A;  3W9C B;  5GMV A;  2KMC A;  2JQR B;  4GGQ A;  2VH2 A;  2AQ1 B;  4MGK E;  4XYC A;  2CU3 A;  3VQI A;  3UIO B;  2LJI A;  3MHZ A;  1GPX A;  3RFZ B;  3KWL A;  3ZTD A;  2OHF A;  1WJU A;  4IM2 A;  3L13 A;  2PJH A;  4EZJ A;  1EWY C;  2C7M B;  2KHW B;  1A5R A;  2WXM A;  1GB1 A;  3ZJT A;  3OLM D;  2LXC A;  3DBR B;  3OJ3 A;  2WP9 B;  1PDX A;  2HD5 B;  3M63 B;  4HKZ E;  4MSQ B;  1FPY A;  1S3S G;  1D6E C;  1XD3 B;  2JRI B;  1MHX A;  4KDL B;  4XE0 A;  4CO7 A;  1N5X A;  4MH0 E;  3PRE A;  2N4F A;  1KOT A;  2WS3 B;  4KDI C;  2KTF A;  5C1Z A;  1XXG A;  3N9Y C;  2UYZ B;  2WDV B;  1WYG A;  2EKE C;  5KHO A;  4ANV A;  3UQB A;  2W82 A;  3NG0 A;  1K53 A;  3AE6 B;  2REX A;  3JSV A;  4HXD A;  3R3M A;  1WXQ A;  4JLC A;  1R4M B;  2CR5 A;  4DDI D;  1XT9 B;  3VH3 B;  2KLC A;  4RCO A;  2BBC A;  4W9K A;  4ZHO A;  2G3Q B;  2K39 A;  1WX8 A;  3L0W B;  1OEY J;  2LVQ A;  3NHE B;  2CJN A;  3AE4 B;  1WGR A;  1SEB D;  4LNN A;  4HPL B;  2Y5C A;  3L08 A;  1WGH A;  2IDY A;  3PS6 A;  2UU7 A;  2V1Y A;  2BKF A;  2ZVO A;  3LXF A;  1EF5 A;  3AEG B;  2N7J A;  4BKT A;  2AL6 A;  4PT5 A;  4WJN A;  4F1S A;  4HK2 A;  4LJP B;  1TKG A;  2KN4 A;  1HQR D;  3KLS X;  4XDD A;  2G45 B;  3K9O B;  4Q2J A;  2KFK A;  1I4Q A;  4A3O A;  4YTN B;  3TCA A;  3UF8 A;  3N32 A;  1YOV B;  3NZ3 A;  4DQO C;  3BVG A;  3I57 A;  3NZS A;  3AE7 B;  3CST A;  1GG3 A;  4LDT B;  1QOG A;  1WSP A;  2BT6 A;  2G4D B;  3BVZ A;  4P7I A;  2HTH A;  2KTR A;  3O65 B;  4ZRK A;  4M0W B;  3KUD B;  1DGJ A;  3AU4 A;  2JZP A;  2W3S A;  3R8B A;  2LGX A;  3NS8 A;  3AEC B;  2C7H A;  3Q3F A;  1KM7 A;  5LNK 1;  3ZJU A;  3R2T A;  3V05 A;  3VRB B;  4JWS C;  4WJQ A;  3GE8 C;  3AE1 B;  3A9K A;  3OG5 A;  1N63 A;  1K51 A;  2NTT A;  3CWI A;  3Q69 A;  5AEK B;  1CZP A;  4D2K A;  1EWC A;  1MG4 A;  4HLE A;  3L17 A;  1TTN A;  1WXM A;  2DNF A;  1IP9 A;  3TIX A;  3DWG C;  4TUU A;  4B6W A;  2M0A A;  3H9D A;  1WE6 A;  3VVW B;  4AP4 C;  4LNF A;  2IO1 B;  3URY A;  1AW7 A;  2D3G A;  2WU2 B;  2HJ8 A;  1QF6 A;  3IT6 B;  3LDZ E;  1Y8R C;  4HEA 1;  3RNC C;  3Q2A C;  3QC8 B;  3EC8 A;  1L0V B;  4DXF A;  3Q3M C;  2JPH A;  2IO3 B;  5DPT A;  4W9D A;  1B9R A;  4H2A A;  2R2Q A;  3TEY A;  1L5P A;  2KWV B;  4UDU C;  4C4V A;  3PO0 A;  4BZA A;  4IWQ A;  1ENF A;  4AOF A;  3SEB A;  4DK5 A;  4WIP A;  3P1M A;  2HDE A;  1FNV A;  3MFG A;  4XGA B;  3PTF C;  1WX7 A;  4XC2 A;  2QIE B;  3ZTC A;  1Z5S B;  4MGI E;  3VDZ A;  1Y56 A;  2H89 B;  4IM0 A;  4BBN C;  5GXG B;  2KWD A;  2V3P A;  3QCA A;  2MLB A;  2XK5 A;  2EEL A;  1RYJ A;  4DDG D;  4WWP A;  2SAK A;  4GN1 A;  3FKY A;  5BMG A;  2N9K A;  4ICU A;  3OJ4 B;  3DHG C;  2ZCB A;  3SD5 A;  1P7F A;  3QAQ A;  2CHW A;  1V49 A;  2L05 A;  1P1A A;  4GDK B;  2CHZ A;  2N7E A;  3TEX A;  1XEE A;  1AWD A;  2D3C A;  3RD2 A;  2K6Q A;  2VZK B;  3X23 A;  4PK1 A;  3M95 A;  3SDL C;  1YQ4 B;  1YIW A;  1DYQ A;  3A4R A;  3I63 C;  3TMP B;  2I1K A;  4OW0 A;  2O6V A;  5JH5 C;  3BK2 A;  2ONQ A;  3W1S A;  5IOI A;  1V81 A;  2KKC A;  4BOZ B;  3NRZ A;  2RPV A;  2GOW A;  3KQ4 A;  3DBL I;  4II2 B;  2RPQ A;  5E6O A;  4HDQ A;  2FNJ B;  2WDQ B;  2JXX A;  2KWC A;  1GC7 A;  1Z2M A;  1C4A A;  3AH7 A;  2BW2 A;  1TY2 A;  1JW9 D;  1LXD A;  2BVC A;  2L52 A;  1VZ7 A;  1QOF A;  2FBW B;  5D2M B;  1XO3 A;  3ZDM C;  2DLB A;  4A20 A;  2WXO A;  4KKJ A;  4JPS A;  3AUL A;  1ZXI A;  4W9L A;  2MX2 A;  2IY0 B;  4HRO A;  1KH0 A;  1L7Y A;  2L76 A;  2W55 A;  4BAX A;  3AN1 A;  2WXR A;  3CF6 E;  3L4P A;  3P4P B;  3CSF A;  3ONS A;  3NJT A;  1YD8 U;  1N60 A;  1LQB A;  3C8Y A;  1E8Y A;  3IAM 1;  1E8Z A;  4NQK E;  3RZF A;  3UQA A;  4HPP A;  4OZB A;  2LD9 A;  1UZX B;  4A90 A;  3BK1 A;  1YJJ A;  4YL8 A;  3M3J A;  4NZL B;  3B2G A;  2LGD A;  3DVN V;  2PTL A;  1KLU D;  3NY5 A;  1WX9 A;  2Z59 B;  3BVM A;  3QK0 A;  2N1W A;  2JVC A;  3ZRC A;  1TKE A;  2DAJ A;  1KJT A;  2CJO A;  3JSV B;  5FK9 C;  1E7V A;  3A9J A;  4MH8 A;  1UBQ A;  2KWU B;  2JY6 A;  5MPO A;  3IBE A;  4EEW A;  4F8C B;  5HI1 A;  1JML A;  2FCM A;  1Q10 A;  5HG2 A;  3KWV A;  2XEW A;  4L2Y A;  2MRP A;  3L10 B;  1JWS D;  2RSU A;  3V60 A;  3VRA B;  2WXK A;  2BKR B;  1UWX A;  3R2I A;  2LWP A;  2LUE A;  4OZC A;  3HM3 A;  2FCS A;  3HUI A;  1ZXH A;  3RUI B;  2DZI A;  4M01 A;  1Q0W B;  3GZN B;  1U4A A;  5TR5 A;  2KFK B;  3RN9 C;  2C7N B;  4ZYS A;  3AEB B;  4CQN A;  1HE8 A;  2EMS A;  3UGB B;  2PKO A;  3PLU A;  5C3J B;  4ZRJ A;  4A8X C;  4IG7 B;  1OFF A;  2AL3 A;  1RLF A;  1K52 A;  3ETR A;  1J7B A;  2KX3 A;  2KTR B;  1QIL A;  1WZ0 A;  5CHW A;  5DPW A;  1D5X C;  4DXG A;  4K1R B;  4JWU C;  2GRI A;  3NUH B;  4AUQ C;  1WH3 A;  3ZUN A;  4BKS D;  1FXA A;  3B9J A;  4KSL C;  5G55 A;  2K25 A;  5AZH A;  5DCN A;  1T0S C;  2Y5P A;  3EHV A;  3VUY A;  4OVU A;  3A9K B;  1C1Y B;  2FCQ A;  3N3K B;  4ZRQ A;  2NBU A;  1ZUD 2;  4WWM A;  1S1Q B;  4WQO B;  4NJC A;  4LJO B;  2WXG A;  1WR6 E;  1D5M C;  2CS4 A; 
#chains in the Genus database with same CATH homology
 2C60 A;  2Z0D B;  3JSV A;  1V9J A;  4J6I A;  3ZVV A;  2GBK A;  4FHJ A;  2IO0 B;  3R3M A;  4HXD A;  4JLC A;  1V5T A;  2CR5 A;  4DDI D;  1XT9 B;  3ZNZ B;  1YX6 B;  2NBW B;  4TKN A;  3RT3 B;  3VH3 B;  4EOY A;  2KLC A;  4JL9 A;  4K7S A;  2MSE D;  4HCP B;  1BT0 A;  5EDS A;  3EFU A;  1EO6 A;  2IO2 B;  1WGG A;  4WWN A;  2DYB A;  2ZCC A;  1WRD B;  4W9K A;  3H1U A;  2G3Q B;  2K39 A;  2MBQ A;  1WX8 A;  3L0W B;  2LZ6 A;  1OEY J;  4E3C A;  1OQY A;  4PS8 A;  4PS7 A;  3PHX B;  3WAN A;  2LVQ A;  4K7W A;  1LM8 B;  4FBJ B;  1H4R A;  3NHE B;  4GU2 A;  1WGR A;  2VRR B;  1AAR A;  2KMA A;  2BYF A;  4CHK A;  2JUO A;  4FJY A;  1WJ6 A;  2ZJD A;  1V5O A;  2LJ5 A;  4HPL B;  1UH6 A;  3MTN B;  3D32 A;  5LLI A;  3T8M A;  3WIM A;  3L08 A;  1H8C A;  1WGH A;  2NR2 A;  3ML9 A;  3DVG X;  3PS6 A;  2V1Y A;  2K6D B;  2MQJ A;  4GIV A;  2JF5 A;  2BKF A;  2ZVO A;  1EF5 A;  1P3Q U;  2OJR A;  4BKT A;  2KDE B;  3ALB A;  2AL6 A;  4FJV B;  4MGZ E;  4WJN A;  4F1S A;  4HK2 A;  2N1V A;  3R7R A;  3W1Y A;  4LJP B;  2HE7 A;  4DHJ B;  4ANU A;  4TQ1 A;  4ASW C;  1EF1 A;  3X0W A;  2G45 B;  2NS5 A;  3K9O B;  3ZDT A;  2KFK A;  4NQL B;  1RAX A;  4NAW B;  4A3O A;  2DHZ A;  3TCA A;  3UF8 A;  1P0R A;  3N32 A;  3NOB A;  2UWQ A;  3GOE A;  2BPS A;  3PGE A;  3MHS D;  2XK5 B;  3H6N A;  3NZS A;  3CST A;  1GG3 A;  2K8B A;  3DVN U;  4LDT B;  4EKU A;  2DYM A;  3EEC A;  2G4D B;  2JZ3 B;  2ZPY A;  2LRW A;  3B0A A;  4P7I A;  2L7R A;  3L16 A;  2KFJ A;  2HTH A;  4MGY E;  5D6J B;  2KTR A;  3O65 B;  4ZRK A;  3NZU A;  1T0Y A;  4M0W B;  1FXT B;  3KUD B;  2BYE A;  3AU4 A;  1WYW B;  4ICV A;  2O2V B;  4OVV A;  1L2N A;  1I35 A;  5J2R A;  1WY8 A;  5BO4 B;  2WDT B;  1E7U A;  3KYD D;  4HWI B;  3ZW3 A;  4IW0 A;  4CYE A;  5AZG A;  4G3X B;  2ZPN A;  1WIA A;  4AWJ A;  2BGF A;  2LGX A;  3KVF B;  4AJW A;  4II3 B;  3NS8 A;  3APC A;  2GBM A;  4TV3 A;  1SE9 A;  4WJO A;  2NCN A;  3WAL A;  4DHZ E;  2O6V B;  2C7H A;  2OOB B;  3Q3F A;  1KM7 A;  2LI5 A;  3TJP A;  3DPD A;  2MBO A;  4WJQ A;  4JGH B;  1V80 A;  4IWP A;  2KJ6 A;  3A9K A;  1GUA B;  2C9W B;  2M17 A;  1E8X A;  5AEK B;  1VD2 A;  2A4Z A;  3QIJ A;  3WA0 A;  4HLE A;  3AXC A;  3BIN A;  3CMM B;  3L17 A;  1TTN A;  1WXM A;  2LVP A;  3DDC B;  2BYV E;  2DZK A;  1IP9 A;  3TIX A;  4TUU A;  4B6W A;  3U7D A;  1UEL A;  1VCB A;  3H9D A;  2FCN A;  1WE6 A;  4LCD E;  4MEL A;  3VVW B;  3WAO A;  3APD A;  4AP4 C;  1IYF A;  2N9P C;  2M0X A;  3SHQ A;  2IO1 B;  2BWF A;  1JRU A;  4ZDV A;  5JZE B;  1E90 A;  1OEY A;  2D3G A;  1ZGU B;  2AYO B;  2LVO A;  1XQQ A;  2KK8 A;  3ECI A;  3VTW A;  5IA7 A;  4XX5 A;  4DHJ D;  4ZYN A;  2HJ8 A;  1WMH B;  4MJS B;  3LDZ E;  1Y8R C;  2C5L C;  2WX0 A;  1ISN A;  3IG3 A;  2EMT A;  1UBI A;  2MBE A;  1WJ4 A;  3QC8 B;  4K81 A;  4N9F 4;  3DVG Y;  3EC8 A;  5DPR A;  4WAA A;  3QWZ B;  4NNJ B;  2JPH A;  2IO3 B;  1J8C A;  5DPT A;  3A33 B;  4W9D A;  4LDT D;  1WR1 A;  2R2Q A;  5E6N A;  5L95 C;  2L0T A;  3HHM A;  2KWV B;  3QHT A;  5JHA A;  4IWQ A;  4AOF A;  3TBL D;  2RGF A;  4DK5 A;  4GDL B;  1CMX B;  2CHX A;  5LXI B;  2IZV B;  4M8N A;  3OAW A;  3QJZ A;  3APF A;  2V3S A;  4MM3 A;  3A1Q B;  2CU1 A;  3PTF C;  1WX7 A;  4PYZ A;  4XC2 A;  2KO3 A;  1WI0 A;  3ZTC A;  1M94 A;  1Q1O A;  4KIK A;  1Z5S B;  4W9F A;  2KDF B;  2MCN B;  1V2Y A;  3W1S C;  4MGI E;  3WAM A;  3VDZ A;  2ZNV B;  3VTV A;  2JWZ A;  2O6V D;  4NAW A;  4IM0 A;  2LRU A;  1SGH A;  4BBN C;  2WYQ A;  2DEN B;  1GJZ A;  4I6P A;  2KC2 A;  3B1L X;  2J0K A;  2DAF A;  2KJH B;  2MLB A;  2XK5 A;  3QCA A;  4G11 A;  1YX5 B;  4DDG D;  1J0G A;  4BVU C;  4KZC A;  2MBB B;  4WWP A;  5FR6 A;  4GN1 A;  4KIK B;  2J0M A;  5LXH A;  2I1J A;  1OTR B;  2LAS A;  2MBH A;  2FIF A;  2FUH B;  4ICU A;  3IFW B;  3OJ4 B;  4HJK A;  3HM6 X;  2ZCB A;  1WF9 A;  2MP2 B;  4RM8 A;  3SD5 A;  2O2V A;  3QAQ A;  4FUL A;  4K7U A;  2RR9 A;  2CHW A;  1V49 A;  2DYO A;  2L05 A;  3DQV A;  1P1A A;  2LXA A;  4GDK B;  3A9J B;  1PQS A;  3IVF A;  2CHZ A;  2N7E A;  4FLH A;  2KD0 A;  4GSW A;  2ZVN A;  4IWO A;  4W9I A;  4GOC A;  2D11 A;  3RD2 A;  2K6Q A;  3X23 A;  3M95 A;  3SDL C;  3VHT C;  4MSM B;  4KSK C;  1YIW A;  3A4R A;  4W9H A;  2I1K A;  3PHW B;  2O6V A;  3TMP B;  5JH5 C;  2N9E B;  1WGY A;  1LFD A;  1WGD A;  3V6C B;  4HCN B;  3N30 A;  2DZJ A;  5J17 A;  3W1S A;  1V81 A;  1R4N I;  3QAR A;  3T9L A;  4F7Z A;  2KX0 A;  2KKC A;  5JHB A;  2YVC A;  4BOZ B;  3V62 A;  2KQ7 A;  1C3T A;  2GOW A;  2FAZ A;  3DBL I;  1V86 A;  3ZNH B;  3AU5 A;  4M8M A;  4II2 B;  2RPQ A;  5E6O A;  2DX5 B;  4HDQ A;  3A4S C;  2FNJ B;  2NPT B;  4IM3 A;  2JXX A;  2KWC A;  4XZ4 A;  1GC7 A;  1Z2M A;  2Z0E B;  2ZNV C;  1WZ3 A;  2K8H A;  3RZW C;  2IY1 B;  3PV1 A;  2KVR A;  2L8J A;  1LXD A;  4IUM B;  4KZ0 A;  3UIN B;  2KZR A;  3PVL A;  1P98 A;  5D2M B;  1WMH A;  2JRH A;  4MDK E;  2KDB A;  3DOW A;  2FID A;  4MJS A;  5CHV C;  3QQ8 B;  1E8W A;  3JW0 X;  3ZDM C;  3VUX A;  1TBE A;  4A20 A;  1WXS A;  4NY0 A;  1YJ1 A;  3AUL A;  4NPN A;  4W9C A;  4W9L A;  2MX2 A;  2IY0 B;  3KYC D;  4E71 A;  3JYU A;  2AWT A;  4TQ0 A;  2ASQ A;  1L7Y A;  3I3T B;  2L76 A;  4RMA A;  2ZZP B;  1E5W A;  4A3P A;  4ANX A;  4BBN F;  3WAP A;  4FN2 A;  3ML8 A;  3PPA A;  3PRP B;  4URK A;  2Y5B B;  5G2N A;  4EUT A;  3B08 A;  3CF6 E;  1J19 A;  2K1F A;  3CSF A;  3HK0 A;  4BOS C;  3R66 C;  2KNB A;  1WJN A;  3H7P B;  3ONS A;  4GDL A;  5D94 A;  5C23 A;  3BY4 B;  3VXW A;  2KOX A;  3GZN I;  2GBJ A;  4FHK A;  1Q5W B;  1YD8 U;  2KAN A;  5D7G A;  4DHZ B;  1V6E A;  1LQB A;  3A1Q A;  1E8Y A;  1SIF A;  2JZZ A;  4W9J A;  2A5U A;  5IAA C;  3ZNG C;  2L00 B;  3KUC B;  3QA8 A;  2KDI A;  3DBS A;  1E8Z A;  3PLV A;  3QX1 A;  4NQK E;  3RZF A;  3UQA A;  1WM2 A;  2PE9 A;  4KVG B;  1WXA A;  3U30 A;  4KV2 A;  2LD9 A;  1UZX B;  2WWZ A;  4PS3 A;  1GNU A;  2MA9 B;  1RFA A;  4ZRI A;  2IYD B;  1NDD A;  4YL8 A;  2AEH A;  2D10 A;  3KUZ A;  3M3J A;  4DBG A;  1IPG A;  5KHQ A;  3ZLZ A;  1KLV A;  2LGD A;  3DVN V;  4HPM B;  2GBR A;  4HDO A;  5J18 A;  2KXJ A;  3V61 A;  3NY5 A;  1TGZ B;  1WX9 A;  2WX1 A;  2Z59 B;  2R2O A;  4GMV A;  3QK0 A;  4BKS A;  3ZNI D;  3DBR I;  2GMI C;  2N1W A;  2JT4 B;  3KW5 B;  3Q3J A;  4BFR A;  3KH0 A;  2JVC A;  3ZKJ C;  2XBB C;  2MP2 A;  3ZRC A;  2DAJ A;  1KJT A;  3JSV B;  1K8R B;  3ENE A;  1NI2 A;  4RM9 A;  1F9J A;  4GDK A;  1E7V A;  3JVZ X;  3HIZ A;  4W9E A;  3A9J A;  4G50 A;  3PT2 B;  3S2A A;  2W9N A;  4FA6 A;  3LJ3 A;  1UBQ A;  2KWU B;  2LGY A;  1UD7 A;  4GB9 A;  1WFY A;  2JY6 A;  2BWE S;  3DCG A;  3MJW A;  3IBE A;  2N9X A;  4EEW A;  4F8C B;  2MW5 A;  3V6E B;  2CKH B;  1MG8 A;  2FCM A;  1WM3 A;  4MEM A;  2GBN A;  4JQW C;  2PE6 B;  4I6L B;  2L0F A;  4EZK A;  2NBV B;  2XEW A;  2MWS B;  1I42 A;  4X57 B;  3C0R B;  2DZM A;  2MRP A;  3L10 B;  3U8Z A;  2J7Q B;  4B9K A;  2V4L A;  4FAD A;  1ZKH A;  4AJY B;  4I6N B;  5L83 A;  1R4M I;  1TZ1 A;  1GC6 A;  1X1M A;  2KQS A;  3ZO5 B;  2ZEQ A;  4WJP A;  2RSU A;  3RUL A;  4HVB A;  3V60 A;  5AZF A;  3ZRF A;  4FJZ A;  2BKR B;  2BF8 B;  1G6J A;  5HKH A;  1QZE A;  2G4S A;  2LWP A;  2NPT A;  2LUE A;  3HM3 A;  1UGM A;  2FCS A;  3H7S A;  3IHP C;  3P2B A;  2RD0 A;  3M62 B;  3RUI B;  3AI5 A;  2DZI A;  2M4N A;  3TL5 A;  3PRM B;  1Q0W B;  4JIO U;  3SU8 X;  1U4A A;  4IC7 B;  5TR5 A;  2N7D A;  1YQB A;  2KFK B;  5CHF A;  4EZL A;  2C7N B;  2J0J A;  3DBH I;  1HE8 A;  2EMS A;  4G0N B;  4DWF A;  3PZD A;  3UGB B;  5CX3 A;  2QHO A;  4PYU A;  3PLU A;  2KMC A;  5GMV A;  4GGQ A;  3RCZ A;  5DPS A;  4ZRJ A;  4IG7 B;  3RYT A;  3L54 A;  4MGK E;  2AL3 A;  1RLF A;  2YLM A;  3VQI A;  3UIO B;  4EFO A;  3VUW A;  1WE7 A;  1OGW A;  3VAW A;  3ZTD A;  3VTU A;  1WJU A;  4NJ7 A;  2KX3 A;  2KTR B;  4IM2 A;  4W9G A;  2B3A A;  3L13 A;  2KC1 A;  4WWO A;  5E6P A;  1WXV A;  2PJH A;  3H7P A;  1WZ0 A;  4EZJ A;  5CHW A;  5DPW A;  4GXB A;  4ANW A;  1ZW7 A;  2C7M B;  2KHW B;  4K1R B;  1A5R A;  2IBI B;  2D07 B;  3VFK A;  3ZIM A;  2PEA A;  3OLM D;  2LXC A;  3OJ3 A;  3PSE B;  1D3Z A;  2HD5 B;  4AUQ C;  2KN5 A;  2PPH A;  3M63 B;  1WH3 A;  3ZUN A;  2KLG A;  4KSL C;  4BKS D;  5G55 A;  4MSQ B;  2K25 A;  1S3S G;  5AZH A;  1XD3 B;  2M8S A;  2JRI B;  5DCN A;  2K8C A;  5CTR C;  1RRB A;  4KDL B;  4NJ6 A;  2KJR A;  4B95 A;  3EHV A;  4CO7 A;  4DXA B;  4MH0 E;  3PRE A;  3VUY A;  2N4F A;  1KOT A;  4OVU A;  3A9K B;  4KDI C;  2KTF A;  1C1Y B;  5C1Z A;  2NVU I;  2FCQ A;  3N3K B;  2UYZ B;  3R7Q A;  2NBU A;  2L3Z A;  2EKE C;  3PRZ A;  5KHO A;  3VH4 B;  1S1Q B;  1P9D U;  4E74 A;  4BKG A;  4ANV A;  4WQO B;  2M1M A;  3UQB A;  4LJO B;  1EUV B;  1NBF C;  2D2Q A;  1WR6 E;  2CS4 A;  3K9P B;  2REX A;  3UIP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...