4YWGG

Crystal structure of 830a in complex with v1v2
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
118
structure length
103
Chain Sequence
MTTFKLAACVTLNCTETRVKHCSFNITTDVKDRKQKVNATFYDLDIVPLSSSLYRLISCQTTTTEAVDAATAAKVFKQYANDNGIDGEWTYDDATKTFTVTEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Light chain of anti-HIV-1 gp120 V1V2 antibody 830A
publication title The V1V2 Region of HIV-1 gp120 Forms a Five-Stranded Beta Barrel.
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 103
sequence length 118
chains with identical sequence Q
ec nomenclature
pdb deposition date 2015-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.790 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4ywgG00
4YWGG 4DQOC 3U2SC 3U4EG
chains in the Genus database with same CATH superfamily
2PVGC 5FK9C 4I6NB 4N58A 2N7EA 1MHHE 4K7SA 5D7GA 3V05A 3ZW3A 3BYTB 5E6PA 3GE3C 3R7RA 1MVKA 1KLVA 2BS4B 3CWIA 1MG8A 4LJPB 4MGIE 4H2AA 3ZNZB 2ZVNA 5CTRC 1L0VB 1M94A 4BVUC 3GP7A 4AQ7A 3A1QB 1YOVB 3VH4B 1LM8B 1TT5B 2LVPA 2NBWB 5BYSA 1CMXB 3BINA 1IBXA 2RSUA 2KK8A 3L54A 4HLEA 3DBRI 2ASQA 1CK1A 4TV3A 2EMSA 2LI5A 4OZCA 3TMPB 3HUIA 1KJTA 4K3BA 1LQBA 2G9HD 1EF1A 2JZZA 4NNJB 4NAWA 2N9KA 2N0SB 1ZP0B 1ZXIA 3VRBB 1XLNA 1N6ZA 2V3SA 3H7PB 5E6OA 3NVWA 3NS1A 3UF8A 4E71A 3R8BA 4J6IA 1FRDA 4MM3B 1FNUA 4C4VB 5CHVC 1TY2A 2LMCA 4HPMB 3RNEC 3SDLC 2ON8A 3ZNHB 1D6EC 3I57A 3HHMA 2WXQA 2PPHA 3AEEB 2KACA 3W9CB 3GZNB 3ZQ4A 1WMHB 2N1VA 2QMTA 5BMIA 3DHGC 2C60A 2M1MA 1UUPA 4YSXB 3ML9A 1XEEA 2J7QB 3DCGA 3JVZX 3RT3B 2K3UA 4BFRA 2L3ZA 3RFZB 4LTUA 2LVQA 1ENFA 4W9DA 3IAS1 3HIZA 2ZVOA 2C5LC 4JX1C 1QOBA 1SE2A 4DBGA 3AH7A 3R7QA 4XWTA 5AZFA 1EU3A 1UGMA 1FMAD 2AX5A 1R4MB 2INCC 4MDKE 4JL9A 2MWSB 3T3NA 3UIOB 2WU5B 4WAFA 1WGGA 3AULA 2QC8A 1OEYJ 3QC8B 4L23A 3W5VB 3DBLB 2KJRA 3HRDD 1EUVB 4XX5A 1V1OA 1IPGA 3RMKC 4HVBA 2PW9A 2MSED 3AE2B 1WF9A 5E6JA 3V3XA 4GMVA 4TMAB 4HPPA 1D3ZA 2IZVB 4XDCA 1SEBD 2EKIA 3ZYYX 2KFJA 1OEYA 4RM8A 2LHDA 4S0RA 4L1BA 1YQ4B 3H9DA 4II3B 1I4RA 3ZKJC 1HZ5A 4BKGA 2J52A 3V62A 5IO9A 3MC9A 2MA9B 4REZA 4MJSA 3CIRB 4K81A 5LLIA 4F8CB 4XC2A 1F0ZA 4LDTB 1C4CA 1JQ4A 3VTUA 3WAMA 1KRHA 1LGRA 1UF0A 4JGHB 3AM9A 4G3XB 3FILA 4A9AA 2DX5B 3I5JC 5EE0A 5C2TB 5J18A 2N4FA 1V6EA 5CHWA 1L6UA 1ET9A 2XEWA 4WJPA 2ZNVC 5TSSA 1FCLA 3WCQA 4KDLB 1FNVA 4A8XC 4URKA 4RNAA 3U7ZA 3PRPB 2OEDA 1WH3A 1WM3A 2AQ1B 1E7PB 1XXGA 5G5HA 1YN3A 3DBHB 1L2NA 4BKTA 2EMTA 2K8CA 5G55A 1HQRD 2KOXA 4LNOA 2AQ3B 4KZ0A 2VZKD 4N59A 3PRMB 4CQNA 3DHHC 4YL8A 1L0YB 2WXOA 2BF8B 4ACFA 3UI3A 2N1WA 2CU3A 3U30A 1SF0A 3EGRA 2CKHB 3BVZA 3DWMA 4MGZE 2D10A 2FCSA 3NVZA 2B76B 2HJ1A 1TTNA 1P3QU 1PQSA 4CO7A 4HJGE 2GBJA 4MM3A 5G5GA 4NJCA 1B1ZA 4E3CA 4RFBA 3R2IA 2NCNA 4ZHOA 1Y56A 3ABVB 2OJRA 2IPKD 2KC2A 2PMVA 2FIFA 4M8NA 4PK1A 1CQVA 3KH0A 3ZJUA 2R61A 2QIEB 1WRDB 4HCNB 2QJLA 3AB5A 1VZ6A 1ZW7A 3I63C 1TKGA 1YQBA 4HEA1 4DK5A 2WXKA 1SE4A 2WNMA 4AOFA 2XK5A 4W9JA 3TIXA 3AE1B 3ZXRA 4A20A 5T8IA 3P63A 2BYTA 4DHJB 3CSTA 3MC0B 1R4NI 1T0SC 1WGHA 2JZ3B 1V8CA 4A3OA 1S1QB 3MTNB 3A9JB 2L0TA 3P1MA 3PT2B 4R3DA 2LXCA 3CMMB 1VZ8A 1C76A 4MACA 2KWDA 4TSSA 4M01A 3HK0A 3TBLD 1EU4A 3BIID 5JHAA 1F2RC 3AU4A 2KWUB 4BOSC 3MJWA 3DBSA 2FCMA 2I1KA 3DBLI 2FAZA 3VAWA 1HZ6A 4EZKA 4B9KA 3Q8CA 3M63B 4ICVA 2O2VA 2J0KA 3TUOA 3B2GA 2LGXA 2D3AA 1NYQA 3LJ3A 2KO3A 3WALA 1HXYD 1YIWA 2J0MA 1IBXB 1C4AA 3H7SA 1LO5D 3IAM1 2JWUA 1KFYB 1L5PA 3X23A 1XQQA 3AE7B 3KQ4A 1L4DB 2LXAA 1FRRA 1J7CA 2W9NA 4GOCA 4W9FA 5IA7A 2DZIA 2MBQA 3PHWB 1ROEA 3NZ3A 2YEPB 2KQ4X 5H92C 4YSZB 2WQYB 5I4DA 3GS2A 2LUEA 4PYUA 1C4PA 4ZHPA 2JY6A 1TKEA 1JWSD 3APDA 1KOTA 3ZNID 5DPRA 2Y5CA 1RAXA 3E9SA 4ZDVA 3NG0A 3CSFA 2DNFA 4B95A 1PGBA 4N9F4 3OWEB 2SAKA 1IP9A 1SB3C 5BO4B 1ZUD2 2Y3AA 3BVMA 1EO6A 4C7YA 2L52A 1YN5A 3C8YA 1VJKA 3SFEB 1WJUA 3A4RA 1YJ1A 1FXAA 2MBOA 1MG4A 2KWCA 4AJWA 3ECIA 3B08A 1GPXA 4LNIA 2XN9C 1SXTA 2ZEQA 4MGKE 1I4GA 2C7HA 5IAAC 2GLSA 3RULA 4W9GA 1NYRA 2YLMA 3TL5A 1K8RB 3N1XC 1G6JA 5AUIA 5LXHA 4YXDB 2KDIA 1KM7A 1F2RI 5BYQA 2DENB 1ZPSA 5JXVA 4EUTA 1YJIA 4GB9A 3EUB2 2CU1A 3ZIMA 4BBNC 5DPTA 1UZXB 4K7WA 3RNGC 1WXVA 2GMIC 4NAMA 2WLBA 2OJWA 2JQRB 2PJHA 2HD5B 4TUUA 2FNJB 5HKHA 4YTMB 3BY4B 1GJZA 4MEMA 1P98A 1AN8A 3A9JA 4JIOU 3T3OA 3T9LA 4MSMB 4WURA 3VQIA 5L95C 5DPWA 3V6EB 1P9DU 1UH6A 3KWLA 4KGSA 5G2NA 2JRHA 3Q3FA 4KKJA 4GDLB 3SR6A 4EFOA 2QHOA 4EEWA 2C7MB 2IO1B 2KC1A 1J0GA 2D3GA 2IO2B 3M95A 4IM2A 3ZJVA 3WIMA 3OJ4B 4OVZA 5HHDG 3FILB 1E7VA 1QF6A 2LHEA 2NTTA 3VFKA 1D5MC 2B3AA 1EWYC 4XYCA 2W3SA 1RFAA 4ARIA 2V4LA 4YTPB 3OAWA 1A5RA 3AE6B 3FAHA 5MPOA 3B1LX 4A3PA 2D5GA 4ASWC 3C0RB 2IGHA 2ZW0A 1L4ZB 4IC7B 2LGIA 2JWZA 1T0YA 5J2RA 1K53A 2ACZB 5EE1A 2L83A 2ZPYA 1GAQB 4A90A 1HA5A 4MGYE 3VXWA 2PE9A 3NZUA 3DVNV 1BMLC 3SFDB 1WWTA 2I2YA 2WDQB 2L1AA 4GDKB 4W9IA 1QKZA 2AL6A 1WXQA 4KX6B 2LRUA 2KN5A 1QLBB 3VVWB 3BWUD 2M4NA 4DXGA 2BWFA 2DHZA 3TEWA 1F77A 1AWDA 5BMGA 3M62B 2IBIB 2K8BA 2FIDA 3AV8A 2HE7A 2PVOD 4WQMA 3QA8A 4JLCA 1PDXA 2NPTB 3AE3B 4RF0A 3QARA 2WXHA 1FXTB 5IKCM 1J19A 4ICUA 1J8CA 2D2QA 4KKIA 1WYWB 3W1YA 3L16A 1WXSA 3T8MA 2KKCA 1FFUA 2QSDA 2KFKA 3GB1A 1E8XA 2LJIA 2H89B 2VZKB 2GBMA 1EWCA 2H88B 2G4DB 1VD2A 3IVFA 1FFVA 3SEBA 2ZPNA 1N5WA 2XK5B 4WJNA 2RMMA 2KDFB 3AEFB 3MC8A 2W54A 3PTFC 4RF1A 2KT7A 2XNAC 4C00A 4DDID 4FULA 2KYWA 3NUHB 3W5UB 4E74A 2O6VD 5FKAC 2KAJA 4FXCA 3TEXA 4EZLA 2EKEC 1SIFA 5LXIB 5AZHA 1CZPA 2FE8A 1TY0A 1Z2MA 4RH6A 3NY5A 1WE6A 1TBEA 3KUDB 3V61A 4K1RB 1C9FA 2WXIA 3KVFB 2ONQA 4FADA 3L08A 3WAPA 1ACCA 2MX2A 4F1SA 1TJEA 2VRRB 4CHKA 4I6LB 2Z0EB 1MFWA 3HM6X 2KHWB 3PGEA 3FC4A 1JWMD 1JRPA 2KTFA 1D4BA 3J9CA 1D5XC 3AEDB 4ZYNA 2MJEA 2O2VB 5D3IB 4WH4A 1C3TA 1C1YB 4YT0B 2GBRA 2PTLA 3W1SA 2MLBA 1WM2A 4US8A 4GDLA 1YN4A 4QAYA 2KZRA 1PFDA 1WX7A 4ANWA 4HXDA 4ZRQA 2MCNB 4MSQB 3VR8B 2BKFA 3QX1A 4K7UA 3EFCA 1V49A 5FR3A 1PUTA 2WDTB 4W9CA 3AEGB 4FJVB 2LZ6A 1D5ZC 1P7FA 3R3MA 4OW0A 2GBNA 3KW5B 5GXGB 1V81A 4BZAA 3OJ3A 2JUOA 3B9JA 4GLSC 4DDGD 2WYQA 2C7NB 1WX8A 3QIJA 1C77A 3NS8A 3UQAA 2KMCA 2UYZB 2W82A 4AJYB 1OQYA 1RFKA 1P0RA 4M8MA 2DYOA 3MHZA 2E3TA 4BOZB 2RPQA 3NZSA 3PRZA 4IWQA 1TZ1A 1TS2A 1SSNA 3Q3OC 2LASA 4FBJB 2BYVE 4BBNF 3AEBB 1MI0A 4GDKA 4OVUA 1UBQA 4JPSA 3C19A 4AWJA 3N9YC 3KLSX 3IT6B 4EOYA 3VH3B 2LGSA 2BYEA 2L05A 3ZTCA 3U52E 2PKOA 3A33B 4DWFA 4WWMA 2MJ3A 4KV2A 4M02A 3D32A 3TJPA 4PS8A 1SBBB 2NPTA 3EECA 1NDDA 1ZDVA 3ZXVA 2BTEA 2OHFA 1FCCC 1OFFA 1T3QA 1L6VA 4WAAA 1SJED 1IUEA 1K50A 2KX0A 1TS4A 4IDIA 2ZCBA 2CJOA 2V3NA 1N5XA 1HTOA 1VR9A 5KHQA 1V97A 4ANVA 2JYEA 1STEA 3V6CB 3BYYB 2L00B 3AECB 3VTVA 3PLVA 2PLPA 3H6NA 1OGWA 1T6BX 1XO3A 3GZNI 2L32A 3QCAA 2D3BA 3VRAB 3N20C 5HG2A 1C78A 4FHJA 4HPLB 1F1HA 2ZCCA 3NVYA 2LJ5A 4TKNA 2RDGA 1S3SG 2LD9A 4XGAB 2K0PA 3ZVVA 2BT6A 4EE2A 2DWQA 1JROA 1FNWA 2RGFA 4HDQA 1WY8A 4D2KA 2JZPA 3AN1A 2KDEB 4LNKA 3LB8C 2KTRA 1BT0A 2BB5A 1XLPA 3ZRCA 4N6EB 4AP4C 1R4MI 3IFWB 1MJDA 2JSVX 2MRPA 1SGHA 2WXLA 2MP2B 5H8YE 1JWBD 4RCOA 2BVCA 3CF6E 2M8SA 3ZJTA 2JXTA 5EDSA 3IBEA 4M00A 4TQ0A 2WX0A 5C1ZA 1RLFA 1TGZB 5DCNA 1T5XD 3Q2AC 2DLBA 2RPVA 2PEAA 3DBRB 1E8ZA 3SD5A 3UIPB 1WGRA 2Q5WD 3WANA 1V9JA 3ZRFA 5DPSA 3MJ5A 1YQ3B 3AMZA 2BKRB 3APCA 3P42A 3L4PA 2JRIB 3AXCA 2WP9B 3P4QB 2BWES 2MBBB 4LNFA 4OHJA 2KANA 3U4EG 3MHSD 4IWOA 3DOWA 2NBUA 4NQLB 3ETRA 3N32A 3SU8X 1M4VA 2IJ0A 2WXJA 2JXXA 2Z8LA 2MEKA 1FD6A 2BW2A 1PGAA 1B9RA 4EZJA 2KMMA 5HI1A 1WZ0A 2CR5A 4GN1A 2K39A 2K1FA 2WX1A 1ZKHA 3PREA 3KWVA 3A9KA 4DHZB 4W9LA 3Q8FA 1FIQA 2AL3A 3NHEB 1H8CA 1ISNA 3ML8A 2INDC 4JE3B 2KNBA 3E56A 2G45B 2HTHA 2GI9A 2LGYA 3PHXB 4LJOB 3VUWA 1E90A 4JWSC 3JW0X 1ET6A 2KVRA 1XT9B 1ZOYB 1E8WA 3DBHI 1BXTA 2KFKB 2N9EB 3AE9B 2DYMA 2DZMA 2J4XA 4W9KA 2BYFA 3FKYA 3IT4B 3PS6A 4BKSD 4ITKA 5JH5C 3DDCB 1GOZA 4DHJD 2NS5A 1N62A 3H1UA 3TSSA 1GUAB 2EELA 1KF6B 5BYRA 3K9PB 2LEKA 3U2SC 1MHXA 2JVCA 3R2TA 4GSWA 3W2DA 3ZGZA 4PS3A 1WJ4A 1OQQA 4IG7B 1UWXA 1F9JA 2MJDA 5IP4D 1K51A 2IY0B 2FCNA 3TCAA 2G1EA 1H4RA 3N1YC 4OVVA 5IOIA 2QDFA 2JPHA 4O1NA 3NJTA 3RNFC 2RR9A 4WWPA 5D6JB 1NI3A 2M17A 3HVDA 1AYFA 3EA6A 4KVGB 2GBKA 2DAJA 2MBHA 1UNSA 3Q3MC 3ZUNA 1JCKB 3ZTDA 3L17A 4BKSA 2LVOA 2V1YA 5E6NA 2K8HA 1WGKA 2MBEA 5L83A 1N60A 1GNUA 1XD3B 2KXJA 3PV1A 3I3TB 1JWAD 1T0QC 5LNK1 4NY0A 3APFA 2O6VB 2N9PC 2N7JA 2ZJDA 2BQQA 3LXFA 1QOGA 2BS2B 3RNCC 2M0AA 1ZGUB 4ZRKA 2FUG1 2AWTA 3Q6BA 2KLCA 1GB1A 3QWZB 4MH0E 4KSLC 2MP2A 3B0AA 4FJZA 1NVID 3UINB 2WXGA 1V86A 2G4SA 2JF5A 3WA0A 1E10A 3WAOA 3QHTA 5BMHA 2WHIA 4C56C 3H8HA 1TZOA 4ANUA 1GG3A 4RGOS 1WFYA 4CYEA 3JSVA 4TQ1A 1LFDA 4II2B 2WWZA 1J7BA 4RGTA 3ALBA 1SE9A 1A70A 1RYJA 1MPEA 2VH2A 1SE3A 4NJ7A 4X57B 4KGRA 2M19A 4USAA 1HEZE 2NR2A 1I35A 1KLUD 2V4IB 3BVGA 2HDEA 4YWGG 4PS7A 2DZKA 3KYCD 3IG3A 4WQOB 2N9XA 3QQ8B 4HWIB 3X0WA 4IWPA 2V0GA 3P4PB 2MHJA 1QZEA 2UWQA 1WRIA 4L2YA 1ZXHA 4P16A 3S2AA 4GGQA 3W1SC 2K6DB 4WJOA 2WS3B 4DQOC 4IM3A 3VUXA 1BUIC 5C3JB 4JQWC 2LWPA 4FN2A 1WZ3A 2IO3B 1P1AA 2I38A 3P2BA 2IDYA 2AQ2B 4FJYA 2A4ZA 2LRWA 1VRAB 5D3DA 2W3RA 3ONSA 3TEZA 3N1ZC 3U7DA 4IM0A 3IHPC 2FBWB 4MH8A 4ZRIA 4NQKE 4ZYSA 1WXMA 1UBIA 1WYGA 3PSEB 1OTRB 4G11A 3Q3NC 1R4NB 4B0EA 2RD0A 3V60A 3Q8AA 3DWGC 1NENB 1I4HA 3RNAC 2N9LA 1I4QA 1WJNA 1EM7A 2AEHA 2BB6A 3IXSA 5CHFA 1X1MA 2HJ8A 1PYWD 1SJHD 2KTRB 1I42A 1ESFA 4RMAA 1ZDXA 5JZEB 3EFUA 2KX3A 1JMLA 4WIPA 3ZNGC 2ZNVB 2K9XA 2CHZA 3RNBC 4KIKA 4PYZA 3RZWC 4ARCA 2UU7A 2BPSA 4G50A 2BS3B 3AU5A 4RGMA 4AUQC 5EE9A 2WDRB 3ZO5B 3R66C 1EF5A 2JU6X 3GE8C 1QT9A 2R2OA 2O6VA 3BZDB 4HJKA 4M0WA 3Q3JA 1WGDA 1HTQA 1WIAA 1IYFA 3QAQA 2KWVB 3URYA 5AZGA 5TR5A 4XDDA 1N61A 2HTME 3VHTC 4LCDE 2Z59B 3EHVA 4YTNB 2D07B 1WXAA 3RI7C 1YJJA 3KYDD 5AUKA 5AEKB 2QEJC 4FHKA 5GMVA 4J3OD 2WDVB 1RM6C 1TYGB 2TSSA 1V80A 3N30A 3PVLA 3VDZA 2KDBA 4K3CA 2QILA 5CX3A 3Q14C 3A1QA 2NMQA 3M3JA 2D3CA 3A9KB 1YX5B 2LGDA 4HKZE 1DYQA 2FCQA 2KN4A 2N7DA 2ZZPB 4HKQA 2YEPF 2OOBB 4JWUC 1LXDA 4S17A 1XCTL 3OLMD 1WE7A 1JWUD 3JYUA 4Q2JA 2CJNA 1V1PB 3RPFC 3BK1A 4LK0M 1F52A 1YD8U 2KJHB 1PGXA 1YNTE 2DYBA 2KMAA 1K52A 2CHXA 4PT5A 4P1CC 3UGBB 3I9V1 1VLBA 2IO0B 2KD0A 4P6VF 1QOFA 4HCPB 4BAXA 4IW0A 2PIAA 2LUMA 2M0XA 2Y5BB 2WGSA 2C9WB 1IGDA 3H7PA 5C23A 4LLGM 2K22A 4HRSA 3L0WB 1XLOA 2NTSA 1WR6E 2MH7A 2KLGA 1XF5L 1FM0D 4WJQA 2NVUI 1GC7A 1TKYA 2DAFA 2DZJA 4C4VA 2E6XA 3ZDTA 1IGCA 2GOWA 4NPNA 3NVVA 1Y8RC 2GRIA 3AEAB 3AI5A 1YX6B 2NBVB 3KUCB 2I1JA 4W9EA 2REXA 4KZCA 2FUHB 1WMHA 1Q10A 1I4XA 1XCQL 3HVZA 1YMHE 4RGNA 2BGFA 3HM3A 3K9OB 1SIJA 3A4SC 2X38A 2V9HA 3ZDMC 4DXAB 3RN9C 3L13A 2K5PA 3N3KB 1WJ6A 1L7YA 1OQRA 1FXIA 3PZ7A 2J0JA 2CHWA 2XBBC 4DHZE 1UELA 3BK2A 2RDBC 2IGGA 1TS3A 1VCBA 2L0FA 4I6PA 1FO4A 2LFIA 4OZBA 1CJEA 4LDTD 1KTKA 1UD7A 2G3QB 4GIVA 1WSPA 3TEYA 5FR6A 3O65B 4GU2A 4HK2A 4W9HA 1WR1A 2A5UA 1XLQA 1DOIA 4MT5A 1VDVA 4KDIC 2J42A 2ZW1A 2KVZA 2YVCA 3O13A 2M56B 4A6QA 1GB4A 1I7HA 2CS4A 3JSVB 4FA6A 1WI0A 2JYTA 4B6WA 2JX5A 1VZ7A 2MQJA 4ZRJA 3AE8B 3NOBA 3PPAA 1UWMA 2WXRA 1E0ZA 5J17A 2WXNA 5D94A 3RUIB 2WXMA 2L76A 4FLHA 1J7AA 1TS5A 1U4AA 2VH1A 1AW7A 4ZOHC 4EKUA 3VTWA 1N63A 4NZLB 1QOAA 1E9MA 3MP9A 3U8ZA 4F7ZA 1NEKB 2Y5PA 3DVGX 4NAWB 3GOEA 1C79A 1UGJA 4B0MA 1V2YA 2QCZA 4P7IA 1JALA 5KHOA 3UQBA 5EE3A 3NRZA 2JT4B 1DOXA 3DVNU 3B2FA 2WXPA 4RM9A 1KH0A 1V1PA 4US9A 1ZE3D 4DXFA 2IY1B 3RZFA 1GC6A 2AYOB 2WXFA 3LDZE 1WX9A 3QJZA 1Q0WB 2KJ6A 3ZLZA 2IYDB 4IKGA 1KLGD 3Q69A 4HROA 1TIFA 4P1BC 2L8JA 3P4RB 5IN7A 1FEHA 2V3PA 1V5TA 1E8YA 2X8XX 4HDOA 4YSYB 1Q5WB 1E5WA 3LYYA 3AE4B 1E6EB 3RYTA 3VR9B 1Z5SB 2DBYA 1L0XB 2KDMA 4WWNA 3DPDA 2SEBD 3PZDA 2PE6B 3VUYA 3L10B 3OG5A 1HE8A 2GB1A 1T0RC 1NI2A 2MW5A 1P7EA 1V5OA 3P4SB 2K25A 4C7ZA 2BBCA 2D11A 1NBFC 2KQSA 4KIKB 4UDUC 3SHQA 2IGDA 1RRBA 1WGYA 4G0NB 3DQVA 2WU2B 3RD2A 1DGJA 1JW9D 4KGTA 5HFYA 3DHIC 4ZRPA 3AE5B 4C80A 2R2QA 3EC8A 2RDHA 1FPYA 1Q1OA 2KQ7A 1RWSA 2K6QA 1R7SA 4KSKC 5JHBA 4OZAA 4LNNA 3PLUA 4XE0A 4A55A 2Z0DB 3Q8BA 1JRUA 4XWWA 2J53A 4M0WB 3MFGA 1DOYA 3QK0A 2W55A 2ICIA 3DVGY 4IUMB 1AARA 4WWOA 2INNE 4ANXA 3PZ8A 3Q8EA 1QQRA 3RCZA 1I4PA 2INPE 3KUZA 1E7UA 3PO0A 5D2MB 4IOIE 4GXBA 2L7RA 4MJSB 1QILA 4XZ4A 4AS1A 4MELA 3ENEA 4NJ6A
chains in the Genus database with same CATH topology
4ZHPA 2PVGC 1TKEA 5FK9C 1JWSD 4N58A 1MHHE 2BTEA 1JMLA 4WIPA 2OHFA 1FCCC 1OFFA 1T3QA 5D7GA 3BYTB 3V05A 1L6VA 2Y5CA 2K9XA 3E9SA 1MVKA 1SJED 1IUEA 2BS4B 1K50A 4IDIA 1TS4A 4ARCA 3CWIA 4H2AA 2CJOA 2V3NA 1N5XA 1PGBA 2BS3B 4RGMA 1L0VB 1VR9A 1V97A 3OWEB 2SAKA 3GP7A 4AQ7A 2JYEA 1STEA 1SB3C 3BYYB 1ZUD2 5EE9A 2WDRB 2Y3AA 3BVMA 3AECB 4C7YA 2L52A 1YN5A 2PLPA 1VJKA 3C8YA 3SFEB 2JU6X 5BYSA 1QT9A 1T6BX 1XO3A 2L32A 3BZDB 1IBXA 3VRAB 4M0WA 1FXAA 5HG2A 1C78A 1CK1A 3NVYA 2RDGA 1GPXA 2K0PA 4OZCA 3URYA 2BT6A 4EE2A 3HUIA 2XN9C 2DWQA 1SXTA 4XDDA 1N61A 2HTME 1I4GA 1JROA 2G9HD 1FNWA 4YTNB 4D2KA 2JZPA 3AN1A 1NYRA 1YJJA 2N9KA 2N0SB 3LB8C 1ZP0B 1ZXIA 5AUKA 3VRBB 2BB5A 1XLNA 2QEJC 1XLPA 5AUIA 3NVWA 4N6EB 3NS1A 4J3OD 2WDVB 4YXDB 1RM6C 1TYGB 2JSVX 2TSSA 1F2RI 5BYQA 5JXVA 1ZPSA 2WXLA 3R8BA 1YJIA 3EUB2 1FRDA 5H8YE 1JWBD 4MM3B 4RCOA 2QILA 1FNUA 3ZJTA 2JXTA 1TY2A 2LMCA 2NMQA 4NAMA 4HKZE 2ON8A 1DYQA 2WLBA 1D6EC 2KN4A 2JQRB 4TQ0A 4HKQA 3I57A 2YEPF 2WXQA 3AEEB 2KACA 4JWUC 3W9CB 1XCTL 1T5XD 4YTMB 2DLBA 2RPVA 3ZQ4A 1JWUD 4Q2JA 2CJNA 1V1PB 3RPFC 1AN8A 3BK1A 2Q5WD 4LK0M 1PGXA 1YNTE 1YQ3B 2QMTA 3MJ5A 5BMIA 3AMZA 3T3OA 4WURA 1K52A 3VQIA 3P42A 4PT5A 1UUPA 3L4PA 3I9V1 4YSXB 1VLBA 1XEEA 4P6VF 1QOFA 2K3UA 2WP9B 3KWLA 3P4QB 4KGSA 2PIAA 3RFZB 2LUMA 4LTUA 4OHJA 1ENFA 3U4EG 3IAS1 4KKJA 4GDLB 1IGDA 4JX1C 1QOBA 1SE2A 3SR6A 4LLGM 2K22A 4HRSA 3ETRA 3AH7A 1XLOA 4XWTA 2NTSA 1EU3A 2AX5A 1FMAD 1M4VA 2IJ0A 2MH7A 3ZJVA 2WXJA 2Z8LA 3T3NA 2MEKA 1FD6A 1XF5L 2BW2A 2WU5B 1FM0D 1PGAA 4OVZA 4WAFA 1B9RA 5HHDG 3FILB 4L23A 3W5VB 1TKYA 2KMMA 5HI1A 2E6XA 1QF6A 1IGCA 3HRDD 2LHEA 2NTTA 3KWVA 3NVVA 1V1OA 2GRIA 3AEAB 1D5MC 1FIQA 3Q8FA 1EWYC 2PW9A 4JE3B 2W3SA 3AE2B 3E56A 4ARIA 5E6JA 2GI9A 4YTPB 3V3XA 4TMAB 4JWSC 1ET6A 1I4XA 1Q10A 1XCQL 1YMHE 3AE6B 3HVZA 4RGNA 4XDCA 3FAHA 5MPOA 1SEBD 2D5GA 1ZOYB 1SIJA 2IGHA 2EKIA 2ZW0A 3ZYYX 1BXTA 1L4ZB 2LGIA 1K53A 2X38A 3AE9B 2ACZB 2DYMA 2L83A 5EE1A 2J4XA 2LHDA 4L1BA 1YQ4B 1GAQB 3IT4B 4A90A 1HA5A 1I4RA 2K5PA 1HZ5A 1OQRA 1BMLC 1FXIA 1WWTA 4ITKA 3SFDB 2J52A 2I2YA 2WDQB 2L1AA 3PZ7A 4GDKB 1GOZA 4REZA 3CIRB 1QKZA 1WXQA 3BK2A 4KX6B 1N62A 1QLBB 2IGGA 3BWUD 1F0ZA 3TSSA 2EELA 4DXGA 1TS3A 1C4CA 1JQ4A 1KF6B 1KRHA 5BYRA 3TEWA 2LEKA 1F77A 1FO4A 1AWDA 2LFIA 3AM9A 4OZBA 3U2SC 1CJEA 5BMGA 1MHXA 1KTKA 3FILA 4A9AA 3R2TA 5EE0A 1WSPA 5C2TB 3W2DA 3TEYA 3ZGZA 1OQQA 3AV8A 1UWXA 2PVOD 4WQMA 1L6UA 1PDXA 2MJDA 1K51A 1ET9A 3AE3B 4RF0A 1XLQA 1DOIA 4MT5A 2WXHA 1VDVA 2J42A 2ZW1A 2G1EA 5TSSA 1FCLA 3WCQA 4KKIA 1FNVA 3O13A 2M56B 4RNAA 4A8XC 4O1NA 3U7ZA 2OEDA 1I7HA 4A6QA 1GB4A 1FFUA 1NI3A 2QSDA 2AQ1B 3HVDA 1E7PB 1AYFA 1XXGA 3EA6A 5G5HA 1YN3A 2JYTA 3GB1A 1UNSA 2JX5A 1VZ7A 1JCKB 2LJIA 2H89B 2VZKB 3AE8B 1EWCA 2H88B 1WGKA 1UWMA 2WXRA 1HQRD 1E0ZA 1N60A 1FFVA 3SEBA 1N5WA 2AQ3B 2VZKD 4N59A 2WXNA 2RMMA 1JWAD 4CQNA 3AEFB 2WXMA 5LNK1 1L0YB 2WXOA 2W54A 4RF1A 3UI3A 2N7JA 2XNAC 2CU3A 3LXFA 1QOGA 1J7AA 3NUHB 1TS5A 3W5UB 1SF0A 2BS2B 5FKAC 3EGRA 3BVZA 3DWMA 1AW7A 2KAJA 2M0AA 3NVZA 2B76B 2FUG1 4FXCA 4ZOHC 3TEXA 1GB1A 1N63A 4NZLB 1QOAA 4HJGE 1E9MA 3MP9A 1NVID 5G5GA 4NJCA 1NEKB 1CZPA 2FE8A 1B1ZA 1TY0A 2WXGA 2Y5PA 4RFBA 4RH6A 4NAWB 3R2IA 4ZHOA 1C79A 1Y56A 3ABVB 2IPKD 1C9FA 1UGJA 1E10A 4B0MA 2PMVA 2WXIA 5BMHA 4C56C 3H8HA 1JALA 1CQVA 2ONQA 1TZOA 5EE3A 3ZJUA 2R61A 2QIEB 3NRZA 1DOXA 1ACCA 4RGOS 2QJLA 3AB5A 1VZ6A 4TQ1A 3B2FA 1J7BA 1TJEA 2WXPA 4RGTA 1A70A 1RYJA 1KH0A 1V1PA 4US9A 1ZE3D 1MPEA 1TKGA 4DXFA 1SE3A 2WXFA 4HEA1 3FC4A 1JWMD 1JRPA 4KGRA 2M19A 4USAA 1D4BA 2WXKA 1SE4A 2WNMA 3J9CA 1D5XC 1HEZE 3AEDB 3AE1B 2MJEA 5D3IB 4IKGA 1KLUD 2V4IB 1KLGD 3BVGA 3Q69A 5T8IA 2HDEA 4HROA 4WH4A 3P63A 4YWGG 2BYTA 4YT0B 3MC0B 2PTLA 3W1SA 3P4RB 4US8A 1FEHA 1YN4A 2V3PA 1PFDA 4ZRQA 1V8CA 2V0GA 3VR8B 3P4PB 4YSYB 3P1MA 1WRIA 3LYYA 5FR3A 1PUTA 3AE4B 4L2YA 4R3DA 3AEGB 1E6EB 1ZXHA 4P16A 3VR9B 1D5ZC 1P7FA 4OW0A 2DBYA 1L0XB 2WS3B 4DQOC 1VZ8A 2KDMA 1BUIC 1C76A 5C3JB 5GXGB 2SEBD 4MACA 3B9JA 4GLSC 2KWDA 4TSSA 2I38A 1C77A 2IDYA 1EU4A 2AQ2B 2GB1A 2W82A 3BIID 1F2RC 1P7EA 1RFKA 3P4SB 4C7ZA 2BBCA 1VRAB 2DYOA 3MHZA 5D3DA 2W3RA 2E3TA 4UDUC 2IGDA 3TEZA 1HZ6A 2WU2B 1DGJA 1JW9D 4KGTA 5HFYA 1TS2A 3Q8CA 1SSNA 4ZRPA 3AE5B 3TUOA 4C80A 2FBWB 3B2GA 2RDHA 4MH8A 1RWSA 4ZYSA 1R7SA 1NYQA 4OZAA 4XE0A 1WYGA 3AEBB 4A55A 1MI0A 3Q8BA 1HXYD 4JPSA 1C4AA 4XWWA 1IBXB 3N9YC 2J53A 3KLSX 1LO5D 3IAM1 3IT6B 3MFGA 4B0EA 2JWUA 1DOYA 1KFYB 2W55A 1L5PA 2ICIA 3Q8AA 3DWGC 1NENB 3AE7B 1I4HA 3U52E 2N9LA 2PKOA 2INNE 4WWMA 3KQ4A 2MJ3A 3PZ8A 1QQRA 3Q8EA 1L4DB 1I4QA 1I4PA 1FRRA 2INPE 1J7CA 3PO0A 1EM7A 4IOIE 2BB6A 3IXSA 1SBBB 1ROEA 3NZ3A 2YEPB 1PYWD 2KQ4X 1QILA 2WQYB 5H92C 4YSZB 1SJHD 3GS2A 5I4DA 4AS1A 1ESFA 1ZDVA 1C4PA 1ZDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YWG G;  4DQO C;  3U2S C;  3U4E G; 
#chains in the Genus database with same CATH topology
 2PVG C;  5FK9 C;  4I6N B;  4N58 A;  2N7E A;  1MHH E;  4K7S A;  5D7G A;  3V05 A;  3ZW3 A;  3BYT B;  5E6P A;  3GE3 C;  3R7R A;  1MVK A;  1KLV A;  2BS4 B;  3CWI A;  1MG8 A;  4LJP B;  4MGI E;  4H2A A;  3ZNZ B;  2ZVN A;  5CTR C;  1L0V B;  1M94 A;  4BVU C;  3GP7 A;  4AQ7 A;  3A1Q B;  1YOV B;  3VH4 B;  1LM8 B;  1TT5 B;  2LVP A;  2NBW B;  5BYS A;  1CMX B;  3BIN A;  1IBX A;  2RSU A;  2KK8 A;  3L54 A;  4HLE A;  3DBR I;  2ASQ A;  1CK1 A;  4TV3 A;  2EMS A;  2LI5 A;  4OZC A;  3TMP B;  3HUI A;  1KJT A;  4K3B A;  1LQB A;  2G9H D;  1EF1 A;  2JZZ A;  4NNJ B;  4NAW A;  2N9K A;  2N0S B;  1ZP0 B;  1ZXI A;  3VRB B;  1XLN A;  1N6Z A;  2V3S A;  3H7P B;  5E6O A;  3NVW A;  3NS1 A;  3UF8 A;  4E71 A;  3R8B A;  4J6I A;  1FRD A;  4MM3 B;  1FNU A;  4C4V B;  5CHV C;  1TY2 A;  2LMC A;  4HPM B;  3RNE C;  3SDL C;  2ON8 A;  3ZNH B;  1D6E C;  3I57 A;  3HHM A;  2WXQ A;  2PPH A;  3AEE B;  2KAC A;  3W9C B;  3GZN B;  3ZQ4 A;  1WMH B;  2N1V A;  2QMT A;  5BMI A;  3DHG C;  2C60 A;  2M1M A;  1UUP A;  4YSX B;  3ML9 A;  1XEE A;  2J7Q B;  3DCG A;  3JVZ X;  3RT3 B;  2K3U A;  4BFR A;  2L3Z A;  3RFZ B;  4LTU A;  2LVQ A;  1ENF A;  4W9D A;  3IAS 1;  3HIZ A;  2ZVO A;  2C5L C;  4JX1 C;  1QOB A;  1SE2 A;  4DBG A;  3AH7 A;  3R7Q A;  4XWT A;  5AZF A;  1EU3 A;  1UGM A;  1FMA D;  2AX5 A;  1R4M B;  2INC C;  4MDK E;  4JL9 A;  2MWS B;  3T3N A;  3UIO B;  2WU5 B;  4WAF A;  1WGG A;  3AUL A;  2QC8 A;  1OEY J;  3QC8 B;  4L23 A;  3W5V B;  3DBL B;  2KJR A;  3HRD D;  1EUV B;  4XX5 A;  1V1O A;  1IPG A;  3RMK C;  4HVB A;  2PW9 A;  2MSE D;  3AE2 B;  1WF9 A;  5E6J A;  3V3X A;  4GMV A;  4TMA B;  4HPP A;  1D3Z A;  2IZV B;  4XDC A;  1SEB D;  2EKI A;  3ZYY X;  2KFJ A;  1OEY A;  4RM8 A;  2LHD A;  4S0R A;  4L1B A;  1YQ4 B;  3H9D A;  4II3 B;  1I4R A;  3ZKJ C;  1HZ5 A;  4BKG A;  2J52 A;  3V62 A;  5IO9 A;  3MC9 A;  2MA9 B;  4REZ A;  4MJS A;  3CIR B;  4K81 A;  5LLI A;  4F8C B;  4XC2 A;  1F0Z A;  4LDT B;  1C4C A;  1JQ4 A;  3VTU A;  3WAM A;  1KRH A;  1LGR A;  1UF0 A;  4JGH B;  3AM9 A;  4G3X B;  3FIL A;  4A9A A;  2DX5 B;  3I5J C;  5EE0 A;  5C2T B;  5J18 A;  2N4F A;  1V6E A;  5CHW A;  1L6U A;  1ET9 A;  2XEW A;  4WJP A;  2ZNV C;  5TSS A;  1FCL A;  3WCQ A;  4KDL B;  1FNV A;  4A8X C;  4URK A;  4RNA A;  3U7Z A;  3PRP B;  2OED A;  1WH3 A;  1WM3 A;  2AQ1 B;  1E7P B;  1XXG A;  5G5H A;  1YN3 A;  3DBH B;  1L2N A;  4BKT A;  2EMT A;  2K8C A;  5G55 A;  1HQR D;  2KOX A;  4LNO A;  2AQ3 B;  4KZ0 A;  2VZK D;  4N59 A;  3PRM B;  4CQN A;  3DHH C;  4YL8 A;  1L0Y B;  2WXO A;  2BF8 B;  4ACF A;  3UI3 A;  2N1W A;  2CU3 A;  3U30 A;  1SF0 A;  3EGR A;  2CKH B;  3BVZ A;  3DWM A;  4MGZ E;  2D10 A;  2FCS A;  3NVZ A;  2B76 B;  2HJ1 A;  1TTN A;  1P3Q U;  1PQS A;  4CO7 A;  4HJG E;  2GBJ A;  4MM3 A;  5G5G A;  4NJC A;  1B1Z A;  4E3C A;  4RFB A;  3R2I A;  2NCN A;  4ZHO A;  1Y56 A;  3ABV B;  2OJR A;  2IPK D;  2KC2 A;  2PMV A;  2FIF A;  4M8N A;  4PK1 A;  1CQV A;  3KH0 A;  3ZJU A;  2R61 A;  2QIE B;  1WRD B;  4HCN B;  2QJL A;  3AB5 A;  1VZ6 A;  1ZW7 A;  3I63 C;  1TKG A;  1YQB A;  4HEA 1;  4DK5 A;  2WXK A;  1SE4 A;  2WNM A;  4AOF A;  2XK5 A;  4W9J A;  3TIX A;  3AE1 B;  3ZXR A;  4A20 A;  5T8I A;  3P63 A;  2BYT A;  4DHJ B;  3CST A;  3MC0 B;  1R4N I;  1T0S C;  1WGH A;  2JZ3 B;  1V8C A;  4A3O A;  1S1Q B;  3MTN B;  3A9J B;  2L0T A;  3P1M A;  3PT2 B;  4R3D A;  2LXC A;  3CMM B;  1VZ8 A;  1C76 A;  4MAC A;  2KWD A;  4TSS A;  4M01 A;  3HK0 A;  3TBL D;  1EU4 A;  3BII D;  5JHA A;  1F2R C;  3AU4 A;  2KWU B;  4BOS C;  3MJW A;  3DBS A;  2FCM A;  2I1K A;  3DBL I;  2FAZ A;  3VAW A;  1HZ6 A;  4EZK A;  4B9K A;  3Q8C A;  3M63 B;  4ICV A;  2O2V A;  2J0K A;  3TUO A;  3B2G A;  2LGX A;  2D3A A;  1NYQ A;  3LJ3 A;  2KO3 A;  3WAL A;  1HXY D;  1YIW A;  2J0M A;  1IBX B;  1C4A A;  3H7S A;  1LO5 D;  3IAM 1;  2JWU A;  1KFY B;  1L5P A;  3X23 A;  1XQQ A;  3AE7 B;  3KQ4 A;  1L4D B;  2LXA A;  1FRR A;  1J7C A;  2W9N A;  4GOC A;  4W9F A;  5IA7 A;  2DZI A;  2MBQ A;  3PHW B;  1ROE A;  3NZ3 A;  2YEP B;  2KQ4 X;  5H92 C;  4YSZ B;  2WQY B;  5I4D A;  3GS2 A;  2LUE A;  4PYU A;  1C4P A;  4ZHP A;  2JY6 A;  1TKE A;  1JWS D;  3APD A;  1KOT A;  3ZNI D;  5DPR A;  2Y5C A;  1RAX A;  3E9S A;  4ZDV A;  3NG0 A;  3CSF A;  2DNF A;  4B95 A;  1PGB A;  4N9F 4;  3OWE B;  2SAK A;  1IP9 A;  1SB3 C;  5BO4 B;  1ZUD 2;  2Y3A A;  3BVM A;  1EO6 A;  4C7Y A;  2L52 A;  1YN5 A;  3C8Y A;  1VJK A;  3SFE B;  1WJU A;  3A4R A;  1YJ1 A;  1FXA A;  2MBO A;  1MG4 A;  2KWC A;  4AJW A;  3ECI A;  3B08 A;  1GPX A;  4LNI A;  2XN9 C;  1SXT A;  2ZEQ A;  4MGK E;  1I4G A;  2C7H A;  5IAA C;  2GLS A;  3RUL A;  4W9G A;  1NYR A;  2YLM A;  3TL5 A;  1K8R B;  3N1X C;  1G6J A;  5AUI A;  5LXH A;  4YXD B;  2KDI A;  1KM7 A;  1F2R I;  5BYQ A;  2DEN B;  1ZPS A;  5JXV A;  4EUT A;  1YJI A;  4GB9 A;  3EUB 2;  2CU1 A;  3ZIM A;  4BBN C;  5DPT A;  1UZX B;  4K7W A;  3RNG C;  1WXV A;  2GMI C;  4NAM A;  2WLB A;  2OJW A;  2JQR B;  2PJH A;  2HD5 B;  4TUU A;  2FNJ B;  5HKH A;  4YTM B;  3BY4 B;  1GJZ A;  4MEM A;  1P98 A;  1AN8 A;  3A9J A;  4JIO U;  3T3O A;  3T9L A;  4MSM B;  4WUR A;  3VQI A;  5L95 C;  5DPW A;  3V6E B;  1P9D U;  1UH6 A;  3KWL A;  4KGS A;  5G2N A;  2JRH A;  3Q3F A;  4KKJ A;  4GDL B;  3SR6 A;  4EFO A;  2QHO A;  4EEW A;  2C7M B;  2IO1 B;  2KC1 A;  1J0G A;  2D3G A;  2IO2 B;  3M95 A;  4IM2 A;  3ZJV A;  3WIM A;  3OJ4 B;  4OVZ A;  5HHD G;  3FIL B;  1E7V A;  1QF6 A;  2LHE A;  2NTT A;  3VFK A;  1D5M C;  2B3A A;  1EWY C;  4XYC A;  2W3S A;  1RFA A;  4ARI A;  2V4L A;  4YTP B;  3OAW A;  1A5R A;  3AE6 B;  3FAH A;  5MPO A;  3B1L X;  4A3P A;  2D5G A;  4ASW C;  3C0R B;  2IGH A;  2ZW0 A;  1L4Z B;  4IC7 B;  2LGI A;  2JWZ A;  1T0Y A;  5J2R A;  1K53 A;  2ACZ B;  5EE1 A;  2L83 A;  2ZPY A;  1GAQ B;  4A90 A;  1HA5 A;  4MGY E;  3VXW A;  2PE9 A;  3NZU A;  3DVN V;  1BML C;  3SFD B;  1WWT A;  2I2Y A;  2WDQ B;  2L1A A;  4GDK B;  4W9I A;  1QKZ A;  2AL6 A;  1WXQ A;  4KX6 B;  2LRU A;  2KN5 A;  1QLB B;  3VVW B;  3BWU D;  2M4N A;  4DXG A;  2BWF A;  2DHZ A;  3TEW A;  1F77 A;  1AWD A;  5BMG A;  3M62 B;  2IBI B;  2K8B A;  2FID A;  3AV8 A;  2HE7 A;  2PVO D;  4WQM A;  3QA8 A;  4JLC A;  1PDX A;  2NPT B;  3AE3 B;  4RF0 A;  3QAR A;  2WXH A;  1FXT B;  5IKC M;  1J19 A;  4ICU A;  1J8C A;  2D2Q A;  4KKI A;  1WYW B;  3W1Y A;  3L16 A;  1WXS A;  3T8M A;  2KKC A;  1FFU A;  2QSD A;  2KFK A;  3GB1 A;  1E8X A;  2LJI A;  2H89 B;  2VZK B;  2GBM A;  1EWC A;  2H88 B;  2G4D B;  1VD2 A;  3IVF A;  1FFV A;  3SEB A;  2ZPN A;  1N5W A;  2XK5 B;  4WJN A;  2RMM A;  2KDF B;  3AEF B;  3MC8 A;  2W54 A;  3PTF C;  4RF1 A;  2KT7 A;  2XNA C;  4C00 A;  4DDI D;  4FUL A;  2KYW A;  3NUH B;  3W5U B;  4E74 A;  2O6V D;  5FKA C;  2KAJ A;  4FXC A;  3TEX A;  4EZL A;  2EKE C;  1SIF A;  5LXI B;  5AZH A;  1CZP A;  2FE8 A;  1TY0 A;  1Z2M A;  4RH6 A;  3NY5 A;  1WE6 A;  1TBE A;  3KUD B;  3V61 A;  4K1R B;  1C9F A;  2WXI A;  3KVF B;  2ONQ A;  4FAD A;  3L08 A;  3WAP A;  1ACC A;  2MX2 A;  4F1S A;  1TJE A;  2VRR B;  4CHK A;  4I6L B;  2Z0E B;  1MFW A;  3HM6 X;  2KHW B;  3PGE A;  3FC4 A;  1JWM D;  1JRP A;  2KTF A;  1D4B A;  3J9C A;  1D5X C;  3AED B;  4ZYN A;  2MJE A;  2O2V B;  5D3I B;  4WH4 A;  1C3T A;  1C1Y B;  4YT0 B;  2GBR A;  2PTL A;  3W1S A;  2MLB A;  1WM2 A;  4US8 A;  4GDL A;  1YN4 A;  4QAY A;  2KZR A;  1PFD A;  1WX7 A;  4ANW A;  4HXD A;  4ZRQ A;  2MCN B;  4MSQ B;  3VR8 B;  2BKF A;  3QX1 A;  4K7U A;  3EFC A;  1V49 A;  5FR3 A;  1PUT A;  2WDT B;  4W9C A;  3AEG B;  4FJV B;  2LZ6 A;  1D5Z C;  1P7F A;  3R3M A;  4OW0 A;  2GBN A;  3KW5 B;  5GXG B;  1V81 A;  4BZA A;  3OJ3 A;  2JUO A;  3B9J A;  4GLS C;  4DDG D;  2WYQ A;  2C7N B;  1WX8 A;  3QIJ A;  1C77 A;  3NS8 A;  3UQA A;  2KMC A;  2UYZ B;  2W82 A;  4AJY B;  1OQY A;  1RFK A;  1P0R A;  4M8M A;  2DYO A;  3MHZ A;  2E3T A;  4BOZ B;  2RPQ A;  3NZS A;  3PRZ A;  4IWQ A;  1TZ1 A;  1TS2 A;  1SSN A;  3Q3O C;  2LAS A;  4FBJ B;  2BYV E;  4BBN F;  3AEB B;  1MI0 A;  4GDK A;  4OVU A;  1UBQ A;  4JPS A;  3C19 A;  4AWJ A;  3N9Y C;  3KLS X;  3IT6 B;  4EOY A;  3VH3 B;  2LGS A;  2BYE A;  2L05 A;  3ZTC A;  3U52 E;  2PKO A;  3A33 B;  4DWF A;  4WWM A;  2MJ3 A;  4KV2 A;  4M02 A;  3D32 A;  3TJP A;  4PS8 A;  1SBB B;  2NPT A;  3EEC A;  1NDD A;  1ZDV A;  3ZXV A;  2BTE A;  2OHF A;  1FCC C;  1OFF A;  1T3Q A;  1L6V A;  4WAA A;  1SJE D;  1IUE A;  1K50 A;  2KX0 A;  1TS4 A;  4IDI A;  2ZCB A;  2CJO A;  2V3N A;  1N5X A;  1HTO A;  1VR9 A;  5KHQ A;  1V97 A;  4ANV A;  2JYE A;  1STE A;  3V6C B;  3BYY B;  2L00 B;  3AEC B;  3VTV A;  3PLV A;  2PLP A;  3H6N A;  1OGW A;  1T6B X;  1XO3 A;  3GZN I;  2L32 A;  3QCA A;  2D3B A;  3VRA B;  3N20 C;  5HG2 A;  1C78 A;  4FHJ A;  4HPL B;  1F1H A;  2ZCC A;  3NVY A;  2LJ5 A;  4TKN A;  2RDG A;  1S3S G;  2LD9 A;  4XGA B;  2K0P A;  3ZVV A;  2BT6 A;  4EE2 A;  2DWQ A;  1JRO A;  1FNW A;  2RGF A;  4HDQ A;  1WY8 A;  4D2K A;  2JZP A;  3AN1 A;  2KDE B;  4LNK A;  3LB8 C;  2KTR A;  1BT0 A;  2BB5 A;  1XLP A;  3ZRC A;  4N6E B;  4AP4 C;  1R4M I;  3IFW B;  1MJD A;  2JSV X;  2MRP A;  1SGH A;  2WXL A;  2MP2 B;  5H8Y E;  1JWB D;  4RCO A;  2BVC A;  3CF6 E;  2M8S A;  3ZJT A;  2JXT A;  5EDS A;  3IBE A;  4M00 A;  4TQ0 A;  2WX0 A;  5C1Z A;  1RLF A;  1TGZ B;  5DCN A;  1T5X D;  3Q2A C;  2DLB A;  2RPV A;  2PEA A;  3DBR B;  1E8Z A;  3SD5 A;  3UIP B;  1WGR A;  2Q5W D;  3WAN A;  1V9J A;  3ZRF A;  5DPS A;  3MJ5 A;  1YQ3 B;  3AMZ A;  2BKR B;  3APC A;  3P42 A;  3L4P A;  2JRI B;  3AXC A;  2WP9 B;  3P4Q B;  2BWE S;  2MBB B;  4LNF A;  4OHJ A;  2KAN A;  3U4E G;  3MHS D;  4IWO A;  3DOW A;  2NBU A;  4NQL B;  3ETR A;  3N32 A;  3SU8 X;  1M4V A;  2IJ0 A;  2WXJ A;  2JXX A;  2Z8L A;  2MEK A;  1FD6 A;  2BW2 A;  1PGA A;  1B9R A;  4EZJ A;  2KMM A;  5HI1 A;  1WZ0 A;  2CR5 A;  4GN1 A;  2K39 A;  2K1F A;  2WX1 A;  1ZKH A;  3PRE A;  3KWV A;  3A9K A;  4DHZ B;  4W9L A;  3Q8F A;  1FIQ A;  2AL3 A;  3NHE B;  1H8C A;  1ISN A;  3ML8 A;  2IND C;  4JE3 B;  2KNB A;  3E56 A;  2G45 B;  2HTH A;  2GI9 A;  2LGY A;  3PHX B;  4LJO B;  3VUW A;  1E90 A;  4JWS C;  3JW0 X;  1ET6 A;  2KVR A;  1XT9 B;  1ZOY B;  1E8W A;  3DBH I;  1BXT A;  2KFK B;  2N9E B;  3AE9 B;  2DYM A;  2DZM A;  2J4X A;  4W9K A;  2BYF A;  3FKY A;  3IT4 B;  3PS6 A;  4BKS D;  4ITK A;  5JH5 C;  3DDC B;  1GOZ A;  4DHJ D;  2NS5 A;  1N62 A;  3H1U A;  3TSS A;  1GUA B;  2EEL A;  1KF6 B;  5BYR A;  3K9P B;  2LEK A;  3U2S C;  1MHX A;  2JVC A;  3R2T A;  4GSW A;  3W2D A;  3ZGZ A;  4PS3 A;  1WJ4 A;  1OQQ A;  4IG7 B;  1UWX A;  1F9J A;  2MJD A;  5IP4 D;  1K51 A;  2IY0 B;  2FCN A;  3TCA A;  2G1E A;  1H4R A;  3N1Y C;  4OVV A;  5IOI A;  2QDF A;  2JPH A;  4O1N A;  3NJT A;  3RNF C;  2RR9 A;  4WWP A;  5D6J B;  1NI3 A;  2M17 A;  3HVD A;  1AYF A;  3EA6 A;  4KVG B;  2GBK A;  2DAJ A;  2MBH A;  1UNS A;  3Q3M C;  3ZUN A;  1JCK B;  3ZTD A;  3L17 A;  4BKS A;  2LVO A;  2V1Y A;  5E6N A;  2K8H A;  1WGK A;  2MBE A;  5L83 A;  1N60 A;  1GNU A;  1XD3 B;  2KXJ A;  3PV1 A;  3I3T B;  1JWA D;  1T0Q C;  5LNK 1;  4NY0 A;  3APF A;  2O6V B;  2N9P C;  2N7J A;  2ZJD A;  2BQQ A;  3LXF A;  1QOG A;  2BS2 B;  3RNC C;  2M0A A;  1ZGU B;  4ZRK A;  2FUG 1;  2AWT A;  3Q6B A;  2KLC A;  1GB1 A;  3QWZ B;  4MH0 E;  4KSL C;  2MP2 A;  3B0A A;  4FJZ A;  1NVI D;  3UIN B;  2WXG A;  1V86 A;  2G4S A;  2JF5 A;  3WA0 A;  1E10 A;  3WAO A;  3QHT A;  5BMH A;  2WHI A;  4C56 C;  3H8H A;  1TZO A;  4ANU A;  1GG3 A;  4RGO S;  1WFY A;  4CYE A;  3JSV A;  4TQ1 A;  1LFD A;  4II2 B;  2WWZ A;  1J7B A;  4RGT A;  3ALB A;  1SE9 A;  1A70 A;  1RYJ A;  1MPE A;  2VH2 A;  1SE3 A;  4NJ7 A;  4X57 B;  4KGR A;  2M19 A;  4USA A;  1HEZ E;  2NR2 A;  1I35 A;  1KLU D;  2V4I B;  3BVG A;  2HDE A;  4YWG G;  4PS7 A;  2DZK A;  3KYC D;  3IG3 A;  4WQO B;  2N9X A;  3QQ8 B;  4HWI B;  3X0W A;  4IWP A;  2V0G A;  3P4P B;  2MHJ A;  1QZE A;  2UWQ A;  1WRI A;  4L2Y A;  1ZXH A;  4P16 A;  3S2A A;  4GGQ A;  3W1S C;  2K6D B;  4WJO A;  2WS3 B;  4DQO C;  4IM3 A;  3VUX A;  1BUI C;  5C3J B;  4JQW C;  2LWP A;  4FN2 A;  1WZ3 A;  2IO3 B;  1P1A A;  2I38 A;  3P2B A;  2IDY A;  2AQ2 B;  4FJY A;  2A4Z A;  2LRW A;  1VRA B;  5D3D A;  2W3R A;  3ONS A;  3TEZ A;  3N1Z C;  3U7D A;  4IM0 A;  3IHP C;  2FBW B;  4MH8 A;  4ZRI A;  4NQK E;  4ZYS A;  1WXM A;  1UBI A;  1WYG A;  3PSE B;  1OTR B;  4G11 A;  3Q3N C;  1R4N B;  4B0E A;  2RD0 A;  3V60 A;  3Q8A A;  3DWG C;  1NEN B;  1I4H A;  3RNA C;  2N9L A;  1I4Q A;  1WJN A;  1EM7 A;  2AEH A;  2BB6 A;  3IXS A;  5CHF A;  1X1M A;  2HJ8 A;  1PYW D;  1SJH D;  2KTR B;  1I42 A;  1ESF A;  4RMA A;  1ZDX A;  5JZE B;  3EFU A;  2KX3 A;  1JML A;  4WIP A;  3ZNG C;  2ZNV B;  2K9X A;  2CHZ A;  3RNB C;  4KIK A;  4PYZ A;  3RZW C;  4ARC A;  2UU7 A;  2BPS A;  4G50 A;  2BS3 B;  3AU5 A;  4RGM A;  4AUQ C;  5EE9 A;  2WDR B;  3ZO5 B;  3R66 C;  1EF5 A;  2JU6 X;  3GE8 C;  1QT9 A;  2R2O A;  2O6V A;  3BZD B;  4HJK A;  4M0W A;  3Q3J A;  1WGD A;  1HTQ A;  1WIA A;  1IYF A;  3QAQ A;  2KWV B;  3URY A;  5AZG A;  5TR5 A;  4XDD A;  1N61 A;  2HTM E;  3VHT C;  4LCD E;  2Z59 B;  3EHV A;  4YTN B;  2D07 B;  1WXA A;  3RI7 C;  1YJJ A;  3KYD D;  5AUK A;  5AEK B;  2QEJ C;  4FHK A;  5GMV A;  4J3O D;  2WDV B;  1RM6 C;  1TYG B;  2TSS A;  1V80 A;  3N30 A;  3PVL A;  3VDZ A;  2KDB A;  4K3C A;  2QIL A;  5CX3 A;  3Q14 C;  3A1Q A;  2NMQ A;  3M3J A;  2D3C A;  3A9K B;  1YX5 B;  2LGD A;  4HKZ E;  1DYQ A;  2FCQ A;  2KN4 A;  2N7D A;  2ZZP B;  4HKQ A;  2YEP F;  2OOB B;  4JWU C;  1LXD A;  4S17 A;  1XCT L;  3OLM D;  1WE7 A;  1JWU D;  3JYU A;  4Q2J A;  2CJN A;  1V1P B;  3RPF C;  3BK1 A;  4LK0 M;  1F52 A;  1YD8 U;  2KJH B;  1PGX A;  1YNT E;  2DYB A;  2KMA A;  1K52 A;  2CHX A;  4PT5 A;  4P1C C;  3UGB B;  3I9V 1;  1VLB A;  2IO0 B;  2KD0 A;  4P6V F;  1QOF A;  4HCP B;  4BAX A;  4IW0 A;  2PIA A;  2LUM A;  2M0X A;  2Y5B B;  2WGS A;  2C9W B;  1IGD A;  3H7P A;  5C23 A;  4LLG M;  2K22 A;  4HRS A;  3L0W B;  1XLO A;  2NTS A;  1WR6 E;  2MH7 A;  2KLG A;  1XF5 L;  1FM0 D;  4WJQ A;  2NVU I;  1GC7 A;  1TKY A;  2DAF A;  2DZJ A;  4C4V A;  2E6X A;  3ZDT A;  1IGC A;  2GOW A;  4NPN A;  3NVV A;  1Y8R C;  2GRI A;  3AEA B;  3AI5 A;  1YX6 B;  2NBV B;  3KUC B;  2I1J A;  4W9E A;  2REX A;  4KZC A;  2FUH B;  1WMH A;  1Q10 A;  1I4X A;  1XCQ L;  3HVZ A;  1YMH E;  4RGN A;  2BGF A;  3HM3 A;  3K9O B;  1SIJ A;  3A4S C;  2X38 A;  2V9H A;  3ZDM C;  4DXA B;  3RN9 C;  3L13 A;  2K5P A;  3N3K B;  1WJ6 A;  1L7Y A;  1OQR A;  1FXI A;  3PZ7 A;  2J0J A;  2CHW A;  2XBB C;  4DHZ E;  1UEL A;  3BK2 A;  2RDB C;  2IGG A;  1TS3 A;  1VCB A;  2L0F A;  4I6P A;  1FO4 A;  2LFI A;  4OZB A;  1CJE A;  4LDT D;  1KTK A;  1UD7 A;  2G3Q B;  4GIV A;  1WSP A;  3TEY A;  5FR6 A;  3O65 B;  4GU2 A;  4HK2 A;  4W9H A;  1WR1 A;  2A5U A;  1XLQ A;  1DOI A;  4MT5 A;  1VDV A;  4KDI C;  2J42 A;  2ZW1 A;  2KVZ A;  2YVC A;  3O13 A;  2M56 B;  4A6Q A;  1GB4 A;  1I7H A;  2CS4 A;  3JSV B;  4FA6 A;  1WI0 A;  2JYT A;  4B6W A;  2JX5 A;  1VZ7 A;  2MQJ A;  4ZRJ A;  3AE8 B;  3NOB A;  3PPA A;  1UWM A;  2WXR A;  1E0Z A;  5J17 A;  2WXN A;  5D94 A;  3RUI B;  2WXM A;  2L76 A;  4FLH A;  1J7A A;  1TS5 A;  1U4A A;  2VH1 A;  1AW7 A;  4ZOH C;  4EKU A;  3VTW A;  1N63 A;  4NZL B;  1QOA A;  1E9M A;  3MP9 A;  3U8Z A;  4F7Z A;  1NEK B;  2Y5P A;  3DVG X;  4NAW B;  3GOE A;  1C79 A;  1UGJ A;  4B0M A;  1V2Y A;  2QCZ A;  4P7I A;  1JAL A;  5KHO A;  3UQB A;  5EE3 A;  3NRZ A;  2JT4 B;  1DOX A;  3DVN U;  3B2F A;  2WXP A;  4RM9 A;  1KH0 A;  1V1P A;  4US9 A;  1ZE3 D;  4DXF A;  2IY1 B;  3RZF A;  1GC6 A;  2AYO B;  2WXF A;  3LDZ E;  1WX9 A;  3QJZ A;  1Q0W B;  2KJ6 A;  3ZLZ A;  2IYD B;  4IKG A;  1KLG D;  3Q69 A;  4HRO A;  1TIF A;  4P1B C;  2L8J A;  3P4R B;  5IN7 A;  1FEH A;  2V3P A;  1V5T A;  1E8Y A;  2X8X X;  4HDO A;  4YSY B;  1Q5W B;  1E5W A;  3LYY A;  3AE4 B;  1E6E B;  3RYT A;  3VR9 B;  1Z5S B;  2DBY A;  1L0X B;  2KDM A;  4WWN A;  3DPD A;  2SEB D;  3PZD A;  2PE6 B;  3VUY A;  3L10 B;  3OG5 A;  1HE8 A;  2GB1 A;  1T0R C;  1NI2 A;  2MW5 A;  1P7E A;  1V5O A;  3P4S B;  2K25 A;  4C7Z A;  2BBC A;  2D11 A;  1NBF C;  2KQS A;  4KIK B;  4UDU C;  3SHQ A;  2IGD A;  1RRB A;  1WGY A;  4G0N B;  3DQV A;  2WU2 B;  3RD2 A;  1DGJ A;  1JW9 D;  4KGT A;  5HFY A;  3DHI C;  4ZRP A;  3AE5 B;  4C80 A;  2R2Q A;  3EC8 A;  2RDH A;  1FPY A;  1Q1O A;  2KQ7 A;  1RWS A;  2K6Q A;  1R7S A;  4KSK C;  5JHB A;  4OZA A;  4LNN A;  3PLU A;  4XE0 A;  4A55 A;  2Z0D B;  3Q8B A;  1JRU A;  4XWW A;  2J53 A;  4M0W B;  3MFG A;  1DOY A;  3QK0 A;  2W55 A;  2ICI A;  3DVG Y;  4IUM B;  1AAR A;  4WWO A;  2INN E;  4ANX A;  3PZ8 A;  3Q8E A;  1QQR A;  3RCZ A;  1I4P A;  2INP E;  3KUZ A;  1E7U A;  3PO0 A;  5D2M B;  4IOI E;  4GXB A;  2L7R A;  4MJS B;  1QIL A;  4XZ4 A;  4AS1 A;  4MEL A;  3ENE A;  4NJ6 A; 
#chains in the Genus database with same CATH homology
 4ZHP A;  2PVG C;  1TKE A;  5FK9 C;  1JWS D;  4N58 A;  1MHH E;  2BTE A;  1JML A;  4WIP A;  2OHF A;  1FCC C;  1OFF A;  1T3Q A;  5D7G A;  3BYT B;  3V05 A;  1L6V A;  2Y5C A;  2K9X A;  3E9S A;  1MVK A;  1SJE D;  1IUE A;  2BS4 B;  1K50 A;  4IDI A;  1TS4 A;  4ARC A;  3CWI A;  4H2A A;  2CJO A;  2V3N A;  1N5X A;  1PGB A;  2BS3 B;  4RGM A;  1L0V B;  1VR9 A;  1V97 A;  3OWE B;  2SAK A;  3GP7 A;  4AQ7 A;  2JYE A;  1STE A;  1SB3 C;  3BYY B;  1ZUD 2;  5EE9 A;  2WDR B;  2Y3A A;  3BVM A;  3AEC B;  4C7Y A;  2L52 A;  1YN5 A;  2PLP A;  1VJK A;  3C8Y A;  3SFE B;  2JU6 X;  5BYS A;  1QT9 A;  1T6B X;  1XO3 A;  2L32 A;  3BZD B;  1IBX A;  3VRA B;  4M0W A;  1FXA A;  5HG2 A;  1C78 A;  1CK1 A;  3NVY A;  2RDG A;  1GPX A;  2K0P A;  4OZC A;  3URY A;  2BT6 A;  4EE2 A;  3HUI A;  2XN9 C;  2DWQ A;  1SXT A;  4XDD A;  1N61 A;  2HTM E;  1I4G A;  1JRO A;  2G9H D;  1FNW A;  4YTN B;  4D2K A;  2JZP A;  3AN1 A;  1NYR A;  1YJJ A;  2N9K A;  2N0S B;  3LB8 C;  1ZP0 B;  1ZXI A;  5AUK A;  3VRB B;  2BB5 A;  1XLN A;  2QEJ C;  1XLP A;  5AUI A;  3NVW A;  4N6E B;  3NS1 A;  4J3O D;  2WDV B;  4YXD B;  1RM6 C;  1TYG B;  2JSV X;  2TSS A;  1F2R I;  5BYQ A;  5JXV A;  1ZPS A;  2WXL A;  3R8B A;  1YJI A;  3EUB 2;  1FRD A;  5H8Y E;  1JWB D;  4MM3 B;  4RCO A;  2QIL A;  1FNU A;  3ZJT A;  2JXT A;  1TY2 A;  2LMC A;  2NMQ A;  4NAM A;  4HKZ E;  2ON8 A;  1DYQ A;  2WLB A;  1D6E C;  2KN4 A;  2JQR B;  4TQ0 A;  4HKQ A;  3I57 A;  2YEP F;  2WXQ A;  3AEE B;  2KAC A;  4JWU C;  3W9C B;  1XCT L;  1T5X D;  4YTM B;  2DLB A;  2RPV A;  3ZQ4 A;  1JWU D;  4Q2J A;  2CJN A;  1V1P B;  3RPF C;  1AN8 A;  3BK1 A;  2Q5W D;  4LK0 M;  1PGX A;  1YNT E;  1YQ3 B;  2QMT A;  3MJ5 A;  5BMI A;  3AMZ A;  3T3O A;  4WUR A;  1K52 A;  3VQI A;  3P42 A;  4PT5 A;  1UUP A;  3L4P A;  3I9V 1;  4YSX B;  1VLB A;  1XEE A;  4P6V F;  1QOF A;  2K3U A;  2WP9 B;  3KWL A;  3P4Q B;  4KGS A;  2PIA A;  3RFZ B;  2LUM A;  4LTU A;  4OHJ A;  1ENF A;  3U4E G;  3IAS 1;  4KKJ A;  4GDL B;  1IGD A;  4JX1 C;  1QOB A;  1SE2 A;  3SR6 A;  4LLG M;  2K22 A;  4HRS A;  3ETR A;  3AH7 A;  1XLO A;  4XWT A;  2NTS A;  1EU3 A;  2AX5 A;  1FMA D;  1M4V A;  2IJ0 A;  2MH7 A;  3ZJV A;  2WXJ A;  2Z8L A;  3T3N A;  2MEK A;  1FD6 A;  1XF5 L;  2BW2 A;  2WU5 B;  1FM0 D;  1PGA A;  4OVZ A;  4WAF A;  1B9R A;  5HHD G;  3FIL B;  4L23 A;  3W5V B;  1TKY A;  2KMM A;  5HI1 A;  2E6X A;  1QF6 A;  1IGC A;  3HRD D;  2LHE A;  2NTT A;  3KWV A;  3NVV A;  1V1O A;  2GRI A;  3AEA B;  1D5M C;  1FIQ A;  3Q8F A;  1EWY C;  2PW9 A;  4JE3 B;  2W3S A;  3AE2 B;  3E56 A;  4ARI A;  5E6J A;  2GI9 A;  4YTP B;  3V3X A;  4TMA B;  4JWS C;  1ET6 A;  1I4X A;  1Q10 A;  1XCQ L;  1YMH E;  3AE6 B;  3HVZ A;  4RGN A;  4XDC A;  3FAH A;  5MPO A;  1SEB D;  2D5G A;  1ZOY B;  1SIJ A;  2IGH A;  2EKI A;  2ZW0 A;  3ZYY X;  1BXT A;  1L4Z B;  2LGI A;  1K53 A;  2X38 A;  3AE9 B;  2ACZ B;  2DYM A;  2L83 A;  5EE1 A;  2J4X A;  2LHD A;  4L1B A;  1YQ4 B;  1GAQ B;  3IT4 B;  4A90 A;  1HA5 A;  1I4R A;  2K5P A;  1HZ5 A;  1OQR A;  1BML C;  1FXI A;  1WWT A;  4ITK A;  3SFD B;  2J52 A;  2I2Y A;  2WDQ B;  2L1A A;  3PZ7 A;  4GDK B;  1GOZ A;  4REZ A;  3CIR B;  1QKZ A;  1WXQ A;  3BK2 A;  4KX6 B;  1N62 A;  1QLB B;  2IGG A;  3BWU D;  1F0Z A;  3TSS A;  2EEL A;  4DXG A;  1TS3 A;  1C4C A;  1JQ4 A;  1KF6 B;  1KRH A;  5BYR A;  3TEW A;  2LEK A;  1F77 A;  1FO4 A;  1AWD A;  2LFI A;  3AM9 A;  4OZB A;  3U2S C;  1CJE A;  5BMG A;  1MHX A;  1KTK A;  3FIL A;  4A9A A;  3R2T A;  5EE0 A;  1WSP A;  5C2T B;  3W2D A;  3TEY A;  3ZGZ A;  1OQQ A;  3AV8 A;  1UWX A;  2PVO D;  4WQM A;  1L6U A;  1PDX A;  2MJD A;  1K51 A;  1ET9 A;  3AE3 B;  4RF0 A;  1XLQ A;  1DOI A;  4MT5 A;  2WXH A;  1VDV A;  2J42 A;  2ZW1 A;  2G1E A;  5TSS A;  1FCL A;  3WCQ A;  4KKI A;  1FNV A;  3O13 A;  2M56 B;  4RNA A;  4A8X C;  4O1N A;  3U7Z A;  2OED A;  1I7H A;  4A6Q A;  1GB4 A;  1FFU A;  1NI3 A;  2QSD A;  2AQ1 B;  3HVD A;  1E7P B;  1AYF A;  1XXG A;  3EA6 A;  5G5H A;  1YN3 A;  2JYT A;  3GB1 A;  1UNS A;  2JX5 A;  1VZ7 A;  1JCK B;  2LJI A;  2H89 B;  2VZK B;  3AE8 B;  1EWC A;  2H88 B;  1WGK A;  1UWM A;  2WXR A;  1HQR D;  1E0Z A;  1N60 A;  1FFV A;  3SEB A;  1N5W A;  2AQ3 B;  2VZK D;  4N59 A;  2WXN A;  2RMM A;  1JWA D;  4CQN A;  3AEF B;  2WXM A;  5LNK 1;  1L0Y B;  2WXO A;  2W54 A;  4RF1 A;  3UI3 A;  2N7J A;  2XNA C;  2CU3 A;  3LXF A;  1QOG A;  1J7A A;  3NUH B;  1TS5 A;  3W5U B;  1SF0 A;  2BS2 B;  5FKA C;  3EGR A;  3BVZ A;  3DWM A;  1AW7 A;  2KAJ A;  2M0A A;  3NVZ A;  2B76 B;  2FUG 1;  4FXC A;  4ZOH C;  3TEX A;  1GB1 A;  1N63 A;  4NZL B;  1QOA A;  4HJG E;  1E9M A;  3MP9 A;  1NVI D;  5G5G A;  4NJC A;  1NEK B;  1CZP A;  2FE8 A;  1B1Z A;  1TY0 A;  2WXG A;  2Y5P A;  4RFB A;  4RH6 A;  4NAW B;  3R2I A;  4ZHO A;  1C79 A;  1Y56 A;  3ABV B;  2IPK D;  1C9F A;  1UGJ A;  1E10 A;  4B0M A;  2PMV A;  2WXI A;  5BMH A;  4C56 C;  3H8H A;  1JAL A;  1CQV A;  2ONQ A;  1TZO A;  5EE3 A;  3ZJU A;  2R61 A;  2QIE B;  3NRZ A;  1DOX A;  1ACC A;  4RGO S;  2QJL A;  3AB5 A;  1VZ6 A;  4TQ1 A;  3B2F A;  1J7B A;  1TJE A;  2WXP A;  4RGT A;  1A70 A;  1RYJ A;  1KH0 A;  1V1P A;  4US9 A;  1ZE3 D;  1MPE A;  1TKG A;  4DXF A;  1SE3 A;  2WXF A;  4HEA 1;  3FC4 A;  1JWM D;  1JRP A;  4KGR A;  2M19 A;  4USA A;  1D4B A;  2WXK A;  1SE4 A;  2WNM A;  3J9C A;  1D5X C;  1HEZ E;  3AED B;  3AE1 B;  2MJE A;  5D3I B;  4IKG A;  1KLU D;  2V4I B;  1KLG D;  3BVG A;  3Q69 A;  5T8I A;  2HDE A;  4HRO A;  4WH4 A;  3P63 A;  4YWG G;  2BYT A;  4YT0 B;  3MC0 B;  2PTL A;  3W1S A;  3P4R B;  4US8 A;  1FEH A;  1YN4 A;  2V3P A;  1PFD A;  4ZRQ A;  1V8C A;  2V0G A;  3VR8 B;  3P4P B;  4YSY B;  3P1M A;  1WRI A;  3LYY A;  5FR3 A;  1PUT A;  3AE4 B;  4L2Y A;  4R3D A;  3AEG B;  1E6E B;  1ZXH A;  4P16 A;  3VR9 B;  1D5Z C;  1P7F A;  4OW0 A;  2DBY A;  1L0X B;  2WS3 B;  4DQO C;  1VZ8 A;  2KDM A;  1BUI C;  1C76 A;  5C3J B;  5GXG B;  2SEB D;  4MAC A;  3B9J A;  4GLS C;  2KWD A;  4TSS A;  2I38 A;  1C77 A;  2IDY A;  1EU4 A;  2AQ2 B;  2GB1 A;  2W82 A;  3BII D;  1F2R C;  1P7E A;  1RFK A;  3P4S B;  4C7Z A;  2BBC A;  1VRA B;  2DYO A;  3MHZ A;  5D3D A;  2W3R A;  2E3T A;  4UDU C;  2IGD A;  3TEZ A;  1HZ6 A;  2WU2 B;  1DGJ A;  1JW9 D;  4KGT A;  5HFY A;  1TS2 A;  3Q8C A;  1SSN A;  4ZRP A;  3AE5 B;  3TUO A;  4C80 A;  2FBW B;  3B2G A;  2RDH A;  4MH8 A;  1RWS A;  4ZYS A;  1R7S A;  1NYQ A;  4OZA A;  4XE0 A;  1WYG A;  3AEB B;  4A55 A;  1MI0 A;  3Q8B A;  1HXY D;  4JPS A;  1C4A A;  4XWW A;  1IBX B;  3N9Y C;  2J53 A;  3KLS X;  1LO5 D;  3IAM 1;  3IT6 B;  3MFG A;  4B0E A;  2JWU A;  1DOY A;  1KFY B;  2W55 A;  1L5P A;  2ICI A;  3Q8A A;  3DWG C;  1NEN B;  3AE7 B;  1I4H A;  3U52 E;  2N9L A;  2PKO A;  2INN E;  4WWM A;  3KQ4 A;  2MJ3 A;  3PZ8 A;  1QQR A;  3Q8E A;  1L4D B;  1I4Q A;  1I4P A;  1FRR A;  2INP E;  1J7C A;  3PO0 A;  1EM7 A;  4IOI E;  2BB6 A;  3IXS A;  1SBB B;  1ROE A;  3NZ3 A;  2YEP B;  1PYW D;  2KQ4 X;  1QIL A;  2WQY B;  5H92 C;  4YSZ B;  1SJH D;  3GS2 A;  5I4D A;  4AS1 A;  1ESF A;  1ZDV A;  1C4P A;  1ZDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...