4YWGG

Crystal structure of 830a in complex with v1v2
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
118
structure length
103
Chain Sequence
MTTFKLAACVTLNCTETRVKHCSFNITTDVKDRKQKVNATFYDLDIVPLSSSLYRLISCQTTTTEAVDAATAAKVFKQYANDNGIDGEWTYDDATKTFTVTEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Light chain of anti-HIV-1 gp120 V1V2 antibody 830A
publication title The V1V2 Region of HIV-1 gp120 Forms a Five-Stranded Beta Barrel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein/immune system
total genus 17
structure length 103
sequence length 118
chains with identical sequence Q
ec nomenclature
pdb deposition date 2015-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.790 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4ywgG00
4DQOC 4YWGG 3U2SC 3U4EG
chains in the Genus database with same CATH superfamily
2Z0DB 3RNEC 5J18A 2M17A 5LLIA 3PHXB 1WJ6A 4NY0A 3RUIB 3WALA 3NZ3A 2JUOA 1HEZE 1C4AA 1ZXHA 1YN5A 3BIID 1V1OA 1WX9A 4ZRKA 1MVKA 3WAMA 1L6VA 4YSYB 2JZZA 2H88B 1WXQA 3EGRA 1SE4A 4K81A 1HXYD 4JGHB 5J2RA 2KK8A 2DAJA 2KWDA 1JW9D 1SE3A 1CQVA 5AEKB 2KWCA 2WLBA 4ANWA 4KVGB 4DXFA 2LASA 1FRRA 1WGYA 2LI5A 3QWZB 2KFKA 3I9V1 3IAM1 1R7SA 2W3RA 1I4XA 3ZRCA 2FUG1 1D3ZA 1V1PB 3L13A 1WXSA 2L3ZA 1JMLA 1IGDA 4RH6A 1SIJA 2OHFA 1WIAA 1TS2A 1I7HA 4GDKA 2JXTA 1A70A 2J7QB 3P1MA 2A5UA 1FXAA 3ML9A 3AE7B 4GDLB 2LUMA 3ZJTA 3NJTA 4GN1A 1S3SG 2LZ6A 1NVID 2JRHA 5JXVA 4K3BA 4BAXA 4IWQA 3P4RB 4II2B 5BMIA 4GOCA 4AUQC 3AEEB 1PFDA 1D5XC 4G11A 1ROEA 3A4SC 3NVWA 1R4NI 4A9AA 2KTRB 4IKGA 3B08A 1OQQA 1TTNA 1SEBD 1WM3A 1DOXA 4ZRQA 3IFWB 2JRIB 4AJYB 2KDEB 1Q0WB 1K8RB 2KMMA 2L00B 1EWYC 3I5JC 4TQ0A 4LNKA 2JY6A 4BKSA 2G4SA 4G50A 2E3TA 1I4QA 3NG0A 1C1YB 5G2NA 3ZDMC 3HVDA 3ZJVA 2OOBB 3R7QA 1XLQA 5G5HA 3WA0A 2WHIA 1J7BA 4YTPB 1FXTB 1FRDA 2EMSA 1JQ4A 1P9DU 4YL8A 3BZDB 2Q5WD 2ONQA 4CYEA 3ZGZA 2NCNA 3Q14C 1WY8A 3P4QB 4A55A 4KGSA 3FILA 2N9EB 3L16A 5AZHA 3UQBA 4RGNA 2HDEA 3W1SC 2LXAA 3DWGC 3A33B 3DBLB 3NZUA 2M8SA 3V61A 1GJZA 1PGXA 1UBIA 1E9MA 4AP4C 4PYZA 4AOFA 1CZPA 3ZVVA 2WXQA 2XK5B 4A90A 2JU6X 3C0RB 2R2QA 1E8YA 2N4FA 3X23A 1GNUA 2BW2A 1EF1A 3K9PB 1VLBA 2EMTA 3KW5B 4WAFA 1E10A 5MPOA 2RDGA 1T5XD 2KLCA 4WQMA 1H4RA 3U30A 5G55A 1TIFA 2Z8LA 3UINB 2PIAA 4PS7A 4HK2A 3VH3B 2N9LA 2OJRA 3TIXA 2XBBC 3NZSA 3ABVB 3RZWC 2N0SB 5CX3A 2BB5A 5E6OA 3L10B 2L0TA 4MGKE 3LDZE 5BO4B 2JZ3B 4ZRJA 2FE8A 4LCDE 3BYYB 2BYEA 1UWXA 1UGJA 4ASWC 2KZRA 4MEMA 2IO1B 1KRHA 1TBEA 1YQBA 3HIZA 3OG5A 4FBJB 4DQOC 4WH4A 3RN9C 1LFDA 2W55A 3NOBA 2C7MB 4DBGA 3T3NA 2NBWB 4YTMB 4H2AA 1I4HA 1LGRA 1WSPA 1YMHE 3DBHI 1JROA 3ALBA 2K8CA 4DHZE 1WYWB 1R4MI 2IY1B 1XQQA 1VRAB 2KLGA 2MWSB 1DGJA 1Z2MA 1T6BX 4W9EA 4NAMA 3NVYA 4TV3A 4M00A 1YQ4B 2QEJC 4C4VB 4F1SA 5FR3A 3JSVA 2KANA 2NPTB 4LTUA 2INDC 2NVUI 3A1QB 3C8YA 4LDTD 4K3CA 1NYRA 3VR8B 1Y8RC 1PDXA 4FJYA 1XCQL 4N6EB 2D2QA 1STEA 3ZNGC 3DVNV 3L08A 3UQAA 4C7YA 4GU2A 1PGBA 1MG4A 1KM7A 1A5RA 4ZDVA 4QAYA 3PRZA 4M0WB 1LQBA 2G3QB 3FC4A 3T8MA 2QMTA 4MM3A 2WXKA 2UWQA 3TEYA 2N1VA 3MTNB 1AYFA 1ZOYB 3O65B 3W1SA 4PS8A 2MBQA 2KFJA 2MX2A 2KMAA 4W9KA 3TCAA 4YSZB 3H1UA 1V86A 2UU7A 2MJDA 4MSQB 2GBMA 3QCAA 4NQKE 3QIJA 2BYVE 4WWPA 3TEXA 2FIDA 3RI7C 2KXJA 3KUCB 2GOWA 1PGAA 1JWAD 3IG3A 3FILB 4KIKB 4L2YA 4BOZB 1ET9A 2CHWA 3SR6A 2KT7A 1F9JA 3NS8A 1TKYA 4IG7B 5I4DA 4HPPA 4HKQA 2KWVB 1RFKA 4ZRIA 3I63C 3ML8A 4A6QA 2R2OA 4EEWA 4WJOA 3HHMA 5CHFA 5D6JB 2DBYA 3A4RA 4YT0B 1FIQA 2ZPYA 3VDZA 3AE1B 4US9A 4P16A 3ZXVA 1HA5A 5IKCM 3VQIA 1WRDB 3BVZA 2LGDA 3URYA 4W9JA 1BT0A 4NZLB 1ET6A 1XLNA 2BF8B 2NMQA 3BWUD 4HLEA 3Q3OC 2N9PC 4OVUA 3PHWB 3NVZA 4JL9A 3RULA 4PK1A 2Z59B 1IUEA 2KN4A 4AS1A 1T0SC 2LD9A 3PREA 4FXCA 3J9CA 2NS5A 2CU1A 3B0AA 2AEHA 1J7AA 4EZJA 5AUIA 4CHKA 1TYGB 2KNBA 4OZCA 3DBRB 3SDLC 5EDSA 4JE3B 2KQ7A 3ENEA 4HCPB 4ZHOA 4W9CA 5LNK1 4ANUA 4BBNC 2ZJDA 4DXGA 4MJSA 4L23A 2BYFA 3WAPA 3X0WA 4FHJA 1QOFA 4PS3A 4XZ4A 1MI0A 2LHEA 2MP2A 4P1BC 2PEAA 1FMAD 2KQSA 3GOEA 1B9RA 2KD0A 2WXPA 3V3XA 3LJ3A 2QDFA 4HJKA 3LXFA 3ZTCA 1WMHA 2IGDA 3ZIMA 2KYWA 1TY0A 2DZKA 2INPE 1V9JA 4US8A 5CHWA 4GSWA 4LNFA 1GB1A 2D5GA 4RCOA 1JWUD 1V49A 4I6NB 1C9FA 3H8HA 1T0RC 2BPSA 3ETRA 3EECA 3BVGA 2MBOA 5DPSA 2OEDA 3GZNB 4S0RA 3AE5B 1ZP0B 3APCA 4LLGM 3KWLA 2QILA 1NDDA 3GS2A 4BVUC 1KJTA 4LDTB 3VFKA 3NHEB 3ZUNA 2LGYA 2PPHA 4REZA 2CHXA 3V6CB 2KDIA 1YIWA 1OEYA 3A9JA 1MPEA 2KMCA 3MHZA 3MC0B 1L4ZB 3N20C 2DLBA 1QT9A 1ZGUB 2ZW1A 3KWVA 1L0VB 4W9GA 1P7EA 3JYUA 1E6EB 1GOZA 2VRRB 2UYZB 1WH3A 1XLPA 3ZO5B 3TUOA 3P4PB 1KFYB 3EHVA 3WAOA 2RPVA 3E9SA 2PKOA 4K7WA 3H7PA 2O6VD 1YN3A 3AN1A 2DZJA 4ZHPA 3PT2B 3Q3FA 2KDMA 2KDFB 1Q5WB 1GAQB 4W9FA 2WP9B 2XEWA 3D32A 1WZ0A 1IBXA 1HZ5A 3E56A 4KKIA 3O13A 2JWUA 4GIVA 4IWPA 4EZKA 1AARA 1BMLC 3M62B 4OZAA 3HVZA 3APDA 4C7ZA 1FM0D 4W9DA 4RGMA 3N1ZC 2CJNA 1FNUA 1F2RI 3KUDB 4II3B 3AE8B 1CK1A 1M4VA 2WXRA 2G4DB 1J19A 4ZYSA 2MBBB 4GGQA 2SAKA 2V3SA 4A3OA 4YSXB 3EFUA 2M0AA 3T9LA 4WWNA 1NI3A 4RGTA 2D11A 2Z0EB 5IN7A 1AWDA 2WXMA 1F2RC 2QCZA 1VR9A 4G0NB 4LJPB 2N9KA 4MGIE 2KC2A 1E8WA 4MGZE 5TR5A 5C3JB 3EFCA 2J0MA 1QILA 2WXFA 1QOAA 3K9OB 2WDTB 1C79A 2DYMA 3MC9A 3S2AA 2N7JA 2HTME 3DDCB 2MP2B 1OTRB 4EFOA 2C7HA 2RPQA 5EE1A 1L4DB 2BVCA 3I57A 5DPRA 1AW7A 4MGYE 2ASQA 4FADA 2N9XA 3R2TA 2BS2B 1TT5B 3VVWB 4NAWA 1I4GA 1ZW7A 4IM3A 4KDIC 3R2IA 2Y3AA 3PRMB 1E7UA 2LRUA 3UGBB 1FNVA 1YN4A 2JX5A 1ZPSA 2RSUA 1TZ1A 2BBCA 1UNSA 2J53A 2M19A 3VXWA 5JHAA 2J42A 2AQ1B 1LM8B 4C00A 3P42A 4NPNA 2HTHA 5D7GA 1FPYA 2PJHA 1FCLA 3AM9A 3AU4A 1UF0A 4TSSA 2K8BA 1NENB 1P1AA 5T8IA 4X57B 3A9KA 2KTFA 2DWQA 2ZNVB 1XEEA 2I38A 1QOBA 3SFDB 4BKSD 4ICUA 3U7DA 1F1HA 1V2YA 2L76A 1WXMA 2LXCA 2PE6B 3VHTC 2GI9A 2I1JA 4J3OD 1N6ZA 3IT4B 1BUIC 3T3OA 2PE9A 3APFA 2B3AA 2O2VA 3QA8A 2KDBA 4OHJA 2W54A 4IM0A 4M8NA 3TBLD 1ACCA 2AQ2B 1RAXA 4IOIE 2PTLA 4WURA 1ZDXA 5HG2A 3OWEB 2E6XA 3WIMA 2ICIA 1V97A 3GE3C 3V6EB 2BWFA 3EA6A 5FK9C 4RM8A 3MC8A 4TMAB 4J6IA 2O6VB 2FNJB 2KJRA 3EUB2 1FFVA 5BYRA 2G9HD 5D3DA 2MA9B 4OZBA 1EU4A 2XNAC 3AEDB 1RLFA 3AE4B 3AU5A 1TZOA 1XXGA 5IOIA 1Z5SB 1OQRA 3VAWA 2GBJA 3JVZX 3ZJUA 4MSMB 2B76B 5G5GA 3P63A 1IPGA 3H7SA 2GBKA 4XDDA 1N63A 2GBNA 4MT5A 1K50A 2LJIA 3PSEB 4WWMA 1ISNA 3GP7A 1E90A 3V62A 4M01A 4B95A 4KX6B 1SJED 4RF1A 5LXIB 5EE9A 1C76A 2DAFA 3KQ4A 1SBBB 4LK0M 2YVCA 2YEPF 2KFKB 4HPMB 4URKA 1KLGD 1D5ZC 1WJ4A 4ANXA 1K51A 1EUVB 2JVCA 4F7ZA 4GDKB 1IYFA 2RD0A 3PZ7A 3AI5A 1WWTA 4UDUC 2HD5B 1J7CA 3TMPB 2WXLA 4YWGG 4RGOS 2QC8A 4XWTA 1FEHA 3UI3A 3Q8FA 2FUHB 4WIPA 3BINA 1L2NA 4CQNA 4P7IA 1P0RA 4G3XB 1WJNA 1L0YB 1ZE3D 3N30A 3AEFB 3LYYA 3RZFA 1E8ZA 1WR6E 2BTEA 2RMMA 2V0GA 2ZPNA 1OFFA 2FCMA 4DDID 2WWZA 3DHHC 2I2YA 2REXA 2JZPA 1CMXB 2NTSA 1B1ZA 1FO4A 3CSTA 5AZGA 1VZ7A 2GB1A 3ZYYX 2PW9A 2MCNB 2KWUB 3ZNID 4EE2A 3RD2A 1SB3C 1WX7A 4AJWA 2DNFA 5IP4D 1MHHE 3DHIC 4E71A 3TEZA 3Q2AC 3B1LX 3R8BA 1DYQA 3ZRFA 5TSSA 2ZW0A 4IC7B 1E7VA 2LVPA 2IO3B 2KAJA 1E5WA 4GLSC 4KZCA 3WANA 4DDGD 1WRIA 5CHVC 2FIFA 4L1BA 3SD5A 4WWOA 1MJDA 2MJEA 4W9IA 5H92C 2NTTA 2AQ3B 2WXOA 2D3CA 2IYDB 2ZVNA 2K6DB 3KYCD 2DZMA 3RPFC 3AE9B 3PTFC 2IZVB 2R61A 3DOWA 2WXIA 4ZOHC 2K8HA 3U4EG 2AL3A 4ARCA 3DBLI 3KYDD 3VH4B 5BMHA 1JALA 3BVMA 2K39A 4M8MA 2A4ZA 2D3GA 3MJWA 3AECB 2K9XA 5C23A 2XN9C 3U8ZA 2MBHA 3C19A 1WI0A 4OVVA 2N7EA 3N1XC 2M56B 1VDVA 5AZFA 1L5PA 2INNE 2ACZB 3B9JA 5C1ZA 5EE3A 1QQRA 4KSLC 1V5TA 3L54A 3OJ4B 4E3CA 2WX1A 1WGRA 1L7YA 3VTUA 1RYJA 4NJ6A 1SGHA 2BYTA 3OJ3A 2RR9A 2KACA 2HE7A 1RWSA 2LRWA 3JSVB 3NUHB 2BKFA 3RT3B 4MDKE 2BS3B 3M95A 2WXJA 4AWJA 1V1PA 1IGCA 1HE8A 1R4NB 2AX5A 5C2TB 2DYOA 3GB1A 1FFUA 3VR9B 2L32A 4N59A 3AEAB 5IO9A 4W9HA 4BKGA 4RFBA 2C9WB 4IDIA 3Q8EA 2IBIB 4GDLA 2YLMA 2BT6A 2GRIA 4BBNF 5D2MB 1YJJA 4MM3B 3RNBC 4ARIA 1RM6C 4NJCA 1EWCA 3KVFB 1SE9A 1Y56A 4BZAA 2WYQA 1WXAA 4XE0A 2ZVOA 3DCGA 3W5VB 4JX1C 1TKEA 1UD7A 3Q6BA 5GMVA 2BWES 4KGTA 2KTRA 2BKRB 5HKHA 1RRBA 4HCNB 1ESFA 1ZXIA 3RMKC 1FXIA 3QHTA 4FLHA 2INCC 4E74A 2Y5BB 3HK0A 3N1YC 4K7SA 4DHJD 4XC2A 1GC6A 2MBEA 3AH7A 3M3JA 3P2BA 3VRBB 5HFYA 4KZ0A 1E7PB 3U52E 2LFIA 3DQVA 1EO6A 3ZKJC 3FAHA 1IP9A 3IVFA 3Q69A 3SHQA 5IA7A 1QZEA 4OVZA 1SIFA 3CF6E 1SF0A 4HKZE 4FJVB 3ZDTA 1V5OA 4RF0A 1YQ3B 2JYTA 4RNAA 4N9F4 3QARA 1GB4A 4I6PA 4JLCA 2L05A 2MHJA 3VTVA 2K5PA 2M4NA 3PS6A 4PT5A 5D3IB 1WGHA 2W82A 2CJOA 2Y5CA 3PGEA 2NBVB 3MHSD 1WF9A 4PYUA 1I4RA 3IAS1 4NJ7A 2J0JA 1TS3A 2L1AA 3DVGX 2IO0B 1Q10A 1WGKA 3OAWA 2FCSA 4YXDB 1N60A 4MH8A 3DWMA 2J52A 1YX6B 1E0ZA 2RGFA 1XF5L 3SEBA 2WDQB 3B2GA 1UZXB 2WDRB 2LHDA 3UF8A 2NR2A 3UIOB 2GLSA 3R66C 1LXDA 4MJSB 4HDOA 1TKGA 2WU2B 3ZW3A 2OJWA 3DBHB 3DHGC 1R4MB 3W1YA 2WDVB 1WMHB 1SJHD 3QC8B 4JIOU 3AMZA 1I4PA 1WFYA 1YNTE 3DBRI 1JWSD 2EKEC 1JRUA 3TSSA 4R3DA 4ICVA 4A20A 1EM7A 4RMAA 1YD8U 3GE8C 3R7RA 2ZEQA 4ITKA 2IJ0A 1FCCC 5JZEB 1J8CA 2KOXA 1NBFC 2EELA 1P3QU 4WQOB 4HDQA 1TS4A 1JCKB 1DOIA 1WX8A 3L4PA 3L17A 3NS1A 2D10A 2VH2A 2V1YA 4C4VA 2PVGC 2BGFA 2RDHA 4A8XC 4EKUA 2LVQA 3Q3MC 2NPTA 2V4LA 3A1QA 1VJKA 2MRPA 3A9JB 3MP9A 1WR1A 2JWZA 5HHDG 1MFWA 3GZNI 2V3PA 2PVOD 2IPKD 2Y5PA 3DPDA 1PYWD 1V6EA 1BXTA 1LO5D 1ENFA 4FN2A 2X8XX 5CTRC 3EC8A 3V05A 3Q8AA 4M0WA 2L0FA 4NQLB 1FD6A 1N5WA 3RNGC 2HJ1A 4F8CB 2K0PA 4A3PA 2PMVA 1N62A 3H7PB 3PZDA 4DHJB 2SEBD 3W5UB 3KUZA 5AUKA 3CSFA 4JPSA 1V80A 1IBXB 4KGRA 1YOVB 1ZUD2 2LGXA 3Q8CA 1WXVA 1C4CA 3ZLZA 4BKTA 3HRDD 3VUYA 1DOYA 4KIKA 2FCQA 3BK1A 4MELA 5DPTA 3SU8X 3Q3JA 3V60A 4HVBA 3BK2A 3HM6X 1PUTA 5D94A 1JWBD 5KHQA 4IM2A 1TS5A 1TY2A 4EZLA 4FJZA 3L0WB 1K52A 1QLBB 2JT4B 3RFZB 3H6NA 1RFAA 3IHPC 3AB5A 1C77A 2JF5A 2LGSA 4O1NA 4DK5A 3CWIA 2WXHA 2C60A 1EF5A 4MACA 2GMIC 1XCTL 4IW0A 4P6VF 1FNWA 3TL5A 4KSKC 5E6JA 2KX0A 2QHOA 1I42A 1CJEA 4CO7A 1YJIA 4B0MA 4K1RB 3TEWA 3QK0A 3ZNHB 1P98A 4DXAB 2C5LC 1XLOA 4WAAA 3MFGA 2IO2B 2M0XA 2JSVX 2IGHA 4TUUA 4KDLB 4NAWB 1T0QC 4RM9A 2IY0B 2KVZA 4FHKA 3R3MA 1WE7A 1JWMD 5DPWA 2WXGA 1NI2A 3ZNZB 1UH6A 4HWIB 3BY4B 2J4XA 2VZKD 4LNOA 5FKAC 4IUMB 2X38A 4ZYNA 2LUEA 2MLBA 1TJEA 5BMGA 2L7RA 4LNIA 4KKJA 1C3TA 1C4PA 4B0EA 4HRSA 4HJGE 2K6QA 2RDBC 4C56C 2L83A 1T3QA 3A9KB 3IBEA 2QJLA 2KJ6A 4ACFA 3NY5A 2ZCBA 1WM2A 1H8CA 4XWWA 4Q2JA 5IAAC 4DWFA 3ZTDA 1VZ6A 2WQYB 2KN5A 3PV1A 4S17A 2K3UA 2AYOB 1I35A 3AE2B 3N9YC 2DHZA 1SE2A 1XD3B 4XYCA 1E8XA 3HM3A 2WU5B 4LNNA 1VD2A 2D3BA 2KVRA 2O2VB 3AV8A 3PRPB 4I6LB 4GB9A 1GC7A 4JQWC 2K25A 2MJ3A 3PO0A 3P4SB 2WS3B 1SXTA 2V4IB 4ANVA 4P1CC 1F77A 1OEYJ 2LJ5A 4LJOB 3RNCC 3AE6B 3NRZA 3UIPB 1D6EC 3AXCA 2L52A 4EUTA 3QX1A 3RNFC 2QSDA 1Q1OA 3B2FA 1YJ1A 1QOGA 2FAZA 2TSSA 2CU3A 4NNJB 1U4AA 2LWPA 2PLPA 4FA6A 2MSED 2KJHB 2MH7A 3KH0A 1KH0A 2WGSA 4WJPA 2MW5A 4D2KA 2KQ4X 1VCBA 4K7UA 1KF6B 2ZNVC 2KC1A 3PPAA 1M94A 3N32A 1JRPA 4N58A 2DENB 1GPXA 5KHOA 4HEA1 2GBRA 5GXGB 2G1EA 3VUWA 4TKNA 5L83A 1D5MC 1YX5B 2VH1A 4EOYA 1NYQA 2I1KA 3U7ZA 1ZDVA 2JYEA 2N7DA 1P7FA 2BQQA 4AQ7A 1XT9B 5LXHA 3TJPA 3DBSA 4ZRPA 3ZXRA 1UGMA 4B9KA 3VTWA 2LVOA 2AL6A 5J17A 2CS4A 2CKHB 2V9HA 3VUXA 1V81A 3ONSA 4TQ1A 1QF6A 2CR5A 1F0ZA 3Q8BA 4JWSC 1KOTA 2C7NB 2D07B 1PQSA 4HPLB 3IT6B 3AEGB 3W2DA 2J0KA 2K1FA 1KTKA 4GMVA 3AE3B 4IWOA 4HXDA 2IGGA 4GXBA 4BFRA 3RNAC 1G6JA 4XGAB 4XDCA 1XO3A 2JPHA 3WCQA 1HTOA 4BOSC 4B6WA 3ECIA 3I3TB 4DHZB 3DVGY 4OW0A 3W9CB 2L8JA 3H9DA 2KHWB 2KX3A 1UUPA 3PLUA 1KLUD 4WJQA 4WJNA 2M1MA 1MG8A 2MQJA 2VZKB 2CHZA 2IDYA 2DX5B 1J0GA 1S1QB 3QQ8B 3VRAB 3U2SC 2NBUA 2W3SA 5BYSA 3RCZA 1N5XA 4FULA 5L95C 3AULA 2BS4B 3QAQA 1WGGA 1WYGA 2KO3A 2LMCA 1ZKHA 4KV2A 2ZZPB 5EE0A 3N3KB 5DCNA 4MH0E 2G45B 4YTNB 3QJZA 1T0YA 1EU3A 5HI1A 1OGWA 1TGZB 2K22A 5H8YE 1V8CA 3BYTB 1X1MA 2WXNA 1KLVA 1HTQA 2YEPB 1VZ8A 1UELA 2WX0A 2LGIA 2WNMA 1SSNA 3HUIA 3MJ5A 3Q3NC 5FR6A 1GG3A 2D3AA 3KLSX 5E6PA 3AEBB 3PZ8A 1F52A 2EKIA 1WZ3A 1HZ6A 4M02A 2ON8A 3ZQ4A 1QKZA 2H89B 2W9NA 2LEKA 2DYBA 3CMMB 3LB8C 1K53A 4W9LA 3RYTA 2JXXA 5BYQA 2FCNA 2AWTA 3CIRB 1MHXA 2N1WA 4XX5A 1HQRD 2DZIA 1AN8A 4C80A 2BB6A 3FKYA 1N61A 1UWMA 2FBWB 2HJ8A 1WGDA 2JQRB 2MEKA 1GUAB 4HROA 3DVNU 4JWUC 1L6UA 2V3NA 1D4BA 1OQYA 1WE6A 5JHBA 3JW0X 3SFEB 2ZCCA 5E6NA 5JH5C 2QIEB 4USAA 3NVVA 1UBQA 1NEKB 3OLMD 3PVLA 2KKCA 2O6VA 3PLVA 1C78A 1L0XB 3M63B 1WJUA 2XK5A 3IXSA
chains in the Genus database with same CATH topology
2PMVA 5LNK1 1N62A 2BTEA 2RMMA 2V0GA 1OFFA 2SEBD 3W5UB 4DXGA 4L23A 5AUKA 4JPSA 3NZ3A 1QOFA 1IBXB 1MI0A 2LHEA 1HEZE 1C4AA 1FMAD 1ZXHA 1YN5A 2I2YA 1B9RA 2WXPA 3V3XA 2JZPA 3BIID 1V1OA 4KGRA 1ZUD2 2NTSA 1MVKA 1B1ZA 1FO4A 3Q8CA 1L6VA 3LXFA 1VZ7A 2GB1A 4YSYB 3ZYYX 1C4CA 2PW9A 2IGDA 3HRDD 1DOYA 1TY0A 2H88B 1WXQA 3BK1A 3EGRA 2INPE 4EE2A 4US8A 1SB3C 3BK2A 1SE4A 1PUTA 1JWBD 1GB1A 2D5GA 4RCOA 1HXYD 1JWUD 1MHHE 3TEZA 1TS5A 1TY2A 3R8BA 1C9FA 1DYQA 3H8HA 3ETRA 3BVGA 2KWDA 1K52A 2OEDA 1JW9D 1QLBB 1SE3A 3AE5B 1CQVA 1ZP0B 3RFZB 4LLGM 5TSSA 3KWLA 2WLBA 2ZW0A 2QILA 4DXFA 3GS2A 3AB5A 1C77A 1FRRA 2KAJA 4O1NA 4GLSC 3CWIA 3I9V1 3IAM1 1R7SA 2WXHA 1WRIA 2W3RA 1I4XA 2FUG1 1V1PB 4REZA 1JMLA 4MACA 1IGDA 4L1BA 4RH6A 1SIJA 1XCTL 2OHFA 4P6VF 1FNWA 1I7HA 1TS2A 5E6JA 2MJEA 2JXTA 1MPEA 1A70A 3MHZA 1CJEA 3MC0B 3P1MA 1FXAA 1L4ZB 2AQ3B 2NTTA 5H92C 1YJIA 4B0MA 2DLBA 2WXOA 1QT9A 2ZW1A 3AE7B 1L0VB 3KWVA 1P7EA 4GDLB 2LUMA 3ZJTA 1E6EB 3TEWA 1GOZA 3RPFC 1XLOA 3AE9B 2R61A 2WXIA 3MFGA 1NVID 4ZOHC 5JXVA 3U4EG 4ARCA 3P4RB 2JSVX 2IGHA 5BMIA 1XLPA 4NAWB 3AEEB 3TUOA 5BMHA 1PFDA 1D5XC 3P4PB 1KFYB 1ROEA 1JALA 3NVWA 1JWMD 2WXGA 3BVMA 4A9AA 2RPVA 3E9SA 4IKGA 2PKOA 3AECB 2J4XA 1YN3A 3AN1A 2K9XA 1OQQA 4ZHPA 2XN9C 2VZKD 2KDMA 1SEBD 5FKAC 1GAQB 4ZRQA 1DOXA 2WP9B 2X38A 1IBXA 1HZ5A 3E56A 4KKIA 3O13A 2JWUA 1TJEA 5BMGA 1BMLC 4KKJA 4OZAA 2KMMA 1C4PA 1EWYC 2M56B 3HVZA 1VDVA 4HRSA 4HJGE 4B0EA 4C7ZA 1L5PA 1FM0D 4TQ0A 4RGMA 4C56C 2INNE 2ACZB 3B9JA 2CJNA 2L83A 1FNUA 1T3QA 1F2RI 5EE3A 2E3TA 1I4QA 3ZJVA 1QQRA 3HVDA 3AE8B 2QJLA 1CK1A 1M4VA 2WXRA 1XLQA 5G5HA 4ZYSA 2SAKA 1J7BA 4YTPB 1FRDA 4YSXB 4XWWA 4Q2JA 1JQ4A 3BZDB 2M0AA 1VZ6A 1RYJA 2Q5WD 2WQYB 2ONQA 3ZGZA 2BYTA 2K3UA 3AE2B 2KACA 3P4QB 3N9YC 4A55A 4KGSA 1NI3A 4RGTA 3FILA 1SE2A 1AWDA 2WXMA 1RWSA 2WU5B 3NUHB 4RGNA 2HDEA 3DWGC 1F2RC 2BS3B 1VR9A 3AV8A 2N9KA 2WXJA 1V1PA 1PGXA 1E9MA 1IGCA 5C3JB 1CZPA 2MJ3A 2AX5A 2WXQA 5C2TB 2DYOA 1QILA 3GB1A 3PO0A 2WXFA 1FFUA 1QOAA 3P4SB 4A90A 2JU6X 2WS3B 1SXTA 2V4IB 3VR9B 2L32A 4N59A 1F77A 3AEAB 3AE6B 2BW2A 3NRZA 1C79A 1D6EC 2DYMA 4RFBA 2L52A 2N7JA 1VLBA 4WAFA 2QSDA 4IDIA 1E10A 3B2FA 3Q8EA 5MPOA 1QOGA 2HTME 2RDGA 1T5XD 4WQMA 2TSSA 2BT6A 2GRIA 2CU3A 5EE1A 1L4DB 2Z8LA 3I57A 1YJJA 1AW7A 2PIAA 4MM3B 1RM6C 2PLPA 4NJCA 4ARIA 2MH7A 1EWCA 2N9LA 1Y56A 1KH0A 3ABVB 3R2TA 3IXSA 2BS2B 2KQ4X 2N0SB 4D2KA 1KF6B 1I4GA 2BB5A 4XE0A 3W5VB 3R2IA 4JX1C 2Y3AA 1TKEA 1JRPA 4KGTA 4N58A 1GPXA 1FNVA 2FE8A 1ESFA 1YN4A 2JX5A 4HEA1 1ZPSA 1ZXIA 5GXGB 2G1EA 2BBCA 3BYYB 1UNSA 1FXIA 1UWXA 1UGJA 2J53A 2M19A 1D5MC 2J42A 1NYQA 3U7ZA 1ZDVA 2AQ1B 1KRHA 2JYEA 1P7FA 3P42A 3AH7A 4DQOC 4AQ7A 3VRBB 5HFYA 5D7GA 4WH4A 1FCLA 1E7PB 3AM9A 3U52E 4ZRPA 2LFIA 4TSSA 2W55A 3T3NA 4YTMB 1NENB 5T8IA 4H2AA 3FAHA 2DWQA 1I4HA 1XEEA 2I38A 1WSPA 1QOBA 1YMHE 3Q69A 3SFDB 1JROA 4OVZA 1SF0A 4HKZE 4RF0A 1YQ3B 4TQ1A 1QF6A 1F0ZA 1VRAB 2JYTA 3Q8BA 4JWSC 4RNAA 2GI9A 1GB4A 1DGJA 3IT6B 3AEGB 1T6BX 3W2DA 4J3OD 4NAMA 3NVYA 3IT4B 1YQ4B 1BUIC 2QEJC 2K5PA 1KTKA 3T3OA 4PT5A 3AE3B 5D3IB 5FR3A 2W82A 2CJOA 2Y5CA 2IGGA 4LTUA 3C8YA 4OHJA 2W54A 1NYRA 4XDCA 3VR8B 1PDXA 1XO3A 1XCQL 3WCQA 4N6EB 1I4RA 3IAS1 1STEA 1ACCA 1TS3A 2AQ2B 2L1AA 4IOIE 4C7YA 1Q10A 2PTLA 4WURA 1ZDXA 5HG2A 1PGBA 1WGKA 3OWEB 2E6XA 2ICIA 1V97A 4OW0A 3EA6A 4YXDB 1N60A 4MH8A 3DWMA 3W9CB 2J52A 5FK9C 1UUPA 4TMAB 1E0ZA 3FC4A 1KLUD 2QMTA 2WXKA 3EUB2 3TEYA 2VZKB 1FFVA 5BYRA 2G9HD 1AYFA 1XF5L 2IDYA 2WDQB 3SEBA 3B2GA 5D3DA 1ZOYB 2WDRB 2LHDA 4OZBA 3U2SC 3VRAB 1EU4A 3W1SA 2W3SA 5BYSA 2XNAC 3AEDB 1TKGA 1N5XA 2WU2B 3AE4B 4YSZB 1TZOA 1XXGA 2BS4B 2MJDA 1WYGA 2LMCA 5EE0A 1OQRA 3TEXA 2WDVB 1SJHD 3ZJUA 3AMZA 1I4PA 1PGAA 1YNTE 1JWAD 4YTNB 3FILB 4L2YA 1EU3A 1JWSD 2B76B 1ET9A 5G5GA 5HI1A 3TSSA 3SR6A 2K22A 3P63A 4R3DA 5H8YE 1V8CA 3BYTB 1TKYA 2WXNA 5I4DA 1EM7A 4HKQA 4XDDA 1N63A 4MT5A 1K50A 1RFKA 2LJIA 2YEPB 1VZ8A 4A6QA 2LGIA 2WNMA 1SSNA 3HUIA 3MJ5A 4WWMA 3GP7A 3KLSX 4ITKA 1SJED 4KX6B 2IJ0A 4RF1A 1FCCC 5EE9A 3AEBB 3PZ8A 2DBYA 4YT0B 1C76A 1FIQA 2EELA 3AE1B 2EKIA 4US9A 4P16A 3KQ4A 1SBBB 1HA5A 1HZ6A 1TS4A 3VQIA 1JCKB 1DOIA 2ON8A 4LK0M 2YEPF 3BVZA 3URYA 3L4PA 3ZQ4A 1QKZA 2H89B 2LEKA 3NS1A 4NZLB 1ET6A 1KLGD 1XLNA 3LB8C 2NMQA 3BWUD 1D5ZC 1K53A 1K51A 2PVGC 5BYQA 2RDHA 4A8XC 3CIRB 1MHXA 1VJKA 1HQRD 4GDKB 1AN8A 4C80A 2BB6A 3PZ7A 3NVZA 1WWTA 3MP9A 4UDUC 1N61A 5HHDG 1J7CA 1IUEA 1UWMA 2KN4A 4AS1A 2V3PA 2FBWB 2PVOD 2IPKD 2WXLA 2Y5PA 4YWGG 2JQRB 4FXCA 4RGOS 3J9CA 2MEKA 4HROA 4JWUC 1PYWD 4XWTA 1L6UA 1BXTA 1FEHA 1LO5D 2V3NA 1D4BA 1ENFA 1J7AA 3SFEB 3V05A 3Q8AA 3UI3A 2QIEB 5AUIA 3Q8FA 4USAA 3NVVA 4WIPA 1NEKB 1TYGB 4M0WA 4OZCA 1FD6A 4CQNA 1N5WA 1C78A 4JE3B 1L0XB 1L0YB 4ZHOA 2K0PA 1ZE3D 3AEFB 3LYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DQO C;  4YWG G;  3U2S C;  3U4E G; 
#chains in the Genus database with same CATH topology
 2Z0D B;  3RNE C;  5J18 A;  2M17 A;  5LLI A;  3PHX B;  1WJ6 A;  4NY0 A;  3RUI B;  3WAL A;  3NZ3 A;  2JUO A;  1HEZ E;  1C4A A;  1ZXH A;  1YN5 A;  3BII D;  1V1O A;  1WX9 A;  4ZRK A;  1MVK A;  3WAM A;  1L6V A;  4YSY B;  2JZZ A;  2H88 B;  1WXQ A;  3EGR A;  1SE4 A;  4K81 A;  1HXY D;  4JGH B;  5J2R A;  2KK8 A;  2DAJ A;  2KWD A;  1JW9 D;  1SE3 A;  1CQV A;  5AEK B;  2KWC A;  2WLB A;  4ANW A;  4KVG B;  4DXF A;  2LAS A;  1FRR A;  1WGY A;  2LI5 A;  3QWZ B;  2KFK A;  3I9V 1;  3IAM 1;  1R7S A;  2W3R A;  1I4X A;  3ZRC A;  2FUG 1;  1D3Z A;  1V1P B;  3L13 A;  1WXS A;  2L3Z A;  1JML A;  1IGD A;  4RH6 A;  1SIJ A;  2OHF A;  1WIA A;  1TS2 A;  1I7H A;  4GDK A;  2JXT A;  1A70 A;  2J7Q B;  3P1M A;  2A5U A;  1FXA A;  3ML9 A;  3AE7 B;  4GDL B;  2LUM A;  3ZJT A;  3NJT A;  4GN1 A;  1S3S G;  2LZ6 A;  1NVI D;  2JRH A;  5JXV A;  4K3B A;  4BAX A;  4IWQ A;  3P4R B;  4II2 B;  5BMI A;  4GOC A;  4AUQ C;  3AEE B;  1PFD A;  1D5X C;  4G11 A;  1ROE A;  3A4S C;  3NVW A;  1R4N I;  4A9A A;  2KTR B;  4IKG A;  3B08 A;  1OQQ A;  1TTN A;  1SEB D;  1WM3 A;  1DOX A;  4ZRQ A;  3IFW B;  2JRI B;  4AJY B;  2KDE B;  1Q0W B;  1K8R B;  2KMM A;  2L00 B;  1EWY C;  3I5J C;  4TQ0 A;  4LNK A;  2JY6 A;  4BKS A;  2G4S A;  4G50 A;  2E3T A;  1I4Q A;  3NG0 A;  1C1Y B;  5G2N A;  3ZDM C;  3HVD A;  3ZJV A;  2OOB B;  3R7Q A;  1XLQ A;  5G5H A;  3WA0 A;  2WHI A;  1J7B A;  4YTP B;  1FXT B;  1FRD A;  2EMS A;  1JQ4 A;  1P9D U;  4YL8 A;  3BZD B;  2Q5W D;  2ONQ A;  4CYE A;  3ZGZ A;  2NCN A;  3Q14 C;  1WY8 A;  3P4Q B;  4A55 A;  4KGS A;  3FIL A;  2N9E B;  3L16 A;  5AZH A;  3UQB A;  4RGN A;  2HDE A;  3W1S C;  2LXA A;  3DWG C;  3A33 B;  3DBL B;  3NZU A;  2M8S A;  3V61 A;  1GJZ A;  1PGX A;  1UBI A;  1E9M A;  4AP4 C;  4PYZ A;  4AOF A;  1CZP A;  3ZVV A;  2WXQ A;  2XK5 B;  4A90 A;  2JU6 X;  3C0R B;  2R2Q A;  1E8Y A;  2N4F A;  3X23 A;  1GNU A;  2BW2 A;  1EF1 A;  3K9P B;  1VLB A;  2EMT A;  3KW5 B;  4WAF A;  1E10 A;  5MPO A;  2RDG A;  1T5X D;  2KLC A;  4WQM A;  1H4R A;  3U30 A;  5G55 A;  1TIF A;  2Z8L A;  3UIN B;  2PIA A;  4PS7 A;  4HK2 A;  3VH3 B;  2N9L A;  2OJR A;  3TIX A;  2XBB C;  3NZS A;  3ABV B;  3RZW C;  2N0S B;  5CX3 A;  2BB5 A;  5E6O A;  3L10 B;  2L0T A;  4MGK E;  3LDZ E;  5BO4 B;  2JZ3 B;  4ZRJ A;  2FE8 A;  4LCD E;  3BYY B;  2BYE A;  1UWX A;  1UGJ A;  4ASW C;  2KZR A;  4MEM A;  2IO1 B;  1KRH A;  1TBE A;  1YQB A;  3HIZ A;  3OG5 A;  4FBJ B;  4DQO C;  4WH4 A;  3RN9 C;  1LFD A;  2W55 A;  3NOB A;  2C7M B;  4DBG A;  3T3N A;  2NBW B;  4YTM B;  4H2A A;  1I4H A;  1LGR A;  1WSP A;  1YMH E;  3DBH I;  1JRO A;  3ALB A;  2K8C A;  4DHZ E;  1WYW B;  1R4M I;  2IY1 B;  1XQQ A;  1VRA B;  2KLG A;  2MWS B;  1DGJ A;  1Z2M A;  1T6B X;  4W9E A;  4NAM A;  3NVY A;  4TV3 A;  4M00 A;  1YQ4 B;  2QEJ C;  4C4V B;  4F1S A;  5FR3 A;  3JSV A;  2KAN A;  2NPT B;  4LTU A;  2IND C;  2NVU I;  3A1Q B;  3C8Y A;  4LDT D;  4K3C A;  1NYR A;  3VR8 B;  1Y8R C;  1PDX A;  4FJY A;  1XCQ L;  4N6E B;  2D2Q A;  1STE A;  3ZNG C;  3DVN V;  3L08 A;  3UQA A;  4C7Y A;  4GU2 A;  1PGB A;  1MG4 A;  1KM7 A;  1A5R A;  4ZDV A;  4QAY A;  3PRZ A;  4M0W B;  1LQB A;  2G3Q B;  3FC4 A;  3T8M A;  2QMT A;  4MM3 A;  2WXK A;  2UWQ A;  3TEY A;  2N1V A;  3MTN B;  1AYF A;  1ZOY B;  3O65 B;  3W1S A;  4PS8 A;  2MBQ A;  2KFJ A;  2MX2 A;  2KMA A;  4W9K A;  3TCA A;  4YSZ B;  3H1U A;  1V86 A;  2UU7 A;  2MJD A;  4MSQ B;  2GBM A;  3QCA A;  4NQK E;  3QIJ A;  2BYV E;  4WWP A;  3TEX A;  2FID A;  3RI7 C;  2KXJ A;  3KUC B;  2GOW A;  1PGA A;  1JWA D;  3IG3 A;  3FIL B;  4KIK B;  4L2Y A;  4BOZ B;  1ET9 A;  2CHW A;  3SR6 A;  2KT7 A;  1F9J A;  3NS8 A;  1TKY A;  4IG7 B;  5I4D A;  4HPP A;  4HKQ A;  2KWV B;  1RFK A;  4ZRI A;  3I63 C;  3ML8 A;  4A6Q A;  2R2O A;  4EEW A;  4WJO A;  3HHM A;  5CHF A;  5D6J B;  2DBY A;  3A4R A;  4YT0 B;  1FIQ A;  2ZPY A;  3VDZ A;  3AE1 B;  4US9 A;  4P16 A;  3ZXV A;  1HA5 A;  5IKC M;  3VQI A;  1WRD B;  3BVZ A;  2LGD A;  3URY A;  4W9J A;  1BT0 A;  4NZL B;  1ET6 A;  1XLN A;  2BF8 B;  2NMQ A;  3BWU D;  4HLE A;  3Q3O C;  2N9P C;  4OVU A;  3PHW B;  3NVZ A;  4JL9 A;  3RUL A;  4PK1 A;  2Z59 B;  1IUE A;  2KN4 A;  4AS1 A;  1T0S C;  2LD9 A;  3PRE A;  4FXC A;  3J9C A;  2NS5 A;  2CU1 A;  3B0A A;  2AEH A;  1J7A A;  4EZJ A;  5AUI A;  4CHK A;  1TYG B;  2KNB A;  4OZC A;  3DBR B;  3SDL C;  5EDS A;  4JE3 B;  2KQ7 A;  3ENE A;  4HCP B;  4ZHO A;  4W9C A;  5LNK 1;  4ANU A;  4BBN C;  2ZJD A;  4DXG A;  4MJS A;  4L23 A;  2BYF A;  3WAP A;  3X0W A;  4FHJ A;  1QOF A;  4PS3 A;  4XZ4 A;  1MI0 A;  2LHE A;  2MP2 A;  4P1B C;  2PEA A;  1FMA D;  2KQS A;  3GOE A;  1B9R A;  2KD0 A;  2WXP A;  3V3X A;  3LJ3 A;  2QDF A;  4HJK A;  3LXF A;  3ZTC A;  1WMH A;  2IGD A;  3ZIM A;  2KYW A;  1TY0 A;  2DZK A;  2INP E;  1V9J A;  4US8 A;  5CHW A;  4GSW A;  4LNF A;  1GB1 A;  2D5G A;  4RCO A;  1JWU D;  1V49 A;  4I6N B;  1C9F A;  3H8H A;  1T0R C;  2BPS A;  3ETR A;  3EEC A;  3BVG A;  2MBO A;  5DPS A;  2OED A;  3GZN B;  4S0R A;  3AE5 B;  1ZP0 B;  3APC A;  4LLG M;  3KWL A;  2QIL A;  1NDD A;  3GS2 A;  4BVU C;  1KJT A;  4LDT B;  3VFK A;  3NHE B;  3ZUN A;  2LGY A;  2PPH A;  4REZ A;  2CHX A;  3V6C B;  2KDI A;  1YIW A;  1OEY A;  3A9J A;  1MPE A;  2KMC A;  3MHZ A;  3MC0 B;  1L4Z B;  3N20 C;  2DLB A;  1QT9 A;  1ZGU B;  2ZW1 A;  3KWV A;  1L0V B;  4W9G A;  1P7E A;  3JYU A;  1E6E B;  1GOZ A;  2VRR B;  2UYZ B;  1WH3 A;  1XLP A;  3ZO5 B;  3TUO A;  3P4P B;  1KFY B;  3EHV A;  3WAO A;  2RPV A;  3E9S A;  2PKO A;  4K7W A;  3H7P A;  2O6V D;  1YN3 A;  3AN1 A;  2DZJ A;  4ZHP A;  3PT2 B;  3Q3F A;  2KDM A;  2KDF B;  1Q5W B;  1GAQ B;  4W9F A;  2WP9 B;  2XEW A;  3D32 A;  1WZ0 A;  1IBX A;  1HZ5 A;  3E56 A;  4KKI A;  3O13 A;  2JWU A;  4GIV A;  4IWP A;  4EZK A;  1AAR A;  1BML C;  3M62 B;  4OZA A;  3HVZ A;  3APD A;  4C7Z A;  1FM0 D;  4W9D A;  4RGM A;  3N1Z C;  2CJN A;  1FNU A;  1F2R I;  3KUD B;  4II3 B;  3AE8 B;  1CK1 A;  1M4V A;  2WXR A;  2G4D B;  1J19 A;  4ZYS A;  2MBB B;  4GGQ A;  2SAK A;  2V3S A;  4A3O A;  4YSX B;  3EFU A;  2M0A A;  3T9L A;  4WWN A;  1NI3 A;  4RGT A;  2D11 A;  2Z0E B;  5IN7 A;  1AWD A;  2WXM A;  1F2R C;  2QCZ A;  1VR9 A;  4G0N B;  4LJP B;  2N9K A;  4MGI E;  2KC2 A;  1E8W A;  4MGZ E;  5TR5 A;  5C3J B;  3EFC A;  2J0M A;  1QIL A;  2WXF A;  1QOA A;  3K9O B;  2WDT B;  1C79 A;  2DYM A;  3MC9 A;  3S2A A;  2N7J A;  2HTM E;  3DDC B;  2MP2 B;  1OTR B;  4EFO A;  2C7H A;  2RPQ A;  5EE1 A;  1L4D B;  2BVC A;  3I57 A;  5DPR A;  1AW7 A;  4MGY E;  2ASQ A;  4FAD A;  2N9X A;  3R2T A;  2BS2 B;  1TT5 B;  3VVW B;  4NAW A;  1I4G A;  1ZW7 A;  4IM3 A;  4KDI C;  3R2I A;  2Y3A A;  3PRM B;  1E7U A;  2LRU A;  3UGB B;  1FNV A;  1YN4 A;  2JX5 A;  1ZPS A;  2RSU A;  1TZ1 A;  2BBC A;  1UNS A;  2J53 A;  2M19 A;  3VXW A;  5JHA A;  2J42 A;  2AQ1 B;  1LM8 B;  4C00 A;  3P42 A;  4NPN A;  2HTH A;  5D7G A;  1FPY A;  2PJH A;  1FCL A;  3AM9 A;  3AU4 A;  1UF0 A;  4TSS A;  2K8B A;  1NEN B;  1P1A A;  5T8I A;  4X57 B;  3A9K A;  2KTF A;  2DWQ A;  2ZNV B;  1XEE A;  2I38 A;  1QOB A;  3SFD B;  4BKS D;  4ICU A;  3U7D A;  1F1H A;  1V2Y A;  2L76 A;  1WXM A;  2LXC A;  2PE6 B;  3VHT C;  2GI9 A;  2I1J A;  4J3O D;  1N6Z A;  3IT4 B;  1BUI C;  3T3O A;  2PE9 A;  3APF A;  2B3A A;  2O2V A;  3QA8 A;  2KDB A;  4OHJ A;  2W54 A;  4IM0 A;  4M8N A;  3TBL D;  1ACC A;  2AQ2 B;  1RAX A;  4IOI E;  2PTL A;  4WUR A;  1ZDX A;  5HG2 A;  3OWE B;  2E6X A;  3WIM A;  2ICI A;  1V97 A;  3GE3 C;  3V6E B;  2BWF A;  3EA6 A;  5FK9 C;  4RM8 A;  3MC8 A;  4TMA B;  4J6I A;  2O6V B;  2FNJ B;  2KJR A;  3EUB 2;  1FFV A;  5BYR A;  2G9H D;  5D3D A;  2MA9 B;  4OZB A;  1EU4 A;  2XNA C;  3AED B;  1RLF A;  3AE4 B;  3AU5 A;  1TZO A;  1XXG A;  5IOI A;  1Z5S B;  1OQR A;  3VAW A;  2GBJ A;  3JVZ X;  3ZJU A;  4MSM B;  2B76 B;  5G5G A;  3P63 A;  1IPG A;  3H7S A;  2GBK A;  4XDD A;  1N63 A;  2GBN A;  4MT5 A;  1K50 A;  2LJI A;  3PSE B;  4WWM A;  1ISN A;  3GP7 A;  1E90 A;  3V62 A;  4M01 A;  4B95 A;  4KX6 B;  1SJE D;  4RF1 A;  5LXI B;  5EE9 A;  1C76 A;  2DAF A;  3KQ4 A;  1SBB B;  4LK0 M;  2YVC A;  2YEP F;  2KFK B;  4HPM B;  4URK A;  1KLG D;  1D5Z C;  1WJ4 A;  4ANX A;  1K51 A;  1EUV B;  2JVC A;  4F7Z A;  4GDK B;  1IYF A;  2RD0 A;  3PZ7 A;  3AI5 A;  1WWT A;  4UDU C;  2HD5 B;  1J7C A;  3TMP B;  2WXL A;  4YWG G;  4RGO S;  2QC8 A;  4XWT A;  1FEH A;  3UI3 A;  3Q8F A;  2FUH B;  4WIP A;  3BIN A;  1L2N A;  4CQN A;  4P7I A;  1P0R A;  4G3X B;  1WJN A;  1L0Y B;  1ZE3 D;  3N30 A;  3AEF B;  3LYY A;  3RZF A;  1E8Z A;  1WR6 E;  2BTE A;  2RMM A;  2V0G A;  2ZPN A;  1OFF A;  2FCM A;  4DDI D;  2WWZ A;  3DHH C;  2I2Y A;  2REX A;  2JZP A;  1CMX B;  2NTS A;  1B1Z A;  1FO4 A;  3CST A;  5AZG A;  1VZ7 A;  2GB1 A;  3ZYY X;  2PW9 A;  2MCN B;  2KWU B;  3ZNI D;  4EE2 A;  3RD2 A;  1SB3 C;  1WX7 A;  4AJW A;  2DNF A;  5IP4 D;  1MHH E;  3DHI C;  4E71 A;  3TEZ A;  3Q2A C;  3B1L X;  3R8B A;  1DYQ A;  3ZRF A;  5TSS A;  2ZW0 A;  4IC7 B;  1E7V A;  2LVP A;  2IO3 B;  2KAJ A;  1E5W A;  4GLS C;  4KZC A;  3WAN A;  4DDG D;  1WRI A;  5CHV C;  2FIF A;  4L1B A;  3SD5 A;  4WWO A;  1MJD A;  2MJE A;  4W9I A;  5H92 C;  2NTT A;  2AQ3 B;  2WXO A;  2D3C A;  2IYD B;  2ZVN A;  2K6D B;  3KYC D;  2DZM A;  3RPF C;  3AE9 B;  3PTF C;  2IZV B;  2R61 A;  3DOW A;  2WXI A;  4ZOH C;  2K8H A;  3U4E G;  2AL3 A;  4ARC A;  3DBL I;  3KYD D;  3VH4 B;  5BMH A;  1JAL A;  3BVM A;  2K39 A;  4M8M A;  2A4Z A;  2D3G A;  3MJW A;  3AEC B;  2K9X A;  5C23 A;  2XN9 C;  3U8Z A;  2MBH A;  3C19 A;  1WI0 A;  4OVV A;  2N7E A;  3N1X C;  2M56 B;  1VDV A;  5AZF A;  1L5P A;  2INN E;  2ACZ B;  3B9J A;  5C1Z A;  5EE3 A;  1QQR A;  4KSL C;  1V5T A;  3L54 A;  3OJ4 B;  4E3C A;  2WX1 A;  1WGR A;  1L7Y A;  3VTU A;  1RYJ A;  4NJ6 A;  1SGH A;  2BYT A;  3OJ3 A;  2RR9 A;  2KAC A;  2HE7 A;  1RWS A;  2LRW A;  3JSV B;  3NUH B;  2BKF A;  3RT3 B;  4MDK E;  2BS3 B;  3M95 A;  2WXJ A;  4AWJ A;  1V1P A;  1IGC A;  1HE8 A;  1R4N B;  2AX5 A;  5C2T B;  2DYO A;  3GB1 A;  1FFU A;  3VR9 B;  2L32 A;  4N59 A;  3AEA B;  5IO9 A;  4W9H A;  4BKG A;  4RFB A;  2C9W B;  4IDI A;  3Q8E A;  2IBI B;  4GDL A;  2YLM A;  2BT6 A;  2GRI A;  4BBN F;  5D2M B;  1YJJ A;  4MM3 B;  3RNB C;  4ARI A;  1RM6 C;  4NJC A;  1EWC A;  3KVF B;  1SE9 A;  1Y56 A;  4BZA A;  2WYQ A;  1WXA A;  4XE0 A;  2ZVO A;  3DCG A;  3W5V B;  4JX1 C;  1TKE A;  1UD7 A;  3Q6B A;  5GMV A;  2BWE S;  4KGT A;  2KTR A;  2BKR B;  5HKH A;  1RRB A;  4HCN B;  1ESF A;  1ZXI A;  3RMK C;  1FXI A;  3QHT A;  4FLH A;  2INC C;  4E74 A;  2Y5B B;  3HK0 A;  3N1Y C;  4K7S A;  4DHJ D;  4XC2 A;  1GC6 A;  2MBE A;  3AH7 A;  3M3J A;  3P2B A;  3VRB B;  5HFY A;  4KZ0 A;  1E7P B;  3U52 E;  2LFI A;  3DQV A;  1EO6 A;  3ZKJ C;  3FAH A;  1IP9 A;  3IVF A;  3Q69 A;  3SHQ A;  5IA7 A;  1QZE A;  4OVZ A;  1SIF A;  3CF6 E;  1SF0 A;  4HKZ E;  4FJV B;  3ZDT A;  1V5O A;  4RF0 A;  1YQ3 B;  2JYT A;  4RNA A;  4N9F 4;  3QAR A;  1GB4 A;  4I6P A;  4JLC A;  2L05 A;  2MHJ A;  3VTV A;  2K5P A;  2M4N A;  3PS6 A;  4PT5 A;  5D3I B;  1WGH A;  2W82 A;  2CJO A;  2Y5C A;  3PGE A;  2NBV B;  3MHS D;  1WF9 A;  4PYU A;  1I4R A;  3IAS 1;  4NJ7 A;  2J0J A;  1TS3 A;  2L1A A;  3DVG X;  2IO0 B;  1Q10 A;  1WGK A;  3OAW A;  2FCS A;  4YXD B;  1N60 A;  4MH8 A;  3DWM A;  2J52 A;  1YX6 B;  1E0Z A;  2RGF A;  1XF5 L;  3SEB A;  2WDQ B;  3B2G A;  1UZX B;  2WDR B;  2LHD A;  3UF8 A;  2NR2 A;  3UIO B;  2GLS A;  3R66 C;  1LXD A;  4MJS B;  4HDO A;  1TKG A;  2WU2 B;  3ZW3 A;  2OJW A;  3DBH B;  3DHG C;  1R4M B;  3W1Y A;  2WDV B;  1WMH B;  1SJH D;  3QC8 B;  4JIO U;  3AMZ A;  1I4P A;  1WFY A;  1YNT E;  3DBR I;  1JWS D;  2EKE C;  1JRU A;  3TSS A;  4R3D A;  4ICV A;  4A20 A;  1EM7 A;  4RMA A;  1YD8 U;  3GE8 C;  3R7R A;  2ZEQ A;  4ITK A;  2IJ0 A;  1FCC C;  5JZE B;  1J8C A;  2KOX A;  1NBF C;  2EEL A;  1P3Q U;  4WQO B;  4HDQ A;  1TS4 A;  1JCK B;  1DOI A;  1WX8 A;  3L4P A;  3L17 A;  3NS1 A;  2D10 A;  2VH2 A;  2V1Y A;  4C4V A;  2PVG C;  2BGF A;  2RDH A;  4A8X C;  4EKU A;  2LVQ A;  3Q3M C;  2NPT A;  2V4L A;  3A1Q A;  1VJK A;  2MRP A;  3A9J B;  3MP9 A;  1WR1 A;  2JWZ A;  5HHD G;  1MFW A;  3GZN I;  2V3P A;  2PVO D;  2IPK D;  2Y5P A;  3DPD A;  1PYW D;  1V6E A;  1BXT A;  1LO5 D;  1ENF A;  4FN2 A;  2X8X X;  5CTR C;  3EC8 A;  3V05 A;  3Q8A A;  4M0W A;  2L0F A;  4NQL B;  1FD6 A;  1N5W A;  3RNG C;  2HJ1 A;  4F8C B;  2K0P A;  4A3P A;  2PMV A;  1N62 A;  3H7P B;  3PZD A;  4DHJ B;  2SEB D;  3W5U B;  3KUZ A;  5AUK A;  3CSF A;  4JPS A;  1V80 A;  1IBX B;  4KGR A;  1YOV B;  1ZUD 2;  2LGX A;  3Q8C A;  1WXV A;  1C4C A;  3ZLZ A;  4BKT A;  3HRD D;  3VUY A;  1DOY A;  4KIK A;  2FCQ A;  3BK1 A;  4MEL A;  5DPT A;  3SU8 X;  3Q3J A;  3V60 A;  4HVB A;  3BK2 A;  3HM6 X;  1PUT A;  5D94 A;  1JWB D;  5KHQ A;  4IM2 A;  1TS5 A;  1TY2 A;  4EZL A;  4FJZ A;  3L0W B;  1K52 A;  1QLB B;  2JT4 B;  3RFZ B;  3H6N A;  1RFA A;  3IHP C;  3AB5 A;  1C77 A;  2JF5 A;  2LGS A;  4O1N A;  4DK5 A;  3CWI A;  2WXH A;  2C60 A;  1EF5 A;  4MAC A;  2GMI C;  1XCT L;  4IW0 A;  4P6V F;  1FNW A;  3TL5 A;  4KSK C;  5E6J A;  2KX0 A;  2QHO A;  1I42 A;  1CJE A;  4CO7 A;  1YJI A;  4B0M A;  4K1R B;  3TEW A;  3QK0 A;  3ZNH B;  1P98 A;  4DXA B;  2C5L C;  1XLO A;  4WAA A;  3MFG A;  2IO2 B;  2M0X A;  2JSV X;  2IGH A;  4TUU A;  4KDL B;  4NAW B;  1T0Q C;  4RM9 A;  2IY0 B;  2KVZ A;  4FHK A;  3R3M A;  1WE7 A;  1JWM D;  5DPW A;  2WXG A;  1NI2 A;  3ZNZ B;  1UH6 A;  4HWI B;  3BY4 B;  2J4X A;  2VZK D;  4LNO A;  5FKA C;  4IUM B;  2X38 A;  4ZYN A;  2LUE A;  2MLB A;  1TJE A;  5BMG A;  2L7R A;  4LNI A;  4KKJ A;  1C3T A;  1C4P A;  4B0E A;  4HRS A;  4HJG E;  2K6Q A;  2RDB C;  4C56 C;  2L83 A;  1T3Q A;  3A9K B;  3IBE A;  2QJL A;  2KJ6 A;  4ACF A;  3NY5 A;  2ZCB A;  1WM2 A;  1H8C A;  4XWW A;  4Q2J A;  5IAA C;  4DWF A;  3ZTD A;  1VZ6 A;  2WQY B;  2KN5 A;  3PV1 A;  4S17 A;  2K3U A;  2AYO B;  1I35 A;  3AE2 B;  3N9Y C;  2DHZ A;  1SE2 A;  1XD3 B;  4XYC A;  1E8X A;  3HM3 A;  2WU5 B;  4LNN A;  1VD2 A;  2D3B A;  2KVR A;  2O2V B;  3AV8 A;  3PRP B;  4I6L B;  4GB9 A;  1GC7 A;  4JQW C;  2K25 A;  2MJ3 A;  3PO0 A;  3P4S B;  2WS3 B;  1SXT A;  2V4I B;  4ANV A;  4P1C C;  1F77 A;  1OEY J;  2LJ5 A;  4LJO B;  3RNC C;  3AE6 B;  3NRZ A;  3UIP B;  1D6E C;  3AXC A;  2L52 A;  4EUT A;  3QX1 A;  3RNF C;  2QSD A;  1Q1O A;  3B2F A;  1YJ1 A;  1QOG A;  2FAZ A;  2TSS A;  2CU3 A;  4NNJ B;  1U4A A;  2LWP A;  2PLP A;  4FA6 A;  2MSE D;  2KJH B;  2MH7 A;  3KH0 A;  1KH0 A;  2WGS A;  4WJP A;  2MW5 A;  4D2K A;  2KQ4 X;  1VCB A;  4K7U A;  1KF6 B;  2ZNV C;  2KC1 A;  3PPA A;  1M94 A;  3N32 A;  1JRP A;  4N58 A;  2DEN B;  1GPX A;  5KHO A;  4HEA 1;  2GBR A;  5GXG B;  2G1E A;  3VUW A;  4TKN A;  5L83 A;  1D5M C;  1YX5 B;  2VH1 A;  4EOY A;  1NYQ A;  2I1K A;  3U7Z A;  1ZDV A;  2JYE A;  2N7D A;  1P7F A;  2BQQ A;  4AQ7 A;  1XT9 B;  5LXH A;  3TJP A;  3DBS A;  4ZRP A;  3ZXR A;  1UGM A;  4B9K A;  3VTW A;  2LVO A;  2AL6 A;  5J17 A;  2CS4 A;  2CKH B;  2V9H A;  3VUX A;  1V81 A;  3ONS A;  4TQ1 A;  1QF6 A;  2CR5 A;  1F0Z A;  3Q8B A;  4JWS C;  1KOT A;  2C7N B;  2D07 B;  1PQS A;  4HPL B;  3IT6 B;  3AEG B;  3W2D A;  2J0K A;  2K1F A;  1KTK A;  4GMV A;  3AE3 B;  4IWO A;  4HXD A;  2IGG A;  4GXB A;  4BFR A;  3RNA C;  1G6J A;  4XGA B;  4XDC A;  1XO3 A;  2JPH A;  3WCQ A;  1HTO A;  4BOS C;  4B6W A;  3ECI A;  3I3T B;  4DHZ B;  3DVG Y;  4OW0 A;  3W9C B;  2L8J A;  3H9D A;  2KHW B;  2KX3 A;  1UUP A;  3PLU A;  1KLU D;  4WJQ A;  4WJN A;  2M1M A;  1MG8 A;  2MQJ A;  2VZK B;  2CHZ A;  2IDY A;  2DX5 B;  1J0G A;  1S1Q B;  3QQ8 B;  3VRA B;  3U2S C;  2NBU A;  2W3S A;  5BYS A;  3RCZ A;  1N5X A;  4FUL A;  5L95 C;  3AUL A;  2BS4 B;  3QAQ A;  1WGG A;  1WYG A;  2KO3 A;  2LMC A;  1ZKH A;  4KV2 A;  2ZZP B;  5EE0 A;  3N3K B;  5DCN A;  4MH0 E;  2G45 B;  4YTN B;  3QJZ A;  1T0Y A;  1EU3 A;  5HI1 A;  1OGW A;  1TGZ B;  2K22 A;  5H8Y E;  1V8C A;  3BYT B;  1X1M A;  2WXN A;  1KLV A;  1HTQ A;  2YEP B;  1VZ8 A;  1UEL A;  2WX0 A;  2LGI A;  2WNM A;  1SSN A;  3HUI A;  3MJ5 A;  3Q3N C;  5FR6 A;  1GG3 A;  2D3A A;  3KLS X;  5E6P A;  3AEB B;  3PZ8 A;  1F52 A;  2EKI A;  1WZ3 A;  1HZ6 A;  4M02 A;  2ON8 A;  3ZQ4 A;  1QKZ A;  2H89 B;  2W9N A;  2LEK A;  2DYB A;  3CMM B;  3LB8 C;  1K53 A;  4W9L A;  3RYT A;  2JXX A;  5BYQ A;  2FCN A;  2AWT A;  3CIR B;  1MHX A;  2N1W A;  4XX5 A;  1HQR D;  2DZI A;  1AN8 A;  4C80 A;  2BB6 A;  3FKY A;  1N61 A;  1UWM A;  2FBW B;  2HJ8 A;  1WGD A;  2JQR B;  2MEK A;  1GUA B;  4HRO A;  3DVN U;  4JWU C;  1L6U A;  2V3N A;  1D4B A;  1OQY A;  1WE6 A;  5JHB A;  3JW0 X;  3SFE B;  2ZCC A;  5E6N A;  5JH5 C;  2QIE B;  4USA A;  3NVV A;  1UBQ A;  1NEK B;  3OLM D;  3PVL A;  2KKC A;  2O6V A;  3PLV A;  1C78 A;  1L0X B;  3M63 B;  1WJU A;  2XK5 A;  3IXS A; 
#chains in the Genus database with same CATH homology
 2PMV A;  5LNK 1;  1N62 A;  2BTE A;  2RMM A;  2V0G A;  1OFF A;  2SEB D;  3W5U B;  4DXG A;  4L23 A;  5AUK A;  4JPS A;  3NZ3 A;  1QOF A;  1IBX B;  1MI0 A;  2LHE A;  1HEZ E;  1C4A A;  1FMA D;  1ZXH A;  1YN5 A;  2I2Y A;  1B9R A;  2WXP A;  3V3X A;  2JZP A;  3BII D;  1V1O A;  4KGR A;  1ZUD 2;  2NTS A;  1MVK A;  1B1Z A;  1FO4 A;  3Q8C A;  1L6V A;  3LXF A;  1VZ7 A;  2GB1 A;  4YSY B;  3ZYY X;  1C4C A;  2PW9 A;  2IGD A;  3HRD D;  1DOY A;  1TY0 A;  2H88 B;  1WXQ A;  3BK1 A;  3EGR A;  2INP E;  4EE2 A;  4US8 A;  1SB3 C;  3BK2 A;  1SE4 A;  1PUT A;  1JWB D;  1GB1 A;  2D5G A;  4RCO A;  1HXY D;  1JWU D;  1MHH E;  3TEZ A;  1TS5 A;  1TY2 A;  3R8B A;  1C9F A;  1DYQ A;  3H8H A;  3ETR A;  3BVG A;  2KWD A;  1K52 A;  2OED A;  1JW9 D;  1QLB B;  1SE3 A;  3AE5 B;  1CQV A;  1ZP0 B;  3RFZ B;  4LLG M;  5TSS A;  3KWL A;  2WLB A;  2ZW0 A;  2QIL A;  4DXF A;  3GS2 A;  3AB5 A;  1C77 A;  1FRR A;  2KAJ A;  4O1N A;  4GLS C;  3CWI A;  3I9V 1;  3IAM 1;  1R7S A;  2WXH A;  1WRI A;  2W3R A;  1I4X A;  2FUG 1;  1V1P B;  4REZ A;  1JML A;  4MAC A;  1IGD A;  4L1B A;  4RH6 A;  1SIJ A;  1XCT L;  2OHF A;  4P6V F;  1FNW A;  1I7H A;  1TS2 A;  5E6J A;  2MJE A;  2JXT A;  1MPE A;  1A70 A;  3MHZ A;  1CJE A;  3MC0 B;  3P1M A;  1FXA A;  1L4Z B;  2AQ3 B;  2NTT A;  5H92 C;  1YJI A;  4B0M A;  2DLB A;  2WXO A;  1QT9 A;  2ZW1 A;  3AE7 B;  1L0V B;  3KWV A;  1P7E A;  4GDL B;  2LUM A;  3ZJT A;  1E6E B;  3TEW A;  1GOZ A;  3RPF C;  1XLO A;  3AE9 B;  2R61 A;  2WXI A;  3MFG A;  1NVI D;  4ZOH C;  5JXV A;  3U4E G;  4ARC A;  3P4R B;  2JSV X;  2IGH A;  5BMI A;  1XLP A;  4NAW B;  3AEE B;  3TUO A;  5BMH A;  1PFD A;  1D5X C;  3P4P B;  1KFY B;  1ROE A;  1JAL A;  3NVW A;  1JWM D;  2WXG A;  3BVM A;  4A9A A;  2RPV A;  3E9S A;  4IKG A;  2PKO A;  3AEC B;  2J4X A;  1YN3 A;  3AN1 A;  2K9X A;  1OQQ A;  4ZHP A;  2XN9 C;  2VZK D;  2KDM A;  1SEB D;  5FKA C;  1GAQ B;  4ZRQ A;  1DOX A;  2WP9 B;  2X38 A;  1IBX A;  1HZ5 A;  3E56 A;  4KKI A;  3O13 A;  2JWU A;  1TJE A;  5BMG A;  1BML C;  4KKJ A;  4OZA A;  2KMM A;  1C4P A;  1EWY C;  2M56 B;  3HVZ A;  1VDV A;  4HRS A;  4HJG E;  4B0E A;  4C7Z A;  1L5P A;  1FM0 D;  4TQ0 A;  4RGM A;  4C56 C;  2INN E;  2ACZ B;  3B9J A;  2CJN A;  2L83 A;  1FNU A;  1T3Q A;  1F2R I;  5EE3 A;  2E3T A;  1I4Q A;  3ZJV A;  1QQR A;  3HVD A;  3AE8 B;  2QJL A;  1CK1 A;  1M4V A;  2WXR A;  1XLQ A;  5G5H A;  4ZYS A;  2SAK A;  1J7B A;  4YTP B;  1FRD A;  4YSX B;  4XWW A;  4Q2J A;  1JQ4 A;  3BZD B;  2M0A A;  1VZ6 A;  1RYJ A;  2Q5W D;  2WQY B;  2ONQ A;  3ZGZ A;  2BYT A;  2K3U A;  3AE2 B;  2KAC A;  3P4Q B;  3N9Y C;  4A55 A;  4KGS A;  1NI3 A;  4RGT A;  3FIL A;  1SE2 A;  1AWD A;  2WXM A;  1RWS A;  2WU5 B;  3NUH B;  4RGN A;  2HDE A;  3DWG C;  1F2R C;  2BS3 B;  1VR9 A;  3AV8 A;  2N9K A;  2WXJ A;  1V1P A;  1PGX A;  1E9M A;  1IGC A;  5C3J B;  1CZP A;  2MJ3 A;  2AX5 A;  2WXQ A;  5C2T B;  2DYO A;  1QIL A;  3GB1 A;  3PO0 A;  2WXF A;  1FFU A;  1QOA A;  3P4S B;  4A90 A;  2JU6 X;  2WS3 B;  1SXT A;  2V4I B;  3VR9 B;  2L32 A;  4N59 A;  1F77 A;  3AEA B;  3AE6 B;  2BW2 A;  3NRZ A;  1C79 A;  1D6E C;  2DYM A;  4RFB A;  2L52 A;  2N7J A;  1VLB A;  4WAF A;  2QSD A;  4IDI A;  1E10 A;  3B2F A;  3Q8E A;  5MPO A;  1QOG A;  2HTM E;  2RDG A;  1T5X D;  4WQM A;  2TSS A;  2BT6 A;  2GRI A;  2CU3 A;  5EE1 A;  1L4D B;  2Z8L A;  3I57 A;  1YJJ A;  1AW7 A;  2PIA A;  4MM3 B;  1RM6 C;  2PLP A;  4NJC A;  4ARI A;  2MH7 A;  1EWC A;  2N9L A;  1Y56 A;  1KH0 A;  3ABV B;  3R2T A;  3IXS A;  2BS2 B;  2KQ4 X;  2N0S B;  4D2K A;  1KF6 B;  1I4G A;  2BB5 A;  4XE0 A;  3W5V B;  3R2I A;  4JX1 C;  2Y3A A;  1TKE A;  1JRP A;  4KGT A;  4N58 A;  1GPX A;  1FNV A;  2FE8 A;  1ESF A;  1YN4 A;  2JX5 A;  4HEA 1;  1ZPS A;  1ZXI A;  5GXG B;  2G1E A;  2BBC A;  3BYY B;  1UNS A;  1FXI A;  1UWX A;  1UGJ A;  2J53 A;  2M19 A;  1D5M C;  2J42 A;  1NYQ A;  3U7Z A;  1ZDV A;  2AQ1 B;  1KRH A;  2JYE A;  1P7F A;  3P42 A;  3AH7 A;  4DQO C;  4AQ7 A;  3VRB B;  5HFY A;  5D7G A;  4WH4 A;  1FCL A;  1E7P B;  3AM9 A;  3U52 E;  4ZRP A;  2LFI A;  4TSS A;  2W55 A;  3T3N A;  4YTM B;  1NEN B;  5T8I A;  4H2A A;  3FAH A;  2DWQ A;  1I4H A;  1XEE A;  2I38 A;  1WSP A;  1QOB A;  1YMH E;  3Q69 A;  3SFD B;  1JRO A;  4OVZ A;  1SF0 A;  4HKZ E;  4RF0 A;  1YQ3 B;  4TQ1 A;  1QF6 A;  1F0Z A;  1VRA B;  2JYT A;  3Q8B A;  4JWS C;  4RNA A;  2GI9 A;  1GB4 A;  1DGJ A;  3IT6 B;  3AEG B;  1T6B X;  3W2D A;  4J3O D;  4NAM A;  3NVY A;  3IT4 B;  1YQ4 B;  1BUI C;  2QEJ C;  2K5P A;  1KTK A;  3T3O A;  4PT5 A;  3AE3 B;  5D3I B;  5FR3 A;  2W82 A;  2CJO A;  2Y5C A;  2IGG A;  4LTU A;  3C8Y A;  4OHJ A;  2W54 A;  1NYR A;  4XDC A;  3VR8 B;  1PDX A;  1XO3 A;  1XCQ L;  3WCQ A;  4N6E B;  1I4R A;  3IAS 1;  1STE A;  1ACC A;  1TS3 A;  2AQ2 B;  2L1A A;  4IOI E;  4C7Y A;  1Q10 A;  2PTL A;  4WUR A;  1ZDX A;  5HG2 A;  1PGB A;  1WGK A;  3OWE B;  2E6X A;  2ICI A;  1V97 A;  4OW0 A;  3EA6 A;  4YXD B;  1N60 A;  4MH8 A;  3DWM A;  3W9C B;  2J52 A;  5FK9 C;  1UUP A;  4TMA B;  1E0Z A;  3FC4 A;  1KLU D;  2QMT A;  2WXK A;  3EUB 2;  3TEY A;  2VZK B;  1FFV A;  5BYR A;  2G9H D;  1AYF A;  1XF5 L;  2IDY A;  2WDQ B;  3SEB A;  3B2G A;  5D3D A;  1ZOY B;  2WDR B;  2LHD A;  4OZB A;  3U2S C;  3VRA B;  1EU4 A;  3W1S A;  2W3S A;  5BYS A;  2XNA C;  3AED B;  1TKG A;  1N5X A;  2WU2 B;  3AE4 B;  4YSZ B;  1TZO A;  1XXG A;  2BS4 B;  2MJD A;  1WYG A;  2LMC A;  5EE0 A;  1OQR A;  3TEX A;  2WDV B;  1SJH D;  3ZJU A;  3AMZ A;  1I4P A;  1PGA A;  1YNT E;  1JWA D;  4YTN B;  3FIL B;  4L2Y A;  1EU3 A;  1JWS D;  2B76 B;  1ET9 A;  5G5G A;  5HI1 A;  3TSS A;  3SR6 A;  2K22 A;  3P63 A;  4R3D A;  5H8Y E;  1V8C A;  3BYT B;  1TKY A;  2WXN A;  5I4D A;  1EM7 A;  4HKQ A;  4XDD A;  1N63 A;  4MT5 A;  1K50 A;  1RFK A;  2LJI A;  2YEP B;  1VZ8 A;  4A6Q A;  2LGI A;  2WNM A;  1SSN A;  3HUI A;  3MJ5 A;  4WWM A;  3GP7 A;  3KLS X;  4ITK A;  1SJE D;  4KX6 B;  2IJ0 A;  4RF1 A;  1FCC C;  5EE9 A;  3AEB B;  3PZ8 A;  2DBY A;  4YT0 B;  1C76 A;  1FIQ A;  2EEL A;  3AE1 B;  2EKI A;  4US9 A;  4P16 A;  3KQ4 A;  1SBB B;  1HA5 A;  1HZ6 A;  1TS4 A;  3VQI A;  1JCK B;  1DOI A;  2ON8 A;  4LK0 M;  2YEP F;  3BVZ A;  3URY A;  3L4P A;  3ZQ4 A;  1QKZ A;  2H89 B;  2LEK A;  3NS1 A;  4NZL B;  1ET6 A;  1KLG D;  1XLN A;  3LB8 C;  2NMQ A;  3BWU D;  1D5Z C;  1K53 A;  1K51 A;  2PVG C;  5BYQ A;  2RDH A;  4A8X C;  3CIR B;  1MHX A;  1VJK A;  1HQR D;  4GDK B;  1AN8 A;  4C80 A;  2BB6 A;  3PZ7 A;  3NVZ A;  1WWT A;  3MP9 A;  4UDU C;  1N61 A;  5HHD G;  1J7C A;  1IUE A;  1UWM A;  2KN4 A;  4AS1 A;  2V3P A;  2FBW B;  2PVO D;  2IPK D;  2WXL A;  2Y5P A;  4YWG G;  2JQR B;  4FXC A;  4RGO S;  3J9C A;  2MEK A;  4HRO A;  4JWU C;  1PYW D;  4XWT A;  1L6U A;  1BXT A;  1FEH A;  1LO5 D;  2V3N A;  1D4B A;  1ENF A;  1J7A A;  3SFE B;  3V05 A;  3Q8A A;  3UI3 A;  2QIE B;  5AUI A;  3Q8F A;  4USA A;  3NVV A;  4WIP A;  1NEK B;  1TYG B;  4M0W A;  4OZC A;  1FD6 A;  4CQN A;  1N5W A;  1C78 A;  4JE3 B;  1L0X B;  1L0Y B;  4ZHO A;  2K0P A;  1ZE3 D;  3AEF B;  3LYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...