4YWGG

Crystal structure of 830a in complex with v1v2
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
118
structure length
103
Chain Sequence
MTTFKLAACVTLNCTETRVKHCSFNITTDVKDRKQKVNATFYDLDIVPLSSSLYRLISCQTTTTEAVDAATAAKVFKQYANDNGIDGEWTYDDATKTFTVTEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The V1V2 Region of HIV-1 gp120 Forms a Five-Stranded Beta Barrel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein/immune system
molecule keywords Light chain of anti-HIV-1 gp120 V1V2 antibody 830A
total genus 17
structure length 103
sequence length 118
chains with identical sequence Q
ec nomenclature
pdb deposition date 2015-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.790 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4ywgG00
3U4EG 3U2SC 4DQOC 4YWGG
chains in the Genus database with same CATH superfamily
3KUDB 3BINA 2NS5A 3W5VB 3ECIA 4K3CA 4TV3A 2KMCA 1EF1A 3IVFA 3PRZA 3AE6B 1KOTA 2Q5WD 2XBBC 4WAAA 4TKNA 3PLUA 5EE0A 1Z5SB 3R2IA 3JW0X 5IAAC 3BYTB 5DPSA 2JRHA 4ICUA 4F1SA 1R7SA 1TKGA 1VDVA 4OZAA 1ENFA 1L6UA 3ZKJC 1WE7A 2R2QA 2MP2A 3FKYA 2OJWA 2M8SA 2HD5B 1GOZA 1FXAA 1QZEA 2ICIA 3GZNI 1TZOA 1E10A 1FPYA 1VZ6A 2KN5A 5IN7A 2KDBA 1XCQL 2WXLA 3QK0A 4YSZB 4ZOHC 4RNAA 1HXYD 1XF5L 2L05A 1FIQA 2J4XA 2V1YA 2IGDA 4XDDA 2I38A 1D4BA 2DAFA 4HVBA 1XD3B 3DVGX 1TIFA 3VTUA 2VH1A 2SAKA 4QAYA 2W82A 3ONSA 3QQ8B 5AEKB 1NI3A 4XYCA 3VVWB 1GNUA 3RPFC 1YN3A 3A4SC 3ML9A 2EELA 1D6EC 3IAS1 1HA5A 1SE2A 1IP9A 2VRRB 1JWSD 2V4LA 1CK1A 2RMMA 3NG0A 4WURA 5DPWA 4GDKA 4I6NB 2L7RA 5AUIA 3V62A 3TUOA 3ZXVA 2L52A 2L0FA 3L0WB 2ZCCA 5TR5A 2JY6A 4IUMB 2WS3B 3ZNID 1KFYB 3AE3B 2BWFA 2N9KA 4ZHOA 1MHHE 2V3NA 2LEKA 2IBIB 2KFKB 1EWYC 4MJSA 3AE9B 2WHIA 2KDIA 1V81A 4M8NA 3SFEB 2MBOA 4RMAA 2LGIA 1EU4A 2LVQA 4ZYSA 2NTSA 3SR6A 2BS3B 4IKGA 3U4EG 3X0WA 1FD6A 1FNWA 1F2RI 4RGNA 3M95A 4W9IA 2BBCA 3DBHI 1XLNA 2KWCA 3VFKA 4DK5A 4CO7A 3N20C 3ZJVA 3ZRFA 1NENB 1BUIC 2PPHA 4HXDA 2Y5PA 4EE2A 2JVCA 4AJYB 5HKHA 1V5OA 5HG2A 2ZPYA 1T3QA 1B1ZA 3D32A 1T5XD 4BAXA 4LDTB 2LUMA 2WYQA 1WX8A 3GE8C 3JYUA 3DVGY 2WWZA 3W5UB 4JWUC 3ZTCA 4II2B 3K9PB 2AL6A 2MJDA 1ZW7A 1LFDA 2AEHA 4LDTD 3AE8B 4FN2A 2L76A 4GDLA 4MT5A 3EHVA 2PW9A 2PTLA 2JYTA 1P7FA 3ZGZA 1RWSA 4AOFA 4HROA 3SEBA 3AI5A 3L17A 2V0GA 1UD7A 2JT4B 1QILA 3T9LA 2C5LC 1NBFC 5D2MB 3AEEB 5LNK1 4JQWC 3AEGB 2INNE 1JWBD 1MJDA 4XDCA 1NDDA 1XLPA 1OQYA 3TEWA 3TEYA 2K3UA 3WIMA 2RPVA 1V6EA 3BVZA 3VQIA 2IJ0A 4LJOB 2KOXA 3Q3OC 1JRPA 4EEWA 1VZ8A 3VR9B 3UGBB 3AEAB 2A4ZA 4IOIE 1JWUD 2KWDA 1E7VA 2GBRA 1RLFA 5LXIB 3BK2A 3PZ8A 4N9F4 1OEYA 2N9EB 3ZQ4A 2BS2B 4A8XC 2MBBB 1WJNA 3VUYA 4MGZE 5DCNA 2ZW0A 2I1JA 2KD0A 3RUIB 1TS3A 2FCQA 3T3NA 3Q3FA 4CYEA 1FNUA 1WMHB 3AU5A 1VRAB 2CU3A 1IPGA 3RCZA 2W55A 3MHSD 4A3OA 2J0MA 2KLCA 4P1CC 2LXCA 2BKFA 2O6VA 2C7MB 1OEYJ 4HCNB 3NOBA 3AU4A 4B9KA 1GB4A 3TMPB 2OEDA 3Q8FA 4RGTA 2R61A 2K5PA 3DBLI 3W1SC 3A9JA 1JALA 1D5ZC 3AB5A 4P16A 4WAFA 1V2YA 2DX5B 2WX0A 2CHZA 3RNGC 3SD5A 2KC1A 1VZ7A 3I9V1 2K8HA 3ZJUA 5FR6A 1E9MA 1WR1A 1WXSA 1XQQA 1X1MA 2W3SA 3I5JC 3ZDMC 1T0QC 5CTRC 2WXJA 2X38A 3DBRI 1ZKHA 2K6DB 3MJ5A 3B9JA 4YSXB 2J0JA 2NVUI 3U30A 2Z8LA 1DGJA 2JRIB 2KTRA 1WSPA 4KX6B 1UUPA 1TJEA 4PS8A 3NY5A 3CWIA 3R66C 1RRBA 4YWGG 3AV8A 4F8CB 2MH7A 4K7UA 2MRPA 2PIAA 4F7ZA 5CHVC 5BMIA 3EC8A 1C79A 4FLHA 3OAWA 1Q5WB 2GBJA 4NNJB 1AN8A 3AECB 1SIFA 3N1YC 3GB1A 2AQ2B 2OHFA 1WX7A 3ZNHB 2BT6A 1EF5A 1L0YB 3V05A 4FJZA 1KLUD 2LHDA 2LVPA 1H8CA 2V3PA 1FFUA 2KQ7A 3UF8A 4KZCA 2GLSA 3BK1A 1I4XA 3TJPA 3WANA 2K22A 2O2VB 1WM2A 3EFUA 3PRMB 1I4RA 3PZ7A 1I4QA 2IO0B 2QMTA 4KZ0A 2GBNA 3P4QB 3TL5A 2INPE 2IZVB 2YEPB 3AE4B 1ZUD2 4LNOA 4TQ0A 4CQNA 1TTNA 1GJZA 2RDBC 5DPRA 3HK0A 1JW9D 4HDOA 2ZW1A 1LQBA 2KXJA 5EDSA 4KIKB 2KAJA 4LK0M 4DDID 1EO6A 2L00B 1VLBA 3WCQA 3U7ZA 5J2RA 3L08A 3PTFC 1P1AA 2KX0A 4RF0A 1BMLC 2B3AA 3KUCB 2AL3A 2WXRA 1C4PA 2HDEA 2DZIA 3I63C 1PGXA 4DXFA 2L1AA 5G2NA 3ZLZA 4OHJA 3N1XC 1M4VA 2EKIA 2RDGA 1V1PB 3HM3A 3DHIC 2REXA 1N5WA 2CJNA 2K0PA 3OWEB 3Q8EA 2MLBA 2HJ8A 4WJQA 2BVCA 1I4GA 2KWVB 3RZWC 1V86A 2G4SA 4MGKE 2G4DB 3GZNB 4LNIA 1MPEA 2WDTB 1I4HA 2FCSA 3Q3NC 1FRRA 1SXTA 2MW5A 3ZNZB 3APCA 1WGKA 1WZ0A 4FHJA 1VD2A 3BY4B 2BYTA 3MC0B 2WXQA 3W2DA 2K8BA 3DQVA 3KW5B 1P7EA 1L4DB 1V9JA 4WH4A 2DYMA 2DYBA 4BZAA 3QWZB 3R8BA 3HVZA 1ET9A 1P0RA 1N63A 3ZO5B 1C1YB 3VH3B 4TQ1A 4KVGB 3ZNGC 1ET6A 4R3DA 1Q1OA 5D6JB 1C78A 2FE8A 3JVZX 4KSLC 3KLSX 3A4RA 5CX3A 1SEBD 4EZJA 3GOEA 3UIPB 1V1OA 1YJIA 2LHEA 3VRBB 3UQBA 1T0YA 2XNAC 2RD0A 3RYTA 3CMMB 3QAQA 3R3MA 4ZRQA 2FCNA 3QARA 2JXTA 4PYUA 4L2YA 5J17A 1J0GA 4NAMA 3Q8CA 1CZPA 5J18A 4DQOC 1JCKB 2BGFA 1V49A 3BIID 3B2GA 2EMTA 2M56B 2RGFA 2KACA 2LI5A 2W54A 3M62B 3AE5B 3O13A 4YTPB 2QEJC 1I7HA 4GLSC 1WGYA 4B0EA 4HEA1 1E7PB 2KWUB 2VZKB 1JQ4A 3NVWA 1XCTL 4ZRJA 3KYDD 4ICVA 3ZIMA 3RNAC 3PREA 3AEFB 4L1BA 2L8JA 1Y56A 1VJKA 4PYZA 3R2TA 1M94A 2M1MA 3TIXA 2ZVNA 1R4MI 4AWJA 3AXCA 3FC4A 2KDEB 3Q8BA 1YMHE 4E74A 4O1NA 1C4AA 3PPAA 5FR3A 4JL9A 4BBNF 3VHTC 3VAWA 4P6VF 3UQAA 2PE6B 1CJEA 1J7CA 2Y3AA 2E6XA 1FXIA 1FRDA 3ABVB 4S17A 2GBMA 4JX1C 2GRIA 1HZ6A 2KVRA 2JU6X 2KANA 1WZ3A 2K8CA 4FADA 2L83A 5G5HA 1XLQA 2MEKA 2ZCBA 1J19A 2GB1A 4LNFA 4EZLA 3A9KB 2LGXA 2PJHA 1T0RC 1MVKA 3KH0A 2IO2B 2KX3A 4FJYA 3MHZA 4XWTA 5IA7A 1E90A 1I4PA 1I42A 4OW0A 3O65B 3TEZA 3I57A 4ACFA 2J42A 2HTHA 4W9KA 2M0AA 2KJHB 1C76A 2ZZPB 3NVVA 1HZ5A 4H2AA 2KJ6A 1GC6A 3DBHB 4WWNA 5T8IA 2UYZB 3Q2AC 2O6VB 1YX5B 3GS2A 2MSED 1MI0A 4AQ7A 1Y8RC 2D3CA 3AH7A 2D5GA 5E6JA 2FUG1 1PGBA 2DNFA 3RNBC 4GN1A 4USAA 2DLBA 3EA6A 2V4IB 3IT6B 1KF6B 5IP4D 3V61A 3CF6E 2OOBB 2IYDB 4NY0A 4ZRKA 3EGRA 3BVGA 4KKIA 5EE1A 1IUEA 3H7PB 2BYEA 1F0ZA 1GB1A 2N4FA 2LGSA 2JZZA 1ESFA 2C9WB 4YXDB 1WY8A 2LFIA 1UZXB 3HUIA 4C56C 2QILA 2G3QB 4ZYNA 3CIRB 2DENB 2LRWA 1D5MC 4M01A 1KH0A 3QC8B 4C4VB 1RAXA 1UF0A 2N9PC 4NAWA 4M0WB 4W9LA 3A33B 3AE1B 4KIKA 3ZJTA 1WMHA 4DHJD 4IG7B 2OJRA 5BYRA 1R4MB 1TYGB 4DWFA 1KLGD 3ZXRA 4PT5A 4RM9A 3MC9A 5C23A 3UIOB 4BKGA 4KGTA 3RI7C 1XLOA 2K9XA 1WYWB 1F2RC 3H6NA 2EMSA 1WJ6A 1UBQA 2KVZA 1V1PA 3ZVVA 2WXNA 4W9FA 2QJLA 5JXVA 1L2NA 1TBEA 3UI3A 3WAPA 2WXHA 4DHJB 1C9FA 3LB8C 1TY0A 1E8WA 1WJ4A 1YN5A 4NQLB 2K1FA 1GUAB 2BTEA 1L0XB 2O2VA 2Z59B 5CHWA 3CSFA 4M00A 2WXOA 3ZTDA 2WXIA 3MFGA 3RNEC 2V9HA 2YVCA 2ZVOA 2CHWA 4IM3A 3CSTA 3U2SC 4BOSC 5BYSA 4JPSA 1HTQA 1T0SC 2LASA 3DHGC 1P98A 3SU8X 1N60A 3PZDA 4XX5A 3H7SA 4AP4C 1ZE3D 4ZRPA 4HPLB 5BMHA 1ISNA 1EM7A 4HLEA 3PSEB 1SE3A 1ACCA 4IM2A 2BQQA 1C3TA 3DVNU 1QKZA 2LRUA 4WQOB 2LJIA 5H92C 2FIDA 2KLGA 4EFOA 2MJEA 2M17A 4IWPA 2IGGA 3KQ4A 4M8MA 1UELA 1A5RA 4EZKA 3QA8A 2WXFA 1ZDXA 3PHXB 1E8YA 2N0SB 3FILA 3OG5A 2JXXA 1MG8A 1ZDVA 1YQBA 5IKCM 2G45B 5C2TB 4TSSA 4KV2A 1JWMD 4RFBA 2A5UA 4W9GA 4MH8A 1KRHA 4CHKA 1JWAD 1J7AA 4FXCA 1V97A 4FBJB 2INCC 1NVID 2Z0DB 1V5TA 2K6QA 4DXAB 4BVUC 2RSUA 4GXBA 3W1SA 1IGCA 4W9JA 4MSMB 1K8RB 3L10B 3KVFB 1HE8A 4GU2A 2WXPA 4YTNB 1E8XA 1GAQB 2WP9B 3NUHB 2JUOA 3RN9C 2KO3A 2DWQA 3WA0A 3WALA 2DBYA 5G5GA 3Q3MC 2M19A 4A55A 3S2AA 3IG3A 3OJ3A 1K53A 1HQRD 2KDMA 4KKJA 4TMAB 1PDXA 4JGHB 1SIJA 4MSQB 5I4DA 2FNJB 3NZ3A 4LTUA 4E3CA 3FAHA 4G11A 1WGGA 1FEHA 3AE7B 2DAJA 3ETRA 3E56A 2BS4B 2J53A 3RZFA 3TSSA 2BYVE 4YSYB 3DWGC 3KYCD 5C1ZA 1WX9A 4BFRA 1WXAA 2ON8A 3EFCA 1SBBB 1JMLA 1DOXA 4LLGM 5MPOA 1SJHD 5G55A 1AW7A 4DHZB 2KJRA 2BKRB 1RFAA 2N7EA 2YEPF 4ZRIA 3A9KA 3EUB2 1FXTB 1KLVA 2KQSA 1GG3A 3Q8AA 4I6PA 2L32A 2KT7A 4C00A 2L3ZA 1G6JA 4ZDVA 3A9JB 4MM3A 4NJ6A 1EU3A 3ENEA 2L0TA 3RNCC 4W9HA 2WU5B 4IW0A 2WLBA 4XGAB 3PT2B 1QT9A 4XZ4A 2KHWB 4OVUA 3APDA 2LWPA 4GSWA 4NJCA 3P4PB 3DBSA 2CS4A 3DVNV 3C0RB 5C3JB 5AZHA 4AUQC 1TZ1A 5JZEB 3MP9A 2AX5A 2YLMA 2QHOA 3BYYB 4BBNC 1WGDA 3H1UA 3QJZA 4I6LB 2GMIC 3M3JA 3N30A 4N58A 4DBGA 2AYOB 1IYFA 2ONQA 2AWTA 2JQRB 5LLIA 4GB9A 3JSVA 5E6NA 4DDGD 1YQ3B 2BB5A 1UNSA 3T8MA 5LXHA 1SGHA 1HTOA 5HFYA 2BB6A 2TSSA 4G3XB 4ANVA 1FO4A 3DPDA 4XWWA 3QHTA 1E0ZA 2X8XX 4M02A 4RGOS 2JZ3B 1WRDB 4C4VA 1UWXA 2MBEA 4ARCA 4URKA 1N5XA 2PE9A 3W9CB 3MC8A 1R4NB 1P9DU 1L4ZB 2D11A 4GIVA 2LXAA 2BF8B 5JH5C 1WXMA 2CJOA 2QC8A 3ML8A 1ZP0B 2PVOD 1UWMA 4BKSD 3APFA 3VR8B 2FCMA 2JZPA 1F9JA 1YD8U 2CR5A 2N9XA 3HVDA 1L7YA 3DWMA 4OZBA 4BKSA 1LM8B 5KHQA 2J7QB 2DZJA 2N7JA 5L83A 4RF1A 2C60A 2PKOA 4P1BC 3VDZA 1T6BX 2NBVB 1KJTA 2UWQA 1WFYA 1FMAD 3IFWB 3VH4B 3AE2B 4NAWB 2WGSA 1YOVB 4EUTA 2N1WA 4EKUA 4HKZE 2O6VD 1YJ1A 3NRZA 4YL8A 5BO4B 1ZGUB 2J0KA 2KQ4X 1ZXHA 1TS4A 2MBQA 2NTTA 3DHHC 3PGEA 1IBXB 2QCZA 2HE7A 1WR6E 1DOIA 4MDKE 1DOYA 3LJ3A 1SE9A 3B2FA 2M0XA 4JIOU 2W9NA 1JRUA 4AJWA 1GC7A 1TY2A 3LYYA 2WDRB 1WGRA 4J6IA 4PS7A 4IM0A 2KMMA 3B1LX 1K52A 4MGIE 4US9A 3RMKC 4A3PA 5CHFA 4LNKA 3RFZB 1K50A 4JWSC 1QF6A 2D3BA 3N1ZC 4HWIB 5DPTA 4WJNA 2LD9A 2SEBD 4KDIC 3PRPB 1V8CA 2MQJA 4HKQA 3V3XA 2WDQB 4LJPB 5HI1A 3BZDB 2IO1B 3AMZA 2QDFA 4UDUC 4EOYA 3OJ4B 4BOZB 2DZKA 3C19A 3HIZA 3OLMD 5GMVA 2B76B 3PV1A 5H8YE 3T3OA 1R4NI 2D3GA 2WNMA 4NQKE 1NYQA 4HCPB 2H88B 2LVOA 3TBLD 1KTKA 2H89B 1C77A 1UGMA 5EE3A 3QIJA 1RYJA 1CQVA 1QOGA 3H7PA 3HM6X 4Q2JA 2LJ5A 5BYQA 3DDCB 3NVYA 1HEZE 1LO5D 1F52A 4ANWA 2BPSA 1U4AA 2N9LA 1PGAA 1H4RA 2HJ1A 2KN4A 2R2OA 1WYGA 3Q14C 2JF5A 4NPNA 2XN9C 1SJED 2EKEC 4HRSA 2UU7A 4K3BA 1OFFA 2FIFA 1PFDA 1WGHA 1WIAA 5E6PA 3U7DA 2WX1A 4C7YA 3PS6A 1OGWA 2RDHA 3N3KB 2NBWB 2JWUA 4W9CA 4WWOA 2QSDA 4LNNA 4M0WA 2K25A 4C7ZA 3VTWA 1SB3C 2IO3B 3DBRB 5FKAC 1QOBA 5E6OA 3P2BA 4PK1A 5AZGA 4K7WA 2RR9A 4ASWC 2JX5A 1D3ZA 5KHOA 4L23A 1XXGA 2BWES 3R7QA 2I2YA 4P7IA 3V6CB 4FJVB 1FFVA 2KNBA 2IY1B 2CU1A 3MTNB 3A1QB 3IT4B 4ZHPA 1NI2A 2KC2A 3ZRCA 4KDLB 4IWOA 3TEXA 3H8HA 2WXKA 3U8ZA 4MM3B 2BYFA 1FCLA 3GP7A 1ZXIA 1AARA 2IDYA 1YJJA 3P1MA 1PUTA 3Q69A 1QOFA 2WQYB 3N32A 4ARIA 3P42A 4JE3B 1LXDA 1MHXA 4WWMA 3TCAA 1BXTA 1QQRA 1Z2MA 1Q0WB 2ACZB 4II3B 2NPTA 4MEMA 5D3DA 3P4SB 2Y5BB 3JSVB 2D2QA 2MBHA 2LGYA 3V60A 1BT0A 3IXSA 5EE9A 3NVZA 1AWDA 1N62A 4BKTA 2MP2B 4K81A 1F77A 1WF9A 2PMVA 4B0MA 2ZNVB 4RGMA 1GPXA 2D3AA 1MFWA 1WXQA 2BW2A 3K9OB 3QCAA 3RNFC 1WRIA 2FUHB 1WM3A 4A90A 3RT3B 2MX2A 2MWSB 3FILB 1N6ZA 1NEKB 1E7UA 3SDLC 2KK8A 3AEDB 1AYFA 3ZDTA 1SSNA 1D5XC 1WE6A 2XK5B 3L16A 1PQSA 2INDC 4LCDE 4XC2A 2LUEA 4B6WA 3SFDB 4KSKC 5JHAA 1ROEA 2MHJA 1XO3A 1LGRA 3ZW3A 4A9AA 2IPKD 3UINB 2ZPNA 1WJUA 4IC7B 2QIEB 2N7DA 1Q10A 3NS1A 4FULA 3VRAB 2M4NA 4GDKB 5HHDG 1L6VA 1KM7A 3BWUD 2KMAA 1SE4A 4RH6A 3VUXA 2WDVB 2KZRA 1FCCC 3QX1A 1E5WA 2WXMA 2NMQA 4OVZA 3ZYYX 1NYRA 4WJOA 3NJTA 3AEBB 1QOAA 2KFKA 4K7SA 2JWZA 4D2KA 3DCGA 1YQ4B 1L0VB 2FBWB 4GGQA 3URYA 1OQRA 2G9HD 4E71A 3P4RB 1N61A 3VXWA 4GMVA 4US8A 3IHPC 3AN1A 4ANUA 4RM8A 3RD2A 1UBIA 2CKHB 3IAM1 4PS3A 1RFKA 2MJ3A 2CHXA 3Q3JA 2GOWA 1ZOYB 3PO0A 5BMGA 3L54A 4HPPA 2ASQA 4A6QA 3RULA 2JSVX 2W3RA 4W9EA 3IBEA 4OZCA 2NBUA 3LXFA 1TS2A 1XT9B 3AULA 5JHBA 1F1HA 4JLCA 2JPHA 4HPMB 4MJSB 4GDLB 2RPQA 3B0AA 4NZLB 3ZUNA 4DXGA 1TKYA 4G0NB 1E8ZA 4MGYE 4G50A 2PVGC 3P63A 1TT5B 2NPTB 5IOIA 1S1QB 4IDIA 4HJGE 5AZFA 1TS5A 3J9CA 2KYWA 1P3QU 1YNTE 1YIWA 5IO9A 4IWQA 3PHWB 1QLBB 1UGJA 2LMCA 2GI9A 1FM0D 4J3OD 3L4PA 4MELA 4NJ7A 4B95A 1E6EB 1PYWD 3GE3C 2KDFB 4ANXA 1FNVA 3V6EB 1VCBA 2HTME 1S3SG 4FA6A 1J8CA 1EUVB 4OVVA 3U52E 3WAMA 1V80A 3E9SA 2LZ6A 2V3SA 4ITKA 4WJPA 3KWLA 3ALBA 2DHZA 3N9YC 4MACA 3MJWA 2AQ3B 4HDQA 2PEAA 2N1VA 1XEEA 3H9DA 1DYQA 3VUWA 1STEA 2C7HA 2KTRB 2IGHA 3DBLB 4WQMA 2Z0EB 2VZKD 1B9RA 2J52A 3NHEB 1K51A 2AQ1B 2KKCA 4KGRA 1WWTA 1A70A 3KWVA 5AUKA 1MG4A 3PVLA 5D3IB 2JYEA 4DHZE 4GOCA 4W9DA 4MH0E 1IGDA 3NZUA 1I35A 3PLVA 3L13A 3BVMA 4REZA 2Y5CA 1YX6B 3AM9A 4K1RB 2MCNB 2K39A 1TKEA 4XE0A 4N6EB 3R7RA 2G1EA 1L5PA 4N59A 2LGDA 1UH6A 1RM6C 2D10A 5FK9C 1TGZB 4FHKA 2ZJDA 1ZPSA 1JROA 4TUUA 1WXVA 1WI0A 3A1QA 3Q6BA 3C8YA 3HRDD 3SHQA 3KUZA 2KFJA 2KTFA 2FAZA 3M63B 4A20A 1WH3A 2ZEQA 3DOWA 2NCNA 4WIPA 4HJKA 1VR9A 2MA9B 2VH2A 2I1KA 2DZMA 5TSSA 3VTVA 3X23A 4C80A 2DYOA 3B08A 3I3TB 4YTMB 4AS1A 2IY0B 1SF0A 3HHMA 1YN4A 4HK2A 2XEWA 3EECA 5D94A 5L95C 1IBXA 2ZNVC 2NR2A 3LDZE 3NS8A 2E3TA 3W1YA 2C7NB 2D07B 4RCOA 4KGSA 4X57B 2WXGA 5D7GA 3WAOA 2XK5A 4WWPA 2WU2B 2PLPA 5GXGB 1OQQA 1EWCA 1OTRB 2GBKA 3NZSA 1C4CA 1CMXB 1J7BA 4YT0B 4S0RA
chains in the Genus database with same CATH topology
2N0SB 3W5VB 3FILA 4RF0A 1BMLC 1ZDVA 2WXRA 5C2TB 2JX5A 1C4PA 2HDEA 4L23A 4TSSA 1PGXA 4DXFA 1JWMD 2L1AA 1XXGA 4RFBA 3AE6B 4MH8A 2Q5WD 1KRHA 4OHJA 1JWAD 2I2YA 1J7AA 4FXCA 1V97A 1M4VA 2EKIA 2RDGA 1FFVA 1V1PB 5EE0A 1NVID 3IT4B 4ZHPA 3R2IA 1N5WA 2CJNA 3BYTB 2K0PA 3OWEB 3W1SA 3Q8EA 1IGCA 3TEXA 3H8HA 1R7SA 1TKGA 1VDVA 2WXKA 1ENFA 4MM3B 1I4GA 1L6UA 4OZAA 1FCLA 2WXPA 4YTNB 3GP7A 1GAQB 2WP9B 3NUHB 1ZXIA 2IDYA 1YJJA 2DWQA 1MPEA 1GOZA 1FXAA 2DBYA 1PUTA 3P1MA 5G5GA 3Q69A 1QOFA 2ICIA 2WQYB 2M19A 1I4HA 4A55A 1TZOA 4ARIA 1E10A 3P42A 4JE3B 1VZ6A 1FRRA 1K53A 1SXTA 1MHXA 4WWMA 1BXTA 1HQRD 2KDMA 4KKJA 4TMAB 1XCQL 1PDXA 1QQRA 2WXLA 2ACZB 4YSZB 4ZOHC 4RNAA 1HXYD 5D3DA 1WGKA 3P4SB 1XF5L 2BYTA 3MC0B 2WXQA 1SIJA 3W2DA 5I4DA 3NZ3A 1FIQA 2J4XA 2IGDA 4LTUA 1P7EA 1L4DB 3FAHA 4WH4A 4XDDA 2I38A 1D4BA 2DYMA 3IXSA 5EE9A 1FEHA 3NVZA 1AWDA 3AE7B 3HVZA 1ET9A 3R8BA 3ETRA 1N62A 3E56A 2BS4B 2J53A 1N63A 2SAKA 3TSSA 2W82A 4YSYB 3DWGC 4TQ1A 1F77A 1NI3A 1ET6A 4R3DA 2PMVA 3RPFC 1C78A 4RGMA 1YN3A 2FE8A 4B0MA 1GPXA 2EELA 1WXQA 2BW2A 1D6EC 1WRIA 3KLSX 4A90A 3IAS1 1HA5A 1SE2A 2ON8A 1NEKB 1SEBD 1SBBB 3FILB 1JWSD 1JMLA 1CK1A 2RMMA 1DOXA 1V1OA 1YJIA 2LHEA 4WURA 3AEDB 4LLGM 3VRBB 1AYFA 5AUIA 5MPOA 3TUOA 1SSNA 1D5XC 2XNAC 1SJHD 2L52A 1AW7A 4ZRQA 2YEPF 2JXTA 3SFDB 4L2YA 2WS3B 3EUB2 1ROEA 4NAMA 3Q8CA 1XO3A 1KFYB 1CZPA 3AE3B 2N9KA 1JCKB 4DQOC 4ZHOA 3BIID 3Q8AA 1MHHE 2L32A 2LEKA 2V3NA 2M56B 3B2GA 4A9AA 2IPKD 2KACA 2W54A 3AE5B 1EWYC 3AE9B 3O13A 2QIEB 1EU3A 4YTPB 2QEJC 3SFEB 1I7HA 4GLSC 4B0EA 1Q10A 2LGIA 1EU4A 4ZYSA 2WU5B 2NTSA 3NS1A 3SR6A 2WLBA 4HEA1 1E7PB 2BS3B 4IKGA 3U4EG 1FD6A 3VRAB 2VZKB 1FNWA 1JQ4A 1F2RI 1QT9A 3NVWA 4GDKB 4RGNA 5HHDG 1L6VA 3BWUD 2BBCA 1XCTL 1XLNA 1SE4A 4NJCA 3P4PB 4RH6A 3ZJVA 2WDVB 1NENB 5C3JB 3AEFB 4L1BA 1FCCC 1BUIC 2WXMA 2Y5PA 4EE2A 2NMQA 4OVZA 3ZYYX 1NYRA 3MP9A 1Y56A 1VJKA 2AX5A 5HG2A 1T3QA 3AEBB 1B1ZA 3R2TA 1T5XD 3BYYB 2LUMA 1QOAA 4D2KA 3FC4A 1YQ4B 3W5UB 1L0VB 4JWUC 2FBWB 3Q8BA 3URYA 4N58A 1OQRA 1YMHE 2G9HD 4O1NA 1C4AA 3P4RB 1N61A 5FR3A 4US8A 2MJDA 3AN1A 3AE8B 2ONQA 4MT5A 2JQRB 4P6VF 1CJEA 2PW9A 1J7CA 2Y3AA 2PTLA 2JYTA 3IAM1 2MJ3A 1P7FA 1FXIA 1RFKA 2E6XA 3ZGZA 1RWSA 1FRDA 4HROA 1YQ3B 3ABVB 2BB5A 1UNSA 5BMGA 1ZOYB 3PO0A 4JX1C 2GRIA 3SEBA 1HZ6A 4A6QA 5HFYA 2BB6A 2JU6X 2TSSA 1FO4A 2V0GA 2JSVX 4XWWA 2W3RA 1E0ZA 4RGOS 1QILA 1UWXA 2L83A 3AEEB 5G5HA 5LNK1 4ARCA 1XLQA 2MEKA 2GB1A 1N5XA 3AEGB 2INNE 4OZCA 1JWBD 3W9CB 4XDCA 3LXFA 1MVKA 1XLPA 1TS2A 3TEWA 3MHZA 1L4ZB 4XWTA 3TEYA 2K3UA 1I4PA 2RPVA 3BVZA 3VQIA 4OW0A 2CJOA 3TEZA 4GDLB 3I57A 2J42A 4NZLB 2IJ0A 2M0AA 1ZP0B 4DXGA 1JRPA 1C76A 1TKYA 3NVVA 1HZ5A 2PVOD 1VZ8A 3VR9B 1UWMA 4H2AA 3VR8B 2PVGC 3AEAB 3P63A 2JZPA 3HVDA 4IOIE 4IDIA 1JWUD 2KWDA 4HJGE 1TS5A 3DWMA 3J9CA 4OZBA 5T8IA 3BK2A 3PZ8A 2N7JA 1YNTE 3ZQ4A 4RF1A 1QLBB 1UGJA 2BS2B 1MI0A 2PKOA 3GS2A 4A8XC 4AQ7A 2LMCA 3AH7A 2GI9A 1FM0D 1T6BX 2D5GA 4J3OD 5E6JA 2ZW0A 2FUG1 1PGBA 3L4PA 1FMAD 1E6EB 1PYWD 1TS3A 3AE2B 3T3NA 4NAWB 1FNVA 2DLBA 4USAA 2HTME 1FNUA 3EA6A 2V4IB 3U52E 4HKZE 3IT6B 1KF6B 3E9SA 4ITKA 1VRAB 2CU3A 3KWLA 3NRZA 3EGRA 2W55A 2KQ4X 3N9YC 1ZXHA 3BVGA 4KKIA 1TS4A 5EE1A 1IUEA 2NTTA 1F0ZA 1GB1A 4MACA 1IBXB 2AQ3B 1ESFA 4YXDB 2LFIA 1XEEA 3HUIA 1DOIA 1DOYA 3B2FA 4C56C 2QILA 1DYQA 3CIRB 1STEA 1GB4A 1D5MC 2OEDA 1TY2A 3LYYA 1KH0A 2WDRB 2IGHA 3Q8FA 4RGTA 2R61A 2K5PA 3AE1B 4WQMA 3ZJTA 2KMMA 2VZKD 1JALA 1D5ZC 3AB5A 1B9RA 5BYRA 1K52A 1TYGB 2J52A 4P16A 4US9A 4WAFA 1KLGD 1K51A 2AQ1B 3RFZB 4PT5A 1K50A 4KGRA 4JWSC 1QF6A 1VZ7A 1WWTA 3I9V1 1A70A 3ZJUA 1E9MA 4KGTA 3KWVA 2W3SA 5AUKA 5D3IB 2JYEA 1XLOA 2SEBD 2X38A 2K9XA 3MJ5A 3B9JA 1V8CA 1F2RC 4YSXB 2Z8LA 1IGDA 4HKQA 3V3XA 2WDQB 1V1PA 1DGJA 2WXNA 1WSPA 5HI1A 4KX6B 3BVMA 4REZA 3BZDB 3AMZA 2Y5CA 3AM9A 1UUPA 1TJEA 2QJLA 5JXVA 4UDUC 3CWIA 3UI3A 2WXHA 1TKEA 4YWGG 4XE0A 4N6EB 2B76B 5H8YE 3AV8A 1C9FA 3LB8C 3T3OA 2MH7A 2WNMA 2G1EA 1TY0A 2PIAA 1NYQA 1L5PA 5BMIA 4N59A 1C79A 1YN5A 1RM6C 2H88B 5FK9C 2BTEA 1L0XB 1ZPSA 1KTKA 2H89B 1AN8A 1JROA 1C77A 3AECB 2WXOA 2WXIA 3MFGA 3C8YA 3HRDD 5EE3A 1RYJA 1CQVA 1QOGA 3GB1A 2AQ2B 4Q2JA 2OHFA 3U2SC 5BYQA 5BYSA 2BT6A 4JPSA 3NVYA 4WIPA 1HEZE 1LO5D 1VR9A 1L0YB 3V05A 1KLUD 2LHDA 1N60A 2N9LA 1PGAA 2KN4A 2V3PA 5TSSA 1FFUA 4C80A 2DYOA 1WYGA 4YTMB 4AS1A 1ZE3D 4ZRPA 3BK1A 5BMHA 1I4XA 1EM7A 1SF0A 2XN9C 1SJED 1YN4A 4HRSA 1SE3A 2K22A 1ACCA 1OFFA 1I4RA 3PZ7A 1QKZA 1PFDA 1IBXA 1I4QA 2LJIA 2QMTA 5H92C 3P4QB 4C7YA 2MJEA 2E3TA 2INPE 2YEPB 4KGSA 2IGGA 4RCOA 2RDHA 2WXGA 3AE4B 3KQ4A 1ZUD2 5D7GA 4TQ0A 4CQNA 2JWUA 2QSDA 2WU2B 2PLPA 5GXGB 1JW9D 1OQQA 2ZW1A 1EWCA 4M0WA 1C4CA 2KAJA 4LK0M 4C7ZA 2WXFA 1SB3C 1VLBA 1ZDXA 3WCQA 1J7BA 4YT0B 3U7ZA 5FKAC 1QOBA 2WXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U4E G;  3U2S C;  4DQO C;  4YWG G; 
#chains in the Genus database with same CATH topology
 3KUD B;  3BIN A;  2NS5 A;  3W5V B;  3ECI A;  4K3C A;  4TV3 A;  2KMC A;  1EF1 A;  3IVF A;  3PRZ A;  3AE6 B;  1KOT A;  2Q5W D;  2XBB C;  4WAA A;  4TKN A;  3PLU A;  5EE0 A;  1Z5S B;  3R2I A;  3JW0 X;  5IAA C;  3BYT B;  5DPS A;  2JRH A;  4ICU A;  4F1S A;  1R7S A;  1TKG A;  1VDV A;  4OZA A;  1ENF A;  1L6U A;  3ZKJ C;  1WE7 A;  2R2Q A;  2MP2 A;  3FKY A;  2OJW A;  2M8S A;  2HD5 B;  1GOZ A;  1FXA A;  1QZE A;  2ICI A;  3GZN I;  1TZO A;  1E10 A;  1FPY A;  1VZ6 A;  2KN5 A;  5IN7 A;  2KDB A;  1XCQ L;  2WXL A;  3QK0 A;  4YSZ B;  4ZOH C;  4RNA A;  1HXY D;  1XF5 L;  2L05 A;  1FIQ A;  2J4X A;  2V1Y A;  2IGD A;  4XDD A;  2I38 A;  1D4B A;  2DAF A;  4HVB A;  1XD3 B;  3DVG X;  1TIF A;  3VTU A;  2VH1 A;  2SAK A;  4QAY A;  2W82 A;  3ONS A;  3QQ8 B;  5AEK B;  1NI3 A;  4XYC A;  3VVW B;  1GNU A;  3RPF C;  1YN3 A;  3A4S C;  3ML9 A;  2EEL A;  1D6E C;  3IAS 1;  1HA5 A;  1SE2 A;  1IP9 A;  2VRR B;  1JWS D;  2V4L A;  1CK1 A;  2RMM A;  3NG0 A;  4WUR A;  5DPW A;  4GDK A;  4I6N B;  2L7R A;  5AUI A;  3V62 A;  3TUO A;  3ZXV A;  2L52 A;  2L0F A;  3L0W B;  2ZCC A;  5TR5 A;  2JY6 A;  4IUM B;  2WS3 B;  3ZNI D;  1KFY B;  3AE3 B;  2BWF A;  2N9K A;  4ZHO A;  1MHH E;  2V3N A;  2LEK A;  2IBI B;  2KFK B;  1EWY C;  4MJS A;  3AE9 B;  2WHI A;  2KDI A;  1V81 A;  4M8N A;  3SFE B;  2MBO A;  4RMA A;  2LGI A;  1EU4 A;  2LVQ A;  4ZYS A;  2NTS A;  3SR6 A;  2BS3 B;  4IKG A;  3U4E G;  3X0W A;  1FD6 A;  1FNW A;  1F2R I;  4RGN A;  3M95 A;  4W9I A;  2BBC A;  3DBH I;  1XLN A;  2KWC A;  3VFK A;  4DK5 A;  4CO7 A;  3N20 C;  3ZJV A;  3ZRF A;  1NEN B;  1BUI C;  2PPH A;  4HXD A;  2Y5P A;  4EE2 A;  2JVC A;  4AJY B;  5HKH A;  1V5O A;  5HG2 A;  2ZPY A;  1T3Q A;  1B1Z A;  3D32 A;  1T5X D;  4BAX A;  4LDT B;  2LUM A;  2WYQ A;  1WX8 A;  3GE8 C;  3JYU A;  3DVG Y;  2WWZ A;  3W5U B;  4JWU C;  3ZTC A;  4II2 B;  3K9P B;  2AL6 A;  2MJD A;  1ZW7 A;  1LFD A;  2AEH A;  4LDT D;  3AE8 B;  4FN2 A;  2L76 A;  4GDL A;  4MT5 A;  3EHV A;  2PW9 A;  2PTL A;  2JYT A;  1P7F A;  3ZGZ A;  1RWS A;  4AOF A;  4HRO A;  3SEB A;  3AI5 A;  3L17 A;  2V0G A;  1UD7 A;  2JT4 B;  1QIL A;  3T9L A;  2C5L C;  1NBF C;  5D2M B;  3AEE B;  5LNK 1;  4JQW C;  3AEG B;  2INN E;  1JWB D;  1MJD A;  4XDC A;  1NDD A;  1XLP A;  1OQY A;  3TEW A;  3TEY A;  2K3U A;  3WIM A;  2RPV A;  1V6E A;  3BVZ A;  3VQI A;  2IJ0 A;  4LJO B;  2KOX A;  3Q3O C;  1JRP A;  4EEW A;  1VZ8 A;  3VR9 B;  3UGB B;  3AEA B;  2A4Z A;  4IOI E;  1JWU D;  2KWD A;  1E7V A;  2GBR A;  1RLF A;  5LXI B;  3BK2 A;  3PZ8 A;  4N9F 4;  1OEY A;  2N9E B;  3ZQ4 A;  2BS2 B;  4A8X C;  2MBB B;  1WJN A;  3VUY A;  4MGZ E;  5DCN A;  2ZW0 A;  2I1J A;  2KD0 A;  3RUI B;  1TS3 A;  2FCQ A;  3T3N A;  3Q3F A;  4CYE A;  1FNU A;  1WMH B;  3AU5 A;  1VRA B;  2CU3 A;  1IPG A;  3RCZ A;  2W55 A;  3MHS D;  4A3O A;  2J0M A;  2KLC A;  4P1C C;  2LXC A;  2BKF A;  2O6V A;  2C7M B;  1OEY J;  4HCN B;  3NOB A;  3AU4 A;  4B9K A;  1GB4 A;  3TMP B;  2OED A;  3Q8F A;  4RGT A;  2R61 A;  2K5P A;  3DBL I;  3W1S C;  3A9J A;  1JAL A;  1D5Z C;  3AB5 A;  4P16 A;  4WAF A;  1V2Y A;  2DX5 B;  2WX0 A;  2CHZ A;  3RNG C;  3SD5 A;  2KC1 A;  1VZ7 A;  3I9V 1;  2K8H A;  3ZJU A;  5FR6 A;  1E9M A;  1WR1 A;  1WXS A;  1XQQ A;  1X1M A;  2W3S A;  3I5J C;  3ZDM C;  1T0Q C;  5CTR C;  2WXJ A;  2X38 A;  3DBR I;  1ZKH A;  2K6D B;  3MJ5 A;  3B9J A;  4YSX B;  2J0J A;  2NVU I;  3U30 A;  2Z8L A;  1DGJ A;  2JRI B;  2KTR A;  1WSP A;  4KX6 B;  1UUP A;  1TJE A;  4PS8 A;  3NY5 A;  3CWI A;  3R66 C;  1RRB A;  4YWG G;  3AV8 A;  4F8C B;  2MH7 A;  4K7U A;  2MRP A;  2PIA A;  4F7Z A;  5CHV C;  5BMI A;  3EC8 A;  1C79 A;  4FLH A;  3OAW A;  1Q5W B;  2GBJ A;  4NNJ B;  1AN8 A;  3AEC B;  1SIF A;  3N1Y C;  3GB1 A;  2AQ2 B;  2OHF A;  1WX7 A;  3ZNH B;  2BT6 A;  1EF5 A;  1L0Y B;  3V05 A;  4FJZ A;  1KLU D;  2LHD A;  2LVP A;  1H8C A;  2V3P A;  1FFU A;  2KQ7 A;  3UF8 A;  4KZC A;  2GLS A;  3BK1 A;  1I4X A;  3TJP A;  3WAN A;  2K22 A;  2O2V B;  1WM2 A;  3EFU A;  3PRM B;  1I4R A;  3PZ7 A;  1I4Q A;  2IO0 B;  2QMT A;  4KZ0 A;  2GBN A;  3P4Q B;  3TL5 A;  2INP E;  2IZV B;  2YEP B;  3AE4 B;  1ZUD 2;  4LNO A;  4TQ0 A;  4CQN A;  1TTN A;  1GJZ A;  2RDB C;  5DPR A;  3HK0 A;  1JW9 D;  4HDO A;  2ZW1 A;  1LQB A;  2KXJ A;  5EDS A;  4KIK B;  2KAJ A;  4LK0 M;  4DDI D;  1EO6 A;  2L00 B;  1VLB A;  3WCQ A;  3U7Z A;  5J2R A;  3L08 A;  3PTF C;  1P1A A;  2KX0 A;  4RF0 A;  1BML C;  2B3A A;  3KUC B;  2AL3 A;  2WXR A;  1C4P A;  2HDE A;  2DZI A;  3I63 C;  1PGX A;  4DXF A;  2L1A A;  5G2N A;  3ZLZ A;  4OHJ A;  3N1X C;  1M4V A;  2EKI A;  2RDG A;  1V1P B;  3HM3 A;  3DHI C;  2REX A;  1N5W A;  2CJN A;  2K0P A;  3OWE B;  3Q8E A;  2MLB A;  2HJ8 A;  4WJQ A;  2BVC A;  1I4G A;  2KWV B;  3RZW C;  1V86 A;  2G4S A;  4MGK E;  2G4D B;  3GZN B;  4LNI A;  1MPE A;  2WDT B;  1I4H A;  2FCS A;  3Q3N C;  1FRR A;  1SXT A;  2MW5 A;  3ZNZ B;  3APC A;  1WGK A;  1WZ0 A;  4FHJ A;  1VD2 A;  3BY4 B;  2BYT A;  3MC0 B;  2WXQ A;  3W2D A;  2K8B A;  3DQV A;  3KW5 B;  1P7E A;  1L4D B;  1V9J A;  4WH4 A;  2DYM A;  2DYB A;  4BZA A;  3QWZ B;  3R8B A;  3HVZ A;  1ET9 A;  1P0R A;  1N63 A;  3ZO5 B;  1C1Y B;  3VH3 B;  4TQ1 A;  4KVG B;  3ZNG C;  1ET6 A;  4R3D A;  1Q1O A;  5D6J B;  1C78 A;  2FE8 A;  3JVZ X;  4KSL C;  3KLS X;  3A4R A;  5CX3 A;  1SEB D;  4EZJ A;  3GOE A;  3UIP B;  1V1O A;  1YJI A;  2LHE A;  3VRB B;  3UQB A;  1T0Y A;  2XNA C;  2RD0 A;  3RYT A;  3CMM B;  3QAQ A;  3R3M A;  4ZRQ A;  2FCN A;  3QAR A;  2JXT A;  4PYU A;  4L2Y A;  5J17 A;  1J0G A;  4NAM A;  3Q8C A;  1CZP A;  5J18 A;  4DQO C;  1JCK B;  2BGF A;  1V49 A;  3BII D;  3B2G A;  2EMT A;  2M56 B;  2RGF A;  2KAC A;  2LI5 A;  2W54 A;  3M62 B;  3AE5 B;  3O13 A;  4YTP B;  2QEJ C;  1I7H A;  4GLS C;  1WGY A;  4B0E A;  4HEA 1;  1E7P B;  2KWU B;  2VZK B;  1JQ4 A;  3NVW A;  1XCT L;  4ZRJ A;  3KYD D;  4ICV A;  3ZIM A;  3RNA C;  3PRE A;  3AEF B;  4L1B A;  2L8J A;  1Y56 A;  1VJK A;  4PYZ A;  3R2T A;  1M94 A;  2M1M A;  3TIX A;  2ZVN A;  1R4M I;  4AWJ A;  3AXC A;  3FC4 A;  2KDE B;  3Q8B A;  1YMH E;  4E74 A;  4O1N A;  1C4A A;  3PPA A;  5FR3 A;  4JL9 A;  4BBN F;  3VHT C;  3VAW A;  4P6V F;  3UQA A;  2PE6 B;  1CJE A;  1J7C A;  2Y3A A;  2E6X A;  1FXI A;  1FRD A;  3ABV B;  4S17 A;  2GBM A;  4JX1 C;  2GRI A;  1HZ6 A;  2KVR A;  2JU6 X;  2KAN A;  1WZ3 A;  2K8C A;  4FAD A;  2L83 A;  5G5H A;  1XLQ A;  2MEK A;  2ZCB A;  1J19 A;  2GB1 A;  4LNF A;  4EZL A;  3A9K B;  2LGX A;  2PJH A;  1T0R C;  1MVK A;  3KH0 A;  2IO2 B;  2KX3 A;  4FJY A;  3MHZ A;  4XWT A;  5IA7 A;  1E90 A;  1I4P A;  1I42 A;  4OW0 A;  3O65 B;  3TEZ A;  3I57 A;  4ACF A;  2J42 A;  2HTH A;  4W9K A;  2M0A A;  2KJH B;  1C76 A;  2ZZP B;  3NVV A;  1HZ5 A;  4H2A A;  2KJ6 A;  1GC6 A;  3DBH B;  4WWN A;  5T8I A;  2UYZ B;  3Q2A C;  2O6V B;  1YX5 B;  3GS2 A;  2MSE D;  1MI0 A;  4AQ7 A;  1Y8R C;  2D3C A;  3AH7 A;  2D5G A;  5E6J A;  2FUG 1;  1PGB A;  2DNF A;  3RNB C;  4GN1 A;  4USA A;  2DLB A;  3EA6 A;  2V4I B;  3IT6 B;  1KF6 B;  5IP4 D;  3V61 A;  3CF6 E;  2OOB B;  2IYD B;  4NY0 A;  4ZRK A;  3EGR A;  3BVG A;  4KKI A;  5EE1 A;  1IUE A;  3H7P B;  2BYE A;  1F0Z A;  1GB1 A;  2N4F A;  2LGS A;  2JZZ A;  1ESF A;  2C9W B;  4YXD B;  1WY8 A;  2LFI A;  1UZX B;  3HUI A;  4C56 C;  2QIL A;  2G3Q B;  4ZYN A;  3CIR B;  2DEN B;  2LRW A;  1D5M C;  4M01 A;  1KH0 A;  3QC8 B;  4C4V B;  1RAX A;  1UF0 A;  2N9P C;  4NAW A;  4M0W B;  4W9L A;  3A33 B;  3AE1 B;  4KIK A;  3ZJT A;  1WMH A;  4DHJ D;  4IG7 B;  2OJR A;  5BYR A;  1R4M B;  1TYG B;  4DWF A;  1KLG D;  3ZXR A;  4PT5 A;  4RM9 A;  3MC9 A;  5C23 A;  3UIO B;  4BKG A;  4KGT A;  3RI7 C;  1XLO A;  2K9X A;  1WYW B;  1F2R C;  3H6N A;  2EMS A;  1WJ6 A;  1UBQ A;  2KVZ A;  1V1P A;  3ZVV A;  2WXN A;  4W9F A;  2QJL A;  5JXV A;  1L2N A;  1TBE A;  3UI3 A;  3WAP A;  2WXH A;  4DHJ B;  1C9F A;  3LB8 C;  1TY0 A;  1E8W A;  1WJ4 A;  1YN5 A;  4NQL B;  2K1F A;  1GUA B;  2BTE A;  1L0X B;  2O2V A;  2Z59 B;  5CHW A;  3CSF A;  4M00 A;  2WXO A;  3ZTD A;  2WXI A;  3MFG A;  3RNE C;  2V9H A;  2YVC A;  2ZVO A;  2CHW A;  4IM3 A;  3CST A;  3U2S C;  4BOS C;  5BYS A;  4JPS A;  1HTQ A;  1T0S C;  2LAS A;  3DHG C;  1P98 A;  3SU8 X;  1N60 A;  3PZD A;  4XX5 A;  3H7S A;  4AP4 C;  1ZE3 D;  4ZRP A;  4HPL B;  5BMH A;  1ISN A;  1EM7 A;  4HLE A;  3PSE B;  1SE3 A;  1ACC A;  4IM2 A;  2BQQ A;  1C3T A;  3DVN U;  1QKZ A;  2LRU A;  4WQO B;  2LJI A;  5H92 C;  2FID A;  2KLG A;  4EFO A;  2MJE A;  2M17 A;  4IWP A;  2IGG A;  3KQ4 A;  4M8M A;  1UEL A;  1A5R A;  4EZK A;  3QA8 A;  2WXF A;  1ZDX A;  3PHX B;  1E8Y A;  2N0S B;  3FIL A;  3OG5 A;  2JXX A;  1MG8 A;  1ZDV A;  1YQB A;  5IKC M;  2G45 B;  5C2T B;  4TSS A;  4KV2 A;  1JWM D;  4RFB A;  2A5U A;  4W9G A;  4MH8 A;  1KRH A;  4CHK A;  1JWA D;  1J7A A;  4FXC A;  1V97 A;  4FBJ B;  2INC C;  1NVI D;  2Z0D B;  1V5T A;  2K6Q A;  4DXA B;  4BVU C;  2RSU A;  4GXB A;  3W1S A;  1IGC A;  4W9J A;  4MSM B;  1K8R B;  3L10 B;  3KVF B;  1HE8 A;  4GU2 A;  2WXP A;  4YTN B;  1E8X A;  1GAQ B;  2WP9 B;  3NUH B;  2JUO A;  3RN9 C;  2KO3 A;  2DWQ A;  3WA0 A;  3WAL A;  2DBY A;  5G5G A;  3Q3M C;  2M19 A;  4A55 A;  3S2A A;  3IG3 A;  3OJ3 A;  1K53 A;  1HQR D;  2KDM A;  4KKJ A;  4TMA B;  1PDX A;  4JGH B;  1SIJ A;  4MSQ B;  5I4D A;  2FNJ B;  3NZ3 A;  4LTU A;  4E3C A;  3FAH A;  4G11 A;  1WGG A;  1FEH A;  3AE7 B;  2DAJ A;  3ETR A;  3E56 A;  2BS4 B;  2J53 A;  3RZF A;  3TSS A;  2BYV E;  4YSY B;  3DWG C;  3KYC D;  5C1Z A;  1WX9 A;  4BFR A;  1WXA A;  2ON8 A;  3EFC A;  1SBB B;  1JML A;  1DOX A;  4LLG M;  5MPO A;  1SJH D;  5G55 A;  1AW7 A;  4DHZ B;  2KJR A;  2BKR B;  1RFA A;  2N7E A;  2YEP F;  4ZRI A;  3A9K A;  3EUB 2;  1FXT B;  1KLV A;  2KQS A;  1GG3 A;  3Q8A A;  4I6P A;  2L32 A;  2KT7 A;  4C00 A;  2L3Z A;  1G6J A;  4ZDV A;  3A9J B;  4MM3 A;  4NJ6 A;  1EU3 A;  3ENE A;  2L0T A;  3RNC C;  4W9H A;  2WU5 B;  4IW0 A;  2WLB A;  4XGA B;  3PT2 B;  1QT9 A;  4XZ4 A;  2KHW B;  4OVU A;  3APD A;  2LWP A;  4GSW A;  4NJC A;  3P4P B;  3DBS A;  2CS4 A;  3DVN V;  3C0R B;  5C3J B;  5AZH A;  4AUQ C;  1TZ1 A;  5JZE B;  3MP9 A;  2AX5 A;  2YLM A;  2QHO A;  3BYY B;  4BBN C;  1WGD A;  3H1U A;  3QJZ A;  4I6L B;  2GMI C;  3M3J A;  3N30 A;  4N58 A;  4DBG A;  2AYO B;  1IYF A;  2ONQ A;  2AWT A;  2JQR B;  5LLI A;  4GB9 A;  3JSV A;  5E6N A;  4DDG D;  1YQ3 B;  2BB5 A;  1UNS A;  3T8M A;  5LXH A;  1SGH A;  1HTO A;  5HFY A;  2BB6 A;  2TSS A;  4G3X B;  4ANV A;  1FO4 A;  3DPD A;  4XWW A;  3QHT A;  1E0Z A;  2X8X X;  4M02 A;  4RGO S;  2JZ3 B;  1WRD B;  4C4V A;  1UWX A;  2MBE A;  4ARC A;  4URK A;  1N5X A;  2PE9 A;  3W9C B;  3MC8 A;  1R4N B;  1P9D U;  1L4Z B;  2D11 A;  4GIV A;  2LXA A;  2BF8 B;  5JH5 C;  1WXM A;  2CJO A;  2QC8 A;  3ML8 A;  1ZP0 B;  2PVO D;  1UWM A;  4BKS D;  3APF A;  3VR8 B;  2FCM A;  2JZP A;  1F9J A;  1YD8 U;  2CR5 A;  2N9X A;  3HVD A;  1L7Y A;  3DWM A;  4OZB A;  4BKS A;  1LM8 B;  5KHQ A;  2J7Q B;  2DZJ A;  2N7J A;  5L83 A;  4RF1 A;  2C60 A;  2PKO A;  4P1B C;  3VDZ A;  1T6B X;  2NBV B;  1KJT A;  2UWQ A;  1WFY A;  1FMA D;  3IFW B;  3VH4 B;  3AE2 B;  4NAW B;  2WGS A;  1YOV B;  4EUT A;  2N1W A;  4EKU A;  4HKZ E;  2O6V D;  1YJ1 A;  3NRZ A;  4YL8 A;  5BO4 B;  1ZGU B;  2J0K A;  2KQ4 X;  1ZXH A;  1TS4 A;  2MBQ A;  2NTT A;  3DHH C;  3PGE A;  1IBX B;  2QCZ A;  2HE7 A;  1WR6 E;  1DOI A;  4MDK E;  1DOY A;  3LJ3 A;  1SE9 A;  3B2F A;  2M0X A;  4JIO U;  2W9N A;  1JRU A;  4AJW A;  1GC7 A;  1TY2 A;  3LYY A;  2WDR B;  1WGR A;  4J6I A;  4PS7 A;  4IM0 A;  2KMM A;  3B1L X;  1K52 A;  4MGI E;  4US9 A;  3RMK C;  4A3P A;  5CHF A;  4LNK A;  3RFZ B;  1K50 A;  4JWS C;  1QF6 A;  2D3B A;  3N1Z C;  4HWI B;  5DPT A;  4WJN A;  2LD9 A;  2SEB D;  4KDI C;  3PRP B;  1V8C A;  2MQJ A;  4HKQ A;  3V3X A;  2WDQ B;  4LJP B;  5HI1 A;  3BZD B;  2IO1 B;  3AMZ A;  2QDF A;  4UDU C;  4EOY A;  3OJ4 B;  4BOZ B;  2DZK A;  3C19 A;  3HIZ A;  3OLM D;  5GMV A;  2B76 B;  3PV1 A;  5H8Y E;  3T3O A;  1R4N I;  2D3G A;  2WNM A;  4NQK E;  1NYQ A;  4HCP B;  2H88 B;  2LVO A;  3TBL D;  1KTK A;  2H89 B;  1C77 A;  1UGM A;  5EE3 A;  3QIJ A;  1RYJ A;  1CQV A;  1QOG A;  3H7P A;  3HM6 X;  4Q2J A;  2LJ5 A;  5BYQ A;  3DDC B;  3NVY A;  1HEZ E;  1LO5 D;  1F52 A;  4ANW A;  2BPS A;  1U4A A;  2N9L A;  1PGA A;  1H4R A;  2HJ1 A;  2KN4 A;  2R2O A;  1WYG A;  3Q14 C;  2JF5 A;  4NPN A;  2XN9 C;  1SJE D;  2EKE C;  4HRS A;  2UU7 A;  4K3B A;  1OFF A;  2FIF A;  1PFD A;  1WGH A;  1WIA A;  5E6P A;  3U7D A;  2WX1 A;  4C7Y A;  3PS6 A;  1OGW A;  2RDH A;  3N3K B;  2NBW B;  2JWU A;  4W9C A;  4WWO A;  2QSD A;  4LNN A;  4M0W A;  2K25 A;  4C7Z A;  3VTW A;  1SB3 C;  2IO3 B;  3DBR B;  5FKA C;  1QOB A;  5E6O A;  3P2B A;  4PK1 A;  5AZG A;  4K7W A;  2RR9 A;  4ASW C;  2JX5 A;  1D3Z A;  5KHO A;  4L23 A;  1XXG A;  2BWE S;  3R7Q A;  2I2Y A;  4P7I A;  3V6C B;  4FJV B;  1FFV A;  2KNB A;  2IY1 B;  2CU1 A;  3MTN B;  3A1Q B;  3IT4 B;  4ZHP A;  1NI2 A;  2KC2 A;  3ZRC A;  4KDL B;  4IWO A;  3TEX A;  3H8H A;  2WXK A;  3U8Z A;  4MM3 B;  2BYF A;  1FCL A;  3GP7 A;  1ZXI A;  1AAR A;  2IDY A;  1YJJ A;  3P1M A;  1PUT A;  3Q69 A;  1QOF A;  2WQY B;  3N32 A;  4ARI A;  3P42 A;  4JE3 B;  1LXD A;  1MHX A;  4WWM A;  3TCA A;  1BXT A;  1QQR A;  1Z2M A;  1Q0W B;  2ACZ B;  4II3 B;  2NPT A;  4MEM A;  5D3D A;  3P4S B;  2Y5B B;  3JSV B;  2D2Q A;  2MBH A;  2LGY A;  3V60 A;  1BT0 A;  3IXS A;  5EE9 A;  3NVZ A;  1AWD A;  1N62 A;  4BKT A;  2MP2 B;  4K81 A;  1F77 A;  1WF9 A;  2PMV A;  4B0M A;  2ZNV B;  4RGM A;  1GPX A;  2D3A A;  1MFW A;  1WXQ A;  2BW2 A;  3K9O B;  3QCA A;  3RNF C;  1WRI A;  2FUH B;  1WM3 A;  4A90 A;  3RT3 B;  2MX2 A;  2MWS B;  3FIL B;  1N6Z A;  1NEK B;  1E7U A;  3SDL C;  2KK8 A;  3AED B;  1AYF A;  3ZDT A;  1SSN A;  1D5X C;  1WE6 A;  2XK5 B;  3L16 A;  1PQS A;  2IND C;  4LCD E;  4XC2 A;  2LUE A;  4B6W A;  3SFD B;  4KSK C;  5JHA A;  1ROE A;  2MHJ A;  1XO3 A;  1LGR A;  3ZW3 A;  4A9A A;  2IPK D;  3UIN B;  2ZPN A;  1WJU A;  4IC7 B;  2QIE B;  2N7D A;  1Q10 A;  3NS1 A;  4FUL A;  3VRA B;  2M4N A;  4GDK B;  5HHD G;  1L6V A;  1KM7 A;  3BWU D;  2KMA A;  1SE4 A;  4RH6 A;  3VUX A;  2WDV B;  2KZR A;  1FCC C;  3QX1 A;  1E5W A;  2WXM A;  2NMQ A;  4OVZ A;  3ZYY X;  1NYR A;  4WJO A;  3NJT A;  3AEB B;  1QOA A;  2KFK A;  4K7S A;  2JWZ A;  4D2K A;  3DCG A;  1YQ4 B;  1L0V B;  2FBW B;  4GGQ A;  3URY A;  1OQR A;  2G9H D;  4E71 A;  3P4R B;  1N61 A;  3VXW A;  4GMV A;  4US8 A;  3IHP C;  3AN1 A;  4ANU A;  4RM8 A;  3RD2 A;  1UBI A;  2CKH B;  3IAM 1;  4PS3 A;  1RFK A;  2MJ3 A;  2CHX A;  3Q3J A;  2GOW A;  1ZOY B;  3PO0 A;  5BMG A;  3L54 A;  4HPP A;  2ASQ A;  4A6Q A;  3RUL A;  2JSV X;  2W3R A;  4W9E A;  3IBE A;  4OZC A;  2NBU A;  3LXF A;  1TS2 A;  1XT9 B;  3AUL A;  5JHB A;  1F1H A;  4JLC A;  2JPH A;  4HPM B;  4MJS B;  4GDL B;  2RPQ A;  3B0A A;  4NZL B;  3ZUN A;  4DXG A;  1TKY A;  4G0N B;  1E8Z A;  4MGY E;  4G50 A;  2PVG C;  3P63 A;  1TT5 B;  2NPT B;  5IOI A;  1S1Q B;  4IDI A;  4HJG E;  5AZF A;  1TS5 A;  3J9C A;  2KYW A;  1P3Q U;  1YNT E;  1YIW A;  5IO9 A;  4IWQ A;  3PHW B;  1QLB B;  1UGJ A;  2LMC A;  2GI9 A;  1FM0 D;  4J3O D;  3L4P A;  4MEL A;  4NJ7 A;  4B95 A;  1E6E B;  1PYW D;  3GE3 C;  2KDF B;  4ANX A;  1FNV A;  3V6E B;  1VCB A;  2HTM E;  1S3S G;  4FA6 A;  1J8C A;  1EUV B;  4OVV A;  3U52 E;  3WAM A;  1V80 A;  3E9S A;  2LZ6 A;  2V3S A;  4ITK A;  4WJP A;  3KWL A;  3ALB A;  2DHZ A;  3N9Y C;  4MAC A;  3MJW A;  2AQ3 B;  4HDQ A;  2PEA A;  2N1V A;  1XEE A;  3H9D A;  1DYQ A;  3VUW A;  1STE A;  2C7H A;  2KTR B;  2IGH A;  3DBL B;  4WQM A;  2Z0E B;  2VZK D;  1B9R A;  2J52 A;  3NHE B;  1K51 A;  2AQ1 B;  2KKC A;  4KGR A;  1WWT A;  1A70 A;  3KWV A;  5AUK A;  1MG4 A;  3PVL A;  5D3I B;  2JYE A;  4DHZ E;  4GOC A;  4W9D A;  4MH0 E;  1IGD A;  3NZU A;  1I35 A;  3PLV A;  3L13 A;  3BVM A;  4REZ A;  2Y5C A;  1YX6 B;  3AM9 A;  4K1R B;  2MCN B;  2K39 A;  1TKE A;  4XE0 A;  4N6E B;  3R7R A;  2G1E A;  1L5P A;  4N59 A;  2LGD A;  1UH6 A;  1RM6 C;  2D10 A;  5FK9 C;  1TGZ B;  4FHK A;  2ZJD A;  1ZPS A;  1JRO A;  4TUU A;  1WXV A;  1WI0 A;  3A1Q A;  3Q6B A;  3C8Y A;  3HRD D;  3SHQ A;  3KUZ A;  2KFJ A;  2KTF A;  2FAZ A;  3M63 B;  4A20 A;  1WH3 A;  2ZEQ A;  3DOW A;  2NCN A;  4WIP A;  4HJK A;  1VR9 A;  2MA9 B;  2VH2 A;  2I1K A;  2DZM A;  5TSS A;  3VTV A;  3X23 A;  4C80 A;  2DYO A;  3B08 A;  3I3T B;  4YTM B;  4AS1 A;  2IY0 B;  1SF0 A;  3HHM A;  1YN4 A;  4HK2 A;  2XEW A;  3EEC A;  5D94 A;  5L95 C;  1IBX A;  2ZNV C;  2NR2 A;  3LDZ E;  3NS8 A;  2E3T A;  3W1Y A;  2C7N B;  2D07 B;  4RCO A;  4KGS A;  4X57 B;  2WXG A;  5D7G A;  3WAO A;  2XK5 A;  4WWP A;  2WU2 B;  2PLP A;  5GXG B;  1OQQ A;  1EWC A;  1OTR B;  2GBK A;  3NZS A;  1C4C A;  1CMX B;  1J7B A;  4YT0 B;  4S0R A; 
#chains in the Genus database with same CATH homology
 2N0S B;  3W5V B;  3FIL A;  4RF0 A;  1BML C;  1ZDV A;  2WXR A;  5C2T B;  2JX5 A;  1C4P A;  2HDE A;  4L23 A;  4TSS A;  1PGX A;  4DXF A;  1JWM D;  2L1A A;  1XXG A;  4RFB A;  3AE6 B;  4MH8 A;  2Q5W D;  1KRH A;  4OHJ A;  1JWA D;  2I2Y A;  1J7A A;  4FXC A;  1V97 A;  1M4V A;  2EKI A;  2RDG A;  1FFV A;  1V1P B;  5EE0 A;  1NVI D;  3IT4 B;  4ZHP A;  3R2I A;  1N5W A;  2CJN A;  3BYT B;  2K0P A;  3OWE B;  3W1S A;  3Q8E A;  1IGC A;  3TEX A;  3H8H A;  1R7S A;  1TKG A;  1VDV A;  2WXK A;  1ENF A;  4MM3 B;  1I4G A;  1L6U A;  4OZA A;  1FCL A;  2WXP A;  4YTN B;  3GP7 A;  1GAQ B;  2WP9 B;  3NUH B;  1ZXI A;  2IDY A;  1YJJ A;  2DWQ A;  1MPE A;  1GOZ A;  1FXA A;  2DBY A;  1PUT A;  3P1M A;  5G5G A;  3Q69 A;  1QOF A;  2ICI A;  2WQY B;  2M19 A;  1I4H A;  4A55 A;  1TZO A;  4ARI A;  1E10 A;  3P42 A;  4JE3 B;  1VZ6 A;  1FRR A;  1K53 A;  1SXT A;  1MHX A;  4WWM A;  1BXT A;  1HQR D;  2KDM A;  4KKJ A;  4TMA B;  1XCQ L;  1PDX A;  1QQR A;  2WXL A;  2ACZ B;  4YSZ B;  4ZOH C;  4RNA A;  1HXY D;  5D3D A;  1WGK A;  3P4S B;  1XF5 L;  2BYT A;  3MC0 B;  2WXQ A;  1SIJ A;  3W2D A;  5I4D A;  3NZ3 A;  1FIQ A;  2J4X A;  2IGD A;  4LTU A;  1P7E A;  1L4D B;  3FAH A;  4WH4 A;  4XDD A;  2I38 A;  1D4B A;  2DYM A;  3IXS A;  5EE9 A;  1FEH A;  3NVZ A;  1AWD A;  3AE7 B;  3HVZ A;  1ET9 A;  3R8B A;  3ETR A;  1N62 A;  3E56 A;  2BS4 B;  2J53 A;  1N63 A;  2SAK A;  3TSS A;  2W82 A;  4YSY B;  3DWG C;  4TQ1 A;  1F77 A;  1NI3 A;  1ET6 A;  4R3D A;  2PMV A;  3RPF C;  1C78 A;  4RGM A;  1YN3 A;  2FE8 A;  4B0M A;  1GPX A;  2EEL A;  1WXQ A;  2BW2 A;  1D6E C;  1WRI A;  3KLS X;  4A90 A;  3IAS 1;  1HA5 A;  1SE2 A;  2ON8 A;  1NEK B;  1SEB D;  1SBB B;  3FIL B;  1JWS D;  1JML A;  1CK1 A;  2RMM A;  1DOX A;  1V1O A;  1YJI A;  2LHE A;  4WUR A;  3AED B;  4LLG M;  3VRB B;  1AYF A;  5AUI A;  5MPO A;  3TUO A;  1SSN A;  1D5X C;  2XNA C;  1SJH D;  2L52 A;  1AW7 A;  4ZRQ A;  2YEP F;  2JXT A;  3SFD B;  4L2Y A;  2WS3 B;  3EUB 2;  1ROE A;  4NAM A;  3Q8C A;  1XO3 A;  1KFY B;  1CZP A;  3AE3 B;  2N9K A;  1JCK B;  4DQO C;  4ZHO A;  3BII D;  3Q8A A;  1MHH E;  2L32 A;  2LEK A;  2V3N A;  2M56 B;  3B2G A;  4A9A A;  2IPK D;  2KAC A;  2W54 A;  3AE5 B;  1EWY C;  3AE9 B;  3O13 A;  2QIE B;  1EU3 A;  4YTP B;  2QEJ C;  3SFE B;  1I7H A;  4GLS C;  4B0E A;  1Q10 A;  2LGI A;  1EU4 A;  4ZYS A;  2WU5 B;  2NTS A;  3NS1 A;  3SR6 A;  2WLB A;  4HEA 1;  1E7P B;  2BS3 B;  4IKG A;  3U4E G;  1FD6 A;  3VRA B;  2VZK B;  1FNW A;  1JQ4 A;  1F2R I;  1QT9 A;  3NVW A;  4GDK B;  4RGN A;  5HHD G;  1L6V A;  3BWU D;  2BBC A;  1XCT L;  1XLN A;  1SE4 A;  4NJC A;  3P4P B;  4RH6 A;  3ZJV A;  2WDV B;  1NEN B;  5C3J B;  3AEF B;  4L1B A;  1FCC C;  1BUI C;  2WXM A;  2Y5P A;  4EE2 A;  2NMQ A;  4OVZ A;  3ZYY X;  1NYR A;  3MP9 A;  1Y56 A;  1VJK A;  2AX5 A;  5HG2 A;  1T3Q A;  3AEB B;  1B1Z A;  3R2T A;  1T5X D;  3BYY B;  2LUM A;  1QOA A;  4D2K A;  3FC4 A;  1YQ4 B;  3W5U B;  1L0V B;  4JWU C;  2FBW B;  3Q8B A;  3URY A;  4N58 A;  1OQR A;  1YMH E;  2G9H D;  4O1N A;  1C4A A;  3P4R B;  1N61 A;  5FR3 A;  4US8 A;  2MJD A;  3AN1 A;  3AE8 B;  2ONQ A;  4MT5 A;  2JQR B;  4P6V F;  1CJE A;  2PW9 A;  1J7C A;  2Y3A A;  2PTL A;  2JYT A;  3IAM 1;  2MJ3 A;  1P7F A;  1FXI A;  1RFK A;  2E6X A;  3ZGZ A;  1RWS A;  1FRD A;  4HRO A;  1YQ3 B;  3ABV B;  2BB5 A;  1UNS A;  5BMG A;  1ZOY B;  3PO0 A;  4JX1 C;  2GRI A;  3SEB A;  1HZ6 A;  4A6Q A;  5HFY A;  2BB6 A;  2JU6 X;  2TSS A;  1FO4 A;  2V0G A;  2JSV X;  4XWW A;  2W3R A;  1E0Z A;  4RGO S;  1QIL A;  1UWX A;  2L83 A;  3AEE B;  5G5H A;  5LNK 1;  4ARC A;  1XLQ A;  2MEK A;  2GB1 A;  1N5X A;  3AEG B;  2INN E;  4OZC A;  1JWB D;  3W9C B;  4XDC A;  3LXF A;  1MVK A;  1XLP A;  1TS2 A;  3TEW A;  3MHZ A;  1L4Z B;  4XWT A;  3TEY A;  2K3U A;  1I4P A;  2RPV A;  3BVZ A;  3VQI A;  4OW0 A;  2CJO A;  3TEZ A;  4GDL B;  3I57 A;  2J42 A;  4NZL B;  2IJ0 A;  2M0A A;  1ZP0 B;  4DXG A;  1JRP A;  1C76 A;  1TKY A;  3NVV A;  1HZ5 A;  2PVO D;  1VZ8 A;  3VR9 B;  1UWM A;  4H2A A;  3VR8 B;  2PVG C;  3AEA B;  3P63 A;  2JZP A;  3HVD A;  4IOI E;  4IDI A;  1JWU D;  2KWD A;  4HJG E;  1TS5 A;  3DWM A;  3J9C A;  4OZB A;  5T8I A;  3BK2 A;  3PZ8 A;  2N7J A;  1YNT E;  3ZQ4 A;  4RF1 A;  1QLB B;  1UGJ A;  2BS2 B;  1MI0 A;  2PKO A;  3GS2 A;  4A8X C;  4AQ7 A;  2LMC A;  3AH7 A;  2GI9 A;  1FM0 D;  1T6B X;  2D5G A;  4J3O D;  5E6J A;  2ZW0 A;  2FUG 1;  1PGB A;  3L4P A;  1FMA D;  1E6E B;  1PYW D;  1TS3 A;  3AE2 B;  3T3N A;  4NAW B;  1FNV A;  2DLB A;  4USA A;  2HTM E;  1FNU A;  3EA6 A;  2V4I B;  3U52 E;  4HKZ E;  3IT6 B;  1KF6 B;  3E9S A;  4ITK A;  1VRA B;  2CU3 A;  3KWL A;  3NRZ A;  3EGR A;  2W55 A;  2KQ4 X;  3N9Y C;  1ZXH A;  3BVG A;  4KKI A;  1TS4 A;  5EE1 A;  1IUE A;  2NTT A;  1F0Z A;  1GB1 A;  4MAC A;  1IBX B;  2AQ3 B;  1ESF A;  4YXD B;  2LFI A;  1XEE A;  3HUI A;  1DOI A;  1DOY A;  3B2F A;  4C56 C;  2QIL A;  1DYQ A;  3CIR B;  1STE A;  1GB4 A;  1D5M C;  2OED A;  1TY2 A;  3LYY A;  1KH0 A;  2WDR B;  2IGH A;  3Q8F A;  4RGT A;  2R61 A;  2K5P A;  3AE1 B;  4WQM A;  3ZJT A;  2KMM A;  2VZK D;  1JAL A;  1D5Z C;  3AB5 A;  1B9R A;  5BYR A;  1K52 A;  1TYG B;  2J52 A;  4P16 A;  4US9 A;  4WAF A;  1KLG D;  1K51 A;  2AQ1 B;  3RFZ B;  4PT5 A;  1K50 A;  4KGR A;  4JWS C;  1QF6 A;  1VZ7 A;  1WWT A;  3I9V 1;  1A70 A;  3ZJU A;  1E9M A;  4KGT A;  3KWV A;  2W3S A;  5AUK A;  5D3I B;  2JYE A;  1XLO A;  2SEB D;  2X38 A;  2K9X A;  3MJ5 A;  3B9J A;  1V8C A;  1F2R C;  4YSX B;  2Z8L A;  1IGD A;  4HKQ A;  3V3X A;  2WDQ B;  1V1P A;  1DGJ A;  2WXN A;  1WSP A;  5HI1 A;  4KX6 B;  3BVM A;  4REZ A;  3BZD B;  3AMZ A;  2Y5C A;  3AM9 A;  1UUP A;  1TJE A;  2QJL A;  5JXV A;  4UDU C;  3CWI A;  3UI3 A;  2WXH A;  1TKE A;  4YWG G;  4XE0 A;  4N6E B;  2B76 B;  5H8Y E;  3AV8 A;  1C9F A;  3LB8 C;  3T3O A;  2MH7 A;  2WNM A;  2G1E A;  1TY0 A;  2PIA A;  1NYQ A;  1L5P A;  5BMI A;  4N59 A;  1C79 A;  1YN5 A;  1RM6 C;  2H88 B;  5FK9 C;  2BTE A;  1L0X B;  1ZPS A;  1KTK A;  2H89 B;  1AN8 A;  1JRO A;  1C77 A;  3AEC B;  2WXO A;  2WXI A;  3MFG A;  3C8Y A;  3HRD D;  5EE3 A;  1RYJ A;  1CQV A;  1QOG A;  3GB1 A;  2AQ2 B;  4Q2J A;  2OHF A;  3U2S C;  5BYQ A;  5BYS A;  2BT6 A;  4JPS A;  3NVY A;  4WIP A;  1HEZ E;  1LO5 D;  1VR9 A;  1L0Y B;  3V05 A;  1KLU D;  2LHD A;  1N60 A;  2N9L A;  1PGA A;  2KN4 A;  2V3P A;  5TSS A;  1FFU A;  4C80 A;  2DYO A;  1WYG A;  4YTM B;  4AS1 A;  1ZE3 D;  4ZRP A;  3BK1 A;  5BMH A;  1I4X A;  1EM7 A;  1SF0 A;  2XN9 C;  1SJE D;  1YN4 A;  4HRS A;  1SE3 A;  2K22 A;  1ACC A;  1OFF A;  1I4R A;  3PZ7 A;  1QKZ A;  1PFD A;  1IBX A;  1I4Q A;  2LJI A;  2QMT A;  5H92 C;  3P4Q B;  4C7Y A;  2MJE A;  2E3T A;  2INP E;  2YEP B;  4KGS A;  2IGG A;  4RCO A;  2RDH A;  2WXG A;  3AE4 B;  3KQ4 A;  1ZUD 2;  5D7G A;  4TQ0 A;  4CQN A;  2JWU A;  2QSD A;  2WU2 B;  2PLP A;  5GXG B;  1JW9 D;  1OQQ A;  2ZW1 A;  1EWC A;  4M0W A;  1C4C A;  2KAJ A;  4LK0 M;  4C7Z A;  2WXF A;  1SB3 C;  1VLB A;  1ZDX A;  3WCQ A;  1J7B A;  4YT0 B;  3U7Z A;  5FKA C;  1QOB A;  2WXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...