2IO2B

Crystal structure of human senp2 in complex with rangap1-sumo-1
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
75
structure length
75
Chain Sequence
KLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sentrin-specific protease 2
publication title Structural basis for SENP2 protease interactions with SUMO precursors and conjugated substrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, hydrolase
total genus 9
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2006-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2io2B00
3QQ8B 3ZO5B 3PRPB 2ZNVC 3QK0A 2FCMA 2FCQA 2JZ3B 1WM3A 4ZYNA 1WE7A 4FJZA 3VTVA 4FJYA 3NHEB 4OVUA 5BO4B 3DOWA 2MA9B 1V80A 3UF8A 4HVBA 2GBJA 4W9DA 2O2VA 5D7GA 2V3SA 2MW5A 3APFA 2MSED 2ZEQA 3VUWA 3JYUA 3KVFB 3PHWB 2MP2A 2NCNA 2IO3B 3NZUA 5D2MB 2UYZB 3ZNHB 3H7PA 5LXIB 1UBIA 2G45B 4RM8A 4FHKA 2UWQA 4GOCA 2KFKA 2C9WB 2PE9A 4TUUA 3HIZA 3L17A 4PYZA 4DBGA 5HKHA 1RAXA 2N1WA 4IM2A 2G3QB 3TL5A 3VAWA 2MX2A 4AWJA 4DHZE 4DWFA 2MP2B 2IBIB 2PPHA 4IW0A 2CU1A 3KH0A 1KOTA 1GJZA 2N9PC 3VXWA 3DCGA 4GMVA 2JZZA 2D10A 4TV3A 3PV1A 5C1ZA 4BBNC 1L7YA 1GUAB 2FIFA 3A9JB 3L54A 4KDLB 2KX0A 1YQBA 2L3ZA 3KUCB 4HCPB 2NS5A 4ICVA 3ALBA 4HDOA 4IM3A 4W9CA 4B9KA 3DVGY 4II2B 2ASQA 5TR5A 1J19A 2DYOA 1WMHB 2WDTB 3EHVA 4GGQA 1E8WA 3CMMB 3GZNI 5JHBA 2LRWA 1WXSA 2L0TA 3ECIA 1P0RA 2XK5A 4JL9A 4KZCA 2IO0B 1T0YA 4K7SA 1NI2A 4IG7B 1WX7A 4JGHB 3R66C 2LWPA 2DZJA 4MH0E 2KLGA 3VVWB 2DAFA 1KJTA 2D3GA 1E7VA 2FCNA 2N9XA 3DVNU 3DVGX 4PS7A 3VQIA 3APCA 2CHWA 3PT2B 1EF5A 2KQ7A 1P98A 4GDLB 4M0WB 2DZKA 2JY6A 1WGGA 1E8YA 1V6EA 4ASWC 2DHZA 4G3XB 4YL8A 3RCZA 4HLEA 3DBRI 3VUYA 2KMCA 2AL3A 1TGZB 3WAPA 1J8CA 2C5LC 3QHTA 2LJ5A 4MSMB 3ML8A 3PZDA 1WGDA 3T9LA 4BOZB 2RSUA 3W1SA 1D3ZA 1SE9A 2PE6B 4ZRJA 1Q5WB 2BGFA 2KTRA 2L05A 3NZSA 1HE8A 2ZCCA 5JHAA 2FUHB 4HPMB 3QX1A 2EMTA 3PS6A 2KHWB 2N4FA 3ZKJC 1XT9B 2M4NA 2NPTB 4DXAB 2R2QA 3PRMB 2IZVB 2MCNB 3ZNZB 1WX8A 4IC7B 3UQBA 5CX3A 1C3TA 1UD7A 5J18A 3B1LX 4K7UA 5DPRA 3SHQA 4RMAA 3A4RA 2BF8B 3BY4B 4KIKB 2G4SA 4F7ZA 3Q3FA 3JSVA 4EUTA 3X23A 1WZ0A 2M8SA 2V4LA 4MJSB 2FCSA 2A5UA 2KDFB 2FAZA 4EOYA 2C7HA 2MLBA 1ZGUB 4IWQA 4MELA 4MDKE 3M62B 3KUDB 4EEWA 3AXCA 3EECA 1UBQA 1Q1OA 1WM2A 3AULA 3W1YA 1V5TA 5CHFA 2K39A 1LXDA 3A1QB 4B95A 1YX6B 4BVUC 3OLMD 4W9IA 3VHTC 3ZLZA 3V6CB 3TBLD 1TBEA 1WE6A 3U8ZA 4HWIB 5G2NA 3ZRFA 1WR6E 3MTNB 4MGIE 3K9PB 4G50A 1A5RA 2LI5A 2KOXA 2C7MB 1NBFC 1WF9A 2N1VA 3V60A 3X0WA 4NQKE 1V49A 2D11A 3I3TB 1NDDA 2KO3A 4W9JA 1V81A 2IO2B 2EMSA 2KDEB 3N32A 5LXHA 2BKRB 1WI0A 3RYTA 2KVRA 3R7QA 1TTNA 3ZIMA 3N30A 2HD5B 4IUMB 2W9NA 2B3AA 4DHJD 3ZDMC 1R4NI 1PQSA 4LDTD 1XQQA 3DBHI 4PYUA 2LZ6A 1ZW7A 3LJ3A 4FADA 2JWZA 2PEAA 4BBNF 2LVQA 4BKTA 2J0MA 5JZEB 4KSKC 2JUOA 1QZEA 2XEWA 4WJOA 4IWOA 2JT4B 3A9KA 2KC1A 3QA8A 1WH3A 1RLFA 2MBHA 3L13A 5G55A 1E8XA 4WJPA 1F9JA 1E8ZA 1S1QB 1UELA 2O2VB 4GDKA 5AEKB 3R3MA 3WAOA 3ENEA 1L2NA 3H7SA 4K1RB 3H9DA 2MBOA 3V6EB 2LGXA 4GSWA 2FNJB 2AEHA 2AL6A 2KKCA 2J0KA 2BPSA 2C60A 2GBNA 2KNBA 2Z59B 3H7PB 4G0NB 2KFKB 4RM9A 4AUQC 2K25A 2CKHB 3OAWA 4KVGB 3U30A 3SDLC 4FULA 3V62A 5DPTA 2KJRA 3ZVVA 4HPLB 1X1MA 4MGKE 4URKA 2LD9A 2KX3A 2PJHA 2L76A 5CTRC 4ZDVA 1JRUA 2NBVB 3TCAA 2NVUI 5DPWA 2RD0A 2LGYA 2KTFA 2DAJA 2KWCA 2LRUA 4ZRKA 1J0GA 4ANVA 4LCDE 2MBBB 1GG3A 2KFJA 2AWTA 4PS3A 3R7RA 2KDBA 2QHOA 3VH3B 4IWPA 4W9EA 1YJ1A 2RR9A 4NJ7A 2WWZA 4WWOA 3B08A 1WZ3A 4FJVB 3PTFC 2NBWB 1WGRA 3VH4B 4CYEA 1P9DU 2GBKA 2XK5B 1WXVA 3DDCB 1V9JA 4F1SA 3IVFA 2Z0EB 5KHOA 1R4MI 2KC2A 3K9OB 2DYMA 2ZVOA 2D2QA 5DPSA 2GBRA 2HJ8A 2ZPNA 4AJWA 1RFAA 2KK8A 1P1AA 3CSTA 4AP4C 1IPGA 1SIFA 3QAQA 3PVLA 4TQ0A 1S3SG 1C1YB 1UGMA 4HXDA 4A20A 3RT3B 2R2OA 4LJOB 4GIVA 5E6NA 1GC6A 4W9HA 3UIOB 2RPQA 3DBLI 4II3B 2LGDA 3WA0A 2VRRB 3JVZX 2KJHB 2LVOA 2O6VD 4K81A 4MSQB 2O6VA 2XBBC 2CR5A 3TIXA 2Z0DB 4JLCA 4DHZB 2KTRB 1AARA 5AZGA 4FHJA 1MG8A 2JPHA 1H8CA 3CF6E 3P2BA 3IHPC 1WXAA 4F8CB 2M1MA 4N9F4 3U7DA 2O6VB 2BYVE 5AZFA 2MBQA 3QWZB 3W1SC 2OOBB 4MGYE 3T8MA 1WXMA 4KDIC 5EDSA 1WFYA 3KYDD 4W9LA 2GMIC 4PS8A 4ZRIA 3RD2A 1Y8RC 3JSVB 2N7DA 4GXBA 1UH6A 4JIOU 2J0JA 1OGWA 1YX5B 1WIAA 4GN1A 1KM7A 3QIJA 5KHQA 1WGYA 2FIDA 4XX5A 4EZKA 2CS4A 3L08A 3AU5A 1UZXB 1WJ6A 3OJ4B 3WALA 3A33B 1LQBA 3HM3A 1YD8U 2JVCA 2IY1B 3PRZA 2JXXA 4W9FA 2M17A 4E71A 3SU8X 4KSLC 4BFRA 3UGBB 2DYBA 4NAWA 4A3OA 4FLHA 1EF1A 2L8JA 4FN2A 2YLMA 3AU4A 3KUZA 3PLVA 2A4ZA 2BKFA 3HHMA 3ZRCA 4JQWC 4XC2A 3PSEB 2IY0B 2L0FA 2ZCBA 3OJ3A 4KZ0A 3VFKA 2WYQA 1OQYA 2LASA 3GOEA 4DHJB 2K8HA 4WJQA 3DPDA 1WY8A 4LDTB 4DDGD 5AZHA 3TMPB 4TKNA 2KWVB 1E90A 3D32A 3N3KB 1P3QU 2MBEA 1XD3B 2JRHA 3L10B 5J2RA 3NOBA 4DDID 2GBMA 3LDZE 1WR1A 1TZ1A 2ZJDA 3A9KB 3L0WB 4NQLB 4AOFA 2KQSA 1I42A 1E7UA 4M8MA 3L16A 1WX9A 4AJYB 2C7NB 4NPNA 2I1JA 2JRIB 4GDKB 4CHKA 1WJ4A 3ZDTA 3ML9A 3ZTDA 2Y5BB 1OEYA 4GU2A 4I6LB 4HK2A 3UQAA 5FR6A 1LFDA 1K8RB 2K8BA 5IA7A 2IYDB 3SD5A 1KLVA 2HE7A 3RZWC 1H4RA 2DZIA 2OJRA 2REXA 1I35A 1EO6A 3H6NA 2MRPA 1U4AA 3PGEA 3A9JA 5D94A 5L83A 3NY5A 2ZVNA 4LJPB 1SGHA 3PPAA 1IYFA 3DQVA 3O65B 1EUVB 5D6JB 4K7WA 4BKSD 3KW5B 1IP9A 4BKSA 1WMHA 3VDZA 2WX0A 1Q0WB 4TQ1A 3UINB 2M0XA 2LVPA 4B6WA 1WJUA 5CHVC 3VTWA 2K6QA 3AI5A 2I1KA 3B0AA 4W9KA 4WJNA 2G4DB 3VTUA 1RRBA 4E3CA 3QJZA 3M3JA 1LM8B 5J17A 1VD2A 5E6OA 1WGHA 2DENB 2K1FA 4E74A 3M95A 4GDLA 4ANUA 3S2AA 4EZJA 1V2YA 2BYFA 2ZPYA 4G11A 2BWES 2LXCA 1CMXB 3IBEA 1WYWB 1E5WA 1M94A 2BYEA 1GNUA 4P7IA 1ZKHA 5CHWA 5C23A 2KANA 5GMVA 4WWPA 4MM3A 4EKUA 4XZ4A 4KV2A 1ISNA 2ZZPB 1OTRB 3QARA 3WAMA 4DK5A 3MHSD 2YVCA 4X57B 2J7QB 1YIWA 2DX5B 2K8CA 2V1YA 2DZMA 5DCNA 3RUIB 2LXAA 3ZUNA 4MEMA 2RGFA 1GC7A 3ZNID 1V5OA 1WRDB 4OVVA 3KYCD 2KWUB 3A4SC 3PREA 2KMAA 2D07B 2NPTA 3TJPA 4IM0A 4I6PA 5JH5C 3BINA 4NJ6A 4EZLA 4BKGA 3PLUA 5E6PA 2CHZA 3DVNV 2KZRA 1Z5SB 4KIKA 3VUXA 2IO1B 1G6JA 3MJWA 4WQOB 5IAAC 1WJNA 1FXTB 2KD0A 3RZFA 4W9GA 3DBSA 4MJSA 3WANA 3M63B 2N9EB 4ICUA 4HDQA 2MQJA 2AYOB 3EC8A 1V86A 3PHXB 3WIMA 3IFWB 2MWSB 5LLIA 3HM6X 3Q3JA 3RULA 4WAAA 5L95C 3A1QA 4HJKA 2JF5A 4FA6A 4FBJB 2N7EA 3C0RB 3JW0X 2K6DB 3ZTCA 4A3PA 3EFUA 2BWFA 4ANXA 1VCBA 3CSFA 2NR2A 3ONSA 4WWNA 2L00B 3APDA 4BOSC 2GOWA 3HK0A 2NBUA 3H1UA 3V61A 3QC8B 3ZW3A 4GB9A 4I6NB 4ANWA 2KN5A 4CO7A 2L7RA 4NNJB 4J6IA 3UIPB 2LUEA 2ZNVB 4HCNB 3IG3A 4M8NA 2KDIA 2HTHA 1OEYJ 3ZNGC 4NY0A 4NAWB 4MGZE 1Z2MA 2CHXA 2EKEC 3QCAA 2KXJA 1BT0A 4EFOA 2KLCA 2WX1A 3NS8A 2KJ6A
chains in the Genus database with same CATH superfamily
1FMAD 3QQ8B 3ZO5B 3T3OA 4ZYNA 2JZ3B 4FJYA 2MA9B 1V80A 4HKQA 1E0ZA 1TT5B 4W9DA 1RYJA 2NTSA 2ZEQA 3PHWB 1OQQA 2NCNA 1PUTA 5D2MB 3ZNHB 5IKCM 1I4XA 2G45B 4FHKA 2UWQA 2KFKA 2PE9A 4RH6A 2K0PA 3Q3MC 3KH0A 1KOTA 1TS3A 1VJKA 4GMVA 1FRDA 3NVYA 4BBNC 4KDLB 3H8HA 3DBHB 4S0RA 1DOXA 2DYOA 1PGBA 3TEWA 2WQYB 3W9CB 2QCZA 1E8WA 3GZNI 3NVZA 2KDMA 3T3NA 4CQNA 1T6BX 1NI2A 1WX7A 3MHZA 3R66C 2LWPA 2KLGA 3VVWB 2DAFA 2BYTA 3PO0A 1I7HA 2N9XA 3DVNU 4RF1A 3VQIA 3PT2B 2KQ7A 1P98A 2JY6A 1XF5L 2E3TA 4JWSC 4HLEA 3RCZA 2KMCA 2FE8A 4MM3B 5HHDG 4BOZB 3W1SA 4WURA 1SE9A 1TS4A 1ESFA 3BYYB 4ZRJA 4ARIA 3MC8A 2Y5CA 1ZDVA 5JHAA 2ZCCA 4HPMB 2EMTA 5TSSA 2N4FA 1XT9B 1MI0A 1Q10A 2IZVB 4FXCA 1WX8A 4M01A 3KQ4A 1AYFA 3UQBA 5J18A 1TIFA 4YWGG 1R4MB 4F7ZA 3Q3FA 3JSVA 1SF0A 3NS1A 2KVZA 3GE3C 3CIRB 2QILA 3C8YA 2OHFA 1ET6A 1FIQA 1UBQA 1HZ5A 1WM2A 3AH7A 4B95A 3A1QB 3DBLB 3R8BA 3CWIA 4JE3B 3AE7B 1TBEA 1WE6A 3U8ZA 4HWIB 2WNMA 3MTNB 2KOXA 2C7MB 3HUIA 2LMCA 2N1VA 3V60A 3X0WA 3RMKC 3ZGZA 2IGHA 3AEDB 4IKGA 3AE4B 4NZLB 4W9JA 2EMSA 3Q3OC 1WI0A 2WXNA 4IOIE 1DOIA 1TTNA 1WWTA 3ZIMA 2X8XX 1YQ4B 3ZDMC 2INPE 5JZEB 5EE0A 1QZEA 4WJOA 4ZRQA 2KC1A 1UUPA 1WH3A 5BMHA 5AEKB 2V0GA 3R3MA 3WAOA 1WGKA 3H9DA 2LGXA 3FAHA 2AL6A 2J0KA 2KNBA 2Z59B 4ANWA 1V1OA 1XXGA 1YMHE 2ZW1A 4KVGB 3SDLC 2VH1A 3AE9B 2KJRA 4HPLB 2LD9A 3DWGC 3SFEB 1BUIC 2KX3A 2L76A 3ZJUA 1JQ4A 3TCAA 2NVUI 3RI7C 1GG3A 3LYYA 4IWPA 4W9EA 3BK1A 2W54A 3MC9A 4WWOA 3PTFC 5FKAC 5BYSA 3IVFA 5KHOA 2KC2A 2ZPNA 1MJDA 1M4VA 4RFBA 1P1AA 4JPSA 3PVLA 1SXTA 3FILB 4HXDA 4A20A 3P4RB 2LGSA 2R2OA 4LJOB 3R2TA 4II3B 4LNFA 2LVOA 4MSQB 1D5XC 2O6VA 1WXQA 1JWSD 4YSXB 3RPFC 1AARA 1MG8A 1ZXIA 2V3NA 3BVMA 3P2BA 4LNOA 3U7DA 2O6VB 2MBQA 3QWZB 2OOBB 3AEEB 3TEZA 2GMIC 4PS8A 1SIJA 1UH6A 1OGWA 5T8IA 1KM7A 5KHQA 3B2GA 4N58A 3N1XC 3WALA 3HM3A 1JWMD 1BMLC 2JVCA 4KSLC 2DYBA 3ZJVA 3VR8B 1JWBD 3KUZA 2A4ZA 3HHMA 1MHHE 2QEJC 1K51A 4XC2A 2HJ1A 1OQYA 1N63A 1C4PA 2K8HA 4LDTB 5AZHA 3TMPB 1VLBA 2Y3AA 1E90A 5IOIA 1F0ZA 5H92C 5J2RA 2BW2A 3LDZE 1TZ1A 4NQLB 3E56A 1ZUD2 2JRIB 4GDKB 1RFKA 3V05A 4ZYSA 1JROA 3ML9A 3ZTDA 1HTOA 5FR6A 1LFDA 1K8RB 3W5UB 3SD5A 2HE7A 1EU4A 1H4RA 2DZIA 1EO6A 4TSSA 1U4AA 5L83A 4MACA 1IYFA 5D6JB 1WMHA 1VDVA 2WX0A 1Q0WB 1N5XA 4TQ1A 1F2RC 1SE3A 5CHVC 1CQVA 3FKYA 3KLSX 2I1KA 4ARCA 4WJNA 2WLBA 2VZKB 2W3RA 4M00A 1YN4A 1L0VB 1P7EA 4A55A 4M0WA 3S2AA 4EZJA 2BYFA 2AQ1B 3IBEA 2BWES 2LXCA 1CMXB 1WYWB 2D3AA 2BYEA 5HI1A 2WP9B 2E6XA 1SE2A 1ISNA 1OTRB 2JYEA 3QARA 4HRSA 2DX5B 2K8CA 3ZUNA 1FRRA 4MEMA 1GC7A 1V5OA 3KYCD 3RNFC 2KMAA 1UWMA 1FFVA 4OVZA 3TJPA 4C56C 1TZOA 3ETRA 5E6PA 1Z5SB 2IO1B 3ZYYX 1G6JA 3VUXA 2KD0A 3DBSA 4HDQA 4KX6B 2MQJA 1FXIA 3RULA 1QF6A 2YEPB 4WAAA 3I63C 4FBJB 3AEGB 4A3PA 3JW0X 2DWQA 1VCBA 2NR2A 1CK1A 4BOSC 2GOWA 2WS3B 2NBUA 4I6NB 2L7RA 3IG3A 2HTHA 5GXGB 1DYQA 1BT0A 3LXFA 4EFOA 2WX1A 1VR9A 2ZNVC 2FCMA 1N5WA 3VTVA 3NHEB 4OVUA 5BO4B 1D6EC 2WXFA 1NYQA 3APFA 4OHJA 1TY0A 2MSED 2IGGA 2W82A 2PW9A 4L2YA 2IO3B 4TUUA 4RM8A 2L52A 3HIZA 3L17A 4PYZA 5HKHA 4P1CC 2BT6A 3VAWA 4DHZE 2WXJA 4LTUA 5BYRA 2IBIB 2PPHA 2CU1A 2MJ3A 1GJZA 3VXWA 3DCGA 2KMMA 2D10A 1FNVA 5C1ZA 3PV1A 4RF0A 1TS2A 2FIFA 3L54A 5FR3A 2KX0A 4ICVA 3ALBA 4II2B 3RNBC 3AE5B 3EHVA 2GI9A 5JHBA 2LRWA 1WXSA 2PLPA 3Q8FA 4JGHB 2DZJA 2FCNA 4PS7A 3NVVA 5AUIA 3APCA 1E6EB 3EFCA 4GDLB 1E8YA 1V6EA 4ASWC 4G3XB 4YL8A 4HPPA 3WAPA 2C5LC 4MSMB 3ML8A 1WGDA 3T9LA 1PGAA 4LNKA 1D3ZA 2WGSA 1JWUD 2L05A 3NZSA 1HE8A 2FUHB 4B0MA 2M4NA 2NPTB 2OEDA 3PRMB 3ZNZB 4IC7B 2B76B 5CX3A 3SHQA 4RMAA 4KIKB 3N20C 2G4SA 2M8SA 2FCSA 1ZDXA 4UDUC 2MLBA 4OZAA 3M62B 1CZPA 3KUDB 3AXCA 3AULA 1V5TA 5CHFA 1LXDA 2BB6A 3V6CB 1QOAA 1JALA 1WR6E 1F1HA 1A5RA 4LK0M 3HVDA 2D11A 3I3TB 2N9KA 2IO2B 2BKRB 4RNAA 3RYTA 3R7QA 1T0RC 3N30A 2B3AA 3GP7A 4DHJD 2MEKA 1PQSA 4YTNB 3AB5A 3DBHI 2LZ6A 4JX1C 4FADA 2AQ3B 4BKTA 1L4DB 2EELA 2XEWA 4IWOA 2JT4B 1FO4A 3QA8A 3L13A 2INCC 2M56B 4WJPA 4OZCA 1KLUD 3ENEA 1L2NA 2MBOA 4KGSA 3VR9B 2KFKB 4AUQC 1DOYA 2CKHB 4BZAA 3U30A 2BS4B 4FULA 1L5PA 4MGKE 1HTQA 2WXIA 5LNK1 4ZDVA 1JRUA 2NBVB 3U7ZA 5DPWA 2QJLA 2LGYA 3RNCC 2LRUA 4ZRKA 1P7FA 4ANVA 4LCDE 2AWTA 2PTLA 1FM0D 3IAS1 3C19A 3VH3B 2RR9A 1FPYA 2Z8LA 3BYTB 4REZA 3B08A 4FJVB 2NBWB 1WGRA 1P9DU 3DDCB 2Z0EB 1R4MI 4YXDB 2ZVOA 5DPSA 1C78A 2KK8A 2IDYA 3CSTA 2RDGA 4TQ0A 1S3SG 1QOGA 1UGMA 5E6NA 1GC6A 2RPQA 3DBLI 1TYGB 2LGDA 3WA0A 2KJHB 1XEEA 4ACFA 3MC0B 2W3SA 1L0XB 2ICIA 5AZGA 4FHJA 2K5PA 1RM6C 1VZ6A 4F8CB 2HTME 3Q6BA 1N62A 2BYVE 5AZFA 2RDBC 2LFIA 1PFDA 5EDSA 1WFYA 3KYDD 2RMMA 4W9LA 3NUHB 1FXAA 5E6JA 3IXSA 2LUMA 3JSVB 4GXBA 2JYTA 1ZPSA 2WXQA 1FNWA 1NYRA 3QIJA 1WGYA 2FIDA 3IT6B 4XX5A 1IBXA 3L08A 4OW0A 1UGJA 1LQBA 1PYWD 2IY1B 2JXXA 4E71A 2NTTA 3SU8X 1GAQB 3UGBB 4NAWA 4FLHA 4FN2A 2YLMA 3AU4A 1L6UA 2IY0B 2L0FA 3OJ3A 5C2TB 3VFKA 3GOEA 4OZBA 4WJQA 1WY8A 1XLNA 4LNIA 2FBWB 3Q8AA 2KWVB 3AE3B 3D32A 3N3KB 4J3OD 2MBEA 2INNE 3NOBA 2GBMA 1JW9D 3L0WB 2XN9C 4AJYB 4CHKA 4NPNA 2K8BA 2IYDB 4N6EB 3RZWC 3H6NA 4AQ7A 1TKYA 3PGEA 3A9JA 1SGHA 3AEBB 2BS2B 3KWLA 2H88B 2L32A 4L1BA 3UINB 4DXGA 3AI5A 2KAJA 4W9KA 3VTUA 3M3JA 1KF6B 1FEHA 1FCCC 1VD2A 5E6OA 3NVWA 1V8CA 2K1FA 3NJTA 4E74A 1HEZE 1V2YA 4US8A 4G11A 1XCTL 4P7IA 3ZLZA 1M94A 5C23A 5GMVA 4KV2A 2ZZPB 3PZ8A 3TEXA 3MHSD 4X57B 1ACCA 3B9JA 4ZHPA 1YIWA 2V1YA 3RUIB 4L23A 1EM7A 3ZNID 4OVVA 2GB1A 3A4SC 4ZHOA 3PREA 2R61A 4IM0A 5JH5C 4NJ6A 3DVNV 1DGJA 2PVOD 4C00A 4WQOB 1I4GA 3RZFA 4W9GA 4MJSA 1ZP0B 3M63B 5FK9C 1UNSA 2AYOB 3PHXB 3WIMA 4XDDA 3IFWB 4MT5A 1GPXA 2L1AA 5EE3A 5JXVA 4IDIA 4HJKA 2JF5A 2N7EA 1I4RA 2K6DB 3EFUA 3P4SB 4P16A 4P6VF 3ONSA 2LGIA 1YQ3B 3H1UA 3V61A 3QC8B 3E9SA 4A9AA 2KDIA 1OEYJ 4A6QA 3R2IA 4NY0A 1YNTE 4MGZE 1Z2MA 2CHXA 3ABVB 4C7YA 2RSUA 1J7CA 3ZXVA 2BQQA 2FCQA 4RGNA 1V1PA 1WM3A 5BMGA 3DOWA 1E10A 1B9RA 2MH7A 4PT5A 2JU6X 2O2VA 5D7GA 3UI3A 2V3SA 1WSPA 1HQRD 1NVID 4JWUC 4RGMA 3NZUA 5LXIB 2UYZB 3H7PA 2C9WB 3RFZB 4KKIA 4DBGA 2G3QB 2CJOA 2MX2A 4AWJA 2SEBD 3PZ7A 1NENB 2JWUA 2WU2B 2WU5B 1VZ7A 3ZJTA 2JZZA 2WXHA 1L7YA 1GUAB 1PGXA 1R4NB 2NMQA 1I4QA 1YQBA 4NJCA 4HDOA 1J19A 2PMVA 1WMHB 1Y56A 4PK1A 4DXFA 4MH8A 4GGQA 3CMMB 1JRPA 2JQRB 2EKIA 3ECIA 1P0RA 2XK5A 4JL9A 3TSSA 4KZCA 1T0YA 4K7SA 1EWCA 4IG7B 2FUG1 4BAXA 2D3GA 2LJIA 1EF5A 2G1EA 4M0WB 2DZKA 1WGGA 2DHZA 4RCOA 1JWAD 1FD6A 3DBRI 3MJ5A 3VRAB 1J8CA 1YOVB 3QHTA 2LJ5A 4ZOHC 1KTKA 4WH4A 2BS3B 1Q5WB 2BGFA 2KTRA 3QX1A 2V3PA 2KHWB 2LHDA 1C4CA 2R2QA 1B1ZA 2MCNB 1C3TA 2M19A 3B1LX 4K7UA 5DPRA 3A4RA 3BY4B 3OWEB 3DBRB 1AWDA 4LNNA 2C7HA 1ZGUB 4GLSC 4MELA 4MDKE 4S17A 2WXMA 3P63A 2OJWA 2IGDA 3W1YA 2K39A 2LEKA 3VHTC 1LGRA 1XLQA 5G2NA 4MGIE 2D5GA 2QC8A 2RDHA 1NBFC 1WF9A 1FFUA 4NQKE 3N32A 4YTMB 2ZW0A 5LXHA 5AUKA 2WHIA 2HD5B 2W9NA 3GB1A 4LDTD 3AE6B 2MHJA 1XQQA 1ZW7A 3LJ3A 3BVZA 2LVQA 2J0MA 2K22A 4HKZE 3A9KA 3ZQ4A 1F9JA 1E8ZA 1UELA 3KWVA 3V6EB 4C7ZA 2L83A 2KKCA 2BPSA 2C60A 2G9HD 4G0NB 4O1NA 2JX5A 3OAWA 4US9A 3DHHC 1X1MA 3W5VB 2XNAC 2PJHA 4C4VA 4C80A 2RD0A 2WXPA 4WAFA 2I38A 2KFJA 4PS3A 2KDBA 1ZE3D 3AE2B 2VZKD 1YJ1A 3LB8C 2WWZA 1WZ3A 4HROA 3VH4B 4CYEA 2GBKA 4F1SA 1WXVA 1V9JA 4XWWA 3MFGA 1QOFA 1I4PA 2D2QA 2GBRA 2HJ8A 1AW7A 1RFAA 4AJWA 3B2FA 3J9CA 4AP4C 2K9XA 1SIFA 3BVGA 1IGCA 3AN1A 3RT3B 2WXOA 1KH0A 4W9HA 3UIOB 2UU7A 3JVZX 2PKOA 4K81A 2XBBC 2CR5A 4LLGM 3N9YC 1N60A 3TIXA 2JPHA 1H8CA 3CF6E 3W2DA 1WXAA 1L4ZB 2M1MA 1BXTA 4N9F4 1E9MA 1HA5A 3EUB2 4WQMA 4MGYE 4ZRIA 3RD2A 1YJIA 2I2YA 5MPOA 4WIPA 4JIOU 4GN1A 1MG4A 2CS4A 1UZXB 4XE0A 3OJ4B 3A33B 2VH2A 4XYCA 3L4PA 2M17A 4A90A 5G5HA 3SR6A 4BFRA 4A3OA 5IO9A 1XLPA 3SFDB 1EF1A 2L8JA 3PLVA 2BKFA 2GRIA 3TUOA 4JQWC 1F2RI 4RGTA 2ZCBA 2WYQA 2LASA 4EE2A 3DPDA 4DDGD 2M0AA 4TKNA 2W55A 1NEKB 2SAKA 2JZPA 2ONQA 2JRHA 3OG5A 1N6ZA 3L16A 2C7NB 2I1JA 3AECB 1WJ4A 3ZDTA 1HZ6A 2Y5BB 4GU2A 4I6LB 4HK2A 3UQAA 3NRZA 1TKGA 4H2AA 4KGRA 2MJEA 2WXRA 3NG0A 2REXA 1I35A 2KWDA 2Q5WD 3NY5A 4LJPB 3DQVA 3O65B 1EUVB 4BKSD 3KW5B 2JXTA 1SE4A 2M0XA 4B6WA 1WJUA 2K6QA 3B0AA 1YN5A 3QJZA 1L6VA 1MFWA 1WGHA 3M95A 4YSZB 1E5WA 3TL5A 1XCQL 4HEA1 4WWPA 4MM3A 2AQ2B 2PIAA 3GE8C 4YT0B 1J7BA 3WAMA 1HXYD 2YVCA 2J7QB 3AV8A 5DCNA 4KKJA 2DZMA 4KGTA 2DNFA 1SEBD 2D07B 1K50A 4I6PA 3BINA 5H8YE 3GZNB 3FC4A 3PLUA 2CHZA 2KZRA 1QT9A 1GOZA 3AEFB 4EKUA 5IAAC 1FXTB 3HVZA 2N9EB 3RNEC 3HM6X 3Q3JA 1LO5D 4K3CA 4TMAB 2J42A 1CJEA 3A1QA 4XWTA 3IT4B 3P4QB 3C0RB 3URYA 3ZTCA 4WWMA 2BWFA 4ANXA 3ZXRA 1IBXB 4R3DA 3AM9A 2QDFA 4WWNA 3HK0A 1MVKA 3ZW3A 4CO7A 3AEAB 1I4HA 4NNJB 1ZXHA 2LUEA 2ZNVB 4HCNB 4M8NA 4NAWB 2J52A 2KLCA 3EGRA 1FCLA 2RPVA 3NS8A 2KJ6A 4B0EA 3P4PB 2V4IB 3PRPB 4USAA 1SBBB 1YN3A 3QK0A 1WE7A 1PDXA 3I9V1 4FJZA 2KN4A 3GS2A 3UF8A 4HVBA 2GBJA 2MW5A 3VUWA 3JYUA 3KVFB 2MP2A 2JSVX 2CU3A 1UBIA 4GOCA 1RAXA 2N1WA 4IM2A 4DWFA 1A70A 2MP2B 1T5XD 4IW0A 2N9PC 1V97A 2WXKA 4TV3A 3A9JB 4FA6A 3KUCB 2L3ZA 4HCPB 2NS5A 4IM3A 4W9CA 4B9KA 3DVGY 2ASQA 3DHIC 5TR5A 3BWUD 2WDTB 1C79A 2L0TA 1EU3A 2IO0B 3RNGC 1N61A 5IP4D 2KACA 3O13A 3Q3NC 1F52A 2J53A 4MH0E 1KJTA 1E7VA 3DVGX 2CHWA 5IN7A 3MP9A 3FILA 2N9LA 3VUYA 2AL3A 1TGZB 1VZ8A 1E7PB 3PZDA 2PE6B 1C4AA 4M02A 2K3UA 3PS6A 3BIID 3ZKJC 4DXAB 1GB4A 3VRBB 3Q8CA 1UD7A 2BF8B 2WXGA 4EUTA 2IJ0A 1WZ0A 2V4LA 3X23A 1OQRA 4MJSB 2A5UA 2KDFB 3RN9C 2FAZA 4EOYA 2WXLA 4IWQA 4EEWA 3EECA 1Q1OA 3AE1B 2DBYA 2WDRB 1SJED 1YX6B 4BVUC 3AE8B 3OLMD 4W9IA 5BYQA 5I4DA 1T3QA 2WDQB 3TBLD 1TY2A 3ZRFA 2DLBA 3K9PB 4G50A 2LI5A 4XGAB 1IUEA 1QKZA 1V49A 1NDDA 2AX5A 2KO3A 3SEBA 1V81A 2KDEB 5C3JB 2KVRA 3Q2AC 4IUMB 1R4NI 1RWSA 1XO3A 4PYUA 2JWZA 2PEAA 4BBNF 4KSKC 2N7JA 2JUOA 1K52A 1T0SC 1V1PB 1RLFA 2MBHA 5G55A 1E8XA 4GDKA 1S1QB 2O2VB 2PVGC 3H7SA 3Q69A 4K1RB 2MJDA 1ROEA 2FNJB 2AEHA 4GSWA 3H7PB 4RM9A 2GBNA 2INDC 2K25A 3TEYA 1IGDA 3V62A 5DPTA 1YJJA 3ZVVA 2BTEA 4URKA 5CTRC 3N1YC 2QSDA 2KTFA 2DAJA 2KWCA 5EE1A 1J0GA 2MBBB 3R7RA 2X38A 4RGOS 2QHOA 1WYGA 4QAYA 1L0YB 2QIEB 1VRAB 4NJ7A 5G5GA 5BMIA 2V9HA 1D5MC 2XK5B 4D2KA 3K9OB 2DYMA 4ITKA 1OFFA 1QQRA 1STEA 5HFYA 3WCQA 4N59A 4ZRPA 1IPGA 3QAQA 1C1YB 3U52E 1D5ZC 1F77A 4GIVA 4HJGE 2CJNA 1SJHD 2VRRB 1MPEA 4NAMA 2O6VD 2BB5A 3HRDD 5D3IB 1C77A 2Z0DB 4JLCA 4DHZB 3EA6A 2YEPF 2KTRB 3N1ZC 1C9FA 3IHPC 2H89B 2QMTA 3IAM1 3W1SC 1JMLA 4XDCA 3T8MA 1WXMA 4KDIC 1D4BA 1MHXA 1T0QC 1Y8RC 2N7DA 2J0JA 1YX5B 1WIAA 1KFYB 2BBCA 1AN8A 4EZKA 2D3CA 3AU5A 1WJ6A 1K53A 1YD8U 3PRZA 4W9FA 2D3BA 2LHEA 4Q2JA 3Q8EA 1GB1A 3ZRCA 3V3XA 1SB3C 3PSEB 4KZ0A 3I5JC 4DHJB 1R7SA 2ON8A 2KYWA 3AMZA 1P3QU 1XD3B 1TS5A 3L10B 3I57A 4DDID 2KT7A 4YTPB 3Q8BA 1WR1A 2ZJDA 4AOFA 3A9KB 3RNAC 2KQSA 1I42A 1E7UA 4M8MA 1WX9A 1JCKB 1OEYA 1TKEA 3P1MA 2GLSA 5IA7A 2ACZB 1KLVA 2Y5PA 1QILA 2OJRA 2MRPA 4A8XC 5D94A 2ZVNA 3PPAA 1ZOYB 4C4VB 4K7WA 1IP9A 3DWMA 4BKSA 3VDZA 2LVPA 2IPKD 3VTWA 4P1BC 3U2SC 3P42A 2G4DB 1RRBA 4K3BA 4E3CA 1LM8B 4DQOC 1J7AA 5J17A 1NI3A 2DENB 2N0SB 4GDLA 4ANUA 2ZPYA 5CHWA 1GNUA 1TJEA 1EWYC 1ZKHA 2BVCA 2KANA 4YSYB 4XZ4A 2HDEA 4DK5A 5HG2A 2LXAA 2RGFA 1UF0A 3DHGC 1WRDB 5EE9A 2KWUB 1ET9A 2NPTA 1KRHA 3U4EG 2J4XA 4EZLA 4BKGA 3BZDB 4KIKA 1SSNA 3MJWA 3WANA 1WJNA 3Q14C 1KLGD 4ICUA 1FNUA 3EC8A 1V86A 1UWXA 2MWSB 5LLIA 1XLOA 3NZ3A 5L95C 2WDVB 1QOBA 3BK2A 2KQ4X 3CSFA 1QLBB 2L00B 3APDA 1WRIA 4GB9A 2KN5A 4J6IA 5D3DA 3UIPB 1C76A 1ENFA 3ZNGC 4AS1A 2EKEC 3QCAA 2KXJA 2TSSA
chains in the Genus database with same CATH topology
3QQ8B 3ZO5B 3PRPB 2ZNVC 3QK0A 2FCMA 2FCQA 2JZ3B 1WM3A 4ZYNA 1WE7A 4FJZA 3VTVA 4FJYA 3NHEB 4OVUA 5BO4B 3DOWA 2MA9B 1V80A 3UF8A 4HVBA 2GBJA 4W9DA 2O2VA 5D7GA 2V3SA 2MW5A 3APFA 2MSED 2ZEQA 3VUWA 3JYUA 3KVFB 3PHWB 2MP2A 2NCNA 2IO3B 3NZUA 5D2MB 2UYZB 3ZNHB 3H7PA 5LXIB 1UBIA 2G45B 4RM8A 4FHKA 2UWQA 4GOCA 2KFKA 2C9WB 2PE9A 4TUUA 3HIZA 3L17A 4PYZA 4DBGA 5HKHA 1RAXA 2N1WA 4IM2A 2G3QB 3TL5A 3VAWA 2MX2A 4AWJA 4DHZE 4DWFA 2MP2B 2IBIB 2PPHA 4IW0A 2CU1A 3KH0A 1KOTA 1GJZA 2N9PC 3VXWA 3DCGA 4GMVA 2JZZA 2D10A 4TV3A 3PV1A 5C1ZA 4BBNC 1L7YA 1GUAB 2FIFA 3A9JB 3L54A 4KDLB 2KX0A 1YQBA 2L3ZA 3KUCB 4HCPB 2NS5A 4ICVA 3ALBA 4HDOA 4IM3A 4W9CA 4B9KA 3DVGY 4II2B 2ASQA 5TR5A 1J19A 2DYOA 1WMHB 2WDTB 3EHVA 4GGQA 1E8WA 3CMMB 3GZNI 5JHBA 2LRWA 1WXSA 2L0TA 3ECIA 1P0RA 2XK5A 4JL9A 4KZCA 2IO0B 1T0YA 4K7SA 1NI2A 4IG7B 1WX7A 4JGHB 3R66C 2LWPA 2DZJA 4MH0E 2KLGA 3VVWB 2DAFA 1KJTA 2D3GA 1E7VA 2FCNA 2N9XA 3DVNU 3DVGX 4PS7A 3VQIA 3APCA 2CHWA 3PT2B 1EF5A 2KQ7A 1P98A 4GDLB 4M0WB 2DZKA 2JY6A 1WGGA 1E8YA 1V6EA 4ASWC 2DHZA 4G3XB 4YL8A 3RCZA 4HLEA 3DBRI 3VUYA 2KMCA 2AL3A 1TGZB 3WAPA 1J8CA 2C5LC 3QHTA 2LJ5A 4MSMB 3ML8A 3PZDA 1WGDA 3T9LA 4BOZB 2RSUA 3W1SA 1D3ZA 1SE9A 2PE6B 4ZRJA 1Q5WB 2BGFA 2KTRA 2L05A 3NZSA 1HE8A 2ZCCA 5JHAA 2FUHB 4HPMB 3QX1A 2EMTA 3PS6A 2KHWB 2N4FA 3ZKJC 1XT9B 2M4NA 2NPTB 4DXAB 2R2QA 3PRMB 2IZVB 2MCNB 3ZNZB 1WX8A 4IC7B 3UQBA 5CX3A 1C3TA 1UD7A 5J18A 3B1LX 4K7UA 5DPRA 3SHQA 4RMAA 3A4RA 2BF8B 3BY4B 4KIKB 2G4SA 4F7ZA 3Q3FA 3JSVA 4EUTA 3X23A 1WZ0A 2M8SA 2V4LA 4MJSB 2FCSA 2A5UA 2KDFB 2FAZA 4EOYA 2C7HA 2MLBA 1ZGUB 4IWQA 4MELA 4MDKE 3M62B 3KUDB 4EEWA 3AXCA 3EECA 1UBQA 1Q1OA 1WM2A 3AULA 3W1YA 1V5TA 5CHFA 2K39A 1LXDA 3A1QB 4B95A 1YX6B 4BVUC 3OLMD 4W9IA 3VHTC 3ZLZA 3V6CB 3TBLD 1TBEA 1WE6A 3U8ZA 4HWIB 5G2NA 3ZRFA 1WR6E 3MTNB 4MGIE 3K9PB 4G50A 1A5RA 2LI5A 2KOXA 2C7MB 1NBFC 1WF9A 2N1VA 3V60A 3X0WA 4NQKE 1V49A 2D11A 3I3TB 1NDDA 2KO3A 4W9JA 1V81A 2IO2B 2EMSA 2KDEB 3N32A 5LXHA 2BKRB 1WI0A 3RYTA 2KVRA 3R7QA 1TTNA 3ZIMA 3N30A 2HD5B 4IUMB 2W9NA 2B3AA 4DHJD 3ZDMC 1R4NI 1PQSA 4LDTD 1XQQA 3DBHI 4PYUA 2LZ6A 1ZW7A 3LJ3A 4FADA 2JWZA 2PEAA 4BBNF 2LVQA 4BKTA 2J0MA 5JZEB 4KSKC 2JUOA 1QZEA 2XEWA 4WJOA 4IWOA 2JT4B 3A9KA 2KC1A 3QA8A 1WH3A 1RLFA 2MBHA 3L13A 5G55A 1E8XA 4WJPA 1F9JA 1E8ZA 1S1QB 1UELA 2O2VB 4GDKA 5AEKB 3R3MA 3WAOA 3ENEA 1L2NA 3H7SA 4K1RB 3H9DA 2MBOA 3V6EB 2LGXA 4GSWA 2FNJB 2AEHA 2AL6A 2KKCA 2J0KA 2BPSA 2C60A 2GBNA 2KNBA 2Z59B 3H7PB 4G0NB 2KFKB 4RM9A 4AUQC 2K25A 2CKHB 3OAWA 4KVGB 3U30A 3SDLC 4FULA 3V62A 5DPTA 2KJRA 3ZVVA 4HPLB 1X1MA 4MGKE 4URKA 2LD9A 2KX3A 2PJHA 2L76A 5CTRC 4ZDVA 1JRUA 2NBVB 3TCAA 2NVUI 5DPWA 2RD0A 2LGYA 2KTFA 2DAJA 2KWCA 2LRUA 4ZRKA 1J0GA 4ANVA 4LCDE 2MBBB 1GG3A 2KFJA 2AWTA 4PS3A 3R7RA 2KDBA 2QHOA 3VH3B 4IWPA 4W9EA 1YJ1A 2RR9A 4NJ7A 2WWZA 4WWOA 3B08A 1WZ3A 4FJVB 3PTFC 2NBWB 1WGRA 3VH4B 4CYEA 1P9DU 2GBKA 2XK5B 1WXVA 3DDCB 1V9JA 4F1SA 3IVFA 2Z0EB 5KHOA 1R4MI 2KC2A 3K9OB 2DYMA 2ZVOA 2D2QA 5DPSA 2GBRA 2HJ8A 2ZPNA 4AJWA 1RFAA 2KK8A 1P1AA 3CSTA 4AP4C 1IPGA 1SIFA 3QAQA 3PVLA 4TQ0A 1S3SG 1C1YB 1UGMA 4HXDA 4A20A 3RT3B 2R2OA 4LJOB 4GIVA 5E6NA 1GC6A 4W9HA 3UIOB 2RPQA 3DBLI 4II3B 2LGDA 3WA0A 2VRRB 3JVZX 2KJHB 2LVOA 2O6VD 4K81A 4MSQB 2O6VA 2XBBC 2CR5A 3TIXA 2Z0DB 4JLCA 4DHZB 2KTRB 1AARA 5AZGA 4FHJA 1MG8A 2JPHA 1H8CA 3CF6E 3P2BA 3IHPC 1WXAA 4F8CB 2M1MA 4N9F4 3U7DA 2O6VB 2BYVE 5AZFA 2MBQA 3QWZB 3W1SC 2OOBB 4MGYE 3T8MA 1WXMA 4KDIC 5EDSA 1WFYA 3KYDD 4W9LA 2GMIC 4PS8A 4ZRIA 3RD2A 1Y8RC 3JSVB 2N7DA 4GXBA 1UH6A 4JIOU 2J0JA 1OGWA 1YX5B 1WIAA 4GN1A 1KM7A 3QIJA 5KHQA 1WGYA 2FIDA 4XX5A 4EZKA 2CS4A 3L08A 3AU5A 1UZXB 1WJ6A 3OJ4B 3WALA 3A33B 1LQBA 3HM3A 1YD8U 2JVCA 2IY1B 3PRZA 2JXXA 4W9FA 2M17A 4E71A 3SU8X 4KSLC 4BFRA 3UGBB 2DYBA 4NAWA 4A3OA 4FLHA 1EF1A 2L8JA 4FN2A 2YLMA 3AU4A 3KUZA 3PLVA 2A4ZA 2BKFA 3HHMA 3ZRCA 4JQWC 4XC2A 3PSEB 2IY0B 2L0FA 2ZCBA 3OJ3A 4KZ0A 3VFKA 2WYQA 1OQYA 2LASA 3GOEA 4DHJB 2K8HA 4WJQA 3DPDA 1WY8A 4LDTB 4DDGD 5AZHA 3TMPB 4TKNA 2KWVB 1E90A 3D32A 3N3KB 1P3QU 2MBEA 1XD3B 2JRHA 3L10B 5J2RA 3NOBA 4DDID 2GBMA 3LDZE 1WR1A 1TZ1A 2ZJDA 3A9KB 3L0WB 4NQLB 4AOFA 2KQSA 1I42A 1E7UA 4M8MA 3L16A 1WX9A 4AJYB 2C7NB 4NPNA 2I1JA 2JRIB 4GDKB 4CHKA 1WJ4A 3ZDTA 3ML9A 3ZTDA 2Y5BB 1OEYA 4GU2A 4I6LB 4HK2A 3UQAA 5FR6A 1LFDA 1K8RB 2K8BA 5IA7A 2IYDB 3SD5A 1KLVA 2HE7A 3RZWC 1H4RA 2DZIA 2OJRA 2REXA 1I35A 1EO6A 3H6NA 2MRPA 1U4AA 3PGEA 3A9JA 5D94A 5L83A 3NY5A 2ZVNA 4LJPB 1SGHA 3PPAA 1IYFA 3DQVA 3O65B 1EUVB 5D6JB 4K7WA 4BKSD 3KW5B 1IP9A 4BKSA 1WMHA 3VDZA 2WX0A 1Q0WB 4TQ1A 3UINB 2M0XA 2LVPA 4B6WA 1WJUA 5CHVC 3VTWA 2K6QA 3AI5A 2I1KA 3B0AA 4W9KA 4WJNA 2G4DB 3VTUA 1RRBA 4E3CA 3QJZA 3M3JA 1LM8B 5J17A 1VD2A 5E6OA 1WGHA 2DENB 2K1FA 4E74A 3M95A 4GDLA 4ANUA 3S2AA 4EZJA 1V2YA 2BYFA 2ZPYA 4G11A 2BWES 2LXCA 1CMXB 3IBEA 1WYWB 1E5WA 1M94A 2BYEA 1GNUA 4P7IA 1ZKHA 5CHWA 5C23A 2KANA 5GMVA 4WWPA 4MM3A 4EKUA 4XZ4A 4KV2A 1ISNA 2ZZPB 1OTRB 3QARA 3WAMA 4DK5A 3MHSD 2YVCA 4X57B 2J7QB 1YIWA 2DX5B 2K8CA 2V1YA 2DZMA 5DCNA 3RUIB 2LXAA 3ZUNA 4MEMA 2RGFA 1GC7A 3ZNID 1V5OA 1WRDB 4OVVA 3KYCD 2KWUB 3A4SC 3PREA 2KMAA 2D07B 2NPTA 3TJPA 4IM0A 4I6PA 5JH5C 3BINA 4NJ6A 4EZLA 4BKGA 3PLUA 5E6PA 2CHZA 3DVNV 2KZRA 1Z5SB 4KIKA 3VUXA 2IO1B 1G6JA 3MJWA 4WQOB 5IAAC 1WJNA 1FXTB 2KD0A 3RZFA 4W9GA 3DBSA 4MJSA 3WANA 3M63B 2N9EB 4ICUA 4HDQA 2MQJA 2AYOB 3EC8A 1V86A 3PHXB 3WIMA 3IFWB 2MWSB 5LLIA 3HM6X 3Q3JA 3RULA 4WAAA 5L95C 3A1QA 4HJKA 2JF5A 4FA6A 4FBJB 2N7EA 3C0RB 3JW0X 2K6DB 3ZTCA 4A3PA 3EFUA 2BWFA 4ANXA 1VCBA 3CSFA 2NR2A 3ONSA 4WWNA 2L00B 3APDA 4BOSC 2GOWA 3HK0A 2NBUA 3H1UA 3V61A 3QC8B 3ZW3A 4GB9A 4I6NB 4ANWA 2KN5A 4CO7A 2L7RA 4NNJB 4J6IA 3UIPB 2LUEA 2ZNVB 4HCNB 3IG3A 4M8NA 2KDIA 2HTHA 1OEYJ 3ZNGC 4NY0A 4NAWB 4MGZE 1Z2MA 2CHXA 2EKEC 3QCAA 2KXJA 1BT0A 4EFOA 2KLCA 2WX1A 3NS8A 2KJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QQ8 B;  3ZO5 B;  3PRP B;  2ZNV C;  3QK0 A;  2FCM A;  2FCQ A;  2JZ3 B;  1WM3 A;  4ZYN A;  1WE7 A;  4FJZ A;  3VTV A;  4FJY A;  3NHE B;  4OVU A;  5BO4 B;  3DOW A;  2MA9 B;  1V80 A;  3UF8 A;  4HVB A;  2GBJ A;  4W9D A;  2O2V A;  5D7G A;  2V3S A;  2MW5 A;  3APF A;  2MSE D;  2ZEQ A;  3VUW A;  3JYU A;  3KVF B;  3PHW B;  2MP2 A;  2NCN A;  2IO3 B;  3NZU A;  5D2M B;  2UYZ B;  3ZNH B;  3H7P A;  5LXI B;  1UBI A;  2G45 B;  4RM8 A;  4FHK A;  2UWQ A;  4GOC A;  2KFK A;  2C9W B;  2PE9 A;  4TUU A;  3HIZ A;  3L17 A;  4PYZ A;  4DBG A;  5HKH A;  1RAX A;  2N1W A;  4IM2 A;  2G3Q B;  3TL5 A;  3VAW A;  2MX2 A;  4AWJ A;  4DHZ E;  4DWF A;  2MP2 B;  2IBI B;  2PPH A;  4IW0 A;  2CU1 A;  3KH0 A;  1KOT A;  1GJZ A;  2N9P C;  3VXW A;  3DCG A;  4GMV A;  2JZZ A;  2D10 A;  4TV3 A;  3PV1 A;  5C1Z A;  4BBN C;  1L7Y A;  1GUA B;  2FIF A;  3A9J B;  3L54 A;  4KDL B;  2KX0 A;  1YQB A;  2L3Z A;  3KUC B;  4HCP B;  2NS5 A;  4ICV A;  3ALB A;  4HDO A;  4IM3 A;  4W9C A;  4B9K A;  3DVG Y;  4II2 B;  2ASQ A;  5TR5 A;  1J19 A;  2DYO A;  1WMH B;  2WDT B;  3EHV A;  4GGQ A;  1E8W A;  3CMM B;  3GZN I;  5JHB A;  2LRW A;  1WXS A;  2L0T A;  3ECI A;  1P0R A;  2XK5 A;  4JL9 A;  4KZC A;  2IO0 B;  1T0Y A;  4K7S A;  1NI2 A;  4IG7 B;  1WX7 A;  4JGH B;  3R66 C;  2LWP A;  2DZJ A;  4MH0 E;  2KLG A;  3VVW B;  2DAF A;  1KJT A;  2D3G A;  1E7V A;  2FCN A;  2N9X A;  3DVN U;  3DVG X;  4PS7 A;  3VQI A;  3APC A;  2CHW A;  3PT2 B;  1EF5 A;  2KQ7 A;  1P98 A;  4GDL B;  4M0W B;  2DZK A;  2JY6 A;  1WGG A;  1E8Y A;  1V6E A;  4ASW C;  2DHZ A;  4G3X B;  4YL8 A;  3RCZ A;  4HLE A;  3DBR I;  3VUY A;  2KMC A;  2AL3 A;  1TGZ B;  3WAP A;  1J8C A;  2C5L C;  3QHT A;  2LJ5 A;  4MSM B;  3ML8 A;  3PZD A;  1WGD A;  3T9L A;  4BOZ B;  2RSU A;  3W1S A;  1D3Z A;  1SE9 A;  2PE6 B;  4ZRJ A;  1Q5W B;  2BGF A;  2KTR A;  2L05 A;  3NZS A;  1HE8 A;  2ZCC A;  5JHA A;  2FUH B;  4HPM B;  3QX1 A;  2EMT A;  3PS6 A;  2KHW B;  2N4F A;  3ZKJ C;  1XT9 B;  2M4N A;  2NPT B;  4DXA B;  2R2Q A;  3PRM B;  2IZV B;  2MCN B;  3ZNZ B;  1WX8 A;  4IC7 B;  3UQB A;  5CX3 A;  1C3T A;  1UD7 A;  5J18 A;  3B1L X;  4K7U A;  5DPR A;  3SHQ A;  4RMA A;  3A4R A;  2BF8 B;  3BY4 B;  4KIK B;  2G4S A;  4F7Z A;  3Q3F A;  3JSV A;  4EUT A;  3X23 A;  1WZ0 A;  2M8S A;  2V4L A;  4MJS B;  2FCS A;  2A5U A;  2KDF B;  2FAZ A;  4EOY A;  2C7H A;  2MLB A;  1ZGU B;  4IWQ A;  4MEL A;  4MDK E;  3M62 B;  3KUD B;  4EEW A;  3AXC A;  3EEC A;  1UBQ A;  1Q1O A;  1WM2 A;  3AUL A;  3W1Y A;  1V5T A;  5CHF A;  2K39 A;  1LXD A;  3A1Q B;  4B95 A;  1YX6 B;  4BVU C;  3OLM D;  4W9I A;  3VHT C;  3ZLZ A;  3V6C B;  3TBL D;  1TBE A;  1WE6 A;  3U8Z A;  4HWI B;  5G2N A;  3ZRF A;  1WR6 E;  3MTN B;  4MGI E;  3K9P B;  4G50 A;  1A5R A;  2LI5 A;  2KOX A;  2C7M B;  1NBF C;  1WF9 A;  2N1V A;  3V60 A;  3X0W A;  4NQK E;  1V49 A;  2D11 A;  3I3T B;  1NDD A;  2KO3 A;  4W9J A;  1V81 A;  2IO2 B;  2EMS A;  2KDE B;  3N32 A;  5LXH A;  2BKR B;  1WI0 A;  3RYT A;  2KVR A;  3R7Q A;  1TTN A;  3ZIM A;  3N30 A;  2HD5 B;  4IUM B;  2W9N A;  2B3A A;  4DHJ D;  3ZDM C;  1R4N I;  1PQS A;  4LDT D;  1XQQ A;  3DBH I;  4PYU A;  2LZ6 A;  1ZW7 A;  3LJ3 A;  4FAD A;  2JWZ A;  2PEA A;  4BBN F;  2LVQ A;  4BKT A;  2J0M A;  5JZE B;  4KSK C;  2JUO A;  1QZE A;  2XEW A;  4WJO A;  4IWO A;  2JT4 B;  3A9K A;  2KC1 A;  3QA8 A;  1WH3 A;  1RLF A;  2MBH A;  3L13 A;  5G55 A;  1E8X A;  4WJP A;  1F9J A;  1E8Z A;  1S1Q B;  1UEL A;  2O2V B;  4GDK A;  5AEK B;  3R3M A;  3WAO A;  3ENE A;  1L2N A;  3H7S A;  4K1R B;  3H9D A;  2MBO A;  3V6E B;  2LGX A;  4GSW A;  2FNJ B;  2AEH A;  2AL6 A;  2KKC A;  2J0K A;  2BPS A;  2C60 A;  2GBN A;  2KNB A;  2Z59 B;  3H7P B;  4G0N B;  2KFK B;  4RM9 A;  4AUQ C;  2K25 A;  2CKH B;  3OAW A;  4KVG B;  3U30 A;  3SDL C;  4FUL A;  3V62 A;  5DPT A;  2KJR A;  3ZVV A;  4HPL B;  1X1M A;  4MGK E;  4URK A;  2LD9 A;  2KX3 A;  2PJH A;  2L76 A;  5CTR C;  4ZDV A;  1JRU A;  2NBV B;  3TCA A;  2NVU I;  5DPW A;  2RD0 A;  2LGY A;  2KTF A;  2DAJ A;  2KWC A;  2LRU A;  4ZRK A;  1J0G A;  4ANV A;  4LCD E;  2MBB B;  1GG3 A;  2KFJ A;  2AWT A;  4PS3 A;  3R7R A;  2KDB A;  2QHO A;  3VH3 B;  4IWP A;  4W9E A;  1YJ1 A;  2RR9 A;  4NJ7 A;  2WWZ A;  4WWO A;  3B08 A;  1WZ3 A;  4FJV B;  3PTF C;  2NBW B;  1WGR A;  3VH4 B;  4CYE A;  1P9D U;  2GBK A;  2XK5 B;  1WXV A;  3DDC B;  1V9J A;  4F1S A;  3IVF A;  2Z0E B;  5KHO A;  1R4M I;  2KC2 A;  3K9O B;  2DYM A;  2ZVO A;  2D2Q A;  5DPS A;  2GBR A;  2HJ8 A;  2ZPN A;  4AJW A;  1RFA A;  2KK8 A;  1P1A A;  3CST A;  4AP4 C;  1IPG A;  1SIF A;  3QAQ A;  3PVL A;  4TQ0 A;  1S3S G;  1C1Y B;  1UGM A;  4HXD A;  4A20 A;  3RT3 B;  2R2O A;  4LJO B;  4GIV A;  5E6N A;  1GC6 A;  4W9H A;  3UIO B;  2RPQ A;  3DBL I;  4II3 B;  2LGD A;  3WA0 A;  2VRR B;  3JVZ X;  2KJH B;  2LVO A;  2O6V D;  4K81 A;  4MSQ B;  2O6V A;  2XBB C;  2CR5 A;  3TIX A;  2Z0D B;  4JLC A;  4DHZ B;  2KTR B;  1AAR A;  5AZG A;  4FHJ A;  1MG8 A;  2JPH A;  1H8C A;  3CF6 E;  3P2B A;  3IHP C;  1WXA A;  4F8C B;  2M1M A;  4N9F 4;  3U7D A;  2O6V B;  2BYV E;  5AZF A;  2MBQ A;  3QWZ B;  3W1S C;  2OOB B;  4MGY E;  3T8M A;  1WXM A;  4KDI C;  5EDS A;  1WFY A;  3KYD D;  4W9L A;  2GMI C;  4PS8 A;  4ZRI A;  3RD2 A;  1Y8R C;  3JSV B;  2N7D A;  4GXB A;  1UH6 A;  4JIO U;  2J0J A;  1OGW A;  1YX5 B;  1WIA A;  4GN1 A;  1KM7 A;  3QIJ A;  5KHQ A;  1WGY A;  2FID A;  4XX5 A;  4EZK A;  2CS4 A;  3L08 A;  3AU5 A;  1UZX B;  1WJ6 A;  3OJ4 B;  3WAL A;  3A33 B;  1LQB A;  3HM3 A;  1YD8 U;  2JVC A;  2IY1 B;  3PRZ A;  2JXX A;  4W9F A;  2M17 A;  4E71 A;  3SU8 X;  4KSL C;  4BFR A;  3UGB B;  2DYB A;  4NAW A;  4A3O A;  4FLH A;  1EF1 A;  2L8J A;  4FN2 A;  2YLM A;  3AU4 A;  3KUZ A;  3PLV A;  2A4Z A;  2BKF A;  3HHM A;  3ZRC A;  4JQW C;  4XC2 A;  3PSE B;  2IY0 B;  2L0F A;  2ZCB A;  3OJ3 A;  4KZ0 A;  3VFK A;  2WYQ A;  1OQY A;  2LAS A;  3GOE A;  4DHJ B;  2K8H A;  4WJQ A;  3DPD A;  1WY8 A;  4LDT B;  4DDG D;  5AZH A;  3TMP B;  4TKN A;  2KWV B;  1E90 A;  3D32 A;  3N3K B;  1P3Q U;  2MBE A;  1XD3 B;  2JRH A;  3L10 B;  5J2R A;  3NOB A;  4DDI D;  2GBM A;  3LDZ E;  1WR1 A;  1TZ1 A;  2ZJD A;  3A9K B;  3L0W B;  4NQL B;  4AOF A;  2KQS A;  1I42 A;  1E7U A;  4M8M A;  3L16 A;  1WX9 A;  4AJY B;  2C7N B;  4NPN A;  2I1J A;  2JRI B;  4GDK B;  4CHK A;  1WJ4 A;  3ZDT A;  3ML9 A;  3ZTD A;  2Y5B B;  1OEY A;  4GU2 A;  4I6L B;  4HK2 A;  3UQA A;  5FR6 A;  1LFD A;  1K8R B;  2K8B A;  5IA7 A;  2IYD B;  3SD5 A;  1KLV A;  2HE7 A;  3RZW C;  1H4R A;  2DZI A;  2OJR A;  2REX A;  1I35 A;  1EO6 A;  3H6N A;  2MRP A;  1U4A A;  3PGE A;  3A9J A;  5D94 A;  5L83 A;  3NY5 A;  2ZVN A;  4LJP B;  1SGH A;  3PPA A;  1IYF A;  3DQV A;  3O65 B;  1EUV B;  5D6J B;  4K7W A;  4BKS D;  3KW5 B;  1IP9 A;  4BKS A;  1WMH A;  3VDZ A;  2WX0 A;  1Q0W B;  4TQ1 A;  3UIN B;  2M0X A;  2LVP A;  4B6W A;  1WJU A;  5CHV C;  3VTW A;  2K6Q A;  3AI5 A;  2I1K A;  3B0A A;  4W9K A;  4WJN A;  2G4D B;  3VTU A;  1RRB A;  4E3C A;  3QJZ A;  3M3J A;  1LM8 B;  5J17 A;  1VD2 A;  5E6O A;  1WGH A;  2DEN B;  2K1F A;  4E74 A;  3M95 A;  4GDL A;  4ANU A;  3S2A A;  4EZJ A;  1V2Y A;  2BYF A;  2ZPY A;  4G11 A;  2BWE S;  2LXC A;  1CMX B;  3IBE A;  1WYW B;  1E5W A;  1M94 A;  2BYE A;  1GNU A;  4P7I A;  1ZKH A;  5CHW A;  5C23 A;  2KAN A;  5GMV A;  4WWP A;  4MM3 A;  4EKU A;  4XZ4 A;  4KV2 A;  1ISN A;  2ZZP B;  1OTR B;  3QAR A;  3WAM A;  4DK5 A;  3MHS D;  2YVC A;  4X57 B;  2J7Q B;  1YIW A;  2DX5 B;  2K8C A;  2V1Y A;  2DZM A;  5DCN A;  3RUI B;  2LXA A;  3ZUN A;  4MEM A;  2RGF A;  1GC7 A;  3ZNI D;  1V5O A;  1WRD B;  4OVV A;  3KYC D;  2KWU B;  3A4S C;  3PRE A;  2KMA A;  2D07 B;  2NPT A;  3TJP A;  4IM0 A;  4I6P A;  5JH5 C;  3BIN A;  4NJ6 A;  4EZL A;  4BKG A;  3PLU A;  5E6P A;  2CHZ A;  3DVN V;  2KZR A;  1Z5S B;  4KIK A;  3VUX A;  2IO1 B;  1G6J A;  3MJW A;  4WQO B;  5IAA C;  1WJN A;  1FXT B;  2KD0 A;  3RZF A;  4W9G A;  3DBS A;  4MJS A;  3WAN A;  3M63 B;  2N9E B;  4ICU A;  4HDQ A;  2MQJ A;  2AYO B;  3EC8 A;  1V86 A;  3PHX B;  3WIM A;  3IFW B;  2MWS B;  5LLI A;  3HM6 X;  3Q3J A;  3RUL A;  4WAA A;  5L95 C;  3A1Q A;  4HJK A;  2JF5 A;  4FA6 A;  4FBJ B;  2N7E A;  3C0R B;  3JW0 X;  2K6D B;  3ZTC A;  4A3P A;  3EFU A;  2BWF A;  4ANX A;  1VCB A;  3CSF A;  2NR2 A;  3ONS A;  4WWN A;  2L00 B;  3APD A;  4BOS C;  2GOW A;  3HK0 A;  2NBU A;  3H1U A;  3V61 A;  3QC8 B;  3ZW3 A;  4GB9 A;  4I6N B;  4ANW A;  2KN5 A;  4CO7 A;  2L7R A;  4NNJ B;  4J6I A;  3UIP B;  2LUE A;  2ZNV B;  4HCN B;  3IG3 A;  4M8N A;  2KDI A;  2HTH A;  1OEY J;  3ZNG C;  4NY0 A;  4NAW B;  4MGZ E;  1Z2M A;  2CHX A;  2EKE C;  3QCA A;  2KXJ A;  1BT0 A;  4EFO A;  2KLC A;  2WX1 A;  3NS8 A;  2KJ6 A; 
#chains in the Genus database with same CATH topology
 1FMA D;  3QQ8 B;  3ZO5 B;  3T3O A;  4ZYN A;  2JZ3 B;  4FJY A;  2MA9 B;  1V80 A;  4HKQ A;  1E0Z A;  1TT5 B;  4W9D A;  1RYJ A;  2NTS A;  2ZEQ A;  3PHW B;  1OQQ A;  2NCN A;  1PUT A;  5D2M B;  3ZNH B;  5IKC M;  1I4X A;  2G45 B;  4FHK A;  2UWQ A;  2KFK A;  2PE9 A;  4RH6 A;  2K0P A;  3Q3M C;  3KH0 A;  1KOT A;  1TS3 A;  1VJK A;  4GMV A;  1FRD A;  3NVY A;  4BBN C;  4KDL B;  3H8H A;  3DBH B;  4S0R A;  1DOX A;  2DYO A;  1PGB A;  3TEW A;  2WQY B;  3W9C B;  2QCZ A;  1E8W A;  3GZN I;  3NVZ A;  2KDM A;  3T3N A;  4CQN A;  1T6B X;  1NI2 A;  1WX7 A;  3MHZ A;  3R66 C;  2LWP A;  2KLG A;  3VVW B;  2DAF A;  2BYT A;  3PO0 A;  1I7H A;  2N9X A;  3DVN U;  4RF1 A;  3VQI A;  3PT2 B;  2KQ7 A;  1P98 A;  2JY6 A;  1XF5 L;  2E3T A;  4JWS C;  4HLE A;  3RCZ A;  2KMC A;  2FE8 A;  4MM3 B;  5HHD G;  4BOZ B;  3W1S A;  4WUR A;  1SE9 A;  1TS4 A;  1ESF A;  3BYY B;  4ZRJ A;  4ARI A;  3MC8 A;  2Y5C A;  1ZDV A;  5JHA A;  2ZCC A;  4HPM B;  2EMT A;  5TSS A;  2N4F A;  1XT9 B;  1MI0 A;  1Q10 A;  2IZV B;  4FXC A;  1WX8 A;  4M01 A;  3KQ4 A;  1AYF A;  3UQB A;  5J18 A;  1TIF A;  4YWG G;  1R4M B;  4F7Z A;  3Q3F A;  3JSV A;  1SF0 A;  3NS1 A;  2KVZ A;  3GE3 C;  3CIR B;  2QIL A;  3C8Y A;  2OHF A;  1ET6 A;  1FIQ A;  1UBQ A;  1HZ5 A;  1WM2 A;  3AH7 A;  4B95 A;  3A1Q B;  3DBL B;  3R8B A;  3CWI A;  4JE3 B;  3AE7 B;  1TBE A;  1WE6 A;  3U8Z A;  4HWI B;  2WNM A;  3MTN B;  2KOX A;  2C7M B;  3HUI A;  2LMC A;  2N1V A;  3V60 A;  3X0W A;  3RMK C;  3ZGZ A;  2IGH A;  3AED B;  4IKG A;  3AE4 B;  4NZL B;  4W9J A;  2EMS A;  3Q3O C;  1WI0 A;  2WXN A;  4IOI E;  1DOI A;  1TTN A;  1WWT A;  3ZIM A;  2X8X X;  1YQ4 B;  3ZDM C;  2INP E;  5JZE B;  5EE0 A;  1QZE A;  4WJO A;  4ZRQ A;  2KC1 A;  1UUP A;  1WH3 A;  5BMH A;  5AEK B;  2V0G A;  3R3M A;  3WAO A;  1WGK A;  3H9D A;  2LGX A;  3FAH A;  2AL6 A;  2J0K A;  2KNB A;  2Z59 B;  4ANW A;  1V1O A;  1XXG A;  1YMH E;  2ZW1 A;  4KVG B;  3SDL C;  2VH1 A;  3AE9 B;  2KJR A;  4HPL B;  2LD9 A;  3DWG C;  3SFE B;  1BUI C;  2KX3 A;  2L76 A;  3ZJU A;  1JQ4 A;  3TCA A;  2NVU I;  3RI7 C;  1GG3 A;  3LYY A;  4IWP A;  4W9E A;  3BK1 A;  2W54 A;  3MC9 A;  4WWO A;  3PTF C;  5FKA C;  5BYS A;  3IVF A;  5KHO A;  2KC2 A;  2ZPN A;  1MJD A;  1M4V A;  4RFB A;  1P1A A;  4JPS A;  3PVL A;  1SXT A;  3FIL B;  4HXD A;  4A20 A;  3P4R B;  2LGS A;  2R2O A;  4LJO B;  3R2T A;  4II3 B;  4LNF A;  2LVO A;  4MSQ B;  1D5X C;  2O6V A;  1WXQ A;  1JWS D;  4YSX B;  3RPF C;  1AAR A;  1MG8 A;  1ZXI A;  2V3N A;  3BVM A;  3P2B A;  4LNO A;  3U7D A;  2O6V B;  2MBQ A;  3QWZ B;  2OOB B;  3AEE B;  3TEZ A;  2GMI C;  4PS8 A;  1SIJ A;  1UH6 A;  1OGW A;  5T8I A;  1KM7 A;  5KHQ A;  3B2G A;  4N58 A;  3N1X C;  3WAL A;  3HM3 A;  1JWM D;  1BML C;  2JVC A;  4KSL C;  2DYB A;  3ZJV A;  3VR8 B;  1JWB D;  3KUZ A;  2A4Z A;  3HHM A;  1MHH E;  2QEJ C;  1K51 A;  4XC2 A;  2HJ1 A;  1OQY A;  1N63 A;  1C4P A;  2K8H A;  4LDT B;  5AZH A;  3TMP B;  1VLB A;  2Y3A A;  1E90 A;  5IOI A;  1F0Z A;  5H92 C;  5J2R A;  2BW2 A;  3LDZ E;  1TZ1 A;  4NQL B;  3E56 A;  1ZUD 2;  2JRI B;  4GDK B;  1RFK A;  3V05 A;  4ZYS A;  1JRO A;  3ML9 A;  3ZTD A;  1HTO A;  5FR6 A;  1LFD A;  1K8R B;  3W5U B;  3SD5 A;  2HE7 A;  1EU4 A;  1H4R A;  2DZI A;  1EO6 A;  4TSS A;  1U4A A;  5L83 A;  4MAC A;  1IYF A;  5D6J B;  1WMH A;  1VDV A;  2WX0 A;  1Q0W B;  1N5X A;  4TQ1 A;  1F2R C;  1SE3 A;  5CHV C;  1CQV A;  3FKY A;  3KLS X;  2I1K A;  4ARC A;  4WJN A;  2WLB A;  2VZK B;  2W3R A;  4M00 A;  1YN4 A;  1L0V B;  1P7E A;  4A55 A;  4M0W A;  3S2A A;  4EZJ A;  2BYF A;  2AQ1 B;  3IBE A;  2BWE S;  2LXC A;  1CMX B;  1WYW B;  2D3A A;  2BYE A;  5HI1 A;  2WP9 B;  2E6X A;  1SE2 A;  1ISN A;  1OTR B;  2JYE A;  3QAR A;  4HRS A;  2DX5 B;  2K8C A;  3ZUN A;  1FRR A;  4MEM A;  1GC7 A;  1V5O A;  3KYC D;  3RNF C;  2KMA A;  1UWM A;  1FFV A;  4OVZ A;  3TJP A;  4C56 C;  1TZO A;  3ETR A;  5E6P A;  1Z5S B;  2IO1 B;  3ZYY X;  1G6J A;  3VUX A;  2KD0 A;  3DBS A;  4HDQ A;  4KX6 B;  2MQJ A;  1FXI A;  3RUL A;  1QF6 A;  2YEP B;  4WAA A;  3I63 C;  4FBJ B;  3AEG B;  4A3P A;  3JW0 X;  2DWQ A;  1VCB A;  2NR2 A;  1CK1 A;  4BOS C;  2GOW A;  2WS3 B;  2NBU A;  4I6N B;  2L7R A;  3IG3 A;  2HTH A;  5GXG B;  1DYQ A;  1BT0 A;  3LXF A;  4EFO A;  2WX1 A;  1VR9 A;  2ZNV C;  2FCM A;  1N5W A;  3VTV A;  3NHE B;  4OVU A;  5BO4 B;  1D6E C;  2WXF A;  1NYQ A;  3APF A;  4OHJ A;  1TY0 A;  2MSE D;  2IGG A;  2W82 A;  2PW9 A;  4L2Y A;  2IO3 B;  4TUU A;  4RM8 A;  2L52 A;  3HIZ A;  3L17 A;  4PYZ A;  5HKH A;  4P1C C;  2BT6 A;  3VAW A;  4DHZ E;  2WXJ A;  4LTU A;  5BYR A;  2IBI B;  2PPH A;  2CU1 A;  2MJ3 A;  1GJZ A;  3VXW A;  3DCG A;  2KMM A;  2D10 A;  1FNV A;  5C1Z A;  3PV1 A;  4RF0 A;  1TS2 A;  2FIF A;  3L54 A;  5FR3 A;  2KX0 A;  4ICV A;  3ALB A;  4II2 B;  3RNB C;  3AE5 B;  3EHV A;  2GI9 A;  5JHB A;  2LRW A;  1WXS A;  2PLP A;  3Q8F A;  4JGH B;  2DZJ A;  2FCN A;  4PS7 A;  3NVV A;  5AUI A;  3APC A;  1E6E B;  3EFC A;  4GDL B;  1E8Y A;  1V6E A;  4ASW C;  4G3X B;  4YL8 A;  4HPP A;  3WAP A;  2C5L C;  4MSM B;  3ML8 A;  1WGD A;  3T9L A;  1PGA A;  4LNK A;  1D3Z A;  2WGS A;  1JWU D;  2L05 A;  3NZS A;  1HE8 A;  2FUH B;  4B0M A;  2M4N A;  2NPT B;  2OED A;  3PRM B;  3ZNZ B;  4IC7 B;  2B76 B;  5CX3 A;  3SHQ A;  4RMA A;  4KIK B;  3N20 C;  2G4S A;  2M8S A;  2FCS A;  1ZDX A;  4UDU C;  2MLB A;  4OZA A;  3M62 B;  1CZP A;  3KUD B;  3AXC A;  3AUL A;  1V5T A;  5CHF A;  1LXD A;  2BB6 A;  3V6C B;  1QOA A;  1JAL A;  1WR6 E;  1F1H A;  1A5R A;  4LK0 M;  3HVD A;  2D11 A;  3I3T B;  2N9K A;  2IO2 B;  2BKR B;  4RNA A;  3RYT A;  3R7Q A;  1T0R C;  3N30 A;  2B3A A;  3GP7 A;  4DHJ D;  2MEK A;  1PQS A;  4YTN B;  3AB5 A;  3DBH I;  2LZ6 A;  4JX1 C;  4FAD A;  2AQ3 B;  4BKT A;  1L4D B;  2EEL A;  2XEW A;  4IWO A;  2JT4 B;  1FO4 A;  3QA8 A;  3L13 A;  2INC C;  2M56 B;  4WJP A;  4OZC A;  1KLU D;  3ENE A;  1L2N A;  2MBO A;  4KGS A;  3VR9 B;  2KFK B;  4AUQ C;  1DOY A;  2CKH B;  4BZA A;  3U30 A;  2BS4 B;  4FUL A;  1L5P A;  4MGK E;  1HTQ A;  2WXI A;  5LNK 1;  4ZDV A;  1JRU A;  2NBV B;  3U7Z A;  5DPW A;  2QJL A;  2LGY A;  3RNC C;  2LRU A;  4ZRK A;  1P7F A;  4ANV A;  4LCD E;  2AWT A;  2PTL A;  1FM0 D;  3IAS 1;  3C19 A;  3VH3 B;  2RR9 A;  1FPY A;  2Z8L A;  3BYT B;  4REZ A;  3B08 A;  4FJV B;  2NBW B;  1WGR A;  1P9D U;  3DDC B;  2Z0E B;  1R4M I;  4YXD B;  2ZVO A;  5DPS A;  1C78 A;  2KK8 A;  2IDY A;  3CST A;  2RDG A;  4TQ0 A;  1S3S G;  1QOG A;  1UGM A;  5E6N A;  1GC6 A;  2RPQ A;  3DBL I;  1TYG B;  2LGD A;  3WA0 A;  2KJH B;  1XEE A;  4ACF A;  3MC0 B;  2W3S A;  1L0X B;  2ICI A;  5AZG A;  4FHJ A;  2K5P A;  1RM6 C;  1VZ6 A;  4F8C B;  2HTM E;  3Q6B A;  1N62 A;  2BYV E;  5AZF A;  2RDB C;  2LFI A;  1PFD A;  5EDS A;  1WFY A;  3KYD D;  2RMM A;  4W9L A;  3NUH B;  1FXA A;  5E6J A;  3IXS A;  2LUM A;  3JSV B;  4GXB A;  2JYT A;  1ZPS A;  2WXQ A;  1FNW A;  1NYR A;  3QIJ A;  1WGY A;  2FID A;  3IT6 B;  4XX5 A;  1IBX A;  3L08 A;  4OW0 A;  1UGJ A;  1LQB A;  1PYW D;  2IY1 B;  2JXX A;  4E71 A;  2NTT A;  3SU8 X;  1GAQ B;  3UGB B;  4NAW A;  4FLH A;  4FN2 A;  2YLM A;  3AU4 A;  1L6U A;  2IY0 B;  2L0F A;  3OJ3 A;  5C2T B;  3VFK A;  3GOE A;  4OZB A;  4WJQ A;  1WY8 A;  1XLN A;  4LNI A;  2FBW B;  3Q8A A;  2KWV B;  3AE3 B;  3D32 A;  3N3K B;  4J3O D;  2MBE A;  2INN E;  3NOB A;  2GBM A;  1JW9 D;  3L0W B;  2XN9 C;  4AJY B;  4CHK A;  4NPN A;  2K8B A;  2IYD B;  4N6E B;  3RZW C;  3H6N A;  4AQ7 A;  1TKY A;  3PGE A;  3A9J A;  1SGH A;  3AEB B;  2BS2 B;  3KWL A;  2H88 B;  2L32 A;  4L1B A;  3UIN B;  4DXG A;  3AI5 A;  2KAJ A;  4W9K A;  3VTU A;  3M3J A;  1KF6 B;  1FEH A;  1FCC C;  1VD2 A;  5E6O A;  3NVW A;  1V8C A;  2K1F A;  3NJT A;  4E74 A;  1HEZ E;  1V2Y A;  4US8 A;  4G11 A;  1XCT L;  4P7I A;  3ZLZ A;  1M94 A;  5C23 A;  5GMV A;  4KV2 A;  2ZZP B;  3PZ8 A;  3TEX A;  3MHS D;  4X57 B;  1ACC A;  3B9J A;  4ZHP A;  1YIW A;  2V1Y A;  3RUI B;  4L23 A;  1EM7 A;  3ZNI D;  4OVV A;  2GB1 A;  3A4S C;  4ZHO A;  3PRE A;  2R61 A;  4IM0 A;  5JH5 C;  4NJ6 A;  3DVN V;  1DGJ A;  2PVO D;  4C00 A;  4WQO B;  1I4G A;  3RZF A;  4W9G A;  4MJS A;  1ZP0 B;  3M63 B;  5FK9 C;  1UNS A;  2AYO B;  3PHX B;  3WIM A;  4XDD A;  3IFW B;  4MT5 A;  1GPX A;  2L1A A;  5EE3 A;  5JXV A;  4IDI A;  4HJK A;  2JF5 A;  2N7E A;  1I4R A;  2K6D B;  3EFU A;  3P4S B;  4P16 A;  4P6V F;  3ONS A;  2LGI A;  1YQ3 B;  3H1U A;  3V61 A;  3QC8 B;  3E9S A;  4A9A A;  2KDI A;  1OEY J;  4A6Q A;  3R2I A;  4NY0 A;  1YNT E;  4MGZ E;  1Z2M A;  2CHX A;  3ABV B;  4C7Y A;  2RSU A;  1J7C A;  3ZXV A;  2BQQ A;  2FCQ A;  4RGN A;  1V1P A;  1WM3 A;  5BMG A;  3DOW A;  1E10 A;  1B9R A;  2MH7 A;  4PT5 A;  2JU6 X;  2O2V A;  5D7G A;  3UI3 A;  2V3S A;  1WSP A;  1HQR D;  1NVI D;  4JWU C;  4RGM A;  3NZU A;  5LXI B;  2UYZ B;  3H7P A;  2C9W B;  3RFZ B;  4KKI A;  4DBG A;  2G3Q B;  2CJO A;  2MX2 A;  4AWJ A;  2SEB D;  3PZ7 A;  1NEN B;  2JWU A;  2WU2 B;  2WU5 B;  1VZ7 A;  3ZJT A;  2JZZ A;  2WXH A;  1L7Y A;  1GUA B;  1PGX A;  1R4N B;  2NMQ A;  1I4Q A;  1YQB A;  4NJC A;  4HDO A;  1J19 A;  2PMV A;  1WMH B;  1Y56 A;  4PK1 A;  4DXF A;  4MH8 A;  4GGQ A;  3CMM B;  1JRP A;  2JQR B;  2EKI A;  3ECI A;  1P0R A;  2XK5 A;  4JL9 A;  3TSS A;  4KZC A;  1T0Y A;  4K7S A;  1EWC A;  4IG7 B;  2FUG 1;  4BAX A;  2D3G A;  2LJI A;  1EF5 A;  2G1E A;  4M0W B;  2DZK A;  1WGG A;  2DHZ A;  4RCO A;  1JWA D;  1FD6 A;  3DBR I;  3MJ5 A;  3VRA B;  1J8C A;  1YOV B;  3QHT A;  2LJ5 A;  4ZOH C;  1KTK A;  4WH4 A;  2BS3 B;  1Q5W B;  2BGF A;  2KTR A;  3QX1 A;  2V3P A;  2KHW B;  2LHD A;  1C4C A;  2R2Q A;  1B1Z A;  2MCN B;  1C3T A;  2M19 A;  3B1L X;  4K7U A;  5DPR A;  3A4R A;  3BY4 B;  3OWE B;  3DBR B;  1AWD A;  4LNN A;  2C7H A;  1ZGU B;  4GLS C;  4MEL A;  4MDK E;  4S17 A;  2WXM A;  3P63 A;  2OJW A;  2IGD A;  3W1Y A;  2K39 A;  2LEK A;  3VHT C;  1LGR A;  1XLQ A;  5G2N A;  4MGI E;  2D5G A;  2QC8 A;  2RDH A;  1NBF C;  1WF9 A;  1FFU A;  4NQK E;  3N32 A;  4YTM B;  2ZW0 A;  5LXH A;  5AUK A;  2WHI A;  2HD5 B;  2W9N A;  3GB1 A;  4LDT D;  3AE6 B;  2MHJ A;  1XQQ A;  1ZW7 A;  3LJ3 A;  3BVZ A;  2LVQ A;  2J0M A;  2K22 A;  4HKZ E;  3A9K A;  3ZQ4 A;  1F9J A;  1E8Z A;  1UEL A;  3KWV A;  3V6E B;  4C7Z A;  2L83 A;  2KKC A;  2BPS A;  2C60 A;  2G9H D;  4G0N B;  4O1N A;  2JX5 A;  3OAW A;  4US9 A;  3DHH C;  1X1M A;  3W5V B;  2XNA C;  2PJH A;  4C4V A;  4C80 A;  2RD0 A;  2WXP A;  4WAF A;  2I38 A;  2KFJ A;  4PS3 A;  2KDB A;  1ZE3 D;  3AE2 B;  2VZK D;  1YJ1 A;  3LB8 C;  2WWZ A;  1WZ3 A;  4HRO A;  3VH4 B;  4CYE A;  2GBK A;  4F1S A;  1WXV A;  1V9J A;  4XWW A;  3MFG A;  1QOF A;  1I4P A;  2D2Q A;  2GBR A;  2HJ8 A;  1AW7 A;  1RFA A;  4AJW A;  3B2F A;  3J9C A;  4AP4 C;  2K9X A;  1SIF A;  3BVG A;  1IGC A;  3AN1 A;  3RT3 B;  2WXO A;  1KH0 A;  4W9H A;  3UIO B;  2UU7 A;  3JVZ X;  2PKO A;  4K81 A;  2XBB C;  2CR5 A;  4LLG M;  3N9Y C;  1N60 A;  3TIX A;  2JPH A;  1H8C A;  3CF6 E;  3W2D A;  1WXA A;  1L4Z B;  2M1M A;  1BXT A;  4N9F 4;  1E9M A;  1HA5 A;  3EUB 2;  4WQM A;  4MGY E;  4ZRI A;  3RD2 A;  1YJI A;  2I2Y A;  5MPO A;  4WIP A;  4JIO U;  4GN1 A;  1MG4 A;  2CS4 A;  1UZX B;  4XE0 A;  3OJ4 B;  3A33 B;  2VH2 A;  4XYC A;  3L4P A;  2M17 A;  4A90 A;  5G5H A;  3SR6 A;  4BFR A;  4A3O A;  5IO9 A;  1XLP A;  3SFD B;  1EF1 A;  2L8J A;  3PLV A;  2BKF A;  2GRI A;  3TUO A;  4JQW C;  1F2R I;  4RGT A;  2ZCB A;  2WYQ A;  2LAS A;  4EE2 A;  3DPD A;  4DDG D;  2M0A A;  4TKN A;  2W55 A;  1NEK B;  2SAK A;  2JZP A;  2ONQ A;  2JRH A;  3OG5 A;  1N6Z A;  3L16 A;  2C7N B;  2I1J A;  3AEC B;  1WJ4 A;  3ZDT A;  1HZ6 A;  2Y5B B;  4GU2 A;  4I6L B;  4HK2 A;  3UQA A;  3NRZ A;  1TKG A;  4H2A A;  4KGR A;  2MJE A;  2WXR A;  3NG0 A;  2REX A;  1I35 A;  2KWD A;  2Q5W D;  3NY5 A;  4LJP B;  3DQV A;  3O65 B;  1EUV B;  4BKS D;  3KW5 B;  2JXT A;  1SE4 A;  2M0X A;  4B6W A;  1WJU A;  2K6Q A;  3B0A A;  1YN5 A;  3QJZ A;  1L6V A;  1MFW A;  1WGH A;  3M95 A;  4YSZ B;  1E5W A;  3TL5 A;  1XCQ L;  4HEA 1;  4WWP A;  4MM3 A;  2AQ2 B;  2PIA A;  3GE8 C;  4YT0 B;  1J7B A;  3WAM A;  1HXY D;  2YVC A;  2J7Q B;  3AV8 A;  5DCN A;  4KKJ A;  2DZM A;  4KGT A;  2DNF A;  1SEB D;  2D07 B;  1K50 A;  4I6P A;  3BIN A;  5H8Y E;  3GZN B;  3FC4 A;  3PLU A;  2CHZ A;  2KZR A;  1QT9 A;  1GOZ A;  3AEF B;  4EKU A;  5IAA C;  1FXT B;  3HVZ A;  2N9E B;  3RNE C;  3HM6 X;  3Q3J A;  1LO5 D;  4K3C A;  4TMA B;  2J42 A;  1CJE A;  3A1Q A;  4XWT A;  3IT4 B;  3P4Q B;  3C0R B;  3URY A;  3ZTC A;  4WWM A;  2BWF A;  4ANX A;  3ZXR A;  1IBX B;  4R3D A;  3AM9 A;  2QDF A;  4WWN A;  3HK0 A;  1MVK A;  3ZW3 A;  4CO7 A;  3AEA B;  1I4H A;  4NNJ B;  1ZXH A;  2LUE A;  2ZNV B;  4HCN B;  4M8N A;  4NAW B;  2J52 A;  2KLC A;  3EGR A;  1FCL A;  2RPV A;  3NS8 A;  2KJ6 A;  4B0E A;  3P4P B;  2V4I B;  3PRP B;  4USA A;  1SBB B;  1YN3 A;  3QK0 A;  1WE7 A;  1PDX A;  3I9V 1;  4FJZ A;  2KN4 A;  3GS2 A;  3UF8 A;  4HVB A;  2GBJ A;  2MW5 A;  3VUW A;  3JYU A;  3KVF B;  2MP2 A;  2JSV X;  2CU3 A;  1UBI A;  4GOC A;  1RAX A;  2N1W A;  4IM2 A;  4DWF A;  1A70 A;  2MP2 B;  1T5X D;  4IW0 A;  2N9P C;  1V97 A;  2WXK A;  4TV3 A;  3A9J B;  4FA6 A;  3KUC B;  2L3Z A;  4HCP B;  2NS5 A;  4IM3 A;  4W9C A;  4B9K A;  3DVG Y;  2ASQ A;  3DHI C;  5TR5 A;  3BWU D;  2WDT B;  1C79 A;  2L0T A;  1EU3 A;  2IO0 B;  3RNG C;  1N61 A;  5IP4 D;  2KAC A;  3O13 A;  3Q3N C;  1F52 A;  2J53 A;  4MH0 E;  1KJT A;  1E7V A;  3DVG X;  2CHW A;  5IN7 A;  3MP9 A;  3FIL A;  2N9L A;  3VUY A;  2AL3 A;  1TGZ B;  1VZ8 A;  1E7P B;  3PZD A;  2PE6 B;  1C4A A;  4M02 A;  2K3U A;  3PS6 A;  3BII D;  3ZKJ C;  4DXA B;  1GB4 A;  3VRB B;  3Q8C A;  1UD7 A;  2BF8 B;  2WXG A;  4EUT A;  2IJ0 A;  1WZ0 A;  2V4L A;  3X23 A;  1OQR A;  4MJS B;  2A5U A;  2KDF B;  3RN9 C;  2FAZ A;  4EOY A;  2WXL A;  4IWQ A;  4EEW A;  3EEC A;  1Q1O A;  3AE1 B;  2DBY A;  2WDR B;  1SJE D;  1YX6 B;  4BVU C;  3AE8 B;  3OLM D;  4W9I A;  5BYQ A;  5I4D A;  1T3Q A;  2WDQ B;  3TBL D;  1TY2 A;  3ZRF A;  2DLB A;  3K9P B;  4G50 A;  2LI5 A;  4XGA B;  1IUE A;  1QKZ A;  1V49 A;  1NDD A;  2AX5 A;  2KO3 A;  3SEB A;  1V81 A;  2KDE B;  5C3J B;  2KVR A;  3Q2A C;  4IUM B;  1R4N I;  1RWS A;  1XO3 A;  4PYU A;  2JWZ A;  2PEA A;  4BBN F;  4KSK C;  2N7J A;  2JUO A;  1K52 A;  1T0S C;  1V1P B;  1RLF A;  2MBH A;  5G55 A;  1E8X A;  4GDK A;  1S1Q B;  2O2V B;  2PVG C;  3H7S A;  3Q69 A;  4K1R B;  2MJD A;  1ROE A;  2FNJ B;  2AEH A;  4GSW A;  3H7P B;  4RM9 A;  2GBN A;  2IND C;  2K25 A;  3TEY A;  1IGD A;  3V62 A;  5DPT A;  1YJJ A;  3ZVV A;  2BTE A;  4URK A;  5CTR C;  3N1Y C;  2QSD A;  2KTF A;  2DAJ A;  2KWC A;  5EE1 A;  1J0G A;  2MBB B;  3R7R A;  2X38 A;  4RGO S;  2QHO A;  1WYG A;  4QAY A;  1L0Y B;  2QIE B;  1VRA B;  4NJ7 A;  5G5G A;  5BMI A;  2V9H A;  1D5M C;  2XK5 B;  4D2K A;  3K9O B;  2DYM A;  4ITK A;  1OFF A;  1QQR A;  1STE A;  5HFY A;  3WCQ A;  4N59 A;  4ZRP A;  1IPG A;  3QAQ A;  1C1Y B;  3U52 E;  1D5Z C;  1F77 A;  4GIV A;  4HJG E;  2CJN A;  1SJH D;  2VRR B;  1MPE A;  4NAM A;  2O6V D;  2BB5 A;  3HRD D;  5D3I B;  1C77 A;  2Z0D B;  4JLC A;  4DHZ B;  3EA6 A;  2YEP F;  2KTR B;  3N1Z C;  1C9F A;  3IHP C;  2H89 B;  2QMT A;  3IAM 1;  3W1S C;  1JML A;  4XDC A;  3T8M A;  1WXM A;  4KDI C;  1D4B A;  1MHX A;  1T0Q C;  1Y8R C;  2N7D A;  2J0J A;  1YX5 B;  1WIA A;  1KFY B;  2BBC A;  1AN8 A;  4EZK A;  2D3C A;  3AU5 A;  1WJ6 A;  1K53 A;  1YD8 U;  3PRZ A;  4W9F A;  2D3B A;  2LHE A;  4Q2J A;  3Q8E A;  1GB1 A;  3ZRC A;  3V3X A;  1SB3 C;  3PSE B;  4KZ0 A;  3I5J C;  4DHJ B;  1R7S A;  2ON8 A;  2KYW A;  3AMZ A;  1P3Q U;  1XD3 B;  1TS5 A;  3L10 B;  3I57 A;  4DDI D;  2KT7 A;  4YTP B;  3Q8B A;  1WR1 A;  2ZJD A;  4AOF A;  3A9K B;  3RNA C;  2KQS A;  1I42 A;  1E7U A;  4M8M A;  1WX9 A;  1JCK B;  1OEY A;  1TKE A;  3P1M A;  2GLS A;  5IA7 A;  2ACZ B;  1KLV A;  2Y5P A;  1QIL A;  2OJR A;  2MRP A;  4A8X C;  5D94 A;  2ZVN A;  3PPA A;  1ZOY B;  4C4V B;  4K7W A;  1IP9 A;  3DWM A;  4BKS A;  3VDZ A;  2LVP A;  2IPK D;  3VTW A;  4P1B C;  3U2S C;  3P42 A;  2G4D B;  1RRB A;  4K3B A;  4E3C A;  1LM8 B;  4DQO C;  1J7A A;  5J17 A;  1NI3 A;  2DEN B;  2N0S B;  4GDL A;  4ANU A;  2ZPY A;  5CHW A;  1GNU A;  1TJE A;  1EWY C;  1ZKH A;  2BVC A;  2KAN A;  4YSY B;  4XZ4 A;  2HDE A;  4DK5 A;  5HG2 A;  2LXA A;  2RGF A;  1UF0 A;  3DHG C;  1WRD B;  5EE9 A;  2KWU B;  1ET9 A;  2NPT A;  1KRH A;  3U4E G;  2J4X A;  4EZL A;  4BKG A;  3BZD B;  4KIK A;  1SSN A;  3MJW A;  3WAN A;  1WJN A;  3Q14 C;  1KLG D;  4ICU A;  1FNU A;  3EC8 A;  1V86 A;  1UWX A;  2MWS B;  5LLI A;  1XLO A;  3NZ3 A;  5L95 C;  2WDV B;  1QOB A;  3BK2 A;  2KQ4 X;  3CSF A;  1QLB B;  2L00 B;  3APD A;  1WRI A;  4GB9 A;  2KN5 A;  4J6I A;  5D3D A;  3UIP B;  1C76 A;  1ENF A;  3ZNG C;  4AS1 A;  2EKE C;  3QCA A;  2KXJ A;  2TSS A; 
#chains in the Genus database with same CATH homology
 3QQ8 B;  3ZO5 B;  3PRP B;  2ZNV C;  3QK0 A;  2FCM A;  2FCQ A;  2JZ3 B;  1WM3 A;  4ZYN A;  1WE7 A;  4FJZ A;  3VTV A;  4FJY A;  3NHE B;  4OVU A;  5BO4 B;  3DOW A;  2MA9 B;  1V80 A;  3UF8 A;  4HVB A;  2GBJ A;  4W9D A;  2O2V A;  5D7G A;  2V3S A;  2MW5 A;  3APF A;  2MSE D;  2ZEQ A;  3VUW A;  3JYU A;  3KVF B;  3PHW B;  2MP2 A;  2NCN A;  2IO3 B;  3NZU A;  5D2M B;  2UYZ B;  3ZNH B;  3H7P A;  5LXI B;  1UBI A;  2G45 B;  4RM8 A;  4FHK A;  2UWQ A;  4GOC A;  2KFK A;  2C9W B;  2PE9 A;  4TUU A;  3HIZ A;  3L17 A;  4PYZ A;  4DBG A;  5HKH A;  1RAX A;  2N1W A;  4IM2 A;  2G3Q B;  3TL5 A;  3VAW A;  2MX2 A;  4AWJ A;  4DHZ E;  4DWF A;  2MP2 B;  2IBI B;  2PPH A;  4IW0 A;  2CU1 A;  3KH0 A;  1KOT A;  1GJZ A;  2N9P C;  3VXW A;  3DCG A;  4GMV A;  2JZZ A;  2D10 A;  4TV3 A;  3PV1 A;  5C1Z A;  4BBN C;  1L7Y A;  1GUA B;  2FIF A;  3A9J B;  3L54 A;  4KDL B;  2KX0 A;  1YQB A;  2L3Z A;  3KUC B;  4HCP B;  2NS5 A;  4ICV A;  3ALB A;  4HDO A;  4IM3 A;  4W9C A;  4B9K A;  3DVG Y;  4II2 B;  2ASQ A;  5TR5 A;  1J19 A;  2DYO A;  1WMH B;  2WDT B;  3EHV A;  4GGQ A;  1E8W A;  3CMM B;  3GZN I;  5JHB A;  2LRW A;  1WXS A;  2L0T A;  3ECI A;  1P0R A;  2XK5 A;  4JL9 A;  4KZC A;  2IO0 B;  1T0Y A;  4K7S A;  1NI2 A;  4IG7 B;  1WX7 A;  4JGH B;  3R66 C;  2LWP A;  2DZJ A;  4MH0 E;  2KLG A;  3VVW B;  2DAF A;  1KJT A;  2D3G A;  1E7V A;  2FCN A;  2N9X A;  3DVN U;  3DVG X;  4PS7 A;  3VQI A;  3APC A;  2CHW A;  3PT2 B;  1EF5 A;  2KQ7 A;  1P98 A;  4GDL B;  4M0W B;  2DZK A;  2JY6 A;  1WGG A;  1E8Y A;  1V6E A;  4ASW C;  2DHZ A;  4G3X B;  4YL8 A;  3RCZ A;  4HLE A;  3DBR I;  3VUY A;  2KMC A;  2AL3 A;  1TGZ B;  3WAP A;  1J8C A;  2C5L C;  3QHT A;  2LJ5 A;  4MSM B;  3ML8 A;  3PZD A;  1WGD A;  3T9L A;  4BOZ B;  2RSU A;  3W1S A;  1D3Z A;  1SE9 A;  2PE6 B;  4ZRJ A;  1Q5W B;  2BGF A;  2KTR A;  2L05 A;  3NZS A;  1HE8 A;  2ZCC A;  5JHA A;  2FUH B;  4HPM B;  3QX1 A;  2EMT A;  3PS6 A;  2KHW B;  2N4F A;  3ZKJ C;  1XT9 B;  2M4N A;  2NPT B;  4DXA B;  2R2Q A;  3PRM B;  2IZV B;  2MCN B;  3ZNZ B;  1WX8 A;  4IC7 B;  3UQB A;  5CX3 A;  1C3T A;  1UD7 A;  5J18 A;  3B1L X;  4K7U A;  5DPR A;  3SHQ A;  4RMA A;  3A4R A;  2BF8 B;  3BY4 B;  4KIK B;  2G4S A;  4F7Z A;  3Q3F A;  3JSV A;  4EUT A;  3X23 A;  1WZ0 A;  2M8S A;  2V4L A;  4MJS B;  2FCS A;  2A5U A;  2KDF B;  2FAZ A;  4EOY A;  2C7H A;  2MLB A;  1ZGU B;  4IWQ A;  4MEL A;  4MDK E;  3M62 B;  3KUD B;  4EEW A;  3AXC A;  3EEC A;  1UBQ A;  1Q1O A;  1WM2 A;  3AUL A;  3W1Y A;  1V5T A;  5CHF A;  2K39 A;  1LXD A;  3A1Q B;  4B95 A;  1YX6 B;  4BVU C;  3OLM D;  4W9I A;  3VHT C;  3ZLZ A;  3V6C B;  3TBL D;  1TBE A;  1WE6 A;  3U8Z A;  4HWI B;  5G2N A;  3ZRF A;  1WR6 E;  3MTN B;  4MGI E;  3K9P B;  4G50 A;  1A5R A;  2LI5 A;  2KOX A;  2C7M B;  1NBF C;  1WF9 A;  2N1V A;  3V60 A;  3X0W A;  4NQK E;  1V49 A;  2D11 A;  3I3T B;  1NDD A;  2KO3 A;  4W9J A;  1V81 A;  2IO2 B;  2EMS A;  2KDE B;  3N32 A;  5LXH A;  2BKR B;  1WI0 A;  3RYT A;  2KVR A;  3R7Q A;  1TTN A;  3ZIM A;  3N30 A;  2HD5 B;  4IUM B;  2W9N A;  2B3A A;  4DHJ D;  3ZDM C;  1R4N I;  1PQS A;  4LDT D;  1XQQ A;  3DBH I;  4PYU A;  2LZ6 A;  1ZW7 A;  3LJ3 A;  4FAD A;  2JWZ A;  2PEA A;  4BBN F;  2LVQ A;  4BKT A;  2J0M A;  5JZE B;  4KSK C;  2JUO A;  1QZE A;  2XEW A;  4WJO A;  4IWO A;  2JT4 B;  3A9K A;  2KC1 A;  3QA8 A;  1WH3 A;  1RLF A;  2MBH A;  3L13 A;  5G55 A;  1E8X A;  4WJP A;  1F9J A;  1E8Z A;  1S1Q B;  1UEL A;  2O2V B;  4GDK A;  5AEK B;  3R3M A;  3WAO A;  3ENE A;  1L2N A;  3H7S A;  4K1R B;  3H9D A;  2MBO A;  3V6E B;  2LGX A;  4GSW A;  2FNJ B;  2AEH A;  2AL6 A;  2KKC A;  2J0K A;  2BPS A;  2C60 A;  2GBN A;  2KNB A;  2Z59 B;  3H7P B;  4G0N B;  2KFK B;  4RM9 A;  4AUQ C;  2K25 A;  2CKH B;  3OAW A;  4KVG B;  3U30 A;  3SDL C;  4FUL A;  3V62 A;  5DPT A;  2KJR A;  3ZVV A;  4HPL B;  1X1M A;  4MGK E;  4URK A;  2LD9 A;  2KX3 A;  2PJH A;  2L76 A;  5CTR C;  4ZDV A;  1JRU A;  2NBV B;  3TCA A;  2NVU I;  5DPW A;  2RD0 A;  2LGY A;  2KTF A;  2DAJ A;  2KWC A;  2LRU A;  4ZRK A;  1J0G A;  4ANV A;  4LCD E;  2MBB B;  1GG3 A;  2KFJ A;  2AWT A;  4PS3 A;  3R7R A;  2KDB A;  2QHO A;  3VH3 B;  4IWP A;  4W9E A;  1YJ1 A;  2RR9 A;  4NJ7 A;  2WWZ A;  4WWO A;  3B08 A;  1WZ3 A;  4FJV B;  3PTF C;  2NBW B;  1WGR A;  3VH4 B;  4CYE A;  1P9D U;  2GBK A;  2XK5 B;  1WXV A;  3DDC B;  1V9J A;  4F1S A;  3IVF A;  2Z0E B;  5KHO A;  1R4M I;  2KC2 A;  3K9O B;  2DYM A;  2ZVO A;  2D2Q A;  5DPS A;  2GBR A;  2HJ8 A;  2ZPN A;  4AJW A;  1RFA A;  2KK8 A;  1P1A A;  3CST A;  4AP4 C;  1IPG A;  1SIF A;  3QAQ A;  3PVL A;  4TQ0 A;  1S3S G;  1C1Y B;  1UGM A;  4HXD A;  4A20 A;  3RT3 B;  2R2O A;  4LJO B;  4GIV A;  5E6N A;  1GC6 A;  4W9H A;  3UIO B;  2RPQ A;  3DBL I;  4II3 B;  2LGD A;  3WA0 A;  2VRR B;  3JVZ X;  2KJH B;  2LVO A;  2O6V D;  4K81 A;  4MSQ B;  2O6V A;  2XBB C;  2CR5 A;  3TIX A;  2Z0D B;  4JLC A;  4DHZ B;  2KTR B;  1AAR A;  5AZG A;  4FHJ A;  1MG8 A;  2JPH A;  1H8C A;  3CF6 E;  3P2B A;  3IHP C;  1WXA A;  4F8C B;  2M1M A;  4N9F 4;  3U7D A;  2O6V B;  2BYV E;  5AZF A;  2MBQ A;  3QWZ B;  3W1S C;  2OOB B;  4MGY E;  3T8M A;  1WXM A;  4KDI C;  5EDS A;  1WFY A;  3KYD D;  4W9L A;  2GMI C;  4PS8 A;  4ZRI A;  3RD2 A;  1Y8R C;  3JSV B;  2N7D A;  4GXB A;  1UH6 A;  4JIO U;  2J0J A;  1OGW A;  1YX5 B;  1WIA A;  4GN1 A;  1KM7 A;  3QIJ A;  5KHQ A;  1WGY A;  2FID A;  4XX5 A;  4EZK A;  2CS4 A;  3L08 A;  3AU5 A;  1UZX B;  1WJ6 A;  3OJ4 B;  3WAL A;  3A33 B;  1LQB A;  3HM3 A;  1YD8 U;  2JVC A;  2IY1 B;  3PRZ A;  2JXX A;  4W9F A;  2M17 A;  4E71 A;  3SU8 X;  4KSL C;  4BFR A;  3UGB B;  2DYB A;  4NAW A;  4A3O A;  4FLH A;  1EF1 A;  2L8J A;  4FN2 A;  2YLM A;  3AU4 A;  3KUZ A;  3PLV A;  2A4Z A;  2BKF A;  3HHM A;  3ZRC A;  4JQW C;  4XC2 A;  3PSE B;  2IY0 B;  2L0F A;  2ZCB A;  3OJ3 A;  4KZ0 A;  3VFK A;  2WYQ A;  1OQY A;  2LAS A;  3GOE A;  4DHJ B;  2K8H A;  4WJQ A;  3DPD A;  1WY8 A;  4LDT B;  4DDG D;  5AZH A;  3TMP B;  4TKN A;  2KWV B;  1E90 A;  3D32 A;  3N3K B;  1P3Q U;  2MBE A;  1XD3 B;  2JRH A;  3L10 B;  5J2R A;  3NOB A;  4DDI D;  2GBM A;  3LDZ E;  1WR1 A;  1TZ1 A;  2ZJD A;  3A9K B;  3L0W B;  4NQL B;  4AOF A;  2KQS A;  1I42 A;  1E7U A;  4M8M A;  3L16 A;  1WX9 A;  4AJY B;  2C7N B;  4NPN A;  2I1J A;  2JRI B;  4GDK B;  4CHK A;  1WJ4 A;  3ZDT A;  3ML9 A;  3ZTD A;  2Y5B B;  1OEY A;  4GU2 A;  4I6L B;  4HK2 A;  3UQA A;  5FR6 A;  1LFD A;  1K8R B;  2K8B A;  5IA7 A;  2IYD B;  3SD5 A;  1KLV A;  2HE7 A;  3RZW C;  1H4R A;  2DZI A;  2OJR A;  2REX A;  1I35 A;  1EO6 A;  3H6N A;  2MRP A;  1U4A A;  3PGE A;  3A9J A;  5D94 A;  5L83 A;  3NY5 A;  2ZVN A;  4LJP B;  1SGH A;  3PPA A;  1IYF A;  3DQV A;  3O65 B;  1EUV B;  5D6J B;  4K7W A;  4BKS D;  3KW5 B;  1IP9 A;  4BKS A;  1WMH A;  3VDZ A;  2WX0 A;  1Q0W B;  4TQ1 A;  3UIN B;  2M0X A;  2LVP A;  4B6W A;  1WJU A;  5CHV C;  3VTW A;  2K6Q A;  3AI5 A;  2I1K A;  3B0A A;  4W9K A;  4WJN A;  2G4D B;  3VTU A;  1RRB A;  4E3C A;  3QJZ A;  3M3J A;  1LM8 B;  5J17 A;  1VD2 A;  5E6O A;  1WGH A;  2DEN B;  2K1F A;  4E74 A;  3M95 A;  4GDL A;  4ANU A;  3S2A A;  4EZJ A;  1V2Y A;  2BYF A;  2ZPY A;  4G11 A;  2BWE S;  2LXC A;  1CMX B;  3IBE A;  1WYW B;  1E5W A;  1M94 A;  2BYE A;  1GNU A;  4P7I A;  1ZKH A;  5CHW A;  5C23 A;  2KAN A;  5GMV A;  4WWP A;  4MM3 A;  4EKU A;  4XZ4 A;  4KV2 A;  1ISN A;  2ZZP B;  1OTR B;  3QAR A;  3WAM A;  4DK5 A;  3MHS D;  2YVC A;  4X57 B;  2J7Q B;  1YIW A;  2DX5 B;  2K8C A;  2V1Y A;  2DZM A;  5DCN A;  3RUI B;  2LXA A;  3ZUN A;  4MEM A;  2RGF A;  1GC7 A;  3ZNI D;  1V5O A;  1WRD B;  4OVV A;  3KYC D;  2KWU B;  3A4S C;  3PRE A;  2KMA A;  2D07 B;  2NPT A;  3TJP A;  4IM0 A;  4I6P A;  5JH5 C;  3BIN A;  4NJ6 A;  4EZL A;  4BKG A;  3PLU A;  5E6P A;  2CHZ A;  3DVN V;  2KZR A;  1Z5S B;  4KIK A;  3VUX A;  2IO1 B;  1G6J A;  3MJW A;  4WQO B;  5IAA C;  1WJN A;  1FXT B;  2KD0 A;  3RZF A;  4W9G A;  3DBS A;  4MJS A;  3WAN A;  3M63 B;  2N9E B;  4ICU A;  4HDQ A;  2MQJ A;  2AYO B;  3EC8 A;  1V86 A;  3PHX B;  3WIM A;  3IFW B;  2MWS B;  5LLI A;  3HM6 X;  3Q3J A;  3RUL A;  4WAA A;  5L95 C;  3A1Q A;  4HJK A;  2JF5 A;  4FA6 A;  4FBJ B;  2N7E A;  3C0R B;  3JW0 X;  2K6D B;  3ZTC A;  4A3P A;  3EFU A;  2BWF A;  4ANX A;  1VCB A;  3CSF A;  2NR2 A;  3ONS A;  4WWN A;  2L00 B;  3APD A;  4BOS C;  2GOW A;  3HK0 A;  2NBU A;  3H1U A;  3V61 A;  3QC8 B;  3ZW3 A;  4GB9 A;  4I6N B;  4ANW A;  2KN5 A;  4CO7 A;  2L7R A;  4NNJ B;  4J6I A;  3UIP B;  2LUE A;  2ZNV B;  4HCN B;  3IG3 A;  4M8N A;  2KDI A;  2HTH A;  1OEY J;  3ZNG C;  4NY0 A;  4NAW B;  4MGZ E;  1Z2M A;  2CHX A;  2EKE C;  3QCA A;  2KXJ A;  1BT0 A;  4EFO A;  2KLC A;  2WX1 A;  3NS8 A;  2KJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...