2IO2B

Crystal structure of human senp2 in complex with rangap1-sumo-1
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
75
structure length
75
Chain Sequence
KLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding, hydrolase
molecule keywords Sentrin-specific protease 2
publication title Structural basis for SENP2 protease interactions with SUMO precursors and conjugated substrates.
pubmed doi rcsb
source organism Homo sapiens
total genus 9
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2006-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2io2B00
2K39A 2K6QA 4XZ4A 5LXIB 1V49A 2O6VD 2CR5A 2KMAA 3L54A 4AJYB 4GB9A 4WWNA 4F7ZA 5JZEB 3DOWA 2GBJA 3IFWB 2UYZB 2O2VB 3ZNID 2GBNA 4DHZB 1G6JA 4BOZB 2PPHA 2KTFA 3JYUA 4BFRA 4MGZE 2ASQA 2CU1A 3ZKJC 4DHJD 2AWTA 2AL3A 1YJ1A 4ASWC 1HE8A 2KZRA 4F8CB 4NQKE 3TMPB 4BKSD 5TR5A 3UQBA 1TGZB 2M8SA 3ML8A 5JH5C 3DBRI 1TBEA 3KUZA 4NY0A 3PPAA 3R7RA 4HVBA 4GU2A 3WALA 3PRMB 2JPHA 2N7EA 3BY4B 2FCMA 2ZNVC 1GC7A 3BINA 2KD0A 4ZYNA 3NHEB 1LQBA 3APDA 4MEMA 5AZGA 2ZVOA 2DAFA 2L8JA 1WX9A 2ZPNA 4ANXA 4E71A 5L95C 4URKA 3OLMD 1BT0A 3PGEA 1WMHB 4W9KA 4FJVB 4KIKA 1LFDA 1E8ZA 1V5TA 2GMIC 3ALBA 4M8NA 3H7SA 3KYDD 4G0NB 4LDTD 2N1WA 2WX1A 4I6NB 4ICUA 3UINB 3ZIMA 1J19A 4IC7B 3MJWA 3R7QA 1EUVB 1UELA 3RZFA 1WE6A 4MH0E 4NAWB 2KFJA 2CHZA 5KHOA 2KKCA 2KJHB 2VRRB 3DVGX 3KW5B 2ZCCA 4K7SA 3CF6E 3A9JA 3QARA 1Q1OA 2C5LC 3DBLI 5KHQA 2NBVB 4MDKE 5D2MB 4GXBA 1TZ1A 4LJPB 2KDBA 3PSEB 5J18A 3UQAA 4PS7A 3LDZE 2FNJB 2XBBC 3DBHI 2M1MA 2JRIB 2RD0A 2BYEA 4HLEA 2I1KA 3JVZX 4X57B 3SHQA 2KJ6A 1IYFA 1RFAA 2JWZA 4ZRIA 3RUIB 4K7UA 3T9LA 4DK5A 4GDLA 3L13A 2JUOA 1WY8A 3VTUA 1WH3A 2KLCA 2NBWB 1OEYJ 4HWIB 2KTRB 3X0WA 4DXAB 2LVQA 1WXVA 3HK0A 2IO2B 4P7IA 1EO6A 3TCAA 4MSMB 1GNUA 4G11A 3PRZA 3KUCB 2R2OA 2V1YA 5C23A 1YIWA 2K8CA 3U30A 3DVNV 4II2B 3M63B 4WWOA 5AZHA 1V5OA 1PQSA 1NDDA 2WWZA 2DYBA 2KWCA 4B9KA 2LUEA 4HXDA 3VTWA 1GC6A 3UF8A 4EUTA 3H7PB 2YVCA 4KZCA 1JRUA 4I6LB 5CHWA 1WM2A 3M3JA 4AOFA 2FUHB 1RRBA 3DBSA 2MBHA 3OAWA 4KV2A 2BWFA 2DAJA 4IWOA 4EEWA 4NJ6A 3DQVA 1OQYA 5CHVC 4EZLA 1YX5B 1RLFA 4ZDVA 4EZKA 3KUDB 2Y5BB 5JHBA 2D3GA 4FLHA 3JSVB 2DZJA 1KLVA 3QWZB 5DPWA 3W1YA 2NPTB 5CTRC 4MELA 1Q0WB 2KMCA 1WXSA 2J0KA 4HCNB 1J0GA 1UD7A 3AULA 2IO3B 2K8BA 3A4RA 3QX1A 4G50A 4WJPA 3AU4A 4BBNF 2L00B 3UGBB 2B3AA 2LZ6A 5IAAC 3RD2A 1WJUA 2NR2A 3CSTA 4JGHB 2CS4A 4ICVA 2N7DA 1XD3B 1S1QB 1V9JA 2FIFA 2O6VA 4GN1A 2LGXA 4HJKA 3U8ZA 3TJPA 2ZEQA 3K9PB 4IW0A 1P0RA 3OJ4B 3HIZA 3TIXA 2N1VA 4W9HA 2DYMA 4WQOB 2KDIA 5JHAA 2GBKA 2MSED 2C60A 2KC2A 2NS5A 3PTFC 1WGDA 1WYWB 3L17A 4HK2A 2DZKA 4PS3A 5E6NA 2WYQA 4OVVA 2FCNA 3M95A 3N30A 1WM3A 2KOXA 2N9XA 4W9LA 3IG3A 1H8CA 4TUUA 1X1MA 1WJ6A 2KWUB 4MGIE 4BKSA 1ISNA 3UIPB 4E3CA 1WGYA 2KFKB 1A5RA 5CX3A 3NY5A 3ZNGC 3HM3A 2MP2A 4WJOA 2G4DB 2MRPA 3RCZA 2LASA 2RGFA 2LRWA 2FIDA 2L3ZA 4HDOA 3WAOA 1T0YA 1P1AA 1WI0A 1Y8RC 4A3OA 2YLMA 3VHTC 2ZJDA 3APFA 2XK5B 3Q3JA 3R3MA 4FHJA 2W9NA 1MG8A 3L16A 3IHPC 3N3KB 4II3B 1P3QU 2ZZPB 1E8YA 1WIAA 3EHVA 4M0WB 1TTNA 2PJHA 1GG3A 3V60A 4OVUA 3V61A 4E74A 1L7YA 3UIOB 1R4MI 5D6JB 2UWQA 4ANWA 3ENEA 3VFKA 3A1QA 3PV1A 2KDFB 4ZRKA 1YD8U 3C0RB 1WXMA 3ZVVA 2ZCBA 4MJSB 1C1YB 5DCNA 3KYCD 3VXWA 1V81A 4NQLB 4PYZA 2CHXA 4DDID 5HKHA 4BKTA 4W9EA 3DCGA 3H1UA 1WE7A 2MA9B 2KVRA 2O2VA 1YQBA 4K1RB 4AJWA 4G3XB 4FHKA 3ZUNA 3SD5A 2XEWA 4W9CA 2RPQA 5G55A 1D3ZA 2EMTA 2NCNA 2DHZA 4BKGA 4XX5A 4RM9A 2RSUA 4HDQA 4HCPB 4JL9A 3VTVA 1H4RA 3NZUA 4NJ7A 3VH3B 3OJ3A 1E90A 3A9KB 5E6OA 2BF8B 4K7WA 1GUAB 3TBLD 2M17A 1XQQA 1WGRA 3QQ8B 2LVPA 4GSWA 2PE6B 4CO7A 3PVLA 2WDTB 4GDKB 5GMVA 4BVUC 1C3TA 5AZFA 2ZVNA 3DVNU 3RZWC 3DDCB 3IBEA 3EFUA 2IO1B 4PYUA 1KM7A 2L0TA 2IZVB 2BYVE 4XC2A 3RULA 2V3SA 1WMHA 1Z5SB 2K1FA 1OGWA 1LM8B 4W9FA 3ZDMC 1M94A 4JLCA 3X23A 3W1SC 5FR6A 4B6WA 1WXAA 4DHZE 4IM2A 4WWPA 1WR1A 4JQWC 2C7MB 3RT3B 3VAWA 4AP4C 1WZ3A 1VD2A 1Z2MA 3B1LX 4NAWA 3TL5A 4ANUA 1V6EA 1NBFC 2IYDB 4LJOB 4PS8A 2L7RA 3NS8A 2MQJA 2JZ3B 1KOTA 1EF5A 2N4FA 1OTRB 5AEKB 3H6NA 2BGFA 1FXTB 2L05A 4TQ0A 4FADA 2MBOA 4FA6A 2KDEB 1ZKHA 2KK8A 4W9GA 3HHMA 4IM3A 1U4AA 3PT2B 4WAAA 1UZXB 2Z59B 1RAXA 4GOCA 3V6EB 3VUXA 2JVCA 3D32A 3KVFB 2NBUA 2MW5A 2GOWA 3ZTDA 2D11A 4KZ0A 4EOYA 2KTRA 5G2NA 2LXCA 3ZTCA 2K25A 4TKNA 2CKHB 3Q3FA 4N9F4 5J2RA 2LVOA 2FAZA 5DPRA 2JZZA 1WJ4A 1L2NA 3PHXB 2D10A 3ML9A 1WRDB 1IP9A 3L10B 4KIKB 3EECA 1XT9B 4TQ1A 3SDLC 2MBBB 2KX0A 3A33B 4MM3A 3PS6A 5LLIA 3QJZA 4MGKE 3H7PA 4MGYE 1E7VA 2GBRA 4FBJB 2C7HA 2AYOB 2KC1A 2BKFA 4EFOA 1QZEA 5DPTA 4CHKA 2JF5A 3DVGY 4FULA 4HPMB 2LGYA 2REXA 2JRHA 2FCSA 4IWPA 1CMXB 2DZMA 3NZSA 2CHWA 2K6DB 4IM0A 3ZRCA 1VCBA 3A9JB 4WJQA 5D7GA 1WF9A 4DBGA 5LXHA 4K81A 4W9IA 1R4NI 3HM6X 3JSVA 3QAQA 4KDIC 3WAPA 3VDZA 1E7UA 2KQSA 2G3QB 2NPTA 2HJ8A 2ZPYA 4MSQB 3ZDTA 2KWVB 3VH4B 3N32A 3QCAA 2BYFA 3PREA 5EDSA 3M62B 2EMSA 2KQ7A 1UGMA 3PZDA 5J17A 4FN2A 1E8WA 2JT4B 3PRPB 1WZ0A 3T8MA 4GDLB 4IG7B 3PLVA 4KSKC 2IO0B 2M0XA 1E5WA 2JY6A 1S3SG 4IUMB 1V80A 2HTHA 2QHOA 2A5UA 2NVUI 4GMVA 4I6PA 4HPLB 1P98A 2KXJA 4A20A 2J7QB 3L08A 2KO3A 2G45B 4BBNC 1ZW7A 3WANA 2LRUA 2HE7A 2KHWB 4JIOU 1UH6A 2DZIA 3S2AA 3ONSA 2IY0B 3ZO5B 3NOBA 3PHWB 4EZJA 2V4LA 3B08A 2LXAA 1IPGA 2I1JA 2KFKA 3B0AA 3VUYA 3GOEA 3W1SA 3L0WB 4ANVA 3KH0A 3H9DA 2KX3A 1E8XA 2AEHA 2BPSA 4AUQC 2G4SA 5L83A 4FJZA 2KN5A 2Z0EB 3RYTA 1LXDA 2BKRB 2IBIB 3AXCA 2DENB 3APCA 3DPDA 2L76A 1WJNA 2C7NB 3VVWB 4B95A 4CYEA 1EF1A 2XK5A 4YL8A 2C9WB 2MBEA 2MCNB 2KANA 1WX7A 2J0MA 4GGQA 5BO4B 2KJRA 4NNJB 2MLBA 4W9DA 2Z0DB 2WX0A 2MX2A 1YX6B 3WIMA 3EC8A 1I35A 1OEYA 5D94A 2BWES 3QC8B 1WR6E 3ZNHB 2RR9A 4AWJA 3WAMA 3A4SC 2IY1B 2JXXA 3VQIA 2MWSB 2O6VB 3WA0A 2LJ5A 1WGHA 3ZNZB 1F9JA 3V6CB 2R2QA 3LJ3A 3VUWA 2D2QA 1V2YA 4MJSA 2KLGA 3I3TB 2ZNVB 1WGGA 3MHSD 3ZW3A 2EKEC 1SE9A 1V86A 3GZNI 2LD9A 1Q5WB 2AL6A 2N9PC 4IWQA 2L0FA 2DYOA 5E6PA 3CSFA 2HD5B 4WJNA 4DHJB 2OJRA 3R66C 1UBIA 1SIFA 1K8RB 2PEAA 3U7DA 4ZRJA 4NPNA 3QK0A 1J8CA 4RM8A 1I42A 1SGHA 1AARA 2A4ZA 4M8MA 3JW0X 2K8HA 2MP2B 5CHFA 4FJYA 5C1ZA 3PLUA 4KDLB 2GBMA 3A9KA 1GJZA 2LWPA 4RMAA 3AI5A 2KNBA 3IVFA 5DPSA 1P9DU 2M4NA 3QHTA 4TV3A 4DDGD 4GDKA 3V62A 2J0JA 1UBQA 3SU8X 4GIVA 2OOBB 4BOSC 3QIJA 3AU5A 2D07B 4EKUA 1KJTA 3ECIA 3ZLZA 1WX8A 1ZGUB 2LI5A 4LDTB 3QA8A 5IA7A 1WFYA 2FCQA 3O65B 2MBQA 3A1QB 2LGDA 4LCDE 2N9EB 4DWFA 4KSLC 4J6IA 4A3PA 3CMMB 4W9JA 4KVGB 1NI2A 4F1SA 3MTNB 3ZRFA 2DX5B 3P2BA 3K9OB 2PE9A
chains in the Genus database with same CATH superfamily
2PKOA 4XZ4A 2EKIA 4GB9A 4F7ZA 1D5ZC 5JZEB 3I5JC 2JU6X 2D3CA 4BOZB 2KTFA 2GI9A 5HFYA 4ASWC 1IGCA 2WXIA 5TR5A 1SEBD 4USAA 1KLGD 3ML8A 4XE0A 5JH5C 1TBEA 3R7RA 3PRMB 2JPHA 2FCMA 3BVGA 2ZNVC 1N62A 2KD0A 2X8XX 5AZGA 2CJOA 2W54A 2DAFA 4HKQA 5C2TB 1SJHD 2ZPNA 4E71A 5L95C 4URKA 1WMHB 4LLGM 4W9KA 4FJVB 1V5TA 2I38A 2WX1A 4L2YA 3J9CA 3DWGC 3EFCA 2K3UA 2KFJA 3N20C 2CHZA 1KFYB 3CF6E 5KHQA 4MDKE 2MJDA 1TZ1A 2QCZA 2WXPA 2FNJB 1ZP0B 3FILB 2BB5A 1Q10A 2AQ3B 2G9HD 4ZRIA 4K7UA 2DBYA 3L13A 2IDYA 1WH3A 1SJED 4P7IA 1EO6A 3V05A 1GNUA 1T0SC 2Y5CA 3Q8CA 4RGOS 2K8CA 2CJNA 3GE3C 4WWMA 2WWZA 4ACFA 1M4VA 2LUEA 4MM3B 3VTWA 1GC6A 3AE8B 4M01A 4I6LB 5CHWA 2V9HA 1L4DB 4LNKA 1KF6B 4KV2A 4IWOA 4EEWA 4NJ6A 1OQYA 5CHVC 1RLFA 4ZDVA 4EZKA 1TS5A 4FLHA 1WYGA 2WXGA 1KLVA 3QWZB 1JALA 2J0KA 4ZHOA 1J0GA 2B3AA 4WQMA 3Q8EA 3CSTA 3P1MA 1T6BX 1YNTE 2LGXA 4HJKA 3K9PB 3OJ4B 2RDGA 3HIZA 1QOAA 4W9HA 2DYMA 2UU7A 2LGSA 5HI1A 3ZJTA 1JWSD 2GBKA 2NS5A 3PTFC 1ACCA 1WYWB 3L17A 4HK2A 2FCNA 4M02A 3M95A 1ZE3D 4TUUA 2KWUB 2WGSA 4E3CA 1WGYA 1AWDA 3NY5A 3RCZA 2MRPA 2LASA 4HDOA 3DWMA 1T0YA 1P1AA 1WI0A 2YLMA 2ZJDA 3Q3JA 1BXTA 3N3KB 1WIAA 4M0WB 1KH0A 1I7HA 2PJHA 4LK0M 3V61A 4TSSA 3A1QA 5HG2A 1F2RC 3RPFC 4ZRKA 1TYGB 4K3CA 1WXMA 2SEBD 1JRPA 2ZCBA 2M19A 2XNAC 1KLUD 2AQ2B 4NQLB 4PYZA 2CHXA 3LYYA 4BKTA 1GB4A 4W9EA 1TS2A 5H8YE 2MA9B 4JX1C 2MHJA 4AJWA 2XEWA 2NCNA 2DHZA 4RM9A 1NEKB 3OJ3A 3A9KB 4US8A 4TMAB 1GUAB 3QQ8B 1C3TA 2WDQB 3RNBC 5AZFA 3DVNU 4PYUA 3RULA 1WMHA 1GPXA 5IP4D 4W9FA 1M94A 2RDBC 4JLCA 2D5GA 3W1SC 4IM2A 4JQWC 4R3DA 1IGDA 5TSSA 1MFWA 1IBXB 1F1HA 3N9YC 2N9KA 4FXCA 1WZ3A 4ANUA 4A9AA 2JZ3B 1EF5A 1OTRB 2H88B 3H6NA 2BGFA 2N0SB 2L05A 1HZ5A 1FNUA 4FA6A 2KK8A 3FILA 3T3OA 3HHMA 2OEDA 4HROA 1UZXB 1RAXA 2W82A 3MP9A 3AEFB 2VZKB 4EOYA 4KGRA 3ZTCA 4TKNA 3Q3FA 1I4HA 3PHXB 1IP9A 2DNFA 4KIKB 1ET9A 1YOVB 2MBBB 2KX0A 4MM3A 2OHFA 3PS6A 1MJDA 2QJLA 4HPPA 3U7ZA 2BKFA 2V3NA 2JF5A 4FULA 3NZSA 4WJQA 5D7GA 5LXHA 2ICIA 3W2DA 3QAQA 4KDIC 3WAPA 4HRSA 1E7UA 3CIRB 2KQSA 2ZPYA 1AN8A 2BYFA 3Q69A 5EDSA 1FNVA 1UGMA 3BK2A 1TY2A 1E8WA 3PRPB 1WZ0A 4GDLB 3ZJUA 1K51A 2M0XA 1S3SG 1YN4A 4IUMB 4OZAA 4HPLB 2VZKD 1QKZA 2G45B 3WANA 2KHWB 2KYWA 2JQRB 2IY0B 4ARIA 2IGGA 1IPGA 2I1JA 1YQ3B 1E8XA 4AUQC 2KN5A 2ON8A 3AXCA 4YSYB 2DENB 1EF1A 2C9WB 2NTSA 2WU5B 3O13A 2J0MA 4M0WA 4L1BA 5BO4B 4W9DA 2Z0DB 4L23A 2MX2A 2KN4A 3QC8B 3BYYB 4AWJA 3ZXRA 2JX5A 2JXXA 2MWSB 2O6VB 1F9JA 2KLGA 2ZNVB 3MHSD 3ZW3A 4RH6A 1V86A 2LD9A 4K3BA 1Q5WB 4US9A 2DYOA 4AS1A 4DHJB 2OJRA 1PFDA 3AEEB 4NPNA 4RM8A 1SGHA 1AARA 4HEA1 2MP2B 3AMZA 3URYA 3PLUA 3A9KA 1VZ7A 1DYQA 1T5XD 2NTTA 3FC4A 1P9DU 2RMMA 4TV3A 1E10A 1TY0A 3RNCC 4RGMA 2OOBB 4ZHPA 1B1ZA 1KJTA 1WX8A 1ZGUB 2J42A 2LI5A 5BYRA 5IA7A 1NENB 4LCDE 4KSLC 1NI3A 4W9JA 1D5XC 1NI2A 4F1SA 1ZUD2 1IBXA 1FM0D 2K6QA 3AM9A 2O6VD 2CR5A 2KMAA 3B9JA 4AJYB 1I4QA 1A70A 3DOWA 2UYZB 4DHZB 4BFRA 3UI3A 2CU1A 3ZKJC 4DHJD 2AWTA 2AL3A 2KACA 3TMPB 2M8SA 3DBRI 3AE6B 4ARCA 4DQOC 4XDCA 2W3RA 3NRZA 3BY4B 1C4PA 1GC7A 3RNFC 3APDA 4MEMA 4RGNA 5AUKA 5FK9C 1WX9A 3DBRB 4RGTA 3E56A 1TZOA 3OLMD 1JWMD 4KIKA 1LFDA 4NAMA 3H7SA 4G0NB 1LGRA 3RI7C 1TKYA 5T8IA 2BW2A 1J19A 1EUVB 1XLNA 1UELA 1FO4A 2DWQA 3PZ8A 3QARA 1Q1OA 4GLSC 3DBLI 1FXIA 5D2MB 4LJPB 2KDBA 3LDZE 5AUIA 2XBBC 2RD0A 3IT6B 1J7BA 4X57B 3SHQA 1IYFA 3RUIB 1FIQA 2J52A 3T9LA 4GDLA 3DBLB 1YN3A 2V3PA 2LHEA 1OEYJ 3B2GA 3IT4B 3X0WA 4DXAB 1EU4A 4ZRQA 3TCAA 3OG5A 3KWVA 3N1XC 2V1YA 5C23A 1NYRA 3U30A 4REZA 4II2B 4WWOA 5AZHA 2RDHA 2BS2B 1QOBA 4EUTA 3H7PB 1WM2A 1UWMA 2JYEA 3DBSA 2WP9B 2MBHA 3ABVB 1N6ZA 1CQVA 1TIFA 4EZLA 1QOFA 1YX5B 3KUDB 2Y5BB 2D3GA 2INPE 1HTOA 2NPTB 4MELA 2KMCA 4HCNB 4LNOA 1FD6A 3A4RA 4WJPA 3AU4A 2K22A 2LZ6A 4P16A 5IAAC 3RD2A 1WJUA 4JGHB 1S1QB 2G1EA 2O6VA 4GN1A 3U8ZA 2N1VA 5JHAA 4WQOB 2KC2A 1WGDA 5E6NA 3RFZB 1N61A 2K9XA 2INCC 1AW7A 1X1MA 1WJ6A 2M56B 2L32A 5BMGA 3UIPB 1VDVA 1A5RA 5IN7A 2MP2A 2G4DB 1C79A 3TEZA 2WQYB 3WAOA 4KKJA 3R3MA 4FHJA 2W9NA 1MG8A 3IHPC 2ZZPB 1J7CA 1P7EA 5D6JB 4ANWA 3VFKA 3PV1A 3NJTA 2IGHA 1VRAB 1YD8U 3C0RB 5DCNA 1V81A 2W3SA 4LTUA 3SR6A 5HKHA 3H1UA 1WE7A 2KVRA 3AEGB 1YQBA 4K1RB 1AYFA 3ZUNA 4N59A 2EMTA 3NG0A 2KWDA 2JWUA 1H4RA 2K0PA 2BVCA 2M17A 4CO7A 2QEJC 2D3AA 3BIID 2WDTB 5GMVA 2EELA 3RZWC 2PW9A 2FE8A 3EFUA 2IO1B 2L0TA 4XC2A 1DOYA 1Z5SB 1SXTA 3CWIA 3ZDMC 3X23A 1XLQA 4B6WA 1WXAA 4WWPA 2HTME 3HRDD 1JW9D 2HJ1A 3B1LX 4KGSA 4LJOB 4PS8A 2L7RA 2ONQA 4MACA 1FMAD 1PGXA 1KRHA 2MBOA 3AEAB 1ZKHA 1U4AA 2E3TA 1OQRA 2Z59B 1TKEA 2JVCA 3KVFB 2MW5A 3L4PA 3KQ4A 4KZ0A 1CZPA 5G2NA 3MC8A 2J53A 5J2RA 4MT5A 3ML9A 1WRDB 2B76B 3L10B 1F77A 2ZW1A 2PTLA 3H7PA 2IJ0A 1E7VA 1EU3A 3U2SC 1UWXA 2AYOB 4HPMB 4A55A 2REXA 1CMXB 1RYJA 1VCBA 1RWSA 4DBGA 3RNEC 1F0ZA 2NMQA 1V1PB 5BYQA 2NPTA 4MSQB 3SFEB 4YTMB 1VZ6A 2QDFA 1JMLA 3PREA 3M62B 1C4AA 4C80A 4J3OD 1K52A 3PLVA 2IO0B 5IOIA 1E5WA 1D4BA 2NVUI 1FNWA 1P98A 1YMHE 2KXJA 4A20A 3AE5B 4BBNC 1TS4A 4JIOU 1UH6A 3ONSA 3ZXVA 3ZO5B 3NOBA 2QILA 3PHWB 4EZJA 2JSVX 3GOEA 3W1SA 3NS1A 2Q5WD 2KX3A 2BPSA 2G4SA 5L83A 2DLBA 1LXDA 4YT0B 2Z8LA 3DPDA 1MG4A 4B95A 1SB3C 1WJNA 2C7NB 2MBEA 2MCNB 1WX7A 1KTKA 5HHDG 4GGQA 4NNJB 1SE4A 1WXQA 1HXYD 2BS4B 4B0EA 1K53A 1YN5A 1YX6B 3NVVA 1OEYA 3VR9B 4NZLB 2V4IB 3WAMA 3A4SC 3VQIA 1WGHA 3V6CB 3LJ3A 1V2YA 3I3TB 1WGGA 2IPKD 3ZJVA 2AL6A 4IWQA 4OW0A 4ZOHC 2PEAA 1TJEA 1J8CA 4UDUC 2GRIA 2K8HA 3P4PB 3I57A 4FJYA 1STEA 5C1ZA 2GBMA 2LWPA 5G5HA 2FUG1 2M4NA 3MC9A 2J0JA 1MI0A 4BOSC 2BTEA 2LJIA 1QLBB 3QIJA 1YJJA 3AU5A 4EKUA 4B0MA 3KWLA 2WXLA 4LDTB 1WFYA 2FCQA 3O65B 4S0RA 4LNIA 2DX5B 5FKAC 3W5UB 5IO9A 2PE9A 2K39A 1V49A 3L54A 5EE1A 2GBJA 3ZNID 2GBNA 1G6JA 4NJCA 1D6EC 4JE3B 1YJ1A 1HE8A 2KZRA 4XDDA 4BKSD 3N1YC 1V97A 3KUZA 3AE2B 2W55A 4NY0A 4GU2A 3WALA 2N7EA 3BINA 1CK1A 3NHEB 2ZVOA 2L8JA 4H2AA 4ANXA 3FKYA 3TEYA 3PGEA 1BT0A 1E8ZA 2MH7A 3ALBA 4LDTD 1I4XA 4ICUA 3BZDB 3ZIMA 4IC7B 3MJWA 1MVKA 3RZFA 3BVMA 5KHOA 3P42A 1L5PA 2KJHB 2KKCA 2VRRB 3DVGX 4K7SA 1WWTA 4KGTA 4LNFA 1V1PA 1VLBA 2NBVB 4GXBA 3PSEB 3Q2AC 4PS7A 3VRBB 3DBHI 2M1MA 2JRIB 3JVZX 2KJ6A 1RFAA 3N1ZC 2JUOA 1WY8A 4HWIB 4OZBA 2KTRB 2LVQA 1WXVA 1ZDXA 3HK0A 3NZ3A 2IO2B 3DBHB 3NVWA 2JXTA 4YWGG 1JWAD 3PRZA 2R2OA 3DVNV 3M63B 1V5OA 1PQSA 1WGKA 2DYBA 4P1BC 1UUPA 2PVOD 4KZCA 1DGJA 1FXAA 2BB6A 4D2KA 1T0QC 4IKGA 3M3JA 2FUHB 5C3JB 1ZXIA 2Y3AA 1N5WA 3DQVA 2WS3B 5JHBA 5DPWA 5CTRC 2WDRB 4RF0A 2IO3B 3P4SB 4G50A 3UGBB 2NR2A 3AE1B 2CS4A 3B2FA 1QILA 2FIFA 4C4VB 1BUIC 3TJPA 1C9FA 1P0RA 3TIXA 1BMLC 1I4GA 2MSED 1WSPA 2C60A 3E9SA 2DZKA 4PS3A 2WYQA 3N30A 1WM3A 4W9LA 2N9XA 3IG3A 4ZYSA 4BKSA 2M0AA 2H89B 3I63C 3Q3OC 3ZNGC 4WJOA 2RGFA 2KMMA 1D5MC 1SF0A 2L3ZA 3P4RB 2KVZA 1Y8RC 4A3OA 3VHTC 3APFA 4LNNA 1E8YA 3EHVA 1TTNA 3HVDA 3V60A 4OVUA 3GE8C 1L7YA 2UWQA 1ZPSA 3ENEA 3VRAB 1R4NB 3ZVVA 3BWUD 4MJSB 1C1YB 2X38A 1E0ZA 3KYCD 2OJWA 3VXWA 4YTNB 3DCGA 1CJEA 2MEKA 4G3XB 4FHKA 1XXGA 3SD5A 2RPQA 5G55A 4XX5A 4KX6B 4JL9A 4HCPB 4PT5A 3NZUA 1WRIA 3VH3B 5BYSA 5E6OA 4WH4A 1XQQA 1ZDVA 4GSWA 2PE6B 1MPEA 5EE3A 4N6EB 1F2RI 3DDCB 3IBEA 1KM7A 2IZVB 3ZYYX 2BYVE 3V3XA 2K1FA 3RN9C 1LM8B 3I9V1 2BYTA 2C7MB 1VD2A 1Z2MA 2I2YA 1NBFC 3NS8A 3ZQ4A 5G5GA 1KOTA 1FXTB 1L6VA 4P1CC 4FADA 5EE9A 4W9GA 3W5VB 4IM3A 3RNGC 4WAAA 4GOCA 3V6EB 2NBUA 3LXFA 2D11A 3H8HA 4N58A 1PDXA 4OZCA 2KTRA 1C4CA 2LXCA 2QIEB 2LVOA 3Q14C 4RF1A 1L2NA 1E7PB 2D10A 3EECA 4TQ1A 5LLIA 1EM7A 4MGKE 4MGYE 1N5XA 2C7HA 2KC1A 4XYCA 1QZEA 5DPTA 4DXFA 3DHIC 3DVGY 1XF5L 3AN1A 2FCSA 1SE3A 2DZMA 3ZRCA 4IM0A 3A9JB 4RCOA 3TUOA 1WF9A 3AE7B 5FR3A 4W9IA 1XEEA 3HM6X 3GS2A 4OVZA 2G3QB 2HJ8A 1TS3A 3VH4B 3N32A 3QCAA 1ROEA 1L4ZB 3WCQA 2KQ7A 5J17A 4FN2A 3T8MA 4IG7B 4KSKC 2JY6A 3Q8BA 4C4VA 2HTHA 4I6PA 2QHOA 4A90A 4BAXA 1R7SA 2J7QB 3L08A 2KO3A 3Q6BA 1ZW7A 5GXGB 2JZPA 2HE7A 1YQ4B 1ET6A 2PIAA 3MFGA 3RMKC 3NUHB 2WXKA 1T0RC 3B08A 4DXGA 3VUYA 3AEDB 2TSSA 3L0WB 4ANVA 3H9DA 2BKRB 2IBIB 3VVWB 3APCA 4CYEA 1FFUA 4YL8A 3AECB 3BVZA 2KANA 3Q8FA 3R2IA 1QF6A 1RM6C 2KJRA 2INDC 1XLOA 5D3IB 1GOZA 1ZXHA 3WIMA 3EC8A 1SE2A 4C56C 3ZNHB 2WNMA 2E6XA 2IY1B 2AX5A 3WA0A 2LJ5A 2R2QA 4MJSA 3P4QB 1VZ8A 1SE9A 2N9PC 2L0FA 2WXOA 5E6PA 2ZW0A 3CSFA 2HD5B 4WJNA 1UBIA 1SIFA 1K8RB 1F52A 2QSDA 1XCTL 1JROA 3HUIA 3QK0A 3KLSX 1I42A 4S17A 4CQNA 4XWWA 4KDLB 1GJZA 1L6UA 4RMAA 1TKGA 5MPOA 2KNBA 3IVFA 1PYWD 4DDGD 1UBQA 3U52E 3SU8X 4GIVA 3TEWA 3ECIA 4QAYA 2WXFA 2MBQA 3NVYA 1IUEA 2N9EB 3EGRA 2R61A 5E6JA 3MTNB 3ZRFA 3P2BA 1VR9A 1OQQA 3K9OB 2LEKA 5LXIB 1LO5D 4C7ZA 4HJGE 4WWNA 3IFWB 3Q3NC 2O2VB 2PPHA 3JYUA 4MGZE 2ASQA 1FRDA 1PGBA 4F8CB 4NQKE 4XGAB 3UQBA 1TGZB 3MHZA 3PPAA 2VH2A 4HVBA 3MJ5A 3C19A 4P6VF 4ZYNA 1QOGA 1LQBA 4JPSA 1XO3A 4XWTA 2L1AA 4AQ7A 2KDMA 2WXMA 2GMIC 4M8NA 3KYDD 2N1WA 4I6NB 3UINB 5H92C 3Q8AA 3R7QA 1WE6A 4MH0E 4NAWB 1GB1A 3AEBB 3KW5B 2ZCCA 3A9JA 2WDVB 3PO0A 2C5LC 4IOIE 1PGAA 5J18A 3UQAA 4YXDB 1YJIA 1HZ6A 2BYEA 2D3BA 2I1KA 4HLEA 2BBCA 1QQRA 2JWZA 4DK5A 1HTQA 3VTUA 2KT7A 2KLCA 2NBWB 1C76A 3IAM1 2WU2B 1DOXA 3AE9B 3R2TA 4MSMB 3HVZA 4G11A 3KUCB 1YIWA 2LMCA 3R8BA 3U4EG 1NDDA 2KWCA 3TEXA 4B9KA 2L52A 2BT6A 4HXDA 1SSNA 3UF8A 2YVCA 1JRUA 2K5PA 4AOFA 1RRBA 3OAWA 2BWFA 2DAJA 1FRRA 1I4PA 1QT9A 2WXNA 3JSVB 2DZJA 1HEZE 3W1YA 1Q0WB 1WXSA 1UD7A 3AULA 2K8BA 3QX1A 1TT5B 1MHXA 4BBNF 1JCKB 2L00B 3PZ7A 1VJKA 2PVGC 4ICVA 2N7DA 1XD3B 3ETRA 1V9JA 2ZEQA 4IW0A 4Q2JA 1C78A 1JQ4A 2KDIA 5EE0A 4OVVA 2KOXA 4RNAA 2WXQA 1H8CA 1RFKA 2WXHA 4MGIE 1ISNA 3ZGZA 4PK1A 1ENFA 2KFKB 4KKIA 5CX3A 2LFIA 3HM3A 5BMIA 2FIDA 2LRWA 2YEPF 2XK5B 3IXSA 1ZOYB 3L16A 4II3B 1P3QU 1GG3A 4E74A 3UIOB 1R4MI 1FFVA 3AV8A 3NVZA 2KDFB 4EE2A 2RPVA 1XCQL 4JWSC 3BK1A 3MC0B 1P7FA 1N60A 2LGIA 1R4MB 2LHDA 4DDID 2LUMA 2O2VA 4W9CA 1D3ZA 4BKGA 2N7JA 2RSUA 4HDQA 3VTVA 4NJ7A 1E90A 2FBWB 3P63A 2BF8B 4K7WA 3TBLD 1WGRA 2LVPA 1K50A 4GDKB 3PVLA 4BVUC 1B9RA 2ZVNA 2QC8A 3SFDB 2V3SA 2KAJA 1OGWA 4BZAA 4C7YA 5FR6A 4DHZE 1WR1A 1EWYC 3SEBA 3RT3B 3VAWA 2JYTA 1OFFA 4AP4C 2GLSA 3AE4B 4NAWA 3TL5A 1V6EA 3AB5A 2IYDB 3C8YA 2MQJA 2WHIA 2N4FA 5AEKB 4TQ0A 2WLBA 2KDEB 2L83A 3OWEB 4WAFA 1V1OA 4YSZB 3PT2B 3VUXA 3LB8C 3D32A 3IAS1 2WXJA 3T3NA 1DOIA 1J7AA 2GOWA 3ZTDA 5I4DA 1EWCA 3VR8B 2MJEA 2K25A 1E9MA 4OHJA 4WIPA 2CKHB 4N9F4 2FAZA 5DPRA 5BMHA 3GP7A 3DHHC 1FCCC 4JWUC 2JZZA 1WJ4A 2IGDA 2Y5PA 4ITKA 2WXRA 4A8XC 1XT9B 3GB1A 5D3DA 3SDLC 3A33B 2QMTA 3QJZA 2GBRA 4FBJB 2PLPA 4EFOA 4CHKA 5JXVA 2LGYA 2JRHA 4IWPA 2V0GA 2CHWA 2K6DB 3RNAC 1NVID 1Y56A 4K81A 1R4NI 1C77A 3JSVA 2AQ1B 3VDZA 1I4RA 3ZDTA 4IDIA 2KWVB 4YSXB 3W9CB 3AH7A 2EMSA 1V8CA 3PZDA 4WURA 1FEHA 2JT4B 3TSSA 2INNE 1V80A 1SIJA 2A5UA 2SAKA 3DHGC 4GMVA 4O1NA 3EA6A 1XLPA 2LRUA 1L0YB 1ESFA 2DZIA 3S2AA 2CU3A 2V4LA 2LXAA 1PUTA 2KFKA 3B0AA 3KH0A 2AEHA 1L0XB 4FJZA 2Z0EB 3RYTA 1L0VB 2KQ4X 2L76A 2XN9C 5IKCM 4A6QA 1HA5A 2N9LA 2XK5A 4C00A 1E6EB 1JWUD 4RFBA 4M00A 2ACZB 2MLBA 1FPYA 3AE3B 2WX0A 1I35A 5D94A 2BWES 1WR6E 2J4XA 2RR9A 1SBBB 3ZNZB 1GAQB 2BS3B 3VUWA 2D2QA 1HQRD 4MH8A 4YTPB 2EKEC 3GZNI 4HKZE 5LNK1 1N63A 1MHHE 3R66C 3FAHA 2HDEA 3U7DA 4ZRJA 1UGJA 1UF0A 2A4ZA 4M8MA 3GZNB 3JW0X 5CHFA 1NYQA 3Q3MC 1FCLA 3AI5A 5DPSA 3QHTA 4GDKA 3BYTB 3V62A 1JWBD 2D07B 2MJ3A 4ZRPA 3ZLZA 2GB1A 2VH1A 2BQQA 3QA8A 1T3QA 1UNSA 3EUB2 3A1QB 2LGDA 4DWFA 2YEPB 4J6IA 4A3PA 3CMMB 4KVGB 2PMVA
chains in the Genus database with same CATH topology
2K39A 2K6QA 4XZ4A 5LXIB 1V49A 2O6VD 2CR5A 2KMAA 3L54A 4AJYB 4GB9A 4WWNA 4F7ZA 5JZEB 3DOWA 2GBJA 3IFWB 2UYZB 2O2VB 3ZNID 2GBNA 4DHZB 1G6JA 4BOZB 2PPHA 2KTFA 3JYUA 4BFRA 4MGZE 2ASQA 2CU1A 3ZKJC 4DHJD 2AWTA 2AL3A 1YJ1A 4ASWC 1HE8A 2KZRA 4F8CB 4NQKE 3TMPB 4BKSD 5TR5A 3UQBA 1TGZB 2M8SA 3ML8A 5JH5C 3DBRI 1TBEA 3KUZA 4NY0A 3PPAA 3R7RA 4HVBA 4GU2A 3WALA 3PRMB 2JPHA 2N7EA 3BY4B 2FCMA 2ZNVC 1GC7A 3BINA 2KD0A 4ZYNA 3NHEB 1LQBA 3APDA 4MEMA 5AZGA 2ZVOA 2DAFA 2L8JA 1WX9A 2ZPNA 4ANXA 4E71A 5L95C 4URKA 3OLMD 1BT0A 3PGEA 1WMHB 4W9KA 4FJVB 4KIKA 1LFDA 1E8ZA 1V5TA 2GMIC 3ALBA 4M8NA 3H7SA 3KYDD 4G0NB 4LDTD 2N1WA 2WX1A 4I6NB 4ICUA 3UINB 3ZIMA 1J19A 4IC7B 3MJWA 3R7QA 1EUVB 1UELA 3RZFA 1WE6A 4MH0E 4NAWB 2KFJA 2CHZA 5KHOA 2KKCA 2KJHB 2VRRB 3DVGX 3KW5B 2ZCCA 4K7SA 3CF6E 3A9JA 3QARA 1Q1OA 2C5LC 3DBLI 5KHQA 2NBVB 4MDKE 5D2MB 4GXBA 1TZ1A 4LJPB 2KDBA 3PSEB 5J18A 3UQAA 4PS7A 3LDZE 2FNJB 2XBBC 3DBHI 2M1MA 2JRIB 2RD0A 2BYEA 4HLEA 2I1KA 3JVZX 4X57B 3SHQA 2KJ6A 1IYFA 1RFAA 2JWZA 4ZRIA 3RUIB 4K7UA 3T9LA 4DK5A 4GDLA 3L13A 2JUOA 1WY8A 3VTUA 1WH3A 2KLCA 2NBWB 1OEYJ 4HWIB 2KTRB 3X0WA 4DXAB 2LVQA 1WXVA 3HK0A 2IO2B 4P7IA 1EO6A 3TCAA 4MSMB 1GNUA 4G11A 3PRZA 3KUCB 2R2OA 2V1YA 5C23A 1YIWA 2K8CA 3U30A 3DVNV 4II2B 3M63B 4WWOA 5AZHA 1V5OA 1PQSA 1NDDA 2WWZA 2DYBA 2KWCA 4B9KA 2LUEA 4HXDA 3VTWA 1GC6A 3UF8A 4EUTA 3H7PB 2YVCA 4KZCA 1JRUA 4I6LB 5CHWA 1WM2A 3M3JA 4AOFA 2FUHB 1RRBA 3DBSA 2MBHA 3OAWA 4KV2A 2BWFA 2DAJA 4IWOA 4EEWA 4NJ6A 3DQVA 1OQYA 5CHVC 4EZLA 1YX5B 1RLFA 4ZDVA 4EZKA 3KUDB 2Y5BB 5JHBA 2D3GA 4FLHA 3JSVB 2DZJA 1KLVA 3QWZB 5DPWA 3W1YA 2NPTB 5CTRC 4MELA 1Q0WB 2KMCA 1WXSA 2J0KA 4HCNB 1J0GA 1UD7A 3AULA 2IO3B 2K8BA 3A4RA 3QX1A 4G50A 4WJPA 3AU4A 4BBNF 2L00B 3UGBB 2B3AA 2LZ6A 5IAAC 3RD2A 1WJUA 2NR2A 3CSTA 4JGHB 2CS4A 4ICVA 2N7DA 1XD3B 1S1QB 1V9JA 2FIFA 2O6VA 4GN1A 2LGXA 4HJKA 3U8ZA 3TJPA 2ZEQA 3K9PB 4IW0A 1P0RA 3OJ4B 3HIZA 3TIXA 2N1VA 4W9HA 2DYMA 4WQOB 2KDIA 5JHAA 2GBKA 2MSED 2C60A 2KC2A 2NS5A 3PTFC 1WGDA 1WYWB 3L17A 4HK2A 2DZKA 4PS3A 5E6NA 2WYQA 4OVVA 2FCNA 3M95A 3N30A 1WM3A 2KOXA 2N9XA 4W9LA 3IG3A 1H8CA 4TUUA 1X1MA 1WJ6A 2KWUB 4MGIE 4BKSA 1ISNA 3UIPB 4E3CA 1WGYA 2KFKB 1A5RA 5CX3A 3NY5A 3ZNGC 3HM3A 2MP2A 4WJOA 2G4DB 2MRPA 3RCZA 2LASA 2RGFA 2LRWA 2FIDA 2L3ZA 4HDOA 3WAOA 1T0YA 1P1AA 1WI0A 1Y8RC 4A3OA 2YLMA 3VHTC 2ZJDA 3APFA 2XK5B 3Q3JA 3R3MA 4FHJA 2W9NA 1MG8A 3L16A 3IHPC 3N3KB 4II3B 1P3QU 2ZZPB 1E8YA 1WIAA 3EHVA 4M0WB 1TTNA 2PJHA 1GG3A 3V60A 4OVUA 3V61A 4E74A 1L7YA 3UIOB 1R4MI 5D6JB 2UWQA 4ANWA 3ENEA 3VFKA 3A1QA 3PV1A 2KDFB 4ZRKA 1YD8U 3C0RB 1WXMA 3ZVVA 2ZCBA 4MJSB 1C1YB 5DCNA 3KYCD 3VXWA 1V81A 4NQLB 4PYZA 2CHXA 4DDID 5HKHA 4BKTA 4W9EA 3DCGA 3H1UA 1WE7A 2MA9B 2KVRA 2O2VA 1YQBA 4K1RB 4AJWA 4G3XB 4FHKA 3ZUNA 3SD5A 2XEWA 4W9CA 2RPQA 5G55A 1D3ZA 2EMTA 2NCNA 2DHZA 4BKGA 4XX5A 4RM9A 2RSUA 4HDQA 4HCPB 4JL9A 3VTVA 1H4RA 3NZUA 4NJ7A 3VH3B 3OJ3A 1E90A 3A9KB 5E6OA 2BF8B 4K7WA 1GUAB 3TBLD 2M17A 1XQQA 1WGRA 3QQ8B 2LVPA 4GSWA 2PE6B 4CO7A 3PVLA 2WDTB 4GDKB 5GMVA 4BVUC 1C3TA 5AZFA 2ZVNA 3DVNU 3RZWC 3DDCB 3IBEA 3EFUA 2IO1B 4PYUA 1KM7A 2L0TA 2IZVB 2BYVE 4XC2A 3RULA 2V3SA 1WMHA 1Z5SB 2K1FA 1OGWA 1LM8B 4W9FA 3ZDMC 1M94A 4JLCA 3X23A 3W1SC 5FR6A 4B6WA 1WXAA 4DHZE 4IM2A 4WWPA 1WR1A 4JQWC 2C7MB 3RT3B 3VAWA 4AP4C 1WZ3A 1VD2A 1Z2MA 3B1LX 4NAWA 3TL5A 4ANUA 1V6EA 1NBFC 2IYDB 4LJOB 4PS8A 2L7RA 3NS8A 2MQJA 2JZ3B 1KOTA 1EF5A 2N4FA 1OTRB 5AEKB 3H6NA 2BGFA 1FXTB 2L05A 4TQ0A 4FADA 2MBOA 4FA6A 2KDEB 1ZKHA 2KK8A 4W9GA 3HHMA 4IM3A 1U4AA 3PT2B 4WAAA 1UZXB 2Z59B 1RAXA 4GOCA 3V6EB 3VUXA 2JVCA 3D32A 3KVFB 2NBUA 2MW5A 2GOWA 3ZTDA 2D11A 4KZ0A 4EOYA 2KTRA 5G2NA 2LXCA 3ZTCA 2K25A 4TKNA 2CKHB 3Q3FA 4N9F4 5J2RA 2LVOA 2FAZA 5DPRA 2JZZA 1WJ4A 1L2NA 3PHXB 2D10A 3ML9A 1WRDB 1IP9A 3L10B 4KIKB 3EECA 1XT9B 4TQ1A 3SDLC 2MBBB 2KX0A 3A33B 4MM3A 3PS6A 5LLIA 3QJZA 4MGKE 3H7PA 4MGYE 1E7VA 2GBRA 4FBJB 2C7HA 2AYOB 2KC1A 2BKFA 4EFOA 1QZEA 5DPTA 4CHKA 2JF5A 3DVGY 4FULA 4HPMB 2LGYA 2REXA 2JRHA 2FCSA 4IWPA 1CMXB 2DZMA 3NZSA 2CHWA 2K6DB 4IM0A 3ZRCA 1VCBA 3A9JB 4WJQA 5D7GA 1WF9A 4DBGA 5LXHA 4K81A 4W9IA 1R4NI 3HM6X 3JSVA 3QAQA 4KDIC 3WAPA 3VDZA 1E7UA 2KQSA 2G3QB 2NPTA 2HJ8A 2ZPYA 4MSQB 3ZDTA 2KWVB 3VH4B 3N32A 3QCAA 2BYFA 3PREA 5EDSA 3M62B 2EMSA 2KQ7A 1UGMA 3PZDA 5J17A 4FN2A 1E8WA 2JT4B 3PRPB 1WZ0A 3T8MA 4GDLB 4IG7B 3PLVA 4KSKC 2IO0B 2M0XA 1E5WA 2JY6A 1S3SG 4IUMB 1V80A 2HTHA 2QHOA 2A5UA 2NVUI 4GMVA 4I6PA 4HPLB 1P98A 2KXJA 4A20A 2J7QB 3L08A 2KO3A 2G45B 4BBNC 1ZW7A 3WANA 2LRUA 2HE7A 2KHWB 4JIOU 1UH6A 2DZIA 3S2AA 3ONSA 2IY0B 3ZO5B 3NOBA 3PHWB 4EZJA 2V4LA 3B08A 2LXAA 1IPGA 2I1JA 2KFKA 3B0AA 3VUYA 3GOEA 3W1SA 3L0WB 4ANVA 3KH0A 3H9DA 2KX3A 1E8XA 2AEHA 2BPSA 4AUQC 2G4SA 5L83A 4FJZA 2KN5A 2Z0EB 3RYTA 1LXDA 2BKRB 2IBIB 3AXCA 2DENB 3APCA 3DPDA 2L76A 1WJNA 2C7NB 3VVWB 4B95A 4CYEA 1EF1A 2XK5A 4YL8A 2C9WB 2MBEA 2MCNB 2KANA 1WX7A 2J0MA 4GGQA 5BO4B 2KJRA 4NNJB 2MLBA 4W9DA 2Z0DB 2WX0A 2MX2A 1YX6B 3WIMA 3EC8A 1I35A 1OEYA 5D94A 2BWES 3QC8B 1WR6E 3ZNHB 2RR9A 4AWJA 3WAMA 3A4SC 2IY1B 2JXXA 3VQIA 2MWSB 2O6VB 3WA0A 2LJ5A 1WGHA 3ZNZB 1F9JA 3V6CB 2R2QA 3LJ3A 3VUWA 2D2QA 1V2YA 4MJSA 2KLGA 3I3TB 2ZNVB 1WGGA 3MHSD 3ZW3A 2EKEC 1SE9A 1V86A 3GZNI 2LD9A 1Q5WB 2AL6A 2N9PC 4IWQA 2L0FA 2DYOA 5E6PA 3CSFA 2HD5B 4WJNA 4DHJB 2OJRA 3R66C 1UBIA 1SIFA 1K8RB 2PEAA 3U7DA 4ZRJA 4NPNA 3QK0A 1J8CA 4RM8A 1I42A 1SGHA 1AARA 2A4ZA 4M8MA 3JW0X 2K8HA 2MP2B 5CHFA 4FJYA 5C1ZA 3PLUA 4KDLB 2GBMA 3A9KA 1GJZA 2LWPA 4RMAA 3AI5A 2KNBA 3IVFA 5DPSA 1P9DU 2M4NA 3QHTA 4TV3A 4DDGD 4GDKA 3V62A 2J0JA 1UBQA 3SU8X 4GIVA 2OOBB 4BOSC 3QIJA 3AU5A 2D07B 4EKUA 1KJTA 3ECIA 3ZLZA 1WX8A 1ZGUB 2LI5A 4LDTB 3QA8A 5IA7A 1WFYA 2FCQA 3O65B 2MBQA 3A1QB 2LGDA 4LCDE 2N9EB 4DWFA 4KSLC 4J6IA 4A3PA 3CMMB 4W9JA 4KVGB 1NI2A 4F1SA 3MTNB 3ZRFA 2DX5B 3P2BA 3K9OB 2PE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K39 A;  2K6Q A;  4XZ4 A;  5LXI B;  1V49 A;  2O6V D;  2CR5 A;  2KMA A;  3L54 A;  4AJY B;  4GB9 A;  4WWN A;  4F7Z A;  5JZE B;  3DOW A;  2GBJ A;  3IFW B;  2UYZ B;  2O2V B;  3ZNI D;  2GBN A;  4DHZ B;  1G6J A;  4BOZ B;  2PPH A;  2KTF A;  3JYU A;  4BFR A;  4MGZ E;  2ASQ A;  2CU1 A;  3ZKJ C;  4DHJ D;  2AWT A;  2AL3 A;  1YJ1 A;  4ASW C;  1HE8 A;  2KZR A;  4F8C B;  4NQK E;  3TMP B;  4BKS D;  5TR5 A;  3UQB A;  1TGZ B;  2M8S A;  3ML8 A;  5JH5 C;  3DBR I;  1TBE A;  3KUZ A;  4NY0 A;  3PPA A;  3R7R A;  4HVB A;  4GU2 A;  3WAL A;  3PRM B;  2JPH A;  2N7E A;  3BY4 B;  2FCM A;  2ZNV C;  1GC7 A;  3BIN A;  2KD0 A;  4ZYN A;  3NHE B;  1LQB A;  3APD A;  4MEM A;  5AZG A;  2ZVO A;  2DAF A;  2L8J A;  1WX9 A;  2ZPN A;  4ANX A;  4E71 A;  5L95 C;  4URK A;  3OLM D;  1BT0 A;  3PGE A;  1WMH B;  4W9K A;  4FJV B;  4KIK A;  1LFD A;  1E8Z A;  1V5T A;  2GMI C;  3ALB A;  4M8N A;  3H7S A;  3KYD D;  4G0N B;  4LDT D;  2N1W A;  2WX1 A;  4I6N B;  4ICU A;  3UIN B;  3ZIM A;  1J19 A;  4IC7 B;  3MJW A;  3R7Q A;  1EUV B;  1UEL A;  3RZF A;  1WE6 A;  4MH0 E;  4NAW B;  2KFJ A;  2CHZ A;  5KHO A;  2KKC A;  2KJH B;  2VRR B;  3DVG X;  3KW5 B;  2ZCC A;  4K7S A;  3CF6 E;  3A9J A;  3QAR A;  1Q1O A;  2C5L C;  3DBL I;  5KHQ A;  2NBV B;  4MDK E;  5D2M B;  4GXB A;  1TZ1 A;  4LJP B;  2KDB A;  3PSE B;  5J18 A;  3UQA A;  4PS7 A;  3LDZ E;  2FNJ B;  2XBB C;  3DBH I;  2M1M A;  2JRI B;  2RD0 A;  2BYE A;  4HLE A;  2I1K A;  3JVZ X;  4X57 B;  3SHQ A;  2KJ6 A;  1IYF A;  1RFA A;  2JWZ A;  4ZRI A;  3RUI B;  4K7U A;  3T9L A;  4DK5 A;  4GDL A;  3L13 A;  2JUO A;  1WY8 A;  3VTU A;  1WH3 A;  2KLC A;  2NBW B;  1OEY J;  4HWI B;  2KTR B;  3X0W A;  4DXA B;  2LVQ A;  1WXV A;  3HK0 A;  2IO2 B;  4P7I A;  1EO6 A;  3TCA A;  4MSM B;  1GNU A;  4G11 A;  3PRZ A;  3KUC B;  2R2O A;  2V1Y A;  5C23 A;  1YIW A;  2K8C A;  3U30 A;  3DVN V;  4II2 B;  3M63 B;  4WWO A;  5AZH A;  1V5O A;  1PQS A;  1NDD A;  2WWZ A;  2DYB A;  2KWC A;  4B9K A;  2LUE A;  4HXD A;  3VTW A;  1GC6 A;  3UF8 A;  4EUT A;  3H7P B;  2YVC A;  4KZC A;  1JRU A;  4I6L B;  5CHW A;  1WM2 A;  3M3J A;  4AOF A;  2FUH B;  1RRB A;  3DBS A;  2MBH A;  3OAW A;  4KV2 A;  2BWF A;  2DAJ A;  4IWO A;  4EEW A;  4NJ6 A;  3DQV A;  1OQY A;  5CHV C;  4EZL A;  1YX5 B;  1RLF A;  4ZDV A;  4EZK A;  3KUD B;  2Y5B B;  5JHB A;  2D3G A;  4FLH A;  3JSV B;  2DZJ A;  1KLV A;  3QWZ B;  5DPW A;  3W1Y A;  2NPT B;  5CTR C;  4MEL A;  1Q0W B;  2KMC A;  1WXS A;  2J0K A;  4HCN B;  1J0G A;  1UD7 A;  3AUL A;  2IO3 B;  2K8B A;  3A4R A;  3QX1 A;  4G50 A;  4WJP A;  3AU4 A;  4BBN F;  2L00 B;  3UGB B;  2B3A A;  2LZ6 A;  5IAA C;  3RD2 A;  1WJU A;  2NR2 A;  3CST A;  4JGH B;  2CS4 A;  4ICV A;  2N7D A;  1XD3 B;  1S1Q B;  1V9J A;  2FIF A;  2O6V A;  4GN1 A;  2LGX A;  4HJK A;  3U8Z A;  3TJP A;  2ZEQ A;  3K9P B;  4IW0 A;  1P0R A;  3OJ4 B;  3HIZ A;  3TIX A;  2N1V A;  4W9H A;  2DYM A;  4WQO B;  2KDI A;  5JHA A;  2GBK A;  2MSE D;  2C60 A;  2KC2 A;  2NS5 A;  3PTF C;  1WGD A;  1WYW B;  3L17 A;  4HK2 A;  2DZK A;  4PS3 A;  5E6N A;  2WYQ A;  4OVV A;  2FCN A;  3M95 A;  3N30 A;  1WM3 A;  2KOX A;  2N9X A;  4W9L A;  3IG3 A;  1H8C A;  4TUU A;  1X1M A;  1WJ6 A;  2KWU B;  4MGI E;  4BKS A;  1ISN A;  3UIP B;  4E3C A;  1WGY A;  2KFK B;  1A5R A;  5CX3 A;  3NY5 A;  3ZNG C;  3HM3 A;  2MP2 A;  4WJO A;  2G4D B;  2MRP A;  3RCZ A;  2LAS A;  2RGF A;  2LRW A;  2FID A;  2L3Z A;  4HDO A;  3WAO A;  1T0Y A;  1P1A A;  1WI0 A;  1Y8R C;  4A3O A;  2YLM A;  3VHT C;  2ZJD A;  3APF A;  2XK5 B;  3Q3J A;  3R3M A;  4FHJ A;  2W9N A;  1MG8 A;  3L16 A;  3IHP C;  3N3K B;  4II3 B;  1P3Q U;  2ZZP B;  1E8Y A;  1WIA A;  3EHV A;  4M0W B;  1TTN A;  2PJH A;  1GG3 A;  3V60 A;  4OVU A;  3V61 A;  4E74 A;  1L7Y A;  3UIO B;  1R4M I;  5D6J B;  2UWQ A;  4ANW A;  3ENE A;  3VFK A;  3A1Q A;  3PV1 A;  2KDF B;  4ZRK A;  1YD8 U;  3C0R B;  1WXM A;  3ZVV A;  2ZCB A;  4MJS B;  1C1Y B;  5DCN A;  3KYC D;  3VXW A;  1V81 A;  4NQL B;  4PYZ A;  2CHX A;  4DDI D;  5HKH A;  4BKT A;  4W9E A;  3DCG A;  3H1U A;  1WE7 A;  2MA9 B;  2KVR A;  2O2V A;  1YQB A;  4K1R B;  4AJW A;  4G3X B;  4FHK A;  3ZUN A;  3SD5 A;  2XEW A;  4W9C A;  2RPQ A;  5G55 A;  1D3Z A;  2EMT A;  2NCN A;  2DHZ A;  4BKG A;  4XX5 A;  4RM9 A;  2RSU A;  4HDQ A;  4HCP B;  4JL9 A;  3VTV A;  1H4R A;  3NZU A;  4NJ7 A;  3VH3 B;  3OJ3 A;  1E90 A;  3A9K B;  5E6O A;  2BF8 B;  4K7W A;  1GUA B;  3TBL D;  2M17 A;  1XQQ A;  1WGR A;  3QQ8 B;  2LVP A;  4GSW A;  2PE6 B;  4CO7 A;  3PVL A;  2WDT B;  4GDK B;  5GMV A;  4BVU C;  1C3T A;  5AZF A;  2ZVN A;  3DVN U;  3RZW C;  3DDC B;  3IBE A;  3EFU A;  2IO1 B;  4PYU A;  1KM7 A;  2L0T A;  2IZV B;  2BYV E;  4XC2 A;  3RUL A;  2V3S A;  1WMH A;  1Z5S B;  2K1F A;  1OGW A;  1LM8 B;  4W9F A;  3ZDM C;  1M94 A;  4JLC A;  3X23 A;  3W1S C;  5FR6 A;  4B6W A;  1WXA A;  4DHZ E;  4IM2 A;  4WWP A;  1WR1 A;  4JQW C;  2C7M B;  3RT3 B;  3VAW A;  4AP4 C;  1WZ3 A;  1VD2 A;  1Z2M A;  3B1L X;  4NAW A;  3TL5 A;  4ANU A;  1V6E A;  1NBF C;  2IYD B;  4LJO B;  4PS8 A;  2L7R A;  3NS8 A;  2MQJ A;  2JZ3 B;  1KOT A;  1EF5 A;  2N4F A;  1OTR B;  5AEK B;  3H6N A;  2BGF A;  1FXT B;  2L05 A;  4TQ0 A;  4FAD A;  2MBO A;  4FA6 A;  2KDE B;  1ZKH A;  2KK8 A;  4W9G A;  3HHM A;  4IM3 A;  1U4A A;  3PT2 B;  4WAA A;  1UZX B;  2Z59 B;  1RAX A;  4GOC A;  3V6E B;  3VUX A;  2JVC A;  3D32 A;  3KVF B;  2NBU A;  2MW5 A;  2GOW A;  3ZTD A;  2D11 A;  4KZ0 A;  4EOY A;  2KTR A;  5G2N A;  2LXC A;  3ZTC A;  2K25 A;  4TKN A;  2CKH B;  3Q3F A;  4N9F 4;  5J2R A;  2LVO A;  2FAZ A;  5DPR A;  2JZZ A;  1WJ4 A;  1L2N A;  3PHX B;  2D10 A;  3ML9 A;  1WRD B;  1IP9 A;  3L10 B;  4KIK B;  3EEC A;  1XT9 B;  4TQ1 A;  3SDL C;  2MBB B;  2KX0 A;  3A33 B;  4MM3 A;  3PS6 A;  5LLI A;  3QJZ A;  4MGK E;  3H7P A;  4MGY E;  1E7V A;  2GBR A;  4FBJ B;  2C7H A;  2AYO B;  2KC1 A;  2BKF A;  4EFO A;  1QZE A;  5DPT A;  4CHK A;  2JF5 A;  3DVG Y;  4FUL A;  4HPM B;  2LGY A;  2REX A;  2JRH A;  2FCS A;  4IWP A;  1CMX B;  2DZM A;  3NZS A;  2CHW A;  2K6D B;  4IM0 A;  3ZRC A;  1VCB A;  3A9J B;  4WJQ A;  5D7G A;  1WF9 A;  4DBG A;  5LXH A;  4K81 A;  4W9I A;  1R4N I;  3HM6 X;  3JSV A;  3QAQ A;  4KDI C;  3WAP A;  3VDZ A;  1E7U A;  2KQS A;  2G3Q B;  2NPT A;  2HJ8 A;  2ZPY A;  4MSQ B;  3ZDT A;  2KWV B;  3VH4 B;  3N32 A;  3QCA A;  2BYF A;  3PRE A;  5EDS A;  3M62 B;  2EMS A;  2KQ7 A;  1UGM A;  3PZD A;  5J17 A;  4FN2 A;  1E8W A;  2JT4 B;  3PRP B;  1WZ0 A;  3T8M A;  4GDL B;  4IG7 B;  3PLV A;  4KSK C;  2IO0 B;  2M0X A;  1E5W A;  2JY6 A;  1S3S G;  4IUM B;  1V80 A;  2HTH A;  2QHO A;  2A5U A;  2NVU I;  4GMV A;  4I6P A;  4HPL B;  1P98 A;  2KXJ A;  4A20 A;  2J7Q B;  3L08 A;  2KO3 A;  2G45 B;  4BBN C;  1ZW7 A;  3WAN A;  2LRU A;  2HE7 A;  2KHW B;  4JIO U;  1UH6 A;  2DZI A;  3S2A A;  3ONS A;  2IY0 B;  3ZO5 B;  3NOB A;  3PHW B;  4EZJ A;  2V4L A;  3B08 A;  2LXA A;  1IPG A;  2I1J A;  2KFK A;  3B0A A;  3VUY A;  3GOE A;  3W1S A;  3L0W B;  4ANV A;  3KH0 A;  3H9D A;  2KX3 A;  1E8X A;  2AEH A;  2BPS A;  4AUQ C;  2G4S A;  5L83 A;  4FJZ A;  2KN5 A;  2Z0E B;  3RYT A;  1LXD A;  2BKR B;  2IBI B;  3AXC A;  2DEN B;  3APC A;  3DPD A;  2L76 A;  1WJN A;  2C7N B;  3VVW B;  4B95 A;  4CYE A;  1EF1 A;  2XK5 A;  4YL8 A;  2C9W B;  2MBE A;  2MCN B;  2KAN A;  1WX7 A;  2J0M A;  4GGQ A;  5BO4 B;  2KJR A;  4NNJ B;  2MLB A;  4W9D A;  2Z0D B;  2WX0 A;  2MX2 A;  1YX6 B;  3WIM A;  3EC8 A;  1I35 A;  1OEY A;  5D94 A;  2BWE S;  3QC8 B;  1WR6 E;  3ZNH B;  2RR9 A;  4AWJ A;  3WAM A;  3A4S C;  2IY1 B;  2JXX A;  3VQI A;  2MWS B;  2O6V B;  3WA0 A;  2LJ5 A;  1WGH A;  3ZNZ B;  1F9J A;  3V6C B;  2R2Q A;  3LJ3 A;  3VUW A;  2D2Q A;  1V2Y A;  4MJS A;  2KLG A;  3I3T B;  2ZNV B;  1WGG A;  3MHS D;  3ZW3 A;  2EKE C;  1SE9 A;  1V86 A;  3GZN I;  2LD9 A;  1Q5W B;  2AL6 A;  2N9P C;  4IWQ A;  2L0F A;  2DYO A;  5E6P A;  3CSF A;  2HD5 B;  4WJN A;  4DHJ B;  2OJR A;  3R66 C;  1UBI A;  1SIF A;  1K8R B;  2PEA A;  3U7D A;  4ZRJ A;  4NPN A;  3QK0 A;  1J8C A;  4RM8 A;  1I42 A;  1SGH A;  1AAR A;  2A4Z A;  4M8M A;  3JW0 X;  2K8H A;  2MP2 B;  5CHF A;  4FJY A;  5C1Z A;  3PLU A;  4KDL B;  2GBM A;  3A9K A;  1GJZ A;  2LWP A;  4RMA A;  3AI5 A;  2KNB A;  3IVF A;  5DPS A;  1P9D U;  2M4N A;  3QHT A;  4TV3 A;  4DDG D;  4GDK A;  3V62 A;  2J0J A;  1UBQ A;  3SU8 X;  4GIV A;  2OOB B;  4BOS C;  3QIJ A;  3AU5 A;  2D07 B;  4EKU A;  1KJT A;  3ECI A;  3ZLZ A;  1WX8 A;  1ZGU B;  2LI5 A;  4LDT B;  3QA8 A;  5IA7 A;  1WFY A;  2FCQ A;  3O65 B;  2MBQ A;  3A1Q B;  2LGD A;  4LCD E;  2N9E B;  4DWF A;  4KSL C;  4J6I A;  4A3P A;  3CMM B;  4W9J A;  4KVG B;  1NI2 A;  4F1S A;  3MTN B;  3ZRF A;  2DX5 B;  3P2B A;  3K9O B;  2PE9 A; 
#chains in the Genus database with same CATH topology
 2PKO A;  4XZ4 A;  2EKI A;  4GB9 A;  4F7Z A;  1D5Z C;  5JZE B;  3I5J C;  2JU6 X;  2D3C A;  4BOZ B;  2KTF A;  2GI9 A;  5HFY A;  4ASW C;  1IGC A;  2WXI A;  5TR5 A;  1SEB D;  4USA A;  1KLG D;  3ML8 A;  4XE0 A;  5JH5 C;  1TBE A;  3R7R A;  3PRM B;  2JPH A;  2FCM A;  3BVG A;  2ZNV C;  1N62 A;  2KD0 A;  2X8X X;  5AZG A;  2CJO A;  2W54 A;  2DAF A;  4HKQ A;  5C2T B;  1SJH D;  2ZPN A;  4E71 A;  5L95 C;  4URK A;  1WMH B;  4LLG M;  4W9K A;  4FJV B;  1V5T A;  2I38 A;  2WX1 A;  4L2Y A;  3J9C A;  3DWG C;  3EFC A;  2K3U A;  2KFJ A;  3N20 C;  2CHZ A;  1KFY B;  3CF6 E;  5KHQ A;  4MDK E;  2MJD A;  1TZ1 A;  2QCZ A;  2WXP A;  2FNJ B;  1ZP0 B;  3FIL B;  2BB5 A;  1Q10 A;  2AQ3 B;  2G9H D;  4ZRI A;  4K7U A;  2DBY A;  3L13 A;  2IDY A;  1WH3 A;  1SJE D;  4P7I A;  1EO6 A;  3V05 A;  1GNU A;  1T0S C;  2Y5C A;  3Q8C A;  4RGO S;  2K8C A;  2CJN A;  3GE3 C;  4WWM A;  2WWZ A;  4ACF A;  1M4V A;  2LUE A;  4MM3 B;  3VTW A;  1GC6 A;  3AE8 B;  4M01 A;  4I6L B;  5CHW A;  2V9H A;  1L4D B;  4LNK A;  1KF6 B;  4KV2 A;  4IWO A;  4EEW A;  4NJ6 A;  1OQY A;  5CHV C;  1RLF A;  4ZDV A;  4EZK A;  1TS5 A;  4FLH A;  1WYG A;  2WXG A;  1KLV A;  3QWZ B;  1JAL A;  2J0K A;  4ZHO A;  1J0G A;  2B3A A;  4WQM A;  3Q8E A;  3CST A;  3P1M A;  1T6B X;  1YNT E;  2LGX A;  4HJK A;  3K9P B;  3OJ4 B;  2RDG A;  3HIZ A;  1QOA A;  4W9H A;  2DYM A;  2UU7 A;  2LGS A;  5HI1 A;  3ZJT A;  1JWS D;  2GBK A;  2NS5 A;  3PTF C;  1ACC A;  1WYW B;  3L17 A;  4HK2 A;  2FCN A;  4M02 A;  3M95 A;  1ZE3 D;  4TUU A;  2KWU B;  2WGS A;  4E3C A;  1WGY A;  1AWD A;  3NY5 A;  3RCZ A;  2MRP A;  2LAS A;  4HDO A;  3DWM A;  1T0Y A;  1P1A A;  1WI0 A;  2YLM A;  2ZJD A;  3Q3J A;  1BXT A;  3N3K B;  1WIA A;  4M0W B;  1KH0 A;  1I7H A;  2PJH A;  4LK0 M;  3V61 A;  4TSS A;  3A1Q A;  5HG2 A;  1F2R C;  3RPF C;  4ZRK A;  1TYG B;  4K3C A;  1WXM A;  2SEB D;  1JRP A;  2ZCB A;  2M19 A;  2XNA C;  1KLU D;  2AQ2 B;  4NQL B;  4PYZ A;  2CHX A;  3LYY A;  4BKT A;  1GB4 A;  4W9E A;  1TS2 A;  5H8Y E;  2MA9 B;  4JX1 C;  2MHJ A;  4AJW A;  2XEW A;  2NCN A;  2DHZ A;  4RM9 A;  1NEK B;  3OJ3 A;  3A9K B;  4US8 A;  4TMA B;  1GUA B;  3QQ8 B;  1C3T A;  2WDQ B;  3RNB C;  5AZF A;  3DVN U;  4PYU A;  3RUL A;  1WMH A;  1GPX A;  5IP4 D;  4W9F A;  1M94 A;  2RDB C;  4JLC A;  2D5G A;  3W1S C;  4IM2 A;  4JQW C;  4R3D A;  1IGD A;  5TSS A;  1MFW A;  1IBX B;  1F1H A;  3N9Y C;  2N9K A;  4FXC A;  1WZ3 A;  4ANU A;  4A9A A;  2JZ3 B;  1EF5 A;  1OTR B;  2H88 B;  3H6N A;  2BGF A;  2N0S B;  2L05 A;  1HZ5 A;  1FNU A;  4FA6 A;  2KK8 A;  3FIL A;  3T3O A;  3HHM A;  2OED A;  4HRO A;  1UZX B;  1RAX A;  2W82 A;  3MP9 A;  3AEF B;  2VZK B;  4EOY A;  4KGR A;  3ZTC A;  4TKN A;  3Q3F A;  1I4H A;  3PHX B;  1IP9 A;  2DNF A;  4KIK B;  1ET9 A;  1YOV B;  2MBB B;  2KX0 A;  4MM3 A;  2OHF A;  3PS6 A;  1MJD A;  2QJL A;  4HPP A;  3U7Z A;  2BKF A;  2V3N A;  2JF5 A;  4FUL A;  3NZS A;  4WJQ A;  5D7G A;  5LXH A;  2ICI A;  3W2D A;  3QAQ A;  4KDI C;  3WAP A;  4HRS A;  1E7U A;  3CIR B;  2KQS A;  2ZPY A;  1AN8 A;  2BYF A;  3Q69 A;  5EDS A;  1FNV A;  1UGM A;  3BK2 A;  1TY2 A;  1E8W A;  3PRP B;  1WZ0 A;  4GDL B;  3ZJU A;  1K51 A;  2M0X A;  1S3S G;  1YN4 A;  4IUM B;  4OZA A;  4HPL B;  2VZK D;  1QKZ A;  2G45 B;  3WAN A;  2KHW B;  2KYW A;  2JQR B;  2IY0 B;  4ARI A;  2IGG A;  1IPG A;  2I1J A;  1YQ3 B;  1E8X A;  4AUQ C;  2KN5 A;  2ON8 A;  3AXC A;  4YSY B;  2DEN B;  1EF1 A;  2C9W B;  2NTS A;  2WU5 B;  3O13 A;  2J0M A;  4M0W A;  4L1B A;  5BO4 B;  4W9D A;  2Z0D B;  4L23 A;  2MX2 A;  2KN4 A;  3QC8 B;  3BYY B;  4AWJ A;  3ZXR A;  2JX5 A;  2JXX A;  2MWS B;  2O6V B;  1F9J A;  2KLG A;  2ZNV B;  3MHS D;  3ZW3 A;  4RH6 A;  1V86 A;  2LD9 A;  4K3B A;  1Q5W B;  4US9 A;  2DYO A;  4AS1 A;  4DHJ B;  2OJR A;  1PFD A;  3AEE B;  4NPN A;  4RM8 A;  1SGH A;  1AAR A;  4HEA 1;  2MP2 B;  3AMZ A;  3URY A;  3PLU A;  3A9K A;  1VZ7 A;  1DYQ A;  1T5X D;  2NTT A;  3FC4 A;  1P9D U;  2RMM A;  4TV3 A;  1E10 A;  1TY0 A;  3RNC C;  4RGM A;  2OOB B;  4ZHP A;  1B1Z A;  1KJT A;  1WX8 A;  1ZGU B;  2J42 A;  2LI5 A;  5BYR A;  5IA7 A;  1NEN B;  4LCD E;  4KSL C;  1NI3 A;  4W9J A;  1D5X C;  1NI2 A;  4F1S A;  1ZUD 2;  1IBX A;  1FM0 D;  2K6Q A;  3AM9 A;  2O6V D;  2CR5 A;  2KMA A;  3B9J A;  4AJY B;  1I4Q A;  1A70 A;  3DOW A;  2UYZ B;  4DHZ B;  4BFR A;  3UI3 A;  2CU1 A;  3ZKJ C;  4DHJ D;  2AWT A;  2AL3 A;  2KAC A;  3TMP B;  2M8S A;  3DBR I;  3AE6 B;  4ARC A;  4DQO C;  4XDC A;  2W3R A;  3NRZ A;  3BY4 B;  1C4P A;  1GC7 A;  3RNF C;  3APD A;  4MEM A;  4RGN A;  5AUK A;  5FK9 C;  1WX9 A;  3DBR B;  4RGT A;  3E56 A;  1TZO A;  3OLM D;  1JWM D;  4KIK A;  1LFD A;  4NAM A;  3H7S A;  4G0N B;  1LGR A;  3RI7 C;  1TKY A;  5T8I A;  2BW2 A;  1J19 A;  1EUV B;  1XLN A;  1UEL A;  1FO4 A;  2DWQ A;  3PZ8 A;  3QAR A;  1Q1O A;  4GLS C;  3DBL I;  1FXI A;  5D2M B;  4LJP B;  2KDB A;  3LDZ E;  5AUI A;  2XBB C;  2RD0 A;  3IT6 B;  1J7B A;  4X57 B;  3SHQ A;  1IYF A;  3RUI B;  1FIQ A;  2J52 A;  3T9L A;  4GDL A;  3DBL B;  1YN3 A;  2V3P A;  2LHE A;  1OEY J;  3B2G A;  3IT4 B;  3X0W A;  4DXA B;  1EU4 A;  4ZRQ A;  3TCA A;  3OG5 A;  3KWV A;  3N1X C;  2V1Y A;  5C23 A;  1NYR A;  3U30 A;  4REZ A;  4II2 B;  4WWO A;  5AZH A;  2RDH A;  2BS2 B;  1QOB A;  4EUT A;  3H7P B;  1WM2 A;  1UWM A;  2JYE A;  3DBS A;  2WP9 B;  2MBH A;  3ABV B;  1N6Z A;  1CQV A;  1TIF A;  4EZL A;  1QOF A;  1YX5 B;  3KUD B;  2Y5B B;  2D3G A;  2INP E;  1HTO A;  2NPT B;  4MEL A;  2KMC A;  4HCN B;  4LNO A;  1FD6 A;  3A4R A;  4WJP A;  3AU4 A;  2K22 A;  2LZ6 A;  4P16 A;  5IAA C;  3RD2 A;  1WJU A;  4JGH B;  1S1Q B;  2G1E A;  2O6V A;  4GN1 A;  3U8Z A;  2N1V A;  5JHA A;  4WQO B;  2KC2 A;  1WGD A;  5E6N A;  3RFZ B;  1N61 A;  2K9X A;  2INC C;  1AW7 A;  1X1M A;  1WJ6 A;  2M56 B;  2L32 A;  5BMG A;  3UIP B;  1VDV A;  1A5R A;  5IN7 A;  2MP2 A;  2G4D B;  1C79 A;  3TEZ A;  2WQY B;  3WAO A;  4KKJ A;  3R3M A;  4FHJ A;  2W9N A;  1MG8 A;  3IHP C;  2ZZP B;  1J7C A;  1P7E A;  5D6J B;  4ANW A;  3VFK A;  3PV1 A;  3NJT A;  2IGH A;  1VRA B;  1YD8 U;  3C0R B;  5DCN A;  1V81 A;  2W3S A;  4LTU A;  3SR6 A;  5HKH A;  3H1U A;  1WE7 A;  2KVR A;  3AEG B;  1YQB A;  4K1R B;  1AYF A;  3ZUN A;  4N59 A;  2EMT A;  3NG0 A;  2KWD A;  2JWU A;  1H4R A;  2K0P A;  2BVC A;  2M17 A;  4CO7 A;  2QEJ C;  2D3A A;  3BII D;  2WDT B;  5GMV A;  2EEL A;  3RZW C;  2PW9 A;  2FE8 A;  3EFU A;  2IO1 B;  2L0T A;  4XC2 A;  1DOY A;  1Z5S B;  1SXT A;  3CWI A;  3ZDM C;  3X23 A;  1XLQ A;  4B6W A;  1WXA A;  4WWP A;  2HTM E;  3HRD D;  1JW9 D;  2HJ1 A;  3B1L X;  4KGS A;  4LJO B;  4PS8 A;  2L7R A;  2ONQ A;  4MAC A;  1FMA D;  1PGX A;  1KRH A;  2MBO A;  3AEA B;  1ZKH A;  1U4A A;  2E3T A;  1OQR A;  2Z59 B;  1TKE A;  2JVC A;  3KVF B;  2MW5 A;  3L4P A;  3KQ4 A;  4KZ0 A;  1CZP A;  5G2N A;  3MC8 A;  2J53 A;  5J2R A;  4MT5 A;  3ML9 A;  1WRD B;  2B76 B;  3L10 B;  1F77 A;  2ZW1 A;  2PTL A;  3H7P A;  2IJ0 A;  1E7V A;  1EU3 A;  3U2S C;  1UWX A;  2AYO B;  4HPM B;  4A55 A;  2REX A;  1CMX B;  1RYJ A;  1VCB A;  1RWS A;  4DBG A;  3RNE C;  1F0Z A;  2NMQ A;  1V1P B;  5BYQ A;  2NPT A;  4MSQ B;  3SFE B;  4YTM B;  1VZ6 A;  2QDF A;  1JML A;  3PRE A;  3M62 B;  1C4A A;  4C80 A;  4J3O D;  1K52 A;  3PLV A;  2IO0 B;  5IOI A;  1E5W A;  1D4B A;  2NVU I;  1FNW A;  1P98 A;  1YMH E;  2KXJ A;  4A20 A;  3AE5 B;  4BBN C;  1TS4 A;  4JIO U;  1UH6 A;  3ONS A;  3ZXV A;  3ZO5 B;  3NOB A;  2QIL A;  3PHW B;  4EZJ A;  2JSV X;  3GOE A;  3W1S A;  3NS1 A;  2Q5W D;  2KX3 A;  2BPS A;  2G4S A;  5L83 A;  2DLB A;  1LXD A;  4YT0 B;  2Z8L A;  3DPD A;  1MG4 A;  4B95 A;  1SB3 C;  1WJN A;  2C7N B;  2MBE A;  2MCN B;  1WX7 A;  1KTK A;  5HHD G;  4GGQ A;  4NNJ B;  1SE4 A;  1WXQ A;  1HXY D;  2BS4 B;  4B0E A;  1K53 A;  1YN5 A;  1YX6 B;  3NVV A;  1OEY A;  3VR9 B;  4NZL B;  2V4I B;  3WAM A;  3A4S C;  3VQI A;  1WGH A;  3V6C B;  3LJ3 A;  1V2Y A;  3I3T B;  1WGG A;  2IPK D;  3ZJV A;  2AL6 A;  4IWQ A;  4OW0 A;  4ZOH C;  2PEA A;  1TJE A;  1J8C A;  4UDU C;  2GRI A;  2K8H A;  3P4P B;  3I57 A;  4FJY A;  1STE A;  5C1Z A;  2GBM A;  2LWP A;  5G5H A;  2FUG 1;  2M4N A;  3MC9 A;  2J0J A;  1MI0 A;  4BOS C;  2BTE A;  2LJI A;  1QLB B;  3QIJ A;  1YJJ A;  3AU5 A;  4EKU A;  4B0M A;  3KWL A;  2WXL A;  4LDT B;  1WFY A;  2FCQ A;  3O65 B;  4S0R A;  4LNI A;  2DX5 B;  5FKA C;  3W5U B;  5IO9 A;  2PE9 A;  2K39 A;  1V49 A;  3L54 A;  5EE1 A;  2GBJ A;  3ZNI D;  2GBN A;  1G6J A;  4NJC A;  1D6E C;  4JE3 B;  1YJ1 A;  1HE8 A;  2KZR A;  4XDD A;  4BKS D;  3N1Y C;  1V97 A;  3KUZ A;  3AE2 B;  2W55 A;  4NY0 A;  4GU2 A;  3WAL A;  2N7E A;  3BIN A;  1CK1 A;  3NHE B;  2ZVO A;  2L8J A;  4H2A A;  4ANX A;  3FKY A;  3TEY A;  3PGE A;  1BT0 A;  1E8Z A;  2MH7 A;  3ALB A;  4LDT D;  1I4X A;  4ICU A;  3BZD B;  3ZIM A;  4IC7 B;  3MJW A;  1MVK A;  3RZF A;  3BVM A;  5KHO A;  3P42 A;  1L5P A;  2KJH B;  2KKC A;  2VRR B;  3DVG X;  4K7S A;  1WWT A;  4KGT A;  4LNF A;  1V1P A;  1VLB A;  2NBV B;  4GXB A;  3PSE B;  3Q2A C;  4PS7 A;  3VRB B;  3DBH I;  2M1M A;  2JRI B;  3JVZ X;  2KJ6 A;  1RFA A;  3N1Z C;  2JUO A;  1WY8 A;  4HWI B;  4OZB A;  2KTR B;  2LVQ A;  1WXV A;  1ZDX A;  3HK0 A;  3NZ3 A;  2IO2 B;  3DBH B;  3NVW A;  2JXT A;  4YWG G;  1JWA D;  3PRZ A;  2R2O A;  3DVN V;  3M63 B;  1V5O A;  1PQS A;  1WGK A;  2DYB A;  4P1B C;  1UUP A;  2PVO D;  4KZC A;  1DGJ A;  1FXA A;  2BB6 A;  4D2K A;  1T0Q C;  4IKG A;  3M3J A;  2FUH B;  5C3J B;  1ZXI A;  2Y3A A;  1N5W A;  3DQV A;  2WS3 B;  5JHB A;  5DPW A;  5CTR C;  2WDR B;  4RF0 A;  2IO3 B;  3P4S B;  4G50 A;  3UGB B;  2NR2 A;  3AE1 B;  2CS4 A;  3B2F A;  1QIL A;  2FIF A;  4C4V B;  1BUI C;  3TJP A;  1C9F A;  1P0R A;  3TIX A;  1BML C;  1I4G A;  2MSE D;  1WSP A;  2C60 A;  3E9S A;  2DZK A;  4PS3 A;  2WYQ A;  3N30 A;  1WM3 A;  4W9L A;  2N9X A;  3IG3 A;  4ZYS A;  4BKS A;  2M0A A;  2H89 B;  3I63 C;  3Q3O C;  3ZNG C;  4WJO A;  2RGF A;  2KMM A;  1D5M C;  1SF0 A;  2L3Z A;  3P4R B;  2KVZ A;  1Y8R C;  4A3O A;  3VHT C;  3APF A;  4LNN A;  1E8Y A;  3EHV A;  1TTN A;  3HVD A;  3V60 A;  4OVU A;  3GE8 C;  1L7Y A;  2UWQ A;  1ZPS A;  3ENE A;  3VRA B;  1R4N B;  3ZVV A;  3BWU D;  4MJS B;  1C1Y B;  2X38 A;  1E0Z A;  3KYC D;  2OJW A;  3VXW A;  4YTN B;  3DCG A;  1CJE A;  2MEK A;  4G3X B;  4FHK A;  1XXG A;  3SD5 A;  2RPQ A;  5G55 A;  4XX5 A;  4KX6 B;  4JL9 A;  4HCP B;  4PT5 A;  3NZU A;  1WRI A;  3VH3 B;  5BYS A;  5E6O A;  4WH4 A;  1XQQ A;  1ZDV A;  4GSW A;  2PE6 B;  1MPE A;  5EE3 A;  4N6E B;  1F2R I;  3DDC B;  3IBE A;  1KM7 A;  2IZV B;  3ZYY X;  2BYV E;  3V3X A;  2K1F A;  3RN9 C;  1LM8 B;  3I9V 1;  2BYT A;  2C7M B;  1VD2 A;  1Z2M A;  2I2Y A;  1NBF C;  3NS8 A;  3ZQ4 A;  5G5G A;  1KOT A;  1FXT B;  1L6V A;  4P1C C;  4FAD A;  5EE9 A;  4W9G A;  3W5V B;  4IM3 A;  3RNG C;  4WAA A;  4GOC A;  3V6E B;  2NBU A;  3LXF A;  2D11 A;  3H8H A;  4N58 A;  1PDX A;  4OZC A;  2KTR A;  1C4C A;  2LXC A;  2QIE B;  2LVO A;  3Q14 C;  4RF1 A;  1L2N A;  1E7P B;  2D10 A;  3EEC A;  4TQ1 A;  5LLI A;  1EM7 A;  4MGK E;  4MGY E;  1N5X A;  2C7H A;  2KC1 A;  4XYC A;  1QZE A;  5DPT A;  4DXF A;  3DHI C;  3DVG Y;  1XF5 L;  3AN1 A;  2FCS A;  1SE3 A;  2DZM A;  3ZRC A;  4IM0 A;  3A9J B;  4RCO A;  3TUO A;  1WF9 A;  3AE7 B;  5FR3 A;  4W9I A;  1XEE A;  3HM6 X;  3GS2 A;  4OVZ A;  2G3Q B;  2HJ8 A;  1TS3 A;  3VH4 B;  3N32 A;  3QCA A;  1ROE A;  1L4Z B;  3WCQ A;  2KQ7 A;  5J17 A;  4FN2 A;  3T8M A;  4IG7 B;  4KSK C;  2JY6 A;  3Q8B A;  4C4V A;  2HTH A;  4I6P A;  2QHO A;  4A90 A;  4BAX A;  1R7S A;  2J7Q B;  3L08 A;  2KO3 A;  3Q6B A;  1ZW7 A;  5GXG B;  2JZP A;  2HE7 A;  1YQ4 B;  1ET6 A;  2PIA A;  3MFG A;  3RMK C;  3NUH B;  2WXK A;  1T0R C;  3B08 A;  4DXG A;  3VUY A;  3AED B;  2TSS A;  3L0W B;  4ANV A;  3H9D A;  2BKR B;  2IBI B;  3VVW B;  3APC A;  4CYE A;  1FFU A;  4YL8 A;  3AEC B;  3BVZ A;  2KAN A;  3Q8F A;  3R2I A;  1QF6 A;  1RM6 C;  2KJR A;  2IND C;  1XLO A;  5D3I B;  1GOZ A;  1ZXH A;  3WIM A;  3EC8 A;  1SE2 A;  4C56 C;  3ZNH B;  2WNM A;  2E6X A;  2IY1 B;  2AX5 A;  3WA0 A;  2LJ5 A;  2R2Q A;  4MJS A;  3P4Q B;  1VZ8 A;  1SE9 A;  2N9P C;  2L0F A;  2WXO A;  5E6P A;  2ZW0 A;  3CSF A;  2HD5 B;  4WJN A;  1UBI A;  1SIF A;  1K8R B;  1F52 A;  2QSD A;  1XCT L;  1JRO A;  3HUI A;  3QK0 A;  3KLS X;  1I42 A;  4S17 A;  4CQN A;  4XWW A;  4KDL B;  1GJZ A;  1L6U A;  4RMA A;  1TKG A;  5MPO A;  2KNB A;  3IVF A;  1PYW D;  4DDG D;  1UBQ A;  3U52 E;  3SU8 X;  4GIV A;  3TEW A;  3ECI A;  4QAY A;  2WXF A;  2MBQ A;  3NVY A;  1IUE A;  2N9E B;  3EGR A;  2R61 A;  5E6J A;  3MTN B;  3ZRF A;  3P2B A;  1VR9 A;  1OQQ A;  3K9O B;  2LEK A;  5LXI B;  1LO5 D;  4C7Z A;  4HJG E;  4WWN A;  3IFW B;  3Q3N C;  2O2V B;  2PPH A;  3JYU A;  4MGZ E;  2ASQ A;  1FRD A;  1PGB A;  4F8C B;  4NQK E;  4XGA B;  3UQB A;  1TGZ B;  3MHZ A;  3PPA A;  2VH2 A;  4HVB A;  3MJ5 A;  3C19 A;  4P6V F;  4ZYN A;  1QOG A;  1LQB A;  4JPS A;  1XO3 A;  4XWT A;  2L1A A;  4AQ7 A;  2KDM A;  2WXM A;  2GMI C;  4M8N A;  3KYD D;  2N1W A;  4I6N B;  3UIN B;  5H92 C;  3Q8A A;  3R7Q A;  1WE6 A;  4MH0 E;  4NAW B;  1GB1 A;  3AEB B;  3KW5 B;  2ZCC A;  3A9J A;  2WDV B;  3PO0 A;  2C5L C;  4IOI E;  1PGA A;  5J18 A;  3UQA A;  4YXD B;  1YJI A;  1HZ6 A;  2BYE A;  2D3B A;  2I1K A;  4HLE A;  2BBC A;  1QQR A;  2JWZ A;  4DK5 A;  1HTQ A;  3VTU A;  2KT7 A;  2KLC A;  2NBW B;  1C76 A;  3IAM 1;  2WU2 B;  1DOX A;  3AE9 B;  3R2T A;  4MSM B;  3HVZ A;  4G11 A;  3KUC B;  1YIW A;  2LMC A;  3R8B A;  3U4E G;  1NDD A;  2KWC A;  3TEX A;  4B9K A;  2L52 A;  2BT6 A;  4HXD A;  1SSN A;  3UF8 A;  2YVC A;  1JRU A;  2K5P A;  4AOF A;  1RRB A;  3OAW A;  2BWF A;  2DAJ A;  1FRR A;  1I4P A;  1QT9 A;  2WXN A;  3JSV B;  2DZJ A;  1HEZ E;  3W1Y A;  1Q0W B;  1WXS A;  1UD7 A;  3AUL A;  2K8B A;  3QX1 A;  1TT5 B;  1MHX A;  4BBN F;  1JCK B;  2L00 B;  3PZ7 A;  1VJK A;  2PVG C;  4ICV A;  2N7D A;  1XD3 B;  3ETR A;  1V9J A;  2ZEQ A;  4IW0 A;  4Q2J A;  1C78 A;  1JQ4 A;  2KDI A;  5EE0 A;  4OVV A;  2KOX A;  4RNA A;  2WXQ A;  1H8C A;  1RFK A;  2WXH A;  4MGI E;  1ISN A;  3ZGZ A;  4PK1 A;  1ENF A;  2KFK B;  4KKI A;  5CX3 A;  2LFI A;  3HM3 A;  5BMI A;  2FID A;  2LRW A;  2YEP F;  2XK5 B;  3IXS A;  1ZOY B;  3L16 A;  4II3 B;  1P3Q U;  1GG3 A;  4E74 A;  3UIO B;  1R4M I;  1FFV A;  3AV8 A;  3NVZ A;  2KDF B;  4EE2 A;  2RPV A;  1XCQ L;  4JWS C;  3BK1 A;  3MC0 B;  1P7F A;  1N60 A;  2LGI A;  1R4M B;  2LHD A;  4DDI D;  2LUM A;  2O2V A;  4W9C A;  1D3Z A;  4BKG A;  2N7J A;  2RSU A;  4HDQ A;  3VTV A;  4NJ7 A;  1E90 A;  2FBW B;  3P63 A;  2BF8 B;  4K7W A;  3TBL D;  1WGR A;  2LVP A;  1K50 A;  4GDK B;  3PVL A;  4BVU C;  1B9R A;  2ZVN A;  2QC8 A;  3SFD B;  2V3S A;  2KAJ A;  1OGW A;  4BZA A;  4C7Y A;  5FR6 A;  4DHZ E;  1WR1 A;  1EWY C;  3SEB A;  3RT3 B;  3VAW A;  2JYT A;  1OFF A;  4AP4 C;  2GLS A;  3AE4 B;  4NAW A;  3TL5 A;  1V6E A;  3AB5 A;  2IYD B;  3C8Y A;  2MQJ A;  2WHI A;  2N4F A;  5AEK B;  4TQ0 A;  2WLB A;  2KDE B;  2L83 A;  3OWE B;  4WAF A;  1V1O A;  4YSZ B;  3PT2 B;  3VUX A;  3LB8 C;  3D32 A;  3IAS 1;  2WXJ A;  3T3N A;  1DOI A;  1J7A A;  2GOW A;  3ZTD A;  5I4D A;  1EWC A;  3VR8 B;  2MJE A;  2K25 A;  1E9M A;  4OHJ A;  4WIP A;  2CKH B;  4N9F 4;  2FAZ A;  5DPR A;  5BMH A;  3GP7 A;  3DHH C;  1FCC C;  4JWU C;  2JZZ A;  1WJ4 A;  2IGD A;  2Y5P A;  4ITK A;  2WXR A;  4A8X C;  1XT9 B;  3GB1 A;  5D3D A;  3SDL C;  3A33 B;  2QMT A;  3QJZ A;  2GBR A;  4FBJ B;  2PLP A;  4EFO A;  4CHK A;  5JXV A;  2LGY A;  2JRH A;  4IWP A;  2V0G A;  2CHW A;  2K6D B;  3RNA C;  1NVI D;  1Y56 A;  4K81 A;  1R4N I;  1C77 A;  3JSV A;  2AQ1 B;  3VDZ A;  1I4R A;  3ZDT A;  4IDI A;  2KWV B;  4YSX B;  3W9C B;  3AH7 A;  2EMS A;  1V8C A;  3PZD A;  4WUR A;  1FEH A;  2JT4 B;  3TSS A;  2INN E;  1V80 A;  1SIJ A;  2A5U A;  2SAK A;  3DHG C;  4GMV A;  4O1N A;  3EA6 A;  1XLP A;  2LRU A;  1L0Y B;  1ESF A;  2DZI A;  3S2A A;  2CU3 A;  2V4L A;  2LXA A;  1PUT A;  2KFK A;  3B0A A;  3KH0 A;  2AEH A;  1L0X B;  4FJZ A;  2Z0E B;  3RYT A;  1L0V B;  2KQ4 X;  2L76 A;  2XN9 C;  5IKC M;  4A6Q A;  1HA5 A;  2N9L A;  2XK5 A;  4C00 A;  1E6E B;  1JWU D;  4RFB A;  4M00 A;  2ACZ B;  2MLB A;  1FPY A;  3AE3 B;  2WX0 A;  1I35 A;  5D94 A;  2BWE S;  1WR6 E;  2J4X A;  2RR9 A;  1SBB B;  3ZNZ B;  1GAQ B;  2BS3 B;  3VUW A;  2D2Q A;  1HQR D;  4MH8 A;  4YTP B;  2EKE C;  3GZN I;  4HKZ E;  5LNK 1;  1N63 A;  1MHH E;  3R66 C;  3FAH A;  2HDE A;  3U7D A;  4ZRJ A;  1UGJ A;  1UF0 A;  2A4Z A;  4M8M A;  3GZN B;  3JW0 X;  5CHF A;  1NYQ A;  3Q3M C;  1FCL A;  3AI5 A;  5DPS A;  3QHT A;  4GDK A;  3BYT B;  3V62 A;  1JWB D;  2D07 B;  2MJ3 A;  4ZRP A;  3ZLZ A;  2GB1 A;  2VH1 A;  2BQQ A;  3QA8 A;  1T3Q A;  1UNS A;  3EUB 2;  3A1Q B;  2LGD A;  4DWF A;  2YEP B;  4J6I A;  4A3P A;  3CMM B;  4KVG B;  2PMV A; 
#chains in the Genus database with same CATH homology
 2K39 A;  2K6Q A;  4XZ4 A;  5LXI B;  1V49 A;  2O6V D;  2CR5 A;  2KMA A;  3L54 A;  4AJY B;  4GB9 A;  4WWN A;  4F7Z A;  5JZE B;  3DOW A;  2GBJ A;  3IFW B;  2UYZ B;  2O2V B;  3ZNI D;  2GBN A;  4DHZ B;  1G6J A;  4BOZ B;  2PPH A;  2KTF A;  3JYU A;  4BFR A;  4MGZ E;  2ASQ A;  2CU1 A;  3ZKJ C;  4DHJ D;  2AWT A;  2AL3 A;  1YJ1 A;  4ASW C;  1HE8 A;  2KZR A;  4F8C B;  4NQK E;  3TMP B;  4BKS D;  5TR5 A;  3UQB A;  1TGZ B;  2M8S A;  3ML8 A;  5JH5 C;  3DBR I;  1TBE A;  3KUZ A;  4NY0 A;  3PPA A;  3R7R A;  4HVB A;  4GU2 A;  3WAL A;  3PRM B;  2JPH A;  2N7E A;  3BY4 B;  2FCM A;  2ZNV C;  1GC7 A;  3BIN A;  2KD0 A;  4ZYN A;  3NHE B;  1LQB A;  3APD A;  4MEM A;  5AZG A;  2ZVO A;  2DAF A;  2L8J A;  1WX9 A;  2ZPN A;  4ANX A;  4E71 A;  5L95 C;  4URK A;  3OLM D;  1BT0 A;  3PGE A;  1WMH B;  4W9K A;  4FJV B;  4KIK A;  1LFD A;  1E8Z A;  1V5T A;  2GMI C;  3ALB A;  4M8N A;  3H7S A;  3KYD D;  4G0N B;  4LDT D;  2N1W A;  2WX1 A;  4I6N B;  4ICU A;  3UIN B;  3ZIM A;  1J19 A;  4IC7 B;  3MJW A;  3R7Q A;  1EUV B;  1UEL A;  3RZF A;  1WE6 A;  4MH0 E;  4NAW B;  2KFJ A;  2CHZ A;  5KHO A;  2KKC A;  2KJH B;  2VRR B;  3DVG X;  3KW5 B;  2ZCC A;  4K7S A;  3CF6 E;  3A9J A;  3QAR A;  1Q1O A;  2C5L C;  3DBL I;  5KHQ A;  2NBV B;  4MDK E;  5D2M B;  4GXB A;  1TZ1 A;  4LJP B;  2KDB A;  3PSE B;  5J18 A;  3UQA A;  4PS7 A;  3LDZ E;  2FNJ B;  2XBB C;  3DBH I;  2M1M A;  2JRI B;  2RD0 A;  2BYE A;  4HLE A;  2I1K A;  3JVZ X;  4X57 B;  3SHQ A;  2KJ6 A;  1IYF A;  1RFA A;  2JWZ A;  4ZRI A;  3RUI B;  4K7U A;  3T9L A;  4DK5 A;  4GDL A;  3L13 A;  2JUO A;  1WY8 A;  3VTU A;  1WH3 A;  2KLC A;  2NBW B;  1OEY J;  4HWI B;  2KTR B;  3X0W A;  4DXA B;  2LVQ A;  1WXV A;  3HK0 A;  2IO2 B;  4P7I A;  1EO6 A;  3TCA A;  4MSM B;  1GNU A;  4G11 A;  3PRZ A;  3KUC B;  2R2O A;  2V1Y A;  5C23 A;  1YIW A;  2K8C A;  3U30 A;  3DVN V;  4II2 B;  3M63 B;  4WWO A;  5AZH A;  1V5O A;  1PQS A;  1NDD A;  2WWZ A;  2DYB A;  2KWC A;  4B9K A;  2LUE A;  4HXD A;  3VTW A;  1GC6 A;  3UF8 A;  4EUT A;  3H7P B;  2YVC A;  4KZC A;  1JRU A;  4I6L B;  5CHW A;  1WM2 A;  3M3J A;  4AOF A;  2FUH B;  1RRB A;  3DBS A;  2MBH A;  3OAW A;  4KV2 A;  2BWF A;  2DAJ A;  4IWO A;  4EEW A;  4NJ6 A;  3DQV A;  1OQY A;  5CHV C;  4EZL A;  1YX5 B;  1RLF A;  4ZDV A;  4EZK A;  3KUD B;  2Y5B B;  5JHB A;  2D3G A;  4FLH A;  3JSV B;  2DZJ A;  1KLV A;  3QWZ B;  5DPW A;  3W1Y A;  2NPT B;  5CTR C;  4MEL A;  1Q0W B;  2KMC A;  1WXS A;  2J0K A;  4HCN B;  1J0G A;  1UD7 A;  3AUL A;  2IO3 B;  2K8B A;  3A4R A;  3QX1 A;  4G50 A;  4WJP A;  3AU4 A;  4BBN F;  2L00 B;  3UGB B;  2B3A A;  2LZ6 A;  5IAA C;  3RD2 A;  1WJU A;  2NR2 A;  3CST A;  4JGH B;  2CS4 A;  4ICV A;  2N7D A;  1XD3 B;  1S1Q B;  1V9J A;  2FIF A;  2O6V A;  4GN1 A;  2LGX A;  4HJK A;  3U8Z A;  3TJP A;  2ZEQ A;  3K9P B;  4IW0 A;  1P0R A;  3OJ4 B;  3HIZ A;  3TIX A;  2N1V A;  4W9H A;  2DYM A;  4WQO B;  2KDI A;  5JHA A;  2GBK A;  2MSE D;  2C60 A;  2KC2 A;  2NS5 A;  3PTF C;  1WGD A;  1WYW B;  3L17 A;  4HK2 A;  2DZK A;  4PS3 A;  5E6N A;  2WYQ A;  4OVV A;  2FCN A;  3M95 A;  3N30 A;  1WM3 A;  2KOX A;  2N9X A;  4W9L A;  3IG3 A;  1H8C A;  4TUU A;  1X1M A;  1WJ6 A;  2KWU B;  4MGI E;  4BKS A;  1ISN A;  3UIP B;  4E3C A;  1WGY A;  2KFK B;  1A5R A;  5CX3 A;  3NY5 A;  3ZNG C;  3HM3 A;  2MP2 A;  4WJO A;  2G4D B;  2MRP A;  3RCZ A;  2LAS A;  2RGF A;  2LRW A;  2FID A;  2L3Z A;  4HDO A;  3WAO A;  1T0Y A;  1P1A A;  1WI0 A;  1Y8R C;  4A3O A;  2YLM A;  3VHT C;  2ZJD A;  3APF A;  2XK5 B;  3Q3J A;  3R3M A;  4FHJ A;  2W9N A;  1MG8 A;  3L16 A;  3IHP C;  3N3K B;  4II3 B;  1P3Q U;  2ZZP B;  1E8Y A;  1WIA A;  3EHV A;  4M0W B;  1TTN A;  2PJH A;  1GG3 A;  3V60 A;  4OVU A;  3V61 A;  4E74 A;  1L7Y A;  3UIO B;  1R4M I;  5D6J B;  2UWQ A;  4ANW A;  3ENE A;  3VFK A;  3A1Q A;  3PV1 A;  2KDF B;  4ZRK A;  1YD8 U;  3C0R B;  1WXM A;  3ZVV A;  2ZCB A;  4MJS B;  1C1Y B;  5DCN A;  3KYC D;  3VXW A;  1V81 A;  4NQL B;  4PYZ A;  2CHX A;  4DDI D;  5HKH A;  4BKT A;  4W9E A;  3DCG A;  3H1U A;  1WE7 A;  2MA9 B;  2KVR A;  2O2V A;  1YQB A;  4K1R B;  4AJW A;  4G3X B;  4FHK A;  3ZUN A;  3SD5 A;  2XEW A;  4W9C A;  2RPQ A;  5G55 A;  1D3Z A;  2EMT A;  2NCN A;  2DHZ A;  4BKG A;  4XX5 A;  4RM9 A;  2RSU A;  4HDQ A;  4HCP B;  4JL9 A;  3VTV A;  1H4R A;  3NZU A;  4NJ7 A;  3VH3 B;  3OJ3 A;  1E90 A;  3A9K B;  5E6O A;  2BF8 B;  4K7W A;  1GUA B;  3TBL D;  2M17 A;  1XQQ A;  1WGR A;  3QQ8 B;  2LVP A;  4GSW A;  2PE6 B;  4CO7 A;  3PVL A;  2WDT B;  4GDK B;  5GMV A;  4BVU C;  1C3T A;  5AZF A;  2ZVN A;  3DVN U;  3RZW C;  3DDC B;  3IBE A;  3EFU A;  2IO1 B;  4PYU A;  1KM7 A;  2L0T A;  2IZV B;  2BYV E;  4XC2 A;  3RUL A;  2V3S A;  1WMH A;  1Z5S B;  2K1F A;  1OGW A;  1LM8 B;  4W9F A;  3ZDM C;  1M94 A;  4JLC A;  3X23 A;  3W1S C;  5FR6 A;  4B6W A;  1WXA A;  4DHZ E;  4IM2 A;  4WWP A;  1WR1 A;  4JQW C;  2C7M B;  3RT3 B;  3VAW A;  4AP4 C;  1WZ3 A;  1VD2 A;  1Z2M A;  3B1L X;  4NAW A;  3TL5 A;  4ANU A;  1V6E A;  1NBF C;  2IYD B;  4LJO B;  4PS8 A;  2L7R A;  3NS8 A;  2MQJ A;  2JZ3 B;  1KOT A;  1EF5 A;  2N4F A;  1OTR B;  5AEK B;  3H6N A;  2BGF A;  1FXT B;  2L05 A;  4TQ0 A;  4FAD A;  2MBO A;  4FA6 A;  2KDE B;  1ZKH A;  2KK8 A;  4W9G A;  3HHM A;  4IM3 A;  1U4A A;  3PT2 B;  4WAA A;  1UZX B;  2Z59 B;  1RAX A;  4GOC A;  3V6E B;  3VUX A;  2JVC A;  3D32 A;  3KVF B;  2NBU A;  2MW5 A;  2GOW A;  3ZTD A;  2D11 A;  4KZ0 A;  4EOY A;  2KTR A;  5G2N A;  2LXC A;  3ZTC A;  2K25 A;  4TKN A;  2CKH B;  3Q3F A;  4N9F 4;  5J2R A;  2LVO A;  2FAZ A;  5DPR A;  2JZZ A;  1WJ4 A;  1L2N A;  3PHX B;  2D10 A;  3ML9 A;  1WRD B;  1IP9 A;  3L10 B;  4KIK B;  3EEC A;  1XT9 B;  4TQ1 A;  3SDL C;  2MBB B;  2KX0 A;  3A33 B;  4MM3 A;  3PS6 A;  5LLI A;  3QJZ A;  4MGK E;  3H7P A;  4MGY E;  1E7V A;  2GBR A;  4FBJ B;  2C7H A;  2AYO B;  2KC1 A;  2BKF A;  4EFO A;  1QZE A;  5DPT A;  4CHK A;  2JF5 A;  3DVG Y;  4FUL A;  4HPM B;  2LGY A;  2REX A;  2JRH A;  2FCS A;  4IWP A;  1CMX B;  2DZM A;  3NZS A;  2CHW A;  2K6D B;  4IM0 A;  3ZRC A;  1VCB A;  3A9J B;  4WJQ A;  5D7G A;  1WF9 A;  4DBG A;  5LXH A;  4K81 A;  4W9I A;  1R4N I;  3HM6 X;  3JSV A;  3QAQ A;  4KDI C;  3WAP A;  3VDZ A;  1E7U A;  2KQS A;  2G3Q B;  2NPT A;  2HJ8 A;  2ZPY A;  4MSQ B;  3ZDT A;  2KWV B;  3VH4 B;  3N32 A;  3QCA A;  2BYF A;  3PRE A;  5EDS A;  3M62 B;  2EMS A;  2KQ7 A;  1UGM A;  3PZD A;  5J17 A;  4FN2 A;  1E8W A;  2JT4 B;  3PRP B;  1WZ0 A;  3T8M A;  4GDL B;  4IG7 B;  3PLV A;  4KSK C;  2IO0 B;  2M0X A;  1E5W A;  2JY6 A;  1S3S G;  4IUM B;  1V80 A;  2HTH A;  2QHO A;  2A5U A;  2NVU I;  4GMV A;  4I6P A;  4HPL B;  1P98 A;  2KXJ A;  4A20 A;  2J7Q B;  3L08 A;  2KO3 A;  2G45 B;  4BBN C;  1ZW7 A;  3WAN A;  2LRU A;  2HE7 A;  2KHW B;  4JIO U;  1UH6 A;  2DZI A;  3S2A A;  3ONS A;  2IY0 B;  3ZO5 B;  3NOB A;  3PHW B;  4EZJ A;  2V4L A;  3B08 A;  2LXA A;  1IPG A;  2I1J A;  2KFK A;  3B0A A;  3VUY A;  3GOE A;  3W1S A;  3L0W B;  4ANV A;  3KH0 A;  3H9D A;  2KX3 A;  1E8X A;  2AEH A;  2BPS A;  4AUQ C;  2G4S A;  5L83 A;  4FJZ A;  2KN5 A;  2Z0E B;  3RYT A;  1LXD A;  2BKR B;  2IBI B;  3AXC A;  2DEN B;  3APC A;  3DPD A;  2L76 A;  1WJN A;  2C7N B;  3VVW B;  4B95 A;  4CYE A;  1EF1 A;  2XK5 A;  4YL8 A;  2C9W B;  2MBE A;  2MCN B;  2KAN A;  1WX7 A;  2J0M A;  4GGQ A;  5BO4 B;  2KJR A;  4NNJ B;  2MLB A;  4W9D A;  2Z0D B;  2WX0 A;  2MX2 A;  1YX6 B;  3WIM A;  3EC8 A;  1I35 A;  1OEY A;  5D94 A;  2BWE S;  3QC8 B;  1WR6 E;  3ZNH B;  2RR9 A;  4AWJ A;  3WAM A;  3A4S C;  2IY1 B;  2JXX A;  3VQI A;  2MWS B;  2O6V B;  3WA0 A;  2LJ5 A;  1WGH A;  3ZNZ B;  1F9J A;  3V6C B;  2R2Q A;  3LJ3 A;  3VUW A;  2D2Q A;  1V2Y A;  4MJS A;  2KLG A;  3I3T B;  2ZNV B;  1WGG A;  3MHS D;  3ZW3 A;  2EKE C;  1SE9 A;  1V86 A;  3GZN I;  2LD9 A;  1Q5W B;  2AL6 A;  2N9P C;  4IWQ A;  2L0F A;  2DYO A;  5E6P A;  3CSF A;  2HD5 B;  4WJN A;  4DHJ B;  2OJR A;  3R66 C;  1UBI A;  1SIF A;  1K8R B;  2PEA A;  3U7D A;  4ZRJ A;  4NPN A;  3QK0 A;  1J8C A;  4RM8 A;  1I42 A;  1SGH A;  1AAR A;  2A4Z A;  4M8M A;  3JW0 X;  2K8H A;  2MP2 B;  5CHF A;  4FJY A;  5C1Z A;  3PLU A;  4KDL B;  2GBM A;  3A9K A;  1GJZ A;  2LWP A;  4RMA A;  3AI5 A;  2KNB A;  3IVF A;  5DPS A;  1P9D U;  2M4N A;  3QHT A;  4TV3 A;  4DDG D;  4GDK A;  3V62 A;  2J0J A;  1UBQ A;  3SU8 X;  4GIV A;  2OOB B;  4BOS C;  3QIJ A;  3AU5 A;  2D07 B;  4EKU A;  1KJT A;  3ECI A;  3ZLZ A;  1WX8 A;  1ZGU B;  2LI5 A;  4LDT B;  3QA8 A;  5IA7 A;  1WFY A;  2FCQ A;  3O65 B;  2MBQ A;  3A1Q B;  2LGD A;  4LCD E;  2N9E B;  4DWF A;  4KSL C;  4J6I A;  4A3P A;  3CMM B;  4W9J A;  4KVG B;  1NI2 A;  4F1S A;  3MTN B;  3ZRF A;  2DX5 B;  3P2B A;  3K9O B;  2PE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...