2WYQA

The crystal structure of the ubiquitin-like (ubl) domain of hhr23a (human homologue a of rad23)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
MAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKNFVVVMVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords UV EXCISION REPAIR PROTEIN RAD23 HOMOLOG A
publication title The Crystal Structure of the Ubiquitin-Like (Ubl) Domain of Human Homologue a of Rad23 (Hhr23A) Protein
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2009-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2wyqA00
1EO6A 5LLIA 1UBQA 4WJNA 2UWQA 4GDLA 3RT3B 2MX2A 1WXVA 4W9HA 5KHQA 2JVCA 2MBOA 2KC2A 2ASQA 3CSFA 1WMHA 3PREA 3WAPA 4ZYNA 3LJ3A 5FR6A 5AZFA 3PSEB 3L54A 3PRPB 2AL3A 3KUDB 4DHJD 3APDA 2DAJA 2KDBA 4ZRIA 2MA9B 3WA0A 3RCZA 3IVFA 3T8MA 4CO7A 1VCBA 5JZEB 3H7PA 4FHKA 4MSMB 5G2NA 4NNJB 3R7RA 4AJYB 2LVOA 1UGMA 3L10B 2KHWB 1Y8RC 2D2QA 4KZ0A 3QQ8B 3VQIA 3DBRI 3N30A 4B95A 3A9JA 2BKRB 3QJZA 4OVVA 3TIXA 2L00B 2ZJDA 4GDLB 3L13A 4E3CA 2KLGA 4KVGB 2B3AA 3VH4B 4ANVA 2A4ZA 4PS7A 1WM3A 3UGBB 4IC7B 3MHSD 3AXCA 2N1VA 3T9LA 2V4LA 2DENB 4ICVA 3IBEA 4LDTB 4HXDA 4FADA 1F9JA 1WIAA 2LRUA 2NBUA 3VTWA 2KKCA 4MJSB 1LM8B 5E6PA 2LVQA 3IHPC 3QIJA 2D3GA 1WR6E 3QK0A 3X0WA 4EZJA 5DPSA 1QZEA 3H7PB 4G11A 2LXCA 2N9XA 2LJ5A 4G50A 4BKTA 2KDEB 3U8ZA 2N9PC 4KIKA 1I35A 3Q3FA 3NS8A 3KW5B 1TZ1A 4LDTD 3KH0A 3Q3JA 5DPTA 5J2RA 4W9KA 2DZKA 2EKEC 4ANXA 2RGFA 3A9JB 3AI5A 1ZGUB 3A1QA 4WAAA 4W9IA 1WXMA 4NAWA 4W9JA 2G45B 3DCGA 3V6CB 1OEYA 3VH3B 3HM6X 4EKUA 4GU2A 2HTHA 3PTFC 4A3PA 2JF5A 1P98A 1HE8A 3BY4B 4FULA 4HDQA 2PJHA 2CR5A 2LZ6A 4B6WA 5J18A 2RD0A 4NY0A 4TKNA 3VAWA 3VTUA 4BBNC 5JH5C 3B08A 2K25A 3W1SC 4KSLC 3PLVA 2KWCA 1H4RA 2KNBA 4XC2A 2A5UA 4IWQA 2ZCBA 2LRWA 1WX9A 1GJZA 3U30A 1E90A 3HK0A 4AJWA 4W9CA 1SGHA 3ZVVA 1WZ3A 3M95A 3PS6A 3VDZA 5L95C 3ZUNA 3NHEB 2WWZA 2NBWB 4WWOA 2XBBC 4NAWB 3EHVA 1V2YA 3JVZX 4IM0A 3ENEA 4OVUA 2FCQA 5CHWA 3UINB 3OLMD 3PT2B 1KM7A 3QC8B 5D2MB 3ZTCA 1KOTA 1WX8A 4W9EA 2J0KA 4HCNB 2DYBA 2WX1A 3DPDA 2K8CA 2XK5A 4JQWC 3V61A 3VUXA 3ZRFA 3DQVA 5BO4B 4TQ1A 2G4DB 2MSED 1WJ4A 4WWNA 5C1ZA 2N9EB 1LXDA 3O65B 1E8YA 3DBHI 2VRRB 2V1YA 1M94A 3TBLD 2Z0DB 2MP2B 3V60A 3U7DA 1RRBA 4M8MA 1IP9A 2L0FA 4II3B 2KJHB 5CHVC 3ZLZA 2KOXA 4NQLB 1J8CA 2KJRA 1R4NI 3KUCB 2EMSA 3JSVA 2PE6B 4IW0A 2BKFA 1NBFC 2G3QB 1OGWA 3DVGX 2KVRA 3N3KB 2GBKA 4BOZB 1GUAB 2RPQA 2FUHB 3AULA 2M1MA 3IG3A 1WGRA 3VXWA 3HIZA 3V62A 3ZO5B 1GC7A 1XQQA 2O6VA 3R3MA 3NZUA 5DPRA 3UIOB 2CS4A 3SD5A 3VHTC 1Q1OA 2L3ZA 3BINA 3MJWA 1C1YB 4I6LB 3RUIB 2M4NA 3TJPA 3PRZA 3CMMB 1UH6A 2KWVB 4KSKC 2ZVNA 2BYEA 2K8BA 2ZPYA 4W9FA 2HE7A 2LGYA 4A3OA 1WGGA 2UYZB 4EFOA 4TV3A 2OOBB 3ECIA 4JGHB 4ANUA 4A20A 3RZFA 4EOYA 4WQOB 2Z59B 5AZHA 2YVCA 2KZRA 1YQBA 2KXJA 2G4SA 1WGDA 4E71A 4EZKA 2KFJA 1WGHA 3GZNI 2KJ6A 3ZNGC 2JT4B 1H8CA 2NS5A 2O2VA 1VD2A 2ZVOA 3H9DA 2BPSA 4B9KA 3ZDMC 4FJZA 3PHWB 2ZZPB 4HPLB 2KLCA 2L8JA 4GN1A 3APCA 4XZ4A 2DHZA 3RYTA 4KZCA 2O6VB 2BGFA 4DK5A 1WFYA 1OEYJ 2KQ7A 2V3SA 3IFWB 1U4AA 4HWIB 2KMAA 1UZXB 4FLHA 3TCAA 3RZWC 3SDLC 1S3SG 2JRIB 4AUQC 2L7RA 3M3JA 4K7UA 4HLEA 1WMHB 3UF8A 4BFRA 2FNJB 4K1RB 1XT9B 2DAFA 2BYVE 2CHZA 4HJKA 4K81A 1OQYA 4M0WB 2CU1A 2N7DA 2R2QA 3PHXB 4YL8A 3HHMA 4ZRJA 1KJTA 3DVGY 1YD8U 3ZTDA 4WWPA 2MRPA 4EUTA 1P0RA 2DX5B 3QAQA 2BWES 2O2VB 4GDKA 4P7IA 4NJ7A 4AP4C 2JWZA 5D94A 4DHJB 2AEHA 4IWPA 1WM2A 1PQSA 4FHJA 3CSTA 3LDZE 3JYUA 4LJOB 2IY1B 4AWJA 5C23A 2JUOA 4RM8A 2JXXA 2MLBA 1WXSA 3KVFB 4W9GA 3WALA 4HCPB 1V5TA 1CMXB 2C7HA 2IO1B 4IG7B 4BKSA 3DDCB 3ML9A 2BF8B 3QX1A 3VFKA 4FA6A 3N32A 2FAZA 4ANWA 2DYOA 2R2OA 3ZDTA 3QA8A 3ONSA 2LI5A 4ASWC 3OJ3A 3WAMA 3L0WB 2EMTA 3TMPB 1YJ1A 1WGYA 2KFKA 2AWTA 2LUEA 4GDKB 1UD7A 4KIKB 1WI0A 3PVLA 5DPWA 1WJ6A 1IYFA 3X23A 2KC1A 1GG3A 3NZSA 3QHTA 3DVNV 1GC6A 3QWZB 3SU8X 1EF1A 2KX0A 5LXIB 1C3TA 3A1QB 3DBLI 3EECA 2KQSA 2CHXA 3DOWA 2D11A 1RLFA 3AU5A 1WE6A 3VTVA 3UQAA 4FJVB 2LASA 5G55A 2LD9A 4MEMA 5KHOA 3GOEA 5IA7A 3B0AA 3C0RB 4MH0E 4DWFA 4LJPB 5JHAA 3L08A 1L7YA 2JPHA 2L76A 2MBHA 2W9NA 4KDLB 1RFAA 3PZDA 4E74A 1Z5SB 2LGDA 4I6NB 5HKHA 1FXTB 3HM3A 2KTRA 4GOCA 3QARA 1BT0A 2AYOB 1SE9A 2KDFB 1WH3A 1WX7A 2N1WA 3PV1A 4EZLA 3A9KA 1WZ0A 4G0NB 4FJYA 3KUZA 3H7SA 4HVBA 2KANA 4GXBA 2WYQA 3M63B 4G3XB 1ZW7A 4J6IA 1KLVA 2K6QA 4MM3A 3K9OB 1MG8A 2Y5BB 3UQBA 4K7SA 5D6JB 3H6NA 4IWOA 4DDGD 2KTFA 2XK5B 2KMCA 4IM3A 4DHZE 2JRHA 4IM2A 2JZ3B 2LVPA 2IO3B 2MWSB 4HDOA 2WDTB 4MDKE 2L0TA 2LGXA 1V6EA 2NR2A 3A4RA 5E6OA 2M17A 3W1YA 4MGIE 4WJOA 4GIVA 2K1FA 2CHWA 2C7MB 1E8WA 2NCNA 3A9KB 1NI2A 5CTRC 2ZPNA 4W9LA 4K7WA 3V6EB 4X57B 3VVWB 2GMIC 3PGEA 3JSVB 2ZCCA 1E7VA 3M62B 3UIPB 3DBSA 2J7QB 3PPAA 3APFA 4JIOU 2K39A 4W9DA 2ZEQA 3A33B 4F1SA 2GBNA 2KN5A 1V86A 1YX6B 2AL6A 2IZVB 2RR9A 4JLCA 4PS8A 4CYEA 2LWPA 5TR5A 4JL9A 3ZIMA 4DHZB 4IUMB 4RM9A 1J0GA 4MGYE 2D10A 2FCSA 4MJSA 3W1SA 3P2BA 1V9JA 1EUVB 3RD2A 4PS3A 3ZNHB 3KYDD 3VUYA 1E7UA 2KD0A 2HD5B 2FCMA 4RMAA 2OJRA 1I42A 4F8CB 2FCNA 1WY8A 2O6VD 4LCDE 1E8ZA 3PRMB 2I1JA 4BVUC 2M8SA 2MBEA 5CX3A 1WJNA 2NBVB 1WXAA 3NOBA 2NPTA 1Q5WB 1EF5A 2GOWA 2KWUB 2MQJA 1WYWB 2Z0EB 2K8HA 1G6JA 4MSQB 2GBRA 1UBIA 4ZRKA 1L2NA 2GBMA 4EEWA 5LXHA 2CKHB 1IPGA 3ZNID 2DZJA 4GGQA 4MGKE 5CHFA 4AOFA 4BOSC 1A5RA 4TUUA 3K9PB 2MBBB 1ISNA 3CF6E 4FN2A 1WRDB 3ML8A 3VUWA 2KDIA 3B1LX 1WF9A 3H1UA 1D3ZA 4ZDVA 3OJ4B 1UELA 2HJ8A 2IO2B 4BBNF 4NJ6A 1E5WA 3EC8A 4MGZE 1LFDA 1V49A 2C60A 2N4FA 2XEWA 2REXA 3SHQA 5L83A 4TQ0A 2IYDB 2BWFA 4GB9A 2RSUA 4XX5A 5EDSA 1NDDA 2NPTB 2PPHA 2GBJA 2JZZA 2KK8A 3ALBA 2L05A 1YX5B 3R66C 2IO0B 4KV2A 4PYUA 2BYFA 4KDIC 2YLMA 2KX3A 3A4SC 5E6NA 3R7QA 1RAXA 4DBGA 2KO3A 1AARA 1TBEA 2M0XA 3EFUA 2NVUI 1V80A 3L16A 3ZW3A 1WR1A 4NQKE 2DZMA 4M8NA 5AZGA 3OAWA 4WJPA 5J17A 2D07B 4MELA 5D7GA 4DDID 2J0MA 3RULA 2MP2A 4HPMB 3WANA 4GMVA 1E8XA 1XD3B 3S2AA 3QCAA 4CHKA 3ZNZB 3MTNB 2QHOA 5GMVA 2MW5A 1K8RB 1R4MI 2KFKB 2MCNB 1TGZB 1LQBA 2ZNVB 1P3QU 1JRUA 4DXAB 3AU4A 1V5OA 4BKSD 3I3TB 1GNUA 2C7NB 2JY6A 5IAAC 2I1KA 5JHBA 4II2B 3JW0X 4ICUA 3ZRCA 1TTNA 3DVNU 2DYMA 2J0JA 2K6DB 1ZKHA 3L17A 1X1MA 1YIWA 1Z2MA 3TL5A 1V81A 4FBJB 2C9WB 4PYZA 2PE9A 2FIFA 4GSWA 1J19A 1T0YA 1OTRB 2WX0A 1P9DU 4URKA 4NPNA 1WJUA 3D32A 3WAOA 3ZKJC 3WIMA 1P1AA 2LXAA 2DZIA 4F7ZA 4BKGA 4WJQA 2IY0B 2KTRB 2IBIB 4N9F4 3KYCD 1Q0WB 2C5LC 2N7EA 1S1QB 1SIFA 3NY5A 5AEKB 1WE7A 3PLUA 2FIDA 2ZNVC 2PEAA 5DCNA 4HK2A 4I6PA 2MBQA
chains in the Genus database with same CATH superfamily
2UWQA 2JVCA 2KC2A 2ASQA 3CSFA 3WAPA 3PSEB 3PRPB 4ZRIA 4CO7A 1VCBA 5JZEB 1FXAA 2LVOA 1UGMA 3AE2B 3L10B 4LNFA 1NEKB 3QQ8B 4B95A 2RMMA 3TIXA 1XEEA 3L13A 4KVGB 2A4ZA 3UGBB 4IC7B 3AXCA 2N1VA 2V4LA 4XWTA 4LDTB 4R3DA 2INPE 3FILA 2LRUA 1K50A 1LM8B 2VZKD 1WR6E 3X0WA 5DPSA 2Y5PA 4G11A 2LXCA 4G50A 1I35A 3KW5B 5EE9A 2L1AA 3Q3JA 5DPTA 4W9KA 1JWMD 2DZKA 1WXMA 4NAWA 3ZYYX 2JX5A 2LGSA 3URYA 2INDC 2N9LA 3PTFC 4A3PA 3B2GA 2LJIA 1J7BA 4FULA 1L5PA 2K0PA 5J18A 3GE8C 2RD0A 4TKNA 1N5XA 4BBNC 4B0EA 2K25A 1ET6A 3SEBA 1H4RA 2KNBA 4XC2A 4HRSA 1I4HA 3RI7C 1R4MB 3HK0A 3PO0A 1QLBB 1RFKA 2GI9A 1DYQA 4DQOC 2V3NA 3U2SC 1HXYD 4ZYSA 4NAWB 3ENEA 3QC8B 1KM7A 1UF0A 1FIQA 2DYBA 3ZRFA 2WXJA 3DQVA 3Q8FA 4WWNA 3LB8C 5C1ZA 1LXDA 1E8YA 3DBHI 4M8MA 4ZOHC 5CHVC 3MFGA 1J8CA 2EMSA 3JSVA 4KGTA 1NBFC 1OGWA 3DVGX 1KFYB 2N7JA 3N3KB 1OQRA 2FUHB 1C4PA 3AULA 3IG3A 5C2TB 2WXLA 1GC7A 3NZUA 2CS4A 3SD5A 2WU5B 4KSKC 2BYEA 4N58A 2WU2B 1MHXA 1RM6C 1WGGA 4TV3A 4JGHB 4A20A 5AZHA 2LMCA 4M0WA 5HFYA 4C80A 1L6VA 1YQBA 5G5HA 4EZKA 3Q8BA 5HHDG 4BAXA 5BYSA 2KJ6A 1VD2A 2QIEB 1GB4A 2ZZPB 4HPLB 3APCA 4AS1A 1WFYA 1OEYJ 2KQ7A 3IFWB 4FLHA 3SR6A 3SDLC 3OWEB 1S3SG 2JRIB 4AUQC 4HLEA 1WMHB 3UF8A 2EKIA 4K1RB 2DAFA 2BYVE 4HJKA 4M0WB 4YL8A 1KJTA 4OVZA 3ZTDA 1P0RA 2DX5B 3QAQA 4P7IA 4AP4C 2AEHA 2MJDA 2WS3B 1PQSA 3LDZE 3ZJUA 4OZBA 2JUOA 5I4DA 2JXXA 3KVFB 3WALA 4HCPB 3ZXVA 4IG7B 3H8HA 3ML9A 3N32A 2R2OA 3QA8A 1JWUD 4LTUA 2AWTA 1SE3A 2LUEA 4KIKB 1WI0A 2J4XA 4RF0A 1F52A 1VJKA 3AU5A 1E9MA 1BMLC 1TKYA 5IA7A 1FMAD 2MBHA 4GOCA 2KTRA 4M02A 4DXGA 1SE9A 3RNAC 1WH3A 1D6EC 1WX7A 2DWQA 2N1WA 1WZ0A 4G0NB 1L0VB 3H7SA 4HVBA 2JXTA 2KANA 1KLVA 3K9OB 1N5WA 2KN4A 1MG8A 2XN9C 2BQQA 2KTFA 4HROA 3MHZA 4IM3A 4ACFA 4NJCA 1I4RA 2ON8A 4LNIA 3KLSX 2OEDA 2TSSA 5E6OA 2M17A 3W1YA 4GIVA 4L2YA 4WAFA 3V6EB 1NI2A 2ZPNA 3DBRB 4X57B 2I38A 4M01A 2ZCCA 3PPAA 4JIOU 4UDUC 2MHJA 5TR5A 4JL9A 4IUMB 1N60A 3RPFC 4MGYE 4USAA 4TMAB 2KDMA 1WXQA 3ZNHB 3KYDD 4RMAA 2OJRA 2FCNA 3BIID 1N6ZA 2NBVB 2NPTA 2WDVB 1EF5A 1SE4A 2MQJA 2PIAA 2WHIA 4L1BA 1UBIA 4ZRKA 3RNGC 1PGAA 1WRDB 2WXFA 3VUWA 3B1LX 3OJ4B 1UELA 4RF1A 1T6BX 1AN8A 3VR8B 3TEWA 5L83A 4TQ0A 2IYDB 4GB9A 3MC9A 3DBLB 2NPTB 5JXVA 2QDFA 1SB3C 2JZZA 2KK8A 3ALBA 2L05A 3R66C 2IO0B 4L23A 1SJED 3A4SC 2KO3A 3EFUA 3BYYB 1ZE3D 3ZW3A 1FFUA 4M8NA 5AZGA 2WXRA 4MELA 5D7GA 4S0RA 2J0MA 2MP2A 1STEA 3AE4B 3S2AA 3ZNZB 1C76A 2BW2A 1JRUA 3JW0X 2DYMA 1FEHA 3RNEC 4O1NA 2PE9A 1XLPA 1J19A 2CU3A 1K51A 1P1AA 4F7ZA 4WH4A 4LK0M 4N9F4 2V9HA 2C5LC 4YSZB 5DCNA 1QF6A 2MEKA 4WJNA 3RT3B 1WXVA 4W9HA 2MJ3A 3NS1A 4YTPB 1JRPA 3LJ3A 5AZFA 3ETRA 3L54A 3KUDB 3IT6B 2W82A 3I63C 2MA9B 4RH6A 3IVFA 3H7PA 2NTSA 4JWUC 2D2QA 3VQIA 3DBRI 1YJIA 3N30A 1UWMA 4C7YA 3QJZA 2GB1A 2VZKB 4WIPA 2L83A 4KKJA 3AEGB 1C78A 4HXDA 4FADA 5BMGA 3VTWA 4MJSB 4WURA 5E6PA 3QK0A 2D3GA 1QZEA 2Y3AA 3H7PB 1K53A 2N9XA 2V4IB 1WRIA 3NS8A 2PTLA 3MJ5A 3AI5A 2KT7A 2BS3B 2KVZA 1BUIC 4W9IA 2G45B 3DCGA 3V6CB 1JQ4A 1P98A 1HE8A 2ACZB 4B6WA 4NY0A 5JH5C 3B08A 4K3CA 1T3QA 3W1SC 2LEKA 2ZCBA 2LRWA 3W2DA 4W9CA 5D3IB 1WZ3A 3M95A 3VDZA 5L95C 1XCQL 3ZUNA 3BK2A 2M0AA 3JVZX 3TEZA 2FCQA 1E7PB 3OLMD 5D2MB 3ZTCA 4N59A 2J0KA 2WX1A 2K8CA 2ZW1A 2FUG1 4TQ1A 2G4DB 2MSED 4KGSA 5D3DA 2QILA 3NVVA 1M94A 2Z0DB 1LO5D 3V60A 1RRBA 2IGHA 1TJEA 2WXPA 1IP9A 2L0FA 2KJHB 2KOXA 4IOIE 2UU7A 2WNMA 4JX1C 2BKFA 2LHEA 1XLQA 2GBKA 2RPQA 3NVZA 3VXWA 3AMZA 3R3MA 3NG0A 1TS2A 2L3ZA 3BINA 3AE6B 3RUIB 3CWIA 3CMMB 3Q3OC 2K8BA 3T3OA 1FM0D 2LGYA 4GLSC 2UYZB 2OOBB 1E10A 2MJEA 2YVCA 2KXJA 1HZ6A 3PZ7A 3GZNI 2KAJA 2ZVOA 3ZDMC 4FJZA 1E6EB 2KLCA 1PFDA 1WWTA 3HVZA 4XZ4A 1ZP0B 1R7SA 3AE5B 5T8IA 4HWIB 1CJEA 1PDXA 3Q69A 4XDDA 4ARIA 1OQQA 2L7RA 3P1MA 4K7UA 4NAMA 1EU4A 4RNAA 2CU1A 2WXQA 3AE8B 2MRPA 4EUTA 4GDKA 2WXGA 3W5VB 2IY1B 5C23A 5BYQA 4RM8A 1UUPA 4W9GA 4LNOA 2C7HA 4IDIA 4BKSA 3FILB 4FA6A 2FAZA 4ANWA 3ZDTA 4ASWC 4ZRQA 4KX6B 3L0WB 4J3OD 2EMTA 1JWBD 1WGYA 2KFKA 4GDKB 1UD7A 4REZA 3I9V1 3X23A 3DVNV 4P1BC 1GC6A 3QWZB 5H8YE 3SU8X 5LXIB 4OHJA 1WE6A 3UQAA 1T5XD 4MEMA 5KHOA 4AQ7A 3AH7A 1N63A 1XCTL 1I4QA 3C0RB 3Q8CA 1HZ5A 4A6QA 2L76A 2W9NA 4KDLB 1ZXHA 3VRBB 1R4NB 1XLNA 3QARA 4Q2JA 5H92C 4WQMA 3RNCC 3PV1A 1SEBD 4FJYA 1FRRA 2JZPA 3KUZA 4GXBA 2WYQA 5C3JB 3M63B 3MC0B 4G3XB 5EE1A 1UWXA 2KQ4X 2Y5BB 4XE0A 4JPSA 2PKOA 4B0MA 3Q8EA 3VR9B 2KMCA 5LNK1 2JRHA 4IM2A 1L4ZB 2IO3B 4HDOA 4XDCA 4P6VF 4MDKE 2L0TA 4US8A 2LGXA 1VZ7A 4OW0A 3VVWB 1IGDA 3JSVB 1E7VA 1GOZA 3M62B 2L52A 2J7QB 4N6EB 1JALA 1K52A 2JYEA 4W9DA 3A33B 2GBNA 2IZVB 1SBBB 3RN9C 4JLCA 1KLUD 2CJNA 3AV8A 3W5UB 1EUVB 3RD2A 1KLGD 3AM9A 1JWSD 4C56C 4C7ZA 1WY8A 1SXTA 4YT0B 3ZXRA 1EWYC 2SEBD 1E8ZA 3PRMB 4HJGE 3O13A 1TS5A 2MBEA 5CX3A 1WJNA 3NOBA 1Q5WB 3TEYA 1DGJA 4EEWA 2CKHB 2DZJA 4AOFA 3GP7A 4JE3B 4TUUA 1A5RA 3K9PB 1RYJA 1ISNA 2KDIA 1WYGA 2X8XX 4ZDVA 4MGZE 5AUKA 1F1HA 4QAYA 2XEWA 2REXA 3SHQA 3HVDA 1NDDA 3B9JA 2HTME 2GBJA 1YX5B 2JU6X 3R7QA 2QEJC 2QSDA 1AARA 1TBEA 2M0XA 5E6JA 4NQKE 3OAWA 4WJPA 5J17A 2D07B 3DHGC 4A8XC 1SE2A 1YNTE 4GMVA 1ZPSA 3QCAA 3MTNB 1XLOA 5GMVA 1K8RB 1R4MI 1B9RA 1LQBA 2QJLA 1P3QU 3AU4A 1V5OA 4BKSD 2C7NB 4II2B 4ICUA 2M56B 4YWGG 3BK1A 1ZKHA 3L17A 1TYGB 1XF5L 2WXHA 1P9DU 4URKA 1WJUA 3D32A 3WIMA 2LXAA 2DZIA 4LLGM 2WLBA 4WJQA 2KTRB 2IBIB 3HUIA 3FKYA 3Q2AC 1S1QB 1L6UA 2Q5WD 2JYTA 1YN5A 2PEAA 4MSMB 4I6PA 2BTEA 1UBQA 5HI1A 3N9YC 3P4QB 2BT6A 2OJWA 3PREA 4ZYNA 3GS2A 4DHJD 1ACCA 1EM7A 4RGTA 1VLBA 1MJDA 1TT5B 2DAJA 2KDBA 3WA0A 2LHDA 4FHKA 5G2NA 1Y8RC 4KZ0A 3A9JA 2BKRB 1C79A 1JW9D 4OVVA 2L00B 4E3CA 2B3AA 2XNAC 1F2RC 3MHSD 3T9LA 4ICVA 2MH7A 2D3AA 3N20C 1WIAA 3AEEB 2NBUA 4ITKA 2W55A 2LVQA 3BWUD 3P42A 3IHPC 2BS4B 4EZJA 4C00A 2R61A 2LJ5A 2N9PC 1TZ1A 2ICIA 5J2RA 1EWCA 4XWWA 2EKEC 3A9JB 1ET9A 1EU3A 1ZGUB 3A1QA 3BVGA 4W9JA 5IN7A 1TKEA 1OEYA 4PK1A 4OZAA 1VDVA 2INNE 3BY4B 2CR5A 4P16A 1WSPA 2LZ6A 4IKGA 3VAWA 4HPPA 2RPVA 3PLVA 2KWCA 1FNUA 1FFVA 4IWQA 3MP9A 1WX9A 1E90A 1TY2A 1TZOA 1SGHA 1YN3A 3PS6A 3EFCA 2WWZA 2NBWB 1M4VA 2XBBC 4WWOA 2BYTA 1P7EA 3EHVA 1V2YA 4IM0A 4OVUA 5CHWA 3V05A 3UINB 4A90A 1ZUD2 4W9EA 4HCNB 4JQWC 3VUXA 2XK5A 3V61A 5BO4B 1MHHE 1WJ4A 2Y5CA 1YMHE 4H2AA 3TBLD 2MP2B 4RFBA 3U7DA 2KJRA 3KUCB 2KVRA 1GUAB 1FCLA 3SFDB 2K5PA 3UIOB 3MJWA 1C1YB 3TJPA 2ZVNA 2DNFA 4EFOA 2IJ0A 3AE7B 3RZFA 1Y56A 2Z59B 1HQRD 2KZRA 2G4SA 2E6XA 1WGHA 1H8CA 2O2VA 4LNKA 3PHWB 2D3BA 4GN1A 2AQ2B 2J42A 2V3SA 3BYTB 1VZ8A 2SAKA 1F2RI 1L0XB 1UZXB 5EE0A 2X38A 3RZWC 3M3JA 3WCQA 4BFRA 2OHFA 1V1PA 2CHZA 4K81A 2YEPF 2N7DA 3AECB 3HHMA 3DVGY 1JCKB 4WWPA 2O2VB 4NJ7A 5D94A 1QT9A 2K22A 1WM2A 5IP4D 3P4RB 3CSTA 3U4EG 2JWUA 2AQ1B 4RGNA 5AUIA 4AWJA 3N1XC 4K3BA 1HEZE 1CMXB 2KYWA 2IO1B 3DDCB 1VR9A 2DYOA 1KRHA 3WAMA 3HRDD 3TMPB 2E3TA 1MG4A 1MVKA 2QCZA 4HKQA 5DPWA 2KC1A 1GG3A 4YTMB 1N62A 1EF1A 3DBLI 2KQSA 2CHXA 1RLFA 4YSYB 4ZRPA 4HEA1 5G55A 2LD9A 3GOEA 3B0AA 3DBHB 4DWFA 4LJPB 1F0ZA 5JHAA 2JPHA 4E74A 2D3CA 1Z5SB 1XO3A 1D5ZC 5HKHA 1FXTB 2RDHA 1SF0A 1BT0A 1RWSA 1FNWA 4XGAB 3A9KA 4EZLA 3N1YC 1V8CA 4J6IA 4MM3A 3UQBA 4K7SA 3H6NA 4IWOA 3NVWA 1CQVA 3AE3B 4DHZE 5EE3A 1VZ6A 2LVPA 3U52E 3R2TA 3CIRB 1V6EA 1WGKA 2IGDA 2NR2A 5FK9C 2HDEA 4MGIE 4WJOA 2CHWA 2C7MB 2H89B 1PGBA 5CTRC 3A9KB 4W9LA 5BMHA 2GMIC 2BBCA 3U7ZA 3L4PA 2K39A 2I2YA 1YX6B 4MM3B 2WXKA 4PS8A 2QMTA 3ZIMA 2YEPB 1C4AA 1YN4A 2PVGC 3DWGC 4MT5A 3RFZB 2FCMA 3Q3MC 5GXGB 4F8CB 2HJ1A 4LCDE 4BVUC 5HG2A 1WXAA 1WYWB 2Z0EB 4MSQB 2GBRA 5LXHA 1IPGA 3ZNID 2WDQB 1QOFA 4MGKE 1TKGA 5CHFA 4BOSC 2MBBB 3C19A 3FC4A 3CF6E 1FD6A 1WF9A 3H1UA 1D3ZA 1JMLA 3TUOA 4NJ6A 3VRAB 1E5WA 3EC8A 3T3NA 1LFDA 2N4FA 1JROA 1KTKA 2BWFA 2RSUA 2IPKD 4YXDB 5EDSA 1I7HA 4PYUA 4F1SA 2BYFA 2YLMA 1N61A 3R8BA 2KX3A 3P4SB 3E56A 4KGRA 2NTTA 1RAXA 3ABVB 1C9FA 2GLSA 1V80A 3L16A 2DZMA 1IUEA 4HPMB 3WANA 1E8XA 1FXIA 3EA6A 1L4DB 2QHOA 2KFKB 2MCNB 3J9CA 1GAQB 2LGIA 1GNUA 5IAAC 2JY6A 5JHBA 2I1KA 3ZRCA 1TTNA 2J0JA 2K6DB 1X1MA 3W9CB 1YIWA 1Z2MA 3TL5A 4YSXB 5TSSA 2BB6A 1FNVA 2WX0A 3Q6BA 4D2KA 1V1OA 4NPNA 3BVZA 2BVCA 3GB1A 1SJHD 2IY0B 2BS2B 1HA5A 3KYCD 1Q0WB 1LGRA 2N7EA 1SIFA 3EUB2 1ZOYB 1QOGA 3PLUA 2FIDA 4DHJB 2JSVX 4HK2A 3VH4B 2MBQA 1EO6A 5LLIA 1SSNA 4GDLA 2MX2A 1V97A 2WXIA 5KHQA 2MBOA 2H88B 1AWDA 3Q3NC 1WMHA 3TSSA 2WXNA 3AEFB 5FR6A 2GRIA 1ESFA 1ENFA 2AL3A 3APDA 1OFFA 3RCZA 3T8MA 4OZCA 4NNJB 3R7RA 4AJYB 2K3UA 2KHWB 1P7FA 1T0SC 4C4VA 2ZJDA 2FBWB 4GDLB 2KLGA 4ANVA 4PS7A 1WM3A 1ZDVA 4MH8A 2DENB 3IBEA 1F9JA 5IOIA 2J52A 2KKCA 2B76B 2WP9B 4EE2A 3QIJA 3NUHB 4BKTA 2KDEB 3U8ZA 4KIKA 3Q3FA 4LDTD 2BB5A 3KH0A 1MI0A 1D5XC 4ANXA 2RGFA 1ZDXA 1YQ4B 2N0SB 4WAAA 3EGRA 4C4VB 3VH3B 2G9HD 3HM6X 4EKUA 4GU2A 1QKZA 2HTHA 2WXMA 2W3RA 2JF5A 1CZPA 4HDQA 2PJHA 1GB1A 3SFEB 1YJJA 2KMMA 3VTUA 1I4PA 4KSLC 3I5JC 1IBXA 2A5UA 2DLBA 1UNSA 1GJZA 3U30A 4LNNA 1J7CA 4AJWA 3GE3C 3ZVVA 1DOXA 3AB5A 2VH1A 3NHEB 2PLPA 3NVYA 3PT2B 1KOTA 1WX8A 4S17A 2FE8A 4M00A 3DPDA 2N9EB 1IBXB 1TS4A 3AE1B 3O65B 2VRRB 2V1YA 2G1EA 1YOVB 3IT4B 5BMIA 4II3B 3ZLZA 4NQLB 1R4NI 3DHHC 1C4CA 2PE6B 4IW0A 4RCOA 2G3QB 4BOZB 2M1MA 2WQYB 1WGRA 3HIZA 2DBYA 3V62A 3ZO5B 5BYRA 1XQQA 5DPRA 2O6VA 3VHTC 1Q1OA 3P63A 4ARCA 4I6LB 2WGSA 2M4NA 1PUTA 2W54A 1MPEA 3PRZA 5IKCM 1UH6A 2KWVB 2K9XA 2ZPYA 4W9FA 2HE7A 2IGGA 4A3OA 3ECIA 4ANUA 4EOYA 3DHIC 4WQOB 2LFIA 1WGDA 4E71A 2KFJA 3ZNGC 1AYFA 2JT4B 1ZXIA 2NS5A 2PW9A 2CJOA 3H9DA 4A55A 2BPSA 4B9KA 1J7AA 2L8JA 2M19A 2DHZA 3RYTA 3BVMA 4KZCA 2O6VB 2BGFA 4DK5A 1U4AA 3N1ZC 3KQ4A 2KMAA 3PZ8A 4PT5A 1NYRA 3TCAA 2FNJB 4A9AA 3RMKC 1XT9B 1OQYA 1ROEA 2WXOA 2PMVA 3PHXB 2R2QA 3RNBC 4DXFA 4ZRJA 1T0QC 5FKAC 1YD8U 2ZW0A 2JQRB 2BWES 2JWZA 3ZQ4A 3ZJVA 4IWPA 4FHJA 3JYUA 4LJOB 1TIFA 1HTOA 2MLBA 1WXSA 1V5TA 4HKZE 2BF8B 3QX1A 3VFKA 1FRDA 3AE9B 3ONSA 2LI5A 3OJ3A 3OG5A 3BZDB 2V3PA 1YJ1A 3PVLA 2RDBC 1WJ6A 1IYFA 1GPXA 1NVID 3NZSA 3QHTA 2KX0A 1C3TA 3A1QB 3EECA 1YQ3B 4RGOS 3DOWA 2D11A 3VTVA 1AW7A 4FJVB 2LASA 4MH0E 4MACA 3L08A 1L7YA 1RFAA 3PZDA 3V3XA 1PGXA 4I6NB 2LGDA 4WWMA 5FR3A 3HM3A 2AYOB 2KDFB 1NYQA 3ZGZA 3LXFA 2KACA 4JWSC 1ZW7A 3I57A 1A70A 1T0RC 2K6QA 3IXSA 5D6JB 1MFWA 3Q8AA 4DDGD 2XK5B 3R2IA 2IDYA 2JZ3B 2MWSB 3MC8A 2WDTB 2ONQA 3GZNB 2V0GA 3A4RA 1QILA 3KWLA 2K1FA 3AEAB 1E8WA 2NCNA 2J53A 4K7WA 3PGEA 1TY0A 3TEXA 1D5MC 3UIPB 1PYWD 3DBSA 4XYCA 3APFA 2ZEQA 4US9A 2KN5A 1V86A 2AL6A 2RR9A 4CYEA 1E0ZA 1VRAB 2LWPA 3B2FA 4TSSA 2Z8LA 1HTQA 4DHZB 4RM9A 1J0GA 2LUMA 2D10A 2FCSA 3LYYA 3Q14C 3P2BA 1V9JA 4MJSA 3W1SA 4KKIA 1JWAD 1I4XA 2W3SA 4PS3A 3VUYA 1E7UA 2KD0A 2HD5B 2RDGA 2EELA 1B1ZA 1I42A 4ZHPA 2O6VD 4YTNB 2I1JA 2M8SA 3IAM1 3UI3A 1Q10A 1DOYA 2VH2A 2AX5A 2GOWA 2KWUB 1NI3A 3E9SA 2K8HA 1G6JA 1L2NA 2GBMA 1UGJA 4GGQA 3FAHA 4FN2A 3ML8A 4P1CC 4RGMA 5IO9A 5G5GA 1KH0A 2AQ3B 2HJ8A 2N9KA 1C77A 2IO2B 4BBNF 1V1PB 4CQNA 2WDRB 4ZHOA 1V49A 2C60A 3NZ3A 1QOAA 4XX5A 3AEBB 1DOIA 2PPHA 4KV2A 1FO4A 1CK1A 4KDIC 1NENB 3RNFC 5E6NA 1SIJA 4DBGA 2PVOD 2NVUI 1XXGA 1FCCC 1WR1A 3AEDB 4DDID 3ZJTA 3RULA 3AN1A 3KWVA 3NJTA 1XD3B 3C8YA 4CHKA 1TS3A 2MW5A 1KF6B 1D4BA 1TGZB 2ZNVB 1L0YB 4DXAB 3I3TB 4BZAA 4FXCA 1QQRA 3DVNU 2NMQA 5MPOA 1V81A 4FBJB 1QOBA 2C9WB 3IAS1 3P4PB 4PYZA 2FIFA 4GSWA 1T0YA 1OTRB 1FPYA 4NZLB 2INCC 3WAOA 2L32A 1IGCA 3ZKJC 3NRZA 2D5GA 4BKGA 2KWDA 3NY5A 5AEKB 1F77A 1I4GA 1WE7A 2ZNVC 3DWMA 1BXTA 2QC8A
chains in the Genus database with same CATH topology
1EO6A 5LLIA 1UBQA 4WJNA 2UWQA 4GDLA 3RT3B 2MX2A 1WXVA 4W9HA 5KHQA 2JVCA 2MBOA 2KC2A 2ASQA 3CSFA 1WMHA 3PREA 3WAPA 4ZYNA 3LJ3A 5FR6A 5AZFA 3PSEB 3L54A 3PRPB 2AL3A 3KUDB 4DHJD 3APDA 2DAJA 2KDBA 4ZRIA 2MA9B 3WA0A 3RCZA 3IVFA 3T8MA 4CO7A 1VCBA 5JZEB 3H7PA 4FHKA 4MSMB 5G2NA 4NNJB 3R7RA 4AJYB 2LVOA 1UGMA 3L10B 2KHWB 1Y8RC 2D2QA 4KZ0A 3QQ8B 3VQIA 3DBRI 3N30A 4B95A 3A9JA 2BKRB 3QJZA 4OVVA 3TIXA 2L00B 2ZJDA 4GDLB 3L13A 4E3CA 2KLGA 4KVGB 2B3AA 3VH4B 4ANVA 2A4ZA 4PS7A 1WM3A 3UGBB 4IC7B 3MHSD 3AXCA 2N1VA 3T9LA 2V4LA 2DENB 4ICVA 3IBEA 4LDTB 4HXDA 4FADA 1F9JA 1WIAA 2LRUA 2NBUA 3VTWA 2KKCA 4MJSB 1LM8B 5E6PA 2LVQA 3IHPC 3QIJA 2D3GA 1WR6E 3QK0A 3X0WA 4EZJA 5DPSA 1QZEA 3H7PB 4G11A 2LXCA 2N9XA 2LJ5A 4G50A 4BKTA 2KDEB 3U8ZA 2N9PC 4KIKA 1I35A 3Q3FA 3NS8A 3KW5B 1TZ1A 4LDTD 3KH0A 3Q3JA 5DPTA 5J2RA 4W9KA 2DZKA 2EKEC 4ANXA 2RGFA 3A9JB 3AI5A 1ZGUB 3A1QA 4WAAA 4W9IA 1WXMA 4NAWA 4W9JA 2G45B 3DCGA 3V6CB 1OEYA 3VH3B 3HM6X 4EKUA 4GU2A 2HTHA 3PTFC 4A3PA 2JF5A 1P98A 1HE8A 3BY4B 4FULA 4HDQA 2PJHA 2CR5A 2LZ6A 4B6WA 5J18A 2RD0A 4NY0A 4TKNA 3VAWA 3VTUA 4BBNC 5JH5C 3B08A 2K25A 3W1SC 4KSLC 3PLVA 2KWCA 1H4RA 2KNBA 4XC2A 2A5UA 4IWQA 2ZCBA 2LRWA 1WX9A 1GJZA 3U30A 1E90A 3HK0A 4AJWA 4W9CA 1SGHA 3ZVVA 1WZ3A 3M95A 3PS6A 3VDZA 5L95C 3ZUNA 3NHEB 2WWZA 2NBWB 4WWOA 2XBBC 4NAWB 3EHVA 1V2YA 3JVZX 4IM0A 3ENEA 4OVUA 2FCQA 5CHWA 3UINB 3OLMD 3PT2B 1KM7A 3QC8B 5D2MB 3ZTCA 1KOTA 1WX8A 4W9EA 2J0KA 4HCNB 2DYBA 2WX1A 3DPDA 2K8CA 2XK5A 4JQWC 3V61A 3VUXA 3ZRFA 3DQVA 5BO4B 4TQ1A 2G4DB 2MSED 1WJ4A 4WWNA 5C1ZA 2N9EB 1LXDA 3O65B 1E8YA 3DBHI 2VRRB 2V1YA 1M94A 3TBLD 2Z0DB 2MP2B 3V60A 3U7DA 1RRBA 4M8MA 1IP9A 2L0FA 4II3B 2KJHB 5CHVC 3ZLZA 2KOXA 4NQLB 1J8CA 2KJRA 1R4NI 3KUCB 2EMSA 3JSVA 2PE6B 4IW0A 2BKFA 1NBFC 2G3QB 1OGWA 3DVGX 2KVRA 3N3KB 2GBKA 4BOZB 1GUAB 2RPQA 2FUHB 3AULA 2M1MA 3IG3A 1WGRA 3VXWA 3HIZA 3V62A 3ZO5B 1GC7A 1XQQA 2O6VA 3R3MA 3NZUA 5DPRA 3UIOB 2CS4A 3SD5A 3VHTC 1Q1OA 2L3ZA 3BINA 3MJWA 1C1YB 4I6LB 3RUIB 2M4NA 3TJPA 3PRZA 3CMMB 1UH6A 2KWVB 4KSKC 2ZVNA 2BYEA 2K8BA 2ZPYA 4W9FA 2HE7A 2LGYA 4A3OA 1WGGA 2UYZB 4EFOA 4TV3A 2OOBB 3ECIA 4JGHB 4ANUA 4A20A 3RZFA 4EOYA 4WQOB 2Z59B 5AZHA 2YVCA 2KZRA 1YQBA 2KXJA 2G4SA 1WGDA 4E71A 4EZKA 2KFJA 1WGHA 3GZNI 2KJ6A 3ZNGC 2JT4B 1H8CA 2NS5A 2O2VA 1VD2A 2ZVOA 3H9DA 2BPSA 4B9KA 3ZDMC 4FJZA 3PHWB 2ZZPB 4HPLB 2KLCA 2L8JA 4GN1A 3APCA 4XZ4A 2DHZA 3RYTA 4KZCA 2O6VB 2BGFA 4DK5A 1WFYA 1OEYJ 2KQ7A 2V3SA 3IFWB 1U4AA 4HWIB 2KMAA 1UZXB 4FLHA 3TCAA 3RZWC 3SDLC 1S3SG 2JRIB 4AUQC 2L7RA 3M3JA 4K7UA 4HLEA 1WMHB 3UF8A 4BFRA 2FNJB 4K1RB 1XT9B 2DAFA 2BYVE 2CHZA 4HJKA 4K81A 1OQYA 4M0WB 2CU1A 2N7DA 2R2QA 3PHXB 4YL8A 3HHMA 4ZRJA 1KJTA 3DVGY 1YD8U 3ZTDA 4WWPA 2MRPA 4EUTA 1P0RA 2DX5B 3QAQA 2BWES 2O2VB 4GDKA 4P7IA 4NJ7A 4AP4C 2JWZA 5D94A 4DHJB 2AEHA 4IWPA 1WM2A 1PQSA 4FHJA 3CSTA 3LDZE 3JYUA 4LJOB 2IY1B 4AWJA 5C23A 2JUOA 4RM8A 2JXXA 2MLBA 1WXSA 3KVFB 4W9GA 3WALA 4HCPB 1V5TA 1CMXB 2C7HA 2IO1B 4IG7B 4BKSA 3DDCB 3ML9A 2BF8B 3QX1A 3VFKA 4FA6A 3N32A 2FAZA 4ANWA 2DYOA 2R2OA 3ZDTA 3QA8A 3ONSA 2LI5A 4ASWC 3OJ3A 3WAMA 3L0WB 2EMTA 3TMPB 1YJ1A 1WGYA 2KFKA 2AWTA 2LUEA 4GDKB 1UD7A 4KIKB 1WI0A 3PVLA 5DPWA 1WJ6A 1IYFA 3X23A 2KC1A 1GG3A 3NZSA 3QHTA 3DVNV 1GC6A 3QWZB 3SU8X 1EF1A 2KX0A 5LXIB 1C3TA 3A1QB 3DBLI 3EECA 2KQSA 2CHXA 3DOWA 2D11A 1RLFA 3AU5A 1WE6A 3VTVA 3UQAA 4FJVB 2LASA 5G55A 2LD9A 4MEMA 5KHOA 3GOEA 5IA7A 3B0AA 3C0RB 4MH0E 4DWFA 4LJPB 5JHAA 3L08A 1L7YA 2JPHA 2L76A 2MBHA 2W9NA 4KDLB 1RFAA 3PZDA 4E74A 1Z5SB 2LGDA 4I6NB 5HKHA 1FXTB 3HM3A 2KTRA 4GOCA 3QARA 1BT0A 2AYOB 1SE9A 2KDFB 1WH3A 1WX7A 2N1WA 3PV1A 4EZLA 3A9KA 1WZ0A 4G0NB 4FJYA 3KUZA 3H7SA 4HVBA 2KANA 4GXBA 2WYQA 3M63B 4G3XB 1ZW7A 4J6IA 1KLVA 2K6QA 4MM3A 3K9OB 1MG8A 2Y5BB 3UQBA 4K7SA 5D6JB 3H6NA 4IWOA 4DDGD 2KTFA 2XK5B 2KMCA 4IM3A 4DHZE 2JRHA 4IM2A 2JZ3B 2LVPA 2IO3B 2MWSB 4HDOA 2WDTB 4MDKE 2L0TA 2LGXA 1V6EA 2NR2A 3A4RA 5E6OA 2M17A 3W1YA 4MGIE 4WJOA 4GIVA 2K1FA 2CHWA 2C7MB 1E8WA 2NCNA 3A9KB 1NI2A 5CTRC 2ZPNA 4W9LA 4K7WA 3V6EB 4X57B 3VVWB 2GMIC 3PGEA 3JSVB 2ZCCA 1E7VA 3M62B 3UIPB 3DBSA 2J7QB 3PPAA 3APFA 4JIOU 2K39A 4W9DA 2ZEQA 3A33B 4F1SA 2GBNA 2KN5A 1V86A 1YX6B 2AL6A 2IZVB 2RR9A 4JLCA 4PS8A 4CYEA 2LWPA 5TR5A 4JL9A 3ZIMA 4DHZB 4IUMB 4RM9A 1J0GA 4MGYE 2D10A 2FCSA 4MJSA 3W1SA 3P2BA 1V9JA 1EUVB 3RD2A 4PS3A 3ZNHB 3KYDD 3VUYA 1E7UA 2KD0A 2HD5B 2FCMA 4RMAA 2OJRA 1I42A 4F8CB 2FCNA 1WY8A 2O6VD 4LCDE 1E8ZA 3PRMB 2I1JA 4BVUC 2M8SA 2MBEA 5CX3A 1WJNA 2NBVB 1WXAA 3NOBA 2NPTA 1Q5WB 1EF5A 2GOWA 2KWUB 2MQJA 1WYWB 2Z0EB 2K8HA 1G6JA 4MSQB 2GBRA 1UBIA 4ZRKA 1L2NA 2GBMA 4EEWA 5LXHA 2CKHB 1IPGA 3ZNID 2DZJA 4GGQA 4MGKE 5CHFA 4AOFA 4BOSC 1A5RA 4TUUA 3K9PB 2MBBB 1ISNA 3CF6E 4FN2A 1WRDB 3ML8A 3VUWA 2KDIA 3B1LX 1WF9A 3H1UA 1D3ZA 4ZDVA 3OJ4B 1UELA 2HJ8A 2IO2B 4BBNF 4NJ6A 1E5WA 3EC8A 4MGZE 1LFDA 1V49A 2C60A 2N4FA 2XEWA 2REXA 3SHQA 5L83A 4TQ0A 2IYDB 2BWFA 4GB9A 2RSUA 4XX5A 5EDSA 1NDDA 2NPTB 2PPHA 2GBJA 2JZZA 2KK8A 3ALBA 2L05A 1YX5B 3R66C 2IO0B 4KV2A 4PYUA 2BYFA 4KDIC 2YLMA 2KX3A 3A4SC 5E6NA 3R7QA 1RAXA 4DBGA 2KO3A 1AARA 1TBEA 2M0XA 3EFUA 2NVUI 1V80A 3L16A 3ZW3A 1WR1A 4NQKE 2DZMA 4M8NA 5AZGA 3OAWA 4WJPA 5J17A 2D07B 4MELA 5D7GA 4DDID 2J0MA 3RULA 2MP2A 4HPMB 3WANA 4GMVA 1E8XA 1XD3B 3S2AA 3QCAA 4CHKA 3ZNZB 3MTNB 2QHOA 5GMVA 2MW5A 1K8RB 1R4MI 2KFKB 2MCNB 1TGZB 1LQBA 2ZNVB 1P3QU 1JRUA 4DXAB 3AU4A 1V5OA 4BKSD 3I3TB 1GNUA 2C7NB 2JY6A 5IAAC 2I1KA 5JHBA 4II2B 3JW0X 4ICUA 3ZRCA 1TTNA 3DVNU 2DYMA 2J0JA 2K6DB 1ZKHA 3L17A 1X1MA 1YIWA 1Z2MA 3TL5A 1V81A 4FBJB 2C9WB 4PYZA 2PE9A 2FIFA 4GSWA 1J19A 1T0YA 1OTRB 2WX0A 1P9DU 4URKA 4NPNA 1WJUA 3D32A 3WAOA 3ZKJC 3WIMA 1P1AA 2LXAA 2DZIA 4F7ZA 4BKGA 4WJQA 2IY0B 2KTRB 2IBIB 4N9F4 3KYCD 1Q0WB 2C5LC 2N7EA 1S1QB 1SIFA 3NY5A 5AEKB 1WE7A 3PLUA 2FIDA 2ZNVC 2PEAA 5DCNA 4HK2A 4I6PA 2MBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EO6 A;  5LLI A;  1UBQ A;  4WJN A;  2UWQ A;  4GDL A;  3RT3 B;  2MX2 A;  1WXV A;  4W9H A;  5KHQ A;  2JVC A;  2MBO A;  2KC2 A;  2ASQ A;  3CSF A;  1WMH A;  3PRE A;  3WAP A;  4ZYN A;  3LJ3 A;  5FR6 A;  5AZF A;  3PSE B;  3L54 A;  3PRP B;  2AL3 A;  3KUD B;  4DHJ D;  3APD A;  2DAJ A;  2KDB A;  4ZRI A;  2MA9 B;  3WA0 A;  3RCZ A;  3IVF A;  3T8M A;  4CO7 A;  1VCB A;  5JZE B;  3H7P A;  4FHK A;  4MSM B;  5G2N A;  4NNJ B;  3R7R A;  4AJY B;  2LVO A;  1UGM A;  3L10 B;  2KHW B;  1Y8R C;  2D2Q A;  4KZ0 A;  3QQ8 B;  3VQI A;  3DBR I;  3N30 A;  4B95 A;  3A9J A;  2BKR B;  3QJZ A;  4OVV A;  3TIX A;  2L00 B;  2ZJD A;  4GDL B;  3L13 A;  4E3C A;  2KLG A;  4KVG B;  2B3A A;  3VH4 B;  4ANV A;  2A4Z A;  4PS7 A;  1WM3 A;  3UGB B;  4IC7 B;  3MHS D;  3AXC A;  2N1V A;  3T9L A;  2V4L A;  2DEN B;  4ICV A;  3IBE A;  4LDT B;  4HXD A;  4FAD A;  1F9J A;  1WIA A;  2LRU A;  2NBU A;  3VTW A;  2KKC A;  4MJS B;  1LM8 B;  5E6P A;  2LVQ A;  3IHP C;  3QIJ A;  2D3G A;  1WR6 E;  3QK0 A;  3X0W A;  4EZJ A;  5DPS A;  1QZE A;  3H7P B;  4G11 A;  2LXC A;  2N9X A;  2LJ5 A;  4G50 A;  4BKT A;  2KDE B;  3U8Z A;  2N9P C;  4KIK A;  1I35 A;  3Q3F A;  3NS8 A;  3KW5 B;  1TZ1 A;  4LDT D;  3KH0 A;  3Q3J A;  5DPT A;  5J2R A;  4W9K A;  2DZK A;  2EKE C;  4ANX A;  2RGF A;  3A9J B;  3AI5 A;  1ZGU B;  3A1Q A;  4WAA A;  4W9I A;  1WXM A;  4NAW A;  4W9J A;  2G45 B;  3DCG A;  3V6C B;  1OEY A;  3VH3 B;  3HM6 X;  4EKU A;  4GU2 A;  2HTH A;  3PTF C;  4A3P A;  2JF5 A;  1P98 A;  1HE8 A;  3BY4 B;  4FUL A;  4HDQ A;  2PJH A;  2CR5 A;  2LZ6 A;  4B6W A;  5J18 A;  2RD0 A;  4NY0 A;  4TKN A;  3VAW A;  3VTU A;  4BBN C;  5JH5 C;  3B08 A;  2K25 A;  3W1S C;  4KSL C;  3PLV A;  2KWC A;  1H4R A;  2KNB A;  4XC2 A;  2A5U A;  4IWQ A;  2ZCB A;  2LRW A;  1WX9 A;  1GJZ A;  3U30 A;  1E90 A;  3HK0 A;  4AJW A;  4W9C A;  1SGH A;  3ZVV A;  1WZ3 A;  3M95 A;  3PS6 A;  3VDZ A;  5L95 C;  3ZUN A;  3NHE B;  2WWZ A;  2NBW B;  4WWO A;  2XBB C;  4NAW B;  3EHV A;  1V2Y A;  3JVZ X;  4IM0 A;  3ENE A;  4OVU A;  2FCQ A;  5CHW A;  3UIN B;  3OLM D;  3PT2 B;  1KM7 A;  3QC8 B;  5D2M B;  3ZTC A;  1KOT A;  1WX8 A;  4W9E A;  2J0K A;  4HCN B;  2DYB A;  2WX1 A;  3DPD A;  2K8C A;  2XK5 A;  4JQW C;  3V61 A;  3VUX A;  3ZRF A;  3DQV A;  5BO4 B;  4TQ1 A;  2G4D B;  2MSE D;  1WJ4 A;  4WWN A;  5C1Z A;  2N9E B;  1LXD A;  3O65 B;  1E8Y A;  3DBH I;  2VRR B;  2V1Y A;  1M94 A;  3TBL D;  2Z0D B;  2MP2 B;  3V60 A;  3U7D A;  1RRB A;  4M8M A;  1IP9 A;  2L0F A;  4II3 B;  2KJH B;  5CHV C;  3ZLZ A;  2KOX A;  4NQL B;  1J8C A;  2KJR A;  1R4N I;  3KUC B;  2EMS A;  3JSV A;  2PE6 B;  4IW0 A;  2BKF A;  1NBF C;  2G3Q B;  1OGW A;  3DVG X;  2KVR A;  3N3K B;  2GBK A;  4BOZ B;  1GUA B;  2RPQ A;  2FUH B;  3AUL A;  2M1M A;  3IG3 A;  1WGR A;  3VXW A;  3HIZ A;  3V62 A;  3ZO5 B;  1GC7 A;  1XQQ A;  2O6V A;  3R3M A;  3NZU A;  5DPR A;  3UIO B;  2CS4 A;  3SD5 A;  3VHT C;  1Q1O A;  2L3Z A;  3BIN A;  3MJW A;  1C1Y B;  4I6L B;  3RUI B;  2M4N A;  3TJP A;  3PRZ A;  3CMM B;  1UH6 A;  2KWV B;  4KSK C;  2ZVN A;  2BYE A;  2K8B A;  2ZPY A;  4W9F A;  2HE7 A;  2LGY A;  4A3O A;  1WGG A;  2UYZ B;  4EFO A;  4TV3 A;  2OOB B;  3ECI A;  4JGH B;  4ANU A;  4A20 A;  3RZF A;  4EOY A;  4WQO B;  2Z59 B;  5AZH A;  2YVC A;  2KZR A;  1YQB A;  2KXJ A;  2G4S A;  1WGD A;  4E71 A;  4EZK A;  2KFJ A;  1WGH A;  3GZN I;  2KJ6 A;  3ZNG C;  2JT4 B;  1H8C A;  2NS5 A;  2O2V A;  1VD2 A;  2ZVO A;  3H9D A;  2BPS A;  4B9K A;  3ZDM C;  4FJZ A;  3PHW B;  2ZZP B;  4HPL B;  2KLC A;  2L8J A;  4GN1 A;  3APC A;  4XZ4 A;  2DHZ A;  3RYT A;  4KZC A;  2O6V B;  2BGF A;  4DK5 A;  1WFY A;  1OEY J;  2KQ7 A;  2V3S A;  3IFW B;  1U4A A;  4HWI B;  2KMA A;  1UZX B;  4FLH A;  3TCA A;  3RZW C;  3SDL C;  1S3S G;  2JRI B;  4AUQ C;  2L7R A;  3M3J A;  4K7U A;  4HLE A;  1WMH B;  3UF8 A;  4BFR A;  2FNJ B;  4K1R B;  1XT9 B;  2DAF A;  2BYV E;  2CHZ A;  4HJK A;  4K81 A;  1OQY A;  4M0W B;  2CU1 A;  2N7D A;  2R2Q A;  3PHX B;  4YL8 A;  3HHM A;  4ZRJ A;  1KJT A;  3DVG Y;  1YD8 U;  3ZTD A;  4WWP A;  2MRP A;  4EUT A;  1P0R A;  2DX5 B;  3QAQ A;  2BWE S;  2O2V B;  4GDK A;  4P7I A;  4NJ7 A;  4AP4 C;  2JWZ A;  5D94 A;  4DHJ B;  2AEH A;  4IWP A;  1WM2 A;  1PQS A;  4FHJ A;  3CST A;  3LDZ E;  3JYU A;  4LJO B;  2IY1 B;  4AWJ A;  5C23 A;  2JUO A;  4RM8 A;  2JXX A;  2MLB A;  1WXS A;  3KVF B;  4W9G A;  3WAL A;  4HCP B;  1V5T A;  1CMX B;  2C7H A;  2IO1 B;  4IG7 B;  4BKS A;  3DDC B;  3ML9 A;  2BF8 B;  3QX1 A;  3VFK A;  4FA6 A;  3N32 A;  2FAZ A;  4ANW A;  2DYO A;  2R2O A;  3ZDT A;  3QA8 A;  3ONS A;  2LI5 A;  4ASW C;  3OJ3 A;  3WAM A;  3L0W B;  2EMT A;  3TMP B;  1YJ1 A;  1WGY A;  2KFK A;  2AWT A;  2LUE A;  4GDK B;  1UD7 A;  4KIK B;  1WI0 A;  3PVL A;  5DPW A;  1WJ6 A;  1IYF A;  3X23 A;  2KC1 A;  1GG3 A;  3NZS A;  3QHT A;  3DVN V;  1GC6 A;  3QWZ B;  3SU8 X;  1EF1 A;  2KX0 A;  5LXI B;  1C3T A;  3A1Q B;  3DBL I;  3EEC A;  2KQS A;  2CHX A;  3DOW A;  2D11 A;  1RLF A;  3AU5 A;  1WE6 A;  3VTV A;  3UQA A;  4FJV B;  2LAS A;  5G55 A;  2LD9 A;  4MEM A;  5KHO A;  3GOE A;  5IA7 A;  3B0A A;  3C0R B;  4MH0 E;  4DWF A;  4LJP B;  5JHA A;  3L08 A;  1L7Y A;  2JPH A;  2L76 A;  2MBH A;  2W9N A;  4KDL B;  1RFA A;  3PZD A;  4E74 A;  1Z5S B;  2LGD A;  4I6N B;  5HKH A;  1FXT B;  3HM3 A;  2KTR A;  4GOC A;  3QAR A;  1BT0 A;  2AYO B;  1SE9 A;  2KDF B;  1WH3 A;  1WX7 A;  2N1W A;  3PV1 A;  4EZL A;  3A9K A;  1WZ0 A;  4G0N B;  4FJY A;  3KUZ A;  3H7S A;  4HVB A;  2KAN A;  4GXB A;  2WYQ A;  3M63 B;  4G3X B;  1ZW7 A;  4J6I A;  1KLV A;  2K6Q A;  4MM3 A;  3K9O B;  1MG8 A;  2Y5B B;  3UQB A;  4K7S A;  5D6J B;  3H6N A;  4IWO A;  4DDG D;  2KTF A;  2XK5 B;  2KMC A;  4IM3 A;  4DHZ E;  2JRH A;  4IM2 A;  2JZ3 B;  2LVP A;  2IO3 B;  2MWS B;  4HDO A;  2WDT B;  4MDK E;  2L0T A;  2LGX A;  1V6E A;  2NR2 A;  3A4R A;  5E6O A;  2M17 A;  3W1Y A;  4MGI E;  4WJO A;  4GIV A;  2K1F A;  2CHW A;  2C7M B;  1E8W A;  2NCN A;  3A9K B;  1NI2 A;  5CTR C;  2ZPN A;  4W9L A;  4K7W A;  3V6E B;  4X57 B;  3VVW B;  2GMI C;  3PGE A;  3JSV B;  2ZCC A;  1E7V A;  3M62 B;  3UIP B;  3DBS A;  2J7Q B;  3PPA A;  3APF A;  4JIO U;  2K39 A;  4W9D A;  2ZEQ A;  3A33 B;  4F1S A;  2GBN A;  2KN5 A;  1V86 A;  1YX6 B;  2AL6 A;  2IZV B;  2RR9 A;  4JLC A;  4PS8 A;  4CYE A;  2LWP A;  5TR5 A;  4JL9 A;  3ZIM A;  4DHZ B;  4IUM B;  4RM9 A;  1J0G A;  4MGY E;  2D10 A;  2FCS A;  4MJS A;  3W1S A;  3P2B A;  1V9J A;  1EUV B;  3RD2 A;  4PS3 A;  3ZNH B;  3KYD D;  3VUY A;  1E7U A;  2KD0 A;  2HD5 B;  2FCM A;  4RMA A;  2OJR A;  1I42 A;  4F8C B;  2FCN A;  1WY8 A;  2O6V D;  4LCD E;  1E8Z A;  3PRM B;  2I1J A;  4BVU C;  2M8S A;  2MBE A;  5CX3 A;  1WJN A;  2NBV B;  1WXA A;  3NOB A;  2NPT A;  1Q5W B;  1EF5 A;  2GOW A;  2KWU B;  2MQJ A;  1WYW B;  2Z0E B;  2K8H A;  1G6J A;  4MSQ B;  2GBR A;  1UBI A;  4ZRK A;  1L2N A;  2GBM A;  4EEW A;  5LXH A;  2CKH B;  1IPG A;  3ZNI D;  2DZJ A;  4GGQ A;  4MGK E;  5CHF A;  4AOF A;  4BOS C;  1A5R A;  4TUU A;  3K9P B;  2MBB B;  1ISN A;  3CF6 E;  4FN2 A;  1WRD B;  3ML8 A;  3VUW A;  2KDI A;  3B1L X;  1WF9 A;  3H1U A;  1D3Z A;  4ZDV A;  3OJ4 B;  1UEL A;  2HJ8 A;  2IO2 B;  4BBN F;  4NJ6 A;  1E5W A;  3EC8 A;  4MGZ E;  1LFD A;  1V49 A;  2C60 A;  2N4F A;  2XEW A;  2REX A;  3SHQ A;  5L83 A;  4TQ0 A;  2IYD B;  2BWF A;  4GB9 A;  2RSU A;  4XX5 A;  5EDS A;  1NDD A;  2NPT B;  2PPH A;  2GBJ A;  2JZZ A;  2KK8 A;  3ALB A;  2L05 A;  1YX5 B;  3R66 C;  2IO0 B;  4KV2 A;  4PYU A;  2BYF A;  4KDI C;  2YLM A;  2KX3 A;  3A4S C;  5E6N A;  3R7Q A;  1RAX A;  4DBG A;  2KO3 A;  1AAR A;  1TBE A;  2M0X A;  3EFU A;  2NVU I;  1V80 A;  3L16 A;  3ZW3 A;  1WR1 A;  4NQK E;  2DZM A;  4M8N A;  5AZG A;  3OAW A;  4WJP A;  5J17 A;  2D07 B;  4MEL A;  5D7G A;  4DDI D;  2J0M A;  3RUL A;  2MP2 A;  4HPM B;  3WAN A;  4GMV A;  1E8X A;  1XD3 B;  3S2A A;  3QCA A;  4CHK A;  3ZNZ B;  3MTN B;  2QHO A;  5GMV A;  2MW5 A;  1K8R B;  1R4M I;  2KFK B;  2MCN B;  1TGZ B;  1LQB A;  2ZNV B;  1P3Q U;  1JRU A;  4DXA B;  3AU4 A;  1V5O A;  4BKS D;  3I3T B;  1GNU A;  2C7N B;  2JY6 A;  5IAA C;  2I1K A;  5JHB A;  4II2 B;  3JW0 X;  4ICU A;  3ZRC A;  1TTN A;  3DVN U;  2DYM A;  2J0J A;  2K6D B;  1ZKH A;  3L17 A;  1X1M A;  1YIW A;  1Z2M A;  3TL5 A;  1V81 A;  4FBJ B;  2C9W B;  4PYZ A;  2PE9 A;  2FIF A;  4GSW A;  1J19 A;  1T0Y A;  1OTR B;  2WX0 A;  1P9D U;  4URK A;  4NPN A;  1WJU A;  3D32 A;  3WAO A;  3ZKJ C;  3WIM A;  1P1A A;  2LXA A;  2DZI A;  4F7Z A;  4BKG A;  4WJQ A;  2IY0 B;  2KTR B;  2IBI B;  4N9F 4;  3KYC D;  1Q0W B;  2C5L C;  2N7E A;  1S1Q B;  1SIF A;  3NY5 A;  5AEK B;  1WE7 A;  3PLU A;  2FID A;  2ZNV C;  2PEA A;  5DCN A;  4HK2 A;  4I6P A;  2MBQ A; 
#chains in the Genus database with same CATH topology
 2UWQ A;  2JVC A;  2KC2 A;  2ASQ A;  3CSF A;  3WAP A;  3PSE B;  3PRP B;  4ZRI A;  4CO7 A;  1VCB A;  5JZE B;  1FXA A;  2LVO A;  1UGM A;  3AE2 B;  3L10 B;  4LNF A;  1NEK B;  3QQ8 B;  4B95 A;  2RMM A;  3TIX A;  1XEE A;  3L13 A;  4KVG B;  2A4Z A;  3UGB B;  4IC7 B;  3AXC A;  2N1V A;  2V4L A;  4XWT A;  4LDT B;  4R3D A;  2INP E;  3FIL A;  2LRU A;  1K50 A;  1LM8 B;  2VZK D;  1WR6 E;  3X0W A;  5DPS A;  2Y5P A;  4G11 A;  2LXC A;  4G50 A;  1I35 A;  3KW5 B;  5EE9 A;  2L1A A;  3Q3J A;  5DPT A;  4W9K A;  1JWM D;  2DZK A;  1WXM A;  4NAW A;  3ZYY X;  2JX5 A;  2LGS A;  3URY A;  2IND C;  2N9L A;  3PTF C;  4A3P A;  3B2G A;  2LJI A;  1J7B A;  4FUL A;  1L5P A;  2K0P A;  5J18 A;  3GE8 C;  2RD0 A;  4TKN A;  1N5X A;  4BBN C;  4B0E A;  2K25 A;  1ET6 A;  3SEB A;  1H4R A;  2KNB A;  4XC2 A;  4HRS A;  1I4H A;  3RI7 C;  1R4M B;  3HK0 A;  3PO0 A;  1QLB B;  1RFK A;  2GI9 A;  1DYQ A;  4DQO C;  2V3N A;  3U2S C;  1HXY D;  4ZYS A;  4NAW B;  3ENE A;  3QC8 B;  1KM7 A;  1UF0 A;  1FIQ A;  2DYB A;  3ZRF A;  2WXJ A;  3DQV A;  3Q8F A;  4WWN A;  3LB8 C;  5C1Z A;  1LXD A;  1E8Y A;  3DBH I;  4M8M A;  4ZOH C;  5CHV C;  3MFG A;  1J8C A;  2EMS A;  3JSV A;  4KGT A;  1NBF C;  1OGW A;  3DVG X;  1KFY B;  2N7J A;  3N3K B;  1OQR A;  2FUH B;  1C4P A;  3AUL A;  3IG3 A;  5C2T B;  2WXL A;  1GC7 A;  3NZU A;  2CS4 A;  3SD5 A;  2WU5 B;  4KSK C;  2BYE A;  4N58 A;  2WU2 B;  1MHX A;  1RM6 C;  1WGG A;  4TV3 A;  4JGH B;  4A20 A;  5AZH A;  2LMC A;  4M0W A;  5HFY A;  4C80 A;  1L6V A;  1YQB A;  5G5H A;  4EZK A;  3Q8B A;  5HHD G;  4BAX A;  5BYS A;  2KJ6 A;  1VD2 A;  2QIE B;  1GB4 A;  2ZZP B;  4HPL B;  3APC A;  4AS1 A;  1WFY A;  1OEY J;  2KQ7 A;  3IFW B;  4FLH A;  3SR6 A;  3SDL C;  3OWE B;  1S3S G;  2JRI B;  4AUQ C;  4HLE A;  1WMH B;  3UF8 A;  2EKI A;  4K1R B;  2DAF A;  2BYV E;  4HJK A;  4M0W B;  4YL8 A;  1KJT A;  4OVZ A;  3ZTD A;  1P0R A;  2DX5 B;  3QAQ A;  4P7I A;  4AP4 C;  2AEH A;  2MJD A;  2WS3 B;  1PQS A;  3LDZ E;  3ZJU A;  4OZB A;  2JUO A;  5I4D A;  2JXX A;  3KVF B;  3WAL A;  4HCP B;  3ZXV A;  4IG7 B;  3H8H A;  3ML9 A;  3N32 A;  2R2O A;  3QA8 A;  1JWU D;  4LTU A;  2AWT A;  1SE3 A;  2LUE A;  4KIK B;  1WI0 A;  2J4X A;  4RF0 A;  1F52 A;  1VJK A;  3AU5 A;  1E9M A;  1BML C;  1TKY A;  5IA7 A;  1FMA D;  2MBH A;  4GOC A;  2KTR A;  4M02 A;  4DXG A;  1SE9 A;  3RNA C;  1WH3 A;  1D6E C;  1WX7 A;  2DWQ A;  2N1W A;  1WZ0 A;  4G0N B;  1L0V B;  3H7S A;  4HVB A;  2JXT A;  2KAN A;  1KLV A;  3K9O B;  1N5W A;  2KN4 A;  1MG8 A;  2XN9 C;  2BQQ A;  2KTF A;  4HRO A;  3MHZ A;  4IM3 A;  4ACF A;  4NJC A;  1I4R A;  2ON8 A;  4LNI A;  3KLS X;  2OED A;  2TSS A;  5E6O A;  2M17 A;  3W1Y A;  4GIV A;  4L2Y A;  4WAF A;  3V6E B;  1NI2 A;  2ZPN A;  3DBR B;  4X57 B;  2I38 A;  4M01 A;  2ZCC A;  3PPA A;  4JIO U;  4UDU C;  2MHJ A;  5TR5 A;  4JL9 A;  4IUM B;  1N60 A;  3RPF C;  4MGY E;  4USA A;  4TMA B;  2KDM A;  1WXQ A;  3ZNH B;  3KYD D;  4RMA A;  2OJR A;  2FCN A;  3BII D;  1N6Z A;  2NBV B;  2NPT A;  2WDV B;  1EF5 A;  1SE4 A;  2MQJ A;  2PIA A;  2WHI A;  4L1B A;  1UBI A;  4ZRK A;  3RNG C;  1PGA A;  1WRD B;  2WXF A;  3VUW A;  3B1L X;  3OJ4 B;  1UEL A;  4RF1 A;  1T6B X;  1AN8 A;  3VR8 B;  3TEW A;  5L83 A;  4TQ0 A;  2IYD B;  4GB9 A;  3MC9 A;  3DBL B;  2NPT B;  5JXV A;  2QDF A;  1SB3 C;  2JZZ A;  2KK8 A;  3ALB A;  2L05 A;  3R66 C;  2IO0 B;  4L23 A;  1SJE D;  3A4S C;  2KO3 A;  3EFU A;  3BYY B;  1ZE3 D;  3ZW3 A;  1FFU A;  4M8N A;  5AZG A;  2WXR A;  4MEL A;  5D7G A;  4S0R A;  2J0M A;  2MP2 A;  1STE A;  3AE4 B;  3S2A A;  3ZNZ B;  1C76 A;  2BW2 A;  1JRU A;  3JW0 X;  2DYM A;  1FEH A;  3RNE C;  4O1N A;  2PE9 A;  1XLP A;  1J19 A;  2CU3 A;  1K51 A;  1P1A A;  4F7Z A;  4WH4 A;  4LK0 M;  4N9F 4;  2V9H A;  2C5L C;  4YSZ B;  5DCN A;  1QF6 A;  2MEK A;  4WJN A;  3RT3 B;  1WXV A;  4W9H A;  2MJ3 A;  3NS1 A;  4YTP B;  1JRP A;  3LJ3 A;  5AZF A;  3ETR A;  3L54 A;  3KUD B;  3IT6 B;  2W82 A;  3I63 C;  2MA9 B;  4RH6 A;  3IVF A;  3H7P A;  2NTS A;  4JWU C;  2D2Q A;  3VQI A;  3DBR I;  1YJI A;  3N30 A;  1UWM A;  4C7Y A;  3QJZ A;  2GB1 A;  2VZK B;  4WIP A;  2L83 A;  4KKJ A;  3AEG B;  1C78 A;  4HXD A;  4FAD A;  5BMG A;  3VTW A;  4MJS B;  4WUR A;  5E6P A;  3QK0 A;  2D3G A;  1QZE A;  2Y3A A;  3H7P B;  1K53 A;  2N9X A;  2V4I B;  1WRI A;  3NS8 A;  2PTL A;  3MJ5 A;  3AI5 A;  2KT7 A;  2BS3 B;  2KVZ A;  1BUI C;  4W9I A;  2G45 B;  3DCG A;  3V6C B;  1JQ4 A;  1P98 A;  1HE8 A;  2ACZ B;  4B6W A;  4NY0 A;  5JH5 C;  3B08 A;  4K3C A;  1T3Q A;  3W1S C;  2LEK A;  2ZCB A;  2LRW A;  3W2D A;  4W9C A;  5D3I B;  1WZ3 A;  3M95 A;  3VDZ A;  5L95 C;  1XCQ L;  3ZUN A;  3BK2 A;  2M0A A;  3JVZ X;  3TEZ A;  2FCQ A;  1E7P B;  3OLM D;  5D2M B;  3ZTC A;  4N59 A;  2J0K A;  2WX1 A;  2K8C A;  2ZW1 A;  2FUG 1;  4TQ1 A;  2G4D B;  2MSE D;  4KGS A;  5D3D A;  2QIL A;  3NVV A;  1M94 A;  2Z0D B;  1LO5 D;  3V60 A;  1RRB A;  2IGH A;  1TJE A;  2WXP A;  1IP9 A;  2L0F A;  2KJH B;  2KOX A;  4IOI E;  2UU7 A;  2WNM A;  4JX1 C;  2BKF A;  2LHE A;  1XLQ A;  2GBK A;  2RPQ A;  3NVZ A;  3VXW A;  3AMZ A;  3R3M A;  3NG0 A;  1TS2 A;  2L3Z A;  3BIN A;  3AE6 B;  3RUI B;  3CWI A;  3CMM B;  3Q3O C;  2K8B A;  3T3O A;  1FM0 D;  2LGY A;  4GLS C;  2UYZ B;  2OOB B;  1E10 A;  2MJE A;  2YVC A;  2KXJ A;  1HZ6 A;  3PZ7 A;  3GZN I;  2KAJ A;  2ZVO A;  3ZDM C;  4FJZ A;  1E6E B;  2KLC A;  1PFD A;  1WWT A;  3HVZ A;  4XZ4 A;  1ZP0 B;  1R7S A;  3AE5 B;  5T8I A;  4HWI B;  1CJE A;  1PDX A;  3Q69 A;  4XDD A;  4ARI A;  1OQQ A;  2L7R A;  3P1M A;  4K7U A;  4NAM A;  1EU4 A;  4RNA A;  2CU1 A;  2WXQ A;  3AE8 B;  2MRP A;  4EUT A;  4GDK A;  2WXG A;  3W5V B;  2IY1 B;  5C23 A;  5BYQ A;  4RM8 A;  1UUP A;  4W9G A;  4LNO A;  2C7H A;  4IDI A;  4BKS A;  3FIL B;  4FA6 A;  2FAZ A;  4ANW A;  3ZDT A;  4ASW C;  4ZRQ A;  4KX6 B;  3L0W B;  4J3O D;  2EMT A;  1JWB D;  1WGY A;  2KFK A;  4GDK B;  1UD7 A;  4REZ A;  3I9V 1;  3X23 A;  3DVN V;  4P1B C;  1GC6 A;  3QWZ B;  5H8Y E;  3SU8 X;  5LXI B;  4OHJ A;  1WE6 A;  3UQA A;  1T5X D;  4MEM A;  5KHO A;  4AQ7 A;  3AH7 A;  1N63 A;  1XCT L;  1I4Q A;  3C0R B;  3Q8C A;  1HZ5 A;  4A6Q A;  2L76 A;  2W9N A;  4KDL B;  1ZXH A;  3VRB B;  1R4N B;  1XLN A;  3QAR A;  4Q2J A;  5H92 C;  4WQM A;  3RNC C;  3PV1 A;  1SEB D;  4FJY A;  1FRR A;  2JZP A;  3KUZ A;  4GXB A;  2WYQ A;  5C3J B;  3M63 B;  3MC0 B;  4G3X B;  5EE1 A;  1UWX A;  2KQ4 X;  2Y5B B;  4XE0 A;  4JPS A;  2PKO A;  4B0M A;  3Q8E A;  3VR9 B;  2KMC A;  5LNK 1;  2JRH A;  4IM2 A;  1L4Z B;  2IO3 B;  4HDO A;  4XDC A;  4P6V F;  4MDK E;  2L0T A;  4US8 A;  2LGX A;  1VZ7 A;  4OW0 A;  3VVW B;  1IGD A;  3JSV B;  1E7V A;  1GOZ A;  3M62 B;  2L52 A;  2J7Q B;  4N6E B;  1JAL A;  1K52 A;  2JYE A;  4W9D A;  3A33 B;  2GBN A;  2IZV B;  1SBB B;  3RN9 C;  4JLC A;  1KLU D;  2CJN A;  3AV8 A;  3W5U B;  1EUV B;  3RD2 A;  1KLG D;  3AM9 A;  1JWS D;  4C56 C;  4C7Z A;  1WY8 A;  1SXT A;  4YT0 B;  3ZXR A;  1EWY C;  2SEB D;  1E8Z A;  3PRM B;  4HJG E;  3O13 A;  1TS5 A;  2MBE A;  5CX3 A;  1WJN A;  3NOB A;  1Q5W B;  3TEY A;  1DGJ A;  4EEW A;  2CKH B;  2DZJ A;  4AOF A;  3GP7 A;  4JE3 B;  4TUU A;  1A5R A;  3K9P B;  1RYJ A;  1ISN A;  2KDI A;  1WYG A;  2X8X X;  4ZDV A;  4MGZ E;  5AUK A;  1F1H A;  4QAY A;  2XEW A;  2REX A;  3SHQ A;  3HVD A;  1NDD A;  3B9J A;  2HTM E;  2GBJ A;  1YX5 B;  2JU6 X;  3R7Q A;  2QEJ C;  2QSD A;  1AAR A;  1TBE A;  2M0X A;  5E6J A;  4NQK E;  3OAW A;  4WJP A;  5J17 A;  2D07 B;  3DHG C;  4A8X C;  1SE2 A;  1YNT E;  4GMV A;  1ZPS A;  3QCA A;  3MTN B;  1XLO A;  5GMV A;  1K8R B;  1R4M I;  1B9R A;  1LQB A;  2QJL A;  1P3Q U;  3AU4 A;  1V5O A;  4BKS D;  2C7N B;  4II2 B;  4ICU A;  2M56 B;  4YWG G;  3BK1 A;  1ZKH A;  3L17 A;  1TYG B;  1XF5 L;  2WXH A;  1P9D U;  4URK A;  1WJU A;  3D32 A;  3WIM A;  2LXA A;  2DZI A;  4LLG M;  2WLB A;  4WJQ A;  2KTR B;  2IBI B;  3HUI A;  3FKY A;  3Q2A C;  1S1Q B;  1L6U A;  2Q5W D;  2JYT A;  1YN5 A;  2PEA A;  4MSM B;  4I6P A;  2BTE A;  1UBQ A;  5HI1 A;  3N9Y C;  3P4Q B;  2BT6 A;  2OJW A;  3PRE A;  4ZYN A;  3GS2 A;  4DHJ D;  1ACC A;  1EM7 A;  4RGT A;  1VLB A;  1MJD A;  1TT5 B;  2DAJ A;  2KDB A;  3WA0 A;  2LHD A;  4FHK A;  5G2N A;  1Y8R C;  4KZ0 A;  3A9J A;  2BKR B;  1C79 A;  1JW9 D;  4OVV A;  2L00 B;  4E3C A;  2B3A A;  2XNA C;  1F2R C;  3MHS D;  3T9L A;  4ICV A;  2MH7 A;  2D3A A;  3N20 C;  1WIA A;  3AEE B;  2NBU A;  4ITK A;  2W55 A;  2LVQ A;  3BWU D;  3P42 A;  3IHP C;  2BS4 B;  4EZJ A;  4C00 A;  2R61 A;  2LJ5 A;  2N9P C;  1TZ1 A;  2ICI A;  5J2R A;  1EWC A;  4XWW A;  2EKE C;  3A9J B;  1ET9 A;  1EU3 A;  1ZGU B;  3A1Q A;  3BVG A;  4W9J A;  5IN7 A;  1TKE A;  1OEY A;  4PK1 A;  4OZA A;  1VDV A;  2INN E;  3BY4 B;  2CR5 A;  4P16 A;  1WSP A;  2LZ6 A;  4IKG A;  3VAW A;  4HPP A;  2RPV A;  3PLV A;  2KWC A;  1FNU A;  1FFV A;  4IWQ A;  3MP9 A;  1WX9 A;  1E90 A;  1TY2 A;  1TZO A;  1SGH A;  1YN3 A;  3PS6 A;  3EFC A;  2WWZ A;  2NBW B;  1M4V A;  2XBB C;  4WWO A;  2BYT A;  1P7E A;  3EHV A;  1V2Y A;  4IM0 A;  4OVU A;  5CHW A;  3V05 A;  3UIN B;  4A90 A;  1ZUD 2;  4W9E A;  4HCN B;  4JQW C;  3VUX A;  2XK5 A;  3V61 A;  5BO4 B;  1MHH E;  1WJ4 A;  2Y5C A;  1YMH E;  4H2A A;  3TBL D;  2MP2 B;  4RFB A;  3U7D A;  2KJR A;  3KUC B;  2KVR A;  1GUA B;  1FCL A;  3SFD B;  2K5P A;  3UIO B;  3MJW A;  1C1Y B;  3TJP A;  2ZVN A;  2DNF A;  4EFO A;  2IJ0 A;  3AE7 B;  3RZF A;  1Y56 A;  2Z59 B;  1HQR D;  2KZR A;  2G4S A;  2E6X A;  1WGH A;  1H8C A;  2O2V A;  4LNK A;  3PHW B;  2D3B A;  4GN1 A;  2AQ2 B;  2J42 A;  2V3S A;  3BYT B;  1VZ8 A;  2SAK A;  1F2R I;  1L0X B;  1UZX B;  5EE0 A;  2X38 A;  3RZW C;  3M3J A;  3WCQ A;  4BFR A;  2OHF A;  1V1P A;  2CHZ A;  4K81 A;  2YEP F;  2N7D A;  3AEC B;  3HHM A;  3DVG Y;  1JCK B;  4WWP A;  2O2V B;  4NJ7 A;  5D94 A;  1QT9 A;  2K22 A;  1WM2 A;  5IP4 D;  3P4R B;  3CST A;  3U4E G;  2JWU A;  2AQ1 B;  4RGN A;  5AUI A;  4AWJ A;  3N1X C;  4K3B A;  1HEZ E;  1CMX B;  2KYW A;  2IO1 B;  3DDC B;  1VR9 A;  2DYO A;  1KRH A;  3WAM A;  3HRD D;  3TMP B;  2E3T A;  1MG4 A;  1MVK A;  2QCZ A;  4HKQ A;  5DPW A;  2KC1 A;  1GG3 A;  4YTM B;  1N62 A;  1EF1 A;  3DBL I;  2KQS A;  2CHX A;  1RLF A;  4YSY B;  4ZRP A;  4HEA 1;  5G55 A;  2LD9 A;  3GOE A;  3B0A A;  3DBH B;  4DWF A;  4LJP B;  1F0Z A;  5JHA A;  2JPH A;  4E74 A;  2D3C A;  1Z5S B;  1XO3 A;  1D5Z C;  5HKH A;  1FXT B;  2RDH A;  1SF0 A;  1BT0 A;  1RWS A;  1FNW A;  4XGA B;  3A9K A;  4EZL A;  3N1Y C;  1V8C A;  4J6I A;  4MM3 A;  3UQB A;  4K7S A;  3H6N A;  4IWO A;  3NVW A;  1CQV A;  3AE3 B;  4DHZ E;  5EE3 A;  1VZ6 A;  2LVP A;  3U52 E;  3R2T A;  3CIR B;  1V6E A;  1WGK A;  2IGD A;  2NR2 A;  5FK9 C;  2HDE A;  4MGI E;  4WJO A;  2CHW A;  2C7M B;  2H89 B;  1PGB A;  5CTR C;  3A9K B;  4W9L A;  5BMH A;  2GMI C;  2BBC A;  3U7Z A;  3L4P A;  2K39 A;  2I2Y A;  1YX6 B;  4MM3 B;  2WXK A;  4PS8 A;  2QMT A;  3ZIM A;  2YEP B;  1C4A A;  1YN4 A;  2PVG C;  3DWG C;  4MT5 A;  3RFZ B;  2FCM A;  3Q3M C;  5GXG B;  4F8C B;  2HJ1 A;  4LCD E;  4BVU C;  5HG2 A;  1WXA A;  1WYW B;  2Z0E B;  4MSQ B;  2GBR A;  5LXH A;  1IPG A;  3ZNI D;  2WDQ B;  1QOF A;  4MGK E;  1TKG A;  5CHF A;  4BOS C;  2MBB B;  3C19 A;  3FC4 A;  3CF6 E;  1FD6 A;  1WF9 A;  3H1U A;  1D3Z A;  1JML A;  3TUO A;  4NJ6 A;  3VRA B;  1E5W A;  3EC8 A;  3T3N A;  1LFD A;  2N4F A;  1JRO A;  1KTK A;  2BWF A;  2RSU A;  2IPK D;  4YXD B;  5EDS A;  1I7H A;  4PYU A;  4F1S A;  2BYF A;  2YLM A;  1N61 A;  3R8B A;  2KX3 A;  3P4S B;  3E56 A;  4KGR A;  2NTT A;  1RAX A;  3ABV B;  1C9F A;  2GLS A;  1V80 A;  3L16 A;  2DZM A;  1IUE A;  4HPM B;  3WAN A;  1E8X A;  1FXI A;  3EA6 A;  1L4D B;  2QHO A;  2KFK B;  2MCN B;  3J9C A;  1GAQ B;  2LGI A;  1GNU A;  5IAA C;  2JY6 A;  5JHB A;  2I1K A;  3ZRC A;  1TTN A;  2J0J A;  2K6D B;  1X1M A;  3W9C B;  1YIW A;  1Z2M A;  3TL5 A;  4YSX B;  5TSS A;  2BB6 A;  1FNV A;  2WX0 A;  3Q6B A;  4D2K A;  1V1O A;  4NPN A;  3BVZ A;  2BVC A;  3GB1 A;  1SJH D;  2IY0 B;  2BS2 B;  1HA5 A;  3KYC D;  1Q0W B;  1LGR A;  2N7E A;  1SIF A;  3EUB 2;  1ZOY B;  1QOG A;  3PLU A;  2FID A;  4DHJ B;  2JSV X;  4HK2 A;  3VH4 B;  2MBQ A;  1EO6 A;  5LLI A;  1SSN A;  4GDL A;  2MX2 A;  1V97 A;  2WXI A;  5KHQ A;  2MBO A;  2H88 B;  1AWD A;  3Q3N C;  1WMH A;  3TSS A;  2WXN A;  3AEF B;  5FR6 A;  2GRI A;  1ESF A;  1ENF A;  2AL3 A;  3APD A;  1OFF A;  3RCZ A;  3T8M A;  4OZC A;  4NNJ B;  3R7R A;  4AJY B;  2K3U A;  2KHW B;  1P7F A;  1T0S C;  4C4V A;  2ZJD A;  2FBW B;  4GDL B;  2KLG A;  4ANV A;  4PS7 A;  1WM3 A;  1ZDV A;  4MH8 A;  2DEN B;  3IBE A;  1F9J A;  5IOI A;  2J52 A;  2KKC A;  2B76 B;  2WP9 B;  4EE2 A;  3QIJ A;  3NUH B;  4BKT A;  2KDE B;  3U8Z A;  4KIK A;  3Q3F A;  4LDT D;  2BB5 A;  3KH0 A;  1MI0 A;  1D5X C;  4ANX A;  2RGF A;  1ZDX A;  1YQ4 B;  2N0S B;  4WAA A;  3EGR A;  4C4V B;  3VH3 B;  2G9H D;  3HM6 X;  4EKU A;  4GU2 A;  1QKZ A;  2HTH A;  2WXM A;  2W3R A;  2JF5 A;  1CZP A;  4HDQ A;  2PJH A;  1GB1 A;  3SFE B;  1YJJ A;  2KMM A;  3VTU A;  1I4P A;  4KSL C;  3I5J C;  1IBX A;  2A5U A;  2DLB A;  1UNS A;  1GJZ A;  3U30 A;  4LNN A;  1J7C A;  4AJW A;  3GE3 C;  3ZVV A;  1DOX A;  3AB5 A;  2VH1 A;  3NHE B;  2PLP A;  3NVY A;  3PT2 B;  1KOT A;  1WX8 A;  4S17 A;  2FE8 A;  4M00 A;  3DPD A;  2N9E B;  1IBX B;  1TS4 A;  3AE1 B;  3O65 B;  2VRR B;  2V1Y A;  2G1E A;  1YOV B;  3IT4 B;  5BMI A;  4II3 B;  3ZLZ A;  4NQL B;  1R4N I;  3DHH C;  1C4C A;  2PE6 B;  4IW0 A;  4RCO A;  2G3Q B;  4BOZ B;  2M1M A;  2WQY B;  1WGR A;  3HIZ A;  2DBY A;  3V62 A;  3ZO5 B;  5BYR A;  1XQQ A;  5DPR A;  2O6V A;  3VHT C;  1Q1O A;  3P63 A;  4ARC A;  4I6L B;  2WGS A;  2M4N A;  1PUT A;  2W54 A;  1MPE A;  3PRZ A;  5IKC M;  1UH6 A;  2KWV B;  2K9X A;  2ZPY A;  4W9F A;  2HE7 A;  2IGG A;  4A3O A;  3ECI A;  4ANU A;  4EOY A;  3DHI C;  4WQO B;  2LFI A;  1WGD A;  4E71 A;  2KFJ A;  3ZNG C;  1AYF A;  2JT4 B;  1ZXI A;  2NS5 A;  2PW9 A;  2CJO A;  3H9D A;  4A55 A;  2BPS A;  4B9K A;  1J7A A;  2L8J A;  2M19 A;  2DHZ A;  3RYT A;  3BVM A;  4KZC A;  2O6V B;  2BGF A;  4DK5 A;  1U4A A;  3N1Z C;  3KQ4 A;  2KMA A;  3PZ8 A;  4PT5 A;  1NYR A;  3TCA A;  2FNJ B;  4A9A A;  3RMK C;  1XT9 B;  1OQY A;  1ROE A;  2WXO A;  2PMV A;  3PHX B;  2R2Q A;  3RNB C;  4DXF A;  4ZRJ A;  1T0Q C;  5FKA C;  1YD8 U;  2ZW0 A;  2JQR B;  2BWE S;  2JWZ A;  3ZQ4 A;  3ZJV A;  4IWP A;  4FHJ A;  3JYU A;  4LJO B;  1TIF A;  1HTO A;  2MLB A;  1WXS A;  1V5T A;  4HKZ E;  2BF8 B;  3QX1 A;  3VFK A;  1FRD A;  3AE9 B;  3ONS A;  2LI5 A;  3OJ3 A;  3OG5 A;  3BZD B;  2V3P A;  1YJ1 A;  3PVL A;  2RDB C;  1WJ6 A;  1IYF A;  1GPX A;  1NVI D;  3NZS A;  3QHT A;  2KX0 A;  1C3T A;  3A1Q B;  3EEC A;  1YQ3 B;  4RGO S;  3DOW A;  2D11 A;  3VTV A;  1AW7 A;  4FJV B;  2LAS A;  4MH0 E;  4MAC A;  3L08 A;  1L7Y A;  1RFA A;  3PZD A;  3V3X A;  1PGX A;  4I6N B;  2LGD A;  4WWM A;  5FR3 A;  3HM3 A;  2AYO B;  2KDF B;  1NYQ A;  3ZGZ A;  3LXF A;  2KAC A;  4JWS C;  1ZW7 A;  3I57 A;  1A70 A;  1T0R C;  2K6Q A;  3IXS A;  5D6J B;  1MFW A;  3Q8A A;  4DDG D;  2XK5 B;  3R2I A;  2IDY A;  2JZ3 B;  2MWS B;  3MC8 A;  2WDT B;  2ONQ A;  3GZN B;  2V0G A;  3A4R A;  1QIL A;  3KWL A;  2K1F A;  3AEA B;  1E8W A;  2NCN A;  2J53 A;  4K7W A;  3PGE A;  1TY0 A;  3TEX A;  1D5M C;  3UIP B;  1PYW D;  3DBS A;  4XYC A;  3APF A;  2ZEQ A;  4US9 A;  2KN5 A;  1V86 A;  2AL6 A;  2RR9 A;  4CYE A;  1E0Z A;  1VRA B;  2LWP A;  3B2F A;  4TSS A;  2Z8L A;  1HTQ A;  4DHZ B;  4RM9 A;  1J0G A;  2LUM A;  2D10 A;  2FCS A;  3LYY A;  3Q14 C;  3P2B A;  1V9J A;  4MJS A;  3W1S A;  4KKI A;  1JWA D;  1I4X A;  2W3S A;  4PS3 A;  3VUY A;  1E7U A;  2KD0 A;  2HD5 B;  2RDG A;  2EEL A;  1B1Z A;  1I42 A;  4ZHP A;  2O6V D;  4YTN B;  2I1J A;  2M8S A;  3IAM 1;  3UI3 A;  1Q10 A;  1DOY A;  2VH2 A;  2AX5 A;  2GOW A;  2KWU B;  1NI3 A;  3E9S A;  2K8H A;  1G6J A;  1L2N A;  2GBM A;  1UGJ A;  4GGQ A;  3FAH A;  4FN2 A;  3ML8 A;  4P1C C;  4RGM A;  5IO9 A;  5G5G A;  1KH0 A;  2AQ3 B;  2HJ8 A;  2N9K A;  1C77 A;  2IO2 B;  4BBN F;  1V1P B;  4CQN A;  2WDR B;  4ZHO A;  1V49 A;  2C60 A;  3NZ3 A;  1QOA A;  4XX5 A;  3AEB B;  1DOI A;  2PPH A;  4KV2 A;  1FO4 A;  1CK1 A;  4KDI C;  1NEN B;  3RNF C;  5E6N A;  1SIJ A;  4DBG A;  2PVO D;  2NVU I;  1XXG A;  1FCC C;  1WR1 A;  3AED B;  4DDI D;  3ZJT A;  3RUL A;  3AN1 A;  3KWV A;  3NJT A;  1XD3 B;  3C8Y A;  4CHK A;  1TS3 A;  2MW5 A;  1KF6 B;  1D4B A;  1TGZ B;  2ZNV B;  1L0Y B;  4DXA B;  3I3T B;  4BZA A;  4FXC A;  1QQR A;  3DVN U;  2NMQ A;  5MPO A;  1V81 A;  4FBJ B;  1QOB A;  2C9W B;  3IAS 1;  3P4P B;  4PYZ A;  2FIF A;  4GSW A;  1T0Y A;  1OTR B;  1FPY A;  4NZL B;  2INC C;  3WAO A;  2L32 A;  1IGC A;  3ZKJ C;  3NRZ A;  2D5G A;  4BKG A;  2KWD A;  3NY5 A;  5AEK B;  1F77 A;  1I4G A;  1WE7 A;  2ZNV C;  3DWM A;  1BXT A;  2QC8 A; 
#chains in the Genus database with same CATH homology
 1EO6 A;  5LLI A;  1UBQ A;  4WJN A;  2UWQ A;  4GDL A;  3RT3 B;  2MX2 A;  1WXV A;  4W9H A;  5KHQ A;  2JVC A;  2MBO A;  2KC2 A;  2ASQ A;  3CSF A;  1WMH A;  3PRE A;  3WAP A;  4ZYN A;  3LJ3 A;  5FR6 A;  5AZF A;  3PSE B;  3L54 A;  3PRP B;  2AL3 A;  3KUD B;  4DHJ D;  3APD A;  2DAJ A;  2KDB A;  4ZRI A;  2MA9 B;  3WA0 A;  3RCZ A;  3IVF A;  3T8M A;  4CO7 A;  1VCB A;  5JZE B;  3H7P A;  4FHK A;  4MSM B;  5G2N A;  4NNJ B;  3R7R A;  4AJY B;  2LVO A;  1UGM A;  3L10 B;  2KHW B;  1Y8R C;  2D2Q A;  4KZ0 A;  3QQ8 B;  3VQI A;  3DBR I;  3N30 A;  4B95 A;  3A9J A;  2BKR B;  3QJZ A;  4OVV A;  3TIX A;  2L00 B;  2ZJD A;  4GDL B;  3L13 A;  4E3C A;  2KLG A;  4KVG B;  2B3A A;  3VH4 B;  4ANV A;  2A4Z A;  4PS7 A;  1WM3 A;  3UGB B;  4IC7 B;  3MHS D;  3AXC A;  2N1V A;  3T9L A;  2V4L A;  2DEN B;  4ICV A;  3IBE A;  4LDT B;  4HXD A;  4FAD A;  1F9J A;  1WIA A;  2LRU A;  2NBU A;  3VTW A;  2KKC A;  4MJS B;  1LM8 B;  5E6P A;  2LVQ A;  3IHP C;  3QIJ A;  2D3G A;  1WR6 E;  3QK0 A;  3X0W A;  4EZJ A;  5DPS A;  1QZE A;  3H7P B;  4G11 A;  2LXC A;  2N9X A;  2LJ5 A;  4G50 A;  4BKT A;  2KDE B;  3U8Z A;  2N9P C;  4KIK A;  1I35 A;  3Q3F A;  3NS8 A;  3KW5 B;  1TZ1 A;  4LDT D;  3KH0 A;  3Q3J A;  5DPT A;  5J2R A;  4W9K A;  2DZK A;  2EKE C;  4ANX A;  2RGF A;  3A9J B;  3AI5 A;  1ZGU B;  3A1Q A;  4WAA A;  4W9I A;  1WXM A;  4NAW A;  4W9J A;  2G45 B;  3DCG A;  3V6C B;  1OEY A;  3VH3 B;  3HM6 X;  4EKU A;  4GU2 A;  2HTH A;  3PTF C;  4A3P A;  2JF5 A;  1P98 A;  1HE8 A;  3BY4 B;  4FUL A;  4HDQ A;  2PJH A;  2CR5 A;  2LZ6 A;  4B6W A;  5J18 A;  2RD0 A;  4NY0 A;  4TKN A;  3VAW A;  3VTU A;  4BBN C;  5JH5 C;  3B08 A;  2K25 A;  3W1S C;  4KSL C;  3PLV A;  2KWC A;  1H4R A;  2KNB A;  4XC2 A;  2A5U A;  4IWQ A;  2ZCB A;  2LRW A;  1WX9 A;  1GJZ A;  3U30 A;  1E90 A;  3HK0 A;  4AJW A;  4W9C A;  1SGH A;  3ZVV A;  1WZ3 A;  3M95 A;  3PS6 A;  3VDZ A;  5L95 C;  3ZUN A;  3NHE B;  2WWZ A;  2NBW B;  4WWO A;  2XBB C;  4NAW B;  3EHV A;  1V2Y A;  3JVZ X;  4IM0 A;  3ENE A;  4OVU A;  2FCQ A;  5CHW A;  3UIN B;  3OLM D;  3PT2 B;  1KM7 A;  3QC8 B;  5D2M B;  3ZTC A;  1KOT A;  1WX8 A;  4W9E A;  2J0K A;  4HCN B;  2DYB A;  2WX1 A;  3DPD A;  2K8C A;  2XK5 A;  4JQW C;  3V61 A;  3VUX A;  3ZRF A;  3DQV A;  5BO4 B;  4TQ1 A;  2G4D B;  2MSE D;  1WJ4 A;  4WWN A;  5C1Z A;  2N9E B;  1LXD A;  3O65 B;  1E8Y A;  3DBH I;  2VRR B;  2V1Y A;  1M94 A;  3TBL D;  2Z0D B;  2MP2 B;  3V60 A;  3U7D A;  1RRB A;  4M8M A;  1IP9 A;  2L0F A;  4II3 B;  2KJH B;  5CHV C;  3ZLZ A;  2KOX A;  4NQL B;  1J8C A;  2KJR A;  1R4N I;  3KUC B;  2EMS A;  3JSV A;  2PE6 B;  4IW0 A;  2BKF A;  1NBF C;  2G3Q B;  1OGW A;  3DVG X;  2KVR A;  3N3K B;  2GBK A;  4BOZ B;  1GUA B;  2RPQ A;  2FUH B;  3AUL A;  2M1M A;  3IG3 A;  1WGR A;  3VXW A;  3HIZ A;  3V62 A;  3ZO5 B;  1GC7 A;  1XQQ A;  2O6V A;  3R3M A;  3NZU A;  5DPR A;  3UIO B;  2CS4 A;  3SD5 A;  3VHT C;  1Q1O A;  2L3Z A;  3BIN A;  3MJW A;  1C1Y B;  4I6L B;  3RUI B;  2M4N A;  3TJP A;  3PRZ A;  3CMM B;  1UH6 A;  2KWV B;  4KSK C;  2ZVN A;  2BYE A;  2K8B A;  2ZPY A;  4W9F A;  2HE7 A;  2LGY A;  4A3O A;  1WGG A;  2UYZ B;  4EFO A;  4TV3 A;  2OOB B;  3ECI A;  4JGH B;  4ANU A;  4A20 A;  3RZF A;  4EOY A;  4WQO B;  2Z59 B;  5AZH A;  2YVC A;  2KZR A;  1YQB A;  2KXJ A;  2G4S A;  1WGD A;  4E71 A;  4EZK A;  2KFJ A;  1WGH A;  3GZN I;  2KJ6 A;  3ZNG C;  2JT4 B;  1H8C A;  2NS5 A;  2O2V A;  1VD2 A;  2ZVO A;  3H9D A;  2BPS A;  4B9K A;  3ZDM C;  4FJZ A;  3PHW B;  2ZZP B;  4HPL B;  2KLC A;  2L8J A;  4GN1 A;  3APC A;  4XZ4 A;  2DHZ A;  3RYT A;  4KZC A;  2O6V B;  2BGF A;  4DK5 A;  1WFY A;  1OEY J;  2KQ7 A;  2V3S A;  3IFW B;  1U4A A;  4HWI B;  2KMA A;  1UZX B;  4FLH A;  3TCA A;  3RZW C;  3SDL C;  1S3S G;  2JRI B;  4AUQ C;  2L7R A;  3M3J A;  4K7U A;  4HLE A;  1WMH B;  3UF8 A;  4BFR A;  2FNJ B;  4K1R B;  1XT9 B;  2DAF A;  2BYV E;  2CHZ A;  4HJK A;  4K81 A;  1OQY A;  4M0W B;  2CU1 A;  2N7D A;  2R2Q A;  3PHX B;  4YL8 A;  3HHM A;  4ZRJ A;  1KJT A;  3DVG Y;  1YD8 U;  3ZTD A;  4WWP A;  2MRP A;  4EUT A;  1P0R A;  2DX5 B;  3QAQ A;  2BWE S;  2O2V B;  4GDK A;  4P7I A;  4NJ7 A;  4AP4 C;  2JWZ A;  5D94 A;  4DHJ B;  2AEH A;  4IWP A;  1WM2 A;  1PQS A;  4FHJ A;  3CST A;  3LDZ E;  3JYU A;  4LJO B;  2IY1 B;  4AWJ A;  5C23 A;  2JUO A;  4RM8 A;  2JXX A;  2MLB A;  1WXS A;  3KVF B;  4W9G A;  3WAL A;  4HCP B;  1V5T A;  1CMX B;  2C7H A;  2IO1 B;  4IG7 B;  4BKS A;  3DDC B;  3ML9 A;  2BF8 B;  3QX1 A;  3VFK A;  4FA6 A;  3N32 A;  2FAZ A;  4ANW A;  2DYO A;  2R2O A;  3ZDT A;  3QA8 A;  3ONS A;  2LI5 A;  4ASW C;  3OJ3 A;  3WAM A;  3L0W B;  2EMT A;  3TMP B;  1YJ1 A;  1WGY A;  2KFK A;  2AWT A;  2LUE A;  4GDK B;  1UD7 A;  4KIK B;  1WI0 A;  3PVL A;  5DPW A;  1WJ6 A;  1IYF A;  3X23 A;  2KC1 A;  1GG3 A;  3NZS A;  3QHT A;  3DVN V;  1GC6 A;  3QWZ B;  3SU8 X;  1EF1 A;  2KX0 A;  5LXI B;  1C3T A;  3A1Q B;  3DBL I;  3EEC A;  2KQS A;  2CHX A;  3DOW A;  2D11 A;  1RLF A;  3AU5 A;  1WE6 A;  3VTV A;  3UQA A;  4FJV B;  2LAS A;  5G55 A;  2LD9 A;  4MEM A;  5KHO A;  3GOE A;  5IA7 A;  3B0A A;  3C0R B;  4MH0 E;  4DWF A;  4LJP B;  5JHA A;  3L08 A;  1L7Y A;  2JPH A;  2L76 A;  2MBH A;  2W9N A;  4KDL B;  1RFA A;  3PZD A;  4E74 A;  1Z5S B;  2LGD A;  4I6N B;  5HKH A;  1FXT B;  3HM3 A;  2KTR A;  4GOC A;  3QAR A;  1BT0 A;  2AYO B;  1SE9 A;  2KDF B;  1WH3 A;  1WX7 A;  2N1W A;  3PV1 A;  4EZL A;  3A9K A;  1WZ0 A;  4G0N B;  4FJY A;  3KUZ A;  3H7S A;  4HVB A;  2KAN A;  4GXB A;  2WYQ A;  3M63 B;  4G3X B;  1ZW7 A;  4J6I A;  1KLV A;  2K6Q A;  4MM3 A;  3K9O B;  1MG8 A;  2Y5B B;  3UQB A;  4K7S A;  5D6J B;  3H6N A;  4IWO A;  4DDG D;  2KTF A;  2XK5 B;  2KMC A;  4IM3 A;  4DHZ E;  2JRH A;  4IM2 A;  2JZ3 B;  2LVP A;  2IO3 B;  2MWS B;  4HDO A;  2WDT B;  4MDK E;  2L0T A;  2LGX A;  1V6E A;  2NR2 A;  3A4R A;  5E6O A;  2M17 A;  3W1Y A;  4MGI E;  4WJO A;  4GIV A;  2K1F A;  2CHW A;  2C7M B;  1E8W A;  2NCN A;  3A9K B;  1NI2 A;  5CTR C;  2ZPN A;  4W9L A;  4K7W A;  3V6E B;  4X57 B;  3VVW B;  2GMI C;  3PGE A;  3JSV B;  2ZCC A;  1E7V A;  3M62 B;  3UIP B;  3DBS A;  2J7Q B;  3PPA A;  3APF A;  4JIO U;  2K39 A;  4W9D A;  2ZEQ A;  3A33 B;  4F1S A;  2GBN A;  2KN5 A;  1V86 A;  1YX6 B;  2AL6 A;  2IZV B;  2RR9 A;  4JLC A;  4PS8 A;  4CYE A;  2LWP A;  5TR5 A;  4JL9 A;  3ZIM A;  4DHZ B;  4IUM B;  4RM9 A;  1J0G A;  4MGY E;  2D10 A;  2FCS A;  4MJS A;  3W1S A;  3P2B A;  1V9J A;  1EUV B;  3RD2 A;  4PS3 A;  3ZNH B;  3KYD D;  3VUY A;  1E7U A;  2KD0 A;  2HD5 B;  2FCM A;  4RMA A;  2OJR A;  1I42 A;  4F8C B;  2FCN A;  1WY8 A;  2O6V D;  4LCD E;  1E8Z A;  3PRM B;  2I1J A;  4BVU C;  2M8S A;  2MBE A;  5CX3 A;  1WJN A;  2NBV B;  1WXA A;  3NOB A;  2NPT A;  1Q5W B;  1EF5 A;  2GOW A;  2KWU B;  2MQJ A;  1WYW B;  2Z0E B;  2K8H A;  1G6J A;  4MSQ B;  2GBR A;  1UBI A;  4ZRK A;  1L2N A;  2GBM A;  4EEW A;  5LXH A;  2CKH B;  1IPG A;  3ZNI D;  2DZJ A;  4GGQ A;  4MGK E;  5CHF A;  4AOF A;  4BOS C;  1A5R A;  4TUU A;  3K9P B;  2MBB B;  1ISN A;  3CF6 E;  4FN2 A;  1WRD B;  3ML8 A;  3VUW A;  2KDI A;  3B1L X;  1WF9 A;  3H1U A;  1D3Z A;  4ZDV A;  3OJ4 B;  1UEL A;  2HJ8 A;  2IO2 B;  4BBN F;  4NJ6 A;  1E5W A;  3EC8 A;  4MGZ E;  1LFD A;  1V49 A;  2C60 A;  2N4F A;  2XEW A;  2REX A;  3SHQ A;  5L83 A;  4TQ0 A;  2IYD B;  2BWF A;  4GB9 A;  2RSU A;  4XX5 A;  5EDS A;  1NDD A;  2NPT B;  2PPH A;  2GBJ A;  2JZZ A;  2KK8 A;  3ALB A;  2L05 A;  1YX5 B;  3R66 C;  2IO0 B;  4KV2 A;  4PYU A;  2BYF A;  4KDI C;  2YLM A;  2KX3 A;  3A4S C;  5E6N A;  3R7Q A;  1RAX A;  4DBG A;  2KO3 A;  1AAR A;  1TBE A;  2M0X A;  3EFU A;  2NVU I;  1V80 A;  3L16 A;  3ZW3 A;  1WR1 A;  4NQK E;  2DZM A;  4M8N A;  5AZG A;  3OAW A;  4WJP A;  5J17 A;  2D07 B;  4MEL A;  5D7G A;  4DDI D;  2J0M A;  3RUL A;  2MP2 A;  4HPM B;  3WAN A;  4GMV A;  1E8X A;  1XD3 B;  3S2A A;  3QCA A;  4CHK A;  3ZNZ B;  3MTN B;  2QHO A;  5GMV A;  2MW5 A;  1K8R B;  1R4M I;  2KFK B;  2MCN B;  1TGZ B;  1LQB A;  2ZNV B;  1P3Q U;  1JRU A;  4DXA B;  3AU4 A;  1V5O A;  4BKS D;  3I3T B;  1GNU A;  2C7N B;  2JY6 A;  5IAA C;  2I1K A;  5JHB A;  4II2 B;  3JW0 X;  4ICU A;  3ZRC A;  1TTN A;  3DVN U;  2DYM A;  2J0J A;  2K6D B;  1ZKH A;  3L17 A;  1X1M A;  1YIW A;  1Z2M A;  3TL5 A;  1V81 A;  4FBJ B;  2C9W B;  4PYZ A;  2PE9 A;  2FIF A;  4GSW A;  1J19 A;  1T0Y A;  1OTR B;  2WX0 A;  1P9D U;  4URK A;  4NPN A;  1WJU A;  3D32 A;  3WAO A;  3ZKJ C;  3WIM A;  1P1A A;  2LXA A;  2DZI A;  4F7Z A;  4BKG A;  4WJQ A;  2IY0 B;  2KTR B;  2IBI B;  4N9F 4;  3KYC D;  1Q0W B;  2C5L C;  2N7E A;  1S1Q B;  1SIF A;  3NY5 A;  5AEK B;  1WE7 A;  3PLU A;  2FID A;  2ZNV C;  2PEA A;  5DCN A;  4HK2 A;  4I6P A;  2MBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...