2WYQA

The crystal structure of the ubiquitin-like (ubl) domain of hhr23a (human homologue a of rad23)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
MAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKNFVVVMVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Ubiquitin-Like (Ubl) Domain of Human Homologue a of Rad23 (Hhr23A) Protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords UV EXCISION REPAIR PROTEIN RAD23 HOMOLOG A
total genus 20
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2009-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2wyqA00
2LGYA 2CHZA 1WR1A 3N30A 4BBNF 3NHEB 5JHAA 1E8XA 4PS3A 2KQSA 2L8JA 4ANUA 1GG3A 3WIMA 3CSTA 2KMCA 3K9PB 2KC2A 5J18A 3ZKJC 2L76A 1HE8A 2C7NB 1V86A 4LJOB 2FCSA 1TBEA 3PZDA 2LRUA 2BGFA 4GOCA 2R2OA 3APDA 2BPSA 2GBRA 2ASQA 3JYUA 3ZVVA 2KTRA 4FADA 3R7QA 3L08A 2GOWA 2BKFA 2NBWB 4G0NB 4HPMB 4NY0A 3PT2B 4ZRIA 3QHTA 3B08A 1OEYA 3H7SA 1WI0A 1IP9A 1YX5B 2ZVOA 3D32A 3T8MA 1GUAB 2DYOA 4A20A 3PSEB 2BYVE 1EF5A 3IFWB 3ZLZA 2MRPA 4MGZE 3L17A 2O2VB 2C7MB 2MBHA 3TIXA 3WALA 3ZUNA 1SGHA 1WE6A 3K9OB 4GMVA 2GBJA 4HCNB 3TCAA 1V6EA 4EZJA 3APCA 3OJ4B 4ZYNA 3WA0A 3EC8A 4F7ZA 2NBVB 2N7EA 4FN2A 3GZNI 1WM2A 3ML9A 2I1KA 1EO6A 1T0YA 1WM3A 3ML8A 3N32A 3VVWB 3VH4B 2L00B 3U8ZA 5FR6A 1EUVB 3AU4A 1LQBA 4NAWB 1LFDA 2D07B 1YJ1A 5DPWA 3BY4B 3VQIA 4EUTA 2CHWA 2M1MA 2FIDA 3TL5A 2LASA 3LJ3A 4BOZB 4K81A 1RAXA 5JH5C 3EFUA 4WQOB 4WJNA 2ZPYA 4M0WB 2C5LC 2KDIA 3VTUA 3A9KA 2D10A 4ZRJA 1TZ1A 2KX0A 3VH3B 4HCPB 2KHWB 1WH3A 2JT4B 2OOBB 2KWVB 2DYMA 1FXTB 1NBFC 1S1QB 1YQBA 2D3GA 1RRBA 2YVCA 4ZRKA 4FHKA 2AEHA 3NY5A 3W1SA 1F9JA 3ZO5B 3ALBA 2KC1A 3I3TB 4W9CA 4DDID 3DVNU 3MTNB 3L54A 3M3JA 4HVBA 5CTRC 5CHWA 5KHOA 4DK5A 1E5WA 1EF1A 4GIVA 2NBUA 4URKA 3DPDA 2N1WA 3NZUA 4FLHA 3R3MA 3M63B 4W9IA 4B6WA 2LXAA 4XC2A 1WXSA 4K7SA 2MSED 2IO2B 3VTVA 1OEYJ 2Z0EB 4G3XB 4W9DA 3KUDB 4G11A 3VUYA 4RM8A 4EZKA 1GC6A 3ZNID 2ZZPB 2DZIA 1YD8U 1S3SG 2ZNVC 4WWOA 3VDZA 4WWPA 4NQKE 4ANWA 2RGFA 2GBNA 1UGMA 4RM9A 3MJWA 3H7PA 4EZLA 2MP2B 2IBIB 4KSLC 2LVQA 2N7DA 4P7IA 3U7DA 2KZRA 5D7GA 1LM8B 4IWQA 4II3B 3H9DA 1AARA 4K1RB 2EMSA 4K7UA 4DWFA 4BKTA 2RD0A 3DOWA 5G2NA 1PQSA 4M8MA 3L13A 3C0RB 1WFYA 3JSVB 4X57B 2FCNA 4ANVA 1WJNA 3GOEA 4DHZE 2KANA 3RZFA 2N9EB 3QARA 4KIKB 4I6NB 4W9FA 1UD7A 1XT9B 2KLGA 2ZCCA 3DBLI 2MWSB 4GDKB 1E7UA 4JL9A 3V6CB 3ZNZB 4DBGA 1ZGUB 2KWCA 1ZW7A 2K8CA 2KJ6A 3DBRI 2DENB 3ONSA 4GU2A 2NR2A 3B1LX 2PE6B 3RZWC 3X23A 2KTFA 3ENEA 2KTRB 5IAAC 2J7QB 2HE7A 2L05A 2JPHA 2KDBA 3EHVA 3NZSA 2FNJB 1MG8A 3UIPB 2KVRA 1UH6A 4GDKA 2FUHB 4GDLA 3W1SC 5E6NA 3P2BA 1WYWB 2D2QA 2LGXA 3KW5B 3LDZE 1UELA 3CMMB 3ZDTA 4CHKA 2PPHA 4KV2A 2GMIC 4W9HA 4WAAA 4F8CB 3ZNHB 3H1UA 1TGZB 4MJSA 3V6EB 4WJQA 2K1FA 4PYZA 3ZTDA 2WWZA 2DYBA 2NCNA 2KDFB 4I6LB 5CHFA 2KNBA 2W9NA 4W9GA 3WAMA 4AUQC 2N4FA 2KFKA 1BT0A 2EMTA 4IWOA 2DZKA 5IA7A 2KJHB 1IPGA 1VD2A 3ZDMC 2KOXA 1Z5SB 3A1QB 2NS5A 4IG7B 3VHTC 3AXCA 3TJPA 3U30A 1K8RB 3B0AA 4MDKE 2O6VD 3JSVA 1KM7A 2KX3A 3IBEA 3SD5A 2L7RA 3NOBA 3PVLA 3QAQA 2LRWA 3O65B 3HM6X 4WWNA 4N9F4 3VUXA 3R66C 2WX1A 3DBHI 4ANXA 1WGYA 2KO3A 1ISNA 2LI5A 4BVUC 3JVZX 2LVPA 1E8YA 3Q3JA 1WXVA 3QA8A 5JHBA 5AZHA 1V5TA 4W9JA 4BFRA 1WF9A 3APFA 4TQ0A 4KZ0A 4A3OA 4FJVB 3L16A 4ICUA 2DX5B 3DBSA 3ZTCA 2C7HA 2N9XA 2BWES 1WZ3A 4IWPA 2A4ZA 5C23A 4ZDVA 2FCQA 2BYEA 4NJ6A 1I42A 4MM3A 3BINA 1WJUA 4XX5A 1WX9A 3A4RA 2MLBA 2CKHB 2DHZA 2ZNVB 4IM3A 4AWJA 3ZRCA 4DHJB 4DXAB 4F1SA 3L0WB 2K8HA 1WRDB 4EFOA 2A5UA 1WGHA 1UBQA 2RR9A 2Y5BB 3KUZA 3M95A 4MGKE 3UIOB 4E74A 2KN5A 3KH0A 1WMHA 1WX8A 1Q5WB 4MEMA 1YIWA 4KVGB 2PEAA 2MW5A 3SU8X 4AOFA 2ZPNA 1V81A 3H7PB 2K6DB 2GBKA 3RYTA 3WAPA 1M94A 3A9JB 3PRZA 1TTNA 3QJZA 3ZIMA 5EDSA 3A9KB 1SIFA 1P0RA 2AL3A 2HD5B 4NPNA 4ASWC 2BKRB 2MBBB 4BKSA 2ZVNA 2MBOA 2KDEB 3V62A 5J17A 3DDCB 1ZKHA 2REXA 4DHZB 3PV1A 5DPTA 4IW0A 4DDGD 2Z59B 4NAWA 4HJKA 1E8ZA 2JF5A 4YL8A 1WE7A 4GB9A 3TMPB 3WANA 1QZEA 4W9LA 4AP4C 3W1YA 1WGGA 2JUOA 2JRIB 4GXBA 4KDLB 3V60A 2QHOA 4PYUA 2LXCA 2LUEA 2L3ZA 3QCAA 4OVVA 3H6NA 2VRRB 3NS8A 2K8BA 3RT3B 1H4RA 3HHMA 4LDTD 2MA9B 4GSWA 2CS4A 4LJPB 4IUMB 2K6QA 2RPQA 4W9EA 3RCZA 2G3QB 3TBLD 4E71A 2KK8A 4NNJB 3L10B 4FJYA 1KJTA 2EKEC 4RMAA 5GMVA 4MJSB 2MBQA 3R7RA 1A5RA 3SHQA 1WMHB 3AU5A 2J0JA 3QWZB 4JGHB 2DZMA 3RUIB 5JZEB 2IY0B 4EOYA 5HKHA 2WYQA 2O6VB 1P9DU 2XK5A 4LDTB 3Q3FA 4IM2A 4KDIC 3PHWB 5AZGA 4IC7B 2MBEA 3DCGA 3PRPB 2MCNB 3KYDD 2C60A 1OQYA 5LLIA 4BKSD 1WY8A 2G4DB 1KLVA 3UGBB 3S2AA 2JXXA 1C1YB 5E6PA 2JRHA 3A4SC 3PHXB 4HDQA 3QIJA 2K25A 2LVOA 5AEKB 4PS8A 2BYFA 4MELA 2KJRA 5D6JB 2MQJA 4FBJB 4MGYE 4MSMB 2YLMA 1V9JA 1E8WA 1LXDA 3RULA 1XQQA 3CF6E 3IG3A 4KIKA 2LZ6A 3UQBA 3OLMD 2L0FA 1OGWA 2DAFA 2G4SA 3UQAA 2AL6A 3HM3A 2CU1A 3JW0X 1H8CA 1WXMA 4TKNA 2JWZA 3AULA 5CHVC 2IZVB 3ECIA 1Y8RC 2M17A 3N3KB 3VAWA 5AZFA 2LD9A 2RSUA 3UINB 5L95C 5J2RA 2J0MA 1Z2MA 2N1VA 3UF8A 1I35A 4A3PA 1C3TA 1R4NI 2V1YA 1G6JA 3VUWA 1Q1OA 3PTFC 4OVUA 2LWPA 1P3QU 2KWUB 4B9KA 4JLCA 4B95A 3ZRFA 4LCDE 1U4AA 4TV3A 2BF8B 3QX1A 4EKUA 1GJZA 5DPRA 1WGDA 2LJ5A 4NQLB 2PE9A 2IYDB 3VTWA 2WX0A 5DCNA 3RD2A 3KYCD 2PJHA 1WR6E 2MX2A 4AJWA 1D3ZA 1KOTA 2B3AA 5D94A 1RFAA 3A9JA 2CR5A 4PS7A 4DHJD 2UYZB 3HIZA 1SE9A 3AI5A 2J0KA 2KXJA 4ICVA 1WJ4A 3SDLC 1V2YA 2C9WB 1IYFA 4NJ7A 2XEWA 2JZ3B 2IO1B 4E3CA 2D11A 4BKGA 2ZCBA 1E7VA 3PREA 4WJPA 4JQWC 4BOSC 4TQ1A 3DVGX 2O2VA 3IHPC 4GGQA 3IVFA 2IO3B 2IY1B 4HK2A 1RLFA 4KSKC 5E6OA 1R4MI 2JVCA 5KHQA 1CMXB 2KKCA 1GC7A 3VFKA 3KVFB 5L83A 1VCBA 4EEWA 2KQ7A 4FULA 4I6PA 1GNUA 2R2QA 2Z0DB 4J6IA 3T9LA 2O6VA 2XK5B 2WDTB 4AJYB 3OAWA 4CO7A 3HK0A 4TUUA 2DZJA 3DQVA 4HWIB 3WAOA 4G50A 3PLUA 1P98A 2K39A 1JRUA 2KFKB 3QQ8B 3M62B 4HLEA 1WZ0A 1WX7A 4CYEA 1WIAA 2AYOB 4HDOA 2MP2A 3A33B 3PGEA 3QK0A 3VXWA 4KZCA 1WJ6A 2M8SA 3PPAA 2KLCA 2XBBC 2DAJA 4MGIE 4HXDA 2V3SA 3PS6A 2KMAA 3X0WA 2KFJA 2OJRA 3QC8B 2IO0B 1UZXB 4HPLB 1OTRB 3EECA 1V49A 1UBIA 1V80A 3V61A 4M8NA 4GDLB 2AWTA 2N9PC 1NI2A 4IM0A 4II2B 2FCMA 5LXHA 2UWQA 1L2NA 1E90A 3KUCB 2I1JA 4BBNC 5DPSA 3DVGY 2L0TA 1NDDA 1J19A 2ZJDA 2JZZA 3OJ3A 3PLVA 2FIFA 1V5OA 2ZEQA 1WXAA 5G55A 2G45B 5LXIB 5CX3A 3MHSD 1L7YA 2NPTB 2HJ8A 2NVUI 3DVNV 2BWFA 1P1AA 2HTHA 4JIOU 2M4NA 4MH0E 2FAZA 4MSQB 4WJOA 1J0GA 3A1QA 1Q0WB 4XZ4A 4FA6A 5C1ZA 1YX6B 3PRMB 5D2MB 3ZW3A 2LGDA 4W9KA 1X1MA 2NPTA 3CSFA 5TR5A 1XD3B 2GBMA 4FHJA 4K7WA 1J8CA 4GN1A 2M0XA 1WGRA 3ZNGC 5BO4B 2KD0A 2V4LA 2JY6A 4FJZA 2CHXA
chains in the Genus database with same CATH superfamily
2LGYA 1JCKB 3AEFB 4RF0A 2L8JA 4ANUA 1TJEA 3WIMA 2EKIA 2KC2A 3ZKJC 1QT9A 4P16A 4LJOB 4WIPA 2FCSA 2LRUA 2BGFA 3APDA 3NVWA 2KWDA 2QDFA 3R7QA 2LGIA 3L08A 1UUPA 1PDXA 4ZRIA 4YTNB 3RNAC 1VRAB 3H7SA 2GB1A 1IP9A 4A20A 1SEBD 3L17A 2O2VB 1K52A 2K22A 3TCAA 4EZJA 3APCA 4N59A 1FNUA 3OJ4B 3RNEC 4ZYNA 5EE0A 4FN2A 2N7EA 2ZW1A 3P1MA 1DYQA 3VH4B 1NENB 5FR6A 2X8XX 2V3PA 2ACZB 2FIDA 2D3CA 1UWXA 3EGRA 4K81A 3W5VB 2MH7A 1IBXB 2KDIA 4ZRJA 2JT4B 2Y5PA 1K51A 2DYMA 1S1QB 5H92C 1YQBA 2Y3AA 4FHKA 3ZGZA 3NY5A 4HKZE 3W1SA 3I3TB 3T3NA 3MTNB 3L54A 3BWUD 5KHOA 4A55A 4GIVA 1EWCA 1T5XD 4M01A 3NZUA 2GI9A 4FLHA 2LXAA 1TYGB 2Z0EB 3KUDB 2KAJA 4EZKA 2DZIA 1YD8U 4ANWA 4EZLA 4A6QA 2IBIB 3TEYA 2LVQA 2KZRA 5D7GA 5G5HA 1FCLA 1AARA 3DOWA 3BYYB 1WFYA 3JSVB 4X57B 3MP9A 4RGMA 4KIKB 3KLSX 3DBLI 3V6CB 1ZP0B 1TZOA 2LHDA 5IOIA 3SFEB 5IO9A 2KTRB 2HE7A 1ZE3D 2JPHA 1T0QC 3EHVA 3EUB2 3NZSA 1P7FA 1EWYC 5E6NA 2D2QA 1MHXA 3CMMB 1C4AA 4WAAA 3ZNHB 1TGZB 3GE3C 3P4PB 2WWZA 1MG4A 2KDFB 5CHFA 2KNBA 4W9GA 2D5GA 3BVGA 4YWGG 4IWOA 5IA7A 2DZKA 3BVMA 3RNBC 2NS5A 4KKIA 4IG7B 3VHTC 3AXCA 4BZAA 3AB5A 1K8RB 1KM7A 1DGJA 3E56A 3NVZA 3PVLA 2LRWA 3HM6X 4YSXB 5IP4D 3VUXA 1WGYA 4BVUC 1ISNA 2LVPA 5JHBA 1NEKB 2INDC 5AZHA 5HI1A 2WXMA 4BFRA 1XLQA 2J4XA 2KQ4X 1VZ6A 4ARIA 4ICUA 1QOGA 2BWES 3C19A 4ZDVA 2FCQA 3AE4B 1I42A 3BINA 1CJEA 2ZNVB 4IM3A 4EFOA 3DWGC 1UBQA 3M95A 4REZA 2YEPB 1YIWA 3NVYA 4AOFA 4NZLB 5C2TB 3RYTA 1M94A 1PUTA 3A9JB 3QJZA 1SIFA 1P0RA 2AL3A 1ZDXA 1JWMD 2XNAC 2KDEB 3DDCB 3PV1A 4IW0A 2Z59B 2Y5CA 4HJKA 1E8ZA 3AN1A 1CQVA 4GB9A 2D3BA 3FC4A 1JRPA 2Q5WD 1WGGA 2JUOA 2R61A 4M0WA 2LXCA 3H6NA 2VRRB 2INCC 3HHMA 2MA9B 3AECB 2BVCA 4DXFA 3N9YC 4E71A 2KK8A 3L10B 1KH0A 3URYA 5GMVA 3SHQA 3QWZB 4JGHB 4C7YA 2DZMA 3FKYA 4EOYA 1P9DU 1QQRA 3Q3FA 4YT0B 1VDVA 1I4PA 2MBEA 1YQ3B 5BMIA 1C79A 2MCNB 3KYDD 4BKSD 3HVZA 2G4DB 1C1YB 3A4SC 3AMZA 5AEKB 2BYFA 3PO0A 4FBJB 5FK9C 1FFVA 1V9JA 3I5JC 3RULA 2N9LA 1XQQA 2WXPA 3IG3A 2LZ6A 1XF5L 4LLGM 1H8CA 1UGJA 4XDDA 2M17A 2HTME 5AZFA 2RSUA 4JWUC 2HJ1A 2J0MA 1C3TA 5EE9A 2WXJA 2D3AA 1G6JA 3VUWA 4OVUA 1P3QU 4B9KA 4B95A 1U4AA 3QX1A 4KGSA 2WLBA 1T0SC 2IDYA 4ARCA 5DPRA 2LJ5A 2IYDB 5DCNA 3RD2A 2IGDA 2MX2A 2WXKA 5D94A 1RFAA 2W54A 4PS7A 1SE9A 1YN5A 4ICVA 4J3OD 1E0ZA 1SF0A 1D4BA 4E3CA 2XEWA 1I4XA 2D11A 1E7VA 1RWSA 2RDHA 4TQ1A 3KQ4A 4JE3B 1B1ZA 1R4MI 2JVCA 5KHQA 3VFKA 1GC7A 2BT6A 2KQ7A 2Z0DB 4C7ZA 2O6VA 3N1XC 4CO7A 4TUUA 2DZJA 4G50A 1AW7A 2K39A 2KFKB 2E6XA 1WX7A 2WXNA 1HTQA 3PPAA 2KLCA 1YOVB 5MPOA 2VZKB 4HXDA 1R4NB 2KFJA 3QC8B 1UZXB 1OTRB 3MC0B 1V49A 1V80A 3V61A 2AWTA 2N9PC 3VR9B 1ZXHA 2W82A 4II2B 2N0SB 5LXHA 4XWTA 4BBNC 3DVGY 2L0TA 1XEEA 2ZJDA 3DWMA 3N20C 3PLVA 2FIFA 1N62A 3SFDB 1WXAA 3UI3A 2G45B 2MEKA 2WXOA 3U52E 1L5PA 3DVNV 1L0XB 1P1AA 1OQQA 2WXIA 4WJOA 1Q0WB 3PRMB 1FMAD 3V05A 1J8CA 1I4RA 1KLGD 1WGRA 2LJIA 2RMMA 2GLSA 3N30A 4BBNF 2XN9C 1N5WA 2KQSA 3CSTA 2KMCA 4WURA 1DOYA 2M19A 2L76A 2WU2B 3AEAB 4CQNA 4LNKA 5AUIA 3PZDA 4GOCA 2R2OA 2BPSA 3JYUA 3DHIC 2GOWA 2BKFA 2NBWB 4G0NB 4NY0A 3L4PA 1OEYA 2VH2A 4YSYB 1YX5B 3Q3OC 4YSZB 5BMHA 2FUG1 2BYVE 2MRPA 4MGZE 2C7MB 2MBHA 4IKGA 1WE6A 3FAHA 3K9OB 3R2TA 2GBJA 4GMVA 4HCNB 1V6EA 1JWSD 2G1EA 4F7ZA 4XWWA 4C4VA 4OZAA 1KFYB 2JYTA 2I1KA 1WM3A 1T0YA 4HKQA 3U8ZA 1ENFA 5DPWA 3ZYYX 3VQIA 2M1MA 3LJ3A 1RAXA 3EFUA 1YJJA 2RDBC 2ZPYA 4FXCA 2WDVB 4OHJA 2D10A 2KX0A 4HCPB 1WH3A 2OOBB 1J7AA 1FXTB 1SE2A 1NBFC 1CK1A 2D3GA 4ZRKA 2YVCA 1GOZA 2AEHA 1K50A 2KC1A 3SEBA 5CHWA 1E5WA 1L0YB 1OFFA 1WRIA 2NBUA 4URKA 3ZJVA 2N1WA 2KMMA 3R3MA 1XLOA 2I2YA 1WXSA 2J53A 4K7SA 2MSED 2IO2B 1OEYJ 2JQRB 3MFGA 2NTSA 3VUYA 1GC6A 4RNAA 2BS2B 2RGFA 3SR6A 1N63A 2WXQA 2N7DA 4WWMA 1PGBA 2BS3B 1LM8B 4JPSA 1TKEA 4II3B 2KN4A 2EMSA 3BK2A 4BKTA 4M8MA 3L13A 3C0RB 2FCNA 4ANVA 1WJNA 1SE3A 2PVGC 3RZFA 3ABVB 3QARA 4I6NB 1XT9B 2DLBA 2SAKA 4DBGA 1ZW7A 1HA5A 2KJ6A 2QILA 2WDRB 3DBRI 3ONSA 4GU2A 3R2IA 3B1LX 4LTUA 2PE6B 3AE6B 3ZQ4A 3NVVA 2KDBA 1XO3A 2X38A 3UIPB 2NTTA 4GDLA 2ONQA 3TEWA 3KW5B 1UELA 4CHKA 2PPHA 1AN8A 3AE1B 1T6BX 4KV2A 4M00A 4OW0A 3H1UA 4A9AA 4MJSA 2K1FA 4PYZA 1AWDA 3ZXRA 5L95C 2W9NA 4LK0M 2N4FA 1BT0A 4R3DA 1RM6C 3LYYA 1IPGA 1MFWA 2KOXA 1RFKA 4L2YA 3E9SA 3B0AA 2O6VD 5FKAC 4XDCA 3NOBA 2V3NA 4WWNA 4N9F4 3VRAB 3DBHI 4ANXA 2KO3A 3JVZX 1E8YA 3QA8A 1WXVA 1V5TA 3Q8EA 1C4PA 1HTOA 3BZDB 4TQ0A 2OJWA 1DOXA 4A3OA 2Z8LA 3Q8CA 2A4ZA 2IPKD 4AS1A 3AEBB 1V1OA 5HG2A 4ZOHC 4F1SA 4DXAB 2K8HA 1WGHA 2RR9A 4MGKE 2MHJA 2KN5A 1WX8A 2AQ3B 1SJED 4KVGB 4LNOA 2ZPNA 3H7PB 2GBKA 2QJLA 3DBHB 1KRHA 3WAPA 4IOIE 3KWVA 3EFCA 2HD5B 2PKOA 2BKRB 1QF6A 3AH7A 5J17A 1Y56A 2DBYA 2EELA 2V4IB 4NAWA 3W9CB 3MC8A 1JALA 4US8A 2OEDA 3TUOA 1WE7A 3WANA 3TMPB 3BYTB 3W2DA 4OZCA 1MHHE 3NG0A 3RT3B 3Q6BA 3AE9B 4LDTD 1AYFA 4XE0A 2LFIA 4IUMB 2K6QA 2WDQB 2G3QB 3IAM1 2H89B 4RGNA 1A5RA 1WMHB 5JZEB 5HKHA 1FRRA 1P7EA 4USAA 2O6VB 3Q3NC 3PHWB 3MHZA 3PRPB 5T8IA 1D5XC 3KWLA 3LXFA 3S2AA 2MJEA 1ZUD2 2DNFA 4JWSC 2KJRA 5D6JB 2PLPA 4P6VF 4RH6A 4MGYE 2YLMA 1PGXA 3CF6E 2ZW0A 1HXYD 2L0FA 2G4SA 3UQAA 3AE7B 2AQ2B 3JW0X 2WNMA 4WH4A 4TKNA 3Q69A 2JWZA 1Y8RC 3N3KB 2UU7A 4OVZA 3VAWA 3GS2A 2OHFA 3UINB 5J2RA 4LNFA 1TS4A 1R4NI 2V1YA 1Q1OA 3PTFC 1V1PA 2KWUB 1OQRA 1WGDA 1HQRD 4NQLB 2PE9A 3U4EG 2PJHA 2BB6A 3A9JA 1ROEA 4DHJD 4HEA1 1L6VA 1IYFA 2W3RA 4NJ7A 3ZXVA 2ZCBA 3PREA 1ACCA 1TS5A 4WJPA 4BOSC 1M4VA 4TSSA 2CJOA 3IVFA 2IO3B 2IY1B 1HZ5A 1CMXB 2KKCA 1GB4A 4FULA 4I6PA 1YMHE 2XK5B 4RGTA 1KF6B 3PLUA 4S17A 4PT5A 1V1PB 4WAFA 2L1AA 4LNNA 1MPEA 3Q8AA 3QK0A 1LGRA 3VXWA 1SSNA 2M8SA 5LNK1 4Q2JA 1FRDA 1QILA 2L52A 2K5PA 2V3SA 2OJRA 1IGDA 1ZPSA 1UNSA 1LO5D 5IKCM 4IM0A 2FCMA 5FR3A 3BIID 1JMLA 3P63A 2JZZA 3OJ3A 4XYCA 1V5OA 1A70A 4L1BA 5G55A 2RDGA 1L7YA 3MHSD 2NPTB 2HTHA 4JIOU 4MH0E 3RN9C 1X1MA 3AE8B 3CSFA 1XD3B 2WXGA 1PYWD 1SJHD 2L32A 5H8YE 3ZNGC 1N60A 2V4LA 1C77A 2CHXA 1C76A 3RI7C 3I63C 3NHEB 1E10A 1E8XA 2PVOD 1GG3A 1Q10A 3K9PB 5J18A 1FXIA 5GXGB 2C7NB 1V86A 3NJTA 2ASQA 2ON8A 1SIJA 5TSSA 3P4RB 5D3DA 3QHTA 3D32A 3I57A 2V9HA 1EF5A 3IFWB 2WXHA 3TIXA 3WALA 1SGHA 3C8YA 3EC8A 1YQ4B 1JQ4A 2NBVB 4BAXA 3ML9A 3T3OA 1EO6A 4KKJA 3VVWB 2L00B 1EUVB 1YN3A 3N1YC 2WGSA 1YJ1A 1UF0A 4EUTA 2CHWA 1TKYA 3TL5A 3DHGC 4BOZB 3IXSA 5G5GA 4WJNA 4M0WB 2C5LC 2QCZA 1RYJA 2KHWB 2FBWB 4PK1A 2KWVB 4US9A 2PTLA 1F0ZA 1F9JA 4ACFA 5HHDG 4W9CA 3AE2B 3DVNU 2CU3A 3M3JA 5CTRC 1VLBA 1SXTA 1I4GA 3DPDA 1WYGA 4NAMA 2J42A 3EA6A 4G3XB 2BBCA 4G11A 1FEHA 1T0RC 1XCTL 4RM8A 3RPFC 3ZNID 2ZNVC 1S3SG 2INPE 1J7BA 4WWPA 4NQKE 2GBNA 4KSLC 1JWAD 2H88B 1ZXIA 1SBBB 1L4ZB 4K7UA 5G2NA 1PQSA 1NYQA 1J7CA 4A90A 2N9KA 1UD7A 2QEJC 1PFDA 2KLGA 2ZCCA 4JL9A 1ZGUB 1TS2A 2KWCA 2K8CA 2VZKD 2DENB 3CWIA 4ZRQA 3RNCC 2V0GA 1VZ7A 4UDUC 5IAAC 2AX5A 2KYWA 1D6EC 1MG8A 1C4CA 1YJIA 3HRDD 3LDZE 3ZDTA 1WWTA 4F8CB 1B9RA 1FNVA 2DYBA 2NCNA 4AUQC 4EE2A 2KFKA 2EMTA 2KJHB 4P1CC 4N58A 1VD2A 3HUIA 3A1QB 4MDKE 2KX3A 3ZJUA 3O65B 3Q3JA 1TY0A 1WF9A 4JX1C 2DX5B 3ZTCA 5JXVA 1WZ3A 1PGAA 2L83A 2PW9A 2BYEA 2I38A 3TEXA 1R4MB 1WJUA 4XX5A 2CKHB 4AWJA 3ZRCA 1N61A 3L0WB 2A5UA 3KUZA 2WS3B 3UIOB 2NMQA 4E74A 3KH0A 1WMHA 4C00A 4MEMA 4OZBA 2PEAA 3SU8X 5HFYA 1V81A 2IJ0A 1JWUD 3ZIMA 1TTNA 1ESFA 2BYTA 4ZHOA 5EDSA 2MBBB 3P4SB 3V62A 1ZKHA 2REXA 4DHZB 2CJNA 2WXLA 1QKZA 2JF5A 5AUKA 4YL8A 3U7ZA 2M0AA 3W1YA 4DQOC 4GXBA 5D3IB 5C3JB 3V60A 5BMGA 1E9MA 2QHOA 4PYUA 2MJ3A 2LUEA 2L3ZA 3QCAA 1T3QA 4OVVA 3NS8A 2K8BA 3IAS1 2CS4A 4K3CA 4MH8A 2WXRA 1FM0D 2RPQA 1VR9A 3RCZA 3TBLD 4RMAA 2EKEC 3DHHC 3H8HA 1MVKA 2J0JA 3RUIB 3Q8FA 2IY0B 1IBXA 2WYQA 2XK5A 1F77A 4LDTB 1MI0A 4MM3B 4IM2A 1ET6A 1QOAA 4IC7B 3DCGA 1WXQA 4K3BA 2C60A 5LLIA 2QSDA 1ZOYB 2JRHA 4WQMA 3QIJA 4ZHPA 3P42A 4PS8A 1VZ8A 2MQJA 2ICIA 3MC9A 1JROA 3NRZA 1C78A 5EE3A 2BQQA 1E8WA 1LXDA 2BS4B 4KIKA 1OGWA 2DAFA 3RNGC 3HM3A 2W55A 1WXMA 3AULA 1JWBD 2LD9A 1E6EB 2N1VA 3UF8A 2KDMA 4A3PA 1XCQL 2KVZA 2LWPA 4JLCA 3ZRFA 2BF8B 1ZDVA 3BVZA 2JSVX 5E6JA 2LEKA 1XLPA 3KYCD 1WR6E 1KOTA 2B3AA 2CR5A 3Q8BA 2UYZB 3HIZA 5I4DA 3AI5A 2J0KA 2AQ1B 3SDLC 2N7JA 2C9WB 1WSPA 2JZ3B 2IO1B 4BKGA 1FD6A 4KGRA 1R7SA 3AEDB 2O2VA 3IHPC 4GGQA 2K0PA 4HK2A 4KSKC 1RLFA 5E6OA 3Q2AC 2DWQA 3KVFB 4EEWA 2W3SA 3CIRB 1NVID 4ZRPA 2WP9B 2GRIA 4J6IA 1NI3A 3Q14C 3OAWA 2QIEB 1YNTE 3HK0A 3DQVA 4HWIB 1P98A 3GE8C 1JRUA 3NS1A 4S0RA 4HLEA 1WZ0A 4C56C 1WIAA 4HDOA 2MP2A 3PGEA 1F52A 3RFZB 4HPPA 4YTPB 3OG5A 3X0WA 2KMAA 2LMCA 1FCCC 4ITKA 2IO0B 4HPLB 2BB5A 4M8NA 4GDLB 4NJCA 1GPXA 1V97A 2UWQA 1E90A 1F1HA 3KUCB 1NDDA 5LXIB 5CX3A 4ZYSA 2HJ8A 3PZ8A 2BWFA 2FAZA 3AE3B 2LGDA 4W9KA 3FILA 5TR5A 4K7WA 4GN1A 4DXGA 2M0XA 5BO4B 2RPVA 3ZJTA 3VR8B 4A8XC 1XXGA 2CHZA 1WR1A 5JHAA 4PS3A 3AE5B 1STEA 3N1ZC 2LHEA 2QMTA 1QOFA 1HE8A 1V8CA 1GAQB 1TBEA 2K3UA 4DDGD 1TIFA 3ZVVA 2GBRA 4FADA 2KTRA 2WHIA 4HPMB 3PT2B 3B08A 2LUMA 1WI0A 2ZVOA 3T8MA 1GUAB 2DYOA 3O13A 3PSEB 1HZ6A 3ZLZA 1QLBB 4M02A 3ZUNA 1C9FA 2WU5B 3WA0A 2B76B 1XLNA 4RGOS 3GZNI 1WM2A 3ML8A 3RMKC 3N32A 2LGSA 2M56B 3AU4A 1LQBA 4NAWB 1LFDA 2D07B 3BY4B 1TT5B 2LASA 5JH5C 4WQOB 4YTMB 1N6ZA 3VTUA 4RF1A 3A9KA 3GZNB 1TZ1A 3VH3B 1RRBA 1BXTA 3ZO5B 3ALBA 4DDID 4HVBA 3HVDA 4DK5A 2JU6X 1EF1A 1JW9D 4N6EB 4W9IA 3M63B 1FXAA 4B6WA 4XC2A 2E3TA 3VTVA 4W9DA 1D5MC 2ZZPB 4WWOA 3VDZA 3ETRA 5BYRA 1UGMA 4RM9A 3MJWA 3H7PA 2MP2B 1I4QA 4P7IA 3U7DA 5IN7A 4IWQA 3H9DA 4K1RB 4DWFA 2RD0A 3GOEA 4DHZE 2KANA 2N9EB 4W9FA 4P1BC 2MWSB 4GDKB 1E7UA 3ZNZB 2HDEA 4B0EA 1I7HA 4XGAB 4H2AA 2KACA 2NR2A 3RZWC 3X23A 2KTFA 3ENEA 1MJDA 4C80A 1FIQA 2J7QB 2L05A 2FNJB 2KVRA 1UH6A 1EU4A 2FUHB 4GDKA 3W1SC 2KT7A 3P2BA 1WYWB 2LGXA 2JYEA 1L4DB 2INNE 2GMIC 4W9HA 4O1NA 5BYQA 3AEEB 3V6EB 4WJQA 3ZTDA 3P4QB 4I6LB 3WAMA 3VRBB 4D2KA 2SEBD 3Q3MC 2TSSA 3ZDMC 3IT4B 1Z5SB 3OWEB 3TJPA 3U30A 1YN4A 1BMLC 3JSVA 3IBEA 3SD5A 2L7RA 3QAQA 2WQYB 2WX1A 3R66C 2LI5A 3NUHB 4W9JA 4LNIA 3APFA 3WCQA 4KZ0A 4HROA 4MACA 4FJVB 3L16A 3DBSA 2J52A 2C7HA 2N9XA 2PMVA 4IWPA 5C23A 5BYSA 4NJ6A 4MM3A 1WX9A 1FPYA 3A4RA 2MLBA 2DHZA 4DHJB 1SE4A 1WRDB 3PZ7A 3V3XA 2WXFA 2Y5BB 1EU3A 1Q5WB 2YEPF 2MW5A 2K6DB 1UWMA 4QAYA 3PRZA 3A9KB 2JXTA 1TKGA 1TY2A 4NPNA 4ASWC 4BKSA 2ZVNA 1E7PB 2MBOA 1SB3C 4IDIA 5DPTA 2IGGA 3DBRB 4AP4C 1QZEA 1FFUA 4W9LA 3LB8C 3AV8A 2JRIB 2FE8A 4KDLB 1FNWA 4KX6B 4RCOA 1BUIC 3W5UB 1L0VB 1H4RA 4GSWA 4LJPB 3GP7A 4W9EA 1N5XA 4NNJB 4FJYA 1KJTA 1F2RI 4MJSB 4YXDB 2MBQA 1DOIA 2BW2A 3R7RA 3AU5A 1L6UA 3DBLB 1WGKA 4KDIC 2G9HD 4TMAB 5AZGA 1KLUD 4HJGE 1OQYA 1WY8A 1KLVA 3UGBB 2JXXA 5E6PA 3PHXB 4AQ7A 2JZPA 4HDQA 2K25A 2LVOA 3GB1A 4MELA 2VH1A 2JX5A 4MSMB 2MJDA 3IT6B 1TS3A 4MT5A 3UQBA 3OLMD 4L23A 2AL6A 2CU1A 5CHVC 2IZVB 3ECIA 1NYRA 2IGHA 1I35A 1Z2MA 1GB1A 1IUEA 3I9V1 4LCDE 4TV3A 4EKUA 1GJZA 2PIAA 3NZ3A 3B2GA 3VTWA 3U2SC 1I4HA 2WX0A 1FO4A 4B0MA 1D3ZA 4AJWA 3MJ5A 2KXJA 1WJ4A 1V2YA 1QOBA 3FILB 1D5ZC 4JQWC 3DVGX 5L83A 1VCBA 1IGCA 3TEZA 1GNUA 2R2QA 3T9LA 2WDTB 4AJYB 1KTKA 3WAOA 2QC8A 3AEGB 3QQ8B 3M62B 1HEZE 2BTEA 3BK1A 4HRSA 4CYEA 2AYOB 1CZPA 3A33B 3B2FA 4KZCA 1WJ6A 2XBBC 2DAJA 2JWUA 4MGIE 3PS6A 3EECA 3J9CA 4GLSC 1UBIA 1NI2A 1L2NA 2I1JA 3RNFC 5DPSA 3R8BA 1VJKA 1J19A 2ZEQA 1EM7A 1K53A 2NVUI 2M4NA 1J0GA 4MSQB 3A1QA 4XZ4A 4FA6A 5C1ZA 1YX6B 5D2MB 1ET9A 3ZW3A 1F2RC 2NPTA 3B9JA 3AM9A 2GBMA 4FHJA 4RFBA 4KGTA 3TSSA 2K9XA 5EE1A 2KD0A 4C4VB 2JY6A 4FJZA
chains in the Genus database with same CATH topology
2LGYA 2CHZA 1WR1A 3N30A 4BBNF 3NHEB 5JHAA 1E8XA 4PS3A 2KQSA 2L8JA 4ANUA 1GG3A 3WIMA 3CSTA 2KMCA 3K9PB 2KC2A 5J18A 3ZKJC 2L76A 1HE8A 2C7NB 1V86A 4LJOB 2FCSA 1TBEA 3PZDA 2LRUA 2BGFA 4GOCA 2R2OA 3APDA 2BPSA 2GBRA 2ASQA 3JYUA 3ZVVA 2KTRA 4FADA 3R7QA 3L08A 2GOWA 2BKFA 2NBWB 4G0NB 4HPMB 4NY0A 3PT2B 4ZRIA 3QHTA 3B08A 1OEYA 3H7SA 1WI0A 1IP9A 1YX5B 2ZVOA 3D32A 3T8MA 1GUAB 2DYOA 4A20A 3PSEB 2BYVE 1EF5A 3IFWB 3ZLZA 2MRPA 4MGZE 3L17A 2O2VB 2C7MB 2MBHA 3TIXA 3WALA 3ZUNA 1SGHA 1WE6A 3K9OB 4GMVA 2GBJA 4HCNB 3TCAA 1V6EA 4EZJA 3APCA 3OJ4B 4ZYNA 3WA0A 3EC8A 4F7ZA 2NBVB 2N7EA 4FN2A 3GZNI 1WM2A 3ML9A 2I1KA 1EO6A 1T0YA 1WM3A 3ML8A 3N32A 3VVWB 3VH4B 2L00B 3U8ZA 5FR6A 1EUVB 3AU4A 1LQBA 4NAWB 1LFDA 2D07B 1YJ1A 5DPWA 3BY4B 3VQIA 4EUTA 2CHWA 2M1MA 2FIDA 3TL5A 2LASA 3LJ3A 4BOZB 4K81A 1RAXA 5JH5C 3EFUA 4WQOB 4WJNA 2ZPYA 4M0WB 2C5LC 2KDIA 3VTUA 3A9KA 2D10A 4ZRJA 1TZ1A 2KX0A 3VH3B 4HCPB 2KHWB 1WH3A 2JT4B 2OOBB 2KWVB 2DYMA 1FXTB 1NBFC 1S1QB 1YQBA 2D3GA 1RRBA 2YVCA 4ZRKA 4FHKA 2AEHA 3NY5A 3W1SA 1F9JA 3ZO5B 3ALBA 2KC1A 3I3TB 4W9CA 4DDID 3DVNU 3MTNB 3L54A 3M3JA 4HVBA 5CTRC 5CHWA 5KHOA 4DK5A 1E5WA 1EF1A 4GIVA 2NBUA 4URKA 3DPDA 2N1WA 3NZUA 4FLHA 3R3MA 3M63B 4W9IA 4B6WA 2LXAA 4XC2A 1WXSA 4K7SA 2MSED 2IO2B 3VTVA 1OEYJ 2Z0EB 4G3XB 4W9DA 3KUDB 4G11A 3VUYA 4RM8A 4EZKA 1GC6A 3ZNID 2ZZPB 2DZIA 1YD8U 1S3SG 2ZNVC 4WWOA 3VDZA 4WWPA 4NQKE 4ANWA 2RGFA 2GBNA 1UGMA 4RM9A 3MJWA 3H7PA 4EZLA 2MP2B 2IBIB 4KSLC 2LVQA 2N7DA 4P7IA 3U7DA 2KZRA 5D7GA 1LM8B 4IWQA 4II3B 3H9DA 1AARA 4K1RB 2EMSA 4K7UA 4DWFA 4BKTA 2RD0A 3DOWA 5G2NA 1PQSA 4M8MA 3L13A 3C0RB 1WFYA 3JSVB 4X57B 2FCNA 4ANVA 1WJNA 3GOEA 4DHZE 2KANA 3RZFA 2N9EB 3QARA 4KIKB 4I6NB 4W9FA 1UD7A 1XT9B 2KLGA 2ZCCA 3DBLI 2MWSB 4GDKB 1E7UA 4JL9A 3V6CB 3ZNZB 4DBGA 1ZGUB 2KWCA 1ZW7A 2K8CA 2KJ6A 3DBRI 2DENB 3ONSA 4GU2A 2NR2A 3B1LX 2PE6B 3RZWC 3X23A 2KTFA 3ENEA 2KTRB 5IAAC 2J7QB 2HE7A 2L05A 2JPHA 2KDBA 3EHVA 3NZSA 2FNJB 1MG8A 3UIPB 2KVRA 1UH6A 4GDKA 2FUHB 4GDLA 3W1SC 5E6NA 3P2BA 1WYWB 2D2QA 2LGXA 3KW5B 3LDZE 1UELA 3CMMB 3ZDTA 4CHKA 2PPHA 4KV2A 2GMIC 4W9HA 4WAAA 4F8CB 3ZNHB 3H1UA 1TGZB 4MJSA 3V6EB 4WJQA 2K1FA 4PYZA 3ZTDA 2WWZA 2DYBA 2NCNA 2KDFB 4I6LB 5CHFA 2KNBA 2W9NA 4W9GA 3WAMA 4AUQC 2N4FA 2KFKA 1BT0A 2EMTA 4IWOA 2DZKA 5IA7A 2KJHB 1IPGA 1VD2A 3ZDMC 2KOXA 1Z5SB 3A1QB 2NS5A 4IG7B 3VHTC 3AXCA 3TJPA 3U30A 1K8RB 3B0AA 4MDKE 2O6VD 3JSVA 1KM7A 2KX3A 3IBEA 3SD5A 2L7RA 3NOBA 3PVLA 3QAQA 2LRWA 3O65B 3HM6X 4WWNA 4N9F4 3VUXA 3R66C 2WX1A 3DBHI 4ANXA 1WGYA 2KO3A 1ISNA 2LI5A 4BVUC 3JVZX 2LVPA 1E8YA 3Q3JA 1WXVA 3QA8A 5JHBA 5AZHA 1V5TA 4W9JA 4BFRA 1WF9A 3APFA 4TQ0A 4KZ0A 4A3OA 4FJVB 3L16A 4ICUA 2DX5B 3DBSA 3ZTCA 2C7HA 2N9XA 2BWES 1WZ3A 4IWPA 2A4ZA 5C23A 4ZDVA 2FCQA 2BYEA 4NJ6A 1I42A 4MM3A 3BINA 1WJUA 4XX5A 1WX9A 3A4RA 2MLBA 2CKHB 2DHZA 2ZNVB 4IM3A 4AWJA 3ZRCA 4DHJB 4DXAB 4F1SA 3L0WB 2K8HA 1WRDB 4EFOA 2A5UA 1WGHA 1UBQA 2RR9A 2Y5BB 3KUZA 3M95A 4MGKE 3UIOB 4E74A 2KN5A 3KH0A 1WMHA 1WX8A 1Q5WB 4MEMA 1YIWA 4KVGB 2PEAA 2MW5A 3SU8X 4AOFA 2ZPNA 1V81A 3H7PB 2K6DB 2GBKA 3RYTA 3WAPA 1M94A 3A9JB 3PRZA 1TTNA 3QJZA 3ZIMA 5EDSA 3A9KB 1SIFA 1P0RA 2AL3A 2HD5B 4NPNA 4ASWC 2BKRB 2MBBB 4BKSA 2ZVNA 2MBOA 2KDEB 3V62A 5J17A 3DDCB 1ZKHA 2REXA 4DHZB 3PV1A 5DPTA 4IW0A 4DDGD 2Z59B 4NAWA 4HJKA 1E8ZA 2JF5A 4YL8A 1WE7A 4GB9A 3TMPB 3WANA 1QZEA 4W9LA 4AP4C 3W1YA 1WGGA 2JUOA 2JRIB 4GXBA 4KDLB 3V60A 2QHOA 4PYUA 2LXCA 2LUEA 2L3ZA 3QCAA 4OVVA 3H6NA 2VRRB 3NS8A 2K8BA 3RT3B 1H4RA 3HHMA 4LDTD 2MA9B 4GSWA 2CS4A 4LJPB 4IUMB 2K6QA 2RPQA 4W9EA 3RCZA 2G3QB 3TBLD 4E71A 2KK8A 4NNJB 3L10B 4FJYA 1KJTA 2EKEC 4RMAA 5GMVA 4MJSB 2MBQA 3R7RA 1A5RA 3SHQA 1WMHB 3AU5A 2J0JA 3QWZB 4JGHB 2DZMA 3RUIB 5JZEB 2IY0B 4EOYA 5HKHA 2WYQA 2O6VB 1P9DU 2XK5A 4LDTB 3Q3FA 4IM2A 4KDIC 3PHWB 5AZGA 4IC7B 2MBEA 3DCGA 3PRPB 2MCNB 3KYDD 2C60A 1OQYA 5LLIA 4BKSD 1WY8A 2G4DB 1KLVA 3UGBB 3S2AA 2JXXA 1C1YB 5E6PA 2JRHA 3A4SC 3PHXB 4HDQA 3QIJA 2K25A 2LVOA 5AEKB 4PS8A 2BYFA 4MELA 2KJRA 5D6JB 2MQJA 4FBJB 4MGYE 4MSMB 2YLMA 1V9JA 1E8WA 1LXDA 3RULA 1XQQA 3CF6E 3IG3A 4KIKA 2LZ6A 3UQBA 3OLMD 2L0FA 1OGWA 2DAFA 2G4SA 3UQAA 2AL6A 3HM3A 2CU1A 3JW0X 1H8CA 1WXMA 4TKNA 2JWZA 3AULA 5CHVC 2IZVB 3ECIA 1Y8RC 2M17A 3N3KB 3VAWA 5AZFA 2LD9A 2RSUA 3UINB 5L95C 5J2RA 2J0MA 1Z2MA 2N1VA 3UF8A 1I35A 4A3PA 1C3TA 1R4NI 2V1YA 1G6JA 3VUWA 1Q1OA 3PTFC 4OVUA 2LWPA 1P3QU 2KWUB 4B9KA 4JLCA 4B95A 3ZRFA 4LCDE 1U4AA 4TV3A 2BF8B 3QX1A 4EKUA 1GJZA 5DPRA 1WGDA 2LJ5A 4NQLB 2PE9A 2IYDB 3VTWA 2WX0A 5DCNA 3RD2A 3KYCD 2PJHA 1WR6E 2MX2A 4AJWA 1D3ZA 1KOTA 2B3AA 5D94A 1RFAA 3A9JA 2CR5A 4PS7A 4DHJD 2UYZB 3HIZA 1SE9A 3AI5A 2J0KA 2KXJA 4ICVA 1WJ4A 3SDLC 1V2YA 2C9WB 1IYFA 4NJ7A 2XEWA 2JZ3B 2IO1B 4E3CA 2D11A 4BKGA 2ZCBA 1E7VA 3PREA 4WJPA 4JQWC 4BOSC 4TQ1A 3DVGX 2O2VA 3IHPC 4GGQA 3IVFA 2IO3B 2IY1B 4HK2A 1RLFA 4KSKC 5E6OA 1R4MI 2JVCA 5KHQA 1CMXB 2KKCA 1GC7A 3VFKA 3KVFB 5L83A 1VCBA 4EEWA 2KQ7A 4FULA 4I6PA 1GNUA 2R2QA 2Z0DB 4J6IA 3T9LA 2O6VA 2XK5B 2WDTB 4AJYB 3OAWA 4CO7A 3HK0A 4TUUA 2DZJA 3DQVA 4HWIB 3WAOA 4G50A 3PLUA 1P98A 2K39A 1JRUA 2KFKB 3QQ8B 3M62B 4HLEA 1WZ0A 1WX7A 4CYEA 1WIAA 2AYOB 4HDOA 2MP2A 3A33B 3PGEA 3QK0A 3VXWA 4KZCA 1WJ6A 2M8SA 3PPAA 2KLCA 2XBBC 2DAJA 4MGIE 4HXDA 2V3SA 3PS6A 2KMAA 3X0WA 2KFJA 2OJRA 3QC8B 2IO0B 1UZXB 4HPLB 1OTRB 3EECA 1V49A 1UBIA 1V80A 3V61A 4M8NA 4GDLB 2AWTA 2N9PC 1NI2A 4IM0A 4II2B 2FCMA 5LXHA 2UWQA 1L2NA 1E90A 3KUCB 2I1JA 4BBNC 5DPSA 3DVGY 2L0TA 1NDDA 1J19A 2ZJDA 2JZZA 3OJ3A 3PLVA 2FIFA 1V5OA 2ZEQA 1WXAA 5G55A 2G45B 5LXIB 5CX3A 3MHSD 1L7YA 2NPTB 2HJ8A 2NVUI 3DVNV 2BWFA 1P1AA 2HTHA 4JIOU 2M4NA 4MH0E 2FAZA 4MSQB 4WJOA 1J0GA 3A1QA 1Q0WB 4XZ4A 4FA6A 5C1ZA 1YX6B 3PRMB 5D2MB 3ZW3A 2LGDA 4W9KA 1X1MA 2NPTA 3CSFA 5TR5A 1XD3B 2GBMA 4FHJA 4K7WA 1J8CA 4GN1A 2M0XA 1WGRA 3ZNGC 5BO4B 2KD0A 2V4LA 2JY6A 4FJZA 2CHXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LGY A;  2CHZ A;  1WR1 A;  3N30 A;  4BBN F;  3NHE B;  5JHA A;  1E8X A;  4PS3 A;  2KQS A;  2L8J A;  4ANU A;  1GG3 A;  3WIM A;  3CST A;  2KMC A;  3K9P B;  2KC2 A;  5J18 A;  3ZKJ C;  2L76 A;  1HE8 A;  2C7N B;  1V86 A;  4LJO B;  2FCS A;  1TBE A;  3PZD A;  2LRU A;  2BGF A;  4GOC A;  2R2O A;  3APD A;  2BPS A;  2GBR A;  2ASQ A;  3JYU A;  3ZVV A;  2KTR A;  4FAD A;  3R7Q A;  3L08 A;  2GOW A;  2BKF A;  2NBW B;  4G0N B;  4HPM B;  4NY0 A;  3PT2 B;  4ZRI A;  3QHT A;  3B08 A;  1OEY A;  3H7S A;  1WI0 A;  1IP9 A;  1YX5 B;  2ZVO A;  3D32 A;  3T8M A;  1GUA B;  2DYO A;  4A20 A;  3PSE B;  2BYV E;  1EF5 A;  3IFW B;  3ZLZ A;  2MRP A;  4MGZ E;  3L17 A;  2O2V B;  2C7M B;  2MBH A;  3TIX A;  3WAL A;  3ZUN A;  1SGH A;  1WE6 A;  3K9O B;  4GMV A;  2GBJ A;  4HCN B;  3TCA A;  1V6E A;  4EZJ A;  3APC A;  3OJ4 B;  4ZYN A;  3WA0 A;  3EC8 A;  4F7Z A;  2NBV B;  2N7E A;  4FN2 A;  3GZN I;  1WM2 A;  3ML9 A;  2I1K A;  1EO6 A;  1T0Y A;  1WM3 A;  3ML8 A;  3N32 A;  3VVW B;  3VH4 B;  2L00 B;  3U8Z A;  5FR6 A;  1EUV B;  3AU4 A;  1LQB A;  4NAW B;  1LFD A;  2D07 B;  1YJ1 A;  5DPW A;  3BY4 B;  3VQI A;  4EUT A;  2CHW A;  2M1M A;  2FID A;  3TL5 A;  2LAS A;  3LJ3 A;  4BOZ B;  4K81 A;  1RAX A;  5JH5 C;  3EFU A;  4WQO B;  4WJN A;  2ZPY A;  4M0W B;  2C5L C;  2KDI A;  3VTU A;  3A9K A;  2D10 A;  4ZRJ A;  1TZ1 A;  2KX0 A;  3VH3 B;  4HCP B;  2KHW B;  1WH3 A;  2JT4 B;  2OOB B;  2KWV B;  2DYM A;  1FXT B;  1NBF C;  1S1Q B;  1YQB A;  2D3G A;  1RRB A;  2YVC A;  4ZRK A;  4FHK A;  2AEH A;  3NY5 A;  3W1S A;  1F9J A;  3ZO5 B;  3ALB A;  2KC1 A;  3I3T B;  4W9C A;  4DDI D;  3DVN U;  3MTN B;  3L54 A;  3M3J A;  4HVB A;  5CTR C;  5CHW A;  5KHO A;  4DK5 A;  1E5W A;  1EF1 A;  4GIV A;  2NBU A;  4URK A;  3DPD A;  2N1W A;  3NZU A;  4FLH A;  3R3M A;  3M63 B;  4W9I A;  4B6W A;  2LXA A;  4XC2 A;  1WXS A;  4K7S A;  2MSE D;  2IO2 B;  3VTV A;  1OEY J;  2Z0E B;  4G3X B;  4W9D A;  3KUD B;  4G11 A;  3VUY A;  4RM8 A;  4EZK A;  1GC6 A;  3ZNI D;  2ZZP B;  2DZI A;  1YD8 U;  1S3S G;  2ZNV C;  4WWO A;  3VDZ A;  4WWP A;  4NQK E;  4ANW A;  2RGF A;  2GBN A;  1UGM A;  4RM9 A;  3MJW A;  3H7P A;  4EZL A;  2MP2 B;  2IBI B;  4KSL C;  2LVQ A;  2N7D A;  4P7I A;  3U7D A;  2KZR A;  5D7G A;  1LM8 B;  4IWQ A;  4II3 B;  3H9D A;  1AAR A;  4K1R B;  2EMS A;  4K7U A;  4DWF A;  4BKT A;  2RD0 A;  3DOW A;  5G2N A;  1PQS A;  4M8M A;  3L13 A;  3C0R B;  1WFY A;  3JSV B;  4X57 B;  2FCN A;  4ANV A;  1WJN A;  3GOE A;  4DHZ E;  2KAN A;  3RZF A;  2N9E B;  3QAR A;  4KIK B;  4I6N B;  4W9F A;  1UD7 A;  1XT9 B;  2KLG A;  2ZCC A;  3DBL I;  2MWS B;  4GDK B;  1E7U A;  4JL9 A;  3V6C B;  3ZNZ B;  4DBG A;  1ZGU B;  2KWC A;  1ZW7 A;  2K8C A;  2KJ6 A;  3DBR I;  2DEN B;  3ONS A;  4GU2 A;  2NR2 A;  3B1L X;  2PE6 B;  3RZW C;  3X23 A;  2KTF A;  3ENE A;  2KTR B;  5IAA C;  2J7Q B;  2HE7 A;  2L05 A;  2JPH A;  2KDB A;  3EHV A;  3NZS A;  2FNJ B;  1MG8 A;  3UIP B;  2KVR A;  1UH6 A;  4GDK A;  2FUH B;  4GDL A;  3W1S C;  5E6N A;  3P2B A;  1WYW B;  2D2Q A;  2LGX A;  3KW5 B;  3LDZ E;  1UEL A;  3CMM B;  3ZDT A;  4CHK A;  2PPH A;  4KV2 A;  2GMI C;  4W9H A;  4WAA A;  4F8C B;  3ZNH B;  3H1U A;  1TGZ B;  4MJS A;  3V6E B;  4WJQ A;  2K1F A;  4PYZ A;  3ZTD A;  2WWZ A;  2DYB A;  2NCN A;  2KDF B;  4I6L B;  5CHF A;  2KNB A;  2W9N A;  4W9G A;  3WAM A;  4AUQ C;  2N4F A;  2KFK A;  1BT0 A;  2EMT A;  4IWO A;  2DZK A;  5IA7 A;  2KJH B;  1IPG A;  1VD2 A;  3ZDM C;  2KOX A;  1Z5S B;  3A1Q B;  2NS5 A;  4IG7 B;  3VHT C;  3AXC A;  3TJP A;  3U30 A;  1K8R B;  3B0A A;  4MDK E;  2O6V D;  3JSV A;  1KM7 A;  2KX3 A;  3IBE A;  3SD5 A;  2L7R A;  3NOB A;  3PVL A;  3QAQ A;  2LRW A;  3O65 B;  3HM6 X;  4WWN A;  4N9F 4;  3VUX A;  3R66 C;  2WX1 A;  3DBH I;  4ANX A;  1WGY A;  2KO3 A;  1ISN A;  2LI5 A;  4BVU C;  3JVZ X;  2LVP A;  1E8Y A;  3Q3J A;  1WXV A;  3QA8 A;  5JHB A;  5AZH A;  1V5T A;  4W9J A;  4BFR A;  1WF9 A;  3APF A;  4TQ0 A;  4KZ0 A;  4A3O A;  4FJV B;  3L16 A;  4ICU A;  2DX5 B;  3DBS A;  3ZTC A;  2C7H A;  2N9X A;  2BWE S;  1WZ3 A;  4IWP A;  2A4Z A;  5C23 A;  4ZDV A;  2FCQ A;  2BYE A;  4NJ6 A;  1I42 A;  4MM3 A;  3BIN A;  1WJU A;  4XX5 A;  1WX9 A;  3A4R A;  2MLB A;  2CKH B;  2DHZ A;  2ZNV B;  4IM3 A;  4AWJ A;  3ZRC A;  4DHJ B;  4DXA B;  4F1S A;  3L0W B;  2K8H A;  1WRD B;  4EFO A;  2A5U A;  1WGH A;  1UBQ A;  2RR9 A;  2Y5B B;  3KUZ A;  3M95 A;  4MGK E;  3UIO B;  4E74 A;  2KN5 A;  3KH0 A;  1WMH A;  1WX8 A;  1Q5W B;  4MEM A;  1YIW A;  4KVG B;  2PEA A;  2MW5 A;  3SU8 X;  4AOF A;  2ZPN A;  1V81 A;  3H7P B;  2K6D B;  2GBK A;  3RYT A;  3WAP A;  1M94 A;  3A9J B;  3PRZ A;  1TTN A;  3QJZ A;  3ZIM A;  5EDS A;  3A9K B;  1SIF A;  1P0R A;  2AL3 A;  2HD5 B;  4NPN A;  4ASW C;  2BKR B;  2MBB B;  4BKS A;  2ZVN A;  2MBO A;  2KDE B;  3V62 A;  5J17 A;  3DDC B;  1ZKH A;  2REX A;  4DHZ B;  3PV1 A;  5DPT A;  4IW0 A;  4DDG D;  2Z59 B;  4NAW A;  4HJK A;  1E8Z A;  2JF5 A;  4YL8 A;  1WE7 A;  4GB9 A;  3TMP B;  3WAN A;  1QZE A;  4W9L A;  4AP4 C;  3W1Y A;  1WGG A;  2JUO A;  2JRI B;  4GXB A;  4KDL B;  3V60 A;  2QHO A;  4PYU A;  2LXC A;  2LUE A;  2L3Z A;  3QCA A;  4OVV A;  3H6N A;  2VRR B;  3NS8 A;  2K8B A;  3RT3 B;  1H4R A;  3HHM A;  4LDT D;  2MA9 B;  4GSW A;  2CS4 A;  4LJP B;  4IUM B;  2K6Q A;  2RPQ A;  4W9E A;  3RCZ A;  2G3Q B;  3TBL D;  4E71 A;  2KK8 A;  4NNJ B;  3L10 B;  4FJY A;  1KJT A;  2EKE C;  4RMA A;  5GMV A;  4MJS B;  2MBQ A;  3R7R A;  1A5R A;  3SHQ A;  1WMH B;  3AU5 A;  2J0J A;  3QWZ B;  4JGH B;  2DZM A;  3RUI B;  5JZE B;  2IY0 B;  4EOY A;  5HKH A;  2WYQ A;  2O6V B;  1P9D U;  2XK5 A;  4LDT B;  3Q3F A;  4IM2 A;  4KDI C;  3PHW B;  5AZG A;  4IC7 B;  2MBE A;  3DCG A;  3PRP B;  2MCN B;  3KYD D;  2C60 A;  1OQY A;  5LLI A;  4BKS D;  1WY8 A;  2G4D B;  1KLV A;  3UGB B;  3S2A A;  2JXX A;  1C1Y B;  5E6P A;  2JRH A;  3A4S C;  3PHX B;  4HDQ A;  3QIJ A;  2K25 A;  2LVO A;  5AEK B;  4PS8 A;  2BYF A;  4MEL A;  2KJR A;  5D6J B;  2MQJ A;  4FBJ B;  4MGY E;  4MSM B;  2YLM A;  1V9J A;  1E8W A;  1LXD A;  3RUL A;  1XQQ A;  3CF6 E;  3IG3 A;  4KIK A;  2LZ6 A;  3UQB A;  3OLM D;  2L0F A;  1OGW A;  2DAF A;  2G4S A;  3UQA A;  2AL6 A;  3HM3 A;  2CU1 A;  3JW0 X;  1H8C A;  1WXM A;  4TKN A;  2JWZ A;  3AUL A;  5CHV C;  2IZV B;  3ECI A;  1Y8R C;  2M17 A;  3N3K B;  3VAW A;  5AZF A;  2LD9 A;  2RSU A;  3UIN B;  5L95 C;  5J2R A;  2J0M A;  1Z2M A;  2N1V A;  3UF8 A;  1I35 A;  4A3P A;  1C3T A;  1R4N I;  2V1Y A;  1G6J A;  3VUW A;  1Q1O A;  3PTF C;  4OVU A;  2LWP A;  1P3Q U;  2KWU B;  4B9K A;  4JLC A;  4B95 A;  3ZRF A;  4LCD E;  1U4A A;  4TV3 A;  2BF8 B;  3QX1 A;  4EKU A;  1GJZ A;  5DPR A;  1WGD A;  2LJ5 A;  4NQL B;  2PE9 A;  2IYD B;  3VTW A;  2WX0 A;  5DCN A;  3RD2 A;  3KYC D;  2PJH A;  1WR6 E;  2MX2 A;  4AJW A;  1D3Z A;  1KOT A;  2B3A A;  5D94 A;  1RFA A;  3A9J A;  2CR5 A;  4PS7 A;  4DHJ D;  2UYZ B;  3HIZ A;  1SE9 A;  3AI5 A;  2J0K A;  2KXJ A;  4ICV A;  1WJ4 A;  3SDL C;  1V2Y A;  2C9W B;  1IYF A;  4NJ7 A;  2XEW A;  2JZ3 B;  2IO1 B;  4E3C A;  2D11 A;  4BKG A;  2ZCB A;  1E7V A;  3PRE A;  4WJP A;  4JQW C;  4BOS C;  4TQ1 A;  3DVG X;  2O2V A;  3IHP C;  4GGQ A;  3IVF A;  2IO3 B;  2IY1 B;  4HK2 A;  1RLF A;  4KSK C;  5E6O A;  1R4M I;  2JVC A;  5KHQ A;  1CMX B;  2KKC A;  1GC7 A;  3VFK A;  3KVF B;  5L83 A;  1VCB A;  4EEW A;  2KQ7 A;  4FUL A;  4I6P A;  1GNU A;  2R2Q A;  2Z0D B;  4J6I A;  3T9L A;  2O6V A;  2XK5 B;  2WDT B;  4AJY B;  3OAW A;  4CO7 A;  3HK0 A;  4TUU A;  2DZJ A;  3DQV A;  4HWI B;  3WAO A;  4G50 A;  3PLU A;  1P98 A;  2K39 A;  1JRU A;  2KFK B;  3QQ8 B;  3M62 B;  4HLE A;  1WZ0 A;  1WX7 A;  4CYE A;  1WIA A;  2AYO B;  4HDO A;  2MP2 A;  3A33 B;  3PGE A;  3QK0 A;  3VXW A;  4KZC A;  1WJ6 A;  2M8S A;  3PPA A;  2KLC A;  2XBB C;  2DAJ A;  4MGI E;  4HXD A;  2V3S A;  3PS6 A;  2KMA A;  3X0W A;  2KFJ A;  2OJR A;  3QC8 B;  2IO0 B;  1UZX B;  4HPL B;  1OTR B;  3EEC A;  1V49 A;  1UBI A;  1V80 A;  3V61 A;  4M8N A;  4GDL B;  2AWT A;  2N9P C;  1NI2 A;  4IM0 A;  4II2 B;  2FCM A;  5LXH A;  2UWQ A;  1L2N A;  1E90 A;  3KUC B;  2I1J A;  4BBN C;  5DPS A;  3DVG Y;  2L0T A;  1NDD A;  1J19 A;  2ZJD A;  2JZZ A;  3OJ3 A;  3PLV A;  2FIF A;  1V5O A;  2ZEQ A;  1WXA A;  5G55 A;  2G45 B;  5LXI B;  5CX3 A;  3MHS D;  1L7Y A;  2NPT B;  2HJ8 A;  2NVU I;  3DVN V;  2BWF A;  1P1A A;  2HTH A;  4JIO U;  2M4N A;  4MH0 E;  2FAZ A;  4MSQ B;  4WJO A;  1J0G A;  3A1Q A;  1Q0W B;  4XZ4 A;  4FA6 A;  5C1Z A;  1YX6 B;  3PRM B;  5D2M B;  3ZW3 A;  2LGD A;  4W9K A;  1X1M A;  2NPT A;  3CSF A;  5TR5 A;  1XD3 B;  2GBM A;  4FHJ A;  4K7W A;  1J8C A;  4GN1 A;  2M0X A;  1WGR A;  3ZNG C;  5BO4 B;  2KD0 A;  2V4L A;  2JY6 A;  4FJZ A;  2CHX A; 
#chains in the Genus database with same CATH topology
 2LGY A;  1JCK B;  3AEF B;  4RF0 A;  2L8J A;  4ANU A;  1TJE A;  3WIM A;  2EKI A;  2KC2 A;  3ZKJ C;  1QT9 A;  4P16 A;  4LJO B;  4WIP A;  2FCS A;  2LRU A;  2BGF A;  3APD A;  3NVW A;  2KWD A;  2QDF A;  3R7Q A;  2LGI A;  3L08 A;  1UUP A;  1PDX A;  4ZRI A;  4YTN B;  3RNA C;  1VRA B;  3H7S A;  2GB1 A;  1IP9 A;  4A20 A;  1SEB D;  3L17 A;  2O2V B;  1K52 A;  2K22 A;  3TCA A;  4EZJ A;  3APC A;  4N59 A;  1FNU A;  3OJ4 B;  3RNE C;  4ZYN A;  5EE0 A;  4FN2 A;  2N7E A;  2ZW1 A;  3P1M A;  1DYQ A;  3VH4 B;  1NEN B;  5FR6 A;  2X8X X;  2V3P A;  2ACZ B;  2FID A;  2D3C A;  1UWX A;  3EGR A;  4K81 A;  3W5V B;  2MH7 A;  1IBX B;  2KDI A;  4ZRJ A;  2JT4 B;  2Y5P A;  1K51 A;  2DYM A;  1S1Q B;  5H92 C;  1YQB A;  2Y3A A;  4FHK A;  3ZGZ A;  3NY5 A;  4HKZ E;  3W1S A;  3I3T B;  3T3N A;  3MTN B;  3L54 A;  3BWU D;  5KHO A;  4A55 A;  4GIV A;  1EWC A;  1T5X D;  4M01 A;  3NZU A;  2GI9 A;  4FLH A;  2LXA A;  1TYG B;  2Z0E B;  3KUD B;  2KAJ A;  4EZK A;  2DZI A;  1YD8 U;  4ANW A;  4EZL A;  4A6Q A;  2IBI B;  3TEY A;  2LVQ A;  2KZR A;  5D7G A;  5G5H A;  1FCL A;  1AAR A;  3DOW A;  3BYY B;  1WFY A;  3JSV B;  4X57 B;  3MP9 A;  4RGM A;  4KIK B;  3KLS X;  3DBL I;  3V6C B;  1ZP0 B;  1TZO A;  2LHD A;  5IOI A;  3SFE B;  5IO9 A;  2KTR B;  2HE7 A;  1ZE3 D;  2JPH A;  1T0Q C;  3EHV A;  3EUB 2;  3NZS A;  1P7F A;  1EWY C;  5E6N A;  2D2Q A;  1MHX A;  3CMM B;  1C4A A;  4WAA A;  3ZNH B;  1TGZ B;  3GE3 C;  3P4P B;  2WWZ A;  1MG4 A;  2KDF B;  5CHF A;  2KNB A;  4W9G A;  2D5G A;  3BVG A;  4YWG G;  4IWO A;  5IA7 A;  2DZK A;  3BVM A;  3RNB C;  2NS5 A;  4KKI A;  4IG7 B;  3VHT C;  3AXC A;  4BZA A;  3AB5 A;  1K8R B;  1KM7 A;  1DGJ A;  3E56 A;  3NVZ A;  3PVL A;  2LRW A;  3HM6 X;  4YSX B;  5IP4 D;  3VUX A;  1WGY A;  4BVU C;  1ISN A;  2LVP A;  5JHB A;  1NEK B;  2IND C;  5AZH A;  5HI1 A;  2WXM A;  4BFR A;  1XLQ A;  2J4X A;  2KQ4 X;  1VZ6 A;  4ARI A;  4ICU A;  1QOG A;  2BWE S;  3C19 A;  4ZDV A;  2FCQ A;  3AE4 B;  1I42 A;  3BIN A;  1CJE A;  2ZNV B;  4IM3 A;  4EFO A;  3DWG C;  1UBQ A;  3M95 A;  4REZ A;  2YEP B;  1YIW A;  3NVY A;  4AOF A;  4NZL B;  5C2T B;  3RYT A;  1M94 A;  1PUT A;  3A9J B;  3QJZ A;  1SIF A;  1P0R A;  2AL3 A;  1ZDX A;  1JWM D;  2XNA C;  2KDE B;  3DDC B;  3PV1 A;  4IW0 A;  2Z59 B;  2Y5C A;  4HJK A;  1E8Z A;  3AN1 A;  1CQV A;  4GB9 A;  2D3B A;  3FC4 A;  1JRP A;  2Q5W D;  1WGG A;  2JUO A;  2R61 A;  4M0W A;  2LXC A;  3H6N A;  2VRR B;  2INC C;  3HHM A;  2MA9 B;  3AEC B;  2BVC A;  4DXF A;  3N9Y C;  4E71 A;  2KK8 A;  3L10 B;  1KH0 A;  3URY A;  5GMV A;  3SHQ A;  3QWZ B;  4JGH B;  4C7Y A;  2DZM A;  3FKY A;  4EOY A;  1P9D U;  1QQR A;  3Q3F A;  4YT0 B;  1VDV A;  1I4P A;  2MBE A;  1YQ3 B;  5BMI A;  1C79 A;  2MCN B;  3KYD D;  4BKS D;  3HVZ A;  2G4D B;  1C1Y B;  3A4S C;  3AMZ A;  5AEK B;  2BYF A;  3PO0 A;  4FBJ B;  5FK9 C;  1FFV A;  1V9J A;  3I5J C;  3RUL A;  2N9L A;  1XQQ A;  2WXP A;  3IG3 A;  2LZ6 A;  1XF5 L;  4LLG M;  1H8C A;  1UGJ A;  4XDD A;  2M17 A;  2HTM E;  5AZF A;  2RSU A;  4JWU C;  2HJ1 A;  2J0M A;  1C3T A;  5EE9 A;  2WXJ A;  2D3A A;  1G6J A;  3VUW A;  4OVU A;  1P3Q U;  4B9K A;  4B95 A;  1U4A A;  3QX1 A;  4KGS A;  2WLB A;  1T0S C;  2IDY A;  4ARC A;  5DPR A;  2LJ5 A;  2IYD B;  5DCN A;  3RD2 A;  2IGD A;  2MX2 A;  2WXK A;  5D94 A;  1RFA A;  2W54 A;  4PS7 A;  1SE9 A;  1YN5 A;  4ICV A;  4J3O D;  1E0Z A;  1SF0 A;  1D4B A;  4E3C A;  2XEW A;  1I4X A;  2D11 A;  1E7V A;  1RWS A;  2RDH A;  4TQ1 A;  3KQ4 A;  4JE3 B;  1B1Z A;  1R4M I;  2JVC A;  5KHQ A;  3VFK A;  1GC7 A;  2BT6 A;  2KQ7 A;  2Z0D B;  4C7Z A;  2O6V A;  3N1X C;  4CO7 A;  4TUU A;  2DZJ A;  4G50 A;  1AW7 A;  2K39 A;  2KFK B;  2E6X A;  1WX7 A;  2WXN A;  1HTQ A;  3PPA A;  2KLC A;  1YOV B;  5MPO A;  2VZK B;  4HXD A;  1R4N B;  2KFJ A;  3QC8 B;  1UZX B;  1OTR B;  3MC0 B;  1V49 A;  1V80 A;  3V61 A;  2AWT A;  2N9P C;  3VR9 B;  1ZXH A;  2W82 A;  4II2 B;  2N0S B;  5LXH A;  4XWT A;  4BBN C;  3DVG Y;  2L0T A;  1XEE A;  2ZJD A;  3DWM A;  3N20 C;  3PLV A;  2FIF A;  1N62 A;  3SFD B;  1WXA A;  3UI3 A;  2G45 B;  2MEK A;  2WXO A;  3U52 E;  1L5P A;  3DVN V;  1L0X B;  1P1A A;  1OQQ A;  2WXI A;  4WJO A;  1Q0W B;  3PRM B;  1FMA D;  3V05 A;  1J8C A;  1I4R A;  1KLG D;  1WGR A;  2LJI A;  2RMM A;  2GLS A;  3N30 A;  4BBN F;  2XN9 C;  1N5W A;  2KQS A;  3CST A;  2KMC A;  4WUR A;  1DOY A;  2M19 A;  2L76 A;  2WU2 B;  3AEA B;  4CQN A;  4LNK A;  5AUI A;  3PZD A;  4GOC A;  2R2O A;  2BPS A;  3JYU A;  3DHI C;  2GOW A;  2BKF A;  2NBW B;  4G0N B;  4NY0 A;  3L4P A;  1OEY A;  2VH2 A;  4YSY B;  1YX5 B;  3Q3O C;  4YSZ B;  5BMH A;  2FUG 1;  2BYV E;  2MRP A;  4MGZ E;  2C7M B;  2MBH A;  4IKG A;  1WE6 A;  3FAH A;  3K9O B;  3R2T A;  2GBJ A;  4GMV A;  4HCN B;  1V6E A;  1JWS D;  2G1E A;  4F7Z A;  4XWW A;  4C4V A;  4OZA A;  1KFY B;  2JYT A;  2I1K A;  1WM3 A;  1T0Y A;  4HKQ A;  3U8Z A;  1ENF A;  5DPW A;  3ZYY X;  3VQI A;  2M1M A;  3LJ3 A;  1RAX A;  3EFU A;  1YJJ A;  2RDB C;  2ZPY A;  4FXC A;  2WDV B;  4OHJ A;  2D10 A;  2KX0 A;  4HCP B;  1WH3 A;  2OOB B;  1J7A A;  1FXT B;  1SE2 A;  1NBF C;  1CK1 A;  2D3G A;  4ZRK A;  2YVC A;  1GOZ A;  2AEH A;  1K50 A;  2KC1 A;  3SEB A;  5CHW A;  1E5W A;  1L0Y B;  1OFF A;  1WRI A;  2NBU A;  4URK A;  3ZJV A;  2N1W A;  2KMM A;  3R3M A;  1XLO A;  2I2Y A;  1WXS A;  2J53 A;  4K7S A;  2MSE D;  2IO2 B;  1OEY J;  2JQR B;  3MFG A;  2NTS A;  3VUY A;  1GC6 A;  4RNA A;  2BS2 B;  2RGF A;  3SR6 A;  1N63 A;  2WXQ A;  2N7D A;  4WWM A;  1PGB A;  2BS3 B;  1LM8 B;  4JPS A;  1TKE A;  4II3 B;  2KN4 A;  2EMS A;  3BK2 A;  4BKT A;  4M8M A;  3L13 A;  3C0R B;  2FCN A;  4ANV A;  1WJN A;  1SE3 A;  2PVG C;  3RZF A;  3ABV B;  3QAR A;  4I6N B;  1XT9 B;  2DLB A;  2SAK A;  4DBG A;  1ZW7 A;  1HA5 A;  2KJ6 A;  2QIL A;  2WDR B;  3DBR I;  3ONS A;  4GU2 A;  3R2I A;  3B1L X;  4LTU A;  2PE6 B;  3AE6 B;  3ZQ4 A;  3NVV A;  2KDB A;  1XO3 A;  2X38 A;  3UIP B;  2NTT A;  4GDL A;  2ONQ A;  3TEW A;  3KW5 B;  1UEL A;  4CHK A;  2PPH A;  1AN8 A;  3AE1 B;  1T6B X;  4KV2 A;  4M00 A;  4OW0 A;  3H1U A;  4A9A A;  4MJS A;  2K1F A;  4PYZ A;  1AWD A;  3ZXR A;  5L95 C;  2W9N A;  4LK0 M;  2N4F A;  1BT0 A;  4R3D A;  1RM6 C;  3LYY A;  1IPG A;  1MFW A;  2KOX A;  1RFK A;  4L2Y A;  3E9S A;  3B0A A;  2O6V D;  5FKA C;  4XDC A;  3NOB A;  2V3N A;  4WWN A;  4N9F 4;  3VRA B;  3DBH I;  4ANX A;  2KO3 A;  3JVZ X;  1E8Y A;  3QA8 A;  1WXV A;  1V5T A;  3Q8E A;  1C4P A;  1HTO A;  3BZD B;  4TQ0 A;  2OJW A;  1DOX A;  4A3O A;  2Z8L A;  3Q8C A;  2A4Z A;  2IPK D;  4AS1 A;  3AEB B;  1V1O A;  5HG2 A;  4ZOH C;  4F1S A;  4DXA B;  2K8H A;  1WGH A;  2RR9 A;  4MGK E;  2MHJ A;  2KN5 A;  1WX8 A;  2AQ3 B;  1SJE D;  4KVG B;  4LNO A;  2ZPN A;  3H7P B;  2GBK A;  2QJL A;  3DBH B;  1KRH A;  3WAP A;  4IOI E;  3KWV A;  3EFC A;  2HD5 B;  2PKO A;  2BKR B;  1QF6 A;  3AH7 A;  5J17 A;  1Y56 A;  2DBY A;  2EEL A;  2V4I B;  4NAW A;  3W9C B;  3MC8 A;  1JAL A;  4US8 A;  2OED A;  3TUO A;  1WE7 A;  3WAN A;  3TMP B;  3BYT B;  3W2D A;  4OZC A;  1MHH E;  3NG0 A;  3RT3 B;  3Q6B A;  3AE9 B;  4LDT D;  1AYF A;  4XE0 A;  2LFI A;  4IUM B;  2K6Q A;  2WDQ B;  2G3Q B;  3IAM 1;  2H89 B;  4RGN A;  1A5R A;  1WMH B;  5JZE B;  5HKH A;  1FRR A;  1P7E A;  4USA A;  2O6V B;  3Q3N C;  3PHW B;  3MHZ A;  3PRP B;  5T8I A;  1D5X C;  3KWL A;  3LXF A;  3S2A A;  2MJE A;  1ZUD 2;  2DNF A;  4JWS C;  2KJR A;  5D6J B;  2PLP A;  4P6V F;  4RH6 A;  4MGY E;  2YLM A;  1PGX A;  3CF6 E;  2ZW0 A;  1HXY D;  2L0F A;  2G4S A;  3UQA A;  3AE7 B;  2AQ2 B;  3JW0 X;  2WNM A;  4WH4 A;  4TKN A;  3Q69 A;  2JWZ A;  1Y8R C;  3N3K B;  2UU7 A;  4OVZ A;  3VAW A;  3GS2 A;  2OHF A;  3UIN B;  5J2R A;  4LNF A;  1TS4 A;  1R4N I;  2V1Y A;  1Q1O A;  3PTF C;  1V1P A;  2KWU B;  1OQR A;  1WGD A;  1HQR D;  4NQL B;  2PE9 A;  3U4E G;  2PJH A;  2BB6 A;  3A9J A;  1ROE A;  4DHJ D;  4HEA 1;  1L6V A;  1IYF A;  2W3R A;  4NJ7 A;  3ZXV A;  2ZCB A;  3PRE A;  1ACC A;  1TS5 A;  4WJP A;  4BOS C;  1M4V A;  4TSS A;  2CJO A;  3IVF A;  2IO3 B;  2IY1 B;  1HZ5 A;  1CMX B;  2KKC A;  1GB4 A;  4FUL A;  4I6P A;  1YMH E;  2XK5 B;  4RGT A;  1KF6 B;  3PLU A;  4S17 A;  4PT5 A;  1V1P B;  4WAF A;  2L1A A;  4LNN A;  1MPE A;  3Q8A A;  3QK0 A;  1LGR A;  3VXW A;  1SSN A;  2M8S A;  5LNK 1;  4Q2J A;  1FRD A;  1QIL A;  2L52 A;  2K5P A;  2V3S A;  2OJR A;  1IGD A;  1ZPS A;  1UNS A;  1LO5 D;  5IKC M;  4IM0 A;  2FCM A;  5FR3 A;  3BII D;  1JML A;  3P63 A;  2JZZ A;  3OJ3 A;  4XYC A;  1V5O A;  1A70 A;  4L1B A;  5G55 A;  2RDG A;  1L7Y A;  3MHS D;  2NPT B;  2HTH A;  4JIO U;  4MH0 E;  3RN9 C;  1X1M A;  3AE8 B;  3CSF A;  1XD3 B;  2WXG A;  1PYW D;  1SJH D;  2L32 A;  5H8Y E;  3ZNG C;  1N60 A;  2V4L A;  1C77 A;  2CHX A;  1C76 A;  3RI7 C;  3I63 C;  3NHE B;  1E10 A;  1E8X A;  2PVO D;  1GG3 A;  1Q10 A;  3K9P B;  5J18 A;  1FXI A;  5GXG B;  2C7N B;  1V86 A;  3NJT A;  2ASQ A;  2ON8 A;  1SIJ A;  5TSS A;  3P4R B;  5D3D A;  3QHT A;  3D32 A;  3I57 A;  2V9H A;  1EF5 A;  3IFW B;  2WXH A;  3TIX A;  3WAL A;  1SGH A;  3C8Y A;  3EC8 A;  1YQ4 B;  1JQ4 A;  2NBV B;  4BAX A;  3ML9 A;  3T3O A;  1EO6 A;  4KKJ A;  3VVW B;  2L00 B;  1EUV B;  1YN3 A;  3N1Y C;  2WGS A;  1YJ1 A;  1UF0 A;  4EUT A;  2CHW A;  1TKY A;  3TL5 A;  3DHG C;  4BOZ B;  3IXS A;  5G5G A;  4WJN A;  4M0W B;  2C5L C;  2QCZ A;  1RYJ A;  2KHW B;  2FBW B;  4PK1 A;  2KWV B;  4US9 A;  2PTL A;  1F0Z A;  1F9J A;  4ACF A;  5HHD G;  4W9C A;  3AE2 B;  3DVN U;  2CU3 A;  3M3J A;  5CTR C;  1VLB A;  1SXT A;  1I4G A;  3DPD A;  1WYG A;  4NAM A;  2J42 A;  3EA6 A;  4G3X B;  2BBC A;  4G11 A;  1FEH A;  1T0R C;  1XCT L;  4RM8 A;  3RPF C;  3ZNI D;  2ZNV C;  1S3S G;  2INP E;  1J7B A;  4WWP A;  4NQK E;  2GBN A;  4KSL C;  1JWA D;  2H88 B;  1ZXI A;  1SBB B;  1L4Z B;  4K7U A;  5G2N A;  1PQS A;  1NYQ A;  1J7C A;  4A90 A;  2N9K A;  1UD7 A;  2QEJ C;  1PFD A;  2KLG A;  2ZCC A;  4JL9 A;  1ZGU B;  1TS2 A;  2KWC A;  2K8C A;  2VZK D;  2DEN B;  3CWI A;  4ZRQ A;  3RNC C;  2V0G A;  1VZ7 A;  4UDU C;  5IAA C;  2AX5 A;  2KYW A;  1D6E C;  1MG8 A;  1C4C A;  1YJI A;  3HRD D;  3LDZ E;  3ZDT A;  1WWT A;  4F8C B;  1B9R A;  1FNV A;  2DYB A;  2NCN A;  4AUQ C;  4EE2 A;  2KFK A;  2EMT A;  2KJH B;  4P1C C;  4N58 A;  1VD2 A;  3HUI A;  3A1Q B;  4MDK E;  2KX3 A;  3ZJU A;  3O65 B;  3Q3J A;  1TY0 A;  1WF9 A;  4JX1 C;  2DX5 B;  3ZTC A;  5JXV A;  1WZ3 A;  1PGA A;  2L83 A;  2PW9 A;  2BYE A;  2I38 A;  3TEX A;  1R4M B;  1WJU A;  4XX5 A;  2CKH B;  4AWJ A;  3ZRC A;  1N61 A;  3L0W B;  2A5U A;  3KUZ A;  2WS3 B;  3UIO B;  2NMQ A;  4E74 A;  3KH0 A;  1WMH A;  4C00 A;  4MEM A;  4OZB A;  2PEA A;  3SU8 X;  5HFY A;  1V81 A;  2IJ0 A;  1JWU D;  3ZIM A;  1TTN A;  1ESF A;  2BYT A;  4ZHO A;  5EDS A;  2MBB B;  3P4S B;  3V62 A;  1ZKH A;  2REX A;  4DHZ B;  2CJN A;  2WXL A;  1QKZ A;  2JF5 A;  5AUK A;  4YL8 A;  3U7Z A;  2M0A A;  3W1Y A;  4DQO C;  4GXB A;  5D3I B;  5C3J B;  3V60 A;  5BMG A;  1E9M A;  2QHO A;  4PYU A;  2MJ3 A;  2LUE A;  2L3Z A;  3QCA A;  1T3Q A;  4OVV A;  3NS8 A;  2K8B A;  3IAS 1;  2CS4 A;  4K3C A;  4MH8 A;  2WXR A;  1FM0 D;  2RPQ A;  1VR9 A;  3RCZ A;  3TBL D;  4RMA A;  2EKE C;  3DHH C;  3H8H A;  1MVK A;  2J0J A;  3RUI B;  3Q8F A;  2IY0 B;  1IBX A;  2WYQ A;  2XK5 A;  1F77 A;  4LDT B;  1MI0 A;  4MM3 B;  4IM2 A;  1ET6 A;  1QOA A;  4IC7 B;  3DCG A;  1WXQ A;  4K3B A;  2C60 A;  5LLI A;  2QSD A;  1ZOY B;  2JRH A;  4WQM A;  3QIJ A;  4ZHP A;  3P42 A;  4PS8 A;  1VZ8 A;  2MQJ A;  2ICI A;  3MC9 A;  1JRO A;  3NRZ A;  1C78 A;  5EE3 A;  2BQQ A;  1E8W A;  1LXD A;  2BS4 B;  4KIK A;  1OGW A;  2DAF A;  3RNG C;  3HM3 A;  2W55 A;  1WXM A;  3AUL A;  1JWB D;  2LD9 A;  1E6E B;  2N1V A;  3UF8 A;  2KDM A;  4A3P A;  1XCQ L;  2KVZ A;  2LWP A;  4JLC A;  3ZRF A;  2BF8 B;  1ZDV A;  3BVZ A;  2JSV X;  5E6J A;  2LEK A;  1XLP A;  3KYC D;  1WR6 E;  1KOT A;  2B3A A;  2CR5 A;  3Q8B A;  2UYZ B;  3HIZ A;  5I4D A;  3AI5 A;  2J0K A;  2AQ1 B;  3SDL C;  2N7J A;  2C9W B;  1WSP A;  2JZ3 B;  2IO1 B;  4BKG A;  1FD6 A;  4KGR A;  1R7S A;  3AED B;  2O2V A;  3IHP C;  4GGQ A;  2K0P A;  4HK2 A;  4KSK C;  1RLF A;  5E6O A;  3Q2A C;  2DWQ A;  3KVF B;  4EEW A;  2W3S A;  3CIR B;  1NVI D;  4ZRP A;  2WP9 B;  2GRI A;  4J6I A;  1NI3 A;  3Q14 C;  3OAW A;  2QIE B;  1YNT E;  3HK0 A;  3DQV A;  4HWI B;  1P98 A;  3GE8 C;  1JRU A;  3NS1 A;  4S0R A;  4HLE A;  1WZ0 A;  4C56 C;  1WIA A;  4HDO A;  2MP2 A;  3PGE A;  1F52 A;  3RFZ B;  4HPP A;  4YTP B;  3OG5 A;  3X0W A;  2KMA A;  2LMC A;  1FCC C;  4ITK A;  2IO0 B;  4HPL B;  2BB5 A;  4M8N A;  4GDL B;  4NJC A;  1GPX A;  1V97 A;  2UWQ A;  1E90 A;  1F1H A;  3KUC B;  1NDD A;  5LXI B;  5CX3 A;  4ZYS A;  2HJ8 A;  3PZ8 A;  2BWF A;  2FAZ A;  3AE3 B;  2LGD A;  4W9K A;  3FIL A;  5TR5 A;  4K7W A;  4GN1 A;  4DXG A;  2M0X A;  5BO4 B;  2RPV A;  3ZJT A;  3VR8 B;  4A8X C;  1XXG A;  2CHZ A;  1WR1 A;  5JHA A;  4PS3 A;  3AE5 B;  1STE A;  3N1Z C;  2LHE A;  2QMT A;  1QOF A;  1HE8 A;  1V8C A;  1GAQ B;  1TBE A;  2K3U A;  4DDG D;  1TIF A;  3ZVV A;  2GBR A;  4FAD A;  2KTR A;  2WHI A;  4HPM B;  3PT2 B;  3B08 A;  2LUM A;  1WI0 A;  2ZVO A;  3T8M A;  1GUA B;  2DYO A;  3O13 A;  3PSE B;  1HZ6 A;  3ZLZ A;  1QLB B;  4M02 A;  3ZUN A;  1C9F A;  2WU5 B;  3WA0 A;  2B76 B;  1XLN A;  4RGO S;  3GZN I;  1WM2 A;  3ML8 A;  3RMK C;  3N32 A;  2LGS A;  2M56 B;  3AU4 A;  1LQB A;  4NAW B;  1LFD A;  2D07 B;  3BY4 B;  1TT5 B;  2LAS A;  5JH5 C;  4WQO B;  4YTM B;  1N6Z A;  3VTU A;  4RF1 A;  3A9K A;  3GZN B;  1TZ1 A;  3VH3 B;  1RRB A;  1BXT A;  3ZO5 B;  3ALB A;  4DDI D;  4HVB A;  3HVD A;  4DK5 A;  2JU6 X;  1EF1 A;  1JW9 D;  4N6E B;  4W9I A;  3M63 B;  1FXA A;  4B6W A;  4XC2 A;  2E3T A;  3VTV A;  4W9D A;  1D5M C;  2ZZP B;  4WWO A;  3VDZ A;  3ETR A;  5BYR A;  1UGM A;  4RM9 A;  3MJW A;  3H7P A;  2MP2 B;  1I4Q A;  4P7I A;  3U7D A;  5IN7 A;  4IWQ A;  3H9D A;  4K1R B;  4DWF A;  2RD0 A;  3GOE A;  4DHZ E;  2KAN A;  2N9E B;  4W9F A;  4P1B C;  2MWS B;  4GDK B;  1E7U A;  3ZNZ B;  2HDE A;  4B0E A;  1I7H A;  4XGA B;  4H2A A;  2KAC A;  2NR2 A;  3RZW C;  3X23 A;  2KTF A;  3ENE A;  1MJD A;  4C80 A;  1FIQ A;  2J7Q B;  2L05 A;  2FNJ B;  2KVR A;  1UH6 A;  1EU4 A;  2FUH B;  4GDK A;  3W1S C;  2KT7 A;  3P2B A;  1WYW B;  2LGX A;  2JYE A;  1L4D B;  2INN E;  2GMI C;  4W9H A;  4O1N A;  5BYQ A;  3AEE B;  3V6E B;  4WJQ A;  3ZTD A;  3P4Q B;  4I6L B;  3WAM A;  3VRB B;  4D2K A;  2SEB D;  3Q3M C;  2TSS A;  3ZDM C;  3IT4 B;  1Z5S B;  3OWE B;  3TJP A;  3U30 A;  1YN4 A;  1BML C;  3JSV A;  3IBE A;  3SD5 A;  2L7R A;  3QAQ A;  2WQY B;  2WX1 A;  3R66 C;  2LI5 A;  3NUH B;  4W9J A;  4LNI A;  3APF A;  3WCQ A;  4KZ0 A;  4HRO A;  4MAC A;  4FJV B;  3L16 A;  3DBS A;  2J52 A;  2C7H A;  2N9X A;  2PMV A;  4IWP A;  5C23 A;  5BYS A;  4NJ6 A;  4MM3 A;  1WX9 A;  1FPY A;  3A4R A;  2MLB A;  2DHZ A;  4DHJ B;  1SE4 A;  1WRD B;  3PZ7 A;  3V3X A;  2WXF A;  2Y5B B;  1EU3 A;  1Q5W B;  2YEP F;  2MW5 A;  2K6D B;  1UWM A;  4QAY A;  3PRZ A;  3A9K B;  2JXT A;  1TKG A;  1TY2 A;  4NPN A;  4ASW C;  4BKS A;  2ZVN A;  1E7P B;  2MBO A;  1SB3 C;  4IDI A;  5DPT A;  2IGG A;  3DBR B;  4AP4 C;  1QZE A;  1FFU A;  4W9L A;  3LB8 C;  3AV8 A;  2JRI B;  2FE8 A;  4KDL B;  1FNW A;  4KX6 B;  4RCO A;  1BUI C;  3W5U B;  1L0V B;  1H4R A;  4GSW A;  4LJP B;  3GP7 A;  4W9E A;  1N5X A;  4NNJ B;  4FJY A;  1KJT A;  1F2R I;  4MJS B;  4YXD B;  2MBQ A;  1DOI A;  2BW2 A;  3R7R A;  3AU5 A;  1L6U A;  3DBL B;  1WGK A;  4KDI C;  2G9H D;  4TMA B;  5AZG A;  1KLU D;  4HJG E;  1OQY A;  1WY8 A;  1KLV A;  3UGB B;  2JXX A;  5E6P A;  3PHX B;  4AQ7 A;  2JZP A;  4HDQ A;  2K25 A;  2LVO A;  3GB1 A;  4MEL A;  2VH1 A;  2JX5 A;  4MSM B;  2MJD A;  3IT6 B;  1TS3 A;  4MT5 A;  3UQB A;  3OLM D;  4L23 A;  2AL6 A;  2CU1 A;  5CHV C;  2IZV B;  3ECI A;  1NYR A;  2IGH A;  1I35 A;  1Z2M A;  1GB1 A;  1IUE A;  3I9V 1;  4LCD E;  4TV3 A;  4EKU A;  1GJZ A;  2PIA A;  3NZ3 A;  3B2G A;  3VTW A;  3U2S C;  1I4H A;  2WX0 A;  1FO4 A;  4B0M A;  1D3Z A;  4AJW A;  3MJ5 A;  2KXJ A;  1WJ4 A;  1V2Y A;  1QOB A;  3FIL B;  1D5Z C;  4JQW C;  3DVG X;  5L83 A;  1VCB A;  1IGC A;  3TEZ A;  1GNU A;  2R2Q A;  3T9L A;  2WDT B;  4AJY B;  1KTK A;  3WAO A;  2QC8 A;  3AEG B;  3QQ8 B;  3M62 B;  1HEZ E;  2BTE A;  3BK1 A;  4HRS A;  4CYE A;  2AYO B;  1CZP A;  3A33 B;  3B2F A;  4KZC A;  1WJ6 A;  2XBB C;  2DAJ A;  2JWU A;  4MGI E;  3PS6 A;  3EEC A;  3J9C A;  4GLS C;  1UBI A;  1NI2 A;  1L2N A;  2I1J A;  3RNF C;  5DPS A;  3R8B A;  1VJK A;  1J19 A;  2ZEQ A;  1EM7 A;  1K53 A;  2NVU I;  2M4N A;  1J0G A;  4MSQ B;  3A1Q A;  4XZ4 A;  4FA6 A;  5C1Z A;  1YX6 B;  5D2M B;  1ET9 A;  3ZW3 A;  1F2R C;  2NPT A;  3B9J A;  3AM9 A;  2GBM A;  4FHJ A;  4RFB A;  4KGT A;  3TSS A;  2K9X A;  5EE1 A;  2KD0 A;  4C4V B;  2JY6 A;  4FJZ A; 
#chains in the Genus database with same CATH homology
 2LGY A;  2CHZ A;  1WR1 A;  3N30 A;  4BBN F;  3NHE B;  5JHA A;  1E8X A;  4PS3 A;  2KQS A;  2L8J A;  4ANU A;  1GG3 A;  3WIM A;  3CST A;  2KMC A;  3K9P B;  2KC2 A;  5J18 A;  3ZKJ C;  2L76 A;  1HE8 A;  2C7N B;  1V86 A;  4LJO B;  2FCS A;  1TBE A;  3PZD A;  2LRU A;  2BGF A;  4GOC A;  2R2O A;  3APD A;  2BPS A;  2GBR A;  2ASQ A;  3JYU A;  3ZVV A;  2KTR A;  4FAD A;  3R7Q A;  3L08 A;  2GOW A;  2BKF A;  2NBW B;  4G0N B;  4HPM B;  4NY0 A;  3PT2 B;  4ZRI A;  3QHT A;  3B08 A;  1OEY A;  3H7S A;  1WI0 A;  1IP9 A;  1YX5 B;  2ZVO A;  3D32 A;  3T8M A;  1GUA B;  2DYO A;  4A20 A;  3PSE B;  2BYV E;  1EF5 A;  3IFW B;  3ZLZ A;  2MRP A;  4MGZ E;  3L17 A;  2O2V B;  2C7M B;  2MBH A;  3TIX A;  3WAL A;  3ZUN A;  1SGH A;  1WE6 A;  3K9O B;  4GMV A;  2GBJ A;  4HCN B;  3TCA A;  1V6E A;  4EZJ A;  3APC A;  3OJ4 B;  4ZYN A;  3WA0 A;  3EC8 A;  4F7Z A;  2NBV B;  2N7E A;  4FN2 A;  3GZN I;  1WM2 A;  3ML9 A;  2I1K A;  1EO6 A;  1T0Y A;  1WM3 A;  3ML8 A;  3N32 A;  3VVW B;  3VH4 B;  2L00 B;  3U8Z A;  5FR6 A;  1EUV B;  3AU4 A;  1LQB A;  4NAW B;  1LFD A;  2D07 B;  1YJ1 A;  5DPW A;  3BY4 B;  3VQI A;  4EUT A;  2CHW A;  2M1M A;  2FID A;  3TL5 A;  2LAS A;  3LJ3 A;  4BOZ B;  4K81 A;  1RAX A;  5JH5 C;  3EFU A;  4WQO B;  4WJN A;  2ZPY A;  4M0W B;  2C5L C;  2KDI A;  3VTU A;  3A9K A;  2D10 A;  4ZRJ A;  1TZ1 A;  2KX0 A;  3VH3 B;  4HCP B;  2KHW B;  1WH3 A;  2JT4 B;  2OOB B;  2KWV B;  2DYM A;  1FXT B;  1NBF C;  1S1Q B;  1YQB A;  2D3G A;  1RRB A;  2YVC A;  4ZRK A;  4FHK A;  2AEH A;  3NY5 A;  3W1S A;  1F9J A;  3ZO5 B;  3ALB A;  2KC1 A;  3I3T B;  4W9C A;  4DDI D;  3DVN U;  3MTN B;  3L54 A;  3M3J A;  4HVB A;  5CTR C;  5CHW A;  5KHO A;  4DK5 A;  1E5W A;  1EF1 A;  4GIV A;  2NBU A;  4URK A;  3DPD A;  2N1W A;  3NZU A;  4FLH A;  3R3M A;  3M63 B;  4W9I A;  4B6W A;  2LXA A;  4XC2 A;  1WXS A;  4K7S A;  2MSE D;  2IO2 B;  3VTV A;  1OEY J;  2Z0E B;  4G3X B;  4W9D A;  3KUD B;  4G11 A;  3VUY A;  4RM8 A;  4EZK A;  1GC6 A;  3ZNI D;  2ZZP B;  2DZI A;  1YD8 U;  1S3S G;  2ZNV C;  4WWO A;  3VDZ A;  4WWP A;  4NQK E;  4ANW A;  2RGF A;  2GBN A;  1UGM A;  4RM9 A;  3MJW A;  3H7P A;  4EZL A;  2MP2 B;  2IBI B;  4KSL C;  2LVQ A;  2N7D A;  4P7I A;  3U7D A;  2KZR A;  5D7G A;  1LM8 B;  4IWQ A;  4II3 B;  3H9D A;  1AAR A;  4K1R B;  2EMS A;  4K7U A;  4DWF A;  4BKT A;  2RD0 A;  3DOW A;  5G2N A;  1PQS A;  4M8M A;  3L13 A;  3C0R B;  1WFY A;  3JSV B;  4X57 B;  2FCN A;  4ANV A;  1WJN A;  3GOE A;  4DHZ E;  2KAN A;  3RZF A;  2N9E B;  3QAR A;  4KIK B;  4I6N B;  4W9F A;  1UD7 A;  1XT9 B;  2KLG A;  2ZCC A;  3DBL I;  2MWS B;  4GDK B;  1E7U A;  4JL9 A;  3V6C B;  3ZNZ B;  4DBG A;  1ZGU B;  2KWC A;  1ZW7 A;  2K8C A;  2KJ6 A;  3DBR I;  2DEN B;  3ONS A;  4GU2 A;  2NR2 A;  3B1L X;  2PE6 B;  3RZW C;  3X23 A;  2KTF A;  3ENE A;  2KTR B;  5IAA C;  2J7Q B;  2HE7 A;  2L05 A;  2JPH A;  2KDB A;  3EHV A;  3NZS A;  2FNJ B;  1MG8 A;  3UIP B;  2KVR A;  1UH6 A;  4GDK A;  2FUH B;  4GDL A;  3W1S C;  5E6N A;  3P2B A;  1WYW B;  2D2Q A;  2LGX A;  3KW5 B;  3LDZ E;  1UEL A;  3CMM B;  3ZDT A;  4CHK A;  2PPH A;  4KV2 A;  2GMI C;  4W9H A;  4WAA A;  4F8C B;  3ZNH B;  3H1U A;  1TGZ B;  4MJS A;  3V6E B;  4WJQ A;  2K1F A;  4PYZ A;  3ZTD A;  2WWZ A;  2DYB A;  2NCN A;  2KDF B;  4I6L B;  5CHF A;  2KNB A;  2W9N A;  4W9G A;  3WAM A;  4AUQ C;  2N4F A;  2KFK A;  1BT0 A;  2EMT A;  4IWO A;  2DZK A;  5IA7 A;  2KJH B;  1IPG A;  1VD2 A;  3ZDM C;  2KOX A;  1Z5S B;  3A1Q B;  2NS5 A;  4IG7 B;  3VHT C;  3AXC A;  3TJP A;  3U30 A;  1K8R B;  3B0A A;  4MDK E;  2O6V D;  3JSV A;  1KM7 A;  2KX3 A;  3IBE A;  3SD5 A;  2L7R A;  3NOB A;  3PVL A;  3QAQ A;  2LRW A;  3O65 B;  3HM6 X;  4WWN A;  4N9F 4;  3VUX A;  3R66 C;  2WX1 A;  3DBH I;  4ANX A;  1WGY A;  2KO3 A;  1ISN A;  2LI5 A;  4BVU C;  3JVZ X;  2LVP A;  1E8Y A;  3Q3J A;  1WXV A;  3QA8 A;  5JHB A;  5AZH A;  1V5T A;  4W9J A;  4BFR A;  1WF9 A;  3APF A;  4TQ0 A;  4KZ0 A;  4A3O A;  4FJV B;  3L16 A;  4ICU A;  2DX5 B;  3DBS A;  3ZTC A;  2C7H A;  2N9X A;  2BWE S;  1WZ3 A;  4IWP A;  2A4Z A;  5C23 A;  4ZDV A;  2FCQ A;  2BYE A;  4NJ6 A;  1I42 A;  4MM3 A;  3BIN A;  1WJU A;  4XX5 A;  1WX9 A;  3A4R A;  2MLB A;  2CKH B;  2DHZ A;  2ZNV B;  4IM3 A;  4AWJ A;  3ZRC A;  4DHJ B;  4DXA B;  4F1S A;  3L0W B;  2K8H A;  1WRD B;  4EFO A;  2A5U A;  1WGH A;  1UBQ A;  2RR9 A;  2Y5B B;  3KUZ A;  3M95 A;  4MGK E;  3UIO B;  4E74 A;  2KN5 A;  3KH0 A;  1WMH A;  1WX8 A;  1Q5W B;  4MEM A;  1YIW A;  4KVG B;  2PEA A;  2MW5 A;  3SU8 X;  4AOF A;  2ZPN A;  1V81 A;  3H7P B;  2K6D B;  2GBK A;  3RYT A;  3WAP A;  1M94 A;  3A9J B;  3PRZ A;  1TTN A;  3QJZ A;  3ZIM A;  5EDS A;  3A9K B;  1SIF A;  1P0R A;  2AL3 A;  2HD5 B;  4NPN A;  4ASW C;  2BKR B;  2MBB B;  4BKS A;  2ZVN A;  2MBO A;  2KDE B;  3V62 A;  5J17 A;  3DDC B;  1ZKH A;  2REX A;  4DHZ B;  3PV1 A;  5DPT A;  4IW0 A;  4DDG D;  2Z59 B;  4NAW A;  4HJK A;  1E8Z A;  2JF5 A;  4YL8 A;  1WE7 A;  4GB9 A;  3TMP B;  3WAN A;  1QZE A;  4W9L A;  4AP4 C;  3W1Y A;  1WGG A;  2JUO A;  2JRI B;  4GXB A;  4KDL B;  3V60 A;  2QHO A;  4PYU A;  2LXC A;  2LUE A;  2L3Z A;  3QCA A;  4OVV A;  3H6N A;  2VRR B;  3NS8 A;  2K8B A;  3RT3 B;  1H4R A;  3HHM A;  4LDT D;  2MA9 B;  4GSW A;  2CS4 A;  4LJP B;  4IUM B;  2K6Q A;  2RPQ A;  4W9E A;  3RCZ A;  2G3Q B;  3TBL D;  4E71 A;  2KK8 A;  4NNJ B;  3L10 B;  4FJY A;  1KJT A;  2EKE C;  4RMA A;  5GMV A;  4MJS B;  2MBQ A;  3R7R A;  1A5R A;  3SHQ A;  1WMH B;  3AU5 A;  2J0J A;  3QWZ B;  4JGH B;  2DZM A;  3RUI B;  5JZE B;  2IY0 B;  4EOY A;  5HKH A;  2WYQ A;  2O6V B;  1P9D U;  2XK5 A;  4LDT B;  3Q3F A;  4IM2 A;  4KDI C;  3PHW B;  5AZG A;  4IC7 B;  2MBE A;  3DCG A;  3PRP B;  2MCN B;  3KYD D;  2C60 A;  1OQY A;  5LLI A;  4BKS D;  1WY8 A;  2G4D B;  1KLV A;  3UGB B;  3S2A A;  2JXX A;  1C1Y B;  5E6P A;  2JRH A;  3A4S C;  3PHX B;  4HDQ A;  3QIJ A;  2K25 A;  2LVO A;  5AEK B;  4PS8 A;  2BYF A;  4MEL A;  2KJR A;  5D6J B;  2MQJ A;  4FBJ B;  4MGY E;  4MSM B;  2YLM A;  1V9J A;  1E8W A;  1LXD A;  3RUL A;  1XQQ A;  3CF6 E;  3IG3 A;  4KIK A;  2LZ6 A;  3UQB A;  3OLM D;  2L0F A;  1OGW A;  2DAF A;  2G4S A;  3UQA A;  2AL6 A;  3HM3 A;  2CU1 A;  3JW0 X;  1H8C A;  1WXM A;  4TKN A;  2JWZ A;  3AUL A;  5CHV C;  2IZV B;  3ECI A;  1Y8R C;  2M17 A;  3N3K B;  3VAW A;  5AZF A;  2LD9 A;  2RSU A;  3UIN B;  5L95 C;  5J2R A;  2J0M A;  1Z2M A;  2N1V A;  3UF8 A;  1I35 A;  4A3P A;  1C3T A;  1R4N I;  2V1Y A;  1G6J A;  3VUW A;  1Q1O A;  3PTF C;  4OVU A;  2LWP A;  1P3Q U;  2KWU B;  4B9K A;  4JLC A;  4B95 A;  3ZRF A;  4LCD E;  1U4A A;  4TV3 A;  2BF8 B;  3QX1 A;  4EKU A;  1GJZ A;  5DPR A;  1WGD A;  2LJ5 A;  4NQL B;  2PE9 A;  2IYD B;  3VTW A;  2WX0 A;  5DCN A;  3RD2 A;  3KYC D;  2PJH A;  1WR6 E;  2MX2 A;  4AJW A;  1D3Z A;  1KOT A;  2B3A A;  5D94 A;  1RFA A;  3A9J A;  2CR5 A;  4PS7 A;  4DHJ D;  2UYZ B;  3HIZ A;  1SE9 A;  3AI5 A;  2J0K A;  2KXJ A;  4ICV A;  1WJ4 A;  3SDL C;  1V2Y A;  2C9W B;  1IYF A;  4NJ7 A;  2XEW A;  2JZ3 B;  2IO1 B;  4E3C A;  2D11 A;  4BKG A;  2ZCB A;  1E7V A;  3PRE A;  4WJP A;  4JQW C;  4BOS C;  4TQ1 A;  3DVG X;  2O2V A;  3IHP C;  4GGQ A;  3IVF A;  2IO3 B;  2IY1 B;  4HK2 A;  1RLF A;  4KSK C;  5E6O A;  1R4M I;  2JVC A;  5KHQ A;  1CMX B;  2KKC A;  1GC7 A;  3VFK A;  3KVF B;  5L83 A;  1VCB A;  4EEW A;  2KQ7 A;  4FUL A;  4I6P A;  1GNU A;  2R2Q A;  2Z0D B;  4J6I A;  3T9L A;  2O6V A;  2XK5 B;  2WDT B;  4AJY B;  3OAW A;  4CO7 A;  3HK0 A;  4TUU A;  2DZJ A;  3DQV A;  4HWI B;  3WAO A;  4G50 A;  3PLU A;  1P98 A;  2K39 A;  1JRU A;  2KFK B;  3QQ8 B;  3M62 B;  4HLE A;  1WZ0 A;  1WX7 A;  4CYE A;  1WIA A;  2AYO B;  4HDO A;  2MP2 A;  3A33 B;  3PGE A;  3QK0 A;  3VXW A;  4KZC A;  1WJ6 A;  2M8S A;  3PPA A;  2KLC A;  2XBB C;  2DAJ A;  4MGI E;  4HXD A;  2V3S A;  3PS6 A;  2KMA A;  3X0W A;  2KFJ A;  2OJR A;  3QC8 B;  2IO0 B;  1UZX B;  4HPL B;  1OTR B;  3EEC A;  1V49 A;  1UBI A;  1V80 A;  3V61 A;  4M8N A;  4GDL B;  2AWT A;  2N9P C;  1NI2 A;  4IM0 A;  4II2 B;  2FCM A;  5LXH A;  2UWQ A;  1L2N A;  1E90 A;  3KUC B;  2I1J A;  4BBN C;  5DPS A;  3DVG Y;  2L0T A;  1NDD A;  1J19 A;  2ZJD A;  2JZZ A;  3OJ3 A;  3PLV A;  2FIF A;  1V5O A;  2ZEQ A;  1WXA A;  5G55 A;  2G45 B;  5LXI B;  5CX3 A;  3MHS D;  1L7Y A;  2NPT B;  2HJ8 A;  2NVU I;  3DVN V;  2BWF A;  1P1A A;  2HTH A;  4JIO U;  2M4N A;  4MH0 E;  2FAZ A;  4MSQ B;  4WJO A;  1J0G A;  3A1Q A;  1Q0W B;  4XZ4 A;  4FA6 A;  5C1Z A;  1YX6 B;  3PRM B;  5D2M B;  3ZW3 A;  2LGD A;  4W9K A;  1X1M A;  2NPT A;  3CSF A;  5TR5 A;  1XD3 B;  2GBM A;  4FHJ A;  4K7W A;  1J8C A;  4GN1 A;  2M0X A;  1WGR A;  3ZNG C;  5BO4 B;  2KD0 A;  2V4L A;  2JY6 A;  4FJZ A;  2CHX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...