2WYQA

The crystal structure of the ubiquitin-like (ubl) domain of hhr23a (human homologue a of rad23)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
MAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKNFVVVMVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Ubiquitin-Like (Ubl) Domain of Human Homologue a of Rad23 (Hhr23A) Protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords UV EXCISION REPAIR PROTEIN RAD23 HOMOLOG A
total genus 20
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2009-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2wyqA00
1WXMA 3CF6E 1VCBA 3R7QA 3H6NA 2WX0A 2D10A 4WJOA 2NPTB 4IWOA 2LGDA 3AU5A 1E90A 2DX5B 4TUUA 2MP2A 3L13A 2I1KA 4W9IA 2KC2A 1WFYA 2JXXA 2KANA 4MEMA 1XQQA 1C3TA 2G45B 2FAZA 2NPTA 3JW0X 3RZFA 3VUYA 2KHWB 2GBMA 1Q0WB 2D3GA 2DZIA 4WWOA 2LJ5A 3HM6X 4PYUA 3QCAA 3LDZE 4ICUA 1WE7A 5J2RA 3RT3B 1WX9A 2IBIB 2ZCBA 2RPQA 2JWZA 3EC8A 3UQAA 3PS6A 3ZNZB 4HCNB 2LGXA 4FLHA 2Z0DB 4HLEA 4XZ4A 1E8WA 1J8CA 2VRRB 3NHEB 3OJ3A 3VTVA 3JVZX 3JYUA 3R66C 4BKSA 4II3B 1K8RB 2RSUA 1E8YA 3WAOA 3N30A 3L16A 4W9JA 2J0KA 4P7IA 3AULA 2BKRB 4EOYA 1WF9A 1HE8A 4FJYA 3OJ4B 3H7PB 3TMPB 2A5UA 4IWQA 2OJRA 1OEYJ 4KSLC 2CHXA 2MBBB 3ZDMC 1JRUA 2I1JA 3U7DA 2FCSA 1WXVA 4ANXA 4N9F4 3M3JA 1RAXA 3A33B 4GB9A 1KJTA 2M17A 1P0RA 2XK5B 4IM3A 2KQ7A 1KM7A 4WWNA 2G3QB 2MCNB 1V81A 3RULA 3U30A 1LXDA 5CTRC 3VDZA 4ANVA 2M1MA 2O6VB 2FUHB 4G0NB 4BFRA 1H8CA 4TKNA 3APDA 4KV2A 4A20A 4BBNF 2MBOA 1XT9B 4GIVA 1WYWB 3V60A 1WJUA 2C7HA 2N1WA 3TBLD 3T8MA 1TTNA 4FN2A 3HM3A 4AOFA 5L83A 2KTRB 4HDQA 3M95A 4EFOA 4LDTD 1Z2MA 2IY0B 3SHQA 5LLIA 3EECA 3PHWB 3A1QB 2KQSA 3UIPB 4W9DA 2KJHB 2HTHA 3U8ZA 1OGWA 2FCMA 2L0TA 5LXHA 1WRDB 5JHAA 3VUXA 2DYOA 1WGGA 2WYQA 3K9PB 4FJZA 3QA8A 2KXJA 3L54A 2BWFA 5AZGA 2KWVB 2KZRA 3VUWA 3A9KA 2JZZA 2K8HA 1UBQA 2NS5A 3A9KB 1WJNA 5JH5C 2ZPNA 3ZTDA 2ZZPB 1WMHA 3PVLA 1R4NI 4DHJB 2RR9A 3PZDA 2HJ8A 3KUDB 3DOWA 3QK0A 1H4RA 3V6EB 4DXAB 2FNJB 2K39A 2N4FA 3QIJA 4MGYE 2LVPA 1NI2A 3Q3FA 4RM9A 4WJQA 4DDID 1WIAA 3QJZA 3ZUNA 1C1YB 3A1QA 3PGEA 4E3CA 2LRUA 3SU8X 5DCNA 1ISNA 4BOSC 2MA9B 4HCPB 2CU1A 3B08A 2IY1B 3KUZA 1WH3A 3D32A 3ENEA 3UGBB 2V1YA 1R4MI 1EUVB 4JQWC 1OQYA 1WGDA 4NQLB 2KDEB 4KIKA 1WR6E 5IAAC 2YLMA 1V6EA 3B1LX 2MWSB 4WAAA 3ZTCA 4IW0A 1YD8U 4EEWA 4PS7A 4IC7B 1WM2A 1YX5B 2JZ3B 2XK5A 1WE6A 2EMSA 2AWTA 3PREA 1CMXB 3ZRFA 2D2QA 1V9JA 4GMVA 4MSQB 4WWPA 1GUAB 1WM3A 5AZHA 3TL5A 3N3KB 4CHKA 1Y8RC 1P3QU 5FR6A 3PLVA 3APCA 2JPHA 2IO0B 2IYDB 2KWCA 3H7PA 1WGHA 2GMIC 3QAQA 3DBHI 2AL3A 3PRMB 3VH3B 5DPTA 5KHOA 3JSVA 1UD7A 4IM0A 2YVCA 1E7VA 1KOTA 2LASA 4G11A 3RD2A 2ASQA 4K7WA 1VD2A 2Z0EB 3ONSA 1V5OA 4F8CB 4LCDE 4GOCA 3NY5A 1WX7A 4K81A 1GNUA 2OOBB 2IO3B 3CSTA 4G50A 4KSKC 5CX3A 2AEHA 4B9KA 4DWFA 1LQBA 4JLCA 3DDCB 4NAWB 3TJPA 1EF5A 3ZKJC 2MX2A 3ZNID 1MG8A 1EF1A 2JUOA 4M8NA 2BWES 3I3TB 2L00B 2D07B 4ZYNA 2O2VA 3V62A 4J6IA 3X23A 2JT4B 4BKTA 4ANUA 4MDKE 1J0GA 2CS4A 4II2B 1SE9A 4HJKA 4HK2A 4I6PA 1OTRB 4GDLB 1IYFA 2N9XA 5E6NA 2J7QB 1Z5SB 2MLBA 3WAMA 1V49A 4W9GA 4HVBA 4GDKA 5DPSA 1E7UA 3NZUA 3L10B 3SD5A 1WR1A 4ANWA 3DBRI 2R2OA 3L08A 4MM3A 2ZPYA 3T9LA 4EKUA 2PPHA 3PV1A 3WALA 1SGHA 2KC1A 4AJYB 4MJSB 2EMTA 2CR5A 5CHFA 4MJSA 4GSWA 4ZRIA 1KLVA 3NS8A 4GU2A 5GMVA 1ZGUB 5AZFA 2ZNVB 2L8JA 5IA7A 3QC8B 3UQBA 3EFUA 2DAFA 5AEKB 2MBEA 2N7EA 5C23A 1D3ZA 3SDLC 2L3ZA 2K6DB 2IO1B 4DHZE 5J17A 5L95C 4IM2A 3DPDA 4FJVB 1XD3B 2LXAA 1P98A 1V2YA 4HWIB 4WJNA 4NQKE 2RD0A 4FHKA 5J18A 2KTFA 4KZ0A 1I42A 3UINB 4MSMB 1F9JA 1Q1OA 3ZDTA 3ECIA 2JF5A 1YQBA 3M62B 5D2MB 4WJPA 2KMAA 1WGRA 2BPSA 4LJOB 4GN1A 4BKSD 3B0AA 2LI5A 3H9DA 3KH0A 2NVUI 3ZO5B 1V86A 2BKFA 3A4RA 4IUMB 3GOEA 2NBWB 5JHBA 2V3SA 5D6JB 1T0YA 2LUEA 1Q5WB 2MRPA 2LZ6A 4I6LB 4PYZA 2NBUA 2KMCA 3WANA 3GZNI 5C1ZA 2MBHA 3RZWC 2Z59B 4FHJA 2C5LC 2NCNA 3ZNHB 1IP9A 1M94A 2BGFA 3CMMB 2FIDA 2WDTB 4M0WB 2M0XA 1UGMA 2KDIA 2AYOB 3PTFC 1GJZA 2JVCA 1YX6B 4BOZB 3ZVVA 3PT2B 2LXCA 1WJ6A 1RFAA 2KX0A 4A3PA 3A9JB 2N9EB 4PS8A 4W9CA 1TBEA 2KO3A 1WX8A 3VTUA 2BYVE 1PQSA 3OLMD 1A5RA 3QHTA 3MTNB 2REXA 4FA6A 2C7MB 2LVOA 3QQ8B 3VFKA 1BT0A 3QWZB 3DVGY 1NDDA 2GBRA 2ZCCA 2DZMA 2L0FA 4JL9A 3L17A 1NBFC 2GBJA 3NOBA 2FCQA 4HPLB 2L05A 2JY6A 1UH6A 1LM8B 4GDLA 2FIFA 3IBEA 3AI5A 3K9OB 4M8MA 1OEYA 2FCNA 3PRZA 3CSFA 3ZNGC 1S1QB 3NZSA 4RMAA 2M4NA 1WJ4A 2CHZA 3M63B 4B95A 3QX1A 2W9NA 1AARA 2C9WB 5CHWA 2ZNVC 4TV3A 2NBVB 4OVUA 1GC7A 4NNJB 2C7NB 2WWZA 3RCZA 4CO7A 4NAWA 2MW5A 3PRPB 2KDFB 3V61A 2KN5A 3ML8A 3N32A 4EUTA 2KDBA 2XBBC 2ZVOA 3IHPC 5D7GA 1UZXB 5LXIB 2D11A 4FULA 1GG3A 5BO4B 3TCAA 3VTWA 2K6QA 5JZEB 1YIWA 3KYDD 1FXTB 3UF8A 1ZW7A 4FBJB 2RGFA 1GC6A 4HPMB 3WIMA 2K8CA 5G2NA 1EO6A 5D94A 3OAWA 1P9DU 4FADA 4W9LA 1WGYA 3DBSA 3Q3JA 3ZLZA 2DENB 2M8SA 3ML9A 4PS3A 4MELA 4W9FA 5EDSA 3ZW3A 2KKCA 2DYMA 2GBKA 2KVRA 4XX5A 2AL6A 2O6VD 3DVGX 2PE9A 4KDLB 4KVGB 4W9EA 1WMHB 2K8BA 5E6OA 3UIOB 3A4SC 4BVUC 4ZDVA 3TIXA 4IG7B 3DQVA 2B3AA 1RRBA 4JGHB 1WXAA 4RM8A 4A3OA 4BBNC 3PSEB 3A9JA 2UYZB 3S2AA 2LD9A 4B6WA 3AXCA 1TZ1A 3PLUA 2N1VA 2ZVNA 4XC2A 3ZIMA 2L7RA 4HXDA 2KOXA 3JSVB 1E8ZA 4ZRJA 1RLFA 1WI0A 2N7DA 4LDTB 2KFJA 4AJWA 4WQOB 5KHQA 3R7RA 3O65B 3R3MA 1WY8A 4TQ0A 4AUQC 4KDIC 2N9PC 2K25A 2EKEC 4NPNA 4EZKA 4DHZB 2KX3A 3MHSD 5CHVC 3PPAA 2J0JA 4AP4C 4MGZE 4G3XB 3RUIB 3DVNV 3MJWA 2KD0A 2DZJA 4CYEA 1WZ3A 3VQIA 5TR5A 2ZEQA 4E74A 3H1UA 2G4DB 2V4LA 2DAJA 2GOWA 1E8XA 2PJHA 5G55A 3AU4A 2O6VA 2KLCA 4DHJD 3IG3A 4W9HA 3RYTA 3VXWA 3IFWB 4DDGD 2KJRA 4URKA 5HKHA 1IPGA 3WA0A 4KIKB 1WZ0A 4F1SA 1S3SG 1U4AA 2JRHA 1WXSA 1E5WA 2MSED 3P2BA 4OVVA 1TGZB 2HE7A 3H7SA 3V6CB 5E6PA 1J19A 4GDKB 4K7SA 2J0MA 2XEWA 1ZKHA 4AWJA 3EHVA 1L2NA 3DCGA 4ICVA 4K7UA 1V5TA 3WAPA 2R2QA 2UWQA 3ALBA 3ZRCA 3BY4B 4I6NB 4KZCA 4NY0A 1SIFA 2LRWA 1G6JA 4JIOU 4NJ7A 4DBGA 3LJ3A 2K1FA 2JRIB 3HIZA 2O2VB 1P1AA 2CHWA 2A4ZA 3KW5B 2LVQA 3KYCD 1I35A 2BYEA 2KFKA 2BF8B 2LGYA 4GGQA 2QHOA 4MGIE 4MGKE 3VAWA 1YJ1A 3VVWB 2GBNA 2DYBA 3KUCB 2DHZA 3DVNU 4GXBA 2WX1A 2PEAA 4YL8A 1QZEA 3VHTC 2CKHB 3W1SA 3IVFA 4TQ1A 4F7ZA 1UELA 2KLGA 4EZJA 3BINA 2PE6B 2IO2B 1X1MA 2ZJDA 4NJ6A 5DPWA 2MBQA 4DK5A 1L7YA 2G4SA 3W1SC 2DZKA 4ZRKA 1UBIA 3X0WA 1V80A 2Y5BB 2NR2A 2KNBA 2MP2B 2HD5B 2KTRA 2LWPA 1LFDA 3W1YA 3HK0A 3L0WB 5DPRA 2MQJA 4X57B 3VH4B 3HHMA 4BKGA 2KK8A 4ASWC 2IZVB 2KWUB 2L76A 3APFA 4W9KA 4K1RB 2KFKB 4MH0E 4IWPA 3PHXB 4EZLA 3KVFB 3C0RB 2KJ6A 2C60A 4LJPB 3QARA 2BYFA 4E71A 3DBLI 4HDOA
chains in the Genus database with same CATH superfamily
3EA6A 4PK1A 1DYQA 4H2AA 3R7QA 1E90A 3U4EG 1TYGB 3L13A 2KC2A 5EE0A 4M00A 1C3TA 3RZFA 2FAZA 2KHWB 4LLGM 1Q0WB 2DZIA 4HJGE 3RT3B 2IBIB 2CJOA 3ZNZB 4HCNB 4FLHA 3AE7B 2MJDA 2MH7A 4NJCA 1NVID 3OJ3A 3VTVA 1K8RB 2D3BA 3NUHB 3N30A 4W9JA 3T3NA 2AQ1B 3AULA 5BYQA 4EOYA 1F1HA 1HE8A 4N58A 3TMPB 4B0MA 1R7SA 3T3OA 1OEYJ 4L23A 3AEDB 3BK1A 2CHXA 3NG0A 1AW7A 1WXVA 1VZ8A 3IXSA 1KJTA 1V1PB 4IM3A 2KQ7A 1KM7A 3U30A 3VDZA 2PLPA 1E7PB 4BFRA 4TKNA 1TS5A 3APDA 2SAKA 4KV2A 4A20A 2MBOA 1N5WA 3V60A 2N1WA 4FN2A 4ITKA 4HDQA 4OW0A 3N1XC 3OG5A 4EFOA 4LDTD 3DBRB 3UIPB 1QT9A 2KJHB 3NRZA 3MFGA 5LXHA 1WRDB 2IGHA 2W54A 4KGSA 3VUXA 5JHAA 3SFEB 2DYOA 3VUWA 3A9KA 5JH5C 3FC4A 2ZPNA 3PVLA 1TS3A 2RR9A 4WQMA 3DOWA 3KWVA 1H4RA 3V6EB 2FNJB 2IPKD 2LEKA 1NI2A 4DDID 3Q3FA 1WIAA 3A1QA 4DQOC 3PGEA 2LRUA 2V9HA 5DCNA 2MA9B 4HCPB 5BYRA 3ZXVA 3ENEA 2V1YA 1EUVB 2LGSA 4KIKA 2VZKB 3URYA 2YLMA 3B1LX 2MWSB 4IW0A 4PS7A 1HA5A 4LNOA 4IC7B 1YX5B 2JZ3B 2JZPA 3BWUD 3PREA 1V9JA 4P1BC 4WWPA 1F2RI 1GUAB 1WM3A 1Y8RC 1P3QU 3APCA 1T0SC 2IO0B 2IYDB 3H7PA 1WGHA 3DBHI 5DPTA 1UD7A 4IM0A 4G11A 3RD2A 4A6QA 3ONSA 4KSKC 1WX7A 2IO3B 4KKJA 3AECB 4KGRA 1LQBA 3ZKJC 2MX2A 4M8NA 2XN9C 1ZDXA 4KX6B 2D07B 4ANUA 4C7ZA 4MDKE 1J0GA 4II2B 4HK2A 1HXYD 2CU3A 1C79A 5E6NA 4YWGG 1F0ZA 1MHHE 5T8IA 3ZJVA 1V49A 4M0WA 5DPSA 3NZUA 3SD5A 2R2OA 3WALA 4AJYB 4HKZE 2EMTA 2CR5A 5CHFA 4GSWA 4DXGA 4GLSC 1WRIA 2ZNVB 4RGTA 5AZFA 3UQBA 1K52A 2DAFA 5G5HA 1MJDA 2L3ZA 2L52A 5I4DA 5L95C 2H89B 3DPDA 1XD3B 2LXAA 4XDDA 1P98A 1ZXIA 3P4SB 3UINB 3LYYA 1FNVA 3FKYA 3W2DA 3VRBB 3Q14C 1XLPA 2FBWB 2KMAA 4LJOB 1I4XA 1V86A 2GI9A 1WYGA 3GOEA 5JHBA 2V3SA 5D6JB 3TEZA 2LUEA 2MRPA 4CQNA 4PYZA 2KMCA 3GZNI 4FHJA 2C5LC 1IP9A 2FE8A 3CMMB 5H92C 1HZ5A 2WDTB 1QOFA 3AM9A 4OVZA 1GJZA 4ZHOA 1N61A 3ZVVA 2LXCA 1GB1A 3N20C 3NJTA 4PS8A 1TBEA 2VZKD 2BYVE 3QHTA 3MTNB 3DBHB 4LK0M 5BMIA 1ZUD2 2C7MB 2LVOA 3QQ8B 3DVGY 5D3IB 2ZCCA 2LGIA 2OJWA 2JYEA 1NBFC 2L05A 2SEBD 2JY6A 4D2KA 1XCTL 1E10A 3K9OB 4M8MA 1S1QB 1RYJA 2M4NA 4WWMA 3EUB2 2W9NA 4MT5A 1AARA 2AQ3B 5CHWA 1P7FA 2NBVB 3RCZA 1KRHA 5H8YE 2MW5A 2KDFB 4RCOA 2QJLA 1SE2A 5LXIB 2DLBA 1VR9A 3VTWA 5JZEB 4AS1A 2HTME 3KYDD 1GC6A 4HPMB 3WIMA 4LNKA 4YSYB 3AEEB 1TJEA 2ZW1A 3ML9A 4LNNA 1DGJA 2DYMA 1J7BA 2AL6A 1STEA 4ZRPA 5E6OA 3AE5B 3UIOB 1L4ZB 4IG7B 2B3AA 4RGMA 2RDGA 4JGHB 3BZDB 3A9JA 4B6WA 1FCCC 3N1YC 2HDEA 4XC2A 2NTSA 2GLSA 4ZRJA 2N7DA 4REZA 2KFJA 3R3MA 1WY8A 4XGAB 2ONQA 4KDIC 1GPXA 2EKEC 2WXLA 2VH1A 5CHVC 3PPAA 4AP4C 4MGZE 3RUIB 3DVNV 2KD0A 2DZJA 4CYEA 1WZ3A 3U52E 1I4HA 3H1UA 1F2RC 1E8XA 5G55A 4P6VF 3AU4A 2KLCA 4NZLB 3IG3A 1C77A 1L6UA 3IFWB 4DDGD 3WA0A 2INDC 1S3SG 2JRHA 1E5WA 3P4RB 3V6CB 5E6PA 4GDKB 1C4AA 4AWJA 1L2NA 3KLSX 4K7UA 4ICVA 1V5TA 3WAPA 3ALBA 3ZRCA 4I6NB 4KZCA 4NY0A 3MHZA 4US8A 1P1AA 4TMAB 2J4XA 3VAWA 3KUCB 4HROA 1JALA 2CKHB 1PFDA 1KTKA 4EZJA 4A8XC 3BINA 2IO2B 2K3UA 1ZP0B 3DWGC 3BYYB 3W1SC 1V80A 2WHIA 2KNBA 1LFDA 1ET9A 1SJED 4UDUC 1QKZA 1V1OA 4OZAA 4MH0E 4EZLA 1JRPA 1NENB 1EU4A 3RI7C 3CF6E 3H6NA 4WJOA 1YJJA 4IWOA 3AU5A 2DX5B 1NYRA 1YN3A 3BK2A 4MEMA 1XQQA 1JWAD 2QILA 1YJIA 2GBMA 2D3GA 3RFZB 5J2RA 1VDVA 2ZCBA 3GS2A 1JWBD 4JWSC 2JWZA 3UQAA 3PS6A 1VRAB 2LGXA 4BZAA 1R4NB 4II3B 4WH4A 1L0YB 1ROEA 2J0KA 2MJEA 1YOVB 3U7DA 2FCSA 3N1ZC 1ZXHA 3A33B 1D6EC 2M17A 1P0RA 4ZHPA 1FRRA 2XK5B 3SEBA 4ANVA 2MCNB 5CTRC 2W82A 2O6VB 2QMTA 4BBNF 2Y5PA 1N5XA 2C7HA 4K3BA 2KTRB 2YEPF 1JMLA 2WXHA 3SHQA 5IN7A 5LNK1 3EECA 3A1QB 5IKCM 2HTHA 1FXAA 3RPFC 2FCMA 3U8ZA 1M4VA 1WGGA 1C4PA 2WYQA 2QDFA 1T6BX 3L54A 1PUTA 1XLQA 2KZRA 4LTUA 4WIPA 2NS5A 1SIJA 2ZZPB 3B2GA 1Y56A 2B76B 1OQRA 3SR6A 3BIID 4RM9A 5HI1A 3ZUNA 1C1YB 1C4CA 3SU8X 1I4GA 3PO0A 3KUZA 1YN4A 3D32A 3UGBB 1TKGA 1R4MI 4JQWC 1OQYA 1WGDA 2CJNA 4C4VB 1WR6E 5IAAC 3GE3C 3U7ZA 2V0GA 3O13A 4ZOHC 3ZTCA 1I4RA 3NVWA 1YD8U 4EEWA 4RF0A 2WXNA 4C56C 2XK5A 1WE6A 2EMSA 2AWTA 1K51A 5TSSA 1CMXB 2D2QA 2IGGA 3TL5A 2PTLA 2JPHA 2KWCA 3QAQA 2GMIC 1YQ3B 2K22A 3PRMB 3JSVA 2LASA 3RN9C 2MEKA 4GOCA 4B9KA 3CSTA 4G50A 2AEHA 1KLUD 3DDCB 3TJPA 3ZNID 1MG8A 3VR9B 2JUOA 3I3TB 2L00B 2D3AA 4ZYNA 3FILA 3V62A 4J6IA 2WXQA 2CS4A 4HJKA 4GDLB 1IYFA 5JXVA 1Z5SB 2MLBA 2WXPA 1K53A 1FRDA 4ANWA 2NTTA 3DBRI 3L08A 4EKUA 2PPHA 3PV1A 2KC1A 1CQVA 4MJSB 4MJSA 4ZRIA 1KLVA 4GU2A 5IA7A 2GB1A 3EFUA 1HEZE 5AEKB 5C23A 3SDLC 3OWEB 1VLBA 4FJVB 2AX5A 1XXGA 5FK9C 2RD0A 4OZBA 2JSVX 1I42A 4MSMB 1NYQA 1F9JA 2N9LA 4YT0B 1SEBD 2JX5A 1D4BA 4BKSD 2LI5A 3H9DA 3KH0A 2NVUI 2OEDA 3A4RA 3TEXA 2NBWB 3J9CA 1T0YA 4I6LB 3Q8FA 3AEGB 2W3RA 5C1ZA 2MBHA 2WDRB 3RZWC 1DOIA 2NCNA 2FIDA 3AEFB 1UGMA 2KDIA 4KGTA 2KX0A 3A9JB 2WXOA 4W9CA 1JROA 2DBYA 2WLBA 1JW9D 4M01A 4C4VA 4MM3B 2GBRA 4ARCA 3RMKC 1EWCA 4JL9A 3L17A 2GBJA 2FCQA 4HPLB 1E6EB 3AI5A 2INPE 1OEYA 3PRZA 3CSFA 3M63B 4B95A 1XO3A 3AE3B 2ZNVC 4OVUA 1R4MB 4NNJB 2WWZA 4NAWA 2TSSA 3V61A 3N32A 5D7GA 1UZXB 4C00A 2D11A 3V05A 1QILA 4EE2A 2K6QA 3Q8BA 1YIWA 1FXTB 4WURA 1N60A 1XEEA 2K8CA 3AN1A 3I57A 2DENB 1RFKA 3ZW3A 3FILB 1TKYA 1YN5A 3E56A 4USAA 2J52A 2O6VD 2PE9A 3A4SC 2WXMA 3TIXA 3Q6BA 1PGXA 1RRBA 1UGJA 4A3OA 1WSPA 1TS2A 2UYZB 2JWUA 2LD9A 1TZ1A 5EE9A 3ZIMA 2L7RA 4HXDA 1ET6A 1E8ZA 4S17A 1RLFA 1WI0A 4WQOB 2EELA 1UF0A 4AUQC 1ENFA 2N9PC 3RNAC 5BYSA 3MHSD 1FD6A 1PGAA 3MJWA 1IGCA 3VQIA 5C3JB 2G4DB 1I4PA 2DAJA 2GOWA 4ZRQA 2O6VA 4DHJD 4URKA 1IPGA 1WZ0A 2MHJA 1UNSA 1TGZB 2Q5WD 2XEWA 1ZKHA 4M02A 4XYCA 1ZPSA 1L0XB 1TY0A 1SXTA 1G6JA 2PW9A 2HJ1A 3Q3OC 2O2VB 4QAYA 3AE9B 3KW5B 2BF8B 2OHFA 4MGKE 2V4IB 4XWTA 2DHZA 4GXBA 2PEAA 4NAMA 1V8CA 3IAS1 4F7ZA 3GZNB 4IKGA 2J53A 2PE6B 4XE0A 5DPWA 2MBQA 1DOXA 4XDCA 1L7YA 2DZKA 4ZRKA 2NR2A 3AEBB 2HD5B 1DOYA 1T3QA 3W1YA 2RPVA 3HK0A 3VH4B 3HHMA 4ASWC 2IZVB 5AUKA 3APFA 3PHXB 2E3TA 1ESFA 3C0RB 3AE1B 2C60A 4LJPB 2N9KA 3QARA 4HDOA 1WXMA 3BVMA 1BMLC 2WX0A 3GP7A 1EWYC 2NPTB 2LMCA 2LGDA 4TUUA 1CJEA 2I1KA 2JXXA 1FFUA 3VUYA 3I63C 3QCAA 3LDZE 1WE7A 1IGDA 1TS4A 4YSXB 2RPQA 1Q10A 2WDVB 1KH0A 2Z0DB 3DWMA 1FO4A 4XZ4A 3ZXRA 1E8WA 1J8CA 3JVZX 3R66C 1E8YA 2BT6A 1QLBB 2PMVA 3L16A 1WF9A 3H7PB 2A5UA 4IWQA 2OJRA 2MBBB 1JRUA 2LJIA 4N9F4 3M3JA 1WGKA 1BUIC 4TSSA 4P1CC 3KWLA 4WWNA 3RULA 2M1MA 4YTPB 1QOAA 3ABVB 3HRDD 1XT9B 1FFVA 4GIVA 4L2YA 4RFBA 3T8MA 1JWUD 2QC8A 3HM3A 1CK1A 2ICIA 1FNUA 1MI0A 1N6ZA 1B1ZA 1Z2MA 2IY0B 2KT7A 1L0VB 2KQSA 1OGWA 2L0TA 1EM7A 4FJZA 3AEAB 2KXJA 2BWFA 1WWTA 5AZGA 2KWVB 2M56B 2WS3B 3A9KB 1WJNA 2D5GA 1WMHA 1V97A 2R61A 1R4NI 3KUDB 1K50A 4RH6A 3QK0A 2K39A 3QIJA 4MGYE 1GB4A 4K3CA 3QJZA 1FNWA 4JE3B 4US9A 3UI3A 2YEPB 3TSSA 4BOSC 3Q8EA 1WH3A 4DXFA 3AB5A 3ETRA 1SF0A 2WGSA 4WAAA 1VJKA 1GOZA 4ACFA 2LHEA 2KACA 4GMVA 4MSQB 3N3KB 4RGNA 1UWXA 5FR6A 1D5XC 3PLVA 5FKAC 1PGBA 2AL3A 3VH3B 1HTQA 1KOTA 3U2SC 2ASQA 4K7WA 1VD2A 1VZ6A 3RNBC 4F8CB 1MHXA 4LNFA 4K81A 5CX3A 4JLCA 1L4DB 4HEA1 1EF1A 3B2FA 3CWIA 4MH8A 4OHJA 2JT4B 1IBXB 4PT5A 1VZ7A 3ZJUA 4I6PA 1RM6C 1RWSA 1OTRB 3RNCC 2N9XA 3P4PB 3WAMA 1MVKA 4W9GA 1WR1A 3T9LA 2M0AA 4MM3A 5FR3A 1PYWD 1FM0D 4A55A 3NS8A 2L8JA 2W3SA 5AUIA 2MBEA 2WU5B 2K6DB 2IO1B 2IDYA 4IM2A 3Q3NC 3VRAB 3W5VB 5J18A 4FHKA 2BS3B 1ZDVA 1YQBA 3AH7A 1NEKB 2BPSA 4GN1A 3B0AA 2RDHA 3AE4B 2JQRB 2BKFA 2D3CA 3PZ7A 1B9RA 1TT5B 3CIRB 4XWWA 2X8XX 1FEHA 2Z59B 3ZNHB 1M94A 1XCQL 4M0WB 4HRSA 3NS1A 3PTFC 3LXFA 1SJHD 2N7JA 1JCKB 4BOZB 3PT2B 1RFAA 1KFYB 3MC0B 1C9FA 2KO3A 3Q2AC 1PQSA 2REXA 5MPOA 5HHDG 2INNE 1CZPA 4FA6A 4JWUC 3VFKA 2INCC 3QWZB 1NDDA 3ZYYX 2DZMA 3IT6B 4RNAA 3NOBA 2IGDA 1UH6A 4GDLA 2FIFA 3IBEA 2ACZB 2FCNA 3ZNGC 4YSZB 3NZSA 2VH2A 1D5MC 2CHZA 3P1MA 2C9WB 1GC7A 2C7NB 1UUPA 1YNTE 4R3DA 3DHHC 2ZVOA 3IHPC 4FULA 1GG3A 5BO4B 3TCAA 1MFWA 2E6XA 3Q3MC 3UF8A 1ZW7A 4BAXA 5E6JA 1IUEA 3I5JC 2JU6X 5G2NA 1EO6A 4W9LA 2LFIA 2M8SA 4PS3A 1SE4A 4MELA 4W9FA 5EDSA 2BBCA 2KKCA 2KYWA 2KVRA 2L83A 4XX5A 1QF6A 3DVGX 4ZDVA 3DQVA 1WXAA 3S2AA 3AXCA 2N1VA 2M19A 2K5PA 4HKQA 3JSVB 3ZQ4A 4LDTB 4AJWA 1IBXA 2ON8A 2BVCA 3AE8B 2K25A 3SFDB 3P4QB 4NPNA 4EZKA 4DHZB 1QQRA 2J0JA 4G3XB 4OZCA 1NI3A 1FCLA 2PJHA 5G5GA 3RYTA 4W9HA 3VXWA 5HKHA 2KJRA 3AE2B 4KIKB 4F1SA 2LUMA 1U4AA 2MSED 3H7SA 4K7SA 2J0MA 3C19A 3R8BA 3EHVA 1QOBA 3EGRA 3DCGA 2R2QA 1MG4A 3WCQA 2I38A 4KKIA 3NVZA 5IO9A 2K1FA 2PVOD 2CHWA 2LVQA 3KYCD 2W55A 1I35A 2LGYA 2QHOA 1LO5D 1PDXA 1YJ1A 2GBNA 4YL8A 3VHTC 3W1SA 5BMHA 1UELA 2RMMA 2I2YA 5GXGB 1X1MA 3TEWA 5HG2A 2BS4B 4RF1A 2L1AA 4DK5A 2G4SA 1UBIA 2Y5BB 1ZOYB 1I4QA 2J42A 3HUIA 2KTRA 2LWPA 5DPRA 2MQJA 4X57B 4BKGA 2WXGA 1FIQA 3FAHA 3MC8A 2BYFA 3DBLI 1C76A 3RNFC 4ARIA 1YQ4B 1VCBA 2NMQA 4YXDB 2D10A 3HVDA 1T5XD 2MP2A 4W9IA 1WFYA 1XF5L 2KANA 2G45B 2NPTA 3JW0X 4O1NA 1FPYA 4WWOA 2LJ5A 3HM6X 4L1BA 4PYUA 4ICUA 1WX9A 2QIEB 3EC8A 3NVYA 4HLEA 1LGRA 2VRRB 3I9V1 3NHEB 4N59A 3JYUA 4BKSA 2WXFA 3RNEC 2RSUA 1J7CA 5EE1A 3WAOA 4P7IA 4RGOS 2BKRB 1SE3A 1TZOA 4FJYA 4LNIA 3OJ4B 1D5ZC 1FXIA 4KSLC 1YMHE 2I1JA 1J7AA 3ZDMC 4ANXA 1RAXA 4GB9A 3Q8CA 3N9YC 2G3QB 1V81A 1LXDA 2K9XA 2Z8LA 2FUHB 4G0NB 2WXJA 1H8CA 1N62A 3E9SA 1FMAD 2IJ0A 5C2TB 1WYWB 1WJUA 3C8YA 2KQ4X 3TBLD 4A90A 1TTNA 4AOFA 5L83A 3M95A 5LLIA 3PHWB 2FUG1 4W9DA 4Q2JA 5EE3A 3TEYA 1AYFA 3Q69A 3GB1A 3K9PB 3QA8A 1V1PA 2JZZA 2K8HA 2RDBC 1UBQA 1JQ4A 1QOGA 1SB3C 3ZTDA 2V3PA 1N63A 4DHJB 3PZDA 2HJ8A 4DXAB 2N4FA 4WJQA 2KAJA 3Q8AA 2G1EA 2LVPA 4B0EA 1GAQB 3P63A 1AN8A 4E3CA 1ISNA 2CU1A 3TUOA 3B08A 2IY1B 2WU2B 5IOIA 3MJ5A 1BXTA 4NQLB 2KDEB 2BW2A 1V6EA 3P42A 3AE6B 1WM2A 4C80A 3NVVA 3ZRFA 5AZHA 4CHKA 2LHDA 4ZYSA 2DWQA 1TIFA 2ZW0A 5KHOA 1HTOA 2YVCA 1E7VA 2KDMA 2UU7A 2QSDA 1KF6B 2Z0EB 1V5OA 4LCDE 1MPEA 3NY5A 1GNUA 2OOBB 4DWFA 4NAWB 3VR8B 1EF5A 2Y5CA 3V3XA 2BWES 2WXKA 3IT4B 2Y3AA 2O2VA 3X23A 4BKTA 2KWDA 1A70A 1SE9A 2H88B 2J7QB 3MC9A 1AWDA 2PKOA 3BVZA 2QEJC 4HVBA 1TKEA 4GDKA 1E7UA 3L10B 2ZPYA 1SGHA 4WAFA 2KVZA 5GMVA 1ZGUB 3QC8B 1JWSD 2N7EA 1D3ZA 3DHIC 1SSNA 2WXRA 4DHZE 5J17A 1L5PA 2N0SB 1V2YA 4HWIB 4WJNA 4NQKE 2KTFA 4KZ0A 1Q1OA 3ZDTA 3ECIA 2JF5A 2X38A 3M62B 5D2MB 1P7EA 4WJPA 1ZE3D 4IDIA 1WGRA 4FXCA 4HPPA 3ZO5B 2G9HD 4IUMB 2GRIA 4P16A 1Q5WB 2LZ6A 1F52A 2NBUA 3WANA 2V3NA 2BGFA 1SBBB 3IAM1 3L4PA 2M0XA 3PZ8A 4IOIE 2AYOB 3KQ4A 1KLGD 2JVCA 3HVZA 2WDQB 1YX6B 1WJ6A 2DNFA 3AV8A 4A3PA 4AQ7A 2N9EB 3VTUA 1WX8A 3OLMD 4YTNB 1A5RA 1UWMA 2BYTA 3RNGC 1BT0A 2JXTA 3DHGC 2L0FA 4MACA 1TY2A 3W9CB 3R2TA 2BS2B 1LM8B 1I7HA 4C7YA 4RMAA 1WJ4A 3QX1A 4JX1C 4TV3A 4CO7A 3PRPB 2KN5A 3MP9A 3ML8A 3NZ3A 2BTEA 5IP4D 2KN4A 4EUTA 2KDBA 2WXIA 2XBBC 3ZJTA 1OFFA 1EU3A 3EFCA 2WP9B 4FBJB 2RGFA 2BB6A 3GE8C 3OAWA 1P9DU 5D94A 4FADA 1E9MA 1WGYA 3DBSA 3Q3JA 3ZGZA 3ZLZA 2EKIA 2GBKA 3LB8C 4KDLB 4KVGB 4W9EA 1WMHB 2K8BA 4BVUC 4RM8A 4BBNC 3BVGA 3PSEB 2MJ3A 1E0ZA 1XLNA 3PLUA 2ZVNA 2K0PA 3BYTB 2QCZA 2KOXA 5KHQA 3R7RA 3O65B 4TQ0A 2XNAC 1OQQA 2KX3A 2BQQA 1ACCA 1JWMD 2WQYB 4N6EB 2JYTA 1WXQA 5BMGA 1HZ6A 5TR5A 2ZEQA 4E74A 2V4LA 2KMMA 3W5UB 2PVGC 1F77A 2L32A 4JPSA 4OVVA 3P2BA 1WXSA 2HE7A 5D3DA 1J19A 3DBLB 1C78A 1T0RC 2UWQA 3BY4B 1SIFA 2LRWA 4JIOU 4NJ7A 4DBGA 3LJ3A 2JRIB 3HIZA 1XLOA 3R2IA 2A4ZA 2BB5A 2BYEA 2KFKA 4GGQA 4J3OD 4MGIE 3VVWB 2WNMA 2DYBA 3B9JA 3DVNU 2WX1A 1QZEA 3IVFA 4TQ1A 2KLGA 1T0QC 2ZJDA 4NJ6A 3AMZA 5HFYA 4YTMB 3X0WA 2PIAA 2MP2B 2AQ2B 1HQRD 3H8HA 3L0WB 4A9AA 1L6VA 2KK8A 4W9KA 2KWUB 2L76A 4K1RB 2KFKB 4IWPA 3KVFB 2KJ6A 4E71A 4S0RA
chains in the Genus database with same CATH topology
1WXMA 3CF6E 1VCBA 3R7QA 3H6NA 2WX0A 2D10A 4WJOA 2NPTB 4IWOA 2LGDA 3AU5A 1E90A 2DX5B 4TUUA 2MP2A 3L13A 2I1KA 4W9IA 2KC2A 1WFYA 2JXXA 2KANA 4MEMA 1XQQA 1C3TA 2G45B 2FAZA 2NPTA 3JW0X 3RZFA 3VUYA 2KHWB 2GBMA 1Q0WB 2D3GA 2DZIA 4WWOA 2LJ5A 3HM6X 4PYUA 3QCAA 3LDZE 4ICUA 1WE7A 5J2RA 3RT3B 1WX9A 2IBIB 2ZCBA 2RPQA 2JWZA 3EC8A 3UQAA 3PS6A 3ZNZB 4HCNB 2LGXA 4FLHA 2Z0DB 4HLEA 4XZ4A 1E8WA 1J8CA 2VRRB 3NHEB 3OJ3A 3VTVA 3JVZX 3JYUA 3R66C 4BKSA 4II3B 1K8RB 2RSUA 1E8YA 3WAOA 3N30A 3L16A 4W9JA 2J0KA 4P7IA 3AULA 2BKRB 4EOYA 1WF9A 1HE8A 4FJYA 3OJ4B 3H7PB 3TMPB 2A5UA 4IWQA 2OJRA 1OEYJ 4KSLC 2CHXA 2MBBB 3ZDMC 1JRUA 2I1JA 3U7DA 2FCSA 1WXVA 4ANXA 4N9F4 3M3JA 1RAXA 3A33B 4GB9A 1KJTA 2M17A 1P0RA 2XK5B 4IM3A 2KQ7A 1KM7A 4WWNA 2G3QB 2MCNB 1V81A 3RULA 3U30A 1LXDA 5CTRC 3VDZA 4ANVA 2M1MA 2O6VB 2FUHB 4G0NB 4BFRA 1H8CA 4TKNA 3APDA 4KV2A 4A20A 4BBNF 2MBOA 1XT9B 4GIVA 1WYWB 3V60A 1WJUA 2C7HA 2N1WA 3TBLD 3T8MA 1TTNA 4FN2A 3HM3A 4AOFA 5L83A 2KTRB 4HDQA 3M95A 4EFOA 4LDTD 1Z2MA 2IY0B 3SHQA 5LLIA 3EECA 3PHWB 3A1QB 2KQSA 3UIPB 4W9DA 2KJHB 2HTHA 3U8ZA 1OGWA 2FCMA 2L0TA 5LXHA 1WRDB 5JHAA 3VUXA 2DYOA 1WGGA 2WYQA 3K9PB 4FJZA 3QA8A 2KXJA 3L54A 2BWFA 5AZGA 2KWVB 2KZRA 3VUWA 3A9KA 2JZZA 2K8HA 1UBQA 2NS5A 3A9KB 1WJNA 5JH5C 2ZPNA 3ZTDA 2ZZPB 1WMHA 3PVLA 1R4NI 4DHJB 2RR9A 3PZDA 2HJ8A 3KUDB 3DOWA 3QK0A 1H4RA 3V6EB 4DXAB 2FNJB 2K39A 2N4FA 3QIJA 4MGYE 2LVPA 1NI2A 3Q3FA 4RM9A 4WJQA 4DDID 1WIAA 3QJZA 3ZUNA 1C1YB 3A1QA 3PGEA 4E3CA 2LRUA 3SU8X 5DCNA 1ISNA 4BOSC 2MA9B 4HCPB 2CU1A 3B08A 2IY1B 3KUZA 1WH3A 3D32A 3ENEA 3UGBB 2V1YA 1R4MI 1EUVB 4JQWC 1OQYA 1WGDA 4NQLB 2KDEB 4KIKA 1WR6E 5IAAC 2YLMA 1V6EA 3B1LX 2MWSB 4WAAA 3ZTCA 4IW0A 1YD8U 4EEWA 4PS7A 4IC7B 1WM2A 1YX5B 2JZ3B 2XK5A 1WE6A 2EMSA 2AWTA 3PREA 1CMXB 3ZRFA 2D2QA 1V9JA 4GMVA 4MSQB 4WWPA 1GUAB 1WM3A 5AZHA 3TL5A 3N3KB 4CHKA 1Y8RC 1P3QU 5FR6A 3PLVA 3APCA 2JPHA 2IO0B 2IYDB 2KWCA 3H7PA 1WGHA 2GMIC 3QAQA 3DBHI 2AL3A 3PRMB 3VH3B 5DPTA 5KHOA 3JSVA 1UD7A 4IM0A 2YVCA 1E7VA 1KOTA 2LASA 4G11A 3RD2A 2ASQA 4K7WA 1VD2A 2Z0EB 3ONSA 1V5OA 4F8CB 4LCDE 4GOCA 3NY5A 1WX7A 4K81A 1GNUA 2OOBB 2IO3B 3CSTA 4G50A 4KSKC 5CX3A 2AEHA 4B9KA 4DWFA 1LQBA 4JLCA 3DDCB 4NAWB 3TJPA 1EF5A 3ZKJC 2MX2A 3ZNID 1MG8A 1EF1A 2JUOA 4M8NA 2BWES 3I3TB 2L00B 2D07B 4ZYNA 2O2VA 3V62A 4J6IA 3X23A 2JT4B 4BKTA 4ANUA 4MDKE 1J0GA 2CS4A 4II2B 1SE9A 4HJKA 4HK2A 4I6PA 1OTRB 4GDLB 1IYFA 2N9XA 5E6NA 2J7QB 1Z5SB 2MLBA 3WAMA 1V49A 4W9GA 4HVBA 4GDKA 5DPSA 1E7UA 3NZUA 3L10B 3SD5A 1WR1A 4ANWA 3DBRI 2R2OA 3L08A 4MM3A 2ZPYA 3T9LA 4EKUA 2PPHA 3PV1A 3WALA 1SGHA 2KC1A 4AJYB 4MJSB 2EMTA 2CR5A 5CHFA 4MJSA 4GSWA 4ZRIA 1KLVA 3NS8A 4GU2A 5GMVA 1ZGUB 5AZFA 2ZNVB 2L8JA 5IA7A 3QC8B 3UQBA 3EFUA 2DAFA 5AEKB 2MBEA 2N7EA 5C23A 1D3ZA 3SDLC 2L3ZA 2K6DB 2IO1B 4DHZE 5J17A 5L95C 4IM2A 3DPDA 4FJVB 1XD3B 2LXAA 1P98A 1V2YA 4HWIB 4WJNA 4NQKE 2RD0A 4FHKA 5J18A 2KTFA 4KZ0A 1I42A 3UINB 4MSMB 1F9JA 1Q1OA 3ZDTA 3ECIA 2JF5A 1YQBA 3M62B 5D2MB 4WJPA 2KMAA 1WGRA 2BPSA 4LJOB 4GN1A 4BKSD 3B0AA 2LI5A 3H9DA 3KH0A 2NVUI 3ZO5B 1V86A 2BKFA 3A4RA 4IUMB 3GOEA 2NBWB 5JHBA 2V3SA 5D6JB 1T0YA 2LUEA 1Q5WB 2MRPA 2LZ6A 4I6LB 4PYZA 2NBUA 2KMCA 3WANA 3GZNI 5C1ZA 2MBHA 3RZWC 2Z59B 4FHJA 2C5LC 2NCNA 3ZNHB 1IP9A 1M94A 2BGFA 3CMMB 2FIDA 2WDTB 4M0WB 2M0XA 1UGMA 2KDIA 2AYOB 3PTFC 1GJZA 2JVCA 1YX6B 4BOZB 3ZVVA 3PT2B 2LXCA 1WJ6A 1RFAA 2KX0A 4A3PA 3A9JB 2N9EB 4PS8A 4W9CA 1TBEA 2KO3A 1WX8A 3VTUA 2BYVE 1PQSA 3OLMD 1A5RA 3QHTA 3MTNB 2REXA 4FA6A 2C7MB 2LVOA 3QQ8B 3VFKA 1BT0A 3QWZB 3DVGY 1NDDA 2GBRA 2ZCCA 2DZMA 2L0FA 4JL9A 3L17A 1NBFC 2GBJA 3NOBA 2FCQA 4HPLB 2L05A 2JY6A 1UH6A 1LM8B 4GDLA 2FIFA 3IBEA 3AI5A 3K9OB 4M8MA 1OEYA 2FCNA 3PRZA 3CSFA 3ZNGC 1S1QB 3NZSA 4RMAA 2M4NA 1WJ4A 2CHZA 3M63B 4B95A 3QX1A 2W9NA 1AARA 2C9WB 5CHWA 2ZNVC 4TV3A 2NBVB 4OVUA 1GC7A 4NNJB 2C7NB 2WWZA 3RCZA 4CO7A 4NAWA 2MW5A 3PRPB 2KDFB 3V61A 2KN5A 3ML8A 3N32A 4EUTA 2KDBA 2XBBC 2ZVOA 3IHPC 5D7GA 1UZXB 5LXIB 2D11A 4FULA 1GG3A 5BO4B 3TCAA 3VTWA 2K6QA 5JZEB 1YIWA 3KYDD 1FXTB 3UF8A 1ZW7A 4FBJB 2RGFA 1GC6A 4HPMB 3WIMA 2K8CA 5G2NA 1EO6A 5D94A 3OAWA 1P9DU 4FADA 4W9LA 1WGYA 3DBSA 3Q3JA 3ZLZA 2DENB 2M8SA 3ML9A 4PS3A 4MELA 4W9FA 5EDSA 3ZW3A 2KKCA 2DYMA 2GBKA 2KVRA 4XX5A 2AL6A 2O6VD 3DVGX 2PE9A 4KDLB 4KVGB 4W9EA 1WMHB 2K8BA 5E6OA 3UIOB 3A4SC 4BVUC 4ZDVA 3TIXA 4IG7B 3DQVA 2B3AA 1RRBA 4JGHB 1WXAA 4RM8A 4A3OA 4BBNC 3PSEB 3A9JA 2UYZB 3S2AA 2LD9A 4B6WA 3AXCA 1TZ1A 3PLUA 2N1VA 2ZVNA 4XC2A 3ZIMA 2L7RA 4HXDA 2KOXA 3JSVB 1E8ZA 4ZRJA 1RLFA 1WI0A 2N7DA 4LDTB 2KFJA 4AJWA 4WQOB 5KHQA 3R7RA 3O65B 3R3MA 1WY8A 4TQ0A 4AUQC 4KDIC 2N9PC 2K25A 2EKEC 4NPNA 4EZKA 4DHZB 2KX3A 3MHSD 5CHVC 3PPAA 2J0JA 4AP4C 4MGZE 4G3XB 3RUIB 3DVNV 3MJWA 2KD0A 2DZJA 4CYEA 1WZ3A 3VQIA 5TR5A 2ZEQA 4E74A 3H1UA 2G4DB 2V4LA 2DAJA 2GOWA 1E8XA 2PJHA 5G55A 3AU4A 2O6VA 2KLCA 4DHJD 3IG3A 4W9HA 3RYTA 3VXWA 3IFWB 4DDGD 2KJRA 4URKA 5HKHA 1IPGA 3WA0A 4KIKB 1WZ0A 4F1SA 1S3SG 1U4AA 2JRHA 1WXSA 1E5WA 2MSED 3P2BA 4OVVA 1TGZB 2HE7A 3H7SA 3V6CB 5E6PA 1J19A 4GDKB 4K7SA 2J0MA 2XEWA 1ZKHA 4AWJA 3EHVA 1L2NA 3DCGA 4ICVA 4K7UA 1V5TA 3WAPA 2R2QA 2UWQA 3ALBA 3ZRCA 3BY4B 4I6NB 4KZCA 4NY0A 1SIFA 2LRWA 1G6JA 4JIOU 4NJ7A 4DBGA 3LJ3A 2K1FA 2JRIB 3HIZA 2O2VB 1P1AA 2CHWA 2A4ZA 3KW5B 2LVQA 3KYCD 1I35A 2BYEA 2KFKA 2BF8B 2LGYA 4GGQA 2QHOA 4MGIE 4MGKE 3VAWA 1YJ1A 3VVWB 2GBNA 2DYBA 3KUCB 2DHZA 3DVNU 4GXBA 2WX1A 2PEAA 4YL8A 1QZEA 3VHTC 2CKHB 3W1SA 3IVFA 4TQ1A 4F7ZA 1UELA 2KLGA 4EZJA 3BINA 2PE6B 2IO2B 1X1MA 2ZJDA 4NJ6A 5DPWA 2MBQA 4DK5A 1L7YA 2G4SA 3W1SC 2DZKA 4ZRKA 1UBIA 3X0WA 1V80A 2Y5BB 2NR2A 2KNBA 2MP2B 2HD5B 2KTRA 2LWPA 1LFDA 3W1YA 3HK0A 3L0WB 5DPRA 2MQJA 4X57B 3VH4B 3HHMA 4BKGA 2KK8A 4ASWC 2IZVB 2KWUB 2L76A 3APFA 4W9KA 4K1RB 2KFKB 4MH0E 4IWPA 3PHXB 4EZLA 3KVFB 3C0RB 2KJ6A 2C60A 4LJPB 3QARA 2BYFA 4E71A 3DBLI 4HDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WXM A;  3CF6 E;  1VCB A;  3R7Q A;  3H6N A;  2WX0 A;  2D10 A;  4WJO A;  2NPT B;  4IWO A;  2LGD A;  3AU5 A;  1E90 A;  2DX5 B;  4TUU A;  2MP2 A;  3L13 A;  2I1K A;  4W9I A;  2KC2 A;  1WFY A;  2JXX A;  2KAN A;  4MEM A;  1XQQ A;  1C3T A;  2G45 B;  2FAZ A;  2NPT A;  3JW0 X;  3RZF A;  3VUY A;  2KHW B;  2GBM A;  1Q0W B;  2D3G A;  2DZI A;  4WWO A;  2LJ5 A;  3HM6 X;  4PYU A;  3QCA A;  3LDZ E;  4ICU A;  1WE7 A;  5J2R A;  3RT3 B;  1WX9 A;  2IBI B;  2ZCB A;  2RPQ A;  2JWZ A;  3EC8 A;  3UQA A;  3PS6 A;  3ZNZ B;  4HCN B;  2LGX A;  4FLH A;  2Z0D B;  4HLE A;  4XZ4 A;  1E8W A;  1J8C A;  2VRR B;  3NHE B;  3OJ3 A;  3VTV A;  3JVZ X;  3JYU A;  3R66 C;  4BKS A;  4II3 B;  1K8R B;  2RSU A;  1E8Y A;  3WAO A;  3N30 A;  3L16 A;  4W9J A;  2J0K A;  4P7I A;  3AUL A;  2BKR B;  4EOY A;  1WF9 A;  1HE8 A;  4FJY A;  3OJ4 B;  3H7P B;  3TMP B;  2A5U A;  4IWQ A;  2OJR A;  1OEY J;  4KSL C;  2CHX A;  2MBB B;  3ZDM C;  1JRU A;  2I1J A;  3U7D A;  2FCS A;  1WXV A;  4ANX A;  4N9F 4;  3M3J A;  1RAX A;  3A33 B;  4GB9 A;  1KJT A;  2M17 A;  1P0R A;  2XK5 B;  4IM3 A;  2KQ7 A;  1KM7 A;  4WWN A;  2G3Q B;  2MCN B;  1V81 A;  3RUL A;  3U30 A;  1LXD A;  5CTR C;  3VDZ A;  4ANV A;  2M1M A;  2O6V B;  2FUH B;  4G0N B;  4BFR A;  1H8C A;  4TKN A;  3APD A;  4KV2 A;  4A20 A;  4BBN F;  2MBO A;  1XT9 B;  4GIV A;  1WYW B;  3V60 A;  1WJU A;  2C7H A;  2N1W A;  3TBL D;  3T8M A;  1TTN A;  4FN2 A;  3HM3 A;  4AOF A;  5L83 A;  2KTR B;  4HDQ A;  3M95 A;  4EFO A;  4LDT D;  1Z2M A;  2IY0 B;  3SHQ A;  5LLI A;  3EEC A;  3PHW B;  3A1Q B;  2KQS A;  3UIP B;  4W9D A;  2KJH B;  2HTH A;  3U8Z A;  1OGW A;  2FCM A;  2L0T A;  5LXH A;  1WRD B;  5JHA A;  3VUX A;  2DYO A;  1WGG A;  2WYQ A;  3K9P B;  4FJZ A;  3QA8 A;  2KXJ A;  3L54 A;  2BWF A;  5AZG A;  2KWV B;  2KZR A;  3VUW A;  3A9K A;  2JZZ A;  2K8H A;  1UBQ A;  2NS5 A;  3A9K B;  1WJN A;  5JH5 C;  2ZPN A;  3ZTD A;  2ZZP B;  1WMH A;  3PVL A;  1R4N I;  4DHJ B;  2RR9 A;  3PZD A;  2HJ8 A;  3KUD B;  3DOW A;  3QK0 A;  1H4R A;  3V6E B;  4DXA B;  2FNJ B;  2K39 A;  2N4F A;  3QIJ A;  4MGY E;  2LVP A;  1NI2 A;  3Q3F A;  4RM9 A;  4WJQ A;  4DDI D;  1WIA A;  3QJZ A;  3ZUN A;  1C1Y B;  3A1Q A;  3PGE A;  4E3C A;  2LRU A;  3SU8 X;  5DCN A;  1ISN A;  4BOS C;  2MA9 B;  4HCP B;  2CU1 A;  3B08 A;  2IY1 B;  3KUZ A;  1WH3 A;  3D32 A;  3ENE A;  3UGB B;  2V1Y A;  1R4M I;  1EUV B;  4JQW C;  1OQY A;  1WGD A;  4NQL B;  2KDE B;  4KIK A;  1WR6 E;  5IAA C;  2YLM A;  1V6E A;  3B1L X;  2MWS B;  4WAA A;  3ZTC A;  4IW0 A;  1YD8 U;  4EEW A;  4PS7 A;  4IC7 B;  1WM2 A;  1YX5 B;  2JZ3 B;  2XK5 A;  1WE6 A;  2EMS A;  2AWT A;  3PRE A;  1CMX B;  3ZRF A;  2D2Q A;  1V9J A;  4GMV A;  4MSQ B;  4WWP A;  1GUA B;  1WM3 A;  5AZH A;  3TL5 A;  3N3K B;  4CHK A;  1Y8R C;  1P3Q U;  5FR6 A;  3PLV A;  3APC A;  2JPH A;  2IO0 B;  2IYD B;  2KWC A;  3H7P A;  1WGH A;  2GMI C;  3QAQ A;  3DBH I;  2AL3 A;  3PRM B;  3VH3 B;  5DPT A;  5KHO A;  3JSV A;  1UD7 A;  4IM0 A;  2YVC A;  1E7V A;  1KOT A;  2LAS A;  4G11 A;  3RD2 A;  2ASQ A;  4K7W A;  1VD2 A;  2Z0E B;  3ONS A;  1V5O A;  4F8C B;  4LCD E;  4GOC A;  3NY5 A;  1WX7 A;  4K81 A;  1GNU A;  2OOB B;  2IO3 B;  3CST A;  4G50 A;  4KSK C;  5CX3 A;  2AEH A;  4B9K A;  4DWF A;  1LQB A;  4JLC A;  3DDC B;  4NAW B;  3TJP A;  1EF5 A;  3ZKJ C;  2MX2 A;  3ZNI D;  1MG8 A;  1EF1 A;  2JUO A;  4M8N A;  2BWE S;  3I3T B;  2L00 B;  2D07 B;  4ZYN A;  2O2V A;  3V62 A;  4J6I A;  3X23 A;  2JT4 B;  4BKT A;  4ANU A;  4MDK E;  1J0G A;  2CS4 A;  4II2 B;  1SE9 A;  4HJK A;  4HK2 A;  4I6P A;  1OTR B;  4GDL B;  1IYF A;  2N9X A;  5E6N A;  2J7Q B;  1Z5S B;  2MLB A;  3WAM A;  1V49 A;  4W9G A;  4HVB A;  4GDK A;  5DPS A;  1E7U A;  3NZU A;  3L10 B;  3SD5 A;  1WR1 A;  4ANW A;  3DBR I;  2R2O A;  3L08 A;  4MM3 A;  2ZPY A;  3T9L A;  4EKU A;  2PPH A;  3PV1 A;  3WAL A;  1SGH A;  2KC1 A;  4AJY B;  4MJS B;  2EMT A;  2CR5 A;  5CHF A;  4MJS A;  4GSW A;  4ZRI A;  1KLV A;  3NS8 A;  4GU2 A;  5GMV A;  1ZGU B;  5AZF A;  2ZNV B;  2L8J A;  5IA7 A;  3QC8 B;  3UQB A;  3EFU A;  2DAF A;  5AEK B;  2MBE A;  2N7E A;  5C23 A;  1D3Z A;  3SDL C;  2L3Z A;  2K6D B;  2IO1 B;  4DHZ E;  5J17 A;  5L95 C;  4IM2 A;  3DPD A;  4FJV B;  1XD3 B;  2LXA A;  1P98 A;  1V2Y A;  4HWI B;  4WJN A;  4NQK E;  2RD0 A;  4FHK A;  5J18 A;  2KTF A;  4KZ0 A;  1I42 A;  3UIN B;  4MSM B;  1F9J A;  1Q1O A;  3ZDT A;  3ECI A;  2JF5 A;  1YQB A;  3M62 B;  5D2M B;  4WJP A;  2KMA A;  1WGR A;  2BPS A;  4LJO B;  4GN1 A;  4BKS D;  3B0A A;  2LI5 A;  3H9D A;  3KH0 A;  2NVU I;  3ZO5 B;  1V86 A;  2BKF A;  3A4R A;  4IUM B;  3GOE A;  2NBW B;  5JHB A;  2V3S A;  5D6J B;  1T0Y A;  2LUE A;  1Q5W B;  2MRP A;  2LZ6 A;  4I6L B;  4PYZ A;  2NBU A;  2KMC A;  3WAN A;  3GZN I;  5C1Z A;  2MBH A;  3RZW C;  2Z59 B;  4FHJ A;  2C5L C;  2NCN A;  3ZNH B;  1IP9 A;  1M94 A;  2BGF A;  3CMM B;  2FID A;  2WDT B;  4M0W B;  2M0X A;  1UGM A;  2KDI A;  2AYO B;  3PTF C;  1GJZ A;  2JVC A;  1YX6 B;  4BOZ B;  3ZVV A;  3PT2 B;  2LXC A;  1WJ6 A;  1RFA A;  2KX0 A;  4A3P A;  3A9J B;  2N9E B;  4PS8 A;  4W9C A;  1TBE A;  2KO3 A;  1WX8 A;  3VTU A;  2BYV E;  1PQS A;  3OLM D;  1A5R A;  3QHT A;  3MTN B;  2REX A;  4FA6 A;  2C7M B;  2LVO A;  3QQ8 B;  3VFK A;  1BT0 A;  3QWZ B;  3DVG Y;  1NDD A;  2GBR A;  2ZCC A;  2DZM A;  2L0F A;  4JL9 A;  3L17 A;  1NBF C;  2GBJ A;  3NOB A;  2FCQ A;  4HPL B;  2L05 A;  2JY6 A;  1UH6 A;  1LM8 B;  4GDL A;  2FIF A;  3IBE A;  3AI5 A;  3K9O B;  4M8M A;  1OEY A;  2FCN A;  3PRZ A;  3CSF A;  3ZNG C;  1S1Q B;  3NZS A;  4RMA A;  2M4N A;  1WJ4 A;  2CHZ A;  3M63 B;  4B95 A;  3QX1 A;  2W9N A;  1AAR A;  2C9W B;  5CHW A;  2ZNV C;  4TV3 A;  2NBV B;  4OVU A;  1GC7 A;  4NNJ B;  2C7N B;  2WWZ A;  3RCZ A;  4CO7 A;  4NAW A;  2MW5 A;  3PRP B;  2KDF B;  3V61 A;  2KN5 A;  3ML8 A;  3N32 A;  4EUT A;  2KDB A;  2XBB C;  2ZVO A;  3IHP C;  5D7G A;  1UZX B;  5LXI B;  2D11 A;  4FUL A;  1GG3 A;  5BO4 B;  3TCA A;  3VTW A;  2K6Q A;  5JZE B;  1YIW A;  3KYD D;  1FXT B;  3UF8 A;  1ZW7 A;  4FBJ B;  2RGF A;  1GC6 A;  4HPM B;  3WIM A;  2K8C A;  5G2N A;  1EO6 A;  5D94 A;  3OAW A;  1P9D U;  4FAD A;  4W9L A;  1WGY A;  3DBS A;  3Q3J A;  3ZLZ A;  2DEN B;  2M8S A;  3ML9 A;  4PS3 A;  4MEL A;  4W9F A;  5EDS A;  3ZW3 A;  2KKC A;  2DYM A;  2GBK A;  2KVR A;  4XX5 A;  2AL6 A;  2O6V D;  3DVG X;  2PE9 A;  4KDL B;  4KVG B;  4W9E A;  1WMH B;  2K8B A;  5E6O A;  3UIO B;  3A4S C;  4BVU C;  4ZDV A;  3TIX A;  4IG7 B;  3DQV A;  2B3A A;  1RRB A;  4JGH B;  1WXA A;  4RM8 A;  4A3O A;  4BBN C;  3PSE B;  3A9J A;  2UYZ B;  3S2A A;  2LD9 A;  4B6W A;  3AXC A;  1TZ1 A;  3PLU A;  2N1V A;  2ZVN A;  4XC2 A;  3ZIM A;  2L7R A;  4HXD A;  2KOX A;  3JSV B;  1E8Z A;  4ZRJ A;  1RLF A;  1WI0 A;  2N7D A;  4LDT B;  2KFJ A;  4AJW A;  4WQO B;  5KHQ A;  3R7R A;  3O65 B;  3R3M A;  1WY8 A;  4TQ0 A;  4AUQ C;  4KDI C;  2N9P C;  2K25 A;  2EKE C;  4NPN A;  4EZK A;  4DHZ B;  2KX3 A;  3MHS D;  5CHV C;  3PPA A;  2J0J A;  4AP4 C;  4MGZ E;  4G3X B;  3RUI B;  3DVN V;  3MJW A;  2KD0 A;  2DZJ A;  4CYE A;  1WZ3 A;  3VQI A;  5TR5 A;  2ZEQ A;  4E74 A;  3H1U A;  2G4D B;  2V4L A;  2DAJ A;  2GOW A;  1E8X A;  2PJH A;  5G55 A;  3AU4 A;  2O6V A;  2KLC A;  4DHJ D;  3IG3 A;  4W9H A;  3RYT A;  3VXW A;  3IFW B;  4DDG D;  2KJR A;  4URK A;  5HKH A;  1IPG A;  3WA0 A;  4KIK B;  1WZ0 A;  4F1S A;  1S3S G;  1U4A A;  2JRH A;  1WXS A;  1E5W A;  2MSE D;  3P2B A;  4OVV A;  1TGZ B;  2HE7 A;  3H7S A;  3V6C B;  5E6P A;  1J19 A;  4GDK B;  4K7S A;  2J0M A;  2XEW A;  1ZKH A;  4AWJ A;  3EHV A;  1L2N A;  3DCG A;  4ICV A;  4K7U A;  1V5T A;  3WAP A;  2R2Q A;  2UWQ A;  3ALB A;  3ZRC A;  3BY4 B;  4I6N B;  4KZC A;  4NY0 A;  1SIF A;  2LRW A;  1G6J A;  4JIO U;  4NJ7 A;  4DBG A;  3LJ3 A;  2K1F A;  2JRI B;  3HIZ A;  2O2V B;  1P1A A;  2CHW A;  2A4Z A;  3KW5 B;  2LVQ A;  3KYC D;  1I35 A;  2BYE A;  2KFK A;  2BF8 B;  2LGY A;  4GGQ A;  2QHO A;  4MGI E;  4MGK E;  3VAW A;  1YJ1 A;  3VVW B;  2GBN A;  2DYB A;  3KUC B;  2DHZ A;  3DVN U;  4GXB A;  2WX1 A;  2PEA A;  4YL8 A;  1QZE A;  3VHT C;  2CKH B;  3W1S A;  3IVF A;  4TQ1 A;  4F7Z A;  1UEL A;  2KLG A;  4EZJ A;  3BIN A;  2PE6 B;  2IO2 B;  1X1M A;  2ZJD A;  4NJ6 A;  5DPW A;  2MBQ A;  4DK5 A;  1L7Y A;  2G4S A;  3W1S C;  2DZK A;  4ZRK A;  1UBI A;  3X0W A;  1V80 A;  2Y5B B;  2NR2 A;  2KNB A;  2MP2 B;  2HD5 B;  2KTR A;  2LWP A;  1LFD A;  3W1Y A;  3HK0 A;  3L0W B;  5DPR A;  2MQJ A;  4X57 B;  3VH4 B;  3HHM A;  4BKG A;  2KK8 A;  4ASW C;  2IZV B;  2KWU B;  2L76 A;  3APF A;  4W9K A;  4K1R B;  2KFK B;  4MH0 E;  4IWP A;  3PHX B;  4EZL A;  3KVF B;  3C0R B;  2KJ6 A;  2C60 A;  4LJP B;  3QAR A;  2BYF A;  4E71 A;  3DBL I;  4HDO A; 
#chains in the Genus database with same CATH topology
 3EA6 A;  4PK1 A;  1DYQ A;  4H2A A;  3R7Q A;  1E90 A;  3U4E G;  1TYG B;  3L13 A;  2KC2 A;  5EE0 A;  4M00 A;  1C3T A;  3RZF A;  2FAZ A;  2KHW B;  4LLG M;  1Q0W B;  2DZI A;  4HJG E;  3RT3 B;  2IBI B;  2CJO A;  3ZNZ B;  4HCN B;  4FLH A;  3AE7 B;  2MJD A;  2MH7 A;  4NJC A;  1NVI D;  3OJ3 A;  3VTV A;  1K8R B;  2D3B A;  3NUH B;  3N30 A;  4W9J A;  3T3N A;  2AQ1 B;  3AUL A;  5BYQ A;  4EOY A;  1F1H A;  1HE8 A;  4N58 A;  3TMP B;  4B0M A;  1R7S A;  3T3O A;  1OEY J;  4L23 A;  3AED B;  3BK1 A;  2CHX A;  3NG0 A;  1AW7 A;  1WXV A;  1VZ8 A;  3IXS A;  1KJT A;  1V1P B;  4IM3 A;  2KQ7 A;  1KM7 A;  3U30 A;  3VDZ A;  2PLP A;  1E7P B;  4BFR A;  4TKN A;  1TS5 A;  3APD A;  2SAK A;  4KV2 A;  4A20 A;  2MBO A;  1N5W A;  3V60 A;  2N1W A;  4FN2 A;  4ITK A;  4HDQ A;  4OW0 A;  3N1X C;  3OG5 A;  4EFO A;  4LDT D;  3DBR B;  3UIP B;  1QT9 A;  2KJH B;  3NRZ A;  3MFG A;  5LXH A;  1WRD B;  2IGH A;  2W54 A;  4KGS A;  3VUX A;  5JHA A;  3SFE B;  2DYO A;  3VUW A;  3A9K A;  5JH5 C;  3FC4 A;  2ZPN A;  3PVL A;  1TS3 A;  2RR9 A;  4WQM A;  3DOW A;  3KWV A;  1H4R A;  3V6E B;  2FNJ B;  2IPK D;  2LEK A;  1NI2 A;  4DDI D;  3Q3F A;  1WIA A;  3A1Q A;  4DQO C;  3PGE A;  2LRU A;  2V9H A;  5DCN A;  2MA9 B;  4HCP B;  5BYR A;  3ZXV A;  3ENE A;  2V1Y A;  1EUV B;  2LGS A;  4KIK A;  2VZK B;  3URY A;  2YLM A;  3B1L X;  2MWS B;  4IW0 A;  4PS7 A;  1HA5 A;  4LNO A;  4IC7 B;  1YX5 B;  2JZ3 B;  2JZP A;  3BWU D;  3PRE A;  1V9J A;  4P1B C;  4WWP A;  1F2R I;  1GUA B;  1WM3 A;  1Y8R C;  1P3Q U;  3APC A;  1T0S C;  2IO0 B;  2IYD B;  3H7P A;  1WGH A;  3DBH I;  5DPT A;  1UD7 A;  4IM0 A;  4G11 A;  3RD2 A;  4A6Q A;  3ONS A;  4KSK C;  1WX7 A;  2IO3 B;  4KKJ A;  3AEC B;  4KGR A;  1LQB A;  3ZKJ C;  2MX2 A;  4M8N A;  2XN9 C;  1ZDX A;  4KX6 B;  2D07 B;  4ANU A;  4C7Z A;  4MDK E;  1J0G A;  4II2 B;  4HK2 A;  1HXY D;  2CU3 A;  1C79 A;  5E6N A;  4YWG G;  1F0Z A;  1MHH E;  5T8I A;  3ZJV A;  1V49 A;  4M0W A;  5DPS A;  3NZU A;  3SD5 A;  2R2O A;  3WAL A;  4AJY B;  4HKZ E;  2EMT A;  2CR5 A;  5CHF A;  4GSW A;  4DXG A;  4GLS C;  1WRI A;  2ZNV B;  4RGT A;  5AZF A;  3UQB A;  1K52 A;  2DAF A;  5G5H A;  1MJD A;  2L3Z A;  2L52 A;  5I4D A;  5L95 C;  2H89 B;  3DPD A;  1XD3 B;  2LXA A;  4XDD A;  1P98 A;  1ZXI A;  3P4S B;  3UIN B;  3LYY A;  1FNV A;  3FKY A;  3W2D A;  3VRB B;  3Q14 C;  1XLP A;  2FBW B;  2KMA A;  4LJO B;  1I4X A;  1V86 A;  2GI9 A;  1WYG A;  3GOE A;  5JHB A;  2V3S A;  5D6J B;  3TEZ A;  2LUE A;  2MRP A;  4CQN A;  4PYZ A;  2KMC A;  3GZN I;  4FHJ A;  2C5L C;  1IP9 A;  2FE8 A;  3CMM B;  5H92 C;  1HZ5 A;  2WDT B;  1QOF A;  3AM9 A;  4OVZ A;  1GJZ A;  4ZHO A;  1N61 A;  3ZVV A;  2LXC A;  1GB1 A;  3N20 C;  3NJT A;  4PS8 A;  1TBE A;  2VZK D;  2BYV E;  3QHT A;  3MTN B;  3DBH B;  4LK0 M;  5BMI A;  1ZUD 2;  2C7M B;  2LVO A;  3QQ8 B;  3DVG Y;  5D3I B;  2ZCC A;  2LGI A;  2OJW A;  2JYE A;  1NBF C;  2L05 A;  2SEB D;  2JY6 A;  4D2K A;  1XCT L;  1E10 A;  3K9O B;  4M8M A;  1S1Q B;  1RYJ A;  2M4N A;  4WWM A;  3EUB 2;  2W9N A;  4MT5 A;  1AAR A;  2AQ3 B;  5CHW A;  1P7F A;  2NBV B;  3RCZ A;  1KRH A;  5H8Y E;  2MW5 A;  2KDF B;  4RCO A;  2QJL A;  1SE2 A;  5LXI B;  2DLB A;  1VR9 A;  3VTW A;  5JZE B;  4AS1 A;  2HTM E;  3KYD D;  1GC6 A;  4HPM B;  3WIM A;  4LNK A;  4YSY B;  3AEE B;  1TJE A;  2ZW1 A;  3ML9 A;  4LNN A;  1DGJ A;  2DYM A;  1J7B A;  2AL6 A;  1STE A;  4ZRP A;  5E6O A;  3AE5 B;  3UIO B;  1L4Z B;  4IG7 B;  2B3A A;  4RGM A;  2RDG A;  4JGH B;  3BZD B;  3A9J A;  4B6W A;  1FCC C;  3N1Y C;  2HDE A;  4XC2 A;  2NTS A;  2GLS A;  4ZRJ A;  2N7D A;  4REZ A;  2KFJ A;  3R3M A;  1WY8 A;  4XGA B;  2ONQ A;  4KDI C;  1GPX A;  2EKE C;  2WXL A;  2VH1 A;  5CHV C;  3PPA A;  4AP4 C;  4MGZ E;  3RUI B;  3DVN V;  2KD0 A;  2DZJ A;  4CYE A;  1WZ3 A;  3U52 E;  1I4H A;  3H1U A;  1F2R C;  1E8X A;  5G55 A;  4P6V F;  3AU4 A;  2KLC A;  4NZL B;  3IG3 A;  1C77 A;  1L6U A;  3IFW B;  4DDG D;  3WA0 A;  2IND C;  1S3S G;  2JRH A;  1E5W A;  3P4R B;  3V6C B;  5E6P A;  4GDK B;  1C4A A;  4AWJ A;  1L2N A;  3KLS X;  4K7U A;  4ICV A;  1V5T A;  3WAP A;  3ALB A;  3ZRC A;  4I6N B;  4KZC A;  4NY0 A;  3MHZ A;  4US8 A;  1P1A A;  4TMA B;  2J4X A;  3VAW A;  3KUC B;  4HRO A;  1JAL A;  2CKH B;  1PFD A;  1KTK A;  4EZJ A;  4A8X C;  3BIN A;  2IO2 B;  2K3U A;  1ZP0 B;  3DWG C;  3BYY B;  3W1S C;  1V80 A;  2WHI A;  2KNB A;  1LFD A;  1ET9 A;  1SJE D;  4UDU C;  1QKZ A;  1V1O A;  4OZA A;  4MH0 E;  4EZL A;  1JRP A;  1NEN B;  1EU4 A;  3RI7 C;  3CF6 E;  3H6N A;  4WJO A;  1YJJ A;  4IWO A;  3AU5 A;  2DX5 B;  1NYR A;  1YN3 A;  3BK2 A;  4MEM A;  1XQQ A;  1JWA D;  2QIL A;  1YJI A;  2GBM A;  2D3G A;  3RFZ B;  5J2R A;  1VDV A;  2ZCB A;  3GS2 A;  1JWB D;  4JWS C;  2JWZ A;  3UQA A;  3PS6 A;  1VRA B;  2LGX A;  4BZA A;  1R4N B;  4II3 B;  4WH4 A;  1L0Y B;  1ROE A;  2J0K A;  2MJE A;  1YOV B;  3U7D A;  2FCS A;  3N1Z C;  1ZXH A;  3A33 B;  1D6E C;  2M17 A;  1P0R A;  4ZHP A;  1FRR A;  2XK5 B;  3SEB A;  4ANV A;  2MCN B;  5CTR C;  2W82 A;  2O6V B;  2QMT A;  4BBN F;  2Y5P A;  1N5X A;  2C7H A;  4K3B A;  2KTR B;  2YEP F;  1JML A;  2WXH A;  3SHQ A;  5IN7 A;  5LNK 1;  3EEC A;  3A1Q B;  5IKC M;  2HTH A;  1FXA A;  3RPF C;  2FCM A;  3U8Z A;  1M4V A;  1WGG A;  1C4P A;  2WYQ A;  2QDF A;  1T6B X;  3L54 A;  1PUT A;  1XLQ A;  2KZR A;  4LTU A;  4WIP A;  2NS5 A;  1SIJ A;  2ZZP B;  3B2G A;  1Y56 A;  2B76 B;  1OQR A;  3SR6 A;  3BII D;  4RM9 A;  5HI1 A;  3ZUN A;  1C1Y B;  1C4C A;  3SU8 X;  1I4G A;  3PO0 A;  3KUZ A;  1YN4 A;  3D32 A;  3UGB B;  1TKG A;  1R4M I;  4JQW C;  1OQY A;  1WGD A;  2CJN A;  4C4V B;  1WR6 E;  5IAA C;  3GE3 C;  3U7Z A;  2V0G A;  3O13 A;  4ZOH C;  3ZTC A;  1I4R A;  3NVW A;  1YD8 U;  4EEW A;  4RF0 A;  2WXN A;  4C56 C;  2XK5 A;  1WE6 A;  2EMS A;  2AWT A;  1K51 A;  5TSS A;  1CMX B;  2D2Q A;  2IGG A;  3TL5 A;  2PTL A;  2JPH A;  2KWC A;  3QAQ A;  2GMI C;  1YQ3 B;  2K22 A;  3PRM B;  3JSV A;  2LAS A;  3RN9 C;  2MEK A;  4GOC A;  4B9K A;  3CST A;  4G50 A;  2AEH A;  1KLU D;  3DDC B;  3TJP A;  3ZNI D;  1MG8 A;  3VR9 B;  2JUO A;  3I3T B;  2L00 B;  2D3A A;  4ZYN A;  3FIL A;  3V62 A;  4J6I A;  2WXQ A;  2CS4 A;  4HJK A;  4GDL B;  1IYF A;  5JXV A;  1Z5S B;  2MLB A;  2WXP A;  1K53 A;  1FRD A;  4ANW A;  2NTT A;  3DBR I;  3L08 A;  4EKU A;  2PPH A;  3PV1 A;  2KC1 A;  1CQV A;  4MJS B;  4MJS A;  4ZRI A;  1KLV A;  4GU2 A;  5IA7 A;  2GB1 A;  3EFU A;  1HEZ E;  5AEK B;  5C23 A;  3SDL C;  3OWE B;  1VLB A;  4FJV B;  2AX5 A;  1XXG A;  5FK9 C;  2RD0 A;  4OZB A;  2JSV X;  1I42 A;  4MSM B;  1NYQ A;  1F9J A;  2N9L A;  4YT0 B;  1SEB D;  2JX5 A;  1D4B A;  4BKS D;  2LI5 A;  3H9D A;  3KH0 A;  2NVU I;  2OED A;  3A4R A;  3TEX A;  2NBW B;  3J9C A;  1T0Y A;  4I6L B;  3Q8F A;  3AEG B;  2W3R A;  5C1Z A;  2MBH A;  2WDR B;  3RZW C;  1DOI A;  2NCN A;  2FID A;  3AEF B;  1UGM A;  2KDI A;  4KGT A;  2KX0 A;  3A9J B;  2WXO A;  4W9C A;  1JRO A;  2DBY A;  2WLB A;  1JW9 D;  4M01 A;  4C4V A;  4MM3 B;  2GBR A;  4ARC A;  3RMK C;  1EWC A;  4JL9 A;  3L17 A;  2GBJ A;  2FCQ A;  4HPL B;  1E6E B;  3AI5 A;  2INP E;  1OEY A;  3PRZ A;  3CSF A;  3M63 B;  4B95 A;  1XO3 A;  3AE3 B;  2ZNV C;  4OVU A;  1R4M B;  4NNJ B;  2WWZ A;  4NAW A;  2TSS A;  3V61 A;  3N32 A;  5D7G A;  1UZX B;  4C00 A;  2D11 A;  3V05 A;  1QIL A;  4EE2 A;  2K6Q A;  3Q8B A;  1YIW A;  1FXT B;  4WUR A;  1N60 A;  1XEE A;  2K8C A;  3AN1 A;  3I57 A;  2DEN B;  1RFK A;  3ZW3 A;  3FIL B;  1TKY A;  1YN5 A;  3E56 A;  4USA A;  2J52 A;  2O6V D;  2PE9 A;  3A4S C;  2WXM A;  3TIX A;  3Q6B A;  1PGX A;  1RRB A;  1UGJ A;  4A3O A;  1WSP A;  1TS2 A;  2UYZ B;  2JWU A;  2LD9 A;  1TZ1 A;  5EE9 A;  3ZIM A;  2L7R A;  4HXD A;  1ET6 A;  1E8Z A;  4S17 A;  1RLF A;  1WI0 A;  4WQO B;  2EEL A;  1UF0 A;  4AUQ C;  1ENF A;  2N9P C;  3RNA C;  5BYS A;  3MHS D;  1FD6 A;  1PGA A;  3MJW A;  1IGC A;  3VQI A;  5C3J B;  2G4D B;  1I4P A;  2DAJ A;  2GOW A;  4ZRQ A;  2O6V A;  4DHJ D;  4URK A;  1IPG A;  1WZ0 A;  2MHJ A;  1UNS A;  1TGZ B;  2Q5W D;  2XEW A;  1ZKH A;  4M02 A;  4XYC A;  1ZPS A;  1L0X B;  1TY0 A;  1SXT A;  1G6J A;  2PW9 A;  2HJ1 A;  3Q3O C;  2O2V B;  4QAY A;  3AE9 B;  3KW5 B;  2BF8 B;  2OHF A;  4MGK E;  2V4I B;  4XWT A;  2DHZ A;  4GXB A;  2PEA A;  4NAM A;  1V8C A;  3IAS 1;  4F7Z A;  3GZN B;  4IKG A;  2J53 A;  2PE6 B;  4XE0 A;  5DPW A;  2MBQ A;  1DOX A;  4XDC A;  1L7Y A;  2DZK A;  4ZRK A;  2NR2 A;  3AEB B;  2HD5 B;  1DOY A;  1T3Q A;  3W1Y A;  2RPV A;  3HK0 A;  3VH4 B;  3HHM A;  4ASW C;  2IZV B;  5AUK A;  3APF A;  3PHX B;  2E3T A;  1ESF A;  3C0R B;  3AE1 B;  2C60 A;  4LJP B;  2N9K A;  3QAR A;  4HDO A;  1WXM A;  3BVM A;  1BML C;  2WX0 A;  3GP7 A;  1EWY C;  2NPT B;  2LMC A;  2LGD A;  4TUU A;  1CJE A;  2I1K A;  2JXX A;  1FFU A;  3VUY A;  3I63 C;  3QCA A;  3LDZ E;  1WE7 A;  1IGD A;  1TS4 A;  4YSX B;  2RPQ A;  1Q10 A;  2WDV B;  1KH0 A;  2Z0D B;  3DWM A;  1FO4 A;  4XZ4 A;  3ZXR A;  1E8W A;  1J8C A;  3JVZ X;  3R66 C;  1E8Y A;  2BT6 A;  1QLB B;  2PMV A;  3L16 A;  1WF9 A;  3H7P B;  2A5U A;  4IWQ A;  2OJR A;  2MBB B;  1JRU A;  2LJI A;  4N9F 4;  3M3J A;  1WGK A;  1BUI C;  4TSS A;  4P1C C;  3KWL A;  4WWN A;  3RUL A;  2M1M A;  4YTP B;  1QOA A;  3ABV B;  3HRD D;  1XT9 B;  1FFV A;  4GIV A;  4L2Y A;  4RFB A;  3T8M A;  1JWU D;  2QC8 A;  3HM3 A;  1CK1 A;  2ICI A;  1FNU A;  1MI0 A;  1N6Z A;  1B1Z A;  1Z2M A;  2IY0 B;  2KT7 A;  1L0V B;  2KQS A;  1OGW A;  2L0T A;  1EM7 A;  4FJZ A;  3AEA B;  2KXJ A;  2BWF A;  1WWT A;  5AZG A;  2KWV B;  2M56 B;  2WS3 B;  3A9K B;  1WJN A;  2D5G A;  1WMH A;  1V97 A;  2R61 A;  1R4N I;  3KUD B;  1K50 A;  4RH6 A;  3QK0 A;  2K39 A;  3QIJ A;  4MGY E;  1GB4 A;  4K3C A;  3QJZ A;  1FNW A;  4JE3 B;  4US9 A;  3UI3 A;  2YEP B;  3TSS A;  4BOS C;  3Q8E A;  1WH3 A;  4DXF A;  3AB5 A;  3ETR A;  1SF0 A;  2WGS A;  4WAA A;  1VJK A;  1GOZ A;  4ACF A;  2LHE A;  2KAC A;  4GMV A;  4MSQ B;  3N3K B;  4RGN A;  1UWX A;  5FR6 A;  1D5X C;  3PLV A;  5FKA C;  1PGB A;  2AL3 A;  3VH3 B;  1HTQ A;  1KOT A;  3U2S C;  2ASQ A;  4K7W A;  1VD2 A;  1VZ6 A;  3RNB C;  4F8C B;  1MHX A;  4LNF A;  4K81 A;  5CX3 A;  4JLC A;  1L4D B;  4HEA 1;  1EF1 A;  3B2F A;  3CWI A;  4MH8 A;  4OHJ A;  2JT4 B;  1IBX B;  4PT5 A;  1VZ7 A;  3ZJU A;  4I6P A;  1RM6 C;  1RWS A;  1OTR B;  3RNC C;  2N9X A;  3P4P B;  3WAM A;  1MVK A;  4W9G A;  1WR1 A;  3T9L A;  2M0A A;  4MM3 A;  5FR3 A;  1PYW D;  1FM0 D;  4A55 A;  3NS8 A;  2L8J A;  2W3S A;  5AUI A;  2MBE A;  2WU5 B;  2K6D B;  2IO1 B;  2IDY A;  4IM2 A;  3Q3N C;  3VRA B;  3W5V B;  5J18 A;  4FHK A;  2BS3 B;  1ZDV A;  1YQB A;  3AH7 A;  1NEK B;  2BPS A;  4GN1 A;  3B0A A;  2RDH A;  3AE4 B;  2JQR B;  2BKF A;  2D3C A;  3PZ7 A;  1B9R A;  1TT5 B;  3CIR B;  4XWW A;  2X8X X;  1FEH A;  2Z59 B;  3ZNH B;  1M94 A;  1XCQ L;  4M0W B;  4HRS A;  3NS1 A;  3PTF C;  3LXF A;  1SJH D;  2N7J A;  1JCK B;  4BOZ B;  3PT2 B;  1RFA A;  1KFY B;  3MC0 B;  1C9F A;  2KO3 A;  3Q2A C;  1PQS A;  2REX A;  5MPO A;  5HHD G;  2INN E;  1CZP A;  4FA6 A;  4JWU C;  3VFK A;  2INC C;  3QWZ B;  1NDD A;  3ZYY X;  2DZM A;  3IT6 B;  4RNA A;  3NOB A;  2IGD A;  1UH6 A;  4GDL A;  2FIF A;  3IBE A;  2ACZ B;  2FCN A;  3ZNG C;  4YSZ B;  3NZS A;  2VH2 A;  1D5M C;  2CHZ A;  3P1M A;  2C9W B;  1GC7 A;  2C7N B;  1UUP A;  1YNT E;  4R3D A;  3DHH C;  2ZVO A;  3IHP C;  4FUL A;  1GG3 A;  5BO4 B;  3TCA A;  1MFW A;  2E6X A;  3Q3M C;  3UF8 A;  1ZW7 A;  4BAX A;  5E6J A;  1IUE A;  3I5J C;  2JU6 X;  5G2N A;  1EO6 A;  4W9L A;  2LFI A;  2M8S A;  4PS3 A;  1SE4 A;  4MEL A;  4W9F A;  5EDS A;  2BBC A;  2KKC A;  2KYW A;  2KVR A;  2L83 A;  4XX5 A;  1QF6 A;  3DVG X;  4ZDV A;  3DQV A;  1WXA A;  3S2A A;  3AXC A;  2N1V A;  2M19 A;  2K5P A;  4HKQ A;  3JSV B;  3ZQ4 A;  4LDT B;  4AJW A;  1IBX A;  2ON8 A;  2BVC A;  3AE8 B;  2K25 A;  3SFD B;  3P4Q B;  4NPN A;  4EZK A;  4DHZ B;  1QQR A;  2J0J A;  4G3X B;  4OZC A;  1NI3 A;  1FCL A;  2PJH A;  5G5G A;  3RYT A;  4W9H A;  3VXW A;  5HKH A;  2KJR A;  3AE2 B;  4KIK B;  4F1S A;  2LUM A;  1U4A A;  2MSE D;  3H7S A;  4K7S A;  2J0M A;  3C19 A;  3R8B A;  3EHV A;  1QOB A;  3EGR A;  3DCG A;  2R2Q A;  1MG4 A;  3WCQ A;  2I38 A;  4KKI A;  3NVZ A;  5IO9 A;  2K1F A;  2PVO D;  2CHW A;  2LVQ A;  3KYC D;  2W55 A;  1I35 A;  2LGY A;  2QHO A;  1LO5 D;  1PDX A;  1YJ1 A;  2GBN A;  4YL8 A;  3VHT C;  3W1S A;  5BMH A;  1UEL A;  2RMM A;  2I2Y A;  5GXG B;  1X1M A;  3TEW A;  5HG2 A;  2BS4 B;  4RF1 A;  2L1A A;  4DK5 A;  2G4S A;  1UBI A;  2Y5B B;  1ZOY B;  1I4Q A;  2J42 A;  3HUI A;  2KTR A;  2LWP A;  5DPR A;  2MQJ A;  4X57 B;  4BKG A;  2WXG A;  1FIQ A;  3FAH A;  3MC8 A;  2BYF A;  3DBL I;  1C76 A;  3RNF C;  4ARI A;  1YQ4 B;  1VCB A;  2NMQ A;  4YXD B;  2D10 A;  3HVD A;  1T5X D;  2MP2 A;  4W9I A;  1WFY A;  1XF5 L;  2KAN A;  2G45 B;  2NPT A;  3JW0 X;  4O1N A;  1FPY A;  4WWO A;  2LJ5 A;  3HM6 X;  4L1B A;  4PYU A;  4ICU A;  1WX9 A;  2QIE B;  3EC8 A;  3NVY A;  4HLE A;  1LGR A;  2VRR B;  3I9V 1;  3NHE B;  4N59 A;  3JYU A;  4BKS A;  2WXF A;  3RNE C;  2RSU A;  1J7C A;  5EE1 A;  3WAO A;  4P7I A;  4RGO S;  2BKR B;  1SE3 A;  1TZO A;  4FJY A;  4LNI A;  3OJ4 B;  1D5Z C;  1FXI A;  4KSL C;  1YMH E;  2I1J A;  1J7A A;  3ZDM C;  4ANX A;  1RAX A;  4GB9 A;  3Q8C A;  3N9Y C;  2G3Q B;  1V81 A;  1LXD A;  2K9X A;  2Z8L A;  2FUH B;  4G0N B;  2WXJ A;  1H8C A;  1N62 A;  3E9S A;  1FMA D;  2IJ0 A;  5C2T B;  1WYW B;  1WJU A;  3C8Y A;  2KQ4 X;  3TBL D;  4A90 A;  1TTN A;  4AOF A;  5L83 A;  3M95 A;  5LLI A;  3PHW B;  2FUG 1;  4W9D A;  4Q2J A;  5EE3 A;  3TEY A;  1AYF A;  3Q69 A;  3GB1 A;  3K9P B;  3QA8 A;  1V1P A;  2JZZ A;  2K8H A;  2RDB C;  1UBQ A;  1JQ4 A;  1QOG A;  1SB3 C;  3ZTD A;  2V3P A;  1N63 A;  4DHJ B;  3PZD A;  2HJ8 A;  4DXA B;  2N4F A;  4WJQ A;  2KAJ A;  3Q8A A;  2G1E A;  2LVP A;  4B0E A;  1GAQ B;  3P63 A;  1AN8 A;  4E3C A;  1ISN A;  2CU1 A;  3TUO A;  3B08 A;  2IY1 B;  2WU2 B;  5IOI A;  3MJ5 A;  1BXT A;  4NQL B;  2KDE B;  2BW2 A;  1V6E A;  3P42 A;  3AE6 B;  1WM2 A;  4C80 A;  3NVV A;  3ZRF A;  5AZH A;  4CHK A;  2LHD A;  4ZYS A;  2DWQ A;  1TIF A;  2ZW0 A;  5KHO A;  1HTO A;  2YVC A;  1E7V A;  2KDM A;  2UU7 A;  2QSD A;  1KF6 B;  2Z0E B;  1V5O A;  4LCD E;  1MPE A;  3NY5 A;  1GNU A;  2OOB B;  4DWF A;  4NAW B;  3VR8 B;  1EF5 A;  2Y5C A;  3V3X A;  2BWE S;  2WXK A;  3IT4 B;  2Y3A A;  2O2V A;  3X23 A;  4BKT A;  2KWD A;  1A70 A;  1SE9 A;  2H88 B;  2J7Q B;  3MC9 A;  1AWD A;  2PKO A;  3BVZ A;  2QEJ C;  4HVB A;  1TKE A;  4GDK A;  1E7U A;  3L10 B;  2ZPY A;  1SGH A;  4WAF A;  2KVZ A;  5GMV A;  1ZGU B;  3QC8 B;  1JWS D;  2N7E A;  1D3Z A;  3DHI C;  1SSN A;  2WXR A;  4DHZ E;  5J17 A;  1L5P A;  2N0S B;  1V2Y A;  4HWI B;  4WJN A;  4NQK E;  2KTF A;  4KZ0 A;  1Q1O A;  3ZDT A;  3ECI A;  2JF5 A;  2X38 A;  3M62 B;  5D2M B;  1P7E A;  4WJP A;  1ZE3 D;  4IDI A;  1WGR A;  4FXC A;  4HPP A;  3ZO5 B;  2G9H D;  4IUM B;  2GRI A;  4P16 A;  1Q5W B;  2LZ6 A;  1F52 A;  2NBU A;  3WAN A;  2V3N A;  2BGF A;  1SBB B;  3IAM 1;  3L4P A;  2M0X A;  3PZ8 A;  4IOI E;  2AYO B;  3KQ4 A;  1KLG D;  2JVC A;  3HVZ A;  2WDQ B;  1YX6 B;  1WJ6 A;  2DNF A;  3AV8 A;  4A3P A;  4AQ7 A;  2N9E B;  3VTU A;  1WX8 A;  3OLM D;  4YTN B;  1A5R A;  1UWM A;  2BYT A;  3RNG C;  1BT0 A;  2JXT A;  3DHG C;  2L0F A;  4MAC A;  1TY2 A;  3W9C B;  3R2T A;  2BS2 B;  1LM8 B;  1I7H A;  4C7Y A;  4RMA A;  1WJ4 A;  3QX1 A;  4JX1 C;  4TV3 A;  4CO7 A;  3PRP B;  2KN5 A;  3MP9 A;  3ML8 A;  3NZ3 A;  2BTE A;  5IP4 D;  2KN4 A;  4EUT A;  2KDB A;  2WXI A;  2XBB C;  3ZJT A;  1OFF A;  1EU3 A;  3EFC A;  2WP9 B;  4FBJ B;  2RGF A;  2BB6 A;  3GE8 C;  3OAW A;  1P9D U;  5D94 A;  4FAD A;  1E9M A;  1WGY A;  3DBS A;  3Q3J A;  3ZGZ A;  3ZLZ A;  2EKI A;  2GBK A;  3LB8 C;  4KDL B;  4KVG B;  4W9E A;  1WMH B;  2K8B A;  4BVU C;  4RM8 A;  4BBN C;  3BVG A;  3PSE B;  2MJ3 A;  1E0Z A;  1XLN A;  3PLU A;  2ZVN A;  2K0P A;  3BYT B;  2QCZ A;  2KOX A;  5KHQ A;  3R7R A;  3O65 B;  4TQ0 A;  2XNA C;  1OQQ A;  2KX3 A;  2BQQ A;  1ACC A;  1JWM D;  2WQY B;  4N6E B;  2JYT A;  1WXQ A;  5BMG A;  1HZ6 A;  5TR5 A;  2ZEQ A;  4E74 A;  2V4L A;  2KMM A;  3W5U B;  2PVG C;  1F77 A;  2L32 A;  4JPS A;  4OVV A;  3P2B A;  1WXS A;  2HE7 A;  5D3D A;  1J19 A;  3DBL B;  1C78 A;  1T0R C;  2UWQ A;  3BY4 B;  1SIF A;  2LRW A;  4JIO U;  4NJ7 A;  4DBG A;  3LJ3 A;  2JRI B;  3HIZ A;  1XLO A;  3R2I A;  2A4Z A;  2BB5 A;  2BYE A;  2KFK A;  4GGQ A;  4J3O D;  4MGI E;  3VVW B;  2WNM A;  2DYB A;  3B9J A;  3DVN U;  2WX1 A;  1QZE A;  3IVF A;  4TQ1 A;  2KLG A;  1T0Q C;  2ZJD A;  4NJ6 A;  3AMZ A;  5HFY A;  4YTM B;  3X0W A;  2PIA A;  2MP2 B;  2AQ2 B;  1HQR D;  3H8H A;  3L0W B;  4A9A A;  1L6V A;  2KK8 A;  4W9K A;  2KWU B;  2L76 A;  4K1R B;  2KFK B;  4IWP A;  3KVF B;  2KJ6 A;  4E71 A;  4S0R A; 
#chains in the Genus database with same CATH homology
 1WXM A;  3CF6 E;  1VCB A;  3R7Q A;  3H6N A;  2WX0 A;  2D10 A;  4WJO A;  2NPT B;  4IWO A;  2LGD A;  3AU5 A;  1E90 A;  2DX5 B;  4TUU A;  2MP2 A;  3L13 A;  2I1K A;  4W9I A;  2KC2 A;  1WFY A;  2JXX A;  2KAN A;  4MEM A;  1XQQ A;  1C3T A;  2G45 B;  2FAZ A;  2NPT A;  3JW0 X;  3RZF A;  3VUY A;  2KHW B;  2GBM A;  1Q0W B;  2D3G A;  2DZI A;  4WWO A;  2LJ5 A;  3HM6 X;  4PYU A;  3QCA A;  3LDZ E;  4ICU A;  1WE7 A;  5J2R A;  3RT3 B;  1WX9 A;  2IBI B;  2ZCB A;  2RPQ A;  2JWZ A;  3EC8 A;  3UQA A;  3PS6 A;  3ZNZ B;  4HCN B;  2LGX A;  4FLH A;  2Z0D B;  4HLE A;  4XZ4 A;  1E8W A;  1J8C A;  2VRR B;  3NHE B;  3OJ3 A;  3VTV A;  3JVZ X;  3JYU A;  3R66 C;  4BKS A;  4II3 B;  1K8R B;  2RSU A;  1E8Y A;  3WAO A;  3N30 A;  3L16 A;  4W9J A;  2J0K A;  4P7I A;  3AUL A;  2BKR B;  4EOY A;  1WF9 A;  1HE8 A;  4FJY A;  3OJ4 B;  3H7P B;  3TMP B;  2A5U A;  4IWQ A;  2OJR A;  1OEY J;  4KSL C;  2CHX A;  2MBB B;  3ZDM C;  1JRU A;  2I1J A;  3U7D A;  2FCS A;  1WXV A;  4ANX A;  4N9F 4;  3M3J A;  1RAX A;  3A33 B;  4GB9 A;  1KJT A;  2M17 A;  1P0R A;  2XK5 B;  4IM3 A;  2KQ7 A;  1KM7 A;  4WWN A;  2G3Q B;  2MCN B;  1V81 A;  3RUL A;  3U30 A;  1LXD A;  5CTR C;  3VDZ A;  4ANV A;  2M1M A;  2O6V B;  2FUH B;  4G0N B;  4BFR A;  1H8C A;  4TKN A;  3APD A;  4KV2 A;  4A20 A;  4BBN F;  2MBO A;  1XT9 B;  4GIV A;  1WYW B;  3V60 A;  1WJU A;  2C7H A;  2N1W A;  3TBL D;  3T8M A;  1TTN A;  4FN2 A;  3HM3 A;  4AOF A;  5L83 A;  2KTR B;  4HDQ A;  3M95 A;  4EFO A;  4LDT D;  1Z2M A;  2IY0 B;  3SHQ A;  5LLI A;  3EEC A;  3PHW B;  3A1Q B;  2KQS A;  3UIP B;  4W9D A;  2KJH B;  2HTH A;  3U8Z A;  1OGW A;  2FCM A;  2L0T A;  5LXH A;  1WRD B;  5JHA A;  3VUX A;  2DYO A;  1WGG A;  2WYQ A;  3K9P B;  4FJZ A;  3QA8 A;  2KXJ A;  3L54 A;  2BWF A;  5AZG A;  2KWV B;  2KZR A;  3VUW A;  3A9K A;  2JZZ A;  2K8H A;  1UBQ A;  2NS5 A;  3A9K B;  1WJN A;  5JH5 C;  2ZPN A;  3ZTD A;  2ZZP B;  1WMH A;  3PVL A;  1R4N I;  4DHJ B;  2RR9 A;  3PZD A;  2HJ8 A;  3KUD B;  3DOW A;  3QK0 A;  1H4R A;  3V6E B;  4DXA B;  2FNJ B;  2K39 A;  2N4F A;  3QIJ A;  4MGY E;  2LVP A;  1NI2 A;  3Q3F A;  4RM9 A;  4WJQ A;  4DDI D;  1WIA A;  3QJZ A;  3ZUN A;  1C1Y B;  3A1Q A;  3PGE A;  4E3C A;  2LRU A;  3SU8 X;  5DCN A;  1ISN A;  4BOS C;  2MA9 B;  4HCP B;  2CU1 A;  3B08 A;  2IY1 B;  3KUZ A;  1WH3 A;  3D32 A;  3ENE A;  3UGB B;  2V1Y A;  1R4M I;  1EUV B;  4JQW C;  1OQY A;  1WGD A;  4NQL B;  2KDE B;  4KIK A;  1WR6 E;  5IAA C;  2YLM A;  1V6E A;  3B1L X;  2MWS B;  4WAA A;  3ZTC A;  4IW0 A;  1YD8 U;  4EEW A;  4PS7 A;  4IC7 B;  1WM2 A;  1YX5 B;  2JZ3 B;  2XK5 A;  1WE6 A;  2EMS A;  2AWT A;  3PRE A;  1CMX B;  3ZRF A;  2D2Q A;  1V9J A;  4GMV A;  4MSQ B;  4WWP A;  1GUA B;  1WM3 A;  5AZH A;  3TL5 A;  3N3K B;  4CHK A;  1Y8R C;  1P3Q U;  5FR6 A;  3PLV A;  3APC A;  2JPH A;  2IO0 B;  2IYD B;  2KWC A;  3H7P A;  1WGH A;  2GMI C;  3QAQ A;  3DBH I;  2AL3 A;  3PRM B;  3VH3 B;  5DPT A;  5KHO A;  3JSV A;  1UD7 A;  4IM0 A;  2YVC A;  1E7V A;  1KOT A;  2LAS A;  4G11 A;  3RD2 A;  2ASQ A;  4K7W A;  1VD2 A;  2Z0E B;  3ONS A;  1V5O A;  4F8C B;  4LCD E;  4GOC A;  3NY5 A;  1WX7 A;  4K81 A;  1GNU A;  2OOB B;  2IO3 B;  3CST A;  4G50 A;  4KSK C;  5CX3 A;  2AEH A;  4B9K A;  4DWF A;  1LQB A;  4JLC A;  3DDC B;  4NAW B;  3TJP A;  1EF5 A;  3ZKJ C;  2MX2 A;  3ZNI D;  1MG8 A;  1EF1 A;  2JUO A;  4M8N A;  2BWE S;  3I3T B;  2L00 B;  2D07 B;  4ZYN A;  2O2V A;  3V62 A;  4J6I A;  3X23 A;  2JT4 B;  4BKT A;  4ANU A;  4MDK E;  1J0G A;  2CS4 A;  4II2 B;  1SE9 A;  4HJK A;  4HK2 A;  4I6P A;  1OTR B;  4GDL B;  1IYF A;  2N9X A;  5E6N A;  2J7Q B;  1Z5S B;  2MLB A;  3WAM A;  1V49 A;  4W9G A;  4HVB A;  4GDK A;  5DPS A;  1E7U A;  3NZU A;  3L10 B;  3SD5 A;  1WR1 A;  4ANW A;  3DBR I;  2R2O A;  3L08 A;  4MM3 A;  2ZPY A;  3T9L A;  4EKU A;  2PPH A;  3PV1 A;  3WAL A;  1SGH A;  2KC1 A;  4AJY B;  4MJS B;  2EMT A;  2CR5 A;  5CHF A;  4MJS A;  4GSW A;  4ZRI A;  1KLV A;  3NS8 A;  4GU2 A;  5GMV A;  1ZGU B;  5AZF A;  2ZNV B;  2L8J A;  5IA7 A;  3QC8 B;  3UQB A;  3EFU A;  2DAF A;  5AEK B;  2MBE A;  2N7E A;  5C23 A;  1D3Z A;  3SDL C;  2L3Z A;  2K6D B;  2IO1 B;  4DHZ E;  5J17 A;  5L95 C;  4IM2 A;  3DPD A;  4FJV B;  1XD3 B;  2LXA A;  1P98 A;  1V2Y A;  4HWI B;  4WJN A;  4NQK E;  2RD0 A;  4FHK A;  5J18 A;  2KTF A;  4KZ0 A;  1I42 A;  3UIN B;  4MSM B;  1F9J A;  1Q1O A;  3ZDT A;  3ECI A;  2JF5 A;  1YQB A;  3M62 B;  5D2M B;  4WJP A;  2KMA A;  1WGR A;  2BPS A;  4LJO B;  4GN1 A;  4BKS D;  3B0A A;  2LI5 A;  3H9D A;  3KH0 A;  2NVU I;  3ZO5 B;  1V86 A;  2BKF A;  3A4R A;  4IUM B;  3GOE A;  2NBW B;  5JHB A;  2V3S A;  5D6J B;  1T0Y A;  2LUE A;  1Q5W B;  2MRP A;  2LZ6 A;  4I6L B;  4PYZ A;  2NBU A;  2KMC A;  3WAN A;  3GZN I;  5C1Z A;  2MBH A;  3RZW C;  2Z59 B;  4FHJ A;  2C5L C;  2NCN A;  3ZNH B;  1IP9 A;  1M94 A;  2BGF A;  3CMM B;  2FID A;  2WDT B;  4M0W B;  2M0X A;  1UGM A;  2KDI A;  2AYO B;  3PTF C;  1GJZ A;  2JVC A;  1YX6 B;  4BOZ B;  3ZVV A;  3PT2 B;  2LXC A;  1WJ6 A;  1RFA A;  2KX0 A;  4A3P A;  3A9J B;  2N9E B;  4PS8 A;  4W9C A;  1TBE A;  2KO3 A;  1WX8 A;  3VTU A;  2BYV E;  1PQS A;  3OLM D;  1A5R A;  3QHT A;  3MTN B;  2REX A;  4FA6 A;  2C7M B;  2LVO A;  3QQ8 B;  3VFK A;  1BT0 A;  3QWZ B;  3DVG Y;  1NDD A;  2GBR A;  2ZCC A;  2DZM A;  2L0F A;  4JL9 A;  3L17 A;  1NBF C;  2GBJ A;  3NOB A;  2FCQ A;  4HPL B;  2L05 A;  2JY6 A;  1UH6 A;  1LM8 B;  4GDL A;  2FIF A;  3IBE A;  3AI5 A;  3K9O B;  4M8M A;  1OEY A;  2FCN A;  3PRZ A;  3CSF A;  3ZNG C;  1S1Q B;  3NZS A;  4RMA A;  2M4N A;  1WJ4 A;  2CHZ A;  3M63 B;  4B95 A;  3QX1 A;  2W9N A;  1AAR A;  2C9W B;  5CHW A;  2ZNV C;  4TV3 A;  2NBV B;  4OVU A;  1GC7 A;  4NNJ B;  2C7N B;  2WWZ A;  3RCZ A;  4CO7 A;  4NAW A;  2MW5 A;  3PRP B;  2KDF B;  3V61 A;  2KN5 A;  3ML8 A;  3N32 A;  4EUT A;  2KDB A;  2XBB C;  2ZVO A;  3IHP C;  5D7G A;  1UZX B;  5LXI B;  2D11 A;  4FUL A;  1GG3 A;  5BO4 B;  3TCA A;  3VTW A;  2K6Q A;  5JZE B;  1YIW A;  3KYD D;  1FXT B;  3UF8 A;  1ZW7 A;  4FBJ B;  2RGF A;  1GC6 A;  4HPM B;  3WIM A;  2K8C A;  5G2N A;  1EO6 A;  5D94 A;  3OAW A;  1P9D U;  4FAD A;  4W9L A;  1WGY A;  3DBS A;  3Q3J A;  3ZLZ A;  2DEN B;  2M8S A;  3ML9 A;  4PS3 A;  4MEL A;  4W9F A;  5EDS A;  3ZW3 A;  2KKC A;  2DYM A;  2GBK A;  2KVR A;  4XX5 A;  2AL6 A;  2O6V D;  3DVG X;  2PE9 A;  4KDL B;  4KVG B;  4W9E A;  1WMH B;  2K8B A;  5E6O A;  3UIO B;  3A4S C;  4BVU C;  4ZDV A;  3TIX A;  4IG7 B;  3DQV A;  2B3A A;  1RRB A;  4JGH B;  1WXA A;  4RM8 A;  4A3O A;  4BBN C;  3PSE B;  3A9J A;  2UYZ B;  3S2A A;  2LD9 A;  4B6W A;  3AXC A;  1TZ1 A;  3PLU A;  2N1V A;  2ZVN A;  4XC2 A;  3ZIM A;  2L7R A;  4HXD A;  2KOX A;  3JSV B;  1E8Z A;  4ZRJ A;  1RLF A;  1WI0 A;  2N7D A;  4LDT B;  2KFJ A;  4AJW A;  4WQO B;  5KHQ A;  3R7R A;  3O65 B;  3R3M A;  1WY8 A;  4TQ0 A;  4AUQ C;  4KDI C;  2N9P C;  2K25 A;  2EKE C;  4NPN A;  4EZK A;  4DHZ B;  2KX3 A;  3MHS D;  5CHV C;  3PPA A;  2J0J A;  4AP4 C;  4MGZ E;  4G3X B;  3RUI B;  3DVN V;  3MJW A;  2KD0 A;  2DZJ A;  4CYE A;  1WZ3 A;  3VQI A;  5TR5 A;  2ZEQ A;  4E74 A;  3H1U A;  2G4D B;  2V4L A;  2DAJ A;  2GOW A;  1E8X A;  2PJH A;  5G55 A;  3AU4 A;  2O6V A;  2KLC A;  4DHJ D;  3IG3 A;  4W9H A;  3RYT A;  3VXW A;  3IFW B;  4DDG D;  2KJR A;  4URK A;  5HKH A;  1IPG A;  3WA0 A;  4KIK B;  1WZ0 A;  4F1S A;  1S3S G;  1U4A A;  2JRH A;  1WXS A;  1E5W A;  2MSE D;  3P2B A;  4OVV A;  1TGZ B;  2HE7 A;  3H7S A;  3V6C B;  5E6P A;  1J19 A;  4GDK B;  4K7S A;  2J0M A;  2XEW A;  1ZKH A;  4AWJ A;  3EHV A;  1L2N A;  3DCG A;  4ICV A;  4K7U A;  1V5T A;  3WAP A;  2R2Q A;  2UWQ A;  3ALB A;  3ZRC A;  3BY4 B;  4I6N B;  4KZC A;  4NY0 A;  1SIF A;  2LRW A;  1G6J A;  4JIO U;  4NJ7 A;  4DBG A;  3LJ3 A;  2K1F A;  2JRI B;  3HIZ A;  2O2V B;  1P1A A;  2CHW A;  2A4Z A;  3KW5 B;  2LVQ A;  3KYC D;  1I35 A;  2BYE A;  2KFK A;  2BF8 B;  2LGY A;  4GGQ A;  2QHO A;  4MGI E;  4MGK E;  3VAW A;  1YJ1 A;  3VVW B;  2GBN A;  2DYB A;  3KUC B;  2DHZ A;  3DVN U;  4GXB A;  2WX1 A;  2PEA A;  4YL8 A;  1QZE A;  3VHT C;  2CKH B;  3W1S A;  3IVF A;  4TQ1 A;  4F7Z A;  1UEL A;  2KLG A;  4EZJ A;  3BIN A;  2PE6 B;  2IO2 B;  1X1M A;  2ZJD A;  4NJ6 A;  5DPW A;  2MBQ A;  4DK5 A;  1L7Y A;  2G4S A;  3W1S C;  2DZK A;  4ZRK A;  1UBI A;  3X0W A;  1V80 A;  2Y5B B;  2NR2 A;  2KNB A;  2MP2 B;  2HD5 B;  2KTR A;  2LWP A;  1LFD A;  3W1Y A;  3HK0 A;  3L0W B;  5DPR A;  2MQJ A;  4X57 B;  3VH4 B;  3HHM A;  4BKG A;  2KK8 A;  4ASW C;  2IZV B;  2KWU B;  2L76 A;  3APF A;  4W9K A;  4K1R B;  2KFK B;  4MH0 E;  4IWP A;  3PHX B;  4EZL A;  3KVF B;  3C0R B;  2KJ6 A;  2C60 A;  4LJP B;  3QAR A;  2BYF A;  4E71 A;  3DBL I;  4HDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...