2WYQA

The crystal structure of the ubiquitin-like (ubl) domain of hhr23a (human homologue a of rad23)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
MAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKNFVVVMVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UV EXCISION REPAIR PROTEIN RAD23 HOMOLOG A
publication title The Crystal Structure of the Ubiquitin-Like (Ubl) Domain of Human Homologue a of Rad23 (Hhr23A) Protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 20
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2009-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2wyqA00
2DZMA 3DBRI 2RR9A 1E7UA 4I6NB 5G55A 3QARA 3P2BA 2CHXA 1E90A 2GBRA 4E74A 1P1AA 2BKFA 2WYQA 2KJRA 3H7PB 2XBBC 4HDQA 3OAWA 2MP2B 3NS8A 3UF8A 2LXCA 4KDIC 2OJRA 3ZDMC 2LXAA 3NHEB 2FCNA 2KFJA 4GN1A 3S2AA 1RAXA 3V60A 2WWZA 4M8MA 2DZJA 4EZLA 3M62B 4GXBA 1L2NA 3DVGX 1WXMA 4MGYE 3VFKA 3NZSA 3L0WB 3PRMB 4LCDE 1WI0A 2PPHA 3R66C 2JXXA 3Q3FA 3ZNGC 4TKNA 3TMPB 3VTVA 4LJPB 1P98A 1YQBA 3PHWB 3V6EB 1YX5B 5LLIA 1WJNA 3UIPB 4B95A 4JQWC 2C5LC 3ALBA 3L08A 2N9PC 4IM0A 3ZNZB 3NOBA 5D6JB 5DCNA 2BWFA 5LXIB 3H7SA 2QHOA 5EDSA 1V81A 2N7DA 1WFYA 4CYEA 3ZTCA 3NZUA 3AXCA 4JGHB 4M8NA 3SD5A 3HM6X 3KYDD 2DX5B 3APCA 1BT0A 3QAQA 2HJ8A 1GJZA 3DPDA 4KZ0A 3APDA 4II3B 2JUOA 3ZNID 3ZW3A 1V5TA 4GIVA 1G6JA 3OJ3A 1RLFA 3U7DA 5CTRC 2ZPNA 4FHJA 1WM2A 3H6NA 5J2RA 2LVPA 2KANA 1JRUA 4PS7A 4KSLC 2BF8B 3B0AA 2V3SA 2LJ5A 3B08A 4MH0E 4BVUC 2KNBA 3C0RB 2ZJDA 2KXJA 4MDKE 2J0JA 3PS6A 4DDGD 2BYVE 3A4SC 4HPMB 5L83A 2L00B 4NQKE 3DOWA 2KX0A 2MRPA 3HK0A 1ZGUB 2L05A 2KJ6A 2M8SA 3MJWA 4GDLB 3A33B 3UIOB 5JH5C 4MEMA 2IY1B 4DHJD 4FJYA 4IWQA 2M1MA 1H8CA 3ZRCA 3TJPA 1V9JA 3KH0A 5AZHA 4DXAB 3ML8A 1VCBA 4BBNF 2XK5A 2GBMA 3L17A 3RYTA 5D94A 3V6CB 2CR5A 5CHFA 2FNJB 3VQIA 5KHOA 3TIXA 2I1KA 2ZVNA 4KIKA 2FCMA 4W9DA 2MQJA 3H9DA 3KUZA 4ANWA 1D3ZA 1CMXB 4IUMB 3BINA 2FCQA 1WE7A 4WWNA 3JSVA 3QIJA 2IY0B 3TL5A 2KO3A 1LM8B 4I6LB 3HIZA 2BYFA 4FJVB 1P9DU 1L7YA 2G4DB 3QA8A 4GDKB 1RRBA 3WAPA 4FJZA 2JT4B 3A9KA 1WXSA 1QZEA 4EEWA 3U8ZA 4BBNC 4LDTB 2GBJA 1ISNA 4NJ6A 4MGKE 3T9LA 2IO0B 3KVFB 4X57B 3OLMD 4BKSA 4FADA 2HTHA 1R4NI 2NPTB 2KLCA 4JL9A 1UGMA 3N30A 1TGZB 4A20A 2M4NA 2Y5BB 3V61A 4KDLB 4EZJA 2K6QA 2AEHA 4K7SA 3GZNI 4GMVA 3QX1A 4W9CA 3WAOA 2KMCA 3UQBA 2DENB 2KLGA 2JZ3B 3A9JB 4WWOA 1Z5SB 1WZ3A 2KHWB 1WX7A 2RPQA 4A3PA 2WDTB 4EFOA 4DHZB 2K39A 2JVCA 1WIAA 3HHMA 3TCAA 1U4AA 2PE9A 2N1VA 3VUXA 2O6VB 3VAWA 5CHVC 4URKA 4MJSB 2KX3A 2JPHA 3D32A 4K7WA 1KLVA 1UELA 2L0FA 1WJ6A 2KFKA 2ZCBA 3NY5A 4MM3A 2UYZB 4BOZB 2AWTA 2IO3B 2UWQA 4FBJB 2KTRB 5C1ZA 2LGYA 4OVUA 1WR1A 3CSFA 4ICVA 4IM2A 2BYEA 4G3XB 1FXTB 2PE6B 1J8CA 4FA6A 3PREA 3A1QA 2C7HA 4G0NB 3CSTA 1YD8U 5JZEB 1GC6A 1UZXB 2KWUB 4W9JA 2ZVOA 5AEKB 2D3GA 2ZZPB 2LWPA 1S3SG 1WMHA 2KK8A 1WGHA 3W1SC 1WGGA 1WJ4A 4FLHA 1F9JA 2LI5A 4RM8A 2YVCA 3JYUA 4FN2A 2I1JA 4RM9A 2WX0A 1WGDA 2DYMA 4FULA 4ANUA 3QQ8B 3WAMA 3PZDA 2N9EB 4XX5A 3PPAA 1IYFA 3PLVA 2MBHA 3JW0X 1K8RB 3PHXB 1KJTA 2D10A 2KD0A 4B9KA 1OEYJ 2KWVB 2O2VA 2A5UA 1EO6A 3IHPC 3L13A 3RCZA 1IPGA 1E8YA 3R3MA 3PLUA 3QJZA 1EUVB 1TBEA 1WX9A 2LZ6A 2B3AA 4PYZA 2ZPYA 3IG3A 5HKHA 3O65B 4A3OA 1J0GA 3ZIMA 4PYUA 3SU8X 2WX1A 4F7ZA 2KMAA 1I42A 1E8WA 4KVGB 2KN5A 4AJWA 1XT9B 5DPTA 3AU4A 4IWPA 4OVVA 1RFAA 1WYWB 2HD5B 3QHTA 2L8JA 5D7GA 2EKEC 2AYOB 2IZVB 2NR2A 4K1RB 3BY4B 3IBEA 4TV3A 1V5OA 3JVZX 1C3TA 3QWZB 2BGFA 3M63B 4P7IA 1WR6E 1WH3A 3X23A 4K7UA 3VXWA 4ZRIA 2FIDA 5D2MB 1GUAB 1NI2A 2JRHA 2A4ZA 3LDZE 4ASWC 4DHZE 1E8XA 2C7MB 4IWOA 3WANA 3B1LX 2G3QB 4E71A 2MA9B 1V80A 1E5WA 3PV1A 2NS5A 2GOWA 2V1YA 4NPNA 4W9HA 3MHSD 3IVFA 1SE9A 3DVNV 3QC8B 2MLBA 4IW0A 3WA0A 3AULA 1MG8A 3R7QA 4HVBA 3H1UA 4ZRJA 4BKGA 3MTNB 5AZGA 3RT3B 1EF1A 1VD2A 2N7EA 1WXAA 2Z0EB 2M17A 5J17A 2D07B 3KUDB 2ZCCA 2K1FA 3TBLD 2MBBB 3KW5B 2PJHA 2L0TA 2LD9A 3EFUA 3K9OB 4DWFA 3AU5A 1EF5A 2K6DB 4NAWA 5FR6A 2G4SA 2KTFA 2MBOA 3VHTC 4GB9A 3L54A 4HCNB 2K25A 3ML9A 5G2NA 1V6EA 2N4FA 2C60A 1UD7A 4AJYB 1I35A 4KIKB 2M0XA 3UQAA 2JY6A 4HWIB 4MGIE 4CHKA 1Q5WB 4W9IA 2HE7A 1OQYA 1WRDB 4EZKA 3VH3B 3UINB 4F1SA 4W9KA 2LVOA 3JSVB 2NBWB 3DBLI 4MJSA 3PRPB 4HDOA 3WIMA 2Z59B 1LQBA 3H7PA 2LGDA 2MP2A 4G11A 2LVQA 1PQSA 3PRZA 2JF5A 5E6PA 3SHQA 1OTRB 2D11A 1Y8RC 1Z2MA 4W9LA 3VH4B 3A9KB 2GBKA 4HXDA 4MELA 4W9EA 2ZNVB 4WJNA 4B6WA 1XD3B 2YLMA 4BKTA 2DAJA 2KDBA 2KZRA 4II2B 3W1YA 5IAAC 3KUCB 1SGHA 1WZ0A 2AL6A 3U30A 4XC2A 2FAZA 1V49A 1P0RA 3V62A 2RSUA 2BPSA 4AUQC 1P3QU 3EC8A 2KC2A 4GGQA 1GG3A 4W9GA 4K81A 2BWES 4HPLB 2KDIA 5LXHA 1AARA 5TR5A 3QK0A 3ONSA 3RUIB 5JHBA 4ANVA 4PS8A 3EHVA 1KM7A 2PEAA 5KHQA 1SIFA 1E8ZA 1WY8A 2MCNB 4M0WB 2JZZA 1WE6A 4KSKC 1KOTA 2KDEB 4HLEA 5E6NA 2DYOA 4W9FA 2MSED 4MSMB 2KFKB 2XEWA 2K8CA 5GMVA 3HM3A 2NVUI 2RGFA 4TQ1A 2KC1A 3DDCB 2D2QA 3A1QB 3M95A 2ZNVC 2IO2B 3VDZA 3X0WA 3L16A 1T0YA 2GBNA 4GOCA 4JIOU 5L95C 1YIWA 3PSEB 1WMHB 3VUWA 2LGXA 2NBVB 2K8BA 2K8HA 1E7VA 3DQVA 3N3KB 3RZWC 4AWJA 3APFA 4LJOB 1WM3A 3ZDTA 1OGWA 1HE8A 1YX6B 4CO7A 2DAFA 2EMTA 3A4RA 2LASA 4EUTA 4TUUA 4NJ7A 2L3ZA 5CX3A 5E6OA 1UBIA 2EMSA 4GDLA 1H4RA 3KYCD 4XZ4A 4TQ0A 1UH6A 4KV2A 2R2QA 4IC7B 4MSQB 2C9WB 3ZTDA 4MGZE 2W9NA 2J7QB 1Q1OA 3I3TB 4HCPB 2CHWA 2O2VB 4DBGA 3ENEA 2KWCA 4J6IA 4BFRA 4F8CB 3CMMB 2L76A 4WQOB 2V4LA 3ZO5B 4ZYNA 3PT2B 2CS4A 4AOFA 4ZDVA 2KQSA 1ZKHA 5J18A 2IYDB 2CU1A 3ZVVA 2J0KA 1S1QB 2IO1B 4EKUA 3SDLC 3T8MA 2JWZA 3VTUA 2VRRB 3WALA 1Q0WB 1NBFC 2CHZA 2LRUA 2REXA 4AP4C 3R7RA 4DK5A 2C7NB 4ZRKA 3VVWB 1R4MI 4ICUA 1UBQA 3LJ3A 3AI5A 4RMAA 1GC7A 3IFWB 3RULA 1C1YB 1LXDA 5JHAA 1J19A 2LUEA 2N1WA 2KVRA 5IA7A 4GDKA 1V2YA 4DHJB 3PTFC 3QCAA 2KOXA 4BOSC 5C23A 1V86A 2FIFA 4GSWA 3PGEA 2MBQA 4GU2A 2CKHB 3ZLZA 1A5RA 2LRWA 3ZUNA 1ZW7A 2NPTA 2DYBA 3W1SA 3ZNHB 4WAAA 1OEYA 4WJOA 3PVLA 2ZEQA 4NY0A 2NBUA 4LDTD 1TZ1A 1XQQA 3A9JA 5BO4B 2XK5B 2ASQA 2DHZA 2R2OA 4G50A 5DPSA 2KJHB 4YL8A 1X1MA 3OJ4B 3ZKJC 1TTNA 4PS3A 3K9PB 3GOEA 2DZKA 3EECA 3VTWA 1IP9A 1WJUA 2IBIB 1M94A 2KQ7A 2BKRB 4HJKA 3RD2A 2O6VA 2MWSB 3N32A 5DPRA 5AZFA 4WJQA 1WGYA 4FHKA 5DPWA 2KKCA 2DZIA 2RD0A 3UGBB 2AL3A 4JLCA 2L7RA 3M3JA 1LFDA 1NDDA 2MX2A 3L10B 2NCNA 2KTRA 4IM3A 5CHWA 4WWPA 4E3CA 4NNJB 2OOBB 4DDID 2FCSA 2O6VD 4EOYA 2MW5A 2Z0DB 3Q3JA 4HK2A 2KDFB 3DVNU 4IG7B 2N9XA 4ANXA 4NQLB 2G45B 3DBHI 2FUHB 1WGRA 1YJ1A 3DBSA 3DVGY 4I6PA 4NAWB 3CF6E 3RZFA 3ECIA 4BKSD 4N9F4 3VUYA 1WXVA 2J0MA 1GNUA 1WF9A 2GMIC 3ZRFA 1WX8A 2JRIB 4WJPA 2MBEA 4KZCA 3DCGA
chains in the Genus database with same CATH superfamily
3B2GA 3DBRI 1E7UA 3QARA 2INNE 3P2BA 1XF5L 1FRDA 4E74A 1HTQA 2LHEA 2KJRA 2JYTA 3H7PB 3RFZB 4KDIC 4ARIA 2EKIA 1XEEA 2KFJA 4M8MA 1QLBB 4GXBA 1L2NA 3HVDA 2JZPA 3FILB 1HEZE 3N1ZC 1ZDVA 3R66C 3IAM1 3TMPB 3Q69A 3VTVA 1P98A 2L52A 2PKOA 3AEEB 4S17A 5DCNA 5EDSA 2N7DA 1JRPA 1WFYA 4M8NA 1E10A 2DX5B 3APCA 1HQRD 3DPDA 3APDA 2JUOA 1LO5D 3ZW3A 2LUMA 3IT4B 4FXCA 4YXDB 1YJIA 3H6NA 5J2RA 4B0MA 1JRUA 3B08A 4MH0E 1R4NB 2BYTA 1F0ZA 3C0RB 2K5PA 2INDC 2KXJA 1SE2A 1AWDA 1DYQA 2J0JA 4LNNA 3GZNB 4HPMB 4NQKE 3DOWA 2KJ6A 4KX6B 4DHJD 3U52E 3TJPA 2V3NA 1CK1A 2NMQA 1DOIA 5AZHA 2XK5A 4D2KA 2KWDA 2CR5A 3TIXA 2ZVNA 5EE1A 3AEAB 3H9DA 1ZXIA 2H89B 1D3ZA 4IUMB 5FKAC 4WWNA 3TSSA 3QIJA 3TL5A 2KO3A 4RCOA 2BYFA 3B9JA 4FJVB 2G4DB 3WAPA 2MHJA 1QZEA 4LDTB 1IGDA 4X57B 4BKSA 1R4NI 3MFGA 2AQ3B 2KLCA 4JL9A 1UGMA 3N30A 2Y5BB 3V61A 3GZNI 3N20C 2KMCA 1XLPA 1Z5SB 2WDTB 3AMZA 3HVZA 2K39A 4HROA 3TCAA 5CHVC 4K7WA 1TKYA 5BMIA 1UELA 1WJ6A 3NY5A 4OVUA 4G3XB 2PE6B 1J8CA 1OFFA 3PREA 4JX1C 3A1QA 3AE4B 3C8YA 1QT9A 4W9JA 5AEKB 1UUPA 3RNCC 2GRIA 3Q2AC 1WMHA 1WGGA 3JYUA 4OZCA 2WX0A 1FIQA 3PPAA 1IYFA 2MJEA 1KJTA 2KD0A 4P1BC 1NI3A 2KWVB 2A5UA 3L13A 3RCZA 1E8YA 2RDGA 1EUVB 1TBEA 1IBXA 2IPKD 5HKHA 3O65B 3NUHB 1N63A 1WYGA 2WX1A 4F7ZA 3EGRA 2KN5A 1QQRA 5DPTA 3AU4A 2JU6X 1TJEA 1WYWB 2L8JA 3N1XC 1FFVA 3JVZX 1C3TA 2IJ0A 1AW7A 3DBLB 2GB1A 1WR6E 1WH3A 1FPYA 2FIDA 2WU2B 1NI2A 4C00A 1SJHD 3BK1A 2LJIA 4IWOA 3ZJUA 3AE8B 1Y56A 4W9HA 1GAQB 1MG8A 3AEBB 4ZRJA 1EF1A 2Z0EB 5J17A 1WXAA 2M17A 3KUDB 2ZCCA 2K1FA 3NJTA 2PJHA 1GB1A 4DWFA 5JXVA 2G4SA 3VHTC 5G2NA 1FRRA 1V6EA 1I35A 4MGIE 2WP9B 4W9IA 4EZKA 3VH3B 2W55A 2NTSA 4W9KA 5IOIA 3DBLI 2Z59B 1LQBA 4YTMB 2LGDA 4G11A 1C79A 1YJJA 2LFIA 3SHQA 1OTRB 2D11A 1Z2MA 1I4GA 1WRIA 4TSSA 2WDQB 3VH4B 1JALA 2ZNVB 3W2DA 2DAJA 2KZRA 1SB3C 3NG0A 1T5XD 4RGNA 5IAAC 1SGHA 1WZ0A 3SFEB 3U30A 2OJWA 1OQRA 1V49A 2Q5WD 2BPSA 4AUQC 3AH7A 2QILA 3EC8A 2R61A 4W9GA 2BWES 4HPLB 5GXGB 4XE0A 3I57A 3KWLA 3Q3NC 2QEJC 3ZYYX 3ONSA 1J7CA 4OZBA 1VR9A 2PEAA 1E0ZA 1SIFA 1E8ZA 1WY8A 2MCNB 4M0WB 3DWGC 1KOTA 5E6JA 1HA5A 2KDEB 4KGRA 1KRHA 4W9FA 4MSMB 1FO4A 2KFKB 1PDXA 2K8CA 1F2RC 5GMVA 2RGFA 4TQ1A 2IO2B 4JIOU 1YIWA 3PSEB 1EWYC 3VUWA 2NBVB 2K8BA 1YQ4B 4AWJA 1C77A 2D3BA 3GE8C 1YX6B 5E6OA 4GDLA 1H4RA 1QOGA 1UH6A 4AS1A 4GLSC 2DWQA 2YEPF 1ESFA 4S0RA 1Q1OA 2ICIA 5HFYA 3ENEA 4J6IA 2OEDA 3ZO5B 4ZYNA 2JSVX 2IYDB 3MP9A 2CU1A 3ZVVA 5J18A 2IO1B 3SDLC 3T8MA 2JWZA 1Q0WB 1NBFC 2CHZA 2LRUA 2QJLA 2REXA 4DK5A 2JXTA 3AI5A 4RMAA 1LXDA 1VRAB 2KVRA 2BW2A 1V2YA 4GDKA 4DHJB 2PMVA 4ACFA 4OVZA 3QCAA 2KOXA 2FIFA 1JWUD 4GU2A 3ZLZA 1A5RA 4USAA 2WXIA 2NPTA 4HRSA 2DYBA 3W1SA 4C7YA 1OEYA 4LDTD 2E6XA 3W5UB 4G50A 3Q8EA 2DHZA 5DPSA 1TTNA 2KDMA 4PS3A 1F1HA 2WXQA 1YNTE 3GB1A 3AEGB 4MH8A 3NRZA 4WJQA 2WXLA 5BYRA 4US8A 5DPWA 2AL3A 4JLCA 5BYSA 3M3JA 3L10B 1HZ5A 1OQQA 2WXFA 2HTME 1VLBA 2J53A 1VDVA 4DDID 4C4VA 3DVGY 1WGRA 3AE1B 4YT0B 4BKSD 2INCC 4Q2JA 1C4AA 2KQ4X 2JRIB 4WJPA 2MBEA 1D5ZC 1Q10A 3BVZA 4I6NB 1E90A 2GBRA 3U2SC 5BMHA 2WXGA 3OAWA 3KWVA 4DXGA 1N61A 2FCNA 2Y5PA 4HKZE 4MGYE 3VFKA 1ET6A 3PRMB 3L0WB 2J52A 1WI0A 3ZNGC 1MPEA 1YQBA 3Q6BA 4A90A 3V6EB 3UIPB 2N7JA 2TSSA 1D6EC 3L08A 2AQ1B 3ZNZB 1FNWA 2WXPA 5LXIB 3H7SA 1V81A 3PZ7A 4CYEA 4JGHB 3RMKC 1L0VB 2HJ8A 1GJZA 2W54A 1SF0A 3FKYA 1G6JA 3OJ3A 2N9LA 1V1PA 4AQ7A 4FHJA 1UGJA 1XCQL 2V3SA 3B0AA 4JPSA 4REZA 2KNBA 2ZJDA 4MDKE 3PS6A 4DDGD 3O13A 3A4SC 1QOFA 2L05A 3HK0A 3UIOB 2M8SA 3MJWA 1PGXA 3EUB2 4FJYA 1H8CA 1V9JA 3KH0A 2NTTA 3MC9A 1M4VA 4B0EA 3BIID 2JYEA 2GBMA 3L17A 3ETRA 3V6CB 5CHFA 2FNJB 2I1KA 4KIKA 2MQJA 3KUZA 1WE7A 2B76B 4I6LB 4QAYA 1RRBA 1V1OA 3R2IA 2JT4B 4FJZA 5FK9C 4EEWA 4P16A 3U8ZA 4MGKE 3KVFB 4IOIE 4EZJA 1QOAA 2M4NA 2AEHA 3Q8AA 2V3PA 1L4ZB 3A9JB 2H88B 4DHZB 1JCKB 1PGBA 1NYRA 2PE9A 1C9FA 2O6VB 2KACA 4MJSB 2KN4A 2KX3A 2WXHA 1KLVA 1EU3A 4BOZB 4MM3A 2UYZB 4BZAA 4FBJB 2KTRB 2LGYA 3CSFA 4ICVA 1E9MA 1XLQA 2C7HA 3CSTA 1WSPA 5JZEB 2ZVOA 2WDVB 1CJEA 3W1SC 4FLHA 4FULA 2N9EB 2RMMA 2I2YA 1ACCA 3PLVA 4RFBA 3JW0X 2BBCA 1K8RB 1PGAA 2JQRB 2ONQA 4C80A 3PHXB 2O2VA 1EO6A 3IHPC 2LZ6A 2BQQA 4A3OA 2LMCA 1J0GA 4PYUA 1SBBB 3RNBC 4KVGB 4AJWA 1XT9B 4LNFA 3QHTA 4US9A 4H2AA 5D7GA 3Q14C 3BY4B 3IBEA 4TV3A 1V5OA 3ZXRA 5D3IB 3M63B 4KGTA 1B9RA 4RGMA 4ZRIA 4DHZE 1MFWA 2C7MB 2G3QB 1E5WA 2V1YA 3IVFA 1SE9A 3DVNV 3QC8B 4A55A 4MT5A 3R2TA 3MTNB 1VD2A 2N7EA 1I4HA 1C4PA 2D07B 2LHDA 2MBBB 1HXYD 3EFUA 1PYWD 4NAWA 2MBOA 2K25A 3ML9A 2Y5CA 4YTNB 1UD7A 2M0XA 4KGSA 2HE7A 3UINB 3RI7C 4HDOA 3WIMA 3SR6A 2MP2A 1FM0D 3PRZA 2JF5A 3W9CB 3U4EG 5E6PA 3P42A 4HXDA 4W9EA 4WJNA 4B6WA 1XD3B 2WS3B 3URYA 3BVMA 1L4DB 2CJOA 1IUEA 3V62A 1P3QU 4GGQA 1GG3A 1XLNA 4K81A 4MACA 5D3DA 2QDFA 2KDIA 1HTOA 1AN8A 2ZW0A 1KM7A 1FXIA 3AB5A 2JZZA 1WE6A 4HLEA 3B2FA 3AECB 3HM3A 2V9HA 3RNAC 2MJ3A 3A1QB 3M95A 4OW0A 2GBNA 3WCQA 1F2RI 3AE9B 1WMHB 3Q8CA 1N60A 2K8HA 3BZDB 3DQVA 3AE6B 3N3KB 5T8IA 3RZWC 4LJOB 5C2TB 1OGWA 4NJ7A 5CX3A 2FE8A 4XZ4A 4TQ0A 4HPPA 3W5VB 4KV2A 2R2QA 2WXNA 5IP4D 2QSDA 1BXTA 1JWBD 4MGZE 3AE2B 5HHDG 2J7QB 4WURA 4BFRA 2KWCA 4F8CB 2V4LA 2CS4A 2KQSA 1S1QB 4EKUA 1VZ8A 2VRRB 3WALA 2C7NB 3DBHB 2DBYA 1GC7A 3VRAB 1TS3A 2N1WA 5IA7A 1K50A 2W3SA 3KLSX 3DHIC 1KLGD 2MBQA 2LRWA 3ZUNA 1ZXHA 4WJOA 5C3JB 2V4IB 4NY0A 2K9XA 2NBUA 3RPFC 2KJHB 4YL8A 2KMMA 2K0PA 3OJ4B 3ZKJC 3K9PB 4LNOA 2L32A 3VTWA 1JW9D 1FNVA 1L5PA 2KQ7A 4HJKA 2MWSB 4RF1A 5G5HA 5AZFA 2KKCA 1XLOA 5AUIA 2L7RA 1LFDA 2MX2A 1SE3A 2NCNA 4IM3A 3CIRB 2OOBB 4EOYA 2O6VD 2Z0DB 4HK2A 4ANXA 2JX5A 2N9XA 3DBHI 3RZFA 2VZKD 2WGSA 4KZCA 3DCGA 2DLBA 2RR9A 5G5GA 2CHXA 4XGAB 1P1AA 2BKFA 2WYQA 1FNUA 3UF8A 3NS8A 3VR8B 2LXCA 2OJRA 3ZDMC 3FC4A 4GN1A 1YOVB 3S2AA 3TEWA 1RAXA 2WWZA 4EZLA 2DZJA 3M62B 3P4SB 2ON8A 3DVGX 1WXMA 2IGGA 4LCDE 2PPHA 2WXMA 2JXXA 1B1ZA 3PHWB 4NAMA 1WJNA 4JQWC 2C5LC 3ALBA 4IM0A 4RNAA 3NOBA 4ZRQA 3EFCA 1MJDA 5H92C 4J3OD 4ZHPA 1K52A 3ZTCA 3AXCA 3SD5A 4XDCA 4UDUC 1BT0A 1NEKB 2QMTA 3ZNID 3CWIA 1IGCA 1V5TA 1P7EA 4GIVA 4TMAB 5CTRC 4K3CA 2QCZA 2KANA 1UWXA 4KSLC 1NVID 2BF8B 2LJ5A 4BVUC 4L2YA 4C7ZA 3BWUD 1N6ZA 2BYVE 5L83A 2MRPA 1ZGUB 3Q3OC 4GDLB 1N62A 2IY1B 4IWQA 2M1MA 2PVOD 5BMGA 1SSNA 2XNAC 1VCBA 4BBNF 1TY2A 3RYTA 3T3NA 2CJNA 3VQIA 5KHOA 2WXKA 1XO3A 4ANWA 1VJKA 3BINA 2FCQA 3JSVA 4N6EB 1TZOA 4JWSC 1LM8B 2GI9A 1L7YA 2M0AA 4GDKB 2LGSA 3A9KA 1ENFA 4ZRPA 2GBJA 2WXOA 4NJ6A 4A8XC 2IO0B 2NPTB 4XYCA 4A20A 4LLGM 4KDLB 2K6QA 4K7SA 3QX1A 3PZ8A 3VRBB 2DENB 2KLGA 4WWOA 2KHWB 1WX7A 1L6UA 4EFOA 1SEBD 3HHMA 3LYYA 3DHHC 1U4AA 2SEBD 3VAWA 1V8CA 3TEYA 2UWQA 1HZ6A 4IM2A 2BYEA 1FXTB 4C4VB 4FA6A 4G0NB 1YD8U 5EE3A 1TYGB 1UZXB 2KWUB 2D3GA 1D5MC 2ZZPB 1ZDXA 1WGHA 2Z8LA 1WJ4A 4LNKA 2E3TA 4FN2A 1JWMD 2I1JA 5AUKA 3TEZA 3QQ8B 2I38A 3PZDA 1FCCC 4LK0M 3EA6A 3C19A 1KLUD 2ACZB 1F77A 4WAFA 2V0GA 2K22A 1IPGA 3R3MA 1QKZA 1WX9A 4PYZA 2ZPYA 1JQ4A 1AYFA 3ZIMA 3P4RB 2M19A 3SU8X 5FR3A 1I42A 3RNEC 1DOYA 2PW9A 2KT7A 4P1CC 3MJ5A 4IWPA 4OVVA 1RFAA 1XCTL 1K51A 3SFDB 2EKEC 2RDHA 2IZVB 3AM9A 4K1RB 1RM6C 4R3DA 2X38A 2BGFA 2WDRB 3X23A 3VXWA 1UNSA 1GUAB 3KQ4A 1YMHE 2JRHA 3LDZE 4ASWC 1E8XA 1V1PB 3WANA 4E71A 3B1LX 3ZQ4A 4YSYB 2MA9B 2GOWA 4NPNA 3MHSD 3DHGC 3Q3MC 2MLBA 3WA0A 1T0SC 4HVBA 3H1UA 1KFYB 1L0YB 5AZGA 2MJDA 1T0QC 2L0TA 2LD9A 3K9OB 2IGHA 2K6DB 5FR6A 3I5JC 2KTFA 2L1AA 2WXJA 3P1MA 4GB9A 4PK1A 3UI3A 2N4FA 2C60A 3I9V1 4KIKB 1SE4A 4HWIB 1I4RA 1OQYA 2AX5A 2LVOA 2G9HD 1FCLA 4MJSA 1MVKA 3Q8FA 3H7PA 2LVQA 1PQSA 1Y8RC 3MC0B 1E6EB 4MELA 2K3UA 4BKTA 2KDBA 2Y3AA 4II2B 3FILA 3W1YA 3ZJTA 1L0XB 4XC2A 1VZ6A 1P0RA 2VZKB 4CQNA 1TS5A 2EELA 4P6VF 2HJ1A 3SEBA 5LXHA 2MEKA 5TR5A 1GPXA 1T3QA 3QK0A 3RUIB 1TY0A 5JHBA 4PS8A 1FMAD 3IXSA 3P4QB 2QIEB 2PLPA 1R4MB 1TIFA 2XEWA 4MM3B 2FUG1 2NVUI 2KC1A 1KF6B 3DDCB 2LEKA 2IGDA 3VDZA 3X0WA 1YN5A 1T0YA 4GOCA 5L95C 4M02A 4RH6A 2YEPB 1E7VA 4XWWA 3IAS1 3HRDD 1WXQA 2GLSA 2KVZA 4EUTA 1TT5B 3RNFC 3ZGZA 1UBIA 2EMSA 1C76A 2RDBC 3KYCD 4YWGG 4DQOC 4IC7B 1T0RC 2C9WB 3I3TB 4HCPB 4DBGA 2O2VB 3CMMB 2L76A 1UWMA 1I7HA 4ZDVA 1A70A 1ZKHA 1WWTA 2J0KA 3VTUA 4K3BA 4L1BA 1R4MI 4ICUA 3RULA 3IFWB 3HUIA 3FAHA 3E9SA 1R7SA 1I4QA 1ROEA 2BT6A 4BOSC 4GSWA 4A6QA 1V97A 1ZOYB 4WAAA 3PVLA 2ZEQA 5BO4B 2XK5B 1SXTA 2ASQA 2R2OA 2VH2A 3N1YC 1MHXA 4KKJA 4YSXB 1MHHE 3EECA 1JROA 4KKIA 3RD2A 3OWEB 3N32A 4YSZB 2RD0A 2DZIA 3UGBB 1STEA 5CHWA 4HKQA 4WWPA 4E3CA 1NENB 3NVYA 4NNJB 4JWUC 4NZLB 1ZE3D 1DGJA 3Q3JA 2KDFB 3AEFB 1YJ1A 4I6PA 1DOXA 4NAWB 3CF6E 3VUYA 2J0MA 1GNUA 1WF9A 3ZRFA 1WX8A 2M56B 2DZMA 4ITKA 2W3RA 5G55A 4O1NA 2BVCA 4M00A 2XBBC 4HDQA 2XN9C 2MP2B 4A9AA 2LXAA 3NHEB 3V60A 1I4PA 4NJCA 1JMLA 3NZSA 3VR9B 3Q3FA 1GOZA 3BYTB 4TKNA 4LJPB 1YX5B 5LLIA 4B95A 3GE3C 1K53A 3TUOA 1BMLC 2N9PC 4LTUA 5D6JB 4ZYSA 1TKEA 2BWFA 2QHOA 4N58A 1EM7A 3NZUA 3RNGC 3LB8C 3HM6X 3KYDD 4DXFA 3QAQA 4KZ0A 3MHZA 2J4XA 4II3B 2L83A 2J42A 1FXAA 2D5GA 1C78A 1RLFA 3U7DA 3AE3B 2ZPNA 1WM2A 2LVPA 3H8HA 1JWSD 4PS7A 1IBXB 5TSSA 1KH0A 2BB6A 1ZUD2 2L00B 2KX0A 2KAJA 3NVVA 5JH5C 4RGOS 3A33B 4MEMA 2PVGC 3ZRCA 3AE5B 4DXAB 3ML8A 1PFDA 2W82A 2D3CA 5D94A 2FCMA 4W9DA 3DWMA 1CMXB 1YQ3B 2IY0B 3HIZA 3RN9C 1P9DU 3QA8A 3P63A 4M01A 1WXSA 1CZPA 4BBNC 1ISNA 3T9LA 2CU3A 3OLMD 3AEDB 4FADA 2HTHA 2RPVA 4WQMA 2WLBA 1TGZB 2WQYB 2JWUA 1ZPSA 3AE7B 4W9CA 4GMVA 3WAOA 3UQBA 2INPE 4XDDA 2JZ3B 2DNFA 1WZ3A 2RPQA 4A3PA 1JWAD 2FBWB 1PUTA 4JE3B 1QOBA 2JVCA 1WIAA 1LGRA 3BVGA 4M0WA 5H8YE 2N0SB 2N1VA 3VUXA 1ET9A 4URKA 3D32A 2JPHA 2L0FA 1ZP0B 2KFKA 2ZCBA 5C1ZA 2AWTA 2IO3B 1WR1A 1QF6A 1GC6A 1FEHA 3NZ3A 2LWPA 1S3SG 2KK8A 4OZAA 1F9JA 2LI5A 4RM8A 2YVCA 4RM9A 1MI0A 1TS2A 1WGDA 2DYMA 3MC8A 4ANUA 3WAMA 2MH7A 4XX5A 3LXFA 2MBHA 2ZW1A 2D10A 3R8BA 4B9KA 1OEYJ 2PTLA 2BB5A 1TS4A 3BYYB 3PLUA 3QJZA 4LNIA 1F52A 3N9YC 3PO0A 4XWTA 3I63C 2B3AA 1CQVA 3IG3A 3AN1A 3OG5A 4EE2A 4RF0A 1RYJA 2BS2B 2KMAA 1E8WA 1FD6A 1D4BA 2X8XX 2HD5B 1FFUA 3E56A 1QILA 2WNMA 2AYOB 2NR2A 2HDEA 3U7ZA 3QWZB 3GP7A 4N59A 4P7IA 4K7UA 5D2MB 5EE9A 2A4ZA 5I4DA 3V05A 3T3OA 3PV1A 1V80A 2NS5A 4ARCA 1N5XA 1YN4A 4IDIA 1J7BA 3ZJVA 2N9KA 3GS2A 3NVWA 4IW0A 1TKGA 3AULA 1EU4A 3R7QA 1D5XC 4RGTA 4BKGA 2WU5B 3RT3B 3TBLD 3KW5B 2BTEA 3AU5A 1EF5A 1UF0A 3L54A 4HCNB 1RWSA 3ABVB 1MG4A 4AJYB 3UQAA 2JY6A 4CHKA 1Q5WB 5IN7A 1WRDB 4WWMA 4F1SA 3JSVB 2NBWB 4L23A 2OHFA 3PRPB 3L4PA 1L6VA 4C56C 4W9LA 3A9KB 5IO9A 2GBKA 3NS1A 1RFKA 2YLMA 3KUCB 2AL6A 2FAZA 2RSUA 1J7AA 2KC2A 4WH4A 3BK2A 3Q8BA 1AARA 5HG2A 2SAKA 1I4XA 4ANVA 5BYQA 1SJED 3EHVA 4WIPA 5IKCM 5KHQA 2G1EA 4KSKC 4ZHOA 5E6NA 2DYOA 2MSED 4HJGE 1VZ7A 1XXGA 2AQ2B 2BS3B 2KYWA 2D2QA 2ZNVC 1E7PB 3IT6B 3L16A 3AV8A 2WXRA 2BS4B 2LGXA 3APFA 5MPOA 1WM3A 3ZDTA 1HE8A 4CO7A 2DAFA 2EMTA 4IKGA 3A4RA 2LASA 4TUUA 3J9CA 2L3ZA 5EE0A 4BAXA 1T6BX 4MSQB 1YN3A 2D3AA 3ZTDA 2W9NA 2CHWA 4OHJA 4WQOB 3PT2B 4AOFA 2IDYA 4AP4C 2WHIA 3R7RA 4ZRKA 3VVWB 3ZXVA 1UBQA 3LJ3A 5JHAA 1C1YB 1C4CA 1J19A 2LUEA 3NVZA 1SIJA 3PTFC 2UU7A 3DBRB 5C23A 1V86A 3PGEA 1P7FA 1EWCA 2CKHB 2LGIA 1ZW7A 3ZNHB 5HI1A 2PIAA 1NYQA 1TZ1A 4HEA1 1XQQA 3A9JA 1X1MA 3GOEA 2DZKA 1IP9A 1WJUA 2IBIB 3P4PB 1M94A 2BKRB 2O6VA 5DPRA 1WGKA 1WGYA 4FHKA 2VH1A 1GB4A 1NDDA 2KTRA 2FCSA 2MW5A 4IG7B 3TEXA 3DVNU 4NQLB 4YTPB 5LNK1 2G45B 2QC8A 2FUHB 3DBSA 3V3XA 1BUIC 1N5WA 3ECIA 1KTKA 1WXVA 4ZOHC 2GMIC 4N9F4 4PT5A
chains in the Genus database with same CATH topology
2DZMA 3DBRI 2RR9A 1E7UA 4I6NB 5G55A 3QARA 3P2BA 2CHXA 1E90A 2GBRA 4E74A 1P1AA 2BKFA 2WYQA 2KJRA 3H7PB 2XBBC 4HDQA 3OAWA 2MP2B 3NS8A 3UF8A 2LXCA 4KDIC 2OJRA 3ZDMC 2LXAA 3NHEB 2FCNA 2KFJA 4GN1A 3S2AA 1RAXA 3V60A 2WWZA 4M8MA 2DZJA 4EZLA 3M62B 4GXBA 1L2NA 3DVGX 1WXMA 4MGYE 3VFKA 3NZSA 3L0WB 3PRMB 4LCDE 1WI0A 2PPHA 3R66C 2JXXA 3Q3FA 3ZNGC 4TKNA 3TMPB 3VTVA 4LJPB 1P98A 1YQBA 3PHWB 3V6EB 1YX5B 5LLIA 1WJNA 3UIPB 4B95A 4JQWC 2C5LC 3ALBA 3L08A 2N9PC 4IM0A 3ZNZB 3NOBA 5D6JB 5DCNA 2BWFA 5LXIB 3H7SA 2QHOA 5EDSA 1V81A 2N7DA 1WFYA 4CYEA 3ZTCA 3NZUA 3AXCA 4JGHB 4M8NA 3SD5A 3HM6X 3KYDD 2DX5B 3APCA 1BT0A 3QAQA 2HJ8A 1GJZA 3DPDA 4KZ0A 3APDA 4II3B 2JUOA 3ZNID 3ZW3A 1V5TA 4GIVA 1G6JA 3OJ3A 1RLFA 3U7DA 5CTRC 2ZPNA 4FHJA 1WM2A 3H6NA 5J2RA 2LVPA 2KANA 1JRUA 4PS7A 4KSLC 2BF8B 3B0AA 2V3SA 2LJ5A 3B08A 4MH0E 4BVUC 2KNBA 3C0RB 2ZJDA 2KXJA 4MDKE 2J0JA 3PS6A 4DDGD 2BYVE 3A4SC 4HPMB 5L83A 2L00B 4NQKE 3DOWA 2KX0A 2MRPA 3HK0A 1ZGUB 2L05A 2KJ6A 2M8SA 3MJWA 4GDLB 3A33B 3UIOB 5JH5C 4MEMA 2IY1B 4DHJD 4FJYA 4IWQA 2M1MA 1H8CA 3ZRCA 3TJPA 1V9JA 3KH0A 5AZHA 4DXAB 3ML8A 1VCBA 4BBNF 2XK5A 2GBMA 3L17A 3RYTA 5D94A 3V6CB 2CR5A 5CHFA 2FNJB 3VQIA 5KHOA 3TIXA 2I1KA 2ZVNA 4KIKA 2FCMA 4W9DA 2MQJA 3H9DA 3KUZA 4ANWA 1D3ZA 1CMXB 4IUMB 3BINA 2FCQA 1WE7A 4WWNA 3JSVA 3QIJA 2IY0B 3TL5A 2KO3A 1LM8B 4I6LB 3HIZA 2BYFA 4FJVB 1P9DU 1L7YA 2G4DB 3QA8A 4GDKB 1RRBA 3WAPA 4FJZA 2JT4B 3A9KA 1WXSA 1QZEA 4EEWA 3U8ZA 4BBNC 4LDTB 2GBJA 1ISNA 4NJ6A 4MGKE 3T9LA 2IO0B 3KVFB 4X57B 3OLMD 4BKSA 4FADA 2HTHA 1R4NI 2NPTB 2KLCA 4JL9A 1UGMA 3N30A 1TGZB 4A20A 2M4NA 2Y5BB 3V61A 4KDLB 4EZJA 2K6QA 2AEHA 4K7SA 3GZNI 4GMVA 3QX1A 4W9CA 3WAOA 2KMCA 3UQBA 2DENB 2KLGA 2JZ3B 3A9JB 4WWOA 1Z5SB 1WZ3A 2KHWB 1WX7A 2RPQA 4A3PA 2WDTB 4EFOA 4DHZB 2K39A 2JVCA 1WIAA 3HHMA 3TCAA 1U4AA 2PE9A 2N1VA 3VUXA 2O6VB 3VAWA 5CHVC 4URKA 4MJSB 2KX3A 2JPHA 3D32A 4K7WA 1KLVA 1UELA 2L0FA 1WJ6A 2KFKA 2ZCBA 3NY5A 4MM3A 2UYZB 4BOZB 2AWTA 2IO3B 2UWQA 4FBJB 2KTRB 5C1ZA 2LGYA 4OVUA 1WR1A 3CSFA 4ICVA 4IM2A 2BYEA 4G3XB 1FXTB 2PE6B 1J8CA 4FA6A 3PREA 3A1QA 2C7HA 4G0NB 3CSTA 1YD8U 5JZEB 1GC6A 1UZXB 2KWUB 4W9JA 2ZVOA 5AEKB 2D3GA 2ZZPB 2LWPA 1S3SG 1WMHA 2KK8A 1WGHA 3W1SC 1WGGA 1WJ4A 4FLHA 1F9JA 2LI5A 4RM8A 2YVCA 3JYUA 4FN2A 2I1JA 4RM9A 2WX0A 1WGDA 2DYMA 4FULA 4ANUA 3QQ8B 3WAMA 3PZDA 2N9EB 4XX5A 3PPAA 1IYFA 3PLVA 2MBHA 3JW0X 1K8RB 3PHXB 1KJTA 2D10A 2KD0A 4B9KA 1OEYJ 2KWVB 2O2VA 2A5UA 1EO6A 3IHPC 3L13A 3RCZA 1IPGA 1E8YA 3R3MA 3PLUA 3QJZA 1EUVB 1TBEA 1WX9A 2LZ6A 2B3AA 4PYZA 2ZPYA 3IG3A 5HKHA 3O65B 4A3OA 1J0GA 3ZIMA 4PYUA 3SU8X 2WX1A 4F7ZA 2KMAA 1I42A 1E8WA 4KVGB 2KN5A 4AJWA 1XT9B 5DPTA 3AU4A 4IWPA 4OVVA 1RFAA 1WYWB 2HD5B 3QHTA 2L8JA 5D7GA 2EKEC 2AYOB 2IZVB 2NR2A 4K1RB 3BY4B 3IBEA 4TV3A 1V5OA 3JVZX 1C3TA 3QWZB 2BGFA 3M63B 4P7IA 1WR6E 1WH3A 3X23A 4K7UA 3VXWA 4ZRIA 2FIDA 5D2MB 1GUAB 1NI2A 2JRHA 2A4ZA 3LDZE 4ASWC 4DHZE 1E8XA 2C7MB 4IWOA 3WANA 3B1LX 2G3QB 4E71A 2MA9B 1V80A 1E5WA 3PV1A 2NS5A 2GOWA 2V1YA 4NPNA 4W9HA 3MHSD 3IVFA 1SE9A 3DVNV 3QC8B 2MLBA 4IW0A 3WA0A 3AULA 1MG8A 3R7QA 4HVBA 3H1UA 4ZRJA 4BKGA 3MTNB 5AZGA 3RT3B 1EF1A 1VD2A 2N7EA 1WXAA 2Z0EB 2M17A 5J17A 2D07B 3KUDB 2ZCCA 2K1FA 3TBLD 2MBBB 3KW5B 2PJHA 2L0TA 2LD9A 3EFUA 3K9OB 4DWFA 3AU5A 1EF5A 2K6DB 4NAWA 5FR6A 2G4SA 2KTFA 2MBOA 3VHTC 4GB9A 3L54A 4HCNB 2K25A 3ML9A 5G2NA 1V6EA 2N4FA 2C60A 1UD7A 4AJYB 1I35A 4KIKB 2M0XA 3UQAA 2JY6A 4HWIB 4MGIE 4CHKA 1Q5WB 4W9IA 2HE7A 1OQYA 1WRDB 4EZKA 3VH3B 3UINB 4F1SA 4W9KA 2LVOA 3JSVB 2NBWB 3DBLI 4MJSA 3PRPB 4HDOA 3WIMA 2Z59B 1LQBA 3H7PA 2LGDA 2MP2A 4G11A 2LVQA 1PQSA 3PRZA 2JF5A 5E6PA 3SHQA 1OTRB 2D11A 1Y8RC 1Z2MA 4W9LA 3VH4B 3A9KB 2GBKA 4HXDA 4MELA 4W9EA 2ZNVB 4WJNA 4B6WA 1XD3B 2YLMA 4BKTA 2DAJA 2KDBA 2KZRA 4II2B 3W1YA 5IAAC 3KUCB 1SGHA 1WZ0A 2AL6A 3U30A 4XC2A 2FAZA 1V49A 1P0RA 3V62A 2RSUA 2BPSA 4AUQC 1P3QU 3EC8A 2KC2A 4GGQA 1GG3A 4W9GA 4K81A 2BWES 4HPLB 2KDIA 5LXHA 1AARA 5TR5A 3QK0A 3ONSA 3RUIB 5JHBA 4ANVA 4PS8A 3EHVA 1KM7A 2PEAA 5KHQA 1SIFA 1E8ZA 1WY8A 2MCNB 4M0WB 2JZZA 1WE6A 4KSKC 1KOTA 2KDEB 4HLEA 5E6NA 2DYOA 4W9FA 2MSED 4MSMB 2KFKB 2XEWA 2K8CA 5GMVA 3HM3A 2NVUI 2RGFA 4TQ1A 2KC1A 3DDCB 2D2QA 3A1QB 3M95A 2ZNVC 2IO2B 3VDZA 3X0WA 3L16A 1T0YA 2GBNA 4GOCA 4JIOU 5L95C 1YIWA 3PSEB 1WMHB 3VUWA 2LGXA 2NBVB 2K8BA 2K8HA 1E7VA 3DQVA 3N3KB 3RZWC 4AWJA 3APFA 4LJOB 1WM3A 3ZDTA 1OGWA 1HE8A 1YX6B 4CO7A 2DAFA 2EMTA 3A4RA 2LASA 4EUTA 4TUUA 4NJ7A 2L3ZA 5CX3A 5E6OA 1UBIA 2EMSA 4GDLA 1H4RA 3KYCD 4XZ4A 4TQ0A 1UH6A 4KV2A 2R2QA 4IC7B 4MSQB 2C9WB 3ZTDA 4MGZE 2W9NA 2J7QB 1Q1OA 3I3TB 4HCPB 2CHWA 2O2VB 4DBGA 3ENEA 2KWCA 4J6IA 4BFRA 4F8CB 3CMMB 2L76A 4WQOB 2V4LA 3ZO5B 4ZYNA 3PT2B 2CS4A 4AOFA 4ZDVA 2KQSA 1ZKHA 5J18A 2IYDB 2CU1A 3ZVVA 2J0KA 1S1QB 2IO1B 4EKUA 3SDLC 3T8MA 2JWZA 3VTUA 2VRRB 3WALA 1Q0WB 1NBFC 2CHZA 2LRUA 2REXA 4AP4C 3R7RA 4DK5A 2C7NB 4ZRKA 3VVWB 1R4MI 4ICUA 1UBQA 3LJ3A 3AI5A 4RMAA 1GC7A 3IFWB 3RULA 1C1YB 1LXDA 5JHAA 1J19A 2LUEA 2N1WA 2KVRA 5IA7A 4GDKA 1V2YA 4DHJB 3PTFC 3QCAA 2KOXA 4BOSC 5C23A 1V86A 2FIFA 4GSWA 3PGEA 2MBQA 4GU2A 2CKHB 3ZLZA 1A5RA 2LRWA 3ZUNA 1ZW7A 2NPTA 2DYBA 3W1SA 3ZNHB 4WAAA 1OEYA 4WJOA 3PVLA 2ZEQA 4NY0A 2NBUA 4LDTD 1TZ1A 1XQQA 3A9JA 5BO4B 2XK5B 2ASQA 2DHZA 2R2OA 4G50A 5DPSA 2KJHB 4YL8A 1X1MA 3OJ4B 3ZKJC 1TTNA 4PS3A 3K9PB 3GOEA 2DZKA 3EECA 3VTWA 1IP9A 1WJUA 2IBIB 1M94A 2KQ7A 2BKRB 4HJKA 3RD2A 2O6VA 2MWSB 3N32A 5DPRA 5AZFA 4WJQA 1WGYA 4FHKA 5DPWA 2KKCA 2DZIA 2RD0A 3UGBB 2AL3A 4JLCA 2L7RA 3M3JA 1LFDA 1NDDA 2MX2A 3L10B 2NCNA 2KTRA 4IM3A 5CHWA 4WWPA 4E3CA 4NNJB 2OOBB 4DDID 2FCSA 2O6VD 4EOYA 2MW5A 2Z0DB 3Q3JA 4HK2A 2KDFB 3DVNU 4IG7B 2N9XA 4ANXA 4NQLB 2G45B 3DBHI 2FUHB 1WGRA 1YJ1A 3DBSA 3DVGY 4I6PA 4NAWB 3CF6E 3RZFA 3ECIA 4BKSD 4N9F4 3VUYA 1WXVA 2J0MA 1GNUA 1WF9A 2GMIC 3ZRFA 1WX8A 2JRIB 4WJPA 2MBEA 4KZCA 3DCGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DZM A;  3DBR I;  2RR9 A;  1E7U A;  4I6N B;  5G55 A;  3QAR A;  3P2B A;  2CHX A;  1E90 A;  2GBR A;  4E74 A;  1P1A A;  2BKF A;  2WYQ A;  2KJR A;  3H7P B;  2XBB C;  4HDQ A;  3OAW A;  2MP2 B;  3NS8 A;  3UF8 A;  2LXC A;  4KDI C;  2OJR A;  3ZDM C;  2LXA A;  3NHE B;  2FCN A;  2KFJ A;  4GN1 A;  3S2A A;  1RAX A;  3V60 A;  2WWZ A;  4M8M A;  2DZJ A;  4EZL A;  3M62 B;  4GXB A;  1L2N A;  3DVG X;  1WXM A;  4MGY E;  3VFK A;  3NZS A;  3L0W B;  3PRM B;  4LCD E;  1WI0 A;  2PPH A;  3R66 C;  2JXX A;  3Q3F A;  3ZNG C;  4TKN A;  3TMP B;  3VTV A;  4LJP B;  1P98 A;  1YQB A;  3PHW B;  3V6E B;  1YX5 B;  5LLI A;  1WJN A;  3UIP B;  4B95 A;  4JQW C;  2C5L C;  3ALB A;  3L08 A;  2N9P C;  4IM0 A;  3ZNZ B;  3NOB A;  5D6J B;  5DCN A;  2BWF A;  5LXI B;  3H7S A;  2QHO A;  5EDS A;  1V81 A;  2N7D A;  1WFY A;  4CYE A;  3ZTC A;  3NZU A;  3AXC A;  4JGH B;  4M8N A;  3SD5 A;  3HM6 X;  3KYD D;  2DX5 B;  3APC A;  1BT0 A;  3QAQ A;  2HJ8 A;  1GJZ A;  3DPD A;  4KZ0 A;  3APD A;  4II3 B;  2JUO A;  3ZNI D;  3ZW3 A;  1V5T A;  4GIV A;  1G6J A;  3OJ3 A;  1RLF A;  3U7D A;  5CTR C;  2ZPN A;  4FHJ A;  1WM2 A;  3H6N A;  5J2R A;  2LVP A;  2KAN A;  1JRU A;  4PS7 A;  4KSL C;  2BF8 B;  3B0A A;  2V3S A;  2LJ5 A;  3B08 A;  4MH0 E;  4BVU C;  2KNB A;  3C0R B;  2ZJD A;  2KXJ A;  4MDK E;  2J0J A;  3PS6 A;  4DDG D;  2BYV E;  3A4S C;  4HPM B;  5L83 A;  2L00 B;  4NQK E;  3DOW A;  2KX0 A;  2MRP A;  3HK0 A;  1ZGU B;  2L05 A;  2KJ6 A;  2M8S A;  3MJW A;  4GDL B;  3A33 B;  3UIO B;  5JH5 C;  4MEM A;  2IY1 B;  4DHJ D;  4FJY A;  4IWQ A;  2M1M A;  1H8C A;  3ZRC A;  3TJP A;  1V9J A;  3KH0 A;  5AZH A;  4DXA B;  3ML8 A;  1VCB A;  4BBN F;  2XK5 A;  2GBM A;  3L17 A;  3RYT A;  5D94 A;  3V6C B;  2CR5 A;  5CHF A;  2FNJ B;  3VQI A;  5KHO A;  3TIX A;  2I1K A;  2ZVN A;  4KIK A;  2FCM A;  4W9D A;  2MQJ A;  3H9D A;  3KUZ A;  4ANW A;  1D3Z A;  1CMX B;  4IUM B;  3BIN A;  2FCQ A;  1WE7 A;  4WWN A;  3JSV A;  3QIJ A;  2IY0 B;  3TL5 A;  2KO3 A;  1LM8 B;  4I6L B;  3HIZ A;  2BYF A;  4FJV B;  1P9D U;  1L7Y A;  2G4D B;  3QA8 A;  4GDK B;  1RRB A;  3WAP A;  4FJZ A;  2JT4 B;  3A9K A;  1WXS A;  1QZE A;  4EEW A;  3U8Z A;  4BBN C;  4LDT B;  2GBJ A;  1ISN A;  4NJ6 A;  4MGK E;  3T9L A;  2IO0 B;  3KVF B;  4X57 B;  3OLM D;  4BKS A;  4FAD A;  2HTH A;  1R4N I;  2NPT B;  2KLC A;  4JL9 A;  1UGM A;  3N30 A;  1TGZ B;  4A20 A;  2M4N A;  2Y5B B;  3V61 A;  4KDL B;  4EZJ A;  2K6Q A;  2AEH A;  4K7S A;  3GZN I;  4GMV A;  3QX1 A;  4W9C A;  3WAO A;  2KMC A;  3UQB A;  2DEN B;  2KLG A;  2JZ3 B;  3A9J B;  4WWO A;  1Z5S B;  1WZ3 A;  2KHW B;  1WX7 A;  2RPQ A;  4A3P A;  2WDT B;  4EFO A;  4DHZ B;  2K39 A;  2JVC A;  1WIA A;  3HHM A;  3TCA A;  1U4A A;  2PE9 A;  2N1V A;  3VUX A;  2O6V B;  3VAW A;  5CHV C;  4URK A;  4MJS B;  2KX3 A;  2JPH A;  3D32 A;  4K7W A;  1KLV A;  1UEL A;  2L0F A;  1WJ6 A;  2KFK A;  2ZCB A;  3NY5 A;  4MM3 A;  2UYZ B;  4BOZ B;  2AWT A;  2IO3 B;  2UWQ A;  4FBJ B;  2KTR B;  5C1Z A;  2LGY A;  4OVU A;  1WR1 A;  3CSF A;  4ICV A;  4IM2 A;  2BYE A;  4G3X B;  1FXT B;  2PE6 B;  1J8C A;  4FA6 A;  3PRE A;  3A1Q A;  2C7H A;  4G0N B;  3CST A;  1YD8 U;  5JZE B;  1GC6 A;  1UZX B;  2KWU B;  4W9J A;  2ZVO A;  5AEK B;  2D3G A;  2ZZP B;  2LWP A;  1S3S G;  1WMH A;  2KK8 A;  1WGH A;  3W1S C;  1WGG A;  1WJ4 A;  4FLH A;  1F9J A;  2LI5 A;  4RM8 A;  2YVC A;  3JYU A;  4FN2 A;  2I1J A;  4RM9 A;  2WX0 A;  1WGD A;  2DYM A;  4FUL A;  4ANU A;  3QQ8 B;  3WAM A;  3PZD A;  2N9E B;  4XX5 A;  3PPA A;  1IYF A;  3PLV A;  2MBH A;  3JW0 X;  1K8R B;  3PHX B;  1KJT A;  2D10 A;  2KD0 A;  4B9K A;  1OEY J;  2KWV B;  2O2V A;  2A5U A;  1EO6 A;  3IHP C;  3L13 A;  3RCZ A;  1IPG A;  1E8Y A;  3R3M A;  3PLU A;  3QJZ A;  1EUV B;  1TBE A;  1WX9 A;  2LZ6 A;  2B3A A;  4PYZ A;  2ZPY A;  3IG3 A;  5HKH A;  3O65 B;  4A3O A;  1J0G A;  3ZIM A;  4PYU A;  3SU8 X;  2WX1 A;  4F7Z A;  2KMA A;  1I42 A;  1E8W A;  4KVG B;  2KN5 A;  4AJW A;  1XT9 B;  5DPT A;  3AU4 A;  4IWP A;  4OVV A;  1RFA A;  1WYW B;  2HD5 B;  3QHT A;  2L8J A;  5D7G A;  2EKE C;  2AYO B;  2IZV B;  2NR2 A;  4K1R B;  3BY4 B;  3IBE A;  4TV3 A;  1V5O A;  3JVZ X;  1C3T A;  3QWZ B;  2BGF A;  3M63 B;  4P7I A;  1WR6 E;  1WH3 A;  3X23 A;  4K7U A;  3VXW A;  4ZRI A;  2FID A;  5D2M B;  1GUA B;  1NI2 A;  2JRH A;  2A4Z A;  3LDZ E;  4ASW C;  4DHZ E;  1E8X A;  2C7M B;  4IWO A;  3WAN A;  3B1L X;  2G3Q B;  4E71 A;  2MA9 B;  1V80 A;  1E5W A;  3PV1 A;  2NS5 A;  2GOW A;  2V1Y A;  4NPN A;  4W9H A;  3MHS D;  3IVF A;  1SE9 A;  3DVN V;  3QC8 B;  2MLB A;  4IW0 A;  3WA0 A;  3AUL A;  1MG8 A;  3R7Q A;  4HVB A;  3H1U A;  4ZRJ A;  4BKG A;  3MTN B;  5AZG A;  3RT3 B;  1EF1 A;  1VD2 A;  2N7E A;  1WXA A;  2Z0E B;  2M17 A;  5J17 A;  2D07 B;  3KUD B;  2ZCC A;  2K1F A;  3TBL D;  2MBB B;  3KW5 B;  2PJH A;  2L0T A;  2LD9 A;  3EFU A;  3K9O B;  4DWF A;  3AU5 A;  1EF5 A;  2K6D B;  4NAW A;  5FR6 A;  2G4S A;  2KTF A;  2MBO A;  3VHT C;  4GB9 A;  3L54 A;  4HCN B;  2K25 A;  3ML9 A;  5G2N A;  1V6E A;  2N4F A;  2C60 A;  1UD7 A;  4AJY B;  1I35 A;  4KIK B;  2M0X A;  3UQA A;  2JY6 A;  4HWI B;  4MGI E;  4CHK A;  1Q5W B;  4W9I A;  2HE7 A;  1OQY A;  1WRD B;  4EZK A;  3VH3 B;  3UIN B;  4F1S A;  4W9K A;  2LVO A;  3JSV B;  2NBW B;  3DBL I;  4MJS A;  3PRP B;  4HDO A;  3WIM A;  2Z59 B;  1LQB A;  3H7P A;  2LGD A;  2MP2 A;  4G11 A;  2LVQ A;  1PQS A;  3PRZ A;  2JF5 A;  5E6P A;  3SHQ A;  1OTR B;  2D11 A;  1Y8R C;  1Z2M A;  4W9L A;  3VH4 B;  3A9K B;  2GBK A;  4HXD A;  4MEL A;  4W9E A;  2ZNV B;  4WJN A;  4B6W A;  1XD3 B;  2YLM A;  4BKT A;  2DAJ A;  2KDB A;  2KZR A;  4II2 B;  3W1Y A;  5IAA C;  3KUC B;  1SGH A;  1WZ0 A;  2AL6 A;  3U30 A;  4XC2 A;  2FAZ A;  1V49 A;  1P0R A;  3V62 A;  2RSU A;  2BPS A;  4AUQ C;  1P3Q U;  3EC8 A;  2KC2 A;  4GGQ A;  1GG3 A;  4W9G A;  4K81 A;  2BWE S;  4HPL B;  2KDI A;  5LXH A;  1AAR A;  5TR5 A;  3QK0 A;  3ONS A;  3RUI B;  5JHB A;  4ANV A;  4PS8 A;  3EHV A;  1KM7 A;  2PEA A;  5KHQ A;  1SIF A;  1E8Z A;  1WY8 A;  2MCN B;  4M0W B;  2JZZ A;  1WE6 A;  4KSK C;  1KOT A;  2KDE B;  4HLE A;  5E6N A;  2DYO A;  4W9F A;  2MSE D;  4MSM B;  2KFK B;  2XEW A;  2K8C A;  5GMV A;  3HM3 A;  2NVU I;  2RGF A;  4TQ1 A;  2KC1 A;  3DDC B;  2D2Q A;  3A1Q B;  3M95 A;  2ZNV C;  2IO2 B;  3VDZ A;  3X0W A;  3L16 A;  1T0Y A;  2GBN A;  4GOC A;  4JIO U;  5L95 C;  1YIW A;  3PSE B;  1WMH B;  3VUW A;  2LGX A;  2NBV B;  2K8B A;  2K8H A;  1E7V A;  3DQV A;  3N3K B;  3RZW C;  4AWJ A;  3APF A;  4LJO B;  1WM3 A;  3ZDT A;  1OGW A;  1HE8 A;  1YX6 B;  4CO7 A;  2DAF A;  2EMT A;  3A4R A;  2LAS A;  4EUT A;  4TUU A;  4NJ7 A;  2L3Z A;  5CX3 A;  5E6O A;  1UBI A;  2EMS A;  4GDL A;  1H4R A;  3KYC D;  4XZ4 A;  4TQ0 A;  1UH6 A;  4KV2 A;  2R2Q A;  4IC7 B;  4MSQ B;  2C9W B;  3ZTD A;  4MGZ E;  2W9N A;  2J7Q B;  1Q1O A;  3I3T B;  4HCP B;  2CHW A;  2O2V B;  4DBG A;  3ENE A;  2KWC A;  4J6I A;  4BFR A;  4F8C B;  3CMM B;  2L76 A;  4WQO B;  2V4L A;  3ZO5 B;  4ZYN A;  3PT2 B;  2CS4 A;  4AOF A;  4ZDV A;  2KQS A;  1ZKH A;  5J18 A;  2IYD B;  2CU1 A;  3ZVV A;  2J0K A;  1S1Q B;  2IO1 B;  4EKU A;  3SDL C;  3T8M A;  2JWZ A;  3VTU A;  2VRR B;  3WAL A;  1Q0W B;  1NBF C;  2CHZ A;  2LRU A;  2REX A;  4AP4 C;  3R7R A;  4DK5 A;  2C7N B;  4ZRK A;  3VVW B;  1R4M I;  4ICU A;  1UBQ A;  3LJ3 A;  3AI5 A;  4RMA A;  1GC7 A;  3IFW B;  3RUL A;  1C1Y B;  1LXD A;  5JHA A;  1J19 A;  2LUE A;  2N1W A;  2KVR A;  5IA7 A;  4GDK A;  1V2Y A;  4DHJ B;  3PTF C;  3QCA A;  2KOX A;  4BOS C;  5C23 A;  1V86 A;  2FIF A;  4GSW A;  3PGE A;  2MBQ A;  4GU2 A;  2CKH B;  3ZLZ A;  1A5R A;  2LRW A;  3ZUN A;  1ZW7 A;  2NPT A;  2DYB A;  3W1S A;  3ZNH B;  4WAA A;  1OEY A;  4WJO A;  3PVL A;  2ZEQ A;  4NY0 A;  2NBU A;  4LDT D;  1TZ1 A;  1XQQ A;  3A9J A;  5BO4 B;  2XK5 B;  2ASQ A;  2DHZ A;  2R2O A;  4G50 A;  5DPS A;  2KJH B;  4YL8 A;  1X1M A;  3OJ4 B;  3ZKJ C;  1TTN A;  4PS3 A;  3K9P B;  3GOE A;  2DZK A;  3EEC A;  3VTW A;  1IP9 A;  1WJU A;  2IBI B;  1M94 A;  2KQ7 A;  2BKR B;  4HJK A;  3RD2 A;  2O6V A;  2MWS B;  3N32 A;  5DPR A;  5AZF A;  4WJQ A;  1WGY A;  4FHK A;  5DPW A;  2KKC A;  2DZI A;  2RD0 A;  3UGB B;  2AL3 A;  4JLC A;  2L7R A;  3M3J A;  1LFD A;  1NDD A;  2MX2 A;  3L10 B;  2NCN A;  2KTR A;  4IM3 A;  5CHW A;  4WWP A;  4E3C A;  4NNJ B;  2OOB B;  4DDI D;  2FCS A;  2O6V D;  4EOY A;  2MW5 A;  2Z0D B;  3Q3J A;  4HK2 A;  2KDF B;  3DVN U;  4IG7 B;  2N9X A;  4ANX A;  4NQL B;  2G45 B;  3DBH I;  2FUH B;  1WGR A;  1YJ1 A;  3DBS A;  3DVG Y;  4I6P A;  4NAW B;  3CF6 E;  3RZF A;  3ECI A;  4BKS D;  4N9F 4;  3VUY A;  1WXV A;  2J0M A;  1GNU A;  1WF9 A;  2GMI C;  3ZRF A;  1WX8 A;  2JRI B;  4WJP A;  2MBE A;  4KZC A;  3DCG A; 
#chains in the Genus database with same CATH topology
 3B2G A;  3DBR I;  1E7U A;  3QAR A;  2INN E;  3P2B A;  1XF5 L;  1FRD A;  4E74 A;  1HTQ A;  2LHE A;  2KJR A;  2JYT A;  3H7P B;  3RFZ B;  4KDI C;  4ARI A;  2EKI A;  1XEE A;  2KFJ A;  4M8M A;  1QLB B;  4GXB A;  1L2N A;  3HVD A;  2JZP A;  3FIL B;  1HEZ E;  3N1Z C;  1ZDV A;  3R66 C;  3IAM 1;  3TMP B;  3Q69 A;  3VTV A;  1P98 A;  2L52 A;  2PKO A;  3AEE B;  4S17 A;  5DCN A;  5EDS A;  2N7D A;  1JRP A;  1WFY A;  4M8N A;  1E10 A;  2DX5 B;  3APC A;  1HQR D;  3DPD A;  3APD A;  2JUO A;  1LO5 D;  3ZW3 A;  2LUM A;  3IT4 B;  4FXC A;  4YXD B;  1YJI A;  3H6N A;  5J2R A;  4B0M A;  1JRU A;  3B08 A;  4MH0 E;  1R4N B;  2BYT A;  1F0Z A;  3C0R B;  2K5P A;  2IND C;  2KXJ A;  1SE2 A;  1AWD A;  1DYQ A;  2J0J A;  4LNN A;  3GZN B;  4HPM B;  4NQK E;  3DOW A;  2KJ6 A;  4KX6 B;  4DHJ D;  3U52 E;  3TJP A;  2V3N A;  1CK1 A;  2NMQ A;  1DOI A;  5AZH A;  2XK5 A;  4D2K A;  2KWD A;  2CR5 A;  3TIX A;  2ZVN A;  5EE1 A;  3AEA B;  3H9D A;  1ZXI A;  2H89 B;  1D3Z A;  4IUM B;  5FKA C;  4WWN A;  3TSS A;  3QIJ A;  3TL5 A;  2KO3 A;  4RCO A;  2BYF A;  3B9J A;  4FJV B;  2G4D B;  3WAP A;  2MHJ A;  1QZE A;  4LDT B;  1IGD A;  4X57 B;  4BKS A;  1R4N I;  3MFG A;  2AQ3 B;  2KLC A;  4JL9 A;  1UGM A;  3N30 A;  2Y5B B;  3V61 A;  3GZN I;  3N20 C;  2KMC A;  1XLP A;  1Z5S B;  2WDT B;  3AMZ A;  3HVZ A;  2K39 A;  4HRO A;  3TCA A;  5CHV C;  4K7W A;  1TKY A;  5BMI A;  1UEL A;  1WJ6 A;  3NY5 A;  4OVU A;  4G3X B;  2PE6 B;  1J8C A;  1OFF A;  3PRE A;  4JX1 C;  3A1Q A;  3AE4 B;  3C8Y A;  1QT9 A;  4W9J A;  5AEK B;  1UUP A;  3RNC C;  2GRI A;  3Q2A C;  1WMH A;  1WGG A;  3JYU A;  4OZC A;  2WX0 A;  1FIQ A;  3PPA A;  1IYF A;  2MJE A;  1KJT A;  2KD0 A;  4P1B C;  1NI3 A;  2KWV B;  2A5U A;  3L13 A;  3RCZ A;  1E8Y A;  2RDG A;  1EUV B;  1TBE A;  1IBX A;  2IPK D;  5HKH A;  3O65 B;  3NUH B;  1N63 A;  1WYG A;  2WX1 A;  4F7Z A;  3EGR A;  2KN5 A;  1QQR A;  5DPT A;  3AU4 A;  2JU6 X;  1TJE A;  1WYW B;  2L8J A;  3N1X C;  1FFV A;  3JVZ X;  1C3T A;  2IJ0 A;  1AW7 A;  3DBL B;  2GB1 A;  1WR6 E;  1WH3 A;  1FPY A;  2FID A;  2WU2 B;  1NI2 A;  4C00 A;  1SJH D;  3BK1 A;  2LJI A;  4IWO A;  3ZJU A;  3AE8 B;  1Y56 A;  4W9H A;  1GAQ B;  1MG8 A;  3AEB B;  4ZRJ A;  1EF1 A;  2Z0E B;  5J17 A;  1WXA A;  2M17 A;  3KUD B;  2ZCC A;  2K1F A;  3NJT A;  2PJH A;  1GB1 A;  4DWF A;  5JXV A;  2G4S A;  3VHT C;  5G2N A;  1FRR A;  1V6E A;  1I35 A;  4MGI E;  2WP9 B;  4W9I A;  4EZK A;  3VH3 B;  2W55 A;  2NTS A;  4W9K A;  5IOI A;  3DBL I;  2Z59 B;  1LQB A;  4YTM B;  2LGD A;  4G11 A;  1C79 A;  1YJJ A;  2LFI A;  3SHQ A;  1OTR B;  2D11 A;  1Z2M A;  1I4G A;  1WRI A;  4TSS A;  2WDQ B;  3VH4 B;  1JAL A;  2ZNV B;  3W2D A;  2DAJ A;  2KZR A;  1SB3 C;  3NG0 A;  1T5X D;  4RGN A;  5IAA C;  1SGH A;  1WZ0 A;  3SFE B;  3U30 A;  2OJW A;  1OQR A;  1V49 A;  2Q5W D;  2BPS A;  4AUQ C;  3AH7 A;  2QIL A;  3EC8 A;  2R61 A;  4W9G A;  2BWE S;  4HPL B;  5GXG B;  4XE0 A;  3I57 A;  3KWL A;  3Q3N C;  2QEJ C;  3ZYY X;  3ONS A;  1J7C A;  4OZB A;  1VR9 A;  2PEA A;  1E0Z A;  1SIF A;  1E8Z A;  1WY8 A;  2MCN B;  4M0W B;  3DWG C;  1KOT A;  5E6J A;  1HA5 A;  2KDE B;  4KGR A;  1KRH A;  4W9F A;  4MSM B;  1FO4 A;  2KFK B;  1PDX A;  2K8C A;  1F2R C;  5GMV A;  2RGF A;  4TQ1 A;  2IO2 B;  4JIO U;  1YIW A;  3PSE B;  1EWY C;  3VUW A;  2NBV B;  2K8B A;  1YQ4 B;  4AWJ A;  1C77 A;  2D3B A;  3GE8 C;  1YX6 B;  5E6O A;  4GDL A;  1H4R A;  1QOG A;  1UH6 A;  4AS1 A;  4GLS C;  2DWQ A;  2YEP F;  1ESF A;  4S0R A;  1Q1O A;  2ICI A;  5HFY A;  3ENE A;  4J6I A;  2OED A;  3ZO5 B;  4ZYN A;  2JSV X;  2IYD B;  3MP9 A;  2CU1 A;  3ZVV A;  5J18 A;  2IO1 B;  3SDL C;  3T8M A;  2JWZ A;  1Q0W B;  1NBF C;  2CHZ A;  2LRU A;  2QJL A;  2REX A;  4DK5 A;  2JXT A;  3AI5 A;  4RMA A;  1LXD A;  1VRA B;  2KVR A;  2BW2 A;  1V2Y A;  4GDK A;  4DHJ B;  2PMV A;  4ACF A;  4OVZ A;  3QCA A;  2KOX A;  2FIF A;  1JWU D;  4GU2 A;  3ZLZ A;  1A5R A;  4USA A;  2WXI A;  2NPT A;  4HRS A;  2DYB A;  3W1S A;  4C7Y A;  1OEY A;  4LDT D;  2E6X A;  3W5U B;  4G50 A;  3Q8E A;  2DHZ A;  5DPS A;  1TTN A;  2KDM A;  4PS3 A;  1F1H A;  2WXQ A;  1YNT E;  3GB1 A;  3AEG B;  4MH8 A;  3NRZ A;  4WJQ A;  2WXL A;  5BYR A;  4US8 A;  5DPW A;  2AL3 A;  4JLC A;  5BYS A;  3M3J A;  3L10 B;  1HZ5 A;  1OQQ A;  2WXF A;  2HTM E;  1VLB A;  2J53 A;  1VDV A;  4DDI D;  4C4V A;  3DVG Y;  1WGR A;  3AE1 B;  4YT0 B;  4BKS D;  2INC C;  4Q2J A;  1C4A A;  2KQ4 X;  2JRI B;  4WJP A;  2MBE A;  1D5Z C;  1Q10 A;  3BVZ A;  4I6N B;  1E90 A;  2GBR A;  3U2S C;  5BMH A;  2WXG A;  3OAW A;  3KWV A;  4DXG A;  1N61 A;  2FCN A;  2Y5P A;  4HKZ E;  4MGY E;  3VFK A;  1ET6 A;  3PRM B;  3L0W B;  2J52 A;  1WI0 A;  3ZNG C;  1MPE A;  1YQB A;  3Q6B A;  4A90 A;  3V6E B;  3UIP B;  2N7J A;  2TSS A;  1D6E C;  3L08 A;  2AQ1 B;  3ZNZ B;  1FNW A;  2WXP A;  5LXI B;  3H7S A;  1V81 A;  3PZ7 A;  4CYE A;  4JGH B;  3RMK C;  1L0V B;  2HJ8 A;  1GJZ A;  2W54 A;  1SF0 A;  3FKY A;  1G6J A;  3OJ3 A;  2N9L A;  1V1P A;  4AQ7 A;  4FHJ A;  1UGJ A;  1XCQ L;  2V3S A;  3B0A A;  4JPS A;  4REZ A;  2KNB A;  2ZJD A;  4MDK E;  3PS6 A;  4DDG D;  3O13 A;  3A4S C;  1QOF A;  2L05 A;  3HK0 A;  3UIO B;  2M8S A;  3MJW A;  1PGX A;  3EUB 2;  4FJY A;  1H8C A;  1V9J A;  3KH0 A;  2NTT A;  3MC9 A;  1M4V A;  4B0E A;  3BII D;  2JYE A;  2GBM A;  3L17 A;  3ETR A;  3V6C B;  5CHF A;  2FNJ B;  2I1K A;  4KIK A;  2MQJ A;  3KUZ A;  1WE7 A;  2B76 B;  4I6L B;  4QAY A;  1RRB A;  1V1O A;  3R2I A;  2JT4 B;  4FJZ A;  5FK9 C;  4EEW A;  4P16 A;  3U8Z A;  4MGK E;  3KVF B;  4IOI E;  4EZJ A;  1QOA A;  2M4N A;  2AEH A;  3Q8A A;  2V3P A;  1L4Z B;  3A9J B;  2H88 B;  4DHZ B;  1JCK B;  1PGB A;  1NYR A;  2PE9 A;  1C9F A;  2O6V B;  2KAC A;  4MJS B;  2KN4 A;  2KX3 A;  2WXH A;  1KLV A;  1EU3 A;  4BOZ B;  4MM3 A;  2UYZ B;  4BZA A;  4FBJ B;  2KTR B;  2LGY A;  3CSF A;  4ICV A;  1E9M A;  1XLQ A;  2C7H A;  3CST A;  1WSP A;  5JZE B;  2ZVO A;  2WDV B;  1CJE A;  3W1S C;  4FLH A;  4FUL A;  2N9E B;  2RMM A;  2I2Y A;  1ACC A;  3PLV A;  4RFB A;  3JW0 X;  2BBC A;  1K8R B;  1PGA A;  2JQR B;  2ONQ A;  4C80 A;  3PHX B;  2O2V A;  1EO6 A;  3IHP C;  2LZ6 A;  2BQQ A;  4A3O A;  2LMC A;  1J0G A;  4PYU A;  1SBB B;  3RNB C;  4KVG B;  4AJW A;  1XT9 B;  4LNF A;  3QHT A;  4US9 A;  4H2A A;  5D7G A;  3Q14 C;  3BY4 B;  3IBE A;  4TV3 A;  1V5O A;  3ZXR A;  5D3I B;  3M63 B;  4KGT A;  1B9R A;  4RGM A;  4ZRI A;  4DHZ E;  1MFW A;  2C7M B;  2G3Q B;  1E5W A;  2V1Y A;  3IVF A;  1SE9 A;  3DVN V;  3QC8 B;  4A55 A;  4MT5 A;  3R2T A;  3MTN B;  1VD2 A;  2N7E A;  1I4H A;  1C4P A;  2D07 B;  2LHD A;  2MBB B;  1HXY D;  3EFU A;  1PYW D;  4NAW A;  2MBO A;  2K25 A;  3ML9 A;  2Y5C A;  4YTN B;  1UD7 A;  2M0X A;  4KGS A;  2HE7 A;  3UIN B;  3RI7 C;  4HDO A;  3WIM A;  3SR6 A;  2MP2 A;  1FM0 D;  3PRZ A;  2JF5 A;  3W9C B;  3U4E G;  5E6P A;  3P42 A;  4HXD A;  4W9E A;  4WJN A;  4B6W A;  1XD3 B;  2WS3 B;  3URY A;  3BVM A;  1L4D B;  2CJO A;  1IUE A;  3V62 A;  1P3Q U;  4GGQ A;  1GG3 A;  1XLN A;  4K81 A;  4MAC A;  5D3D A;  2QDF A;  2KDI A;  1HTO A;  1AN8 A;  2ZW0 A;  1KM7 A;  1FXI A;  3AB5 A;  2JZZ A;  1WE6 A;  4HLE A;  3B2F A;  3AEC B;  3HM3 A;  2V9H A;  3RNA C;  2MJ3 A;  3A1Q B;  3M95 A;  4OW0 A;  2GBN A;  3WCQ A;  1F2R I;  3AE9 B;  1WMH B;  3Q8C A;  1N60 A;  2K8H A;  3BZD B;  3DQV A;  3AE6 B;  3N3K B;  5T8I A;  3RZW C;  4LJO B;  5C2T B;  1OGW A;  4NJ7 A;  5CX3 A;  2FE8 A;  4XZ4 A;  4TQ0 A;  4HPP A;  3W5V B;  4KV2 A;  2R2Q A;  2WXN A;  5IP4 D;  2QSD A;  1BXT A;  1JWB D;  4MGZ E;  3AE2 B;  5HHD G;  2J7Q B;  4WUR A;  4BFR A;  2KWC A;  4F8C B;  2V4L A;  2CS4 A;  2KQS A;  1S1Q B;  4EKU A;  1VZ8 A;  2VRR B;  3WAL A;  2C7N B;  3DBH B;  2DBY A;  1GC7 A;  3VRA B;  1TS3 A;  2N1W A;  5IA7 A;  1K50 A;  2W3S A;  3KLS X;  3DHI C;  1KLG D;  2MBQ A;  2LRW A;  3ZUN A;  1ZXH A;  4WJO A;  5C3J B;  2V4I B;  4NY0 A;  2K9X A;  2NBU A;  3RPF C;  2KJH B;  4YL8 A;  2KMM A;  2K0P A;  3OJ4 B;  3ZKJ C;  3K9P B;  4LNO A;  2L32 A;  3VTW A;  1JW9 D;  1FNV A;  1L5P A;  2KQ7 A;  4HJK A;  2MWS B;  4RF1 A;  5G5H A;  5AZF A;  2KKC A;  1XLO A;  5AUI A;  2L7R A;  1LFD A;  2MX2 A;  1SE3 A;  2NCN A;  4IM3 A;  3CIR B;  2OOB B;  4EOY A;  2O6V D;  2Z0D B;  4HK2 A;  4ANX A;  2JX5 A;  2N9X A;  3DBH I;  3RZF A;  2VZK D;  2WGS A;  4KZC A;  3DCG A;  2DLB A;  2RR9 A;  5G5G A;  2CHX A;  4XGA B;  1P1A A;  2BKF A;  2WYQ A;  1FNU A;  3UF8 A;  3NS8 A;  3VR8 B;  2LXC A;  2OJR A;  3ZDM C;  3FC4 A;  4GN1 A;  1YOV B;  3S2A A;  3TEW A;  1RAX A;  2WWZ A;  4EZL A;  2DZJ A;  3M62 B;  3P4S B;  2ON8 A;  3DVG X;  1WXM A;  2IGG A;  4LCD E;  2PPH A;  2WXM A;  2JXX A;  1B1Z A;  3PHW B;  4NAM A;  1WJN A;  4JQW C;  2C5L C;  3ALB A;  4IM0 A;  4RNA A;  3NOB A;  4ZRQ A;  3EFC A;  1MJD A;  5H92 C;  4J3O D;  4ZHP A;  1K52 A;  3ZTC A;  3AXC A;  3SD5 A;  4XDC A;  4UDU C;  1BT0 A;  1NEK B;  2QMT A;  3ZNI D;  3CWI A;  1IGC A;  1V5T A;  1P7E A;  4GIV A;  4TMA B;  5CTR C;  4K3C A;  2QCZ A;  2KAN A;  1UWX A;  4KSL C;  1NVI D;  2BF8 B;  2LJ5 A;  4BVU C;  4L2Y A;  4C7Z A;  3BWU D;  1N6Z A;  2BYV E;  5L83 A;  2MRP A;  1ZGU B;  3Q3O C;  4GDL B;  1N62 A;  2IY1 B;  4IWQ A;  2M1M A;  2PVO D;  5BMG A;  1SSN A;  2XNA C;  1VCB A;  4BBN F;  1TY2 A;  3RYT A;  3T3N A;  2CJN A;  3VQI A;  5KHO A;  2WXK A;  1XO3 A;  4ANW A;  1VJK A;  3BIN A;  2FCQ A;  3JSV A;  4N6E B;  1TZO A;  4JWS C;  1LM8 B;  2GI9 A;  1L7Y A;  2M0A A;  4GDK B;  2LGS A;  3A9K A;  1ENF A;  4ZRP A;  2GBJ A;  2WXO A;  4NJ6 A;  4A8X C;  2IO0 B;  2NPT B;  4XYC A;  4A20 A;  4LLG M;  4KDL B;  2K6Q A;  4K7S A;  3QX1 A;  3PZ8 A;  3VRB B;  2DEN B;  2KLG A;  4WWO A;  2KHW B;  1WX7 A;  1L6U A;  4EFO A;  1SEB D;  3HHM A;  3LYY A;  3DHH C;  1U4A A;  2SEB D;  3VAW A;  1V8C A;  3TEY A;  2UWQ A;  1HZ6 A;  4IM2 A;  2BYE A;  1FXT B;  4C4V B;  4FA6 A;  4G0N B;  1YD8 U;  5EE3 A;  1TYG B;  1UZX B;  2KWU B;  2D3G A;  1D5M C;  2ZZP B;  1ZDX A;  1WGH A;  2Z8L A;  1WJ4 A;  4LNK A;  2E3T A;  4FN2 A;  1JWM D;  2I1J A;  5AUK A;  3TEZ A;  3QQ8 B;  2I38 A;  3PZD A;  1FCC C;  4LK0 M;  3EA6 A;  3C19 A;  1KLU D;  2ACZ B;  1F77 A;  4WAF A;  2V0G A;  2K22 A;  1IPG A;  3R3M A;  1QKZ A;  1WX9 A;  4PYZ A;  2ZPY A;  1JQ4 A;  1AYF A;  3ZIM A;  3P4R B;  2M19 A;  3SU8 X;  5FR3 A;  1I42 A;  3RNE C;  1DOY A;  2PW9 A;  2KT7 A;  4P1C C;  3MJ5 A;  4IWP A;  4OVV A;  1RFA A;  1XCT L;  1K51 A;  3SFD B;  2EKE C;  2RDH A;  2IZV B;  3AM9 A;  4K1R B;  1RM6 C;  4R3D A;  2X38 A;  2BGF A;  2WDR B;  3X23 A;  3VXW A;  1UNS A;  1GUA B;  3KQ4 A;  1YMH E;  2JRH A;  3LDZ E;  4ASW C;  1E8X A;  1V1P B;  3WAN A;  4E71 A;  3B1L X;  3ZQ4 A;  4YSY B;  2MA9 B;  2GOW A;  4NPN A;  3MHS D;  3DHG C;  3Q3M C;  2MLB A;  3WA0 A;  1T0S C;  4HVB A;  3H1U A;  1KFY B;  1L0Y B;  5AZG A;  2MJD A;  1T0Q C;  2L0T A;  2LD9 A;  3K9O B;  2IGH A;  2K6D B;  5FR6 A;  3I5J C;  2KTF A;  2L1A A;  2WXJ A;  3P1M A;  4GB9 A;  4PK1 A;  3UI3 A;  2N4F A;  2C60 A;  3I9V 1;  4KIK B;  1SE4 A;  4HWI B;  1I4R A;  1OQY A;  2AX5 A;  2LVO A;  2G9H D;  1FCL A;  4MJS A;  1MVK A;  3Q8F A;  3H7P A;  2LVQ A;  1PQS A;  1Y8R C;  3MC0 B;  1E6E B;  4MEL A;  2K3U A;  4BKT A;  2KDB A;  2Y3A A;  4II2 B;  3FIL A;  3W1Y A;  3ZJT A;  1L0X B;  4XC2 A;  1VZ6 A;  1P0R A;  2VZK B;  4CQN A;  1TS5 A;  2EEL A;  4P6V F;  2HJ1 A;  3SEB A;  5LXH A;  2MEK A;  5TR5 A;  1GPX A;  1T3Q A;  3QK0 A;  3RUI B;  1TY0 A;  5JHB A;  4PS8 A;  1FMA D;  3IXS A;  3P4Q B;  2QIE B;  2PLP A;  1R4M B;  1TIF A;  2XEW A;  4MM3 B;  2FUG 1;  2NVU I;  2KC1 A;  1KF6 B;  3DDC B;  2LEK A;  2IGD A;  3VDZ A;  3X0W A;  1YN5 A;  1T0Y A;  4GOC A;  5L95 C;  4M02 A;  4RH6 A;  2YEP B;  1E7V A;  4XWW A;  3IAS 1;  3HRD D;  1WXQ A;  2GLS A;  2KVZ A;  4EUT A;  1TT5 B;  3RNF C;  3ZGZ A;  1UBI A;  2EMS A;  1C76 A;  2RDB C;  3KYC D;  4YWG G;  4DQO C;  4IC7 B;  1T0R C;  2C9W B;  3I3T B;  4HCP B;  4DBG A;  2O2V B;  3CMM B;  2L76 A;  1UWM A;  1I7H A;  4ZDV A;  1A70 A;  1ZKH A;  1WWT A;  2J0K A;  3VTU A;  4K3B A;  4L1B A;  1R4M I;  4ICU A;  3RUL A;  3IFW B;  3HUI A;  3FAH A;  3E9S A;  1R7S A;  1I4Q A;  1ROE A;  2BT6 A;  4BOS C;  4GSW A;  4A6Q A;  1V97 A;  1ZOY B;  4WAA A;  3PVL A;  2ZEQ A;  5BO4 B;  2XK5 B;  1SXT A;  2ASQ A;  2R2O A;  2VH2 A;  3N1Y C;  1MHX A;  4KKJ A;  4YSX B;  1MHH E;  3EEC A;  1JRO A;  4KKI A;  3RD2 A;  3OWE B;  3N32 A;  4YSZ B;  2RD0 A;  2DZI A;  3UGB B;  1STE A;  5CHW A;  4HKQ A;  4WWP A;  4E3C A;  1NEN B;  3NVY A;  4NNJ B;  4JWU C;  4NZL B;  1ZE3 D;  1DGJ A;  3Q3J A;  2KDF B;  3AEF B;  1YJ1 A;  4I6P A;  1DOX A;  4NAW B;  3CF6 E;  3VUY A;  2J0M A;  1GNU A;  1WF9 A;  3ZRF A;  1WX8 A;  2M56 B;  2DZM A;  4ITK A;  2W3R A;  5G55 A;  4O1N A;  2BVC A;  4M00 A;  2XBB C;  4HDQ A;  2XN9 C;  2MP2 B;  4A9A A;  2LXA A;  3NHE B;  3V60 A;  1I4P A;  4NJC A;  1JML A;  3NZS A;  3VR9 B;  3Q3F A;  1GOZ A;  3BYT B;  4TKN A;  4LJP B;  1YX5 B;  5LLI A;  4B95 A;  3GE3 C;  1K53 A;  3TUO A;  1BML C;  2N9P C;  4LTU A;  5D6J B;  4ZYS A;  1TKE A;  2BWF A;  2QHO A;  4N58 A;  1EM7 A;  3NZU A;  3RNG C;  3LB8 C;  3HM6 X;  3KYD D;  4DXF A;  3QAQ A;  4KZ0 A;  3MHZ A;  2J4X A;  4II3 B;  2L83 A;  2J42 A;  1FXA A;  2D5G A;  1C78 A;  1RLF A;  3U7D A;  3AE3 B;  2ZPN A;  1WM2 A;  2LVP A;  3H8H A;  1JWS D;  4PS7 A;  1IBX B;  5TSS A;  1KH0 A;  2BB6 A;  1ZUD 2;  2L00 B;  2KX0 A;  2KAJ A;  3NVV A;  5JH5 C;  4RGO S;  3A33 B;  4MEM A;  2PVG C;  3ZRC A;  3AE5 B;  4DXA B;  3ML8 A;  1PFD A;  2W82 A;  2D3C A;  5D94 A;  2FCM A;  4W9D A;  3DWM A;  1CMX B;  1YQ3 B;  2IY0 B;  3HIZ A;  3RN9 C;  1P9D U;  3QA8 A;  3P63 A;  4M01 A;  1WXS A;  1CZP A;  4BBN C;  1ISN A;  3T9L A;  2CU3 A;  3OLM D;  3AED B;  4FAD A;  2HTH A;  2RPV A;  4WQM A;  2WLB A;  1TGZ B;  2WQY B;  2JWU A;  1ZPS A;  3AE7 B;  4W9C A;  4GMV A;  3WAO A;  3UQB A;  2INP E;  4XDD A;  2JZ3 B;  2DNF A;  1WZ3 A;  2RPQ A;  4A3P A;  1JWA D;  2FBW B;  1PUT A;  4JE3 B;  1QOB A;  2JVC A;  1WIA A;  1LGR A;  3BVG A;  4M0W A;  5H8Y E;  2N0S B;  2N1V A;  3VUX A;  1ET9 A;  4URK A;  3D32 A;  2JPH A;  2L0F A;  1ZP0 B;  2KFK A;  2ZCB A;  5C1Z A;  2AWT A;  2IO3 B;  1WR1 A;  1QF6 A;  1GC6 A;  1FEH A;  3NZ3 A;  2LWP A;  1S3S G;  2KK8 A;  4OZA A;  1F9J A;  2LI5 A;  4RM8 A;  2YVC A;  4RM9 A;  1MI0 A;  1TS2 A;  1WGD A;  2DYM A;  3MC8 A;  4ANU A;  3WAM A;  2MH7 A;  4XX5 A;  3LXF A;  2MBH A;  2ZW1 A;  2D10 A;  3R8B A;  4B9K A;  1OEY J;  2PTL A;  2BB5 A;  1TS4 A;  3BYY B;  3PLU A;  3QJZ A;  4LNI A;  1F52 A;  3N9Y C;  3PO0 A;  4XWT A;  3I63 C;  2B3A A;  1CQV A;  3IG3 A;  3AN1 A;  3OG5 A;  4EE2 A;  4RF0 A;  1RYJ A;  2BS2 B;  2KMA A;  1E8W A;  1FD6 A;  1D4B A;  2X8X X;  2HD5 B;  1FFU A;  3E56 A;  1QIL A;  2WNM A;  2AYO B;  2NR2 A;  2HDE A;  3U7Z A;  3QWZ B;  3GP7 A;  4N59 A;  4P7I A;  4K7U A;  5D2M B;  5EE9 A;  2A4Z A;  5I4D A;  3V05 A;  3T3O A;  3PV1 A;  1V80 A;  2NS5 A;  4ARC A;  1N5X A;  1YN4 A;  4IDI A;  1J7B A;  3ZJV A;  2N9K A;  3GS2 A;  3NVW A;  4IW0 A;  1TKG A;  3AUL A;  1EU4 A;  3R7Q A;  1D5X C;  4RGT A;  4BKG A;  2WU5 B;  3RT3 B;  3TBL D;  3KW5 B;  2BTE A;  3AU5 A;  1EF5 A;  1UF0 A;  3L54 A;  4HCN B;  1RWS A;  3ABV B;  1MG4 A;  4AJY B;  3UQA A;  2JY6 A;  4CHK A;  1Q5W B;  5IN7 A;  1WRD B;  4WWM A;  4F1S A;  3JSV B;  2NBW B;  4L23 A;  2OHF A;  3PRP B;  3L4P A;  1L6V A;  4C56 C;  4W9L A;  3A9K B;  5IO9 A;  2GBK A;  3NS1 A;  1RFK A;  2YLM A;  3KUC B;  2AL6 A;  2FAZ A;  2RSU A;  1J7A A;  2KC2 A;  4WH4 A;  3BK2 A;  3Q8B A;  1AAR A;  5HG2 A;  2SAK A;  1I4X A;  4ANV A;  5BYQ A;  1SJE D;  3EHV A;  4WIP A;  5IKC M;  5KHQ A;  2G1E A;  4KSK C;  4ZHO A;  5E6N A;  2DYO A;  2MSE D;  4HJG E;  1VZ7 A;  1XXG A;  2AQ2 B;  2BS3 B;  2KYW A;  2D2Q A;  2ZNV C;  1E7P B;  3IT6 B;  3L16 A;  3AV8 A;  2WXR A;  2BS4 B;  2LGX A;  3APF A;  5MPO A;  1WM3 A;  3ZDT A;  1HE8 A;  4CO7 A;  2DAF A;  2EMT A;  4IKG A;  3A4R A;  2LAS A;  4TUU A;  3J9C A;  2L3Z A;  5EE0 A;  4BAX A;  1T6B X;  4MSQ B;  1YN3 A;  2D3A A;  3ZTD A;  2W9N A;  2CHW A;  4OHJ A;  4WQO B;  3PT2 B;  4AOF A;  2IDY A;  4AP4 C;  2WHI A;  3R7R A;  4ZRK A;  3VVW B;  3ZXV A;  1UBQ A;  3LJ3 A;  5JHA A;  1C1Y B;  1C4C A;  1J19 A;  2LUE A;  3NVZ A;  1SIJ A;  3PTF C;  2UU7 A;  3DBR B;  5C23 A;  1V86 A;  3PGE A;  1P7F A;  1EWC A;  2CKH B;  2LGI A;  1ZW7 A;  3ZNH B;  5HI1 A;  2PIA A;  1NYQ A;  1TZ1 A;  4HEA 1;  1XQQ A;  3A9J A;  1X1M A;  3GOE A;  2DZK A;  1IP9 A;  1WJU A;  2IBI B;  3P4P B;  1M94 A;  2BKR B;  2O6V A;  5DPR A;  1WGK A;  1WGY A;  4FHK A;  2VH1 A;  1GB4 A;  1NDD A;  2KTR A;  2FCS A;  2MW5 A;  4IG7 B;  3TEX A;  3DVN U;  4NQL B;  4YTP B;  5LNK 1;  2G45 B;  2QC8 A;  2FUH B;  3DBS A;  3V3X A;  1BUI C;  1N5W A;  3ECI A;  1KTK A;  1WXV A;  4ZOH C;  2GMI C;  4N9F 4;  4PT5 A; 
#chains in the Genus database with same CATH homology
 2DZM A;  3DBR I;  2RR9 A;  1E7U A;  4I6N B;  5G55 A;  3QAR A;  3P2B A;  2CHX A;  1E90 A;  2GBR A;  4E74 A;  1P1A A;  2BKF A;  2WYQ A;  2KJR A;  3H7P B;  2XBB C;  4HDQ A;  3OAW A;  2MP2 B;  3NS8 A;  3UF8 A;  2LXC A;  4KDI C;  2OJR A;  3ZDM C;  2LXA A;  3NHE B;  2FCN A;  2KFJ A;  4GN1 A;  3S2A A;  1RAX A;  3V60 A;  2WWZ A;  4M8M A;  2DZJ A;  4EZL A;  3M62 B;  4GXB A;  1L2N A;  3DVG X;  1WXM A;  4MGY E;  3VFK A;  3NZS A;  3L0W B;  3PRM B;  4LCD E;  1WI0 A;  2PPH A;  3R66 C;  2JXX A;  3Q3F A;  3ZNG C;  4TKN A;  3TMP B;  3VTV A;  4LJP B;  1P98 A;  1YQB A;  3PHW B;  3V6E B;  1YX5 B;  5LLI A;  1WJN A;  3UIP B;  4B95 A;  4JQW C;  2C5L C;  3ALB A;  3L08 A;  2N9P C;  4IM0 A;  3ZNZ B;  3NOB A;  5D6J B;  5DCN A;  2BWF A;  5LXI B;  3H7S A;  2QHO A;  5EDS A;  1V81 A;  2N7D A;  1WFY A;  4CYE A;  3ZTC A;  3NZU A;  3AXC A;  4JGH B;  4M8N A;  3SD5 A;  3HM6 X;  3KYD D;  2DX5 B;  3APC A;  1BT0 A;  3QAQ A;  2HJ8 A;  1GJZ A;  3DPD A;  4KZ0 A;  3APD A;  4II3 B;  2JUO A;  3ZNI D;  3ZW3 A;  1V5T A;  4GIV A;  1G6J A;  3OJ3 A;  1RLF A;  3U7D A;  5CTR C;  2ZPN A;  4FHJ A;  1WM2 A;  3H6N A;  5J2R A;  2LVP A;  2KAN A;  1JRU A;  4PS7 A;  4KSL C;  2BF8 B;  3B0A A;  2V3S A;  2LJ5 A;  3B08 A;  4MH0 E;  4BVU C;  2KNB A;  3C0R B;  2ZJD A;  2KXJ A;  4MDK E;  2J0J A;  3PS6 A;  4DDG D;  2BYV E;  3A4S C;  4HPM B;  5L83 A;  2L00 B;  4NQK E;  3DOW A;  2KX0 A;  2MRP A;  3HK0 A;  1ZGU B;  2L05 A;  2KJ6 A;  2M8S A;  3MJW A;  4GDL B;  3A33 B;  3UIO B;  5JH5 C;  4MEM A;  2IY1 B;  4DHJ D;  4FJY A;  4IWQ A;  2M1M A;  1H8C A;  3ZRC A;  3TJP A;  1V9J A;  3KH0 A;  5AZH A;  4DXA B;  3ML8 A;  1VCB A;  4BBN F;  2XK5 A;  2GBM A;  3L17 A;  3RYT A;  5D94 A;  3V6C B;  2CR5 A;  5CHF A;  2FNJ B;  3VQI A;  5KHO A;  3TIX A;  2I1K A;  2ZVN A;  4KIK A;  2FCM A;  4W9D A;  2MQJ A;  3H9D A;  3KUZ A;  4ANW A;  1D3Z A;  1CMX B;  4IUM B;  3BIN A;  2FCQ A;  1WE7 A;  4WWN A;  3JSV A;  3QIJ A;  2IY0 B;  3TL5 A;  2KO3 A;  1LM8 B;  4I6L B;  3HIZ A;  2BYF A;  4FJV B;  1P9D U;  1L7Y A;  2G4D B;  3QA8 A;  4GDK B;  1RRB A;  3WAP A;  4FJZ A;  2JT4 B;  3A9K A;  1WXS A;  1QZE A;  4EEW A;  3U8Z A;  4BBN C;  4LDT B;  2GBJ A;  1ISN A;  4NJ6 A;  4MGK E;  3T9L A;  2IO0 B;  3KVF B;  4X57 B;  3OLM D;  4BKS A;  4FAD A;  2HTH A;  1R4N I;  2NPT B;  2KLC A;  4JL9 A;  1UGM A;  3N30 A;  1TGZ B;  4A20 A;  2M4N A;  2Y5B B;  3V61 A;  4KDL B;  4EZJ A;  2K6Q A;  2AEH A;  4K7S A;  3GZN I;  4GMV A;  3QX1 A;  4W9C A;  3WAO A;  2KMC A;  3UQB A;  2DEN B;  2KLG A;  2JZ3 B;  3A9J B;  4WWO A;  1Z5S B;  1WZ3 A;  2KHW B;  1WX7 A;  2RPQ A;  4A3P A;  2WDT B;  4EFO A;  4DHZ B;  2K39 A;  2JVC A;  1WIA A;  3HHM A;  3TCA A;  1U4A A;  2PE9 A;  2N1V A;  3VUX A;  2O6V B;  3VAW A;  5CHV C;  4URK A;  4MJS B;  2KX3 A;  2JPH A;  3D32 A;  4K7W A;  1KLV A;  1UEL A;  2L0F A;  1WJ6 A;  2KFK A;  2ZCB A;  3NY5 A;  4MM3 A;  2UYZ B;  4BOZ B;  2AWT A;  2IO3 B;  2UWQ A;  4FBJ B;  2KTR B;  5C1Z A;  2LGY A;  4OVU A;  1WR1 A;  3CSF A;  4ICV A;  4IM2 A;  2BYE A;  4G3X B;  1FXT B;  2PE6 B;  1J8C A;  4FA6 A;  3PRE A;  3A1Q A;  2C7H A;  4G0N B;  3CST A;  1YD8 U;  5JZE B;  1GC6 A;  1UZX B;  2KWU B;  4W9J A;  2ZVO A;  5AEK B;  2D3G A;  2ZZP B;  2LWP A;  1S3S G;  1WMH A;  2KK8 A;  1WGH A;  3W1S C;  1WGG A;  1WJ4 A;  4FLH A;  1F9J A;  2LI5 A;  4RM8 A;  2YVC A;  3JYU A;  4FN2 A;  2I1J A;  4RM9 A;  2WX0 A;  1WGD A;  2DYM A;  4FUL A;  4ANU A;  3QQ8 B;  3WAM A;  3PZD A;  2N9E B;  4XX5 A;  3PPA A;  1IYF A;  3PLV A;  2MBH A;  3JW0 X;  1K8R B;  3PHX B;  1KJT A;  2D10 A;  2KD0 A;  4B9K A;  1OEY J;  2KWV B;  2O2V A;  2A5U A;  1EO6 A;  3IHP C;  3L13 A;  3RCZ A;  1IPG A;  1E8Y A;  3R3M A;  3PLU A;  3QJZ A;  1EUV B;  1TBE A;  1WX9 A;  2LZ6 A;  2B3A A;  4PYZ A;  2ZPY A;  3IG3 A;  5HKH A;  3O65 B;  4A3O A;  1J0G A;  3ZIM A;  4PYU A;  3SU8 X;  2WX1 A;  4F7Z A;  2KMA A;  1I42 A;  1E8W A;  4KVG B;  2KN5 A;  4AJW A;  1XT9 B;  5DPT A;  3AU4 A;  4IWP A;  4OVV A;  1RFA A;  1WYW B;  2HD5 B;  3QHT A;  2L8J A;  5D7G A;  2EKE C;  2AYO B;  2IZV B;  2NR2 A;  4K1R B;  3BY4 B;  3IBE A;  4TV3 A;  1V5O A;  3JVZ X;  1C3T A;  3QWZ B;  2BGF A;  3M63 B;  4P7I A;  1WR6 E;  1WH3 A;  3X23 A;  4K7U A;  3VXW A;  4ZRI A;  2FID A;  5D2M B;  1GUA B;  1NI2 A;  2JRH A;  2A4Z A;  3LDZ E;  4ASW C;  4DHZ E;  1E8X A;  2C7M B;  4IWO A;  3WAN A;  3B1L X;  2G3Q B;  4E71 A;  2MA9 B;  1V80 A;  1E5W A;  3PV1 A;  2NS5 A;  2GOW A;  2V1Y A;  4NPN A;  4W9H A;  3MHS D;  3IVF A;  1SE9 A;  3DVN V;  3QC8 B;  2MLB A;  4IW0 A;  3WA0 A;  3AUL A;  1MG8 A;  3R7Q A;  4HVB A;  3H1U A;  4ZRJ A;  4BKG A;  3MTN B;  5AZG A;  3RT3 B;  1EF1 A;  1VD2 A;  2N7E A;  1WXA A;  2Z0E B;  2M17 A;  5J17 A;  2D07 B;  3KUD B;  2ZCC A;  2K1F A;  3TBL D;  2MBB B;  3KW5 B;  2PJH A;  2L0T A;  2LD9 A;  3EFU A;  3K9O B;  4DWF A;  3AU5 A;  1EF5 A;  2K6D B;  4NAW A;  5FR6 A;  2G4S A;  2KTF A;  2MBO A;  3VHT C;  4GB9 A;  3L54 A;  4HCN B;  2K25 A;  3ML9 A;  5G2N A;  1V6E A;  2N4F A;  2C60 A;  1UD7 A;  4AJY B;  1I35 A;  4KIK B;  2M0X A;  3UQA A;  2JY6 A;  4HWI B;  4MGI E;  4CHK A;  1Q5W B;  4W9I A;  2HE7 A;  1OQY A;  1WRD B;  4EZK A;  3VH3 B;  3UIN B;  4F1S A;  4W9K A;  2LVO A;  3JSV B;  2NBW B;  3DBL I;  4MJS A;  3PRP B;  4HDO A;  3WIM A;  2Z59 B;  1LQB A;  3H7P A;  2LGD A;  2MP2 A;  4G11 A;  2LVQ A;  1PQS A;  3PRZ A;  2JF5 A;  5E6P A;  3SHQ A;  1OTR B;  2D11 A;  1Y8R C;  1Z2M A;  4W9L A;  3VH4 B;  3A9K B;  2GBK A;  4HXD A;  4MEL A;  4W9E A;  2ZNV B;  4WJN A;  4B6W A;  1XD3 B;  2YLM A;  4BKT A;  2DAJ A;  2KDB A;  2KZR A;  4II2 B;  3W1Y A;  5IAA C;  3KUC B;  1SGH A;  1WZ0 A;  2AL6 A;  3U30 A;  4XC2 A;  2FAZ A;  1V49 A;  1P0R A;  3V62 A;  2RSU A;  2BPS A;  4AUQ C;  1P3Q U;  3EC8 A;  2KC2 A;  4GGQ A;  1GG3 A;  4W9G A;  4K81 A;  2BWE S;  4HPL B;  2KDI A;  5LXH A;  1AAR A;  5TR5 A;  3QK0 A;  3ONS A;  3RUI B;  5JHB A;  4ANV A;  4PS8 A;  3EHV A;  1KM7 A;  2PEA A;  5KHQ A;  1SIF A;  1E8Z A;  1WY8 A;  2MCN B;  4M0W B;  2JZZ A;  1WE6 A;  4KSK C;  1KOT A;  2KDE B;  4HLE A;  5E6N A;  2DYO A;  4W9F A;  2MSE D;  4MSM B;  2KFK B;  2XEW A;  2K8C A;  5GMV A;  3HM3 A;  2NVU I;  2RGF A;  4TQ1 A;  2KC1 A;  3DDC B;  2D2Q A;  3A1Q B;  3M95 A;  2ZNV C;  2IO2 B;  3VDZ A;  3X0W A;  3L16 A;  1T0Y A;  2GBN A;  4GOC A;  4JIO U;  5L95 C;  1YIW A;  3PSE B;  1WMH B;  3VUW A;  2LGX A;  2NBV B;  2K8B A;  2K8H A;  1E7V A;  3DQV A;  3N3K B;  3RZW C;  4AWJ A;  3APF A;  4LJO B;  1WM3 A;  3ZDT A;  1OGW A;  1HE8 A;  1YX6 B;  4CO7 A;  2DAF A;  2EMT A;  3A4R A;  2LAS A;  4EUT A;  4TUU A;  4NJ7 A;  2L3Z A;  5CX3 A;  5E6O A;  1UBI A;  2EMS A;  4GDL A;  1H4R A;  3KYC D;  4XZ4 A;  4TQ0 A;  1UH6 A;  4KV2 A;  2R2Q A;  4IC7 B;  4MSQ B;  2C9W B;  3ZTD A;  4MGZ E;  2W9N A;  2J7Q B;  1Q1O A;  3I3T B;  4HCP B;  2CHW A;  2O2V B;  4DBG A;  3ENE A;  2KWC A;  4J6I A;  4BFR A;  4F8C B;  3CMM B;  2L76 A;  4WQO B;  2V4L A;  3ZO5 B;  4ZYN A;  3PT2 B;  2CS4 A;  4AOF A;  4ZDV A;  2KQS A;  1ZKH A;  5J18 A;  2IYD B;  2CU1 A;  3ZVV A;  2J0K A;  1S1Q B;  2IO1 B;  4EKU A;  3SDL C;  3T8M A;  2JWZ A;  3VTU A;  2VRR B;  3WAL A;  1Q0W B;  1NBF C;  2CHZ A;  2LRU A;  2REX A;  4AP4 C;  3R7R A;  4DK5 A;  2C7N B;  4ZRK A;  3VVW B;  1R4M I;  4ICU A;  1UBQ A;  3LJ3 A;  3AI5 A;  4RMA A;  1GC7 A;  3IFW B;  3RUL A;  1C1Y B;  1LXD A;  5JHA A;  1J19 A;  2LUE A;  2N1W A;  2KVR A;  5IA7 A;  4GDK A;  1V2Y A;  4DHJ B;  3PTF C;  3QCA A;  2KOX A;  4BOS C;  5C23 A;  1V86 A;  2FIF A;  4GSW A;  3PGE A;  2MBQ A;  4GU2 A;  2CKH B;  3ZLZ A;  1A5R A;  2LRW A;  3ZUN A;  1ZW7 A;  2NPT A;  2DYB A;  3W1S A;  3ZNH B;  4WAA A;  1OEY A;  4WJO A;  3PVL A;  2ZEQ A;  4NY0 A;  2NBU A;  4LDT D;  1TZ1 A;  1XQQ A;  3A9J A;  5BO4 B;  2XK5 B;  2ASQ A;  2DHZ A;  2R2O A;  4G50 A;  5DPS A;  2KJH B;  4YL8 A;  1X1M A;  3OJ4 B;  3ZKJ C;  1TTN A;  4PS3 A;  3K9P B;  3GOE A;  2DZK A;  3EEC A;  3VTW A;  1IP9 A;  1WJU A;  2IBI B;  1M94 A;  2KQ7 A;  2BKR B;  4HJK A;  3RD2 A;  2O6V A;  2MWS B;  3N32 A;  5DPR A;  5AZF A;  4WJQ A;  1WGY A;  4FHK A;  5DPW A;  2KKC A;  2DZI A;  2RD0 A;  3UGB B;  2AL3 A;  4JLC A;  2L7R A;  3M3J A;  1LFD A;  1NDD A;  2MX2 A;  3L10 B;  2NCN A;  2KTR A;  4IM3 A;  5CHW A;  4WWP A;  4E3C A;  4NNJ B;  2OOB B;  4DDI D;  2FCS A;  2O6V D;  4EOY A;  2MW5 A;  2Z0D B;  3Q3J A;  4HK2 A;  2KDF B;  3DVN U;  4IG7 B;  2N9X A;  4ANX A;  4NQL B;  2G45 B;  3DBH I;  2FUH B;  1WGR A;  1YJ1 A;  3DBS A;  3DVG Y;  4I6P A;  4NAW B;  3CF6 E;  3RZF A;  3ECI A;  4BKS D;  4N9F 4;  3VUY A;  1WXV A;  2J0M A;  1GNU A;  1WF9 A;  2GMI C;  3ZRF A;  1WX8 A;  2JRI B;  4WJP A;  2MBE A;  4KZC A;  3DCG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...