2WYQA

The crystal structure of the ubiquitin-like (ubl) domain of hhr23a (human homologue a of rad23)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
b'MAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKNFVVVMVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UV EXCISION REPAIR PROTEIN RAD23 HOMOLOG A
publication title The Crystal Structure of the Ubiquitin-Like (Ubl) Domain of Human Homologue a of Rad23 (Hhr23A) Protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 20
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2009-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2wyqA00
1S1QB 4JQWC 4HPMB 3UIPB 4OVVA 4GIVA 2MBBB 2IO3B 2KFJA 2ZZPB 2IYDB 5KHQA 2KD0A 2KWUB 2KMAA 4KIKA 3U8ZA 1WIAA 1OQYA 4KV2A 4PYUA 1KM7A 4ZRIA 3MTNB 2ZPYA 5G55A 2FCSA 1EF1A 3CSTA 4F8CB 3A1QB 3V61A 1ZW7A 3VUXA 1JRUA 2LWPA 2KO3A 5DPWA 1P98A 3ZNZB 3DBLI 3CF6E 1WMHA 5G2NA 3SDLC 3T9LA 1E90A 1ZKHA 4EKUA 4NQKE 4DWFA 2N9XA 4WQOB 2JRIB 4DHZB 2K8CA 5CX3A 2RSUA 2L8JA 3VDZA 3TJPA 2KJ6A 4G0NB 4KSLC 4DHZE 5AZGA 1J8CA 2DZJA 3QX1A 3U7DA 2M8SA 3QAQA 1YX6B 4AOFA 3EHVA 2IO2B 4IC7B 3LDZE 3S2AA 2GBJA 2KJRA 2IBIB 2KTFA 4PS7A 4B6WA 2XK5A 3Q3JA 2MBHA 3BINA 5GMVA 1H8CA 2HE7A 2ZPNA 3PHWB 3CSFA 2KDFB 3PS6A 3JSVA 3A4RA 3WANA 2DX5B 3APCA 1Q1OA 2GMIC 2ZNVC 2NBWB 3X0WA 4URKA 4YL8A 5E6OA 5IA7A 2FIFA 2QHOA 4BVUC 5J18A 1QZEA 1A5RA 1WJ6A 2J7QB 4GXBA 4DK5A 5J2RA 4GDKB 3ECIA 2BKRB 1WH3A 2WX0A 2MP2A 2KC1A 2KVRA 1NDDA 2WX1A 2DHZA 5DPTA 4GB9A 4HPLB 2JXXA 1GG3A 4AP4C 3Q3FA 4II2B 1NI2A 2M17A 4MSQB 4BOZB 2REXA 4XX5A 3OAWA 3L17A 2KTRA 2G4DB 2K8BA 3TIXA 3M95A 3R66C 3TCAA 3L0WB 1OTRB 1FXTB 3QJZA 2BYVE 4IUMB 2BYEA 2Z59B 3JW0X 3ZUNA 2J0KA 3BY4B 2FCQA 3PVLA 3RUIB 3H9DA 2WWZA 3O65B 3WAPA 3PT2B 4KZCA 2GBRA 2XBBC 1RLFA 1V80A 3APFA 1WXSA 1ZGUB 1RAXA 2D10A 2KK8A 2MQJA 4JLCA 4MEMA 4JIOU 1L7YA 2EMSA 3ZKJC 4TV3A 2DYOA 4II3B 4RMAA 4ANXA 4IWQA 2DAFA 1RFAA 5C1ZA 5AEKB 2MSED 4W9KA 1Q5WB 4A3PA 3HK0A 4FA6A 3H7PB 1WM2A 4IM3A 1KLVA 1GC6A 1UGMA 3ZNHB 2C9WB 3DVNU 3GZNI 1WJUA 2EMTA 2NS5A 3DCGA 1WYWB 3B08A 4ICVA 2LVPA 3A1QA 3M63B 2CS4A 4NPNA 2R2OA 3DBHI 3V60A 4AUQC 3NOBA 2NBUA 3PTFC 2LASA 3APDA 4HCPB 1G6JA 4G50A 3DDCB 4IWOA 5E6NA 2DZKA 2FCNA 1GUAB 2I1JA 1V2YA 2W9NA 2ZJDA 4IM0A 2MA9B 1E8XA 3I3TB 4N9F4 3RCZA 2LUEA 3R7QA 3W1YA 1WJ4A 4CO7A 2L05A 5D94A 2LRWA 2XEWA 2KHWB 5BO4B 4G11A 1YX5B 3ZW3A 4FLHA 2JZ3B 4BKGA 3L16A 1WXVA 2N4FA 4TKNA 4ASWC 2WYQA 1CMXB 4E3CA 2BYFA 4M8MA 3SHQA 2YVCA 2KJHB 3QIJA 1P3QU 3X23A 1UBIA 4KVGB 3ZDMC 2C60A 3DVGX 3ZRFA 5L95C 2DZMA 2G3QB 2JUOA 2AYOB 1MG8A 3PRMB 4MELA 4ANUA 1Q0WB 4NJ6A 4A20A 2L7RA 3PGEA 2MBOA 3NZUA 4GMVA 4WAAA 1IPGA 3AULA 3ZNID 3ZTDA 3RZWC 2GOWA 2L0FA 4K7SA 2N9EB 3MJWA 3V6EB 2ZCBA 1H4RA 4AWJA 4GGQA 3OJ4B 3QC8B 4MGKE 2N1VA 5DCNA 2GBMA 4PS8A 4W9IA 3V6CB 1EUVB 2LRUA 3ZNGC 3QARA 2LXAA 1SGHA 2KOXA 3WALA 3VQIA 2NCNA 3PHXB 2B3AA 1WRDB 1EF5A 4IWPA 2KMCA 5CHFA 4WJNA 3H1UA 4DHJB 1L2NA 3CMMB 2FNJB 2L0TA 1WGRA 3IG3A 4W9HA 4FHJA 2O6VB 4LJPB 4LCDE 3A9KB 2V4LA 2C7MB 3KYDD 4FN2A 2O2VB 4NAWB 3ZIMA 3HM6X 2NVUI 4BKSA 4CYEA 4MJSA 3B0AA 4XC2A 3M62B 4BKSD 4GDLB 3AXCA 2NPTB 3DQVA 3VUYA 3AU5A 4F1SA 3WAOA 3VUWA 2KX3A 2ZVOA 2ZEQA 3N32A 3R3MA 2N7DA 3KYCD 2D07B 1E8WA 4OVUA 3JVZX 4I6NB 3OLMD 1UZXB 2R2QA 3DVGY 4J6IA 2KX0A 1WZ3A 2D3GA 2JRHA 3P2BA 4M8NA 3VTWA 4B9KA 1YD8U 2KNBA 2JY6A 3KVFB 4LDTB 4X57B 3H7PA 2CR5A 2JPHA 4HDQA 2BWFA 1WR1A 4JL9A 5JZEB 1SIFA 1V9JA 1OGWA 2K6QA 3TBLD 4ANWA 2RD0A 2PE9A 4WJOA 1NBFC 2Z0DB 2JF5A 2LJ5A 4ZDVA 2D11A 3PZDA 2LXCA 5D6JB 1WFYA 4GOCA 2N9PC 2KQ7A 2AL6A 4G3XB 1YIWA 5J17A 5KHOA 2BF8B 1WJNA 3EECA 2M1MA 4K1RB 3WA0A 1E7UA 4ZRKA 1XT9B 3IHPC 1P1AA 3NS8A 2PJHA 3HM3A 4W9GA 5D2MB 3AI5A 5DPSA 3EC8A 1V81A 3N30A 4HWIB 4TQ1A 2RR9A 1EO6A 4WJQA 3DOWA 2YLMA 1LXDA 2MX2A 3EFUA 3WIMA 3DBRI 2KLCA 4BBNF 5LXIB 1WX7A 2NBVB 2VRRB 2K1FA 1WR6E 2MW5A 4P7IA 4EOYA 1D3ZA 4A3OA 1C3TA 4HLEA 5IAAC 2DYMA 2N1WA 4W9EA 2N7EA 3UQAA 2HTHA 4B95A 2AL3A 1S3SG 3KUZA 2KANA 2PE6B 3RZFA 2C7NB 1TBEA 3H7SA 3PLUA 5CHWA 2OOBB 2NR2A 3KW5B 3VFKA 5TR5A 3SD5A 2KLGA 1TZ1A 4WWNA 4KZ0A 5FR6A 4MM3A 4PYZA 3VVWB 2C5LC 4PS3A 3TL5A 3L10B 3ZDTA 3B1LX 3N3KB 4EUTA 2RGFA 2LGXA 1SE9A 2FAZA 2MLBA 2M4NA 3LJ3A 3ONSA 1R4NI 4FHKA 4FJYA 2AEHA 3A4SC 3A9JB 4DBGA 3PSEB 2V1YA 2A4ZA 4IW0A 1WGHA 1YJ1A 5E6PA 2LGYA 1WGDA 1VCBA 1WE7A 3KUDB 4HK2A 2O6VA 2HD5B 2WDTB 4BFRA 3A9KA 5LLIA 4FJZA 5C23A 2FUHB 1XD3B 2D2QA 3UQBA 2L00B 2O2VA 4IM2A 4NAWA 1R4MI 3PREA 2K25A 4ZYNA 4GDLA 3U30A 2NPTA 2OJRA 2KKCA 3KUCB 4DDID 1P0RA 1GJZA 3UGBB 4EZLA 2KDBA 2KFKB 1TGZB 5CHVC 3ML9A 2G4SA 1V49A 4RM8A 3RT3B 2K8HA 2LZ6A 2UWQA 3M3JA 3ZO5B 1HE8A 1T0YA 4K7UA 3H6NA 1IYFA 2BWES 4GDKA 3VXWA 4E71A 1I42A 1BT0A 3UF8A 3JYUA 1IP9A 2MRPA 3IVFA 4DDGD 5DPRA 1YQBA 3ZRCA 4LDTD 1OEYJ 3UINB 2LGDA 2K6DB 1UD7A 3UIOB 2C7HA 4DXAB 4I6LB 3OJ3A 2ASQA 2JZZA 1UELA 1Y8RC 2LVQA 3QA8A 4KDIC 5D7GA 3VTUA 4KSKC 1WF9A 4XZ4A 2KZRA 2CHWA 3QQ8B 4EFOA 2ZCCA 2KQSA 2KWVB 4FULA 1WGGA 3ML8A 4TUUA 3R7RA 4W9JA 3TMPB 4HVBA 1U4AA 3IBEA 2CKHB 2PEAA 3VHTC 2KXJA 1WX8A 2EKEC 5CTRC 1UBQA 4BOSC 1KOTA 3ALBA 3HHMA 3MHSD 1F9JA 2LVOA 3VH3B 2MBEA 4KIKB 4CHKA 3C0RB 1XQQA 4FJVB 2MBQA 4WWPA 1X1MA 4EEWA 4EZJA 2Z0EB 2G45B 2KC2A 2PPHA 4LJOB 5AZFA 1V86A 1WMHB 2CU1A 1M94A 3SU8X 1J19A 4MGYE 5LXHA 3NY5A 1V5TA 4NNJB 2L76A 4W9FA 4K7WA 1V5OA 2I1KA 4HJKA 2IO1B 5HKHA 2M0XA 2IY1B 3DVNV 3L54A 1WI0A 2AWTA 2FIDA 3GOEA 1E8YA 1LFDA 2LI5A 5JHBA 2DENB 4W9LA 1J0GA 2DAJA 2GBKA 2HJ8A 4BBNC 5EDSA 4AJWA 3NHEB 4K81A 5AZHA 1E7VA 2LD9A 4TQ0A 2Y5BB 4MGZE 4W9CA 2CHXA 4FBJB 2L3ZA 4RM9A 3W1SA 3KH0A 1WXMA 4GN1A 3K9OB 2ZNVB 3IFWB 3RULA 5JH5C 2CHZA 2XK5B 1LM8B 1WZ0A 3A9JA 1LQBA 4MGIE 4HXDA 4E74A 3QWZB 4HDOA 3VAWA 1UH6A 4ANVA 2J0MA 5L83A 2JVCA 3DPDA 1WY8A 2MCNB 1C1YB 2RPQA 3JSVB 2DYBA 4MJSB 4WWOA 2BKFA 1TTNA 2FCMA 3W1SC 2BGFA 2A5UA 1WX9A 3QK0A 2GBNA 4BKTA 2J0JA 4KDLB 1GC7A 1WXAA 4NQLB 2DZIA 4WJPA 2V3SA 1AARA 3L13A 4HCNB 4AJYB 3L08A 1P9DU 1WGYA 3QHTA 4GSWA 1GNUA 4ICUA 1PQSA 4ZRJA 3ZTCA 3RYTA 4F7ZA 2KFKA 4FADA 4MH0E 2MP2B 3DBSA 1WE6A 3PRZA 4I6PA 2MWSB 3ZLZA 3V62A 4GU2A 2IY0B 1V6EA 2JWZA 4MDKE 1I35A 2IO0B 1K8RB 3ENEA 2UYZB 2JT4B 3NZSA 2KTRB 3A33B 1VD2A 4M0WB 3VH4B 2KDEB 3PPAA 3QCAA 4MSMB 4EZKA 3VTVA 4NY0A 4NJ7A 1E8ZA 1ISNA 3HIZA 3PV1A 3RD2A 4DHJD 3PLVA 2KWCA 1Z2MA 1KJTA 3WAMA 2O6VD 2KDIA 5JHAA 1RRBA 3PRPB 3K9PB 2IZVB 2BPSA 2KN5A 4W9DA 2K39A 4IG7B 1WM3A 1Z5SB 2ZVNA 3T8MA 4JGHB 3ZVVA 1E5WA 3AU4A 3D32A 1OEYA
chains in the Genus database with same CATH superfamily
4JQWC 3UIPB 2MBBB 2KD0A 2I2YA 5IOIA 1OQYA 1KM7A 3MTNB 5HI1A 5G55A 5TSSA 4RF1A 4F8CB 3V61A 1PUTA 3VUXA 5BMIA 1JRUA 2LWPA 4J3OD 3MFGA 1IBXA 2M56B 2K8CA 2L8JA 2KJ6A 1SEBD 1BUIC 1GOZA 4WURA 4ARIA 1YX6B 1CZPA 2IO2B 4FXCA 1XCQL 2KJRA 1LGRA 2N9KA 4XYCA 4B6WA 3Q3JA 2LHDA 2MBHA 5GMVA 2HE7A 3PHWB 3P63A 2KDFB 3AE3B 2CU3A 2GI9A 3I57A 5H8YE 4US8A 1YN4A 3P1MA 1P7FA 4XWTA 2NBWB 2Y5PA 4BVUC 1SSNA 3BIID 2BS4B 4DK5A 5J2RA 4Q2JA 4GDKB 2BT6A 3BWUD 2WX0A 2DHZA 4AP4C 2MJ3A 3IT4B 4II2B 2M17A 1JWUD 4BOZB 2LMCA 3BVGA 2ONQA 4M0WA 3R66C 2BBCA 2BYVE 2WU5B 3ZUNA 3U7ZA 1JQ4A 3PVLA 3PO0A 3WAPA 2XBBC 1DOXA 4L1BA 1L7YA 3ZKJC 4TV3A 4WQMA 4ANXA 2DAFA 2OHFA 1CQVA 4W9KA 4A3PA 3GP7A 3H7PB 4M00A 4IM3A 2QC8A 1GC6A 2JU6X 3J9CA 2C9WB 3P4QB 2R2OA 3V60A 4AUQC 3NOBA 3PTFC 4KGRA 4HCPB 1D6EC 3DDCB 3I63C 3RCZA 4CO7A 1N60A 2LRWA 1YX5B 1NVID 4FLHA 2JZ3B 4BKGA 2WYQA 3P4SB 4MT5A 4M8MA 2YVCA 4KVGB 1J7AA 5C2TB 1YNTE 1UF0A 2DZMA 3PRMB 1N6ZA 4GMVA 2BB5A 1TKEA 3AULA 1D5ZC 3ZTDA 2K0PA 4K7SA 3V6EB 3TEXA 2KWDA 2PKOA 4OZBA 1EUVB 2LRUA 3WALA 4BAXA 3PHXB 4NAMA 1VZ6A 4WWMA 3TEYA 3ZJUA 1YJIA 1TY2A 2HTME 4DHJB 2PVGC 3A9KB 3Q8AA 3ZIMA 1MHXA 4JX1C 3B0AA 4XC2A 4A90A 3DBHB 2NPTB 3WAOA 1QILA 1I4GA 3N32A 3R3MA 4OVUA 2KN4A 3JVZX 1T0SC 1WZ3A 4M8NA 2KNBA 1TS5A 3EGRA 1F52A 4R3DA 4HDQA 4LLGM 2WDRB 2MEKA 1NYRA 3P4PB 1C4CA 4ANWA 2RD0A 2PE9A 2HJ1A 1TIFA 3Q2AC 1WFYA 3AEDB 2AL6A 1YIWA 5J17A 1ZDVA 3WA0A 2D3BA 4REZA 3NS8A 5BYQA 2PJHA 5HHDG 2RDBC 3DHHC 1EO6A 4WJQA 2W55A 2YLMA 1LXDA 2MX2A 3EFUA 3EA6A 5LXIB 2SEBD 2VRRB 2K1FA 1F1HA 1WR6E 2MW5A 4P7IA 1D3ZA 4A3OA 1XLPA 1C3TA 1VZ8A 2DYMA 3MC9A 3VR9B 4DQOC 1AN8A 3SD5A 3LB8C 1E6EB 2INDC 4PYZA 3VVWB 3TL5A 3B1LX 3N3KB 3LJ3A 1UWMA 1R4NI 4FHKA 2AEHA 1L4ZB 1FPYA 3NJTA 2KDMA 3AM9A 2HD5B 2WDTB 5LLIA 4YTNB 4IM2A 2E6XA 3PREA 1KTKA 3U30A 2V9HA 3Q6BA 2DLBA 4IDIA 1F2RC 2KDBA 5D3IB 1TGZB 2G4SA 2MJDA 4TSSA 3M3JA 1T0YA 1OQQA 2J4XA 3H6NA 2UU7A 3BK2A 3I9V1 1C77A 1ZUD2 4AS1A 4LDTD 3UIOB 2K6DB 3CWIA 3OJ3A 4H2AA 5BMHA 3AECB 5D7GA 3T3NA 1BXTA 3OWEB 2GB1A 2KZRA 4YT0B 2CHWA 3QQ8B 4FULA 1MI0A 4W9JA 3IBEA 3VHTC 1WX8A 1RM6C 2EELA 3MHSD 3VH3B 1F9JA 2MBEA 3C0RB 4FJVB 1ACCA 4WWPA 4EEWA 4EZJA 2V4IB 1KLUD 2W82A 1C76A 3I5JC 4LJOB 3TEWA 2XNAC 5AZFA 1RWSA 2JYTA 1WMHB 3SU8X 5LXHA 3VR8B 4HJKA 4JPSA 3TUOA 2IO1B 3L54A 1A70A 1FFUA 2AWTA 2LFIA 3FAHA 2IDYA 1J0GA 1DOIA 5EDSA 1EM7A 2DWQA 5JH5C 2XK5B 2YEPF 4MGIE 5GXGB 4HXDA 4E74A 4HDOA 1JWAD 3VAWA 2YEPB 2JVCA 2RPQA 1AW7A 3GB1A 2BGFA 1FFVA 1QT9A 1PGXA 1GC7A 3MC8A 4NQLB 2V3SA 2VZKD 4HCNB 1P9DU 3NUHB 4GSWA 1L5PA 2MP2B 3DBSA 1WE6A 3PRZA 3ZLZA 4ITKA 1I35A 3B2FA 1K8RB 2K9XA 3NZSA 4ZRPA 4EE2A 1N62A 3QCAA 3VTVA 1ISNA 1VDVA 2WP9B 3PLVA 4WIPA 1L4DB 2O6VD 4MH8A 5JHAA 1RRBA 2INPE 2JSVX 3T8MA 3ABVB 5EE0A 1T6BX 5BMGA 4HPMB 4OVVA 2IO3B 2KFJA 2KWUB 2KMAA 4KIKA 4KV2A 3IAM1 4PYUA 4ZRIA 3V3XA 1SXTA 3AE5B 3A1QB 3NVVA 2E3TA 1NYQA 2KO3A 1P98A 1L6VA 3ZNZB 3DBLI 5G2NA 3T9LA 4EKUA 4WQOB 1ROEA 2QSDA 4K3BA 2RSUA 3VDZA 3TJPA 2Z8LA 1KRHA 4KSLC 5AZGA 3U7DA 2M8SA 2BS2B 5EE3A 1PGAA 3LDZE 1HA5A 3Q8FA 3S2AA 2IBIB 2KTFA 4DXFA 5FKAC 2WXPA 4ZHPA 1H8CA 2ZW1A 1IUEA 1KLGD 3N20C 3JSVA 1N5XA 4IOIE 2DX5B 1Q1OA 2INNE 2ON8A 4HKZE 4HRSA 3RN9C 4URKA 4YL8A 2FIFA 4N6EB 1ESFA 1QZEA 1WJ6A 4GXBA 1FRDA 1WH3A 1NDDA 2WX1A 2N0SB 4GB9A 2JXXA 1B9RA 1DOYA 4KGTA 4MSQB 2REXA 2G4DB 2K8BA 3M95A 1GAQB 1FXTB 3BYYB 4HPPA 2Z59B 1XLNA 2IGGA 3RUIB 2GBRA 2WXJA 1V80A 1ZPSA 1WXSA 3N1YC 2D10A 4NZLB 4JLCA 5EE1A 4MEMA 4JIOU 4ACFA 4II3B 4RMAA 1RFAA 1FNVA 5AEKB 3HK0A 4FA6A 1WM2A 1J7CA 1F2RI 4RH6A 1YJJA 1C78A 3DVNU 3GZNI 2NS5A 1XXGA 4NPNA 1G6JA 4LNOA 4O1NA 1FCLA 1F77A 1QLBB 4IWOA 1V2YA 4KKIA 2KQ4X 3I3TB 2WQYB 2L52A 1WJ4A 1TJEA 2K3UA 2L05A 5D94A 2XEWA 5BO4B 1ZOYB 1WXVA 2PW9A 2LEKA 3FC4A 1QOBA 1CMXB 3H8HA 2LJIA 2SAKA 1T5XD 3X23A 2C60A 3DVGX 1UUPA 2AYOB 4MELA 4ANUA 4NJ6A 4A20A 2IPKD 2J52A 3PGEA 2KACA 2KVZA 1V1PB 1VLBA 2L83A 2WU2B 4USAA 3RZWC 3SEBA 2GOWA 2L0FA 2RPVA 4GGQA 3OJ4B 1GB4A 4W9IA 2LGIA 3SR6A 3VQIA 2B3AA 1SIJA 4LK0M 5MPOA 1WXQA 3H1UA 1L2NA 2FNJB 2L0TA 1WGRA 2WNMA 4FHJA 2J42A 2V4LA 2C7MB 4A8XC 4NAWB 2NVUI 3RNGC 1UWXA 3P4RB 4MJSA 4CYEA 3M62B 3AU5A 4F1SA 4A6QA 4S0RA 4YTPB 2JX5A 4I6NB 3DVGY 3NVYA 2D3GA 2JRHA 3P2BA 1YD8U 3Q8BA 4ARCA 2D5GA 3H7PA 2CR5A 3BVZA 3TBLD 1DYQA 2J53A 3IT6B 4WJOA 2V3NA 2JF5A 1IBXB 4ZDVA 2WXMA 3PZDA 4GLSC 2LXCA 2N9PC 2WXLA 2PIAA 2BF8B 4K1RB 1E7UA 3IHPC 5DPSA 3RNBC 4DXGA 3EC8A 1V81A 2RR9A 3DOWA 3NVWA 3Q69A 3DBRI 2KLCA 4US9A 2QDFA 3MJ5A 4EOYA 2BB6A 4HLEA 2HTHA 2AL3A 1S3SG 2KANA 2PE6B 2C7NB 3H7SA 2FE8A 2OOBB 1QOGA 3KW5B 3VFKA 2KLGA 4WWNA 2C5LC 3L10B 2JZPA 3ZDTA 2RGFA 1TS3A 2MLBA 1CJEA 2NTSA 3BYTB 2QJLA 4B0EA 2JWUA 3A4SC 4IKGA 3PSEB 2V1YA 2WXGA 5BYRA 1WSPA 5E6PA 2LGYA 1WGDA 1WE7A 4HK2A 3A9KA 1PYWD 5C23A 3UQBA 1XD3B 3RI7C 1R4MI 4ZYNA 2NPTA 1MPEA 2OJRA 4DDID 3UGBB 2DBYA 5CHVC 3MP9A 1I7HA 2BVCA 2X38A 1HE8A 2IJ0A 4K7UA 3KWVA 2BQQA 3SFDB 1BT0A 3UF8A 3JYUA 3NS1A 4A9AA 4DDGD 1HZ5A 1YQBA 5DPRA 1UD7A 2Y3AA 4I6LB 1UELA 3ZXVA 2WXQA 1Y8RC 3VTUA 4HJGE 3AEFB 5E6JA 2ZCCA 2KWVB 1WGGA 1L0YB 3NVZA 3R7RA 3TMPB 1K52A 4HVBA 3N1ZC 1XCTL 4YSXB 1YMHE 1R4NB 2QEJC 1AYFA 2Z0EB 2KC2A 1FEHA 3AH7A 1M94A 2AQ3B 4W9FA 3WCQA 4OZCA 1WI0A 1E8YA 4LNFA 4W9LA 4BBNC 2HJ8A 3KLSX 5AZHA 4TQ0A 2Y5BB 4MGZE 2CHXA 1HEZE 3W1SA 1L0XB 1WXMA 4GN1A 2CHZA 1WZ0A 2J0MA 5L83A 4S17A 3TEZA 2MCNB 1C1YB 1V8CA 5IP4D 1Q10A 4BKTA 2GBNA 4KDLB 2ACZB 1C79A 2DZIA 1DGJA 1MG4A 3Q14C 4WJPA 1I4HA 4RGMA 1WGYA 3QHTA 3RYTA 4FADA 2VH2A 2KYWA 2MWSB 1QQRA 1V6EA 2JWZA 2IO0B 4KX6B 2KTRB 3A33B 1VD2A 4NJ7A 2KWCA 4WAFA 1Z2MA 1FM0D 1EU3A 2HDEA 1MVKA 3K9PB 2BPSA 4XDCA 4W9DA 1WM3A 2ZVNA 3C19A 3ZGZA 1E5WA 4GU2A 1B1ZA 2NMQA 3U8ZA 2AQ2B 3AEEB 2FCSA 1EF1A 3CSTA 1ZW7A 1SF0A 3B9JA 1WMHA 3SDLC 1E90A 1ZKHA 2WXFA 3FILA 4DWFA 4ZYSA 2JRIB 4G0NB 1FXAA 2WDQB 4AOFA 1D5XC 3EHVA 4IC7B 1AWDA 1V97A 2WXOA 1OFFA 4PS7A 2XK5A 3BINA 3CSFA 1GB1A 4C7YA 3WANA 1SE4A 2GMIC 2ZNVC 3X0WA 2WGSA 3C8YA 3DHGC 5E6OA 5IA7A 5J18A 1A5RA 2BKRB 2WLBA 2MP2A 2KC1A 3EUB2 2WXHA 4HPLB 1GG3A 3Q3FA 1N61A 3AV8A 3TIXA 3TCAA 3L0WB 3QJZA 1FRRA 4IUMB 3LXFA 2W54A 3JW0X 2J0KA 4CQNA 2FCQA 3H9DA 3O65B 3DBLB 3GE8C 1GPXA 1FCCC 1RLFA 3APFA 1RAXA 2D3CA 3DHIC 2EKIA 2DYOA 4IWQA 4ZRQA 5C1ZA 2W3RA 1Q5WB 5HG2A 4MACA 1KLVA 3RPFC 1UGMA 1TYGB 2EMTA 3DCGA 1WYWB 3B08A 4ICVA 3A1QA 2V3PA 5G5GA 2NBUA 3APDA 1FNWA 5E6NA 2DZKA 2I1JA 2W9NA 2MA9B 1E8XA 4N9F4 1QOFA 2KHWB 2IGHA 4G11A 4TKNA 4ASWC 2L32A 2BTEA 2BYFA 1JCKB 3SHQA 4UDUC 2KJHB 1P3QU 1UBIA 3ZDMC 5C3JB 2JUOA 2G3QB 3B2GA 1MG8A 2VZKB 2MBOA 3NZUA 2QIEB 3ETRA 1IPGA 4WAAA 4RGOS 2K5PA 3W9CB 3MJWA 3Q3NC 4MM3B 3V05A 2ZCBA 1H4RA 4AWJA 1EWYC 5DCNA 4PS8A 2FUG1 3QARA 1SGHA 2KOXA 2QMTA 3RNAC 1WRDB 1EF5A 2L1AA 4IWPA 3AE9B 4C4VB 3IG3A 1T0RC 2O6VB 3GZNB 3KYDD 4FN2A 2O2VB 2M19A 3DWGC 3HM6X 2LHEA 4BKSA 4BKSD 4GDLB 3AXCA 3VUYA 1FIQA 3AEAB 4AQ7A 4XWWA 3VUWA 2KX3A 2MH7A 2ZVOA 3W5UB 2ZEQA 4XE0A 2N7DA 3KYCD 2D07B 1E8WA 1K53A 3OLMD 1UZXB 2R2QA 1NEKB 4J6IA 2KX0A 3VTWA 2JY6A 3KVFB 3AE2B 1L6UA 2JPHA 2BWFA 1WR1A 4JL9A 1WGKA 5JZEB 4OW0A 1I4PA 1V9JA 1OGWA 2K6QA 1NBFC 2MJEA 2ZW0A 1FO4A 2LJ5A 4RNAA 5D6JB 4GOCA 1FMAD 2KQ7A 4NJCA 4G3XB 5KHOA 2M1MA 1MFWA 1XT9B 1P1AA 3HM3A 5D2MB 4OVZA 3N30A 4HWIB 4TQ1A 1YN5A 3E9SA 1TY0A 1WX7A 1ZP0B 2PMVA 2N1WA 3KWLA 4W9EA 3UI3A 3UQAA 4B95A 3PLUA 5CHWA 1CK1A 2NR2A 4RCOA 5FR6A 1TZ1A 4KZ0A 2GRIA 3T3OA 4PS3A 4PT5A 3HRDD 4TMAB 2LGXA 2FAZA 2M4NA 1XO3A 1E0ZA 3A9JB 1SE2A 4DBGA 2A4ZA 3HUIA 2BS3B 4YSZB 4B0MA 1VCBA 1FXIA 3KUDB 1QOAA 4NAWA 3RNEC 2KKCA 3KUCB 4EZLA 1C9FA 2KFKB 3ML9A 3VRAB 1ZDXA 2UWQA 4RGNA 3AB5A 4WH4A 4GDKA 1MJDA 4E71A 3IVFA 1OEYJ 3UINB 1VJKA 2LGDA 4DXAB 3DBRB 2LVQA 1HTOA 3QA8A 4KDIC 4XZ4A 2R61A 1QKZA 1Y56A 2KQSA 3Q3MC 3ML8A 3NRZA 1U4AA 2CKHB 2PEAA 2XN9C 3AE8B 5LNK1 2WXKA 2EKEC 1UBQA 4BOSC 1KOTA 3ALBA 4JWUC 4RF0A 2LVOA 2WXRA 2Q5WD 1STEA 4ZOHC 4PK1A 1X1MA 2Y5CA 5H92C 1V86A 2CU1A 5JXVA 1J19A 4MGYE 5FR3A 3NY5A 1JWMD 2AX5A 2IGDA 2IY1B 3DVNV 3BZDB 3OG5A 1R4MB 2FIDA 3GOEA 1D5MC 1LFDA 1PFDA 1XF5L 5JHBA 2DAJA 2GBKA 4OZAA 3NHEB 1E7VA 4W9CA 4FBJB 4RM9A 3K9OB 3IAS1 1LM8B 3QWZB 3VRBB 1UH6A 4ANVA 1WY8A 4MJSB 2DYBA 3BVMA 1TTNA 3ZQ4A 3W1SC 2CJOA 2A5UA 3PZ8A 1WX9A 5IN7A 1YQ4B 1XLQA 4AJYB 3L08A 4F7ZA 4ICUA 1GNUA 4ZRJA 4KKJA 3AE1B 3R2IA 2DNFA 4I6PA 4RGTA 2QILA 3V62A 2VH1A 4YTMB 3Q8CA 4C80A 4MDKE 2UYZB 2JT4B 2PLPA 4M0WB 3VH4B 1E8ZA 1J7BA 3HIZA 4RFBA 4DHJD 3WAMA 1KJTA 2KDIA 3ZJTA 3PRPB 2K39A 1Z5SB 2N9LA 4JGHB 3AU4A 1OEYA 1M4VA 1S1QB 4XGAB 4GIVA 5HFYA 2ZZPB 2IYDB 4JWSC 5KHQA 1L0VB 1WIAA 1T3QA 2ZPYA 2CJNA 1YOVB 3RNFC 1IGCA 5DPWA 3CF6E 3GE3C 4NQKE 2N9XA 1VZ7A 4DHZB 3AE7B 5CX3A 3AN1A 1EU4A 4DHZE 1J8CA 2DZJA 3AEGB 3QX1A 1ET6A 3QAQA 3FKYA 1E7PB 2GBJA 4HROA 2WS3B 2ZPNA 2TSSA 3PS6A 3A4RA 4LNNA 3APCA 2WDVB 1BMLC 2RDHA 3W2DA 3PZ7A 4YSYB 2QHOA 2J7QB 2INCC 1SJHD 3ECIA 1KFYB 4LNKA 3L4PA 2KVRA 1VRAB 5DPTA 1D4BA 1NI2A 5EE9A 5I4DA 1ZXHA 4XX5A 3OAWA 3L17A 2KTRA 2WXIA 4K3CA 2MHJA 1OTRB 3R8BA 2BYEA 3BY4B 4LTUA 4P6VF 2WWZA 4C00A 3PT2B 4KZCA 4P1CC 1ZGUB 2KK8A 2MQJA 1ENFA 2EMSA 1N63A 4L23A 2MSED 5IKCM 2BYTA 3W5VB 4D2KA 1JMLA 3ZNHB 1QF6A 1JWBD 1TKYA 1WJUA 2LUMA 2LVPA 3CIRB 3TSSA 3M63B 2CS4A 5T8IA 3DBHI 3NG0A 2LASA 4G50A 1PGBA 4KGSA 2FCNA 1GUAB 2ZJDA 4IM0A 2LUEA 2RDGA 3R7QA 3W1YA 2KAJA 3AE4B 3HVDA 2G1EA 5AUKA 3ZW3A 3L16A 2N4FA 1JROA 4E3CA 1WYGA 3GS2A 4M01A 3QIJA 1SE3A 1V1OA 3ZRFA 3U52E 5L95C 1Q0WB 2QCZA 2L7RA 1ZE3D 4N58A 3ZNID 2N9EB 1OQRA 5IO9A 1E10A 4MGKE 3QC8B 1FNUA 2N1VA 2GBMA 3V6CB 4YXDB 1I4QA 2X8XX 3ZNGC 2LXAA 2NCNA 4BZAA 2KT7A 2KMCA 5CHFA 4WJNA 2JXTA 3CMMB 1SB3C 4QAYA 4C7ZA 4W9HA 4LJPB 4LCDE 1ET9A 3AE6B 3RFZB 1KH0A 3DQVA 1RYJA 2PTLA 1XEEA 5FK9C 1TS2A 5D3DA 4B9KA 3R2TA 4LDTB 4X57B 1MHHE 3BK1A 4M02A 1SIFA 3N9YC 4ZHOA 2Z0DB 3FILB 3ZYYX 2D11A 1R7SA 3MHZA 1HTQA 3MC0B 2H89B 1C4AA 2ICIA 1ZXIA 1WJNA 3AEBB 3EECA 1SJED 4ZRKA 1KF6B 2B76B 4W9GA 1IGDA 3AI5A 3N1XC 1YN3A 2AQ1B 3IXSA 3WIMA 4BBNF 2NBVB 5IAAC 4XDDA 1VR9A 2N7EA 4A55A 1HZ6A 3KUZA 3RZFA 1XLOA 1LO5D 4P1BC 3URYA 3ZXRA 1TBEA 2W3SA 1HQRD 5TR5A 1I4RA 4MM3A 4EUTA 1SE9A 3ONSA 2G9HD 3RNCC 4FJYA 2N7JA 4IW0A 2OJWA 1WGHA 1YJ1A 4C56C 2FBWB 4C4VA 2O6VA 4BFRA 4FJZA 1WRIA 2FUHB 2D2QA 2L00B 2O2VA 3U2SC 1TZOA 2K25A 1F0ZA 2M0AA 4GDLA 3RMKC 2K22A 1P0RA 1GJZA 3P42A 1HXYD 1K51A 1V49A 4RM8A 3LYYA 3RT3B 2K8HA 2LZ6A 1IYFA 1JW9D 3ZO5B 2BWES 3VXWA 1I42A 2JYEA 1IP9A 2MRPA 3EFCA 3ZRCA 1RFKA 2I38A 1PDXA 1P7EA 2C7HA 1C4PA 2ASQA 2JZZA 2BW2A 4OHJA 2RMMA 4KSKC 1WF9A 4EFOA 3Q3OC 2D3AA 4TUUA 3NZ3A 1UGJA 2KXJA 5CTRC 3HHMA 4P16A 4KIKB 4HEA1 4CHKA 1XQQA 2MBQA 5G5HA 2G45B 2PPHA 4HKQA 3KQ4A 4L2YA 1V5TA 4NNJB 2L76A 4K7WA 4JE3B 1V5OA 2I1KA 2JQRB 1JWSD 2M0XA 3O13A 5HKHA 4LNIA 2V0GA 5BYSA 3U4EG 1TT5B 2LI5A 1FD6A 2DENB 2PVOD 4YWGG 4AJWA 1JRPA 4N59A 4K81A 2LD9A 1TKGA 2L3ZA 3KH0A 3HVZA 2ZNVB 3IFWB 3RULA 2KMMA 3A9JA 1LQBA 1NENB 3DPDA 3JSVB 4WWOA 1UNSA 2BKFA 2FCMA 5AUIA 3QK0A 1K50A 2J0JA 1WXAA 1E9MA 1AARA 1EWCA 3L13A 1V1PA 3ZTCA 3DWMA 1PQSA 1TS4A 2KFKA 2WXNA 1NI3A 4MH0E 1N5WA 2NTTA 1WWTA 3AMZA 1SBBB 2IY0B 1I4XA 3ENEA 2H88B 2KDEB 3PPAA 2WHIA 4MSMB 4EZKA 2GLSA 4NY0A 3ZJVA 3PV1A 1T0QC 3RD2A 3Q8EA 3E56A 2OEDA 3SFEB 2LGSA 2IZVB 2KN5A 4IG7B 3ZVVA 1YQ3B 3D32A 1JALA
chains in the Genus database with same CATH topology
1S1QB 4JQWC 4HPMB 3UIPB 4OVVA 4GIVA 2MBBB 2IO3B 2KFJA 2ZZPB 2IYDB 5KHQA 2KD0A 2KWUB 2KMAA 4KIKA 3U8ZA 1WIAA 1OQYA 4KV2A 4PYUA 1KM7A 4ZRIA 3MTNB 2ZPYA 5G55A 2FCSA 1EF1A 3CSTA 4F8CB 3A1QB 3V61A 1ZW7A 3VUXA 1JRUA 2LWPA 2KO3A 5DPWA 1P98A 3ZNZB 3DBLI 3CF6E 1WMHA 5G2NA 3SDLC 3T9LA 1E90A 1ZKHA 4EKUA 4NQKE 4DWFA 2N9XA 4WQOB 2JRIB 4DHZB 2K8CA 5CX3A 2RSUA 2L8JA 3VDZA 3TJPA 2KJ6A 4G0NB 4KSLC 4DHZE 5AZGA 1J8CA 2DZJA 3QX1A 3U7DA 2M8SA 3QAQA 1YX6B 4AOFA 3EHVA 2IO2B 4IC7B 3LDZE 3S2AA 2GBJA 2KJRA 2IBIB 2KTFA 4PS7A 4B6WA 2XK5A 3Q3JA 2MBHA 3BINA 5GMVA 1H8CA 2HE7A 2ZPNA 3PHWB 3CSFA 2KDFB 3PS6A 3JSVA 3A4RA 3WANA 2DX5B 3APCA 1Q1OA 2GMIC 2ZNVC 2NBWB 3X0WA 4URKA 4YL8A 5E6OA 5IA7A 2FIFA 2QHOA 4BVUC 5J18A 1QZEA 1A5RA 1WJ6A 2J7QB 4GXBA 4DK5A 5J2RA 4GDKB 3ECIA 2BKRB 1WH3A 2WX0A 2MP2A 2KC1A 2KVRA 1NDDA 2WX1A 2DHZA 5DPTA 4GB9A 4HPLB 2JXXA 1GG3A 4AP4C 3Q3FA 4II2B 1NI2A 2M17A 4MSQB 4BOZB 2REXA 4XX5A 3OAWA 3L17A 2KTRA 2G4DB 2K8BA 3TIXA 3M95A 3R66C 3TCAA 3L0WB 1OTRB 1FXTB 3QJZA 2BYVE 4IUMB 2BYEA 2Z59B 3JW0X 3ZUNA 2J0KA 3BY4B 2FCQA 3PVLA 3RUIB 3H9DA 2WWZA 3O65B 3WAPA 3PT2B 4KZCA 2GBRA 2XBBC 1RLFA 1V80A 3APFA 1WXSA 1ZGUB 1RAXA 2D10A 2KK8A 2MQJA 4JLCA 4MEMA 4JIOU 1L7YA 2EMSA 3ZKJC 4TV3A 2DYOA 4II3B 4RMAA 4ANXA 4IWQA 2DAFA 1RFAA 5C1ZA 5AEKB 2MSED 4W9KA 1Q5WB 4A3PA 3HK0A 4FA6A 3H7PB 1WM2A 4IM3A 1KLVA 1GC6A 1UGMA 3ZNHB 2C9WB 3DVNU 3GZNI 1WJUA 2EMTA 2NS5A 3DCGA 1WYWB 3B08A 4ICVA 2LVPA 3A1QA 3M63B 2CS4A 4NPNA 2R2OA 3DBHI 3V60A 4AUQC 3NOBA 2NBUA 3PTFC 2LASA 3APDA 4HCPB 1G6JA 4G50A 3DDCB 4IWOA 5E6NA 2DZKA 2FCNA 1GUAB 2I1JA 1V2YA 2W9NA 2ZJDA 4IM0A 2MA9B 1E8XA 3I3TB 4N9F4 3RCZA 2LUEA 3R7QA 3W1YA 1WJ4A 4CO7A 2L05A 5D94A 2LRWA 2XEWA 2KHWB 5BO4B 4G11A 1YX5B 3ZW3A 4FLHA 2JZ3B 4BKGA 3L16A 1WXVA 2N4FA 4TKNA 4ASWC 2WYQA 1CMXB 4E3CA 2BYFA 4M8MA 3SHQA 2YVCA 2KJHB 3QIJA 1P3QU 3X23A 1UBIA 4KVGB 3ZDMC 2C60A 3DVGX 3ZRFA 5L95C 2DZMA 2G3QB 2JUOA 2AYOB 1MG8A 3PRMB 4MELA 4ANUA 1Q0WB 4NJ6A 4A20A 2L7RA 3PGEA 2MBOA 3NZUA 4GMVA 4WAAA 1IPGA 3AULA 3ZNID 3ZTDA 3RZWC 2GOWA 2L0FA 4K7SA 2N9EB 3MJWA 3V6EB 2ZCBA 1H4RA 4AWJA 4GGQA 3OJ4B 3QC8B 4MGKE 2N1VA 5DCNA 2GBMA 4PS8A 4W9IA 3V6CB 1EUVB 2LRUA 3ZNGC 3QARA 2LXAA 1SGHA 2KOXA 3WALA 3VQIA 2NCNA 3PHXB 2B3AA 1WRDB 1EF5A 4IWPA 2KMCA 5CHFA 4WJNA 3H1UA 4DHJB 1L2NA 3CMMB 2FNJB 2L0TA 1WGRA 3IG3A 4W9HA 4FHJA 2O6VB 4LJPB 4LCDE 3A9KB 2V4LA 2C7MB 3KYDD 4FN2A 2O2VB 4NAWB 3ZIMA 3HM6X 2NVUI 4BKSA 4CYEA 4MJSA 3B0AA 4XC2A 3M62B 4BKSD 4GDLB 3AXCA 2NPTB 3DQVA 3VUYA 3AU5A 4F1SA 3WAOA 3VUWA 2KX3A 2ZVOA 2ZEQA 3N32A 3R3MA 2N7DA 3KYCD 2D07B 1E8WA 4OVUA 3JVZX 4I6NB 3OLMD 1UZXB 2R2QA 3DVGY 4J6IA 2KX0A 1WZ3A 2D3GA 2JRHA 3P2BA 4M8NA 3VTWA 4B9KA 1YD8U 2KNBA 2JY6A 3KVFB 4LDTB 4X57B 3H7PA 2CR5A 2JPHA 4HDQA 2BWFA 1WR1A 4JL9A 5JZEB 1SIFA 1V9JA 1OGWA 2K6QA 3TBLD 4ANWA 2RD0A 2PE9A 4WJOA 1NBFC 2Z0DB 2JF5A 2LJ5A 4ZDVA 2D11A 3PZDA 2LXCA 5D6JB 1WFYA 4GOCA 2N9PC 2KQ7A 2AL6A 4G3XB 1YIWA 5J17A 5KHOA 2BF8B 1WJNA 3EECA 2M1MA 4K1RB 3WA0A 1E7UA 4ZRKA 1XT9B 3IHPC 1P1AA 3NS8A 2PJHA 3HM3A 4W9GA 5D2MB 3AI5A 5DPSA 3EC8A 1V81A 3N30A 4HWIB 4TQ1A 2RR9A 1EO6A 4WJQA 3DOWA 2YLMA 1LXDA 2MX2A 3EFUA 3WIMA 3DBRI 2KLCA 4BBNF 5LXIB 1WX7A 2NBVB 2VRRB 2K1FA 1WR6E 2MW5A 4P7IA 4EOYA 1D3ZA 4A3OA 1C3TA 4HLEA 5IAAC 2DYMA 2N1WA 4W9EA 2N7EA 3UQAA 2HTHA 4B95A 2AL3A 1S3SG 3KUZA 2KANA 2PE6B 3RZFA 2C7NB 1TBEA 3H7SA 3PLUA 5CHWA 2OOBB 2NR2A 3KW5B 3VFKA 5TR5A 3SD5A 2KLGA 1TZ1A 4WWNA 4KZ0A 5FR6A 4MM3A 4PYZA 3VVWB 2C5LC 4PS3A 3TL5A 3L10B 3ZDTA 3B1LX 3N3KB 4EUTA 2RGFA 2LGXA 1SE9A 2FAZA 2MLBA 2M4NA 3LJ3A 3ONSA 1R4NI 4FHKA 4FJYA 2AEHA 3A4SC 3A9JB 4DBGA 3PSEB 2V1YA 2A4ZA 4IW0A 1WGHA 1YJ1A 5E6PA 2LGYA 1WGDA 1VCBA 1WE7A 3KUDB 4HK2A 2O6VA 2HD5B 2WDTB 4BFRA 3A9KA 5LLIA 4FJZA 5C23A 2FUHB 1XD3B 2D2QA 3UQBA 2L00B 2O2VA 4IM2A 4NAWA 1R4MI 3PREA 2K25A 4ZYNA 4GDLA 3U30A 2NPTA 2OJRA 2KKCA 3KUCB 4DDID 1P0RA 1GJZA 3UGBB 4EZLA 2KDBA 2KFKB 1TGZB 5CHVC 3ML9A 2G4SA 1V49A 4RM8A 3RT3B 2K8HA 2LZ6A 2UWQA 3M3JA 3ZO5B 1HE8A 1T0YA 4K7UA 3H6NA 1IYFA 2BWES 4GDKA 3VXWA 4E71A 1I42A 1BT0A 3UF8A 3JYUA 1IP9A 2MRPA 3IVFA 4DDGD 5DPRA 1YQBA 3ZRCA 4LDTD 1OEYJ 3UINB 2LGDA 2K6DB 1UD7A 3UIOB 2C7HA 4DXAB 4I6LB 3OJ3A 2ASQA 2JZZA 1UELA 1Y8RC 2LVQA 3QA8A 4KDIC 5D7GA 3VTUA 4KSKC 1WF9A 4XZ4A 2KZRA 2CHWA 3QQ8B 4EFOA 2ZCCA 2KQSA 2KWVB 4FULA 1WGGA 3ML8A 4TUUA 3R7RA 4W9JA 3TMPB 4HVBA 1U4AA 3IBEA 2CKHB 2PEAA 3VHTC 2KXJA 1WX8A 2EKEC 5CTRC 1UBQA 4BOSC 1KOTA 3ALBA 3HHMA 3MHSD 1F9JA 2LVOA 3VH3B 2MBEA 4KIKB 4CHKA 3C0RB 1XQQA 4FJVB 2MBQA 4WWPA 1X1MA 4EEWA 4EZJA 2Z0EB 2G45B 2KC2A 2PPHA 4LJOB 5AZFA 1V86A 1WMHB 2CU1A 1M94A 3SU8X 1J19A 4MGYE 5LXHA 3NY5A 1V5TA 4NNJB 2L76A 4W9FA 4K7WA 1V5OA 2I1KA 4HJKA 2IO1B 5HKHA 2M0XA 2IY1B 3DVNV 3L54A 1WI0A 2AWTA 2FIDA 3GOEA 1E8YA 1LFDA 2LI5A 5JHBA 2DENB 4W9LA 1J0GA 2DAJA 2GBKA 2HJ8A 4BBNC 5EDSA 4AJWA 3NHEB 4K81A 5AZHA 1E7VA 2LD9A 4TQ0A 2Y5BB 4MGZE 4W9CA 2CHXA 4FBJB 2L3ZA 4RM9A 3W1SA 3KH0A 1WXMA 4GN1A 3K9OB 2ZNVB 3IFWB 3RULA 5JH5C 2CHZA 2XK5B 1LM8B 1WZ0A 3A9JA 1LQBA 4MGIE 4HXDA 4E74A 3QWZB 4HDOA 3VAWA 1UH6A 4ANVA 2J0MA 5L83A 2JVCA 3DPDA 1WY8A 2MCNB 1C1YB 2RPQA 3JSVB 2DYBA 4MJSB 4WWOA 2BKFA 1TTNA 2FCMA 3W1SC 2BGFA 2A5UA 1WX9A 3QK0A 2GBNA 4BKTA 2J0JA 4KDLB 1GC7A 1WXAA 4NQLB 2DZIA 4WJPA 2V3SA 1AARA 3L13A 4HCNB 4AJYB 3L08A 1P9DU 1WGYA 3QHTA 4GSWA 1GNUA 4ICUA 1PQSA 4ZRJA 3ZTCA 3RYTA 4F7ZA 2KFKA 4FADA 4MH0E 2MP2B 3DBSA 1WE6A 3PRZA 4I6PA 2MWSB 3ZLZA 3V62A 4GU2A 2IY0B 1V6EA 2JWZA 4MDKE 1I35A 2IO0B 1K8RB 3ENEA 2UYZB 2JT4B 3NZSA 2KTRB 3A33B 1VD2A 4M0WB 3VH4B 2KDEB 3PPAA 3QCAA 4MSMB 4EZKA 3VTVA 4NY0A 4NJ7A 1E8ZA 1ISNA 3HIZA 3PV1A 3RD2A 4DHJD 3PLVA 2KWCA 1Z2MA 1KJTA 3WAMA 2O6VD 2KDIA 5JHAA 1RRBA 3PRPB 3K9PB 2IZVB 2BPSA 2KN5A 4W9DA 2K39A 4IG7B 1WM3A 1Z5SB 2ZVNA 3T8MA 4JGHB 3ZVVA 1E5WA 3AU4A 3D32A 1OEYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S1Q B;  4JQW C;  4HPM B;  3UIP B;  4OVV A;  4GIV A;  2MBB B;  2IO3 B;  2KFJ A;  2ZZP B;  2IYD B;  5KHQ A;  2KD0 A;  2KWU B;  2KMA A;  4KIK A;  3U8Z A;  1WIA A;  1OQY A;  4KV2 A;  4PYU A;  1KM7 A;  4ZRI A;  3MTN B;  2ZPY A;  5G55 A;  2FCS A;  1EF1 A;  3CST A;  4F8C B;  3A1Q B;  3V61 A;  1ZW7 A;  3VUX A;  1JRU A;  2LWP A;  2KO3 A;  5DPW A;  1P98 A;  3ZNZ B;  3DBL I;  3CF6 E;  1WMH A;  5G2N A;  3SDL C;  3T9L A;  1E90 A;  1ZKH A;  4EKU A;  4NQK E;  4DWF A;  2N9X A;  4WQO B;  2JRI B;  4DHZ B;  2K8C A;  5CX3 A;  2RSU A;  2L8J A;  3VDZ A;  3TJP A;  2KJ6 A;  4G0N B;  4KSL C;  4DHZ E;  5AZG A;  1J8C A;  2DZJ A;  3QX1 A;  3U7D A;  2M8S A;  3QAQ A;  1YX6 B;  4AOF A;  3EHV A;  2IO2 B;  4IC7 B;  3LDZ E;  3S2A A;  2GBJ A;  2KJR A;  2IBI B;  2KTF A;  4PS7 A;  4B6W A;  2XK5 A;  3Q3J A;  2MBH A;  3BIN A;  5GMV A;  1H8C A;  2HE7 A;  2ZPN A;  3PHW B;  3CSF A;  2KDF B;  3PS6 A;  3JSV A;  3A4R A;  3WAN A;  2DX5 B;  3APC A;  1Q1O A;  2GMI C;  2ZNV C;  2NBW B;  3X0W A;  4URK A;  4YL8 A;  5E6O A;  5IA7 A;  2FIF A;  2QHO A;  4BVU C;  5J18 A;  1QZE A;  1A5R A;  1WJ6 A;  2J7Q B;  4GXB A;  4DK5 A;  5J2R A;  4GDK B;  3ECI A;  2BKR B;  1WH3 A;  2WX0 A;  2MP2 A;  2KC1 A;  2KVR A;  1NDD A;  2WX1 A;  2DHZ A;  5DPT A;  4GB9 A;  4HPL B;  2JXX A;  1GG3 A;  4AP4 C;  3Q3F A;  4II2 B;  1NI2 A;  2M17 A;  4MSQ B;  4BOZ B;  2REX A;  4XX5 A;  3OAW A;  3L17 A;  2KTR A;  2G4D B;  2K8B A;  3TIX A;  3M95 A;  3R66 C;  3TCA A;  3L0W B;  1OTR B;  1FXT B;  3QJZ A;  2BYV E;  4IUM B;  2BYE A;  2Z59 B;  3JW0 X;  3ZUN A;  2J0K A;  3BY4 B;  2FCQ A;  3PVL A;  3RUI B;  3H9D A;  2WWZ A;  3O65 B;  3WAP A;  3PT2 B;  4KZC A;  2GBR A;  2XBB C;  1RLF A;  1V80 A;  3APF A;  1WXS A;  1ZGU B;  1RAX A;  2D10 A;  2KK8 A;  2MQJ A;  4JLC A;  4MEM A;  4JIO U;  1L7Y A;  2EMS A;  3ZKJ C;  4TV3 A;  2DYO A;  4II3 B;  4RMA A;  4ANX A;  4IWQ A;  2DAF A;  1RFA A;  5C1Z A;  5AEK B;  2MSE D;  4W9K A;  1Q5W B;  4A3P A;  3HK0 A;  4FA6 A;  3H7P B;  1WM2 A;  4IM3 A;  1KLV A;  1GC6 A;  1UGM A;  3ZNH B;  2C9W B;  3DVN U;  3GZN I;  1WJU A;  2EMT A;  2NS5 A;  3DCG A;  1WYW B;  3B08 A;  4ICV A;  2LVP A;  3A1Q A;  3M63 B;  2CS4 A;  4NPN A;  2R2O A;  3DBH I;  3V60 A;  4AUQ C;  3NOB A;  2NBU A;  3PTF C;  2LAS A;  3APD A;  4HCP B;  1G6J A;  4G50 A;  3DDC B;  4IWO A;  5E6N A;  2DZK A;  2FCN A;  1GUA B;  2I1J A;  1V2Y A;  2W9N A;  2ZJD A;  4IM0 A;  2MA9 B;  1E8X A;  3I3T B;  4N9F 4;  3RCZ A;  2LUE A;  3R7Q A;  3W1Y A;  1WJ4 A;  4CO7 A;  2L05 A;  5D94 A;  2LRW A;  2XEW A;  2KHW B;  5BO4 B;  4G11 A;  1YX5 B;  3ZW3 A;  4FLH A;  2JZ3 B;  4BKG A;  3L16 A;  1WXV A;  2N4F A;  4TKN A;  4ASW C;  2WYQ A;  1CMX B;  4E3C A;  2BYF A;  4M8M A;  3SHQ A;  2YVC A;  2KJH B;  3QIJ A;  1P3Q U;  3X23 A;  1UBI A;  4KVG B;  3ZDM C;  2C60 A;  3DVG X;  3ZRF A;  5L95 C;  2DZM A;  2G3Q B;  2JUO A;  2AYO B;  1MG8 A;  3PRM B;  4MEL A;  4ANU A;  1Q0W B;  4NJ6 A;  4A20 A;  2L7R A;  3PGE A;  2MBO A;  3NZU A;  4GMV A;  4WAA A;  1IPG A;  3AUL A;  3ZNI D;  3ZTD A;  3RZW C;  2GOW A;  2L0F A;  4K7S A;  2N9E B;  3MJW A;  3V6E B;  2ZCB A;  1H4R A;  4AWJ A;  4GGQ A;  3OJ4 B;  3QC8 B;  4MGK E;  2N1V A;  5DCN A;  2GBM A;  4PS8 A;  4W9I A;  3V6C B;  1EUV B;  2LRU A;  3ZNG C;  3QAR A;  2LXA A;  1SGH A;  2KOX A;  3WAL A;  3VQI A;  2NCN A;  3PHX B;  2B3A A;  1WRD B;  1EF5 A;  4IWP A;  2KMC A;  5CHF A;  4WJN A;  3H1U A;  4DHJ B;  1L2N A;  3CMM B;  2FNJ B;  2L0T A;  1WGR A;  3IG3 A;  4W9H A;  4FHJ A;  2O6V B;  4LJP B;  4LCD E;  3A9K B;  2V4L A;  2C7M B;  3KYD D;  4FN2 A;  2O2V B;  4NAW B;  3ZIM A;  3HM6 X;  2NVU I;  4BKS A;  4CYE A;  4MJS A;  3B0A A;  4XC2 A;  3M62 B;  4BKS D;  4GDL B;  3AXC A;  2NPT B;  3DQV A;  3VUY A;  3AU5 A;  4F1S A;  3WAO A;  3VUW A;  2KX3 A;  2ZVO A;  2ZEQ A;  3N32 A;  3R3M A;  2N7D A;  3KYC D;  2D07 B;  1E8W A;  4OVU A;  3JVZ X;  4I6N B;  3OLM D;  1UZX B;  2R2Q A;  3DVG Y;  4J6I A;  2KX0 A;  1WZ3 A;  2D3G A;  2JRH A;  3P2B A;  4M8N A;  3VTW A;  4B9K A;  1YD8 U;  2KNB A;  2JY6 A;  3KVF B;  4LDT B;  4X57 B;  3H7P A;  2CR5 A;  2JPH A;  4HDQ A;  2BWF A;  1WR1 A;  4JL9 A;  5JZE B;  1SIF A;  1V9J A;  1OGW A;  2K6Q A;  3TBL D;  4ANW A;  2RD0 A;  2PE9 A;  4WJO A;  1NBF C;  2Z0D B;  2JF5 A;  2LJ5 A;  4ZDV A;  2D11 A;  3PZD A;  2LXC A;  5D6J B;  1WFY A;  4GOC A;  2N9P C;  2KQ7 A;  2AL6 A;  4G3X B;  1YIW A;  5J17 A;  5KHO A;  2BF8 B;  1WJN A;  3EEC A;  2M1M A;  4K1R B;  3WA0 A;  1E7U A;  4ZRK A;  1XT9 B;  3IHP C;  1P1A A;  3NS8 A;  2PJH A;  3HM3 A;  4W9G A;  5D2M B;  3AI5 A;  5DPS A;  3EC8 A;  1V81 A;  3N30 A;  4HWI B;  4TQ1 A;  2RR9 A;  1EO6 A;  4WJQ A;  3DOW A;  2YLM A;  1LXD A;  2MX2 A;  3EFU A;  3WIM A;  3DBR I;  2KLC A;  4BBN F;  5LXI B;  1WX7 A;  2NBV B;  2VRR B;  2K1F A;  1WR6 E;  2MW5 A;  4P7I A;  4EOY A;  1D3Z A;  4A3O A;  1C3T A;  4HLE A;  5IAA C;  2DYM A;  2N1W A;  4W9E A;  2N7E A;  3UQA A;  2HTH A;  4B95 A;  2AL3 A;  1S3S G;  3KUZ A;  2KAN A;  2PE6 B;  3RZF A;  2C7N B;  1TBE A;  3H7S A;  3PLU A;  5CHW A;  2OOB B;  2NR2 A;  3KW5 B;  3VFK A;  5TR5 A;  3SD5 A;  2KLG A;  1TZ1 A;  4WWN A;  4KZ0 A;  5FR6 A;  4MM3 A;  4PYZ A;  3VVW B;  2C5L C;  4PS3 A;  3TL5 A;  3L10 B;  3ZDT A;  3B1L X;  3N3K B;  4EUT A;  2RGF A;  2LGX A;  1SE9 A;  2FAZ A;  2MLB A;  2M4N A;  3LJ3 A;  3ONS A;  1R4N I;  4FHK A;  4FJY A;  2AEH A;  3A4S C;  3A9J B;  4DBG A;  3PSE B;  2V1Y A;  2A4Z A;  4IW0 A;  1WGH A;  1YJ1 A;  5E6P A;  2LGY A;  1WGD A;  1VCB A;  1WE7 A;  3KUD B;  4HK2 A;  2O6V A;  2HD5 B;  2WDT B;  4BFR A;  3A9K A;  5LLI A;  4FJZ A;  5C23 A;  2FUH B;  1XD3 B;  2D2Q A;  3UQB A;  2L00 B;  2O2V A;  4IM2 A;  4NAW A;  1R4M I;  3PRE A;  2K25 A;  4ZYN A;  4GDL A;  3U30 A;  2NPT A;  2OJR A;  2KKC A;  3KUC B;  4DDI D;  1P0R A;  1GJZ A;  3UGB B;  4EZL A;  2KDB A;  2KFK B;  1TGZ B;  5CHV C;  3ML9 A;  2G4S A;  1V49 A;  4RM8 A;  3RT3 B;  2K8H A;  2LZ6 A;  2UWQ A;  3M3J A;  3ZO5 B;  1HE8 A;  1T0Y A;  4K7U A;  3H6N A;  1IYF A;  2BWE S;  4GDK A;  3VXW A;  4E71 A;  1I42 A;  1BT0 A;  3UF8 A;  3JYU A;  1IP9 A;  2MRP A;  3IVF A;  4DDG D;  5DPR A;  1YQB A;  3ZRC A;  4LDT D;  1OEY J;  3UIN B;  2LGD A;  2K6D B;  1UD7 A;  3UIO B;  2C7H A;  4DXA B;  4I6L B;  3OJ3 A;  2ASQ A;  2JZZ A;  1UEL A;  1Y8R C;  2LVQ A;  3QA8 A;  4KDI C;  5D7G A;  3VTU A;  4KSK C;  1WF9 A;  4XZ4 A;  2KZR A;  2CHW A;  3QQ8 B;  4EFO A;  2ZCC A;  2KQS A;  2KWV B;  4FUL A;  1WGG A;  3ML8 A;  4TUU A;  3R7R A;  4W9J A;  3TMP B;  4HVB A;  1U4A A;  3IBE A;  2CKH B;  2PEA A;  3VHT C;  2KXJ A;  1WX8 A;  2EKE C;  5CTR C;  1UBQ A;  4BOS C;  1KOT A;  3ALB A;  3HHM A;  3MHS D;  1F9J A;  2LVO A;  3VH3 B;  2MBE A;  4KIK B;  4CHK A;  3C0R B;  1XQQ A;  4FJV B;  2MBQ A;  4WWP A;  1X1M A;  4EEW A;  4EZJ A;  2Z0E B;  2G45 B;  2KC2 A;  2PPH A;  4LJO B;  5AZF A;  1V86 A;  1WMH B;  2CU1 A;  1M94 A;  3SU8 X;  1J19 A;  4MGY E;  5LXH A;  3NY5 A;  1V5T A;  4NNJ B;  2L76 A;  4W9F A;  4K7W A;  1V5O A;  2I1K A;  4HJK A;  2IO1 B;  5HKH A;  2M0X A;  2IY1 B;  3DVN V;  3L54 A;  1WI0 A;  2AWT A;  2FID A;  3GOE A;  1E8Y A;  1LFD A;  2LI5 A;  5JHB A;  2DEN B;  4W9L A;  1J0G A;  2DAJ A;  2GBK A;  2HJ8 A;  4BBN C;  5EDS A;  4AJW A;  3NHE B;  4K81 A;  5AZH A;  1E7V A;  2LD9 A;  4TQ0 A;  2Y5B B;  4MGZ E;  4W9C A;  2CHX A;  4FBJ B;  2L3Z A;  4RM9 A;  3W1S A;  3KH0 A;  1WXM A;  4GN1 A;  3K9O B;  2ZNV B;  3IFW B;  3RUL A;  5JH5 C;  2CHZ A;  2XK5 B;  1LM8 B;  1WZ0 A;  3A9J A;  1LQB A;  4MGI E;  4HXD A;  4E74 A;  3QWZ B;  4HDO A;  3VAW A;  1UH6 A;  4ANV A;  2J0M A;  5L83 A;  2JVC A;  3DPD A;  1WY8 A;  2MCN B;  1C1Y B;  2RPQ A;  3JSV B;  2DYB A;  4MJS B;  4WWO A;  2BKF A;  1TTN A;  2FCM A;  3W1S C;  2BGF A;  2A5U A;  1WX9 A;  3QK0 A;  2GBN A;  4BKT A;  2J0J A;  4KDL B;  1GC7 A;  1WXA A;  4NQL B;  2DZI A;  4WJP A;  2V3S A;  1AAR A;  3L13 A;  4HCN B;  4AJY B;  3L08 A;  1P9D U;  1WGY A;  3QHT A;  4GSW A;  1GNU A;  4ICU A;  1PQS A;  4ZRJ A;  3ZTC A;  3RYT A;  4F7Z A;  2KFK A;  4FAD A;  4MH0 E;  2MP2 B;  3DBS A;  1WE6 A;  3PRZ A;  4I6P A;  2MWS B;  3ZLZ A;  3V62 A;  4GU2 A;  2IY0 B;  1V6E A;  2JWZ A;  4MDK E;  1I35 A;  2IO0 B;  1K8R B;  3ENE A;  2UYZ B;  2JT4 B;  3NZS A;  2KTR B;  3A33 B;  1VD2 A;  4M0W B;  3VH4 B;  2KDE B;  3PPA A;  3QCA A;  4MSM B;  4EZK A;  3VTV A;  4NY0 A;  4NJ7 A;  1E8Z A;  1ISN A;  3HIZ A;  3PV1 A;  3RD2 A;  4DHJ D;  3PLV A;  2KWC A;  1Z2M A;  1KJT A;  3WAM A;  2O6V D;  2KDI A;  5JHA A;  1RRB A;  3PRP B;  3K9P B;  2IZV B;  2BPS A;  2KN5 A;  4W9D A;  2K39 A;  4IG7 B;  1WM3 A;  1Z5S B;  2ZVN A;  3T8M A;  4JGH B;  3ZVV A;  1E5W A;  3AU4 A;  3D32 A;  1OEY A; 
#chains in the Genus database with same CATH topology
 4JQW C;  3UIP B;  2MBB B;  2KD0 A;  2I2Y A;  5IOI A;  1OQY A;  1KM7 A;  3MTN B;  5HI1 A;  5G55 A;  5TSS A;  4RF1 A;  4F8C B;  3V61 A;  1PUT A;  3VUX A;  5BMI A;  1JRU A;  2LWP A;  4J3O D;  3MFG A;  1IBX A;  2M56 B;  2K8C A;  2L8J A;  2KJ6 A;  1SEB D;  1BUI C;  1GOZ A;  4WUR A;  4ARI A;  1YX6 B;  1CZP A;  2IO2 B;  4FXC A;  1XCQ L;  2KJR A;  1LGR A;  2N9K A;  4XYC A;  4B6W A;  3Q3J A;  2LHD A;  2MBH A;  5GMV A;  2HE7 A;  3PHW B;  3P63 A;  2KDF B;  3AE3 B;  2CU3 A;  2GI9 A;  3I57 A;  5H8Y E;  4US8 A;  1YN4 A;  3P1M A;  1P7F A;  4XWT A;  2NBW B;  2Y5P A;  4BVU C;  1SSN A;  3BII D;  2BS4 B;  4DK5 A;  5J2R A;  4Q2J A;  4GDK B;  2BT6 A;  3BWU D;  2WX0 A;  2DHZ A;  4AP4 C;  2MJ3 A;  3IT4 B;  4II2 B;  2M17 A;  1JWU D;  4BOZ B;  2LMC A;  3BVG A;  2ONQ A;  4M0W A;  3R66 C;  2BBC A;  2BYV E;  2WU5 B;  3ZUN A;  3U7Z A;  1JQ4 A;  3PVL A;  3PO0 A;  3WAP A;  2XBB C;  1DOX A;  4L1B A;  1L7Y A;  3ZKJ C;  4TV3 A;  4WQM A;  4ANX A;  2DAF A;  2OHF A;  1CQV A;  4W9K A;  4A3P A;  3GP7 A;  3H7P B;  4M00 A;  4IM3 A;  2QC8 A;  1GC6 A;  2JU6 X;  3J9C A;  2C9W B;  3P4Q B;  2R2O A;  3V60 A;  4AUQ C;  3NOB A;  3PTF C;  4KGR A;  4HCP B;  1D6E C;  3DDC B;  3I63 C;  3RCZ A;  4CO7 A;  1N60 A;  2LRW A;  1YX5 B;  1NVI D;  4FLH A;  2JZ3 B;  4BKG A;  2WYQ A;  3P4S B;  4MT5 A;  4M8M A;  2YVC A;  4KVG B;  1J7A A;  5C2T B;  1YNT E;  1UF0 A;  2DZM A;  3PRM B;  1N6Z A;  4GMV A;  2BB5 A;  1TKE A;  3AUL A;  1D5Z C;  3ZTD A;  2K0P A;  4K7S A;  3V6E B;  3TEX A;  2KWD A;  2PKO A;  4OZB A;  1EUV B;  2LRU A;  3WAL A;  4BAX A;  3PHX B;  4NAM A;  1VZ6 A;  4WWM A;  3TEY A;  3ZJU A;  1YJI A;  1TY2 A;  2HTM E;  4DHJ B;  2PVG C;  3A9K B;  3Q8A A;  3ZIM A;  1MHX A;  4JX1 C;  3B0A A;  4XC2 A;  4A90 A;  3DBH B;  2NPT B;  3WAO A;  1QIL A;  1I4G A;  3N32 A;  3R3M A;  4OVU A;  2KN4 A;  3JVZ X;  1T0S C;  1WZ3 A;  4M8N A;  2KNB A;  1TS5 A;  3EGR A;  1F52 A;  4R3D A;  4HDQ A;  4LLG M;  2WDR B;  2MEK A;  1NYR A;  3P4P B;  1C4C A;  4ANW A;  2RD0 A;  2PE9 A;  2HJ1 A;  1TIF A;  3Q2A C;  1WFY A;  3AED B;  2AL6 A;  1YIW A;  5J17 A;  1ZDV A;  3WA0 A;  2D3B A;  4REZ A;  3NS8 A;  5BYQ A;  2PJH A;  5HHD G;  2RDB C;  3DHH C;  1EO6 A;  4WJQ A;  2W55 A;  2YLM A;  1LXD A;  2MX2 A;  3EFU A;  3EA6 A;  5LXI B;  2SEB D;  2VRR B;  2K1F A;  1F1H A;  1WR6 E;  2MW5 A;  4P7I A;  1D3Z A;  4A3O A;  1XLP A;  1C3T A;  1VZ8 A;  2DYM A;  3MC9 A;  3VR9 B;  4DQO C;  1AN8 A;  3SD5 A;  3LB8 C;  1E6E B;  2IND C;  4PYZ A;  3VVW B;  3TL5 A;  3B1L X;  3N3K B;  3LJ3 A;  1UWM A;  1R4N I;  4FHK A;  2AEH A;  1L4Z B;  1FPY A;  3NJT A;  2KDM A;  3AM9 A;  2HD5 B;  2WDT B;  5LLI A;  4YTN B;  4IM2 A;  2E6X A;  3PRE A;  1KTK A;  3U30 A;  2V9H A;  3Q6B A;  2DLB A;  4IDI A;  1F2R C;  2KDB A;  5D3I B;  1TGZ B;  2G4S A;  2MJD A;  4TSS A;  3M3J A;  1T0Y A;  1OQQ A;  2J4X A;  3H6N A;  2UU7 A;  3BK2 A;  3I9V 1;  1C77 A;  1ZUD 2;  4AS1 A;  4LDT D;  3UIO B;  2K6D B;  3CWI A;  3OJ3 A;  4H2A A;  5BMH A;  3AEC B;  5D7G A;  3T3N A;  1BXT A;  3OWE B;  2GB1 A;  2KZR A;  4YT0 B;  2CHW A;  3QQ8 B;  4FUL A;  1MI0 A;  4W9J A;  3IBE A;  3VHT C;  1WX8 A;  1RM6 C;  2EEL A;  3MHS D;  3VH3 B;  1F9J A;  2MBE A;  3C0R B;  4FJV B;  1ACC A;  4WWP A;  4EEW A;  4EZJ A;  2V4I B;  1KLU D;  2W82 A;  1C76 A;  3I5J C;  4LJO B;  3TEW A;  2XNA C;  5AZF A;  1RWS A;  2JYT A;  1WMH B;  3SU8 X;  5LXH A;  3VR8 B;  4HJK A;  4JPS A;  3TUO A;  2IO1 B;  3L54 A;  1A70 A;  1FFU A;  2AWT A;  2LFI A;  3FAH A;  2IDY A;  1J0G A;  1DOI A;  5EDS A;  1EM7 A;  2DWQ A;  5JH5 C;  2XK5 B;  2YEP F;  4MGI E;  5GXG B;  4HXD A;  4E74 A;  4HDO A;  1JWA D;  3VAW A;  2YEP B;  2JVC A;  2RPQ A;  1AW7 A;  3GB1 A;  2BGF A;  1FFV A;  1QT9 A;  1PGX A;  1GC7 A;  3MC8 A;  4NQL B;  2V3S A;  2VZK D;  4HCN B;  1P9D U;  3NUH B;  4GSW A;  1L5P A;  2MP2 B;  3DBS A;  1WE6 A;  3PRZ A;  3ZLZ A;  4ITK A;  1I35 A;  3B2F A;  1K8R B;  2K9X A;  3NZS A;  4ZRP A;  4EE2 A;  1N62 A;  3QCA A;  3VTV A;  1ISN A;  1VDV A;  2WP9 B;  3PLV A;  4WIP A;  1L4D B;  2O6V D;  4MH8 A;  5JHA A;  1RRB A;  2INP E;  2JSV X;  3T8M A;  3ABV B;  5EE0 A;  1T6B X;  5BMG A;  4HPM B;  4OVV A;  2IO3 B;  2KFJ A;  2KWU B;  2KMA A;  4KIK A;  4KV2 A;  3IAM 1;  4PYU A;  4ZRI A;  3V3X A;  1SXT A;  3AE5 B;  3A1Q B;  3NVV A;  2E3T A;  1NYQ A;  2KO3 A;  1P98 A;  1L6V A;  3ZNZ B;  3DBL I;  5G2N A;  3T9L A;  4EKU A;  4WQO B;  1ROE A;  2QSD A;  4K3B A;  2RSU A;  3VDZ A;  3TJP A;  2Z8L A;  1KRH A;  4KSL C;  5AZG A;  3U7D A;  2M8S A;  2BS2 B;  5EE3 A;  1PGA A;  3LDZ E;  1HA5 A;  3Q8F A;  3S2A A;  2IBI B;  2KTF A;  4DXF A;  5FKA C;  2WXP A;  4ZHP A;  1H8C A;  2ZW1 A;  1IUE A;  1KLG D;  3N20 C;  3JSV A;  1N5X A;  4IOI E;  2DX5 B;  1Q1O A;  2INN E;  2ON8 A;  4HKZ E;  4HRS A;  3RN9 C;  4URK A;  4YL8 A;  2FIF A;  4N6E B;  1ESF A;  1QZE A;  1WJ6 A;  4GXB A;  1FRD A;  1WH3 A;  1NDD A;  2WX1 A;  2N0S B;  4GB9 A;  2JXX A;  1B9R A;  1DOY A;  4KGT A;  4MSQ B;  2REX A;  2G4D B;  2K8B A;  3M95 A;  1GAQ B;  1FXT B;  3BYY B;  4HPP A;  2Z59 B;  1XLN A;  2IGG A;  3RUI B;  2GBR A;  2WXJ A;  1V80 A;  1ZPS A;  1WXS A;  3N1Y C;  2D10 A;  4NZL B;  4JLC A;  5EE1 A;  4MEM A;  4JIO U;  4ACF A;  4II3 B;  4RMA A;  1RFA A;  1FNV A;  5AEK B;  3HK0 A;  4FA6 A;  1WM2 A;  1J7C A;  1F2R I;  4RH6 A;  1YJJ A;  1C78 A;  3DVN U;  3GZN I;  2NS5 A;  1XXG A;  4NPN A;  1G6J A;  4LNO A;  4O1N A;  1FCL A;  1F77 A;  1QLB B;  4IWO A;  1V2Y A;  4KKI A;  2KQ4 X;  3I3T B;  2WQY B;  2L52 A;  1WJ4 A;  1TJE A;  2K3U A;  2L05 A;  5D94 A;  2XEW A;  5BO4 B;  1ZOY B;  1WXV A;  2PW9 A;  2LEK A;  3FC4 A;  1QOB A;  1CMX B;  3H8H A;  2LJI A;  2SAK A;  1T5X D;  3X23 A;  2C60 A;  3DVG X;  1UUP A;  2AYO B;  4MEL A;  4ANU A;  4NJ6 A;  4A20 A;  2IPK D;  2J52 A;  3PGE A;  2KAC A;  2KVZ A;  1V1P B;  1VLB A;  2L83 A;  2WU2 B;  4USA A;  3RZW C;  3SEB A;  2GOW A;  2L0F A;  2RPV A;  4GGQ A;  3OJ4 B;  1GB4 A;  4W9I A;  2LGI A;  3SR6 A;  3VQI A;  2B3A A;  1SIJ A;  4LK0 M;  5MPO A;  1WXQ A;  3H1U A;  1L2N A;  2FNJ B;  2L0T A;  1WGR A;  2WNM A;  4FHJ A;  2J42 A;  2V4L A;  2C7M B;  4A8X C;  4NAW B;  2NVU I;  3RNG C;  1UWX A;  3P4R B;  4MJS A;  4CYE A;  3M62 B;  3AU5 A;  4F1S A;  4A6Q A;  4S0R A;  4YTP B;  2JX5 A;  4I6N B;  3DVG Y;  3NVY A;  2D3G A;  2JRH A;  3P2B A;  1YD8 U;  3Q8B A;  4ARC A;  2D5G A;  3H7P A;  2CR5 A;  3BVZ A;  3TBL D;  1DYQ A;  2J53 A;  3IT6 B;  4WJO A;  2V3N A;  2JF5 A;  1IBX B;  4ZDV A;  2WXM A;  3PZD A;  4GLS C;  2LXC A;  2N9P C;  2WXL A;  2PIA A;  2BF8 B;  4K1R B;  1E7U A;  3IHP C;  5DPS A;  3RNB C;  4DXG A;  3EC8 A;  1V81 A;  2RR9 A;  3DOW A;  3NVW A;  3Q69 A;  3DBR I;  2KLC A;  4US9 A;  2QDF A;  3MJ5 A;  4EOY A;  2BB6 A;  4HLE A;  2HTH A;  2AL3 A;  1S3S G;  2KAN A;  2PE6 B;  2C7N B;  3H7S A;  2FE8 A;  2OOB B;  1QOG A;  3KW5 B;  3VFK A;  2KLG A;  4WWN A;  2C5L C;  3L10 B;  2JZP A;  3ZDT A;  2RGF A;  1TS3 A;  2MLB A;  1CJE A;  2NTS A;  3BYT B;  2QJL A;  4B0E A;  2JWU A;  3A4S C;  4IKG A;  3PSE B;  2V1Y A;  2WXG A;  5BYR A;  1WSP A;  5E6P A;  2LGY A;  1WGD A;  1WE7 A;  4HK2 A;  3A9K A;  1PYW D;  5C23 A;  3UQB A;  1XD3 B;  3RI7 C;  1R4M I;  4ZYN A;  2NPT A;  1MPE A;  2OJR A;  4DDI D;  3UGB B;  2DBY A;  5CHV C;  3MP9 A;  1I7H A;  2BVC A;  2X38 A;  1HE8 A;  2IJ0 A;  4K7U A;  3KWV A;  2BQQ A;  3SFD B;  1BT0 A;  3UF8 A;  3JYU A;  3NS1 A;  4A9A A;  4DDG D;  1HZ5 A;  1YQB A;  5DPR A;  1UD7 A;  2Y3A A;  4I6L B;  1UEL A;  3ZXV A;  2WXQ A;  1Y8R C;  3VTU A;  4HJG E;  3AEF B;  5E6J A;  2ZCC A;  2KWV B;  1WGG A;  1L0Y B;  3NVZ A;  3R7R A;  3TMP B;  1K52 A;  4HVB A;  3N1Z C;  1XCT L;  4YSX B;  1YMH E;  1R4N B;  2QEJ C;  1AYF A;  2Z0E B;  2KC2 A;  1FEH A;  3AH7 A;  1M94 A;  2AQ3 B;  4W9F A;  3WCQ A;  4OZC A;  1WI0 A;  1E8Y A;  4LNF A;  4W9L A;  4BBN C;  2HJ8 A;  3KLS X;  5AZH A;  4TQ0 A;  2Y5B B;  4MGZ E;  2CHX A;  1HEZ E;  3W1S A;  1L0X B;  1WXM A;  4GN1 A;  2CHZ A;  1WZ0 A;  2J0M A;  5L83 A;  4S17 A;  3TEZ A;  2MCN B;  1C1Y B;  1V8C A;  5IP4 D;  1Q10 A;  4BKT A;  2GBN A;  4KDL B;  2ACZ B;  1C79 A;  2DZI A;  1DGJ A;  1MG4 A;  3Q14 C;  4WJP A;  1I4H A;  4RGM A;  1WGY A;  3QHT A;  3RYT A;  4FAD A;  2VH2 A;  2KYW A;  2MWS B;  1QQR A;  1V6E A;  2JWZ A;  2IO0 B;  4KX6 B;  2KTR B;  3A33 B;  1VD2 A;  4NJ7 A;  2KWC A;  4WAF A;  1Z2M A;  1FM0 D;  1EU3 A;  2HDE A;  1MVK A;  3K9P B;  2BPS A;  4XDC A;  4W9D A;  1WM3 A;  2ZVN A;  3C19 A;  3ZGZ A;  1E5W A;  4GU2 A;  1B1Z A;  2NMQ A;  3U8Z A;  2AQ2 B;  3AEE B;  2FCS A;  1EF1 A;  3CST A;  1ZW7 A;  1SF0 A;  3B9J A;  1WMH A;  3SDL C;  1E90 A;  1ZKH A;  2WXF A;  3FIL A;  4DWF A;  4ZYS A;  2JRI B;  4G0N B;  1FXA A;  2WDQ B;  4AOF A;  1D5X C;  3EHV A;  4IC7 B;  1AWD A;  1V97 A;  2WXO A;  1OFF A;  4PS7 A;  2XK5 A;  3BIN A;  3CSF A;  1GB1 A;  4C7Y A;  3WAN A;  1SE4 A;  2GMI C;  2ZNV C;  3X0W A;  2WGS A;  3C8Y A;  3DHG C;  5E6O A;  5IA7 A;  5J18 A;  1A5R A;  2BKR B;  2WLB A;  2MP2 A;  2KC1 A;  3EUB 2;  2WXH A;  4HPL B;  1GG3 A;  3Q3F A;  1N61 A;  3AV8 A;  3TIX A;  3TCA A;  3L0W B;  3QJZ A;  1FRR A;  4IUM B;  3LXF A;  2W54 A;  3JW0 X;  2J0K A;  4CQN A;  2FCQ A;  3H9D A;  3O65 B;  3DBL B;  3GE8 C;  1GPX A;  1FCC C;  1RLF A;  3APF A;  1RAX A;  2D3C A;  3DHI C;  2EKI A;  2DYO A;  4IWQ A;  4ZRQ A;  5C1Z A;  2W3R A;  1Q5W B;  5HG2 A;  4MAC A;  1KLV A;  3RPF C;  1UGM A;  1TYG B;  2EMT A;  3DCG A;  1WYW B;  3B08 A;  4ICV A;  3A1Q A;  2V3P A;  5G5G A;  2NBU A;  3APD A;  1FNW A;  5E6N A;  2DZK A;  2I1J A;  2W9N A;  2MA9 B;  1E8X A;  4N9F 4;  1QOF A;  2KHW B;  2IGH A;  4G11 A;  4TKN A;  4ASW C;  2L32 A;  2BTE A;  2BYF A;  1JCK B;  3SHQ A;  4UDU C;  2KJH B;  1P3Q U;  1UBI A;  3ZDM C;  5C3J B;  2JUO A;  2G3Q B;  3B2G A;  1MG8 A;  2VZK B;  2MBO A;  3NZU A;  2QIE B;  3ETR A;  1IPG A;  4WAA A;  4RGO S;  2K5P A;  3W9C B;  3MJW A;  3Q3N C;  4MM3 B;  3V05 A;  2ZCB A;  1H4R A;  4AWJ A;  1EWY C;  5DCN A;  4PS8 A;  2FUG 1;  3QAR A;  1SGH A;  2KOX A;  2QMT A;  3RNA C;  1WRD B;  1EF5 A;  2L1A A;  4IWP A;  3AE9 B;  4C4V B;  3IG3 A;  1T0R C;  2O6V B;  3GZN B;  3KYD D;  4FN2 A;  2O2V B;  2M19 A;  3DWG C;  3HM6 X;  2LHE A;  4BKS A;  4BKS D;  4GDL B;  3AXC A;  3VUY A;  1FIQ A;  3AEA B;  4AQ7 A;  4XWW A;  3VUW A;  2KX3 A;  2MH7 A;  2ZVO A;  3W5U B;  2ZEQ A;  4XE0 A;  2N7D A;  3KYC D;  2D07 B;  1E8W A;  1K53 A;  3OLM D;  1UZX B;  2R2Q A;  1NEK B;  4J6I A;  2KX0 A;  3VTW A;  2JY6 A;  3KVF B;  3AE2 B;  1L6U A;  2JPH A;  2BWF A;  1WR1 A;  4JL9 A;  1WGK A;  5JZE B;  4OW0 A;  1I4P A;  1V9J A;  1OGW A;  2K6Q A;  1NBF C;  2MJE A;  2ZW0 A;  1FO4 A;  2LJ5 A;  4RNA A;  5D6J B;  4GOC A;  1FMA D;  2KQ7 A;  4NJC A;  4G3X B;  5KHO A;  2M1M A;  1MFW A;  1XT9 B;  1P1A A;  3HM3 A;  5D2M B;  4OVZ A;  3N30 A;  4HWI B;  4TQ1 A;  1YN5 A;  3E9S A;  1TY0 A;  1WX7 A;  1ZP0 B;  2PMV A;  2N1W A;  3KWL A;  4W9E A;  3UI3 A;  3UQA A;  4B95 A;  3PLU A;  5CHW A;  1CK1 A;  2NR2 A;  4RCO A;  5FR6 A;  1TZ1 A;  4KZ0 A;  2GRI A;  3T3O A;  4PS3 A;  4PT5 A;  3HRD D;  4TMA B;  2LGX A;  2FAZ A;  2M4N A;  1XO3 A;  1E0Z A;  3A9J B;  1SE2 A;  4DBG A;  2A4Z A;  3HUI A;  2BS3 B;  4YSZ B;  4B0M A;  1VCB A;  1FXI A;  3KUD B;  1QOA A;  4NAW A;  3RNE C;  2KKC A;  3KUC B;  4EZL A;  1C9F A;  2KFK B;  3ML9 A;  3VRA B;  1ZDX A;  2UWQ A;  4RGN A;  3AB5 A;  4WH4 A;  4GDK A;  1MJD A;  4E71 A;  3IVF A;  1OEY J;  3UIN B;  1VJK A;  2LGD A;  4DXA B;  3DBR B;  2LVQ A;  1HTO A;  3QA8 A;  4KDI C;  4XZ4 A;  2R61 A;  1QKZ A;  1Y56 A;  2KQS A;  3Q3M C;  3ML8 A;  3NRZ A;  1U4A A;  2CKH B;  2PEA A;  2XN9 C;  3AE8 B;  5LNK 1;  2WXK A;  2EKE C;  1UBQ A;  4BOS C;  1KOT A;  3ALB A;  4JWU C;  4RF0 A;  2LVO A;  2WXR A;  2Q5W D;  1STE A;  4ZOH C;  4PK1 A;  1X1M A;  2Y5C A;  5H92 C;  1V86 A;  2CU1 A;  5JXV A;  1J19 A;  4MGY E;  5FR3 A;  3NY5 A;  1JWM D;  2AX5 A;  2IGD A;  2IY1 B;  3DVN V;  3BZD B;  3OG5 A;  1R4M B;  2FID A;  3GOE A;  1D5M C;  1LFD A;  1PFD A;  1XF5 L;  5JHB A;  2DAJ A;  2GBK A;  4OZA A;  3NHE B;  1E7V A;  4W9C A;  4FBJ B;  4RM9 A;  3K9O B;  3IAS 1;  1LM8 B;  3QWZ B;  3VRB B;  1UH6 A;  4ANV A;  1WY8 A;  4MJS B;  2DYB A;  3BVM A;  1TTN A;  3ZQ4 A;  3W1S C;  2CJO A;  2A5U A;  3PZ8 A;  1WX9 A;  5IN7 A;  1YQ4 B;  1XLQ A;  4AJY B;  3L08 A;  4F7Z A;  4ICU A;  1GNU A;  4ZRJ A;  4KKJ A;  3AE1 B;  3R2I A;  2DNF A;  4I6P A;  4RGT A;  2QIL A;  3V62 A;  2VH1 A;  4YTM B;  3Q8C A;  4C80 A;  4MDK E;  2UYZ B;  2JT4 B;  2PLP A;  4M0W B;  3VH4 B;  1E8Z A;  1J7B A;  3HIZ A;  4RFB A;  4DHJ D;  3WAM A;  1KJT A;  2KDI A;  3ZJT A;  3PRP B;  2K39 A;  1Z5S B;  2N9L A;  4JGH B;  3AU4 A;  1OEY A;  1M4V A;  1S1Q B;  4XGA B;  4GIV A;  5HFY A;  2ZZP B;  2IYD B;  4JWS C;  5KHQ A;  1L0V B;  1WIA A;  1T3Q A;  2ZPY A;  2CJN A;  1YOV B;  3RNF C;  1IGC A;  5DPW A;  3CF6 E;  3GE3 C;  4NQK E;  2N9X A;  1VZ7 A;  4DHZ B;  3AE7 B;  5CX3 A;  3AN1 A;  1EU4 A;  4DHZ E;  1J8C A;  2DZJ A;  3AEG B;  3QX1 A;  1ET6 A;  3QAQ A;  3FKY A;  1E7P B;  2GBJ A;  4HRO A;  2WS3 B;  2ZPN A;  2TSS A;  3PS6 A;  3A4R A;  4LNN A;  3APC A;  2WDV B;  1BML C;  2RDH A;  3W2D A;  3PZ7 A;  4YSY B;  2QHO A;  2J7Q B;  2INC C;  1SJH D;  3ECI A;  1KFY B;  4LNK A;  3L4P A;  2KVR A;  1VRA B;  5DPT A;  1D4B A;  1NI2 A;  5EE9 A;  5I4D A;  1ZXH A;  4XX5 A;  3OAW A;  3L17 A;  2KTR A;  2WXI A;  4K3C A;  2MHJ A;  1OTR B;  3R8B A;  2BYE A;  3BY4 B;  4LTU A;  4P6V F;  2WWZ A;  4C00 A;  3PT2 B;  4KZC A;  4P1C C;  1ZGU B;  2KK8 A;  2MQJ A;  1ENF A;  2EMS A;  1N63 A;  4L23 A;  2MSE D;  5IKC M;  2BYT A;  3W5V B;  4D2K A;  1JML A;  3ZNH B;  1QF6 A;  1JWB D;  1TKY A;  1WJU A;  2LUM A;  2LVP A;  3CIR B;  3TSS A;  3M63 B;  2CS4 A;  5T8I A;  3DBH I;  3NG0 A;  2LAS A;  4G50 A;  1PGB A;  4KGS A;  2FCN A;  1GUA B;  2ZJD A;  4IM0 A;  2LUE A;  2RDG A;  3R7Q A;  3W1Y A;  2KAJ A;  3AE4 B;  3HVD A;  2G1E A;  5AUK A;  3ZW3 A;  3L16 A;  2N4F A;  1JRO A;  4E3C A;  1WYG A;  3GS2 A;  4M01 A;  3QIJ A;  1SE3 A;  1V1O A;  3ZRF A;  3U52 E;  5L95 C;  1Q0W B;  2QCZ A;  2L7R A;  1ZE3 D;  4N58 A;  3ZNI D;  2N9E B;  1OQR A;  5IO9 A;  1E10 A;  4MGK E;  3QC8 B;  1FNU A;  2N1V A;  2GBM A;  3V6C B;  4YXD B;  1I4Q A;  2X8X X;  3ZNG C;  2LXA A;  2NCN A;  4BZA A;  2KT7 A;  2KMC A;  5CHF A;  4WJN A;  2JXT A;  3CMM B;  1SB3 C;  4QAY A;  4C7Z A;  4W9H A;  4LJP B;  4LCD E;  1ET9 A;  3AE6 B;  3RFZ B;  1KH0 A;  3DQV A;  1RYJ A;  2PTL A;  1XEE A;  5FK9 C;  1TS2 A;  5D3D A;  4B9K A;  3R2T A;  4LDT B;  4X57 B;  1MHH E;  3BK1 A;  4M02 A;  1SIF A;  3N9Y C;  4ZHO A;  2Z0D B;  3FIL B;  3ZYY X;  2D11 A;  1R7S A;  3MHZ A;  1HTQ A;  3MC0 B;  2H89 B;  1C4A A;  2ICI A;  1ZXI A;  1WJN A;  3AEB B;  3EEC A;  1SJE D;  4ZRK A;  1KF6 B;  2B76 B;  4W9G A;  1IGD A;  3AI5 A;  3N1X C;  1YN3 A;  2AQ1 B;  3IXS A;  3WIM A;  4BBN F;  2NBV B;  5IAA C;  4XDD A;  1VR9 A;  2N7E A;  4A55 A;  1HZ6 A;  3KUZ A;  3RZF A;  1XLO A;  1LO5 D;  4P1B C;  3URY A;  3ZXR A;  1TBE A;  2W3S A;  1HQR D;  5TR5 A;  1I4R A;  4MM3 A;  4EUT A;  1SE9 A;  3ONS A;  2G9H D;  3RNC C;  4FJY A;  2N7J A;  4IW0 A;  2OJW A;  1WGH A;  1YJ1 A;  4C56 C;  2FBW B;  4C4V A;  2O6V A;  4BFR A;  4FJZ A;  1WRI A;  2FUH B;  2D2Q A;  2L00 B;  2O2V A;  3U2S C;  1TZO A;  2K25 A;  1F0Z A;  2M0A A;  4GDL A;  3RMK C;  2K22 A;  1P0R A;  1GJZ A;  3P42 A;  1HXY D;  1K51 A;  1V49 A;  4RM8 A;  3LYY A;  3RT3 B;  2K8H A;  2LZ6 A;  1IYF A;  1JW9 D;  3ZO5 B;  2BWE S;  3VXW A;  1I42 A;  2JYE A;  1IP9 A;  2MRP A;  3EFC A;  3ZRC A;  1RFK A;  2I38 A;  1PDX A;  1P7E A;  2C7H A;  1C4P A;  2ASQ A;  2JZZ A;  2BW2 A;  4OHJ A;  2RMM A;  4KSK C;  1WF9 A;  4EFO A;  3Q3O C;  2D3A A;  4TUU A;  3NZ3 A;  1UGJ A;  2KXJ A;  5CTR C;  3HHM A;  4P16 A;  4KIK B;  4HEA 1;  4CHK A;  1XQQ A;  2MBQ A;  5G5H A;  2G45 B;  2PPH A;  4HKQ A;  3KQ4 A;  4L2Y A;  1V5T A;  4NNJ B;  2L76 A;  4K7W A;  4JE3 B;  1V5O A;  2I1K A;  2JQR B;  1JWS D;  2M0X A;  3O13 A;  5HKH A;  4LNI A;  2V0G A;  5BYS A;  3U4E G;  1TT5 B;  2LI5 A;  1FD6 A;  2DEN B;  2PVO D;  4YWG G;  4AJW A;  1JRP A;  4N59 A;  4K81 A;  2LD9 A;  1TKG A;  2L3Z A;  3KH0 A;  3HVZ A;  2ZNV B;  3IFW B;  3RUL A;  2KMM A;  3A9J A;  1LQB A;  1NEN B;  3DPD A;  3JSV B;  4WWO A;  1UNS A;  2BKF A;  2FCM A;  5AUI A;  3QK0 A;  1K50 A;  2J0J A;  1WXA A;  1E9M A;  1AAR A;  1EWC A;  3L13 A;  1V1P A;  3ZTC A;  3DWM A;  1PQS A;  1TS4 A;  2KFK A;  2WXN A;  1NI3 A;  4MH0 E;  1N5W A;  2NTT A;  1WWT A;  3AMZ A;  1SBB B;  2IY0 B;  1I4X A;  3ENE A;  2H88 B;  2KDE B;  3PPA A;  2WHI A;  4MSM B;  4EZK A;  2GLS A;  4NY0 A;  3ZJV A;  3PV1 A;  1T0Q C;  3RD2 A;  3Q8E A;  3E56 A;  2OED A;  3SFE B;  2LGS A;  2IZV B;  2KN5 A;  4IG7 B;  3ZVV A;  1YQ3 B;  3D32 A;  1JAL A; 
#chains in the Genus database with same CATH homology
 1S1Q B;  4JQW C;  4HPM B;  3UIP B;  4OVV A;  4GIV A;  2MBB B;  2IO3 B;  2KFJ A;  2ZZP B;  2IYD B;  5KHQ A;  2KD0 A;  2KWU B;  2KMA A;  4KIK A;  3U8Z A;  1WIA A;  1OQY A;  4KV2 A;  4PYU A;  1KM7 A;  4ZRI A;  3MTN B;  2ZPY A;  5G55 A;  2FCS A;  1EF1 A;  3CST A;  4F8C B;  3A1Q B;  3V61 A;  1ZW7 A;  3VUX A;  1JRU A;  2LWP A;  2KO3 A;  5DPW A;  1P98 A;  3ZNZ B;  3DBL I;  3CF6 E;  1WMH A;  5G2N A;  3SDL C;  3T9L A;  1E90 A;  1ZKH A;  4EKU A;  4NQK E;  4DWF A;  2N9X A;  4WQO B;  2JRI B;  4DHZ B;  2K8C A;  5CX3 A;  2RSU A;  2L8J A;  3VDZ A;  3TJP A;  2KJ6 A;  4G0N B;  4KSL C;  4DHZ E;  5AZG A;  1J8C A;  2DZJ A;  3QX1 A;  3U7D A;  2M8S A;  3QAQ A;  1YX6 B;  4AOF A;  3EHV A;  2IO2 B;  4IC7 B;  3LDZ E;  3S2A A;  2GBJ A;  2KJR A;  2IBI B;  2KTF A;  4PS7 A;  4B6W A;  2XK5 A;  3Q3J A;  2MBH A;  3BIN A;  5GMV A;  1H8C A;  2HE7 A;  2ZPN A;  3PHW B;  3CSF A;  2KDF B;  3PS6 A;  3JSV A;  3A4R A;  3WAN A;  2DX5 B;  3APC A;  1Q1O A;  2GMI C;  2ZNV C;  2NBW B;  3X0W A;  4URK A;  4YL8 A;  5E6O A;  5IA7 A;  2FIF A;  2QHO A;  4BVU C;  5J18 A;  1QZE A;  1A5R A;  1WJ6 A;  2J7Q B;  4GXB A;  4DK5 A;  5J2R A;  4GDK B;  3ECI A;  2BKR B;  1WH3 A;  2WX0 A;  2MP2 A;  2KC1 A;  2KVR A;  1NDD A;  2WX1 A;  2DHZ A;  5DPT A;  4GB9 A;  4HPL B;  2JXX A;  1GG3 A;  4AP4 C;  3Q3F A;  4II2 B;  1NI2 A;  2M17 A;  4MSQ B;  4BOZ B;  2REX A;  4XX5 A;  3OAW A;  3L17 A;  2KTR A;  2G4D B;  2K8B A;  3TIX A;  3M95 A;  3R66 C;  3TCA A;  3L0W B;  1OTR B;  1FXT B;  3QJZ A;  2BYV E;  4IUM B;  2BYE A;  2Z59 B;  3JW0 X;  3ZUN A;  2J0K A;  3BY4 B;  2FCQ A;  3PVL A;  3RUI B;  3H9D A;  2WWZ A;  3O65 B;  3WAP A;  3PT2 B;  4KZC A;  2GBR A;  2XBB C;  1RLF A;  1V80 A;  3APF A;  1WXS A;  1ZGU B;  1RAX A;  2D10 A;  2KK8 A;  2MQJ A;  4JLC A;  4MEM A;  4JIO U;  1L7Y A;  2EMS A;  3ZKJ C;  4TV3 A;  2DYO A;  4II3 B;  4RMA A;  4ANX A;  4IWQ A;  2DAF A;  1RFA A;  5C1Z A;  5AEK B;  2MSE D;  4W9K A;  1Q5W B;  4A3P A;  3HK0 A;  4FA6 A;  3H7P B;  1WM2 A;  4IM3 A;  1KLV A;  1GC6 A;  1UGM A;  3ZNH B;  2C9W B;  3DVN U;  3GZN I;  1WJU A;  2EMT A;  2NS5 A;  3DCG A;  1WYW B;  3B08 A;  4ICV A;  2LVP A;  3A1Q A;  3M63 B;  2CS4 A;  4NPN A;  2R2O A;  3DBH I;  3V60 A;  4AUQ C;  3NOB A;  2NBU A;  3PTF C;  2LAS A;  3APD A;  4HCP B;  1G6J A;  4G50 A;  3DDC B;  4IWO A;  5E6N A;  2DZK A;  2FCN A;  1GUA B;  2I1J A;  1V2Y A;  2W9N A;  2ZJD A;  4IM0 A;  2MA9 B;  1E8X A;  3I3T B;  4N9F 4;  3RCZ A;  2LUE A;  3R7Q A;  3W1Y A;  1WJ4 A;  4CO7 A;  2L05 A;  5D94 A;  2LRW A;  2XEW A;  2KHW B;  5BO4 B;  4G11 A;  1YX5 B;  3ZW3 A;  4FLH A;  2JZ3 B;  4BKG A;  3L16 A;  1WXV A;  2N4F A;  4TKN A;  4ASW C;  2WYQ A;  1CMX B;  4E3C A;  2BYF A;  4M8M A;  3SHQ A;  2YVC A;  2KJH B;  3QIJ A;  1P3Q U;  3X23 A;  1UBI A;  4KVG B;  3ZDM C;  2C60 A;  3DVG X;  3ZRF A;  5L95 C;  2DZM A;  2G3Q B;  2JUO A;  2AYO B;  1MG8 A;  3PRM B;  4MEL A;  4ANU A;  1Q0W B;  4NJ6 A;  4A20 A;  2L7R A;  3PGE A;  2MBO A;  3NZU A;  4GMV A;  4WAA A;  1IPG A;  3AUL A;  3ZNI D;  3ZTD A;  3RZW C;  2GOW A;  2L0F A;  4K7S A;  2N9E B;  3MJW A;  3V6E B;  2ZCB A;  1H4R A;  4AWJ A;  4GGQ A;  3OJ4 B;  3QC8 B;  4MGK E;  2N1V A;  5DCN A;  2GBM A;  4PS8 A;  4W9I A;  3V6C B;  1EUV B;  2LRU A;  3ZNG C;  3QAR A;  2LXA A;  1SGH A;  2KOX A;  3WAL A;  3VQI A;  2NCN A;  3PHX B;  2B3A A;  1WRD B;  1EF5 A;  4IWP A;  2KMC A;  5CHF A;  4WJN A;  3H1U A;  4DHJ B;  1L2N A;  3CMM B;  2FNJ B;  2L0T A;  1WGR A;  3IG3 A;  4W9H A;  4FHJ A;  2O6V B;  4LJP B;  4LCD E;  3A9K B;  2V4L A;  2C7M B;  3KYD D;  4FN2 A;  2O2V B;  4NAW B;  3ZIM A;  3HM6 X;  2NVU I;  4BKS A;  4CYE A;  4MJS A;  3B0A A;  4XC2 A;  3M62 B;  4BKS D;  4GDL B;  3AXC A;  2NPT B;  3DQV A;  3VUY A;  3AU5 A;  4F1S A;  3WAO A;  3VUW A;  2KX3 A;  2ZVO A;  2ZEQ A;  3N32 A;  3R3M A;  2N7D A;  3KYC D;  2D07 B;  1E8W A;  4OVU A;  3JVZ X;  4I6N B;  3OLM D;  1UZX B;  2R2Q A;  3DVG Y;  4J6I A;  2KX0 A;  1WZ3 A;  2D3G A;  2JRH A;  3P2B A;  4M8N A;  3VTW A;  4B9K A;  1YD8 U;  2KNB A;  2JY6 A;  3KVF B;  4LDT B;  4X57 B;  3H7P A;  2CR5 A;  2JPH A;  4HDQ A;  2BWF A;  1WR1 A;  4JL9 A;  5JZE B;  1SIF A;  1V9J A;  1OGW A;  2K6Q A;  3TBL D;  4ANW A;  2RD0 A;  2PE9 A;  4WJO A;  1NBF C;  2Z0D B;  2JF5 A;  2LJ5 A;  4ZDV A;  2D11 A;  3PZD A;  2LXC A;  5D6J B;  1WFY A;  4GOC A;  2N9P C;  2KQ7 A;  2AL6 A;  4G3X B;  1YIW A;  5J17 A;  5KHO A;  2BF8 B;  1WJN A;  3EEC A;  2M1M A;  4K1R B;  3WA0 A;  1E7U A;  4ZRK A;  1XT9 B;  3IHP C;  1P1A A;  3NS8 A;  2PJH A;  3HM3 A;  4W9G A;  5D2M B;  3AI5 A;  5DPS A;  3EC8 A;  1V81 A;  3N30 A;  4HWI B;  4TQ1 A;  2RR9 A;  1EO6 A;  4WJQ A;  3DOW A;  2YLM A;  1LXD A;  2MX2 A;  3EFU A;  3WIM A;  3DBR I;  2KLC A;  4BBN F;  5LXI B;  1WX7 A;  2NBV B;  2VRR B;  2K1F A;  1WR6 E;  2MW5 A;  4P7I A;  4EOY A;  1D3Z A;  4A3O A;  1C3T A;  4HLE A;  5IAA C;  2DYM A;  2N1W A;  4W9E A;  2N7E A;  3UQA A;  2HTH A;  4B95 A;  2AL3 A;  1S3S G;  3KUZ A;  2KAN A;  2PE6 B;  3RZF A;  2C7N B;  1TBE A;  3H7S A;  3PLU A;  5CHW A;  2OOB B;  2NR2 A;  3KW5 B;  3VFK A;  5TR5 A;  3SD5 A;  2KLG A;  1TZ1 A;  4WWN A;  4KZ0 A;  5FR6 A;  4MM3 A;  4PYZ A;  3VVW B;  2C5L C;  4PS3 A;  3TL5 A;  3L10 B;  3ZDT A;  3B1L X;  3N3K B;  4EUT A;  2RGF A;  2LGX A;  1SE9 A;  2FAZ A;  2MLB A;  2M4N A;  3LJ3 A;  3ONS A;  1R4N I;  4FHK A;  4FJY A;  2AEH A;  3A4S C;  3A9J B;  4DBG A;  3PSE B;  2V1Y A;  2A4Z A;  4IW0 A;  1WGH A;  1YJ1 A;  5E6P A;  2LGY A;  1WGD A;  1VCB A;  1WE7 A;  3KUD B;  4HK2 A;  2O6V A;  2HD5 B;  2WDT B;  4BFR A;  3A9K A;  5LLI A;  4FJZ A;  5C23 A;  2FUH B;  1XD3 B;  2D2Q A;  3UQB A;  2L00 B;  2O2V A;  4IM2 A;  4NAW A;  1R4M I;  3PRE A;  2K25 A;  4ZYN A;  4GDL A;  3U30 A;  2NPT A;  2OJR A;  2KKC A;  3KUC B;  4DDI D;  1P0R A;  1GJZ A;  3UGB B;  4EZL A;  2KDB A;  2KFK B;  1TGZ B;  5CHV C;  3ML9 A;  2G4S A;  1V49 A;  4RM8 A;  3RT3 B;  2K8H A;  2LZ6 A;  2UWQ A;  3M3J A;  3ZO5 B;  1HE8 A;  1T0Y A;  4K7U A;  3H6N A;  1IYF A;  2BWE S;  4GDK A;  3VXW A;  4E71 A;  1I42 A;  1BT0 A;  3UF8 A;  3JYU A;  1IP9 A;  2MRP A;  3IVF A;  4DDG D;  5DPR A;  1YQB A;  3ZRC A;  4LDT D;  1OEY J;  3UIN B;  2LGD A;  2K6D B;  1UD7 A;  3UIO B;  2C7H A;  4DXA B;  4I6L B;  3OJ3 A;  2ASQ A;  2JZZ A;  1UEL A;  1Y8R C;  2LVQ A;  3QA8 A;  4KDI C;  5D7G A;  3VTU A;  4KSK C;  1WF9 A;  4XZ4 A;  2KZR A;  2CHW A;  3QQ8 B;  4EFO A;  2ZCC A;  2KQS A;  2KWV B;  4FUL A;  1WGG A;  3ML8 A;  4TUU A;  3R7R A;  4W9J A;  3TMP B;  4HVB A;  1U4A A;  3IBE A;  2CKH B;  2PEA A;  3VHT C;  2KXJ A;  1WX8 A;  2EKE C;  5CTR C;  1UBQ A;  4BOS C;  1KOT A;  3ALB A;  3HHM A;  3MHS D;  1F9J A;  2LVO A;  3VH3 B;  2MBE A;  4KIK B;  4CHK A;  3C0R B;  1XQQ A;  4FJV B;  2MBQ A;  4WWP A;  1X1M A;  4EEW A;  4EZJ A;  2Z0E B;  2G45 B;  2KC2 A;  2PPH A;  4LJO B;  5AZF A;  1V86 A;  1WMH B;  2CU1 A;  1M94 A;  3SU8 X;  1J19 A;  4MGY E;  5LXH A;  3NY5 A;  1V5T A;  4NNJ B;  2L76 A;  4W9F A;  4K7W A;  1V5O A;  2I1K A;  4HJK A;  2IO1 B;  5HKH A;  2M0X A;  2IY1 B;  3DVN V;  3L54 A;  1WI0 A;  2AWT A;  2FID A;  3GOE A;  1E8Y A;  1LFD A;  2LI5 A;  5JHB A;  2DEN B;  4W9L A;  1J0G A;  2DAJ A;  2GBK A;  2HJ8 A;  4BBN C;  5EDS A;  4AJW A;  3NHE B;  4K81 A;  5AZH A;  1E7V A;  2LD9 A;  4TQ0 A;  2Y5B B;  4MGZ E;  4W9C A;  2CHX A;  4FBJ B;  2L3Z A;  4RM9 A;  3W1S A;  3KH0 A;  1WXM A;  4GN1 A;  3K9O B;  2ZNV B;  3IFW B;  3RUL A;  5JH5 C;  2CHZ A;  2XK5 B;  1LM8 B;  1WZ0 A;  3A9J A;  1LQB A;  4MGI E;  4HXD A;  4E74 A;  3QWZ B;  4HDO A;  3VAW A;  1UH6 A;  4ANV A;  2J0M A;  5L83 A;  2JVC A;  3DPD A;  1WY8 A;  2MCN B;  1C1Y B;  2RPQ A;  3JSV B;  2DYB A;  4MJS B;  4WWO A;  2BKF A;  1TTN A;  2FCM A;  3W1S C;  2BGF A;  2A5U A;  1WX9 A;  3QK0 A;  2GBN A;  4BKT A;  2J0J A;  4KDL B;  1GC7 A;  1WXA A;  4NQL B;  2DZI A;  4WJP A;  2V3S A;  1AAR A;  3L13 A;  4HCN B;  4AJY B;  3L08 A;  1P9D U;  1WGY A;  3QHT A;  4GSW A;  1GNU A;  4ICU A;  1PQS A;  4ZRJ A;  3ZTC A;  3RYT A;  4F7Z A;  2KFK A;  4FAD A;  4MH0 E;  2MP2 B;  3DBS A;  1WE6 A;  3PRZ A;  4I6P A;  2MWS B;  3ZLZ A;  3V62 A;  4GU2 A;  2IY0 B;  1V6E A;  2JWZ A;  4MDK E;  1I35 A;  2IO0 B;  1K8R B;  3ENE A;  2UYZ B;  2JT4 B;  3NZS A;  2KTR B;  3A33 B;  1VD2 A;  4M0W B;  3VH4 B;  2KDE B;  3PPA A;  3QCA A;  4MSM B;  4EZK A;  3VTV A;  4NY0 A;  4NJ7 A;  1E8Z A;  1ISN A;  3HIZ A;  3PV1 A;  3RD2 A;  4DHJ D;  3PLV A;  2KWC A;  1Z2M A;  1KJT A;  3WAM A;  2O6V D;  2KDI A;  5JHA A;  1RRB A;  3PRP B;  3K9P B;  2IZV B;  2BPS A;  2KN5 A;  4W9D A;  2K39 A;  4IG7 B;  1WM3 A;  1Z5S B;  2ZVN A;  3T8M A;  4JGH B;  3ZVV A;  1E5W A;  3AU4 A;  3D32 A;  1OEY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...