2WYQA

The crystal structure of the ubiquitin-like (ubl) domain of hhr23a (human homologue a of rad23)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
MAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKNFVVVMVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UV EXCISION REPAIR PROTEIN RAD23 HOMOLOG A
publication title The Crystal Structure of the Ubiquitin-Like (Ubl) Domain of Human Homologue a of Rad23 (Hhr23A) Protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 20
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2009-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2wyqA00
3IHPC 3UIPB 1WGGA 4WWPA 5CX3A 2KK8A 1YJ1A 2V3SA 4BKSA 3VQIA 5DCNA 5C1ZA 2ZJDA 3R7QA 2NBWB 3S2AA 3A9KB 5D6JB 3WAOA 2EKEC 1I35A 1ISNA 2IO0B 1Q0WB 1VCBA 2N9PC 2W9NA 3KYCD 5AZHA 2JWZA 2KVRA 4TKNA 1HE8A 1RFAA 2KANA 1OEYJ 4G11A 3N3KB 3ZKJC 3CMMB 4WQOB 4A20A 4EEWA 4GOCA 4I6LB 4MDKE 2JVCA 3U8ZA 3ZRCA 2M4NA 4KZ0A 4W9IA 5G55A 2KJHB 2OOBB 4XX5A 3QQ8B 4WJNA 4K7WA 3B0AA 1LXDA 2L3ZA 1OTRB 3DOWA 3M95A 3SU8X 2AEHA 3B1LX 4AJWA 4DHZB 3IG3A 3ML8A 2DYMA 1V49A 1WM2A 3M3JA 1X1MA 5GMVA 2KX0A 2LWPA 3ALBA 3EFUA 1TZ1A 2L0FA 2EMSA 2R2QA 4GMVA 4IG7B 1UH6A 1YIWA 2KC1A 3EHVA 4JLCA 4ASWC 3ZTCA 2LD9A 1IPGA 3AI5A 3PT2B 3D32A 5JHAA 3SDLC 2KFJA 3ZIMA 4DXAB 1FXTB 3LDZE 1E7VA 4GDLB 2ASQA 2DAJA 3A9JB 5CHWA 3PV1A 2NVUI 3Q3FA 2K1FA 4EFOA 5D7GA 1S3SG 1EUVB 2G4DB 1V5TA 2G45B 2LVQA 4J6IA 3EECA 3LJ3A 1SGHA 1UZXB 4GU2A 2KX3A 3HM3A 2NCNA 4F8CB 4AP4C 5KHQA 4JL9A 2O2VA 3ZDTA 4I6PA 4IWPA 2C9WB 1K8RB 2JT4B 1UELA 4FJZA 2KOXA 1H4RA 2KFKA 2O6VD 3DBHI 2G3QB 4FBJB 2DYOA 2KTFA 1Z5SB 1V86A 1ZGUB 2MX2A 4GN1A 3GZNI 4AUQC 2DAFA 2K25A 1C3TA 4ANXA 3WAPA 2JZ3B 4ANVA 2GMIC 2KWUB 3R3MA 4BKSD 4FA6A 1WGRA 1G6JA 4HPLB 3NS8A 2MSED 3V60A 4EKUA 5AZGA 4ICUA 3L54A 1P3QU 4WWOA 3L17A 3QARA 2KWVB 4GDLA 3X0WA 1V81A 3R66C 4F7ZA 1GNUA 3QX1A 4TV3A 4EZKA 2KDEB 3VDZA 2Y5BB 4X57B 2CHXA 2KDIA 3ENEA 4AJYB 3PLVA 1NDDA 2KNBA 4HPMB 4HVBA 3MHSD 4B95A 1E7UA 2J0JA 5KHOA 2FCQA 3C0RB 4EZJA 4MGZE 1KJTA 4ZYNA 3EC8A 4W9DA 3PLUA 1WFYA 3ML9A 3UQBA 5L95C 1WR1A 4DHJD 1SE9A 3DDCB 2R2OA 4MEMA 1KM7A 2KDBA 2KN5A 4RMAA 2BGFA 5JH5C 5DPTA 3NHEB 4LJPB 4W9JA 1WGHA 1OQYA 1TTNA 5DPWA 1WE6A 3UF8A 2CS4A 5IAAC 3VUXA 4JIOU 3DBRI 4NQKE 3ZNID 3JW0X 1CMXB 2JPHA 4E74A 5DPSA 2G4SA 2CR5A 1WM3A 2C7MB 4FHJA 2PJHA 4DHJB 4DWFA 3Q3JA 3K9PB 4IM2A 2ZEQA 5CHVC 1WJNA 4NQLB 2BWES 5BO4B 2J0MA 4NPNA 3PREA 4ICVA 2IY1B 3TMPB 2MLBA 3A33B 3MTNB 1U4AA 3PGEA 4KSLC 3RZFA 1OGWA 2IZVB 4TQ1A 2KLCA 5LLIA 3CSTA 2FCMA 1RAXA 4W9HA 2L76A 2GBMA 4HCNB 3H7SA 3N32A 2FNJB 2MCNB 4MGYE 1ZW7A 4BKTA 4AOFA 3IFWB 3ZNGC 4EOYA 3N30A 3T8MA 2MQJA 4EUTA 1WF9A 3IVFA 3H1UA 4PS3A 5FR6A 4NJ6A 3HHMA 1IP9A 1P0RA 2N9EB 2PE9A 1TBEA 1XT9B 3DBSA 3DVGY 4KIKA 2Z59B 2M8SA 4MGIE 2A4ZA 2FUHB 3WA0A 1Y8RC 2WDTB 4HCPB 1UBQA 3L13A 4IC7B 3BY4B 4MJSA 2M0XA 5J2RA 4RM8A 1UGMA 3WAMA 2DYBA 2O2VB 4FN2A 4GGQA 3VUWA 1UD7A 2KXJA 1WY8A 1RLFA 3B08A 3VFKA 4K81A 4HDQA 2KFKB 3ZW3A 1M94A 2AL3A 2LUEA 2JF5A 2IO3B 3HK0A 4TUUA 4IM0A 4NNJB 2N7EA 4JQWC 1PQSA 2JZZA 3VTUA 4AWJA 1E5WA 1ZKHA 2MBEA 3VAWA 3HIZA 3PRZA 2JXXA 3R7RA 3TCAA 2LXAA 1WMHA 3CF6E 4LJOB 4DHZE 2CHWA 4FADA 1WXSA 3A4SC 5TR5A 1E8XA 4HJKA 3P2BA 5E6NA 3ZTDA 4BBNF 2WX0A 3SHQA 3VTWA 1J0GA 3W1SC 4RM9A 5DPRA 2JRIB 1NBFC 2KMAA 3M62B 4W9GA 2BKFA 2REXA 2NPTA 4MH0E 4DK5A 3ZNHB 1XQQA 2ZCBA 4M8MA 4P7IA 1YD8U 4MSMB 1P1AA 3VH4B 4KSKC 4HWIB 5C23A 4KVGB 2ZZPB 3RYTA 2MBOA 2BYEA 4FJYA 1V9JA 1L7YA 4ZRIA 5CHFA 3TJPA 3VXWA 2KQ7A 4A3PA 5JZEB 2KDFB 1EF5A 1WIAA 2MP2B 2LXCA 4XZ4A 5AEKB 1E8ZA 2C7NB 1GC7A 2WWZA 4LDTB 2IO1B 3L16A 4MSQB 4PYUA 2M17A 4II2B 2CHZA 3H9DA 2K6QA 3BINA 1WX8A 4NY0A 3H7PA 1MG8A 1V80A 3RT3B 2HJ8A 3CSFA 3PZDA 4N9F4 5D2MB 2DZKA 4II3B 2NS5A 3NZUA 2XBBC 2FCSA 2AYOB 4FLHA 4CO7A 3KUDB 2ZCCA 2GBKA 2MWSB 2LZ6A 2BF8B 2N7DA 3GOEA 1KLVA 4G3XB 2PEAA 4NAWA 1EO6A 2KTRB 2LGDA 3L10B 5LXHA 2KWCA 3RZWC 3QHTA 2CU1A 2DHZA 2N1VA 1WRDB 3AU5A 5E6PA 3UQAA 3WIMA 5IA7A 4NJ7A 2JUOA 2UYZB 4KIKB 5LXIB 2DZIA 2CKHB 2V1YA 1V5OA 2C5LC 2MBBB 1GG3A 2MP2A 2LASA 4MJSB 4IWQA 1V2YA 5D94A 3QC8B 2ZPYA 4DDGD 4WJOA 1WE7A 1J8CA 2KKCA 2NBVB 4IUMB 3WALA 4B6WA 4IM3A 4ZDVA 3DVGX 1XD3B 1E8WA 4K7SA 4PYZA 3PRMB 1WJ6A 4GB9A 4W9KA 4BOSC 2KMCA 4GIVA 5EDSA 1GC6A 3TIXA 1T0YA 1LM8B 4HLEA 2ZVNA 2DENB 2LGXA 3JSVA 4M8NA 3SD5A 3WANA 4WJQA 2KJ6A 3KW5B 2YLMA 3A1QA 2RGFA 2LRWA 2KTRA 1WGDA 3A4RA 2JRHA 2IO2B 3JVZX 3ZO5B 2NR2A 1WMHB 2LVPA 1GUAB 3ZNZB 1YX6B 2ZPNA 3PRPB 1P98A 2IY0B 4CYEA 2BYVE 2GOWA 2I1JA 4K1RB 4W9EA 1WH3A 3L08A 1Z2MA 2J0KA 2C60A 2MRPA 2HD5B 3VHTC 3PHWB 4E3CA 2K6DB 3VUYA 2D10A 4K7UA 1D3ZA 2KO3A 1E90A 1WXMA 2NPTB 1P9DU 2NBUA 4GDKA 1UBIA 1WZ3A 3ONSA 3KVFB 5L83A 4B9KA 2FCNA 2I1KA 2XK5A 3O65B 1IYFA 2HTHA 3UGBB 2ZNVC 2BYFA 3UINB 2D3GA 4MGKE 4BBNC 2RSUA 3MJWA 2LJ5A 4BKGA 3KYDD 1TGZB 3W1YA 2JY6A 3X23A 1OEYA 2L8JA 3ZDMC 1WXVA 2A5UA 1EF1A 5AZFA 2DZJA 2MW5A 2AL6A 2HE7A 4WAAA 5HKHA 1Q1OA 4KDLB 3VVWB 2D07B 3OJ3A 4MM3A 1J19A 2FIDA 3W1SA 1WR6E 2XEWA 5J18A 2KJRA 3H7PB 3M63B 3PPAA 5E6OA 3QA8A 3H6NA 4G0NB 4F1SA 3TL5A 2FAZA 3NY5A 3RUIB 3V6EB 2LI5A 1I42A 4TQ0A 2KD0A 4FULA 1WJ4A 2UWQA 3UIOB 3V61A 1RRBA 2FIFA 2WYQA 2BKRB 2MA9B 2MBQA 2N9XA 2B3AA 4KZCA 4PS7A 4URKA 4NAWB 1WJUA 4LCDE 3DBLI 3A9KA 1L2NA 4LDTD 1QZEA 3PTFC 1AARA 3OJ4B 4IWOA 4OVUA 3QAQA 4OVVA 5G2NA 2N1WA 2L00B 3KH0A 2GBRA 2IYDB 2RD0A 1H8CA 4W9LA 1E8YA 4CHKA 3QJZA 1A5RA 3ZUNA 3PS6A 3U30A 2V4LA 4ZRJA 4FJVB 2Z0DB 2BWFA 4MELA 2GBNA 1WX9A 4BVUC 3PVLA 2L05A 3NZSA 1JRUA 1KOTA 2ZVOA 3PHXB 1LFDA 3DVNU 1YQBA 1F9JA 4W9FA 2DX5B 4KDIC 4DDID 3T9LA 1NI2A 2GBJA 1YX5B 1LQBA 2PE6B 2K8CA 1V6EA 3ZVVA 4IW0A 3DPDA 4WJPA 3RD2A 2KQSA 3DVNV 3HM6X 4PS8A 3VTVA 4HDOA 3JSVB 1WGYA 4BOZB 1Q5WB 5J17A 2EMTA 2D11A 3QIJA 5CTRC 2QHOA 1R4MI 2VRRB 2YVCA 3OAWA 2LGYA 3A1QB 3V62A 2IBIB 3I3TB 4ANUA 4GXBA 4KV2A 4YL8A 3ZLZA 2RR9A 3KUZA 3DQVA 2C7HA 3U7DA 3NOBA 2O6VB 3APFA 1VD2A 3A9JA 4DBGA 2KC2A 3JYUA 4GSWA 2L0TA 2AWTA 3L0WB 3ECIA 2N4FA 2Z0EB 4HXDA 3RCZA 1WXAA 3V6CB 2ZNVB 2MBHA 2L7RA 4GDKB 3ZRFA 4ZRKA 2BPSA 2KZRA 1GJZA 3PSEB 3QK0A 2K39A 2XK5B 2J7QB 3OLMD 2OJRA 3VH3B 1S1QB 2K8BA 4JGHB 4BFRA 4A3OA 4XC2A 3RULA 3AULA 4ANWA 2K8HA 3K9OB 3IBEA 2KHWB 4M0WB 1BT0A 1SIFA 1WI0A 2LVOA 2WX1A 4WWNA 2LRUA 3QCAA 1R4NI 1WX7A 3QWZB 4E71A 1C1YB 4HK2A 2M1MA 2D2QA 2PPHA 2KLGA 2O6VA 3KUCB 4I6NB 3AXCA 5JHBA 3APDA 3DCGA 2DZMA 4EZLA 3AU4A 1WYWB 3APCA 4G50A 4FHKA 3TBLD 4W9CA 2RPQA 1WZ0A
chains in the Genus database with same CATH superfamily
1WGGA 1OFFA 1YJ1A 1R7SA 2V3SA 3H8HA 5DCNA 5BMIA 1K53A 1XLQA 3W2DA 3S2AA 1XO3A 3A9KB 1ISNA 2W9NA 5AZHA 1I4GA 4TKNA 1YJIA 2KANA 1OEYJ 3ZKJC 4WQOB 4GOCA 5BYQA 2M4NA 2Z8LA 1PGBA 1QOFA 4WJNA 5HFYA 4K7WA 3B0AA 2L3ZA 2ZW0A 3DOWA 1WXQA 3SU8X 2AEHA 2RPVA 4AJWA 3EA6A 4WQMA 3ML8A 1X1MA 5GMVA 3EFUA 1JWBD 2PW9A 2L0FA 1SE2A 3DWGC 4GLSC 1YIWA 2KC1A 4RGOS 2KFJA 1E7VA 3NZ3A 4ZRPA 1WRIA 2DAJA 3PV1A 3VRAB 2NVUI 5D3DA 2V3PA 4EFOA 1S3SG 1KLGD 1EUVB 1TY0A 3EECA 1KTKA 1SSNA 1TKGA 2KX3A 4P6VF 3CWIA 4AP4C 2H88B 1QILA 1WWTA 4IWPA 2Y5CA 1H4RA 2G3QB 2DYOA 1Z5SB 3DBLB 2W55A 4AUQC 2DAFA 4KX6B 3AE3B 3WAPA 1T0SC 4ANVA 3R3MA 4FA6A 1WGRA 4HPLB 1NVID 3V60A 4ICUA 4TV3A 4EZKA 3Q69A 3I57A 3VDZA 4X57B 2CHXA 1DOXA 1SEBD 1E7UA 2J0JA 1EU4A 4EZJA 4MGZE 1KJTA 1PGXA 3J9CA 1AYFA 3W5VB 4XWWA 4DHJD 3DDCB 2L52A 2AQ2B 2KN5A 5JH5C 1WGHA 3EUB2 1OQYA 1TTNA 1WE6A 5IAAC 3VUXA 3DBRI 1D5XC 2JPHA 4AQ7A 2PJHA 1MVKA 5BO4B 2J0MA 4NPNA 2M19A 4OHJA 2SAKA 2MLBA 4O1NA 1V8CA 2AQ3B 3P63A 5LLIA 2FCMA 4IOIE 2GBMA 4HCNB 3H7SA 4HPPA 4MGYE 1ZW7A 3P4PB 3IFWB 3DBRB 1SF0A 4M01A 5I4DA 4PS3A 4NJ6A 1IP9A 1F2RI 1XT9B 3DBSA 2M8SA 4L2YA 2O2VB 3VUWA 1QF6A 3AB5A 1WY8A 1PUTA 2FBWB 2MEKA 1C76A 4TUUA 1HXYD 2BBCA 1E5WA 1C78A 2MBEA 1MJDA 4HJGE 3VAWA 3PRZA 3AE2B 3MP9A 1WMHA 3CF6E 4DHZE 4J3OD 1I4QA 1N62A 2WX0A 4B0MA 2MJDA 4P16A 4RGNA 1GPXA 4L1BA 1B1ZA 4MH0E 3ZNHB 3RMKC 1P1AA 3VH4B 4KVGB 1I4HA 1N61A 1L7YA 4ZRIA 4A3PA 4RFBA 2KQ4X 1EF5A 1E8ZA 2C7NB 1GC7A 4LDTB 1NYQA 2IO1B 3L16A 4II2B 1TYGB 1FRDA 3I63C 3H7PA 1V80A 4N9F4 5D2MB 3NZUA 2XBBC 4FLHA 3DBHB 3DHIC 2BF8B 3Q8CA 1MHHE 2KTRB 5LXHA 2KWCA 3RZWC 2DHZA 3U52E 1Q10A 4NJ7A 3ZYYX 4KIKB 4OZBA 3P42A 1HQRD 5GXGB 1MG4A 1QOAA 2KYWA 2V1YA 5IP4D 2WXNA 2K22A 4MJSB 1GG3A 1V2YA 2ZPYA 4WJOA 1J8CA 1GB4A 4B6WA 1XD3B 1TT5B 2BQQA 2Q5WD 4C4VA 3ZJVA 2MHJA 1T0YA 1LM8B 5IKCM 2WU5B 1F1HA 2YLMA 3Q8EA 1WGDA 3FKYA 3PRPB 4CYEA 1P98A 2IY0B 1WH3A 1Z2MA 2C60A 1QKZA 3Q2AC 4K7UA 1GOZA 2L32A 2NPTB 3BK1A 1WZ3A 2I1KA 2LHEA 3O65B 1BUIC 1HTOA 1T6BX 4MGKE 4USAA 2JY6A 2L8JA 2RDGA 1EF1A 2B76B 2GRIA 3T3NA 1TKEA 4MM3A 2FIDA 2XEWA 4IDIA 2KJRA 5J18A 3PPAA 1T5XD 1HZ6A 4F1SA 2FAZA 3V6EB 1I42A 2LI5A 3MJ5A 2KD0A 3GE3C 3KLSX 4FULA 3UIOB 5EE9A 2BKRB 2MA9B 4URKA 1WJUA 1L2NA 3A9KA 1FCLA 1QZEA 1SB3C 3OJ4B 4OVVA 4RGMA 2L00B 1YN3A 1SE4A 2IYDB 2RD0A 1SIJA 1E8YA 3KQ4A 1A5RA 2Z0DB 3PVLA 1JRUA 3PHXB 1LFDA 4JE3B 5HI1A 2HDEA 3P4RB 4LNOA 3NRZA 3Q14C 4TSSA 2GBJA 4WJPA 2K5PA 1UWXA 3RD2A 4BZAA 3VTVA 2QJLA 5J17A 5CTRC 2YVCA 3I3TB 2QMTA 4YL8A 1HTQA 3NOBA 4GSWA 3ECIA 2N4FA 3TUOA 3RCZA 4ZOHC 1WXAA 2ZNVB 2MBHA 2L7RA 4GDKB 2BW2A 2KZRA 3QK0A 3VH3B 1JWMD 1S1QB 3RULA 3B9JA 3AULA 4ITKA 2K8HA 3EFCA 2RDBC 1D6EC 3DHHC 2LVOA 3QCAA 1R4NI 1WX7A 3QWZB 2MH7A 1TZOA 1RWSA 2PPHA 4I6NB 1ZP0B 5JHBA 2DZMA 4ZDVA 4FHKA 2RPQA 3ZJUA 2J42A 3IHPC 3UIPB 5CX3A 2M0AA 2JQRB 4YT0B 3R7QA 1Y56A 3WAOA 3KYCD 3N1ZC 1HE8A 4G11A 3N3KB 4EEWA 4A20A 4I6LB 4MDKE 2BS2B 3U8ZA 1TS2A 3QQ8B 4KGSA 2PKOA 1LXDA 1NYRA 4LTUA 5FK9C 1OTRB 3M95A 1J7AA 3B1LX 3TEWA 3IG3A 3BYTB 2NMQA 2JWUA 2LJIA 1HZ5A 2LGSA 3SFDB 2DWQA 2L1AA 4IG7B 1UH6A 2YEPB 4XDCA 1NEKB 4FXCA 1IPGA 4YTNB 4DXAB 1FXTB 3LDZE 4AS1A 1V1PB 3A9JB 5CHWA 4A9AA 2K1FA 5D7GA 2G45B 4J6IA 1SGHA 4GU2A 2I38A 2KACA 2O2VA 2C9WB 1K8RB 3LYYA 1UELA 4DXGA 2O6VD 3RNEC 1C3TA 2K25A 2PVGC 5D3IB 4XGAB 2QEJC 5EE3A 1VZ6A 4YSZB 2INDC 2MJ3A 3NS8A 5AZGA 4GDLA 4F7ZA 3X0WA 1V81A 1GNUA 3QX1A 2KDEB 2D5GA 2PTLA 4S17A 2Y5BB 1NDDA 4HPMB 4HVBA 3MHSD 4ZYNA 1PYWD 4W9DA 3O13A 3PLUA 2OJWA 5L95C 3UQBA 1WR1A 2R2OA 4MEMA 3WCQA 2BGFA 5DPTA 1FPYA 4LJPB 1R4MB 4C80A 4PT5A 2K9XA 4ZRQA 4JIOU 4KGTA 4NQKE 3JW0X 2WS3B 2CR5A 2C7MB 3ZXRA 4DWFA 2BB5A 3Q3JA 1E7PB 3K9PB 2WXGA 5CHVC 4NQLB 2CJNA 3PREA 2WU2B 1WGKA 3A33B 3MTNB 1U4AA 1OGWA 1C4PA 3U7ZA 1D4BA 4W9HA 2L76A 2MCNB 2FNJB 1XXGA 1VLBA 2IJ0A 3N30A 3SR6A 5FR6A 1I7HA 4C7YA 4KIKA 2PE9A 3DVGY 1IGDA 2FUHB 3WA0A 1CK1A 1UBQA 4MJSA 5J2RA 4HKZE 4RM8A 2DYBA 5G5GA 4GGQA 1UD7A 3ZJTA 3GB1A 1RLFA 2KFKB 2LUEA 3HK0A 1P7FA 5IO9A 4JQWC 3L4PA 3C19A 1EWCA 2JZZA 4MT5A 2R61A 1ZKHA 3AE9B 4IKGA 2LXAA 4FADA 1VZ7A 2CHWA 2G1EA 2KAJA 3V3XA 2WXPA 1E8XA 4BBNF 2KWDA 1J0GA 3W1SC 4RM9A 2KMAA 2NPTA 4DK5A 5E6JA 3SEBA 1SBBB 1YD8U 3RYTA 1FRRA 3TJPA 2K3UA 2KQ7A 3AEFB 5JZEB 2KDFB 1WIAA 2BVCA 4XZ4A 5AEKB 2WWZA 3ZGZA 1ENFA 2K6QA 2KT7A 1WX8A 5BYRA 2HJ8A 5T8IA 2DZKA 2FCSA 2OEDA 2N7DA 3RPFC 1JMLA 4G3XB 2WGSA 2CU1A 2MJEA 3WIMA 3AE8B 2JSVX 1VR9A 5LXIB 2E6XA 1SJED 2MP2A 1MPEA 1YN4A 2IGDA 1N5XA 5D94A 1N5WA 2HJ1A 4IM3A 3DVGX 4K7SA 2JZPA 1E10A 3FC4A 4BOSC 2KMCA 4GIVA 4K3BA 1VRAB 2ZVNA 1ZXIA 2DENB 3SD5A 4WJQA 2RGFA 3Q8FA 3BYYB 3A4RA 3P4SB 3VR9B 3DHGC 2BYVE 3Q8AA 2WNMA 3VHTC 3PHWB 2K6DB 2Y3AA 3VUYA 2PLPA 4RCOA 1AN8A 1D3ZA 2NBUA 4GDKA 1UGJA 3ONSA 2AQ1B 2HTHA 1B9RA 4N58A 2ZNVC 3RNAC 4BBNC 2RSUA 4BKGA 1RYJA 1TGZB 3W1YA 1FD6A 1OEYA 3ZDMC 3RNFC 2DLBA 4WAAA 1Q1OA 3OJ3A 1J19A 4RF1A 2JU6X 2VZKB 4LNFA 1QQRA 3M63B 3MHZA 3QA8A 4M00A 3E56A 4JX1C 3RUIB 2W54A 2SEBD 1M4VA 1WJ4A 1RRBA 1XF5L 2FIFA 2MBQA 2N9XA 2B3AA 4NAWB 4LCDE 3AEDB 1AARA 3AEBB 4IWOA 4OVUA 3R2IA 3QAQA 3KH0A 3R8BA 2GBRA 4N59A 3PS6A 1WX9A 1NENB 1UNSA 3N1YC 1KOTA 1RFKA 3DVNU 1YQBA 4R3DA 3GE8C 1BXTA 1F9JA 1JWSD 2DX5B 4KDIC 4HROA 1YMHE 2K8CA 4A8XC 1WSPA 3ZVVA 3DVNV 3HM6X 3QIJA 3V62A 3OAWA 2IBIB 4ARCA 4GXBA 3ZLZA 1TKYA 3DQVA 2C7HA 1QT9A 1V1PA 1XCQL 2O6VB 3A9JA 4DBGA 3JYUA 2WXFA 2AWTA 3L0WB 2Z0EB 1DGJA 2N7JA 4HXDA 3ZRFA 4ZRKA 1UUPA 1GJZA 4JPSA 2K39A 2J7QB 4C7ZA 2OJRA 2ACZB 4QAYA 1JCKB 2K8BA 4JGHB 3AE5B 3PZ8A 2BYTA 3K9OB 2KHWB 4M0WB 3OG5A 4JWUC 1SIFA 2WX1A 1FXAA 2LRUA 1OQQA 2BT6A 4E71A 1D5ZC 3Q8BA 2D2QA 3BZDB 3APDA 3DCGA 4G50A 4EE2A 2KK8A 4BKSA 1C77A 3NVWA 2NBWB 5D6JB 2EKEC 2N9PC 1L6VA 2RMMA 4XWTA 2JWZA 5FR3A 5G55A 1P7EA 2WDQB 4XX5A 2IPKD 2WXIA 4K3CA 1FNVA 4S0RA 1WM2A 2KX0A 3ALBA 1FXIA 1TZ1A 2EMSA 3EHVA 4JLCA 3ZTCA 2LD9A 3AI5A 2WXHA 3ZIMA 3SFEB 3AV8A 5MPOA 2G4DB 2NTSA 2RDHA 1V1OA 3LJ3A 1UZXB 2XNAC 2NCNA 1ZPSA 4I6PA 2JT4B 2KOXA 2KFKA 4ZHOA 2PVOD 4FBJB 2KTFA 1UWMA 4ZHPA 3GZNI 4ANXA 1L0VB 2TSSA 4Q2JA 2GMIC 2KWUB 4NJCA 1YN5A 2J53A 1G6JA 4WWOA 1FEHA 3L17A 1CZPA 3QARA 2IGGA 3R66C 2LEKA 5BMGA 2W82A 2KDIA 2ONQA 1YJJA 1STEA 2WXKA 3AH7A 2KNBA 3T3OA 1ESFA 2FCQA 1T0QC 3FAHA 3C0RB 3AE4B 3NVVA 1WFYA 3ML9A 4HRSA 1SE9A 4PK1A 5BYSA 2KDBA 3B2FA 3NHEB 4A55A 4W9JA 1TY2A 5TSSA 1ZUD2 1GAQB 3AECB 5DPWA 2CS4A 3ZNID 5DPSA 2G4SA 4DHJB 4NAMA 1XLOA 2GLSA 2ZEQA 4N6EB 3RNBC 2ON8A 3Q6BA 2INNE 4ICVA 2IY1B 3RZFA 3KWLA 4TQ1A 2GB1A 1RAXA 3N32A 4LLGM 4BKTA 4AOFA 3Q3MC 3ZNGC 4EOYA 3PO0A 3T8MA 2KMMA 2MQJA 1R4NB 1WF9A 3IVFA 3H1UA 2D3AA 2XN9C 3HHMA 4OZCA 4C00A 3MC0B 1YOVB 2N9EB 1TBEA 3MC9A 2A4ZA 5H92C 2X8XX 1Y8RC 2WDTB 4HCPB 3BY4B 2BS3B 1UGMA 3LB8C 3NUHB 3PZ7A 1KLUD 3B08A 4K81A 1M94A 2FE8A 3B2GA 2N7EA 5EE1A 1XEEA 4WH4A 1PQSA 2V0GA 1E9MA 3HIZA 3LXFA 4LJOB 1EWYC 2KVZA 3A4SC 1F52A 5TR5A 4HJKA 4A90A 2INCC 3FILB 3SHQA 3VTWA 5DPRA 2WP9B 3M62B 2L83A 1KH0A 1D5MC 1XQQA 2ZCBA 4M8MA 4P7IA 4MSMB 2ZZPB 1DOIA 1PGAA 3URYA 2V9HA 2BYEA 4FJYA 3I5JC 1KFYB 1V97A 5AUIA 1LGRA 1FFVA 2LXCA 4TMAB 2BS4B 4XE0A 4PYUA 2M17A 3VRBB 5C2TB 3BINA 5EE0A 4NY0A 1MG8A 4M02A 3RT3B 1K51A 2JYEA 3PZDA 1F2RC 2NS5A 5IOIA 2AYOB 3P1MA 4CO7A 2ZCCA 2GBKA 2UU7A 2MWSB 2LZ6A 3GOEA 1KLVA 4XYCA 4NAWA 2LGDA 3L10B 2WXOA 2N1VA 2WXQA 2KN4A 3UQAA 2N0SB 2JUOA 3ETRA 2WDVB 2DZIA 1V5OA 2C5LC 2MBBB 2LASA 3VR8B 2AX5A 3ZQ4A 2WXJA 4YTMB 3DWMA 1WE7A 1F0ZA 2QIEB 4IUMB 4YSYB 3N9YC 1ZXHA 2K0PA 4GB9A 1WJ6A 2OHFA 1L5PA 1GC6A 2VH2A 5EDSA 3TIXA 2W3RA 1EU3A 2KJ6A 3KW5B 1TS5A 3IXSA 3HRDD 2KTRA 4MM3B 2JRHA 2IO2B 3ZO5B 3ZNZB 1YX6B 2GOWA 4K1RB 4W9EA 3L08A 3U2SC 2J0KA 5IN7A 3IAM1 5HG2A 3R2TA 1FFUA 1DYQA 2HD5B 2INPE 3ZXVA 4E3CA 2D10A 2KO3A 1E90A 1WXMA 1P9DU 3N1XC 1UBIA 4YWGG 4B9KA 2FCNA 2QSDA 4HEA1 3AE1B 4KKJA 2BYFA 3UINB 2NTTA 3TEZA 2JX5A 4YTPB 1PFDA 1ZDVA 1XLNA 4REZA 4M0WA 2H89B 1F77A 2V4IB 1WXVA 2A5UA 5AZFA 2DZJA 2MW5A 2AL6A 2HE7A 4KDLB 4HKQA 2D07B 2WLBA 3W1SA 1J7BA 1J7CA 1WR6E 3C8YA 2X38A 4G0NB 3TL5A 4TQ0A 1JROA 3HUIA 2WXLA 4KZCA 4PS7A 2M56B 3DBLI 1E6EB 4WWMA 1QOBA 2N1WA 2ZW1A 3AM9A 1H8CA 1XLPA 2WHIA 3U30A 4LK0M 4MELA 2GBNA 4BVUC 3IT6B 1C79A 2ZVOA 2HTME 1YNTE 1NI2A 1LQBA 2PE6B 4IW0A 3DPDA 1XCTL 4RF0A 4PS8A 4HDOA 3JSVB 1Q5WB 1T3QA 2EMTA 1C4CA 2QHOA 4ANUA 1L4ZB 3A1QB 4KV2A 2Y5PA 3KUZA 3APFA 4C56C 1I4RA 2L0TA 3BK2A 1IUEA 3CIRB 4US8A 2WDRB 2BPSA 1AWDA 4KGRA 3NJTA 5LNK1 2XK5B 1QOGA 1IBXB 4BFRA 2YEPF 4RH6A 3MC8A 2PIAA 3KWVA 3I9V1 1FNWA 1BT0A 1IGCA 1WI0A 4MACA 1CQVA 3BVZA 2LHDA 1C1YB 4HK2A 5BMHA 1FNUA 3BVMA 3KUCB 4UDUC 3AXCA 1TS3A 4B0EA 3AU4A 3MFGA 4W9CA 1WZ0A 4WWPA 1TJEA 1VZ8A 3IAS1 3VQIA 1QLBB 2ZJDA 5C1ZA 1TIFA 1ZOYB 1I35A 3AN1A 4YSXB 1ET9A 2IO0B 1Q0WB 1VCBA 3AEEB 2KVRA 3E9SA 1RFAA 5AUKA 3CMMB 2JVCA 3ZRCA 4KZ0A 4W9IA 2KJHB 2OOBB 2W3SA 4NZLB 3TEYA 1N60A 1K52A 2PMVA 1TS4A 4DHZB 1I4XA 2DYMA 1V49A 3M3JA 2JXTA 2LWPA 3P4QB 2R2QA 4GMVA 3NG0A 3RFZB 4ASWC 2EELA 3PT2B 3Q3NC 3D32A 5JHAA 3SDLC 4GDLB 2ASQA 3GP7A 3Q3FA 4D2KA 1V5TA 3HVZA 2LVQA 1HEZE 1MHXA 3BVGA 3HM3A 4F8CB 5KHQA 4JL9A 3ZDTA 4FJZA 5H8YE 3DBHI 1V86A 1ZGUB 2MX2A 4GN1A 3EGRA 2JZ3B 3RN9C 4BKSD 5HHDG 2MSED 4EKUA 2LGIA 3L54A 1P3QU 3W5UB 4WURA 2KWVB 1JRPA 1NI3A 2D3CA 3ENEA 4AJYB 3PLVA 4LNNA 3FILA 4B95A 5KHOA 4ZYSA 3EC8A 3RI7C 1KM7A 1KRHA 4RMAA 2LFIA 1A70A 1L4DB 2BB6A 3U4EG 3W9CB 3UF8A 4LNIA 2CJOA 1CMXB 4E74A 4FHJA 1WM3A 4IM2A 1WJNA 4ARIA 2BWES 1EM7A 4ACFA 4L23A 3TMPB 4KSLC 3PGEA 2IZVB 2KLCA 3CSTA 3ABVB 2VH1A 4RGTA 1ACCA 3RNCC 1FM0D 4EUTA 1P0RA 1JWUD 2Z59B 4MGIE 2N9KA 4WAFA 3L13A 4IC7B 5G5HA 2M0XA 1GB1A 3WAMA 4FN2A 2N9LA 2KXJA 1UF0A 3VFKA 1BMLC 4HDQA 3AMZA 3ZW3A 2AL3A 2JF5A 2DNFA 2IO3B 4IM0A 4NNJB 2QCZA 4P1BC 1YQ3B 3Q3OC 3BIID 3VTUA 4AWJA 4P1CC 1HA5A 4XDDA 3AE7B 2E3TA 3OWEB 1AW7A 2JXXA 3R7RA 3TCAA 1WXSA 4LNKA 4JWSC 5E6NA 3ZTDA 3P2BA 1C4AA 2JRIB 1NBFC 4W9GA 2BKFA 2REXA 2WXRA 1FCCC 1JALA 4KKIA 4HWIB 4KSKC 5C23A 4WIPA 1FMAD 2MBOA 1MFWA 1V9JA 2ICIA 5CHFA 3VXWA 1ZE3D 2MP2B 1VJKA 1KF6B 4MSQB 2CHZA 1N63A 3H9DA 1L0XB 3AE6B 3CSFA 2BTEA 4II3B 1ZDXA 3KUDB 2KDMA 1ET6A 1RM6C 1WYGA 2PEAA 1EO6A 3GZNB 3QHTA 1JQ4A 1WRDB 3AU5A 5E6PA 5IA7A 4US9A 4DQOC 2I2YA 2UYZB 3NVYA 2CKHB 4CQNA 4IWQA 3HVDA 3QC8B 2V3NA 2KKCA 2NBVB 3WALA 1MI0A 1E8WA 1FO4A 4PYZA 3PRMB 4W9KA 1E0ZA 4H2AA 4HLEA 4M8NA 2LGXA 3JSVA 3WANA 2GI9A 3A1QA 2LRWA 2QC8A 3IT4B 1LO5D 3JVZX 5JXVA 2NR2A 1WMHB 2LVPA 2J4XA 1GUAB 2ZPNA 2I1JA 2EKIA 2MRPA 1VDVA 3GS2A 2D3BA 1T0RC 3KVFB 2XK5A 2QDFA 1IYFA 2LUMA 3UGBB 1IBXA 1FIQA 2VZKD 2D3GA 3MJWA 2LJ5A 3KYDD 2WQYB 2WXMA 3N20C 2IDYA 5HKHA 4OZAA 3VVWB 3TSSA 1ROEA 3H7PB 5E6OA 3H6NA 1K50A 4A6QA 3NY5A 2UWQA 3V61A 2WYQA 1JW9D 1L0YB 4MH8A 4LDTD 3PTFC 1DOYA 1SXTA 5G2NA 3RNGC 3NVZA 4W9LA 1N6ZA 1L6UA 4CHKA 3QJZA 3ZUNA 2V4LA 4ZRJA 4FJVB 2BWFA 2L05A 3NZSA 1OQRA 4DXFA 4W9FA 1YQ4B 4DDID 3T9LA 1YX5B 1V6EA 4C4VB 2G9HD 2KQSA 1SE3A 1WGYA 4BOZB 2D11A 1R4MI 2VRRB 2LGYA 4BAXA 2QILA 2JYTA 4OVZA 2RR9A 3U7DA 1VD2A 3TEXA 2KC2A 5FKAC 3BWUD 2CU3A 3V6CB 1SJHD 2DBYA 3PSEB 3OLMD 1I4PA 3NS1A 2IGHA 3AEAB 4A3OA 4XC2A 4OW0A 4ANWA 1CJEA 1C9FA 3IBEA 3AEGB 1PDXA 3V05A 4WWNA 4YXDB 2LMCA 1JWAD 2FUG1 3UI3A 2M1MA 2KLGA 2O6VA 2J52A 5L83A 4EZLA 5C3JB 3TBLD 1WYWB 3APCA 3X23A 4RNAA 4DDGD
chains in the Genus database with same CATH topology
3IHPC 3UIPB 1WGGA 4WWPA 5CX3A 2KK8A 1YJ1A 2V3SA 4BKSA 3VQIA 5DCNA 5C1ZA 2ZJDA 3R7QA 2NBWB 3S2AA 3A9KB 5D6JB 3WAOA 2EKEC 1I35A 1ISNA 2IO0B 1Q0WB 1VCBA 2N9PC 2W9NA 3KYCD 5AZHA 2JWZA 2KVRA 4TKNA 1HE8A 1RFAA 2KANA 1OEYJ 4G11A 3N3KB 3ZKJC 3CMMB 4WQOB 4A20A 4EEWA 4GOCA 4I6LB 4MDKE 2JVCA 3U8ZA 3ZRCA 2M4NA 4KZ0A 4W9IA 5G55A 2KJHB 2OOBB 4XX5A 3QQ8B 4WJNA 4K7WA 3B0AA 1LXDA 2L3ZA 1OTRB 3DOWA 3M95A 3SU8X 2AEHA 3B1LX 4AJWA 4DHZB 3IG3A 3ML8A 2DYMA 1V49A 1WM2A 3M3JA 1X1MA 5GMVA 2KX0A 2LWPA 3ALBA 3EFUA 1TZ1A 2L0FA 2EMSA 2R2QA 4GMVA 4IG7B 1UH6A 1YIWA 2KC1A 3EHVA 4JLCA 4ASWC 3ZTCA 2LD9A 1IPGA 3AI5A 3PT2B 3D32A 5JHAA 3SDLC 2KFJA 3ZIMA 4DXAB 1FXTB 3LDZE 1E7VA 4GDLB 2ASQA 2DAJA 3A9JB 5CHWA 3PV1A 2NVUI 3Q3FA 2K1FA 4EFOA 5D7GA 1S3SG 1EUVB 2G4DB 1V5TA 2G45B 2LVQA 4J6IA 3EECA 3LJ3A 1SGHA 1UZXB 4GU2A 2KX3A 3HM3A 2NCNA 4F8CB 4AP4C 5KHQA 4JL9A 2O2VA 3ZDTA 4I6PA 4IWPA 2C9WB 1K8RB 2JT4B 1UELA 4FJZA 2KOXA 1H4RA 2KFKA 2O6VD 3DBHI 2G3QB 4FBJB 2DYOA 2KTFA 1Z5SB 1V86A 1ZGUB 2MX2A 4GN1A 3GZNI 4AUQC 2DAFA 2K25A 1C3TA 4ANXA 3WAPA 2JZ3B 4ANVA 2GMIC 2KWUB 3R3MA 4BKSD 4FA6A 1WGRA 1G6JA 4HPLB 3NS8A 2MSED 3V60A 4EKUA 5AZGA 4ICUA 3L54A 1P3QU 4WWOA 3L17A 3QARA 2KWVB 4GDLA 3X0WA 1V81A 3R66C 4F7ZA 1GNUA 3QX1A 4TV3A 4EZKA 2KDEB 3VDZA 2Y5BB 4X57B 2CHXA 2KDIA 3ENEA 4AJYB 3PLVA 1NDDA 2KNBA 4HPMB 4HVBA 3MHSD 4B95A 1E7UA 2J0JA 5KHOA 2FCQA 3C0RB 4EZJA 4MGZE 1KJTA 4ZYNA 3EC8A 4W9DA 3PLUA 1WFYA 3ML9A 3UQBA 5L95C 1WR1A 4DHJD 1SE9A 3DDCB 2R2OA 4MEMA 1KM7A 2KDBA 2KN5A 4RMAA 2BGFA 5JH5C 5DPTA 3NHEB 4LJPB 4W9JA 1WGHA 1OQYA 1TTNA 5DPWA 1WE6A 3UF8A 2CS4A 5IAAC 3VUXA 4JIOU 3DBRI 4NQKE 3ZNID 3JW0X 1CMXB 2JPHA 4E74A 5DPSA 2G4SA 2CR5A 1WM3A 2C7MB 4FHJA 2PJHA 4DHJB 4DWFA 3Q3JA 3K9PB 4IM2A 2ZEQA 5CHVC 1WJNA 4NQLB 2BWES 5BO4B 2J0MA 4NPNA 3PREA 4ICVA 2IY1B 3TMPB 2MLBA 3A33B 3MTNB 1U4AA 3PGEA 4KSLC 3RZFA 1OGWA 2IZVB 4TQ1A 2KLCA 5LLIA 3CSTA 2FCMA 1RAXA 4W9HA 2L76A 2GBMA 4HCNB 3H7SA 3N32A 2FNJB 2MCNB 4MGYE 1ZW7A 4BKTA 4AOFA 3IFWB 3ZNGC 4EOYA 3N30A 3T8MA 2MQJA 4EUTA 1WF9A 3IVFA 3H1UA 4PS3A 5FR6A 4NJ6A 3HHMA 1IP9A 1P0RA 2N9EB 2PE9A 1TBEA 1XT9B 3DBSA 3DVGY 4KIKA 2Z59B 2M8SA 4MGIE 2A4ZA 2FUHB 3WA0A 1Y8RC 2WDTB 4HCPB 1UBQA 3L13A 4IC7B 3BY4B 4MJSA 2M0XA 5J2RA 4RM8A 1UGMA 3WAMA 2DYBA 2O2VB 4FN2A 4GGQA 3VUWA 1UD7A 2KXJA 1WY8A 1RLFA 3B08A 3VFKA 4K81A 4HDQA 2KFKB 3ZW3A 1M94A 2AL3A 2LUEA 2JF5A 2IO3B 3HK0A 4TUUA 4IM0A 4NNJB 2N7EA 4JQWC 1PQSA 2JZZA 3VTUA 4AWJA 1E5WA 1ZKHA 2MBEA 3VAWA 3HIZA 3PRZA 2JXXA 3R7RA 3TCAA 2LXAA 1WMHA 3CF6E 4LJOB 4DHZE 2CHWA 4FADA 1WXSA 3A4SC 5TR5A 1E8XA 4HJKA 3P2BA 5E6NA 3ZTDA 4BBNF 2WX0A 3SHQA 3VTWA 1J0GA 3W1SC 4RM9A 5DPRA 2JRIB 1NBFC 2KMAA 3M62B 4W9GA 2BKFA 2REXA 2NPTA 4MH0E 4DK5A 3ZNHB 1XQQA 2ZCBA 4M8MA 4P7IA 1YD8U 4MSMB 1P1AA 3VH4B 4KSKC 4HWIB 5C23A 4KVGB 2ZZPB 3RYTA 2MBOA 2BYEA 4FJYA 1V9JA 1L7YA 4ZRIA 5CHFA 3TJPA 3VXWA 2KQ7A 4A3PA 5JZEB 2KDFB 1EF5A 1WIAA 2MP2B 2LXCA 4XZ4A 5AEKB 1E8ZA 2C7NB 1GC7A 2WWZA 4LDTB 2IO1B 3L16A 4MSQB 4PYUA 2M17A 4II2B 2CHZA 3H9DA 2K6QA 3BINA 1WX8A 4NY0A 3H7PA 1MG8A 1V80A 3RT3B 2HJ8A 3CSFA 3PZDA 4N9F4 5D2MB 2DZKA 4II3B 2NS5A 3NZUA 2XBBC 2FCSA 2AYOB 4FLHA 4CO7A 3KUDB 2ZCCA 2GBKA 2MWSB 2LZ6A 2BF8B 2N7DA 3GOEA 1KLVA 4G3XB 2PEAA 4NAWA 1EO6A 2KTRB 2LGDA 3L10B 5LXHA 2KWCA 3RZWC 3QHTA 2CU1A 2DHZA 2N1VA 1WRDB 3AU5A 5E6PA 3UQAA 3WIMA 5IA7A 4NJ7A 2JUOA 2UYZB 4KIKB 5LXIB 2DZIA 2CKHB 2V1YA 1V5OA 2C5LC 2MBBB 1GG3A 2MP2A 2LASA 4MJSB 4IWQA 1V2YA 5D94A 3QC8B 2ZPYA 4DDGD 4WJOA 1WE7A 1J8CA 2KKCA 2NBVB 4IUMB 3WALA 4B6WA 4IM3A 4ZDVA 3DVGX 1XD3B 1E8WA 4K7SA 4PYZA 3PRMB 1WJ6A 4GB9A 4W9KA 4BOSC 2KMCA 4GIVA 5EDSA 1GC6A 3TIXA 1T0YA 1LM8B 4HLEA 2ZVNA 2DENB 2LGXA 3JSVA 4M8NA 3SD5A 3WANA 4WJQA 2KJ6A 3KW5B 2YLMA 3A1QA 2RGFA 2LRWA 2KTRA 1WGDA 3A4RA 2JRHA 2IO2B 3JVZX 3ZO5B 2NR2A 1WMHB 2LVPA 1GUAB 3ZNZB 1YX6B 2ZPNA 3PRPB 1P98A 2IY0B 4CYEA 2BYVE 2GOWA 2I1JA 4K1RB 4W9EA 1WH3A 3L08A 1Z2MA 2J0KA 2C60A 2MRPA 2HD5B 3VHTC 3PHWB 4E3CA 2K6DB 3VUYA 2D10A 4K7UA 1D3ZA 2KO3A 1E90A 1WXMA 2NPTB 1P9DU 2NBUA 4GDKA 1UBIA 1WZ3A 3ONSA 3KVFB 5L83A 4B9KA 2FCNA 2I1KA 2XK5A 3O65B 1IYFA 2HTHA 3UGBB 2ZNVC 2BYFA 3UINB 2D3GA 4MGKE 4BBNC 2RSUA 3MJWA 2LJ5A 4BKGA 3KYDD 1TGZB 3W1YA 2JY6A 3X23A 1OEYA 2L8JA 3ZDMC 1WXVA 2A5UA 1EF1A 5AZFA 2DZJA 2MW5A 2AL6A 2HE7A 4WAAA 5HKHA 1Q1OA 4KDLB 3VVWB 2D07B 3OJ3A 4MM3A 1J19A 2FIDA 3W1SA 1WR6E 2XEWA 5J18A 2KJRA 3H7PB 3M63B 3PPAA 5E6OA 3QA8A 3H6NA 4G0NB 4F1SA 3TL5A 2FAZA 3NY5A 3RUIB 3V6EB 2LI5A 1I42A 4TQ0A 2KD0A 4FULA 1WJ4A 2UWQA 3UIOB 3V61A 1RRBA 2FIFA 2WYQA 2BKRB 2MA9B 2MBQA 2N9XA 2B3AA 4KZCA 4PS7A 4URKA 4NAWB 1WJUA 4LCDE 3DBLI 3A9KA 1L2NA 4LDTD 1QZEA 3PTFC 1AARA 3OJ4B 4IWOA 4OVUA 3QAQA 4OVVA 5G2NA 2N1WA 2L00B 3KH0A 2GBRA 2IYDB 2RD0A 1H8CA 4W9LA 1E8YA 4CHKA 3QJZA 1A5RA 3ZUNA 3PS6A 3U30A 2V4LA 4ZRJA 4FJVB 2Z0DB 2BWFA 4MELA 2GBNA 1WX9A 4BVUC 3PVLA 2L05A 3NZSA 1JRUA 1KOTA 2ZVOA 3PHXB 1LFDA 3DVNU 1YQBA 1F9JA 4W9FA 2DX5B 4KDIC 4DDID 3T9LA 1NI2A 2GBJA 1YX5B 1LQBA 2PE6B 2K8CA 1V6EA 3ZVVA 4IW0A 3DPDA 4WJPA 3RD2A 2KQSA 3DVNV 3HM6X 4PS8A 3VTVA 4HDOA 3JSVB 1WGYA 4BOZB 1Q5WB 5J17A 2EMTA 2D11A 3QIJA 5CTRC 2QHOA 1R4MI 2VRRB 2YVCA 3OAWA 2LGYA 3A1QB 3V62A 2IBIB 3I3TB 4ANUA 4GXBA 4KV2A 4YL8A 3ZLZA 2RR9A 3KUZA 3DQVA 2C7HA 3U7DA 3NOBA 2O6VB 3APFA 1VD2A 3A9JA 4DBGA 2KC2A 3JYUA 4GSWA 2L0TA 2AWTA 3L0WB 3ECIA 2N4FA 2Z0EB 4HXDA 3RCZA 1WXAA 3V6CB 2ZNVB 2MBHA 2L7RA 4GDKB 3ZRFA 4ZRKA 2BPSA 2KZRA 1GJZA 3PSEB 3QK0A 2K39A 2XK5B 2J7QB 3OLMD 2OJRA 3VH3B 1S1QB 2K8BA 4JGHB 4BFRA 4A3OA 4XC2A 3RULA 3AULA 4ANWA 2K8HA 3K9OB 3IBEA 2KHWB 4M0WB 1BT0A 1SIFA 1WI0A 2LVOA 2WX1A 4WWNA 2LRUA 3QCAA 1R4NI 1WX7A 3QWZB 4E71A 1C1YB 4HK2A 2M1MA 2D2QA 2PPHA 2KLGA 2O6VA 3KUCB 4I6NB 3AXCA 5JHBA 3APDA 3DCGA 2DZMA 4EZLA 3AU4A 1WYWB 3APCA 4G50A 4FHKA 3TBLD 4W9CA 2RPQA 1WZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IHP C;  3UIP B;  1WGG A;  4WWP A;  5CX3 A;  2KK8 A;  1YJ1 A;  2V3S A;  4BKS A;  3VQI A;  5DCN A;  5C1Z A;  2ZJD A;  3R7Q A;  2NBW B;  3S2A A;  3A9K B;  5D6J B;  3WAO A;  2EKE C;  1I35 A;  1ISN A;  2IO0 B;  1Q0W B;  1VCB A;  2N9P C;  2W9N A;  3KYC D;  5AZH A;  2JWZ A;  2KVR A;  4TKN A;  1HE8 A;  1RFA A;  2KAN A;  1OEY J;  4G11 A;  3N3K B;  3ZKJ C;  3CMM B;  4WQO B;  4A20 A;  4EEW A;  4GOC A;  4I6L B;  4MDK E;  2JVC A;  3U8Z A;  3ZRC A;  2M4N A;  4KZ0 A;  4W9I A;  5G55 A;  2KJH B;  2OOB B;  4XX5 A;  3QQ8 B;  4WJN A;  4K7W A;  3B0A A;  1LXD A;  2L3Z A;  1OTR B;  3DOW A;  3M95 A;  3SU8 X;  2AEH A;  3B1L X;  4AJW A;  4DHZ B;  3IG3 A;  3ML8 A;  2DYM A;  1V49 A;  1WM2 A;  3M3J A;  1X1M A;  5GMV A;  2KX0 A;  2LWP A;  3ALB A;  3EFU A;  1TZ1 A;  2L0F A;  2EMS A;  2R2Q A;  4GMV A;  4IG7 B;  1UH6 A;  1YIW A;  2KC1 A;  3EHV A;  4JLC A;  4ASW C;  3ZTC A;  2LD9 A;  1IPG A;  3AI5 A;  3PT2 B;  3D32 A;  5JHA A;  3SDL C;  2KFJ A;  3ZIM A;  4DXA B;  1FXT B;  3LDZ E;  1E7V A;  4GDL B;  2ASQ A;  2DAJ A;  3A9J B;  5CHW A;  3PV1 A;  2NVU I;  3Q3F A;  2K1F A;  4EFO A;  5D7G A;  1S3S G;  1EUV B;  2G4D B;  1V5T A;  2G45 B;  2LVQ A;  4J6I A;  3EEC A;  3LJ3 A;  1SGH A;  1UZX B;  4GU2 A;  2KX3 A;  3HM3 A;  2NCN A;  4F8C B;  4AP4 C;  5KHQ A;  4JL9 A;  2O2V A;  3ZDT A;  4I6P A;  4IWP A;  2C9W B;  1K8R B;  2JT4 B;  1UEL A;  4FJZ A;  2KOX A;  1H4R A;  2KFK A;  2O6V D;  3DBH I;  2G3Q B;  4FBJ B;  2DYO A;  2KTF A;  1Z5S B;  1V86 A;  1ZGU B;  2MX2 A;  4GN1 A;  3GZN I;  4AUQ C;  2DAF A;  2K25 A;  1C3T A;  4ANX A;  3WAP A;  2JZ3 B;  4ANV A;  2GMI C;  2KWU B;  3R3M A;  4BKS D;  4FA6 A;  1WGR A;  1G6J A;  4HPL B;  3NS8 A;  2MSE D;  3V60 A;  4EKU A;  5AZG A;  4ICU A;  3L54 A;  1P3Q U;  4WWO A;  3L17 A;  3QAR A;  2KWV B;  4GDL A;  3X0W A;  1V81 A;  3R66 C;  4F7Z A;  1GNU A;  3QX1 A;  4TV3 A;  4EZK A;  2KDE B;  3VDZ A;  2Y5B B;  4X57 B;  2CHX A;  2KDI A;  3ENE A;  4AJY B;  3PLV A;  1NDD A;  2KNB A;  4HPM B;  4HVB A;  3MHS D;  4B95 A;  1E7U A;  2J0J A;  5KHO A;  2FCQ A;  3C0R B;  4EZJ A;  4MGZ E;  1KJT A;  4ZYN A;  3EC8 A;  4W9D A;  3PLU A;  1WFY A;  3ML9 A;  3UQB A;  5L95 C;  1WR1 A;  4DHJ D;  1SE9 A;  3DDC B;  2R2O A;  4MEM A;  1KM7 A;  2KDB A;  2KN5 A;  4RMA A;  2BGF A;  5JH5 C;  5DPT A;  3NHE B;  4LJP B;  4W9J A;  1WGH A;  1OQY A;  1TTN A;  5DPW A;  1WE6 A;  3UF8 A;  2CS4 A;  5IAA C;  3VUX A;  4JIO U;  3DBR I;  4NQK E;  3ZNI D;  3JW0 X;  1CMX B;  2JPH A;  4E74 A;  5DPS A;  2G4S A;  2CR5 A;  1WM3 A;  2C7M B;  4FHJ A;  2PJH A;  4DHJ B;  4DWF A;  3Q3J A;  3K9P B;  4IM2 A;  2ZEQ A;  5CHV C;  1WJN A;  4NQL B;  2BWE S;  5BO4 B;  2J0M A;  4NPN A;  3PRE A;  4ICV A;  2IY1 B;  3TMP B;  2MLB A;  3A33 B;  3MTN B;  1U4A A;  3PGE A;  4KSL C;  3RZF A;  1OGW A;  2IZV B;  4TQ1 A;  2KLC A;  5LLI A;  3CST A;  2FCM A;  1RAX A;  4W9H A;  2L76 A;  2GBM A;  4HCN B;  3H7S A;  3N32 A;  2FNJ B;  2MCN B;  4MGY E;  1ZW7 A;  4BKT A;  4AOF A;  3IFW B;  3ZNG C;  4EOY A;  3N30 A;  3T8M A;  2MQJ A;  4EUT A;  1WF9 A;  3IVF A;  3H1U A;  4PS3 A;  5FR6 A;  4NJ6 A;  3HHM A;  1IP9 A;  1P0R A;  2N9E B;  2PE9 A;  1TBE A;  1XT9 B;  3DBS A;  3DVG Y;  4KIK A;  2Z59 B;  2M8S A;  4MGI E;  2A4Z A;  2FUH B;  3WA0 A;  1Y8R C;  2WDT B;  4HCP B;  1UBQ A;  3L13 A;  4IC7 B;  3BY4 B;  4MJS A;  2M0X A;  5J2R A;  4RM8 A;  1UGM A;  3WAM A;  2DYB A;  2O2V B;  4FN2 A;  4GGQ A;  3VUW A;  1UD7 A;  2KXJ A;  1WY8 A;  1RLF A;  3B08 A;  3VFK A;  4K81 A;  4HDQ A;  2KFK B;  3ZW3 A;  1M94 A;  2AL3 A;  2LUE A;  2JF5 A;  2IO3 B;  3HK0 A;  4TUU A;  4IM0 A;  4NNJ B;  2N7E A;  4JQW C;  1PQS A;  2JZZ A;  3VTU A;  4AWJ A;  1E5W A;  1ZKH A;  2MBE A;  3VAW A;  3HIZ A;  3PRZ A;  2JXX A;  3R7R A;  3TCA A;  2LXA A;  1WMH A;  3CF6 E;  4LJO B;  4DHZ E;  2CHW A;  4FAD A;  1WXS A;  3A4S C;  5TR5 A;  1E8X A;  4HJK A;  3P2B A;  5E6N A;  3ZTD A;  4BBN F;  2WX0 A;  3SHQ A;  3VTW A;  1J0G A;  3W1S C;  4RM9 A;  5DPR A;  2JRI B;  1NBF C;  2KMA A;  3M62 B;  4W9G A;  2BKF A;  2REX A;  2NPT A;  4MH0 E;  4DK5 A;  3ZNH B;  1XQQ A;  2ZCB A;  4M8M A;  4P7I A;  1YD8 U;  4MSM B;  1P1A A;  3VH4 B;  4KSK C;  4HWI B;  5C23 A;  4KVG B;  2ZZP B;  3RYT A;  2MBO A;  2BYE A;  4FJY A;  1V9J A;  1L7Y A;  4ZRI A;  5CHF A;  3TJP A;  3VXW A;  2KQ7 A;  4A3P A;  5JZE B;  2KDF B;  1EF5 A;  1WIA A;  2MP2 B;  2LXC A;  4XZ4 A;  5AEK B;  1E8Z A;  2C7N B;  1GC7 A;  2WWZ A;  4LDT B;  2IO1 B;  3L16 A;  4MSQ B;  4PYU A;  2M17 A;  4II2 B;  2CHZ A;  3H9D A;  2K6Q A;  3BIN A;  1WX8 A;  4NY0 A;  3H7P A;  1MG8 A;  1V80 A;  3RT3 B;  2HJ8 A;  3CSF A;  3PZD A;  4N9F 4;  5D2M B;  2DZK A;  4II3 B;  2NS5 A;  3NZU A;  2XBB C;  2FCS A;  2AYO B;  4FLH A;  4CO7 A;  3KUD B;  2ZCC A;  2GBK A;  2MWS B;  2LZ6 A;  2BF8 B;  2N7D A;  3GOE A;  1KLV A;  4G3X B;  2PEA A;  4NAW A;  1EO6 A;  2KTR B;  2LGD A;  3L10 B;  5LXH A;  2KWC A;  3RZW C;  3QHT A;  2CU1 A;  2DHZ A;  2N1V A;  1WRD B;  3AU5 A;  5E6P A;  3UQA A;  3WIM A;  5IA7 A;  4NJ7 A;  2JUO A;  2UYZ B;  4KIK B;  5LXI B;  2DZI A;  2CKH B;  2V1Y A;  1V5O A;  2C5L C;  2MBB B;  1GG3 A;  2MP2 A;  2LAS A;  4MJS B;  4IWQ A;  1V2Y A;  5D94 A;  3QC8 B;  2ZPY A;  4DDG D;  4WJO A;  1WE7 A;  1J8C A;  2KKC A;  2NBV B;  4IUM B;  3WAL A;  4B6W A;  4IM3 A;  4ZDV A;  3DVG X;  1XD3 B;  1E8W A;  4K7S A;  4PYZ A;  3PRM B;  1WJ6 A;  4GB9 A;  4W9K A;  4BOS C;  2KMC A;  4GIV A;  5EDS A;  1GC6 A;  3TIX A;  1T0Y A;  1LM8 B;  4HLE A;  2ZVN A;  2DEN B;  2LGX A;  3JSV A;  4M8N A;  3SD5 A;  3WAN A;  4WJQ A;  2KJ6 A;  3KW5 B;  2YLM A;  3A1Q A;  2RGF A;  2LRW A;  2KTR A;  1WGD A;  3A4R A;  2JRH A;  2IO2 B;  3JVZ X;  3ZO5 B;  2NR2 A;  1WMH B;  2LVP A;  1GUA B;  3ZNZ B;  1YX6 B;  2ZPN A;  3PRP B;  1P98 A;  2IY0 B;  4CYE A;  2BYV E;  2GOW A;  2I1J A;  4K1R B;  4W9E A;  1WH3 A;  3L08 A;  1Z2M A;  2J0K A;  2C60 A;  2MRP A;  2HD5 B;  3VHT C;  3PHW B;  4E3C A;  2K6D B;  3VUY A;  2D10 A;  4K7U A;  1D3Z A;  2KO3 A;  1E90 A;  1WXM A;  2NPT B;  1P9D U;  2NBU A;  4GDK A;  1UBI A;  1WZ3 A;  3ONS A;  3KVF B;  5L83 A;  4B9K A;  2FCN A;  2I1K A;  2XK5 A;  3O65 B;  1IYF A;  2HTH A;  3UGB B;  2ZNV C;  2BYF A;  3UIN B;  2D3G A;  4MGK E;  4BBN C;  2RSU A;  3MJW A;  2LJ5 A;  4BKG A;  3KYD D;  1TGZ B;  3W1Y A;  2JY6 A;  3X23 A;  1OEY A;  2L8J A;  3ZDM C;  1WXV A;  2A5U A;  1EF1 A;  5AZF A;  2DZJ A;  2MW5 A;  2AL6 A;  2HE7 A;  4WAA A;  5HKH A;  1Q1O A;  4KDL B;  3VVW B;  2D07 B;  3OJ3 A;  4MM3 A;  1J19 A;  2FID A;  3W1S A;  1WR6 E;  2XEW A;  5J18 A;  2KJR A;  3H7P B;  3M63 B;  3PPA A;  5E6O A;  3QA8 A;  3H6N A;  4G0N B;  4F1S A;  3TL5 A;  2FAZ A;  3NY5 A;  3RUI B;  3V6E B;  2LI5 A;  1I42 A;  4TQ0 A;  2KD0 A;  4FUL A;  1WJ4 A;  2UWQ A;  3UIO B;  3V61 A;  1RRB A;  2FIF A;  2WYQ A;  2BKR B;  2MA9 B;  2MBQ A;  2N9X A;  2B3A A;  4KZC A;  4PS7 A;  4URK A;  4NAW B;  1WJU A;  4LCD E;  3DBL I;  3A9K A;  1L2N A;  4LDT D;  1QZE A;  3PTF C;  1AAR A;  3OJ4 B;  4IWO A;  4OVU A;  3QAQ A;  4OVV A;  5G2N A;  2N1W A;  2L00 B;  3KH0 A;  2GBR A;  2IYD B;  2RD0 A;  1H8C A;  4W9L A;  1E8Y A;  4CHK A;  3QJZ A;  1A5R A;  3ZUN A;  3PS6 A;  3U30 A;  2V4L A;  4ZRJ A;  4FJV B;  2Z0D B;  2BWF A;  4MEL A;  2GBN A;  1WX9 A;  4BVU C;  3PVL A;  2L05 A;  3NZS A;  1JRU A;  1KOT A;  2ZVO A;  3PHX B;  1LFD A;  3DVN U;  1YQB A;  1F9J A;  4W9F A;  2DX5 B;  4KDI C;  4DDI D;  3T9L A;  1NI2 A;  2GBJ A;  1YX5 B;  1LQB A;  2PE6 B;  2K8C A;  1V6E A;  3ZVV A;  4IW0 A;  3DPD A;  4WJP A;  3RD2 A;  2KQS A;  3DVN V;  3HM6 X;  4PS8 A;  3VTV A;  4HDO A;  3JSV B;  1WGY A;  4BOZ B;  1Q5W B;  5J17 A;  2EMT A;  2D11 A;  3QIJ A;  5CTR C;  2QHO A;  1R4M I;  2VRR B;  2YVC A;  3OAW A;  2LGY A;  3A1Q B;  3V62 A;  2IBI B;  3I3T B;  4ANU A;  4GXB A;  4KV2 A;  4YL8 A;  3ZLZ A;  2RR9 A;  3KUZ A;  3DQV A;  2C7H A;  3U7D A;  3NOB A;  2O6V B;  3APF A;  1VD2 A;  3A9J A;  4DBG A;  2KC2 A;  3JYU A;  4GSW A;  2L0T A;  2AWT A;  3L0W B;  3ECI A;  2N4F A;  2Z0E B;  4HXD A;  3RCZ A;  1WXA A;  3V6C B;  2ZNV B;  2MBH A;  2L7R A;  4GDK B;  3ZRF A;  4ZRK A;  2BPS A;  2KZR A;  1GJZ A;  3PSE B;  3QK0 A;  2K39 A;  2XK5 B;  2J7Q B;  3OLM D;  2OJR A;  3VH3 B;  1S1Q B;  2K8B A;  4JGH B;  4BFR A;  4A3O A;  4XC2 A;  3RUL A;  3AUL A;  4ANW A;  2K8H A;  3K9O B;  3IBE A;  2KHW B;  4M0W B;  1BT0 A;  1SIF A;  1WI0 A;  2LVO A;  2WX1 A;  4WWN A;  2LRU A;  3QCA A;  1R4N I;  1WX7 A;  3QWZ B;  4E71 A;  1C1Y B;  4HK2 A;  2M1M A;  2D2Q A;  2PPH A;  2KLG A;  2O6V A;  3KUC B;  4I6N B;  3AXC A;  5JHB A;  3APD A;  3DCG A;  2DZM A;  4EZL A;  3AU4 A;  1WYW B;  3APC A;  4G50 A;  4FHK A;  3TBL D;  4W9C A;  2RPQ A;  1WZ0 A; 
#chains in the Genus database with same CATH topology
 1WGG A;  1OFF A;  1YJ1 A;  1R7S A;  2V3S A;  3H8H A;  5DCN A;  5BMI A;  1K53 A;  1XLQ A;  3W2D A;  3S2A A;  1XO3 A;  3A9K B;  1ISN A;  2W9N A;  5AZH A;  1I4G A;  4TKN A;  1YJI A;  2KAN A;  1OEY J;  3ZKJ C;  4WQO B;  4GOC A;  5BYQ A;  2M4N A;  2Z8L A;  1PGB A;  1QOF A;  4WJN A;  5HFY A;  4K7W A;  3B0A A;  2L3Z A;  2ZW0 A;  3DOW A;  1WXQ A;  3SU8 X;  2AEH A;  2RPV A;  4AJW A;  3EA6 A;  4WQM A;  3ML8 A;  1X1M A;  5GMV A;  3EFU A;  1JWB D;  2PW9 A;  2L0F A;  1SE2 A;  3DWG C;  4GLS C;  1YIW A;  2KC1 A;  4RGO S;  2KFJ A;  1E7V A;  3NZ3 A;  4ZRP A;  1WRI A;  2DAJ A;  3PV1 A;  3VRA B;  2NVU I;  5D3D A;  2V3P A;  4EFO A;  1S3S G;  1KLG D;  1EUV B;  1TY0 A;  3EEC A;  1KTK A;  1SSN A;  1TKG A;  2KX3 A;  4P6V F;  3CWI A;  4AP4 C;  2H88 B;  1QIL A;  1WWT A;  4IWP A;  2Y5C A;  1H4R A;  2G3Q B;  2DYO A;  1Z5S B;  3DBL B;  2W55 A;  4AUQ C;  2DAF A;  4KX6 B;  3AE3 B;  3WAP A;  1T0S C;  4ANV A;  3R3M A;  4FA6 A;  1WGR A;  4HPL B;  1NVI D;  3V60 A;  4ICU A;  4TV3 A;  4EZK A;  3Q69 A;  3I57 A;  3VDZ A;  4X57 B;  2CHX A;  1DOX A;  1SEB D;  1E7U A;  2J0J A;  1EU4 A;  4EZJ A;  4MGZ E;  1KJT A;  1PGX A;  3J9C A;  1AYF A;  3W5V B;  4XWW A;  4DHJ D;  3DDC B;  2L52 A;  2AQ2 B;  2KN5 A;  5JH5 C;  1WGH A;  3EUB 2;  1OQY A;  1TTN A;  1WE6 A;  5IAA C;  3VUX A;  3DBR I;  1D5X C;  2JPH A;  4AQ7 A;  2PJH A;  1MVK A;  5BO4 B;  2J0M A;  4NPN A;  2M19 A;  4OHJ A;  2SAK A;  2MLB A;  4O1N A;  1V8C A;  2AQ3 B;  3P63 A;  5LLI A;  2FCM A;  4IOI E;  2GBM A;  4HCN B;  3H7S A;  4HPP A;  4MGY E;  1ZW7 A;  3P4P B;  3IFW B;  3DBR B;  1SF0 A;  4M01 A;  5I4D A;  4PS3 A;  4NJ6 A;  1IP9 A;  1F2R I;  1XT9 B;  3DBS A;  2M8S A;  4L2Y A;  2O2V B;  3VUW A;  1QF6 A;  3AB5 A;  1WY8 A;  1PUT A;  2FBW B;  2MEK A;  1C76 A;  4TUU A;  1HXY D;  2BBC A;  1E5W A;  1C78 A;  2MBE A;  1MJD A;  4HJG E;  3VAW A;  3PRZ A;  3AE2 B;  3MP9 A;  1WMH A;  3CF6 E;  4DHZ E;  4J3O D;  1I4Q A;  1N62 A;  2WX0 A;  4B0M A;  2MJD A;  4P16 A;  4RGN A;  1GPX A;  4L1B A;  1B1Z A;  4MH0 E;  3ZNH B;  3RMK C;  1P1A A;  3VH4 B;  4KVG B;  1I4H A;  1N61 A;  1L7Y A;  4ZRI A;  4A3P A;  4RFB A;  2KQ4 X;  1EF5 A;  1E8Z A;  2C7N B;  1GC7 A;  4LDT B;  1NYQ A;  2IO1 B;  3L16 A;  4II2 B;  1TYG B;  1FRD A;  3I63 C;  3H7P A;  1V80 A;  4N9F 4;  5D2M B;  3NZU A;  2XBB C;  4FLH A;  3DBH B;  3DHI C;  2BF8 B;  3Q8C A;  1MHH E;  2KTR B;  5LXH A;  2KWC A;  3RZW C;  2DHZ A;  3U52 E;  1Q10 A;  4NJ7 A;  3ZYY X;  4KIK B;  4OZB A;  3P42 A;  1HQR D;  5GXG B;  1MG4 A;  1QOA A;  2KYW A;  2V1Y A;  5IP4 D;  2WXN A;  2K22 A;  4MJS B;  1GG3 A;  1V2Y A;  2ZPY A;  4WJO A;  1J8C A;  1GB4 A;  4B6W A;  1XD3 B;  1TT5 B;  2BQQ A;  2Q5W D;  4C4V A;  3ZJV A;  2MHJ A;  1T0Y A;  1LM8 B;  5IKC M;  2WU5 B;  1F1H A;  2YLM A;  3Q8E A;  1WGD A;  3FKY A;  3PRP B;  4CYE A;  1P98 A;  2IY0 B;  1WH3 A;  1Z2M A;  2C60 A;  1QKZ A;  3Q2A C;  4K7U A;  1GOZ A;  2L32 A;  2NPT B;  3BK1 A;  1WZ3 A;  2I1K A;  2LHE A;  3O65 B;  1BUI C;  1HTO A;  1T6B X;  4MGK E;  4USA A;  2JY6 A;  2L8J A;  2RDG A;  1EF1 A;  2B76 B;  2GRI A;  3T3N A;  1TKE A;  4MM3 A;  2FID A;  2XEW A;  4IDI A;  2KJR A;  5J18 A;  3PPA A;  1T5X D;  1HZ6 A;  4F1S A;  2FAZ A;  3V6E B;  1I42 A;  2LI5 A;  3MJ5 A;  2KD0 A;  3GE3 C;  3KLS X;  4FUL A;  3UIO B;  5EE9 A;  2BKR B;  2MA9 B;  4URK A;  1WJU A;  1L2N A;  3A9K A;  1FCL A;  1QZE A;  1SB3 C;  3OJ4 B;  4OVV A;  4RGM A;  2L00 B;  1YN3 A;  1SE4 A;  2IYD B;  2RD0 A;  1SIJ A;  1E8Y A;  3KQ4 A;  1A5R A;  2Z0D B;  3PVL A;  1JRU A;  3PHX B;  1LFD A;  4JE3 B;  5HI1 A;  2HDE A;  3P4R B;  4LNO A;  3NRZ A;  3Q14 C;  4TSS A;  2GBJ A;  4WJP A;  2K5P A;  1UWX A;  3RD2 A;  4BZA A;  3VTV A;  2QJL A;  5J17 A;  5CTR C;  2YVC A;  3I3T B;  2QMT A;  4YL8 A;  1HTQ A;  3NOB A;  4GSW A;  3ECI A;  2N4F A;  3TUO A;  3RCZ A;  4ZOH C;  1WXA A;  2ZNV B;  2MBH A;  2L7R A;  4GDK B;  2BW2 A;  2KZR A;  3QK0 A;  3VH3 B;  1JWM D;  1S1Q B;  3RUL A;  3B9J A;  3AUL A;  4ITK A;  2K8H A;  3EFC A;  2RDB C;  1D6E C;  3DHH C;  2LVO A;  3QCA A;  1R4N I;  1WX7 A;  3QWZ B;  2MH7 A;  1TZO A;  1RWS A;  2PPH A;  4I6N B;  1ZP0 B;  5JHB A;  2DZM A;  4ZDV A;  4FHK A;  2RPQ A;  3ZJU A;  2J42 A;  3IHP C;  3UIP B;  5CX3 A;  2M0A A;  2JQR B;  4YT0 B;  3R7Q A;  1Y56 A;  3WAO A;  3KYC D;  3N1Z C;  1HE8 A;  4G11 A;  3N3K B;  4EEW A;  4A20 A;  4I6L B;  4MDK E;  2BS2 B;  3U8Z A;  1TS2 A;  3QQ8 B;  4KGS A;  2PKO A;  1LXD A;  1NYR A;  4LTU A;  5FK9 C;  1OTR B;  3M95 A;  1J7A A;  3B1L X;  3TEW A;  3IG3 A;  3BYT B;  2NMQ A;  2JWU A;  2LJI A;  1HZ5 A;  2LGS A;  3SFD B;  2DWQ A;  2L1A A;  4IG7 B;  1UH6 A;  2YEP B;  4XDC A;  1NEK B;  4FXC A;  1IPG A;  4YTN B;  4DXA B;  1FXT B;  3LDZ E;  4AS1 A;  1V1P B;  3A9J B;  5CHW A;  4A9A A;  2K1F A;  5D7G A;  2G45 B;  4J6I A;  1SGH A;  4GU2 A;  2I38 A;  2KAC A;  2O2V A;  2C9W B;  1K8R B;  3LYY A;  1UEL A;  4DXG A;  2O6V D;  3RNE C;  1C3T A;  2K25 A;  2PVG C;  5D3I B;  4XGA B;  2QEJ C;  5EE3 A;  1VZ6 A;  4YSZ B;  2IND C;  2MJ3 A;  3NS8 A;  5AZG A;  4GDL A;  4F7Z A;  3X0W A;  1V81 A;  1GNU A;  3QX1 A;  2KDE B;  2D5G A;  2PTL A;  4S17 A;  2Y5B B;  1NDD A;  4HPM B;  4HVB A;  3MHS D;  4ZYN A;  1PYW D;  4W9D A;  3O13 A;  3PLU A;  2OJW A;  5L95 C;  3UQB A;  1WR1 A;  2R2O A;  4MEM A;  3WCQ A;  2BGF A;  5DPT A;  1FPY A;  4LJP B;  1R4M B;  4C80 A;  4PT5 A;  2K9X A;  4ZRQ A;  4JIO U;  4KGT A;  4NQK E;  3JW0 X;  2WS3 B;  2CR5 A;  2C7M B;  3ZXR A;  4DWF A;  2BB5 A;  3Q3J A;  1E7P B;  3K9P B;  2WXG A;  5CHV C;  4NQL B;  2CJN A;  3PRE A;  2WU2 B;  1WGK A;  3A33 B;  3MTN B;  1U4A A;  1OGW A;  1C4P A;  3U7Z A;  1D4B A;  4W9H A;  2L76 A;  2MCN B;  2FNJ B;  1XXG A;  1VLB A;  2IJ0 A;  3N30 A;  3SR6 A;  5FR6 A;  1I7H A;  4C7Y A;  4KIK A;  2PE9 A;  3DVG Y;  1IGD A;  2FUH B;  3WA0 A;  1CK1 A;  1UBQ A;  4MJS A;  5J2R A;  4HKZ E;  4RM8 A;  2DYB A;  5G5G A;  4GGQ A;  1UD7 A;  3ZJT A;  3GB1 A;  1RLF A;  2KFK B;  2LUE A;  3HK0 A;  1P7F A;  5IO9 A;  4JQW C;  3L4P A;  3C19 A;  1EWC A;  2JZZ A;  4MT5 A;  2R61 A;  1ZKH A;  3AE9 B;  4IKG A;  2LXA A;  4FAD A;  1VZ7 A;  2CHW A;  2G1E A;  2KAJ A;  3V3X A;  2WXP A;  1E8X A;  4BBN F;  2KWD A;  1J0G A;  3W1S C;  4RM9 A;  2KMA A;  2NPT A;  4DK5 A;  5E6J A;  3SEB A;  1SBB B;  1YD8 U;  3RYT A;  1FRR A;  3TJP A;  2K3U A;  2KQ7 A;  3AEF B;  5JZE B;  2KDF B;  1WIA A;  2BVC A;  4XZ4 A;  5AEK B;  2WWZ A;  3ZGZ A;  1ENF A;  2K6Q A;  2KT7 A;  1WX8 A;  5BYR A;  2HJ8 A;  5T8I A;  2DZK A;  2FCS A;  2OED A;  2N7D A;  3RPF C;  1JML A;  4G3X B;  2WGS A;  2CU1 A;  2MJE A;  3WIM A;  3AE8 B;  2JSV X;  1VR9 A;  5LXI B;  2E6X A;  1SJE D;  2MP2 A;  1MPE A;  1YN4 A;  2IGD A;  1N5X A;  5D94 A;  1N5W A;  2HJ1 A;  4IM3 A;  3DVG X;  4K7S A;  2JZP A;  1E10 A;  3FC4 A;  4BOS C;  2KMC A;  4GIV A;  4K3B A;  1VRA B;  2ZVN A;  1ZXI A;  2DEN B;  3SD5 A;  4WJQ A;  2RGF A;  3Q8F A;  3BYY B;  3A4R A;  3P4S B;  3VR9 B;  3DHG C;  2BYV E;  3Q8A A;  2WNM A;  3VHT C;  3PHW B;  2K6D B;  2Y3A A;  3VUY A;  2PLP A;  4RCO A;  1AN8 A;  1D3Z A;  2NBU A;  4GDK A;  1UGJ A;  3ONS A;  2AQ1 B;  2HTH A;  1B9R A;  4N58 A;  2ZNV C;  3RNA C;  4BBN C;  2RSU A;  4BKG A;  1RYJ A;  1TGZ B;  3W1Y A;  1FD6 A;  1OEY A;  3ZDM C;  3RNF C;  2DLB A;  4WAA A;  1Q1O A;  3OJ3 A;  1J19 A;  4RF1 A;  2JU6 X;  2VZK B;  4LNF A;  1QQR A;  3M63 B;  3MHZ A;  3QA8 A;  4M00 A;  3E56 A;  4JX1 C;  3RUI B;  2W54 A;  2SEB D;  1M4V A;  1WJ4 A;  1RRB A;  1XF5 L;  2FIF A;  2MBQ A;  2N9X A;  2B3A A;  4NAW B;  4LCD E;  3AED B;  1AAR A;  3AEB B;  4IWO A;  4OVU A;  3R2I A;  3QAQ A;  3KH0 A;  3R8B A;  2GBR A;  4N59 A;  3PS6 A;  1WX9 A;  1NEN B;  1UNS A;  3N1Y C;  1KOT A;  1RFK A;  3DVN U;  1YQB A;  4R3D A;  3GE8 C;  1BXT A;  1F9J A;  1JWS D;  2DX5 B;  4KDI C;  4HRO A;  1YMH E;  2K8C A;  4A8X C;  1WSP A;  3ZVV A;  3DVN V;  3HM6 X;  3QIJ A;  3V62 A;  3OAW A;  2IBI B;  4ARC A;  4GXB A;  3ZLZ A;  1TKY A;  3DQV A;  2C7H A;  1QT9 A;  1V1P A;  1XCQ L;  2O6V B;  3A9J A;  4DBG A;  3JYU A;  2WXF A;  2AWT A;  3L0W B;  2Z0E B;  1DGJ A;  2N7J A;  4HXD A;  3ZRF A;  4ZRK A;  1UUP A;  1GJZ A;  4JPS A;  2K39 A;  2J7Q B;  4C7Z A;  2OJR A;  2ACZ B;  4QAY A;  1JCK B;  2K8B A;  4JGH B;  3AE5 B;  3PZ8 A;  2BYT A;  3K9O B;  2KHW B;  4M0W B;  3OG5 A;  4JWU C;  1SIF A;  2WX1 A;  1FXA A;  2LRU A;  1OQQ A;  2BT6 A;  4E71 A;  1D5Z C;  3Q8B A;  2D2Q A;  3BZD B;  3APD A;  3DCG A;  4G50 A;  4EE2 A;  2KK8 A;  4BKS A;  1C77 A;  3NVW A;  2NBW B;  5D6J B;  2EKE C;  2N9P C;  1L6V A;  2RMM A;  4XWT A;  2JWZ A;  5FR3 A;  5G55 A;  1P7E A;  2WDQ B;  4XX5 A;  2IPK D;  2WXI A;  4K3C A;  1FNV A;  4S0R A;  1WM2 A;  2KX0 A;  3ALB A;  1FXI A;  1TZ1 A;  2EMS A;  3EHV A;  4JLC A;  3ZTC A;  2LD9 A;  3AI5 A;  2WXH A;  3ZIM A;  3SFE B;  3AV8 A;  5MPO A;  2G4D B;  2NTS A;  2RDH A;  1V1O A;  3LJ3 A;  1UZX B;  2XNA C;  2NCN A;  1ZPS A;  4I6P A;  2JT4 B;  2KOX A;  2KFK A;  4ZHO A;  2PVO D;  4FBJ B;  2KTF A;  1UWM A;  4ZHP A;  3GZN I;  4ANX A;  1L0V B;  2TSS A;  4Q2J A;  2GMI C;  2KWU B;  4NJC A;  1YN5 A;  2J53 A;  1G6J A;  4WWO A;  1FEH A;  3L17 A;  1CZP A;  3QAR A;  2IGG A;  3R66 C;  2LEK A;  5BMG A;  2W82 A;  2KDI A;  2ONQ A;  1YJJ A;  1STE A;  2WXK A;  3AH7 A;  2KNB A;  3T3O A;  1ESF A;  2FCQ A;  1T0Q C;  3FAH A;  3C0R B;  3AE4 B;  3NVV A;  1WFY A;  3ML9 A;  4HRS A;  1SE9 A;  4PK1 A;  5BYS A;  2KDB A;  3B2F A;  3NHE B;  4A55 A;  4W9J A;  1TY2 A;  5TSS A;  1ZUD 2;  1GAQ B;  3AEC B;  5DPW A;  2CS4 A;  3ZNI D;  5DPS A;  2G4S A;  4DHJ B;  4NAM A;  1XLO A;  2GLS A;  2ZEQ A;  4N6E B;  3RNB C;  2ON8 A;  3Q6B A;  2INN E;  4ICV A;  2IY1 B;  3RZF A;  3KWL A;  4TQ1 A;  2GB1 A;  1RAX A;  3N32 A;  4LLG M;  4BKT A;  4AOF A;  3Q3M C;  3ZNG C;  4EOY A;  3PO0 A;  3T8M A;  2KMM A;  2MQJ A;  1R4N B;  1WF9 A;  3IVF A;  3H1U A;  2D3A A;  2XN9 C;  3HHM A;  4OZC A;  4C00 A;  3MC0 B;  1YOV B;  2N9E B;  1TBE A;  3MC9 A;  2A4Z A;  5H92 C;  2X8X X;  1Y8R C;  2WDT B;  4HCP B;  3BY4 B;  2BS3 B;  1UGM A;  3LB8 C;  3NUH B;  3PZ7 A;  1KLU D;  3B08 A;  4K81 A;  1M94 A;  2FE8 A;  3B2G A;  2N7E A;  5EE1 A;  1XEE A;  4WH4 A;  1PQS A;  2V0G A;  1E9M A;  3HIZ A;  3LXF A;  4LJO B;  1EWY C;  2KVZ A;  3A4S C;  1F52 A;  5TR5 A;  4HJK A;  4A90 A;  2INC C;  3FIL B;  3SHQ A;  3VTW A;  5DPR A;  2WP9 B;  3M62 B;  2L83 A;  1KH0 A;  1D5M C;  1XQQ A;  2ZCB A;  4M8M A;  4P7I A;  4MSM B;  2ZZP B;  1DOI A;  1PGA A;  3URY A;  2V9H A;  2BYE A;  4FJY A;  3I5J C;  1KFY B;  1V97 A;  5AUI A;  1LGR A;  1FFV A;  2LXC A;  4TMA B;  2BS4 B;  4XE0 A;  4PYU A;  2M17 A;  3VRB B;  5C2T B;  3BIN A;  5EE0 A;  4NY0 A;  1MG8 A;  4M02 A;  3RT3 B;  1K51 A;  2JYE A;  3PZD A;  1F2R C;  2NS5 A;  5IOI A;  2AYO B;  3P1M A;  4CO7 A;  2ZCC A;  2GBK A;  2UU7 A;  2MWS B;  2LZ6 A;  3GOE A;  1KLV A;  4XYC A;  4NAW A;  2LGD A;  3L10 B;  2WXO A;  2N1V A;  2WXQ A;  2KN4 A;  3UQA A;  2N0S B;  2JUO A;  3ETR A;  2WDV B;  2DZI A;  1V5O A;  2C5L C;  2MBB B;  2LAS A;  3VR8 B;  2AX5 A;  3ZQ4 A;  2WXJ A;  4YTM B;  3DWM A;  1WE7 A;  1F0Z A;  2QIE B;  4IUM B;  4YSY B;  3N9Y C;  1ZXH A;  2K0P A;  4GB9 A;  1WJ6 A;  2OHF A;  1L5P A;  1GC6 A;  2VH2 A;  5EDS A;  3TIX A;  2W3R A;  1EU3 A;  2KJ6 A;  3KW5 B;  1TS5 A;  3IXS A;  3HRD D;  2KTR A;  4MM3 B;  2JRH A;  2IO2 B;  3ZO5 B;  3ZNZ B;  1YX6 B;  2GOW A;  4K1R B;  4W9E A;  3L08 A;  3U2S C;  2J0K A;  5IN7 A;  3IAM 1;  5HG2 A;  3R2T A;  1FFU A;  1DYQ A;  2HD5 B;  2INP E;  3ZXV A;  4E3C A;  2D10 A;  2KO3 A;  1E90 A;  1WXM A;  1P9D U;  3N1X C;  1UBI A;  4YWG G;  4B9K A;  2FCN A;  2QSD A;  4HEA 1;  3AE1 B;  4KKJ A;  2BYF A;  3UIN B;  2NTT A;  3TEZ A;  2JX5 A;  4YTP B;  1PFD A;  1ZDV A;  1XLN A;  4REZ A;  4M0W A;  2H89 B;  1F77 A;  2V4I B;  1WXV A;  2A5U A;  5AZF A;  2DZJ A;  2MW5 A;  2AL6 A;  2HE7 A;  4KDL B;  4HKQ A;  2D07 B;  2WLB A;  3W1S A;  1J7B A;  1J7C A;  1WR6 E;  3C8Y A;  2X38 A;  4G0N B;  3TL5 A;  4TQ0 A;  1JRO A;  3HUI A;  2WXL A;  4KZC A;  4PS7 A;  2M56 B;  3DBL I;  1E6E B;  4WWM A;  1QOB A;  2N1W A;  2ZW1 A;  3AM9 A;  1H8C A;  1XLP A;  2WHI A;  3U30 A;  4LK0 M;  4MEL A;  2GBN A;  4BVU C;  3IT6 B;  1C79 A;  2ZVO A;  2HTM E;  1YNT E;  1NI2 A;  1LQB A;  2PE6 B;  4IW0 A;  3DPD A;  1XCT L;  4RF0 A;  4PS8 A;  4HDO A;  3JSV B;  1Q5W B;  1T3Q A;  2EMT A;  1C4C A;  2QHO A;  4ANU A;  1L4Z B;  3A1Q B;  4KV2 A;  2Y5P A;  3KUZ A;  3APF A;  4C56 C;  1I4R A;  2L0T A;  3BK2 A;  1IUE A;  3CIR B;  4US8 A;  2WDR B;  2BPS A;  1AWD A;  4KGR A;  3NJT A;  5LNK 1;  2XK5 B;  1QOG A;  1IBX B;  4BFR A;  2YEP F;  4RH6 A;  3MC8 A;  2PIA A;  3KWV A;  3I9V 1;  1FNW A;  1BT0 A;  1IGC A;  1WI0 A;  4MAC A;  1CQV A;  3BVZ A;  2LHD A;  1C1Y B;  4HK2 A;  5BMH A;  1FNU A;  3BVM A;  3KUC B;  4UDU C;  3AXC A;  1TS3 A;  4B0E A;  3AU4 A;  3MFG A;  4W9C A;  1WZ0 A;  4WWP A;  1TJE A;  1VZ8 A;  3IAS 1;  3VQI A;  1QLB B;  2ZJD A;  5C1Z A;  1TIF A;  1ZOY B;  1I35 A;  3AN1 A;  4YSX B;  1ET9 A;  2IO0 B;  1Q0W B;  1VCB A;  3AEE B;  2KVR A;  3E9S A;  1RFA A;  5AUK A;  3CMM B;  2JVC A;  3ZRC A;  4KZ0 A;  4W9I A;  2KJH B;  2OOB B;  2W3S A;  4NZL B;  3TEY A;  1N60 A;  1K52 A;  2PMV A;  1TS4 A;  4DHZ B;  1I4X A;  2DYM A;  1V49 A;  3M3J A;  2JXT A;  2LWP A;  3P4Q B;  2R2Q A;  4GMV A;  3NG0 A;  3RFZ B;  4ASW C;  2EEL A;  3PT2 B;  3Q3N C;  3D32 A;  5JHA A;  3SDL C;  4GDL B;  2ASQ A;  3GP7 A;  3Q3F A;  4D2K A;  1V5T A;  3HVZ A;  2LVQ A;  1HEZ E;  1MHX A;  3BVG A;  3HM3 A;  4F8C B;  5KHQ A;  4JL9 A;  3ZDT A;  4FJZ A;  5H8Y E;  3DBH I;  1V86 A;  1ZGU B;  2MX2 A;  4GN1 A;  3EGR A;  2JZ3 B;  3RN9 C;  4BKS D;  5HHD G;  2MSE D;  4EKU A;  2LGI A;  3L54 A;  1P3Q U;  3W5U B;  4WUR A;  2KWV B;  1JRP A;  1NI3 A;  2D3C A;  3ENE A;  4AJY B;  3PLV A;  4LNN A;  3FIL A;  4B95 A;  5KHO A;  4ZYS A;  3EC8 A;  3RI7 C;  1KM7 A;  1KRH A;  4RMA A;  2LFI A;  1A70 A;  1L4D B;  2BB6 A;  3U4E G;  3W9C B;  3UF8 A;  4LNI A;  2CJO A;  1CMX B;  4E74 A;  4FHJ A;  1WM3 A;  4IM2 A;  1WJN A;  4ARI A;  2BWE S;  1EM7 A;  4ACF A;  4L23 A;  3TMP B;  4KSL C;  3PGE A;  2IZV B;  2KLC A;  3CST A;  3ABV B;  2VH1 A;  4RGT A;  1ACC A;  3RNC C;  1FM0 D;  4EUT A;  1P0R A;  1JWU D;  2Z59 B;  4MGI E;  2N9K A;  4WAF A;  3L13 A;  4IC7 B;  5G5H A;  2M0X A;  1GB1 A;  3WAM A;  4FN2 A;  2N9L A;  2KXJ A;  1UF0 A;  3VFK A;  1BML C;  4HDQ A;  3AMZ A;  3ZW3 A;  2AL3 A;  2JF5 A;  2DNF A;  2IO3 B;  4IM0 A;  4NNJ B;  2QCZ A;  4P1B C;  1YQ3 B;  3Q3O C;  3BII D;  3VTU A;  4AWJ A;  4P1C C;  1HA5 A;  4XDD A;  3AE7 B;  2E3T A;  3OWE B;  1AW7 A;  2JXX A;  3R7R A;  3TCA A;  1WXS A;  4LNK A;  4JWS C;  5E6N A;  3ZTD A;  3P2B A;  1C4A A;  2JRI B;  1NBF C;  4W9G A;  2BKF A;  2REX A;  2WXR A;  1FCC C;  1JAL A;  4KKI A;  4HWI B;  4KSK C;  5C23 A;  4WIP A;  1FMA D;  2MBO A;  1MFW A;  1V9J A;  2ICI A;  5CHF A;  3VXW A;  1ZE3 D;  2MP2 B;  1VJK A;  1KF6 B;  4MSQ B;  2CHZ A;  1N63 A;  3H9D A;  1L0X B;  3AE6 B;  3CSF A;  2BTE A;  4II3 B;  1ZDX A;  3KUD B;  2KDM A;  1ET6 A;  1RM6 C;  1WYG A;  2PEA A;  1EO6 A;  3GZN B;  3QHT A;  1JQ4 A;  1WRD B;  3AU5 A;  5E6P A;  5IA7 A;  4US9 A;  4DQO C;  2I2Y A;  2UYZ B;  3NVY A;  2CKH B;  4CQN A;  4IWQ A;  3HVD A;  3QC8 B;  2V3N A;  2KKC A;  2NBV B;  3WAL A;  1MI0 A;  1E8W A;  1FO4 A;  4PYZ A;  3PRM B;  4W9K A;  1E0Z A;  4H2A A;  4HLE A;  4M8N A;  2LGX A;  3JSV A;  3WAN A;  2GI9 A;  3A1Q A;  2LRW A;  2QC8 A;  3IT4 B;  1LO5 D;  3JVZ X;  5JXV A;  2NR2 A;  1WMH B;  2LVP A;  2J4X A;  1GUA B;  2ZPN A;  2I1J A;  2EKI A;  2MRP A;  1VDV A;  3GS2 A;  2D3B A;  1T0R C;  3KVF B;  2XK5 A;  2QDF A;  1IYF A;  2LUM A;  3UGB B;  1IBX A;  1FIQ A;  2VZK D;  2D3G A;  3MJW A;  2LJ5 A;  3KYD D;  2WQY B;  2WXM A;  3N20 C;  2IDY A;  5HKH A;  4OZA A;  3VVW B;  3TSS A;  1ROE A;  3H7P B;  5E6O A;  3H6N A;  1K50 A;  4A6Q A;  3NY5 A;  2UWQ A;  3V61 A;  2WYQ A;  1JW9 D;  1L0Y B;  4MH8 A;  4LDT D;  3PTF C;  1DOY A;  1SXT A;  5G2N A;  3RNG C;  3NVZ A;  4W9L A;  1N6Z A;  1L6U A;  4CHK A;  3QJZ A;  3ZUN A;  2V4L A;  4ZRJ A;  4FJV B;  2BWF A;  2L05 A;  3NZS A;  1OQR A;  4DXF A;  4W9F A;  1YQ4 B;  4DDI D;  3T9L A;  1YX5 B;  1V6E A;  4C4V B;  2G9H D;  2KQS A;  1SE3 A;  1WGY A;  4BOZ B;  2D11 A;  1R4M I;  2VRR B;  2LGY A;  4BAX A;  2QIL A;  2JYT A;  4OVZ A;  2RR9 A;  3U7D A;  1VD2 A;  3TEX A;  2KC2 A;  5FKA C;  3BWU D;  2CU3 A;  3V6C B;  1SJH D;  2DBY A;  3PSE B;  3OLM D;  1I4P A;  3NS1 A;  2IGH A;  3AEA B;  4A3O A;  4XC2 A;  4OW0 A;  4ANW A;  1CJE A;  1C9F A;  3IBE A;  3AEG B;  1PDX A;  3V05 A;  4WWN A;  4YXD B;  2LMC A;  1JWA D;  2FUG 1;  3UI3 A;  2M1M A;  2KLG A;  2O6V A;  2J52 A;  5L83 A;  4EZL A;  5C3J B;  3TBL D;  1WYW B;  3APC A;  3X23 A;  4RNA A;  4DDG D; 
#chains in the Genus database with same CATH homology
 3IHP C;  3UIP B;  1WGG A;  4WWP A;  5CX3 A;  2KK8 A;  1YJ1 A;  2V3S A;  4BKS A;  3VQI A;  5DCN A;  5C1Z A;  2ZJD A;  3R7Q A;  2NBW B;  3S2A A;  3A9K B;  5D6J B;  3WAO A;  2EKE C;  1I35 A;  1ISN A;  2IO0 B;  1Q0W B;  1VCB A;  2N9P C;  2W9N A;  3KYC D;  5AZH A;  2JWZ A;  2KVR A;  4TKN A;  1HE8 A;  1RFA A;  2KAN A;  1OEY J;  4G11 A;  3N3K B;  3ZKJ C;  3CMM B;  4WQO B;  4A20 A;  4EEW A;  4GOC A;  4I6L B;  4MDK E;  2JVC A;  3U8Z A;  3ZRC A;  2M4N A;  4KZ0 A;  4W9I A;  5G55 A;  2KJH B;  2OOB B;  4XX5 A;  3QQ8 B;  4WJN A;  4K7W A;  3B0A A;  1LXD A;  2L3Z A;  1OTR B;  3DOW A;  3M95 A;  3SU8 X;  2AEH A;  3B1L X;  4AJW A;  4DHZ B;  3IG3 A;  3ML8 A;  2DYM A;  1V49 A;  1WM2 A;  3M3J A;  1X1M A;  5GMV A;  2KX0 A;  2LWP A;  3ALB A;  3EFU A;  1TZ1 A;  2L0F A;  2EMS A;  2R2Q A;  4GMV A;  4IG7 B;  1UH6 A;  1YIW A;  2KC1 A;  3EHV A;  4JLC A;  4ASW C;  3ZTC A;  2LD9 A;  1IPG A;  3AI5 A;  3PT2 B;  3D32 A;  5JHA A;  3SDL C;  2KFJ A;  3ZIM A;  4DXA B;  1FXT B;  3LDZ E;  1E7V A;  4GDL B;  2ASQ A;  2DAJ A;  3A9J B;  5CHW A;  3PV1 A;  2NVU I;  3Q3F A;  2K1F A;  4EFO A;  5D7G A;  1S3S G;  1EUV B;  2G4D B;  1V5T A;  2G45 B;  2LVQ A;  4J6I A;  3EEC A;  3LJ3 A;  1SGH A;  1UZX B;  4GU2 A;  2KX3 A;  3HM3 A;  2NCN A;  4F8C B;  4AP4 C;  5KHQ A;  4JL9 A;  2O2V A;  3ZDT A;  4I6P A;  4IWP A;  2C9W B;  1K8R B;  2JT4 B;  1UEL A;  4FJZ A;  2KOX A;  1H4R A;  2KFK A;  2O6V D;  3DBH I;  2G3Q B;  4FBJ B;  2DYO A;  2KTF A;  1Z5S B;  1V86 A;  1ZGU B;  2MX2 A;  4GN1 A;  3GZN I;  4AUQ C;  2DAF A;  2K25 A;  1C3T A;  4ANX A;  3WAP A;  2JZ3 B;  4ANV A;  2GMI C;  2KWU B;  3R3M A;  4BKS D;  4FA6 A;  1WGR A;  1G6J A;  4HPL B;  3NS8 A;  2MSE D;  3V60 A;  4EKU A;  5AZG A;  4ICU A;  3L54 A;  1P3Q U;  4WWO A;  3L17 A;  3QAR A;  2KWV B;  4GDL A;  3X0W A;  1V81 A;  3R66 C;  4F7Z A;  1GNU A;  3QX1 A;  4TV3 A;  4EZK A;  2KDE B;  3VDZ A;  2Y5B B;  4X57 B;  2CHX A;  2KDI A;  3ENE A;  4AJY B;  3PLV A;  1NDD A;  2KNB A;  4HPM B;  4HVB A;  3MHS D;  4B95 A;  1E7U A;  2J0J A;  5KHO A;  2FCQ A;  3C0R B;  4EZJ A;  4MGZ E;  1KJT A;  4ZYN A;  3EC8 A;  4W9D A;  3PLU A;  1WFY A;  3ML9 A;  3UQB A;  5L95 C;  1WR1 A;  4DHJ D;  1SE9 A;  3DDC B;  2R2O A;  4MEM A;  1KM7 A;  2KDB A;  2KN5 A;  4RMA A;  2BGF A;  5JH5 C;  5DPT A;  3NHE B;  4LJP B;  4W9J A;  1WGH A;  1OQY A;  1TTN A;  5DPW A;  1WE6 A;  3UF8 A;  2CS4 A;  5IAA C;  3VUX A;  4JIO U;  3DBR I;  4NQK E;  3ZNI D;  3JW0 X;  1CMX B;  2JPH A;  4E74 A;  5DPS A;  2G4S A;  2CR5 A;  1WM3 A;  2C7M B;  4FHJ A;  2PJH A;  4DHJ B;  4DWF A;  3Q3J A;  3K9P B;  4IM2 A;  2ZEQ A;  5CHV C;  1WJN A;  4NQL B;  2BWE S;  5BO4 B;  2J0M A;  4NPN A;  3PRE A;  4ICV A;  2IY1 B;  3TMP B;  2MLB A;  3A33 B;  3MTN B;  1U4A A;  3PGE A;  4KSL C;  3RZF A;  1OGW A;  2IZV B;  4TQ1 A;  2KLC A;  5LLI A;  3CST A;  2FCM A;  1RAX A;  4W9H A;  2L76 A;  2GBM A;  4HCN B;  3H7S A;  3N32 A;  2FNJ B;  2MCN B;  4MGY E;  1ZW7 A;  4BKT A;  4AOF A;  3IFW B;  3ZNG C;  4EOY A;  3N30 A;  3T8M A;  2MQJ A;  4EUT A;  1WF9 A;  3IVF A;  3H1U A;  4PS3 A;  5FR6 A;  4NJ6 A;  3HHM A;  1IP9 A;  1P0R A;  2N9E B;  2PE9 A;  1TBE A;  1XT9 B;  3DBS A;  3DVG Y;  4KIK A;  2Z59 B;  2M8S A;  4MGI E;  2A4Z A;  2FUH B;  3WA0 A;  1Y8R C;  2WDT B;  4HCP B;  1UBQ A;  3L13 A;  4IC7 B;  3BY4 B;  4MJS A;  2M0X A;  5J2R A;  4RM8 A;  1UGM A;  3WAM A;  2DYB A;  2O2V B;  4FN2 A;  4GGQ A;  3VUW A;  1UD7 A;  2KXJ A;  1WY8 A;  1RLF A;  3B08 A;  3VFK A;  4K81 A;  4HDQ A;  2KFK B;  3ZW3 A;  1M94 A;  2AL3 A;  2LUE A;  2JF5 A;  2IO3 B;  3HK0 A;  4TUU A;  4IM0 A;  4NNJ B;  2N7E A;  4JQW C;  1PQS A;  2JZZ A;  3VTU A;  4AWJ A;  1E5W A;  1ZKH A;  2MBE A;  3VAW A;  3HIZ A;  3PRZ A;  2JXX A;  3R7R A;  3TCA A;  2LXA A;  1WMH A;  3CF6 E;  4LJO B;  4DHZ E;  2CHW A;  4FAD A;  1WXS A;  3A4S C;  5TR5 A;  1E8X A;  4HJK A;  3P2B A;  5E6N A;  3ZTD A;  4BBN F;  2WX0 A;  3SHQ A;  3VTW A;  1J0G A;  3W1S C;  4RM9 A;  5DPR A;  2JRI B;  1NBF C;  2KMA A;  3M62 B;  4W9G A;  2BKF A;  2REX A;  2NPT A;  4MH0 E;  4DK5 A;  3ZNH B;  1XQQ A;  2ZCB A;  4M8M A;  4P7I A;  1YD8 U;  4MSM B;  1P1A A;  3VH4 B;  4KSK C;  4HWI B;  5C23 A;  4KVG B;  2ZZP B;  3RYT A;  2MBO A;  2BYE A;  4FJY A;  1V9J A;  1L7Y A;  4ZRI A;  5CHF A;  3TJP A;  3VXW A;  2KQ7 A;  4A3P A;  5JZE B;  2KDF B;  1EF5 A;  1WIA A;  2MP2 B;  2LXC A;  4XZ4 A;  5AEK B;  1E8Z A;  2C7N B;  1GC7 A;  2WWZ A;  4LDT B;  2IO1 B;  3L16 A;  4MSQ B;  4PYU A;  2M17 A;  4II2 B;  2CHZ A;  3H9D A;  2K6Q A;  3BIN A;  1WX8 A;  4NY0 A;  3H7P A;  1MG8 A;  1V80 A;  3RT3 B;  2HJ8 A;  3CSF A;  3PZD A;  4N9F 4;  5D2M B;  2DZK A;  4II3 B;  2NS5 A;  3NZU A;  2XBB C;  2FCS A;  2AYO B;  4FLH A;  4CO7 A;  3KUD B;  2ZCC A;  2GBK A;  2MWS B;  2LZ6 A;  2BF8 B;  2N7D A;  3GOE A;  1KLV A;  4G3X B;  2PEA A;  4NAW A;  1EO6 A;  2KTR B;  2LGD A;  3L10 B;  5LXH A;  2KWC A;  3RZW C;  3QHT A;  2CU1 A;  2DHZ A;  2N1V A;  1WRD B;  3AU5 A;  5E6P A;  3UQA A;  3WIM A;  5IA7 A;  4NJ7 A;  2JUO A;  2UYZ B;  4KIK B;  5LXI B;  2DZI A;  2CKH B;  2V1Y A;  1V5O A;  2C5L C;  2MBB B;  1GG3 A;  2MP2 A;  2LAS A;  4MJS B;  4IWQ A;  1V2Y A;  5D94 A;  3QC8 B;  2ZPY A;  4DDG D;  4WJO A;  1WE7 A;  1J8C A;  2KKC A;  2NBV B;  4IUM B;  3WAL A;  4B6W A;  4IM3 A;  4ZDV A;  3DVG X;  1XD3 B;  1E8W A;  4K7S A;  4PYZ A;  3PRM B;  1WJ6 A;  4GB9 A;  4W9K A;  4BOS C;  2KMC A;  4GIV A;  5EDS A;  1GC6 A;  3TIX A;  1T0Y A;  1LM8 B;  4HLE A;  2ZVN A;  2DEN B;  2LGX A;  3JSV A;  4M8N A;  3SD5 A;  3WAN A;  4WJQ A;  2KJ6 A;  3KW5 B;  2YLM A;  3A1Q A;  2RGF A;  2LRW A;  2KTR A;  1WGD A;  3A4R A;  2JRH A;  2IO2 B;  3JVZ X;  3ZO5 B;  2NR2 A;  1WMH B;  2LVP A;  1GUA B;  3ZNZ B;  1YX6 B;  2ZPN A;  3PRP B;  1P98 A;  2IY0 B;  4CYE A;  2BYV E;  2GOW A;  2I1J A;  4K1R B;  4W9E A;  1WH3 A;  3L08 A;  1Z2M A;  2J0K A;  2C60 A;  2MRP A;  2HD5 B;  3VHT C;  3PHW B;  4E3C A;  2K6D B;  3VUY A;  2D10 A;  4K7U A;  1D3Z A;  2KO3 A;  1E90 A;  1WXM A;  2NPT B;  1P9D U;  2NBU A;  4GDK A;  1UBI A;  1WZ3 A;  3ONS A;  3KVF B;  5L83 A;  4B9K A;  2FCN A;  2I1K A;  2XK5 A;  3O65 B;  1IYF A;  2HTH A;  3UGB B;  2ZNV C;  2BYF A;  3UIN B;  2D3G A;  4MGK E;  4BBN C;  2RSU A;  3MJW A;  2LJ5 A;  4BKG A;  3KYD D;  1TGZ B;  3W1Y A;  2JY6 A;  3X23 A;  1OEY A;  2L8J A;  3ZDM C;  1WXV A;  2A5U A;  1EF1 A;  5AZF A;  2DZJ A;  2MW5 A;  2AL6 A;  2HE7 A;  4WAA A;  5HKH A;  1Q1O A;  4KDL B;  3VVW B;  2D07 B;  3OJ3 A;  4MM3 A;  1J19 A;  2FID A;  3W1S A;  1WR6 E;  2XEW A;  5J18 A;  2KJR A;  3H7P B;  3M63 B;  3PPA A;  5E6O A;  3QA8 A;  3H6N A;  4G0N B;  4F1S A;  3TL5 A;  2FAZ A;  3NY5 A;  3RUI B;  3V6E B;  2LI5 A;  1I42 A;  4TQ0 A;  2KD0 A;  4FUL A;  1WJ4 A;  2UWQ A;  3UIO B;  3V61 A;  1RRB A;  2FIF A;  2WYQ A;  2BKR B;  2MA9 B;  2MBQ A;  2N9X A;  2B3A A;  4KZC A;  4PS7 A;  4URK A;  4NAW B;  1WJU A;  4LCD E;  3DBL I;  3A9K A;  1L2N A;  4LDT D;  1QZE A;  3PTF C;  1AAR A;  3OJ4 B;  4IWO A;  4OVU A;  3QAQ A;  4OVV A;  5G2N A;  2N1W A;  2L00 B;  3KH0 A;  2GBR A;  2IYD B;  2RD0 A;  1H8C A;  4W9L A;  1E8Y A;  4CHK A;  3QJZ A;  1A5R A;  3ZUN A;  3PS6 A;  3U30 A;  2V4L A;  4ZRJ A;  4FJV B;  2Z0D B;  2BWF A;  4MEL A;  2GBN A;  1WX9 A;  4BVU C;  3PVL A;  2L05 A;  3NZS A;  1JRU A;  1KOT A;  2ZVO A;  3PHX B;  1LFD A;  3DVN U;  1YQB A;  1F9J A;  4W9F A;  2DX5 B;  4KDI C;  4DDI D;  3T9L A;  1NI2 A;  2GBJ A;  1YX5 B;  1LQB A;  2PE6 B;  2K8C A;  1V6E A;  3ZVV A;  4IW0 A;  3DPD A;  4WJP A;  3RD2 A;  2KQS A;  3DVN V;  3HM6 X;  4PS8 A;  3VTV A;  4HDO A;  3JSV B;  1WGY A;  4BOZ B;  1Q5W B;  5J17 A;  2EMT A;  2D11 A;  3QIJ A;  5CTR C;  2QHO A;  1R4M I;  2VRR B;  2YVC A;  3OAW A;  2LGY A;  3A1Q B;  3V62 A;  2IBI B;  3I3T B;  4ANU A;  4GXB A;  4KV2 A;  4YL8 A;  3ZLZ A;  2RR9 A;  3KUZ A;  3DQV A;  2C7H A;  3U7D A;  3NOB A;  2O6V B;  3APF A;  1VD2 A;  3A9J A;  4DBG A;  2KC2 A;  3JYU A;  4GSW A;  2L0T A;  2AWT A;  3L0W B;  3ECI A;  2N4F A;  2Z0E B;  4HXD A;  3RCZ A;  1WXA A;  3V6C B;  2ZNV B;  2MBH A;  2L7R A;  4GDK B;  3ZRF A;  4ZRK A;  2BPS A;  2KZR A;  1GJZ A;  3PSE B;  3QK0 A;  2K39 A;  2XK5 B;  2J7Q B;  3OLM D;  2OJR A;  3VH3 B;  1S1Q B;  2K8B A;  4JGH B;  4BFR A;  4A3O A;  4XC2 A;  3RUL A;  3AUL A;  4ANW A;  2K8H A;  3K9O B;  3IBE A;  2KHW B;  4M0W B;  1BT0 A;  1SIF A;  1WI0 A;  2LVO A;  2WX1 A;  4WWN A;  2LRU A;  3QCA A;  1R4N I;  1WX7 A;  3QWZ B;  4E71 A;  1C1Y B;  4HK2 A;  2M1M A;  2D2Q A;  2PPH A;  2KLG A;  2O6V A;  3KUC B;  4I6N B;  3AXC A;  5JHB A;  3APD A;  3DCG A;  2DZM A;  4EZL A;  3AU4 A;  1WYW B;  3APC A;  4G50 A;  4FHK A;  3TBL D;  4W9C A;  2RPQ A;  1WZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...