4EUTA

Structure of bx-795 complexed with unphosphorylated human tbk1 kinase-uld domain
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
386
structure length
384
Chain Sequence
GSQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRNIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of Tank-binding kinase 1 activation by transautophosphorylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase TBK1
total genus 108
structure length 384
sequence length 386
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4eutA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4eutA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4eutA01
4D9TA 5KHXA 3E8DA 3FPMA 3L1SA 5J95A 4TWCA 2C3LA 4XEYA 2VWWA 4RX7A 1KOTA 5CX9A 3CBLA 3DCVA 3RALA 5IQGA 5GIOE 3GUBA 1BL7A 3DPDA 1H24A 5CVHA 5IUIA 4HW7A 5IA3A 4MGKE 2YFXA 5AAFA 4WBBB 2DS1A 1V0OA 2O5KA 3QKKA 4IBMA 4OBPA 4NJ7A 2X6DA 4GJ3A 4X2JA 3W1FA 3WILA 1OL6A 3PA4A 3VUIA 4E73A 3Q3FA 4YJRA 1STCE 3PPJA 4O0YA 3WZUA 1QCFA 4EZ5A 3VH4B 4ZSJA 4AGCA 4FZ7A 4FSZA 1VD2A 1H25A 3AOXA 3OCGA 3QQJA 2O3PA 3SKCA 3C0GA 5LLIA 3MHSD 1J0GA 4FSUA 4LJOB 3DKOA 3X23A 5ETAA 2XK3A 5AUYA 1OBDA 1WIAA 3K9PB 2CNUA 4ZMFA 2B9HA 4A9TA 3OVVA 1Z5SB 4XS2A 2KJHB 3WZEA 3RMFA 3O50A 3P9JA 4PRJA 5BPYA 1SNXA 2IVSA 2YEXA 3DLZA 5AMNA 3LJ3A 2BPMA 1GAGA 5CALA 4OTIA 1QPJA 4EWHA 2YCQA 4NQLB 5GIPE 4NCTA 4FTRA 4L45A 3ZEWA 2L76A 3PPAA 2YZAA 3RGFA 3A7GA 4BTJA 2JUOA 2KDIA 3VTWA 5DPRA 2PE1A 4DHFA 3QQFA 4DINA 2JKQA 5AP1A 2CHZA 5D6JB 2YM6A 3Q3BA 2QU5A 3O8UA 1KOBA 1Y6AA 4USDA 4DGNA 4EWQA 4CMTA 5H2UA 4FYOA 1D3ZA 3X0WA 3APDA 3MESA 2F2UA 3FZSA 1XWSA 4JDHA 4ZTNA 1ZYJA 3ENEA 3ML8A 2R0UA 5LWMA 3NEWA 3V5TA 1JKTA 3K3JA 4HPTE 5ACBC 3MH3A 3AG9A 3I4BA 5KO1A 1Q8ZA 1V81A 3EL7A 1PQSA 3ZM4A 3WAMA 2H9VA 5AM7A 3PSCA 2LVOA 4IM2A 3AT4A 2JRHA 4AZEA 4UMUA 2W4KA 4KSLC 4FV3A 2P0CA 4XBUA 3LFBA 1V86A 3UIPB 3IECA 3B1LX 3SD0A 2J5FA 3WF5A 4NJ3A 1R4MI 4U41A 1OEYJ 3UINB 1WJUA 4M7IA 4TYHB 2OLCA 3ZOSA 3NUAA 4ZLYA 3LFQA 5C27A 4X2GA 2LVPA 1IRKA 3D7ZA 1ISNA 3UZTA 2RIOA 2BZKB 1OL7A 4J95A 4GK3A 3RPVA 3W2OA 5IA4A 4TWPA 5DLSA 5FTQA 2QD9A 2DZKA 2W1GA 2UYZB 4MELA 4ZTLA 4PP7A 5ANDA 1KE8A 1YQJA 3F3WA 2KWUB 3EQFA 2C3JA 4FZFB 3C5UA 3FE3A 4RIYB 3TKUA 1UV5A 1PJKA 1VYWA 4GJ2A 4YJUA 3WZKA 5M07A 3NR9A 2Z7QA 3LW0A 2VWZA 2UZOA 4B9KA 2R2PA 5KMJA 2WTIA 3Q32A 5IA0A 1UKHA 3KK9A 1Y8YA 3NW5A 3NSZA 4DTKA 2QOLA 2PYWA 4AA5A 2UZNA 4IJPA 4KS7A 4CFUA 4EYJA 3D0EA 4C57A 4D5KA 4O7VA 1NDDA 4ICVA 3F82A 3G6GA 3C4CA 4NUSA 5CU4A 1SYKA 3RK5A 2YIRA 3EL8A 3EQHA 1OEYA 2ZZPB 5J79A 4MTAA 2FYSA 2XVDA 4BTKA 5LCJA 3OHTA 4QMWA 4QMUA 1KV2A 5JKGA 3LMIA 2OIDA 4XG9A 1TGZB 2J0IA 1KWPA 4CMUA 4OT6A 4GXBA 4BKJA 5IU2A 2YCFA 2K8HA 1PXKA 3GP0A 3DLSA 4TNBA 4CYJA 4QP7A 4BBFA 2IO0B 4EZLA 4J96A 4QNYA 3A60A 3DNEA 3IG7A 4OTRA 4DGMA 4BIDA 4QPMA 3PXRA 4RJ5A 4RIOA 3NAXA 1RQQA 2XJ1A 3OW4A 4UALA 4BKZA 1QMZA 3DT1A 3WZJA 4D1XA 4EHEA 3QC4A 5EH0A 2GHMA 5HTCA 3AMYA 4FR4A 5I9WA 3NS8A 1IA8A 2VV9A 4U3YA 4ZZNA 5IZFA 5IEXA 3HM6X 2CGXA 3JY0A 3OWKA 3QLGA 4IWDA 5DE2A 4CQEA 4UXLA 3DBRI 4O83A 4FKTA 4I94A 3L9NA 1R3CA 4KB8A 4HLEA 3CPCA 1WVWA 1BI7A 5HO7A 4AQCA 2J7TA 1Q5KA 3HV5A 2HOGA 3MPAA 3TTIA 4BGGA 5IUGA 1WX9A 3H0YA 4C2WA 4MH0E 3E88A 4Y8DA 5HCXA 5ANJA 3NCZA 1KE9A 4C3RA 3EYHA 4U40A 4RJ7A 3V5JA 2LAVA 3EFUA 2I1MA 4QP2A 2MBBB 3N4UA 2MCNB 1WE7A 2IPXA 3QKLA 5ITAA 2I40A 2FVDA 3C13A 4V05A 3EQCA 4WRSA 3FPQA 3E62A 3ZSGA 3QJZA 2R3RA 5H3QA 2BHHA 2BIYA 4F7LA 1Y8RC 2B9JA 1AGWA 4PPAA 3O7LB 5E8VA 2XIXA 5FEDA 2JF5A 4PUZA 3PZEA 3QF9A 4QQ5A 3ZH8A 2OJIA 2QHNA 2YLEA 1OIRA 3IGOA 4RRVA 2EU9A 3D4QA 4Y72A 4M3QA 5DN3A 3EECA 2PEAA 4PDYA 5D7GA 2XBBC 3GT8A 5CASA 2CKOA 3ORLA 3PY0A 3QX2A 4D2PA 5DPTA 2W5AA 2JITA 5LMAA 2BYEA 1HCLA 1Q62A 3QA8A 2ZV9A 4G3DA 4AS0A 3DBFA 4E5BA 1W84A 2H6DA 4F1TA 4DDGD 2QOIA 3ZZEA 1OZ1A 4ANQA 2W5HA 4YC6A 3UOKA 5DNRA 3QA0A 4L52A 2MX2A 4FKGA 2PULA 2WTKB 3Q5ZA 4V01A 4ZMEA 3UTOA 3GCQA 4RWLA 2GS2A 4E4LA 1ZMWA 4JJRA 1U59A 3CXWA 1UNHA 2IZTA 2YIWA 2ZMDA 5AUVA 4FA2A 4FTJA 3OXZA 5IPJA 2XYUA 2YM5A 2BKRB 3BPRA 4E8AA 3G90X 3A9KB 2YCRA 4GIHA 3QUDA 4QNAA 2YLFA 4PL4A 2PVNA 4AP7A 2R7BA 4D9UA 4K81A 2MA9B 3FMLA 1KE5A 2GNIA 3TZ8A 1Z5MA 4NSTA 5CSXA 2UVXA 3E8NA 4O38A 5EKNA 1WM3A 2N9XA 3HMMA 4YLLA 3UQFA 2C5VA 4I5MA 4WA9A 4WOVA 3M3JA 1F3MC 2KULA 4RM9A 3LLAA 2PVMA 5KUPA 2RF9A 3LCTA 4O7NA 2B1PA 4I22A 2XM8A 5EW9A 4ZTQA 1NA7A 3LJ2A 1ZOGA 3TUDA 4QD6A 1YXTA 4NEUA 5CEMA 3TNHA 3GU6A 1LEWA 3II5A 3QL8A 2KDFB 3L16A 2NPQA 4JG7A 5KZ0A 4HYSA 3MVMA 3PXYA 5KMMA 2QKWB 2WTDA 2L0TA 3Q52A 2IY0B 2ZCBA 2YWPA 1YXUA 4QMSA 4XG6A 4EH6A 4B95A 1V1KA 4S34A 4M67A 2MLBA 3RCZA 1VEBA 4EKUA 1WJ6A 5A3XA 3F61A 3RTPA 5HICA 3FZ1A 4TTHB 1WI0A 3JVZX 3OAWA 1YW2A 3UMXA 4JAJA 4MBLA 5FEQA 4AOJA 3O8TA 4FTLA 4QTDA 3OXIA 2HZNA 3AT2A 4Y83A 4PNKA 2N1WA 3JW0X 4LG4A 3E93A 3DBEA 5J17A 1YWRA 3R2YA 1XBBA 4WNPA 3OBJA 3OJ4B 2WTWA 2IVTA 3UQCA 1MG8A 3GU4A 3BE2A 2L05A 4FHKA 3ID6C 5EQEA 5IQEA 2VD5A 2FSTX 1OPLA 1TQPA 2WIHA 5CU6A 2E9NA 1GNGA 5HIEA 4CT2A 2G2IA 3N3KB 3QUEA 3DAKA 2Z02A 1YHWA 3ORMA 4ANWA 4R7BA 5I0BA 4WJQA 2X39A 4ZJJA 4FT5A 5KHWA 3TMPB 3LCDA 4E6CA 2WU6A 3UYSA 3G33A 4K8AA 4J7BA 4F64A 3DKFA 5BYLA 3VN9A 4GB9A 3TIXA 4ZY4A 4C37A 4XP3A 1JKSA 5ANIA 5HCYA 1G6JA 3R66C 5FWKK 1E8XA 3W16A 2O65A 4RLLA 2V7AA 1KE7A 4MGYE 5HKHA 3T8OA 3FUPA 3P0MA 4M13A 4O0UA 4RX9A 3OTVA 3WBLA 4DEGA 4QMOA 3U6IA 4EH9A 3BLHA 4Z3VA 2B9IA 2VNYA 2F57A 4PTGA 3ZRFA 2WQBA 3SV0A 3LXKA 1UU3A 4AN9A 4LJPB 3SLSA 4RA5A 4F7ZA 1M94A 3M62B 3H7PB 2O2VA 4I21A 3V8WA 4DHJD 4FVRA 2XK7A 4MBJA 4YLKA 1W8CA 2WAJA 3BQCA 4GEOA 3FMNA 5JMSA 3CQUA 3WZDA 5L3AA 4GCJA 3PJ2A 1ZAOA 5M08A 4Y95A 2BRBA 4ACGA 2W0JA 4IANA 4RX8A 2X7FA 4X6QC 4XHKB 5H9BA 4D4VA 5KMKA 4PL3A 3S4QA 3KGAA 4HVIA 1E8ZA 2HXQA 4ASDA 1WGDA 3ALBA 2VTMA 3V51A 1FBNA 4FC0A 3UGBB 3KRLA 4RVLA 2C6EA 3AGMA 4U42A 3JSVA 4NQKE 2R3JA 2YDKA 5HNBA 5EG3A 5BUJA 5E8SA 3VS1A 4HZRA 1UKIA 2R3IA 3VF9A 4BR3A 5D7VA 3THBA 4FGBA 2C68A 3A7IA 3Q9XA 2OG8A 3R30A 4K18A 3FZOA 1REKA 2GTMA 3EKNA 2UW5A 2Y6MA 1OKWA 4G3GA 3QC8B 4XOYA 3KU2A 4G3CA 1GIHA 5HVJA 4YJTA 2VTPA 3U51A 4EL9A 2XBJA 5FR6A 2ZOQA 3HEGA 4NT4A 3QD2B 5E90A 2BKZA 4AFEA 5M4FA 1GC6A 1KLVA 2B54A 3Q6WA 4MXCA 3H4JA 3QWJA 2IZRA 3PIZA 4I3ZA 4II5A 5FQDC 5LMBA 2BF8B 3FMKA 2R3GA 4QYYA 1ZZ2A 2RG6A 4CEGA 3RULA 3FHRA 4JL9A 2CU1A 3DKCA 3OMVA 2P4IA 3SX9A 4ASZA 4DFNA 5DBXA 2WQMA 1A5RA 3CC6A 4CCBA 5DEWA 4JT3A 5I5ZA 2KDBA 2GNHA 2ACXA 1UNGA 1MQ4A 4B8LA 3KXHA 4A7CA 1GZNA 3MI9A 4DFLA 3FJQE 3VHKA 2A5UA 1JNKA 2BWFA 3SC1A 3FZRA 4I0TA 5AZHA 3KK8A 2J90A 3VBYA 4HVSA 3A4PA 1E8WA 4ZJVA 2OXXA 4GSWA 3ACJA 4MSMB 4NFNA 3LXLA 3MTLA 3A7FA 4E26A 3ZO5B 3EN7A 2NCNA 1H0VA 4IEBA 4BYIA 4KAOA 3NCGA 3PVBA 3PHXB 2CKPA 4YNEA 5FBNC 3F2NA 3QTUA 2QOCA 2PZRA 3HGKA 4YJVA 2KANA 3IW4A 4QMQA 4CV9A 3APFA 2QR7A 3OOMA 4O2PA 1W82A 4PMMA 1Q5WB 3NNWA 1YIWA 3ORXA 2BDJA 1ATPE 2EB3A 2GDOA 4IX3A 4JLCA 4L44A 5ETCA 2X0GA 4D1SA 3PPKA 3DVGX 3QLFA 3ORTA 3NZUA 1UBIA 4P7EA 3MN3A 2B55A 5CSWA 4QTEA 2BHEA 3DZOA 4FZAB 4IAKA 3UO5A 4O7TA 3O17A 3ZYAA 2N4FA 1OGWA 4I6LB 4K0YA 3HK0A 4JQWC 4CLIA 3VUMA 4DH3A 3TJPA 4L9IA 3BHUA 3W10A 3QBNA 1M2RA 3BZ3A 3LM0A 4GYIA 2X6EA 4S30A 5L4QA 1TBEA 5J7HA 2YAAA 4QP3A 4FJYA 4IVAA 4KIKB 3TJCA 4Z9LA 3P78A 3OTUA 3RNYA 5G55A 1UU8A 4FEUA 3A61A 1KUTA 3C0HA 3CJGA 2WTKC 1CMXB 2C6KA 4BTMA 4YMJA 2K1FA 4M84A 4U0IA 2HWOA 3OC1A 3DVGY 4AFJA 1R39A 2IO6A 4FI1A 4AZFA 2AWTA 4I6PA 4EZKA 4GKIA 3FQSA 1Q8UA 3EYGA 4ANXA 2B53A 4HJOA 3ONSA 1A06A 4FT7A 4I6BA 5F20A 3F6XA 5HOAA 2HJ8A 2EXMA 3MTFA 4ANVA 4CSVA 4WUAA 4FG8A 2XIYA 3QYZA 4O6LA 4FNWA 4QPSA 4ZLOA 2MRPA 3I0OA 5GZ9A 3TTJA 2LXCA 3G9LX 4JRNA 1P5EA 3F7ZA 3O71A 4LQMA 3KRXA 4DGOA 4MVFA 4CV8A 3GOEA 2Z7RA 4QPAA 4ZSLA 3NDMA 4PDSA 3UF8A 5IQIA 4IDVA 2I1JA 4I6NB 2PE0A 3F66A 4FF8A 3TL5A 3V6EB 3CE3A 3F3VA 4GVJA 2JBOA 4I20A 2FUMA 4PDPA 4IVDA 4PP9A 5DFPA 5JRSA 3DVNV 3ZRMA 5KHOA 4EBVA 5CX3A 1XO2B 3L9LA 2OGVA 3QTRA 3COMA 3WF6A 5BVOA 4W8EA 4TKSA 2PVKA 3OD6X 3PXKA 4QQCA 3W18A 2IZUA 3MH1A 1OTRB 4OTDA 4DBGA 2DUVA 4RVTA 4F9CA 4QMPA 3QFVA 1G5SA 5LOHA 2NPTB 3LMHA 2LZ6A 4TRLA 2CDZA 3PE2A 1YOLA 2ERZE 5CT0A 4E6DA 4TQ1A 5GHVA 4URKA 1OECA 1YDSE 3HMIA 3EN4A 1YQBA 2IBIB 3GU5A 4AT4A 4BFMA 4BRXA 5CY3A 4AX8A 4DN5A 3ORPA 3A8XA 1Z2MA 4HNFA 4DG2E 3HMPA 2GFCA 4JVGA 5DIAA 3H9DA 4G1WA 1P4OA 3H9RA 5KBQA 4FL1A 3H10A 3EN6A 3H30A 4KD1A 5EI8A 4DG0E 2CKHB 2PVHA 4FA6A 3R00A 4MD7E 4DHZB 2QOQA 3NYNA 1SM2A 2ITPA 3Q2MA 4MKCA 3C4WA 3VO3A 5IA1A 3ZM9A 2E9PA 4FIFA 1W0XC 4QYFA 4EK3A 5FGKA 4XBRA 3C4XA 4FTNA 3TV4A 3FI4A 4RC3A 4D0WA 5CAQA 1LPUA 4UWYA 4XV9A 3BLQA 2VRRB 3ENHA 3QZHA 5BVWA 2W06A 4DCEA 3OUKA 4O0WA 3VS6A 4H3PA 3LZBA 3RP9A 4JNWA 2JY6A 4KS8A 3DVNU 3DV3A 3COKA 4OR5A 4NIFB 4FBJB 4ZS0A 3LLTA 4CRSA 4OLIA 4FX3A 1Q24A 4JX7A 4RVKA 5CAUA 4UX9A 4IC8A 1YWVA 4TV3A 4IUMB 2R3OA 3BYVA 4HK2A 4AOIA 4IHPA 2WDTB 2FIDA 3FEGA 5EHOA 2VNWA 3IQ7A 4Y46A 4F63A 5BMSA 3AC8A 4X2FA 5DT3A 4IZAA 5M53A 1XKKA 4WWPA 3BRBA 3A2CA 5CNNA 4DFXE 4I6QA 2WNTA 1ZY5A 3RVGA 1U54A 2KFKA 2M4NA 4EOKA 3DZQA 3WF9A 2GSFA 2VWVA 4QMXA 3K9OB 2UW4A 4FG7A 5EHYA 4IAAA 4TN6A 4OGRA 4GMVA 2UWQA 3V3VA 4BBNC 1H28A 3DB6A 3QHWA 2PE9A 3SRVB 5J5TA 4RWKA 4TXCA 1OB3A 3KULA 3RHXA 4J99A 3HP5A 4D2WA 5CAOA 4AE6A 4AW2A 4GVAA 4K7SA 4MHAA 4QMMA 5AP5A 1YXSA 1SZMA 4F09A 2CHWA 3GOPA 3Q9YA 5BQ0A 5GJFA 3L13A 4BCMA 2KC1A 4FV9A 1UH6A 2VWBA 5D9HA 4DK5A 4DF3A 1GJZA 3OF0A 5IEYA 3PG1A 2UW3A 3VTVA 1J8CA 3IPHA 1M14A 5KCVA 1IP9A 4NY0A 3GI3A 5L95C 3OW3A 4LGGA 3PE1A 4BCPA 4ITIA 2YN8A 2QOBA 5KKRB 4UMQA 1ZARA 3GZNI 4X7QA 3WA0A 3H9FA 5HNGA 4BKTA 4PQNA 1PKGA 1HCKA 1WCCA 1JOWB 2JRIB 4JBVA 1WGHA 5L2IA 1WXMA 1GJOA 2ZM4A 3BGZA 3EZVA 1GZOA 3Q60A 4V0GA 2ZEQA 5CF5A 4FNZA 3NZSA 4G3XB 4MNEA 1PMEA 3GQIA 3Q3JA 4M69A 3TCPA 5J9ZA 3MV5A 2VTJA 4RZWA 4P2KA 4QOXA 5CZIA 4XUFA 5CTRC 5L6PA 2BDWA 2B0QA 3BLRA 3M63B 4CG9A 2OBJA 2VO0A 4BI2A 2PVJA 3E8CA 3W33A 1P3QU 2N7EA 2I0VA 3L08A 5FXRA 2ZB0A 4F08A 3OT8A 1I42A 5HBJA 2C6IA 3TKHA 3NNUA 3V8TA 5KHQA 5EDPA 1FMOE 5CS6A 1WGYA 2LWPA 2M17A 2W4JA 4DEHA 2C6OA 3CF6E 3RPOA 1IAJA 5D2MB 3R9OA 5CF4A 4YJNA 1XQZA 1UWJA 4GKHA 3A4OX 5D10A 3N51A 5E91A 4FNXA 3GENA 4BL1A 1NI2A 3AI5A 4II2B 4Q9ZA 3LXPA 2KJRA 3TT0A 4BCKA 2JZZA 4NKSA 5IMEA 2C3IB 2OH4A 2PHKA 5AJQA 5HG8A 1PF8A 2YM8A 3ITZA 2KX0A 3ZC6A 3KMWA 1RFAA 4R5SA 4GGQA 5FDXA 1WVXA 5CVGA 2XIKA 4R77A 5HD4A 3QRJA 4BCQA 4ANUA 3CD8A 2F7XE 1IR3A 3E7VA 1YJ1A 3ML9A 3EH9A 5DEYA 3P7CA 4NW6A 3MVJA 4WSQA 4CQGA 5LMKC 3FXZA 3QQLA 5EM7A 3R7QA 3QGWA 5JH5C 3E63A 2XKCA 4NJ6A 4FKRA 2R0IA 2HTHA 3RHKA 3UPZA 5EM8A 4C34A 3LQ5A 3PRPB 1S9IA 4BIBA 2ZDUA 5DI1A 5K5XA 1EH4A 2D2QA 3LCSA 3S2PA 5CEKA 1WYWB 4EH3A 3L0WB 1PXLA 2OKRA 4YJSA 3BHVA 3DFAA 5B2MA 5IG1A 1NY3A 5DH3A 3SOAA 3VS0A 4K7UA 3VS5A 5CT7A 2F4JA 2JD5A 1E1VA 2YHVA 3GVUA 4B8MA 1V80A 4U45A 2C69A 3B8RA 3PRIA 4TW9A 3TCAA 3QD0A 3HRFA 2V62A 2K8CA 5AR5A 3FY2A 5BUEA 3MJ1A 2YJRA 4ANOA 2REIA 3K54A 2PPQA 4BHNA 4M8NA 2EMTA 3MS9A 5CF6A 3V04A 3OJ3A 3ZNID 3T3UA 3A1QA 4XG3A 4RC2A 4MWHA 4F6SA 4CO7A 5ETFA 4NWMA 4A9UA 3TUBA 3I81A 3O96A 3D5VA 3SGCA 5EOBA 3AGLA 3BYSA 5CF8A 5AP3A 3KVWA 5H8BA 5C01A 4U80A 4JOAA 2DYBA 3IHPC 1OPKA 1DS5A 4C4HA 1WH3A 4WD5A 2HCKA 4OTPA 4EBWA 3TNWA 2C9WB 2K6QA 4I4EA 2LD9A 2O0UA 2B9FA 3UG1A 4O7SA 4AUAA 4S33A 1RW8A 1V0BA 3GCVA 5E8TA 5KNJA 2CGVA 5FRIA 4QP4A 4B6WA 4L00A 3GOKA 2NNWB 4E4XA 3HMNA 2XP2A 2K8BA 3AC4A 4E71A 3W55A 4FV0A 5GMVA 4IAZA 2UW0A 1JAMA 2QNJA 3MBLA 5DR9A 2ZV2A 3ECIA 1RLFA 1BX6A 3PSBA 2JAMA 2R3FA 3RCJA 4TZRA 3RNIA 1Q8YA 2C4GA 2C6MA 4OW8A 4EH5A 5AUTA 5HX8A 1J3HA 2DZMA 1L8TA 4EH7A 3UC3A 3SU8X 3KMUA 3HRBA 5JFSA 3ZNZB 3L8SA 4A9SA 4UXQA 5AAGA 3DAEA 1WR1A 2PUPA 4Z16A 1WR6E 4GDKA 3WF8A 3IW6A 2W4OA 2JC6A 4YSMA 3R9RA 1XHAA 5LXIB 4FODA 5AV2A 1IYFA 1R78A 3W2SA 3Q2JA 3EB0A 2IW6A 5AZFA 2D11A 2KTYA 2VWUA 2XK4A 3AT3A 4C35A 2AUHA 3BYUA 3QXOA 3QQHA 4XLVA 2C30A 4JRVA 2ETMA 5E8XA 2G4DB 4KVGB 4N6ZA 4JR7A 3A8WA 3GC7A 4I0RA 1WZ0A 1M52A 3C9WA 5AP0A 3SXSA 3TI1A 2BVAA 3QHRA 4YPSA 2OJGA 3N9XA 4BF2A 4KSPA 2GQGA 4BKGA 4ZS4A 4FJVB 2MW5A 1P98A 3ALOA 3KRRA 1S9JA 2R3PA 4G5JA 4AGUA 4CFNA 1IG1A 3U4UA 4AW1A 2LI5A 3DJ5A 3PRZA 3MW1A 5AUZA 3P5KA 4F6UA 2WMAA 4DH1A 3PVLA 5TE0A 4CT1A 2LASA 2QKRA 3BYOA 4KIPA 4NK9A 1C1YB 1K8RB 4HCTA 4MBIA 4YZNA 2WQEA 3PTFC 4KABA 5DRBA 4DT9A 4X3FA 2IN6A 4ZDVA 3R8VA 3F88A 4FKPA 2ZYBA 4E74A 1Y6BA 3FXWA 5HBEA 5AR3A 5DHJA 3QZGA 2UW8A 3V01A 5A4CA 4QTAA 2ZNVB 4S2ZA 3MTNB 5M06A 3QZFA 4W9CA 1OUKA 3HDNA 3MY0A 4PMSA 3VUGA 4ZRJA 5HLWA 5K5NA 4F1SA 4TYJA 4IJ9A 2I7QA 3OZ6A 3CIKA 5E1EA 1IA9A 1GNUA 2G45B 1K3AA 4GFGA 4J1RA 1OIYA 3DNDA 4WKQA 4MCVA 4BN1A 3ZXZA 1FXTB 4I5PA 4BDHA 3SA0A 3V6SA 4D4RA 2Z8CA 3DFCB 3PXZA 2ZJDA 3HAMA 4ZSGA 5BMMA 4ZY5A 2C0TA 4MD8E 5CTPA 2J51A 2H8HA 3TL8A 2FCMA 3DK3A 4TYGA 5GINE 4YLJA 1ERKA 4EKLA 3VULA 2JT4B 3R7UA 2WKMA 2KWCA 5ETIA 3PREA 2XB7A 3B08A 4FJZA 3R6XA 3HMOA 5CENA 1A9UA 4AZSA 2WGJA 3MJWA 3H9OA 3QD4A 3BBTB 3PIYA 2GNFA 4W9XA 1G3NA 4WG5A 1OVEA 3AULA 5JN2A 4XLIA 4L46A 5CXHA 3R2BA 2HELA 1BYGA 3PY1A 4IQ6A 1JVPP 2C5YA 4BDFA 3SW4A 2GTNA 2X9EA 4DEBA 3UJGA 1WM2A 3QWZB 4LL5A 4ID7A 2GBJA 4BGQA 2BRHA 3PT2B 2YZLA 3JXWA 5IF1A 2BRGA 4C38A 4UY9A 3GC0A 3LFDA 3KYDD 4HNIA 2UZBA 4W4YA 1UA2A 3P2BA 5T3QA 3KB7A 3ZDIA 3VJOA 3I3TB 3UE4A 4LL0A 4U97A 4IVCA 5CEQA 2ITZA 2BGFA 3VQIA 4NFMA 3RPRA 2KNBA 4IZ7A 5A46A 3IDPA 5CEOA 5F9EA 3R7GA 5FM3A 3BV2A 1YDRE 3LIJA 1FINA 3EQBA 5HE2A 4AA4A 4EQUA 5HG5A 4YTIA 3A4SC 3TNIA 3ZKJC 4JR3A 3H1UA 3VRZA 4F7SA 1X1MA 2VTNA 3RAIA 3UNJA 3ATTA 3SG9A 4FTQA 5E7RA 1VJYA 3QGYA 2WOUA 3ZSIA 4W4WA 4ACHA 4EOJA 4USFA 1WX7A 5AZGA 3T9LA 4FOBA 3PJCA 5E8ZA 2PPHA 2VWXA 3CD3A 3BE9A 3OWPA 4ZK5A 2I1KA 4DAWA 4TY1A 4B0GA 5AA9A 4NM0A 3UZPA 3VVHA 3SG8A 4K6ZA 4R3CA 2FO0A 2ZMCA 1JKKA 3TACA 2KTRA 4XG8A 3RK9A 4BCIA 4EH8A 3UOLA 3R9NA 3L10B 2BALA 3DAJA 4NPNA 2SRCA 3MIAA 4LUDA 2J0KA 4FVPA 1YD8U 4IG7B 4JQ7A 4FTKA 2RGPA 2WU7A 2XK8A 3QTXA 2NRYA 3GCUA 3ZFYA 2ZDTA 4W9LA 3S95A 2HIWA 2F9GA 2OZAB 5IMXA 4YZMA 4BC6A 3L9PA 4IM3A 5J1VA 1WAKA 5AR7A 5HIBA 3ZRLA 4RVMA 2DWBA 2LRUA 2IY1B 4Q2AA 3HYHA 4Q5HA 4F0IA 4O81A 5AADA 3ZU7A 3BINA 1MUOA 3DTWA 4FL2A 5F1ZA 4GIIA 4AZWA 3R9HA 3RKBA 4QQJA 2ETKA 4EOSA 3N4VA 4XYFA 5KKRC 1PHKA 4QP1A 4FLHA 2GHGA 2WELA 4J6IA 5HE3A 2QOHA 5K4IA 2W1EA 3CGOA 3UGCA 4GRBA 5FM2A 2A4ZA 2R3KA 3R73A 5A6NA 3BY4B 4FKLA 3L9MA 5ACKA 5DCNA 3ZIMA 2VUWA 4MQ2A 2JKMA 5L8LA 2N9EB 1JPAA 3R21A 5EI6A 5AEPA 4LDTD 5AAEA 3QRTA 3KYCD 4II3B 4CLJA 4M8MA 5JZEB 2X2MA 4EK4A 1V2YA 5IQFA 3EFLA 4EOLA 3Q4CA 4YHTA 4BDDA 3DBLI 2FSLX 4WIHA 4FEQA 2VO3A 3G15A 1Y8GA 4G17A 4HCVA 4HZSA 2V3SA 4UZHA 4FV2A 4UBAA 4F9BA 3CEKA 3CMMB 3IKAA 3UQBA 3U54A 3ZRCA 1QPCA 2CKEA 2CR5A 3FI3A 4KIQA 3CTJA 3QZIA 4FT0A 1O6YA 4H1JA 4ZP5A 1BUHA 1NVSA 2JGZA 2HK5A 3D5XA 3NYOA 5EK7A 3FI2A 5IA2A 3OEFX 1QZEA 5C8MA 2E9UA 4C4GA 4OTFA 3ZRKA 1GZKA 2P33A 3JYAA 4PTEA 3KVFB 1IAHA 2CNQA 2NPTA 5JEBA 1E7UA 3U6JA 4RMAA 4ASWC 3EC8A 1Q1OA 5T68A 2KTRB 4XX9A 3WIGA 4IIRA 3V8SA 3C4ZA 3EJ1A 2ITOA 2XK9A 5G6VA 4N70A 3KMMA 4WSYA 3HAVA 4RT7A 4LV8A 1PRYA 1XH5A 2PSQA 3PVWA 1FVRA 4I41A 4MAOA 4CHKA 5HD7A 3TNPC 4HDOA 3I60A 5AP4A 2C0OA 1DM2A 3WOWA 3VHTC 4GV1A 5CYIA 2UZWE 1R4NI 3QCAA 3PXQA 2PZ5A 4RJ8A 2CS4A 3A9JA 4UN0C 4ZTMA 4UMTA 5FD2A 2LVQA 1RJBA 5EHLA 4C3PA 4E4NA 3UVQA 3V6CB 4PS3A 1QPDA 2XNBA 4J97A 3DU8A 2YVCA 1GIIA 2XRWA 1FPUA 4JBPA 4YC3A 1Q61A 3ZDUA 2O8YA 2M1MA 2O6VB 4WJOA 1RE8A 2AYPA 1V9JA 4C2VA 2O6VD 2LGXA 2HW7A 4KDLB 2BTRA 4F9AA 5GZAA 3W2CA 4B6LA 2C5NA 5LWNA 2RR9A 2NVUI 2VGOA 4FTTA 4I1ZA 4OBOA 5D12A 3UZRA 3CSTA 2C5XA 3TV6A 2WMBA 5JH6A 5LXMA 4O82A 3FLQA 4H39A 3HL7A 3MJ2A 4L42A 4GUBA 3ZLYA 1V6EA 2D07B 4FTIA 1WRDB 1AQ1A 1JKLA 3PLSA 4XC2A 3UOJA 4WNMA 5CSHA 3ZUVA 2J5EA 5E1SA 5HO6A 3S1HA 1URCA 2GCDA 4IC7B 4O96A 4CKIA 2JEDA 4C58A 2PMIA 5B2LA 5DA3A 2OWBA 3LCKA 4FV5A 4BKSA 2QR8A 3QD3A 2X7OA 4APPA 4HGEA 4NTSA 3R1SA 3L17A 4WWNA 4DGGA 3G2FA 5CZHA 2JWZA 3ZUTA 4MM3A 1I09A 3FQHA 2V1YA 2XJ2A 5L8JA 2IWIA 4AOTA 3APCA 3ZO2A 5C8KA 2WWZA 4I23A 4MXZA 2VZ6A 4F0FA 4Y5HA 5E9EA 3IFWB 4PX6A 2C3KA 3NNXA 3RT3B 5HEZA 3N30A 2OXDA 4KSKC 1RDQE 2BIKB 3AC1A 4ITJA 3NHEB 4AG8A 4YUQA 5L6OA 4AJYB 4MK0A 2RFDA 2DZJA 2L0FA 5IH5A 3IVFA 3DK6A 1OPJA 3HV3A 4I6HA 4KNBA 4OTGA 4AACA 3FLNC 3KKVA 5M51A 3R8MA 3C50A 4WBOA 4MXOA 2M8SA 5AR2A 1J1CA 1PXMA 1H27A 3KVXA 4M12A 2A4LA 3VIDA 4YBKA 1WF9A 3IGGA 4RFYA 2OJRA 3I79A 3IW7A 4FVQA 3D2KA 3ZTXA 3R7EA 2O6VA 2R3QA 2DYOA 2JFLA 3D9VA 2FGIA 1OIUA 2YERA 2KOXA 4GS6A 4LUEA 1J7UA 5DR2A 3WARA 1E5WA 4EEWA 4C8BA 2KFJA 3EMGA 2XRUA 3IBEA 4W9IA 4TWNA 4BBMA 3PRMB 3RZFA 4HGSA 4DYMA 3WAPA 4FEVA 3LHJA 4NW5A 5AP2A 3A9JB 4FUYA 3PJ8A 1B6CB 1CKJA 1YHVA 2XNEA 5B0XA 4C61A 4PF4A 4YTCA 2HZ4A 4FYNA 2OU7A 4W9JA 2KFKB 4FEWA 3BCEA 4DLJA 2L00B 4FV6A 4A07A 4A06A 3QQUA 4I92A 1R1WA 3G9NA 3RM6A 2VTLA 2A1AB 1NVRA 2QOFA 3HDMA 4I5CA 4NKAA 3NZ0A 4J8MA 4W4VA 2RL5A 1V5TA 2X4FA 3K3IA 3AU4A 4EC9A 5E92A 3VQUA 2O63A 1XQQA 1YXVA 2UW7A 3CQWA 4FIGA 4O27B 5EYCA 4BB4A 3C51A 3FKLA 2JLDA 1PMNA 4LCDE 1TQIA 5AUUA 4YP8A 5TT7A 4EUUA 4D2VA 3ZVVA 4AU8A 4XP2A 4HVBA 4J71A 2XEWA 4G16A 2Y7JA 3ZLXA 1NW1A 2D3GA 5HESA 3PIXA 4FADA 3IG3A 5LARA 3QUPA 4FTUA 1GG3A 3E5AA 1Q99A 4KZCA 4GT5A 5I9ZA 2X8EA 3PY3A 3EN9A 3ORNA 3UIUA 1FGKA 3SQQA 2XMYA 2XNNA 5DGZA 5A9UA 4QMVA 3MFSA 4I4FA 5DR6A 5CEIA 1PXIA 5LQFA 5J1WA 2AL6A 3EHVA 4FN2A 3R7IA 2AC5A 5T6KA 3SRVA 3Q6UA 4G2FA 2WTJA 5FLFA 3CQEA 1WGRA 2PK9A 4X57B 1OL2A 4CMOA 1VZOA 2WQOA 5A54A 3UIBA 1T0YA 4PMTA 4KUJA 5K4JA 3KA0A 4JIKA 3ZO4A 2BZHB 2CGUA 3DQWA 5IDPA 2GMXA 2LGCA 4FIEA 1M7NA 2RFEA 4BDJA 5AR8A 2IJMA 2OH0E 3JS2A 4GFOA 2HENA 5D94A 1H0WA 4ITHA 1M2QA 5J18A 2MBOA 4HCUA 2R7IA 1LEZA 5AA8A 1HE8A 1J91A 2IG7A 2QLUA 3LCOA 4IM0A 4L3JA 1P1AA 1U4AA 5DYJA 4XV3A 4F7JA 4AT5A 3DJ6A 2BAQA 2JKOA 3BYMA 3C7QA 1DAYA 4NIFA 5KZIA 5LVOA 4FMQA 4JS8A 4WJNA 3P08A 3KREA 2J50A 3DOGA 4RJ6A 2DHZA 3RAHA 3T9TA 4JDJA 3GBZA 4AXAA 5A14A 3DB8A 1MQBA 4V04A 3VS4A 3W8LA 1MRUA 1AARA 5K0XA 4PWNA 3TEIA 5CHFA 1OBGA 4L53A 1PMUA 4W8DA 1PMVA 2VTRA 4ZJIA 4ANBA 3TV7A 3TUCA 5FP5A 3E3BX 3ZHPC 3PZDA 4O7ZA 5GJDA 4O0XA 3KXNA 3PHWB 5I3OA 3L54A 3FLSA 4TWOA 5D1JA 1PXJA 2E9VA 2WQNA 2XNOA 5ANEA 4BDGA 4GOCA 5L2WA 3CR0A 3VS3A 4F7NA 4G9RA 2X9FA 4GG5A 3PWDA 2YLMA 2ONLA 4RX5A 2X81A 3UYTA 1Y91A 2JIUA 4ONAA 4X2KA 1Z57A 4TPTA 4DEDA 1E1XA 4EJ7A 3R9DA 4A3OA 3FC2A 2OO8X 3GCSA 3QX4A 3ULIA 4B99A 1SIFA 4WJPA 2GQRA 3FLYA 4AA0A 3MB6A 2W1ZA 3W2PA 4ZY6A 2W1CA 4IWPA 4MXYA 4XMOA 1JQHA 1WXSA 4WAAA 2BPSA 4AAAA 3R71A 3HRCA 1MRVA 3MH2A 5JFWA 4DHJB 2GS7A 3MA3A 3R7VA 3LMGA 4CTCA 3PSEB 2PVFA 3DDCB 1UNLA 3CKWA 4LYNA 3OG7A 4RWIA 2ZM3A 4IAYA 1U4DA 2W1DA 3R3MA 3LFFA 1WBPA 2KDEB 2PUUA 3FYKX 3IW5A 4UWBA 1SGHA 3VAWA 3EKKA 1Z9XA 3HECA 3HUCA 2XCKA 5E6OA 4KRDA 2OJJA 5CSVA 5DRDA 5CU2A 2X2KA 3HKOA 2G2FA 2VU3A 4OTWA 2W9NA 3MDYA 1ZMUA 2JDRA 3NRMA 1H08A 2JDOA 3F69A 2BRMA 3AMAA 4GT3A 4H58A 3I1AA 4EZ7A 1I44A 1ZXEA 4PNIA 3VFKA 4FE2A 4FGRA 4I6FA 3QCYA 2J7QB 4WG3A 2ZPNA 2BROA 4J52A 4CRLA 3KN5A 1OKYA 3PWYA 1ZYCA 1YX5B 2YJSA 3GNIB 3OCTA 4Z7GA 3DBSA 4JAIA 2OIQA 3KRJA 2WB8A 3NUUA 4R1YA 1E9HA 1Q3WA 2BTSA 3CY3A 3Q9ZA 2X8IA 2XEZA 3FMEA 4C7TA 4Z7HA 3OT3A 5C26A 4MD9E 2RSUA 3ZNGC 4U81A 4IADA 3BU6A 4FICA 4UZDA 3CS9A 3W2RA 2JZ3B 1APME 2Y9QA 2KK8A 4XRLA 4AZVA 1JRUA 4XRJA 4LGHA 4EHVA 4UEUA 1LUFA 3QALE 4RA4A 5HIDA 3UVRA 5JRQA 5KMLA 5FUTA 3D5UA 3OWLA 4PYZA 4QYHA 2YM7A 2R5TA 2YCSA 3ETAA 2JBPA 2I6LA 3E3PA 3FMJA 3Q4UA 4I5HA 2Z0EB 4WQOB 4W9GA 4IXPA 3AD4A 4HVGA 1WFCA 4L3PA 4TYEA 1XR1A 3VUXA 3CJFA 2GU8A 1CM8A 3TWJA 5J87A 2YWVA 4MDKE 2B3AA 3ZNHB 2XNGA 2J6MA 3VAPA 4FULA 3KRWA 4GFMA 4BGHA 2KTFA 2BZIB 2C7MB 3QRKA 2C7HA 5CLPA 3UDBA 2DX5B 2C60A 4BI0A 3ZFXA 4C3FA 5DMZA 5L2QA 3BHTA 1P2AA 3RM7A 4O0RA 2N1VA 1P4FA 2UW9A 3KCFA 3FL5A 3P7AA 4FZDB 5KE0A 5EOLA 3VUHA 2PZIA 1EF5A 1PYEA 4R1VA 4WHZA 4C36A 3JPVA 4D0XA 3QIJA 3OCSA 5IH4A 1Q41A 3K5VA 2RFSA 4EK8A 2WX1A 3WI6A 4BBEA 1E7VA 1SE9A 5CAVA 3ODYX 4RJ3A 4A9RA 2JXXA 2ZVNA 1XH7A 4HPUE 4B4LA 4G3EA 3H6NA 3AQVA 4IC7A 3R02A 3PDTA 2QCSA 2UZVA 2ZB1A 3BEAA 4IB1A 3PYYA 5AM6A 5TR6A 1ZYSA 2AC3A 4G6LA 4YZCA 3U87A 4M0YA 3ELJA 2QQ7A 5HX6A 3LVPA 3COIA 3D5WA 4MF0A 4C02A 2GBNA 3N32A 1U54B 2G9XA 3VUWA 2QG5A 3K2LA 2R2OA 2FNJB 4FBXA 2N9PC 4YBJA 5TO8A 4NJDA 3FLWA 4U8ZA 3VRYA 1TVOA 1KSWA 3BKBA 4PPBA 3UG2A 4IAFA 1FMKA 3I7BA 5C9CA 1ZKHA 3LQ3A 4KKHA 2J0JA 4QMZA 3TIYA 3HZTA 2VGPA 3FLZA 3FKNA 4HYIA 4MX9A 1H1WA 4ASXA 4E7WA 2NBUA 4H36A 3PGEA 5HI2A 3KC3A 5JHAA 2XS0A 3WIKA 3WIMA 2YDIA 3ZDMC 1YKRA 3FBVA 5DT0A 4D2SA 3TN8A 2GBRA 5C23A 3EQRA 3QTQA 4QP9A 2VX3A 4BFRA 2E9OA 5BVFA 3W2QA 4DFUA 2CJMA 3KY2A 1WGGA 3I6UA 5IQCA 2F49A 2W1HA 4OVVA 4NTTA 2QONA 3ZCLA 2KLGA 2GQSA 1IASA 5I9XA 4EKKA 3Q04A 1XJDA 2YAKA 3PS6A 3TIZA 3BI6A 3V60A 3DXNA 5JT2A 2MP2A 4HPMB 4KSQA 5CXZA 3QQ8B 2KX3A 1GIJA 4R8QA 3VW6A 4GH2A 5C1QB 2JDSA 3CTQA 3MGYA 4FL3A 1LR4A 1WMHB 4M15A 2VTAA 3QK0A 3VHEA 5DPWA 2WD1A 2KXJA 2ITQA 5TKDA 2AL3A 4EQMA 2JPHA 3IOPA 4AWJA 3K5UA 2O2VB 1YOMA 4QQTA 4M68A 3LFEA 3NOBA 4JDIA 5EDSA 5HG7A 3GFWA 4BWXA 1LFDA 1OQYA 4BOSC 2CNVA 2RSVA 5FEEA 1WBVA 4EI4A 5I9YA 3GCPA 4KBKA 3KXXA 4Q9SA 3E92A 4ZAUA 1XBAA 3A33B 3PA3A 2RG5A 3NVKI 1CDKA 3ACKA 3KCKA 3S3IA 3SXRA 4ORKA 3RI1A 3UIXA 4FZ6A 3DBQA 3ZZWA 4DWFA 3H7PA 1F9JA 2EKEC 4EH4A 3SHEA 2UUEA 4QP6A 2C6LA 3B8QA 3SAYA 4WG4A 4DGLC 4EK5A 5BYYA 2P2IA 2HW6A 3IDCA 2WTCA 3W1SA 3U8ZA 2YM4A 4HXDA 4HOKA 1QPEA 3JY9A 4RQKA 3OCBA 3W8QA 4BKYA 4DFYA 5HNIX 4YJQA 2YIYA 3R83A 4YL8A 1YXXA 1SNUA 1SVEA 4RIWB 2ETRA 5EKOA 4M66A 1UBQA 1H4LA 2PMLX 4M14A 1Y57A 4DE4A 3KFAA 5D7AA 4YO4A 4R7IA 5FDPA 2FSMX 2P3GX 2XUUA 2ZV7A 4GU9A 4LGDA 3WYYA 4CGAA 4ZTSA 5C4KA 2Z2WA 4P5ZA 2GBKA 1XT9B 2PY3A 3G0EA 4Q5EA 5HE0A 2DYLA 3FC1X 5CHWA 4NU1A 1PXNA 1WMHA 3QC9A 4FKOA 3TKIA 2UZLA 5IEVA 3DXPA 5IQAA 3ANQA 5E8UA 4FHJA 4AOFA 1H8FA 3RAWA 1YI4A 4S31A 4NAWA 3P23A 3T3VA 1RRBA 5LCKA 4EORA 4RZVA 3H0ZA 2JAVA 3VF8A 4ACDA 5JZJA 1G8SA 2PUIA 2CN5A 4DG3E 3R63A 4RQVA 5CQUA 4FKIA 4EONA 4EH2A 4YURA 3UP2A 3HM3A 2J2IB 3GEQA 3KH0A 1UVRA 5EQPA 3KXGA 1JWHA 2KVRA 4ZXTA 5HZNA 4A9YA 1NXKA 4U9AA 5IUHA 2KC2A 2ZAZA 4FSRA 4OBQA 3E64A 3A7JA 3KUZA 3ZSHA 2FCQA 1M17A 3QU0A 5HVYA 3EFWA 3D15A 3RZWC 3GU7A 2BILB 4FSTA 3NUYA 4U79A 3SOCA 3ZBFA 3EFJA 4TQ0A 4ICUA 4G0NB 2PZPA 4C62A 5CANA 4CFFA 1TZ1A 3R8PA 3NUSA 1H1SA 5DT4A 5TF9A 3VVWB 3EQDA 2F7ZE 3M42A 2UZUE 4MEMA 4UWCA 3A1QB 4IX5A 2XNPA 2KLCA 4RMZA 4ACCA 3ZW3A 3JYUA 4W9EA 4G11A 3TNQB 4BDEA 3QAQA 4GK2A 3UO6A 4L7FA 2DENB 1WBOA 4UB7A 2OF4A 1IEPA 3EQIA 3PP1A 5IDNA 5HTIA 3M2WA 4KIKA 5E6PA 3DY7A 2QO2A 4M69B 4NM5A 5B2KA 5IA7A 4ALWA 3HHMA 4A4LA 2ZV8A 4ERKA 4KDIC 3R04A 3GC9A 4ARKA 4AP4C 4AUQC 2PE2A 1K9AA 3PVUA 5CQWA 1ZOHA 1T46A 1SMHA 1J7IA 3DTCA 4BCJA 4F99A 4O7YA 2XIRA 3C0RB 3E8EA 4DC2A 2GHLA 2WPAA 2HZ0A 3H7SA 1TKIA 4BCHA 4EOIA 4N9F4 1Q0WB 3DQVA 2BDFA 3KXZA 2ZNVC 3LOKA 4Y85A 4FV8A 2ITWA 4FT3A 3NLBA 5BVKA 3B0AA 1OKVA 3JVSA 4I0SA 2CMWA 3HA8A 3FKOA 1VYZA 5AV0A 2XK5B 4IH8A 5CU3A 4CZTA 4AJWA 2J9MA 3SD5A 4LMNA 1ZY4A 5HORA 2CSNA 3NYXA 2G1TA 3GU8A 4L6QA 5HQ0A 2KO3A 3R1YA 4PTCA 3VBQA 3TM0A 2XF0A 3Q53A 4LM5A 3M95A 3BHYA 3D7TB 2CLXA 3ZO1A 2IZVB 4RFZA 4NAWB 5G2NA 4FTCA 3SDLC 1NT2A 2OJ9A 4E1ZA 3NS9A 2XKEA 3MB7A 4OTQA 2N7DA 4F70A 2VTIA 3L8PA 3IONA 4EYMA 3T8MA 1H1RA 5EDRA 2FCSA 3UNZA 3IK3A 4CZUA 5BX0A 3N4TA 3ALNA 3L8VA 2XJ0A 2P2HA 3BBWA 4EUTA 1WE6A 2MBHA 4PV0A 3KQ7A 2XNMA 4X21A 3U9CA 2UV2A 2W1IA 5FXSA 3VS2A 4M8TA 4N0SA 3WF7A 1CKIA 4HVDA 3RZBA 4IX4A 4HCPB 5M09A 3UVPA 3R28A 2C1AA 3R8LA 2IW9A 3R0TA 4B7TA 2WHBA 5J8IA 4MWIA 4BWKA 4D4SA 5JZNA 1GOLA 4H3QA 5FG8A 4ANLA 3LDZE 3LFNA 3DBCA 4QMTA 2YABA 3ROCA 4CCUA 5GZ8A 1P0RA 2OF2A 2IVUA 4E6QA 2AEHA 4RM8A 1BKXA 1YDTE 4WNOA 4AWIA 2L8JA 5BVEA 4EEVA 1OGUA 4TNDA 1YI6A 5J7BA 3BQRA 3MPTA 4KINA 5A4LA 3UIOB 3DDQA 4LRMA 2XM9A 4RPVA 2NO3A 3IW8A 2OK1A 3LJ0A 4FV7A 4CZYB 5EW3A 4BZNA 2F7EE 4DLIA 1GC7A 5IQBA 4OVUA 3WANA 4JXFA 5LVPA 4GDLA 4H3BA 3REPA 4TUUA 3ANRA 4GYGA 4F8CB 2QO7A 3O23A 3D14A 4RIYA 1H1QA 1U5QA 2R4BA 5L8KA 5DPSA 1KV1A 1Q8TA 3U9NA 5LXHA 4FTAA 3UQAA 2UZEA 1F5QA 3RCDA 2WIPA 3OEZA 5M44A 3DA6A 2VTQA 3PP0A 3Q9WA 1LM8B 1OMWA 2DAFA 3CTHA 3D32A 3NIEA 2R3NA 3AMBA 5IH6A 4X3FB 2BUJA 4PS7A 3F2AA 3AC3A 4ENXA 4BZOA 4C4EA 2UW6A 5I4NA 1R0EA 2OI4X 2KMAA 4BZDA 4N6YA 2R3HA 3AXCA 2WMSA 3HVCA 3TZ9A 2KKCA 4NM7A 3Q4ZA 3GXLA 5DVRA 2Q83A 4I24A 1VR2A 4IW0A 2BR1A 2OSCA 4O1PA 2L7RA 4R6VA 3AU5A 3CGFA 2W17A 2C47A 2O2UA 4A4OA 3D2IA 2XBAA 2QODA 4FKSA 2PJHA 1UWHA 4DITA 3EQPA 2BCJA 4WRGA 2GMIC 3M1SA 2K25A 2HZIA 4QTBA 3UBDA 3FMHA 3ZXTA 4CKRA 3CY2A 2GOWA 4LOQA 3ZBXA 1I35A 1VCBA 4S32A 3JR1A 3C1XA 3MYGA 3Q4TA 4M97A 5EYKA 5LJJA 1OITA 4FTOA 5F4NA 4KIOA 4MQ1A 3TZMA 1WX8A 4KV2A 2OW3A 1WFYA 1JSTA 2YDJA 3OBGA 3VC4A 2YIQA 2I0YA 2WMWA 4IFCA 5H8GA 3SDJA 4XCUA 5CI6A 4YR8A 2ZVAA 4GDLB 4P5QA 1CSNA 4AGWA 5JHBA 4O21A 2QG7A 3KF7A 3EN5A 3V5PA 1DAWA 3WE4A 4MF1A 4CYIA 2P55A 2JIIA 3AC5A 4DT8A 4ACMA 1KE6A 3QTIA 4PL5A 2MBQA 3QWKA 2WMVA 3RWPA 4ANNA 3NPCA 2WZJA 2X7GA 5F94A 4D58A 4JG8A 2B4SB 3DS6A 5K0KA 1RAXA 3FMDA 4QYGA 2PVRA 3ZLSA 2ITUA 3ZC5A 1P14A 2G15A 2WXVA 4FUXA 4CNHA 3FAAA 1WVYA 5LVMA 3WE8A 3I0QA 3BX5A 2Z7LA 4FKWA 5AV4A 4CYEA 4W9HA 3BHHA 3OS3A 4JBQA 4QMLA 2NBVB 5BNJA 4DTBA 3L8XA 3LPBA 4OAVB 3HV7A 3OY3A 5IQDA 1WY8A 2GNGA 3MH0A 4GG7A 5KBRA 3G6HA 2YACA 4CTBA 3KW5B 2CKQA 3O51A 4JQEA 2HY0A 4DH8A 3FHIA 2OIBA 2E2BA 3U4WA 3ZUUA 2DYMA 4BCGA 2BZJA 2OZAA 4HPLB 3BIZA 4W9WA 1WBSA 2JDVA 3KUDB 4UV0A 5DOSA 2VTTA 3WYXA 4C0TA 4YGAA 5LMKA 4D2RA 1P9DU 3DQXA 4O0TA 3PRFA 3HNGA 3PXFA 3BGQA 5JK3A 1TQMA 4GW8A 5HU3A 4MJSA 4NYEA 3OUNB 3QTWA 3UP7A 2VWIA 5CU0A 3PVGA 5C4LA 4EFOA 4LRKA 4AE9A 1MRYA 1ZGUB 1WJ4A 2Z7SA 4HGTA 2X2LA 3FYJX 5D11A 3VBTA 2JIVA 2R3MA 5E8WA 3TG1A 3VJNA 4OAUC 3EOCA 4EHZA 4G5PA 4IVBA 4FSWA 2X4ZA 3V5WA 4GK4A 2V0DA 4R7HA 3ENMA 4EZ3A 5HG9A 1L2NA 4KZ0A 5E6NA 2HE7A 2YA9A 2CLQA 2QVSE 3F3ZA 4NCTC 4XZ4A 1DI8A 4I93A 3LM5A 4LRJA 3V62A 2FUHB 2VTSA 2M0XA 1OL5A 3OOGA 4ZEGA 4NL0A 2YIXA 4IZ5A 1C3TA 4HYHA 2YM3A 3DJ7A 3F5UA 2BWES 5IA5A 4DH7A 3ODZX 2CCHA 3ET7A 2LRWA 4G31A 3AC2A 3MY5A 3QQGA 3GB2A 4AF3A 1EF1A 1BI8A 4EOYA 2IO3B 2RKUA 1KM7A 4IAIA 4HGLA 2DZIA 1UZXB 5ANKA 5F95A 4C4FA 4F1MA 5HTBA 4D5HA 1LXDA 1M2PA 2JVCA 5BYZA 4DA5A 3TDWA 4ENYA 3SHQA 2C1BA 3I7CA 4JI9A 2OZOA 2NS5A 5AV1A 4A3PA 3PUPA 4FK6A 3MFTA 4G34A 4P7IA 2ITYA 4AW0A 3UIMA 3F3TA 4ALVA 3PV1A 2XZSA 3DBDA 2J0LA 4KRCA 1LQBA 1XH6A 3VUTA 2QO9A 2V5QA 2VAGA 4WT6A 4JIOU 3S0OA 4K7WA 4LMUA 4L68A 1JSUA 4L3LA 2BKKA 3HIZA 5K3YA 3M11A 5FTGA 1O6KA 1OL1A 1PXOA 2HWPA 3LFAA 2CPKE 2PMNX 2WMXA 3HV4A 4U6RA 3VBXA 4MYGA 4HDQA 1S3SG 2VTOA 4AW5A 5LVNA 4BCFA 3P4KA 1NVQA 4L67A 4JQ8A 4R3RA 4XNEA 2W1FA 1ZLTA 4TYIA 2LGYA 4PS8A 3FZPA 2B52A 3OY1A 5KMNA 3IOKA 2MWSB 2Z59B 3JSVB 2EUFB 4RJ4A 4XV2A 1ZWSA 3BELA 3Q96A 5ANOA 4D55A 3HLLA 4EOPA 4YPDA 3COHA 5HU9A 4CG8A 1WBTA 4FSMA 3VUKA 2FA2A 3KULB 3ORIA 4LOOA 5HCZA 5AWMA 4K11A 4ZIMA 1WBWA 3OXTA 1JSVA 4IE9A 3ZLWA 3PLVA 4KBAA 2BKFA 4GN1A 4O7WA 3UOHA 1KOAA 2FB8A 3DXQA 5TOZA 4AT3A 4F9YA 4AZTA 4TKNA 4KWPA 3HP2A 3VW8A 3LXNA 3PLAE 3QARA 5EFQA 4E93A 2XKDA 2YITA 5FXQA 1YVJA 3A99A 2WEIA 4QMNA 5CEPA 3R7OA 5I3RA 3P1AA 2RFNA 4M0ZA 1JBPE 5DPVA 3RPSA 2XYNA 3RAKA 4EJNA 1OI9A 2IZSA 2QOKA 4F0GA 4O91A 4K1RB 3V5LA 3VBWA 4DEAA 4NM3A 3NNVA 4KBCA 4EOMA 5DWRA 2GNLA 3E87A 2R9SA 2Y0AA 2A19B 3UNKA 4DEEA 3NWWA 2Q0BA 2KN5A 5AIKA 4LV5A 5AV3A 3NY5A 1M7QA 4O0SA 1OKZA 2W05A 2CHLA 4O1OA 2W9ZB 3GC8A 3NUXA 3QRIA 1E90A 1UELA 4DFBA 3NYVA 3QRUA 4RBLA 4RLKA 4ZZMA 3ZS5A 4F65A 2BFXA 4PY1A 5I9VA 1LP4A 3LAUA 3PZHA 2ONLC 3BWFA 3VS7A 3LFCA 4AN2A 2R3LA 5BUIA 3W1YA 5AFVA 3QYWA 5JQ8A 2DQ7X 3B2TA 5IKWA 3ZMMA 4E6AA 3TDVA 3HV6A 1PXPA 2ITTA 4MSQB 2BRNA 3DK7A 2PU8A 4P90A 4CFVA 3QAME 2AYOB 4LDTB 4ZYNA 1CMKE 3NAYA 2XCHA 3P7BA 4WNKA 4YU2A 3VWAA 5EYMA 1WXVA 3PLUA 1YWNA 4QP8A 2JDTA 1J19A 2PMOX 3FXXA 2OJFE 3OROA 4JG6A 5FTOA 2ERKA 3ERKA 5EQYA 1PYXA 3E7OA 1GZ8A 2EWAA 3BV3A 3DDPA 5M55A 3VUDA 3EHAA 4BI1A 5B7VA 2GBMA 2EXCX 4U5JA 3A7HA 4D4YA 3QTSA 3EQGA 4XG4A 4ZSAA 2C5OA 3HUBA 1H07A 1REJA 3I6WA 4HJKA 2LXAA 3CLYA 3KL8A 4BCNA 3OLMD 4EK6A 4EC8A 1H26A 3IDBA 4RC4A 4ERWA 1OM1A 1XH4A 4FKUA 4IWOA 4KKGA 3R1QA 4A4XA 2D10A 3UPXA 4BKSD 1XH8A 4ALUA 3W1SC 4XOZA 3AXWA 3PG3A 4QRCA 4PPCA 1L7YA 1H8CA 4OTHA 4BDCA 3WAOA 4KKEA 4XJ0A 5ANGA 5HKMA 3EIDA 3IO7A 4USEA 4YHFA 1WXAA 1ZW7A 5L6WL 4MXAA 2MQJA 4YO6A 3SW7A 2G3QB 1SVHA 4BYJA 1BL6A 4C4JA 5I9UA 4BOZB 5KX8A 5IAAC 4DDID 2ITNA 4ASEA 3NVMB 4X0MA 1V5OA 3WALA 4ZTRA 4X2NA 2UVZA 4E4MA 2FIFA 4GDKB 1F0QA 3ZFMA 4QO9A 2EVAA 4IWQA 4L01A 4YJPA 4OUCA 3D83A 3FQEA 4FSQA 4NH1A 1FOTA 2A2AA 5CI7A 5LVLA 3O65B 2Z60A 4FV1A 4MH7A 4CKJA 4M0WB 5A4QA 3O8PA 4V0GB 3PJ1A 2VX0A 3CKXA 4K2RA 2CN8A 4RIXB 2KZRA 1V0PA 3RINA 1WZ3A 4IB5A 1H00A 3FDNA 4ZLZA 2UVYA 3LJ1A 2XK5A 3RJCA 4ZZOA 3EZRA 1R0PA 2FAZA 4QYEA 4P4CA 2C6TA 4IB3A 3U6HA 3FV8A 4FKJA 3PTGA 2UZDA 3QCSA 3TZ7A 3S00A 4FKVA 4O84A 2OOBB 1B39A 3UC4A 1A48A 1H4RA 2EXEA 4CFWA 2OFVA 4E5AX 3UODA 4ANSA 5JGAA 2WX0A 4JGHB 3MVLA 5A4TA 2MSED 2ZPYA 1B38A 1FVTA 2XIZA 3BEGA 3O2MA 3A62A 5C8NA 4XG7A 4F9WA 3GFEA 4FTMA 4OT5A 4N4SA 1ZOEA 4RWJA 1YHSA 2FH9A 4O22A 4EOQA 4HVHA 1NBFC 2L3ZA 4FG9A 3U8WA 1CKPA 4R5YA 4R78A 4DTAA 5IISA 4BY9E 4IZYA 2PVYA 2W9FB 3POZA 3R1NA 4FIIA 4U3ZA 4UYNA 4X3JA 3MPMA 5AX3A 2F2CB 5HLPA 4BICA 1YOJA 3NUNA 4FSNA 4E5WA 5E8YA 4WWOA 1OUYA 2BYFA 3FWQA 3EFKA 3CPBA 3FY0A 2WMQA 5BVNA 2QLQA 3QCXA 2PL0A 2HXLA 3QTZA 3QQKA 4ZOGA 3S2AA 3D7TA 1ZZLA 4YZBA 3QX1A 4BBNF 1FQ1B 5M4UA 1XD3B 2BYVE 2Y8OA 1WMKA 5H8EA 3FSKA 4K1BA 3ORKA 2Y4IB 4DFZE 4MJSB 3LKMA 3OFMA 3C4EA 2Y4IC 3CCNA 2KQSA 4GIVA 4N57A 4MXXA 2HY81 4GMYA 4WUNA 3ROYA 3C4FA 3PFQA 3VQHA 4UMPA 4K77A 1GY3A 4G6OA 4YSJA 3R8ZA 3G51A 3TBLD 2UZTA 3NX8A 2ZJWA 4FT9A 4BTFA 4BVUA 3CP9A 3KN6A 4E3CA 3ZTCA 5GNKA 2V22A 2VWYA 2NR2A 4XX5A 4FNYA 1TTNA 2LGDA 3C5IA 2PZYA 5IQHA 1PW2A 2KQ7A 4NZWB 3VDZA 1ZYDA 4BDKA 3P79A 1J7LA 5JSMA 4U43A 2R64A 2W7XA 2WO6A 2J0MA 5HE1A 5EI2A 3NIZA 3PPZA 2W96B 4X3FC 4UMRA 3SXFA 2FCNA 5M4CA 4TL0A 5BVDA 4FIJA 2LUEA 4JX3A 3ZTDA 1K2PA 1CTPE 2RPQA 4FEXA 4B9DA 5EM6A 1WJNA 4RIXA 3LFSA 3CSFA 2OICA 4XG2A 1EO6A 3ULZA 4UYAA 2FSOX 3PJ3A 2JFMA 3D94A 4ANMA 4H1MA 2WYQA 4J8NA 1XBCA 2QHOA 2NP8A 3LE6A 3RWQA 3TXOA 2C6DA 3MA6A 4Y5QA 3UO4A 1DI9A 4E20A 1WBNA 1V49A 1UD7A 3RPYA 2X8DA 4QT1A 3UQGA 1Q4LA 4YZDA 3QXPA 3R8UA 3R7RA 4BWPA 2GS6A 5CAPA 5J5SA 4F1OA 2Y5BB 2Z0DB 3QHTA 5L2TA 4ZRIA 3NUPA 5AUWA 3RD2A 2RD0A 2C0IA 3I5NA 3F9NA 2BAJA 4IACA 4RIWA 5FP6A 4CXAA 3H3CA 2QURA 3OWJA 3W32A 2G2HA 3C0IA 4YHJA 4BCOA 1AD5A 4CD0A 4O2ZA 4FK3A 2X1NA 4IDTA 3ZDTA 2KJ6A 3U30A 3AD6A 5FBOA 1XH9A 4Y73A 2YISA 5EDQA 5J2RA 3G5DA 4RFMA 1UU9A 4W9DA 5K9IA 3ATSA 1QL6A 4MNEB 3FMMA 4CFXA 1GUAB 2PTKA 4YTHA 2V7OA 4GSBA 3JVRA 2V55A 1FGIA 2GPHA 2I0EA 2I0HA 2PVLA 4FOCA 5KMOA 4W4XA 3FI8A 5C1ZA 5CHVC 4BVUC 2ZM1A 5EM5A 4A20A 1O6LA 2V4LA 1ZYLA 4DBNA 2GFSA 1PY5A 1E8YA 2R2QA 4MNFA 1BLXA 3VBVA 3I5ZA 1YI3A 2HD5B 4O86A 4HWIB 2WMUA 4L8MA 2XEYA 3MY1A 4K33A 3V5QA 3RUIB 4BDIA 4F4PA 3F5XA 3VTUA 3FSFA 3O0GA 2ZCCA 4J53A 4F6WA 1WZYA 2K39A 4RSSA 1Q97A 3F5GA 4BDAA 1O9UA 4MGIE 1ZMVA 4O7LA 1Q3DA 3NW6A 4AN3A 4HYUA 4IB0A 3MSSA 3OP5A 2IW8A 4EOOA 3AD5A 5CWZA 4G3FA 4O6EA 2WFYA 5GJGA 2KHWB 4HCNB 3VXWA 4W9FA 4PDOA 3UMWA 5G1XA 2H34A 4DEIA 4FIHA 4CVAA 4ZSEA 4LOPA 4YJOA 1W83A 2ITXA 3HX4A 4TYHA 4PYUA 1FVVA 2WEVA 2MP2B 1YRPA 3MVHA 5L2SA 3DCGA 3QKMA 1J1BA 4C33A 2QHMA 5J9YA 2J0MB 2ITVA 4JIAA 5M57A 4EQCA 4KA3A 4G9CA 4TT7A 3POOA 2XH5A 3TJDA 2KD0A 5D41A 2LJ5A 5BO4B 4DBXA 1X8BA 4QTCA 3JUHA 5AIRA 4D28A 4Z55A 5HHWA 4DH5A 5JFXA 3KF4A 3ZLZA 2KMCA 4APCA 1U46A 2OXYA 2Q0NA 2PUNA 1BMKA 3G0FA 3PA5A 3DGKA 2B7AA 4YTFA 5JGBA 4G50A 3DPKA 5JQ5A 2CGWA 3EWHA 3PSDA 5ICPA 2HAKA 4O0VA 4MGZE 4W9KA 3ZO3A 2XKFA 1H01A 2VO6A 4RGJA 4C59A 2G4SA 3F2RA 5JFVA 3DBHI 5DG5A 2Y6OA 2QI8A 4J98A 1IPGA 2C5LC 2HYYA 4DCAA 3NGAA 2G01A 2NBWB 4NNJB 4EHGA 3KEXA 2IYDB 2QC6A 3BU3A 4JDKA 3IS5A 1OIQA 1SVGA 2ASQA 3RYTA 3O7LD 4IMYA 3A4RA 1L3RE 4YNOA 5EW8A 3VNTA 5AUXA 2QU6A 4RG0A 3RK7A 5A4EA 1Q8WA 1T45A 3GGFA 4MEDA 2WMRA 2PE6B 3ZONA 5CNOA 4G6NA 2XK6A 2NRUA 1EUVB 5HLNA 3HA6A 1W98A 4FV4A 4EZJA 5AEKB 3BU5A 5HVKA 3B2WA 3R22A 4JBOA 2EMSA 2VN9A 2IVVA 2WMTA 4U7ZA 4L7SA 2J4ZA 4WO5A 3CSVA 5M56A 1YX6B 3LQ8A 4YZ9A 3FL4A 3U55A 5C03A 4DXAB 1URWA 4L43A 4O7RA 3MFUA 3KUCB 4C4IA 3R7YA 3ORZA 4CFMA 4GL9A 2XA4A 3QCQA 3ZUNA 2MBEA 1W7HA 3Q5IA 1PKDA 2ESMA 4IFGA 3DOWA 3GQLA 4DHZE 2H96A 4X6RA 5CVFA 5HBHA 1HOWA 3T9IA 4XP0A 5CSPA 5M4IA 4D2TA 4XH6A 3A9KA 2IO2B 2CCIA 3VH3B 2VRXA 3V61A 1MP8A 2W99B 1H1PA 4PMPA 4H05A 2VTHA 4R3PA 3SVVA 3F5PA 2BAKA 4FSYA 3RBWA 4D1ZA 3ZEPA 1S1QB 2KWVB 3NMUF 2CHXA 4AGDA 2BMCA 2ZVOA 2WTVA 3R01A 3DKGA 1G8AA 5E4HA 3MFRA 4GU2A 2PWLA 4GU6A 2K6DB 1UU7A 5TR5A 3P86A 4BDBA 3BGPA 4IX6A 5AX9A 4LI5A 2REXA 3F3UA 1U5RA 4GUEA 2QOOA 5KMIA 3FZTA 4U44A 2GNJA 1UGMA 2RGFA 3MWUA 2O64A 4GT4A 5AP6A 2Y4PA 5EYDA 2EB2A 5A6OA 2C7NB 4ZTHA 4LFIA 2JKKA 2DAJA 5L83A 2BFYA 3BWJA 1JLUE 2A27A 2OFUA 4BIEA 5JGDA 5J9LA 3U7DA 5AR4A 4ZRKA 2A0CX 2VO7A 3F7WA 5HO8A 2WOTA 4K9YA 4YC8A 3VUYA 2VX1A 4XV1A 1KJTA 1ND4A 4BHZA 4QMYA 1ZRZA 4FKQA 2IO1B 5AP7A 3NW7A 5HGIA 3V6RA 3MIYA 1BT0A 3KXMA 2W5BA
chains in the Genus database with same CATH superfamily
5KHXA 3FPMA 4XEYA 4RX7A 3DCVA 5GIOE 4HW7A 2MJEA 2DS1A 3PA4A 3WZUA 2AEGA 3VH4B 4FZ7A 1VD2A 3QQJA 3AOXA 3SKCA 3C0GA 1J0GA 4LJOB 3Q3MC 4ZMFA 2IVSA 3DLZA 2QDFA 4OTIA 1QPJA 4NQLB 4L45A 1WYGA 2L76A 2JUOA 4BTJA 3VTWA 4DHFA 4YTNB 4USDA 4EWQA 1XWSA 3ML8A 2R0UA 5LWMA 3NJTA 1YN5A 3AG9A 1V81A 4US9A 3ZM4A 3BVMA 2LVOA 4IM2A 2JRHA 4UMUA 4KSLC 1PGAA 4ARIA 4O4DA 3IECA 3SD0A 3WF5A 1R4MI 3UINB 4M7IA 4ZLYA 4X2GA 2E6XA 2RIOA 1OL7A 3W2OA 5IA4A 2DZKA 4DFUA 5DLSA 2UYZB 4ZTLA 1KE8A 1YQJA 3F3WA 4FZFB 1UV5A 3WZKA 2Z7QA 1N5WA 2UZOA 2WTIA 3Q32A 1UKHA 1Y8YA 3NW5A 2PYWA 4AA5A 4D5KA 3F82A 3G6GA 3EL8A 5J79A 2FYSA 2XVDA 4BTKA 1TGZB 4OT6A 1PXKA 1L5PA 3DLSA 1NYRA 4QNYA 1VJKA 3DNEA 4QPMA 4RIOA 3NAXA 1RQQA 2XJ1A 3OW4A 4D1XA 4BKGA 3WZJA 3QLGA 4IWDA 5DE2A 3DBRI 4UXLA 2L1AA 4I94A 4KB8A 4HLEA 3CPCA 2IJ0A 2J7TA 1Q5KA 2HOGA 4BGGA 3H0YA 5HCXA 4U40A 3EFUA 2MBBB 3N4UA 3QKLA 5ITAA 4WRSA 5H3QA 2BHHA 2BIYA 4F7LA 1C78A 5E8VA 2XIXA 5FEDA 4PUZA 2EU9A 3CIRB 3D4QA 3GT8A 2CKOA 2W5AA 2JITA 4L23A 3IXSA 1D4BA 3DBFA 1W84A 2W5HA 4YC6A 3UOKA 3QA0A 4L52A 4V01A 2GS2A 4E4LA 2IZTA 2YM5A 1FNWA 2YCRA 4QNAA 2PVNA 2MA9B 3TZ8A 4REZA 3E56A 2UVXA 5EKNA 4YLLA 2KULA 3W0OA 2PVMA 2RF9A 3LCTA 4O7NA 4ZTQA 1YXTA 3GU6A 3MVMA 3PXYA 2QKWB 3Q52A 2IY0B 1YXUA 4QMSA 4B95A 4EH6A 4S34A 1VEBA 4FEWA 3F61A 3FZ1A 4MBLA 5FEQA 4QTDA 3OXIA 2N1WA 3E93A 3DBEA 3BZDB 3R2YA 3UQCA 1MG8A 5IQEA 1LO5D 2FSTX 2WIHA 4CT2A 3NG0A 1YHWA 3UYSA 4J7BA 3TIXA 4C37A 1UF0A 1G6JA 5FWKK 3W16A 2V7AA 3FUPA 3OTVA 3BLHA 2VNYA 3SV0A 3LXKA 4DHJD 4MBJA 4GEOA 3CQUA 4GCJA 4Y95A 4ACGA 4D4VA 2X7FA 4OVZA 5H9BA 1WGDA 4PL3A 3U2SC 3KGAA 3ALBA 2C6EA 5BUJA 3NRZA 2W3RA 3R30A 4K18A 3EKNA 3QC8B 1OKWA 3T3NA 3KU2A 5HVJA 2WU2B 2B54A 3Q6WA 3QWJA 2BF8B 3PIZA 1SJED 2R3GA 2P4IA 2MLBA 1JNKA 3KK8A 2J90A 3VBYA 2BB6A 1E8WA 2OXXA 4B0MA 3ACJA 2CJNA 3A7FA 4NJCA 3NCGA 2CKPA 3F2NA 3QTUA 2QOCA 2PZRA 2EB3A 3ORTA 4P7EA 2BHEA 4FZAB 3UO5A 1E6EB 2DNFA 4JQWC 4CLIA 3VUMA 3TJPA 4L9IA 4S30A 1TBEA 4QP3A 4IVAA 4KIKB 3TJCA 1MI0A 1KUTA 2WTKC 2C6KA 4M84A 4AFJA 4EZKA 4I6PA 3FQSA 1Q8UA 4I6BA 5F20A 3F6XA 5HOAA 4QPSA 3I0OA 2LXCA 1P5EA 4LQMA 3KRXA 4ZSLA 3NDMA 2I1JA 4I6NB 3F66A 4WIPA 3TL5A 3CE3A 3ZJTA 4IVDA 4EBVA 5BMGA 1XO2B 3L9LA 2PVKA 3OD6X 2IZUA 1OTRB 4OZCA 2DUVA 2NPTB 1YOLA 5GHVA 4URKA 2IBIB 3EN4A 4AT4A 4DN5A 4HNFA 2GFCA 5DIAA 2KNBA 4FL1A 3H10A 3H30A 4FA6A 4MD7E 1SM2A 4QYFA 3TV4A 4D0WA 1AWDA 5CAQA 4UWYA 3BLQA 4DCEA 3OUKA 3VS6A 4H3PA 3RP9A 2JY6A 2JSVX 3DV3A 4NIFB 3LLTA 4OLIA 4UX9A 1YWVA 2MHJA 2WDTB 5EHOA 3ZJVA 5DT3A 1XKKA 2VH1A 3DB6A 3QHWA 3RHXA 3HP5A 5CAOA 4MHAA 4QMMA 2CHWA 3AKKA 3GOPA 3Q9YA 3GP7A 4FV9A 1J8CA 5IEYA 5KCVA 3PE1A 4ITIA 4X7QA 3H9FA 1JOWB 1WXMA 1GZOA 3NZSA 4MNEA 3GQIA 3TCPA 4QOXA 3M63B 2VO0A 3E8CA 1P3QU 2N7EA 2I0VA 5FXRA 3TKHA 1DOXA 2LWPA 3PZ7A 4DEHA 5D2MB 1XQZA 5D10A 5E91A 4BL1A 1JWSD 3AB5A 4BCKA 2JZZA 4NKSA 4LLGM 5IMEA 2PLPA 3ZC6A 1RFAA 3Q8CA 1TZOA 1YJ1A 3FXZA 4FKRA 2R0IA 2HTHA 3UPZA 2KYWA 4M02A 4EH3A 1PXLA 3BHVA 5B2MA 1NY3A 3SOAA 1E1VA 2PKOA 4U45A 2K8CA 1KLGD 4ANOA 2REIA 2K3UA 1NVID 3NFFB 3V04A 3I81A 3AM9A 1ENFA 3KVWA 5H8BA 5C01A 4U80A 1OPKA 2C9WB 4I4EA 3UG1A 4O7SA 4AUAA 1RW8A 2CGVA 1QT9A 4L00A 4R3DA 2K8BA 3AC4A 1JAMA 3MBLA 2ZV2A 1BX6A 3PSBA 2JAMA 3RNIA 2DZMA 5HX8A 1J3HA 1L8TA 5JFSA 3NVYA 4UXQA 5AAGA 2JC6A 2IW6A 3AT3A 2AUHA 3BYUA 1A70A 4JRVA 2ETMA 4I0RA 3C9WA 5AP0A 4DDIA 1S9JA 2R3PA 4G5JA 2LI5A 2BW2A 3P5KA 3PVLA 1K8RB 1V1PA 2WQEA 5DRBA 2IN6A 3F88A 1Y6BA 3FXWA 5HBEA 5DHJA 1Q10A 2J53A 2I7QA 3OZ6A 5E1EA 1GNUA 4J1RA 1OIYA 3DNDA 1QKZA 1FXTB 3SA0A 4ZSGA 5BMMA 4MD8E 2H8HA 3PREA 2WKMA 2KWCA 5ETIA 2XB7A 3HMOA 2A98A 1A9UA 3PIYA 1OVEA 3R2BA 2GTNA 4DEBA 3UJGA 4ID7A 4BGQA 3JXWA 2BRGA 3LFDA 3EQBA 1CJEA 3ZKJC 1HTQA 3UNJA 3SG9A 1VJYA 4EOJA 4P6VF 3T9LA 3PJCA 2I1KA 3VVHA 3W0RA 4R3CA 2FO0A 4BCIA 4LUDA 4IG7B 1YD8U 2RGPA 2XK8A 2KVZA 2OZAB 5IMXA 4BC6A 3L9PA 1WAKA 5HIBA 3ZRLA 3RFZB 4BAXA 2IY1B 5F1ZA 4AZWA 1PHKA 5K4IA 2A4ZA 5ACKA 3ZIMA 2G9HD 3R21A 4EK4A 3Q8FA 3G15A 4G17A 4HZSA 1QOBA 4UBAA 3IKAA 2JQRB 4KIQA 3CTJA 3QZIA 4CZUA 3ZLZA 3D5XA 5G5GA 3KQ4A 4C4GA 1ROEA 1GZKA 3JYAA 2NPTA 4ASWC 1Q1OA 5T68A 3WIGA 3C4ZA 4N70A 1XH5A 3PVWA 4MAOA 2MJDA 3I60A 3WOWA 2UZWE 4UN0C 4UMTA 4E4NA 2YVCA 2XRWA 1FPUA 1Q61A 3ZDUA 2M1MA 2PVGC 2BTRA 3W2CA 2C5NA 3CSTA 4O82A 2WMBA 4H39A 3MJ2A 4XC2A 3ZUVA 1SE2A 1WRIA 2GCDA 1UNSA 4FV5A 4APPA 4HGEA 3L17A 3R1SA 4DGGA 1I09A 2WWZA 2VZ6A 4Y5HA 2C3KA 3NNXA 4I6LA 4YUQA 4AJYB 2L0FA 1OPJA 1VRAB 4OTGA 4WQMA 2Y3AA 3FLNC 3KKVA 3C50A 2M8SA 5AR2A 1J1CA 1PXMA 2A4LA 3VIDA 4YBKA 1WF9A 4FVQA 3D2KA 3ZTXA 3R7EA 4KGTA 2JFLA 3D9VA 5DR2A 3WARA 3EMGA 2XRUA 4W9IA 4DYMA 4FEVA 4NW5A 1SBBB 4FUYA 2X0OA 2EELA 2XNEA 4C61A 2HZ4A 4W9JA 4DLJA 4A07A 3QQUA 3RM6A 4FEXA 3R9NA 3HDMA 3NZ0A 3K3IA 3VQUA 2UW7A 3CQWA 1TQIA 4EUUA 3ZVVA 4AU8A 3PIXA 3IG3A 3PY3A 5A9UA 4QMVA 1PXIA 5J1WA 3EHVA 3R7IA 4X57B 1QF6A 2PK9A 4CMOA 5A54A 4KUJA 3UIBA 5K4JA 3KA0A 2LGCA 2RFEA 5AR8A 2OH0E 1DOYA 1H0WA 1M2QA 1LEZA 1J91A 2IG7A 4IM0A 3C7QA 2JKOA 3BYMA 3KREA 2J50A 3DOGA 3T9TA 4JDJA 3GBZA 5A14A 3DB8A 1MRUA 5K0XA 4PWNA 3TUCA 1UUPA 4O0XA 3FLSA 5IO9A 2XNOA 3CR0A 4G9RA 2X9FA 2ONLA 3UYTA 3GCSA 3ULIA 3FLYA 4AA0A 2W1ZA 4ZY6A 4MXYA 1F1HA 2BPSA 4AAAA 3R7VA 3RI7C 4CTCA 1UNLA 5C3JB 1EWYC 3R3MA 2KDEB 3FYKX 3IW5A 3BK1A 2X0QA 5D3DA 5CSVA 5DRDA 2X2KA 3HKOA 4OTWA 4ZYNA 3RM7A 1H08A 2BRMA 3AMAA 4GT3A 4PNIA 3QCYA 2BROA 1ZYCA 4JAIA 2WB8A 3Q9ZA 2X8IA 2RSUA 3ZNGC 2JZ3B 3W2RA 2KK8A 4XRLA 1JRUA 4LGHA 1LUFA 5HIDA 5KMLA 4J3OD 5FUTA 3OWLA 4PYZA 2YCSA 2Z0EB 5C2TB 4L3PA 4TYEA 3VUXA 3CJFA 2J6MA 3VAPA 2BZIB 2DX5B 3ZFXA 5L2QA 3BHTA 3FL5A 5EOLA 4R1VA 3WI6A 2PULA 1SE9A 1XH7A 4G3EA 4IC7A 3C19A 2ZB1A 4G6LA 3U87A 3ELJA 2QQ7A 5EQEA 4MF0A 3FKYA 4FBXA 4YBJA 1KSWA 3BKBA 5C9CA 1FIQA 2J0JA 3VRBB 2VGPA 5HI2A 3KC3A 2XS0A 3FBVA 4D2SA 5DT0A 2E9OA 1UGJA 2GQSA 5I9XA 1C77A 2YAKA 3TIZA 5JT2A 3QQ8B 2KX3A 4R8QA 3MGYA 1WMHB 4M15A 5DPWA 2WD1A 2ITQA 5TKDA 4HROA 1YOMA 4BJJA 5EDSA 5HG7A 1LFDA 1OQYA 4QDEA 3BL9A 3KXXA 4FZ6A 1F9JA 2EKEC 1E0ZA 4QP6A 4DGLC 5BYYA 2P2IA 2HW6A 4O4EA 1QPEA 3OCBA 1SNUA 4RIWB 5EKOA 4M14A 2INPE 3KFAA 2FSMX 2XUUA 2ZV7A 4LGDA 3WYYA 1KRHA 1T3QA 1XT9B 4Q5EA 2UZLA 3DXPA 5E8UA 1ZUD2 4AOFA 4NAWA 3P23A 4EORA 5JZJA 3H0ZA 1G8SA 2CN5A 4YURA 4FKIA 3KXGA 4A9YA 3KUZA 1M17A 5HVYA 3SFEB 3DWGC 4C62A 3VVWB 3M42A 4MEMA 2UZUE 3BYYB 1AYFA 2OF4A 3EQIA 3M2WA 5E6PA 4NM5A 4ALWA 3HHMA 4ZRQA 3BVGA 3GC9A 4ARKA 4AUQC 2PE2A 3PVUA 1SMHA 4O7YA 3E8EA 4BCHA 3DQVA 4Y85A 4FT3A 5BVKA 3B0AA 2AQXA 3JVSA 2CMWA 2J9MA 1ZY4A 5HQ0A 2KO3A 4LM5A 3BHYA 3D7TB 1NT2A 3SDLC 4FTCA 2OJ9A 2N7DA 4F70A 5EDRA 3UNZA 5BX0A 4EUTA 4HRSA 2XNMA 3U9CA 4M8TA 3R28A 2WHBA 4MWIA 5JZNA 1F2RI 3LDZE 3LFNA 4CCUA 2OF2A 2IVUA 1HA5A 2PTLA 5BVEA 3MJ5A 1YI6A 4KINA 3DDQA 4LRMA 2NO3A 3IW8A 4FV7A 4DLIA 2WQYB 4JXFA 3D14A 4RIYA 1F5QA 2VTQA 2DAFA 2R3NA 4X3FB 4PS7A 4BZOA 5I4NA 4BZDA 2RDBC 2Q83A 1VR2A 2BR1A 4O1PA 2W17A 2PJHA 4DITA 4WRGA 3UBDA 3FMHA 4KIOA 1WX8A 1WFYA 1JSTA 3Q8EA 4IFCA 5H8GA 3EN5A 3WE4A 2P55A 3AC5A 4DT8A 3QTIA 3QWKA 1VDVA 3NPCA 2WZJA 2X7GA 4JG8A 1VZ7A 2PVRA 3ZLSA 3ZC5A 1P14A 3WE8A 3I0QA 3BX5A 5AV4A 4CYEA 4W9HA 5BNJA 4OAVB 3HV7A 5IQDA 3OG5A 2GNGA 3KW5B 2KT7A 2B76B 2OIBA 3AE3B 2NMQA 2KQ4X 4C0TA 4YGAA 3PXFA 4GW8A 2VWIA 5CU0A 3PVGA 5BYSA 4AE9A 1ZGUB 1WJ4A 4HGTA 2X2LA 5E8WA 3EOCA 4G5PA 4IVBA 4FSWA 2X4ZA 3V5WA 3IAS1 1E10A 1L2NA 4KZ0A 5E6NA 2QVSE 4XZ4A 4LRJA 3V62A 2VTSA 4NL0A 3OOGA 2ZW1A 3AC2A 2RKUA 3I57A 5HTBA 2BB5A 4JI9A 2OZOA 4A3PA 5AV1A 3PUPA 3MFTA 4G34A 4P7IA 2ITYA 1TFFA 2XZSA 2QO9A 4K7WA 4JIOU 4LMUA 4C4VB 3HIZA 1O6KA 5H8YE 1PXOA 4DQOC 3HV4A 2QEJC 3P4KA 1NVQA 4XNEA 2W1FA 4TYIA 2Z59B 2EUFB 4JX1C 2R61A 3KULB 4LOOA 4K11A 1YN3A 3DXQA 5TOZA 4AZTA 2J52A 5CEPA 5AZFA 3A99A 4M0ZA 1JBPE 3RPSA 2QOKA 4EOMA 5DWRA 2GNLA 2A19B 3NWWA 2Q0BA 2KN5A 3NY5A 1M7QA 4O1OA 3GC8A 3NUXA 3QRUA 4RBLA 4ZZMA 3ZS5A 1I7HA 2BFXA 4PY1A 5I9VA 2ONLC 2R3LA 1IBXA 2DQ7X 4E6AA 2AYOB 1HZ5A 2XCHA 5EYMA 1YWNA 1J19A 2PMOX 3OROA 1FMAD 3IT4B 3AE7B 5B7VA 3A7HA 4XG4A 4ZSAA 3AE8B 3KL8A 4EK6A 4IWOA 4ALU