4EUTA

Structure of bx-795 complexed with unphosphorylated human tbk1 kinase-uld domain
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
386
structure length
384
Chain Sequence
b'GSQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRNIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase TBK1
publication title Molecular basis of Tank-binding kinase 1 activation by transautophosphorylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 108
structure length 384
sequence length 386
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4eutA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4eutA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4eutA01
3NYXA 2ZAZA 5HIBA 2P2IA 2LGYA 1L2NA 3BYMA 3VAPA 3F69A 3KRXA 2ITQA 2W4KA 3B2WA 4L44A 5A4QA 3QZHA 3ZNHB 5K5NA 1YOMA 5J18A 3AQVA 4LRJA 3UIMA 2A27A 5EOBA 1WYWB 4F6UA 3IVFA 3MY1A 5DH3A 2WX0A 4LJOB 4XG3A 1OL1A 1QPJA 1H4LA 4U43A 5AV4A 2WMSA 1ZY4A 2X8DA 3D7TB 4U41A 4II5A 3SOCA 5DCNA 5H8EA 3W18A 3BYSA 2Z7RA 4I24A 4M68A 4BB4A 4UYAA 4I6HA 5IA7A 3BGQA 1VJYA 4QYFA 3TEIA 2YJRA 5CASA 1TZ1A 3ZSIA 1FVRA 3QD3A 4FK6A 1ERKA 3DGKA 3UIPB 4FL1A 3HMIA 1Q99A 1U54B 2W5HA 3R7UA 4TPTA 3PWDA 3PG3A 3EN7A 3V61A 3R8PA 2BHEA 4I6FA 4LL5A 1H27A 1W83A 4RQKA 2O65A 3IPHA 4DTAA 4O82A 4WG4A 4IANA 4JJRA 5M51A 2UVYA 4YZCA 4I21A 4KIQA 4AZWA 3WIMA 3ET7A 3A62A 5A4EA 1CMXB 5AUWA 2OOBB 4HPTE 3E8CA 2G3QB 5JFSA 2REXA 5LARA 2DUVA 3KREA 3S1HA 4JLCA 2WTWA 4PPCA 4TQ0A 1ZYLA 2UW3A 4CGAA 4HYSA 4WSYA 3ZSGA 3LCKA 4CNHA 3C0IA 2W1EA 3U8ZA 1PXJA 3DS6A 4OAUC 3LW0A 4NCTC 4FYNA 4N70A 4EOSA 1Q3WA 3R30A 5F95A 4U3YA 1BX6A 3WF5A 4D55A 4BZDA 1R39A 4UZHA 4J97A 3NUYA 4ZJVA 4DFZE 4H39A 3AT4A 3DLSA 1ZAOA 5E92A 3TJCA 3LFCA 4FKRA 3QHRA 1WZ3A 3ZU7A 3F66A 4CSVA 3MIYA 5HEZA 2IYDB 2FYSA 5CU4A 3VVHA 2F7EE 3W1YA 4YBJA 4AE6A 4RWJA 4GRBA 1UU3A 4A4LA 4IAIA 3II5A 5CF6A 3HM6X 3NUPA 4A06A 2CN5A 1SZMA 3EB0A 4O21A 4E5WA 5EQPA 4ZSJA 3DBLI 2BCJA 4L01A 4W9LA 4O7YA 1WJ4A 2IG7A 4X2JA 3BU3A 3NX8A 1YDTE 3ZC5A 5AZFA 5AEPA 3HKOA 3H9FA 3LPBA 4GKIA 3BU6A 1K9AA 3FSKA 3R04A 2JVCA 4BHNA 4D58A 4ENYA 3S4QA 4A07A 3NNUA 3ZHPC 4BFRA 4FKUA 2Z7LA 4NFNA 3CBLA 2OICA 4EOPA 2CN8A 4AOFA 1IYFA 3H7SA 5AFVA 2I0HA 3TJPA 4O0TA 1TKIA 4PF4A 3FZOA 1ZARA 1V0PA 4CFVA 1NA7A 1E9HA 2OJGA 2BAQA 1XT9B 5C4KA 3FZ1A 5EW8A 3RKBA 4GIIA 5AWMA 2PYWA 4JBPA 1A5RA 3LCTA 2HW6A 1E1VA 3HA8A 3ANRA 5K0KA 2BROA 3OTVA 4JIKA 3MVMA 2QG5A 4V0GB 3R1SA 3R7QA 4RVKA 4MEMA 4G6LA 1XHAA 2N9XA 4U45A 5M53A 5IDNA 5AIRA 2DS1A 3CQUA 1J7UA 4H3PA 3W32A 2R2QA 3C5IA 1GAGA 2YIYA 4YZDA 3LXKA 4BDDA 2XCKA 3IOPA 1APME 3C9WA 4DGNA 5AV0A 3WYYA 3QL8A 3RGFA 3D2KA 3R2YA 4B9KA 5KNJA 4DDID 2XM9A 2IVVA 3EN5A 4G0NB 4YTCA 2QI8A 4XBRA 4IAFA 5CVHA 2GOWA 4UMTA 4RFYA 1B38A 4BI1A 3QWJA 4XH6A 3TL8A 2ZNVC 3FXZA 2KC2A 1XH8A 2Y7JA 3OXZA 4JG6A 4DBXA 1WMHA 4AT4A 4QQCA 4OR5A 3R9NA 4Z7GA 4QMMA 4WKQA 3LJ2A 2PMIA 5FG8A 3PXKA 3CP9A 4J8MA 2UW0A 3VS4A 4ANXA 1YOJA 4LDTD 2WTVA 2XK8A 2VWBA 4L3PA 2K6DB 4BYJA 2ZPNA 4DLIA 1WBSA 4YNOA 3U54A 3K5VA 2XNGA 3TNWA 3UGCA 4QMWA 2ZMCA 2JBPA 3VS3A 1A9UA 3ZLWA 2BWFA 4Y5HA 5JZJA 4YJQA 3DNEA 4B7TA 4FVRA 3A60A 5TKDA 4QMQA 3Q52A 4E6DA 3MFRA 4GB9A 2VX0A 2Y6OA 4USFA 1RAXA 5E8TA 5HHWA 3D83A 2KULA 4QP2A 3V5JA 2BYFA 5LVNA 4W9WA 5KBRA 1WJ6A 4M8TA 3DAEA 3EZRA 3W2OA 2WNTA 2QLQA 4B0GA 4U79A 4IDVA 4YHFA 3LFFA 3CCNA 1O6YA 2CNQA 5LOHA 5HICA 3IGOA 4WUAA 2V55A 3GFEA 5HNIX 2OU7A 1XBCA 2ZVAA 4PDOA 4RT7A 3SXRA 2DYOA 2O2VB 4AS0A 4NFMA 2J9MA 4MWHA 4S2ZA 4QP3A 5EYCA 4W4YA 4E8AA 3LMGA 4D0WA 4RMAA 3OS3A 5HBHA 3W10A 1V86A 5CXHA 4A9RA 5J7BA 5L2SA 4USDA 3UMWA 2UWQA 1VEBA 3W2RA 2IO1B 2FUHB 4XHKB 4EH5A 2X8EA 2WMWA 2BR1A 2G9XA 2PUNA 1TGZB 4KRDA 4CZTA 2VWYA 4EC8A 4F7NA 4QMUA 2GBMA 3EFWA 3REPA 2QR7A 3LQ3A 2HK5A 3R22A 2JFLA 4V01A 4EZLA 3HV6A 1BT0A 3U6HA 3MESA 4RA4A 3TZ8A 2QKRA 4OTFA 4GK3A 3KMUA 2W5AA 4EOJA 2N7DA 2AC3A 2HOGA 1KE8A 1GZKA 2HE7A 3DKGA 3P7AA 2WQNA 3Q5ZA 3QTZA 4C58A 5DPRA 1YDRE 5BYZA 4BVUA 5AMNA 2YM8A 1SVHA 3BWJA 3BV2A 2QD9A 4C8BA 2LVQA 1XH9A 2C5NA 4RFZA 3OLMD 5DPTA 5ANOA 2KJ6A 5HVKA 4DG0E 3HMOA 1OKWA 3PSBA 2G4DB 3O0GA 5EFQA 3MB7A 2C4GA 4GVJA 5E1EA 4QYGA 5IA1A 2OSCA 4FI1A 4AA4A 4FV3A 5G6VA 1OGUA 3DFAA 3PIZA 1WGRA 1Y6BA 4CV8A 3FKNA 3H9DA 2A4ZA 3R9OA 4UMRA 3LAUA 4FUYA 1W98A 1VD2A 2J0KA 2VWZA 5HG8A 3UYSA 4TTHB 2G4SA 3NCZA 2ZDTA 3GU7A 5DWRA 3JR1A 3ZKJC 2HZ4A 3FQEA 3PXRA 1WBWA 3QWZB 2IPXA 3V5TA 2XBJA 5KMMA 4NJ7A 1OPJA 3QQFA 3G33A 3QTWA 3V01A 4AU8A 4HWIB 4H05A 3RPSA 5CEIA 4MCVA 5FDPA 2VO0A 4L9IA 2XYUA 2XBAA 3OHTA 4QPSA 2F4JA 3L8SA 3PTGA 3TDVA 4JOAA 3E8NA 3UP2A 4H3BA 2VRRB 5TR5A 3R66C 3P78A 5EI8A 4EJNA 5AADA 3CKWA 3QALE 4O0RA 1JPAA 2FCMA 1Q3DA 4ITJA 4QTDA 5A6OA 3S3IA 2XK7A 1XO2B 5E6OA 5HO8A 4OVUA 4FYOA 2PZYA 1V80A 5L6OA 2C6MA 2E9UA 4MQ2A 3G51A 3QTRA 3DXNA 1OI9A 2BRHA 3FI2A 1M7NA 1P14A 4J7BA 2NO3A 1Q41A 1Q1OA 4FA6A 4UB7A 2UUEA 1RDQE 1YWRA 3WE8A 4MJSA 4M7IA 3BELA 4M13A 3PZEA 4G2FA 3I3TB 4HJKA 4TYEA 4M0WB 5AP2A 3ZFYA 3NYVA 3DBRI 1KE7A 1P3QU 2KDEB 2X4ZA 2OFUA 4KSPA 4YHTA 4RIYB 4TY1A 3MFTA 3LQ8A 1OECA 3LM0A 3UJGA 4ACMA 4XX9A 1UH6A 2YHVA 1JKLA 3PXQA 4FTTA 3MA3A 4NZWB 1UBQA 3WBLA 3Q9YA 4L43A 4S34A 3DPDA 2PWLA 4FKLA 4L68A 3NW7A 4AN3A 5JRQA 3R63A 2QONA 3BKBA 4PY1A 5HTBA 5J5TA 4ZZOA 3MGYA 2GTNA 3C1XA 4E3CA 4PQNA 3R8ZA 2VTSA 3AMAA 4PP9A 2ITXA 2UZDA 4QMTA 5CX9A 3LOKA 5ETIA 3EH9A 4WSQA 3HLLA 3F3VA 4RFMA 2X8IA 3RWQA 3OXTA 3I5NA 3POOA 4I0TA 2WZJA 1H28A 3TTIA 4PX6A 1XBBA 4FSQA 3BEGA 2V0DA 2CLQA 2YDJA 2B4SB 3NUUA 1SNUA 4XG8A 2XNMA 3NNXA 3ZRCA 2PPHA 4EQCA 4DFYA 2UZOA 5FDXA 4GDKB 4R1VA 3BX5A 2GNIA 3GFWA 2VTJA 4OTHA 3VRZA 2EU9A 4X2GA 5D7GA 2RFNA 5CNNA 3FJQE 5JMSA 3EQCA 4J53A 2JWZA 3L08A 4DH1A 2WKMA 3A7GA 2ZJDA 3TIZA 3VS1A 3K3JA 1GUAB 3KXNA 2WMVA 4I6PA 2RG6A 3IG7A 2M0XA 3PA4A 5IA2A 4TZRA 4AQCA 3ZRFA 4FF8A 4XOYA 4K81A 3VNTA 1OKZA 2L0TA 4ZTSA 3IS5A 5BVKA 4EOMA 1H01A 2JDRA 5EHLA 2XIRA 4N0SA 4F63A 1F5QA 4W8DA 3C5UA 4BC6A 4QP7A 1AQ1A 4ZS4A 4GU2A 3GCVA 4DGLC 4QP8A 4I5HA 4RIWB 3MPTA 2R3OA 2QOKA 5FLFA 2M4NA 4FSNA 2QO2A 3VUIA 3EQDA 4ANUA 2B9JA 5F20A 4ANNA 3FLSA 1SMHA 5EQYA 3NY5A 1JSVA 3GU6A 4FZFB 5G2NA 2VZ6A 2WQBA 3QQJA 3CIKA 5CAOA 4GDLB 4XNEA 4DTBA 2QKWB 3ETAA 3RPVA 4JNWA 4MQ1A 3CS9A 3F7ZA 4Q9ZA 3RAWA 2UVXA 5DG5A 2LRWA 1IR3A 4O0UA 3NNWA 3RAHA 3D5VA 4ASZA 1CM8A 4W9XA 3DVGX 1YIWA 1YWNA 1Y8RC 3FDNA 3VUTA 3DBEA 2PZIA 5DA3A 3N4VA 1E7VA 3KRRA 1S9IA 1TVOA 1UA2A 3C4FA 4FN2A 4XG7A 2J2IB 5IEYA 4M69A 4DITA 2MBQA 3ZRKA 2YA9A 4ZP5A 4D0XA 4R3RA 3VC4A 4EKLA 3DBDA 4CRSA 2CS4A 5J8IA 2O8YA 3QJZA 4GYIA 3U8WA 1L7YA 2IZVB 3D7TA 2CKEA 4BZNA 4PWNA 4FTUA 4X3FA 3DAJA 3WA0A 2QOQA 2R3PA 3GBZA 3FLWA 4B95A 3L13A 1TBEA 5BUJA 4OGRA 4CFWA 5CAPA 4LOQA 4O84A 1OZ1A 4DAWA 2CCHA 4QMSA 2RR9A 3WF6A 4JI9A 3R00A 2ETKA 3L0WB 3E87A 5HESA 3RP9A 2VTMA 4KIPA 2BTSA 3Q04A 4F9AA 3SKCA 2C0TA 5GHVA 3WAMA 2WMXA 2E9PA 1E90A 2ZV9A 3IW6A 3QIJA 2IZUA 3R71A 4NQLB 3W2CA 3M95A 4RC2A 2JIIA 4TUUA 1REJA 4EHZA 1IEPA 1YXTA 4TW9A 4EYJA 4BCFA 4BICA 1BI8A 4FSZA 4UWYA 3EECA 4M97A 3L8PA 2BWES 3KUZA 2C6OA 2PMLX 2KHWB 3KB7A 3U7DA 4MBLA 3TT0A 5JGDA 2OGVA 2CKHB 4GIVA 3Q5IA 3F5UA 2KOXA 1E5WA 5E1SA 3ZSHA 3NGAA 4C02A 5CS6A 4QTCA 3E7VA 4O96A 4AFJA 3DKFA 4X21A 3VTWA 5CEQA 1OL2A 4ZTMA 4F7JA 4AW0A 4IWOA 3LXNA 3GU4A 4V05A 2QC6A 4XV9A 4BKSA 1ZRZA 4WRGA 3WAPA 4D9UA 4P90A 4CQEA 2GNHA 4WNPA 2FVDA 4B6LA 4ZXTA 2W0JA 1JWHA 2OXYA 4UALA 1JSTA 3Q9XA 4FKSA 3LFDA 2XP2A 3ZMMA 5DR6A 2VGOA 2VO7A 2LI5A 3CPBA 5AP3A 3KF7A 5BVOA 3FI4A 5CALA 1YJ1A 5EQEA 4AWIA 3E62A 4JQWC 4CV9A 4XRJA 1STCE 4EZKA 2HWPA 4TYGA 2GBJA 5H9BA 4MD8E 3WYXA 1WVWA 2W17A 1JQHA 1XBAA 2JKKA 1WRDB 5ETFA 2IVUA 3TG1A 3DY7A 4CYEA 3UQAA 5KKRC 3IO7A 3I81A 4FIEA 3ZDTA 4NWMA 5F4NA 1LR4A 4PMTA 4FTIA 4L3JA 3DKCA 3VWAA 4HYHA 3NHEB 4MXXA 3DK3A 5DLSA 5D12A 1Q8YA 4TNBA 1ZY5A 4ZZNA 4YZNA 1EH4A 3GU8A 3PSDA 4AUAA 4NAWB 2CGXA 3RZBA 3LJ3A 4I5MA 3V8WA 2IW8A 3R9DA 4XG4A 3QRKA 5HBJA 3L16A 1DAWA 3ZZEA 1V6EA 2Q83A 5FR6A 2ERKA 2KX0A 4XEYA 5CF4A 4I23A 5HG5A 3UZTA 3I6WA 4G9RA 4EH6A 1Y6AA 1NBFC 3N4TA 2GDOA 1Q24A 3SLSA 3QCSA 2K8CA 3R6XA 5T3QA 4FSTA 3HZTA 2C5OA 5HLWA 2C0IA 2KO3A 1J7IA 4ERKA 1LEZA 1P4FA 2WO6A 3KVFB 2PE0A 3UDBA 3OT8A 4A3PA 4FKVA 3QYZA 4IEBA 1NVSA 2JDTA 1PW2A 2PVRA 1R0PA 3Q3BA 2PE9A 5B0XA 2KTFA 3I60A 5AM6A 2GBKA 2JRHA 5I9YA 4CMOA 1WGGA 1PXKA 2VWIA 4EEWA 2ZNVB 2LAVA 4FG9A 2YDKA 3X23A 3VXWA 2W1GA 1R0EA 3VUXA 3A7HA 1WJUA 4UN0C 2R3LA 3GB2A 5CSVA 1I35A 3COMA 4YJSA 2R3HA 5CHVC 4FTAA 4IQ6A 1WBOA 4MXAA 4GXBA 5LCKA 5BPYA 3BLHA 3KGAA 4IW0A 1K3AA 5ANKA 4MDKE 1W0XC 4GFMA 3FV8A 4BFMA 4ASDA 2XRUA 3OWKA 4F64A 5ETCA 4BDCA 2DWBA 4DFLA 1ZXEA 4KIOA 4C62A 4RVTA 2P4IA 3VUMA 2DQ7X 4HPMB 5DT4A 4FVPA 3O65B 2LGXA 4W9FA 3QQUA 2F7XE 3PP0A 2H9VA 3D5UA 2HELA 4NM7A 2JKOA 4AT5A 3RWPA 3QRUA 4EK5A 5HGIA 4ERWA 1H08A 5C8MA 2LZ6A 3BE2A 4RC3A 2Y8OA 4MWIA 4NY0A 4Z55A 2R0UA 3QC8B 3G0EA 4EHGA 4ACCA 2F49A 1PYEA 3I7CA 2KMAA 4BCIA 4G3CA 4RZWA 3DB8A 2PVMA 4C34A 4Y5QA 4AACA 4C4JA 3FZPA 3KRLA 4RX9A 2WXVA 2ZEQA 3PLUA 5H2UA 2B55A 4UWBA 4G3GA 3PY1A 3A9KB 5A4TA 4LGDA 5JK3A 5FRIA 1OIYA 5J1WA 3KQ7A 3BU5A 2XVDA 3OW4A 3TBLD 4O7TA 5B7VA 2VTAA 5ETAA 3R0TA 4BCKA 4CG8A 4OAVB 5I9UA 4GEOA 1YQBA 5LWMA 1YXXA 4IAYA 3O51A 4C2VA 4MTAA 2KTRA 3T9LA 3R3MA 3VUWA 4WOVA 4IB1A 5CEKA 3KF4A 3UQBA 2W06A 1KE9A 2CGVA 1IASA 3COHA 3JPVA 3FYKX 2QNJA 3WZJA 4HVBA 3CE3A 4IX6A 2DYLA 3L54A 2GBNA 3OBGA 5DEYA 3E8DA 3QFVA 2ZB0A 3F3ZA 4AOJA 4YPDA 2R3NA 3H7PA 3FMKA 4PP7A 3IKAA 2XKDA 4GT3A 2BFYA 4MD9E 5IH4A 4XLIA 5GJDA 4BDJA 2CCIA 3PT2B 1CSNA 3OUNB 4UV0A 5TE0A 4K6ZA 3MVLA 2HXLA 4HCVA 3DZQA 2GU8A 3QXOA 3D15A 1QCFA 3F3WA 3LXPA 3K9PB 2NR2A 3KEXA 4APPA 4R1YA 3QLFA 2OF4A 4IB3A 3ZO1A 2ZYBA 2YLFA 2I1JA 4ALVA 4YJPA 1OPLA 2F57A 2LWPA 4LUDA 3FI3A 5CF8A 3UIBA 4F65A 2UYZB 1SNXA 2GNLA 3T3UA 3TN8A 4FSMA 5IKWA 4NJDA 3TI1A 4XG6A 4GVAA 2FSTX 1FBNA 4C3RA 3DA6A 1JOWB 5J2RA 2IWIA 4G31A 4DEDA 1H07A 2WMUA 3A99A 4EK3A 3EN4A 5FXSA 1ZMVA 2GSFA 2CJMA 2A19B 3R02A 3AGMA 5E8WA 3GP0A 2KC1A 2J7TA 4IFCA 4DBNA 4FNZA 2Z60A 2YERA 4WO5A 5CEPA 1ZMWA 4AUQC 3LKMA 3T3VA 4QMXA 4DHFA 2JITA 3AXCA 1LQBA 1H1WA 3SD0A 1JKKA 1V1KA 1ZYDA 4FT9A 3F61A 2VTOA 1W8CA 3EKNA 4ZTQA 2JPHA 4F0FA 3IDCA 4CTCA 3IDPA 4LGHA 4JIAA 1FVVA 1V81A 2FSLX 1YD8U 4BBNF 4R7BA 4R77A 2X2LA 4Y46A 2XKFA 3TNPC 2QODA 4FICA 4PS8A 4HVIA 3ALBA 5IQIA 5AP4A 4IVBA 5IQHA 4AZSA 3QLGA 3APFA 5A4CA 4QOXA 1HOWA 5HG9A 5L2QA 4KV2A 3VHTC 3FSFA 4MM3A 5BVEA 3C4CA 2OIDA 1UV5A 4QQTA 2OZAB 4GIHA 2IZTA 1B6CB 2K1FA 3IK3A 5E8ZA 3LIJA 1T45A 4LM5A 4FKQA 3ROCA 4C61A 4FT5A 3QKLA 4KVGB 3E92A 3MYGA 4NSTA 4YGAA 1YVJA 4RX5A 4EORA 4IZAA 4BDBA 2EB2A 4HCTA 4I4EA 1URCA 4MGIE 2PZPA 2XK5A 4WNMA 4ONAA 3G90X 4O38A 3VS6A 4BBFA 4FZ6A 1CKPA 5CU2A 5AP1A 3TUCA 5DOSA 4H3QA 1CKIA 3GXLA 3SW7A 5I3RA 3CLYA 4QPMA 3HMMA 2ITYA 4IFGA 3PJ3A 3IDBA 2L76A 5B2LA 3KN5A 2NS5A 3PDTA 4GK4A 4NIFB 4YJRA 2W5BA 4JDKA 1OEYJ 4NJ6A 4IUMB 4FTQA 3TV6A 2VNYA 2QOLA 3O8PA 1GZNA 2VU3A 4E5BA 5CU0A 3OFMA 4K77A 2OJFE 2XIZA 2QHNA 4O7LA 2BTRA 2GQGA 2XBBC 4BYIA 2UZEA 3N32A 2YN8A 2NCNA 3UQGA 5JRSA 3ORLA 4NTTA 1WBVA 2EXCX 2WGJA 2OFVA 1XH7A 5IQFA 3HAVA 2YIWA 4FG7A 2QOOA 4UX9A 4L46A 5TR6A 4IG7B 2I7QA 4AZVA 2HW7A 2ZZPB 3GCUA 4NEUA 3RNIA 4EOKA 3HUBA 5CT7A 4GJ2A 3BE9A 1IA8A 3KK9A 2UW4A 2C3LA 2KQSA 4OUCA 3MPAA 3JYAA 5EYMA 1PMNA 4W4VA 2NP8A 3OY1A 3A7JA 3WANA 1ZYSA 3FKOA 4OLIA 1R4NI 1FXTB 5AR7A 3VTVA 5AUXA 4IX4A 5TF9A 3E88A 1WBNA 3TXOA 2BKKA 4F4PA 2WU7A 3O71A 4FNWA 5IUGA 5G1XA 5CLPA 2J0MB 4EBWA 5A6NA 4AT3A 4PMSA 4E4NA 3FL5A 3KULB 1OVEA 4ZSGA 3JSVB 3E3BX 3F82A 3ORXA 3UMXA 3FZSA 2QHOA 4JG7A 4A9UA 5M4CA 4CFMA 4IB5A 3TV7A 3M11A 2LD9A 3PVWA 4GUEA 4BGQA 4M67A 3V5QA 1J19A 2BPSA 1PXNA 4BDGA 4ALUA 5I9XA 2CU1A 2XK9A 1YKRA 5LLIA 3FLYA 1UNGA 3EKKA 3V04A 4JR7A 4AW1A 4PTGA 1ZW7A 1UD7A 3QF9A 2ZV2A 4DBGA 4HVHA 3CGOA 5KBQA 4WT6A 5JFXA 1J0GA 1GY3A 4MXCA 3PIYA 2ITWA 4CD0A 3Q4ZA 3U6JA 4FSWA 3FC1X 3PP1A 4UWCA 1Y91A 1WH3A 4HCNB 2WOTA 4IB0A 3S95A 4FV2A 2X0GA 4GYGA 2MRPA 2H6DA 3QBNA 2LASA 1Z9XA 3F6XA 4FGRA 1VYWA 1WJNA 4BDAA 1WI0A 2YWVA 5EI2A 2HENA 2V22A 2ZV8A 3Q2MA 3H3CA 4QYHA 4L3LA 3MY5A 4DT8A 4GDLA 3ZXZA 3VJNA 5G55A 4S32A 4D4RA 3PWYA 5M55A 3VRYA 5TO8A 4WNOA 3PGEA 1YHWA 1GNUA 4BI0A 2BGFA 2FB8A 2YZAA 3VF8A 5KX8A 1JRUA 1KM7A 4ANBA 3ULZA 4RSSA 2KVRA 5J7HA 5KMNA 4OTDA 5J9YA 4HCUA 1FINA 2N9PC 5D2MB 3NZUA 3CR0A 2M17A 1GOLA 3RVGA 4DDGD 5AR5A 2FIFA 3PZHA 2Z8CA 4O0WA 4OTIA 1V49A 1PMEA 4TYJA 3UO4A 4NJ3A 5HE2A 4BCPA 4AA5A 3ORPA 2A0CX 2W96B 3V5PA 3PREA 3HVCA 1MP8A 3LCDA 1X8BA 3KN6A 4PTCA 1KUTA 4ASWC 1P1AA 2RF9A 2WTKC 2VTIA 3DDQA 4HGEA 3CY3A 3WF8A 4DFBA 3MSSA 4BDHA 2YM7A 5CI6A 3C4EA 4TQ1A 5K3YA 1V9JA 2MP2B 4TWCA 5CAVA 3KXXA 4AOTA 5J17A 3H6NA 4QYEA 2Z7QA 4QMVA 4JIOU 3FWQA 4BN1A 5HCZA 2GNGA 2W1CA 4LFIA 2YZLA 2GHLA 2XNPA 5AA9A 4D1SA 3OXIA 5IDPA 4EK4A 5KMOA 4MSQB 4K1RB 4NCTA 4FSRA 2Z7SA 3FUPA 4ANSA 4FHKA 4KSLC 4O1OA 4OVVA 2EUFB 3CJGA 4MH7A 4YC6A 1ZLTA 3CPCA 4KAOA 5GJGA 3C4ZA 3BEAA 4Y85A 3OT3A 2IJMA 4AWJA 3MV5A 2C60A 3HV3A 3SG8A 1Y8YA 4RRVA 1M2QA 5HU9A 4RG0A 3ZOSA 2JY6A 4NH1A 4BL1A 3HDNA 3GC9A 2YWPA 4DT9A 3DXPA 2UZTA 3U30A 3OWPA 2QOIA 4RM9A 4GU9A 3P9JA 2B53A 4I20A 5LJJA 3RCDA 3P79A 4UMQA 4RWKA 2JDSA 2GFSA 4DEHA 5A46A 4JBVA 5M06A 2IW6A 1BKXA 3QQ8B 4OTPA 3DCVA 3LCOA 4ZAUA 4RMZA 1KV1A 2OF2A 2PUUA 5L2WA 4BZOA 4RGJA 3E3PA 5L2IA 4RVMA 3IW8A 5DGZA 3QTQA 5ANGA 2WU6A 4DEEA 1XH6A 2C1BA 5D7VA 1BMKA 2HIWA 2R3GA 4IADA 4IX5A 1OIRA 3UBDA 4WG3A 2I0YA 3PYYA 1W7HA 3EFKA 3IG3A 2C0OA 2KMCA 5HE0A 3R8LA 4DK5A 1YI4A 2R3IA 4QP9A 3NZSA 1NXKA 3PRFA 5DIAA 1O6LA 4TWPA 1KE5A 4XRLA 2VGPA 3CSFA 3QCAA 3JS2A 4P4CA 1PXOA 2HWOA 5E8UA 1I44A 1WFCA 3EQIA 2VN9A 3RHKA 3ZUTA 3OCSA 1UU9A 4N4SA 2WAJA 5HBEA 2YACA 1EO6A 4EQMA 1SM2A 4NAWA 4B99A 4PTEA 2UZUE 3PE2A 5I9VA 5CHFA 2VTLA 4FT7A 4ASEA 1NY3A 2JZ3B 2JFMA 3BYUA 3OD6X 3SXFA 4E4LA 3A7FA 3SU8X 4W4XA 4USEA 3HAMA 1BLXA 3ZO4A 2HY81 3GZNI 4DLJA 1H8FA 2FA2A 4Z16A 4UZDA 2HTHA 2L8JA 4ZY5A 4WJQA 3VBYA 5GJFA 4HJOA 2UZLA 1UNHA 4ZTNA 4TN6A 2FAZA 4DGOA 2FNJB 4IZ5A 4FK3A 4IVAA 3QX2A 2GPHA 4EKKA 5B2KA 4K2RA 4TYIA 4DCEA 4URKA 2R0IA 3OWLA 3RM6A 3R7IA 2K39A 2WB8A 4YLLA 5CSPA 4M8MA 1OL5A 4QP4A 4ZJIA 3QZGA 4FIFA 3G6HA 2D10A 1U46A 3ACJA 5AZGA 5JZEB 5JQ5A 2ITNA 1MRVA 4XCUA 5JFVA 1E8XA 4AAAA 2ZM3A 2BDJA 5AAFA 1BI7A 2GNFA 4BBMA 1P4OA 2BZKB 1GG3A 4U42A 3ZDIA 4G34A 4FC0A 3MTFA 2OIBA 4MYGA 2JKMA 4U7ZA 4WAAA 5EKNA 3I6UA 5LMAA 4BTJA 4F99A 1F0QA 5LVPA 4KA3A 4LL0A 3RZWC 5J9LA 4NL0A 2ERZE 2MBBB 2M1MA 1H1RA 1ISNA 4XUFA 4LUEA 5HLNA 1YXUA 2KWCA 1J1BA 3V8TA 1PXPA 4HXDA 2XM8A 3F2NA 5DPWA 3LFEA 3BQRA 3F88A 2X6DA 5EM7A 1JNKA 3ZBFA 5C4LA 4IZ7A 1M2RA 4EEVA 4CZYB 4OTQA 3PLSA 4E26A 4BCOA 1Z5MA 3SRVB 3KFAA 1E8WA 5JHBA 3QTUA 2PVLA 3HL7A 4F7SA 2NPTA 2GQSA 3FZRA 4WWPA 3TZMA 3FMEA 3EZVA 2HXQA 4BWKA 3M63B 4MBIA 1W84A 1WAKA 5HE3A 3VBWA 1UNLA 5M44A 1UGMA 3MFUA 1UKIA 2VTNA 3L9NA 4O2ZA 5EKOA 4UYNA 3NMUF 1UKHA 1G8SA 3EN9A 4GOCA 3DBSA 4YTHA 3A9KA 3UG2A 2OJ9A 4D4YA 2QLUA 2R3MA 3UC4A 5HU3A 4F7LA 2P55A 3QGYA 2X6EA 5IA0A 3PVUA 2W4OA 3IOKA 3UOLA 3R1QA 2F2CB 4AGDA 5FXQA 1LP4A 2WHBA 1P2AA 3MW1A 3DOGA 3GEQA 4HPLB 5CEMA 1T0YA 3HRCA 5FM3A 3OROA 4YJNA 2YIQA 3W1FA 3ECIA 1JKTA 1K2PA 3PV1A 3FMLA 2EKEC 4ASXA 1YW2A 5FTQA 2OK1A 4BCMA 3F5GA 1CTPE 2QO7A 4D2PA 2OW3A 3RAKA 4G5JA 4EOYA 2OKRA 1OIQA 4CRLA 5J9ZA 4I93A 4C4IA 3ZTCA 2DZMA 2KKCA 3P7BA 1UWHA 2PVYA 3FMHA 4EH2A 4O7WA 4MNFA 1MG8A 5LXHA 2KNBA 4Y8DA 4FX3A 4I6BA 3VVWB 1DAYA 4R5YA 1GIJA 3RI1A 4HZSA 2DAFA 3ZO3A 4PDSA 4X2FA 4M15A 3BLRA 1OQYA 2ZJWA 5L8JA 2UZBA 1GNGA 3PSCA 2VX3A 1WY8A 5HCYA 3KRJA 4MK0A 5LMKC 4DHJB 3UZPA 4RJ7A 3SDJA 5HD4A 3VO3A 2J0JA 3OBJA 4TT7A 4IC7A 1D3ZA 3TZ7A 5GIOE 4CFFA 1M52A 5EHOA 3B08A 2MA9B 4DTKA 2J90A 3NVKI 3PJ8A 4KS8A 2UW8A 3DT1A 3VQHA 3BYVA 2X2KA 3F5PA 4DF3A 5AR2A 3AD6A 2WMTA 4C37A 3Q3FA 2IVSA 1SE9A 1OUYA 1FGKA 3K2LA 1ZYJA 2XIYA 2CHZA 4JDJA 1F3MC 2XEZA 5ACKA 2HCKA 4LQMA 4LG4A 1BYGA 3ML9A 2ZV7A 4NYEA 2FSMX 3ZNID 4H1MA 3QQHA 4Z9LA 5EM6A 4I6QA 1Q8TA 5FEEA 3ZLSA 4FV5A 2C5XA 2PY3A 4C2WA 2C30A 1UBIA 1KE6A 2E9VA 3G2FA 5AAEA 1WGYA 5GINE 3ZEWA 1ZOEA 4GS6A 4S33A 3SHEA 2XEYA 5CAQA 4DG3E 2XJ1A 3FHIA 2PMOX 3H0YA 4XP2A 3SA0A 2O3PA 4YJVA 4YSJA 5TOZA 4FKTA 2NBVB 3AMYA 2VD5A 2B9FA 3JY9A 4JL9A 4UXLA 4OTRA 4HZRA 5I3OA 4FIHA 3B2TA 5CY3A 5L6WL 4PS7A 3ZNGC 4S30A 2W9NA 5DI1A 4W9KA 5C9CA 4UEUA 4E71A 4F0IA 1WR6E 1Q0WB 1AARA 2OZAA 4AE9A 3ENEA 2B1PA 1RJBA 2BIKB 3H10A 2L7RA 3UZRA 3GNIB 2O6VB 3EWHA 3GUBA 3UTOA 2L05A 2KD0A 4BKSD 2H34A 3VUGA 5AUZA 1G5SA 4OT6A 3MVHA 4ID7A 5B2MA 3M42A 3N30A 5FP5A 3HMNA 3ZW3A 1GC6A 2V62A 2R3QA 1H24A 2QO9A 3QARA 5IA5A 2C69A 2ETMA 5IF1A 2OJRA 2BMCA 3BRBA 4DH5A 3UF8A 3M1SA 4OW8A 3W8QA 2IN6A 3LMHA 4N9F4 3QQLA 2I1KA 3TKUA 4NIFA 1U4DA 4AZFA 2BF8B 1WE7A 3NS9A 1GIHA 3QUDA 3U4UA 5IQCA 2FUMA 4M3QA 4ORKA 4H1JA 3QK0A 3BQCA 3BZ3A 1YXSA 5I4NA 3HM3A 2XK6A 5DMZA 2WEVA 3R7RA 4KKHA 3N4UA 5CQUA 4CVAA 3U87A 2UVZA 3OOGA 2E2BA 2YDIA 4C7TA 4O0SA 4E74A 3LLTA 2AL6A 3TDWA 4QMNA 4ITHA 4J95A 3F9NA 3R2BA 2BYEA 2KTYA 3DQVA 5J87A 2EB3A 4WG5A 3ANQA 3HNGA 4WJOA 4JR3A 5IAAC 3D2IA 5IG1A 3FXWA 1SYKA 2FCQA 2ZDUA 4EH4A 2SRCA 2WPAA 2KZRA 4MF1A 3KCFA 5LXMA 3NUNA 3P4KA 4TXCA 4RQVA 4XLVA 3ZZWA 5M4FA 5DN3A 1OBDA 3ZBXA 4KIKB 3KKVA 5K9IA 3VIDA 4AZTA 1VR2A 1XKKA 4ZTLA 2Q0BA 4RIXA 4YZMA 4PNIA 2WIPA 4I1ZA 1PKDA 4ZRIA 3ULIA 2X1NA 4ICUA 4O0XA 4BCGA 1IPGA 4F0GA 5JT2A 3IFWB 2YIXA 2C47A 5E91A 2V3SA 2UW9A 3R9HA 5L4QA 4FTKA 3KULA 4EQUA 3AU5A 4KSKC 5CTPA 5H3QA 3MDYA 3DBFA 3VH4B 1OIUA 5M57A 1XH4A 2PZ5A 5DR2A 5IQEA 3GENA 3C51A 2Z0DB 2KLGA 3V5LA 3TCAA 4LV5A 3ZYAA 4DCAA 3DFCB 3DQXA 4KBAA 2HAKA 3V60A 3ZM9A 3Q6UA 2O6VD 3WALA 5AX9A 5E8YA 3AC2A 1LM8B 2PL0A 4I5CA 5L83A 3KXHA 1LEWA 3UVQA 2QG7A 3TV4A 3NDMA 3DDCB 1OKYA 2JDOA 3OVVA 2PVKA 3D7ZA 5D11A 4FJVB 3GCPA 3ZFXA 4C0TA 4FV7A 2OXDA 2FH9A 3B1LX 4KBKA 3QA8A 4EK8A 3QAME 3CGFA 4JG8A 4FODA 5I5ZA 1JKSA 3FE3A 4R3PA 1FPUA 3ACKA 3VFKA 3V62A 2W99B 3LCSA 2ITUA 1MQ4A 3IW7A 3R01A 3W2QA 1WZYA 1YXVA 4RWLA 4DWFA 2R9SA 5ANEA 2YIRA 4HDOA 4EOIA 3O50A 2WTKB 1I42A 3K54A 4K11A 4WWOA 1R78A 3VAWA 2YM4A 2XK3A 2MBOA 4L00A 4YZ9A 4NTSA 1MRYA 2IVTA 3Q2JA 3PPZA 1O9UA 5KMKA 2GQRA 2OBJA 3VH3B 4EJ7A 4DEBA 4M8NA 3NRMA 3LM5A 4EBVA 2W9FB 4GH2A 1SGHA 3RINA 3BI6A 3A1QB 1AGWA 4PL5A 1WF9A 4PS3A 4MJSB 4DHZB 1YDSE 3PS6A 3PA5A 4I41A 4MGZE 3VJOA 3ENHA 1WXMA 2LGDA 4EZ7A 2QOBA 2VAGA 3R73A 5AUVA 4J6IA 3IW4A 3TCPA 1RQQA 4DFUA 3GGFA 2PK9A 4BKGA 3DAKA 1YHSA 2YVCA 2VO6A 5C8KA 3R1YA 3QZIA 4KNBA 2MP2A 3KRWA 5LXIB 4Y95A 3E5AA 5AUYA 1M7QA 4XG9A 4RWIA 2C6LA 1UZXB 3FC2A 4AJWA 5E90A 5AV2A 3MHSD 1P5EA 4I0RA 3T8OA 3V6CB 3O2MA 4NU1A 2H8HA 3AD5A 1L3RE 4Z7HA 2WMAA 3KMMA 4FR4A 3K9OB 3GQIA 2W1DA 3MN3A 4BOSC 2QOFA 4EL9A 5J1VA 3UQFA 4QTBA 1WFYA 4E20A 1M2PA 4FNXA 3RZFA 3U6IA 3IECA 3BWFA 4FULA 3UODA 2WYQA 4KKEA 4J8NA 4EOLA 4TKNA 1EF1A 5E8SA 2G2IA 3K3IA 4CG9A 5E4HA 2J50A 3RHXA 2ASQA 2Z2WA 3A4OX 3EFUA 5L3AA 3Q53A 2J5FA 1C3TA 3UIXA 3HV5A 1Z57A 3IHPC 3LFQA 1VCBA 5JHAA 2YFXA 1J3HA 4MD7E 4KABA 1U4AA 3UQCA 5IISA 5E8VA 1J7LA 2B54A 3O8UA 4YR8A 4CKIA 3FQSA 3R8VA 1WR1A 2YCSA 4EH3A 4MKCA 3ZRLA 3ORKA 1HE8A 2VTTA 5KHQA 5KHXA 4X2KA 2V1YA 2H96A 4ANQA 3SHQA 3ZFMA 4FKJA 5I9WA 2C3KA 4FV4A 4TL0A 3W1SC 2XCHA 4F70A 4ZOGA 2PE1A 4V04A 4G6NA 2X4FA 3HYHA 5E8XA 2VRXA 4U81A 1TQPA 1OTRB 4A20A 4O7VA 2NVUI 3A9JA 3KMWA 3GI3A 4BWXA 1R3CA 5FUTA 4Q2AA 3ITZA 5EI6A 4R3CA 2IO2B 4ZRKA 4PPBA 4DYMA 2Z02A 1Q5WB 5EDPA 5KHWA 3S00A 5DE2A 1IAHA 3MIAA 4QMOA 4XP0A 1WXAA 2WDTB 3O96A 5BYYA 1LUFA 3HV4A 3AI5A 2C5LC 2JRIB 3UO5A 2W4JA 3QXPA 1E8YA 3NS8A 4E4MA 4DINA 1BL7A 2J5EA 4JQ7A 1WE6A 2KFKB 4M69B 4HLEA 4OT5A 3HP2A 3GVUA 3ELJA 2XYNA 4FEVA 4EH7A 4KZ0A 3T9IA 5LVOA 3HMPA 2C7NB 5HNBA 5HE1A 2CKOA 4U0IA 2J51A 5CSWA 3LMIA 3LFBA 3TJDA 3CTJA 3KYCD 2PVJA 4X3FB 2XUUA 4WWNA 2PVFA 5JEBA 3ALNA 4X57B 4B8MA 4E6AA 4ZZMA 2KDBA 1LXDA 3G9NA 5KCVA 1H26A 4YSMA 1K8RB 3M62B 2ONLC 2BHHA 5DEWA 1KJTA 2C3IB 3MPMA 3GC0A 3A33B 3UG1A 3C7QA 3ODYX 3WZKA 2J4ZA 3ZS5A 5T6KA 2NNWB 4MH0E 4LOPA 3BBWA 4L53A 5EW9A 4ZLZA 3HRBA 3APDA 5K5XA 3I0OA 5EYKA 4S31A 3KVWA 2GCDA 1A06A 3OJ3A 4JDHA 1YX6B 3JUHA 4O91A 4R7HA 4RJ4A 2RL5A 4MHAA 1H1SA 3PHWB 3PPAA 5M56A 3A4PA 2QHMA 4MELA 2ACXA 2XA4A 3DV3A 3AG9A 4WJPA 3PA3A 4FJZA 2W9ZB 1JBPE 4MVFA 4MNEB 3W8LA 4I6NB 1E8ZA 4XP3A 4XJ0A 1P9DU 1WBPA 3MH2A 1H00A 2E9OA 2AL3A 4FV6A 5HVYA 4AX8A 4GCJA 5BMSA 2C3JA 3KK8A 2KK8A 1HCKA 3VBTA 2E9NA 3SVVA 5CI7A 3R7VA 4PPAA 4K7UA 4E7WA 2MBEA 3L17A 1H0WA 3NIZA 5AP7A 1TQIA 3SRVA 3CD8A 5CZHA 3FLZA 2G01A 1Q62A 3ZH8A 3RYTA 4EZ5A 5IQBA 1U54A 3ZCLA 5EM8A 3Q4TA 3ZONA 3HRFA 2PU8A 3ORZA 3R7GA 3DTWA 3E64A 2IZRA 4G3EA 3FLNC 4F1SA 1REKA 2VNWA 4EFOA 3B8QA 5C03A 3EYHA 3UC3A 4IACA 2WMRA 4OBOA 4NT4A 3KUDB 5LCJA 4MBJA 3OW3A 4RLKA 4DH8A 2L3ZA 4FV0A 4N6ZA 4FIGA 5D6JB 1IAJA 4IJ9A 2A2AA 4FTLA 3NUAA 2QR8A 5KMJA 5CWZA 4FKWA 4A4OA 3G6GA 3I7BA 2ZCCA 4PNKA 5M08A 2EXMA 3FMMA 1CKJA 4WQOB 1X1MA 3G15A 3IQ7A 5CT0A 2UZVA 2HZIA 1B39A 3T8MA 4IAAA 2BILB 3CXWA 4W4WA 2A1AB 3CQWA 3NOBA 4RLLA 4O7NA 3APCA 3D0EA 2ZVNA 5KHOA 4YLJA 5CHWA 4C4GA 2YAAA 4XX5A 4UMPA 2R3RA 2RSUA 1NW1A 1W82A 1YI3A 4LDTB 3UIUA 3JVZX 5K4IA 4GSWA 1IRKA 1V2YA 2X7OA 3LJ1A 4F9CA 2PSQA 4BF2A 5A4LA 3RD2A 2WTDA 3I1AA 4I94A 3SAYA 3RALA 3O23A 3JXWA 2Y6MA 3B8RA 3GCQA 3F5XA 3P86A 3Q4CA 3EYGA 4ANLA 5C1QB 4RJ5A 2YABA 4CXAA 4U6RA 1V0OA 4FA2A 4EH9A 3OWJA 2I0VA 4F9BA 5BX0A 4FVQA 4F6WA 3ZXTA 3R8UA 1RW8A 4G5PA 3GCSA 2XNOA 3C4XA 4JBQA 4ZY6A 2JF5A 3A8XA 4AP7A 1NT2A 2CPKE 4CMUA 3VS2A 5HOAA 5DFPA 5FTGA 3OMVA 3PUPA 2ZM4A 3HDMA 2ZOQA 2RFEA 4IWPA 3EIDA 2O2UA 3CC6A 2F9GA 3PTFC 4HNFA 2HJ8A 5BUEA 4FLHA 3FMNA 4O0YA 4FMQA 3F2RA 1LFDA 2CMWA 4AG8A 3C13A 1NDDA 1CMKE 4BGGA 4KRCA 4O81A 5CX3A 2W1ZA 4BIDA 5A9UA 3SC1A 5DBXA 3QD2B 4KB8A 5DT0A 3OJ4B 4FUXA 4DA5A 3VHKA 1ZKHA 3L8VA 3SX9A 3NW5A 2OWBA 4HK2A 4CQGA 3PRIA 3A8WA 4YPSA 4LOOA 2VTPA 2D3GA 2ESMA 4YTIA 2X39A 3D32A 2CGWA 3KW5B 3QHTA 1PYXA 2MWSB 4A3OA 4O6LA 3QQKA 2G45B 3AU4A 4EWQA 5HD7A 3FI8A 4QTAA 2RGFA 3RJCA 4CYJA 1UU7A 3QC9A 4DHZE 3DNDA 4AN2A 5GIPE 3TZ9A 4I4FA 2PMNX 4EHEA 1OB3A 4BY9E 4R8QA 3O7LB 2M8SA 4BCJA 4U3ZA 3TKIA 3ZO5B 4V0GA 4FEWA 3ZUUA 3WE4A 4EC9A 4IH8A 4O7ZA 4IIRA 4PL3A 5IPJA 4DEAA 3RPRA 3C0HA 4YBKA 3VBVA 2XB7A 3P7CA 4BTMA 2O6VA 2PJHA 3DVNV 5L6PA 3CQEA 2CNUA 3GOKA 4APCA 2B9IA 3TM0A 1H8CA 3PIXA 2OH0E 2L00B 4ZMFA 4FTNA 1MQBA 4W9CA 2OIQA 4FTJA 2V4LA 4U44A 4II3B 2J7QB 4UBAA 4A4XA 4CLJA 2C7HA 4M12A 4FHJA 4LMNA 4YJOA 5DHJA 5GZAA 4D2SA 4FG8A 4ACHA 4WJNA 4LMUA 3NNVA 3ZUVA 2W1FA 5IH5A 4LI5A 2KFJA 2Y4PA 3MJ1A 3RPOA 1I09A 1U59A 3PJ1A 2JIUA 2GMXA 4QT1A 3FPMA 3L8XA 3MVJA 3QRIA 4FZDB 1OUKA 4EOQA 5CZIA 1KOBA 3H9RA 4YU2A 2KTRB 3BINA 1YHVA 3AT2A 5HO6A 5IEXA 2IBIB 2QURA 4LCDE 2DYMA 3BHVA 3H30A 2UW7A 2DAJA 2P2HA 5J5SA 2XMYA 3H0ZA 3RMFA 3RK5A 2HD5B 4PDPA 2AYPA 4AJYB 3RCZA 4DE4A 4RX8A 3QCQA 2XKCA 3UIOB 3Q6WA 4QD6A 3AMBA 1ZZLA 3WAOA 3H7PB 4R7IA 3PRMB 3ODZX 5DRBA 3VN9A 2C6DA 1AD5A 2IY1B 4CCUA 5D7AA 4KBCA 4AGUA 3ROYA 2KX3A 2P0CA 3VUKA 2YLEA 3R9RA 5DT3A 1JSUA 4KKGA 3PPJA 2X7FA 2CNVA 3BIZA 3D5XA 2C9WB 5AP0A 1U5QA 1WIAA 3OZ6A 4O7RA 4BDKA 4KIKA 1GJOA 4XV1A 3KY2A 5BVWA 4J71A 3PRPB 5DYJA 3QYWA 4QP1A 3QD4A 4U8ZA 3HGKA 5IMEA 2WTIA 5D41A 3HP5A 1WVYA 3WI6A 5TT7A 5CVFA 1J1CA 2O2VA 1S3SG 4W9IA 3EQBA 4JRVA 4C38A 4FTCA 1FVTA 3CTHA 3O7LD 3BLQA 4XOZA 5A54A 4MX9A 2R2OA 2YISA 2CKPA 4YC8A 4D9TA 2EMTA 4WA9A 3RUIB 3OY3A 2BIYA 2BALA 1XQQA 4O0VA 3EQHA 5LMBA 3OP5A 5FBOA 2IO0B 4ZSLA 2WOUA 2A4LA 1WGHA 4QQ5A 2MBHA 2YM6A 5ANJA 3ML8A 4F08A 3EL8A 2ITTA 2OJIA 3TTJA 1BL6A 3H9OA 4PYZA 2WTCA 2VWXA 3U55A 3DQWA 5CXZA 3BCEA 4YO4A 1KOTA 3E7OA 4F8CB 4CFXA 3SW4A 5AIKA 4C57A 4E93A 1GZOA 2F7ZE 3FYJX 4I6LB 5K4JA 5C23A 3CD3A 3FY2A 3N3KB 5HNGA 3KL8A 3WARA 4EKUA 2MSED 2D07B 3C50A 4LJPB 1FQ1B 5HZNA 1R1WA 5AP6A 2WIHA 5LVLA 3QA0A 1OGWA 5CF5A 2B52A 3SG9A 5AV1A 2OG8A 4FJYA 3ALOA 4ZMEA 1U5RA 4G9CA 3ORIA 4JQEA 2GFCA 3AULA 4IAKA 4IM0A 2XJ2A 2FSOX 3P2BA 4L8MA 4WNKA 4W9EA 1YRPA 4GG5A 1C1YB 2Z59B 2LVPA 3BV3A 3RAIA 2XK5B 5D10A 5H8GA 4FT3A 3KA0A 4L52A 4WRSA 3FZTA 3TL5A 4MEDA 4QMLA 2HYYA 3DJ5A 5CU6A 4IVCA 5E6NA 2O63A 2YCFA 4JXFA 2FO0A 4KS7A 3A1QA 1PRYA 3TNQB 3V5WA 1YX5B 3DOWA 4FKIA 2V7AA 3DVGY 4TNDA 4DFNA 4BKZA 4NKAA 2VTHA 2NBWB 2QQ7A 4HW7A 4N57A 3CEKA 5CENA 3PLAE 4D5KA 4JGHB 3QUPA 4NPNA 3SD5A 4E6QA 2LXCA 2WD1A 3WZEA 5KMLA 4FTOA 2B7AA 2PE6B 4BR3A 2R5TA 4EUUA 4A9YA 2PUIA 3FMJA 1R4MI 2Y4IB 5CVGA 3NPCA 4BBNC 4NQKE 3PVLA 4PRJA 3FBVA 4BOZB 4BDEA 4WUNA 4QTEA 1E1XA 4FIIA 4BDIA 5FD2A 2GTMA 1RFAA 3MH0A 3VS5A 4QMYA 4FKPA 3GOEA 2RPQA 3ZLYA 4Q9SA 4FV1A 4GKHA 4FIJA 3D9VA 3QWKA 3LLAA 4GUBA 2XS0A 2KDFB 3ORNA 3ZIMA 4FBXA 5FBNC 2RKUA 4PMMA 1DI9A 1EF5A 1PXIA 3O8TA 4HPUE 4FOBA 4L42A 2PEAA 2UV2A 2OI4X 4Q5EA 5KZ0A 1H1QA 5HORA 3F7WA 4EOOA 4RIYA 1DS5A 2BDFA 4BDFA 4XG2A 5GZ9A 4MXOA 4L7SA 3FPQA 5EK7A 3PY3A 4O6EA 2YAKA 3BGZA 3OF0A 2C5YA 2ITVA 2BRMA 3Q3JA 2IO3B 1G6JA 2CHWA 5HKHA 3DTCA 2PULA 3W33A 3UNKA 2ZCBA 4JT3A 2MQJA 5C01A 3ZUNA 1Q97A 4EI4A 5E7RA 5CTRC 2JGZA 4FKGA 4Z3VA 2FGIA 2PTKA 2GBRA 3TIYA 4IVDA 4W9JA 4ZTHA 5HI2A 3U9NA 4CO7A 5AUUA 3LDZE 5IA4A 4K7SA 4IBMA 4D2VA 2O0UA 2DZIA 4BIBA 3MJWA 2QU5A 2A5UA 4AGWA 3RCJA 3VUHA 2JAMA 2NPQA 4W9DA 3O17A 3JW0X 3EC8A 3IBEA 2D2QA 1PMVA 2R3FA 5F94A 2BVAA 3AC5A 3RK7A 4O22A 4W8EA 2JEDA 2JAVA 3R7OA 3I5ZA 5IQAA 4GDKA 2BKRB 3QTXA 5EDQA 2BAJA 4C3PA 4K33A 5KUPA 1TTNA 3QQGA 2DENB 4AFEA 1OL7A 5EG3A 5JQ8A 3BHUA 4HCPB 3TACA 3OC1A 3UOJA 3AGLA 4CKRA 5HLPA 4O2PA 2RIOA 2P3GX 3QKKA 4CT2A 2QCSA 3DLZA 4ICVA 4TYHB 4II2B 3DU8A 4ACDA 4BCNA 4UXQA 3NAYA 4K1BA 3R1NA 3KC3A 5AEKB 2DHZA 2NRYA 1YI6A 4N6YA 4AN9A 4IWDA 4D2RA 4ZSEA 2X81A 2QVSE 2BRBA 4JBOA 2ZVOA 3ZC6A 3OEZA 2XEWA 1H25A 1NVRA 3QRTA 2BAKA 1YOLA 4X6QC 5JN2A 4TWOA 3ZNZB 4I22A 5DVRA 2KFKA 3GOPA 2ZPYA 1PY5A 4ITIA 1QPEA 2KDIA 4RIWA 4BVUC 3HEGA 4XBUA 3BGPA 4ZJJA 4CFNA 1VYZA 2BRNA 3MB6A 2JT4B 3I4BA 4ZIMA 5JH5C 3MTLA 3DKOA 2DX5B 5D9HA 2B3AA 2F2UA 4K18A 4G3DA 5EW3A 4BWPA 1M17A 3TWJA 4HVDA 2BKZA 1T46A 3A4RA 4MXZA 4EWHA 5D94A 4B9DA 4HGSA 2XK4A 1GZ8A 2XIKA 4E5AX 2K8HA 2WQEA 5FXRA 3V6RA 1DM2A 2ITOA 3NW6A 5FWKK 5BVNA 1OEYA 1L8TA 2G2HA 1PJKA 4XYFA 2C1AA 4DFXE 4RZVA 4ZLYA 2I0EA 3RM7A 3MH3A 4ZEGA 3NEWA 3JYUA 4G6OA 2KWUB 1OM1A 1HCLA 2MX2A 4IHPA 3ZO2A 4CMTA 3CKXA 1XH5A 1QZEA 5JKGA 1XJDA 5CU3A 4U9AA 2UW6A 4KUJA 4KD1A 4GFGA 4MNEA 4BKTA 3L9MA 2R7BA 3DVNU 4J99A 2Y5BB 3RNYA 4F7ZA 4RIOA 2N1VA 1S1QB 4LGGA 3TUBA 4YTFA 1WM3A 3R83A 3NZ0A 4JAIA 5CSHA 5FM2A 1M14A 4GT4A 1WXVA 4D28A 2W05A 4Y72A 4WIHA 2YITA 4B4LA 3DB6A 2AC5A 4NM3A 2CHLA 5J79A 3THBA 3UINB 2N7EA 4E73A 4NK9A 5BYLA 2BZJA 5EYDA 4JRNA 4FEXA 4HGLA 2LGCA 5AJQA 3FAAA 3Q9WA 4HGTA 4AXAA 4ANMA 2IO6A 4TV3A 4EK6A 3DCGA 1KOAA 4IXPA 3U9CA 4M84A 3L9PA 3W2PA 3L9LA 2WMQA 2AUHA 4NW5A 1EUVB 2KLCA 2OLCA 5IUIA 2X7GA 3TKHA 3CMMB 3COKA 3VHEA 3QC4A 4Y83A 4BGHA 3VW8A 3UVRA 3D5WA 4QMPA 1GC7A 3BHTA 4IDTA 3ZM4A 3QAQA 3N9XA 5BVDA 4AW2A 5M4IA 2AEHA 3OTUA 4RJ6A 5HIDA 3E63A 3F3UA 4XV3A 1Q61A 3G9LX 2VX1A 4B6WA 5LMKA 4WD5A 3HK0A 1G8AA 1H4RA 1RRBA 1VZOA 4ZYNA 3NWWA 3SDLC 3P1AA 3TUDA 4MGKE 5BNJA 2JC6A 3WILA 3UGBB 4ENXA 2UZWE 3ENMA 3DJ6A 1NVQA 5KMIA 4O86A 1DI8A 4QP6A 3UNZA 2C6TA 1KLVA 1QPCA 2RSVA 4GGQA 4JVGA 4NM5A 3MY0A 5T68A 2K6QA 3ERKA 1P98A 2BKFA 2LXAA 4O7SA 1WM2A 1Z2MA 4YHJA 4A9TA 2PE2A 2JLDA 2XZSA 4R5SA 3PXZA 4IM2A 4QQJA 4GK2A 2YCRA 5BUIA 4GN1A 5I0BA 4HOKA 5EOLA 4GV1A 4D2TA 3FXXA 1QPDA 3TNHA 3NCGA 4NKSA 2W1HA 2RFSA 4U97A 3DZOA 4FNYA 4LRKA 4G17A 4A7CA 5HCXA 2YEXA 4BRXA 4H58A 4F9YA 5KE0A 4EYMA 2WELA 2VUWA 2GHMA 3T9TA 1Q8UA 1J91A 3AT3A 3DK6A 4O1PA 4BIEA 4FTMA 4BHZA 4DH7A 2P33A 4OTGA 2LVOA 4M0YA 1Q5KA 3UO6A 3HA6A 3VULA 2QOCA 4A9SA 2AWTA 5DR9A 4F09A 3JY0A 5F1ZA 2BDWA 5LWNA 2ZMDA 1WXSA 1PKGA 5ICPA 4FSYA 3VS0A 3MBLA 4G1WA 2XNEA 4FL3A 3LE6A 5EHYA 3X0WA 1WX9A 5KZIA 4ZSAA 4EZ3A 3R8MA 3ATTA 3VS7A 2W1IA 5JH6A 2JUOA 4AOIA 3KYDD 4K8AA 2BRGA 1RLFA 5C27A 3LJ0A 4RVLA 1PXMA 1RE8A 3PJ2A 3F2AA 1CDKA 4YJUA 2HY0A 4P5QA 5ANDA 5M4UA 1NI2A 2OJJA 3PFQA 4IE9A 5IZFA 4MSMB 2R4BA 3LQ5A 3R7YA 5AZHA 3AC1A 3I79A 3MS9A 2G15A 1OPKA 4XMOA 4QO9A 4CZUA 3NYNA 3VUYA 4U80A 4G3FA 1GIIA 3FY0A 4CT1A 2WQOA 4MXYA 1QL6A 3PVGA 4TWNA 4HYIA 2NPTB 1WVXA 4C4EA 3AC3A 2WTJA 3BHHA 3NUSA 4R78A 2G1TA 3LHJA 3HIZA 2RD0A 4X3FC 4ANVA 4QYYA 2R3JA 1TQMA 1ND4A 4F9WA 5A3XA 1ZYCA 4ACGA 3JVSA 3ZTDA 4L7FA 4D1XA 4G3XB 3GT8A 3FMDA 4FV8A 3M3JA 4NW6A 1WBTA 4X7QA 4GT5A 5AR4A 5HVJA 2VO3A 4DXAB 5AR8A 2I1MA 4JQ8A 1JLUE 3PJCA 3D14A 1OBGA 3TNIA 2CSNA 4EZJA 4EUTA 3LFSA 2DYBA 4YP8A 3ZRMA 4YURA 2EVAA 3V3VA 2JD5A 1WMKA 2UZNA 1P0RA 4C36A 2Y9QA 4GJ3A 1ZZ2A 3OEFX 4EHVA 2OXXA 3FEGA 4RC4A 4YJTA 4ANWA 5M09A 2MLBA 1H0VA 4DG2E 5AA8A 2V7OA 4C3FA 2PUPA 1MUOA 3I0QA 3EFJA 4LYNA 4M66A 5C26A 2IW9A 1IA9A 4BTFA 4IWQA 5KO1A 2C6KA 3OCGA 5HO7A 2CGUA 2WMBA 1V0BA 4YNEA 5DPSA 4AW5A 2EWAA 3V6SA 2YJSA 2DZJA 3KH0A 3L10B 2JZZA 1SIFA 1Z5SB 3Q4UA 2NRUA 2DZKA 2OH4A 4IC7B 3GC8A 3EQRA 5BMMA 4G11A 3LFNA 5DRDA 2XIXA 3V8SA 2KWVB 2CR5A 4UMUA 3FHRA 2KQ7A 3TMPB 5L8KA 2C6IA 3UOHA 4YL8A 5ACBC 1ZGUB 2XH5A 1WX7A 3PPKA 3CSTA 2K8BA 2VWWA 4YLKA 4ZTRA 4IM3A 4DEGA 2BYVE 3Q9ZA 4GL9A 5IUHA 5FGKA 5HKMA 4QPAA 5FEQA 2ZM1A 3QGWA 3DBCA 3FQHA 5IQDA 3NIEA 4HVSA 5BVFA 3VW6A 3AXWA 3OOMA 5HQ0A 4AF3A 1F9JA 2VWUA 2ZB1A 3HV7A 5IQGA 3ZEPA 4Y73A 1FGIA 1WGDA 5AM7A 4GU6A 3WOWA 4NM0A 4WBOA 4GSBA 4J1RA 3WF7A 3UOKA 5FP6A 3FKLA 5JFWA 4C59A 5EDRA 4YMJA 1WZ0A 1V5TA 5HX6A 3BYOA 1UELA 4L45A 4PV0A 1A48A 2GS2A 3IGGA 4MAOA 2Y0AA 2OO8X 3IONA 4CHKA 5LVMA 2WX1A 3QX4A 1OMWA 3DBQA 3QRJA 3W16A 1WX8A 5IMXA 3UVPA 3SQQA 2B9HA 2VTRA 3DBHI 3U4WA 2Z0EB 4F1OA 4EONA 3H1UA 3IW5A 3COIA 3N51A 3HX4A 4W9GA 2BPMA 4WHZA 3JVRA 4X3JA 4RJ8A 4AA0A 5JSMA 2K25A 3BY4B 2KJHB 3MJ2A 3SGCA 3R28A 4BKJA 3CSVA 4QNYA 4CFUA 2JBOA 1ZOGA 3AC4A 3M2WA 4PUZA 4P7IA 1FOTA 4I5PA 3K5UA 4U5JA 3VQIA 3ID6C 1WMHB 2XF0A 2GHGA 3EMGA 5EDSA 3P08A 5JGAA 1XR1A 1IG1A 3WF9A 4E1ZA 2X2MA 3W55A 5BO4B 2XJ0A 4F1MA 1GJZA 4OBQA 3PG1A 2R2PA 3QKMA 1G3NA 4DN5A 1UU8A 3ONSA 3G0FA 4E4XA 3EN6A 2KN5A 4FOCA 2BZHB 1Y8GA 4I0SA 4BTKA 3PHXB 1QMZA 5CEOA 2HZNA 2CHXA 4I92A 4FTRA 3ZLXA 4FEUA 1JAMA 4BI2A 5DPVA 4CEGA 4BCQA 4NNJB 3QTSA 3EQGA 5CQWA 3NR9A 3OAWA 1WCCA 1FMOE 1J8CA 5GMVA 3GC7A 4QMZA 4J96A 1BUHA 2FCSA 4RJ3A 3FL4A 4JAJA 4TRLA 4JDIA 3UYTA 2GS7A 2KANA 3BBTB 3WIKA 3KUCB 3PRZA 4DHJD 3D4QA 4IAZA 3QCYA 3UE4A 3PVBA 2N1WA 5C1ZA 3ORTA 5M07A 2WQMA 3S0OA 1IP9A 5E6PA 4RA5A 3DJ7A 4D5HA 1XWSA 3WIGA 4RIXB 3G5DA 5L8LA 2BUJA 1ZMUA 3VBXA 3MFSA 4JS8A 4JX7A 2PHKA 5C8NA 4OBPA 4X0MA 3NAXA 5EH0A 3P23A 3W1SA 3LXLA 3Q32A 3UNJA 1V5OA 5L95C 4EH8A 4UY9A 4KINA 2FIDA 5HIEA 3W2SA 2YCQA 2O64A 3KXZA 3QUEA 2FCNA 5FEDA 3A2CA 4ZY4A 5CANA 4FE2A 2BZIB 1XD3B 4HYUA 5DNRA 4AZEA 2GNJA 4XS2A 2REIA 3F3TA 4GMYA 3LVPA 3PY0A 4AP4C 4BBEA 4FT0A 3QU0A 4TKSA 5LQFA 3E8EA 1S9JA 3AC8A 3CY2A 4RPVA 3ZDUA 2X9FA 5FQDC 2CKQA 3P5KA 5IA3A 3VTUA 4ZLOA 1O6KA 4PDYA 2PPQA 4IZYA 3MA6A 4IC8A 2MCNB 3FLQA 2R7IA 4YC3A 1URWA 2J0MA 4G50A 2UW5A 4J98A 3ZVVA 1XQZA 4M14A 4D2WA 2XNBA 3KVXA 4HNIA 3RULA 1UVRA 3E93A 4QRCA 3JSVA 2JIVA 4HDQA 5GNKA 5AUTA 5AV3A 1E7UA 2N9EB 4AGCA 4GW8A 4O83A 3A61A 4TYHA 2G2FA 3VBQA 3WZUA 4F6SA 1LPUA 2VWVA 2WWZA 4XV2A 3RTPA 2D11A 4K0YA 2PVHA 3U51A 3QD0A 4CLIA 5L2TA 2C68A 5K0XA 5CYIA 5IU2A 3EJ1A 3CJFA 2XNNA 1OKVA 3WZDA 2ONLA 3R21A 3MTNB 3EOCA 5EM5A 2QOHA 3BPRA 3C0RB 2GS6A 1M94A 5CNOA 3CF6E 4DC2A 4FL2A 3EL7A 4C4HA 3S2AA 3PXYA 4ARKA 4YUQA 2AYOB 3OCTA 4KSQA 2J6MA 2I6LA 4P2KA 3DPKA 1PXLA 1YQJA 2Q0NA 3PXFA 4GFOA 3SOAA 4D4VA 3RBWA 3Q96A 2XKEA 5AP5A 3ZTXA 1Q8ZA 3NYOA 4E6CA 3BHYA 4U40A 1H1PA 4FZAB 1KWPA 3EFLA 4DH3A 3L1SA 3TIXA 3S2PA 1Q8WA 2RGPA 5HG7A 4YZBA 2PVNA 3RT3B 4C33A 2VTQA 4BKYA 2MW5A 2JDVA 2NBUA 4ALWA 5A14A 4X2NA 2RG5A 3SV0A 2LUEA 1Q4LA 3PSEB 3PZDA 2C5VA 2EMSA 3MI9A 3HHMA 3GU5A 4ZS0A 3ZDMC 2OZOA 5E9EA 4CCBA 4FBJB 3KU2A 4HVGA 4KWPA 2EXEA 2O5KA 3C0GA 4FEQA 4FV9A 3R7EA 1MRUA 4K9YA 3V51A 4PMPA 3ZLZA 3MWUA 3EHVA 2X9EA 5CSXA 5H8BA 5BQ0A 4C4FA 4H36A 3LZBA 2YM5A 4L67A 2BFXA 1FMKA 4DGGA 3NSZA 1ATPE 3VUDA 1PF8A 4ANOA 4NUSA 1OL6A 4FZ7A 5D1JA 4P7EA 4GG7A 4MF0A 2WFYA 5IEVA 2V5QA 2KXJA 3UP7A 1OITA 1KSWA 4O27B 4FSUA 2ETRA 1PMUA 5ANIA 4FKOA 3NLBA 3SXSA 1ZWSA 3RK9A 5AAGA 4D4SA 2J0LA 3QCXA 5J95A 5FTOA 4M0ZA 4QNAA 4XZ4A 3QHWA 3HUCA 5KKRB 5GZ8A 2W7XA 4C35A 3UPZA 3H4JA 4W9HA 4JX3A 4L6QA 3ORMA 4WBBB 4YO6A 5AR3A 4CTBA 2R64A 4DGMA 5AX3A 4R6VA 3VQUA 1Y57A 3VF9A 3QTIA 2IY0B 5I9ZA 5F9EA 5JGBA 2QU6A 4FADA 3QX1A 1JVPP 2Y4IC 2VV9A 4KZCA 2L0FA 4Q5HA 4LRMA 2N4FA 3AD4A 2LJ5A 2PZRA 3VDZA 1PQSA 4GMVA 3ATSA 4B8LA 3A9JB 3D94A 2RFDA 3HECA 4LV8A 5HX8A 4RBLA 2B0QA 3LFAA 4RX7A 3POZA 3V6EB 4FGBA 5ITAA 3MH1A 3RPYA 2ITZA 2JKQA 1PHKA 3KCKA 4IJPA 1ZOHA 4D1ZA 2C6EA 4IMYA 3OG7A 3DK7A 3DXQA 5JZNA 3P0MA 2WEIA 2JXXA 1SVGA 2GMIC 4G16A 3Q60A 2C7MB 3QZFA 3PLVA 4P5ZA 3PE1A 3NUXA 3GQLA 3EQPA 3A4SC 3OUKA 4X6RA 4PL4A 3A7IA 1YWVA 4XC2A 3B0AA 3UPXA 2YLMA 1KV2A 2R3KA 2IZSA 4BCHA 2CLXA 3AOXA 3EQFA 2KJRA 4DEIA 4RM8A 3KXGA 1UWJA 5HTIA 5IH6A 3EHAA 3NVMB 3CTQA 4MGYE 2I40A 3OCBA 4K7WA 2YM3A 5CAUA 4F1TA 4CKJA 4KDIC 4ZRJA 4J52A 2J0IA 2HZ0A 4PYUA 3KXMA 4KDLB 2CDZA 2ITPA 4ZDVA 3C4WA 1SVEA 4CYIA 2XRWA 4ZK5A 4IX3A 4I3ZA 2LRUA 5HTCA 4OTWA 3DDPA
chains in the Genus database with same CATH superfamily
3TEZA 3NYXA 2ZAZA 5HIBA 2P2IA 2LGYA 1L2NA 3SR6A 2Y5PA 3BYMA 3VAPA 3F69A 3KRXA 2ITQA 2W4KA 3B2WA 4L44A 1WRIA 5A4QA 3QZHA 1T0RC 2VZKD 3RNEC 3ZNHB 4IDIA 5K5NA 1YOMA 5J18A 3AQVA 4LRJA 3UIMA 2A27A 5EOBA 1XF5L 1WYWB 4F6UA 3IVFA 4ARCA 3MY1A 5DH3A 2WX0A 4LJOB 3KQ4A 4XG3A 1OL1A 1QPJA 1H4LA 3NVZA 4U43A 5AV4A 2WMSA 1TFFA 1ZY4A 2X8DA 3D7TB 4U41A 4II5A 3SOCA 5DCNA 5H8EA 3W18A 3BYSA 2Z7RA 4I24A 4M68A 1UWMA 2KT7A 4BB4A 4UYAA 4I6HA 5IA7A 4LNOA 3BGQA 1VJYA 4QYFA 3TEIA 2YJRA 5CASA 1TZ1A 3ZSIA 1FVRA 3QD3A 4FK6A 1ERKA 3DGKA 3UIPB 4FL1A 3HMIA 1Q99A 1U54B 2W5HA 2Y3AA 3R7UA 4TPTA 3PWDA 3PG3A 3EN7A 3V61A 3R8PA 2BHEA 4I6FA 4LL5A 1H27A 1W83A 4RQKA 2O65A 3IPHA 4DTAA 4O82A 1MI0A 4WG4A 4IANA 4JJRA 5M51A 2UVYA 4YZCA 4I21A 4KIQA 4AZWA 1XLOA 3WIMA 3ET7A 3A62A 1TY0A 5A4EA 4JPSA 1CMXB 5AUWA 2OOBB 4HPTE 1YQ4B 3E8CA 2G3QB 5JFSA 2REXA 5LARA 2DUVA 3KREA 2WS3B 3S1HA 4JLCA 2WTWA 4PPCA 4TQ0A 1ZYLA 2UW3A 2JXTA 4CGAA 4HYSA 4WSYA 3ZSGA 3LCKA 4CNHA 3C0IA 2W1EA 4AAYA 3U8ZA 3DWMA 1PXJA 3DS6A 4OAUC 3LW0A 4NCTC 4FYNA 3LB8C 4N70A 4EOSA 1L0YB 1Q3WA 3R30A 5F95A 4U3YA 1BX6A 3WF5A 4D55A 4BZDA 1R39A 4UZHA 4J97A 3NUYA 1YN5A 4ZJVA 4DFZE 2J52A 3DBLB 4H39A 3AT4A 4C4VB 3DLSA 1ZAOA 5E92A 3TJCA 3LFCA 4FKRA 3QHRA 1WZ3A 3ZU7A 3F66A 4CSVA 3Q3MC 3MIYA 5HEZA 2IYDB 2BYTA 2FYSA 5CU4A 3VVHA 1MPEA 2F7EE 3W1YA 4YBJA 4AE6A 4RWJA 4GRBA 4JWUC 1UU3A 4A4LA 3BVGA 3P42A 4IAIA 3II5A 5CF6A 1UNSA 3HM6X 3NUPA 4A06A 2CN5A 1SZMA 3EB0A 4O21A 4E5WA 5EQPA 2QILA 4ZSJA 3W0PA 3DBLI 2BCJA 4L01A 4W9LA 4O7YA 1WJ4A 2IG7A 2XALA 4X2JA 3BU3A 3NX8A 1D6EC 1YDTE 3ZC5A 5AZFA 2D3CA 1CZPA 5AEPA 3TSSA 3HKOA 3H9FA 3LPBA 2HJ1A 4GKIA 3BU6A 1K9AA 3FSKA 3R04A 2JVCA 4BHNA 4D58A 4ENYA 3S4QA 4HROA 3AE2B 2RMMA 4A07A 4KGRA 3VRBB 3NNUA 3ZHPC 4BFRA 4FKUA 2Z7LA 4NFNA 3CBLA 2OICA 4DHJA 4EOPA 2CN8A 4AOFA 1IYFA 1KH0A 4LV7A 3H7SA 5AFVA 2I0HA 3TJPA 2WXQA 4O0TA 1TKIA 2BQQA 4PF4A 3FZOA 1ZARA 4LLGM 1V0PA 4CFVA 1NA7A 1E9HA 3GP7A 2OJGA 1HXYD 2BAQA 3Q3NC 1XT9B 5C4KA 3FZ1A 3AE1B 5EW8A 3RKBA 4GIIA 5AWMA 2PYWA 4JBPA 1A5RA 3LCTA 2HW6A 1E1VA 2BS4B 3HA8A 3ANRA 5K0KA 2BROA 3OTVA 4JIKA 3MVMA 2QG5A 4V0GB 3R1SA 3R7QA 4RVKA 4MEMA 4G6LA 1XHAA 2N9XA 4U45A 5M53A 5IDNA 5AIRA 2DS1A 3CQUA 1J7UA 4H3PA 3W32A 2R2QA 3C5IA 3V05A 1GAGA 1R7SA 2YIYA 4YZDA 3LXKA 4BDDA 2XCKA 3IOPA 1APME 3C9WA 4DGNA 5AV0A 3WYYA 3QL8A 3RGFA 3D2KA 3R2YA 4O4FA 4B9KA 3ZGZA 5KNJA 4DDID 1VZ8A 2XM9A 2IVVA 3EN5A 4G0NB 4YTCA 2QI8A 4XBRA 4IAFA 5CVHA 2GOWA 4UMTA 3ZJVA 4RFYA 1B38A 4BI1A 3QWJA 4XH6A 3TL8A 2ZNVC 4M01A 3FXZA 2KC2A 1XH8A 2Y7JA 3OXZA 4JG6A 4DBXA 1WMHA 5C2TB 4AT4A 4NZLB 4QQCA 4OR5A 3R9NA 4Z7GA 4QMMA 4WKQA 3LJ2A 2PMIA 5FG8A 3PXKA 3CP9A 4J8MA 2UW0A 4HEA1 4KKJA 3VS4A 2L52A 4ANXA 2TSSA 1L6VA 1YOJA 4DXGA 4LDTD 2WTVA 2XK8A 2VWBA 4L3PA 2K6DB 4BYJA 2ZPNA 4DLIA 1WBSA 4YNOA 3U54A 3K5VA 2XNGA 1I4HA 3TNWA 3UGCA 1J7BA 4QMWA 2ZMCA 2JBPA 3VS3A 3I57A 1A9UA 3ZLWA 2BWFA 2BS2B 4Y5HA 5JZJA 4KKIA 4YJQA 3DNEA 4B7TA 4FVRA 4Q2JA 3A60A 5TKDA 4QMQA 3Q52A 4E6DA 3MFRA 4GB9A 3U52E 5IN7A 2VX0A 2Y6OA 4USFA 1RAXA 5E8TA 5HHWA 3D83A 2KULA 4QP2A 3V5JA 2BYFA 5LVNA 2K9XA 4RF0A 4W9WA 5KBRA 1WJ6A 4M8TA 3DAEA 2WU5B 3EZRA 3W2OA 2WNTA 2QLQA 4B0GA 4U79A 4IDVA 4YHFA 3LFFA 3CCNA 1O6YA 2CNQA 5LOHA 5HICA 3IGOA 4WUAA 2V55A 3GFEA 5HNIX 2OU7A 4RH6A 1XBCA 2ZVAA 4PDOA 4RT7A 3SXRA 3Q2AC 2DYOA 3CWIA 2O2VB 4AS0A 4NFMA 2WXFA 1KRHA 2J9MA 4MWHA 2IPKD 4S2ZA 4QP3A 5EYCA 4W4YA 4E8AA 3LMGA 4D0WA 3AKJA 4RMAA 3OS3A 5HBHA 3W10A 1V86A 5CXHA 4A9RA 5J7BA 5L2SA 4USDA 3UMWA 2UWQA 1VEBA 3W2RA 2IO1B 2FUHB 4XHKB 4EH5A 2X8EA 2WMWA 2BR1A 2G9XA 2PUNA 1TGZB 4KRDA 4CZTA 2VWYA 4EC8A 4F7NA 4QMUA 1C78A 2GBMA 3EFWA 3REPA 2QR7A 3LQ3A 2HK5A 3R22A 2JFLA 4K3BA 4V01A 4EZLA 3HV6A 4N58A 1BT0A 3U6HA 3MESA 2INPE 4RA4A 3TZ8A 2QKRA 4OTFA 4GK3A 3KMUA 2W5AA 4EOJA 4TMAB 2N7DA 2AC3A 2HOGA 1KE8A 1GZKA 2HE7A 3DKGA 3P7AA 2WQNA 3Q5ZA 3QTZA 4C58A 5DPRA 1YDRE 1J7AA 5BYZA 4BVUA 5AMNA 1V1OA 2YM8A 1SVHA 3BWJA 3BV2A 2QD9A 4C8BA 2LVQA 1XH9A 2C5NA 3URYA 4RFZA 3OLMD 5DPTA 5ANOA 2KJ6A 5HVKA 4DG0E 3HMOA 2PLPA 1OKWA 3PSBA 2G4DB 3O0GA 1VJKA 5EFQA 3MB7A 2C4GA 4GVJA 5E1EA 4QYGA 5IA1A 2OSCA 4FI1A 4AA4A 4MACA 4FV3A 5G6VA 1OGUA 3NFGB 3DFAA 3PIZA 1WGRA 1Y6BA 4CV8A 3FKNA 3H9DA 2A4ZA 2WDQB 3R9OA 2MJDA 4UMRA 1SE3A 3LAUA 4FUYA 1W98A 1VD2A 2J0KA 2VWZA 5HG8A 3UYSA 4TTHB 2G4SA 1IGCA 2KDMA 3NCZA 2ZDTA 3GU7A 4FJVA 5DWRA 3JR1A 3ZKJC 4DXFA 2HZ4A 1G8JA 3TYKA 3FQEA 3PXRA 1WBWA 3QWZB 2IPXA 3V5TA 1XMLA 2XBJA 5KMMA 4NJ7A 1OPJA 3QQFA 3G33A 3QTWA 4LNFA 3V01A 4AU8A 4HWIB 4H05A 3RPSA 1PGAA 5CEIA 4MCVA 5FDPA 2VO0A 4L9IA 2XYUA 2XBAA 3OHTA 4QPSA 2F4JA 3L8SA 3PTGA 3TDVA 4JOAA 3E8NA 3UP2A 1JW9D 4H3BA 2VRRB 5TR5A 3R66C 3ZXVA 3DBRB 3P78A 5EI8A 4EJNA 5AADA 3CKWA 3QALE 4O0RA 1JPAA 2FCMA 1Q3DA 3EUB2 4ITJA 5D3IB 4O4CA 4QTDA 5A6OA 3S3IA 2XK7A 5EE1A 3O5AA 1XO2B 5E6OA 5HO8A 4OVUA 4FYOA 2PZYA 1V80A 5L6OA 2C6MA 2E9UA 4MQ2A 3G51A 3QTRA 3DXNA 1OI9A 2BRHA 3FI2A 1M7NA 1TZOA 1P14A 4J7BA 2NO3A 1Q41A 3BWUD 1Q1OA 4FA6A 4UB7A 2UUEA 1RDQE 2W3SA 1YWRA 3WE8A 4MJSA 4M7IA 3BELA 4M13A 3PZEA 4G2FA 3I3TB 4HJKA 4TYEA 1C77A 4M0WB 5AP2A 3ZFYA 1FPYA 3NYVA 3DBRI 1KE7A 1P3QU 2KDEB 2X4ZA 4XE0A 2OFUA 4KSPA 4YHTA 4RIYB 4TY1A 3MFTA 3LQ8A 1OECA 3LM0A 3UJGA 4ACMA 2N0SB 4XX9A 1UH6A 2YHVA 3BIID 1JKLA 3PXQA 4FTTA 3MA3A 4NZWB 1UBQA 3WBLA 1YOVB 3Q9YA 4L43A 4S34A 3DPDA 2PWLA 4FKLA 4L68A 3NW7A 4AN3A 5JRQA 3R63A 2QONA 3BKBA 4PY1A 5HTBA 5J5TA 4ZZOA 3MGYA 2GTNA 3C1XA 4E3CA 4PQNA 3R8ZA 2VTSA 2WXGA 1ACCA 3AMAA 4PP9A 2ITXA 2UZDA 4QMTA 5CX9A 3LOKA 5ETIA 3EH9A 4WSQA 3HLLA 3IAS1 3F3VA 3P4QB 4RCOA 4RFMA 2X8IA 3RWQA 3OXTA 3I5NA 3POOA 4I0TA 2WZJA 1H28A 3TTIA 4PX6A 1XBBA 4FSQA 3BEGA 2V0DA 3VONA 2CLQA 2YDJA 1JMLA 4OHJA 3TEXA 2B4SB 3NUUA 1SNUA 4XG8A 2XNMA 3NNXA 3ZRCA 2PPHA 3EA6A 4EQCA 4DFYA 2UZOA 5FDXA 4GDKB 4R1VA 3MHZA 3PZ8A 3BX5A 2GNIA 3GFWA 2VTJA 4OTHA 3VRZA 2EU9A 4X2GA 5D7GA 2RFNA 5CNNA 3FJQE 5D3DA 5JMSA 3EQCA 4J53A 2JWZA 3L08A 4DH1A 2WKMA 3A7GA 2ZJDA 3TIZA 3VS1A 3K3JA 1GUAB 3KXNA 2WMVA 4I6PA 2RG6A 2WGSA 3IG7A 2M0XA 3PA4A 5IA2A 3T3NA 4TZRA 4AQCA 3ZRFA 4FF8A 4XOYA 4K81A 3VNTA 1OKZA 2L0TA 4ZTSA 3IS5A 5BVKA 4EOMA 1H01A 2JDRA 5EHLA 2XIRA 4N0SA 4F63A 1F5QA 4W8DA 3C5UA 1HZ6A 4BC6A 4QP7A 1AQ1A 4ZS4A 3GCVA 4DGLC 4GU2A 4QP8A 4I5HA 4RIWB 3MPTA 2R3OA 2V4IB 2QOKA 5FLFA 2M4NA 4FSNA 2QO2A 1MFWA 3VUIA 3EQDA 4ANUA 2B9JA 5F20A 4ANNA 3FLSA 1SMHA 5EQYA 3NY5A 1JSVA 3GU6A 3AECB 4FZFB 5G2NA 2VZ6A 2WQBA 3QQJA 3CIKA 5CAOA 4GDLB 3AE6B 4XNEA 4DTBA 2QKWB 3ETAA 3RPVA 4JNWA 4C56C 4MQ1A 3CS9A 2KN4A 3F7ZA 4Q9ZA 3RAWA 3RNAC 2UVXA 5DG5A 2LRWA 1IR3A 4O0UA 3NNWA 3RAHA 3D5VA 4ASZA 1CM8A 4W9XA 1QOGA 3DVGX 1YIWA 1YWNA 1Y8RC 3FDNA 3VUTA 3DBEA 1KLUD 1Y56A 2PZIA 5DA3A 3N4VA 1E7VA 3KRRA 2LUMA 1S9IA 1TVOA 1UA2A 3C4FA 4FN2A 4XG7A 2J2IB 5IEYA 3AN1A 1K50A 4M69A 4DITA 2MBQA 3Q8FA 3ZRKA 2YA9A 4ZP5A 4D0XA 4R3RA 1VR9A 3VC4A 4EKLA 3DBDA 4CRSA 2CS4A 5J8IA 5BMGA 2O8YA 3QJZA 4GYIA 3U8WA 1L7YA 2IZVB 3D7TA 2CKEA 4BZNA 4PWNA 4FTUA 4X3FA 3DAJA 3O13A 3WA0A 2QOQA 4YT0B 2R3PA 3GBZA 3FLWA 1HQRD 4B95A 3L13A 1TBEA 5BUJA 4OGRA 4CFWA 5CAPA 4LOQA 5IO9A 4O84A 1OZ1A 4DAWA 1ESFA 2CCHA 4QMSA 1VZ6A 3DHIC 2RR9A 1JWBD 1OFFA 3WF6A 2K3UA 4JI9A 3R00A 2ETKA 4C7ZA 3L0WB 3E87A 5HESA 3RP9A 3BVZA 2VTMA 4KIPA 2BTSA 1C4CA 3OWEB 3Q04A 4F9AA 3SKCA 1E0ZA 2C0TA 5GHVA 3WAMA 2WMXA 2E9PA 1E90A 2ZV9A 3IW6A 3SEBA 4OZAA 3QIJA 2IZUA 3R71A 2M56B 4NQLB 3W2CA 4LNKA 3AE7B 3M95A 4RC2A 2JIIA 3AEBB 4AXFA 2WDVB 4TUUA 1REJA 2WXRA 4EHZA 1IEPA 1YXTA 4TW9A 4EYJA 4BCFA 4BICA 1BI8A 4FSZA 4M02A 4UWYA 3EECA 4M97A 3L8PA 2BWES 3KUZA 2C6OA 2PMLX 2KHWB 3KB7A 3U7DA 4MBLA 2NTTA 3TT0A 2LEKA 5JGDA 2OGVA 2CKHB 4GIVA 2Z8LA 3Q5IA 3F5UA 2KOXA 1E5WA 5E1SA 3ZSHA 3NZ3A 3NGAA 4C02A 5CS6A 4QTCA 3E7VA 3B2FA 4O96A 4AFJA 3DKFA 4X21A 3VTWA 2IGDA 5CEQA 3IT6B 1OL2A 4ZTMA 4F7JA 4AW0A 4IWOA 3LXNA 3GU4A 4V05A 2QC6A 4XV9A 4BKSA 5G5GA 1ZRZA 4WRGA 3WAPA 4D9UA 4C4VA 4P90A 4CQEA 2GNHA 4DDIA 4WNPA 2JSVX 2FVDA 4B6LA 4ZXTA 2W0JA 1JWHA 2OXYA 4UALA 1JSTA 3Q9XA 5IKCM 4MT5A 4FKSA 4RGMA 3LFDA 2XP2A 3ZMMA 5DR6A 2VGOA 2VO7A 2LI5A