4EUTA

Structure of bx-795 complexed with unphosphorylated human tbk1 kinase-uld domain
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
386
structure length
384
Chain Sequence
GSQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRNIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase TBK1
publication title Molecular basis of Tank-binding kinase 1 activation by transautophosphorylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 108
structure length 384
sequence length 386
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4eutA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4eutA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4eutA01
3Q4UA 1BMKA 4DEGA 4XHKB 4TNBA 3UG2A 2D3GA 3RCZA 4F9AA 3NAYA 3W8LA 3F5UA 4FKLA 3GCPA 1V1KA 3B2WA 4CG8A 4CVAA 2VWVA 4O0WA 3UBDA 4AA5A 4FIIA 2X7GA 4S34A 2UZUE 3JYUA 3ZSGA 4H3PA 5FP5A 4D2TA 3O51A 3HV5A 4RZVA 4FJVB 4EZLA 3QF9A 3GCVA 3VF8A 3T8OA 3JVZX 3TDVA 2KJHB 5IEYA 5FEEA 1FVRA 1UZXB 2UUEA 5BO4B 2R3NA 3K9OB 2YLEA 4NW6A 1F0QA 4CD0A 4CV9A 4PMSA 3RCDA 2G3QB 2JKKA 3MVJA 1DS5A 3DTCA 3AMAA 4QMZA 4BKYA 3H7PA 2B9HA 2JZ3B 5EI2A 2PULA 1WBVA 4FVPA 3PVWA 2C5YA 4QMWA 5FXQA 2W06A 4Q5HA 2G9XA 3ZLWA 4M69B 2JDVA 4GL9A 4Y73A 4GCJA 2IG7A 2Y5BB 4B6WA 4DTAA 2YLMA 2IO0B 2C5VA 3MPMA 3R8VA 4ICVA 3T9IA 2VZ6A 4L45A 4FYNA 5HTIA 4O7RA 3ET7A 5EYDA 5DWRA 4NIFA 5KHOA 3BBTB 4ANNA 4Z7GA 4M7IA 4EK6A 2M1MA 4CMOA 4MF0A 4ZLOA 3L10B 2XMYA 1WE7A 2X7FA 4D2VA 2KC1A 4CCBA 4LJOB 4V05A 1P14A 5A54A 3QQGA 3O50A 5HG8A 1H4LA 3EFJA 5K4IA 3QRJA 5F94A 3P08A 2G4SA 3OXTA 4QQ5A 3VHTC 4HJKA 3F5PA 4ZTLA 4UWBA 1MRVA 2OXYA 4O0VA 3HYHA 3PDTA 4EH2A 2XKDA 5J18A 4I41A 2UZLA 2OFVA 2K1FA 4ZMEA 4GK3A 4FKVA 3EECA 2W05A 4NT4A 1S9JA 5CXZA 3NZSA 4B8LA 2KMAA 4GFMA 3ZZEA 4HYHA 3A9KA 2VWWA 1XD3B 5I9VA 3MTFA 4E8AA 3GNIB 3HV7A 3P7AA 2C3KA 3W2CA 3SD0A 3FQSA 4C61A 3EN4A 2ITVA 3A2CA 4XH6A 5IQDA 3V60A 2V0DA 3UVQA 3VBYA 2R7IA 3PSEB 4CEGA 1DAYA 3KN6A 2BFYA 3ZS5A 2YCRA 2GTNA 2JAMA 3QCXA 2JZZA 5KMKA 2NRYA 4BBNF 4WBOA 1YHSA 4DGLC 4IB0A 3ZTDA 5EW8A 3LCKA 4MGKE 4CFFA 3PLVA 3MVLA 4MBJA 4CO7A 4FIFA 4S31A 2O0UA 5IH5A 4MXYA 1WF9A 2GFCA 2LVQA 3TKUA 3RPVA 4O0SA 1R3CA 2KFKA 3EQHA 2WFYA 3KRXA 2YZLA 2AEHA 3RWQA 2PUPA 3HL7A 4TL0A 2Z0DB 3FBVA 4PTCA 4ERKA 3E7VA 4EZ5A 1GC7A 4A9TA 3KK9A 3JSVA 3F3TA 3GB2A 3DXPA 3HUBA 2X6EA 4J96A 3G9LX 3E87A 4G3FA 2KD0A 3R7UA 3A8WA 3ORTA 5HVKA 3KRWA 3I5NA 5IQFA 5ACKA 2GOWA 4IFCA 4ALUA 2GBKA 1H27A 2IVTA 1WJ4A 5L6WL 4X2GA 4IIRA 5LARA 1LEZA 2PTKA 1V5TA 3ALBA 3A8XA 4W9FA 3VNTA 4UXLA 4XEYA 2R3KA 2CNUA 1H8CA 5DYJA 2G2FA 3UVPA 5J79A 4AGCA 2FCSA 3TZ9A 4FSMA 4KRCA 1JRUA 3NUNA 3FL5A 3ENHA 3TIYA 4DA5A 3EFKA 3BU3A 2HCKA 2ACXA 4ZTSA 3L54A 4D2SA 4LFIA 1H25A 3MBLA 3I60A 2WU6A 2H34A 4EKUA 4UBAA 1YX5B 4CFXA 4RJ5A 3A4OX 1ZYCA 4F63A 4IACA 5IA1A 2PU8A 5J7BA 3SHQA 2YFXA 4UALA 1NVQA 4PMTA 4APCA 5CVGA 3UTOA 5LCJA 3LJ2A 2JKOA 3WAMA 1JBPE 4RWLA 5DGZA 3HHMA 1WZ0A 5HX8A 3PRIA 3AI5A 2ITPA 4ARKA 4BI1A 3EFWA 2BAQA 2XIZA 3DBDA 1G6JA 4J97A 2CSNA 3ID6C 2OBJA 4JQ8A 4R5YA 3D94A 5KX8A 4FTQA 3D4QA 3ZNID 3ALNA 5IA7A 2WKMA 3HMNA 5IMXA 2I6LA 2XVDA 5EM5A 5L8KA 3IS5A 4ZMFA 4ZYNA 5CSWA 2CLXA 3KEXA 3CKXA 4JBPA 3O23A 4MEDA 4JLCA 4G6NA 3V5PA 4WRSA 2XKFA 4DBXA 4L7SA 2QOLA 5IF1A 5DPRA 5C1QB 4IX4A 5JQ8A 3OP5A 4O7LA 3APCA 4AT4A 4ALVA 4F8CB 4QMLA 4YTIA 2QOOA 4IWOA 1WE6A 2KKCA 3DDQA 2J0MA 3KXZA 3PJ8A 1VR2A 3UVRA 3FYKX 2DWBA 1XH9A 4I0RA 3VTUA 4P4CA 1IP9A 1EUVB 1OBGA 4AZFA 2VGPA 5CWZA 5EI6A 5FM2A 4NM3A 4TUUA 5J9YA 4I24A 4XP3A 1OKVA 3RPRA 2OJRA 2QVSE 3WF8A 4FKJA 3UZRA 1QPJA 2HAKA 2XBBC 4AP7A 4FJZA 4LOQA 4I6BA 3W2QA 4CQEA 3DVGY 3ULZA 1SNXA 1KE8A 1Q8WA 4DYMA 4M15A 5HTCA 3P7BA 4V01A 3PE1A 3L1SA 4AFEA 4XLIA 3CC6A 3F69A 2X81A 3JR1A 3ENMA 5D6JB 4JIAA 5ETAA 4AZTA 2FB8A 1M14A 1XH7A 4NL0A 3ZM4A 4LI5A 4R77A 4U81A 1V86A 5CS6A 2R3HA 5B2LA 5E8YA 2E9UA 3MPAA 4FEWA 3WYXA 3X23A 3LFDA 2GU8A 4ZSEA 1BL7A 2XIXA 4ACDA 3B1LX 3PPAA 2YCFA 1UKIA 3U6JA 2DYBA 4D2PA 3KRJA 3E8CA 5EKNA 4ZJIA 4CMTA 4ZSLA 3W2SA 2Z7SA 3CR0A 3ZUNA 5BMMA 4DWFA 3R2YA 2P2HA 3RK9A 1FGKA 3OMVA 4R7HA 5FBNC 2WHBA 3ZEPA 2AYOB 1LXDA 3DK6A 2IZRA 3I7CA 3NNWA 3A7FA 2IO1B 4MGIE 4AOIA 1UU8A 1REKA 3TN8A 4P7EA 5TOZA 1WR1A 1H1QA 4ACMA 4EOJA 4GKHA 5CF5A 1M2RA 2FYSA 3COKA 4BCGA 3KA0A 2VWIA 4CFUA 4FIGA 3AT2A 4YJTA 3UC3A 3E88A 5AUUA 4J52A 1YOLA 4O2ZA 3WIMA 4F0GA 4W9IA 4IAFA 4FV1A 4RFMA 2RGFA 2B9IA 3LXNA 4EK5A 3DQVA 1PMNA 3FXZA 4FADA 3PPJA 3BGPA 3ZLZA 3EHVA 1FMOE 3F3WA 3ORIA 4FKPA 2AC5A 3W2RA 2C6IA 3H9FA 5EDSA 4BFMA 2PMOX 1MQ4A 4QYGA 2W0JA 3AU5A 1YOJA 2WTKC 3JYAA 3UOLA 2E9OA 5L4QA 3O71A 3ZONA 2WEIA 3GXLA 4FOBA 1XKKA 3DBQA 2RG6A 3KQ7A 5HBJA 2Q0NA 2C47A 3UE4A 4FA6A 3LPBA 3P23A 2GNGA 4GB9A 1ZAOA 1PJKA 1Y6AA 4DXAB 4GT3A 3UNJA 3L8VA 3AULA 5DHJA 5AUWA 4MJSB 3A61A 4O81A 5FRIA 1CSNA 4QNYA 4USEA 4HVDA 2WOTA 3ZRMA 2C1BA 4RIWA 4WUNA 2NBVB 3SW4A 2JIUA 5AADA 4IBMA 2L0TA 2E2BA 1Q62A 1W98A 4UB7A 3VBQA 5FLFA 1O6LA 4RJ6A 2C7MB 2DUVA 5AP7A 3TJDA 2OIDA 3R30A 5A3XA 4BCPA 5AAFA 3F7ZA 5DT4A 4U3ZA 4CKJA 4K7WA 2FA2A 4CYEA 1R39A 3GU6A 2KFJA 4RGJA 2IW8A 2W1ZA 4FL1A 4X7QA 2CDZA 3PIXA 3R21A 2GS6A 4QTDA 3M1SA 2EUFB 3DK3A 1L8TA 2CMWA 4OR5A 3BU6A 3QA8A 5FWKK 3MI9A 3CJFA 3ZO2A 1H24A 5I9YA 4I6QA 5IA0A 4AGWA 4YJRA 4RFZA 2G1TA 4O2PA 4GYIA 4DH7A 2REIA 3MH1A 3OUNB 4QP6A 2KQ7A 3AU4A 4TKNA 1UVRA 3C4WA 4E93A 4LMNA 4DH5A 5HORA 3ZTCA 4FT3A 2F7EE 4K77A 4FSZA 3HRFA 2VWYA 4K0YA 3OCSA 1RJBA 4II5A 2F2CB 1M2QA 4LG4A 4KIQA 4X21A 3F5GA 1P0RA 3EQBA 3DBFA 4FICA 3O8TA 5H3QA 1SYKA 4HGLA 3DLSA 3Q9ZA 2OICA 3G6GA 2J4ZA 2UV2A 4O6EA 3H6NA 2E9PA 3BRBA 2KTYA 5CVHA 4F9YA 3EH9A 4CMUA 1GUAB 2F57A 4FTKA 5M09A 4CFMA 1NBFC 5D12A 3B0AA 5G6VA 3TL8A 1J8CA 5CU0A 4C8BA 3RK7A 3AD6A 3AXCA 2O2UA 2OI4X 2GNLA 2KX0A 1Q5WB 3ODZX 3OT8A 4J99A 1XBAA 2NRUA 4FSYA 3E8EA 4QQTA 3G6HA 3HRCA 4IAZA 3A7JA 4YO6A 3VUHA 2R7BA 4WBBB 5DT0A 3ZBFA 1YDRE 4GIIA 5KZIA 3TUCA 3EWHA 4IB1A 4PPAA 3LFAA 3NYXA 4FSRA 3VXWA 4CLJA 1UU9A 5AA8A 3V3VA 3VQIA 2C3IB 3UYTA 3UO4A 2HY0A 3H9RA 3NZ0A 3TMPB 3KXHA 2FNJB 2BKRB 3SOCA 1LQBA 1QPDA 3RM7A 3VC4A 4X3FB 3I4BA 2OJFE 3D5VA 4ID7A 3UNZA 3U9NA 1K9AA 3MW1A 4RC3A 5JT2A 4O84A 4BCHA 4C57A 3U4UA 3BQCA 2IPXA 4BZDA 3ZO4A 3NZUA 5M56A 3UYSA 4C4JA 5D7VA 5CEPA 3IW4A 2VX3A 3D9VA 2WTDA 4AN2A 5AR7A 5ICPA 3H0ZA 4MNEB 1K2PA 3RTPA 1UD7A 1Q97A 4OLIA 4F1TA 4MJSA 3NMUF 5BVFA 2BDFA 4II2B 4H05A 2ITQA 3OY1A 3CJGA 1KJTA 1LP4A 1FXTB 4I5CA 5CLPA 4L67A 4MAOA 4UYAA 4MXZA 1HOWA 3DOGA 4G16A 4BICA 5BYYA 1SGHA 4TYJA 3UG1A 5LLIA 4FK6A 1CMKE 3PSDA 3SG9A 2MW5A 5FEQA 4MWIA 5CNNA 3IBEA 2KWCA 3ZNZB 2I1JA 2VRRB 3UNKA 4IM3A 4NJ7A 2P55A 3SLSA 4FG8A 5ANKA 3AC3A 2R3OA 4LRMA 4BHNA 3LXKA 3DOWA 2WO6A 4CKRA 1RRBA 5EI8A 3PHWB 3IDBA 3IO7A 4E3CA 4FE2A 5C9CA 5BUIA 4EL9A 1PKGA 3R22A 3DJ7A 3D32A 4BKJA 1OPLA 3HAVA 4DTBA 4EC8A 3PGEA 3FMDA 3QZFA 3PSBA 3LFBA 3WF5A 3HP2A 3QGYA 4BDKA 3I6UA 1KOAA 4L43A 4O7YA 4D9UA 3VAWA 5JH6A 5EYKA 4OTFA 3L16A 4J8NA 2CS4A 2BAKA 1OKYA 3HV3A 4F7NA 4MGZE 3UQAA 3ZDUA 3K5UA 5EK7A 2BIYA 3UJGA 5FR6A 3A4RA 3FHRA 2C7HA 4RWKA 5GMVA 3QUEA 1Q3WA 3TV6A 3HM3A 4KSKC 1H1SA 3TKIA 1FPUA 2XNOA 1PXMA 2ITYA 3PREA 2KZRA 2X1NA 1PXJA 5C8NA 3F3ZA 3NS8A 4R3RA 4TTHB 3CSTA 3QQUA 3ZH8A 2CN8A 3EQRA 2DHZA 2X7OA 2XS0A 3HRBA 2YM4A 3FMKA 4MCVA 1M7NA 2KNBA 2FAZA 4RA5A 4Q9SA 1IG1A 5DR9A 5DRDA 3SXFA 3VS4A 4BOSC 2RD0A 4OAUC 4U79A 2KO3A 4EH7A 3R7OA 3VJNA 1QZEA 1CKIA 3GU5A 5JZNA 4ZS4A 3N51A 1W84A 3DGKA 3VF9A 1WBNA 2IW9A 5AUVA 4C36A 2VNYA 2XJ1A 2V62A 3L9LA 5CU2A 3A9JB 2IZTA 4KBAA 1E5WA 3MVHA 4BIEA 5JSMA 2W1FA 4JNWA 4RWJA 4Y5HA 4B6LA 4GSBA 1I42A 2BGFA 3TUBA 3WAPA 3MB6A 4RLKA 3BU5A 4AWIA 4EUTA 1NDDA 3QC4A 4BBNC 3ANRA 2RKUA 4XG8A 2YIQA 4AZWA 2RFDA 4FNWA 2YM5A 3VH4B 3DKOA 3PTGA 1OGUA 4FV6A 2WMWA 5EDPA 1BKXA 3BQRA 4B99A 2DZMA 4U45A 3G0EA 4TV3A 4IJPA 2KDIA 2JLDA 4EZKA 1JQHA 1IEPA 5FGKA 3VVHA 5HCZA 4KBCA 3ZIMA 4B7TA 5J87A 1S3SG 3VAPA 2KLCA 3DAJA 2LGDA 4IZ7A 4FODA 4I92A 4C4GA 4WWNA 3BYUA 3VS7A 3QRTA 2PVYA 1A06A 4JT3A 4HCVA 3QTSA 4EHVA 1QPCA 3ENEA 5BMSA 3IW8A 4O21A 4M14A 2J5EA 2HOGA 2WYQA 5LVNA 3VBTA 3F2NA 1PMEA 3MYGA 2PVNA 3ZW3A 3ORMA 3MFTA 1R1WA 2JPHA 4HJOA 1DM2A 3PJCA 3KF4A 1B38A 5LVPA 1YVJA 1XR1A 4D1XA 5CZIA 3FZPA 4DTKA 1BL6A 5EM7A 3MSSA 2VV9A 5EDRA 2GNJA 4RLLA 3OT3A 1OQYA 3H3CA 2ZVOA 1M94A 2JGZA 3AD5A 3RINA 3UMWA 2YCSA 2XCHA 5KUPA 3QUDA 1GZOA 2JDTA 4MXOA 2QQ7A 2RIOA 4QRCA 5CEIA 1D3ZA 2XIRA 2JIVA 1J7UA 5KZ0A 3T3UA 2R5TA 3MIAA 2W1DA 2BRHA 3KK8A 3P5KA 5E8VA 1AARA 4HNIA 4JS8A 4AG8A 4UV0A 2Y9QA 2M4NA 3BKBA 3MS9A 4LM5A 5HU3A 2XEZA 2GBJA 4FZ6A 4EJNA 4FZ7A 2RSUA 4EH3A 5L6PA 4K8AA 4HCNB 2XM8A 3RHXA 4AUQC 1OIQA 4FVQA 4M67A 3WYYA 3LFQA 4WWOA 1H0WA 3MJ2A 2XNNA 3NS9A 2VO0A 4TYGA 1OEYJ 1UKHA 3EKKA 3PPZA 2X2LA 2KMCA 4KIPA 4P2KA 2JRHA 4GUEA 5E8XA 5HIEA 2LGXA 3VN9A 4ANXA 5DPTA 5CEKA 4BCIA 1PYEA 4EOSA 2C69A 4X2NA 1J1BA 3MJ1A 4QP3A 3WIGA 4RJ8A 1J91A 4M3QA 2YABA 4XCUA 5HO6A 4B9DA 4GV1A 3NIZA 1SNUA 3FZ1A 4FGRA 3HM6X 4NM7A 3MFUA 3NX8A 4NJ3A 3UQCA 4NJDA 1EO6A 2KVRA 2XK5A 3CD3A 3Q5IA 4G3DA 4AWJA 1YWVA 4GMVA 1ND4A 3DXNA 4CQGA 3ZEWA 2PMLX 3C4XA 5IUIA 2PZPA 2M17A 4G3CA 4W9EA 3LIJA 4I1ZA 2J0IA 5C03A 5K5NA 2M8SA 5GZAA 4K1BA 4BDHA 4BVUC 1P2AA 1YD8U 4DF3A 4USDA 4D0WA 1YRPA 2OXXA 4EONA 4U9AA 4A4OA 2MA9B 4L53A 3LQ3A 4PDOA 4FG7A 5GZ9A 3EYGA 1K3AA 3ITZA 4TWOA 4C3PA 4XV3A 5FM3A 1RQQA 3GENA 2WTVA 2J90A 4AOTA 4DG3E 5K5XA 4NFNA 3ANQA 4NFMA 2GHLA 1W83A 2WOUA 2VAGA 3UIXA 5A46A 3RZFA 4QTCA 5IEVA 1UELA 3ZO1A 3RK5A 1XQZA 4CZUA 4EYJA 5FD2A 2BCJA 3HA6A 4IVBA 2YM6A 4Y95A 1FVTA 1TKIA 4NUSA 4UN0C 2HELA 4HVGA 4H3BA 4IX6A 4MD7E 5E6PA 3CGFA 4WAAA 4AW2A 4GDLB 4YTHA 5HZNA 3CPBA 5EYMA 4WIHA 3W1SC 3FLSA 4QOXA 4NZWB 4EOKA 2OJIA 3C0RB 3NHEB 1LR4A 5IQGA 4IB5A 4UY9A 2PVKA 3NW5A 4BVUA 5HX6A 4AW5A 3BWFA 5D41A 2XK7A 3ZMMA 3V6EB 3FLQA 4FL3A 3DY7A 4AGUA 1NA7A 4EQUA 2X2MA 4F9WA 3ORNA 4QP8A 1EH4A 3QYWA 3A33B 1ZYSA 4D2RA 2R0UA 4F64A 4S2ZA 4O6LA 3OWLA 2W4JA 4E4MA 2OZAB 4O38A 2UW0A 5AR8A 3PVLA 2PE2A 3ALOA 4CRSA 4QTEA 3POZA 5D7GA 3O7LD 4ASXA 3K2LA 2HTHA 4KZ0A 3RMFA 4BCKA 3LCSA 4TYHA 3K3IA 1W82A 3G15A 1DI8A 2GCDA 1LFDA 3CSVA 5CF4A 5CTPA 2BYFA 3PXFA 4N0SA 4FV4A 4IWDA 3R7QA 4OTPA 1IA8A 4YLKA 4B8MA 4XG9A 2JBOA 1LEWA 1PW2A 4TYIA 4QTAA 2VWZA 3OBGA 4TT7A 5CEOA 1YXTA 3W1SA 2B54A 3FSKA 3NR9A 4A06A 5DLSA 4E4NA 1GZ8A 4IWPA 5IDNA 4LDTD 3Q3JA 3Q04A 4OAVB 2LZ6A 3FY0A 3QX1A 1V9JA 2KC2A 4XJ0A 4YJOA 2NR2A 4IVCA 3Q9XA 4UMTA 5G55A 1WIAA 4RRVA 1Z2MA 2VTNA 4D5KA 5CYIA 2ZNVC 3ML9A 4MHAA 3DFCB 4QMMA 4C3RA 2XK3A 4RX8A 2WB8A 4WQOB 5JRSA 4AJWA 5DVRA 3N30A 4W4XA 4I4FA 4TWCA 4WSYA 4HDOA 5AV2A 4YZMA 4YZDA 3LW0A 1ERKA 1C3TA 3PZEA 2VN9A 2XIKA 5HG5A 1PMVA 4FTAA 3PRZA 3QTWA 1GAGA 4HCPB 3HK0A 4OGRA 4TZRA 4YNEA 4I6NB 5FTQA 3HVCA 3UOKA 3FC2A 4MBIA 4TW9A 4O1PA 5JFSA 3OXZA 1K8RB 3HMIA 4IHPA 3U54A 4D0XA 4EH5A 5ANJA 2L05A 4F9CA 2C7NB 4BBFA 4RVKA 4MQ1A 1R0PA 4GJ3A 2QU5A 3NY5A 4I22A 4QMTA 4OBQA 1Q8UA 2D11A 1UA2A 2Y8OA 2BR1A 3FQHA 3ZLYA 3BEGA 4D1SA 3L9MA 1V5OA 3QQHA 3RVGA 3EB0A 1CDKA 2W9FB 4XUFA 1KWPA 2BVAA 5AAEA 2JXXA 2WMAA 2W9NA 3CQUA 3KRLA 3KULB 5F20A 1AGWA 3EQGA 3SDJA 3SQQA 3MVMA 2PYWA 4NPNA 1QCFA 4L68A 2ZVNA 4MSQB 4GS6A 3AMBA 2IY1B 1KV1A 4BDEA 3AD4A 2G2HA 1WMHB 4JGHB 4C4IA 2GNIA 4QMSA 2FCMA 1NVRA 5A4QA 3HNGA 2QOQA 4GOCA 1G5SA 2DS1A 3RNYA 4C62A 5EW3A 5I5ZA 3P7CA 1LM8B 4FKWA 4X57B 2J9MA 4HYSA 4TRLA 3ZUUA 3IOKA 3KF7A 2UVXA 2C3LA 1VJYA 1Q99A 5EDQA 4Y85A 3VULA 5E90A 1H01A 2XBJA 3JVRA 2AL3A 2RFEA 3VHKA 3H0YA 3W8QA 3UPZA 4CCUA 4O0UA 1H1WA 4XOYA 1E9HA 1P4OA 4WJOA 3AC8A 4C4EA 5IUHA 4GEOA 4GDKB 4DC2A 2ZM4A 5KBQA 2YM7A 3GT8A 4C35A 2QHOA 3OOMA 3PWYA 4BDJA 3OBJA 4ZSJA 4Q9ZA 1FBNA 3HAMA 3MDYA 4KKEA 2WMUA 3UQFA 3DCGA 2CN5A 3OY3A 3NW6A 3R04A 4ANMA 2CGVA 2NPQA 3A1QB 3E62A 5E1EA 5IQAA 5IISA 1WJ6A 5E8WA 2XYNA 2PY3A 4TN6A 3C9WA 4FLHA 3DDPA 5JFVA 3FLNC 1UWJA 1BYGA 2Y4IC 3SOAA 4IC7A 3L9NA 3PRFA 4EH8A 2YEXA 2EVAA 4BWXA 4FJYA 2XK6A 1ZW7A 2BTSA 5JQ5A 4KSLC 4JXFA 4C02A 2MBEA 5DIAA 4XX9A 3R9NA 4GK2A 4ASZA 2XEWA 4QO9A 4PDYA 4TKSA 3TJCA 2IO2B 4KZCA 4IX5A 4KIKA 4F6WA 5M07A 4EBWA 1OEYA 3R9HA 2X0GA 1Z57A 4EOIA 1E8WA 4CFNA 4I6PA 4AE6A 1TZ1A 5IA5A 4ANSA 4UMPA 3TCAA 4BKSA 5J1WA 1GZNA 1RFAA 5IQCA 1Q8ZA 5HG9A 3S4QA 5A9UA 5M44A 4APPA 1OIYA 3I5ZA 4MXAA 4PNKA 4XYFA 3EKNA 3MV5A 4OW8A 4H36A 4Y72A 2FH9A 4HXDA 5M51A 4KV2A 3OUKA 3QTIA 4IZYA 4KWPA 2CKEA 4ZY5A 4V0GA 5CAOA 4YHJA 4YP8A 4E5BA 2ZZPB 3SDLC 4W9LA 2V1YA 4DFXE 1Q4LA 1WX9A 2HZNA 1P98A 3UIPB 1AD5A 2MCNB 4ANOA 4TWPA 2C68A 2Z02A 3T9TA 3KUCB 2CPKE 2WMQA 5FDPA 2C0OA 4QMVA 3R8ZA 2BDWA 4X2JA 3RPSA 4FT5A 1WR6E 3M95A 3WOWA 3ZUVA 4G0NB 2BDJA 3BHVA 1YWRA 4EHZA 4WJNA 5EKOA 4KVGB 4YJUA 4J53A 3E64A 5HO7A 1FOTA 4HPMB 2ZJWA 2LXAA 4JQEA 2HENA 3FI8A 2GS2A 2BFXA 1L3RE 4N70A 2LVOA 1TQIA 2IWIA 1Y8RC 4F65A 2ASQA 3NGAA 3R7EA 4RVLA 3BCEA 3MWUA 3H30A 2X8DA 3OEZA 4HZSA 5BNJA 5CX9A 4ZRIA 4MXCA 3QRUA 3S00A 4IC8A 2ZB0A 4A9YA 2O6VB 3CD8A 3DS6A 3RHKA 4E74A 3SX9A 4HVBA 5J1VA 3N3KB 4D58A 2FIDA 5IG1A 1KOBA 5T68A 4E73A 5M55A 3ZCLA 4QMUA 4M0YA 3CY2A 2OF2A 2WELA 4URKA 4ZSAA 3PVBA 2R3GA 4DGGA 2CGXA 3A60A 4A07A 4RMAA 2A0CX 2HYYA 1GG3A 1OL1A 4G3GA 4M8TA 3QKKA 2KANA 3F2AA 3UIBA 2J51A 4ZXTA 2VWBA 5CY3A 3P86A 4FT7A 3V01A 2QOKA 1WX8A 4RG0A 2VUWA 2PE6B 3PIYA 2V55A 4ZLYA 3G9NA 4ACHA 4AU8A 3E7OA 5CZHA 3BIZA 2QODA 2BZJA 5CXHA 2C30A 2IN6A 3BX5A 4XV9A 2MRPA 5IQIA 2GS7A 5ETFA 3H7PB 4MELA 5AUXA 3OZ6A 1A48A 4RIYA 4J7BA 4A9SA 5AAGA 2RSVA 3UZPA 4FIJA 2MP2B 3S2AA 5AM6A 5E8SA 4J95A 4J1RA 1SVHA 1Q61A 4U40A 4FGBA 3HMOA 3EN9A 3I0OA 4YPDA 4A9RA 3VFKA 3MFSA 2VTJA 2PMNX 5BX0A 3FLYA 5AV0A 5C01A 5JGDA 4NIFB 1YDTE 4KUJA 4I0SA 1SZMA 5F9EA 5J95A 3ZXZA 1XJDA 4DHFA 1WRDB 2W96B 3DK7A 4AS0A 4RX5A 4O7TA 3R8LA 4G2FA 4OTHA 3V5QA 5M53A 5DG5A 2OGVA 2B55A 4QYFA 2YWPA 2CNQA 2YWVA 1WY8A 1BI7A 2UZBA 3GGFA 2NPTB 3SVVA 4PF4A 3MY1A 3QLFA 2C5LC 5DFPA 2LD9A 5CX3A 4O7ZA 5HVYA 3P2BA 4XBRA 4OBPA 1ZZLA 3DKGA 3SD5A 4HLEA 3F7WA 4EWHA 1IAJA 5I9UA 3FXXA 3AT4A 3QKLA 3LMGA 3FJQE 4K11A 3LJ1A 2N1VA 3PG3A 4PNIA 2QR8A 2O5KA 5CHFA 4I3ZA 4MKCA 3A9KB 3F3UA 5L3AA 1JPAA 2X8IA 4YJQA 3QCAA 3TIZA 4PX6A 4C3FA 4WRGA 3SRVB 4FSUA 4BKGA 5M4FA 3IVFA 4FTIA 1WGRA 5LVLA 1YWNA 5AV3A 4YPSA 5AUTA 3KXNA 4CNHA 5DN3A 3HV4A 4PL4A 3VH3B 1OI9A 3BE9A 1REJA 2E9NA 2RL5A 2PUIA 3M2WA 1FMKA 3FL4A 3B8RA 4BCQA 4DEAA 1W7HA 2R3FA 1OIRA 4EH4A 4RQVA 4FMQA 2KFKB 3UODA 4ZP5A 3PY0A 2B52A 2A2AA 1STCE 3K9PB 1WBSA 4D4VA 3ORXA 3GP0A 2WAJA 3PRMB 3JSVB 3LCOA 1E8XA 3L8XA 4O82A 4KRDA 4PP7A 4P5ZA 4CSVA 2O64A 2PUUA 4G5JA 2OLCA 4YGAA 4E4LA 3KREA 3LFSA 3ROYA 4MYGA 3A7HA 4JRNA 3UMXA 4GG5A 5DI1A 1GC6A 5BVEA 5JEBA 3KXGA 4DE4A 3BWJA 1SE9A 3U51A 5CVFA 3GQLA 3UIMA 4M68A 4FNXA 5HKMA 3C13A 2ONLC 2LVPA 5LMKC 2PVFA 4G34A 3ZO5B 4WNOA 5BQ0A 4C0TA 4DFNA 2MP2A 5IDPA 4C4FA 5EHYA 5CU4A 1U54A 2R3RA 3QTUA 4W9WA 5CASA 3AC5A 2OW3A 3VRYA 3IW6A 1H1RA 4WA9A 4ANQA 4QYEA 3PLAE 2N7DA 3ZM9A 3PP0A 3PXQA 3RAHA 3FY2A 2O3PA 4CV8A 4E1ZA 3DNDA 4NK9A 5J2RA 2V7AA 3V04A 3GFWA 4RSSA 3BHYA 4DN5A 3U8ZA 3ERKA 1V6EA 2B3AA 1XQQA 3KUZA 4YUQA 2NPTA 4FUXA 1ZWSA 4BCFA 3ZC6A 4D4SA 3RWPA 3OWPA 4FTMA 2CHLA 4C7TA 3TBLD 5EH0A 1I44A 4I20A 3F66A 4W8EA 3HDMA 5K9IA 4MM3A 3IG7A 2QG5A 2L3ZA 2UZDA 4FC0A 4NKSA 3I3TB 3C1XA 4PL3A 2QOIA 4ASEA 2VTMA 4F4PA 4UX9A 4O0XA 2ONLA 4BGHA 5LMKA 2H8HA 3MH0A 1YHWA 2BWFA 4LDTB 5AP4A 4QMPA 3FMLA 4LRKA 5E8ZA 4YZ9A 3W18A 2VO6A 3SRVA 4PS7A 2J0MB 3S2PA 2OIQA 4ZTQA 3H9OA 2X4FA 3LXPA 2XNBA 3DNEA 5JGBA 5T3QA 3CGOA 5D1JA 3LQ8A 3PFQA 5TR5A 5CSHA 1OVEA 3FMMA 4EQCA 5AX9A 4PUZA 4RA4A 2OH0E 5HICA 3MN3A 4F08A 3R66C 1JOWB 3APDA 4OTIA 4W9XA 3CQWA 3PVGA 5K0XA 4DCEA 3BZ3A 2CKQA 5CAVA 4JAJA 4B0GA 2VWXA 5BVOA 4TQ0A 4ITIA 4FI1A 2GQGA 2HXQA 3QJZA 4C4HA 3EN7A 4RM8A 3KRRA 2YDJA 3S1HA 2P0CA 1Z5MA 4R7BA 3BINA 4RC2A 2QLUA 4FSQA 4DK5A 2BRGA 1GOLA 2WMRA 4DH1A 4BY9E 2JVCA 5HNGA 4CYIA 1XHAA 2ZMDA 3KY2A 3DKFA 3TNPC 4ALWA 3EJ1A 5KNJA 5EQPA 3OJ3A 3KC3A 4QYYA 4M84A 3QQFA 1WVXA 4IANA 4OVUA 5KMIA 1T0YA 1OL5A 3R1SA 5LQFA 2ZV9A 2A27A 2XEYA 2WQMA 5E8UA 4CTBA 1V81A 3R8UA 3UQBA 3PXZA 2YDKA 5BVDA 2PZYA 4I93A 5HE2A 4RX7A 3FMHA 4ZOGA 4RM9A 2VTQA 4L44A 2R9SA 4FULA 2SRCA 4R8QA 3TXOA 1NXKA 1ZARA 5B7VA 1U4DA 1OMWA 2KX3A 3POOA 4YC8A 3FMNA 3PA3A 2DENB 1X8BA 1WH3A 2PVLA 4ZEGA 3PXYA 5IA4A 3RCJA 1YI3A 3A62A 1VEBA 3NVKI 1ZKHA 4O27B 2YDIA 4G31A 4WJQA 5AMNA 2Z7LA 2FCNA 3ORKA 4YJSA 3ORPA 3QRKA 4KKGA 4M8MA 3ZSIA 5KMMA 2N9XA 4E7WA 1XO2B 4IVDA 4D9TA 2C6TA 3RT3B 4C2WA 5KCVA 4O7VA 2AL6A 2HIWA 4UWYA 4O91A 3CQEA 3LM0A 3C0HA 2VX1A 3D5UA 3D5WA 4GVAA 1Q41A 5AEPA 4Z9LA 3X0WA 3VS5A 2ZDUA 1FGIA 4QMQA 4RIWB 4C2VA 3GZNI 4AFJA 3DV3A 4GIHA 2OF4A 5IA3A 2GBMA 4ZLZA 5JFWA 1Y8YA 2HW6A 5F4NA 5EYCA 3QBNA 2JY6A 3KW5B 2A5UA 2KLGA 3LAUA 4Z55A 2JITA 2R2OA 5J9ZA 3ECIA 2RF9A 3OWKA 1WM2A 3U6IA 1OECA 2Z7QA 2QHMA 3F82A 4BYIA 3GQIA 3O17A 2KTRA 3ZU7A 3IDCA 5K4JA 3UP7A 2JFMA 3WZUA 5L95C 3PXKA 3FQEA 3QLGA 4EH6A 1CKPA 4U6RA 2CKHB 1G8AA 2QONA 3EHAA 1OL2A 4ZZMA 3JY9A 5KKRC 5LXHA 1ZRZA 1UH6A 1G3NA 2IVUA 3SAYA 4W4WA 2WTKB 4BRXA 1WXVA 4DFUA 5ITAA 2EMSA 2X9EA 3DXQA 3BLRA 4U41A 5DBXA 1VYZA 3UC4A 2R2QA 3LJ3A 2V3SA 1CM8A 2OKRA 3ZKJC 4H1JA 3K5VA 1EF5A 5JKGA 1H26A 3NUXA 4M66A 2J0KA 5I3OA 2YIRA 3GC7A 3R83A 4ANWA 4I6FA 5ANEA 4AOJA 1YIWA 3SW7A 3FSFA 3LXLA 3NAXA 4BBMA 4MSMB 2Z59B 3PVUA 1U5QA 2QOBA 2WXVA 4II3B 4IE9A 2GFSA 2QR7A 2WZJA 4ASDA 2EB2A 3QTXA 3C50A 3LDZE 2YN8A 4FEUA 3VS2A 5D9HA 2JDSA 3QIJA 5D10A 5ANOA 4FN2A 4W9KA 4IMYA 3FC1X 3V61A 2XF0A 1URCA 2VU3A 3L13A 4U7ZA 3QTRA 2HXLA 3C51A 4NEUA 2XP2A 1OPJA 4EK8A 4LV5A 4U0IA 4O83A 5L6OA 2R3JA 4M12A 3DVGX 2VD5A 1OUKA 4RIXA 4X6QC 3FLWA 4QPSA 4B9KA 3ZRKA 1A9UA 5EFQA 2PVJA 4FNYA 3LKMA 1ZYJA 3ZFXA 2CHWA 3R7VA 3QD4A 2WTCA 2R3IA 3VBXA 3DBRI 3OEFX 4JBVA 2UYZB 2K8CA 4MX9A 2Z7RA 3UO6A 3OXIA 4EZJA 3HV6A 3JXWA 5EW9A 4AZVA 1H1PA 2KULA 3C4ZA 3EZVA 3TUDA 4E71A 5H8BA 5GJDA 5GHVA 4W9DA 4EZ7A 2MBBB 1UV5A 2JRIB 1UNHA 4YLJA 3VQHA 3VVWB 1ZLTA 4E4XA 1MQBA 4PP9A 5HLWA 1XBBA 4S33A 2X4ZA 5EHOA 4JG8A 4IX3A 3NEWA 3BELA 1V2YA 3C4CA 2GMIC 3UDBA 3UP2A 3QQKA 1OPKA 5IA2A 4OVVA 4J8MA 2ZYBA 3IONA 4AW0A 2Y7JA 3WZEA 4AA4A 2J0LA 4U42A 3DFAA 5JHAA 3MPTA 4DHZE 1H28A 3E63A 2BYEA 5FTGA 4XC2A 4U44A 2KQSA 4PYUA 5AZFA 3Q60A 1PXKA 3ZNHB 4UEUA 2YJSA 5C1ZA 2W4KA 3P1AA 2W99B 2DZJA 4FVRA 2QOCA 3TL5A 3DPDA 5EHLA 4D5HA 3TZ7A 2CR5A 2R64A 2QNJA 2EB3A 1BLXA 4V04A 4YZNA 5CTRC 2DQ7X 1WYWB 2HJ8A 4DINA 2CKOA 2DYMA 4F0FA 5CI7A 5AR4A 3W1FA 2OO8X 1B6CB 1Q5KA 2UWQA 5JZEB 3TIXA 2GDOA 4FV9A 2LRUA 3OOGA 3T3VA 4FV7A 2V7OA 3DCVA 1PY5A 4L3PA 3SU8X 3LMIA 1P5EA 2XNMA 5AUZA 4MQ2A 1I09A 3RJCA 4RVMA 3OFMA 4EORA 2UZEA 3VUKA 2KHWB 4ZTNA 1O6KA 3VIDA 4ZRJA 2WMTA 4EK3A 4EKKA 2UZOA 2HZIA 2X6DA 4S30A 4FHKA 1WAKA 3OCGA 5AP0A 3G5DA 3KCFA 2JF5A 3GI3A 4FV8A 4X2KA 4AOFA 3QAQA 4FEVA 5GNKA 1OGWA 4GU9A 4M0ZA 3TNIA 1NT2A 2WMVA 2QO7A 4U80A 1NY3A 1M17A 2AC3A 3PJ2A 4ACGA 2LUEA 4BKSD 3OD6X 4PL5A 4IAKA 5DE2A 2C6KA 2VTIA 4FV5A 4FZAB 1UBIA 4YLLA 4TPTA 4W4VA 4G6LA 4BGQA 3C7QA 4KBKA 2ZCBA 1SMHA 1IAHA 5HCYA 3EQCA 2PUNA 3ZDIA 1Y91A 3QQLA 4OUCA 2L7RA 3CCNA 3OTUA 2XYUA 4PS8A 2BROA 2VWUA 2UW7A 3EN6A 4WT6A 2C5OA 3EN5A 4C37A 4FIHA 3VHEA 4QMXA 4NH1A 1YOMA 4EOLA 2QCSA 2K39A 3VWAA 1WM3A 4WSQA 5AP3A 2OIBA 3FZSA 1UBQA 4K1RB 1Z9XA 3QTQA 3ROCA 3BY4B 4YHFA 2WX1A 4L8MA 5CU3A 2KK8A 2XCKA 4ORKA 3RAWA 4HNFA 3PXRA 5CHVC 4FTCA 5J17A 4KINA 1KUTA 3OWJA 5FBOA 3OAWA 2UW3A 4YSJA 2YVCA 3LLAA 1Q24A 3V8TA 2FO0A 5E1SA 2K8HA 4JG7A 4FF8A 3UF8A 3H1UA 2KOXA 4JQWC 4DH8A 5HGIA 4AXAA 2R4BA 3LLTA 3R8MA 3WBLA 3V5WA 3KVWA 2QOHA 1NVSA 3B2TA 5TR6A 3R7IA 1ZGUB 3PHXB 3EL8A 4FZDB 1Y57A 3DPKA 3M62B 5AP2A 1PHKA 1J7LA 1OB3A 3HX4A 1FQ1B 4YC3A 3O65B 3VUXA 2G4DB 4FIEA 1CKJA 3BHUA 3FKNA 3D2IA 1PXIA 2UW8A 4L00A 3C4EA 5AV1A 4BDBA 1G8SA 5AIRA 2UW6A 4FSTA 4XZ4A 1WGGA 4XS2A 3MTLA 2XNPA 3PE2A 3ORLA 2DAFA 2WQBA 4PQNA 4DEBA 3B8QA 4QP9A 5HI2A 3WZJA 4JOAA 3CPCA 3TNHA 4DLJA 3BLQA 3C4FA 3LFCA 3BGZA 2EXMA 2LWPA 2YZAA 4K7UA 5CAPA 3N4UA 4G6OA 2BF8B 1JSVA 4EH9A 3U55A 3L8PA 3LOKA 5DPVA 2YLFA 3GUBA 2IZVB 2HY81 3D7TA 1OM1A 2I0VA 3WANA 5I0BA 4DEDA 4Y46A 3PY3A 2CJMA 4CXAA 5CF8A 1PXOA 1WXMA 5LJJA 2P2IA 2YIWA 4FT9A 2BRNA 4EHEA 3KMWA 2KDFB 4F70A 4DHJD 3ZXTA 3Q6UA 2BILB 2HWOA 3C5IA 4GKIA 5AUYA 1V0PA 3CS9A 4PPCA 1OITA 4KS7A 2G15A 4U3YA 2A1AB 4CT2A 4DT8A 4H1MA 3U9CA 5DH3A 4H58A 3MHSD 4ZRKA 3QUPA 3IW7A 3MFRA 1SIFA 4DH3A 4JVGA 1O9UA 3U8WA 3ZDMC 4FZFB 4JR3A 1BUHA 4O7SA 2VTSA 2UZWE 2GSFA 4L52A 3AC1A 5IKWA 3IG3A 3UGCA 5J9LA 4CTCA 3R00A 3KGAA 5C4KA 2LI5A 4XG2A 4AN9A 3VUWA 3I0QA 4FOCA 5ANIA 3QHTA 1SVGA 3KL8A 3OCBA 4IQ6A 2JWZA 4DG0E 4IVAA 4DDGD 4MVFA 4I5MA 5K3YA 2XK5B 2QHNA 3VTWA 4O7NA 4XG4A 4XLVA 1ZY4A 3TTIA 3QAME 3MY0A 4RMZA 4E5AX 2OXDA 2R3QA 3NNVA 4DCAA 3UIOB 4M13A 5CAQA 3UINB 2J2IB 3F6XA 1U5RA 5FXRA 4HGEA 3EQPA 3DB6A 4IUMB 4CRLA 3UGBB 3I79A 2W1CA 3LJ0A 3ZLSA 3VRZA 3BYOA 4DEEA 4XX5A 2HZ0A 5KBRA 4ZJVA 3A7GA 3PT2B 4BDDA 4I21A 3IW5A 5GJGA 5BYZA 1M52A 4OTQA 2A4ZA 3OF0A 3LQ5A 3DU8A 2BMCA 1JNKA 4K2RA 4BCOA 4U8ZA 1VCBA 4EOMA 4MNFA 1VZOA 3FKLA 3G33A 3PUPA 1YI6A 5LMAA 1ZYDA 3R1YA 3FE3A 3RPYA 3A4PA 2ITXA 4IH8A 2YAAA 1VD2A 3DKCA 2JDRA 2H96A 1QMZA 4RIOA 4ZZNA 1NW1A 2QLQA 5DNRA 5HHWA 5C23A 2K6DB 2XBAA 3WAOA 4FEXA 2GPHA 2P3GX 3DTWA 1R0EA 4D55A 2XKEA 5IQHA 2XKCA 2VO3A 1YXXA 3CBLA 4GUBA 4IFGA 2OH4A 3AMYA 5L8JA 3QL8A 4AGDA 1UWHA 2BZIB 5DR6A 4M69A 5HNIX 2PL0A 2UZVA 4HOKA 3NIEA 3QALE 1ZOGA 4DGMA 4GXBA 3FXWA 4RC4A 2IJMA 4EQMA 3ULIA 3R1NA 4GG7A 1HCKA 1WBTA 5TE0A 4UZHA 4KA3A 2QKWB 4R5SA 3W10A 3VUMA 4Q5EA 2Y6MA 2MBOA 2PMIA 2I7QA 2GHMA 3WZKA 2CCIA 4LMUA 4FT0A 2I0EA 1J19A 1IA9A 2W1GA 3FPMA 1GIIA 5B2MA 4GJ2A 2W5BA 4LL5A 2JKQA 1L7YA 1PQSA 3LHJA 3NYOA 4IW0A 2R3LA 1RW8A 3BHTA 3QC9A 2QO9A 3NOBA 2H9VA 2B53A 5CU6A 4R3CA 3T8MA 3LCDA 4R1YA 4D4YA 3PRPB 3Q3FA 2VRXA 4G5PA 4ZAUA 1IASA 3TDWA 4KKHA 4TYHB 3WF9A 1Y6BA 3LFFA 2FGIA 2ZV7A 4EEVA 3ZRFA 2JDOA 4JX7A 5FP6A 2NBWB 4ZIMA 2GHGA 4BDFA 2HZ4A 3EIDA 1H07A 4ZTHA 3TTJA 3M42A 5A4TA 1GY3A 4W9JA 4ANLA 2ERZE 4WNMA 3Q96A 4ANVA 3OW3A 4YJNA 4BN1A 4AP4C 4NM5A 3QXOA 3MB7A 3HP5A 3BI6A 4W8DA 2Q83A 4B95A 3W1YA 3AT3A 4Y8DA 4KSPA 4BCMA 2IZUA 2WDTB 3VUDA 1XBCA 5AM7A 2VGOA 3HECA 2ZVAA 5HNBA 3WZDA 2BHEA 2WTJA 4Q2AA 1TVOA 5M08A 2PHKA 5HESA 4ZSGA 1MRYA 3NLBA 2X8EA 3Q32A 1M7QA 3AQVA 4QPMA 5HO8A 2IYDB 4WUAA 3RGFA 3DAEA 3CLYA 3OC1A 3Q2JA 3CEKA 4HW7A 4FNZA 3OG7A 4QP4A 3MESA 2WTIA 2C5NA 3NCZA 2JIIA 3KKVA 4QNAA 4L3LA 1YW2A 4JG6A 3LZBA 2Y0AA 4GK4A 5BPYA 3CP9A 3FWQA 3Q52A 2N9PC 4DHZB 2P4IA 3H7SA 3TNQB 4O0TA 4FKIA 3Q6WA 3E8NA 4X0MA 4G3XB 2YIXA 5LWMA 2N9EB 2OWBA 3QXPA 3BE2A 1H00A 5EM6A 3KVFB 3OJ4B 3FZOA 1S1QB 4BWPA 2Y4PA 3DQWA 5CI6A 4RX9A 2PE0A 3MIYA 3V5LA 1JSTA 3R9RA 4C38A 4G50A 2ZV8A 4C34A 4K6ZA 2B7AA 5CT7A 2RR9A 3MH3A 5AZHA 5L2WA 2ZNVB 4RJ3A 1XT9B 2ZM3A 4GU2A 2IW6A 4FBJB 2NP8A 2I0HA 4XBUA 3D2KA 1XH4A 1F9JA 2M0XA 3UQGA 2YIYA 4GRBA 5ANGA 4EOPA 2J7QB 2ITTA 1I35A 3TV7A 3Q2MA 2X9FA 4F1MA 3IHPC 1P3QU 2VTAA 4YZBA 2YA9A 3VO3A 5CSPA 3E93A 1UNGA 2ZOQA 2BTRA 4FKTA 4E6DA 3ATSA 4IXPA 2QU6A 3ZLXA 5FXSA 3SGCA 4YO4A 4IZ5A 4YTFA 3VS6A 3NUAA 1RDQE 3QHWA 2MWSB 3BYMA 3QWKA 4AA0A 1OZ1A 3QC8B 3QARA 5G1XA 5M4CA 3NCGA 5KMOA 3L08A 1P9DU 2BWES 2V5QA 4AF3A 4GFOA 4NTSA 3PLSA 1WJUA 3CE3A 3IECA 5LWNA 1GIHA 4ITHA 5DA3A 2DAJA 3AC4A 3U7DA 3OS3A 4O0RA 3I1AA 5H8GA 5C4LA 3DB8A 4NKAA 4KDIC 2C6DA 3HUCA 3PIZA 5DRBA 4BDAA 4BDCA 4EK4A 2V4LA 4TWNA 4Z16A 5B0XA 3V8SA 2J5FA 4I6LB 2VTPA 5D11A 2C0TA 2ZEQA 3GEQA 3OLMD 4JI9A 4QMYA 4U5JA 2O63A 3DBLI 3QFVA 2ZMCA 1IYFA 4JR7A 3PP1A 1U46A 4WO5A 1PXNA 3CY3A 4R7IA 3OVVA 4WNPA 2J6MA 2IVSA 4I0TA 3PZHA 4O86A 4PS3A 4LOOA 4ACCA 3QCYA 2YJRA 2KTFA 5HLPA 4IC7B 3QRIA 2OJJA 4GH2A 1OBDA 3TG1A 2YCQA 4BL1A 5TKDA 3VUIA 2C4GA 4F0IA 4J6IA 5AZGA 3EMGA 3ZFYA 5KO1A 4C59A 4I23A 4GFGA 3OROA 2WQOA 1YDSE 2ZB1A 3KVXA 5FG8A 4AZSA 3OHTA 2PWLA 2XNGA 4EOYA 3RP9A 3R28A 4RWIA 2N1WA 2EXCX 4KIKB 1TQPA 2NVUI 2UZNA 1KM7A 4NM0A 4BWKA 1KE6A 3JY0A 1YQBA 4JJRA 4KNBA 3R3MA 2XJ2A 4YR8A 2QG7A 1M2PA 4N4SA 2Z2WA 4YURA 2I1MA 4BTFA 4E5WA 5BVNA 1XH6A 3A99A 4O0YA 1UU7A 5HIBA 2BYVE 3FKOA 5IH6A 1WCCA 4ONAA 1JKTA 2BZKB 4KIOA 3JW0X 4IZAA 4FTLA 1X1MA 3F9NA 4ENXA 5I9XA 5B2KA 3DT1A 4F7SA 5IZFA 1OL6A 5A4EA 2QC6A 5C26A 4V0GB 1PXLA 5ETIA 3H9DA 4JX3A 3KH0A 4Y83A 4HPLB 1S9IA 4RZWA 3D5XA 3RYTA 2LJ5A 2PSQA 3UPXA 5H9BA 2O8YA 5I3RA 5I4NA 4BCJA 3R7GA 2Y4IB 1H08A 3EZRA 3OCTA 2DZIA 5EM8A 4AW1A 2B1PA 4A3OA 4FHJA 2W17A 2LGYA 3HMPA 4P5QA 4NQKE 4UMQA 5IAAC 2GTMA 5TO8A 4W9GA 3RALA 1TQMA 4N6ZA 1V80A 2YACA 1E7VA 3G90X 4PDSA 3BEAA 3LCTA 1FINA 2WWZA 2Z60A 5BVKA 2J0JA 3QZHA 4N9F4 1R78A 2IZSA 2LAVA 4LGDA 4WG3A 3BLHA 4OTRA 3L9PA 5AWMA 4LGGA 5IQBA 5A4CA 1FVVA 1LUFA 2F9GA 4MH0E 4FKQA 2PPHA 3E3PA 3RULA 1F3MC 4F7ZA 2D2QA 4EC9A 4YBKA 3AGMA 4ZY4A 3APFA 4PWNA 5A6OA 4LL0A 3AC2A 3G51A 3TEIA 5BYLA 3COIA 3LVPA 4PY1A 5A14A 3N32A 3KU2A 2F4JA 2O2VB 2PK9A 4QTBA 2JAVA 4JIOU 3ORZA 5L2SA 3F3VA 4HVIA 5GIPE 1XWSA 3P79A 2WMSA 3V6CB 4HCUA 2HD5B 3SV0A 4HCTA 5M4IA 2C6LA 3QYZA 4M8NA 1CMXB 1PXPA 4LGHA 2WTWA 5ACBC 2BPSA 4HDQA 3I7BA 5HOAA 3UOJA 3WE8A 4I6HA 4CFWA 4MGYE 3KXMA 3VUYA 3K3JA 4IG7B 1IRKA 4H3QA 1JLUE 5AP6A 3JUHA 4M0WB 4I94A 4RIYB 3P4KA 4DLIA 2K8BA 1J7IA 2ERKA 5I9WA 4WNKA 4P90A 2GNHA 3R01A 4IM2A 1CTPE 1HCLA 3ETAA 2YHVA 5CSVA 3GCQA 3VS1A 2Z0EB 2OOBB 3PLUA 3V5TA 2W1IA 3BV3A 3W16A 2W1HA 4JDIA 3ZHPC 3WILA 4NY0A 1OIUA 4X3FC 4DHJB 2JKMA 4BHZA 5D7AA 1YQJA 3RAKA 4DDID 4BZNA 1U4AA 3DVNU 1KE7A 1ZXEA 4JDJA 3EL7A 3O2MA 5C8KA 1E90A 5D2MB 1AQ1A 5GJFA 3FAAA 3D14A 2OJ9A 3UOHA 4K81A 2C6EA 3PSCA 3V51A 3I6WA 4F99A 4QP1A 1HE8A 5AEKB 2E9VA 2O65A 2G01A 4F7LA 3LE6A 3RPOA 4E6AA 5AV4A 4FTUA 3LM5A 4YL8A 4GYGA 3ZBXA 3Q5ZA 3WARA 4NAWB 5KMJA 4XRLA 4A9UA 4BDGA 3N4TA 5EG3A 2X39A 4EHGA 3ACJA 5AA9A 4GT4A 2KDBA 5L2IA 4QQJA 2N4FA 4MEMA 1MG8A 3ZUTA 1WBWA 4AN3A 4RVTA 1R4NI 3L8SA 2NO3A 1WGDA 5BVWA 3HKOA 1Y8GA 3SXRA 5CEMA 3G2FA 3RZWC 4CGAA 5IQEA 2Y6OA 3KMMA 3U4WA 2L0FA 3JVSA 3JPVA 5JN2A 3EFUA 3VUTA 4UMRA 2ZPNA 4HVHA 3PA4A 5AR3A 1V49A 5L2TA 3S0OA 4XG7A 4ZDVA 2W4OA 4YJVA 3MA6A 5HG7A 5K0KA 3WE4A 3KYDD 3FMJA 2XK8A 2AWTA 4GU6A 2FCQA 3KFAA 3R63A 2NBUA 2K25A 4R6VA 4BB4A 1NI2A 1LPUA 4X3FA 3TCPA 4RT7A 3FEGA 4JBOA 1ZOEA 1ZMWA 2W5HA 3RI1A 4M97A 2AYPA 2WX0A 2GNFA 3Q4CA 4CKIA 4G1WA 3FUPA 4FKOA 4OTDA 2KWVB 4ZTMA 3D83A 4MD8E 3OTVA 2GBRA 5AP1A 2PVHA 4BI2A 4DEIA 4AAAA 2B0QA 3RKBA 1EF1A 3DJ6A 4RPVA 3TNWA 2BAJA 4CLIA 3BV2A 2MLBA 3S95A 4MNEA 3TJPA 1JWHA 2VTHA 1L2NA 4HYIA 5F1ZA 2GBNA 2F7ZE 3BYVA 3IDPA 3O96A 5HU9A 4XG3A 2YM3A 4EI4A 4CFVA 5BUJA 2O2VA 2O6VD 5LOHA 4CT1A 4NCTC 2MBQA 5HE0A 1ISNA 4W9HA 4ANBA 5C8MA 2ETKA 3FDNA 3R7RA 4NYEA 3IOPA 4JIKA 2RPQA 4BCNA 4X6RA 4IEBA 4L42A 5AP5A 1OKZA 4B4LA 4NJ6A 1TBEA 5GINE 5DPSA 5HBHA 3R6XA 3FZRA 4TY1A 4F1OA 3WA0A 3DAKA 3T9LA 2XNEA 3FI4A 3F5XA 3EQFA 2C60A 3REPA 3VUGA 5IH4A 3RM6A 3BYSA 4UYNA 1IPGA 2ITWA 2FUHB 2D07B 3QU0A 4G9CA 4HPUE 4BOZB 3V6RA 5BUEA 2EXEA 1PMUA 3F88A 1A5RA 3QWJA 1WXAA 4LJPB 4XMOA 2ITOA 3RD2A 2CGUA 5JMSA 1U54B 1GNGA 2XIYA 5DCNA 4O7WA 3FHIA 4AQCA 2W1EA 4KDLB 4USFA 4F09A 3IGOA 2HK5A 4H39A 4XRJA 5JFXA 5DMZA 3BHHA 5JGAA 4FUYA 4WG4A 4DFZE 1PKDA 4FKUA 3HEGA 4YBJA 3Q3BA 1J0GA 2OFUA 4EWQA 1H0VA 5LVOA 4EYMA 4TXCA 4U43A 2MX2A 4K7SA 3EC8A 3DBEA 4KSQA 5IPJA 2PEAA 2MSED 3B08A 4BGGA 2HW7A 1ZYLA 2PE9A 4NCTA 4FX3A 5AJQA 5CQUA 4IM0A 4FSNA 4DGNA 3FI3A 1URWA 3SXSA 3SC1A 4X2FA 2K6QA 2QI8A 2PVMA 3L0WB 4NAWA 5HEZA 4AE9A 5CF6A 2B9FA 3NUUA 2B4SB 2C6MA 4FV3A 5HKHA 4WOVA 4TNDA 3QQJA 1U59A 1P1AA 2PE1A 4WG5A 2ZDTA 3QD2B 3VQUA 3IK3A 3VW8A 4CYJA 5LXIB 2QOFA 1SVEA 3RAIA 5AR2A 3ZDTA 3QX2A 5LXMA 5J8IA 2UZTA 4MXXA 3NWWA 5TF9A 4HGSA 4FBXA 3M63B 4EJ7A 4A20A 3R0TA 4PTEA 5CSXA 5T6KA 4JQ7A 2D10A 3MY5A 4A4XA 3A9JA 3ZNGC 4L7FA 1SM2A 3W55A 4NQLB 5DT3A 4J98A 4OTGA 4ICUA 1WMKA 1JAMA 1WVWA 2KJ6A 3HA8A 4PDPA 4HZRA 4D1ZA 2BRBA 2PPQA 4KABA 5M06A 5L2QA 3UIUA 2C1AA 4A3PA 4DG2E 3PJ1A 3TZ8A 3ZSHA 2YITA 4BYJA 4PYZA 3M3JA 4QT1A 4YNOA 1YXSA 1H8FA 3M11A 1Q8TA 4C33A 1WBOA 4BTJA 3R9OA 3NYVA 2WD1A 5DR2A 4LOPA 3P0MA 5JK3A 4IB3A 3QWZB 3DA6A 3G0FA 4NU1A 4PMPA 2XH5A 2R3MA 5EOLA 4DEHA 4YC6A 4GN1A 3PZDA 4EUUA 2L00B 2MQJA 2ETMA 2CU1A 3GCUA 1WZ3A 3H4JA 4OBOA 2C6OA 3QCQA 5AX3A 3RZBA 3C0IA 3QX4A 1ZMUA 2UVYA 3BBWA 3SA0A 3TWJA 5J5SA 4FA2A 4L9IA 4QPAA 3Q4TA 3PV1A 5IEXA 1YXVA 5HIDA 4R1VA 4HPTE 4GIVA 4NSTA 3P9JA 1DI9A 3UO5A 2XRUA 1GJOA 4FYOA 5HD7A 3DJ5A 3O0GA 2ZAZA 5E9EA 3C0GA 2NS5A 4JRVA 2WMXA 3NUPA 4YSMA 2L8JA 4IDVA 5DEWA 3O8PA 2UW9A 5CEQA 1PF8A 5A4LA 2N7EA 4O1OA 4G17A 2V22A 5ANDA 2A4LA 2GQSA 3CXWA 3E3BX 2VTOA 2BIKB 4FV0A 1WGYA 3GC0A 2XM9A 1PRYA 2OK1A 4FR4A 3EQIA 3WI6A 3O7LB 2EWAA 5JH5C 4MD9E 4FEQA 3NDMA 2JUOA 3VS0A 2IVVA 1WXSA 3GOPA 3C5UA 4PRJA 4IWQA 5HVJA 2IBIB 2XJ0A 1YI4A 3FZTA 4AACA 3AG9A 2AUHA 5HCXA 2F2UA 4QMNA 3ZRCA 1TGZB 3Q53A 2LXCA 4EOOA 3NNUA 3ZOSA 4XP0A 5IUGA 4EOQA 3THBA 3ELJA 5E7RA 1GJZA 4FKGA 4YMJA 3FMEA 4F6UA 5LVMA 1T45A 5KHXA 1T46A 4UZDA 3V6SA 4RJ4A 2BUJA 2BALA 5E91A 4LV8A 2KN5A 4E26A 4XG6A 3R02A 5KHQA 4YZCA 3DBCA 4MDKE 2QKRA 4MWHA 2QURA 3ML8A 5IMEA 5KMLA 4OTWA 3ZRLA 3COMA 3CTJA 4GT5A 5E92A 3NW7A 2KJRA 1YXUA 1B39A 3TT0A 4FTTA 4BTMA 4S32A 1MRUA 3F2RA 3CKWA 4XP2A 4ERWA 3QCSA 2KTRB 3Q9WA 1VYWA 5F95A 5EQYA 3DLZA 3IFWB 3QD0A 5D94A 1QPEA 1BI8A 1WFCA 2ITZA 3MGYA 4EBVA 3RUIB 1F5QA 4W4YA 1E1VA 5DPWA 3FV8A 1ATPE 5CENA 3GBZA 3GCSA 5HE3A 3EQDA 2J50A 1Q1OA 1P4FA 3QD3A 4PPBA 5M57A 1YHVA 2ZM1A 4G3EA 4QQCA 4YJPA 3NYNA 3FYJX 2WQEA 4BI0A 3SG8A 1RE8A 3BGQA 5JRQA 1Q0WB 3V5JA 3E8DA 4WD5A 1KE9A 1R4MI 5LMBA 3PJ3A 4QD6A 4D4RA 4DGOA 5E8TA 2NNWB 4BBEA 1KSWA 3HIZA 5E4HA 3KN5A 4NTTA 5EQEA 2F49A 4ANUA 3NPCA 2XK4A 5HTBA 2UVZA 3TM0A 3FI2A 4L46A 4D28A 1YKRA 4EEWA 2C9WB 3D7ZA 3LMHA 4BKZA 1KV2A 3COHA 2JFLA 1J1CA 3HDNA 4ZTRA 3VW6A 4AJYB 2VO7A 1BX6A 1QL6A 2WQNA 1IR3A 3KB7A 4FK3A 3ZTXA 3ZC5A 4FTJA 2VX0A 3D15A 4BC6A 3V62A 3GC9A 2PZ5A 2OU7A 3IGGA 4CG9A 1WI0A 4BZOA 4MK0A 3A4SC 4L01A 2LRWA 2GQRA 4IDTA 3GU8A 3MA3A 4GDLA 2W7XA 3ODYX 2C5XA 2UW5A 1ZOHA 1YJ1A 4DT9A 2PZIA 4RIXB 4DAWA 3QK0A 2BKZA 4IJ9A 3NUSA 2UW4A 3V8WA 2PJHA 2W9ZB 3QTZA 5KKRB 5FDXA 2JD5A 2LASA 1ZMVA 2RGPA 4TQ1A 3I81A 4FTRA 3UZTA 1JVPP 5GZ8A 4CZYB 3PS6A 3GVUA 4GGQA 4KB8A 3W32A 3R71A 4O22A 1W0XC 4DFBA 3PG1A 4QMOA 4F7JA 3CTQA 3HMMA 4E20A 3R9DA 4ASWC 3GOKA 3QKMA 4MH7A 5HE1A 2FSOX 3KCKA 5FQDC 2EKEC 2RG5A 2FSMX 4QP7A 5HD4A 4PTGA 2I1KA 2C3JA 2DX5B 4ZY6A 2W5AA 2OZAA 4N57A 3TI1A 3LFEA 4LUEA 2QD9A 3CIKA 3BPRA 3PYYA 3QA0A 1UNLA 3L17A 3GFEA 3DBHI 2RFSA 4ZJJA 3KYCD 5M4UA 4JDKA 5LCKA 4L3JA 3F61A 4N6YA 1WX7A 4DBNA 3HZTA 5G2NA 3CSFA 5IU2A 5GIOE 2CNVA 4Z7HA 3FLZA 5FTOA 3EOCA 1XH8A 2BZHB 4HVSA 1W8CA 3Q9YA 3PY1A 1Z5SB 3ZO3A 4AT5A 2ZJDA 2OG8A 3EYHA 4LQMA 5HBEA 3MH2A 4Y5QA 3R7YA 4A7CA 3WF6A 1H4RA 3ZVVA 2G45B 1E8YA 2REXA 2DYOA 4BF2A 3NVMB 1WJNA 2YERA 4ENYA 4J71A 3TACA 4FG9A 3W2OA 3VTVA 2BHHA 3CTHA 4I5HA 4KS8A 5L83A 1J3HA 2CGWA 4LRJA 2JT4B 2ESMA 1V0BA 4IAYA 3A7IA 3H10A 5DOSA 2BKKA 4UXQA 4MF1A 4DFLA 2BPMA 1Q3DA 4KD1A 5HQ0A 5AR5A 1WGHA 3PPKA 2PZRA 5CALA 3VDZA 3KUDB 2LGCA 3R2BA 1BT0A 2GMXA 1E8ZA 1ZY5A 2WMBA 3VBWA 2EU9A 3IQ7A 4E6QA 1OKWA 1OTRB 3O8UA 2YAKA 5TT7A 1Q8YA 1UGMA 4RQKA 2CLQA 1OUYA 4O96A 1O6YA 3NSZA 3HLLA 1ZZ2A 1RAXA 1UU3A 2HE7A 2ZPYA 2P33A 4EKLA 3AOXA 3N4VA 4BKTA 4ZS0A 4FTOA 4W9CA 4WJPA 4FKSA 2JBPA 2Z8CA 3R8PA 4K18A 3ZFMA 5ETCA 2XRWA 4G11A 4JL9A 1MUOA 4PV0A 5CT0A 3TZMA 4XOZA 2WGJA 4IAAA 3ATTA 3D0EA 2HWPA 2CCHA 1C1YB 2ITNA 2FUMA 2NCNA 2ZCCA 3E5AA 3ZYAA 4WHZA 3DDCB 2ITUA 3DQXA 3N9XA 4G9RA 2I40A 3AGLA 2XA4A 5CHWA 5H8EA 2VTLA 4NW5A 3KULA 4GVJA 3QQ8B 2EMTA 4BFRA 4A4LA 4JBQA 1GIJA 4Z3VA 2Q0BA 4XV1A 1WMHA 2A19B 2OZOA 3P78A 4XV2A 3U30A 5A6NA 2VTTA 4HGTA 3GOEA 3PA5A 2KXJA 4WWPA 3SKCA 2ETRA 2FSTX 3VJOA 3K54A 5FUTA 3ONSA 2CHZA 4NNJB 5DEYA 1WVYA 3PTFC 4KAOA 3RBWA 5AIKA 1OL7A 5J5TA 1WBPA 2X2KA 2XUUA 2QO2A 3TV4A 3W2PA 2VNWA 4D2WA 4AZEA 4YTCA 4ZZOA 3GC8A 1JKKA 2C0IA 2BKFA 3Q4ZA 4DFYA 5CNOA 1MP8A 2IO3B 5E6NA 4MBLA 4GDKA 4JAIA 4HYUA 4OT6A 1KLVA 4PMMA 4GMYA 3S3IA 2VTRA 2PVRA 4AT3A 2XZSA 2WIPA 2FVDA 2WIHA 4LCDE 4YHTA 2F7XE 4U97A 4LUDA 4BDIA 1KE5A 4UWCA 3A1QA 1V0OA 4C58A 3SHEA 2DYLA 4L6QA 4LYNA 4HK2A 1YX6B 3WF7A 3U87A 3MJWA 4MTAA 4E6CA 2J7TA 3GU7A 5FEDA 1APME 3W33A 2MBHA 4FSWA 1GNUA 4JDHA 2R3PA 4RJ7A 3TKHA 4EZ3A 5CQWA 4F1SA 5E6OA 3WIKA 4BTKA 4EFOA 3GU4A 2OSCA 4BIDA 4P7IA 4FL2A 4DBGA 5JHBA 3OW4A 5C27A 1JKLA 1JKSA 5CAUA 3VBVA 4OT5A 4XNEA 3NUYA 5KMNA 3WALA 3DVNV 5CANA 5HLNA 4GSWA 5J7HA 5I9ZA 2WEVA 2FSLX 2JEDA 2YM8A 3D7TB 2CHXA 3ACKA 1PYXA 3NRMA 2G2IA 3II5A 2RFNA 2L76A 4HWIB 4QP2A 3CMMB 1GZKA 5H2UA 5L8LA 4FKRA 4R78A 4K9YA 4FV2A 2R2PA 3VS3A 2KDEB 2ZV2A 2WU7A 3ZZWA 3KXXA 4NWMA 3JS2A 2KWUB 2XK9A 2JC6A 5JZJA 1XH5A 4WKQA 1E1XA 3R73A 5KHWA 2WNTA 4IAIA 5AFVA 2YISA 3DZOA 3E92A 1WFYA 2XB7A 3CF6E 3QGWA 2H6DA 3HGKA 4CZTA 4CHKA 4F9BA 2BRMA 2FIFA 2CKPA 5KE0A 3RNIA 3PWDA 3AXWA 2OJGA 3NNXA 4YU2A 4R3PA 2IY0B 4BR3A 4DITA 2I0YA 3FPQA 3U6HA 1JSUA 3DZQA 1WZYA 4IADA 3R1QA 3QZIA 4RBLA 3QZGA 2DZKA 4ZK5A 4I4EA 4AUAA 1TTNA 4TYEA 1E7UA 3QHRA 4I5PA 3IKAA 2WPAA 4QYHA 1RLFA 3DBSA 1DAWA 4K33A 4UMUA 1KOTA 4ITJA 4X3JA 4AX8A 4RFYA 3IPHA 4BIBA 4F6SA 3MTNB 4GW8A 2B9JA 3LFNA 2O6VA 3KMUA 5EOBA 2R0IA 4FTNA 3EFLA 2IO6A
chains in the Genus database with same CATH superfamily
3Q4UA 1BMKA 4DEGA 4XHKB 2JZPA 4TNBA 3UG2A 2D3GA 3RCZA 4F9AA 3NAYA 3W8LA 3F5UA 4FKLA 3GCPA 1V1KA 3B2WA 4CG8A 4CVAA 2VWVA 4O0WA 3UBDA 4AA5A 4FIIA 2X7GA 4S34A 2UZUE 3JYUA 3ZSGA 4H3PA 5FP5A 4D2TA 3O51A 3HV5A 4RZVA 4FJVB 4EZLA 3QF9A 1SE2A 3GCVA 1TIFA 3U4EG 3VF8A 3T8OA 3JVZX 3TDVA 2KJHB 5IEYA 1FXIA 5FEEA 1R7SA 2K5PA 1MPEA 1FVRA 1UZXB 2UUEA 5BO4B 2R3NA 2X0QA 3K9OB 2YLEA 3U2SC 4NW6A 1F0QA 4CD0A 4CV9A 4PMSA 2XALA 3RCDA 2G3QB 2JKKA 3MVJA 1DS5A 3DTCA 3AE7B 3AMAA 4QMZA 4HKZE 4BKYA 3H7PA 2B9HA 1L6VA 3N20C 2JZ3B 5EI2A 2PULA 1WBVA 4FVPA 3PVWA 2C5YA 4QMWA 3IAM1 4P16A 5FXQA 2W06A 4Q5HA 2G9XA 3ZLWA 4M69B 1CQVA 2JDVA 2R61A 1ST0A 4GL9A 4Y73A 4GCJA 2IG7A 2CJOA 2Y5BB 4B6WA 4O4BB 4DTAA 2YLMA 2IO0B 2C5VA 3MPMA 3R8VA 1YOVB 4ICVA 3T9IA 2VZ6A 4L45A 4FYNA 5HTIA 4O7RA 3ET7A 5EYDA 1QOBA 5DWRA 4NIFA 3E56A 5KHOA 3BBTB 4ANNA 4R3DA 4Z7GA 4M7IA 4EK6A 2M1MA 4L2YA 4CMOA 3NS1A 4MF0A 4ZLOA 3L10B 2XMYA 5G5GA 1WE7A 2X7FA 4D2VA 4S0RA 2KC1A 4CCBA 2VZKD 4LJOB 4V05A 1P14A 5A54A 3QQGA 3O50A 5HG8A 1H4LA 3EFJA 5K4IA 2RPVA 3QRJA 5F94A 3P08A 3PZ7A 2G4SA 3OXTA 4QQ5A 3VHTC 4HJKA 3F5PA 4ZTLA 4UWBA 1MRVA 2OXYA 4O0VA 3HYHA 3PDTA 4EH2A 1JWUD 2XKDA 2D3BA 5J18A 3LB8C 4ARIA 4I41A 2UZLA 2OFVA 2K1FA 4ZMEA 4GK3A 4FKVA 3EECA 2W05A 4NT4A 1S9JA 5CXZA 3NZSA 4B8LA 2KMAA 4GFMA 3ZZEA 2PW9A 4HYHA 1LO5D 3W5UB 3A9KA 2VWWA 1FPYA 1XD3B 2NTTA 5I9VA 3MTFA 4E8AA 3GNIB 3HV7A 1ET6A 3P7AA 2C3KA 3W2CA 3SD0A 3FQSA 4C61A 3EN4A 2ITVA 3A2CA 4XH6A 5IQDA 3V60A 2V0DA 3UVQA 3VBYA 2R7IA 3PSEB 4CEGA 1DAYA 3KN6A 2BFYA 3ZS5A 3C8YA 2YCRA 2GTNA 2JAMA 3QCXA 2JZZA 5KMKA 2NRYA 4BBNF 3ZJUA 1I4HA 4WBOA 1YHSA 4JPSA 4DGLC 4IB0A 3ZTDA 5EW8A 1K51A 3LCKA 4MGKE 4CFFA 3PLVA 3MVLA 4MBJA 4CO7A 4FIFA 5HG2A 4S31A 2O0UA 5IH5A 4MXYA 1WF9A 2GFCA 2LVQA 3TKUA 3RPVA 4O0SA 1R3CA 2KFKA 3EQHA 2WFYA 4LNOA 3KRXA 2YZLA 2AEHA 1XEEA 3RWQA 2PUPA 3HL7A 4TL0A 2Z0DB 3FBVA 4PTCA 4ERKA 3E7VA 1L6UA 4EZ5A 2QJLA 1GC7A 4A9TA 3KK9A 3JSVA 3F3TA 2XARA 3GB2A 3DXPA 3HUBA 2X6EA 4J96A 3G9LX 3E87A 4G3FA 2KD0A 3R7UA 3A8WA 3ORTA 5HVKA 3P42A 3KRWA 3I5NA 3AN1A 5IQFA 5ACKA 2GOWA 4IFCA 4ALUA 2GBKA 1H27A 2IVTA 1WJ4A 5L6WL 4X2GA 4IIRA 5LARA 1LEZA 2PTKA 1T0SC 1V5TA 3ALBA 3A8XA 4W9FA 3VNTA 4UXLA 4XEYA 1P7EA 3RNGC 2R3KA 3ETRA 5C2TB 2CNUA 1H8CA 5DYJA 2G2FA 3UVPA 5J79A 4USAA 3W0PA 4AGCA 2FCSA 3TZ9A 4FSMA 4KRCA 1JRUA 3NUNA 3FL5A 3ENHA 1YQ4B 3TIYA 4DA5A 3EFKA 3BU3A 2HCKA 2ACXA 4ZTSA 2LGSA 3L54A 4D2SA 4LFIA 1H25A 3MBLA 3I60A 2WU6A 2H34A 2KT7A 4EKUA 4UBAA 1YX5B 4CFXA 4JX1C 4RJ5A 3A4OX 1ZYCA 4F63A 4IACA 5IA1A 1YN4A 2PU8A 5J7BA 3SHQA 2YFXA 3EA6A 4UALA 3LXFA 1QOFA 4KKIA 1NVQA 4PMTA 4APCA 5CVGA 3UTOA 5LCJA 3LJ2A 2JKOA 3WAMA 1FCCC 1JBPE 4RWLA 5DGZA 3HHMA 3NVWA 1WZ0A 5HX8A 3PRIA 3AI5A 2ITPA 4ARKA 4BI1A 3EFWA 2BAQA 2XIZA 3DBDA 1G6JA 4J97A 2CSNA 3ID6C 2OBJA 4JQ8A 4R5YA 3D94A 5KX8A 4FTQA 3I57A 3D4QA 3ZNID 3ALNA 3Q6BA 5IA7A 2WKMA 3HMNA 5IMXA 2I6LA 2XVDA 5EM5A 5L8KA 5JXVA 3IS5A 1XLPA 4ZMFA 4ZYNA 5CSWA 2CLXA 3KEXA 3CKXA 4JBPA 3O23A 4MEDA 4C00A 4JLCA 4G6NA 3V5PA 4WRSA 2XKFA 4DBXA 4L7SA 2QOLA 1YJIA 5IF1A 5DPRA 3NFFB 5C1QB 4LDTA 4IX4A 5JQ8A 3OP5A 1FNWA 4O7LA 3APCA 4AT4A 5D3DA 4ALVA 4F8CB 4QMLA 4YTIA 2QOOA 4IWOA 1WE6A 2KKCA 3DDQA 2J0MA 3KXZA 1KRHA 3PJ8A 1VR2A 3UVRA 3FYKX 2DWBA 1XH9A 4I0RA 3AE4B 3VTUA 1VZ7A 4P4CA 1IP9A 1EUVB 1OBGA 4AZFA 2VGPA 5CWZA 5EI6A 5FM2A 4NM3A 4TUUA 5J9YA 4I24A 4XP3A 1OKVA 3RPRA 2OJRA 2QVSE 3WF8A 4FKJA 3UZRA 1QPJA 2HAKA 2XBBC 4AP7A 4FJZA 4LOQA 4I6BA 3W2QA 4CQEA 3DVGY 3ULZA 1SNXA 1KE8A 3Q69A 1Q8WA 4DYMA 4YT0B 4M15A 5HTCA 3P7BA 4V01A 2WLBA 3PE1A 3L1SA 4AFEA 4XLIA 3CC6A 3F69A 2X81A 3JR1A 3ENMA 5D6JB 4JIAA 3AEFB 5ETAA 4AZTA 2FB8A 1M14A 1XH7A 4NL0A 4AXCA 3ZM4A 4LI5A 4R77A 4U81A 1V86A 1R4MB 5CS6A 3RFZB 2R3HA 5B2LA 5E8YA 2E9UA 3MPAA 4FEWA 3WYXA 3X23A 4O4EA 3LFDA 2GU8A 4ZSEA 1BL7A 2XIXA 4ACDA 3B1LX 3PPAA 2YCFA 1UKIA 3U6JA 2DYBA 4D2PA 3KRJA 3E8CA 5EKNA 4ZJIA 4CMTA 4ZSLA 3W2SA 2Z7SA 3CR0A 3B9JA 3ZUNA 5BMMA 4DWFA 3R2YA 2P2HA 3RK9A 1FGKA 3OMVA 1C76A 4R7HA 5FBNC 4US8A 2WHBA 3ZEPA 2AYOB 2JSVX 3AKJA 1LXDA 2RDHA 3DK6A 2IZRA 3I7CA 3NNWA 3A7FA 2IO1B 4MGIE 2KAJA 4AOIA 1UU8A 1REKA 3TN8A 4P7EA 3P4SB 5TOZA 1WR1A 1H1QA 1SJHD 4ACMA 4EOJA 2WS3B 4GKHA 5CF5A 1M2RA 5T8IA 2FYSA 3COKA 4BCGA 3KA0A 2VWIA 4CFUA 1JQ4A 4FIGA 3AT2A 4YJTA 3UC3A 3E88A 5AUUA 4J52A 1YOLA 4O2ZA 3WIMA 4F0GA 4W9IA 4IAFA 4FV1A 4RFMA 2RGFA 4US9A 2B9IA 3LXNA 4EK5A 3DQVA 1PMNA 3FXZA 1EWCA 4FADA 3PPJA 3BGPA 3ZLZA 3EHVA 1FMOE 3F3WA 3ORIA 4FKPA 2AC5A 3W2RA 1OQRA 3BK2A 2C6IA 3H9FA 5EDSA 4BFMA 2PMOX 1MQ4A 4QYGA 2W0JA 3AU5A 1YOJA 1ZE3D 2WTKC 3JYAA 3DWMA 3UOLA 2E9OA 5L4QA 3O71A 3ZONA 2WEIA 3GXLA 4FOBA 1XKKA 3DBQA 2RG6A 4HJGE 3KQ7A 2CU3A 5HBJA 2Q0NA 2C47A 3UE4A 4FA6A 3LPBA 4S17A 3DHIC 3P23A 2GNGA 4GB9A 1ZAOA 2WXMA 2E3TA 3DBHB 1PJKA 1Y6AA 4DXAB 4GT3A 3UNJA 3L8VA 3AULA 5DHJA 3BK1A 5AUWA 4MJSB 3A61A 4O81A 5FRIA 4BJJA 1CSNA 4QNYA 4USEA 4HVDA 2WOTA 3ZRMA 2IEWA 2C1BA 4RIWA 4WUNA 2NBVB 3SW4A 2JIUA 5AADA 4IBMA 2L0TA 2E2BA 1Q62A 1W98A 3AV8A 4UB7A 3VBQA 5FLFA 1O6LA 2GRIA 4RJ6A 1L4DB 2C7MB 2DUVA 5AP7A 2BVCA 4MUQA 2PMVA 3TJDA 2OIDA 3R30A 5A3XA 4BCPA 5AAFA 3F7ZA 5DT4A 4U3ZA 4CKJA 4K7WA 2FA2A 4CYEA 1R39A 3GU6A 2KFJA 4RGJA 2IW8A 2W1ZA 4FL1A 4X7QA 2CDZA 3BYYB 3PIXA 3R21A 2GS6A 4QTDA 3M1SA 2EUFB 3DK3A 1L8TA 2CMWA 4OR5A 3BU6A 3QA8A 5FWKK 3MI9A 3CJFA 3ZO2A 1H24A 1XF5L 5I9YA 4I6QA 5IA0A 1ST4A 4AGWA 4YJRA 4RFZA 2G1TA 4O2PA 4GYIA 4DH7A 2REIA 3MH1A 3OUNB 4DXGA 4QP6A 2KQ7A 3AU4A 4TKNA 1UVRA 3C4WA 4E93A 4LMNA 4DH5A 5HORA 3ZTCA 4FT3A 1MFWA 2F7EE 1VLBA 1N60A 4K77A 1WYGA 4FSZA 3HRFA 2VWYA 4K0YA 3OCSA 1RJBA 1T5XD 4II5A 2F2CB 1M2QA 2G9HD 4LG4A 4KIQA 4X21A 3F5GA 1P0RA 3EQBA 3DBFA 4FICA 3O8TA 5H3QA 1SYKA 4HGLA 3DLSA 3Q9ZA 2OICA 3G6GA 2BQQA 2J4ZA 2UV2A 4O6EA 3H6NA 2E9PA 3BRBA 2KTYA 2GI9A 5CVHA 4F9YA 2WP9B 3EH9A 4BZAA 4CMUA 3NFGB 1C4CA 1GUAB 2F57A 4FTKA 1HA5A 5M09A 4CFMA 1NBFC 5D12A 4K3BA 3B0AA 5G6VA 3TL8A 1J8CA 5CU0A 4C8BA 3RK7A 3AD6A 3AXCA 2O2UA 2OI4X 3GE3C 2GNLA 2KX0A 1Q5WB 3ODZX 3OT8A 4J99A 2QSDA 1XBAA 2NRUA 1SBBB 4FSYA 3E8EA 4QQTA 2NMQA 3G6HA 3HRCA 4IAZA 3A7JA 4YO6A 3VUHA 3GB1A 2R7BA 4WBBB 5DT0A 3ZBFA 1YDRE 4GIIA 5KZIA 3TUCA 3EWHA 4IB1A 4PPAA 3LFAA 3AMZA 3NYXA 4FSRA 2OJWA 3VXWA 4CLJA 1UU9A 5AA8A 3V3VA 1E6EB 3VQIA 2C3IB 3UYTA 3UO4A 2HY0A 3H9RA 3NZ0A 3TMPB 3KXHA 2FNJB 2BKRB 3SOCA 3KQ4A 1LQBA 1QPDA 1ZDVA 3RM7A 3VC4A 4X3FB 3I4BA 2OJFE 3D5VA 2N9KA 4ID7A 3UNZA 3U9NA 1K9AA 3MW1A 4RC3A 1DYQA 5JT2A 4O84A 4BCHA 4C57A 3U4UA 3BQCA 2IPXA 4P6VF 4BZDA 3ZO4A 3NZUA 5M56A 3UYSA 4C4JA 5D7VA 5CEPA 3IW4A 2VX3A 3D9VA 2WTDA 4AN2A 5AR7A 5ICPA 3H0ZA 1SE4A 4MNEB 1K2PA 3RTPA 1UD7A 1Q97A 4OLIA 4RGMA 3Q3OC 4F1TA 4MJSA 3NMUF 5BVFA 2BDFA 4II2B 2XAMA 2W82A 4H05A 2ITQA 3OY1A 3CJGA 1KJTA 1LP4A 1FXTB 4I5CA 5CLPA 4L67A 4MAOA 2INNE 5FK9C 4UYAA 3PO0A 1E0ZA 3Q8AA 4MXZA 1TS2A 1HOWA 3DOGA 4G16A 4BICA 5BYYA 1SGHA 4TYJA 3UG1A 4FK6A 1CMKE 5LLIA 3PSDA 3BL7A 2MW5A 5FEQA 3SG9A 1V1PB 4MWIA 5CNNA 3IBEA 2KWCA 3ZNZB 2I1JA 2VRRB 3UNKA 4IM3A 4NJ7A 2P55A 3SLSA 4FG8A 5ANKA 3AC3A 2R3OA 4ZHOA 4LRMA 4BHNA 3LXKA 3RI7C 3DOWA 2WO6A 4CKRA 1RRBA 5EI8A 3PHWB 3IDBA 3IO7A 4E3CA 4FE2A 1VR9A 5C9CA 5BUIA 4EL9A 1PKGA 3R22A 3AE5B 3DJ7A 3D32A 4BKJA 1OPLA 3HAVA 4DTBA 4EC8A 3PGEA 3FMDA 3QZFA 3PSBA 1PGXA 3LFBA 3WF5A 3HP2A 3QGYA 4BDKA 3I6UA 4HKQA 1KOAA 4L43A 3N1YC 4O7YA 3TSSA 4D9UA 3VAWA 5JH6A 5EYKA 4OTFA 2N0SB 3HUIA 4J8NA 3L16A 2CS4A 2BAKA 1OKYA 3HV3A 4F7NA 4MGZE 1TS5A 3UQAA 3ZDUA 3K5UA 5EK7A 2BIYA 3UJGA 5FR6A 3A4RA 3FHRA 2C7HA 4RWKA 5GMVA 1ZUD2 3QUEA 1Q3WA 1ET9A 1FFUA 3TV6A 3HM3A 4KSKC 1H1SA 3TKIA 1FPUA 2XNOA 1PXMA 2ITYA 3PREA 4AS1A 2KZRA 2X1NA 1PXJA 5C8NA 4XDDA 5TSSA 3F3ZA 3NS8A 4R3RA 4TTHB 3CSTA 3QQUA 1TJEA 3ZH8A 2CN8A 3EQRA 2DHZA 2X7OA 2XS0A 5E6JA 3HRBA 2YM4A 3FMKA 4MCVA 4RGOS 1M7NA 2KNBA 2FAZA 4RA5A 4Q9SA 1IG1A 5DR9A 5DRDA 3SXFA 3VS4A 4BOSC 2RD0A 4OAUC 4U79A 2KO3A 4RNAA 4EH7A 3R7OA 3VJNA 1QZEA 1TS3A 1CKIA 3GU5A 5JZNA 4ZS4A 3N51A 1W84A 3DGKA 5IO9A 3VF9A 1WBNA 2IW9A 5AUVA 4C36A 2VNYA 2XJ1A 3BIID 2V62A 3L9LA 5CU2A 3A9JB 2IZTA 3NZ3A