4EUTA

Structure of bx-795 complexed with unphosphorylated human tbk1 kinase-uld domain
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
386
structure length
384
Chain Sequence
GSQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRNIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase TBK1
publication title Molecular basis of Tank-binding kinase 1 activation by transautophosphorylation.
pubmed doi rcsb
source organism Homo sapiens
total genus 108
structure length 384
sequence length 386
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4eutA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4eutA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4eutA01
4FG7A 4QO9A 3R7GA 2CNQA 3V5WA 5CSPA 2X9EA 3VULA 2BMCA 3WF9A 5ACBC 4AZWA 1ZOEA 2EXEA 5JQ8A 1UKHA 3HP2A 4GT3A 2OJGA 2R3NA 4FKSA 3OWJA 2PMLX 3COMA 3TNHA 3NZ0A 1JKLA 2QOIA 3E7VA 3U55A 3QARA 4NJ3A 3EFLA 4HNIA 2CN8A 4M7IA 3ZO2A 2NBVB 5DEWA 4M0YA 2E9PA 3Q3BA 3PE1A 4PPCA 4DFXE 3KMMA 4GUBA 3W1YA 2KFJA 4FEUA 3Q9YA 2I1MA 3H1UA 4CFXA 4C35A 2YZLA 1R4MI 4V0GA 4XV1A 4TQ1A 1APME 1I44A 2UZBA 3CCNA 4XG4A 2YIWA 2CKOA 2G4SA 3BHTA 1NI2A 2QOHA 4RVKA 4GV1A 3W32A 1ZWSA 3MFRA 5L6OA 2VO7A 2G2HA 4RIYA 2OF2A 3ODYX 2QO9A 3KUDB 3RALA 3R9NA 4YTIA 2XMYA 3O7LB 4Y5QA 3MHSD 5CVHA 4QP9A 2ITQA 4EK8A 3QTRA 4OT5A 5HTBA 3EN4A 3TV6A 1OB3A 3ZM4A 3A4PA 5KBRA 2ITWA 2OGVA 1Q5KA 3C13A 4M84A 3PRMB 1GC7A 3I7CA 3S2PA 3ORLA 2KC2A 4MEDA 4ZZMA 3HM3A 2JDVA 4UWCA 2VAGA 2OFUA 2CNUA 3COHA 5L6WL 4EQUA 2JF5A 5JGBA 4MD7E 4Z7GA 3EYHA 2FA2A 4EOIA 5AUZA 1PMVA 2VD5A 3EQHA 4MKCA 1HCLA 4W9JA 5AX9A 3RINA 3C1XA 3NNUA 3A9KA 3ENEA 5DYJA 4LOQA 4WIHA 4YJNA 1OIQA 5BVEA 5E8YA 2GNGA 4C59A 4A4OA 1KE7A 4EONA 4N70A 4PV0A 3NS8A 1CKJA 4K0YA 3UZPA 4X3JA 3RNIA 1DS5A 3R7UA 3WE4A 2B52A 5LWMA 3R83A 2O6VD 1ISNA 1XH9A 4E6AA 2RGPA 4V05A 4MGIE 4L9IA 2L7RA 5K0XA 5DPSA 5EG3A 4BHNA 5HCYA 2F57A 1VCBA 4YC6A 4MX9A 3UO6A 3GOKA 2QHMA 2BDWA 5AAFA 3FPQA 4FKQA 1JSTA 3U7DA 3QFVA 5ITAA 5EYCA 2WDTB 5EQYA 4V04A 3F3ZA 3FY0A 4NEUA 5AP2A 2IN6A 4C4GA 2FSOX 3PG3A 3QQUA 5DN3A 2N4FA 2W1FA 2KTFA 5E8ZA 5FQDC 2L00B 3VO3A 4BBFA 4MGZE 1LQBA 5FM3A 4DGGA 3MFSA 4EOKA 3F66A 2VO3A 4DGOA 2KNBA 4U3ZA 2JAMA 2OU7A 4EEWA 1M52A 1B6CB 3QRUA 4BCNA 2BZJA 4W9IA 4U7ZA 1YXUA 3CTJA 5C8MA 2YIXA 5FR6A 4YR8A 4OAVB 1OQYA 2FCQA 2D3GA 2JAVA 3OJ3A 3TZ8A 3A4OX 3LFAA 3LXLA 3BLQA 3O0GA 3BIZA 3UGCA 3DK3A 3E63A 4BCOA 2PE0A 4O0TA 5I9ZA 1H0WA 3EB0A 5EM6A 1J8CA 5HG7A 3SXSA 3UVPA 4A4LA 3B2WA 3VBYA 2HY81 3FI8A 3W2RA 2UW6A 5CEQA 3JUHA 3VUWA 3LDZE 3G15A 4Y73A 4XG3A 4H39A 5HLNA 1WGYA 1P5EA 2UVXA 4M14A 4URKA 5A4EA 2CGWA 4A4XA 3SW7A 3MJ2A 4ZTHA 3PIXA 3WIMA 3DA6A 5HE1A 4BGGA 4G3DA 5BYYA 4HW7A 4YP8A 4QOXA 5DPWA 2PE2A 5JFWA 1Y8RC 5DCNA 4EBWA 4LFIA 4KRDA 2QR7A 3EFWA 1WBOA 4IXPA 1YW2A 5DEYA 4FV6A 2UZEA 4U5JA 5EDRA 3AD6A 4RPVA 4DDID 4BTFA 2G01A 2Z2WA 4YJRA 4O7SA 3M42A 4ZTMA 4N9F4 4R6VA 3JYUA 3PPJA 5EOBA 3UPZA 1S9JA 5EYMA 4J1RA 4YBJA 3SW4A 2I0VA 3VUHA 4BGHA 5K5XA 4M12A 1OUYA 5CI7A 2C69A 5BVWA 2G15A 4FNYA 2GPHA 1U46A 4YPDA 3K3JA 4Y83A 2DYLA 4AN3A 4FKLA 4GYGA 1ATPE 3M62B 2YERA 4XEYA 3ORNA 3R7RA 3JVRA 1Z5SB 5AUYA 2OZAA 4I3ZA 1YOMA 1KSWA 3X0WA 2CCIA 2HW6A 4QP6A 1IP9A 4IAAA 3VQUA 4LCDE 2QOOA 3LHJA 2VTTA 4RJ5A 4FV5A 2C5VA 3QX4A 5IH4A 2VN9A 3UYSA 3LFDA 2MX2A 1Y57A 2PHKA 4F9YA 5JZJA 2LAVA 3NNVA 2QR8A 2DENB 2YLFA 4B4LA 3L0WB 4C3PA 1U5RA 3ZO4A 3OS3A 4LV8A 1LXDA 4IVDA 2VTHA 4S34A 5FP6A 4XJ0A 1WM3A 2BFXA 3SOCA 3NX8A 2GBRA 4BL1A 2CNVA 1Y91A 2CHLA 4D1SA 2GHGA 2M0XA 1URCA 3ODZX 3UG2A 3DOGA 3UINB 3EOCA 5CVGA 4XHKB 3GQIA 3VUDA 3QBNA 3LXKA 3E64A 5E1SA 1P4FA 3VDZA 5C23A 4HVHA 3BE9A 3VQHA 4FHKA 1XH7A 1V5TA 1RLFA 4CRSA 4TN6A 5DOSA 4AGDA 3V6RA 3TNWA 2XIXA 5FUTA 4PDSA 5FTQA 4O7NA 4DG0E 2JIUA 2MW5A 2BYEA 3F3VA 4JDKA 3IW8A 4FIEA 4FTQA 3QX2A 4MXZA 2J0KA 3LPBA 1S3SG 3HAMA 4QYHA 3GC7A 1H25A 4K18A 3DLZA 5HBHA 3FLNC 3C0HA 4I6FA 5J9YA 1LUFA 2W9FB 4ZTQA 3SRVB 1V9JA 5E8WA 3AGMA 4NTSA 4XX9A 4ICVA 2GCDA 4X6QC 1M7QA 2F2UA 5TT7A 1E8XA 3RAHA 2C5XA 1M7NA 4MSMB 4LDTD 3ITZA 1YI3A 4IAYA 1L7YA 4IM2A 4O7RA 5CANA 2IVUA 1NA7A 4ZSJA 2R0IA 2ITNA 3RGFA 5CENA 4YZNA 4C62A 3UOHA 4OTQA 2WMSA 3NWWA 4M8MA 3QWKA 3D83A 1HOWA 4KDIC 4AE6A 4TPTA 2C4GA 2ZZPB 4CFMA 3ZLSA 5CAPA 1ZXEA 3UC4A 4FKIA 4GU2A 5BYLA 4FTRA 3Q4CA 1F5QA 5AWMA 2JY6A 2V7AA 3GQLA 5J1VA 4B95A 3G6HA 2ONLA 4IM3A 3CTQA 3EKNA 4DCEA 4M0ZA 2WKMA 3R0TA 4I92A 2XIYA 4DFBA 2B7AA 3ZRKA 5L8KA 5EK7A 4NTTA 3QTXA 3WF6A 4BBEA 2WQOA 4M68A 4OTWA 1IPGA 3LOKA 3FLYA 2J0LA 4B8MA 3IK3A 4YC8A 4ZJVA 3I7BA 5A6OA 4NIFA 3R00A 4JRNA 2NPTA 5FXRA 3I1AA 3LM0A 3VS4A 4AOFA 4QTEA 1LFDA 1W0XC 3R63A 5AFVA 4GK4A 3ULIA 2NCNA 4DFZE 3C51A 1E7UA 1FPUA 3A7GA 2C3KA 4W9CA 3JW0X 2I6LA 4D9UA 3P08A 3MY5A 4O83A 4E26A 2WNTA 2Z7SA 1ZOHA 4G3CA 3JVZX 2D11A 3GU8A 3Q04A 5M53A 4YNOA 3FQSA 2FYSA 3IG3A 3PA3A 4WNPA 2MP2B 2MSED 3HGKA 4IC7A 4IM0A 2QOFA 2GDOA 5E4HA 3HDMA 2IZRA 2UW7A 2VTJA 3QD3A 5IQFA 4E4XA 5HCXA 3CJGA 2XKCA 2Y4IB 1H08A 4UZDA 4E4MA 4JI9A 3S00A 5M08A 1GG3A 4WD5A 4O0WA 5KZ0A 2WZJA 3IVFA 3L17A 1CKIA 5D6JB 4RWKA 4EJ7A 4GDKB 3U8ZA 4O6EA 3VNTA 4OVUA 2R0UA 5HESA 2GSFA 3BHHA 3PIYA 4EH8A 3BY4B 2OZOA 4KINA 3FYJX 2AL3A 3DAJA 3CD8A 4IJPA 3HRBA 2RD0A 4UMPA 4MH7A 3W18A 4AA5A 4IG7B 4L43A 1GZ8A 3KXZA 2WTKC 3R7IA 2XNNA 4RT7A 3FI4A 1Q5WB 4DEHA 3VIDA 5CWZA 5DWRA 3ZRLA 4HGSA 4L01A 4UALA 1XKKA 4XC2A 1JKKA 3QQJA 3Q2MA 3MW1A 2BR1A 4WJQA 4BCPA 3UG1A 3F5UA 1YI6A 1ZRZA 2HJ8A 5ETIA 3MPMA 2XNBA 4FT0A 2YABA 2IO2B 1UELA 4D2VA 2VWIA 4FMQA 5KE0A 2GBKA 4K7WA 2CKQA 2YWVA 4JQ7A 3ZSHA 3GC9A 2MBEA 3CIKA 4O82A 2QQ7A 3GU6A 3DV3A 4FTKA 3QTIA 4EOPA 3EQPA 1TBEA 5HNGA 3AC4A 1PYXA 3PFQA 2R2QA 4J71A 1CMXB 4PDPA 2R3PA 3TEIA 4AFJA 4XBRA 3BLRA 3BEAA 5J5TA 3HRFA 4W9LA 3KRJA 4QMWA 2SRCA 4ANLA 4N4SA 4ANQA 4D5KA 3LFQA 3L8VA 3A1QB 2X4FA 3MI9A 4FV8A 3DPDA 4E93A 3FV8A 5I9XA 4J52A 3ZUUA 3VWAA 3ULZA 3W1SC 3ZOSA 1BI8A 1YX5B 4FZFB 3H0YA 4FKUA 3BI6A 3VH4B 3ZRCA 3KN5A 3UO5A 4IB3A 1YX6B 3SLSA 4R3CA 3NZUA 5LVPA 5EM5A 4PS7A 5DIAA 4DH8A 3O96A 4S33A 4Q2AA 1DI8A 1F0QA 2MA9B 3QCYA 4DLJA 5CU6A 4NAWB 2FH9A 5AR7A 4ZOGA 2X6DA 1PY5A 3VAPA 3NVKI 4A07A 2BKRB 3FQHA 3OZ6A 4CG8A 2VV9A 5J8IA 5L83A 2DHZA 3OUKA 3R9HA 3E93A 3ZDMC 1ZZLA 2VTAA 3KUCB 3SKCA 3A33B 4GT5A 3HECA 4KSLC 5HLPA 2GNFA 4PNIA 2CR5A 4G31A 5AM6A 4OTHA 4DBNA 2JC6A 5CSVA 4RC3A 1SGHA 4CZYB 1RDQE 5IA7A 4EOSA 3RM6A 3ANRA 4ITJA 4GFMA 3I5ZA 2CHWA 3OW3A 4DH3A 2QOKA 2WGJA 3VHEA 3ZXTA 3N30A 3VH3B 3QUPA 3HX4A 4CV8A 3LAUA 4B6LA 2Z02A 1WBSA 3PZDA 2GU8A 3DK6A 4Z9LA 4CTBA 3BYMA 4HJKA 4WJPA 1OIRA 5M44A 2KLGA 4FIFA 2XEYA 4AA4A 5FP5A 4L52A 2JZZA 4IWDA 3GXLA 2BGFA 4EL9A 2FVDA 4XLVA 3I0QA 1O6LA 1CM8A 3EJ1A 3F61A 3MA6A 1GY3A 3PE2A 3ZSGA 2B9JA 5GZ8A 3IDPA 4DINA 1TQMA 3VS3A 4W9EA 1XH4A 2IW9A 3MPAA 4FIJA 1FGKA 5AZFA 2PZPA 2KHWB 2J0JA 4YSMA 2YCSA 2ZPYA 4M0WB 3VBXA 2A27A 5L3AA 3PTFC 4CVAA 4U9AA 4MGYE 5A14A 1U5QA 4LOPA 3KC3A 1FQ1B 2VO6A 3PDTA 3TTJA 4PX6A 3BHUA 3R2BA 2QU5A 4AN9A 4FGBA 2WTDA 3PP0A 5BYZA 2IZVB 4C2WA 4BI2A 1V49A 1YWVA 2AEHA 3CEKA 5KMJA 1WVXA 4XG2A 4RMZA 3BX5A 4PUZA 4C38A 1Q99A 4Q9ZA 4QYGA 3DZOA 3ZZWA 4JJRA 4PMPA 3FLQA 4PP7A 3BV2A 4E3CA 2XJ1A 3HUBA 2JKKA 5BPYA 3NHEB 4FL3A 2PVJA 4WT6A 4NY0A 4RA5A 3DTWA 4HZSA 2EVAA 2IWIA 2GBNA 3MSSA 4HVSA 2C0OA 2VGOA 3PJCA 4EOJA 4JXFA 4W4VA 4FSRA 2PVNA 3FAAA 4EKUA 2NNWB 3NYNA 2WFYA 4E6DA 3VHTC 4EZKA 3ETAA 3LIJA 3SOAA 4CNHA 2A19B 4I5PA 4U44A 3P86A 4F7LA 4FV9A 2G2IA 4WSYA 5K4JA 4IDTA 3F5GA 4D2TA 4FKRA 3Q3JA 1RAXA 4YLLA 4RQVA 4USDA 4LL5A 4RM8A 3U30A 3VBWA 1QCFA 3KW5B 3ZO3A 1WBVA 4NM3A 3E88A 4KIKB 2MBOA 3HV4A 2XB7A 4FG9A 3TL5A 3DFCB 3TZMA 2V3SA 2HW7A 4WJOA 3FZPA 5EI2A 3OTVA 4YZMA 5KMKA 4BKTA 3VW8A 5M51A 5GZAA 2JBOA 4N0SA 4CMOA 3TZ9A 3APCA 2C68A 3HM6X 4GEOA 2UZVA 2CSNA 4IX3A 1EH4A 5LVMA 1WGHA 5HD7A 4ACMA 4IUMB 1K8RB 1DI9A 2PE6B 3O71A 4DH7A 4OBOA 2H6DA 4MCVA 5LWNA 2YZAA 4BYIA 3CKXA 2YM8A 5HU3A 4ENXA 4ITHA 4HGTA 4O7VA 2BHEA 3LXNA 2WU7A 3W2PA 2DZMA 4GMVA 3BCEA 2VTQA 3U9CA 2OLCA 4WRGA 4R7IA 4IACA 5CI6A 4ANNA 3IDBA 5EFQA 2VWWA 4CFUA 3HV7A 3HMNA 4R7BA 4IX6A 2R3FA 3SXFA 2XRWA 2GHLA 2QC6A 2PE9A 5M06A 5KMIA 5T6KA 2HE7A 4FKTA 4ID7A 3KK9A 1FMOE 3UQGA 5JFVA 4WHZA 2L3ZA 4ACHA 1KOAA 4OR5A 5BVFA 3TZ7A 4AZFA 1MUOA 2UW5A 3HA6A 4IEBA 3HHMA 3NCZA 4O84A 3QHWA 3OP5A 3TCAA 1JNKA 4BI0A 2J51A 4GCJA 4EC8A 2G1TA 4EHZA 4CMTA 3F69A 2Y4PA 3W10A 2Z8CA 2P4IA 3QRTA 1ZYJA 1OKYA 3NUXA 2W1CA 5C9CA 4BWXA 3TNQB 4CGAA 3FWQA 5B2MA 5BVKA 4U42A 4D2PA 5D7GA 3MY0A 3K3IA 3VF9A 4K1RB 1WX8A 4D9TA 4LGDA 4FTTA 4ANWA 1YOJA 4GU9A 5HE0A 1UU9A 5J9ZA 3A7HA 3NS9A 4W9GA 4XBUA 4RX8A 1WIAA 1B39A 3F5PA 4KIOA 3FZ1A 1H1WA 3DCVA 4U43A 3UC3A 3KXHA 5HKHA 3PVGA 4FLHA 4RQKA 4O0UA 4M69B 4Q5EA 5KKRB 3RAKA 4E73A 3U51A 2QKRA 2AL6A 1FVTA 4DT8A 3BGZA 1WMHB 4C0TA 3M2WA 2DWBA 4ZRJA 2XK8A 5E92A 2VZ6A 4NM5A 3UGBB 4OTDA 4G1WA 5EHLA 3OBJA 3ZEWA 4FOBA 2K8CA 2F2CB 3FQEA 4A7CA 3PVWA 2VTLA 2N7DA 3GCVA 5E9EA 5AP7A 2IPXA 4N57A 5AX3A 2UZWE 3OHTA 4PYZA 4RIXB 5CU3A 3UNZA 2BIKB 4P90A 3UMWA 3DBQA 2W1IA 4CTCA 2EUFB 3GC8A 1MQ4A 4JDJA 5CF8A 1H4RA 4QTBA 4OBQA 5LXHA 5KMOA 5EYDA 5HNBA 4PQNA 5DG5A 1OL2A 4PNKA 2NRYA 4X57B 2PY3A 3BU6A 3QQFA 4L00A 4AS0A 2VNYA 4ZRIA 2IY0B 4TL0A 5DT3A 5HZNA 3DZQA 2WX1A 2R7BA 2H96A 4AFEA 4O22A 1JWHA 1URWA 1WXMA 3C0IA 3S2AA 4IHPA 4RA4A 4MTAA 2OG8A 1OL1A 2XKDA 3AMBA 3RM7A 2B4SB 2PJHA 3OF0A 3WYXA 2DAJA 2P0CA 4I5CA 2R2PA 5EYKA 5GINE 3ATTA 2VX1A 3FMNA 2E2BA 2Z59B 3JS2A 4UEUA 4LM5A 2M1MA 5EDPA 3EQBA 3FZRA 3B8QA 5AV0A 4DYMA 4FEVA 4II2B 5DI1A 3B2TA 5E90A 3Q96A 3PLVA 2QOQA 5DNRA 4FUXA 2KX3A 3FMDA 5AUWA 4MWHA 2WMVA 4QNYA 4LRKA 3QTQA 1JVPP 4TW9A 4PWNA 3SDLC 3L13A 2YCFA 3TT0A 2EMTA 3WZKA 5D94A 2Y0AA 2MP2A 3VQIA 3UQFA 4O96A 2YAKA 4APPA 3UP7A 1PMUA 3AU4A 3PSBA 2F4JA 4B9KA 4WSQA 4G50A 5ANIA 2FB8A 3SX9A 3MH0A 4G6OA 3D32A 3TL8A 4EK6A 4CKJA 3RPVA 5EDQA 1JPAA 4GVJA 2BVAA 2WQNA 4FV0A 4LQMA 1XJDA 4HVBA 1ZYLA 3MPTA 4GDKA 4JBQA 3PJ8A 1WBNA 2JDOA 3QUDA 3PVUA 3GZNI 2HIWA 4PDYA 2W4KA 4DA5A 4BZDA 5CF6A 4JQEA 3M1SA 4YPSA 3OC1A 3I6UA 2LGXA 4BHZA 3QC8B 3OCSA 4CZUA 4RIWB 5C4LA 2UZOA 4D4RA 5ETFA 3OCTA 5FDPA 4IC8A 1Z9XA 2O5KA 1ERKA 2C3JA 3SC1A 4OTPA 4KZCA 5DA3A 2XS0A 4EZLA 4IZ7A 2J90A 3ZM9A 3UOLA 3DNEA 5HE2A 1QMZA 3COIA 4F70A 2I0EA 3LZBA 1G6JA 5F1ZA 4GGQA 3PY1A 1V0OA 2QG7A 2OK1A 3G6GA 4BN1A 2W5HA 5IQEA 5CQWA 2Z0EB 2HXQA 2ITYA 2YM5A 1OL7A 5LARA 3V3VA 2YDIA 5DE2A 3G0FA 4OW8A 4V0GB 4IB0A 1OGWA 3ZBFA 2MBQA 3HEGA 2KQSA 2XNOA 4CKIA 3LJ2A 3L8XA 1M14A 3PHXB 1H00A 2B9HA 5M09A 3PXQA 3PWYA 4E8AA 4MNFA 4EK4A 2R3LA 5A46A 2CGXA 3VFKA 4ACDA 2ZJDA 1XBBA 4XS2A 2C0IA 4A9YA 2J7TA 3A1QA 2W06A 3TIXA 3ZTDA 1LEWA 4RWIA 4II5A 5K4IA 4ZY4A 2XIZA 4M67A 4O27B 4WNOA 2JDRA 2R5TA 4FL1A 4E74A 1UD7A 3A4SC 4AT5A 4XG9A 5BQ0A 3NW7A 3IW5A 3PYYA 4C3FA 3M63B 3G51A 2GFSA 2W4JA 2IW6A 5CF4A 3TIZA 4AA0A 4ANUA 4W8EA 4GUEA 4EC9A 3AD4A 2LASA 2ONLC 5EW8A 4I23A 4JBOA 4KVGB 4F7JA 5L8JA 3NUYA 3KF4A 2MWSB 2C6IA 2C3LA 4YTHA 4FKJA 3C4ZA 3ZCLA 3IHPC 3ZLYA 1SYKA 4NAWA 2R3IA 4JQ8A 2GNJA 4JG8A 4C34A 3ZRFA 5DMZA 5J95A 2OJIA 3E8DA 4QQ5A 3AQVA 5HORA 2JXXA 2JZ3B 4R3RA 1YVJA 2A2AA 1OECA 4RZWA 4RVTA 3KYDD 2PMOX 4KKHA 2C6LA 4AGWA 4A9RA 1JRUA 5L95C 4ZMEA 1OITA 4ZJIA 3QXPA 4WNKA 4ITIA 3OXIA 3BYUA 4V01A 5LOHA 1GAGA 2JEDA 4F9BA 3B1LX 1YDRE 2YM6A 3M95A 1XBAA 1K3AA 2WWZA 3C0GA 3ENHA 5ANKA 4UN0C 3JSVB 2QKWB 5CLPA 3F3WA 2IVVA 5AV1A 3ORPA 3UVRA 2LD9A 3R8LA 4EH9A 2ETMA 2GHMA 4XZ4A 4R77A 2BTRA 2WEVA 4XH6A 1V80A 3UO4A 3GFEA 4QRCA 2XP2A 5DR9A 4FSYA 3UTOA 2I0HA 5IKWA 3QZFA 4YZCA 2XNPA 1WZYA 5HO8A 3H4JA 4MYGA 5C27A 3D7TB 3NCGA 3DBSA 4CXAA 2KTRB 3PA4A 2X7FA 3WA0A 4I5MA 1VZOA 4MQ2A 4ANSA 4H1JA 4AN2A 1OL5A 3RWPA 2X39A 3C0RB 1WR6E 1SZMA 4W4WA 4AOIA 5AV3A 2MBHA 2JDTA 4I93A 5B0XA 1QPCA 4O6LA 2NO3A 3HL7A 4AW5A 2D2QA 1YOLA 2L8JA 1ZYDA 3EQRA 1T45A 3KRXA 3WZDA 2WTJA 3FMLA 4FKVA 2HTHA 5GIPE 1Y6BA 4X3FB 5KHWA 4FT7A 3QAQA 3QAME 3JXWA 2O0UA 4EWQA 5HCZA 3T9IA 2ZJWA 4G17A 2KMCA 2WXVA 4AWIA 5CU0A 2FSLX 4L3LA 4C33A 3MESA 1P0RA 3NYXA 4FZDB 3MGYA 4IVAA 5EM7A 4FSTA 2AUHA 1BL6A 2OH0E 3BHYA 4ANVA 5CZIA 4IW0A 4F7ZA 2K8BA 2UZDA 4R1YA 4DLIA 4RWJA 2HY0A 4F1OA 3AOXA 3VUYA 5F20A 1R0PA 4HLEA 4FNWA 3UPXA 4HZRA 5IUIA 4BDFA 3G5DA 4F7SA 2Y8OA 2KZRA 4Y8DA 4ALVA 5L4QA 3R6XA 5D10A 3CGFA 4H3QA 1P3QU 4FV7A 4ZTSA 4QYYA 3ZKJC 1OPKA 3UIUA 2ZVAA 5CX9A 1VEBA 4F1TA 4FJYA 3R01A 2PVYA 5IEVA 4AX8A 1XO2B 3O51A 2BRHA 4BDAA 2BWES 5K5NA 5HHWA 3KA0A 1WE7A 2ZB1A 2LGDA 3ZU7A 4WRSA 3DXNA 2VNWA 4G6NA 3FZTA 3HVCA 4BKSD 4GXBA 4KIKA 1KLVA 4FSQA 2HZ4A 3VUTA 1KV1A 4MWIA 1ZAOA 1UNGA 1PKDA 3RMFA 4D2WA 2C9WB 4RSSA 4WG4A 2QU6A 3OY1A 5AUUA 2QO7A 4CD0A 5FGKA 3Q4TA 3W2QA 4PTGA 4W9DA 3DXQA 3FXWA 3BWFA 2CCHA 4R5YA 4K81A 3W55A 3KH0A 4AT3A 4FKOA 4X2FA 4U41A 4DFNA 2WB8A 4E5WA 3OTUA 3D5UA 3RKBA 5CAOA 3QWZB 4XP2A 4QP7A 4LJOB 2PYWA 2PTKA 1J7UA 2C1BA 4EZ7A 4FJZA 3O8UA 1IAJA 5CX3A 4FK3A 2K1FA 3JR1A 3HUCA 3F88A 3H6NA 3DQVA 1SM2A 2OI4X 1ZMWA 4EH3A 2ITPA 4YJUA 3Q52A 2B54A 2OJJA 2W1GA 4K8AA 5LVLA 2ETKA 4DTBA 4GJ2A 3K54A 4BBMA 4DEAA 1OI9A 2XK9A 3W2OA 3EQDA 3ZDUA 4BWPA 2IO1B 2ZVNA 5LVNA 3DPKA 3ZNZB 3FC1X 3IONA 3KVWA 1KOBA 1Q3DA 4I4EA 1G8SA 3TUBA 4DCAA 4PF4A 1RJBA 2CHZA 2WOUA 5CZHA 5L2SA 5FDXA 1YRPA 3AT3A 4YHJA 4U3YA 3DVNV 4WWPA 3TV4A 4FODA 5DRBA 3NDMA 4O1PA 4JS8A 2H8HA 3QLGA 3POZA 3PXYA 3NSZA 2YA9A 4P5ZA 4QMUA 4C3RA 1T46A 2GBJA 5CEOA 2BF8B 4IB1A 4EQMA 2W1EA 3PGEA 3PJ1A 3ZBXA 2XKFA 4KIQA 3GOPA 5JHBA 3PA5A 2YLMA 2D10A 3OCGA 4B6WA 5CASA 2UW8A 2M8SA 3ID6C 2F49A 3BQCA 3VJNA 4M69A 2WQBA 3ZLZA 3LCSA 4L3JA 4HGLA 1XR1A 2HOGA 4AZVA 1WMHA 5LXIB 4I6LB 3MFTA 3ZSIA 5IQBA 2A0CX 5C26A 3LFNA 4D4VA 4FIHA 5AAGA 4QNAA 4HGEA 1MRUA 4HK2A 2YCRA 5HGIA 5CEMA 3DOWA 5AP0A 4NT4A 3WIGA 2J50A 4OUCA 3W1FA 3QD4A 4GYIA 3RI1A 4GDLB 5IA0A 4PS3A 4XRJA 4RIXA 2X2MA 2GBMA 2BALA 2LXAA 3R1YA 2R3MA 3ORXA 1YXTA 4QP1A 4EK5A 3TKHA 4WBBB 3LFCA 3ORIA 1UV5A 1PYEA 3HV5A 4K7SA 1TVOA 1TQIA 2J9MA 4MAOA 5K3YA 4TKNA 5ANEA 2OO8X 3RZWC 2UUEA 5AZGA 1I42A 1WBTA 3PHWB 4ZZOA 1E1XA 1UVRA 3H3CA 1STCE 3QTUA 3IKAA 3B0AA 5IQHA 2P2IA 4LJPB 1QZEA 1MG8A 3RTPA 3PSEB 3RZFA 4NFMA 4G3XB 3ZFYA 3QZGA 4YJTA 3HIZA 1WFYA 4NM0A 4D58A 4OLIA 5IH5A 3D9VA 3D5VA 2WMTA 3QQLA 4HCTA 1PXIA 5LQFA 5DFPA 2UZTA 5AP3A 4YNEA 3KMUA 3N4UA 4IE9A 1BX6A 4CG9A 4I6BA 2RL5A 3COKA 3NUNA 1UKIA 4PP9A 4OAUC 3L8SA 4LOOA 3LMHA 1K9AA 4GSWA 3KRWA 4BFRA 3BGPA 1Q8ZA 4MDKE 4ZSGA 4KZ0A 3F3UA 2EKEC 4JLCA 1OUKA 4W9XA 3SD0A 2I40A 2LGYA 3NNXA 1RFAA 2Z7RA 5KMNA 3OWPA 3SD5A 2YAAA 3R1QA 1L3RE 4RM9A 3THBA 4WAAA 2J0MB 3KRRA 2RSUA 4U0IA 1LEZA 3R3MA 3SGCA 2G45B 5FD2A 4C61A 5J5SA 5K9IA 4JOAA 5IUHA 4AZTA 1KE5A 4KSKC 5L2TA 3O65B 1EF5A 1MRYA 1MQBA 4RFMA 4XMOA 4KD1A 4KNBA 4XRLA 1OTRB 3OUNB 4XG7A 1A9UA 3SHQA 4MF1A 4GL9A 4E5AX 3POOA 3QCAA 3QUEA 4QYEA 3N4TA 4CLIA 3BYSA 4OTRA 3H30A 2BIYA 4XG6A 4RX7A 2W99B 3E5AA 4QTDA 3MVJA 3OLMD 3TMPB 3NVMB 3W8QA 4LGHA 4N6ZA 4IMYA 2R7IA 3TBLD 3VAWA 3ZFMA 1V5OA 4FTLA 2XVDA 3EC8A 4RIWA 5IA1A 1RE8A 5T68A 4L44A 3R7VA 3WF8A 3W2SA 3DQWA 3HLLA 2ZV8A 2PPHA 2VTSA 3GUBA 4UYNA 3EQIA 4EQCA 3BYVA 4KDLB 1REKA 5I9WA 1K2PA 2GMXA 3GT8A 3R21A 1ZLTA 3FXZA 4FICA 3DKCA 3MWUA 4W9WA 4FK6A 1GNUA 3DBFA 2DUVA 2UZLA 2UYZB 3QYWA 4EZJA 3G33A 4IBMA 3V6CB 4NUSA 2ZM3A 5KZIA 4RIOA 2L0TA 2NBUA 3V8TA 2LXCA 3P78A 4PDOA 2YN8A 4LDTB 1PXLA 3C4EA 3P4KA 2L05A 4CKRA 2OOBB 4KUJA 4AG8A 2BPMA 3Q9XA 3UDBA 2HYYA 2UW4A 1YJ1A 4FKGA 2K25A 3QCXA 4B9DA 3F3TA 2O2VB 2OH4A 3GBZA 4NZWB 3F7WA 4L3PA 2JFLA 3FE3A 4YU2A 4A9TA 5JMSA 3U4WA 3P7BA 4ENYA 1KOTA 2YLEA 3MYGA 2C5YA 3OWKA 3IPHA 4CMUA 4TYHB 5EKOA 2XF0A 3UQAA 2IG7A 3I6WA 3QKMA 1PF8A 4MSQB 3EHAA 3CQEA 1IA8A 1C3TA 3D0EA 3PVBA 4DBGA 4KA3A 3GI3A 3WALA 4MELA 2JUOA 4FGRA 5AP6A 2Q0NA 4I4FA 1OGUA 2UV2A 2YEXA 4CEGA 4KB8A 4H3PA 5CEKA 3ZRMA 1LPUA 5D11A 4TWPA 5FEDA 2P3GX 5CHVC 2ZOQA 5E8TA 5IMEA 3ORTA 4DDGD 1Q24A 1J7LA 5DPRA 4BC6A 3ZH8A 3CD3A 2YACA 2CJMA 5I5ZA 4MF0A 5J18A 2W05A 5CF5A 3HK0A 4QP2A 2EXCX 4BYJA 2FAZA 3LLAA 2NVUI 3T8MA 4RMAA 4HOKA 2WOTA 3UJGA 4F7NA 3EFUA 4LI5A 4L46A 4DEDA 4I6QA 3ZEPA 1V2YA 2C6TA 5IQCA 3OCBA 3G9LX 2IO3B 1RRBA 1M17A 4BKZA 4PMTA 4GS6A 4J97A 2XYUA 3R22A 3JSVA 3ZDIA 3IECA 4J95A 3R30A 2Y4IC 3E62A 3IW6A 4G3GA 3O8TA 4FSZA 3ML9A 5AEPA 4HCPB 4S30A 3DKFA 2PZYA 4FIIA 2X8EA 1R1WA 2ERZE 2ZPNA 4FT9A 3G9NA 4UMQA 2BAQA 2BRMA 3KCFA 4MNEB 2X8IA 4H1MA 3DBDA 5HVKA 2CU1A 2IZSA 3D7TA 5HO7A 2YIRA 4QQTA 4ZLYA 2VWUA 2KTRA 5I0BA 2BRGA 4FR4A 1H01A 3R9OA 1H07A 3AD5A 3SG9A 3N4VA 2G4DB 4HYIA 3R1NA 3QWJA 2QHNA 4JL9A 2KTYA 4EOQA 4RLLA 3R02A 4O0YA 3Q4ZA 1TTNA 4AWJA 3BU5A 2OIBA 4BIDA 5AR3A 4X3FA 5CAUA 3NGAA 4BKJA 3HV6A 3OMVA 4NCTA 1TGZB 3PLUA 4YURA 2H34A 3QHRA 4J98A 2OJ9A 4KBKA 3LJ0A 2PZ5A 3OBGA 3FMKA 2EWAA 1F9JA 2YWPA 4QMOA 5A4LA 1YXSA 4R78A 4TTHB 1JKSA 4UMTA 3HMIA 1JLUE 5I3OA 3GC0A 2C47A 4TXCA 4UV0A 3QTSA 4C4FA 3FZOA 3ZO5B 3N51A 1WZ3A 2XKEA 5LVOA 3FMHA 2NS5A 1OBDA 2AC5A 4O0XA 3PRIA 5KHOA 3FI2A 3GGFA 2PVMA 3CLYA 3QJZA 3VN9A 2UW0A 3RPRA 4RC4A 1Q8UA 4WNMA 3DBCA 1U4DA 2QURA 3QRIA 4DH1A 3EMGA 1ZYCA 2KANA 5KNJA 3ORMA 4I0TA 3CY2A 1GIHA 2XK7A 4KABA 4MBLA 2FNJB 3P79A 4F0GA 3Q60A 4JIKA 3MJWA 1UU8A 3OEFX 5HE3A 5BVDA 2ACXA 4DITA 3Q9ZA 2PVHA 4FI1A 4PMMA 4D0WA 2EU9A 4HVGA 5G1XA 5JN2A 3BE2A 1PHKA 2QHOA 2V5QA 4F9AA 2HELA 5ANOA 5IQGA 4FBJB 3OWLA 3AULA 2YM7A 4JIAA 3V62A 5M07A 3MTNB 4X6RA 3N9XA 4GB9A 4J53A 3TI1A 3ZNHB 5DHJA 1ZY4A 2F7EE 4FTIA 5JHAA 4KSQA 5FTGA 4I20A 3HP5A 1OIUA 3A7IA 4JNWA 4XNEA 4ZAUA 4FE2A 3UBDA 3EQCA 5DPTA 4EUTA 5D1JA 4F6WA 3UQCA 2PPQA 4J99A 3VS0A 3DNDA 4HPTE 2ETRA 4GN1A 4APCA 5EOLA 3LFBA 4QMTA 3PWDA 3FDNA 2Z0DB 4GIIA 4QD6A 3V61A 4AE9A 4AGUA 4IX5A 4D1ZA 2PUIA 5BUJA 1NT2A 4FL2A 5L8LA 4Z7HA 3PV1A 4MM3A 2XJ2A 2X0GA 2VTNA 4IADA 2K6DB 2GFCA 5GMVA 2RG5A 4YJSA 1WBWA 3GOEA 2C7MB 2YIYA 3DDQA 3GEQA 4PRJA 4X7QA 3FY2A 3I0OA 3QC9A 1UWJA 2JLDA 4ZS4A 2JKQA 4D55A 3NYOA 2C5LC 5E6OA 1KE8A 5I9UA 4ONAA 5FG8A 2XYNA 3KEXA 3FYKX 1NVRA 1GIJA 2E9NA 2HZIA 2FCSA 3NMUF 2ZM4A 1P14A 4NQKE 4FZ7A 1NVSA 3ERKA 3LM5A 4I0RA 5DRDA 4QMXA 4TYIA 3PRZA 1WXVA 2W7XA 4HXDA 2PVRA 4DF3A 4JBPA 3PPKA 4K9YA 5HBJA 2X2LA 4M15A 2WHBA 4BCMA 5H8GA 1CDKA 3I81A 2I1JA 2JVCA 3H7PB 4F1MA 1UBQA 4BDCA 4NWMA 2ZV7A 1DM2A 4IDVA 5HTCA 4DFYA 3PVLA 3DXPA 2LVQA 3WF5A 4O81A 4X21A 4USEA 2Z60A 2FSMX 2C1AA 4W4YA 5JH5C 2GTNA 1WGRA 1KV2A 3CC6A 3TJPA 3F6XA 3HMMA 3OEZA 1GJOA 2WTWA 4IJ9A 5KBQA 2W1HA 1WRDB 1PXJA 3ET7A 3PSCA 2DQ7X 4PTCA 4GDLA 1PMEA 4YZ9A 5LCKA 4EH7A 3PSDA 3DBHI 4DN5A 2O63A 5J9LA 3OVVA 4G9CA 3P2BA 1RQQA 2VWVA 3UVQA 5C8NA 2JIVA 2UWQA 1UU7A 4K33A 5BX0A 3MY1A 5IUGA 3GCPA 3TJCA 2CS4A 2BKZA 1F3MC 4BTMA 4L53A 1Q1OA 2WIPA 3PTGA 1UNHA 3NUPA 2YM4A 3GENA 2XEWA 4ASZA 3NPCA 4DGMA 2DZKA 4BB4A 1KWPA 4IAKA 4ICUA 3E92A 2V22A 3PREA 1M94A 2WAJA 2CGUA 4ZSLA 4HCUA 1Q61A 1SVHA 5EKNA 4XLIA 4YZDA 3GNIB 3ZNID 5JFSA 1BLXA 1VD2A 5J17A 4TT7A 2BYFA 3FXXA 5CXHA 5LMBA 3V5PA 4IH8A 2C6OA 3VVHA 2RFNA 2HD5B 1HCKA 3WILA 4FA2A 5EH0A 4RVLA 1UGMA 3GFWA 4LMUA 4XUFA 4NPNA 4PL3A 4IANA 2J0MA 2ZM1A 3ZUVA 1UNLA 2LJ5A 4EZ5A 2R2OA 2LWPA 4C02A 3QA8A 2WQEA 2KDEB 3AT2A 3FLZA 3RULA 4UXLA 2XUUA 1AQ1A 3FBVA 4EK3A 1QL6A 3AC1A 4IZYA 5AR5A 3NR9A 3V5TA 3BLHA 2XK5B 1GOLA 4ZK5A 1JBPE 3KB7A 1W8CA 1E8YA 1JAMA 5A4TA 4FJVB 4BIBA 3KVXA 2JBPA 5M4UA 3V5LA 5HO6A 3ENMA 5I4NA 1WJ6A 5HKMA 5A6NA 1H27A 5AUXA 2VUWA 5DBXA 4L67A 2PEAA 5HICA 4PL4A 3P7CA 3A7FA 4HCVA 3BKBA 4GFOA 5IA4A 3VUIA 5AUTA 5TKDA 3ZTXA 4WWNA 3NNWA 5CT7A 5G6VA 4GG5A 2KFKA 4MXXA 5FRIA 1IEPA 1H1RA 3R66C 4FKWA 4L6QA 3RPYA 4ZEGA 1XBCA 4DHZE 2XNMA 4CQEA 4BCGA 2ZNVB 3W33A 2VRXA 5BNJA 4QMLA 2GS6A 4BCHA 4AT4A 4Z16A 4N6YA 4RJ4A 5J1WA 5TF9A 4JRVA 5KKRC 5A4QA 5M4IA 5I3RA 2X4ZA 4I94A 5BVNA 3RP9A 2VWYA 5JK3A 2KWCA 4FTNA 3KGAA 1XD3B 3V8WA 2A5UA 2O2VA 3TXOA 3VRYA 3PPAA 3VUXA 1R0EA 3BU3A 3AU5A 4NSTA 1WJUA 3IW4A 1L8TA 1WXSA 1GIIA 4A9UA 4AJYB 2CN5A 4YBKA 2VWBA 4XCUA 3DQXA 2BHHA 4EH5A 2RGFA 4G11A 4A3PA 1BI7A 3CE3A 3BGQA 2V7OA 2WMWA 4TYHA 2PZIA 1V6EA 3IOKA 2BAKA 2QD9A 5IPJA 1PKGA 1NXKA 3APFA 5IF1A 5IDPA 2WPAA 3SA0A 1PXMA 1UBIA 1J91A 4C37A 3UNJA 2CHXA 2E9UA 4BCJA 2FSTX 4CFVA 4D1XA 4F6UA 4FNZA 3HZTA 4O1OA 3UE4A 1L2NA 2C6DA 2B1PA 4E5BA 2C6KA 5GZ9A 4P4CA 1WAKA 4E1ZA 3W2CA 4FTMA 3H10A 4IAFA 3KMWA 2ZYBA 3S0OA 3AC2A 5HTIA 2X8DA 4CFNA 4RBLA 4MJSB 4TNBA 5E8XA 4JAIA 3MTFA 3NW6A 1KM7A 1M2PA 1R4NI 4FC0A 3KFAA 2KJRA 3LFSA 3EN7A 4L42A 2HENA 3DU8A 5D7AA 4OTFA 2ZV9A 3AC3A 1OIYA 1EF1A 2DZIA 2CPKE 1X8BA 2WMUA 5FBNC 4JX3A 2A1AB 5F9EA 3NOBA 4XG8A 3U6JA 4NKAA 2K8HA 1E7VA 4GG7A 2GQSA 4BDDA 3MH1A 5GJDA 3E3BX 4CYIA 2OF4A 2XZSA 3ZS5A 3PIZA 1DAWA 3S95A 3P1AA 3PRFA 2XA4A 3KK8A 5IA3A 4B99A 4DFLA 4MNEA 3G0EA 5FWKK 3V5JA 3A62A 3NYVA 3W16A 3FMMA 4IAIA 3OG7A 4K6ZA 4AW0A 3LE6A 1AARA 2LI5A 4NJDA 1ZYSA 4FEXA 4DTAA 4DT9A 1NY3A 5IAAC 1E5WA 4FZAB 4E4LA 3ZYAA 2WMXA 5CSHA 4BOZB 2DYOA 3L9NA 4KRCA 4AXAA 4A3OA 5JRSA 2QOBA 1OPLA 3LQ8A 4HWIB 3UYTA 2W4OA 3O2MA 4LRMA 4FT5A 5E8VA 4C58A 4E4NA 2ZMDA 3CPBA 4EBVA 2Y6OA 3CSFA 2BZHB 4UMUA 2N9XA 3E7OA 3PJ3A 2ZCBA 4H3BA 1WH3A 3OXTA 5HNIX 2ITUA 4XOZA 1PXOA 3ZUNA 1NVQA 2XRUA 4DEIA 3ALBA 4UMRA 5FXSA 5FLFA 3JYAA 2N9PC 3AT4A 3WI6A 4ASDA 4S2ZA 3I60A 3H0ZA 3D5XA 3GU7A 3EYGA 4X2NA 3WAPA 4P7IA 3H7SA 3KQ7A 5HX6A 4JX7A 3Q53A 2XM8A 4H05A 4RJ6A 3IFWB 3VS5A 3OFMA 3R7EA 1ZZ2A 2NPQA 1FXTB 3Q5IA 5D2MB 4JG6A 4ARKA 1OKZA 3P7AA 3GU4A 3R7OA 4L7SA 2PSQA 4W4XA 4L45A 4LGGA 2WELA 2L76A 4R8QA 1UZXB 2JPHA 3UIPB 2PUUA 1R78A 1WVYA 3TDWA 2AYOB 4GT4A 2L0FA 3LFFA 1Q8YA 5HVJA 4I6HA 2KO3A 3ALNA 1SIFA 4YJOA 4CFFA 3Q6WA 4IX4A 4MQ1A 3HRCA 3H9OA 1YD8U 2PMNX 3ZZEA 3EN6A 4U6RA 5AADA 3Q5ZA 4QPAA 5D41A 1H28A 3EZVA 2CKHB 1M2RA 4C8BA 3EQGA 3A61A 3ACKA 3G2FA 1Q4LA 4O7LA 1WJNA 3I79A 2C6MA 1E8WA 3HYHA 4L68A 5HLWA 3IG7A 3V01A 1J3HA 4I24A 3OD6X 4DFUA 3E8EA 3EZRA 4EFOA 2RFEA 3QYZA 4E71A 2C0TA 4AF3A 2UVZA 3PLAE 2O65A 1OKVA 4JG7A 4O0RA 2PWLA 4BTJA 4PS8A 1VYZA 5E1EA 4XP0A 2V0DA 3EHVA 4PTEA 3C5IA 3RAWA 5J7HA 4NKSA 4FSMA 4NU1A 3LFEA 5TOZA 3PXKA 3Q32A 4UXQA 4ZLOA 3KU2A 1YXVA 3T3UA 3IGOA 3K9PB 4G5PA 4O0VA 4II3B 2Y7JA 5CHWA 4BF2A 5CEIA 2HCKA 3DY7A 4BY9E 3SDJA 3QQKA 1WGDA 3AI5A 4FNXA 5HIBA 2CLQA 3O23A 1OEYJ 4ZRKA 3VC4A 4DGLC 3U87A 2CDZA 5IA2A 4YSJA 2X6EA 1BL7A 4F64A 4ZYNA 3HDNA 4O2ZA 4U40A 3P0MA 5JEBA 3QC4A 4LRJA 4CSVA 2OXXA 3DJ6A 3OXZA 5EDSA 5CTPA 2LRUA 4DHJD 4QMMA 3Q3FA 1KJTA 3KXNA 1ZARA 1CSNA 2XEZA 2XNEA 4GKHA 2G9XA 3A2CA 1UWHA 1XQQA 2R3GA 4TKSA 2BKKA 5LMKA 3ROYA 5FTOA 3OT8A 3DVGY 4D4SA 3L9MA 5DR6A 3JY9A 3PLSA 1IR3A 2FCNA 3LXPA 3SG8A 1G5SA 2KXJA 4ANOA 2OICA 4X3FC 3PRPB 2KWVB 4NCTC 4KS7A 5HEZA 4E6QA 3OJ4B 2M4NA 5JRQA 4UY9A 3H7PA 4WKQA 2R64A 3D15A 3EWHA 2Y5BB 3C9WA 2PVLA 3DB6A 3AMYA 2RIOA 4WJNA 3MFUA 5BMMA 4IZ5A 3RYTA 5IMXA 4AZSA 1WMKA 3R04A 4IIRA 1YIWA 4BDEA 2KULA 3LMGA 4RJ3A 4YGAA 3L54A 3QZIA 5EI6A 5M57A 3I4BA 4L7FA 2BUJA 4F09A 1Z57A 4MXYA 1EUVB 4UZHA 5ETAA 3RAIA 5M4CA 2KQ7A 5AIRA 4K11A 5KHXA 2I0YA 4HPMB 1G3NA 2OWBA 2J0IA 4K7UA 4QMVA 1H26A 3EN5A 3PZEA 3VVWB 4I6PA 3UIOB 2ZEQA 3TACA 2DAFA 2XK6A 4TWCA 4TYEA 4FX3A 1PRYA 4F9WA 3EH9A 3T8OA 2JDSA 4FSWA 5A3XA 4QPSA 4KWPA 4GVAA 4Y85A 3FMJA 2M17A 3O7LD 2YJRA 2P55A 4M97A 4RJ8A 1UU3A 1YHWA 2O8YA 2GNHA 3ZONA 4RZVA 4BCKA 2V55A 3UMXA 2WEIA 4MXAA 4GW8A 5AP4A 2X1NA 4XOYA 3QF9A 2QLUA 2F7XE 2GTMA 5AUVA 4AP4C 2QONA 4CYEA 4R7HA 2N7EA 2VX0A 3ZC5A 5KMMA 3FKLA 4GOCA 2IW8A 1U54A 4GMYA 5DVRA 3D5WA 4DWFA 3R71A 2ITTA 3PUPA 4BDIA 1T0YA 3TDVA 4MBIA 2IO0B 3DBEA 4JGHB 3V5QA 4AAAA 2B9IA 3TKUA 3QRJA 4G6LA 3SU8X 3HKOA 3OOMA 2NBWB 4DGNA 2QG5A 3R28A 4RJ7A 3NLBA 5ACKA 2I7QA 5EHYA 5JQ5A 3K2LA 4EHEA 3FC2A 4RRVA 4Z3VA 4BVUA 3FKOA 2C6EA 2BKFA 1W98A 2B0QA 4O2PA 3A7JA 4WQOB 2W5BA 4GRBA 4LG4A 1PXPA 2YJSA 1J1BA 5B2LA 3HA8A 5HQ0A 2P33A 3CQUA 2W5AA 3UZTA 4AZEA 4TZRA 2BROA 2XK5A 4NW6A 5IZFA 3REPA 5J87A 2R3OA 3NZSA 4BI1A 5LJJA 4D28A 2XM9A 2QO2A 2WO6A 3U54A 5H9BA 4BBNF 3BHVA 4G9RA 3VF8A 1TQPA 3TTIA 5TR6A 4H58A 4K1BA 3L08A 4EOMA 4ZY6A 3WIKA 2OXDA 4DEBA 2CMWA 3AXWA 3NUUA 4J96A 4FTAA 2LGCA 4EH6A 4ALWA 4H36A 3WF7A 3RCDA 4UB7A 3SHEA 4XX5A 3MDYA 4CT1A 3V8SA 5HOAA 2MQJA 2UW3A 2XJ0A 4FV2A 2O3PA 4U79A 2GS2A 4YO4A 3GP0A 3PJ2A 3GB2A 5FEEA 4BCFA 2W96B 2EMSA 2JITA 4R3PA 2KOXA 4FVRA 4BOSC 5M56A 4I22A 1FMKA 4BGQA 4WWOA 3RD2A 3PPZA 4EHVA 2C7NB 3BZ3A 2QOCA 3ECIA 1WJ4A 1ZW7A 3DJ7A 1KE9A 3FUPA 2PE1A 3WYYA 4MHAA 4FZ6A 4AOTA 3KREA 3R8PA 2A4LA 3QD2B 2BPSA 2F9GA 4B7TA 3FL5A 5EW3A 2VU3A 3VUKA 2PUNA 3H9FA 3EL7A 4GK3A 3QCQA 5C1ZA 5E6NA 1AD5A 2YFXA 2W0JA 4K2RA 2PL0A 4GSBA 3RVGA 1BKXA 4PPAA 4AGCA 4G2FA 2IVSA 1MRVA 3BQRA 3VRZA 4C7TA 1YWNA 4KAOA 2FO0A 2VWXA 2XK4A 5IISA 4E7WA 3S1HA 3CJFA 3DVNU 4I0SA 3D14A 4HYUA 1P2AA 1S1QB 2GNLA 5EW9A 2VX3A 2VTPA 3IO7A 4XV9A 4DHFA 3RPOA 3QD0A 5C8KA 1VJYA 3P23A 5H8BA 5IG1A 3Q9WA 3OY3A 4IWQA 5L2WA 2WTCA 2W1DA 5HIDA 5AV2A 5IEXA 4ZJJA 3JPVA 4WG5A 5EQPA 1ZY5A 3NUSA 5EQEA 4IVBA 3ANQA 2IBIB 3QX1A 3LVPA 1WYWB 4GH2A 4W9HA 2ESMA 4ANMA 4BDKA 3E8NA 3WAMA 4ZLZA 2OBJA 2PUPA 4MJSA 3L9PA 3MIYA 5GJFA 3PXRA 4AQCA 3B08A 2RFDA 3OAWA 4AJWA 2X7GA 3NAXA 4FIGA 1W84A 3DK7A 2OKRA 4BIEA 4ZIMA 3Q4UA 4DE4A 4A20A 4G16A 5FM2A 2W9ZB 4Y5HA 3DVGX 2BAJA 3CR0A 4BDBA 1KE6A 5BO4B 1FGIA 4ZTRA 4D4YA 4Y95A 1LP4A 1Q8TA 3PG1A 2JFMA 4Q5HA 3QA0A 5GNKA 1IAHA 3TJDA 3V51A 1BUHA 3D4QA 4IVCA 2WQMA 1ZKHA 2CKEA 2DS1A 4AW2A 1OKWA 2QVSE 2IO6A 2XIKA 3CBLA 2RR9A 3ZLXA 3LJ3A 5CQUA 2G3QB 2CKPA 3QZHA 1Y8YA 3NEWA 5HD4A 4PPBA 2JKOA 3KN6A 3QLFA 4YLJA 4X2JA 3R2YA 3BPRA 3DAKA 3Q6UA 4P5QA 3KXGA 4FV4A 3GCSA 3QL8A 3C4XA 5CT0A 2KD0A 3C50A 1QPEA 4KS8A 5JGDA 1W83A 2KMAA 5FBOA 3T3VA 5C4KA 4IQ6A 3K5VA 4NW5A 2QLQA 4D2RA 5L6PA 4D0XA 1SVGA 1FVRA 3TWJA 4ANXA 4YTFA 1I09A 4EYMA 4AACA 1OM1A 3WZUA 3IQ7A 4YHTA 3W8LA 4QMYA 3BYOA 4EI4A 1GNGA 3SVVA 1JKTA 4WG3A 3MN3A 4RFYA 3V6SA 3BV3A 4G34A 4R1VA 4ZTLA 5AV4A 5EHOA 4BDHA 5L2IA 1WXAA 3D7ZA 2LRWA 1P1AA 2BFYA 4O7ZA 4E20A 4AU8A 4G5JA 5JH6A 1ZOGA 2R3QA 4WOVA 3EQFA 2KVRA 3LCTA 5CSXA 2CLXA 3OW4A 1B38A 3F2AA 3TUCA 3QIJA 3VUGA 5K0KA 4ALUA 4YL8A 5HI2A 4NL0A 5HIEA 4CFWA 5G55A 3QU0A 4X2GA 5TR5A 3PT2B 2BZKB 3BBWA 4QMZA 3QQHA 3HV3A 4F63A 4ACCA 4UWBA 2LVOA 4RLKA 2IYDB 2YHVA 3OROA 1Q62A 4BTKA 1SNUA 2B3AA 4YJVA 4W8DA 4QPMA 2XBJA 4HPLB 1W7HA 4YZBA 1Q8WA 3VTUA 1BYGA 5ICPA 4W9KA 4F6SA 4D2SA 3UQBA 2YDJA 3U9NA 5TE0A 3UP2A 2ZDUA 5H2UA 2O6VB 3HNGA 2ERKA 4ZXTA 2RPQA 5HX8A 3BWJA 4K77A 5CS6A 2R4BA 3CSTA 1E1VA 2UZNA 2R9SA 4MBJA 4BDGA 1CTPE 4BR3A 5AP1A 2J4ZA 4NK9A 2PVKA 3VXWA 1OPJA 1IRKA 4YC3A 3RPSA 3ZO1A 4M8TA 1V0BA 4DG3E 4KKEA 3IOPA 1WFCA 3PS6A 4J8MA 1SMHA 3C4WA 2X9FA 3MH3A 2WMQA 2UZUE 2YM3A 3MA3A 2ZAZA 3UOJA 5C03A 4FKPA 3F2RA 1ND4A 3U4UA 1J7IA 2W1ZA 1VYWA 3FI3A 4FN2A 4RVMA 2W9NA 1IASA 4OBPA 4HCNB 2WTKB 3UIMA 3CS9A 2JT4B 3DB8A 3CGOA 4JVGA 3A9JB 2XBBC 3F2NA 4MXOA 3U6HA 2OJRA 1E9HA 4QQJA 2KLCA 3QKKA 3DTCA 1LR4A 1FVVA 3LQ3A 4PYUA 1PJKA 3K5UA 3PXFA 3QTWA 5CAVA 3DCGA 5CY3A 5IQDA 3ZW3A 2B55A 4BCQA 2Y6MA 2PMIA 2ITOA 3D2KA 4QYFA 1BT0A 4DEEA 5AR4A 3FMEA 2WMBA 2J7QB 4ASWC 3MS9A 4QT1A 4RX5A 2Q83A 2YDKA 3ZVVA 4KSPA 4MD8E 3EL8A 3ZHPC 1Q97A 1GC6A 3TNIA 2JRIB 4E6CA 3UIXA 1E8ZA 2OFVA 1VR2A 5F94A 3QCSA 4EHGA 3E3PA 4CLJA 3DJ5A 3VUMA 4DG2E 2KJHB 2FUHB 2JD5A 4PY1A 3VS2A 4NM7A 4FTOA 3QGYA 4MGKE 3FL4A 1OBGA 4CHKA 4G0NB 4FOCA 3VBVA 2BTSA 3KY2A 3K9OB 3RHKA 3OT3A 5DT0A 2QI8A 3DKOA 1H24A 1H1QA 3CXWA 3CKWA 3BBTB 3C7QA 4ZMFA 3II5A 3FEGA 4YJQA 1J0GA 1H0VA 2QCSA 4MXCA 5IU2A 2E9OA 3ELJA 1Y6AA 1OEYA 4OGRA 3ZIMA 1PXKA 4HNFA 3NIZA 3P9JA 1WX9A 2H9VA 2WIHA 4I6NB 4O7WA 4ZZNA 4IWPA 2R3HA 5J2RA 3LCDA 3SRVA 4JDIA 1OZ1A 3TNPC 1G8AA 2VWZA 4ASXA 2X7OA 4WUAA 5JT2A 2JRHA 4JAJA 5KX8A 3QHTA 5CALA 3S4QA 1WX7A 1ZMVA 4BKSA 3FPMA 2VO0A 5BUEA 4UX9A 4ANBA 4FF8A 5HBEA 5H3QA 3FKNA 1CMKE 4BWKA 4QMSA 1PQSA 4FTCA 5CEPA 2R3RA 4BFMA 2FCMA 2C5NA 3HMOA 1QPJA 3WOWA 4U97A 4I21A 5I9VA 5KCVA 4GIHA 3HMPA 4F99A 2C30A 1XWSA 5AZHA 1YHSA 3T9LA 4QP4A 3KCKA 2OJFE 1IG1A 2R3JA 3KF7A 2FIDA 1H4LA 5D9HA 4BKGA 2ZCCA 4ZP5A 2R3KA 5E8UA 1SNXA 4PL5A 4U80A 1Y8GA 5HG9A 3NAYA 4GKIA 5J79A 3H9RA 4YTCA 4GJ3A 3NRMA 1I35A 2IY1B 3R73A 1IYFA 2B53A 4CV9A 3RK9A 1NW1A 2BWFA 2EXMA 5HG5A 3AMAA 2PZRA 4FEQA 4OVVA 4O0SA 5M4FA 1PXNA 5HU9A 3KRLA 5B7VA 1OMWA 2XH5A 1FINA 2C5OA 3WARA 3D94A 1ZGUB 3TIYA 1XH8A 5AR2A 2KFKB 3RCZA 3ONSA 4HDOA 1NDDA 4HYHA 4XYFA 4FSNA 2XK3A 4EYJA 5G2NA 2QNJA 1H8CA 5CHFA 5HVYA 5AIKA 3C4FA 4P2KA 3GCUA 2PULA 3MV5A 2DZJA 4P7EA 1S9IA 4BZNA 1J19A 3DDCB 4JR3A 4CZTA 3ORZA 4LMNA 3RZBA 3NY5A 3DDPA 5GHVA 4WO5A 3D2IA 3RWQA 4TUUA 3MB7A 1XH5A 3ZMMA 5J7BA 3CPCA 4YLKA 4KV2A 1YDTE 4NQLB 1V86A 1A5RA 2VTRA 2G2FA 2KC1A 2VTMA 3VS6A 1A06A 2ITVA 4AUQC 3LLTA 2Y9QA 3CF6E 2JWZA 3F7ZA 3EKKA 3O17A 2J5FA 3KULB 2V1YA 3UF8A 4X2KA 4C36A 3EIDA 4PMSA 5LMKC 3IGGA 3VW6A 4M13A 4WBOA 2D07B 2ITZA 3SXRA 3WE8A 3VBQA 2KDFB 5F95A 3VJOA 3TUDA 3LKMA 4FV3A 4EORA 5AAEA 4C57A 4UYAA 4O7YA 3TG1A 3KVFB 5JKGA 4TNDA 3DAEA 3ZTCA 5JSMA 1FOTA 3R7QA 5JGAA 2K39A 1H8FA 1O6KA 1WF9A 4TWOA 2JKMA 1TKIA 4CT2A 4LYNA 4Y72A 4XP3A 4FT3A 2HK5A 3DBRI 3LCOA 3EECA 2QOLA 5FEQA 5IEYA 1CKPA 4FTJA 4LUEA 4IB5A 4U81A 3ALOA 1UH6A 3QTZA 1HE8A 3MH2A 4ASEA 4NH1A 4USFA 4EOLA 4F4PA 1EO6A 1YDSE 3SQQA 3F9NA 2BCJA 4DXAB 2BRNA 5C01A 4MH0E 4EOOA 2HAKA 4TQ0A 1GZKA 3CQWA 1SVEA 5CXZA 3UZRA 3RNYA 4EUUA 2BYVE 4XV2A 3X23A 4X0MA 4FA6A 1WVWA 4RIYB 4YHFA 3E8CA 1P98A 4CCUA 4LL0A 3GCQA 4BICA 3A8XA 2C7HA 2OIDA 2V4LA 3EN9A 3CSVA 4EH4A 3CTHA 5AJQA 4O21A 4MD9E 1YI4A 3FHRA 2Z7QA 4YUQA 2BDFA 3V60A 5D7VA 5GIOE 1P9DU 4IWOA 2KDIA 4A06A 4QMQA 3FSFA 4C4JA 5DH3A 4Y46A 2OIQA 4D5HA 2GOWA 1NBFC 4U8ZA 4BKYA 2ASQA 5AR8A 2N9EB 4I41A 3VHKA 4C4HA 4CYJA 4CQGA 4WUNA 4FG8A 3R7YA 3PZHA 1V1KA 4JT3A 4NFNA 5AEKB 2NP8A 4BCIA 5ETCA 4HYSA 3A9KB 3TV7A 2O64A 3WAOA 3IBEA 5T3QA 4LUDA 4O91A 4OTIA 2XIRA 4MK0A 2C60A 3VS7A 1JSVA 2I1KA 3LJ1A 3AG9A 2V62A 4FHJA 5EI8A 2RSVA 2KWUB 2MBBB 5CTRC 2NRUA 1XT9B 1WBPA 2WMAA 3TCPA 5D12A 1XQZA 3UOKA 1WI0A 4I5HA 3MIAA 2XBAA 2WYQA 4YMJA 1GJZA 2BDJA 3VTVA 2PU8A 4FYNA 3HAVA 1JSUA 1AGWA 2VTOA 4BVUC 4QMPA 4HVIA 4J8NA 3UNKA 5E8SA 4DK5A 3AXCA 4L8MA 3DBLI 5C1QB 4HDQA 3BRBA 5KUPA 3L16A 1UA2A 4JDHA 4IZAA 4FULA 1PMNA 3KKVA 4TYJA 3AC8A 2KN5A 4NNJB 5BUIA 1GZOA 3EFKA 3U8WA 4ZSEA 3V6EB 5CNNA 3QQGA 4R5SA 3BEGA 4G3EA 2P2HA 3WBLA 4EZ3A 4BBNC 5B2KA 4W9FA 4O7TA 3MB6A 4C4EA 5CYIA 1YWRA 3P5KA 2VGPA 3KL8A 4ZTNA 4O38A 1ZMUA 2C3IB 3LMIA 5E7RA 2VRRB 3O50A 2J5EA 3LQ5A 2WX0A 4QMNA 3IS5A 2YISA 4UBAA 1WY8A 2AWTA 4AOJA 3ACJA 3F5XA 4A9SA 1PW2A 4FUYA 1KUTA 3QXOA 3IW7A 5GJGA 3RHXA 2RF9A 4Z55A 2REXA 2ZNVC 3R8UA 4KBCA 3O8PA 4FVQA 4J7BA 5LXMA 1OL6A 2XNGA 3R9DA 2MCNB 4FTUA 5I9YA 3M3JA 5BVOA 3NUAA 1REJA 2RKUA 3C4CA 4CCBA 3VBTA 5E6PA 2OW3A 5JZNA 4JQWC 3SV0A 4IFGA 1YKRA 3PY3A 3KUZA 2UW9A 2K6QA 1U4AA 3BELA 4YO6A 4NJ7A 5H8EA 2ITXA 2ZB0A 3M11A 3R8ZA 4RX9A 1OVEA 3VTWA 3UODA 3MJ1A 3CY3A 2XCKA 1W82A 4RWLA 1WM2A 1O9UA 1YQJA 2PK9A 4C4IA 1BMKA 4M3QA 1WR1A 2IJMA 2CGVA 2YITA 3R8VA 3WANA 3ZC6A 4EKKA 3B8RA 1JQHA 4F65A 1DAYA 5DLSA 4CO7A 3G90X 2B9FA 2YIQA 3IDCA 2O2UA 1SE9A 2BRBA 3R1SA 4B0GA 4YJPA 3R8MA 2O6VA 2Q0BA 4MEMA 2JGZA 4TV3A 3MTLA 4JBVA 2OZAB 1V81A 1O6YA 4QP3A 1Z5MA 2KDBA 3CMMB 4FADA 5E91A 3DS6A 2FUMA 4CRLA 4F08A 4HVDA 3ZNGC 3APDA 2X81A 1H1SA 4DTKA 3U6IA 4TY1A 3KYCD 4FSUA 2N1VA 1WCCA 3A99A 4GK2A 2DYBA 5KO1A 3MBLA 5CAQA 3PY0A 3RCJA 1X1MA 4JIOU 4M8NA 5ANJA 2GQGA 3OOGA 5DT4A 5ANGA 4FBXA 3EFJA 4EEVA 1GZNA 4RC2A 2KJ6A 4BRXA 1E90A 2KX0A 3FZSA 2J2IB 5JZEB 3L1SA 2X2KA 3ML8A 5AA9A 3A9JA 3ZXZA 3JVSA 3NIEA 5KMLA 1Q0WB 3L9LA 3S3IA 2JIIA 2DX5B 4AW1A 3RK7A 2ZV2A 5M55A 1D3ZA 3RBWA 1H1PA 5ANDA 2DYMA 5IA5A 1J1CA 5CSWA 5L2QA 3L8PA 4ZS0A 4ERKA 2WTVA 4HJOA 4C2VA 1LM8B 4IFCA 4ZDVA 5LMAA 4S32A 1V0PA 4GFGA 1XH6A 3DFAA 4DHZB 1U59A 4RG0A 3LW0A 2AC3A 4IAZA 2BZIB 4UWYA 4S31A 2QODA 4MVFA 3F82A 4ACGA 3UIBA 5A9UA 3FSKA 1RW8A 2LZ6A 3GU5A 2F7ZE 2FIFA 3ZDTA 5CVFA 5AM7A 5CU2A 3ROCA 4NJ6A 3RT3B 5FXQA 4B8LA 3FHIA 4EWHA 4F0IA 3DKGA 1M2QA 5LCJA 3PXZA 4Q9SA 4F8CB 3N3KB 3JY0A 3V04A 1P4OA 1WZ0A 3MVMA 4KKGA 2KK8A 4RGJA 1R39A 1FBNA 1GUAB 5IH6A 4ZSAA 3W1SA 2LUEA 4F1SA 4TRLA 3BINA 4OT6A 3RK5A 4AP7A 2N1WA 3KXXA 3TKIA 3E87A 4DH5A 1Z2MA 2WTIA 5F4NA 4DEGA 2RFSA 2OXYA 3GVUA 3MVHA 5AMNA 3CP9A 4FV1A 3T9TA 4O86A 3VS1A 4FVPA 4JR7A 4HPUE 3WZJA 2BILB 5TO8A 3ATSA 2EB3A 3TN8A 1U54B 2E9VA 5DPVA 4EH2A 4DAWA 2AYPA 4NIFB 2W17A 2NPTB 3LCKA 5JFXA 4WA9A 2GQRA 4M66A 5AP5A 2GNIA 3KXMA 3RJCA 2WMRA 2Z7LA 3I5NA 2RG6A 4ERWA 2HWPA 4F0FA 4QTCA 2A4ZA 3FLWA 3L10B 2KKCA 3N32A 2HXLA 2HZ0A 4EJNA 3ZUTA 1JOWB 3QKLA 1TZ1A 4IC7B 3RUIB 1Q3WA 1A48A 4U45A 2J6MA 3DT1A 2GMIC 2HZNA 4GIVA 4EOYA 5DGZA 4QQCA 4I1ZA 4LV5A 1IA9A 5BMSA 5A4CA 4TWNA 4AUAA 2HWOA 1C1YB 3AC5A 1QPDA 2WD1A 4QTAA 3ZLWA 3I3TB 4FEWA 4BDJA 1XHAA 1YHVA 2YVCA 4GU6A 5CNOA 5KHQA 3AGLA 4DC2A 3H9DA 5LLIA 3QK0A 1WGGA 4F9CA 3A8WA 2ZVOA 4KIPA 3QALE 2IVTA 4BZOA 4RFZA 2GS7A 4XV3A 4EKLA 2VTIA 5HG8A 4KBAA 2WU6A 4G3FA 2OSCA 3A60A 3ZFXA 4ZY5A 3QRKA 2EB2A 3TM0A 5IDNA 3Q2JA 4NYEA 4DHJB 5EM8A 2PVFA 2FGIA 3C5UA 3R9RA 3DGKA 2YCQA 3WZEA 1R3CA 2LVPA 3PP1A 5IQIA 1MP8A 2MLBA 3A4RA 4DBXA 4OTGA 3QQ8B 2NR2A 2REIA 3MVLA 5A54A 4ORKA 3QGWA 2IZUA 2IZTA 4QP8A 2XCHA 1YQBA 3FJQE 3FLSA 1YXXA 4FYOA 3DLSA 2ZMCA 5AA8A 1WE6A 3NW5A 3KULA 2MRPA 3SAYA 2UVYA 2ZDTA 5DR2A 5IQAA 5CU4A 4TYGA 4J6IA 1Q41A 3ORKA
chains in the Genus database with same CATH superfamily
4FG7A 4QO9A 3R7GA 1JWSD 2CNQA 3V5WA 5CSPA 2X9EA 3VULA 5BMHA 4AQ7A 2BMCA 3WF9A 5ACBC 5HG2A 4AZWA 1ZOEA 1TS2A 1YN4A 2EXEA 5JQ8A 1UKHA 2K0PA 3HP2A 4GT3A 2OJGA 2R3NA 4FKSA 3OWJA 2PMLX 3COMA 3TNHA 3NZ0A 1JKLA 2QOIA 1TZOA 3E7VA 3U55A 3QARA 4NJ3A 3EFLA 4HNIA 2CN8A 2QIEB 4M7IA 3ZO2A 2NBVB 5DEWA 4M0YA 2E9PA 3Q3BA 3PE1A 4PPCA 2INDC 4DFXE 3KMMA 1ZE3D 4GUBA 3W1YA 1F0ZA 2KFJA 4FEUA 3Q9YA 2I1MA 1FRDA 2J52A 3H1UA 4CFXA 4C35A 2YZLA 2OEDA 1I4QA 1R4MI 4V0GA 4XV1A 4TQ1A 1APME 1I44A 1NEKB 2UZBA 3CCNA 4XG4A 3Q8BA 3MC0B 2YIWA 2CKOA 2G4SA 4NJCA 3BHTA 2NYAA 1NI2A 2QOHA 4RVKA 4GV1A 3W32A 1ZWSA 3MFRA 5L6OA 2VO7A 2G2HA 4RIYA 2OF2A 3ODYX 2QO9A 3KUDB 3RALA 3R9NA 4YTIA 2XMYA 3O7LB 4Y5QA 3MHSD 5CVHA 4QP9A 2ITQA 4EK8A 3QTRA 4OT5A 5HTBA 3EN4A 3TV6A 1OB3A 3ZM4A 4XDCA 3A4PA 5KBRA 2OHFA 2ITWA 2OGVA 1Q5KA 3C13A 4M84A 3PRMB 1GC7A 2Y3AA 3I7CA 3S2PA 3ORLA 2KC2A 4MEDA 2I2YA 4ZZMA 3HM3A 2JDVA 4UWCA 2VAGA 2OFUA 2CNUA 3COHA 5L6WL 1SEBD 4C7ZA 4EQUA 2JF5A 5JGBA 4MD7E 4Z7GA 3EYHA 2FA2A 4EOIA 2WQYB 5AUZA 1PMVA 2VD5A 1K52A 3EQHA 4MKCA 1HCLA 4W9JA 5AX9A 3RINA 3C1XA 3NNUA 3FILB 3A9KA 3ENEA 5DYJA 4LOQA 1VZ6A 4WIHA 4YJNA 1ZXIA 1OIQA 5BVEA 5E8YA 2GNGA 4C59A 4A4OA 1KE7A 4EONA 4N70A 4PV0A 1R7SA 3NS8A 1CKJA 4K0YA 3UZPA 4X3JA 3RNIA 1DS5A 3R7UA 3WE4A 2B52A 5LWMA 3R83A 2O6VD 1QOGA 1ISNA 5LNK1 1XH9A 4F78A 4E6AA 2RGPA 4V05A 4MGIE 4L9IA 2L7RA 5K0XA 5DPSA 5EG3A 4BHNA 5HCYA 2F57A 1VCBA 4YC6A 4MX9A 3UO6A 3GOKA 2QHMA 2BDWA 5AAFA 3FPQA 4FKQA 2AQ3B 1JSTA 3U7DA 3QFVA 5ITAA 5EYCA 2WDTB 1TS3A 4V04A 5EQYA 3F3ZA 3FY0A 4NEUA 4YTNB 5AP2A 2IN6A 4C4GA 2FSOX 3PG3A 3QQUA 5DN3A 2N4FA 2W1FA 2KTFA 5E8ZA 5FQDC 2L00B 3VO3A 3W9CB 1XMMA 4BBFA 4MGZE 1LQBA 5FM3A 4DGGA 3MFSA 4EOKA 3F66A 2VO3A 4O4CA 4DGOA 2KNBA 4U3ZA 3RNEC 2JAMA 2OU7A 1OGYA 4EEWA 1M52A 1B6CB 3QRUA 4BCNA 2WHIA 2BZJA 4W9IA 3GZNB 2QSDA 2RDBC 4U7ZA 5FK9C 1YXUA 3CTJA 5C8MA 2YIXA 5FR6A 4YR8A 1V1PA 4OAVB 1OQYA 1DOIA 2FCQA 2D3GA 2JAVA 3AEAB 3OJ3A 3TZ8A 3A4OX 3LFAA 3LXLA 3BLQA 3O0GA 3BIZA 5H92C 3UGCA 3DK3A 3E63A 4BCOA 2PE0A 4O0TA 5I9ZA 1H0WA 3EB0A 5EM6A 1J8CA 5HG7A 3SXSA 3UVPA 4A4LA 3B2WA 3VBYA 2HY81 3FI8A 3W2RA 2UW6A 5CEQA 3JUHA 1ZOYB 2J4XA 3VUWA 1RYJA 3LDZE 3G15A 4Y73A 2WXKA 4XG3A 4H39A 5HLNA 1WGYA 1P5EA 3TEXA 2UVXA 1Q10A 4M14A 3W0RA 4URKA 5A4EA 2CGWA 4A4XA 3SW7A 3MJ2A 4ZTHA 3PIXA 3RNAC 3WIMA 3DA6A 5HE1A 2IEWA 4BGGA 4G3DA 5BYYA 4HW7A 4YP8A 4QOXA 5DPWA 2PE2A 5JFWA 1Y8RC 5DCNA 4EBWA 2ACZB 4LFIA 4KRDA 2QR7A 3EFWA 1WBOA 2TSSA 4IXPA 1YW2A 5DEYA 4FV6A 2UZEA 4U5JA 5EDRA 3AD6A 4RPVA 4DDID 1JCKB 4BTFA 2G01A 2Z2WA 4YJRA 4O7SA 3M42A 4ZTMA 4N9F4 4R6VA 3JYUA 3PPJA 5EOBA 3UPZA 1S9JA 5EYMA 4J1RA 4YBJA 3SW4A 2I0VA 3VUHA 4BGHA 5K5XA 2IPKD 4M12A 4HROA 1OUYA 5CI7A 2C69A 5BVWA 2G15A 4FNYA 2GPHA 1U46A 4YPDA 3K3JA 4Y83A 2DYLA 4AN3A 5FKAC 4FKLA 3KWLA 4MACA 4GYGA 4HKZE 1ATPE 3M62B 2YERA 4XEYA 3ORNA 3R7RA 3JVRA 1Z5SB 5AUYA 2OZAA 4I3ZA 1YOMA 1KSWA 3X0WA 1F1HA 2CCIA 2HW6A 4QP6A 1IP9A 4IAAA 3VQUA 4LCDE 2QOOA 3LHJA 2VTTA 4RJ5A 4FV5A 2C5VA 3QX4A 5IH4A 2VN9A 3UYSA 3LFDA 2MX2A 1Y57A 2PHKA 5FR3A 4F9YA 5JZJA 2LAVA 3NNVA 4CQNA 2QR8A 2DENB 2YLFA 4B4LA 3L0WB 3U4EG 4C3PA 1U5RA 3ZO4A 3OS3A 4LV8A 1LXDA 4IVDA 1WRIA 2VTHA 4S34A 5FP6A 4XJ0A 1MPEA 1WM3A 2BFXA 3SOCA 3NX8A 2GBRA 4BL1A 2CNVA 3AEFB 4RGMA 3O13A 2BVCA 1Y91A 2CHLA 4D1SA 2GHGA 3B9JA 2M0XA 1URCA 3ODZX 3UG2A 2MEKA 3DOGA 3UINB 3EOCA 5CVGA 4XHKB 3GQIA 3VUDA 1P7FA 2PVGC 3QBNA 3LXKA 3E64A 5E1SA 1P4FA 3VDZA 5C23A 2OJWA 2H88B 4GLSC 4HVHA 3BE9A 3VQHA 4FHKA 1XH7A 1V5TA 1RLFA 4CRSA 4TN6A 5DOSA 4AGDA 1XLOA 3V6RA 3TNWA 2XIXA 1FO4A 5FUTA 4PDSA 5FTQA 4O7NA 4DG0E 2JIUA 2MW5A 2BYEA 3W0SA 3F3VA 4JDKA 3IW8A 4FIEA 4FTQA 3QX2A 4MXZA 2BYTA 2J0KA 4DHZA 3LPBA 1S3SG 3HAMA 4QYHA 3GC7A 1ET9A 1H25A 4K18A 3DLZA 5HBHA 3FLNC 3C0HA 4I6FA 5J9YA 4KGSA 1LUFA 4MT5A 2W9FB 4ZTQA 3SRVB 1V9JA 5E8WA 3AGMA 4NTSA 4XX9A 4ICVA 2GCDA 4X6QC 1M7QA 2F2UA 5TT7A 4WH4A 1E8XA 3RAHA 2C5XA 1M7NA 4MSMB 4LDTD 3ITZA 1YI3A 4IAYA 1L7YA 4IM2A 4O7RA 5CANA 1EM7A 2IVUA 1NA7A 4ZSJA 2DNFA 2R0IA 2ITNA 3RGFA 5CENA 3AKLA 4YZNA 3O5AA 2L1AA 4C62A 3UOHA 4OTQA 2WMSA 3NWWA 4M8MA 3RNBC 3QWKA 3D83A 1HOWA 4KDIC 5H8YE 4AE6A 4TPTA 2C4GA 2ZZPB 4CFMA 3ZLSA 5CAPA 1ZXEA 3UC4A 4FKIA 4GU2A 5BYLA 4FTRA 3Q4CA 1F5QA 5AWMA 2JY6A 2V7AA 3GQLA 5J1VA 4B95A 3G6HA 4RCOA 2ONLA 1HXYD 4IM3A 3CTQA 3EKNA 4DCEA 4M0ZA 2WKMA 3R0TA 4I92A 2XIYA 4DFBA 4P6VF 2B7AA 3ZRKA 5L8KA 5EK7A 4NTTA 3TEYA 3QTXA 3WF6A 4BBEA 2WQOA 4M68A 4OTWA 1IPGA 3LOKA 3FLYA 3RNGC 2J0LA 4B8MA 1AWDA 1UGJA 1W2FA 3IK3A 4YC8A 4ZJVA 3I7BA 5A6OA 5C2TB 4NIFA 3R00A 4JRNA 2NPTA 5FXRA 4ZRQA 3I1AA 3LM0A 3VS4A 4AOFA 4QTEA 1LFDA 1W0XC 3R63A 5AFVA 1ZUD2 2M19A 4GK4A 3ULIA 2NCNA 3BK1A 4DFZE 3C51A 1E7UA 1FPUA 3A7GA 4YSXB 2C3KA 4W9CA 3JW0X 2I6LA 4D9UA 3P08A 3MY5A 4O83A 2WXGA 4E26A 2WNTA 2Z7SA 1ZOHA 4G3CA 3JVZX 2D11A 3GU8A 4O4DA 3Q04A 5M53A 4YNOA 3FQSA 2FYSA 3HVDA 4RF1A 3IG3A 3NFFB 3PA3A 4WNPA 2MP2B 2MSED 3HGKA 4IC7A 4IM0A 2QOFA 2GDOA 5E4HA 3HDMA 2IZRA 2UW7A 2VTJA 3QD3A 5IQFA 4E4XA 5HCXA 3CJGA 2XKCA 2Y4IB 1H08A 3AE2B 4UZDA 4E4MA 4JI9A 3S00A 1QOBA 5M08A 1GG3A 3U52E 4WD5A 4O0WA 5KZ0A 2WZJA 3IVFA 3L17A 1CKIA 5D6JB 4RWKA 4EJ7A 4GDKB 3U8ZA 4O6EA 3VNTA 4OVUA 2R0UA 5HESA 2KAJA 2GSFA 3BHHA 3PIYA 5GXGB 4EH8A 3BY4B 3U7ZA 2OZOA 4KINA 5AUIA 3FYJX 2AL3A 4YSZB 3DAJA 3CD8A 4AQKA 4IJPA 2WU2B 3HRBA 2RD0A 4UMPA 4MH7A 3W18A 4AA5A 4IG7B 4L43A 1GZ8A 3KXZA 2WTKC 3R7IA 2XNNA 4RT7A 3FI4A 1Q5WB 4DEHA 3VIDA 5CWZA 2PMVA 5DWRA 3ZRLA 2KQ4X 4HGSA 4L01A 4UALA 1XKKA 4XC2A 1JKKA 3QQJA 3Q2MA 3MW1A 2BR1A 4WJQA 4DHJA 4BCPA 3UG1A 3F5UA 1YI6A 1ZRZA 2HJ8A 5ETIA 3MPMA 2XNBA 4FT0A 2YABA 2IO2B 1UELA 2WXJA 4D2VA 2VWIA 4FMQA 5KE0A 1MHHE 2GBKA 4K7WA 2CKQA 2YWVA 4JQ7A 3ZSHA 3GC9A 2MBEA 3CIKA 4O82A 2QQ7A 3GU6A 3DV3A 4FTKA 3QTIA 4EOPA 2ZFYA 2IGDA 3EQPA 1TBEA 5HNGA 3AC4A 3DWMA 1PYXA 4LNOA 3PFQA 2R2QA 1TKYA 4J71A 1CMXB 1HZ6A 4PDPA 2PTLA 2R3PA 3TEIA 4AFJA 4XBRA 3BLRA 1Y56A 3BEAA 5J5TA 3HRFA 4W9LA 3KRJA 4QMWA 2SRCA 4ANLA 4N4SA 4ANQA 4D5KA 3LFQA 3L8VA 3A1QB 2X4FA 1F2RI 3MI9A 4FV8A 3DPDA 4E93A 3GP7A 3FV8A 5I9XA 4J52A 3ZUUA 3VWAA 3ULZA 1FFVA 3W1SC 3ZOSA 1BI8A 1UF0A 1YX5B 4FZFB 3H0YA 1TKGA 4FKUA 3BI6A 3VH4B 3ZRCA 3KN5A 3UO5A 4IB3A 3DHGC 1YX6B 3SLSA 4R3CA 3NZUA 2W82A 5LVPA 5EM5A 4PS7A 5DIAA 4DH8A 3O96A 4S33A 1GPXA 4Q2AA 1DI8A 2MA9B 1F0QA 3QCYA 4DLJA 5CU6A 4NAWB 2FH9A 5AR7A 4ZOGA 2X6DA 1PY5A 3VAPA 3NVKI 4A07A 2BKRB 2DBYA 3FQHA 3OZ6A 4CG8A 2VV9A 5J8IA 5HHDG 5L83A 2DHZA 3OUKA 2J53A 3R9HA 3E93A 3ZDMC 1UNSA 2JWUA 1ZZLA 1T5XD 2VTAA 3KUCB 3SKCA 3A33B 4GT5A 3HECA 4KSLC 5HLPA 2GNFA 4PNIA 2CR5A 4G31A 5AM6A 5I4DA 4OTHA 4DBNA 2JC6A 5CSVA 4RC3A 1SGHA 4RGTA 4CZYB 1RDQE 5IA7A 4EOSA 3RM6A 3ANRA 4ITJA 4GFMA 3I5ZA 4OW0A 2CHWA 3OW3A 4DH3A 2QOKA 2WGJA 3BK2A 3VHEA 3ZXTA 3N30A 3VH3B 3QUPA 1WYGA 3HX4A 4CV8A 3LAUA 4B6LA 2Z02A 1WBSA 3PZDA 2GU8A 3DK6A 4Z9LA 4CTBA 3BYMA 1JALA 4HJKA 4WJPA 1OIRA 5M44A 2KLGA 4FIFA 2XEYA 3SEBA 4AA4A 4IKGA 5FP5A 4L52A 2JZZA 4IWDA 3GXLA 2BGFA 1C4CA 4EL9A 2FVDA 4XLVA 3I0QA 1O6LA 1CM8A 3EJ1A 3F61A 3MA6A 1GY3A 3PE2A 3ZSGA 2B9JA 5GZ8A 3IDPA 4DINA 1TQMA 3VS3A 4W9EA 1XH4A 2IW9A 1ZDVA 3MPAA 4FIJA 1FGKA 2WLBA 5AZFA 2PZPA 2KHWB 2J0JA 4YSMA 2YCSA 2ZPYA 4M0WB 3VBXA 2A27A 5L3AA 2W55A 2N9KA 3P4QB 3PTFC 4CVAA 4U9AA 4MGYE 5A14A 1BUIC 1U5QA 4LOPA 3KC3A 1FQ1B 2VO6A 1XLPA 3DHHC 3PDTA 3TTJA 2WP9B 4PX6A 1FXIA 3BHUA 3R2BA 2QU5A 4AN9A 4FGBA 2WTDA 3PP0A 3V05A 5BYZA 2IZVB 4C2WA 4BI2A 2K3UA 1V49A 1YWVA 2AEHA 3CEKA 5KMJA 1WVXA 4XG2A 4RMZA 2FBWB 3BX5A 4PUZA 4C38A 1Q99A 4Q9ZA 4QYGA 3DZOA 3ZZWA 4JJRA 1ESFA 4XGAB 4PMPA 3FLQA 4PP7A 3BV2A 4E3CA 2XJ1A 3HUBA 2JKKA 5BPYA 3NHEB 4AXFA 4FL3A 2XALA 1KH0A 3HUIA 2PVJA 3V3XA 4WT6A 4NY0A 4RA5A 3DTWA 1OQRA 4HZSA 2EVAA 2IWIA 2GBNA 4LNFA 4WQMA 3MSSA 3KQ4A 4HVSA 2C0OA 2VGOA 3PJCA 4EOJA 4JXFA 4W4VA 4FSRA 2PVNA 3FAAA 4EKUA 2NNWB 3NYNA 2WFYA 4E6DA 3VHTC 4EZKA 3ETAA 3LIJA 3SOAA 4CNHA 2A19B 4I5PA 4U44A 3P86A 4F7LA 4FV9A 2G2IA 4WSYA 4LNKA 3RN9C 5K4JA 4IDTA 3F5GA 4D2TA 4FKRA 3Q3JA 1RAXA 4YLLA 4RQVA 4USDA 4LL5A 2BB6A 4RM8A 3U30A 3HVZA