4EUTA

Structure of bx-795 complexed with unphosphorylated human tbk1 kinase-uld domain
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
386
structure length
384
Chain Sequence
GSQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRNIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of Tank-binding kinase 1 activation by transautophosphorylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase TBK1
total genus 108
structure length 384
sequence length 386
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4eutA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4eutA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4eutA01
2O2VA 1A06A 3KU2A 3BU5A 3TNIA 4FV4A 3KXGA 4LL0A 1DI9A 2FGIA 3BBWA 3TNHA 3HM6X 2G2IA 2WPAA 2OJ9A 1KM7A 1OQYA 5GMVA 5KUPA 4ZTMA 4ZTSA 5M57A 3E62A 4DHJD 3MJ2A 1JKSA 4ZZNA 2YDKA 4BHNA 4C0TA 5B2LA 2JDTA 5BVWA 3C7QA 5HIBA 4Y72A 3KRWA 1R0EA 3GEQA 4JS8A 2VTOA 1XQZA 3QZFA 1OKZA 4IB5A 3VH3B 2C3JA 4RRVA 3WF8A 5IDPA 4FIIA 5HX6A 2VWBA 4PF4A 2IN6A 5CVFA 3TZMA 2WMRA 1Y8RC 4AW5A 1V81A 3LM0A 4E74A 5EW3A 3CC6A 4J99A 4ASWC 3RBWA 2IY0B 1YKRA 4IHPA 1Q5KA 5AR7A 4GJ3A 5CF8A 4OAUC 2DX5B 5CX9A 1OZ1A 3SAYA 2WMXA 3QTSA 1PW2A 3V5TA 2AYOB 2JRIB 3HMNA 4O7TA 2XCKA 1PY5A 1WCCA 4O0XA 5L6PA 2KO3A 5BVKA 2B9JA 2QVSE 3QCXA 4GMYA 4RJ3A 4WO5A 3K54A 3SXRA 3DAKA 3SD0A 4C4FA 3B8RA 4TY1A 1OL5A 3FJQE 5HICA 3RI1A 1J19A 4J8MA 3VUHA 3X23A 3FYJX 3OBGA 4EEWA 4BI0A 1Z57A 3NAXA 4QQJA 5JGBA 3E8DA 3A99A 3FPMA 2YEXA 3JY0A 2OXYA 2ITQA 4DEHA 3O23A 2GU8A 3KXZA 4XG3A 1WIAA 2DAFA 3OLMD 5IUGA 3S4QA 5DG5A 3HRBA 2FCNA 4WBBB 2XIRA 5HBJA 2JDVA 3F88A 3H7PB 5LLIA 4FZAB 2OGVA 4MSMB 4WJPA 2R5TA 2BVAA 3KB7A 4AG8A 4CQEA 4U7ZA 1YXSA 3MPAA 2I40A 3IDBA 4M12A 4J6IA 2XBJA 4M7IA 4U8ZA 4EQCA 4YMJA 3FI2A 2F7XE 5L2TA 1CMXB 1WGDA 4I0RA 3FXWA 2F4JA 2OF2A 4WUNA 3KXMA 4P7EA 4R1YA 1H8FA 3GU5A 3PY1A 4ALUA 1Q3DA 3GOEA 3NNWA 3CBLA 2VGPA 5BMSA 3DCGA 5EK7A 3VF9A 5I9ZA 2G4SA 4CGAA 4HCUA 4JBVA 1WJ4A 2R3FA 2MBHA 4BGGA 3UPXA 1XH7A 3G0EA 4LQMA 1SVHA 3DBFA 4KDLB 4KSPA 3EN6A 4OT6A 4U5JA 2ZAZA 4W4VA 4CXAA 1EUVB 4CV9A 4AT3A 4QTEA 2PZYA 1WZ0A 3KKVA 3SW7A 1Q8UA 1PMVA 4EBVA 4Z3VA 2J2IB 4OTIA 1P5EA 4QO9A 4GUEA 5JN2A 3E7VA 3DBDA 3CQEA 1UU7A 2R3OA 1JRUA 4QPMA 5ANGA 4FKQA 4MWHA 2MWSB 3DKCA 3C50A 3UVQA 2ESMA 4WOVA 3QZIA 2C6OA 1V80A 1PMUA 4XEYA 3Q9ZA 1ZGUB 2KFKB 2ITNA 4Y5QA 2N9EB 2E9UA 3D2KA 5JHAA 4Q2AA 5J79A 3D2IA 3UODA 1ZAOA 3RGFA 3JVZX 3E3BX 3H0YA 3QYZA 4MXYA 4BDJA 2PVNA 4C7TA 4YTHA 2A2AA 2PZPA 1ZZ2A 4KS7A 2UZEA 3U8WA 1U54A 2GS2A 5DPTA 1E1XA 2NRYA 3DKGA 3NDMA 3ROCA 2R7BA 3RAKA 5E8WA 3G0FA 3WZUA 1OEYJ 3PRPB 5L2QA 3NR9A 3QX4A 2FB8A 3O2MA 3RAWA 4BCOA 2N9PC 2PVLA 4I20A 5CHFA 3PVWA 2EVAA 1WVYA 2YA9A 4M68A 3M95A 3PVUA 4X3FC 4AWIA 2IZVB 4B9KA 4YC6A 3HUBA 3VAPA 3UPZA 2WTVA 4QP1A 5JH5C 2FSMX 2GHMA 4O0VA 5BMMA 3QCAA 4NPNA 1YX5B 1M2QA 2YCQA 4ZLYA 4N0SA 4F1MA 3V5WA 2N7EA 3HGKA 1YDTE 2BRHA 2HELA 3A7GA 1KE6A 4FL3A 1H1WA 2QD9A 3LMHA 2XNNA 2ZM1A 1YI4A 4BI1A 4OTQA 5J17A 4M15A 5L6WL 4C35A 3FZOA 5I9VA 4IUMB 1OL2A 2OIBA 1R4MI 4BOSC 4FTIA 4Q5EA 5FXSA 4YSMA 5J5TA 4B6WA 4BVUC 4O7SA 3EYGA 3RAIA 1ZYDA 2UZWE 4JX3A 4A9UA 4YJTA 2NBUA 5K5XA 3HMPA 2YM8A 4GW8A 3DBHI 4D2RA 4GDLB 4AE9A 4MSQB 1TGZB 5E8UA 2IO6A 4IVCA 4WNPA 2R0IA 4I6FA 2R64A 4PRJA 2RG5A 3PHXB 4CMTA 5A54A 4HVBA 3IECA 3AC2A 3FI4A 4ANMA 5IA2A 3VDZA 2IG7A 5M07A 3VQHA 2QOLA 1FMOE 2VTLA 3BPRA 4RVTA 4U0IA 1JBPE 4UZHA 5L8JA 2FNJB 3DQVA 3PPAA 4G3FA 3MFUA 4JR3A 4CLIA 2BFXA 3VHTC 5CAVA 2CN8A 3EFKA 4H05A 3MFTA 4UWBA 5K3YA 4CO7A 5FQDC 4C2WA 5F94A 3TZ7A 3U9CA 3PV1A 5GJDA 5J8IA 4GXBA 5EOBA 3H9FA 3ZIMA 5JRSA 3MH3A 4AT4A 2BIYA 5LMBA 2B3AA 2KVRA 3KFAA 2FIFA 4DT9A 2CN5A 3P7BA 4V04A 4B0GA 3SGCA 2EU9A 3QZGA 2Z8CA 4O21A 1RRBA 3C4ZA 3MI9A 3PXFA 4XOZA 4N6YA 3BV2A 3I5ZA 4P90A 5EM6A 4AGUA 2YZLA 3L9MA 4KINA 4HGEA 1WX7A 1CTPE 5BVOA 1Z5SB 3BWFA 1PRYA 4N57A 2QODA 5C23A 5CALA 4MEDA 3R2BA 2RFSA 4DHFA 4E5BA 1NI2A 4AUQC 2N1WA 2RSUA 4UMUA 3ROYA 3V6CB 3ZM9A 2GDOA 3QUDA 2X2MA 3QU0A 4GG5A 4PL5A 3O8TA 3PRMB 4GK3A 4JBOA 4E93A 5J95A 3A9JB 1OMWA 1HCLA 1OITA 2V7AA 2WB8A 2ZV2A 4YZNA 4M0ZA 5ANOA 2KTFA 2G1TA 2UYZB 4RC3A 4U44A 2WMWA 4XP2A 3AT3A 2BWFA 3C51A 2CKPA 3QZHA 1WBNA 5EG3A 4USEA 3MYGA 3AGLA 3R02A 4FICA 5J7HA 1WYWB 3OCTA 2R3QA 3QUEA 2PJHA 3GNIB 3EMGA 4YZMA 2VWIA 4V0GB 4PDYA 1VJYA 4FSQA 4R5YA 4WIHA 4JAIA 4FNXA 1UBIA 3Q3JA 5ACKA 4B8MA 4PS7A 3RD2A 3QWJA 1GZ8A 1QL6A 3KUZA 2GBJA 3UQBA 1ISNA 5HVYA 2UZLA 2VWYA 1YOJA 4V0GA 3KYDD 5FBOA 3UVRA 5DPWA 4ZSEA 3TJDA 1A5RA 1NVSA 3HX4A 4QMMA 4GMVA 2W0JA 3DQWA 1WMKA 3DJ7A 3QQJA 3PFQA 4KNBA 4XV2A 3VN9A 3LW0A 5EHLA 1YOMA 5HD4A 3NW6A 4A3PA 4J52A 4MGKE 1FBNA 1SE9A 1QMZA 2W5HA 1OPLA 3QKMA 2PK9A 3RUIB 4WT6A 3P7AA 1BL6A 2CLXA 4O81A 3OC1A 2M0XA 2G01A 3HA6A 3PWYA 4NW6A 4UXLA 5K9IA 4U9AA 5T6KA 1YQJA 2JXXA 3T9LA 4PMSA 2EMSA 4LOOA 3AXCA 4B9DA 3NZUA 3V5JA 3ERKA 4N70A 2QOCA 4I21A 2HYYA 2B7AA 3BE9A 5HG5A 1KOTA 4D0XA 2ZNVC 3CR0A 2GS6A 3TEIA 3GC0A 3V6RA 1BKXA 1OEYA 2MBBB 1ZKHA 4I6LB 4F7LA 4ALWA 4MGIE 5LMKC 3O0GA 4GIIA 5F9EA 3LXNA 5I9WA 2P2HA 4FNYA 4FZDB 3H1UA 2WEIA 5AUZA 4I3ZA 2YM4A 2C7HA 4XG8A 3K9PB 2QU6A 3PDTA 2I1MA 2BAQA 3LLTA 4J95A 5I4NA 3UQAA 4C4HA 4RZWA 4ZZOA 1UBQA 3NOBA 1OECA 2XKEA 5L6OA 2NCNA 2W4KA 3EQFA 4HVGA 2DZIA 3QALE 5EM5A 4YP8A 5AR8A 2VTPA 3D0EA 5GJFA 4I5PA 3DLZA 4DCEA 4O7VA 2I1KA 3OEZA 3RPOA 1JAMA 2CDZA 4DTKA 2NBWB 1G8AA 4IZ5A 3P5KA 3DY7A 1Y6AA 2XNMA 3EQGA 3WOWA 5HVJA 4C37A 5HQ0A 2JF5A 1KE5A 4AW1A 2GQGA 3RTPA 3SOCA 2KOXA 2BYEA 2XNGA 4OAVB 2YLEA 4EONA 5CANA 2W5BA 5CT7A 5KHQA 3R7IA 3TTJA 3IG7A 2QR7A 3K5UA 4FJZA 3LCSA 3NCZA 5E8YA 4S31A 4CV8A 5KNJA 4GFMA 2KXJA 5E9EA 2WX1A 4GU2A 3CPBA 1PKGA 2J0MB 1CMKE 5HCYA 3NCGA 3QHTA 4AZWA 2P2IA 4JRVA 3MPMA 4U79A 3IG3A 3MPTA 1Z5MA 2XIXA 2YVCA 2O3PA 4IX6A 4HPMB 3NUAA 4NL0A 3V5LA 2Z2WA 2K6QA 3WAPA 2XBAA 3TDWA 1VZOA 1JLUE 2HY0A 2PMOX 4Y73A 1IEPA 3RWPA 2VUWA 4MCVA 3RM6A 3W10A 2A4LA 1L2NA 4X2GA 2M4NA 5AZHA 2GHGA 4QMOA 3UIXA 5LWMA 4LOPA 3UOHA 4DAWA 3Q4UA 1S1QB 3CXWA 4QT1A 4D5HA 3DFCB 4K33A 5JFXA 3KRXA 3S1HA 4TT7A 4ZOGA 5M06A 3RHKA 3DVNV 4FGRA 4CTCA 4XP0A 4RG0A 1OGUA 3TWJA 2MRPA 3U4UA 4L46A 2V5QA 4YTIA 5CAPA 2RF9A 4MGZE 2DYOA 3EQPA 4JBPA 4I6HA 4M13A 5CY3A 4AZTA 3DCVA 4LGHA 1F3MC 2V0DA 2W1FA 3ZUTA 2C6LA 4LCDE 3PJCA 3UG1A 2HXQA 4I24A 2DYBA 4LDTB 4BCMA 2WEVA 1UVRA 2X4FA 3F5UA 3RKBA 2KLCA 4W9FA 4ARKA 2HW6A 5TOZA 3OF0A 2W1IA 4M84A 4D28A 5LOHA 3F5GA 3DS6A 4MELA 1MP8A 2H96A 5CSVA 4RGJA 3GOPA 4JJRA 2CCIA 3F5PA 4PNKA 2HW7A 3TV4A 3QTRA 2ONLC 2KTRB 2QG7A 5DCNA 3QBNA 3EOCA 3KCKA 4EOIA 3NAYA 4HDQA 3ZS5A 5A4TA 2GNIA 4HYSA 4MH7A 1F9JA 3FXXA 4GRBA 4FEXA 3QQFA 4G3CA 3ZU7A 5EI8A 4ACMA 3PSEB 3ZW3A 4BBNC 1PJKA 1Q24A 3R28A 3ULZA 3C0HA 4ACGA 5LVPA 4FIEA 5IF1A 3DZQA 4IAYA 3PZDA 4MTAA 2PUPA 5EHOA 4FYNA 2PE9A 2YWVA 5JZJA 2R3IA 3A8WA 3EQIA 4BKZA 2DENB 3MESA 2NPQA 2D07B 3ZTDA 4G6LA 2BHHA 4XLVA 5AUXA 5HEZA 3H9DA 5CEQA 4L44A 2PWLA 5H3QA 4GB9A 3BLHA 4FHKA 4PS8A 1J1BA 3DK3A 3LCKA 3MVMA 4WA9A 1UH6A 2KKCA 3FMJA 2KANA 2F49A 4K6ZA 2F2CB 5DIAA 3UNJA 4TYIA 4PMPA 3TV7A 1W98A 1GIIA 2C0OA 3QQGA 3AC3A 3R7EA 1Q3WA 3P4KA 4NKAA 4E20A 2VWUA 4J53A 4DTBA 4QMPA 3RZWC 4A06A 2BWES 2YM3A 3SXFA 5L3AA 1OKYA 1IA8A 1PXPA 2AYPA 2UZOA 3NWWA 4KB8A 4KIQA 4HNIA 5CSXA 2HD5B 3BELA 4FNZA 2VO7A 2EUFB 2EWAA 3PY3A 4I0TA 2KDIA 2KTRA 5LVOA 3F3ZA 4IM0A 4PY1A 4X57B 1XD3B 3MBLA 4R7HA 4EK4A 1V9JA 5EQEA 2ZVNA 5BYLA 4FOCA 4AJYB 4LUEA 3SRVA 1ZXEA 4LJOB 3PG3A 3L8SA 4RPVA 2XJ2A 4FSUA 3D15A 1QPDA 4HJOA 1GAGA 4L8MA 5CTPA 2GNFA 1MQBA 4BHZA 5HTCA 3UBDA 3FWQA 4EH9A 4F99A 2BR1A 5FD2A 3RULA 3MW1A 3H4JA 4AACA 4H1MA 3NEWA 4D58A 1JSTA 2FH9A 4HVHA 1CKPA 4E6AA 1A9UA 4RC4A 2CU1A 3ONSA 3DJ5A 1ZOHA 3SHEA 2H34A 4ZMFA 4FTOA 5DT3A 1V5TA 3ZLXA 4HCNB 4G34A 1I44A 3P23A 4RWJA 3RZFA 3ZYAA 4WRSA 1OI9A 3LFEA 4QMWA 3PS6A 4MGYE 4Z55A 3ORKA 3PWDA 4NJDA 2LXAA 4L68A 4XRJA 3QLFA 5HOAA 4ZLOA 4IVBA 4IB0A 2M8SA 2WU7A 3VUXA 2EXCX 3DTWA 4M67A 3LJ3A 3FPQA 3H9RA 2GPHA 4P7IA 1J91A 1WBPA 2J0KA 4EK6A 3OZ6A 5IISA 4EZ7A 3WANA 4HVDA 3GOKA 3UQGA 4IWQA 3W2RA 1CSNA 4CCUA 2WTWA 2YIWA 3LXLA 1FOTA 3ZUUA 4QD6A 4BCFA 4F7NA 4NAWA 3FZPA 3W2OA 4GT3A 1AARA 2YFXA 4DEAA 2LVPA 2EXMA 2PUUA 5HTBA 1Q8WA 2KLGA 4XRLA 4MXCA 4S33A 1AQ1A 1REKA 3CLYA 1GZNA 3F2NA 4QYFA 4YZBA 1PXKA 3UOJA 2A0CX 3LAUA 1YWVA 2WAJA 3QTUA 4AXAA 5K4IA 4CVAA 1EH4A 4A7CA 4EL9A 2E9OA 5L4QA 4GG7A 4HJKA 4LJPB 2PMNX 2YCSA 4NM0A 4V05A 2MX2A 4X2NA 5M56A 2M1MA 3BGQA 1YXTA 5KE0A 3KXHA 2JBPA 2UZUE 3L8VA 1YRPA 3CQUA 5AP1A 4NJ3A 4BDKA 3EWHA 3P1AA 3R2YA 2RSVA 4GCJA 1MRYA 4HCTA 4BRXA 5CF5A 2YERA 1Q5WB 3UIUA 5TR6A 4ZRJA 4EHZA 3R8ZA 1OM1A 2RD0A 3QTZA 4L7FA 1U59A 3ANRA 3QCQA 3VHEA 4U80A 4I6NB 4W9CA 3HV5A 4DG3E 4EHGA 4JQWC 1IAHA 1XH9A 4RJ7A 4FG9A 4EOLA 4L67A 5FRIA 3PZEA 3QXOA 5BO4B 4ALVA 1GZKA 4WD5A 4BFMA 3F7ZA 3DVNU 2J9MA 2KX0A 4DDID 4RZVA 4O82A 3ETAA 3UP2A 4YSJA 3I6WA 4BTKA 2XNPA 3TCAA 3D7TB 2NS5A 4GEOA 4LFIA 4YBJA 3MH1A 4XYFA 1YXVA 3IW7A 4JNWA 5JZNA 1PYXA 4IQ6A 5DHJA 3ZO3A 4KDIC 3A1QB 3NPCA 1OIYA 2AL6A 4CFWA 4BZNA 4WJQA 2OXXA 5KHOA 4FJVB 2G9XA 2WMQA 5KCVA 4DGNA 4DGOA 1Q4LA 2PVHA 5HU3A 3SVVA 5TT7A 3GGFA 4H39A 4R3PA 1J0GA 1GJZA 3K2LA 4CG9A 4W9XA 1IAJA 4O7YA 4FKRA 4O7LA 1WI0A 2LXCA 3ZDMC 3Q6UA 3DK6A 4HW7A 4PDOA 4MXOA 3KREA 3ORNA 3O50A 4GYIA 1PXNA 5DR2A 5KZIA 2LGYA 3BYVA 3V61A 4C57A 5KMNA 2Y4PA 3SV0A 3HZTA 1WGHA 3BHHA 4A9TA 3E8NA 4ZJVA 4I4FA 4HWIB 3F3VA 4G3EA 4MVFA 3FDNA 5KMLA 1WMHA 4FIHA 3ZXTA 2BZIB 1JVPP 3FMLA 3QRJA 3FKOA 5HBEA 2IW8A 3FY0A 4TYHA 3I4BA 3OBJA 4LL5A 5IEXA 4II3B 4EHVA 4KZCA 1YI6A 4WHZA 3UNKA 3VBWA 2YDJA 4I23A 3R7YA 2JPHA 3M2WA 2WMUA 3EN5A 3JUHA 4MD9E 3SRVB 1TVOA 4W9IA 4ORKA 4H3QA 4NZWB 3LIJA 1YQBA 4ZRKA 3V8TA 2C5YA 3WA0A 4FVQA 4E6QA 2LVQA 3FEGA 5DYJA 4RT7A 4O7RA 1KSWA 3QKLA 1EF1A 2REXA 3QWZB 3KRLA 2QCSA 4X21A 2D2QA 2KMAA 3W2SA 2BAKA 5HIDA 4FZFB 2XEWA 4MM3A 1QPEA 3KK9A 2WU6A 4X2FA 5CXHA 1WM3A 1ZYLA 2W99B 4IX3A 1IG1A 4G3GA 3DOGA 4FHJA 4HVIA 3EZRA 4QTCA 2NR2A 3LFBA 1APME 3C13A 2YLFA 2C68A 2YCFA 5IG1A 4G5JA 1PXLA 4IC7A 1OBDA 3EJ1A 3U8ZA 2R3HA 2Z0DB 3ML9A 3CKWA 3NRMA 4PTGA 4ANBA 4ACHA 4KKEA 1P3QU 4FT7A 2YABA 4MK0A 2ERZE 5DMZA 4YJSA 2VTJA 4O7NA 1FVVA 3Q53A 2YACA 3C1XA 2BALA 2XK6A 3VXWA 3QTWA 2C6EA 4J98A 4DFNA 4Q9ZA 3PSBA 4RJ8A 1ZYCA 2X2KA 4IAAA 4QP4A 4B7TA 4C61A 3ZRKA 4Z16A 2L0TA 4URKA 4ZRIA 3MH0A 4F1SA 2QOQA 4UV0A 1F0QA 1ZYJA 4XHKB 2ITTA 5T3QA 4AW2A 2XJ1A 4O7WA 3NHEB 4Q9SA 5IH5A 1H27A 4AN9A 3W1SA 5AM6A 1I35A 5EFQA 1WXAA 4FC0A 5IH4A 2CMWA 3VUWA 4GKHA 3DK7A 1KOBA 4YHFA 4CT1A 2OH4A 2WO6A 2X8IA 3V60A 4FV1A 2PE0A 4XJ0A 4OLIA 5KMIA 4RA4A 4NQLB 2WXVA 4ASZA 4YURA 5AV4A 3EQRA 3KN6A 3NYVA 4GUBA 4BIEA 3F6XA 5FTGA 3ITZA 3FMHA 4ANLA 5KKRC 3NUSA 2VX1A 3KXNA 4L52A 3QUPA 4NTSA 2HCKA 4ANNA 4FODA 4FGBA 4OTRA 5D41A 3R9DA 4GJ2A 3TIZA 5EDSA 2XIYA 4NNJB 4GN1A 5E6NA 1W84A 3V6EB 2Z7QA 3PJ1A 5AP2A 5C8NA 4IFGA 4DHZE 2C1AA 3V51A 4CYEA 3VS1A 1KUTA 4L42A 3ZFMA 3DNEA 1JKLA 3PE1A 2UW7A 5E92A 1LQBA 3DDCB 4DLIA 3KUCB 4K1RB 4CYIA 5IEYA 2VWXA 4JDJA 3MFRA 3PIYA 3OWJA 4A07A 4UB7A 2QOBA 1VEBA 2ZOQA 2REIA 3QTXA 4U42A 4BKSD 4RVKA 2VWWA 2ZV9A 1IYFA 2C0IA 2C0TA 2EB2A 3ZEWA 4G1WA 4RVLA 2KC2A 3C0RB 3LE6A 5M53A 3DVGX 3GXLA 2XK3A 3PHWB 1LR4A 2MW5A 2J6MA 2NNWB 3ODZX 3OOGA 2NPTA 3I60A 3PRZA 3LFAA 1RQQA 4N4SA 5I3OA 4JIAA 4FKWA 2YWPA 2XKCA 3OTVA 4IAIA 4ZTHA 5HG7A 2XUUA 3O71A 3PJ8A 4EWQA 3A9KB 5G2NA 3UO5A 2H9VA 5C9CA 3QLGA 3RMFA 4DFZE 3A9JA 4LUDA 3FC1X 4IX4A 3ZZWA 3U7DA 5HE1A 4GV1A 3TUCA 2ETRA 2QOOA 3IVFA 4FVPA 3PJ2A 3N4TA 3EQHA 1UD7A 2WTIA 4DWFA 2W1HA 3PT2B 5GINE 4PPCA 4J1RA 3B0AA 3MHSD 5E8XA 3L8XA 5DLSA 4FE2A 4AUAA 2JFLA 1LP4A 4DHZB 2OO8X 3NLBA 2LGXA 1YWRA 1MQ4A 4IH8A 3BZ3A 3L9LA 4O0TA 2C60A 3ENHA 1XH4A 5CF6A 3OWPA 2IVSA 3A62A 3II5A 4MYGA 5HBHA 2F2UA 2YJRA 3G2FA 3LJ1A 5HE2A 3MIYA 4RWKA 3ECIA 4FBJB 4B99A 3ZVVA 2G2FA 3DKOA 3OEFX 2QO7A 3DJ6A 4KIPA 4LOQA 4ZSGA 3TCPA 2CJMA 1WF9A 4KIKA 1XBBA 4XP3A 1ZOGA 3A60A 2JIIA 3MVJA 4QPAA 5DEWA 3W2PA 5JQ5A 3HK0A 2GTMA 4USDA 4IZAA 4HYUA 4L01A 4BCQA 3LJ2A 1XBAA 4R7IA 2IZRA 3C4FA 3NYOA 4Y95A 2UWQA 5CEOA 4MBLA 5C8MA 3ZOSA 4FN2A 4JDHA 4D2VA 2VTHA 2Z60A 5AZGA 2R3GA 3PSCA 3S3IA 1LUFA 3LFSA 4YO6A 1JQHA 1NY3A 3EFWA 3OFMA 4DGGA 1E90A 3Q2JA 3TDVA 1YX6B 4DEDA 5C1QB 5CU4A 2WDTB 5DBXA 1S9IA 3QHWA 2LVOA 4H1JA 3WAOA 4IE9A 3U30A 1WR1A 3DLSA 3EKKA 4LDTD 3P7CA 3HHMA 2BRGA 5A46A 2FA2A 3JYUA 5FP5A 1P14A 5FLFA 3V04A 4EK5A 3VQIA 2VZ6A 5KMMA 4WWNA 4X2KA 1M7QA 4PNIA 3R8VA 3WIGA 3ZLSA 4BCHA 4HXDA 2GOWA 1WJNA 5CYIA 3SXSA 2QNJA 4FF8A 4QMUA 3VS0A 4NKSA 5CU6A 5GZ8A 2IVTA 2VNYA 3HKOA 3OXTA 4XV9A 3VS6A 5A4LA 3QARA 4FJYA 3ZLZA 3SA0A 5DFPA 3PLSA 4BB4A 3ENMA 2PE1A 3BHYA 4IVAA 4JIKA 4EEVA 2WQBA 2GFCA 3JS2A 5H8BA 2FCMA 2CNUA 1ERKA 4JR7A 2XIZA 4TYEA 4I6QA 4E8AA 5HNIX 3A4OX 2O64A 3ZHPC 2KDFB 3LXKA 2OIDA 5ANKA 3HDNA 3SLSA 3BHUA 3T9TA 4EUTA 4QP7A 5LVMA 3TV6A 3H3CA 2R3LA 2JZZA 4TPTA 3CQWA 2IVUA 3C4WA 3QA0A 4C36A 5DR9A 2IO3B 4YZ9A 2UZBA 4IWDA 4OBPA 2OZAB 1WGGA 4CKIA 3D5VA 4EQUA 3BIZA 2L05A 4JDKA 3VRYA 3UP7A 4NT4A 1F5QA 5FG8A 2XIKA 3FAAA 3L1SA 4O2PA 3RWQA 4D0WA 3C5UA 3MB6A 1BUHA 3FSKA 1REJA 4QMQA 2N4FA 2NVUI 4GK4A 2PU8A 2WQMA 3RPVA 4EKKA 2CS4A 4QMNA 1WXMA 3ODYX 3LOKA 2QURA 3VAWA 5G1XA 5KMOA 3JR1A 2PY3A 1YHWA 3Q4ZA 4G3DA 4CQGA 4CEGA 4BDEA 4X3FB 4QYYA 3Q3BA 4EOYA 4BGHA 4EOKA 4R78A 1G5SA 3GT8A 3FMKA 3MSSA 5AV1A 3VS5A 4IG7B 3MY5A 3MGYA 3R1SA 4BCNA 2KZRA 3LFFA 3UC4A 3KEXA 2C5LC 3EQBA 3LFDA 4RWIA 4KABA 4X3FA 1JOWB 2YM7A 4PUZA 5EKOA 1UU3A 2XEZA 1YHVA 2ITPA 3ET7A 4L45A 3DV3A 4OTGA 3AD5A 5CU3A 4F6SA 4CMOA 2GBRA 2IYDB 2WTJA 3O7LD 5ANEA 1X1MA 2K25A 5L95C 4XC2A 4E26A 4JOAA 4ZS0A 2Z02A 4MEMA 2W9ZB 4KIOA 3DB8A 4EFOA 4XG4A 2E9VA 5CS6A 4BBMA 3PPZA 3BRBA 2X7GA 1BX6A 3T8MA 4ZJIA 1J7LA 4TWNA 4ZJJA 2PYWA 4L3LA 1Q8ZA 3GP0A 2ZJWA 3R1NA 3COKA 2YZAA 3A7IA 4JRNA 4LMNA 4M69A 4QTAA 1WX8A 3NGAA 5E8ZA 4TKSA 3VBQA 3UTOA 1NBFC 3OP5A 4UALA 3VO3A 2N1VA 4WSYA 3NNVA 4ONAA 5FBNC 4BIBA 2R3KA 5CHWA 1QZEA 2KFKA 2ZDUA 3ANQA 3HA8A 5CZIA 2YITA 1CDKA 3Q9YA 5LQFA 2KK8A 3ZXZA 2XK5B 3QQ8B 3D7ZA 4FULA 3H30A 4QQ5A 4II2B 4KA3A 2GTNA 4IJPA 4FTNA 2XKFA 3VNTA 4MJSB 4KVGB 4FKLA 4S2ZA 4FYOA 4IX5A 3BINA 3I3TB 4AFJA 4EC9A 5JFSA 5HG9A 3T9IA 5AAGA 5IDNA 1IPGA 5HZNA 2QHMA 3EC8A 5E1SA 4XG7A 3EHVA 1Q41A 4D2PA 3QCSA 3CD8A 4L6QA 4K7UA 3C0IA 2FIDA 4FV6A 1OL1A 3PXYA 5DRBA 2V1YA 2NPTB 5IA0A 4RIXA 5K4JA 2PPQA 3KW5B 5EYKA 4IWPA 3V62A 5HESA 2QOKA 1RFAA 4H58A 1WBTA 3I0OA 4OR5A 5FDXA 4QP6A 2BPMA 2X8EA 1Y8YA 4Z7GA 5HX8A 5CSWA 1WX9A 2O5KA 2CHXA 3MJ1A 4EH4A 2Q0BA 4ANSA 1P2AA 5AAFA 2LJ5A 3BX5A 3LCDA 2J0JA 4AU8A 4FTRA 3R9OA 3Q2MA 5C03A 4BIDA 1E8ZA 2ZPYA 4D4YA 4KRDA 3FE3A 4AZSA 4GU9A 3G51A 1MUOA 2LWPA 5TR5A 2GNHA 5GZ9A 2B9HA 3A7JA 3DGKA 4P4CA 2WNTA 2WOUA 4O0UA 1L3RE 4EOJA 3A8XA 2AC3A 4DN5A 5HLPA 3UGCA 1J7UA 4KBCA 5A4EA 3UGBB 1JSUA 3ELJA 3QTIA 3RAHA 2D3GA 1Q0WB 4DEBA 4ERWA 3KMMA 3E88A 4CSVA 1KE7A 5LVNA 3AMBA 3FL5A 4YLKA 2R3RA 3GC8A 4BFRA 4IAKA 3EFLA 2HTHA 5CQWA 4EQMA 4GKIA 1H28A 3QJZA 2YIYA 5CI7A 4EOOA 4UXQA 4Z7HA 3LFCA 3WBLA 4I1ZA 3MTFA 4OBQA 3BBTB 5EQPA 2W5AA 4F8CB 3PXRA 4R8QA 3M3JA 3R7RA 2HZ4A 1LPUA 3O51A 1R0PA 2PUNA 3IOKA 2R3PA 3OVVA 4A4OA 2O8YA 4AGWA 4AS0A 3W18A 1G3NA 2FVDA 2XNOA 2BUJA 1WGRA 4JG6A 4YJQA 4ZP5A 1EF5A 5C01A 2LAVA 4RQKA 3NUXA 4F6UA 3E87A 5I3RA 4FL2A 2X39A 3OCGA 2JIUA 5M4FA 3OW4A 4E7WA 4ZSLA 1TTNA 5AR4A 1WR6E 2VWZA 2KD0A 4ANVA 4JVGA 1V0PA 4GU6A 4OBOA 5IA3A 3EQDA 2ZYBA 2B52A 4YJUA 4G31A 3TXOA 3U6IA 2BZJA 2HJ8A 1PXJA 3ENEA 1CKJA 4KKHA 3RPSA 4R77A 4JIOU 3BKBA 4PQNA 4YC3A 4A3OA 4DH8A 2P33A 4MNFA 1RE8A 4Y83A 3CF6E 2MBQA 2XZSA 3MB7A 3HV3A 5J9YA 4CHKA 3C0GA 5K5NA 3R8UA 5IQHA 3DBEA 4GSBA 4FL1A 1LEWA 4KIKB 4C62A 4UBAA 4FX3A 3F69A 5BVEA 4MQ1A 4ASXA 3LZBA 3U6HA 1BMKA 2K39A 4JLCA 4O6EA 5E8VA 3DA6A 3GQIA 1ATPE 4TWOA 4MNEA 2KMCA 4RMAA 2X7FA 2V7OA 3QWKA 2BILB 4FI1A 4QRCA 4D55A 3V8SA 4AFEA 4QMYA 1ZMUA 3BQCA 5L2SA 4FEVA 3LQ5A 4PP7A 3Q4CA 2KULA 3MV5A 4Y8DA 2ITYA 3FHRA 4XG6A 5CASA 5JHBA 3VUKA 2HWOA 3ZO2A 3DBCA 1XT9B 5IA5A 1V5OA 2PVJA 3FKNA 2MCNB 4BCKA 3P2BA 2XNEA 3QRUA 5LCJA 4BCPA 4FK6A 4A9SA 3AMAA 3UQFA 3OG7A 5EQYA 2QHOA 3L0WB 1H0WA 3COIA 1RDQE 3C9WA 4BTJA 5ETCA 4UMRA 2OJFE 1ZY5A 1XR1A 3G6GA 4FZ7A 4BBFA 2JDRA 2EXEA 3JY9A 3ZONA 2WZJA 5AX3A 3RHXA 3T3VA 3S00A 4B95A 3QHRA 4EKUA 1G8SA 2XS0A 1WJUA 5C26A 3EFUA 1XKKA 2CHWA 4AWJA 2RGFA 1YJ1A 4DH3A 4FTTA 3WE4A 4I5CA 5FGKA 5E8TA 1IP9A 1SIFA 1XWSA 5AA9A 2FSTX 5FXRA 5J9LA 4NU1A 2VAGA 2R9SA 4FKIA 5KHXA 3W1YA 2X4ZA 1L8TA 3VH4B 3ZRLA 3LFQA 3FQSA 3CKXA 3WZDA 5J18A 2LGDA 3D14A 1V2YA 4IADA 5AP5A 4DE4A 3ZUNA 5EH0A 4BVUA 5IQGA 3LKMA 3FMDA 3HV4A 3OT8A 4AA5A 4U3ZA 4YZDA 4DT8A 1PMNA 1IA9A 1YI3A 5F1ZA 4FUYA 3DB6A 4G6OA 4TQ0A 1ZY4A 5C1ZA 3G15A 2XH5A 4UYAA 5CU2A 2W9NA 2UW6A 4FSTA 1NA7A 2R3JA 4AZVA 2LRUA 4EJ7A 3IS5A 3QA8A 4CZUA 5IA4A 5IZFA 4WWOA 3U6JA 2WD1A 4MF1A 4PX6A 4ZK5A 4YL8A 1WAKA 5IKWA 2H6DA 1GZOA 4O22A 3ZLWA 2Y6MA 3ATTA 1UWHA 4K7WA 5BUIA 3FY2A 2DHZA 5B2KA 1LEZA 2FSLX 2UW0A 4KBKA 3U9NA 5L8LA 2WIHA 3I5NA 4XV3A 4YPSA 3SQQA 1YW2A 4R7BA 2JDSA 5CEMA 1GC7A 3TACA 1VYZA 5FDPA 5EM7A 4NM5A 3Q9WA 3I7BA 4YJPA 2N7DA 4ZIMA 3AGMA 2BROA 4HYHA 3TTIA 4UWCA 3T3UA 1SVGA 4BDAA 4M8MA 4B6LA 2KJ6A 3LM5A 4TXCA 1O6LA 1URCA 2IWIA 3IONA 4WBOA 5E8SA 2K6DB 2KC1A 5JRQA 2A19B 4CNHA 2F9GA 2YIQA 4GVAA 1KLVA 4BDGA 3L9NA 2XF0A 3PZHA 4I6BA 3H9OA 2O6VA 2Y8OA 4IXPA 3R9NA 2O65A 5ANIA 3G9NA 4U97A 4F0IA 4UX9A 1KJTA 2IJMA 3FZTA 4BTFA 4C4IA 2OG8A 4W9WA 3UG2A 4AN2A 3ORLA 5G55A 2B54A 2IW9A 1I42A 2J7TA 2XNBA 4L9IA 3NVMB 2C69A 3E64A 4OGRA 3CTHA 2OFVA 3PIXA 3BYMA 2Y6OA 4BKYA 1DM2A 4DHJB 3DT1A 1U54B 4IZ7A 1P0RA 2I7QA 3VUTA 3KQ7A 3H7PA 3NSZA 2WMAA 3LQ8A 4FV3A 3L08A 4QPSA 4FT5A 5D6JB 3FLQA 3HDMA 3DKFA 2CGVA 3CJGA 3FLYA 4L00A 2VO6A 2FCQA 4O7ZA 4NEUA 3WYXA 4FBXA 2J51A 4FV7A 5EI6A 3NIZA 4CCBA 4QQTA 5AADA 1LXDA 3TZ8A 2PVFA 5TE0A 3G9LX 3R9HA 1HE8A 2A5UA 4ZXTA 5FEQA 4FSZA 3SW4A 3W8LA 4AGDA 5I5ZA 4DBGA 4GL9A 4PTEA 2MA9B 2UW5A 4NWMA 2IPXA 3F5XA 5GIPE 4C02A 4JDIA 3F7WA 3GCUA 4DG0E 5BPYA 3A61A 4GIVA 4FA2A 3AC8A 2C6DA 4AP7A 2HZNA 3ZM4A 2JY6A 4FG8A 2OFUA 3IKAA 3KXXA 3OTUA 5CWZA 1FQ1B 3PRFA 4CFVA 4ENXA 3P86A 4RJ4A 4F0FA 4BBNF 2RR9A 1YXXA 3RJCA 3IBEA 3OROA 3O65B 2XM8A 3KL8A 5KBQA 2V4LA 5CU0A 4C8BA 2C9WB 2GS7A 1R78A 2WQNA 3BGZA 3KVXA 3GC7A 2JD5A 4XS2A 1OKWA 3KF4A 4GFOA 4F6WA 2MQJA 2V3SA 4I6PA 5I9XA 4RC2A 4DEIA 4R3RA 1P9DU 1WGYA 2NRUA 3WAMA 2RL5A 1Q8YA 3MY0A 4YLJA 3ZO5B 2JAVA 2R4BA 4MBJA 3IW6A 4RFZA 1WZ3A 2IZSA 3EQCA 3GUBA 3UZTA 3ZDUA 3NVKI 3QTQA 3R66C 3QK0A 2L76A 3R8MA 5AEKB 2ZV7A 3RK9A 2C5NA 4MWIA 3OS3A 2WTCA 2LI5A 4G11A 4DITA 4W4YA 4XBUA 2B53A 2GFSA 3UZPA 4BICA 4JQ8A 4HGSA 2ZVAA 3F3WA 3VW8A 3LMIA 4QOXA 4EJNA 3OT3A 1H07A 1E8WA 1XJDA 2BIKB 4HZRA 2J50A 4FTCA 3F9NA 4F9CA 3W16A 5AR2A 5J1VA 4HNFA 3QAQA 2BAJA 4UZDA 5HIEA 4R3CA 3BYOA 3Q04A 2HE7A 4UMTA 5CSPA 5LMKA 3RK5A 4HCPB 3POOA 5D94A 1JKKA 2CCHA 2XVDA 2YM6A 3VJOA 5JGDA 1K3AA 3P79A 5J87A 3PRIA 4K8AA 3S95A 5JKGA 4APCA 2ZCCA 3MN3A 3N32A 3HMIA 3UINB 4QMLA 2H8HA 2JDOA 2OZAA 2PZRA 3D9VA 2OU7A 2VTSA 3NZ0A 4FV8A 4ZSAA 4M14A 2BKRB 4BDIA 4G50A 1Y57A 2VU3A 3DTCA 4KWPA 2BFYA 4DFBA 3VTUA 3U55A 1SM2A 4PL3A 4J97A 5JEBA 4RIYB 2CKHB 3TIXA 4F4PA 4IAFA 4F65A 4LG4A 4RM9A 4UMQA 3FV8A 2C7MB 3VFKA 1UGMA 2IW6A 2GBKA 4TN6A 4I22A 4MD8E 2N9XA 4D1XA 4EI4A 5HKHA 3K3JA 1H1RA 1GIJA 2O63A 3CP9A 4E1ZA 4BCIA 1E8XA 3UO6A 3VVWB 4YNOA 2W4JA 1WJ6A 1H01A 2RFDA 4ACCA 3ORTA 4EH3A 2PPHA 1Q99A 3KCFA 4DEGA 2C6IA 3TI1A 5J1WA 1UNGA 5AP6A 2KFJA 2R2PA 4HGTA 4MHAA 4PTCA 3FLNC 3GI3A 3FMNA 3NUNA 4IDTA 4D2TA 4MH0E 3OMVA 4RVMA 5LVLA 3D5UA 3GU7A 1V86A 4FIJA 4WNMA 5GHVA 3LQ3A 3HM3A 2BYVE 2VX0A 4J8NA 2JBOA 4GSWA 4WG5A 1XH6A 4NCTA 3APCA 2L3ZA 3KH0A 3KULA 2PVMA 2MBOA 3TZ9A 4W9JA 4AOIA 3EL7A 3HRCA 3PPJA 2R2OA 4BDBA 2C6MA 4Y46A 5JFWA 4I4EA 1Q8TA 3I1AA 2CSNA 3QCYA 4YJNA 4O38A 2VTNA 2BYFA 2WFYA 5CAUA 3Q5IA 2GHLA 4FG7A 2GQSA 3BU6A 4KZ0A 5I9UA 3DXPA 4N9F4 4X0MA 4LM5A 2J0LA 5HKMA 3NMUF 4EK8A 2P55A 4AA4A 1NDDA 1SNUA 4YO4A 2X9FA 4FMQA 2Z59B 5BYZA 4KBAA 5IPJA 4F7SA 5A6NA 4D2SA 2QG5A 3MWUA 4EH2A 1UNLA 2ZZPB 3ORXA 3GENA 3O8UA 4U3YA 4FTLA 5CNOA 1V0OA 3ZDIA 3ZCLA 4A9YA 3C4EA 1ZRZA 4FT0A 2UVYA 3WF7A 4C4EA 5JFVA 3NYXA 2KDEB 1FXTB 2KWUB 3RZBA 3AMYA 3UZRA 3EYHA 3HP5A 5JK3A 4EWHA 3I0QA 4TWCA 2UV2A 1PHKA 3A7HA 4YGAA 4BYIA 1L7YA 2PVYA 3NUYA 3R9RA 2VD5A 3CY3A 1BLXA 5JH6A 1KE8A 4IJ9A 3ACKA 5FTOA 3UMWA 2ETKA 2BMCA 3HNGA 3BYSA 3PA5A 2OJIA 5CVGA 3V6SA 3VQUA 1UELA 4BN1A 2JZ3B 3FZSA 4GDLA 2XK7A 4BOZB 4PV0A 2HXLA 3HVCA 3F3UA 5D7AA 5CI6A 3BV3A 3FMMA 1QPJA 4DG2E 3UIPB 2OF4A 2PMLX 1T45A 3DPDA 5KHWA 3MY1A 2WQOA 2W96B 4BKJA 5DPSA 4ZYNA 3MA6A 3S2AA 3CSVA 1WXSA 3PXZA 5H9BA 3AU5A 3PIZA 5LXHA 4FKTA 5AP7A 4FKUA 4O0WA 4KKGA 4PDSA 3MIAA 5TKDA 3RPYA 5AEPA 3NZSA 2WYQA 3VUMA 2OH0E 4A9RA 4DBNA 4IVDA 4MKCA 1ZZLA 2J4ZA 4BI2A 3APDA 4YNEA 3TNQB 4EHEA 3ZSGA 3W55A 2QO9A 4XX5A 1Y8GA 3CGFA 4BCJA 3MH2A 4FKSA 5KO1A 4YJRA 3GCPA 3ZO1A 5AV3A 4AT5A 5AA8A 5CSHA 4YJOA 5CENA 2GMIC 4GS6A 2DYMA 4ICVA 1M94A 3E5AA 5CTRC 1HOWA 4MJSA 4NJ6A 3EN4A 3NY5A 2P4IA 4O6LA 1XH5A 3W1SC 3HAVA 2Q0NA 3JPVA 4UEUA 2W1CA 2Y0AA 4CYJA 5IH6A 5DVRA 5AUWA 3HYHA 3NX8A 2KTYA 4AF3A 4FT9A 1WXVA 2IZUA 3BLRA 4TZRA 5GIOE 2HZIA 4I0SA 4YLLA 2JT4B 4ASEA 2QI8A 2VNWA 3D7TA 3D83A 3FLZA 4BF2A 5A14A 5IA1A 4UMPA 5D12A 5I9YA 5M51A 2IY1B 1STCE 4K7SA 1U5QA 3IK3A 3Q6WA 5AFVA 5BNJA 2RFNA 4BCGA 4ERKA 5CEIA 2VX3A 3R71A 4DH1A 3QRKA 1MRVA 3QD3A 3UDBA 4BDFA 5IU2A 2FAZA 3A4SC 4FTQA 5AUYA 5HNGA 3MJWA 1OIUA 3KK8A 3VTWA 2LUEA 3EHAA 2DZMA 2VN9A 4IWOA 3IDPA 4O0RA 3DPKA 3TNWA 3LCTA 2DAJA 4UN0C 3NIEA 4HDOA 3Q4TA 3ZZEA 4NY0A 3VUDA 4YJVA 5CF4A 3WI6A 3N4VA 4JX7A 5E6PA 3OCBA 2DS1A 2E9PA 2R3MA 4CFXA 4E4MA 4K81A 3EKNA 2D11A 3ZNID 2YCRA 4NW5A 5ITAA 3N4UA 3EZVA 2W4OA 3O17A 2O6VB 2Q83A 5JMSA 4FA6A 2O2VB 2WMVA 2V55A 3ZEPA 2X81A 3VRZA 2VWVA 3AOXA 2X2LA 4R6VA 4ITJA 3SDLC 5CHVC 4BKSA 3F2AA 1P98A 3HV6A 1R1WA 5ETIA 3ZLYA 5E4HA 4RBLA 4BR3A 3L8PA 4II5A 2C7NB 3T8OA 4O96A 2A27A 2NP8A 3Q5ZA 2MP2B 1M17A 5LXMA 3UQCA 3OJ3A 1WBVA 3V3VA 2UZDA 3VHKA 3SOAA 2I0YA 2PTKA 3OHTA 4YPDA 2W05A 3LMGA 2Z0EB 4I5HA 2BHEA 5JT2A 3D94A 5GJGA 3QX2A 2UZNA 3E92A 4M8TA 2V62A 4RQVA 5BVDA 5IQEA 1BI7A 4TV3A 3WZEA 3CD3A 2D10A 2IO1B 4CG8A 2FCSA 3TUBA 3PLVA 4EYMA 1S9JA 4BL1A 5D2MB 2W17A 2W7XA 3GFWA 2ERKA 4D4SA 2K1FA 4FZ6A 4HLEA 2PUIA 1GNUA 1OVEA 2OJJA 5D10A 4F70A 1FVTA 2A1AB 2ZCBA 3CIKA 3W33A 1QPCA 2L0FA 3CJFA 2HIWA 5HNBA 4ACDA 1WY8A 2OJGA 2QU5A 2JRHA 4NAWB 3N30A 1GIHA 5A3XA 3A7FA 1X8BA 1TBEA 3L10B 1XH8A 1C3TA 5LARA 3OCSA 2L7RA 4S34A 4NK9A 4X7QA 4F08A 1H08A 5DPVA 4TWPA 1T46A 4QP9A 5AM7A 4QNAA 4FUXA 5DWRA 5IMEA 5L83A 4CFFA 5CQUA 1JWHA 3AU4A 1WM2A 3CEKA 2AUHA 5AUVA 2KN5A 1SGHA 4FIGA 3SU8X 3DAEA 4FV0A 1ZYSA 3ORPA 3AULA 3EFJA 1XBCA 5J7BA 3A9KA 3P08A 1M14A 2LZ6A 3N9XA 4YR8A 4ZEGA 1Q62A 4ZTQA 4WKQA 3U4WA 1BT0A 2JEDA 2B0QA 4Q5HA 3IOPA 2CKEA 4F63A 4IC7B 3R73A 4FTUA 4PPAA 3AT2A 2FO0A 3R00A 3V5QA 1U46A 5DI1A 2P3GX 1Q61A 4HPTE 5AP0A 4MDKE 1T0YA 3E93A 3MA3A 2PULA 5HORA 3HAMA 2HOGA 3R3MA 3COHA 1FPUA 4WNKA 4O84A 3PE2A 4X6RA 5BYYA 2KQSA 4FTJA 2K8CA 1M52A 2C5XA 2UUEA 4PL4A 3FLWA 5DT4A 2M17A 3GBZA 2X9EA 4B8LA 3R1QA 1Y91A 4R1VA 3B2WA 3K9OB 4LRMA 3UOKA 4FSMA 4ZZMA 2BZHB 2ACXA 2I0VA 3ZC6A 5IUHA 1VCBA 4NQKE 4W9HA 4KUJA 5CEKA 4U43A 3VC4A 5BVNA 2W1GA 5EYMA 1BYGA 2FYSA 2C6TA 2G2HA 4F1OA 2KDBA 1YDRE 4IZYA 4F9AA 2C3KA 4L43A 3UYSA 3QD0A 4BTMA 2QOIA 4XLIA 1TKIA 1AGWA 2VTMA 4DH7A 5BQ0A 3VF8A 2EMTA 1DS5A 2QLUA 4IMYA 5BUEA 3ML8A 3FI3A 3FL4A 1R3CA 1VR2A 3LXPA 4EORA 3LLAA 4RMZA 4MD7E 5HTIA 2PVRA 4RX5A 3NUPA 2L8JA 2JKKA 2ITXA 2E9NA 4EH5A 4D1ZA 4OTFA 2KWVB 2YLMA 3NNXA 5H8EA 2IO0B 2J7QB 4KSKC 4KV2A 3G6HA 3GFEA 3OUKA 3R01A 3RINA 2J5FA 2GSFA 4A4XA 2I1JA 3V8WA 4EKLA 1IRKA 5FTQA 3U51A 5CEPA 4FLHA 4A20A 2NO3A 2XM9A 4EBWA 2JKOA 3R7VA 3O7LB 3GC9A 1B6CB 1S3SG 1J7IA 3WIKA 3PJ3A 3BQRA 5TF9A 1KOAA 4LGDA 4PMTA 4RWLA 1GG3A 4O86A 2AC5A 4C3FA 1UU9A 4BWXA 3OJ4B 5J2RA 4DEEA 4W9KA 4MBIA 2QO2A 1BL7A 3WF9A 4BZOA 3HL7A 4W8EA 3DAJA 3VUGA 4DFUA 2B55A 4FVRA 2B9FA 3EH9A 2BRMA 4EOMA 2IBIB 3QGYA 2X1NA 3KC3A 4FEUA 4Y5HA 4IIRA 5AV2A 3N51A 3VS4A 3HIZA 2RGPA 1PXMA 5ANJA 3SKCA 3SC1A 2W1ZA 3PY0A 5FEDA 2DWBA 2O0UA 2ZDTA 3R21A 4M66A 1H4LA 2UW3A 3UOLA 1U4AA 1RJBA 4CRSA 3HECA 3PGEA 3FHIA 4XMOA 3C4CA 2YIXA 2GNGA 4WUAA 4F9YA 2YAKA 4ICUA 4D4VA 3OOMA 5EKNA 3OAWA 4FKVA 2VTQA 5T68A 2CPKE 1WBSA 4CKJA 1XQQA 3RNYA 3JSVA 4FEQA 1TQMA 2IVVA 4FOBA 4FR4A 3W2QA 4R5SA 4A4LA 1Z9XA 3TKIA 3LHJA 4FSRA 4ANXA 2WGJA 2F7EE 4U6RA 3KN5A 2GBNA 4MQ2A 2MLBA 4OVVA 4ZDVA 4FT3A 4G6NA 1E7VA 2UVZA 4GT4A 3IGOA 4TYHB 3BHVA 3AD4A 1V49A 3GCQA 3NUUA 4O83A 1H1SA 2ZB1A 5HE3A 2ZNVB 5FEEA 3ALNA 4CFMA 3R04A 2G15A 4KAOA 4NYEA 4IC8A 1IR3A 4FEWA 3CCNA 1FINA 1JNKA 4AX8A 4OVUA 3UO4A 4E73A 4WAAA 1CM8A 3GU4A 4RA5A 4U41A 5DGZA 1CKIA 4HGLA 5JSMA 3L9PA 1LM8B 4CTBA 4FSYA 2GNLA 2ITZA 3ZH8A 1EO6A 4DDGD 2Z7RA 3KRRA 4E5WA 4RIWA 3ATSA 2JIVA 2VO0A 4HCVA 1SZMA 2BRNA 2ITOA 3SDJA 2JC6A 5HCXA 5ETFA 1H4RA 4JQ7A 1YXUA 3FZ1A 4O2ZA 4GK2A 5TO8A 5AP4A 1RLFA 4IFCA 3RVGA 1M2PA 2F57A 2QKRA 3BEAA 4F0GA 3C4XA 1ZOEA 5F95A 4EUUA 3GZNI 2VO3A 5HG8A 3TN8A 2NBVB 4K11A 4E5AX 4E6DA 1U4DA 3M63B 3VTVA 3FUPA 1XO2B 1WVXA 3IO7A 3TMPB 2CNQA 3ACJA 3QF9A 1SMHA 2UZTA 3DVGY 3UIMA 4G17A 4FTAA 2JVCA 4NIFA 2CGWA 4C4GA 1XHAA 3R7UA 3WALA 3VWAA 3AC5A 3RM7A 2VTIA 4AZEA 5AX9A 3H7SA 1NXKA 3JVSA 2Y4IC 4J96A 3UC3A 3LCOA 4E4LA 4EH7A 2ONLA 2AWTA 4U81A 4ZY4A 1YDSE 4PYUA 2YISA 3NW5A 4B4LA 5KBRA 2C5OA 2KHWB 2XBBC 3FMEA 2XMYA 3ZBFA 4CFNA 1W82A 4LV5A 4CMUA 4C59A 3PP1A 4K77A 2HAKA 3D32A 1JPAA 3L54A 3UVPA 2X8DA 4E4NA 2QOFA 5M4IA 2WKMA 3TG1A 3EN9A 5KMJA 1Q1OA 3ZSIA 3OXZA 1FMKA 4NH1A 4RIWB 3WF6A 3ALBA 5JZEB 4TNBA 4F7JA 2VTRA 1YWNA 4W8DA 4XUFA 3QD2B 4F09A 4XOYA 2ZB0A 3G5DA 4W9LA 1ZMWA 5HCZA 2BCJA 2ZEQA 4OT5A 5EDRA 2QC6A 3AI5A 3FQHA 4BKGA 4S32A 2HY81 4WG3A 3U54A 4ZTLA 3KMWA 4JL9A 3DBLI 3JVRA 2SRCA 4RX9A 3EIDA 3UMXA 1SVEA 3ZRCA 4FKPA 3E7OA 3R22A 5B2MA 4G5PA 2WHBA 4L3PA 1A48A 2VRRB 1DAYA 3M11A 3NS9A 3VJNA 5J5SA 2J0MA 3DBRI 5AIKA 5H2UA 3UNZA 3UYTA 4ZMEA 2AEHA 1PYEA 1ZARA 4WSQA 4GT5A 1OL6A 3G33A 1UKHA 2ZPNA 5CZHA 4MF0A 3B08A 2XJ0A 2XYNA 4NM7A 5CLPA 3ULIA 2JWZA 4X6QC 3HMMA 2JAMA 4AJWA 3OWKA 4LRKA 3OY3A 5AUTA 4GYGA 1OIRA 3OWLA 3VS2A 4LMUA 2Z7LA 3AC4A 3MTLA 3POZA 3TJCA 2JKMA 2G3QB 2WIPA 3MFSA 4GOCA 4JG8A 4PDPA 3SG9A 4AQCA 4GDKB 2OIQA 5EYCA 5A9UA 1BI8A 2JGZA 2J5EA 2ETMA 2R0UA 3LDZE 5AJQA 2QHNA 4O27B 4QMTA 2PZ5A 3BLQA 5AMNA 4RIYA 5HGIA 1GJOA 3BU3A 3CY2A 3TNPC 4NSTA 3CMMB 5IQFA 1WRDB 5F20A 2BPSA 2FUMA 2LGCA 2WTKC 4HPLB 4Y85A 2UW8A 3ZNHB 1TQPA 4D5KA 5LMAA 2W1DA 1WH3A 5DOSA 2PSQA 1KV1A 3FZRA 4FV5A 1WFYA 4QTDA 4EZ3A 2QLQA 5E1EA 3H10A 3AXWA 3BHTA 3LJ0A 2PL0A 4O1OA 2C4GA 4EZKA 4BY9E 3A33B 3AQVA 3CTJA 2GBMA 2RFEA 5CVHA 2BDJA 3PPKA 3EL8A 5EDPA 1H00A 1C1YB 1VYWA 4ANUA 4JXFA 2X7OA 4M3QA 3KF7A 2QR8A 4LV8A 2XA4A 3R63A 1RAXA 5B0XA 2OKRA 3IFWB 3M1SA 3L17A 2B1PA 2WOTA 4FSNA 2VGOA 3DZOA 3OD6X 2WELA 4TYJA 4ZTNA 1YD8U 3KA0A 2MSED 4DTAA 3QRTA 4BWPA 2VRXA 4RFYA 2Z7SA 2LD9A 2Y5BB 4HPUE 5K0KA 3P0MA 1WFCA 1MRUA 1Q97A 3RT3B 4F64A 3VIDA 3L13A 4XG9A 1HCKA 4QQCA 1G6JA 2R7IA 3RP9A 4FKOA 3A1QA 3DFAA 4MXAA 3MTNB 5KMKA 1PXIA 3IHPC 3HV7A 1M2RA 4MNEB 4P5ZA 2ITWA 2O2UA 3QAME 4Z9LA 3WE8A 5CAQA 3D5XA 2LASA 4IAZA 4IM3A 2HWPA 2OBJA 3VW6A 2IO2B 4XNEA 3ZRMA 3LFNA 4IB3A 4J7BA 2KJRA 4WJOA 1YIWA 2XB7A 3P9JA 4NM3A 4E4XA 2K8HA 4G0NB 3O8PA 3MVHA 2KNBA 4XCUA 2X6EA 4P2KA 4EZLA 1R39A 3Q60A 4UYNA 2BKZA 3KYCD 2DZKA 3PLUA 2AL3A 3AC1A 4TL0A 3W32A 4JI9A 4JQEA 1JKTA 3QC9A 4DFXE 3X0WA 2PHKA 4NTTA 4NFMA 5HO6A 3GU8A 2XRWA 3ZMMA 5IQIA 1OGWA 5FXQA 3WIMA 3D5WA 3VBYA 4AOTA 4QYEA 5AV0A 3RALA 2RIOA 3PA3A 3HP2A 3JYAA 4JG7A 3QD4A 4H36A 5DEYA 4BDHA 3NW7A 2P0CA 3DXQA 3JW0X 2WMBA 2PZIA 4LRJA 1O6YA 1TQIA 4KS8A 3SD5A 4H3PA 3TIYA 5C4KA 4AOJA 5C4LA 5IAAC 1TZ1A 5DA3A 4HZSA 1V0BA 4C3RA 3VBTA 4AA0A 5DT0A 2CHLA 2R3NA 4J71A 4IW0A 4AZFA 4DGLC 5KX8A 1ZW7A 1KWPA 2BTRA 1B39A 3K3IA 5IEVA 2CKOA 2OK1A 4YHJA 1ZLTA 5DE2A 3ORIA 3W1FA 3EECA 3QQLA 1NT2A 3SG8A 3EB0A 3FYKX 4JGHB 4NUSA 5AWMA 4AGCA 3PG1A 5L2IA 1J3HA 4I94A 1H25A 3UF8A 1V1KA 2W06A 2YJSA 4RSSA 5ACBC 4U40A 3CS9A 4RX8A 3PSDA 3RNIA 5LWNA 4KD1A 3ZKJC 4ITHA 3ORMA 4C38A 1WE7A 5M4UA 5AIRA 2YN8A 5IMXA 4L7SA 3K5VA 1J1CA 2VTAA 3MDYA 1PMEA 2UW4A 4RLKA 4RIXB 3DXNA 1GUAB 1J8CA 3TM0A 3M42A 1PQSA 1PKDA 2JLDA 2W1EA 3HEGA 4O0SA 3LVPA 3FXZA 4EC8A 2QONA 5K0XA 4DF3A 5DR6A 1RW8A 5CXZA 3OW3A 4DFLA 2FUHB 4D1SA 4YHTA 2J90A 3BGPA 2GMXA 3M62B 2CGXA 3KGAA 3G90X 3OY1A 3I79A 3TL8A 1R4NI 3KRJA 3TUDA 1O9UA 4NIFB 2B9IA 4TNDA 3QGWA 3DBSA 2KX3A 4ID7A 3ZO4A 2O6VD 3ZTCA 4C34A 2CGUA 2XCHA 3R8LA 4G2FA 2W9FB 4HK2A 2CHZA 1KV2A 1SYKA 3WILA 2QKWB 4E71A 3MS9A 3UIOB 4DCAA 4BZDA 2C3LA 3PP0A 5H8GA 5E91A 2YHVA 3FKLA 4EZ5A 4JT3A 1H26A 3B2TA 4C3PA 5JGAA 4RIOA 3QXPA 2ZMDA 2DZJA 1VD2A 2OJRA 3APFA 4IEBA 2MP2A 3LPBA 4UWYA 4D9TA 2DYLA 4WG4A 1NVRA 3Q52A 4TTHB 5D9HA 4GVJA 4PWNA 4ZLZA 3IDCA 4DK5A 3QYWA 5AR3A 4IM2A 2WQEA 3OUNB 1GNGA 4MXXA 3WZJA 3HRFA 4CFUA 5GNKA 4EYJA 5HLNA 1E7UA 5FM3A 4RFMA 2KQ7A 2PE6B 5D7GA 4OTWA 3ZC5A 5AP3A 4ZY5A 5J9ZA 1JSVA 2UVXA 3DDQA 3O96A 4EZJA 3I7CA 3AD6A 3F2RA 5IQDA 2RG6A 4DGMA 4EOPA 4FADA 4HVSA 4OW8A 4HYIA 5G6VA 2E2BA 3I6UA 4DXAB 3ALOA 4QNYA 5F4NA 3ZTXA 2QOHA 2CNVA 2XK5A 4YC8A 2C30A 4O91A 5M55A 3QQHA 2R2QA 2WMTA 2JFMA 3N3KB 4CKRA 4W9GA 1FGKA 2OOBB 5EYDA 1YHSA 5EW8A 4C33A 3L16A 5M08A 2F7ZE 5AUUA 3ZNGC 4DFYA 2GQRA 5D1JA 4WNOA 5HHWA 3REPA 2BKFA 3KUDB 3A4PA 5E6OA 2ZM4A 4V01A 3JSVB 5BVFA 2ZM3A 2PVKA 3JXWA 4KSLC 1DI8A 1Z2MA 4ITIA 4ANOA 2BDWA 3ZFXA 3VBXA 5HI2A 3FBVA 2RKUA 3NNUA 2JITA 4X3JA 5AR5A 5GZAA 3B1LX 4GDKA 1O6KA 3TKHA 1M7NA 4RJ5A 3GCSA 5ETAA 4U45A 3R7GA 3WZKA 2A4ZA 4O1PA 5C8KA 4XH6A 3PTGA 4F1TA 5DPRA 2BKKA 4IANA 3BI6A 4G9RA 3AG9A 3R8PA 2HZ0A 2XRUA 4W9DA 4EOQA 5L2WA 4RX7A 2YDIA 3WARA 4QYHA 4FSWA 4OTHA 5E7RA 2Y9QA 1P4OA 2B4SB 3ZSHA 4GGQA 2I6LA 3S2PA 1WVWA 2UW9A 4NJ7A 1OUKA 5DH3A 3R83A 1H24A 2ITVA 4FTKA 2FSOX 3FQEA 4AOFA 1FVRA 3ZNZB 4BBEA 4I93A 2JKQA 3QC4A 4QMSA 1ZMVA 3V01A 3ZFYA 4YUQA 4OTDA 1K8RB 2WTKB 3MVLA 5DN3A 5EOLA 3CPCA 3F3TA 2XK4A 4HOKA 4ENYA 4PPBA 1MG8A 3E63A 2VTTA 3IQ7A 2DQ7X 3RPRA 1V6EA 1B38A 4XZ4A 2ITUA 4F7ZA 1OPJA 4JBQA 2BDFA 3DQXA 1URWA 4YBKA 5BX0A 4NCTC 1LFDA 4PP9A 3GVUA 3WF5A 3WYYA 4M8NA 3ZRFA 5CT0A 1KE9A 1OPKA 3QQKA 4H3BA 3PVLA 4G3XB 1QCFA 4TQ1A 3F61A 1K2PA 4G9CA 4XX9A 3RCJA 5ANDA 1D3ZA 4CRLA 3CE3A 3TKUA 3VS3A 4BGQA 4BWKA 4YTFA 3QIJA 3TBLD 4L53A 1NW1A 2PMIA 4OTPA 5AAEA 3IPHA 4ZS4A 3R0TA 5IQBA 3AT4A 3RK7A 1H8CA 2C47A 3PXKA 2BTSA 3GU6A 2XK8A 3QKKA 5CAOA 5M4CA 2G4DB 3Q3FA 3FI8A 4F9BA 4TRLA 4FV2A 3R1YA 5DRDA 4D4RA 3CGOA 1NVQA 2C5VA 2I0HA 3COMA 4M69B 3KMUA 1WBOA 4QP3A 4TYGA 5FP6A 5IQAA 4W9EA 1GC6A 4N6ZA 3OXIA 1E5WA 2BZKB 3R6XA 4LYNA 3Q96A 3E3PA 4UY9A 3VUYA 4K0YA 3PUPA 4IACA 4WWPA 3ZBXA 1AD5A 4FTMA 3DDPA 3W2CA 3TJPA 3QX1A 1W0XC 3E8EA 4ASDA 3P78A 4LGGA 2G45B 4S30A 1U5RA 1WBWA 2Y4IB 4WRGA 4EH8A 5HVKA 3IW5A 3BCEA 2KWCA 3ID6C 2JUOA 1Y6BA 4QMXA 5M44A 2Y7JA 4PYZA 3FLSA 2WWZA 4PS3A 3BE2A 5B7VA 4FKJA 4QP8A 4FNWA 4QP2A 3VS7A 4DA5A 5D11A 5CX3A 1IASA 2ZJDA 4I92A 3QC8B 1GY3A 3F82A 2C6KA 1FGIA 3R7QA 2C1BA 3KULB 2OZOA 4I5MA 4F9WA 4IBMA 2HK5A 2OWBA 4YZCA 1E1VA 3ORZA 4RLLA 4X2JA 3VVHA 4DINA 4ZSJA 2OI4X 5A4CA 3EN7A 2I0EA 4AN3A 4XG2A 4GH2A 4D9UA 5A6OA 4CLJA 2KJHB 2CKQA 1UWJA 2CLQA 2PEAA 2XKDA 1UV5A 2DUVA 1K9AA 3E8CA 3GQLA 4IDVA 3BYUA 3D4QA 3IGGA 4K1BA 2C3IB 4TUUA 2RPQA 3CTQA 1DAWA 3KVWA 4CT2A 5EI2A 5LJJA 1YVJA 2XYUA 4FK3A 1OKVA 4CZYB 4XBRA 4ANQA 5KKRB 4YU2A 3UIBA 2GNJA 4APPA 4FV9A 4BC6A 2XEYA 3PA4A 5BUJA 4DC2A 3GB2A 1E8YA 5D7VA 2CR5A 2PE2A 3DOWA 3RYTA 5I0BA 3KVFB 4BDCA 1ND4A 1W7HA 4C4JA 1E9HA 3CSFA 3U87A 5IA7A 3UJGA 2IZTA 1SNXA 2UZVA 5FUTA 5M09A 1I09A 2BGFA 2OW3A 4QTBA 3THBA 3B8QA 4PMMA 4QMVA 4AE6A 4DYMA 3IW8A 3PVBA 5IUIA 4USFA 3CSTA 4CZTA 2WTDA 5L8KA 2OSCA 1W83A 4P5QA 4AP4C 5LXIB 2J0IA 3SX9A 3HLLA 4ZAUA 5ICPA 3W8QA 3SHQA 2BRBA 2ASQA 2WMSA 2OXDA 3QFVA 1PXOA 5HO8A 4K2RA 4C58A 4LI5A 5HU9A 1UZXB 2K8BA 1UKIA 1UA2A 2OICA 2YAAA 3RCZA 5HD7A 3IW4A 2QQ7A 2ZMCA 4W4XA 2EB3A 5LCKA 5C27A 4BKTA 4KRCA 3PVGA 3ZUVA 4D2WA 4C2VA 5FR6A 4ANWA 2XK9A 4TKNA 5DNRA 5JQ8A 5HLWA 1H1QA 4GFGA 5CNNA 2VV9A 1P1AA 2WX0A 3A4RA 4EH6A 3PTFC 2OLCA 3DBQA 3QQUA 3PYYA 1WE6A 3VUIA 3C5IA 2ZV8A 4CD0A 4M97A 3BWJA 4YTCA 3HUCA 1PF8A 3PREA 4XV1A 4ZY6A 3H6NA 1OBGA 1OTRB 4FIFA 3PLAE 3TL5A 3H0ZA 2L00B 2V22A 2XP2A 4M0WB 4RJ6A 3DU8A 4K18A 5HE0A 4E3CA 5E90A 4WQOB 3QL8A 3QRIA 3GCVA 2X0GA 3PXQA 3HMOA 4OUCA 4GIHA 4K9YA 1OUYA 4TW9A 2MBEA 2X6DA 1UU8A 2BF8B 1YOLA 2LRWA 3UE4A 3A2CA 3BEGA 3R30A 3DNDA 3VBVA 4AW0A 1H0VA 1ZWSA 4FKGA 3NS8A 4DBXA 4BYJA 3V5PA 4JAJA 2HENA 1W8CA 4IB1A 4DLJA 5EDQA 4MX9A 4I41A 5A4QA 4O0YA 3TT0A 3RCDA 3Q32A 4AAAA 1OL7A 3FC2A 5FWKK 3F66A 5KZ0A 4EK3A 5HO7A 4RM8A 5AZFA 2EKEC 4W4WA 4DH5A 4E6CA 3FSFA 3NYNA 1UNHA 4NFNA 1H1PA 2ZVOA 3I81A 4MAOA 2GCDA 3KY2A 2YM5A 5FM2A 4QYGA 5EM8A 3VULA 3BY4B 4KSQA 1P4FA 4MXZA 4QMZA 1OIQA 4M0YA 1WMHB 5EHYA 4G16A 5IQCA 4EOSA 3ZDTA 3Q9XA 4WJNA 1WZYA 4L3JA 5EW9A 4BDDA 1GOLA 3S0OA 3R7OA 4ZTRA 1OB3A 2YIRA
chains in the Genus database with same CATH superfamily
3TNIA 3BBWA 1FXAA 4N59A 5KUPA 4ZTSA 5M57A 3C7QA 4JS8A 2VTOA 3QZFA 3WF8A 4FIIA 4PF4A 2IN6A 4ASWC 1RWSA 3QTSA 4O7TA 1WCCA 2KO3A 1TS3A 2B9JA 3QCXA 3SD0A 3X23A 3FYJX 4BI0A 3A99A 3FPMA 2GU8A 2FCNA 2XIRA 3H7PB 3F88A 2H88B 5LLIA 1YXSA 3IDBA 4M7IA 1WGDA 3FXWA 2OEDA 3GOEA 3CBLA 5BMSA 3DCGA 5I9ZA 2G4SA 4CGAA 4HCUA 4JBVA 1N60A 1WJ4A 4MT5A 4BGGA 1XH7A 2ZAZA 4W4VA 1EUVB 4QTEA 2PZYA 3SW7A 1Q8UA 5JN2A 5ANGA 4MWHA 2ESMA 1ZGUB 1PMUA 2KFKB 4Y5QA 5JHAA 3D2IA 1ZAOA 3RGFA 1UF0A 2PMVA 4OZAA 4KS7A 5DPTA 2UZEA 1U54A 5E8WA 3PRPB 3NR9A 3PFYA 2YA9A 4B9KA 3VAPA 2FSMX 1YX5B 4FL3A 1H1WA 1XCQL 2XNNA 1YI4A 4BI1A 5J17A 4M15A 5I9VA 3ETRA 4BOSC 1IGDA 5K5XA 2YM8A 4MSQB 1EU4A 3OG5A 4WNPA 2R64A 3AC2A 3VDZA 4HKQA 2QOLA 5L8JA 3DQVA 4U0IA 4G3FA 3MFUA 3VHTC 5CAVA 2CN8A 4UWBA 3W0RA 4CO7A 1FEHA 4HPPA 3U9CA 3PV1A 3ZIMA 3H9FA 4K3BA 3MH3A 3KFAA 3I5JC 2EU9A 2SAKA 2INDC 3PXFA 1PYWD 3I5ZA 2YZLA 4KINA 1WX7A 4N57A 2K22A 2QODA 1A70A 4MEDA 3ZM9A 2RSUA 2X2MA 3QU0A 3PRMB 3A9JB 4M0ZA 2UYZB 4RC3A 2WMWA 2BWFA 3AT3A 3C51A 2CKPA 5EG3A 3AGLA 2R3QA 2VWIA 1VJYA 4R5YA 4BJJB 2GBJA 1ISNA 5HVYA 5FBOA 3UVRA 3TJDA 1NVSA 3HX4A 4GMVA 2W0JA 1FBNA 1IBXB 1SE9A 1QMZA 4WT6A 1BL6A 3HA6A 4NW6A 4YTPB 2XALA 2JXXA 5H92C 2EMSA 4B9DA 2HYYA 4WWMA 2ZNVC 1OEYA 2GS6A 3VFKA 2LHEA 1ZKHA 3W2DA 4ALWA 1N5XA 5EE1A 4GIIA 3H1UA 2WEIA 5AUZA 4I3ZA 4AXDA 2BAQA 4ZZOA 2XKEA 3EQFA 4HVGA 2DZIA 3QALE 5EM5A 3DLZA 4O7VA 2NBWB 4IZ5A 2LGYA 3I9V1 2XNMA 3EQGA 5HQ0A 2JF5A 3RTPA 4OAVB 4EONA 3R7IA 3IG7A 2QR7A 4FJZA 3NCZA 5KNJA 1PKGA 2J0MB 5HCYA 4U79A 3IG3A 3MPTA 4HPMB 1VZOA 1JLUE 3RWPA 2VUWA 3RM6A 1GB1A 2M4NA 4QMOA 4LOPA 5JFXA 4TT7A 4XP0A 2MRPA 3U4UA 5CAPA 4MGZE 5CY3A 4L1BA 2V0DA 2W1FA 1QT9A 2DYBA 4LDTB 4BCMA 3KWLA 4ARKA 4W9FA 2HW6A 2W1IA 2WXJA 2WDRB 4Q2JA 1MP8A 3GOPA 3TV4A 2ONLC 3EOCA 3FXXA 3QQFA 4G3CA 4FIEA 3DZQA 4IAYA 4AQ7A 4O1NA 2PE9A 2YWVA 3A8WA 2D07B 3H9DA 4L44A 4FHKA 4PS8A 4WA9A 1UH6A 2KKCA 2F49A 4PMPA 3TV7A 1W98A 2C0OA 3AC3A 1Q3WA 3P4KA 4E20A 2KWDA 4DTBA 3RZWC 2BWES 2KTRA 4X57B 4EK4A 1V9JA 5EQEA 1MVKA 4FOCA 3OWEB 4RPVA 4FSUA 4HJOA 3FWQA 4AACA 2FH9A 4HVHA 1A9UA 3ONSA 3DBLB 5DT3A 4HCNB 3RPFC 3DTWA 1RM6C 2J0KA 5IISA 3OZ6A 4EZ7A 4HVDA 3GOKA 1FRDA 4IWQA 3LXLA 4F7NA 2ON8A 4GT3A 2YFXA 5HTBA 2I38A 1AQ1A 3CLYA 1PXKA 1YWVA 4B6WA 5M56A 3BGQA 3GS2A 4NJ3A 4BRXA 3R2YA 4GCJA 2RSVA 1Q5WB 3R8ZA 1OM1A 2RD0A 4W9CA 4L7FA 1U59A 3ANRA 4U80A 4L67A 3QXOA 2KX0A 3ETAA 3I6WA 4BTKA 2XNPA 4YBJA 3ZO3A 1YXVA 2GB1A 5DHJA 3A1QB 5KHOA 5KCVA 2FBWB 1TYGB 1HXYD 1GJZA 4W9XA 1IAJA 1WI0A 3Q6UA 3DK6A 3KREA 3ORNA 3O50A 5DR2A 3RNCC 3BYVA 3E8NA 4MVFA 4REZA 3HUIA 3QRJA 3AEGB 3FY0A 4TYHA 5IEXA 4KZCA 3M2WA 2WGSA 1TVOA 4NZWB 4ZRKA 2C5YA 4E6QA 1EF1A 5HIDA 2JWUA 2XEWA 1QPEA 1WM3A 3TUOA 1ZYLA 4IX3A 4FHJA 1IG1A 4QTCA 3LFBA 1VZ8A 1APME 4AQKA 1PXLA 3AE9B 1OBDA 3U8ZA 2R3HA 3ML9A 3CKWA 5BYQA 2E3TA 1FVVA 2BALA 2C6EA 4J98A 1ZYCA 4C61A 3ZRKA 1F0QA 1ZYJA 4O7WA 4Q9SA 5IH5A 4AN9A 1I35A 5EFQA 1WXAA 3DK7A 4CT1A 4YHFA 3V60A 2OH4A 4FV1A 4RA4A 4NQLB 5AV4A 3EQRA 1FXIA 3FMHA 4NTSA 4L52A 4ANNA 5D41A 3TIZA 2XIYA 4GN1A 5E6NA 3NVVA 3V6EB 3PJ1A 1QOBA 3VS1A 4DLIA 1ESFA 4CYIA 2VWXA 2QOBA 1VEBA 2REIA 2C0IA 2C0TA 4RVLA 2XK3A 3OOGA 2NPTA 1RQQA 5G2NA 3A9KB 3QLGA 1P7EA 2QOOA 1TKYA 4FVPA 3EQHA 2GI9A 2WTIA 4DWFA 4PPCA 3B0AA 2JFLA 4DHZB 1YWRA 1MQ4A 3BZ3A 1YQ4B 3ENHA 3OWPA 2FIFA 5HBHA 4RWKA 3ZVVA 3DKOA 4KIPA 4WQOB 4XP3A 3HK0A 3MVJA 3DHHC 2INCC 4L01A 3NYOA 4MBLA 4D2VA 1LUFA 3LFSA 3OFMA 4DGGA 3Q2JA 5CU4A 2LVOA 1HTOA 3U30A 1WR1A 3HHMA 2BRGA 3JYUA 1P14A 5FLFA 2KACA 3VQIA 1XXGA 2GOWA 5CYIA 3SXSA 2VNYA 3HKOA 4FJYA 4BB4A 2PE1A 3BHYA 4IVAA 2CNUA 2GFCA 5H8BA 3A4OX 3LXKA 3SLSA 4QP7A 3H3CA 2JZZA 2IVUA 5DR9A 5BYRA 4IWDA 1WGGA 4CKIA 2L05A 3UP7A 1F5QA 5FG8A 3L1SA 2IPKD 4D0WA 1YQ3B 3FSKA 4QMQA 1REJA 4GK4A 3RPVA 3O13A 3ODYX 5KMOA 2PY3A 1YHWA 4G3DA 4BDEA 4QYYA 4R78A 1G5SA 3VS5A 2C5LC 3LFDA 4KABA 2MCNB 2L52A 4OTGA 5CU3A 2ITPA 3ET7A 4L45A 4F6SA 5L95C 3NRZA 4ZS0A 2Z02A 2W9ZB 3DB8A 4BBMA 3PPZA 3T8MA 1SBBB 4L3LA 4ANOA 4M69A 4QTAA 2JZPA 3VO3A 4ONAA 4A9AA 2ZDUA 3QQ8B 4FTNA 2XKFA 4MJSB 3BINA 3I3TB 5AAGA 2QHMA 3EC8A 4XG7A 4L6QA 2FIDA 5DRBA 5K4JA 3HRDD 3KW5B 4IWPA 2MHJA 2QOKA 1WBTA 2BPMA 1WX9A 2Q0BA 1P2AA 1E8ZA 4KRDA 3A7JA 2WNTA 1CK1A 2WOUA 1L3RE 3KLSX 3A8XA 3UGCA 1JSUA 2D3GA 4QAYA 1DOIA 2YIYA 4OBQA 3BBTB 5EQPA 3R7RA 1LPUA 3O51A 1R0PA 2PUNA 3IOKA 4AS0A 4JG6A 5C01A 3NUXA 5I3RA 3E87A 2RDHA 3SFDB 1TTNA 2VWZA 4JVGA 5IA3A 4OBOA 4IOIE 4A3OA 4GB9A 2XZSA 3MB7A 5J9YA 3C0GA 3R8UA 4GSBA 4C62A 4FL1A 4HEA1 3U6HA 5E8VA 3DA6A 3GQIA 4MNEA 3QWKA 4FI1A 4QRCA 1ZMUA 4FEVA 3Q4CA 3RI7C 4XG6A 5CASA 1XT9B 3FKNA 4BCKA 2XNEA 3ZJTA 4FK6A 2QHOA 3COIA 5ETCA 4FZ7A 2JDRA 3ZONA 3BL7A 3EFUA 4FTTA 4I5CA 5AA9A 2VAGA 2R9SA 1TS2A 3LFQA 3D14A 1V2YA 5AP5A 2Y3AA 4DT8A 1IA9A 1YI3A 2W9NA 1NA7A 1W2FA 2R3JA 5IZFA 4PX6A 4YL8A 3ATTA 4O22A 1UWHA 4KBKA 2FSLX 3U9NA 5L8LA 3I5NA 1YW2A 1GC7A 3TACA 5EM7A 4YJPA 2N7DA 3AGMA 3TTIA 3T3UA 4TXCA 1O6LA 3IONA 3SFEB 2F9GA 4GVAA 5HI1A 2XF0A 3H9OA 3R9NA 2O65A 1KJTA 4AN2A 2D3AA 2J7TA 2XNBA 3NVMB 3E64A 4OGRA 1J0GA 2OFVA 1DM2A 1U54B 3VUTA 3H7PA 3NSZA 3L08A 3HDMA 3FLYA 3L4PA 4L00A 4O7ZA 1N62A 3FILA 4FV7A 5TE0A 4AGDA 3SW4A 4DBGA 2C6DA 2HZNA 3KXXA 1FQ1B 4F0FA 3P86A 4RJ4A 2RR9A 3IBEA 3OROA 3O65B 2XM8A 4C8BA 1V97A 2E6XA 2JD5A 4XS2A 2V3SA 4RC2A 4R3RA 2JAVA 4MBJA 3IW6A 1WZ3A 3ZDUA 3QTQA 2L76A 3RK9A 3OS3A 4G11A 4BICA 3UZPA 3VW8A 4QOXA 2BIKB 2J50A 4FTCA 4F9CA 4HNFA 5HIEA 3Q04A 3POOA 2YM6A 1K3AA 3BK1A 3PT2B 4K8AA 3MN3A 2OU7A 1Y57A 2BFYA 4PL3A 4RIYB 4UMQA 2IW6A 4EI4A 3AN1A 1E8XA 1H01A 3ORTA 4TMAB 1T5XD 4HGTA 4MHAA 4D2TA 5LVLA 3D5UA 3GU7A 4O4BB 3BVZA 4WG5A 1XH6A 3TZ9A 4AOIA 2ICIA 2C6MA 1Q8TA 2BYFA 2WFYA 3Q5IA 4N9F4 1YJJA 1NDDA 4YO4A 2X9FA 5IPJA 4KBAA 3MWUA 4EH2A 5CNOA 4XWWA 3ZDIA 2WXNA 3IAS1 3ZCLA 3VRBB 2KWUB 3RZBA 3EYHA 5JK3A 1PHKA 3R9RA 4YGAA 3EFCA 2BS4B 3PA5A 3BYSA 1UELA 3F3UA 3BV3A 1QPJA 3UIPB 2OF4A 4RNAA 1T45A 2W96B 5DPSA 4ZYNA 3PXZA 5AP7A 4FKUA 4KKGA 5TKDA 4M00A 1KH0A 4DBNA 2B76B 3APDA 3TNQB 2QDFA 1DYQA 5KO1A 5CSHA 2GMIC 1L0XB 2PLPA 3EN4A 2V3NA 3W1SC 3HAVA 4UEUA 5AUWA 1ZDVA 3UDZA 1WXVA 4BF2A 3FLZA 5M51A 1ZP0B 4K7SA 1U5QA 2FAZA 1MRVA 5IU2A 5AUYA 4HDOA 3Q4TA 3ZZEA 1C4AA 4I6LA 3OCBA 2DS1A 4YSZB 2R3MA 3EKNA 4NW5A 3EZVA 2HDEA 5JMSA 2WMVA 1ZXHA 2X81A 3SDLC 1D6EC 3F2AA 1P98A 3HV6A 1R1WA 3ZLYA 4RBLA 1QOFA 4II5A 3T8OA 4O96A 2MP2B 2J4XA 3AEDB 4NAMA 3V3VA 3VHKA 4YPDA 3LMGA 3BVMA 2WXHA 3QX2A 2UZNA 4M8TA 2W17A 3GFWA 2PUIA 3BVGA 1OVEA 2OJJA 3ZLZA 1QPCA 3CJFA 2HIWA 2WXPA 2JRHA 2OJGA 1X8BA 1TBEA 3L10B 4NK9A 4X7QA 4TWPA 4QNAA 1G8JA 5IMEA 5AUVA 2M0AA 3ORPA 3AULA 2JX5A 1M14A 4YR8A 1BT0A 3U4WA 4Q5HA 5DI1A 1T0YA 3E93A 2PULA 4O4DA 4WNKA 4X6RA 5BYYA 4FTJA 1M52A 4PL4A 2M17A 3GBZA 2X0PA 4R1VA 3B2WA 2LGSA 4NQKE 4LTUA 5CEKA 5EYMA 3MC8A 2C6TA 4O4EA 4IZYA 2C3KA 3UYSA 3QD0A 2QOIA 2EMTA 2Q83A 3FI3A 3FL4A 3LXPA 3LLAA 3NUPA 2JKKA 4KV2A 4A4XA 4EKLA 2NO3A 2XM9A 2JKOA 3BQRA 4LGDA 1GG3A 4C3FA 4BWXA 1BL7A 4W8EA 5C3JB 3VUGA 4FVRA 2BRMA 4FEUA 4Y5HA 5AV2A 5EE3A 5ANJA 3SC1A 3PY0A 2O0UA 4R3DA 1GOZA 4C56C 2CU3A 3PGEA 4ICUA 5EKNA 1WBSA 4CKJA 1TQMA 4FR4A 4A4LA 1Z9XA 4U6RA 2F7EE 4OVVA 4FT3A 4G6NA 5HE3A 2ZNVB 3ALNA 3R04A 2G15A 4KAOA 4IC8A 1IR3A 1FINA 4OVUA 4KKJA 4U41A 5DGZA 4HGLA 4FSYA 3ZH8A 4ZOHC 1EO6A 1SZMA 2BRNA 3SDJA 5HCXA 5ETFA 1E10A 1OFFA 1RLFA 2QKRA 3BEAA 4F0GA 4FJVA 3GZNI 2VO3A 2NBVB 4K11A 4E5AX 3M63B 1XO2B 1WVXA 3UIMA 2JVCA 3AC5A 2VTIA 4AZEA 2A98A 2Y4IC 4E4LA 4PYUA 3BYTB 1YDSE 4B4LA 2XNAC 3D32A 5M4IA 3EN9A 1Q1OA 3OXZA 4F7JA 2VTRA 4F09A 1ZMWA 5HCZA 4JX1C 3JVRA 2SRCA 4FKPA 4YTNB 2WHBA 2VRRB 2J0MA 4ZMEA 2AEHA 4GT5A 1F2RI 3DBHB 2XJ0A 5CLPA 3OWLA 3MTLA 2JKMA 4GOCA 4OZCA 3SG9A 2OIQA 2J5EA 5AJQA 3ZXVA 3CMMB 3TNPC 2FUMA 2UW8A 4D5KA 5LMAA 1SSNA 5DOSA 2PSQA 4FV5A 5E1EA 3H10A 2GBMA 5CVHA 5EDPA 1H00A 4YT0B 2XA4A 3R63A 3L17A 2OKRA 3QRTA 4RFYA 3P0MA 4F64A 5BYSA 1G6JA 4FKOA 4DQOC 3DFAA 4P5ZA 5CAQA 4Z9LA 4IAZA 2HWPA 4NM3A 4G0NB 4LLGM 4XCUA 4EZLA 3Q60A 4JQEA 2PHKA 3GU8A 1OGWA 5FXQA 3RNFC 3VBYA 4QYEA 3HP2