4EUTA

Structure of bx-795 complexed with unphosphorylated human tbk1 kinase-uld domain
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
386
structure length
384
Chain Sequence
GSQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRNIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase TBK1
publication title Molecular basis of Tank-binding kinase 1 activation by transautophosphorylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 108
structure length 384
sequence length 386
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4eutA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4eutA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4eutA01
1WBOA 1ZOHA 4X3FA 1JNKA 3VH3B 4O7NA 1E7VA 4WBOA 1ZOGA 4WQOB 3FDNA 5HCZA 4WG5A 4QYEA 4IDTA 3QAQA 1OL7A 4ZSLA 3PG1A 2IW6A 4YZMA 3AG9A 4R5SA 4K11A 3BYSA 3VF8A 4JBOA 1ZYDA 5HIBA 1DAYA 1JSVA 2I0YA 4IC8A 3FXXA 3PE2A 5HKHA 1S9JA 4RRVA 2GOWA 1E7UA 2QHMA 3TIYA 3R9NA 3OTUA 3QHRA 4CNHA 3MJWA 3KKVA 2JFLA 1OUKA 5LCKA 3Q32A 4WG4A 5D9HA 2WTIA 2EMTA 3JY9A 4EH7A 4BDJA 4MJSA 3ALNA 5LMKA 1YXSA 3R2YA 4O0WA 2ASQA 3FI2A 5CWZA 5G55A 4O7VA 1JKLA 4DAWA 4RQKA 3NNVA 4XEYA 5AIRA 1V49A 5JRSA 3KUZA 3P1AA 2VO6A 4ID7A 5DPTA 5JSMA 3PZEA 4B0GA 4NCTA 2BAQA 5CI7A 5KZ0A 4FT9A 1WR1A 4FBJB 2WD1A 3F82A 2K6DB 2L05A 4BC6A 2RL5A 4AZTA 3Q53A 1NBFC 4BFMA 2XJ0A 5FLFA 1XBCA 4O1OA 4YP8A 2Z7SA 4KSPA 5EK7A 2VGPA 3OUKA 3R21A 4YU2A 4FV5A 4M69B 4J1RA 4DFBA 4G2FA 3OD6X 1K3AA 3VTUA 3DBDA 2IY0B 1Q97A 2Z7LA 4DGGA 2JGZA 2M8SA 5KMOA 3KCKA 4D2WA 4RA4A 2LASA 3KY2A 4E8AA 1KV2A 5CHWA 5J1WA 3FYKX 3ZMMA 3DDQA 1U5QA 4DH3A 2BKKA 4MNFA 3GC0A 3VF9A 3NHEB 5IF1A 4EJNA 3ZXTA 1ZAOA 4I3ZA 2EKEC 3CR0A 4GYIA 1WM3A 5EYMA 2J0MB 5CSVA 3ORIA 1V1KA 5LWNA 1SVEA 3RZWC 1DI9A 2ZNVC 4MXZA 2ZVAA 1U59A 2W1FA 4E71A 3WYXA 1KE5A 2FB8A 4OT5A 3QUEA 2VWIA 4L44A 2QG5A 3ERKA 4MM3A 5KKRC 2JDOA 3KMMA 1JAMA 2R3PA 2UVYA 5E90A 3QA0A 3DB6A 2CS4A 3ZO2A 2X1NA 3AC2A 3O7LD 4GDKA 1SGHA 2XK3A 1M7NA 4CFWA 4PRJA 1GJZA 4Y5QA 5CI6A 2WMAA 4CT2A 2J7TA 5J2RA 3ZDTA 5JK3A 4EH4A 3ZO5B 1FGKA 3POZA 2YZLA 5HCYA 5LARA 3GP0A 5I9WA 3ALBA 1IPGA 4HCTA 3T9IA 4S31A 1W0XC 5JQ8A 4DCEA 5C1QB 2N7EA 1OVEA 2I0VA 4JQ8A 4YJPA 2CDZA 3V51A 2BFYA 3TXOA 4CTBA 4ICUA 3VW8A 4BDKA 2WOTA 4I20A 5HZNA 5JHBA 4V0GA 1I42A 2ZDUA 4GDLA 1LFDA 2WDTB 3M3JA 5HNBA 3LJ0A 2C1BA 3ZLWA 4O86A 2VV9A 4S34A 1M2QA 1A5RA 5ANGA 3D2KA 2V0DA 5JT2A 2X8IA 3V5QA 4MXCA 2OZOA 2QR7A 2Z7QA 4NJ7A 3BE9A 1Q0WB 4CCUA 5KMMA 3F61A 5AA9A 4ZRJA 4FL2A 4N4SA 1WGYA 4QPMA 3TTIA 3ANQA 2JAMA 3PVUA 2BDWA 2EU9A 1UKHA 2JIIA 1RAXA 3ID6C 5DLSA 4BBFA 4WSYA 3ZU7A 2WMUA 1OB3A 2KANA 4RPVA 1P9DU 3VUDA 1OIQA 3B2WA 3JY0A 5K0XA 2ZYBA 2HIWA 1YX5B 4DDID 1R0PA 5CQUA 2JRIB 3CXWA 4E6DA 2B9IA 4KZCA 3LJ1A 1Q5KA 3TJPA 3TNWA 5AX3A 1L8TA 5GJFA 4WHZA 1PW2A 2R2OA 3D5UA 4DEAA 3PWDA 4QMPA 2ERKA 1PXKA 4ACCA 4K81A 4RFZA 1CM8A 3FSKA 2QONA 2WQEA 4FIHA 4IX5A 4PS3A 1GIJA 3CMMB 5HTIA 2DZMA 3U6HA 4OTIA 4NYEA 3RPYA 2UZWE 3TKHA 3HX4A 3NLBA 3PLSA 4BN1A 3IVFA 5DIAA 3DDPA 4JBVA 3L1SA 3HRCA 5EM5A 4H1JA 1MUOA 3VULA 2IZSA 1WF9A 4OBPA 4BDBA 3OOMA 3KRXA 3L8SA 5GMVA 2GS6A 4YTHA 2LI5A 4ASDA 4A4XA 1M7QA 4EH9A 3UOLA 4E5WA 1J19A 4G50A 3CKWA 3RULA 3VNTA 1P4FA 4U44A 1S1QB 3FXWA 3G2FA 2RFSA 4ZZOA 3QQHA 4IEBA 4ZAUA 3QHTA 3VBVA 3CTJA 1Z2MA 5JHAA 1F0QA 5CANA 2NO3A 5IA1A 4I6LB 3EFUA 2P3GX 2J5EA 4RM9A 1JLUE 3TJDA 3R1QA 2RIOA 4EOJA 3MY5A 1G5SA 3LJ2A 2C5YA 1J3HA 4B6WA 4MXXA 3H7SA 3C4EA 3O23A 4H36A 3KXZA 2ITZA 2IZUA 2OKRA 1GJOA 2YWPA 3UZTA 3UP2A 2REXA 2FIDA 3GVUA 2VO7A 1WJ6A 3RNIA 3V5JA 2PMLX 4X6RA 5M56A 4RMAA 3E3BX 5B2MA 2Y9QA 1X8BA 3HDNA 5HU9A 3FI4A 3BPRA 3BKBA 4D5KA 3A9JB 5CX9A 4EOKA 3R04A 1YOJA 4IWPA 2XCHA 5C4KA 3QQFA 3OWLA 3HA8A 2H9VA 2JIUA 4MBIA 1PQSA 4BZOA 3C4ZA 3QXPA 4ZTLA 4DINA 2X2KA 3M42A 2HTHA 3I81A 2XNOA 4GCJA 3S1HA 4DHZB 2UZNA 3EFJA 2YLEA 4NT4A 2YM3A 2E9NA 4TQ1A 4YZ9A 4IC7A 1SIFA 5IQFA 3QUPA 1PXJA 2HAKA 2KTRA 2XK9A 4HYSA 3ZZEA 4RJ6A 3LCTA 5EHYA 5DRBA 1ZW7A 1TQPA 3KVFB 2X8DA 4YJSA 4BWXA 3E8NA 3KH0A 3WIKA 2XNMA 2OO8X 1G3NA 4MXOA 2C68A 4W9JA 4APPA 4FEXA 1AGWA 4DFZE 2DZIA 2XK5A 4GEOA 2I1MA 3U4WA 4FKUA 3NCGA 3R7RA 2PZYA 3D32A 2W1EA 3H9RA 5KMJA 2YABA 4QMTA 4EC9A 5EDRA 2YLMA 4RJ3A 4K0YA 2XNBA 4RIXB 3JR1A 3R9HA 1UWHA 4ASZA 4Y95A 3LDZE 5IA4A 4FG7A 2G4DB 2VWXA 3WF8A 2W4OA 1UU8A 1H24A 4B95A 3ZNID 4RWJA 5J9ZA 4CFFA 4K2RA 2KXJA 1P2AA 2E2BA 4FSRA 3L9PA 4IDVA 2O6VD 2CHLA 4WJOA 1DM2A 5BUIA 1T46A 1WI0A 4RMZA 4KS7A 3DPKA 4P7EA 4AUQC 4K77A 1KSWA 3DBQA 3QKKA 3RUIB 3H7PB 3CE3A 2KKCA 5J7BA 2DQ7X 3Q4CA 3BQCA 4XJ0A 2OOBB 2LVOA 5AP5A 3S4QA 3UIMA 4MVFA 4M13A 2XIRA 3O8UA 3UVPA 4MF0A 5GZ8A 3PHWB 2OXDA 1KOTA 2FSLX 2IO0B 5AUUA 5DPVA 4HNFA 1WMHB 2WWZA 4TN6A 5EDSA 3U7DA 2BTRA 3HMOA 2WMTA 5IEYA 1J8CA 3KXGA 3SDJA 3G90X 4GT3A 3KRLA 5HTCA 3MV5A 3Q5IA 5FM3A 4CFUA 4EOSA 4QPAA 1PMEA 4K33A 3QD4A 3L16A 2YCRA 4M15A 1Q99A 3FWQA 3V8SA 3P23A 1I09A 3QUDA 3ZRMA 1ZYLA 1LPUA 3VVHA 3SQQA 3C4XA 1RE8A 4QP7A 3QTUA 1FVTA 3HYHA 2DZJA 4G5PA 4L9IA 4Q5HA 3LQ5A 4RX8A 3MVMA 4D4YA 2PVRA 3PZHA 4PX6A 3RK9A 5M07A 5AX9A 4U45A 1CKPA 4IB3A 5CVFA 1YDRE 4NAWA 3UO5A 4RM8A 2JVCA 2PSQA 5JFVA 4RGJA 2O6VB 1Y8GA 3U30A 5D11A 4EH8A 2RKUA 1JKSA 5IUHA 2KJHB 2HOGA 3TUCA 2W1DA 3ZKJC 5LJJA 3PTGA 1YX6B 5AZHA 4F7NA 5LXIB 3DFAA 4MDKE 3PA5A 1DS5A 5TO8A 5AR3A 3EN9A 4PNIA 1H8CA 2DYBA 3W32A 3OTVA 3EQDA 3QZGA 3QCXA 4QMWA 5F1ZA 2PMOX 3HKOA 4BCIA 2BHEA 2VTHA 4GJ2A 4AUAA 4AGUA 4FKVA 2XM8A 4HGSA 2C5VA 4I6BA 3N32A 2ZVNA 3P7BA 5JGAA 3F66A 2A5UA 4HGEA 4AA0A 3QTIA 2C6IA 4EH2A 1G8AA 3F2AA 2CHZA 3V5LA 4HXDA 3ZRKA 4F64A 5L2SA 1V5OA 3CY3A 2CMWA 4YGAA 2I40A 1PRYA 1ZGUB 1URWA 3KF7A 3WARA 2IZTA 4ZTSA 4A07A 4AA5A 3QKLA 2KDEB 3UIOB 4G6OA 1EF1A 3NVKI 3ZEWA 3BEAA 5TKDA 4X3FB 3KYDD 5L6PA 3WYYA 3RPSA 3CKXA 4HVSA 5IA2A 5ANIA 4CFMA 5AAGA 3QD2B 3O2MA 3OJ3A 4HW7A 5FWKK 4PL5A 4RIYA 4IVBA 3CEKA 3O8TA 4ZY5A 4O82A 1Q3WA 3TV7A 3W1SA 2H6DA 4TNDA 4HYHA 4RFYA 2Z0DB 4AAAA 5EH0A 1GNUA 4JLCA 5AUTA 3UPXA 3PVWA 2FH9A 4E4XA 2UW0A 3EECA 3LFFA 4XV2A 1OITA 2DAFA 3IW4A 1NY3A 4FTRA 3CQEA 3RWQA 3JUHA 3R63A 3R28A 4WD5A 4FTKA 2KX3A 1GC7A 1PJKA 4C33A 4MJSB 2C69A 5ITAA 1J7IA 2O65A 2W5HA 4RA5A 4X2JA 4Y46A 4FI1A 2PJHA 3VS6A 3BWJA 3EZVA 2Q0NA 4XP3A 4RC2A 3TV6A 3DBLI 2PE9A 4YLJA 5CYIA 2BDJA 1JSTA 2RF9A 1RDQE 3L13A 3JXWA 4DBXA 4EHZA 3ZFMA 4MQ2A 2O63A 4HJOA 2R2PA 2OFUA 1GNGA 1XH5A 4JVGA 4QQTA 4HZRA 1NI2A 2C60A 4G17A 3DJ6A 1GIIA 5C1ZA 2YCQA 3QHWA 5DYJA 2R64A 4I92A 3ZRCA 1NVQA 4M0ZA 5IDNA 1QPEA 4Z3VA 3L8XA 2NNWB 4IAKA 1V2YA 3NYOA 3CSVA 4RG0A 4PWNA 2ITWA 1W83A 5AJQA 4AT5A 2VX0A 2QVSE 3LFNA 4FT5A 5HG5A 4LYNA 3HZTA 2BZIB 1Z5SB 3ORZA 4JDIA 2HD5B 3EMGA 2ZPYA 4FEVA 3FZRA 1ZRZA 1JBPE 4W9KA 3BLQA 3WBLA 4DH1A 2LGYA 3OCGA 2CGUA 5L2QA 3DXNA 4XG4A 2LZ6A 2UZBA 5DPSA 2HE7A 3LFCA 2GMXA 3NVMB 2BVAA 3OEFX 5HLWA 4X21A 2X9FA 2QO9A 3PXZA 3PY0A 4DGOA 1WH3A 3MFUA 3FC1X 3AD5A 4Y5HA 2PTKA 4FIGA 1I35A 3NR9A 4EQUA 4BGHA 2JAVA 3IW6A 2UW8A 4FKIA 4ORKA 1OL1A 4WRGA 2PYWA 4ARKA 2UW7A 4FTOA 3RHXA 4CYIA 4N57A 1XH8A 1KWPA 2DYOA 2D2QA 2QHOA 4L3LA 4R5YA 3WZJA 1QCFA 4CRSA 4GDKB 4C4JA 3DVNU 2VU3A 3HV3A 2I6LA 5M06A 2Y6MA 2AL6A 4YTFA 5BO4B 5HTBA 3ZUTA 3QGWA 2R5TA 3GC7A 5B2KA 2JY6A 5J17A 3AULA 3W1FA 4KA3A 3V5PA 2HWOA 4YURA 1UD7A 2F2CB 2OW3A 3GFEA 3A7HA 2XA4A 4EJ7A 5I9VA 3DBCA 2Z02A 3NUAA 4FODA 2G01A 4JQ7A 3QA8A 4YZDA 2G45B 4OUCA 5DT3A 4EWQA 3LAUA 2WYQA 3UO6A 3CTQA 4V0GB 3UQAA 2O3PA 4BKSD 3Q9ZA 2F2UA 4GDLB 5CSXA 3DOGA 4TYEA 4G31A 4F6SA 5FDXA 2QU6A 3MH2A 4JAJA 4O7SA 4ZP5A 4BZNA 2MW5A 4URKA 3W2OA 1PY5A 3UIBA 2W1IA 2ZV7A 3NNXA 4BDGA 4EKKA 4II3B 2OBJA 2VNYA 3MY1A 2VWZA 4JX7A 3Q4TA 1QL6A 5A6NA 2B53A 5HO7A 3MA3A 4PMMA 4IMYA 2NS5A 4WJNA 4WJQA 4EORA 1PXOA 3T8MA 2BUJA 5CT0A 5ANKA 1OMWA 5DOSA 2BR1A 4RVTA 5K4JA 3HDMA 2JWZA 3L10B 2YHVA 5KNJA 2KWVB 4DTBA 4CKJA 4LUDA 3C4CA 1ZZLA 3QIJA 3FMEA 5CEQA 4M7IA 3VAPA 1VEBA 2OI4X 4M0YA 1IAHA 4LGDA 5CHFA 2CLQA 5BYZA 2VO3A 3QCAA 4BIDA 1WBPA 5DI1A 3MH1A 3UQCA 4HZSA 4BCGA 3DQWA 3ZRFA 3PVLA 5JRQA 2C3KA 4RJ7A 4FV0A 2XK8A 5IQGA 3OFMA 3LMGA 5A4EA 2XKCA 2VUWA 4JG8A 4FVRA 5K3YA 1WYWB 2ITNA 4U9AA 4ALVA 5HQ0A 2BCJA 4YJVA 4ANUA 2Q0BA 3LCOA 4DTAA 2ITTA 2PULA 2C7HA 4CKRA 3QC4A 2L0TA 3JSVA 4FTLA 4Z7GA 3PA4A 3FUPA 1YOLA 4FKQA 4D2SA 3ZRLA 4LOOA 4U79A 1YRPA 3SHEA 5BNJA 2NR2A 1IRKA 1BL6A 5KMKA 4A06A 2RSUA 3FKLA 1UELA 4KBKA 4JDJA 3BHTA 4CMUA 4F65A 4GMVA 3TL5A 5I9XA 4AU8A 2OICA 4O0TA 1H0WA 3KXMA 3O17A 3V6SA 4AOJA 2ZM3A 3B8RA 2QOFA 4RBLA 4YHJA 4DCAA 4CEGA 2C6TA 2RFEA 4EH5A 2VTLA 4P4CA 5CEPA 5I9ZA 3K3IA 3KUCB 3FAAA 4FEUA 4F7SA 2WMBA 4I0SA 4ITIA 3PFQA 2ZJWA 4OTHA 2C5XA 2KMCA 1BX6A 1PXMA 3RPVA 4NY0A 5DG5A 4F0IA 3P4KA 2ZEQA 2ZV2A 4C36A 5D1JA 1XT9B 4FTNA 3BI6A 4BKTA 4X2FA 4X57B 3MWUA 2XIZA 2XEWA 3Q3JA 4GJ3A 2N7DA 4OTRA 4C4EA 4HJKA 5IMXA 1OBGA 3Q5ZA 1IEPA 3SW4A 5GINE 5IUGA 2AL3A 3F69A 3QWZB 4ICVA 3UINB 1PHKA 4KAOA 1U4AA 3H10A 5H9BA 3U6JA 4FC0A 4DG2E 4RX9A 2C5LC 5AM7A 4FG8A 5G2NA 4AZWA 4ZJJA 5BVWA 3MBLA 4HPMB 3TNHA 4HDOA 1M52A 4AG8A 1OPKA 2I1KA 4FIIA 1ISNA 4DGNA 3WAPA 4IAAA 5HLPA 1H00A 4JIAA 4UEUA 5E8ZA 4BHZA 1LEZA 4F9WA 3FC2A 4XC2A 2VNWA 3DK3A 2LRWA 2BRGA 4K8AA 2W4KA 3E8DA 4IADA 4JJRA 2MBBB 2BDFA 4CT1A 4HGTA 3U9CA 2KK8A 4IC7B 3LM0A 2KC1A 4DBGA 1MQBA 1HCKA 3TZ8A 4MWIA 2A2AA 1Q41A 3ZUVA 3A8XA 2J90A 2KTRB 2JITA 3B1LX 5FP6A 1V86A 2A19B 5IA0A 3VDZA 2J0KA 4E5AX 1YWVA 3QTQA 5BVFA 4BKYA 4ZIMA 4EOQA 5L8LA 5EOLA 4DFUA 3FKOA 4OAVB 5ETAA 2XYNA 2ONLC 4PDSA 4TWOA 5E1EA 2Y0AA 2W4JA 3ZIMA 4DHFA 1ZMUA 3KC3A 5HE2A 2PVHA 4G9RA 1VJYA 3DPDA 4WUAA 5A4QA 2XK5B 3UDBA 2DX5B 3TWJA 4LL5A 3ZDUA 4RJ8A 5F94A 2BKZA 2R3LA 4G3DA 4BTKA 4PYUA 4WWOA 3EQIA 2O2VA 4G11A 3IECA 3ZONA 1YJ1A 4FTTA 3OMVA 4O21A 4UN0C 2W1ZA 4OLIA 4QTAA 2JXXA 4A3PA 5ACBC 4MXYA 4CG8A 4U5JA 3SGCA 2OF2A 1GZNA 1O6KA 2BROA 4PL3A 3TM0A 4S32A 1FMOE 3D5XA 1PKDA 3IDPA 3Q4ZA 4C3RA 3NZ0A 2K8BA 4BBNC 4PQNA 3TUDA 3PT2B 5JEBA 5AR8A 3FMHA 5AA8A 1J0GA 3FLZA 4KBCA 2KOXA 5BQ0A 5FG8A 3DXPA 3OP5A 2I0EA 3QZIA 4FGBA 1YW2A 4V01A 4YPDA 3GCQA 5E8TA 3FL5A 4EBWA 4CFVA 4MGYE 4A9YA 4XX9A 4F7LA 1HE8A 1OTRB 3D14A 5E8XA 5LCJA 3DA6A 2OSCA 1WGGA 3G9LX 1YD8U 4UWYA 4J52A 4L68A 3D4QA 3E63A 4F08A 4C3PA 3BBTB 3PVGA 3BQRA 4J53A 4BGGA 3N51A 2CGVA 3GUBA 3KU2A 3Q3FA 2IVSA 3FQSA 4KDLB 4GH2A 3KB7A 2QOIA 3BHHA 3A61A 5FGKA 2M4NA 3V6EB 2I0HA 1CDKA 4PS8A 4LGHA 1DAWA 3HM6X 4TTHB 4PPCA 1YWNA 2JT4B 5G6VA 2KFJA 3E62A 4G9CA 4DEBA 3LHJA 3KRJA 4L52A 3ZBFA 2F57A 4FF8A 5GIPE 1PKGA 5JKGA 3B0AA 1JKKA 4BCQA 2K1FA 4S30A 4FL3A 2PPQA 3GCVA 3ORXA 4FR4A 5GIOE 2RR9A 4O0SA 3MS9A 3LJ3A 5CALA 1XBBA 1UU9A 2QC6A 4W9CA 1UBIA 2QG7A 4FTQA 3N9XA 4NAWB 5LVOA 2HJ8A 2CPKE 3QQJA 4M84A 4AW2A 2QLQA 4O7LA 3BY4B 5KMIA 3IS5A 2NPTA 3R7VA 4DH5A 4XNEA 2QCSA 2KZRA 4BKZA 4L01A 4EZ7A 3HMIA 2M1MA 1M17A 5D7AA 4BBNF 1FMKA 4FKPA 3OG7A 5CAQA 2BKRB 3V8TA 2GQGA 4TRLA 2CNVA 4D0XA 4FV4A 2RFNA 3HIZA 3VVWB 1KM7A 5T6KA 3BEGA 4E6AA 4J6IA 4EFOA 2GHMA 3DK6A 3OY3A 2JKQA 3TZ9A 2P4IA 3H9OA 2UZEA 3C7QA 3APDA 3OS3A 1WFCA 3MIAA 3HL7A 3PA3A 4MKCA 4BCKA 3IBEA 4EHGA 3FMDA 4ZTNA 2KWCA 4DLIA 3GU4A 2C6OA 5TF9A 2BWFA 3DQVA 2E9OA 4ZJVA 2L3ZA 3A9KA 3UOJA 1MQ4A 4FOBA 1O6LA 4XG8A 4OVUA 3VN9A 4FSMA 3BYOA 5A14A 4O7TA 3ORTA 1R4NI 5CVGA 1P14A 1HCLA 2VN9A 3ZS5A 4YTCA 3I6UA 3KVXA 2FO0A 2B1PA 3VJOA 1OI9A 4KSKC 4TUUA 2WQBA 3CGFA 4M3QA 5FEEA 2C3LA 1WXVA 1Q5WB 4PYZA 1DI8A 2VX1A 5M44A 3A4OX 3WF6A 1OM1A 5AUWA 3A62A 5FP5A 5A4CA 4AQCA 4RIYB 3AU5A 1TQMA 3IPHA 2XBBC 1VYWA 2RGFA 4D58A 2BPSA 3QD0A 3R8LA 5AR4A 3ZVVA 2N9PC 1GOLA 5E1SA 4FSUA 3QX2A 1YI6A 2CKOA 4XG9A 5CU4A 4AW1A 4JL9A 4BL1A 4W9XA 3BV3A 4XP2A 5EW8A 3DAJA 2V5QA 3OY1A 4C4GA 3VS0A 1UWJA 4FKTA 4EOOA 1PF8A 5M51A 1LM8B 2VTOA 5BUJA 4UYAA 4NIFA 4UWCA 5HORA 4M8MA 3C0HA 4QP1A 4L6QA 2WMSA 3PXFA 1WIAA 1YDSE 1AD5A 4GB9A 3DAKA 3NX8A 4ZMFA 4JX3A 1KE9A 4R6VA 2JKMA 4YSMA 4FEWA 3UOHA 1FOTA 2A0CX 2PE6B 4LMNA 3NGAA 2BRMA 3KMUA 2Y5BB 3BHUA 1E1VA 4WUNA 1R3CA 4EH3A 5EQPA 4HCVA 4KZ0A 2QO7A 4NQKE 3RYTA 1IASA 5TE0A 3RAHA 5D12A 5E9EA 3ZDMC 1U46A 3QD3A 5J8IA 4MNEA 3CIKA 2YLFA 5EOBA 5D7GA 1S9IA 1H4LA 4GS6A 1OPJA 4APCA 4LDTD 4BYJA 3G9NA 2BALA 3NW5A 3Q96A 4FV7A 4JIKA 1H1RA 4G34A 1Z9XA 1JWHA 4PNKA 4M12A 2OK1A 2B54A 2J0IA 4FIEA 4AFJA 2G4SA 2OXXA 3DOWA 4DTKA 4D1XA 1J1BA 4FKOA 2CNUA 2IO2B 2N9XA 1WZ0A 1W84A 3ZDIA 2NBWB 4XP0A 4QMUA 1CKJA 4AE6A 3Q52A 3JW0X 4YJTA 3H0ZA 2N1VA 1F5QA 4TNBA 4O27B 1WR6E 5LLIA 4BF2A 4BBEA 2JC6A 4QT1A 4ZSEA 1LQBA 4XV1A 1X1MA 2NPQA 2R0IA 4AT4A 2P2HA 4A20A 4N6YA 1GZOA 4F0GA 3QRTA 1YQBA 2HWPA 4EOIA 3S0OA 4FKRA 3I1AA 4QYHA 5DT4A 2H96A 1OPLA 1KE6A 2JDVA 5KBQA 4D4RA 2GPHA 2MP2B 4AA4A 3D5VA 3ZLSA 3BHVA 2W1GA 2C0TA 2V55A 3AMBA 3QU0A 3VUXA 3HMNA 3L08A 4ANOA 1OIRA 3LLTA 5AR2A 2SRCA 1A06A 2CLXA 3OZ6A 5KMNA 5M4FA 4FTJA 3FPMA 1L2NA 2F4JA 3R01A 3M1SA 3F2RA 5AUZA 4W4XA 3TIZA 3NDMA 3EN4A 4WNMA 1LR4A 4LDTB 3VXWA 2CN5A 4JAIA 4GFOA 3VUTA 3BV2A 5E8WA 1V9JA 2UZTA 2A1AB 3R1SA 4LFIA 2LXCA 4G3XB 4C8BA 4KD1A 2VTQA 4QMMA 3MPTA 3PJ2A 2UZDA 3CTHA 2E9UA 3OXIA 3EYHA 3DLSA 5KCVA 2VRXA 3OUNB 3LQ3A 3B8QA 4F1SA 2V22A 1H01A 3R8ZA 2CHWA 3GGFA 5JGBA 4WA9A 4JXFA 4IM0A 5CU0A 4CD0A 3KCFA 3TACA 4LMUA 5KHWA 4BCNA 4B9DA 3TV4A 5I9YA 4OVVA 4GVJA 3UQBA 3ORNA 2VO0A 1GIHA 3EQBA 2C7MB 3ORKA 4BHNA 2YCSA 2GHLA 4ENXA 3PPAA 1OL2A 4AP4C 2GFCA 3LVPA 5A3XA 3FSFA 4FA2A 4KABA 4NK9A 4RLKA 5TR6A 5L2WA 3LMIA 4EUTA 4C2WA 2VRRB 3PSCA 4Q9ZA 5IQAA 2OZAA 2Y8OA 1YI4A 5DVRA 1ZWSA 5CF4A 2WEVA 3VQIA 3TDWA 2XJ1A 5EW9A 3R00A 4FUXA 3LM5A 5IEVA 2E9PA 2XNEA 4F9CA 5E92A 3KVWA 3HK0A 1GZ8A 4IW0A 2GNGA 4FJZA 2H34A 2VTJA 2C7NB 3P9JA 4CMTA 1M2RA 2WQMA 2WX1A 3AXWA 3ZCLA 1OGWA 4JRVA 5IQDA 4FKSA 3K3JA 2Y4IC 5M57A 3BGPA 3NNWA 4K9YA 5CU6A 3MPMA 3F2NA 4TKNA 3R71A 3A7GA 4ZS0A 4IM3A 5IAAC 5C8KA 3JSVB 3QBNA 4U6RA 2KDIA 2J50A 1A48A 3HRBA 1B38A 5IH4A 1GY3A 3ZBXA 2OJIA 4FYOA 4C4HA 3HVCA 4G1WA 4GFMA 4ONAA 3ZC6A 2UZUE 5EQEA 5AP3A 3BZ3A 4WJPA 3MSSA 3VAWA 2UW9A 1XH9A 3FHIA 2PY3A 3PPKA 2JRHA 3E8EA 4ASWC 4OTGA 4WBBB 2JIVA 3X23A 1Y6AA 4N9F4 4ACDA 2CU1A 3TDVA 4EOLA 4CLIA 5CZHA 3AT3A 4NPNA 1C3TA 4QOXA 4O2PA 3C50A 2BWES 3BYVA 4A9UA 4NUSA 2PEAA 3VS7A 4MBLA 4TWPA 3SHQA 1XJDA 3WIMA 4FOCA 2MBOA 4E5BA 5GZ9A 5FQDC 4BDAA 5HESA 4J96A 3P7CA 2OJFE 4AW5A 3GCUA 3ZM9A 2W05A 3S2PA 3ZZWA 3V3VA 3K9OB 2FUHB 1FINA 3KMWA 3Q4UA 4I23A 3ULIA 3MFTA 5AP6A 3RT3B 3M2WA 3IK3A 2KQ7A 4TWCA 4IWDA 2PVLA 3F5XA 3VTWA 2XNGA 1UH6A 1UGMA 1Q4LA 2K39A 3MB6A 1Y6BA 3RPRA 1R39A 4NTSA 2FCQA 5ETIA 5C4LA 4OBOA 3FLSA 1J7LA 2LAVA 2KFKA 1M14A 2QO2A 5FBOA 1WXSA 3BLHA 5HO8A 5CAPA 3IONA 2WNTA 2IO6A 3PLVA 4D2TA 5HE3A 4JBPA 4XV3A 5J7HA 2IJMA 1TVOA 3R02A 1WX8A 3RGFA 3ML8A 4AOTA 2KX0A 4UZDA 2QQ7A 4QMVA 3ORPA 2FCNA 2NCNA 2BTSA 3ACKA 3BU3A 4IXPA 4DG0E 4U8ZA 3O0GA 3SX9A 1U5RA 2XYUA 4LV8A 3BCEA 3R3MA 2JLDA 5D7VA 4UBAA 3P2BA 3NAXA 3CJGA 4FSWA 3PG3A 4YMJA 3NRMA 1GZKA 4K1BA 4KKHA 5E91A 1NW1A 4FTUA 5J9YA 3R7EA 5E7RA 5M08A 5E4HA 3HEGA 2OF4A 4E4MA 3LLAA 4IJPA 3AMYA 4KIQA 3Q6UA 5DGZA 4PMSA 4YJOA 4EHVA 1VZOA 4ZY4A 1OEYA 3BYUA 4ANLA 4FV9A 2XM9A 3NCZA 2LVPA 4LRMA 4AW0A 4J99A 2YA9A 2O2VB 1WM2A 4OR5A 4C37A 4MYGA 4DGMA 5J5TA 2D3GA 1AQ1A 5ETCA 5KHQA 4YJQA 4IHPA 4CZUA 3I60A 3UZPA 4HVHA 5K4IA 3QGYA 4NU1A 1RW8A 2DS1A 1VD2A 4PDYA 4QMLA 3RZBA 2KVRA 4BVUC 2PVMA 3CSFA 1ZMWA 4IAZA 2V7AA 4XUFA 4IACA 4K18A 2JEDA 4LJOB 3V04A 2ITUA 2R4BA 4E7WA 3ZXZA 2W1HA 4USDA 5H2UA 5JMSA 1WFYA 2VTPA 2WTJA 2PVYA 3WAOA 4YC8A 2WTKB 3V60A 5D2MB 4ASXA 3FI8A 4X2KA 3RCZA 5FBNC 2XP2A 4Z16A 1M94A 1L3RE 3UG2A 3BIZA 4FX3A 4F99A 5IZFA 1P0RA 2MWSB 4UMQA 5DR6A 4TKSA 4GK4A 2NP8A 3PLUA 3LFDA 4F63A 4I4EA 3ZM4A 3R0TA 3KF4A 4JIOU 1XR1A 4BDIA 3M95A 2G2FA 4AN9A 3NUXA 3UQGA 5EQYA 2KD0A 4RZVA 3HAMA 3V62A 3WF9A 2RSVA 4JBQA 1JPAA 2C3IB 4L45A 2XEYA 5L2IA 5EW3A 3ZLZA 2JKKA 4TYHA 2GBKA 1NVRA 4QMQA 4O1PA 3COHA 4X3JA 3UP7A 2XRWA 3I6WA 5HHWA 3C5IA 5AADA 4BR3A 1MRYA 3GOKA 3QWKA 1MG8A 1SNXA 5C8NA 3OWJA 4D2VA 3SOCA 5BUEA 3TMPB 4XG7A 5CLPA 3A1QA 4LQMA 1REJA 2B0QA 2F7ZE 3PWYA 3HV6A 2QKRA 5DCNA 2BYVE 2W9FB 5IQIA 2PMIA 2PUUA 4EQMA 5ANDA 1GG3A 3ZO4A 4GVAA 5IA3A 4ANMA 4YNOA 4L00A 2UW6A 3MTFA 2ZM1A 3VBWA 2KJRA 5BMMA 4R7IA 5ICPA 2KWUB 5J18A 1OIYA 2BAJA 3E88A 5HBJA 4DBNA 1L7YA 3IG3A 1VR2A 2JZ3B 4FVQA 3ENHA 4IAIA 5KHXA 2NPTB 3PTFC 1WVWA 4D9TA 5CT7A 4I1ZA 3MHSD 1WJUA 2XBAA 4FL1A 3APFA 4OAUC 3OW3A 3TL8A 2C9WB 2UW3A 3TI1A 4FV3A 3MVLA 3EHVA 2DYLA 3PIYA 4QMSA 5IA5A 2WHBA 1XH4A 2YDKA 5DFPA 2YM6A 2YVCA 4RX7A 2IG7A 2BZJA 5LXMA 3KA0A 2R3GA 2AUHA 2VAGA 4O0RA 3I4BA 3ALOA 3AGLA 1Y8YA 4HWIB 2C3JA 4BDDA 4LUEA 1NVSA 3JVZX 3APCA 3R66C 3LCDA 4D1SA 3THBA 2YIXA 5L4QA 4CVAA 4DEGA 3LFQA 3QQ8B 2XIKA 4BTFA 5L6WL 1WJNA 2DAJA 4EZJA 4BI1A 4LCDE 3A99A 4RT7A 1OZ1A 4ZTMA 4MSMB 4D2RA 3A9KB 2BGFA 4K6ZA 2GU8A 3H4JA 3EJ1A 2QI8A 4KSLC 4BBMA 3E8CA 3MI9A 4QMYA 1ZARA 1BI8A 4W9DA 1ZOEA 4NW6A 4ANSA 3GC9A 3ZO1A 3LW0A 3R7GA 2GTNA 1CSNA 3POOA 4XBRA 4IUMB 2K8CA 1IG1A 2CR5A 2GBMA 2OJGA 5DWRA 2B3AA 1GC6A 1FVVA 3PHXB 4YJUA 3ETAA 3RAIA 1RJBA 4XBUA 5EM7A 1H8FA 2WMXA 3RAWA 5T68A 2R3HA 2FSTX 3SG9A 4ZRIA 3DBFA 3R8UA 5HVJA 2EXMA 3QF9A 1YHSA 2J4ZA 2HYYA 4EI4A 3TCAA 1J1CA 5KO1A 5DMZA 4GL9A 2OLCA 3H0YA 4UWBA 5BMSA 3L9MA 2R3IA 3SG8A 2X7FA 4YZCA 3EFKA 5DA3A 2W17A 1PXNA 3DJ5A 2ZOQA 4W4VA 3D9VA 2WX0A 3S00A 3FZ1A 3KQ7A 4F7JA 2GTMA 2Z8CA 3F9NA 4TW9A 4GT4A 5AUYA 3WA0A 4NIFB 4XYFA 2W0JA 4JDKA 4NKAA 3BGZA 3DB8A 3W2CA 2KJ6A 3P0MA 4V04A 1J7UA 3D7ZA 2XS0A 4FZDB 2HY81 2WTDA 3FPQA 4IAFA 1V0BA 5CNOA 3FJQE 3W16A 3PXKA 4DEIA 4YSJA 1TTNA 3R9OA 5AV4A 3K5VA 2OWBA 5FTOA 3P5KA 5CEIA 4U42A 4H05A 1KE8A 3QRUA 3FQEA 4BKJA 4L3PA 5DPWA 5I4NA 4EQCA 3RTPA 3BU5A 4FK6A 4LOQA 4MNEB 2PVKA 4B99A 5M4CA 5LVNA 3DDCB 2Z2WA 2ZNVB 4BWPA 3CPCA 3FZOA 3I7CA 2GQSA 1QPDA 4XMOA 5AZGA 4FSTA 2YCFA 4U3ZA 3F3TA 2CKQA 4GIHA 4L7FA 5KKRB 3NS8A 4I0TA 4KV2A 3TNPC 4RIOA 5DRDA 5K0KA 1XHAA 4F6WA 3LCSA 2BKFA 5AFVA 3VUKA 2XUUA 5DNRA 4CZTA 4X7QA 5A4TA 2QODA 2L00B 4N6ZA 2Y7JA 4KKEA 2A4LA 3Q3BA 3RKBA 3V6RA 3A2CA 2PE2A 4BDEA 1YHWA 2OIBA 1WBNA 4ZTHA 1EO6A 3HMMA 4CYEA 1Y57A 5C9CA 3BX5A 4MH7A 4IWQA 4USFA 3NS9A 5IISA 1V0OA 4I5HA 4BCFA 5CAVA 4AOFA 3UIPB 2XB7A 3H9FA 4LRKA 4XCUA 4GGQA 2R3NA 4AF3A 4IVAA 2YZAA 2K6QA 2EXEA 4PF4A 3RHKA 4EL9A 5EFQA 3CD8A 3DTCA 2NVUI 2PZIA 1P98A 3C9WA 5M4IA 2NBVB 4ALWA 3NYVA 1UKIA 3EKNA 1YXVA 3FYJX 4NM3A 4MSQB 3UGBB 1XH6A 4WOVA 3QARA 2YEXA 3W55A 2UZLA 4MK0A 4YO6A 2LWPA 1RQQA 2HXQA 4O91A 2EWAA 4PV0A 4ANXA 5HKMA 2W5AA 4UX9A 5HVYA 2DYMA 2BYFA 4FIFA 4DA5A 3LIJA 4Z7HA 1ZY4A 3GFWA 4YO4A 2UV2A 1K9AA 5L83A 4JOAA 4R8QA 4ZDVA 3GCPA 2PL0A 3DBRI 5B2LA 5J1VA 3AT4A 3ZTXA 4DN5A 3ZNZB 4C59A 2QOOA 3U4UA 3D94A 1D3ZA 4RC3A 4OTPA 3WZDA 3QQGA 4MAOA 3UYSA 3KEXA 4FSNA 5FUTA 3HP2A 4CO7A 5AIKA 2PPHA 4FT7A 3SA0A 4IBMA 4I5CA 4WIHA 3DXQA 4CG9A 2VTNA 3R22A 2RGPA 1F3MC 2JD5A 4R7HA 2BZKB 4FVPA 1UVRA 4MELA 2LGCA 5AR7A 5LMAA 4FTMA 4BGQA 3OF0A 2OZAB 1OKWA 4E4LA 2L8JA 1R1WA 4O0YA 5GHVA 5J79A 2P33A 4QTEA 3QLGA 4LRJA 2O5KA 5A46A 2GNJA 5FEQA 3UZRA 4O81A 2PUPA 2YJSA 3PGEA 2C6MA 3DFCB 1E90A 2P0CA 1UBQA 5CASA 4PMPA 3Q9YA 3PJ1A 4C7TA 4QMZA 4CRLA 4ZZNA 4IVCA 4PTGA 3DZOA 3R30A 3HAVA 4AZSA 3UC3A 3FY0A 1WXMA 2C47A 4M97A 5LQFA 2XIXA 5LVPA 3RPOA 1JRUA 3FV8A 4J71A 3ODYX 5L8JA 4DT9A 2DUVA 4BYIA 4YBKA 2IWIA 3AC1A 3HV4A 3FLNC 2GDOA 3O65B 1OL6A 2AEHA 3MPAA 3PIZA 5DH3A 4GRBA 4XG2A 3WF5A 3W8LA 2WQOA 1YXTA 5I9UA 2WO6A 4R77A 4RZWA 4NQLB 4IFGA 3A60A 4TWNA 3MB7A 4FZAB 5HCXA 1XO2B 4WG3A 5F4NA 1Z57A 3N3KB 3MA6A 3IO7A 3BLRA 3WIGA 4HDQA 4GU2A 4ZY6A 1KOAA 2FVDA 1UA2A 4P5ZA 3SLSA 5L3AA 4AZEA 4C58A 2VD5A 3UMWA 4NKSA 3EB0A 3CJFA 2ACXA 2R0UA 1FQ1B 4ZLZA 5IQBA 3ANRA 4NSTA 1UZXB 4QYGA 4GK2A 3UGCA 2WMQA 2XK6A 4IAYA 4O6LA 1E5WA 4FEQA 3ACJA 3U87A 2PHKA 4DH7A 2KLGA 2LGXA 3E5AA 2DZKA 2AYPA 3I0QA 4ERKA 3TZ7A 3CC6A 5CEKA 3R83A 5EI8A 3A4SC 3FZTA 4ANQA 4ERWA 1UU7A 5HG9A 2WELA 2HZ4A 3EHAA 3KUDB 3DTWA 3ZFYA 2ONLA 4P2KA 4ACGA 2HY0A 2V7OA 1QPCA 3KRRA 3RK5A 3QTXA 3RD2A 4Y73A 2VWUA 1H25A 3ZTDA 5BVEA 4G6NA 3NAYA 3GEQA 1V5TA 3T8OA 4FIJA 1WXAA 2KFKB 2B7AA 5AAFA 4WRSA 2OIQA 1H1WA 4TYJA 2KDBA 2XK4A 5H8EA 3ZC5A 2JDSA 4I93A 2B52A 4D1ZA 2KTFA 3MVHA 4CFXA 3ULZA 1B6CB 1VCBA 5C01A 5IPJA 4GU9A 3NUYA 3IW5A 3VHEA 5CQWA 1Z5MA 3R1YA 4L53A 2YIRA 3DBSA 4AWJA 3QRKA 5IQCA 3PXRA 5EYKA 3QRJA 4KRCA 3GT8A 3R7IA 3RNYA 1Q8TA 1E9HA 1SNUA 4M67A 2UWQA 3GENA 4G0NB 4B8LA 1BUHA 3WI6A 4Y85A 3IKAA 3UC4A 4ZXTA 2WTVA 4KIKA 3RZFA 4D2PA 4J95A 4AX8A 2REIA 2EB2A 4AP7A 2ITYA 2PVFA 2O64A 4IX4A 3M62B 2HZIA 2WEIA 4HYUA 4XOYA 1SMHA 3COKA 1T0YA 2IVVA 2YITA 1ZYSA 1XH7A 3OCBA 4DEEA 3ZNGC 3FLQA 3HUBA 3DNEA 4S2ZA 1APME 1YXUA 3UVQA 3GU8A 2D07B 4ACMA 4U3YA 2JUOA 4IB5A 3TT0A 4W8EA 2DWBA 2X8EA 5J9LA 4EYJA 2UYZB 5BX0A 3TBLD 2G2HA 1WCCA 3LFSA 4AWIA 4GUEA 3QWJA 2ITOA 2N9EB 5JGDA 2MCNB 4ANVA 5FXRA 3GU6A 1C1YB 5AV0A 5KE0A 2EXCX 3PJ3A 3MW1A 2OG8A 3ZW3A 2PUIA 3JYUA 5ANEA 2DENB 3D2IA 1Q8UA 2ETRA 4XLIA 3G15A 5FD2A 4LJPB 2I7QA 3EQGA 3S2AA 1R0EA 3P78A 2Y6OA 4CHKA 2QOCA 2W9NA 4D4SA 3F3UA 3E3PA 1OQYA 5KMLA 3PREA 4IWOA 4JI9A 5A54A 3AU4A 4GG7A 5AWMA 3Q9XA 2YN8A 3FE3A 4HK2A 5C23A 5M09A 2ZZPB 4AS0A 1PXIA 4D55A 2GNHA 5CSPA 5AP1A 5JFXA 2HCKA 1FBNA 1IP9A 4GIVA 4JRNA 3KREA 3REPA 1UNGA 3VQHA 5CF8A 1I44A 4BIBA 4H3QA 4TYHB 3K2LA 2R3JA 4W9GA 4UXLA 3RAKA 3SXRA 4YNEA 2QOBA 4ALUA 2CCIA 3ZSGA 2YDJA 4UZHA 5EDQA 5E6OA 5HOAA 2WGJA 3ZLYA 2IY1B 3F6XA 1PYEA 1PMUA 3RVGA 3A1QB 2MSED 4JQWC 5AP7A 3LFAA 4F70A 4JQEA 3HMPA 3OHTA 4GW8A 2ZJDA 4U40A 4FKLA 1NT2A 4O83A 2KDFB 2G3QB 5CZIA 3PSEB 1O9UA 4I41A 4CCBA 4R1VA 2VTRA 1R4MI 4DT8A 4IVDA 2LD9A 4HVGA 4UMPA 2ZB1A 4XV9A 3PRZA 3MJ1A 2AWTA 1PYXA 3EQFA 1YKRA 5AP2A 1WRDB 2JF5A 4BCPA 3E93A 4GSBA 3V01A 5JZEB 4U7ZA 3QTZA 3OXTA 3W18A 3R7QA 3QTSA 3DKGA 2WIHA 3U6IA 3O7LB 5CHVC 3QAME 4LI5A 4D28A 2OFVA 4EK6A 1TZ1A 2VZ6A 3LE6A 4FT0A 5DEYA 1OKYA 4O7RA 4PTCA 4O0UA 4YHFA 4O7ZA 3UQFA 4DLJA 3CBLA 2VWBA 3W2QA 1H08A 2FA2A 4Y72A 3ZLXA 1H0VA 2C0OA 5HICA 5K5XA 2MA9B 5CSWA 2C6DA 3SV0A 3KFAA 4FYNA 5EKOA 3RM7A 5AAEA 3GBZA 4FKWA 2Z0EB 5CTRC 2WB8A 4KBAA 4E74A 1P3QU 5ACKA 2WOUA 4C61A 3HECA 4U0IA 3PSDA 2B55A 3BHYA 5KZIA 4AACA 3RK7A 4GU6A 4BKSA 2OJJA 4B4LA 3P7AA 4FNXA 3NWWA 4I5MA 4AZVA 3F5UA 5J87A 3EN6A 3DBHI 4BI0A 4B6LA 1IR3A 2W06A 3SXSA 2ITQA 2R7IA 4M14A 3CS9A 4DF3A 2WFYA 4GMYA 4TPTA 3C0IA 4FTCA 4KNBA 4V05A 3G6GA 2EUFB 2AYOB 4XRJA 5A9UA 1ZKHA 1NXKA 1TQIA 4TT7A 3V5TA 4BB4A 5CF5A 2FCSA 3NMUF 4EOYA 5EI6A 2V4LA 5M4UA 4E26A 4CGAA 2WZJA 2ZV8A 3L8PA 4I0RA 3LOKA 4CQGA 3VH4B 5HG7A 1IAJA 4MD9E 4ANNA 4Q5EA 3QTRA 5K9IA 4RQVA 4QTDA 4X6QC 3RM6A 3BU6A 4CKIA 1QZEA 5LXHA 3ONSA 3FZSA 3JS2A 4K7WA 1CMKE 2GSFA 2WMVA 2L0FA 3IQ7A 3UTOA 5CAOA 5LVMA 5HNIX 4WKQA 3VBQA 3LFBA 4KIPA 5EG3A 3GOEA 4W9FA 1YWRA 4E6QA 2KC2A 1IYFA 3PSBA 3KXXA 2AC3A 4RWLA 2C6KA 4RIWA 5DPRA 4QP4A 4DEDA 2XKEA 4YC3A 2LGDA 4MD7E 2GNLA 4JDHA 2GMIC 4FSQA 3GC8A 3VS4A 3ZH8A 3AC3A 4EZKA 1ZY5A 1KUTA 4WWNA 3OT3A 4BICA 4KKGA 1WGRA 4OTQA 3UBDA 2WAJA 4RSSA 4ZS4A 3D83A 2YAAA 3QJZA 4X3FC 4F9BA 1TGZB 3TCPA 1EF5A 2X2MA 2X0GA 2MX2A 5C03A 3IG7A 4EZ5A 2WXVA 1JVPP 3ENMA 1EH4A 4BOSC 4A3OA 4U81A 3GXLA 2FYSA 1RRBA 4FNWA 4AJWA 2LXAA 4XRLA 4KDIC 2JKOA 4YR8A 2NRUA 2VGOA 1K8RB 1LXDA 3VUHA 2WKMA 5HBEA 1JQHA 4XZ4A 4LGGA 2R7BA 1BI7A 4JT3A 2NRYA 3UO4A 3V8WA 2YIQA 5HG8A 3R1NA 4WNKA 2VWVA 2LUEA 5BYLA 3SAYA 4FN2A 3R7OA 2W1CA 5L6OA 3CPBA 5CTPA 2ZCCA 2UVXA 4QMNA 4ITJA 4KVGB 2LJ5A 3O50A 3P79A 4MBJA 4BZDA 4LL0A 4IM2A 1WBWA 3PIXA 2AC5A 5IKWA 3TNIA 5LMKC 3A7FA 4KS8A 5BVDA 5TT7A 2F7EE 3O51A 3B2TA 2YM7A 3MH3A 4II2B 4A9SA 1JKTA 4AXAA 3D5WA 2UUEA 3R9DA 1T45A 3DT1A 1W7HA 3EL7A 5IEXA 4OGRA 3COIA 1F9JA 1OGUA 2CKEA 1OECA 4NCTC 4K7UA 5T3QA 5FXQA 4IG7B 4WAAA 3G0EA 3G6HA 4P5QA 4F7ZA 4F9AA 4D9UA 3BWFA 4RX5A 3LFEA 5LVLA 3R8MA 5GZAA 1E8XA 3P86A 2YAKA 2L76A 4FADA 2PZ5A 3NYXA 1WE7A 5J95A 4A9TA 5FTQA 4EH6A 2IYDB 4IIRA 4X2GA 4C57A 2J2IB 4YLKA 4MEDA 4CSVA 1VYZA 3PRFA 3T3VA 4FZ7A 2IN6A 3PP1A 2GHGA 2XKFA 3NIZA 2C5NA 2RG5A 1XQZA 4G6LA 4BY9E 1LP4A 3NUPA 4BDFA 5KHOA 4XG6A 4U43A 4EK3A 2C6EA 2BHHA 4ZK5A 5KX8A 3OAWA 3FMNA 3NUNA 4ZYNA 3UNZA 2WPAA 4YZNA 2JFMA 2RFDA 3FXZA 4HLEA 4IH8A 2BYEA 3AD4A 3TNQB 1BMKA 5AEPA 3G0FA 4NM5A 2C30A 3AC4A 4Q2AA 5BVNA 2ERZE 4MCVA 4OTDA 3NSZA 4YTIA 2XJ2A 4UYNA 4L3JA 3DY7A 1CTPE 1V0PA 3TKUA 4GSWA 2YM8A 2VWWA 3DKFA 2XIYA 4QNYA 1H07A 4MHAA 3PY1A 1S3SG 5FRIA 4E20A 5B7VA 4TV3A 4E73A 4ENYA 4QTCA 4FV6A 5E8VA 3MFRA 2HK5A 2R3RA 5BPYA 5I5ZA 4MF1A 3E92A 1ERKA 3NUUA 4XLVA 4W4YA 1WAKA 3PRMB 4L46A 3IOKA 1BKXA 2FSMX 4O0VA 1FGIA 1Q8YA 4L67A 1W82A 5H8GA 4IB0A 5JZJA 3A7JA 4O96A 4I6PA 3ZOSA 3K54A 4NNJB 4DDGD 4HPUE 3E7OA 2ZMDA 4OT6A 2BFXA 3LPBA 2A4ZA 4FT3A 3EQPA 1OIUA 3SRVA 2X6DA 4Y8DA 3KK8A 3DAEA 2JDTA 4KB8A 4AN2A 3I5NA 4DH8A 3R7YA 4DC2A 4W9HA 3VUYA 5FM2A 5HX6A 3X0WA 4GKHA 3PRPB 1WGHA 4BDCA 3WALA 4K1RB 4G3GA 4IANA 3VHKA 3G51A 3W2RA 4B8MA 2C1AA 4L43A 1UU3A 4C3FA 2PZPA 3K9PB 1ATPE 3UJGA 3L9NA 3RCDA 3GI3A 3AQVA 3IW8A 3QLFA 2OH4A 2VTTA 4QMOA 3NUSA 4A7CA 3HV7A 4DITA 2QOKA 2J5FA 4Z55A 2X7OA 3KN6A 3EOCA 1TKIA 5HVKA 3OJ4B 2XZSA 2O0UA 2BILB 3NZSA 3FMMA 4CMOA 2N1WA 2OU7A 3DGKA 4I94A 1FVRA 4WNOA 3G5DA 1V81A 4BDHA 2X6EA 3CY2A 2F49A 2VWYA 4NFNA 3AXCA 4GFGA 1ZXEA 4MWHA 5F9EA 4IZ7A 3GCSA 3VWAA 2G1TA 5IDPA 2UW5A 3PXYA 5CX3A 4GUBA 3MTNB 1U54A 5CENA 4CFNA 3VS2A 4JR7A 4TYIA 1OEYJ 2MQJA 2C5OA 4FA6A 1GUAB 5EM8A 2KULA 4W9WA 1Q24A 3QYZA 3WAMA 5BVOA 2W7XA 2B9HA 3N4TA 3EH9A 3WOWA 2CCHA 5AMNA 4H58A 3OBGA 4U41A 5FXSA 3JVSA 4MGIE 4KWPA 4MTAA 2IZRA 4EUUA 2XCKA 4I4FA 4AGCA 4DYMA 4X2NA 2ITVA 3LQ8A 5AV1A 4DEHA 4TL0A 5ETFA 4G16A 4HVDA 2BRHA 4E93A 2W9ZB 1H1QA 4YUQA 4O22A 3AC8A 3EN7A 4U97A 3OROA 4BKGA 5AP0A 3N4UA 4QNAA 3LXPA 5AV2A 4L8MA 4QPSA 5CU2A 5IUIA 2XVDA 3KULA 3R6XA 4DFXE 2ZMCA 4QP8A 3ZYAA 3UF8A 2CGXA 2J7QB 4FK3A 3JYAA 5L2TA 4LOPA 2BAKA 5EYCA 4EK5A 4YLLA 4NM7A 1E1XA 3GQLA 3GNIB 3V61A 3VJNA 1LEWA 3T9TA 1KV1A 5C27A 4F6UA 3ITZA 4BVUA 4M8TA 5CXHA 3NW7A 4D5HA 1H1PA 2OGVA 2CKPA 3LKMA 3QXOA 4GV1A 4EOMA 3UPZA 1XBAA 3ATSA 4CYJA 1H28A 4FMQA 3MJ2A 2CHXA 4KIKB 2QHNA 4GYGA 4N0SA 5E8YA 2XMYA 4PP9A 3VC4A 3KRWA 4HCPB 1JSUA 2KMAA 4OW8A 4B9KA 3RP9A 3MN3A 4GXBA 4O7YA 2B4SB 3DVNV 2IBIB 4F1OA 3RALA 4L7SA 4FSYA 4PL4A 4R1YA 2M17A 1E8WA 4CXAA 5I3OA 3ZUUA 5CEOA 5CXZA 5GNKA 3NPCA 3A7IA 3C0RB 4J8NA 4FNZA 3SD0A 5ANJA 3N4VA 3SXFA 4XG3A 3N30A 1MP8A 1H26A 2WTCA 4FTAA 4EC8A 2KQSA 3ZUNA 2ETKA 3OWPA 3FKNA 5IA7A 4IFCA 2R9SA 3FMLA 4TY1A 4R3CA 2MRPA 2J51A 4I24A 2DHZA 4F9YA 4C38A 2WU7A 2MP2A 3PUPA 5AV3A 4RWIA 4IZ5A 3SDLC 5D41A 4FJVB 3QK0A 3MTLA 3TN8A 5JFSA 5EI2A 3SW7A 3UODA 2LRUA 2YACA 4RLLA 4IB1A 1H27A 1R78A 4O2ZA 4ZRKA 5A6OA 5HE0A 3DNDA 1BL7A 3SU8X 3D0EA 3OLMD 3QX1A 3HM3A 4MGZE 3UIXA 3ELJA 3DJ7A 3ZEPA 5L8KA 4LM5A 4ITHA 3MH0A 4F4PA 4Q9SA 4D0WA 4QP3A 2YM4A 4RVLA 3U54A 2ZDTA 3H9DA 1BYGA 2UZOA 2F7XE 2I1JA 4ZLYA 2UW4A 5JFWA 3NZUA 2QR8A 1W98A 5HD4A 3OWKA 2ZPNA 4R7BA 1G8SA 1YI3A 1Q3DA 3ZTCA 3TKIA 4E1ZA 3DVGX 5GJGA 5IQEA 2HZ0A 4GKIA 3QCYA 4IZYA 3BELA 4GG5A 3DKOA 4GOCA 5JH6A 3L9LA 2HW6A 3CQWA 5HEZA 3DZQA 3PRIA 2ZCBA 5TOZA 4FGRA 5CF6A 5ANOA 2XKDA 2GS7A 3FQHA 1CKIA 4ZJIA 4QRCA 2Q83A 2BF8B 3RWPA 2Z59B 4FV1A 3G33A 2YWVA 4HGLA 3QCSA 2KO3A 4A9RA 3CCNA 1G6JA 3MVJA 2GCDA 2HZNA 3PP0A 1QPJA 1V6EA 1Y8RC 2QNJA 4XS2A 2QURA 3GQIA 4H39A 2YISA 2IZVB 5HGIA 4HVBA 3FZPA 3ODZX 3LXKA 2JZZA 4NJ3A 4LG4A 4BI2A 3PS6A 2PWLA 3QQLA 5JQ5A 4O84A 4AN3A 1GAGA 4BCJA 4CV9A 3AGMA 4EHEA 3F5GA 2JPHA 4OTFA 5E8SA 5GJDA 5C26A 5HIDA 4JNWA 3EKKA 4QQCA 1O6YA 3EIDA 5E6NA 3KYCD 1WJ4A 4NEUA 5DBXA 4FBXA 4HOKA 3DKCA 4H3BA 1M2PA 5BVKA 4AZFA 4RC4A 2X81A 4IQ6A 4EZ3A 5J5SA 4HYIA 4I5PA 2RD0A 2Z60A 4I6FA 3E87A 3AC5A 3P08A 4NTTA 3UIUA 1ZLTA 3QQKA 5AM6A 4BIEA 3D7TA 5EM6A 2FGIA 2ITPA 3QKMA 3NNUA 3W33A 4GT5A 4DG3E 3H1UA 3MGYA 4QD6A 3KN5A 4AFEA 3AT2A 3ORLA 5LMBA 2BRNA 3BINA 5C8MA 1KLVA 4K7SA 4C35A 2IVUA 3FI3A 2W99B 3SOAA 4QYFA 3B08A 5CSHA 4BCHA 3HNGA 5HLNA 3VRYA 4MX9A 1REKA 2ZVOA 3OC1A 5TR5A 5CEMA 4Z9LA 2WQNA 3ROYA 3CSTA 1UV5A 3F88A 4YL8A 4F1TA 2EB3A 2J9MA 4BFRA 4TQ0A 5D94A 2ZAZA 4TZRA 3AOXA 5LOHA 1NA7A 4RJ5A 3IDCA 4OTWA 4FV8A 3PV1A 3CP9A 4ZTRA 1IA8A 3VHTC 1U4DA 3RI1A 3VQUA 3DU8A 2OJRA 1SZMA 1NDDA 5FDPA 4CV8A 3V5WA 3HA6A 4RIWB 3U51A 1BT0A 1ZYJA 3C1XA 3W2PA 3RMFA 4F1MA 1WZYA 1SE9A 4EWHA 5K5NA 4CZYB 2BRBA 2C0IA 2XNNA 3HRFA 4FG9A 3KGAA 4PTEA 2GS2A 4LV5A 4ACHA 3L54A 3MYGA 2Y4PA 4J8MA 4J97A 2Z7RA 4MQ1A 5CU3A 2PUNA 4FZFB 3ZNHB 1XQQA 1LUFA 4RVMA 5IH5A 2R2QA 4NZWB 3F3ZA 3R2BA 5F20A 2ZV9A 1Q62A 3CF6E 2YIYA 3KW5B 4ANBA 3UVRA 3JVRA 3GOPA 3W1SC 5DE2A 3D15A 2BMCA 4DFYA 3DBEA 2HELA 3HV5A 3RCJA 4WO5A 1BLXA 2WIPA 2B9JA 2CKHB 2J0LA 2X9EA 2RG6A 3JPVA 3SC1A 2XH5A 4M69A 1XD3B 4IJ9A 4EBVA 1URCA 1TBEA 3O71A 2K25A 1FPUA 3ROCA 1J91A 4GN1A 2IPXA 4BCMA 4PPAA 3QZHA 3VFKA 2FAZA 2KHWB 4ZSJA 1YVJA 3C4WA 3R73A 5KBRA 1KJTA 3L17A 3MESA 2J6MA 3BYMA 3OCTA 3UMXA 1KE7A 4NWMA 5IQHA 2J0MA 1WBTA 4CQEA 3H6NA 5HD7A 3FLYA 3UYTA 3BRBA 4ZMEA 3OXZA 5L95C 3OVVA 3SKCA 3EQRA 4WWPA 4YPSA 4JR3A 4W4WA 3QCQA 4UV0A 4PP7A 2PZRA 2WMRA 3EZRA 4FV2A 1WVYA 3QALE 4RVKA 2D11A 2V62A 4ZSGA 4CTCA 3COMA 5HX8A 1IA9A 3ET7A 3ZFXA 4A4OA 2PU8A 5AEKB 1Q8ZA 3OEZA 3S3IA 1OBDA 4EONA 3LCKA 2NBUA 4HPLB 4EEWA 3A33B 5AUVA 3Q2JA 3OCSA 2IW9A 2UVZA 1OUYA 2C4GA 2YJRA 3DV3A 4ANWA 2X39A 3C0GA 2UZVA 4D4VA 1RLFA 2WMWA 4I21A 5EHOA 4MEMA 3KK9A 3L8VA 4ZZMA 3Q2MA 5HO6A 3U8WA 4PDOA 4C4FA 4FSZA 2KLCA 2JDRA 5FEDA 2H8HA 3CLYA 3W10A 2OJ9A 1OL5A 4TXCA 3EWHA 1YXXA 3QRIA 4PS7A 4EEVA 1WMKA 3E7VA 2WU6A 3Q60A 5FTGA 2YERA 4BWKA 3IGOA 5LWMA 2Y4IB 1PXPA 2GBRA 3OBJA 1SYKA 3ATTA 3E64A 1WX9A 4I6QA 4C34A 4YZBA 3QC9A 4C4IA 4ZSAA 3UNJA 3VBYA 3ML9A 4HNIA 3WE4A 1FXTB 4QYYA 3FLWA 2KNBA 1Y91A 4PDPA 1E8ZA 3I7BA 2XEZA 2GNIA 1Q1OA 4FZ6A 2PE1A 1WBSA 3MDYA 3OOGA 4R3RA 4GK3A 5IU2A 2BIYA 4P90A 5BYYA 4I6NB 5JN2A 5HE1A 4C0TA 4HVIA 1WGDA 1WZ3A 3LMHA 2A27A 3SRVB 2QOHA 3T3UA 3VW6A 2FCMA 4QO9A 3GU5A 2QOLA 4WSQA 5M55A 2KN5A 4W9LA 3OT8A 2K8HA 2XF0A 1P1AA 3T9LA 4NJDA 3FEGA 3NW6A 5AUXA 1RFAA 3NIEA 4UMRA 3NOBA 3LXNA 2QD9A 4AE9A 3I5ZA 4FE2A 2HXLA 3W2SA 4EOPA 1ZMVA 2CJMA 4KSQA 2XK7A 5EDPA 3VS3A 3LZBA 3PXQA 4AGDA 2F9GA 2IO1B 3EC8A 3NEWA 5G1XA 3DVGY 4KIOA 3HGKA 4QP2A 4I6HA 2O2UA 3PYYA 3M11A 4EKUA 3PPZA 2ZM4A 2X7GA 3M63B 2PK9A 2VTAA 4C62A 3U8ZA 3II5A 1WY8A 3ENEA 1PMNA 4W8DA 3RJCA 4B7TA 3VRZA 4BTMA 4F8CB 4JGHB 3PJCA 2CGWA 3F3VA 5DN3A 1P5EA 4PMTA 4L42A 2CNQA 4YJNA 4E4NA 3F3WA 2G15A 2MLBA 5D10A 4MH0E 4KINA 4RJ4A 3BBWA 3UE4A 1P4OA 4F09A 4O6EA 1K2PA 4DGLC 4MGKE 1U54B 1MRVA 4R3PA 2YDIA 4YC6A 5AR5A 2RPQA 3VUGA 4C02A 1YHVA 3AMAA 2OXYA 1H1SA 2WTWA 2CN8A 4NJ6A 4EKLA 3Q6WA 4ZTQA 3QQUA 3O8PA 2ETMA 4FHKA 4BCOA 1A9UA 4FICA 3QX4A 4R78A 1Q8WA 3I79A 3EYGA 3R8VA 4IX6A 5CS6A 3CGOA 2X4ZA 4M8NA 3VS1A 3I3TB 4G3EA 3LXLA 2QU5A 4QMXA 4RFMA 2PVJA 2MBEA 2BZHB 5AZFA 3SD5A 2FSOX 3C13A 4O7WA 4E3CA 3A9JA 2M0XA 3QC8B 3Q9WA 3VUMA 4BOZB 2MBHA 2ITXA 3AI5A 3KL8A 3KULB 2GFSA 3FHRA 5EKNA 3W8QA 3EN5A 4E6CA 5H8BA 4M68A 2FIFA 3KXNA 1MRUA 4ASEA 3SVVA 2R3OA 3FL4A 4UY9A 5H3QA 1OKZA 2PE0A 5I0BA 1YDTE 4DHZE 3PJ8A 5EHLA 4DWFA 2HW7A 3TIXA 4NL0A 3A4RA 4UMTA 4XX5A 1WX7A 2L7RA 5FR6A 4X0MA 3TEIA 3QL8A 4DXAB 3EQCA 2P2IA 4QP9A 4RWKA 1JOWB 5IG1A 2W96B 4FULA 3VUIA 3MFSA 3DS6A 4A4LA 3TZMA 4UXQA 4H1MA 3VS5A 2QOQA 3BGQA 3C51A 4UMUA 3QTWA 5DHJA 3A8WA 4IE9A 4NFMA 3VO3A 1WVXA 5E8UA 3Q04A 4J98A 3GU7A 3UG1A 4XH6A 4WT6A 4FUYA 1ND4A 4AGWA 3GB2A 4IX3A 3RBWA 5CNNA 1Q61A 4JG6A 4N70A 3C4FA 3CD3A 3DQXA 3HUCA 1H4RA 3L0WB 4QP6A 3KXHA 1EUVB 2KTYA 1YIWA 3EFWA 3PPJA 3MY0A 2ESMA 3RINA 3ZSHA 3EL8A 2XRUA 4RIXA 3R8PA 3K5UA 4JS8A 3HP5A 3IFWB 3WZKA 4YHTA 1SVGA 3AD6A 4FNYA 3NYNA 3ZHPC 4W9IA 5CAUA 3IDBA 3ORMA 4W9EA 3WZEA 2X2LA 1SM2A 4ZOGA 3OW4A 2X4FA 5HBHA 2R3KA 4DFNA 4USEA 3DCGA 2V3SA 1PXLA 3DK7A 1E8YA 2IW8A 3ECIA 2R3FA 2C6LA 4HPTE 3TG1A 3QFVA 3A4PA 4MXAA 3PE1A 3FMJA 2P55A 3R9RA 1OKVA 3WANA 3UNKA 2YIWA 4FJYA 4KUJA 3WILA 3PDTA 1KOBA 2LVQA 4KRDA 3WZUA 4S33A 4O38A 2W5BA 3NY5A 2E9VA 4EK8A 2GQRA 3H7PA 1V80A 2JBPA 2V1YA 2CSNA 1W8CA 3DCVA 4FTIA 3IGGA 1QMZA 3UOKA 2PVNA 5EYDA 1SVHA 5JH5C 4FKGA 2EVAA 2XBJA 3VBXA 4PPBA 4I22A 2VX3A 1WMHA 4M0WB 2VTIA 3IHPC 4QQ5A 3IOPA 2FUMA 4XHKB 2O8YA 3BE2A 5DT0A 4GIIA 5A4LA 3EQHA 3F7WA 4DK5A 4CLJA 2B9FA 2VTSA 3MIYA 2YFXA 3U55A 2BPMA 4UB7A 4AOIA 1AARA 2D10A 5DR2A 4IZAA 2IVTA 4BRXA 2R3QA 2G2IA 5HIEA 3PVBA 4MD8E 4OBQA 2WTKC 4QQJA 5CY3A 1CMXB 3C5UA 1UNLA 2BIKB 4WNPA 4C2VA 1B39A 4ZEGA 3ZO3A 3TUBA 4EZLA 5JZNA 2MBQA 4PUZA 3WE8A 5CVHA 4UALA 2ZB0A 2GBNA 4DHJD 3H30A 5KUPA 2PMNX 4II5A 2O6VA 1YOMA 5DEWA 3FMKA 3DLZA 3PY3A 3R7UA 5IH6A 3VUWA 3PLAE 2IO3B 4YJRA 3HHMA 1ZZ2A 2HENA 2GNFA 4F0FA 3W1YA 4HCNB 4NW5A 1YQJA 2R3MA 3TJCA 1PMVA 3QYWA 5HI2A 4Y83A 4JG7A 4FHJA 4G3CA 3GZNI 5I3RA 2OIDA 3PZDA 3FBVA 3ZSIA 1HOWA 4DFLA 4FLHA 4EYMA 5B0XA 4U80A 1WBVA 4XOZA 1STCE 4M66A 1ZYCA 3FY2A 4BTJA 3V6CB 2EMSA 4FKJA 4DE4A 5E6PA 4H3PA 4P7IA 3VIDA 4HCUA 4NH1A 3CQUA 3D7TB 1WE6A 3QZFA 2YM5A 4AJYB 4AT3A 3H3CA 4G3FA 2N4FA 3I0OA 2GBJA 4EK4A 3U9NA 4PY1A 5DR9A 1UNHA 3F7ZA 4NM0A 2QLUA 4J7BA 2XNPA 5HU3A 1XWSA 3EFLA 3O96A 3VTVA 2OH0E 3IW7A 4YBJA 2FNJB 5F95A 5D6JB 3F5PA 2J0JA 4TYGA 4O0XA 4G5JA 3HLLA 2VTMA 5IMEA 5M53A 4QTBA 3S95A 4ZLOA 3TTJA 2G9XA 5HNGA 2JBOA 2QKWB 5AP4A 3WF7A 4DHJB 1XKKA 3VBTA
chains in the Genus database with same CATH superfamily
1WBOA 1ZOHA 4X3FA 1JNKA 3VH3B 3MC9A 4O7NA 1E7VA 4WBOA 1ZOGA 4WQOB 3FDNA 5HCZA 1FXIA 4WG5A 4QYEA 4IDTA 3QAQA 1OL7A 3UI3A 4ZSLA 3PG1A 2IW6A 4YZMA 3AG9A 1YN4A 4R5SA 4K11A 1IGCA 3BYSA 3VF8A 4JBOA 1ZYDA 5HIBA 1DAYA 1JSVA 2I0YA 4IC8A 3FXXA 3PE2A 5HKHA 1S9JA 1YNTE 4RRVA 2GOWA 1E7UA 2QHMA 3TIYA 3R9NA 3OTUA 3QHRA 4CNHA 3MJWA 3KKVA 2JFLA 1OUKA 1ST0A 5LCKA 3Q32A 4WG4A 5D9HA 2WTIA 2EMTA 3JY9A 4EH7A 4BDJA 4MJSA 3Q3NC 3ALNA 5LMKA 1YXSA 3R2YA 4O0WA 2ASQA 3FI2A 5CWZA 3SR6A 5G55A 4O7VA 1JKLA 4DAWA 4RQKA 3NNVA 4XEYA 2JSVX 5AIRA 2OHFA 1V49A 5JRSA 3KUZA 3P1AA 2VO6A 4ID7A 5DPTA 3OWEB 5JSMA 3PZEA 4MUQA 4OHJA 4B0GA 4NCTA 2MHJA 2BAQA 5CI7A 5KZ0A 4FT9A 4HJGE 1WR1A 3GZNB 3MFGA 4FBJB 2WD1A 3F82A 2K6DB 2KAJA 2L05A 4BC6A 4HRSA 4P1CC 2RL5A 4AZTA 3Q53A 1NBFC 4BFMA 1VR9A 2XJ0A 5FLFA 1XBCA 4O1OA 4YP8A 2Z7SA 4KSPA 5EK7A 2VGPA 3OUKA 3R21A 4YU2A 1FXAA 4FV5A 4M69B 4J1RA 4DFBA 4G2FA 3OD6X 1K3AA 3VTUA 3DBDA 2IY0B 1Q97A 2Z7LA 4DGGA 2JGZA 1SXTA 2M8SA 5KMOA 3KCKA 4D2WA 4RA4A 2LASA 3KY2A 4E8AA 1KV2A 5CHWA 1K53A 5J1WA 3FYKX 3ZMMA 3DDQA 1U5QA 4DH3A 2BKKA 1BMLC 4MNFA 3GC0A 3VF9A 3AKLA 3NHEB 5IF1A 4EJNA 3ZXTA 1ZAOA 4I3ZA 2EKEC 3CR0A 4GYIA 1WM3A 5EYMA 2J0MB 3ZQ4A 3Q69A 3AEAB 5CSVA 3ORIA 1V1KA 5LWNA 1FCCC 1SVEA 3RZWC 1DI9A 2ZNVC 4MXZA 2GLSA 2ZVAA 1U59A 2W1FA 4E71A 4ZYSA 3WYXA 1KE5A 2FB8A 4OT5A 3QUEA 2VWIA 4L44A 2QG5A 1XXGA 3ERKA 4MM3A 5KKRC 2JDOA 3KMMA 3L4PA 1JAMA 2R3PA 2UVYA 5E90A 3QA0A 3DB6A 3B9JA 2CS4A 3ZO2A 2X1NA 3AC2A 3O7LD 4GDKA 1SGHA 2CJOA 2XK3A 1M7NA 4CFWA 4PRJA 1GJZA 4K3CA 4Y5QA 1DGJA 5CI6A 2WMAA 4CT2A 2J7TA 5J2RA 3ZDTA 5JK3A 4EH4A 3ZO5B 2D3CA 1FGKA 3POZA 2YZLA 3NZ3A 5HCYA 5LARA 3GP0A 5I9WA 3ALBA 1IPGA 4HCTA 3T9IA 4S31A 1W0XC 3N1YC 5JQ8A 4DCEA 5C1QB 3LYYA 2N7EA 1OVEA 2I0VA 4JQ8A 4YJPA 2CDZA 4LNIA 3V51A 2BFYA 3TXOA 4CTBA 4ICUA 3VW8A 4BDKA 2WOTA 4I20A 5HZNA 5JHBA 4V0GA 1I42A 3R2TA 2ZDUA 4GDLA 1LFDA 2WDTB 3M3JA 5HNBA 1SE3A 3LJ0A 2NTSA 2C1BA 3ZLWA 1HEZE 4O86A 1CZPA 2VV9A 4S34A 1M2QA 1A5RA 5LNK1 5ANGA 3D2KA 2V0DA 5JT2A 2X8IA 3V5QA 4MXCA 2OZOA 2QR7A 2Z7QA 4NJ7A 3BE9A 1Q0WB 4CCUA 3RNGC 5KMMA 3F61A 5AA9A 4ZRJA 4FL2A 4N4SA 1WGYA 4QPMA 3TTIA 1WXQA 3ANQA 2JAMA 3PVUA 2BDWA 2EU9A 2IF8A 1UKHA 1ZP0B 2JIIA 1RAXA 3ID6C 5DLSA 4BBFA 4WSYA 3ZU7A 2WMUA 1OB3A 2KANA 4RPVA 1P9DU 3VUDA 1OIQA 3B2WA 3JY0A 5K0XA 2ZYBA 2HIWA 1YX5B 4DDID 1R0PA 5CQUA 2JRIB 2Z8LA 3CXWA 4E6DA 2B9IA 4KZCA 3LJ1A 2WDVB 1Q5KA 3TJPA 3TNWA 5AX3A 1L8TA 5GJFA 1SSNA 4WHZA 1CQVA 1PW2A 2R2OA 3D5UA 4DEAA 5AUKA 3PWDA 4QMPA 5IKCM 2ERKA 1PXKA 4ACCA 4K81A 4RFZA 1CM8A 3FSKA 2QONA 2WQEA 4FIHA 4IX5A 4PS3A 1GIJA 3CMMB 5HTIA 2DZMA 3U6HA 4OTIA 4NYEA 3RPYA 2Y5CA 1E0ZA 2UZWE 3TKHA 3HX4A 3NLBA 3PLSA 4BN1A 3IVFA 5DIAA 3DDPA 4JBVA 3L1SA 3HRCA 5EM5A 4H1JA 1MUOA 3VULA 2IZSA 1WF9A 4OBPA 4BDBA 3OOMA 5JXVA 3KRXA 3L8SA 5GMVA 2GS6A 4YTHA 2LI5A 4ASDA 4A4XA 1M7QA 4EH9A 3UOLA 4E5WA 1J19A 4G50A 3CKWA 3RULA 3P63A 3VNTA 1P4FA 4U44A 1S1QB 3FXWA 3G2FA 2RFSA 4ZZOA 3QQHA 4IEBA 4ZAUA 3QHTA 3VBVA 3CTJA 1Z2MA 5JHAA 2VZKD 1F0QA 2WLBA 5CANA 2NO3A 5IA1A 4I6LB 1ET6A 3EFUA 2P3GX 2J5EA 4RM9A 1JLUE 3TJDA 3R1QA 2RIOA 4EOJA 3ZXRA 3MY5A 2ACZB 1G5SA 3LJ2A 3MHZA 1FNUA 2C5YA 1ESFA 1J3HA 4B6WA 3AE8B 4MXXA 3H7SA 3C4EA 4A55A 3O23A 4H36A 3KXZA 2ITZA 2IZUA 2OKRA 1GJOA 2YWPA 3W0PA 3UZTA 3UP2A 2REXA 2FIDA 3GVUA 2VO7A 1WJ6A 3RNIA 3V5JA 2PMLX 2YEPF 4X6RA 5M56A 4RMAA 3E3BX 5B2MA 2Y9QA 2NMQA 1X8BA 3RNAC 3HDNA 5HU9A 3GP7A 3FI4A 3BPRA 3BKBA 4D5KA 3A9JB 5CX9A 4EOKA 3P1MA 3R04A 1YOJA 4IWPA 2XCHA 5C4KA 3QQFA 3OWLA 3HA8A 2H9VA 2JIUA 4MBIA 1PQSA 4BZOA 3C4ZA 3QXPA 4ZTLA 4DINA 2X2KA 3M42A 2AQ3B 2HTHA 3I81A 2XNOA 4GCJA 3S1HA 4DHZB 2UZNA 3EFJA 2YLEA 4NT4A 2YM3A 2E9NA 4TQ1A 4YZ9A 4IC7A 1SIFA 5IQFA 3RFZB 3QUPA 1PXJA 2HAKA 2KTRA 2XK9A 4HYSA 1IUEA 3ZZEA 4RJ6A 3LCTA 5EHYA 5DRBA 1ZW7A 1TQPA 3KVFB 2X8DA 4YJSA 4BWXA 2VZKB 3E8NA 3KIOC 3KH0A 3WIKA 2XNMA 2OO8X 1G3NA 4MXOA 5D3IB 2X38A 2KQ4X 2C68A 4W9JA 2PLPA 4APPA 4FEXA 1AGWA 4DFZE 2DZIA 2XK5A 2KN4A 4GEOA 2I1MA 3U4WA 4O4EA 4FKUA 3NCGA 3R7RA 2PZYA 3D32A 2W1EA 3H9RA 5KMJA 2YABA 4QMTA 4EC9A 5EDRA 2YLMA 4RJ3A 4K0YA 2XNBA 4RIXB 3JR1A 3R9HA 1TKEA 1UWHA 4ASZA 4Y95A 3LDZE 5IA4A 4MACA 4FG7A 2G4DB 2VWXA 3WF8A 2W4OA 1UU8A 1H24A 4B95A 3ZNID 4RWJA 5J9ZA 4CFFA 4YTNB 4K2RA 2KXJA 1P2AA 2E2BA 4FSRA 3L9PA 4IDVA 2O6VD 2CHLA 4WJOA 1DM2A 5BUIA 1T46A 1WI0A 4RMZA 4KS7A 3DPKA 4P7EA 4AUQC 4K77A 1KSWA 3DBQA 3QKKA 3RUIB 3H7PB 3CE3A 2KKCA 5J7BA 2DQ7X 3Q4CA 3BQCA 1KLUD 4XJ0A 2MEKA 1WYGA 2OOBB 2LVOA 3I5JC 5AP5A 1EWCA 3S4QA 3UIMA 1HTOA 4MVFA 1V8CA 4M13A 2XIRA 1RWSA 1T5XD 3O8UA 1VZ7A 3UVPA 4MF0A 5GZ8A 3PHWB 2OXDA 1KOTA 2FSLX 2IO0B 5AUUA 5DPVA 4HNFA 1WMHB 2WWZA 4TN6A 5EDSA 3U7DA 2BTRA 3HMOA 2WMTA 5IEYA 1J8CA 3KXGA 3SDJA 3G90X 4GT3A 1VLRA 3KRLA 5HTCA 3MV5A 3Q5IA 5FM3A 4CFUA 4EOSA 4QPAA 1PMEA 4K33A 3QD4A 3L16A 2YCRA 4M15A 1G8KA 1Q99A 3FWQA 3V8SA 4ARCA 3P23A 1I09A 3QUDA 3ZRMA 1ZYLA 2X8XX 1LPUA 3VVHA 3SQQA 3C4XA 1RE8A 4QP7A 3QTUA 1FVTA 2PKOA 3HYHA 2DZJA 4G5PA 4L9IA 4Q5HA 3LQ5A 4XGAB 4RX8A 3MVMA 4D4YA 1QLBB 2PVRA 3AE9B 3PZHA 4PX6A 3RK9A 3T3OA 5M07A 5AX9A 2ONQA 4U45A 1CKPA 4IB3A 5CVFA 1YDRE 4NAWA 3UO5A 4RM8A 2JVCA 2PSQA 5JFVA 4RGJA 2O6VB 1Y8GA 3U30A 5D11A 4EH8A 2RKUA 5IP4D 1JKSA 5IUHA 2KJHB 2HOGA 3TUCA 2W1DA 3ZKJC 5LJJA 3PTGA 1YX6B 5AZHA 4F7NA 1JWBD 5LXIB 3DFAA 4MDKE 3PA5A 1DS5A 5TO8A 5AR3A 3TEWA 3EN9A 4PNIA 2EELA 1HA5A 1H8CA 2DYBA 3W32A 3OTVA 3EQDA 3QZGA 3QCXA 4QMWA 5F1ZA 1F0ZA 2GRIA 2PMOX 3HKOA 4BCIA 3W0MA 3Q2AC 2BHEA 2VTHA 4GJ2A 4AUAA 4AGUA 4FKVA 3SFDB 2XM8A 4HGSA 2C5VA 4I6BA 3N32A 2ZVNA 3P7BA 5JGAA 3F66A 2A5UA 4HGEA 4AA0A 3QTIA 2C6IA 4EH2A 1G8AA 3F2AA 2CHZA 3V5LA 4HXDA 3ZRKA 4F64A 5L2SA 1V5OA 3CY3A 2CMWA 4YGAA 2I40A 3ETRA 1FFUA 1PRYA 1ZGUB 1URWA 3KF7A 3WARA 2IZTA 3VR8B 4ZTSA 4A07A 4AA5A 3QKLA 4DHIB 2KDEB 3UIOB 4G6OA 1EF1A 3NVKI 3ZEWA 3BEAA 5TKDA 4X3FB 3KYDD 5L6PA 3J9CA 1PGBA 3WYYA 3RPSA 4DDGA 3CKXA 4HVSA 5IA2A 5ANIA 4CFMA 5AAGA 3QD2B 3O2MA 1NYRA 3OJ3A 4HW7A 5FWKK 4PL5A 4RIYA 4IVBA 3CEKA 3O8TA 3PFYA 4ZY5A 4O82A 1Q3WA 3TV7A 3W1SA 2H6DA 4TNDA 4HYHA 4RFYA 2Z0DB 4AAAA 5EH0A 1GNUA 2WU5B 4JLCA 5AUTA 3UPXA 3PVWA 2FH9A 4E4XA 2UW0A 2Q5WD 3EECA 3LFFA 4XV2A 1UUPA 3NS1A 1OITA 2DAFA 3IW4A 1NY3A 4FTRA 3MP9A 3CQEA 3RWQA 3JUHA 3R63A 3PUFC 3R28A 4WD5A 4FTKA 2KX3A 1GC7A 1PJKA 4C33A 4MJSB 2C69A 5ITAA 1J7IA 2O65A 2W5HA 4RA5A 4M01A 4X2JA 4Y46A 4FI1A 2PJHA 3VS6A 5G5GA 3BWJA 3EZVA 2Q0NA 2XARA 4XP3A 4RC2A 2BYTA 3TV6A 3DBLI 2PE9A 4YLJA 5CYIA 2BDJA 1JSTA 2RF9A 1RDQE 3L13A 3JXWA 2KVZA 4DBXA 4EHZA 3AE1B 3ZFMA 4MQ2A 2O63A 4HJOA 2R2PA 2OFUA 1GNGA 1XH5A 4JVGA 4QQTA 4HZRA 1NI2A 2C60A 4G17A 3DJ6A 1GIIA 3IT6B 5C1ZA 1BUIC 2YCQA 3QHWA 5DYJA 2R64A 4I92A 3ZRCA 1NVQA 2V3PA 4M0ZA 4PT5A 5IDNA 1QPEA 4Z3VA 3L8XA 2NNWB 4IAKA 1V2YA 3NYOA 1CJEA 3CSVA 4RG0A 4PWNA 2ITWA 1W83A 5AJQA 4AT5A 2VX0A 2QVSE 3LFNA 4FT5A 5HG5A 4LYNA 3HZTA 2BZIB 1QOBA 1Z5SB 3ORZA 4HROA 4JDIA 2HD5B 3EMGA 2ZPYA 3NFGB 4FEVA 3FZRA 2MJ3A 1ZRZA 1JBPE 4W9KA 3BLQA 3EA6A 3WBLA 4DH1A 2LGYA 1IGDA 3OCGA 2CGUA 5L2QA 3DXNA 4XG4A 2LZ6A 2UZBA 5DPSA 2HE7A 3LFCA 2GMXA 3NVMB 5TSSA 2BVAA 3OEFX 5HLWA 4M00A 3AKJA 4X21A 2X9FA 2QO9A 3PXZA 3PY0A 4DGOA 1WH3A 3MFUA 3FC1X 3AD5A 4Y5HA 2PTKA 4FIGA 4J3OD 1I35A 3NR9A 4EQUA 3N20C 4BGHA 2JAVA 3IW6A 2UW8A 4FKIA 4MM3B 4ORKA 1N60A 1OL1A 4WRGA 2PYWA 4ARKA 2UW7A 4FTOA 3RHXA 4CYIA 4N57A 1XH8A 1KWPA 2DYOA 2PW9A 2D2QA 2QHOA 4L3LA 4R5YA 3WZJA 1QCFA 4CRSA 2EKIA 4GDKB 3AECB 2QC8A 4YSXB 4C4JA 3DVNU 1UNSA 4LDTA 2VU3A 2DLBA 3HV3A 2I6LA 5M06A 2Y6MA 2AL6A 4YTFA 5BO4B 1L4DB 5HTBA 3ZUTA 3QGWA 1P7EA 2R5TA 3GC7A 5B2KA 2JY6A 5J17A 3AULA 3W1FA 3AE4B 4KA3A 3V5PA 4JMQA 2HWOA 4YURA 4LK0M 1UD7A 2F2CB 2OW3A 3GFEA 3TYKA 1TZOA 3A7HA 2XA4A 4EJ7A 5I9VA 3DBCA 2Z02A 3NUAA 4FODA 2G01A 4JQ7A 3QA8A 4YZDA 2G45B 4OUCA 5DT3A 4EWQA 3LAUA 2DNFA 2WYQA 3UO6A 3CTQA 1SBBB 4V0GB 1XLNA 3UQAA 2O3PA 4BKSD 3Q9ZA 2F2UA 4GDLB 5CSXA 3DOGA 4TYEA 4G31A 4F6SA 5FDXA 2QU6A 3MH2A 4JAJA 4O7SA 4ZP5A 4BZNA 1UWMA 2MW5A 4URKA 3W2OA 1PY5A 3UIBA 2W1IA 2ZV7A 3NNXA 4BDGA 4EKKA 4II3B 2OBJA 1I4GA 3SFEB