3AB5A

Crystal structure of the 2fe 2s ferredoxin from cyanidioschyzon merolae
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
97
structure length
97
Chain Sequence
MYKIQLVNQKEGIDVTIQCAGDQYILDAAEEQGVDLPYSCRAGACSTCAGKLVKGSVDQSDQSFLDEDQISKGFILTCVAYPTSDCVIQTHQEEALY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin
publication title Crystal structure of the 2Fe 2S Ferredoxin from Cyanidioschyzon merolae at 1.18A resolution.
rcsb
source organism Cyanidioschyzon merolae
molecule tags Electron transport
total genus 25
structure length 97
sequence length 97
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ab5A00
1XLPA 3AE5B 3NVWA 4US9A 2DWQA 3W5VB 1V97A 2N0SB 3AEBB 3AEDB 3AE6B 1T3QA 3AE9B 2W3SA 3AE3B 2K22A 1FXAA 1ZP0B 1VDVA 2WQYB 1RFKA 2W54A 3AN1A 1FIQA 1OFFA 2K9XA 2PVOD 3AE1B 4N59A 3RPFC 3VR8B 3NVVA 1E9MA 1N5XA 2WDVB 1QOBA 3AECB 4YTPB 1YQ4B 5G5GA 3SR6A 2Q5WD 1NYRA 3AEGB 1FRDA 3W9CB 3ZYYX 1JQ4A 3FAHA 1E10A 3DWGC 1L6UA 5H92C 3CWIA 3HUIA 1KRHA 1WYGA 1OQRA 1FFVA 1ZOYB 2K5PA 2KMMA 2WP9B 1XO3A 1J7AA 1XLNA 4JWSC 1SIJA 2WDQB 2WDRB 1NEKB 3AE2B 3LB8C 3P4SB 3AH7A 1QOAA 2CJNA 3CIRB 3EUB2 3P63A 1RM6C 1NVID 3AB5A 3ABVB 1AWDA 1KF6B 2BS2B 4JX1C 4WWMA 5H8YE 2H89B 4HRSA 2G1EA 3VR9B 1TKYA 3P4RB 1E7PB 2BT6A 1YJJA 2B76B 2DBYA 1N63A 2W3RA 4YT0B 4YTMB 1E0ZA 1AYFA 4N6EB 1QOGA 1ZXIA 3WCQA 1DOYA 3PO0A 1YJIA 1OQQA 2QJLA 1JWBD 4USAA 2WS3B 1ROEA 2M19A 2WU2B 1L6VA 1RWSA 2PKOA 1PUTA 1FFUA 1B9RA 1WWTA 1L0VB 4C7ZA 4ZHPA 2JQRB 4C80A 5G5HA 2BS4B 4WQMA 1TKEA 2Y5CA 1R7SA 4ITKA 3VRBB 1NENB 3P1MA 2LEKA 2BS3B 1SF0A 3P4PB 1TYGB 1CZPA 3AEAB 2E3TA 3LXFA 1ZUD2 4YXDB 1FO4A 3AV8A 1FMAD 1FRRA 1A70A 1VJKA 3BIID 2H88B 1N61A 3L4PA 1SB3C 1JWAD 1L5PA 3NRZA 4C7YA 1JALA 4KX6B 5AUKA 3AEEB 1CJEA 1UWMA 3SFEB 1WXQA 2M56B 2WU5B 1IUEA 1PDXA 4IDIA 5C3JB 3VRAB 1J7CA 4A9AA 1VLBA 1XLOA 1QOFA 2L52A 4JWUC 1DOXA 1GAQB 1JROA 1N60A 2FBWB 1NI3A 2MJDA 3AEFB 3B2FA 2PVGC 3AE8B 3NVZA 4FXCA 4YSYB 2EKIA 5C2TB 2OHFA 1QF6A 3DWMA 2CJOA 5EE0A 3AE4B 1RYJA 2PIAA 1DOIA 5EE3A 1WRIA 1KFYB 3NVYA 4LTUA 3ETRA 2MH7A 1FXIA 2MJ3A 2HTME 4ZHOA 3NS1A 5MPOA 1E6EB 3AMZA 1TJEA 1XLQA 2CU3A 2MJEA 2QIEB 3HRDD 1QT9A 2W55A 1NYQA 5AUIA 2ACZB 4YTNB 1PFDA 4US8A 4P6VF 4YSXB 3B2GA 1J7BA 3AE7B 3W5UB 5EE9A 1N62A 3SFDB 1QLBB 1I7HA 4YSZB 3HVZA 3B9JA 4N58A 1JW9D 5GXGB 3KWLA 1V8CA 2L83A 1F0ZA 3FC4A 5EE1A 1GPXA 2JX5A 3AM9A 1FM0D 2WLBA 4HROA 1TKGA 4ZOHC 1DGJA 2AX5A 1JRPA 1N5WA 1EWYC 3P4QB 1WGKA 2KAJA 1YQ3B
chains in the Genus database with same CATH superfamily
1XLPA 2QEJC 2D10A 2MBHA 4RF0A 4MH0E 2BQQA 2KQ4X 4HK2A 1TT5B 3JSVB 2IGHA 1P7FA 4EOYA 4WWPA 2NBVB 2CU1A 4MJSB 3CSTA 4YTPB 3RCZA 2Q5WD 3OJ3A 4C4VB 4W9KA 2KQ7A 4XDCA 4KGRA 1SEBD 4GXBA 3VH4B 2KWDA 1VCBA 4A3PA 1XO3A 2KC2A 1PGXA 2CJNA 2RDGA 3P63A 4S0RA 1AARA 3W2DA 2Z0EB 1AWDA 2BS2B 2RDHA 4IG7B 2WNMA 1TKYA 2DBYA 1E0ZA 5GMVA 2J0JA 3GZNB 1C76A 2D5GA 2GBJA 4MELA 1XXGA 1L0VB 1XF5L 4JL9A 4LCDE 2V3NA 4L1BA 3WALA 1XD3B 1V2YA 1YJ1A 1EF5A 1L0YB 3EA6A 4ANVA 3PRMB 3DVGY 5AUKA 3RNBC 1IUEA 1WI0A 3PTFC 2N9KA 3M63B 5JH5C 1JWUD 2OJWA 2GBNA 4DXAB 2BKRB 2G3QB 2BVCA 4HEA1 4DHZB 2M0XA 4BKSD 3NS1A 5TSSA 1V5TA 2ACZB 4WJQA 2IO0B 3AE7B 2Z8LA 2BWFA 1JWMD 1Q5WB 4URKA 2INCC 1NI2A 4M0WB 2MBOA 4P1CC 1LGRA 1V8CA 4AOFA 1GPXA 1BUIC 3B0AA 1WZ0A 1F2RI 3J9CA 1V1PA 2GRIA 2WX0A 3AEDB 4HCNB 2LJ5A 4ICUA 5HI1A 3AE1B 2RR9A 1IPGA 3ONSA 4KDLB 1S1QB 1NYRA 2WXFA 3FAHA 3ZTDA 5H92C 4TQ1A 5BMIA 1OQRA 4GMVA 2WX1A 3H6NA 3P4SB 2Z0DB 2JPHA 1KH0A 4W9JA 5J17A 3NHEB 4JGHB 3Q2AC 1P3QU 3BY4B 2KACA 1AYFA 1GOZA 3OJ4B 3DOWA 3ZRCA 2ZCBA 3PHWB 1E8YA 3HHMA 2Y5CA 2GBKA 2ZEQA 2LUEA 1CZPA 3MJ5A 4F7ZA 4ZRJA 2MHJA 1WYWB 1SSNA 1UGJA 3RZFA 1MI0A 3VTUA 3ZJVA 1Y56A 3FILA 2K39A 5BMGA 1K8RB 2ZW0A 3UF8A 4ANXA 1J7CA 1VLBA 3EC8A 2Z59B 2FCQA 2PPHA 3IT6B 4A3OA 1JRUA 1P98A 2WXOA 1GB4A 3Q8BA 3ZGZA 4M8MA 1ZGUB 2G4SA 4YTNB 4B0EA 4YSXB 1T0QC 1QLBB 2JU6X 2WXLA 3KUZA 5I4DA 3C19A 3L0WB 1JW9D 3KWLA 1SJHD 2YVCA 3DVNU 2WXHA 2I1JA 3IXSA 3Q8EA 3PLVA 3ZNGC 1TS5A 3AE9B 3A4RA 1FIQA 1L2NA 4WJOA 2FE8A 2JXXA 2K8HA 3IG3A 3V60A 2K5PA 1FFVA 2KFKA 4II3B 2B3AA 2MBQA 2KZRA 3ABVB 2M4NA 4RM9A 2N9XA 3SD5A 1TZOA 1C1YB 3VH3B 4HJKA 3TL5A 3N9YC 4IM2A 3M62B 4LNNA 3QHTA 4NY0A 2BWES 4GB9A 4JIOU 3VRBB 5FKAC 2L00B 2E3TA 4YXDB 4RFBA 2PW9A 2BW2A 2RD0A 4FJYA 1AW7A 1GC7A 3EGRA 4Q2JA 3H9DA 1WIAA 2EKIA 2FCNA 3N20C 3Q8AA 4O1NA 5L95C 1VZ8A 4IKGA 4TUUA 3ZO5B 1R4MI 4TKNA 1PFDA 2BYEA 3RNCC 4K7SA 4HVBA 2KX3A 3RNEC 1OEYA 1NDDA 2FAZA 2Y3AA 2FUG1 3K9OB 1N5WA 1JMLA 2NPTA 4PK1A 2EKEC 2ZNVB 4YTMB 4EZLA 3AE3B 2N1VA 1Z2MA 4RGTA 1I4RA 2SEBD 3GE8C 4LLGM 1EWCA 4OZCA 3W9CB 2V4LA 3DBRB 2C7NB 1L6UA 5BYQA 1WYGA 1YN4A 1XLNA 4JWSC 2WGSA 2AQ1B 4NPNA 1NEKB 3IT4B 1C4CA 4F1SA 1TZ1A 2D11A 2N7DA 5BO4B 3VDZA 2KWCA 2M19A 2WU2B 2V0GA 1WXMA 1PUTA 4OHJA 3QARA 4ZHPA 4WQMA 3ZQ4A 5CX3A 3R2IA 1TYGB 3RULA 2VRRB 3N3KB 3H7PA 2BTEA 1C3TA 2KDBA 4GDLA 3AI5A 4GLSC 4EZJA 4A90A 4XWWA 2EMSA 4MT5A 3DBHI 4JWUC 1Z5SB 3H8HA 2WXIA 3AEFB 1QF6A 2INDC 2ZW1A 3A9KA 3AU5A 2LHDA 1RYJA 4MGYE 1WRIA 1KFYB 3T3NA 1MFWA 5DPRA 5IA7A 1XLQA 2IGDA 3VFKA 3MC8A 3DCGA 3HRDD 2BYTA 4US8A 2ZPYA 2REXA 5J18A 1J7BA 1WE6A 2FIDA 5CHWA 2C60A 1UZXB 3PV1A 3NOBA 3V62A 3IVFA 1IGCA 3T3OA 2VZKD 1V1OA 2I2YA 3S2AA 4WJPA 4HROA 1YX6B 3P4QB 2ZCCA 4KV2A 4LJOB 3NVWA 1WH3A 2JZPA 2L0TA 1WJNA 2MRPA 2CHZA 1E9MA 2JWUA 2HJ8A 1FRDA 4GN1A 3W1YA 1V80A 4HPLB 2RPVA 3DVGX 1FCLA 4DBGA 2M1MA 2IDYA 3BVGA 4FJZA 2FCSA 4BBNF 5H8YE 1YJJA 4PS3A 1SBBB 4LK0M 3BK1A 5D6JB 5D3DA 1YIWA 3EECA 3B1LX 3EHVA 2XBBC 2CKHB 3WAOA 3TEZA 4KVGB 1RLFA 3RFZB 4ACFA 1ZPSA 2G45B 3LXFA 1D5XC 2KD0A 2Y5PA 5L83A 1XCQL 1OEYJ 1N61A 1JWAD 1L5PA 1TY2A 2UU7A 1GUAB 4R3DA 4KGSA 2K8CA 4L23A 5DPSA 4A6QA 2PVGC 4IW0A 2JSVX 2PE9A 1UD7A 1SE2A 5MPOA 1MJDA 1VR9A 2LD9A 2MP2A 1QT9A 1NYQA 2KFKB 1C77A 2MQJA 1J0GA 5E6JA 1FEHA 2L05A 2TSSA 3R3MA 1K53A 3PSEB 2N7EA 4JE3B 2WWZA 1GB1A 1T0RC 3KUCB 4MH8A 1WGHA 2DHZA 3U2SC 5JZEB 2L76A 2BB6A 4TMAB 3A33B 3QC8B 1Q1OA 3KWVA 1VDVA 2AWTA 3D32A 1ISNA 4CQNA 1D4BA 4ARIA 5G5GA 3NZUA 4EE2A 3DWGC 3CWIA 2RPQA 2LASA 3PRZA 3E56A 2MW5A 2GLSA 1KF6B 1HTOA 2KDFB 4FJVB 2L8JA 3VR9B 3P4RB 1ZKHA 1M94A 4YT0B 2D3AA 2K1FA 1HA5A 2LGYA 3RNAC 2NMQA 5EDSA 4K1RB 4MM3A 2WXKA 1GJZA 1QQRA 5BYSA 4C7ZA 4FN2A 2GBRA 4MSMB 2C7HA 3AU4A 3NG0A 2K6QA 3N1ZC 3DDCB 2BS3B 4FHKA 5LXHA 2LGXA 4MSQB 3L4PA 1SB3C 2VH1A 1EF1A 4KKJA 1WXQA 1WJ4A 2HE7A 4JLCA 1UH6A 4KDIC 1SIFA 2NPTB 3I5JC 2IBIB 4BZAA 2QMTA 2FUHB 2KXJA 5G55A 1J8CA 3Q3JA 4PS8A 1B1ZA 3AMZA 2BGFA 4JPSA 3VUYA 1NBFC 1HEZE 1WR1A 5EE9A 5IKCM 3ZDTA 1QILA 2FNJB 3IBEA 1WZ3A 4LJPB 4AP4C 4REZA 4HDOA 3R2TA 2KNBA 4WAFA 1K52A 2AQ3B 2XEWA 3QAQA 2WXRA 2W3SA 4J3OD 2K22A 1FXAA 1EU4A 5E6OA 1WR6E 5T8IA 5TR5A 3ZYYX 2NBUA 3H7PB 2KLGA 3ZTCA 1TS4A 2J0MA 2OOBB 4GDLB 3Q3MC 1HZ6A 4ARCA 4G11A 1FNVA 4W9EA 3JYUA 3L17A 5HG2A 3AB5A 4HKZE 4L2YA 4AUQC 2ZPNA 3A9KB 2IGGA 2O6VA 1QKZA 3PO0A 3DHIC 1IP9A 3W1SC 1ROEA 1RWSA 1BXTA 4ZRKA 4FA6A 3GZNI 1SXTA 1YOVB 4ITKA 1R4NI 3GE3C 5FR6A 4K3CA 1ZDVA 3GS2A 3AV8A 2KJHB 5LLIA 4WWNA 1WRDB 2D3GA 3Q14C 1CJEA 3SFEB 3Q8FA 2M56B 3ZRFA 3PLUA 3V3XA 1UNSA 2KLCA 1QOFA 3LJ3A 2MJDA 4OZAA 3O13A 2D07B 4YSYB 2KKCA 4IUMB 5EE0A 1WFYA 3ZDMC 2GMIC 2MH7A 2MJ3A 2XK5A 2ZNVC 2C5LC 3DPDA 3NZ3A 2W55A 2K3UA 4ANUA 3ZIMA 1JCKB 3HIZA 2RGFA 3KLSX 3APDA 5D7GA 1PGBA 5DPTA 2BYFA 1P9DU 4F8CB 3VAWA 2JX5A 2WLBA 4HDQA 3ZKJC 2A4ZA 4IM0A 3R7QA 1YQ3B 4LNIA 4US9A 1UUPA 2DWQA 1V97A 1WXSA 3AE6B 1J19A 2IYDB 2K9XA 3NVVA 2UWQA 3LDZE 3SR6A 1JQ4A 1GC6A 1MG8A 2WXGA 5E6PA 1KRHA 4ICVA 2NTTA 2KDEB 1Q0WB 2LVOA 3I63C 2L3ZA 1STEA 3BYYB 2KTFA 3WCQA 1I42A 3ZVVA 1C78A 4NJ7A 1XEEA 2QILA 5AZHA 3IAM1 3ZLZA 2MP2B 3UIOB 1TIFA 2BS4B 4HCPB 3PGEA 2G9HD 2ZVNA 2NCNA 1Y8RC 1CMXB 4G3XB 1WGDA 1I4XA 2MCNB 3WIMA 1TS3A 4PT5A 4ZRIA 4M02A 1M4VA 3DBSA 2V3PA 4FADA 4W9HA 5IO9A 3TCAA 2YEPB 3TEWA 1SGHA 4AWJA 1I4HA 3AE8B 3AE4B 3NVYA 1FXIA 2DZIA 2J53A 1VRAB 3Q3NC 3VUWA 1TJEA 4EFOA 3TMPB 1P1AA 2CU3A 3DBLI 4P1BC 2JYEA 2AL6A 4XWTA 1YX5B 3KW5B 4M8NA 3QQ8B 4FLHA 5JXVA 3ZW3A 1XT9B 1LFDA 1OTRB 2KAJA 4DDGD 4IWPA 1LXDA 4MM3B 1IBXA 3W5VB 4WWOA 1V5OA 1TGZB 4MEMA 3UIPB 2JYTA 1EM7A 1IYFA 4OVVA 2JZ3B 2ON8A 3R7RA 3A9JA 2KANA 2QDFA 4ZYNA 2KTRA 4HWIB 2QSDA 3EUB2 4GOCA 4JX1C 2RSUA 4WWMA 1WM2A 3DBHB 2X8XX 3O65B 2DAFA 2GB1A 2FCMA 3SHQA 3AULA 2PTLA 2SAKA 2O6VD 3UI3A 4NAWA 4K7WA 2ICIA 2OEDA 5G5HA 1R7SA 2VH2A 4B6WA 1NENB 2IO1B 2BYVE 3HK0A 1SF0A 2KHWB 2IY1B 4EZKA 3UQAA 4ZRPA 3RNFC 3TJPA 3U8ZA 1FNWA 2KX0A 3FKYA 1FO4A 1A70A 2BB5A 1QZEA 2MBEA 4KX6B 3MTNB 5BMHA 1SE3A 1CQVA 1T6BX 1KTKA 3DQVA 4A9AA 3VUXA 2LVPA 4XC2A 1GAQB 2YLMA 1UBQA 3B2FA 3Q8CA 4C00A 2N9EB 2MWSB 4IM3A 2R61A 3VTWA 3NJTA 3APCA 2JXTA 3N30A 4ZHOA 1V6EA 3A4SC 5LNK1 2D3BA 3UQBA 4ASWC 4OVUA 4AJWA 3PZ8A 2BPSA 2LGSA 3NZSA 3V6CB 4DXFA 1I7HA 5FK9C 3BVMA 4CHKA 1V1PB 2LXCA 2O6VB 4W9DA 4W9CA 1FM0D 1LO5D 4ZOHC 1RRBA 1ZDXA 4M0WA 2R2OA 3GOEA 3VTVA 2KN4A 1P0RA 2WQYB 5DPWA 2W54A 1LM8B 3GP7A 4N59A 4XYCA 3HM3A 4BBNC 1YN3A 2LVQA 2KN5A 1V86A 1ZOYB 3VQIA 2C9WB 2WP9B 3KH0A 3DBRI 1V9JA 4EEWA 3BZDB 1G6JA 3PS6A 3L54A 2G1EA 4J6IA 2DNFA 1EO6A 2QCZA 4I6PA 2AEHA 1FNUA 1VZ6A 1F2RC 1OGWA 1YMHE 2XK5B 1U4AA 4LNKA 2MA9B 1WWTA 4C80A 2WXQA 1D6EC 3FILB 3P2BA 3RNGC 3ZXVA 4C56C 3AEAB 3DVNV 1ZUD2 5HHDG 1L0XB 2KQSA 4PS7A 3NRZA 4HPPA 1ZXHA 4GU2A 3QA8A 5C3JB 4W9IA 1N6ZA 4EUTA 2FBWB 3RI7C 4GIVA 4GGQA 3DWMA 4DHJB 1MHHE 5EE3A 4LTUA 4N9F4 1F77A 4P16A 4GSWA 2UYZB 4KSKC 1C9FA 1KJTA 3N32A 2CS4A 2LJIA 1WGRA 3QJZA 1A5RA 3PZDA 2A5UA 3KUDB 1WE7A 1K51A 3RYTA 4HJGE 3V61A 1TKGA 2WHIA 1FXTB 3PREA 1MG4A 4RNAA 4AS1A 2KDMA 4WJNA 2J4XA 2X38A 1E7UA 3M95A 2KYWA 1ZW7A 1OFFA 1PYWD 2N7JA 5AZFA 1SE4A 3QX1A 4FULA 3I9V1 2WDVB 3AECB 4KIKA 3A1QA 3WAMA 3LYYA 2QHOA 3LB8C 1I4QA 5IP4D 4MGIE 4BOZB 4WH4A 3RMKC 2DAJA 3MP9A 4ZDVA 4DK5A 4G50A 3Q69A 4N6EB 1QOGA 3PT2B 4CO7A 2KWUB 1YJIA 2WXMA 2WS3B 1WMHA 2J0KA 4II2B 3JVZX 3IAS1 1VD2A 1VZ7A 3ALBA 2BKFA 1TBEA 1WXAA 3ZNID 1KLVA 5KHOA 4LDTD 3QWZB 4GDKA 2IZVB 4BOSC 3L13A 1TS2A 4RM8A 1JALA 2E6XA 3CMMB 1I4PA 1GG3A 2N9LA 3C8YA 2KMCA 1XLOA 1IBXB 2HDEA 1BT0A 2FIFA 3QK0A 5JHBA 1YQBA 2PIAA 4MGKE 2N9PC 3A9JB 3KVFB 3W1SA 5FR3A 1EU3A 4BKGA 2J7QB 2PEAA 2KT7A 2KTRB 3B2GA 4E3CA 3W5UB 2IJ0A 2KK8A 2AQ2B 2NBWB 4WIPA 2DZMA 4N58A 4RGMA 3U30A 4DDID 5DCNA 4RH6A 3AM9A 2MBBB 4NAWB 2LMCA 3NUHB 2O2VA 2KMAA 2LRWA 5CHVC 4BKTA 2DX5B 4TQ0A 1C4AA 1WM3A 4LDTB 4OW0A 4MGZE 1L7YA 1R4NB 3M3JA 1HQRD 3AEGB 1WX8A 1WY8A 3OLMD 4IWOA 2W9NA 2J42A 1WX9A 3TEYA 3HUIA 1WXVA 4HLEA 3V6EB 2IY0B 3RT3B 2V4IB 3SU8X 3ZJUA 5D94A 4RGOS 1NVID 2G4DB 2ZJDA 4HRSA 1L4ZB 1E7PB 2BT6A 1S3SG 3Q3OC 2IPKD 2PKOA 3R66C 1ZE3D 1EUVB 3P4PB 2J52A 2LI5A 1H4RA 1I4GA 2ZZPB 3T9LA 5E6NA 1F52A 1T0YA 4DXGA 2W82A 1FPYA 1PGAA 2WU5B 3CF6E 2WXNA 4IOIE 4XZ4A 4IDIA 3HVDA 4XE0A 4ANWA 1F9JA 1DOXA 3ENEA 2CHXA 2LXAA 4M01A 1T0SC 3EFCA 5IN7A 2NTSA 2HTME 1CK1A 2DZKA 2DYOA 2R2QA 2YEPF 3QIJA 2LHEA 2MJEA 3AXCA 5AUIA 4K7UA 2JF5A 4D2KA 4YSZB 3ECIA 5GXGB 4A20A 2AYOB 2PMVA 4TV3A 2AL3A 3U7DA 2JZZA 2DYBA 1AN8A 3EFUA 2RDBC 2JUOA 2MEKA 4FBJB 1X1MA 3AN1A 1ZP0B 4I6LB 1ET6A 1N5XA 3MFGA 1D5MC 2DLBA 2K0PA 3RN9C 4LNFA 4WURA 2LGDA 3T8MA 4XDDA 1LQBA 3MHZA 1SIJA 4G0NB 5AEKB 2KWVB 3CIRB 4OVZA 2LUMA 2JRHA 4DQOC 2L1AA 4NJ6A 2B76B 2PE6B 3VXWA 2IO2B 2D2QA 3N1XC 1OQQA 4NAMA 1F1HA 1H8CA 2GBMA 5CHFA 1OQYA 3RUIB 2JQRB 4S17A 1UGMA 3ZNHB 1ET9A 3DBLB 3TIXA 3ML9A 5IOIA 5AZGA 3IHPC 4HXDA 3U52E 1XQQA 4KGTA 4B0MA 3X0WA 4EKUA 4PYZA 1UWMA 5HKHA 2IO3B 1WJUA 1UF0A 4NJCA 3VRAB 2L52A 3PZ7A 1KLUD 2JVCA 3VVWB 1JROA 1N60A 2CJOA 4NZLB 1R4MB 3H7SA 4W9FA 1DOIA 2L32A 3JW0X 4KIKB 3A1QB 4M00A 4KZ0A 5KHQA 2V3SA 3B9JA 3K9PB 4XGAB 5EE1A 1E5WA 2AX5A 3TSSA 1EWYC 1C79A 1WMHB 3SEBA 1HE8A 5C1ZA 4ZRQA 1KM7A 1HZ5A 3Q3FA 1SJED 1TTNA 4GDKB 4OZBA 2I38A 1UWXA 4NQLB 2XNAC 4RF1A 4E74A 3ZUNA 2WDRB 3AE2B 3U4EG 1QOAA 2OJRA 3U7ZA 2PLPA 4RGNA 4BVUC 1N63A 2KOXA 1DOYA 3X23A 1T5XD 3DHGC 1JWBD 5LXIB 3SDLC 1FFUA 3OAWA 5CTRC 1TKEA 2MSED 3JSVA 2ZVOA 5HFYA 1MPEA 4MJSA 4HKQA 4C4VA 2I1KA 4A55A 2LZ6A 2WXPA 2H88B 1TY0A 4TSSA 3AEEB 1V49A 2DZJA 4K3BA 3H1UA 3NY5A 3BVZA 2O2VB 3TEXA 3TBLD 2WXJA 1NI3A 5C2TB 3WANA 3APFA 2EELA 1YN5A 2OHFA 1FCCC 3BYTB 4NNJB 2RMMA 3ETRA 2N4FA 3V05A 3MHSD 2DYMA 2NS5A 1E6EB 2KJ6A 4YWGG 3BWUD 1MHXA 3ZXRA 3L16A 4WQOB 4BAXA 4BFRA 4P6VF 2NVUI 2K6DB 4KZCA 3SFDB 1SE9A 3P42A 2INNE 3I57A 2GI9A 1DGJA 2JWZA 2WDTB 5J2RA 1B9RA 4XX5A 2LFIA 1WSPA 2N0SB 3AEBB 1E8XA 4RMAA 4A8XC 3RPFC 3VR8B 4HPMB 1QOBA 3PRPB 4WAAA 2JT4B 3IFWB 3OWEB 4IC7B 4I6NB 1P7EA 3BK2A 3R8BA 1E10A 2KC1A 4H2AA 1ENFA 4RCOA 4W9GA 2KDIA 3TUOA 1J7AA 3URYA 3AH7A 1FD6A 2XN9C 4FHJA 1YNTE 2W3RA 1KLGD 1ZXIA 2KJRA 1GNUA 4JQWC 4DHJD 1L6VA 3Q6BA 3QCAA 3MC9A 4DHZE 2NR2A 1E8WA 2KFJA 4CYEA 2C7MB 4MDKE 1JWSD 5IAAC 4AQ7A 1KOTA 3GB1A 2BBCA 1RAXA 1FRRA 3BIID 4C7YA 2ASQA 3E9SA 2M0AA 3BINA 1PDXA 4QAYA 1I35A 4ZYSA 2KO3A 2HD5B 3KQ4A 2LWPA 4BKSA 2K8BA 3KYCD 3RD2A 3B08A 3UINB 4B95A 1K50A 4NQKE 3ZNZB 1E8ZA 1IGDA 2DENB 5JHAA 2CR5A 4DWFA 3CSFA 3HVZA 4E71A 4K81A 1C4PA 2M8SA 1F0ZA 3FC4A 1HXYD 1WX7A 1WGKA 3MC0B 3PPAA 3AE5B 1BMLC 2WYQA 3PHXB 2GOWA 1T3QA 2QC8A 4LNOA 1RFKA 1RFAA 2N1WA 2V9HA 2PVOD 1E7VA 2K25A 2KVZA 1YQ4B 1E90A 3NS8A 3UGBB 3WA0A 2HTHA 2KMMA 3DHHC 2JY6A 1Q10A 2WDQB 4UDUC 1RM6C 2VZKB 4YL8A 2H89B 1D3ZA 1XCTL 2LGIA 2BF8B 1ESFA 1ACCA 1WJ6A 1MVKA 4B9KA 1D5ZC 2LRUA 4IWQA 3ML8A 2QJLA 4USAA 5D2MB 2EMTA 4AJYB 2ONQA 2D3CA 5D3IB 2MLBA 2Y5BB 3WAPA 3P1MA 3L10B 2LEKA 1WGGA 3VHTC 1FMAD 3L08A 1UELA 1VJKA 4PYUA 1WF9A 1HTQA 1DYQA 3ZJTA 2INPE 3C0RB 1L4DB 2PJHA 3NVZA 4FXCA 3OG5A 2V1YA 4P7IA 1V81A 3RZWC 2L0FA 2KVRA 2JRIB 3PVLA 2L7RA 2QIEB 2MX2A 2HJ1A 1WGYA 1PQSA 4KSLC 3HM6X 1N62A 5G2NA 3MJWA 5C23A 3KYDD 4W9LA 2CHWA 2L83A 4KKIA 5BYRA 4X57B 2M17A 3I3TB 4MACA 1JRPA 1YD8U 1UBIA 3N1YC
chains in the Genus database with same CATH topology
1XLPA 4MM3B 2QEJC 3NVWA 1IBXA 2JZPA 3W5VB 2MEKA 2JYTA 4RF0A 1EM7A 3AN1A 1ZP0B 2KQ4X 2IGHA 1P7FA 1ET6A 1E9MA 1N5XA 2ON8A 4YTPB 2JWUA 1D5MC 3MFGA 2DLBA 2K0PA 2Q5WD 1FRDA 4WURA 4XDCA 4KGRA 1SEBD 2KWDA 2RPVA 4XDDA 1FCLA 1XO3A 3MHZA 1SIJA 1PGXA 2IDYA 2QSDA 3BVGA 2CJNA 2RDGA 3CIRB 3EUB2 3P63A 3W2DA 4OVZA 2LUMA 1AWDA 2BS2B 2RDHA 4JX1C 4WWMA 5H8YE 2WNMA 4DQOC 2L1AA 2GB1A 1TKYA 1YJJA 2B76B 2DBYA 1E0ZA 1SBBB 4LK0M 2PTLA 3BK1A 2SAKA 1C76A 2D5GA 3UI3A 1OQQA 4NAMA 5D3DA 1XXGA 2ICIA 1L0VB 2JQRB 2OEDA 5G5HA 3TEZA 1R7SA 1ET9A 1XF5L 1NENB 2V3NA 3RFZB 4L1BA 1SF0A 1ZPSA 4ZRPA 3LXFA 1D5XC 1FNWA 1L0YB 1FO4A 3EA6A 1A70A 2Y5PA 1XCQL 3U52E 2BB5A 4KGTA 1N61A 4B0MA 1JWAD 1L5PA 1TY2A 4KX6B 5AUKA 1UWMA 5BMHA 1SE3A 4KGSA 1IUEA 1CQVA 4R3DA 1T6BX 4L23A 4NJCA 3VRAB 2N9KA 1KTKA 1JWUD 4A9AA 2L52A 3PZ7A 1KLUD 1GAQB 1JROA 1N60A 3B2FA 3Q8CA 4A6QA 2PVGC 2CJOA 4HEA1 4NZLB 2JSVX 2R61A 1DOIA 2L32A 1SE2A 2JXTA 4ZHOA 3NS1A 5MPOA 5LNK1 1VR9A 5TSSA 1QT9A 1NYQA 2ACZB 1C77A 3PZ8A 3AE7B 4DXFA 2Z8LA 1I7HA 1JWMD 3BVMA 5FK9C 5E6JA 1FEHA 2TSSA 3B9JA 1K53A 4JE3B 1V1PB 1GB1A 1V8CA 5EE1A 1GPXA 1BUIC 1FM0D 1LO5D 4ZOHC 4MH8A 3U2SC 2AX5A 3TSSA 1F2RI 1EWYC 1ZDXA 1C79A 3J9CA 4M0WA 1V1PA 2GRIA 3SEBA 2BB6A 4TMAB 3AEDB 2KN4A 3KWVA 1VDVA 2WQYB 4ZRQA 5HI1A 2W54A 3GP7A 3AE1B 4CQNA 1HZ5A 4N59A 1D4BA 1SJED 4ARIA 4GDKB 4OZBA 5G5GA 1NYRA 1YN3A 2WXFA 4EE2A 3FAHA 2I38A 1UWXA 2XNAC 3DWGC 4RF1A 5H92C 3CWIA 4TQ1A 5BMIA 1OQRA 1ZOYB 3VQIA 2WP9B 3E56A 3P4SB 2WDRB 3AE2B 3U4EG 1QOAA 3BZDB 1KH0A 1KF6B 3U7ZA 2G1EA 2PLPA 4RGNA 3P4RB 3VR9B 4YT0B 1N63A 2KACA 1AYFA 1GOZA 1FNUA 1HA5A 1DOYA 1VZ6A 1T5XD 1F2RC 1JWBD 1YMHE 2NMQA 2WXKA 1FFUA 1QQRA 1WWTA 4C7ZA 5BYSA 4C80A 2WXQA 1TKEA 2Y5CA 1D6EC 3FILB 4C56C 2BS3B 5HFYA 1CZPA 3AEAB 1MPEA 3MJ5A 4HKQA 1ZUD2 5HHDG 1SSNA 4A55A 1L0XB 1UGJA 2WXPA 2H88B 1MI0A 3L4PA 3NRZA 1SB3C 1TY0A 3ZJVA 1ZXHA 1Y56A 3FILA 4KKJA 3AEEB 4TSSA 5BMGA 1WXQA 2ZW0A 5C3JB 3BVZA 1J7CA 1VLBA 3TEXA 2WXJA 2FBWB 1NI3A 5C2TB 2QMTA 2EELA 1YN5A 2OHFA 3IT6B 3DWMA 1FCCC 3BYTB 1MHHE 5EE3A 4LTUA 2RMMA 2WXOA 1GB4A 3ETRA 3Q8BA 1F77A 3V05A 3ZGZA 4P16A 1B1ZA 2DYMA 1E6EB 3AMZA 4YWGG 3BWUD 1MHXA 4JPSA 1C9FA 4YTNB 1HEZE 4B0EA 4P6VF 4YSXB 5EE9A 3SFDB 1QLBB 1QILA 2JU6X 2LJIA 2WXLA 3P42A 4REZA 5I4DA 2INNE 1JW9D 3R2TA 3KWLA 3I57A 1SJHD 1K51A 2WXHA 4HJGE 4WAFA 1TKGA 2GI9A 1DGJA 3IXSA 3Q8EA 1B9RA 1TS5A 1K52A 2AQ3B 2LFIA 1WSPA 2N0SB 3AEBB 4RNAA 4AS1A 2KDMA 2WXRA 2J4XA 2W3SA 2X38A 2K22A 1FXAA 3AE9B 4J3OD 1EU4A 1FIQA 1OFFA 1PYWD 2N7JA 4A8XC 5T8IA 1SE4A 3RPFC 3VR8B 3I9V1 2WDVB 1QOBA 3AECB 3ZYYX 3OWEB 1P7EA 3BK2A 2FE8A 3R8BA 3LYYA 1E10A 4H2AA 1ENFA 1TS4A 4RCOA 3TUOA 2K5PA 1FFVA 4GDLB 1HZ6A 1J7AA 4ARCA 3URYA 3LB8C 1FNVA 1I4QA 3AH7A 1FD6A 2XN9C 5HG2A 3AB5A 3ABVB 4HKZE 4WH4A 4L2YA 3MP9A 1YNTE 2W3RA 2IGGA 3Q69A 1KLGD 1TZOA 4N6EB 1QOGA 1ZXIA 1QKZA 3PO0A 1YJIA 2WXMA 3N9YC 2WS3B 1ROEA 1L6VA 1RWSA 1BXTA 3IAS1 1SXTA 1VZ7A 4ITKA 3VRBB 1JWSD 5FKAC 1ZDVA 3GS2A 4AQ7A 2E3TA 3GB1A 2BBCA 4YXDB 3AV8A 1FRRA 3BIID 4RFBA 2PW9A 2BW2A 4C7YA 1TS2A 1JALA 3E9SA 2M0AA 2E6XA 3SFEB 1CJEA 3Q8FA 1I4PA 1AW7A 2M56B 1PDXA 2N9LA 3C8YA 3V3XA 3EGRA 4Q2JA 1UNSA 4ZYSA 1XLOA 1QOFA 1IBXB 2HDEA 3KQ4A 4OZAA 2MJDA 3O13A 4YSYB 2EKIA 5EE0A 2PIAA 3Q8AA 4O1NA 2MH7A 2MJ3A 1VZ8A 4IKGA 3W1SA 1K50A 5FR3A 3NZ3A 2W55A 1EU3A 1IGDA 2K3UA 1PFDA 1JCKB 3B2GA 3W5UB 3KLSX 2IJ0A 5D7GA 1PGBA 2AQ2B 3HVZA 4WIPA 4N58A 4RGMA 1C4PA 2Y3AA 2FUG1 1F0ZA 3FC4A 4RH6A 2JX5A 3AM9A 2WLBA 1N5WA 4NAWB 2LMCA 1HXYD 3NUHB 1WGKA 1YQ3B 3MC0B 1JMLA 3AE5B 4US9A 1BMLC 1UUPA 2DWQA 1V97A 3AE6B 1T3QA 4TQ0A 3AE3B 4YTMB 1C4AA 1RFKA 4RGTA 4OW0A 2K9XA 1I4RA 2PVOD 2SEBD 3NVVA 1HQRD 4LLGM 1EWCA 1YQ4B 3SR6A 4OZCA 1JQ4A 3AEGB 3W9CB 2J42A 2WXGA 1L6UA 5BYQA 3TEYA 3HUIA 1KRHA 1WYGA 2KMMA 1YN4A 1Q10A 1XLNA 2NTTA 2V4IB 4JWSC 2WDQB 2AQ1B 3ZJUA 1NEKB 4RGOS 4UDUC 1RM6C 1NVID 2VZKB 2H89B 1XCTL 2LGIA 4HRSA 1L4ZB 1E7PB 1ESFA 1ACCA 2BT6A 1STEA 3IT4B 1C4CA 1MVKA 1D5ZC 3BYYB 3WCQA 2QJLA 1C78A 4USAA 2M19A 2IPKD 2WU2B 2PKOA 2V0GA 1PUTA 1XEEA 2QILA 4OHJA 3IAM1 2ONQA 5D3IB 4ZHPA 2BS4B 4WQMA 3ZQ4A 2G9HD 3P1MA 2LEKA 1ZE3D 3P4PB 3R2IA 1TYGB 2J52A 1I4GA 2BTEA 1FMAD 1VJKA 1I4XA 1TS3A 4DXGA 4PT5A 4GLSC 1DYQA 2W82A 1PGAA 4A90A 3ZJTA 4XWWA 2WU5B 1M4VA 2INPE 2WXNA 4IOIE 4IDIA 3HVDA 4MT5A 2V3PA 4XE0A 1L4DB 4JWUC 1DOXA 3H8HA 2WXIA 2YEPB 3TEWA 3AEFB 1QF6A 1I4HA 3AE8B 3NVZA 4FXCA 2ZW1A 2LHDA 3AE4B 1RYJA 1WRIA 1KFYB 3NVYA 3T3NA 2NTSA 1FXIA 2HTME 1CK1A 2J53A 2DYOA 1VRAB 1TJEA 1XLQA 2IGDA 2YEPF 2LHEA 2CU3A 2MJEA 2QIEB 3HRDD 2JYEA 5AUIA 2BYTA 4US8A 1J7BA 1N62A 4XWTA 4D2KA 4YSZB 5GXGB 5JXVA 2PMVA 1IGCA 3T3OA 2L83A 4KKIA 2VZKD 5BYRA 1V1OA 2I2YA 1AN8A 4HROA 4MACA 1JRPA 3P4QB 2KAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XLP A;  3AE5 B;  3NVW A;  4US9 A;  2DWQ A;  3W5V B;  1V97 A;  2N0S B;  3AEB B;  3AED B;  3AE6 B;  1T3Q A;  3AE9 B;  2W3S A;  3AE3 B;  2K22 A;  1FXA A;  1ZP0 B;  1VDV A;  2WQY B;  1RFK A;  2W54 A;  3AN1 A;  1FIQ A;  1OFF A;  2K9X A;  2PVO D;  3AE1 B;  4N59 A;  3RPF C;  3VR8 B;  3NVV A;  1E9M A;  1N5X A;  2WDV B;  1QOB A;  3AEC B;  4YTP B;  1YQ4 B;  5G5G A;  3SR6 A;  2Q5W D;  1NYR A;  3AEG B;  1FRD A;  3W9C B;  3ZYY X;  1JQ4 A;  3FAH A;  1E10 A;  3DWG C;  1L6U A;  5H92 C;  3CWI A;  3HUI A;  1KRH A;  1WYG A;  1OQR A;  1FFV A;  1ZOY B;  2K5P A;  2KMM A;  2WP9 B;  1XO3 A;  1J7A A;  1XLN A;  4JWS C;  1SIJ A;  2WDQ B;  2WDR B;  1NEK B;  3AE2 B;  3LB8 C;  3P4S B;  3AH7 A;  1QOA A;  2CJN A;  3CIR B;  3EUB 2;  3P63 A;  1RM6 C;  1NVI D;  3AB5 A;  3ABV B;  1AWD A;  1KF6 B;  2BS2 B;  4JX1 C;  4WWM A;  5H8Y E;  2H89 B;  4HRS A;  2G1E A;  3VR9 B;  1TKY A;  3P4R B;  1E7P B;  2BT6 A;  1YJJ A;  2B76 B;  2DBY A;  1N63 A;  2W3R A;  4YT0 B;  4YTM B;  1E0Z A;  1AYF A;  4N6E B;  1QOG A;  1ZXI A;  3WCQ A;  1DOY A;  3PO0 A;  1YJI A;  1OQQ A;  2QJL A;  1JWB D;  4USA A;  2WS3 B;  1ROE A;  2M19 A;  2WU2 B;  1L6V A;  1RWS A;  2PKO A;  1PUT A;  1FFU A;  1B9R A;  1WWT A;  1L0V B;  4C7Z A;  4ZHP A;  2JQR B;  4C80 A;  5G5H A;  2BS4 B;  4WQM A;  1TKE A;  2Y5C A;  1R7S A;  4ITK A;  3VRB B;  1NEN B;  3P1M A;  2LEK A;  2BS3 B;  1SF0 A;  3P4P B;  1TYG B;  1CZP A;  3AEA B;  2E3T A;  3LXF A;  1ZUD 2;  4YXD B;  1FO4 A;  3AV8 A;  1FMA D;  1FRR A;  1A70 A;  1VJK A;  3BII D;  2H88 B;  1N61 A;  3L4P A;  1SB3 C;  1JWA D;  1L5P A;  3NRZ A;  4C7Y A;  1JAL A;  4KX6 B;  5AUK A;  3AEE B;  1CJE A;  1UWM A;  3SFE B;  1WXQ A;  2M56 B;  2WU5 B;  1IUE A;  1PDX A;  4IDI A;  5C3J B;  3VRA B;  1J7C A;  4A9A A;  1VLB A;  1XLO A;  1QOF A;  2L52 A;  4JWU C;  1DOX A;  1GAQ B;  1JRO A;  1N60 A;  2FBW B;  1NI3 A;  2MJD A;  3AEF B;  3B2F A;  2PVG C;  3AE8 B;  3NVZ A;  4FXC A;  4YSY B;  2EKI A;  5C2T B;  2OHF A;  1QF6 A;  3DWM A;  2CJO A;  5EE0 A;  3AE4 B;  1RYJ A;  2PIA A;  1DOI A;  5EE3 A;  1WRI A;  1KFY B;  3NVY A;  4LTU A;  3ETR A;  2MH7 A;  1FXI A;  2MJ3 A;  2HTM E;  4ZHO A;  3NS1 A;  5MPO A;  1E6E B;  3AMZ A;  1TJE A;  1XLQ A;  2CU3 A;  2MJE A;  2QIE B;  3HRD D;  1QT9 A;  2W55 A;  1NYQ A;  5AUI A;  2ACZ B;  4YTN B;  1PFD A;  4US8 A;  4P6V F;  4YSX B;  3B2G A;  1J7B A;  3AE7 B;  3W5U B;  5EE9 A;  1N62 A;  3SFD B;  1QLB B;  1I7H A;  4YSZ B;  3HVZ A;  3B9J A;  4N58 A;  1JW9 D;  5GXG B;  3KWL A;  1V8C A;  2L83 A;  1F0Z A;  3FC4 A;  5EE1 A;  1GPX A;  2JX5 A;  3AM9 A;  1FM0 D;  2WLB A;  4HRO A;  1TKG A;  4ZOH C;  1DGJ A;  2AX5 A;  1JRP A;  1N5W A;  1EWY C;  3P4Q B;  1WGK A;  2KAJ A;  1YQ3 B; 
#chains in the Genus database with same CATH topology
 1XLP A;  2QEJ C;  2D10 A;  2MBH A;  4RF0 A;  4MH0 E;  2BQQ A;  2KQ4 X;  4HK2 A;  1TT5 B;  3JSV B;  2IGH A;  1P7F A;  4EOY A;  4WWP A;  2NBV B;  2CU1 A;  4MJS B;  3CST A;  4YTP B;  3RCZ A;  2Q5W D;  3OJ3 A;  4C4V B;  4W9K A;  2KQ7 A;  4XDC A;  4KGR A;  1SEB D;  4GXB A;  3VH4 B;  2KWD A;  1VCB A;  4A3P A;  1XO3 A;  2KC2 A;  1PGX A;  2CJN A;  2RDG A;  3P63 A;  4S0R A;  1AAR A;  3W2D A;  2Z0E B;  1AWD A;  2BS2 B;  2RDH A;  4IG7 B;  2WNM A;  1TKY A;  2DBY A;  1E0Z A;  5GMV A;  2J0J A;  3GZN B;  1C76 A;  2D5G A;  2GBJ A;  4MEL A;  1XXG A;  1L0V B;  1XF5 L;  4JL9 A;  4LCD E;  2V3N A;  4L1B A;  3WAL A;  1XD3 B;  1V2Y A;  1YJ1 A;  1EF5 A;  1L0Y B;  3EA6 A;  4ANV A;  3PRM B;  3DVG Y;  5AUK A;  3RNB C;  1IUE A;  1WI0 A;  3PTF C;  2N9K A;  3M63 B;  5JH5 C;  1JWU D;  2OJW A;  2GBN A;  4DXA B;  2BKR B;  2G3Q B;  2BVC A;  4HEA 1;  4DHZ B;  2M0X A;  4BKS D;  3NS1 A;  5TSS A;  1V5T A;  2ACZ B;  4WJQ A;  2IO0 B;  3AE7 B;  2Z8L A;  2BWF A;  1JWM D;  1Q5W B;  4URK A;  2INC C;  1NI2 A;  4M0W B;  2MBO A;  4P1C C;  1LGR A;  1V8C A;  4AOF A;  1GPX A;  1BUI C;  3B0A A;  1WZ0 A;  1F2R I;  3J9C A;  1V1P A;  2GRI A;  2WX0 A;  3AED B;  4HCN B;  2LJ5 A;  4ICU A;  5HI1 A;  3AE1 B;  2RR9 A;  1IPG A;  3ONS A;  4KDL B;  1S1Q B;  1NYR A;  2WXF A;  3FAH A;  3ZTD A;  5H92 C;  4TQ1 A;  5BMI A;  1OQR A;  4GMV A;  2WX1 A;  3H6N A;  3P4S B;  2Z0D B;  2JPH A;  1KH0 A;  4W9J A;  5J17 A;  3NHE B;  4JGH B;  3Q2A C;  1P3Q U;  3BY4 B;  2KAC A;  1AYF A;  1GOZ A;  3OJ4 B;  3DOW A;  3ZRC A;  2ZCB A;  3PHW B;  1E8Y A;  3HHM A;  2Y5C A;  2GBK A;  2ZEQ A;  2LUE A;  1CZP A;  3MJ5 A;  4F7Z A;  4ZRJ A;  2MHJ A;  1WYW B;  1SSN A;  1UGJ A;  3RZF A;  1MI0 A;  3VTU A;  3ZJV A;  1Y56 A;  3FIL A;  2K39 A;  5BMG A;  1K8R B;  2ZW0 A;  3UF8 A;  4ANX A;  1J7C A;  1VLB A;  3EC8 A;  2Z59 B;  2FCQ A;  2PPH A;  3IT6 B;  4A3O A;  1JRU A;  1P98 A;  2WXO A;  1GB4 A;  3Q8B A;  3ZGZ A;  4M8M A;  1ZGU B;  2G4S A;  4YTN B;  4B0E A;  4YSX B;  1T0Q C;  1QLB B;  2JU6 X;  2WXL A;  3KUZ A;  5I4D A;  3C19 A;  3L0W B;  1JW9 D;  3KWL A;  1SJH D;  2YVC A;  3DVN U;  2WXH A;  2I1J A;  3IXS A;  3Q8E A;  3PLV A;  3ZNG C;  1TS5 A;  3AE9 B;  3A4R A;  1FIQ A;  1L2N A;  4WJO A;  2FE8 A;  2JXX A;  2K8H A;  3IG3 A;  3V60 A;  2K5P A;  1FFV A;  2KFK A;  4II3 B;  2B3A A;  2MBQ A;  2KZR A;  3ABV B;  2M4N A;  4RM9 A;  2N9X A;  3SD5 A;  1TZO A;  1C1Y B;  3VH3 B;  4HJK A;  3TL5 A;  3N9Y C;  4IM2 A;  3M62 B;  4LNN A;  3QHT A;  4NY0 A;  2BWE S;  4GB9 A;  4JIO U;  3VRB B;  5FKA C;  2L00 B;  2E3T A;  4YXD B;  4RFB A;  2PW9 A;  2BW2 A;  2RD0 A;  4FJY A;  1AW7 A;  1GC7 A;  3EGR A;  4Q2J A;  3H9D A;  1WIA A;  2EKI A;  2FCN A;  3N20 C;  3Q8A A;  4O1N A;  5L95 C;  1VZ8 A;  4IKG A;  4TUU A;  3ZO5 B;  1R4M I;  4TKN A;  1PFD A;  2BYE A;  3RNC C;  4K7S A;  4HVB A;  2KX3 A;  3RNE C;  1OEY A;  1NDD A;  2FAZ A;  2Y3A A;  2FUG 1;  3K9O B;  1N5W A;  1JML A;  2NPT A;  4PK1 A;  2EKE C;  2ZNV B;  4YTM B;  4EZL A;  3AE3 B;  2N1V A;  1Z2M A;  4RGT A;  1I4R A;  2SEB D;  3GE8 C;  4LLG M;  1EWC A;  4OZC A;  3W9C B;  2V4L A;  3DBR B;  2C7N B;  1L6U A;  5BYQ A;  1WYG A;  1YN4 A;  1XLN A;  4JWS C;  2WGS A;  2AQ1 B;  4NPN A;  1NEK B;  3IT4 B;  1C4C A;  4F1S A;  1TZ1 A;  2D11 A;  2N7D A;  5BO4 B;  3VDZ A;  2KWC A;  2M19 A;  2WU2 B;  2V0G A;  1WXM A;  1PUT A;  4OHJ A;  3QAR A;  4ZHP A;  4WQM A;  3ZQ4 A;  5CX3 A;  3R2I A;  1TYG B;  3RUL A;  2VRR B;  3N3K B;  3H7P A;  2BTE A;  1C3T A;  2KDB A;  4GDL A;  3AI5 A;  4GLS C;  4EZJ A;  4A90 A;  4XWW A;  2EMS A;  4MT5 A;  3DBH I;  4JWU C;  1Z5S B;  3H8H A;  2WXI A;  3AEF B;  1QF6 A;  2IND C;  2ZW1 A;  3A9K A;  3AU5 A;  2LHD A;  1RYJ A;  4MGY E;  1WRI A;  1KFY B;  3T3N A;  1MFW A;  5DPR A;  5IA7 A;  1XLQ A;  2IGD A;  3VFK A;  3MC8 A;  3DCG A;  3HRD D;  2BYT A;  4US8 A;  2ZPY A;  2REX A;  5J18 A;  1J7B A;  1WE6 A;  2FID A;  5CHW A;  2C60 A;  1UZX B;  3PV1 A;  3NOB A;  3V62 A;  3IVF A;  1IGC A;  3T3O A;  2VZK D;  1V1O A;  2I2Y A;  3S2A A;  4WJP A;  4HRO A;  1YX6 B;  3P4Q B;  2ZCC A;  4KV2 A;  4LJO B;  3NVW A;  1WH3 A;  2JZP A;  2L0T A;  1WJN A;  2MRP A;  2CHZ A;  1E9M A;  2JWU A;  2HJ8 A;  1FRD A;  4GN1 A;  3W1Y A;  1V80 A;  4HPL B;  2RPV A;  3DVG X;  1FCL A;  4DBG A;  2M1M A;  2IDY A;  3BVG A;  4FJZ A;  2FCS A;  4BBN F;  5H8Y E;  1YJJ A;  4PS3 A;  1SBB B;  4LK0 M;  3BK1 A;  5D6J B;  5D3D A;  1YIW A;  3EEC A;  3B1L X;  3EHV A;  2XBB C;  2CKH B;  3WAO A;  3TEZ A;  4KVG B;  1RLF A;  3RFZ B;  4ACF A;  1ZPS A;  2G45 B;  3LXF A;  1D5X C;  2KD0 A;  2Y5P A;  5L83 A;  1XCQ L;  1OEY J;  1N61 A;  1JWA D;  1L5P A;  1TY2 A;  2UU7 A;  1GUA B;  4R3D A;  4KGS A;  2K8C A;  4L23 A;  5DPS A;  4A6Q A;  2PVG C;  4IW0 A;  2JSV X;  2PE9 A;  1UD7 A;  1SE2 A;  5MPO A;  1MJD A;  1VR9 A;  2LD9 A;  2MP2 A;  1QT9 A;  1NYQ A;  2KFK B;  1C77 A;  2MQJ A;  1J0G A;  5E6J A;  1FEH A;  2L05 A;  2TSS A;  3R3M A;  1K53 A;  3PSE B;  2N7E A;  4JE3 B;  2WWZ A;  1GB1 A;  1T0R C;  3KUC B;  4MH8 A;  1WGH A;  2DHZ A;  3U2S C;  5JZE B;  2L76 A;  2BB6 A;  4TMA B;  3A33 B;  3QC8 B;  1Q1O A;  3KWV A;  1VDV A;  2AWT A;  3D32 A;  1ISN A;  4CQN A;  1D4B A;  4ARI A;  5G5G A;  3NZU A;  4EE2 A;  3DWG C;  3CWI A;  2RPQ A;  2LAS A;  3PRZ A;  3E56 A;  2MW5 A;  2GLS A;  1KF6 B;  1HTO A;  2KDF B;  4FJV B;  2L8J A;  3VR9 B;  3P4R B;  1ZKH A;  1M94 A;  4YT0 B;  2D3A A;  2K1F A;  1HA5 A;  2LGY A;  3RNA C;  2NMQ A;  5EDS A;  4K1R B;  4MM3 A;  2WXK A;  1GJZ A;  1QQR A;  5BYS A;  4C7Z A;  4FN2 A;  2GBR A;  4MSM B;  2C7H A;  3AU4 A;  3NG0 A;  2K6Q A;  3N1Z C;  3DDC B;  2BS3 B;  4FHK A;  5LXH A;  2LGX A;  4MSQ B;  3L4P A;  1SB3 C;  2VH1 A;  1EF1 A;  4KKJ A;  1WXQ A;  1WJ4 A;  2HE7 A;  4JLC A;  1UH6 A;  4KDI C;  1SIF A;  2NPT B;  3I5J C;  2IBI B;  4BZA A;  2QMT A;  2FUH B;  2KXJ A;  5G55 A;  1J8C A;  3Q3J A;  4PS8 A;  1B1Z A;  3AMZ A;  2BGF A;  4JPS A;  3VUY A;  1NBF C;  1HEZ E;  1WR1 A;  5EE9 A;  5IKC M;  3ZDT A;  1QIL A;  2FNJ B;  3IBE A;  1WZ3 A;  4LJP B;  4AP4 C;  4REZ A;  4HDO A;  3R2T A;  2KNB A;  4WAF A;  1K52 A;  2AQ3 B;  2XEW A;  3QAQ A;  2WXR A;  2W3S A;  4J3O D;  2K22 A;  1FXA A;  1EU4 A;  5E6O A;  1WR6 E;  5T8I A;  5TR5 A;  3ZYY X;  2NBU A;  3H7P B;  2KLG A;  3ZTC A;  1TS4 A;  2J0M A;  2OOB B;  4GDL B;  3Q3M C;  1HZ6 A;  4ARC A;  4G11 A;  1FNV A;  4W9E A;  3JYU A;  3L17 A;  5HG2 A;  3AB5 A;  4HKZ E;  4L2Y A;  4AUQ C;  2ZPN A;  3A9K B;  2IGG A;  2O6V A;  1QKZ A;  3PO0 A;  3DHI C;  1IP9 A;  3W1S C;  1ROE A;  1RWS A;  1BXT A;  4ZRK A;  4FA6 A;  3GZN I;  1SXT A;  1YOV B;  4ITK A;  1R4N I;  3GE3 C;  5FR6 A;  4K3C A;  1ZDV A;  3GS2 A;  3AV8 A;  2KJH B;  5LLI A;  4WWN A;  1WRD B;  2D3G A;  3Q14 C;  1CJE A;  3SFE B;  3Q8F A;  2M56 B;  3ZRF A;  3PLU A;  3V3X A;  1UNS A;  2KLC A;  1QOF A;  3LJ3 A;  2MJD A;  4OZA A;  3O13 A;  2D07 B;  4YSY B;  2KKC A;  4IUM B;  5EE0 A;  1WFY A;  3ZDM C;  2GMI C;  2MH7 A;  2MJ3 A;  2XK5 A;  2ZNV C;  2C5L C;  3DPD A;  3NZ3 A;  2W55 A;  2K3U A;  4ANU A;  3ZIM A;  1JCK B;  3HIZ A;  2RGF A;  3KLS X;  3APD A;  5D7G A;  1PGB A;  5DPT A;  2BYF A;  1P9D U;  4F8C B;  3VAW A;  2JX5 A;  2WLB A;  4HDQ A;  3ZKJ C;  2A4Z A;  4IM0 A;  3R7Q A;  1YQ3 B;  4LNI A;  4US9 A;  1UUP A;  2DWQ A;  1V97 A;  1WXS A;  3AE6 B;  1J19 A;  2IYD B;  2K9X A;  3NVV A;  2UWQ A;  3LDZ E;  3SR6 A;  1JQ4 A;  1GC6 A;  1MG8 A;  2WXG A;  5E6P A;  1KRH A;  4ICV A;  2NTT A;  2KDE B;  1Q0W B;  2LVO A;  3I63 C;  2L3Z A;  1STE A;  3BYY B;  2KTF A;  3WCQ A;  1I42 A;  3ZVV A;  1C78 A;  4NJ7 A;  1XEE A;  2QIL A;  5AZH A;  3IAM 1;  3ZLZ A;  2MP2 B;  3UIO B;  1TIF A;  2BS4 B;  4HCP B;  3PGE A;  2G9H D;  2ZVN A;  2NCN A;  1Y8R C;  1CMX B;  4G3X B;  1WGD A;  1I4X A;  2MCN B;  3WIM A;  1TS3 A;  4PT5 A;  4ZRI A;  4M02 A;  1M4V A;  3DBS A;  2V3P A;  4FAD A;  4W9H A;  5IO9 A;  3TCA A;  2YEP B;  3TEW A;  1SGH A;  4AWJ A;  1I4H A;  3AE8 B;  3AE4 B;  3NVY A;  1FXI A;  2DZI A;  2J53 A;  1VRA B;  3Q3N C;  3VUW A;  1TJE A;  4EFO A;  3TMP B;  1P1A A;  2CU3 A;  3DBL I;  4P1B C;  2JYE A;  2AL6 A;  4XWT A;  1YX5 B;  3KW5 B;  4M8N A;  3QQ8 B;  4FLH A;  5JXV A;  3ZW3 A;  1XT9 B;  1LFD A;  1OTR B;  2KAJ A;  4DDG D;  4IWP A;  1LXD A;  4MM3 B;  1IBX A;  3W5V B;  4WWO A;  1V5O A;  1TGZ B;  4MEM A;  3UIP B;  2JYT A;  1EM7 A;  1IYF A;  4OVV A;  2JZ3 B;  2ON8 A;  3R7R A;  3A9J A;  2KAN A;  2QDF A;  4ZYN A;  2KTR A;  4HWI B;  2QSD A;  3EUB 2;  4GOC A;  4JX1 C;  2RSU A;  4WWM A;  1WM2 A;  3DBH B;  2X8X X;  3O65 B;  2DAF A;  2GB1 A;  2FCM A;  3SHQ A;  3AUL A;  2PTL A;  2SAK A;  2O6V D;  3UI3 A;  4NAW A;  4K7W A;  2ICI A;  2OED A;  5G5H A;  1R7S A;  2VH2 A;  4B6W A;  1NEN B;  2IO1 B;  2BYV E;  3HK0 A;  1SF0 A;  2KHW B;  2IY1 B;  4EZK A;  3UQA A;  4ZRP A;  3RNF C;  3TJP A;  3U8Z A;  1FNW A;  2KX0 A;  3FKY A;  1FO4 A;  1A70 A;  2BB5 A;  1QZE A;  2MBE A;  4KX6 B;  3MTN B;  5BMH A;  1SE3 A;  1CQV A;  1T6B X;  1KTK A;  3DQV A;  4A9A A;  3VUX A;  2LVP A;  4XC2 A;  1GAQ B;  2YLM A;  1UBQ A;  3B2F A;  3Q8C A;  4C00 A;  2N9E B;  2MWS B;  4IM3 A;  2R61 A;  3VTW A;  3NJT A;  3APC A;  2JXT A;  3N30 A;  4ZHO A;  1V6E A;  3A4S C;  5LNK 1;  2D3B A;  3UQB A;  4ASW C;  4OVU A;  4AJW A;  3PZ8 A;  2BPS A;  2LGS A;  3NZS A;  3V6C B;  4DXF A;  1I7H A;  5FK9 C;  3BVM A;  4CHK A;  1V1P B;  2LXC A;  2O6V B;  4W9D A;  4W9C A;  1FM0 D;  1LO5 D;  4ZOH C;  1RRB A;  1ZDX A;  4M0W A;  2R2O A;  3GOE A;  3VTV A;  2KN4 A;  1P0R A;  2WQY B;  5DPW A;  2W54 A;  1LM8 B;  3GP7 A;  4N59 A;  4XYC A;  3HM3 A;  4BBN C;  1YN3 A;  2LVQ A;  2KN5 A;  1V86 A;  1ZOY B;  3VQI A;  2C9W B;  2WP9 B;  3KH0 A;  3DBR I;  1V9J A;  4EEW A;  3BZD B;  1G6J A;  3PS6 A;  3L54 A;  2G1E A;  4J6I A;  2DNF A;  1EO6 A;  2QCZ A;  4I6P A;  2AEH A;  1FNU A;  1VZ6 A;  1F2R C;  1OGW A;  1YMH E;  2XK5 B;  1U4A A;  4LNK A;  2MA9 B;  1WWT A;  4C80 A;  2WXQ A;  1D6E C;  3FIL B;  3P2B A;  3RNG C;  3ZXV A;  4C56 C;  3AEA B;  3DVN V;  1ZUD 2;  5HHD G;  1L0X B;  2KQS A;  4PS7 A;  3NRZ A;  4HPP A;  1ZXH A;  4GU2 A;  3QA8 A;  5C3J B;  4W9I A;  1N6Z A;  4EUT A;  2FBW B;  3RI7 C;  4GIV A;  4GGQ A;  3DWM A;  4DHJ B;  1MHH E;  5EE3 A;  4LTU A;  4N9F 4;  1F77 A;  4P16 A;  4GSW A;  2UYZ B;  4KSK C;  1C9F A;  1KJT A;  3N32 A;  2CS4 A;  2LJI A;  1WGR A;  3QJZ A;  1A5R A;  3PZD A;  2A5U A;  3KUD B;  1WE7 A;  1K51 A;  3RYT A;  4HJG E;  3V61 A;  1TKG A;  2WHI A;  1FXT B;  3PRE A;  1MG4 A;  4RNA A;  4AS1 A;  2KDM A;  4WJN A;  2J4X A;  2X38 A;  1E7U A;  3M95 A;  2KYW A;  1ZW7 A;  1OFF A;  1PYW D;  2N7J A;  5AZF A;  1SE4 A;  3QX1 A;  4FUL A;  3I9V 1;  2WDV B;  3AEC B;  4KIK A;  3A1Q A;  3WAM A;  3LYY A;  2QHO A;  3LB8 C;  1I4Q A;  5IP4 D;  4MGI E;  4BOZ B;  4WH4 A;  3RMK C;  2DAJ A;  3MP9 A;  4ZDV A;  4DK5 A;  4G50 A;  3Q69 A;  4N6E B;  1QOG A;  3PT2 B;  4CO7 A;  2KWU B;  1YJI A;  2WXM A;  2WS3 B;  1WMH A;  2J0K A;  4II2 B;  3JVZ X;  3IAS 1;  1VD2 A;  1VZ7 A;  3ALB A;  2BKF A;  1TBE A;  1WXA A;  3ZNI D;  1KLV A;  5KHO A;  4LDT D;  3QWZ B;  4GDK A;  2IZV B;  4BOS C;  3L13 A;  1TS2 A;  4RM8 A;  1JAL A;  2E6X A;  3CMM B;  1I4P A;  1GG3 A;  2N9L A;  3C8Y A;  2KMC A;  1XLO A;  1IBX B;  2HDE A;  1BT0 A;  2FIF A;  3QK0 A;  5JHB A;  1YQB A;  2PIA A;  4MGK E;  2N9P C;  3A9J B;  3KVF B;  3W1S A;  5FR3 A;  1EU3 A;  4BKG A;  2J7Q B;  2PEA A;  2KT7 A;  2KTR B;  3B2G A;  4E3C A;  3W5U B;  2IJ0 A;  2KK8 A;  2AQ2 B;  2NBW B;  4WIP A;  2DZM A;  4N58 A;  4RGM A;  3U30 A;  4DDI D;  5DCN A;  4RH6 A;  3AM9 A;  2MBB B;  4NAW B;  2LMC A;  3NUH B;  2O2V A;  2KMA A;  2LRW A;  5CHV C;  4BKT A;  2DX5 B;  4TQ0 A;  1C4A A;  1WM3 A;  4LDT B;  4OW0 A;  4MGZ E;  1L7Y A;  1R4N B;  3M3J A;  1HQR D;  3AEG B;  1WX8 A;  1WY8 A;  3OLM D;  4IWO A;  2W9N A;  2J42 A;  1WX9 A;  3TEY A;  3HUI A;  1WXV A;  4HLE A;  3V6E B;  2IY0 B;  3RT3 B;  2V4I B;  3SU8 X;  3ZJU A;  5D94 A;  4RGO S;  1NVI D;  2G4D B;  2ZJD A;  4HRS A;  1L4Z B;  1E7P B;  2BT6 A;  1S3S G;  3Q3O C;  2IPK D;  2PKO A;  3R66 C;  1ZE3 D;  1EUV B;  3P4P B;  2J52 A;  2LI5 A;  1H4R A;  1I4G A;  2ZZP B;  3T9L A;  5E6N A;  1F52 A;  1T0Y A;  4DXG A;  2W82 A;  1FPY A;  1PGA A;  2WU5 B;  3CF6 E;  2WXN A;  4IOI E;  4XZ4 A;  4IDI A;  3HVD A;  4XE0 A;  4ANW A;  1F9J A;  1DOX A;  3ENE A;  2CHX A;  2LXA A;  4M01 A;  1T0S C;  3EFC A;  5IN7 A;  2NTS A;  2HTM E;  1CK1 A;  2DZK A;  2DYO A;  2R2Q A;  2YEP F;  3QIJ A;  2LHE A;  2MJE A;  3AXC A;  5AUI A;  4K7U A;  2JF5 A;  4D2K A;  4YSZ B;  3ECI A;  5GXG B;  4A20 A;  2AYO B;  2PMV A;  4TV3 A;  2AL3 A;  3U7D A;  2JZZ A;  2DYB A;  1AN8 A;  3EFU A;  2RDB C;  2JUO A;  2MEK A;  4FBJ B;  1X1M A;  3AN1 A;  1ZP0 B;  4I6L B;  1ET6 A;  1N5X A;  3MFG A;  1D5M C;  2DLB A;  2K0P A;  3RN9 C;  4LNF A;  4WUR A;  2LGD A;  3T8M A;  4XDD A;  1LQB A;  3MHZ A;  1SIJ A;  4G0N B;  5AEK B;  2KWV B;  3CIR B;  4OVZ A;  2LUM A;  2JRH A;  4DQO C;  2L1A A;  4NJ6 A;  2B76 B;  2PE6 B;  3VXW A;  2IO2 B;  2D2Q A;  3N1X C;  1OQQ A;  4NAM A;  1F1H A;  1H8C A;  2GBM A;  5CHF A;  1OQY A;  3RUI B;  2JQR B;  4S17 A;  1UGM A;  3ZNH B;  1ET9 A;  3DBL B;  3TIX A;  3ML9 A;  5IOI A;  5AZG A;  3IHP C;  4HXD A;  3U52 E;  1XQQ A;  4KGT A;  4B0M A;  3X0W A;  4EKU A;  4PYZ A;  1UWM A;  5HKH A;  2IO3 B;  1WJU A;  1UF0 A;  4NJC A;  3VRA B;  2L52 A;  3PZ7 A;  1KLU D;  2JVC A;  3VVW B;  1JRO A;  1N60 A;  2CJO A;  4NZL B;  1R4M B;  3H7S A;  4W9F A;  1DOI A;  2L32 A;  3JW0 X;  4KIK B;  3A1Q B;  4M00 A;  4KZ0 A;  5KHQ A;  2V3S A;  3B9J A;  3K9P B;  4XGA B;  5EE1 A;  1E5W A;  2AX5 A;  3TSS A;  1EWY C;  1C79 A;  1WMH B;  3SEB A;  1HE8 A;  5C1Z A;  4ZRQ A;  1KM7 A;  1HZ5 A;  3Q3F A;  1SJE D;  1TTN A;  4GDK B;  4OZB A;  2I38 A;  1UWX A;  4NQL B;  2XNA C;  4RF1 A;  4E74 A;  3ZUN A;  2WDR B;  3AE2 B;  3U4E G;  1QOA A;  2OJR A;  3U7Z A;  2PLP A;  4RGN A;  4BVU C;  1N63 A;  2KOX A;  1DOY A;  3X23 A;  1T5X D;  3DHG C;  1JWB D;  5LXI B;  3SDL C;  1FFU A;  3OAW A;  5CTR C;  1TKE A;  2MSE D;  3JSV A;  2ZVO A;  5HFY A;  1MPE A;  4MJS A;  4HKQ A;  4C4V A;  2I1K A;  4A55 A;  2LZ6 A;  2WXP A;  2H88 B;  1TY0 A;  4TSS A;  3AEE B;  1V49 A;  2DZJ A;  4K3B A;  3H1U A;  3NY5 A;  3BVZ A;  2O2V B;  3TEX A;  3TBL D;  2WXJ A;  1NI3 A;  5C2T B;  3WAN A;  3APF A;  2EEL A;  1YN5 A;  2OHF A;  1FCC C;  3BYT B;  4NNJ B;  2RMM A;  3ETR A;  2N4F A;  3V05 A;  3MHS D;  2DYM A;  2NS5 A;  1E6E B;  2KJ6 A;  4YWG G;  3BWU D;  1MHX A;  3ZXR A;  3L16 A;  4WQO B;  4BAX A;  4BFR A;  4P6V F;  2NVU I;  2K6D B;  4KZC A;  3SFD B;  1SE9 A;  3P42 A;  2INN E;  3I57 A;  2GI9 A;  1DGJ A;  2JWZ A;  2WDT B;  5J2R A;  1B9R A;  4XX5 A;  2LFI A;  1WSP A;  2N0S B;  3AEB B;  1E8X A;  4RMA A;  4A8X C;  3RPF C;  3VR8 B;  4HPM B;  1QOB A;  3PRP B;  4WAA A;  2JT4 B;  3IFW B;  3OWE B;  4IC7 B;  4I6N B;  1P7E A;  3BK2 A;  3R8B A;  1E10 A;  2KC1 A;  4H2A A;  1ENF A;  4RCO A;  4W9G A;  2KDI A;  3TUO A;  1J7A A;  3URY A;  3AH7 A;  1FD6 A;  2XN9 C;  4FHJ A;  1YNT E;  2W3R A;  1KLG D;  1ZXI A;  2KJR A;  1GNU A;  4JQW C;  4DHJ D;  1L6V A;  3Q6B A;  3QCA A;  3MC9 A;  4DHZ E;  2NR2 A;  1E8W A;  2KFJ A;  4CYE A;  2C7M B;  4MDK E;  1JWS D;  5IAA C;  4AQ7 A;  1KOT A;  3GB1 A;  2BBC A;  1RAX A;  1FRR A;  3BII D;  4C7Y A;  2ASQ A;  3E9S A;  2M0A A;  3BIN A;  1PDX A;  4QAY A;  1I35 A;  4ZYS A;  2KO3 A;  2HD5 B;  3KQ4 A;  2LWP A;  4BKS A;  2K8B A;  3KYC D;  3RD2 A;  3B08 A;  3UIN B;  4B95 A;  1K50 A;  4NQK E;  3ZNZ B;  1E8Z A;  1IGD A;  2DEN B;  5JHA A;  2CR5 A;  4DWF A;  3CSF A;  3HVZ A;  4E71 A;  4K81 A;  1C4P A;  2M8S A;  1F0Z A;  3FC4 A;  1HXY D;  1WX7 A;  1WGK A;  3MC0 B;  3PPA A;  3AE5 B;  1BML C;  2WYQ A;  3PHX B;  2GOW A;  1T3Q A;  2QC8 A;  4LNO A;  1RFK A;  1RFA A;  2N1W A;  2V9H A;  2PVO D;  1E7V A;  2K25 A;  2KVZ A;  1YQ4 B;  1E90 A;  3NS8 A;  3UGB B;  3WA0 A;  2HTH A;  2KMM A;  3DHH C;  2JY6 A;  1Q10 A;  2WDQ B;  4UDU C;  1RM6 C;  2VZK B;  4YL8 A;  2H89 B;  1D3Z A;  1XCT L;  2LGI A;  2BF8 B;  1ESF A;  1ACC A;  1WJ6 A;  1MVK A;  4B9K A;  1D5Z C;  2LRU A;  4IWQ A;  3ML8 A;  2QJL A;  4USA A;  5D2M B;  2EMT A;  4AJY B;  2ONQ A;  2D3C A;  5D3I B;  2MLB A;  2Y5B B;  3WAP A;  3P1M A;  3L10 B;  2LEK A;  1WGG A;  3VHT C;  1FMA D;  3L08 A;  1UEL A;  1VJK A;  4PYU A;  1WF9 A;  1HTQ A;  1DYQ A;  3ZJT A;  2INP E;  3C0R B;  1L4D B;  2PJH A;  3NVZ A;  4FXC A;  3OG5 A;  2V1Y A;  4P7I A;  1V81 A;  3RZW C;  2L0F A;  2KVR A;  2JRI B;  3PVL A;  2L7R A;  2QIE B;  2MX2 A;  2HJ1 A;  1WGY A;  1PQS A;  4KSL C;  3HM6 X;  1N62 A;  5G2N A;  3MJW A;  5C23 A;  3KYD D;  4W9L A;  2CHW A;  2L83 A;  4KKI A;  5BYR A;  4X57 B;  2M17 A;  3I3T B;  4MAC A;  1JRP A;  1YD8 U;  1UBI A;  3N1Y C; 
#chains in the Genus database with same CATH homology
 1XLP A;  4MM3 B;  2QEJ C;  3NVW A;  1IBX A;  2JZP A;  3W5V B;  2MEK A;  2JYT A;  4RF0 A;  1EM7 A;  3AN1 A;  1ZP0 B;  2KQ4 X;  2IGH A;  1P7F A;  1ET6 A;  1E9M A;  1N5X A;  2ON8 A;  4YTP B;  2JWU A;  1D5M C;  3MFG A;  2DLB A;  2K0P A;  2Q5W D;  1FRD A;  4WUR A;  4XDC A;  4KGR A;  1SEB D;  2KWD A;  2RPV A;  4XDD A;  1FCL A;  1XO3 A;  3MHZ A;  1SIJ A;  1PGX A;  2IDY A;  2QSD A;  3BVG A;  2CJN A;  2RDG A;  3CIR B;  3EUB 2;  3P63 A;  3W2D A;  4OVZ A;  2LUM A;  1AWD A;  2BS2 B;  2RDH A;  4JX1 C;  4WWM A;  5H8Y E;  2WNM A;  4DQO C;  2L1A A;  2GB1 A;  1TKY A;  1YJJ A;  2B76 B;  2DBY A;  1E0Z A;  1SBB B;  4LK0 M;  2PTL A;  3BK1 A;  2SAK A;  1C76 A;  2D5G A;  3UI3 A;  1OQQ A;  4NAM A;  5D3D A;  1XXG A;  2ICI A;  1L0V B;  2JQR B;  2OED A;  5G5H A;  3TEZ A;  1R7S A;  1ET9 A;  1XF5 L;  1NEN B;  2V3N A;  3RFZ B;  4L1B A;  1SF0 A;  1ZPS A;  4ZRP A;  3LXF A;  1D5X C;  1FNW A;  1L0Y B;  1FO4 A;  3EA6 A;  1A70 A;  2Y5P A;  1XCQ L;  3U52 E;  2BB5 A;  4KGT A;  1N61 A;  4B0M A;  1JWA D;  1L5P A;  1TY2 A;  4KX6 B;  5AUK A;  1UWM A;  5BMH A;  1SE3 A;  4KGS A;  1IUE A;  1CQV A;  4R3D A;  1T6B X;  4L23 A;  4NJC A;  3VRA B;  2N9K A;  1KTK A;  1JWU D;  4A9A A;  2L52 A;  3PZ7 A;  1KLU D;  1GAQ B;  1JRO A;  1N60 A;  3B2F A;  3Q8C A;  4A6Q A;  2PVG C;  2CJO A;  4HEA 1;  4NZL B;  2JSV X;  2R61 A;  1DOI A;  2L32 A;  1SE2 A;  2JXT A;  4ZHO A;  3NS1 A;  5MPO A;  5LNK 1;  1VR9 A;  5TSS A;  1QT9 A;  1NYQ A;  2ACZ B;  1C77 A;  3PZ8 A;  3AE7 B;  4DXF A;  2Z8L A;  1I7H A;  1JWM D;  3BVM A;  5FK9 C;  5E6J A;  1FEH A;  2TSS A;  3B9J A;  1K53 A;  4JE3 B;  1V1P B;  1GB1 A;  1V8C A;  5EE1 A;  1GPX A;  1BUI C;  1FM0 D;  1LO5 D;  4ZOH C;  4MH8 A;  3U2S C;  2AX5 A;  3TSS A;  1F2R I;  1EWY C;  1ZDX A;  1C79 A;  3J9C A;  4M0W A;  1V1P A;  2GRI A;  3SEB A;  2BB6 A;  4TMA B;  3AED B;  2KN4 A;  3KWV A;  1VDV A;  2WQY B;  4ZRQ A;  5HI1 A;  2W54 A;  3GP7 A;  3AE1 B;  4CQN A;  1HZ5 A;  4N59 A;  1D4B A;  1SJE D;  4ARI A;  4GDK B;  4OZB A;  5G5G A;  1NYR A;  1YN3 A;  2WXF A;  4EE2 A;  3FAH A;  2I38 A;  1UWX A;  2XNA C;  3DWG C;  4RF1 A;  5H92 C;  3CWI A;  4TQ1 A;  5BMI A;  1OQR A;  1ZOY B;  3VQI A;  2WP9 B;  3E56 A;  3P4S B;  2WDR B;  3AE2 B;  3U4E G;  1QOA A;  3BZD B;  1KH0 A;  1KF6 B;  3U7Z A;  2G1E A;  2PLP A;  4RGN A;  3P4R B;  3VR9 B;  4YT0 B;  1N63 A;  2KAC A;  1AYF A;  1GOZ A;  1FNU A;  1HA5 A;  1DOY A;  1VZ6 A;  1T5X D;  1F2R C;  1JWB D;  1YMH E;  2NMQ A;  2WXK A;  1FFU A;  1QQR A;  1WWT A;  4C7Z A;  5BYS A;  4C80 A;  2WXQ A;  1TKE A;  2Y5C A;  1D6E C;  3FIL B;  4C56 C;  2BS3 B;  5HFY A;  1CZP A;  3AEA B;  1MPE A;  3MJ5 A;  4HKQ A;  1ZUD 2;  5HHD G;  1SSN A;  4A55 A;  1L0X B;  1UGJ A;  2WXP A;  2H88 B;  1MI0 A;  3L4P A;  3NRZ A;  1SB3 C;  1TY0 A;  3ZJV A;  1ZXH A;  1Y56 A;  3FIL A;  4KKJ A;  3AEE B;  4TSS A;  5BMG A;  1WXQ A;  2ZW0 A;  5C3J B;  3BVZ A;  1J7C A;  1VLB A;  3TEX A;  2WXJ A;  2FBW B;  1NI3 A;  5C2T B;  2QMT A;  2EEL A;  1YN5 A;  2OHF A;  3IT6 B;  3DWM A;  1FCC C;  3BYT B;  1MHH E;  5EE3 A;  4LTU A;  2RMM A;  2WXO A;  1GB4 A;  3ETR A;  3Q8B A;  1F77 A;  3V05 A;  3ZGZ A;  4P16 A;  1B1Z A;  2DYM A;  1E6E B;  3AMZ A;  4YWG G;  3BWU D;  1MHX A;  4JPS A;  1C9F A;  4YTN B;  1HEZ E;  4B0E A;  4P6V F;  4YSX B;  5EE9 A;  3SFD B;  1QLB B;  1QIL A;  2JU6 X;  2LJI A;  2WXL A;  3P42 A;  4REZ A;  5I4D A;  2INN E;  1JW9 D;  3R2T A;  3KWL A;  3I57 A;  1SJH D;  1K51 A;  2WXH A;  4HJG E;  4WAF A;  1TKG A;  2GI9 A;  1DGJ A;  3IXS A;  3Q8E A;  1B9R A;  1TS5 A;  1K52 A;  2AQ3 B;  2LFI A;  1WSP A;  2N0S B;  3AEB B;  4RNA A;  4AS1 A;  2KDM A;  2WXR A;  2J4X A;  2W3S A;  2X38 A;  2K22 A;  1FXA A;  3AE9 B;  4J3O D;  1EU4 A;  1FIQ A;  1OFF A;  1PYW D;  2N7J A;  4A8X C;  5T8I A;  1SE4 A;  3RPF C;  3VR8 B;  3I9V 1;  2WDV B;  1QOB A;  3AEC B;  3ZYY X;  3OWE B;  1P7E A;  3BK2 A;  2FE8 A;  3R8B A;  3LYY A;  1E10 A;  4H2A A;  1ENF A;  1TS4 A;  4RCO A;  3TUO A;  2K5P A;  1FFV A;  4GDL B;  1HZ6 A;  1J7A A;  4ARC A;  3URY A;  3LB8 C;  1FNV A;  1I4Q A;  3AH7 A;  1FD6 A;  2XN9 C;  5HG2 A;  3AB5 A;  3ABV B;  4HKZ E;  4WH4 A;  4L2Y A;  3MP9 A;  1YNT E;  2W3R A;  2IGG A;  3Q69 A;  1KLG D;  1TZO A;  4N6E B;  1QOG A;  1ZXI A;  1QKZ A;  3PO0 A;  1YJI A;  2WXM A;  3N9Y C;  2WS3 B;  1ROE A;  1L6V A;  1RWS A;  1BXT A;  3IAS 1;  1SXT A;  1VZ7 A;  4ITK A;  3VRB B;  1JWS D;  5FKA C;  1ZDV A;  3GS2 A;  4AQ7 A;  2E3T A;  3GB1 A;  2BBC A;  4YXD B;  3AV8 A;  1FRR A;  3BII D;  4RFB A;  2PW9 A;  2BW2 A;  4C7Y A;  1TS2 A;  1JAL A;  3E9S A;  2M0A A;  2E6X A;  3SFE B;  1CJE A;  3Q8F A;  1I4P A;  1AW7 A;  2M56 B;  1PDX A;  2N9L A;  3C8Y A;  3V3X A;  3EGR A;  4Q2J A;  1UNS A;  4ZYS A;  1XLO A;  1QOF A;  1IBX B;  2HDE A;  3KQ4 A;  4OZA A;  2MJD A;  3O13 A;  4YSY B;  2EKI A;  5EE0 A;  2PIA A;  3Q8A A;  4O1N A;  2MH7 A;  2MJ3 A;  1VZ8 A;  4IKG A;  3W1S A;  1K50 A;  5FR3 A;  3NZ3 A;  2W55 A;  1EU3 A;  1IGD A;  2K3U A;  1PFD A;  1JCK B;  3B2G A;  3W5U B;  3KLS X;  2IJ0 A;  5D7G A;  1PGB A;  2AQ2 B;  3HVZ A;  4WIP A;  4N58 A;  4RGM A;  1C4P A;  2Y3A A;  2FUG 1;  1F0Z A;  3FC4 A;  4RH6 A;  2JX5 A;  3AM9 A;  2WLB A;  1N5W A;  4NAW B;  2LMC A;  1HXY D;  3NUH B;  1WGK A;  1YQ3 B;  3MC0 B;  1JML A;  3AE5 B;  4US9 A;  1BML C;  1UUP A;  2DWQ A;  1V97 A;  3AE6 B;  1T3Q A;  4TQ0 A;  3AE3 B;  4YTM B;  1C4A A;  1RFK A;  4RGT A;  4OW0 A;  2K9X A;  1I4R A;  2PVO D;  2SEB D;  3NVV A;  1HQR D;  4LLG M;  1EWC A;  1YQ4 B;  3SR6 A;  4OZC A;  1JQ4 A;  3AEG B;  3W9C B;  2J42 A;  2WXG A;  1L6U A;  5BYQ A;  3TEY A;  3HUI A;  1KRH A;  1WYG A;  2KMM A;  1YN4 A;  1Q10 A;  1XLN A;  2NTT A;  2V4I B;  4JWS C;  2WDQ B;  2AQ1 B;  3ZJU A;  1NEK B;  4RGO S;  4UDU C;  1RM6 C;  1NVI D;  2VZK B;  2H89 B;  1XCT L;  2LGI A;  4HRS A;  1L4Z B;  1E7P B;  1ESF A;  1ACC A;  2BT6 A;  1STE A;  3IT4 B;  1C4C A;  1MVK A;  1D5Z C;  3BYY B;  3WCQ A;  2QJL A;  1C78 A;  4USA A;  2M19 A;  2IPK D;  2WU2 B;  2PKO A;  2V0G A;  1PUT A;  1XEE A;  2QIL A;  4OHJ A;  3IAM 1;  2ONQ A;  5D3I B;  4ZHP A;  2BS4 B;  4WQM A;  3ZQ4 A;  2G9H D;  3P1M A;  2LEK A;  1ZE3 D;  3P4P B;  3R2I A;  1TYG B;  2J52 A;  1I4G A;  2BTE A;  1FMA D;  1VJK A;  1I4X A;  1TS3 A;  4DXG A;  4PT5 A;  4GLS C;  1DYQ A;  2W82 A;  1PGA A;  4A90 A;  3ZJT A;  4XWW A;  2WU5 B;  1M4V A;  2INP E;  2WXN A;  4IOI E;  4IDI A;  3HVD A;  4MT5 A;  2V3P A;  4XE0 A;  1L4D B;  4JWU C;  1DOX A;  3H8H A;  2WXI A;  2YEP B;  3TEW A;  3AEF B;  1QF6 A;  1I4H A;  3AE8 B;  3NVZ A;  4FXC A;  2ZW1 A;  2LHD A;  3AE4 B;  1RYJ A;  1WRI A;  1KFY B;  3NVY A;  3T3N A;  2NTS A;  1FXI A;  2HTM E;  1CK1 A;  2J53 A;  2DYO A;  1VRA B;  1TJE A;  1XLQ A;  2IGD A;  2YEP F;  2LHE A;  2CU3 A;  2MJE A;  2QIE B;  3HRD D;  2JYE A;  5AUI A;  2BYT A;  4US8 A;  1J7B A;  1N62 A;  4XWT A;  4D2K A;  4YSZ B;  5GXG B;  5JXV A;  2PMV A;  1IGC A;  3T3O A;  2L83 A;  4KKI A;  2VZK D;  5BYR A;  1V1O A;  2I2Y A;  1AN8 A;  4HRO A;  4MAC A;  1JRP A;  3P4Q B;  2KAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...