3AB5A

Crystal structure of the 2fe 2s ferredoxin from cyanidioschyzon merolae
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
97
structure length
97
Chain Sequence
MYKIQLVNQKEGIDVTIQCAGDQYILDAAEEQGVDLPYSCRAGACSTCAGKLVKGSVDQSDQSFLDEDQISKGFILTCVAYPTSDCVIQTHQEEALY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the 2Fe 2S Ferredoxin from Cyanidioschyzon merolae at 1.18A resolution.
rcsb
source organism Cyanidioschyzon merolae
molecule tags Electron transport
molecule keywords Ferredoxin
total genus 25
structure length 97
sequence length 97
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ab5A00
4C80A 4HROA 1NEKB 1QLBB 1AWDA 2BS2B 5MPOA 1XO3A 2M56B 1GPXA 2WS3B 2WU5B 3RPFC 3AE6B 1AYFA 1JROA 4WWMA 1TJEA 3AEEB 4P6VF 1YQ4B 1ZOYB 3NVVA 3PO0A 4YTNB 3W9CB 2PIAA 1FO4A 1SF0A 1WWTA 3DWMA 5G5GA 3VRBB 1FRDA 3EUB2 1SB3C 1QOAA 3FC4A 4IDIA 3AE9B 2Y5CA 3ABVB 1TYGB 2QJLA 2G1EA 1N5XA 1RYJA 4WQMA 4YSXB 5H92C 2BS4B 3AE5B 1V8CA 5EE0A 3VR8B 4YSZB 3P4QB 2KMMA 2H88B 3KWLA 4YXDB 5H8YE 1L6VA 3NVYA 1IUEA 3ETRA 3AH7A 1GAQB 3P4SB 1OFFA 1XLNA 3VR9B 1WRIA 1QOGA 3AE3B 2L83A 2MJ3A 3B2FA 1ZP0B 1FFUA 2WU2B 3HRDD 2BT6A 2MH7A 3AE2B 1XLOA 1VDVA 2WDQB 3AE8B 3AECB 4N59A 1N61A 3NVZA 1WXQA 1DOIA 2DBYA 1E0ZA 1DGJA 1QOBA 3AEFB 3P4RB 4A9AA 1TKGA 4LTUA 4JWUC 1PDXA 2L52A 3AM9A 1OQRA 2HTME 3NRZA 3AMZA 1EWYC 2CU3A 3AV8A 1YJJA 4US9A 1B9RA 1RM6C 2CJOA 2N0SB 1NENB 3B2GA 4ITKA 3AEBB 3SFEB 4FXCA 2KAJA 3B9JA 2EKIA 2WP9B 1FXIA 1RFKA 1CZPA 1PUTA 2W55A 3HVZA 3NS1A 1E7PB 1R7SA 1XLQA 1JRPA 1ZUD2 3NVWA 1NYQA 3LB8C 3W5VB 1NYRA 2JX5A 2WQYB 1YQ3B 1PFDA 2ACZB 1WYGA 2W3SA 1VJKA 1JQ4A 2W54A 1DOYA 1JALA 2WLBA 3DWGC 1QOFA 2H89B 2PVOD 1A70A 2PVGC 3AEGB 5C3JB 2QIEB 2OHFA 3CWIA 5EE1A 4KX6B 1E10A 1E9MA 1JWBD 1KRHA 2AX5A 2MJDA 3WCQA 1DOXA 4JX1C 2K9XA 4C7YA 1CJEA 1KF6B 1TKYA 3AB5A 3AE1B 1FRRA 1L0VB 1N63A 2B76B 4YSYB 2E3TA 3P1MA 3SR6A 1J7BA 1NVID 1RWSA 4N6EB 2JQRB 3AE7B 1ROEA 1T3QA 2Q5WD 1J7AA 3LXFA 1V97A 2WDVB 3AE4B 2WDRB 4ZOHC 3ZYYX 3SFDB 4HRSA 1TKEA 1SIJA 1FFVA 1JWAD 4ZHPA 1I7HA 2PKOA 1L6UA 1J7CA 2DWQA 3BIID 3P63A 1FMAD 3W5UB 1FM0D 1N62A 1WGKA 1N60A 3HUIA 2MJEA 4YTMB 1FIQA 2M19A 4US8A 3AEDB 1XLPA 3L4PA 1OQQA 5C2TB 4YTPB 1ZXIA 5EE3A 3VRAB 4C7ZA 5EE9A 1NI3A 1UWMA 4ZHOA 4USAA 1E6EB 1L5PA 3FAHA 1VLBA 5AUIA 4N58A 2FBWB 1N5WA 2LEKA 3AEAB 4JWSC 1JW9D 2K22A 3AN1A 5GXGB 2CJNA 5G5HA 1QF6A 1FXAA 2W3RA 3CIRB 5AUKA 1YJIA 2BS3B 2K5PA 4YT0B 1KFYB 3P4PB 1QT9A 1F0ZA
chains in the Genus database with same CATH superfamily
1ZGUB 2DZIA 1S3SG 2JY6A 2X38A 1GPXA 1TJEA 3OAWA 2N9EB 3R8BA 2J0JA 1WSPA 2NR2A 4BOSC 2KDBA 2IO0B 5TR5A 1XF5L 1XCTL 4LNKA 2KFKA 5E6OA 2KJ6A 1OFFA 4H2AA 3B0AA 4C4VB 4EEWA 1VDVA 3AE8B 2L32A 1N61A 1DOIA 2DBYA 3AEFB 4LDTB 1T0YA 4JL9A 2UYZB 4I6NB 4W9LA 1XEEA 1E5WA 1DYQA 4EKUA 3AMZA 1SJHD 2L3ZA 4ZRQA 3RNCC 4ITKA 1C79A 3HM3A 2SAKA 1GOZA 1UGMA 2WP9B 4WAFA 3HVZA 1E7PB 4PS8A 1JRPA 3VH4B 1GC6A 2RD0A 2FCNA 4ZRJA 2N4FA 4C56C 2C9WB 1VCBA 1SE3A 4XYCA 2JT4B 2H89B 2IYDB 2PVGC 4II3B 1ET9A 1E9MA 1TKYA 4KIKB 1N63A 2GMIC 4ZRKA 2WXJA 3NY5A 1ET6A 3LXFA 2JSVX 3WA0A 2AL6A 4CHKA 1P1AA 4W9EA 2KNBA 4EUTA 2YEPB 3FILB 3L4PA 3BZDB 1WR6E 3DBRI 4MEMA 2LXCA 1SXTA 4OHJA 3DVNV 1JW9D 5G5HA 2BS3B 2DYMA 2K5PA 3DBHI 4DHZB 2JXXA 4AJYB 1I4HA 4ZYNA 3ZRCA 2I38A 3GS2A 1ZE3D 3NVVA 1Y8RC 5J2RA 2V4LA 1V86A 2QJLA 3X0WA 3VR8B 4WWOA 4MGYE 1HQRD 3NVYA 1V9JA 1E90A 2MW5A 3B2FA 2RR9A 4YL8A 3I5JC 2KMCA 4N59A 5AZHA 4A9AA 1TKGA 1ZDVA 1F77A 4WJQA 4F1SA 3A1QA 4GDLB 2GRIA 2JVCA 1J19A 4NJ7A 1FNWA 3B9JA 1P98A 3JSVA 3NS1A 3DBSA 3W5VB 1J0GA 2O2VA 1D5XC 1P7FA 4NJCA 3M95A 3FILA 4IWQA 3UQAA 2X8XX 2IO2B 1DOYA 1WF9A 4II2B 2KVRA 2KD0A 4LNNA 3W1SA 4B9KA 4XE0A 1JWBD 3PREA 1DOXA 1WGRA 1KF6B 3CF6E 2BYTA 5I4DA 2E3TA 3P1MA 2ASQA 1J7BA 5JHAA 5JH5C 4KGTA 2FIDA 2IZVB 3AXCA 2PE6B 4HWIB 3WALA 1SE2A 2PPHA 4DQOC 5BMGA 1FEHA 4BKSA 2Y5PA 1V1PB 3TEZA 2LUMA 1P9DU 2INPE 3JVZX 3TSSA 2LHDA 4IKGA 3VUYA 3BK2A 4L2YA 2LXAA 4HLEA 1RRBA 4NPNA 2BYEA 1FXAA 3PV1A 3KYDD 4R3DA 4S0RA 3TL5A 1BUIC 1MHHE 5HI1A 4XDCA 3U4EG 4XWWA 5EDSA 3PO0A 3R2TA 4RM9A 2DZKA 4I6PA 1U4AA 1OQYA 4WH4A 4N9F4 1FD6A 1EWCA 1WXSA 1XQQA 5CHVC 1Q5WB 3AM9A 2HTME 2FE8A 1EM7A 3R66C 4BKGA 3HM6X 3O65B 2AEHA 2W55A 1OGWA 3NZ3A 3WAPA 4GDLA 1D3ZA 2IY0B 2KACA 3DQVA 4WJPA 1RFAA 4AJWA 2KZRA 3ZQ4A 4PT5A 3P42A 3MJ5A 1E10A 3SHQA 3APCA 3DPDA 4FHKA 3ZO5B 1F9JA 1D5MC 3BYYB 3GZNB 3A9KA 4HRSA 2WNMA 2BKRB 2PKOA 3W5UB 4P16A 2JRIB 2MJEA 2BWES 1C1YB 3Q3MC 5J18A 3ZTCA 4GB9A 1VR9A 4OVVA 2WXNA 3I57A 4C4VA 3TBLD 2AQ3B 4JWSC 5BYRA 3ENEA 1QF6A 1YNTE 4DXFA 2KX3A 1KLVA 1L4ZB 3J9CA 2V0GA 2O6VD 3MP9A 3IHPC 4JIOU 2KANA 3FC4A 4W9HA 3RNAC 2MP2B 3OG5A 4EE2A 4L23A 3PRMB 3KLSX 1HZ6A 5KHQA 3PGEA 2RSUA 2CHXA 2SEBD 2J0MA 2JPHA 2LFIA 1MPEA 2MJ3A 2V3SA 2WXKA 2MHJA 4JE3B 4RH6A 4ICUA 2ZPYA 4RM8A 4W9JA 3VAWA 4FJVB 2WX1A 3C8YA 4G3XB 2CU3A 5IAAC 2BB5A 3K9PB 4MM3B 2BWFA 2LVQA 3BYTB 4I6LB 3NZUA 3SFEB 1UWXA 4B95A 3KUCB 2JRHA 3RI7C 4DK5A 3EC8A 3NVWA 4XZ4A 4DHZE 4W9CA 2GBJA 1TS4A 2RPVA 1JCKB 4A3OA 4DDID 2JF5A 2GI9A 1WJUA 1SGHA 1BMLC 4ICVA 4GLSC 3RNFC 3VXWA 3AB5A 2KLCA 1WH3A 2YLMA 4WURA 3L10B 2J0KA 4MH0E 3E9SA 4AOFA 1SIJA 3ML8A 1UH6A 4TUUA 1FXTB 2KO3A 2FCSA 2GBMA 3GE8C 5DPSA 3N1YC 1K52A 2Y5BB 5L83A 3QWZB 2N9KA 3BVGA 2GBKA 1C4PA 3GZNI 3DWMA 1WJNA 3U2SC 1F0ZA 3NUHB 4ANWA 1AYFA 4IM0A 4YTNB 3L16A 1SF0A 1YOVB 4KGRA 4E3CA 1TYGB 2VRRB 2BF8B 2W9NA 3N32A 2Y3AA 2N7DA 4IM3A 1PGBA 4GOCA 3SDLC 4EFOA 1SJED 3WANA 2LGXA 2K6DB 1ZKHA 2KTRA 4NJ6A 2NBVB 3PPAA 2WXLA 3RZFA 1OQRA 2V9HA 5D7GA 1B9RA 4XC2A 4G11A 2DHZA 3AEBB 4B6WA 3U52E 1FXIA 1WR1A 2NBUA 1T6BX 1WXVA 3SEBA 2JX5A 2XNAC 2C5LC 3PRPB 3RNEC 2L0FA 2L00B 2WXGA 4HDQA 2IO1B 1PGXA 1YJ1A 2MJDA 3IXSA 2N1VA 4GDKA 2EKEC 2W82A 3BINA 3HIZA 1H4RA 1RWSA 2JUOA 4RGOS 1V97A 2WDRB 1KM7A 4RGNA 1TKEA 1I7HA 2BYFA 4D2KA 2INDC 2XK5B 1IGDA 4HPMB 3N1ZC 4RGMA 1WI0A 3UQBA 1I4XA 4JPSA 1LGRA 3KW5B 4MGZE 1JWMD 1UWMA 2KYWA 3ZRFA 3LYYA 1GC7A 1QQRA 2JYEA 2UU7A 2NBWB 1FPYA 3ZW3A 4GN1A 1ZW7A 1UUPA 2KWUB 2PE9A 3L13A 3D32A 1QT9A 2M4NA 4HCPB 1QLBB 1I35A 4M00A 2KFJA 3W1YA 3VFKA 2NCNA 2FIFA 2NS5A 1FRDA 1AW7A 2KXJA 1WM2A 1ENFA 2N9PC 4YSZB 3EECA 3VTVA 2ZEQA 4TSSA 1WE6A 1WRIA 3KVFB 1NI2A 2RGFA 1L2NA 2WDQB 2PW9A 1MG4A 3BVMA 1SE4A 1QOBA 3UINB 4W9FA 3PZ7A 5BMIA 1D6EC 2MA9B 4Q2JA 2ZW1A 4US9A 4JGHB 1GB1A 1ZDXA 4PS3A 2JU6X 1R4MB 2GBRA 2A5UA 2KAJA 4B0MA 3TEWA 4QAYA 2RDGA 1CZPA 4O1NA 4XX5A 4TV3A 4PS7A 2WDTB 1GB4A 1ZUD2 3MHZA 3EHVA 3UIOB 3H9DA 3DHIC 4LK0M 3W1SC 4BBNC 4REZA 2XBBC 1I4GA 3HHMA 1G6JA 3MC0B 2HJ1A 1UF0A 4CO7A 1CJEA 2EMTA 3V05A 3TEYA 3DBHB 3ZXRA 2KKCA 2TSSA 3Q2AC 4ZOHC 1P7EA 1FFVA 1JWAD 1TS5A 1WY8A 2KWDA 4LNIA 1QILA 3P63A 3IT4B 2V3NA 1N60A 4US8A 2K3UA 2J53A 3PLUA 1ZXIA 3DDCB 3FAHA 1E8WA 2RDBC 2MWSB 2OJWA 2KMAA 4BZAA 1TIFA 4A6QA 2QSDA 2J42A 4WWNA 1WM3A 2M56B 4NZLB 4P6VF 3PHWB 1LXDA 2D3AA 2BW2A 3RD2A 1KOTA 1WWTA 3ECIA 1IBXB 4IDIA 1I4PA 4LCDE 2K6QA 1F2RC 3QARA 3ZDMC 5H92C 4GU2A 3R7QA 1MVKA 3AE5B 4PYZA 3KWLA 2QCZA 2MLBA 5H8YE 2LGYA 2E6XA 2RMMA 1Q10A 4MACA 3SU8X 2KC2A 4ZRPA 3P4RB 1D5ZC 1MHXA 3PS6A 1YN3A 4GSWA 1CQVA 3PZDA 1ZPSA 2NVUI 1VZ7A 3QHTA 4NQKE 2KX0A 1PUTA 3S2AA 3APDA 4KKJA 5DPTA 2M17A 2KHWB 5HG2A 5LNK1 2WGSA 3TEXA 2ICIA 2EMSA 3ZKJC 1N6ZA 1PQSA 2IY1B 2LJIA 3ZGZA 3GB1A 1F2RI 4HVBA 2LRUA 3R2IA 2B76B 5JHBA 2WXFA 1YD8U 4HDOA 3X23A 1I42A 2IJ0A 2FUHB 5IP4D 2ZVOA 3BIID 2L8JA 2D3GA 1WIAA 3HUIA 2JWUA 2M0XA 5EE3A 2K8HA 4BVUC 4USAA 5FR3A 3Q69A 1HZ5A 2QEJC 2LGDA 5IKCM 2K22A 1V1PA 2W3RA 1WRDB 4FN2A 3P4PB 3I63C 1NEKB 2NMQA 1GG3A 4DHJD 1WGYA 2G45B 5C23A 3ZIMA 2IDYA 2QC8A 4E74A 4HXDA 1MG8A 4M01A 3T3NA 3SD5A 5EE0A 1KLGD 5LXIB 3RFZB 1UELA 2BTEA 3MTNB 2D2QA 1GAQB 4RF1A 4IG7B 3H8HA 3MJWA 1K50A 3TIXA 1WGDA 3R3MA 4EZKA 2WU2B 3N3KB 1YN4A 4IUMB 4IWPA 4GDKB 4F7ZA 1L7YA 3NRZA 1EWYC 1GUAB 2CKHB 2KDFB 2R2QA 1BXTA 4FXCA 3EGRA 4RCOA 4X57B 2OOBB 1UNSA 2KFKB 2LASA 2FNJB 3AU5A 4KZ0A 2AYOB 4K81A 3QIJA 4HK2A 3T3OA 3RT3B 2W54A 1E7UA 3DWGC 1QOFA 2QIEB 3U7DA 3NZSA 1OEYA 4RF0A 2K1FA 1KRHA 1SE9A 3DHGC 2JZPA 1VZ6A 2IGGA 4MGIE 2DZMA 4YSYB 1NVID 4OZCA 3AE7B 1J7AA 2R2OA 3Q8EA 4M8NA 2M1MA 2IBIB 4C00A 1UZXB 2UWQA 4S17A 2OJRA 4ANXA 5JZEB 1FIQA 1Z5SB 2IGDA 2KQ7A 2WYQA 4KV2A 4LJOB 3Q3NC 2EELA 1SSNA 1Z2MA 3QX1A 2LEKA 5GXGB 1S1QB 3AU4A 4F8CB 3TMPB 4TQ1A 4YT0B 1MI0A 2Z59B 3V60A 4IM2A 3OWEB 2WS3B 4LDTD 2NTTA 3W9CB 2QHOA 3PTFC 3E56A 2D3BA 2ZW0A 3ABVB 2BS4B 1Q0WB 1V8CA 3ZDTA 3P4QB 1XXGA 2NTSA 1WFYA 2GLSA 3LJ3A 1I4QA 2L83A 4WWPA 4EOYA 3NVZA 4HPLB 1WYWB 3KYCD 4JLCA 4NAWB 2ZVNA 1P0RA 1VZ8A 4XGAB 2LJ5A 3AV8A 1YJJA 4W9KA 2K0PA 3U30A 2GBNA 2MRPA 2LMCA 2CHZA 2KVZA 1C4CA 4KSKC 1WJ6A 2ZCBA 4DWFA 1ZXHA 1NYQA 1NYRA 2KWVB 4BBNF 1V80A 3O13A 2K25A 5EE1A 5D3IB 1XD3B 2R61A 3H7PA 1NBFC 4E71A 1UD7A 1MFWA 1HE8A 4MT5A 4BKSD 3QJZA 2RDHA 3DVGX 3Q3JA 3EFCA 4ZYSA 3GP7A 4K7SA 4OVUA 2A4ZA 1FMAD 2O2VB 1T0QC 1T0SC 5C1ZA 2XEWA 3N30A 1YMHE 1NI3A 4NNJB 3GE3C 4A8XC 1VLBA 1LFDA 4FBJB 3OJ3A 5HFYA 2CJNA 4HKQA 1WX9A 3OLMD 1FCLA 1NDDA 1EF5A 2DNFA 4XWTA 3AEEB 1H8CA 2O6VA 2PIAA 1V5OA 3EUB2 2KQ4X 1TGZB 2FCMA 5AEKB 1L0XB 4DHJB 4XDDA 2KMMA 4YXDB 3L54A 5FKAC 2K8BA 3QK0A 4HCNB 1L6VA 4FJZA 2WXOA 4KGSA 3AE2B 4DBGA 5MPOA 4RFBA 1L4DB 2KWCA 4MSMB 3VUXA 4RGTA 4KZCA 1R4NB 4TQ0A 2L76A 3I3TB 4AS1A 3NHEB 2CHWA 1KLUD 2VZKD 2REXA 3I9V1 3V61A 5DPRA 2MBBB 4BFRA 4W9GA 1YQ3B 3ZNHB 1VD2A 2BQQA 3GOEA 3AI5A 3EFUA 1Q1OA 4KX6B 4GXBA 4P1CC 5DPWA 5D6JB 3ZJTA 3AE1B 2DYBA 2LRWA 3V6EB 2WDVB 3RN9C 3RNBC 4JQWC 4FULA 2LGSA 2MBHA 2AWTA 1E8XA 4GIVA 4HEA1 5HKHA 4YTPB 5BYQA 5EE9A 3A9JB 4ZHOA 1E6EB 1L5PA 3DVGY 1STEA 4BAXA 1K53A 4A55A 1RAXA 3T9LA 3OJ4B 3Q3OC 3H7PB 1YJIA 2Z0EB 3KWVA 3M62B 1V5TA 4NQLB 4K3BA 2M0AA 2WXHA 3L0WB 3U7ZA 1C3TA 4A3PA 4HPPA 4MSQB 3QCAA 1QOAA 2VH1A 2N9XA 1RYJA 3PHXB 2LGIA 3W2DA 3UIPB 4MM3A 1IYFA 2C60A 3VTUA 1DGJA 1E8YA 2ZNVB 4TMAB 1WX7A 1I4RA 1IPGA 1IP9A 2KLGA 4CYEA 2ZPNA 4IOIE 2JXTA 4MH8A 5E6NA 1PFDA 3P2BA 2ACZB 3WAMA 2W3SA 2MBEA 3K9OB 1AN8A 4MDKE 2OHFA 3NG0A 1TZ1A 1WE7A 2BB6A 1HTQA 3KUZA 1C76A 1VRAB 1KJTA 3N20C 1OTRB 4B0EA 1FRRA 2KDEB 2INCC 3QAQA 5DCNA 3AULA 1FCCC 5IOIA 2KK8A 1V1OA 1TT5B 4LNOA 2G3QB 5AZGA 2XN9C 2M19A 2I2YA 1XLPA 1ACCA 1WMHB 3UF8A 1FNUA 3EA6A 1B1ZA 3Q8FA 4PK1A 4N58A 1TTNA 3IAS1 2BPSA 4J3OD 4M02A 1TY0A 1WJ4A 4GGQA 3IT6B 3M63B 3ZJUA 4MJSA 1YQ4B 4DDGD 1FO4A 3VRBB 4FADA 2WWZA 2B3AA 4WIPA 2G1EA 1N5XA 3C19A 3CSTA 3PT2B 1K51A 2I1KA 1ESFA 5D94A 1QKZA 3DHHC 1V81A 1QOGA 2ZJDA 2LVOA 2JZZA 3JW0X 2WXQA 2Z0DB 5E6JA 1WXMA 2G4DB 3CMMB 4K1RB 4IW0A 2K39A 1F52A 3RNGC 3Q8CA 2M8SA 2HD5B 3RMKC 2WXRA 2N7JA 4BOZB 1IBXA 1RFKA 4KVGB 3ZNID 2D11A 2KDIA 3LB8C 2HE7A 4HJKA 1GJZA 1VJKA 5BMHA 1Y56A 2WLBA 2JWZA 5C3JB 1YX5B 2BBCA 2LZ6A 3Q8AA 4LLGM 2AX5A 4EZJA 4FA6A 5BYSA 4ASWC 1XCQL 3SFDB 1L6UA 1YIWA 2DWQA 4J6IA 3FKYA 4A20A 1WGKA 3QA8A 1E7VA 3IAM1 3C0RB 4C7ZA 3N9YC 3RZWC 1WXAA 1HXYD 1N5WA 1TZOA 4OW0A 1EF1A 2D5GA 3CIRB 4KIKA 3BY4B 4OZBA 5AUKA 4M8MA 1V6EA 2ZZPB 1AWDA 3RPFC 2WU5B 3AE6B 1JRUA 2KTFA 3KH0A 2LI5A 3AE9B 4YSXB 2LD9A 2MX2A 1WMHA 2PEAA 2H88B 4ARCA 4WJOA 2PMVA 1ISNA 1LM8B 1BT0A 3ETRA 4WAAA 3H6NA 4ARIA 1HEZE 3DBLI 1FFUA 4PYUA 2ZNVC 2MP2A 3AECB 2KQSA 3PLVA 4DXAB 4G50A 4ANUA 1PGAA 4JWUC 2DAFA 2KOXA 1CK1A 2N9LA 5AZFA 2DAJA 3IBEA 2N0SB 3WIMA 2O6VB 1M4VA 4ZRIA 1UBIA 1R7SA 1UGJA 2L0TA 2G9HD 4WQOB 2WXMA 3APFA 3VVWB 4BKTA 3RYTA 2PTLA 3Q14C 3VDZA 3L17A 2AQ1B 3KQ4A 2K9XA 4C7YA 3A1QB 2L7RA 4N6EB 5FK9C 2JQRB 2BYVE 2Q5WD 4IC7B 2NPTB 3WAOA 1L0YB 3ZYYX 3A9JA 3MHSD 3QQ8B 4ZHPA 2PJHA 1J7CA 4OZAA 4A90A 1GNUA 2ZCCA 5HHDG 3MC8A 1FM0D 4IWOA 3Q6BA 5L95C 3AEDB 3ALBA 4K7UA 5C2TB 4M0WB 2LUEA 5AUIA 2WX0A 3KUDB 3MC9A 3RULA 4C80A 2HDEA 3AN1A 2JZ3B 3VTWA 1EU3A 4ZDVA 2CS4A 3DVNU 4EZLA 1QZEA 4HROA 1SIFA 2BS2B 4UDUC 2J7QB 1XO3A 3B08A 1JMLA 2KC1A 1JROA 5G2NA 3TJPA 5CHFA 5BO4B 3T8MA 4P1BC 3ZJVA 5G5GA 1SB3C 2Y5CA 4WJNA 3IVFA 4NY0A 2L1AA 2KN4A 5IA7A 3NS8A 2WXPA 3CSFA 2VH2A 3VR9B 3AE3B 1X1MA 4G0NB 2BT6A 2MH7A 2KN5A 1E0ZA 1WXQA 5D3DA 5IN7A 3BVZA 4P7IA 2BVCA 2MEKA 1JWSD 3NOBA 1TS2A 4L1BA 3IG3A 2EKIA 3Q3FA 2KTRB 4ACFA 3DBLB 3HVDA 3HK0A 2WQYB 2ONQA 1WYGA 2WXIA 4CQNA 1E8ZA 2DYOA 2NPTA 3AEGB 3LDZE 3CWIA 1IGCA 1YN5A 2MBOA 2V4IB 1L0VB 2C7HA 2MSED 1T3QA 1JWUD 3AE4B 4RNAA 3VHTC 2V3PA 5CTRC 2LWPA 3BK1A 1N62A 4YTMB 3N1XC 2V1YA 5FR6A 1OEYJ 1OQQA 2DENB 2ON8A 1T5XD 1KTKA 3Q8BA 5GMVA 1M94A 4MJSB 2XK5A 1EU4A 2N7EA 2MCNB 2DX5B 1WZ3A 4LJPB 3DOWA 3V62A 3L08A 4KDIC 1C77A 1ZOYB 2QDFA 1R4MI 3QC8B 3B1LX 3ML9A 3ZXVA 2D10A 3ZUNA 2BGFA 1SEBD 2LVPA 1K8RB 3RUIB 3IFWB 1IUEA 5KHOA 3M3JA 3AH7A 2Z8LA 1XLNA 2INNE 1ZP0B 1XLOA 3ONSA 2AQ2B 3R7RA 1FNVA 5IO9A 1A5RA 2L52A 3BWUD 2N1WA 1PYWD 4K7WA 1RM6C 4TKNA 2CJOA 2DLBA 2D3CA 2IPKD 4AUQC 4AP4C 2DZJA 1XLQA 3UGBB 2FUG1 4ANVA 4GMVA 3UI3A 2C7NB 3V3XA 1JQ4A 3JYUA 2YVCA 3DBRB 1EO6A 1T0RC 2FCQA 2IGHA 3JSVB 5T8IA 4FLHA 3PVLA 3NJTA 1SBBB 1HTOA 1AARA 2BKFA 4OVZA 5J17A 3A33B 3MFGA 1LO5D 4FJYA 3H1UA 2L05A 3H7SA 4KKIA 2RPQA 1V49A 5LXHA 1KH0A 2GOWA 1HA5A 3URYA 2WHIA 2G4SA 3VRAB 3A4RA 5CX3A 3ZNZB 3VH3B 3ZTDA 1C9FA 1WX8A 4MELA 2CR5A 2K8CA 4AWJA 4LNFA 2KDMA 3ZNGC 1WGGA 4HJGE 5CHWA 2QILA 1WGHA 1F1HA 1UBQA 1YX6B 4WWMA 3PSEB 4K3CA 5G55A 2KT7A 3TCAA 5D2MB 4MGKE 4WQMA 2C7MB 1TY2A 1MJDA 5E6PA 3RCZA 2GB1A 3P4SB 3HRDD 1LQBA 1J8CA 2J4XA 4LTUA 1PDXA 1TBEA 2FAZA 1EUVB 3A4SC 3DCGA 1CMXB 1TS3A 1C78A 2MBQA 1NENB 3B2GA 3ZVVA 2KJHB 2JYTA 4KDLB 4NAWA 2PLPA 2AL3A 2MQJA 1V2YA 4NAMA 1C4AA 1P3QU 1JALA 1RLFA 2QMTA 3U8ZA 2PVOD 2CU1A 1A70A 4DXGA 3A9KB 3WCQA 2HTHA 3V6CB 3PZ8A 4JX1C 4KSLC 4W9DA 2YEPF 3SR6A 2VZKB 2LHEA 1ROEA 3TUOA 2OEDA 4M0WA 4YWGG 3VQIA 4URKA 2I1JA 5TSSA 2J52A 4RMAA 3VUWA 3ZLZA 5LLIA 1WZ0A 2D07B 1D4BA 2HJ8A 5JXVA 4W9IA 2KJRA 1R4NI 3PRZA 2FBWB 4FHJA 3AEAB 1XT9B 4HKZE 1YQBA 4AQ7A 1KFYB 2IO3B
chains in the Genus database with same CATH topology
1MI0A 3NUHB 1AWDA 3OWEB 2X38A 1GPXA 2WS3B 2WU5B 3RPFC 3AE6B 1AYFA 2NTTA 1TJEA 4YTNB 3W9CB 3E56A 1SF0A 3R8BA 1WSPA 4KGRA 2ZW0A 3AE9B 3ABVB 1TYGB 4YSXB 1XF5L 2BS4B 1V8CA 1XCTL 3P4QB 2Y3AA 1XXGA 2H88B 2NTSA 4ARCA 2PMVA 1PGBA 3ETRA 1SJED 1I4QA 1OFFA 4ARIA 1HEZE 2L83A 4H2AA 1FFUA 1VDVA 3AE8B 3AECB 2L32A 1N61A 3NVZA 1DOIA 2DBYA 3AEFB 1PGAA 4JWUC 4NAWB 1CK1A 1XEEA 2N9LA 2WXLA 1OQRA 1DYQA 1VZ8A 3AMZA 3AV8A 1YJJA 1SJHD 5D7GA 4ZRQA 1B9RA 2K0PA 2N0SB 4ITKA 1C79A 3AEBB 2LMCA 1M4VA 2SAKA 1GOZA 1C4CA 2WP9B 3U52E 1FXIA 4WAFA 3HVZA 1E7PB 1R7SA 1T6BX 1JRPA 1ZXHA 1NYQA 3SEBA 1NYRA 2JX5A 1UGJA 2XNAC 4C56C 2G9HD 1SE3A 2WXMA 2WXGA 2PTLA 2H89B 2PVGC 3O13A 1PGXA 5EE1A 5D3IB 1ET9A 1E9MA 2AQ1B 2MJDA 3IXSA 3KQ4A 2K9XA 4C7YA 1TKYA 2W82A 2R61A 1N63A 2WXJA 4N6EB 5FK9C 1RWSA 2JQRB 1ET6A 2Q5WD 3LXFA 4RGOS 1V97A 1L0YB 2WDRB 3ZYYX 4RGNA 2JSVX 4MT5A 1TKEA 4ZHPA 1I7HA 2RDHA 1J7CA 4ZYSA 4OZAA 4A90A 3GP7A 4D2KA 5HHDG 1FMAD 1FM0D 1IGDA 2YEPB 3AEDB 3FILB 4RGMA 3L4PA 1I4XA 4JPSA 5C2TB 1YMHE 3BZDB 1JWMD 1NI3A 1UWMA 4A8XC 3LYYA 1SXTA 1VLBA 5AUIA 1QQRA 2JYEA 4OHJA 4C80A 2HDEA 1JW9D 5HFYA 3AN1A 2CJNA 5G5HA 1UUPA 1EU3A 2BS3B 2DYMA 2K5PA 4HKQA 1FCLA 1QT9A 4HROA 1QLBB 2BS2B 4UDUC 1XO3A 1I4HA 1JMLA 4XWTA 1JROA 3AEEB 2I38A 3GS2A 1ZE3D 3NVVA 2PIAA 3ZJVA 5G5GA 1FRDA 3EUB2 1AW7A 1SB3C 2KQ4X 2Y5CA 1ENFA 2QJLA 2L1AA 2KN4A 1L0XB 4YSZB 3VR8B 4XDDA 2KMMA 4YXDB 2WXPA 5FKAC 1L6VA 1HQRD 3NVYA 4TSSA 3VR9B 1WRIA 2WXOA 3AE3B 3B2FA 4KGSA 2BT6A 2MH7A 3AE2B 4N59A 2WDQB 5MPOA 2PW9A 1E0ZA 4RFBA 1WXQA 1L4DB 1SE4A 3BVMA 5D3DA 1QOBA 4A9AA 1TKGA 3BVZA 1ZDVA 1F77A 2MEKA 4RGTA 3PZ7A 5BMIA 1D6EC 1JWSD 2ZW1A 4Q2JA 4TQ0A 4GDLB 4US9A 1GB1A 1ZDXA 2GRIA 1TS2A 2JU6X 1FNWA 4AS1A 4L1BA 2KAJA 2VZKD 1KLUD 3B9JA 4B0MA 2EKIA 3TEWA 2RDGA 1CZPA 3I9V1 4O1NA 3NS1A 1GB4A 3HVDA 1ZUD2 3W5VB 3MHZA 1D5XC 2WQYB 1YQ3B 2ONQA 1P7FA 4NJCA 1WYGA 3FILA 4LK0M 1DOYA 2WXIA 4CQNA 4REZA 2DYOA 3AEGB 3W1SA 3CWIA 1I4GA 4KX6B 4XE0A 1JWBD 3MC0B 1DOXA 1IGCA 1YN5A 1CJEA 1KF6B 3ZJTA 3AE1B 2V4IB 2BYTA 5I4DA 1L0VB 2E3TA 3P1MA 1J7BA 3V05A 3TEYA 4KGTA 1T3QA 2TSSA 1JWUD 2WDVB 3AE4B 4RNAA 1P7EA 4ZOHC 1FFVA 1JWAD 1SE2A 1TS5A 2KWDA 1QILA 3P63A 2V3PA 3IT4B 1FEHA 2V3NA 5BMGA 2Y5PA 1N62A 1V1PB 1N60A 3BK1A 3TEZA 4YTMB 4US8A 4HEA1 1OQQA 2LUMA 2K3UA 2J53A 2INPE 1ZXIA 4YTPB 3TSSA 5BYQA 2ON8A 5EE9A 1T5XD 1KTKA 2LHDA 3Q8BA 4ZHOA 1E6EB 1L5PA 3FAHA 4IKGA 1STEA 3BK2A 1K53A 4L2YA 4A55A 1EU4A 1FXAA 4R3DA 1YJIA 3KWVA 4A6QA 2QSDA 2J42A 1BUIC 1MHHE 2M0AA 2WXHA 2M56B 4NZLB 5HI1A 1C77A 4XDCA 3U4EG 4XWWA 4P6VF 1ZOYB 2BW2A 3PO0A 3U7ZA 1WWTA 1IBXB 4IDIA 1QOAA 3R2TA 1F0ZA 1I4PA 1F2RC 1RYJA 5H92C 1MVKA 3AE5B 3KWLA 1SEBD 5H8YE 2E6XA 2LGIA 2RMMA 1Q10A 4MACA 1IUEA 3W2DA 3AH7A 2Z8LA 1XLNA 2INNE 4WH4A 1ZP0B 1FD6A 1XLOA 1EWCA 2AQ2B 4ZRPA 1DGJA 3P4RB 1FNVA 1D5ZC 1MHXA 1YN3A 2L52A 3AM9A 4TMAB 1CQVA 3BWUD 2HTME 1ZPSA 1PYWD 2FE8A 1I4RA 1RM6C 2CJOA 1VZ7A 2DLBA 1EM7A 2IPKD 1PUTA 2W55A 1XLQA 4IOIE 3NZ3A 2JXTA 4MH8A 1PFDA 2ACZB 2FUG1 4KKJA 2KACA 3UI3A 2W3SA 3V3XA 1JQ4A 5HG2A 5LNK1 3TEXA 1AN8A 3ZQ4A 2IGHA 4PT5A 2ICIA 3P42A 3MJ5A 2OHFA 1E10A 2BB6A 5T8IA 1C76A 1VRAB 2LJIA 3ZGZA 3GB1A 1F2RI 4B0EA 1SBBB 1FRRA 3R2IA 2B76B 4OVZA 2WXFA 3MFGA 1D5MC 3BYYB 1FCCC 1LO5D 2IJ0A 4HRSA 2WNMA 2PKOA 1V1OA 3BIID 4KKIA 3W5UB 4P16A 3HUIA 2MJEA 2XN9C 2M19A 2I2YA 2JWUA 1XLPA 1ACCA 1KH0A 1HA5A 3URYA 5EE3A 1FNUA 3VRAB 3EA6A 1B1ZA 4USAA 1C9FA 5FR3A 3Q69A 1VR9A 1HZ5A 3Q8FA 2WXNA 3I57A 2QEJC 4N58A 2AQ3B 4JWSC 3IAS1 2K22A 1V1PA 5BYRA 1QF6A 2W3RA 4J3OD 2KDMA 1TY0A 1YNTE 4DXFA 4HJGE 4DQOC 3IT6B 3P4PB 2QILA 1NEKB 1L4ZB 3J9CA 2NMQA 2V0GA 3MP9A 4WWMA 3ZJUA 1YQ4B 2IDYA 1FO4A 3VRBB 3DWMA 3FC4A 4WIPA 4EE2A 4L23A 2G1EA 1N5XA 4WQMA 3KLSX 1HZ6A 3T3NA 5EE0A 1KLGD 3RFZB 1TY2A 2SEBD 1K51A 2BTEA 1ESFA 1QKZA 2GB1A 2LFIA 1GAQB 3H8HA 3P4SB 4RF1A 1K50A 1QOGA 1MPEA 2MJ3A 3HRDD 2WU2B 2WXKA 4JE3B 4RH6A 1YN4A 2WXQA 2J4XA 5E6JA 4LTUA 1PDXA 4GDKB 3NRZA 3C8YA 1EWYC 2CU3A 1TS3A 2BB5A 1C78A 3Q8CA 4MM3B 1BXTA 1NENB 3B2GA 3BYTB 3SFEB 1UWXA 4FXCA 2WXRA 3EGRA 4RCOA 2N7JA 2JYTA 1IBXA 1RFKA 3NVWA 1UNSA 3LB8C 2PLPA 1TS4A 2RPVA 1JCKB 4NAMA 3T3OA 1C4AA 1VJKA 5BMHA 2W54A 1JALA 2GI9A 1Y56A 2WLBA 3DWGC 2QMTA 1QOFA 2PVOD 1A70A 1BMLC 4DXGA 5C3JB 2QIEB 4RF0A 4GLSC 2BBCA 3Q8AA 1KRHA 4LLGM 3WCQA 2AX5A 2JZPA 3PZ8A 1VZ6A 2IGGA 4JX1C 3AB5A 5BYSA 4YSYB 2YEPF 3SR6A 1NVID 2LHEA 2VZKB 4OZCA 3AE7B 1ROEA 4WURA 3TUOA 1J7AA 2OEDA 3Q8EA 4M0WA 3E9SA 1XCQL 3SFDB 1SIJA 4YWGG 3VQIA 1L6UA 5TSSA 2J52A 2DWQA 1WGKA 1FIQA 1K52A 2IGDA 3IAM1 1D4BA 5JXVA 4C7ZA 2EELA 2N9KA 1SSNA 3N9YC 3BVGA 1HXYD 2FBWB 1N5WA 1TZOA 2LEKA 3AEAB 4OW0A 5GXGB 2D5GA 4HKZE 3CIRB 5AUKA 4AQ7A 4OZBA 1C4PA 4TQ1A 4YT0B 1KFYB 3U2SC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C80 A;  4HRO A;  1NEK B;  1QLB B;  1AWD A;  2BS2 B;  5MPO A;  1XO3 A;  2M56 B;  1GPX A;  2WS3 B;  2WU5 B;  3RPF C;  3AE6 B;  1AYF A;  1JRO A;  4WWM A;  1TJE A;  3AEE B;  4P6V F;  1YQ4 B;  1ZOY B;  3NVV A;  3PO0 A;  4YTN B;  3W9C B;  2PIA A;  1FO4 A;  1SF0 A;  1WWT A;  3DWM A;  5G5G A;  3VRB B;  1FRD A;  3EUB 2;  1SB3 C;  1QOA A;  3FC4 A;  4IDI A;  3AE9 B;  2Y5C A;  3ABV B;  1TYG B;  2QJL A;  2G1E A;  1N5X A;  1RYJ A;  4WQM A;  4YSX B;  5H92 C;  2BS4 B;  3AE5 B;  1V8C A;  5EE0 A;  3VR8 B;  4YSZ B;  3P4Q B;  2KMM A;  2H88 B;  3KWL A;  4YXD B;  5H8Y E;  1L6V A;  3NVY A;  1IUE A;  3ETR A;  3AH7 A;  1GAQ B;  3P4S B;  1OFF A;  1XLN A;  3VR9 B;  1WRI A;  1QOG A;  3AE3 B;  2L83 A;  2MJ3 A;  3B2F A;  1ZP0 B;  1FFU A;  2WU2 B;  3HRD D;  2BT6 A;  2MH7 A;  3AE2 B;  1XLO A;  1VDV A;  2WDQ B;  3AE8 B;  3AEC B;  4N59 A;  1N61 A;  3NVZ A;  1WXQ A;  1DOI A;  2DBY A;  1E0Z A;  1DGJ A;  1QOB A;  3AEF B;  3P4R B;  4A9A A;  1TKG A;  4LTU A;  4JWU C;  1PDX A;  2L52 A;  3AM9 A;  1OQR A;  2HTM E;  3NRZ A;  3AMZ A;  1EWY C;  2CU3 A;  3AV8 A;  1YJJ A;  4US9 A;  1B9R A;  1RM6 C;  2CJO A;  2N0S B;  1NEN B;  3B2G A;  4ITK A;  3AEB B;  3SFE B;  4FXC A;  2KAJ A;  3B9J A;  2EKI A;  2WP9 B;  1FXI A;  1RFK A;  1CZP A;  1PUT A;  2W55 A;  3HVZ A;  3NS1 A;  1E7P B;  1R7S A;  1XLQ A;  1JRP A;  1ZUD 2;  3NVW A;  1NYQ A;  3LB8 C;  3W5V B;  1NYR A;  2JX5 A;  2WQY B;  1YQ3 B;  1PFD A;  2ACZ B;  1WYG A;  2W3S A;  1VJK A;  1JQ4 A;  2W54 A;  1DOY A;  1JAL A;  2WLB A;  3DWG C;  1QOF A;  2H89 B;  2PVO D;  1A70 A;  2PVG C;  3AEG B;  5C3J B;  2QIE B;  2OHF A;  3CWI A;  5EE1 A;  4KX6 B;  1E10 A;  1E9M A;  1JWB D;  1KRH A;  2AX5 A;  2MJD A;  3WCQ A;  1DOX A;  4JX1 C;  2K9X A;  4C7Y A;  1CJE A;  1KF6 B;  1TKY A;  3AB5 A;  3AE1 B;  1FRR A;  1L0V B;  1N63 A;  2B76 B;  4YSY B;  2E3T A;  3P1M A;  3SR6 A;  1J7B A;  1NVI D;  1RWS A;  4N6E B;  2JQR B;  3AE7 B;  1ROE A;  1T3Q A;  2Q5W D;  1J7A A;  3LXF A;  1V97 A;  2WDV B;  3AE4 B;  2WDR B;  4ZOH C;  3ZYY X;  3SFD B;  4HRS A;  1TKE A;  1SIJ A;  1FFV A;  1JWA D;  4ZHP A;  1I7H A;  2PKO A;  1L6U A;  1J7C A;  2DWQ A;  3BII D;  3P63 A;  1FMA D;  3W5U B;  1FM0 D;  1N62 A;  1WGK A;  1N60 A;  3HUI A;  2MJE A;  4YTM B;  1FIQ A;  2M19 A;  4US8 A;  3AED B;  1XLP A;  3L4P A;  1OQQ A;  5C2T B;  4YTP B;  1ZXI A;  5EE3 A;  3VRA B;  4C7Z A;  5EE9 A;  1NI3 A;  1UWM A;  4ZHO A;  4USA A;  1E6E B;  1L5P A;  3FAH A;  1VLB A;  5AUI A;  4N58 A;  2FBW B;  1N5W A;  2LEK A;  3AEA B;  4JWS C;  1JW9 D;  2K22 A;  3AN1 A;  5GXG B;  2CJN A;  5G5H A;  1QF6 A;  1FXA A;  2W3R A;  3CIR B;  5AUK A;  1YJI A;  2BS3 B;  2K5P A;  4YT0 B;  1KFY B;  3P4P B;  1QT9 A;  1F0Z A; 
#chains in the Genus database with same CATH topology
 1ZGU B;  2DZI A;  1S3S G;  2JY6 A;  2X38 A;  1GPX A;  1TJE A;  3OAW A;  2N9E B;  3R8B A;  2J0J A;  1WSP A;  2NR2 A;  4BOS C;  2KDB A;  2IO0 B;  5TR5 A;  1XF5 L;  1XCT L;  4LNK A;  2KFK A;  5E6O A;  2KJ6 A;  1OFF A;  4H2A A;  3B0A A;  4C4V B;  4EEW A;  1VDV A;  3AE8 B;  2L32 A;  1N61 A;  1DOI A;  2DBY A;  3AEF B;  4LDT B;  1T0Y A;  4JL9 A;  2UYZ B;  4I6N B;  4W9L A;  1XEE A;  1E5W A;  1DYQ A;  4EKU A;  3AMZ A;  1SJH D;  2L3Z A;  4ZRQ A;  3RNC C;  4ITK A;  1C79 A;  3HM3 A;  2SAK A;  1GOZ A;  1UGM A;  2WP9 B;  4WAF A;  3HVZ A;  1E7P B;  4PS8 A;  1JRP A;  3VH4 B;  1GC6 A;  2RD0 A;  2FCN A;  4ZRJ A;  2N4F A;  4C56 C;  2C9W B;  1VCB A;  1SE3 A;  4XYC A;  2JT4 B;  2H89 B;  2IYD B;  2PVG C;  4II3 B;  1ET9 A;  1E9M A;  1TKY A;  4KIK B;  1N63 A;  2GMI C;  4ZRK A;  2WXJ A;  3NY5 A;  1ET6 A;  3LXF A;  2JSV X;  3WA0 A;  2AL6 A;  4CHK A;  1P1A A;  4W9E A;  2KNB A;  4EUT A;  2YEP B;  3FIL B;  3L4P A;  3BZD B;  1WR6 E;  3DBR I;  4MEM A;  2LXC A;  1SXT A;  4OHJ A;  3DVN V;  1JW9 D;  5G5H A;  2BS3 B;  2DYM A;  2K5P A;  3DBH I;  4DHZ B;  2JXX A;  4AJY B;  1I4H A;  4ZYN A;  3ZRC A;  2I38 A;  3GS2 A;  1ZE3 D;  3NVV A;  1Y8R C;  5J2R A;  2V4L A;  1V86 A;  2QJL A;  3X0W A;  3VR8 B;  4WWO A;  4MGY E;  1HQR D;  3NVY A;  1V9J A;  1E90 A;  2MW5 A;  3B2F A;  2RR9 A;  4YL8 A;  3I5J C;  2KMC A;  4N59 A;  5AZH A;  4A9A A;  1TKG A;  1ZDV A;  1F77 A;  4WJQ A;  4F1S A;  3A1Q A;  4GDL B;  2GRI A;  2JVC A;  1J19 A;  4NJ7 A;  1FNW A;  3B9J A;  1P98 A;  3JSV A;  3NS1 A;  3DBS A;  3W5V B;  1J0G A;  2O2V A;  1D5X C;  1P7F A;  4NJC A;  3M95 A;  3FIL A;  4IWQ A;  3UQA A;  2X8X X;  2IO2 B;  1DOY A;  1WF9 A;  4II2 B;  2KVR A;  2KD0 A;  4LNN A;  3W1S A;  4B9K A;  4XE0 A;  1JWB D;  3PRE A;  1DOX A;  1WGR A;  1KF6 B;  3CF6 E;  2BYT A;  5I4D A;  2E3T A;  3P1M A;  2ASQ A;  1J7B A;  5JHA A;  5JH5 C;  4KGT A;  2FID A;  2IZV B;  3AXC A;  2PE6 B;  4HWI B;  3WAL A;  1SE2 A;  2PPH A;  4DQO C;  5BMG A;  1FEH A;  4BKS A;  2Y5P A;  1V1P B;  3TEZ A;  2LUM A;  1P9D U;  2INP E;  3JVZ X;  3TSS A;  2LHD A;  4IKG A;  3VUY A;  3BK2 A;  4L2Y A;  2LXA A;  4HLE A;  1RRB A;  4NPN A;  2BYE A;  1FXA A;  3PV1 A;  3KYD D;  4R3D A;  4S0R A;  3TL5 A;  1BUI C;  1MHH E;  5HI1 A;  4XDC A;  3U4E G;  4XWW A;  5EDS A;  3PO0 A;  3R2T A;  4RM9 A;  2DZK A;  4I6P A;  1U4A A;  1OQY A;  4WH4 A;  4N9F 4;  1FD6 A;  1EWC A;  1WXS A;  1XQQ A;  5CHV C;  1Q5W B;  3AM9 A;  2HTM E;  2FE8 A;  1EM7 A;  3R66 C;  4BKG A;  3HM6 X;  3O65 B;  2AEH A;  2W55 A;  1OGW A;  3NZ3 A;  3WAP A;  4GDL A;  1D3Z A;  2IY0 B;  2KAC A;  3DQV A;  4WJP A;  1RFA A;  4AJW A;  2KZR A;  3ZQ4 A;  4PT5 A;  3P42 A;  3MJ5 A;  1E10 A;  3SHQ A;  3APC A;  3DPD A;  4FHK A;  3ZO5 B;  1F9J A;  1D5M C;  3BYY B;  3GZN B;  3A9K A;  4HRS A;  2WNM A;  2BKR B;  2PKO A;  3W5U B;  4P16 A;  2JRI B;  2MJE A;  2BWE S;  1C1Y B;  3Q3M C;  5J18 A;  3ZTC A;  4GB9 A;  1VR9 A;  4OVV A;  2WXN A;  3I57 A;  4C4V A;  3TBL D;  2AQ3 B;  4JWS C;  5BYR A;  3ENE A;  1QF6 A;  1YNT E;  4DXF A;  2KX3 A;  1KLV A;  1L4Z B;  3J9C A;  2V0G A;  2O6V D;  3MP9 A;  3IHP C;  4JIO U;  2KAN A;  3FC4 A;  4W9H A;  3RNA C;  2MP2 B;  3OG5 A;  4EE2 A;  4L23 A;  3PRM B;  3KLS X;  1HZ6 A;  5KHQ A;  3PGE A;  2RSU A;  2CHX A;  2SEB D;  2J0M A;  2JPH A;  2LFI A;  1MPE A;  2MJ3 A;  2V3S A;  2WXK A;  2MHJ A;  4JE3 B;  4RH6 A;  4ICU A;  2ZPY A;  4RM8 A;  4W9J A;  3VAW A;  4FJV B;  2WX1 A;  3C8Y A;  4G3X B;  2CU3 A;  5IAA C;  2BB5 A;  3K9P B;  4MM3 B;  2BWF A;  2LVQ A;  3BYT B;  4I6L B;  3NZU A;  3SFE B;  1UWX A;  4B95 A;  3KUC B;  2JRH A;  3RI7 C;  4DK5 A;  3EC8 A;  3NVW A;  4XZ4 A;  4DHZ E;  4W9C A;  2GBJ A;  1TS4 A;  2RPV A;  1JCK B;  4A3O A;  4DDI D;  2JF5 A;  2GI9 A;  1WJU A;  1SGH A;  1BML C;  4ICV A;  4GLS C;  3RNF C;  3VXW A;  3AB5 A;  2KLC A;  1WH3 A;  2YLM A;  4WUR A;  3L10 B;  2J0K A;  4MH0 E;  3E9S A;  4AOF A;  1SIJ A;  3ML8 A;  1UH6 A;  4TUU A;  1FXT B;  2KO3 A;  2FCS A;  2GBM A;  3GE8 C;  5DPS A;  3N1Y C;  1K52 A;  2Y5B B;  5L83 A;  3QWZ B;  2N9K A;  3BVG A;  2GBK A;  1C4P A;  3GZN I;  3DWM A;  1WJN A;  3U2S C;  1F0Z A;  3NUH B;  4ANW A;  1AYF A;  4IM0 A;  4YTN B;  3L16 A;  1SF0 A;  1YOV B;  4KGR A;  4E3C A;  1TYG B;  2VRR B;  2BF8 B;  2W9N A;  3N32 A;  2Y3A A;  2N7D A;  4IM3 A;  1PGB A;  4GOC A;  3SDL C;  4EFO A;  1SJE D;  3WAN A;  2LGX A;  2K6D B;  1ZKH A;  2KTR A;  4NJ6 A;  2NBV B;  3PPA A;  2WXL A;  3RZF A;  1OQR A;  2V9H A;  5D7G A;  1B9R A;  4XC2 A;  4G11 A;  2DHZ A;  3AEB B;  4B6W A;  3U52 E;  1FXI A;  1WR1 A;  2NBU A;  1T6B X;  1WXV A;  3SEB A;  2JX5 A;  2XNA C;  2C5L C;  3PRP B;  3RNE C;  2L0F A;  2L00 B;  2WXG A;  4HDQ A;  2IO1 B;  1PGX A;  1YJ1 A;  2MJD A;  3IXS A;  2N1V A;  4GDK A;  2EKE C;  2W82 A;  3BIN A;  3HIZ A;  1H4R A;  1RWS A;  2JUO A;  4RGO S;  1V97 A;  2WDR B;  1KM7 A;  4RGN A;  1TKE A;  1I7H A;  2BYF A;  4D2K A;  2IND C;  2XK5 B;  1IGD A;  4HPM B;  3N1Z C;  4RGM A;  1WI0 A;  3UQB A;  1I4X A;  4JPS A;  1LGR A;  3KW5 B;  4MGZ E;  1JWM D;  1UWM A;  2KYW A;  3ZRF A;  3LYY A;  1GC7 A;  1QQR A;  2JYE A;  2UU7 A;  2NBW B;  1FPY A;  3ZW3 A;  4GN1 A;  1ZW7 A;  1UUP A;  2KWU B;  2PE9 A;  3L13 A;  3D32 A;  1QT9 A;  2M4N A;  4HCP B;  1QLB B;  1I35 A;  4M00 A;  2KFJ A;  3W1Y A;  3VFK A;  2NCN A;  2FIF A;  2NS5 A;  1FRD A;  1AW7 A;  2KXJ A;  1WM2 A;  1ENF A;  2N9P C;  4YSZ B;  3EEC A;  3VTV A;  2ZEQ A;  4TSS A;  1WE6 A;  1WRI A;  3KVF B;  1NI2 A;  2RGF A;  1L2N A;  2WDQ B;  2PW9 A;  1MG4 A;  3BVM A;  1SE4 A;  1QOB A;  3UIN B;  4W9F A;  3PZ7 A;  5BMI A;  1D6E C;  2MA9 B;  4Q2J A;  2ZW1 A;  4US9 A;  4JGH B;  1GB1 A;  1ZDX A;  4PS3 A;  2JU6 X;  1R4M B;  2GBR A;  2A5U A;  2KAJ A;  4B0M A;  3TEW A;  4QAY A;  2RDG A;  1CZP A;  4O1N A;  4XX5 A;  4TV3 A;  4PS7 A;  2WDT B;  1GB4 A;  1ZUD 2;  3MHZ A;  3EHV A;  3UIO B;  3H9D A;  3DHI C;  4LK0 M;  3W1S C;  4BBN C;  4REZ A;  2XBB C;  1I4G A;  3HHM A;  1G6J A;  3MC0 B;  2HJ1 A;  1UF0 A;  4CO7 A;  1CJE A;  2EMT A;  3V05 A;  3TEY A;  3DBH B;  3ZXR A;  2KKC A;  2TSS A;  3Q2A C;  4ZOH C;  1P7E A;  1FFV A;  1JWA D;  1TS5 A;  1WY8 A;  2KWD A;  4LNI A;  1QIL A;  3P63 A;  3IT4 B;  2V3N A;  1N60 A;  4US8 A;  2K3U A;  2J53 A;  3PLU A;  1ZXI A;  3DDC B;  3FAH A;  1E8W A;  2RDB C;  2MWS B;  2OJW A;  2KMA A;  4BZA A;  1TIF A;  4A6Q A;  2QSD A;  2J42 A;  4WWN A;  1WM3 A;  2M56 B;  4NZL B;  4P6V F;  3PHW B;  1LXD A;  2D3A A;  2BW2 A;  3RD2 A;  1KOT A;  1WWT A;  3ECI A;  1IBX B;  4IDI A;  1I4P A;  4LCD E;  2K6Q A;  1F2R C;  3QAR A;  3ZDM C;  5H92 C;  4GU2 A;  3R7Q A;  1MVK A;  3AE5 B;  4PYZ A;  3KWL A;  2QCZ A;  2MLB A;  5H8Y E;  2LGY A;  2E6X A;  2RMM A;  1Q10 A;  4MAC A;  3SU8 X;  2KC2 A;  4ZRP A;  3P4R B;  1D5Z C;  1MHX A;  3PS6 A;  1YN3 A;  4GSW A;  1CQV A;  3PZD A;  1ZPS A;  2NVU I;  1VZ7 A;  3QHT A;  4NQK E;  2KX0 A;  1PUT A;  3S2A A;  3APD A;  4KKJ A;  5DPT A;  2M17 A;  2KHW B;  5HG2 A;  5LNK 1;  2WGS A;  3TEX A;  2ICI A;  2EMS A;  3ZKJ C;  1N6Z A;  1PQS A;  2IY1 B;  2LJI A;  3ZGZ A;  3GB1 A;  1F2R I;  4HVB A;  2LRU A;  3R2I A;  2B76 B;  5JHB A;  2WXF A;  1YD8 U;  4HDO A;  3X23 A;  1I42 A;  2IJ0 A;  2FUH B;  5IP4 D;  2ZVO A;  3BII D;  2L8J A;  2D3G A;  1WIA A;  3HUI A;  2JWU A;  2M0X A;  5EE3 A;  2K8H A;  4BVU C;  4USA A;  5FR3 A;  3Q69 A;  1HZ5 A;  2QEJ C;  2LGD A;  5IKC M;  2K22 A;  1V1P A;  2W3R A;  1WRD B;  4FN2 A;  3P4P B;  3I63 C;  1NEK B;  2NMQ A;  1GG3 A;  4DHJ D;  1WGY A;  2G45 B;  5C23 A;  3ZIM A;  2IDY A;  2QC8 A;  4E74 A;  4HXD A;  1MG8 A;  4M01 A;  3T3N A;  3SD5 A;  5EE0 A;  1KLG D;  5LXI B;  3RFZ B;  1UEL A;  2BTE A;  3MTN B;  2D2Q A;  1GAQ B;  4RF1 A;  4IG7 B;  3H8H A;  3MJW A;  1K50 A;  3TIX A;  1WGD A;  3R3M A;  4EZK A;  2WU2 B;  3N3K B;  1YN4 A;  4IUM B;  4IWP A;  4GDK B;  4F7Z A;  1L7Y A;  3NRZ A;  1EWY C;  1GUA B;  2CKH B;  2KDF B;  2R2Q A;  1BXT A;  4FXC A;  3EGR A;  4RCO A;  4X57 B;  2OOB B;  1UNS A;  2KFK B;  2LAS A;  2FNJ B;  3AU5 A;  4KZ0 A;  2AYO B;  4K81 A;  3QIJ A;  4HK2 A;  3T3O A;  3RT3 B;  2W54 A;  1E7U A;  3DWG C;  1QOF A;  2QIE B;  3U7D A;  3NZS A;  1OEY A;  4RF0 A;  2K1F A;  1KRH A;  1SE9 A;  3DHG C;  2JZP A;  1VZ6 A;  2IGG A;  4MGI E;  2DZM A;  4YSY B;  1NVI D;  4OZC A;  3AE7 B;  1J7A A;  2R2O A;  3Q8E A;  4M8N A;  2M1M A;  2IBI B;  4C00 A;  1UZX B;  2UWQ A;  4S17 A;  2OJR A;  4ANX A;  5JZE B;  1FIQ A;  1Z5S B;  2IGD A;  2KQ7 A;  2WYQ A;  4KV2 A;  4LJO B;  3Q3N C;  2EEL A;  1SSN A;  1Z2M A;  3QX1 A;  2LEK A;  5GXG B;  1S1Q B;  3AU4 A;  4F8C B;  3TMP B;  4TQ1 A;  4YT0 B;  1MI0 A;  2Z59 B;  3V60 A;  4IM2 A;  3OWE B;  2WS3 B;  4LDT D;  2NTT A;  3W9C B;  2QHO A;  3PTF C;  3E56 A;  2D3B A;  2ZW0 A;  3ABV B;  2BS4 B;  1Q0W B;  1V8C A;  3ZDT A;  3P4Q B;  1XXG A;  2NTS A;  1WFY A;  2GLS A;  3LJ3 A;  1I4Q A;  2L83 A;  4WWP A;  4EOY A;  3NVZ A;  4HPL B;  1WYW B;  3KYC D;  4JLC A;  4NAW B;  2ZVN A;  1P0R A;  1VZ8 A;  4XGA B;  2LJ5 A;  3AV8 A;  1YJJ A;  4W9K A;  2K0P A;  3U30 A;  2GBN A;  2MRP A;  2LMC A;  2CHZ A;  2KVZ A;  1C4C A;  4KSK C;  1WJ6 A;  2ZCB A;  4DWF A;  1ZXH A;  1NYQ A;  1NYR A;  2KWV B;  4BBN F;  1V80 A;  3O13 A;  2K25 A;  5EE1 A;  5D3I B;  1XD3 B;  2R61 A;  3H7P A;  1NBF C;  4E71 A;  1UD7 A;  1MFW A;  1HE8 A;  4MT5 A;  4BKS D;  3QJZ A;  2RDH A;  3DVG X;  3Q3J A;  3EFC A;  4ZYS A;  3GP7 A;  4K7S A;  4OVU A;  2A4Z A;  1FMA D;  2O2V B;  1T0Q C;  1T0S C;  5C1Z A;  2XEW A;  3N30 A;  1YMH E;  1NI3 A;  4NNJ B;  3GE3 C;  4A8X C;  1VLB A;  1LFD A;  4FBJ B;  3OJ3 A;  5HFY A;  2CJN A;  4HKQ A;  1WX9 A;  3OLM D;  1FCL A;  1NDD A;  1EF5 A;  2DNF A;  4XWT A;  3AEE B;  1H8C A;  2O6V A;  2PIA A;  1V5O A;  3EUB 2;  2KQ4 X;  1TGZ B;  2FCM A;  5AEK B;  1L0X B;  4DHJ B;  4XDD A;  2KMM A;  4YXD B;  3L54 A;  5FKA C;  2K8B A;  3QK0 A;  4HCN B;  1L6V A;  4FJZ A;  2WXO A;  4KGS A;  3AE2 B;  4DBG A;  5MPO A;  4RFB A;  1L4D B;  2KWC A;  4MSM B;  3VUX A;  4RGT A;  4KZC A;  1R4N B;  4TQ0 A;  2L76 A;  3I3T B;  4AS1 A;  3NHE B;  2CHW A;  1KLU D;  2VZK D;  2REX A;  3I9V 1;  3V61 A;  5DPR A;  2MBB B;  4BFR A;  4W9G A;  1YQ3 B;  3ZNH B;  1VD2 A;  2BQQ A;  3GOE A;  3AI5 A;  3EFU A;  1Q1O A;  4KX6 B;  4GXB A;  4P1C C;  5DPW A;  5D6J B;  3ZJT A;  3AE1 B;  2DYB A;  2LRW A;  3V6E B;  2WDV B;  3RN9 C;  3RNB C;  4JQW C;  4FUL A;  2LGS A;  2MBH A;  2AWT A;  1E8X A;  4GIV A;  4HEA 1;  5HKH A;  4YTP B;  5BYQ A;  5EE9 A;  3A9J B;  4ZHO A;  1E6E B;  1L5P A;  3DVG Y;  1STE A;  4BAX A;  1K53 A;  4A55 A;  1RAX A;  3T9L A;  3OJ4 B;  3Q3O C;  3H7P B;  1YJI A;  2Z0E B;  3KWV A;  3M62 B;  1V5T A;  4NQL B;  4K3B A;  2M0A A;  2WXH A;  3L0W B;  3U7Z A;  1C3T A;  4A3P A;  4HPP A;  4MSQ B;  3QCA A;  1QOA A;  2VH1 A;  2N9X A;  1RYJ A;  3PHX B;  2LGI A;  3W2D A;  3UIP B;  4MM3 A;  1IYF A;  2C60 A;  3VTU A;  1DGJ A;  1E8Y A;  2ZNV B;  4TMA B;  1WX7 A;  1I4R A;  1IPG A;  1IP9 A;  2KLG A;  4CYE A;  2ZPN A;  4IOI E;  2JXT A;  4MH8 A;  5E6N A;  1PFD A;  3P2B A;  2ACZ B;  3WAM A;  2W3S A;  2MBE A;  3K9O B;  1AN8 A;  4MDK E;  2OHF A;  3NG0 A;  1TZ1 A;  1WE7 A;  2BB6 A;  1HTQ A;  3KUZ A;  1C76 A;  1VRA B;  1KJT A;  3N20 C;  1OTR B;  4B0E A;  1FRR A;  2KDE B;  2INC C;  3QAQ A;  5DCN A;  3AUL A;  1FCC C;  5IOI A;  2KK8 A;  1V1O A;  1TT5 B;  4LNO A;  2G3Q B;  5AZG A;  2XN9 C;  2M19 A;  2I2Y A;  1XLP A;  1ACC A;  1WMH B;  3UF8 A;  1FNU A;  3EA6 A;  1B1Z A;  3Q8F A;  4PK1 A;  4N58 A;  1TTN A;  3IAS 1;  2BPS A;  4J3O D;  4M02 A;  1TY0 A;  1WJ4 A;  4GGQ A;  3IT6 B;  3M63 B;  3ZJU A;  4MJS A;  1YQ4 B;  4DDG D;  1FO4 A;  3VRB B;  4FAD A;  2WWZ A;  2B3A A;  4WIP A;  2G1E A;  1N5X A;  3C19 A;  3CST A;  3PT2 B;  1K51 A;  2I1K A;  1ESF A;  5D94 A;  1QKZ A;  3DHH C;  1V81 A;  1QOG A;  2ZJD A;  2LVO A;  2JZZ A;  3JW0 X;  2WXQ A;  2Z0D B;  5E6J A;  1WXM A;  2G4D B;  3CMM B;  4K1R B;  4IW0 A;  2K39 A;  1F52 A;  3RNG C;  3Q8C A;  2M8S A;  2HD5 B;  3RMK C;  2WXR A;  2N7J A;  4BOZ B;  1IBX A;  1RFK A;  4KVG B;  3ZNI D;  2D11 A;  2KDI A;  3LB8 C;  2HE7 A;  4HJK A;  1GJZ A;  1VJK A;  5BMH A;  1Y56 A;  2WLB A;  2JWZ A;  5C3J B;  1YX5 B;  2BBC A;  2LZ6 A;  3Q8A A;  4LLG M;  2AX5 A;  4EZJ A;  4FA6 A;  5BYS A;  4ASW C;  1XCQ L;  3SFD B;  1L6U A;  1YIW A;  2DWQ A;  4J6I A;  3FKY A;  4A20 A;  1WGK A;  3QA8 A;  1E7V A;  3IAM 1;  3C0R B;  4C7Z A;  3N9Y C;  3RZW C;  1WXA A;  1HXY D;  1N5W A;  1TZO A;  4OW0 A;  1EF1 A;  2D5G A;  3CIR B;  4KIK A;  3BY4 B;  4OZB A;  5AUK A;  4M8M A;  1V6E A;  2ZZP B;  1AWD A;  3RPF C;  2WU5 B;  3AE6 B;  1JRU A;  2KTF A;  3KH0 A;  2LI5 A;  3AE9 B;  4YSX B;  2LD9 A;  2MX2 A;  1WMH A;  2PEA A;  2H88 B;  4ARC A;  4WJO A;  2PMV A;  1ISN A;  1LM8 B;  1BT0 A;  3ETR A;  4WAA A;  3H6N A;  4ARI A;  1HEZ E;  3DBL I;  1FFU A;  4PYU A;  2ZNV C;  2MP2 A;  3AEC B;  2KQS A;  3PLV A;  4DXA B;  4G50 A;  4ANU A;  1PGA A;  4JWU C;  2DAF A;  2KOX A;  1CK1 A;  2N9L A;  5AZF A;  2DAJ A;  3IBE A;  2N0S B;  3WIM A;  2O6V B;  1M4V A;  4ZRI A;  1UBI A;  1R7S A;  1UGJ A;  2L0T A;  2G9H D;  4WQO B;  2WXM A;  3APF A;  3VVW B;  4BKT A;  3RYT A;  2PTL A;  3Q14 C;  3VDZ A;  3L17 A;  2AQ1 B;  3KQ4 A;  2K9X A;  4C7Y A;  3A1Q B;  2L7R A;  4N6E B;  5FK9 C;  2JQR B;  2BYV E;  2Q5W D;  4IC7 B;  2NPT B;  3WAO A;  1L0Y B;  3ZYY X;  3A9J A;  3MHS D;  3QQ8 B;  4ZHP A;  2PJH A;  1J7C A;  4OZA A;  4A90 A;  1GNU A;  2ZCC A;  5HHD G;  3MC8 A;  1FM0 D;  4IWO A;  3Q6B A;  5L95 C;  3AED B;  3ALB A;  4K7U A;  5C2T B;  4M0W B;  2LUE A;  5AUI A;  2WX0 A;  3KUD B;  3MC9 A;  3RUL A;  4C80 A;  2HDE A;  3AN1 A;  2JZ3 B;  3VTW A;  1EU3 A;  4ZDV A;  2CS4 A;  3DVN U;  4EZL A;  1QZE A;  4HRO A;  1SIF A;  2BS2 B;  4UDU C;  2J7Q B;  1XO3 A;  3B08 A;  1JML A;  2KC1 A;  1JRO A;  5G2N A;  3TJP A;  5CHF A;  5BO4 B;  3T8M A;  4P1B C;  3ZJV A;  5G5G A;  1SB3 C;  2Y5C A;  4WJN A;  3IVF A;  4NY0 A;  2L1A A;  2KN4 A;  5IA7 A;  3NS8 A;  2WXP A;  3CSF A;  2VH2 A;  3VR9 B;  3AE3 B;  1X1M A;  4G0N B;  2BT6 A;  2MH7 A;  2KN5 A;  1E0Z A;  1WXQ A;  5D3D A;  5IN7 A;  3BVZ A;  4P7I A;  2BVC A;  2MEK A;  1JWS D;  3NOB A;  1TS2 A;  4L1B A;  3IG3 A;  2EKI A;  3Q3F A;  2KTR B;  4ACF A;  3DBL B;  3HVD A;  3HK0 A;  2WQY B;  2ONQ A;  1WYG A;  2WXI A;  4CQN A;  1E8Z A;  2DYO A;  2NPT A;  3AEG B;  3LDZ E;  3CWI A;  1IGC A;  1YN5 A;  2MBO A;  2V4I B;  1L0V B;  2C7H A;  2MSE D;  1T3Q A;  1JWU D;  3AE4 B;  4RNA A;  3VHT C;  2V3P A;  5CTR C;  2LWP A;  3BK1 A;  1N62 A;  4YTM B;  3N1X C;  2V1Y A;  5FR6 A;  1OEY J;  1OQQ A;  2DEN B;  2ON8 A;  1T5X D;  1KTK A;  3Q8B A;  5GMV A;  1M94 A;  4MJS B;  2XK5 A;  1EU4 A;  2N7E A;  2MCN B;  2DX5 B;  1WZ3 A;  4LJP B;  3DOW A;  3V62 A;  3L08 A;  4KDI C;  1C77 A;  1ZOY B;  2QDF A;  1R4M I;  3QC8 B;  3B1L X;  3ML9 A;  3ZXV A;  2D10 A;  3ZUN A;  2BGF A;  1SEB D;  2LVP A;  1K8R B;  3RUI B;  3IFW B;  1IUE A;  5KHO A;  3M3J A;  3AH7 A;  2Z8L A;  1XLN A;  2INN E;  1ZP0 B;  1XLO A;  3ONS A;  2AQ2 B;  3R7R A;  1FNV A;  5IO9 A;  1A5R A;  2L52 A;  3BWU D;  2N1W A;  1PYW D;  4K7W A;  1RM6 C;  4TKN A;  2CJO A;  2DLB A;  2D3C A;  2IPK D;  4AUQ C;  4AP4 C;  2DZJ A;  1XLQ A;  3UGB B;  2FUG 1;  4ANV A;  4GMV A;  3UI3 A;  2C7N B;  3V3X A;  1JQ4 A;  3JYU A;  2YVC A;  3DBR B;  1EO6 A;  1T0R C;  2FCQ A;  2IGH A;  3JSV B;  5T8I A;  4FLH A;  3PVL A;  3NJT A;  1SBB B;  1HTO A;  1AAR A;  2BKF A;  4OVZ A;  5J17 A;  3A33 B;  3MFG A;  1LO5 D;  4FJY A;  3H1U A;  2L05 A;  3H7S A;  4KKI A;  2RPQ A;  1V49 A;  5LXH A;  1KH0 A;  2GOW A;  1HA5 A;  3URY A;  2WHI A;  2G4S A;  3VRA B;  3A4R A;  5CX3 A;  3ZNZ B;  3VH3 B;  3ZTD A;  1C9F A;  1WX8 A;  4MEL A;  2CR5 A;  2K8C A;  4AWJ A;  4LNF A;  2KDM A;  3ZNG C;  1WGG A;  4HJG E;  5CHW A;  2QIL A;  1WGH A;  1F1H A;  1UBQ A;  1YX6 B;  4WWM A;  3PSE B;  4K3C A;  5G55 A;  2KT7 A;  3TCA A;  5D2M B;  4MGK E;  4WQM A;  2C7M B;  1TY2 A;  1MJD A;  5E6P A;  3RCZ A;  2GB1 A;  3P4S B;  3HRD D;  1LQB A;  1J8C A;  2J4X A;  4LTU A;  1PDX A;  1TBE A;  2FAZ A;  1EUV B;  3A4S C;  3DCG A;  1CMX B;  1TS3 A;  1C78 A;  2MBQ A;  1NEN B;  3B2G A;  3ZVV A;  2KJH B;  2JYT A;  4KDL B;  4NAW A;  2PLP A;  2AL3 A;  2MQJ A;  1V2Y A;  4NAM A;  1C4A A;  1P3Q U;  1JAL A;  1RLF A;  2QMT A;  3U8Z A;  2PVO D;  2CU1 A;  1A70 A;  4DXG A;  3A9K B;  3WCQ A;  2HTH A;  3V6C B;  3PZ8 A;  4JX1 C;  4KSL C;  4W9D A;  2YEP F;  3SR6 A;  2VZK B;  2LHE A;  1ROE A;  3TUO A;  2OED A;  4M0W A;  4YWG G;  3VQI A;  4URK A;  2I1J A;  5TSS A;  2J52 A;  4RMA A;  3VUW A;  3ZLZ A;  5LLI A;  1WZ0 A;  2D07 B;  1D4B A;  2HJ8 A;  5JXV A;  4W9I A;  2KJR A;  1R4N I;  3PRZ A;  2FBW B;  4FHJ A;  3AEA B;  1XT9 B;  4HKZ E;  1YQB A;  4AQ7 A;  1KFY B;  2IO3 B; 
#chains in the Genus database with same CATH homology
 1MI0 A;  3NUH B;  1AWD A;  3OWE B;  2X38 A;  1GPX A;  2WS3 B;  2WU5 B;  3RPF C;  3AE6 B;  1AYF A;  2NTT A;  1TJE A;  4YTN B;  3W9C B;  3E56 A;  1SF0 A;  3R8B A;  1WSP A;  4KGR A;  2ZW0 A;  3AE9 B;  3ABV B;  1TYG B;  4YSX B;  1XF5 L;  2BS4 B;  1V8C A;  1XCT L;  3P4Q B;  2Y3A A;  1XXG A;  2H88 B;  2NTS A;  4ARC A;  2PMV A;  1PGB A;  3ETR A;  1SJE D;  1I4Q A;  1OFF A;  4ARI A;  1HEZ E;  2L83 A;  4H2A A;  1FFU A;  1VDV A;  3AE8 B;  3AEC B;  2L32 A;  1N61 A;  3NVZ A;  1DOI A;  2DBY A;  3AEF B;  1PGA A;  4JWU C;  4NAW B;  1CK1 A;  1XEE A;  2N9L A;  2WXL A;  1OQR A;  1DYQ A;  1VZ8 A;  3AMZ A;  3AV8 A;  1YJJ A;  1SJH D;  5D7G A;  4ZRQ A;  1B9R A;  2K0P A;  2N0S B;  4ITK A;  1C79 A;  3AEB B;  2LMC A;  1M4V A;  2SAK A;  1GOZ A;  1C4C A;  2WP9 B;  3U52 E;  1FXI A;  4WAF A;  3HVZ A;  1E7P B;  1R7S A;  1T6B X;  1JRP A;  1ZXH A;  1NYQ A;  3SEB A;  1NYR A;  2JX5 A;  1UGJ A;  2XNA C;  4C56 C;  2G9H D;  1SE3 A;  2WXM A;  2WXG A;  2PTL A;  2H89 B;  2PVG C;  3O13 A;  1PGX A;  5EE1 A;  5D3I B;  1ET9 A;  1E9M A;  2AQ1 B;  2MJD A;  3IXS A;  3KQ4 A;  2K9X A;  4C7Y A;  1TKY A;  2W82 A;  2R61 A;  1N63 A;  2WXJ A;  4N6E B;  5FK9 C;  1RWS A;  2JQR B;  1ET6 A;  2Q5W D;  3LXF A;  4RGO S;  1V97 A;  1L0Y B;  2WDR B;  3ZYY X;  4RGN A;  2JSV X;  4MT5 A;  1TKE A;  4ZHP A;  1I7H A;  2RDH A;  1J7C A;  4ZYS A;  4OZA A;  4A90 A;  3GP7 A;  4D2K A;  5HHD G;  1FMA D;  1FM0 D;  1IGD A;  2YEP B;  3AED B;  3FIL B;  4RGM A;  3L4P A;  1I4X A;  4JPS A;  5C2T B;  1YMH E;  3BZD B;  1JWM D;  1NI3 A;  1UWM A;  4A8X C;  3LYY A;  1SXT A;  1VLB A;  5AUI A;  1QQR A;  2JYE A;  4OHJ A;  4C80 A;  2HDE A;  1JW9 D;  5HFY A;  3AN1 A;  2CJN A;  5G5H A;  1UUP A;  1EU3 A;  2BS3 B;  2DYM A;  2K5P A;  4HKQ A;  1FCL A;  1QT9 A;  4HRO A;  1QLB B;  2BS2 B;  4UDU C;  1XO3 A;  1I4H A;  1JML A;  4XWT A;  1JRO A;  3AEE B;  2I38 A;  3GS2 A;  1ZE3 D;  3NVV A;  2PIA A;  3ZJV A;  5G5G A;  1FRD A;  3EUB 2;  1AW7 A;  1SB3 C;  2KQ4 X;  2Y5C A;  1ENF A;  2QJL A;  2L1A A;  2KN4 A;  1L0X B;  4YSZ B;  3VR8 B;  4XDD A;  2KMM A;  4YXD B;  2WXP A;  5FKA C;  1L6V A;  1HQR D;  3NVY A;  4TSS A;  3VR9 B;  1WRI A;  2WXO A;  3AE3 B;  3B2F A;  4KGS A;  2BT6 A;  2MH7 A;  3AE2 B;  4N59 A;  2WDQ B;  5MPO A;  2PW9 A;  1E0Z A;  4RFB A;  1WXQ A;  1L4D B;  1SE4 A;  3BVM A;  5D3D A;  1QOB A;  4A9A A;  1TKG A;  3BVZ A;  1ZDV A;  1F77 A;  2MEK A;  4RGT A;  3PZ7 A;  5BMI A;  1D6E C;  1JWS D;  2ZW1 A;  4Q2J A;  4TQ0 A;  4GDL B;  4US9 A;  1GB1 A;  1ZDX A;  2GRI A;  1TS2 A;  2JU6 X;  1FNW A;  4AS1 A;  4L1B A;  2KAJ A;  2VZK D;  1KLU D;  3B9J A;  4B0M A;  2EKI A;  3TEW A;  2RDG A;  1CZP A;  3I9V 1;  4O1N A;  3NS1 A;  1GB4 A;  3HVD A;  1ZUD 2;  3W5V B;  3MHZ A;  1D5X C;  2WQY B;  1YQ3 B;  2ONQ A;  1P7F A;  4NJC A;  1WYG A;  3FIL A;  4LK0 M;  1DOY A;  2WXI A;  4CQN A;  4REZ A;  2DYO A;  3AEG B;  3W1S A;  3CWI A;  1I4G A;  4KX6 B;  4XE0 A;  1JWB D;  3MC0 B;  1DOX A;  1IGC A;  1YN5 A;  1CJE A;  1KF6 B;  3ZJT A;  3AE1 B;  2V4I B;  2BYT A;  5I4D A;  1L0V B;  2E3T A;  3P1M A;  1J7B A;  3V05 A;  3TEY A;  4KGT A;  1T3Q A;  2TSS A;  1JWU D;  2WDV B;  3AE4 B;  4RNA A;  1P7E A;  4ZOH C;  1FFV A;  1JWA D;  1SE2 A;  1TS5 A;  2KWD A;  1QIL A;  3P63 A;  2V3P A;  3IT4 B;  1FEH A;  2V3N A;  5BMG A;  2Y5P A;  1N62 A;  1V1P B;  1N60 A;  3BK1 A;  3TEZ A;  4YTM B;  4US8 A;  4HEA 1;  1OQQ A;  2LUM A;  2K3U A;  2J53 A;  2INP E;  1ZXI A;  4YTP B;  3TSS A;  5BYQ A;  2ON8 A;  5EE9 A;  1T5X D;  1KTK A;  2LHD A;  3Q8B A;  4ZHO A;  1E6E B;  1L5P A;  3FAH A;  4IKG A;  1STE A;  3BK2 A;  1K53 A;  4L2Y A;  4A55 A;  1EU4 A;  1FXA A;  4R3D A;  1YJI A;  3KWV A;  4A6Q A;  2QSD A;  2J42 A;  1BUI C;  1MHH E;  2M0A A;  2WXH A;  2M56 B;  4NZL B;  5HI1 A;  1C77 A;  4XDC A;  3U4E G;  4XWW A;  4P6V F;  1ZOY B;  2BW2 A;  3PO0 A;  3U7Z A;  1WWT A;  1IBX B;  4IDI A;  1QOA A;  3R2T A;  1F0Z A;  1I4P A;  1F2R C;  1RYJ A;  5H92 C;  1MVK A;  3AE5 B;  3KWL A;  1SEB D;  5H8Y E;  2E6X A;  2LGI A;  2RMM A;  1Q10 A;  4MAC A;  1IUE A;  3W2D A;  3AH7 A;  2Z8L A;  1XLN A;  2INN E;  4WH4 A;  1ZP0 B;  1FD6 A;  1XLO A;  1EWC A;  2AQ2 B;  4ZRP A;  1DGJ A;  3P4R B;  1FNV A;  1D5Z C;  1MHX A;  1YN3 A;  2L52 A;  3AM9 A;  4TMA B;  1CQV A;  3BWU D;  2HTM E;  1ZPS A;  1PYW D;  2FE8 A;  1I4R A;  1RM6 C;  2CJO A;  1VZ7 A;  2DLB A;  1EM7 A;  2IPK D;  1PUT A;  2W55 A;  1XLQ A;  4IOI E;  3NZ3 A;  2JXT A;  4MH8 A;  1PFD A;  2ACZ B;  2FUG 1;  4KKJ A;  2KAC A;  3UI3 A;  2W3S A;  3V3X A;  1JQ4 A;  5HG2 A;  5LNK 1;  3TEX A;  1AN8 A;  3ZQ4 A;  2IGH A;  4PT5 A;  2ICI A;  3P42 A;  3MJ5 A;  2OHF A;  1E10 A;  2BB6 A;  5T8I A;  1C76 A;  1VRA B;  2LJI A;  3ZGZ A;  3GB1 A;  1F2R I;  4B0E A;  1SBB B;  1FRR A;  3R2I A;  2B76 B;  4OVZ A;  2WXF A;  3MFG A;  1D5M C;  3BYY B;  1FCC C;  1LO5 D;  2IJ0 A;  4HRS A;  2WNM A;  2PKO A;  1V1O A;  3BII D;  4KKI A;  3W5U B;  4P16 A;  3HUI A;  2MJE A;  2XN9 C;  2M19 A;  2I2Y A;  2JWU A;  1XLP A;  1ACC A;  1KH0 A;  1HA5 A;  3URY A;  5EE3 A;  1FNU A;  3VRA B;  3EA6 A;  1B1Z A;  4USA A;  1C9F A;  5FR3 A;  3Q69 A;  1VR9 A;  1HZ5 A;  3Q8F A;  2WXN A;  3I57 A;  2QEJ C;  4N58 A;  2AQ3 B;  4JWS C;  3IAS 1;  2K22 A;  1V1P A;  5BYR A;  1QF6 A;  2W3R A;  4J3O D;  2KDM A;  1TY0 A;  1YNT E;  4DXF A;  4HJG E;  4DQO C;  3IT6 B;  3P4P B;  2QIL A;  1NEK B;  1L4Z B;  3J9C A;  2NMQ A;  2V0G A;  3MP9 A;  4WWM A;  3ZJU A;  1YQ4 B;  2IDY A;  1FO4 A;  3VRB B;  3DWM A;  3FC4 A;  4WIP A;  4EE2 A;  4L23 A;  2G1E A;  1N5X A;  4WQM A;  3KLS X;  1HZ6 A;  3T3N A;  5EE0 A;  1KLG D;  3RFZ B;  1TY2 A;  2SEB D;  1K51 A;  2BTE A;  1ESF A;  1QKZ A;  2GB1 A;  2LFI A;  1GAQ B;  3H8H A;  3P4S B;  4RF1 A;  1K50 A;  1QOG A;  1MPE A;  2MJ3 A;  3HRD D;  2WU2 B;  2WXK A;  4JE3 B;  4RH6 A;  1YN4 A;  2WXQ A;  2J4X A;  5E6J A;  4LTU A;  1PDX A;  4GDK B;  3NRZ A;  3C8Y A;  1EWY C;  2CU3 A;  1TS3 A;  2BB5 A;  1C78 A;  3Q8C A;  4MM3 B;  1BXT A;  1NEN B;  3B2G A;  3BYT B;  3SFE B;  1UWX A;  4FXC A;  2WXR A;  3EGR A;  4RCO A;  2N7J A;  2JYT A;  1IBX A;  1RFK A;  3NVW A;  1UNS A;  3LB8 C;  2PLP A;  1TS4 A;  2RPV A;  1JCK B;  4NAM A;  3T3O A;  1C4A A;  1VJK A;  5BMH A;  2W54 A;  1JAL A;  2GI9 A;  1Y56 A;  2WLB A;  3DWG C;  2QMT A;  1QOF A;  2PVO D;  1A70 A;  1BML C;  4DXG A;  5C3J B;  2QIE B;  4RF0 A;  4GLS C;  2BBC A;  3Q8A A;  1KRH A;  4LLG M;  3WCQ A;  2AX5 A;  2JZP A;  3PZ8 A;  1VZ6 A;  2IGG A;  4JX1 C;  3AB5 A;  5BYS A;  4YSY B;  2YEP F;  3SR6 A;  1NVI D;  2LHE A;  2VZK B;  4OZC A;  3AE7 B;  1ROE A;  4WUR A;  3TUO A;  1J7A A;  2OED A;  3Q8E A;  4M0W A;  3E9S A;  1XCQ L;  3SFD B;  1SIJ A;  4YWG G;  3VQI A;  1L6U A;  5TSS A;  2J52 A;  2DWQ A;  1WGK A;  1FIQ A;  1K52 A;  2IGD A;  3IAM 1;  1D4B A;  5JXV A;  4C7Z A;  2EEL A;  2N9K A;  1SSN A;  3N9Y C;  3BVG A;  1HXY D;  2FBW B;  1N5W A;  1TZO A;  2LEK A;  3AEA B;  4OW0 A;  5GXG B;  2D5G A;  4HKZ E;  3CIR B;  5AUK A;  4AQ7 A;  4OZB A;  1C4P A;  4TQ1 A;  4YT0 B;  1KFY B;  3U2S C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...