3AB5A

Crystal structure of the 2fe 2s ferredoxin from cyanidioschyzon merolae
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
97
structure length
97
Chain Sequence
MYKIQLVNQKEGIDVTIQCAGDQYILDAAEEQGVDLPYSCRAGACSTCAGKLVKGSVDQSDQSFLDEDQISKGFILTCVAYPTSDCVIQTHQEEALY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Ferredoxin
publication title Crystal structure of the 2Fe 2S Ferredoxin from Cyanidioschyzon merolae at 1.18A resolution.
rcsb
source organism Cyanidioschyzon merolae
total genus 25
structure length 97
sequence length 97
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ab5A00
1E0ZA 1N62A 1DOYA 1V97A 4C80A 3VR8B 1N60A 2PVOD 2WS3B 3P4QB 4YSYB 4YTNB 2MH7A 3B2FA 4A9AA 5GXGB 2DWQA 1NYRA 1J7AA 3RPFC 1TKEA 3AE3B 1GAQB 5G5GA 4US8A 1QF6A 1WRIA 1XLNA 4C7ZA 5C3JB 4YSXB 3AN1A 3WCQA 2OHFA 4WWMA 1NENB 1N63A 1PFDA 3AE1B 1T3QA 3B9JA 1I7HA 3P1MA 2QJLA 1QT9A 1L5PA 1FM0D 1QOGA 1XLOA 2H88B 2Y5CA 4N58A 3AECB 3AEFB 1FIQA 5EE1A 1E10A 3AE7B 1L6UA 1L0VB 3AE9B 3AE8B 2WQYB 1L6VA 2FBWB 1XLPA 4IDIA 4P6VF 2BT6A 3BIID 2E3TA 2MJEA 3AE5B 1JROA 1FXIA 3AEAB 5MPOA 1GPXA 1PDXA 2PVGC 3ETRA 4YXDB 1YQ3B 4KX6B 1RWSA 1E9MA 3P4PB 2B76B 5H8YE 3HUIA 2K5PA 4LTUA 1KRHA 1TKYA 2KMMA 4JWUC 1JALA 1NYQA 1TYGB 3AEBB 2L52A 2PKOA 1SF0A 3HVZA 3AE2B 3KWLA 3LXFA 5AUIA 2G1EA 2WU5B 1CJEA 3NVZA 1J7CA 1OQRA 1ZXIA 4HRSA 4ZOHC 1OFFA 2LEKA 2BS4B 1TJEA 3EUB2 1ZOYB 2M19A 2W55A 1NVID 1JWBD 1R7SA 3AMZA 1ROEA 1AYFA 2Q5WD 1QLBB 2WDRB 2K22A 2N0SB 1JWAD 2JX5A 1E7PB 1OQQA 2PIAA 3W5UB 3FC4A 3P4RB 1SIJA 1QOFA 4N6EB 2CJOA 1CZPA 4N59A 3ZYYX 1EWYC 1N61A 3AH7A 2CJNA 5EE3A 4YSZB 4YTMB 1JW9D 4ITKA 4WQMA 3VR9B 2WDQB 1SB3C 1YJIA 1ZP0B 4HROA 5C2TB 3W5VB 3NVWA 1VJKA 1XO3A 1E6EB 4US9A 3AM9A 1UWMA 4YT0B 2W3SA 1FFUA 2BS2B 3HRDD 3B2GA 2W54A 2WU2B 1TKGA 3AEGB 1IUEA 1J7BA 5EE9A 3NS1A 1JQ4A 1YQ4B 1DGJA 1F0ZA 1VLBA 4USAA 2H89B 1DOIA 5EE0A 5G5HA 1FFVA 3NVVA 4ZHPA 2JQRB 1N5WA 2KAJA 1JRPA 3FAHA 4JX1C 2MJ3A 1RYJA 3P63A 3NRZA 1FRDA 5AUKA 3CWIA 1N5XA 1FRRA 1AWDA 1V8CA 3SFEB 2L83A 3CIRB 3VRAB 2QIEB 1B9RA 3LB8C 4JWSC 2DBYA 1FO4A 2M56B 3AE6B 3AV8A 3AE4B 1WGKA 1KF6B 2EKIA 2MJDA 4C7YA 2CU3A 2WLBA 2AX5A 1WYGA 3ABVB 1NI3A 1QOAA 1PUTA 1FXAA 2WP9B 2WDVB 1VDVA 3AB5A 4YTPB 1RFKA 3L4PA 4FXCA 2BS3B 4ZHOA 3P4SB 1WWTA 3DWMA 1FMAD 3PO0A 3VRBB 1DOXA 1ZUD2 2HTME 2W3RA 3AEDB 5H92C 3W9CB 1RM6C 1YJJA 3SFDB 1QOBA 1A70A 3SR6A 3NVYA 2ACZB 2K9XA 3AEEB 3DWGC 1KFYB 1WXQA 1NEKB 1XLQA
chains in the Genus database with same CATH superfamily
2K25A 2QDFA 2DYBA 1NI2A 4IUMB 4FJZA 2EMTA 2C5LC 3FILA 3RPFC 3AE3B 1QF6A 1GJZA 3QAQA 5LLIA 2PE9A 4E71A 4WWMA 4CQNA 3NUHB 1L5PA 3VFKA 5E6NA 1ZDXA 2KFKB 3AEAB 5AEKB 4X57B 1MHXA 2KJ6A 4AP4C 3H9DA 4MGIE 1GPXA 3DBSA 5AZFA 2NS5A 2Z0DB 3T8MA 2K5PA 1OEYA 2A5UA 4MDKE 3O65B 4E74A 1MVKA 3ALBA 2PJHA 4DXAB 2INCC 4KKIA 2PIAA 2WXNA 4S17A 4US8A 1CZPA 2DAJA 1WGGA 4CO7A 4HROA 4US9A 1GC7A 3ML9A 3V6CB 1K53A 2AL6A 3ONSA 2V1YA 3GZNB 3L54A 4I6PA 3FAHA 4AJWA 3DBHI 3BVZA 4ANXA 2KNBA 2JUOA 2EMSA 3RI7C 3AE6B 4GGQA 3EFCA 4FJVB 4W9DA 1MI0A 2LGDA 3RNFC 3AB5A 4HJGE 3KYCD 1PGXA 2PW9A 3NZ3A 2C7HA 2XK5A 4WJOA 3VXWA 2KN5A 1NEKB 3WA0A 1C78A 4P16A 4NJCA 3TEXA 3C19A 3I3TB 3ML8A 5JXVA 2LGIA 4C7ZA 2D3AA 3M3JA 3DVGY 1SXTA 1FIQA 3WALA 2G9HD 4IOIE 2E3TA 1C76A 2MW5A 1HEZE 3MFGA 1V86A 3Q8BA 4KX6B 1GUAB 1RWSA 4K1RB 2PPHA 2KTFA 3P4PB 3IVFA 3SU8X 2IO2B 2N9KA 3LYYA 1TYGB 3RFZB 1V9JA 3TSSA 5IP4D 2WU5B 3ENEA 2WXGA 4OZBA 4KDLB 2ASQA 3HVDA 1QOFA 2CJOA 2LUMA 3BK1A 2AQ1B 3P2BA 4FA6A 4ITKA 4ZRKA 3EHVA 4LNOA 4PK1A 3OLMD 2QC8A 3KWVA 3JYUA 3K9PB 1SE3A 3ZNGC 3MHSD 3N20C 2N1WA 2BYEA 1L0XB 1RYJA 3P63A 2PTLA 2L8JA 1P98A 2MBEA 2D2QA 1QKZA 3L10B 4I6NB 2JT4B 2L1AA 2M0AA 3VQIA 1WX9A 2BS3B 3DWMA 3TIXA 1FPYA 2HTME 2IY0B 3TMPB 3KQ4A 2MQJA 2K9XA 1XF5L 2IGGA 1EO6A 1L4DB 2KWDA 4UDUC 1VRAB 4II3B 4GN1A 2MH7A 1K50A 4A9AA 4P7IA 1WRIA 3WCQA 4MH0E 2LFIA 4HPPA 4ZRQA 5DPSA 4EKUA 4GU2A 4NAWA 2KC1A 3AU4A 3AULA 1PDXA 2WXRA 3UF8A 1IBXA 1YQ3B 3N3KB 3BZDB 2KHWB 2BYFA 4HDOA 1JALA 3KH0A 5CHWA 3VH4B 3GOEA 4HJKA 3PT2B 1V1PA 2NBUA 2ZVOA 3UIPB 3GZNI 1WMHA 3TJPA 1YN5A 4GDLB 3NVWA 1VJKA 4A6QA 1UBQA 2KWVB 1I4QA 3IT6B 5DPWA 2JF5A 2YLMA 3H6NA 1H8CA 3A4SC 4ZHPA 1N5WA 1JMLA 4AOFA 1SJHD 1GNUA 2I1KA 3ZRCA 1ZW7A 3QCAA 4W9HA 1AN8A 3A9KB 3AE4B 5EDSA 1Q10A 2WXKA 4LNIA 3Q2AC 4O1NA 2W82A 5AZHA 4WAAA 1KLUD 2K1FA 3ZNID 4DQOC 5H92C 1QOBA 4RM8A 3I9V1 4RGNA 2OJWA 1MG8A 1N62A 5C1ZA 1YNTE 1TKEA 3AI5A 3ZXVA 3ZVVA 1GB1A 2X8XX 1XLNA 3MTNB 2BB6A 1E8YA 4L23A 4B0EA 5JZEB 3W1YA 2H88B 1M4VA 3MC9A 1KOTA 1TTNA 2X38A 2I2YA 2C7NB 3VTVA 4YXDB 3OG5A 4LDTD 2KDMA 1TIFA 1NYQA 2LXAA 3AE2B 2ZCBA 4MJSB 4ZOHC 1M94A 1PYWD 3N1ZC 2NMQA 3ZXRA 5E6OA 4RFBA 2O6VB 4N59A 1EWYC 2XNAC 2BKFA 1YQBA 2KZRA 2Y5BB 4R3DA 5BYSA 4TQ0A 4A3PA 4W9LA 1R4MB 3B2GA 4YL8A 4BBNC 1JQ4A 5C23A 4ZDVA 1STEA 4W9IA 1FFVA 3H7PA 3LDZE 3KUZA 3T9LA 3NRZA 4D2KA 3CIRB 4NQLB 2QIEB 1I35A 1I4RA 1WZ0A 1V49A 1D5ZC 1D3ZA 5FKAC 2WP9B 4MT5A 1UUPA 2NCNA 3GS2A 1UZXB 5J2RA 3AEDB 2LUEA 1BT0A 4G3XB 2I38A 2KJRA 1XQQA 4KIKA 4YTNB 4FJYA 5GXGB 2DWQA 1HA5A 2Z8LA 2NPTA 1T0SC 3A33B 3DVGX 4QAYA 2G45B 4RF1A 5LXHA 2NR2A 5KHQA 4JQWC 1PFDA 2J53A 3P1MA 4C4VB 1I7HA 4EFOA 4HK2A 1ISNA 4J6IA 4IDIA 3RNGC 5DCNA 3O13A 4TQ1A 2FCMA 4L2YA 4WAFA 1A5RA 3Q3JA 2NBVB 1QZEA 2BWES 1KJTA 2N7DA 1LM8B 4JWUC 1I4XA 4GDKB 2HD5B 3IAS1 2PKOA 1OQRA 2YEPF 1P3QU 1QQRA 4S0RA 4HWIB 3JSVB 4HDQA 4WJPA 4LK0M 1OQQA 5JHAA 2KVZA 2K6DB 3Q3OC 1FFUA 1TKGA 3AEGB 3EC8A 3MHZA 1TT5B 2JZ3B 1VLBA 4A90A 5TSSA 4GIVA 3VTWA 1FRDA 3PHXB 5IKCM 2AWTA 4KGRA 1T0QC 1RFAA 1RAXA 2INDC 4HVBA 4JWSC 3DVNU 1KF6B 1LGRA 2ZPNA 1ZKHA 2LHDA 4LNNA 1HQRD 3BINA 4GLSC 2QCZA 2ZW0A 3DBRB 4OVZA 1KTKA 4ZHOA 4FULA 2W3RA 2KD0A 3T3NA 1A70A 5BYQA 1FCLA 3BK2A 1TZOA 2MWSB 1TZ1A 4LJOB 3ZTDA 3Q6BA 1FNUA 1N63A 1UF0A 3B9JA 1FM0D 1C77A 1QOGA 4TKNA 4XWTA 5J17A 4NZLB 3DHHC 3QQ8B 4WH4A 3DVNV 2MP2A 5D2MB 2WXOA 4WJNA 2PVGC 4BAXA 2KTRB 2IYDB 1EU3A 1GG3A 2DHZA 2BB5A 1HTQA 3WAMA 2G1EA 4HRSA 4RGTA 3PHWB 4LNKA 5E6JA 1JWBD 3TBLD 3GE3C 2Q5WD 1R4MI 4MM3A 2LXCA 5IOIA 3DPDA 5LNK1 1V2YA 1RLFA 3FC4A 1SIJA 1F52A 4GMVA 3IAM1 3RMKC 2PEAA 2WXHA 4WQMA 2WDQB 2JZZA 2DZIA 3U4EG 1E6EB 3AM9A 4YT0B 2BS2B 4KVGB 2Y5PA 3NS1A 4MGKE 2LRUA 1F0ZA 4IWOA 1WE6A 4RH6A 3QWZB 3U7DA 1VCBA 3NVVA 1VZ8A 3UGBB 4K3CA 2ZZPB 2LVOA 2J52A 1B9RA 2REXA 3KLSX 3NZSA 3LB8C 1FO4A 1L0YB 3A9JA 3BWUD 4DHJB 4ZRJA 3TUOA 2W9NA 2E6XA 4A20A 1WIAA 1Y56A 3SR6A 4HEA1 3QC8B 1XLQA 1Z2MA 2B3AA 3N30A 3I57A 4EE2A 1ESFA 1B1ZA 1T3QA 1WM3A 4IC7B 1P7EA 1GOZA 2DENB 1E10A 1L0VB 1WJ6A 3Q8EA 3EFUA 4P6VF 1WZ3A 3R7QA 1FXIA 4A55A 2C9WB 2KMCA 3QX1A 3J9CA 5IA7A 2VZKB 3ZLZA 2FE8A 2DLBA 1D4BA 1J8CA 1ZE3D 4P1CC 2KC2A 3R2IA 1NVID 3U2SC 2WXQA 2AYOB 2V4LA 4EZLA 2CKHB 1F1HA 1WR6E 2L0FA 1ZDVA 4J3OD 1BXTA 1V5TA 5I4DA 1CQVA 4N6EB 2KO3A 3ZYYX 5CHVC 4G50A 3R8BA 2HJ8A 5D6JB 1UWXA 2W3SA 3BY4B 3V05A 3W1SC 1DGJA 2KKCA 2JQRB 3LJ3A 1NBFC 2WWZA 2GBJA 3DBRI 1T6BX 4ZRPA 1WGYA 2O2VB 2K8CA 2M4NA 2KQ4X 1SE2A 3Q3NC 3VRAB 3Q3FA 4OW0A 2WXFA 3MP9A 2V9HA 2JWUA 4C7YA 4HKQA 2TSSA 1FXAA 2WDVB 1TY2A 3B0AA 3NS8A 1PGBA 3RT3B 5LXIB 3T3OA 2DYMA 3DDCB 3SFDB 3VVWB 2J0JA 2G4DB 2LHEA 2M17A 3VTUA 3QARA 3PRPB 2BYTA 1OEYJ 1JWMD 2K6QA 3NHEB 1GAQB 1YN3A 2BBCA 4KKJA 3WAPA 2GB1A 3ZJUA 1P1AA 3N9YC 3AEFB 5EE1A 4MSQB 4RNAA 4M0WB 2IGDA 2NTTA 3I5JC 4BFRA 2WYQA 4ANUA 2MX2A 1E8ZA 4PS8A 3AEBB 1SF0A 3PS6A 1CJEA 1ZXIA 1R7SA 2EKEC 2LI5A 1WM2A 3Q14C 2EELA 4WWOA 3B08A 4PS7A 2GLSA 3FILB 1D5MC 2N7EA 2L32A 3V6EB 3WANA 4XYCA 2IPKD 1VZ6A 3RN9C 3K9OB 2BVCA 3GE8C 4XZ4A 2QEJC 4KGSA 3A1QA 3U52E 1J7BA 3RULA 3X0WA 4ANWA 4OHJA 1YX5B 2JU6X 2QILA 3PREA 1WGDA 1JRPA 2BF8B 1LO5D 2D3BA 3TCAA 3ZKJC 3AU5A 3B1LX 2VH1A 2MA9B 2K8HA 2NBWB 3PLUA 3PVLA 3ZUNA 1KLVA 1FXTB 4B9KA 2WXLA 4HPLB 3ZDTA 2V3NA 2V3PA 3ABVB 1HTOA 4DHZB 4YTPB 3WIMA 2JRIB 3Q69A 4EOYA 1FMAD 1LQBA 2BYVE 4B95A 1YJ1A 1X1MA 3KYDD 1SEBD 4TMAB 3VR8B 4YSYB 2KOXA 3I63C 3ZJVA 5D3DA 5CHFA 2M0XA 1SGHA 4K7SA 2QJLA 4BKTA 3QIJA 4ICUA 3BYYB 1L6UA 2GMIC 2J42A 4GXBA 2KX0A 4C00A 3MC8A 4L1BA 3PZ8A 2ON8A 1WI0A 4WWPA 1E9MA 5H8YE 1C4CA 1VZ7A 1TKYA 2WXIA 3OJ4B 4RCOA 1TS4A 4FHJA 2VRRB 1ZOYB 2IO3B 2XK5B 2J0MA 2RDBC 2LWPA 3V62A 2K22A 3KUCB 2J0KA 1E7PB 3H1UA 3C0RB 4AJYB 4PS3A 3H7SA 3VR9B 4M01A 4ANVA 1UWMA 3NOBA 3HRDD 4OVVA 4LNFA 2LMCA 2HE7A 5HFYA 3V3XA 4G0NB 3PGEA 3UIOB 1E7VA 2MJ3A 1G6JA 2XBBC 1IGDA 2PLPA 4DDGD 2KK8A 2KFKA 2LVQA 3ZNZB 2LRWA 1Q5WB 3APCA 4A8XC 1MFWA 4JLCA 4ZRIA 3DQVA 1L7YA 5G2NA 2BPSA 2ZNVC 5FR6A 2GOWA 1RFKA 1SIFA 2RMMA 1YJJA 4DXFA 3ECIA 2RPVA 3AEEB 4B0MA 2WXMA 4HXDA 2WS3B 1TY0A 2N7JA 3X23A 4N9F4 1XT9B 1FEHA 1NDDA 2OHFA 1NENB 3RNBC 4EZKA 1UGJA 1XLOA 2C7MB 2MBQA 3AECB 2AQ3B 2G4SA 4KDIC 3AE9B 1UGMA 3BIID 3AE5B 3U7ZA 3SEBA 4DHZE 1OQYA 1V80A 4EEWA 2K0PA 4XX5A 1EM7A 3L13A 3BYTB 1OGWA 1AW7A 1ET6A 3Q8AA 3ZO5B 2XN9C 3VAWA 5AUIA 4JPSA 3IFWB 5D94A 4NPNA 4XC2A 4JE3B 4M8NA 1SBBB 3SD5A 3NG0A 2KDFB 5JHBA 4F7ZA 3W5UB 3L16A 1FNWA 1HZ5A 2MBBB 3P42A 2JPHA 5BMHA 1SB3C 1OTRB 5BYRA 3WAOA 1T0YA 2D5GA 1EF1A 1JWUD 2R2OA 1E5WA 4MH8A 3CSTA 3RYTA 4NAWB 2KANA 5G5HA 4TV3A 3PPAA 4PYUA 3DCGA 5CX3A 1IBXB 1HXYD 3PTFC 1V8CA 2FIFA 2DNFA 3TEWA 4BOSC 1BUIC 3AV8A 4KSKC 2EKIA 1WYGA 2JXXA 2R61A 4URKA 3BVGA 2SEBD 5AZGA 2O6VD 4FXCA 1P9DU 1WXVA 1DOXA 3IG3A 2FNJB 1V1PB 2D11A 4ARCA 1WMHB 2RDGA 2MBHA 3ZTCA 1XCQL 1YN4A 1SSNA 2RPQA 4M02A 2IGHA 1DOYA 2D3GA 2IO1B 5BMGA 3S2AA 4IW0A 3KUDB 1IYFA 4M00A 2KDEB 2RD0A 3AN1A 4Q2JA 2BKRB 3W9CB 3U8ZA 2Y5CA 3AE7B 1D5XC 2N4FA 1F77A 4K7WA 4RM9A 2KT7A 2RDHA 2FBWB 1Y8RC 2CU1A 5CTRC 1JROA 4IG7B 3ZRFA 2WX1A 1WFYA 3N1XC 5L95C 4ICVA 1WR1A 4GB9A 3ZDMC 3HVZA 1WGRA 3KWLA 2ZNVB 4LJPB 5IN7A 1OFFA 3EUB2 2KXJA 1FCCC 2M1MA 2BGFA 4FHKA 3NY5A 3DOWA 2JX5A 1LXDA 5GMVA 4WQOB 1E8XA 3U30A 2CJNA 3GB1A 5C2TB 3ZIMA 2WHIA 3RCZA 1BMLC 4W9JA 3DBLI 4FN2A 4E3CA 4BKGA 3RZFA 1JCKB 5EE0A 2KQ7A 4CHKA 1AWDA 5TR5A 3ZW3A 2ZPYA 5D7GA 1AARA 2IY1B 2GRIA 4IWQA 4JIOU 2KN4A 2PE6B 1Q1OA 1TS5A 4RGOS 2JSVX 4NAMA 1WX8A 1RM6C 3MC0B 2KWUB 2J7QB 1KM7A 3CMMB 4MEMA 1KFYB 3IXSA 3R2TA 1E0ZA 1J19A 1V97A 4MACA 3APDA 1J7AA 1K8RB 1P0RA 1TBEA 2OJRA 5IO9A 3IHPC 2UU7A 1HZ6A 5FK9C 1QILA 4WIPA 4GDLA 1C1YB 4F1SA 3H7PB 4WWNA 1Z5SB 1L2NA 2RR9A 1WGHA 3AE8B 1ENFA 2D10A 2IO0B 2LJIA 4AUQC 4W9FA 3L08A 3L0WB 2BQQA 3ZJTA 3EGRA 3RUIB 3HUIA 1EU4A 2KMMA 1GC6A 3VDZA 1ET9A 1XD3B 3A9KA 3NVZA 1XCTL 1MHHE 3W1SA 1SJED 2W55A 2KDBA 2ZCCA 4EZJA 4KGTA 2AL3A 4NJ6A 3PZ7A 4KIKB 4ASWC 3A4RA 1ZXHA 3RZWC 4KV2A 2NPTB 3RNAC 4RGMA 2KACA 3W5VB 3R66C 4FADA 3C8YA 5FR3A 3HIZA 3QK0A 1XXGA 4B6WA 1YQ4B 2PMVA 2IZVB 2H89B 1DOIA 2KLGA 2LVPA 2D07B 3EA6A 1N5XA 3MJWA 1UH6A 3W2DA 4LLGM 3N32A 1E8WA 2DBYA 2OEDA 3OJ3A 1WGKA 3UI3A 2N9LA 1ZPSA 3V60A 2MCNB 4XE0A 5HKHA 2UWQA 4DXGA 1WX7A 1EWCA 3P4SB 1WWTA 2NTSA 4MJSA 1IPGA 2IJ0A 1V1OA 2NVUI 3HM3A 1JRUA 2WLBA 2QMTA 4C80A 3P4QB 1U4AA 2BWFA 4KSLC 2O6VA 2JYTA 2WX0A 4W9KA 3IT4B 4IM3A 1YD8U 4AQ7A 3AE1B 2LD9A 2KYWA 4N58A 1PGAA 1SE4A 4BBNF 2WXJA 2R2QA 4W9CA 2L00B 2LGSA 3Q8FA 4HCNB 4DHJD 3RNEC 2GBMA 4MELA 2DX5B 1IGCA 1T5XD 1WRDB 4BZAA 2DZMA 4MSMB 1MG4A 3AXCA 1T0RC 1F2RI 2WXPA 3E9SA 3SHQA 3JVZX 4C56C 1ROEA 2N1VA 4NJ7A 3PZDA 2N0SB 2QHOA 1UD7A 1GB4A 1MPEA 3R3MA 4RMAA 4HPMB 2M8SA 3UQBA 1ZP0B 1S1QB 5D3IB 2W54A 2WU2B 4AS1A 1K51A 2FAZA 2MP2B 2VZKD 2ZJDA 4H2AA 4IM2A 2FCNA 4C4VA 2INNE 3M63B 1YIWA 4XGAB 2DZKA 5KHOA 4NQKE 5JH5C 2M56B 1E90A 4ZYSA 2AX5A 1QOAA 1PUTA 2CR5A 2INPE 4GSWA 4MM3B 4GDKA 2V4IB 2VH2A 3EECA 2CHWA 4G11A 2LGXA 3N1YC 4LDTB 2JY6A 4F8CB 3ZGZA 4A3OA 3JSVA 3TEYA 2XEWA 3HHMA 4ACFA 2J4XA 1R4NB 2FUG1 5BO4B 4PYZA 3B2FA 3Q8CA 2Z59B 2L3ZA 2L7RA 3PRMB 2FCSA 3QHTA 3VHTC 3H8HA 1WXSA 1XEEA 3URYA 4GOCA 1WSPA 2JYEA 1YOVB 3RD2A 2MJEA 3NJTA 2K3UA 3ETRA 3A9JB 3KVFB 3V61A 2YEPB 1KRHA 3PLVA 1WE7A 5HG2A 2L52A 4FBJB 2BS4B 4REZA 4WURA 2M19A 3D32A 3HM6X 2AEHA 1RRBA 2FCQA 3AMZA 3NZUA 2N9PC 1D6EC 1QLBB 1N6ZA 2KJHB 1C4AA 2KWCA 2WDTB 1WYWB 5HI1A 1HE8A 4BKSD 4HLEA 2RGFA 4YSZB 4YTMB 2HTHA 3VUXA 4HCPB 1DYQA 1YJIA 3BVMA 1XO3A 2LJ5A 1WH3A 3HK0A 2Z0EB 3Q3MC 2ZVNA 2JXTA 2KAJA 4DDID 2ZW1A 2BTEA 1VD2A 4JL9A 2YVCA 2CHZA 1I42A 1J0GA 1UNSA 2ZEQA 1P7FA 4AWJA 5DPTA 3CF6E 4II2B 1VDVA 2KTRA 2KMAA 5HHDG 2BW2A 3PO0A 4IWPA 2JRHA 4NY0A 3FKYA 2JWZA 2ACZB 2MSED 3L17A 3DWGC 1KLGD 2MEKA 1I4PA 1N60A 3DBLB 3ZQ4A 2GBKA 4OZAA 3ZNHB 2ICIA 4FLHA 5G5GA 5C3JB 4YSXB 1YX6B 4RF0A 1C3TA 1WJNA 1ZGUB 3KW5B 1VR9A 3E56A 2WGSA 3PSEB 1WJ4A 1CK1A 2RSUA 2SAKA 2BT6A 2MRPA 1TGZB 3PRZA 5MPOA 3OAWA 2IDYA 2GBNA 1F2RC 1C79A 4ARIA 2KQSA 5E6PA 5T8IA 3IBEA 3M62B 1IP9A 1J7CA 5G55A 4KZCA 3CSFA 1AYFA 2WDRB 1C4PA 1JWAD 3DHGC 4OZCA 2MLBA 3RNCC 2DAFA 1JW9D 4W9EA 1CMXB 2K39A 4DBGA 5DPRA 2KX3A 1K52A 2I1JA 5EE9A 4PT5A 1FNVA 2D3CA 1I4GA 4USAA 2JZPA 2L05A 4IKGA 4JGHB 4JX1C 4BVUC 1YMHE 5AUKA 3QJZA 1L4ZB 1ACCA 2N9XA 3CWIA 1FRRA 2L83A 1WXMA 4MGYE 5J18A 1S3SG 2MJDA 4IM0A 1WJUA 2CU3A 5L83A 1UELA 1R4NI 4K7UA 3MJ5A 4XDDA 3DBHB 3L4PA 3UINB 4DWFA 3VRBB 4CYEA 2DYOA 1ZUD2 4OVUA 2WNMA 4I6LB 3SDLC 1MJDA 1E7UA 1WXQA 2KFJA 2L0TA 4LCDE 3GP7A 3OWEB 2PVOD 4BOZB 2HJ1A 1I4HA 2L76A 1NYRA 3A1QB 1UBIA 4KZ0A 3QA8A 1PQSA 1FD6A 1QT9A 4K3BA 2OOBB 1KH0A 2WQYB 4K81A 1L6VA 1XLPA 2JVCA 2UYZB 3DHIC 2GI9A 1V81A 1TS2A 2DZJA 2KVRA 3VUYA 2CHXA 2O2VA 4W9GA 3VH3B 2B76B 3TEZA 4XWWA 2V0GA 2LGYA 4LTUA 2MHJA 3PV1A 2FIDA 4NNJB 3LXFA 1C9FA 2HDEA 2LZ6A 2LEKA 2KLCA 1TJEA 2GBRA 3APFA 1Q0WB 2QSDA 2G3QB 1EF5A 1EUVB 3M95A 1LFDA 2ONQA 4YWGG 3P4RB 2A4ZA 2K8BA 3AH7A 1N61A 2MBOA 4M8MA 5EE3A 1V6EA 1SE9A 3VUWA 1V5OA 1F9JA 1H4RA 1TS3A 2LASA 2IBIB 1WXAA 1IUEA 2C60A 4BKSA 2KDIA 1WY8A 4MGZE 1WF9A 5IAAC 2N9EB 4WJQA 4XDCA 3TL5A 2V3SA 3SFEB 4TSSA 1JWSD 4DK5A 4TUUA 2FUHB 4M0WA 3R7RA 4ZYNA 1NI3A 3UQAA 4P1BC 2CS4A 2Y3AA 5BMIA 2AQ2B 4EUTA 3JW0X 4HKZE 3NVYA
chains in the Genus database with same CATH topology
2I38A 1SEBD 2QMTA 4C80A 4TMAB 3VR8B 3P4QB 4YSYB 4YTNB 5GXGB 2DWQA 1HA5A 3FILA 2Z8LA 2JYTA 3RPFC 3AE3B 5D3DA 3ZJVA 1QF6A 3IT4B 4RF1A 4AQ7A 4WWMA 1PFDA 2J53A 3AE1B 3P1MA 4CQNA 1I7HA 3NUHB 2QJLA 1L5PA 4N58A 3BYYB 1L6UA 1PGAA 1SE4A 2J42A 2WXJA 1ZDXA 4IDIA 3O13A 3Q8FA 4TQ1A 3AEAB 4L2YA 1MHXA 4WAFA 4L1BA 1IGCA 1T5XD 1GPXA 3PZ8A 2ON8A 1E9MA 5H8YE 2K5PA 1C4CA 1VZ7A 1TKYA 4JWUC 2WXIA 1I4XA 4RCOA 4GDKB 3IAS1 1F2RI 2WXPA 2PKOA 3E9SA 1TS4A 1OQRA 1MVKA 2YEPF 1QQRA 1ZOYB 4C56C 1ROEA 2K22A 2N0SB 4KKIA 1E7PB 4LK0M 1OQQA 1GB4A 2PIAA 1MPEA 2WXNA 4US8A 1CZPA 3VR9B 1ZP0B 4HROA 4US9A 1UWMA 5D3IB 1FFUA 3HRDD 2W54A 1K53A 2WU2B 1TKGA 3AEGB 4AS1A 1K51A 3MHZA 2LMCA 5HFYA 3V3XA 1VLBA 2VZKD 4H2AA 4A90A 3FAHA 5TSSA 2MJ3A 2INNE 1FRDA 1IGDA 3BVZA 4KGRA 2PLPA 4JWSC 2M56B 3AE6B 4A8XC 1KF6B 2LHDA 2AX5A 4ZYSA 1MI0A 1HQRD 1QOAA 1PUTA 3AB5A 2INPE 4GLSC 2ZW0A 1RFKA 4HJGE 4MM3B 1KTKA 4OVZA 4ZHOA 2V4IB 2RMMA 1PGXA 2PW9A 2W3RA 3NZ3A 3T3NA 1YJJA 4DXFA 3ZGZA 1A70A 5BYQA 2RPVA 3AEEB 4B0MA 1FCLA 1NEKB 3BK2A 1TZOA 3TEYA 2WXMA 2J4XA 1C78A 4P16A 2FUG1 2WS3B 3B2FA 1TY0A 3Q8CA 4NJCA 3TEXA 2N7JA 5JXVA 2LGIA 4C7ZA 1FEHA 1FNUA 2OHFA 1NENB 1N63A 3B9JA 1UGJA 1FM0D 1C77A 1QOGA 1XLOA 3H8HA 1XEEA 4XWTA 1SXTA 3AECB 1FIQA 2AQ3B 4NZLB 3AE9B 3URYA 2G9HD 1WSPA 4IOIE 2JYEA 4WH4A 3BIID 2E3TA 2MJEA 3AE5B 1C76A 3SEBA 3U7ZA 2WXOA 1HEZE 2PVGC 3MFGA 2K3UA 3ETRA 3Q8BA 4KX6B 2K0PA 1RWSA 1EM7A 3BYTB 3P4PB 1AW7A 1ET6A 3Q8AA 2N9KA 2YEPB 3LYYA 1KRHA 5HG2A 1EU3A 1TYGB 2XN9C 2BB5A 2L52A 3RFZB 5AUIA 4JPSA 3TSSA 2G1EA 2WU5B 4HRSA 4RGTA 2BS4B 4REZA 4WURA 2M19A 5E6JA 2WXGA 1JWBD 3AMZA 4JE3B 4OZBA 1SBBB 1D6EC 1QLBB 2Q5WD 1C4AA 3HVDA 5HI1A 5LNK1 3W5UB 3FC4A 1SIJA 1QOFA 3IAM1 2CJOA 1FNWA 2LUMA 1HZ5A 4YSZB 3BK1A 2AQ1B 3P42A 4YTMB 4ITKA 2WXHA 4WQMA 5BMHA 2WDQB 1DYQA 1SB3C 1YJIA 3BVMA 5BYRA 1XO3A 3U4EG 1E6EB 3AM9A 4YT0B 2BS2B 2D5GA 1JWUD 4MH8A 2Y5PA 3NS1A 3KWVA 1F0ZA 4RH6A 1SE3A 4NAWB 5G5HA 3NVVA 2JXTA 2KAJA 1VZ8A 2ZW1A 2BTEA 1L0XB 1RYJA 3P63A 1IBXB 1HXYD 2PTLA 1V8CA 2J52A 3TEWA 1B9RA 3KLSX 3LB8C 1UNSA 1BUIC 1FO4A 1P7FA 1L0YB 3AV8A 1QKZA 2EKIA 3BWUD 1WYGA 2R61A 1VDVA 2L1AA 2M0AA 3VQIA 3BVGA 2SEBD 4FXCA 5HHDG 2BS3B 2BW2A 3TUOA 3DWMA 3PO0A 1DOXA 2HTME 2E6XA 1V1PB 3KQ4A 1Y56A 4ARCA 3SR6A 4HEA1 2ACZB 3DWGC 1KLGD 2K9XA 1XF5L 2RDGA 2IGGA 1YN4A 1XCQL 1XLQA 1SSNA 1L4DB 2KWDA 2MEKA 2IGHA 4UDUC 1DOYA 1VRAB 1I4PA 5BMGA 1N60A 3ZQ4A 2MH7A 1K50A 3I57A 4OZAA 4A9AA 2ICIA 5G5GA 4EE2A 1WRIA 5C3JB 4YSXB 3AN1A 4RF0A 3WCQA 4Q2JA 1ESFA 3W9CB 1B1ZA 1T3QA 2LFIA 1VR9A 1P7EA 2Y5CA 3E56A 1GOZA 4ZRQA 1E10A 3AE7B 1D5XC 1CK1A 1F77A 1L0VB 2RDHA 3Q8EA 2SAKA 2FBWB 4P6VF 2BT6A 1JROA 1FXIA 4A55A 5MPOA 2IDYA 1PDXA 2WXRA 3J9CA 1YQ3B 1IBXA 1F2RC 2VZKB 1C79A 3BZDB 4ARIA 2FE8A 5T8IA 2DLBA 1D4BA 1JALA 3HVZA 3KWLA 1ZE3D 1J7CA 1OFFA 3EUB2 3R2IA 1FCCC 1NVID 3U2SC 2WXQA 1AYFA 2WDRB 1C4PA 1JWAD 2JX5A 1ZDVA 4J3OD 1BXTA 4OZCA 5I4DA 1V1PA 1CQVA 4N6EB 3ZYYX 2CJNA 1YN5A 1JW9D 3GB1A 5C2TB 4GDLB 3NVWA 1VJKA 4A6QA 3R8BA 1UWXA 1BMLC 1I4QA 2W3SA 3V05A 3IT6B 1K52A 5EE9A 4PT5A 1DGJA 1FNVA 1I4GA 1JCKB 4USAA 5EE0A 2JZPA 4ZHPA 2JQRB 1N5WA 4IKGA 4JX1C 1JMLA 1YMHE 5AUKA 1SJHD 1T6BX 1L4ZB 1ACCA 4ZRPA 3CWIA 1FRRA 1AWDA 2L83A 5D7GA 2KQ4X 1SE2A 3VRAB 1AN8A 4OW0A 2WXFA 3MP9A 2GRIA 3AE4B 2JWUA 2MJDA 1Q10A 4C7YA 4HKQA 2TSSA 2CU3A 2WXKA 2KN4A 1FXAA 4O1NA 2WDVB 3MJ5A 1TY2A 2W82A 4XDDA 1PGBA 1TS5A 4RGOS 3L4PA 1KLUD 2JSVX 3VRBB 2DYOA 1ZUD2 4NAMA 4DQOC 5H92C 3T3OA 2WNMA 2DYMA 1RM6C 3MC0B 3SFDB 1QOBA 3I9V1 1KFYB 3IXSA 1WXQA 3R2TA 4RGNA 2LHEA 1E0ZA 1N62A 1V97A 3GP7A 3OWEB 2PVOD 4MACA 1YNTE 2BYTA 1I4HA 1NYRA 1J7AA 1JWMD 1TKEA 1GAQB 1GB1A 1YN3A 2BBCA 1XLNA 4KKJA 1HZ6A 5FK9C 2BB6A 1QILA 2GB1A 4WIPA 4L23A 4B0EA 3ZJUA 3N9YC 1FD6A 1QT9A 2H88B 1KH0A 3AEFB 5EE1A 1M4VA 3AE8B 2WQYB 1ENFA 1L6VA 1XLPA 2LJIA 4RNAA 2X38A 2GI9A 2I2YA 1TS2A 4YXDB 3ZJTA 2IGDA 3EGRA 2NTTA 2B76B 3TEZA 3HUIA 1EU4A 4XWWA 2V0GA 4LTUA 2KMMA 2KDMA 1NYQA 3AEBB 1ET9A 1SF0A 3LXFA 3AE2B 1C9FA 2HDEA 1CJEA 3NVZA 4ZOHC 1XCTL 1ZXIA 2LEKA 1MHHE 1TJEA 3W1SA 1PYWD 1SJED 2W55A 1R7SA 2QSDA 2NMQA 4KGTA 3PZ7A 2EELA 2ONQA 4YWGG 1ZXHA 3P4RB 4RFBA 3FILB 1D5MC 4N59A 1EWYC 1N61A 3AH7A 5EE3A 2XNAC 2L32A 4RGMA 2KACA 2IPKD 1VZ6A 4R3DA 3W5VB 5BYSA 3C8YA 5FR3A 1TS3A 4TQ0A 2QEJC 1XXGA 3B2GA 4KGSA 3U52E 1IUEA 1J7BA 1JQ4A 1YQ4B 2PMVA 4OHJA 2JU6X 2H89B 1DOIA 1STEA 2QILA 1FFVA 1JRPA 1LO5D 3EA6A 3NRZA 4XDCA 1N5XA 3SFEB 4TSSA 4D2KA 1JWSD 3W2DA 3CIRB 4LLGM 2QIEB 2WXLA 2DBYA 2OEDA 1I4RA 4M0WA 2V3NA 1WGKA 3UI3A 2N9LA 1ZPSA 1D5ZC 2V3PA 3ABVB 5FKAC 1NI3A 4XE0A 2WP9B 4MT5A 1UUPA 4YTPB 3GS2A 4DXGA 1EWCA 3Q69A 3P4SB 1WWTA 1FMAD 2NTSA 3AEDB 2Y3AA 5BMIA 2AQ2B 2IJ0A 1V1OA 4HKZE 3NVYA 2WLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E0Z A;  1N62 A;  1DOY A;  1V97 A;  4C80 A;  3VR8 B;  1N60 A;  2PVO D;  2WS3 B;  3P4Q B;  4YSY B;  4YTN B;  2MH7 A;  3B2F A;  4A9A A;  5GXG B;  2DWQ A;  1NYR A;  1J7A A;  3RPF C;  1TKE A;  3AE3 B;  1GAQ B;  5G5G A;  4US8 A;  1QF6 A;  1WRI A;  1XLN A;  4C7Z A;  5C3J B;  4YSX B;  3AN1 A;  3WCQ A;  2OHF A;  4WWM A;  1NEN B;  1N63 A;  1PFD A;  3AE1 B;  1T3Q A;  3B9J A;  1I7H A;  3P1M A;  2QJL A;  1QT9 A;  1L5P A;  1FM0 D;  1QOG A;  1XLO A;  2H88 B;  2Y5C A;  4N58 A;  3AEC B;  3AEF B;  1FIQ A;  5EE1 A;  1E10 A;  3AE7 B;  1L6U A;  1L0V B;  3AE9 B;  3AE8 B;  2WQY B;  1L6V A;  2FBW B;  1XLP A;  4IDI A;  4P6V F;  2BT6 A;  3BII D;  2E3T A;  2MJE A;  3AE5 B;  1JRO A;  1FXI A;  3AEA B;  5MPO A;  1GPX A;  1PDX A;  2PVG C;  3ETR A;  4YXD B;  1YQ3 B;  4KX6 B;  1RWS A;  1E9M A;  3P4P B;  2B76 B;  5H8Y E;  3HUI A;  2K5P A;  4LTU A;  1KRH A;  1TKY A;  2KMM A;  4JWU C;  1JAL A;  1NYQ A;  1TYG B;  3AEB B;  2L52 A;  2PKO A;  1SF0 A;  3HVZ A;  3AE2 B;  3KWL A;  3LXF A;  5AUI A;  2G1E A;  2WU5 B;  1CJE A;  3NVZ A;  1J7C A;  1OQR A;  1ZXI A;  4HRS A;  4ZOH C;  1OFF A;  2LEK A;  2BS4 B;  1TJE A;  3EUB 2;  1ZOY B;  2M19 A;  2W55 A;  1NVI D;  1JWB D;  1R7S A;  3AMZ A;  1ROE A;  1AYF A;  2Q5W D;  1QLB B;  2WDR B;  2K22 A;  2N0S B;  1JWA D;  2JX5 A;  1E7P B;  1OQQ A;  2PIA A;  3W5U B;  3FC4 A;  3P4R B;  1SIJ A;  1QOF A;  4N6E B;  2CJO A;  1CZP A;  4N59 A;  3ZYY X;  1EWY C;  1N61 A;  3AH7 A;  2CJN A;  5EE3 A;  4YSZ B;  4YTM B;  1JW9 D;  4ITK A;  4WQM A;  3VR9 B;  2WDQ B;  1SB3 C;  1YJI A;  1ZP0 B;  4HRO A;  5C2T B;  3W5V B;  3NVW A;  1VJK A;  1XO3 A;  1E6E B;  4US9 A;  3AM9 A;  1UWM A;  4YT0 B;  2W3S A;  1FFU A;  2BS2 B;  3HRD D;  3B2G A;  2W54 A;  2WU2 B;  1TKG A;  3AEG B;  1IUE A;  1J7B A;  5EE9 A;  3NS1 A;  1JQ4 A;  1YQ4 B;  1DGJ A;  1F0Z A;  1VLB A;  4USA A;  2H89 B;  1DOI A;  5EE0 A;  5G5H A;  1FFV A;  3NVV A;  4ZHP A;  2JQR B;  1N5W A;  2KAJ A;  1JRP A;  3FAH A;  4JX1 C;  2MJ3 A;  1RYJ A;  3P63 A;  3NRZ A;  1FRD A;  5AUK A;  3CWI A;  1N5X A;  1FRR A;  1AWD A;  1V8C A;  3SFE B;  2L83 A;  3CIR B;  3VRA B;  2QIE B;  1B9R A;  3LB8 C;  4JWS C;  2DBY A;  1FO4 A;  2M56 B;  3AE6 B;  3AV8 A;  3AE4 B;  1WGK A;  1KF6 B;  2EKI A;  2MJD A;  4C7Y A;  2CU3 A;  2WLB A;  2AX5 A;  1WYG A;  3ABV B;  1NI3 A;  1QOA A;  1PUT A;  1FXA A;  2WP9 B;  2WDV B;  1VDV A;  3AB5 A;  4YTP B;  1RFK A;  3L4P A;  4FXC A;  2BS3 B;  4ZHO A;  3P4S B;  1WWT A;  3DWM A;  1FMA D;  3PO0 A;  3VRB B;  1DOX A;  1ZUD 2;  2HTM E;  2W3R A;  3AED B;  5H92 C;  3W9C B;  1RM6 C;  1YJJ A;  3SFD B;  1QOB A;  1A70 A;  3SR6 A;  3NVY A;  2ACZ B;  2K9X A;  3AEE B;  3DWG C;  1KFY B;  1WXQ A;  1NEK B;  1XLQ A; 
#chains in the Genus database with same CATH topology
 2K25 A;  2QDF A;  2DYB A;  1NI2 A;  4IUM B;  4FJZ A;  2EMT A;  2C5L C;  3FIL A;  3RPF C;  3AE3 B;  1QF6 A;  1GJZ A;  3QAQ A;  5LLI A;  2PE9 A;  4E71 A;  4WWM A;  4CQN A;  3NUH B;  1L5P A;  3VFK A;  5E6N A;  1ZDX A;  2KFK B;  3AEA B;  5AEK B;  4X57 B;  1MHX A;  2KJ6 A;  4AP4 C;  3H9D A;  4MGI E;  1GPX A;  3DBS A;  5AZF A;  2NS5 A;  2Z0D B;  3T8M A;  2K5P A;  1OEY A;  2A5U A;  4MDK E;  3O65 B;  4E74 A;  1MVK A;  3ALB A;  2PJH A;  4DXA B;  2INC C;  4KKI A;  2PIA A;  2WXN A;  4S17 A;  4US8 A;  1CZP A;  2DAJ A;  1WGG A;  4CO7 A;  4HRO A;  4US9 A;  1GC7 A;  3ML9 A;  3V6C B;  1K53 A;  2AL6 A;  3ONS A;  2V1Y A;  3GZN B;  3L54 A;  4I6P A;  3FAH A;  4AJW A;  3DBH I;  3BVZ A;  4ANX A;  2KNB A;  2JUO A;  2EMS A;  3RI7 C;  3AE6 B;  4GGQ A;  3EFC A;  4FJV B;  4W9D A;  1MI0 A;  2LGD A;  3RNF C;  3AB5 A;  4HJG E;  3KYC D;  1PGX A;  2PW9 A;  3NZ3 A;  2C7H A;  2XK5 A;  4WJO A;  3VXW A;  2KN5 A;  1NEK B;  3WA0 A;  1C78 A;  4P16 A;  4NJC A;  3TEX A;  3C19 A;  3I3T B;  3ML8 A;  5JXV A;  2LGI A;  4C7Z A;  2D3A A;  3M3J A;  3DVG Y;  1SXT A;  1FIQ A;  3WAL A;  2G9H D;  4IOI E;  2E3T A;  1C76 A;  2MW5 A;  1HEZ E;  3MFG A;  1V86 A;  3Q8B A;  4KX6 B;  1GUA B;  1RWS A;  4K1R B;  2PPH A;  2KTF A;  3P4P B;  3IVF A;  3SU8 X;  2IO2 B;  2N9K A;  3LYY A;  1TYG B;  3RFZ B;  1V9J A;  3TSS A;  5IP4 D;  2WU5 B;  3ENE A;  2WXG A;  4OZB A;  4KDL B;  2ASQ A;  3HVD A;  1QOF A;  2CJO A;  2LUM A;  3BK1 A;  2AQ1 B;  3P2B A;  4FA6 A;  4ITK A;  4ZRK A;  3EHV A;  4LNO A;  4PK1 A;  3OLM D;  2QC8 A;  3KWV A;  3JYU A;  3K9P B;  1SE3 A;  3ZNG C;  3MHS D;  3N20 C;  2N1W A;  2BYE A;  1L0X B;  1RYJ A;  3P63 A;  2PTL A;  2L8J A;  1P98 A;  2MBE A;  2D2Q A;  1QKZ A;  3L10 B;  4I6N B;  2JT4 B;  2L1A A;  2M0A A;  3VQI A;  1WX9 A;  2BS3 B;  3DWM A;  3TIX A;  1FPY A;  2HTM E;  2IY0 B;  3TMP B;  3KQ4 A;  2MQJ A;  2K9X A;  1XF5 L;  2IGG A;  1EO6 A;  1L4D B;  2KWD A;  4UDU C;  1VRA B;  4II3 B;  4GN1 A;  2MH7 A;  1K50 A;  4A9A A;  4P7I A;  1WRI A;  3WCQ A;  4MH0 E;  2LFI A;  4HPP A;  4ZRQ A;  5DPS A;  4EKU A;  4GU2 A;  4NAW A;  2KC1 A;  3AU4 A;  3AUL A;  1PDX A;  2WXR A;  3UF8 A;  1IBX A;  1YQ3 B;  3N3K B;  3BZD B;  2KHW B;  2BYF A;  4HDO A;  1JAL A;  3KH0 A;  5CHW A;  3VH4 B;  3GOE A;  4HJK A;  3PT2 B;  1V1P A;  2NBU A;  2ZVO A;  3UIP B;  3GZN I;  1WMH A;  3TJP A;  1YN5 A;  4GDL B;  3NVW A;  1VJK A;  4A6Q A;  1UBQ A;  2KWV B;  1I4Q A;  3IT6 B;  5DPW A;  2JF5 A;  2YLM A;  3H6N A;  1H8C A;  3A4S C;  4ZHP A;  1N5W A;  1JML A;  4AOF A;  1SJH D;  1GNU A;  2I1K A;  3ZRC A;  1ZW7 A;  3QCA A;  4W9H A;  1AN8 A;  3A9K B;  3AE4 B;  5EDS A;  1Q10 A;  2WXK A;  4LNI A;  3Q2A C;  4O1N A;  2W82 A;  5AZH A;  4WAA A;  1KLU D;  2K1F A;  3ZNI D;  4DQO C;  5H92 C;  1QOB A;  4RM8 A;  3I9V 1;  4RGN A;  2OJW A;  1MG8 A;  1N62 A;  5C1Z A;  1YNT E;  1TKE A;  3AI5 A;  3ZXV A;  3ZVV A;  1GB1 A;  2X8X X;  1XLN A;  3MTN B;  2BB6 A;  1E8Y A;  4L23 A;  4B0E A;  5JZE B;  3W1Y A;  2H88 B;  1M4V A;  3MC9 A;  1KOT A;  1TTN A;  2X38 A;  2I2Y A;  2C7N B;  3VTV A;  4YXD B;  3OG5 A;  4LDT D;  2KDM A;  1TIF A;  1NYQ A;  2LXA A;  3AE2 B;  2ZCB A;  4MJS B;  4ZOH C;  1M94 A;  1PYW D;  3N1Z C;  2NMQ A;  3ZXR A;  5E6O A;  4RFB A;  2O6V B;  4N59 A;  1EWY C;  2XNA C;  2BKF A;  1YQB A;  2KZR A;  2Y5B B;  4R3D A;  5BYS A;  4TQ0 A;  4A3P A;  4W9L A;  1R4M B;  3B2G A;  4YL8 A;  4BBN C;  1JQ4 A;  5C23 A;  4ZDV A;  1STE A;  4W9I A;  1FFV A;  3H7P A;  3LDZ E;  3KUZ A;  3T9L A;  3NRZ A;  4D2K A;  3CIR B;  4NQL B;  2QIE B;  1I35 A;  1I4R A;  1WZ0 A;  1V49 A;  1D5Z C;  1D3Z A;  5FKA C;  2WP9 B;  4MT5 A;  1UUP A;  2NCN A;  3GS2 A;  1UZX B;  5J2R A;  3AED B;  2LUE A;  1BT0 A;  4G3X B;  2I38 A;  2KJR A;  1XQQ A;  4KIK A;  4YTN B;  4FJY A;  5GXG B;  2DWQ A;  1HA5 A;  2Z8L A;  2NPT A;  1T0S C;  3A33 B;  3DVG X;  4QAY A;  2G45 B;  4RF1 A;  5LXH A;  2NR2 A;  5KHQ A;  4JQW C;  1PFD A;  2J53 A;  3P1M A;  4C4V B;  1I7H A;  4EFO A;  4HK2 A;  1ISN A;  4J6I A;  4IDI A;  3RNG C;  5DCN A;  3O13 A;  4TQ1 A;  2FCM A;  4L2Y A;  4WAF A;  1A5R A;  3Q3J A;  2NBV B;  1QZE A;  2BWE S;  1KJT A;  2N7D A;  1LM8 B;  4JWU C;  1I4X A;  4GDK B;  2HD5 B;  3IAS 1;  2PKO A;  1OQR A;  2YEP F;  1P3Q U;  1QQR A;  4S0R A;  4HWI B;  3JSV B;  4HDQ A;  4WJP A;  4LK0 M;  1OQQ A;  5JHA A;  2KVZ A;  2K6D B;  3Q3O C;  1FFU A;  1TKG A;  3AEG B;  3EC8 A;  3MHZ A;  1TT5 B;  2JZ3 B;  1VLB A;  4A90 A;  5TSS A;  4GIV A;  3VTW A;  1FRD A;  3PHX B;  5IKC M;  2AWT A;  4KGR A;  1T0Q C;  1RFA A;  1RAX A;  2IND C;  4HVB A;  4JWS C;  3DVN U;  1KF6 B;  1LGR A;  2ZPN A;  1ZKH A;  2LHD A;  4LNN A;  1HQR D;  3BIN A;  4GLS C;  2QCZ A;  2ZW0 A;  3DBR B;  4OVZ A;  1KTK A;  4ZHO A;  4FUL A;  2W3R A;  2KD0 A;  3T3N A;  1A70 A;  5BYQ A;  1FCL A;  3BK2 A;  1TZO A;  2MWS B;  1TZ1 A;  4LJO B;  3ZTD A;  3Q6B A;  1FNU A;  1N63 A;  1UF0 A;  3B9J A;  1FM0 D;  1C77 A;  1QOG A;  4TKN A;  4XWT A;  5J17 A;  4NZL B;  3DHH C;  3QQ8 B;  4WH4 A;  3DVN V;  2MP2 A;  5D2M B;  2WXO A;  4WJN A;  2PVG C;  4BAX A;  2KTR B;  2IYD B;  1EU3 A;  1GG3 A;  2DHZ A;  2BB5 A;  1HTQ A;  3WAM A;  2G1E A;  4HRS A;  4RGT A;  3PHW B;  4LNK A;  5E6J A;  1JWB D;  3TBL D;  3GE3 C;  2Q5W D;  1R4M I;  4MM3 A;  2LXC A;  5IOI A;  3DPD A;  5LNK 1;  1V2Y A;  1RLF A;  3FC4 A;  1SIJ A;  1F52 A;  4GMV A;  3IAM 1;  3RMK C;  2PEA A;  2WXH A;  4WQM A;  2WDQ B;  2JZZ A;  2DZI A;  3U4E G;  1E6E B;  3AM9 A;  4YT0 B;  2BS2 B;  4KVG B;  2Y5P A;  3NS1 A;  4MGK E;  2LRU A;  1F0Z A;  4IWO A;  1WE6 A;  4RH6 A;  3QWZ B;  3U7D A;  1VCB A;  3NVV A;  1VZ8 A;  3UGB B;  4K3C A;  2ZZP B;  2LVO A;  2J52 A;  1B9R A;  2REX A;  3KLS X;  3NZS A;  3LB8 C;  1FO4 A;  1L0Y B;  3A9J A;  3BWU D;  4DHJ B;  4ZRJ A;  3TUO A;  2W9N A;  2E6X A;  4A20 A;  1WIA A;  1Y56 A;  3SR6 A;  4HEA 1;  3QC8 B;  1XLQ A;  1Z2M A;  2B3A A;  3N30 A;  3I57 A;  4EE2 A;  1ESF A;  1B1Z A;  1T3Q A;  1WM3 A;  4IC7 B;  1P7E A;  1GOZ A;  2DEN B;  1E10 A;  1L0V B;  1WJ6 A;  3Q8E A;  3EFU A;  4P6V F;  1WZ3 A;  3R7Q A;  1FXI A;  4A55 A;  2C9W B;  2KMC A;  3QX1 A;  3J9C A;  5IA7 A;  2VZK B;  3ZLZ A;  2FE8 A;  2DLB A;  1D4B A;  1J8C A;  1ZE3 D;  4P1C C;  2KC2 A;  3R2I A;  1NVI D;  3U2S C;  2WXQ A;  2AYO B;  2V4L A;  4EZL A;  2CKH B;  1F1H A;  1WR6 E;  2L0F A;  1ZDV A;  4J3O D;  1BXT A;  1V5T A;  5I4D A;  1CQV A;  4N6E B;  2KO3 A;  3ZYY X;  5CHV C;  4G50 A;  3R8B A;  2HJ8 A;  5D6J B;  1UWX A;  2W3S A;  3BY4 B;  3V05 A;  3W1S C;  1DGJ A;  2KKC A;  2JQR B;  3LJ3 A;  1NBF C;  2WWZ A;  2GBJ A;  3DBR I;  1T6B X;  4ZRP A;  1WGY A;  2O2V B;  2K8C A;  2M4N A;  2KQ4 X;  1SE2 A;  3Q3N C;  3VRA B;  3Q3F A;  4OW0 A;  2WXF A;  3MP9 A;  2V9H A;  2JWU A;  4C7Y A;  4HKQ A;  2TSS A;  1FXA A;  2WDV B;  1TY2 A;  3B0A A;  3NS8 A;  1PGB A;  3RT3 B;  5LXI B;  3T3O A;  2DYM A;  3DDC B;  3SFD B;  3VVW B;  2J0J A;  2G4D B;  2LHE A;  2M17 A;  3VTU A;  3QAR A;  3PRP B;  2BYT A;  1OEY J;  1JWM D;  2K6Q A;  3NHE B;  1GAQ B;  1YN3 A;  2BBC A;  4KKJ A;  3WAP A;  2GB1 A;  3ZJU A;  1P1A A;  3N9Y C;  3AEF B;  5EE1 A;  4MSQ B;  4RNA A;  4M0W B;  2IGD A;  2NTT A;  3I5J C;  4BFR A;  2WYQ A;  4ANU A;  2MX2 A;  1E8Z A;  4PS8 A;  3AEB B;  1SF0 A;  3PS6 A;  1CJE A;  1ZXI A;  1R7S A;  2EKE C;  2LI5 A;  1WM2 A;  3Q14 C;  2EEL A;  4WWO A;  3B08 A;  4PS7 A;  2GLS A;  3FIL B;  1D5M C;  2N7E A;  2L32 A;  3V6E B;  3WAN A;  4XYC A;  2IPK D;  1VZ6 A;  3RN9 C;  3K9O B;  2BVC A;  3GE8 C;  4XZ4 A;  2QEJ C;  4KGS A;  3A1Q A;  3U52 E;  1J7B A;  3RUL A;  3X0W A;  4ANW A;  4OHJ A;  1YX5 B;  2JU6 X;  2QIL A;  3PRE A;  1WGD A;  1JRP A;  2BF8 B;  1LO5 D;  2D3B A;  3TCA A;  3ZKJ C;  3AU5 A;  3B1L X;  2VH1 A;  2MA9 B;  2K8H A;  2NBW B;  3PLU A;  3PVL A;  3ZUN A;  1KLV A;  1FXT B;  4B9K A;  2WXL A;  4HPL B;  3ZDT A;  2V3N A;  2V3P A;  3ABV B;  1HTO A;  4DHZ B;  4YTP B;  3WIM A;  2JRI B;  3Q69 A;  4EOY A;  1FMA D;  1LQB A;  2BYV E;  4B95 A;  1YJ1 A;  1X1M A;  3KYD D;  1SEB D;  4TMA B;  3VR8 B;  4YSY B;  2KOX A;  3I63 C;  3ZJV A;  5D3D A;  5CHF A;  2M0X A;  1SGH A;  4K7S A;  2QJL A;  4BKT A;  3QIJ A;  4ICU A;  3BYY B;  1L6U A;  2GMI C;  2J42 A;  4GXB A;  2KX0 A;  4C00 A;  3MC8 A;  4L1B A;  3PZ8 A;  2ON8 A;  1WI0 A;  4WWP A;  1E9M A;  5H8Y E;  1C4C A;  1VZ7 A;  1TKY A;  2WXI A;  3OJ4 B;  4RCO A;  1TS4 A;  4FHJ A;  2VRR B;  1ZOY B;  2IO3 B;  2XK5 B;  2J0M A;  2RDB C;  2LWP A;  3V62 A;  2K22 A;  3KUC B;  2J0K A;  1E7P B;  3H1U A;  3C0R B;  4AJY B;  4PS3 A;  3H7S A;  3VR9 B;  4M01 A;  4ANV A;  1UWM A;  3NOB A;  3HRD D;  4OVV A;  4LNF A;  2LMC A;  2HE7 A;  5HFY A;  3V3X A;  4G0N B;  3PGE A;  3UIO B;  1E7V A;  2MJ3 A;  1G6J A;  2XBB C;  1IGD A;  2PLP A;  4DDG D;  2KK8 A;  2KFK A;  2LVQ A;  3ZNZ B;  2LRW A;  1Q5W B;  3APC A;  4A8X C;  1MFW A;  4JLC A;  4ZRI A;  3DQV A;  1L7Y A;  5G2N A;  2BPS A;  2ZNV C;  5FR6 A;  2GOW A;  1RFK A;  1SIF A;  2RMM A;  1YJJ A;  4DXF A;  3ECI A;  2RPV A;  3AEE B;  4B0M A;  2WXM A;  4HXD A;  2WS3 B;  1TY0 A;  2N7J A;  3X23 A;  4N9F 4;  1XT9 B;  1FEH A;  1NDD A;  2OHF A;  1NEN B;  3RNB C;  4EZK A;  1UGJ A;  1XLO A;  2C7M B;  2MBQ A;  3AEC B;  2AQ3 B;  2G4S A;  4KDI C;  3AE9 B;  1UGM A;  3BII D;  3AE5 B;  3U7Z A;  3SEB A;  4DHZ E;  1OQY A;  1V80 A;  4EEW A;  2K0P A;  4XX5 A;  1EM7 A;  3L13 A;  3BYT B;  1OGW A;  1AW7 A;  1ET6 A;  3Q8A A;  3ZO5 B;  2XN9 C;  3VAW A;  5AUI A;  4JPS A;  3IFW B;  5D94 A;  4NPN A;  4XC2 A;  4JE3 B;  4M8N A;  1SBB B;  3SD5 A;  3NG0 A;  2KDF B;  5JHB A;  4F7Z A;  3W5U B;  3L16 A;  1FNW A;  1HZ5 A;  2MBB B;  3P42 A;  2JPH A;  5BMH A;  1SB3 C;  1OTR B;  5BYR A;  3WAO A;  1T0Y A;  2D5G A;  1EF1 A;  1JWU D;  2R2O A;  1E5W A;  4MH8 A;  3CST A;  3RYT A;  4NAW B;  2KAN A;  5G5H A;  4TV3 A;  3PPA A;  4PYU A;  3DCG A;  5CX3 A;  1IBX B;  1HXY D;  3PTF C;  1V8C A;  2FIF A;  2DNF A;  3TEW A;  4BOS C;  1BUI C;  3AV8 A;  4KSK C;  2EKI A;  1WYG A;  2JXX A;  2R61 A;  4URK A;  3BVG A;  2SEB D;  5AZG A;  2O6V D;  4FXC A;  1P9D U;  1WXV A;  1DOX A;  3IG3 A;  2FNJ B;  1V1P B;  2D11 A;  4ARC A;  1WMH B;  2RDG A;  2MBH A;  3ZTC A;  1XCQ L;  1YN4 A;  1SSN A;  2RPQ A;  4M02 A;  2IGH A;  1DOY A;  2D3G A;  2IO1 B;  5BMG A;  3S2A A;  4IW0 A;  3KUD B;  1IYF A;  4M00 A;  2KDE B;  2RD0 A;  3AN1 A;  4Q2J A;  2BKR B;  3W9C B;  3U8Z A;  2Y5C A;  3AE7 B;  1D5X C;  2N4F A;  1F77 A;  4K7W A;  4RM9 A;  2KT7 A;  2RDH A;  2FBW B;  1Y8R C;  2CU1 A;  5CTR C;  1JRO A;  4IG7 B;  3ZRF A;  2WX1 A;  1WFY A;  3N1X C;  5L95 C;  4ICV A;  1WR1 A;  4GB9 A;  3ZDM C;  3HVZ A;  1WGR A;  3KWL A;  2ZNV B;  4LJP B;  5IN7 A;  1OFF A;  3EUB 2;  2KXJ A;  1FCC C;  2M1M A;  2BGF A;  4FHK A;  3NY5 A;  3DOW A;  2JX5 A;  1LXD A;  5GMV A;  4WQO B;  1E8X A;  3U30 A;  2CJN A;  3GB1 A;  5C2T B;  3ZIM A;  2WHI A;  3RCZ A;  1BML C;  4W9J A;  3DBL I;  4FN2 A;  4E3C A;  4BKG A;  3RZF A;  1JCK B;  5EE0 A;  2KQ7 A;  4CHK A;  1AWD A;  5TR5 A;  3ZW3 A;  2ZPY A;  5D7G A;  1AAR A;  2IY1 B;  2GRI A;  4IWQ A;  4JIO U;  2KN4 A;  2PE6 B;  1Q1O A;  1TS5 A;  4RGO S;  2JSV X;  4NAM A;  1WX8 A;  1RM6 C;  3MC0 B;  2KWU B;  2J7Q B;  1KM7 A;  3CMM B;  4MEM A;  1KFY B;  3IXS A;  3R2T A;  1E0Z A;  1J19 A;  1V97 A;  4MAC A;  3APD A;  1J7A A;  1K8R B;  1P0R A;  1TBE A;  2OJR A;  5IO9 A;  3IHP C;  2UU7 A;  1HZ6 A;  5FK9 C;  1QIL A;  4WIP A;  4GDL A;  1C1Y B;  4F1S A;  3H7P B;  4WWN A;  1Z5S B;  1L2N A;  2RR9 A;  1WGH A;  3AE8 B;  1ENF A;  2D10 A;  2IO0 B;  2LJI A;  4AUQ C;  4W9F A;  3L08 A;  3L0W B;  2BQQ A;  3ZJT A;  3EGR A;  3RUI B;  3HUI A;  1EU4 A;  2KMM A;  1GC6 A;  3VDZ A;  1ET9 A;  1XD3 B;  3A9K A;  3NVZ A;  1XCT L;  1MHH E;  3W1S A;  1SJE D;  2W55 A;  2KDB A;  2ZCC A;  4EZJ A;  4KGT A;  2AL3 A;  4NJ6 A;  3PZ7 A;  4KIK B;  4ASW C;  3A4R A;  1ZXH A;  3RZW C;  4KV2 A;  2NPT B;  3RNA C;  4RGM A;  2KAC A;  3W5V B;  3R66 C;  4FAD A;  3C8Y A;  5FR3 A;  3HIZ A;  3QK0 A;  1XXG A;  4B6W A;  1YQ4 B;  2PMV A;  2IZV B;  2H89 B;  1DOI A;  2KLG A;  2LVP A;  2D07 B;  3EA6 A;  1N5X A;  3MJW A;  1UH6 A;  3W2D A;  4LLG M;  3N32 A;  1E8W A;  2DBY A;  2OED A;  3OJ3 A;  1WGK A;  3UI3 A;  2N9L A;  1ZPS A;  3V60 A;  2MCN B;  4XE0 A;  5HKH A;  2UWQ A;  4DXG A;  1WX7 A;  1EWC A;  3P4S B;  1WWT A;  2NTS A;  4MJS A;  1IPG A;  2IJ0 A;  1V1O A;  2NVU I;  3HM3 A;  1JRU A;  2WLB A;  2QMT A;  4C80 A;  3P4Q B;  1U4A A;  2BWF A;  4KSL C;  2O6V A;  2JYT A;  2WX0 A;  4W9K A;  3IT4 B;  4IM3 A;  1YD8 U;  4AQ7 A;  3AE1 B;  2LD9 A;  2KYW A;  4N58 A;  1PGA A;  1SE4 A;  4BBN F;  2WXJ A;  2R2Q A;  4W9C A;  2L00 B;  2LGS A;  3Q8F A;  4HCN B;  4DHJ D;  3RNE C;  2GBM A;  4MEL A;  2DX5 B;  1IGC A;  1T5X D;  1WRD B;  4BZA A;  2DZM A;  4MSM B;  1MG4 A;  3AXC A;  1T0R C;  1F2R I;  2WXP A;  3E9S A;  3SHQ A;  3JVZ X;  4C56 C;  1ROE A;  2N1V A;  4NJ7 A;  3PZD A;  2N0S B;  2QHO A;  1UD7 A;  1GB4 A;  1MPE A;  3R3M A;  4RMA A;  4HPM B;  2M8S A;  3UQB A;  1ZP0 B;  1S1Q B;  5D3I B;  2W54 A;  2WU2 B;  4AS1 A;  1K51 A;  2FAZ A;  2MP2 B;  2VZK D;  2ZJD A;  4H2A A;  4IM2 A;  2FCN A;  4C4V A;  2INN E;  3M63 B;  1YIW A;  4XGA B;  2DZK A;  5KHO A;  4NQK E;  5JH5 C;  2M56 B;  1E90 A;  4ZYS A;  2AX5 A;  1QOA A;  1PUT A;  2CR5 A;  2INP E;  4GSW A;  4MM3 B;  4GDK A;  2V4I B;  2VH2 A;  3EEC A;  2CHW A;  4G11 A;  2LGX A;  3N1Y C;  4LDT B;  2JY6 A;  4F8C B;  3ZGZ A;  4A3O A;  3JSV A;  3TEY A;  2XEW A;  3HHM A;  4ACF A;  2J4X A;  1R4N B;  2FUG 1;  5BO4 B;  4PYZ A;  3B2F A;  3Q8C A;  2Z59 B;  2L3Z A;  2L7R A;  3PRM B;  2FCS A;  3QHT A;  3VHT C;  3H8H A;  1WXS A;  1XEE A;  3URY A;  4GOC A;  1WSP A;  2JYE A;  1YOV B;  3RD2 A;  2MJE A;  3NJT A;  2K3U A;  3ETR A;  3A9J B;  3KVF B;  3V61 A;  2YEP B;  1KRH A;  3PLV A;  1WE7 A;  5HG2 A;  2L52 A;  4FBJ B;  2BS4 B;  4REZ A;  4WUR A;  2M19 A;  3D32 A;  3HM6 X;  2AEH A;  1RRB A;  2FCQ A;  3AMZ A;  3NZU A;  2N9P C;  1D6E C;  1QLB B;  1N6Z A;  2KJH B;  1C4A A;  2KWC A;  2WDT B;  1WYW B;  5HI1 A;  1HE8 A;  4BKS D;  4HLE A;  2RGF A;  4YSZ B;  4YTM B;  2HTH A;  3VUX A;  4HCP B;  1DYQ A;  1YJI A;  3BVM A;  1XO3 A;  2LJ5 A;  1WH3 A;  3HK0 A;  2Z0E B;  3Q3M C;  2ZVN A;  2JXT A;  2KAJ A;  4DDI D;  2ZW1 A;  2BTE A;  1VD2 A;  4JL9 A;  2YVC A;  2CHZ A;  1I42 A;  1J0G A;  1UNS A;  2ZEQ A;  1P7F A;  4AWJ A;  5DPT A;  3CF6 E;  4II2 B;  1VDV A;  2KTR A;  2KMA A;  5HHD G;  2BW2 A;  3PO0 A;  4IWP A;  2JRH A;  4NY0 A;  3FKY A;  2JWZ A;  2ACZ B;  2MSE D;  3L17 A;  3DWG C;  1KLG D;  2MEK A;  1I4P A;  1N60 A;  3DBL B;  3ZQ4 A;  2GBK A;  4OZA A;  3ZNH B;  2ICI A;  4FLH A;  5G5G A;  5C3J B;  4YSX B;  1YX6 B;  4RF0 A;  1C3T A;  1WJN A;  1ZGU B;  3KW5 B;  1VR9 A;  3E56 A;  2WGS A;  3PSE B;  1WJ4 A;  1CK1 A;  2RSU A;  2SAK A;  2BT6 A;  2MRP A;  1TGZ B;  3PRZ A;  5MPO A;  3OAW A;  2IDY A;  2GBN A;  1F2R C;  1C79 A;  4ARI A;  2KQS A;  5E6P A;  5T8I A;  3IBE A;  3M62 B;  1IP9 A;  1J7C A;  5G55 A;  4KZC A;  3CSF A;  1AYF A;  2WDR B;  1C4P A;  1JWA D;  3DHG C;  4OZC A;  2MLB A;  3RNC C;  2DAF A;  1JW9 D;  4W9E A;  1CMX B;  2K39 A;  4DBG A;  5DPR A;  2KX3 A;  1K52 A;  2I1J A;  5EE9 A;  4PT5 A;  1FNV A;  2D3C A;  1I4G A;  4USA A;  2JZP A;  2L05 A;  4IKG A;  4JGH B;  4JX1 C;  4BVU C;  1YMH E;  5AUK A;  3QJZ A;  1L4Z B;  1ACC A;  2N9X A;  3CWI A;  1FRR A;  2L83 A;  1WXM A;  4MGY E;  5J18 A;  1S3S G;  2MJD A;  4IM0 A;  1WJU A;  2CU3 A;  5L83 A;  1UEL A;  1R4N I;  4K7U A;  3MJ5 A;  4XDD A;  3DBH B;  3L4P A;  3UIN B;  4DWF A;  3VRB B;  4CYE A;  2DYO A;  1ZUD 2;  4OVU A;  2WNM A;  4I6L B;  3SDL C;  1MJD A;  1E7U A;  1WXQ A;  2KFJ A;  2L0T A;  4LCD E;  3GP7 A;  3OWE B;  2PVO D;  4BOZ B;  2HJ1 A;  1I4H A;  2L76 A;  1NYR A;  3A1Q B;  1UBI A;  4KZ0 A;  3QA8 A;  1PQS A;  1FD6 A;  1QT9 A;  4K3B A;  2OOB B;  1KH0 A;  2WQY B;  4K81 A;  1L6V A;  1XLP A;  2JVC A;  2UYZ B;  3DHI C;  2GI9 A;  1V81 A;  1TS2 A;  2DZJ A;  2KVR A;  3VUY A;  2CHX A;  2O2V A;  4W9G A;  3VH3 B;  2B76 B;  3TEZ A;  4XWW A;  2V0G A;  2LGY A;  4LTU A;  2MHJ A;  3PV1 A;  2FID A;  4NNJ B;  3LXF A;  1C9F A;  2HDE A;  2LZ6 A;  2LEK A;  2KLC A;  1TJE A;  2GBR A;  3APF A;  1Q0W B;  2QSD A;  2G3Q B;  1EF5 A;  1EUV B;  3M95 A;  1LFD A;  2ONQ A;  4YWG G;  3P4R B;  2A4Z A;  2K8B A;  3AH7 A;  1N61 A;  2MBO A;  4M8M A;  5EE3 A;  1V6E A;  1SE9 A;  3VUW A;  1V5O A;  1F9J A;  1H4R A;  1TS3 A;  2LAS A;  2IBI B;  1WXA A;  1IUE A;  2C60 A;  4BKS A;  2KDI A;  1WY8 A;  4MGZ E;  1WF9 A;  5IAA C;  2N9E B;  4WJQ A;  4XDC A;  3TL5 A;  2V3S A;  3SFE B;  4TSS A;  1JWS D;  4DK5 A;  4TUU A;  2FUH B;  4M0W A;  3R7R A;  4ZYN A;  1NI3 A;  3UQA A;  4P1B C;  2CS4 A;  2Y3A A;  5BMI A;  2AQ2 B;  4EUT A;  3JW0 X;  4HKZ E;  3NVY A; 
#chains in the Genus database with same CATH homology
 2I38 A;  1SEB D;  2QMT A;  4C80 A;  4TMA B;  3VR8 B;  3P4Q B;  4YSY B;  4YTN B;  5GXG B;  2DWQ A;  1HA5 A;  3FIL A;  2Z8L A;  2JYT A;  3RPF C;  3AE3 B;  5D3D A;  3ZJV A;  1QF6 A;  3IT4 B;  4RF1 A;  4AQ7 A;  4WWM A;  1PFD A;  2J53 A;  3AE1 B;  3P1M A;  4CQN A;  1I7H A;  3NUH B;  2QJL A;  1L5P A;  4N58 A;  3BYY B;  1L6U A;  1PGA A;  1SE4 A;  2J42 A;  2WXJ A;  1ZDX A;  4IDI A;  3O13 A;  3Q8F A;  4TQ1 A;  3AEA B;  4L2Y A;  1MHX A;  4WAF A;  4L1B A;  1IGC A;  1T5X D;  1GPX A;  3PZ8 A;  2ON8 A;  1E9M A;  5H8Y E;  2K5P A;  1C4C A;  1VZ7 A;  1TKY A;  4JWU C;  2WXI A;  1I4X A;  4RCO A;  4GDK B;  3IAS 1;  1F2R I;  2WXP A;  2PKO A;  3E9S A;  1TS4 A;  1OQR A;  1MVK A;  2YEP F;  1QQR A;  1ZOY B;  4C56 C;  1ROE A;  2K22 A;  2N0S B;  4KKI A;  1E7P B;  4LK0 M;  1OQQ A;  1GB4 A;  2PIA A;  1MPE A;  2WXN A;  4US8 A;  1CZP A;  3VR9 B;  1ZP0 B;  4HRO A;  4US9 A;  1UWM A;  5D3I B;  1FFU A;  3HRD D;  2W54 A;  1K53 A;  2WU2 B;  1TKG A;  3AEG B;  4AS1 A;  1K51 A;  3MHZ A;  2LMC A;  5HFY A;  3V3X A;  1VLB A;  2VZK D;  4H2A A;  4A90 A;  3FAH A;  5TSS A;  2MJ3 A;  2INN E;  1FRD A;  1IGD A;  3BVZ A;  4KGR A;  2PLP A;  4JWS C;  2M56 B;  3AE6 B;  4A8X C;  1KF6 B;  2LHD A;  2AX5 A;  4ZYS A;  1MI0 A;  1HQR D;  1QOA A;  1PUT A;  3AB5 A;  2INP E;  4GLS C;  2ZW0 A;  1RFK A;  4HJG E;  4MM3 B;  1KTK A;  4OVZ A;  4ZHO A;  2V4I B;  2RMM A;  1PGX A;  2PW9 A;  2W3R A;  3NZ3 A;  3T3N A;  1YJJ A;  4DXF A;  3ZGZ A;  1A70 A;  5BYQ A;  2RPV A;  3AEE B;  4B0M A;  1FCL A;  1NEK B;  3BK2 A;  1TZO A;  3TEY A;  2WXM A;  2J4X A;  1C78 A;  4P16 A;  2FUG 1;  2WS3 B;  3B2F A;  1TY0 A;  3Q8C A;  4NJC A;  3TEX A;  2N7J A;  5JXV A;  2LGI A;  4C7Z A;  1FEH A;  1FNU A;  2OHF A;  1NEN B;  1N63 A;  3B9J A;  1UGJ A;  1FM0 D;  1C77 A;  1QOG A;  1XLO A;  3H8H A;  1XEE A;  4XWT A;  1SXT A;  3AEC B;  1FIQ A;  2AQ3 B;  4NZL B;  3AE9 B;  3URY A;  2G9H D;  1WSP A;  4IOI E;  2JYE A;  4WH4 A;  3BII D;  2E3T A;  2MJE A;  3AE5 B;  1C76 A;  3SEB A;  3U7Z A;  2WXO A;  1HEZ E;  2PVG C;  3MFG A;  2K3U A;  3ETR A;  3Q8B A;  4KX6 B;  2K0P A;  1RWS A;  1EM7 A;  3BYT B;  3P4P B;  1AW7 A;  1ET6 A;  3Q8A A;  2N9K A;  2YEP B;  3LYY A;  1KRH A;  5HG2 A;  1EU3 A;  1TYG B;  2XN9 C;  2BB5 A;  2L52 A;  3RFZ B;  5AUI A;  4JPS A;  3TSS A;  2G1E A;  2WU5 B;  4HRS A;  4RGT A;  2BS4 B;  4REZ A;  4WUR A;  2M19 A;  5E6J A;  2WXG A;  1JWB D;  3AMZ A;  4JE3 B;  4OZB A;  1SBB B;  1D6E C;  1QLB B;  2Q5W D;  1C4A A;  3HVD A;  5HI1 A;  5LNK 1;  3W5U B;  3FC4 A;  1SIJ A;  1QOF A;  3IAM 1;  2CJO A;  1FNW A;  2LUM A;  1HZ5 A;  4YSZ B;  3BK1 A;  2AQ1 B;  3P42 A;  4YTM B;  4ITK A;  2WXH A;  4WQM A;  5BMH A;  2WDQ B;  1DYQ A;  1SB3 C;  1YJI A;  3BVM A;  5BYR A;  1XO3 A;  3U4E G;  1E6E B;  3AM9 A;  4YT0 B;  2BS2 B;  2D5G A;  1JWU D;  4MH8 A;  2Y5P A;  3NS1 A;  3KWV A;  1F0Z A;  4RH6 A;  1SE3 A;  4NAW B;  5G5H A;  3NVV A;  2JXT A;  2KAJ A;  1VZ8 A;  2ZW1 A;  2BTE A;  1L0X B;  1RYJ A;  3P63 A;  1IBX B;  1HXY D;  2PTL A;  1V8C A;  2J52 A;  3TEW A;  1B9R A;  3KLS X;  3LB8 C;  1UNS A;  1BUI C;  1FO4 A;  1P7F A;  1L0Y B;  3AV8 A;  1QKZ A;  2EKI A;  3BWU D;  1WYG A;  2R61 A;  1VDV A;  2L1A A;  2M0A A;  3VQI A;  3BVG A;  2SEB D;  4FXC A;  5HHD G;  2BS3 B;  2BW2 A;  3TUO A;  3DWM A;  3PO0 A;  1DOX A;  2HTM E;  2E6X A;  1V1P B;  3KQ4 A;  1Y56 A;  4ARC A;  3SR6 A;  4HEA 1;  2ACZ B;  3DWG C;  1KLG D;  2K9X A;  1XF5 L;  2RDG A;  2IGG A;  1YN4 A;  1XCQ L;  1XLQ A;  1SSN A;  1L4D B;  2KWD A;  2MEK A;  2IGH A;  4UDU C;  1DOY A;  1VRA B;  1I4P A;  5BMG A;  1N60 A;  3ZQ4 A;  2MH7 A;  1K50 A;  3I57 A;  4OZA A;  4A9A A;  2ICI A;  5G5G A;  4EE2 A;  1WRI A;  5C3J B;  4YSX B;  3AN1 A;  4RF0 A;  3WCQ A;  4Q2J A;  1ESF A;  3W9C B;  1B1Z A;  1T3Q A;  2LFI A;  1VR9 A;  1P7E A;  2Y5C A;  3E56 A;  1GOZ A;  4ZRQ A;  1E10 A;  3AE7 B;  1D5X C;  1CK1 A;  1F77 A;  1L0V B;  2RDH A;  3Q8E A;  2SAK A;  2FBW B;  4P6V F;  2BT6 A;  1JRO A;  1FXI A;  4A55 A;  5MPO A;  2IDY A;  1PDX A;  2WXR A;  3J9C A;  1YQ3 B;  1IBX A;  1F2R C;  2VZK B;  1C79 A;  3BZD B;  4ARI A;  2FE8 A;  5T8I A;  2DLB A;  1D4B A;  1JAL A;  3HVZ A;  3KWL A;  1ZE3 D;  1J7C A;  1OFF A;  3EUB 2;  3R2I A;  1FCC C;  1NVI D;  3U2S C;  2WXQ A;  1AYF A;  2WDR B;  1C4P A;  1JWA D;  2JX5 A;  1ZDV A;  4J3O D;  1BXT A;  4OZC A;  5I4D A;  1V1P A;  1CQV A;  4N6E B;  3ZYY X;  2CJN A;  1YN5 A;  1JW9 D;  3GB1 A;  5C2T B;  4GDL B;  3NVW A;  1VJK A;  4A6Q A;  3R8B A;  1UWX A;  1BML C;  1I4Q A;  2W3S A;  3V05 A;  3IT6 B;  1K52 A;  5EE9 A;  4PT5 A;  1DGJ A;  1FNV A;  1I4G A;  1JCK B;  4USA A;  5EE0 A;  2JZP A;  4ZHP A;  2JQR B;  1N5W A;  4IKG A;  4JX1 C;  1JML A;  1YMH E;  5AUK A;  1SJH D;  1T6B X;  1L4Z B;  1ACC A;  4ZRP A;  3CWI A;  1FRR A;  1AWD A;  2L83 A;  5D7G A;  2KQ4 X;  1SE2 A;  3VRA B;  1AN8 A;  4OW0 A;  2WXF A;  3MP9 A;  2GRI A;  3AE4 B;  2JWU A;  2MJD A;  1Q10 A;  4C7Y A;  4HKQ A;  2TSS A;  2CU3 A;  2WXK A;  2KN4 A;  1FXA A;  4O1N A;  2WDV B;  3MJ5 A;  1TY2 A;  2W82 A;  4XDD A;  1PGB A;  1TS5 A;  4RGO S;  3L4P A;  1KLU D;  2JSV X;  3VRB B;  2DYO A;  1ZUD 2;  4NAM A;  4DQO C;  5H92 C;  3T3O A;  2WNM A;  2DYM A;  1RM6 C;  3MC0 B;  3SFD B;  1QOB A;  3I9V 1;  1KFY B;  3IXS A;  1WXQ A;  3R2T A;  4RGN A;  2LHE A;  1E0Z A;  1N62 A;  1V97 A;  3GP7 A;  3OWE B;  2PVO D;  4MAC A;  1YNT E;  2BYT A;  1I4H A;  1NYR A;  1J7A A;  1JWM D;  1TKE A;  1GAQ B;  1GB1 A;  1YN3 A;  2BBC A;  1XLN A;  4KKJ A;  1HZ6 A;  5FK9 C;  2BB6 A;  1QIL A;  2GB1 A;  4WIP A;  4L23 A;  4B0E A;  3ZJU A;  3N9Y C;  1FD6 A;  1QT9 A;  2H88 B;  1KH0 A;  3AEF B;  5EE1 A;  1M4V A;  3AE8 B;  2WQY B;  1ENF A;  1L6V A;  1XLP A;  2LJI A;  4RNA A;  2X38 A;  2GI9 A;  2I2Y A;  1TS2 A;  4YXD B;  3ZJT A;  2IGD A;  3EGR A;  2NTT A;  2B76 B;  3TEZ A;  3HUI A;  1EU4 A;  4XWW A;  2V0G A;  4LTU A;  2KMM A;  2KDM A;  1NYQ A;  3AEB B;  1ET9 A;  1SF0 A;  3LXF A;  3AE2 B;  1C9F A;  2HDE A;  1CJE A;  3NVZ A;  4ZOH C;  1XCT L;  1ZXI A;  2LEK A;  1MHH E;  1TJE A;  3W1S A;  1PYW D;  1SJE D;  2W55 A;  1R7S A;  2QSD A;  2NMQ A;  4KGT A;  3PZ7 A;  2EEL A;  2ONQ A;  4YWG G;  1ZXH A;  3P4R B;  4RFB A;  3FIL B;  1D5M C;  4N59 A;  1EWY C;  1N61 A;  3AH7 A;  5EE3 A;  2XNA C;  2L32 A;  4RGM A;  2KAC A;  2IPK D;  1VZ6 A;  4R3D A;  3W5V B;  5BYS A;  3C8Y A;  5FR3 A;  1TS3 A;  4TQ0 A;  2QEJ C;  1XXG A;  3B2G A;  4KGS A;  3U52 E;  1IUE A;  1J7B A;  1JQ4 A;  1YQ4 B;  2PMV A;  4OHJ A;  2JU6 X;  2H89 B;  1DOI A;  1STE A;  2QIL A;  1FFV A;  1JRP A;  1LO5 D;  3EA6 A;  3NRZ A;  4XDC A;  1N5X A;  3SFE B;  4TSS A;  4D2K A;  1JWS D;  3W2D A;  3CIR B;  4LLG M;  2QIE B;  2WXL A;  2DBY A;  2OED A;  1I4R A;  4M0W A;  2V3N A;  1WGK A;  3UI3 A;  2N9L A;  1ZPS A;  1D5Z C;  2V3P A;  3ABV B;  5FKA C;  1NI3 A;  4XE0 A;  2WP9 B;  4MT5 A;  1UUP A;  4YTP B;  3GS2 A;  4DXG A;  1EWC A;  3Q69 A;  3P4S B;  1WWT A;  1FMA D;  2NTS A;  3AED B;  2Y3A A;  5BMI A;  2AQ2 B;  2IJ0 A;  1V1O A;  4HKZ E;  3NVY A;  2WLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...