3AB5A

Crystal structure of the 2fe 2s ferredoxin from cyanidioschyzon merolae
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
97
structure length
97
Chain Sequence
MYKIQLVNQKEGIDVTIQCAGDQYILDAAEEQGVDLPYSCRAGACSTCAGKLVKGSVDQSDQSFLDEDQISKGFILTCVAYPTSDCVIQTHQEEALY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin
publication title Crystal structure of the 2Fe 2S Ferredoxin from Cyanidioschyzon merolae at 1.18A resolution.
rcsb
source organism Cyanidioschyzon merolae
molecule tags Electron transport
total genus 25
structure length 97
sequence length 97
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ab5A00
5G5GA 3DWGC 4YTPB 1TJEA 2AX5A 1B9RA 1KFYB 3P4RB 1ZP0B 3AEGB 1QOGA 1JROA 1R7SA 1N60A 1YQ3B 3PO0A 5EE3A 1L6VA 1ZOYB 3AE1B 5G5HA 2BS3B 3SFEB 2L52A 2B76B 3AM9A 4A9AA 3DWMA 1ZXIA 1FFVA 2WU2B 5C2TB 1NI3A 3HUIA 1FRRA 4WQMA 1PFDA 2JQRB 1VJKA 1WWTA 3WCQA 4IDIA 1DOXA 3AE4B 4HRSA 3P4SB 1RM6C 1FO4A 1GPXA 1YQ4B 3NS1A 1FIQA 1YJIA 1A70A 2G1EA 4HROA 4KX6B 1NVID 1WYGA 4P6VF 1XLNA 4ZOHC 1FXAA 5EE9A 2MJEA 3HRDD 3P4PB 1L5PA 5AUIA 4ZHPA 1E7PB 2KMMA 5MPOA 1YJJA 4JWUC 3CWIA 4N58A 2WDRB 2BS2B 2W54A 4US9A 2PVGC 1QT9A 2W3RA 1QOBA 1NYQA 3NVWA 3P63A 1TKEA 1NEKB 1NENB 1J7AA 2W3SA 2K22A 2EKIA 2K9XA 3B2FA 3W5VB 2L83A 1J7CA 1ZUD2 2KAJA 1SB3C 2PKOA 1JQ4A 3ABVB 1RWSA 1OQQA 4US8A 3VR8B 1DOIA 3AE8B 4ZHOA 4ITKA 3FC4A 1J7BA 3LXFA 3P4QB 2K5PA 1GAQB 1L0VB 3AE7B 3SFDB 3HVZA 1WRIA 3AMZA 2N0SB 2ACZB 3AB5A 3AEBB 3AEAB 2QIEB 5H92C 5H8YE 3AV8A 4C80A 2PIAA 2OHFA 1ROEA 4FXCA 5C3JB 3L4PA 3BIID 3NVVA 1TKYA 3AEFB 1E0ZA 2FBWB 1PUTA 1XLQA 2MJDA 1QF6A 1FXIA 1DOYA 2LEKA 2H88B 2QJLA 3AEEB 3AE5B 2BT6A 3LB8C 1SIJA 2MH7A 4WWMA 3VRAB 1DGJA 1N5XA 1WXQA 1JRPA 2M19A 2Y5CA 3AE6B 1AYFA 4YSXB 1JW9D 2WLBA 1RYJA 3AE2B 1VLBA 3AE3B 1QLBB 3AH7A 3NRZA 3NVYA 4YSZB 4JWSC 2CU3A 3ETRA 3AN1A 3P1MA 3RPFC 1RFKA 1TKGA 2E3TA 1N61A 2M56B 2WP9B 3AECB 1KRHA 1CJEA 1OQRA 1KF6B 1TYGB 2MJ3A 3AE9B 4N6EB 4YT0B 4YXDB 4C7YA 1N5WA 1V97A 2PVOD 1XLPA 2WQYB 4LTUA 1FMAD 1I7HA 1E6EB 3KWLA 3B2GA 1PDXA 1T3QA 5GXGB 2WDVB 3VRBB 1FM0D 1L6UA 1WGKA 2W55A 3W9CB 1CZPA 1NYRA 3EUB2 4C7ZA 3B9JA 1JWAD 4YSYB 5EE1A 3ZYYX 1VDVA 3AEDB 5EE0A 2H89B 2CJOA 1OFFA 3CIRB 4USAA 4YTNB 2DBYA 2WU5B 3FAHA 1JWBD 2WDQB 5AUKA 1XO3A 1E9MA 1JALA 1FFUA 1AWDA 2BS4B 3VR9B 4JX1C 1QOAA 1FRDA 1F0ZA 3W5UB 1N63A 2WS3B 2JX5A 1IUEA 2DWQA 4YTMB 2CJNA 3NVZA 1UWMA 2Q5WD 1XLOA 2HTME 3SR6A 1EWYC 1N62A 1E10A 1SF0A 1QOFA 1V8CA 4N59A
chains in the Genus database with same CATH superfamily
4KDIC 1WSPA 4FJZA 2LGDA 3V60A 4HCNB 2D07B 3AE1B 2B76B 4TKNA 4A9AA 2JXTA 4WURA 1G6JA 3MC0B 2ZCCA 2GBNA 3PLUA 1FXAA 3EECA 2ZJDA 2DYBA 3VVWB 3NHEB 2RDHA 1NBFC 2EKEC 3NVWA 1TKEA 1XT9B 4WQOB 3DQVA 3ZGZA 1GB1A 3ZRCA 2BWFA 1Z2MA 2KK8A 1SB3C 2NTSA 2HDEA 2MQJA 1WFYA 1MHHE 3DBLB 3NJTA 3LXFA 3UIPB 1C4CA 3AMZA 3DHHC 2KLGA 4ZRKA 2VH1A 5JXVA 2YEPB 4MELA 2CHWA 1IGDA 4GGQA 4ZDVA 2DX5B 3BIID 3KW5B 4K1RB 1ET6A 2RR9A 1EUVB 1Q5WB 1YNTE 2K8HA 1HXYD 3U2SC 5JZEB 3QA8A 1AN8A 3LB8C 1DGJA 1TGZB 3M3JA 1YN5A 4IM2A 5JHAA 4IWQA 3NVYA 3KWVA 4JWSC 1T0YA 1LGRA 2J42A 4RH6A 2EMTA 1FPYA 2D3CA 3PPAA 5BYRA 1OEYA 2JYEA 2WGSA 1R4MI 3A9KB 2C9WB 1F0ZA 1WMHB 1IUEA 3GS2A 2K6DB 3VHTC 4TQ0A 2C7MB 3DOWA 2FIDA 2RPVA 3QCAA 4W9JA 3DBRI 4ICUA 2HTHA 4MSQB 1YOVB 2MBOA 3GE8C 2N7DA 3B0AA 3ZXVA 3P2BA 3TEYA 4HKQA 1I35A 1FNVA 2BVCA 4B0EA 4II3B 4ZOHC 2L05A 5MPOA 2N9KA 3JYUA 3ENEA 3ZNID 1P7FA 3SEBA 3RNBC 2IJ0A 4C4VA 1MG4A 1K8RB 2EKIA 1QZEA 5HI1A 2KQSA 4KVGB 3ZRFA 1Q10A 5E6OA 3MC8A 3L10B 1IP9A 3C0RB 1GAQB 2D3BA 1EF5A 1WXVA 2I1JA 1BXTA 3AB5A 2HJ1A 3PHWB 3PV1A 3RNGC 4KSKC 1D4BA 1PUTA 3N1YC 3NY5A 5DPRA 2YLMA 1SBBB 4X57B 2KMCA 4M8NA 5J17A 4B9KA 1JW9D 3VAWA 5G55A 3RNEC 2ZW0A 3PRZA 3O65B 3AE9B 3L08A 4YT0B 3BYYB 4TQ1A 4UDUC 1T3QA 2RMMA 1LQBA 2KVZA 4WIPA 2LZ6A 2NBUA 1VZ8A 1S1QB 1TTNA 4BKTA 4JE3B 1N63A 1KOTA 2IO2B 4IWOA 3UINB 1EWYC 2N1WA 3DCGA 4YTPB 1FD6A 3GP7A 1B9RA 2D3GA 3BINA 1KJTA 3APDA 4GSWA 3NUHB 4TMAB 3PRMB 4BBNF 3WANA 1P0RA 2LHDA 3ZJVA 1FRRA 1Y8RC 4F7ZA 2B3AA 4KZ0A 1F9JA 1WYWB 3JSVB 1FIQA 2NPTB 2G1EA 2KQ4X 1F77A 2I38A 2N1VA 2WDRB 4GOCA 4KGRA 5AZFA 4DWFA 5IA7A 2AL6A 4A20A 2L00B 3H1UA 4G50A 1MJDA 2ZNVB 3RNAC 4IUMB 5IAAC 3IAS1 1ACCA 4ICVA 1J7BA 1WGGA 3V3XA 2GBJA 1WM2A 1E8WA 3DHIC 3A9JB 3AEAB 4EKUA 1P98A 1PGXA 2JWUA 2XNAC 3CF6E 2M17A 1PGBA 2LUEA 2BKFA 1LO5D 3VH4B 5IOIA 1SIJA 3Q69A 5JHBA 1AYFA 1WE7A 3H9DA 2FNJB 2V4IB 2J0KA 1V97A 2PVOD 5J18A 5GXGB 3HVDA 2FUHB 1IYFA 2ZW1A 4TV3A 4G3XB 5EE1A 1EF1A 1WF9A 2LASA 1XO3A 4XYCA 3APCA 4DDGD 2LUMA 3O13A 3NVZA 3JVZX 4KV2A 3WA0A 4EFOA 2G4DB 1FNUA 2CU1A 2PE6B 4PYUA 1QOGA 1PYWD 1I42A 3GZNI 4PS7A 3AM9A 1YJ1A 2WNMA 2KWVB 2GRIA 5D94A 1WWTA 1WXMA 1WZ3A 1J19A 2MEKA 1WRDB 1AW7A 3MHSD 2Y5PA 4KSLC 3P4PB 1WX8A 4I6PA 4ZRJA 2Z59B 4F8CB 2AYOB 3ZKJC 2MW5A 2L83A 2KAJA 2D10A 4KKIA 1UF0A 2XEWA 1WI0A 3ZJTA 3SHQA 2BGFA 4AJYB 2INDC 2K25A 2K5PA 1GNUA 1R4NB 2KLCA 2KJRA 3VUYA 1LXDA 1M4VA 5BYQA 2VRRB 3BK2A 4K3CA 1I4QA 2KVRA 5IKCM 1QF6A 1D5MC 1L2NA 2JSVX 2PTLA 3VRAB 4DHJB 3TEXA 1JRPA 4A55A 2WXLA 4JL9A 3AE3B 1QLBB 5GMVA 3P1MA 3APFA 1UGMA 3WALA 3BVZA 1N5WA 1XLPA 3N32A 4ZRIA 3V61A 3PRPB 3V62A 2OJWA 1CZPA 2N9PC 2JF5A 1KLGD 2ZPNA 1C4AA 2KDBA 1VCBA 4DHZB 2DBYA 2WDQB 1JWSD 1E9MA 1P9DU 1C9FA 2X38A 2MP2A 5HG2A 2UYZB 2I1KA 2Q5WD 1ZW7A 1QOFA 3DWGC 2SEBD 3PTFC 2KMAA 4MJSA 3AI5A 3V05A 2WHIA 3PS6A 1V5OA 3VUXA 3HUIA 3KH0A 4AJWA 5DPTA 2NTTA 4K7WA 3ZDMC 1A5RA 4PK1A 4KKJA 5EE9A 1K52A 3LJ3A 1QILA 2KMMA 3V6EB 3OLMD 2X8XX 4GDKB 1V9JA 3VH3B 2IPKD 3W2DA 4W9DA 4FJYA 4M0WB 2L0TA 2OJRA 4OHJA 2PKOA 4URKA 4XWWA 2GOWA 4OZAA 2CHXA 3A33B 4M00A 3P4QB 4LNIA 2O6VD 1HTOA 3Q14C 5D2MB 2QIEB 4JLCA 4BOZB 2MBHA 5LXHA 3TEWA 1ROEA 2JZPA 2O6VA 2QJLA 4C56C 2I2YA 4NY0A 1XEEA 4KGSA 3RUIB 4HLEA 1OEYJ 3DPDA 2IY1B 3V6CB 2BPSA 5JH5C 4NPNA 4IM3A 3RZFA 3DVNV 2M56B 2WP9B 2VZKB 1E8ZA 3QC8B 3R8BA 3PZ8A 2V3NA 2AQ2B 4G11A 3E56A 2JXXA 3I5JC 1NYRA 1HZ5A 1YX5B 1E90A 4H2AA 2WU5B 2D11A 4FA6A 4MM3A 1WX9A 2WXOA 4DXAB 2AL3A 1GJZA 1XLOA 3OJ3A 3FILB 1TJEA 2AQ1B 1I4HA 4RFBA 4NNJB 1UELA 4ASWC 4LDTB 4FADA 3U7ZA 4OVVA 2N9XA 4C7YA 1DOXA 1PFDA 3W1YA 3ZW3A 4OZBA 4E3CA 1RM6C 4P7IA 2A4ZA 1XCTL 3TIXA 3PVLA 2ICIA 4KX6B 3MC9A 3T8MA 2PPHA 1XF5L 2E6XA 4MDKE 2BKRB 3UF8A 4DDID 4O1NA 3P63A 2WXNA 1UD7A 2LRUA 4HPLB 2K22A 1ZPSA 1UBIA 3H7PA 1J7CA 1QKZA 1EO6A 4RCOA 2KXJA 4ZHOA 5BYSA 1WGDA 3FC4A 3DBRB 1SE3A 4K7UA 3UQBA 4DHZE 2A5UA 2BF8B 2JZZA 3NG0A 1GUAB 2WXHA 2NR2A 2LEKA 4REZA 3R2IA 2Y5BB 2J0MA 3L0WB 3QJZA 2KTRB 4F1SA 2BW2A 2MH7A 4PS3A 2O2VA 4WWNA 2KDFB 2M0XA 3RCZA 3TUOA 1V86A 4FJVB 1GB4A 4A8XC 1TT5B 3VFKA 2LGYA 2MWSB 2JU6X 3ONSA 2WQYB 2WDVB 2LGIA 4GMVA 1V2YA 1DYQA 1I4RA 3IAM1 5BMHA 2K8BA 3FAHA 2KFJA 4M02A 1IBXA 4YL8A 1TBEA 4KDLB 1RFAA 1WGHA 4LK0M 4W9EA 2AQ3B 2JWZA 1EU3A 1V5TA 4CYEA 3RFZB 5D3IB 4Q2JA 1E7UA 1L6VA 2C60A 5G5HA 4WH4A 1V1PB 2VH2A 4K7SA 4NAWA 3MJWA 1VJKA 3I3TB 1UWXA 1BT0A 1K51A 2IY0B 2FCNA 2EELA 1N6ZA 5AUIA 4LCDE 3CWIA 2PVGC 3ML9A 5BMIA 3DBHB 4MACA 1FEHA 3QAQA 2LI5A 3C8YA 3ECIA 4GLSC 1K53A 2M4NA 3PREA 3WAPA 3SFDB 3GB1A 1Z5SB 1KLVA 2IDYA 1TS5A 1L7YA 1OGWA 1WJ4A 4GDLA 4HWIB 1FXIA 4EOYA 3QQ8B 1L0XB 2ZNVC 2V3SA 2G9HD 5I4DA 3ML8A 2IZVB 4M01A 2CR5A 2RD0A 3IFWB 3ZQ4A 3IVFA 3Q6BA 2CU3A 1LFDA 2KHWB 2JVCA 3GOEA 1CJEA 3DBLI 4N6EB 1MHXA 4LTUA 2MSED 2W55A 3BVMA 3B9JA 3P42A 4ZYNA 4HPPA 2H89B 4GB9A 4FULA 4HCPB 4ARIA 1WH3A 2HTME 1JWMD 1CK1A 4BVUC 1V49A 2BYTA 1EM7A 2WXGA 2DAFA 1WE6A 1T5XD 1ZP0B 1ZOYB 3QHTA 4LJOB 1OTRB 1F52A 1RLFA 1HQRD 4GXBA 4HROA 1Y56A 4XE0A 2JRHA 5J2RA 3RMKC 4DK5A 2M0AA 3R3MA 1J7AA 2NVUI 3CMMB 4HDOA 4AOFA 5CTRC 2LD9A 3VR8B 1F2RC 1C1YB 2LGXA 4XX5A 5BMGA 2MHJA 3AE7B 2PE9A 2QC8A 1WRIA 4GN1A 5L95C 1YX6B 1ZDVA 4J6IA 1J8CA 2RSUA 3L4PA 3NVVA 1TKYA 1E0ZA 2KTFA 3VTVA 1PGAA 4AS1A 3EFCA 2K0PA 3NZUA 4NJCA 2BQQA 1VLBA 4C4VB 2NMQA 3ETRA 3AECB 3Q2AC 1TS3A 4OZCA 4HK2A 3FKYA 4KIKB 4RMAA 1GOZA 5KHQA 3PZ7A 2BYEA 2C7HA 4MSMB 3TBLD 1C76A 1TZOA 2XBBC 2KZRA 4DHJD 1QQRA 1TIFA 3LDZE 1GG3A 1AWDA 2ON8A 1ISNA 1T0QC 4L23A 2CJNA 2UU7A 1UWMA 4ANUA 1NDDA 1L4DB 2N9EB 5G5GA 1KFYB 2WXIA 3VTWA 1TY2A 2XK5B 3HM6X 1WGYA 5D6JB 2K3UA 3Q8EA 3ZIMA 1FFVA 4N9F4 1NI3A 1KM7A 4W9GA 3DDCB 1GC7A 4W9KA 4JGHB 2J52A 5D3DA 3RT3B 5IO9A 1SJED 2BYFA 1L5PA 4WWOA 4XDDA 5EDSA 3DHGC 4JWUC 2L1AA 4ANXA 4N58A 2BS2B 4WJQA 3BY4B 2FAZA 3KUCB 2KD0A 4NJ7A 3QARA 2N7JA 1D5XC 1MFWA 3TMPB 1WIAA 3T3OA 3EA6A 2J4XA 1E5WA 1FCCC 3W1SC 4YWGG 1ZGUB 2ACZB 2G3QB 4WJPA 2KDEB 5C3JB 2AEHA 5LLIA 2KC1A 1I4GA 3KYDD 3PSEB 3NOBA 3W1SA 2MJDA 5FR3A 1DOYA 3SDLC 1MVKA 4WWPA 4GDKA 2BT6A 3I9V1 2GLSA 2WWZA 3M95A 3U7DA 1WXSA 4RGNA 2M19A 2Y5CA 4BOSC 4MGIE 1FNWA 2DENB 2LRWA 2DZJA 2LGSA 1AARA 4MEMA 4OVUA 2LXCA 3MHZA 3HHMA 1PDXA 4M8MA 1WGKA 3W9CB 2LVPA 2KFKA 1VDVA 1SXTA 4YTNB 1OFFA 4USAA 2LVQA 2AWTA 3TCAA 2PLPA 3BZDB 1JWBD 3RN9C 2KJ6A 3T9LA 1D3ZA 1VZ7A 2WS3B 1V80A 2Z0DB 2LVOA 3Q8AA 2LXAA 2VZKD 2MBEA 1KH0A 3AEGB 2KT7A 3L16A 1L0YB 4AUQC 4WJOA 2MRPA 3QIJA 3N1ZC 4A90A 2LJIA 2WU2B 2KNBA 4EEWA 4IDIA 1UH6A 1RRBA 2WDTB 1KLUD 4W9LA 4W9CA 3K9OB 4I6NB 4QAYA 1C79A 5G2NA 2ZEQA 3DVGX 4JIOU 4WJNA 3MFGA 2KWCA 3L54A 4DXGA 4MGYE 1M94A 4L2YA 1ZDXA 2JZ3B 3I63C 2BTEA 1UBQA 2INPE 3AV8A 3AXCA 3A1QB 4FXCA 3KLSX 1F2RI 5FR6A 2KQ7A 1T0SC 2QCZA 1P1AA 2KC2A 3PLVA 1JCKB 3R2TA 4WWMA 1LM8B 3H7SA 5CHFA 1IPGA 1RFKA 3Q8FA 4LNFA 4XC2A 2MJ3A 4WAFA 5E6PA 1R4NI 1FMAD 4RNAA 4A3OA 2ZPYA 3WAMA 2RGFA 2KWUB 4NJ6A 2HE7A 3AEDB 1XCQL 2CJOA 3EHVA 3ZTCA 4BKGA 4AWJA 4L1BA 1BMLC 1JALA 2KOXA 3VR9B 1OQYA 2LHEA 3NZ3A 1KTKA 2WXKA 3HRDD 2NCNA 1V8CA 3OJ4B 1EU4A 4FHKA 3KQ4A 1N60A 4HXDA 1ZKHA 2GI9A 2DNFA 2SAKA 3Q8BA 3VXWA 3JW0X 2UWQA 3L13A 2FCQA 4FLHA 3OG5A 3AE4B 4RM8A 2KYWA 5HFYA 1HZ6A 1VRAB 1YQ4B 1HA5A 4P6VF 4EZKA 5LXIB 2J7QB 4US9A 3U8ZA 1QOBA 2W3SA 3B2FA 1ZUD2 2RDBC 3HIZA 2D2QA 2MX2A 3VUWA 3ABVB 2JRIB 4US8A 4A6QA 2PJHA 4MJSB 3AU5A 3EC8A 2G45B 3SU8X 2N0SB 4S17A 5HKHA 3A9KA 4C80A 4FN2A 1GC6A 2OHFA 1WMHA 2WXFA 4RM9A 1UGJA 2KDIA 2WXMA 4NAMA 3U4EG 1R4MB 1XLQA 3RYTA 1I4PA 2H88B 4AQ7A 3N20C 4LLGM 4KGTA 1WXQA 3AE6B 2MA9B 2WLBA 4IW0A 3NS8A 3TEZA 3EGRA 1VZ6A 1N61A 3KYCD 4W9IA 1KF6B 4YXDB 2GB1A 3B1LX 3B2GA 3VRBB 5CHWA 2DZKA 3ZJUA 4YSYB 4AP4C 3J9CA 4FBJB 3CIRB 2ZVOA 3DVNU 3TSSA 3IT6B 3UI3A 2O6VB 1CQVA 3IT4B 1E10A 3VDZA 4N59A 2IO3B 4RGTA 2BS3B 4EUTA 4KZCA 5D7GA 1ZXIA 1P3QU 4WQMA 3ZVVA 2BYVE 2JQRB 3Q3MC 4RGOS 3AULA 4II2B 1WJ6A 1GPXA 2PEAA 1YJIA 4MGKE 4XWTA 4IOIE 3UIOB 3X23A 1SGHA 1QT9A 2W3RA 3BK1A 4TUUA 5CHVC 3HK0A 4BBNC 5TSSA 4MM3B 2KO3A 5IN7A 2QHOA 1TY0A 2R61A 1DOIA 2LMCA 3OWEB 2ZZPB 4IKGA 2M8SA 2Y3AA 4E71A 2MBBB 3X0WA 2YEPF 2MBQA 1XQQA 1XD3B 3CSFA 3M62B 1JMLA 1WJNA 2QEJC 1E8YA 2FIFA 1SE4A 4YSZB 3E9SA 1WZ0A 2JUOA 4B0MA 2MCNB 3N3KB 1KRHA 3H7PB 4FHJA 1YN3A 3RZWC 4LNOA 2GMIC 1XXGA 3JSVA 2NPTA 2W9NA 1CMXB 3EUB2 4C7ZA 2TSSA 3ZO5B 3ZYYX 3TJPA 1FXTB 5E6JA 3RD2A 4B6WA 5AUKA 2LFIA 2INCC 4ZRPA 3W5UB 2JY6A 2CHZA 2FUG1 2KACA 1N62A 3BWUD 4NZLB 4PYZA 5CX3A 2WXRA 5HHDG 1X1MA 3Q3JA 1UNSA 1WM3A 2O2VB 3PO0A 2N9LA 5EE3A 3SFEB 1STEA 3A9JA 2V3PA 3DWMA 4IG7B 4KIKA 4HDQA 1SIFA 1VR9A 1RAXA 3NS1A 2CKHB 4B95A 1ZE3D 1H8CA 2DZMA 2L0FA 3ZXRA 4LNKA 2KWDA 3A4SC 3Q8CA 1NYQA 4RGMA 1IBXB 2K9XA 1ZXHA 2C7NB 5C1ZA 2ONQA 2V4LA 2KDMA 3ZTDA 4IWPA 2BBCA 2D3AA 1RWSA 1OQQA 2XK5A 2J53A 2NS5A 4MH8A 3UGBB 2KKCA 4GIVA 5H8YE 3PZDA 4NAWB 2BWES 3N30A 4HEA1 1MG8A 2L3ZA 4CO7A 2RPQA 1WJUA 1YIWA 1YMHE 5DPWA 4TSSA 3ZDTA 1ENFA 4A3PA 1WR1A 1V6EA 3ZNHB 3AE2B 3AH7A 3C19A 3DBHI 4WAAA 2E3TA 2D5GA 4BZAA 3GZNB 3VTUA 4MH0E 1E8XA 4J3OD 2DYOA 3K9PB 3BYTB 3MTNB 2WXJA 1WGRA 4C00A 5T8IA 1E7VA 5EE0A 2V9HA 3WAOA 4CQNA 2PMVA 1WR6E 1FCLA 2QSDA 4GDLB 4HPMB 5AZGA 3S2AA 1FRDA 4GU2A 4W9HA 4P1BC 2DWQA 4YTMB 1T0RC 3RI7C 1C4PA 2W82A 3SR6A 2AX5A 2L8JA 3Q3FA 1EWCA 2JYTA 1TS2A 1YQ3B 2KN5A 1UZXB 1PQSA 4MGZE 4DBGA 3UQAA 5BO4B 1BUIC 4HRSA 3KUDB 3P4SB 3KVFB 4D2KA 3QX1A 1FO4A 2V1YA 4MT5A 1NVID 2FE8A 3IBEA 3R66C 1WX7A 2W54A 4LNNA 1NEKB 1P7EA 3URYA 2K39A 2V0GA 2GBRA 4RF0A 3TL5A 1YN4A 2BB6A 3ZNGC 4HJKA 5L83A 4ARCA 4HVBA 5DPSA 1T6BX 2DHZA 3L17A 5H92C 4W9FA 1MPEA 2KN4A 3AEFB 5TR5A 2FBWB 2NBWB 2QILA 3AE5B 3AU4A 2QMTA 2LJ5A 1V81A 2KX3A 3R7QA 4DQOC 2XN9C 2PW9A 3NRZA 2IO1B 1TKGA 2DAJA 4R3DA 1IGCA 1TYGB 2KX0A 2L7RA 2OEDA 1U4AA 3IXSA 1TS4A 3I57A 3KWLA 1ESFA 1L6UA 3SD5A 4ANWA 3ZUNA 2GBKA 3A1QA 2IYDB 1HEZE 4NQKE 3N1XC 1FFUA 2BS4B 3BVGA 1VD2A 4JX1C 4M0WA 4XDCA 2EMSA 3MP9A 4IM0A 3LYYA 1NI2A 1SF0A 3PGEA 2K6QA 3D32A 4K3BA 1JROA 1R7SA 4ACFA 2ZCBA 2K8CA 2L52A 4ZRQA 3A4RA 3M63B 2IBIB 5C2TB 1C3TA 3WCQA 4PT5A 2WXPA 4EZLA 3ALBA 3MJ5A 1A70A 1XLNA 3HM3A 4P1CC 4ZHPA 2MJEA 3OAWA 1YJJA 1JWUD 3ZLZA 3W5VB 2WXQA 5FKAC 1JQ4A 4BFRA 1UUPA 3DVGY 5E6NA 4P16A 1C78A 3AE8B 4ITKA 1L0VB 3HVZA 2DYMA 1WY8A 1YD8U 3AEBB 2ZVNA 2N7EA 2IGHA 2ASQA 2JT4B 1L4ZB 2L76A 2DZIA 3H6NA 3PHXB 4LDTD 2CS4A 1ET9A 1D6EC 3CSTA 3FILA 1SJHD 3AEEB 3IG3A 2M1MA 4XZ4A 2YVCA 3U52E 4LJPB 5LNK1 2R2QA 2Z8LA 1RYJA 3DBSA 3VQIA 3ZNZB 4CHKA 1HE8A 1OQRA 1WXAA 5KHOA 1J0GA 1I7HA 1E6EB 1FM0D 4HKZE 4ANVA 3IHPC 4I6LB 4IC7B 3B08A 1SE9A 1H4RA 3Q3OC 3H8HA 1QOAA 3KUZA 2JX5A 4XGAB 4OW0A 1B1ZA 4E74A 4EE2A 3QK0A 3NZSA 3T3NA 3P4RB 1TZ1A 4DXFA 2GBMA 3RNCC 1Q1OA 3RULA 2Z0EB 1SSNA 2QDFA 4BKSD 2G4SA 4HJGE 2HJ8A 2OOBB 5IP4D 2RDGA 1C77A 1WYGA 2NBVB 2KTRA 2INNE 2J0JA 2JPHA 1E7PB 2KFKB 1JRUA 3WIMA 4BKSA 4BAXA 2HD5B 2KANA 1NENB 2K1FA 3QWZB 2L32A 1YQBA 2IGDA 4ZYSA 2REXA 4G0NB 4JQWC 2N4FA 2BB5A 1HTQA 2FCMA 2PIAA 4PS8A 1MI0A 4S0RA 1V1OA 5C23A 2MP2B 3RNFC 3Q3NC 1Q0WB 5FK9C 2C5LC 4JPSA 1F1HA 1N5XA 4EZJA 3U30A 1S3SG 3EFUA 4YSXB 1V1PA 3RPFC 3AN1A 2LWPA 2KJHB 4K81A 3GE3C 2WX1A 5AEKB 5AZHA 1K50A 3N9YC 1JWAD 2R2OA 1I4XA 2WYQA 5DCNA 2IGGA 3PT2B 2DLBA 3R7RA 2FCSA 4RF1A 4NQLB 2IO0B 4OVZA 1SEBD 2WX0A 1D5ZC 1SE2A 2MLBA
chains in the Genus database with same CATH topology
5G5GA 1WSPA 3DWGC 3BWUD 4NZLB 2SEBD 1KFYB 2WXRA 5HHDG 2WXIA 3V05A 1TY2A 1UNSA 3PO0A 5EE3A 2N9LA 3AE1B 3SFEB 2K3UA 2B76B 1STEA 4A9AA 2V3PA 3DWMA 3Q8EA 1FFVA 2JXTA 4WURA 1NI3A 3HUIA 3MC0B 1VR9A 2J52A 2NTTA 3NS1A 5D3DA 4KKJA 5EE9A 1ZE3D 1FXAA 1K52A 1SJED 1L5PA 1QILA 2KMMA 4XDDA 4JWUC 2L1AA 2RDHA 4GDKB 4N58A 2BS2B 2KWDA 2IPKD 3Q8CA 1NYQA 3NVWA 4RGMA 3W2DA 1TKEA 1IBXB 2K9XA 1GB1A 3ZGZA 1ZXHA 2ONQA 4OHJA 1SB3C 2NTSA 2PKOA 2HDEA 2KDMA 2N7JA 1D5XC 2BBCA 1RWSA 1MHHE 1OQQA 4XWWA 4OZAA 3T3OA 3EA6A 2J53A 3P4QB 2J4XA 3LXFA 1FCCC 4MH8A 4YWGG 1C4CA 3AMZA 2ACZB 2QIEB 5JXVA 2YEPB 1IGDA 4NAWB 5H8YE 3TEWA 1ROEA 5C3JB 3BIID 4HEA1 2JZPA 1I4GA 1ET6A 3W1SA 2MJDA 5FR3A 1DOYA 2QJLA 1MVKA 1YNTE 1HXYD 4C56C 1YMHE 3U2SC 2I2YA 2BT6A 3I9V1 1XEEA 1AN8A 3LB8C 4KGSA 4TSSA 1ENFA 1DGJA 4RGNA 2M19A 2Y5CA 1YN5A 1FNWA 3AE2B 3NVYA 3AH7A 3KWVA 4JWSC 2E3TA 2D5GA 2M56B 2WP9B 3MHZA 2VZKB 4J3OD 3R8BA 3PZ8A 2DYOA 2V3NA 2AQ2B 1PDXA 3E56A 2J42A 1WGKA 4RH6A 3BYTB 3W9CB 2WXJA 1NYRA 5T8IA 1HZ5A 5BYRA 1VDVA 5EE0A 1SXTA 4YTNB 1OFFA 4USAA 4H2AA 2JYEA 2PMVA 4CQNA 2PLPA 2WU5B 3BZDB 1JWBD 1FCLA 2QSDA 4GDLB 1F0ZA 1FRDA 1VZ7A 2WS3B 1IUEA 2DWQA 2WXOA 3GS2A 4YTMB 1C4PA 1XLOA 3Q8AA 2W82A 3SR6A 4TQ0A 2VZKD 3FILB 1TJEA 2AX5A 1KH0A 2AQ1B 1I4HA 1EWCA 2RPVA 4RFBA 2JYTA 3AEGB 1TS2A 1YQ3B 1L0YB 3U7ZA 4A90A 2LJIA 2WU2B 4C7YA 1DOXA 1PFDA 4IDIA 1BUIC 3TEYA 4HRSA 4OZBA 3P4SB 4D2KA 4HKQA 1FNVA 1RM6C 1FO4A 4B0EA 1XCTL 2ICIA 1KLUD 4KX6B 4MT5A 1NVID 4ZOHC 5MPOA 2FE8A 2N9KA 1XF5L 2E6XA 1C79A 2W54A 4O1NA 1P7FA 3P63A 3SEBA 2IJ0A 2WXNA 1NEKB 1P7EA 3URYA 2K22A 1ZPSA 2EKIA 5HI1A 1J7CA 2V0GA 4RF0A 1Q10A 3MFGA 1QKZA 1YN4A 4RCOA 2BB6A 4ZHOA 5BYSA 3FC4A 4DXGA 1SE3A 1GAQB 4ARCA 1BXTA 1T6BX 3AB5A 4L2YA 1ZDXA 2BTEA 2INPE 5H92C 3AV8A 4FXCA 1MPEA 3KLSX 1F2RI 2KN4A 3AEFB 2WXHA 1D4BA 2FBWB 1PUTA 2LEKA 4REZA 3R2IA 1JCKB 1SBBB 2QILA 3AE5B 2QMTA 3R2TA 2BW2A 2MH7A 4WWMA 4DQOC 2XN9C 1JW9D 2PW9A 3NRZA 3TUOA 2ZW0A 1RFKA 1GB4A 1TKGA 3Q8FA 4A8XC 4R3DA 1IGCA 3AE9B 1TYGB 2MJ3A 4YT0B 2JU6X 2OEDA 3BYYB 4WAFA 3IXSA 1TS4A 3I57A 2WQYB 4TQ1A 1FMAD 3KWLA 4RNAA 1ESFA 4UDUC 1T3QA 2RMMA 2WDVB 1L6UA 2LGIA 4WIPA 3AEDB 1DYQA 1I4RA 1VZ8A 1XCQL 2CJOA 3IAM1 1HEZE 5BMHA 3FAHA 4L1BA 1BMLC 1FFUA 1JALA 2BS4B 3BVGA 3VR9B 1IBXA 4JX1C 4M0WA 4JE3B 1N63A 2LHEA 3MP9A 4XDCA 3NZ3A 1KTKA 3LYYA 1EWYC 1SF0A 2WXKA 3HRDD 1V8CA 4LK0M 2AQ3B 4YTPB 1EU3A 1FD6A 3GP7A 1B9RA 1EU4A 3KQ4A 1JROA 1R7SA 1N60A 3NUHB 4TMAB 4Q2JA 5D3IB 3RFZB 2GI9A 1L6VA 5G5HA 2SAKA 2LHDA 4WH4A 1V1PB 2L52A 3Q8BA 4ZRQA 3ZJVA 5C2TB 3WCQA 1FRRA 1VJKA 4PT5A 2WXPA 3AE4B 1UWXA 1K51A 5HFYA 1HZ6A 3MJ5A 1VRAB 1YQ4B 1FIQA 2EELA 1A70A 2G1EA 2KQ4X 1HA5A 4P6VF 1XLNA 5AUIA 4ZHPA 2MJEA 1YJJA 1F77A 1JWUD 2I38A 3CWIA 4US9A 2WDRB 4KGRA 2PVGC 1QOBA 5BMIA 2W3SA 3B2FA 3W5VB 2WXQA 1ZUD2 5FKAC 4MACA 1JQ4A 3ABVB 1FEHA 1UUPA 3C8YA 4P16A 1C78A 3IAS1 4GLSC 1ACCA 1K53A 4US8A 3AE8B 4ITKA 4A6QA 1J7BA 3SFDB 1L0VB 3GB1A 3V3XA 3HVZA 2DYMA 2IDYA 1TS5A 2N0SB 3AEBB 3AEAB 4C80A 2WXFA 2OHFA 2IGHA 1PGXA 2JWUA 1UGJA 2WXMA 2XNAC 4NAMA 1L4ZB 1PGBA 3U4EG 1XLQA 1LO5D 1FXIA 1I4PA 2H88B 1L0XB 1ET9A 1D6EC 3FILA 4AQ7A 1SJHD 2G9HD 3AEEB 5I4DA 4LLGM 3U52E 1SIJA 4KGTA 1WXQA 3Q69A 5LNK1 3ZQ4A 3AE6B 1AYFA 2Z8LA 2WLBA 1RYJA 3TEZA 2CU3A 3EGRA 1VZ6A 3VQIA 1N61A 1CJEA 1KF6B 1OQRA 4N6EB 4YXDB 2V4IB 1V97A 2GB1A 2PVOD 1MHXA 4LTUA 1I7HA 3HVDA 1E6EB 5GXGB 3B2GA 3VRBB 1FM0D 2W55A 3BVMA 2ZW1A 3ZJUA 4HKZE 3B9JA 4YSYB 5EE1A 3J9CA 3P42A 2H89B 3CIRB 3H8HA 1XO3A 3TSSA 1QOAA 3IT6B 2JX5A 2LUMA 4ARIA 4OW0A 3O13A 3UI3A 3NVZA 1CQVA 3IT4B 2HTME 1JWMD 1B1ZA 1CK1A 1E10A 2BYTA 4N59A 1EM7A 4EE2A 1FNUA 2WXGA 3T3NA 3P4RB 1T5XD 1ZP0B 1QOGA 1PYWD 4RGTA 4DXFA 1ZOYB 2BS3B 3AM9A 2WNMA 5D7GA 1ZXIA 1SSNA 2GRIA 4WQMA 2JQRB 1WWTA 4RGOS 4HJGE 2MEKA 1HQRD 1GPXA 1AW7A 2RDGA 1C77A 1YJIA 4HROA 1Y56A 2Y5PA 1WYGA 4XE0A 3P4PB 2INNE 1E7PB 4XWTA 4IOIE 2M0AA 1QT9A 2W3RA 3BK1A 5TSSA 1NENB 1J7AA 4MM3B 2L83A 2L32A 2KAJA 4KKIA 2IGDA 4ZYSA 3ZJTA 1TY0A 2R61A 1DOIA 2LMCA 3OWEB 3VR8B 1F2RC 4IKGA 2Y3AA 5BMGA 2K5PA 3AE7B 1M4VA 1WRIA 2BB5A 5BYQA 1ZDVA 3BK2A 2YEPF 2PIAA 1I4QA 3L4PA 3NVVA 1TKYA 1MI0A 1E0ZA 1QF6A 1PGAA 1D5MC 1JMLA 1V1OA 4AS1A 2QEJC 2K0PA 5FK9C 4JPSA 2JSVX 2PTLA 3VRAB 1N5XA 4NJCA 1JRPA 3TEXA 4YSXB 1SE4A 4A55A 1V1PA 2WXLA 1VLBA 3AE3B 1QLBB 4YSZB 3E9SA 4B0MA 2NMQA 3ETRA 3AN1A 3P1MA 3RPFC 3AECB 1KRHA 1TS3A 1YN3A 3BVZA 4OZCA 1N5WA 1XLPA 1XXGA 1GOZA 1K50A 3N9YC 3PZ7A 1CZPA 3EUB2 4C7ZA 1JWAD 2TSSA 1I4XA 3ZYYX 1C76A 1KLGD 1TZOA 1C4AA 5E6JA 2IGGA 2DBYA 1QQRA 2WDQB 5AUKA 2DLBA 1E9MA 1JWSD 2LFIA 1AWDA 4RF1A 4ZRPA 2ON8A 3W5UB 1C9FA 2X38A 5HG2A 4OVZA 4L23A 2CJNA 2FUG1 1UWMA 2KACA 2Q5WD 1SEBD 1D5ZC 1N62A 1SE2A 1L4DB 1QOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G5G A;  3DWG C;  4YTP B;  1TJE A;  2AX5 A;  1B9R A;  1KFY B;  3P4R B;  1ZP0 B;  3AEG B;  1QOG A;  1JRO A;  1R7S A;  1N60 A;  1YQ3 B;  3PO0 A;  5EE3 A;  1L6V A;  1ZOY B;  3AE1 B;  5G5H A;  2BS3 B;  3SFE B;  2L52 A;  2B76 B;  3AM9 A;  4A9A A;  3DWM A;  1ZXI A;  1FFV A;  2WU2 B;  5C2T B;  1NI3 A;  3HUI A;  1FRR A;  4WQM A;  1PFD A;  2JQR B;  1VJK A;  1WWT A;  3WCQ A;  4IDI A;  1DOX A;  3AE4 B;  4HRS A;  3P4S B;  1RM6 C;  1FO4 A;  1GPX A;  1YQ4 B;  3NS1 A;  1FIQ A;  1YJI A;  1A70 A;  2G1E A;  4HRO A;  4KX6 B;  1NVI D;  1WYG A;  4P6V F;  1XLN A;  4ZOH C;  1FXA A;  5EE9 A;  2MJE A;  3HRD D;  3P4P B;  1L5P A;  5AUI A;  4ZHP A;  1E7P B;  2KMM A;  5MPO A;  1YJJ A;  4JWU C;  3CWI A;  4N58 A;  2WDR B;  2BS2 B;  2W54 A;  4US9 A;  2PVG C;  1QT9 A;  2W3R A;  1QOB A;  1NYQ A;  3NVW A;  3P63 A;  1TKE A;  1NEK B;  1NEN B;  1J7A A;  2W3S A;  2K22 A;  2EKI A;  2K9X A;  3B2F A;  3W5V B;  2L83 A;  1J7C A;  1ZUD 2;  2KAJ A;  1SB3 C;  2PKO A;  1JQ4 A;  3ABV B;  1RWS A;  1OQQ A;  4US8 A;  3VR8 B;  1DOI A;  3AE8 B;  4ZHO A;  4ITK A;  3FC4 A;  1J7B A;  3LXF A;  3P4Q B;  2K5P A;  1GAQ B;  1L0V B;  3AE7 B;  3SFD B;  3HVZ A;  1WRI A;  3AMZ A;  2N0S B;  2ACZ B;  3AB5 A;  3AEB B;  3AEA B;  2QIE B;  5H92 C;  5H8Y E;  3AV8 A;  4C80 A;  2PIA A;  2OHF A;  1ROE A;  4FXC A;  5C3J B;  3L4P A;  3BII D;  3NVV A;  1TKY A;  3AEF B;  1E0Z A;  2FBW B;  1PUT A;  1XLQ A;  2MJD A;  1QF6 A;  1FXI A;  1DOY A;  2LEK A;  2H88 B;  2QJL A;  3AEE B;  3AE5 B;  2BT6 A;  3LB8 C;  1SIJ A;  2MH7 A;  4WWM A;  3VRA B;  1DGJ A;  1N5X A;  1WXQ A;  1JRP A;  2M19 A;  2Y5C A;  3AE6 B;  1AYF A;  4YSX B;  1JW9 D;  2WLB A;  1RYJ A;  3AE2 B;  1VLB A;  3AE3 B;  1QLB B;  3AH7 A;  3NRZ A;  3NVY A;  4YSZ B;  4JWS C;  2CU3 A;  3ETR A;  3AN1 A;  3P1M A;  3RPF C;  1RFK A;  1TKG A;  2E3T A;  1N61 A;  2M56 B;  2WP9 B;  3AEC B;  1KRH A;  1CJE A;  1OQR A;  1KF6 B;  1TYG B;  2MJ3 A;  3AE9 B;  4N6E B;  4YT0 B;  4YXD B;  4C7Y A;  1N5W A;  1V97 A;  2PVO D;  1XLP A;  2WQY B;  4LTU A;  1FMA D;  1I7H A;  1E6E B;  3KWL A;  3B2G A;  1PDX A;  1T3Q A;  5GXG B;  2WDV B;  3VRB B;  1FM0 D;  1L6U A;  1WGK A;  2W55 A;  3W9C B;  1CZP A;  1NYR A;  3EUB 2;  4C7Z A;  3B9J A;  1JWA D;  4YSY B;  5EE1 A;  3ZYY X;  1VDV A;  3AED B;  5EE0 A;  2H89 B;  2CJO A;  1OFF A;  3CIR B;  4USA A;  4YTN B;  2DBY A;  2WU5 B;  3FAH A;  1JWB D;  2WDQ B;  5AUK A;  1XO3 A;  1E9M A;  1JAL A;  1FFU A;  1AWD A;  2BS4 B;  3VR9 B;  4JX1 C;  1QOA A;  1FRD A;  1F0Z A;  3W5U B;  1N63 A;  2WS3 B;  2JX5 A;  1IUE A;  2DWQ A;  4YTM B;  2CJN A;  3NVZ A;  1UWM A;  2Q5W D;  1XLO A;  2HTM E;  3SR6 A;  1EWY C;  1N62 A;  1E10 A;  1SF0 A;  1QOF A;  1V8C A;  4N59 A; 
#chains in the Genus database with same CATH topology
 4KDI C;  1WSP A;  4FJZ A;  2LGD A;  3V60 A;  4HCN B;  2D07 B;  3AE1 B;  2B76 B;  4TKN A;  4A9A A;  2JXT A;  4WUR A;  1G6J A;  3MC0 B;  2ZCC A;  2GBN A;  3PLU A;  1FXA A;  3EEC A;  2ZJD A;  2DYB A;  3VVW B;  3NHE B;  2RDH A;  1NBF C;  2EKE C;  3NVW A;  1TKE A;  1XT9 B;  4WQO B;  3DQV A;  3ZGZ A;  1GB1 A;  3ZRC A;  2BWF A;  1Z2M A;  2KK8 A;  1SB3 C;  2NTS A;  2HDE A;  2MQJ A;  1WFY A;  1MHH E;  3DBL B;  3NJT A;  3LXF A;  3UIP B;  1C4C A;  3AMZ A;  3DHH C;  2KLG A;  4ZRK A;  2VH1 A;  5JXV A;  2YEP B;  4MEL A;  2CHW A;  1IGD A;  4GGQ A;  4ZDV A;  2DX5 B;  3BII D;  3KW5 B;  4K1R B;  1ET6 A;  2RR9 A;  1EUV B;  1Q5W B;  1YNT E;  2K8H A;  1HXY D;  3U2S C;  5JZE B;  3QA8 A;  1AN8 A;  3LB8 C;  1DGJ A;  1TGZ B;  3M3J A;  1YN5 A;  4IM2 A;  5JHA A;  4IWQ A;  3NVY A;  3KWV A;  4JWS C;  1T0Y A;  1LGR A;  2J42 A;  4RH6 A;  2EMT A;  1FPY A;  2D3C A;  3PPA A;  5BYR A;  1OEY A;  2JYE A;  2WGS A;  1R4M I;  3A9K B;  2C9W B;  1F0Z A;  1WMH B;  1IUE A;  3GS2 A;  2K6D B;  3VHT C;  4TQ0 A;  2C7M B;  3DOW A;  2FID A;  2RPV A;  3QCA A;  4W9J A;  3DBR I;  4ICU A;  2HTH A;  4MSQ B;  1YOV B;  2MBO A;  3GE8 C;  2N7D A;  3B0A A;  3ZXV A;  3P2B A;  3TEY A;  4HKQ A;  1I35 A;  1FNV A;  2BVC A;  4B0E A;  4II3 B;  4ZOH C;  2L05 A;  5MPO A;  2N9K A;  3JYU A;  3ENE A;  3ZNI D;  1P7F A;  3SEB A;  3RNB C;  2IJ0 A;  4C4V A;  1MG4 A;  1K8R B;  2EKI A;  1QZE A;  5HI1 A;  2KQS A;  4KVG B;  3ZRF A;  1Q10 A;  5E6O A;  3MC8 A;  3L10 B;  1IP9 A;  3C0R B;  1GAQ B;  2D3B A;  1EF5 A;  1WXV A;  2I1J A;  1BXT A;  3AB5 A;  2HJ1 A;  3PHW B;  3PV1 A;  3RNG C;  4KSK C;  1D4B A;  1PUT A;  3N1Y C;  3NY5 A;  5DPR A;  2YLM A;  1SBB B;  4X57 B;  2KMC A;  4M8N A;  5J17 A;  4B9K A;  1JW9 D;  3VAW A;  5G55 A;  3RNE C;  2ZW0 A;  3PRZ A;  3O65 B;  3AE9 B;  3L08 A;  4YT0 B;  3BYY B;  4TQ1 A;  4UDU C;  1T3Q A;  2RMM A;  1LQB A;  2KVZ A;  4WIP A;  2LZ6 A;  2NBU A;  1VZ8 A;  1S1Q B;  1TTN A;  4BKT A;  4JE3 B;  1N63 A;  1KOT A;  2IO2 B;  4IWO A;  3UIN B;  1EWY C;  2N1W A;  3DCG A;  4YTP B;  1FD6 A;  3GP7 A;  1B9R A;  2D3G A;  3BIN A;  1KJT A;  3APD A;  4GSW A;  3NUH B;  4TMA B;  3PRM B;  4BBN F;  3WAN A;  1P0R A;  2LHD A;  3ZJV A;  1FRR A;  1Y8R C;  4F7Z A;  2B3A A;  4KZ0 A;  1F9J A;  1WYW B;  3JSV B;  1FIQ A;  2NPT B;  2G1E A;  2KQ4 X;  1F77 A;  2I38 A;  2N1V A;  2WDR B;  4GOC A;  4KGR A;  5AZF A;  4DWF A;  5IA7 A;  2AL6 A;  4A20 A;  2L00 B;  3H1U A;  4G50 A;  1MJD A;  2ZNV B;  3RNA C;  4IUM B;  5IAA C;  3IAS 1;  1ACC A;  4ICV A;  1J7B A;  1WGG A;  3V3X A;  2GBJ A;  1WM2 A;  1E8W A;  3DHI C;  3A9J B;  3AEA B;  4EKU A;  1P98 A;  1PGX A;  2JWU A;  2XNA C;  3CF6 E;  2M17 A;  1PGB A;  2LUE A;  2BKF A;  1LO5 D;  3VH4 B;  5IOI A;  1SIJ A;  3Q69 A;  5JHB A;  1AYF A;  1WE7 A;  3H9D A;  2FNJ B;  2V4I B;  2J0K A;  1V97 A;  2PVO D;  5J18 A;  5GXG B;  3HVD A;  2FUH B;  1IYF A;  2ZW1 A;  4TV3 A;  4G3X B;  5EE1 A;  1EF1 A;  1WF9 A;  2LAS A;  1XO3 A;  4XYC A;  3APC A;  4DDG D;  2LUM A;  3O13 A;  3NVZ A;  3JVZ X;  4KV2 A;  3WA0 A;  4EFO A;  2G4D B;  1FNU A;  2CU1 A;  2PE6 B;  4PYU A;  1QOG A;  1PYW D;  1I42 A;  3GZN I;  4PS7 A;  3AM9 A;  1YJ1 A;  2WNM A;  2KWV B;  2GRI A;  5D94 A;  1WWT A;  1WXM A;  1WZ3 A;  1J19 A;  2MEK A;  1WRD B;  1AW7 A;  3MHS D;  2Y5P A;  4KSL C;  3P4P B;  1WX8 A;  4I6P A;  4ZRJ A;  2Z59 B;  4F8C B;  2AYO B;  3ZKJ C;  2MW5 A;  2L83 A;  2KAJ A;  2D10 A;  4KKI A;  1UF0 A;  2XEW A;  1WI0 A;  3ZJT A;  3SHQ A;  2BGF A;  4AJY B;  2IND C;  2K25 A;  2K5P A;  1GNU A;  1R4N B;  2KLC A;  2KJR A;  3VUY A;  1LXD A;  1M4V A;  5BYQ A;  2VRR B;  3BK2 A;  4K3C A;  1I4Q A;  2KVR A;  5IKC M;  1QF6 A;  1D5M C;  1L2N A;  2JSV X;  2PTL A;  3VRA B;  4DHJ B;  3TEX A;  1JRP A;  4A55 A;  2WXL A;  4JL9 A;  3AE3 B;  1QLB B;  5GMV A;  3P1M A;  3APF A;  1UGM A;  3WAL A;  3BVZ A;  1N5W A;  1XLP A;  3N32 A;  4ZRI A;  3V61 A;  3PRP B;  3V62 A;  2OJW A;  1CZP A;  2N9P C;  2JF5 A;  1KLG D;  2ZPN A;  1C4A A;  2KDB A;  1VCB A;  4DHZ B;  2DBY A;  2WDQ B;  1JWS D;  1E9M A;  1P9D U;  1C9F A;  2X38 A;  2MP2 A;  5HG2 A;  2UYZ B;  2I1K A;  2Q5W D;  1ZW7 A;  1QOF A;  3DWG C;  2SEB D;  3PTF C;  2KMA A;  4MJS A;  3AI5 A;  3V05 A;  2WHI A;  3PS6 A;  1V5O A;  3VUX A;  3HUI A;  3KH0 A;  4AJW A;  5DPT A;  2NTT A;  4K7W A;  3ZDM C;  1A5R A;  4PK1 A;  4KKJ A;  5EE9 A;  1K52 A;  3LJ3 A;  1QIL A;  2KMM A;  3V6E B;  3OLM D;  2X8X X;  4GDK B;  1V9J A;  3VH3 B;  2IPK D;  3W2D A;  4W9D A;  4FJY A;  4M0W B;  2L0T A;  2OJR A;  4OHJ A;  2PKO A;  4URK A;  4XWW A;  2GOW A;  4OZA A;  2CHX A;  3A33 B;  4M00 A;  3P4Q B;  4LNI A;  2O6V D;  1HTO A;  3Q14 C;  5D2M B;  2QIE B;  4JLC A;  4BOZ B;  2MBH A;  5LXH A;  3TEW A;  1ROE A;  2JZP A;  2O6V A;  2QJL A;  4C56 C;  2I2Y A;  4NY0 A;  1XEE A;  4KGS A;  3RUI B;  4HLE A;  1OEY J;  3DPD A;  2IY1 B;  3V6C B;  2BPS A;  5JH5 C;  4NPN A;  4IM3 A;  3RZF A;  3DVN V;  2M56 B;  2WP9 B;  2VZK B;  1E8Z A;  3QC8 B;  3R8B A;  3PZ8 A;  2V3N A;  2AQ2 B;  4G11 A;  3E56 A;  2JXX A;  3I5J C;  1NYR A;  1HZ5 A;  1YX5 B;  1E90 A;  4H2A A;  2WU5 B;  2D11 A;  4FA6 A;  4MM3 A;  1WX9 A;  2WXO A;  4DXA B;  2AL3 A;  1GJZ A;  1XLO A;  3OJ3 A;  3FIL B;  1TJE A;  2AQ1 B;  1I4H A;  4RFB A;  4NNJ B;  1UEL A;  4ASW C;  4LDT B;  4FAD A;  3U7Z A;  4OVV A;  2N9X A;  4C7Y A;  1DOX A;  1PFD A;  3W1Y A;  3ZW3 A;  4OZB A;  4E3C A;  1RM6 C;  4P7I A;  2A4Z A;  1XCT L;  3TIX A;  3PVL A;  2ICI A;  4KX6 B;  3MC9 A;  3T8M A;  2PPH A;  1XF5 L;  2E6X A;  4MDK E;  2BKR B;  3UF8 A;  4DDI D;  4O1N A;  3P63 A;  2WXN A;  1UD7 A;  2LRU A;  4HPL B;  2K22 A;  1ZPS A;  1UBI A;  3H7P A;  1J7C A;  1QKZ A;  1EO6 A;  4RCO A;  2KXJ A;  4ZHO A;  5BYS A;  1WGD A;  3FC4 A;  3DBR B;  1SE3 A;  4K7U A;  3UQB A;  4DHZ E;  2A5U A;  2BF8 B;  2JZZ A;  3NG0 A;  1GUA B;  2WXH A;  2NR2 A;  2LEK A;  4REZ A;  3R2I A;  2Y5B B;  2J0M A;  3L0W B;  3QJZ A;  2KTR B;  4F1S A;  2BW2 A;  2MH7 A;  4PS3 A;  2O2V A;  4WWN A;  2KDF B;  2M0X A;  3RCZ A;  3TUO A;  1V86 A;  4FJV B;  1GB4 A;  4A8X C;  1TT5 B;  3VFK A;  2LGY A;  2MWS B;  2JU6 X;  3ONS A;  2WQY B;  2WDV B;  2LGI A;  4GMV A;  1V2Y A;  1DYQ A;  1I4R A;  3IAM 1;  5BMH A;  2K8B A;  3FAH A;  2KFJ A;  4M02 A;  1IBX A;  4YL8 A;  1TBE A;  4KDL B;  1RFA A;  1WGH A;  4LK0 M;  4W9E A;  2AQ3 B;  2JWZ A;  1EU3 A;  1V5T A;  4CYE A;  3RFZ B;  5D3I B;  4Q2J A;  1E7U A;  1L6V A;  2C60 A;  5G5H A;  4WH4 A;  1V1P B;  2VH2 A;  4K7S A;  4NAW A;  3MJW A;  1VJK A;  3I3T B;  1UWX A;  1BT0 A;  1K51 A;  2IY0 B;  2FCN A;  2EEL A;  1N6Z A;  5AUI A;  4LCD E;  3CWI A;  2PVG C;  3ML9 A;  5BMI A;  3DBH B;  4MAC A;  1FEH A;  3QAQ A;  2LI5 A;  3C8Y A;  3ECI A;  4GLS C;  1K53 A;  2M4N A;  3PRE A;  3WAP A;  3SFD B;  3GB1 A;  1Z5S B;  1KLV A;  2IDY A;  1TS5 A;  1L7Y A;  1OGW A;  1WJ4 A;  4GDL A;  4HWI B;  1FXI A;  4EOY A;  3QQ8 B;  1L0X B;  2ZNV C;  2V3S A;  2G9H D;  5I4D A;  3ML8 A;  2IZV B;  4M01 A;  2CR5 A;  2RD0 A;  3IFW B;  3ZQ4 A;  3IVF A;  3Q6B A;  2CU3 A;  1LFD A;  2KHW B;  2JVC A;  3GOE A;  1CJE A;  3DBL I;  4N6E B;  1MHX A;  4LTU A;  2MSE D;  2W55 A;  3BVM A;  3B9J A;  3P42 A;  4ZYN A;  4HPP A;  2H89 B;  4GB9 A;  4FUL A;  4HCP B;  4ARI A;  1WH3 A;  2HTM E;  1JWM D;  1CK1 A;  4BVU C;  1V49 A;  2BYT A;  1EM7 A;  2WXG A;  2DAF A;  1WE6 A;  1T5X D;  1ZP0 B;  1ZOY B;  3QHT A;  4LJO B;  1OTR B;  1F52 A;  1RLF A;  1HQR D;  4GXB A;  4HRO A;  1Y56 A;  4XE0 A;  2JRH A;  5J2R A;  3RMK C;  4DK5 A;  2M0A A;  3R3M A;  1J7A A;  2NVU I;  3CMM B;  4HDO A;  4AOF A;  5CTR C;  2LD9 A;  3VR8 B;  1F2R C;  1C1Y B;  2LGX A;  4XX5 A;  5BMG A;  2MHJ A;  3AE7 B;  2PE9 A;  2QC8 A;  1WRI A;  4GN1 A;  5L95 C;  1YX6 B;  1ZDV A;  4J6I A;  1J8C A;  2RSU A;  3L4P A;  3NVV A;  1TKY A;  1E0Z A;  2KTF A;  3VTV A;  1PGA A;  4AS1 A;  3EFC A;  2K0P A;  3NZU A;  4NJC A;  2BQQ A;  1VLB A;  4C4V B;  2NMQ A;  3ETR A;  3AEC B;  3Q2A C;  1TS3 A;  4OZC A;  4HK2 A;  3FKY A;  4KIK B;  4RMA A;  1GOZ A;  5KHQ A;  3PZ7 A;  2BYE A;  2C7H A;  4MSM B;  3TBL D;  1C76 A;  1TZO A;  2XBB C;  2KZR A;  4DHJ D;  1QQR A;  1TIF A;  3LDZ E;  1GG3 A;  1AWD A;  2ON8 A;  1ISN A;  1T0Q C;  4L23 A;  2CJN A;  2UU7 A;  1UWM A;  4ANU A;  1NDD A;  1L4D B;  2N9E B;  5G5G A;  1KFY B;  2WXI A;  3VTW A;  1TY2 A;  2XK5 B;  3HM6 X;  1WGY A;  5D6J B;  2K3U A;  3Q8E A;  3ZIM A;  1FFV A;  4N9F 4;  1NI3 A;  1KM7 A;  4W9G A;  3DDC B;  1GC7 A;  4W9K A;  4JGH B;  2J52 A;  5D3D A;  3RT3 B;  5IO9 A;  1SJE D;  2BYF A;  1L5P A;  4WWO A;  4XDD A;  5EDS A;  3DHG C;  4JWU C;  2L1A A;  4ANX A;  4N58 A;  2BS2 B;  4WJQ A;  3BY4 B;  2FAZ A;  3KUC B;  2KD0 A;  4NJ7 A;  3QAR A;  2N7J A;  1D5X C;  1MFW A;  3TMP B;  1WIA A;  3T3O A;  3EA6 A;  2J4X A;  1E5W A;  1FCC C;  3W1S C;  4YWG G;  1ZGU B;  2ACZ B;  2G3Q B;  4WJP A;  2KDE B;  5C3J B;  2AEH A;  5LLI A;  2KC1 A;  1I4G A;  3KYD D;  3PSE B;  3NOB A;  3W1S A;  2MJD A;  5FR3 A;  1DOY A;  3SDL C;  1MVK A;  4WWP A;  4GDK A;  2BT6 A;  3I9V 1;  2GLS A;  2WWZ A;  3M95 A;  3U7D A;  1WXS A;  4RGN A;  2M19 A;  2Y5C A;  4BOS C;  4MGI E;  1FNW A;  2DEN B;  2LRW A;  2DZJ A;  2LGS A;  1AAR A;  4MEM A;  4OVU A;  2LXC A;  3MHZ A;  3HHM A;  1PDX A;  4M8M A;  1WGK A;  3W9C B;  2LVP A;  2KFK A;  1VDV A;  1SXT A;  4YTN B;  1OFF A;  4USA A;  2LVQ A;  2AWT A;  3TCA A;  2PLP A;  3BZD B;  1JWB D;  3RN9 C;  2KJ6 A;  3T9L A;  1D3Z A;  1VZ7 A;  2WS3 B;  1V80 A;  2Z0D B;  2LVO A;  3Q8A A;  2LXA A;  2VZK D;  2MBE A;  1KH0 A;  3AEG B;  2KT7 A;  3L16 A;  1L0Y B;  4AUQ C;  4WJO A;  2MRP A;  3QIJ A;  3N1Z C;  4A90 A;  2LJI A;  2WU2 B;  2KNB A;  4EEW A;  4IDI A;  1UH6 A;  1RRB A;  2WDT B;  1KLU D;  4W9L A;  4W9C A;  3K9O B;  4I6N B;  4QAY A;  1C79 A;  5G2N A;  2ZEQ A;  3DVG X;  4JIO U;  4WJN A;  3MFG A;  2KWC A;  3L54 A;  4DXG A;  4MGY E;  1M94 A;  4L2Y A;  1ZDX A;  2JZ3 B;  3I63 C;  2BTE A;  1UBQ A;  2INP E;  3AV8 A;  3AXC A;  3A1Q B;  4FXC A;  3KLS X;  1F2R I;  5FR6 A;  2KQ7 A;  1T0S C;  2QCZ A;  1P1A A;  2KC2 A;  3PLV A;  1JCK B;  3R2T A;  4WWM A;  1LM8 B;  3H7S A;  5CHF A;  1IPG A;  1RFK A;  3Q8F A;  4LNF A;  4XC2 A;  2MJ3 A;  4WAF A;  5E6P A;  1R4N I;  1FMA D;  4RNA A;  4A3O A;  2ZPY A;  3WAM A;  2RGF A;  2KWU B;  4NJ6 A;  2HE7 A;  3AED B;  1XCQ L;  2CJO A;  3EHV A;  3ZTC A;  4BKG A;  4AWJ A;  4L1B A;  1BML C;  1JAL A;  2KOX A;  3VR9 B;  1OQY A;  2LHE A;  3NZ3 A;  1KTK A;  2WXK A;  3HRD D;  2NCN A;  1V8C A;  3OJ4 B;  1EU4 A;  4FHK A;  3KQ4 A;  1N60 A;  4HXD A;  1ZKH A;  2GI9 A;  2DNF A;  2SAK A;  3Q8B A;  3VXW A;  3JW0 X;  2UWQ A;  3L13 A;  2FCQ A;  4FLH A;  3OG5 A;  3AE4 B;  4RM8 A;  2KYW A;  5HFY A;  1HZ6 A;  1VRA B;  1YQ4 B;  1HA5 A;  4P6V F;  4EZK A;  5LXI B;  2J7Q B;  4US9 A;  3U8Z A;  1QOB A;  2W3S A;  3B2F A;  1ZUD 2;  2RDB C;  3HIZ A;  2D2Q A;  2MX2 A;  3VUW A;  3ABV B;  2JRI B;  4US8 A;  4A6Q A;  2PJH A;  4MJS B;  3AU5 A;  3EC8 A;  2G45 B;  3SU8 X;  2N0S B;  4S17 A;  5HKH A;  3A9K A;  4C80 A;  4FN2 A;  1GC6 A;  2OHF A;  1WMH A;  2WXF A;  4RM9 A;  1UGJ A;  2KDI A;  2WXM A;  4NAM A;  3U4E G;  1R4M B;  1XLQ A;  3RYT A;  1I4P A;  2H88 B;  4AQ7 A;  3N20 C;  4LLG M;  4KGT A;  1WXQ A;  3AE6 B;  2MA9 B;  2WLB A;  4IW0 A;  3NS8 A;  3TEZ A;  3EGR A;  1VZ6 A;  1N61 A;  3KYC D;  4W9I A;  1KF6 B;  4YXD B;  2GB1 A;  3B1L X;  3B2G A;  3VRB B;  5CHW A;  2DZK A;  3ZJU A;  4YSY B;  4AP4 C;  3J9C A;  4FBJ B;  3CIR B;  2ZVO A;  3DVN U;  3TSS A;  3IT6 B;  3UI3 A;  2O6V B;  1CQV A;  3IT4 B;  1E10 A;  3VDZ A;  4N59 A;  2IO3 B;  4RGT A;  2BS3 B;  4EUT A;  4KZC A;  5D7G A;  1ZXI A;  1P3Q U;  4WQM A;  3ZVV A;  2BYV E;  2JQR B;  3Q3M C;  4RGO S;  3AUL A;  4II2 B;  1WJ6 A;  1GPX A;  2PEA A;  1YJI A;  4MGK E;  4XWT A;  4IOI E;  3UIO B;  3X23 A;  1SGH A;  1QT9 A;  2W3R A;  3BK1 A;  4TUU A;  5CHV C;  3HK0 A;  4BBN C;  5TSS A;  4MM3 B;  2KO3 A;  5IN7 A;  2QHO A;  1TY0 A;  2R61 A;  1DOI A;  2LMC A;  3OWE B;  2ZZP B;  4IKG A;  2M8S A;  2Y3A A;  4E71 A;  2MBB B;  3X0W A;  2YEP F;  2MBQ A;  1XQQ A;  1XD3 B;  3CSF A;  3M62 B;  1JML A;  1WJN A;  2QEJ C;  1E8Y A;  2FIF A;  1SE4 A;  4YSZ B;  3E9S A;  1WZ0 A;  2JUO A;  4B0M A;  2MCN B;  3N3K B;  1KRH A;  3H7P B;  4FHJ A;  1YN3 A;  3RZW C;  4LNO A;  2GMI C;  1XXG A;  3JSV A;  2NPT A;  2W9N A;  1CMX B;  3EUB 2;  4C7Z A;  2TSS A;  3ZO5 B;  3ZYY X;  3TJP A;  1FXT B;  5E6J A;  3RD2 A;  4B6W A;  5AUK A;  2LFI A;  2INC C;  4ZRP A;  3W5U B;  2JY6 A;  2CHZ A;  2FUG 1;  2KAC A;  1N62 A;  3BWU D;  4NZL B;  4PYZ A;  5CX3 A;  2WXR A;  5HHD G;  1X1M A;  3Q3J A;  1UNS A;  1WM3 A;  2O2V B;  3PO0 A;  2N9L A;  5EE3 A;  3SFE B;  1STE A;  3A9J A;  2V3P A;  3DWM A;  4IG7 B;  4KIK A;  4HDQ A;  1SIF A;  1VR9 A;  1RAX A;  3NS1 A;  2CKH B;  4B95 A;  1ZE3 D;  1H8C A;  2DZM A;  2L0F A;  3ZXR A;  4LNK A;  2KWD A;  3A4S C;  3Q8C A;  1NYQ A;  4RGM A;  1IBX B;  2K9X A;  1ZXH A;  2C7N B;  5C1Z A;  2ONQ A;  2V4L A;  2KDM A;  3ZTD A;  4IWP A;  2BBC A;  2D3A A;  1RWS A;  1OQQ A;  2XK5 A;  2J53 A;  2NS5 A;  4MH8 A;  3UGB B;  2KKC A;  4GIV A;  5H8Y E;  3PZD A;  4NAW B;  2BWE S;  3N30 A;  4HEA 1;  1MG8 A;  2L3Z A;  4CO7 A;  2RPQ A;  1WJU A;  1YIW A;  1YMH E;  5DPW A;  4TSS A;  3ZDT A;  1ENF A;  4A3P A;  1WR1 A;  1V6E A;  3ZNH B;  3AE2 B;  3AH7 A;  3C19 A;  3DBH I;  4WAA A;  2E3T A;  2D5G A;  4BZA A;  3GZN B;  3VTU A;  4MH0 E;  1E8X A;  4J3O D;  2DYO A;  3K9P B;  3BYT B;  3MTN B;  2WXJ A;  1WGR A;  4C00 A;  5T8I A;  1E7V A;  5EE0 A;  2V9H A;  3WAO A;  4CQN A;  2PMV A;  1WR6 E;  1FCL A;  2QSD A;  4GDL B;  4HPM B;  5AZG A;  3S2A A;  1FRD A;  4GU2 A;  4W9H A;  4P1B C;  2DWQ A;  4YTM B;  1T0R C;  3RI7 C;  1C4P A;  2W82 A;  3SR6 A;  2AX5 A;  2L8J A;  3Q3F A;  1EWC A;  2JYT A;  1TS2 A;  1YQ3 B;  2KN5 A;  1UZX B;  1PQS A;  4MGZ E;  4DBG A;  3UQA A;  5BO4 B;  1BUI C;  4HRS A;  3KUD B;  3P4S B;  3KVF B;  4D2K A;  3QX1 A;  1FO4 A;  2V1Y A;  4MT5 A;  1NVI D;  2FE8 A;  3IBE A;  3R66 C;  1WX7 A;  2W54 A;  4LNN A;  1NEK B;  1P7E A;  3URY A;  2K39 A;  2V0G A;  2GBR A;  4RF0 A;  3TL5 A;  1YN4 A;  2BB6 A;  3ZNG C;  4HJK A;  5L83 A;  4ARC A;  4HVB A;  5DPS A;  1T6B X;  2DHZ A;  3L17 A;  5H92 C;  4W9F A;  1MPE A;  2KN4 A;  3AEF B;  5TR5 A;  2FBW B;  2NBW B;  2QIL A;  3AE5 B;  3AU4 A;  2QMT A;  2LJ5 A;  1V81 A;  2KX3 A;  3R7Q A;  4DQO C;  2XN9 C;  2PW9 A;  3NRZ A;  2IO1 B;  1TKG A;  2DAJ A;  4R3D A;  1IGC A;  1TYG B;  2KX0 A;  2L7R A;  2OED A;  1U4A A;  3IXS A;  1TS4 A;  3I57 A;  3KWL A;  1ESF A;  1L6U A;  3SD5 A;  4ANW A;  3ZUN A;  2GBK A;  3A1Q A;  2IYD B;  1HEZ E;  4NQK E;  3N1X C;  1FFU A;  2BS4 B;  3BVG A;  1VD2 A;  4JX1 C;  4M0W A;  4XDC A;  2EMS A;  3MP9 A;  4IM0 A;  3LYY A;  1NI2 A;  1SF0 A;  3PGE A;  2K6Q A;  3D32 A;  4K3B A;  1JRO A;  1R7S A;  4ACF A;  2ZCB A;  2K8C A;  2L52 A;  4ZRQ A;  3A4R A;  3M63 B;  2IBI B;  5C2T B;  1C3T A;  3WCQ A;  4PT5 A;  2WXP A;  4EZL A;  3ALB A;  3MJ5 A;  1A70 A;  1XLN A;  3HM3 A;  4P1C C;  4ZHP A;  2MJE A;  3OAW A;  1YJJ A;  1JWU D;  3ZLZ A;  3W5V B;  2WXQ A;  5FKA C;  1JQ4 A;  4BFR A;  1UUP A;  3DVG Y;  5E6N A;  4P16 A;  1C78 A;  3AE8 B;  4ITK A;  1L0V B;  3HVZ A;  2DYM A;  1WY8 A;  1YD8 U;  3AEB B;  2ZVN A;  2N7E A;  2IGH A;  2ASQ A;  2JT4 B;  1L4Z B;  2L76 A;  2DZI A;  3H6N A;  3PHX B;  4LDT D;  2CS4 A;  1ET9 A;  1D6E C;  3CST A;  3FIL A;  1SJH D;  3AEE B;  3IG3 A;  2M1M A;  4XZ4 A;  2YVC A;  3U52 E;  4LJP B;  5LNK 1;  2R2Q A;  2Z8L A;  1RYJ A;  3DBS A;  3VQI A;  3ZNZ B;  4CHK A;  1HE8 A;  1OQR A;  1WXA A;  5KHO A;  1J0G A;  1I7H A;  1E6E B;  1FM0 D;  4HKZ E;  4ANV A;  3IHP C;  4I6L B;  4IC7 B;  3B08 A;  1SE9 A;  1H4R A;  3Q3O C;  3H8H A;  1QOA A;  3KUZ A;  2JX5 A;  4XGA B;  4OW0 A;  1B1Z A;  4E74 A;  4EE2 A;  3QK0 A;  3NZS A;  3T3N A;  3P4R B;  1TZ1 A;  4DXF A;  2GBM A;  3RNC C;  1Q1O A;  3RUL A;  2Z0E B;  1SSN A;  2QDF A;  4BKS D;  2G4S A;  4HJG E;  2HJ8 A;  2OOB B;  5IP4 D;  2RDG A;  1C77 A;  1WYG A;  2NBV B;  2KTR A;  2INN E;  2J0J A;  2JPH A;  1E7P B;  2KFK B;  1JRU A;  3WIM A;  4BKS A;  4BAX A;  2HD5 B;  2KAN A;  1NEN B;  2K1F A;  3QWZ B;  2L32 A;  1YQB A;  2IGD A;  4ZYS A;  2REX A;  4G0N B;  4JQW C;  2N4F A;  2BB5 A;  1HTQ A;  2FCM A;  2PIA A;  4PS8 A;  1MI0 A;  4S0R A;  1V1O A;  5C23 A;  2MP2 B;  3RNF C;  3Q3N C;  1Q0W B;  5FK9 C;  2C5L C;  4JPS A;  1F1H A;  1N5X A;  4EZJ A;  3U30 A;  1S3S G;  3EFU A;  4YSX B;  1V1P A;  3RPF C;  3AN1 A;  2LWP A;  2KJH B;  4K81 A;  3GE3 C;  2WX1 A;  5AEK B;  5AZH A;  1K50 A;  3N9Y C;  1JWA D;  2R2O A;  1I4X A;  2WYQ A;  5DCN A;  2IGG A;  3PT2 B;  2DLB A;  3R7R A;  2FCS A;  4RF1 A;  4NQL B;  2IO0 B;  4OVZ A;  1SEB D;  2WX0 A;  1D5Z C;  1SE2 A;  2MLB A; 
#chains in the Genus database with same CATH homology
 5G5G A;  1WSP A;  3DWG C;  3BWU D;  4NZL B;  2SEB D;  1KFY B;  2WXR A;  5HHD G;  2WXI A;  3V05 A;  1TY2 A;  1UNS A;  3PO0 A;  5EE3 A;  2N9L A;  3AE1 B;  3SFE B;  2K3U A;  2B76 B;  1STE A;  4A9A A;  2V3P A;  3DWM A;  3Q8E A;  1FFV A;  2JXT A;  4WUR A;  1NI3 A;  3HUI A;  3MC0 B;  1VR9 A;  2J52 A;  2NTT A;  3NS1 A;  5D3D A;  4KKJ A;  5EE9 A;  1ZE3 D;  1FXA A;  1K52 A;  1SJE D;  1L5P A;  1QIL A;  2KMM A;  4XDD A;  4JWU C;  2L1A A;  2RDH A;  4GDK B;  4N58 A;  2BS2 B;  2KWD A;  2IPK D;  3Q8C A;  1NYQ A;  3NVW A;  4RGM A;  3W2D A;  1TKE A;  1IBX B;  2K9X A;  1GB1 A;  3ZGZ A;  1ZXH A;  2ONQ A;  4OHJ A;  1SB3 C;  2NTS A;  2PKO A;  2HDE A;  2KDM A;  2N7J A;  1D5X C;  2BBC A;  1RWS A;  1MHH E;  1OQQ A;  4XWW A;  4OZA A;  3T3O A;  3EA6 A;  2J53 A;  3P4Q B;  2J4X A;  3LXF A;  1FCC C;  4MH8 A;  4YWG G;  1C4C A;  3AMZ A;  2ACZ B;  2QIE B;  5JXV A;  2YEP B;  1IGD A;  4NAW B;  5H8Y E;  3TEW A;  1ROE A;  5C3J B;  3BII D;  4HEA 1;  2JZP A;  1I4G A;  1ET6 A;  3W1S A;  2MJD A;  5FR3 A;  1DOY A;  2QJL A;  1MVK A;  1YNT E;  1HXY D;  4C56 C;  1YMH E;  3U2S C;  2I2Y A;  2BT6 A;  3I9V 1;  1XEE A;  1AN8 A;  3LB8 C;  4KGS A;  4TSS A;  1ENF A;  1DGJ A;  4RGN A;  2M19 A;  2Y5C A;  1YN5 A;  1FNW A;  3AE2 B;  3NVY A;  3AH7 A;  3KWV A;  4JWS C;  2E3T A;  2D5G A;  2M56 B;  2WP9 B;  3MHZ A;  2VZK B;  4J3O D;  3R8B A;  3PZ8 A;  2DYO A;  2V3N A;  2AQ2 B;  1PDX A;  3E56 A;  2J42 A;  1WGK A;  4RH6 A;  3BYT B;  3W9C B;  2WXJ A;  1NYR A;  5T8I A;  1HZ5 A;  5BYR A;  1VDV A;  5EE0 A;  1SXT A;  4YTN B;  1OFF A;  4USA A;  4H2A A;  2JYE A;  2PMV A;  4CQN A;  2PLP A;  2WU5 B;  3BZD B;  1JWB D;  1FCL A;  2QSD A;  4GDL B;  1F0Z A;  1FRD A;  1VZ7 A;  2WS3 B;  1IUE A;  2DWQ A;  2WXO A;  3GS2 A;  4YTM B;  1C4P A;  1XLO A;  3Q8A A;  2W82 A;  3SR6 A;  4TQ0 A;  2VZK D;  3FIL B;  1TJE A;  2AX5 A;  1KH0 A;  2AQ1 B;  1I4H A;  1EWC A;  2RPV A;  4RFB A;  2JYT A;  3AEG B;  1TS2 A;  1YQ3 B;  1L0Y B;  3U7Z A;  4A90 A;  2LJI A;  2WU2 B;  4C7Y A;  1DOX A;  1PFD A;  4IDI A;  1BUI C;  3TEY A;  4HRS A;  4OZB A;  3P4S B;  4D2K A;  4HKQ A;  1FNV A;  1RM6 C;  1FO4 A;  4B0E A;  1XCT L;  2ICI A;  1KLU D;  4KX6 B;  4MT5 A;  1NVI D;  4ZOH C;  5MPO A;  2FE8 A;  2N9K A;  1XF5 L;  2E6X A;  1C79 A;  2W54 A;  4O1N A;  1P7F A;  3P63 A;  3SEB A;  2IJ0 A;  2WXN A;  1NEK B;  1P7E A;  3URY A;  2K22 A;  1ZPS A;  2EKI A;  5HI1 A;  1J7C A;  2V0G A;  4RF0 A;  1Q10 A;  3MFG A;  1QKZ A;  1YN4 A;  4RCO A;  2BB6 A;  4ZHO A;  5BYS A;  3FC4 A;  4DXG A;  1SE3 A;  1GAQ B;  4ARC A;  1BXT A;  1T6B X;  3AB5 A;  4L2Y A;  1ZDX A;  2BTE A;  2INP E;  5H92 C;  3AV8 A;  4FXC A;  1MPE A;  3KLS X;  1F2R I;  2KN4 A;  3AEF B;  2WXH A;  1D4B A;  2FBW B;  1PUT A;  2LEK A;  4REZ A;  3R2I A;  1JCK B;  1SBB B;  2QIL A;  3AE5 B;  2QMT A;  3R2T A;  2BW2 A;  2MH7 A;  4WWM A;  4DQO C;  2XN9 C;  1JW9 D;  2PW9 A;  3NRZ A;  3TUO A;  2ZW0 A;  1RFK A;  1GB4 A;  1TKG A;  3Q8F A;  4A8X C;  4R3D A;  1IGC A;  3AE9 B;  1TYG B;  2MJ3 A;  4YT0 B;  2JU6 X;  2OED A;  3BYY B;  4WAF A;  3IXS A;  1TS4 A;  3I57 A;  2WQY B;  4TQ1 A;  1FMA D;  3KWL A;  4RNA A;  1ESF A;  4UDU C;  1T3Q A;  2RMM A;  2WDV B;  1L6U A;  2LGI A;  4WIP A;  3AED B;  1DYQ A;  1I4R A;  1VZ8 A;  1XCQ L;  2CJO A;  3IAM 1;  1HEZ E;  5BMH A;  3FAH A;  4L1B A;  1BML C;  1FFU A;  1JAL A;  2BS4 B;  3BVG A;  3VR9 B;  1IBX A;  4JX1 C;  4M0W A;  4JE3 B;  1N63 A;  2LHE A;  3MP9 A;  4XDC A;  3NZ3 A;  1KTK A;  3LYY A;  1EWY C;  1SF0 A;  2WXK A;  3HRD D;  1V8C A;  4LK0 M;  2AQ3 B;  4YTP B;  1EU3 A;  1FD6 A;  3GP7 A;  1B9R A;  1EU4 A;  3KQ4 A;  1JRO A;  1R7S A;  1N60 A;  3NUH B;  4TMA B;  4Q2J A;  5D3I B;  3RFZ B;  2GI9 A;  1L6V A;  5G5H A;  2SAK A;  2LHD A;  4WH4 A;  1V1P B;  2L52 A;  3Q8B A;  4ZRQ A;  3ZJV A;  5C2T B;  3WCQ A;  1FRR A;  1VJK A;  4PT5 A;  2WXP A;  3AE4 B;  1UWX A;  1K51 A;  5HFY A;  1HZ6 A;  3MJ5 A;  1VRA B;  1YQ4 B;  1FIQ A;  2EEL A;  1A70 A;  2G1E A;  2KQ4 X;  1HA5 A;  4P6V F;  1XLN A;  5AUI A;  4ZHP A;  2MJE A;  1YJJ A;  1F77 A;  1JWU D;  2I38 A;  3CWI A;  4US9 A;  2WDR B;  4KGR A;  2PVG C;  1QOB A;  5BMI A;  2W3S A;  3B2F A;  3W5V B;  2WXQ A;  1ZUD 2;  5FKA C;  4MAC A;  1JQ4 A;  3ABV B;  1FEH A;  1UUP A;  3C8Y A;  4P16 A;  1C78 A;  3IAS 1;  4GLS C;  1ACC A;  1K53 A;  4US8 A;  3AE8 B;  4ITK A;  4A6Q A;  1J7B A;  3SFD B;  1L0V B;  3GB1 A;  3V3X A;  3HVZ A;  2DYM A;  2IDY A;  1TS5 A;  2N0S B;  3AEB B;  3AEA B;  4C80 A;  2WXF A;  2OHF A;  2IGH A;  1PGX A;  2JWU A;  1UGJ A;  2WXM A;  2XNA C;  4NAM A;  1L4Z B;  1PGB A;  3U4E G;  1XLQ A;  1LO5 D;  1FXI A;  1I4P A;  2H88 B;  1L0X B;  1ET9 A;  1D6E C;  3FIL A;  4AQ7 A;  1SJH D;  2G9H D;  3AEE B;  5I4D A;  4LLG M;  3U52 E;  1SIJ A;  4KGT A;  1WXQ A;  3Q69 A;  5LNK 1;  3ZQ4 A;  3AE6 B;  1AYF A;  2Z8L A;  2WLB A;  1RYJ A;  3TEZ A;  2CU3 A;  3EGR A;  1VZ6 A;  3VQI A;  1N61 A;  1CJE A;  1KF6 B;  1OQR A;  4N6E B;  4YXD B;  2V4I B;  1V97 A;  2GB1 A;  2PVO D;  1MHX A;  4LTU A;  1I7H A;  3HVD A;  1E6E B;  5GXG B;  3B2G A;  3VRB B;  1FM0 D;  2W55 A;  3BVM A;  2ZW1 A;  3ZJU A;  4HKZ E;  3B9J A;  4YSY B;  5EE1 A;  3J9C A;  3P42 A;  2H89 B;  3CIR B;  3H8H A;  1XO3 A;  3TSS A;  1QOA A;  3IT6 B;  2JX5 A;  2LUM A;  4ARI A;  4OW0 A;  3O13 A;  3UI3 A;  3NVZ A;  1CQV A;  3IT4 B;  2HTM E;  1JWM D;  1B1Z A;  1CK1 A;  1E10 A;  2BYT A;  4N59 A;  1EM7 A;  4EE2 A;  1FNU A;  2WXG A;  3T3N A;  3P4R B;  1T5X D;  1ZP0 B;  1QOG A;  1PYW D;  4RGT A;  4DXF A;  1ZOY B;  2BS3 B;  3AM9 A;  2WNM A;  5D7G A;  1ZXI A;  1SSN A;  2GRI A;  4WQM A;  2JQR B;  1WWT A;  4RGO S;  4HJG E;  2MEK A;  1HQR D;  1GPX A;  1AW7 A;  2RDG A;  1C77 A;  1YJI A;  4HRO A;  1Y56 A;  2Y5P A;  1WYG A;  4XE0 A;  3P4P B;  2INN E;  1E7P B;  4XWT A;  4IOI E;  2M0A A;  1QT9 A;  2W3R A;  3BK1 A;  5TSS A;  1NEN B;  1J7A A;  4MM3 B;  2L83 A;  2L32 A;  2KAJ A;  4KKI A;  2IGD A;  4ZYS A;  3ZJT A;  1TY0 A;  2R61 A;  1DOI A;  2LMC A;  3OWE B;  3VR8 B;  1F2R C;  4IKG A;  2Y3A A;  5BMG A;  2K5P A;  3AE7 B;  1M4V A;  1WRI A;  2BB5 A;  5BYQ A;  1ZDV A;  3BK2 A;  2YEP F;  2PIA A;  1I4Q A;  3L4P A;  3NVV A;  1TKY A;  1MI0 A;  1E0Z A;  1QF6 A;  1PGA A;  1D5M C;  1JML A;  1V1O A;  4AS1 A;  2QEJ C;  2K0P A;  5FK9 C;  4JPS A;  2JSV X;  2PTL A;  3VRA B;  1N5X A;  4NJC A;  1JRP A;  3TEX A;  4YSX B;  1SE4 A;  4A55 A;  1V1P A;  2WXL A;  1VLB A;  3AE3 B;  1QLB B;  4YSZ B;  3E9S A;  4B0M A;  2NMQ A;  3ETR A;  3AN1 A;  3P1M A;  3RPF C;  3AEC B;  1KRH A;  1TS3 A;  1YN3 A;  3BVZ A;  4OZC A;  1N5W A;  1XLP A;  1XXG A;  1GOZ A;  1K50 A;  3N9Y C;  3PZ7 A;  1CZP A;  3EUB 2;  4C7Z A;  1JWA D;  2TSS A;  1I4X A;  3ZYY X;  1C76 A;  1KLG D;  1TZO A;  1C4A A;  5E6J A;  2IGG A;  2DBY A;  1QQR A;  2WDQ B;  5AUK A;  2DLB A;  1E9M A;  1JWS D;  2LFI A;  1AWD A;  4RF1 A;  4ZRP A;  2ON8 A;  3W5U B;  1C9F A;  2X38 A;  5HG2 A;  4OVZ A;  4L23 A;  2CJN A;  2FUG 1;  1UWM A;  2KAC A;  2Q5W D;  1SEB D;  1D5Z C;  1N62 A;  1SE2 A;  1L4D B;  1QOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...