3AB5A

Crystal structure of the 2fe 2s ferredoxin from cyanidioschyzon merolae
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
97
structure length
97
Chain Sequence
MYKIQLVNQKEGIDVTIQCAGDQYILDAAEEQGVDLPYSCRAGACSTCAGKLVKGSVDQSDQSFLDEDQISKGFILTCVAYPTSDCVIQTHQEEALY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the 2Fe 2S Ferredoxin from Cyanidioschyzon merolae at 1.18A resolution.
rcsb
source organism Cyanidioschyzon merolae
molecule tags Electron transport
molecule keywords Ferredoxin
total genus 25
structure length 97
sequence length 97
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ab5A00
1TKGA 4KX6B 1NEKB 4IDIA 1JW9D 1XLPA 1TKEA 3NRZA 3P4SB 3EUB2 3ETRA 2H88B 1FRDA 3AEFB 1VDVA 3NVWA 1QF6A 4YSXB 3AE1B 1T3QA 3ZYYX 1N5WA 2PVGC 2W3SA 1N60A 1SF0A 1YQ3B 3LB8C 3RPFC 1SB3C 3AEDB 4C80A 2BS4B 2CJOA 2Y5CA 1GAQB 3AE5B 2WU2B 2MJ3A 3SFDB 5MPOA 2CJNA 1FO4A 1NI3A 3AE9B 2PVOD 3VRBB 1FFUA 2WP9B 2EKIA 2WU5B 2QIEB 3DWMA 1ZOYB 2MJEA 4N6EB 1ROEA 1RFKA 1OFFA 1NYRA 1WXQA 1JQ4A 5EE0A 4ZOHC 1F0ZA 2BS2B 4JWUC 2E3TA 2W54A 1L6VA 1KRHA 3FAHA 1XLOA 1DGJA 5G5GA 4A9AA 3DWGC 1N62A 4YXDB 3HUIA 2MJDA 1JWAD 2W55A 1CJEA 3AE4B 3AEAB 5G5HA 1E10A 2WLBA 3LXFA 1FIQA 4JWSC 1J7BA 1JALA 1WRIA 3BIID 4ZHPA 5GXGB 1RM6C 3W5UB 1XO3A 2DBYA 3VR8B 3AEBB 2FBWB 1QOFA 3AB5A 3P4PB 1KFYB 1FFVA 1RYJA 2KAJA 1QLBB 2KMMA 4YTMB 5C3JB 1NENB 3B9JA 1AYFA 4YTPB 1A70A 1JWBD 2L52A 1QOAA 2K9XA 1GPXA 1ZP0B 2N0SB 2WQYB 5EE9A 3SR6A 1PDXA 5C2TB 2DWQA 3WCQA 4ZHOA 1B9RA 1I7HA 1DOYA 3NS1A 1R7SA 3FC4A 3KWLA 3AE6B 2WDVB 1UWMA 3AE2B 1PFDA 2WDQB 2QJLA 1FRRA 3W9CB 4C7ZA 1N5XA 1QOBA 2M56B 1V8CA 1ZUD2 2Q5WD 2K5PA 2AX5A 3AE3B 4C7YA 1FMAD 5AUKA 1WWTA 4YTNB 2OHFA 3SFEB 1YJIA 1IUEA 3AE7B 3CWIA 1TJEA 1TYGB 4USAA 1TKYA 1YJJA 3B2GA 4HRSA 4WQMA 4HROA 1NYQA 4ITKA 1E7PB 2PKOA 3HRDD 5H8YE 1J7CA 1NVID 2G1EA 3NVYA 4JX1C 5EE1A 4LTUA 2B76B 5H92C 3AEEB 1SIJA 1FXAA 1KF6B 3P63A 4FXCA 1L6UA 2MH7A 1L0VB 1E9MA 3AECB 3B2FA 4YSZB 1DOXA 4P6VF 2CU3A 2JQRB 3NVZA 2LEKA 3CIRB 1CZPA 2L83A 1WGKA 2K22A 1JRPA 3AE8B 3W5VB 3AV8A 1XLNA 3P1MA 2WDRB 3VRAB 1AWDA 4US9A 1J7AA 3ABVB 3P4RB 4WWMA 1VLBA 2PIAA 3VR9B 1E6EB 2H89B 2BT6A 2M19A 1FM0D 2HTME 2JX5A 3P4QB 1OQRA 1ZXIA 1QOGA 4YSYB 1FXIA 1WYGA 3AEGB 3AH7A 1E0ZA 2W3RA 3NVVA 1EWYC 1QT9A 1VJKA 1YQ4B 2ACZB 3L4PA 3PO0A 4N59A 4N58A 5AUIA 1OQQA 3AMZA 4US8A 5EE3A 1DOIA 4YT0B 3HVZA 1N63A 2BS3B 1V97A 3AM9A 1XLQA 1JROA 1N61A 1L5PA 3AN1A 1PUTA 2WS3B 1RWSA
chains in the Genus database with same CATH superfamily
4OVZA 1MPEA 2MW5A 4GGQA 4LNIA 4WURA 1M4VA 3ETRA 3APDA 3QWZB 2ZNVC 2FE8A 3Q8BA 4TSSA 1TS3A 2LHDA 3KVFB 2VRRB 1XCQL 3TEXA 2BYVE 4C80A 2CJOA 5MPOA 3KW5B 4ZRQA 4HVBA 4W9GA 5C23A 4WWOA 1C1YB 1IYFA 1WX8A 2A5UA 1SBBB 1BMLC 2FCSA 2NTSA 4LLGM 4EE2A 5G5GA 3ZTCA 3VUWA 2KFKB 2J0JA 3ZDMC 4G0NB 1Z2MA 2FBWB 1YNTE 2FIDA 1UBQA 2L0TA 1YD8U 1AYFA 4P1BC 1JWBD 3AXCA 2D3CA 3VFKA 3BY4B 5T8IA 3PGEA 3VTWA 1ZKHA 1WX7A 3NY5A 4C4VA 2LGXA 2AQ3B 1WX9A 5AUKA 3FILA 5HKHA 4HPMB 5EDSA 5D7GA 5BYQA 1YX6B 1GC7A 1LO5D 4KZCA 3W5VB 1GC6A 1P98A 1F2RI 2WDRB 1TS2A 1WE7A 5DPRA 4HDOA 2QHOA 1KLVA 2BF8B 3TCAA 2ICIA 4ACFA 2PJHA 1DOIA 3VHTC 3ECIA 2WS3B 4RMAA 4WAFA 1EF5A 2LXAA 2CKHB 1WGRA 1T3QA 2LMCA 4WAAA 3D32A 4IW0A 4BKTA 1ENFA 3OG5A 3HM3A 3UI3A 2IY0B 2LUEA 4K7SA 2O2VA 1RFKA 4IC7B 3R66C 3PZ7A 3FAHA 3VVWB 2N7JA 2ZCCA 4JPSA 3ALBA 3BVZA 2DYOA 1J7BA 1WRIA 3VR8B 1IP9A 3EFUA 3NZ3A 3BWUD 2V3PA 4LK0M 1E8ZA 2KFKA 2LGIA 1VZ8A 2J0KA 4NQKE 4YL8A 1PDXA 1I7HA 1DOYA 1R7SA 1PGAA 4C7ZA 1N5XA 4ANWA 4GXBA 2IO2B 2ZVNA 2O2VB 1TBEA 1TY0A 4YTNB 3DBRB 3M63B 3ZQ4A 4WQMA 1Y8RC 2ZPYA 4IWQA 1YN5A 3BK2A 1FXAA 1LM8B 3P63A 4LCDE 4FXCA 1KJTA 1D5ZC 2KDBA 2KK8A 2VZKD 3DBRI 3APFA 1KLGD 2KQ4X 2C7NB 1CZPA 2K22A 5LNK1 1RAXA 1AARA 1V5TA 5BYSA 3ABVB 3JYUA 1FNWA 3KQ4A 3C0RB 3EC8A 2RMMA 1PGBA 1D5MC 4EZJA 4ZDVA 1TGZB 4HXDA 4MSMB 3SD5A 3SU8X 3ZXRA 1KTKA 3R3MA 3ZRCA 5BMHA 4P16A 1L4ZB 3W2DA 3ZNZB 4WWNA 4YSXB 4TV3A 5HG2A 3AU4A 1AW7A 3NJTA 3N1ZC 3WAPA 2BVCA 4QAYA 5TR5A 3KLSX 3AI5A 1TZ1A 4RGTA 4JQWC 2GI9A 1WE6A 3IG3A 1L6VA 4MGKE 2GBRA 1P0RA 4RH6A 5D2MB 1HZ5A 4G3XB 1K50A 5FR6A 1JALA 3A1QA 5E6JA 2R2OA 3P4PB 2KMMA 1NENB 2W82A 3CF6E 2JYTA 1C3TA 4W9FA 1P7EA 5L83A 1GPXA 1B9RA 3ZJUA 5GMVA 3L10B 1UWMA 1PFDA 2L7RA 3U7DA 2K25A 2CU1A 4XC2A 4B6WA 3MC0B 2BKFA 4ASWC 1HEZE 4ZRPA 1STEA 4DWFA 4ITKA 3HRDD 1MI0A 1V1OA 4FADA 4II2B 2G3QB 1I4XA 4E71A 2NS5A 5HI1A 3Q6BA 4BOSC 1MVKA 4DXAB 1IPGA 1R4MB 3N9YC 4IM2A 4EKUA 2Z59B 4WWMA 2NR2A 4YSYB 2JZPA 3AEGB 5HHDG 2J7QB 1VR9A 1EWCA 3W1SA 3M95A 1EU4A 5BMGA 4NAMA 2K39A 1GJZA 2N4FA 1N61A 3AN1A 1ET9A 4KX6B 3HM6X 3ZW3A 1XLPA 3NRZA 3A4RA 2JZZA 2KLCA 2MRPA 2AWTA 4NY0A 2MX2A 1MG4A 1YX5B 2W3SA 2V3SA 2K6DB 2LJIA 1R4NB 3ZNID 2AQ1B 1PGXA 4UDUC 1E5WA 3BYTB 4C4VB 4EFOA 1MJDA 1NYRA 4L23A 4XWWA 4ZRKA 4F8CB 3ZXVA 1ZE3D 2N1VA 2W55A 3ZTDA 2WNMA 1SGHA 5E6PA 2BB6A 3PTFC 1V80A 3APCA 4KVGB 2D10A 1WGYA 1U4AA 2J0MA 2N9KA 3CMMB 2ZEQA 1QQRA 1ZXHA 3ZJVA 3NUHB 3R2TA 2K9XA 1ZP0B 3DBSA 1ZGUB 1E8YA 2INPE 3L08A 5D3IB 1SJHD 3A9JA 3V6EB 4M8NA 4XX5A 2JVCA 4FJZA 4W9CA 3JSVA 4LNFA 4L1BA 4IM0A 4DXFA 2DZMA 3KYCD 5IP4D 2G1EA 2JUOA 5EE1A 1KOTA 5H92C 2KN4A 3B2FA 2IYDB 2M17A 3I63C 2DHZA 2IZVB 1XLNA 2QCZA 3IAM1 3VRAB 2GBMA 1XCTL 3K9OB 4GLSC 4A8XC 2IGDA 4M0WB 2LASA 4US8A 4YT0B 2BS3B 1XT9B 2JT4B 3NZSA 3T8MA 5TSSA 2NBVB 4G50A 2WXJA 4MJSA 4HLEA 1IBXA 3TBLD 1WYWB 3L16A 3Q8EA 3AEDB 2MJ3A 3Q3MC 1I4RA 1NI3A 4FULA 4EZKA 3NZUA 1ZOYB 1ROEA 1NBFC 4NAWB 4FJYA 4KIKB 1HTQA 4W9HA 4B0MA 3V62A 1DGJA 1E7VA 3KWVA 3HUIA 1EU3A 4IUMB 5LLIA 4FHJA 1E0ZA 2DBYA 3AEBB 2I2YA 4YTMB 3BYYB 1NI2A 2B3AA 1UNSA 3I57A 3BVMA 3VQIA 3SR6A 1CMXB 4ZHOA 1WZ3A 1S3SG 4ARIA 1NDDA 4F1SA 1QOBA 1RRBA 2K5PA 3ZUNA 4K1RB 2HE7A 1JMLA 4I6NB 3IBEA 5D3DA 2K8HA 4W9LA 2PKOA 4RM9A 1J7CA 1ET6A 3A9JB 2JPHA 1C78A 2BYEA 3AECB 1DOXA 2ZCBA 4P6VF 3JSVB 3TJPA 3RYTA 1CK1A 2I1KA 4XYCA 1MHXA 2A4ZA 2NTTA 3P4RB 1I4QA 3E9SA 1WFYA 3MTNB 2BT6A 1QOGA 2L0FA 4HDQA 2I1JA 1G6JA 4JL9A 3B1LX 2KDFB 1S1QB 3R7QA 4HKZE 3AE3B 1I35A 1J8CA 2BB5A 1L2NA 3EUB2 3PHXB 3ML9A 3H7SA 2NBUA 3IVFA 2PVGC 4IOIE 3NG0A 1R4NI 1YQ3B 4RF0A 1V9JA 1TTNA 2MP2A 2C60A 3RCZA 4PYUA 3N20C 4OZBA 2LUMA 1FNUA 4I6LB 5EE0A 2DZIA 2HD5B 1HA5A 2L05A 2E3TA 1XLOA 3IT6B 5D6JB 2LVQA 3PV1A 2KJ6A 3U8ZA 4HEA1 3AE4B 1FCCC 2KTFA 3AB5A 5J2RA 3V60A 2KAJA 3MJ5A 1I4HA 1GB4A 4IG7B 1SSNA 2LVPA 4MELA 2N7EA 2Y5PA 2C7HA 4KKIA 3IAS1 3AE6B 3R8BA 5D94A 2DX5B 2AL3A 2D07B 4KSKC 4WJQA 1IUEA 1TYGB 4ICUA 3NVYA 1NVID 2M8SA 4BKGA 3PRZA 3WANA 4YSZB 4LNOA 2DNFA 2WXMA 3NVZA 3ZO5B 4DDID 4MGZE 2GMIC 2KD0A 2LJ5A 2QSDA 1J19A 3H8HA 2K8BA 4XDCA 4MSQB 2BYFA 1V6EA 1ZXIA 1WYGA 2LD9A 3VUYA 2KWDA 1OQQA 2LGYA 5EE3A 4MJSB 5JH5C 4RGNA 1HQRD 4DBGA 4GDLB 1QILA 2KVZA 1TKEA 1F2RC 2V4LA 2ZPNA 1T0SC 3AEFB 1MFWA 3QJZA 2M1MA 4AQ7A 4O1NA 2BS4B 3L17A 2CR5A 2WU2B 1FO4A 1K8RB 3VAWA 1Y56A 3FKYA 3X0WA 2D3GA 2LGDA 3Q69A 4BVUC 3DBHI 1C4PA 4WIPA 2ZW0A 5G55A 3U2SC 4D2KA 3PLUA 1WY8A 3BK1A 4JWSC 1QZEA 2LRWA 2EMSA 5CX3A 4RGMA 1OGWA 1SJED 2QEJC 2ZZPB 1C9FA 2XK5B 4PYZA 3WCQA 1WJNA 1EF1A 2LRUA 2V9HA 3KWLA 3QIJA 4LJOB 2QJLA 5CTRC 4XWTA 2JWUA 4TQ1A 2AX5A 4ANUA 4CYEA 1WXVA 3QARA 4ARCA 4KKJA 3AEEB 1X1MA 1PYWD 3RZFA 1L0YB 1FD6A 3A33B 2L83A 2PEAA 2YEPF 1SIFA 1FXTB 4W9EA 2XK5A 1VZ6A 1J7AA 3JVZX 4AOFA 5DPWA 5FR3A 3TEYA 2KFJA 1C79A 1AN8A 1ZDXA 3L4PA 2GB1A 4TQ0A 1E8XA 3UIOB 4KV2A 1PUTA 2WU5B 2V1YA 4P1CC 1H8CA 1WMHA 3KH0A 2WXPA 2MBHA 3AULA 4OZAA 2WXKA 2MQJA 2PW9A 2VZKB 5JXVA 3ZKJC 1IGDA 2LFIA 4WWPA 3DQVA 3ZNHB 5LXIB 1GAQB 5H8YE 3W1YA 3LDZE 1ZW7A 4DHJB 3GZNB 2KXJA 4ZYNA 3RMKC 3WALA 2WDTB 3V3XA 1FIQA 1TS4A 4EZLA 4LDTD 4HCNB 2OEDA 4M02A 2XEWA 4TKNA 4W9JA 2NPTA 1WMHB 2L52A 1FNVA 2O6VA 4KGSA 1E7UA 1F9JA 3ZIMA 4KDLB 1EUVB 3E56A 3VUXA 4EEWA 2K1FA 3Q2AC 4GOCA 2KWCA 2HDEA 2R2QA 2MHJA 2SAKA 4BBNF 1KH0A 3I9V1 3PLVA 4L2YA 4LNKA 3SFEB 3AE7B 3DPDA 3DHGC 4GN1A 2CHZA 1SIJA 4XE0A 1C77A 2KC1A 2ZVOA 3C19A 2NPTB 4JE3B 2Y5BB 3AE8B 4FLHA 4PT5A 3WAMA 1WXMA 3P1MA 1C4AA 1ESFA 2JWZA 1ACCA 4REZA 3HHMA 2OOBB 4OZCA 3VH3B 2ACZB 1SE4A 3AMZA 1D5XC 4A6QA 2KNBA 5C1ZA 3N32A 2UU7A 2YLMA 4CHKA 4W9IA 3L54A 4N9F4 3AE1B 4LJPB 3ZYYX 4HKQA 4DHZB 3RNFC 1T6BX 3EECA 2WXGA 1UD7A 3Q8CA 3QX1A 3TIXA 2VH2A 1WGGA 2EKIA 4N6EB 1WJUA 3ONSA 2EELA 4K81A 4JWUC 2CHWA 2W54A 5JHBA 2IPKD 2L76A 1I4PA 2LWPA 5E6OA 1T0YA 1LXDA 1V2YA 2L1AA 2WLBA 1PQSA 4AUQC 3RNCC 2IGHA 3B08A 4WQOB 3RNGC 4AS1A 2WX1A 2FCQA 2FCNA 3B9JA 1XEEA 4FJVB 2NBWB 5AZHA 1SE9A 5C2TB 2DWQA 2PTLA 3QC8B 3FC4A 1ZDVA 1JWSD 2Q5WD 4P7IA 2QILA 1XD3B 5DPSA 4AWJA 4ANXA 5JHAA 3CSFA 3K9PB 4HCPB 1BUIC 2Y3AA 3O13A 4FA6A 4CQNA 2DAJA 2JYEA 2INNE 4MEMA 1UF0A 3AV8A 2KQ7A 2JZ3B 3M3JA 2BWFA 4MACA 3ENEA 1VLBA 3N3KB 4MM3B 3GZNI 4NQLB 1VJKA 2WXIA 3Q3FA 3TUOA 4DHJD 2K0PA 1JROA 1L5PA 2V4IB 2RD0A 4IDIA 1D6EC 2JSVX 3SEBA 4AJWA 1WRDB 2AYOB 3DVNV 2J52A 2KTRB 3T9LA 4FHKA 1T0QC 3LB8C 3U4EG 1WJ6A 3QHTA 3VRBB 3DWMA 2QC8A 1I42A 2UYZB 2XBBC 4KDIC 2G9HD 2WXLA 3WAOA 2KO3A 3AEAB 5GXGB 4B0EA 4ICVA 4PK1A 2ON8A 4YWGG 1WR1A 3QQ8B 1WXAA 4YTPB 2IO3B 3UGBB 2GBKA 2WDVB 1WI0A 3QAQA 4RM8A 3MP9A 1V1PB 1WWTA 3GB1A 2ONQA 1YJJA 5DCNA 2FUG1 1XQQA 4ZRIA 3RNBC 4LTUA 3H7PB 2DYBA 1L0VB 1R4MI 2MBEA 5AZFA 1Q10A 5IN7A 3FILB 3X23A 3A9KA 3S2AA 3CIRB 4KSLC 4PS7A 2KOXA 4HPLB 4XGAB 3VR9B 4C00A 5HFYA 2M19A 3KUCB 1EO6A 2D5GA 1UELA 1QT9A 1YQ4B 2MBOA 2X8XX 3RI7C 2BKRB 2C7MB 3RFZB 3BZDB 2BW2A 4OVVA 2ZNVB 2FUHB 3OJ4B 3SDLC 2IDYA 1FRDA 3H7PA 2GOWA 4B9KA 1GOZA 2IY1B 3U7ZA 1LGRA 3J9CA 1ISNA 1YN3A 4I6PA 3PVLA 4BKSA 3Q14C 3VDZA 1FFUA 3ZJTA 1Q5WB 1Q0WB 1FEHA 3QK0A 3IHPC 1KRHA 5J18A 1D4BA 2GBNA 3H9DA 2NMQA 1RM6C 3ZRFA 4JIOU 1FPYA 1QOFA 2W9NA 2MEKA 4H2AA 1WM3A 1FCLA 4JGHB 2N9LA 3HK0A 1P1AA 5EE9A 3CSTA 1OEYJ 3NS1A 4M01A 5AZGA 2V3NA 4W9DA 2D11A 2K3UA 2GBJA 4MH8A 1V81A 2Z8LA 3PS6A 4HROA 5BMIA 1RFAA 2RSUA 4PS3A 1UGJA 2AL6A 2JXTA 4ZRJA 1KF6B 2KMCA 2GLSA 2RPQA 4C56C 2PE9A 1YMHE 2WYQA 1K53A 2KWVB 2KJRA 3R7RA 2WXOA 1Q1OA 2KVRA 4RF1A 3VH4B 2J53A 1FXIA 2RGFA 3A9KB 2L8JA 4N58A 4DDGD 3RNEC 5L95C 2DYMA 2N7DA 5G2NA 3JW0X 4IM3A 4TUUA 3TL5A 1JCKB 1MG8A 1I4GA 2KT7A 3O65B 2KJHB 4NAWA 1N5WA 4KIKA 2KHWB 1SXTA 5AEKB 1EM7A 1L0XB 2PVOD 2QIEB 1WGHA 1TIFA 3UQBA 4KGTA 1WXQA 3SHQA 4ANVA 4HJKA 1F0ZA 3TSSA 4NJ7A 3P2BA 2WXNA 3KYDD 2YEPB 3I5JC 1C76A 2NCNA 5DPTA 2AEHA 5CHFA 3RNAC 2WXRA 2LHEA 1FFVA 1RYJA 2MLBA 1HTOA 2DAFA 3Q3OC 3NS8A 1BXTA 4GB9A 3Q3NC 1V1PA 1UWXA 1E90A 3WIMA 2KACA 4MM3A 2JY6A 4WJPA 1SE3A 4A3OA 3ZGZA 2N9EB 1TT5B 1E8WA 3NHEB 2QMTA 4C7YA 2TSSA 1H4RA 2OHFA 2JRIB 1YJIA 2J4XA 4ZYSA 3PREA 3B2GA 3M62B 4JX1C 2KWUB 4EOYA 1GG3A 2E6XA 1WIAA 2MWSB 3UQAA 4J6IA 1E9MA 1P9DU 4NJCA 2IJ0A 2JQRB 3BVGA 2PE6B 4BFRA 3QA8A 5FKAC 1KLUD 1N6ZA 5IKCM 4K3BA 1HXYD 2LI5A 1WGDA 2KN5A 1XXGA 2KZRA 1E6EB 2IBIB 3AH7A 4B95A 4WJOA 2BPSA 1XLQA 4LNNA 1IGCA 1RWSA 1NEKB 4MH0E 4RNAA 2H88B 3NVWA 3GE8C 4XDDA 1UBIA 4DK5A 1LFDA 2LVOA 3TMPB 2L3ZA 3V61A 2WP9B 1D3ZA 5CHVC 1B1ZA 1JQ4A 4DQOC 1CQVA 4M0WA 2M0AA 4KGRA 4F7ZA 2KYWA 1L7YA 3DWGC 1N62A 4YXDB 1T0RC 5JZEB 1E10A 1OEYA 2BQQA 2L32A 3VXWA 1WH3A 2GRIA 4BZAA 1XO3A 4MDKE 5LXHA 4BOZB 1TS5A 1HZ6A 3ZLZA 1QLBB 5C3JB 1RLFA 4NZLB 4DXGA 3OWEB 4WJNA 2X38A 4K3CA 3UINB 2SEBD 3EGRA 4CO7A 3U30A 3AE2B 3AU5A 2KKCA 2WDQB 5J17A 3N1XC 3VTVA 1V8CA 4GDKB 3RD2A 3Q3JA 1FMAD 3DVGX 2M0XA 4S17A 4USAA 3TEZA 2NVUI 2N1WA 3DOWA 3V05A 5KHQA 4XZ4A 1L6UA 4PS8A 2KMAA 2CU3A 3DBLI 2KDEB 3GE3C 2HJ8A 3U52E 3ZVVA 2V0GA 3PHWB 1AWDA 4EUTA 3TEWA 1P3QU 2AQ2B 2W3RA 3NVVA 1L4DB 4FN2A 1YN4A 2L00B 1K51A 1V86A 2XN9C 3A1QB 3DVNU 3P42A 2KQSA 4S0RA 3PRPB 1JW9D 2PMVA 1KM7A 3P4SB 3IT4B 1SE2A 1VDVA 3PT2B 4OVUA 3T3NA 3EHVA 3H1UA 1JWUD 2G4DB 2CS4A 3Q8AA 2Y5CA 3SFDB 4A3PA 3AE9B 1GB1A 3NOBA 4FBJB 4NJ6A 3GP7A 2MCNB 4II3B 3N1YC 2BS2B 3HVDA 3I3TB 4A9AA 3DVGY 2J42A 2IO0B 2ASQA 2REXA 1VCBA 2LXCA 3BIID 4ZHPA 3OLMD 2OJWA 2K6QA 2KX0A 3EFCA 3IFWB 1A70A 1QOAA 2WXFA 2N0SB 2KDIA 2EKEC 2G4SA 2BWES 4RCOA 2M56B 1ZUD2 1WR6E 2O6VB 5FK9C 3QCAA 4HJGE 3PPAA 3L0WB 5KHOA 4IKGA 4HRSA 4GDLA 3RULA 4M8MA 1WM2A 4RFBA 1VD2A 1M94A 2JU6X 2M4NA 1VRAB 2FNJB 4NNJB 2PLPA 4MGIE 4NPNA 3L13A 1WF9A 4US9A 2FAZA 2MSED 2PIAA 3Q8FA 1FM0D 3P4QB 1OQRA 3DBHB 4HWIB 1EWYC 5IO9A 3V6CB 2D3BA 4K7WA 1JRUA 2CHXA 3HVZA 1QKZA 2MBQA 3AM9A 2HJ1A 1IBXB 3ML8A 3B0AA 1C4CA 2PPHA 1TZOA 5IA7A 2BYTA 1UH6A 4E3CA 3UIPB 1N60A 1SF0A 3RPFC 2DZKA 4HPPA 2DZJA 4G11A 3ZDTA 1F77A 2N9XA 3AE5B 2WWZA 2CJNA 4OW0A 4GMVA 4WH4A 4AP4C 2ZW1A 2I38A 2LZ6A 3DCGA 1WXSA 2KDMA 4ZOHC 1ZPSA 3H6NA 3MC9A 3VTUA 2FCMA 2VH1A 2C9WB 2WGSA 2N9PC 4GU2A 2MJDA 1JWAD 4IWPA 1CJEA 5G5HA 3LYYA 3HIZA 3W5UB 1GNUA 3DBLB 2RPVA 1J0GA 3KUDB 3C8YA 2DENB 4GDKA 2RDBC 3KUZA 3OAWA 3PRMB 2IGGA 4HK2A 2FIFA 2D3AA 2G45B 2MBBB 3W9CB 1FRRA 3T3OA 3IXSA 1UGMA 3PSEB 2JF5A 3MJWA 3BINA 1P7FA 1V49A 4E74A 3RZWC 3CWIA 1TKYA 2EMTA 1A5RA 2K8CA 1E7PB 2INDC 4M00A 4A20A 2B76B 2MH7A 3GOEA 2RDGA 5E6NA 2INCC 2KC2A 1JRPA 4DHZE 3WA0A 2OJRA 2RR9A 2QDFA 3A4SC 2WX0A 2HTME 2JX5A 3DDCB 3N30A 1WSPA 2KANA 3PO0A 4N59A 5AUIA 4RGOS 2R61A 1Z5SB 1XF5L 2BBCA 1F52A 5IOIA 1MHHE 5IAAC 1TKGA 3MHZA 3DHIC 2DLBA 2D2QA 2MP2B 1DYQA 1SEBD 1V5OA 2LGSA 4JLCA 1QF6A 3LJ3A 2BTEA 3EA6A 2ZJDA 1SB3C 4KZ0A 2KLGA 4GIVA 1BT0A 3MHSD 3OJ3A 4OHJA 1OQYA 2MJEA 1OFFA 3W1SC 4BBNC 4GSWA 1JWMD 2YVCA 3MFGA 1HE8A 4LDTB 3PZ8A 2UWQA 2O6VD 1TY2A 2JRHA 3LXFA 3URYA 1GUAB 2WXHA 1YQBA 4X57B 4AJYB 1KFYB 3RT3B 4Q2JA 4MT5A 2WQYB 5BYRA 1UUPA 2XNAC 4BKSD 3ZNGC 2RDHA 1WJ4A 4BAXA 2BGFA 4W9KA 1YIWA 2Z0EB 3RN9C 4TMAB 1VZ7A 1TJEA 4IWOA 3UF8A 5CHWA 2Z0DB 1NYQA 3DHHC 1K52A 4A55A 2WHIA 2JXXA 5I4DA 2HTHA 1T5XD 3PZDA 2C5LC 4J3OD 1LQBA 1OTRB 2LEKA 1UZXB 1WGKA 5BO4B 4A90A 4URKA 4MGYE 2H89B 2KX3A 4R3DA 3MC8A 2MA9B 1YJ1A 2IO1B 3GS2A 1YOVB 3RUIB 3R2IA 1WZ0A 2WXQA 1N63A 1V97A 2KTRA 1F1HA 4K7UA
chains in the Genus database with same CATH topology
4OVZA 1MPEA 4A6QA 1NEKB 5TSSA 4RNAA 4WURA 1M4VA 3ETRA 2WXJA 2H88B 3NVWA 2FE8A 3Q8BA 3AE1B 4TSSA 1TS3A 2LHDA 3ZYYX 4HKQA 1IBXA 1XCQL 1T6BX 4XDDA 2WXGA 3TEXA 3Q8EA 3AEDB 4C80A 2CJOA 5MPOA 3Q8CA 4ZRQA 2MJ3A 1I4RA 1NI3A 2WP9B 2EKIA 4N6EB 1ZOYB 1ROEA 1SBBB 1B1ZA 2EELA 4NAWB 1JQ4A 4DQOC 1BMLC 2NTSA 4JWUC 1CQVA 2W54A 4LLGM 2M0AA 4KGRA 4M0WA 4B0MA 1DGJA 5G5GA 2IPKD 4EE2A 3DWGC 3KWVA 1I4PA 1N62A 4YXDB 3HUIA 1EU3A 2L1AA 2WLBA 1E10A 2L32A 2IGHA 2GRIA 1E0ZA 1XO3A 2DBYA 3AEBB 2FBWB 1YNTE 2I2YA 1TS5A 4AS1A 1HZ6A 4YTMB 3BYYB 1QLBB 5C3JB 4NZLB 3B9JA 4DXGA 1XEEA 1AYFA 3OWEB 1UNSA 1JWBD 3I57A 3BVMA 2X38A 3VQIA 3SR6A 4ZHOA 5C2TB 2SEBD 2DWQA 2PTLA 3FC4A 3EGRA 4ARIA 3AE2B 5T8IA 2WDQB 1QOBA 1ZDVA 1JWSD 1V8CA 4GDKB 2Q5WD 2K5PA 2AQ3B 1FMAD 2QILA 5AUKA 1JMLA 3FILA 4USAA 5D3DA 3TEZA 2PKOA 1J7CA 1ET6A 3V05A 5D7GA 1C78A 1BUIC 2Y3AA 1L6UA 5BYQA 3AECB 1DOXA 3O13A 4P6VF 2CU3A 4CQNA 2JYEA 1LO5D 2INNE 1CK1A 3U52E 2V0GA 3W5VB 3AV8A 1MHXA 1F2RI 2NTTA 2WDRB 4MACA 1AWDA 1TS2A 3P4RB 1I4QA 1VLBA 3E9SA 2BT6A 4MM3B 1QOGA 3TEWA 2AQ2B 2W3RA 3NVVA 1VJKA 1L4DB 2WXIA 3TUOA 2ICIA 1YN4A 2K0PA 1DOIA 4HKZE 1K51A 1JROA 2XN9C 1L5PA 3AE3B 2WS3B 3P42A 2V4IB 4IDIA 1JW9D 1D6EC 2JSVX 2PMVA 3SEBA 3P4SB 4WAFA 2BB5A 3IT4B 1SE2A 3EUB2 1VDVA 2J52A 1T3QA 2LMCA 2PVGC 4IOIE 1YQ3B 3LB8C 3U4EG 3T3NA 4RF0A 1JWUD 1ENFA 3Q8AA 2Y5CA 3SFDB 4OZBA 3AE9B 1GB1A 3VRBB 2LUMA 3DWMA 3UI3A 1FNUA 1RFKA 3GP7A 5EE0A 2BS2B 1HA5A 2E3TA 3PZ7A 3FAHA 3HVDA 1XLOA 3IT6B 4A9AA 2G9HD 2N7JA 2WXLA 4HEA1 3AE4B 2J42A 1FCCC 3AEAB 4JPSA 3BVZA 2DYOA 1J7BA 1WRIA 3BIID 4ZHPA 5GXGB 3VR8B 4B0EA 3NZ3A 3AB5A 3BWUD 2V3PA 2ON8A 4LK0M 2KAJA 3MJ5A 4YWGG 1I4HA 2LGIA 1VZ8A 1GB4A 1SSNA 4YTPB 1A70A 2Y5PA 1QOAA 4KKIA 2WXFA 2N0SB 1PDXA 1I7HA 3IAS1 1DOYA 1R7SA 3AE6B 1PGAA 2WDVB 3R8BA 4RCOA 4C7ZA 1N5XA 2M56B 1ZUD2 3MP9A 1V1PB 5FK9C 1WWTA 3GB1A 2ONQA 1TY0A 4HJGE 4YTNB 1IUEA 1TYGB 4IKGA 1YJJA 4HRSA 4WQMA 3ZQ4A 2FUG1 3NVYA 1NVID 4LTUA 1YN5A 3BK2A 1FXAA 3P63A 4FXCA 4RFBA 1L0VB 4YSZB 1D5ZC 2JU6X 1Q10A 2WXMA 3FILB 2VZKD 1VRAB 1KLGD 3NVZA 2KQ4X 3CIRB 1CZPA 2PLPA 2K22A 5LNK1 5BYSA 4US9A 3ABVB 2QSDA 3H8HA 2PIAA 3VR9B 1FNWA 2M19A 3KQ4A 3Q8FA 4XDCA 1FM0D 3P4QB 5HFYA 1OQRA 1ZXIA 1WYGA 2D5GA 1EWYC 1QT9A 1YQ4B 2KWDA 1OQQA 2RMMA 1PGBA 1D5MC 5EE3A 3HVZA 1QKZA 3AM9A 3RFZB 1KTKA 3BZDB 1IBXB 2BW2A 4RGNA 1C4CA 1HQRD 4GDLB 1QILA 1TKEA 5BMHA 1F2RC 1L4ZB 4P16A 1TZOA 3W2DA 2BYTA 2IDYA 1FRDA 3AEFB 1GOZA 4YSXB 5HG2A 1AW7A 3U7ZA 3J9CA 1N60A 1SF0A 1YN3A 3RPFC 4AQ7A 4O1NA 2BS4B 1F77A 2WU2B 3AE5B 4OW0A 2CJNA 1FO4A 4WH4A 3KLSX 1FFUA 1Y56A 2ZW1A 2I38A 4RGTA 3ZJTA 2KDMA 4ZOHC 1ZPSA 1FEHA 2GI9A 1L6VA 1KRHA 4RH6A 3Q69A 1D4BA 1C4PA 2MJDA 1HZ5A 1JWAD 2ZW0A 1CJEA 1K50A 4WIPA 3U2SC 5G5HA 4D2KA 3LYYA 3BK1A 4JWSC 1JALA 4RGMA 2NMQA 1RM6C 5E6JA 3W5UB 2RPVA 1QOFA 1SJED 2MEKA 3P4PB 2KMMA 4H2AA 2QEJC 1NENB 3C8YA 2W82A 2JYTA 1FCLA 1C9FA 2N9LA 1P7EA 2IGGA 1GPXA 1B9RA 5EE9A 3WCQA 3ZJUA 3NS1A 3KWLA 1UWMA 3W9CB 1PFDA 2V3NA 2QJLA 1FRRA 4XWTA 3T3OA 2JWUA 3IXSA 2K3UA 4TQ1A 2AX5A 1P7FA 4MH8A 3MC0B 1HEZE 3CWIA 2Z8LA 4ZRPA 1STEA 1TKYA 4HROA 4ARCA 5BMIA 4ITKA 1E7PB 4KKJA 3HRDD 1UGJA 2JXTA 1MI0A 1V1OA 2B76B 3AEEB 1KF6B 2MH7A 4C56C 1PYWD 1YMHE 2RDGA 1I4XA 1L0YB 1FD6A 5HI1A 2L83A 1K53A 1MVKA 1JRPA 2YEPF 3N9YC 1VZ6A 1J7AA 5FR3A 4WWMA 3TEYA 2WXOA 4YSYB 2JX5A 2HTME 1C79A 4RF1A 2JZPA 1WSPA 1AN8A 1FXIA 2J53A 3AEGB 1ZDXA 5HHDG 3PO0A 1VR9A 3L4PA 4N59A 4N58A 5AUIA 2GB1A 1EWCA 4RGOS 3W1SA 2R61A 1EU4A 2DYMA 5BMGA 4NAMA 4TQ0A 1XF5L 2BBCA 1N61A 1MHHE 3AN1A 1PUTA 2WU5B 1TKGA 1ET9A 3MHZA 4KX6B 2DLBA 1XLPA 1DYQA 1SEBD 3NRZA 1JCKB 1I4GA 2WXPA 4OZAA 2WXKA 1QF6A 2PW9A 2VZKB 5JXVA 2BTEA 3EA6A 1N5WA 2W3SA 2LJIA 1SXTA 1IGDA 2LFIA 1SB3C 1EM7A 1GAQB 2AQ1B 1PGXA 1L0XB 4UDUC 2PVOD 4OHJA 3BYTB 5H8YE 2QIEB 2MJEA 1OFFA 1NYRA 4L23A 4KGTA 1WXQA 1JWMD 4XWWA 1F0ZA 3MFGA 3TSSA 2WXNA 3PZ8A 1ZE3D 1TY2A 2YEPB 2W55A 1C76A 3V3XA 2WNMA 3LXFA 3URYA 1FIQA 1TS4A 2BB6A 2WXHA 2OEDA 2WXRA 2LHEA 1KFYB 1FFVA 1RYJA 2N9KA 1QQRA 1ZXHA 1BXTA 3ZJVA 3NUHB 3R2TA 2L52A 1FNVA 1V1PA 4KGSA 1UWXA 2K9XA 1ZP0B 2WQYB 2KACA 4MT5A 4Q2JA 5BYRA 1UUPA 2XNAC 1SE3A 3E56A 2INPE 3ZGZA 5D3IB 1SJHD 2HDEA 2QMTA 2RDHA 4C7YA 2SAKA 2TSSA 1KH0A 3I9V1 4L2YA 2OHFA 4TMAB 3SFEB 1YJIA 3AE7B 1VZ7A 1TJEA 2J4XA 4L1BA 4ZYSA 3B2GA 4DXFA 1NYQA 1K52A 4A55A 2G1EA 4JX1C 5EE1A 5H92C 2KN4A 1SIJA 5I4DA 1T5XD 2E6XA 4J3OD 3B2FA 1E9MA 4XE0A 1C77A 4NJCA 2IJ0A 2JQRB 3BVGA 5FKAC 2LEKA 1KLUD 4JE3B 1WGKA 3AE8B 4A90A 4PT5A 1HXYD 1XLNA 3P1MA 3IAM1 1C4AA 3VRAB 1ESFA 1XCTL 1XXGA 1E6EB 2H89B 1ACCA 4GLSC 4REZA 4A8XC 2IGDA 3AH7A 4R3DA 4OZCA 2ACZB 1SE4A 3GS2A 3R2IA 3AMZA 4US8A 2WXQA 4YT0B 1D5XC 1N63A 2BS3B 1V97A 1XLQA 1IGCA 1RWSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TKG A;  4KX6 B;  1NEK B;  4IDI A;  1JW9 D;  1XLP A;  1TKE A;  3NRZ A;  3P4S B;  3EUB 2;  3ETR A;  2H88 B;  1FRD A;  3AEF B;  1VDV A;  3NVW A;  1QF6 A;  4YSX B;  3AE1 B;  1T3Q A;  3ZYY X;  1N5W A;  2PVG C;  2W3S A;  1N60 A;  1SF0 A;  1YQ3 B;  3LB8 C;  3RPF C;  1SB3 C;  3AED B;  4C80 A;  2BS4 B;  2CJO A;  2Y5C A;  1GAQ B;  3AE5 B;  2WU2 B;  2MJ3 A;  3SFD B;  5MPO A;  2CJN A;  1FO4 A;  1NI3 A;  3AE9 B;  2PVO D;  3VRB B;  1FFU A;  2WP9 B;  2EKI A;  2WU5 B;  2QIE B;  3DWM A;  1ZOY B;  2MJE A;  4N6E B;  1ROE A;  1RFK A;  1OFF A;  1NYR A;  1WXQ A;  1JQ4 A;  5EE0 A;  4ZOH C;  1F0Z A;  2BS2 B;  4JWU C;  2E3T A;  2W54 A;  1L6V A;  1KRH A;  3FAH A;  1XLO A;  1DGJ A;  5G5G A;  4A9A A;  3DWG C;  1N62 A;  4YXD B;  3HUI A;  2MJD A;  1JWA D;  2W55 A;  1CJE A;  3AE4 B;  3AEA B;  5G5H A;  1E10 A;  2WLB A;  3LXF A;  1FIQ A;  4JWS C;  1J7B A;  1JAL A;  1WRI A;  3BII D;  4ZHP A;  5GXG B;  1RM6 C;  3W5U B;  1XO3 A;  2DBY A;  3VR8 B;  3AEB B;  2FBW B;  1QOF A;  3AB5 A;  3P4P B;  1KFY B;  1FFV A;  1RYJ A;  2KAJ A;  1QLB B;  2KMM A;  4YTM B;  5C3J B;  1NEN B;  3B9J A;  1AYF A;  4YTP B;  1A70 A;  1JWB D;  2L52 A;  1QOA A;  2K9X A;  1GPX A;  1ZP0 B;  2N0S B;  2WQY B;  5EE9 A;  3SR6 A;  1PDX A;  5C2T B;  2DWQ A;  3WCQ A;  4ZHO A;  1B9R A;  1I7H A;  1DOY A;  3NS1 A;  1R7S A;  3FC4 A;  3KWL A;  3AE6 B;  2WDV B;  1UWM A;  3AE2 B;  1PFD A;  2WDQ B;  2QJL A;  1FRR A;  3W9C B;  4C7Z A;  1N5X A;  1QOB A;  2M56 B;  1V8C A;  1ZUD 2;  2Q5W D;  2K5P A;  2AX5 A;  3AE3 B;  4C7Y A;  1FMA D;  5AUK A;  1WWT A;  4YTN B;  2OHF A;  3SFE B;  1YJI A;  1IUE A;  3AE7 B;  3CWI A;  1TJE A;  1TYG B;  4USA A;  1TKY A;  1YJJ A;  3B2G A;  4HRS A;  4WQM A;  4HRO A;  1NYQ A;  4ITK A;  1E7P B;  2PKO A;  3HRD D;  5H8Y E;  1J7C A;  1NVI D;  2G1E A;  3NVY A;  4JX1 C;  5EE1 A;  4LTU A;  2B76 B;  5H92 C;  3AEE B;  1SIJ A;  1FXA A;  1KF6 B;  3P63 A;  4FXC A;  1L6U A;  2MH7 A;  1L0V B;  1E9M A;  3AEC B;  3B2F A;  4YSZ B;  1DOX A;  4P6V F;  2CU3 A;  2JQR B;  3NVZ A;  2LEK A;  3CIR B;  1CZP A;  2L83 A;  1WGK A;  2K22 A;  1JRP A;  3AE8 B;  3W5V B;  3AV8 A;  1XLN A;  3P1M A;  2WDR B;  3VRA B;  1AWD A;  4US9 A;  1J7A A;  3ABV B;  3P4R B;  4WWM A;  1VLB A;  2PIA A;  3VR9 B;  1E6E B;  2H89 B;  2BT6 A;  2M19 A;  1FM0 D;  2HTM E;  2JX5 A;  3P4Q B;  1OQR A;  1ZXI A;  1QOG A;  4YSY B;  1FXI A;  1WYG A;  3AEG B;  3AH7 A;  1E0Z A;  2W3R A;  3NVV A;  1EWY C;  1QT9 A;  1VJK A;  1YQ4 B;  2ACZ B;  3L4P A;  3PO0 A;  4N59 A;  4N58 A;  5AUI A;  1OQQ A;  3AMZ A;  4US8 A;  5EE3 A;  1DOI A;  4YT0 B;  3HVZ A;  1N63 A;  2BS3 B;  1V97 A;  3AM9 A;  1XLQ A;  1JRO A;  1N61 A;  1L5P A;  3AN1 A;  1PUT A;  2WS3 B;  1RWS A; 
#chains in the Genus database with same CATH topology
 4OVZ A;  1MPE A;  2MW5 A;  4GGQ A;  4LNI A;  4WUR A;  1M4V A;  3ETR A;  3APD A;  3QWZ B;  2ZNV C;  2FE8 A;  3Q8B A;  4TSS A;  1TS3 A;  2LHD A;  3KVF B;  2VRR B;  1XCQ L;  3TEX A;  2BYV E;  4C80 A;  2CJO A;  5MPO A;  3KW5 B;  4ZRQ A;  4HVB A;  4W9G A;  5C23 A;  4WWO A;  1C1Y B;  1IYF A;  1WX8 A;  2A5U A;  1SBB B;  1BML C;  2FCS A;  2NTS A;  4LLG M;  4EE2 A;  5G5G A;  3ZTC A;  3VUW A;  2KFK B;  2J0J A;  3ZDM C;  4G0N B;  1Z2M A;  2FBW B;  1YNT E;  2FID A;  1UBQ A;  2L0T A;  1YD8 U;  1AYF A;  4P1B C;  1JWB D;  3AXC A;  2D3C A;  3VFK A;  3BY4 B;  5T8I A;  3PGE A;  3VTW A;  1ZKH A;  1WX7 A;  3NY5 A;  4C4V A;  2LGX A;  2AQ3 B;  1WX9 A;  5AUK A;  3FIL A;  5HKH A;  4HPM B;  5EDS A;  5D7G A;  5BYQ A;  1YX6 B;  1GC7 A;  1LO5 D;  4KZC A;  3W5V B;  1GC6 A;  1P98 A;  1F2R I;  2WDR B;  1TS2 A;  1WE7 A;  5DPR A;  4HDO A;  2QHO A;  1KLV A;  2BF8 B;  3TCA A;  2ICI A;  4ACF A;  2PJH A;  1DOI A;  3VHT C;  3ECI A;  2WS3 B;  4RMA A;  4WAF A;  1EF5 A;  2LXA A;  2CKH B;  1WGR A;  1T3Q A;  2LMC A;  4WAA A;  3D32 A;  4IW0 A;  4BKT A;  1ENF A;  3OG5 A;  3HM3 A;  3UI3 A;  2IY0 B;  2LUE A;  4K7S A;  2O2V A;  1RFK A;  4IC7 B;  3R66 C;  3PZ7 A;  3FAH A;  3VVW B;  2N7J A;  2ZCC A;  4JPS A;  3ALB A;  3BVZ A;  2DYO A;  1J7B A;  1WRI A;  3VR8 B;  1IP9 A;  3EFU A;  3NZ3 A;  3BWU D;  2V3P A;  4LK0 M;  1E8Z A;  2KFK A;  2LGI A;  1VZ8 A;  2J0K A;  4NQK E;  4YL8 A;  1PDX A;  1I7H A;  1DOY A;  1R7S A;  1PGA A;  4C7Z A;  1N5X A;  4ANW A;  4GXB A;  2IO2 B;  2ZVN A;  2O2V B;  1TBE A;  1TY0 A;  4YTN B;  3DBR B;  3M63 B;  3ZQ4 A;  4WQM A;  1Y8R C;  2ZPY A;  4IWQ A;  1YN5 A;  3BK2 A;  1FXA A;  1LM8 B;  3P63 A;  4LCD E;  4FXC A;  1KJT A;  1D5Z C;  2KDB A;  2KK8 A;  2VZK D;  3DBR I;  3APF A;  1KLG D;  2KQ4 X;  2C7N B;  1CZP A;  2K22 A;  5LNK 1;  1RAX A;  1AAR A;  1V5T A;  5BYS A;  3ABV B;  3JYU A;  1FNW A;  3KQ4 A;  3C0R B;  3EC8 A;  2RMM A;  1PGB A;  1D5M C;  4EZJ A;  4ZDV A;  1TGZ B;  4HXD A;  4MSM B;  3SD5 A;  3SU8 X;  3ZXR A;  1KTK A;  3R3M A;  3ZRC A;  5BMH A;  4P16 A;  1L4Z B;  3W2D A;  3ZNZ B;  4WWN A;  4YSX B;  4TV3 A;  5HG2 A;  3AU4 A;  1AW7 A;  3NJT A;  3N1Z C;  3WAP A;  2BVC A;  4QAY A;  5TR5 A;  3KLS X;  3AI5 A;  1TZ1 A;  4RGT A;  4JQW C;  2GI9 A;  1WE6 A;  3IG3 A;  1L6V A;  4MGK E;  2GBR A;  1P0R A;  4RH6 A;  5D2M B;  1HZ5 A;  4G3X B;  1K50 A;  5FR6 A;  1JAL A;  3A1Q A;  5E6J A;  2R2O A;  3P4P B;  2KMM A;  1NEN B;  2W82 A;  3CF6 E;  2JYT A;  1C3T A;  4W9F A;  1P7E A;  5L83 A;  1GPX A;  1B9R A;  3ZJU A;  5GMV A;  3L10 B;  1UWM A;  1PFD A;  2L7R A;  3U7D A;  2K25 A;  2CU1 A;  4XC2 A;  4B6W A;  3MC0 B;  2BKF A;  4ASW C;  1HEZ E;  4ZRP A;  1STE A;  4DWF A;  4ITK A;  3HRD D;  1MI0 A;  1V1O A;  4FAD A;  4II2 B;  2G3Q B;  1I4X A;  4E71 A;  2NS5 A;  5HI1 A;  3Q6B A;  4BOS C;  1MVK A;  4DXA B;  1IPG A;  1R4M B;  3N9Y C;  4IM2 A;  4EKU A;  2Z59 B;  4WWM A;  2NR2 A;  4YSY B;  2JZP A;  3AEG B;  5HHD G;  2J7Q B;  1VR9 A;  1EWC A;  3W1S A;  3M95 A;  1EU4 A;  5BMG A;  4NAM A;  2K39 A;  1GJZ A;  2N4F A;  1N61 A;  3AN1 A;  1ET9 A;  4KX6 B;  3HM6 X;  3ZW3 A;  1XLP A;  3NRZ A;  3A4R A;  2JZZ A;  2KLC A;  2MRP A;  2AWT A;  4NY0 A;  2MX2 A;  1MG4 A;  1YX5 B;  2W3S A;  2V3S A;  2K6D B;  2LJI A;  1R4N B;  3ZNI D;  2AQ1 B;  1PGX A;  4UDU C;  1E5W A;  3BYT B;  4C4V B;  4EFO A;  1MJD A;  1NYR A;  4L23 A;  4XWW A;  4ZRK A;  4F8C B;  3ZXV A;  1ZE3 D;  2N1V A;  2W55 A;  3ZTD A;  2WNM A;  1SGH A;  5E6P A;  2BB6 A;  3PTF C;  1V80 A;  3APC A;  4KVG B;  2D10 A;  1WGY A;  1U4A A;  2J0M A;  2N9K A;  3CMM B;  2ZEQ A;  1QQR A;  1ZXH A;  3ZJV A;  3NUH B;  3R2T A;  2K9X A;  1ZP0 B;  3DBS A;  1ZGU B;  1E8Y A;  2INP E;  3L08 A;  5D3I B;  1SJH D;  3A9J A;  3V6E B;  4M8N A;  4XX5 A;  2JVC A;  4FJZ A;  4W9C A;  3JSV A;  4LNF A;  4L1B A;  4IM0 A;  4DXF A;  2DZM A;  3KYC D;  5IP4 D;  2G1E A;  2JUO A;  5EE1 A;  1KOT A;  5H92 C;  2KN4 A;  3B2F A;  2IYD B;  2M17 A;  3I63 C;  2DHZ A;  2IZV B;  1XLN A;  2QCZ A;  3IAM 1;  3VRA B;  2GBM A;  1XCT L;  3K9O B;  4GLS C;  4A8X C;  2IGD A;  4M0W B;  2LAS A;  4US8 A;  4YT0 B;  2BS3 B;  1XT9 B;  2JT4 B;  3NZS A;  3T8M A;  5TSS A;  2NBV B;  4G50 A;  2WXJ A;  4MJS A;  4HLE A;  1IBX A;  3TBL D;  1WYW B;  3L16 A;  3Q8E A;  3AED B;  2MJ3 A;  3Q3M C;  1I4R A;  1NI3 A;  4FUL A;  4EZK A;  3NZU A;  1ZOY B;  1ROE A;  1NBF C;  4NAW B;  4FJY A;  4KIK B;  1HTQ A;  4W9H A;  4B0M A;  3V62 A;  1DGJ A;  1E7V A;  3KWV A;  3HUI A;  1EU3 A;  4IUM B;  5LLI A;  4FHJ A;  1E0Z A;  2DBY A;  3AEB B;  2I2Y A;  4YTM B;  3BYY B;  1NI2 A;  2B3A A;  1UNS A;  3I57 A;  3BVM A;  3VQI A;  3SR6 A;  1CMX B;  4ZHO A;  1WZ3 A;  1S3S G;  4ARI A;  1NDD A;  4F1S A;  1QOB A;  1RRB A;  2K5P A;  3ZUN A;  4K1R B;  2HE7 A;  1JML A;  4I6N B;  3IBE A;  5D3D A;  2K8H A;  4W9L A;  2PKO A;  4RM9 A;  1J7C A;  1ET6 A;  3A9J B;  2JPH A;  1C78 A;  2BYE A;  3AEC B;  1DOX A;  2ZCB A;  4P6V F;  3JSV B;  3TJP A;  3RYT A;  1CK1 A;  2I1K A;  4XYC A;  1MHX A;  2A4Z A;  2NTT A;  3P4R B;  1I4Q A;  3E9S A;  1WFY A;  3MTN B;  2BT6 A;  1QOG A;  2L0F A;  4HDQ A;  2I1J A;  1G6J A;  4JL9 A;  3B1L X;  2KDF B;  1S1Q B;  3R7Q A;  4HKZ E;  3AE3 B;  1I35 A;  1J8C A;  2BB5 A;  1L2N A;  3EUB 2;  3PHX B;  3ML9 A;  3H7S A;  2NBU A;  3IVF A;  2PVG C;  4IOI E;  3NG0 A;  1R4N I;  1YQ3 B;  4RF0 A;  1V9J A;  1TTN A;  2MP2 A;  2C60 A;  3RCZ A;  4PYU A;  3N20 C;  4OZB A;  2LUM A;  1FNU A;  4I6L B;  5EE0 A;  2DZI A;  2HD5 B;  1HA5 A;  2L05 A;  2E3T A;  1XLO A;  3IT6 B;  5D6J B;  2LVQ A;  3PV1 A;  2KJ6 A;  3U8Z A;  4HEA 1;  3AE4 B;  1FCC C;  2KTF A;  3AB5 A;  5J2R A;  3V60 A;  2KAJ A;  3MJ5 A;  1I4H A;  1GB4 A;  4IG7 B;  1SSN A;  2LVP A;  4MEL A;  2N7E A;  2Y5P A;  2C7H A;  4KKI A;  3IAS 1;  3AE6 B;  3R8B A;  5D94 A;  2DX5 B;  2AL3 A;  2D07 B;  4KSK C;  4WJQ A;  1IUE A;  1TYG B;  4ICU A;  3NVY A;  1NVI D;  2M8S A;  4BKG A;  3PRZ A;  3WAN A;  4YSZ B;  4LNO A;  2DNF A;  2WXM A;  3NVZ A;  3ZO5 B;  4DDI D;  4MGZ E;  2GMI C;  2KD0 A;  2LJ5 A;  2QSD A;  1J19 A;  3H8H A;  2K8B A;  4XDC A;  4MSQ B;  2BYF A;  1V6E A;  1ZXI A;  1WYG A;  2LD9 A;  3VUY A;  2KWD A;  1OQQ A;  2LGY A;  5EE3 A;  4MJS B;  5JH5 C;  4RGN A;  1HQR D;  4DBG A;  4GDL B;  1QIL A;  2KVZ A;  1TKE A;  1F2R C;  2V4L A;  2ZPN A;  1T0S C;  3AEF B;  1MFW A;  3QJZ A;  2M1M A;  4AQ7 A;  4O1N A;  2BS4 B;  3L17 A;  2CR5 A;  2WU2 B;  1FO4 A;  1K8R B;  3VAW A;  1Y56 A;  3FKY A;  3X0W A;  2D3G A;  2LGD A;  3Q69 A;  4BVU C;  3DBH I;  1C4P A;  4WIP A;  2ZW0 A;  5G55 A;  3U2S C;  4D2K A;  3PLU A;  1WY8 A;  3BK1 A;  4JWS C;  1QZE A;  2LRW A;  2EMS A;  5CX3 A;  4RGM A;  1OGW A;  1SJE D;  2QEJ C;  2ZZP B;  1C9F A;  2XK5 B;  4PYZ A;  3WCQ A;  1WJN A;  1EF1 A;  2LRU A;  2V9H A;  3KWL A;  3QIJ A;  4LJO B;  2QJL A;  5CTR C;  4XWT A;  2JWU A;  4TQ1 A;  2AX5 A;  4ANU A;  4CYE A;  1WXV A;  3QAR A;  4ARC A;  4KKJ A;  3AEE B;  1X1M A;  1PYW D;  3RZF A;  1L0Y B;  1FD6 A;  3A33 B;  2L83 A;  2PEA A;  2YEP F;  1SIF A;  1FXT B;  4W9E A;  2XK5 A;  1VZ6 A;  1J7A A;  3JVZ X;  4AOF A;  5DPW A;  5FR3 A;  3TEY A;  2KFJ A;  1C79 A;  1AN8 A;  1ZDX A;  3L4P A;  2GB1 A;  4TQ0 A;  1E8X A;  3UIO B;  4KV2 A;  1PUT A;  2WU5 B;  2V1Y A;  4P1C C;  1H8C A;  1WMH A;  3KH0 A;  2WXP A;  2MBH A;  3AUL A;  4OZA A;  2WXK A;  2MQJ A;  2PW9 A;  2VZK B;  5JXV A;  3ZKJ C;  1IGD A;  2LFI A;  4WWP A;  3DQV A;  3ZNH B;  5LXI B;  1GAQ B;  5H8Y E;  3W1Y A;  3LDZ E;  1ZW7 A;  4DHJ B;  3GZN B;  2KXJ A;  4ZYN A;  3RMK C;  3WAL A;  2WDT B;  3V3X A;  1FIQ A;  1TS4 A;  4EZL A;  4LDT D;  4HCN B;  2OED A;  4M02 A;  2XEW A;  4TKN A;  4W9J A;  2NPT A;  1WMH B;  2L52 A;  1FNV A;  2O6V A;  4KGS A;  1E7U A;  1F9J A;  3ZIM A;  4KDL B;  1EUV B;  3E56 A;  3VUX A;  4EEW A;  2K1F A;  3Q2A C;  4GOC A;  2KWC A;  2HDE A;  2R2Q A;  2MHJ A;  2SAK A;  4BBN F;  1KH0 A;  3I9V 1;  3PLV A;  4L2Y A;  4LNK A;  3SFE B;  3AE7 B;  3DPD A;  3DHG C;  4GN1 A;  2CHZ A;  1SIJ A;  4XE0 A;  1C77 A;  2KC1 A;  2ZVO A;  3C19 A;  2NPT B;  4JE3 B;  2Y5B B;  3AE8 B;  4FLH A;  4PT5 A;  3WAM A;  1WXM A;  3P1M A;  1C4A A;  1ESF A;  2JWZ A;  1ACC A;  4REZ A;  3HHM A;  2OOB B;  4OZC A;  3VH3 B;  2ACZ B;  1SE4 A;  3AMZ A;  1D5X C;  4A6Q A;  2KNB A;  5C1Z A;  3N32 A;  2UU7 A;  2YLM A;  4CHK A;  4W9I A;  3L54 A;  4N9F 4;  3AE1 B;  4LJP B;  3ZYY X;  4HKQ A;  4DHZ B;  3RNF C;  1T6B X;  3EEC A;  2WXG A;  1UD7 A;  3Q8C A;  3QX1 A;  3TIX A;  2VH2 A;  1WGG A;  2EKI A;  4N6E B;  1WJU A;  3ONS A;  2EEL A;  4K81 A;  4JWU C;  2CHW A;  2W54 A;  5JHB A;  2IPK D;  2L76 A;  1I4P A;  2LWP A;  5E6O A;  1T0Y A;  1LXD A;  1V2Y A;  2L1A A;  2WLB A;  1PQS A;  4AUQ C;  3RNC C;  2IGH A;  3B08 A;  4WQO B;  3RNG C;  4AS1 A;  2WX1 A;  2FCQ A;  2FCN A;  3B9J A;  1XEE A;  4FJV B;  2NBW B;  5AZH A;  1SE9 A;  5C2T B;  2DWQ A;  2PTL A;  3QC8 B;  3FC4 A;  1ZDV A;  1JWS D;  2Q5W D;  4P7I A;  2QIL A;  1XD3 B;  5DPS A;  4AWJ A;  4ANX A;  5JHA A;  3CSF A;  3K9P B;  4HCP B;  1BUI C;  2Y3A A;  3O13 A;  4FA6 A;  4CQN A;  2DAJ A;  2JYE A;  2INN E;  4MEM A;  1UF0 A;  3AV8 A;  2KQ7 A;  2JZ3 B;  3M3J A;  2BWF A;  4MAC A;  3ENE A;  1VLB A;  3N3K B;  4MM3 B;  3GZN I;  4NQL B;  1VJK A;  2WXI A;  3Q3F A;  3TUO A;  4DHJ D;  2K0P A;  1JRO A;  1L5P A;  2V4I B;  2RD0 A;  4IDI A;  1D6E C;  2JSV X;  3SEB A;  4AJW A;  1WRD B;  2AYO B;  3DVN V;  2J52 A;  2KTR B;  3T9L A;  4FHK A;  1T0Q C;  3LB8 C;  3U4E G;  1WJ6 A;  3QHT A;  3VRB B;  3DWM A;  2QC8 A;  1I42 A;  2UYZ B;  2XBB C;  4KDI C;  2G9H D;  2WXL A;  3WAO A;  2KO3 A;  3AEA B;  5GXG B;  4B0E A;  4ICV A;  4PK1 A;  2ON8 A;  4YWG G;  1WR1 A;  3QQ8 B;  1WXA A;  4YTP B;  2IO3 B;  3UGB B;  2GBK A;  2WDV B;  1WI0 A;  3QAQ A;  4RM8 A;  3MP9 A;  1V1P B;  1WWT A;  3GB1 A;  2ONQ A;  1YJJ A;  5DCN A;  2FUG 1;  1XQQ A;  4ZRI A;  3RNB C;  4LTU A;  3H7P B;  2DYB A;  1L0V B;  1R4M I;  2MBE A;  5AZF A;  1Q10 A;  5IN7 A;  3FIL B;  3X23 A;  3A9K A;  3S2A A;  3CIR B;  4KSL C;  4PS7 A;  2KOX A;  4HPL B;  4XGA B;  3VR9 B;  4C00 A;  5HFY A;  2M19 A;  3KUC B;  1EO6 A;  2D5G A;  1UEL A;  1QT9 A;  1YQ4 B;  2MBO A;  2X8X X;  3RI7 C;  2BKR B;  2C7M B;  3RFZ B;  3BZD B;  2BW2 A;  4OVV A;  2ZNV B;  2FUH B;  3OJ4 B;  3SDL C;  2IDY A;  1FRD A;  3H7P A;  2GOW A;  4B9K A;  1GOZ A;  2IY1 B;  3U7Z A;  1LGR A;  3J9C A;  1ISN A;  1YN3 A;  4I6P A;  3PVL A;  4BKS A;  3Q14 C;  3VDZ A;  1FFU A;  3ZJT A;  1Q5W B;  1Q0W B;  1FEH A;  3QK0 A;  3IHP C;  1KRH A;  5J18 A;  1D4B A;  2GBN A;  3H9D A;  2NMQ A;  1RM6 C;  3ZRF A;  4JIO U;  1FPY A;  1QOF A;  2W9N A;  2MEK A;  4H2A A;  1WM3 A;  1FCL A;  4JGH B;  2N9L A;  3HK0 A;  1P1A A;  5EE9 A;  3CST A;  1OEY J;  3NS1 A;  4M01 A;  5AZG A;  2V3N A;  4W9D A;  2D11 A;  2K3U A;  2GBJ A;  4MH8 A;  1V81 A;  2Z8L A;  3PS6 A;  4HRO A;  5BMI A;  1RFA A;  2RSU A;  4PS3 A;  1UGJ A;  2AL6 A;  2JXT A;  4ZRJ A;  1KF6 B;  2KMC A;  2GLS A;  2RPQ A;  4C56 C;  2PE9 A;  1YMH E;  2WYQ A;  1K53 A;  2KWV B;  2KJR A;  3R7R A;  2WXO A;  1Q1O A;  2KVR A;  4RF1 A;  3VH4 B;  2J53 A;  1FXI A;  2RGF A;  3A9K B;  2L8J A;  4N58 A;  4DDG D;  3RNE C;  5L95 C;  2DYM A;  2N7D A;  5G2N A;  3JW0 X;  4IM3 A;  4TUU A;  3TL5 A;  1JCK B;  1MG8 A;  1I4G A;  2KT7 A;  3O65 B;  2KJH B;  4NAW A;  1N5W A;  4KIK A;  2KHW B;  1SXT A;  5AEK B;  1EM7 A;  1L0X B;  2PVO D;  2QIE B;  1WGH A;  1TIF A;  3UQB A;  4KGT A;  1WXQ A;  3SHQ A;  4ANV A;  4HJK A;  1F0Z A;  3TSS A;  4NJ7 A;  3P2B A;  2WXN A;  3KYD D;  2YEP B;  3I5J C;  1C76 A;  2NCN A;  5DPT A;  2AEH A;  5CHF A;  3RNA C;  2WXR A;  2LHE A;  1FFV A;  1RYJ A;  2MLB A;  1HTO A;  2DAF A;  3Q3O C;  3NS8 A;  1BXT A;  4GB9 A;  3Q3N C;  1V1P A;  1UWX A;  1E90 A;  3WIM A;  2KAC A;  4MM3 A;  2JY6 A;  4WJP A;  1SE3 A;  4A3O A;  3ZGZ A;  2N9E B;  1TT5 B;  1E8W A;  3NHE B;  2QMT A;  4C7Y A;  2TSS A;  1H4R A;  2OHF A;  2JRI B;  1YJI A;  2J4X A;  4ZYS A;  3PRE A;  3B2G A;  3M62 B;  4JX1 C;  2KWU B;  4EOY A;  1GG3 A;  2E6X A;  1WIA A;  2MWS B;  3UQA A;  4J6I A;  1E9M A;  1P9D U;  4NJC A;  2IJ0 A;  2JQR B;  3BVG A;  2PE6 B;  4BFR A;  3QA8 A;  5FKA C;  1KLU D;  1N6Z A;  5IKC M;  4K3B A;  1HXY D;  2LI5 A;  1WGD A;  2KN5 A;  1XXG A;  2KZR A;  1E6E B;  2IBI B;  3AH7 A;  4B95 A;  4WJO A;  2BPS A;  1XLQ A;  4LNN A;  1IGC A;  1RWS A;  1NEK B;  4MH0 E;  4RNA A;  2H88 B;  3NVW A;  3GE8 C;  4XDD A;  1UBI A;  4DK5 A;  1LFD A;  2LVO A;  3TMP B;  2L3Z A;  3V61 A;  2WP9 B;  1D3Z A;  5CHV C;  1B1Z A;  1JQ4 A;  4DQO C;  1CQV A;  4M0W A;  2M0A A;  4KGR A;  4F7Z A;  2KYW A;  1L7Y A;  3DWG C;  1N62 A;  4YXD B;  1T0R C;  5JZE B;  1E10 A;  1OEY A;  2BQQ A;  2L32 A;  3VXW A;  1WH3 A;  2GRI A;  4BZA A;  1XO3 A;  4MDK E;  5LXH A;  4BOZ B;  1TS5 A;  1HZ6 A;  3ZLZ A;  1QLB B;  5C3J B;  1RLF A;  4NZL B;  4DXG A;  3OWE B;  4WJN A;  2X38 A;  4K3C A;  3UIN B;  2SEB D;  3EGR A;  4CO7 A;  3U30 A;  3AE2 B;  3AU5 A;  2KKC A;  2WDQ B;  5J17 A;  3N1X C;  3VTV A;  1V8C A;  4GDK B;  3RD2 A;  3Q3J A;  1FMA D;  3DVG X;  2M0X A;  4S17 A;  4USA A;  3TEZ A;  2NVU I;  2N1W A;  3DOW A;  3V05 A;  5KHQ A;  4XZ4 A;  1L6U A;  4PS8 A;  2KMA A;  2CU3 A;  3DBL I;  2KDE B;  3GE3 C;  2HJ8 A;  3U52 E;  3ZVV A;  2V0G A;  3PHW B;  1AWD A;  4EUT A;  3TEW A;  1P3Q U;  2AQ2 B;  2W3R A;  3NVV A;  1L4D B;  4FN2 A;  1YN4 A;  2L00 B;  1K51 A;  1V86 A;  2XN9 C;  3A1Q B;  3DVN U;  3P42 A;  2KQS A;  4S0R A;  3PRP B;  1JW9 D;  2PMV A;  1KM7 A;  3P4S B;  3IT4 B;  1SE2 A;  1VDV A;  3PT2 B;  4OVU A;  3T3N A;  3EHV A;  3H1U A;  1JWU D;  2G4D B;  2CS4 A;  3Q8A A;  2Y5C A;  3SFD B;  4A3P A;  3AE9 B;  1GB1 A;  3NOB A;  4FBJ B;  4NJ6 A;  3GP7 A;  2MCN B;  4II3 B;  3N1Y C;  2BS2 B;  3HVD A;  3I3T B;  4A9A A;  3DVG Y;  2J42 A;  2IO0 B;  2ASQ A;  2REX A;  1VCB A;  2LXC A;  3BII D;  4ZHP A;  3OLM D;  2OJW A;  2K6Q A;  2KX0 A;  3EFC A;  3IFW B;  1A70 A;  1QOA A;  2WXF A;  2N0S B;  2KDI A;  2EKE C;  2G4S A;  2BWE S;  4RCO A;  2M56 B;  1ZUD 2;  1WR6 E;  2O6V B;  5FK9 C;  3QCA A;  4HJG E;  3PPA A;  3L0W B;  5KHO A;  4IKG A;  4HRS A;  4GDL A;  3RUL A;  4M8M A;  1WM2 A;  4RFB A;  1VD2 A;  1M94 A;  2JU6 X;  2M4N A;  1VRA B;  2FNJ B;  4NNJ B;  2PLP A;  4MGI E;  4NPN A;  3L13 A;  1WF9 A;  4US9 A;  2FAZ A;  2MSE D;  2PIA A;  3Q8F A;  1FM0 D;  3P4Q B;  1OQR A;  3DBH B;  4HWI B;  1EWY C;  5IO9 A;  3V6C B;  2D3B A;  4K7W A;  1JRU A;  2CHX A;  3HVZ A;  1QKZ A;  2MBQ A;  3AM9 A;  2HJ1 A;  1IBX B;  3ML8 A;  3B0A A;  1C4C A;  2PPH A;  1TZO A;  5IA7 A;  2BYT A;  1UH6 A;  4E3C A;  3UIP B;  1N60 A;  1SF0 A;  3RPF C;  2DZK A;  4HPP A;  2DZJ A;  4G11 A;  3ZDT A;  1F77 A;  2N9X A;  3AE5 B;  2WWZ A;  2CJN A;  4OW0 A;  4GMV A;  4WH4 A;  4AP4 C;  2ZW1 A;  2I38 A;  2LZ6 A;  3DCG A;  1WXS A;  2KDM A;  4ZOH C;  1ZPS A;  3H6N A;  3MC9 A;  3VTU A;  2FCM A;  2VH1 A;  2C9W B;  2WGS A;  2N9P C;  4GU2 A;  2MJD A;  1JWA D;  4IWP A;  1CJE A;  5G5H A;  3LYY A;  3HIZ A;  3W5U B;  1GNU A;  3DBL B;  2RPV A;  1J0G A;  3KUD B;  3C8Y A;  2DEN B;  4GDK A;  2RDB C;  3KUZ A;  3OAW A;  3PRM B;  2IGG A;  4HK2 A;  2FIF A;  2D3A A;  2G45 B;  2MBB B;  3W9C B;  1FRR A;  3T3O A;  3IXS A;  1UGM A;  3PSE B;  2JF5 A;  3MJW A;  3BIN A;  1P7F A;  1V49 A;  4E74 A;  3RZW C;  3CWI A;  1TKY A;  2EMT A;  1A5R A;  2K8C A;  1E7P B;  2IND C;  4M00 A;  4A20 A;  2B76 B;  2MH7 A;  3GOE A;  2RDG A;  5E6N A;  2INC C;  2KC2 A;  1JRP A;  4DHZ E;  3WA0 A;  2OJR A;  2RR9 A;  2QDF A;  3A4S C;  2WX0 A;  2HTM E;  2JX5 A;  3DDC B;  3N30 A;  1WSP A;  2KAN A;  3PO0 A;  4N59 A;  5AUI A;  4RGO S;  2R61 A;  1Z5S B;  1XF5 L;  2BBC A;  1F52 A;  5IOI A;  1MHH E;  5IAA C;  1TKG A;  3MHZ A;  3DHI C;  2DLB A;  2D2Q A;  2MP2 B;  1DYQ A;  1SEB D;  1V5O A;  2LGS A;  4JLC A;  1QF6 A;  3LJ3 A;  2BTE A;  3EA6 A;  2ZJD A;  1SB3 C;  4KZ0 A;  2KLG A;  4GIV A;  1BT0 A;  3MHS D;  3OJ3 A;  4OHJ A;  1OQY A;  2MJE A;  1OFF A;  3W1S C;  4BBN C;  4GSW A;  1JWM D;  2YVC A;  3MFG A;  1HE8 A;  4LDT B;  3PZ8 A;  2UWQ A;  2O6V D;  1TY2 A;  2JRH A;  3LXF A;  3URY A;  1GUA B;  2WXH A;  1YQB A;  4X57 B;  4AJY B;  1KFY B;  3RT3 B;  4Q2J A;  4MT5 A;  2WQY B;  5BYR A;  1UUP A;  2XNA C;  4BKS D;  3ZNG C;  2RDH A;  1WJ4 A;  4BAX A;  2BGF A;  4W9K A;  1YIW A;  2Z0E B;  3RN9 C;  4TMA B;  1VZ7 A;  1TJE A;  4IWO A;  3UF8 A;  5CHW A;  2Z0D B;  1NYQ A;  3DHH C;  1K52 A;  4A55 A;  2WHI A;  2JXX A;  5I4D A;  2HTH A;  1T5X D;  3PZD A;  2C5L C;  4J3O D;  1LQB A;  1OTR B;  2LEK A;  1UZX B;  1WGK A;  5BO4 B;  4A90 A;  4URK A;  4MGY E;  2H89 B;  2KX3 A;  4R3D A;  3MC8 A;  2MA9 B;  1YJ1 A;  2IO1 B;  3GS2 A;  1YOV B;  3RUI B;  3R2I A;  1WZ0 A;  2WXQ A;  1N63 A;  1V97 A;  2KTR A;  1F1H A;  4K7U A; 
#chains in the Genus database with same CATH homology
 4OVZ A;  1MPE A;  4A6Q A;  1NEK B;  5TSS A;  4RNA A;  4WUR A;  1M4V A;  3ETR A;  2WXJ A;  2H88 B;  3NVW A;  2FE8 A;  3Q8B A;  3AE1 B;  4TSS A;  1TS3 A;  2LHD A;  3ZYY X;  4HKQ A;  1IBX A;  1XCQ L;  1T6B X;  4XDD A;  2WXG A;  3TEX A;  3Q8E A;  3AED B;  4C80 A;  2CJO A;  5MPO A;  3Q8C A;  4ZRQ A;  2MJ3 A;  1I4R A;  1NI3 A;  2WP9 B;  2EKI A;  4N6E B;  1ZOY B;  1ROE A;  1SBB B;  1B1Z A;  2EEL A;  4NAW B;  1JQ4 A;  4DQO C;  1BML C;  2NTS A;  4JWU C;  1CQV A;  2W54 A;  4LLG M;  2M0A A;  4KGR A;  4M0W A;  4B0M A;  1DGJ A;  5G5G A;  2IPK D;  4EE2 A;  3DWG C;  3KWV A;  1I4P A;  1N62 A;  4YXD B;  3HUI A;  1EU3 A;  2L1A A;  2WLB A;  1E10 A;  2L32 A;  2IGH A;  2GRI A;  1E0Z A;  1XO3 A;  2DBY A;  3AEB B;  2FBW B;  1YNT E;  2I2Y A;  1TS5 A;  4AS1 A;  1HZ6 A;  4YTM B;  3BYY B;  1QLB B;  5C3J B;  4NZL B;  3B9J A;  4DXG A;  1XEE A;  1AYF A;  3OWE B;  1UNS A;  1JWB D;  3I57 A;  3BVM A;  2X38 A;  3VQI A;  3SR6 A;  4ZHO A;  5C2T B;  2SEB D;  2DWQ A;  2PTL A;  3FC4 A;  3EGR A;  4ARI A;  3AE2 B;  5T8I A;  2WDQ B;  1QOB A;  1ZDV A;  1JWS D;  1V8C A;  4GDK B;  2Q5W D;  2K5P A;  2AQ3 B;  1FMA D;  2QIL A;  5AUK A;  1JML A;  3FIL A;  4USA A;  5D3D A;  3TEZ A;  2PKO A;  1J7C A;  1ET6 A;  3V05 A;  5D7G A;  1C78 A;  1BUI C;  2Y3A A;  1L6U A;  5BYQ A;  3AEC B;  1DOX A;  3O13 A;  4P6V F;  2CU3 A;  4CQN A;  2JYE A;  1LO5 D;  2INN E;  1CK1 A;  3U52 E;  2V0G A;  3W5V B;  3AV8 A;  1MHX A;  1F2R I;  2NTT A;  2WDR B;  4MAC A;  1AWD A;  1TS2 A;  3P4R B;  1I4Q A;  1VLB A;  3E9S A;  2BT6 A;  4MM3 B;  1QOG A;  3TEW A;  2AQ2 B;  2W3R A;  3NVV A;  1VJK A;  1L4D B;  2WXI A;  3TUO A;  2ICI A;  1YN4 A;  2K0P A;  1DOI A;  4HKZ E;  1K51 A;  1JRO A;  2XN9 C;  1L5P A;  3AE3 B;  2WS3 B;  3P42 A;  2V4I B;  4IDI A;  1JW9 D;  1D6E C;  2JSV X;  2PMV A;  3SEB A;  3P4S B;  4WAF A;  2BB5 A;  3IT4 B;  1SE2 A;  3EUB 2;  1VDV A;  2J52 A;  1T3Q A;  2LMC A;  2PVG C;  4IOI E;  1YQ3 B;  3LB8 C;  3U4E G;  3T3N A;  4RF0 A;  1JWU D;  1ENF A;  3Q8A A;  2Y5C A;  3SFD B;  4OZB A;  3AE9 B;  1GB1 A;  3VRB B;  2LUM A;  3DWM A;  3UI3 A;  1FNU A;  1RFK A;  3GP7 A;  5EE0 A;  2BS2 B;  1HA5 A;  2E3T A;  3PZ7 A;  3FAH A;  3HVD A;  1XLO A;  3IT6 B;  4A9A A;  2G9H D;  2N7J A;  2WXL A;  4HEA 1;  3AE4 B;  2J42 A;  1FCC C;  3AEA B;  4JPS A;  3BVZ A;  2DYO A;  1J7B A;  1WRI A;  3BII D;  4ZHP A;  5GXG B;  3VR8 B;  4B0E A;  3NZ3 A;  3AB5 A;  3BWU D;  2V3P A;  2ON8 A;  4LK0 M;  2KAJ A;  3MJ5 A;  4YWG G;  1I4H A;  2LGI A;  1VZ8 A;  1GB4 A;  1SSN A;  4YTP B;  1A70 A;  2Y5P A;  1QOA A;  4KKI A;  2WXF A;  2N0S B;  1PDX A;  1I7H A;  3IAS 1;  1DOY A;  1R7S A;  3AE6 B;  1PGA A;  2WDV B;  3R8B A;  4RCO A;  4C7Z A;  1N5X A;  2M56 B;  1ZUD 2;  3MP9 A;  1V1P B;  5FK9 C;  1WWT A;  3GB1 A;  2ONQ A;  1TY0 A;  4HJG E;  4YTN B;  1IUE A;  1TYG B;  4IKG A;  1YJJ A;  4HRS A;  4WQM A;  3ZQ4 A;  2FUG 1;  3NVY A;  1NVI D;  4LTU A;  1YN5 A;  3BK2 A;  1FXA A;  3P63 A;  4FXC A;  4RFB A;  1L0V B;  4YSZ B;  1D5Z C;  2JU6 X;  1Q10 A;  2WXM A;  3FIL B;  2VZK D;  1VRA B;  1KLG D;  3NVZ A;  2KQ4 X;  3CIR B;  1CZP A;  2PLP A;  2K22 A;  5LNK 1;  5BYS A;  4US9 A;  3ABV B;  2QSD A;  3H8H A;  2PIA A;  3VR9 B;  1FNW A;  2M19 A;  3KQ4 A;  3Q8F A;  4XDC A;  1FM0 D;  3P4Q B;  5HFY A;  1OQR A;  1ZXI A;  1WYG A;  2D5G A;  1EWY C;  1QT9 A;  1YQ4 B;  2KWD A;  1OQQ A;  2RMM A;  1PGB A;  1D5M C;  5EE3 A;  3HVZ A;  1QKZ A;  3AM9 A;  3RFZ B;  1KTK A;  3BZD B;  1IBX B;  2BW2 A;  4RGN A;  1C4C A;  1HQR D;  4GDL B;  1QIL A;  1TKE A;  5BMH A;  1F2R C;  1L4Z B;  4P16 A;  1TZO A;  3W2D A;  2BYT A;  2IDY A;  1FRD A;  3AEF B;  1GOZ A;  4YSX B;  5HG2 A;  1AW7 A;  3U7Z A;  3J9C A;  1N60 A;  1SF0 A;  1YN3 A;  3RPF C;  4AQ7 A;  4O1N A;  2BS4 B;  1F77 A;  2WU2 B;  3AE5 B;  4OW0 A;  2CJN A;  1FO4 A;  4WH4 A;  3KLS X;  1FFU A;  1Y56 A;  2ZW1 A;  2I38 A;  4RGT A;  3ZJT A;  2KDM A;  4ZOH C;  1ZPS A;  1FEH A;  2GI9 A;  1L6V A;  1KRH A;  4RH6 A;  3Q69 A;  1D4B A;  1C4P A;  2MJD A;  1HZ5 A;  1JWA D;  2ZW0 A;  1CJE A;  1K50 A;  4WIP A;  3U2S C;  5G5H A;  4D2K A;  3LYY A;  3BK1 A;  4JWS C;  1JAL A;  4RGM A;  2NMQ A;  1RM6 C;  5E6J A;  3W5U B;  2RPV A;  1QOF A;  1SJE D;  2MEK A;  3P4P B;  2KMM A;  4H2A A;  2QEJ C;  1NEN B;  3C8Y A;  2W82 A;  2JYT A;  1FCL A;  1C9F A;  2N9L A;  1P7E A;  2IGG A;  1GPX A;  1B9R A;  5EE9 A;  3WCQ A;  3ZJU A;  3NS1 A;  3KWL A;  1UWM A;  3W9C B;  1PFD A;  2V3N A;  2QJL A;  1FRR A;  4XWT A;  3T3O A;  2JWU A;  3IXS A;  2K3U A;  4TQ1 A;  2AX5 A;  1P7F A;  4MH8 A;  3MC0 B;  1HEZ E;  3CWI A;  2Z8L A;  4ZRP A;  1STE A;  1TKY A;  4HRO A;  4ARC A;  5BMI A;  4ITK A;  1E7P B;  4KKJ A;  3HRD D;  1UGJ A;  2JXT A;  1MI0 A;  1V1O A;  2B76 B;  3AEE B;  1KF6 B;  2MH7 A;  4C56 C;  1PYW D;  1YMH E;  2RDG A;  1I4X A;  1L0Y B;  1FD6 A;  5HI1 A;  2L83 A;  1K53 A;  1MVK A;  1JRP A;  2YEP F;  3N9Y C;  1VZ6 A;  1J7A A;  5FR3 A;  4WWM A;  3TEY A;  2WXO A;  4YSY B;  2JX5 A;  2HTM E;  1C79 A;  4RF1 A;  2JZP A;  1WSP A;  1AN8 A;  1FXI A;  2J53 A;  3AEG B;  1ZDX A;  5HHD G;  3PO0 A;  1VR9 A;  3L4P A;  4N59 A;  4N58 A;  5AUI A;  2GB1 A;  1EWC A;  4RGO S;  3W1S A;  2R61 A;  1EU4 A;  2DYM A;  5BMG A;  4NAM A;  4TQ0 A;  1XF5 L;  2BBC A;  1N61 A;  1MHH E;  3AN1 A;  1PUT A;  2WU5 B;  1TKG A;  1ET9 A;  3MHZ A;  4KX6 B;  2DLB A;  1XLP A;  1DYQ A;  1SEB D;  3NRZ A;  1JCK B;  1I4G A;  2WXP A;  4OZA A;  2WXK A;  1QF6 A;  2PW9 A;  2VZK B;  5JXV A;  2BTE A;  3EA6 A;  1N5W A;  2W3S A;  2LJI A;  1SXT A;  1IGD A;  2LFI A;  1SB3 C;  1EM7 A;  1GAQ B;  2AQ1 B;  1PGX A;  1L0X B;  4UDU C;  2PVO D;  4OHJ A;  3BYT B;  5H8Y E;  2QIE B;  2MJE A;  1OFF A;  1NYR A;  4L23 A;  4KGT A;  1WXQ A;  1JWM D;  4XWW A;  1F0Z A;  3MFG A;  3TSS A;  2WXN A;  3PZ8 A;  1ZE3 D;  1TY2 A;  2YEP B;  2W55 A;  1C76 A;  3V3X A;  2WNM A;  3LXF A;  3URY A;  1FIQ A;  1TS4 A;  2BB6 A;  2WXH A;  2OED A;  2WXR A;  2LHE A;  1KFY B;  1FFV A;  1RYJ A;  2N9K A;  1QQR A;  1ZXH A;  1BXT A;  3ZJV A;  3NUH B;  3R2T A;  2L52 A;  1FNV A;  1V1P A;  4KGS A;  1UWX A;  2K9X A;  1ZP0 B;  2WQY B;  2KAC A;  4MT5 A;  4Q2J A;  5BYR A;  1UUP A;  2XNA C;  1SE3 A;  3E56 A;  2INP E;  3ZGZ A;  5D3I B;  1SJH D;  2HDE A;  2QMT A;  2RDH A;  4C7Y A;  2SAK A;  2TSS A;  1KH0 A;  3I9V 1;  4L2Y A;  2OHF A;  4TMA B;  3SFE B;  1YJI A;  3AE7 B;  1VZ7 A;  1TJE A;  2J4X A;  4L1B A;  4ZYS A;  3B2G A;  4DXF A;  1NYQ A;  1K52 A;  4A55 A;  2G1E A;  4JX1 C;  5EE1 A;  5H92 C;  2KN4 A;  1SIJ A;  5I4D A;  1T5X D;  2E6X A;  4J3O D;  3B2F A;  1E9M A;  4XE0 A;  1C77 A;  4NJC A;  2IJ0 A;  2JQR B;  3BVG A;  5FKA C;  2LEK A;  1KLU D;  4JE3 B;  1WGK A;  3AE8 B;  4A90 A;  4PT5 A;  1HXY D;  1XLN A;  3P1M A;  3IAM 1;  1C4A A;  3VRA B;  1ESF A;  1XCT L;  1XXG A;  1E6E B;  2H89 B;  1ACC A;  4GLS C;  4REZ A;  4A8X C;  2IGD A;  3AH7 A;  4R3D A;  4OZC A;  2ACZ B;  1SE4 A;  3GS2 A;  3R2I A;  3AMZ A;  4US8 A;  2WXQ A;  4YT0 B;  1D5X C;  1N63 A;  2BS3 B;  1V97 A;  1XLQ A;  1IGC A;  1RWS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...