4B0MA

Complex of the caf1an usher domain, caf1m chaperone and caf1 subunit from yersinia pestis
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
135
structure length
131
Chain Sequence
AYTFDSTMLDTNSGESIDVSLFNQGLQLPGNYFVNVFVNGRKVDSGNIDFRLEKHNGKELLWPCLSSLQLTKYGIDIDKYPDLIEQCVDLLAIPHSDVQFYFNQQKLSLIVPPQALLPRFDGIMPMQLWDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords F1 CAPSULE-ANCHORING PROTEIN
publication title Allosteric Mechanism Controls Traffic in the Chaperone/Usher Pathway.
pubmed doi rcsb
source organism Yersinia pestis
total genus 21
structure length 131
sequence length 135
ec nomenclature
pdb deposition date 2012-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.410 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4b0mA00
1ZDVA 1ZE3D 1ZDXA 3RFZB 4B0MA 3BWUD 4B0EA 4J3OD
chains in the Genus database with same CATH superfamily
3RI7C 2IO3B 1E9MA 3QK0A 3AE9B 3R7RA 2QEJC 4JX1C 1OQRA 1ACCA 4FADA 2QIEB 1Y56A 4C56C 2Y5BB 3AMZA 1LM8B 4ZYSA 2EKEC 4K7UA 2DHZA 2KHWB 1P0RA 1V49A 1WZ3A 2AL3A 3DPDA 2UU7A 3MJ5A 1UWMA 3VUYA 2G45B 3FAHA 5DPTA 3HVDA 4EZLA 2R61A 2QJLA 4XDDA 1WSPA 3ZRCA 4A3PA 2BS3B 3HUIA 1T3QA 3OG5A 3T3OA 2N9PC 3M95A 1E6EB 1T0QC 1ZXHA 3WA0A 3FILB 4NJ7A 2I1KA 3B2FA 1PQSA 2AQ3B 1VRAB 1E0ZA 1WXMA 4WJQA 4MM3A 3O13A 3B9JA 3ZXRA 3VTUA 4C80A 2JQRB 1WXAA 2Z8LA 4LJPB 1FCCC 2WXFA 4KGRA 4YWGG 1KLGD 4HPLB 1VZ6A 1OQYA 1WR1A 3AV8A 3ZYYX 1FNUA 1E5WA 3PHWB 2R2OA 2KWCA 2N7DA 3DVGY 4XYCA 1L4ZB 3AEDB 4J3OD 3A1QB 3TEXA 4K81A 2WQYB 3AEAB 3C19A 3ZKJC 5G55A 2D5GA 4W9EA 3CSFA 3DVNU 4GSWA 1ESFA 3RULA 5E6NA 5AUKA 3WIMA 4BKSA 4EEWA 1LGRA 2KWUB 4FXCA 2FIFA 1EUVB 2JSVX 4ZRQA 3ZRFA 1SEBD 2YLMA 2RDGA 2NS5A 1RAXA 2JF5A 4R3DA 1KTKA 5G2NA 3H7SA 1ZDXA 3OAWA 4FJZA 2L52A 1N6ZA 3LJ3A 3PLVA 2GBRA 1ISNA 5J2RA 3GS2A 3PSEB 2DENB 4KKJA 1IBXA 3TEWA 1KM7A 1ET9A 4A9AA 2OOBB 1NI2A 2WDTB 4IWQA 3RNCC 4IG7B 3TCAA 1U4AA 1FXAA 3TUOA 4HCPB 5IP4D 3ML8A 3H1UA 2WXIA 2W9NA 1V5OA 5L95C 3H8HA 2RPQA 4BVUC 3VDZA 3ZJTA 1IGCA 4M02A 4ANUA 4EZJA 2LASA 1UBIA 1YJIA 2PKOA 1E90A 1WM3A 1CK1A 1SE2A 2ZJDA 1ZW7A 2C5LC 2HD5B 4YSXB 4E3CA 5IKCM 2FCMA 3EFCA 2X8XX 4A20A 2KQ4X 1IGDA 1FNWA 1DOXA 1E7PB 1UD7A 2K6DB 2MJ3A 1UZXB 2EMSA 3HIZA 3L08A 1V2YA 3V05A 4HJKA 2FCQA 4M00A 3UQAA 1WJUA 4WIPA 1F52A 3T9LA 2ZW1A 5CHWA 2B76B 2WDQB 1C78A 3C0RB 4MGKE 4WWMA 2MCNB 2VRRB 4BOSC 2BB5A 3GZNI 3IFWB 2BS2B 3C8YA 3NVYA 2BYVE 4GXBA 1JALA 4CYEA 1B1ZA 1WZ0A 3WAPA 3UI3A 3AU4A 4P1BC 4MGIE 4NAWB 4DHZB 4HKQA 3NZUA 1TS4A 1VJKA 2KJRA 2GOWA 3ZNHB 1V1PB 1E8YA 4NAMA 2MBOA 2QHOA 1K50A 4PT5A 2N1VA 1P98A 1VR9A 3RNGC 1D5ZC 3Q3FA 1GPXA 1EF5A 3A9JA 1CQVA 1QT9A 2NPTB 2CHWA 2V9HA 1WYWB 2J0KA 3OWEB 4LDTB 1WGRA 2KDBA 1RLFA 3NVWA 4KDIC 1YNTE 1IUEA 2BWES 2ONQA 2JPHA 2K39A 2V3NA 2GMIC 5I4DA 4WWOA 3UGBB 3PHXB 2LHDA 3KW5B 4XGAB 3P4RB 4KGTA 3A9KB 2K22A 3Q8EA 5HFYA 1GB1A 4JWSC 2D3CA 2BGFA 2QDFA 3AEEB 4A55A 4C4VB 1XCQL 1QF6A 3DBSA 2IY0B 1YN4A 4ARCA 3MTNB 3IT6B 3DHGC 2DZMA 3QARA 4HDQA 5IA7A 3AEGB 1SIFA 4XC2A 2LGXA 3W1SA 4TSSA 4MH8A 1D5MC 2N9XA 1KH0A 4JWUC 2JUOA 2FCNA 2LEKA 2LVPA 2JXTA 4PS7A 4IC7B 2N9EB 1TS3A 4OZCA 3O65B 1PDXA 2FUG1 2QC8A 2L3ZA 2KQSA 1A5RA 3RFZB 1UUPA 2PW9A 3X0WA 4TMAB 3R8BA 4DXFA 3I9V1 2KDIA 1QOFA 2M19A 4USAA 3U52E 2EELA 4DDGD 2O2VB 2WXKA 3DBHI 4YTPB 2KN5A 2D3GA 2CU1A 3JSVB 2AEHA 1NI3A 5CHVC 3AECB 1WXSA 4CHKA 3PTFC 5EE0A 5TSSA 4NZLB 4YT0B 2LD9A 2LUEA 3VUWA 1QOBA 2K9XA 1LFDA 1V9JA 3TBLD 3DBLB 2H88B 5C3JB 4RMAA 1JW9D 1OEYJ 3BY4B 2HJ1A 2L05A 5C23A 1VZ8A 1L2NA 3T8MA 2KZRA 3VRBB 2X38A 2WXRA 3Q6BA 2RGFA 3Q8BA 4HWIB 2KK8A 4KZCA 2PLPA 4TKNA 3VUXA 1EU4A 2ZEQA 4ZRJA 3VHTC 4ICUA 3PV1A 3N20C 3CSTA 4ZHOA 1K8RB 1QZEA 2RMMA 4BFRA 3KUDB 5C2TB 2IPKD 3V60A 4OVUA 3Q8FA 4KX6B 4OHJA 5JHAA 3VR9B 2L32A 2I1JA 3CIRB 2J7QB 3ECIA 3V6EB 1UNSA 1JCKB 2J53A 2BKFA 4K3BA 2K0PA 2N9KA 2L1AA 2ZPNA 4KSKC 1TS2A 1WGDA 1WI0A 3DWMA 1H4RA 2ICIA 5AEKB 4W9FA 4PK1A 2KTFA 2PEAA 4NJCA 1F1HA 3RYTA 1VCBA 4OZBA 1F9JA 1YMHE 2DX5B 3P1MA 1ROEA 3TIXA 1YX5B 1AYFA 4N9F4 2LRUA 2ZVNA 2KDFB 2INCC 2HE7A 1UH6A 1WGHA 2R2QA 2KACA 2RDBC 4EOYA 1J7CA 3OJ3A 3EFUA 3H7PB 3FILA 3DBRI 3NJTA 1T0SC 3QWZB 5BYRA 4US8A 2ON8A 4MJSB 4BKTA 4K7SA 1EF1A 3PO0A 4JE3B 1V81A 4N6EB 3FKYA 5L83A 2G9HD 2K1FA 2B3AA 1BUIC 5H92C 4N59A 2D3AA 1PUTA 3MP9A 2OHFA 1SE3A 4KIKA 3DHHC 4XE0A 1SIJA 3VRAB 1YD8U 1EU3A 2N1WA 2GLSA 3A1QA 3MC9A 1MJDA 3V6CB 3AU5A 1SE4A 2N7JA 4GB9A 2MX2A 2WLBA 1SGHA 1C4CA 2ACZB 4LNKA 1PYWD 1ZPSA 1RWSA 4NY0A 1GC7A 1YOVB 4GMVA 4RFBA 2D2QA 3PZ8A 3BK1A 3JYUA 4DXGA 2LI5A 1DOIA 2MA9B 1E7UA 1XLPA 1EWCA 1B9RA 4MDKE 4WWPA 4HKZE 1HZ6A 4YL8A 4DHZE 4MGYE 3AEBB 3TSSA 3L4PA 2C7HA 4NJ6A 5FKAC 4C00A 5EE9A 2LUMA 3ZDTA 2KX0A 3QJZA 4URKA 5EDSA 4ZHPA 2K8CA 1S3SG 3SR6A 2XNAC 3UIPB 3L16A 3ABVB 2O6VD 1TGZB 2MHJA 1ZXIA 5CX3A 4W9LA 2PVGC 2O6VB 1I4GA 3HK0A 2KN4A 2N7EA 4JQWC 3HVZA 3VVWB 1GUAB 2AQ2B 4P7IA 2BBCA 3WAMA 2C7MB 3P4SB 1GG3A 1XCTL 5T8IA 2L83A 1RYJA 3K9OB 3TL5A 1TYGB 4ZDVA 4FN2A 2D3BA 2FAZA 1NVID 2NMQA 2Q5WD 1Q0WB 3K9PB 2BB6A 5DCNA 4AP4C 4ARIA 2NCNA 1TKEA 3DWGC 2KMCA 3Q3MC 4AS1A 5D6JB 1OEYA 1WXVA 2LWPA 3SHQA 4YSZB 3IAM1 4H2AA 1WFYA 1JRPA 1QOAA 2MP2B 2KTRB 1FEHA 3DQVA 1RRBA 3P4PB 3BK2A 4ZOHC 5LXHA 1FFVA 4IM3A 1CMXB 1DGJA 1TIFA 1I4HA 2WX1A 1Q10A 1NYRA 2Y5PA 2OJRA 2WXNA 1CZPA 3W1YA 2WXPA 4US9A 2MWSB 3WAOA 4WURA 1WJ4A 2IZVB 1TT5B 3BIID 1C3TA 1NENB 2DAFA 3T3NA 3QHTA 5E6JA 1E8ZA 1FRDA 3P2BA 2KXJA 4GU2A 4LCDE 4NAWA 3EC8A 3EUB2 1KLVA 4RGOS 3AE2B 3R2IA 1MVKA 1DOYA 4IM0A 1R7SA 2NBVB 2KJ6A 2C7NB 5HKHA 1WR6E 1I7HA 2KC2A 2W3RA 2GBMA 2PVOD 3MFGA 3X23A 1JWSD 2L7RA 1NEKB 4LTUA 2UWQA 2WNMA 1TS5A 4WAFA 5HI1A 2V4IB 3R2TA 3KUCB 1F2RC 1WE6A 2M1MA 5BO4B 2NPTA 2H89B 2N9LA 5IAAC 3AE4B 2IBIB 2IO2B 3RNFC 1WF9A 2MSED 4DXAB 1UELA 3PRZA 2DZKA 3W9CB 4KV2A 1TTNA 1XO3A 3A4RA 2CR5A 1FNVA 2G4SA 3N1YC 2NVUI 1D4BA 1HEZE 4MH0E 2ZVOA 3A9KA 2CJOA 2JZ3B 3J9CA 3NVVA 2C60A 2INNE 3M63B 4C4VA 4MSMB 1JMLA 2LVQA 1V86A 5DPSA 1SF0A 2KDEB 1P7EA 4K3CA 4ZRIA 1FFUA 2LJIA 5FR3A 2NR2A 2KOXA 1YQBA 1ZP0B 2YEPB 1HE8A 4W9GA 3BWUD 3TJPA 4ANWA 2K6QA 1NDDA 5DPWA 1R4MI 1HTOA 2BW2A 2WXMA 2JXXA 4ITKA 2REXA 1AARA 1AWDA 3PS6A 4ZRKA 3P63A 1YIWA 2BKRB 2LMCA 3PGEA 2V0GA 3EGRA 1WE7A 1JROA 2O2VA 3KQ4A 1C4PA 1L7YA 4L1BA 3LYYA 3JSVA 1WWTA 3GB1A 1LQBA 2XK5B 2MBBB 3JW0X 2N4FA 3KUZA 3NS8A 5LNK1 1NYQA 3I63C 3ENEA 3ZQ4A 2PPHA 3N1ZC 1L4DB 1S1QB 1N60A 4FHKA 2JRHA 1WX7A 2MBEA 3W2DA 1TZ1A 4XWTA 3PZDA 3U8ZA 3H6NA 5JXVA 4XWWA 4ANVA 3ZTDA 4J6IA 3RNEC 4EFOA 2UYZB 3HRDD 2WGSA 2BT6A 1I4PA 4WH4A 1Q5WB 2J52A 2Z59B 2W3SA 1SJHD 4DQOC 2D07B 2V1YA 2VZKD 3APCA 3LDZE 1D6EC 1ET6A 4KZ0A 1T6BX 4AQ7A 1WX9A 3HM3A 2VZKB 4NNJB 2CS4A 2L0FA 1WJNA 3NOBA 4HVBA 1I35A 2WDRB 1SE9A 2L76A 4HJGE 1Y8RC 3PREA 1XEEA 1C76A 2IJ0A 2KLCA 4B6WA 4S0RA 3GE8C 3N1XC 4LNNA 1PFDA 2AX5A 3Q3JA 1FM0D 3IG3A 4RNAA 1BT0A 4G11A 2M4NA 4GDKB 1SB3C 3AE6B 1J8CA 4KGSA 4RGNA 3W5VB 3BVGA 2D10A 1K51A 2KFJA 4I6LB 5D7GA 3APFA 2WX0A 4DBGA 3VTVA 3RZFA 4OVVA 4WJOA 3H7PA 2K8BA 2IGGA 2WXOA 2DZJA 2KKCA 4MJSA 2W82A 3U7ZA 2AWTA 4P1CC 2AYOB 1WMHB 2K3UA 2XEWA 1TY0A 2QSDA 3QAQA 1QKZA 2BPSA 4GLSC 5LLIA 3GE3C 4NQLB 2I2YA 5EE3A 2M0AA 4P6VF 3BINA 3WCQA 3BYYB 5D94A 1FO4A 2CHXA 1XLQA 2VH1A 4CQNA 3FC4A 2GBKA 1WX8A 4M01A 1XLNA 1J7AA 1J7BA 2GBJA 3NY5A 5AZHA 3ZUNA 5BMIA 1YN3A 3P4QB 2Y5CA 4GGQA 3UF8A 1MG8A 1R4NB 3PRMB 4BOZB 2JVCA 5MPOA 1H8CA 2RPVA 5KHQA 4F8CB 2NTTA 3PZ7A 5HHDG 1D3ZA 3NVZA 3D32A 4RH6A 5D2MB 3U7DA 1FRRA 3NZSA 3EECA 2KDMA 1P7FA 2WXQA 1KOTA 1L0XB 3V61A 5D3DA 3SD5A 3A33B 4ANXA 3NHEB 4HROA 2WXLA 4ZYNA 2KJHB 3MC8A 3ALBA 3OJ4B 1AW7A 1BMLC 1P1AA 3NRZA 3RN9C 2HDEA 2LXAA 2LHEA 3ZO5B 1C9FA 3RPFC 2MEKA 3I57A 4LK0M 2WYQA 2MLBA 3BYTB 1STEA 1GAQB 1C77A 3IVFA 4HPPA 4BKGA 4ACFA 5FK9C 2IO1B 1M94A 3KYDD 4HRSA 4XX5A 2DYOA 5AZGA 1GOZA 2J4XA 1DYQA 3E9SA 3W1SC 1TKYA 4M0WB 4HEA1 4FLHA 2O6VA 4F1SA 4EZKA 1WH3A 3CWIA 4FJVB 2DWQA 1ZGUB 2IGHA 1C1YB 2KD0A 5DPRA 1FD6A 1GB4A 2L00B 2JRIB 2KANA 3L13A 1I4QA 4BBNC 3RZWC 4IWPA 5AUIA 1TY2A 2KT7A 1E7VA 1T5XD 2DAJA 4N58A 2KFKB 2JT4B 2JWZA 3P42A 4MEMA 1F2RI 3URYA 4G0NB 3N32A 5BYSA 5LXIB 5E6PA 3ZXVA 4JLCA 2RD0A 2INDC 1J0GA 4UDUC 3UQBA 4YSYB 2N0SB 4OZAA 4XDCA 1V6EA 1JWBD 5G5GA 1ZDVA 1QQRA 2ZW0A 3ZNGC 1N5WA 3OLMD 2LGDA 3UINB 2QCZA 1KJTA 2K5PA 4FHJA 2INPE 1LO5D 3PT2B 3APDA 3N30A 2LGIA 2D11A 2BQQA 4B95A 2V3PA 3RNBC 1XXGA 2IY1B 4L23A 5GXGB 3RD2A 4HPMB 2DYBA 3AH7A 5IOIA 3VQIA 2RDHA 3L54A 1L5PA 2HTHA 1IYFA 4ZRPA 4MT5A 1XQQA 3MJWA 4M8NA 3AM9A 2FIDA 4RCOA 1N62A 1SBBB 1CJEA 4IDIA 3DVGX 5IN7A 1QLBB 2CU3A 3PRPB 4WQMA 4HCNB 2QMTA 3VAWA 3CMMB 3AEFB 1UGMA 3AULA 4DDID 1MHXA 2V3SA 1SSNA 2EKIA 3IHPC 2BYTA 3Q69A 2AL6A 1XLOA 3UIOB 3DBHB 2JZPA 2J42A 3ONSA 4FBJB 2ASQA 3KVFB 3RUIB 2IDYA 3Q8CA 4PYUA 1LXDA 3ZW3A 2LJ5A 4GIVA 2JZZA 1WRIA 4MSQB 2KQ7A 2MJDA 3ZNZB 1MPEA 4E74A 3SEBA 3ETRA 3U2SC 2HJ8A 2FUHB 3VFKA 4C7ZA 4KVGB 2OEDA 5FR6A 3GP7A 5KHOA 3QIJA 2BVCA 3QQ8B 4FJYA 2LFIA 4K1RB 3I3TB 3ZGZA 2W54A 1FXTB 4IM2A 1JQ4A 1VD2A 3MHZA 2PJHA 2WXJA 3AB5A 3QC8B 2KX3A 2MBHA 5JHBA 4GDLB 4KIKB 1XF5L 4TUUA 1FPYA 1MI0A 2WHIA 3SFEB 4DHJD 2G4DB 4WQOB 1Q1OA 5D3IB 1V80A 2MW5A 1EM7A 2LZ6A 2KO3A 4DHJB 4G50A 2RSUA 3N9YC 4NPNA 4F7ZA 2I38A 2GI9A 4PYZA 2PE9A 2Y3AA 3TMPB 4C7YA 2XK5A 1V1PA 3VH4B 2EMTA 1SXTA 1IPGA 2DNFA 5IO9A 2JYEA 1YX6B 1E8WA 1E8XA 4A3OA 2YEPF 3KWLA 3RMKC 1J19A 1KLUD 4BAXA 4KDLB 3ZJUA 2PMVA 1GJZA 3BZDB 2WWZA 3AE3B 1KFYB 1UF0A 4MELA 4O1NA 1WYGA 1KRHA 2FCSA 4M8MA 3RCZA 3V62A 1OTRB 1E10A 3DBRB 5HG2A 3TEZA 2IYDB 4KKIA 2KMAA 3WANA 5CHFA 5TR5A 3DBLI 2BS4B 4RM9A 2KVZA 1WY8A 2DBYA 3H9DA 3KH0A 4A90A 4FA6A 1JRUA 1GC6A 2JWUA 2SAKA 2JYTA 1M4VA 1I4RA 4IOIE 1R4NI 3EA6A 1V8CA 4OW0A 1K53A 1N63A 1NBFC 2KWVB 1OFFA 3Q3OC 4K7WA 1QOGA 2M8SA 1WGKA 4RGTA 2J0JA 1WIAA 2KAJA 3M62B 4MM3B 2Z0DB 3BVMA 4KSLC 4W9HA 1AN8A 3JVZX 4GDKA 4JGHB 3BVZA 1XD3B 2JU6X 2LGSA 1UWXA 4FULA 1VZ7A 4S17A 2MRPA 1IP9A 3VR8B 3ZJVA 3NG0A 4Q2JA 1FCLA 4BZAA 4CO7A 2ZCBA 3S2AA 2FBWB 4II2B 1X1MA 2GB1A 4BKSD 2MBQA 4LNFA 2L8JA 5BYQA 4G3XB 3KLSX 2WS3B 1EWYC 3QA8A 1RM6C 1WMHA 1YJ1A 3KWVA 2E6XA 1FXIA 2G1EA 4WAAA 3PVLA 2C9WB 4NQKE 5EE1A 1YQ4B 3R3MA 3L17A 2L0TA 5AZFA 1L6VA 3IBEA 4YXDB 4AOFA 2CJNA 4REZA 1WM2A 1IBXB 4GOCA 1HA5A 3IXSA 1ZKHA 1JWMD 1TKGA 4YTMB 4XZ4A 4IUMB 5CTRC 2ZCCA 3VH3B 4LNOA 1YJJA 4RGMA 2IO0B 1P3QU 4LDTD 1MFWA 4WJNA 2WU2B 2WXGA 3E56A 1VLBA 4OVZA 1Z2MA 1A70A 3GOEA 1F77A 4ICVA 1C4AA 1VDVA 3Q2AC 1L6UA 3B0AA 1V97A 4TQ1A 1V5TA 1HQRD 4DK5A 1I4XA 1TBEA 4AUQC 1RFAA 1I42A 3NUHB 5J18A 4A8XC 1G6JA 5J17A 1T0YA 4WJPA 1EO6A 3MHSD 1PGXA 2KWDA 3B2GA 4I6PA 3ZDMC 2KC1A 3LB8C 2BTEA 3R66C 4RF1A 4HLEA 2AQ1B 4I6NB 2K25A 1PGBA 2J0MA 2A5UA 3IT4B 5BMGA 3I5JC 2CHZA 2VH2A 4M0WA 4TQ0A 3DOWA 3HHMA 3L0WB 5C1ZA 3AE5B 2MJEA 2NBWB 4L2YA 1UBQA 4AJYB 2XN9C 4QAYA 4DWFA 3AE7B 3ML9A 2OJWA 2WP9B 1MHHE 4YTNB 1WRDB 3PPAA 2CKHB 1L0YB 1HZ5A 3IAS1 4LJOB 3QX1A 2KFKA 2GRIA 2BYEA 2GBNA 2M56B 3A4SC 1L0VB 1ZE3D 2Z0EB 2BF8B 1WGGA 3DCGA 4B0EA 4MACA 4JIOU 3ZVVA 2TSSA 5BMHA 4PS3A 2KVRA 4TV3A 3PLUA 2E3TA 2K8HA 3M3JA 4W9CA 4JPSA 3DVNV 4B9KA 3AI5A 2FNJB 2LXCA 4RF0A 1Z5SB 3SDLC 3ZIMA 2ZPYA 1XT9B 3Q14C 2M17A 4HK2A 4WWNA 3KYCD 2DLBA 4HDOA 5JH5C 1ENFA 4IWOA 3Q3NC 3QCAA 1SJED 1C79A 2DYMA 3A9JB 2WDVB 1FIQA 1WJ6A 2YVCA 5H8YE 3RT3B 3N3KB 2ZZPB 3VTWA 1RFKA 3CF6E 4BBNF 1OGWA 3DHIC 3AE1B 4W9DA 4E71A 3U30A 2M0XA 1UGJA 5JZEB 3NS1A 2LRWA 2QILA 3VXWA 4B0MA 3AXCA 1T0RC 1P9DU 1ZUD2 2HTME 3MC0B 1OQQA 4W9KA 2NBUA 2KLGA 4P16A 1YN5A 1KF6B 2W55A 2LGYA 4A6QA 4W9IA 2NTSA 3GZNB 1R4MB 3U4EG 3SFDB 2PTLA 1D5XC 3R7QA 3WALA 2MH7A 4PS8A 1JWAD 1K52A 4RM8A 4LLGM 2LVOA 2G3QB 2JX5A 3ZTCA 4GN1A 2BWFA 4X57B 3V3XA 2MQJA 1HXYD 2SEBD 2PE6B 1TZOA 5G5HA 3TEYA 1PGAA 3LXFA 2KNBA 2XBBC 1JWUD 3ZNID 2JY6A 4D2KA 3B1LX 2ZNVC 3ZLZA 2WXHA 3AN1A 2IGDA 3RNAC 3HM6X 3EHVA 2ZNVB 4MGZE 3AE8B 5E6OA 1V1OA 3B08A 2WU5B 4EUTA 2MP2A 2KTRA 1F0ZA 4ASWC 4W9JA 2BYFA 1QILA 2KYWA 1GNUA 2PIAA 1N61A 1WGYA 2A4ZA 1N5XA 1HTQA 4IW0A 4JL9A 3L10B 1BXTA 4GDLA 4EKUA 1TJEA 4HXDA 5GMVA 3DDCB 1WXQA 3Q8AA 4II3B 1YQ3B 4LNIA 1FMAD 1MG4A 2DZIA 2V4LA 3SU8X 4AJWA 2KMMA 3NZ3A 3W5UB 1ZOYB 2RR9A 4AWJA 4EE2A 2FE8A 4IKGA
chains in the Genus database with same CATH topology
2J52A 2W3SA 4ZHOA 1SJHD 3AE3B 1KFYB 4O1NA 4DQOC 1E9MA 1WYGA 1KRHA 2RMMA 3AE9B 2QEJC 4JX1C 5C2TB 2IPKD 2VZKD 1OQRA 1ACCA 1D6EC 1ET6A 2QIEB 3Q8FA 1Y56A 4KX6B 4OHJA 1T6BX 3VR9B 1E10A 2L32A 4C56C 4AQ7A 5HG2A 3TEZA 2VZKB 3CIRB 3AMZA 4KKIA 4ZYSA 1UNSA 1JCKB 2BS4B 2J53A 2DBYA 2K0PA 4A90A 2N9KA 2JWUA 2L1AA 1TS2A 3DWMA 2WDRB 3MJ5A 2ICIA 2JYTA 2SAKA 1UWMA 1M4VA 4HJGE 3FAHA 1I4RA 3HVDA 4IOIE 1XEEA 1C76A 2R61A 1V8CA 2QJLA 3EA6A 4OW0A 1K53A 1WSPA 4NJCA 1N63A 4XDDA 2IJ0A 1OFFA 2BS3B 4OZBA 3HUIA 1T3QA 1YMHE 3T3OA 1QOGA 1PFDA 2AX5A 3P1MA 1WGKA 1ROEA 1FM0D 1AYFA 4RGTA 4RNAA 1E6EB 1ZXHA 2KAJA 4MM3B 3FILB 4GDKB 3B2FA 1SB3C 3AE6B 4KGSA 2AQ3B 3BVMA 1VRAB 1E0ZA 2KACA 4RGNA 3W5VB 1J7CA 3BVGA 1AN8A 1K51A 3FILA 3O13A 3BVZA 3B9JA 2JU6X 4C80A 5D7GA 2JQRB 5BYRA 4US8A 1UWXA 2ON8A 1VZ7A 2Z8LA 2IGGA 3PO0A 4JE3B 4N6EB 3VR8B 1FCCC 2WXOA 2WXFA 4KGRA 3ZJVA 4YWGG 1KLGD 4Q2JA 1VZ6A 1FCLA 3AV8A 3ZYYX 2W82A 2FBWB 2G9HD 3U7ZA 2GB1A 1FNUA 1BUIC 5H92C 4N59A 1L4ZB 3AEDB 2K3UA 4J3OD 3TEXA 2WQYB 1TY0A 3AEAB 5BYQA 2QSDA 1PUTA 1QKZA 3KLSX 3MP9A 2WS3B 4GLSC 2I2YA 2D5GA 2OHFA 5EE3A 2M0AA 1SE3A 4P6VF 1EWYC 4XE0A 3WCQA 1SIJA 3VRAB 3BYYB 1RM6C 1ESFA 1FO4A 3KWVA 1EU3A 2E6XA 1FXIA 5AUKA 1XLQA 4CQNA 2G1EA 1SE4A 2N7JA 3FC4A 1XLNA 4FXCA 1J7AA 1J7BA 2JSVX 2WLBA 4ZRQA 5EE1A 5BMIA 1YQ4B 1YN3A 1C4CA 3P4QB 1SEBD 2ACZB 2Y5CA 2RDGA 1L6VA 5MPOA 4R3DA 1KTKA 2RPVA 4YXDB 1ZDXA 1PYWD 1ZPSA 2CJNA 2NTTA 3PZ7A 1RWSA 4REZA 5HHDG 1IBXB 3NVZA 2L52A 1HA5A 4RFBA 3IXSA 4RH6A 3PZ8A 1JWMD 1TKGA 4YTMB 1FRRA 3BK1A 3GS2A 4DXGA 2KDMA 1P7FA 2WXQA 1L0XB 1DOIA 5D3DA 4KKJA 1IBXA 1YJJA 1XLPA 4RGMA 3TEWA 1ET9A 4A9AA 1EWCA 4HROA 1B9RA 2WXLA 4HKZE 1HZ6A 2WU2B 2WXGA 3E56A 1VLBA 4OVZA 3AEBB 1AW7A 3L4PA 3TSSA 1BMLC 1A70A 3NRZA 2HDEA 1F77A 2LHEA 1C9FA 1FXAA 3TUOA 5FKAC 3RPFC 2MEKA 1C4AA 5EE9A 3I57A 1VDVA 2LUMA 4LK0M 2WXIA 1L6UA 1V97A 4TQ1A 4ZHPA 1HQRD 3BYTB 1I4XA 1STEA 3H8HA 3SR6A 1GAQB 1C77A 2XNAC 3ZJTA 1IGCA 3ABVB 3NUHB 4A8XC 1PGXA 2KWDA 1ZXIA 1YJIA 3B2GA 2PKOA 5FK9C 3LB8C 4HRSA 2PVGC 1I4GA 2DYOA 2KN4A 2BTEA 3HVZA 4RF1A 1CK1A 1GOZA 2AQ2B 1SE2A 2J4XA 1DYQA 2BBCA 3E9SA 1TKYA 2AQ1B 4HEA1 3P4SB 4YSXB 1PGBA 1XCTL 5T8IA 2L83A 3IT4B 5BMGA 1RYJA 1TYGB 3CWIA 4M0WA 2DWQA 4TQ0A 2KQ4X 2IGHA 1IGDA 1FNWA 1NVID 1DOXA 1FD6A 2NMQA 1E7PB 1GB4A 2Q5WD 3AE5B 1I4QA 2BB6A 2MJ3A 2MJEA 4ARIA 4L2YA 1TKEA 2XN9C 5AUIA 1TY2A 3DWGC 3AE7B 4AS1A 1T5XD 2WP9B 4N58A 1MHHE 4YTNB 3V05A 3P42A 1L0YB 1HZ5A 4YSZB 1F2RI 3IAS1 4WIPA 3URYA 3IAM1 2ZW1A 4H2AA 2B76B 1JRPA 1QOAA 2WDQB 1FEHA 1C78A 5BYSA 3P4PB 2GRIA 3BK2A 4WWMA 2M56B 4ZOHC 1FFVA 1L0VB 1ZE3D 1DGJA 2BB5A 1I4HA 2BS2B 4B0EA 3C8YA 1Q10A 3NVYA 4MACA 1NYRA 4UDUC 2Y5PA 1JALA 2WXNA 1B1ZA 4YSYB 2N0SB 1CZPA 4OZAA 2TSSA 2WXPA 4XDCA 5BMHA 4US9A 1JWBD 4WURA 3UI3A 5G5GA 1ZDVA 1QQRA 2E3TA 2ZW0A 3BIID 4JPSA 1N5WA 1NENB 4NAWB 4RF0A 3T3NA 5E6JA 1FRDA 2K5PA 2INPE 4HKQA 1LO5D 1TS4A 1VJKA 2LGIA 3EUB2 2DLBA 4RGOS 1V1PB 3AE2B 3R2IA 1MVKA 4NAMA 1ENFA 2V3PA 1DOYA 1SJED 1XXGA 1C79A 1K50A 2DYMA 1R7SA 4PT5A 2WDVB 4L23A 1FIQA 5GXGB 1VR9A 1I7HA 5H8YE 2W3RA 1D5ZC 2PVOD 3MFGA 3AH7A 3VQIA 2RDHA 1JWSD 1RFKA 1GPXA 1NEKB 1CQVA 1QT9A 4LTUA 3AE1B 2WNMA 1TS5A 1L5PA 3OWEB 4WAFA 5HI1A 2V4IB 4ZRPA 3R2TA 1UGJA 4MT5A 3NVWA 1F2RC 1YNTE 1IUEA 3NS1A 2ONQA 2H89B 2N9LA 3AM9A 2V3NA 4RCOA 1N62A 2QILA 3AE4B 1SBBB 1CJEA 4IDIA 4B0MA 5I4DA 2LHDA 1ZUD2 1QLBB 2CU3A 2HTME 3MC0B 4WQMA 3P4RB 1OQQA 4KGTA 2QMTA 4P16A 1YN5A 2K22A 3AEFB 1KF6B 3Q8EA 2W55A 5HFYA 3W9CB 1GB1A 1MHXA 1XO3A 1SSNA 2EKIA 4JWSC 4A6QA 2NTSA 3AEEB 1FNVA 2BYTA 4A55A 3U4EG 1D4BA 1HEZE 1XCQL 3SFDB 3Q69A 2PTLA 1QF6A 1D5XC 1XLOA 2CJOA 2MH7A 1JWAD 1K52A 4LLGM 1YN4A 3J9CA 4ARCA 3NVVA 2JZPA 2J42A 3IT6B 2INNE 2IDYA 2JX5A 1JMLA 3Q8CA 3V3XA 3AEGB 1HXYD 2SEBD 1SF0A 1P7EA 1WRIA 2MJDA 3W1SA 1FFUA 4TSSA 1TZOA 2LJIA 4MH8A 1MPEA 5G5HA 5FR3A 3TEYA 1D5MC 3SEBA 3ETRA 1PGAA 3U2SC 1KH0A 4JWUC 3LXFA 1ZP0B 2YEPB 1JWUD 4C7ZA 2LEKA 3BWUD 4D2KA 2JXTA 2OEDA 2WXHA 3AN1A 1TS3A 3GP7A 4OZCA 2IGDA 1PDXA 2FUG1 2LFIA 3AE8B 1V1OA 3RFZB 1UUPA 2WU5B 2PW9A 4TMAB 3R8BA 4DXFA 2BW2A 3I9V1 3ZGZA 2W54A 1JQ4A 1F0ZA 3MHZA 1QOFA 2WXMA 2M19A 2WXJA 4USAA 3U52E 4ITKA 3AB5A 2EELA 2WXKA 4YTPB 1AWDA 3P63A 4GDLB 1QILA 2LMCA 2V0GA 1XF5L 2PIAA 1NI3A 3EGRA 1N61A 1MI0A 1N5XA 3AECB 3SFEB 1JROA 5EE0A 5TSSA 3KQ4A 1C4PA 4NZLB 5D3IB 4L1BA 4YT0B 3LYYA 1EM7A 1BXTA 1TJEA 1WWTA 3GB1A 1QOBA 2K9XA 3N9YC 1WXQA 2I38A 3Q8AA 5LNK1 1YQ3B 2GI9A 2H88B 5C3JB 1NYQA 2Y3AA 1FMAD 1JW9D 3ZQ4A 4C7YA 1V1PA 1VZ8A 1SXTA 1L4DB 2JYEA 1N60A 3VRBB 2X38A 2WXRA 3W2DA 2KMMA 2YEPF 3KWLA 4XWTA 3Q8BA 3NZ3A 3W5UB 1ZOYB 5JXVA 4XWWA 2PLPA 1KLUD 3ZJUA 2PMVA 3HRDD 2BT6A 4EE2A 1EU4A 1I4PA 3BZDB 4WH4A 2FE8A 4IKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZDV A;  1ZE3 D;  1ZDX A;  3RFZ B;  4B0M A;  3BWU D;  4B0E A;  4J3O D; 
#chains in the Genus database with same CATH topology
 3RI7 C;  2IO3 B;  1E9M A;  3QK0 A;  3AE9 B;  3R7R A;  2QEJ C;  4JX1 C;  1OQR A;  1ACC A;  4FAD A;  2QIE B;  1Y56 A;  4C56 C;  2Y5B B;  3AMZ A;  1LM8 B;  4ZYS A;  2EKE C;  4K7U A;  2DHZ A;  2KHW B;  1P0R A;  1V49 A;  1WZ3 A;  2AL3 A;  3DPD A;  2UU7 A;  3MJ5 A;  1UWM A;  3VUY A;  2G45 B;  3FAH A;  5DPT A;  3HVD A;  4EZL A;  2R61 A;  2QJL A;  4XDD A;  1WSP A;  3ZRC A;  4A3P A;  2BS3 B;  3HUI A;  1T3Q A;  3OG5 A;  3T3O A;  2N9P C;  3M95 A;  1E6E B;  1T0Q C;  1ZXH A;  3WA0 A;  3FIL B;  4NJ7 A;  2I1K A;  3B2F A;  1PQS A;  2AQ3 B;  1VRA B;  1E0Z A;  1WXM A;  4WJQ A;  4MM3 A;  3O13 A;  3B9J A;  3ZXR A;  3VTU A;  4C80 A;  2JQR B;  1WXA A;  2Z8L A;  4LJP B;  1FCC C;  2WXF A;  4KGR A;  4YWG G;  1KLG D;  4HPL B;  1VZ6 A;  1OQY A;  1WR1 A;  3AV8 A;  3ZYY X;  1FNU A;  1E5W A;  3PHW B;  2R2O A;  2KWC A;  2N7D A;  3DVG Y;  4XYC A;  1L4Z B;  3AED B;  4J3O D;  3A1Q B;  3TEX A;  4K81 A;  2WQY B;  3AEA B;  3C19 A;  3ZKJ C;  5G55 A;  2D5G A;  4W9E A;  3CSF A;  3DVN U;  4GSW A;  1ESF A;  3RUL A;  5E6N A;  5AUK A;  3WIM A;  4BKS A;  4EEW A;  1LGR A;  2KWU B;  4FXC A;  2FIF A;  1EUV B;  2JSV X;  4ZRQ A;  3ZRF A;  1SEB D;  2YLM A;  2RDG A;  2NS5 A;  1RAX A;  2JF5 A;  4R3D A;  1KTK A;  5G2N A;  3H7S A;  1ZDX A;  3OAW A;  4FJZ A;  2L52 A;  1N6Z A;  3LJ3 A;  3PLV A;  2GBR A;  1ISN A;  5J2R A;  3GS2 A;  3PSE B;  2DEN B;  4KKJ A;  1IBX A;  3TEW A;  1KM7 A;  1ET9 A;  4A9A A;  2OOB B;  1NI2 A;  2WDT B;  4IWQ A;  3RNC C;  4IG7 B;  3TCA A;  1U4A A;  1FXA A;  3TUO A;  4HCP B;  5IP4 D;  3ML8 A;  3H1U A;  2WXI A;  2W9N A;  1V5O A;  5L95 C;  3H8H A;  2RPQ A;  4BVU C;  3VDZ A;  3ZJT A;  1IGC A;  4M02 A;  4ANU A;  4EZJ A;  2LAS A;  1UBI A;  1YJI A;  2PKO A;  1E90 A;  1WM3 A;  1CK1 A;  1SE2 A;  2ZJD A;  1ZW7 A;  2C5L C;  2HD5 B;  4YSX B;  4E3C A;  5IKC M;  2FCM A;  3EFC A;  2X8X X;  4A20 A;  2KQ4 X;  1IGD A;  1FNW A;  1DOX A;  1E7P B;  1UD7 A;  2K6D B;  2MJ3 A;  1UZX B;  2EMS A;  3HIZ A;  3L08 A;  1V2Y A;  3V05 A;  4HJK A;  2FCQ A;  4M00 A;  3UQA A;  1WJU A;  4WIP A;  1F52 A;  3T9L A;  2ZW1 A;  5CHW A;  2B76 B;  2WDQ B;  1C78 A;  3C0R B;  4MGK E;  4WWM A;  2MCN B;  2VRR B;  4BOS C;  2BB5 A;  3GZN I;  3IFW B;  2BS2 B;  3C8Y A;  3NVY A;  2BYV E;  4GXB A;  1JAL A;  4CYE A;  1B1Z A;  1WZ0 A;  3WAP A;  3UI3 A;  3AU4 A;  4P1B C;  4MGI E;  4NAW B;  4DHZ B;  4HKQ A;  3NZU A;  1TS4 A;  1VJK A;  2KJR A;  2GOW A;  3ZNH B;  1V1P B;  1E8Y A;  4NAM A;  2MBO A;  2QHO A;  1K50 A;  4PT5 A;  2N1V A;  1P98 A;  1VR9 A;  3RNG C;  1D5Z C;  3Q3F A;  1GPX A;  1EF5 A;  3A9J A;  1CQV A;  1QT9 A;  2NPT B;  2CHW A;  2V9H A;  1WYW B;  2J0K A;  3OWE B;  4LDT B;  1WGR A;  2KDB A;  1RLF A;  3NVW A;  4KDI C;  1YNT E;  1IUE A;  2BWE S;  2ONQ A;  2JPH A;  2K39 A;  2V3N A;  2GMI C;  5I4D A;  4WWO A;  3UGB B;  3PHX B;  2LHD A;  3KW5 B;  4XGA B;  3P4R B;  4KGT A;  3A9K B;  2K22 A;  3Q8E A;  5HFY A;  1GB1 A;  4JWS C;  2D3C A;  2BGF A;  2QDF A;  3AEE B;  4A55 A;  4C4V B;  1XCQ L;  1QF6 A;  3DBS A;  2IY0 B;  1YN4 A;  4ARC A;  3MTN B;  3IT6 B;  3DHG C;  2DZM A;  3QAR A;  4HDQ A;  5IA7 A;  3AEG B;  1SIF A;  4XC2 A;  2LGX A;  3W1S A;  4TSS A;  4MH8 A;  1D5M C;  2N9X A;  1KH0 A;  4JWU C;  2JUO A;  2FCN A;  2LEK A;  2LVP A;  2JXT A;  4PS7 A;  4IC7 B;  2N9E B;  1TS3 A;  4OZC A;  3O65 B;  1PDX A;  2FUG 1;  2QC8 A;  2L3Z A;  2KQS A;  1A5R A;  3RFZ B;  1UUP A;  2PW9 A;  3X0W A;  4TMA B;  3R8B A;  4DXF A;  3I9V 1;  2KDI A;  1QOF A;  2M19 A;  4USA A;  3U52 E;  2EEL A;  4DDG D;  2O2V B;  2WXK A;  3DBH I;  4YTP B;  2KN5 A;  2D3G A;  2CU1 A;  3JSV B;  2AEH A;  1NI3 A;  5CHV C;  3AEC B;  1WXS A;  4CHK A;  3PTF C;  5EE0 A;  5TSS A;  4NZL B;  4YT0 B;  2LD9 A;  2LUE A;  3VUW A;  1QOB A;  2K9X A;  1LFD A;  1V9J A;  3TBL D;  3DBL B;  2H88 B;  5C3J B;  4RMA A;  1JW9 D;  1OEY J;  3BY4 B;  2HJ1 A;  2L05 A;  5C23 A;  1VZ8 A;  1L2N A;  3T8M A;  2KZR A;  3VRB B;  2X38 A;  2WXR A;  3Q6B A;  2RGF A;  3Q8B A;  4HWI B;  2KK8 A;  4KZC A;  2PLP A;  4TKN A;  3VUX A;  1EU4 A;  2ZEQ A;  4ZRJ A;  3VHT C;  4ICU A;  3PV1 A;  3N20 C;  3CST A;  4ZHO A;  1K8R B;  1QZE A;  2RMM A;  4BFR A;  3KUD B;  5C2T B;  2IPK D;  3V60 A;  4OVU A;  3Q8F A;  4KX6 B;  4OHJ A;  5JHA A;  3VR9 B;  2L32 A;  2I1J A;  3CIR B;  2J7Q B;  3ECI A;  3V6E B;  1UNS A;  1JCK B;  2J53 A;  2BKF A;  4K3B A;  2K0P A;  2N9K A;  2L1A A;  2ZPN A;  4KSK C;  1TS2 A;  1WGD A;  1WI0 A;  3DWM A;  1H4R A;  2ICI A;  5AEK B;  4W9F A;  4PK1 A;  2KTF A;  2PEA A;  4NJC A;  1F1H A;  3RYT A;  1VCB A;  4OZB A;  1F9J A;  1YMH E;  2DX5 B;  3P1M A;  1ROE A;  3TIX A;  1YX5 B;  1AYF A;  4N9F 4;  2LRU A;  2ZVN A;  2KDF B;  2INC C;  2HE7 A;  1UH6 A;  1WGH A;  2R2Q A;  2KAC A;  2RDB C;  4EOY A;  1J7C A;  3OJ3 A;  3EFU A;  3H7P B;  3FIL A;  3DBR I;  3NJT A;  1T0S C;  3QWZ B;  5BYR A;  4US8 A;  2ON8 A;  4MJS B;  4BKT A;  4K7S A;  1EF1 A;  3PO0 A;  4JE3 B;  1V81 A;  4N6E B;  3FKY A;  5L83 A;  2G9H D;  2K1F A;  2B3A A;  1BUI C;  5H92 C;  4N59 A;  2D3A A;  1PUT A;  3MP9 A;  2OHF A;  1SE3 A;  4KIK A;  3DHH C;  4XE0 A;  1SIJ A;  3VRA B;  1YD8 U;  1EU3 A;  2N1W A;  2GLS A;  3A1Q A;  3MC9 A;  1MJD A;  3V6C B;  3AU5 A;  1SE4 A;  2N7J A;  4GB9 A;  2MX2 A;  2WLB A;  1SGH A;  1C4C A;  2ACZ B;  4LNK A;  1PYW D;  1ZPS A;  1RWS A;  4NY0 A;  1GC7 A;  1YOV B;  4GMV A;  4RFB A;  2D2Q A;  3PZ8 A;  3BK1 A;  3JYU A;  4DXG A;  2LI5 A;  1DOI A;  2MA9 B;  1E7U A;  1XLP A;  1EWC A;  1B9R A;  4MDK E;  4WWP A;  4HKZ E;  1HZ6 A;  4YL8 A;  4DHZ E;  4MGY E;  3AEB B;  3TSS A;  3L4P A;  2C7H A;  4NJ6 A;  5FKA C;  4C00 A;  5EE9 A;  2LUM A;  3ZDT A;  2KX0 A;  3QJZ A;  4URK A;  5EDS A;  4ZHP A;  2K8C A;  1S3S G;  3SR6 A;  2XNA C;  3UIP B;  3L16 A;  3ABV B;  2O6V D;  1TGZ B;  2MHJ A;  1ZXI A;  5CX3 A;  4W9L A;  2PVG C;  2O6V B;  1I4G A;  3HK0 A;  2KN4 A;  2N7E A;  4JQW C;  3HVZ A;  3VVW B;  1GUA B;  2AQ2 B;  4P7I A;  2BBC A;  3WAM A;  2C7M B;  3P4S B;  1GG3 A;  1XCT L;  5T8I A;  2L83 A;  1RYJ A;  3K9O B;  3TL5 A;  1TYG B;  4ZDV A;  4FN2 A;  2D3B A;  2FAZ A;  1NVI D;  2NMQ A;  2Q5W D;  1Q0W B;  3K9P B;  2BB6 A;  5DCN A;  4AP4 C;  4ARI A;  2NCN A;  1TKE A;  3DWG C;  2KMC A;  3Q3M C;  4AS1 A;  5D6J B;  1OEY A;  1WXV A;  2LWP A;  3SHQ A;  4YSZ B;  3IAM 1;  4H2A A;  1WFY A;  1JRP A;  1QOA A;  2MP2 B;  2KTR B;  1FEH A;  3DQV A;  1RRB A;  3P4P B;  3BK2 A;  4ZOH C;  5LXH A;  1FFV A;  4IM3 A;  1CMX B;  1DGJ A;  1TIF A;  1I4H A;  2WX1 A;  1Q10 A;  1NYR A;  2Y5P A;  2OJR A;  2WXN A;  1CZP A;  3W1Y A;  2WXP A;  4US9 A;  2MWS B;  3WAO A;  4WUR A;  1WJ4 A;  2IZV B;  1TT5 B;  3BII D;  1C3T A;  1NEN B;  2DAF A;  3T3N A;  3QHT A;  5E6J A;  1E8Z A;  1FRD A;  3P2B A;  2KXJ A;  4GU2 A;  4LCD E;  4NAW A;  3EC8 A;  3EUB 2;  1KLV A;  4RGO S;  3AE2 B;  3R2I A;  1MVK A;  1DOY A;  4IM0 A;  1R7S A;  2NBV B;  2KJ6 A;  2C7N B;  5HKH A;  1WR6 E;  1I7H A;  2KC2 A;  2W3R A;  2GBM A;  2PVO D;  3MFG A;  3X23 A;  1JWS D;  2L7R A;  1NEK B;  4LTU A;  2UWQ A;  2WNM A;  1TS5 A;  4WAF A;  5HI1 A;  2V4I B;  3R2T A;  3KUC B;  1F2R C;  1WE6 A;  2M1M A;  5BO4 B;  2NPT A;  2H89 B;  2N9L A;  5IAA C;  3AE4 B;  2IBI B;  2IO2 B;  3RNF C;  1WF9 A;  2MSE D;  4DXA B;  1UEL A;  3PRZ A;  2DZK A;  3W9C B;  4KV2 A;  1TTN A;  1XO3 A;  3A4R A;  2CR5 A;  1FNV A;  2G4S A;  3N1Y C;  2NVU I;  1D4B A;  1HEZ E;  4MH0 E;  2ZVO A;  3A9K A;  2CJO A;  2JZ3 B;  3J9C A;  3NVV A;  2C60 A;  2INN E;  3M63 B;  4C4V A;  4MSM B;  1JML A;  2LVQ A;  1V86 A;  5DPS A;  1SF0 A;  2KDE B;  1P7E A;  4K3C A;  4ZRI A;  1FFU A;  2LJI A;  5FR3 A;  2NR2 A;  2KOX A;  1YQB A;  1ZP0 B;  2YEP B;  1HE8 A;  4W9G A;  3BWU D;  3TJP A;  4ANW A;  2K6Q A;  1NDD A;  5DPW A;  1R4M I;  1HTO A;  2BW2 A;  2WXM A;  2JXX A;  4ITK A;  2REX A;  1AAR A;  1AWD A;  3PS6 A;  4ZRK A;  3P63 A;  1YIW A;  2BKR B;  2LMC A;  3PGE A;  2V0G A;  3EGR A;  1WE7 A;  1JRO A;  2O2V A;  3KQ4 A;  1C4P A;  1L7Y A;  4L1B A;  3LYY A;  3JSV A;  1WWT A;  3GB1 A;  1LQB A;  2XK5 B;  2MBB B;  3JW0 X;  2N4F A;  3KUZ A;  3NS8 A;  5LNK 1;  1NYQ A;  3I63 C;  3ENE A;  3ZQ4 A;  2PPH A;  3N1Z C;  1L4D B;  1S1Q B;  1N60 A;  4FHK A;  2JRH A;  1WX7 A;  2MBE A;  3W2D A;  1TZ1 A;  4XWT A;  3PZD A;  3U8Z A;  3H6N A;  5JXV A;  4XWW A;  4ANV A;  3ZTD A;  4J6I A;  3RNE C;  4EFO A;  2UYZ B;  3HRD D;  2WGS A;  2BT6 A;  1I4P A;  4WH4 A;  1Q5W B;  2J52 A;  2Z59 B;  2W3S A;  1SJH D;  4DQO C;  2D07 B;  2V1Y A;  2VZK D;  3APC A;  3LDZ E;  1D6E C;  1ET6 A;  4KZ0 A;  1T6B X;  4AQ7 A;  1WX9 A;  3HM3 A;  2VZK B;  4NNJ B;  2CS4 A;  2L0F A;  1WJN A;  3NOB A;  4HVB A;  1I35 A;  2WDR B;  1SE9 A;  2L76 A;  4HJG E;  1Y8R C;  3PRE A;  1XEE A;  1C76 A;  2IJ0 A;  2KLC A;  4B6W A;  4S0R A;  3GE8 C;  3N1X C;  4LNN A;  1PFD A;  2AX5 A;  3Q3J A;  1FM0 D;  3IG3 A;  4RNA A;  1BT0 A;  4G11 A;  2M4N A;  4GDK B;  1SB3 C;  3AE6 B;  1J8C A;  4KGS A;  4RGN A;  3W5V B;  3BVG A;  2D10 A;  1K51 A;  2KFJ A;  4I6L B;  5D7G A;  3APF A;  2WX0 A;  4DBG A;  3VTV A;  3RZF A;  4OVV A;  4WJO A;  3H7P A;  2K8B A;  2IGG A;  2WXO A;  2DZJ A;  2KKC A;  4MJS A;  2W82 A;  3U7Z A;  2AWT A;  4P1C C;  2AYO B;  1WMH B;  2K3U A;  2XEW A;  1TY0 A;  2QSD A;  3QAQ A;  1QKZ A;  2BPS A;  4GLS C;  5LLI A;  3GE3 C;  4NQL B;  2I2Y A;  5EE3 A;  2M0A A;  4P6V F;  3BIN A;  3WCQ A;  3BYY B;  5D94 A;  1FO4 A;  2CHX A;  1XLQ A;  2VH1 A;  4CQN A;  3FC4 A;  2GBK A;  1WX8 A;  4M01 A;  1XLN A;  1J7A A;  1J7B A;  2GBJ A;  3NY5 A;  5AZH A;  3ZUN A;  5BMI A;  1YN3 A;  3P4Q B;  2Y5C A;  4GGQ A;  3UF8 A;  1MG8 A;  1R4N B;  3PRM B;  4BOZ B;  2JVC A;  5MPO A;  1H8C A;  2RPV A;  5KHQ A;  4F8C B;  2NTT A;  3PZ7 A;  5HHD G;  1D3Z A;  3NVZ A;  3D32 A;  4RH6 A;  5D2M B;  3U7D A;  1FRR A;  3NZS A;  3EEC A;  2KDM A;  1P7F A;  2WXQ A;  1KOT A;  1L0X B;  3V61 A;  5D3D A;  3SD5 A;  3A33 B;  4ANX A;  3NHE B;  4HRO A;  2WXL A;  4ZYN A;  2KJH B;  3MC8 A;  3ALB A;  3OJ4 B;  1AW7 A;  1BML C;  1P1A A;  3NRZ A;  3RN9 C;  2HDE A;  2LXA A;  2LHE A;  3ZO5 B;  1C9F A;  3RPF C;  2MEK A;  3I57 A;  4LK0 M;  2WYQ A;  2MLB A;  3BYT B;  1STE A;  1GAQ B;  1C77 A;  3IVF A;  4HPP A;  4BKG A;  4ACF A;  5FK9 C;  2IO1 B;  1M94 A;  3KYD D;  4HRS A;  4XX5 A;  2DYO A;  5AZG A;  1GOZ A;  2J4X A;  1DYQ A;  3E9S A;  3W1S C;  1TKY A;  4M0W B;  4HEA 1;  4FLH A;  2O6V A;  4F1S A;  4EZK A;  1WH3 A;  3CWI A;  4FJV B;  2DWQ A;  1ZGU B;  2IGH A;  1C1Y B;  2KD0 A;  5DPR A;  1FD6 A;  1GB4 A;  2L00 B;  2JRI B;  2KAN A;  3L13 A;  1I4Q A;  4BBN C;  3RZW C;  4IWP A;  5AUI A;  1TY2 A;  2KT7 A;  1E7V A;  1T5X D;  2DAJ A;  4N58 A;  2KFK B;  2JT4 B;  2JWZ A;  3P42 A;  4MEM A;  1F2R I;  3URY A;  4G0N B;  3N32 A;  5BYS A;  5LXI B;  5E6P A;  3ZXV A;  4JLC A;  2RD0 A;  2IND C;  1J0G A;  4UDU C;  3UQB A;  4YSY B;  2N0S B;  4OZA A;  4XDC A;  1V6E A;  1JWB D;  5G5G A;  1ZDV A;  1QQR A;  2ZW0 A;  3ZNG C;  1N5W A;  3OLM D;  2LGD A;  3UIN B;  2QCZ A;  1KJT A;  2K5P A;  4FHJ A;  2INP E;  1LO5 D;  3PT2 B;  3APD A;  3N30 A;  2LGI A;  2D11 A;  2BQQ A;  4B95 A;  2V3P A;  3RNB C;  1XXG A;  2IY1 B;  4L23 A;  5GXG B;  3RD2 A;  4HPM B;  2DYB A;  3AH7 A;  5IOI A;  3VQI A;  2RDH A;  3L54 A;  1L5P A;  2HTH A;  1IYF A;  4ZRP A;  4MT5 A;  1XQQ A;  3MJW A;  4M8N A;  3AM9 A;  2FID A;  4RCO A;  1N62 A;  1SBB B;  1CJE A;  4IDI A;  3DVG X;  5IN7 A;  1QLB B;  2CU3 A;  3PRP B;  4WQM A;  4HCN B;  2QMT A;  3VAW A;  3CMM B;  3AEF B;  1UGM A;  3AUL A;  4DDI D;  1MHX A;  2V3S A;  1SSN A;  2EKI A;  3IHP C;  2BYT A;  3Q69 A;  2AL6 A;  1XLO A;  3UIO B;  3DBH B;  2JZP A;  2J42 A;  3ONS A;  4FBJ B;  2ASQ A;  3KVF B;  3RUI B;  2IDY A;  3Q8C A;  4PYU A;  1LXD A;  3ZW3 A;  2LJ5 A;  4GIV A;  2JZZ A;  1WRI A;  4MSQ B;  2KQ7 A;  2MJD A;  3ZNZ B;  1MPE A;  4E74 A;  3SEB A;  3ETR A;  3U2S C;  2HJ8 A;  2FUH B;  3VFK A;  4C7Z A;  4KVG B;  2OED A;  5FR6 A;  3GP7 A;  5KHO A;  3QIJ A;  2BVC A;  3QQ8 B;  4FJY A;  2LFI A;  4K1R B;  3I3T B;  3ZGZ A;  2W54 A;  1FXT B;  4IM2 A;  1JQ4 A;  1VD2 A;  3MHZ A;  2PJH A;  2WXJ A;  3AB5 A;  3QC8 B;  2KX3 A;  2MBH A;  5JHB A;  4GDL B;  4KIK B;  1XF5 L;  4TUU A;  1FPY A;  1MI0 A;  2WHI A;  3SFE B;  4DHJ D;  2G4D B;  4WQO B;  1Q1O A;  5D3I B;  1V80 A;  2MW5 A;  1EM7 A;  2LZ6 A;  2KO3 A;  4DHJ B;  4G50 A;  2RSU A;  3N9Y C;  4NPN A;  4F7Z A;  2I38 A;  2GI9 A;  4PYZ A;  2PE9 A;  2Y3A A;  3TMP B;  4C7Y A;  2XK5 A;  1V1P A;  3VH4 B;  2EMT A;  1SXT A;  1IPG A;  2DNF A;  5IO9 A;  2JYE A;  1YX6 B;  1E8W A;  1E8X A;  4A3O A;  2YEP F;  3KWL A;  3RMK C;  1J19 A;  1KLU D;  4BAX A;  4KDL B;  3ZJU A;  2PMV A;  1GJZ A;  3BZD B;  2WWZ A;  3AE3 B;  1KFY B;  1UF0 A;  4MEL A;  4O1N A;  1WYG A;  1KRH A;  2FCS A;  4M8M A;  3RCZ A;  3V62 A;  1OTR B;  1E10 A;  3DBR B;  5HG2 A;  3TEZ A;  2IYD B;  4KKI A;  2KMA A;  3WAN A;  5CHF A;  5TR5 A;  3DBL I;  2BS4 B;  4RM9 A;  2KVZ A;  1WY8 A;  2DBY A;  3H9D A;  3KH0 A;  4A90 A;  4FA6 A;  1JRU A;  1GC6 A;  2JWU A;  2SAK A;  2JYT A;  1M4V A;  1I4R A;  4IOI E;  1R4N I;  3EA6 A;  1V8C A;  4OW0 A;  1K53 A;  1N63 A;  1NBF C;  2KWV B;  1OFF A;  3Q3O C;  4K7W A;  1QOG A;  2M8S A;  1WGK A;  4RGT A;  2J0J A;  1WIA A;  2KAJ A;  3M62 B;  4MM3 B;  2Z0D B;  3BVM A;  4KSL C;  4W9H A;  1AN8 A;  3JVZ X;  4GDK A;  4JGH B;  3BVZ A;  1XD3 B;  2JU6 X;  2LGS A;  1UWX A;  4FUL A;  1VZ7 A;  4S17 A;  2MRP A;  1IP9 A;  3VR8 B;  3ZJV A;  3NG0 A;  4Q2J A;  1FCL A;  4BZA A;  4CO7 A;  2ZCB A;  3S2A A;  2FBW B;  4II2 B;  1X1M A;  2GB1 A;  4BKS D;  2MBQ A;  4LNF A;  2L8J A;  5BYQ A;  4G3X B;  3KLS X;  2WS3 B;  1EWY C;  3QA8 A;  1RM6 C;  1WMH A;  1YJ1 A;  3KWV A;  2E6X A;  1FXI A;  2G1E A;  4WAA A;  3PVL A;  2C9W B;  4NQK E;  5EE1 A;  1YQ4 B;  3R3M A;  3L17 A;  2L0T A;  5AZF A;  1L6V A;  3IBE A;  4YXD B;  4AOF A;  2CJN A;  4REZ A;  1WM2 A;  1IBX B;  4GOC A;  1HA5 A;  3IXS A;  1ZKH A;  1JWM D;  1TKG A;  4YTM B;  4XZ4 A;  4IUM B;  5CTR C;  2ZCC A;  3VH3 B;  4LNO A;  1YJJ A;  4RGM A;  2IO0 B;  1P3Q U;  4LDT D;  1MFW A;  4WJN A;  2WU2 B;  2WXG A;  3E56 A;  1VLB A;  4OVZ A;  1Z2M A;  1A70 A;  3GOE A;  1F77 A;  4ICV A;  1C4A A;  1VDV A;  3Q2A C;  1L6U A;  3B0A A;  1V97 A;  4TQ1 A;  1V5T A;  1HQR D;  4DK5 A;  1I4X A;  1TBE A;  4AUQ C;  1RFA A;  1I42 A;  3NUH B;  5J18 A;  4A8X C;  1G6J A;  5J17 A;  1T0Y A;  4WJP A;  1EO6 A;  3MHS D;  1PGX A;  2KWD A;  3B2G A;  4I6P A;  3ZDM C;  2KC1 A;  3LB8 C;  2BTE A;  3R66 C;  4RF1 A;  4HLE A;  2AQ1 B;  4I6N B;  2K25 A;  1PGB A;  2J0M A;  2A5U A;  3IT4 B;  5BMG A;  3I5J C;  2CHZ A;  2VH2 A;  4M0W A;  4TQ0 A;  3DOW A;  3HHM A;  3L0W B;  5C1Z A;  3AE5 B;  2MJE A;  2NBW B;  4L2Y A;  1UBQ A;  4AJY B;  2XN9 C;  4QAY A;  4DWF A;  3AE7 B;  3ML9 A;  2OJW A;  2WP9 B;  1MHH E;  4YTN B;  1WRD B;  3PPA A;  2CKH B;  1L0Y B;  1HZ5 A;  3IAS 1;  4LJO B;  3QX1 A;  2KFK A;  2GRI A;  2BYE A;  2GBN A;  2M56 B;  3A4S C;  1L0V B;  1ZE3 D;  2Z0E B;  2BF8 B;  1WGG A;  3DCG A;  4B0E A;  4MAC A;  4JIO U;  3ZVV A;  2TSS A;  5BMH A;  4PS3 A;  2KVR A;  4TV3 A;  3PLU A;  2E3T A;  2K8H A;  3M3J A;  4W9C A;  4JPS A;  3DVN V;  4B9K A;  3AI5 A;  2FNJ B;  2LXC A;  4RF0 A;  1Z5S B;  3SDL C;  3ZIM A;  2ZPY A;  1XT9 B;  3Q14 C;  2M17 A;  4HK2 A;  4WWN A;  3KYC D;  2DLB A;  4HDO A;  5JH5 C;  1ENF A;  4IWO A;  3Q3N C;  3QCA A;  1SJE D;  1C79 A;  2DYM A;  3A9J B;  2WDV B;  1FIQ A;  1WJ6 A;  2YVC A;  5H8Y E;  3RT3 B;  3N3K B;  2ZZP B;  3VTW A;  1RFK A;  3CF6 E;  4BBN F;  1OGW A;  3DHI C;  3AE1 B;  4W9D A;  4E71 A;  3U30 A;  2M0X A;  1UGJ A;  5JZE B;  3NS1 A;  2LRW A;  2QIL A;  3VXW A;  4B0M A;  3AXC A;  1T0R C;  1P9D U;  1ZUD 2;  2HTM E;  3MC0 B;  1OQQ A;  4W9K A;  2NBU A;  2KLG A;  4P16 A;  1YN5 A;  1KF6 B;  2W55 A;  2LGY A;  4A6Q A;  4W9I A;  2NTS A;  3GZN B;  1R4M B;  3U4E G;  3SFD B;  2PTL A;  1D5X C;  3R7Q A;  3WAL A;  2MH7 A;  4PS8 A;  1JWA D;  1K52 A;  4RM8 A;  4LLG M;  2LVO A;  2G3Q B;  2JX5 A;  3ZTC A;  4GN1 A;  2BWF A;  4X57 B;  3V3X A;  2MQJ A;  1HXY D;  2SEB D;  2PE6 B;  1TZO A;  5G5H A;  3TEY A;  1PGA A;  3LXF A;  2KNB A;  2XBB C;  1JWU D;  3ZNI D;  2JY6 A;  4D2K A;  3B1L X;  2ZNV C;  3ZLZ A;  2WXH A;  3AN1 A;  2IGD A;  3RNA C;  3HM6 X;  3EHV A;  2ZNV B;  4MGZ E;  3AE8 B;  5E6O A;  1V1O A;  3B08 A;  2WU5 B;  4EUT A;  2MP2 A;  2KTR A;  1F0Z A;  4ASW C;  4W9J A;  2BYF A;  1QIL A;  2KYW A;  1GNU A;  2PIA A;  1N61 A;  1WGY A;  2A4Z A;  1N5X A;  1HTQ A;  4IW0 A;  4JL9 A;  3L10 B;  1BXT A;  4GDL A;  4EKU A;  1TJE A;  4HXD A;  5GMV A;  3DDC B;  1WXQ A;  3Q8A A;  4II3 B;  1YQ3 B;  4LNI A;  1FMA D;  1MG4 A;  2DZI A;  2V4L A;  3SU8 X;  4AJW A;  2KMM A;  3NZ3 A;  3W5U B;  1ZOY B;  2RR9 A;  4AWJ A;  4EE2 A;  2FE8 A;  4IKG A; 
#chains in the Genus database with same CATH homology
 2J52 A;  2W3S A;  4ZHO A;  1SJH D;  3AE3 B;  1KFY B;  4O1N A;  4DQO C;  1E9M A;  1WYG A;  1KRH A;  2RMM A;  3AE9 B;  2QEJ C;  4JX1 C;  5C2T B;  2IPK D;  2VZK D;  1OQR A;  1ACC A;  1D6E C;  1ET6 A;  2QIE B;  3Q8F A;  1Y56 A;  4KX6 B;  4OHJ A;  1T6B X;  3VR9 B;  1E10 A;  2L32 A;  4C56 C;  4AQ7 A;  5HG2 A;  3TEZ A;  2VZK B;  3CIR B;  3AMZ A;  4KKI A;  4ZYS A;  1UNS A;  1JCK B;  2BS4 B;  2J53 A;  2DBY A;  2K0P A;  4A90 A;  2N9K A;  2JWU A;  2L1A A;  1TS2 A;  3DWM A;  2WDR B;  3MJ5 A;  2ICI A;  2JYT A;  2SAK A;  1UWM A;  1M4V A;  4HJG E;  3FAH A;  1I4R A;  3HVD A;  4IOI E;  1XEE A;  1C76 A;  2R61 A;  1V8C A;  2QJL A;  3EA6 A;  4OW0 A;  1K53 A;  1WSP A;  4NJC A;  1N63 A;  4XDD A;  2IJ0 A;  1OFF A;  2BS3 B;  4OZB A;  3HUI A;  1T3Q A;  1YMH E;  3T3O A;  1QOG A;  1PFD A;  2AX5 A;  3P1M A;  1WGK A;  1ROE A;  1FM0 D;  1AYF A;  4RGT A;  4RNA A;  1E6E B;  1ZXH A;  2KAJ A;  4MM3 B;  3FIL B;  4GDK B;  3B2F A;  1SB3 C;  3AE6 B;  4KGS A;  2AQ3 B;  3BVM A;  1VRA B;  1E0Z A;  2KAC A;  4RGN A;  3W5V B;  1J7C A;  3BVG A;  1AN8 A;  1K51 A;  3FIL A;  3O13 A;  3BVZ A;  3B9J A;  2JU6 X;  4C80 A;  5D7G A;  2JQR B;  5BYR A;  4US8 A;  1UWX A;  2ON8 A;  1VZ7 A;  2Z8L A;  2IGG A;  3PO0 A;  4JE3 B;  4N6E B;  3VR8 B;  1FCC C;  2WXO A;  2WXF A;  4KGR A;  3ZJV A;  4YWG G;  1KLG D;  4Q2J A;  1VZ6 A;  1FCL A;  3AV8 A;  3ZYY X;  2W82 A;  2FBW B;  2G9H D;  3U7Z A;  2GB1 A;  1FNU A;  1BUI C;  5H92 C;  4N59 A;  1L4Z B;  3AED B;  2K3U A;  4J3O D;  3TEX A;  2WQY B;  1TY0 A;  3AEA B;  5BYQ A;  2QSD A;  1PUT A;  1QKZ A;  3KLS X;  3MP9 A;  2WS3 B;  4GLS C;  2I2Y A;  2D5G A;  2OHF A;  5EE3 A;  2M0A A;  1SE3 A;  4P6V F;  1EWY C;  4XE0 A;  3WCQ A;  1SIJ A;  3VRA B;  3BYY B;  1RM6 C;  1ESF A;  1FO4 A;  3KWV A;  1EU3 A;  2E6X A;  1FXI A;  5AUK A;  1XLQ A;  4CQN A;  2G1E A;  1SE4 A;  2N7J A;  3FC4 A;  1XLN A;  4FXC A;  1J7A A;  1J7B A;  2JSV X;  2WLB A;  4ZRQ A;  5EE1 A;  5BMI A;  1YQ4 B;  1YN3 A;  1C4C A;  3P4Q B;  1SEB D;  2ACZ B;  2Y5C A;  2RDG A;  1L6V A;  5MPO A;  4R3D A;  1KTK A;  2RPV A;  4YXD B;  1ZDX A;  1PYW D;  1ZPS A;  2CJN A;  2NTT A;  3PZ7 A;  1RWS A;  4REZ A;  5HHD G;  1IBX B;  3NVZ A;  2L52 A;  1HA5 A;  4RFB A;  3IXS A;  4RH6 A;  3PZ8 A;  1JWM D;  1TKG A;  4YTM B;  1FRR A;  3BK1 A;  3GS2 A;  4DXG A;  2KDM A;  1P7F A;  2WXQ A;  1L0X B;  1DOI A;  5D3D A;  4KKJ A;  1IBX A;  1YJJ A;  1XLP A;  4RGM A;  3TEW A;  1ET9 A;  4A9A A;  1EWC A;  4HRO A;  1B9R A;  2WXL A;  4HKZ E;  1HZ6 A;  2WU2 B;  2WXG A;  3E56 A;  1VLB A;  4OVZ A;  3AEB B;  1AW7 A;  3L4P A;  3TSS A;  1BML C;  1A70 A;  3NRZ A;  2HDE A;  1F77 A;  2LHE A;  1C9F A;  1FXA A;  3TUO A;  5FKA C;  3RPF C;  2MEK A;  1C4A A;  5EE9 A;  3I57 A;  1VDV A;  2LUM A;  4LK0 M;  2WXI A;  1L6U A;  1V97 A;  4TQ1 A;  4ZHP A;  1HQR D;  3BYT B;  1I4X A;  1STE A;  3H8H A;  3SR6 A;  1GAQ B;  1C77 A;  2XNA C;  3ZJT A;  1IGC A;  3ABV B;  3NUH B;  4A8X C;  1PGX A;  2KWD A;  1ZXI A;  1YJI A;  3B2G A;  2PKO A;  5FK9 C;  3LB8 C;  4HRS A;  2PVG C;  1I4G A;  2DYO A;  2KN4 A;  2BTE A;  3HVZ A;  4RF1 A;  1CK1 A;  1GOZ A;  2AQ2 B;  1SE2 A;  2J4X A;  1DYQ A;  2BBC A;  3E9S A;  1TKY A;  2AQ1 B;  4HEA 1;  3P4S B;  4YSX B;  1PGB A;  1XCT L;  5T8I A;  2L83 A;  3IT4 B;  5BMG A;  1RYJ A;  1TYG B;  3CWI A;  4M0W A;  2DWQ A;  4TQ0 A;  2KQ4 X;  2IGH A;  1IGD A;  1FNW A;  1NVI D;  1DOX A;  1FD6 A;  2NMQ A;  1E7P B;  1GB4 A;  2Q5W D;  3AE5 B;  1I4Q A;  2BB6 A;  2MJ3 A;  2MJE A;  4ARI A;  4L2Y A;  1TKE A;  2XN9 C;  5AUI A;  1TY2 A;  3DWG C;  3AE7 B;  4AS1 A;  1T5X D;  2WP9 B;  4N58 A;  1MHH E;  4YTN B;  3V05 A;  3P42 A;  1L0Y B;  1HZ5 A;  4YSZ B;  1F2R I;  3IAS 1;  4WIP A;  3URY A;  3IAM 1;  2ZW1 A;  4H2A A;  2B76 B;  1JRP A;  1QOA A;  2WDQ B;  1FEH A;  1C78 A;  5BYS A;  3P4P B;  2GRI A;  3BK2 A;  4WWM A;  2M56 B;  4ZOH C;  1FFV A;  1L0V B;  1ZE3 D;  1DGJ A;  2BB5 A;  1I4H A;  2BS2 B;  4B0E A;  3C8Y A;  1Q10 A;  3NVY A;  4MAC A;  1NYR A;  4UDU C;  2Y5P A;  1JAL A;  2WXN A;  1B1Z A;  4YSY B;  2N0S B;  1CZP A;  4OZA A;  2TSS A;  2WXP A;  4XDC A;  5BMH A;  4US9 A;  1JWB D;  4WUR A;  3UI3 A;  5G5G A;  1ZDV A;  1QQR A;  2E3T A;  2ZW0 A;  3BII D;  4JPS A;  1N5W A;  1NEN B;  4NAW B;  4RF0 A;  3T3N A;  5E6J A;  1FRD A;  2K5P A;  2INP E;  4HKQ A;  1LO5 D;  1TS4 A;  1VJK A;  2LGI A;  3EUB 2;  2DLB A;  4RGO S;  1V1P B;  3AE2 B;  3R2I A;  1MVK A;  4NAM A;  1ENF A;  2V3P A;  1DOY A;  1SJE D;  1XXG A;  1C79 A;  1K50 A;  2DYM A;  1R7S A;  4PT5 A;  2WDV B;  4L23 A;  1FIQ A;  5GXG B;  1VR9 A;  1I7H A;  5H8Y E;  2W3R A;  1D5Z C;  2PVO D;  3MFG A;  3AH7 A;  3VQI A;  2RDH A;  1JWS D;  1RFK A;  1GPX A;  1NEK B;  1CQV A;  1QT9 A;  4LTU A;  3AE1 B;  2WNM A;  1TS5 A;  1L5P A;  3OWE B;  4WAF A;  5HI1 A;  2V4I B;  4ZRP A;  3R2T A;  1UGJ A;  4MT5 A;  3NVW A;  1F2R C;  1YNT E;  1IUE A;  3NS1 A;  2ONQ A;  2H89 B;  2N9L A;  3AM9 A;  2V3N A;  4RCO A;  1N62 A;  2QIL A;  3AE4 B;  1SBB B;  1CJE A;  4IDI A;  4B0M A;  5I4D A;  2LHD A;  1ZUD 2;  1QLB B;  2CU3 A;  2HTM E;  3MC0 B;  4WQM A;  3P4R B;  1OQQ A;  4KGT A;  2QMT A;  4P16 A;  1YN5 A;  2K22 A;  3AEF B;  1KF6 B;  3Q8E A;  2W55 A;  5HFY A;  3W9C B;  1GB1 A;  1MHX A;  1XO3 A;  1SSN A;  2EKI A;  4JWS C;  4A6Q A;  2NTS A;  3AEE B;  1FNV A;  2BYT A;  4A55 A;  3U4E G;  1D4B A;  1HEZ E;  1XCQ L;  3SFD B;  3Q69 A;  2PTL A;  1QF6 A;  1D5X C;  1XLO A;  2CJO A;  2MH7 A;  1JWA D;  1K52 A;  4LLG M;  1YN4 A;  3J9C A;  4ARC A;  3NVV A;  2JZP A;  2J42 A;  3IT6 B;  2INN E;  2IDY A;  2JX5 A;  1JML A;  3Q8C A;  3V3X A;  3AEG B;  1HXY D;  2SEB D;  1SF0 A;  1P7E A;  1WRI A;  2MJD A;  3W1S A;  1FFU A;  4TSS A;  1TZO A;  2LJI A;  4MH8 A;  1MPE A;  5G5H A;  5FR3 A;  3TEY A;  1D5M C;  3SEB A;  3ETR A;  1PGA A;  3U2S C;  1KH0 A;  4JWU C;  3LXF A;  1ZP0 B;  2YEP B;  1JWU D;  4C7Z A;  2LEK A;  3BWU D;  4D2K A;  2JXT A;  2OED A;  2WXH A;  3AN1 A;  1TS3 A;  3GP7 A;  4OZC A;  2IGD A;  1PDX A;  2FUG 1;  2LFI A;  3AE8 B;  1V1O A;  3RFZ B;  1UUP A;  2WU5 B;  2PW9 A;  4TMA B;  3R8B A;  4DXF A;  2BW2 A;  3I9V 1;  3ZGZ A;  2W54 A;  1JQ4 A;  1F0Z A;  3MHZ A;  1QOF A;  2WXM A;  2M19 A;  2WXJ A;  4USA A;  3U52 E;  4ITK A;  3AB5 A;  2EEL A;  2WXK A;  4YTP B;  1AWD A;  3P63 A;  4GDL B;  1QIL A;  2LMC A;  2V0G A;  1XF5 L;  2PIA A;  1NI3 A;  3EGR A;  1N61 A;  1MI0 A;  1N5X A;  3AEC B;  3SFE B;  1JRO A;  5EE0 A;  5TSS A;  3KQ4 A;  1C4P A;  4NZL B;  5D3I B;  4L1B A;  4YT0 B;  3LYY A;  1EM7 A;  1BXT A;  1TJE A;  1WWT A;  3GB1 A;  1QOB A;  2K9X A;  3N9Y C;  1WXQ A;  2I38 A;  3Q8A A;  5LNK 1;  1YQ3 B;  2GI9 A;  2H88 B;  5C3J B;  1NYQ A;  2Y3A A;  1FMA D;  1JW9 D;  3ZQ4 A;  4C7Y A;  1V1P A;  1VZ8 A;  1SXT A;  1L4D B;  2JYE A;  1N60 A;  3VRB B;  2X38 A;  2WXR A;  3W2D A;  2KMM A;  2YEP F;  3KWL A;  4XWT A;  3Q8B A;  3NZ3 A;  3W5U B;  1ZOY B;  5JXV A;  4XWW A;  2PLP A;  1KLU D;  3ZJU A;  2PMV A;  3HRD D;  2BT6 A;  4EE2 A;  1EU4 A;  1I4P A;  3BZD B;  4WH4 A;  2FE8 A;  4IKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...